3NV2A

Crystal structure of human galectin-9 c-terminal crd in complex with n-acetyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv2A00
2ES3A 4NO4A 2D6PA 4Q1PA 4OZXA 2DVAA 3ILNA 4YW3A 3R4SA 4Q26A 2D3RA 2FHRA 5JOXA 3FLTA 4FQ4A 4UW3A 1LGNA 1Z0HA 4FPKA 3UL2A 1W6QB 5JLVA 5GZCA 2H0BA 1SLIA 1LULA 5HCBA 3UJQA 1QGLA 3FBYA 3VV1A 3WUCA 2JJ6A 3M2MA 2GN7A 3IPVA 5IUQA 1GANA 3OPZA 3U4XA 2NN8A 3O0VA 2WQZC 1GICA 1W6OB 1SACA 1QOSA 1HKDA 4GWMA 4LBJA 2NP0A 1SBFA 1MS5A 3AYDA 4BLJA 3WDVA 3WLUA 1QF3A 1QNWA 1B09A 1VIWB 1LHVA 3V0AB 4LBNA 5H9PA 2AENA 2NMNA 4M01A 4YW5A 1Q56A 1ENQA 2R49A 3O5SA 3ENRA 3AYAA 2CNAA 3QCWA 4Y20A 2HYKA 2EXJA 3FUQA 3AZYA 3O12A 1D0HA 1DGLA 1O4YA 3ZPYA 5JMCA 4ATEA 5GLWA 1MS0A 3AFKA 4TZDA 3V65A 2DURA 1YIFA 2D7FA 1V6KA 1QKQA 3WDUA 2YROA 1FV3A 2GNDA 1LU2A 3OBTA 2GMMA 2UU8A 1N3QA 2CTVA 2OUJA 2D6LX 2WT2A 3OJBA 2DVBA 4XJ9A 3PVOA 5DG1A 4FOWA 1W6MA 2DTYA 3SISA 5JVVA 4YM3A 4XZPA 3AJYA 1FAYA 1QNYA 1G9DA 4PQ9A 3UJOA 4BMBA 1LGBA 4R9BA 1V6OA 3PVEA 1DQ4A 3WZ1A 4GALA 1CVNA 2DUPA 3AP4A 2ZKNA 3UK9A 1N1YA 3O0XA 2ERFA 2OW4A 4Y26A 2PELA 3W59A 4YW1A 1CR7A 2R1BA 2VH9A 3T1LA 3ZSMA 2P3JA 1ULGA 1KRIA 2A3XA 2D3PA 3SNMA 1LJ7A 3DUIA 2Q5TA 5FRAA 4LBOA 3USUB 1WLWA 4FPLA 5GZGA 4DQAA 1APNA 4YW2A 1S0GA 4F83A 5F9TA 4XJAA 1DLLA 2ZGUA 4FOVA 3IMNA 4PF5A 1SLCA 4DRVA 2CWSA 4WZFA 5F5QA 4BPZA 1DQ1A 2W68A 4DS0A 3WDTA 1W6PB 1Q8QA 4XBNA 5JDBA 4AGVA 2Z42A 4GKYA 1ZM1A 2DVDA 2WSUA 4R9DA 3NWKA 4XMIA 2NM1A 5FREA 2CYFA 4ITCA 4JCKA 1A8DA 1ZA4A 4M3CE 5CNAA 1QDOA 1N1TA 2P3IA 1FX5A 2YV8A 3H0OA 4UW5A 5LK5A 1MS4A 2PHUA 4YFWA 2RHPA 4ISQA 4Y1YA 3IPVB 1C4RA 4GXLA 1GZWA 2V73A 3AP7A 3N36A 5H9QA 3WCSA 3V0BA 1G9FA 4ATFA 1V6IA 2ZZJA 5IK5A 1OFSA 1LEMA 2VW1A 4M00A 1KITA 4Z8BA 4K21A 1AX0A 4U2AA 2P2KA 1Q8VA 1ENSA 3BIWE 3AP6A 1GBGA 3WDXA 1JBCA 3M3OA 5EYXA 2E53A 3ZYPA 1DQ0A 1Q8PA 3LSDA 3NV4A 4Y20B 3WNXA 4GKXA 2ARXA 1ULDA 1VALA 1YRZA 2PHFA 3M3EA 2ZGMA 2PHXA 1W0OA 2VXRA 4FOQA 3N7MA 2I2SA 4K20A 1CN1A 3D6EA 3R4UA 1DYKA 1CPNA 5E89A 5JOZA 1UAIA 1GKBA 1ULFA 3WG3A 2ZAAA 4L8QA 1JOJA 2UURA 4FQZA 4K1ZA 3BTAA 3M1HA 1DBNA 2D43A 1QU0A 1I3HA 2D6NA 2R0FA 5T52A 3VUOA 5IK7A 3R05A 3TAYA 2VW2A 1C57A 4XIOA 1OKQA 2PHTA 1AXZA 2YY1A 4ASMB 1RITA 1SBDA 3ZSJA 5GALA 4AGGA 4BQ1A 5HCAA 1CQ9A 2D44A 2ZGQA 3FFZA 4FPJA 4XILA 4XJUA 3ATGA 5DUWA 2ENRA 3WDWA 1V6MA 3N7JA 4Y24A 1AXKA 4XXPA 1G9CA 3PVNA 4DPNA 4YFZA 3BODA 1MS1A 1N1VA 1SLTA 1S0CA 2D6MA 3VKMA 4TYSA 1FNZA 5E8AA 4AVSA 4FPHA 1H9WA 1DYPA 2OUHA 3M3QA 1W0PA 3AX4A 5JOWA 4ZKTB 4UW6A 4XJZA 2D6KA 5DZFA 1DZQA 4XBLA 5IK4A 4UW4A 1JUIA 3GNEA 2DUOA 3KQRA 2E51A 5EWSA 3SH5A 4M3CA 3ZXJA 1VAMA 4YZ4A 5CBLA 4YGEA 1A78A 1N1SA 1UMZA 4AWDA 1V00A 4XHBA 1MVEA 1VAVA 2YXSA 3AYEA 1LEDA 4MYEA 1HLCA 4XTPA 5T55A 4H55A 3HMYA 2W39A 2GDFA 1MS3A 2E6VA 2A7AA 3T1MA 2DTWA 2JE9A 1GZWB 4YM2A 3WG1A 3A0KA 2ZMNA 2WSVA 2SLIA 5EYYA 1KQRA 3I8TA 1WW7A 4DRRA 4P14A 2ZGTA 3JUUA 4WVVA 3VKFC 2WT0A 1WLDA 5DUUA 1BZWA 1H30A 2ZHNA 4KBBA 3A0NA 3N35A 1GNZA 2CL2A 5GLZA 3M3CA 1YO8A 2GN3A 4JRAA 2XB6C 1RINA 2P3KA 4Y22A 4LBLA 4RA0A 4YZ2A 4FPYA 1MR5A 2A5ZA 2C5DA 1LHNA 1SLLA 1IS6A 1AX1A 3L2YA 1F31A 4Q8LA 3SLIA 3PJQA 1SCRA 1GSLA 3Q9OA 4Q27A 2A3WA 4BM8A 1UL9A 1IS4A 2DUQA 1KDKA 1X50A 1LHOA 4Q1RA 4YG6A 1FNYA 1WCSA 2EALA 3IN9A 4XOGA 1LCLA 1LHWA 2ZMLA 1W6NA 3ILFA 4YZ3A 2P37A 1LOFA 2VUAA 1CJPA 3WG4A 4BOWA 1ONAA 3OYWA 4D69A 1C1FA 4XMAA 1U0AA 1LOAA 3FUOA 2YZ4A 2GNMA 4YG0A 4CTEA 4DFSA 1CIWA 2A6WA 1LTEA 1BXHA 2WKKA 3C2UA 2DV9A 5T5JA 4FP3A 4Q8KA 1AX2A 3FLRA 3O0WA 1LOCA 1Q8OA 4SLIA 4XIKA 2AGSA 3KM5A 3ZXKA 1I1EA 3MPPG 2ZHLA 3MW2A 5HCFA 3DGTA 1LGCA 5KXCA 2R16A 2ARBA 4P9WA 3OY8A 2FMDA 2A3YA 1BYHA 5T5OA 1WUVA 4NOTA 4CZSA 3VKNA 1SCSA 1UKGA 3IM0A 2DYCA 2ZGPA 5KXDA 4FPGA 3VKOA 1UN1A 2KM2A 4AVVA 2PHRA 3D5OA 1SFYA 2BQPA 4HL0A 4P9YA 2JE7A 3NV3A 1GV9A 2XG3A 1G9BA 3ZXLA 1PZ8A 1V6LA 1V6NA 1QDCA 5GLTA 1R1ZA 2E7TA 3POYA 4XYXA 3RMYA 1QMJA 1QOTA 1JXNA 1AJKA 1YXWA 1ULCA 3AXDA 1OQ1A 5T54A 2D3SA 1MZ5A 4GWNA 2EAKA 1S0JA 4FPEA 4WV8A 4XBQA 1F9KA 1BQPA 4FPOB 4XTMA 2W08A 3RQ0A 1W6MB 1UX6A 5GZEA 1ENRA 2NZ9A 2EIGA 1PZ9A 4LBQA 2CWMA 4LBQD 1DIWA 4XJ8A 4FP2A 5AVAA 1UZYA 3ASIA 1CESA 3ZXEA 5IT6A 5DUXA 1GLHA 1SLAA 1JHNA 3B69A 1AVBA 1C1LA 3SH3A 4LBMA 1AF9A 2WJSA 2ZGRA 5GZFA 1JYCA 3WHUA 1WLCA 5JOYA 1DHKB 1W6PA 1IS5A 2R0HA 1SLBA 2ZGSA 1G7YA 5SV8A 2OVUA 3MW3A 1YYNA 2WLQA 5T5PA 3ZVXA 4YZ1A 1LOGA 2A71A 1WW5A 2EXHA 3AXEA 3PMEA 2ZBJA 4LBKA 5KXEA 3B3QE 3I4IA 3IKWA 1W6NB 1IKQA 4BLIA 4FPCA 3INAA 1G8WA 1PZ7A 5DZGA 2NMOA 4I30A 1SBEA 1JN2P 5EXOA 1MACA 4C1WA 1CONA 1WD3A 2A70A 2DVGA 3OYWB 5L73A 1VLNA 3B9CA 1HQWA 5E88A 1MS8A 2GMEA 2AR6A 1FYUA 3AZWA 3RSJA 4AYUA 2LALA 2UWAA 1S0IA 2ZABA 3NV2A 5CB7A 2A6YA 5DXDA 1WBLA 3V0BB 4JC1A 4FVVA 1GZ9A 2VY0A 2WT1A 4HANA 1WBFA 2EXKA 1HDKA 1ULEA 2A6ZA 2AYHA 1S0DA 3D4KA 3OY8B 4R9AA 3SH4A 2NYYA 3MW4A 1XQNA 3APBA 3WG2A 1J1TA 1Y7BA 3WV6A 3SITA 4XJWA 1DQ2A 5KXBA 4Y1UA 4PBPA 2AUYA 2JD4A 4Y1XA 1LESA 4YW4A 5CA6A 2GNTA 2GALA 2DU1A 2GNBA 4W65A 5GZDA 3ZSLA 1BKZA 1N3OA 1LOFC 3OGGA 3RG0A 3T2TA 1V6JA 1MS9A 3B01A 1LODA 3AK0A 4YGDA 5DG2A 2DWRA 1LU1A 2AREA 4C1XA 2ZMKA 1GYKA 1TEIA 1W6QA 4WVWA 2CY6A 3TB0A 1H9PA 2ZGKA 3POSA 3AP5A 3NV1A 3ZYRA 4YG3A 2GMPA 1F5FA 5DUVA 3WCRA 1LHUA 4YGCA 5IK8A 1W6OA 4M3CF 4Q2FA 3ZXFA 1S0FA 3FLPA 3RRDA 3W58A 1JW6A 4AVTA 2VW0A 1WW6A 3JU9A 2ZACA 1LENA 3LSEA 4FOYA 1AXYA 4LBQB 5BYNA 1DFQA 4ZXKA 1HQLA 2A75A 1O4ZA 3N7LA 4XHXA 5GLVA 3V0AA 1S0BA 1AJOA 1GNHA 3A4UA 1N3PA 5GJ6A 2JDZA 4IQPA 1WW4A 2SBAA 3N3HA 1JYIA 2PHWA 2YMZA 3BOPA 4XDQA 1S1AA 1LOEA 2ZA9A 3AZVA 4Y1VA 1IKPA 4PBOA 4YM0A 3RS6A 1Z78A 2TEPA 2UWBA 4GA9A 2B7YA 5CAZA 1QOOA 1GZCA 1G86A 1CPMA 1EPWA 1G9AA 5T5LA 4XE9A 1MZ6A 4P9XA 3QLQA 4Y1ZA 3HN1A 2A6VA 5T50A 2G4IA 4M3CB 5DZEA 5H9SA 3GALA 2WNEA 3LCPA 3WDYA 3WUDA 3HR9A 1RIRA 3POWA 2A6XA 2D6OX 2R1DA 3OBRA 4YM1A 1DQ5A 2E7QA 1FATA 2ZHMA 1D2SA 2W52A 4FPFA 5GLUA 1WD4A 2EXIA 1MVQA 1KDMA 3B00A 3AP9A 3ILRA 5GM0A 4YZ5A 2UWCA 1YI7A 4K1YA 1Q8SA 1UPSA 1LECA 1UZZA 3AZZA 3RMXA 1BJQA 1IS3A 4RL7A 2AH2A 1NXD1 1URXA 1IOAA 3N7KA 3AYCA 3AZXA 1LOBA 3CNAA 1A3KA 2DVFA 2ZGNA 4PCRA 4XXAA 4CRQA 2JECA 3WOGA 3MEPA 3WVJA 1S0EA 2ZHKA 2ZGLA 4U36A 3USUA 1NLSA 4ISRA 4YGBA 1AZDA 4BMEA 1N47A 3V64A 3ZSKA 5H9RA 2DU0A 2EF6A 2JKBA 2V5YA 3WHTA 1FV2A 3VKLA 4Y22B 1KJRA 2P34A 2VU9A 1DQ6A 4YLZA 2LTNA 2ZGOA 4R9CA 1KJLA 4AGRA 2C9AA 3AJZA
chains in the Genus database with same CATH superfamily
3M70A 4KU8A 3I2OA 2VZOA 1BK0A 4Q4V1 5BNPB 2QDRA 4Q0SA 4XUOA 1BEV2 3ILNA 3WW1A 1XYOA 2D3RA 4LO4B 2FHRA 3CLPA 1GP6A 3H42B 1LGNA 1W6QB 4N7IA 5ISLA 2ILMA 5CG9A 3ZO0B 4QHOA 3X29B 4CDXB 3UJQA 1W9WA 3FBYA 3MBWA 4QPIC 3IPVA 3LAGA 4P02B 4UT5A 3OPZA 5IUQA 1LKNA 3O0VA 1GICA 1AL22 1W6OB 2YG0A 4GD4A 1U5ZA 3PJYA 2NP0A 1R092 2ZJCA 1SBFA 1UYPA 1MS5A 4I0BA 4C0HA 4JQRA 5FP8A 1YQ8A 3WLUA 4QQPA 3LKJA 1QNWA 1PGW2 1LHVA 3FZ3A 4LBNA 2VMFA 2AENA 4M01A 3USSA 2HLEA 2E32A 2LROA 2R49A 3N9MA 4NIDA 3AYAA 4RR3A 2CNAA 2VD7A 1RMU3 2HYXA 2ID4A 4UWDA 1JYWA 3AZYA 5F39A 4NAOA 4Q4W3 5A3LA 3T2OA 3ZPYA 1V70A 1YQCA 2VCMA 3MV01 4QQ2A 5JR2A 4HZFA 1RUH2 3KGZA 5GLWA 1AR71 1MS0A 4RGAA 3AFKA 1A8MA 2WZR2 3V65A 2QQMA 5TSWA 1WA4A 5FZOA 1YIFA 3JB4C 1V6KA 1QKQA 3WDUA 1HXS2 2YROA 3GZTB 3LOIA 3OBTA 2WNUC 5FYIA 2PAEA 1OMIA 1DGRA 2UU8A 3E6DA 4IGOA 2D6LX 2I07B 1NCQC 5JSRA 4AEDC 3OD0A 3PVOA 4RGKA 5DG1A 1PGL2 2VMHA 4ET7A 4DXRA 4LO8A 2X29A 1OLME 3H7YA 3THTA 2DFBA 3CQOA 1UU6A 5JVVA 2UY9A 1QNYA 1G9DA 3J7HA 5FUIA 4BMBA 5C5UA 3Q8AA 4R9BA 5FYYA 4J1XA 5C5TA 1DQ4A 2JWPA 3NVCA 1JZ5A 4GULA 5FPVA 4J25A 2IC1A 3KS7A 1OLQA 3UK9A 2BDRA 4META 2Y34A 5EJ3A 3NKTA 2VTXA 3CU7A 1HB4A 5A1AA 3IAPA 5BXXA 1CR7A 2R1BA 1RUD3 3GJBA 2D97A 1ULGA 2XQXA 5J1XA 2Q8DA 3WF2A 1H6YA 3WX5A 5LA9A 3PNAA 4DQAA 3UKVA 4DMIA 4CDWC 2ZGUA 3NNGA 4LA3A 2O0OA 4FFGA 4GQ7A 4QMAA 3I2DA 2P1BA 4IEPA 4COYA 1Q8QA 1W8UA 4AQSA 4GKYA 1ZM1A 2WSUA 5LBFA 5JXHA 2VZ1A 3OOXA 4GMP1 1JU3A 1US3A 5BY5A 1A8DA 5IAXA 4M3CE 3U4SA 1QJX2 5CU1A 2YV8A 4UW5A 1HN1A 1MS4A 2JD9A 2OS2A 4YFWA 2XDVA 1AR62 1PM7A 2GP5A 3KSCA 1OHFA 4RS5C 5LATA 1DZRA 3RJ2X 3AP7A 5H9QA 1R082 3WCSA 1G9FA 1V6IA 1GP5A 4COUA 1KITA 4K21A 1AX0A 4L97A 1L7RA 5FP9A 1PIV2 1VMHA 1JUHA 1YEWA 3P6BA 4JKLA 4QPIB 1GBGA 2VZRA 2BTVC 4Z07A 1GQPA 5FZ6A 4E8DA 1DQ0A 3VBHC 3JD73 3T3YA 1VRH2 2IFRA 3DYMA 4Q4Y2 4MVTA 2PHFA 1YRZA 2YBPA 4X6RB 3M3EA 2PHXA 1W0OA 2VXRA 5C8WA 2GZWA 2VECA 5E16A 3R4UA 4IV1B 1T6GC 1UOJA 1UAIA 1TME1 5FZLA 5BNOB 5F5IA 1ULFA 2VTXJ 4Z92B 5JIUA 3ZM8A 1YHFA 2FCVA 4FQZA 1YFXA 3BTAA 3M1HA 4DY5A 3W5NA 5C9AB 3BU0A 1DBNA 1QU0A 2R043 4O7XA 2R0FA 3ZDVA 5FP3A 5T52A 3DPRB 1XPWA 4FAGA 3HT2A 2PHTA 2JG9C 2YY1A 4ASMB 4EN0A 5JI9A 1SBDA 3F95A 3MYXA 3S7IA 5FY5A 3JBG1 3ORJA 5FYCA 5J98B 3PU8A 3B02A 1GQHA 4AEDB 1JS9A 4XXPA 3PVNA 1VBE3 2BNOA 3IZOA 5F6KA 1C8M2 1XYPA 4FCAA 3WF4A 1MS1A 1SLTA 1BBT3 2HEVF 4MGYE 4PQQA 1PK6C 4LXLA 5DAPA 4AEMA 2Q1FA 3ZX7A 1XU1A 1RUJ1 1FNZA 4NROA 2JDPA 2ZX3A 2JIJA 5E8AA 3WD5A 1DYPA 3M3QA 4BQ5A 2B45X 1H4GA 3VBUA 5JXJA 1WKYA 3HBKA 4QPGA 1UWWA 3RYKA 5D21A 4K8FA 4AHXA 3GNEA 2DUOA 3KQRA 1YFUA 3U0ZA 5EP9A 3EJKA 3UGFA 2MEV2 2LRPA 4ARXA 3I2GA 3VZKA 1RVF3 5CBLA 1A78A 3RZHA 1UMZA 1JYNA 4AEJA 1ND2A 4WM8A 3RI8A 1MVEA 1YFYA 2B8MA 4GB33 1TG7A 1VAVA 4CDWB 3CHXA 5DPNA 4DINB 1HRV3 1HB2A 3I7DA 3QOPA 4P5YA 1LEDA 4MYEA 4XTPA 1PX4A 2I74A 4LHKA 1I5ZA 3HMYA 2ZEXA 4QX3A 2WC2A 2A7AA 1V9U3 2DTWA 4AE2A 4Q29A 1GP4A 4YARA 4XCAA 5FP4A 3WG1A 1SMVA 3BPZA 4Y5TA 2ZMNA 3KLSA 2W9XA 4P08A 1WW7A 2GP3A 2W87A 1E5IA 1IQAA 4P14A 4Q0QA 2RJ2A 1U12A 4KBBA 4LOTA 1GNZA 2RS31 2W92A 5GLZA 1QJZA 3M3CA 1YO8A 2WNVB 2XB6C 5L9BA 4LA2A 5I93A 4UFKA 1U5IA 4YNIA 4COWA 4NHYA 4QGLA 2A5ZA 2C5DA 1ULOA 4QDQA 4MHUA 4HOOA 1A34A 3SLIA 5M0TA 2IWGB 3PJQA 5BNNA 5KC5A 1UL9A 3LPFA 4D6QA 2OIIA 5DQ0A 2VOWA 3FBMA 4AI1A 2QFEA 3UGHA 4FSJA 1LHWA 3UV9A 2ZX1A 1W6NA 3J8F1 4YZ3A 2YYOA 5A3TA 1O59A 4P9JA 2J1TA 3GHNA 2ADDA 3THDA 3WP5A 1ASJ1 2O1QA 4UF0A 5A7SA 1NA1A 4D69A 4S2FA 1EY2A 2JE8A 3ZPOA 4RGGA 3WW4A 3WQ7A 4JHZA 1AYN3 1CIWA 2WAAA 1BXHA 1VBA3 2ARCA 4SLIA 4CP2A 3IT8A 3O0WA 4QKDA 3KM5A 4KQ7A 1I1EA 4OZOA 2QKDA 5FLIA 3MW2A 4QXBA 5HCFA 2LW8A 1J84A 1W9TA 5HPOA 1VBB1 2ARBA 1DG6A 2JDMA 4P9WA 5FLHA 4EN8B 2RMU2 4B29A 4NOTA 4CZSA 5LA1A 4IGQA 2WZ8A 1H1AA 2E31A 1UKGA 3U07A 3UYJA 3I2HA 4R4XA 2X05A 4RR3B 4XPVA 1BLZA 1D0GA 3AKTA 1UN1A 3VKOA 1J58A 2PHRA 2Q8CA 3ZYBA 3D5OA 1SFYA 4P9YA 4XABA 1GU3A 3FHAA 1QJY3 1SZBA 2XG3A 3MUZ1 1G9BA 1PZ8A 1V6LA 4S2HA 4UI9L 5FJHA 1VBD2 1NXMA 1R1ZA 1QJU2 3ZFEA 4P9IA 3POYA 4JVAA 3RMYA 2AC1A 4HN1A 4CU9A 1QMJA 4ES8A 5I0SA 1AJKA 4BQXA 5JUVA 2D3SA 1KFXL 4OHWA 3I3EA 4XUNA 2EAKA 4BQ4A 5J48A 3N9PA 4N53A 1BVP1 1SHWB 4GJZA 4XBQA 5C71A 1F9KA 4EZ4A 3K48A 3HVDA 4Y3OA 4LLFA 3IBMA 5IWFA 3K3OA 2VVFA 2EIGA 1UZWA 4QT6A 1O91A 3I2IA 4XJ8A 2R072 2WQ4A 4FP2A 5AVAA 4KWKA 1W04A 4QDSA 3VBUC 3I97A 1CESA 4QPGC 2WS93 1GLHA 1JHNA 1C1LA 3OEAA 1AF9A 4A41A 3ME2A 2Q4SA 3TN91 5K0UC 1W6PA 4J6GA 1IS5A 3CJIA 1SLBA 4WM8C 1GFF2 2WLQA 4AHZA 2WBKA 3LFMA 5FMBA 4O61A 1WW5A 2O8OA 5IJRA 4HVQA 4G9SB 1AR73 1YC61 4JKKA 3KV9A 2XUMA 1QJEA 2PLV1 3IKWA 1UU4A 2CHHA 3SEPA 1IKQA 3IMMA 4BLIA 4L11A 4KWJA 3RPQA 1SBEA 4BXSV 5EXOA 2Q8EA 1JYVA 1W8WA 4CP1A 3S30A 5L73A 3WR0A 3B9CA 1HQWA 2J1VA 2XJTA 2YUEA 4R52A 2WNOA 1IG0A 1H2NA 5HV4A 2GMEA 3OSDA 1FYUA 1RUG3 3KF3A 1LB2A 4OMCA 3L2HA 4QXCA 4F3JA 4URTA 4Y4YA 5FBJA 1WBLA 4UFMA 2WT1A 1I5PA 4MHRA 3K4ZA 2A6ZA 2AYHA 4RD7A 1S0DA 4CU6A 3VBSA 2YPJA 1HJGA 2X8KA 2FCUA 3HWJA 2QQLA 3SH4A 1XQNA 3WV6A 5HXVA 4Q0VA 2Y8KA 3S7EA 1XNAA 5KXBA 4JX0A 1STMA 2MPFA 2H6BA 3WXPA 4FAHA 2GNTA 4W65A 2VBBA 1OA2A 5GZDA 3AKPA 3KT4A 3OGGA 1UIJA 4NWVA 2H0VA 3I54A 1PVC1 1UY4A 5F1RA 1C5HA 2BNNA 3MGUA 2DWRA 1LU1A 1NA1C 1H2MA 2XBO2 4H3WA 4IEOA 1BEV1 5LA0A 1W6QA 3CMGA 1JOBA 4QX1A 5BV6A 4CDXA 4GMP3 1W8OA 3ALQA 4TLGA 1FT9A 1ODNA 2RS51 2X09A 3CEWA 2PAMA 4PDWA 4YG3A 1QH6A 4LKFA 5K4LA 4FTEA 5DUVA 3S5QA 1LHUA 4PT6A 3WCRA 3VBRC 1X8EA 5IK8A 1W6OA 4HBNA 4M3CF 4Q2FA 1S0FA 3FLPA 3OCPA 4AVTA 2J1AA 3U1XA 2JX9A 3VB9A 1WW6A 3JU9A 4LBQB 3LA2A 3C3VA 3HT1A 3AL6A 2QQOA 3AKQA 4ZXKA 2VCCA 1OVPA 1R091 4QWNA 5FDBA 4OUSA 4XFCA 1AJOA 3QH7A 1GNHA 2RDNA 3H3LA 4XF0A 5F7UA 4MG2A 5GJ6A 1EAH2 5FXVA 2JDZA 4IQPA 1VMFA 4DNYA 1WW4A 2JEMA 1JYIA 3MIEA 4Q5OA 4D7SA 1JZ8A 2XJSA 2V4AA 1US2A 2PHWA 2YMZA 4NIHA 1LOEA 3GBGA 4YM0A 4D0QA 2K0GA 3POFA 1NE6A 2TEPA 4KG8A 2PMWB 3ZFFB 3OUIA 4EN7B 3ZFEC 4X8PA 4CDQB 1QOOA 3VBOA 5IFTA 1RUH1 1EPWA 5I0TA 1G9AA 4XE9A 2D93A 2ZKLA 3TYJA 2WZR1 2BNMA 4D7YA 2G4IA 2WL1A 5C8CB 1XNDA 2W94A 3D3AA 3NJXA 4NHKA 3LCPA 1HXS1 5FYTA 3WDYA 2FDIA 1NCRA 3O7OA 2IXIA 2LS6A 1ND2B 2R1DA 3NKGA 2E7QA 2Y60A 1RXGA 1NOVA 5ABJA 1HRI2 4JGZA 4DXZA 2ORZA 3AB0A 1XOYA 2VZPA 1PGL1 5GLUA 3U14A 1KDMA 3B00A 3AP9A 3LE0A 4CE8A 1UMIA 4BDVB 1OT5A 1Q8SA 2HWE2 3RMXA 4JV4A 5LCWL 4AQ6A 4XETA 3LWCA 4XXAA 5JSOA 3H8XA 3WP6A 5A3WA 1W03A 5FZMA 2JECA 4OQ8A 3A21A 3CJIC 4UAPA 2V09A 3D0JA 3RZKA 3NMBA 4LQRA 4IERA 4U36A 4QX7A 3TRSB 1NE4A 2C24A 3H50A 3IDCB 4QX2A 2D5HA 4BMEA 1RUJ3 3ZSKA 4QGMA 2DU0A 2EF6A 2JKBA 4LUKA 5H9RA 3NL1A 5KHKA 3VKLA 1KJRA 1DP0A 2F17A 3W9AA 2VU9A 2LTNA 1XC6A 3OGSA 1KJLA 1OOPA 3HN1A 4LUMA 4NO4A 4OI4A 2D6PA 4IE6A 5BNNB 2H6CA 3R4SA 4Q26A 4WZCA 3FLTA 1W8NA 3LA3A 3T09A 3PIJA 1QY4A 1SLIA 5F3IA 3WNPA 3O1PA 4ZU4A 4Z2WA 1QJX1 1QGLA 5IVJA 3UKTA 3WUCA 1Z7S1 2JJ6A 3M2MA 4YPJA 1AR61 1UOBA 1ODMA 1M06G 2FZ2A 2WQZC 1O5LA 4MO3M 1SACA 4UF0B 1HKDA 1NA1B 4IEYA 3POGA 2DCYA 4GWMA 2K46A 4LBJA 3O1VA 1R081 2QNKA 1JMUB 4BLJA 4E4HA 1X33A 4AXOA 3U10A 4D94A 3I3DA 1O5UA 3HEIA 3WP4A 1Q5OA 4YW5A 2G9GA 1PIV1 2VL4A 3LIHA 3O5SA 5FZIA 1UY0A 4CU8A 5FP7A 1ZVFA 2QQIA 3HIFA 2VBDA 1IPJA 2OX0A 3MLLA 2R7EB 1W90A 1VRH1 1XE7A 2GC0A 4Q4Y1 3WNMA 5I91A 5JMCA 4PI0A 3C7EA 3N9LA 3THPA 2C1FA 5BNPC 5LWBA 2F6BA 2WDBA 1ZRFA 5IAVA 2BWAA 4IE5A 3MUY1 2D7FA 1FV3A 4CDXC 3TEZA 2GMMA 4ZXEA 2IXLA 5D8AB 4A7KA 2CTVA 2OUJA 5C9AA 3NSTA 4FOWA 4OFGA 4AQ2A 3DPRA 3LOBA 1ALYA 4HKLA 4N43B 3IB3A 3J8F3 2ZCWA 4KWUA 4W4ZA 4H14A 3J7NA 1SDWA 3AJYA 5JZGA 4PQ9A 1LGBA 5C6CA 5FPBA 4N53B 1CVNA 2VMDA 4P5HA 2HWF1 3AP4A 1EPZA 1RUE2 1S2KA 2YGMA 2ZKNA 5FIXA 4DZGA 5LY2A 2OW4A 4Y26A 2PYTA 3BU7A 1OA4A 4E2QA 1W8FA 4QD2A 2VH9A 3BCWA 3T1LA 1F8VA 1C8M1 4WM7B 1PHMA 4LEJA 4AFBA 3PL0A 2D3PA 5LY1A 1LJ7A 3JQXA 1X36A 4ZHNA 1KRIA 2P6CA 2Z79A 4RHV2 3RZZA 3WF0A 3USUB 4A42A 1WLWA 5FYZA 1S0GA 5LBEA 1U5XA 1VBB3 2EIBA 3KMHA 4Q4X2 4DO0A 1CAUA 3WW2A 4GZ9A 4CCOA 3IMNA 2VNVA 1SLCA 1OI6A 4MXWB 4WZFA 5F5QA 1DQ1A 4BPZA 3IIAA 1W0NA 3O1MA 1W6PB 3PURA 3PLQA 2DVDA 1HB1A 2MEV1 4XMIA 5D2AA 5JI7A 5FREA 2ARAA 4JCKA 4ITCA 4NN0A 3LEIA 3NRUA 3PUQA 5FY1A 2P3IA 1FX5A 3VDCA 2XKPA 2IXCA 1YWKA 1CIYA 4XZUG 1DGRN 2BFUS 5FYUA 5FYVA 1C4RA 4HSJA 4BK4A 2O14A 3N36A 2W0XA 4QQHA 3V0BA 2ZZJA 5LB6A 1TMF2 1LEMA 4LMFA 2VW1A 1ZBA2 5AVPA 2QZ2A 5J36A 1E5RA 4R8HA 5EZWA 2JDHA 1JYXA 1ENSA 1UYXA 4DUXA 3AP6A 1JBCA 4QGNA 5EYXA 4QPWA 1YJLA 1JZ4A 4RN5A 3BUCA 2TUNA 3R4DB 3SQOA 2ARXA 1ULDA 4K7JA 5A7QA 3OEBA 1OOPC 3VBSB 4FOQA 3RWNA 1DYKA 3BPSA 3SHRA 1CPNA 1H2LA 1YUDA 5E89A 3ACFA 1FOD2 1AR92 3TN93 4W6YA 1GKBA 3J4UH 5IW0A 3WG3A 1LRHA 3MIBA 3AVRA 5CZKA 1OLMA 1UU5A 1D4VB 2UURA 3DN7A 4JTOA 2W1WA 3ZMOA 4FI9A 2FBEA 1PVC2 3T4VA 3EYPA 2R062 4CEYA 3MDPA 4MOAA 5FPLA 2D6NA 2PLV3 2DCZA 3PUAA 1OKQA 1AXZA 4DXTA 1CZTA 3ETQA 4Q4W2 1NQJA 2RS52 4BQ1A 3GHMA 4J1WA 3FFZA 4UYBA 4FPJA 1NAEA 3ATGA 2RDSA 4PDWB 3WDWA 2BP6A 1NQDA 4HSLA 1PMJX 4QPYA 1AXKA 1G9CA 2KR2A 4B7EA 3PUHA 2XGXA 1CAVA 3CL1A 3BODA 2D6MA 1S0CA 3ZLIA 4O9GA 1RXFA 4ZS2A 1BMV2 4TYSA 4GMP0 1J3RA 3GDBA 3C7HA 2XJRA 4FPHA 4CUAA 3T30A 3AMHA 3SKJE 4IV1C 3QH6A 4ZU5A 5JOWA 4IUGA 4UW6A 1CX1A 1H8TA 4YVWA 5BNOC 2DF7A 2RMU1 4F7ZA 4Y5SA 5K7PA 1UXXX 1UIKA 2IZWA 4UW4A 1JUIA 5FMOS 3WT3A 1HX6A 3FWEA 3ZXJA 4M3CA 5L36A 4YZ4A 5C9AC 4NRPA 4AWDA 1V00A 3ECQA 3DPRC 2CU5A 1TQ5A 3MO4A 3VBOB 1ZRCA 1UKRA 4NWWA 4PLOA 1VBD1 1XE0A 1QJU1 2XVKA 4TLFA 3OG2A 3U75A 3V56A 4HONA 4H55A 4EQVA 3KV4A 1CAWB 2W39A 4CXYA 2GDFA 1CWPA 3KQ4B 1NCRB 1VRBA 3AMPA 2HKXA 5J3UA 2FMYA 2V5DA 3K75B 3LDBA 4JGZB 4XFBA 5EYYA 2GSYA 2PA7A 2Q1MA 4O9EA 4I0AA 5A1LA 3JUUA 2Z5WA 1OH3A 4LHLA 4LTAA 5GKAC 3A0NA 3AMNA 3N35A 1RUI2 2R071 4IGPA 4CCKA 1AL23 5FZKA 3P3NA 4CUGA 1UQXA 1KS4A 5C7GA 1R093 4RA0A 2DBNA 1NZCA 2WO1A 3EQEA 4FPYA 5F5CA 1PVXA 4YZ2A 3QBQA 1LHNA 5FZ8A 1SLLA 3PDQA 3L2YA 2HJIA 3WNKA 4Q8LA 3P1IA 1O3QA 3NJZA 3Q9OA 4JAAA 3H1WA 1FPN3 2VOKA 1LHOA 4IEXA 4AZZA 1FNYA 1AYM2 1UO9A 3S6PA 3IN9A 4IE7A 2WLPA 4DUWA 1RUH3 1LAJA 1GOFA 1X7NA 1OOPB 3KGLA 2VUAA 2WZR3 1ZX5A 5JCTA 1DF0A 4GAZA 3OTFA 3WG4A 1ONAA 4QX5A 3RVHA 1C1FA 1HXS3 1U0AA 1NLQA 1LOAA 1Z7S2 2DBIA 4A4AA 5FY7A 4YG0A 3WNOA 2VOVA 4DOUA 1LTEA 4TTGA 2DV9A 2E26A 2WWUA 4AF9A 1REFA 2WNVC 1Q8OA 4R4ZA 3EO6A 3RJRA 3ZXKA 1UNBA 1COV2 4YRDA 3RFRA 2N7GA 1U5YA 2XPJA 4ZU7A 2R16A 2K2SA 1YFWA 4BQ2A 3W20A 3PTYA 1RHI2 2OZJA 4AI9A 4C0BA 5LEKA 2GC3A 2ZS6B 1VP6A 3B93A 4URAA 1PO22 4G3YC 4HN0A 4Z2AA 3IM0A 2VAUA 2B42B 2YB7A 5KXDA 3I59A 2WFPA 4FPGA 4GH4A 2FDJA 3FE5A 1IGOA 4AVVA 4CEWB 5C3PA 3NV3A 1GV9A 2R30A 2RV9A 4CEYC 2RG4A 3E1F1 4KL1A 4AEKA 2E7TA 4CDUA 1K5MA 1WMXA 1RUNA 3TEYA 3S57A 3DXUA 1JXNA 5B4XA 1ULCA 1OQ1A 1L7LA 2XBO1 3Q8BA 3FHIB 4GWNA 5EPAA 2R6QA 4FPEA 2HEYF 2VZ3A 2YDEA 3PMSA 4LPLA 2HWB2 5FZEA 2GAUA 2QDNA 5HXMA 4FPOB 4CP0A 1QJX3 3RQ0A 1UX6A 1VBC2 5DDJ2 3DKWA 5GZEA 1PZ9A 4NHXA 1AR63 2AEZA 1MQTA 4LBQA 3BTXA 2OZ6A 2HWF2 2J1SA 2XHNA 3KVAA 5JZGB 2VVDA 1RVF2 1QEXA 3I49A 4JQTA 4DIQA 1ZZBA 4YVWC 5JPMB 1R083 3BN6A 2AEYA 4NE9A 5AC92 5FY9A 1YQ6A 4HMZA 1SLAA 4LOSA 3J7LA 4RR3C 1OURA 3BGAA 2XL9A 4A3ZA 1HRV2 1AVBA 3SH3A 2W1QA 3WHUA 1EAH1 1WLCA 3ACGA 3OD4A 4LT5A 1PIV3 2R0HA 4COZA 1W2OA 5FMCA 2ET1A 4OQ9A 1WMFA 3ZFFA 2VXJA 3DV8A 1AR82 2BW8A 2EICA 4PJYA 3ZVXA 4CDQA 4EJRA 4YZ1A 2BUKA 2A71A 3O14A 1VRH3 4Q4Y3 1UPIA 1CAUB 3AXEA 1PGSA 2TNFA 2ZBJA 4ORFA 4ASLA 4ZZ5A 5A32A 5ANNA 3B3QE 5CKMA 5LZ6A 1OD3A 5C8CA 4CP9B 2YFZA 3RZLA 2BERA 1QQP2 4LR4A 2Z4FA 4I30A 5F6LB 2BBVA 4BIFA 5DAXA 4AK3A 1CONA 2BBAA 2BFUL 2A70A 2WYSA 3CF6E 3OYWB 3BI3A 5C3QA 2QQKA 5E88A 4QXKA 5FZFA 5EV7A 2EVXA 3H3UA 1HRI1 1QIQA 2XKOA 5LW9A 2B9VA 3AZWA 5KR7A 4COVA 2FCTA 1S0IA 1KD7A 5CYYA 5LASA 2GH8A 3NV2A 2A6YA 2HWE1 3V0BB 5FPZA 4A7ZA 2VY0A 4HANA 5KWRA 5LRRA 1HDKA 1C28A 4LKEA 2VBPA 4ES9A 5JXGA 3D4KA 3OY8B 5FAXA 1XRUA 4LE4A 2NYYA 3MW4A 3APBA 3ZXAC 1OF3A 1C8M3 2P17A 2PFWA 4Y5Z0 2YFUA 5KHHA 3SITA 5J96B 4ZY9A 4HLTA 4PBPA 3UT0A 3QD6A 2WA3A 1UCXA 4Y1XA 3I2JA 4YW4A 5CA6A 2GALA 2GNBA 4KWLA 3ZSLA 1BKZA 4QU2A 2YHJA 2YU2A 2CV6A 3MZHA 2AREA 4C1XA 5A7WA 2ZMKA 1RUC1 3K4AA 5FZ9A 1GYKA 1TEIA 2RDQA 3KV6A 5FPXA 2MEV3 4XUTA 2ZGKA 4K3UA 4MGSA 4OCTA 3NV1A 3QACA 1BHGA 3VDDA 2GMPA 2D98A 4CEYB 3LDKA 3Q8CA 2VMIA 4IETA 3ACIA 4YGCA 4IE0A 3BVCA 4XDPA 1KS5A 3UGGA 5EIYB 4K8RB 3N9QA 4M4PA 3ZYIB 4F8AA 4FOYA 1LENA 2RR12 1AXYA 1H0BA 3ZYHA 5FO9B 3C7GA 4P9GA 4XHXA 1B35B 5GLVA 1S0BA 3FL7A 3NNJA 3KHCA 2MNGA 1CAVB 1E5SA 1OFNA 1SPPA 2Y6FA 4JRLA 3N3HA 4GH4C 5A7PA 3BOPA 1UY2A 2VC9A 3EB7A 4XDQA 3POBA 4Y1VA 1IKPA 2IXHA 4PBOA 5FWEA 2XL7A 2KXLA 1DGWX 3WEZA 3AVSA 2RE9A 3I3QA 1ZZCA 1K5MC 1H8TB 1R1A2 1OQDA 3D8CA 3KCXA 4YVWB 5G04L 5J7MA 3C8XA 4M0NA 2XWJB 3WSOA 3QLQA 3DKQA 2Y26A 1OD5A 1PM4A 3PU3A 4Q0UA 5T50A 5F37A 4M3CB 5DZEA 5D8AA 2UYAA 5C33A 5FYSA 4OHXA 3POWA 4UBGA 1NYWA 4HETA 3OBRA 5JXIA 2WS92 4N43A 5DAQA 2W52A 4NPRA 1GWKA 1XE8A 2WINB 1MQTC 2VQTA 2EXIA 3FFQA 4Q4V3 3ES4A 1HW5A 1OF4A 1YI7A 3VD7A 4TSVA 4FBFA 5A3NA 5L19A 1POQA 3B9IA 1TE1B 1RUF2 1LECA 3MPBA 3AZZA 4NIIA 1BJQA 3TBDA 3WNNA 3BKZA 3ZR6A 1CAXA 3B5LB 1C3HA 2VR4A 1F15A 1Y9QA 2WFF2 5ACA2 5FPUA 1RYYA 3N7KA 3GZAA 3TOJA 1RUE1 1PO12 2DFCA 3CNAA 4BU2A 1J59A 4WM7A 5FZ1A 4EE2A 5FXZA 4IEQA 3ZFFC 4OI1A 1ST8A 3USUA 2CAVA 2VZSA 1S2BA 4CDQC 1O7FA 1OSGA 1AZDA 1N47A 4RHV1 4HVRA 5IVFA 1O3SA 5CG8A 5CFDB 1SEFA 2XHKA 4Z1VA 5C8CC 2BOIA 1DQ6A 1OC1A 2P6HA 2ZGOA 2RMU3 4MXWA 4Q4X1 1BCXA 4YLZA 2C9AA 3WDVA 1RUG2 3AJZA 4E8CA 1ZNPA 5DN2A 2Y0OA 5E1RA 3JB8A 1ND2C 5A3UA 3K3NA 4Q1PA 1NLRA 4YW3A 5FOJB 2J7MA 5LBBA 3EBRA 1VB2A 5JOXA 3WW3A 4FQ4A 4UW3A 5JSPA 5JLVA 3UL2A 3MLJA 5GZCA 3ZDSA 3T2PA 1OUXA 5HCBA 3IAQA 3AM2A 3VV1A 2GN7A 3VZLA 1KGYA 1VBD3 1QJU3 2NN8A 2VMEA 3HOBA 4BH9A 1UW8A 2KA3A 4NAMA 4TXWA 4DEVA 2XJPA 3AYDA 3P3PA 3RYPA 4XQ4A 1GMMA 4IESA 1QF3A 1TMF1 4DXSA 1ZBA1 2OA2A 3V0AB 4AFDA 2VGDA 2Y6GA 1Q56A 2WRAA 3ENRA 4LO7A 4BB3A 3QCWA 3ABZA 2EXJA 3JCIA 3O12A 1DGLA 3HQUA 1XSRA 2R073 1Y9MA 2W3JA 4IEUA 2VULA 3AC0A 4ATEA 4AOCA 5BNNC 3E5UA 3POJA 4YYOA 3LEKA 5FZDA 3I59B 1Y43B 4N8MA 3EMRA 1FOD1 2GNDA 1AR91 1LU2A 4GH4B 4YW7A 3WINE 2P3YA 1ZA7A 3A23A 3OJBA 3E5XA 2DVBA 5FXWA 1NZIA 4BA6A 4CDUB 1K5MB 2R061 1W6MA 3HQRA 1K12A 3SISA 4IE4A 2PN5A 2XVGA 2GU9A 4B7KA 1PNFA 4HPKA 1V6OA 2VNOA 2ZEZA 3WZ1A 2Q8OA 4Q4W1 3O1OA 1D7PM 2G19A 3VZNA 2PHLA 2XR4A 1RJ8A 3ZSEA 4CCNA 2QQPA 3O0XA 2ERFA 2FDGA 5FZBA 3G7DA 2PELA 2KD7A 4WVMB 4YW1A 3ZSMA 1Y9GA 5BNQA 1W3XA 2ETEA 2ATFA 2P3JA 1MQTB 1SFPA 4BYYA 1EV12 5C4WB 5I8YA 4RYDA 2CAUA 3SNMA 4ZONA 1BMV1 2X5IB 3KZ4C 4LBOA 1W06A 4FPLA 5FXXA 1APNA 3KWVA 4YW2A 4CUCA 5A1FA 4XJAA 4XC9A 5F9TA 1O4TA 2JDNA 3MIFA 4FOVA 4PF5A 4HKOA 3ETPA 2DCJA 2W95A 2CWSA 3VGIA 4DS0A 5HBAA 2GC2A 4HK9A 5D8AC 2VCAA 2C6SA 4XBNA 5JDBA 3ZKYA 5FY8A 1RL3A 2YC2A 5I8TA 4R9DA 1JZ2A 2NM1A 2CYFA 4N43C 3VN4A 5FUPA 2PQQA 1ZZ8A 5CNAA 1PMHX 3LZZA 1DU3D 5FYMA 5A32B 5LK5A 3O1SA 2PHUA 4X8NA 1CAWA 2IXKA 4N53C 1TME3 4WBBA 4Y1YA 3GM8A 3PTRB 4JGYA 4B1MA 4GXLA 4I09A 4DY3A 2XBO3 4ATFA 1Y3TA 5FUNA 4LE3A 5IK5A 4QB6A 4WM7C 1ULPA 4XUPA 3SCGA 5CKQA 1GWLA 2HWC2 4M00A 2RJLA 2Y64A 3H1YA 2GH2A 1ZZ7A 1Q8VA 4E27A 5D1IA 3BIWE 4QKNA 1GR3A 3WDXA 2E53A 3GBWA 3HQXA 4LKDA 1Q8PA 3JBG3 4Y20B 1W99A 5EFUA 3N9NA 3WNXA 1RUI1 4GKXA 4XFGA 4EYUA 1RTVA 1BVVA 1D4M2 1FMD2 1VALA 2WWSA 1UOFA 4K20A 2I2SA 4K9SA 1EYBA 4PIYA 4E4SA 2QQUA 2W91A 1EAH3 2WR9A 5C3RA 4QM9A 4L8QA 3SXWA 1ZRIA 4I3GA 3MF9A 2JG8B 2IVJA 4AVBA 1PX3A 4E9KA 1KXGA 4LO5B 4A45A 3ITQA 3KCYA 4K1ZA 4CA9A 1AYM1 2D43A 2JDYA 5L9RA 3TWIA 2WN3A 1HB3A 3NAPA 1RUC2 4OI2A 3AFGA 3VUOA 3R05A 3TAYA 2VW2A 1C57A 3LGRA 1XBFA 5A7WB 3VL9A 4NUBA 4GWJA 4A6OA 5FY0A 3ZSJA 3M4FA 4XQWA 4AGGA 5HCAA 1CQ9A 2D44A 1WCDJ 2OXBA 1JTZX 4CXXA 4CCJA 1OA3A 4MADA 4UFLA 5DUWA 1IPSA 3TEXA 3N7JA 3VDDB 1Y4WA 4AG4A 3FJSA 4DPNA 1HRI3 1F4AA 3KCCA 1I9RA 5CADA 2RS12 4S2DA 5KC6A 3I3MA 3BTZA 4KGQA 3VBSC 1NX9A 1COV1 1H9WA 2HWE3 1W0PA 3OPWA 4XJZA 1X8MA 4XQDA 4XW3A 5DZFA 3UKNA 1DZQA 3VBFA 1RHI1 5IK4A 1SPPB 1PO21 2E51A 2YGLA 4D3WA 5EWSA 5I8SA 2RS33 4CEWA 4YGEA 2ZOEB 4LIVA 5FKCA 3PUIA 4BXFA 3H9AA 4XHBA 3WQ0A 3RGBA 1PMIA 2CGOA 2VE1A 1VBE1 1ND3B 1JH5A 4ONUA 1W2AX 1UY1A 2D40A 2JIGA 4K40A 4MGZE 5T55A 1YQ5A 2X10A 1MS3A 4LK6A 5F8PA 4PDWC 1GZTA 3NW4A 2JE9A 4CCCA 1GZWB 5FK7A 3A0KA 5FBZA 3HBZA 4IV3A 2WSVA 2SLIA 3KHBA 2HWB1 4DRRA 2ZGTA 4WVVA 4XURA 2QQVA 1MEC2 2WT0A 3VKFC 2WN2A 1VBC1 1WLDA 1ASJ3 1H30A 3AMMA 4QB2A 5DDJ1 5DUUA 3WQBA 4AW7A 4FFHA 4BWOA 4FTBA 2V72A 1V0AA 4NMIA 3E5QA 1WCKA 4H7LA 4OHVA 3SKVA 1CAXB 1RVF1 4JRAA 2BRTA 4NPMA 1NT0A 3ZOIA 4KMQA 2Z69A 4LBLA 4Y22A 5IHRA 4RSUA 5AC91 3FN9A 3ZIXA 1QJFA 1MR5A 2ORXA 1YQ2A 1HRV1 4L99A 3GJAA 4JTNA 4V1PA 1SDDB 2VQUA 5EJZB 5HI0A 2WO2A 1SCRA 2RM22 3M8LA 4Q27A 2A3WA 3VBOC 1IS4A 4BCUA 4V2VA 4TN7A 1ZBE2 1UY3A 1YLLA 3THCA 1KDKA 4Q1RA 1AR81 3G6JB 1WCSA 4N9IA 2LM3A 3VDBA 2EALA 2WNUA 3U37A 3SEEA 4XOGA 4CP9A 4UFHA 3I3BA 1YIPA 1XSQA 2OPWA 1NCRC 2XXZA 1NCQA 2JKXA 1LOFA 4YWAA 1LR5A 1CJPA 4XFHA 4TWTA 5C70A 5ABJC 3MIHA 4JGZC 1QQP1 3OYWA 3CKHA 1JHJA 4RFRB 4NHLA 1YCIA 1T2XA 2HWD2 2OQ6A 3FUOA 4CTEA 2J1EA 5C3OA 3VZJA 2WKKA 3C2UA 3J26N 1AX2A 5E6HA 1LOCA 2Y33A 3BB6A 1JYTA 1L3JA 2AGSA 3VD5A 4FFIA 1LGCA 1YI9A 2HEWF 2VMGA 5KXCA 3UNPA 1F5JA 3OY8A 3SCFA 3GZUC 1C5IA 1WUVA 4IW3A 2R32A 3UESA 1JOPA 5F5AA 4MGIE 1CD3G 5FJKA 5IVYA 1RUOA 5F3EA 3RZJA 3DEMA 3ZFGA 1POV1 2BQPA 2I45A 4RHV3 4MH0E 5EHDA 3NAPC 1V6NA 2Y0IA 3IWZA 4LK7A 3T0BA 3MHZA 5GLTA 1F4HA 1ZZ6A 4Q4X3 4MZUA 4XF1A 4XYXA 2QQNA 1QOTA 2C26A 3AL5A 5T54A 1S0JA 3D0SA 1OKOA 4WV8A 3NNMA 1QXJA 3NNLA 4G4FA 4BQWA 1REDA 3T0DA 5IVVA 4XTMA 3GGLA 4K6BA 1IPKA 4EWDA 1ENXA 2F4LA 2W08A 4YW6A 4OVEA 1W6MB 5I0UA 4EV0A 1ENRA 1RMU2 2VUDA 2VOXA 4P9LA 3RYRA 1UMHA 4D6SA 5JMOA 4LBQD 1DIWA 1X9TA 1UZYA 3ELNA 4HPKB 4IXLA 3ROUA 3O1TA 3ASIA 2MHFA 2RR11 1B35A 2W1SA 2VCBA 5LA2A 3ZXEA 3VBFC 5AFBA 1W8ZA 5IT6A 5K9YA 4PHZA 3BIEA 3B69A 3MV11 1UF2C 1TMF3 3OGRA 4BQYA 1ZBA3 2ZGRA 4CEWC 2BYVE 5JOYA 4Y4RA 3JZVA 3BTYA 4XFAA 5FO8B 1G7YA 4PF1A 3M3IA 3MW3A 1YYNA 2XJQA 4QAWA 5IFPA 1XB9A 3JQWA 1W28A 4HT1T 2W5FA 3RZMA 5EQUA 1F2NA 2Y6KA 1R1A1 3OBZA 3I4IA 2F4PA 4NHMA 2WA4A 4FPCA 3KT7A 2JDKA 4JHTA 5DZGA 3RDIA 2L9LA 1JN2P 1MACA 1FOD3 1VJ2A 1AR93 4C1WA 4IV3C 2EIEA 1NY72 2JG9A 3NNFA 4YVSA 4RQPB 3VZOA 2WS91 5JZGC 1RUD2 1PVC3 1MS8A 3UETA 2R063 4AYUA 1XXNA 3VD3A 5LRSA 5A6XA 1RGSA 2LALA 4JGYB 1BEV3 3VHNA 4KG0A 2ZABA 4CU7A 1OPOA 1RUF1 4XAEA 1FPN2 3I2FA 4JC1A 5A6QA 1FXZA 3LPGA 4I2OA 1PK6A 5FQ0B 2EXKA 3RNSA 2RS53 4EN9B 5KHIA 3H8RA 2WFF1 5ACA1 1P8JA 1PO11 2WIIB 3DXTA 3RI9A 2ADEA 1CZVA 2QCSB 3J7MA 5FZ0A 3LEMA 4H2AA 1Q3EA 4LULA 5B2GB 4Y1UA 1X9PA 5CFDA 3NJVA 2IVIB 3BOWA 2JD4A 3KD4A 2HBUA 1LESA 1DCSA 3A7QA 2VJXA 1HJFA 1IQDC 2K9ZA 5G05L 1LOFC 1MZEA 2VMCA 3T2TA 1NG0A 3B01A 4MGTA 1LODA 4XFFA 5C4WA 3AK0A 4HXCA 1A6CA 1KFUL 1RUG1 3OB8A 4Y33A 5DG2A 5J37A 1O6UA 2GC1A 2WUHA 4E4ZA 1Q43A 5JPNB 2QQJA 3LB9A 3OUHA 1H9PA 3MIGA 3R6SA 1CX4A 3POSA 4CVUA 2Z2SB 3NAPB 1F5FA 5DMYA 3FHQA 5FZCA 4MX3A 4FO9A 3OBAA 3RRDA 4AFMA 1JW6A 1QWRA 5LEJA 1TNRA 3JD72 4B1LA 5KXEA 2ZACA 1DFQA 2ZX2A 1DDLA 2NPIA 1W2UA 2BWCA 1O4ZA 1O8SA 1VR3A 3JXSA 3N7LA 3V0AA 3ZN5A 4AAPA 3U78A 1N3PA 3RWKX 1IG3A 2VG9A 3IDEA 1QXPA 3CO2A 3MFAA 5FWJA 1O3TA 2IUWA 1DGWA 3ZFGC 4NRQA 4C90A 5SV5A 2ZA9A 3DECA 5A7OA 1S2EA 1Z78A 1RUI3 2UWBA 4GA9A 2R042 3KV5A 1GZCA 1CPMA 1IZ3A 1EUUA 1WCUA 3VBFB 1MZ6A 2WYFA 3DYPA 5F2WA 4A7YA 5L7OA 3D82A 2X53S 2E9QA 4WVZA 3URFA 3U11A 4CSWA 2XONA 3LQCA 5H9SA 3GALA 4KBZA 2NQYA 3OPTA 2J1UA 2A6XA 3E6CC 3TNQA 2B5HA 3C7OA 4YM1A 3N9OA 1DQ5A 1VBE2 4NJ4A 3DF0A 1AYM3 2W2IA 1BBT2 2BVBA 4QM8A 1WD4A 1MVQA 2TBVA 5GM0A 2UWCA 2ZPXA 1B35C 2J42A 1DYOA 3OGVA 2YC0A 3ES1A 5J09A 4RL7A 1CZSA 2Q1ZB 1WWYA 2AH2A 2BV4A 2NLRA 1NXD1 1URXA 4IV3B 1IOAA 4PCRA 3AZXA 4Q0PA 5DABA 1A3KA 2DVFA 1Z7S3 2ZGNA 4LORA 4I0WB 4WVMA 3GBFA 2XOMA 2Q0AA 2OQ7A 2XLFA 1XNKA 3MEPA 2VQ0A 2YBKA 4PIXA 2ZHKA 4QKBA 2X5IA 5FZ3A 2ZGLA 1RB8G 4KU7A 4PIZA 4AHYA 1H8TC 1EV11 1NLSA 2IFWA 3NO8A 4GB32 3V64A 2V5YA 1COV3 4IEWA 1FV2A 4Y22B 1L7QA 2D5FA 3W21A 4AI8A 1RHI3 1XJAA 4AGRA 4AI0A 2ES3A 4JZRA 1AHSA 1AL0G 2ZX0A 1OLRA 1V9U2 1PO23 4CCLA 4OZXA 2DVAA 5A33A 2JDAA 4FXKB 5IVBA 4YVSC 4DB5A 1E57A 5JAXA 1Z0HA 4FPKA 4A3XA 2ZEWA 2H0BA 5HCHA 2WNUB 1LULA 4W50A 4I01A 2OYZA 1WGPA 1GANA 1NCQB 3U4XA 2CSGA 1R64A 1QHDA 3IDAA 4AFAA 4L9BA 3BALA 4XVHA 1QOSA 1XNCA 1ZRRA 3J9SA 3VZMA 4W6WA 1EP0A 5FLJA 3HNYM 5FCCA 2JDUA 1NKGA 1ZRDA 1B09A 1VIWB 2HWB3 4BQ3A 2HWC1 4FT8A 3H8UA 2Y6HA 5H9PA 4A6SA 2NMNA 4XF4A 1ENQA 4NVPA 1JZ7A 2EIDA 1VBC3 5DDJ3 5CFDC 4Y20A 2HYKA 3FUQA 1D0HA 1O4YA 2HWF3 4QX8A 4ASKA 5K0UA 2RJKA 1D4M1 1FMD1 4NPLA 5I0RA 4M4RA 5AC93 2FZ1A 2WZPP 4TZDA 5AFEA 1W3VA 2WWJA 2DURA 1MZFA 4LIUA 4W8JA 1UZ0A 2JG8A 4AAXA 4X6QB 5A70A 1SQ4A 4GJYA 3ZFGB 1JI6A 1IHMA 1GUIA 1N3QA 3ST7A 5FOBB 1AYN2 2WT2A 3ZN6A 1AR83 2QUOA 1ZYBA 1VBA2 4L92A 4XJ9A 5ERLA 2VZTA 4CPBD 2DTYA 4YM3A 1J3PA 4XZPA 1FAYA 2YBSA 3BYWA 3UJOA 4S2GA 2QBXA 3PVEA 1QQP3 3ZR5A 4GALA 2DUPA 5CIRA 4IL7A 5CEHA 1OPMA 3MFCA 1N1YA 4RS5B 4LITA 2BOJA 5FPAA 3HD8B 3W59A 2DCTA 3VHOA 2ZX4A 1CJDA 1J83A 2C4XA 2RS11 2A3XA 1E5HA 3GCXA 4MSVA 3TEWA 3EHKA 1F35A 3DUIA 2Q5TA 2FQPA 5FRAA 1QJY2 4SBVA 4AL9A 1XYNA 5GZGA 3ZYFA 2LUWA 4F83A 1DLLA 4QKFA 4OUMA 4QQOA 5L7OC 3VBHB 3VL8A 3ON7A 3HNBM 4EROA 3MIDA 4DRVA 2G1MA 2ZZQA 4Q4V2 2W68A 3F2ZA 2C9KA 1JU4A 3WDTA 5FMOL 1WA6X 4AVAA 4XUQA 4AGVA 2Z42A 2YPDA 4FTSA 3NWKA 4AVCA 4CDUC 5A7NA 1W2NA 1POV3 1ZA4A 4UOJA 3H1MA 5FKBA 1QDOA 1N1TA 5A3PA 4B8EA 2C0ZA 1J3QA 4QHZA 1ND3A 2P5BA 3H0OA 1I6XA 4AHWA 4OI0A 3GF6A 2RHPA 3FMGA 4ISQA 3IPVB 2IXJA 2JB4A 3OGJA 4YSFA 1GZWA 2V73A 5FZGA 4UFIA 3VBRA 2HH9A 2JG9B 1OFSA 4YVSB 5CFCA 3HN3A 4XEZA 5FV3A 4Z8BA 5C4WC 3E97A 4OULA 2JXAA 2X5IC 2ZAHA 4U2AA 1VPHA 1OBNA 2P2KA 1G6NA 5B4NA 3PVBB 1MEC1 1UXZA 3M3OA 3ZYPA 3WQ1A 3C7FA 3LSDA 1FI2A 3NV4A 2UY8A 3KVBA 1PK6B 2RR13 3POEA 4HG6B 1AR72 2ZGMA 2PQSA 3N7MA 1CN1A 1HV0A 3D6EA 1UYZA 1WMEA 5JOZA 3WNLA 2XJUA 5FZOB 5FTTC 2ZAAA 3Q8EA 3EXUA 5FO7B 1JOJA 2RM21 4D8MA 2YU1A 1K42A 2QZ3A 1ZBE1 4AFCA 5IATA 4B3NA 1DLCA 3T08A 2FDHA 1HIXA 1HN0A 1I3HA 1R1A3 4MUVA 4BK5A 4IEVA 5CISA 5IK7A 3ZN4A 4QXHA 1SG3A 4XIOA 1H2KA 5ANQA 1RITA 2BEOA 3CDZB 1S4CA 5GALA 2VUJA 4E2SA 3CIHA 3HAGA 2G9ZA 2ZGQA 4XF3A 4XILA 3GZEA 3OF1A 4XJUA 4LNVA 2B9UA 2ENRA 2HWD1 1V6MA 4Y24A 4FFFA 4Z82A 4YFZA 3VKMA 1N1VA 5FZ7A 3VHPA 5F2SA 4AVSA 3OUJA 2OUHA 1RUF3 3AX4A 2Y6JA 2ZTNA 1J1LA 3TNPB 2XJVA 4LJHA 4ZKTB 2D6KA 3B7MA 2WFF3 5ACA3 2WQ8A 4XBLA 1JZ6A 1MPXA 1GNYA 1PO13 3ZKUA 2PHDA 1ZREA 2JG8C 1VAKA 4MV2A 2AACA 5F3GA 4A44A 5CVRA 3SH5A 5JWPA 1VAMA 2JB8A 2BGPA 1N1SA 2W47A 1GOHA 1K5JA 3K77A 5FZHA 2YXSA 1OH4A 3AYEA 5L7OB 1HLCA 1VMJA 2A1XA 1H1IA 3HNMA 1BK1A 2E6VA 3T1MA 3VDDC 1UX7A 4UFJA 2ZXQA 3CJXA 3HJRA 1EUTA 4YM2A 4CPBA 4OHZA 4QX0A 3LDRA 1KQRA 3I8TA 2XQRA 1XU2A 1XNBA 2AZ5A 2RVAA 4XF9A 1YNAA 4LHSA 4ARYA 5FYBA 1BZWA 2ZHNA 1RMU1 3CBNA 3SMHA 2XWBB 1GQGA 2CL2A 2ET7A 2XLGA 4HKWA 4A2UA 5HV0A 3M7AA 4HFSA 2BU9A 5FZ4A 2GN3A 3FC0A 1RINA 2P3KA 2W1UA 4PLMA 1JODA 2B46X 1NUKA 2PTMA 1W8HA 4N7UA 5FYHA 5A80A 1AUYA 1TME2 3PIGA 2VTFA 1IS6A 1AX1A 1CGPA 4H7MA 1F31A 2Y38A 5BNPA 2E63A 1GSLA 2E33A 4BM8A 3MLKA 2DUQA 2XUEA 3WF3A 2FDFA 1HQNA 2BGOA 1X50A 2VQAA 3R0RA 4LKSA 4YG6A 1ND3C 1K3IA 4KI5M 3RZGA 4EZHA 3T4HB 4EWAA 1LCLA 2ZMLA 3ILFA 5JR7B 1OQEA 2V4VA 2DDUA 3SCHA 5I0DA 2P37A 3NJYA 2EA7A 2BPA2 2VZVA 5A33B 3ZXGA 2JENA 4BOWA 4DEQA 3JBG2 4XMAA 4EN6B 5CFCC 2OT7A 4RQPA 2OPKA 2JICA 1SFNA 1AL21 4RFT0 2YZ4A 2GNMA 1NY71 2ZEYA 4DFSA 4PI2A 5A3MA 2A6WA 1H6XA 4OYUA 4CCMA 3LA7A 5T5JA 1RUD1 4Q8KA 4QB1A 4FP3A 5IYYA 2Q30A 3FLRA 4XIKA 2VUCA 1PGW1 4O65A 1RUJ2 3MPPG 1X82A 2ZHLA 5FQ0A 5APAA 3DGTA 3A22A 5C3SA 2FD8A 1FPN1 3L9JT 5DAWA 2FMDA 2A3YA 1BYHA 5T5OA 4HK8A 3VBUB 2P4EA 4AI2A 1OUSA 4QPGB 4GIQA 3VKNA 1SCSA 3P5BA 2DYCA 2ZGPA 1TVGA 4JDOA 2XMLA 3MF6A 1EV13 2KM2A 4BISA 3S5AA 1H8VA 4HL0A 5K0UB 3KF5A 1RC6A 2JE7A 3ZXLA 4WM8B 4UXAA 1QDCA 4I3PA 1KEXA 4XFIA 4MGKE 5IVEA 2CGNA 2G9FA 3K2OA 1YXWA 3AXDA 2VZUA 3N4MA 1MZ5A 5ABJB 4KGGA 2QTWB 2XLAA 4CUBA 2CGPA 5KHGA 3ZN6B 2YC4A 3NQHA 4D7TA 2VOTA 2BJSA 1ACCA 3ZYJB 1BQPA 2VPVA 3VDAA 4QDRA 2NZ9A 1VE0A 1YJKA 4NRMA 2CWMA 2RS32 1XNTA 4MXVA 4MLOA 3ACHA 3JD71 2O8QA 4LO6B 4XAAA 5DUXA 2QQWA 2WO3A 1UOGA 2VM9A 2W46A 2BVVA 4BHPA 4LBMA 1REEA 2HWC3 2WJSA 5GZFA 1JYCA 2J22A 2WO7A 1DHKB 3DCQA 3HPNA 4OUEA 2ZGSA 4I02A 4LLOA 2OVUA 4OLLA 1C8NA 4ZPIA 1W05A 5SV8A 2PXJA 3B94A 5T5PA 2BGCA 3T2QA 1WLTA 1LOGA 3ZXDA 4E2GA 5LK7B 3O1RA 4CCDA 4N90A 2EXHA 2QE3A 2VVEA 2R041 1UZVA 1D4M3 1FMD3 3J8F2 3LEGA 3PMEA 4LBKA 4OMDA 5LBCA 1OVSA 2UYBA 1W6NB 3POIA 3ZIWA 4DUVA 1ASJ2 4W6XA 2XH6A 3INAA 1G8WA 1PZ7A 2NMOA 4AR2A 4KH9A 1WD3A 3CZJA 2DVGA 1W8TA 1VLNA 1D2QA 3DYOA 1M4WA 2HBTA 5FFOC 5F3CA 1VB4A 4ZS3A 2FDKA 3AKRA 2AR6A 3K4DA 4D6RA 1BBT1 3DL3A 3RSJA 2UWAA 1RUC3 4QPIA 4KNCA 2VO5A 4GWIA 4LHNA 1POV0 1WMDA 5CB7A 5DXDA 4P00B 1K45A 3VBRB 1VBB2 1GZ9A 3AMQA 4FVVA 1WBFA 4FXGB 5CFCB 1ULEA 4L0PA 5IVCA 2EAAA 1WCQA 4C91A 2CDPA 3IIIA 4R9AA 4M0HA 1W39A 4ZZ8A 4IV1A 3VD9A 2XVLA 3WG2A 1J1TA 1Y7BA 2J1RA 5BNOA 4XJWA 2RS13 1DQ2A 5T3NA 2VNRA 5A3OA 2AUYA 3MICA 4GB31 4N9HA 3LF7A 2DU1A 3E6BA 5FMDA 4V2WA 1N3OA 1W9YA 3RG0A 1V6JA 1MS9A 3ZFEB 4YGDA 1V9U1 3IDBB 3Q8FA 4RQPC 2QJVA 5JIAA 2CDOA 3GXUA 4MGQA 4WVWA 2CY6A 3K51A 3TB0A 2VZQA 3VLBB 4QU1A 3KT1A 5K8SA 2Y6LA 1QH7A 3AP5A 4C8DA 3ZYRA 4QQLA 4CYDA 4JGYC 3CZUA 5FK8A 1HV1A 5FZAA 4AEDA 4JDNA 1DZTA 4HVOA 1UD1A 3MI8A 1S55A 3K46A 3ZXFA 3GYDA 4UBHA 4IEZA 3W58A 3H8OA 5BPXA 2VW0A 3LSEA 3AKSA 3H3ZA 4CCEA 4QHBA 5BYNA 3WP3A 2BZDA 2VNGA 4BE3A 5DAVA 1HQLA 2A75A 4IDZA 4XDOA 5FY4A 1UYYA 3SC7X 2B4KA 3ZMNA 3ZYGA 3A4UA 1JZ3A 4EWEA 4INDA 3I2KA 4NIAA 3TN92 4XACA 2SBAA 1MEC3 1S1AA 2RDRA 2WZEA 3AZVA 2WABA 3CJIB 3RS6A 3WF1A 3PUSA 4BIOA 1W2TA 3S0MA 1RUE3 1GOGA 2B7YA 1QXRA 4NR1A 1O8PA 5CAZA 4BZ4A 1TNFA 1G86A 4CXWA 5KHJA 4CDWA 1O3RA 5T5LA 3WY6A 1W9SA 2PLV2 3VD4A 4P9XA 1H1MA 1WZXA 4Y1ZA 5A6YA 5FR3A 3H7JA 3LIGA 2A6VA 5F32A 1TZOA 4AQTA 1GWMA 1W9FA 4AI3A 2WNEA 3WUDA 3HR9A 1RIRA 1LNSA 3KB5A 2RM23 2D6OX 4L2NA 3T0AA 3ACLA 4XCBA 1FATA 1ZBE3 1D2SA 1AYN1 2ZHMA 1H4HA 5BUVA 1VBA1 4FPFA 3LFIA 4PLNA 3ILRA 4YZ5A 3O1UA 4B4QA 5A6ZA 3VHRA 5KBFA 4K1YA 2A73B 1UPSA 3LD8A 1UZZA 1T6BX 1IS3A 4B4RA 4RS5A 2WNVA 3PHMA 2QVSB 5EJ1B 3AYCA 1LOBA 2OKXA 2HWD3 4E4DX 4CRQA 2E7AA 2PAKA 2B39A 5L9VA 3WOGA 3WVJA 1S0EA 3FX3A 1ZZ9A 3GCWA 2WAOA 3W5MA 4ISRA 4YGBA 4JDMA 5CKNA 1RJ7A 1QJY1 4B4PA 3WHTA 4JKMA 3VBHA 4BJ0A 2P34A 4OHYA 2DCKA 4R9CA 1PNGA 1OXCA 4NIGA
chains in the Genus database with same CATH topology
3M70A 4KU8A 4Q4V1 5BNPB 2QDRA 4Q0SA 1BEV2 3ILNA 3WW1A 1XYOA 2D3RA 4LO4B 2FHRA 3CLPA 1LGNA 1W6QB 4N7IA 5CG9A 2ILMA 3ZO0B 3X29B 4CDXB 3UJQA 3FBYA 4QPIC 3IPVA 3LAGA 5IUQA 3OPZA 1LKNA 3O0VA 1GICA 1AL22 1W6OB 1U5ZA 3PJYA 2NP0A 1R092 2ZJCA 1SBFA 4I0BA 1MS5A 4C0HA 4JQRA 3WLUA 4QQPA 3LKJA 1QNWA 1PGW2 1LHVA 3FZ3A 4LBNA 2AENA 4M01A 3USSA 2R49A 3AYAA 4RR3A 2CNAA 1RMU3 3AZYA 4Q4W3 5A3LA 3ZPYA 1V70A 4QQ2A 4HZFA 1RUH2 3KGZA 5GLWA 1AR71 1MS0A 4RGAA 3AFKA 1A8MA 2WZR2 3V65A 5TSWA 1WA4A 1YIFA 3JB4C 1V6KA 1QKQA 3WDUA 1HXS2 2YROA 3GZTB 3LOIA 3OBTA 2WNUC 2PAEA 1OMIA 1DGRA 2UU8A 3E6DA 2D6LX 2I07B 1NCQC 5JSRA 4AEDC 3OD0A 3PVOA 5DG1A 1PGL2 2VMHA 4LO8A 2X29A 3H7YA 3THTA 2DFBA 1UU6A 5JVVA 2UY9A 1QNYA 1G9DA 4BMBA 4R9BA 4J1XA 1DQ4A 3NVCA 4GULA 2IC1A 3KS7A 1OLQA 3UK9A 4META 5EJ3A 3NKTA 3CU7A 5BXXA 1CR7A 2R1BA 1RUD3 2D97A 1ULGA 3WX5A 3PNAA 4DQAA 3UKVA 4DMIA 4CDWC 2ZGUA 4LA3A 2O0OA 4GQ7A 4QMAA 3I2DA 4IEPA 1Q8QA 4AQSA 4GKYA 1ZM1A 2WSUA 4GMP1 5BY5A 1A8DA 4M3CE 1QJX2 5CU1A 2YV8A 4UW5A 1MS4A 1AR62 4YFWA 1PM7A 3KSCA 1OHFA 4RS5C 3RJ2X 1DZRA 3AP7A 5H9QA 1R082 3WCSA 1G9FA 1V6IA 4COUA 1KITA 4K21A 1AX0A 4L97A 1PIV2 1JUHA 4QPIB 1GBGA 2BTVC 4Z07A 1DQ0A 3VBHC 3JD73 1VRH2 2IFRA 4Q4Y2 4X6RB 4MVTA 2PHFA 1YRZA 3M3EA 2PHXA 1W0OA 2VXRA 5C8WA 2GZWA 2VECA 5E16A 3R4UA 4IV1B 1T6GC 5BNOB 1UAIA 1TME1 1ULFA 4Z92B 5JIUA 1YHFA 4FQZA 1YFXA 3BTAA 3M1HA 4DY5A 5C9AB 1DBNA 1QU0A 2R043 2R0FA 5T52A 3DPRB 4FAGA 3HT2A 2PHTA 2JG9C 2YY1A 4ASMB 4EN0A 5JI9A 1SBDA 3MYXA 3S7IA 3JBG1 5J98B 3B02A 1GQHA 4AEDB 4XXPA 3PVNA 1VBE3 2BNOA 5F6KA 1C8M2 1XYPA 4FCAA 1MS1A 1SLTA 1BBT3 2HEVF 4MGYE 4AEMA 1PK6C 3ZX7A 1XU1A 1RUJ1 1FNZA 5E8AA 2ZX3A 3WD5A 1DYPA 3M3QA 2B45X 1H4GA 3VBUA 4QPGA 3RYKA 4K8FA 4AHXA 3GNEA 2DUOA 3KQRA 1YFUA 3U0ZA 3EJKA 2MEV2 5CBLA 3VZKA 1RVF3 1A78A 1UMZA 4AEJA 1ND2A 4WM8A 3RI8A 1MVEA 1YFYA 2B8MA 4GB33 1VAVA 4DINB 4CDWB 1HRV3 3QOPA 3I7DA 1LEDA 4MYEA 4XTPA 2I74A 4LHKA 1I5ZA 3HMYA 2WC2A 2A7AA 1V9U3 2DTWA 4AE2A 4Q29A 4YARA 3WG1A 1SMVA 3BPZA 2ZMNA 3KLSA 1WW7A 4P14A 1IQAA 4Q0QA 1U12A 4KBBA 1GNZA 2RS31 5GLZA 1QJZA 3M3CA 1YO8A 2WNVB 2XB6C 4LA2A 5I93A 1U5IA 4YNIA 4COWA 4QGLA 2A5ZA 2C5DA 3SLIA 2IWGB 3PJQA 5BNNA 5KC5A 1UL9A 2OIIA 2VOWA 3FBMA 4AI1A 2QFEA 4FSJA 1LHWA 3UV9A 2ZX1A 1W6NA 3J8F1 4YZ3A 2YYOA 4P9JA 3GHNA 3WP5A 1ASJ1 2O1QA 4D69A 1NA1A 4S2FA 1EY2A 4RGGA 3WW4A 3WQ7A 1AYN3 1CIWA 1BXHA 1VBA3 4SLIA 4CP2A 3IT8A 3O0WA 3KM5A 4KQ7A 1I1EA 2QKDA 5FLIA 3MW2A 5HCFA 1VBB1 2ARBA 1DG6A 4EN8B 4P9WA 5FLHA 2RMU2 4B29A 4NOTA 4CZSA 1H1AA 1UKGA 3U07A 4R4XA 4RR3B 4XPVA 1D0GA 3AKTA 1UN1A 3VKOA 1J58A 2PHRA 3D5OA 1SFYA 4P9YA 1QJY3 2XG3A 1G9BA 1PZ8A 1V6LA 4S2HA 1VBD2 1NXMA 1R1ZA 1QJU2 3ZFEA 4P9IA 3POYA 4JVAA 3RMYA 4HN1A 1QMJA 4ES8A 5I0SA 1AJKA 2D3SA 1KFXL 4OHWA 5J48A 2EAKA 4N53A 1BVP1 4XBQA 1F9KA 3K48A 4LLFA 3IBMA 2VVFA 2EIGA 4QT6A 1O91A 4XJ8A 2R072 2WQ4A 4FP2A 5AVAA 4KWKA 3VBUC 1CESA 4QPGC 2WS93 1GLHA 1JHNA 1C1LA 1AF9A 3ME2A 2Q4SA 3TN91 5K0UC 1W6PA 4J6GA 1IS5A 3CJIA 1SLBA 4WM8C 1GFF2 2WLQA 4AHZA 1WW5A 2O8OA 4HVQA 4G9SB 1AR73 2XUMA 2PLV1 3IKWA 1UU4A 1IKQA 4BLIA 4L11A 4KWJA 3RPQA 1SBEA 5EXOA 4CP1A 3S30A 5L73A 3WR0A 3B9CA 1HQWA 2XJTA 4R52A 2YUEA 1H2NA 2GMEA 1FYUA 1RUG3 1LB2A 3L2HA 4F3JA 4URTA 4Y4YA 1WBLA 2WT1A 2A6ZA 2AYHA 4RD7A 1S0DA 3VBSA 2YPJA 2X8KA 3HWJA 3SH4A 1XQNA 3WV6A 5HXVA 4Q0VA 3S7EA 5KXBA 2MPFA 2H6BA 3WXPA 4FAHA 2GNTA 4W65A 1OA2A 5GZDA 3AKPA 3KT4A 3OGGA 1UIJA 4NWVA 2H0VA 3I54A 1PVC1 5F1RA 1C5HA 2BNNA 3MGUA 2DWRA 1LU1A 1NA1C 1H2MA 2XBO2 4H3WA 4IEOA 1BEV1 1W6QA 5BV6A 4CDXA 4GMP3 3ALQA 1FT9A 4PDWA 2RS51 3CEWA 4YG3A 2PAMA 1QH6A 4FTEA 5DUVA 3WCRA 1LHUA 3VBRC 1X8EA 5IK8A 1W6OA 4HBNA 4M3CF 4Q2FA 1S0FA 3FLPA 3OCPA 4AVTA 2JX9A 1WW6A 3JU9A 4LBQB 3LA2A 3C3VA 3HT1A 4ZXKA 3AKQA 1R091 5FDBA 4OUSA 4XFCA 1AJOA 3QH7A 1GNHA 4XF0A 5GJ6A 1EAH2 2JDZA 4IQPA 4DNYA 1WW4A 2JEMA 1JYIA 3MIEA 4D7SA 2XJSA 2PHWA 2YMZA 1LOEA 3GBGA 4YM0A 2K0GA 2TEPA 1NE6A 4KG8A 3ZFFB 4EN7B 3ZFEC 4X8PA 4CDQB 1QOOA 3VBOA 1RUH1 1EPWA 5I0TA 1G9AA 4XE9A 2D93A 2ZKLA 3TYJA 2WZR1 2BNMA 4D7YA 2G4IA 2WL1A 5C8CB 1XNDA 4NHKA 3LCPA 1HXS1 3WDYA 1NCRA 3O7OA 2IXIA 1ND2B 2R1DA 3NKGA 2E7QA 1NOVA 5ABJA 1HRI2 4JGZA 4DXZA 3AB0A 1PGL1 5GLUA 1KDMA 3B00A 3AP9A 1Q8SA 2HWE2 3RMXA 4JV4A 4AQ6A 4XETA 3LWCA 4XXAA 5JSOA 3WP6A 2JECA 3CJIC 2V09A 3D0JA 4IERA 4U36A 3TRSB 1NE4A 3H50A 3IDCB 2D5HA 4BMEA 1RUJ3 3ZSKA 4QGMA 2DU0A 2EF6A 2JKBA 4LUKA 5H9RA 3NL1A 5KHKA 3VKLA 1KJRA 3W9AA 2VU9A 2LTNA 1KJLA 1OOPA 3HN1A 4LUMA 4NO4A 4OI4A 2D6PA 5BNNB 2H6CA 3R4SA 4Q26A 4WZCA 3FLTA 3LA3A 1QY4A 1SLIA 4ZU4A 4Z2WA 1QJX1 1QGLA 3UKTA 3WUCA 1Z7S1 2JJ6A 3M2MA 1AR61 2FZ2A 1M06G 2WQZC 1O5LA 1SACA 1HKDA 1NA1B 4IEYA 2DCYA 4GWMA 4LBJA 1R081 2QNKA 4BLJA 1X33A 4AXOA 3U10A 4D94A 1O5UA 3WP4A 1Q5OA 4YW5A 2G9GA 1PIV1 3O5SA 1ZVFA 3HIFA 1IPJA 3MLLA 5JMCA 1VRH1 1XE7A 2GC0A 4Q4Y1 5I91A 1ZRFA 5BNPC 3THPA 2C1FA 2F6BA 2BWAA 2D7FA 1FV3A 4CDXC 2GMMA 2IXLA 5D8AB 4A7KA 2CTVA 2OUJA 5C9AA 3NSTA 4FOWA 4OFGA 4AQ2A 3DPRA 3LOBA 1ALYA 4HKLA 4N43B 3J8F3 2ZCWA 4H14A 1SDWA 3AJYA 5JZGA 4PQ9A 1LGBA 5C6CA 4N53B 1CVNA 4P5HA 2HWF1 3AP4A 1EPZA 1RUE2 1S2KA 2YGMA 2ZKNA 4DZGA 2OW4A 4Y26A 2PYTA 3BU7A 1OA4A 4E2QA 4QD2A 3T1LA 2VH9A 3BCWA 1F8VA 1C8M1 4WM7B 1PHMA 4LEJA 4AFBA 1KRIA 2D3PA 1LJ7A 3JQXA 1X36A 2Z79A 4RHV2 3RZZA 3USUB 1WLWA 1S0GA 1U5XA 1VBB3 3KMHA 4Q4X2 1CAUA 3WW2A 3IMNA 1SLCA 1OI6A 4MXWB 4WZFA 5F5QA 1DQ1A 4BPZA 3IIAA 1W6PB 3PLQA 2DVDA 2MEV1 4XMIA 5JI7A 5FREA 4JCKA 4ITCA 4NN0A 2P3IA 1FX5A 2XKPA 2IXCA 1YWKA 1DGRN 2BFUS 1C4RA 4HSJA 3N36A 2W0XA 4QQHA 3V0BA 2ZZJA 1TMF2 1LEMA 2VW1A 1ZBA2 5AVPA 2QZ2A 5J36A 4R8HA 5EZWA 1ENSA 3AP6A 1JBCA 4QGNA 5EYXA 1YJLA 2TUNA 3R4DB 2ARXA 1ULDA 4K7JA 1OOPC 3VBSB 4FOQA 3RWNA 1DYKA 3SHRA 1CPNA 1H2LA 1YUDA 5E89A 1FOD2 1AR92 3TN93 4W6YA 1GKBA 3J4UH 3WG3A 1LRHA 3MIBA 1UU5A 1D4VB 2UURA 3DN7A 4JTOA 3ZMOA 2FBEA 1PVC2 2R062 4CEYA 3MDPA 2D6NA 2PLV3 2DCZA 1OKQA 1AXZA 3ETQA 4Q4W2 1NQJA 2RS52 4BQ1A 3GHMA 4J1WA 3FFZA 4FPJA 3ATGA 4PDWB 3WDWA 1NQDA 4HSLA 4QPYA 1AXKA 1G9CA 4B7EA 2XGXA 1CAVA 3CL1A 3BODA 2D6MA 1S0CA 4O9GA 1BMV2 4TYSA 4GMP0 1J3RA 2XJRA 4FPHA 3AMHA 4IV1C 3QH6A 4ZU5A 5JOWA 4UW6A 1H8TA 4YVWA 5BNOC 2DF7A 2RMU1 4F7ZA 5K7PA 1UIKA 2IZWA 4UW4A 1JUIA 5FMOS 3WT3A 1HX6A 3FWEA 3ZXJA 4M3CA 5L36A 4YZ4A 5C9AC 4AWDA 1V00A 3ECQA 3DPRC 1TQ5A 3VBOB 1ZRCA 1UKRA 4NWWA 4PLOA 1VBD1 1QJU1 2XVKA 4TLFA 3V56A 4H55A 1CAWB 2W39A 2GDFA 1NCRB 3AMPA 2HKXA 5J3UA 2FMYA 4XFBA 4JGZB 5EYYA 5ABJB 2GSYA 2PA7A 2Q1MA 4O9EA 4I0AA 3JUUA 2Z5WA 4LHLA 4LTAA 5GKAC 3A0NA 3AMNA 3N35A 1RUI2 2R071 1AL23 3P3NA 1KS4A 1R093 4RA0A 1NZCA 3EQEA 4YZ2A 4FPYA 1PVXA 3QBQA 1LHNA 1SLLA 3L2YA 2HJIA 4Q8LA 1O3QA 3NJZA 3Q9OA 4JAAA 3H1WA 1FPN3 2VOKA 1LHOA 4IEXA 1FNYA 1AYM2 3S6PA 3IN9A 2WLPA 1RUH3 1X7NA 1OOPB 3KGLA 2VUAA 2WZR3 1ZX5A 5JCTA 1DF0A 3WG4A 3OTFA 1ONAA 4QX5A 1C1FA 1HXS3 1U0AA 1LOAA 1Z7S2 4YG0A 2VOVA 4DOUA 1LTEA 2DV9A 4AF9A 1REFA 2WNVC 1Q8OA 4R4ZA 3EO6A 3RJRA 3ZXKA 1COV2 4YRDA 2N7GA 1U5YA 2XPJA 4ZU7A 2R16A 2K2SA 1YFWA 3PTYA 1RHI2 2OZJA 4C0BA 5LEKA 2GC3A 2ZS6B 1VP6A 3B93A 1PO22 4G3YC 4HN0A 3IM0A 2B42B 5KXDA 3I59A 2WFPA 4FPGA 4GH4A 4AVVA 3FE5A 1IGOA 4CEWB 3NV3A 1GV9A 2R30A 4CEYC 4KL1A 4AEKA 2E7TA 4CDUA 1K5MA 1RUNA 1JXNA 1ULCA 1OQ1A 2XBO1 3FHIB 4GWNA 2R6QA 4FPEA 2HEYF 2YDEA 3PMSA 2HWB2 2GAUA 2QDNA 4FPOB 4CP0A 1QJX3 3RQ0A 1UX6A 1VBC2 5DDJ2 3DKWA 5GZEA 1PZ9A 1AR63 4LBQA 1MQTA 2OZ6A 2HWF2 5JZGB 2VVDA 1RVF2 1ZZBA 4YVWC 5JPMB 1R083 5AC92 4HMZA 1SLAA 4RR3C 2XL9A 1HRV2 1AVBA 3SH3A 3WHUA 1EAH1 1WLCA 3OD4A 4LT5A 1PIV3 2R0HA 4COZA 2ET1A 1WMFA 3ZFFA 3DV8A 1AR82 2BW8A 4PJYA 4CDQA 3ZVXA 4EJRA 4YZ1A 2BUKA 2A71A 3O14A 1VRH3 4Q4Y3 1UPIA 1CAUB 3AXEA 1PGSA 2TNFA 2ZBJA 4ORFA 4ASLA 5A32A 3B3QE 5C8CA 1QQP2 4LR4A 4I30A 5F6LB 2BBVA 4BIFA 4AK3A 1CONA 2BFUL 2A70A 3CF6E 3OYWB 5E88A 4QXKA 5EV7A 2EVXA 3H3UA 1HRI1 2XKOA 3AZWA 4COVA 1S0IA 1KD7A 2GH8A 3NV2A