3NV2A

Crystal structure of human galectin-9 c-terminal crd in complex with n-acetyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv2A00
3SH3A 1WLCA 4XIOA 1D2SA 3LSDA 3SNMA 1LEMA 1JBCA 4XBNA 4Y20A 5H9QA 1H9WA 2ZGUA 1LGBA 1CQ9A 3M2MA 4P9WA 1KDMA 3SLIA 4XJZA 2D6OX 2JE9A 2ZGRA 1FV2A 3WG2A 5JLVA 2PHXA 3JU9A 1C57A 1G7YA 1LGCA 1N1YA 2EXKA 2GNTA 2YY1A 5T5PA 2ES3A 2VW2A 4FPFA 3OY8B 1UN1A 1W6NB 2DUOA 1WUVA 3VKLA 2DVDA 4XBLA 3O12A 4XILA 2R0HA 2ZGNA 1C4RA 2KM2A 1W6MB 1S0GA 1MR5A 1SLLA 4R9AA 5LK5A 3UJOA 1KRIA 1LOCA 3V0BA 4I30A 4DS0A 3ZXJA 3V0AA 4P9YA 4YZ1A 2C5DA 4YG0A 3ZXFA 2AENA 1BQPA 2D43A 5DUWA 1H9PA 2ERFA 1NLSA 3AZZA 3WDYA 1V6KA 3ILRA 1GYKA 2W68A 4R9BA 3POSA 3M3OA 1JXNA 4GALA 4UW5A 1SLBA 1G9CA 2NMNA 4F83A 1GZ9A 2DYCA 4LBQB 3ZXKA 1AJOA 1LULA 2OUHA 4UW4A 2JJ6A 1SCRA 4DPNA 1NXD1 1W6OB 3T2TA 3RMXA 3ATGA 2G4IA 5DZEA 4BMEA 2YV8A 4LBOA 2ZGSA 3O0WA 2ZGMA 2A7AA 4K1YA 3O0XA 2PELA 3KM5A 5T55A 2UWBA 3AP6A 4XTMA 5JOYA 3APBA 4FPOB 1OKQA 4WV8A 3GNEA 5HCBA 2ZGTA 1SACA 2EIGA 2FMDA 1AX0A 3AXDA 1CVNA 1LOFA 3A4UA 1N1TA 4ITCA 1A8DA 4Y1ZA 5GALA 2E7QA 3HN1A 4YFWA 1QOSA 3FUOA 3L2YA 4PBPA 1SCSA 4XIKA 3RQ0A 3WUDA 4XZPA 1GZWB 1S0BA 5GLUA 4AWDA 1WBFA 2AREA 4LBLA 1SLTA 2FHRA 1JW6A 3WV6A 4Y22B 3B3QE 1FNZA 2UWCA 4Q2FA 1LU1A 2OVUA 2ZA9A 3IMNA 3LSEA 4W65A 5H9SA 1WLDA 2A75A 3FUQA 4YZ5A 1FX5A 1EPWA 3AXEA 3B01A 4XXPA 4Q8KA 1N1VA 3AP5A 3RG0A 1IS6A 1BZWA 5HCFA 5GLVA 4YG6A 4K20A 1FNYA 1RITA 2B7YA 1IS4A 1W6PB 5T50A 1HDKA 3MEPA 3TAYA 3UK9A 3BODA 4Q1PA 4FPLA 3OGGA 3N36A 2D6LX 5H9PA 5IK5A 1G9BA 1DQ5A 1A3KA 2DVGA 1S1AA 3ENRA 1LEDA 1MZ6A 1YXWA 2A6ZA 2EXJA 1QDOA 3ILNA 5JDBA 2ZGKA 5GLWA 4YZ4A 3IKWA 1FATA 1FV3A 4JRAA 5IK4A 5HCAA 5JOZA 1N47A 4BQ1A 5T52A 1MZ5A 5GZGA 5GLTA 4BM8A 2GN7A 3N35A 2WQZC 3R4UA 5GZCA 1G9DA 1HLCA 5GLZA 1DQ2A 4FP3A 1Q8OA 2ENRA 5EWSA 2DUPA 3SH4A 1WCSA 4UW3A 1BKZA 4XJWA 2GMPA 2ZGPA 4YFZA 2VW1A 2VY0A 1RINA 4M3CA 4YW4A 2ZHLA 4HANA 3AFKA 1BYHA 1UMZA 3AP9A 1YI7A 4Q8LA 1SLAA 1QF3A 3I4IA 1AXKA 5DZFA 2CWSA 4P9XA 1GV9A 3FBYA 2WT2A 1GNHA 4KBBA 2DVFA 3D4KA 1DQ1A 1DQ6A 2DV9A 3MPPG 3ZVXA 1LODA 1LU2A 1LOBA 3FLRA 4RA0A 3PJQA 4FVVA 3NV3A 4Y24A 4XMAA 5IT6A 3USUB 1QDCA 4PF5A 2D6MA 3MW2A 3PVNA 3UJQA 4U2AA 2I2SA 1F9KA 4ZXKA 1WW6A 1S0EA 3MW3A 2VXRA 4NO4A 2R16A 2ZMKA 1W6MA 4FPYA 1QNWA 3AP7A 1FYUA 4BLIA 3ZSMA 3UL2A 4Q27A 4M01A 4YGBA 1MVEA 4WZFA 3NV4A 1YIFA 4ASMB 2JD4A 1CESA 4YGDA 1UKGA 1G9AA 4PQ9A 1WLWA 4FPCA 5EXOA 3AZWA 4FOVA 1Q8VA 2TEPA 1V6LA 4LBQA 4BMBA 1LJ7A 5T5OA 1YRZA 1F5FA 1WW7A 3AZXA 4M3CE 4K21A 3IPVB 1LHNA 1AX2A 1UZYA 3ZXLA 1LOEA 1S0CA 1Q8QA 2AGSA 1GBGA 4FOYA 3QLQA 1ULCA 4YG3A 5KXDA 3OYWB 4YM3A 1HQLA 1URXA 1U0AA 4XHBA 1W0OA 4BPZA 1AF9A 2YROA 1AXZA 2UURA 2ZZJA 1TEIA 4YGEA 1SBDA 5DUXA 2CNAA 2R1DA 3R05A 1R1ZA 4TYSA 5GM0A 3WG1A 2OW4A 1GZWA 3FFZA 4YM1A 5JMCA 1VLNA 2P3JA 4CTEA 2AH2A 3OJBA 4AVVA 3WDVA 5IK8A 3M3QA 2A6VA 4Y1XA 1UL9A 2JKBA 4MYEA 3Q9OA 4YZ3A 3WLUA 5CA6A 3ZPYA 1G86A 3SITA 2R1BA 1DYPA 4YW1A 2DTWA 3V0BB 1I3HA 2WT0A 3WG4A 3WNXA 4XXAA 4OZXA 1S0FA 2CWMA 3HMYA 3RSJA 3WDTA 5KXEA 3POYA 3VKOA 4JC1A 2VH9A 2EF6A 2EXIA 2D6PA 2GN3A 4LBJA 5FRAA 1DQ4A 3W59A 2ZGQA 3D5OA 1LHUA 3R4SA 2D3SA 2ZACA 4D69A 1V6IA 2LALA 5T5LA 4ISQA 3ZSJA 3ZSLA 1IKQA 2W52A 4NOTA 4XJ9A 5F5QA 2PHRA 1O4ZA 2WLQA 1I1EA 3O0VA 3ZYPA 4XJ8A 2ZGLA 2A3XA 1CR7A 1LENA 2Z42A 1Z78A 4ATFA 1N3PA 1HKDA 1YYNA 4GXLA 4M3CF 4RL7A 2YZ4A 5DG2A 1IS5A 1B09A 1X50A 4R9CA 4PCRA 2LTNA 4DRVA 2PHTA 4LBMA 3AJYA 3ZYRA 2ZHNA 3AK0A 2D6NA 5L73A 1DBNA 2PHFA 3T1MA 3AYDA 4IQPA 3OBRA 1MS3A 1UX6A 4FPEA 4XE9A 2D44A 1CN1A 1MS0A 1VIWB 1DHKB 4XBQA 1V6MA 1W6QA 2AYHA 5AVAA 1IS3A 1ENRA 5BYNA 3BOPA 4YLZA 1BXHA 5GZEA 2WJSA 1CJPA 2ZHKA 1WW4A 1GANA 2ZAAA 4GWNA 4FQ4A 3FLPA 1RIRA 3M3CA 5T5JA 3USUA 1G9FA 4LBQD 4YW5A 4ZKTB 5IK7A 2ZGOA 3B9CA 2XB6C 1H30A 1LGNA 1DQ0A 2E53A 2C9AA 4FPKA 4YW2A 1ENQA 3RRDA 1GICA 4AVSA 2NZ9A 3N7KA 2NN8A 2ZHMA 3I8TA 1AXYA 1PZ7A 5H9RA 4AGVA 4XHXA 3N7MA 2H0BA 2PHUA 3WDUA 1GSLA 1V6NA 1UZZA 3V64A 1ULGA 2YMZA 4ISRA 1MS5A 4U36A 3V65A 3CNAA 3WUCA 4FOQA 4XJUA 3OY8A 1LHOA 1W6NA 2A71A 1A78A 2RHPA 1VAVA 2P3IA 3POWA 1MS4A 4DRRA 3W58A 2DUQA 2OUJA 2P34A 1C1LA 1V6OA 1WBLA 2JE7A 3PVOA 1JYIA 1Y7BA 2A5ZA 2DVAA 3IPVA 1QOOA 1SBEA 5CB7A 1JOJA 3RS6A 1LHWA 5DUUA 4GA9A 4AYUA 2ZBJA 1KJLA 5SV8A 5KXBA 1KDKA 5DZGA 1GLHA 3AZVA 3AYCA 3OYWA 5CNAA 1AVBA 1N1SA 4M3CB 2D3RA 1LTEA 4Z8BA 4JCKA 1AJKA 3A0NA 2WSUA 3MW4A 4XTPA 1DFQA 5GZDA 1VALA 1MS1A 2P3KA 1Z0HA 1W6OA 3NV1A 4L8QA 3JUUA 1ONAA 2EALA 3WDXA 2CYFA 2E7TA 3SISA 3NV2A 2VUAA 3KQRA 4Q1RA 5E89A 3D6EA 3RMYA 2VU9A 4XDQA 1DYKA 2D7FA 3N7JA 4YGCA 3WCRA 4BLJA 4WVVA 2SBAA 2GNDA 4Y20B 1BJQA 5FREA 1GNZA 5E8AA 2R0FA 4FPJA 2DVBA 1D0HA 2DWRA 2UU8A 3INAA 3WHUA 5JOXA 1ULFA 1WD3A 1SFYA 3ZXEA 3NWKA 4CZSA 1JN2P 1LOFC 1ULEA 2GALA 1YO8A 2WKKA 1LHVA 4K1ZA 1F31A 3H0OA 1V00A 4XYXA 2VW0A 1CIWA 5CAZA 1PZ8A 2NM1A 3HR9A 4Y22A 4YM2A 2ZKNA 5JVVA 3GALA 3PVEA 4DQAA 1W0PA 1SLIA 4LBKA 1MS9A 4AVTA 1CPMA 1FAYA 1S0JA 2EXHA 4FPHA 5DUVA 5CBLA 4Q26A 1LOGA 1JYCA 1UAIA 4PBOA 3TB0A 3V0AB 3ASIA 2GMMA 3BIWE 1W6PA 1GKBA 1AZDA 2E51A 1LCLA 4GKYA 4H55A 1HQWA 2ZABA 5GJ6A 2CY6A 4R9DA 4FQZA 5EYXA 1ULDA 2NYYA 1VAMA 1MS8A 1APNA 2A6YA 1ZM1A 3A0KA 3OBTA 2DURA 2ZMLA 5EYYA 3AP4A 1CPNA 3AJZA 2CL2A 1AX1A 4FP2A 1Q8SA 1SLCA 1CONA 2UWAA 4Y1YA 2E6VA 2ZMNA 2A3WA 1ZA4A 1MACA 1G8WA 3C2UA 3VUOA 1Q56A 3AX4A 4HL0A 4XJAA 2WSVA 3OPZA 1KITA 2WT1A 3PMEA 3DUIA 2A6WA 2D6KA 2V5YA 3O5SA 3ILFA 5DG1A 4DFSA 3AYEA 1QMJA 2GMEA 1ENSA 3M1HA 4C1XA 1QOTA 2V73A 1IKPA 2GNMA 3B69A 4Y1UA 5E88A 1N3OA 3U4XA 2GDFA 1LOAA 3WDWA 2A70A 1JHNA 5F9TA 3IN9A 1QU0A 1UPSA 2WNEA 3QCWA 3BTAA 2P2KA 1SBFA 1QGLA 1MVQA 3WCSA 1LECA 5GZFA 3SH5A 4FOWA 2P37A 3IM0A 4SLIA 4YM0A 4M00A 3VKNA 5DXDA 1DIWA 4BOWA 4P14A 1S0DA 3ZSKA 2W39A 1DZQA 2XG3A 1PZ9A 4AGRA 1V6JA 3VV1A 2JECA 4Y1VA 3T1LA 2AUYA 1J1TA 3N7LA 1C1FA 2BQPA 2JDZA 2SLIA 1LESA 4ATEA 4UW6A 1GZCA 2D3PA 4YW3A 2DTYA 1DGLA 4XOGA 2NP0A 3AZYA 2R49A 2A6XA 2DU1A 5T54A 1O4YA 4WVWA 5KXCA 3WOGA 4XMIA 2A3YA 3WG3A 4LBNA 4AGGA 1QKQA 1IOAA 4TZDA 1KQRA 2Q5TA 4YZ2A 1XQNA 2W08A 2EAKA 2ARXA 1WD4A 3N3HA 4C1WA 3FLTA 1JUIA 5JOWA 2DU0A 2NMOA 5IUQA 3WVJA 1DLLA 4GKXA 3VKFC 2PHWA 3DGTA 1Q8PA 4Y26A 1WW5A 4FPGA 3VKMA 1S0IA 2ARBA 3WZ1A 1OQ1A 2AR6A 1W6QB 4GWMA 3AYAA 2YXSA 1QNYA 3LCPA 3WHTA 2CTVA 1KJRA 2HYKA 3M3EA 4CRQA 1OFSA 1N3QA 3B00A 2GNBA
chains in the Genus database with same CATH superfamily
1NX9A 3ZFFA 3LSDA 1PK6A 1VMFA 1W8NA 3H8RA 3C8XA 1XNAA 5FBJA 4XFFA 3IBMA 2ZGUA 1Q5OA 1LGBA 2R041 2HWF3 4R4XA 5EV7A 3LKJA 2G9ZA 4NHMA 4YVSC 2YC2A 4GULA 2HBTA 4D7TA 1UY0A 2WLPA 4N53B 1CZSA 1ZZ7A 2PHXA 1C57A 1LGCA 1SG3A 2VOXA 3NJYA 3TYJA 4AI2A 5T5PA 5FZ9A 2CGPA 2V09A 3OY8B 3VHOA 4MXVA 2BW8A 2VCCA 4I3GA 3U4SA 2DVDA 3G6JB 3ECQA 4Q0QA 1YQ2A 3MUY1 3C7OA 2KM2A 1U5IA 4XACA 4R9AA 5IFTA 2JDYA 5C8CC 1GP4A 5FZAA 1ZZ9A 2ORXA 3THTA 3V0AA 4IEOA 1CAUA 3MICA 2ZEZA 1HN1A 2C5DA 3ZXJA 3E5UA 4AVBA 1JOBA 2ERFA 3X29B 5FBZA 3CBNA 3P3PA 5BNQA 2CHHA 3CJIB 5C3OA 4B7EA 2W68A 1IGOA 3J7HA 2Q1FA 2LROA 3POSA 4UW5A 5K0UA 2Y6KA 1VBB2 5FJHA 3H8UA 1SDWA 4Q4W1 1AJOA 1V70A 2OUHA 4UW4A 4S2FA 2ZX3A 5BNPA 5LY1A 1YQ6A 3LF7A 2IZWA 4LJHA 4MGTA 3DPRC 2ZGMA 3O0XA 1UY1A 5T55A 4EROA 5IVFA 1UU5A 1RUOA 3FN9A 2NLRA 3Q8EA 5JOYA 1EV11 1OKQA 4CDXB 3P3NA 4IERA 5FZHA 3I2OA 3VBSA 1SACA 2V5DA 3IT8A 4ITCA 1JTZX 4LHKA 1A8DA 4CUGA 1MQTB 1YJKA 2VMEA 4RD7A 1ZX5A 2BFUL 2Q1ZB 4IL7A 4B3NA 1ZBE3 4YFWA 1QOSA 5B2GB 1UQXA 1YQ5A 2ZKLA 3FUOA 3NAPA 4GJZA 1VBA2 3OGVA 5FZ6A 3WUDA 4AAPA 4BQYA 4C91A 4F7ZA 2W47A 4EWEA 5CKNA 4LOTA 4MGSA 1DDLA 4LBLA 1SLTA 5IVYA 4Y22B 4AFDA 4Q2FA 4DNYA 1PX3A 2RR11 4K8RB 5C7GA 1NA1B 2MNGA 1OA4A 3JCIA 5ABJC 4QHBA 2VCMA 3AP5A 3VZNA 4LT5A 4DEVA 4Q0UA 5GLVA 4B1MA 5CFCC 1VBC1 2B7YA 3MEPA 1JZ4A 3OGGA 5FYZA 2D6LX 5IK5A 1DQ5A 2XPJA 4PI0A 3U1XA 2E7AA 3O1VA 4XF9A 3ILNA 1WCUA 4RR3A 2ZGKA 3NNJA 3HQUA 5HCAA 2XJTA 2WS92 2DBIA 4EQVA 2VCBA 5T52A 1MZ5A 2WNUC 3PU8A 5JR7B 4NHLA 3U78A 4BM8A 2GN7A 2VOWA 2WQZC 5I0UA 5CU1A 5FLHA 4KL1A 1LKNA 1XNBA 2DUPA 1BLZA 1T6GC 4HMZA 3SH4A 4JGYC 1BKZA 4KQ7A 3WQBA 3FHIB 2VE1A 2ZGPA 1HXS2 5CG9A 2VW1A 1UYPA 3ITQA 2RS52 5LW9A 1HRV3 2ZHLA 2VQUA 1BYHA 1UW8A 1NCQC 4RS5C 3I3MA 1RUC1 1K3IA 4YRDA 2XJRA 3HJRA 3I7DA 4KBBA 1K42A 2DV9A 3MPPG 3PUSA 5FY7A 2WO3A 4A2UA 5LCWL 4FFGA 1W2NA 4H7MA 4NHXA 4XZUG 2PLV2 4F8AA 1XNCA 1RUJ3 3WP6A 4XAAA 3T2PA 5IYYA 1W9YA 4P9LA 1H4HA 4GD4A 2C26A 3QBQA 5FZGA 4PF5A 4KI5M 2RVAA 4Q4Y3 4XCBA 1NY71 3E6CC 1XU1A 5A7OA 5FMOS 4NO4A 3FHQA 2IUWA 2R16A 4Q29A 1H6YA 2XONA 3ON7A 2MEV1 2DCYA 2ZCWA 5KHKA 1J58A 1QNWA 4GB33 5F6KA 2AEZA 4H3WA 3I3QA 4M01A 5FO7B 3O1SA 2H6CA 3NV4A 3OOXA 5G05L 2JD4A 1CESA 4NMIA 1KS4A 5FIXA 3WX5A 1UKGA 4XDOA 4LO7A 1WLWA 2IXLA 2HKXA 1RUH2 2JDPA 5DDJ3 5C8WA 2VTFA 4E8CA 1H2MA 4AI3A 2RS11 5JXHA 5FYYA 1ZYBA 4HETA 4K21A 1D4M2 4LHSA 1CX1A 2J7MA 1AYN1 3NO8A 1L7RA 1UZYA 2W94A 1ND2C 3TN91 1LOEA 1F2NA 1E5HA 1S0CA 2JB4A 4D6QA 5FWJA 3LA3A 3O7OA 4FOYA 4Q4V3 5D1IA 5IVEA 3T0DA 4YG3A 3SKJE 4QX2A 1HQLA 3AMMA 3OBAA 1JHJA 1REDA 4CDUA 4FCAA 1PIV1 4CDXA 1ZZBA 4XHBA 1W0OA 4BPZA 4JKKA 5FZOB 5G04L 1JODA 2ZEYA 1JYTA 1RUG1 1R093 1TEIA 2J1RA 4CCKA 2LM3A 3AKQA 3VD4A 3AFGA 2TUNA 1OURA 4LK7A 1NQDA 1MEC3 2PFWA 1DGWX 2F4PA 2QQNA 1J1LA 1VLNA 2WFPA 2WWSA 2AH2A 4CDQC 4P00B 4YVSB 2B42B 3THDA 2HWC1 3M3QA 1YEWA 3WDVA 3WLUA 1UL9A 2W1UA 4YZ3A 4FBFA 4UWDA 2R043 4UFJA 1ZVFA 4Q4X1 5ACA3 1NA1A 1XYOA 2R1BA 3CZJA 1RHI2 5BV6A 4EZHA 4XXAA 2VG9A 4GZ9A 3CQOA 4LIVA 4OZXA 2XVKA 4CPBD 4OI0A 4J25A 4XW3A 4QPWA 3WDTA 1PMJX 5BNNB 2VH9A 2EF6A 5I8SA 5IATA 1VBD2 3WQ0A 2D6PA 2X29A 4NWWA 5F39A 4QQLA 4I3PA 4NPRA 3W21A 1CJDA 2ZGQA 3J8F3 4XQWA 1JZ7A 2E33A 2WAOA 2D3SA 4D69A 5K8SA 2LALA 2XOMA 4LNVA 3ZO0B 4IE7A 4HPKA 5I8TA 4HZFA 4KWJA 5AC93 1FI2A 3WNLA 4NOTA 4Q0PA 4OHVA 5JZGC 2YPJA 4RFT0 4CVUA 2DDUA 3DECA 1I1EA 1TVGA 1PO12 3BPSA 2PYTA 1AR62 5LEKA 1IQDC 2ETEA 2Z42A 3TNQA 4BIFA 4FAGA 1H6XA 3KSCA 4HONA 2YZ4A 5DG2A 2FCVA 1BVVA 4E9KA 3K3OA 4COVA 3VZLA 3S5AA 4PCRA 4AQTA 4WM8A 2ZHNA 5J1XA 2Y0IA 4XQDA 1OHFA 1COV1 1XXNA 2HWE1 3GHMA 4A41A 3OBRA 4QKDA 4CP0A 1SFPA 1CN1A 5FMDA 3LOBA 1EV13 1IS3A 1LRHA 3BOPA 4KGGA 3KGZA 2XJPA 3E1F1 1CJPA 3M4FA 1G9FA 1I5PA 4Z82A 3ZFGC 3AC0A 3B9CA 4NWVA 1RUE1 2ILMA 5FO9B 5KHJA 3LFIA 5FZKA 4W4ZA 1GICA 5K7PA 2NZ9A 1YI9A 4NRQA 1JMUB 2X05A 2ORZA 2ZHMA 4BDVB 1S4CA 2YGMA 3I8TA 4D0QA 1PZ7A 5HXMA 1PK6C 1X7NA 5H9RA 4AGVA 3MV01 1V9U2 2D5FA 4ZXEA 4CCDA 2WYSA 2FDGA 1EUUA 5LK7B 2RR13 5L7OB 4U36A 4QGMA 4CCMA 2P3YA 2Y38A 2W1SA 4LLFA 1PMIA 3AKPA 2RHPA 1XE7A 5FP7A 4ES9A 1MS4A 3ALQA 4GMP0 2YBSA 3SHRA 5FPAA 3T2QA 1VBC3 1W8OA 4O7XA 5FZ3A 3WR0A 1C1LA 1V6OA 3VDDC 3PIGA 4OMDA 3JB8A 1EAH2 1S2EA 1NCRB 4NHKA 3Q8FA 3RS6A 1LHWA 2QKDA 3NL1A 5CFDB 3FFQA 2VOKA 4CEWC 3BALA 3WNKA 5A6ZA 4LITA 4S2HA 4KU8A 5A1FA 3O1PA 2XDVA 1AR82 1JYVA 3AZVA 3B93A 3AYCA 3FJSA 1CWPA 4M3CB 2WL1A 3NSTA 4ASLA 5A3MA 2DCZA 1HV1A 3LA7A 5J09A 5FZMA 1UU6A 1VPHA 3KVBA 3PUQA 2YUEA 5FZOA 4AL9A 1VALA 1HB3A 4LO5B 4MVTA 4CU6A 5K0UC 1RXFA 4L8QA 1ONAA 5LA9A 1DGRN 4IV3B 3ZMNA 4RS5B 1YCIA 2GU9A 1YIPA 2Q8DA 2E7TA 5D2AA 4Q1RA 3UKNA 4DUVA 3PTRB 3PUAA 2N7GA 3C7HA 3D6EA 2VU9A 1DYKA 3N7JA 4Y5SA 4RFRB 3ZMOA 4YVSA 3KWVA 2JIGA 4Y20B 2GNDA 2B9VA 4QX3A 3POBA 1UXXX 3K77A 5E8AA 1SFNA 2DVBA 2DWRA 3INAA 4FTEA 3ROUA 1H0BA 1OVPA 1GOGA 4JQRA 4CZSA 2VUJA 1ULEA 2WKKA 1LHVA 5FXWA 1F31A 2Y6HA 3H0OA 4PT6A 3ZN6B 5EPAA 1QJU1 5C8CA 4QPGB 4QX0A 2R30A 4W50A 2BWCA 1GOFA 3GALA 3PVEA 1W0PA 4DQAA 2MEV3 1S0JA 5CBLA 4FPHA 1CAVA 4Q26A 4KWUA 5BUVA 3VBHB 3TB0A 1YFXA 2YBPA 5BNOB 4YVWC 1AL21 1W6PA 4L0PA 2ARCA 3MFAA 5FYIA 4LA3A 4JGZB 1LCLA 4GKYA 4TXWA 5A80A 3UESA 4A4AA 2W1WA 3RZGA 4AEDC 2EIEA 4R9DA 2HH9A 5FYVA 3VD7A 2RS13 1ULDA 1OD3A 3DPRA 4ZU4A 5IAXA 3KF3A 1H8VA 2OXBA 2DURA 3TN93 2G9GA 3AJZA 3D3AA 1H8TB 2A3WA 3HIFA 3OPTA 4LA2A 1TNFA 4GH4C 3VUOA 3AX4A 1PIV3 1UZVA 4HL0A 1C8M2 2ZEXA 3IWZA 1X9TA 3MYXA 2D6KA 4NUBA 5DG1A 5FZ8A 2GZWA 1QMJA 4QQPA 2GMEA 2VBPA 5A70A 1ENSA 4BJ0A 3GZTB 1OA2A 2ZTNA 4OHWA 2D5HA 4Y1UA 1HJFA 1A6CA 4AI1A 1K5JA 3U4XA 4AVAA 3WINE 2RDQA 1QU0A 1UPSA 2WNEA 2ZX2A 1HQNA 2VR4A 3U37A 1ZBA2 4I01A 5IVBA 2ET1A 3IM0A 4SLIA 4Q4X3 1UZWA 2WWJA 1O3QA 1PGSA 5DXDA 4JVAA 2W39A 2C4XA 3OEBA 4IEYA 4YWAA 2OX0A 4N53C 2JECA 4QDRA 5LATA 2JXAA 3LEGA 2BQPA 4YARA 3NQHA 4UW6A 2D3PA 5FZ7A 3UYJA 1R64A 1SQ4A 2DU1A 5T54A 4XABA 1RMU3 5FYTA 3WOGA 1X82A 3AMQA 5F2WA 2WNUA 4LBNA 4AGGA 1QKQA 4TZDA 1KQRA 4HN0A 2FD8A 1XQNA 2ARXA 2YU2A 1TMF2 1H2KA 5JMOA 1JUIA 3NRUA 1DZTA 2NMOA 1D2QA 3RJ2X 3PVBB 3WVJA 4JGYA 4HBNA 3VKFC 3CJIC 5FY9A 4JX0A 4WM7B 2MHFA 3I2GA 1S0IA 1OQ1A 3CL1A 1TE1B 3AYAA 3SEEA 4IESA 2QUOA 4RS5A 3RPQA 3HBKA 1RUF1 2AACA 1KJRA 4HOOA 2HYKA 2VZVA 1GNYA 2YB7A 4IGPA 3J7LA 5A7NA 1N3QA 1PZ8A 2GNBA 3H1WA 5E6HA 3ZFEB 4XIOA 3RJRA 1D2SA 1COV3 1VR3A 1LEMA 3JD72 4Y20A 4KH9A 4E2SA 1OFNA 1QQP1 4BXSV 4MADA 4GMP3 4TLFA 3ACFA 4IDZA 3NW4A 3WQ7A 2EIBA 3ZFGB 4CDXC 5A3NA 1KDMA 5FK7A 4XJZA 2QDRA 1FV2A 3FMGA 5EJZB 5JLVA 5A7PA 1OMIA 4J1WA 3BCWA 3QD6A 1MQTC 3JU9A 1G7YA 2GNTA 2YY1A 4MUVA 3ZN6A 1J59A 4QXBA 2VW2A 2XJUA 2W1QA 3VKLA 3OGJA 1R082 2Y6LA 2R0HA 4DXSA 1W3VA 4M0HA 1C4RA 2Z5WA 4EE2A 2WA4A 4AE2A 3V0BA 3VBHA 1O5LA 3VBFB 2RV9A 4JAAA 4YG0A 3ZXFA 2WQ4A 1BQPA 5DUWA 2E32A 2JDNA 4QM8A 4WBBA 3WDYA 3KLSA 4RYDA 2OKXA 2QCSB 4IGQA 3IB3A 2OQ7A 1JXNA 3M3OA 1KFXL 4N8MA 1ND2A 2VNRA 4AVCA 1SMVA 1G9CA 4F83A 5I91A 5JI9A 1PHMA 3WQ1A 3NVCA 3E6DA 4DPNA 1NAEA 1NXD1 1W6OB 4FI9A 4E27A 3PDQA 4MGIE 3BTXA 4BMEA 1H8TA 4KG0A 4LBOA 1DP0A 1CAWB 4N9IA 2A7AA 3ME2A 5F5CA 1UY3A 1PNGA 2Y0OA 1E5RA 2PELA 4HN1A 5FYBA 2Y33A 1FPN2 4BCUA 4ASKA 4CCOA 2UWBA 5IJRA 1HB4A 2VAUA 4XTMA 2WBKA 3APBA 3IDEA 5F8PA 1XYNA 2VULA 3GNEA 2WFF1 2EIGA 4Z2AA 1AX0A 3AXDA 5GALA 1LOFA 4EN7B 3VDBA 4OHXA 3ZSEA 3HN1A 2JDKA 1IHMA 2G9FA 4LO6B 4ZU5A 4CDQA 3L2YA 4PBPA 4LMFA 4Z92B 4META 4BXFA 1PX4A 4MXWA 2C6SA 2B45X 3FC0A 2AREA 5K4LA 2FHRA 4A3XA 2O0OA 1FNZA 3MV11 5I93A 1VBA1 4QPIC 1ODNA 5CZKA 1IG3A 2OVUA 4OHZA 3IMNA 4IEWA 3LSEA 3EO6A 4QD2A 4ZZ8A 1VRH2 3AMNA 4Q4Y1 2C0ZA 3AXEA 3B01A 4URTA 4Q8KA 4JV4A 1U5XA 1IS6A 3UNPA 3UT0A 4YG6A 1US2A 3ZIWA 4MH0E 4MGYE 5HBAA 1AYM2 2HWD1 4B1LA 3BODA 4Q1PA 4FTSA 1QJU3 5DAPA 3WP5A 4GB31 3N36A 1G9BA 5KWRA 1A3KA 1XU2A 2DVGA 2JG9C 3POFA 4AFBA 3I59B 2VQTA 1LEDA 2O14A 4FXKB 4LKFA 1PGL2 4PLMA 3O1TA 5JZGA 1BCXA 2QBXA 2CU5A 3OTFA 3OB8A 1FATA 4JRAA 5JOZA 1AL23 1TG7A 3ZXGA 3ACHA 1R1A2 1DYOA 5GLTA 3ZYFA 2VNGA 2OQ6A 2DFBA 4QU2A 1DQ2A 1KXGA 1Q8OA 1US3A 5EWSA 4CPBA 1WCSA 2RMU3 4PHZA 3W9AA 4NROA 1HN0A 1EY2A 5JIAA 3VGIA 4HVQA 5A32A 4J1XA 2A73B 2VY0A 1XNDA 5FQ0B 1GWKA 1OF3A 4HANA 4LIUA 3TEWA 5FZFA 1UOGA 2MPFA 1NUKA 4OULA 3WW1A 3FBYA 1GNHA 5EZWA 5FMOL 1DQ1A 4RQPB 2RJKA 3RVHA 1NQJA 2IXIA 3T0AA 2BGPA 4OLLA 3FLRA 3ZFGA 4RA0A 3PJQA 3FBMA 4FVVA 5IT6A 4Q0VA 3KV4A 3VDAA 1EP0A 3UV9A 3MW2A 5C9AC 4XUNA 4E4HA 2ZXQA 2DFCA 3UJQA 4AEJA 2D40A 4AXOA 2I2SA 4CA9A 1F9KA 1OBNA 1YFYA 1WMFA 4ZXKA 4CCLA 4K6BA 2VXRA 2WO7A 3MIEA 1VBE3 5DAWA 3ZN4A 2Q30A 4F3JA 5ACA1 3BU7A 4IXLA 4CP1A 2WR9A 4BLIA 5I0DA 3QH7A 4QT6A 4YGBA 1ND3B 4KMQA 1PVC2 5FKCA 4ASMB 4LK6A 4XFBA 4YGDA 2VNOA 1C28A 4L92A 3VDDA 5JXIA 1W04A 4XF3A 3AZWA 1O3SA 4FOVA 1SDDB 4ZHNA 4O9GA 4CEWA 2GAUA 1LJ7A 1QJY1 5BNNC 1YRZA 4P02B 1WW7A 3EBRA 3J8F1 1OPMA 4M3CE 3PJYA 3JZVA 4MOAA 5JPMB 4QB2A 3JBG2 1LHNA 1O91A 1AX2A 3EYPA 3U75A 1QXJA 3K51A 5AC91 3A23A 2AGSA 1GR3A 1KD7A 3HT2A 1ULCA 1NT0A 3OYWB 3ZYIB 3MIBA 1URXA 1Q3EA 2YGLA 3PUHA 1ULOA 1X33A 1ULPA 1BMV1 2BWAA 3DYMA 4ZU7A 2R061 1AXZA 2ZZJA 5FZEA 1SBDA 4UOJA 1J3PA 3R05A 1RUF3 2QQIA 5GM0A 4J6GA 4K9SA 4JTNA 3WG1A 4QB1A 3FFZA 1NG0A 3ZKUA 4N9HA 2QTWB 4D8MA 4YM1A 5JMCA 2P3JA 2QQJA 1JZ3A 3K4AA 1QQP3 3CLPA 4BA6A 1DF0A 2A6VA 4Y1XA 5CA6A 4O9EA 1GFF2 4COYA 2XLAA 4E2QA 2VXJA 1G86A 1DYPA 4LORA 2KR2A 3F95A 2DTWA 3T4HB 2HLEA 2WT0A 5FY1A 2BVVA 3WG4A 3JB4C 3UKVA 1W8FA 3MLLA 3ORJA 2B5HA 2JWPA 5LEJA 1LAJA 4MSVA 3LE0A 1RUI2 4JC1A 2VZRA 3ZR6A 4BH9A 5D8AB 1UOBA 3GZUC 1JYNA 4LBJA 1QEXA 5FRAA 1VAKA 1DQ4A 5A7QA 4OUSA 4YVWA 1DGWA 1OXCA 3D5OA 3L2HA 4CCNA 4DXTA 1VBD1 5L7OC 1OD5A 1J3QA 4KU7A 4AEDA 3WW3A 1LNSA 1O4ZA 1RUJ2 1WMXA 5FUPA 3O0VA 3ZYPA 4NE9A 2A3XA 1CR7A 1LENA 3HWJA 2GC3A 2K46A 2WA3A 3J26N 1Z78A 4ATFA 4BWOA 2YFZA 3KGLA 3VBRB 4AI0A 1FOD1 4NRPA 4GXLA 4M3CF 3PUIA 4IE5A 2Y26A 1B09A 1CD3G 1RUD1 1NCRC 4R9CA 3TEXA 2PTMA 4HKWA 3ZR5A 3KV9A 4UFMA 1AR61 2LTNA 4GH4A 2FDKA 3LEMA 3GCXA 1RGSA 3AK0A 4YW7A 5CFDC 2XKOA 3T1MA 4ZY9A 5A33A 1ENXA 3K4DA 1UX6A 3RDIA 1PNFA 1VIWB 3LFMA 2YFUA 5AVAA 4D94A 2VZ3A 1W6QA 2AYHA 5FR3A 3I2DA 1FMD2 1ENRA 1XNKA 5BYNA 2VBBA 3VB9A 5GZEA 2WFF3 1UY2A 2ARAA 2ZAAA 3Q8BA 5DDJ2 5T3NA 3CF6E 3ZX7A 3O14A 4IV3C 5IK7A 2HYXA 1TME1 1OI6A 1H30A 1TNRA 2Z69A 2E53A 4FPKA 1PO22 1DLCA 1K5MC 2JEMA 4MGQA 4A6OA 1ZZ8A 2NN8A 4QPIB 3BI3A 4OCTA 2XBO1 2JICA 5A3LA 4CXWA 4Q4V2 1EPZA 3D8CA 1A34A 2PHUA 3RYKA 1VBA3 2CDOA 2WZR2 4N53A 1ND3A 1ULGA 2K0GA 4ISRA 4X6RB 5APAA 2F17A 5F37A 2B8MA 3H1YA 3LOIA 3OY8A 4LQRA 4Y4RA 4LEJA 2QJVA 2W2IA 2TNFA 4DRRA 3WNNA 1U12A 2W95A 2JG9B 2WRAA 3W58A 4FSJA 2HWD3 2CGNA 2OUJA 1WBLA 3I2HA 5FP9A 1F5JA 3R6SA 3SQOA 3WD5A 3WF1A 1Y7BA 4C0HA 5KHIA 2A5ZA 4QPGC 3KB5A 4XAEA 1MEC2 1JS9A 1SBEA 5J36A 5IVVA 1ZREA 3POEA 1WCDJ 4BQWA 2WO1A 4AYUA 3J4UH 1KJLA 1KDKA 3CJIA 1HJGA 3ETQA 1GLHA 3OYWA 3VBHC 1C3HA 1DCSA 1N1SA 1OH4A 2R042 3DXUA 4HXCA 5BNOC 3E5XA 1W8UA 2WYFA 1GWMA 4JGZC 1QWRA 1L3JA 5GZDA 5FZBA 5FY0A 1F15A 3T0BA 2P3KA 3TEYA 2RS32 1WMEA 3JUUA 2BU9A 4LE3A 2Q8OA 4DY3A 2W91A 1OPOA 2EALA 4ZZ5A 4WVMB 2BBAA 1JH5A 5JCTA 3SISA 2YC0A 5E89A 4QAWA 3NKGA 3RZZA 2WAAA 1H8TC 2ZPXA 2D7FA 1UU4A 5A3TA 4BLJA 2SBAA 4EZ4A 2RS53 2VQ0A 2VZOA 4PI2A 5FREA 3AMPA 1JYWA 1MQTA 2ADDA 1D0HA 2UU8A 4FPJA 4OYUA 1UPIA 5C9AB 4QHZA 4JKLA 4B4QA 1SFYA 5E1RA 2B39A 3SCFA 2J1UA 1LOFC 2VUCA 3RZKA 1O8PA 1B35C 1PMHX 4Q4W2 4XYXA 3HNYM 2AZ5A 3ZYGA 2VMGA 2YHJA 5CAZA 5D8AA 4Y22A 1GP5A 5FOBB 2ZKNA 2RM21 2W5FA 4CUBA 1O6UA 2ATFA 4LBKA 2R6QA 1MS9A 2CAUA 3AKSA 1FAYA 3IMMA 4AVTA 2AC1A 1U5ZA 2IFRA 1JYCA 3DL3A 1ZRIA 2VVFA 1P8JA 1REFA 1H1MA 2EAAA 3MGUA 2L9LA 2GMMA 1DZRA 3PMSA 3BPZA 4CDWB 1TQ5A 3HOBA 2I07B 5F6LB 4EWAA 2GC0A 4JDNA 4H55A 1HQWA 1VMJA 2CY6A 2BUKA 1RMU1 4FQZA 5EYXA 3WXPA 1QJY3 2X09A 1BK0A 1ZRFA 2NYYA 5FPBA 2YYOA 1VAMA 1APNA 3A0KA 2XUEA 4NHYA 3FX3A 1RUH3 2CL2A 4FP2A 4MLOA 5FLJA 4Y1YA 1NE6A 1QXPA 4UAPA 4I02A 4EWDA 1S2BA 1J83A 2RR12 5SV5A 1W8TA 2QVSB 3GHNA 2VO5A 4XUQA 3ZYBA 4C90A 5L36A 2XUMA 3DUIA 2A6WA 3H7YA 4H7LA 4WM7C 4AI8A 3ILFA 5FUNA 2XJVA 2R063 3T4VA 4MGKE 4IETA 1QOTA 2V4VA 2GP3A 1IKPA 3OD0A 3U11A 1XBFA 2WQ8A 1UD1A 3I3BA 4I2OA 4QMAA 1JHNA 5J7MA 1O59A 3IN9A 3MO4A 4QPIA 3ZFEC 4GMP1 3GXUA 5AFBA 5C3PA 1SBFA 1MZFA 4ORFA 3WP4A 3WF4A 4BK5A 4EN6B 2OIIA 1OOPC 4M00A 3WNMA 2B9UA 1IPJA 3PHMA 1I9RA 1S2KA 3VL8A 4CCJA 2JG9A 2J1TA 4HSLA 1C1FA 4V2WA 5FZ4A 1AR91 2IC1A 1T2XA 3OG2A 1DGLA 1EUTA 4HK8A 2Z79A 2R49A 3B02A 4XF4A 5JWPA 1O4YA 4WVWA 1PM7A 1RUC2 1Z7S1 2PA7A 3EHKA 4TSVA 2C1FA 1IOAA 2Q5TA 1VBD3 2OPWA 3VBFC 3N3HA 3WP3A 4YZ2A 4OHYA 1O8SA 4N43B 3FLTA 4E8DA 2O1QA 1W9FA 2ZS6B 1XE0A 2JG8B 3ACLA 4XF1A 5C3SA 5LASA 1DLLA 3WSOA 2KD7A 4B4PA 1M06G 3DGTA 2ZEWA 1Q8PA 1UZ0A 3GF6A 5EJ1B 3WZ1A 2FCTA 4Y5Z0 1FOD3 4GWMA 4QDSA 1QNYA 3ES1A 2XJSA 4WVMA 3WHTA 4BE3A 4IV1B 1AR72 1RUD3 4W6WA 3U10A 1PO13 4FAHA 1AR63 3M3EA 3OEAA 3BB6A 4CRQA 1OFSA 1J1TA 2MEV2 3B00A 2FCUA 4LBMA 2QQOA 3SH3A 1W2UA 5JUVA 1JBCA 2Q4SA 4IEUA 4RSUA 3G7DA 4DMIA 1H9WA 4URAA 3LQCA 2PN5A 2YU1A 4PLOA 2GP5A 3VHNA 5C9AA 3M2MA 4P9WA 3K4ZA 3SLIA 3ZKYA 2JE9A 2JX9A 3VHRA 3WG2A 5IHRA 1I5ZA 1CIYA 4MV2A 1K5MB 3AMHA 1N1YA 4DUXA 2EXKA 1TME3 1A8MA 2RS12 1HX6A 3IDCB 2ES3A 2QZ3A 4FPFA 4FTBA 1ASJ1 1W6NB 3CJXA 1AYN2 3BN6A 1WUVA 4CUAA 5FMCA 3O12A 4XILA 3TN92 4AFMA 5DPNA 2HWB1 2XBO3 3POIA 4A3ZA 1XYPA 1VJ2A 3UJOA 1O3RA 4IEVA 1LOCA 3VD5A 1W9WA 4I30A 4DS0A 4P9YA 4LLOA 3U14A 1R081 1UMHA 1PIV2 3OD4A 4QDQA 3D82A 3FE5A 1H9PA 3LD8A 4RHV1 4JTOA 4XVHA 5BNNA 1V9U3 1V6KA 4IEXA 4QB6A 1GYKA 3OUHA 4O65A 1ZNPA 1RUG2 4LR4A 3IIAA 4NN0A 2P5BA 4XEZA 5FXXA 1SLBA 1OLME 1GZ9A 5C4WB 1LULA 1QJX1 2WUHA 2JJ6A 1NLRA 1UYYA 1SCRA 2YPDA 3WT3A 5JIUA 5HCHA 2VMIA 1SEFA 3T2TA 2WZPP 4B29A 5FPZA 2XQRA 2HWC2 3O0WA 1WCKA 2WN3A 4MZUA 5CVRA 1EAH3 1BEV1 2R071 1AL0G 3KM5A 2BNMA 4Q4X2 1D4VB 3AP6A 4LXLA 2RMU1 5I0SA 1BBT1 5HV4A 5IW0A 3SXWA 1X8EA 5HCBA 5EJ3A 2B46X 1AR83 5F3GA 4XC9A 1CVNA 3A4UA 4BU2A 1N1TA 4Y1ZA 4HSJA 4UBGA 1JZ8A 4XFGA 5K9YA 2WDBA 3K3NA 4XIKA 2HEVF 3RQ0A 4XZPA 1GZWB 2LRPA 2WC2A 5GLUA 4AWDA 1NE4A 1WBFA 4XUTA 3MUZ1 2RDSA 2VOTA 1JW6A 4Q5OA 4QM9A 3B3QE 2K9ZA 2UWCA 4RQPC 1LU1A 3KCYA 2ZA9A 4LO4B 1B35B 3O1OA 4W65A 5H9SA 1XSQA 2A75A 2UY9A 1FX5A 4DINB 3POJA 1OLQA 5HCFA 3C7FA 5A3UA 4P9GA 1VBE1 2VVDA 1LB2A 1PGW1 1IS4A 2FQPA 1HDKA 5T50A 3TAYA 1U5YA 1YFUA 1VRH1 1W39A 3MIFA 3M70A 2NPIA 5H9PA 3UKTA 3ZN5A 1BHGA 2RM23 3E97A 3OBZA 5L7OA 5C70A 3ENRA 1HB2A 2EXJA 2A6ZA 1QDOA 2VECA 2HWE2 4CCCA 3T3YA 5GLWA 1L7LA 3IKWA 5IK4A 4N43A 3EMRA 2Z2SB 4L2NA 1ND3C 1W2TA 1N47A 2BEOA 3B5LB 1UCXA 1W2OA 2QZ2A 1NXMA 2F6BA 1RVF1 3LDKA 5FYUA 4BQ1A 2QQKA 4QU1A 3R4UA 1JUHA 3A21A 5FWEA 1G9DA 1NCRA 3JQWA 5GLZA 1XOYA 4FP3A 2ENRA 2GH8A 5CFDA 1RUE2 3HPNA 1T6BX 4YFZA 1V0AA 2FZ2A 3H8OA 2V4AA 2Y6GA 4M3CA 4YW4A 1W99A 2G1MA 4XFHA 4Q8LA 1VE0A 1WGPA 1YI7A 3WW4A 3AL5A 1QF3A 2XHNA 1XNTA 2Q8CA 4P9XA 2WT2A 3GBFA 3D4KA 3ZVXA 5FYMA 1LODA 4MHRA 1DU3D 3I2IA 1LU2A 4BK4A 1J3RA 1NOVA 1UY4A 4IV3A 5F5AA 1UYXA 3NV3A 4Y24A 4XMAA 4NAMA 4OMCA 1X8MA 1O7FA 3I2FA 1K5MA 1QDCA 2XWJB 3ES4A 4LKDA 4UI9L 3USUB 5C5UA 4M0NA 5ANNA 1HRI1 2D98A 4U2AA 4MG2A 1QIQA 1UWWA 4DIQA 1WW6A 3E5QA 1VRBA 2CSGA 5CIRA 4ZS2A 1REEA 2ZMKA 2BVBA 2X53S 1OT5A 5I0RA 1OOPB 2JB8A 1HIXA 4FPYA 2IVJA 4B8EA 3RYPA 1MVEA 5DAVA 4NPMA 1ZRRA 3N4MA 5FYCA 4UXAA 4HVOA 4G9SB 1G9AA 4PQ9A 4QPGA 3VZOA 3BTZA 1UO9A 4A7ZA 1PVC1 1WLTA 1V6LA 1AR93 2WABA 1F5FA 5LBFA 3AZXA 1UOFA 4TLGA 5D8AC 5C71A 2BP6A 3IPVB 1YHFA 3TNPB 5BNOA 1Z7S3 1L7QA 2ZOEB 2XLFA 4XETA 1Q8QA 4W6XA 1D7PM 4JGZA 1UOJA 5KXDA 1JZ2A 4YM3A 2J42A 3JBG1 1YC61 4TWTA 4NJ4A 3DYOA 3ELNA 3ZFFB 3IDBB 3K2OA 3SEPA 5CISA 4CEYC 1AF9A 2EICA 3KT4A 3VBRC 3N9MA 4B4RA 2WO2A 3T30A 5DUXA 1OF4A 1VBB1 2CNAA 3S6PA 3W20A 2NQYA 1R1ZA 4TYSA 2EIDA 3KV6A 2VBDA 1OH3A 2HEWF 4IW3A 1YFWA 2E26A 2JDAA 1GZWA 4XUOA 2HJIA 5FKBA 3AB0A 4K40A 3DXTA 2WIIB 3MHZA 5HPOA 1G6NA 3OJBA 4AVVA 4MX3A 4LKSA 4UYBA 3RYRA 1TZOA 4DZGA 3Q9OA 1AL22 3ZPYA 2P17A 3QOPA 2XR4A 4LPLA 1B35A 3SITA 3RZLA 4YW1A 2O8OA 3JD73 2XLGA 1I3HA 2FDJA 3MFCA 2VMHA 1CAUB 3WNXA 2Y6FA 4G3YC 2QQWA 3RSJA 5KXEA 3I2JA 3RI8A 1Y9GA 3POYA 3RNSA 3VZKA 1ASJ3 2JD9A 1YUDA 2XL7A 4C8DA 2BGCA 2HWB3 4ET7A 2P1BA 1SZBA 4IEQA 3W59A 2QQMA 2BYVE 3LB9A 3R4DB 3HQXA 3R4SA 1DG6A 2ZACA 1V6IA 1XRUA 1RJ7A 2FDFA 1M4WA 1R083 4RN5A 3WEZA 1K45A 1ZA7A 2ZAHA 4RHV3 2VGDA 4QHOA 2IXJA 2PHRA 5HXVA 1OC1A 3RWNA 5DN2A 1XB9A 3CO2A 3LAGA 4OUEA 2K2SA 2WINB 2VC9A 4D3WA 5JPNB 1QXRA 2O8QA 4OVEA 5IVCA 1YYNA 2JIJA 1QJX3 2DBNA 4RL7A 4CSWA 2A1XA 3VBSB 5C6CA 1KS5A 1GP6A 4WZCA 2J1VA 3S30A 3BGAA 4A6SA 4XFCA 4Y5TA 2HWF2 1AHSA 2DCTA 4H14A 3TBDA 2D6NA 5L73A 1DBNA 4BIOA 3GJBA 1W8WA 1BEV3 2R073 3HNMA 2C9KA 2PXJA 4FPEA 4WM7A 2BRTA 4XE9A 2D44A 5IFPA 2WS91 4AOCA 1O4TA 4AQ6A 1BBT3 1W90A 1BXHA 4BYYA 2WJSA 1WW4A 3PIJA 1GANA 4CU8A 4OQ8A 2KA3A 3USUA 4B7KA 2CV6A 1C8NA 3M3CA 3WNPA 4LBQD 4ZKTB 2VZSA 3ZFEA 1W8ZA 2ZGOA 1FMD1 1UYZA 2XB6C 3EJKA 3IAQA 3Q8AA 5A3OA 1LGNA 1HXS1 4YW2A 4I0AA 1ENQA 3RRDA 4AVSA 2RS51 3N7KA 1DGRA 3C3VA 3OPWA 5AFEA 1OOPA 4DO0A 1STMA 4UF0B 2DCJA 2XJQA 4XHXA 4I0BA 3N7MA 4GQ7A 4IE4A 3RZHA 3WDUA 2P6HA 3IAPA 1GSLA 1V6NA 1PO21 2ADEA 3AL6A 2OZ6A 3HQRA 5FTTC 4YPJA 1MS5A 1CAXB 3V64A 3V65A 3WUCA 2FDIA 4FOQA 2PLV1 4RR3B 1GOHA 4NIGA 5FZ1A 3FWEA 2PAKA 2P3IA 3M8LA 3U07A 5KR7A 4RGAA 4JHZA 3NMBA 2DUQA 2H6BA 2IFWA 2P34A 2JE7A 3SMHA 1VRH3 2J22A 2E31A 3PVOA 4LKEA 4RGKA 5HI0A 2VZPA 3LIGA 3IPVA 3Q8CA 3BOWA 4NPLA 1QOOA 4PLNA 1S55A 2DF7A 1KEXA 3PTYA 4LUKA 5CB7A 1ACCA 1Y9MA 4OI1A 3N9PA 5DUUA 3V56A 1AYM3 5FP8A 2ZBJA 5EIYB 5SV8A 1QQP2 5KXBA 5D21A 5JXJA 1AVBA 1UIKA 5FAXA 4Z8BA 4JCKA 2ET7A 1RVF3 4CDWC 4L99A 3D0SA 3A0NA 1ZBE2 5KHHA 4XTPA 5JXGA 4XFAA 5LB6A 2XHKA 3K75B 3B9IA 1MS1A 3VBOC 1W6OA 3NV1A 3OCPA 1W0NA 4IGOA 1RUH1 4DEQA 1WKYA 1R1A3 3WDXA 1CAWA 5DMYA 2CYFA 2BERA 4QXHA 3MLJA 4NRMA 3NV2A 3K48A 1D4M1 2RS31 4LUMA 2VMDA 5TSWA 3USSA 3S7EA 2WN2A 1GUIA 4YGCA 1UX7A 1POV1 1RL3A 3P6BA 1BJQA 3I49A 2R0FA 4R8HA 3S57A 3GBWA 4YNIA 1ULFA 3N9NA 1X36A 3LDRA 2P6CA 3ZXEA 4UT5A 1JN2P 2VL4A 4K1ZA 2GALA 1YO8A 1PM4A 2P4EA 1W9SA 1HRI3 3MIGA 4INDA 4ARXA 5I0TA 3TOJA 2Y64A 1H2LA 2VW0A 4UFLA 1CIWA 4ONUA 4IE0A 4YM2A 4HVRA 5JVVA 1QHDA 4ZPIA 1J84A 5A6XA 1RJ8A 2EXHA 2I74A 5DUVA 2I45A 1XC6A 4NVPA 1LOGA 2X10A 2IWGB 3RZJA 4PBOA 4UBHA 3W5NA 3ASIA 1NKGA 3H9AA 1OVSA 3BIWE 3KCCA 3PURA 2PQSA 1GKBA 1POV0 2WFF2 1RHI1 5DABA 3URFA 1HRV2 5DAXA 3I59A 4HFSA 1PVC3 3N9LA 4CDUB 5FZLA 3IZOA 1MS8A 5DAQA 2A6YA 3OSDA 3H8XA 1ZM1A 3OBTA 4N90A 4W8JA 3ZLIA 3NJZA 1E57A 2BGOA 3AP4A 1CPNA 5EYYA 5FXZA 1AX1A 3T08A 4KWLA 4GJYA 1Q8SA 2PMWB 4AZZA 2X5IB 1ZRDA 3F2ZA 3GM8A 1ST8A 4N43C 3LZZA 5F2SA 5F3EA 1MACA 3JBG3 4CEYB 1G8WA 3H3ZA 4NIDA 1Q56A 2JG8C 3OPZA 4Q4Y2 1KITA 3TWIA 2WT1A 3PMEA 3PU3A 2V5YA 4I09A 2VQAA 4KGQA 4R4ZA 1PO11 5EP9A 5FQ0A 3D0JA 3I97A 2HWD2 4C1XA 1VBB3 3J7NA 2V73A 4GB32 4IV1C 3B69A 4PDWB 5E88A 4AK3A 4COWA 1LOAA 2XKPA 4RQPA 4EJRA 3WDWA 4OFGA 4DB5A 5F9TA 5FPXA 3QCWA 2OZJA 4QX1A 4QXCA 4UF0A 1C5IA 2P2KA 1QGLA 3M3IA 5GZFA 3GZAA 4FOWA 2P37A 3KHCA 2OS2A 1CAXA 5FJKA 4GAZA 1E5SA 4AFAA 1JYXA 2GSYA 1DIWA 4FT8A 1XJAA 2J1AA 2BV4A 3CZUA 4P14A 2XL9A 2OYZA 3ST7A 3VD3A 1DZQA 1QH6A 1PZ9A 2XG3A 4HPKB 3POGA 3VDCA 4AGRA 1V6JA 3VV1A 5L19A 2PAEA 3JXSA 4Y1VA 3T1LA 2AUYA 3N7LA 2SLIA 2FBEA 4ATEA 1XPWA 1GZCA 2DTYA 5L9VA 3KZ4C 2NP0A 2KXLA 3AZYA 2A6XA 2BNOA 4W6YA 5KXCA 3PNAA 4XMIA 2A3YA 3WG3A 3J7MA 3MZHA 1FT9A 4JDOA 3KD4A 1RUI3 2XH6A 2W08A 2EAKA 2BNNA 1V9U1 4QQ2A 5CKQA 2Z4FA 2DU0A 5JOWA 1WCQA 4XPVA 1R092 1YJLA 2PHDA 4WM8B 4CXXA 2F4LA 4GKXA 1GWLA 5LA1A 2XQXA 2PHWA 2XGXA 1GU3A 4Y26A 3HT1A 5FDBA 2FDHA 1JU3A 2AR6A 4DXZA 2VZTA 5C4WC 5FPLA 4BQ2A 3VBUB 4CU7A 4K3UA 1OLMA 4G4FA 5FZCA 1O5UA 3SC7X 1EAH1 5LWBA 4FXGB 3GGLA 5ACA2 1F8VA 1WLCA 3L9JT 2RDRA 3EXUA 3SNMA 4XBNA 5BY5A 4QQHA 5FP4A 1IPKA 1AR71 5CKMA 5H9QA 3RWKX 5LK5A 3ZPOA 3I2KA 1AR81 1JU4A 4UFIA 2YG0A 1IZ3A 2WS93 3ZOIA 1W9TA 1CQ9A 5E16A 2BOIA 2JDHA 3ZDSA 1OUXA 3HN3A 2D6OX 5A6QA 2ZGRA 4UFKA 5C5TA 3KS7A 3DEMA 4YYOA 4NAOA 3N9OA 4JKMA 1QJY2 2WNOA 1FMD3 3CKHA 4YSFA 3J8F2 3SCGA 1HXS3 1UN1A 2R7EB 4DY5A 2DUOA 2GH2A 2CGOA 4KNCA 4XBLA 5AC92 5KHGA 2ZGNA 1W6MB 1S0GA 1MR5A 1SLLA 2ZX4A 4H2AA 3R0RA 5FK8A 1IQAA 3CDZB 3DKQA 3J9SA 2J1SA 3KV5A 5F32A 5FY5A 1KRIA 1PO23 5LA0A 4YZ1A 2AENA 2D43A 1NLSA 2PLV3 3JQXA 3AZZA 1BMV2 3HVDA 4QGLA 2QFEA 2BZDA 3CIHA 3ILRA 2R062 4R9BA 2WZR3 2EA7A 4GALA 4Y3OA 3FHAA 3KQ4B 2NMNA 3MDPA 3LIHA 2DYCA 2XWBB 2JE8A 3KT1A 4LBQB 3ZXKA 5HV0A 3PLQA 1K12A 1UXZA 4N7UA 3LPGA 5BPXA 4X8NA 3RMXA 1RC6A 3ATGA 1EV12 2G4IA 1QJZA 5DZEA 5L9BA 2X5IA 2YV8A 5IAVA 4AHXA 2Y34A 2ZGSA 1XSRA 3WF0A 3GYDA 4K1YA 3B94A 4CEYA 5C3RA 4QKNA 4BB3A 4I0WB 3VBOB 4ARYA 5A1LA 3VBRA 3VHPA 4FPOB 2VM9A 2XVLA 5EQUA 4WV8A 2ZGTA 2FMDA 1WZXA 4N7IA 2E7QA 4A45A 5C3QA 3VD9A 3QACA 4PDWA 4A7YA 4BQ3A 5FV3A 5BXXA 1SHWB 1D4M3 1SCSA 4EV0A 2RS33 2RE9A 1S0BA 2TBVA 3NKTA 3NJVA 4E4DX 3HBZA 4CP9B 5FY8A 2QQUA 1POV3 3WV6A 5C8CB 2ZZQA 2WNVC 5EHDA 4AEKA 1VBC2 1C5HA 3EB7A 4FFIA 2BFUS 1CAVB 1C8M1 1WLDA 1OA3A 2VCAA 3FUQA 3M7AA 4XXPA 1EPWA 2VTXJ 4ZS3A 4YZ5A 1N1VA 3RG0A 3BUCA 1BZWA 1H2NA 1FOD2 4K20A 1FNYA 1RITA 1W6PB 2FMYA 2D97A 2RJLA 3NNMA 3UK9A 1RUD2 3A7QA 4FPLA 2LW8A 1GZTA 4BISA 4JZRA 3W5MA 4EN0A 1QJFA 1S1AA 1MZ6A 1WWYA 1YXWA 4Q4W3 4CP2A 1F4HA 3MBWA 5JDBA 4PJYA 3ABZA 3DPRB 4YZ4A 1LR5A 1FV3A 1ZBA1 4P5YA 2VZQA 4FFHA 4AW7A 2LUWA 5ISLA 3GDBA 5GZGA 2D93A 5FPUA 1RHI3 3N35A 5GZCA 2HEYF 3WNOA 4P9IA 2RG4A 3LPFA 3H42B 2Y8KA 1HLCA 4MGZE 1KFUL 4R52A 1TME2 1KGYA 3AKTA 4UW3A 1CX4A 5FZDA 4XJWA 2GMPA 3VBUA 1CZVA 2B4KA 1RINA 2OPKA 4X8PA 3AFKA 1UMZA 1NZCA 2X8KA 2XBO2 3AP9A 5I8YA 1SLAA 2HBUA 3I4IA 1AXKA 3NNGA 5DZFA 2CWSA 1JYIA 1GV9A 3MI8A 4PF1A 3SKVA 1HW5A 1YQCA 1DQ6A 2DVFA 2W46A 3DCQA 3DF0A 5JSRA 3BIEA 4HKLA 1TMF1 4FO9A 1LOBA 5C33A 1NY72 3WW2A 3ZFFC 3O1UA 3S7IA 2IXHA 4NIIA 3RFRA 4LHNA 5ABJB 4AG4A 5FFOC 3S5QA 2Q8EA 2JDMA 5CFCB 2D6MA 2VMFA 3PVNA 4GWIA 4COZA 4OQ9A 5A3PA 1H4GA 2RDNA 5B4NA 1GQGA 4S2DA 1S0EA 2BJSA 3KVAA 3LA2A 3LGRA 3MW3A 3ZXDA 3TEZA 1HB1A 3OUJA 1W6MA 4KG8A 3HAGA 2BDRA 4BQXA 5FMBA 3AP7A 2E9QA 4GIQA 2W92A 1CGPA 1FYUA 3ZSMA 3JD71 4QX7A 1QY4A 4Q27A 5FUIA 3UL2A 1ZZCA 4AHYA 4COUA 5LZ6A 1ODMA 4WZFA 1YIFA 4L9BA 3DKWA 2JKXA 2WNUB 1VB2A 5FZIA 4IE6A 3BVCA 4V1PA 4AHZA 4GWJA 4FPCA 5KBFA 5CYYA 1X9PA 3GZEA 1Q8VA 2TEPA 1SPPB 2ZJCA 3T2OA 4BMBA 4LBQA 4JGYB 5F7UA 5T5OA 4K8FA 1GQPA 1YNAA 4IEZA 3ZIXA 1W8HA 1JOPA 4IUGA 3ACIA 3AM2A 3MF6A 3ZXLA 3O1RA 2BTVC 2PQQA 1UMIA 2V72A 1NCQB 4CDWA 4NIHA 4XFIA 1GBGA 2QQLA 3VL9A 2ZX0A 3MIDA 3QLQA 4TN7A 5BNPC 3VBOA 1HV0A 1U0AA 4BQ4A 4QX8A 1RUC3 3NNLA 4SBVA 3ZXAC 3WY6A 5FZ0A 4P5HA 5J98B 4LTAA 5A6YA 1MPXA 2VD7A 3ZDVA 4AI9A 1WMDA 3K46A 2Y60A 2YROA 4L97A 4LOSA 2UURA 4PIYA 1GQHA 4YGEA 4CCEA 5A7WB 5J37A 2R1DA 3VBSC 4HK9A 1UKRA 2RM22 4DXRA 3RI9A 2VVEA 2OW4A 4OI2A 3I3EA 1YLLA 3CEWA 3GCWA 3ZYJB 4CP9A 4CTEA 2QQVA 3VZJA 1AR73 3NAPC 4E2GA 5FOJB 5IK8A 1ZZ6A 1WA6X 4AHWA 2JKBA 4MYEA 1FPN1 1OKOA 4PQQA 4QX5A 1RUNA 4BHPA 4NR1A 3LWCA 1JZ6A 1UF2C 3H3LA 3V0BB 1RMU2 3RGBA 1S0FA 2CWMA 3HMYA 3KHBA 2QNKA 4TTGA 3PL0A 3KMHA 3VKOA 1D0GA 3HNBM 4Y33A 4AEMA 2EXIA 3OUIA 4QKBA 3T09A 2GN3A 5J3UA 1ND2B 1W2AX 3B7MA 4ZONA 1OUSA 4Y4YA 4D7SA 1LHUA 3I3DA 2CDPA 1VB4A 1AYN3 5T5LA 4ISQA 4D6SA 3ZSJA 3ZSLA 2XXZA 3CMGA 3OGSA 1IKQA 2W52A 1BK1A 4XJ9A 5F5QA 2WLQA 4RR3C 3O1MA 3KF5A 5LBEA 3H1MA 4XJ8A 2ZGLA 3TRSB 3C7EA 2Y6JA 4M4RA 2C24A 2BPA2 5F3IA 1ALYA 1N3PA 1HKDA 3VN4A 1COV2 5GKAC 1AUYA 1AYM1 1IS5A 5JSPA 3U0ZA 1X50A 2DCKA 3DN7A 3MLKA 4QWNA 5A3WA 1RUG3 1W03A 1H1IA 4DRVA 2PHTA 5A7SA 3AJYA 3ZYRA 2JG8A 2AEYA 1PGL1 4O61A 5ERLA 2PHFA 1OSGA 3AYDA 4IQPA 3FL7A 4CDQB 4AQSA 1MS3A 1VP6A 4LE4A 4XDPA 5FY4A 1MS0A 4XBQA 1DHKB 4MXWB 1V6MA 5IWFA 5LRRA 3SCHA 1E5IA 2VZUA 4HKOA 2HWF1 2IVIB 4YLZA 4IV1A 1R1A1 2HWC3 4L11A 4BZ4A 5ABJA 2ZHKA 3S0MA 4GWNA 4FQ4A 3FLPA 1RIRA 5T5JA 4YW5A 5CFCA 3EQEA 1AR92 5LY2A 2UY8A 4C0BA 2EVXA 1DQ0A 5LRSA 2C9AA 4D6RA 3AVRA 2WNVB 1QJEA 1Z7S2 3DYPA 5B4XA 1AXYA 2CAVA 3ZM8A 1FXZA 1POQA 2H0BA 2XMLA 4FFFA 1UZZA 2YMZA 5FO8B 2VTXA 3HD8B 3H7JA 4V2VA 3CNAA 5AVPA 1C8M3 5JZGB 4XJUA 2W0XA 1LHOA 3LEIA 1W6NA 2A71A 4A7KA 1A78A 1VAVA 3POWA 3BTYA 1SPPA 1YWKA 3P1IA 4OI4A 5JAXA 5J96B 2DVAA 4OUMA 1JOJA 1OLRA 3THCA 5FCCA 4Q0SA 4GA9A 4P08A 1NCQA 3GJAA 4QKFA 5F5IA 3MIHA 1NLQA 1OQEA 5J48A 5A32B 1ZBA3 5DZGA 4YW6A 4CUCA 3BYWA 4LULA 5CNAA 5F3CA 3GBGA 2D3RA 1LTEA 4UFHA 1GMMA 1AJKA 1JZ5A 4A44A 2WSUA 2HWE3 2ZX1A 4JHTA 5C4WA 3MW4A 4P9JA 2RJ2A 1DFQA 2WZ8A 4HT1T 4DUWA 1RTVA 1Z0HA 3MPBA 3QH6A 4CDUC 1I6XA 2VNVA 5LBBA 2VUDA 2GC1A 2W87A 5A7WA 1ASJ2 2GC2A 3VZMA 5L9RA 1Q43A 1ZBE1 4XUPA 2UYAA 2W3JA 2VUAA 3AKRA 2HWB2 3KQRA 4AR2A 2VZ1A 1MZEA 4S2GA 2X5IC 3RMYA 1RUE3 4M4PA 4XDQA 3WF2A 1PK6B 4LHLA 4QXKA 3UGHA 2JENA 3WCRA 4WVVA 4XQ4A 1W06A 4CYDA 1TMF3 1GNZA 4RHV2 4XCAA 4AAXA 3WHUA 5JOXA 1QJU2 1WD3A 1CZTA 1RYYA 2VOVA 3NWKA 3BU0A 1ZRCA 2UYBA 4XURA 5KC5A 3AVSA 1NA1C 1V00A 1QJX2 4JDMA 3THPA 2PHLA 4PDWC 3VDDB 1W3XA 1H1AA 2NM1A 3HR9A 2VJXA 3KT7A 4MHUA 1F4AA 4AFCA 4AQ2A 3BKZA 3MF9A 4KBZA 1SLIA 4JRLA 1CPMA 5CEHA 4CEWB 1RB8G 4IEPA 4JQTA 2E63A 1BEV2 2R072 1UAIA 1F35A 3KCXA 2ID4A 3V0AB 4LO8A 3ACGA 1VMHA 2RMU2 1BBT2 3IDAA 2OT7A 3WF3A 1AZDA 5FYHA 2E51A 4CU9A 2ZABA 5GJ6A 4XF0A 1IG0A 1O3TA 5K0UB 2Q1MA 4K7JA 4HLTA 1JI6A 1RUI1 3ETPA 4MO3M 3VLBB 5BNPB 1XE8A 2JDUA 2ZMLA 1HRV1 4AF9A 4Z07A 4CXYA 3I54A 3N9QA 1SLCA 5LBCA 1CONA 5FXVA 4E4ZA 1UNBA 2UWAA 2E6VA 2OA2A 2ZMNA 4QQOA 4A42A 1ZA4A 2H0VA 3C2UA 4RGGA 4WM8C 5ANQA 5JR2A 1BVP1 4XJAA 2WSVA 3IIIA 1RUJ1 3RZMA 1YQ8A 3H50A 3O5SA 4DFSA 5CG8A 2BBVA 1W28A 3AYEA 1VBE2 5M0TA 1PGW2 3M1HA 3UGFA 2Q0AA 3VBUC 4BQ5A 3UGGA 4NIAA 2GNMA 4EYUA 1N3OA 1EYBA 1PVXA 2GDFA 3NAPB 4KWKA 3VBFA 3C7GA 4DOUA 2WNVA 4X6QB 2A70A 5KC6A 1WA4A 3BTAA 1QH7A 3DV8A 3ZYHA 1MVQA 1RXGA 1LECA 3FZ3A 3H3UA 3SH5A 3NJXA 3WCSA 5IVJA 3UETA 4Z2WA 1FPN3 4HG6B 1RVF2 4YM0A 3P5BA 3VKNA 4YVWB 3LDBA 4OZOA 2VPVA 4PIXA 4BOWA 1Y43B 1S0DA 3ZSKA 3OGRA 2LS6A 4EN8B 2QQPA 5A1AA 4AEDB 2QDNA 5DDJ1 1W05A 4WVZA 5FP3A 2JDZA 2W9XA 1LESA 2J1EA 5FYSA 2PAMA 5LA2A 4YW3A 5FPVA 3CHXA 4XOGA 2WZEA 5F1RA 1IPSA 2XVGA 1NZIA 2IXKA 3LEKA 4QGNA 1Y4WA 5JSOA 5CADA 2FZ1A 1UIJA 1Y3TA 2WWUA 3A22A 5JI7A 4Q4V1 4C1WA 1WD4A 1OQDA 2QE3A 2YBKA 4GH4B 2WZR1 5IUQA 2VMCA 4ES8A 5DQ0A 4EN9B 1RUF2 2BOJA 2R32A 4PIZA 5A33B 2G19A 1Y9QA 3CU7A 1WW5A 3HEIA 4FPGA 3VKMA 2ARBA 4Z1VA 3E6BA 1NYWA 1HRI2 1W6QB 3NNFA 2YXSA 5EFUA 1R091 3LCPA 4QPYA 4E4SA 2CTVA 3OF1A 2IXCA 4CE8A 4D7YA 2YC4A 5FLIA 5EXOA 1MEC1 2YDEA
chains in the Genus database with same CATH topology
3ZFFA 3LSDA 1PK6A 4XFFA 3IBMA 2ZGUA 1Q5OA 1LGBA 2R041 2HWF3 4R4XA 5EV7A 3LKJA 4NHMA 4YVSC 4GULA 4D7TA 2WLPA 4N53B 1ZZ7A 2PHXA 1C57A 1LGCA 2VOXA 4AI2A 3TYJA 2CGPA 5T5PA 2V09A 3OY8B 3VHOA 4MXVA 2BW8A 4I3GA 2DVDA 3G6JB 3ECQA 4Q0QA 2KM2A 1U5IA 4R9AA 5C8CC 1ZZ9A 3THTA 3V0AA 4IEOA 1CAUA 3MICA 3ZXJA 2C5DA 3E5UA 4AVBA 2ERFA 3X29B 5FBZA 3P3PA 5BNQA 3CJIB 4B7EA 2W68A 1IGOA 3POSA 4UW5A 5K0UA 1VBB2 3H8UA 1SDWA 4Q4W1 1AJOA 1V70A 2OUHA 4UW4A 4S2FA 2ZX3A 5BNPA 2IZWA 3DPRC 2ZGMA 3O0XA 5T55A 4EROA 1UU5A 1RUOA 2NLRA 5JOYA 1EV11 1OKQA 4CDXB 3P3NA 4IERA 3VBSA 1SACA 3IT8A 4ITCA 1JTZX 4LHKA 1A8DA 1MQTB 1YJKA 4RD7A 1ZX5A 2BFUL 2Q1ZB 4IL7A 4B3NA 1ZBE3 4YFWA 1QOSA 5B2GB 3FUOA 3NAPA 2ZKLA 1VBA2 4F7ZA 4C91A 3WUDA 4EWEA 1DDLA 4LBLA 1SLTA 4Y22B 4AFDA 4Q2FA 4DNYA 2RR11 1NA1B 2MNGA 1OA4A 3JCIA 5ABJC 4QHBA 3AP5A 3VZNA 4LT5A 4Q0UA 5GLVA 5CFCC 1VBC1 2B7YA 3MEPA 3OGGA 2D6LX 5IK5A 1DQ5A 2XPJA 2E7AA 4XF9A 3ILNA 4RR3A 2ZGKA 5HCAA 2XJTA 2WS92 5T52A 1MZ5A 2WNUC 5JR7B 4NHLA 4BM8A 2GN7A 2VOWA 2WQZC 5I0UA 5CU1A 5FLHA 4KL1A 1LKNA 1XNBA 2DUPA 1T6GC 4HMZA 3SH4A 4JGYC 1BKZA 4KQ7A 5CG9A 3FHIB 2ZGPA 1HXS2 2VW1A 2RS52 1HRV3 2ZHLA 1BYHA 1UW8A 1NCQC 4RS5C 1RUC1 4YRDA 2XJRA 3I7DA 4KBBA 2DV9A 3MPPG 4A2UA 4H7MA 2PLV2 4F8AA 1XNCA 1RUJ3 3WP6A 4P9LA 1H4HA 3QBQA 4PF5A 4Q4Y3 3E6CC 1NY71 1XU1A 5FMOS 4NO4A 2R16A 4Q29A 2MEV1 2DCYA 2ZCWA 5KHKA 1J58A 1QNWA 4GB33 5F6KA 4H3WA 5FO7B 4M01A 2H6CA 3NV4A 2JD4A 1CESA 1KS4A 3WX5A 1UKGA 4LO7A 1WLWA 2IXLA 2HKXA 1RUH2 5DDJ3 5C8WA 1H2MA 4AI3A 2RS11 1ZYBA 4HETA 4K21A 1D4M2 1AYN1 3NO8A 1UZYA 1ND2C 3TN91 1LOEA 1F2NA 1S0CA 3LA3A 3O7OA 4FOYA 4Q4V3 5D1IA 4YG3A 1HQLA 3AMMA 1REDA 4CDUA 4FCAA 1PIV1 4CDXA 1ZZBA 4XHBA 1W0OA 4BPZA 1RUG1 1R093 1TEIA 2LM3A 3AKQA 3AFGA 2TUNA 1NQDA 1MEC3 2PFWA 1DGWX 2F4PA 1J1LA 1VLNA 2WFPA 2WWSA 2AH2A 4CDQC 4YVSB 2B42B 3WDVA 2HWC1 3M3QA 3WLUA 1UL9A 4YZ3A 4FBFA 2R043 1ZVFA 4Q4X1 5ACA3 1NA1A 1XYOA 2R1BA 1RHI2 5BV6A 4XXAA 2VG9A 4OZXA 4OI0A 2XVKA 4XW3A 3WDTA 5BNNB 2VH9A 2EF6A 5I8SA 1VBD2 3WQ0A 2D6PA 2X29A 4NWWA 4QQLA 4I3PA 4NPRA 1CJDA 2ZGQA 3J8F3 4XQWA 5K8SA 2D3SA 4D69A 2LALA 4LNVA 3ZO0B 4HPKA 4HZFA 4KWJA 5AC93 1FI2A 4NOTA 4Q0PA 4OHVA 5JZGC 2YPJA 4RFT0 1I1EA 1PO12 2PYTA 1AR62 5LEKA 2ETEA 2Z42A 3TNQA 4BIFA 4FAGA 3KSCA 2YZ4A 5DG2A 1BVVA 4E9KA 4COVA 3VZLA 4PCRA 4AQTA 4WM8A 2ZHNA 2Y0IA 4XQDA 1OHFA 1COV1 1XXNA 2HWE1 3GHMA 3OBRA 4CP0A 1CN1A 3LOBA 1EV13 1IS3A 1LRHA 3BOPA 4KGGA 3KGZA 2XJPA 1CJPA 3M4FA 1G9FA 4Z82A 3ZFGC 3B9CA 4NWVA 1RUE1 2ILMA 5FO9B 5KHJA 1GICA 5K7PA 2NZ9A 1YI9A 2ZHMA 2YGMA 3I8TA 1PZ7A 1PK6C 1X7NA 5H9RA 4AGVA 1V9U2 2D5FA 5LK7B 2RR13 5L7OB 4U36A 4QGMA 2Y38A 4LLFA 1PMIA 3AKPA 2RHPA 1XE7A 4ES9A 1MS4A 3ALQA 4GMP0 3SHRA 1VBC3 3WR0A 1C1LA 1V6OA 3VDDC 3JB8A 1EAH2 1NCRB 4NHKA 3RS6A 1LHWA 2QKDA 3NL1A 5CFDB 3FFQA 2VOKA 4CEWC 3BALA 4S2HA 4KU8A 1AR82 3AZVA 3B93A 3AYCA 3FJSA 4M3CB 2WL1A 3NSTA 4ASLA 5A3MA 2DCZA 1HV1A 3LA7A 5J09A 1UU6A 2YUEA 1VALA 4LO5B 4MVTA 5K0UC 4L8QA 1ONAA 1DGRN 4IV3B 3ZMNA 4RS5B 1YCIA 2GU9A 1YIPA 2E7TA 4Q1RA 3UKNA 2N7GA 3D6EA 2VU9A 1DYKA 3N7JA 3ZMOA 4YVSA 4Y20B 2GNDA 5E8AA 1SFNA 2DVBA 2DWRA 3INAA 4FTEA 3ROUA 1H0BA 4JQRA 4CZSA 2VUJA 1ULEA 2WKKA 1LHVA 1F31A 3H0OA 3ZN6B 1QJU1 5C8CA 4QPGB 2R30A 2BWCA 3GALA 3PVEA 4DQAA 1W0PA 2MEV3 1S0JA 5CBLA 4FPHA 1CAVA 4Q26A 5BUVA 3VBHB 3TB0A 1YFXA 5BNOB 4YVWC 1AL21 1W6PA 3MFAA 4LA3A 4JGZB 1LCLA 4GKYA 4AEDC 4R9DA 2RS13 1ULDA 3DPRA 4ZU4A 1H8VA 2DURA 3TN93 2G9GA 3AJZA 1H8TB 2A3WA 3HIFA 4LA2A 1TNFA 4GH4C 3VUOA 3AX4A 1PIV3 4HL0A 1C8M2 3IWZA 3MYXA 2D6KA 5DG1A 2GZWA 1QMJA 4QQPA 2GMEA 1ENSA 3GZTB 1OA2A 2ZTNA 4OHWA 2D5HA 4Y1UA 4AI1A 1A6CA 3U4XA 4AVAA 3WINE 1QU0A 1UPSA 2WNEA 2ZX2A 1HQNA 1ZBA2 4I01A 2ET1A 3IM0A 4SLIA 4Q4X3 1O3QA 1PGSA 5DXDA 4JVAA 2W39A 4IEYA 4N53C 2JECA 2JXAA 2BQPA 4YARA 4UW6A 2D3PA 1SQ4A 2DU1A 5T54A 1RMU3 3WOGA 1X82A 3AMQA 2WNUA 4LBNA 4AGGA 1QKQA 4TZDA 1KQRA 4HN0A 1XQNA 2ARXA 1TMF2 1H2KA 1JUIA 1DZTA 2NMOA 1D2QA 3RJ2X 3PVBB 3WVJA 4JGYA 4HBNA 3VKFC 3CJIC 4WM7B 2MHFA 1S0IA 1OQ1A 3CL1A 1TE1B 3AYAA 4IESA 2QUOA 4RS5A 3RPQA 1RUF1 1KJRA 2HYKA 1N3QA 1PZ8A 2GNBA 3H1WA 3ZFEB 4XIOA 3RJRA 1D2SA 1COV3 1VR3A 1LEMA 3JD72 4Y20A 4KH9A 4E2SA 1OFNA 1QQP1 4GMP3 4TLFA 3WQ7A 3NW4A 4CDXC 3ZFGB 1KDMA 4XJZA 2QDRA 1FV2A 3FMGA 5JLVA 1OMIA 4J1WA 3BCWA 3QD6A 1MQTC 3JU9A 1G7YA 2GNTA 2YY1A 4MUVA 3ZN6A 1J59A 2VW2A 2XJUA 3VKLA 3OGJA 1R082 2R0HA 4M0HA 1C4RA 2Z5WA 2WA4A 4AE2A 3V0BA 3VBHA 1O5LA 3VBFB 4JAAA 4YG0A 3ZXFA 2WQ4A 1BQPA 5DUWA 4QM8A 4WBBA 3WDYA 3KLSA 2QCSB 3M3OA 1JXNA 1KFXL 1ND2A 2VNRA 4AVCA 1SMVA 1G9CA 4F83A 5I91A 5JI9A 1PHMA 3WQ1A 3NVCA 3E6DA 4DPNA 1NXD1 1W6OB 4E27A 4MGIE 4BMEA 1H8TA 4KG0A 4LBOA 1CAWB 4N9IA 2A7AA 3ME2A 1PNGA 2Y0OA 4BCUA 2PELA 4HN1A 1FPN2 2UWBA 4XTMA 3APBA 3IDEA 1XYNA 2VULA 3GNEA 2WFF1 2EIGA 1AX0A 3AXDA 5GALA 1LOFA 4EN7B 4OHXA 3ZSEA 3HN1A 1IHMA 2G9FA 4LO6B 4ZU5A 4CDQA 3L2YA 4PBPA 4Z92B 4META 4MXWA 2B45X 3FC0A 2AREA 2FHRA 4A3XA 2O0OA 1FNZA 5I93A 1VBA1 4QPIC 2OVUA 4OHZA 3IMNA 4IEWA 3LSEA 3EO6A 4QD2A 1VRH2 3AMNA 4Q4Y1 2C0ZA 3AXEA 3B01A 4URTA 4Q8KA 4JV4A 1U5XA 1IS6A 4YG6A 3ZIWA 4MH0E 4MGYE 5HBAA 1AYM2 2HWD1 3BODA 4Q1PA 4FTSA 1QJU3 3WP5A 4GB31 3N36A 1G9BA 5KWRA 1A3KA 1XU2A 2DVGA 2JG9C 4AFBA 3I59B 1LEDA 4FXKB 1PGL2 4PLMA 5JZGA 1BCXA 3OTFA 1FATA 4JRAA 5JOZA 1AL23 3ZXGA 1R1A2 5GLTA 2VNGA 2DFBA 4QU2A 1DQ2A 1KXGA 1Q8OA 5EWSA 1WCSA 2RMU3 3W9AA 5JIAA 1EY2A 3VGIA 4HVQA 5A32A 4J1XA 2A73B 2VY0A 1XNDA 5FQ0B 4HANA 2MPFA 4OULA 3WW1A 3FBYA 1GNHA 5EZWA 5FMOL 1DQ1A 4RQPB 2RJKA 1NQJA 2IXIA 4OLLA 3FLRA 3ZFGA 4RA0A 3PJQA 3FBMA 4FVVA 5IT6A 4Q0VA 1EP0A 3UV9A 3MW2A 5C9AC 2DFCA 3UJQA 4AEJA 2D40A 4AXOA 2I2SA 1F9KA 1YFYA 4ZXKA 1WMFA 4K6BA 2VXRA 3MIEA 3ZN4A 1VBE3 2Q30A 4F3JA 5ACA1 3BU7A 4IXLA 4CP1A 4BLIA 3QH7A 4QT6A 4YGBA 1ND3B 1PVC2 4ASMB 4XFBA 4YGDA 2VNOA 1C28A 4L92A 3VDDA 4XF3A 3AZWA 1O3SA 4FOVA 4O9GA 4CEWA 2GAUA 1LJ7A 1QJY1 5BNNC 1YRZA 1WW7A 3EBRA 3J8F1 1OPMA 4M3CE 3PJYA 3JZVA 5JPMB 3JBG2 1LHNA 1O91A 1AX2A 1QXJA 3K51A 5AC91 2AGSA 1GR3A 1KD7A 3HT2A 1ULCA 3OYWB 3ZYIB 3MIBA 1URXA 1Q3EA 2YGLA 1X33A 1BMV1 2BWAA 4ZU7A 2R061 1AXZA 2ZZJA 1SBDA 1J3PA 3R05A 1RUF3 5GM0A 4J6GA 4K9SA 4JTNA 3WG1A 3FFZA 1NG0A 4N9HA 4YM1A 5JMCA 2P3JA 1QQP3 3CLPA 4BA6A 1DF0A 2A6VA 4Y1XA 5CA6A 4O9EA 1GFF2 4COYA 2XLAA 4E2QA 1G86A 1DYPA 2DTWA 2WT0A 2BVVA 3WG4A 3JB4C 3UKVA 3MLLA 2B5HA 5LEJA 4MSVA 4JC1A 1RUI2 4BH9A 5D8AB 3GZUC 4LBJA 5FRAA 1VAKA 1DQ4A 4OUSA 4YVWA 1DGWA 3D5OA 3L2HA 1VBD1 5L7OC 1OD5A 1J3QA 4KU7A 4AEDA 3WW3A 1O4ZA 1RUJ2 3O0VA 3ZYPA 2A3XA 1CR7A 1LENA 3HWJA 2GC3A 2WA3A 3J26N 4BWOA 1Z78A 4ATFA 3KGLA 4AI0A 3VBRB 1FOD1 4GXLA 4M3CF 2Y26A 1B09A 1CD3G 1RUD1 1NCRC 4R9CA 2PTMA 4HKWA 1AR61 2LTNA 4GH4A 5CFDC 1RGSA 3AK0A 2XKOA 3T1MA 5A33A 1ENXA 1UX6A 3RDIA 1PNFA 1VIWB 5AVAA 4D94A 1W6QA 2AYHA 3I2DA 1FMD2 1ENRA 1XNKA 5BYNA 5GZEA 2WFF3 2ZAAA 5DDJ2 5T3NA 3CF6E 3ZX7A 3O14A 4IV3C 5IK7A 1TME1 1OI6A 1H30A 1TNRA 2Z69A 2E53A 4FPKA 1PO22 2JEMA 1K5MC 1ZZ8A 2NN8A 4QPIB 2XBO1 2JICA 5A3LA 4Q4V2 1EPZA 3D8CA 2PHUA 3RYKA 1VBA3 4N53A 2WZR2 1ND3A 1ULGA 2K0GA 4ISRA 4X6RB 2B8MA 3H1YA 3LOIA 3OY8A 4LEJA 2QJVA 2TNFA 4DRRA 1U12A 2JG9B 3W58A 4FSJA 2OUJA 2CGNA 2HWD3 1WBLA 1F5JA 3R6SA 3WD5A 1Y7BA 4C0HA 5KHIA 2A5ZA 4QPGC 3KB5A 1MEC2 1SBEA 5J36A 1ZREA 1WCDJ 4AYUA 3J4UH 1KJLA 1KDKA 3CJIA 3ETQA 3VBHC 1GLHA 3OYWA 1C3HA 1N1SA 2R042 5BNOC 3E5XA 4JGZC 1QWRA 1L3JA 5GZDA 2P3KA 2RS32 1WMEA 3JUUA 2Q8OA 4LE3A 4DY3A 1OPOA 2EALA 4WVMB 1JH5A 5JCTA 3SISA 2YC0A 5E89A 3RZZA 3NKGA 1H8TC 2ZPXA 2D7FA 1UU4A 4BLJA 2SBAA 2RS53 2VQ0A 5FREA 3AMPA 1MQTA 2UU8A 1D0HA 4FPJA 1UPIA 5C9AB 4B4QA 1SFYA 5E1RA 2B39A 3SCFA 1LOFC 1B35C 4Q4W2 4XYXA 2AZ5A 3ZYGA 2VMGA 2YHJA 5CAZA 5D8AA 4Y22A 5FOBB 2ZKNA 2RM21 2ATFA 4LBKA 2R6QA 1MS9A 2CAUA 3AKSA 1FAYA 4AVTA 1U5ZA 2IFRA 1JYCA 3DL3A 2VVFA 1REFA 1H1MA 2EAAA 3MGUA 2GMMA 1DZRA 3PMSA 3BPZA 4CDWB 1TQ5A 2I07B 5F6LB 4EWAA