1AX2A

Erythrina corallodendron lectin in complex with n-acetyllactosamine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LECTIN
publication title Structures of the Erythrina corallodendron lectin and of its complexes with mono- and disaccharides.
pubmed doi rcsb
total genus 52
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ax2A00
1KQRA 1EPWA 2EXIA 3D4KA 5E89A 1HLCA 4M3CB 1GLHA 4XDQA 1G9FA 3ZXJA 1WCSA 1QF3A 3B69A 3ASIA 2PHWA 2NN8A 4NO4A 1WW7A 1I1EA 3WVJA 3DUIA 3O0XA 1SCRA 1V00A 2ZGUA 4FOVA 1B09A 2ZHMA 4XJAA 5DG1A 3A0KA 1HQLA 2NP0A 3OY8A 3RG0A 4YGBA 1GZWA 1JYIA 1G8WA 4FPCA 5LK5A 3AYCA 5HCAA 2ZHLA 3B00A 5GM0A 2DV9A 4LBNA 4D69A 1QOTA 4ZXKA 5JDBA 3WNXA 1Q56A 4YW2A 1Q8SA 1W6OA 3AYAA 1UPSA 3O0VA 4YM2A 1LGBA 2ZGSA 4Q27A 5T5JA 5HCBA 1GZCA 3RMYA 3WDYA 5GZDA 1DIWA 4GWNA 1AX1A 1UKGA 3VKLA 1IKQA 2GDFA 2ZMNA 4Y1XA 4Y1ZA 2AH2A 1LHWA 1SLTA 4FQ4A 4XBLA 4Y26A 3LSDA 5GZFA 4LBQD 2A3XA 3D5OA 4DS0A 2GMMA 1WD3A 1SLCA 2ZGOA 4UW6A 2WQZC 4FVVA 1W6NA 3IM0A 4WV8A 1VALA 2A6WA 2PELA 3MW2A 4FP3A 4CTEA 3BOPA 1ULEA 5T5OA 1FATA 1WD4A 3FUOA 2D3PA 3LSEA 3PMEA 4FOWA 4XMIA 1N3QA 4DQAA 3ZXEA 1C1LA 1V6LA 4XIOA 4RA0A 2JE7A 4YM0A 5DUVA 3AXEA 4UW3A 2A6YA 3AJYA 4XIKA 1CIWA 2A7AA 3POSA 5H9PA 3WLUA 2RHPA 4Z8BA 2SBAA 5H9RA 3WOGA 1A3KA 3ZYPA 3INAA 3RQ0A 1HKDA 1C1FA 2E7TA 2YMZA 4Q1RA 2Z42A 3MEPA 5HCFA 3V0AB 5DZEA 1N1YA 1MS5A 2WT1A 3POWA 1DYKA 3SH3A 1AJOA 1UL9A 4YW3A 2D6MA 1LULA 5H9QA 2DVDA 1CJPA 4FPOB 3ZYRA 4Y1UA 4AVVA 4DPNA 2V73A 4C1XA 1LECA 3SITA 2WT2A 2D6LX 5EXOA 1Q8OA 1G9DA 2D7FA 2JECA 3IN9A 1ZM1A 4HL0A 2G4IA 3UJQA 1IS5A 1JBCA 3GNEA 5GALA 4GXLA 3UL2A 1GYKA 2YZ4A 3USUA 1UN1A 2NMNA 1AX2A 3WHUA 5GZEA 2GMPA 1JHNA 1ULFA 3AZVA 5CA6A 3OY8B 4GA9A 5JOWA 1O4YA 3UJOA 4YW4A 4AVSA 1FYUA 1GZWB 1LHOA 4FQZA 4WVWA 4XTPA 1UMZA 3RSJA 1KITA 2GALA 1W6QA 2OVUA 2CL2A 2LTNA 2YV8A 1S1AA 1D2SA 2P34A 4XJUA 2ZGPA 1KJRA 3I8TA 1W6OB 1W0PA 4ITCA 4JRAA 3OPZA 1UAIA 2DU0A 3NV1A 2AREA 3Q9OA 2JDZA 4YM1A 3AJZA 1LENA 2WLQA 1LTEA 1F9KA 3AZWA 5DZFA 3APBA 3I4IA 3SH5A 1DQ0A 2EF6A 1LOEA 4FPLA 4XILA 4YZ2A 4YG6A 2VW2A 1G9BA 4XBNA 4BLIA 1APNA 1GZ9A 5IT6A 2P3IA 2I2SA 3T1LA 1A8DA 5FREA 4P9XA 2CWMA 2JJ6A 2Q5TA 4YM3A 2PHFA 2V5YA 3RRDA 4LBQA 1W6NB 3PJQA 2DU1A 3M3CA 1QKQA 1H9WA 5KXBA 2VW0A 3A0NA 2E6VA 3O12A 4BPZA 4XE9A 5KXEA 1IKPA 2A6XA 2VY0A 3ZXFA 1QOOA 4JCKA 4XBQA 3FLTA 3RMXA 1LOBA 2DUOA 1F5FA 2JKBA 3B9CA 1AXKA 1OFSA 2A3WA 3ILNA 3M3OA 1S0BA 2W52A 1CPNA 2FMDA 3M1HA 3O5SA 3TB0A 2GNDA 3OJBA 4SLIA 4Y1VA 1LU2A 1A78A 2ARXA 1Z0HA 2WSVA 3MW4A 2FHRA 2A71A 2WJSA 2ZACA 2E53A 2SLIA 1WLWA 4NOTA 2YXSA 1AXZA 2EXKA 1S0DA 4YZ3A 4TYSA 2VH9A 1H30A 4YFZA 1QMJA 1YI7A 1RINA 2EALA 5GLVA 4YW1A 3WG1A 5GZCA 3NV2A 3D6EA 5F9TA 4PBPA 1HQWA 1LHNA 4AGGA 4FPKA 4Y20A 1MR5A 2H0BA 1LGCA 3KQRA 3M3QA 3USUB 4BM8A 1MS3A 2VXRA 3KM5A 5JOYA 5GLUA 1GANA 3SISA 1LHUA 5EYXA 3AZYA 1QNWA 1JUIA 5T52A 2R1BA 2DYCA 1W6QB 4P14A 1ENQA 3V64A 1BXHA 3ENRA 1JYCA 3SLIA 4BLJA 1LCLA 1CN1A 2D43A 1LHVA 4AGRA 2CYFA 1DQ5A 1S0EA 2PHTA 4Q8KA 1WW4A 1ENRA 4RL7A 3ZPYA 2WSUA 2P3JA 3V65A 1ULCA 2CNAA 3R4SA 3O0WA 1QDOA 5JOXA 2R49A 4FPJA 5IUQA 2OUHA 2NYYA 1U0AA 4PF5A 1N3PA 3ZSMA 5H9SA 3AZZA 1MZ6A 4ISRA 3N3HA 4PCRA 2ERFA 4LBQB 5JLVA 3ATGA 5IK5A 2WT0A 3ILFA 1NXD1 1WUVA 5DUXA 2PHUA 4UW5A 3V0AA 4P9WA 1CVNA 3ZSJA 1V6MA 2E51A 1SBDA 1DZQA 2A6ZA 4AGVA 1YIFA 3FBYA 1URXA 3SNMA 5GLTA 4JC1A 4HANA 1QOSA 2DUQA 3BTAA 3OYWA 1DFQA 3N35A 3ZVXA 2ZZJA 1BJQA 3RS6A 1LOFA 1WBLA 3WDVA 4K1YA 4FOYA 2ZHNA 3WG4A 5KXCA 2D6NA 2AYHA 3VKFC 2ZBJA 2ZGNA 1CR7A 3AP9A 4GWMA 5DXDA 4Y24A 1AJKA 4YW5A 1KDMA 1JW6A 1LGNA 1PZ8A 3AX4A 1N3OA 2D6OX 4FPYA 1LEMA 2ZGMA 4H55A 3HR9A 4C1WA 2OW4A 3PVOA 1WBFA 2NM1A 1V6KA 3OGGA 3W59A 4ISQA 1QGLA 4BOWA 1GNZA 2DWRA 4CRQA 2ZHKA 3L2YA 2PHRA 3VKOA 2D3SA 2VUAA 3N7MA 4YZ4A 1SBEA 1Y7BA 1N47A 1O4ZA 5T54A 1ONAA 5E88A 2W39A 4U2AA 2ZGKA 2P2KA 1V6NA 4XTMA 4XOGA 5EWSA 2W08A 1MS9A 1RIRA 4Y20B 1FV3A 2GNMA 2DUPA 2ZGRA 3ZSLA 1MACA 3B3QE 2B7YA 1Q8PA 1SFYA 2A3YA 4K20A 2OUJA 1S0JA 3WUDA 1FV2A 2AGSA 4YZ1A 2DVAA 2JE9A 4BMEA 5GZGA 4M3CF 2YROA 4K21A 3AYDA 1W0OA 2ZMKA 4XYXA 1BKZA 3OBTA 2C5DA 5F5QA 3WDUA 4GALA 3N7KA 4ATFA 3HMYA 4ASMB 4XJZA 1AVBA 2DTYA 1C4RA 4R9AA 1LOCA 1DBNA 1MVEA 4XJ8A 1KDKA 4Q2FA 4XJ9A 1DQ6A 4M00A 5T5LA 3FUQA 1GV9A 1GBGA 1LOFC 3POYA 3TAYA 1KJLA 2NZ9A 4BQ1A 1MZ5A 3JUUA 2A75A 2ZKNA 1AXYA 1V6JA 2AENA 3AP4A 1DQ2A 1UZYA 1LJ7A 2ZAAA 2W68A 1BYHA 4P9YA 1KRIA 1CQ9A 5GJ6A 3CNAA 1GICA 1F31A 1YYNA 3AXDA 3H0OA 1IS6A 1MVQA 1IOAA 4FOQA 1I3HA 5T5PA 3NWKA 1Q8QA 3WDWA 5E8AA 3GALA 2AUYA 3LCPA 4XZPA 3OYWB 3VV1A 2D6PA 2VW1A 4AWDA 2CY6A 4Q1PA 4XXAA 4ZKTB 4LBMA 4GKYA 4XXPA 1VAMA 3AP6A 3PVEA 3QCWA 2UU8A 1JXNA 3MPPG 4YZ5A 2ZA9A 3ZSKA 4CZSA 1SLAA 1RITA 1YRZA 2ARBA 2DURA 2HYKA 5DG2A 1V6IA 2P3KA 1S0GA 4KBBA 1R1ZA 1X50A 1ZA4A 3IPVA 3WV6A 1ULGA 2UWAA 4XHBA 3WZ1A 3M3EA 1H9PA 1GKBA 4YG0A 2GNTA 1DQ1A 2R1DA 3AZXA 5CB7A 2A70A 1LOAA 2EXJA 4K1ZA 3T2TA 3WUCA 1W6MA 4Y22A 5CNAA 2GMEA 1FNZA 4L8QA 1G9AA 1LEDA 2KM2A 4PBOA 3JU9A 5JVVA 1DQ4A 4XJWA 3VKMA 1AZDA 1QNYA 2D3RA 4FPGA 4WZFA 4XMAA 5IK4A 1SLLA 2DVBA 2ES3A 5L73A 1Z78A 4DRRA 3U4XA 4DFSA 1FX5A 4AVTA 2ZGTA 1TEIA 2P37A 5GLWA 1FNYA 3N7LA 5GLZA 1DYPA 3ZXKA 3M2MA 5JOZA 4GKXA 1FAYA 4IQPA 1VIWB 4Q8LA 3ILRA 3V0BA 3WHTA 3AK0A 1S0CA 2UURA 3DGTA 2GN3A 2WNEA 1ULDA 2CTVA 4F83A 4YFWA 4YLZA 4AYUA 1S0FA 4XHXA 1W6PA 2WKKA 5T55A 4R9BA 5JMCA 4R9CA 3AP5A 2D44A 1AX0A 2ENRA 3C2UA 4FP2A 3WCRA 2D6KA 2GN7A 4M3CA 1HDKA 3AP7A 4FPFA 1NLSA 1OQ1A 2R0FA 4ATEA 2BQPA 2NMOA 2XB6C 2DVFA 1LODA 1QU0A 4YG3A 3AFKA 5IK8A 2EXHA 1MS0A 1N1SA 1D0HA 1GSLA 4U36A 1GNHA 1CPMA 1ENSA 1IS3A 1SLBA 3HN1A 4OZXA 1BQPA 1DHKB 1DGLA 2E7QA 5DZGA 2A5ZA 1BZWA 1UX6A 2UWBA 2ZABA 2LALA 3OBRA 5KXDA 4R9DA 2EIGA 3WCSA 4LBKA 2VU9A 2GNBA 4DRVA 3QLQA 1N1TA 1CONA 1YXWA 4M01A 2C9AA 4Y1YA 1SCSA 4M3CE 2DVGA 3VKNA 3ZXLA 1SLIA 3A4UA 4UW4A 1AF9A 2JD4A 1WW5A 4TZDA 1UZZA 5AVAA 3T1MA 1DLLA 3SH4A 3FLPA 3WDTA 5BYNA 1MS8A 3FFZA 4YGEA 1N1VA 1MS1A 2CWSA 1VAVA 2ZMLA 3IPVB 4I30A 4Q26A 3BODA 1CESA 4MYEA 4LBLA 2R0HA 3BIWE 3WG3A 1WLDA 3WG2A 1S0IA 1JN2P 3IKWA 1WLCA 1W6MB 4LBJA 2UWCA 4Y22B 3UK9A 1LU1A 5EYYA 1G9CA 5T50A 2YY1A 5CAZA 5DUUA 1WW6A 1JOJA 2A6VA 1Q8VA 3N36A 4PQ9A 3IMNA 5IK7A 1PZ7A 1XQNA 1G7YA 4FPEA 3VUOA 2XG3A 1PZ9A 2PHXA 2ZGLA 4LBOA 3MW3A 5CBLA 1C57A 3PVNA 3R05A 2ZGQA 4FPHA 1IS4A 1SBFA 5FRAA 1MS4A 1V6OA 3B01A 2AR6A 1J1TA 2DTWA 3AYEA 1OKQA 2EAKA 3R4UA 4YGDA 3V0BB 1VLNA 2R16A 1LOGA 1G86A 5SV8A 3W58A 3NV3A 3NV4A 4WVVA 3WDXA 3N7JA 4YGCA 4BMBA 3FLRA 5DUWA 1SACA 1QDCA 1YO8A 1W6PB 1LESA 2TEPA 4W65A
chains in the Genus database with same CATH superfamily
2YBPA 5FZOB 2WWJA 1HRI2 2EXIA 3D4KA 5IVYA 4CCCA 2GP5A 3X29B 1GLHA 3ZXJA 1RB8G 3PTYA 4LT5A 2PHWA 1Q3EA 3D3AA 5EJ1B 2FDKA 4DY5A 1HRI3 1NLQA 1NZIA 3K4ZA 3I2JA 3M70A 3EO6A 3M7AA 1AR61 1OLQA 2Z79A 1IZ3A 3N9LA 5FKBA 4RS5A 5FAXA 3MGUA 1PGW2 5HCAA 4OI4A 4H14A 3W20A 4LBNA 3I54A 5FMCA 4Q0VA 2RDSA 3WNXA 3AYAA 2ZZQA 2ZGSA 1ALYA 4Q27A 4XQ4A 2R042 3I3BA 4B7KA 1RJ8A 3DN7A 1DIWA 2X5IA 2HKXA 2IXLA 4FFHA 1K5MC 2RS32 1UKGA 5IWFA 3TBDA 4YVWA 3DXUA 5FTTC 4Y1XA 2GDFA 4P00B 2R043 4FFIA 1LHWA 4FQ4A 4EWDA 5HXVA 2A3XA 1RUH2 2EAAA 3IDBB 1AR91 4RR3C 1WD3A 1JS9A 2PYTA 1I5ZA 2B9VA 3H3ZA 3IM0A 2A6WA 3T2QA 1RUH3 5BNNC 4QQLA 4PLNA 4UFMA 4UWDA 3FUOA 4BQ4A 1VB4A 2D3PA 3NNLA 4AFBA 1OKOA 1N3QA 4XZUG 4CCEA 3LFIA 4TN7A 1UU4A 4DIQA 1P8JA 4XIOA 2JDHA 4QDRA 1PO23 5LEKA 3K3OA 4UW3A 3DV8A 2A6YA 1CIWA 4QX0A 1KGYA 4Z8BA 1UMIA 2SBAA 3ME2A 5FK8A 2FD8A 4XAEA 1A3KA 5C3SA 4P02B 4CP1A 4M4PA 1J1LA 2IZWA 4RGAA 1HKDA 1H0BA 1R091 3WP6A 5E1RA 3WNMA 2HWC1 2OZJA 2YMZA 5FY4A 3ZPOA 5AFBA 5HCFA 3B93A 3V0AB 1N1YA 1J3QA 1YI9A 3POWA 3RNSA 5LCWL 1RUC1 2WABA 4HKOA 1ND3A 2VVEA 1UKRA 1GOHA 4RS5C 2BP6A 4HSLA 3MIHA 4DPNA 3ZFGA 2GH8A 4C1XA 4C90A 4KMQA 1LECA 2WT2A 2XVGA 3ZR5A 4C0BA 1C5IA 3VHOA 5IVEA 1G9DA 1BLZA 2G4IA 3EHKA 1RUNA 1IS5A 1CD3G 3LZZA 4DXZA 4GH4B 5JI9A 3GBWA 5L9RA 2X5IC 5A3OA 3OBAA 4XETA 4MLOA 4QKNA 2GMPA 4YVWC 3VBOA 1JHNA 5LZ6A 3Q8CA 1ZRDA 3MO4A 4YW4A 3PUIA 3DL3A 1LHOA 3RSJA 3E6BA 3VBUB 3WP5A 1BBT1 1KITA 4ES8A 2OZ6A 5JZGB 1NY72 1W6QA 2GALA 4BK4A 2ZTNA 3DPRA 1OBNA 3ACLA 2QQUA 4XJUA 3C3VA 5FXWA 3UNPA 1UAIA 3NV1A 4Y4RA 3NAPB 4BE3A 3KVAA 4LMFA 4NAMA 1E5IA 5F32A 2WLQA 1LTEA 5DZFA 3SH5A 1DQ0A 1GFF2 1LOEA 3EJKA 4FPLA 4YG6A 4XBNA 4EN0A 3DEMA 3VHPA 5BNOB 4FFFA 1APNA 2WBKA 5IT6A 2Q5TA 5D8AA 2PHFA 5DAQA 2V5YA 2Y6HA 3GBGA 4NRMA 1CAVA 1K45A 2DU1A 3AMQA 2PHDA 2RS11 1OA4A 3NNMA 2VW0A 3O12A 4XE9A 1IKPA 2HWF1 4Q4W1 3ZXFA 1ND3C 1UPIA 2OT7A 4GMP1 3MZHA 1OLMA 1RXFA 2DUOA 3ZFGC 1OFSA 2A3WA 3ILNA 4XUNA 2FMDA 1GQHA 2UY9A 3M1HA 4CDQA 3IB3A 3GZEA 3KF5A 1LU2A 4C0HA 1UZ0A 1ZBA3 1RUOA 1RHI2 2A71A 2WJSA 5FO8B 2SLIA 4AHZA 3VBOC 2XL9A 4JDOA 4QB2A 1O59A 4COUA 2EXKA 1DZRA 1O5LA 3HBKA 4Z2AA 5FPUA 1RHI3 1WCUA 2B8MA 1YI7A 2VNOA 4CXYA 1OLME 3MF6A 4XAAA 3DPRC 5GLVA 3SKJE 1PGL2 1XNCA 4X6QB 3KCYA 4RQPA 3D6EA 3D0SA 3LOBA 3KS7A 3WF1A 1LHNA 2XJUA 3BKZA 4Y20A 2H0BA 4QKDA 3H7JA 3M3QA 4A6OA 3ZYGA 4BM8A 2VXRA 3ORJA 1XNKA 5GLUA 3D82A 5A80A 3SISA 4AW7A 4URTA 1JUIA 1OA2A 2VCMA 2PMWB 1ND2B 2CDPA 1XPWA 2VZ3A 4I01A 4V2VA 2BBVA 2CV6A 2DYCA 3LPFA 5BNPB 3UGGA 5D8AC 3QBQA 4KBZA 4MHRA 3ZO0B 2D43A 3RJ2X 1LHVA 2VZPA 2WNVA 4AGRA 3DKQA 1PM7A 4D7SA 2ARCA 4XFGA 4D7YA 5CU1A 3NSTA 2JG8A 4RL7A 4P08A 4NIAA 1JYNA 4CEWB 1ULCA 1UF2C 3K75B 3O0WA 4AHXA 3UKVA 2BNOA 4P5HA 4FPJA 4AAPA 2OUHA 1OI6A 1U0AA 4AF9A 5LA1A 2XBO1 1SFPA 4LKEA 4CDQC 4QX3A 2V4AA 1GP5A 4Z1VA 3I49A 1VE0A 4MOAA 2W5FA 4UFJA 4LBQB 1JODA 5CZKA 1IGOA 3ATGA 5IK5A 1DGRA 2WT0A 3T0BA 2VQ0A 1WUVA 1LB2A 3ZYIB 2JDAA 2JKXA 4OFGA 4RGGA 5A7PA 3HQRA 1NX9A 3JQWA 3B5LB 3N9MA 1IQDC 1C3HA 3KB5A 3UGHA 4B8EA 1EYBA 4Z82A 1KFXL 2YFZA 2DCTA 1YHFA 4OI2A 4DUWA 3RS6A 2J7MA 3CL1A 1RMU2 1VBD1 1WBLA 2ATFA 3MBWA 4K1YA 4QU1A 5L9BA 4NPRA 2QQJA 2PN5A 2ZBJA 2ZGNA 2UY8A 4J1XA 4RQPC 1AJKA 3AKSA 1JW6A 1PZ8A 3AX4A 1NXMA 1LEMA 1RMU3 4NJ4A 3HR9A 2OW4A 5JSRA 3PVOA 1WBFA 2WQ4A 1EP0A 2OS2A 1BK1A 2WYFA 2YG0A 2Z4FA 2QZ3A 4ISQA 4KI5M 3CJIA 4RN5A 5DDJ1 4BOWA 5C4WB 5A7NA 3LKJA 2R073 2VUAA 4Q5OA 1SBEA 5JR7B 2OPKA 1N47A 3JZVA 5T54A 3B9IA 4WBBA 2W39A 1FXZA 2VZVA 2WNVC 1V6NA 2HWB1 2N7GA 2VMHA 5EWSA 1CX1A 3LA2A 4HMZA 1MS9A 2WUHA 4AL9A 4CDWB 2JG8C 3VGIA 1QQP1 3RPQA 3WW4A 1S2EA 2XJTA 2ZGRA 3VBSB 2BGCA 3DYMA 4V2WA 2E63A 3U11A 5K9YA 1XSRA 4BQ2A 1J3PA 1VBE3 2A3YA 2C26A 2J1SA 2OUJA 4K20A 3PU3A 3GZAA 1W2NA 5CKQA 3S5AA 4YZ1A 1OF4A 3E5UA 2DVAA 5C3QA 1O6UA 4Q4Y2 5FKCA 4DXSA 4YVSB 5F39A 3JD71 4OVEA 5CFDB 3OBTA 5ABJB 2IVJA 2ORXA 5F5QA 2BDRA 4JGZA 5J98B 3WR0A 4ATFA 4DMIA 4LNVA 4XJZA 2WNOA 4Q4Y3 3P5BA 1ZZ8A 4XJ8A 4I09A 2BEOA 4Q2FA 4QB1A 4N7IA 1DQ6A 1J84A 1H2NA 2JDKA 2RS53 5FY5A 5T5LA 2GC2A 5A7SA 4QDSA 3POYA 5FUIA 1KJLA 3HNMA 1MZ5A 1SEFA 4KQ7A 3WEZA 1AXYA 5IVJA 2XWBB 4UAPA 1NE4A 3JBG3 3W9AA 3CHXA 2XJQA 4B1LA 4E4ZA 1YQ6A 4LTAA 1CQ9A 2P6HA 3KT4A 3AXDA 1F31A 3H0OA 4COWA 3NWKA 5C4WA 3RZZA 3T0DA 1Q8QA 3WDWA 1QWRA 3CJIC 4YW6A 4XZPA 1ASJ2 4FTEA 3OYWB 3KV9A 4E2QA 2D6PA 3GCXA 1AL21 3HOBA 3L2HA 4TLFA 2QQPA 4K40A 2CY6A 4Q1PA 4X8PA 5FPAA 3VZKA 1OUXA 1KFUL 4GKYA 1GQPA 4RHV1 3AP6A 3PVEA 1ASJ3 4AK3A 1JXNA 3MPPG 3HJRA 2HLEA 1LR5A 4CZSA 1TE1B 1YRZA 2ARBA 4ZY9A 2Q1FA 4IE0A 5JWPA 1FOD1 1YFUA 2P3KA 1YJKA 4UXAA 5D21A 1ULGA 4XHBA 3WZ1A 1JZ2A 1H9PA 2Y26A 3KV6A 1JMUB 1NLRA 4CEYA 2Y60A 2A70A 4LO5B 1W6MA 2HBTA 2GMEA 1J58A 2QVSB 3CU7A 3JU9A 4NROA 1RUJ1 4XJWA 4GB31 1AZDA 2D3RA 3FE5A 4WZFA 1GMMA 4B4RA 5AC91 4JGZC 4MGYE 1SLLA 2DVBA 5L73A 2R061 3ZN5A 4ASKA 4MXWA 3B02A 2IFRA 2ZGTA 4AQSA 3RZHA 2P37A 4CCNA 1BCXA 1QJEA 4WM7A 2LM3A 4BYYA 4HLTA 3SKVA 5JOZA 4GKXA 5T3NA 1DGWX 5FY9A 1FAYA 2VVFA 2D98A 3K51A 3ZN4A 1RVF2 1H2KA 1FMD3 2DFCA 3CQOA 3V0BA 4A4AA 5FZCA 2ZX3A 2K46A 5FZHA 3ZX7A 4Q0QA 1ULDA 2CTVA 3EYPA 2BOIA 5C7GA 1OLRA 1TMF2 1Y9GA 3J9SA 4YFWA 2VZQA 1RVF3 1W6PA 4K3UA 5C4WC 5FYIA 1RUE1 1HN1A 2BUKA 2J1VA 4AR2A 4HK9A 3ETPA 4ZXEA 2Y33A 3AP7A 1POV0 1OQ1A 4FPFA 2DCZA 2D5HA 2DVFA 2ZEWA 3H3LA 5IK8A 1BEV1 1AR71 3FHIB 1NOVA 1ULPA 5BV6A 1MS0A 4OHWA 1GSLA 4U36A 1GNHA 4Q0PA 1POQA 1XE0A 1HXS2 2YPDA 4AEDA 4CPBD 5EHDA 1RUF2 3OG2A 1UX6A 4QX5A 2LALA 5KXDA 3V56A 5FV3A 2CDOA 4LOTA 4LBKA 1FPN2 1HXS3 2VU9A 5DAVA 4DRVA 3QLQA 3Q8FA 2WWUA 1RUF3 4CEYC 1VR3A 1C28A 1SCSA 4PQQA 3MV01 4AQ2A 2X10A 1ZZCA 3VD4A 1FPN3 2WZEA 2PQQA 4PT6A 4IL7A 1UX7A 4N43A 1QH6A 1V70A 4HBNA 5AVAA 1HV1A 3VL9A 4AVBA 5BUVA 4CDUB 1CIYA 1X7NA 3KHBA 5BYNA 1MS8A 3FFZA 1C8NA 4I30A 2ZMLA 1U5YA 1WA4A 5K0UA 4A45A 1CGPA 1CESA 4MYEA 2LROA 3PLQA 2XJSA 4LBLA 3MICA 4WM7C 4QU2A 2VZOA 1UO9A 3IDAA 4IGPA 1WLCA 4XUOA 4XPVA 3ZDSA 3OGVA 4EYUA 4XUQA 4IV1B 4W6XA 2YY1A 3T08A 2E26A 5FQ0B 1X9TA 1TNRA 5A6QA 4PDWA 5IFPA 2WR9A 2ZX0A 1XQNA 1QJY1 5A33A 1UY2A 3DCQA 4LBOA 3MW3A 1VJ2A 3I2KA 5FZ6A 4DINB 1C57A 4I0BA 4PLMA 1UMHA 3RZLA 1PVC1 1KEXA 2XUEA 4XABA 5M0TA 1JYTA 2AR6A 1J1TA 2XONA 4O9EA 4PF1A 5A1LA 4AQ6A 4NRQA 3D0JA 4XFHA 3W58A 4AEDC 4P9GA 3NV3A 4RD7A 3I97A 3VBFB 2VPVA 2VTFA 4NAOA 5C9AA 1VRH2 3I2HA 3O1PA 3O1SA 1HB2A 3H50A 4PI0A 1QXPA 1SDWA 4TXWA 1V9U1 4M3CB 1AHSA 3LDKA 4XDQA 1G9FA 1VRH3 2GC0A 2W1QA 1AYN1 3B69A 2PLV1 4NO4A 1I1EA 3NRUA 5FLHA 3WVJA 5C5UA 1O91A 3O0XA 4BH9A 4K6BA 1SCRA 1XNTA 2ZGUA 4N43C 4N7UA 1B09A 1QEXA 3EB7A 4XJAA 1NCQA 2BBAA 3A0KA 5FUNA 2NP0A 4NHLA 3WNOA 1CAXB 4YGBA 5LB6A 2JDPA 1QJZA 4AZZA 2E33A 5I8SA 4A7YA 3AYCA 2ZHLA 3I59A 1BVP1 3MIGA 3B00A 4LO8A 4DB5A 5K0UC 5KHGA 2DV9A 1U5ZA 3N9PA 4D69A 3FFQA 3I3DA 3SCGA 2ZEXA 2W3JA 1W6OA 5T5JA 3J4UH 4NVPA 1A34A 3W5MA 2AACA 1OC1A 3WDYA 5FXXA 5FP9A 2E31A 4XFCA 1AX1A 2VM9A 2A1XA 1I9RA 2BZDA 4PDWC 5KHHA 1IKQA 4Y1ZA 3VKLA 1NQJA 4XBLA 1HIXA 1YWKA 3LSDA 4LBQD 4LUKA 1VBB1 1YCIA 2PFWA 3GM8A 1H4HA 4QQPA 4WVMB 5K4LA 4DS0A 1AR82 1UYZA 2ZGOA 3I3EA 4HSJA 5HV4A 2CAUA 1O3TA 2JG9B 2F6BA 2Y38A 2L9LA 4QDQA 1VALA 3MW2A 4LA3A 4FP3A 1REDA 1ULEA 5T5OA 1FATA 1AL0G 2X29A 2YBSA 1AR83 4AI2A 5J36A 3TEWA 2BV4A 2F4LA 4FXKB 1K5MB 3OUHA 5BNQA 1LNSA 3FMGA 3ZN6A 4E9KA 1C1LA 3WNPA 1V6LA 5C9AC 5IVVA 2VNRA 4YM0A 1U12A 4UOJA 3AXEA 1JYXA 3AJYA 4LO7A 2CGNA 1QXJA 3SQOA 4XQWA 4RR3B 3WLUA 4AOCA 4UBGA 3R4DB 3PURA 1IPKA 4E4SA 3MDPA 4DXTA 1QH7A 1C1FA 2E7TA 2E9QA 4FFGA 4Q1RA 4CCJA 5BNNB 3MEPA 4IETA 3LGRA 4DUXA 1OT5A 1DYKA 1NCQC 2QCSB 2D6MA 3GGLA 4YW3A 1CJPA 1QJX1 2VMCA 2VULA 1O4TA 2Y6GA 4Y1UA 3W21A 4I0WB 3POFA 4AVVA 2WFF1 5KXCA 3I2OA 2UYAA 2D6LX 1F5JA 3O14A 4CUGA 2WZ8A 1FT9A 3T0AA 3UJQA 2Y34A 4DEQA 4E2SA 3IAQA 2YBKA 3N9NA 3GNEA 5LY2A 1RUD1 1CJDA 1GYKA 2BOJA 1NT0A 3UL2A 2VE1A 3USUA 3HT2A 1UN1A 2Y6KA 1AX2A 4DZGA 3S0MA 1ZRIA 4Q4V1 4URAA 2Y0IA 1O4YA 3UJOA 2RR11 4XTPA 1UMZA 2YC4A 3HT1A 2Q8CA 3BUCA 1XOYA 5L19A 5FP7A 2JG9A 3TN91 2OVUA 3WNNA 5C3PA 1D4VB 1JHJA 1JZ6A 2WC2A 3CZJA 1RXGA 3I2FA 4UT5A 5HBAA 2DU0A 5F8PA 4ZS3A 2JDZA 4K7JA 1W8WA 2W9XA 3AJZA 4D0QA 1W8HA 4DXRA 3H1WA 4L99A 5FPXA 4QM8A 1QY4A 2X5IB 4MVTA 3AZWA 5FCCA 2MPFA 2QQMA 5FXZA 4N90A 4YVWB 2EF6A 5A6XA 5ACA1 4SBVA 4YZ2A 1G9BA 3ACIA 4BLIA 1DGWA 4QT6A 3OEAA 2P3IA 2I2SA 4QB6A 2JJ6A 4NMIA 1L3JA 3ST7A 2WRAA 2ET7A 4BQYA 3IDCB 3P3PA 3RRDA 3AKRA 3WSOA 3PJQA 2BTVC 3M3CA 5I0UA 4DNYA 4LIVA 5K7PA 3LD8A 3HPNA 1WZXA 2CSGA 2E6VA 3A0NA 1E57A 5CG9A 1ACCA 2A6XA 2VY0A 1QOOA 4XBQA 4LXLA 3ZYJB 3N9OA 3ZXDA 4D7TA 3THPA 3FWEA 3RMXA 2P6CA 3DXTA 1F5FA 4COYA 3B9CA 1DGRN 3NJXA 5FJHA 1S0BA 5DPNA 4N8MA 3MFAA 1NCRA 4KWKA 5JSOA 1COV1 2RMU1 4LQRA 2F4PA 5FZFA 2GNDA 3M3IA 1MEC1 3OJBA 3PL0A 5FZ9A 3TEXA 3WT3A 4EN7B 4FAHA 2VQAA 1X9PA 5LATA 2ARXA 3EMRA 2Y6LA 1XYPA 5FP4A 3DYPA 5A70A 4L92A 3VZLA 1KS4A 2E53A 2VTXA 3C7OA 4OMCA 5FZAA 5FO9B 3O1OA 1ND3B 2YXSA 4META 2CAVA 4Y5TA 4YRDA 3MF9A 2BERA 2K0GA 2RJKA 4YZ3A 2VH9A 1DP0A 3ZFGB 2C0ZA 1QMJA 1CAWA 2JG9C 5HV0A 3S7EA 1SG3A 3AMNA 3OOXA 5ANNA 3WG1A 5FZLA 4AI9A 5GZCA 3NV2A 3IZOA 5C71A 2P4EA 4PBPA 4GZ9A 1OH4A 2I07B 1MR5A 3ABZA 3I3QA 3L9JT 1LGCA 3KQRA 4FPKA 4MGZE 4QAWA 1MS3A 5FZ3A 3FC0A 4HZFA 3VBOB 2HWB3 2W91A 5JOYA 1LHUA 4IEYA 3AZYA 1LAJA 1QNWA 1R1A2 4UFHA 3CBNA 1Q5OA 1TG7A 1PO11 2WO1A 4EZ4A 1XXNA 2D97A 1W3VA 1QQP3 2QQOA 5FYBA 2V5DA 1UW8A 5I8YA 3CDZB 1F35A 1MPXA 1SPPA 2X8KA 1W6QB 5JXIA 3MPBA 3DPRB 1ENQA 3I2DA 2Y64A 3ENRA 1ZZ7A 3U4SA 4X6RB 1R1A3 1CN1A 4IERA 2FBEA 1PO22 3H1MA 1S0EA 1YFWA 2GU9A 2PHTA 3GCWA 3QD6A 1ENRA 3CLPA 1F15A 1GP4A 2WSUA 2P3JA 3PDQA 5FJKA 5FZ0A 4LKSA 2FMYA 3JQXA 2VMGA 3J7LA 4XCAA 1WKYA 3CF6E 2QQWA 4KU7A 1GQGA 2F17A 2Q30A 2WN3A 4HFSA 1NCRC 1YJLA 3LWCA 2VNGA 5D8AB 5ANQA 1UY3A 1G6NA 2D40A 1H6XA 3N3HA 2ERFA 4Q0SA 1RUI1 3BALA 4NWVA 1CAVB 3NO8A 1NXD1 1QXRA 1EV11 2IC1A 2PHUA 5DUXA 4UW5A 1ZBE1 5FYTA 1CVNA 5B4NA 4LO4B 2JWPA 3BPZA 1SBDA 1DZQA 4B4PA 2A6ZA 3FBYA 1URXA 1RUG1 5GLTA 4JC1A 1VRBA 4A44A 3BTAA 1SZBA 5F6KA 3LEIA 3WDVA 1YQ2A 4FOYA 4RYDA 4IESA 3EQEA 4CDQB 4AVAA 4GWMA 1CR7A 5DXDA 1OQEA 1QJFA 4YW5A 2B42B 3VD3A 2D93A 1AL23 5TSWA 1ZRFA 2D6OX 1VP6A 1W90A 2QZ2A 1D0GA 2WA3A 4C1WA 1FOD2 3LPGA 5AFEA 1V6KA 4RHV3 1C8M2 2VOXA 4HKLA 4QPIA 5G04L 1XNDA 2GSYA 2WZR1 1GNZA 1SFNA 2VZSA 5FMOL 4CRQA 5FR3A 1M4WA 2D3SA 1Z7S2 4I3GA 4ZZ5A 5HPOA 1FOD3 3N7MA 1C8M3 2B4KA 1O4ZA 2G9FA 1ONAA 5E88A 5FPVA 2J1EA 4LHKA 4JTNA 4RQPB 3S30A 1XNBA 4B29A 1Z7S3 2MHFA 1W8FA 4Y20B 2EIEA 3AFGA 2VNVA 1MACA 3B3QE 1T6BX 2ADEA 2P17A 1Y9QA 1ZA7A 4GB33 3ES1A 1DU3D 5AC93 5B4XA 4BJ0A 1RC6A 5F6LB 3RZJA 2O0OA 4QGMA 2AGSA 4BISA 3LOIA 4XURA 5DAWA 1VBA1 4BZ4A 2NQYA 2D5FA 3RZGA 4XFBA 2JE9A 5FMOS 3T4HB 4M3CF 2IXHA 2WNVB 1OVPA 2YROA 3AYDA 1W0OA 4K21A 5LBBA 1BKZA 2ZX2A 3J8F2 4IGOA 3WXPA 3ZSEA 4BXFA 3WDUA 4LHSA 3N7KA 2JG8B 2XLGA 4E2GA 3I2GA 1W8TA 2XVLA 4OI1A 1W2TA 4AAXA 1O3QA 1DBNA 4C8DA 1KDKA 4XJ9A 3J8F3 1ZBA2 1GV9A 4O61A 3OD0A 1GBGA 3I7DA 1KXGA 3TAYA 1XE7A 3JUUA 2H6CA 1RUE3 2A75A 3KGZA 5C5TA 1V6JA 1DQ2A 1UZYA 3C8XA 1LJ7A 2ZAAA 3J7HA 1BYHA 1I5PA 4P9YA 4KG0A 1KRIA 3U78A 5BY5A 1JI6A 1XYOA 2IXKA 4BK5A 1IS6A 2VMEA 5T5PA 1I3HA 4AI3A 4QPIC 1S55A 1VBC1 2W47A 3GALA 2AUYA 4HVOA 3NJYA 3ZOIA 2DF7A 3POGA 4L97A 1X33A 4R4XA 3SEPA 3R0RA 4JHTA 2R7EB 5FZEA 1ZZBA 4BXSV 2VW1A 3RYKA 1BMV2 3O7OA 4NPLA 4XXAA 1XSQA 4LBMA 2AZ5A 4UFLA 4PLOA 4ZKTB 5EV7A 4UF0B 1QJU2 1VAMA 3AKQA 3QCWA 1HB3A 1I6XA 3ZSKA 5C8WA 2RJLA 4COZA 4TLGA 2DURA 4QX7A 4Q4X2 1V6IA 4C91A 3E97A 5C70A 1QJU3 5A7WA 1X50A 1L7QA 3FN9A 2G9GA 2BU9A 1PMIA 3CJIB 3RYPA 3T2OA 4CPBA 2VG9A 3GJBA 2W87A 3M3EA 2VZTA 5LRRA 4Q4X3 2R1DA 3MLKA 4YG0A 5CB7A 3OGSA 4PIYA 3WUCA 2WS91 4BMBA 3K2OA 4AEKA 5A6ZA 1FNZA 4H2AA 3FBMA 5KWRA 1S2KA 1LEDA 1F4HA 5KHKA 4XMAA 2ZCWA 4LLFA 2RM22 2W92A 2X09A 4MV2A 5EFUA 5FZMA 4Z07A 5LRSA 2AEZA 3U4XA 1FX5A 2YU2A 1TEIA 3BOWA 1GU3A 1ZYBA 1QJY3 2RM23 5GLZA 3PNAA 3M2MA 1JU3A 5K8SA 4I2OA 4GD4A 2LW8A 3ILRA 3O1RA 4HXCA 1PVC3 2Q8EA 3WHTA 1S0CA 4K9SA 2GN3A 4UFKA 3NNGA 2BJSA 4F83A 3RWKX 1OPMA 5A3TA 3MUY1 4JGZB 4YLZA 4AYUA 1S0FA 2B46X 1VMFA 3NW4A 3WY6A 2HWD1 4R9CA 3LEKA 4NHXA 2D6KA 5KHJA 4LJHA 1W03A 2G9ZA 1NLSA 2MEV2 1WCDJ 2R0FA 2BQPA 2NMOA 2PLV2 3MIFA 3ES4A 4UF0A 2VCBA 3BIEA 4QWNA 2WAAA 2P5BA 3LEGA 3LFMA 1ENSA 1GWLA 3NNFA 4KG8A 4XVHA 4OZXA 1BQPA 2PXJA 2MEV3 2R072 2VR4A 5A7OA 2PLV3 5DZGA 4CUBA 3S57A 2IFWA 4E27A 2ZABA 3MLJA 3OBRA 2WL1A 2CGOA 2HWE2 5JXHA 2I74A 4JGYA 3GHNA 1CONA 4JVAA 2XLAA 4KL1A 4KWUA 1HRI1 3AKPA 2EA7A 1DDLA 4W6YA 2DVGA 2HWE3 1IG3A 1HQNA 3C7FA 2H0VA 1OA3A 4UW4A 5C8CA 4CA9A 1VBE2 1AF9A 4TZDA 1UZZA 1H1MA 3SH4A 3UT0A 3PUAA 4OHYA 3RYRA 4W50A 2C6SA 4D6RA 3F95A 3JXSA 4D3WA 4Q26A 4G4FA 4QQHA 3BODA 2JB4A 3MIEA 1UU6A 5FYUA 1PGW1 3HBZA 3OTFA 3BIWE 4CEYB 3HN3A 3WG2A 4FO9A 1UZVA 3ACFA 1W6MB 2UWCA 2XL7A 3QH6A 3AKTA 4E4HA 1REEA 5LWBA 2IVIB 2QFEA 2R041 2RS52 4PI2A 5FZ7A 3BN6A 5CAZA 2BW8A 4L11A 5LBFA 2A6VA 2EVXA 4QD2A 3N36A 4YSFA 4LK7A 1PZ7A 5FMDA 2RS31 1G7YA 3OSDA 4FPEA 4WM8A 3VUOA 2XG3A 5EP9A 5HI0A 2R32A 2J42A 4IEZA 5I8TA 2LUWA 2PHXA 3JBG2 4MXWB 4Y4YA 4LUMA 4ZU7A 4CCMA 1H1IA 4QPWA 2WFPA 3PVNA 4WM7B 3K3NA 3E5XA 1SBFA 5J09A 1WMEA 4IEVA 2XJPA 5FYYA 3DECA 2DTWA 3AYEA 2C1FA 4EWAA 1TME2 4YGDA 3V0BB 2R16A 3KV5A 4WVVA 4LEJA 5CG8A 4M0HA 1YO8A 2WFF2 2JDUA 1TME3 1W6PB 1LESA 4J25A 4BDVB 4W65A 3TNQA 1KQRA 2R6QA 4JGYC 4QXCA 1EPWA 1MQTA 5E89A 1UYPA 2BNNA 4JRLA 5JMOA 2WFF3 1QF3A 3G7DA 3VL8A 3BTXA 3OUIA 5FYSA 3KCXA 4QXHA 4NHKA 5C8CC 3DUIA 2EIDA 4AEDB 4FXGB 4KU8A 3A22A 2ZHMA 1EAH2 1RJ7A 2XMLA 3C7HA 1HQLA 1CZVA 4FOVA 5EZWA 3OY8A 4NE9A 1W9YA 4KWLA 1EY2A 1BK0A 1GZWA 3OD4A 4FPCA 3CZUA 2RDNA 2CU5A 4LHNA 5GM0A 1YFXA 1EAH3 3TWIA 2W1SA 5CFCA 1QOTA 2JDYA 2C24A 2YU1A 2OXBA 3KCCA 4QXBA 3DYOA 4YM2A 1UPSA 2X05A 3RWNA 1LGBA 3QACA 2WYSA 4N9IA 1U5IA 1GZCA 3BU7A 5F5CA 3C7EA 3PIJA 1PM4A 5C6CA 4GWNA 4IV3A 4N43B 5FYHA 3BCWA 3SCHA 2VQUA 2ZMNA 1SLTA 4Y26A 4WM8C 5GZFA 3E6CC 4AEMA 1FMD2 4KNCA 3NKGA 5BXXA 1UXXX 2LS6A 2VZRA 3D5OA 5K0UB 2GMMA 5LA2A 4P9IA 4CSWA 1GUIA 2WQZC 2ADDA 3VZMA 1NY71 1W6NA 3WF2A 4WV8A 1A8MA 1GNYA 3U14A 3BOPA 5DMYA 1WD4A 2J1TA 3LSEA 1M06G 1UOBA 2VCAA 4DQAA 4DO0A 4PDWB 4FCAA 3ZXEA 2Q4SA 5FZKA 4IEOA 5DUVA 2XXZA 5A33B 5H9PA 3H8RA 4XIKA 2JENA 3HWJA 4UI9L 3POSA 3RVHA 1MQTC 5F7UA 2FZ2A 4JTOA 5KC6A 1K42A 1MEC2 3UV9A 2BRTA 3ZYPA 4ZS2A 3RQ0A 5LEJA 1H1AA 4I0AA 1AR62 1Q43A 5DZEA 1MEC3 1HB1A 1CAUA 4LULA 4IE5A 3J26N 1LULA 5H9QA 3BTYA 2DVDA 5FY1A 5C9AB 2V73A 3AVSA 1UY4A 4B4QA 4MX3A 1AR63 1UIKA 5I93A 4ZPIA 3SITA 4AFCA 5JCTA 5EXOA 5CFCC 1Q8OA 5FWEA 4D6QA 1DCSA 3T4VA 3IN9A 1W3XA 1JYVA 2GZWA 1JBCA 2ZKLA 5GALA 4GXLA 4ARXA 4EE2A 1JU4A 4HN0A 4EROA 2PQSA 3TEYA 1JTZX 3ZXGA 3ZFEB 1W06A 4O9GA 4IV3C 1O3SA 1VMJA 4HPKA 5CIRA 4AQTA 1RHI1 1NCQB 5CA6A 4JKLA 1NA1A 1J59A 5JOWA 2O8OA 4GAZA 1AR92 4K8FA 4AVSA 2KD7A 1FYUA 1PNFA 4AG4A 5FZ1A 4CCOA 2JXAA 3I59B 2B5HA 2CL2A 1YEWA 1D2SA 4MGQA 1OHFA 1H8VA 2X53S 1W6OB 1W0PA 2HEVF 1AR93 3I8TA 3OPZA 4ITCA 3VDCA 2AREA 3Q9OA 2PA7A 5LA0A 3OGRA 1PGL1 4NRPA 5JPMB 1OOPA 2IXIA 3K48A 3VB9A 1F9KA 1W2UA 3APBA 4NR1A 4IW3A 2W95A 4XF3A 4EN8B 3PMSA 2VW2A 3E6DA 4YWAA 2ZEZA 1GZ9A 4MGKE 2WIIB 3BU0A 1VAKA 3Q8AA 4P9XA 2CWMA 1NE6A 4OMDA 1R092 4BIOA 3ZKUA 2GC1A 3R6SA 2HWC2 4CXWA 5J48A 1UYYA 1QKQA 1JOPA 3WQ1A 2ZEYA 1VB2A 1RUC2 4QQ2A 2VUJA 1R093 5L9VA 5KXEA 4MSVA 2Q1MA 2HWC3 1X8EA 1O8PA 1RUI3 2Y0OA 4LK6A 3ZN6B 1PK6B 3FLTA 3RDIA 3ETQA 3GJAA 4JKMA 1LOBA 3M3OA 1AXKA 1RUC3 1XU1A 2WQ8A 2W52A 2YB7A 1CPNA 3O5SA 2QQIA 4CXXA 5FDBA 5DAPA 1RUG3 4PIXA 3M4FA 1UCXA 1W2AX 4SLIA 4AFMA 2VVDA 3FJSA 3P3NA 5A3WA 3ZFEA 2WSVA 1L7LA 1Z0HA 1HX6A 2FHRA 3FX3A 4ONUA 4XEZA 4XUTA 4GULA 3CMGA 5IAVA 2VECA 3RI9A 5FZGA 5C3OA 1NA1C 3WW2A 1UOFA 1BBT2 2HJIA 5HXMA 1AXZA 3A23A 5FXVA 4H7MA 4TYSA 4R8HA 4YFZA 1XC6A 3ZKYA 2ZAHA 3JB8A 4YW1A 1BBT3 5F9TA 5DQ0A 2J1UA 4AGGA 1OOPC 3ZM8A 3H1YA 4TSVA 3ZYBA 2GH2A 3USUB 2GP3A 5C3RA 1JZ7A 1XRUA 3KM5A 1NUKA 1E5HA 3O1UA 3GYDA 1W9FA 5CVRA 5T52A 3RFRA 2E7AA 2VOKA 4QGNA 4AE2A 2OKXA 3FHQA 3VDDB 3ROUA 2O8QA 3IT8A 3H9AA 3FHAA 3V64A 3WNLA 1JYCA 4BLJA 2RS12 1WWYA 5JAXA 2I45A 3D8CA 5LASA 1DQ5A 4A3XA 1WW4A 4QX2A 1VBA3 2HWF2 4Q4W2 4UBHA 5CKMA 3LA7A 4MGSA 1PVXA 2XQXA 1PK6A 4H7LA 3V65A 2KR2A 2RS13 3R4SA 4RSUA 1R081 3KD4A 5IUQA 2NYYA 2HWF3 4Q4W3 1DF0A 5HCHA 1UOJA 4GMP3 2YPJA 1US2A 5H9SA 2CGPA 3VBRA 4ARYA 5JLVA 5FYZA 1SQ4A 3MIBA 5AVPA 3ZFEC 5A6YA 1O7FA 4Q4Y1 3AVRA 1RL3A 4P9WA 2FCTA 1YQ5A 3ZDVA 5IFTA 3K77A 1V6MA 1F4AA 3ZFFA 3BYWA 4CP2A 1X8MA 2Z5WA 2WA4A 3LEMA 5LBCA 4HANA 2DUQA 4K8RB 2H6BA 3O1VA 4NIDA 1DFQA 3N35A 2WNUA 1LOFA 3QOPA 1NCRB 4CP9A 1ZRCA 1PIV1 3E5QA 3KHCA 1GZTA 2AYHA 1NQDA 1UY0A 1HRV1 3JB4C 3Q8EA 5IVFA 3DKWA 1N3OA 4FPYA 5J37A 2ZGMA 3WF3A 3OF1A 4I3PA 2NM1A 2DCKA 3K4DA 4JX0A 1W9SA 4GQ7A 4A6SA 4LITA 2DWRA 4ASLA 3VDDA 3VKOA 3IAPA 4BQ3A 5A32A 4OZOA 3JCIA 1POV1 5CKNA 1CAWB 1DLCA 2YHJA 1Y7BA 2K9ZA 4XACA 2W1UA 1WA6X 3RI8A 4CDXA 2C4XA 5IHRA 2ZGKA 2C9KA 4XF9A 4OYUA 1KS5A 4LHLA 5J96B 4MGIE 4XOGA 4A7ZA 3BPSA 2W08A 5FZ8A 1RIRA 1FV3A 2B9UA 4JKKA 3WINE 1PK6C 1WMFA 2QQNA 2VD7A 2W0XA 4XDPA 2ILMA 4S2GA 1E5RA 2B7YA 3ZSLA 1Q8PA 3VZJA 4GMP0 2Q1ZB 2XBO2 5KR7A 2FDIA 1W9TA 2HEWF 2XKPA 1SPPB 3UETA 4AFAA 4DEVA 4P9LA 4R4ZA 2R30A 2V72A 4KGGA 3VBRC 5GZGA 2XBO3 4GWJA 3J7MA 3LDBA 2FQPA 4GALA 1D7PM 3HMYA 4OUSA 4ASMB 2QBXA 2DTYA 1C4RA 4QHBA 2G19A 4R9AA 1UYXA 3ZFFC 1MVEA 5A3MA 1ZNPA 2QKDA 1VBD2 4M00A 4EJRA 2PAEA 4KWJA 3FUQA 2WNUC 1LOFC 1UY1A 3ZIWA 2NZ9A 4BQ1A 3ALQA 4FBFA 4AHYA 2JB8A 2ZPXA 3BGAA 2ZKNA 1WLTA 3SCFA 4COVA 2AC1A 2AENA 3AP4A 2ZXQA 2O1QA 1VBD3 5JUVA 2W68A 5FMBA 3LF7A 5GJ6A 3CNAA 1MZEA 3ZMOA 1OFNA 1GICA 1YYNA 2VC9A 4FOQA 5DDJ2 1IOAA 4E8DA 3PU8A 1SDDB 5FY7A 1TMF1 1WMXA 3Q8BA 3UGFA 5E8AA 1AYM1 3LCPA 4YARA 3VDDC 3WQBA 4MUVA 3VD7A 5DDJ3 2QJVA 3LIHA 5FZIA 5FK7A 4N53B 1DYOA 4NUBA 4AWDA 3IMMA 3HQXA 3NMBA 2HWB2 4KH9A 5FO7B 5D1IA 4CDXC 4TTGA 4XXPA 2YC2A 3ACHA 4YNIA 4YZ5A 1QQP2 2ZA9A 4AI0A 1SLAA 3CO2A 3OEBA 1HXS1 2WLPA 1KD7A 4LKFA 2HBUA 2ZJCA 4HVRA 4TWTA 1S0GA 4QPIB 1R1ZA 1RUF1 1ZA4A 2YYOA 3IPVA 3KT7A 3WV6A 5CEHA 2UWAA 2VCCA 5FIXA 3OPTA 1FPN1 1GKBA 2GNTA 3AZXA 5IATA 3LIGA 3JD72 4QPGA 4Y22A 1G9AA 4JAAA 2KM2A 4DY3A 5JVVA 3H8XA 1HJFA 3VKMA 1QNYA 4A3ZA 4Z92B 4EN9B 3TYJA 3JD73 5JSPA 2ZX1A 1Z78A 3IBMA 2XQRA 4MZUA 4AVTA 4IE6A 3BTZA 1XJAA 2HH9A 1FNYA 3ACGA 2RS33 3N7LA 4CUCA 1W99A 3KV4A 3ZXKA 4BA6A 5JI7A 3S6PA 1JZ5A 1VIWB 4S2HA 1OD3A 1UQXA 3AK0A 1QHDA 2UURA 4EV0A 3OGJA 3U37A 3PUHA 4JHZA 1W0NA 1IHMA 3ELNA 4XHXA 2WKKA 5JMCA 5EJ3A 5FZOA 3AP5A 1AX0A 1AL22 3WCRA 2GN7A 1GWMA 4N53A 4OHVA 1HDKA 1ZVFA 3N4MA 1OXCA 4RHV2 4YG3A 3WP4A 2W46A 2XOMA 2JEMA 1RGSA 1PX4A 3VN4A 1N1SA 4YW7A 1XB9A 4W8JA 1CPMA 1SLBA 3EXUA 4XF4A 3PUQA 1DHKB 2E7QA 2VXJA 3K46A 4M0NA 1BZWA 3AL6A 2UWBA 1STMA 3S7IA 1HV0A 4IGQA 1SHWB 1NAEA 1VRH1 5FBZA 3WQ0A 1F2NA 5F2SA 3HIFA 1N1TA 4F7ZA 3RZKA 4NIGA 1CWPA 1CX4A 1YXWA 4M01A 1GP6A 5LA9A 3U07A 2C9AA 5IVCA 2JICA 5A3NA 2IUWA 2WN2A 4QPGC 2VUDA 4B1MA 1RUJ2 4Z2WA 4GB32 3ZXLA 1SLIA 5AC92 1DG6A 2VQTA 1WW5A 2R062 3AMPA 1D4M1 1W04A 3FLPA 4OQ9A 3N9QA 3WDTA 3NKTA 1EUUA 5A7QA 2OA2A 1RUJ3 3SC7X 3THTA 2HEYF 1N1VA 5E16A 2OYZA 3WD5A 5A7WB 1DZTA 4ZZ8A 2R063 2WAOA 5LBEA 2FCUA 2RE9A 4F3JA 1Y3TA 2J1AA 1YQCA 4P5YA 1JN2P 4QQOA 3SEEA 3UK9A 1LU1A 4M4RA 5L7OB 1G9CA 5T50A 4CE8A 2VAUA 4N9HA 5DAXA 4W6WA 1WW6A 1JOJA 2KXLA 5DABA 5IK7A 2OX0A 1RUE2 4ZU5A 4Q29A 5IW0A 2XLFA 1PX3A 2V4VA 1OPOA 2FZ1A 4N53C 1BEV2 1W05A 1AR72 2ZGQA 1IS4A 4FPHA 1AR81 1V6OA 2FDHA 1GR3A 1CZSA 2DFBA 1NKGA 3UKNA 1OKQA 4QHZA 3R4UA 4J1WA 2XVKA 3V0AA 1VLNA 3IWZA 1LOGA 1G86A 3WDXA 1JUHA 4CP0A 3N7JA 1BEV3 1AR73 4WZCA 4A42A 4QMAA 5EPAA 1REFA 4YGCA 5B2GB 5F3CA 1UOGA 1R64A 3M8LA 5DUWA 1SACA 1QDCA 2TBVA 3TB0A 1W28A 1T6GC 3R05A 4NN0A 3THDA 1HLCA 5F3EA 1TNFA 3I2IA 4HETA 2ZS6B 1WCSA 2JD9A 2BVVA 3ASIA 5A3UA 1ZREA 2NN8A 4GH4A 2VMIA 1WW7A 4HKWA 4CU9A 3GZTB 3NJVA 4Q0UA 1V00A 2ZX4A 2RDQA 5DG1A 4PHZA 5FOJB 3BI3A 2VBBA 1ZRRA 3RG0A 3ZLIA 4EQVA 1HN0A 1RYYA 3HQUA 4PJYA 2LRPA 1JYIA 1G8WA 2RV9A 2YFUA 5LK5A 2YGLA 3VBUA 3OCPA 4HN1A 3OB8A 4JGYB 5JZGA 4L0PA 4KGQA 2WO2A 4ZXKA 1O5UA 5JDBA 5I0SA 1Q56A 4YW2A 1Q8SA 3O0VA 2P1BA 1OMIA 4P9JA 3NAPA 4GJZA 5HCBA 5L7OA 3U0ZA 4MO3M 3RMYA 5GZDA 1K3IA 2OIIA 5C8CB 1QJY2 4ES9A 2K2SA 3KLSA 2AH2A 3CJXA 3KF3A 2BNMA 3WQ7A 5BNOA 3NL1A 1PVC2 3B94A 3HD8B 4QXKA 3VBHB 3PJYA 4CVUA 1SLCA 1IG0A 3KT1A 2J22A 4UW6A 4FVVA 4Y5SA 3MIDA 4G3YC 2PELA 4CTEA 4WVZA 1VMHA 3VHRA 3BB6A 3I3MA 3PMEA 4FOWA 4XMIA 3T30A 4XF1A 4RGKA 1SMVA 2JX9A 2XKOA 5IVBA 4XW3A 3FZ3A 2JE7A 4RA0A 2E32A 1NG0A 1V9U2 4WM8B 5FZ4A 4ZONA 3RJRA 2TNFA 4X8NA 2A7AA 2P3YA 3GDBA 4G9SB 4L9BA 3T09A 2OQ7A 2RHPA 4IEWA 4AVCA 1JZ4A 3MHZA 1AYN2 4QX1A 5H9RA 3WOGA 3P6BA 1PHMA 3INAA 1V9U3 4BHPA 3WW3A 5FPBA 2BFUL 1TVGA 4GH4C 4JDNA 3QH7A 2Z42A 2RJ2A 3S5QA 5GKAC 3MV11 4XQDA 5FPLA 1AYN3 1MS5A 2WT1A 3SH3A 1AJOA 1YC61 1UL9A 3A7QA 5A3PA 3PHMA 3E1F1 5DN2A 4FPOB 4A41A 2FDGA 1E5SA 5FYVA 2XHKA 4CU8A 2WO7A 3VBUC 1RTVA 1XE8A 4NIIA 5JZGC 1MQTB 1OVSA 2D7FA 2JECA 3LDRA 4JQRA 1ZM1A 4HL0A 2V09A 3RGBA 5I0TA 4D6SA 5L7OC 3NAPC 4OLLA 2YZ4A 2NMNA 3WHUA 3AL5A 1H2LA 2VJXA 3VD9A 5GZEA 1ULFA 3AZVA 2BFUS 3OY8B 5J7MA 4GA9A 1PMHX 1VBB2 3J7NA 2BGOA 1JZ3A 1D2QA 1QIQA 1GZWB 1ND2A 2DCYA 4FQZA 4WVWA 3VBHA 3POIA 4LR4A 2CHHA 4AI8A 4ET7A 5BNOC 3GZUC 5BNPA 2JE8A 2LTNA 4E4DX 2JDNA 5CFCB 2YV8A 1S1AA 2Q0AA 4XFAA 2P34A 1VBB3 2DDUA 1KJRA 2ZGPA 4JRAA 3WP3A 3ZYRA 4Q8KA 2XH6A 5FOBB 5FZDA 4YM1A 1W8ZA 2ID4A 1LENA 3VDAA 3WF0A 2QTWB 3CEWA 4PIZA 4IV3B 4CEWA 2XGXA 3F2ZA 3I4IA 1R082 4XILA 1ENXA 4BU2A 4O65A 1UXZA 3PVBB 1R1A1 1RUH1 3T1LA 1A8DA 5FREA 4NWWA 1R083 1XYNA 4YM3A 5APAA 5KHIA 2EICA 4LBQA 4OQ8A 1W6NB 5FY8A 2JIJA 3AM2A 1YFYA 1WGPA 1H9WA 2A73B 1HW5A 2VL4A 5KXBA 1PO21 4UYBA 3HVDA 3H8UA 4BPZA 1A6CA 1QJX2 4FSJA 3KVBA 4CYDA 4JCKA 3AMHA 1UD1A 2JKBA 5CBLA 4OUMA 1Y43B 4CCLA 3SMHA 1QJX3 1PIV2 5FYMA 1XBFA 5A1AA 2PAKA 1J83A 1FI2A 1IQAA 3VLBB 3VZOA 1RUD2 1HRV2 1ZZ9A 4IEPA 3ZIXA 4Y1VA 2XR4A 2VOWA 3LQCA 5IJRA 4I02A 2QDNA 1A78A 4IDZA 1ST8A 3MW4A 5J1XA 4Q4V2 2IXCA 3T3YA 3LB9A 1PIV3 3NJZA 2YDEA 4MHUA 2ZACA 1WCQA 3ZR6A 1CAUB 1HRV3 1RUD3 1H8TB 1UIJA 1WLWA 2RR12 4LPLA 4NOTA 5F5IA 5C33A 3MUZ1 5EIYB 1JYWA 4BQXA 2GC3A 1S0DA 1ND2C 4Q4V3 5FLIA 3TN92 3VBHC 1T2XA 1H30A 5BNPC 1RINA 2EALA 3WNKA 2RR13 2QE3A 4HT1T 4Y33A 5JR2A 4XF0A 2XJVA 1EPZA 3TN93 4DUVA 4O7XA 1POV3 1HQWA 3H42B 5F2WA 5FLJA 5A3LA 5I91A 3HAGA 4CDWA 4XC9A 5ACA2 5JPNB 4HPKB 4S2FA 4CEWC 5BPXA 3VBSA 2W2IA 1GANA 3GBFA 1NA1B 5EYXA 4AFDA 1C8M1 2R1BA 2J1RA 5ACA3 3GHMA 1W8UA 3H3UA 3GXUA 1J3RA 3POJA 1OSGA 1TQ5A 1Z7S1 4P14A 4QPYA 3ECQA 1BXHA 4FT8A 3SLIA 1HJGA 1LCLA 3KZ4C 3VZNA 2VGDA 2FCVA 4YVSA 2CYFA 5CFDA 2W1WA 4LE4A 5ABJA 4CU6A 1OOPB 1H4GA 5L36A 3ZPYA 5FPZA 4QX8A 2CNAA 2RVAA 3ITQA 2BWAA 1QDOA 5JOXA 3A21A 3VHNA 2R49A 4EWEA 1UNBA 1COV2 2RMU2 4PF5A 2IWGB 1N3PA 1OH3A 2VOVA 3K4AA 3ZSMA 3ZXAC 3KQ4B 5JXJA 3AZZA 4IE7A 1MZ6A 4ISRA 4LIUA 1OUSA 4PCRA 2BVBA 4BIFA 4LLOA 2JIGA 3ILFA 2FDJA 2DBIA 1COV3 2RMU3 4EZHA 1WCKA 5KC5A 2YC0A 3ZSJA 1H8TA 3J8F1 1LKNA 3NQHA 2E51A 1NYWA 1OQDA 2ETEA 4AGVA 1AYM2 1YIFA 3NNJA 3SNMA 2TUNA 2WZPP 1QOSA 3OYWA 1GOGA 3ZVXA 4GIQA 1JZ8A 2ZZJA 3THCA 1BJQA 3NVCA 1S2BA 1K12A 1ZBA1 1TMF3 3MYXA 2ZHNA 3WG4A 2JDMA 4LO6B 2D6NA 1AYM3 4RFT0 2ET1A 4QGLA 3VKFC 3AP9A 4AI1A 4Y24A 5EJZB 1UU5A 1KDMA 1Y4WA 1CZTA 2VZUA 1LGNA 3ZYHA 4INDA 4JQTA 1IPJA 4LOSA 4CDWC 1V0AA 4H55A 4CCKA 3UYJA 1ODMA 4QKFA 1LRHA 2XWJB 3VBSC 1PO12 3OGGA 3W59A 1BVVA 1QGLA 5CYYA 2ZHKA 3SHRA 3L2YA 2PHRA 2WDBA 5JIAA 3MLLA 2VUCA 4UFIA 5F3GA 2DCJA 1VPHA 4YZ4A 4BB3A 1PO13 5FWJA 4XDOA 1OF3A 2ARAA 4U2AA 1BMV1 2P2KA 4LA2A 4HG6B 4YVSC 1YNAA 4IUGA 3ZYFA 5CFDC 5LW9A 4QM9A 1UWWA 4XTMA 1QJU1 3IIIA 5ABJC 3O1TA 1UZWA 2GNMA 2DUPA 4E8CA 1W9WA 3UESA 3POEA 2MNGA 4Q4X1 3O1MA 1SFYA 1XU2A 4LKDA 2PAMA 2Y6JA 4JDMA 1PMJX 4MH0E 1S0JA 3WUDA 1FV2A 2YUEA 3W5NA 2AEYA 3LE0A 4NHMA 4RFRB 1RUI2 4GJYA 4BQ5A 4D8MA 2WO3A 1GOFA 4BMEA 1EV12 3PTRB 1ZBE2 2ZMKA 3DF0A 4XYXA 2DBNA 2G1MA 2XUMA 2C5DA 1YIPA 2BGPA 1H8TC 2XJRA 1RUG2 2Y8KA 1PGSA 1AVBA 3KGLA 1EV13 1LOCA 1ZBE3 2RM21 2PHLA 4B7EA 2VBDA 5FFOC 3ZMNA 3AB0A 4OI0A 5CADA 3POBA 5CISA 1OURA 3VBRB 1C5HA 4BQWA 5JIUA 5F5AA 5LY1A 4A2UA 2WZR2 1F8VA 1ODNA 1MVQA 4B3NA 2VMFA 1WMDA 2QDRA 3ZFFB 2VOTA 1YUDA 4IEXA 3VDBA 2BPA2 2Q8DA 5FZBA 3VV1A 4IEQA 4BWOA 1O8SA 5ERLA 2WZR3 3BVCA 2WNUB 4ZU4A 3TRSB 1ZZ6A 4CP9B 1RMU1 2OQ6A 2MEV1 4XUPA 4V1PA 4ZHNA 2UU8A 4HK8A 3WX5A 1BHGA 2QQLA 2QUOA 4W4ZA 1D4M2 3G6JB 5D2AA 3H8OA 1W39A 1RITA 2HYKA 4CDUA 5FY0A 5DG2A 3U1XA 4HVQA 1GWKA 4AEJA 4FI9A 4JV4A 2R071 4FTSA 4KBBA 2IXJA 1B35B 1D4M3 1MZFA 4R52A 2VTXJ 1EUTA 1VBA2 2HWE1 3H7YA 5LK7B 5A32B 1IPSA 1DQ1A 4OHZA 2VBPA 3T2TA 1LOAA 2EXJA 4K1ZA 3KWVA 5CNAA 4CDXB 4L8QA 3B7MA 2XDVA 5JXGA 4PBOA 4IV1A 1DQ4A 3OUJA 1ULOA 5F37A 4QHOA 5FQ0A 4FPGA 3MI8A 1ZX5A 1VBE1 2O14A 5IK4A 2QNKA 2ES3A 1Y9MA 4DRRA 3IIAA 4DFSA 4J6GA 3P1IA 4CCDA 3KMHA 2QQKA 2W94A 5GLWA 3LA3A 5EQUA 1DYPA 2NLRA 2B45X 2WINB 4OCTA 2EIBA 1US3A 4IQPA 4XFIA 4CUAA 4Q8LA 5FP8A 1L7RA 4FAGA 1TZOA 4ORFA 1W8NA 3U10A 2KA3A 3VBFA 3DGTA 4LORA 2WNEA 4CU7A 2HYXA 1VBC2 2RS51 3VD5A 2PTMA 2WWSA 3HEIA 5FBJA 5T55A 4R9BA 3WW1A 4OULA 4MGTA 1H6YA 1W8OA 3C2UA 2D44A 2ENRA 4FP2A 4FTBA 3TEZA 3AC0A 3JBG1 4IE4A 4M3CA 4A7KA 4EN6B 1VBC3 5I0RA 2ZOEB 4S2DA 4ATEA 2XB6C 4JZRA 1LODA 1QU0A 2BWCA 3AFKA 3HNYM 5I0DA 2EXHA 4MADA 4NPMA 1D0HA 5ISLA 4QKBA 1IS3A 4YPJA 3HN1A 3TOJA 1TME1 1W2OA 3HNBM 5FYCA 4IEUA 1DGLA 1CAXA 5F3IA 2YGMA 2A5ZA 3AMMA 5FUPA 4CDUC 1O3RA 2Q8OA 1B35A 2VO5A 4R9DA 3WCSA 2GNBA 2VZ1A 3PIGA 4Y5Z0 2WS92 2RG4A 2Z69A 5FP3A 1ASJ1 3CIHA 3RZMA 3ON7A 4Y1YA 1JH5A 3T2PA 1OD5A 2BYVE 4M3CE 4AXOA 3URFA 3VKNA 3A4UA 2UYBA 4IV1C 2WS93 2JD4A 2FDFA 2NPIA 4XCBA 5E6HA 3T1MA 1DLLA 5SV5A 4BCUA 3GF6A 4HOOA 4HONA 2RDRA 1EAH1 4H3WA 4YGEA 4OUEA 1MS1A 2CWSA 1VAVA 2Z2SB 3IPVB 4LE3A 4WVMA 3FL7A 4RS5B 5J3UA 3LAGA 2Y6FA 2ORZA 2R0HA 3WG3A 3IDEA 1WLDA 1YQ8A 1S0IA 1X36A 1H2MA 3C7GA 1NZCA 3IKWA 1PNGA 3UKTA 1U5XA 3KSCA 3PUSA 4LBJA 4QPGB 4XFFA 4Y22B 5EYYA 5A1FA 3VBFC 3OBZA 5F1RA 1K5MA 4IXLA 5DUUA 1YLLA 5KBFA 4Y3OA 4AHWA 1Q8VA 4PQ9A 3IMNA 2HWD2 1XNAA 3U75A 2XHNA 2QQVA 4OHXA 5IYYA 1PZ9A 2ZGLA 4YYOA 3USSA 1HB4A 4RR3A 1K5JA 4D94A 3EBRA 1FMD1 4L2NA 4GWIA 4NIHA 2HWD3 5FRAA 4MXVA 4F8AA 3SXWA 2VMDA 1MS4A 3B01A 3TNPB 3CKHA 5IAXA 5G05L 3OPWA 2EAKA 2GAUA 3MFCA 2B39A 4DOUA 1AUYA 5BNNA 4MG2A 1RVF1 5SV8A 3WF4A 2OPWA 4NHYA 1X82A 3NV4A 3FLRA 1JOBA 1S4CA 1B35C 2EIGA 2TEPA 2XPJA
chains in the Genus database with same CATH topology
1HRI2 2EXIA 3D4KA 3X29B 1GLHA 3ZXJA 1RB8G 3PTYA 4LT5A 2PHWA 1Q3EA 4DY5A 1HRI3 3M70A 3EO6A 3M7AA 1AR61 1OLQA 2Z79A 1IZ3A 4RS5A 5FAXA 3MGUA 1PGW2 5HCAA 4OI4A 4H14A 4LBNA 3I54A 4Q0VA 3WNXA 3AYAA 2ZZQA 2ZGSA 1ALYA 4Q27A 4XQ4A 2R042 4B7KA 1RJ8A 3DN7A 1DIWA 2X5IA 2HKXA 2IXLA 1K5MC 2RS32 1UKGA 3TBDA 4YVWA 5FTTC 4Y1XA 2GDFA 2R043 4FQ4A 1LHWA 4EWDA 5HXVA 2A3XA 1RUH2 2EAAA 3IDBB 1AR91 4RR3C 1WD3A 2PYTA 1I5ZA 3IM0A 3H3ZA 2A6WA 1RUH3 5BNNC 4QQLA 4PLNA 3FUOA 1VB4A 2D3PA 4AFBA 1N3QA 1UU4A 4XIOA 5LEKA 1PO23 4UW3A 3DV8A 2A6YA 1CIWA 4Z8BA 2SBAA 3ME2A 1A3KA 4CP1A 1J1LA 2IZWA 4RGAA 1HKDA 1H0BA 1R091 3WP6A 5E1RA 5AFBA 2HWC1 2OZJA 2YMZA 5HCFA 3B93A 3V0AB 1N1YA 1J3QA 1YI9A 3POWA 3RNSA 1RUC1 4HKOA 1ND3A 2VVEA 1UKRA 4RS5C 4HSLA 4DPNA 3MIHA 3ZFGA 2GH8A 4C1XA 4C90A 1LECA 2WT2A 2XVGA 4C0BA 1C5IA 3VHOA 1G9DA 2G4IA 3EHKA 1RUNA 1IS5A 1CD3G 3LZZA 4DXZA 4GH4B 5JI9A 3GBWA 2X5IC 4XETA 4MLOA 2GMPA 4YVWC 3VBOA 1JHNA 1ZRDA 4YW4A 3DL3A 1LHOA 3RSJA 3E6BA 3VBUB 3WP5A 1BBT1 1KITA 4ES8A 2OZ6A 5JZGB 1NY72 1W6QA 2GALA 2ZTNA 3DPRA 3ACLA 4XJUA 3C3VA 1UAIA 3NV1A 3NAPB 4BE3A 2WLQA 1LTEA 5DZFA 3SH5A 1DQ0A 1GFF2 1LOEA 3EJKA 4FPLA 4YG6A 4XBNA 4EN0A 3VHPA 5BNOB 1APNA 5IT6A 2Q5TA 5D8AA 2PHFA 2V5YA 3GBGA 1CAVA 2DU1A 3AMQA 2PHDA 2RS11 1OA4A 2VW0A 3O12A 4XE9A 1IKPA 2HWF1 4Q4W1 3ZXFA 1ND3C 1UPIA 4GMP1 3MZHA 2DUOA 3ZFGC 1OFSA 2A3WA 3ILNA 2FMDA 1GQHA 2UY9A 3M1HA 4CDQA 1LU2A 4C0HA 1ZBA3 1RUOA 1RHI2 2A71A 2WJSA 5FO8B 2SLIA 4AHZA 3VBOC 2XL9A 4JDOA 4COUA 2EXKA 1DZRA 1O5LA 1RHI3 2B8MA 1YI7A 2VNOA 3MF6A 3DPRC 5GLVA 1PGL2 1XNCA 4X6QB 3KCYA 4RQPA 3D6EA 3D0SA 3LOBA 3KS7A 1LHNA 2XJUA 4Y20A 2H0BA 3H7JA 3M3QA 3ZYGA 4BM8A 2VXRA 1XNKA 5GLUA 3D82A 3SISA 4AW7A 4URTA 1JUIA 1OA2A 1ND2B 2BBVA 4I01A 2CV6A 2DYCA 5BNPB 5D8AC 3QBQA 3ZO0B 2D43A 3RJ2X 2WNVA 1LHVA 4AGRA 1PM7A 4D7SA 4XFGA 4D7YA 5CU1A 3NSTA 2JG8A 4RL7A 4CEWB 1ULCA 1UF2C 3O0WA 4AHXA 3UKVA 2BNOA 4P5HA 4FPJA 2OUHA 1OI6A 1U0AA 4AF9A 2XBO1 4CDQC 4Z1VA 4LBQB 1IGOA 3ATGA 5IK5A 1DGRA 2WT0A 2VQ0A 1WUVA 1LB2A 3ZYIB 4OFGA 4RGGA 3JQWA 3B5LB 3KB5A 1C3HA 4B8EA 1EYBA 4Z82A 1KFXL 2DCTA 1YHFA 4OI2A 3RS6A 3CL1A 1RMU2 1VBD1 1WBLA 2ATFA 4K1YA 4NPRA 2PN5A 2ZBJA 2ZGNA 2UY8A 4J1XA 4RQPC 1AJKA 3AKSA 1JW6A 1PZ8A 3AX4A 1NXMA 1LEMA 1RMU3 3HR9A 2OW4A 5JSRA 3PVOA 1WBFA 2WQ4A 1EP0A 1BK1A 5DDJ1 4ISQA 2QZ3A 3CJIA 4BOWA 5C4WB 3LKJA 2R073 2VUAA 1SBEA 5JR7B 2OPKA 1N47A 3JZVA 5T54A 3B9IA 4WBBA 2W39A 1FXZA 2WNVC 1V6NA 2HWB1 2N7GA 2VMHA 5EWSA 3LA2A 4HMZA 1MS9A 4CDWB 2JG8C 3VGIA 1QQP1 3RPQA 3WW4A 2ZGRA 2XJTA 3VBSB 2BGCA 2E63A 3U11A 5K9YA 1J3PA 1VBE3 2A3YA 4K20A 2OUJA 3GZAA 4YZ1A 3E5UA 2DVAA 4Q4Y2 4YVSB 3JD71 4OVEA 5CFDB 3OBTA 5ABJB 5F5QA 4JGZA 5J98B 3WR0A 4ATFA 4DMIA 4LNVA 4XJZA 4Q4Y3 1ZZ8A 4XJ8A 4I09A 2BEOA 4Q2FA 4N7IA 1DQ6A 1H2NA 5T5LA 2RS53 2GC2A 3POYA 1KJLA 1MZ5A 1SEFA 4KQ7A 1AXYA 2XWBB 1NE4A 3JBG3 3W9AA 2XJQA 4E4ZA 4LTAA 1CQ9A 3KT4A 3AXDA 1F31A 3H0OA 4COWA 3NWKA 5C4WA 3RZZA 1Q8QA 3WDWA 1QWRA 3CJIC 4XZPA 1ASJ2 4FTEA 3OYWB 4E2QA 2D6PA 1AL21 3L2HA 4TLFA 2QQPA 4K40A 2CY6A 4Q1PA 4X8PA 3VZKA 1KFUL 4GKYA 4RHV1 3AP6A 3PVEA 1ASJ3 4AK3A 1JXNA 3MPPG 1LR5A 4CZSA 1TE1B 1YRZA 2ARBA 5JWPA 1FOD1 1YFUA 2P3KA 1YJKA 4UXAA 1ULGA 4XHBA 3WZ1A 1H9PA 2Y26A 4CEYA 1NLRA 2A70A 4LO5B 1W6MA 2GMEA 1J58A 2QVSB 3CU7A 3JU9A 1RUJ1 4XJWA 4GB31 1AZDA 2D3RA 3FE5A 4WZFA 4B4RA 5AC91 4JGZC 4MGYE 1SLLA 2DVBA 5L73A 2R061 3ZN5A 4MXWA 3B02A 2IFRA 2ZGTA 4AQSA 2P37A 1BCXA 4WM7A 2LM3A 4BYYA 4HLTA 5JOZA 4GKXA 5T3NA 1DGWX 1FAYA 2VVFA 2D98A 3K51A 3ZN4A 1RVF2 1H2KA 1FMD3 2DFCA 3V0BA 2ZX3A 3ZX7A 4Q0QA 1ULDA 2CTVA 1OLRA 1TMF2 4YFWA 3J9SA 1RVF3 1W6PA 4K3UA 5C4WC 1RUE1 2BUKA 4HK9A 3AP7A 1POV0 1OQ1A 4FPFA 2DCZA 2D5HA 2DVFA 5IK8A 1BEV1 1AR71 3FHIB 1NOVA 5BV6A 1MS0A 4OHWA 1GSLA 4U36A 1GNHA 4Q0PA 4AEDA 1HXS2 1RUF2 1UX6A 4QX5A 2LALA 5KXDA 3V56A 4LBKA 1FPN2 1HXS3 2VU9A 4DRVA 3QLQA 1RUF3 4CEYC 1VR3A 1C28A 1SCSA 4AQ2A 1ZZCA 1FPN3 2PQQA 4IL7A 4N43A 1QH6A 1V70A 4HBNA 5AVAA 1HV1A 3VL9A 4AVBA 5BUVA 4CDUB 1X7NA 5BYNA 1MS8A 3FFZA 1C8NA 4I30A 2ZMLA 1U5YA 1WA4A 5K0UA 1CGPA 1CESA 4MYEA 3PLQA 2XJSA 4LBLA 3MICA 4WM7C 4QU2A 1WLCA 4XPVA 3ZDSA 4IV1B 4W6XA 2YY1A 5FQ0B 1TNRA 4PDWA 2ZX0A 1XQNA 1QJY1 5A33A 4LBOA 3MW3A 1VJ2A 4DINB 1C57A 4I0BA 4PLMA 1PVC1 2AR6A 1J1TA 4O9EA 4AQ6A 3D0JA 4XFHA 3W58A 4AEDC 4P9GA 3NV3A 4RD7A 3VBFB 2VPVA 5C9AA 1VRH2 3H50A 1QXPA 1SDWA 1V9U1 4M3CB 1AHSA 4XDQA 1G9FA 1VRH3 2GC0A 1AYN1 3B69A 2PLV1 4NO4A 1I1EA 5FLHA 3WVJA 1O91A 3O0XA 4BH9A 4K6BA 1SCRA 4N43C 2ZGUA 4N7UA 4XJAA 1B09A 2NP0A 1NCQA 3A0KA 4NHLA 1CAXB 4YGBA 1QJZA 5I8SA 4A7YA 3AYCA 2ZHLA 3I59A 1BVP1 3MIGA 3B00A 4LO8A 4DB5A 5K0UC 5KHGA 2DV9A 1U5ZA 4D69A 3FFQA 3SCGA 1W6OA 5T5JA 3J4UH 4NVPA 3WDYA 4XFCA 1AX1A 1I9RA 4PDWC 5KHHA 3VKLA 1IKQA 4Y1ZA 1NQJA 4XBLA 1HIXA 1YWKA 3LSDA 4LBQD 4LUKA 1VBB1 1YCIA 2PFWA 4QQPA 1H4HA 4WVMB 4DS0A 1AR82 2ZGOA 4HSJA 1O3TA 2CAUA 2JG9B 2F6BA 2Y38A 1VALA 3MW2A 4LA3A 4FP3A 1REDA 1ULEA 5T5OA 1FATA 1AL0G 2X29A 1AR83 4AI2A 5J36A 4FXKB 1K5MB 5BNQA 3FMGA 3ZN6A 4E9KA 1C1LA 1V6LA 5C9AC 2VNRA 4YM0A 1U12A 3AXEA 3AJYA 4LO7A 2CGNA 1QXJA 4XQWA 4RR3B 3WLUA 4UBGA 3R4DB 1IPKA 4E4SA 3MDPA 1QH7A 1C1FA 2E7TA 2E9QA 4Q1RA 5BNNB 3MEPA 4IETA 3LGRA 1DYKA 1NCQC 2QCSB 2D6MA 4YW3A 1CJPA 1QJX1 2VULA 1O4TA 4Y1UA 4AVVA 4I0WB 2WFF1 2UYAA 2D6LX 1F5JA 3O14A 1FT9A 3UJQA 4E2SA 3GNEA 1RUD1 1CJDA 1GYKA 3UL2A 3S0MA 3USUA 3HT2A 1UN1A 4DZGA 1AX2A 4Q4V1 2Y0IA 1O4YA 3UJOA 2RR11 4XTPA 1UMZA 3HT1A 5L19A 2JG9A 3TN91 2OVUA 1D4VB 2WC2A 5HBAA 2DU0A 2JDZA 4K7JA 3AJZA 3H1WA 4L99A 5FPXA 4QM8A 1QY4A 2X5IB 4MVTA 3AZWA 5FCCA 2MPFA 4N90A 4YVWB 2EF6A 5ACA1 4SBVA 4YZ2A 1G9BA 4BLIA 1DGWA 4QT6A 2P3IA 2I2SA 2JJ6A 1L3JA 3ST7A 2ET7A 3IDCB 3P3PA 3RRDA 3AKRA 3PJQA 2BTVC 3M3CA 5I0UA 4DNYA 5K7PA 3A0NA 2E6VA 1E57A 5CG9A 2A6XA 2VY0A 1QOOA 4XBQA 3ZYJB 4D7TA 3ZXDA 3THPA 3FWEA 3RMXA 4COYA 1F5FA 3B9CA 1DGRN 1S0BA 5JSOA 3MFAA 1NCRA 4KWKA 1COV1 2RMU1 2F4PA 2GNDA 3M3IA 1MEC1 3OJBA 3WT3A 4FAHA 4EN7B 2VQAA 2ARXA 1XYPA 4L92A 3VZLA 1KS4A 2E53A 5FO9B 1ND3B 2YXSA 4META 2CAVA 4YRDA 3MF9A 2RJKA 2K0GA 4YZ3A 3ZFGB 2VH9A 2C0ZA 1QMJA 1CAWA 2JG9C 3S7EA 3AMNA 3WG1A 5GZCA 3NV2A 4PBPA 3L9JT 2I07B 1MR5A 4FPKA 4MGZE 1LGCA 3KQRA 1MS3A 3FC0A 4HZFA 3VBOB 2HWB3 5JOYA 1LHUA 4IEYA 3AZYA 1QNWA 1R1A2 1Q5OA 1PO11 1XXNA 2D97A 1QQP3 5I8YA 1UW8A 2X8KA 1W6QB 3MPBA 3DPRB 1ENQA 3I2DA 3ENRA 1ZZ7A 4X6RB 1R1A3 1CN1A 4IERA 2FBEA 1PO22 3H1MA 1S0EA 1YFWA 2GU9A 2PHTA 3QD6A 1ENRA 3CLPA 2WSUA 2P3JA 2FMYA 3JQXA 2VMGA 3CF6E 4KU7A 1GQGA 2Q30A 4HFSA 1NCRC 1YJLA 3LWCA 2VNGA 5D8AB 1G6NA 2D40A 3N3HA 2ERFA 4Q0SA 1RUI1 3BALA 4NWVA 1CAVB 3NO8A 1NXD1 1QXRA 1EV11 2IC1A 2PHUA 5DUXA 4UW5A 1ZBE1 1CVNA 4LO4B 3BPZA 1SBDA 1DZQA 4B4PA 2A6ZA 3FBYA 1URXA 1RUG1 5GLTA 4JC1A 3BTAA 5F6KA 3WDVA 4FOYA 4CDQB 4IESA 3EQEA 4AVAA 4GWMA 1CR7A 5DXDA 1OQEA 4YW5A 2B42B 2D93A 1AL23 5TSWA 1ZRFA 2D6OX 1VP6A 2QZ2A 1D0GA 2WA3A 4C1WA 1FOD2 5AFEA 1V6KA 4RHV3 1C8M2 2VOXA 4HKLA 4QPIA 1XNDA 2GSYA 2WZR1 1GNZA 1SFNA 4CRQA 5FMOL 1M4WA 2D3SA 1Z7S2 4I3GA 1FOD3 3N7MA 1C8M3 1O4ZA 2G9FA 1ONAA 5E88A 4LHKA 4JTNA 4RQPB 3S30A 1XNBA 4B29A 1Z7S3 2MHFA 4Y20B 3AFGA 1MACA 3B3QE 2P17A 1Y9QA 4GB33 3ES1A 1DU3D 5AC93 1RC6A 5F6LB 2O0OA 4QGMA 2AGSA 4BZ4A 3LOIA 1VBA1 2NQYA 2D5FA 4XFBA 2JE9A 5FMOS 4M3CF 2IXHA 2WNVB 2YROA 4K21A 3AYDA 1W0OA 1BKZA 2ZX2A 3J8F2 3ZSEA 3WXPA 3WDUA 3N7KA 2JG8B 2XLGA 4E2GA 2XVLA 4OI1A 1O3QA 1DBNA 1KDKA 4XJ9A 3J8F3 1ZBA2 1GV9A 3OD0A 1GBGA 3I7DA 1KXGA 3TAYA 1XE7A 3JUUA 2H6CA 1RUE3 2A75A 3KGZA 1V6JA 1DQ2A 1UZYA 1LJ7A 2ZAAA 1BYHA 4P9YA 4KG0A 1KRIA 5BY5A 1XYOA 2IXKA 1IS6A 5T5PA 1I3HA 4AI3A 4QPIC 1S55A 1VBC1 3GALA 2AUYA 4HVOA 2DF7A 4L97A 1X33A 4R4XA 3R0RA 1BMV2 1ZZBA 2VW1A 3RYKA 3O7OA 4XXAA 4ZKTB 4LBMA 2AZ5A 4PLOA 5EV7A 1QJU2 1VAMA 3AKQA 3QCWA 1I6XA 3ZSKA 5C8WA 2RJLA 4COZA 2DURA 4Q4X2 1V6IA 4C91A 3E97A 1QJU3 1X50A 2G9GA