3NV2A

Crystal structure of human galectin-9 c-terminal crd in complex with n-acetyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin 9 short isoform variant
total genus 31
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv2A00
4Y26A 3H0OA 1SFYA 1KDMA 2FHRA 3BIWE 2JKBA 2ZKNA 3NV1A 4R9CA 5CAZA 3D4KA 1DQ2A 1LU1A 4XBQA 1IKQA 1WW5A 1H30A 1S0GA 4SLIA 3AZVA 2P2KA 2ZGNA 4Y22B 4Q8LA 1F31A 1AJKA 4R9BA 4LBQB 2OVUA 1V6LA 3AP5A 1AF9A 5IK5A 1RITA 3OYWB 1CESA 1MS9A 4LBOA 1N47A 2D44A 4OZXA 3UL2A 3WDXA 3WUCA 2A3XA 4YM0A 3ZSMA 3AP6A 2NMOA 1GYKA 1IS6A 1GZ9A 1UZYA 1S0BA 4LBJA 5IK7A 4I30A 1A3KA 1O4YA 2JD4A 1APNA 2R0HA 1O4ZA 4Y1VA 3PJQA 4BOWA 1ENQA 5GLZA 2E7QA 4CZSA 3WCSA 1A8DA 3MEPA 1LOCA 1DHKB 1W0OA 3A0NA 3BOPA 2P34A 1LHOA 4HL0A 4TZDA 2SLIA 4ITCA 4NO4A 3AYDA 1FV2A 1KJRA 2ZBJA 4FOWA 5DUUA 2PHFA 3OY8A 4LBQA 3USUB 3V0BB 1N1TA 4XJAA 2ZHLA 4CTEA 3AZWA 4XJUA 4ISRA 2RHPA 1UX6A 2WQZC 3RS6A 1KQRA 3POYA 1QF3A 2DVBA 2EIGA 1JYCA 4W65A 4YM1A 1VIWB 1IS3A 1G8WA 4ASMB 1BKZA 2DVDA 3IPVB 1QOSA 3ZYRA 3POWA 4XHXA 1BYHA 4PF5A 4XBLA 4YFZA 2Q5TA 2VU9A 4KBBA 3ZVXA 3B00A 1WW4A 2ZHMA 4FOQA 1W6OB 2JE9A 2W68A 3M3CA 2DVGA 2WSVA 4L8QA 3VUOA 1CPNA 5DUVA 2FMDA 3B69A 2EXHA 1BXHA 1W6MA 5KXDA 2VH9A 3NWKA 1N3OA 1S0EA 1JUIA 1OFSA 3ENRA 1LEDA 1G7YA 3DGTA 4XYXA 3N7LA 3AP9A 1S0FA 1Z0HA 2EF6A 2A6YA 2ZGRA 1LHVA 2ZGOA 5JOYA 2NN8A 1I3HA 1N1YA 1V6KA 3FLPA 1DQ0A 3PVEA 1SLCA 4XMAA 1N1SA 1Q56A 3WV6A 5EYXA 4Y24A 1D0HA 1MS0A 1WD3A 2PHTA 3CNAA 4M3CF 1W6PA 4XMIA 1SBFA 4Y1ZA 5GZDA 5GALA 2VW0A 1V6MA 5GLVA 1NLSA 1RINA 5H9SA 1KITA 2ZAAA 5GZFA 3UK9A 2P37A 4BLIA 2DUPA 1GV9A 2WJSA 1GICA 3SISA 3B01A 1LJ7A 2A6WA 4U36A 1W6OA 2ZGPA 1YI7A 1LCLA 5CNAA 4AVTA 1C57A 1SACA 3ZXLA 1B09A 3N3HA 1D2SA 1DQ4A 5HCBA 1GANA 5CA6A 1QOTA 2AR6A 1BZWA 4P9YA 2D6MA 2NZ9A 3V0BA 2AREA 1Q8SA 2V73A 4YM3A 2E7TA 3WOGA 5LK5A 3SITA 2A7AA 1R1ZA 5HCFA 3V65A 1JHNA 1V00A 2ES3A 4XBNA 4XXPA 4Y1XA 5T54A 1ULCA 4AVVA 3O0WA 2D6OX 2B7YA 2A3WA 1SCSA 2PHRA 1SBDA 4RA0A 1ZM1A 4P9XA 1JW6A 1WLCA 4P9WA 2CWSA 2D7FA 4YG3A 1C1LA 5GLWA 4YZ5A 1DGLA 4IQPA 1QGLA 1OQ1A 2DWRA 3INAA 3SNMA 1S0CA 3M2MA 1JBCA 1GNZA 1RIRA 1N3QA 3AZYA 1MZ6A 3AFKA 3VKMA 1HLCA 1WBFA 1PZ8A 3DUIA 2ZGLA 3B9CA 4FPKA 2ZGMA 1LOEA 2ERFA 4U2AA 3UJQA 1HQLA 1VLNA 2DU0A 2DVFA 3LCPA 3OGGA 3TAYA 1AXYA 1S0DA 3ZSKA 4YW2A 1FNYA 3HMYA 3T2TA 1UL9A 4YGCA 2GDFA 1MS8A 3LSDA 4C1WA 4DRVA 2AH2A 1VAVA 2A5ZA 4FPHA 1VAMA 2P3JA 4YW1A 5T55A 3OBRA 4YZ3A 1SLIA 1LTEA 3ASIA 1DZQA 2UWBA 1MS3A 4Q2FA 5DZEA 5GZGA 4YG6A 2YV8A 1LOFC 2D6LX 4FPCA 1LOBA 4FQ4A 1LESA 3R4SA 1G9FA 2BQPA 4YZ1A 4XIOA 5DUWA 2AUYA 4D69A 3WDWA 1JN2P 1AJOA 2ZA9A 3AJYA 1ULFA 3AXDA 3ZXJA 1LEMA 4DS0A 2V5YA 4M3CB 5H9PA 1TEIA 5F5QA 2ZZJA 3AYEA 1FNZA 3N36A 2UURA 4UW3A 1QNWA 2PHUA 1SLTA 4FOYA 4DFSA 4F83A 2GMPA 1YXWA 1WD4A 1MACA 2CYFA 2D43A 3SH3A 3WCRA 3OJBA 4R9DA 3VV1A 4JRAA 2GMEA 3AJZA 3ILRA 4XIKA 4DQAA 3ILNA 1MS1A 1QOOA 4LBLA 2JE7A 4FPOB 3PVNA 2DU1A 1CR7A 2ZGKA 3HN1A 4FPGA 1LGBA 1S0IA 1W6QA 4YFWA 1W6MB 2UWCA 1DLLA 5DXDA 3SLIA 3KM5A 1CQ9A 1MS5A 1A78A 2ZGTA 2R1DA 5DG1A 4BMEA 4XJWA 2A6VA 1LULA 2SBAA 5EXOA 1ONAA 2VXRA 4FP2A 2EALA 4WVVA 3A4UA 5T50A 4GKXA 1ULGA 4YGDA 4GXLA 1AXZA 2C9AA 3WDTA 3ZXFA 3SH4A 3WDYA 3VKFC 3ZXEA 1G9DA 1C1FA 1YIFA 2W08A 2ZGQA 5T5JA 2OW4A 3R4UA 1W6NA 4YGBA 3RRDA 1MVEA 1I1EA 5T5LA 2JECA 3RSJA 1NXD1 4C1XA 5CBLA 3FLRA 5T5OA 1QDOA 2D6NA 1SBEA 2D6KA 3M1HA 3M3OA 3USUA 4FPFA 2E53A 3N7KA 1MS4A 5IT6A 1SLBA 1ENRA 4K20A 2GNDA 2TEPA 3QLQA 5JOXA 2GN3A 3V0AA 4LBKA 4RL7A 1FYUA 3WG4A 1MZ5A 5GJ6A 4YW3A 1SLAA 4AGRA 2EXIA 5E89A 1JYIA 4Y20B 2ARXA 1GZCA 2R16A 1QDCA 3AP4A 3Q9OA 1DQ1A 2A70A 3MW3A 1SLLA 1ULDA 2GNTA 4JC1A 4ATFA 4BMBA 3AZZA 2GNMA 1UPSA 4GALA 1CJPA 4XZPA 1BQPA 5KXBA 1C4RA 4LBNA 2UWAA 3N7JA 4FPJA 5DZGA 2NP0A 3APBA 1CIWA 1GZWB 2LTNA 2WT0A 4XJZA 5JOZA 1YO8A 1WCSA 2ZGSA 1DYPA 4K21A 4YW5A 5KXEA 5JVVA 2E6VA 2LALA 3MW2A 3V64A 3RMXA 1KJLA 3IM0A 2PELA 4Y1YA 2DURA 2WLQA 4YZ4A 5H9RA 1LGCA 4Q27A 1LHWA 4ZKTB 2DTWA 2NYYA 3B3QE 4FOVA 4MYEA 4FVVA 5SV8A 3V0AB 3RG0A 5E88A 2H0BA 1EPWA 2YROA 2A6ZA 2JDZA 1YYNA 3D6EA 2CNAA 3IN9A 1LOAA 1PZ7A 2DVAA 2PHXA 1FAYA 3JU9A 4K1YA 5EWSA 1S1AA 2OUJA 3D5OA 4BLJA 3GALA 1FATA 1GKBA 1OKQA 3UJOA 3PMEA 1W6NB 3AXEA 3R05A 1IS5A 3C2UA 2P3IA 3WDUA 1N1VA 3L2YA 2AGSA 2WKKA 3NV2A 2GNBA 2YZ4A 2W39A 1W0PA 3OY8B 2ARBA 1Q8VA 1G9CA 1GSLA 2OUHA 5JOWA 3NV3A 2ZACA 3A0KA 4XDQA 3BODA 2DTYA 1CONA 3ILFA 4GWNA 3WG1A 3ZSLA 3O5SA 1LHNA 2VUAA 2A3YA 2E51A 3VKOA 2I2SA 4XJ9A 4HANA 1FX5A 1DYKA 4PCRA 4UW5A 4Y20A 4LBQD 4JCKA 5JMCA 3IKWA 4AYUA 3POSA 4XTMA 2NM1A 3I8TA 4YM2A 3HR9A 5EYYA 3WHTA 2GALA 2NMNA 4FPYA 1VALA 1HKDA 3VKNA 4R9AA 3WG2A 2VW2A 2WT1A 4YW4A 1URXA 4XOGA 1IKPA 4XXAA 5IUQA 4GWMA 5AVAA 5KXCA 3MPPG 4LBMA 4XTPA 1Z78A 2YY1A 3ZSJA 5IK4A 1JXNA 3TB0A 2A6XA 2R1BA 1MR5A 4PQ9A 3OBTA 5DUXA 3VKLA 3RMYA 3W58A 5F9TA 1ENSA 3FUOA 3PVOA 1CPMA 3RQ0A 1DBNA 2D6PA 1CVNA 4WZFA 4FP3A 1UKGA 1W6PB 1WUVA 3WDVA 4M01A 2WT2A 4M00A 1LOGA 1LU2A 1LECA 1Y7BA 3ZPYA 1DQ6A 2YMZA 4GKYA 2EXKA 3WUDA 4K1ZA 4XE9A 5GM0A 5GLUA 5JLVA 5H9QA 1QU0A 1IS4A 3SH5A 3T1LA 2ZMNA 1LOFA 4Q1RA 1UMZA 4Q1PA 4YGEA 2YXSA 2XG3A 1AX1A 4YZ2A 5E8AA 5DG2A 1QKQA 3FUQA 3QCWA 3AX4A 4BPZA 2D3PA 1N3PA 1GZWA 3WNXA 5HCAA 2XB6C 4FPEA 2ZABA 4H55A 2PHWA 2AENA 4BM8A 4DRRA 1Q8OA 1AX2A 1H9PA 2DV9A 4TYSA 2EXJA 3O12A 5IK8A 1S0JA 4M3CE 4Z8BA 1Q8QA 2DUOA 3ATGA 3M3EA 3WHUA 1G86A 1H9WA 1AZDA 1HDKA 1HQWA 4ATEA 1KDKA 1UAIA 4AGGA 1GLHA 2EAKA 2Z42A 2WNEA 4FPLA 4AWDA 3IPVA 4WVWA 4YG0A 1UN1A 2KM2A 1LENA 3O0XA 4NOTA 4P14A 2ENRA 3IMNA 4UW6A 2VY0A 5FRAA 1V6OA 4AVSA 2D3SA 3LSEA 2ZMLA 4AGVA 2UU8A 3AYAA 3I4IA 4GA9A 1DFQA 5BYNA 1WBLA 1WW6A 3JUUA 1GBGA 2CL2A 1MVQA 1X50A 3BTAA 2GMMA 4BQ1A 1QNYA 1WW7A 2JJ6A 4ISQA 5CB7A 3FBYA 1AX0A 1V6IA 2P3KA 3KQRA 5T52A 2CY6A 1W6QB 3FLTA 4PBPA 1F5FA 3WG3A 3O0VA 2A71A 3AK0A 4UW4A 1V6NA 1PZ9A 2G4IA 3U4XA 1XQNA 1UZZA 2CTVA 2ZMKA 1DIWA 1JOJA 1AVBA 3MW4A 2A75A 4CRQA 3AP7A 4Q8KA 1U0AA 5GZCA 3N35A 1CN1A 1ULEA 5L73A 1DQ5A 1FV3A 3NV4A 2AYHA 1LODA 2WSUA 3OYWA 4XILA 5DZFA 5T5PA 1KRIA 3WVJA 1ZA4A 4Y1UA 2DYCA 1V6JA 3M3QA 2R0FA 2W52A 3WLUA 1G9AA 5GLTA 1G9BA 1J1TA 1LHUA 1GNHA 4FQZA 4ZXKA 1QMJA 1AXKA 3OPZA 2ZHNA 3FFZA 3WZ1A 4DPNA 2CWMA 1IOAA 3N7MA 2GN7A 1LGNA 2DUQA 4Y22A 5FREA 2D3RA 1SCRA 1WLDA 2C5DA 3AZXA 2R49A 2ZHKA 1YRZA 4XHBA 4WV8A 4M3CA 5JDBA 4YLZA 5GZEA 2ZGUA 1Q8PA 3AYCA 3GNEA 4XJ8A 4Q26A 2VW1A 2HYKA 3ZYPA 1WLWA 3W59A 1BJQA 4PBOA 3T1MA 1F9KA 3ZXKA
chains in the Genus database with same CATH superfamily
1SFYA 1ZYBA 1BK0A 2ZKNA 2TNFA 3ZYHA 2YC4A 5I0DA 1LU1A 4XBQA 3NAPC 3M8LA 1MEC2 1H30A 1XNKA 4PF1A 3AZVA 5FZHA 1HW5A 2WFF1 3AMNA 1UYYA 5JXJA 2WLPA 4R9BA 5G05L 2OVUA 1OA3A 2Y6LA 5FLJA 1AF9A 1CESA 1W9TA 4MX3A 1N47A 4QPIC 3WUCA 2A3XA 2QQOA 3K51A 4L0PA 3ZIXA 4DUWA 5K0UB 1UD1A 4AR2A 3K3NA 3LA3A 3LFIA 3THCA 4AHYA 2B46X 4N43B 3DYMA 3W5MA 2QFEA 2VNRA 4CUBA 1O4ZA 1PGW1 1D4M1 2RDQA 1DYOA 2E7QA 4FT8A 1X8EA 4IE7A 4CEWB 2G19A 3MEPA 1LOCA 1DHKB 3ACLA 2RS12 3A0NA 3NO8A 4K6BA 4FTBA 1GWKA 3HD8B 4KH9A 2BERA 3RDIA 3H8XA 4ITCA 4NO4A 3VL8A 2VJXA 5EP9A 5FV3A 4FOWA 4LE3A 3MV01 4MVTA 5DUUA 4KU8A 1FOD2 3USUB 3ZYIB 2CGPA 3KD4A 4XJAA 5DAPA 2ZHLA 2R7EB 2VECA 1PK6A 4XJUA 4CTEA 2VUJA 1F2NA 3DPRB 4I09A 5FFOC 5FO7B 5IVYA 5L19A 1HN0A 5DQ0A 2RV9A 2ZOEB 1VRH3 2VUCA 5L9BA 2LM3A 1JYCA 1YJKA 3VBOC 4ASMB 3UNPA 1G8WA 4CDQB 1BKZA 1OF4A 4B7EA 5FZAA 3IPVB 4IEYA 5FZ4A 3I54A 3POWA 1BYHA 4FXGB 2Q5TA 2VU9A 4KBBA 4GULA 1JZ4A 1W6OB 2D98A 2W68A 2BWCA 3A22A 2WSVA 2JG9C 5DN2A 2ET1A 5A6QA 3VD4A 1VBA1 2BUKA 2FMDA 5A3NA 2I45A 4J6GA 4H14A 4R8HA 1FMD2 1DG6A 1OLRA 2VGDA 2YYOA 3NWKA 5FLIA 5LA2A 2K9ZA 3POFA 3ENRA 1VB2A 3VBRB 3DGTA 4HPKA 4XYXA 4CDWA 4CUCA 5FY0A 5IFTA 1PK6C 3AP9A 3H1WA 1O4TA 5TSWA 4C0HA 4Z92B 2XKOA 4OI4A 2QQVA 3PU3A 1O3QA 4DEVA 4B4PA 3C7FA 1N1YA 3CJXA 1SLCA 1N1SA 2F4LA 2P17A 4GJYA 4AEKA 3HWJA 3BUCA 2WS93 5J48A 4CCMA 4XVHA 1O8SA 1VBB3 4UBHA 1YCIA 3VBRA 1W6PA 3EXUA 1SBFA 1W28A 5GALA 1BLZA 1V6MA 1AR93 1CAVB 1NLSA 1KITA 4QX5A 3LEMA 2Q4SA 1VBC2 5BY5A 5CISA 2C24A 1AL23 5F3IA 4DIQA 1GICA 5FXWA 4MH0E 4XUNA 3THPA 1LJ7A 3ZOIA 1YI7A 3E6DA 5CNAA 1UW8A 5FYUA 3TN92 3VZKA 4AVTA 4AF9A 4NPMA 3UGFA 5IVVA 1C8M2 1I5PA 3ECQA 5FP7A 1VMHA 4QHBA 5FZEA 1HRI2 5DAQA 4XZUG 5FZCA 2QQNA 2AR6A 4P9YA 2W87A 1ND3C 2D6MA 3H50A 4BQXA 3VBFC 4FO9A 1RUC1 1S4CA 4YM3A 1RUG3 2ILMA 3WOGA 3RJ2X 3SITA 3V65A 2BFUS 2YG0A 5J96B 2HBTA 2OA2A 4RSUA 5T54A 4EJRA 2D6OX 2A3WA 2QQJA 3CQOA 1GZTA 4JAAA 2HEWF 2WO7A 3AMMA 3KV9A 3OUHA 4HOOA 4RN5A 1NE4A 1RUC3 2ZKLA 3VZOA 3GBGA 4WVZA 4YG3A 4EN7B 4QQPA 3KQ4B 4YZ5A 3U07A 4IQPA 3JD71 4PI2A 1R092 3MI8A 3TNQA 1JH5A 4WM7C 4X6RB 1JBCA 1RIRA 2BJSA 4I0WB 3VKMA 3AZYA 1MZ6A 3AFKA 4ZPIA 4BIFA 5C8CA 2Q8EA 3K4ZA 4FPKA 4ES9A 2ZGMA 1AR82 3CL1A 2HJIA 3OUJA 4IV3B 1LOEA 2ERFA 1AR91 3UJQA 2VNOA 3H8OA 1PX4A 2DVFA 2H6CA 3OGVA 1S0DA 1RUD1 3G7DA 1O3TA 2WZ8A 4DRVA 3HMYA 4NMIA 1UL9A 2GDFA 3D3AA 2HWC1 2YFZA 2WBKA 4XFIA 2Q8OA 1HB4A 4AI2A 5A33B 1EAH2 2LUWA 1SLIA 4YZ3A 5C9AA 1KEXA 2DBNA 3FBMA 2RS11 3TYJA 3I3BA 4YG6A 5FZ6A 2ZX4A 5FDBA 3WR0A 4C8DA 3RZKA 1UXXX 5BNOC 1G9FA 4YZ1A 2B8MA 3N9NA 2VOKA 4D69A 5K4LA 2XJTA 3WY6A 2Y6JA 2ZA9A 3AXDA 3ZN5A 2OQ6A 5FY9A 2MNGA 5C8WA 2E26A 3CDZB 3CIHA 4DS0A 4Y5TA 5FZDA 4FAGA 5E1RA 4AE2A 3AYEA 1PO22 3UKNA 5A7NA 2Y26A 2UURA 2PHUA 4LTAA 1SLTA 4AFDA 4F83A 4CPBA 2CYFA 2D43A 2RG4A 3RI9A 4R9DA 1VAKA 3EBRA 1QOOA 2WAOA 2XOMA 4CXWA 2JE7A 1J83A 4HPKB 1CR7A 2V4VA 2ZGKA 1QH7A 1SZBA 1K12A 4A42A 2YB7A 1UMHA 1AR62 2UWCA 5A6ZA 1R082 3KM5A 2HWD1 1MS5A 3WW2A 1A78A 2ZGTA 4I3PA 3VBOA 2A6VA 4QB1A 5FUPA 1LULA 3WSOA 1HN1A 2G1MA 2VXRA 2EALA 3IB3A 1PNFA 2HWC3 2YC0A 3A4UA 1OA4A 3C7HA 4QM9A 4LNVA 4NN0A 1OPMA 1ULGA 1ND2C 1HRV3 4QQ2A 2YHJA 2BP6A 1K5MC 4XACA 3ZXFA 2R6QA 3SH4A 1TME2 3VKFC 4QGMA 1W9SA 2XL7A 2XJUA 3ACGA 4E9KA 3HBKA 2VCCA 3LB9A 1NA1A 5C5UA 5HI0A 3Q8BA 4TXWA 3VBRC 4ES8A 1WA4A 1NXD1 3M3IA 2IXHA 3AKQA 4JDMA 1PK6B 1CAWB 5T5OA 2I07B 1QDOA 3ZX7A 5FPBA 2NLRA 1H2LA 3UETA 3GDBA 2ZS6B 4AOCA 2D6KA 3USUA 5FMDA 2E53A 3L2HA 5IT6A 1YC61 1W8NA 1Z7S2 4A7YA 1ZA7A 3ZXGA 5FKCA 2BGOA 3WG4A 2H0VA 4L99A 3JCIA 5GJ6A 1NLQA 4RS5A 4BK5A 2EXIA 5E89A 2NPIA 2QJVA 2J1TA 5L9VA 1GZCA 2R16A 1W06A 2A70A 2BFUL 2JDHA 3MW3A 1ULDA 2PHDA 1PX3A 4N43A 5LASA 3AZZA 4RR3C 4Q4V3 1G6NA 4PIZA 2IVJA 1W8FA 5EPAA 4R4ZA 5ERLA 3ZR5A 2R062 3M70A 4E4DX 3GCXA 1C4RA 5DZGA 2QKDA 3APBA 1CIWA 1US3A 2JDNA 2VZUA 4MHRA 3T0BA 4E4HA 1QJY3 4LA2A 2LTNA 2WT0A 3OG2A 3UESA 3ZFFC 2QQWA 4K21A 5A6XA 3H7JA 5JVVA 4P02B 3VDCA 4CP9B 3CKHA 3RVHA 4K7JA 5AC92 1BBT2 3MHZA 1KJLA 4O9EA 5BNPA 4AEJA 4LK6A 4Y1YA 3V56A 5A1FA 1JYVA 4A45A 2FDIA 2HH9A 4GH4A 1PGL2 5LY2A 1C28A 4YZ4A 2HWF2 5H9RA 2HBUA 2BEOA 1LHWA 5CFCB 4JX0A 3B02A 4OQ9A 1RB8G 3B3QE 1BCXA 5FPXA 1RGSA 3RG0A 4AQ6A 1R1A3 4JGYA 3ZDSA 4CSWA 2H0BA 4HKWA 1HB3A 2A6ZA 2JDZA 5EZWA 3AKPA 4EN8B 1YQCA 4Q4Y2 3IN9A 1BBT1 4AFBA 1PZ7A 2DVAA 2WNOA 2BNMA 3D5OA 1CAWA 1OKOA 3K4DA 1OKQA 5CYYA 4I2OA 1BMV2 3UT0A 1D0GA 3AXEA 3VZJA 3R05A 5F3CA 1IS5A 1T2XA 3WDUA 1UZ0A 4OULA 3LDKA 2AGSA 4HLTA 1H8TC 2RVAA 3Q8FA 5FYCA 2YZ4A 3IWZA 1WLTA 1Z7S3 2W39A 4R4XA 5BUVA 1UZVA 2ARBA 2C0ZA 1Y3TA 1G9CA 1GSLA 2OPWA 2OUHA 4KNCA 4NRQA 4QPIA 2IXLA 1UOJA 1AR73 4QXCA 1NX9A 3NL1A 1VPHA 3ZSLA 5I8TA 2DBIA 3BIEA 2XBO3 4XABA 1VBD3 4TLGA 4XFGA 1C5HA 3PUHA 3VKOA 1HXS1 1Q5OA 4XJ9A 3ETQA 4PCRA 1POQA 1VP6A 3RNSA 3KGZA 1Q3EA 2JEMA 2H6BA 4JCKA 3T08A 3IKWA 3POSA 4XTMA 2CU5A 1ENXA 1GUIA 3HR9A 5F3EA 2GALA 2NMNA 1NYWA 5FOBB 4ORFA 3WG2A 1RUH3 1X33A 3EO6A 4GB33 4QHZA 5K0UC 1R091 4OHZA 1UX7A 4YVSA 2VTXJ 2VCAA 2WYFA 3ACHA 5IUQA 5A3MA 4QKDA 5A3LA 5F5IA 3WNMA 1DF0A 4B7KA 2JG8B 2IXCA 3RYRA 4LBMA 2V5DA 3RZZA 2YDEA 4V1PA 3ZSJA 5FY7A 1QEXA 3FZ3A 3HQXA 2W3JA 2XMLA 3TB0A 1MR5A 3VBUC 3RZMA 1C8M3 3GJBA 1H1AA 3RMYA 4AEMA 1WGPA 3RQ0A 1CPMA 2XKPA 5E16A 3QACA 2MHFA 4FP3A 1JU3A 1UKGA 2YPDA 2FDFA 3NKGA 3H1MA 3WDVA 2VZPA 1NT0A 4HBNA 3QOPA 1VBD1 1LOGA 1NCQA 5FYSA 1J59A 1Y7BA 4A3ZA 2YMZA 3K77A 1W39A 1AR71 4LHLA 1TMF2 5GLUA 4F3JA 3GF6A 5H9QA 3T1LA 2XVGA 1NE6A 2VQTA 2ZMNA 1UXZA 4Q1RA 4Q1PA 2XG3A 3MFAA 5E8AA 4XF3A 3FUQA 3QCWA 3VBFA 5E6HA 4BPZA 2MEV2 4QPGA 1GZWA 4QPWA 3ACIA 2QDRA 1PO21 2ZABA 3S30A 3OPWA 4YNIA 1AX2A 2XLFA 2EXJA 5FIXA 4XFCA 4ZXEA 4M3CE 1ND3A 2RR12 3UYJA 3ATGA 3M3EA 4W6WA 3PUAA 2YC2A 2Y64A 5CVRA 4ATEA 1RMU2 1GLHA 1W0NA 4FPLA 4QXBA 4G3YC 3OEAA 4HSJA 3SCFA 4WM7A 4WVWA 3KCXA 5FCCA 1OLME 3KVBA 4AI0A 4N90A 4NOTA 3E6CC 1PGW2 2WNVB 1D4VB 4LJHA 2D3SA 2ZMLA 4AGVA 2PHLA 3NW4A 3KS7A 1NCRB 1R1A2 1WBLA 1JI6A 3JUUA 4QKFA 4DB5A 3O1MA 4N43C 1REEA 5FXVA 4K8RB 3WP6A 1WW7A 3O1UA 3TEZA 3VHOA 5JI7A 4UFMA 1WCUA 1EYBA 2BNOA 1AX0A 4H3WA 2UY8A 2GH8A 4BZ4A 1EV13 3OF1A 3K2OA 2CY6A 5A7WA 3BU0A 2KA3A 2W91A 1PGSA 3FLTA 3HBZA 1O5LA 2QE3A 3VDBA 4PDWA 4XFAA 3AK0A 5KHGA 4LXLA 1V6NA 1FXZA 1PZ9A 2BOIA 5JCTA 3X29B 3U4XA 1XQNA 1UZZA 4FAHA 2ZMKA 1ND3B 1JOJA 1AVBA 4NRPA 4PJYA 2XWBB 4CRQA 5AFBA 4Q8KA 2XH6A 4SBVA 5BXXA 2G9GA 4ZS3A 4K9SA 2W2IA 4S2GA 1C8NA 3NV4A 2PXJA 5A7SA 2WSUA 5DZFA 3ZN6A 2OXBA 1RUE1 5FPVA 5BPXA 3ZN4A 2WWJA 1PNGA 2QQKA 4QGLA 4QPGB 4Z82A 1V6JA 1FMD1 1YFYA 3VL9A 3WLUA 5GLTA 4NWVA 2GZWA 1REFA 1GNHA 5CKNA 3PU8A 1G9BA 1JODA 5JMOA 5L7OA 1AXKA 1RUH2 2ZHNA 4GB32 4DPNA 5FPLA 2Y6FA 2VO5A 3PJYA 5LATA 3BN6A 5F2SA 2PAEA 1LGNA 2DUQA 1HRV1 1RUF1 1UCXA 1OOPA 5F5CA 4RR3A 1SCRA 2VMCA 3AZXA 1PO11 2R49A 1CX1A 2LW8A 1YRZA 3UGHA 2Y0IA 4IEUA 4WV8A 4QDSA 1E5RA 3ZDVA 1CAUB 1SEFA 4YLZA 3VBSB 3WD5A 1GMMA 3U0ZA 1BEV2 3KHBA 1L7QA 2QTWB 2VW1A 3H42B 3C8XA 1BJQA 2ZCWA 3ME2A 1F9KA 3ZXKA 2F17A 2PAMA 2FHRA 4Y4YA 1YUDA 2JKBA 3NV1A 4R9CA 5CAZA 4QX1A 4ZONA 3AL6A 3DCQA 1WW5A 2F4PA 1VBE2 1OA2A 4CP9A 2DCYA 1TVGA 2R041 4MSVA 1POV3 4CP2A 3WF0A 5IVBA 2ZX3A 1XNBA 1NA1C 1MS9A 4OZXA 1R083 4TSVA 3T2QA 3UL2A 5JZGB 1JYTA 1SQ4A 1UZWA 4WVMB 4B4QA 5JIAA 1L7RA 1STMA 1OC1A 3AFGA 2NMOA 5BNOB 2BBVA 1GYKA 1UZYA 4RFRB 3K3OA 1NCQC 2E7AA 1O4YA 1QJX2 2J42A 3HN3A 4Q4V2 1APNA 4QHOA 2R0HA 4PLNA 4BOWA 1PHMA 3Q8EA 1W9YA 2OYZA 2E31A 4GJZA 4DNYA 3O7OA 1PVC3 2SLIA 4ZHNA 2ETEA 3ZXDA 1FV2A 1MQTC 1CGPA 2QQLA 2ZBJA 3W9AA 1QJX1 2RS13 2GP5A 2BU9A 2RS51 3BALA 5DDJ3 4LBQA 1RXGA 4CU8A 1F35A 2JE8A 5KHJA 4RQPC 5C3QA 2E63A 4ISRA 4JGZA 4RFT0 4UAPA 2RHPA 3BTZA 2LROA 4KGQA 2P6CA 5HXMA 3I59A 1RUD3 2VOVA 1W8WA 5FPUA 4HFSA 2R063 4YM1A 2AZ5A 5K9YA 2DVDA 5I8SA 4KWJA 2XQXA 4JTNA 4OI1A 4ZY9A 2CGOA 1ZVFA 4YFZA 4XBLA 3Q8AA 1CAUA 1YWKA 2GH2A 4OI2A 5I0SA 2EA7A 1KS4A 3O1SA 2OS2A 2X09A 4L8QA 1FI2A 3THTA 5IW0A 1CPNA 2XJQA 2Y33A 1K5MB 3B69A 3KZ4C 4QKNA 1W6MA 3WP3A 4AXOA 2VH9A 5F37A 4XF0A 1JUIA 3VDDA 1G7YA 4W50A 3N7LA 3KV4A 1S0FA 2A6YA 3T3YA 5C9AC 4P00B 5JR7B 1VBD2 1XJAA 5FBJA 1UO9A 2NN8A 5IVCA 2WUHA 3D0SA 3FLPA 1DQ0A 3PVEA 3WQ7A 4GQ7A 2XHKA 4J1WA 5JPMB 4XMAA 2Q1MA 1NQDA 2HWE1 1Q56A 5EYXA 5C3PA 1MS0A 2XJPA 4QX7A 1WD3A 3CNAA 3VDDB 1T6BX 4JKLA 4Y1ZA 5FKBA 5GZDA 3LAGA 4AHWA 3OPTA 5BNPC 5CFDC 1RINA 1WKYA 2ZAAA 5FJHA 2P37A 3NNGA 3KSCA 4BISA 2V4AA 4HXCA 5FZBA 2XLAA 1RUE2 3I2JA 4URTA 5LBCA 2A6WA 4GWJA 2Y6KA 4U36A 1ZZ8A 5EV7A 4NROA 3T09A 3W20A 5GZGA 3OGSA 1C57A 1SACA 5KHIA 1B09A 1NQJA 5L7OC 1W8TA 4KBZA 1QQP3 1UQXA 4N53A 4Q4W2 4G9SB 1QOTA 4Z1VA 3BTYA 1BZWA 2NZ9A 4PIYA 2AREA 5A33A 3M4FA 2ARAA 4Q0PA 1EAH3 1Q8SA 2YBKA 2ZEZA 2VNVA 4NIAA 2RS53 2XPJA 2WO1A 2FCUA 2VM9A 1JHNA 1V00A 2ID4A 2ES3A 1KGYA 4QDQA 4CDUA 1SCSA 1W2TA 3BU7A 1SBDA 4RD7A 2YUEA 1PO23 3NMBA 1JW6A 3OCPA 4LOSA 4D7SA 5GLWA 4JGZC 2HKXA 1COV1 1QGLA 2F6BA 3S7IA 3H3ZA 3J8F2 3SNMA 1S0CA 1XC6A 1UOFA 4YVWB 1DZTA 3HEIA 4BWOA 1HLCA 2XBO2 3BPSA 4QXKA 1SHWB 2DFCA 1CD3G 3LEGA 5ANQA 1NG0A 2RE9A 2ZGLA 2YBPA 3B9CA 3DUIA 4M0HA 4AI9A 4INDA 1H8TB 4YW6A 5A7PA 3JXSA 1HQLA 1VLNA 4AVBA 3GZAA 3TAYA 4LO7A 1VRH1 3SKVA 1AL22 3T2TA 1ZRCA 2VZVA 3H7YA 3FHAA 3N9LA 1RVF1 2AH2A 4IEVA 1VAVA 2RDSA 3A23A 3WX5A 4BB3A 1VAMA 1OT5A 5T55A 5JI9A 5C4WA 4BQWA 2HWB3 2UWBA 3D0JA 1UYPA 4HK9A 4DEQA 1QQP2 3LQCA 2C26A 4MGKE 1PMIA 2W1WA 1LOFC 2R32A 1VJ2A 4Q0UA 1RUH1 4GB31 5DABA 1M06G 4EZ4A 4LKSA 3WDWA 3ZXJA 1XNDA 4CDWC 1HRV2 1RXFA 1YFXA 4EV0A 2XJSA 1RUOA 2G9ZA 2V5YA 1TNRA 4A44A 5APAA 2ZZJA 1ZBE3 3ZFFB 1E5SA 4FTSA 4EN6B 4RHV2 1YXWA 5FP8A 3N9PA 1MQTB 1XYOA 4MHUA 4DINB 5BNNA 4URAA 3VBUB 4LA3A 2O1QA 2OIIA 5J1XA 4IEXA 3ILRA 4XIKA 3N4MA 4MGZE 4DQAA 3C7GA 2X5IA 2BGCA 4FPOB 3PVNA 2DU1A 3JBG2 2VMFA 3NNMA 3HN1A 1LGBA 3AMHA 2WRAA 3UKTA 1I9RA 1NOVA 2XQRA 3PTYA 1W6MB 4YFWA 5DXDA 2BDRA 4FXKB 3T0DA 3MF9A 5K7PA 2VTXA 4F8AA 1EV11 1JOBA 2R1DA 5D8AA 5DG1A 3B5LB 4PLOA 1ONAA 4FP2A 4KMQA 2VZQA 1EV12 1QJU3 3DN7A 1SPPB 1BBT3 2J1VA 2PMWB 5I0TA 3WQ1A 1TME1 2P5BA 5LW9A 4GKXA 3EMRA 3K48A 2Q1FA 2WDBA 4CU9A 1R1A1 3POGA 3VGIA 4GD4A 3WDYA 5CU1A 4HT1T 2W08A 1YIFA 3ZXEA 4YGBA 5T5LA 4KWKA 2E33A 3HIFA 3UKVA 1RMU1 4C1XA 2XDVA 3F2ZA 3M1HA 4LO4B 4DXTA 4FPFA 1EP0A 2B4KA 3N7KA 1MS4A 1SLBA 3AKSA 4JGYB 4K20A 2GNDA 1TE1B 1JYWA 5JOXA 4GMP1 1WMXA 4META 4LBKA 4Q4X2 3WF3A 1FYUA 5A3WA 4N53C 1O5UA 3O1VA 1SLAA 4A6SA 1PM4A 1JYIA 3ZFGB 4Y20B 4DY3A 5BNPB 3J7MA 3J9SA 4TTGA 3KLSA 2GNTA 4ATFA 3CJIC 3LEIA 4QXHA 1TMF1 1GP6A 1NZCA 2O8OA 3C3VA 5FMOL 4AEDA 1OD3A 1CJPA 4JDOA 5BNOA 5KXBA 4LBNA 1ULPA 3GZTB 3BTXA 1IG0A 2NP0A 1V70A 1TNFA 1O8PA 4IERA 4TWTA 4AVAA 5KXEA 1DYPA 1RHI3 2HWF3 1AR72 1ULOA 1QIQA 2LALA 3BPZA 3KGLA 4LULA 1VBE3 1ZBE2 3IM0A 3RMXA 4CDXA 1ZZBA 3E97A 3EJKA 2DURA 2YU2A 1OVPA 2XWJB 1W05A 1ZBE1 4NHXA 3IDCB 1UU4A 2UYAA 4MYEA 4FVVA 5A3TA 1XRUA 2LRPA 5E88A 2ZZQA 1MZFA 3OEBA 2YBSA 1JYXA 2YROA 3LA2A 2X5IC 4D6RA 3D6EA 2CNAA 3H3UA 1LOAA 1LR5A 1AHSA 1KXGA 1PIV3 1QJZA 2B5HA 3JU9A 5KBFA 3WP4A 1LKNA 4YVSB 2VD7A 3MUY1 4P5HA 1ASJ1 2X10A 3UJOA 2PLV3 4ASKA 1V9U2 3C7OA 5A3OA 4B4RA 3OOXA 2XJVA 4E2SA 1N1VA 3AL5A 3L2YA 3IIAA 2WKKA 2GNBA 2JENA 4M4PA 4C90A 4Y5SA 4WZCA 3WNKA 4E4ZA 5LEJA 1D2QA 2ZACA 1OPOA 2P4EA 3BODA 4IGPA 1CONA 2CAVA 3GZUC 3N9OA 5SV5A 3O5SA 3K4AA 3LD8A 1RUJ2 2WZR2 2XBO1 4LT5A 3MUZ1 2A3YA 2HEYF 2XUEA 2I2SA 4BHPA 1NAEA 1UPIA 2HYXA 5IK5A 4KGGA 4XFBA 4E2GA 2VG9A 4LQRA 2WQ4A 4DY5A 2KXLA 3WF1A 1AYN2 4COVA 4UBGA 3I8TA 3N9QA 1Y4WA 4YM2A 5D21A 5ANNA 5EYYA 3WHTA 4DUVA 3DKWA 3RZLA 5BNNB 1VALA 4ET7A 2VQAA 4Y3OA 3QH7A 4XXAA 5FUIA 3VBHA 1GWMA 3B93A 1FT9A 4DXZA 1ZZCA 2YY1A 1UWWA 3NRUA 4L9BA 1JXNA 4D6SA 2RDNA 4BK4A 1YEWA 1MEC1 2YGMA 5DAWA 4LUKA 3MPBA 5LBEA 3VKLA 1ENSA 4CCJA 4BJ0A 5AC91 2D6PA 1ZRDA 4LKFA 2VMEA 1UY3A 1PM7A 3ALQA 3MLKA 4JV4A 4MOAA 1PGL1 5J3UA 2WT2A 4M00A 4BH9A 3WW3A 4QPGC 1LU2A 1O3SA 3DKQA 4GKYA 2EXKA 3WUDA 4K1ZA 4XE9A 4AL9A 1NY71 1QU0A 1IS4A 5I8YA 1JZ3A 3I3DA 1LOFA 1UY4A 1XU2A 4QT6A 4YGEA 2YXSA 1H0BA 1AX1A 3JD73 5LZ6A 2HWE3 2VMGA 4W6XA 2D3PA 5LK7B 5HCAA 3T0AA 4GH4C 3RI8A 4H55A 2PHWA 2E9QA 4UF0B 4XCAA 4BM8A 1Q8OA 1RUJ3 2WZR3 4NAOA 4TYSA 5FZ9A 5FP3A 3VBSC 1KD7A 5LA9A 2VZ1A 3I2FA 5IK8A 2VULA 1ST8A 1Q8QA 2DUOA 3LDRA 1RUG1 1HQWA 5JR2A 5CFDA 4AGGA 4OVEA 3C7EA 1HQNA 3NAPB 5JIUA 3LA7A 3PTRB 4ZU7A 2VMHA 2Q8CA 2HEVF 3A7QA 1UN1A 4OYUA 2DCKA 5CG8A 2RS31 3IMNA 3NNLA 5FRAA 1V6OA 1NA1B 4V2WA 2IFRA 4QPYA 3LSEA 4IEWA 3CZJA 4Y4RA 2UU8A 1SFPA 5FZFA 5A1LA 4BCUA 3AYAA 3I4IA 4P9LA 2R061 3TBDA 3VBHB 2O14A 1GBGA 2CL2A 5KHKA 2DFBA 2GMMA 3VDDC 3T2OA 4BQ1A 1ZZ6A 1HV1A 2C6SA 2VZSA 2WS91 1H1IA 5DAXA 1UMIA 3OBAA 2JDAA 4NPLA 4P08A 1WZXA 1REDA 5CB7A 1V6IA 2OPKA 1UY1A 4D8MA 4LO8A 4KL1A 4MZUA 3OB8A 1JZ5A 4S2FA 1P8JA 3ES1A 5EJ3A 1W6QB 4COZA 3WG3A 1F5FA 3E6BA 3O0VA 1PVXA 1F8VA 1U5YA 4XQ4A 3KVAA 4J25A 2VOXA 2G4IA 1UIKA 4YVWA 5C3RA 5C6CA 1OF3A 2CTVA 3I7DA 3K75B 3MW4A 2A75A 5GZCA 4NIIA 3VBUA 5FLHA 3DPRC 4YYOA 5A1AA 5F1RA 5L73A 4NE9A 4UF0A 4AI1A 2P6HA 4LLFA 4F7ZA 2X5IB 5T5PA 3VDAA 4Y1UA 4MGIE 1E5IA 2GP3A 1G9AA 2KD7A 2YPJA 2J1EA 3OGRA 5G04L 2RM22 4OUMA 2J1RA 5K0UA 4NPRA 4P9IA 4YWAA 4ZXKA 1ZZ7A 3OPZA 3WZ1A 3PNAA 2N7GA 4BA6A 1JYNA 2CWMA 3ZO0B 2IZWA 1J3RA 1U12A 3N7MA 4DO0A 2GN7A 5FPAA 4HMZA 2JG9B 4Y22A 4UFIA 4FSJA 1WLDA 4IUGA 1OFNA 4XHBA 5FY4A 4LHNA 1K5JA 1BVP1 3AYCA 2QBXA 4XJ8A 2HYKA 1HRI1 4HN1A 4QX8A 1WLWA 1GZ9A 4PBOA 2XR4A 4Y33A 4JKKA 2OX0A 1DP0A 1KDMA 3BIWE 5FMBA 4QKBA 4BQYA 1OVSA 3DV8A 4DXSA 1PO12 1IKQA 4LHSA 1H2KA 1S0GA 2A1XA 2IXKA 2VNGA 2WL1A 4DXRA 1IQAA 4C91A 3P5BA 4JQRA 1X36A 5FZ7A 1F31A 1AJKA 1NUKA 2ADEA 4LBQB 2WO3A 1AR92 1PVC2 3CU7A 4CCKA 4LBOA 1K45A 1VR3A 2GAUA 2D44A 3B7MA 4WM8B 1XOYA 3ZSMA 4OLLA 4DOUA 3IZOA 2TBVA 3AP6A 3DXUA 3TWIA 3ACFA 2BBAA 1IS6A 2GC0A 5IK7A 3WNLA 4A7KA 2JD4A 2CGNA 1O3RA 4MGTA 4Y1VA 3PJQA 4CEYA 2RMU2 4CEYB 4Q0SA 5GLZA 4CZSA 5B4XA 1A8DA 1NLRA 3BOPA 2P34A 4RGGA 4X8PA 5F2WA 4AK3A 5FYBA 3LIGA 4QU1A 1NKGA 3MLJA 4XUTA 4A6OA 1RUJ1 2WZR1 3I3MA 1VBA2 2PHFA 2Z4FA 1KRIA 5ABJC 3V0BB 1N1TA 3FJSA 1ND2A 4XETA 3AZWA 1UX6A 4XQWA 1JZ8A 4E8DA 1RC6A 3LE0A 2Q30A 4QQHA 1MZEA 1VBC1 1QF3A 3GCWA 4BE3A 1XSQA 2DVBA 1UF2C 2MEV1 4W65A 1UU6A 2P1BA 1IS3A 4MGSA 4P9GA 1PIV2 3T2PA 2BTVC 2WWSA 1WWYA 4WM7B 5A80A 4NAMA 2IUWA 3AVRA 1QJEA 1QOSA 3U14A 4XHXA 4PF5A 4EE2A 5AFEA 3NJXA 4KU7A 2XXZA 3T30A 5J7MA 3ZVXA 3B00A 5IVEA 2ZHMA 4NHKA 3M3CA 3VUOA 5JUVA 5F6KA 2WFF2 4AHZA 1W3VA 2BPA2 3BOWA 3BGAA 3W21A 5C3SA 2EXHA 1MEC3 3DL3A 5KXDA 4CEWA 4B8EA 1OFSA 2PQQA 4LR4A 4QB2A 4N9HA 2EF6A 1Z0HA 3FFQA 5LBBA 5HV4A 1YNAA 4GZ9A 4XAEA 4BIOA 1V6KA 1UY0A 2ZJCA 2W94A 4I0AA 3I49A 2VBBA 3O14A 3VD7A 4Y24A 1VBA3 2TUNA 3VHRA 4I02A 5FUNA 4CDWB 4B1LA 1BEV1 4M3CF 4CDXC 4PDWB 2J22A 5H9SA 3M7AA 5GLVA 1RHI2 2GSYA 1MPXA 5C3OA 1SFNA 3NJVA 3PVBB 1GV9A 1Y43B 1ALYA 2A73B 4GIQA 3B01A 4QQOA 3RGBA 3SISA 4EYUA 1GQGA 2K46A 3WXPA 1W6OA 3HPNA 3PHMA 2DCTA 5C5TA 2O0OA 2CDPA 1POV1 4XDOA 3VHNA 3RYPA 3N3HA 2R30A 4UOJA 1DQ4A 2GC2A 4YPJA 3O1PA 1GANA 1NCRA 3ZYBA 4XQDA 3POEA 4P5YA 4D94A 4XDPA 2V73A 2E7TA 1GOFA 5HBAA 2YU1A 4NHYA 2JDMA 5EFUA 5LK5A 1FOD1 4IESA 1R1ZA 4LKEA 3DPRA 4UFKA 4BYYA 5IJRA 1ASJ3 4XXPA 1ULCA 1W8UA 4NRMA 3IT8A 2B7YA 3AM2A 1FOD3 2PHRA 2RJLA 1JU4A 1RUI3 1ZM1A 1PO13 3NAPA 4P9XA 5GKAC 4AFMA 3ZN6B 5LEKA 2ZX2A 4P9WA 2CWSA 2D7FA 3BCWA 1DGLA 3VBOB 4AFCA 4LIUA 2DWRA 3INAA 2WIIB 1J1LA 2VCMA 2YGLA 3ELNA 2VE1A 1N3QA 3RJRA 1WBFA 1O91A 2QVSB 4AG4A 2JWPA 1HV0A 2HWF1 2X53S 4OMDA 4U2AA 3ZMNA 3ZSKA 2DU0A 3LCPA 3OGGA 1A8MA 2WFF3 4L92A 5JSPA 4YW2A 1YIPA 2B39A 1FNYA 4Q4W1 4YGCA 4C1WA 5C8CC 1DU3D 1GQPA 4JGYC 2A5ZA 4FPHA 1NZIA 4YW1A 3MO4A 1LTEA 3ASIA 1DZQA 4Z2AA 4LO6B 4N53B 1MS3A 3MIHA 4OCTA 5DZEA 1AYN3 2YV8A 4FCAA 3VBSA 3U75A 1W90A 3H9AA 4FPCA 4Q0QA 2ZXQA 4FQ4A 1BMV1 3MLLA 1ZBA2 2BQPA 2OT7A 3J7NA 1ZRIA 4XIOA 2AUYA 3CJIA 3CJIB 4RR3B 2EICA 1JN2P 2RM21 3AJYA 1ULFA 3LZZA 2GC3A 2HWE2 1JS9A 1LEMA 2J1SA 4M3CB 5IAVA 2HWB2 1FNZA 1KS5A 3N36A 2L9LA 4LITA 5CG9A 1JZ7A 5C33A 3AKRA 3WINE 1QNWA 4FOYA 1VE0A 4DFSA 5FYYA 3TOJA 1WD4A 3GYDA 1CWPA 3J4UH 4HKOA 4OHXA 4PLMA 2XVLA 3SH3A 4CCCA 1XBFA 1NXMA 4FFHA 2ADDA 3OJBA 3KWVA 3VV1A 2XJRA 5ABJB 5CFCC 4KG0A 2PTMA 1IQDC 1XPWA 2FCTA 3GBWA 1W04A 1QJU1 4QX0A 4OHVA 5FYTA 3DYPA 4AEDB 4GMP0 3VHPA 2VZ3A 1W6QA 1AYN1 1DLLA 4CCOA 1CQ9A 3GGLA 4BMEA 4UFLA 4XJWA 4CU7A 1W2AX 2SBAA 5ACA2 4O7XA 4LKDA 1X8MA 3AB0A 3FC0A 4HONA 4WVVA 4OUEA 5JXHA 4JRLA 5A7WB 3MZHA 4ZZ5A 4YGDA 2D5HA 1AXZA 3U37A 4CDQA 2C9AA 1D7PM 3WDTA 5BV6A 2FD8A 3U10A 4W4ZA 3UGGA 4JZRA 4YARA 3I59B 5T5JA 2OW4A 3R4UA 1W6NA 3RPQA 4CE8A 1MVEA 4OUSA 5HPOA 3POIA 4COWA 5CBLA 1W8HA 4BQ2A 3ON7A 4D7TA 1DLCA 1SBEA 1YJLA 3ZPOA 2JKXA 1HB2A 4AAPA 1LAJA 3J26N 2WYSA 4UI9L 3ZIWA 4LLOA 1YFUA 3QLQA 3V0AA 5J36A 2VBPA 4RL7A 4AI8A 1MZ5A 1IHMA 4UFJA 3PUIA 5F6LB 4YW3A 5FZIA 4AGRA 1UY2A 3H3LA 4OHWA 3I2OA 2W1UA 4CDXB 1QDCA 2XGXA 1DQ1A 2WS92 2HWD3 4JC1A 4BMBA 2B9UA 3JBG3 2JDUA 5FXXA 3PL0A 5ABJA 4MXVA 2GNMA 3R4DB 1UPSA 1O7FA 3MYXA 4XURA 4XZPA 1BVVA 3N7JA 3U78A 4M4RA 2JDPA 1GZWB 5JOZA 5FK7A 4Q29A 2VR4A 1YO8A 1WCSA 3FHIB 3DXTA 4PT6A 2X29A 2BOJA 1W3XA 2C9KA 2E6VA 3URFA 2WN3A 3SMHA 1US2A 5BNQA 4QD2A 2PELA 5FZLA 3ZFGA 5DDJ2 4KWLA 3JB4C 4RS5B 2WQ8A 1GU3A 1LGCA 4WBBA 3I2GA 1K5MA 5DPNA 2ZEYA 4ZKTB 1RUG2 5SV8A 3ZM8A 2ZEWA 2GC1A 2BVBA 4O9GA 2XHNA 1XU1A 1OI6A 1EPWA 2FQPA 3LEKA 3VZNA 1YYNA 2ZAHA 3JQWA 4LK7A 5LWBA 3PLQA 1IPJA 4BLJA 2JX9A 5HXVA 3NJZA 5FPZA 1GKBA 3JQXA 3PMSA 2WN2A 3E5UA 4GH4B 1UU5A 1W6NB 2P3YA 3C2UA 2P3IA 3HT2A 4EWEA 3RZHA 1EAH1 3EHKA 3GXUA 1O6UA 1FPN1 2W46A 3L9JT 4LMFA 3ZR6A 5C4WB 3WQ0A 3OY8B 1W0PA 3N9MA 1Q8VA 4CP1A 1UNBA 5JOWA 1AR83 5C8CB 3NKTA 4XDQA 3A0KA 1HJFA 2DTYA 2O8QA 3ILFA 3EB7A 3WG1A 3O1RA 5LB6A 3LF7A 2FDGA 4IE4A 2IXIA 1CZTA 3LPFA 1M4WA 4IV3A 1LHNA 2C1FA 2Q0AA 2OQ7A 1HB1A 2D93A 4HANA 5IATA 2WNVC 4UW5A 2MEV3 4Y20A 1CAXA 3EQEA 4RGKA 1C3HA 1JOPA 4Z2WA 4AYUA 1U5XA 2WA4A 5IHRA 1NCRC 3PUSA 2BZDA 1UYZA 4N8MA 4FPYA 4WM8C 3SKJE 5FO8B 1MQTA 4Q4V1 3VKNA 4R9AA 2VW2A 1OLQA 1ZNPA 4XOGA 1IKPA 1H6XA 1V9U1 4CDUB 4PQQA 4HSLA 4MG2A 1V9U3 5AVAA 4OMCA 3R0RA 1X9TA 2QZ3A 3MPPG 4IV1B 5LBFA 3WW1A 5KXCA 1Z78A 1IGOA 3NJYA 4UFHA 5CADA 5IK4A 2B42B 2R1BA 5A7OA 4PQ9A 2FZ1A 5FZ8A 1GOGA 4B1MA 3W58A 1JUHA 1F4AA 2ATFA 5F9TA 3PVOA 4Q4Y3 1DBNA 2EIBA 4E8CA 3RZGA 1CVNA 4HKLA 4UYBA 4WZFA 4J1XA 2ORXA 3FL7A 2XLGA 3K46A 5AVPA 1W6PB 1WUVA 4K40A 3RFRA 4M01A 1JHJA 4AEDC 2WINB 2C4XA 2Y0OA 1H2MA 3ZPYA 1DQ6A 4XFHA 3KF3A 1AR81 5LA0A 2DF7A 4IEQA 4IEOA 1VBB1 1UMZA 5AC93 4MUVA 4YZ2A 2ET7A 4IE6A 3ZSEA 2VAUA 5FYHA 1QJFA 1SDWA 3AX4A 1ODNA 3OTFA 1IZ3A 4CCNA 3QH6A 5JSRA 2XB6C 4FPEA 4L2NA 5DDJ1 1ZX5A 5FZ3A 4DRRA 1QJX3 3E1F1 1HRI3 1H9PA 2DV9A 3MFCA 4JTOA 4AW7A 3ZFEA 4IXLA 4A4AA 3O1OA 2R073 1XNCA 5C71A 3O12A 2JB8A 3TN93 4Z07A 4EQVA 5JXIA 4Z8BA 4OI0A 4QMAA 3P6BA 4K3UA 4ONUA 2QUOA 3D82A 3ZYGA 2WNEA 3VD3A 4AWDA 3IPVA 4YG0A 1H4GA 4QX2A 3ZKYA 4NHLA 1COV2 1J84A 2KM2A 1KFXL 1LENA 1W8ZA 4JDNA 3O0XA 2ENRA 4UW6A 4I0BA 2VY0A 5JZGC 3HNMA 3NNJA 5C7GA 4NUBA 2VVDA 3I97A 1DZRA 5FYIA 2XONA 4EWDA 2X8KA 2V09A 1RUD2 3MIEA 4QM8A 4IW3A 5BYNA 3T4HB 4GA9A 1DFQA 2BGPA 1ZBA3 2BYVE 4AZZA 1MVQA 4CCLA 3KT7A 4BQ3A 3JD72 1QNYA 2JJ6A 4PDWC 4XF9A 4YW7A 1CX4A 2QQUA 5KHHA 4CEYC 1YQ6A 2Y38A 1H6YA 1DGWX 3FBYA 5CEHA 3JBG1 2EIEA 1WCKA 5T52A 1HJGA 1WMEA 1TZOA 3NSTA 1WA6X 4IEPA 5FZOB 2PLV1 1CAXB 4A7ZA 1OUXA 2JIGA 4UW4A 4OFGA 1GOHA 2VPVA 5FOJB 2DDUA 3LPGA 1DIWA 2BVVA 3WEZA 4HG6B 2WNUA 1JMUB 1U0AA 4HETA 1CN1A 4E27A 1D4M3 4WVMA 3WNNA 2CSGA 1DQ5A 2VMIA 4MO3M 1ZRRA 4V2VA 1FV3A 2HLEA 1SG3A 1JTZX 1QXJA 4XILA 3S6PA 3EYPA 2NQYA 4AQ2A 4RHV1 4LOTA 1OOPC 2FCVA 3LKJA 3MICA 3ZFFA 3M3QA 3OGJA 3RWNA 2RS33 5JXGA 1J1TA 1LHUA 4FQZA 1E57A 4Q4X3 1RUE3 2DCJA 5HV0A 2EIDA 4KI5M 1RHI1 1XB9A 1IOAA 4XUQA 5FY8A 3S57A 5HCHA 1OURA 2D3RA 4COYA 5IAXA 5I0RA 4IE5A 1XYNA 2D40A 1IPSA 2JIJA 4QDRA 3GNEA 3I2IA 4Q26A 3ZYPA 2WNUC 3I2HA 3T1MA 5C9AB 1OQEA 4Y26A 3H0OA 2VQ0A 4ZU5A 4EN0A 5KC5A 3D4KA 1DQ2A 5FZ1A 2BRTA 3AMPA 5FZMA 4SLIA 2P2KA 4LORA 2ZGNA 5A70A 1W03A 2JG9A 4Y22B 3H8UA 4Q8LA 5ACA3 5IVJA 1V6LA 2K0GA 1LRHA 3AP5A 1AR63 1RITA 3OYWB 1RYYA 3WDXA 2IFWA 4CCEA 1HIXA 1WCQA 4YM0A 2RJ2A 3I3EA 2PLV2 4D0QA 3QD6A 1K42A 1S0BA 3SCHA 4LBJA 4EWAA 5JAXA 4I30A 1A3KA 1RL3A 3A21A 5FR3A 4UWDA 4KWUA 4QX3A 1ENQA 1T6GC 5D1IA 1B35B 4FFGA 5FYZA 5FQ0B 1TME3 4NHMA 3WCSA 1W0OA 4C0BA 1LHOA 4HL0A 5EIYB 4NWWA 3WNPA 3WW4A 5IFPA 4TZDA 3BVCA 2VCBA 3AYDA 4KQ7A 1OH4A 5FMCA 3ST7A 3TRSB 5FO9B 1KJRA 2BW8A 5A3UA 5LCWL 4OHYA 1RVF2 3IAQA 4FFFA 3LIHA 3OY8A 5T3NA 5B4NA 4YRDA 1HX6A 2Z69A 3OD4A 4QQLA 1JZ2A 4S2HA 2RMU3 3MIDA 2VC9A 4A3XA 3USSA 2EAAA 3U11A 2WQZC 5F3GA 4Q4W3 3RS6A 4N7IA 5IWFA 1KQRA 3POYA 1GNYA 3U1XA 1D4M2 2EIGA 4JGZB 5FXZA 2KR2A 1VIWB 2Y34A 4GAZA 3J8F1 2UY9A 4OZOA 3ZYRA 2HWD2 4YVWC 3ZKUA 1CAVA 1RJ8A 2OZ6A 2QQIA 1WW4A 4FOQA 4RHV3 2JE9A 4CU6A 1DCSA 2DVGA 1VMFA 2AC1A 5DUVA 1V0AA 3WQBA 2Y6GA 1BXHA 1C8M1 3S7EA 4IETA 1N3OA 5FZKA 1S0EA 1XXNA 2W9XA 2E32A 1RUNA 5J98B 1VBB2 1LEDA 3PUQA 1RTVA 1QWRA 2GU9A 2VVFA 5CKQA 4AVCA 2G9FA 4CA9A 3LWCA 1S55A 2DCZA 4CUGA 2ZGRA 1F4HA 1LHVA 1H1MA 2W5FA 2ZGOA 4BU2A 5JOYA 1DDLA 1R093 3SQOA 1PMJX 4IL7A 1I3HA 1XYPA 4MXWA 4MXWB 4DMIA 4WM8A 2HWB1 4M0NA 3BI3A 2RJKA 1F15A 3AKTA 3NVCA 1WMFA 1RVF3 1VRBA 1YQ2A 3WV6A 3FMGA 1D0HA 1OBNA 2JB4A 2PHTA 3VZLA 3UV9A 4XMIA 1ZBA1 2VW0A 4LEJA 4R52A 3UK9A 5D8AC 4ZZ8A 5GZFA 1HXS3 1Y9MA 2DUPA 5L9RA 4BLIA 3GHNA 3WF2A 1VBE1 2WJSA 5M0TA 3GHMA 1NCQB 2BNNA 2MPFA 2D97A 2ZGPA 2YFUA 3KT4A 1LCLA 1S2EA 5FZ0A 3TNPB 3HQRA 3ZXLA 3P3PA 4JKMA 3KHCA 2CHHA 1D2SA 5HCBA 3JZVA 1K3IA 4D3WA 5CA6A 1Z7S1 4A2UA 2VTFA 4NIDA 3V0BA 3ZYJB 4TLFA 5FK8A 3CMGA 3CO2A 2VQUA 1JZ6A 2PQSA 3FHQA 3PURA 4HK8A 5L36A 2A7AA 3VZMA 4RS5C 5F8PA 5HCFA 5FBZA 4AI3A 4ARXA 4XBNA 1RUF2 4IGOA 4Y1XA 4AVVA 3O0WA 1KFUL 2VOTA 4RQPB 3PIJA 1X82A 4I01A 3WP5A 4RA0A 3ES4A 3SC7X 4PI0A 4N7UA 1WLCA 1ASJ2 1AYM1 1C1LA 1XE7A 4I3GA 2K2SA 4BXFA 3MGUA 5D2AA 1OQ1A 3HNYM 3IDAA 1S2BA 3DEMA 1YQ5A 2Y8KA 2Y6HA 3M2MA 1GNZA 5A7QA 3TEXA 3IIIA 1OLMA 3LOIA 1PZ8A 4GWIA 4E4SA 1AR61 4LIVA 5C4WC 1H2NA 1EUUA 4X8NA 5FWEA 1QJU2 3NNFA 1AXYA 3F95A 1VBC3 2WR9A 3CHXA 4Q4Y1 2AEZA 1UOGA 3P3NA 1MS8A 3LSDA 4XCBA 5JZGA 1YHFA 1UOBA 2VZRA 2P3JA 5FYMA 2X05A 3OBRA 1OXCA 1U5ZA 4XF1A 1ZREA 1EUTA 1AL0G 1EY2A 4LE4A 3MDPA 2Q1ZB 4LPLA 4Q2FA 1EPZA 3WT3A 2D6LX 4FTEA 1LOBA 2J1UA 1J58A 4LUMA 4XUOA 1LESA 1WCDJ 3R4SA 3RZJA 2BWAA 5DUWA 2FDJA 2JD9A 4N9IA 1AJOA 1ZZ9A 3PDQA 1ACCA 3VB9A 5JWPA 1OQDA 1A6CA 2CAUA 3BYWA 5CFDB 5H9PA 3GJAA 1TEIA 5F5QA 5F7UA 5CKMA 1RUI2 2AACA 4CDUC 1OUSA 4Q4X1 4CCDA 4CEWC 5CFCA 5DMYA 1CIYA 3D8CA 1WMDA 3KV5A 4UW3A 4IV1C 5KR7A 2PAKA 2UYBA 2GMPA 1MACA 1DGRN 5L7OB 1RJ7A 3ZYFA 2RR11 4FI9A 3WCRA 3CF6E 4IE0A 3POJA 1OMIA 4HN0A 4JRAA 2GMEA 3AJZA 4Q5OA 3VBFB 3P1IA 1LNSA 3ILNA 1MS1A 4ZS2A 2JICA 4LBLA 5FY5A 4D7YA 2QNKA 4B29A 3WNOA 2J1AA 4FPGA 5DAVA 3I2DA 3E5XA 5C70A 4MLOA 1S0IA 3ABZA 3SLIA 2PFWA 3U4SA 4CDQC 1E5HA 4JHZA 5FY1A 4YVSC 2OZJA 4UT5A 5CIRA 1BK1A 5EXOA 2WO2A 3LDBA 3GZEA 1HXS2 5F32A 4EROA 4HVQA 2WAAA 5T50A 5IYYA 3G6JB 5B2GB 5JPNB 3THDA 4BDVB 1Y9QA 4RQPA 4GXLA 2Z79A 4COUA 5A3PA 1G9DA 1C1FA 2WFPA 1YQ8A 2ZGQA 3FX3A 3RRDA 2VBDA 4NIGA 1I1EA 2JECA 3IMMA 3RSJA 2VXJA 4MGYE 2LS6A 4IEZA 3POBA 3VD5A 3FLRA 2WC2A 4O65A 1H8VA 2D6NA 1R081 3M3OA 3S5AA 5EJ1B 1SMVA 1COV3 2WNVA 2WZEA 1ENRA 3QBQA 2ZX0A 2B9VA 1TQ5A 4UXAA 2TEPA 4TN7A 3J7HA 5FP4A 2GN3A 1CJDA 1PMHX 2W0XA 5J37A 3KCYA 2VOWA 2IXJA 3TN91 4NJ4A 3S0MA 1B35A 2R071 5A6YA 2IC1A 1VB4A 3AMQA 5BNNC 2Z2SB 1S2KA 2ARXA 5FAXA 5K8SA 1XNTA 3AP4A 3Q9OA 3VD9A 5D8AB 1SLLA 1XNAA 4ARYA 3AC0A 3RWKX 3H1YA 3LOBA 2I74A 4JQTA 1OHFA 2JDYA 4GALA 3ZFEB 1BQPA 3MF6A 3HJRA 1QQP1 2UWAA 4FPJA 4AQTA 4XJZA 4XEZA 4KG8A 3HVDA 2ZGSA 4YW5A 3OBZA 4Q0VA 2Q8DA 3VLBB 1DGWA 4RYDA 3J7LA 2WABA 3MW2A 3V64A 2FZ2A 2Z5WA 4MADA 3SCGA 1FMD3 4EZHA 3DF0A 1FPN2 2WLQA 3DECA 1Q43A 3FE5A 1OH3A 4Q27A 2ZTNA 1XSRA 2DTWA 2XUMA 4XAAA 2NYYA 1ODMA 1W9WA 4FOVA 1C5IA 3V0AB 4ASLA 2W92A 4NIHA 4EN9B 3WF4A 4CXXA 2JDKA 2EVXA 4PHZA 1NY72 3ORJA 2W1QA 4IGQA 4HVOA 3MV11 4IV1A 2VZOA 4K1YA 2PHXA 2JG8A 1FAYA 2B45X 5EWSA 2OUJA 1S1AA 3Q8CA 3FWEA 3GALA 4HZFA 1J3QA 1FATA 2ORZA 3ZMOA 5ISLA 1VMJA 1QXPA 2AEYA 3PMEA 2VVEA 2VL4A 1OSGA 3SEEA 3I2KA 3OSDA 5FZGA 4Y5Z0 4IDZA 4QB6A 1L7LA 1ND2B 3NV2A 4JVAA 4IV3C 4AFAA 4B3NA 3GM8A 4XPVA 1SPPA 3TEYA 3IAPA 1F5JA 3NV3A 4BQ5A 1YLLA 5JSOA 1IPKA 4MV2A 4DUXA 3CBNA 1X9PA 2WNUB 4GWNA 4QGNA 4W6YA 2ZEXA 2VUDA 1DGRA 1H8TA 3MIGA 4P9JA 3RYKA 4AHXA 2QQPA 1AL21 2VUAA 2E51A 3NQHA 1FX5A 4HVRA 1DYKA 1QXRA 4LBQD 5EJZB 4BXSV 5JMCA 3LGRA 2RDRA 1RUC2 4G4FA 3VBHC 1AYM2 2NM1A 2W1SA 1FPN3 4RGAA 5LA1A 3KT1A 2ZPXA 3ZFGC 2RM23 3ITQA 2QCSB 1UKRA 3PIGA 1HKDA 2PN5A 2Y60A 4QPIB 5LY1A 2WT1A 5KWRA 4YW4A 5FTTC 5F5AA 1URXA 5I93A 1TG7A 4GWMA 4O61A 4QU2A 2CV6A 1AUYA 5F39A 4QAWA 1CZVA 4XTPA 4E2QA 3TEWA 3OD0A 1PVC1 5LRRA 3AVSA 2A6XA 2FDHA 3OBTA 5FYVA 5DUXA 3ETPA 3FUOA 3E5QA 4AQSA 3OUIA 3ZXAC 4H7LA 1A34A 3SXWA 1QH6A 4A41A 3HNBM 1L3JA 1W9FA 3SEPA 4CUAA 4W8JA 4NR1A 3T4VA 3VN4A 1OOPB 1LECA 3H8RA 2PYTA 4NVPA 5GM0A 4CP0A 4CXYA 5JLVA 3KMHA 2R043 3SH5A 3ROUA 5KC6A 3GBFA 5DG2A 1H4HA 1QKQA 3IBMA 4L11A 4CYDA 3MIBA 4S2DA 2BV4A 4BQ4A 1N3PA 2W47A 3W5NA 2ARCA 4MGQA 5FJKA 3WNXA 1UIJA 4XF4A 5FWJA 1RUI1 3BB6A 1W2OA 2AENA 4OQ8A 2W95A 2XL9A 2WA3A 1S0JA 2V72A 5I0UA 5A32B 2WZPP 1PIV1 1R64A 2HWC2 3WHUA 1G86A 4FFIA 1H9WA 1AZDA 1HDKA 1RUF3 3IDEA 4XFFA 1KDKA 5CZKA 1UAIA 2D5FA 5FZOA 2EAKA 1W99A 2Z42A 2RR13 1UYXA 4QWNA 1ZRFA 1BHGA 1GR3A 1I6XA 1W8OA 3MIFA 4LHKA 1QY4A 4P14A 2XVKA 1CZSA 2R072 4AVSA 3J8F3 1LB2A 1SDDB 5I91A 1VRH2 3B9IA 2QDNA 1W2NA 4H7MA 1WW6A 1BEV3 1GP4A 1X50A 3BTAA 3ZFEC 1GQHA 1XE8A 4FBFA 3MBWA 3KV6A 4XW3A 4AAXA 4DZGA 5IVFA 2RMU1 4ISQA 3KCCA 5FMOS 1B35C 1TMF3 2P3KA 2R042 2OKXA 3KQRA 2JG8C 3HOBA 2FDKA 2FMYA 4PBPA 1J3PA 1Y9GA 2RS32 4CPBD 1XE0A 2A71A 2QQMA 3HQUA 1GFF2 2RS52 1X7NA 5A32A 4CVUA 4GMP3 5FQ0A 3AP7A 2PA7A 5LRSA 3N35A 4ZU4A 3DYOA 1ULEA 1GP5A 3HT1A 3KB5A 1YI9A 1I5ZA 2AYHA 1LODA 2VMDA 2J7MA 2FBEA 3OYWA 2JXAA 3WVJA 1ZA4A 1U5IA 2DYCA 5J09A 1QHDA 4JHTA 1GWLA 2R0FA 2W52A 4LO5B 1RMU3 2CDOA 1POV0 3FN9A 3LFMA 3SHRA 3IDBB 1YFWA 2IWGB 1QMJA 3CLPA 3CZUA 3FFZA 4XUPA 3ZLIA 3BKZA 1IG3A 5FP9A 1AYM3 2IVIB 1OD5A 1QJY1 5FREA 5ACA1 5EQUA 4L97A 2C5DA 3B94A 3S5QA 2ZHKA 4PIXA 4YSFA 1QJY2 4X6QB 4D6QA 4M3CA 4XC9A 2QZ2A 3JB8A 4H2AA 2VZTA 4K8FA 3R6SA 3CEWA 5JDBA 1W2UA 5GZEA 3O1TA 2ZGUA 1Q8PA 2WWUA 3I3QA 5EHDA 2ZX1A 3W59A 3KF5A 3HAGA 1O59A
chains in the Genus database with same CATH topology
1SFYA 1ZYBA 2ZKNA 2TNFA 1LU1A 4XBQA 3NAPC 3M8LA 1MEC2 1H30A 1XNKA 3AZVA 1HW5A 2WFF1 3AMNA 2WLPA 4R9BA 2OVUA 1OA3A 5FLJA 1AF9A 1CESA 4MX3A 3WUCA 1N47A 4QPIC 2A3XA 3ZIXA 3K51A 5K0UB 1UD1A 3LA3A 4AHYA 2B46X 4N43B 2QFEA 2VNRA 1O4ZA 1PGW1 1D4M1 2E7QA 4FT8A 1X8EA 4CEWB 3MEPA 1LOCA 1DHKB 3ACLA 2RS12 3A0NA 3NO8A 4K6BA 4FTBA 3HD8B 4KH9A 3RDIA 4ITCA 4NO4A 3VL8A 4FOWA 4LE3A 4MVTA 5DUUA 4KU8A 1FOD2 3USUB 3ZYIB 2CGPA 3KD4A 4XJAA 2ZHLA 4CTEA 2VECA 1PK6A 4XJUA 2VUJA 1F2NA 3DPRB 4I09A 5FFOC 5FO7B 5L19A 2ZOEB 1VRH3 2LM3A 1JYCA 1YJKA 3VBOC 4ASMB 1G8WA 4CDQB 1BKZA 4B7EA 3IPVB 4IEYA 3I54A 3POWA 1BYHA 4FXGB 2Q5TA 2VU9A 4KBBA 4GULA 1W6OB 2D98A 2W68A 2BWCA 2WSVA 2JG9C 2ET1A 1VBA1 2BUKA 2FMDA 2I45A 4J6GA 4H14A 4R8HA 1FMD2 1DG6A 1OLRA 2VGDA 2YYOA 3NWKA 5FLIA 2K9ZA 3ENRA 1VB2A 3VBRB 3DGTA 4HPKA 4XYXA 4CDWA 1PK6C 3AP9A 3H1WA 1O4TA 5TSWA 4C0HA 4Z92B 2XKOA 4OI4A 1O3QA 4B4PA 1N1YA 3CJXA 1SLCA 1N1SA 4AEKA 2P17A 3HWJA 2WS93 5J48A 1VBB3 4UBHA 1YCIA 3VBRA 1W6PA 3EXUA 1SBFA 5GALA 1V6MA 5BY5A 1AR93 1CAVB 1NLSA 1KITA 4QX5A 2Q4SA 1VBC2 1AL23 1GICA 3THPA 4MH0E 1LJ7A 1YI7A 3E6DA 5CNAA 1UW8A 3TN92 3VZKA 4AVTA 4AF9A 1C8M2 3ECQA 4QHBA 1HRI2 2AR6A 4P9YA 1ND3C 2D6MA 3H50A 3VBFC 4FO9A 1RUC1 4YM3A 1RUG3 2ILMA 3WOGA 3RJ2X 3SITA 3V65A 2BFUS 5J96B 2OA2A 4RSUA 5T54A 4EJRA 2D6OX 2A3WA 4JAAA 2HEWF 3VZOA 3AMMA 1NE4A 1RUC3 2ZKLA 3GBGA 4WVZA 4YG3A 4EN7B 4QQPA 4YZ5A 3U07A 4IQPA 3JD71 1R092 3MI8A 3TNQA 1JH5A 4WM7C 4X6RB 1JBCA 1RIRA 4I0WB 3VKMA 3AZYA 1MZ6A 3AFKA 4BIFA 5C8CA 4FPKA 4ES9A 2ZGMA 1AR82 3CL1A 2HJIA 4IV3B 1LOEA 2ERFA 1AR91 3UJQA 2VNOA 2DVFA 2H6CA 1S0DA 1RUD1 3G7DA 1O3TA 4DRVA 3HMYA 1UL9A 2GDFA 2HWC1 4XFIA 2Q8OA 4AI2A 5A33B 1EAH2 2LUWA 1SLIA 4YZ3A 5C9AA 3FBMA 2RS11 3TYJA 4YG6A 2ZX4A 5FDBA 3WR0A 5BNOC 1G9FA 4YZ1A 2B8MA 2VOKA 4D69A 3WY6A 2XJTA 2ZA9A 3AXDA 3ZN5A 2MNGA 5C8WA 4DS0A 4FAGA 5E1RA 4AE2A 3AYEA 1PO22 3UKNA 2Y26A 2UURA 2PHUA 4LTAA 1SLTA 4AFDA 4F83A 2CYFA 2D43A 3RI9A 4R9DA 1VAKA 3EBRA 1QOOA 2JE7A 4HPKB 1CR7A 2ZGKA 1QH7A 1AR62 2UWCA 1R082 3KM5A 2HWD1 1MS5A 3WW2A 1A78A 2ZGTA 4I3PA 3VBOA 2A6VA 1LULA 2VXRA 2EALA 1PNFA 2HWC3 2YC0A 3A4UA 1OA4A 4QM9A 4LNVA 4NN0A 1OPMA 1ULGA 1ND2C 1HRV3 4QQ2A 2YHJA 1K5MC 3ZXFA 2R6QA 3SH4A 1TME2 3VKFC 4QGMA 2XL7A 2XJUA 4E9KA 5HI0A 3LB9A 1NA1A 3VBRC 4ES8A 1WA4A 1NXD1 3M3IA 2IXHA 3AKQA 4JDMA 1PK6B 1CAWB 5T5OA 2I07B 1QDOA 3ZX7A 2NLRA 1H2LA 2ZS6B 2D6KA 3USUA 2E53A 3L2HA 5IT6A 1Z7S2 4A7YA 3ZXGA 3WG4A 2H0VA 4L99A 3JCIA 5GJ6A 4RS5A 2EXIA 5E89A 2NPIA 2QJVA 1GZCA 2R16A 2A70A 2BFUL 3MW3A 1ULDA 2PHDA 4N43A 3AZZA 4RR3C 4Q4V3 1G6NA 4PIZA 4R4ZA 2R062 3M70A 4E4DX 1C4RA 5DZGA 2QKDA 3APBA 1CIWA 1QJY3 4LA2A 2LTNA 2WT0A 3ZFFC 4K21A 3H7JA 5JVVA 5AC92 4K7JA 1BBT2 1KJLA 4O9EA 5BNPA 4AEJA 4Y1YA 3V56A 4GH4A 1PGL2 1C28A 4YZ4A 2HWF2 5H9RA 2BEOA 1LHWA 5CFCB 1RB8G 3B02A 3B3QE 1BCXA 5FPXA 1RGSA 3RG0A 4AQ6A 1R1A3 4JGYA 3ZDSA 2H0BA 4HKWA 2A6ZA 2JDZA 5EZWA 3AKPA 4EN8B 4Q4Y2 3IN9A 1BBT1 4AFBA 1PZ7A 2DVAA 2BNMA 3D5OA 1CAWA 1OKQA 4I2OA 1BMV2 1D0GA 3AXEA 3VZJA 3R05A 1IS5A 3WDUA 4OULA 2AGSA 4HLTA 1H8TC 2YZ4A 3IWZA 1WLTA 1Z7S3 2W39A 4R4XA 5BUVA 2ARBA 2C0ZA 1Y3TA 1G9CA 1GSLA 2OUHA 4QPIA 4KNCA 2IXLA 1AR73 5I8TA 3NL1A 3ZSLA 2XBO3 1VBD3 4XFGA 1C5HA 3VKOA 1HXS1 1Q5OA 4XJ9A 3ETQA 4PCRA 1VP6A 3RNSA 3KGZA 1Q3EA 2JEMA 2H6BA 4JCKA 3IKWA 3POSA 4XTMA 1ENXA 3HR9A 2GALA 2NMNA 1NYWA 5FOBB 4ORFA 3WG2A 1RUH3 1X33A 3EO6A 4GB33 5K0UC 1R091 4OHZA 5A3LA 4YVSA 5A3MA 5IUQA 1DF0A 4B7KA 2JG8B 2IXCA 3RYRA 4LBMA 3RZZA 2YDEA 4V1PA 3ZSJA 3FZ3A 3HQXA 3TB0A 1MR5A 3VBUC 1C8M3 4AEMA 1H1AA 3RMYA 1WGPA 3RQ0A 1CPMA 2XKPA 5E16A 3QACA 2MHFA 4FP3A 1UKGA 3NKGA 3H1MA 3WDVA 4HBNA 3QOPA 1VBD1 1LOGA 1NCQA 1J59A 1Y7BA 2YMZA 1W39A 1AR71 4LHLA 1TMF2 5GLUA 4F3JA 3GF6A 5H9QA 3T1LA 2XVGA 1NE6A 2ZMNA 4Q1RA 4Q1PA 2XG3A 3MFAA 5E8AA 4XF3A 3FUQA 3QCWA 3VBFA 4BPZA 2MEV2 4QPGA 1GZWA 2QDRA 1PO21 2ZABA 3S30A 4YNIA 1AX2A 2XLFA 2EXJA 4XFCA 4M3CE 1ND3A 2RR12 3ATGA 3M3EA 4W6WA 5CVRA 4ATEA 1RMU2 1GLHA 4FPLA 3SCFA 4G3YC 4HSJA 4WM7A 4WVWA 3KCXA 5FCCA 4AI0A 4N90A 4NOTA 3E6CC 1PGW2 2WNVB 1D4VB 2D3SA 2ZMLA 4AGVA 2PHLA 3NW4A 3KS7A 1NCRB 1R1A2 1WBLA 3JUUA 4DB5A 4N43C 1REEA 3WP6A 1WW7A 3VHOA 5JI7A 1EYBA 2BNOA 1AX0A 4H3WA 2UY8A 2GH8A 4BZ4A 1EV13 3OF1A 2CY6A 2KA3A 3FLTA 1PGSA 3HBZA 1O5LA 2QE3A 4PDWA 4XFAA 3AK0A 5KHGA 1V6NA 1FXZA 1PZ9A 5JCTA 3X29B 3U4XA 1XQNA 1UZZA 4FAHA 2ZMKA 1ND3B 1JOJA 1AVBA 4PJYA 2XWBB 4CRQA 5AFBA 4Q8KA 2XH6A 4SBVA 5BXXA 2G9GA 4K9SA 4S2GA 1C8NA 3NV4A 3ZN6A 1KRIA 2WSUA 5DZFA 5BPXA 1RUE1 3ZN4A 1PNGA 4QGLA 4QPGB 4Z82A 1V6JA 1FMD1 1YFYA 3VL9A 3WLUA 5GLTA 4NWVA 2GZWA 1REFA 1GNHA 1G9BA 5L7OA 1AXKA 1RUH2 2ZHNA 4GB32 4DPNA 3PJYA 2PAEA 1LGNA 2DUQA 1HRV1 1RUF1 1UCXA 1OOPA 4RR3A 1SCRA 3AZXA 1PO11 2R49A 1YRZA 2Y0IA 4IEUA 4WV8A 1CAUB 1SEFA 4YLZA 3VBSB 3WD5A 3U0ZA 1BEV2 2VW1A 2ZCWA 1BJQA 3ME2A 1F9KA 3ZXKA 2PAMA 2FHRA 4Y4YA 1YUDA 2JKBA 3NV1A 4R9CA 5CAZA 1WW5A 2F4PA 1VBE2 1OA2A 2DCYA 2R041 4MSVA 1POV3 4CP2A 2ZX3A 1XNBA 1NA1C 1MS9A 4OZXA 1R083 4TSVA 3UL2A 5JZGB 5IK5A 1SQ4A 4WVMB 4B4QA 5JIAA 5BNOB 2BBVA 3AFGA 2NMOA 1GYKA 1UZYA 1NCQC 2E7AA 1O4YA 1QJX2 4Q4V2 1APNA 2R0HA 4PLNA 4BOWA 1PHMA 2OYZA 4DNYA 3O7OA 1PVC3 2SLIA 2ETEA 3ZXDA 1FV2A 1MQTC 1CGPA 2ZBJA 3W9AA 1QJX1 2RS13 3BALA 2RS51 5DDJ3 4LBQA 5KHJA 4RQPC 2E63A 4ISRA 4JGZA 4RFT0 2RHPA 4KGQA 3I59A 1RUD3 2VOVA 4HFSA 2R063 4YM1A 2AZ5A 5K9YA 2DVDA 5I8SA 4KWJA 4OI1A 4JTNA 2CGOA 1ZVFA 4YFZA 4XBLA 1CAUA 1YWKA 2GH2A 4OI2A 5I0SA 2EA7A 1KS4A 4L8QA 1FI2A 3THTA 1CPNA 2XJQA 3B69A 1K5MB 3KZ4C 1W6MA 3WP3A 4AXOA 2VH9A 4XF0A 1JUIA 3VDDA 1G7YA 3N7LA 1S0FA 2A6YA 5C9AC 5JR7B 1VBD2 2NN8A 3D0SA 3FLPA 1DQ0A 3PVEA 3WQ7A 4GQ7A 2XHKA 4J1WA 5JPMB 4XMAA 2Q1MA 1NQDA 2HWE1 1Q56A 5EYXA 1MS0A 2XJPA 1WD3A 3CNAA 3VDDB 4AHWA 4Y1ZA 5BNPC 5GZDA 5CFDC 3LAGA 1RINA 2ZAAA 2P37A 3KSCA 2XLAA 1RUE2 4URTA 4A7ZA 2A6WA 5EV7A 4U36A 1ZZ8A 1C57A 1SACA 5KHIA 1B09A 1NQJA 5L7OC 1QQP3 4N53A 4Q4W2 4G9SB 1QOTA 4Z1VA 1BZWA 2NZ9A 4PIYA 2AREA 5A33A 3M4FA 4Q0PA 1EAH3 1Q8SA 2RS53 2XPJA 1JHNA 1V00A 2ES3A 4CDUA 1SCSA 3BU7A 1SBDA 4RD7A 2YUEA 1PO23 1JW6A 3OCPA 4D7SA 5GLWA 4JGZC 2HKXA 1COV1 1QGLA 2F6BA 3S7IA 3H3ZA 3J8F2 3SNMA 1S0CA 4YVWB 1DZTA 4BWOA 1HLCA 2XBO2 4QXKA 2DFCA 1CD3G 1NG0A 2RE9A 2ZGLA 3B9CA 3DUIA 4M0HA 4INDA 1H8TB 1HQLA 1VLNA 4AVBA 3GZAA 3TAYA 4LO7A 1VRH1 1AL22 3T2TA 1ZRCA 3H7YA 3WX5A 1RVF1 2AH2A 4IEVA 1VAVA 1VAMA 5T55A 5JI9A 5C4WA 2HWB3 2UWBA 3D0JA 4HK9A 1QQP2 4MGKE 1PMIA 1LOFC 2R32A 1VJ2A 4Q0UA 1RUH1 4GB31 1M06G 3WDWA 3ZXJA 1XNDA 4CDWC 1HRV2 1YFXA 4EV0A 2XJSA 1RUOA 2V5YA 1TNRA 2ZZJA 1ZBE3 3ZFFB 4FTSA 4EN6B 4RHV2 1YXWA 1MQTB 1XYOA 4DINB 5BNNA 3VBUB 4LA3A 2O1QA 2OIIA 4IEXA 3ILRA 4XIKA 3N4MA 4MGZE 4DQAA 2X5IA 2BGCA 4FPOB 3PVNA 2DU1A 3JBG2 3HN1A 1LGBA 3AMHA 3UKTA 1I9RA 1NOVA 3PTYA 4YFWA 1W6MB 5DXDA 4FXKB 3MF9A 5K7PA 4F8AA 1EV11 2R1DA 5DG1A 5D8AA 3B5LB 4PLOA 1ONAA 4FP2A 1EV12 1QJU3 3DN7A 1BBT3 5I0TA 3WQ1A 1TME1 4GKXA 3K48A 1R1A1 3VGIA 3WDYA 5CU1A 4HT1T 2W08A 1YIFA 3ZXEA 4YGBA 5T5LA 4KWKA 3HIFA 3UKVA 4C1XA 1RMU1 3M1HA 4LO4B 4FPFA 1EP0A 3N7KA 1MS4A 1SLBA 3AKSA 4JGYB 4K20A 2GNDA 1TE1B 5JOXA 4GMP1 4Q4X2 4META 4LBKA 1FYUA 4N53C 1O5UA 1SLAA 1JYIA 3ZFGB 4Y20B 4DY3A 5BNPB 3J9SA 3KLSA 2GNTA 4ATFA 3CJIC 1TMF1 1NZCA 2O8OA 3C3VA 5FMOL 4AEDA 4JDOA 1CJPA 5BNOA 5KXBA 4LBNA 2NP0A 3GZTB 1V70A 1TNFA 4IERA 4TWTA 4AVAA 5KXEA 1DYPA 1RHI3 2HWF3 1AR72 2LALA 3BPZA 3KGLA 4LULA 1VBE3 1ZBE2 3IM0A 3RMXA 4CDXA 1ZZBA 3E97A 3EJKA 2DURA 2XWJB 1ZBE1 3IDCB 1UU4A 2UYAA 4MYEA 4FVVA 1XRUA 5E88A 2ZZQA 1MZFA 2YROA 3LA2A 2X5IC 3D6EA 2CNAA 3H3UA 1LOAA 1LR5A 1AHSA 1KXGA 1PIV3 1QJZA 2B5HA 3JU9A 5KBFA 3WP4A 1LKNA 4YVSB 3UJOA 4P5HA 1ASJ1 2PLV3 1V9U2 4B4RA 4E2SA 2XJVA 1N1VA 3L2YA 3IIAA 2WKKA 2GNBA 2JENA 4C90A 4WZCA 4E4ZA 5LEJA 1D2QA 2ZACA 1OPOA 3BODA 1CONA 2CAVA 3GZUC 5SV5A 3O5SA 4LT5A 1RUJ2 2WZR2 2XBO1 2A3YA 2HEYF 2I2SA 4BHPA 1UPIA 4KGGA 4XFBA