3NV2A

Crystal structure of human galectin-9 c-terminal crd in complex with n-acetyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
b'HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv2A00
1JBCA 1RITA 1I3HA 1QMJA 4YM1A 4YFWA 3USUA 4DRVA 3WV6A 4ISRA 2E7TA 2D6NA 5KXCA 1MVEA 4XDQA 1Q56A 2SLIA 3AYCA 1G7YA 4DRRA 1FYUA 2CWSA 4XIOA 1DQ6A 3IN9A 1Q8QA 1JYCA 4XJ8A 3ZXLA 2VUAA 3FLTA 5GZDA 3U4XA 2XG3A 2NYYA 4AGVA 5JOWA 5T50A 2DURA 4KBBA 1IKQA 1BXHA 5GZGA 5HCAA 2DTWA 2GMEA 1W6PA 1OFSA 1G9BA 3LCPA 4XHBA 4K20A 3V0AB 2TEPA 4AWDA 4BLIA 1CN1A 5KXBA 1JHNA 4R9DA 3SH5A 1V6KA 1W6OA 5SV8A 4LBKA 1MZ6A 4GALA 1BKZA 2D6MA 1FAYA 2ZA9A 5T5LA 3A4UA 3WLUA 1QOSA 4M3CA 4XJ9A 4RL7A 2GNDA 1UZYA 2DVGA 4YW4A 1VIWB 1B09A 5T55A 1S0CA 3IPVB 3RMXA 3MPPG 3QLQA 3WUDA 1BYHA 4P14A 1N47A 3N35A 1WW5A 1DHKB 3T1LA 1WUVA 3ZVXA 1C4RA 3AK0A 4XIKA 3AXEA 2YXSA 3TB0A 4UW6A 4R9CA 5T52A 1CPNA 2ENRA 1JOJA 3IM0A 5E8AA 1AXYA 1SLBA 3FUQA 1AF9A 3MW2A 2DVBA 2AUYA 4LBMA 5T5OA 4H55A 2VY0A 4FOWA 1Q8SA 1ENRA 1Q8PA 1SBEA 2P3JA 2B7YA 1CJPA 4HANA 2NMNA 4FPCA 4SLIA 3AYAA 5DZEA 3AX4A 1CIWA 4BPZA 1W6MB 3PVEA 1UPSA 4M3CF 2W08A 4YZ1A 1W6NA 3BTAA 3NV2A 1LOFA 1LTEA 1MR5A 2WQZC 3LSDA 2PHFA 2UWBA 3V0BB 5T54A 3M3OA 4Q2FA 1G8WA 2CWMA 3NV4A 2V73A 3H0OA 4YW3A 4HL0A 2A3YA 2AYHA 1ZM1A 2DTYA 4BOWA 5AVAA 4Y22A 2ARBA 1MS9A 2DU0A 2D44A 2EXKA 2GDFA 3WOGA 3OJBA 5T5JA 2VXRA 1RIRA 2ZGUA 2GNTA 5CB7A 2R0HA 4I30A 3CNAA 2W52A 2A3XA 4CRQA 3NWKA 1DBNA 3WDTA 1SBDA 4ITCA 1FATA 4F83A 1DYPA 1VALA 3ZSKA 4Q8KA 4W65A 2E7QA 3GNEA 4AVSA 1JYIA 1MS5A 5H9SA 3AYEA 4C1XA 2PHUA 1Q8OA 2D43A 4M01A 3ZSJA 3VKFC 1LULA 1S0JA 2DV9A 2RHPA 1H9PA 2EXIA 2GMMA 4XMIA 1DQ4A 5DZGA 1ULEA 2NN8A 4YM3A 1N1VA 3B69A 4YW5A 3AJYA 3WG2A 5GLVA 2P3KA 4GXLA 3BOPA 2VW1A 1CQ9A 4FPKA 2YMZA 3M3EA 4Q1RA 2OUJA 3C2UA 1S0BA 3RRDA 1ULGA 3USUB 1IS3A 1LGCA 3RQ0A 1HLCA 1URXA 4Y1XA 1QKQA 3D6EA 1UN1A 4L8QA 2ZGNA 3VKLA 4OZXA 2I2SA 4AVTA 1FX5A 4XBNA 4K1ZA 3ZSLA 1WW7A 4WZFA 3UJQA 3RMYA 1S0IA 3UJOA 4U2AA 4CZSA 2PHTA 2DUQA 3AJZA 1MS0A 3NV1A 2VH9A 1JUIA 3SH4A 1NXD1 2H0BA 4PBOA 2YY1A 4ATFA 1F9KA 1DQ2A 4YG0A 1X50A 3Q9OA 1LECA 1W6PB 1WLDA 2PHWA 1LHWA 1ONAA 3IKWA 4YFZA 1N3OA 1UAIA 1DQ0A 3FLPA 2JE7A 3WCRA 2ZHNA 3HN1A 5GZFA 2ZHKA 3JU9A 5KXDA 3IMNA 1JN2P 1MVQA 2DUPA 1W6OB 3N7MA 3B01A 4DPNA 1BJQA 1WLCA 4XXPA 3AXDA 5GZEA 4ISQA 1DQ5A 1BZWA 2KM2A 4GA9A 1VAMA 2OVUA 4JC1A 4XMAA 4YW2A 4YZ5A 2ZKNA 5JOZA 4PQ9A 4M3CB 5JOXA 3APBA 2JE9A 4LBOA 5EWSA 1N1TA 3NV3A 3WG1A 5H9RA 5F5QA 1KJRA 1CONA 3WDXA 1VAVA 1V6LA 2ZGSA 3N7KA 4FP2A 4P9XA 1C57A 3B3QE 2D3PA 4XYXA 4YGBA 4DS0A 1C1LA 3RG0A 4FOVA 4PF5A 4Y1YA 3DUIA 5CNAA 1YI7A 5IK8A 3ILNA 5JMCA 3OBRA 3POSA 2GNMA 2WT0A 1YO8A 4GWNA 1LHVA 2Q5TA 3FFZA 4YLZA 3PMEA 1W0OA 2EIGA 1ZA4A 1GZWA 5JVVA 1KJLA 1W6QA 4K21A 1DQ1A 2ZGOA 1WD3A 1J1TA 4Q26A 4XBQA 1EPWA 5GJ6A 2AGSA 3WUCA 1LHOA 4PCRA 4AYUA 1OKQA 3O0VA 2SBAA 3A0KA 4LBJA 3ATGA 2CYFA 1QOTA 1SCSA 4XE9A 1C1FA 1ENQA 4K1YA 1V6NA 1PZ7A 4XOGA 1AVBA 1WLWA 1W6NB 3OY8A 3AP5A 3R4SA 3M3QA 1UKGA 2D6KA 1AX0A 1LENA 3AZYA 3M3CA 4FPYA 2A6YA 1O4YA 3RSJA 4YGEA 3WCSA 1UX6A 1WD4A 3PVNA 4FPGA 5GZCA 1LEDA 3R4UA 4FP3A 2GN3A 2WT2A 4Y22B 5DUXA 1SLIA 4XZPA 1XQNA 2WNEA 1G9DA 1U0AA 2A7AA 3L2YA 1KDKA 3PVOA 3WG4A 1JXNA 5F9TA 4PBPA 1YXWA 3ZXJA 1IOAA 1IS6A 1DZQA 3ZYRA 5IK5A 4YZ3A 4GKXA 5E89A 3AZWA 2V5YA 1DGLA 5BYNA 1GANA 4FPLA 3DGTA 2YROA 4YZ2A 2GALA 3AZZA 3ILFA 5JLVA 5L73A 1N1YA 4YGDA 4GKYA 1KQRA 2ARXA 2ZGRA 4FQZA 1I1EA 2WSVA 3SH3A 4YGCA 5GLTA 1QU0A 5FRAA 1A3KA 4IQPA 2JJ6A 1G9AA 4XTPA 4YW1A 2ES3A 1Z78A 4NO4A 4AVVA 2DYCA 1UZZA 1LCLA 3M1HA 4WVVA 1WW6A 3INAA 2D6OX 2FMDA 5JOYA 1LHUA 2EALA 2CTVA 2A6ZA 1MS4A 1S0FA 1LESA 1GV9A 1SLLA 1CVNA 1VLNA 4LBQD 1UL9A 5DG2A 3WDVA 2ZGKA 2ZAAA 4LBQA 3WDWA 2ERFA 2NZ9A 5IT6A 2OW4A 2BQPA 3N36A 4UW4A 5LK5A 3WDYA 4CTEA 4FPFA 1SCRA 2PHRA 1V6JA 4UW3A 1LOCA 1FV3A 1QNWA 1Y7BA 1A78A 2P34A 1GBGA 4XXAA 4Y20A 5DUVA 1ULCA 1OQ1A 2R49A 3M2MA 3O5SA 5GLUA 5FREA 4Y1VA 1GZ9A 2ZHMA 5T5PA 1V00A 1SACA 4MYEA 1D2SA 2A3WA 3WVJA 1LEMA 4Y26A 1Q8VA 4YG6A 1S0EA 2W68A 2E6VA 2ZBJA 3OYWA 1CPMA 1AXKA 2A6VA 2CY6A 1G9CA 4FOQA 5DZFA 1LOEA 1KRIA 2C9AA 3ASIA 4Q8LA 2UWAA 2NMOA 5DXDA 1GSLA 3ILRA 1MS3A 1W0PA 2WKKA 4FPEA 2DVFA 4RA0A 2D3RA 1FNYA 2EF6A 2GNBA 3KQRA 3O0WA 4XBLA 1QGLA 1H30A 1GZWB 1LGNA 4JRAA 4FOYA 1W6QB 1F5FA 2WLQA 2ZMNA 4BMBA 3JUUA 3UK9A 2A75A 2NM1A 2ZGQA 4UW5A 2D6LX 4FVVA 4BMEA 2DWRA 3AP6A 1AJKA 3RS6A 2A5ZA 1SLCA 2C5DA 1BQPA 3POYA 3SLIA 1MS1A 2E53A 3AYDA 1LOAA 4C1WA 4Z8BA 3VUOA 3OGGA 3UL2A 5EXOA 1WBLA 2UU8A 1SLAA 3OY8B 2VU9A 4XJWA 1GICA 2LALA 4XILA 2WSUA 2Z42A 4M00A 4AGGA 3HR9A 2XB6C 1V6MA 2CNAA 3WHTA 3AP9A 3AP4A 2R0FA 1LOGA 2A71A 3QCWA 4BM8A 5GALA 4LBNA 1PZ8A 1HKDA 1SBFA 5IK4A 4D69A 2R16A 1F31A 3AZXA 3GALA 3ZXKA 1S0GA 3OBTA 1YYNA 2YV8A 2NP0A 3T1MA 2OUHA 3A0NA 3WHUA 1WW4A 4TYSA 2JECA 5H9PA 3OPZA 1G86A 1KDMA 2EXHA 2G4IA 1IS5A 4LBLA 4XJAA 5CA6A 2AREA 3AFKA 2A6XA 3ENRA 3R05A 4YZ4A 3W59A 1QNYA 3AZVA 1QOOA 4WV8A 4P9YA 1YRZA 2P3IA 3BIWE 1H9WA 2EXJA 3FUOA 4ZXKA 4DQAA 4YM2A 3ZXFA 4YM0A 3W58A 2JD4A 2ZABA 5CAZA 1FNZA 1QDOA 1Z0HA 1AZDA 5DUWA 2ZGPA 3VKMA 1HQLA 2P37A 2R1DA 3V0AA 1RINA 5GLZA 1GZCA 1N3PA 2D7FA 2W39A 1QF3A 3D5OA 2WT1A 4FPOB 1TEIA 5JDBA 1V6IA 4FPHA 2A70A 2JKBA 2FHRA 3TAYA 3V64A 4DFSA 1GKBA 3B00A 2D6PA 1IKPA 5CBLA 1G9FA 1AX2A 3FBYA 3AP7A 2DUOA 1DYKA 1LOFC 2P2KA 1GYKA 4LBQB 4NOTA 3IPVA 2HYKA 2ZZJA 3SITA 2AENA 5IUQA 4R9AA 4JCKA 3O12A 3D4KA 1DFQA 1PZ9A 5H9QA 3FLRA 1FV2A 3B9CA 1CR7A 4Y20B 3WG3A 1D0HA 2DU1A 4R9BA 1HQWA 2D3SA 4WVWA 2VW0A 1N3QA 5E88A 5HCFA 1WCSA 3MW4A 5DG1A 5GLWA 2LTNA 2CL2A 1LODA 1ULDA 2ZGLA 2GMPA 5IK7A 5KXEA 1APNA 4GWMA 2GN7A 2ZACA 5DUUA 1QDCA 2WJSA 1A8DA 3OYWB 1LU1A 4Q1PA 1W6MA 2UWCA 1MACA 4Y1ZA 2PHXA 2ZGTA 2ZHLA 4Y24A 3ZYPA 4XJUA 3KM5A 2YZ4A 1CESA 4ASMB 5EYYA 3V0BA 4XHXA 1MS8A 4BLJA 1ENSA 4FPJA 3SISA 4Q27A 1IS4A 1AX1A 1DIWA 1LGBA 3WDUA 3VKOA 1R1ZA 1SFYA 2E51A 2ZMKA 1JW6A 2R1BA 1YIFA 1MZ5A 3VKNA 3T2TA 1WBFA 1O4ZA 4XTMA 3MEPA 4M3CE 3ZPYA 2PELA 3BODA 3ZXEA 1NLSA 3VV1A 3N7JA 2VW2A 3N7LA 4ATEA 1AJOA 3O0XA 4XJZA 4TZDA 2ZMLA 2UURA 3HMYA 5GM0A 1V6OA 3PJQA 4P9WA 3POWA 3V65A 4U36A 4BQ1A 1DLLA 1LOBA 1UMZA 2JDZA 3LSEA 2EAKA 3WZ1A 2A6WA 1N1SA 2AH2A 3SNMA 4YG3A 5EYXA 2DVAA 1GLHA 4Y1UA 1LU2A 5HCBA 1LHNA 1SLTA 1ULFA 3N3HA 2ZGMA 3MW3A 1HDKA 2AR6A 3I8TA 4FQ4A 4ZKTB 4AGRA 1KITA 1GNHA 1LJ7A 3ZSMA 2DVDA 3I4IA 3WNXA 1S1AA 1S0DA 1AXZA 1GNZA
chains in the Genus database with same CATH superfamily
3T09A 1QMJA 4YFWA 3WF3A 1NQJA 2VOKA 3USUA 1VBA3 4E4DX 2D6NA 4HSJA 4QPIC 5F39A 4M0NA 5AVPA 1NCRC 3I59B 4DRRA 3AYCA 5IVJA 1ZZCA 4KQ7A 3IN9A 1GU3A 1Q8QA 4HMZA 4HONA 4HVOA 4NRQA 3K3OA 1OH3A 2IWGB 5GZDA 4AVAA 2OA2A 4AGVA 5C4WA 4KBBA 3H8UA 5FFOC 1FT9A 2QQLA 1YNAA 5IAVA 2XL7A 1W99A 1KFUL 1I9RA 2CDPA 2DDUA 4DXSA 3LCPA 4HKLA 4MOAA 3RJ2X 5KHJA 1DZTA 2WWSA 3E5XA 5DAPA 2XONA 3PLQA 4MZUA 3THTA 2R062 4COWA 5LA0A 3BTXA 4BYYA 2YC2A 1CN1A 4IEWA 1V6KA 3HIFA 3RVHA 5SV8A 3JBG2 3HBZA 3MIBA 2YBSA 4GALA 2D6MA 3B7MA 2ZA9A 3PVBB 5T5LA 1TME3 1MQTC 2JENA 2WFPA 3EO6A 5IVBA 1BEV3 4CDXB 1LB2A 2DVGA 3KV4A 1AYN3 2HWC1 1S0CA 3IPVB 2JDUA 1NLQA 2XJUA 1NA1A 3QLQA 4RD7A 1W06A 1C4RA 2BP6A 1RUE3 2YXSA 4UW6A 4LITA 3PU3A 3H1YA 3T08A 4A2UA 5AFEA 1JOJA 1X9PA 1QJY1 5E8AA 1OOPC 3FUQA 3OTFA 4B7KA 4NN0A 1UD1A 1G6NA 2HWB3 3MW2A 4BISA 2ZEXA 2JG9C 1WCKA 4FSJA 1Q8PA 5I0TA 4QHBA 2B7YA 4O9EA 4P9LA 4Q4X2 2NMNA 2OIIA 5G05L 1AL21 1OPOA 3AYAA 2RS52 2PXJA 5EP9A 1VBB1 3ZYFA 3ACLA 4YYOA 4AEDA 1QQP1 3I2GA 1UPSA 4OHXA 4BPZA 2W08A 4EYUA 2HWE1 2OZJA 1W6NA 1RUD1 1BHGA 1HRV1 2BW8A 1LOFA 1LTEA 1MR5A 1AYM1 3CQOA 3DCQA 4IE7A 3UGHA 2VZ3A 4MXVA 2ZEYA 2PHFA 4Y4RA 2EA7A 1HRI3 4QQOA 3M3OA 1M06G 4Q2FA 1G8WA 2FDFA 4XF9A 4YW3A 3VZLA 3WW4A 3IT8A 5IATA 4B8EA 1K3IA 1XYOA 4XUOA 4BOWA 2WBKA 2Y34A 5CU1A 4NHLA 2D44A 3ITQA 4QGNA 5I8TA 2VXRA 5FZ3A 2W52A 4LA3A 4PLNA 4XFIA 5B2GB 5JZGA 1DBNA 3PIJA 2XGXA 2RDSA 1F5JA 1SBDA 1FATA 3CZJA 4F83A 1DGRA 3ZSKA 3A23A 4AI1A 1TMF2 2Y0IA 3GNEA 1NUKA 4HETA 4UT5A 3WNNA 3DPRC 1JZ8A 1UY4A 2RS11 3AYEA 5IFPA 4KU8A 3BVCA 3K51A 3HQRA 1Q8OA 2D43A 4IEXA 4M01A 2XWBB 1CGPA 2R6QA 5DZGA 1ULEA 3DYMA 4YM3A 4JTNA 5DAWA 5C8WA 3AJYA 2Q1MA 3ACHA 3RJRA 4YSFA 3WG2A 2DCJA 4O65A 5B4NA 3ZIXA 1CQ9A 3RRDA 3ZDSA 2UYBA 2ZOEB 2GU9A 3ZDVA 1YC61 1KS4A 5AC92 3U4SA 5JXJA 1SHWB 4UFHA 4L8QA 2WNUA 4OZXA 2XOMA 4ES8A 4Q0PA 4Z2WA 4XBNA 3ZSLA 1SEFA 2P17A 2WABA 3TRSB 4CZSA 2PHTA 4MLOA 3WQ0A 3RZLA 2GH2A 4IV3B 4HXCA 4URAA 2LM3A 2MPFA 1NXD1 3MZHA 4PBOA 1K5MB 1NZIA 4ATFA 3LIHA 1DQ2A 3OUIA 5IYYA 2XVGA 1BEV1 4I0BA 4ZXEA 5LCWL 1LHWA 4KWLA 4RHV1 5FBJA 4K8FA 2JICA 5GZFA 1DYOA 4Y33A 5A7WA 3ZFGB 4CCLA 1JYVA 1PIV1 2N7GA 1RUE1 1S4CA 2VTXA 2X5IA 1VBE1 2OQ7A 2ZS6B 3EQEA 3ON7A 4LOSA 4NUBA 4QQHA 3B01A 1Y9QA 3OBZA 3J7LA 5C3OA 5FPXA 4GA9A 3VBUC 1RHI3 1VAMA 2OVUA 5D2AA 5L36A 2VVDA 2ZKNA 4M3CB 1ZBA3 5FPBA 3N7KA 2ZGSA 4FP2A 4P9XA 1C57A 3B3QE 3QH7A 4BQ3A 5ABJA 2HKXA 1PNGA 2LROA 5IWFA 1WGPA 3DUIA 3AMPA 1YI7A 5CNAA 2FD8A 3P3NA 2PTMA 3W5MA 3C7FA 1AR81 3FFZA 3PUHA 5DDJ3 2XLGA 3PMEA 1A8MA 1GZWA 1RVF3 2MEV1 3LAGA 1KJLA 1X82A 1B35B 3I2JA 3I3EA 3K77A 4Q5OA 1J1TA 1UNBA 4JTOA 3NJVA 4IESA 3VLBB 3ZR5A 1QJY2 2ZZQA 4MG2A 1JYXA 5LZ6A 5EPAA 3WUCA 1LHOA 4L9BA 3FBMA 3ABZA 3KVBA 1XU2A 1ZBE3 2PQSA 2CYFA 1QOTA 3ATGA 4N53C 4OLLA 4D6RA 1AL22 4GD4A 1WLWA 2J1RA 1REEA 1UKGA 1QQP2 3D0SA 3FZ3A 4FPYA 3U0ZA 1VBC3 3IIAA 4YGEA 1RUD2 1TNRA 1D7PM 1HRV2 5FMOS 5I0DA 4OUMA 1AYM2 2WA4A 5BNOA 1ZRCA 2G9FA 3ZO0B 5A70A 3R4UA 3HN3A 2B39A 1W2OA 1SLIA 5TSWA 1HN0A 1UYXA 2PLV3 2ZX3A 3L2YA 1HQNA 2G9GA 3PVOA 2FMYA 1JXNA 4LKSA 1UZVA 2ZEWA 1GQHA 2HWD3 4CCNA 1IS6A 1DZQA 1IG3A 3KHBA 4Y4YA 2ZXQA 1CX1A 5E89A 3RZZA 1ZREA 3IDAA 4I3PA 5A32A 3OF1A 1QXPA 3VDAA 4FPLA 1O3QA 4JGZB 2YC0A 2YROA 4UFMA 1PO13 2W91A 4DZGA 2GZWA 1N1YA 4GKYA 5FJHA 2RS12 1JHJA 2WNVA 1GP4A 3GBFA 1NKGA 2W1UA 3AMHA 4XUPA 4PJYA 1QU0A 2C9KA 5FRAA 3VHRA 1ZZ9A 1A3KA 2FDKA 4QQPA 4CDWA 4HZFA 2ES3A 5CISA 1GWKA 4WM8C 4AVVA 2JDNA 3P3PA 4QAWA 3LEIA 3USSA 1AUYA 3INAA 4O61A 2D6OX 5FYHA 5C7GA 4QGMA 2ZEZA 1O6UA 3K4ZA 2CTVA 3J8F3 1P8JA 1U5ZA 1D0GA 4IE0A 1MS4A 1LESA 1S0FA 3ZMNA 1G9AA 1UL9A 4QHZA 5C8CA 3DXUA 3J7NA 2VMGA 3DN7A 3EMRA 2OT7A 4LBQA 2J42A 1YFUA 2ARCA 2NZ9A 3JD71 5IT6A 1RUNA 3N36A 5EV7A 4COUA 4OUSA 5CFCA 4QX7A 3WQ7A 1SCRA 2UY8A 1ZBA1 4NAOA 5ACA3 4DY3A 1V6JA 2W1SA 3MFAA 1CAXB 1TME2 5FWEA 4WVMB 4Y20A 4CCMA 2R49A 1BEV2 3EXUA 5GLUA 5FR3A 1W2UA 4B4QA 1UZ0A 2NQYA 1Z7S3 3BB6A 5FK7A 4DO0A 4AFCA 4RHV2 1SACA 4Q4Y3 2QZ3A 1PIV2 4YG6A 5F3EA 1RUE2 1S0EA 4EE2A 1VBE2 3MLJA 3QOPA 4YVSC 2Q30A 2E6VA 4MGQA 3OYWA 2A6VA 1AXKA 5CFDA 1G9CA 3CDZB 1NCRB 3GCXA 4FOQA 1KRIA 3ME2A 2HWB2 4FCAA 4H7LA 2ZCWA 3UT0A 1CAXA 4Q8LA 3LE0A 3WX5A 5FP9A 1VB2A 5DXDA 1PMHX 1ZBE1 2R043 1H1AA 1JTZX 4IEYA 5F6LB 4IEOA 5A7OA 5FPUA 2D3RA 1EUUA 3NJZA 3MV01 4K7JA 4XDOA 1LGNA 4B29A 1UOFA 2Y33A 2WINB 3GHMA 3T4HB 1RUF3 4UYBA 1FMD3 1QJX1 1AR82 3JUUA 2A75A 4QPIA 3N4MA 4GB31 2MEV2 4FVVA 4UW5A 4Z07A 4BMEA 2B9UA 1AJKA 2A5ZA 3GBGA 3HNYM 2XJPA 2DBNA 3JQWA 4P9GA 4BWOA 2BWCA 2GSYA 5ANNA 2ETEA 3AYDA 4LKFA 1LOAA 2EICA 2XXZA 4MXWA 3VUOA 1O5LA 3OGGA 5DMYA 1WBLA 1BMV2 2D40A 1CZTA 4JX0A 5JAXA 1ZVFA 4AGGA 3T0DA 3HR9A 4J25A 2CNAA 4AFBA 2XL9A 2WZR1 1NAEA 1C8M3 3QCWA 1XYNA 1PO11 4D69A 4XUTA 1OVSA 2H6BA 4YM1A 3GALA 4NRPA 3WP3A 3AKQA 4CUCA 5A1LA 2NP0A 5J1XA 3FHAA 3A0NA 1Y9GA 3MHZA 1WW4A 2Y38A 2JECA 1MQTA 3CJIA 1G86A 2JG8C 2EXHA 1W28A 1IS5A 3O1SA 3I2KA 3HJRA 4JKKA 4PHZA 3MF9A 3ENRA 3K48A 5I0SA 3R05A 5LRSA 2YUEA 2D97A 5HXVA 1VRH1 2P3IA 3BIWE 3J8F1 4AQSA 2QCSB 3ZYHA 1XC6A 3H8RA 4YW7A 3UETA 3UYJA 4DQAA 4Z2AA 3M4FA 2PN5A 4YM0A 1JYWA 1OOPA 5CAZA 1W8FA 4PDWC 3VD9A 2JG9A 1U5YA 2CHHA 1GZCA 3KMHA 5GLZA 1SPPA 5ACA1 2W39A 1QF3A 4HK9A 5JDBA 4OMCA 1V6IA 3T2OA 2BZDA 1ODMA 2OYZA 1V0AA 1OMIA 2EIBA 2IXIA 4DFSA 1LR5A 4XCBA 2JKXA 3B00A 2D6PA 1IKPA 2W1WA 1G9FA 3FBYA 1H6YA 4B7EA 4OHZA 1F15A 1DYKA 5L7OA 1NZCA 1LOFC 2P2KA 4AW7A 2O14A 3O1UA 1VB4A 4H2AA 1CAUB 1JMUB 1IPKA 1RUH1 2PFWA 4I2OA 3JD72 1W04A 2WIIB 3Q8CA 4HKOA 4DUVA 1RUJ1 3J7MA 1FV2A 4QPGC 1D2QA 5G04L 1ZBA2 5APAA 2WAOA 4DB5A 5JXIA 5CEHA 2R041 2UYAA 4WVWA 2VW0A 1N3QA 5JXGA 3AKRA 3MW4A 3WW2A 2CL2A 4NIGA 5C6CA 3VBRB 2G9ZA 3VBOC 2R063 5IK7A 5FBZA 1OD5A 1FMD1 2ZACA 1VPHA 1QDCA 1A8DA 3UV9A 1LU1A 3DPRA 3UESA 1RMU1 1XOYA 1AR61 5LRRA 4LHLA 1MACA 4Y1ZA 3WY6A 4DIQA 2PHXA 4Y24A 5HPOA 3WEZA 4XJUA 1YQCA 4XF1A 4A6SA 3O14A 5EYYA 3MIEA 1W05A 1MS8A 4OCTA 5LBCA 1VAKA 4FPJA 1IS4A 4WM7C 1AX1A 1DIWA 3WDUA 5FYSA 1ZBE2 4LHKA 1VRBA 2E51A 1GP5A 2VZQA 2HYXA 1WBFA 4A41A 1YIPA 2Q8EA 1C8M1 1ENXA 2X8KA 1DDLA 2ARAA 1QJX2 1VBC2 2PELA 1UIJA 2R32A 1U5XA 2PQQA 4G3YC 3ZPYA 4GB32 4I3GA 3N7LA 1BK0A 1AJOA 2BERA 4A45A 1UY2A 2UURA 2VBPA 3HMYA 2IVIB 2A73B 3CKHA 4KGGA 3PJQA 5F6KA 5GM0A 4Q4X3 1O4TA 4CPBA 1XNCA 3VD3A 4BQ1A 1NCQC 5DAXA 2YYOA 1UMZA 1UOGA 5FZDA 1E5IA 3WZ1A 2FDHA 2AH2A 1O3RA 2DVAA 3ALQA 1SLTA 3KVAA 5EJ3A 2WZR2 4LEJA 1GNHA 2PAMA 4YLZA 3WNXA 1GWLA 1AXZA 5LBEA 3LIGA 1PO12 2KA3A 4IDZA 5JUVA 1ZZ6A 3VBUA 3WV6A 1BCXA 5T3NA 3H3UA 4XDQA 4RQPC 5EFUA 5J7MA 3NAPB 5FK8A 4URTA 4BQWA 3A22A 3KQ4B 3VB9A 3FC0A 2SLIA 2V4VA 1FYUA 2QQPA 3BIEA 3OBAA 4N53B 5I8SA 3GBWA 2QBXA 4KNCA 4HFSA 5FZCA 3LFIA 1JYCA 4XJ8A 2FCVA 2VUAA 3FLTA 1C8NA 4CCDA 3RYKA 5FCCA 4CUAA 5A1AA 2DURA 3I3MA 1IKQA 4QDSA 1RUOA 3WF0A 1TMF3 1VRH2 3J8F2 4AF9A 5HCAA 1H4GA 1W6PA 1XYPA 2B4KA 2YFUA 4FI9A 4RFT0 4CP0A 4EN0A 3SEPA 2ZJCA 1QWRA 3V0AB 1XU1A 2RJLA 3HWJA 5FY0A 3F2ZA 4AWDA 4BLIA 5JPNB 5KXBA 4MO3M 3GZUC 4R9DA 1L7QA 4B4PA 3PUQA 1OC1A 1ASJ1 2JXAA 5ACA2 1SMVA 4KG8A 1BKZA 3WNLA 3VBFB 2HEWF 5CYYA 5IVCA 1QOSA 5AC93 3BALA 4OUEA 4XJ9A 3SCFA 4QKDA 2GNDA 4P9IA 4YW4A 1YEWA 3RMXA 3J4UH 4FAGA 2P6HA 2W0XA 3MPPG 1I5ZA 3ZYGA 1REFA 4CEWC 3N35A 4EN8B 1DHKB 2P3YA 4LK7A 1WUVA 3KF5A 1PM7A 4XIKA 3AXEA 2CV6A 1WCUA 5EHDA 5T52A 4PI2A 4EWAA 4G4FA 3ZLIA 2XUEA 1RUH2 3LD8A 4XCAA 5FQ0B 1AXYA 5FYTA 2F4PA 4LIVA 1RUJ2 2WC2A 4DEVA 3U07A 3HD8B 4LBMA 4H55A 4FOWA 4WM8B 1ENRA 1SBEA 2WUHA 2R042 4QX2A 1CJPA 2XHKA 3MLLA 4HANA 3AM2A 4SLIA 3VBHC 5EIYB 5ISLA 2RJ2A 2BEOA 2GC0A 3KV6A 1W6MB 3M3IA 1FMD2 2Y6LA 4YZ1A 4CCOA 3NV2A 1RMU2 3JQXA 2QQIA 1AR62 2VTFA 3TBDA 5F3CA 2UWBA 2C24A 5T54A 4QPWA 2BPA2 1XRUA 2CWMA 4JV4A 2V73A 4CCKA 4CDWC 3ACIA 2AYHA 3IWZA 2XHNA 4KGQA 5J3UA 2HWC3 2ARBA 5KC5A 5A33A 1JI6A 3HVDA 1KXGA 2D5FA 5T5JA 5K0UA 2B9VA 4I30A 3SHRA 1UU5A 3KV9A 4OULA 1OKOA 1C8M2 2OPWA 2J1EA 1ND3A 2JIJA 3NWKA 5C8CC 3WDTA 1QJY3 2XWJB 5LY2A 3RYRA 2Y0OA 3I97A 4W4ZA 1OH4A 2OQ6A 4HBNA 4X6RB 2E7QA 5CVRA 1V70A 1JYIA 3MPBA 5CG9A 4C1XA 2WQ8A 2JE8A 2FCUA 4QDRA 2CAUA 3RPQA 1A6CA 2YBPA 3WP6A 2RHPA 3GZTB 4LE4A 3VZOA 1VBB3 3LGRA 1IHMA 2V09A 2XQRA 4LUKA 5F5IA 4YW5A 4IEQA 2HWE3 2P3KA 2QQUA 1RUD3 4TN7A 2VW1A 1AYM3 2YMZA 3Q8BA 1GP6A 2OUJA 3C2UA 1ULGA 2RJKA 4YW6A 4YVSA 3USUB 1UY1A 4NHYA 2FDGA 5CKQA 3T2PA 1QKQA 2J22A 4I02A 4B1MA 1POV1 2W92A 3VKLA 1ZRIA 2K46A 3ECQA 2H0VA 3EJKA 3UJQA 4EZ4A 4F8AA 1S0IA 3ES4A 1QJFA 1HV1A 4J1XA 2X05A 1BBT3 3AJZA 3MYXA 1MS0A 2MNGA 4NIIA 2QZ2A 1JUIA 1UZWA 3VBSC 5FZMA 5C4WB 2YY1A 5BNQA 1F9KA 4IGPA 4YG0A 2VQAA 4ZS3A 2NPIA 1UYZA 5IVEA 5A7SA 4Q0SA 1WLDA 1O8SA 3IKWA 4YFZA 3FLPA 4KMQA 1ULPA 2ZHNA 4QB6A 2RS13 4CA9A 4XVHA 3JU9A 4IEUA 1D4M1 2VZ1A 3IMNA 4GMP1 1MVQA 5KXDA 2BVVA 2DUPA 4IEPA 4B1LA 2B5HA 1NLRA 3N7MA 4UAPA 3T30A 5D21A 4N7IA 1VBD3 4DPNA 1WLCA 5GZEA 5K4LA 3AXDA 3PDQA 3LA2A 2VBBA 1XNTA 1YWKA 4XMAA 1COV1 4YZ5A 5FZLA 3ROUA 5JOZA 5JOXA 4LO6B 4X8NA 3NV3A 3DECA 4PIXA 1XE0A 3C7EA 1CONA 5H9RA 3VGIA 2BV4A 1V6LA 4DS0A 3NSTA 1NA1B 2D3PA 3W21A 3PL0A 4NAMA 3ACFA 3RG0A 4FOVA 4Y1YA 1GNYA 2W9XA 1L7RA 2YBKA 2VG9A 3POSA 1PK6C 3RWKX 2YPDA 2P1BA 2Z5WA 4JAAA 4AVBA 1UWWA 2BOJA 2WWJA 3WF2A 1W0OA 1UY0A 2EIGA 5JVVA 4XFCA 5B4XA 1W6QA 1GMMA 1WD3A 4Q26A 4HT1T 1EPWA 1JZ6A 5FY5A 2JG8A 3CJIC 2AGSA 4N90A 2GAUA 1ACCA 1L7LA 4V2VA 4MSVA 3NNLA 4BQ4A 4COZA 3A0KA 3CLPA 3OEAA 4LBJA 4RHV3 5A7NA 4QKBA 1SCSA 4GH4A 4XE9A 1KS5A 5C5TA 2PYTA 4AEDB 4L99A 2YU1A 1PIV3 1PZ7A 1RUI1 1V6NA 1V9U1 2IXHA 3U11A 1VBE3 1W6NB 2W2IA 3OY8A 4D0QA 1H0BA 1A34A 3NNFA 5E1RA 2D6KA 1AX0A 3AZYA 3M3CA 4COVA 4BU2A 4IL7A 4PDWA 2V5DA 4E8CA 2VVEA 4FPGA 4QB2A 4XQ4A 5HV4A 4V2WA 4FP3A 3BUCA 2GN3A 2VGDA 1RJ8A 2WN2A 3BGAA 3POBA 1IQAA 3KLSA 4DNYA 4XQWA 1C3HA 2B46X 2A7AA 2X10A 3VHNA 1FOD3 1KDKA 2VVFA 3WG4A 2YHJA 5F9TA 3I2DA 1H1MA 4NR1A 1OPMA 2WYFA 3ZPOA 4CXYA 1AR83 5JZGB 2PAKA 4META 2MEV3 5FIXA 4YZ3A 4GKXA 3OD0A 3BU0A 3ZOIA 5L7OC 1UIKA 1DGLA 5SV5A 5K8SA 1XE7A 4CE8A 1F2NA 5FO9B 1OURA 4AI8A 2VTXJ 1L3JA 2K2SA 4D7SA 1X36A 2V72A 4QPGA 4YGDA 2ATFA 3IBMA 4H14A 5LASA 2AC1A 2WSVA 1E57A 1BBT1 2WO1A 4YGCA 5GLTA 2F4LA 3SCHA 3CJXA 3MUY1 4NO4A 5KWRA 2DYCA 3M1HA 1LCLA 1H8TC 3VBOA 1F4AA 2FCTA 1PHMA 3N9NA 3DYPA 2WNUB 1SLLA 2QQOA 1X7NA 3BCWA 5DG2A 5FZOA 1E5RA 1MZFA 2DCYA 2R073 1PM4A 4NJ4A 4N9IA 5LK7B 3T4VA 1IG0A 2D93A 1VBD1 2VMCA 1XSRA 4OHYA 2BQPA 1NYWA 1T6GC 4LTAA 5LK5A 2ZPXA 1CAVA 4WM7A 3LDRA 4FPFA 4CTEA 1VE0A 5IHRA 4QQ2A 3ZIWA 4DXRA 3AVSA 4A7KA 3LDBA 4BDVB 3NJYA 2RVAA 1RC6A 2P34A 2W3JA 3H7YA 4XXAA 4GJYA 5DUVA 2BFUL 3MIHA 3M2MA 3I49A 4ZU5A 5A7WB 2QQNA 2ZX4A 4E27A 5FREA 2X5IB 2HEVF 4DMIA 5FWJA 4W6YA 2IUWA 3UGGA 2A3WA 1JZ3A 3VD7A 1LEMA 4Y26A 1D4M2 2LRPA 4A44A 1GZTA 1XJAA 3KGZA 2O1QA 3ZM8A 1NCQA 4EN9B 4JHTA 1E5HA 1QHDA 4MV2A 5DZFA 1LOEA 2OZ6A 4OMDA 2C9AA 3DXTA 5ABJB 3NKGA 2OKXA 2W46A 2Z4FA 3POJA 2UWAA 4JRLA 2Z2SB 4CXXA 3P1IA 1OA4A 1PGSA 2DVFA 4GJZA 2GNBA 5FTTC 5FO7B 5FYVA 1JH5A 1QGLA 4QXHA 1GZWB 4MGKE 1H2NA 4JRAA 3JD73 4Q4W1 3ZN5A 3NNMA 4HK8A 1GOGA 4RQPA 1W9SA 4S2GA 3AP6A 5CIRA 3T2QA 5JCTA 3RS6A 4M4PA 4UFJA 3R6SA 1SLCA 3C8XA 1J83A 3IIIA 4AQ6A 1MS1A 2TUNA 1F4HA 3AL5A 3THDA 1XE8A 2E53A 1ST8A 5K7PA 3EBRA 1FOD1 4O7XA 5LEKA 1UXZA 2HWC2 3TN93 5JI9A 3MO4A 4RR3C 4YVWC 4JGYC 1R1A1 1QJZA 2VU9A 1GICA 3THPA 4B3NA 2WSUA 1PGL1 1RUI2 1V9U2 1V6MA 4S2DA 3AP9A 5A80A 3RZHA 2R0FA 4UF0A 5BNOB 4LO4B 4EROA 5C3RA 2I74A 3FWEA 1OVPA 1F31A 1Y43B 2R16A 3AZXA 4TWTA 5J36A 5I0UA 3T1MA 4Q0QA 3WHUA 1PVXA 3U10A 2Y60A 3MUZ1 3JB4C 3K3NA 4KBZA 1VBB2 2D98A 4GQ7A 1R64A 2VCMA 2AREA 2BJSA 5J37A 1QJX3 2HWE2 4CEWA 2ET1A 5FZ0A 5A32B 3W59A 3CBNA 3AZVA 4GB33 3ES1A 4Q29A 1DG6A 4PLMA 2BDRA 2IFRA 1H9WA 2W95A 1ZA7A 3FUOA 1UMIA 1STMA 1BLZA 2R071 3MIGA 3NW4A 4YM2A 2VC9A 2ZAHA 3GM8A 2WNVB 2ZABA 1W8HA 2IFWA 3ZFEC 4NHKA 3N9LA 4AAXA 5DPNA 5C3SA 3VKMA 1HQLA 2WO3A 4CDWB 2GH8A 4CP1A 3BI3A 1RINA 1BBT2 5L19A 4JHZA 5A3LA 1C28A 3OGJA 4FPOB 1W8TA 2WT1A 3VBHA 5LBBA 2WZR3 1TEIA 2FQPA 3R4DB 4D8MA 4R52A 1MZEA 2F6BA 2FHRA 3LPGA 3V64A 4P08A 1GKBA 1W8ZA 1W2TA 1X8MA 2J1TA 5C8CB 4BQXA 5CG8A 2KD7A 3TNPB 1EV11 2DUOA 3B94A 3NJXA 4CP9A 2R7EB 1GYKA 4LBQB 4Y5Z0 5FZ6A 4OQ8A 2ZZJA 1DLCA 2AENA 4FBFA 5CFCB 5IUQA 1VBD2 4A3XA 4NMIA 2VQ0A 3O12A 1UU4A 3GCWA 3K2OA 4HN0A 2XJVA 3C7GA 3B9CA 3TEZA 3ORJA 5FOBB 4Y20B 1D0HA 1VRH3 2DU1A 3GJAA 1GOHA 2VZTA 4N43A 5HCFA 1NXMA 4K9SA 5K0UC 3KF3A 5C9AA 5GLWA 4N9HA 2LTNA 4FXGB 4E4ZA 3SQOA 4RFRB 1ND3C 1ULDA 5FYMA 3TYJA 2AZ5A 3Q8FA 5FV3A 3LA3A 4GWMA 5C70A 3GHNA 5DUUA 5J48A 4QHOA 3OYWB 4R8HA 5CFDB 2VQTA 4IEZA 5DAQA 1LKNA 5JI7A 2VNRA 2ZGTA 4CCCA 2BGOA 1J3PA 2YZ4A 5IAXA 3V0BA 4XHXA 1SFPA 4BLJA 5C3PA 4X8PA 5A3PA 1OF4A 3TN91 4NPLA 4Q27A 1POV0 3E97A 1LGBA 3KGLA 4LO5B 4QU2A 1PO23 4Q0UA 5JXHA 2ZMKA 1JW6A 2R1BA 1SDWA 3EB7A 5A3WA 4BXSV 2YB7A 1IGOA 4QKFA 3KS7A 4QPIB 5A3OA 1YUDA 3TOJA 2WZEA 3RDIA 1RUH3 3C7OA 1IZ3A 4M3CE 1W9WA 4Q4W2 3ZXEA 1DGWX 1RUJ3 3VV1A 4PT6A 2HBUA 2BGCA 3LA7A 1W3XA 4QGLA 5A6QA 3AMMA 5BNNC 4XJZA 2QE3A 1V6OA 3KCXA 4MXWB 3VBSA 5CKNA 4RS5C 3POWA 3V65A 4YWAA 2VO5A 4OZOA 2A6WA 1FOD2 2PHDA 4GMP0 1UXXX 4M4RA 4XC9A 1J58A 5F1RA 2LUWA 5EYXA 2VNVA 2JD9A 3PUSA 3ZN4A 4DOUA 1LU2A 1R1A2 4HOOA 5BNPA 3MW3A 4KH9A 5FDBA 1PGL2 1RMU3 4FQ4A 1AR63 3DYOA 4D3WA 4R4ZA 4AGRA 1US2A 2XJTA 3I4IA 4XZUG 3IAPA 5J98B 1OI6A 1GNZA 4DRVA 1I3HA 2E33A 5FMCA 2VR4A 3M8LA 3O1RA 4ISRA 2E7TA 5KXCA 1TQ5A 1MVEA 3CJIB 3IDEA 1MQTB 3H42B 4BA6A 5F3GA 1Q56A 1G7YA 2WZ8A 2FZ2A 2CWSA 3OCPA 2FZ1A 3VDDC 4B4RA 1DQ6A 1BVP1 1HJFA 4BHPA 2WO7A 5BUVA 3CO2A 3ZXLA 4C8DA 4LT5A 3RZJA 1PK6A 2XG3A 4BIOA 5FOJB 2BNNA 5T50A 4ARYA 5JOWA 4CCEA 1YLLA 4COYA 3AKTA 1OOPB 3IZOA 2DTWA 2XJSA 4FXKB 4OVEA 2R072 1GQPA 2JG9B 4CEYA 1NT0A 1AL0G 1DU3D 1KFXL 1SPPB 1RUG1 3G6JB 3WNMA 3PMSA 3NRUA 3TEYA 4S2HA 5BV6A 1JHNA 3DKWA 4XDPA 2V4AA 1W6OA 4IGOA 4LBKA 1MZ6A 4CDQA 5FZGA 3PNAA 1YQ6A 1ZRDA 3AFGA 3T0BA 2XH6A 3ZFFA 3I2OA 3P6BA 4GH4C 1XBFA 3I3QA 4XABA 5BPXA 4YPJA 2B8MA 1TE1B 5C3QA 5L7OB 1NOVA 1UZYA 5T55A 4EJRA 1VIWB 1B09A 3MLKA 3E5QA 1BYHA 3WUDA 1EV12 3N9OA 1N47A 4P14A 1TG7A 1WW5A 3ZVXA 3AK0A 1OD3A 4R9CA 5JWPA 2QDRA 3WP5A 3ACGA 4NWWA 1SLBA 3GDBA 4KL1A 4NIHA 4LKDA 1R081 1J84A 4R4XA 4RYDA 5FZBA 2VE1A 4CDUA 3O1TA 2VY0A 4EQVA 3OUHA 1PO21 3H3ZA 3QH6A 3LDKA 4FPCA 3LWCA 4WBBA 4XF3A 5FYIA 3SXWA 4UFKA 3U14A 4HVRA 1QEXA 1CIWA 3DPRB 3PVEA 4IV1A 1O8PA 4OI4A 5KHIA 1NE6A 4I0AA 1K42A 1QY4A 2WN3A 5GKAC 2BFUS 3WNOA 1VMJA 2QQVA 1ASJ3 4CDXC 1UKRA 1MPXA 1JUHA 3NV4A 2PAEA 3ELNA 2ADEA 3GGLA 3HOBA 2A3YA 1W39A 2D5HA 3NVCA 1H8TA 2DTYA 1DGWA 5AVAA 4Y22A 3RWNA 3TN92 1MS9A 2DU0A 4AI9A 2WRAA 3LOIA 1WA4A 2GDFA 5AFBA 4XETA 4AFAA 4X6QB 2GNTA 5CB7A 2R0HA 3CNAA 5IVVA 5FP3A 5LW9A 2A3XA 1YJKA 2P6CA 3FL7A 4OYUA 4I01A 3TWIA 2PMWB 4ITCA 4YNIA 5HI0A 3VD5A 1DYPA 4LORA 1XNAA 2RS31 4Q8KA 2ZX2A 4W65A 5FP8A 3CL1A 1YQ2A 1RXGA 2PHUA 2BTVC 4NVPA 1W90A 1SZBA 3VKFC 1LULA 4J6GA 4C0HA 2DV9A 3SCGA 3PHMA 2EXIA 2GMMA 4XMIA 3KT4A 2NN8A 3G7DA 1UX7A 4JDMA 3N9MA 2BNMA 2B45X 1W8UA 2CDOA 3MI8A 2QKDA 3M3EA 4LULA 3NKTA 1S0BA 1PVC1 3RI8A 4QXKA 3VBUB 1LGCA 3RQ0A 5FZKA 2Z79A 1URXA 3MIDA 2JDAA 3D6EA 4P5HA 1W8NA 2LW8A 2WYSA 2XKPA 2E26A 2JDPA 4GWIA 1J3QA 1FX5A 4K1ZA 4AVTA 2DBIA 1WW7A 2GC1A 2P4EA 4UBGA 3WF1A 4U2AA 5A3UA 1ZYBA 2DUQA 1QJEA 4AEKA 3NV1A 3VL8A 3SH4A 4Z92B 3KT7A 1ZZ8A 4Y5SA 2DFBA 1LECA 3E6DA 4ASLA 5J09A 3OGRA 1W6PB 2PHWA 2J1AA 3UNPA 3QACA 4GZ9A 2JE7A 2RMU1 3PUIA 1WZXA 4QPYA 1RGSA 2ZHKA 3MFCA 3WCRA 1UCXA 3ETQA 4UXAA 3OEBA 1HN1A 4GWJA 4C90A 3FE5A 4TXWA 1J3RA 3ZR6A 1HB3A 4LE3A 4XXPA 5IW0A 1RUG2 4QQLA 4RR3A 1LRHA 3B9IA 4YVWA 4JGYA 4PQ9A 5C33A 2JE9A 3WG1A 1TNFA 4CCJA 1LNSA 1VAVA 4LO8A 4XYXA 1HB4A 4AI3A 2OXBA 4YGBA 4CVUA 1C1LA 3HT2A 2GP5A 4PF5A 4NIDA 3B93A 1POV3 4IV3C 4MGSA 4ORFA 2I07B 3WQ1A 4BQ2A 3MIFA 3OBRA 3M70A 4K3UA 3JZVA 2GNMA 1OHFA 1YO8A 2WT0A 1LHVA 4W6XA 2W94A 3O1PA 5KHKA 1GFF2 1ULOA 1ZA4A 4CXWA 2CGOA 4ARXA 5I8YA 4AFMA 1OLME 3ZN6B 1DQ1A 4FFFA 1S55A 1S2EA 2A1XA 3NNJA 4RN5A 4XBQA 3WXPA 5EQUA 1XSQA 5LA2A 5I0RA 1Y4WA 1R082 4A7ZA 1ND2A 4AHYA 2XVLA 4CUBA 5FPLA 4PCRA 3PJYA 4AYUA 1OKQA 4LO7A 4LXLA 3O0VA 4Q4V1 5A3TA 3ETPA 1PO22 2VZOA 3BPSA 2BBVA 1C1FA 1ENQA 2QNKA 1D4M3 4XURA 4GMP3 1AVBA 4XW3A 3AP5A 3OPTA 3R4SA 5E6HA 1LENA 4PIYA 5FZAA 1H2MA 3ZFEA 3IDCB 2A6YA 2Y26A 1UO9A 4JDOA 4XQDA 2QQKA 5F32A 3RSJA 3ZN6A 1WD4A 5GZCA 1COV3 1EUTA 1ZRFA 5JIAA 3VZJA 2VUCA 4EV0A 1LEDA 1UY3A 5KC6A 4CPBD 5FPAA 4FT8A 5DUXA 2DCKA 3I3BA 1XQNA 3GZEA 2WNEA 5FUIA 5A33B 1G9DA 1U0AA 3GXUA 1CIYA 3O1VA 2Y6HA 2Y6FA 3P5BA 1K5JA 5K0UB 3SEEA 2VUDA 3ZXJA 5FO8B 1IOAA 4XFHA 3URFA 1ND3B 5KR7A 2RDQA 2E31A 3AZWA 1HV0A 2CSGA 2VMEA 3DGTA 2IXKA 4YZ2A 4XFGA 5E16A 2IZWA 5F37A 2GALA 3AZZA 5JLVA 2RS32 3UKNA 4AI0A 2C1FA 5A1FA 2VQUA 3DV8A 3ZYBA 1PGW1 4LLFA 4E4SA 1RUI3 1V9U3 2WAAA 2JJ6A 4IQPA 2P5BA 1K12A 2VPVA 3A7QA 2J7MA 4GULA 4N43C 4XTPA 1Z78A 4YW1A 3U78A 1RXFA 4AEMA 5C9AC 4JQTA 5FYYA 4WVVA 1WW6A 5FMDA 2QUOA 4A7YA 4YVSB 4NE9A 2FMDA 1ZRRA 4QX1A 1X33A 4W50A 5FY7A 1LHUA 2EALA 1PVC2 3FMGA 4L0PA 1GV9A 1VLNA 4LBQD 2ET7A 5FZIA 2E32A 1W0NA 2XVKA 3WDWA 1CAWA 4QM9A 3RZGA 1FPN1 2OW4A 4UW4A 3ZX7A 4CU7A 2RM21 3H9AA 4PQQA 2PHRA 3SC7X 2XR4A 4UW3A 3HQUA 5FUPA 1SFNA 1Y7BA 4AG4A 1W9FA 3O5SA 4AQ2A 1GZ9A 2ZHMA 1VJ2A 1V00A 1WCDJ 2RMU2 3JXSA 4MYEA 5T5PA 5BNNA 2CGPA 1O7FA 1CZVA 1Q8VA 2W5FA 5IVFA 4RS5A 1RTVA 2QTWB 1WMDA 3IB3A 2ZBJA 1CPMA 2WL1A 5FY9A 2EIEA 3S7IA 3NL1A 1CD3G 3B5LB 2ZKLA 2W47A 1OUXA 2AACA 2WS91 5A6ZA 2Q8CA 5BNPC 2NMOA 2RDRA 4QU1A 1GSLA 1MS3A 2WKKA 4IE5A 3OOXA 4RA0A 3BN6A 1FNYA 2EF6A 5JIUA 4D94A 4XBLA 4QMAA 3DL3A 4CYDA 5BY5A 2Q0AA 2VM9A 4TSVA 1I5PA 3LPFA 1W6QB 1F5FA 3V56A 2ZMNA 4BMBA 3JCIA 5I93A 3UK9A 2ZGQA 3A21A 2D6LX 4N8MA 3E6CC 2DWRA 1AR91 1WLTA 2JG8B 1ASJ2 2VMIA 4FO9A 2O8OA 3VDDA 1RL3A 3CF6E 3RZMA 1BQPA 3POYA 4MH0E 2WWUA 4HSLA 5LB6A 3AMNA 4QXCA 3HT1A 4GH4B 5A7PA 4Z8BA 2XBO1 2JX9A 5D1IA 3H1MA 5EXOA 3AVRA 2UU8A 4Q4V2 1SLAA 3HQXA 3OSDA 3OY8B 4XPVA 5C5UA 2LALA 4L92A 3LF7A 4NWVA 2XB6C 3PU8A 4HPKA 2LS6A 4PDWB 3D0JA 3WHTA 3AP4A 3I2FA 1LOGA 4QB1A 3SMHA 3SKVA 5F5CA 2RR11 1SBFA 1GOFA 2Q1ZB 4CEYC 3AKPA 1AR71 2YPJA 2G19A 3BTZA 4AI2A 3ZXKA 4BH9A 4E2GA 5F2SA 1YFYA 2EAAA 2JDMA 4IEVA 4CDQC 3FHIB 4IW3A 2YV8A 3FJSA 4AXOA 1WWYA 4C0BA 3ZFFC 3C7HA 2OUHA 3TEWA 5BXXA 5H9PA 4BZ4A 2I45A 3OPZA 5CA6A 1OQEA 2G4IA 4LBLA 3I59A 3FFQA 1UOJA 4Q4W3 3X29B 3AFKA 3GYDA 4OHVA 4YZ4A 1QNYA 3U37A 1JU4A 2ID4A 1POQA 1YRZA 2IXLA 1XB9A 2DF7A 4E2SA 1RUC1 2EXJA 3QBQA 4QPGB 1VMFA 2ZX1A 3ZXFA 1GWMA 4AHWA 1MEC3 2VOXA 4AAPA 1FNZA 2C4XA 1Z0HA 3J26N 2R30A 5DUWA 3HNBM 5HXMA 2XUMA 4UI9L 2QQMA 4M0HA 1R1A3 5JSRA 2PHLA 1PGW2 4CDUC 3WW3A 5CKMA 1XNBA 4E9KA 3VBOB 4K6BA 4FPHA 4FFGA 2W1QA 2JKBA 1DP0A 5A3MA 3IMMA 5FZOB 5CADA 3I7DA 4IV1C 1JOPA 1WCQA 2L9LA 4D7TA 5I91A 4CDXA 4NOTA 2PA7A 3IPVA 5FUNA 4DUXA 1CAVB 4WM7B 2Y6GA 1JYTA 4LJHA 4P9JA 4R9AA 3VDCA 1QJU1 3POEA 4JCKA 1FPN2 1DFQA 1PZ9A 1ZZBA 2RM22 4EN6B 1CR7A 3KV5A 4INDA 4JKMA 3WG3A 4E8DA 2D3SA 3AL6A 4ZS2A 1JOBA 3HEIA 4BE3A 2ZGLA 4MGIE 1R091 2GMPA 2WLPA 5KXEA 3H8OA 2GN7A 1NCQB 2WJSA 4WVZA 4Q1PA 2UWCA 3KCYA 4QX0A 1EAH3 3W5NA 1RJ7A 1PNFA 4LKEA 1DF0A 1CESA 5FP7A 4KU7A 4O9GA 1VBA1 3ZXGA 1ENSA 2VOTA 1KEXA 5D8AC 3SISA 1SDDB 1YI9A 2WS92 1Y9MA 2MHFA 1EV13 4LOTA 1E5SA 3H8XA 1SFYA 2QFEA 2CAVA 1YIFA 4IE6A 5FKBA 5A7QA 3T2TA 4LHSA 1ODNA 4OHWA 5IJRA 1OBNA 4RQPB 3Q8EA 1O4ZA 2HJIA 2KR2A 3MEPA 3RZKA 5FYCA 2VL4A 1NLSA 3PTYA 3KSCA 1O59A 1COV2 2VMHA 3E5UA 2HWF3 3N9QA 3GF6A 1AR92 4NPMA 2HH9A 3O0XA 3RNSA 4ATEA 4TZDA 1Q3EA 2ZMLA 3VBRC 4W6WA 3U75A 4LNVA 1F35A 4P02B 4U36A 4GAZA 1DLLA 1LOBA 4AVCA 2JDZA 3LSEA 3M7AA 3O7OA 4ZZ8A 2XBO2 1N1SA 1QXJA 1YJLA 1OLQA 4HVQA 4YG3A 1VR3A 4Y1UA 4AHZA 1FI2A 4BQYA 1LHNA 3E6BA 4UF0B 3RYPA 1CZSA 1M4WA 2AR6A 3I8TA 3UGFA 4AR2A 3BKZA 1LJ7A 4AK3A 1TME1 2GC2A 4L97A 4IETA 3BPZA 1S1AA 2RR12 3WR0A 1JBCA 1H4HA 1RITA 3EHKA 2G1MA 1MEC1 1AR72 1ALYA 1AYN1 1UW8A 1UYPA 2XJRA 4QX3A 3NNGA 5FPZA 3D8CA 1T6BX 2YU2A 2F17A 5J96B 3HNMA 4XIOA 4CEWB 4BIFA 2BU9A 5ANQA 5ERLA 1DGRN 4IV3A 4QDQA 4UWDA 3S7EA 3KWVA 3OB8A 4ASKA 2DFCA 2HWB1 3U4XA 5LEJA 4UFIA 2NYYA 1OT5A 1K5MA 1H2LA 3R0RA 1BXHA 4XFFA 2AEYA 4XF0A 1PMIA 1X9TA 2VZPA 2WDBA 4LIUA 3VHPA 5GZGA 1W8WA 2GMEA 1RUC2 2W87A 1OFSA 1G9BA 2E9QA 2YDEA 4XHBA 1GR3A 1QH6A 1TVGA 3I2HA 4K20A 4YRDA 4DXZA 2TEPA 2IXJA 3ZFGA 4DINB 4KI5M 1KD7A 4MHRA 3VBHB 4GIQA 1EP0A 2VZSA 3SH5A 5HV0A 1ND2C 5DAVA 3RI9A 3FX3A 4PF1A 4CU8A 5FZ4A 1W03A 1HRI1 4F3JA 4XUNA 2ORXA 1FAYA 3WLUA 2BGPA 3A4UA 5A3NA 4M3CA 2Y8KA 2VZRA 3NAPC 4RL7A 4CP9B 2XLFA 2E7AA 3THCA 4LHNA 4H7MA 1BMV1 3PTRB 2OPKA 5FPVA 5IFTA 5LWBA 1YQ8A 1S2KA 2FDJA 3T1LA 1GUIA 3TB0A 5JR7B 1EAH1 1S2BA 2VOWA 5FZ7A 3B02A 4MADA 1CPNA 2ENRA 3IM0A 1QJU2 1NY71 1O91A 5FXWA 5FZEA 1B35A 2VCCA 1AF9A 4KWKA 2DVBA 4N43B 2AUYA 5FZ9A 5T5OA 2ADDA 4AQTA 5C9AB 3KT1A 1Q8SA 5JSPA 2P3JA 1US3A 4E2QA 4D6QA 3KCCA 3S30A 1W9TA 3S5QA 5DZEA 3AX4A 1R092 2YGMA 4M3CF 1RUG3 4NIAA 3BTAA 4IERA 3VBFC 4XAAA 2HWF1 5FXZA 2RV9A 2WQZC 4K40A 3LSDA 4XFAA 5C71A 2IC1A 2J1VA 3V0BB 2TBVA 2BUKA 2XKOA 1HXS3 3H0OA 3L9JT 2Q8OA 4BQ5A 4HL0A 5FYBA 3TEXA 4W8JA 1VBA2 1ZM1A 3CMGA 2JDHA 2VAUA 4AOCA 1Y3TA 3PIGA 4TLGA 2EXKA 2Y6KA 3WOGA 3OJBA 5LY1A 1T2XA 3O1OA 2RDNA 1RIRA 1UF2C 2ZGUA 4LQRA 4Q0VA 1YCIA 4CRQA 2JB4A 2QDNA 2VECA 4LMFA 5JMOA 1U5IA 4LPLA 4Z82A 3RGBA 1R083 3VBSB 1VALA 4ET7A 1JS9A 4JGZA 4AVSA 1MS5A 5H9SA 2Q1FA 3ZKUA 2JEMA 3ZSJA 1S0JA 5DABA 5FJKA 4IGQA 1XNKA 2XDVA 4ZONA 1H9PA 5BNPB 1DQ4A 4CU9A 1N1VA 3GJBA 3B69A 3VL9A 4XAEA 4CU6A 2YC4A 1RHI1 4ZHNA 5GLVA 2C6SA 4GXLA 1OQDA 1WMFA 3BOPA 3I54A 4FPKA 1OLRA 4LA2A 4Q1RA 5FYZA 1YHFA 4NHMA 4P5YA 1CWPA 4L11A 4FTEA 1IS3A 1HLCA 1CX4A 1RYYA 1W9YA 4Y1XA 4Z1VA 4EWEA 3NO8A 1UN1A 1MEC2 1AYN2 2ZGNA 2YGLA 2I2SA 2X09A 4LLOA 2EVXA 4WZFA 1JU3A 4RSUA 5DDJ1 3RMYA 3UJOA 1RVF1 2BBAA 5KBFA 2KXLA 2VOVA 2H6CA 2VH9A 4NPRA 3VZNA 1PK6B 1UOBA 2XJQA 2H0BA 4ZY9A 3W9AA 2BYVE 1JYNA 4FFIA 1W2AX 2ZTNA 3UKVA 1X50A 3Q9OA 4QM8A 2VMDA 4DY5A 1ONAA 2EIDA 2RS33 1N3OA 1UAIA 1DQ0A 4WVMA 4QD2A 4CEYB 3HN1A 1RB8G 1UU6A 5FLJA 1JN2P 1W6OB 2VNOA 4HLTA 4SBVA 4CDQB 2C26A 5F3IA 1BJQA 1WMEA 3RFRA 4F7ZA 1CJDA 1VBC1 4ISQA 3ZFFB 1DQ5A 3BTYA 4MGTA 1BZWA 2KM2A 4YW2A 2VULA 3JB8A 4JC1A 1VMHA 3APBA 3MGUA 1NCRA 4LBOA 1N1TA 1HRI2 2HEYF 5EWSA 4AL9A 4BB3A 5F5QA 1KJRA 1PVC3 3HPNA 1OF3A 5KHHA 3WDXA 4HKWA 1VP6A 2E63A 3DF0A 1JZ5A 2PLV1 5L9VA 1DCSA 2QQJA 1H2KA 4E4HA 1D4VB 3ILNA 4XF4A 5JMCA 5IK8A 1GQGA 1WKYA 4RGAA 2HWD1 4GWNA 2WZPP 2Q5TA 1YFWA 2VCAA 1QIQA 1EYBA 5FYUA 5C4WC 5DQ0A 3KHCA 4I09A 4K21A 2TNFA 3I3DA 2RG4A 2ZGOA 4DEQA 1EAH2 2Z69A 3VDBA 4EN7B 2QQWA 4L2NA 1HXS1 3ZXAC 4AFDA 1NY72 4V1PA 1X8EA 1NE4A 2JB8A 2X53S 3Q8AA 4IUGA 5GJ6A 1OXCA 4EZHA 4XFBA 1WA6X 4HG6B 2VZUA 2WA3A 2SBAA 2RMU3 1LAJA 4OFGA 4IV1B 4K1YA 4NRMA 4XOGA 2K9ZA 4QWNA 2BRTA 4NHXA 1ZZ7A 3M3QA 1ZNPA 5FAXA 1O4YA 3H50A 4NROA 4P00B 3WCSA 1UX6A 3PVNA 1NA1C 1K45A 2HWF2 3O1MA 5FZ8A 3WNKA 2FBEA 3T0AA 1H8TB 4RGKA 2WT2A 3LEMA 5KHGA 2AEZA 4Y22B 5F2WA 4XZPA 3WD5A 1PX4A 3OGSA 3E1F1 3OUJA 5FY8A 1ZX5A 4D6SA 4PBPA 1YXWA 4IXLA 4A42A 3MICA 1XNDA 2GC3A 1QXRA 3IDBB 1PMJX 3ZYRA 1JZ4A 3LEGA 5IK5A 2Y64A 4LUMA 1XXNA 2V5YA 2WFF3 5FP4A 1GANA 4QX8A 4ES9A 1FXZA 2CGNA 3K46A 4AEDC 2RE9A 1UQXA 3ILFA 3WW1A 1Z7S1 3N9PA 5L73A 3CEWA 5L9BA 1AHSA 1HJGA 1KQRA 2ARXA 2ZGRA 4FQZA 4Q4V3 4Q4Y1 3SH3A 3U1XA 1I1EA 5D8AB 3H3LA 3H1WA 4FTBA 2VXJA 3FHQA 4MVTA 1OA3A 1UZZA 5CZKA 1RHI2 1NG0A 2IVJA 5M0TA 3ZYJB 3POGA 5DN2A 2JDKA 5JOYA 4D7YA 1OLMA 4G9SB 4JKLA 3VHOA 5F7UA 3ZMOA 2A6ZA 2OX0A 3LZZA 4KG0A 5BYNA 3POIA 1CVNA 5JSOA 1J59A 3D82A 3WDVA 2ZGKA 2QJVA 5FLIA 2BOIA 3D3AA 1W3VA 1C5IA 1NX9A 2B42B 5EJ1B 3K4DA 5JZGC 2ZAAA 1RUF1 1JZ2A 2ERFA 4OI2A 5D8AA 1CAUA 2DCZA 5DDJ2 3WDYA 4LK6A 1RVF2 3BOWA 2JIGA 3JBG3 1W2NA 3NQHA 4XEZA 3CU7A 3LOBA 4K8RB 1IPJA 1LOCA 4MGYE 1FV3A 1QNWA 5EZWA 1A78A 1GBGA 1EPZA 1OUSA 1Q43A 3CZUA 1H1IA 1OQ1A 1ULCA 2JDYA 2ZX0A 4JZRA 4N7UA 2VCBA 4Y1VA 2BVBA 1JZ7A 1D2SA 3WVJA 1NQDA 4FFHA 3VBRA 2Q8DA 2VD7A 2JWPA 4AEJA 5A6XA 2W68A 4RR3B 4YVWB 4JGYB 1BVVA 2CY6A 3KB5A 3MBWA 2WNUC 4KWUA 4J1WA 3MF6A 1HW5A 3ASIA 4WZCA 3QD6A 4DXTA 3ILRA 1W0PA 3CHXA 3J9SA 4FPEA 3UKTA 1REDA 3J7HA 2RS53 2PLV2 3KQRA 3O0WA 1H30A 4I0WB 3VD4A 2VBDA 5FKCA 1SG3A 4FOYA 4A3ZA 1H8VA 2HWD2 2WLQA 3VZMA 1FPN3 3L2HA 4IE4A 3KD4A 2NM1A 1PX3A 5F5AA 2RM23 3MDPA 1U12A 1H6XA 3ZXDA 5IVYA 3LKJA 1UYYA 1ND2B 2C5DA 3OPWA 3OGVA 1HXS2 2X5IC 4OQ9A 3SLIA 2VMFA 4MGZE 1WMXA 1XPWA 5L9RA 4C1WA 4QX5A 4C91A 2O0OA 3H7JA 3UL2A 4A6OA 4XJWA 3WNPA 1K5MC 4XILA 4UFLA 2Z42A 4M00A 3DKQA 3ZFEB 4CSWA 1JODA 4XACA 3KZ4C 2WFF1 5ABJC 4JDNA 2A71A 4EWDA 1O3TA 1UPIA 1OFNA 4BM8A 5GALA 1OSGA 1PZ8A 1HKDA 1UMHA 3NMBA 4LBNA 4CP2A 5IK4A 2ILMA 3ZFGC 3VN4A 1HB1A 2WQ4A 1I6XA 2VZVA 5FMBA 3VZKA 3WQBA 1S0GA 2CU5A 2WS93 3F95A 3OBTA 4OI1A 1YYNA 5JR2A 2ORZA 3SKJE 3BYWA 2Y6JA 4TYSA 3NAPA 1KDMA 4MUVA 4XJAA 4QXBA 3BU7A 2BNOA 3LQCA 5FXXA 2A6XA 4N53A 4DUWA 3GZAA 5K9YA 1QOOA 3LB9A 4P9YA 4WV8A 1AR93 3WF4A 1HIXA 4JQRA 3ZKYA 1O3SA 3OG2A 4ZXKA 5LATA 3TNQA 2UY9A 4FTSA 3W58A 2JD4A 2O8QA 1TZOA 1Z7S2 1QDOA 2R061 2XBO3 3S57A 1W8OA 1AZDA 5A6YA 1B35C 2VUJA 2ZGPA 3K75B 4MX3A 2P37A 2R1DA 3V0AA 4Q4Y2 5BNOC 1F8VA 1DZRA 1N3PA 2D7FA 3AC0A 3JBG1 4ONUA 4JVAA 3D5OA 4AHXA 3POFA 1HX6A 4OI0A 2OS2A 1BK1A 2A70A 4PLOA 2HBTA 3TAYA 2C0ZA 2RR13 4TLFA 2QVSB 2XLAA 3PURA 3AKSA 2X29A 3WINE 1AR73 5JPMB 2J1SA 3VBFA 3WT3A 5CBLA 4TTGA 3LFMA 1AX2A 1O5UA 2K0GA 3AP7A 3IAQA 4BK5A 4FAHA 3ST7A 1CAWB 2GP3A 2NLRA 3ZSEA 2HYKA 5FY4A 2VJXA 2XQXA 3C3VA 4KWJA 3SITA 4AE2A 1RUF2 3T3YA 3WP4A 3D4KA 1QH7A 5H9QA 3S6PA 4BK4A 4A4AA 3FLRA 5LBFA 2XMLA 3WSOA 5FQ0A 2IXCA 3CIHA 2WNVC 4BCUA 1OA2A 4R9BA 1HQWA 3PUAA 4Q4X1 4MHUA 1RUC3 1SQ4A 5E88A 1IQDC 5FMOL 1WCSA 4WM8A 2RS51 5DG1A 3DEMA 5FZ1A 4CUGA 1LODA 5BNNB 2WR9A 1IPSA 4BJ0A 2Q4SA 2YG0A 4RS5B 1APNA 4AZZA 5FXVA 5FZFA 3HBKA 3S0MA 5HCHA 4JGZC 1W6MA 2WO2A 2ZHLA 3ZYPA 2DCTA 5FY1A 1EY2A 3KM5A 3OD4A 4ASMB 1J1LA 4PI0A 3I2IA 1C5HA 4ZPIA 2YFZA 3EYPA 5CFCC 5FLHA 3VKOA 2FDIA 1R1ZA 4BXFA 2WNOA 5HBAA 1AL23 1MZ5A 3VKNA 2XPJA 5EJZB 1YFXA 2VNGA 3AMQA 1QQP3 3AB0A 4XTMA 4Y5TA 4ZZ5A 1QJU3 3S5AA 3BODA 4ZU7A 4LR4A 3ZYIB 1HRV3 3VDDB 1YQ5A 4YARA 3N7JA 4UOJA 2VW2A 1TMF1 2J1UA 4S2FA 2HLEA 4PIZA 1KGYA 4P9WA 4ZU4A 3LEKA 2EAKA 5CFDC 3SNMA 3HAGA 4H3WA 1R093 4HPKB 1GLHA 4Y3OA 5LA1A 5HCBA 4UBHA 3N3HA 4QT6A 1ULFA 2ZGMA 5LA9A 4HN1A 1HB2A 3FN9A 4QKNA 3K4AA 4RGGA 1HDKA 4ZKTB 5FZHA 4XUQA 5F8PA 2WFF2 4CDUB 1KITA 3ZSMA 2DVDA 5AC91 3W20A 3MV11 1Q5OA 1S0DA 2BWAA
chains in the Genus database with same CATH topology
1QMJA 4YFWA 4E4DX 1NQJA 2VOKA 3USUA 1VBA3 2D6NA 4HSJA 4QPIC 4M0NA 5AVPA 1NCRC 3I59B 4DRRA 3AYCA 1ZZCA 4KQ7A 3IN9A 4HVOA 1Q8QA 4HMZA 5GZDA 2IWGB 4AVAA 2OA2A 4AGVA 5C4WA 4KBBA 3H8UA 5FFOC 1FT9A 1YNAA 2XL7A 1KFUL 1I9RA 3LCPA 4HKLA 3RJ2X 5KHJA 1DZTA 2WWSA 3E5XA 3THTA 3PLQA 4MZUA 2R062 4COWA 4BYYA 1CN1A 4IEWA 1V6KA 3HIFA 5SV8A 3JBG2 3HBZA 3MIBA 4GALA 2D6MA 3B7MA 2ZA9A 3PVBB 5T5LA 1TME3 1MQTC 2JENA 2WFPA 3EO6A 1LB2A 1BEV3 4CDXB 2DVGA 1AYN3 2HWC1 1S0CA 3IPVB 2XJUA 4RD7A 1NA1A 3QLQA 1C4RA 1RUE3 2YXSA 4UW6A 5AFEA 4A2UA 3H1YA 1JOJA 1QJY1 5E8AA 1OOPC 3FUQA 3OTFA 4B7KA 4NN0A 1UD1A 1G6NA 2HWB3 3MW2A 2JG9C 1WCKA 4FSJA 1Q8PA 5I0TA 4QHBA 2B7YA 4O9EA 4P9LA 4Q4X2 2NMNA 2OIIA 1AL21 1OPOA 3AYAA 2RS52 1VBB1 3ACLA 4YYOA 4AEDA 1QQP1 4BPZA 1UPSA 4OHXA 2W08A 2HWE1 2OZJA 1W6NA 1RUD1 1HRV1 2BW8A 1LOFA 1LTEA 1MR5A 1AYM1 4D3WA 4MXVA 1M06G 2PHFA 2EA7A 1HRI3 4QQOA 3M3OA 4Q2FA 1G8WA 4XF9A 4YW3A 3VZLA 3WW4A 3IT8A 4B8EA 1XYOA 4BOWA 5CU1A 4NHLA 2D44A 4QGNA 5I8TA 2VXRA 2W52A 4LA3A 4PLNA 4XFIA 5B2GB 5JZGA 1DBNA 2XGXA 1F5JA 1SBDA 1FATA 4F83A 1DGRA 3ZSKA 4AI1A 1TMF2 2Y0IA 3GNEA 4HETA 3DPRC 2RS11 3AYEA 4KU8A 3K51A 1Q8OA 2D43A 4IEXA 4M01A 2XWBB 1CGPA 2R6QA 5DZGA 1ULEA 4YM3A 4JTNA 5C8WA 3AJYA 2Q1MA 3RJRA 4YSFA 3WG2A 2DCJA 3ZIXA 1CQ9A 3RRDA 3ZDSA 2UYBA 2ZOEB 2GU9A 1KS4A 5AC92 4L8QA 2WNUA 4OZXA 4ES8A 4Q0PA 4XBNA 3ZSLA 1SEFA 2P17A 3TRSB 4CZSA 2PHTA 4MLOA 3WQ0A 2GH2A 4IV3B 2LM3A 2MPFA 1NXD1 3MZHA 4PBOA 1K5MB 4ATFA 1DQ2A 2XVGA 1BEV1 4I0BA 1LHWA 4KWLA 4RHV1 4K8FA 2JICA 5GZFA 3ZFGB 1PIV1 2N7GA 1RUE1 4QQHA 2X5IA 1VBE1 2ZS6B 3EQEA 3B01A 1Y9QA 5FPXA 4GA9A 3VBUC 1RHI3 1VAMA 2OVUA 5L36A 2VVDA 2ZKNA 4M3CB 1ZBA3 3N7KA 2ZGSA 4FP2A 4P9XA 1C57A 3B3QE 3QH7A 5ABJA 2HKXA 1PNGA 1WGPA 3DUIA 3AMPA 1YI7A 5CNAA 3P3NA 2PTMA 1AR81 3FFZA 5DDJ3 2XLGA 3PMEA 1A8MA 1GZWA 1RVF3 2MEV1 3LAGA 1KJLA 1X82A 1B35B 1J1TA 4JTOA 4IESA 3VLBB 1QJY2 2ZZQA 3WUCA 1LHOA 4L9BA 3FBMA 1XU2A 1ZBE3 3ATGA 2CYFA 1QOTA 4N53C 4OLLA 1AL22 1WLWA 1REEA 1UKGA 1QQP2 3D0SA 3FZ3A 4FPYA 3U0ZA 1VBC3 3IIAA 4YGEA 1RUD2 1TNRA 1HRV2 5FMOS 4OUMA 1AYM2 2WA4A 5BNOA 2G9FA 3ZO0B 3R4UA 2B39A 1SLIA 5TSWA 2PLV3 2ZX3A 3L2YA 1HQNA 2G9GA 3PVOA 2FMYA 1JXNA 1GQHA 2HWD3 1IS6A 1DZQA 4Y4YA 5E89A 3RZZA 1ZREA 4I3PA 5A32A 3OF1A 1QXPA 4FPLA 1O3QA 4JGZB 2YC0A 2YROA 1PO13 4DZGA 2GZWA 1N1YA 4GKYA 2RS12 2WNVA 3GBFA 3AMHA 4PJYA 1QU0A 5FRAA 3VHRA 1ZZ9A 1A3KA 4QQPA 4CDWA 4HZFA 2ES3A 4WM8C 4AVVA 3P3PA 3USSA 1AUYA 3INAA 2D6OX 4QGMA 2CTVA 3J8F3 3ZMNA 1U5ZA 1D0GA 1MS4A 1LESA 1S0FA 1G9AA 1UL9A 5C8CA 2VMGA 3DN7A 4LBQA 1YFUA 2NZ9A 3JD71 5IT6A 1RUNA 3N36A 5EV7A 4COUA 4OUSA 5CFCA 3WQ7A 1SCRA 2UY8A 1ZBA1 5ACA3 4DY3A 1V6JA 3MFAA 1CAXB 1TME2 4WVMB 4Y20A 2R49A 1BEV2 3EXUA 5GLUA 1W2UA 4B4QA 2NQYA 1Z7S3 3BB6A 4AFCA 4RHV2 1SACA 4Q4Y3 2QZ3A 1PIV2 4YG6A 1RUE2 1S0EA 1VBE2 3MLJA 3QOPA 4YVSC 2Q30A 2E6VA 3OYWA 2A6VA 1AXKA 5CFDA 1G9CA 1NCRB 4FOQA 1KRIA 3ME2A 2HWB2 4FCAA 4H7LA 2ZCWA 1CAXA 4Q8LA 3WX5A 1VB2A 5DXDA 1ZBE1 2R043 1H1AA 1JTZX 4IEYA 5F6LB 4IEOA 2D3RA 3NJZA 4K7JA 1LGNA 4B29A 2WINB 3GHMA 1RUF3 1FMD3 1QJX1 1AR82 3JUUA 2A75A 4QPIA 3N4MA 4GB31 2MEV2 4FVVA 4UW5A 4Z07A 4BMEA 2B9UA 1AJKA 2A5ZA 3GBGA 2XJPA 3JQWA 4P9GA 4BWOA 2BWCA 2GSYA 2ETEA 3AYDA 1LOAA 4MXWA 3VUOA 1O5LA 3OGGA 1WBLA 1BMV2 2D40A 5JAXA 1ZVFA 4AGGA 3HR9A 2CNAA 4AFBA 2XL9A 2WZR1 1C8M3 3QCWA 1XYNA 1PO11 4D69A 2H6BA 3GALA 3WP3A 3AKQA 2NP0A 3A0NA 1WW4A 2Y38A 2JECA 1MQTA 3CJIA 1G86A 2JG8C 2EXHA 1IS5A 3MF9A 3ENRA 3K48A 5I0SA 3R05A 5LRSA 2YUEA 2D97A 5HXVA 1VRH1 2P3IA 3BIWE 3J8F1 4AQSA 2QCSB 4DQAA 3M4FA 2PN5A 4YM0A 1OOPA 5CAZA 4PDWC 2JG9A 1U5YA 3KMHA 1GZCA 5GLZA 5ACA1 2W39A 1QF3A 4HK9A 5JDBA 1V6IA 2OYZA 1OMIA 2IXIA 4DFSA 1LR5A 3B00A 2D6PA 1IKPA 1G9FA 3FBYA 4B7EA 4OHZA 1DYKA 5L7OA 1NZCA 1LOFC 2P2KA 4AW7A 1VB4A 1CAUB 1IPKA 1RUH1 2PFWA 4I2OA 3JD72 2WIIB 4HKOA 1RUJ1 4QPGC 1FV2A 1D2QA 1ZBA2 4DB5A 2R041 2UYAA 4WVWA 2VW0A 1N3QA 3AKRA 3MW4A 3WW2A 2CL2A 5C6CA 3VBRB 3VBOC 2R063 5IK7A 5FBZA 1OD5A 1FMD1 2ZACA 1QDCA 1A8DA 3UV9A 1LU1A 3DPRA 1RMU1 5LRRA 1AR61 4LHLA 1MACA 4Y1ZA 3WY6A 2PHXA 4Y24A 4XJUA 4XF1A 3O14A 5EYYA 3MIEA 1MS8A 1VAKA 4FPJA 1IS4A 4WM7C 1AX1A 1DIWA 3WDUA 1ZBE2 4LHKA 2E51A 1WBFA 1YIPA 1C8M1 1ENXA 2X8KA 1DDLA 1QJX2 1VBC2 2PELA 1UIJA 2R32A 1U5XA 2PQQA 4G3YC 3ZPYA 4GB32 4I3GA 3N7LA 1AJOA 2UURA 3HMYA 5GM0A 4KGGA 2A73B 3PJQA 5F6KA 4Q4X3 1O4TA 1XNCA 4BQ1A 1NCQC 3WZ1A 2YYOA 1UMZA 2AH2A 1O3RA 2DVAA 3ALQA 1SLTA 5EJ3A 2WZR2 4LEJA 1GNHA 2PAMA 4YLZA 3WNXA 1AXZA 1PO12 2KA3A 1ZZ6A 3VBUA 3WV6A 1BCXA 5T3NA 3H3UA 4XDQA 4RQPC 5EFUA 5J7MA 3NAPB 4URTA 3FC0A 2SLIA 1FYUA 2QQPA 4N53B 5I8SA 3GBWA 4KNCA 4HFSA 1JYCA 4XJ8A 2VUAA 3FLTA 1C8NA 3RYKA 5FCCA 2DURA 1IKQA 1RUOA 4AF9A 1TMF3 1VRH2 3J8F2 5HCAA 1H4GA 1W6PA 1XYPA 4RFT0 4CP0A 4EN0A 2ZJCA 1QWRA 3V0AB 1XU1A 2RJLA 3HWJA 4AWDA 4BLIA 5JPNB 5KXBA 3GZUC 4R9DA 4B4PA 1ASJ1 2JXAA 5ACA2 1SMVA 4KG8A 1BKZA 3VBFB 2HEWF 1QOSA 5AC93 3BALA 4XJ9A 3SCFA 2GNDA 4P9IA 4YW4A 3RMXA 3J4UH 4FAGA 3MPPG 2W0XA 3ZYGA 1I5ZA 4CEWC 1REFA 3N35A 4EN8B 1DHKB 1WUVA 1PM7A 4XIKA 3AXEA 2CV6A 5T52A 4EWAA 4G4FA 1RUH2 5FQ0B 1AXYA 2F4PA 1RUJ2 2WC2A 3U07A 3HD8B 4LBMA 4H55A 4FOWA 4WM8B 1ENRA 1SBEA 2R042 1CJPA 2XHKA 3MLLA 4HANA 3AM2A 4SLIA 3VBHC 2BEOA 2GC0A 3M3IA 1W6MB 1FMD2 4YZ1A 3NV2A 1RMU2 3JQXA 1AR62 3TBDA 2UWBA 5T54A 2BPA2 1XRUA 2CWMA 4JV4A 2V73A 4CDWC 2AYHA 3IWZA 4KGQA 5J3UA 2HWC3 2ARBA 5KC5A 5A33A 1KXGA 2D5FA 5T5JA 5K0UA 4I30A 3SHRA 1UU5A 4OULA 1C8M2 1ND3A 3NWKA 5C8CC 3WDTA 1QJY3 2XWJB 3RYRA 2Y0OA 4HBNA 4X6RB 2E7QA 5CVRA 1V70A 1JYIA 3MPBA 5CG9A 4C1XA 3RPQA 2CAUA 1A6CA 3WP6A 2RHPA 3GZTB 4LE4A 3VZOA 1VBB3 3LGRA 1IHMA 2V09A 4LUKA 4YW5A 4IEQA 2HWE3 2P3KA 1RUD3 2VW1A 1AYM3 2YMZA 2OUJA 3C2UA 1ULGA 2RJKA 3USUB 4YVSA 1QKQA 4I02A 1POV1 3VKLA 3ECQA 2H0VA 3EJKA 3UJQA 4F8AA 1S0IA 3ES4A 4J1XA 1HV1A 1BBT3 3AJZA 3MYXA 1MS0A 2MNGA 2QZ2A 1JUIA 3VBSC 5C4WB 2YY1A 5BNQA 1F9KA 4YG0A 2VQAA 2NPIA 4Q0SA 1WLDA 3IKWA 4YFZA 3FLPA 2ZHNA 2RS13 3JU9A 4IEUA 1D4M1 3IMNA 4GMP1 5KXDA 1MVQA 2BVVA 2DUPA 4IEPA 2B5HA 1NLRA 3N7MA 4N7IA 1VBD3 4DPNA 1WLCA 5GZEA 3AXDA 3LA2A 1YWKA 4XMAA 1COV1 4YZ5A 3ROUA 5JOZA 5JOXA 4LO6B 4X8NA 3NV3A 4PIXA 5H9RA 3VGIA 1CONA 1V6LA 4DS0A 3NSTA 1NA1B 2D3PA 3RG0A 4FOVA 4Y1YA 2VG9A 3POSA 1PK6C 2Z5WA 4JAAA 4AVBA 1W0OA 2EIGA 5JVVA 4XFCA 1W6QA 1WD3A 4Q26A 4HT1T 1EPWA 2JG8A 3CJIC 2AGSA 4N90A 2GAUA 4MSVA 4COZA 3A0KA 3CLPA 4LBJA 4RHV3 1SCSA 4GH4A 4XE9A 1KS5A 2PYTA 4AEDB 4L99A 1PIV3 1PZ7A 1RUI1 1V6NA 1V9U1 2IXHA 3U11A 1VBE3 1W6NB 3OY8A 1H0BA 5E1RA 2D6KA 1AX0A 3AZYA 3M3CA 4COVA 4IL7A 4PDWA 2VVEA 4FPGA 4XQ4A 4FP3A 2GN3A 2VGDA 1RJ8A 1IQAA 3KLSA 4DNYA 4XQWA 1C3HA 2B46X 2A7AA 3VHNA 1FOD3 1KDKA 2VVFA 3WG4A 2YHJA 5F9TA 3I2DA 1H1MA 4NR1A 1OPMA 1AR83 5JZGB 2PAKA 4META 2MEV3 4YZ3A 4GKXA 3OD0A 5L7OC 1UIKA 1DGLA 5SV5A 5K8SA 1XE7A 1F2NA 5FO9B 4AI8A 1L3JA 2K2SA 4D7SA 1X36A 4QPGA 4YGDA 2ATFA 3IBMA 4H14A 2WSVA 1E57A 1BBT1 4YGCA 5GLTA 3SCHA 3CJXA 4NO4A 5KWRA 2DYCA 3M1HA 1LCLA 1H8TC 3VBOA 1PHMA 2WNUB 1SLLA 3BCWA 1X7NA 5DG2A 2R073 1MZFA 2DCYA 5LK7B 4N9IA 2D93A 1VBD1 4OHYA 2BQPA 1NYWA 1T6GC 4LTAA 5LK5A 2ZPXA 1CAVA 4WM7A 4CTEA 4FPFA 4QQ2A 3ZIWA 4A7KA 1RC6A 2P34A 3H7YA 4XXAA 5DUVA 2BFUL 3MIHA 3M2MA 4ZU5A 2ZX4A 4E27A 5FREA 2X5IB 2HEVF 4DMIA 4W6YA 2A3WA 1LEMA 4Y26A 1D4M2 3KGZA 2O1QA 1NCQA 4EN9B 1QHDA 4MV2A 5DZFA 1LOEA 2OZ6A 2C9AA 5ABJB 3NKGA 2UWAA 4JRLA 2Z2SB 1OA4A 1PGSA 2DVFA 5FTTC 2GNBA 5FO7B 1JH5A 1QGLA 1GZWB 4MGKE 1H2NA 4JRAA 3JD73 4Q4W1 3ZN5A 4HK8A 4RQPA 4S2GA 5JCTA 3AP6A 5CIRA 3RS6A 3R6SA 1SLCA 4AQ6A 1MS1A 2TUNA 1XE8A 2E53A 5K7PA 3EBRA 1FOD1 5LEKA 2HWC2 5JI9A 3TN93 4RR3C 4YVWC 4JGYC 1R1A1 1QJZA 2VU9A 1GICA 3THPA 4B3NA 2WSUA 1PGL1 1RUI2 1V9U2 1V6MA 4S2DA 3AP9A 2R0FA 5BNOB 4LO4B 4EROA 2I74A 3FWEA 2R16A 1F31A 1Y43B 3AZXA 4TWTA 5J36A 5I0UA 3T1MA 4Q0QA 3WHUA 1PVXA 3U10A 3JB4C 1VBB2 2D98A 4GQ7A 2AREA 5J37A 1QJX3 2HWE2