3NV2A

Crystal structure of human galectin-9 c-terminal crd in complex with n-acetyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv2A00
5IK8A 1JW6A 1WBFA 1GZWB 3AZVA 5H9QA 2P2KA 1HKDA 1SLTA 2ZGTA 4BLJA 5GZGA 1KRIA 4K20A 1AF9A 4XIOA 4Q26A 1A78A 1I3HA 3RG0A 1MS4A 1W6PB 1DQ1A 1W0OA 3WDXA 4ATEA 2ZBJA 4Y20A 2ZAAA 5T50A 4YGDA 2Q5TA 2ZZJA 5JDBA 3FUOA 1CONA 1MS0A 1QOSA 2EIGA 2GMMA 2R1BA 4GWNA 3LSDA 3ZPYA 2JKBA 1N1YA 4Y1XA 3GNEA 1ENQA 1V6JA 1MVQA 3AZWA 5KXBA 2JD4A 2R0FA 1G9AA 1KDKA 5H9RA 1ULFA 2ENRA 4PF5A 2DUQA 2W68A 3ZYPA 3C2UA 3USUB 1CPMA 1O4ZA 1AX0A 2PHXA 2JJ6A 1F9KA 2ZHLA 3M1HA 4YW1A 1S0GA 1LHUA 5T55A 2VY0A 2NMOA 1GZCA 3WG4A 2OW4A 1WLDA 1SBDA 2ZGQA 2D6MA 1YO8A 2D7FA 3N7JA 5JMCA 1GNZA 1W6OB 3LCPA 3POYA 4YW5A 4OZXA 1G9CA 1BQPA 1SACA 4FQ4A 1LHOA 1O4YA 4Q27A 5DUXA 1UMZA 3T1LA 4K1YA 2E51A 3U4XA 2GNBA 4XXAA 1GBGA 4P14A 4PQ9A 4U36A 4FPFA 1LU1A 3RRDA 1ULCA 2DVBA 1HQLA 2FHRA 3TAYA 1QGLA 4LBQA 3WG2A 1WLCA 2ZMNA 4H55A 4BQ1A 3Q9OA 1MR5A 1X50A 2ZHKA 2W52A 3IN9A 2CL2A 1FNYA 2A3XA 4XDQA 1G8WA 3WDWA 1V6MA 5CAZA 1F31A 2ZGUA 5DUUA 3H0OA 4ZKTB 5T52A 5DG1A 4YW4A 4DS0A 1LHWA 1ULEA 3RMXA 1KDMA 1W6MB 2DWRA 1MZ6A 1G86A 1H30A 4JCKA 1DQ6A 4PBOA 1HDKA 4M00A 1CPNA 1AX2A 2D6OX 1LOGA 2CY6A 1APNA 2R1DA 3RQ0A 3RSJA 2I2SA 3WHUA 4YG0A 2DURA 3V0BA 1DQ5A 1KJLA 4Y20B 2P3JA 1SFYA 4DRRA 3SH5A 1N47A 1EPWA 3UL2A 3ZXKA 5GALA 1JN2P 2V73A 3NV4A 4GA9A 2DVDA 1SLIA 5GM0A 1AZDA 2Z42A 2ZABA 1SCSA 4P9YA 4XJWA 3SH4A 3WHTA 3ZSLA 1URXA 1Q8OA 3MW2A 4YG3A 4YGEA 3UJOA 2UWAA 3LSEA 1CJPA 3OY8A 1W6QA 4YZ1A 2E7QA 4GWMA 2ZHMA 1ENRA 2D6LX 2W08A 1AXZA 5HCAA 4UW3A 2YMZA 3R4SA 3R4UA 4YM1A 1W0PA 1WBLA 2YROA 2P3KA 1H9WA 4WZFA 1V6KA 1UAIA 2GNMA 4NOTA 1GSLA 1XQNA 2D44A 1FX5A 1JHNA 3OYWA 1LOEA 2JDZA 3ATGA 5EYXA 1WW5A 1AX1A 1LGBA 4DPNA 1G9FA 2A6WA 4XJZA 1LOCA 1LGCA 5IUQA 5H9SA 2OUJA 1WD3A 1N3QA 2A71A 3B69A 2ZGLA 2AYHA 1QDCA 5DZFA 5T54A 3ILNA 1MS5A 3AK0A 4R9DA 1DHKB 1LESA 3AP4A 4XTPA 4ISQA 1Q8VA 3OBRA 5GLZA 4YGBA 5HCBA 1CVNA 3RS6A 3A0NA 1I1EA 2ARBA 1QOOA 3BIWE 2AENA 3AZZA 4LBQB 1QOTA 1D0HA 1JBCA 3UJQA 1VAMA 5CBLA 3AZYA 5KXDA 4PBPA 3AXDA 2GALA 4YM3A 5GZDA 4LBKA 1Y7BA 4FVVA 1GZ9A 3ZVXA 4L8QA 1DQ2A 2ZGNA 3O5SA 1QNWA 1UN1A 3ZXFA 2CWSA 3D4KA 4UW6A 3FFZA 3T2TA 1MS8A 1KJRA 1YXWA 3ZXLA 2CTVA 5JOWA 1N3OA 1SBFA 5GLVA 4Y1UA 2ZGRA 2DVAA 4F83A 4AGVA 2EALA 1WD4A 4BPZA 2JE9A 3WG1A 1LODA 1CESA 1JXNA 1RINA 5DUVA 1GNHA 3VKLA 1JUIA 2A7AA 3PVOA 4M3CE 3IM0A 1G9DA 2A6YA 1SLBA 1G9BA 3NV3A 2OVUA 1CN1A 1F5FA 5E8AA 2V5YA 1OKQA 1ONAA 2XB6C 1LOFA 5FRAA 2ES3A 4Q2FA 1U0AA 1LECA 2UURA 2CYFA 4JRAA 5HCFA 1FYUA 1SLLA 2NMNA 2OUHA 2AH2A 5DG2A 3V0AA 1B09A 2C5DA 5T5LA 3WDYA 5DZGA 4WVVA 5T5PA 4Y1ZA 1AJKA 1HQWA 3A0KA 1W6QB 2SLIA 3N7MA 3OY8B 3PJQA 4HANA 4YLZA 4YGCA 4XTMA 5JVVA 2GMPA 4FOYA 2NP0A 2D3SA 2A70A 4FP2A 1N3PA 1SBEA 1BXHA 4XMAA 4Q1RA 4BOWA 1MVEA 4Y1VA 4Y24A 2WSUA 1CIWA 1V6IA 3I4IA 4Y22A 3AP7A 1IS6A 4XJUA 3OYWB 1GANA 3MEPA 5JLVA 1UPSA 3HN1A 4LBQD 4XOGA 4XJAA 2A3WA 4YZ2A 2JECA 1C1FA 3A4UA 3ZYRA 5KXEA 2A75A 1BJQA 4JC1A 1ULDA 4GKXA 3WOGA 1S0DA 2P34A 1VAVA 3ENRA 2E7TA 1IKPA 1PZ8A 1GKBA 3D6EA 4LBJA 3WNXA 4YFWA 1MACA 2JE7A 2AREA 2ZGSA 1CQ9A 2ZHNA 3WDUA 5BYNA 2PELA 2EAKA 3OPZA 1SLAA 1C57A 1LOFC 3FLRA 2AR6A 1GZWA 3AP6A 3WLUA 1JOJA 3B00A 2C9AA 1FV2A 3DGTA 4C1XA 4R9BA 1S0IA 2D3RA 1KQRA 2PHWA 2DU0A 2A6VA 2AGSA 5KXCA 1AXKA 1V00A 4ATFA 2PHTA 1C1LA 3N3HA 4XJ9A 3WDTA 1LENA 5SV8A 3AJYA 4BMEA 2YY1A 4YZ5A 2VW1A 1AVBA 4P9WA 3R05A 4YFZA 2SBAA 1NLSA 4YW2A 4AWDA 5GLTA 4YM2A 1ZA4A 5EXOA 4UW4A 4AVTA 1QF3A 1LU2A 1DQ4A 4FOWA 3KM5A 4KBBA 4FPHA 2CWMA 4P9XA 3WCRA 4XXPA 5FREA 3FUQA 5GZFA 1MS9A 1R1ZA 5DXDA 5AVAA 4Z8BA 2RHPA 3D5OA 2A6ZA 3MW4A 3QLQA 5GLUA 3AP9A 3AX4A 4FPCA 1N1VA 1C4RA 5F5QA 1LOAA 2GMEA 3NV1A 3SNMA 2DYCA 2WKKA 3MPPG 4XE9A 4R9CA 1LTEA 5GJ6A 3M3QA 2VH9A 1CR7A 2DUOA 2NM1A 4K21A 3V0AB 2EF6A 1DBNA 2DVFA 2WJSA 4XBQA 3N36A 1LEMA 2DV9A 1LHVA 1JYCA 1Q8SA 1GICA 1Z0HA 3AZXA 3POWA 3HR9A 4K1ZA 2GNTA 2PHFA 3SLIA 4AVSA 3V65A 1WW4A 3VKMA 1MZ5A 4YG6A 2DVGA 4Y22B 3RMYA 3WCSA 2NYYA 1FAYA 4YZ4A 2ZGPA 1A3KA 3SISA 4M3CF 2VU9A 1DYPA 1FATA 1W6NA 1IOAA 2D43A 3M3EA 1J1TA 4FPJA 1DGLA 5DUWA 5CB7A 4ASMB 3N7KA 1LHNA 1S0JA 2WSVA 2G4IA 4GXLA 2GN7A 1HLCA 2E53A 4Q1PA 3ZXJA 2YZ4A 4AGGA 1LOBA 1LGNA 1DQ0A 2P37A 1D2SA 5CNAA 5T5JA 3SH3A 1WUVA 5GLWA 2XG3A 3KQRA 2TEPA 5L73A 1AJOA 5IK7A 2YXSA 2BQPA 2PHRA 3ZSJA 1N1TA 3M3OA 4RL7A 2NN8A 1UKGA 2ZGKA 4WVWA 3PVNA 1BYHA 3O0VA 3O12A 2ZA9A 1OQ1A 1WW6A 3O0WA 4M01A 2LTNA 5JOZA 4IQPA 1MS3A 1RIRA 3V0BB 2AUYA 4FPKA 1S0CA 4FOVA 3AP5A 3DUIA 2WNEA 4YW3A 4LBNA 4BLIA 3QCWA 3IKWA 1ENSA 1OFSA 3T1MA 3VV1A 2ARXA 1G7YA 1PZ7A 5JOYA 4FPOB 1S0BA 2GDFA 4Q8LA 5LK5A 4AYUA 4DFSA 4XMIA 5E89A 4XZPA 3WUCA 2ZMKA 2YV8A 4W65A 3ASIA 4M3CA 1DLLA 4Y26A 1SCRA 4LBMA 2R16A 4XYXA 1KITA 2KM2A 5IK4A 4FP3A 1FNZA 3AYCA 3OBTA 2CNAA 4Y1YA 3B01A 2GN3A 4FPLA 5CA6A 3UK9A 4FOQA 5IK5A 1V6LA 1Z78A 1Q8PA 1ULGA 1FV3A 1YRZA 1GYKA 1SLCA 1DIWA 3CNAA 3IPVA 4PCRA 3BODA 3VKNA 3NWKA 2NZ9A 3NV2A 1UX6A 4DQAA 3GALA 5JOXA 4BM8A 2GNDA 4MYEA 4CTEA 3N35A 1V6NA 4ISRA 3WUDA 1DFQA 1H9PA 1S0FA 1IS4A 2D3PA 3ZSKA 4FPEA 2DTYA 2UU8A 5E88A 4ZXKA 4AVVA 4YM0A 3FLTA 2EXJA 2DUPA 3L2YA 1BZWA 1WLWA 2VXRA 3M3CA 2A5ZA 1W6NB 4R9AA 2P3IA 4I30A 1LEDA 1W6PA 4AGRA 1VLNA 2D6KA 2DU1A 3AYDA 1ZM1A 4CRQA 2E6VA 4GALA 5EWSA 3AYEA 2WT0A 1GLHA 2HYKA 4FPGA 2ZGOA 4HL0A 2ZACA 3N7LA 1LULA 4FPYA 4SLIA 4TZDA 1A8DA 3I8TA 1LJ7A 1JYIA 4XJ8A 3HMYA 5GZEA 5IT6A 4XILA 1Q8QA 4BMBA 2EXHA 1MS1A 1S1AA 1V6OA 2WT1A 4LBOA 3O0XA 2UWCA 1QDOA 1QU0A 3WV6A 2A3YA 1QNYA 4XIKA 1TEIA 2FMDA 1UZZA 3ILFA 2LALA 1AXYA 4NO4A 3USUA 3V64A 3W59A 4CZSA 2B7YA 2VW2A 1S0EA 1DYKA 3B3QE 3WVJA 1LCLA 1QMJA 2D6PA 4UW5A 1Q56A 4XHBA 5F9TA 2VUAA 2EXKA 2W39A 3JUUA 3IMNA 3OJBA 3WZ1A 2ZMLA 3AXEA 4RA0A 2ERFA 4FQZA 3FLPA 1GV9A 3W58A 1VIWB 1YI7A 1YYNA 2UWBA 2WLQA 5H9PA 1UZYA 4TYSA 1W6OA 4WV8A 3PVEA 3VKOA 4D69A 1YIFA 4M3CB 4XBLA 2D6NA 3FBYA 4C1WA 1DZQA 3AYAA 1WCSA 1VALA 5DZEA 3APBA 5GZCA 3AJZA 3PMEA 1IS3A 3VUOA 1N1SA 2A6XA 2ZGMA 3AFKA 3M2MA 3TB0A 4ITCA 4DRVA 4U2AA 2H0BA 1PZ9A 2WQZC 1WW7A 3BOPA 4GKYA 2DTWA 3WG3A 3BTAA 3ZSMA 3ZXEA 3MW3A 2WT2A 1QKQA 2VW0A 2ZKNA 1IKQA 3IPVB 3SITA 3JU9A 4LBLA 4XBNA 5EYYA 1IS5A 2R49A 2EXIA 3B9CA 1UL9A 3ILRA 5T5OA 4Q8KA 3OGGA 1RITA 1W6MA 2R0HA 3VKFC 2PHUA 3INAA 4XHXA 4YZ3A 1NXD1 3WDVA 1BKZA 3POSA
chains in the Genus database with same CATH superfamily
3FHAA 1A8MA 4JVAA 4RR3C 4K40A 4BLJA 5GZGA 2QVSB 2ZGTA 2OIIA 2RR12 3B93A 4JDMA 5FBZA 4K20A 1AF9A 2YU2A 2BP6A 1A78A 1PM7A 3RG0A 1AL21 1QQP1 5A7PA 1UIKA 1W0OA 3T4VA 4PLNA 2B45X 1VBC3 4N7IA 1AR93 2Q5TA 1WCQA 1NUKA 1RUC2 2RDQA 2VXJA 2X5IB 3CZJA 3ON7A 4EQVA 1JYNA 3FUOA 4UFIA 1W9SA 2EIGA 2R1BA 5C4WA 2JKBA 4IV1A 4KBZA 3MV11 2F17A 4JDOA 1G9AA 5A7OA 3AC0A 4E4ZA 1ULFA 4PF5A 5FXVA 3ZYPA 5FPLA 1O4ZA 2JJ6A 4Z2WA 2ZHLA 1RHI2 1S0GA 3GBFA 1LHUA 2RMU3 2VVEA 3ME2A 1MZEA 1CX1A 3U1XA 3KGLA 1T6BX 3AM2A 5FYUA 1SBDA 2ZGQA 1FOD2 2D6MA 4G4FA 3MFAA 1EV12 3NO8A 4JKLA 1QJU1 4N43B 1C8NA 2ETEA 1RUJ3 4MLOA 4OZXA 1G9CA 1LHOA 3AMQA 5DUXA 1UMZA 3T1LA 3CZUA 3F95A 1US2A 2VCAA 5FXXA 4M4RA 2IZWA 4UAPA 5KHIA 1EAH3 1F4HA 5IWFA 3I3MA 1CAVB 4S2GA 1W05A 2ADEA 1GWMA 3O1TA 3TAYA 2FHRA 4IV1C 1QJFA 3KQ4B 1PO13 4BQ1A 2VZVA 3EO6A 3IMMA 3Q9OA 1IZ3A 1R093 4XDQA 5FOJB 3IN9A 4F7ZA 1G8WA 3WDWA 1JZ7A 4COUA 2WINB 5CAZA 2ZGUA 4ZKTB 3WY6A 2DFCA 5BNQA 1H6XA 1UZWA 5M0TA 5DG1A 5AFBA 2WIIB 1ALYA 1HRI3 4IEZA 1MZ6A 1G86A 3MIGA 4IEXA 1ZBA1 4JCKA 4A4AA 1DQ6A 4HPKA 4DXSA 4OUSA 2R30A 2VZ3A 3T4HB 3ACFA 1XE8A 2WN3A 3ZFGA 1GP4A 1APNA 1NY72 3GF6A 1AYM3 4J25A 1YQ8A 2RS31 1W39A 2G19A 2D93A 1KJLA 4Y20B 1R082 3IDCB 5DDJ2 1QHDA 5F3EA 1PK6B 3ZYIB 5GALA 2K46A 1WCUA 2QDNA 1PVXA 2DVDA 4IXLA 4E4DX 5GM0A 1AZDA 4MV2A 4P9YA 5A6ZA 3WHTA 5BPXA 4OULA 4NIGA 1Y3TA 4CEWB 3MICA 3KVBA 4LHKA 4YG3A 2OPWA 3LSEA 3OY8A 3NAPA 2E7QA 4FFHA 1OKOA 5KHHA 2D6LX 5HCAA 5KHJA 4YM1A 2X05A 1UD1A 1WBLA 4WVMA 2Q0AA 3LIGA 1DF0A 3BVCA 5FK7A 3I2FA 3H3ZA 5HI0A 1V6KA 2J1RA 3M7AA 3ABZA 2D44A 4OQ8A 2BU9A 3KT7A 1Y9GA 1XU2A 3BPZA 2B42B 2WZEA 1UKRA 3DXTA 2A6WA 2LUWA 2PQSA 4LO6B 3ORJA 4NRPA 4BIFA 2QJVA 2Y38A 1IQDC 2AEYA 4N7UA 5KC6A 3OGJA 1FPN1 3NJZA 1N3QA 4HSJA 2ZGLA 4AAPA 1W2TA 2R042 5T54A 1ZZ7A 5CEHA 5EPAA 3ILNA 5D1IA 2YHJA 1MS5A 1XNCA 3KV6A 4C0HA 5GLZA 1DHKB 3AP4A 3WHUA 2RR13 4ISQA 5HCBA 1AR62 4YGBA 5AC91 1CVNA 1JZ3A 4AEDA 2ARBA 2MNGA 1G6NA 1EUUA 3BIWE 4LKFA 4DXRA 4LBQB 4K3UA 1Z7S1 3H50A 3RFRA 4P5HA 1EP0A 1J59A 1RUC3 4LBKA 1Y7BA 1GZ9A 3ZVXA 4L8QA 4MGSA 2WO2A 5FYSA 2CWSA 3D4KA 3FFZA 4BWOA 2J1TA 1YXWA 1KJRA 2R071 5JOWA 2CTVA 3KT4A 2BNNA 4Z82A 2HLEA 1NZCA 2Z4FA 1WD4A 4CPBD 2Y6KA 4BPZA 1RHI3 2JE9A 4BZ4A 3WG1A 2NLRA 4AQ2A 1CESA 1JXNA 1O3RA 5FMDA 4R52A 1OBNA 2XLGA 1ENXA 4YARA 2LW8A 2WQ8A 3PDQA 1KEXA 3O1OA 1PGW2 2J1AA 5CG8A 1FOD3 3KHCA 3NV3A 5B4XA 4YSFA 4Q4Y3 5E8AA 1EV13 3AFGA 1VJ2A 4Q0SA 2FDKA 4Q2FA 4RHV2 4JRAA 2XJSA 1CAWA 2UURA 1E5RA 3LA7A 5FXWA 1P8JA 3ZIWA 4AEDC 2AH2A 4WM7B 4B1MA 4EWAA 2C5DA 5T5LA 3WQ1A 2D5FA 3BIEA 2E7AA 4GB32 5T5PA 4GWIA 3A0KA 5LBFA 3N7MA 3MF9A 2AZ5A 4YLZA 4YGCA 4FOYA 2D3SA 3D0JA 2HWF1 4FP2A 4META 4Q4W2 5JR7B 1QIQA 4Q1RA 4BOWA 2MEV2 3MLKA 5KHGA 3ZKUA 2RDRA 2WSUA 3QD6A 3WNOA 4Y22A 3O1SA 2BYVE 4XJUA 5JI9A 1OC1A 5C8CA 3ZXAC 3KCXA 5CVRA 2LM3A 3MEPA 1GMMA 3PUAA 2YBPA 1UPSA 4A41A 4IEQA 4XJAA 2A3WA 4YZ2A 3A4UA 5IJRA 2A75A 4LUKA 3SKJE 4BQ2A 1RUNA 1ULDA 1MEC1 1S0DA 3KV5A 3QOPA 1OVPA 2DCZA 2P34A 3ST7A 1QJY2 1WCKA 4A7KA 4LORA 1KS5A 1R1A1 1PZ8A 3MIHA 4CP2A 2CGPA 3H8UA 4UF0A 1EY2A 3NNFA 5A1AA 1VRH1 3GCWA 1WMFA 3S7EA 3I2HA 4UT5A 1UYZA 2VOTA 5DAQA 3X29B 1W3VA 2ZTNA 2VMFA 1CJDA 1HRV1 1AR82 3WLUA 3FLRA 1O3SA 3AP6A 4QQOA 5J36A 3OCPA 3DGTA 2BWCA 1W9FA 3J26N 1S0IA 4MGYE 2RS12 1R083 3M3IA 1YC61 3CLPA 2D3RA 3CIHA 1KQRA 3PURA 4Q4V2 5DDJ3 2DU0A 2A6VA 2VMDA 1UPIA 4QD2A 4E4SA 5I8YA 3DV8A 4NUBA 5ANQA 4N53B 3WDTA 1H0BA 4RYDA 3PUIA 4YZ5A 2W1SA 5F3CA 1FMD2 2XQXA 4Q4X3 5FZKA 1NLQA 5C7GA 5FPZA 4YFZA 1PIV2 2SBAA 5BNPA 2JDHA 4YM2A 3DPRA 4YRDA 3RDIA 5C8CC 5CYYA 3JQXA 2F4PA 1QF3A 4IV3A 1POV1 2QQJA 5FY4A 1VBD1 5FLJA 4FOWA 5D8AA 4MHUA 2VVDA 4H7MA 2FQPA 1UQXA 5A3UA 3SCHA 3AKRA 3IT8A 1YIPA 3FUQA 1VBA2 2YPDA 4QM8A 1EPZA 2A6ZA 3WSOA 3MZHA 2WAAA 3AX4A 5F5QA 1N1VA 1OVSA 2W92A 2GMEA 3B02A 4OYUA 5LBBA 5FY0A 3ACHA 3MPPG 3WQ0A 4ZZ8A 4CDWA 3FMGA 4P9JA 1LTEA 1YFWA 2VOXA 1OPMA 2WO7A 1CR7A 2J1SA 4A3XA 4AFBA 5FZGA 2NQYA 2WJSA 4IE4A 3RI8A 1LEMA 2DV9A 4IEPA 4PLMA 4COZA 2I45A 3LAGA 3LEKA 2R043 1A6CA 3H3UA 5JIAA 3O1MA 3FJSA 5I8SA 2PLV3 3DYOA 3PL0A 2B9UA 1AR63 3K3OA 2W46A 1SHWB 3TN92 4YG6A 2DVGA 4Z1VA 4QPIA 3VZOA 1V9U3 5BNPC 5FMOL 1UYYA 3DPRC 5K0UA 1UU5A 1COV1 3UNPA 5C5TA 1W6NA 2VZSA 4IV3C 5L9VA 5DUWA 5CB7A 2VUCA 5D8AC 3POJA 2WSVA 2WNUA 1SZBA 5FQ0B 4A6SA 3AVRA 3T30A 1U5ZA 2XKOA 4QQPA 3SH3A 1RUG2 3VDAA 4AGGA 2I07B 2J42A 4A45A 4AL9A 5FPAA 3I7DA 5F39A 5FUPA 5F32A 1E57A 2TEPA 4COWA 1AJOA 1B35B 2JG9B 3PTYA 2YXSA 4ZU5A 2PHRA 5A33A 3DXUA 1N1TA 4MO3M 4MADA 2WS93 4CDWC 3FE5A 2ZGKA 5J7MA 5JR2A 3O12A 2GC3A 2X29A 4AI2A 2X53S 3ZMNA 4EYUA 5DABA 5IVVA 2YDEA 1D4VB 2C0ZA 5FZ7A 1CZTA 1TNFA 3E5UA 4FOVA 2LROA 4XFBA 4MX3A 2Y8KA 3WNMA 5FLIA 4EJRA 1C8M2 5LBEA 2RV9A 2BGCA 4FPOB 3KHBA 1J58A 5DAWA 4GJZA 4Q8LA 3IB3A 4QHZA 4QPIC 5LK5A 3TEXA 3DEMA 5E89A 5JCTA 4UBGA 1DCSA 2ZMKA 1XSRA 3EYPA 5K0UC 3THPA 1JHJA 4Q4W3 1TME1 1UWWA 2Y0OA 4HT1T 4LBMA 4AI1A 5I0UA 2KM2A 2IXKA 1WLTA 1OMIA 3AYCA 1J84A 1QXRA 4MGZE 2CNAA 3ZM8A 1ZYBA 3B01A 4FPLA 1W06A 5CA6A 4FOQA 4BE3A 1SDWA 1V6LA 2VZQA 2WQ4A 3K4DA 5A3LA 5FV3A 1W90A 3ITQA 1FV3A 1YRZA 4FCAA 3J8F2 5FZCA 4FXKB 1QJY3 4ZS2A 3CNAA 1RUE2 3GM8A 3VKNA 3BYWA 4HG6B 5C3QA 2G9ZA 3AMPA 3IZOA 1UX6A 3UYJA 3LA2A 3GALA 1H8VA 4BM8A 1GQHA 4IL7A 4QHOA 1V6NA 3E1F1 1DFQA 1REDA 1AR83 1IS4A 3KGZA 4YNIA 2PN5A 4LOTA 3VL8A 2BFUS 4LUMA 2XUEA 2V4AA 5C3SA 3UKTA 1VB2A 2OX0A 2EXJA 2DUPA 1BZWA 1WLWA 1RUD2 2VXRA 3MHZA 2XOMA 4MH0E 4UFJA 3WP4A 4I30A 3N9MA 1PGL1 1FMD3 2DU1A 3I59B 4CRQA 2X5IA 4GALA 4GWJA 5F3GA 3HNYM 2BV4A 1S55A 2WLPA 4YVWB 3LFIA 1K42A 4HL0A 3KSCA 1BMV2 5FP9A 3LPFA 5C9AB 3C7FA 2HWE1 4NPMA 4XILA 2JE8A 1TMF2 4AFCA 2XVGA 4KGQA 2JDPA 4BDVB 4C0BA 1OOPB 3B7MA 3VBFC 4IERA 2UWCA 1QDOA 1QU0A 3LF7A 5HCHA 1UZZA 2Z2SB 3ILFA 1D0GA 2VULA 1AR71 1F8VA 1L7RA 3BOWA 3ACGA 1S0EA 4H7LA 3B3QE 1LB2A 1JYTA 1H2MA 1LCLA 2D6PA 3QACA 1XNDA 2EIDA 4LOSA 4OUEA 1AYN1 4XHBA 5BXXA 4AHWA 3WZ1A 3ZMOA 1DYOA 3AXEA 2H6BA 2IXCA 3W58A 5LA9A 1VIWB 2TNFA 3DKWA 4KI5M 5FY1A 5H9PA 2OKXA 4N43A 3LDBA 2OT7A 2ZOEB 3TEYA 3VKOA 4CUGA 4M3CB 4KWUA 4XBLA 4Y4RA 3FBYA 5LK7B 2ZEZA 5FY7A 2H6CA 5JSRA 1RUH1 5EP9A 3Q8EA 5FP7A 1PMJX 1OD5A 2X5IC 3AJZA 2ZGMA 3UT0A 3M2MA 4ONUA 4XQ4A 4TN7A 1PZ9A 2L9LA 3SCFA 1VBC1 3WG3A 4A2UA 1AR91 3UKNA 1AHSA 1IKQA 3IPVB 4AHXA 2ILMA 1RUG3 2JG8B 4ORFA 4LBLA 2WAOA 5A7QA 4BQXA 5EYYA 4OHZA 5T5OA 2OZJA 1UL9A 4I3GA 3V56A 3VDDB 2PTMA 3LFMA 2JKXA 4CP9B 2R0HA 1NA1B 2C26A 2PHUA 3INAA 4MUVA 3RRDA 1BKZA 5IK8A 1WBFA 2ZZQA 1W03A 1SLTA 3K51A 1YUDA 2RMU1 1BEV2 3W20A 4N43C 4CCNA 1RUF2 2IXHA 3RZMA 1I3HA 2Q1ZB 5BNNB 1W6PB 2DF7A 3WDXA 5T50A 1C8M3 1QJEA 4Y20A 2VZTA 3POEA 5LA0A 2GH8A 3ELNA 2ZZJA 1PK6A 4OI1A 1RUJ1 4CUBA 5FMBA 1JH5A 1MS0A 4MXWB 1XNTA 3LSDA 1BK1A 2O0OA 4B7EA 1BBT3 4ES8A 4TTGA 2VVFA 4AQ6A 1V6JA 1MVQA 3DYPA 3AZWA 2WBKA 5FZHA 3RZZA 4CEWA 3S7IA 4WM8C 1ZBE3 1EAH1 1KDKA 3Q8BA 4DIQA 3ACIA 3J7NA 3TRSB 2DUQA 3C2UA 2PHXA 1YQ6A 2BNMA 2QBXA 3MDPA 2VQTA 4YW1A 3EHKA 3WP5A 5T55A 1R091 2VY0A 3KV9A 3J8F3 4YVSB 5EFUA 4V2WA 5DAXA 3JXSA 3WP6A 2KXLA 2OW4A 3ZN4A 1WLDA 4GZ9A 3NJVA 2D7FA 2ORXA 3N7JA 5JMCA 2HWC2 1OLQA 3CMGA 4A6OA 1K3IA 4LNVA 1HRI1 3DL3A 3POYA 3RZGA 1F35A 3VB9A 1LAJA 4NHYA 1HXS2 1DGRA 4AR2A 5C3RA 1SG3A 2P1BA 3H7JA 4Q27A 1CAXB 3EQEA 4IUGA 2E51A 2XLFA 2WO1A 2Z69A 3MLJA 1GUIA 5A32B 3DCQA 5HXVA 3URFA 1AYM1 1PK6C 3H9AA 5JZGB 1RUD3 3VBHB 5CIRA 1HQLA 1PO22 1RB8G 2YGLA 4LKDA 2FDGA 4LBQA 3WG2A 4H55A 3ACLA 5FZ3A 1UY0A 2BTVC 4JKKA 5K9YA 1MR5A 1X50A 2ZHKA 4CEWC 2A3XA 2V72A 2XL7A 3B9IA 3VHNA 1V6MA 2WNUB 2Y33A 3L2HA 4IGPA 1F31A 4JGZB 2VG9A 4DUVA 2TUNA 4XEZA 4DS0A 1LHWA 2XJTA 3LPGA 1ULEA 2VM9A 1TMF3 4GULA 3DYMA 1W6MB 2OZ6A 3WT3A 4FO9A 3LOIA 3VD5A 5FKBA 1XE0A 4PBOA 3H3LA 2WZR2 1AX2A 3I54A 3ZO0B 2D6OX 1DDLA 5T3NA 4UOJA 4HMZA 2CY6A 2D40A 3HQXA 4EN0A 3RSJA 3GZAA 5C5UA 3D82A 3PIJA 2I2SA 3V0BA 4Y33A 1DQ5A 3THDA 4AI8A 4D6QA 5EIYB 4IE6A 4DRRA 3SQOA 2GAUA 3THTA 1KS4A 1N47A 5IYYA 4BCUA 2QQPA 1W8TA 3U10A 4Q0UA 3UL2A 3ZXKA 5C3PA 4AE2A 1JN2P 3GCXA 2V73A 3D8CA 3ZOIA 3IAQA 4GA9A 4CEYB 2XXZA 1PGSA 4XFGA 3WNLA 3O1VA 2H0VA 1SQ4A 2X09A 2Z42A 3FZ3A 3ZSLA 3SH4A 3E5XA 1RVF1 1XSQA 4WM7A 5F7UA 1K5MA 3MW2A 2BUKA 4YGEA 3UJOA 1O59A 5FBJA 1CJPA 4YZ1A 5ERLA 3S6PA 1NX9A 2OA2A 3MIFA 4QB2A 5L19A 1JOPA 1QH7A 3GJBA 3PIGA 1DZTA 2YMZA 4UW3A 4QDSA 1NE6A 1H9WA 4NVPA 1YJKA 1RUC1 4QGLA 3K2OA 5A6QA 4V1PA 2GNMA 4Z92B 4NOTA 4L99A 1ASJ2 1F15A 1LOEA 2WC2A 3HNMA 2R063 5EYXA 3AB0A 1M4WA 3L9JT 4FFFA 1LGBA 2YFZA 2JDUA 2WFF1 4OCTA 4DPNA 2R6QA 4XJZA 1TZOA 3I2KA 3WR0A 5LRSA 1YCIA 3WEZA 3BPSA 3ZYJB 3NNMA 5FKCA 2A71A 2BWAA 1E5HA 3OGSA 4N9HA 4Y3OA 4CYDA 4UI9L 4GH4B 3RVHA 4R9DA 1BEV3 1UOFA 2J1UA 4NWWA 2RM22 1I1EA 1UY2A 3A0NA 1RUF3 3LD8A 3DN7A 1QOOA 2OXBA 1E5IA 3G7DA 1WMXA 3OOXA 1OXCA 3PMSA 4CCCA 1GWLA 2J22A 2W91A 1GFF2 4PJYA 4WM7C 1BHGA 2R32A 4AF9A 3IDEA 4Q4Y1 5IVJA 1NCRB 1EV11 5J3UA 4YM3A 1JZ6A 3W5MA 1XYNA 3KB5A 4N53A 3WF2A 4FVVA 2YC0A 1TVGA 1JUHA 2P17A 2QFEA 3HT1A 3ZXFA 4XF3A 5K7PA 3S57A 3F2ZA 5EHDA 3T2TA 3ZXLA 3OUJA 1N3OA 2YGMA 5GLVA 4NHXA 2ZGRA 2ARAA 1RUI2 2A73B 1H1MA 1U5XA 4Q29A 5FWEA 2EALA 2JENA 3FHIB 3PU3A 4JZRA 1X7NA 1PVC2 5ISLA 1US3A 2B46X 4QGMA 1RMU3 1TG7A 3I3BA 4K7JA 5DUVA 1GNHA 3VKLA 2D98A 4Y5TA 4LLFA 2VNGA 3PVOA 4M3CE 4B29A 4C91A 1YQ5A 1YLLA 1VAKA 4IE7A 1G9BA 3RZKA 4OI2A 3T0BA 3VBUB 5CFCB 4PI2A 1OKQA 2HWC3 4LMFA 5FRAA 1LOFA 2ES3A 3I2IA 1PMHX 1HXS3 1FYUA 1SLLA 2NMNA 3AMNA 5FY8A 1B09A 1UOJA 1DU3D 5JPNB 4WVVA 4BA6A 4HBNA 2UYBA 3ZSEA 4OLLA 5I93A 1JYXA 2NP0A 2A70A 3T0DA 1CZSA 1SBEA 1BXHA 4XMAA 4N53C 1OUSA 4ARYA 5B4NA 3U07A 1JZ2A 2ZX3A 1PO23 2DFBA 3CEWA 1W2AX 3I4IA 1BCXA 1NQDA 5DDJ1 1C28A 3UESA 5C4WC 1CZVA 4BQ3A 1QEXA 5JLVA 5JSPA 4XOGA 5FZ6A 4AG4A 4NIHA 2HH9A 2WNOA 4E2GA 1C1FA 3ZYRA 1ZZ9A 4O65A 1HB3A 4JC1A 4Q4X1 5TSWA 3O1UA 4NE9A 1MPXA 3JCIA 4GKXA 2E32A 3U14A 5FQ0A 4LBJA 4NIAA 3ZFEB 3WNXA 2P5BA 2QQMA 2WZR3 4LKSA 4UFMA 2AREA 1CQ9A 3ETQA 4HONA 2K9ZA 3WDUA 5BYNA 2JG9A 1B35A 4QHBA 4QX5A 4D0QA 2QDRA 3ZYBA 4E4HA 5CG9A 2VMGA 1LOFC 2AR6A 3B00A 2C9AA 4CU6A 4CUCA 3FX3A 4QDRA 4TLGA 1AUYA 1D4M3 2ET7A 3POGA 5KXCA 4CCJA 1HB4A 2F4LA 3U11A 4P9IA 5LBCA 1LENA 3ROUA 1PMIA 1IPJA 4EWDA 4P9WA 5ACA2 2JXAA 2PFWA 2HWB2 2R041 3R05A 4GIQA 1E5SA 4RN5A 4XURA 3T2PA 3ZXGA 2PLV1 4AQTA 3AKPA 3DKQA 1QJU2 5EXOA 5A3OA 1AR61 1POV0 4AVTA 2WWUA 4L97A 3LKJA 4NMIA 3KM5A 4KBBA 4NHMA 4BXFA 4QX8A 5G05L 4P9XA 3LA3A 4XXPA 5FREA 1V9U1 4QB6A 4G3YC 5C6CA 5AVAA 4Z8BA 1C3HA 1ASJ3 3D5OA 3HBKA 4HETA 5D2AA 3T2QA 4UFHA 4BQ4A 3AP9A 4Q5OA 2Y6JA 2HBUA 4FFIA 5FO9B 4XAAA 2ET1A 4LE4A 2JG9C 1B35C 4MG2A 4LE3A 5GJ6A 4CDUB 4JRLA 4NJ4A 2QE3A 4R8HA 1QJX3 4XBQA 3S30A 3N36A 4QX3A 3ZFGC 1ULPA 1UOGA 1Z0HA 5FYHA 1QH6A 3HPNA 3VBSA 2B9VA 1JS9A 2WS91 4OHXA 5DQ0A 1KFUL 3QBQA 4X6RB 4AVSA 3LEIA 2QQLA 4KU7A 1WW4A 3OF1A 3VBRB 4O9GA 2XPJA 4JV4A 3TNPB 5C70A 1UIJA 1PGW1 4NPRA 3O1PA 2NYYA 1RYYA 4CDXB 5FYMA 3ZIXA 1BLZA 5I0DA 2Q4SA 4FSJA 2FZ1A 1W8UA 4KG8A 2D43A 4FPJA 3ETPA 2W94A 1U5IA 3NAPC 4CCKA 5FZFA 3I59A 1H2LA 2GN7A 1HLCA 2E53A 1LOBA 5CNAA 4YVWA 5T5JA 5ABJB 4Q4W1 2XG3A 2DCTA 4AVAA 5L73A 5C9AA 1X33A 4I09A 3ZSJA 1PVC3 1O3QA 4RL7A 1OOPA 4P5YA 4WVWA 3O0VA 3BUCA 4QU1A 2DBIA 2CHHA 1MQTB 1W99A 2BZDA 4AFAA 2B5HA 5E16A 4INDA 1RIRA 4EWEA 3V0BB 2VZ1A 1XYOA 5FMOS 2YC4A 1QJY1 1S0CA 3AP5A 2XVKA 3DUIA 5A3MA 3V0AA 4YW3A 4JAAA 3IKWA 2ARXA 5A70A 4OZOA 3LWCA 1CD3G 5A3TA 5FTTC 2RJ2A 4AYUA 1MZFA 4XUNA 4DFSA 2BVBA 1K5MB 3WUCA 4W65A 3ASIA 4M3CA 1J3RA 1S2KA 1SCRA 2QQIA 4XYXA 4YWAA 1CGPA 1W9WA 1KITA 4B4PA 5IK4A 5LEKA 1RUOA 2IUWA 5FCCA 1R64A 4FP3A 2W3JA 3BU0A 1NQJA 4YVWC 2FZ2A 1IPKA 3UK9A 3GHNA 2RJKA 3WQ7A 5IK5A 4W4ZA 1ULOA 1FMD1 1ULGA 5C9AC 2VE1A 2HWD2 4A3ZA 1OQEA 2PXJA 1I6XA 2PAKA 2FDFA 3CF6E 4XF1A 1GYKA 1XNAA 3O14A 4XFAA 1DIWA 1OOPC 3IPVA 2VCCA 2VMHA 4PCRA 4QMAA 4RS5B 3GGLA 3AVSA 2Q1FA 4H14A 2E31A 2BVVA 2NZ9A 2JG8A 2VUJA 3NWKA 4QQLA 4B1LA 3NV2A 3LEGA 4AVBA 5HV4A 2NPIA 5FPXA 1JZ4A 4MYEA 3S0MA 1ZZ8A 3KS7A 1QJZA 2PQQA 2XJUA 3VDDA 1WA6X 4CTEA 4XFCA 3WUDA 3LQCA 4BISA 4CP9A 1HB2A 1NA1A 2E33A 1SMVA 4FPEA 2UU8A 4AOCA 4K8RB 4YM0A 2B4KA 1RC6A 3I97A 1GP5A 3OPWA 5LZ6A 2BGOA 2UY9A 2O8OA 2ORZA 5LCWL 3L2YA 4W6XA 3M3CA 1VBB2 3P3PA 4R9AA 3ZX7A 2P3IA 3H1MA 4DUXA 5LRRA 3PLQA 5BNNA 1W6PA 4AGRA 4AEKA 3ZYHA 3AL6A 5A3PA 5ACA3 2HWB3 4CVUA 3ZDSA 2PMWB 1GLHA 2HYKA 4FPGA 2ZGOA 2EICA 4SLIA 3VDBA 1QJU3 4LA2A 4MXWA 1A8DA 1CAUB 3HMYA 4EN6B 4BMBA 2EXHA 5E1RA 5FO7B 4S2DA 1S1AA 2JDMA 3O0XA 2XBO1 3W9AA 5IFPA 1WMEA 2YPJA 4YW7A 5LW9A 2CU5A 4XUPA 2P4EA 5JMOA 3MYXA 5FZOB 4B7KA 1BVVA 2JG8C 2LALA 4CZSA 1PX3A 2E9QA 3HT2A 2DCYA 4KMQA 1Q56A 4UW5A 3VDDC 5I8TA 4YVSA 4QKNA 2VUAA 2EXKA 5JSOA 3IMNA 1RUG1 1NA1C 2ZMLA 5IATA 2KD7A 3BI3A 4LITA 2ERFA 4N9IA 4BIOA 1LNSA 1CWPA 4JTOA 3FLPA 4HN1A 1Y9MA 1ZRRA 4NHLA 1GNYA 4KGGA 1MEC2 3PUHA 4D69A 4BK4A 1PHMA 1R1A2 2D6NA 2G9FA 1DZQA 2EVXA 1CAXA 3AYAA 5BNNC 1WCSA 3MIBA 3UV9A 1VRH2 4KWLA 5DZEA 5EQUA 3PMEA 1IS3A 2KR2A 3RYPA 5A32A 1XYPA 5BUVA 1N1SA 1YQ2A 1IG3A 3VUOA 3PTRB 1NLRA 1VBE2 4O61A 5JZGA 3TB0A 2GC1A 3WX5A 3EB7A 5KR7A 3VBHA 4XF4A 2DTWA 1C8M1 3AL5A 4DEVA 3ZSMA 5FY9A 2QUOA 5A80A 4AAXA 2WT2A 2VW0A 2JWPA 2ZKNA 4ZZ5A 3SITA 3JU9A 2XKPA 4DMIA 1DG6A 5IVBA 4XUOA 4GMP3 1BBT1 4JGZA 1S2EA 3POBA 2EXIA 1JTZX 1YHFA 4XQWA 1ZBE1 1W6MA 4YVSC 4W6YA 4CU8A 4YZ3A 4YW4A 1UYXA 4D3WA 4FTSA 5CFDB 1ZREA 5JIUA 5H9QA 5C71A 2ATFA 2P2KA 1VBD2 3BN6A 3GDBA 3KCCA 5CADA 4L11A 5FLHA 3J8F1 4COYA 1KRIA 3N9NA 4HN0A 4DXTA 2W2IA 4ZS3A 1MS4A 4ATEA 1PNFA 4KU8A 3I3DA 3N4MA 3SKVA 2BBAA 2JB8A 4RHV3 3RJ2X 4GAZA 1CONA 4CEYA 3RGBA 4GWNA 3ZPYA 5JZGC 1N1YA 4GB33 4Q0VA 2ARCA 1NE4A 3VBHC 3GNEA 1ENQA 2Z79A 5KXBA 1KXGA 3C7HA 5AFEA 2QQWA 4DZGA 2MEV3 2ENRA 4OHVA 4PQQA 1CPMA 1AX0A 3N9PA 4IEVA 3HNBM 3Q8FA 2WNUC 3POFA 3M1HA 4JGZC 4RD7A 4HOOA 5A1FA 3P5BA 1OA2A 2HWD3 4AI0A 4NROA 1GZCA 1QY4A 4PT6A 5IFTA 3ZXDA 5F8PA 1F4AA 5FP3A 5ANNA 1BMV1 2IVIB 1COV2 5CZKA 4E8DA 2GU9A 2GC2A 5I91A 1GNZA 1WA4A 2WABA 1TMF1 1OA4A 3LCPA 3CQOA 4FBFA 1BQPA 2XJVA 1O4YA 3VBSB 4K1YA 3WF3A 1W9TA 3HQUA 3JB4C 1H6YA 3NL1A 3HEIA 2LS6A 4GH4A 1SDDB 4P14A 3M70A 4PQ9A 5I0SA 4U36A 4CEYC 4FPFA 1VBB3 2RS13 2C1FA 2HKXA 2DVBA 4LO4B 4Q4V3 1Q3EA 1XNKA 2VMCA 1BVP1 5FAXA 2W5FA 5AVPA 2LRPA 1UNBA 2BW8A 5EV7A 3SC7X 2W52A 4RGAA 1C5HA 3RZLA 1NCRA 3ZDVA 3VZKA 3ZN6B 4QKFA 4AEJA 3RWKX 5DUUA 3H0OA 1PIV3 1XRUA 3H1YA 5F6KA 3RMXA 1KDMA 4TLFA 1H1AA 1OQDA 3U4SA 1H30A 2UY8A 5A6XA 1HN1A 1D2QA 1CPNA 2ZEWA 3AKSA 4BH9A 3IWZA 1JYVA 1LOGA 1FI2A 2QQNA 2VC9A 1TME2 2EAAA 1VBA3 2TBVA 5A3NA 5KC5A 4LK7A 2R1DA 3RQ0A 5IVCA 4LPLA 3SHRA 4EV0A 5HBAA 2DURA 2R061 2P3JA 3RNSA 1UMIA 1EPWA 2E63A 3EJKA 3GZUC 5KWRA 4LR4A 3VBUA 5CFCA 3NV4A 4GH4C 1MEC3 1JZ8A 2ZABA 4AW7A 4UFLA 5HV0A 3FFQA 3T09A 4QKDA 1VRH3 2G9GA 2BGPA 4MGKE 1BEV1 4QQHA 4FFGA 3TN93 1NCRC 1AXZA 5JXJA 4UYBA 1RUF1 3HAGA 1VBE3 2EIEA 3R4UA 3K3NA 2WNVB 4CU7A 5LA1A 4J1WA 2VOWA 2P3KA 4XCBA 5JXIA 4BB3A 4AZZA 1UAIA 4LXLA 2CSGA 1XOYA 3C7OA 1GSLA 1XQNA 2FMYA 1FX5A 1JHNA 2D5HA 4DOUA 4CP1A 2VBDA 1OD3A 3ATGA 3JBG2 1OA3A 1AX1A 1Q5OA 3MUY1 5I0TA 4CSWA 1G9FA 2UYAA 1JU4A 2ZS6B 2RDSA 3JD72 1LOCA 1LGCA 4FXGB 5H9SA 4PIZA 2OUJA 4M4PA 1WD3A 5FP8A 2PA7A 3ZFEA 2AYHA 2FCUA 2YU1A 3GBGA 1KGYA 3LE0A 2VQ0A 3T2OA 2HWE2 2WYFA 1VBD3 1RMU1 4XTPA 2ADDA 3OBRA 5CFCC 4B3NA 3RS6A 4CCOA 3AMHA 1IQAA 5EJZB 3AZZA 2Q30A 3WNPA 1D0HA 4UXAA 3N9OA 3Q8CA 1JBCA 4XACA 1REFA 5FYCA 3UJQA 3H8RA 1IHMA 3AZYA 5KXDA 1VMJA 2HWC1 2HEWF 2EA7A 1F5JA 1I9RA 2VGDA 1HXS1 4XF0A 3ZN5A 3T08A 3BB6A 5B2GB 1ZRCA 1W2OA 3O5SA 1QNWA 4BK5A 2ID4A 2ZX2A 2YBSA 2XHKA 1EUTA 1MS8A 2C6SA 3HWJA 1SBFA 4HSLA 2K2SA 3NVCA 4Y1UA 4F83A 4QXCA 2MHFA 1UZ0A 1PO21 1UX7A 3BU7A 1HB1A 4FT8A 3I49A 1LODA 1RUH2 2A1XA 1RINA 2IC1A 2VECA 4WBBA 3T0AA 1W0NA 5EJ1B 1JUIA 1PO11 4H2AA 4HXCA 5FO8B 1GQPA 4K9SA 2CV6A 2JD9A 1LR5A 3IM0A 4JGYA 3ZFEC 4NRMA 2IWGB 1COV3 5FZMA 1CN1A 1NZIA 2VNOA 1VBC2 4KWKA 1AR92 1RUE3 3PUSA 2XB6C 4BU2A 4X8NA 2XL9A 1LECA 3KLSA 1XBFA 2CYFA 5HCFA 2OUHA 4CDUA 4D7SA 4L2NA 3WDYA 5DZGA 4DXZA 2Y6FA 4AFDA 1HQWA 3PJQA 1W6QB 4P08A 1ZRFA 3BALA 1JODA 1KD7A 3MBWA 5FYVA 2GMPA 2C9KA 4QT6A 2ZX0A 1HW5A 1N3PA 4YW6A 5A7NA 1MVEA 4Y24A 3VBRA 4BJ0A 1V6IA 1W2NA 1IS6A 4IETA 1D4M1 3ZPOA 3OYWB 1YJLA 4CDXA 5K8SA 1GANA 2RMU2 3HD8B 3HN1A 4FAHA 4B4RA 1ZRIA 2JECA 2ZEYA 5LASA 2YB7A 1ZA7A 2GSYA 2AC1A 3WOGA 3HVDA 1VAVA 1O5LA 3HJRA 2XJPA 1IKPA 1GKBA 3D6EA 4NPLA 5ABJA 5FYYA 1MACA 1X8EA 4LJHA 2FCVA 5FP4A 1W8FA 2JE7A 3C8XA 1DGWA 3VZLA 4QX0A 2G1MA 4LHNA 3OPZA 4PDWB 2BJSA 4AVCA 3E6BA 1SLAA 1C57A 2Y64A 1EAH2 1GZWA 5FJHA 1JOJA 5J37A 1FV2A 4CDUC 2VUDA 4PI0A 1MQTA 1OPOA 1WMDA 1O6UA 3WP3A 4HVOA 1GP6A 3E97A 2PHWA 2AGSA 1AXKA 1V00A 3QH6A 3ZYFA 3RYRA 2PHTA 1C1LA 1W8HA 2YC2A 1HV1A 3I3EA 2XVLA 1QJX1 2MPFA 4BMEA 2YY1A 4G9SB 5I0RA 2VW1A 1AVBA 3OGRA 4XC9A 3VBRC 2DDUA 2R7EB 5JXGA 2PAMA 1U12A 4AWDA 5GLTA 5FYTA 1ZA4A 3C7EA 4CDXC 1UCXA 3ZYGA 4W50A 4UW4A 4MGIE 3TEZA 1J3PA 2WA3A 1CIYA 1DQ4A 2RR11 2WL1A 4FPHA 2CWMA 3WCRA 3I2GA 2E26A 4MGQA 1MS9A 1O4TA 1R1ZA 5DXDA 4C8DA 2RHPA 2VAUA 1ST8A 1AYM2 3AMMA 3QLQA 3ZR5A 3JBG3 5ABJC 1C4RA 2Y6GA 1EYBA 3NV1A 5J09A 4GMP0 2GC0A 4P9LA 4PF1A 4HVQA 1RJ8A 2DYCA 5JWPA 1L7LA 2WKKA 2CGOA 2V5DA 4XE9A 2XMLA 4HZFA 3JD73 4R9CA 4RR3A 3M3QA 2VH9A 2NM1A 4LQRA 3IDBB 4K21A 1C5IA 1J1LA 2EF6A 4RS5A 1UXXX 2W0XA 1LHVA 1JYCA 1MQTC 1Q8SA 4OMCA 3AZXA 3HOBA 3HR9A 1PVC1 4GQ7A 3SLIA 4RQPB 3HN3A 4Q0PA 3V65A 4HLTA 1IGOA 1GZTA 1UZVA 1RHI1 2Y6LA 1ZZ6A 2YFUA 5L7OB 3ECQA 3MO4A 4XW3A 3NJYA 3USSA 2WYSA 2ZGPA 3EXUA 5FZ1A 4M3CF 3SISA 1FOD1 1DYPA 1FATA 1K5MC 4PIYA 1SEFA 1IOAA 1W8ZA 1ACCA 1OLRA 1WCDJ 3KT1A 1V0AA 3M3EA 3RWNA 3N7KA 2P6CA 3W21A 1LHNA 4BHPA 2G4IA 4GXLA 2WFPA 2GP5A 5LY2A 3UKVA 2YZ4A 1NKGA 3OGVA 1LGNA 1DQ0A 1D2SA 3VN4A 2FDJA 3KQRA 4BXSV 3NNJA 2Q8DA 1W8NA 1VMFA 3MGUA 1CAUA 3GZEA 3JZVA 5HPOA 2BEOA 1ODNA 1RVF2 5IK7A 3U75A 3WNKA 1FXZA 3TBDA 1RUH3 1UKGA 3SEPA 2Q8CA 1ND2B 3PVNA 4CA9A 1ND3B 1UU6A 3A21A 1OQ1A 4RS5C 5FZOA 5FUNA 2WDBA 4DEQA 5JOZA 4IQPA 1MS3A 3KV4A 4P02B 3WW1A 3BTYA 1DGRN 1HV0A 2B39A 4FPKA 4XETA 3IIIA 4OFGA 4MOAA 3WW4A 3K75B 4BLIA 5A1LA 3QCWA 2RS52 4Y5SA 3T1MA 5FZIA 2HEYF 4DO0A 1XPWA 5DMYA 1G7YA 1PZ7A 4NWVA 3CL1A 4XQDA 5JOYA 2VPVA 5LY1A 1S0BA 2WFF2 3CJXA 4XMIA 5J96B 3BTXA 2YV8A 1F2NA 2R16A 1NY71 2DCJA 4OUMA 4KH9A 3CHXA 3ZR6A 4QAWA 3LB9A 2Q8OA 1TQ5A 1XB9A 1K5JA 1R081 3OBTA 3N9LA 5FR3A 4Y1YA 5A7WB 1U5YA 3MFCA 5EZWA 3WD5A 2CAVA 1Z78A 4WVZA 1X8MA 4DINB 5ACA1 2WZ8A 2HWB1 2VZUA 1T2XA 3U78A 2XHNA 1SLCA 4Q4Y2 5CKMA 5LEJA 1I5PA 2GZWA 1AL22 1QQP2 3OEAA 1LKNA 4JKMA 3LIHA 3P1IA 4MHRA 2QQUA 1OH4A 1JI6A 3A23A 2V4VA 2VCBA 3S5QA 5EJ3A 2O1QA 4UFKA 3OPTA 1UY4A 3N35A 4ISRA 1K12A 5F2WA 4HK9A 4CCDA 2D3PA 3ZSKA 1QXPA 1NG0A 4AVVA 4JX0A 4E27A 2AEZA 3NW4A 5HXMA 5CFDA 1JYWA 3FLTA 3GXUA 4IE5A 2BDRA 5F3IA 4WM8B 5BNOB 3ZFFB 3GYDA 3NNGA 3HQRA 1LEDA 1VLNA 2JDYA 2X10A 2J1VA 3AYDA 4RFT0 3KD4A 1J3QA 3WXPA 2VNVA 5J48A 3AYEA 5KBFA 4QXKA 1OFNA 2WT0A 3R6SA 4DNYA 4TZDA 2ZACA 3N7LA 1LULA 4FPYA 3H8OA 4MGTA 4K6BA 3I8TA 1LJ7A 2QQKA 3TOJA 2D97A 4PIXA 4ZY9A 3GZTB 1Q8QA 3AKQA 4JDNA 4I3PA 1GWKA 2Y26A 1MS1A 4XFFA 4CXYA 1V6OA 2WT1A 2CDOA 1O7FA 2WWJA 4LBOA 2PAEA 5IAVA 2A3YA 4LULA 4XIKA 3VD9A 2FMDA 1AXYA 3V64A 5IVFA 1H2NA 1H8TB 5DAPA 3WW2A 2VW2A 3WVJA 1W8WA 2DBNA 4JGYB 5DAVA 2QZ3A 1XXNA 3JUUA 3OJBA 3HIFA 4BQYA 2XJQA 4GMP1 4P9GA 4XPVA 1NCQB 3TYJA 2YG0A 2BOIA 5CFDC 3PNAA 2UWBA 4E9KA 1UZYA 4Q4X2 4M0HA 4KWJA 3LEMA 4TYSA 1OF3A 4WV8A 3PVEA 4N8MA 3MUZ1 3KMHA 3FL7A 2BRTA 1NOVA 2GH2A 1RJ7A 3IIAA 4ZONA 1VB4A 2PYTA 2FBEA 3VBOB 3GBWA 3TNQA 3LOBA 5LATA 1VALA 1UU4A 5GZCA 2RM23 4NRQA 5FZ8A 1ZBA2 2IXLA 3AFKA 4ZU4A 1GQGA 4H3WA 4ET7A 3J9SA 2ZEXA 4DRVA 4CCLA 3BOPA 4ZU7A 1WW7A 3BTAA 4MSVA 3KF5A 4RHV1 4NIIA 2P6HA 2Y6HA 2RS32 4QPYA 4QPWA 4BYYA 4EZHA 2JDAA 4GB31 3NNLA 4XBNA 1NT0A 3ZN6A 4W8JA 1IS5A 1XE7A 1PNGA 2RDNA 3B9CA 4Q8KA 3P3NA 2OPKA 1S4CA 1RVF3 3OGGA 4ES9A 3JB8A 3JQWA 4WZCA 2VMIA 1RUI3 2MEV1 1QWRA 4TSVA 2PLV2 3CJIB 3R4DB 3NJXA 1XJAA 2Y34A 3WDVA 3P6BA 4LIVA 1WZXA 2PHDA 3WF4A 4EE2A 1JW6A 1GZWB 1XU1A 1SFNA 2VTFA 3AZVA 1HKDA 4CU9A 1HJGA 1NAEA 2HWD1 1CX4A 1O8PA 2CDPA 4XIOA 4XAEA 4CDQB 4AXOA 4CXXA 4IEWA 1V9U2 4Q26A 5A6YA 5F5IA 1DQ1A 3E5QA 3ES1A 2W1WA 2ZBJA 2RS53 2ZAAA 3H7YA 4YGDA 3VBSC 4AK3A 1T6GC 3CKHA 4AHYA 5LWBA 3FBMA 4NAMA 4XUTA 2VZOA 2WFF3 4NN0A 5JDBA 3OEBA 4KG0A 1QOSA 4CXWA 2GMMA 2WN2A 1FT9A 3UGGA 2FDHA 2ZX1A 1RTVA 1DLCA 1X82A 4C90A 4RGKA 4Y1XA 5LA2A 5D21A 5BV6A 1GR3A 2JD4A 1AR81 3MIDA 2R0FA 4V2VA 3UGHA 1FPN2 2K0GA 1JMUB 2IXIA 2RVAA 3E6DA 5H9RA 4JHZA 2W68A 1VBB1 2RS11 2WS92 3G6JB 4Q4V1 3USUB 5C3OA 2OS2A 2WNVA 1Y9QA 1F9KA 4QPGB 4XVHA 1OHFA 1PM4A 4O7XA 3ALQA 4OMDA 1L3JA 4QWNA 4OI0A 2NMOA 3LDRA 5AC92 2B8MA 3WG4A 2HJIA 1Z7S2 1AL23 1QQP3 4RR3B 3U37A 1YO8A 1PIV1 2JIJA 2ZJCA 1UMHA 1W6OB 5FYIA 3VD4A 4XABA 4YW5A 2VTXA 1SACA 4FQ4A 3OD0A 4IEYA 2ZAHA 1YWKA 3TEWA 4QX1A 4ZPIA 3I2JA 4MZUA 2YYOA 1VBA1 1OF4A 2R072 1BK0A 4IW3A 5FFOC 3U4XA 2GNBA 2C4XA 1GBGA 2IFWA 3DECA 3KZ4C 2XQRA 5FYZA 5GKAC 3J4UH 1LU1A 1ULCA 4IGOA 1ZNPA 1QGLA 4UBHA 1YQCA 2YBKA 1WLCA 2ZMNA 3H42B 3OUHA 2QKDA 5FUIA 1H1IA 1W3XA 1FNYA 2CL2A 4KQ7A 1SPPB 5SV5A 1YI9A 1GOHA 3EMRA 4LK6A 5FPBA 2BBVA 4FI9A 1LRHA 4FTBA 5T52A 2WNVC 4YPJA 4Y4YA 2DWRA 1YNAA 1VE0A 2IXJA 3EBRA 3WW3A 4BQWA 3TN91 2HBTA 1HDKA 4M00A 4MVTA 1VBE1 2Y0IA 3SMHA 3WQBA 2VL4A 4AHZA 1WKYA 4Q0QA 1VPHA 1DGWX 2XJRA 5JUVA 1UW8A 4CP0A 2HWF2 1DP0A 2XUMA 4YG0A 4ASKA 4URAA 1O8SA 1SFYA 3SH5A 1VR3A 3KWVA 5C4WB 4IV1B 1SLIA 4XDOA 4LA3A 5CISA 1M06G 4CCMA 1SCSA 5FZBA 4XJWA 1URXA 3CO2A 4S2FA 1Q8OA 2UWAA 4K8FA 4OHWA 2W87A 4LLOA 1W6QA 4D6SA 3CBNA 4GWMA 1ZBA3 1ENRA 1OSGA 2W08A 2ZHMA 3K4ZA 2DCKA 4IE0A 4A42A 4B8EA 3R4SA 1UXZA 1W0PA 5CU1A 2YROA 4D8MA 1ZZBA 4PLOA 3PJYA 4JQRA 4WZFA 1HRV2 3FN9A 3J7MA 4ZHNA 2RS33 3OYWA 1VRBA 4QM9A 5F5CA 4F3JA 3E6CC 2JDZA 4W6WA 5FIXA 1WW5A 2VZPA 4PHZA 5FZDA 1OLME 4IDZA 4A44A 4DY3A 5IUQA 1JU3A 1RGSA 4Z07A 5IHRA 1YFYA 2IFRA 2ZPXA 3NQHA 3B69A 1QDCA 4QKBA 5DZFA 1PX4A 5FZ0A 1V70A 3CDZB 5FZLA 3AK0A 4PDWA 1LESA 1Q8VA 4DB5A 3PU8A 2XBO2 2AENA 3ZLIA 3W5NA 2JB4A 1QOTA 5L36A 2JX9A 1VAMA 4ASLA 5CBLA 4PBPA 2VTXJ 3AXDA 1RUE1 4RGGA 5FZ4A 2GALA 2VOKA 3J7LA 3M8LA 3NRUA 4XCAA 3BTZA 4LO8A 5GZDA 3VZNA 4MXVA 2VOVA 4AI3A 1DQ2A 2ZGNA 4P00B 1RL3A 1H2KA 1UN1A 4BQ5A 3UETA 1JOBA 4AI9A 2JEMA 2RE9A 4UW6A 2XGXA 4J6GA 5JPMB 3A22A 2JDKA 3IBMA 1FPN3 4HPKB 1ZRDA 2VNRA 2DVAA 2WRAA 4AGVA 2HEVF 4CPBA 1OUXA 4IEOA 3FWEA 3ZFGB 2XWBB 1X9TA 1RUD1 4HKOA 2FCTA 4LTAA 2VO5A 5DN2A 5AC93 2A7AA 4B4QA 5G04L 1Z7S3 1G9DA 2A6YA 1SLBA 3MLLA 2OVUA 3RZJA 1F5FA 3GHMA 2V5YA 2YUEA 4NAOA 3UGFA 3POIA 1ONAA 4PDWC 1X9PA 1RXGA 4R4XA 1U0AA 3LZZA 3MI8A 5DG2A 2WO3A 4COVA 2QTWB 4QX2A 5E6HA 4Y1ZA 1BBT2 3PHMA 1AJKA 2W9XA 3OY8B 2SLIA 3NAPB 4HANA 2R073 4XTMA 5JVVA 4QGNA 1ZBE2 4RQPA 3N9QA 4X8PA 4OI4A 4WVMB 2ZCWA 4XFIA 2OQ6A 4HKLA 4Y1VA 3VLBB 1CIWA 3PVBB 4IGQA 3AP7A 4GJYA 2FD8A 2X8KA 5FJKA 5L7OA 3OD4A 4LBQD 3VBFA 3S5AA 1GOGA 5KXEA 3D3AA 1BJQA 2J1EA 3RPQA 4UWDA 1O91A 3J7HA 4TWTA 4JHTA 2Y60A 4XFHA 5C8WA 3ENRA 2E7TA 2VBPA 4RSUA 4CUAA 4JQTA 4XZUG 4YFWA 3QH7A 3B94A 1UF2C 2ZGSA 1HJFA 1W04A 2ZHNA 2PELA 2EAKA 2BERA 3NSTA 1XC6A 5APAA 4AEDB 3FHQA 1KFXL 2HWF3 5C33A 5FPUA 2QZ2A 4E2SA 1ND2A 4C1XA 4R9BA 1ND3A 3JBG1 1VMHA 4I0AA 4QDQA 3BCWA 2JICA 5CKNA 4NIDA 2BNOA 3OBZA 2VMEA 3I3QA 4ATFA 2KA3A 3MV01 3JD71 4LHSA 3O7OA 4OVEA 3N3HA 4QXBA 4XJ9A 5SV8A 3AJYA 4LIUA 4RQPC 3BKZA 4URTA 5L9RA 2JDNA 1HX6A 4XDPA 1GU3A 2XDVA 5IVYA 3I2OA 1O3TA 1NLSA 1OI6A 2AACA 2C24A 1R1A3 3K4AA 3K48A 3OUIA 4YW2A 5L7OC 3M4FA 5IVEA 4QXHA 4EN7B 1LU2A 3H1WA 5DPNA 4J1XA 2QCSB 3AKTA 1HRV3 5GZFA 1D7PM 2XONA 2OYZA 2Q1MA 3MW4A 4E8CA 5GLUA 4FPCA 4RFRB 5A7WA 2Q8EA 1LOAA 2RG4A 3SNMA 4ARXA 1CAWB 2DUOA 3V0AB 1DBNA 2DVFA 1X36A 1ND2C 3HBZA 1PGL2 1ND3C 2I74A 1GICA 1HN0A 1W8OA 3POWA 1YFXA 3FC0A 3Q8AA 2GNTA 2PHFA 4I02A 4K1ZA 4LT5A 1ODMA 3I2DA 5JI7A 3WF0A 1SFPA 4HKWA 3VGIA 1POV3 2XBO3 4LO5B 3VKMA 1MZ5A 4Y22B 3RMYA 3VBUC 4LKEA 1CAVA 1NXMA 3WCSA 3WNNA 5FMCA 1REEA 1FAYA 1OLMA 1UY1A 3GJAA 3KCYA 4YZ4A 5C8CB 1WGPA 4QU2A 4KNCA 3VZMA 3OBAA 5F2SA 1A3KA 2QNKA 4WM8A 2VU9A 2WUHA 3CU7A 3ZFFA 3RJRA 5BNOA 2P3YA 4ZXEA 4ASMB 1AR72 1J1TA 1DGLA 3IAPA 2R062 1S0JA 3C3VA 4Q1PA 2O14A 1AYN2 5FZ9A 5J98B 3VL9A 3ZXJA 4A7YA 2XLAA 5JAXA 1OURA 2P37A 4UF0B 1WUVA 2FDIA 2XH6A 5GLWA 4LEJA 4M0NA 1S2BA 5KHKA 1DZRA 5IAXA 3BGAA 3VZJA 2BQPA 4Y5Z0 4LHLA 4L9BA 2JIGA 3M3OA 2NN8A 1BYHA 3LGRA 2ZA9A 3VD3A 3LDKA 4M01A 1WW6A 3O0WA 1HIXA 4EN9B 2LTNA 5FOBB 2GP3A 2BPA2 2AUYA 1H8TA 3C7GA 5IW0A 2BOJA 4S2HA 3U0ZA 5LB6A 5FYBA 4AFMA 3RI9A 2WNEA 1ZVFA 3A7QA 3ES4A 4Z2AA 4LBNA 1XNBA 2N7GA 1ENSA 1OFSA 3VV1A 2ZKLA 1NCQA 4NHKA 4AEMA 3PUQA 1I5ZA 5BNPB 1JZ5A 2GDFA 2Z5WA 3DPRB 2WZR1 4XZPA 4O9EA 4A7ZA 4IV3B 4D7TA 1Y43B 5BNOC 2QQVA 3ZFFC 4Y26A 5A7SA 1DLLA 5D8AB 4XUQA 2HYXA 3OG2A 2BFUL 1WWYA 5FZEA 3KF3A 2WA4A 1STMA 3VBOA 5F37A 5F1RA 3NMBA 1TE1B 2VJXA 1FNZA 3MIEA 4QQ2A 1RMU2 4L92A 4X6QB 5F6LB 2VD7A 4HVRA 2GN3A 4EN8B 5FWJA 1Q8PA 3OB8A 4D6RA 4CDWB 4R4ZA 4L0PA 4DUWA 2VBBA 3K46A 3BODA 4I0WB 2XWJB 3RYKA 4JTNA 4D7YA 1H4GA 4DQAA 4NR1A 1OH3A 5BY5A 5JOXA 2GNDA 3VHOA 4I2OA 2F6BA 1RUJ2 1H8TC 3NKGA 3NKTA 3TWIA 1UOBA 4JGYC 1H9PA 1S0FA 4ZXKA 1W9YA 1UYPA 2DTYA 1TME3 3CJIA 5E88A 1HQNA 4QPIB 4OQ9A 1NCQC 3IDAA 1YEWA 1TNRA 1ASJ1 4IESA 5K0UB 1QXJA 4XXAA 4OHYA 2A5ZA 1YFUA 4CDQA 1W6NB 2IVJA 1PO12 5FY5A 3VD7A 2D6KA 2XR4A 1R092 1ZM1A 4KL1A 5J1XA 2E6VA 3VBOC 5EWSA 1IG0A 1ZZCA 4DY5A 1Q43A 2J7MA 3THCA 5JXHA 3SCGA 4I01A 5F5AA 1JYIA 3DF0A 3R0RA 4QB1A 4XJ8A 3MPBA 5GZEA 4EROA 5A33B 5IT6A 1A34A 3RZHA 1HRI2 2VQAA 3T3YA 2RM21 1IPSA 5L9BA 3WF1A 4GD4A 3SEEA 2ZXQA 3WV6A 1L7QA 2W95A 4HFSA 1QNYA 4LO7A 4TXWA 2WZPP 4CCEA 1W28A 1O5UA 2VR4A 1TEIA 4NO4A 3USUA 3W59A 3VDCA 4F8AA 2W1QA 3K77A 3O1RA 2B7YA 4QPGA 4I0BA 1DYKA 2OQ7A 1QMJA 3VHPA 3H8XA 3WINE 5F9TA 1D4M2 2W39A 3KVAA 2V09A 2CAUA 4AQSA 4D94A 4RA0A 3B5LB 3CJIC 2WWSA 4FQZA 1GV9A 3SXWA 1YYNA 1YI7A 4QX7A 2WLQA 2PHLA 5K4LA 1W6OA 3MF6A 4IEUA 5A3WA 1RUI1 2O8QA 1YIFA 4HK8A 4CDQC 4C1WA 1K45A 2HWE3 4XF9A 5FDBA 4YYOA 3ZKYA 1W2UA 3APBA 3OSDA 1NYWA 5FZAA 4EZ4A 5FXZA 4FTEA 1POQA 2RJLA 2A6XA 1UO9A 2W1UA 1UY3A 4ITCA 5FK8A 4U2AA 2H0BA 2WQZC 4E2QA 4GKYA 2W47A 1AR73 2RS51 1Y4WA 2ZX4A 3ZXEA 3MW3A 3VBFB 1QKQA 4CE8A 2WR9A 3VHRA 1AYN3 2EIBA 1J83A 1SPPA 5FPVA 2VCMA 1ZX5A 1AL0G 1QJX2 1VP6A 4SBVA 2VQUA 2R49A 3ILRA 3OTFA 4N90A 5CKQA 1OT5A 3D0SA 4QPGC 2VZRA 1H4HA 1RITA 3VKFC 4FAGA 1GOFA 4XHXA 1RXFA 2QQOA 1NXD1 2CGNA 3POSA
chains in the Genus database with same CATH topology
1A8MA 4JVAA 4RR3C 4K40A 4BLJA 5GZGA 2QVSB 2ZGTA 2OIIA 2RR12 3B93A 4JDMA 5FBZA 4K20A 1AF9A 1A78A 1PM7A 3RG0A 1AL21 1QQP1 1UIKA 1W0OA 4PLNA 2B45X 1VBC3 4N7IA 1AR93 2Q5TA 2X5IB 4X6QB 1RUC2 3FUOA 2EIGA 2R1BA 5C4WA 2JKBA 4IV1A 4JDOA 1G9AA 4E4ZA 1ULFA 4PF5A 3ZYPA 1O4ZA 2JJ6A 4Z2WA 2ZHLA 1RHI2 1S0GA 3GBFA 1LHUA 2RMU3 2VVEA 3ME2A 1MZEA 3KGLA 3AM2A 1SBDA 2ZGQA 1FOD2 2D6MA 4G4FA 3MFAA 1EV12 3NO8A 4N43B 1QJU1 1C8NA 2ETEA 1RUJ3 4MLOA 4OZXA 1G9CA 1LHOA 3AMQA 5DUXA 1UMZA 3T1LA 2IZWA 5KHIA 1EAH3 1CAVB 4S2GA 3TAYA 2FHRA 4IV1C 1PO13 4BQ1A 3EO6A 3Q9OA 1IZ3A 1R093 4XDQA 5FOJB 3IN9A 4F7ZA 1G8WA 3WDWA 4COUA 2WINB 5CAZA 2ZGUA 4ZKTB 3WY6A 2DFCA 5BNQA 5DG1A 5AFBA 2WIIB 1ALYA 1HRI3 4IEZA 1MZ6A 1G86A 3MIGA 4IEXA 1ZBA1 4JCKA 1DQ6A 4HPKA 4OUSA 2R30A 1XE8A 3ZFGA 1APNA 1NY72 3GF6A 1AYM3 2RS31 1W39A 2D93A 1KJLA 4Y20B 1R082 3IDCB 5DDJ2 1QHDA 1PK6B 3ZYIB 5GALA 2QDNA 1PVXA 2DVDA 4IXLA 4E4DX 5GM0A 1AZDA 4MV2A 4P9YA 3WHTA 5BPXA 4OULA 1Y3TA 4CEWB 3MICA 4YG3A 4LHKA 3LSEA 3OY8A 3NAPA 2E7QA 5KHHA 5HCAA 2D6LX 4YM1A 1UD1A 1WBLA 4WVMA 2Q0AA 1DF0A 3H3ZA 5HI0A 1V6KA 3M7AA 2D44A 3KT7A 1XU2A 3BPZA 2B42B 1UKRA 2A6WA 2LUWA 4LO6B 4BIFA 2QJVA 2Y38A 4N7UA 5KC6A 3OGJA 1FPN1 3NJZA 1N3QA 4HSJA 2ZGLA 5T54A 2R042 1ZZ7A 3ILNA 5D1IA 2YHJA 1MS5A 1XNCA 4C0HA 5GLZA 1DHKB 3AP4A 3WHUA 2RR13 4ISQA 5HCBA 1AR62 4YGBA 5AC91 1CVNA 4AEDA 2ARBA 2MNGA 1G6NA 3BIWE 4LBQB 4K3UA 1Z7S1 3H50A 4P5HA 1EP0A 1J59A 1RUC3 4LBKA 1Y7BA 1GZ9A 3ZVXA 4L8QA 2CWSA 3D4KA 3FFZA 4BWOA 1YXWA 1KJRA 2R071 5JOWA 2CTVA 3KT4A 2BNNA 4Z82A 1NZCA 1WD4A 4BPZA 1RHI3 2JE9A 4BZ4A 3WG1A 2NLRA 4AQ2A 1CESA 1JXNA 1O3RA 4R52A 2XLGA 1ENXA 4YARA 1PGW2 5CG8A 1FOD3 3NV3A 4YSFA 4Q4Y3 5E8AA 1EV13 3AFGA 1VJ2A 4Q0SA 4Q2FA 4RHV2 4JRAA 2XJSA 1CAWA 2UURA 3LA7A 3ZIWA 4AEDC 3V0AA 2AH2A 4WM7B 4EWAA 2C5DA 5T5LA 3WQ1A 2D5FA 2E7AA 4GB32 5T5PA 3A0KA 3N7MA 3MF9A 2AZ5A 4YLZA 4YGCA 4FOYA 2D3SA 3D0JA 2HWF1 4FP2A 4META 4Q4W2 5JR7B 4Q1RA 4BOWA 2MEV2 3MLKA 5KHGA 2WSUA 3QD6A 4Y22A 2BYVE 4XJUA 5JI9A 5C8CA 3ZXAC 3KCXA 5CVRA 2LM3A 3MEPA 1UPSA 4IEQA 4XJAA 2A3WA 4YZ2A 3A4UA 2A75A 4LUKA 1RUNA 1ULDA 1MEC1 1S0DA 3QOPA 2DCZA 2P34A 3ST7A 1QJY2 1WCKA 4A7KA 1KS5A 1R1A1 1PZ8A 3MIHA 4CP2A 2CGPA 3H8UA 1EY2A 1VRH1 3S7EA 1WMFA 3X29B 2ZTNA 1CJDA 1HRV1 1AR82 3WLUA 3FLRA 1O3SA 3AP6A 4QQOA 5J36A 3OCPA 3DGTA 2BWCA 3J26N 1S0IA 4MGYE 2RS12 1R083 3M3IA 3CLPA 4Q4V2 2D3RA 5DDJ3 1KQRA 4AEKA 5I8YA 2DU0A 2A6VA 4QD2A 1UPIA 4E4SA 3DV8A 4N53B 3WDTA 1H0BA 4YZ5A 1FMD2 4Q4X3 5FPZA 4YFZA 1PIV2 2SBAA 5BNPA 4YM2A 3DPRA 4YRDA 3RDIA 5C8CC 3JQXA 2F4PA 1QF3A 4IV3A 1POV1 1VBD1 5FLJA 4FOWA 5D8AA 2VVDA 4H7MA 2FQPA 3SCHA 3AKRA 3IT8A 1YIPA 3FUQA 1VBA2 4QM8A 1EPZA 2A6ZA 3MZHA 3AX4A 5F5QA 1N1VA 2GMEA 3B02A 3MPPG 3WQ0A 4CDWA 3FMGA 4P9JA 1LTEA 1YFWA 2VOXA 1OPMA 1CR7A 4A3XA 4AFBA 2NQYA 2WJSA 3RI8A 1LEMA 2DV9A 4IEPA 4PLMA 4COZA 2I45A 3LAGA 5JIAA 2R043 1A6CA 3H3UA 3FJSA 5I8SA 2PLV3 2B9UA 1AR63 3TN92 4YG6A 2DVGA 4Z1VA 4QPIA 3VZOA 1V9U3 5BNPC 5FMOL 3DPRC 5K0UA 1UU5A 1COV1 1W6NA 4IV3C 5DUWA 5CB7A 5D8AC 2WSVA 2WNUA 5FQ0B 4AGGA 1U5ZA 2XKOA 4QQPA 3SH3A 1RUG2 2I07B 3I7DA 1E57A 2TEPA 4COWA 1AJOA 1B35B 2JG9B 3PTYA 2YXSA 4ZU5A 2PHRA 5A33A 1N1TA 2WS93 4CDWC 3FE5A 2ZGKA 5J7MA 3O12A 2GC3A 2X29A 2X53S 3ZMNA 2YDEA 1D4VB 2C0ZA 1TNFA 3E5UA 4FOVA 4XFBA 4MX3A 4EJRA 5FLIA 1C8M2 2BGCA 4FPOB 1J58A 4Q8LA 4QPIC 5LK5A 5E89A 5JCTA 4UBGA 2ZMKA 5K0UC 3THPA 4Q4W3 1TME1 4LBMA 2Y0OA 4HT1T 4AI1A 5I0UA 2KM2A 2IXKA 1WLTA 1OMIA 3AYCA 1QXRA 4MGZE 2CNAA 1ZYBA 3B01A 4FPLA 5CA6A 4FOQA 4BE3A 1SDWA 1V6LA 2WQ4A 5A3LA 4FCAA 1FV3A 1YRZA 3J8F2 4FXKB 1QJY3 3CNAA 1RUE2 3VKNA 3AMPA 1UX6A 3LA2A 3GALA 1H8VA 4BM8A 1GQHA 4IL7A 1V6NA 1DFQA 1REDA 1AR83 1IS4A 3KGZA 4YNIA 2PN5A 3VL8A 2BFUS 4LUMA 3UKTA 1VB2A 2EXJA 2DUPA 1BZWA 1WLWA 1RUD2 2VXRA 4MH0E 3WP4A 4I30A 1PGL1 1FMD3 2DU1A 3I59B 4CRQA 2X5IA 4GALA 1S55A 2WLPA 4YVWB 4HL0A 3KSCA 1BMV2 5C9AB 2HWE1 4XILA 1TMF2 4AFCA 2XVGA 4KGQA 4C0BA 1OOPB 3B7MA 3VBFC 4IERA 2UWCA 1QDOA 1QU0A 1UZZA 2Z2SB 3ILFA 1D0GA 2VULA 1AR71 1F8VA 3BOWA 1S0EA 4H7LA 3B3QE 1LB2A 1H2MA 1LCLA 2D6PA 3QACA 1XNDA 4XHBA 5BXXA 4AHWA 1AYN1 5KHJA 3WZ1A 3ZMOA 3AXEA 2H6BA 2IXCA 3W58A 1VIWB 2TNFA 3DKWA 5H9PA 4N43A 2ZOEB 3VKOA 4M3CB 5LK7B 4XBLA 3FBYA 2H6CA 5JSRA 1RUH1 3AJZA 1OD5A 2X5IC 2ZGMA 3M2MA 4ONUA 4XQ4A 1PZ9A 3SCFA 3WG3A 1VBC1 4A2UA 1AR91 3UKNA 1AHSA 1IKQA 3IPVB 4AHXA 2ILMA 1RUG3 2JG8B 4ORFA 4LBLA 5EYYA 4OHZA 5T5OA 2OZJA 1UL9A 4I3GA 3V56A 3VDDB 2PTMA 2R0HA 1NA1B 2PHUA 3INAA 4MUVA 3RRDA 1BKZA 5IK8A 1WBFA 2ZZQA 1SLTA 3K51A 1YUDA 2RMU1 1BEV2 4N43C 1RUF2 2IXHA 1I3HA 2Q1ZB 5BNNB 1W6PB 2DF7A 3WDXA 5T50A 1C8M3 4Y20A 2GH8A 3ELNA 2ZZJA 1PK6A 4OI1A 1RUJ1 1JH5A 1MS0A 4MXWB 3LSDA 1BK1A 2O0OA 4B7EA 1BBT3 4ES8A 2VVFA 4AQ6A 1V6JA 1MVQA 3RZZA 3AZWA 4CEWA 3S7IA 4WM8C 1ZBE3 1EAH1 1KDKA 3TRSB 2DUQA 3C2UA 2PHXA 2BNMA 3MDPA 4YW1A 3EHKA 3WP5A 5T55A 1R091 2VY0A 4YVSB 3J8F3 5EFUA 3WP6A 2KXLA 2OW4A 3ZN4A 1WLDA 2D7FA 3N7JA 5JMCA 2HWC2 1OLQA 4LNVA 1HRI1 3DL3A 3POYA 1HXS2 1DGRA 3H7JA 4Q27A 1CAXB 3EQEA 2E51A 2XLFA 2Z69A 3MLJA 5A32B 5HXVA 3URFA 1AYM1 1PK6C 3H9AA 5JZGB 1RUD3 3VBHB 5CIRA 1HQLA 1PO22 1RB8G 2YGLA 4LBQA 3WG2A 4H55A 3ACLA 2BTVC 5K9YA 1MR5A 1X50A 2ZHKA 4CEWC 2A3XA 2XL7A 3B9IA 3VHNA 1V6MA 2WNUB 4JGZB 3L2HA 1F31A 2VG9A 2TUNA 4XEZA 4DS0A 1LHWA 2XJTA 1ULEA 1TMF3 4GULA 1W6MB 2OZ6A 3WT3A 4FO9A 3LOIA 4PBOA 2WZR2 1AX2A 3I54A 3ZO0B 2D6OX 1DDLA 5T3NA 4HMZA 2CY6A 2D40A 3HQXA 4EN0A 3RSJA 3GZAA 3D82A 2I2SA 3V0BA 1DQ5A 4AI8A 4DRRA 2GAUA 3THTA 1KS4A 1N47A 4BCUA 2QQPA 3U10A 4Q0UA 3UL2A 3ZXKA 4AE2A 1JN2P 4CEYB 2V73A 3D8CA 4GA9A 4XFGA 1PGSA 2H0VA 1SQ4A 2Z42A 3FZ3A 3ZSLA 4AI2A 3SH4A 3E5XA 1RVF1 4WM7A 1K5MA 3MW2A 2BUKA 4YGEA 3UJOA 1CJPA 4YZ1A 3S6PA 2OA2A 3MIFA 5L19A 1QH7A 4UW3A 1DZTA 2YMZA 1NE6A 1H9WA 4NVPA 1YJKA 1RUC1 4QGLA 4Z92B 4V1PA 2GNMA 4NOTA 4L99A 1ASJ2 1LOEA 2WC2A 2R063 5EYXA 3AB0A 1M4WA 3L9JT 1LGBA 2WFF1 4DPNA 2R6QA 4XJZA 3WR0A 5LRSA 1YCIA 3ZYJB 2A71A 2BWAA 4N9HA 4CYDA 4GH4B 4R9DA 1BEV3 1I1EA 4NWWA 2RM22 3A0NA 1RUF3 3DN7A 1QOOA 3G7DA 3PMSA 1GFF2 4PJYA 4WM7C 2R32A 4AF9A 3IDEA 4Q4Y1 1NCRB 1EV11 5J3UA 4YM3A 1XYNA 3KB5A 4N53A 4FVVA 2YC0A 2P17A 1JUHA 2QFEA 3HT1A 3ZXFA 5K7PA 4XF3A 3T2TA 3ZXLA 1N3OA 2YGMA 5GLVA 2ZGRA 1RUI2 2A73B 1H1MA 1U5XA 4Q29A 2EALA 2JENA 3FHIB 1X7NA 1PVC2 4QGMA 2B46X 1RMU3 4K7JA 5DUVA 1GNHA 3VKLA 2D98A 4LLFA 2VNGA 3PVOA 4M3CE 4B29A 4C91A 1YLLA 1VAKA 1G9BA 4OI2A 3VBUB 5CFCB 1OKQA 2HWC3 5FRAA 1LOFA 2ES3A 1HXS3 1FYUA 1SLLA 2NMNA 3AMNA 1B09A 1DU3D 5JPNB 4WVVA 4BA6A 4HBNA 2UYBA 3ZSEA 4OLLA 5I93A 2NP0A 2A70A 1SBEA 1BXHA 4XMAA 4N53C 3U07A 2ZX3A 1PO23 2DFBA 3CEWA 3I4IA 1BCXA 1NQDA 5DDJ1 1C28A 5C4WC 5JLVA 5JSPA 4XOGA 4AG4A 4E2GA 1C1FA 3ZYRA 1ZZ9A 4JC1A 4Q4X1 5TSWA 4GKXA 3JCIA 5FQ0A 4LBJA 3ZFEB 3WNXA 2WZR3 2AREA 1CQ9A 3ETQA 2K9ZA 3WDUA 5BYNA 2JG9A 1B35A 4QHBA 4QX5A 2QDRA 5CG9A 2VMGA 1LOFC 2AR6A 3B00A 2C9AA 3FX3A 1AUYA 1D4M3 2ET7A 5KXCA 3U11A 4P9IA 3ROUA 1LENA 1PMIA 1IPJA 4EWDA 4P9WA 5ACA2 2JXAA 2PFWA 2HWB2 2R041 3R05A 4GIQA 3ZXGA 2PLV1 4AQTA 3AKPA 1QJU2 5EXOA 1AR61 1POV0 4AVTA 4L97A 3LKJA 3KM5A 4KBBA 4NHMA 4P9XA 3LA3A 4XXPA 5FREA 1V9U1 4G3YC 5C6CA 5AVAA 4Z8BA 1C3HA 1ASJ3 3D5OA 4HETA 3AP9A 5FO9B 2ET1A 4LE4A 2JG9C 1B35C 4LE3A 5GJ6A 4CDUB 4JRLA 2QE3A 4R8HA 1QJX3 4XBQA 3S30A 3N36A 3ZFGC 1Z0HA 1QH6A 3VBSA 2WS91 4OHXA 1KFUL 3QBQA 4X6RB 4AVSA 4KU7A 1WW4A 3OF1A 3VBRB 4O9GA 2XPJA 4JV4A 3TNPB 1UIJA 1PGW1 4NPRA 2NYYA 4CDXB 3ZIXA 2Q4SA 4FSJA 2FZ1A 4KG8A 2D43A 4FPJA 3NAPC 1U5IA 3I59A 1H2LA 2GN7A 1HLCA 2E53A 1LOBA 5CNAA 4YVWA 5T5JA 5ABJB 4Q4W1 2XG3A 2DCTA 4AVAA 5L73A 5C9AA 1X33A 4I09A 3ZSJA 1PVC3 1O3QA 4RL7A 1OOPA 4WVWA 3O0VA 1MQTB 4AFAA 2B5HA 5E16A 4INDA 1RIRA 4EWEA 3V0BB 1XYOA 5FMOS 1QJY1 1S0CA 3AP5A 2XVKA 3DUIA 5A3MA 4YW3A 4JAAA 3IKWA 2ARXA 3LWCA 1CD3G 5FTTC 4AYUA 1MZFA 4DFSA 2BVBA 1K5MB 3WUCA 4W65A 3ASIA 4M3CA 1J3RA 1S2KA 1SCRA