3MW3A

Crystal structure of beta-neurexin 2 with the splice insert 4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
189
Chain Sequence
STTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNRQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurexin-2-beta
publication title Splice Form Dependence of beta-Neurexin/Neuroligin Binding Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 38
structure length 189
sequence length 205
ec nomenclature
pdb deposition date 2010-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mw3A00
1AVBA 4ITCA 1S0IA 1G7YA 3AZWA 3AP5A 5T5OA 1V6KA 2JKBA 2VW1A 2EF6A 1MS1A 2D3PA 1GBGA 2GDFA 4FOVA 4LBQD 1YI7A 1GICA 1H9PA 1BJQA 3NV1A 1LGCA 3VKOA 4FPYA 2JE7A 2UWAA 4DRVA 1OQ1A 2DVFA 4JRAA 1N3OA 2DVDA 4FPJA 1QOOA 1QOTA 2AYHA 4FPFA 1APNA 2ENRA 4YZ5A 2SLIA 2DUOA 1CIWA 4YFWA 4DRRA 3AP6A 1SFYA 1YRZA 2AH2A 5IK4A 5DXDA 4Y22B 5T5PA 3OYWA 3WUCA 5BYNA 2NMOA 1TEIA 2WT0A 2A3WA 4Q1RA 3NV4A 2VY0A 2W39A 5DZEA 2ZGRA 4Y24A 1SACA 2WLQA 1JHNA 1W6PA 1FNYA 2DVAA 2ES3A 2ZHNA 1S0DA 4I30A 5CA6A 5JLVA 3OY8B 4AVSA 4FQ4A 1LHOA 3MW3A 1ONAA 1S0JA 2E7QA 2R0HA 2ZGPA 4AWDA 4Y1UA 4XIOA 1DQ1A 2HYKA 4ISRA 1N47A 2PHRA 1S0CA 3ZVXA 2EALA 4YZ2A 4AVVA 2D3RA 1MR5A 1DYPA 3AP4A 3O12A 1S0BA 3AZXA 2DU1A 3HR9A 4DPNA 1QNWA 2NP0A 2GN7A 4Y26A 2NMNA 3MEPA 1I3HA 4LBLA 4K1ZA 1G9FA 4XHXA 1DHKB 1MACA 2R16A 4CZSA 2WSVA 1MVEA 1F5FA 4YM1A 2VXRA 3I4IA 4LBQA 2XB6C 1H9WA 4P14A 1LOBA 3PMEA 2ZGUA 2DURA 2A7AA 1V6JA 2DV9A 2WKKA 4FPGA 4YZ1A 1VALA 3MPPG 1S0EA 2ARBA 4LBJA 4Y1XA 3IM0A 1WD4A 2GMPA 1Q8PA 3WHTA 1FYUA 2WT1A 1W6MA 3BODA 4R9DA 1QU0A 3AX4A 2DTYA 2C5DA 3INAA 5E8AA 1UN1A 3ZXFA 2E51A 1C1LA 5CAZA 1JYIA 2A6XA 3AFKA 4AGVA 5GJ6A 1KRIA 4UW4A 4XXAA 1KJLA 1LEMA 4ATEA 1UL9A 1A8DA 5T50A 3MW2A 4FOYA 3PJQA 3PVNA 3W58A 1DQ6A 2D6NA 4FPKA 3WG3A 3V65A 3I8TA 5DUUA 3AYCA 2D3SA 4FP3A 1G9AA 1V6LA 4R9CA 1MVQA 5EWSA 2V73A 1SLCA 1DIWA 1DQ4A 2DVGA 4XYXA 2A70A 3USUA 3N3HA 1G86A 1J1TA 1PZ9A 4GKYA 1V6OA 4YW5A 1AF9A 3T2TA 5EYYA 1ULFA 1Z78A 2A6WA 5H9RA 1CR7A 1SBFA 4XJAA 3ILFA 1JYCA 3OGGA 1VAMA 1NLSA 4P9YA 1FV2A 4Y1VA 2UWCA 4XDQA 3FFZA 3Q9OA 4U2AA 4XMAA 3SNMA 4FPHA 2ZGLA 2GNTA 1IOAA 4NO4A 3RS6A 1UZYA 1DYKA 5JMCA 4DFSA 2FHRA 4GXLA 3IPVA 3WHUA 2ZGNA 3WV6A 1MS8A 3R4UA 4FOWA 1LESA 3POSA 2NYYA 5GZCA 3ATGA 1W6QA 1LOAA 5L73A 1WW6A 2UWBA 3WG1A 3LSEA 2OW4A 2XG3A 3LCPA 4BOWA 1AZDA 4Q26A 1ENQA 5AVAA 2WJSA 2ZACA 4HANA 1FX5A 5FRAA 2ZHLA 4XHBA 5GLVA 1PZ8A 1NXD1 2JD4A 2GALA 1LHVA 2ZMNA 4IQPA 4GWMA 4YW3A 3ZXKA 2YZ4A 2H0BA 3M3CA 1AXKA 3IKWA 3QLQA 3UJQA 4BLJA 5DG2A 4YG0A 1EPWA 5KXCA 2AREA 5GZFA 1W0PA 1UMZA 3FUOA 3GNEA 4YM2A 2P3KA 4Q27A 1RINA 3QCWA 1JBCA 1JXNA 1V6MA 4M3CA 1AJOA 4D69A 3B69A 1VLNA 1CPNA 4YZ3A 2ZGQA 3AXDA 5DUVA 4C1WA 1A3KA 4XXPA 3WLUA 1V6IA 2PHFA 2TEPA 4PQ9A 5KXBA 3WUDA 4Z8BA 2WNEA 5JOWA 2AENA 5HCAA 1DQ5A 1W6NB 1ULEA 2A6VA 2D6KA 4M3CE 4R9AA 1QDOA 1KJRA 4U36A 2DUQA 5DUXA 3SLIA 2UU8A 3MW4A 1LOFA 3NWKA 4ZXKA 1SLIA 2C9AA 1SLLA 3A0NA 3D6EA 3BIWE 2CTVA 5JDBA 4K1YA 4Y20A 3HN1A 3DGTA 1SLTA 5GLTA 3RMYA 2GMMA 3W59A 4BPZA 1GYKA 2ZHMA 3AJYA 1LOGA 1QF3A 2B7YA 3IMNA 5T55A 1GSLA 1CVNA 3CNAA 4RA0A 4ATFA 1ENRA 1OFSA 3B00A 1LHWA 4FP2A 2P34A 5IT6A 1RIRA 1YIFA 2DU0A 3KQRA 1MS0A 1N1VA 1AX2A 3OJBA 4YW1A 2D44A 2ZAAA 4TZDA 2DTWA 3OPZA 3OBRA 1MZ5A 1SCSA 1VAVA 3OYWB 3TB0A 4LBMA 4WVWA 5E89A 1BZWA 5JOYA 4P9XA 4UW6A 1SLBA 4SLIA 4XOGA 1HLCA 1X50A 3AZVA 1LU1A 1DBNA 5KXEA 4JCKA 4Q1PA 2P3IA 4YGEA 1IS6A 2KM2A 2GMEA 2R1BA 3FLRA 1W6OB 1S0GA 2W08A 4M01A 3T1LA 1ULGA 4BMEA 3AJZA 1HDKA 3ZSLA 3N7MA 4XJUA 4H55A 1CONA 2DUPA 4XBQA 1GNZA 1JUIA 5DZGA 1JOJA 2YXSA 3ZYRA 2D6PA 5GZGA 2CYFA 1CQ9A 2ZABA 2PELA 1G9CA 3M3QA 2E6VA 2Q5TA 1YXWA 2Z42A 4Q8LA 1F31A 5GLUA 1AXZA 3ENRA 2EXJA 2JE9A 4PF5A 4XJZA 1GZWA 2ZMLA 2JDZA 1IS3A 1BKZA 4YZ4A 1GANA 2R49A 4ISQA 5JOXA 3ZSMA 2D6LX 5LK5A 1LTEA 1MS9A 1ULDA 1IS5A 4XJ8A 3RG0A 2OUJA 1A78A 2AGSA 2YY1A 3O0XA 4GKXA 4F83A 3FLPA 4DS0A 4AGRA 4LBOA 5GM0A 2FMDA 5HCBA 2LALA 1LJ7A 3V0AA 1WW7A 1GNHA 2VU9A 1KQRA 1C4RA 1QKQA 2DYCA 5T5LA 3OBTA 1V6NA 4FOQA 5GLWA 4ZKTB 2ZGTA 5DG1A 1N1YA 2BQPA 3VKFC 5IK5A 3ILNA 2GNMA 4DQAA 2UURA 1OKQA 1Y7BA 3R05A 4FVVA 3UK9A 1URXA 5DZFA 3WVJA 4M00A 1LOCA 1Q8QA 4M3CF 3ZXEA 3PVOA 2YMZA 3A4UA 3WOGA 3V0BB 4XE9A 4P9WA 4FPEA 4PBOA 1KDKA 1AX1A 2EXHA 2ZZJA 3BOPA 3N35A 1Q8SA 4WZFA 1Q8OA 1MZ6A 3M2MA 4AVTA 2EXIA 3D4KA 1UPSA 2ZMKA 4PBPA 3RRDA 1DQ2A 1IS4A 1D0HA 3RSJA 1GZ9A 1SLAA 1SBDA 1ZA4A 3RQ0A 2VH9A 3KM5A 5GZEA 2ZGSA 3ZPYA 1DQ0A 4XJ9A 2CWSA 3AXEA 3R4SA 3DUIA 3IPVB 3N7LA 4FPLA 2D7FA 5GZDA 3ZXJA 3WG4A 2YROA 1QMJA 1F9KA 1QGLA 4Y1ZA 1ENSA 2GNBA 2R1DA 1MS5A 2PHWA 3AP7A 2JECA 3WDYA 3WDTA 2PHXA 2CY6A 4PCRA 3WNXA 3SH5A 1FAYA 2GNDA 5SV8A 1AX0A 1DGLA 2VW2A 1UKGA 1Z0HA 1XQNA 3BTAA 4XTPA 2ZA9A 1G9DA 2ZGOA 2G4IA 4YM0A 1KDMA 4L8QA 1W6NA 3N36A 4GALA 4YGDA 3SISA 2ERFA 1MS4A 4Y22A 1O4YA 2ZBJA 4R9BA 4Y1YA 3WDXA 1N1TA 2A6YA 3O5SA 4XJWA 2ARXA 5IUQA 1S0FA 1GLHA 4WVVA 1JW6A 2EIGA 4M3CB 4XZPA 3OY8A 4K20A 1ULCA 2WQZC 3AYEA 1BQPA 1CJPA 5EYXA 1HQLA 4FPOB 5CBLA 3N7KA 3U4XA 3WCRA 2V5YA 1UX6A 1G9BA 1FNZA 3AYAA 3PVEA 5JOZA 4YG3A 2D6MA 1HQWA 1BYHA 3SITA 3AZYA 1C1FA 2P2KA 3IN9A 3O0WA 1H30A 5HCFA 5CNAA 2CNAA 1S1AA 1D2SA 2NN8A 2A71A 3VKLA 2ZHKA 3D5OA 1WLDA 2D43A 1HKDA 2W68A 2R0FA 2OVUA 3AYDA 3WCSA 4ASMB 4Y20B 1GKBA 2SBAA 1AJKA 1YYNA 3FLTA 3AZZA 1W6PB 4TYSA 5JVVA 4YW4A 2CWMA 1V00A 2PHTA 1WD3A 1W6OA 2NZ9A 1LCLA 1WLCA 4YW2A 1LENA 2WT2A 3ASIA 4NOTA 1GZCA 4BQ1A 4CRQA 1O4ZA 1LOEA 2PHUA 1FV3A 5CB7A 4JC1A 4BLIA 1Q8VA 2NM1A 1LU2A 4OZXA 1SBEA 1QNYA 3ZXLA 3ILRA 2ZGMA 4Q8KA 5F5QA 1AXYA 4BM8A 3WDUA 2VW0A 5T5JA 3GALA 1LGNA 1WW4A 4XBNA 3VKNA 1KITA 4XILA 4BMBA 4UW3A 3A0KA 4LBQB 1LULA 4W65A 3WDVA 2YV8A 2P37A 1DFQA 2ZGKA 4YG6A 4MYEA 5FREA 1ZM1A 4YLZA 1VIWB 1WBLA 3M3EA 3POWA 5H9QA 2DWRA 3SH3A 4AGGA 3SH4A 1CESA 3M3OA 4KBBA 1W6MB 1N1SA 2DVBA 1CN1A 3WDWA 5T54A 4CTEA 5IK8A 4RL7A 2W52A 1WW5A 1W0OA 4XBLA 1MS3A 3UL2A 5GALA 4YGCA 4FQZA 4C1XA 3VUOA 1LHUA 1GV9A 1WBFA 2LTNA 3UJOA 5F9TA 4LBKA 1N3QA 1R1ZA 1LODA 2WSUA 3AP9A 4UW5A 1GZWB 1LGBA 3T1MA 3JUUA 4YFZA 5H9SA 1Q56A 4XIKA 4FPCA 2GN3A 5IK7A 3N7JA 3V0BA 3ZYPA 1N3PA 1BXHA 3JU9A 3WG2A 3O0VA 3WZ1A 1PZ7A 1LHNA 3LSDA 3USUB 3TAYA 3M1HA 1YO8A 4K21A 3VV1A 2I2SA 3VKMA 5EXOA 3V0AB 3B9CA 1QOSA 4HL0A 2ZKNA 4GWNA 3H0OA 5KXDA 1CPMA 3ZSJA 5H9PA 5GLZA 2EXKA 4YGBA 1LOFC 1WLWA 1JN2P 2EAKA 3ZSKA 1DLLA 3HMYA 5E88A 2JJ6A 2AR6A 4XMIA 1U0AA 2E7TA 1WCSA 3FUQA 1FATA 2CL2A 2OUHA 4GA9A 4XTMA 4AYUA 1LEDA 2VUAA 1DZQA 4YM3A 5DUWA 1I1EA 2A3YA 1LECA 1IKPA 1G8WA 1C57A 1SCRA 3AK0A 3FBYA 1QDCA 4LBNA 3B3QE 1B09A 2P3JA 4WV8A 1UAIA 2D6OX 1W6QB 1RITA 1UZZA 3NV3A 2A6ZA 2AUYA 5T52A 1IKQA 1WUVA 2E53A 3L2YA 3POYA 4Q2FA 2RHPA 3RMXA 3APBA 3V64A 2A5ZA 2A3XA 3NV2A 3B01A 3C2UA 2A75A
chains in the Genus database with same CATH superfamily
3IAQA 4XPVA 1STMA 2BOIA 3MO4A 4G4FA 4P08A 2FCUA 4RQPC 5K0UA 5CG8A 2JKBA 2LUWA 4AHWA 1W2NA 5EHDA 4A3XA 4DUVA 1QJY3 4DUWA 2PHLA 3HIFA 2C24A 4H2AA 4AF9A 4LBQD 1M06G 3W20A 2UYAA 1GICA 1YI7A 1UY1A 1BJQA 3NV1A 5GKAC 3HNYM 2HBTA 4AFBA 1RUOA 2IXLA 1ND3A 1RUE2 4JRAA 1NG0A 4CP9A 1X36A 4FPJA 4HVOA 2GC3A 1RUC3 4LO5B 2XJRA 2BWCA 4H14A 1NXMA 2CSGA 3HT2A 1AR93 1RHI1 1UNBA 2DUOA 4MUVA 2GC1A 3MICA 1TNFA 4URAA 3AP6A 4CEYA 2Z2SB 5F3CA 2AH2A 2XBO3 3H8RA 2VBBA 5J98B 3VBSA 5BPXA 2JXAA 1QJU2 2VC9A 3RPQA 3VBUB 1UW8A 4I09A 1YHFA 2W1WA 2WT0A 3H3UA 5FPXA 4IE0A 2V09A 1WWYA 2WAOA 2VY0A 4LMFA 1ZZ6A 3ZR6A 4UBGA 5T5JA 2ES3A 4AQ2A 5FPVA 4F7ZA 2LW8A 2X29A 4AVSA 3LA3A 4FQ4A 2ZEXA 4AI3A 1ONAA 1OUSA 4JZRA 4JHZA 1D4VB 2QCSB 2W87A 3DYOA 1REFA 1ODNA 3HD8B 1HX6A 5CKNA 3I3DA 4ISRA 2D40A 1XYOA 4LO4B 5FZMA 1S0CA 3FBMA 2EALA 2D3RA 2XDVA 3OGJA 1MR5A 3MYXA 3AP4A 1ZREA 1UOJA 2QKDA 4YW7A 3BYWA 1Y9QA 1W8TA 4TN7A 2QFEA 4Y26A 2RJKA 1I3HA 3LD8A 4LBLA 4S2HA 3VBRC 2RMU2 3KV4A 1QQP3 2RR11 3FMGA 4QX2A 4XHXA 4CZSA 1MVEA 1DGWA 4QPGA 4BWOA 4CCKA 2VXRA 2D5HA 1BMV1 2XB6C 1LOBA 3POFA 2ZGUA 2DURA 4DNYA 3O1UA 2HBUA 2MPFA 4FPGA 4XF0A 4YZ1A 2WO7A 2XONA 1PIV3 2RM22 1RUJ1 2ARBA 2R063 4LBJA 1CWPA 1HXS3 1NT0A 3EQEA 2VNGA 2WT1A 2WWSA 1W6MA 3BODA 4R9DA 4XDOA 2J7MA 5E8AA 2C5DA 2VNRA 3FZ3A 4Q29A 5LW9A 3AFKA 1EP0A 3K46A 5GJ6A 1KRIA 4UW4A 2WFF2 1WZXA 4ZXEA 4WM8B 2UYBA 3MW2A 5FZKA 1HRI2 4BXFA 1D4M2 5EJ3A 1FMD2 2VUCA 3WG3A 1ODMA 5F7UA 2VZOA 4I3GA 4CXXA 5DUUA 1O3QA 4FP3A 3GJBA 4QX1A 3T2QA 4R9CA 3WW3A 5AC92 5A7SA 1ND2A 1KS5A 4BQ3A 1SLCA 4LXLA 4PDWC 3ZKUA 1DIWA 3TN93 1W99A 4XYXA 2A70A 3N3HA 3S30A 4GKYA 4NJ4A 1QJX1 3W5NA 4YW5A 3VGIA 1Z7S2 5I0SA 3PTRB 4A41A 2H6CA 1Z78A 2HWC1 1I6XA 1UO9A 3ACLA 4NIIA 5H9RA 1OOPA 5LK7B 1NA1A 3IIAA 3JD71 3H1MA 3KCCA 3ZYGA 4NAOA 4FPHA 2ZGLA 2QTWB 4CDQA 1K42A 1W9TA 4NO4A 5FV3A 4FFGA 3KHCA 2FBEA 2J1EA 1VPHA 4S2GA 2C9KA 3WHUA 3IDBB 1W8FA 3OGVA 4XEZA 3B94A 3OF1A 5F5AA 4CA9A 2NYYA 1NYWA 1RVF1 2CAVA 4P9IA 4Q4X2 4ZS3A 5J37A 1JYXA 2WNVA 1COV1 4QXHA 3RFRA 5EP9A 4OCTA 3WG1A 1F4HA 3AB0A 2OW4A 2XG3A 1UU5A 5AVAA 2Q8DA 4OI1A 3ZN4A 2RVAA 1FX5A 1OLQA 4A6OA 4CDWA 2ZHLA 1PNFA 1UMIA 2C4XA 2RV9A 4PI0A 4B1LA 3KD4A 4JGZB 4E4SA 5C71A 2HWB2 1NXD1 3S5AA 4QMAA 1LHVA 2ZMNA 4INDA 3ZXKA 2VQ0A 2Y34A 5EJZB 5DG2A 2XJVA 3RJ2X 5LY1A 5F32A 1VBC1 3RZZA 3CJIB 1K5MC 1QXRA 1UMZA 4CEWA 1HRV1 2HWF3 4JTNA 4LJHA 3M8LA 4OUEA 2B4KA 3GBGA 3AKRA 3U10A 4CU9A 1VLNA 4A44A 1R082 4YZ3A 3MUY1 2DCZA 1A3KA 2BTVC 4XC9A 3I2JA 2VQAA 4IEVA 3FFQA 2PAKA 3C7OA 2TEPA 4PQ9A 3ZX7A 4AFCA 4FT8A 4BZ4A 3KQ4B 4BIOA 3USSA 4E4DX 4NN0A 5FUNA 1B35C 2VZVA 4G9SB 5FK8A 2BFUS 5F3IA 1ZRIA 3VDDC 4Q4W3 1KJRA 2E32A 1EV13 3VHOA 1UX7A 1XE8A 3GZUC 4UAPA 3WXPA 5FZAA 2RDRA 3RZKA 2VMHA 1Q3EA 5JR2A 4K1YA 3SXWA 5FWEA 2OT7A 1SLTA 4PLOA 4EV0A 1RJ8A 3W59A 1SZBA 1RXGA 4MADA 1QF3A 3PUHA 1GSLA 1CVNA 5FZLA 4I02A 2Q1ZB 4OUSA 3OSDA 1WCUA 2DU0A 1RIRA 5CYYA 1O3RA 1RUH3 2GP5A 3IDCB 4IE5A 3KF5A 4K3UA 1AX2A 3OJBA 5BNQA 3W9AA 5FY4A 2BVBA 1ZBE2 1NCQA 4XCBA 4I2OA 4O61A 3N9LA 2FCVA 4CP1A 4D7TA 2JD9A 3I3EA 5JOYA 5IAVA 4RQPA 4UW6A 1VE0A 1SLBA 2TBVA 1HLCA 2VM9A 1E5SA 1DBNA 1QH6A 4L11A 4JCKA 4Q1PA 5LBBA 2P3IA 2G9FA 5LA0A 3AM2A 4WM7C 3K2OA 4UOJA 5FZEA 2GAUA 2YFZA 4HPKA 4GQ7A 3N7MA 1OURA 3U14A 4AG4A 2FDHA 4HT1T 1CONA 2G9ZA 1TZOA 3CZUA 3AL5A 4NVPA 3C7HA 5DZGA 2YXSA 3ETQA 4RS5C 2BFUL 4PHZA 4QPWA 1XNKA 1DDLA 4NHKA 4WVMB 3M3QA 4W8JA 3LKJA 2E6VA 4Q0PA 5B4XA 1LNSA 1VRH3 2VMGA 3JZVA 1IG3A 4NHLA 3GHMA 1AXZA 5GLUA 5M0TA 5DPNA 3UGHA 2EXJA 2XGXA 2ZMLA 2WYSA 4JTOA 3JQWA 2J1SA 4Q0UA 3IT8A 2BUKA 3WEZA 5JXIA 4LR4A 1ULDA 3AC0A 1IS5A 4XJ8A 3UT0A 3MV11 5DMYA 2ARAA 2EIDA 2IXCA 4CCCA 5LA2A 2YY1A 5L7OA 3NSTA 4XFBA 2VAUA 4DS0A 4AGRA 3MLLA 1X82A 2FMDA 4IE6A 4MGQA 4QWNA 5J36A 3V0AA 3D8CA 3DCQA 4RR3C 1FOD1 1VBE2 1QKQA 2VPVA 2R061 3IDEA 4QXCA 1QHDA 3OBTA 1YFYA 3RZLA 2B9VA 2ZGTA 2G9GA 4JDOA 4MXWA 1H8TC 3VKFC 2BQPA 3LEIA 5FP9A 1IPSA 1VBB1 4QX0A 3ILNA 1ZRCA 1H2MA 1OKQA 3UK9A 5LA1A 1BLZA 1URXA 4AK3A 2VZSA 4FFIA 3WVJA 3ZXEA 1LOCA 1Q8QA 4XFAA 3PVOA 3A4UA 3VBRA 4CUCA 3T2PA 3NL1A 4P9WA 2P1BA 3THCA 5A6XA 2W94A 4FPEA 1OFNA 5DDJ1 2ZZJA 3N35A 3P6BA 3IWZA 1YQ2A 5FZHA 2YG0A 3LFMA 4PBPA 2Y33A 3RYKA 4LK6A 5C4WB 4EZHA 3TN91 2WNUA 3RSJA 1GZ9A 3LOBA 2JDKA 2WFPA 1YJKA 3C7EA 3O1VA 4HK9A 4NHMA 1XNTA 2OQ7A 3MPBA 3WF1A 1NZIA 1ZA4A 3RQ0A 4H7LA 1GFF2 1UIKA 1YWKA 1HN1A 4ET7A 2V72A 2ZGSA 3PTYA 3GZTB 3R4SA 3IPVB 5GZDA 5ABJA 1JMUB 1ENXA 2YROA 1E57A 4RHV2 4Y1ZA 3MI8A 4FFHA 2P4EA 1UF2C 1ASJ1 1MS5A 3H7JA 1NUKA 2BP6A 5IVBA 1VBA2 1TQ5A 3WDYA 3WDTA 1EUUA 2CY6A 2ET7A 5F6LB 3WF2A 1FAYA 2GNDA 4KWKA 5SV8A 1RUD1 1AX0A 1WKYA 2JB8A 1UKGA 5C9AC 2ZGOA 1NY71 4YM0A 2RS12 3RZHA 2F4PA 1W6NA 3ZFEC 4GALA 1UQXA 2Y38A 4J25A 2ERFA 2ZAHA 4CXWA 1H1MA 1MS4A 1AYM2 4Y22A 1RUI1 5CKMA 4LULA 4R52A 2ARXA 3J8F1 4CUGA 2XH6A 2GU9A 4M3CB 3KB5A 4MX3A 3UGGA 3AMQA 2IXJA 1NAEA 3AYEA 3LAGA 4C8DA 1EUTA 3BKZA 2PFWA 1JH5A 2V5YA 3IZOA 3VDBA 1G9BA 2HWF1 2X5IC 3I2FA 5JOZA 5A32A 4AQ6A 3WSOA 3AZYA 3KCXA 3NNGA 3IN9A 3O0WA 2EVXA 2JE8A 3H3ZA 3O1RA 5FYVA 4B1MA 2CNAA 4OHYA 5JSPA 4NIHA 3M70A 2ZHKA 4BQ2A 1JZ6A 1XNAA 3AMMA 3ZOIA 2W9XA 4ASMB 1S2KA 5A3TA 3MFCA 4EN8B 4TYSA 3VBOC 4A2UA 3EHKA 4MG2A 1K5MA 1GP5A 3KT1A 4UFIA 1W8WA 1RUF1 5FJKA 5LBCA 4D0QA 1VB4A 4D6QA 1HJFA 3CL1A 3LIHA 5FFOC 1PO23 4XETA 4BLIA 1AYN2 1POV3 5IVYA 1QNYA 5FP7A 3ILRA 1JOBA 4LUKA 4Q8KA 1MEC1 4BM8A 3ZR5A 4BQYA 4W4ZA 2GC0A 5JI9A 4D8MA 3FN9A 1LGNA 1WW4A 2QZ2A 5BNOB 5F37A 3CDZB 3TEXA 1AL22 1PVC3 1UWWA 2YC2A 3VDDA 4UW3A 4OHXA 5JWPA 3A0KA 1LULA 2VOTA 1Y9MA 1RTVA 2GH8A 2WN2A 2YV8A 4UF0A 4Q4V1 4DB5A 1RUG3 4YG6A 5FREA 3M3EA 1WBLA 2PA7A 4AGGA 4A7KA 1DLCA 2W2IA 1CESA 4CTEA 5CFDB 1BEV2 1N1SA 1SDDB 1SPPB 3I59B 4GULA 4QHZA 3T2OA 3KT7A 2WS91 1UD1A 1IPKA 3WINE 1X9PA 3VD3A 4XBLA 3WQ0A 2HEYF 4COUA 5GALA 1GMMA 3H1YA 3P3PA 2Y6JA 3AP9A 3I2DA 4QPYA 4LKDA 2YC0A 3WX5A 2IVIB 3S7EA 3KVBA 3T1MA 4RFRB 5H9SA 1NLQA 1W28A 1K12A 2HEVF 1W39A 1PZ7A 1LHNA 2R30A 5FY7A 3USUB 3TAYA 1YO8A 3GZEA 4JAAA 3VKMA 5DAVA 3SKJE 2XLGA 5FTTC 4HL0A 1QOSA 1CZTA 3IMMA 4IGOA 3VHRA 2Q8OA 2PQQA 2YC4A 1CPMA 2V4VA 5GLZA 3VBUC 4CXYA 4BHPA 1C8NA 1S2EA 4CU6A 3BIEA 5FQ0B 1DLLA 4YRDA 4Z82A 5TSWA 1X9TA 2FDIA 1DGRA 1J83A 2JDNA 3FUQA 4BQXA 2OX0A 2O14A 1AR82 2W5FA 2ZJCA 2OUHA 4QX3A 4A3ZA 4AYUA 5FR3A 2BNOA 5E16A 2CHHA 1IZ3A 1I1EA 1LECA 3VD7A 4ZU7A 3AK0A 3FBYA 3ACGA 3VBHA 3S7IA 3J7NA 3WNOA 2D6OX 1RHI3 1R64A 1W6QB 4DY3A 1RGSA 4SBVA 2E53A 2MEV1 3L2YA 4DOUA 2RHPA 3APBA 5FPLA 5IJRA 5LEJA 2KXLA 3NV2A 1WCKA 3B01A 4LHSA 3OG2A 4ITCA 1XE0A 2J1AA 1G7YA 4RR3A 5IVFA 3AZWA 4CPBA 2FD8A 5T5OA 1V6KA 4E4ZA 1CAWB 2JDHA 1CGPA 4Q4Y3 4YPJA 1H8TA 4FOVA 3LZZA 4KGQA 1VBD2 4QDRA 4WZCA 1UKRA 1LGCA 3VKOA 4FPYA 1CZSA 3AL6A 5JR7B 1XXNA 4NR1A 2DVDA 3BB6A 1QOOA 2E9QA 2ZOEB 1R1A2 3WR0A 4BQWA 3A23A 1APNA 1OC1A 2ENRA 4WM8C 2XJUA 4HBNA 3E1F1 2IC1A 4PJYA 5FYMA 2RR13 1SFYA 4PIYA 2VMDA 3LA7A 3ZIWA 4WBBA 1YRZA 3BALA 5IK4A 1AR61 4ZU5A 5T5PA 4JKKA 3WUCA 3ZLIA 4QAWA 2YDEA 4M0HA 1FI2A 3D82A 3RZMA 1TEIA 2W39A 1RUJ3 3JBG2 1JHNA 1SHWB 5FPZA 1I9RA 1S0DA 1OF4A 3AVSA 2WAAA 3MDPA 1PO12 4B4PA 4YVSB 2D5FA 5BY5A 1WCDJ 3ES1A 1S0JA 2E7QA 2R0HA 2ZGPA 4MHRA 5F3EA 1ZBA1 2O8OA 2PHRA 2ZEYA 4UWDA 4FBFA 4YZ2A 4AEKA 1PM7A 1V0AA 4OZOA 3O12A 2AEYA 5FMDA 4GB31 3SCGA 3J7LA 3AZXA 5FYUA 2DU1A 4DPNA 2WC2A 4PF1A 2HWD2 1KEXA 2NMNA 5C9AA 2VTXJ 5L9BA 2WO1A 1MACA 2WNOA 2R16A 3ZFEA 2WSVA 3OD4A 4LHNA 4L2NA 3VB9A 1CAVA 1QJX3 3I4IA 3NJVA 4HSLA 2FZ1A 4LBQA 4P14A 3GJAA 4LUMA 5JUVA 5FP3A 3E6BA 5C7GA 1CD3G 4OQ8A 3RNSA 2JG8A 4Y1XA 1W03A 3N9MA 4LHLA 1UY0A 1FYUA 4QXBA 5JPMB 1C8M2 1ST8A 3VBFB 2BVVA 2X09A 3VDAA 2RS31 5FZCA 1LAJA 1QXPA 3I2HA 1UN1A 5FMOS 2BGCA 1C1LA 5E1RA 2Q8EA 1JYIA 2OPWA 4XQ4A 4AGVA 5CFCB 4XXAA 4D7YA 4ATEA 3CJIC 4CPBD 1FXZA 3NVCA 4FOYA 4BYYA 3MLKA 1AR72 4NPLA 1DQ6A 2D6NA 5HXVA 3V65A 3AYCA 2D3SA 1COV3 1V6LA 2OA2A 1MVQA 3NW4A 4CCOA 3ACFA 1DQ4A 3H1WA 5I0RA 1PZ9A 3LA2A 3I7DA 3VBOA 4P5HA 5A80A 1V6OA 2E31A 3WW2A 2D98A 5EYYA 4Y3OA 3GHNA 2A6WA 1XRUA 2OIIA 4GMP1 4N43A 4ONUA 4XJAA 5BXXA 2MHFA 1AUYA 1JYCA 4OI2A 3OGGA 3HBZA 4NUBA 1VAMA 1NLSA 1F15A 1RXFA 1VBC3 1YQ8A 2PLV2 3PVBB 5L19A 1FV2A 5IVVA 1HRV3 3PIGA 1PMHX 2PAMA 3DKWA 3H8UA 4AI2A 4ASLA 5ISLA 5JIUA 3LOIA 1UXXX 5FWJA 2Y64A 2FHRA 4GXLA 4OHVA 2ZGNA 3AMPA 3KS7A 3WV6A 3POSA 4O9EA 1JZ2A 1RMU2 1OQEA 3ATGA 5BNNB 4FTEA 3HWJA 4XFHA 1CZVA 3ZFFA 1TMF2 3LSEA 5G05L 3VL8A 1W06A 4B7EA 1TME1 1KXGA 1O3SA 2E63A 2GH2A 5GLVA 5FXZA 5FZ3A 3H8OA 2V4AA 4LO6B 1JUHA 4DXSA 3PLQA 3WF0A 2YZ4A 4M4PA 4G3YC 2RE9A 4CP0A 1R092 2FMYA 3U0ZA 4YG0A 1EPWA 3CO2A 2XVGA 1O4TA 5T3NA 1I5ZA 4L9BA 2Q1MA 5GZFA 1FPN2 5FZIA 4H7MA 5C3PA 3K48A 1RINA 1JYNA 3DPRB 1A6CA 1JBCA 5HV4A 2QDRA 1CX4A 3MGUA 1V6MA 2R071 1AJOA 4AFMA 3B69A 2ZGQA 1L7QA 1V9U2 2HWE2 3AXDA 4XXPA 4ARXA 1ZYBA 1OMIA 4NRMA 4W50A 3WLUA 1V6IA 3OTFA 4LE4A 5F2WA 4AEDB 4DXTA 5C33A 1ZRRA 5BNPB 2C6SA 2AENA 5K0UB 2BNNA 1W3VA 4HOOA 1OD5A 4U36A 4XCAA 5FLJA 1IQDC 2QQNA 4JGYB 3VBUA 1W0NA 3NWKA 4ZXKA 4W6YA 4P5YA 5J1XA 3A0NA 1RUE1 2CTVA 2BU9A 2ETEA 3OCPA 5JDBA 2QQLA 4JX0A 2B46X 3KWVA 2F17A 3PU3A 4Q4Y1 1CAUB 2ZHMA 4A7YA 1LOGA 2B7YA 2UY9A 2IWGB 2BDRA 2VD7A 4OI4A 4AI8A 4ATFA 1ENRA 3B00A 3U37A 1LHWA 5J09A 3HT1A 3BPZA 3SMHA 1DU3D 1HB1A 1T2XA 3WP6A 4EWDA 1QJU1 4CEYB 2HJIA 2ZAAA 1MZ5A 4LPLA 3WNLA 5JZGC 4Y5Z0 1VAVA 4LBMA 4WVWA 5E89A 1DG6A 4IW3A 2XVLA 3ELNA 1BZWA 4P9XA 3LFIA 1NE4A 5FZGA 4SLIA 2VO5A 3LE0A 4K8FA 2XPJA 4XOGA 5KXEA 1X50A 3AZVA 1LU1A 3BPSA 4X8PA 5EZWA 3I2GA 4M4RA 3DKQA 1S0GA 3T1LA 5BNPA 2IFWA 1FOD3 5C4WC 3AJZA 5C8CB 3ZYJB 4AL9A 1JYVA 2DF7A 2DUPA 3GYDA 5A7PA 3WP4A 3ZO0B 2WZEA 2G19A 1J1LA 4NHYA 3ZYRA 1VBB3 3E5QA 4EN7B 2ZABA 2PELA 2RMU1 4UI9L 2Q5TA 1NKGA 2VVDA 3NO8A 3ZIXA 3MBWA 1YXWA 4WM8A 4BE3A 3ORJA 1ZZCA 4XJZA 4PF5A 1GZWA 5FYHA 4GH4B 2JDZA 4IV1B 1IS3A 4DMIA 5IATA 5DDJ3 4LT5A 1OBNA 4YZ4A 5FZ7A 1GANA 2RM21 3MUZ1 1ZX5A 1KD7A 1MS9A 4QX5A 2WINB 2OUJA 4QQHA 2AGSA 4XURA 3OD0A 3O0XA 5C3OA 4GKXA 3UYJA 2P3YA 1OT5A 3FLPA 4HG6B 2WFF1 4A42A 2VTXA 1RUNA 4CDUA 1F2NA 5IYYA 5CEHA 1C4RA 1HRI1 1D4M1 4MV2A 4HFSA 1FMD1 4AI0A 2DYCA 4ZKTB 4PT6A 1JZ5A 4FOQA 5IWFA 4IERA 5J96B 5AC91 1VJ2A 5IK5A 3JD72 4DQAA 5LA9A 3R05A 3UGFA 4OI0A 1IPJA 2G1MA 4FVVA 1ASJ3 2QE3A 4M3CF 3BTXA 4BA6A 3GZAA 4FI9A 1Z7S1 4N7UA 5I93A 4XE9A 1V70A 2BJSA 5A33B 2W46A 4PBOA 2W3JA 2B42B 2FDGA 2JDMA 2EXHA 1RUD3 4PLMA 4PLNA 1J59A 1AL0G 1UYYA 3TNPB 1RVF2 2OKXA 1UPSA 5JCTA 1JYTA 1DQ2A 1CIYA 1SDWA 3B93A 1BK0A 1W8UA 3PUSA 5A3MA 2CDOA 1YQCA 1SLAA 4JGZA 3SCFA 4UT5A 5LWBA 1RUI3 1UOBA 1LB2A 4NIGA 2LM3A 3J8F3 4NRPA 4XF1A 1VBA3 3J9SA 2WRAA 4L0PA 4N90A 4QKNA 3T0BA 1OD3A 3KM5A 5GZEA 3ZPYA 5JSOA 1DQ0A 4Q4X1 5IHRA 3DUIA 3KVAA 3N7LA 3VZKA 2D7FA 3ZXJA 1NOVA 1H2KA 4IEXA 3RI9A 3WG4A 2HKXA 1OPMA 4UFMA 5A1AA 1QMJA 4NIDA 2WNVB 3W5MA 4KH9A 3FWEA 3BUCA 5LASA 4LO7A 2P6CA 3IDAA 5AFEA 3ROUA 2HWB1 3AP7A 4PQQA 4MGTA 4HVRA 4JVAA 2YHJA 4XUOA 4PCRA 3WNXA 3SH5A 5A3PA 4W6XA 4KG8A 2VW2A 1G9DA 5FMCA 2J1UA 5BNOC 3VZJA 3B5LB 1VMHA 2C1FA 3PU8A 4ZONA 5FUPA 3N36A 1QY4A 3PNAA 2WIIB 5A3LA 1K3IA 1POV0 2WZR2 4Y5TA 1O4YA 3KV6A 4R9BA 3THDA 3WDXA 1JS9A 3O5SA 4L99A 1H6YA 2K0GA 4RD7A 2ADEA 1PVXA 5IUQA 1RUF3 1R081 1S0FA 2R042 2W1QA 3OPTA 4WVVA 5IAXA 2EIGA 5CFDC 4Q0VA 3OY8A 4K20A 4ZY9A 4A45A 1ULCA 3AKTA 2WQZC 5IVEA 2CGPA 2I45A 4O9GA 5EYXA 3TYJA 1MZEA 4FPOB 3OGRA 1QJY2 4CCMA 1MEC3 3PVEA 1O7FA 1OA3A 3VZLA 2AEZA 4TXWA 1GQPA 3A21A 1PGW2 4OLLA 3PL0A 1O5LA 4I0BA 5HPOA 1QJEA 1JHJA 5CNAA 3WY6A 4MLOA 5KHGA 1RUC2 2D43A 2W68A 4E4HA 4Q4V3 2R0FA 3LDRA 4BK4A 4COWA 3T0DA 1AYN3 2VCCA 1AR92 5JXJA 1AJKA 4GJZA 4HMZA 1W6PB 3MLJA 2K2SA 4YW4A 1REEA 2CWMA 4Y4RA 2Y6FA 1ULPA 1OF3A 1WD3A 4OQ9A 2WS93 2XBO2 4C0BA 5L36A 1PNGA 5A6QA 2VVFA 1XOYA 3ASIA 4CRQA 1MQTC 1FV3A 4N53B 5CB7A 2NM1A 5BUVA 1YC61 2Y26A 4OZXA 2VCAA 1W9WA 2ZGMA 5FDBA 1XNBA 1NCQB 4CUBA 1D0GA 3IB3A 1VMJA 1AXYA 2WO3A 3ZM8A 2XL7A 2VW0A 4LIVA 5DN2A 1H1IA 4KNCA 5I8SA 1XJAA 2YGLA 1BBT2 3A22A 3EO6A 4BMBA 1WA6X 5FYIA 2ZX3A 1J84A 3NMBA 4URTA 2P37A 4HPKB 1ALYA 2QBXA 4CCLA 1HJGA 4IEZA 4YLZA 3TBDA 2DWRA 4CU8A 3SH4A 3ITQA 5FYYA 1QQP2 2ORZA 2DVBA 1GQHA 4IE7A 4LEJA 5T54A 4IDZA 1WMDA 1YUDA 1ZZ8A 3HJRA 3B9IA 4HK8A 4KMQA 4Q5OA 2AZ5A 5EJ1B 1PK6B 1WW5A 1W0OA 5FZOB 3WT3A 4C91A 3C7FA 1WBFA 4ZZ8A 2LTNA 1IHMA 1PIV2 1UU6A 1YLLA 4LBKA 1OQDA 4UW5A 1C3HA 1HXS2 5FKBA 3CBNA 5C6CA 3PUIA 3U07A 1TVGA 5JZGB 3ME2A 3R0RA 3WF4A 5IK7A 3ZYPA 5CU1A 1S2BA 5FY9A 2MEV3 3JU9A 5LRRA 1A8MA 4CUAA 3WZ1A 3KCYA 3KGLA 1VBE1 4K21A 3VV1A 2JB4A 1YEWA 4LK7A 5EXOA 3V0AB 3B9CA 4KU8A 4QKDA 5C4WA 1UMHA 4GWNA 3H0OA 3ZSJA 2EXKA 1W90A 3HMYA 5E88A 4B8EA 1VB2A 1U0AA 4UFJA 4RGKA 3WQBA 4CSWA 4OMDA 3E5XA 1FATA 2CL2A 3I3BA 1LEDA 2VUAA 4YVSC 1DYOA 1DZQA 4MGZE 4YM3A 2VBDA 3PIJA 4XUTA 4DO0A 3OPWA 1IKPA 3CF6E 1C57A 4GWJA 3GCXA 4K40A 4NMIA 4HSJA 5I0UA 3V56A 3ZXGA 1H4HA 3NV3A 2A6ZA 4OMCA 5LBFA 1IKQA 1BHGA 1WUVA 3POYA 1SMVA 4GZ9A 3LPGA 4PDWA 4Q2FA 4M0NA 3V64A 1VBD3 2WNUB 4E9KA 5IFPA 1AR63 4ORFA 2W92A 2GZWA 4QGLA 4NROA 4B3NA 2XJTA 3KLSA 5FBZA 1VMFA 4EZ4A 1XU2A 2VW1A 2EF6A 1EYBA 4RHV1 1GBGA 2GDFA 3VZMA 3BI3A 1H4GA 2VR4A 5ABJB 3K3OA 3PHMA 4LLOA 1SFPA 1H9PA 1UYXA 5KR7A 1J3RA 1UIJA 1VBA1 1ZBA3 5A3OA 4E8DA 3VBFC 2BOJA 3I49A 1XC6A 2DCKA 2TNFA 1N3OA 2ADDA 4GB33 5FOJB 2OPKA 5A7WB 1QOTA 2RS11 1GWLA 2Y6KA 5CFCC 2KD7A 4FPFA 2BBVA 2SLIA 1TNRA 1W8ZA 2VZ1A 5FZ6A 4NWWA 1AYM1 4YFWA 4GAZA 4AE2A 4DRRA 2QNKA 1H8VA 2EIBA 2BRTA 4JQRA 3HBKA 3SEPA 1HV0A 1LKNA 1C5IA 4FFFA 3VL9A 1XYPA 5FXWA 4KL1A 5LBEA 4Y22B 3OYWA 3DEMA 4HKLA 1Q43A 3CMGA 3VZNA 1KS4A 2Q30A 3H8XA 2A3WA 2HH9A 5DZEA 4Y24A 1IGOA 1SACA 2DVAA 2WLQA 4XAAA 1X8EA 4NE9A 2X05A 2NPIA 3TOJA 3U4SA 2HWD3 2RS33 2ZTNA 3MW3A 1IG0A 3U1XA 4Q4W2 3O1PA 1XSRA 2VOVA 1M4WA 3NNFA 1EV12 2OZJA 3O14A 4AWDA 3QH6A 1HB4A 1W04A 2HYKA 4XIOA 4B29A 3ZVXA 2IZWA 4AVVA 4Q0QA 1UY3A 1DYPA 4QXKA 4XABA 1JZ4A 3HR9A 3D0SA 4AHZA 3MEPA 4TSVA 3N9NA 4K1ZA 5BNOA 4ARYA 1DHKB 1B35A 2VZRA 1JODA 3JCIA 2BBAA 2RDQA 2D93A 1F5FA 3R4DB 4YW6A 5BNNC 1RUH2 1H9WA 1UZVA 3N9QA 2A7AA 1V6JA 2DV9A 3ABZA 1VALA 1XSQA 2WQ4A 4GMP3 3MIGA 3N4MA 2AC1A 2WL1A 1J58A 2RJLA 1AYN1 1WD4A 5KC5A 1XB9A 5FY5A 2P6HA 1SPPA 3I59A 1X33A 3INAA 3DV8A 3BN6A 5CVRA 3ZXFA 2I74A 3E6DA 2A6XA 2WLPA 1AL21 1LEMA 2QQKA 1UL9A 4KWUA 5T50A 4CE8A 4BH9A 3PJQA 3OEBA 3PVNA 4AVBA 5A6YA 1NCRB 3D0JA 3DPRC 3I8TA 3T30A 3LPFA 1G9AA 2JIJA 2LROA 1GWMA 4O65A 3OUJA 5A7QA 1TME3 4UF0B 2O8QA 1BEV1 2R6QA 2YU2A 3AKSA 1H0BA 1VRH2 1D2QA 2BWAA 3USUA 1G86A 1J1TA 4OFGA 4Y4YA 3EXUA 2E7AA 4NAMA 4AEDC 1AF9A 2YUEA 5BNPC 1ULFA 1OLRA 4XVHA 4WM7A 4EE2A 5I8TA 5K0UC 1CR7A 5FAXA 2ZXQA 1OXCA 3GBFA 3ILFA 5FZDA 2CU5A 3ZDVA 4AR2A 5IVCA 3NNJA 4JGYC 4P9YA 5FQ0A 4EN9B 3POGA 1TMF3 1MQTB 4RS5A 2UWCA 3GF6A 4XDQA 3SKVA 3HEIA 4U2AA 3SNMA 1GWKA 4MOAA 2GNTA 3NKGA 1IOAA 3B7MA 1BCXA 2R073 3NJZA 1OUXA 1UZYA 1DYKA 4I3PA 5JMCA 4DFSA 4OHWA 2VMEA 2XMLA 3LDBA 4XAEA 1E5IA 4Z92B 4FOWA 1LESA 3ETPA 2Y6GA 4A4AA 5FY0A 1W6QA 3M7AA 1LOAA 1JZ7A 4QQLA 4IESA 1U5YA 2WQ8A 3LCPA 4BOWA 1AZDA 4CEYC 2X53S 1ENQA 3DYMA 1EAH2 5F5CA 1DF0A 4BISA 2ZACA 4HANA 2DFBA 3UETA 4E2SA 4ASKA 1GOGA 5JI7A 3OGSA 2GALA 2EICA 2ZKLA 4IQPA 1AR81 2YGMA 2H0BA 1RUE3 2DCTA 1OHFA 4QB6A 3C8XA 3UJQA 1HIXA 2XQXA 1ZNPA 4IEPA 5D1IA 5FY1A 1SFNA 5JIAA 5KXCA 2AREA 2Y60A 4DXRA 2VQUA 4IEOA 3HNBM 1W0PA 1ZZ9A 1W8NA 3FUOA 3GNEA 5C8CC 3S0MA 4GWIA 3VBHB 4Y5SA 1YFUA 5D2AA 1QJU3 2RS52 5FZBA 4X8NA 5L9RA 5DUVA 2WA3A 5I0DA 4IEUA 1U5IA 4Z8BA 2WNEA 4IUGA 5HCAA 1E5RA 4GH4C 4XFCA 4IV1C 1ULEA 2D6KA 3KHBA 4R4XA 1T6BX 4BK5A 3JQXA 1VBD1 1XU1A 2DUQA 3FHAA 5DUXA 3MW4A 3SLIA 1ZA7A 4IGPA 2UY8A 5LEKA 2C9AA 4KU7A 1SLLA 4EQVA 3D6EA 3BIWE 4MSVA 2IXIA 5FYSA 1PGL2 5ACA2 2B5HA 5HI0A 4V2WA 4Y20A 4BB3A 3DGTA 1Y3TA 5GLTA 1JZ8A 3QBQA 5FXXA 4BCUA 2GMMA 3HQXA 1DZRA 1GYKA 4LTAA 3IMNA 2JICA 4IV3B 2QQWA 4FSJA 4RA0A 2XJSA 1CAXB 2RMU3 4BU2A 3KF3A 1F4AA 1PX3A 2XWJB 3GM8A 4ZHNA 2XWBB 1L3JA 3CU7A 3KQRA 1U5XA 3KV9A 1N1VA 4YW1A 2BNMA 4C0HA 4TZDA 1MPXA 2DTWA 1HQNA 3I3QA 5LRSA 5JSRA 3F95A 5FXVA 2RM23 4DXZA 3TB0A 4YSFA 4EN0A 3JBG1 2VG9A 4IEWA 1PO11 2QQOA 3B02A 3K51A 2Z5WA 4NPRA 4E27A 3BTYA 3K4ZA 2BPA2 5D8AB 4XFFA 2WFF3 2KM2A 2GMEA 2R1BA 1W6OB 2K46A 1ZZBA 1ULGA 4BMEA 1HDKA 1HRI3 2VGDA 1D4M3 1RJ7A 1RL3A 2XLAA 1FMD3 2Y0OA 2YU1A 4XACA 1KGYA 4IEQA 1OKOA 1GNZA 2QQMA 4XBQA 4UBHA 4MO3M 1JUIA 3VBFA 4LKSA 1JOJA 4LE3A 5AC93 3E6CC 2HWD1 2YPJA 1OI6A 5CFCA 3ZYFA 2ORXA 3NAPB 4IGQA 2X5IA 4Q8LA 1O5UA 1GP4A 1F31A 1D7PM 3N9OA 3G6JB 5AVPA 3ENRA 4JRLA 1Z7S3 3LWCA 4LQRA 3RJRA 4DIQA 4PI2A 5CG9A 1PMJX 1JI6A 1BKZA 1CAVB 3EBRA 4AAXA 1BVVA 1PO22 2WNVC 2R49A 2PQSA 4ISQA 3C3VA 3ZSMA 5A7NA 5LK5A 1LTEA 2DDUA 4QPIB 3RG0A 1F8VA 1C8M1 1HB3A 1OH3A 4JKMA 4NHXA 4LKEA 5A1FA 4AFDA 2BGOA 1A78A 2WYFA 5KC6A 4I01A 5EPAA 3I2KA 5GM0A 5FBJA 4CDXB 5HCBA 2LALA 1LJ7A 1PVC2 4YVWB 1GNHA 2HYXA 4DY5A 1JU3A 1KQRA 4S2DA 4XFIA 2JG9B 5FZ9A 3QH7A 1AR71 4J1WA 3U11A 4RN5A 1XNDA 1V6NA 3JB4C 3BOWA 4Q4X3 4QGMA 5J48A 5C5UA 1N1YA 1RUG2 3T0AA 3WQ7A 1NX9A 3I2OA 2UURA 4NIAA 1Y7BA 3D3AA 3ZDSA 5DZFA 1TE1B 2FCTA 1PMIA 4HKWA 4M00A 2JWPA 1CJDA 2WA4A 3WOGA 3PURA 2HWB3 3V0BB 1KFXL 3HQUA 4QT6A 1QWRA 1KDKA 1S55A 3BOPA 4WZFA 1H1AA 3RZJA 1Q8OA 3FHQA 2TUNA 1GOFA 3M2MA 3ZN6A 2PLV1 4F8AA 5KHKA 2VCMA 1U12A 4N43B 3RRDA 4CCJA 3P3NA 3RYRA 1IS4A 1D0HA 3AFGA 1JTZX 2VUJA 3IBMA 1DGWX 1SEFA 2ZS6B 1SBDA 4E2QA 4F3JA 4QU2A 1R083 3BU7A 2VH9A 3MHZA 2EAAA 5A70A 1SQ4A 4QM8A 2WZ8A 4XF3A 2FZ2A 1GUIA 1Y9GA 4XJ9A 5LB6A 3AXEA 1REDA 4N9IA 1TMF1 4XZUG 5FO7B 4N9HA 5FOBB 2WWUA 1O59A 2VTFA 1F9KA 1QGLA 4AI1A 1ENSA 2R1DA 3NNLA 3NRUA 1FT9A 2WZR3 3N9PA 3O7OA 4N53C 3M4FA 2PHWA 4JQTA 3AMHA 4TLGA 5C3QA 2PHXA 3RWNA 5JPNB 3MIDA 1NCQC 3CJXA 1L7RA 2NLRA 3BTAA 1DGLA 4AEDA 1R091 1Z0HA 1XQNA 3MIBA 4I0AA 4XTPA 3ZFGB 1OA2A 1W9FA 2VE1A 3AVRA 3VHPA 3WD5A 5FLHA 1KDMA 1WMXA 4L8QA 4B7KA 1O8PA 1FPN1 2E33A 1RHI2 3K77A 3P1IA 4YGDA 5FLIA 2CDPA 4JGYA 4KG0A 3WNPA 4A6SA 2QZ3A 3LEGA 2BYVE 2ZBJA 4KWJA 2VUDA 4Z1VA 4Y1YA 2XR4A 4KI5M 2VZ3A 3RDIA 4N8MA 4UYBA 2Z69A 2YBSA 2HWE1 1V9U1 1W9SA 1AHSA 2Q8CA 1YNAA 4AI9A 1ZBE3 2GC2A 5K7PA 4XZPA 1GOHA 1ND3B 3J7HA 1CAUA 4CP9B 5CBLA 1HQLA 4KGGA 4Q4Y2 1PK6C 2VVEA 3AYAA 4MGSA 5B4NA 1Y43B 1HQWA 4CCNA 4ES9A 1BYHA 4Q0SA 2J1RA 3ZPOA 2FDKA 2WN3A 1H30A 4FCAA 3RGBA 3VBSB 3RWKX 1QIQA 3VKLA 1D2SA 2R7EB 2W1UA 4QHOA 2ZCWA 3D5OA 4XUNA 1HKDA 1E5HA 3G7DA 2OVUA 3JXSA 3WCSA 5L7OC 3DN7A 4K6BA 2SBAA 3FLTA 3AZZA 3L2HA 3VD5A 2RR12 4QM9A 3K4DA 4H3WA 3O1OA 1BMV2 5C8CA 3O1TA 3H50A 1BBT3 3ZYHA 3T4VA 3CEWA 3DL3A 4NOTA 1GZCA 4BQ1A 1O4ZA 2PHUA 2DCYA 4JC1A 3FJSA 1RUJ2 1LU2A 3J7MA 5FYCA 4YNIA 3T09A 3UKNA 4LLFA 2XKPA 5F5QA 2XOMA 3GALA 4XBNA 1VP6A 4L92A 2P17A 4GH4A 4ZS2A 4IV1A 4DZGA 1KFUL 4QGNA 4QPGB 1VBE3 4ES8A 4QDSA 1GZTA 3NQHA 4LIUA 3WDVA 1JOPA 5B2GB 1WGPA 1DFQA 2WNUC 3MIEA 4MYEA 4YYOA 2HLEA 3ZKYA 1LRHA 2B9UA 3POWA 5H9QA 3POIA 4LA2A 2EA7A 3ACIA 3M3OA 5EV7A 1W6MB 2XQRA 5IK8A 2QQIA 4AFAA 1QH7A 4EYUA 1QJX2 4V1PA 4DEVA 2P5BA 2W52A 2HWC2 4C1XA 1WMEA 3UL2A 1XE7A 3Q8CA 4FQZA 3VUOA 1LHUA 1GV9A 5F9TA 1R1ZA 5ABJC 2WSUA 1GZWB 2BW8A 3WQ1A 1NE6A 1LGBA 1RYYA 2IUWA 5FYTA 4YFZA 1Q56A 2VBPA 4XIKA 2E26A 3AKQA 3GBWA 1ND2B 2GN3A 3GCWA 4RGAA 3U78A 3ZN5A 1N3PA 3WG2A 5I91A 5A33A 2JKXA 3O0VA 1K45A 3LSDA 4PIZA 3ZYIB 3VLBB 4EJRA 3URFA 3VD9A 1LR5A 2I2SA 4CDUB 1OOPB 2Y0IA 4META 1OA4A 2A73B 2ZKNA 2PTMA 1COV2 3EYPA 3H42B 3IIIA 5C3RA 1UXZA 1NA1B 2ZX2A 4YGBA 1LOFC 1WLWA 2EAKA 3MFAA 4RHV3 1J3QA 2JIGA 5KBFA 5IVJA 4XMIA 4IE4A 2E7TA 1WA4A 3VDCA 2RG4A 2ZEZA 2ET1A 5FCCA 1UCXA 3UKTA 4CDQB 4KQ7A 4GA9A 3KMHA 3S57A 3CJIA 3KSCA 3WW4A 1VBC2 1QDCA 4AZZA 2RS13 2VOKA 2P3JA 2Y8KA 4E2GA 5JMOA 1RB8G 3CHXA 1RITA 1UZZA 3ON7A 4AHXA 1HRV2 1AYM3 1W3XA 3A7QA 3AKPA 1VRBA 2XXZA 3WP5A 4DINB 3RMXA 5C5TA 4CDWB 2O1QA 2A3XA 4IXLA 1JYWA 2D97A 3C2UA 3Q8FA 5BYNA 1DZTA 1AVBA 3SC7X 2B45X 1S0IA 2N7GA 3AP5A 3OEAA 2I07B 4UFKA 3M3IA 1SG3A 4FAGA 1MS1A 2D3PA 4AHYA 4OHZA 4RSUA 3SCHA 3U75A 1G6NA 4OYUA 2QQVA 4CEWB 5D21A 2W0XA 1UYPA 4AQSA 2C26A 2ID4A 2IXKA 2JE7A 2UWAA 2YYOA 1OQ1A 3AMNA 4QQ2A 2DVFA 4DRVA 5JXHA 4X6RB 2KR2A 1X8MA 4O7XA 1POQA 1UU4A 2W1SA 2AYHA 4GMP0 4MZUA 2YBPA 4YZ5A 2Y6HA 3SQOA 2RDSA 1CIWA 3DF0A 4FTSA 1YI9A 3BVCA 2WZR1 5C70A 5HXMA 1O8SA 4QHBA 5I8YA 1NCRC 2PYTA 2YPDA 3W21A 3EJKA 4LNVA 3QD6A 4LITA 2FQPA 5DXDA 2R041 3OUHA 1ZZ7A 3DECA 4XUQA 3T3YA 2H6BA 2NMOA 4Q1RA 5A1LA 3TNQA 4FXKB 3NV4A 5LZ6A 2VZTA 2ZGRA 4V2VA 4I30A 5JLVA 1W6PA 1FNYA 5DABA 2ZHNA 5FO9B 5CA6A 1QJY1 2ZX0A 1H2LA 3OY8B 1LHOA 1YJLA 5FP4A 3I97A 1Q5OA 2GSYA 5FKCA 5FO8B 3FL7A 1X7NA 1YFXA 4Y1UA 1AL23 1DQ1A 1TG7A 4AVAA 1N47A 1ZBE1 4JHTA 1PGW1 3WNKA 4N53A 4XDPA 1S0BA 2B39A 1RUC1 4XF9A 4WVMA 4CCEA 3IAPA 3ZMNA 1QNWA 2NP0A 1AR91 2GN7A 4QB1A 4HZFA 5DAWA 2VZUA 5FJHA 4S2FA 3F2ZA 1G9FA 1BEV3 4RQPB 3WP3A 1WLTA 1UOGA 4YM1A 2XBO1 4IL7A 3CIHA 2WZPP 4QU1A 2XJPA 2VZQA 3PMEA 4K7JA 2WKKA 1PX4A 3T4HB 3MPPG 5FK7A 2ZZQA 1S0EA 3WW1A 4J1XA 3IM0A 2ATFA 2GMPA 3ACHA 1Q8PA 3SEEA 1ACCA 1UOFA 4TLFA 1QU0A 5LCWL 5CIRA 3AX4A 2DTYA 5DQ0A 2CV6A 2E51A 5CAZA 1ULOA 5KHJA 3K75B 1PK6A 5FZOA 1BBT1 1KJLA 4C90A 1A8DA 1FOD2 1YQ6A 2YFUA 2H0VA 2R062 1NZCA 2VECA 4FPKA 3VBHC 3W58A 5L9VA 2CGNA 4K9SA 1QXJA 5JZGA 3K4AA 2BZDA 5FY8A 2VOXA 5EWSA 1VBB2 2V73A 2YB7A 5JXGA 2VXJA 3FE5A 4IEYA 4MXVA 1QQP1 2DVGA 3UKVA 5L7OB 3OUIA 2LRPA 2OXBA 3T2TA 3J4UH 4XQWA 1AR83 3H7YA 1SBFA 3CKHA 5DDJ2 4LHKA 4AW7A 1PIV1 3X29B 1GQGA 1QJFA 2DBIA 2QUOA 2WDBA 1HXS1 2PXJA 3BGAA 1VAKA 4HN0A 5K9YA 2FDFA 1NQDA 2PMWB 2XVKA 4MXWB 4Y1VA 5CKQA 5KHHA 3TN92 3FFZA 3Q9OA 4XMAA 1EAH3 4AEJA 4WVZA 3VHNA 4A7ZA 2QQUA 2MNGA 4R8HA 5ANNA 3RS6A 4EROA 3MZHA 1T6GC 2CAUA 3EB7A 3IPVA 4IV3C 1MS8A 2OS2A 5FZ0A 3R4UA 3VBRB 4BIFA 1UYZA 1PM4A 3Q8AA 4QX8A 5GZCA 2BV4A 5L73A 1WW6A 2UWBA 1XPWA 4FO9A 5EQUA 4Q26A 4N7IA 2WJSA 4CYDA 3GDBA 3LF7A 5FRAA 4XHBA 1GR3A 1ASJ2 1PZ8A 5A3WA 2FDJA 1J3PA 5HCHA 2JD4A 4YW3A 4GWMA 1XNCA 1QJZA 2RS53 3M3CA 4RYDA 2F4LA 1AXKA 1RUD2 3IKWA 3QLQA 4HLTA 4BLJA 5D8AC 4MHUA 1R1A3 5DAXA 1NY72 3KV5A 4FTBA 2VMIA 5EFUA 1Y4WA 2P3KA 4HONA 4Q27A 4YM2A 4XW3A 3QCWA 1RUI2 1JXNA 5A3UA 4M3CA 4D69A 3I3MA 3PDQA 3J8F2 1CPNA 4ZU4A 4PDWB 3CZJA 4R4ZA 2F6BA 5A7WA 4C1WA 5ACA3 3MIHA 4OVEA 3NAPC 1OLMA 2PHFA 3JBG3 5KXBA 3WUDA 4TTGA 5JOWA 1F35A 2WWJA 1PO13 1DQ5A 4LOTA 4PIXA 4CP2A 4B4RA 2HWF2 1W6NB 2A6VA 4FXGB 4R9AA 4M3CE 1QDOA 2W95A 3BU0A 2UU8A 5IW0A 3WNNA 1LOFA 4COZA 1SLIA 5I0TA 4QPIC 5FMBA 3I54A 2YBKA 4ZPIA 1OLME 2JG8C 5LATA 2LS6A 2DFCA 3HN1A 3ECQA 1HB2A 3RMYA 4CDXC 2WUHA 4BPZA 3AJYA 1MZFA 5T55A 1EPZA 2VCBA 4YVWC 4Z2WA 3CNAA 1OVPA 2JG9C 1A34A 4JDNA 5F5IA 1OFSA 4FP2A 2OZ6A 2ILMA 4ZZ5A 2P34A 3WF3A 5IT6A 1W2AX 1YIFA 3DXUA 1HN0A 1YQ5A 1MS0A 1US2A 4NWVA 5FIXA 1RUF2 5A32B 4AVCA 2D44A 4UFHA 3OPZA 3QOPA 3OBRA 4D94A 5IFTA 3NJYA 1SCSA 1W05A 2VNOA 3OYWB 2XKOA 3I2IA 1XYNA 2QQPA 1XBFA 3C7GA 4Y33A 1C8M3 5F3GA 1MEC2 3POBA 4Q4W1 1IQAA 4K8RB 1EV11 5F8PA 4YGEA 5FPBA 1IS6A 4XJUA 1O6UA 2JDUA 2VQTA 3FLRA 2VULA 1K5MB 2W08A 4M01A 4N43C 4P9JA 4BDVB 4H55A 1AR73 3ALQA 1NQJA 3O1SA 2JEMA 2XL9A 4J6GA 1O91A 1H6XA 5F6KA 4CVUA 4XFGA 4AEMA 2X10A 4Q4V2 5CFDA 5CZKA 1YFWA 4QDQA 2VMFA 2D6PA 5GZGA 2CYFA 1CQ9A 1RC6A 3T08A 1G9CA 3HVDA 1WMFA 3ES4A 2J1TA 2Z42A 4UFLA 2WS92 1RUH1 3HOBA 4LKFA 2Q1FA 2XUEA 3MV01 1UPIA 2JE9A 1B35B 1NCRA 1K5JA 4YWAA 3VDDB 2IXHA 3VD4A 4KWLA 3ZFFC 1NLRA 5JOXA 2D6LX 2PLV3 2PHDA 4YARA 2J22A 4MGYE 4QX7A 1OVSA 2ARCA 5K4LA 4F83A 4LBOA 3ZFGC 5FYZA 4MH0E 1WW7A 2VU9A 5DAQA 5FZFA 2DBNA 4QD2A 4UXAA 5T5LA 1RMU3 3UV9A 4QQOA 4GIQA 5GLWA 3TEWA 4NPMA 5DG1A 4FAHA 4AXOA 1MQTA 3HAGA 1S4CA 2GNMA 2VMCA 1VRH1 2ZEWA 4EN6B 1ND3C 3QACA 1DP0A 1UZ0A 5ERLA 2YMZA 3RVHA 3GGLA 5FP8A 4HXCA 2Z79A 3CQOA 1GP6A 2XLFA 1AX1A 5FZ1A 2JENA 2O0OA 1Q8SA 3E97A 3KGZA 1R093 1MZ6A 3O1MA 1BK1A 4AVTA 2EXIA 3PJYA 1YIPA 2QJVA 4WM7B 3D4KA 2ZMKA 2GP3A 4GD4A 1FPN3 4X6QB 4JDMA 2EIEA 3VBSC 5F2SA 2MEV2 1DCSA 4RS5B 2Z4FA 3GXUA 2HWE3 1V9U3 1L7LA 5A6ZA 1CAWA 1OSGA 4RFT0 4XQDA 4BQ4A 2CWSA 1W9YA 2V5DA 3OB8A 3TWIA 4XF4A 5C3SA 4COYA 3R6SA 4FPLA 2QDNA 3HPNA 5FYBA 3ZXAC 3CLPA 5FZ8A 1EAH1 2ZX1A 3RZGA 2GNBA 4OUMA 4GJYA 1PHMA 3FX3A 2JECA 4D3WA 3LDKA 4HN1A 4JV4A 4DUXA 4CCDA 3H9AA 3KT4A 5FPUA 2ZA9A 3LEMA 2OYZA 3ZYBA 3VZOA 4MGKE 2G4IA 4RR3B 2VZPA 4QPGC 5F39A 3SISA 3THTA 2WBKA 1OH4A 1H8TB 1N1TA 2A6YA 4XJWA 2RDNA 1US3A 1AR62 3NNMA 2RS51 2XJQA 4XUPA 1GLHA 3ZMOA 1JW6A 4BQ5A 4BXSV 4E8CA 5HV0A 1WCQA 1R1A1 1UY4A 4YVSA 3ST7A 4IV3A 4DEQA 2IFRA 2WABA 1BQPA 1CJPA 1CAXA 3U4XA 3N7KA 4I0WB 3WCRA 1UX6A 2KA3A 1FNZA 2Y6LA 3ZXDA 2JX9A 3HNMA 4YG3A 2D6MA 3KZ4C 3S5QA 1CX1A 3HN3A 3SITA 2XHNA 3EMRA 1C1FA 1VR3A 1ZBA2 2BERA 2P2KA 3MF6A 1PGL1 2PAEA 3Q8BA 4Z07A 4AAPA 4P9GA 5HCFA 5ACA1 3HQRA 1S1AA 2NN8A 5KHIA 2A71A 1ND2C 4GB32 1WLDA 1U5ZA 2OQ6A 4P00B 3AYDA 1W2TA 1H2NA 4KBZA 3RYPA 4Y20B 1ZRDA 1GU3A 3PMSA 4MVTA 1GKBA 3LEKA 1YYNA 5D8AA 5ANQA 5JVVA 5FZ4A 2ZX4A 3UESA 1V00A 2PHTA 2J1VA 2VL4A 1W6OA 2NZ9A 2W47A 4CDUC 5CISA 1OOPC 1YCIA 1LCLA 1WLCA 1C5HA 4YW2A 1LENA 1W2OA 4BJ0A 3S6PA 1NA1C 2WT2A 5J3UA 2W91A 1C28A 5BV6A 1LOEA 2WO2A 4QQPA 1Q8VA 2VJXA 2L9LA 3LIGA 3MF9A 4D6SA 1SBEA 3ZXLA 3NAPA 4CDQC 3P5BA 2RJ2A 2RS32 2BEOA 2Q4SA 2DCJA 5G04L 3WDUA 5C9AB 5LY2A 1F5JA 3H3LA 5A3NA 3TEYA 3VKNA 1KITA 4XILA 1W8OA 3ZFEB 3ZSEA 2C0ZA 3VN4A 4LBQB 5CADA 4W65A 2HWC3 3ZSLA 4HVQA 4MGIE 4L97A 4QPIA 1UY2A 1EY2A 4QKFA 5DAPA 5K8SA 3BTZA 2ZGKA 3JB8A 4HKOA 4CDWC 4JKLA 5E6HA 1ZM1A 1VIWB 2JDYA 2JG8B 1PGSA 1HV1A 2J42A 3JD73 3OBAA 4JGZC 3SH3A 4CDXA 5EIYB 4KBBA 2BGPA 3WDWA 1ZVFA 1CN1A 3NJXA 3OOXA 4YVWA 4TWTA 4RL7A 3LGRA 2ZPXA 3MIFA 3UNPA 2JG9A 3DYPA 4AQTA 1W8HA 4COVA 1MS3A 2X5IB 3E5UA 3FHIB 2JDPA 3LB9A 4LOSA 1PO21 4QKBA 4YGCA 5APAA 5FPAA 3L9JT 4LA3A 1N3QA 3UJOA 1LODA 4Z2AA 2A1XA 4W6WA 1POV1 1RVF3 1BVP1 3RI8A 4CEWC 2VNVA 2PN5A 3JUUA 4AOCA 4LO8A 2XUMA 4FPCA 1JZ3A 2JDAA 3FC0A 3N7JA 3V0BA 1BXHA 4QB2A 1PVC1 3POEA 4EWAA 5C8WA 2IVJA 1I5PA 4P9LA 3M1HA 3VBOB 5BNNA 3BCWA 5SV5A 4D6RA 1P8JA 1W2UA 5HBAA 3SHRA 2VOWA 2WR9A 3K3NA 1RUG1 2B8MA 4RGGA 3OBZA 4IETA 5KXDA 2CGOA 5H9PA 4EWEA 3ZSKA 1TME2 1JN2P 2AACA 4OULA 3WNMA 1HW5A 3TEZA 2JJ6A 3J26N 2AR6A 2K9ZA 1WCSA 2R32A 4NRQA 5A7OA 2Q0AA 4LORA 3LQCA 1O3TA 4XTMA 1RMU1 5JAXA 2XHKA 4P02B 3THPA 5DUWA 2A3YA 1OPOA 1GNYA 2QQJA 1G8WA 3PUQA 1SCRA 1UZWA 4WV8A 4LBNA 5FUIA 3B3QE 1B09A 4CU7A 2NQYA 1UAIA 3DPRA 4HETA 4D7SA 5F1RA 2HEWF 3POJA 5FMOL 2X8KA 3ZFFB 3ZN6B 2AUYA 5T52A 3TRSB 4B4QA 3WHTA 3DXTA 3NKTA 2QVSB 5KWRA 1DGRN 2A5ZA 2R072 3Q8EA 1ZRFA 3PUAA 2R043 1JU4A 5AFBA 3ZFGA 5J7MA 2A75A 1QEXA
chains in the Genus database with same CATH topology
4XPVA 4RQPC 4G4FA 5K0UA 5CG8A 2JKBA 2LUWA 4AHWA 4A3XA 1QJY3 2PHLA 3HIFA 4AF9A 4LBQD 1M06G 2UYAA 1GICA 1YI7A 5GKAC 1BJQA 3NV1A 4AFBA 4A7ZA 1RUOA 2IXLA 1ND3A 1RUE2 4JRAA 1NG0A 1X36A 4FPJA 4HVOA 2GC3A 1RUC3 4LO5B 2XJRA 2BWCA 4H14A 1NXMA 3HT2A 1AR93 1RHI1 2DUOA 4MUVA 2GC1A 3MICA 1TNFA 3AP6A 4CEYA 2Z2SB 2AH2A 2XBO3 5J98B 3VBSA 5BPXA 2JXAA 1QJU2 3VBUB 3RPQA 1UW8A 4I09A 1YHFA 2WT0A 3H3UA 5FPXA 2V09A 2VY0A 1ZZ6A 4UBGA 5T5JA 2ES3A 4AQ2A 4F7ZA 2X29A 4AVSA 3LA3A 4FQ4A 4AI3A 1ONAA 1D4VB 2QCSB 1REFA 3HD8B 1HX6A 4ISRA 2D40A 1XYOA 4LO4B 1S0CA 3FBMA 2EALA 2D3RA 3OGJA 1MR5A 3MYXA 3AP4A 2QKDA 1Y9QA 2QFEA 4Y26A 2RJKA 1I3HA 4LBLA 4S2HA 3VBRC 2RMU2 4XHXA 1QQP3 2RR11 3FMGA 4CZSA 1MVEA 1DGWA 4QPGA 4BWOA 1BMV1 2VXRA 2D5HA 2XB6C 1LOBA 2ZGUA 2DURA 4DNYA 4FPGA 2MPFA 4XF0A 4YZ1A 1PIV3 2RM22 1RUJ1 2ARBA 2R063 4LBJA 1HXS3 3EQEA 2VNGA 2WT1A 2WWSA 1W6MA 3BODA 4R9DA 5E8AA 2C5DA 2VNRA 3FZ3A 4Q29A 3AFKA 1EP0A 5GJ6A 1KRIA 4UW4A 2WFF2 4WM8B 2UYBA 3MW2A 1HRI2 1D4M2 5EJ3A 1FMD2 3WG3A 4I3GA 5DUUA 1O3QA 4FP3A 3WW3A 5AC92 4R9CA 1ND2A 1KS5A 1SLCA 4PDWC 1DIWA 3TN93 4XYXA 2A70A 3N3HA 3S30A 4GKYA 1QJX1 4YW5A 3VGIA 1Z7S2 5I0SA 1RUNA 2H6CA 1Z78A 2HWC1 1I6XA 3ACLA 5LK7B 5H9RA 1OOPA 1NA1A 3IIAA 3JD71 3H1MA 3KCCA 3ZYGA 4FPHA 2ZGLA 4CDQA 4NO4A 2FBEA 4S2GA 3WHUA 3IDBB 4XEZA 3B94A 3OF1A 2NYYA 1NYWA 1RVF1 2CAVA 4P9IA 4Q4X2 5J37A 2WNVA 1COV1 3WG1A 3AB0A 2OW4A 2XG3A 1UU5A 5AVAA 4OI1A 3ZN4A 1FX5A 1OLQA 4CDWA 2ZHLA 1PNFA 4E4SA 3KD4A 4JGZB 2HWB2 1NXD1 4QMAA 1LHVA 2ZMNA 4INDA 3ZXKA 2VQ0A 5DG2A 2XJVA 3RJ2X 1VBC1 3RZZA 3CJIB 1K5MC 1QXRA 1UMZA 4CEWA 1HRV1 2HWF3 4JTNA 3M8LA 3GBGA 3AKRA 3U10A 1VLNA 1R082 4YZ3A 2DCZA 1A3KA 2BTVC 2VQAA 4IEVA 3FFQA 2PAKA 4PQ9A 2TEPA 3ZX7A 4AFCA 4FT8A 4BZ4A 4BIOA 3USSA 4E4DX 4NN0A 1B35C 4G9SB 2BFUS 3VDDC 4Q4W3 1KJRA 1EV13 3VHOA 1XE8A 3GZUC 3WXPA 2VMHA 1Q3EA 4K1YA 3SXWA 1SLTA 4PLOA 4EV0A 1RJ8A 3W59A 1QF3A 1GSLA 1CVNA 4I02A 2Q1ZB 4OUSA 1RIRA 2DU0A 1RUH3 3IDCB 4K3UA 1AX2A 3OJBA 5BNQA 3W9AA 2BVBA 1ZBE2 1NCQA 4I2OA 4CP1A 4D7TA 5JOYA 4RQPA 4UW6A 1SLBA 2TBVA 1HLCA 1QH6A 1DBNA 4L11A 4JCKA 4Q1PA 2P3IA 2G9FA 3AM2A 4WM7C 2GAUA 4HPKA 4GQ7A 3N7MA 4AG4A 4HT1T 1CONA 4NVPA 5DZGA 2YXSA 3ETQA 4RS5C 2BFUL 1XNKA 1DDLA 4NHKA 4WVMB 3M3QA 3LKJA 2E6VA 4Q0PA 2VMGA 1VRH3 3JZVA 4NHLA 3GHMA 1AXZA 5GLUA 2EXJA 2XGXA 2ZMLA 4JTOA 3JQWA 4Q0UA 3IT8A 2BUKA 4LR4A 1ULDA 1IS5A 4XJ8A 2IXCA 2YY1A 5L7OA 3NSTA 4XFBA 4DS0A 4AGRA 3MLLA 1X82A 2FMDA 5J36A 3V0AA 3D8CA 4RR3C 1FOD1 1VBE2 1QKQA 2VPVA 2R061 3IDEA 1QHDA 3OBTA 1YFYA 2ZGTA 2G9GA 4JDOA 4MXWA 1H8TC 3VKFC 2BQPA 1VBB1 3ILNA 1ZRCA 1H2MA 1OKQA 3UK9A 1URXA 4AK3A 3WVJA 3ZXEA 1LOCA 1Q8QA 4XFAA 3PVOA 3A4UA 3VBRA 3NL1A 4P9WA 4FPEA 1OFNA 5DDJ1 2ZZJA 3N35A 3IWZA 4PBPA 3RYKA 5C4WB 3TN91 2WNUA 3RSJA 1GZ9A 3LOBA 2WFPA 1YJKA 4HK9A 4NHMA 3MPBA 1ZA4A 3RQ0A 4H7LA 1GFF2 1UIKA 1YWKA 2ZGSA 3PTYA 3GZTB 3R4SA 3IPVB 5GZDA 5ABJA 2YROA 1ENXA 1E57A 4RHV2 4Y1ZA 3MI8A 1UF2C 1ASJ1 1MS5A 3H7JA 1VBA2 1TQ5A 3WDYA 3WDTA 2CY6A 2ET7A 5F6LB 1FAYA 2GNDA 4KWKA 5SV8A 1RUD1 1AX0A 1UKGA 5C9AC 2ZGOA 1NY71 4YM0A 2RS12 2F4PA 1W6NA 3ZFEC 4GALA 2Y38A 2ERFA 2ZAHA 1H1MA 1MS4A 1AYM2 4Y22A 1RUI1 4LULA 4R52A 2ARXA 3J8F1 2XH6A 2GU9A 4M3CB 3KB5A 4MX3A 3AMQA 2IXJA 3AYEA 3LAGA 2PFWA 1JH5A 2V5YA 1G9BA 2HWF1 2X5IC 5JOZA 5A32A 4AQ6A 3AZYA 3KCXA 3IN9A 3O0WA 2EVXA 3H3ZA 4OHYA 2CNAA 5JSPA 3M70A 2ZHKA 3AMMA 4ASMB 1S2KA 3MFCA 4EN8B 4TYSA 3VBOC 4A2UA 3EHKA 1K5MA 3KT1A 1RUF1 1VB4A 5FFOC 3CL1A 1PO23 4XETA 4BLIA 1AYN2 1POV3 1QNYA 3ILRA 4LUKA 4Q8KA 1MEC1 4BM8A 2GC0A 5JI9A 1LGNA 1WW4A 2QZ2A 5BNOB 1AL22 1PVC3 3VDDA 4UW3A 4OHXA 5JWPA 3A0KA 1LULA 1RTVA 2GH8A 2YV8A 4Q4V1 4DB5A 1RUG3 4YG6A 5FREA 3M3EA 1WBLA 2PA7A 4AGGA 4A7KA 1CESA 4CTEA 5CFDB 1BEV2 1N1SA 3I59B 4GULA 3KT7A 2WS91 1UD1A 1IPKA 3WINE 4XBLA 3WQ0A 2HEYF 4COUA 5GALA 3H1YA 3P3PA 3AP9A 3I2DA 4QPYA 2YC0A 3WX5A 3S7EA 3T1MA 5H9SA 2HEVF 1W39A 1PZ7A 1LHNA 2R30A 3USUB 3TAYA 1YO8A 4JAAA 3VKMA 2XLGA 5FTTC 4HL0A 1QOSA 3VHRA 2Q8OA 2PQQA 1CPMA 5GLZA 3VBUC 4BHPA 1C8NA 5FQ0B 1DLLA 4YRDA 4Z82A 5TSWA 1DGRA 3FUQA 1AR82 2ZJCA 2OUHA 4AYUA 2BNOA 5E16A 1IZ3A 1I1EA 1LECA 4ZU7A 3AK0A 3FBYA 3VBHA 3S7IA 2D6OX 1RHI3 1W6QB 4DY3A 1RGSA 4SBVA 2E53A 2MEV1 3L2YA 4DOUA 2RHPA 3APBA 5LEJA 2KXLA 3NV2A 1WCKA 3B01A 4ITCA 1G7YA 4RR3A 3AZWA 5T5OA 1V6KA 4E4ZA 1CAWB 1CGPA 4Q4Y3 1H8TA 4FOVA 3LZZA 4KGQA 1VBD2 4WZCA 1UKRA 1LGCA 3VKOA 4FPYA 5JR7B 1XXNA 4NR1A 2DVDA 3BB6A 1QOOA 2E9QA 2ZOEB 1R1A2 3WR0A 1APNA 2ENRA 4WM8C 2XJUA 4HBNA 4PJYA 2IC1A 2RR13 1SFYA 4PIYA 3LA7A 3ZIWA 4WBBA 1YRZA 3BALA 5IK4A 1AR61 4ZU5A 5T5PA 3WUCA 2YDEA 4M0HA 1FI2A 3D82A 1TEIA 2W39A 1RUJ3 3JBG2 1JHNA 5FPZA 1I9RA 1S0DA 3MDPA 1PO12 4B4PA 4YVSB 2D5FA 5BY5A 1WCDJ 3ES1A 1S0JA 2E7QA 2R0HA 2ZGPA 1ZBA1 2O8OA 2PHRA 4YZ2A 4FBFA 4AEKA 1PM7A 3O12A 4GB31 3SCGA 3AZXA 2DU1A 4DPNA 2WC2A 2HWD2 2NMNA 5C9AA 1MACA 2R16A 3ZFEA 2WSVA 3OD4A 4LHNA 4L2NA 1CAVA 1QJX3 3I4IA 4LBQA 4HSLA 2FZ1A 4P14A 4LUMA 3E6BA 1CD3G 3RNSA 2JG8A 4Y1XA 4LHLA 1FYUA 5JPMB 1C8M2 3VBFB 2BVVA 2RS31 1QXPA 1UN1A 5FMOS 2BGCA 1C1LA 5E1RA 1JYIA 4XQ4A 4AGVA 5CFCB 4XXAA 4D7YA 4ATEA 3CJIC 1FXZA 3NVCA 4FOYA 4BYYA 3MLKA 1AR72 1DQ6A 2D6NA 5HXVA 3V65A 3AYCA 2D3SA 1COV3 1V6LA 2OA2A 1MVQA 3NW4A 3H1WA 1DQ4A 1PZ9A 3LA2A 3I7DA 3VBOA 4P5HA 1V6OA 3WW2A 2D98A 5EYYA 3GHNA 2A6WA 1XRUA 2OIIA 4GMP1 4N43A 4ONUA 4XJAA 5BXXA 2MHFA 1AUYA 1JYCA 4OI2A 3OGGA 3HBZA 1VAMA 1NLSA 1VBC3 2PLV2 3PVBB 5L19A 1FV2A 1HRV3 2PAMA 3DKWA 3H8UA 4AI2A 4ASLA 5JIUA 3LOIA 2FHRA 4GXLA 4OHVA 2ZGNA 3AMPA 3KS7A 3WV6A 3POSA 4O9EA 1RMU2 1OQEA 3ATGA 5BNNB 4FTEA 3HWJA 4XFHA 3ZFFA 1TMF2 3LSEA 3VL8A 4B7EA 1TME1 1KXGA 1O3SA 2E63A 2GH2A 5GLVA 4LO6B 1JUHA 3PLQA 2YZ4A 4G3YC 2RE9A 4CP0A 1R092 2FMYA 3U0ZA 4YG0A 1EPWA 3CO2A 2XVGA 1O4TA 5T3NA 1I5ZA 4L9BA 2Q1MA 5GZFA 1FPN2 4H7MA 3K48A 1RINA 3DPRB 1A6CA 1JBCA 2QDRA 1CX4A 3MGUA 1V6MA 2R071 1AJOA 4AFMA 3B69A 2ZGQA 2HWE2 1V9U2 3AXDA 4XXPA 1ZYBA 1OMIA 3WLUA 1V6IA 3OTFA 4LE4A 4AEDB 5C33A 1ZRRA 5BNPB 2AENA 5K0UB 2BNNA 1OD5A 4U36A 5FLJA 4JGYB 3VBUA 3NWKA 4ZXKA 4W6YA 3A0NA 1RUE1 2CTVA 2ETEA 3OCPA 5JDBA 2B46X 4Q4Y1 1CAUB 2ZHMA 4A7YA 1LOGA 2B7YA 2UY9A 2IWGB 4OI4A 4AI8A 4ATFA 1ENRA 3B00A 1LHWA 5J09A 3HT1A 3BPZA 3SMHA 1DU3D 3WP6A 4EWDA 1QJU1 4CEYB 2HJIA 2ZAAA 1MZ5A 5JZGC 4Y5Z0 1VAVA 4LBMA 4WVWA 5E89A 1DG6A 2XVLA 3ELNA 1BZWA 4P9XA 1NE4A 4SLIA 2XPJA 4K8FA 4XOGA 5KXEA 1X50A 3AZVA 1LU1A 4X8PA 5EZWA 3T1LA 1S0GA 2IFWA 1FOD3 5C4WC 3AJZA 5C8CB 3ZYJB 2DF7A 2DUPA 3GYDA 3WP4A 3ZO0B 3ZYRA 1J1LA 1VBB3 3E5QA 4EN7B 2ZABA 2PELA 2RMU1 2Q5TA 2VVDA 3NO8A 3ZIXA 1YXWA 4WM8A 4BE3A 1ZZCA 4XJZA 4PF5A 1GZWA 4GH4B 2JDZA 4IV1B 1IS3A 4DMIA 5DDJ3 4LT5A 4YZ4A 1GANA 2RM21 1ZX5A 1KD7A 1MS9A 4QX5A 2WINB 2OUJA 4QQHA 2AGSA 3OD0A 3O0XA 4GKXA 3FLPA 2WFF1 4CDUA 1F2NA 1C4RA 1HRI1 1D4M1 4MV2A 4HFSA 1FMD1 4AI0A 2DYCA 4ZKTB 4FOQA 4IERA 5J96B 5AC91 1VJ2A 5IK5A 3JD72 4DQAA 3R05A 4OI0A 1IPJA 4FVVA 1ASJ3 2QE3A 4M3CF 4BA6A 3GZAA 4N7UA 1Z7S1 5I93A 4XE9A 1V70A 5A33B 4PBOA 2B42B 2EXHA 1RUD3 4PLMA 4PLNA 1J59A 1AL0G 3TNPB 1RVF2 1UPSA 5JCTA 1DQ2A 1SDWA 5A3MA 3B93A 1SLAA 4JGZA 3SCFA 1RUI3 1LB2A 2LM3A 3J8F3 4XF1A 1VBA3 3J9SA 4N90A 5JSOA 3KM5A 5GZEA 3ZPYA 1DQ0A 4Q4X1 3DUIA 3N7LA 3VZKA 2D7FA 3ZXJA 1NOVA 1H2KA 4IEXA 3RI9A 3WG4A 2HKXA 1OPMA 1QMJA 2WNVB 4KH9A 3FWEA 4LO7A 5AFEA 3ROUA 2HWB1 3AP7A 4HVRA 4JVAA 2YHJA 4PCRA 3WNXA 3SH5A 4W6XA 4KG8A 2VW2A 1G9DA 5BNOC 3VZJA 3B5LB 2C1FA 3N36A 1QY4A 3PNAA 2WIIB 5A3LA 1POV0 2WZR2 1O4YA 4R9BA 3WDXA 3O5SA 4L99A 4RD7A 2K0GA 5IUQA 1PVXA 1RUF3 1R081 1S0FA 2R042 4WVVA 2EIGA 5CFDC 4Q0VA 3OY8A 4K20A 1ULCA 3AKTA 2WQZC 2CGPA 2I45A 4O9GA 5EYXA 3TYJA 1MZEA 4FPOB 1QJY2 1MEC3 3PVEA 1O7FA 1OA3A 3VZLA 1PGW2 4OLLA 4I0BA 1O5LA 5CNAA 3WY6A 4MLOA 5KHGA 1RUC2 2D43A 2W68A 4Q4V3 2R0FA 4COWA 1AYN3 1AR92 1AJKA 4HMZA 1W6PB 3MLJA 2K2SA 4YW4A 1REEA 2CWMA