3MW3A

Crystal structure of beta-neurexin 2 with the splice insert 4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
189
Chain Sequence
STTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNRQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Neurexin-2-beta
publication title Splice Form Dependence of beta-Neurexin/Neuroligin Binding Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 38
structure length 189
sequence length 205
ec nomenclature
pdb deposition date 2010-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mw3A00
1GICA 2AYHA 2ZGSA 1I3HA 4XBNA 1CVNA 2W39A 3W59A 1BYHA 4BPZA 1GBGA 1UL9A 1S0EA 1DZQA 1DFQA 3OJBA 3O5SA 3A0KA 1W6PA 3LCPA 3OY8A 4JCKA 1WBLA 2D3RA 3OBRA 4XJZA 1FNYA 1RINA 4R9DA 1GZWA 3OYWB 1JN2P 2ERFA 3OPZA 3R4SA 1BJQA 1OQ1A 2R16A 2TEPA 3N35A 4P9YA 4RA0A 5FREA 1ZA4A 4K1YA 1DQ4A 5T54A 2VW2A 3WDTA 1AX2A 1HQWA 3AZVA 3D4KA 5F5QA 4AYUA 2GDFA 4AVVA 1AXYA 1DYPA 4JRAA 3BOPA 1Y7BA 5DZGA 4Y20A 1U0AA 1G7YA 2WT2A 2ES3A 1G86A 3I4IA 4BLJA 1N3QA 3AZZA 4XJUA 4ZKTB 1YXWA 3N7MA 2P3JA 1CONA 1UAIA 1Q56A 5DUWA 3TAYA 5KXEA 4XTPA 1VIWB 3IKWA 3UJOA 5KXBA 5HCFA 4YW2A 1YI7A 1AJKA 1G9FA 3SLIA 4BM8A 4HL0A 3AYAA 4XIOA 4AVTA 2NMNA 5DUUA 1MVEA 1DYKA 1IS5A 1SACA 1W6PB 4YLZA 3OY8B 4YGCA 3WG3A 1SLIA 1S0BA 2JD4A 3IPVB 1QNYA 5AVAA 1LOAA 3HN1A 4M3CF 2NZ9A 2WT0A 3M3EA 1V6NA 2CWSA 4Y1ZA 1S0IA 3FLPA 3ZSLA 4YW1A 4MYEA 1G9BA 1AX0A 4DS0A 1SCSA 5GLZA 4Q1RA 2OUJA 4DFSA 2CY6A 4SLIA 1WD3A 4FOWA 4XIKA 1DQ6A 4R9AA 3AYEA 4YM0A 3ZPYA 1LHUA 2ARXA 3WCSA 3FLTA 2D6NA 1QF3A 3JU9A 3PJQA 1ONAA 1LOFC 1ULGA 2A3YA 4Y20B 1DQ1A 4FVVA 5JOYA 1OKQA 5GLVA 1GZ9A 2WJSA 3NV2A 3WCRA 2ZGQA 3IM0A 1IS4A 2D6MA 4CZSA 1QGLA 2AGSA 2P37A 2ENRA 5DXDA 1VAMA 5KXDA 1DQ2A 2A6VA 2ZGOA 3AZXA 3IN9A 2WNEA 3QLQA 2ZGLA 4LBQB 4XOGA 4I30A 4Y1UA 4YG6A 5EYYA 2AH2A 2YZ4A 1C1FA 5GALA 3ZVXA 4ASMB 4K1ZA 4P9XA 2Z42A 2DU1A 4FP2A 3RMYA 1LEDA 1LOCA 1Q8PA 3N7JA 3UK9A 4LBJA 3ZXKA 3O0WA 2R1DA 3T1MA 1GLHA 3BTAA 1CQ9A 1XQNA 3RMXA 2NP0A 1KDKA 3PVEA 1GZCA 4CTEA 1F31A 3WDXA 5DZFA 5DUVA 1ENSA 2A3XA 2VXRA 3Q9OA 1GNHA 3D5OA 4PF5A 3WNXA 2PELA 4M3CE 4BLIA 1UZYA 4LBKA 1ENRA 2HYKA 2ZKNA 2DVGA 4ATFA 4FPJA 5IUQA 1AX1A 1UPSA 1CJPA 1DHKB 2GMMA 4XDQA 1QU0A 1S0GA 1UMZA 2FHRA 3POSA 3A4UA 2V5YA 2WT1A 2W68A 4TYSA 5EWSA 1G9CA 2DVDA 1DLLA 1MACA 4L8QA 4FPGA 1B09A 4YGDA 3VKOA 4LBNA 4Q1PA 1LU1A 4M3CB 3SH3A 3DGTA 1KRIA 1BQPA 3T1LA 1SBDA 5GZFA 1JHNA 3WG2A 3ZSJA 2R0HA 4FQ4A 3JUUA 1N1YA 2E7QA 1WD4A 4WVVA 1GKBA 1V00A 4YGEA 3B69A 3ZYPA 3ZXLA 3WDVA 1N1TA 1WLDA 1C1LA 3INAA 4FPYA 3SNMA 2ZA9A 3PVOA 1S0DA 1Q8QA 1AXKA 4FOVA 3FUOA 3W58A 2ZHLA 1JUIA 4YM1A 1FAYA 4PBOA 5EXOA 5E8AA 4LBOA 1PZ8A 3CNAA 3WG1A 1N3PA 2D6LX 2EF6A 3C2UA 1DQ0A 1HQLA 1BXHA 1QMJA 2AR6A 2DVBA 2Q5TA 4Q2FA 1CPMA 1VALA 3KM5A 5JMCA 3M3OA 3ZSKA 4GWMA 4P14A 4AGGA 2ZHMA 1DQ5A 2DV9A 1A3KA 3B9CA 4Z8BA 1Q8SA 2DYCA 3NV4A 2ZGMA 3L2YA 1HDKA 3VUOA 2GALA 5GM0A 1QOSA 3R4UA 4UW4A 3AX4A 2E7TA 1LJ7A 5H9RA 3FFZA 4LBQD 4FPOB 2VH9A 4FQZA 3B01A 2C5DA 2SLIA 1V6OA 1LESA 1V6KA 2WSUA 2R49A 2UWCA 3POYA 1V6JA 4XXAA 4YW4A 2CL2A 2ZMLA 3ILRA 4XTMA 2CYFA 2YXSA 3ATGA 2ZMNA 4ITCA 4NO4A 4AWDA 2RHPA 3MPPG 5IK7A 1IS3A 4DRVA 1MS5A 2FMDA 4FPCA 3M2MA 5L73A 2CNAA 1MZ6A 4WZFA 1W6NA 1LECA 3H0OA 3WZ1A 4KBBA 1G9DA 3ENRA 2GNBA 4RL7A 1O4YA 1D2SA 4XJ9A 3WLUA 1N3OA 3AYDA 1FNZA 5IK5A 2D3SA 3AP5A 4ATEA 2DWRA 2ZGNA 3N7KA 4U36A 5T5PA 2WLQA 4YG3A 3ILNA 1WUVA 2DUQA 2ARBA 2OUHA 3B3QE 2ZMKA 3PMEA 4XXPA 3KQRA 4BMEA 1DIWA 4TZDA 3VKNA 1OFSA 4PCRA 3SH5A 1SBEA 1GZWB 1N1VA 4Y1VA 2A71A 1LENA 5H9QA 2W52A 2GN3A 2DTYA 1W6MA 4FPHA 4XMIA 1W6OA 2A6XA 1FYUA 4AVSA 3ZXFA 2ZGUA 2UWAA 5JLVA 2W08A 3AZYA 3N3HA 4XBQA 5E88A 1MS9A 4XYXA 2PHXA 4Q27A 5HCBA 2E6VA 1SLLA 2JE9A 1D0HA 2D6KA 4XBLA 5GZGA 1MS8A 4FPLA 3IMNA 4PBPA 2WSVA 2JKBA 5GLTA 1CR7A 2UWBA 3POWA 3WUCA 2D3PA 1AZDA 1BZWA 4GKYA 1R1ZA 2DVFA 2NN8A 3USUA 1APNA 2P2KA 1LEMA 2A70A 1QDCA 4GA9A 5F9TA 2CWMA 3NV3A 4YM3A 1UZZA 2A6YA 5FRAA 1IKQA 2D43A 3N7LA 2GMPA 1QNWA 2PHFA 3RS6A 5JVVA 4K21A 2A6WA 1LULA 1LHWA 1KJLA 3LSEA 5JOWA 2B7YA 4YFWA 1ZM1A 1V6IA 1WCSA 1DGLA 4NOTA 1S0JA 1W6MB 4DQAA 2H0BA 1G8WA 3NWKA 2BQPA 3GNEA 3AXEA 2JE7A 4YZ2A 2EIGA 4WVWA 2A3WA 3WVJA 3N36A 2EXHA 2G4IA 2P3KA 3M3QA 2JECA 1AXZA 1WBFA 5IT6A 1J1TA 3TB0A 1MS4A 3APBA 3AYCA 5CNAA 3NV1A 1SBFA 3VKFC 1QDOA 5DUXA 2UU8A 2OVUA 3RSJA 4Y26A 3D6EA 2EXKA 4R9BA 5SV8A 1F5FA 4FPEA 1ULEA 1QOTA 1HLCA 1NXD1 1YYNA 3BIWE 4XE9A 2CTVA 3FUQA 3WUDA 5E89A 4YG0A 3RQ0A 4WV8A 2YV8A 5CBLA 1KQRA 2PHRA 1S0CA 2WQZC 1ENQA 1LCLA 3AZWA 5T5JA 5JOXA 3OGGA 3AFKA 1EPWA 1SLAA 1VAVA 4LBLA 5IK8A 5KXCA 5LK5A 3UJQA 2YROA 5T5OA 3MEPA 2ZABA 1W0PA 2ZGRA 5T50A 1LOEA 1JW6A 1IKPA 1LOFA 1WW4A 4GKXA 3I8TA 2D44A 3WHTA 1A78A 2ZHNA 1LGNA 1KJRA 1LU2A 1S1AA 2E51A 4M00A 1MR5A 4YM2A 4ISQA 3T2TA 2DURA 4Y1XA 1BKZA 4IQPA 1WW5A 2XG3A 3VKMA 4DPNA 2KM2A 1GNZA 4BQ1A 2EALA 2EXIA 2GMEA 5DG2A 1MS1A 1URXA 2AUYA 1N1SA 3BODA 1JBCA 3A0NA 4BMBA 4YZ5A 3AJZA 1CPNA 4XJWA 2P3IA 1ULFA 3HMYA 3SISA 2R1BA 2ZGPA 1O4ZA 1SLCA 3WOGA 4ZXKA 4W65A 3IPVA 5H9PA 1GANA 3V0BA 4DRRA 3M1HA 2D6PA 2GNMA 1FV3A 1Q8OA 1V6LA 4XHXA 1CESA 1QKQA 1SLTA 1WLCA 4Y24A 1W6QA 1FX5A 2C9AA 5T52A 4YZ3A 4D69A 4YW5A 4Q8LA 4UW5A 4Y22A 4CRQA 2ZGTA 3VKLA 3ILFA 5DG1A 1G9AA 2EAKA 2EXJA 3ZXEA 4XZPA 1SCRA 2ZACA 3WV6A 4LBMA 4BOWA 1H30A 2PHUA 3AXDA 3O12A 2A6ZA 3AP9A 1QOOA 5CA6A 4XHBA 5GLUA 2D6OX 4FP3A 5T5LA 3LSDA 1JOJA 1SLBA 3MW2A 2PHWA 1MS3A 3WDUA 1A8DA 1PZ7A 5T55A 1S0FA 4LBQA 1H9PA 1H9WA 2AENA 2E53A 2NMOA 3ZSMA 2GNTA 2DVAA 2VUAA 4JC1A 3WDWA 3O0VA 2JJ6A 3M3CA 5GZEA 3V0BB 1W6NB 1YIFA 1UKGA 3DUIA 1FATA 4YZ1A 3R05A 1PZ9A 1MVQA 3AP4A 3WG4A 1AVBA 1W6QB 5CAZA 2R0FA 4FOQA 1LODA 2LTNA 2DU0A 4U2AA 4XJAA 3VV1A 4Y22B 3U4XA 2ZZJA 3QCWA 1MS0A 3WHUA 1JYIA 2XB6C 1C4RA 1Q8VA 1LHOA 1NLSA 3HR9A 4YZ4A 1KDMA 3AP7A 3AK0A 4YW3A 3V0AA 4GWNA 1JYCA 4AGRA 5H9SA 1UX6A 4XILA 1KITA 3V65A 4P9WA 4R9CA 2GNDA 1Z78A 4C1WA 3AP6A 1I1EA 1W6OB 1VLNA 2LALA 1F9KA 2V73A 1V6MA 2P34A 4Y1YA 3SH4A 2I2SA 3MW4A 4GXLA 1LHNA 1AJOA 3OBTA 1GYKA 1ULCA 4M3CA 4YFZA 4HANA 4XJ8A 2VW0A 1YRZA 1WW6A 2A75A 2ZAAA 3O0XA 3UL2A 1LOGA 4C1XA 2ZBJA 4FOYA 5JOZA 1UN1A 3GALA 4AGVA 1N47A 3ASIA 1SFYA 5GLWA 5GJ6A 4F83A 2A7AA 1IS6A 4K20A 2DUPA 2SBAA 1FV2A 4UW6A 4H55A 1MZ5A 1HKDA 4Q26A 3FLRA 3USUB 3RG0A 4UW3A 1DBNA 5GZCA 4M01A 2NYYA 1YO8A 2D7FA 5EYXA 4GALA 2VU9A 1Z0HA 2PHTA 1GV9A 4PQ9A 4Q8KA 2DUOA 4YGBA 4OZXA 1X50A 3ZXJA 3SITA 1WW7A 5GZDA 2VY0A 5IK4A 5CB7A 2OW4A 1LTEA 5JDBA 2YY1A 3FBYA 1TEIA 3V0AB 1ULDA 2WKKA 2DTWA 1LOBA 2A5ZA 3PVNA 3MW3A 4FPFA 1IOAA 3OYWA 1AF9A 1LHVA 3RRDA 1GSLA 1LGCA 1RIRA 5DZEA 3WDYA 3ZYRA 2ZGKA 1RITA 2YMZA 2AREA 5HCAA 3AJYA 1CN1A 2UURA 4FPKA 4ISRA 1LGBA 3V64A 1WLWA 1W0OA 2JDZA 2ZHKA 2GN7A 4XMAA 5BYNA 1C57A 3B00A 1JXNA 2NM1A 2VW1A 1CIWA
chains in the Genus database with same CATH superfamily
2IVIB 2ZGSA 2H6BA 3AMHA 2Y6JA 2W39A 1UOBA 2PLV1 1BYHA 2X10A 3W59A 2BDRA 4XQ4A 4L0PA 5ANQA 3VL9A 4OI0A 3OJBA 4LO8A 3ZKUA 1GFF2 2X5IB 3P6BA 3OY8A 4JCKA 5EP9A 2ZXQA 5F6KA 1WBLA 2D3RA 3MBWA 5L36A 1Q43A 3NAPB 3ES4A 1XU2A 4QX2A 3WEZA 4COWA 5F5CA 4RR3C 1VBC2 2DCTA 5JCTA 3L9JT 5FREA 2BBVA 1OQ1A 1U5ZA 2ET1A 2TEPA 5FP4A 3DCQA 3TYJA 2YFUA 2VW2A 5B4XA 4QPGC 1S55A 1DYPA 2BFUL 4JRAA 3BOPA 1UYZA 5D8AA 3JD73 4OI1A 4EWDA 5FBJA 2Y6HA 3A21A 1W90A 4Y33A 3UGHA 1IPKA 4CCKA 4NIDA 1UYYA 3LWCA 4XJUA 1ND3B 3J8F2 1NA1B 4LMFA 1YXWA 3N7MA 2R071 3RWKX 5DUWA 1A34A 1VIWB 3GCWA 4YW2A 2XJUA 5BNPB 5JIUA 4QQOA 5LASA 1PO12 1FOD1 1ASJ1 5DUUA 1NG0A 4R52A 3RJRA 2QQWA 3VDDA 3NMBA 3MICA 4DZGA 1LOAA 4IE7A 4B1LA 5FLIA 4M3CF 3N9NA 2VBBA 3M3EA 2D40A 1RUG2 2QVSB 2X5IC 4NE9A 1XNDA 2JDUA 4Z92B 3QOPA 1BEV2 4R9AA 2ZJCA 4YM0A 3NAPC 4B8EA 2UYBA 4B4QA 1VR3A 3WCSA 4XC9A 1JMUB 3GDBA 4OULA 1QF3A 3JU9A 4KNCA 5LBCA 5J96B 1ONAA 1LOFC 2A3YA 2WFF2 3ACGA 4FVVA 3I49A 3D3AA 1YFXA 3NV2A 3ON7A 3WY6A 2HWE1 3IM0A 4X8PA 3CBNA 1RTVA 2P37A 2RDNA 1WKYA 1J83A 3MYXA 4YVWC 2XQRA 1TMF2 3URFA 5AC93 4EYUA 2ZX0A 3DYPA 2QDRA 4AHXA 2WYFA 4P9IA 5LW9A 1R081 3GF6A 5BNNB 3C8XA 2VGDA 4QDSA 4Y1UA 5EYYA 4OFGA 5C9AB 1UY1A 4HPKB 2DU1A 5A1LA 4FP2A 4RFT0 4XFIA 1NCRA 2XJQA 2Z2SB 2ORZA 3M8LA 4IETA 5C4WA 3RMYA 3N7JA 3ZXKA 1NZIA 5LA9A 1BLZA 2WNUA 3O0WA 4PHZA 3T1MA 4I0AA 3C3VA 3BTAA 2XQXA 3SCFA 3VZLA 2BFUS 3ZYHA 4NIAA 1KDKA 3WF0A 1GZCA 3WDXA 5DZFA 1EP0A 5DUVA 3I2KA 4EN7B 1UU6A 4PF5A 3VZMA 3WNXA 1NUKA 4IEQA 5ANNA 2HYKA 1UQXA 4J25A 5FO8B 4YVSA 3F2ZA 3BU0A 3IAPA 4IUGA 4E27A 4FPJA 1CJPA 4QDRA 1VMJA 2VNGA 1L7QA 1S0GA 1UMZA 3POSA 4N53C 3FFQA 3CEWA 1DLLA 3I3QA 1JZ4A 4HETA 4ZS3A 3VHOA 5HI0A 3LIGA 5F5AA 4EN8B 1QJX3 2XWJB 1LU1A 3DGTA 4LHKA 4A41A 1B35B 3T1LA 1W8FA 1NYWA 3PUHA 4CPBD 4FQ4A 5A3MA 3LEMA 2VG9A 1WD4A 1VBC1 1V00A 3C7FA 1C8M2 3WDVA 5BNNC 5FMCA 5L19A 2WZR3 1C1LA 2RDSA 4K8RB 4XFAA 1KS5A 1UXZA 2IXCA 4Z07A 4GB32 4YARA 5LRSA 1S0DA 1UY2A 1Q8QA 1J58A 4FOVA 1VBD2 4CU9A 2JB8A 4QKFA 1KEXA 4KI5M 4PBOA 4DXRA 1FPN2 4LBOA 1PZ8A 5E8AA 3WG1A 2VMEA 3I3EA 3B93A 2EF6A 2RMU2 1ENXA 1HQLA 1QMJA 2AR6A 4Q2FA 4BK4A 1NQDA 1CGPA 3J8F1 2WS93 4HT1T 5DAXA 1ZZBA 1WMXA 4CYDA 2DV9A 1A3KA 3PTRB 3B9CA 4OCTA 5FZAA 2DYCA 3NNMA 2ZGMA 1XE8A 5FYSA 1HDKA 2B8MA 1PO11 4INDA 4MVTA 5FZFA 2J42A 3HT2A 1I5ZA 1WCKA 5H9RA 1RB8G 2VCAA 4IEXA 1WA4A 4P9GA 3E97A 4SBVA 3BVCA 1W8WA 3WD5A 5AC91 2PMWB 3S7IA 3CQOA 2CL2A 1Y9QA 1RC6A 4LULA 2JG8C 4WM8B 2CYFA 3ATGA 3N9LA 5K9YA 4NO4A 3MPPG 4FPCA 1H8TA 1MZ6A 3FMGA 1W6NA 2IC1A 2LS6A 3LD8A 4XPVA 4CDWA 4KBBA 5HPOA 1CAXB 2GNBA 2WFF1 1OOPA 1QH6A 2RS13 3MIEA 1DGWX 3MHZA 1O4YA 3OGJA 5BUVA 5J1XA 3RZKA 2Q30A 1N3OA 3N7KA 5T5PA 2Y34A 1TMF1 3ZR5A 1AR62 2QQJA 4Z82A 2ARBA 2HBUA 2OUHA 4E8DA 4G4FA 2VVEA 5JAXA 1RUJ1 2VOVA 3WF4A 4TZDA 4PCRA 4IEZA 1PGL2 1GZWB 3MLLA 3VBRB 3S0MA 4DMIA 3CIHA 4E9KA 4NHYA 4Q4V3 2Q8OA 1GP5A 5FXVA 5A33B 1UXXX 4FPHA 1JH5A 1W6OA 1QJEA 1YQ5A 5C8CA 5FY4A 2W08A 1QJX1 3AZYA 3N3HA 4L92A 4CEWA 5BPXA 2G1MA 3H8RA 1IPJA 3TN92 5HCBA 3ZDVA 3ZIXA 5F6LB 1JS9A 1D0HA 5FP9A 1SFPA 2WSVA 3T0BA 4ARYA 2BBAA 2JKBA 5BNOB 3U37A 3U0ZA 2XHKA 4CU7A 3VBUA 1L7RA 4NMIA 2J1SA 2OXBA 5FKCA 1R1ZA 2DVFA 3JQWA 1GOFA 4GA9A 4NRPA 4NROA 2CWMA 4IV3C 4QHZA 4XUOA 4ARXA 2WWUA 4QGMA 4K7JA 4Q4X3 1UPIA 3MIBA 1XYPA 4W6XA 3RS6A 2RJ2A 4AFAA 4QKDA 1V9U3 3LDKA 2A6WA 2G9FA 2P5BA 4IL7A 5JOWA 1KJLA 5I0SA 5EZWA 1WCSA 1DGLA 4NOTA 4B3NA 1W6MB 2RS53 1G8WA 1VBE3 4MGIE 3VBRC 2BQPA 1UMHA 3GNEA 4QB6A 3ZOIA 4GB31 2VTXA 4WVWA 5BXXA 2A3WA 3V56A 1A6CA 3ME2A 2P3KA 1VBD1 2JECA 2JE8A 4WVZA 1RUE3 5FIXA 5LBFA 1LNSA 1J1TA 1FPN1 1AL23 2VUDA 4I0WB 3APBA 4P5YA 3TB0A 2RMU1 4AFBA 3ZN4A 1PVC3 1SG3A 3NV1A 3VKFC 4BE3A 4AHZA 1Y9GA 5CFDA 2R6QA 1K42A 5BV6A 1I6XA 2PAMA 3D6EA 3ZFGA 2EXKA 3NJZA 2DCJA 3BYWA 1WA6X 1NQJA 4E4DX 1D7PM 1QOTA 4WM7A 2K0GA 1RUH3 1W3VA 4KH9A 3WUDA 3NSTA 3B7MA 1MQTA 3CMGA 5JI7A 4WV8A 3H8OA 1Y9MA 3QH7A 3R4DB 4RGAA 2Q1FA 1AR93 3PURA 1ENQA 3MDPA 3LGRA 1OBNA 3OGGA 3WF1A 3Q8EA 2VQTA 3PMSA 3T4VA 2WYSA 1VAVA 4ASLA 1RMU3 2P6HA 4FFGA 4LBLA 2XLFA 1PO22 5KXCA 4N7IA 3UJQA 4AI2A 3CDZB 3MEPA 2PFWA 2ZABA 2KA3A 4QX5A 2GU9A 4Q29A 2Y38A 4GKXA 1K12A 1NE6A 2BGCA 1W3XA 4KGGA 1O59A 1WLTA 1UIKA 2ZHNA 1JTZX 1W9FA 4QPIB 2E51A 1LU2A 1RUD3 5T3NA 5IVEA 1AYN3 1OLQA 3WQ7A 4CDUA 5IVFA 1XNKA 2YBSA 1WW5A 2XG3A 4J1XA 4G3YC 4L97A 1VAKA 5IVCA 2HLEA 1URXA 2VBDA 2AUYA 3DEMA 2HH9A 3OD4A 5LCWL 4I3GA 4A7KA 3I97A 3A0NA 3OG2A 3AJZA 3LDRA 1P8JA 1UZ0A 3TEWA 2VMDA 2BERA 2E31A 4ZZ8A 2ZGPA 5IAVA 1O4ZA 4QU1A 1RUF2 3IPVA 4PT6A 3V0BA 4N9IA 1GNYA 2A73B 3BKZA 1QKQA 1WLCA 4IGQA 3BN6A 5L7OB 3KLSA 2C6SA 3POGA 4UF0A 1DLCA 2J1AA 3SMHA 4Q8LA 4HK9A 1E5RA 3NJYA 2NPIA 3BPSA 1CZTA 2PA7A 2EAKA 1FMD2 2WQ4A 2JENA 4WBBA 4JGYB 2Q8CA 4F8AA 4I2OA 2QQUA 2HBTA 3VBHA 1K45A 2ZACA 4QDQA 1E5IA 3THPA 3WV6A 1RUE1 4LBMA 3TRSB 1RHI3 2YBPA 2AZ5A 1BHGA 4MSVA 1QJY2 2R062 4QPIC 1EAH3 5CA6A 4LKSA 4MGKE 4A42A 1O8PA 3MI8A 4COVA 5JI9A 3LPFA 4IV1A 5E16A 1JOJA 3MW2A 3E5UA 4YYOA 3WDUA 1A8DA 5T55A 4PDWB 1XNCA 2QQNA 1SFNA 2BZDA 4LBQA 1H9PA 1H9WA 2AENA 3EO6A 1H6XA 4MUVA 1ZRRA 2XVKA 3G7DA 4UWDA 5ABJB 3GHMA 2VUAA 2X05A 5CZKA 1RVF2 2JJ6A 1IZ3A 4JDMA 4KG0A 4NPRA 5ERLA 1FATA 3T2QA 4YZ1A 4LOTA 1AR91 1AVBA 1ULPA 2YC0A 4FFHA 3WW2A 4FOQA 1ODMA 1ST8A 4EROA 1LODA 1PK6A 2LTNA 3H3LA 1TQ5A 3ZFEA 4DNYA 5FYHA 5FUIA 3TEXA 1H4HA 3QCWA 4JRLA 4LO7A 1X36A 2OA2A 5FCCA 2ILMA 2BP6A 5L7OC 1XNTA 3K75B 5A7SA 2LUWA 2XB6C 3H1YA 1SDDB 2XUEA 3HR9A 2WZEA 1KDMA 4GMP1 4N8MA 4YZ4A 4YW3A 5HV4A 2FDKA 4AEJA 4GWNA 1OA2A 4XFCA 3N9MA 4JGYC 1QQP2 1JYNA 4P9WA 1I5PA 1XNBA 1Z78A 5FK7A 2WL1A 1H8VA 2HEYF 4XF1A 3SH4A 3LE0A 4CEYB 1V6MA 4KMQA 3GXUA 4Y1YA 2I2SA 4GXLA 1W28A 2YYOA 1GYKA 5LEJA 2MEV2 4COZA 5A6YA 2G19A 2J1RA 4XJ8A 4AOCA 1WW6A 3UL2A 3GGLA 2IXJA 2C0ZA 2G9ZA 4XDPA 4P00B 4C1XA 4BH9A 3BGAA 4QPWA 4K20A 4QM8A 1OLMA 4H7LA 3UKVA 5IVBA 4LHNA 5CU1A 1AR81 3HNYM 3MGUA 1MZ5A 1HKDA 2VQ0A 4Q26A 4Q4Y1 3VD3A 3USUB 1DBNA 1W8ZA 4RYDA 5A7OA 2VU9A 1XE0A 2PHTA 5FYVA 4CXXA 4JGZA 3AMMA 4Q0UA 4Q0VA 2ZKLA 4RHV3 3ZXJA 3D8CA 5GZDA 2VY0A 2QQPA 1HXS3 4J1WA 3NL1A 5F32A 3UV9A 3VL8A 3V0AB 3BUCA 3RZLA 1RUI1 4MGTA 2DTWA 5JIAA 2A5ZA 1QXPA 5I91A 2XONA 1PIV1 1TME2 3I2DA 1R1A1 3MW3A 5K0UA 4WVMA 2JB4A 1HB3A 3RRDA 4ES8A 1GSLA 4IGPA 4L11A 1DU3D 2UY9A 4NPMA 2QUOA 4CEYC 2UURA 3KHBA 4FPKA 2Y6KA 1BBT2 4NJ4A 3H8UA 1AHSA 1EUUA 1K5MC 1WLWA 1J84A 2DF7A 4NR1A 3UT0A 3MLKA 4XUTA 4XMAA 3W5MA 5I0DA 1C57A 3POFA 1QJZA 2NM1A 2VW1A 1XSRA 4QX7A 4AXOA 4DOUA 4FTBA 2HWF3 2QDNA 2VVDA 2WO3A 1F15A 2Q4SA 5EJ1B 1GICA 1H2KA 2AYHA 3WNPA 2FCUA 1YFUA 4PIYA 5DAPA 3X29B 1C28A 1PNFA 4LLOA 5F2WA 2R061 1GBGA 1UL9A 1DFQA 4K6BA 3HWJA 3O5SA 5FY1A 2JX9A 3HEIA 2VNOA 3AVRA 4QGNA 3LCPA 1MEC3 4MX3A 2VZSA 2JG9A 4TSVA 1OD3A 2PYTA 3OBRA 4XJZA 5CFCA 2WO2A 1C5HA 4IEVA 2R32A 4TN7A 4DB5A 3WF3A 1M4WA 3LEIA 5A3OA 1YFWA 3OYWB 3B5LB 5FZMA 2R16A 4Q0PA 4JZRA 4OI2A 1GUIA 1NCQB 3HBKA 4RA0A 4CCDA 1HW5A 3OTFA 4MZUA 4NUBA 5T54A 4D7YA 1GWLA 2XUMA 5KR7A 2EIDA 5F5QA 4QKNA 3EYPA 3OD0A 1AXYA 1Y7BA 2VMCA 2DCYA 4GH4A 2G9GA 2ES3A 2P17A 4P08A 2R7EB 2PLV2 3NNFA 5LB6A 5JZGC 1K5JA 1N3QA 3AZZA 4P02B 4ZKTB 5IFTA 4XF9A 3J9SA 1CAUB 1CONA 5C8WA 4QWNA 3GJAA 4IEWA 3WNNA 5KXEA 1X9PA 2RG4A 3IKWA 1O3SA 5HCFA 3Q8AA 4ASKA 1W8NA 1YI7A 2KD7A 2W95A 3VHPA 2WRAA 2YC2A 1CJDA 2ZS6B 3LDBA 3AYAA 4XIOA 3TEYA 5CYYA 2NMNA 4N90A 4R4ZA 1MVEA 1WZXA 3WNMA 4E2QA 1QIQA 3VBFA 4YLZA 3WX5A 1C3HA 3OY8B 3WG3A 3RZJA 1S0BA 1QNYA 3AC0A 5A7NA 2Y6LA 5CG8A 2NZ9A 2WT0A 2P4EA 4HONA 4RHV1 4UT5A 1S0IA 1XYNA 4Y1ZA 1QH7A 4MYEA 5FO7B 3KWVA 2IXKA 5GLZA 3SQOA 1JYVA 1VB2A 3O14A 3UYJA 4DFSA 1WD3A 4FOWA 4XIKA 5A7WB 1ZX5A 3U07A 1JZ3A 5IW0A 3RZZA 2OS2A 1NOVA 3FLTA 2D6NA 5A6XA 1NCQC 1ULGA 1YHFA 4NWWA 1OKQA 1VBB1 3PNAA 1Y3TA 1YQ6A 2Z5WA 4YSFA 4HVOA 4A4AA 5FOBB 1IS4A 1FOD2 1CD3G 2YFZA 1QGLA 2PQQA 3LA2A 4CXWA 2ENRA 2B5HA 4NN0A 5JXHA 5KXDA 2A6VA 2JXAA 5APAA 2HWF1 2ZGOA 3AZXA 3IN9A 3SKJE 3QLQA 4AF9A 3HVDA 1VB4A 4LORA 4YG6A 5FWEA 4OUMA 2AH2A 1X8EA 2ETEA 3VDDB 1C1FA 1TNRA 5GALA 3ZVXA 4QXHA 2R043 4CDXA 3S57A 2Z42A 5EIYB 1LEDA 1LOCA 2ET7A 4LBJA 1YJKA 2GP3A 1MEC1 2CSGA 4Y5Z0 3ZFFC 1H6YA 1JYTA 3K2OA 1W2TA 2B42B 5FPVA 4AL9A 2NP0A 1W2AX 2JIGA 1ACCA 1F31A 1HV0A 3JXSA 4HK8A 2JD9A 3D5OA 2VOTA 3AVSA 4NAOA 3HNMA 1UZYA 4BLIA 2ZKNA 5LA1A 2D97A 5FZ8A 2DVGA 3ZSEA 1PGW1 5FZHA 4AI9A 5IUQA 1AX1A 1UPSA 4XDQA 4XFFA 3K4DA 1SDWA 3CU7A 3A4UA 2V5YA 2WA4A 1OLME 2W68A 4TYSA 5FYYA 5A70A 2DVDA 4L8QA 4ZONA 1MZEA 2XVLA 1B09A 3O1UA 4M3CB 4OHVA 4C90A 1V0AA 5ISLA 1SBDA 2FDJA 5I0UA 3WG2A 4BYYA 1CAWA 4L9BA 1W8TA 4OQ9A 3ZXDA 1N1YA 1YC61 2E7QA 3IT8A 1GKBA 4KL1A 4YGEA 5FXWA 3ZYPA 1CIYA 4JQTA 5C4WB 2QQLA 2WNOA 5I8YA 5FZKA 2WNUB 5A32A 2HWB3 4FPYA 3SNMA 3GYDA 1DCSA 5FY7A 2ZA9A 3VDDC 5J36A 1ND2C 1OI6A 2OZJA 3IDAA 4QXBA 5FZCA 4NPLA 1AXKA 1CX4A 4AVCA 1OHFA 1FAYA 5A3LA 5EXOA 3BPZA 3H3ZA 1N3PA 2D6LX 2OIIA 2Y8KA 3ZSJA 3LEKA 3VLBB 1POV1 2PN5A 4Y5SA 5F7UA 3JD72 4EQVA 1E5HA 4YVSB 4GWMA 4P14A 4QQHA 2ZHMA 2ADDA 4H7MA 5FUNA 4C0BA 3NV4A 3W9AA 3L2YA 4D7TA 3VUOA 4S2GA 4HKWA 1QOSA 2ZZQA 1ZBA3 3AX4A 3RPQA 4BHPA 2XJSA 3EBRA 3FFZA 2XBO3 2FZ1A 3BCWA 4I02A 3JBG3 1V6OA 2ZEXA 2WSUA 3RZHA 2R49A 2UWCA 1TE1B 3POYA 3TNQA 3JB8A 1W39A 4XXAA 4R8HA 4YW4A 3T3YA 4CP9A 1R093 3ILRA 3Q8FA 3CO2A 5FMDA 5I8SA 5KHJA 1POQA 2VOXA 4YRDA 1D4M3 5FWJA 5IK7A 3PDQA 4DRVA 1MS5A 1QWRA 3M2MA 2R041 2DFCA 5J09A 1E5SA 1TZOA 3LFIA 4WZFA 3MFCA 1LECA 2WO7A 3POIA 4AEDA 4B1MA 3LFMA 1G9DA 4KU7A 1M06G 4C0HA 5F8PA 1GU3A 3MIFA 3ZDSA 1LAJA 5FPBA 4CDQA 4ZU4A 1H1IA 1HQNA 3VHNA 4D6SA 5IK5A 4UI9L 4AEKA 4ATEA 1IGOA 3MIGA 5C33A 1UU5A 1UF2C 4XUNA 4YG3A 3ILNA 5SV5A 4DXSA 5FV3A 2PXJA 2ZMKA 3B3QE 3GCXA 4JV4A 4META 4BMEA 3VKNA 2XLAA 5AC92 3I7DA 5FY0A 3GJBA 2QJVA 1N1VA 4B7EA 2VZVA 4Y1VA 1LENA 5H9QA 4BQWA 1ZNPA 2F6BA 4NAMA 4W6YA 2OYZA 3I2IA 1XOYA 4XMIA 1EUTA 3POJA 4N43A 2HJIA 3ZXFA 2ZGUA 3B9IA 1CZSA 1RXFA 2I45A 4XBQA 1TG7A 2OPWA 3CJIA 3BTZA 1GMMA 1OPOA 1XC6A 2WN2A 2WWSA 2F4LA 2XJRA 3AKPA 1PMIA 4Q27A 4NWVA 1AUYA 3PU8A 2XKOA 2E6VA 1US2A 4XBLA 5GZGA 2BPA2 1MS8A 4W50A 1Z7S3 2VMFA 1XBFA 1L3JA 3RWNA 1ND3C 3FWEA 1NA1C 2GH2A 1OQDA 1RUJ2 2RM21 1QDCA 2QZ2A 4K40A 4FBFA 1ZZ8A 1LR5A 2MHFA 3EQEA 1UMIA 1UZZA 5BNPC 1UZWA 2D43A 2DCKA 2GMPA 3N7LA 2PHFA 2AACA 2BOJA 2VM9A 1ZVFA 1ZRCA 3CL1A 4LO4B 4RR3A 3UESA 1QJX2 5K4LA 1V6IA 1VJ2A 3EHKA 2RE9A 4QQ2A 1YQ2A 1S0JA 5KWRA 2H0BA 3IIIA 1ZBA1 4UBGA 4FAGA 1RUG3 2C9KA 2BW8A 2W5FA 4MGYE 3DYMA 5E6HA 5FPAA 5C8CB 2JE7A 4DXZA 5FMOL 2EIGA 1PM4A 5IYYA 4BJ0A 1BEV3 1IHMA 4LIVA 4DEQA 1R091 4QAWA 5K8SA 1OA4A 2WLPA 1SBFA 1QDOA 1HIXA 1DF0A 3JD71 2OVUA 4LJHA 2VJXA 3GZTB 3HD8B 3HJRA 4Y26A 3BIEA 3VBUB 3OUIA 5F37A 2WS92 4FPEA 1ULEA 3J7NA 4GJYA 1HLCA 1NXD1 4XE9A 3KZ4C 5E89A 3WQ0A 4K8FA 5JSRA 3KT7A 3VDCA 1KQRA 3SEEA 2EIBA 2WC2A 4MOAA 2MNGA 2RVAA 1S0CA 2WQZC 2PHDA 2X5IA 4JDNA 1LCLA 2D5FA 3AZWA 5C9AC 5JOXA 4BISA 4QKBA 2LRPA 3NVCA 3WP6A 3AFKA 1EPWA 3HAGA 5DDJ3 5FZIA 2J1TA 2YROA 1X8MA 1VRH3 5J3UA 2RDQA 3O1SA 2IXIA 4UYBA 1W0PA 2ZGRA 3THCA 4KGQA 1IKPA 1LOFA 3ZIWA 3ACFA 4P5HA 5FMBA 3I8TA 3WSOA 2D44A 5JXJA 2VULA 3RI9A 5C3RA 2OKXA 1S1AA 5FR3A 1F2NA 3GZAA 2YGMA 1OXCA 1GZTA 4ISQA 4A45A 4Y1XA 1BKZA 1UD1A 3C7EA 4YVWA 5CFDB 5ACA3 3VKMA 4JHZA 1GNZA 2Y64A 2GMEA 1XRUA 2LW8A 1HB1A 4RN5A 5FPLA 4LHLA 4WM7B 3KB5A 1Z7S1 1W04A 3V0BB 3A22A 2VZUA 1UX7A 4DIQA 4L99A 2CAUA 1OUXA 4GD4A 4JTNA 2CGOA 1B35C 2R1BA 1W8HA 5FP8A 1SLCA 3WOGA 4ZXKA 3MO4A 1WMDA 2GC0A 4W65A 3OF1A 5F3GA 4ZU5A 5FMOS 5LY2A 5BY5A 1UOFA 2PAKA 2GNMA 4DRRA 2J1EA 1FV3A 4RQPA 2ZTNA 1SLTA 3T4HB 1W6QA 4OUSA 3M70A 3QBQA 3ZMOA 2K9ZA 3WP4A 4Y22A 3PUSA 2VMHA 2ZGTA 1OH3A 3VKLA 4KQ7A 1S4CA 2QQKA 1G9AA 4UOJA 3Q8CA 5JXGA 2E63A 3VBSA 4D0QA 4DY5A 5I8TA 4N53A 3DYOA 1XNAA 2FMYA 3T0AA 4A7ZA 2GSYA 3NKTA 3VGIA 2PHUA 4LA2A 3IDEA 3O12A 2VMIA 1HRV3 3AP9A 3H7YA 1QOOA 4AZZA 5KBFA 5T5LA 3KV6A 3HPNA 5CFDC 4IEUA 3RVHA 4OHWA 2PHWA 2XR4A 3L2HA 5J98B 4WM7C 4X6QB 2GNTA 3AM2A 1WCUA 4I3PA 4OLLA 3H9AA 3M3CA 4WM8C 2YHJA 2GC2A 1RYYA 1UKGA 3ES1A 3Q8BA 5GZEA 4QPYA 1VBE2 1MVQA 2WZR1 3WG4A 2LM3A 1YWKA 5FZ6A 4URTA 2DU0A 3WW4A 3LA7A 4FFFA 3MLJA 1RUE2 5FYTA 3O1VA 2AC1A 4OMDA 2XJPA 5L9BA 5HV0A 1MS0A 1UW8A 1AL22 2D5HA 3ACLA 3I59A 1RXGA 4LKFA 5EV7A 4QQLA 4CCOA 1RUC3 2GP5A 4TWTA 3JCIA 3VBHB 4A6OA 2WS91 1UO9A 1LHOA 3GBFA 4HFSA 2IZWA 3H8XA 5A1FA 3I3DA 1EY2A 1ODNA 4QXKA 1UX6A 3IB3A 3V65A 1JUHA 2XL9A 4O9GA 4D3WA 5ACA1 1X33A 1I1EA 2DCZA 3SC7X 4ZZ5A 2P34A 2JG8A 5A80A 1VBA3 1DG6A 2QFEA 2Z4FA 4RS5B 1GOGA 4YFZA 1OQEA 1W05A 4HANA 2VW0A 1YRZA 2VUCA 1AR92 2A75A 4N7UA 1Q5OA 3H3UA 4IEOA 3ASIA 4O61A 1T2XA 1RMU2 1MZFA 5DAVA 3CJXA 5GJ6A 4F83A 3T0DA 4CCCA 2C4XA 2DUPA 2VQUA 2BWCA 3OEAA 2SBAA 1FV2A 2ADEA 4EZ4A 3TN93 5FPXA 4TTGA 2HWD3 3FLRA 1PK6B 3W20A 3CHXA 4M01A 2RS33 2NYYA 2GZWA 4BQYA 2HWC3 3NNGA 4XF0A 2RS11 5FZ0A 3ZXAC 5BNOC 4K3UA 4PQ9A 4Q8KA 4NIHA 1RUD2 4FSJA 4QB2A 5LZ6A 4OZXA 1AYN2 5F3IA 4AVBA 2E33A 5JR2A 2QE3A 4RGKA 4DXTA 3I2OA 3C7GA 5FYCA 2XMLA 2YY1A 4S2HA 4TLFA 5I0RA 1JZ5A 4PF1A 2OPKA 1ULDA 2BNOA 2WKKA 4RGGA 3VHRA 3VBHC 3ZN6B 3NRUA 3OSDA 1H2MA 2XGXA 5FDBA 4FPFA 4MHRA 1IOAA 3S30A 1HRV1 1F4HA 1LGCA 1RIRA 1YFYA 4Q4V1 2GAUA 5EHDA 4JDOA 3KT4A 4IEYA 2IXHA 3D0JA 2Q8DA 3K3OA 1AR82 1RITA 4HZFA 3WDYA 2AREA 3TNPB 1CAVB 4Q4Y2 4XFHA 3V64A 1LGBA 2PQSA 1K3IA 3WQ1A 2IVJA 2XOMA 4R4XA 4BIFA 4BXSV 4RS5C 2OT7A 2ZHKA 1YEWA 3VB9A 3DPRB 3KHCA 1JXNA 1VMHA 1J1LA 2IXLA 1ZRFA 4K9SA 2B45X 4NRMA 2FDGA 3DXTA 4CCLA 4IV3A 1RUI2 2W1UA 5LRRA 1CVNA 4JGZB 1HRI3 3WNOA 1CWPA 2WZ8A 4BPZA 5IAXA 1DZQA 1O3RA 1XPWA 4EWAA 1PIV2 2B4KA 3A0KA 1R1A2 3I54A 3NKGA 1W6PA 3J4UH 2VUJA 4Q4X1 3H1WA 1EAH2 4JQRA 5HCHA 1BVVA 3MPBA 3N4MA 1V9U1 2BNNA 2RJKA 2VO5A 1GZWA 5K0UB 1OD5A 1F8VA 1UOJA 2FZ2A 2ERFA 3OPZA 2V5DA 3N35A 3LOIA 1RJ8A 1YQ8A 5A33A 3KCCA 5C70A 2RS51 1PO23 1VBE1 1AX2A 1HQWA 2YDEA 3AZVA 3KT1A 3P3PA 2DDUA 2GDFA 5I0TA 4AVVA 4AYUA 1VBA1 3ETQA 2J1VA 3KCYA 5DZGA 4Y20A 4H2AA 1G86A 2YU2A 4HXCA 4W6WA 1AL21 3MFAA 3AB0A 1QHDA 2MPFA 4XDOA 1PVC1 2W91A 2P3JA 2W1QA 3R6SA 3VD7A 3OBAA 1Q56A 2W92A 5LA0A 1DGWA 3UJOA 2VAUA 5LWBA 1IQAA 3MUZ1 3DPRC 1O5UA 5FZ1A 1G9FA 3SLIA 3BOWA 4HL0A 2HWD1 4AVTA 2QBXA 4BWOA 4AI1A 1IS5A 3VD9A 1RUH1 4YGCA 2JD4A 5AVAA 3EB7A 2JG9B 4JGZC 4XEZA 3ZPOA 3HN1A 5CFCB 4JAAA 3IIAA 3ZSLA 2CWSA 5C3SA 3FLPA 4YW1A 4DS0A 2W87A 1SCSA 4LA3A 2VL4A 4C91A 5F3CA 1RUF3 3THDA 4HG6B 4SLIA 1E57A 5B4NA 1RMU1 2VZQA 3AYEA 4GWIA 3O1MA 5JXIA 5DAWA 1LHUA 1OF3A 2QQMA 4NHMA 5K0UC 4A44A 2ARXA 2B9UA 3GHNA 4XURA 1JYWA 3AMQA 4GH4B 5JOYA 3B02A 2ZGQA 3ALQA 1RUD1 1PM7A 2D6MA 2YU1A 5JSOA 1AYN1 5LBEA 4CZSA 3KCXA 2JICA 2Z79A 3CZJA 4AAPA 4CSWA 1GQPA 2JEMA 5DXDA 1VAMA 2OQ6A 5AFBA 4NIGA 1QJY3 4RHV2 3OCPA 2ZGLA 2GH8A 3VBFB 1NLQA 1PVXA 2ARAA 1HRI1 4K1ZA 4P9XA 3LZZA 5JSPA 4PDWC 1Q8PA 5ABJC 2R1DA 4D7SA 5IHRA 2JG9C 1CQ9A 4AVAA 4M0NA 4UFIA 2YC4A 3QH6A 5CFCC 3PVEA 4ONUA 4I01A 4CTEA 1VBB2 2B9VA 3J7LA 1ENSA 2A3XA 2VXRA 4M4PA 2VZRA 1HV1A 2ZCWA 3Q9OA 5HXVA 2ID4A 3AFGA 2KR2A 2VR4A 1NY71 4QU2A 4LO5B 1JODA 3P1IA 4QGLA 4ATFA 3D82A 1O3TA 2QQIA 2HWF2 3JB4C 4LKDA 4QPIA 1RL3A 2WT1A 5EWSA 1G9CA 1VPHA 4CCJA 1MACA 1RHI1 4FPGA 4FTSA 3VKOA 4LBNA 3SH3A 4BCUA 1EAH1 1QJU3 1KRIA 1BQPA 5JPNB 2UY8A 1BCXA 4YW6A 5GZFA 1JHNA 3PTYA 4DEVA 1MEC2 2NLRA 5FZ4A 2CAVA 4XW3A 3JUUA 3LKJA 4CDXB 4LIUA 2VCBA 1EV13 3ZXLA 3B69A 3LQCA 5FLJA 1N1TA 4BK5A 4CE8A 3VBOB 2OQ7A 3INAA 4Q4W3 1KGYA 1XYOA 4W8JA 2E26A 3PVOA 3IDBB 4AW7A 2RR13 2WNVB 3FUOA 3T2PA 3T30A 3W58A 1JUIA 1UIJA 1PGW2 4I0BA 4XVHA 2BJSA 4ORFA 4YM1A 3GZUC 1DQ0A 4BB3A 1BXHA 1XSQA 5L7OA 3WW1A 4Q0QA 4Y4YA 5FZOA 2WA3A 3ZSKA 1XU1A 3WINE 4RSUA 3KF5A 3NNJA 4Z8BA 3PVBB 1FI2A 3OGVA 2GALA 3AKSA 2X09A 5GM0A 5EJ3A 1ZREA 1W2OA 1LJ7A 2E7TA 4XZUG 3SEPA 5C3OA 2XDVA 1WCDJ 2VH9A 1HB2A 3U1XA 2VE1A 3KVAA 3AKTA 1LESA 2QQOA 1REEA 1W99A 1TME3 3WR0A 2BUKA 4HVQA 1O8SA 2ZMLA 4XF3A 2YXSA 3LOBA 1NX9A 2C1FA 2VOKA 5FZEA 4GWJA 2RHPA 2ZX2A 5A32B 3U78A 1IS3A 2FMDA 1DP0A 3RI8A 5FUPA 3RYPA 2CNAA 2DBIA 1BBT3 4LTAA 1REFA 3H0OA 5L9VA 3VBOC 4QD2A 1Y43B 2CDOA 3AL5A 1D2SA 3HQRA 3MV01 3FC0A 1JI6A 4XJ9A 1US3A 2WAAA 3M7AA 4PLOA 3VN4A 2WNVC 2EICA 3RDIA 4AFDA 4CUAA 2D3SA 1JZ8A 3ZYGA 1WCQA 3RZGA 4LR4A 2DWRA 2ZGNA 5G05L 2WLQA 2ZEWA 3WT3A 5A7QA 1AYM3 3PMEA 4LUKA 1X82A 1DIWA 1OFSA 3U10A 5JPMB 5LATA 3SH5A 2Y33A 1VRBA 1HXS1 2VTFA 2BTVC 3I3BA 5C5TA 2W52A 1AR73 2WDBA 3DV8A 1ZA7A 5FZLA 3N9QA 3ABZA 2JDNA 4CP9B 2R042 2A6XA 1FYUA 4AVSA 1J3RA 5JLVA 1ZRDA 1K5MA 5D8AB 2GC1A 1MS9A 4MXWA 4XYXA 2PHXA 1QXJA 2FCTA 2JE9A 1EV11 2D6KA 4FPLA 4PBPA 4AEDB 4EJRA 3BI3A 5A6QA 2CDPA 4C8DA 1CR7A 2UWBA 3POWA 5A3UA 5FZ3A 5LA2A 4FXGB 4CDQB 4GKYA 3PJYA 1UZVA 2NN8A 3USUA 4B7KA 2P2KA 1COV3 2VNRA 5F1RA 3P5BA 1H2NA 3T08A 1W8UA 3POBA 1GR3A 1OKOA 2A6YA 2NQYA 5FRAA 4GJZA 3U14A 3E6DA 4GZ9A 1QNWA 1T6GC 2BRTA 5JVVA 3VD5A 4K21A 1NE4A 2N7GA 5AFEA 4LUMA 2VZ3A 5A3PA 3LSEA 4AQSA 2B7YA 4YFWA 4AHWA 1ZM1A 5FXXA 3WP5A 4HBNA 1NKGA 4AEMA 5C7GA 3ZLIA 1UCXA 1W8OA 3AXEA 4EN0A 4YZ2A 3ITQA 4DINB 2EXHA 4IDZA 3M3QA 3CJIB 3E1F1 4PIZA 4DY3A 2HWB2 1AXZA 5A1AA 4XAEA 1WBFA 5JZGA 4MGSA 1MS4A 1WMEA 3EXUA 3O1OA 3J26N 2D93A 3FX3A 1UOGA 4YW7A 2R073 5DUXA 3ZXGA 2QZ3A 2RM22 4DUVA 5D8AC 3RSJA 3H1MA 1ZZ7A 1OT5A 1YI9A 4R9BA 5SV8A 4BQ3A 1FOD3 1ASJ3 2WAOA 1YYNA 2XWBB 4JHTA 3FUQA 3RQ0A 2YG0A 4ZPIA 1NCRB 1UY4A 1OA3A 1ZBE3 3PUAA 4IW3A 1ZBA2 3KMHA 4PI2A 1KFXL 5FJKA 2XBO2 4JKLA 5T5JA 1HB4A 1UKRA 3FL7A 5TSWA 1F35A 3SXWA 4E4SA 1DZRA 5AVPA 4CPBA 3W21A 5IK8A 3K48A 2VPVA 3AKQA 5LK5A 2Y6FA 4M0HA 1R092 3NJVA 1JZ7A 3E6CC 2BVBA 4PLMA 1LOEA 1MPXA 1NCQA 1D4M2 3F95A 4TLGA 2RDRA 1AR71 4NVPA 4XACA 2HWE3 1LGNA 1KJRA 2BNMA 1F4AA 3ROUA 3T2TA 3VD4A 2OZ6A 2VZTA 4IQPA 3FBMA 3ZR6A 3QACA 1OFNA 2ZX3A 1SPPA 2KM2A 4AI8A 1R083 2V72A 2W1SA 4BQ1A 1S2EA 5BNQA 2C24A 1GP6A 1XB9A 1BK0A 3UETA 1BMV1 5DPNA 4MGZE 1NT0A 1N1SA 4BMBA 4YZ5A 5FQ0A 3D0SA 5K7PA 1CPNA 3GZEA 1PGSA 4XJWA 2P3IA 1COV1 3HMYA 4LK6A 3SISA 1TVGA 2A1XA 3ZFFA 5H9PA 5IWFA 2FQPA 3OGSA 1GANA 4QXCA 3HNBM 3M1HA 4QHOA 1NCRC 5C4WC 3I2GA 5L9RA 1V6LA 2QNKA 1C5IA 1CESA 2WNUC 3CF6E 4FCAA 4MG2A 1FX5A 2CHHA 2C9AA 5T52A 4YZ3A 4YW5A 1D4VB 2ZPXA 5A7WA 4CRQA 2JDAA 4NHLA 1NLRA 4CVUA 4QQPA 4E4ZA 2EXJA 3BALA 4HN1A 3ZXEA 3RGBA 4OHXA 4XZPA 1W9YA 1SCRA 1Z7S2 3A7QA 5FJHA 3ZYJB 4YVWB 4YVSC 3UKTA 4BOWA 5A6ZA 3OPWA 4GQ7A 4XCBA 3AXDA 1JZ6A 2YGLA 1FT9A 4FTEA 3E5QA 1HJGA 1TNFA 5GLUA 1W2UA 4XFGA 5C71A 3BTXA 4NHKA 2WIIB 1VBC3 1S0FA 1DZTA 1OH4A 2JDHA 5LY1A 2DVAA 1OUSA 4JC1A 2XH6A 4PIXA 1ND2A 4CCEA 1U5YA 4HKLA 3GBWA 1H8TB 4FI9A 3I2HA 4CDWB 1W6NB 1W03A 4XAAA 3DUIA 1ZBE1 4RQPB 2LROA 4LE4A 4AFCA 4Q0SA 3AP4A 1OOPB 2HWB1 2WUHA 1W6QB 5FK8A 5FYIA 5CAZA 2R0FA 1RUNA 4IE4A 3DF0A 3J8F3 4XJAA 3VV1A 3U4XA 4Y22B 1H1MA 2ZZJA 5FP7A 3PIJA 5FKBA 3VBSB 2Q8EA 4N53B 2RV9A 5FZ7A 1L7LA 3KV9A 3ZYBA 1JYIA 1PO13 1C8NA 4HLTA 1Q8VA 2E9QA 2Y0IA 3QD6A 3AP7A 3RYKA 2XLGA 1JYCA 1VE0A 4AGRA 5H9SA 1KITA 3RJ2X 4R9CA 5F3EA 3KQ4B 4YPJA 4OYUA 5FOJB 3AP6A 4IGOA 5FYMA 1W6OB 1VLNA 4QPGA 1F9KA 4CP0A 4XQDA 2XBO1 1UU4A 3K46A 1LHNA 3J7MA 3KVBA 3JBG1 4P9LA 4M3CA 5FZBA 1PMJX 4AHYA 4CEWB 2WZR2 4AQ2A 4RFRB 4CCMA 1SMVA 2I07B 1LOGA 1NXMA 2VQAA 2JDYA 4IERA 1IQDC 5A3NA 5JOZA 1YQCA 5IATA 1N47A 3ZYRA 2BV4A 3BB6A 1SFYA 2WQ8A 2XXZA 5DDJ2 2VZOA 1H2LA 5GLWA 3T09A 1D4M1 1IS6A 2O8OA 2WFF3 1VRH2 5JMOA 4MGQA 3WF2A 2VCCA 4XCAA 2W2IA 2HEVF 2O1QA 1H8TC 4V1PA 4KWJA 4CDWC 4QMAA 4JVAA 2YPDA 4FO9A 1OMIA 3ACHA 2D7FA 2Z69A 3I59B 4RQPC 5EYXA 1OOPC 1TMF3 3HQUA 5CKQA 4O9EA 4E2GA 2DUOA 2FBEA 1ZZCA 1X50A 3RZMA 1RUJ3 5FYBA 4D94A 2Y60A 3NQHA 5ACA2 5IK4A 1QJFA 5CB7A 2OW4A 3FBYA 4XF4A 2P3YA 3VZJA 3SCHA 5CEHA 3VBSC 3OEBA 3NAPA 1XJAA 3PVNA 3WHUA 3E6BA 2CGPA 2JG8B 1AF9A 1LHVA 2AEZA 2O0OA 2Q0AA 1JHJA 4V2WA 2ZGKA 2YMZA 4AE2A 1W9TA 5C3QA 5HCAA 4EV0A 1JYXA 1CN1A 1X9TA 4ISRA 4IE0A 3U75A 2ZX4A 3WNKA 3ZKYA 3OBZA 4A3ZA 5C8CC 3G6JB 2JDZA 4CEWC 5J37A 2GN7A 4QX8A 1OSGA 5BYNA 5KHIA 2RS12 4X6RB 4QB1A 3ZFGB 4OHYA 2BEOA 4FAHA 1ND3A 4BQ2A 1NA1A 2VECA 3FJSA 4KWUA 1IPSA 5FLHA 1GP4A 4LEJA 1D2QA 1I3HA 5BNPA 4XBNA 1MQTB 2Q1ZB 3VBUC 4LT5A 3VZNA 1JOPA 4CUCA 1S0EA 3J7HA 4I09A 2D98A 2FDFA 1HRV2 3MZHA 4H14A 2W0XA 1YJLA 4Q4V2 2EA7A 2EVXA 1C8M3 3HIFA 4FXKB 3PHMA 4GULA 4V2VA 2O14A 1FNYA 3MUY1 4JKMA 1RINA 4OZOA 4UFLA 4R9DA 2UYAA 5CIRA 5DQ0A 5IJRA 1JN2P 4CCNA 5DABA 4GB33 4BZ4A 4Z1VA 3R4SA 4P9YA 1BJQA 5FAXA 1PX3A 1ZA4A 1VBD3 3CKHA 4K1YA 1DQ4A 3WDTA 1RUG1 1FPN3 3D4KA 2RJLA 2RMU3 3KGLA 4CU6A 2WABA 1UY0A 2B39A 5A3WA 4CDUB 2CV6A 5FBZA 1BEV1 1G7YA 1U0AA 2W3JA 2WT2A 2I74A 3I4IA 4Y4RA 4GIQA 3KV5A 4ET7A 4BLJA 3H50A 4DUWA 2W1WA 1PX4A 2DFBA 1W9WA 4COYA 4ZHNA 1SEFA 1UAIA 3PUIA 3I2FA 4PI0A 3TAYA 1EPZA 4IV3B 4XTPA 5JWPA 5KXBA 1QXRA 1W0NA 4Q4X2 1AJKA 1RUC2 3ZFGC 4BM8A 1JZ2A 1U5XA 4H3WA 1V9U2 4KG8A 5EFUA 5BNNA 2W46A 3AMNA 2XJVA 5CKNA 1DYKA 2H0VA 4X8NA 4COUA 1SACA 1W6PB 3LF7A 1SLIA 2JDPA 3IPVB 2F17A 2K2SA 2CGNA 1MQTC 3LPGA 4HPKA 5C9AA 5J48A 2XKPA 2XL7A 1V6NA 2JKXA 3I2JA 2RS52 3SHRA 3O1TA 1G9BA 1AX0A 1ZYBA 1VBA2 4Q1RA 3IBMA 3OGRA 2OUJA 4UF0B 2CY6A 1H0BA 4YNIA 5FTTC 5IVVA 4QX1A 5EQUA 1DQ6A 5DDJ1 5F2SA 3ZPYA 1VRH1 4AQ6A 1PVC2 5C3PA 4PLNA 3FE5A 3PJQA 5F5IA 4CXYA 4Y20B 1DQ1A 1BK1A 5GLVA 2J1UA 1GZ9A 2WJSA 4LO6B 3WCRA 2HWD2 1AR63 3R0RA 2E7AA 4GMP0 4CDUC 2AGSA 2RS32 1RUH2 2YBKA 2HWC2 3VZOA 4IV1B 4ZY9A 1SQ4A 3MF9A 1F5JA 3TWIA 1DQ2A 3N9PA 2X53S 5FPZA 5A7PA 2WNEA 2IFWA 4LBQB 3AMPA 1B35A 3IMMA 4I30A 4XOGA 4YWAA 2YZ4A 1W2NA 4ASMB 4S2FA 3ORJA 2WO1A 2VZPA 3ZO0B 3U4SA 3UK9A 3SCGA 1OVPA 2TBVA 4BQXA 4MXVA 1GLHA 1R64A 3PU3A 1XQNA 3ZFEB 3RMXA 4AK3A 2IWGB 1C8M1 1ULOA 3H7JA 1U5IA 4G9SB 5C5UA 2Y26A 1KXGA 1HX6A 2ZEYA 1GNHA 1J3QA 2V4AA 3FHAA 2ATFA 2PELA 1STMA 4M3CE 4LBKA 1ENRA 2R30A 5EPAA 2FCVA 5KHKA 3C7HA 2XPJA 4CP2A 2J7MA 2QCSB 3NO8A 4XQWA 1DHKB 1IG0A 2GMMA 3NNLA 1QU0A 1REDA 2VCMA 5FO9B 2FHRA 3HT1A 3TBDA 4UFMA 1LRHA 2KXLA 1HRI2 1RGSA 4YGDA 3BTYA 4Q1PA 4IE5A 3JZVA 4M4RA 4O7XA 5FYUA 1PMHX 4IV1C 2R0HA 1U12A 4LHSA 3GM8A 4E8CA 4WVVA 4WM8A 4CP1A 1VP6A 1WLDA 4OI4A 1JOBA 3PUQA 2E32A 1SZBA 2V09A 1A8MA 3THTA 1NY72 2FD8A 2X8KA 4LITA 2ZHLA 1CAXA 3CNAA 3C2UA 2DVBA 4QX3A 4LQRA 2Q5TA 1CPMA 1VALA 1PK6C 3KM5A 4P9JA 4XUQA 3ZFEC 3M3OA 4ES9A 3WQBA 4ZS2A 2W9XA 4AGGA 5JMCA 3HN3A 4GMP3 4IE6A 1RHI2 1DQ5A 4UFJA 4O65A 3RFRA 1Q8SA 1RUC1 4F7ZA 3M3IA 3R4UA 3DL3A 1WMFA 2TNFA 4UW4A 4HSJA 4Y3OA 5CISA 3VBRA 4WVMB 2QQVA 4LBQD 3USSA 1AR61 4FPOB 4IESA 4FQZA 5JR7B 3B01A 2C5DA 3O1PA 2SLIA 4FFIA 1V6KA 5DN2A 4AI3A 3LAGA 2VZ1A 2WBKA 4B4RA 3TEZA 1V6JA 2ZX1A 4IEPA 1PGL1 2ZAHA 4OMCA 1OURA 4XTMA 1KS4A 2YPJA 2ZMNA 2ZOEB 4ITCA 4AWDA 5A3TA 3NW4A 1AR83 1FXZA 4RD7A 5L73A 4Q4Y3 3M4FA 3UKNA 1CX1A 2HYXA 5KC6A 2P1BA 3WZ1A 4OVEA 5BNOA 3ENRA 4AFMA 2TUNA 3MIHA 3IZOA 4RL7A 2XJTA 5G04L 3TN91 2FDHA 3VDBA 5FZOB 3WLUA 3AYDA 2VOWA 1FNZA 1GQHA 3BU7A 3FN9A 3AP5A 2RS31 2HWC1 2WN3A 4U36A 3ECQA 3E5XA 1RUI3 1WUVA 1PHMA 5FPUA 2DUQA 4XXPA 3KQRA 1J3PA 1WWYA 4HVRA 1SBEA 1PIV3 1R1A3 4OUEA 3VDAA 2A71A 3DN7A 4DUXA 2GN3A 4Z2WA 1GWKA 1W6MA 2DTYA 2EIEA 1VMFA 1O6UA 2UWAA 5IVJA 5CKMA 5EJZB 4RS5A 1JU3A 4J6GA 4B29A 5E88A 3KD4A 1NZCA 3RNSA 4CA9A 1FMD3 1SLLA 3S7EA 1UYXA 3IMNA 1DYOA 5GLTA 2IUWA 3WUCA 2WFPA 2D3PA 1H4GA 2BU9A 4B4PA 1AZDA 1BZWA 2R063 1APNA 1S2BA 3DKQA 5LBBA 1D0GA 1LEMA 2A70A 2VC9A 1HXS2 5F9TA 3NV3A 4YM3A 5B2GB 1IKQA 3P3NA 3KSCA 1ALYA 2JWPA 2W94A 4OHZA 2YB7A 4GAZA 2O8QA 4D6QA 2FDIA 3WW3A 4HMZA 1LULA 4QM9A 1LHWA 4BDVB 3PIGA 5JUVA 4D6RA 3HQXA 3ELNA 4HOOA 1QJU2 1RVF3 5KHGA 4MH0E 5FXZA 3ZN6A 1O91A 4DQAA 4JKKA 4NHXA 3K77A 3NWKA 2WWJA 3PL0A 4LK7A 4NRQA 1EV12 5GKAC 3WVJA 1K5MB 3N36A 4LXLA 2G4IA 4AG4A 1YNAA 4L2NA 4Q4W2 4MXWB 1YIPA 4EN6B 1PO21 1YLLA 4NIIA 2PAEA 5IT6A 3AYCA 1CAVA 2RR12 2V4VA 5CNAA 1IG3A 2UU8A 1DGRA 3KV4A 3AKRA 4GH4C 3T2OA 3DPRA 1KD7A 4S2DA 3K4ZA 4AR2A 3OOXA 1F5FA 4HKOA 4UXAA 1QQP3 5IVYA 3BIWE 3I3MA 3NJXA 2CTVA 2QTWB 1V70A 2PHLA 4YG0A 1O3QA 3JQXA 2YV8A 4LKEA 5CBLA 2XHNA 3CLPA 2PHRA 5HBAA 2MEV3 1CZVA 3LB9A 3VBFC 1H1AA 2X29A 4BXFA 2F4PA 3OB8A 4E2SA 1G6NA 1SLAA 3S5QA 5F39A 2WINB 2L9LA 5T5OA 3ACIA 1RUF1 5T50A 4UFHA 1JW6A 3TOJA 3W5NA 3B94A 1WW4A 2BVVA 1UWWA 1VBB3 5D1IA 3WHTA 1A78A 5JZGB 1POV0 2BOIA 2JDMA 2H6CA 3LEGA 1I9RA 3S6PA 4MO3M 4JGYA 4M00A 1MR5A 1OPMA 3DKWA 4YM2A 2DURA 2BWAA 4CU8A 4E4HA 4UFKA 2Y6GA 4DPNA 1FMD1 1UNBA 2EALA 2EXIA 4BA6A 2CU5A 5DG2A 1MS1A 1UY3A 1ZZ6A 1UYPA 1CAWB 3BODA 1JBCA 1AYM2 3OPTA 4PDWA 4PQQA 1QJY1 1ULFA 5ABJA 3DXUA 2XVGA 4Q5OA 5CVRA 4CDXC 5FP3A 1RJ7A 3S5AA 2JDKA 3ST7A 2D6PA 1AR72 1XE7A 1PNGA 1Q8OA 5DAQA 5DMYA 4XHXA 1Y4WA 4Y24A 5FY5A 3ZYFA 4D69A 4UBHA 2B46X 1RVF1 1DDLA 4KWKA 3U11A 4UW5A 4QX0A 5J7MA 1ZZ9A 2VMGA 1OC1A 3ILFA 1Q3EA 2ZEZA 4WZCA 5DG1A 4LLFA 1LB2A 4ZU7A 2P6CA 2DBNA 3KGZA 4JX0A 5E1RA 3UGFA 2VXJA 3N9OA 2EAAA 3ZN5A 4AQTA 4Z2AA 5D21A 1BMV2 3DECA 1H30A 3IDCB 1SPPB 2A6ZA 3MF6A 4EWEA 1COV2 4XHBA 2D6OX 4FP3A 1WGPA 3LSDA 5LEKA 3FZ3A 1SLBA 3RYRA 4CEYA 1MS3A 5FQ0B 2VVFA 1PZ7A 4TXWA 4BQ5A 3EJKA 3K3NA 1GWMA 2VBPA 1QJU1 1QQP1 3LA3A 4XUPA 2E53A 3FHQA 2NMOA 4A7YA 3ZSMA 2PTMA 3ZM8A 5IFPA 1ZRIA 1O5LA 3ZFFB 2GC3A 3MIDA 3WDWA 2VTXJ 3O0VA 5HXMA 3ZX7A 1YCIA 1YIFA 5FZ9A 3UGGA 4MHUA 2OX0A 2MEV1 3R05A 4KBZA 1PZ9A 2BGPA 1W9SA 3KF3A 2WR9A 4Q4W1 5FY8A 2PLV3 1POV3 5CG9A 2RR11 1QEXA 4N9HA 4U2AA 5FYZA 4EE2A 5FZDA 4JTOA 4A2UA 2J22A 1NAEA 3MV11 4AI0A 4KU8A 1XXNA 4Y5TA 3WXPA 3O7OA 2R072 1YUDA 2BYVE 1C4RA 1X7NA 1O4TA 4CUGA 3O1RA 1NLSA 2BGOA 3LIHA 4EZHA 4LOSA 5CADA 3AK0A 3V0AA 3VZKA 4EN9B 4HN0A 2K46A 3UNPA 1ASJ2 4XILA 3ZYIB 2JIJA 2GNDA 4UAPA 4C1WA 3C7OA 2YUEA 2V73A 2LALA 4N43B 1OF4A 3MW4A 2ARCA 1AJOA 2VD7A 3AL6A 3OBTA 1ZBE2 1ULCA 4XFBA 1HN1A 2AEYA 2ORXA 2ZAAA 3O0XA 3OUHA 4XETA 5FY9A 2ZBJA 1QY4A 1ND2B 1TME1 1UN1A 3GALA 3HOBA 1O7FA 4FOYA 2HEWF 5D2AA 3POEA 4QHBA 4A6SA 3IAQA 4AGVA 4D8MA 5LK7B 1W06A 2A7AA 2HKXA 3VBOA 4A3XA 5I93A 4UW6A 3HBZA 4FT8A 4H55A 5M0TA 2WZPP 1HJFA 1BBT1 3RG0A 2WNVA 4UW3A 5GZCA 3KS7A 1GQGA 4AEDC 4XABA 4ZXEA 1YO8A 3K51A 4GALA 1Z0HA 2HWE2 1GV9A 4LNVA 3ZMNA 4BIOA 4YGBA 4LE3A 4MV2A 4CDQC 2C26A 3EMRA 3SITA 1OLRA 1WW7A 1BVP1 1LTEA 5JDBA 4RR3B 1TEIA 1R082 1EYBA 1KFUL 4BQ4A 2Q1MA 1AYM1 3GBGA 3JBG2 3OUJA 3PLQA 5C6CA 3WNLA 4OQ8A 1RUOA 3SKVA 1LOBA 5FZGA 2Y0OA 2W47A 4QPGB 4F3JA 3OYWA 5FFOC 2QKDA 5KHHA 1J59A 5DZEA 2VNVA 3FHIB 4MLOA 1LKNA 4W4ZA 1AL0G 1OVSA 3K4AA 5KC5A 1GOHA 1S2KA 1JU4A 3AJYA 4N43C 3WP3A 3IWZA 4MADA 4QT6A 4DO0A 1W0OA 4PJYA 4URAA 4AAXA 3CJIC 1HN0A 4IXLA 3B00A 2IFRA 3CZUA 3ETPA 4BU2A 1DGRN 4KWLA 4HSLA 1CIWA 3A23A 4LPLA 4CUBA 1SHWB 1CAUA 3H42B 2RM23 1T6BX
chains in the Genus database with same CATH topology
2ZGSA 2H6BA 3AMHA 2W39A 3W59A 2PLV1 1BYHA 4XQ4A 3VL9A 4OI0A 3OJBA 4LO8A 1GFF2 2X5IB 3OY8A 4JCKA 5F6KA 1WBLA 2D3RA 5L36A 1Q43A 3NAPB 3ES4A 1XU2A 4COWA 4RR3C 1VBC2 2DCTA 5JCTA 3L9JT 5FREA 2BBVA 1OQ1A 1U5ZA 2ET1A 2TEPA 3TYJA 2VW2A 4QPGC 1S55A 1DYPA 2BFUL 4JRAA 3BOPA 4OI1A 5D8AA 3JD73 4EWDA 1IPKA 3LWCA 4XJUA 1ND3B 3J8F2 1NA1B 1YXWA 3N7MA 2R071 5DUWA 1VIWB 4YW2A 2XJUA 5BNPB 5JIUA 4QQOA 1PO12 1FOD1 1ASJ1 5DUUA 1NG0A 4R52A 3RJRA 3VDDA 3MICA 4DZGA 1LOAA 5FLIA 4M3CF 3M3EA 2D40A 1RUG2 2QVSB 2X5IC 1XNDA 4Z92B 3QOPA 1BEV2 4R9AA 2ZJCA 4YM0A 3NAPC 4B8EA 2UYBA 4B4QA 1VR3A 3WCSA 4OULA 1QF3A 3JU9A 4KNCA 5J96B 1ONAA 1LOFC 2A3YA 2WFF2 4FVVA 1YFXA 3NV2A 3WY6A 2HWE1 3IM0A 4X8PA 1RTVA 2P37A 3MYXA 4YVWC 5AC93 1TMF2 3URFA 2ZX0A 4AHXA 2QDRA 4P9IA 1R081 3GF6A 5BNNB 2VGDA 4Y1UA 5EYYA 4OFGA 5C9AB 4HPKB 2DU1A 4FP2A 4RFT0 4XFIA 1NCRA 2XJQA 2Z2SB 5C4WA 3M8LA 4IETA 3RMYA 3N7JA 3ZXKA 2WNUA 3O0WA 3T1MA 4I0AA 3C3VA 3BTAA 3VZLA 3SCFA 2BFUS 1KDKA 1GZCA 3WDXA 5DZFA 1EP0A 5DUVA 4EN7B 1UU6A 4PF5A 3VZMA 3WNXA 4IEQA 2HYKA 5FO8B 4YVSA 4E27A 4FPJA 1CJPA 2VNGA 1S0GA 1UMZA 3POSA 4N53C 3FFQA 3CEWA 1DLLA 4HETA 3VHOA 5HI0A 4EN8B 1QJX3 2XWJB 1LU1A 3DGTA 4LHKA 1B35B 3T1LA 1NYWA 5A3MA 4FQ4A 2VG9A 1WD4A 1VBC1 1V00A 1C8M2 3WDVA 5BNNC 5L19A 2WZR3 1C1LA 4XFAA 1KS5A 2IXCA 4Z07A 4GB32 4YARA 5LRSA 1S0DA 1Q8QA 1J58A 4FOVA 1VBD2 4PBOA 1FPN2 4LBOA 1PZ8A 5E8AA 3WG1A 5HBAA 3B93A 2EF6A 2RMU2 1ENXA 1HQLA 1QMJA 2AR6A 4Q2FA 1NQDA 1CGPA 3J8F1 2WS93 4HT1T 1ZZBA 4CYDA 2DV9A 1A3KA 3B9CA 2DYCA 2ZGMA 1XE8A 1HDKA 2B8MA 1PO11 4INDA 4MVTA 3HT2A 1I5ZA 1WCKA 5H9RA 1RB8G 4P9GA 4IEXA 1WA4A 3E97A 4SBVA 3WD5A 5AC91 3S7IA 2CL2A 1Y9QA 1RC6A 4LULA 2JG8C 4WM8B 2CYFA 3ATGA 5K9YA 4NO4A 3MPPG 4FPCA 1H8TA 1MZ6A 3FMGA 1W6NA 2IC1A 4CDWA 4XPVA 4KBBA 1CAXB 2GNBA 2WFF1 1OOPA 1QH6A 2RS13 3MIEA 1DGWX 3OGJA 1O4YA 5BUVA 2Q30A 1N3OA 3N7KA 5T5PA 1TMF1 1AR62 4Z82A 2ARBA 2OUHA 4G4FA 2VVEA 5JAXA 1RUJ1 2VOVA 4TZDA 4PCRA 4IEZA 1PGL2 1GZWB 3MLLA 3VBRB 3S0MA 4DMIA 4E9KA 4Q4V3 2Q8OA 5A33B 4FPHA 1JH5A 1W6OA 5C8CA 2W08A 1QJX1 3AZYA 3N3HA 4L92A 4CEWA 5BPXA 1IPJA 3TN92 5HCBA 3ZIXA 5F6LB 1D0HA 2WSVA 2JKBA 5BNOB 3U0ZA 2XHKA 3VBUA 1R1ZA 2DVFA 3JQWA 4GA9A 2CWMA 4IV3C 4QGMA 4K7JA 4Q4X3 1UPIA 3MIBA 1XYPA 4W6XA 3RS6A 4AFAA 1V9U3 2A6WA 2G9FA 4IL7A 5JOWA 1KJLA 5I0SA 5EZWA 1WCSA 1DGLA 4NOTA 4B3NA 1W6MB 2RS53 1G8WA 1VBE3 4MGIE 3VBRC 2BQPA 3GNEA 4GB31 4WVWA 5BXXA 2A3WA 3V56A 1A6CA 3ME2A 2P3KA 1VBD1 2JECA 4WVZA 1RUE3 4I0WB 1J1TA 1FPN1 1AL23 3TB0A 3APBA 2RMU1 4AFBA 3ZN4A 1PVC3 3NV1A 3VKFC 4BE3A 4AHZA 5CFDA 2R6QA 5BV6A 1I6XA 2PAMA 3D6EA 3ZFGA 2EXKA 3NJZA 2DCJA 1NQJA 4E4DX 1QOTA 4WM7A 2K0GA 1RUH3 4KH9A 3WUDA 3NSTA 3B7MA 1MQTA 5JI7A 4WV8A 3QH7A 3R4DB 4RGAA 1AR93 1ENQA 3MDPA 3LGRA 3OGGA 3PMSA 1VAVA 4ASLA 1RMU3 4LBLA 5KXCA 2XLFA 1PO22 4N7IA 3UJQA 4AI2A 3MEPA 2PFWA 2ZABA 2KA3A 4QX5A 2GU9A 4Q29A 2Y38A 4GKXA 1NE6A 2BGCA 4KGGA 1WLTA 1UIKA 2ZHNA 1JTZX 4QPIB 1LU2A 1RUD3 2E51A 5T3NA 1AYN3 1OLQA 3WQ7A 4CDUA 1XNKA 1WW5A 2XG3A 4J1XA 4G3YC 4L97A 1VAKA 1URXA 3OD4A 2AUYA 4I3GA 4A7KA 3A0NA 3AJZA 2ZGPA 1O4ZA 1RUF2 3IPVA 3V0BA 4N9IA 2A73B 1QKQA 1WLCA 5L7OB 3KLSA 3SMHA 4Q8LA 4HK9A 2NPIA 2PA7A 2EAKA 1FMD2 2WQ4A 2JENA 4WBBA 4JGYB 4F8AA 4I2OA 3VBHA 2ZACA 3THPA 3WV6A 1RUE1 4LBMA 3TRSB 1RHI3 2AZ5A 4MSVA 1QJY2 2R062 4QPIC 1EAH3 5CA6A 4MGKE 4COVA 3MI8A 5JI9A 4IV1A 5E16A 1JOJA 3MW2A 3E5UA 3WDUA 1A8DA 5T55A 4PDWB 1XNCA 1SFNA 4LBQA 1H9PA 1H9WA 2AENA 3EO6A 4MUVA 5ABJB 1ZRRA 2XVKA 3G7DA 3GHMA 2VUAA 1RVF2 2JJ6A 1IZ3A 4JDMA 4KG0A 4NPRA 1FATA 4YZ1A 1AR91 1AVBA 2YC0A 3WW2A 4FOQA 4EROA 1LODA 1PK6A 2LTNA 3ZFEA 1TQ5A 4DNYA 1H4HA 3QCWA 4JRLA 4LO7A 1X36A 2OA2A 5FCCA 2ILMA 5L7OC 2LUWA 2XB6C 3H1YA 3HR9A 4GMP1 1KDMA 4YZ4A 4YW3A 4AEJA 4GWNA 1OA2A 4XFCA 4JGYC 1QQP2 4P9WA 1XNBA 1Z78A 2WL1A 1H8VA 2HEYF 4XF1A 3SH4A 4CEYB 1V6MA 4Y1YA 2I2SA 4GXLA 2YYOA 1GYKA 5LEJA 2MEV2 4COZA 4XJ8A 1WW6A 3UL2A 4C1XA 2IXJA 2C0ZA 4BH9A 4K20A 4QM8A 4H7LA 3UKVA 4LHNA 5CU1A 1AR81 3MGUA 1MZ5A 1HKDA 2VQ0A 4Q26A 4Q4Y1 3USUB 1DBNA 2VU9A 2PHTA 4JGZA 3AMMA 4Q0UA 4Q0VA 2ZKLA 4RHV3 3ZXJA 3D8CA 5GZDA 2VY0A 2QQPA 1HXS3 4J1WA 3NL1A 3UV9A 3VL8A 3V0AB 1RUI1 2DTWA 5JIAA 2A5ZA 1QXPA 5I91A 1PIV1 1TME2 3I2DA 1R1A1 3MW3A 5K0UA 4WVMA 3RRDA 4ES8A 1GSLA 4L11A 1DU3D 2UY9A 2QUOA 4CEYC 2UURA 4FPKA 1BBT2 3H8UA 1AHSA 1K5MC 1WLWA 2DF7A 4NR1A 3MLKA 4XMAA 1C57A 1QJZA 2NM1A 2VW1A 4AXOA 4DOUA 4FTBA 2HWF3 2QDNA 2VVDA 2Q4SA 1GICA 1H2KA 2AYHA 1YFUA 4PIYA 3X29B 1C28A 1PNFA 4LLOA 2R061 1GBGA 1UL9A 1DFQA 4K6BA 3HWJA 3O5SA 2JX9A 2VNOA 4QGNA 3LCPA 1MEC3 4MX3A 2JG9A 4TSVA 3OBRA 2PYTA 4XJZA 5CFCA 1C5HA 4IEVA 2R32A 4DB5A 1M4WA 1YFWA 3OYWB 3B5LB 2R16A 4Q0PA 4OI2A 1NCQB 4RA0A 1HW5A 3OTFA 4MZUA 5T54A 4D7YA 2XUMA 5F5QA 3OD0A 1AXYA 1Y7BA 2DCYA 4GH4A 2G9GA 2ES3A 2P17A 2PLV2 5JZGC 1N3QA 3AZZA 4ZKTB 4XF9A 3J9SA 1CAUB 1CONA 5C8WA 4IEWA 5KXEA 3IKWA 1O3SA 5HCFA 1YI7A 3VHPA 2ZS6B 1CJDA 3AYAA 4XIOA 2NMNA 4N90A 4R4ZA 1MVEA 4E2QA 3VBFA 4YLZA 3WX5A 1C3HA 3OY8B 3WG3A 1S0BA 1QNYA 5CG8A 2NZ9A 2WT0A 4RHV1 4Y1ZA 1S0IA 1XYNA 1QH7A 4MYEA 5FO7B 2IXKA 5GLZA 1VB2A 3O14A 4DFSA 1WD3A 4FOWA 4XIKA 1ZX5A 3U07A 3RZZA 1NOVA 3FLTA 2D6NA 1NCQC 1ULGA 1YHFA 4NWWA 1OKQA 1VBB1 3PNAA 1Y3TA 2Z5WA 5FOBB 4HVOA 1IS4A 1FOD2 1CD3G 1QGLA 2PQQA 3LA2A 2ENRA 2B5HA 4NN0A 5KXDA 2A6VA 2JXAA 2HWF1 2ZGOA 3AZXA 3IN9A 4AF9A 3QLQA 1VB4A 4YG6A 4OUMA 2AH2A 1X8EA 2ETEA 3VDDB 1C1FA 1TNRA 5GALA 3ZVXA 2R043 4CDXA 2Z42A 1LEDA 1LOCA 2ET7A 4LBJA 1YJKA 1MEC1 4Y5Z0 3ZFFC 2B42B 2NP0A 1F31A 1HV0A 4HK8A 3D5OA 4BLIA 1UZYA 2ZKNA 2D97A 2DVGA 3ZSEA 1PGW1 5IUQA 1AX1A 1UPSA 4XDQA 4XFFA 1SDWA 3CU7A 3A4UA 2V5YA 2WA4A 2W68A 4TYSA 2DVDA 4L8QA 1MZEA 2XVLA 1B09A 4M3CB 4OHVA 4C90A 1SBDA 5I0UA 3WG2A 4BYYA 1CAWA 4L9BA 3ZXDA 1N1YA 2E7QA 4KL1A 3IT8A 1GKBA 4YGEA 4AI3A 3ZYPA 5C4WB 5I8YA 2WNUB 5A32A 2HWB3 4FPYA 3SNMA 3GYDA 3VDDC 2ZA9A 5J36A 1ND2C 1OI6A 2OZJA 1AXKA 1CX4A 4AVCA 1OHFA 1FAYA 5A3LA 5EXOA 3BPZA 3H3ZA 1N3PA 2D6LX 2OIIA 3ZSJA 3VLBB 1POV1 2PN5A 3JD72 4YVSB 4GWMA 4P14A 4QQHA 2ZHMA 4H7MA 4C0BA 3NV4A 3W9AA 3L2YA 4D7TA 3VUOA 4S2GA 4HKWA 1QOSA 2ZZQA 1ZBA3 3AX4A 3RPQA 4BHPA 2XJSA 3EBRA 3FFZA 2XBO3 2FZ1A 3BCWA 4I02A 3JBG3 1V6OA 2WSUA 2R49A 2UWCA 1TE1B 3POYA 3TNQA 3JB8A 1W39A 4XXAA 4R8HA 4YW4A 1R093 3ILRA 5I8SA 3CO2A 5KHJA 2VOXA 4YRDA 1D4M3 5IK7A 4DRVA 1MS5A 1QWRA 3M2MA 2R041 2DFCA 5J09A 4WZFA 3MFCA 1LECA 4AEDA 1G9DA 4KU7A 1M06G 4C0HA 3MIFA 3ZDSA 4CDQA 4ZU4A 1H1IA 1HQNA 3VHNA 5IK5A 4AEKA 4ATEA 1IGOA 3MIGA 5C33A 1UU5A 1UF2C 4YG3A 3ILNA 5SV5A 3B3QE 2ZMKA 4BMEA 4JV4A 4META 3VKNA 2XLAA 5AC92 3I7DA 2QJVA 1N1VA 4B7EA 4Y1VA 1LENA 5H9QA 1ZNPA 2F6BA 4W6YA 2OYZA 4XMIA 4N43A 2HJIA 3ZXFA 2ZGUA 3B9IA 2I45A 4XBQA 3CJIA 1OPOA 2WWSA 2XJRA 3AKPA 1PMIA 4Q27A 4NWVA 1AUYA 2XKOA 2E6VA 4XBLA 5GZGA 2BPA2 1MS8A 1Z7S3 1L3JA 3RWNA 1ND3C 3FWEA 1NA1C 1OQDA 1RUJ2 2GH2A 2RM21 1QDCA 2QZ2A 4K40A 4FBFA 1ZZ8A 1LR5A 2MHFA 3EQEA 1UZZA 5BNPC 2D43A 2DCKA 2GMPA 3N7LA 2PHFA 1ZVFA 1ZRCA 3CL1A 4LO4B 4RR3A 1QJX2 1V6IA 1VJ2A 3EHKA 2RE9A 4QQ2A 1S0JA 5KWRA 2H0BA 1ZBA1 4UBGA 4FAGA 1RUG3 2BW8A 4MGYE 5C8CB 2JE7A 4DXZA 5FMOL 2EIGA 1BEV3 1IHMA 1R091 5K8SA 2WLPA 1OA4A 1SBFA 1QDOA 1HIXA 1DF0A 3JD71 2OVUA 3GZTB 3HD8B 4Y26A 3VBUB 2WS92 4FPEA 1ULEA 1HLCA 1NXD1 4XE9A 3KZ4C 5E89A 3WQ0A 4K8FA 5JSRA 3KT7A 1KQRA 2WC2A 2MNGA 1S0CA 2WQZC 2PHDA 2X5IA 4JDNA 1LCLA 2D5FA 3AZWA 5C9AC 5JOXA 3NVCA 3WP6A 3AFKA 1EPWA 3HAGA 5DDJ3 2YROA 1X8MA 1VRH3 5J3UA 2IXIA 1W0PA 2ZGRA 4KGQA 1IKPA 1LOFA 3ZIWA 4P5HA 3I8TA 2D44A 2VULA 3RI9A 1S1AA 1F2NA 3GZAA 2YGMA 4ISQA 4Y1XA 1BKZA 1UD1A 4YVWA 5CFDB 5ACA3 3VKMA 1GNZA 1XRUA 2GMEA 4LHLA 4WM7B 3KB5A 1Z7S1 4L99A 2CAUA 4JTNA 2CGOA 1B35C 2R1BA 1SLCA 3WOGA 4ZXKA 4W65A 1WMDA 2GC0A 3OF1A 5FMOS 4ZU5A 5BY5A 2PAKA 4DRRA 2GNMA 1FV3A 4RQPA 2ZTNA 1SLTA 1W6QA 4OUSA 3M70A 3QBQA 3ZMOA 2K9ZA 3WP4A