3MW3A

Crystal structure of beta-neurexin 2 with the splice insert 4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
189
Chain Sequence
b'STTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNRQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurexin-2-beta
publication title Splice Form Dependence of beta-Neurexin/Neuroligin Binding Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 38
structure length 189
sequence length 205
ec nomenclature
pdb deposition date 2010-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mw3A00
3WNXA 3H0OA 1O4YA 2ZGMA 4YG0A 4Q27A 2VY0A 2D3RA 1V6MA 1A3KA 1Q8SA 1JBCA 4BQ1A 3VV1A 1V6IA 1GYKA 2D3SA 4YFZA 1MS4A 2JE9A 1LTEA 1DYPA 4WV8A 2NP0A 4YG3A 4C1XA 3USUB 1AX2A 3FBYA 1WBLA 1YIFA 5DXDA 1MZ6A 3AYDA 3AYEA 4YW3A 1LGCA 1FV2A 1HQWA 2Q5TA 2ZGUA 1BJQA 4Y1VA 2R1DA 2OUJA 3O5SA 3POYA 1N47A 4PBPA 1WLCA 4AVVA 1U0AA 1XQNA 1TEIA 1DQ0A 3V0AA 4YZ2A 3WDYA 2YZ4A 5JOWA 3M3CA 1SLAA 4FOVA 3ZPYA 2CY6A 5GZEA 2YXSA 2NM1A 2OUHA 1S0FA 5GZFA 3N7MA 2R1BA 1F9KA 1ULFA 2ARXA 2AUYA 5EWSA 5IUQA 3D4KA 2AH2A 3N35A 1MS8A 2GNTA 2PHUA 5KXDA 2DUQA 1N3OA 2D6OX 2YV8A 2VW1A 1LGNA 5IK4A 3AP9A 2ERFA 2C9AA 4TZDA 5GLTA 4DQAA 3AZWA 4R9AA 2UURA 1Q8PA 1DZQA 1MS1A 3AX4A 4JRAA 3AYCA 2D6LX 2GDFA 2ZGNA 1QMJA 3INAA 1MR5A 1LOBA 4M3CA 4DRRA 5GLVA 4YLZA 4GA9A 4AYUA 4PQ9A 3PVNA 1APNA 5H9QA 1DQ1A 5CBLA 3WHTA 4PF5A 1YYNA 2BQPA 1G9DA 4LBKA 3NWKA 1SCSA 5L73A 1LU1A 1BYHA 5CB7A 4LBOA 1LULA 2WQZC 4FPKA 2WSUA 1DQ4A 2ZAAA 2AGSA 5HCAA 3LCPA 1LHOA 2VH9A 2WT0A 3IM0A 3PVOA 1N1TA 3OYWB 3ZXEA 5DZEA 4AGVA 1IS3A 2I2SA 1W6PA 4FPLA 4HL0A 4PBOA 1G9AA 5JOXA 1VIWB 2ZGTA 1IKPA 4Y1YA 1FYUA 4FOYA 4FPYA 3AYAA 1QNWA 1LHNA 1WW5A 1LECA 4GWMA 3WDTA 3DGTA 4XZPA 4YZ5A 3ZYRA 3QLQA 4RA0A 5T52A 3WCRA 1S0GA 3BODA 2ZMNA 2FMDA 5CAZA 2D44A 1KRIA 2D6KA 3ILNA 3D5OA 4BMEA 1WW4A 2WT2A 1LENA 4Y1ZA 3O0WA 4UW6A 5HCFA 3UJOA 1J1TA 4P14A 4AGRA 3NV4A 2PELA 2NN8A 1ULCA 3M3OA 3AK0A 1IS6A 1JUIA 1PZ7A 2HYKA 3FUQA 4AVTA 2FHRA 3QCWA 3CNAA 5T5PA 1Q56A 1IS4A 2SLIA 3N7KA 1Z78A 3R4UA 3ZSJA 3JU9A 1CPNA 4LBMA 4R9CA 1SBEA 1JYCA 4ATFA 4FVVA 3SITA 4MYEA 3SNMA 1V00A 3T1MA 1LHVA 1LOAA 1N3PA 1X50A 1S0EA 5SV8A 2DTWA 4KBBA 2JKBA 3RSJA 4CRQA 2R49A 2SBAA 1Y7BA 2EIGA 1D2SA 4K1ZA 3WDUA 1WW7A 2DYCA 4Q8LA 5JLVA 2AR6A 2OVUA 2ZKNA 3AZYA 4CTEA 2H0BA 4NO4A 3UJQA 3OBRA 1O4ZA 4FPCA 3WG1A 3O0XA 5AVAA 2VU9A 1MS0A 3AZVA 5DZFA 3V0BB 4Q1RA 2P3IA 4LBQB 1WD3A 2WSVA 3I8TA 1DQ5A 2D43A 2EF6A 3Q9OA 4FPEA 2D3PA 3AJYA 2NZ9A 3MW4A 2A6VA 1IKQA 2P2KA 1RIRA 1DLLA 4Y20A 1ENRA 4OZXA 4XILA 5EYYA 4AVSA 4DS0A 4ZXKA 2ZHNA 4M3CF 2WJSA 2ZMKA 1LJ7A 1QU0A 1GLHA 2A71A 2AENA 4YW4A 1UPSA 5GM0A 4FQZA 5GZGA 1C1LA 3SH3A 1GZCA 4AGGA 1AX1A 3D6EA 1G8WA 2CL2A 1LESA 1WLWA 3SH4A 1GNZA 5EXOA 2EXHA 3PMEA 3O12A 5GZDA 1W6NB 1ENSA 1W6MB 2A6WA 3OY8B 1I1EA 2R0FA 1S0BA 3WCSA 3ZXFA 1G9CA 3V0BA 3KQRA 3LSEA 1V6OA 1NLSA 1N1VA 1RITA 1ENQA 3BTAA 2WT1A 1YO8A 1LOCA 4HANA 4P9XA 1GZ9A 1VAVA 4LBQD 4Q26A 1H9PA 2ZHMA 2WLQA 4FOWA 5EYXA 1QOOA 3WG3A 4K21A 4Z8BA 1I3HA 2A6YA 5IK5A 3WG2A 2P3JA 1OKQA 1LODA 2ZHLA 1UAIA 2ZABA 3ZXKA 2P34A 1YI7A 2W39A 4XJ8A 5F5QA 2ZBJA 4R9DA 5T54A 3USUA 4CZSA 3N36A 5FREA 1C1FA 3M2MA 4ISQA 4YW1A 2CYFA 1N3QA 1W6NA 1W6MA 2DTYA 2OW4A 3OY8A 4YGBA 5H9RA 2ENRA 1ONAA 1DFQA 4WZFA 5HCBA 1GICA 2VW0A 1JW6A 1LOEA 2E51A 2DWRA 1CESA 5T5LA 4YZ4A 2ZGOA 4D69A 3AP4A 5E89A 3GNEA 1LGBA 1QGLA 3RRDA 3ZSKA 3WUCA 4ISRA 1FV3A 2GN7A 4Y1UA 3ENRA 1WCSA 2WNEA 5FRAA 3RS6A 3TB0A 3AZXA 3ATGA 1UL9A 5CNAA 2CTVA 1AXZA 4Y24A 1AX0A 5F9TA 1JXNA 1PZ8A 1UZZA 5T5JA 1YXWA 4XTPA 2ZGPA 1QNYA 3IPVB 4XBQA 1H30A 1QDCA 1QKQA 2NMNA 3POWA 3WDXA 4XYXA 1CJPA 5DG1A 4U36A 2AREA 1SACA 1W6OB 1Q8OA 1MS3A 2PHTA 2JECA 4M00A 4XBNA 4FOQA 3WZ1A 1KJRA 1AJKA 2VUAA 3MEPA 5DZGA 1CONA 4YG6A 3R4SA 2V5YA 2E7QA 2UWCA 4F83A 1Q8VA 3OBTA 4GXLA 3DUIA 1CQ9A 2PHFA 3VKLA 2LTNA 1A8DA 2GMEA 3W59A 3O0VA 4YM0A 3OYWA 1V6JA 4BPZA 1LOFA 2UWAA 1SFYA 4BMBA 2TEPA 2EXJA 5E8AA 1IS5A 2LALA 3IPVA 2ARBA 2D6MA 1LU2A 4W65A 3C2UA 2ZMLA 3APBA 4XMAA 3VKOA 1S1AA 2W52A 3PVEA 2DUOA 4ZKTB 2Z42A 1LEDA 2DVGA 5JOZA 3FLPA 3AXDA 3OPZA 2ZGKA 2A7AA 2ZA9A 2EAKA 4XMIA 5JOYA 1LOGA 4FPJA 1HDKA 2A70A 1S0CA 3KM5A 1AXKA 1WUVA 3FLTA 2VXRA 4JCKA 1W0OA 1G9FA 1UZYA 3N3HA 1SBFA 2A6XA 3B01A 3NV1A 4Q2FA 2UWBA 1BZWA 1RINA 2DVBA 1LCLA 1PZ9A 2B7YA 1CR7A 1DQ6A 4Y1XA 3OJBA 1D0HA 2A3YA 5GZCA 1Z0HA 1WD4A 3AXEA 3R05A 1DHKB 2NYYA 2DU0A 2YMZA 2NMOA 2XG3A 5GLUA 2E53A 2PHWA 3V65A 1KDMA 2E7TA 3B69A 3RQ0A 2CWSA 2DV9A 3UL2A 3ZVXA 4IQPA 1CN1A 2D6NA 4DPNA 3RMXA 3A0KA 4JC1A 2VW2A 2C5DA 1JN2P 1F5FA 1S0IA 1MS9A 1DQ2A 4FPGA 4UW5A 5KXBA 3IKWA 4P9YA 1G9BA 4NOTA 1C57A 1URXA 4FP3A 4UW4A 1GKBA 4YZ3A 3I4IA 3AFKA 4P9WA 3AZZA 1SLCA 1IOAA 3WDVA 3AP6A 3GALA 1S0DA 5DUXA 1DYKA 5BYNA 4K1YA 5JMCA 3A0NA 2ZGQA 3ASIA 4SLIA 1JOJA 1BQPA 4LBQA 4XDQA 3V0AB 2DUPA 1HKDA 2GALA 2GNDA 5GLZA 2EXKA 3FUOA 1SLLA 3RMYA 4I30A 3ZYPA 2RHPA 5IK7A 3IMNA 5T50A 4BLIA 2DU1A 3WLUA 4XOGA 1UN1A 4XJUA 1ULDA 2DURA 2EALA 3ZXLA 2PHXA 3MW3A 1AF9A 4XHXA 1KJLA 5KXCA 2A5ZA 2GMMA 1AXYA 2CWMA 3VUOA 2ZGSA 1KITA 1DBNA 1KDKA 1AVBA 1AZDA 4M01A 1WLDA 2GNBA 4ATEA 1V6KA 2G4IA 3TAYA 5DUWA 1GZWB 5JDBA 2JE7A 1Q8QA 4M3CB 1MVQA 5T5OA 4YM3A 2A75A 4LBNA 1WW6A 1BXHA 3BIWE 2E6VA 4R9BA 2DVDA 1OQ1A 3M3EA 2JD4A 4XJWA 3VKFC 3IN9A 3WV6A 2GMPA 2JDZA 1DGLA 1ULEA 4TYSA 4YW5A 4YZ1A 3FLRA 3T1LA 4FPOB 4M3CE 2GNMA 4BM8A 1JYIA 1W6PB 4XXAA 3POSA 4PCRA 4DRVA 3AP7A 5GJ6A 1A78A 2D6PA 4DFSA 4K20A 1GZWA 2UU8A 3ZXJA 3VKNA 5DUUA 5H9SA 3SLIA 1KQRA 3WHUA 4C1WA 4GKXA 4WVVA 3LSDA 4UW3A 4BOWA 1JHNA 1GANA 1VALA 1GBGA 2ZGLA 3A4UA 3AP5A 4YGCA 2JJ6A 5DUVA 5GLWA 2PHRA 1YRZA 5KXEA 2V73A 1LHUA 1MVEA 3ILRA 5DG2A 1MACA 2W68A 2GN3A 2ZHKA 4XIOA 3T2TA 4XIKA 4FPHA 4Y22B 2ZACA 4AWDA 1CVNA 3B9CA 1S0JA 4BLJA 2R16A 1V6LA 4U2AA 4YM2A 3SH5A 4Q1PA 1W6QB 3NV2A 3U4XA 2P37A 1GNHA 3W58A 4XHBA 4XJAA 4Q8KA 1HQLA 2XB6C 3FFZA 3M3QA 4XTMA 5T55A 2W08A 1GV9A 1UKGA 4XE9A 1W6OA 1FNYA 1LEMA 3L2YA 4XJ9A 1G86A 1FNZA 1HLCA 5H9PA 1MZ5A 3B00A 1MS5A 2DVAA 2ZZJA 4GALA 4LBLA 2EXIA 1N1SA 2KM2A 5IK8A 1W0PA 3B3QE 3AJZA 1OFSA 2D7FA 3PJQA 1LOFC 2YY1A 1LHWA 4XXPA 3V64A 4FQ4A 3JUUA 1AJOA 1NXD1 1VLNA 4YGDA 2ZGRA 1QOTA 4YM1A 4YW2A 4Y22A 1ULGA 2R0HA 1V6NA 3SISA 5JVVA 1G7YA 1SLTA 4H55A 1SLBA 4XJZA 2WKKA 3HN1A 4YGEA 5CA6A 1W6QA 3WOGA 2AYHA 3RG0A 1DIWA 3OGGA 3M1HA 1R1ZA 1QF3A 2P3KA 3N7LA 4Y26A 1GSLA 1WBFA 4ASMB 1FATA 1QDOA 1CPMA 1UMZA 3NV3A 3ILFA 3VKMA 1ZA4A 1N1YA 3HMYA 4FP2A 4L8QA 1FX5A 1QOSA 2CNAA 3MW2A 4Y20B 1EPWA 4RL7A 3ZSMA 4GKYA 1H9WA 1F31A 4FPFA 2A3WA 1UX6A 3N7JA 3WDWA 4LBJA 1C4RA 4GWNA 1CIWA 3ZSLA 1BKZA 1ZM1A 4YFWA 3WVJA 2DVFA 4XBLA 3MPPG 3UK9A 2YROA 5E88A 1SLIA 3HR9A 5IT6A 1SBDA 1VAMA 1B09A 4WVWA 2ES3A 3WG4A 1SCRA 2A3XA 2A6ZA 5GALA 5LK5A 3BOPA 1FAYA 3WUDA 4ITCA
chains in the Genus database with same CATH superfamily
3WNXA 2ZGMA 4CSWA 1T6BX 1RUH1 4NPMA 4Q27A 4RSUA 2H6BA 4XFFA 3D0JA 5FP9A 2D3RA 4PLNA 4BQ1A 3U14A 3VV1A 1JHJA 2C9KA 2JG9A 1MS4A 5LA1A 1LTEA 1DYPA 4RYDA 1X36A 4WV8A 4TSVA 4YG3A 2C0ZA 2J1TA 4EQVA 4GWIA 1JS9A 4ZZ5A 2K9ZA 3KCXA 3HAGA 4DUVA 4QAWA 1OD3A 1UY1A 4XUNA 4S2DA 3MIHA 3VD5A 5J1XA 3SKJE 1GWLA 1CAWA 3PU3A 3POYA 3NAPA 3ZXGA 3EMRA 1L7QA 3ZYGA 3E5UA 3SXWA 5FO8B 1US3A 5FY0A 4AL9A 2JDMA 3PIGA 2QZ2A 3MFAA 1COV3 3CDZB 3MI8A 4OFGA 1FMD1 3T08A 5DDJ2 2VR4A 1SLAA 3M3CA 3ZPYA 5A3PA 3WF3A 2BRTA 5GZEA 4LT5A 2NM1A 4AQSA 1B35B 2JDHA 3SC7X 1F9KA 2RR11 2ARXA 4IGQA 3NRUA 2HKXA 5EWSA 3N35A 2BERA 3WP3A 3T30A 2YV8A 5IVVA 1W8TA 1U5ZA 2VW1A 3NVCA 3MV01 4AFDA 1O3SA 5IAVA 1RMU3 4TZDA 2YC2A 5BNNA 3RJRA 4R9AA 2VECA 4JGZC 3RZHA 1Q8PA 1WA4A 3AX4A 1UY2A 2D6LX 4E9KA 3K4DA 1J3PA 2LROA 4WVZA 1AR63 4YLZA 2RJLA 4GA9A 2XL9A 1R083 1K45A 1W99A 4XFAA 2LUWA 3ZN4A 4ZY9A 1NE4A 1SPPA 5LEKA 1JYXA 1PO12 1W06A 4PQQA 3WHTA 5EHDA 3LB9A 4ORFA 1C8M2 4CCOA 1AL23 4Y5SA 2IXJA 2ZOEB 4COUA 4LBKA 1CX4A 1SCSA 3U4SA 1BYHA 4LBOA 1UU4A 2PYTA 4L11A 1GMMA 2AGSA 5HCHA 2WT0A 3IM0A 1N1TA 5DZEA 1XXNA 3VL9A 1IS3A 2I2SA 1R1A1 5G05L 2AEYA 1AYN1 1G9AA 2EAAA 4OI0A 4PI2A 2Q30A 3W9AA 2XVGA 4FOYA 4FPYA 1NCRA 1LHNA 1WW5A 1WLTA 5FQ0B 2GC2A 3WDTA 3LA3A 4LO8A 4YVSA 5A3TA 3ZYRA 1UF2C 3QLQA 4ARYA 2D98A 4RA0A 3S30A 2GSYA 5F6KA 1EAH3 2YC0A 4E2GA 3D5OA 3UKTA 1BLZA 1MQTC 2WNVB 4KWUA 4GQ7A 1LENA 1CAUA 3LDRA 4E8CA 1AR81 4NAMA 4UW6A 4QDQA 4OI4A 5BNPB 3L9JT 3AC0A 5IVBA 4HVRA 2BPA2 2G1MA 1STMA 4I0WB 3PTRB 3K51A 3PHMA 3FUQA 3MIFA 4AVTA 1O3QA 4GZ9A 3RJ2X 3CNAA 4BQ2A 3HWJA 5FPVA 4XUPA 3NQHA 2KD7A 3BTXA 2WFF1 4LBMA 2JDYA 4CU9A 1JYCA 3GZAA 1HXS1 2UY9A 2OZJA 4MYEA 4AFCA 2OYZA 1UX7A 1IQAA 1RUC3 2XJVA 2WL1A 3U75A 5A1AA 2JDAA 4YSFA 4KBBA 3PURA 4QHBA 3VDAA 2ZEZA 2R49A 1EP0A 2WZEA 2EIGA 1D2SA 3ZLIA 2K0GA 2XDVA 5JLVA 3MLJA 2AR6A 2VZVA 1ZBA2 1EY2A 2IXLA 2ZKNA 3ZYJB 1CAVB 1BMV2 4NO4A 3UJQA 4KI5M 3RZMA 4L97A 2P1BA 3WG1A 2HWE3 2X53S 4Z1VA 5FZGA 1ULPA 3DCQA 3WQ1A 5A6ZA 4Q1RA 1OC1A 3DV8A 3DKWA 1WD3A 2WNVC 2WSVA 1KEXA 3NSTA 3I8TA 3UYJA 1YCIA 1OF3A 2EF6A 3GHNA 4FPEA 3Q9OA 4LORA 1PNFA 2D3PA 3AJYA 2G9ZA 3MW4A 1PGL1 2P2KA 5IFTA 3WF4A 4Q29A 1ND2A 5EYYA 5KHHA 1IPSA 4DS0A 5F1RA 1PK6A 2ZHNA 5DN2A 4M3CF 3I3QA 2ZS6B 2A71A 2AENA 3FMGA 4W4ZA 4YW4A 5A33B 1UPSA 1C1LA 2R041 3VD4A 1UD1A 5J48A 1G8WA 5IWFA 1PO21 2CL2A 1LESA 2OS2A 4W6XA 4Y3OA 4AEDB 1CAXB 4OHVA 1R092 3RWKX 4X6RB 1QJY1 1Y9MA 3IB3A 3AL6A 5GZDA 1W6NB 1ENSA 4GAZA 2FDKA 1WKYA 3IMMA 1S0BA 5DAXA 3WCSA 3V0BA 3OCPA 3TOJA 3E97A 1YQ5A 2EIDA 3CIHA 5JR2A 4LXLA 1YO8A 3K75B 2O1QA 4HANA 1VAVA 4NHMA 4DB5A 2Y6LA 4HXCA 1Z7S1 1H9PA 2OQ6A 1EV12 2WLQA 4FOWA 1YLLA 5ACA2 3E6BA 2VOVA 3EJKA 1GOHA 5SV5A 3VGIA 4YRDA 2XLAA 3SKVA 1OKQA 2ZHLA 4CZSA 3UNPA 4R9DA 1RUE2 3CMGA 3K4AA 4OQ9A 1C1FA 4YW1A 1VBE1 1QJX2 2FDFA 4NIDA 5H9RA 4DNYA 4D8MA 1ONAA 4N90A 2J1VA 4DOUA 4IE6A 1W9YA 4MXWB 4AI0A 2VW0A 4UT5A 5C4WA 3WXPA 2FQPA 5FZ9A 2DWRA 4AZZA 2VM9A 3OPTA 5FLIA 3B5LB 5T5LA 2WO3A 2ZGOA 5FZCA 3WF0A 2ORZA 4QQ2A 4AI2A 2HWF2 4NRPA 5BNNC 1DDLA 4ISRA 3Q8BA 5FUPA 3RS6A 1WCSA 4UFJA 1J3QA 5A32A 3ATGA 3J7MA 3TEWA 4QB1A 1TMF1 5JI9A 2CTVA 2WS91 4HMZA 4UXAA 3K48A 2R30A 4AHZA 1S2KA 5DDJ3 4B1MA 4IEUA 1QNYA 5JUVA 1QKQA 2NMNA 2QZ3A 2WN3A 1F35A 2ZAHA 3MDPA 1SACA 4CCLA 4IE4A 3I2KA 4JKMA 4IEPA 5CKQA 4XBNA 2QQJA 4CEWA 3CKHA 3OF1A 1H8TB 2YBSA 5DZGA 2R071 1ACCA 4FO9A 1CONA 3OOXA 2FZ1A 3KT4A 4YG6A 5E6HA 5BXXA 4MGTA 3B02A 4IXLA 5LW9A 2RDNA 3OBTA 2HJIA 2G19A 3QOPA 4LR4A 3VKLA 5L7OA 1W8UA 1JZ2A 3IDAA 4CE8A 3I49A 3JCIA 3RZGA 4BPZA 4YVSC 2CAVA 3OYWA 2UWAA 1H4HA 3LEGA 3AKSA 4LUMA 1PO13 5AVPA 3T2QA 4IEOA 2HWB2 5FYZA 1C8M3 2LALA 2QKDA 3IPVA 4E4DX 4K6BA 2ARBA 3PUQA 4JVAA 1AYM2 4IUGA 4LA3A 3TRSB 3ZN6B 4Q4W2 1NX9A 4BQ4A 5C8CB 2VO5A 2RVAA 3QACA 3TNQA 2QE3A 1S1AA 1M4WA 1XOYA 3MF6A 3PVEA 5D2AA 1HJFA 1QXJA 5A3UA 1LEDA 3J7HA 4QX7A 3DPRA 1TE1B 3OPZA 1UXZA 4FPJA 1HDKA 4QPWA 2J1RA 5FLJA 4MG2A 2VXRA 2FDHA 3J7NA 4JCKA 1G9FA 1UZYA 3HD8B 1SBFA 4LK7A 4W6WA 3THPA 5FCCA 4A41A 2LW8A 4LUKA 2B7YA 1DU3D 2CDPA 2EA7A 3OJBA 5CFDB 4UF0B 4F7ZA 5GZCA 5AC92 5BNOC 1WD4A 3AXEA 3FC0A 5KHJA 1Q3EA 1TVGA 1NY72 2NYYA 3KVAA 3QH6A 4IE0A 2YMZA 2NMOA 4YW7A 5GLUA 4Z82A 3IBMA 1HV1A 2DV9A 2RJ2A 4LO7A 2GC3A 3U10A 5FXZA 4JC1A 1UNBA 2VW2A 1VBA1 1JN2P 4PIZA 2V4AA 1MS9A 2YPJA 4QGMA 1AR72 4UW5A 5KXBA 5EQUA 4A3ZA 2FCTA 4JQTA 3IKWA 1O8SA 3Q8EA 3EHKA 1RUI3 4AHYA 1RUF2 5K4LA 1QH7A 4Q0SA 3VDDB 4BK4A 3VLBB 1URXA 2B45X 4EN9B 3FBMA 1QJX1 2VZTA 3I4IA 5CYYA 2WAAA 1GUIA 1SLCA 1IOAA 1IQDC 2GAUA 4NVPA 3WDVA 3WW2A 5CADA 3GALA 4BJ0A 4K40A 2VTFA 3BTZA 4N53A 4K1YA 3PL0A 4D7YA 4OHYA 4AVBA 3BIEA 4IEWA 1JOJA 1BQPA 4LBQA 1RYYA 3V0AB 1HKDA 3FHAA 3H8RA 5DQ0A 2JIGA 2IXHA 3HN3A 1ZBA3 2ADDA 1SLLA 5HI0A 4IV1A 3RMYA 4GMP3 3GYDA 2DU1A 5FV3A 1VRH1 4MADA 4XOGA 1F5JA 3WLUA 1ULDA 2PAMA 3HJRA 4EWDA 2EALA 4N43B 2J22A 2MEV1 1AF9A 1KJLA 5FWEA 2CWMA 3HT1A 4C91A 1OLRA 4KMQA 4NMIA 2PLV2 4ASLA 3MF9A 2IVIB 1PVXA 2VNRA 2WLPA 3RVHA 4XURA 1F4AA 3WEZA 3HQRA 1GZWB 3ZFFB 3ST7A 2VXJA 5T5OA 3EB7A 2J7MA 4M3CB 4LBNA 1WMEA 1RUD2 5FY5A 3BIWE 4D94A 2E6VA 3IZOA 5A7SA 4COVA 1HJGA 2WDBA 4EZ4A 2JD4A 1R093 3VHOA 5K8SA 5FYHA 1HB3A 3VKFC 4QPGA 3IN9A 4BK5A 4Q0PA 3ON7A 3C8XA 2QCSB 2VG9A 4J6GA 2J42A 1OLMA 2F4LA 1QJU2 4P02B 3MBWA 4D6SA 3KQ4B 4XXAA 3POSA 4PCRA 3BI3A 1XNAA 3PIJA 1ZRCA 3I2IA 1UYXA 4JZRA 5C7GA 1A78A 1EV13 5ACA3 4AEJA 1K42A 2E9QA 2VQAA 2VZQA 3R0RA 5F2WA 3WSOA 3CO2A 1W04A 4QHZA 1OMIA 3H3UA 3LSDA 4UW3A 4WM7B 5EJ3A 5DUVA 5FXXA 2AEZA 2ZGLA 3A4UA 5FKCA 5FY4A 4AG4A 5IVEA 1RUE3 2NLRA 4CCCA 5KXEA 1LHUA 2DFBA 2X10A 3CJIC 3H1MA 3AMHA 4M0NA 4AK3A 1MACA 2W68A 1CD3G 3HNMA 1EPZA 1LRHA 4AI3A 3POJA 3ZFFC 3NMBA 4RHV2 1CVNA 2Q4SA 4LNVA 2R16A 3I59A 4U2AA 1IPJA 5EPAA 5F6LB 1JODA 3K77A 4GD4A 2QQKA 1WMXA 1FOD2 4NROA 1XYOA 1W6QB 1NA1B 2GH8A 3NV2A 5FZKA 3VZMA 4CEWC 2HWF3 2ZTNA 2VMEA 4XHBA 2BNMA 4WM8C 1HQLA 5DAWA 4DEVA 1UOBA 1NCQB 4FXKB 3OB8A 4IV3A 4I09A 4LK6A 5C6CA 1ULOA 2BP6A 2VVEA 2W08A 2HEYF 4G3YC 1CGPA 1FNYA 3B9IA 5FMDA 5K0UA 3ACGA 3HIFA 3L2YA 4XJ9A 1FNZA 1QXRA 1HLCA 5JR7B 1MZ5A 3VHRA 5A1LA 5I0SA 3VD9A 1RJ7A 2VCBA 4LBLA 4XCBA 1ZREA 5F2SA 5JAXA 3B3QE 3V64A 3JD71 3PJQA 2YY1A 4XXPA 1DZRA 3CZJA 2WQ4A 1AJOA 3JUUA 5AFEA 4YW2A 2PHLA 3FZ3A 4Y22A 3SISA 1ODNA 2XWJB 3KCCA 2WYFA 2Y34A 4WVMA 5A7WB 2BJSA 3LZZA 4Q4V1 3VZKA 1SLBA 1JYVA 3HN1A 1L7LA 5FZ6A 1NLQA 1TNRA 3P5BA 3KV9A 5ABJA 5EIYB 1H2MA 2P3KA 3DPRC 3WF2A 2D40A 1UMZA 2BNNA 5CU1A 1OA4A 3LGRA 1QOSA 2RS12 3E5XA 2XL7A 1POV1 4QQLA 1ND3A 3ZFGB 3W20A 1BBT1 4FPFA 2HWB3 3N7JA 4GB32 3BKZA 3UESA 2YG0A 3LKJA 4LBJA 1C4RA 1LB2A 4E8DA 4NN0A 1CIWA 1AYM3 2HWD2 2OA2A 4JRLA 3SCGA 4Q4W3 1JTZX 3ZSLA 4DUXA 4C0HA 1HRI2 2E33A 2BV4A 1ZVFA 3Q8FA 1ZX5A 2BVBA 1W2AX 2DBNA 5F5CA 3O1SA 1K5MB 1PMJX 4JX0A 4WVWA 5C8WA 5IFPA 2VQ0A 2RS52 3A21A 4IE5A 5FXWA 3BOPA 4MO3M 4OULA 3B7MA 4JV4A 3LFMA 2TNFA 4YG0A 1JU4A 4XAAA 2W95A 5LEJA 1UZVA 3AKTA 1U5YA 4NHYA 1A3KA 4XQ4A 4BDVB 1YEWA 1GYKA 2D3SA 3LWCA 1BEV2 1REDA 5AC93 3NNJA 1O3TA 1FPN1 2NP0A 3AVRA 4D3WA 2BDRA 5JWPA 3FBYA 4HSJA 5LCWL 1RHI3 1YIFA 4I01A 5JZGA 3IWZA 5DXDA 1MZ6A 3AYDA 4YW3A 1AR92 2ZGUA 4CUAA 4IW3A 4CA9A 1BVVA 3U07A 2R1DA 1AR73 2BOJA 1N47A 4PBPA 4PLMA 5A7OA 4AVVA 3MLKA 3PJYA 1U0AA 2WNUB 1TEIA 1RUF3 4QT6A 3BTYA 5KWRA 2VOKA 5FZDA 2YZ4A 4FOVA 4LTAA 2CY6A 2YXSA 3I7DA 1OBNA 4LO5B 4IGPA 2OUHA 1RUH2 5BNQA 4YVWB 2QQPA 1ULFA 5KHIA 4CXXA 4FSJA 2BU9A 2PHDA 4HN0A 3PNAA 1OH3A 2VOTA 4PT6A 1BCXA 1TZOA 2DUQA 4JTOA 5IK4A 2W91A 5JMOA 4CP2A 2HWC3 3BUCA 4LITA 2VVDA 4D0QA 4DQAA 2CGPA 2X5IC 2WIIB 1ZZ7A 1KS4A 4JRAA 3H9AA 1NKGA 5F8PA 4YARA 2GDFA 3SEEA 1ZA7A 3INAA 1DZTA 1MR5A 2Y26A 4DXTA 1LOBA 2CHHA 5IYYA 4W50A 5GLVA 4PQ9A 3PVNA 3ZYIB 4CDXB 5J09A 5FZ8A 3VZJA 2PLV3 4PF5A 1YYNA 2XUEA 4JTNA 1W0NA 2BQPA 1B35A 3KB5A 5FPLA 4TLGA 1G9DA 3NWKA 2VBBA 2VZ1A 3KD4A 3ZDVA 1FMD2 3RNSA 2DBIA 3I54A 3OGVA 2WSUA 2B46X 1RUD3 2RR12 5JXGA 2RM23 2BWCA 4QPIB 3ZOIA 1W6PA 4FPLA 4HL0A 1JU3A 1TME3 1WA6X 3GBWA 2WZPP 1I9RA 3B94A 1MQTA 3Q8AA 4MGKE 4Z92B 1IKPA 4Y1YA 5IVCA 3POFA 1YFXA 3ALQA 1LECA 5FZOB 4XZPA 5JCTA 1ALYA 5FJHA 1QJU3 5T52A 1S0GA 3RI9A 5CAZA 3OPWA 2RV9A 4P9JA 1KRIA 2WNOA 3ILNA 4WBBA 4LKDA 1WW4A 2WT2A 4CCNA 3PUHA 4ZONA 4AQ2A 1HB2A 3OSDA 3H3ZA 4AGRA 5G04L 4AAPA 3NO8A 2PELA 3OUHA 1ULCA 3M3OA 5FYTA 5F7UA 3AFGA 3URFA 3PDQA 4OUEA 1JUIA 1PZ7A 3VBFC 1Q56A 2A1XA 1IS4A 2SLIA 3N7KA 1Z78A 2XVKA 3O14A 2P6HA 1H0BA 1CPNA 1VMHA 4R9CA 1R1A2 1SBEA 2QQLA 1AYN2 4FVVA 2WQ8A 4JHZA 4ATFA 1O4TA 3SNMA 2ZEYA 3I3BA 4RHV3 3LOBA 3DF0A 3OBZA 4NIHA 2N7GA 1FOD3 2VMIA 1VJ2A 4DEQA 4NPLA 2ZX4A 4CRQA 2DF7A 3GZUC 2WNVA 3P1IA 1WW7A 4W6YA 3N9LA 5ABJC 4LHKA 3DN7A 2H0BA 4QXKA 1OVPA 4Q4X1 5LRSA 4KWKA 5A3OA 4EN8B 2Y6KA 5J36A 2W46A 1UO9A 2VUCA 3ACHA 3O1PA 3LDBA 4F8AA 1ND3C 3VBSB 4PHZA 5DZFA 4CDWC 1V9U1 4XAEA 3PUSA 2WO7A 4JGYB 3KF3A 3KVBA 2D43A 3BCWA 2WFF2 2A6VA 1JZ6A 1UIKA 4Y20A 3AMQA 1HXS2 1ENRA 1H1AA 1UU5A 2W94A 4OQ8A 2WWSA 4RGKA 4AVSA 2F4PA 2FDIA 1R64A 2WJSA 2ZMKA 2W87A 1QU0A 1MEC3 5GM0A 1VBB1 4E27A 5JPNB 1NAEA 3G7DA 1AX1A 3D0SA 3ZPOA 3MPBA 3LFIA 2RS13 2EXHA 3POIA 3OBAA 3ZKUA 4NWVA 2PAKA 1I6XA 1WCQA 3O12A 4FAGA 1W39A 3OY8B 1OH4A 4UI9L 2R0FA 3BPSA 3A22A 4XACA 1Q43A 4GB33 3RGBA 5D21A 2K46A 1H6XA 2GC0A 2D5FA 4RQPB 3ZXAC 2HWD3 4AE2A 5FZLA 3DYOA 1HRI3 4P9XA 1GZ9A 1H4GA 2GP5A 4LBQD 2ZJCA 1UW8A 2ZHMA 5KR7A 3IIIA 5JZGC 3WQBA 1DF0A 2VQTA 4AEMA 2RS53 5L9VA 2A6YA 4Q0UA 1PGL2 1DLCA 4GULA 4FTSA 3WG2A 2Y6JA 3PU8A 5FTTC 5A33A 1US2A 5FPBA 1POV0 2ZABA 2P34A 3USUA 5T54A 2LS6A 2XKPA 4AEDA 1CAXA 4LOTA 4XQWA 4ISQA 2CYFA 3L2HA 1W6NA 2R042 2DTYA 1C28A 3ZO0B 3MGUA 3TN91 3WNNA 4AGVA 1PO22 4B7KA 2Q8OA 1BEV3 3HPNA 5T3NA 1OPOA 5FR3A 1L3JA 5JIUA 1QJY2 4D6RA 1JW6A 4BA6A 4CDQB 1RUG1 2GH2A 5J7MA 4YWAA 4O61A 3AP4A 3MUY1 4RS5B 3GNEA 3S5QA 3TNPB 1LGBA 1RB8G 1RC6A 3J4UH 1AR93 4AI8A 4Y1UA 1Z7S2 2WNEA 3THCA 3GXUA 5FY1A 3UGFA 1PX4A 2RG4A 2W1UA 4P5HA 4COWA 2W9XA 1RVF1 1UXXX 3R6SA 3FFQA 1JXNA 1PZ8A 1UZZA 2ET7A 1YXWA 4QGLA 5T5JA 3ZFEB 1QY4A 4KQ7A 2IXKA 3I3EA 4FAHA 1JYWA 4Y5TA 1RUH3 3WDXA 5FP7A 4MXWA 2HWE1 4XYXA 1VBE2 2UYAA 1B35C 5F3CA 2I45A 1W6OB 1ZRDA 3M8LA 3DL3A 1OT5A 2XLGA 4FOQA 3WZ1A 1KJRA 5EFUA 5FKBA 3H8UA 4QXHA 4URTA 4HK9A 3BU0A 3R4SA 2E7QA 2O8QA 3DUIA 1CQ9A 1UZ0A 1YFUA 3U1XA 3KHCA 4CDQC 4MH0E 1H2LA 2VBPA 1J84A 4YM0A 5FK7A 4Z2AA 3O1VA 1DGRN 3AL5A 3BB6A 1IS5A 1TMF2 2WS92 3PUAA 1OI6A 4R52A 4CXWA 3C2UA 3ZIXA 1FMD3 3F2ZA 4DXRA 1HRV2 1PMHX 4HPKB 3ZYBA 1F15A 3LD8A 1W03A 2DUOA 2RR13 2VOXA 2ZCWA 3BPZA 4UFLA 2DVGA 4BWOA 2VL4A 3FLPA 4W8JA 5BNOA 4EWAA 2ZGKA 2ZA9A 5JOZA 2EAKA 4BQ3A 5JOYA 3I2DA 4NRQA 4AVCA 5FMOS 2A70A 3C3VA 3KM5A 3KV5A 3VHPA 1AXKA 1WUVA 2AACA 2R072 3VL8A 1W2OA 1HN1A 1W0OA 4PDWB 5LRRA 3VBRB 3H42B 1LAJA 1RINA 1LCLA 1CR7A 1XE8A 4Y1XA 3VHNA 2E63A 3JQWA 1JUHA 1NQDA 3R4DB 2VPVA 1SZBA 3OUJA 4UFMA 1YWKA 1DHKB 1DP0A 5A3NA 2DU0A 2JENA 4KWLA 4XF1A 1Y4WA 2E53A 1KDMA 1PX3A 2E7TA 5C8CA 3J8F1 1UWWA 4XPVA 1GR3A 2CWSA 2I07B 5B4XA 4HETA 2CV6A 4IQPA 5I0TA 3SCHA 5HXMA 2GC1A 3KT1A 2Z79A 3A0KA 1DYOA 2JG9B 4LE4A 5BNPC 1OUXA 1F5FA 4DUWA 2WN2A 5JIAA 1CZTA 3RFRA 2BGOA 2EIBA 1NXMA 1G9BA 1R1A3 1AYN3 4Y33A 3SEPA 5CEHA 2VNOA 2DCZA 3U37A 1ZZCA 4MX3A 4HOOA 4KL1A 4A44A 1D0GA 1YI9A 3AFKA 1C8NA 1S55A 2XBO1 3AZZA 1W8HA 4UFIA 2OZ6A 5AFBA 3AP6A 4MVTA 2IFRA 2ZGQA 3OTFA 4SLIA 4TN7A 3THDA 2H0VA 1V70A 4C0BA 3HQUA 3RYRA 5IATA 1A34A 1A8MA 2EXKA 2XONA 4I30A 2RHPA 1AR83 1OHFA 4OYUA 3OEAA 2QDRA 5T50A 3K3NA 1OUSA 1O5LA 1UN1A 4AR2A 4XF0A 3LPFA 4ZZ8A 3ZXLA 1ASJ2 1VBA2 3P3PA 3IDEA 1L7RA 5KXCA 2GMMA 2WZR2 2BW8A 4CU7A 2RS31 1XNTA 4IGOA 2KR2A 1K3IA 2WFF3 4NJ4A 1ZZ6A 1XSRA 5DPNA 4QM8A 1HXS3 3AKPA 3FHIB 4L9BA 4ONUA 4ATEA 2JE7A 1Q8QA 3T4HB 1VB2A 2A75A 4XF3A 2R061 5CG9A 1UMIA 1BXHA 1SPPB 1CWPA 5GKAC 5ISLA 4R9BA 4C90A 4O65A 3WF1A 4XJWA 4KH9A 4AEDC 2JD9A 4MGSA 4QDRA 2XJTA 3H1WA 4IERA 3OGSA 3WW3A 5ANNA 3IDCB 2GP3A 4A4AA 1VRH2 2J1AA 5B2GB 4LKFA 2GNMA 4CCKA 3O1MA 4BM8A 1YUDA 2MEV2 3UETA 3W5NA 3CJIA 1UU6A 3AP7A 5GJ6A 4COYA 5FWJA 5FYUA 2C1FA 2MNGA 1HRV1 1NCRB 1GZWA 1H2KA 1YFYA 2OIIA 1HB1A 2UU8A 3ZFFA 4N7IA 3ZXJA 3RI8A 2YUEA 1ODMA 3SLIA 1KQRA 2VUDA 4FTBA 4P5YA 4BOWA 4K9SA 2FD8A 1GANA 1XJAA 1WCKA 3AP5A 5A3LA 4XUTA 2PHRA 1UCXA 2E26A 1MVEA 5M0TA 3CU7A 3VDCA 4WM8A 1LKNA 3ILRA 2R043 1ST8A 2VOWA 4LLOA 1PO23 3H50A 2ZHKA 4XIOA 3T2TA 1H1IA 4RGAA 3S0MA 1QJY3 3B9CA 3FN9A 4BLJA 1J59A 1V6LA 2Q1ZB 3MO4A 4Q1PA 1K12A 1IG3A 1GNHA 2JG8B 2VZUA 1VAKA 4XJAA 3D3AA 4Q8KA 2XB6C 3M3QA 1Z7S3 4K8FA 1GV9A 4XE9A 1PHMA 2YFUA 4WM7A 3QD6A 5J98B 2BYVE 5H9PA 1MS5A 5FLHA 3VDBA 2EXIA 1N1SA 2KM2A 5F3GA 1GU3A 3RZLA 4Z07A 5FMOL 1NXD1 2XJPA 1QOTA 2ZGRA 4UFHA 4UYBA 3USSA 4ES9A 1VBE3 4XFGA 2XLFA 1W6QA 1NA1A 2W1WA 3EXUA 3I97A 5LK7B 3NJYA 1SG3A 1DIWA 2Y6FA 3UV9A 1H8TC 1R1ZA 2W3JA 4IEYA 4ZS2A 1WBFA 1NCQA 1FATA 2ATFA 4Y4RA 4MV2A 5JSPA 1N1YA 3HMYA 4L8QA 3MW2A 4ZPIA 4E4HA 4I0AA 5HV0A 1ND2B 1H9WA 4BYYA 3HBZA 1PK6B 1ASJ1 4V2VA 2WZR1 2A3WA 4HG6B 1TMF3 4A7ZA 2WS93 1UQXA 4Y5Z0 2LM3A 2VVFA 2WR9A 4GWNA 5BPXA 1JZ8A 5A7WA 4YFWA 3JD72 3W5MA 2P4EA 5FYMA 2ZEWA 1QJZA 2Y33A 5E88A 4P9IA 1SLIA 5C8CC 3RZZA 3I2FA 5IT6A 1SBDA 1B09A 4OCTA 4OZOA 5C3SA 2ES3A 5F32A 2A6ZA 2BOIA 4KU7A 4Q4V2 3VBOB 3WG4A 1FAYA 2VCMA 1CX1A 4ITCA 4CCDA 2G9FA 1NZIA 4A6OA 1MZFA 2R073 3H0OA 4BIOA 2Q8CA 1F2NA 2BBAA 4HONA 3LOIA 2PTMA 2VY0A 1SMVA 4QX0A 3KWVA 1DCSA 1QEXA 1MPXA 1V6MA 2QTWB 2WO2A 5JXIA 4XFBA 1REEA 4KGQA 4Q0VA 4TXWA 4HN1A 5CFDC 4CCEA 1QQP1 3AM2A 5LASA 5A3MA 5FP4A 5JPMB 4TWTA 4C1XA 2DCJA 3GDBA 1BBT2 4XFIA 1AX2A 3AKQA 4EWEA 4QB6A 2JIJA 3S57A 3C7HA 1K5MA 3AYEA 3FHQA 1LGCA 1FV2A 1HQWA 3JXSA 3LEMA 2Q5TA 2GU9A 3N9MA 3GF6A 5FZHA 3IIAA 2OUJA 1IGOA 2ARAA 2B39A 4I2OA 3GGLA 1XQNA 1DQ0A 3A7QA 2VMDA 4QHOA 3VDDC 2X5IA 3WDYA 3PLQA 2WRAA 4LO4B 3N9PA 4RD7A 1S0FA 4B29A 3I3MA 5FMBA 2R1BA 2AUYA 2WA4A 2E31A 4MUVA 5IUQA 3D4KA 1WCDJ 3MIGA 2XQRA 4Q4Y1 3DECA 1GOGA 1MS8A 2GNTA 4IEZA 3OD4A 4XFCA 1N3OA 1LGNA 1FPN2 3AP9A 1VBD1 3CLPA 5D1IA 5L9RA 3AZWA 4QB2A 4YYOA 2PXJA 1DZQA 4JKKA 2E32A 1MS1A 3AYCA 5J96B 3TBDA 1QMJA 3LA2A 3H7JA 3C7EA 1U5IA 4DRRA 4B3NA 4N43C 2WNUA 1VBA3 3RPQA 4BCUA 1ZBE1 2JDNA 2VQUA 2XR4A 1ZNPA 5H9QA 4Y4YA 1DQ1A 3JQXA 5CBLA 3T0DA 4QKFA 4DZGA 4IESA 4UBHA 1HX6A 3ZDSA 5KHGA 4QX2A 1JYNA 4LLFA 2XHKA 4YVWA 2NPIA 1QJX3 1LU1A 1O5UA 1W8FA 1ZRIA 5L7OB 1LULA 1DQ4A 2ZAAA 3HOBA 5HCAA 3HVDA 3OEBA 2VH9A 3PVOA 3ZXEA 1DGWA 3OYWB 1O6UA 3M3IA 1RUOA 4M4PA 1VRBA 1VIWB 1PVC2 2HBTA 2ZGTA 1FYUA 3Q8CA 1OSGA 4PIYA 4AQTA 3AYAA 5F39A 4GWMA 3ZYFA 2Q8EA 3DGTA 2O14A 3BALA 4YZ5A 2JDKA 1VRH3 3SCFA 4AHXA 2C4XA 1NYWA 3BODA 2XWBB 1O59A 2FMDA 2D44A 2MEV3 3E1F1 5CVRA 2D6KA 1RUJ1 3GJAA 2B8MA 2XMLA 5J37A 5FY8A 1W90A 1RUNA 3O0WA 5EP9A 5HCFA 3UJOA 1J1TA 2R6QA 5FZ3A 4IL7A 2NN8A 5FPUA 4EYUA 4ZS3A 4QPIA 4FI9A 1IS6A 2HYKA 4WM7C 4IEXA 2FHRA 4L0PA 2K2SA 1UY3A 4MLOA 5D8AB 2B9VA 5FZMA 2QQMA 5I91A 4CU6A 2BGCA 1W9SA 2ET1A 3SITA 1Y43B 1X8EA 1YIPA 1E5RA 2BWAA 3DYPA 3T0AA 1VBC1 5LB6A 4RR3B 5CZKA 1D4M1 2ZEXA 1X50A 3FL7A 1LNSA 1S0EA 3WNLA 2XPJA 4NR1A 4CDWA 3RSJA 1NA1C 2VAUA 1Y7BA 2CU5A 4K1ZA 5FYIA 3WDUA 2DYCA 4Q8LA 2OXBA 1WMFA 4LHLA 1YJKA 1NCQC 3AZYA 2O8OA 4CTEA 3AMNA 4LHNA 1W8WA 4I3PA 4EV0A 5FYYA 3O1RA 3HEIA 3FX3A 1O4ZA 4FPCA 4N53B 3J9SA 4QU1A 1GP4A 1GQPA 4BH9A 2QQUA 3AZVA 5C3RA 2P3IA 4LBQB 3MFCA 2XKOA 1SDDB 4LHSA 4BE3A 1DQ5A 4CEYB 2W0XA 3U0ZA 2NZ9A 1W8OA 5FZ1A 1YQ6A 4AW7A 1RIRA 2W1SA 5JSOA 2QUOA 4OZXA 4XILA 3LAGA 3WP5A 4ZXKA 2RDSA 2FBEA 4OHXA 4P08A 3S7EA 5IAXA 4NUBA 1FI2A 1LJ7A 3QBQA 5D8AC 1KXGA 3ZM8A 5FZIA 5C5TA 4FQZA 5GZGA 3VN4A 1UOGA 1RJ8A 1WLWA 3M7AA 1GNZA 3D82A 3KHBA 2YFZA 5EXOA 3VD7A 4RR3C 3WX5A 1W6MB 2A6WA 2WC2A 4KWJA 3VBSA 3ZXFA 4CDUB 1G9CA 3LPGA 1TME1 4Q4X2 3ZFGC 4KG0A 1HV0A 1V6OA 4JGYA 5HXVA 1NLSA 2UYBA 4FCAA 4YPJA 3BTAA 3OGRA 5FP3A 1GQGA 1LOCA 3JD73 4RGGA 3WNMA 1V9U2 3JZVA 4Q26A 2YU1A 1KFXL 4Z2WA 5EYXA 2WFPA 1BK1A 1H2NA 4K21A 4Z8BA 1K5MC 1IHMA 4Q4V3 5FFOC 5A7NA 3U78A 1R082 3NNMA 4QQOA 3EYPA 1LODA 5CKMA 4KNCA 2FZ2A 1ZYBA 5F5QA 1PVC1 2YGLA 3N36A 3T3YA 1PIV1 5FREA 2Y8KA 5C9AB 3OGJA 1OXCA 3HNYM 1QIQA 1UOFA 1VBB2 1Y9QA 4IEVA 4GJZA 2OW4A 1VMFA 3OY8A 2ETEA 4YGBA 5I0RA 4WZFA 5F3IA 3VBHB 5FYCA 2L9LA 2X29A 2WUHA 3ITQA 5FPAA 1G6NA 2XOMA 3SMHA 1POV3 4RQPA 2E51A 5LBFA 2RMU1 3NNLA 1OVSA 1BBT3 2I74A 2TBVA 4E2QA 1PMIA 2FCVA 3ACIA 3H1YA 4PI0A 3IAQA 4D69A 2CAUA 3N9NA 5JXJA 4OVEA 1QGLA 1BK0A 2IFWA 3I2GA 4BXFA 3MIDA 2WAOA 3S7IA 1W9FA 4GJYA 5J3UA 2QQVA 1MZEA 2GN7A 3ENRA 5FRAA 3TB0A 5ERLA 2VZPA 4XDPA 1UYPA 2EIEA 2KA3A 1JH5A 4Y24A 1AXZA 4NIAA 4E4SA 2Q1FA 1AX0A 1FT9A 2WNUC 2Y0OA 2Y60A 4MGYE 1OPMA 3ZIWA 5F9TA 5BY5A 3O1UA 1QHDA 3JBG1 4JDMA 2Y0IA 4N7UA 2ZGPA 1QDCA 4IV3B 3POWA 1SFNA 5FY9A 4U36A 5FZAA 4YVWC 1Q8OA 3KSCA 4CDQA 3VBOC 5K0UB 1MS3A 2OT7A 2PHTA 3TN92 2JECA 3NKGA 4CPBA 5A80A 3WQ0A 4EZHA 1E5SA 1FPN3 1AJKA 1UY0A 3MIBA 1RUG2 1OOPB 4M4RA 4BQXA 2V5DA 3UGGA 2UWCA 2C24A 4F83A 3MIEA 4GXLA 1VP6A 2PHFA 4WVMB 4CP1A 4N9HA 2JB4A 2LTNA 1SFPA 2GMEA 1YNAA 2XQXA 1V6JA 1RTVA 3I3DA 4CDXC 1SFYA 4BMBA 3ZFEA 5FO7B 2EXJA 3N9QA 5E8AA 1RVF2 4COZA 3VBUB 5CFCB 1XPWA 5FBJA 2IXCA 3N9OA 4W65A 1LU2A 4CCMA 1XNDA 5FQ0A 2ZMLA 1T6GC 3APBA 3K46A 4ZU5A 4CVUA 4DFSA 3HNBM 4BISA 1D2QA 4CYDA 2W52A 4A6SA 4ET7A 2HWE2 3FWEA 3P3NA 4ZKTB 3RZJA 4QPIC 1LOGA 4JDOA 1COV1 4RN5A 1WCUA 4AOCA 1W2TA 4CU8A 2VULA 3N3HA 3AKRA 4Q2FA 1JZ4A 3B01A 2UWBA 3RYKA 3GHMA 1PZ9A 1A6CA 1XC6A 3ZSEA 2QQWA 5BNPA 2F6BA 3POBA 1OD5A 3ZYHA 5JXHA 2W2IA 3F95A 1OOPC 1RMU1 3T09A 3MV11 1CIYA 1Q5OA 2XG3A 4N9IA 2Q8DA 1NE6A 3V65A 4HPKA 5I0UA 5K7PA 3RQ0A 1TNFA 3K2OA 4EN7B 3RYPA 3WR0A 2WINB 4H14A 1AR61 3WW4A 2DCYA 3IT8A 2C5DA 4CP0A 5C3PA 1R081 3O1OA 1J1LA 1S0IA 1HQNA 2JEMA 1DQ2A 4FPGA 4XFHA 1JZ5A 3ELNA 3O1TA 4QPYA 5FP8A 1S4CA 4JAAA 4NIIA 3VBUC 4H7LA 5CFCC 3THTA 1AL21 4NOTA 1C57A 4FP3A 4MGZE 3C7FA 1TG7A 5B4NA 2WWJA 1CAVA 2EICA 4A7KA 1OKOA 1S0DA 5DUXA 1DYKA 5BYNA 5JMCA 2PFWA 2VGDA 1UY4A 1X33A 4NHXA 4E4ZA 2DUPA 5FZ7A 2GALA 5GLZA 4JGZB 3FUOA 4FFGA 1REFA 4A42A 2XJSA 2W47A 3ETQA 3IMNA 3TEXA 3J8F2 4XDOA 5A3WA 5KC5A 3CBNA 1S2EA 5LBCA 2DURA 4I3GA 2PHXA 2XH6A 4XHXA 3VBSC 3KT7A 1EAH1 1AXYA 1YQ8A 4J1WA 4AFBA 3VUOA 2W1QA 2YB7A 2O0OA 2YHJA 4JGYC 1JZ3A 1DBNA 1Y9GA 1AVBA 4M01A 1WLDA 1RL3A 5L36A 2X8KA 3SHRA 1V6KA 5LATA 5IW0A 5L9BA 4H7MA 5E1RA 1MVQA 2XBO2 3WNOA 1D7PM 3ORJA 4AFAA 4X8PA 2XXZA 5FUNA 3KF5A 1OLME 3M70A 1OQ1A 4K8RB 4P9GA 3U11A 4DY5A 5BUVA 1POQA 2GMPA 2JDZA 4GH4B 1RUC1 4D7SA 3E6CC 5TSWA 1XB9A 4Q4X3 3UT0A 1H6YA 2CGNA 4TYSA 3FLRA 4MZUA 4YW5A 4YZ1A 5IVJA 4FPOB 1LR5A 2XJUA 3X29B 2QFEA 1WWYA 4BU2A 4RQPC 1JYIA 1W6PB 4IEQA 1AHSA 1W28A 1V9U3 1MQTB 3N4MA 2D6PA 2RS32 2WA3A 5FY7A 3OG2A 4K20A 2LRPA 2HEWF 2TUNA 3VKNA 4AAXA 3MICA 5DUUA 3WHUA 1VMJA 4C1WA 1DGRA 4GKXA 4XVHA 4DXZA 1GBGA 1U12A 2B4KA 4YGCA 5GLWA 2JJ6A 5FDBA 5A6QA 1YRZA 3ECQA 2R062 4OHWA 3WNPA 1VBB3 2VD7A 2OPKA 2GN3A 2GZWA 4LKEA 5APAA 5FAXA 4QGNA 1Y3TA 4URAA 1PGW1 4XIKA 1JI6A 4FPHA 2ZACA 4YNIA 3UKVA 2W92A 3ZN5A 1IZ3A 4LIVA 2HLEA 4YM2A 4OHZA 4HZFA 3U4XA 2P37A 3W58A 2Z4FA 4RS5C 5F5AA 4R4XA 4XTMA 3CZUA 1HIXA 4GH4C 5T55A 2VZSA 3BU7A 1WMDA 3ACLA 1G86A 3B00A 3LQCA 2DVAA 4GALA 4HKWA 1H8TA 1W0PA 3ROUA 4AVAA 3GCWA 5JI7A 3AJZA 1OFSA 3NW4A 1E57A 4CP9B 3ZFEC 3OD0A 5A6YA 1VLNA 3DXUA 5LA0A 4H3WA 1ULGA 2R0HA 5LBBA 1PGSA 3TN93 1SLTA 4H55A 5FZFA 2WKKA 5FYVA 3LF7A 4XUOA 3BGAA 3ZR6A 2JG8A 1RUG3 3RG0A 3M1HA 4FFIA 1RUI2 3ZX7A 4Y26A 5KBFA 2JB8A 4IETA 1QDOA 4MHUA 3ZN6A 3NV3A 3ILFA 4KGGA 1ZZBA 1ZA4A 3HQXA 1FX5A 1W3XA 4Y20B 5A70A 5LY1A 5FOBB 4RL7A 1KFUL 4AI1A 4KG8A 4MGIE 4BB3A 3CHXA 1RVF3 4D6QA 4NRMA 4B4PA 3H8OA 3EO6A 1XNKA 1S2BA 1XE0A 2VMHA 1W2UA 1QH6A 1BKZA 1ZM1A 2QBXA 4DIQA 1XNCA 3WVJA 2DVFA 5C5UA 4FFHA 4XBLA 3LEIA 2Q0AA 2YROA 1KD7A 2Y38A 4QD2A 4XF9A 5CFDA 4UF0A 2A3XA 1ZRFA 4R4ZA 1VE0A 2VMGA 1CAWB 1VR3A 2P5BA 3NAPB 5FYSA 2AC1A 5DDJ1 2WYSA 4QWNA 1O4YA 4I02A 1K5JA 3H3LA 5A1FA 4PDWC 3VBRC 4KU8A 4QU2A 1Q8SA 3S6PA 1JBCA 2Z69A 2P17A 3CL1A 1V6IA 3KMHA 4ZU4A 4QKBA 4YFZA 3E5QA 1X9TA 2JE9A 3AVSA 4K3UA 3TWIA 1O8PA 2YC4A 4EROA 1BHGA 5EV7A 3USUB 3FJSA 4CCJA 3VDDA 3ETPA 3FE5A 1WBLA 2BEOA 2CSGA 2RE9A 3NKTA 5BNNB 5JSRA 1C5HA 2OQ7A 3VBOA 3CF6E 1BJQA 2JG9C 4Y1VA 3O5SA 2ILMA 3DYMA 4HT1T 4LO6B 2BFUS 1PO11 1WLCA 1XU1A 5CG8A 1C8M1 1WGPA 4V2WA 3TEZA 2ADEA 2X05A 3V0AA 1CZSA 4SBVA 4YZ2A 4LKSA 5JOWA 2F17A 1EUTA 1YHFA 3MZHA 5GZFA 3VZNA 3N7MA 1GNYA 4S2FA 1UKRA 4DXSA 4N43A 2AH2A 3NAPC 2PHUA 5KXDA 5I0DA 2D6OX 4O7XA 4EJRA 2ERFA 1QQP2 4J1XA 4EN0A 2C9AA 5GLTA 2UURA 5C33A 2C6SA 4HBNA 3TYJA 4XC9A 3J8F3 2ZGNA 5K9YA 3T2OA 3K4ZA 4M3CA 1QWRA 4PIXA 4YVSB 4IE7A 4AYUA 2BGPA 2Z5WA 1CZVA 1APNA 5HPOA 1UYZA 4L99A 3WD5A 5I8SA 2QQNA 4DO0A 3POEA 4MXVA 5L73A 5CB7A 1CAUB 2VZRA 1DGWX 2XBO3 2WQZC 4FPKA 4WZCA 1XU2A 3LCPA 1LHOA 1ENXA 2C26A 5F37A 1M06G 1O7FA 1OA3A 5LZ6A 1HN0A 4G4FA 1QJEA 1RUI1 2IUWA 4M0HA 4Q4Y2 2HH9A 1X9PA 4PBOA 5JOXA 3KS7A 2ZX0A 4YW6A 3PVBB 2OPWA 3NL1A 1VBD2 1KS5A 1QNWA 1PM7A 2PMWB 3ACFA 3KCYA 4FT8A 3IDBB 1C5IA 2J1UA 3WCRA 5BNOB 3EBRA 5EJZB 2ZMNA 4NAOA 4ASKA 2VMCA 2FDGA 4NPRA 1X82A 2VNGA 4CPBD 1ZBE2 2QQOA 4NE9A 1OLQA 1ZBA1 2JICA 2RS33 4BMEA 1BMV1 2B9UA 4Y1ZA 5FXVA 4GMP1 3MUZ1 1NCRC 2FMYA 4LEJA 4P14A 1NOVA 3NV4A 4GIQA 4X6QB 2VZ3A 5FK8A 3AK0A 3DEMA 2CDOA 3ZKYA 4AEKA 2YYOA 3DXTA 1J58A 3QCWA 5T5PA 3WP4A 2R063 3R4UA 3ZSJA 4AXOA 5C70A 3JU9A 2X09A 4QKNA 2YGMA 2JE8A 3T4VA 3DKQA 1QJFA 4EN6B 1WZXA 1V00A 3UKNA 3T1MA 1GWMA 1LHVA 1XSQA 1O3RA 1LOAA 1N3PA 2QNKA 2RJKA 4AF9A 5SV8A 2B5HA 2DTWA 4BQYA 4JQRA 1SQ4A 2JKBA 1SHWB 3KZ4C 2SBAA 1I5PA 2FCUA 2JG8C 3WQ7A 1R091 2XJQA 1RUJ2 2OVUA 2R7EB 1AL0G 1HRV3 5CIRA 4F3JA 1U5XA 4DINB 1YJLA 3H7YA 3OBRA 5DAQA 4L2NA 3O0XA 5AVAA 2VU9A 1MS0A 3EQEA 2VUJA 5D8AA 1YQ2A 4G9SB 4UOJA 3V0BB 5F5IA 4JHTA 5FZEA 1EV11 1RHI2 2P3YA 2W5FA 5ACA1 3GM8A 2WWUA 4ES8A 1IKQA 4RR3A 1DLLA 3ZFGA 1VBC2 2IVJA 1RUE1 4C8DA 3P6BA 2HYXA 1D4M2 1GLHA 2DCKA 2ZX2A 3ABZA 4XZUG 1KGYA 1V0AA 3POGA 4AGGA 3SH3A 1GZCA 3D6EA 2PN5A 2WZ8A 3SH4A 3PMEA 1EYBA 5DABA 4ZHNA 2MPFA 4LA2A 1I1EA 1ND2C 3RDIA 3WY6A 2BFUL 1PK6C 3KQRA 3LSEA 1P8JA 2XGXA 4Q5OA 5C4WB 1N1VA 1RITA 2HWF1 5A7QA 1ENQA 2HWC2 4CEYA 1H1MA 2WT1A 3KLSA 3GBFA 5FZBA 1DG6A 3RZKA 5KHKA 4TTGA 1UPIA 4R8HA 1QOOA 1E5IA 3WG3A 2HEVF 1I3HA 5IK5A 2ZX3A 3WP6A 3V56A 4D7TA 4DY3A 2P3JA 2XHNA 2BUKA 1GQHA 5A32B 1UAIA 3MYXA 3ZXKA 2AZ5A 1YI7A 2W39A 4XJ8A 5C3OA 2ZBJA 1O91A 3CJIB 3NNFA 1OURA 3M2MA 4UWDA 1PNGA 1GFF2 1N3QA 5IJRA 1W6MA 3VD3A 3B93A 5HCBA 3JB4C 2ENRA 4AFMA 1DFQA 4BHPA 4CDUA 2RDRA 5FPZA 1GICA 4I0BA 3VBFA 1LOEA 2IZWA 2J1EA 4QX5A 2Y64A 2RM22 1ASJ3 3C7OA 4FXGB 1CESA 1TME2 2D5HA 2RDQA 2VZOA 2WZR3 4YZ4A 4ARXA 5E89A 4CEWB 4WM8B 5BV6A 1GP6A 4UFKA 2NQYA 3ES1A 4LMFA 3RRDA 2ZKLA 1UOJA 3PMSA 3ZSKA 4BQ5A 3WINE 1EUUA 3WUCA 1FV3A 2PQQA 4BXSV 2OX0A 3AZXA 5I8TA 1UL9A 2VNVA 1F4HA 2HWB1 2DDUA 2WABA 2VCCA 3GJBA 5CNAA 5C4WC 1XYPA 5C9AA 1AYM1 4META 4A7YA 1JYTA 4Q4W1 4XTPA 5LA9A 4XBQA 3IPVB 3VBHA 1H30A 4HVQA 1PIV2 3CQOA 5L19A 1CJPA 3J26N 5DG1A 2AREA 4ZXEA 4DMIA 5FOJB 5A7PA 4M00A 1T2XA 3ZR5A 4CDXA 1NQJA 1QQP3 2VUAA 3MEPA 4XEZA 2VBDA 3DPRB 3T0BA 5DAPA 2RMU2 1AUYA 2V5YA 4BZ4A 4JKLA 4X8NA 5LA2A 1Q8VA 3HT2A 4OUMA 3BOWA 2QDNA 4FTEA 4GWJA 2KXLA 5LWBA 1A8DA 1JOPA 5AC91 5LY2A 4QX3A 3W59A 3M4FA 4IDZA 1NY71 3WNKA 5I8YA 3O0VA 2BTVC 1LOFA 4OMCA 1JOBA 2TEPA 3O7OA 3T2PA 4CUGA 1H8VA 4XQDA 1RHI1 5FO9B 3KV6A 5HV4A 5IVFA 3ES4A 4EE2A 2VTXA 2D6MA 4HFSA 3NNGA 3LIHA 1XNBA 3JBG2 4A45A 5FZOA 1JMUB 2B42B 4NWWA 4XMAA 3VKOA 1AR71 1RXGA 5L7OC 5FZ4A 4QQHA 2ORXA 3S5AA 2Z42A 3JB8A 1VB4A 4Q4Y3 5FMCA 1RUF1 3AXDA 1OOPA 3NJZA 2A7AA 4LOSA 4XMIA 4ZU7A 5FZ0A 3IAPA 4S2GA 1VBD3 1S0CA 3FLTA 3NV1A 1XE7A 2A6XA 4LJHA 4QMAA 2DCTA 2VJXA 1BZWA 2DVBA 1J3RA 2P6CA 4CUCA 1DQ6A 1VPHA 4QKDA 1J83A 2BZDA 1D0HA 1OF4A 2A3YA 2PAEA 3PUIA 1Z0HA 2H6CA 5FIXA 3R05A 2JDPA 3VBUA 5CFCA 1ZBE3 2HWC1 1MEC2 2JDUA 3AB0A 4K7JA 4O9GA 1FXZA 4E2SA 2PHWA 4BQWA 3B69A 1IPKA 2PQSA 1X8MA 3QH7A 3UL2A 3ZVXA 1CN1A 2D6NA 4DPNA 2YDEA 3RMXA 4IV1B 2IWGB 2MHFA 4OMDA 1NUKA 2PLV1 2BNOA 1F8VA 4P9YA 2IXIA 2DFCA 1ZZ9A 2ZX1A 4UBGA 2OKXA 5CISA 1W05A 4UW4A 1GKBA 4YZ3A 1COV2 3H8XA 1IG0A 2Q1MA 3KGLA 3LA7A 3MLLA 1GWKA 4P9WA 4LQRA 2JX9A 2D93A 4GMP0 1GOFA 5EZWA 1RUD1 2UY8A 2RM21 4XCAA 3A0NA 3ASIA 3CEWA 4MGQA 4XDQA 2ZZQA 2GNDA 3BN6A 1RMU2 2V4VA 1RUJ3 2X5IB 2JKXA 2YU2A 3CJXA 3MHZA 4HK8A 4O9EA 4TLFA 3VZLA 3ZYPA 1X7NA 2J1SA 5IK7A 2CGOA 4BLIA 1NG0A 4AQ6A 4QPGB 1QJU1 3BVCA 3GZEA 4XJUA 5IVYA 1JZ7A 1TQ5A 3MW3A 4N53C 1AR62 4B1LA 3VB9A 2A5ZA 4CXYA 2PA7A 2ZXQA 5E16A 5KC6A 5ANQA 2IC1A 4INDA 2ZGSA 1KITA 4XUQA 1KDKA 3A23A 2VTXJ 3NJXA 5DAVA 4CEYC 1AL22 1AZDA 4LULA 5HBAA 4MHRA 4IV1C 2GNBA 1W9WA 2G4IA 4OLLA 3TAYA 5DUWA 4NIGA 1VBC3 5JDBA 1BVP1 1QXPA 4HLTA 1NLRA 4YM3A 1D4M3 4PF1A 4RFRB 3J7LA 3ZXDA 4Q0QA 1C3HA 1UMHA 1W8ZA 1WW6A 2XUMA 4JGZA 2QJVA 2BBVA 1PM4A 3AMMA 2DVDA 4JDNA 3M3EA 1W8NA 4RHV1 2G9GA 2WBKA 2VMFA 2ARCA 2E7AA 1XRUA 1XYNA 3WV6A 1RGSA 2JXAA 1DGLA 4B7EA 1FOD1 1GP5A 1ULEA 2VCAA 1OQEA 2YBPA 3I2JA 4HKLA 4NHLA 3T1LA 4CDUC 4M3CE 3I59B 2VC9A 2QQIA 4QDSA 1RXFA 4BIFA 4RFT0 5IHRA 4QX1A 1EAH2 1HB4A 2FDJA 4OUSA 4DRVA 5I93A 2A73B 1D4VB 3KV4A 4H2AA 4L92A 3WW1A 1XBFA 4QPGC 4QQPA 3LDKA 2VE1A 3C7GA 5F3EA 5FJKA 5H9SA 3I2OA 2YBKA 3K3OA 4WVVA 4B8EA 1JHNA 1VALA 4HSLA 3VBFB 4UAPA 4XW3A 5LBEA 2Z2SB 1YQCA 2V73A 4RS5A 5FPXA 3E6DA 3UGHA 5C9AC 5DG2A 4GH4A 2Y6HA 4AHWA 3NJVA 1NZCA 3OUIA 2V09A 4LIUA 3BYWA 3LEKA 4Y22B 3VBHC 4XF4A 4AWDA 1S0JA 4A3XA 4XABA 1RUC2 4V1PA 2EVXA 2HBUA 3SH5A 1MEC1 3GZTB 2YPDA 2QVSB 5DMYA 4XETA 4FBFA 5CKNA 5ABJB 2RS11 2D97A 3FFZA 3KGZA 2XVLA 1SEFA 4B4RA 1E5HA 1UKGA 2ID4A 1W6OA 4OI2A 1W3VA 1LEMA 2Y6GA 3G6JB 2WO1A 4GB31 1GZTA 3LIGA 1ND3B 2ZZJA 5IK8A 4MOAA 3TEYA 2HWD1 4CDWB 4FFFA 5C71A 2D7FA 2XJRA 1HRI1 1LOFC 4S2HA 1LHWA 3LE0A 1PVC3 4FQ4A 4NHKA 1CJDA 4PLOA 5FBZA 3SQOA 1PIV3 4YGDA 4AI9A 4YM1A 4B4QA 2R32A 4IV3C 1V6NA 3VZOA 3ME2A 3W21A 2RS51 3PTYA 4QXCA 4QX8A 5FUIA 5JVVA 1G7YA 2ZPXA 4XJZA 4CUBA 3I2HA 5K0UC 3HBKA 1NT0A 1PGW2 4YGEA 3WOGA 1ZRRA 4LE3A 3GBGA 2BVVA 5CA6A 2AYHA 2RMU3 3OGGA 1QF3A 1UZWA 3N7LA 4N8MA 4P00B 1GSLA 4HVOA 4MSVA 3RWNA 4QXBA 3ZMOA 4ASMB 1CPMA 5A6XA 1UIJA 3VKMA 1YC61 4J25A 1BEV1 1W9TA 2V72A 4FP2A 4PJYA 2CNAA 3GCXA 5EJ1B 1OQDA 1W2NA 4OI1A 1EPWA 3WT3A 3ZSMA 4GKYA 1YFWA 1OFNA 1F31A 3D8CA 1ZZ8A 3WDWA 1UX6A 4CP9A 3AMPA 4PDWA 3VBRA 1AR91 1OA2A 3JBG3 1UYYA 4KBZA 3MPPG 1AR82 3UK9A 4QM9A 5JZGB 3ZMNA 3HR9A 1I5ZA 1VAMA 4LPLA 4P9LA 1SCRA 5GALA 5C3QA 4A2UA 5LK5A 1HW5A 1SDWA 3WUDA 2JWPA 5FYBA 4HKOA
chains in the Genus database with same CATH topology
3WNXA 2ZGMA 4RSUA 1RUH1 4Q27A 4XFFA 2H6BA 3D0JA 2D3RA 4PLNA 4BQ1A 3VV1A 2JG9A 1MS4A 1LTEA 1DYPA 4WV8A 1X36A 4TSVA 4YG3A 2C0ZA 2K9ZA 3KCXA 3HAGA 4S2DA 3MIHA 3ZXGA 1CAWA 3ZYGA 3POYA 3NAPA 3E5UA 3SXWA 5FO8B 2QZ2A 3MFAA 1COV3 3MI8A 4OFGA 1FMD1 5DDJ2 3M3CA 1SLAA 3ZPYA 4LT5A 5GZEA 2NM1A 4AQSA 1B35B 1F9KA 2RR11 2ARXA 5EWSA 2HKXA 3N35A 3WP3A 2YV8A 2VW1A 1U5ZA 3NVCA 4AFDA 1O3SA 1RMU3 4TZDA 5BNNA 3RJRA 4R9AA 2VECA 4JGZC 1Q8PA 1WA4A 3AX4A 2D6LX 4E9KA 1J3PA 4WVZA 1AR63 4YLZA 2RJLA 4GA9A 2XL9A 1R083 4XFAA 2LUWA 3ZN4A 1NE4A 5LEKA 1PO12 3WHTA 3LB9A 4ORFA 1C8M2 1AL23 2IXJA 2ZOEB 4COUA 4LBKA 1CX4A 1SCSA 1BYHA 4LBOA 1UU4A 2PYTA 4L11A 2AGSA 2WT0A 3IM0A 1N1TA 5DZEA 1XXNA 3VL9A 1IS3A 2I2SA 1R1A1 1AYN1 1G9AA 2EAAA 4OI0A 2Q30A 3W9AA 2XVGA 4FOYA 4FPYA 1NCRA 1LHNA 1WW5A 1WLTA 5FQ0B 2GC2A 3WDTA 3LA3A 4LO8A 4YVSA 3ZYRA 1UF2C 3QLQA 2D98A 4RA0A 3S30A 2GSYA 5F6KA 1EAH3 2YC0A 4E2GA 3D5OA 3UKTA 1MQTC 2WNVB 4GQ7A 1LENA 1CAUA 1AR81 4UW6A 4OI4A 5BNPB 3L9JT 4HVRA 2BPA2 4I0WB 3K51A 3PHMA 3FUQA 3MIFA 4AVTA 1O3QA 3RJ2X 3CNAA 3HWJA 2WFF1 4LBMA 1JYCA 3GZAA 1HXS1 2UY9A 2OZJA 4MYEA 2OYZA 1IQAA 1RUC3 2XJVA 2WL1A 4YSFA 4KBBA 4QHBA 2R49A 1EP0A 2EIGA 1D2SA 2K0GA 5JLVA 3MLJA 2AR6A 1ZBA2 1EY2A 2IXLA 2ZKNA 3ZYJB 1CAVB 1BMV2 4NO4A 3UJQA 4L97A 3WG1A 2HWE3 2X53S 4Z1VA 3WQ1A 4Q1RA 3DV8A 3DKWA 1WD3A 2WNVC 2WSVA 3NSTA 3I8TA 1YCIA 2EF6A 3GHNA 4FPEA 3Q9OA 1PNFA 2D3PA 3AJYA 3MW4A 1PGL1 2P2KA 4Q29A 1ND2A 5EYYA 5KHHA 4DS0A 1PK6A 2ZHNA 4M3CF 2ZS6B 2A71A 2AENA 3FMGA 4YW4A 5A33B 1UPSA 1C1LA 2R041 1UD1A 5J48A 1G8WA 1PO21 2CL2A 1LESA 4W6XA 4AEDB 1CAXB 4OHVA 1R092 4X6RB 1QJY1 5GZDA 1W6NB 1ENSA 3WCSA 1S0BA 3V0BA 3OCPA 3TOJA 3E97A 1YO8A 4DB5A 2O1QA 4HANA 1VAVA 4NHMA 1Z7S1 1H9PA 1EV12 2WLQA 4FOWA 1YLLA 5ACA2 3E6BA 2VOVA 3EJKA 5SV5A 3VGIA 4YRDA 2XLAA 1OKQA 2ZHLA 4CZSA 4R9DA 1RUE2 1C1FA 4YW1A 1VBE1 1QJX2 5H9RA 4DNYA 1ONAA 4N90A 4DOUA 4MXWB 4AI0A 2VW0A 5C4WA 3WXPA 2FQPA 2DWRA 5FLIA 3B5LB 5T5LA 2ZGOA 4QQ2A 4AI2A 2HWF2 5BNNC 1DDLA 4ISRA 3RS6A 1WCSA 1J3QA 5A32A 3ATGA 1TMF1 5JI9A 2CTVA 2WS91 4HMZA 4UXAA 3K48A 2R30A 4AHZA 1S2KA 5DDJ3 4IEUA 1QNYA 1QKQA 2NMNA 2QZ3A 2ZAHA 3MDPA 1SACA 4IEPA 4XBNA 4CEWA 3OF1A 1H8TB 5DZGA 2R071 4FO9A 1CONA 4YG6A 2FZ1A 3KT4A 5BXXA 3B02A 4IXLA 3OBTA 2HJIA 3QOPA 4LR4A 3VKLA 5L7OA 3JCIA 4BPZA 4YVSC 2CAVA 3OYWA 2UWAA 1H4HA 3AKSA 4LUMA 1PO13 5AVPA 4IEOA 2HWB2 1C8M3 2LALA 2QKDA 3IPVA 4E4DX 4K6BA 2ARBA 4JVAA 1AYM2 4LA3A 3TRSB 3ZN6B 4Q4W2 5C8CB 3QACA 3TNQA 2QE3A 1S1AA 1M4WA 3MF6A 3PVEA 1QXJA 1LEDA 3DPRA 1TE1B 3OPZA 4FPJA 1HDKA 5FLJA 2VXRA 4JCKA 1G9FA 1UZYA 3HD8B 1SBFA 4W6WA 3THPA 5FCCA 4LUKA 2B7YA 1DU3D 2EA7A 3OJBA 5CFDB 4F7ZA 5GZCA 5AC92 5BNOC 1WD4A 3AXEA 3FC0A 5KHJA 1Q3EA 1NY72 2NYYA 3QH6A 2YMZA 2NMOA 5GLUA 4Z82A 3IBMA 1HV1A 2DV9A 4LO7A 2GC3A 3U10A 4JC1A 2VW2A 1VBA1 1JN2P 4PIZA 1MS9A 2YPJA 4QGMA 1AR72 4UW5A 5KXBA 3IKWA 3EHKA 1RUI3 4AHYA 1RUF2 1QH7A 4Q0SA 3VDDB 4EN9B 3VLBB 1URXA 2B45X 3FBMA 1QJX1 3I4IA 1SLCA 2GAUA 1IOAA 4NVPA 3WDVA 3WW2A 5CADA 3GALA 4K40A 4N53A 4K1YA 4D7YA 4OHYA 4AVBA 4IEWA 1JOJA 1BQPA 4LBQA 3V0AB 1HKDA 2IXHA 1ZBA3 1SLLA 5HI0A 4IV1A 3RMYA 4GMP3 3GYDA 2DU1A 3WLUA 1VRH1 4XOGA 1F5JA 4EWDA 1ULDA 2PAMA 2EALA 4N43B 2MEV1 1AF9A 1KJLA 2CWMA 3HT1A 4C91A 1OLRA 2PLV2 4ASLA 3MF9A 1PVXA 2VNRA 2WLPA 1GZWB 3ZFFB 3ST7A 5T5OA 4M3CB 4LBNA 1WMEA 1RUD2 3BIWE 4D94A 2E6VA 4COVA 2JD4A 1R093 3VHOA 5K8SA 3VKFC 4QPGA 3IN9A 4Q0PA 2QCSB 2VG9A 4J6GA 1QJU2 4XXAA 3POSA 4PCRA 1ZRCA 1A78A 1EV13 5ACA3 4AEJA 2E9QA 2VQAA 3R0RA 3CO2A 4OHZA 5EJ3A 1OMIA 3H3UA 3LSDA 4UW3A 4WM7B 5DUVA 2ZGLA 3A4UA 4AG4A 1RUE3 2NLRA 5KXEA 1LHUA 2DFBA 3CJIC 3H1MA 3AMHA 4M0NA 4AK3A 1MACA 2W68A 1CD3G 1EPZA 1LRHA 4AI3A 3ZFFC 4RHV2 1CVNA 2Q4SA 4LNVA 2R16A 3I59A 4U2AA 1IPJA 5F6LB 1FOD2 1XYOA 1W6QB 1NA1B 2GH8A 3NV2A 3VZMA 4CEWC 2HWF3 2ZTNA 4XHBA 2BNMA 4WM8C 1HQLA 4FXKB 1NCQB 4IV3A 5KHGA 4I09A 5C6CA 1CGPA 2VVEA 2W08A 4G3YC 2HEYF 1FNYA 3B9IA 5K0UA 3VBFA 3L2YA 3HIFA 4XJ9A 5JR7B 1FNZA 1QXRA 1HLCA 3VHRA 1MZ5A 5I0SA 1RJ7A 1ZREA 4LBLA 5JAXA 3B3QE 3V64A 3JD71 3PJQA 2YY1A 4XXPA 1DZRA 3JUUA 2WQ4A 1AJOA 5AFEA 4YW2A 2PHLA 3FZ3A 4Y22A 3SISA 2XWJB 3KCCA 4WVMA 3LZZA 4Q4V1 3VZKA 1SLBA 3HN1A 1TNRA 5ABJA 1H2MA 2P3KA 3DPRC 2D40A 1UMZA 2BNNA 5CU1A 1OA4A 3LGRA 1QOSA 2RS12 3E5XA 2XL7A 1POV1 4QQLA 1ND3A 3ZFGB 1BBT1 4FPFA 2HWB3 3N7JA 4GB32 3LKJA 4LBJA 1C4RA 1LB2A 4NN0A 1CIWA 1AYM3 2HWD2 2OA2A 4JRLA 3SCGA 4Q4W3 1JTZX 3ZSLA 4C0HA 1HRI2 1ZVFA 1ZX5A 2BVBA 1K5MB 4WVWA 5C8WA 2VQ0A 2RS52 3BOPA 4OULA 3B7MA 4JV4A 2TNFA 4YG0A 5LEJA 3AKTA 1U5YA 1A3KA 4XQ4A 1GYKA 2D3SA 3LWCA 1BEV2 1REDA 5AC93 1O3TA 1FPN1 2NP0A 4D3WA 5JWPA 3FBYA 4HSJA 1RHI3 1YIFA 4I01A 5JZGA 3IWZA 5DXDA 1MZ6A 3AYDA 4YW3A 1AR92 2ZGUA 1BVVA 3U07A 2R1DA 1AR73 1N47A 4PBPA 4PLMA 4AVVA 3MLKA 3PJYA 1U0AA 2WNUB 1TEIA 1RUF3 4QT6A 5KWRA 2VOKA 2YZ4A 4FOVA 4LTAA 2CY6A 2YXSA 3I7DA 4LO5B 2OUHA 1RUH2 5BNQA 4YVWB 2QQPA 1ULFA 5KHIA 4FSJA 2PHDA 4HN0A 3PNAA 1BCXA 2DUQA 4JTOA 5IK4A 4CP2A 2HWC3 2VVDA 4DQAA 2CGPA 2X5IC 2WIIB 1ZZ7A 1KS4A 4JRAA 3H9AA 4YARA 2GDFA 3INAA 1DZTA 1MR5A 2Y26A 1LOBA 5GLVA 4PQ9A 3PVNA 3ZYIB 4CDXB 5J09A 3VZJA 2PLV3 4PF5A 1YYNA 4JTNA 2BQPA 1B35A 3KB5A 1G9DA 3NWKA 3KD4A 1FMD2 3RNSA 3I54A 2WSUA 2B46X 1RUD3 2RR12 2RM23 2BWCA 4QPIB 1W6PA 4FPLA 4HL0A 3GBWA 1TME3 2WZPP 1I9RA 3B94A 1MQTA 4MGKE 4Z92B 1IKPA 4Y1YA 1YFXA 3ALQA 1LECA 4XZPA 5JCTA 1ALYA 1QJU3 5T52A 1S0GA 3RI9A 5CAZA 1KRIA 4P9JA 3ILNA 4WBBA 1WW4A 2WT2A 4AQ2A 3H3ZA 4AGRA 3NO8A 2PELA 1ULCA 3M3OA 3AFGA 3URFA 1JUIA 1PZ7A 3VBFC 1Q56A 1IS4A 2SLIA 3N7KA 1Z78A 2XVKA 3O14A 1H0BA 1CPNA 4R9CA 1R1A2 1SBEA 4ATFA 1AYN2 4FVVA 1O4TA 3SNMA 4RHV3 3LOBA 3DF0A 2N7GA 1FOD3 2VMIA 1VJ2A 2ZX4A 4CRQA 2DF7A 3GZUC 2WNVA 1WW7A 4W6YA 5ABJC 4LHKA 3DN7A 2H0BA 4QXKA 4Q4X1 5LRSA 4KWKA 4EN8B 5J36A 4F8AA 1ND3C 3VBSB 5DZFA 4CDWC 1V9U1 4JGYB 2D43A 3BCWA 2WFF2 2A6VA 1UIKA 4Y20A 3AMQA 1HXS2 1ENRA 1H1AA 1UU5A 2WWSA 4AVSA 2F4PA 2WJSA 2ZMKA 1QU0A 1MEC3 5GM0A 1VBB1 4E27A 5JPNB 3G7DA 1AX1A 3D0SA 3MPBA 2RS13 2EXHA 4NWVA 2PAKA 1I6XA 3O12A 4FAGA 1W39A 3OY8B 2R0FA 1Q43A 4GB33 2GC0A 2D5FA 4RQPB 3ZXAC 2HWD3 4AE2A 1HRI3 4P9XA 1GZ9A 1H4GA 4LBQD 2ZJCA 1UW8A 2ZHMA 5JZGC 1DF0A 4AEMA 2RS53 2A6YA 4Q0UA 1PGL2 4GULA 4FTSA 3WG2A 5FTTC 5A33A 1POV0 2ZABA 2P34A 3USUA 5T54A 2XKPA 4AEDA 1CAXA 4XQWA 4ISQA 2CYFA 3L2HA 1W6NA 2R042 2DTYA 1C28A 3ZO0B 3MGUA 3TN91 4AGVA 4B7KA 1PO22 2Q8OA 1BEV3 5T3NA 1OPOA 1L3JA 5JIUA 1QJY2 1JW6A 4BA6A 4CDQB 1RUG1 2GH2A 5J7MA 3AP4A 4RS5B 3GNEA 3TNPB 1LGBA 1RB8G 1RC6A 3J4UH 1AR93 4AI8A 4Y1UA 1Z7S2 2WNEA 4COWA 4P5HA 1RVF1 3R6SA 3FFQA 1JXNA 1PZ8A 1UZZA 2ET7A 1YXWA 4QGLA 5T5JA 3ZFEB 1QY4A 4KQ7A 2IXKA 4FAHA 1RUH3 3WDXA 4MXWA 2HWE1 4XYXA 1VBE2 2UYAA 1B35C 2I45A 1W6OB 1ZRDA 3M8LA 3DL3A 2XLGA 3WZ1A 4FOQA 1KJRA 5EFUA 3H8UA 4URTA 4HK9A 3R4SA 2E7QA 2O8QA 3DUIA 1CQ9A 1YFUA 4CDQC 4MH0E 1H2LA 4YM0A 1DGRN 3BB6A 1IS5A 1TMF2 2WS92 1OI6A 4R52A 3C2UA 3ZIXA 1FMD3 1HRV2 4HPKB 2DUOA 2RR13 2VOXA 2ZCWA 5BNOA 3BPZA 4BWOA 2DVGA 5JOZA 3FLPA 4EWAA 2ZGKA 2ZA9A 2EAKA 5JOYA 3I2DA 4AVCA 5FMOS 2A70A 3C3VA 3KM5A 3VHPA 1AXKA 1WUVA 3VL8A 2R072 4AFCA 4PDWB 1W0OA 3VBRB 5LRRA 1RINA 1LCLA 1CR7A 1XE8A 4Y1XA 3VHNA 2E63A 3JQWA 1JUHA 1NQDA 3R4DB 2VPVA 1YWKA 1DHKB 2DU0A 2JENA 4KWLA 4XF1A 2E53A 1KDMA 2E7TA 5C8CA 3J8F1 4XPVA 1GR3A 2CWSA 2I07B 4HETA 2CV6A 4IQPA 5I0TA 3SCHA 2GC1A 3KT1A 2Z79A 3A0KA 2JG9B 4LE4A 5BNPC 1F5FA 5JIAA 1NXMA 1G9BA 1R1A3 1AYN3 2VNOA 2DCZA 1ZZCA 4MX3A 4KL1A 1D0GA 1YI9A 3AFKA 1C8NA 1S55A 2XBO1 3AZZA 2OZ6A 5AFBA 3AP6A 4MVTA 2IFRA 2ZGQA 3OTFA 4SLIA 2H0VA 1V70A 4C0BA 3RYRA 1A8MA 2EXKA 4I30A 2RHPA 1AR83 1OHFA 2QDRA 5T50A 1O5LA 1UN1A 4XF0A 3ZXLA 1ASJ2 1VBA2 3P3PA 3IDEA 5KXCA 2GMMA 2WZR2 2BW8A 2RS31 2WFF3 1ZZ6A 4QM8A 1HXS3 3AKPA 3FHIB 4L9BA 4ONUA 4ATEA 2JE7A 1Q8QA 1VB2A 2A75A 4XF3A 2R061 5CG9A 1BXHA 5GKAC