1AX2A

Erythrina corallodendron lectin in complex with n-acetyllactosamine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Erythrina corallodendron lectin and of its complexes with mono- and disaccharides.
pubmed doi rcsb
molecule tags Lectin
molecule keywords LECTIN
total genus 52
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ax2A00
1SBDA 2ZABA 2ZKNA 2GNMA 3WDTA 3AP9A 2Z42A 2R1BA 3R4SA 4YW3A 4YW2A 5IK4A 1DQ0A 4CRQA 3BTAA 4PQ9A 1PZ8A 2A6ZA 2EALA 1QNWA 4WV8A 4Y1UA 3BIWE 3ENRA 4YFZA 1GV9A 3FLPA 1QF3A 2DUPA 4XILA 3FLRA 2GNBA 1G8WA 4WVWA 2PHRA 3FUQA 2D44A 3MW2A 1CR7A 3UJOA 1B09A 3M3CA 3HN1A 4FPYA 5IK7A 3SISA 3ZSKA 3N36A 2JE9A 5HCAA 2EXIA 4D69A 5CA6A 5IK5A 3N7JA 4Y26A 1PZ7A 2WQZC 1IS5A 3WG1A 4AWDA 1DYKA 3SH4A 1N3OA 2D6PA 1JYIA 4MYEA 4M3CF 4M3CE 4P9WA 2Q5TA 4PBOA 4Y1XA 1LOFC 3A0NA 3N3HA 3DGTA 1GKBA 3ZSJA 4AYUA 1MS1A 3O0XA 4Q2FA 1ULFA 1Q8VA 2E51A 2CNAA 2JDZA 4XE9A 4WVVA 3VKMA 3V0BB 2LALA 1H30A 3IM0A 1QU0A 3KM5A 5DXDA 3OY8A 4XIOA 5CNAA 4IQPA 1AZDA 2E7TA 2KM2A 1W6OA 1YI7A 3DUIA 3POSA 1LODA 3U4XA 1C57A 4XMAA 1A8DA 1HLCA 4DS0A 4YM3A 1ENSA 4YGCA 3RMXA 3GALA 2W39A 4YZ1A 2BQPA 1GYKA 1KQRA 3TB0A 4Y1YA 1AX0A 3L2YA 2ZBJA 5E8AA 2PHXA 1G7YA 1LHVA 1FAYA 1N3QA 3OJBA 1KRIA 1W6PA 5E88A 1DFQA 3AZVA 4ISQA 1IKQA 3IMNA 1C1FA 2PELA 5H9QA 3ZSMA 4FOQA 1LU1A 2DVAA 3JU9A 4OZXA 5KXCA 1LCLA 2SBAA 3AJZA 1W6MA 3AXDA 4JRAA 2EXKA 5GJ6A 2D43A 1CQ9A 4UW6A 1Q8SA 1QOSA 2R0FA 2YMZA 4XXAA 5FRAA 1KDMA 2GMMA 3MPPG 4SLIA 5DUWA 4HANA 4ISRA 2OUJA 1IOAA 1LESA 1QDCA 1WLWA 1SBEA 3AZZA 1Q56A 4U36A 2ARBA 4DPNA 2WLQA 1S1AA 5GZGA 1LJ7A 2VW0A 3ZXLA 4YGDA 4XTPA 4LBQB 1SBFA 1H9WA 5H9RA 4XMIA 2YXSA 2AH2A 3W58A 4FP2A 5AVAA 1V6IA 1JN2P 1LGBA 2EXHA 4Q1RA 4Q8LA 5JLVA 3RS6A 2DVGA 4FOWA 2DTYA 2P37A 3SH3A 1LU2A 1VAVA 1W0PA 4Y20A 1IS4A 1PZ9A 1LOGA 1KJLA 4AGRA 3KQRA 5T5OA 1VALA 1Z0HA 1SACA 4BOWA 5F9TA 3ILNA 3OGGA 4YZ3A 4Y22A 2WT1A 4YW4A 1DYPA 3BODA 1GZWA 1SCSA 5JVVA 3T2TA 4GA9A 1YYNA 5GLZA 1AXKA 4U2AA 4YZ5A 2ZMNA 3V0AB 3ZPYA 1V00A 1W6QA 1V6OA 2ZGRA 2NMNA 1CIWA 2ZHKA 4DRRA 2C5DA 1S0DA 3V0BA 3I8TA 1LEMA 3UL2A 1JXNA 3WG2A 2FHRA 5JDBA 3LSEA 4RL7A 4GALA 3ZXEA 2GNDA 3SITA 1J1TA 5IUQA 1HQWA 1LULA 1DIWA 1V6JA 3ZXKA 3A4UA 4W65A 5T55A 2A3WA 1JW6A 2D3SA 2JKBA 2GN7A 1CPMA 4XJAA 1WBLA 4PCRA 4XZPA 3RRDA 3SH5A 3WNXA 1LOBA 1VLNA 5JMCA 1VAMA 2VXRA 3T1LA 2YY1A 3B69A 1I3HA 1MS3A 2P34A 3WHTA 1SLCA 1BJQA 1AF9A 1F9KA 2DU0A 4YZ4A 3W59A 1GSLA 2NMOA 3NWKA 5GZCA 1U0AA 1CJPA 4ITCA 1KJRA 2D6OX 3IKWA 3R05A 2EAKA 1OQ1A 2DUQA 4FPEA 4YW5A 1N1YA 4XJ9A 2VU9A 5DG2A 2CWMA 4YZ2A 1Q8PA 3VKOA 1ZA4A 4ATFA 4ATEA 1SCRA 1FX5A 3HR9A 4YM2A 1WW6A 2JJ6A 1OFSA 4XBLA 3VKNA 3BOPA 2EF6A 5IT6A 2DUOA 2W68A 2CY6A 5LK5A 1UAIA 2UU8A 4FPCA 1WLCA 4AGVA 4Q8KA 2ZGKA 2NP0A 1VIWB 3IN9A 2XG3A 1BZWA 4UW3A 4AVSA 4GXLA 1F31A 2OVUA 2D6KA 4Y1VA 2JE7A 1MR5A 4BM8A 3FFZA 2ZHLA 5JOZA 2ZGOA 4LBQD 3OBRA 3D4KA 4TYSA 1A3KA 2ENRA 2WT2A 3WG3A 3QCWA 4FPJA 1HDKA 3ASIA 4XIKA 4XXPA 1AJKA 1LENA 1QDOA 2D3RA 3SLIA 3IPVB 3MW3A 4FP3A 2DV9A 1Y7BA 4Y1ZA 3POYA 4ZXKA 1CPNA 1N3PA 3M1HA 2H0BA 4P9YA 4FPOB 5GZDA 3POWA 5GLTA 3TAYA 1AJOA 1FNZA 1D2SA 1Z78A 3Q9OA 1S0CA 3B9CA 3SNMA 2ZHNA 3GNEA 4BMEA 5EYYA 3VKFC 1MS4A 2LTNA 1LGCA 1CVNA 4C1XA 1S0FA 3AYDA 3ZVXA 2YROA 4ASMB 3WDVA 1UZZA 5BYNA 5EXOA 2ZA9A 4XHXA 4YM1A 3ZSLA 1CESA 5T50A 3ZXJA 1IS3A 5CAZA 1V6LA 4XDQA 4PF5A 4FPGA 1QOTA 1RITA 4I30A 5T5PA 5H9PA 1YXWA 1DQ5A 3PJQA 2AREA 4Z8BA 3JUUA 1YO8A 5DUVA 3WV6A 3NV3A 4XJUA 2ZGTA 5E89A 4FPFA 1G9BA 5GM0A 3RSJA 1QKQA 3VKLA 1G9AA 3AP4A 4R9BA 5CB7A 3QLQA 1SLIA 1JHNA 2WSUA 4CZSA 2CWSA 3B3QE 2A6YA 2A6XA 1DQ1A 4BPZA 2DVBA 4ZKTB 2R1DA 2WNEA 3OYWB 4XTMA 1WBFA 1DGLA 4Q1PA 3V64A 4FQZA 3I4IA 1S0BA 2D6NA 1TEIA 1DQ6A 4XYXA 1G9DA 1AXYA 3NV2A 1C4RA 1LTEA 2ZAAA 2ZGNA 4XHBA 3WZ1A 4FVVA 5IK8A 1UL9A 1GANA 1W6OB 1LHUA 2SLIA 2E53A 2ZZJA 5HCBA 3OYWA 3PMEA 2R0HA 3FLTA 1CONA 4LBNA 3R4UA 1NLSA 2ZGLA 1GLHA 3WOGA 2ERFA 2WJSA 2W52A 5DUUA 2A3XA 1IS6A 2NYYA 1RINA 3RG0A 3WUCA 1SFYA 4DFSA 1XQNA 4XBNA 3WLUA 2ZGUA 1LHOA 1ENQA 4Y20B 4FPHA 1W6PB 1N1TA 1SLBA 4C1WA 1KITA 3AFKA 2P3KA 2D6LX 1SLTA 5DZFA 1R1ZA 4XJ8A 4YFWA 4YGBA 2HYKA 1WLDA 1BKZA 1AX2A 2A3YA 2GDFA 1O4YA 2GMPA 3CNAA 3H0OA 1JUIA 1GZWB 4RA0A 2ZMLA 5T52A 2DVDA 3NV4A 4P14A 2A6VA 3M3OA 1QOOA 3FUOA 3MEPA 1O4ZA 3WCRA 2A5ZA 2CYFA 1Q8OA 1LGNA 1YRZA 3O0VA 4K21A 2EIGA 5HCFA 3T1MA 2PHUA 4YM0A 1I1EA 2AYHA 1S0EA 3B01A 4Q26A 2JD4A 1BXHA 4FPKA 5DZGA 1SLLA 2I2SA 1V6MA 2NM1A 2B7YA 2VY0A 4FOVA 5SV8A 4DRVA 2ZGQA 4R9AA 5EYXA 1KDKA 1LOFA 2AENA 1MZ5A 2PHTA 3O0WA 1N1SA 3LSDA 1BQPA 1RIRA 2ARXA 2C9AA 3PVOA 4LBLA 3V65A 4YGEA 4FOYA 1W6NB 4UW4A 4TZDA 1FNYA 2VH9A 3OY8B 1MVEA 2R49A 3AZXA 2D7FA 4KBBA 2A7AA 4JCKA 1ULEA 4Y22B 1AVBA 1GNHA 1DQ2A 1GICA 4LBJA 1LEDA 3D6EA 4HL0A 3O12A 3AP5A 1WUVA 1YIFA 4L8QA 1FV3A 3RQ0A 5T5LA 3USUA 1JOJA 1AX1A 2DYCA 3AYEA 2E6VA 2JECA 1NXD1 4GKYA 3WUDA 5T5JA 1ONAA 1URXA 1MS9A 4M01A 3UJQA 1WD4A 2GMEA 3AZYA 1DQ4A 3M3QA 3M3EA 3M2MA 1DLLA 1UPSA 3N7MA 1QMJA 5DG1A 2DVFA 2ZGMA 4YG6A 2V73A 2GNTA 2AR6A 2UWAA 2E7QA 3O5SA 3USUB 4R9DA 5GLVA 4AGGA 4NO4A 5GZFA 3N7LA 2FMDA 4GWNA 1UKGA 3AYAA 5GLWA 1HQLA 4GWMA 2VW1A 2NN8A 2WKKA 4K1ZA 4NOTA 2EXJA 1CN1A 2DWRA 3WVJA 1MZ6A 2CL2A 4BLIA 2D6MA 2YV8A 4AVVA 4DQAA 2UWCA 5L73A 2VUAA 2DTWA 1OKQA 4Q27A 1GZCA 4XJZA 2AUYA 1WCSA 1D0HA 3ZYRA 1S0GA 2R16A 1GNZA 3WDUA 2RHPA 1FYUA 1Q8QA 1AXZA 2ZACA 1UX6A 3A0KA 1G9CA 1FV2A 1QNYA 2A70A 1DBNA 3OBTA 5FREA 1S0JA 3C2UA 4K20A 4YLZA 1APNA 2ZMKA 1S0IA 1IKPA 2A6WA 3AYCA 1LECA 1MS8A 5T54A 2UURA 2WT0A 4GKXA 1JYCA 1W6MB 1FATA 4UW5A 3D5OA 2TEPA 4YG0A 3ZXFA 2D3PA 1UN1A 1JBCA 1HKDA 3NV1A 4P9XA 5H9SA 4M3CB 4H55A 2VW2A 1F5FA 3AX4A 3WHUA 3APBA 4FPLA 3ATGA 3AZWA 3V0AA 2P3JA 5JOXA 2WSVA 1BYHA 1G9FA 4R9CA 4Y24A 1W6NA 2GALA 1GBGA 1MVQA 2OUHA 2ZGSA 3WDYA 3ZYPA 1ULDA 2CTVA 4LBOA 4F83A 3IPVA 5JOYA 1N47A 1MACA 2W08A 1V6KA 3AJYA 1ULCA 4LBQA 1GZ9A 3N7KA 3RMYA 5F5QA 3AP6A 1MS5A 2P2KA 5DUXA 2ES3A 1UMZA 2A75A 1LHWA 3VUOA 3WDXA 4XBQA 4M3CA 3ILFA 4YG3A 5GZEA 4BQ1A 4CTEA 2PHWA 3HMYA 1EPWA 1WW5A 1H9PA 4LBKA 2YZ4A 4XOGA 4AVTA 2NZ9A 1C1LA 3INAA 3LCPA 3AK0A 1SLAA 3PVNA 1V6NA 4K1YA 1LHNA 1ENRA 2DURA 4LBMA 2XB6C 4FQ4A 3OPZA 3WDWA 4YW1A 1X50A 3FBYA 4BMBA 4BLJA 3AP7A 5KXDA 1QGLA 2G4IA 3N35A 3VV1A 2AGSA 3PVEA 2UWBA 1WW7A 1W6QB 3WG4A 2PHFA 4XJWA 5EWSA 1LOCA 1G86A 1W0OA 3AXEA 1UZYA 3MW4A 4WZFA 5GLUA 1WW4A 1DZQA 2A71A 1MS0A 3B00A 5GALA 2P3IA 1DHKB 3WCSA 5CBLA 4M00A 2GN3A 4JC1A 5DZEA 3ILRA 2OW4A 5JOWA 2DU1A 3UK9A 2ZHMA 1LOEA 1ZM1A 2ZGPA 1ULGA 1N1VA 1WD3A 2V5YA 5KXBA 4PBPA 1LOAA 1A78A 5KXEA
chains in the Genus database with same CATH superfamily
1FPN3 1SBDA 2ZABA 1MEC1 2ZKNA 3FHIB 1TME1 3KHBA 3KVBA 3POEA 3WDTA 5A3UA 4HK8A 4XFFA 4YW3A 2RMU1 4LNVA 3T2QA 4CPBA 2CGNA 4A4AA 4CRQA 1PZ8A 1QJFA 4PIXA 4CUBA 2R043 2UYAA 2CGOA 4WV8A 3FLPA 2DUPA 4B3NA 3FLRA 3NJVA 3AKQA 2YFUA 1G8WA 3IT8A 1R1A1 3HD8B 2PHRA 2VMHA 3C7HA 5A3LA 1D2QA 1QJY3 2E33A 4URAA 3UJOA 3M3CA 4COUA 1BBT1 5LATA 3S6PA 4EN0A 2LS6A 3KT4A 4FPYA 4RGAA 3N36A 1S2BA 1AL0G 4QX8A 1PVC1 1RUNA 5C6CA 2UYBA 3MV01 4IEPA 4MGTA 4MVTA 3O7OA 3THPA 1RUH2 3WG1A 4AWDA 1N3OA 4XFAA 1XSQA 1D4M3 4KNCA 4M3CF 4MYEA 1CX1A 4YPJA 2Q5TA 5ANQA 3NSTA 3DGTA 3MPBA 1GKBA 3H3ZA 3ZSJA 1A6CA 4DEVA 2J42A 4OQ8A 3BKZA 1VPHA 4LLFA 4Q0VA 4Q2FA 2VAUA 2CNAA 1JYTA 3DXUA 1IHMA 4FFGA 3ZYFA 3IM0A 1QU0A 1VBE1 3FMGA 5DXDA 1JYVA 1AZDA 2WFF1 1W2AX 3OF1A 2ATFA 1ZRFA 2R062 3DUIA 1Y3TA 3LOIA 1BBT3 1YQ8A 3TNPB 5LK7B 2E63A 1Z7S3 2C24A 3DKWA 5EJ1B 1A8DA 1TE1B 3AVSA 4YM3A 3HPNA 4YGCA 3RMXA 3LIGA 4Q4W1 5C7GA 2BQPA 2RR12 3A21A 3WF2A 5FIXA 1GYKA 1KEXA 4IDZA 4GB32 5FZ7A 3ZKUA 5LBBA 3FZ3A 1TME2 5IVBA 2PHXA 4AHYA 1G7YA 1N3QA 3AKPA 4PHZA 4QM9A 3WW2A 2BBVA 4QKDA 3AFGA 1UY2A 5C8CA 2F4PA 3ZSMA 2Q1MA 4MXWB 4QQLA 1W90A 5KXCA 2PYTA 2TUNA 2A73B 2SBAA 3AJZA 3AXDA 3U10A 1RUH1 1FPN2 2EXKA 4GH4B 4ARYA 2Y34A 4L97A 5CYYA 1O7FA 2HWC1 4D6QA 1WGPA 4BIOA 5LB6A 2YMZA 4Z2WA 4E4DX 1KDMA 2GMMA 4SLIA 5FZMA 4HANA 2VJXA 4IE5A 4XCBA 4Z82A 3P3NA 3NNFA 3ORJA 1J1LA 3H7YA 3OUJA 1UIJA 1XNKA 1S1AA 2LUWA 2WLQA 4CUAA 4D7YA 3NJYA 5GZGA 4MZUA 3ZXLA 3O1MA 4MGIE 1OI6A 4KU8A 3VBRC 2Q1ZB 4DXRA 3VBFB 4ZZ5A 1NA1C 1NY71 2XL9A 3QD6A 5FZIA 3W58A 3TN91 3MIFA 3ZX7A 3HVDA 1V6IA 4C8DA 3MDPA 1JN2P 2BDRA 5JLVA 1HW5A 1ZZ6A 3RS6A 4KL1A 5JR2A 1AR72 2DTYA 3SH3A 4FTEA 1VAVA 1W0PA 1MEC2 3JBG2 1OH3A 4Y20A 3PU8A 1RVF1 1C28A 2O1QA 2Y6HA 2Y0IA 1O8SA 5T5OA 5LZ6A 4NE9A 1XNTA 5F9TA 3ZYGA 3NNJA 4YZ3A 2GAUA 1RUD2 3BODA 3F95A 1SCSA 3HJRA 4V2WA 5JVVA 2EIDA 3U14A 2BFUS 2JIGA 2QE3A 2XUMA 1AR63 5FYTA 5GLZA 1AYN2 1S2KA 2JENA 4Q29A 3ZPYA 1H2KA 1DG6A 2ZGRA 1MQTB 2VUCA 4EE2A 4L99A 1YJKA 1RVF2 2NMNA 2BEOA 2HWB3 2LROA 1CIWA 1L7QA 2YC4A 3BCWA 5FYBA 4DRRA 1S0DA 2VTFA 4KWJA 1LEMA 3I2KA 1HN1A 4JAAA 2XJQA 3ON7A 5I8YA 3WG2A 3ZYBA 4E8DA 5JDBA 3A22A 1DGWX 3PHMA 4OZOA 3LSEA 4XUPA 3FBMA 2JG8C 2W47A 4EWAA 1O59A 1LULA 2WNVA 1Q3EA 1CAXA 2QQOA 4BU2A 1HB4A 5HV4A 2QVSB 3WQ0A 1WZXA 3KCYA 2A3WA 2W87A 3CJIC 4RSUA 4LUMA 4WZCA 2AEZA 1CPMA 3J8F2 1EUTA 5JMCA 4XZPA 1HB1A 3K3NA 3GHMA 3T1LA 1TNFA 2YY1A 3VBOC 4F3JA 4MV2A 3SHRA 2X10A 5BNPC 2HWC3 1F9KA 2NMOA 1NLQA 2VXJA 3H42B 4D7SA 4QXKA 5FO7B 2EAKA 2Q8DA 5FUNA 4FPEA 3WSOA 4C0BA 4GH4A 1EV13 2G19A 5A7OA 2AC1A 5C5TA 2VU9A 2ZX2A 3MV11 1PIV3 4GZ9A 5L36A 3IDEA 3HR9A 4OHWA 4GWIA 4XBLA 5D1IA 1RMU2 3I2FA 1VB4A 1H8VA 4CDQC 5BNQA 3NJZA 2ADDA 5IT6A 3BTZA 4AGVA 1ZBA2 3S57A 1BZWA 3H8UA 4GXLA 1AR93 1NAEA 3BVCA 3FHAA 5IAVA 1I6XA 1MR5A 4BM8A 1UMHA 3MFCA 2ZHLA 4XCAA 5JOZA 1WLTA 4LBQD 2VQTA 1GQHA 2VL4A 5A1LA 3D4KA 2R061 2BOJA 4DY5A 5FO8B 3WG3A 4PIZA 3Q8EA 1HDKA 2C26A 1S2EA 4XIKA 1K3IA 2VZ3A 1AR81 3IAQA 3H1MA 1Y7BA 2Y0OA 4QKNA 4Q0QA 3M1HA 2W1QA 2H0BA 4P9YA 1PGW2 2I07B 1UPIA 2R072 5GLTA 3DYOA 5J98B 1D2SA 4NWWA 1S0CA 1UCXA 4HG6B 1U5XA 1C5HA 3B9CA 3MYXA 3SNMA 5EYYA 1POQA 1VBA3 2LTNA 1CVNA 4C1XA 5FBZA 4QGNA 4ZU4A 5BYNA 3ZYJB 3E5QA 5SV5A 2Y6JA 4XHXA 4YM1A 3ZSLA 1BEV2 1CESA 1NCQB 1SG3A 1IS3A 2OT7A 3KV6A 1V6LA 5FQ0A 5BNPA 1VBE3 2MEV2 1TMF3 2WNUC 5CZKA 3VL9A 2QQNA 5FAXA 2WC2A 1VJ2A 5A3WA 2FQPA 4G9SB 2OKXA 3WV6A 3CDZB 1OH4A 4OLLA 1WCQA 1G9BA 3OBZA 3VKLA 5FWEA 1IG3A 2P17A 3AP4A 3R6SA 1NKGA 1W8OA 4XABA 2VOTA 1OQDA 3QLQA 4GJZA 1MZFA 5FMOS 2AACA 3GM8A 3TNQA 1LB2A 4GJYA 4I09A 3D0JA 4BPZA 2DVBA 3WINE 1ACCA 2YBPA 1XSRA 3GDBA 5JMOA 1LNSA 2RM23 2XJRA 4FQZA 1TEIA 4MADA 1G9DA 3NV2A 3ZFGC 3VDBA 5F6LB 1COV3 4IEYA 4MHUA 4CDUA 3K4AA 2ZGNA 3U4SA 3WZ1A 4XACA 3ZFEA 3KT7A 3BPSA 3TEWA 1UL9A 1RUC3 5BPXA 3SCFA 4FAHA 3BIEA 1LHUA 4A6SA 2DF7A 2SLIA 3M70A 4EYUA 1ND3C 3H3UA 5FUPA 1GLHA 4OMDA 2BOIA 2VVDA 1NA1A 1RUJ3 1UXXX 3N4MA 4Q4W3 2JIJA 3ZFFB 4E4SA 2RS12 1S4CA 5F1RA 2EAAA 4XFCA 1ENQA 4CU6A 2P5BA 1SLBA 3LF7A 1NYWA 4GH4C 5KBFA 1JTZX 4QX0A 1W8HA 4J25A 1BKZA 5ANNA 5AC92 4UXAA 2VECA 2A3YA 2WO7A 2HJIA 4J6GA 1NG0A 3BGAA 4RA0A 2YUEA 4HKOA 1YIPA 3MEPA 3W21A 5IW0A 1PO12 3F2ZA 3E1F1 2CYFA 2I45A 1Q8OA 1HN0A 2W46A 5J3UA 2EIGA 2X5IC 2PHUA 4YM0A 4OCTA 2AYHA 1UF2C 1NQJA 3GZTB 4Q26A 1SFNA 1SLLA 3DKQA 3OGRA 2FDFA 4CCNA 1V6MA 4HOOA 4UAPA 1C3HA 2B7YA 3AMHA 5SV8A 4LO5B 2W91A 3J9SA 5IVEA 2AENA 3ZFGA 2PHTA 1POV1 3ZIWA 1N1SA 4RS5A 3LSDA 3Q8FA 3QH6A 3T0BA 1HRI2 1V9U2 1GP5A 3DV8A 4FOYA 4LULA 1W6NB 1VBE2 3B9IA 4AEMA 5I0RA 2K2SA 2VR4A 1QJY1 3AZXA 4KBBA 5FZHA 2A7AA 2WFPA 3JD72 3NJXA 4IE7A 4NAMA 3RYKA 4Y22B 5HCHA 3NMBA 2RS52 1GICA 4LBJA 2FZ1A 3KS7A 1NXMA 5C3SA 1WUVA 5B2GB 2J7MA 4AG4A 2PMWB 4AF9A 2E6VA 5CFCC 1VBB2 2GSYA 5T5JA 1YQ5A 3WUDA 3ZSEA 1W8NA 4IGPA 4M01A 1WD4A 4IV3C 1YNAA 3C7OA 2VZPA 3I2JA 3WP6A 1ZVFA 3I59B 2H6BA 5IAXA 1PO22 3SQOA 2DCKA 2P6HA 1VMJA 2AR6A 2Q4SA 2V73A 2E7QA 3POGA 4O9GA 4E4HA 2X5IA 1PMHX 4GAZA 5LWBA 4AGGA 4Y3OA 3I2HA 2FMDA 1QEXA 2JDYA 3E5UA 1HQLA 2PN5A 1DP0A 3N9PA 4K1ZA 1QJX3 2EXJA 1OC1A 2VUJA 3WW4A 4BK4A 3SC7X 4AVVA 4DQAA 2VUAA 4FI9A 3I3MA 1OKQA 4LUKA 4CE8A 5C3QA 4NIGA 5FY0A 3VDDC 3KQ4B 4UFHA 1UU4A 1PIV2 3WDUA 1GNZA 1LR5A 2MPFA 1FYUA 3K75B 1Q8QA 4BYYA 1YCIA 5F7UA 3VBSA 3PIGA 2VZTA 1EAH1 5C5UA 1ENXA 1OA4A 2GC1A 4OUMA 5FREA 2XR4A 3N9OA 4MH0E 2QQKA 4YLZA 3K48A 1YFXA 5FV3A 2ZEZA 2BRTA 1LECA 5T54A 4JTOA 3J8F1 2PLV1 3ZKYA 1FATA 5HXVA 1X9PA 2OZJA 1UY1A 4LOSA 2WZR1 4MSVA 4MXWA 5K0UC 4RQPC 3EQEA 1K42A 2IFRA 3BN6A 3LDKA 1HKDA 1CZSA 2CU5A 5FR3A 2JG9B 2CDOA 4H55A 1CGPA 1OKOA 3APBA 1UU5A 1DF0A 2E7AA 2ZCWA 4FPLA 4I0AA 3V0AA 4R9CA 3ACIA 1OQEA 5CFDB 2J1RA 2GALA 3U1XA 2O0OA 3WDYA 1UU6A 5J7MA 2UY9A 3IPVA 3ZN6A 1V6KA 4NJ4A 1E57A 3LA7A 4QB2A 5I0UA 3KVAA 5JAXA 3RMYA 5F5QA 2P2KA 4KI5M 4A44A 1VP6A 5AFEA 4AEDB 3VUOA 4XBQA 1H8TB 5C70A 2L9LA 4S2FA 3ILFA 2FBEA 1MQTC 2VVEA 1RUI2 4A3ZA 3LD8A 4LORA 4BQYA 2E31A 4B4PA 5FZ6A 1EPWA 2H0VA 1BVVA 4YARA 4XOGA 4AVTA 5F39A 4CEYB 2P4EA 1C1LA 1HB2A 1E5SA 3LCPA 1K5MC 4R4ZA 3AK0A 3PVNA 3RYRA 5IVVA 1V6NA 3BU0A 4QDSA 1RUC1 2WZ8A 2J22A 1EYBA 3WP5A 1GUIA 1QJU3 3M8LA 2X5IB 2XB6C 3MGUA 3OPZA 2XWJB 2A1XA 5L9BA 1X50A 3FBYA 4BLJA 3JZVA 4NMIA 3DYPA 3VBHA 3I3QA 2RR11 4Q4W2 2UWBA 1UY4A 1W6QB 4N43A 1OSGA 3WG4A 4AI3A 2WFF3 3THDA 1REDA 1LOCA 3J7MA 2QQVA 3MW4A 2R32A 1OLMA 3O14A 4META 1WW4A 2NPIA 5FKCA 1XNCA 2WNVC 1MS0A 3B00A 4KU7A 4LPLA 4RR3A 5EP9A 3ZMOA 3ZN5A 2G1MA 2JDNA 2P3IA 2WUHA 5FZCA 1KGYA 4JTNA 1OOPB 2GN3A 4UWDA 2RS32 4JC1A 3RI8A 3UNPA 2GP3A 2Y6LA 5DZEA 3ILRA 2XHNA 3UK9A 3WNMA 3VBRA 2QBXA 2ZKLA 1GFF2 5EPAA 4AQ2A 4PBPA 5FY5A 4P00B 2O14A 5KXEA 2HWC2 4D3WA 3GBGA 4LXLA 2JX9A 1UD1A 3AP9A 1ASJ1 3KD4A 3BYWA 1COV1 4N43C 3VD4A 2YGMA 3GF6A 4YW2A 4H2AA 4BQ4A 5IK4A 2VPVA 2WBKA 4PQ9A 2VCAA 1POV3 1QWRA 4EN8B 2A6ZA 4XEZA 1QXRA 2NQYA 4PLMA 4QHZA 1QNWA 1F4AA 2RJ2A 2WFF2 2FMYA 1BBT2 4YFZA 3ENRA 4LKEA 2VZSA 1RC6A 1YFWA 3WR0A 4WVWA 4XETA 2OYZA 1CR7A 2VD7A 2FDKA 3PU3A 1WCDJ 4Z07A 3E5XA 2GC2A 3K77A 3OTFA 3HQXA 4J1XA 3ZSKA 4NAOA 1HRV2 3ZLIA 5HCAA 4D69A 5A6YA 1F35A 4FTBA 1RYYA 3UV9A 4YVSC 2VCCA 2VZUA 4AZZA 3UKTA 2XJVA 3SH4A 2XJPA 2D6PA 3OGVA 2LRPA 5A80A 2XQXA 4M3CE 4JKMA 5DAXA 1JUHA 4PBOA 4QX2A 5FY7A 1RUI3 1U5IA 5F32A 5F37A 1QHDA 3WD5A 3N3HA 1US3A 3UKNA 1H1IA 2QCSB 5JIUA 4BCUA 2WN3A 4AI9A 3FX3A 5FCCA 4AI1A 1Q8VA 2DFCA 2JDKA 2HKXA 2JDZA 2W1UA 3NKTA 4XE9A 3VKMA 2WQ8A 1H30A 3A23A 3JD73 2ZS6B 3KM5A 4CP0A 3POSA 1LODA 2B5HA 4S2GA 1FXZA 2YFZA 2B42B 4XMAA 4A7YA 5A3MA 3U4XA 1WMDA 5FP8A 4E2GA 4DOUA 3VZKA 1REEA 2EA7A 5EV7A 1KQRA 3TB0A 4AAPA 2RDSA 3DXTA 3L2YA 3THCA 5BNPB 5E8AA 4QPYA 3OJBA 1LHVA 3T2OA 3UETA 3AZVA 2J1AA 3QACA 5FZEA 1BVP1 1PK6C 4TN7A 4OZXA 3JU9A 2E32A 2GU9A 4X6QB 2VZRA 4AFBA 1W6MA 3D0SA 2FDJA 5GJ6A 1PO13 1CQ9A 1AL23 2Y6GA 1Q8SA 2R0FA 2Y60A 4OI1A 4MG2A 1PNGA 2D98A 4XUNA 5FMCA 3N9NA 5CG8A 1YLLA 4IW3A 4XF3A 2QDRA 3WNOA 1W06A 2OUJA 3K4ZA 1STMA 4LITA 5LA1A 1SBEA 1ZZBA 2BYVE 4DPNA 1LJ7A 2VZQA 2CGPA 4QPIC 3CJXA 1W2NA 4LKSA 4YGDA 5FY8A 2VUDA 4S2HA 4XTPA 5LBCA 3ZXDA 4A41A 1US2A 1ZBA3 5LY2A 1H9WA 1I5PA 1U12A 4XMIA 5H9RA 3OGJA 2KA3A 2JG8B 1LGBA 2EXHA 1FOD1 2HWF3 4OFGA 4Q4Y1 1TMF2 4PDWA 3ES4A 2VBPA 1J83A 3BALA 3MIDA 4AW7A 1A8MA 1LU2A 2OXBA 1FT9A 5CIRA 4AL9A 1KJLA 3KSCA 1DLCA 3KQRA 1VALA 4B8EA 1SACA 3ILNA 3OGGA 1OPOA 2PLV2 4A7KA 3ALQA 4D94A 2WT1A 3H50A 1O3RA 3T2TA 3AC0A 4UYBA 5JZGC 3UGHA 5GKAC 1VBB3 1YYNA 3HNBM 3RZHA 1VAKA 1AXKA 1EY2A 4U2AA 2IXCA 2R073 4AFMA 4B7KA 2YG0A 5FPAA 3D82A 1O5LA 5ERLA 4XQDA 3FJSA 4ZHNA 2JXAA 3PTRB 4LHSA 2BNNA 2C5DA 5C4WB 3I8TA 4BISA 4BH9A 1DGRA 2VMEA 2MHFA 3KGZA 4EWDA 1JXNA 2HYXA 5F2WA 2FHRA 2BVVA 1ND2B 3CMGA 3ZXEA 2GNDA 1JZ4A 1C8M1 1J1TA 3FWEA 2FCVA 4P9GA 5IUQA 3V56A 4OMCA 1REFA 3ZXKA 1POV0 1RMU1 4JHTA 1UWWA 3NAPB 1RUJ1 5IVFA 1JW6A 1K5JA 5IATA 4AAXA 1VMHA 5LRRA 1HV0A 2GZWA 2Y64A 3LE0A 1U5ZA 4QB1A 4A45A 2P34A 1MS3A 1CD3G 4WVZA 3C3VA 2NLRA 1AF9A 4YZ4A 2R071 5FYMA 4AHWA 4G4FA 5KHHA 4COWA 1KJRA 3IKWA 2ARCA 4YW5A 5FZ8A 3MZHA 4QD2A 1B35A 5JR7B 1L7LA 2W9XA 3GJBA 3ZMNA 4YZ2A 1Q8PA 1YFYA 4ATEA 4ES9A 1QJU1 2JJ6A 1OFSA 4XDPA 3VBUA 1XRUA 1UAIA 3MF9A 4H7MA 1WLCA 4PF1A 5LK5A 2ZGKA 3IWZA 4JQRA 4K6BA 1J59A 3VHRA 4KGGA 3T30A 1VBD1 1FOD3 2HWF1 4IL7A 3MLJA 1Z7S2 4FFFA 5FY4A 4CCJA 5G04L 4EN7B 4B4RA 1YEWA 1PVC3 4IESA 3P6BA 1AHSA 3QCWA 5C8CC 2BBAA 2Q30A 5T3NA 4XW3A 4DXTA 1LENA 2HBTA 3GCXA 4LKFA 5ABJC 5L7OA 2BU9A 4DXZA 2ID4A 2B9VA 1PO23 3POJA 5I0DA 3POYA 1CPNA 1N3PA 4NROA 3WF0A 1JYNA 3O1OA 5CEHA 2B4KA 3AVRA 4OHZA 4KBZA 1FNZA 4XF1A 1XXNA 2WAAA 3Q9OA 4EV0A 2ZHNA 5BNOC 3VZOA 2YB7A 5A3OA 3T08A 1XE0A 5K8SA 1TMF1 3ZOIA 2RVAA 3KLSA 4BZ4A 4ASMB 3WDVA 1UZZA 2Q1FA 5EXOA 2ZA9A 4IV1A 2ILMA 3LA3A 5JPNB 3PUSA 3LFMA 5AC91 2RS53 4R52A 5CAZA 4PF5A 1J3PA 2R063 4FPGA 5F3IA 5A33B 3I2OA 3PJQA 4KG8A 4PDWC 2AREA 3H8OA 4Z8BA 3NV3A 4IXLA 4XJUA 2ZGTA 1QQP3 2MEV3 1T2XA 3OBAA 5GM0A 3S5AA 2ZZQA 5LEKA 1NCRA 2E26A 1TNRA 1UX7A 1JI6A 1GR3A 3T4VA 2WSUA 2WS93 3WP3A 2CWSA 4Q4V3 4CZSA 4CP1A 3B3QE 1PGL2 5CFDA 1DQ1A 1VMFA 2WZEA 3CL1A 4HVOA 4XTMA 5L19A 3N9LA 1DGLA 3RZMA 3O1RA 4CU7A 3B5LB 4XAEA 3RNSA 5IFTA 1S0BA 4RN5A 1WMFA 4AEJA 4XYXA 1W9FA 3CEWA 1KD7A 1H0BA 1R083 4CP2A 1F5JA 3E6DA 3PUHA 4XHBA 4AEDA 4CP9B 1MEC3 4FVVA 4Z1VA 3U37A 3ACLA 1JU3A 1FMD2 1GANA 2LW8A 5HCBA 1KFXL 1CONA 4LBNA 3K4DA 1W39A 1NLSA 2BFUL 2VZOA 2XH6A 2RJLA 5FJHA 1RINA 2R042 3WUCA 4CEWC 4DFSA 1K5MA 2EIBA 1LHOA 4HETA 2DBIA 2WS91 3CLPA 3IZOA 4XFGA 2VNVA 1N1TA 3BU7A 1VRBA 4QXBA 5DZFA 2EICA 4XJ8A 4YFWA 3HNMA 3S0MA 2JDAA 1AX2A 4UFLA 1UKRA 1O4YA 2D97A 2GDFA 2VTXA 1JUIA 1GZWB 3H0OA 5DDJ3 2DVDA 3NV4A 4P14A 3M3OA 1B35C 3FUOA 3NO8A 2A5ZA 3B93A 3HQUA 1LRHA 1E5HA 1COV2 1EV12 1AR61 3O0VA 5DAVA 3OSDA 2FZ2A 3WNPA 2Z2SB 4HZFA 4RR3C 3B01A 4RHV2 3HIFA 4QX3A 4FPKA 2WO1A 2I2SA 1XOYA 2FCTA 2YPDA 2JICA 4IV3A 2NM1A 4N8MA 2KR2A 1QQP2 4R9AA 4FFHA 3CJIA 2IXJA 1GWLA 1LOFA 4JKLA 1MZ5A 5I8TA 4D7TA 3NAPA 2XUEA 1BQPA 2ARXA 3V65A 4BE3A 3PVOA 3BUCA 5FYHA 2BNOA 1ZZ9A 4BHPA 2VH9A 3VL8A 2R49A 2D7FA 2V4VA 3K46A 2P3YA 1ULEA 4OULA 4ZU5A 3O1TA 1IG0A 3IDCB 1BMV1 1LEDA 1RUF2 3O12A 4RD7A 1X8MA 1YIFA 2P1BA 4L8QA 5K4LA 1FV3A 2C1FA 3FFQA 3PTYA 5T5LA 2ZX1A 3T09A 3S7EA 5A6ZA 3BI3A 2DYCA 5FY1A 4RS5C 5DABA 2OPKA 2YC2A 3FN9A 5HPOA 4LQRA 2B9UA 2G9FA 2GC3A 1URXA 3ZXGA 5A1FA 5E1RA 5TSWA 4QQ2A 2GMEA 3AZYA 1DQ4A 3FL7A 3M3QA 2WDBA 1RUH3 1DLLA 1UPSA 3M2MA 1QMJA 5APAA 2DCZA 5FFOC 3U0ZA 4BQ2A 4O61A 1OFNA 4MX3A 3NQHA 4YG6A 1ZRIA 5FZOA 2GNTA 2UWAA 3ITQA 1OLQA 5DQ0A 3USUB 3LB9A 4OYUA 3RJRA 1NZCA 2HWE2 5GLVA 4A2UA 4CCLA 2WQ4A 3AMMA 3LPGA 1UKGA 3AYAA 5GLWA 4LO7A 1AR91 3DL3A 1RHI1 4DY3A 2IVJA 2VW1A 4Z2AA 1NCRC 2E9QA 4S2DA 3WVJA 1MZ6A 4CDXC 4QDRA 5C9AA 3JCIA 4IE6A 1RUE3 4XJZA 4Q27A 2XJTA 4LO8A 4NPMA 3PUIA 2AUYA 2RMU2 2VM9A 5ABJA 3POFA 2HWE1 2VMFA 4HXCA 2BZDA 1JH5A 3ZYRA 1OA3A 1R64A 4DMIA 4NRPA 5FZOB 1R082 2ZACA 1U5YA 1UX6A 2XHKA 4DUVA 1DGRN 3MIBA 3AKTA 4CEYC 5FK8A 5FP4A 1G9CA 2GH2A 2JB4A 4YSFA 1BCXA 1WWYA 2ZJCA 4K20A 3ACGA 2IZWA 2JE8A 4FBFA 1JHJA 2AEYA 5KHGA 4IV1B 3ZDVA 2UURA 5LA9A 4OHYA 1TVGA 3NNLA 1JYCA 4QPIB 3VDAA 4XUQA 5JXJA 1SZBA 1RTVA 1UNBA 5ACA3 2D3PA 1UN1A 1JBCA 4P9XA 1W04A 1KS5A 3VBSB 2CDPA 1RUF1 3GXUA 4XQWA 3URFA 5J37A 1F5FA 3WHUA 2JB8A 3ATGA 2XBO1 2GH8A 4FTSA 3LAGA 4RFRB 1AYM1 4J1WA 1MQTA 1E5RA 5FZ9A 5JSPA 2QTWB 4LHLA 2XJSA 1RJ8A 1ULDA 4K8FA 3OD4A 4K8RB 5AFBA 5L9VA 2HWD1 1MACA 1GWMA 3AJYA 1UY3A 1IPKA 1GZ9A 1W8TA 4HVQA 1NX9A 5JI9A 3UGGA 2RE9A 3I2GA 3RDIA 4E8CA 1UMZA 3KGLA 3MBWA 2FDGA 2ADEA 5FPVA 1LHWA 2WNVB 3WDXA 1GP6A 2JD9A 3CQOA 4PI2A 2O8OA 3QOPA 4BQ1A 4ZPIA 3ZIXA 2PHWA 2C9KA 3VBHB 2Z79A 1D4M2 3OUIA 1WW5A 4M0NA 4LBKA 5CFCB 1E5IA 2YZ4A 1PIV1 4AXOA 3JB8A 4Q0UA 1QJZA 1ZZ7A 4KWKA 3EYPA 1LHNA 4N90A 2DURA 5LW9A 3MIHA 4FQ4A 4JGYB 3WDWA 1AR73 1YUDA 4YW1A 2W5FA 5J1XA 5KHKA 2WAOA 2RMU3 3BB6A 1BMV2 5K0UB 4OVEA 4EJRA 3N35A 3VDDA 1JZ6A 3NNGA 5LCWL 4L2NA 3T0DA 2PHFA 4W6WA 5LBEA 1O8PA 4WZFA 1UZYA 2JDUA 3DF0A 2A71A 5GLUA 1UIKA 2WWJA 5FPBA 4A7ZA 5FDBA 3TRSB 5A6QA 4TLGA 2PHLA 3CZUA 4AR2A 1DHKB 5CBLA 5FOJB 2XONA 4M00A 1ZRDA 1CZTA 3W5NA 1H1AA 1RJ7A 4MHRA 1OVSA 4TLFA 3ZR5A 4LE4A 4NHLA 5JOWA 2DU1A 2XQRA 4INDA 4QQPA 3LKJA 1ZM1A 3KF3A 2ZGPA 3DYMA 2Y33A 1OD5A 1ULOA 4Y4YA 1WMEA 1W03A 2V5YA 4XF0A 5K0UA 3ZFEB 2WL1A 3ES1A 5FXXA 2GNMA 4OI4A 5FYZA 2VMIA 4N9IA 1H4HA 1JOBA 1ODNA 4COZA 3L9JT 1NE6A 4CDWB 1DQ0A 4UFJA 4CEWA 4YW6A 1UZVA 2DCYA 4AFDA 2VG9A 4WM8C 1PGL1 2Y6KA 3JQXA 2EALA 5FMBA 2OIIA 3LPFA 2N7GA 4IEVA 3H1WA 4Y1UA 3O1VA 3LFIA 1VBD3 1GV9A 4XILA 3RWKX 3C7FA 1XYPA 2GNBA 4LK6A 3RPQA 4N7UA 3FUQA 3ZYHA 4GULA 4RFT0 4NRQA 4Q4X2 5B4NA 1CAUA 4DIQA 1Q43A 3GBWA 3SISA 2JE9A 3MUZ1 1F2NA 2RDQA 3N7JA 4Y26A 4B29A 5IK5A 1NCRB 1IS5A 2PXJA 1YHFA 3ETPA 4LHNA 1W8FA 2Q8OA 2X05A 5L7OC 1RB8G 4HK9A 1PM4A 3AM2A 5FTTC 1IPSA 4P9WA 1D7PM 3U11A 3LEKA 4Y1XA 4AI2A 2Z69A 1LOFC 4E9KA 5CFCA 3UT0A 5LRSA 1WMXA 2XDVA 3I2IA 3OCPA 1MS1A 1JMUB 3R4DB 3O0XA 1SMVA 3VBUB 2FD8A 3WEZA 4XF9A 3FC0A 4V1PA 4WVVA 3V0BB 1ND2C 3R0RA 2LALA 2QQMA 4I02A 2EIEA 5FLHA 1O5UA 3OY8A 5CNAA 4IQPA 1QIQA 2C6SA 1VRH2 2E7TA 4Q4X3 4CYDA 1W6OA 4IV1C 2BWAA 3NVCA 1ALYA 1C57A 5FWJA 1HLCA 4DS0A 4N53B 1V70A 1ENSA 4P5HA 2IUWA 3GALA 2W39A 2B46X 3CBNA 4YZ1A 5FXWA 1H2MA 1F15A 4PLOA 4Y1YA 1RUE1 1PMJX 3Q8CA 2MEV1 2ZBJA 4LMFA 1IQAA 3ST7A 1PNFA 2VVFA 4BQWA 1PX4A 1FAYA 1KRIA 1M06G 1O91A 5E88A 5FLJA 1DFQA 5A33A 1BEV1 4ISQA 4RHV3 3IMNA 5FLIA 1JZ7A 3TEYA 3W9AA 4AHZA 4FOQA 4GQ7A 1JS9A 5LY1A 4XQ4A 5BY5A 1NCQC 4BXSV 4CCDA 4PQQA 3M3IA 3T0AA 2D43A 4UW6A 1W0NA 2IXKA 3I2DA 1HRV1 3GYDA 4E2QA 1QOSA 1S55A 1ZYBA 3CF6E 2OA2A 1J84A 3AMQA 4QT6A 4XXAA 5FRAA 2Q8EA 4A6OA 3MPPG 2QFEA 5DUWA 4ZZ8A 4P9JA 2WWUA 5C3OA 1AR82 1KXGA 3AZZA 2J1TA 3P1IA 2ARBA 4JHZA 2VOKA 2GC0A 4MGKE 3WNKA 3PUQA 2VW0A 4CCMA 3SEPA 1RUG3 5FMOL 4BJ0A 4D8MA 1UYYA 4LBQB 2R7EB 1OHFA 1PVXA 2AH2A 4DINB 1H6YA 5AVAA 5A32B 4Q1RA 2R30A 2ZEWA 1FMD3 2DVGA 3WP4A 2IFWA 2ORXA 3IDAA 4UFIA 1XNBA 4NHYA 1F8VA 2WNUA 3ZM8A 2QQLA 2RG4A 3EO6A 3K51A 3SXWA 1IS4A 1PZ9A 1AL21 3J7NA 2BJSA 1DGWA 3NW4A 2DCJA 1Z0HA 4HSJA 4CCOA 4BOWA 2VCBA 3QH7A 4IEZA 4Y22A 1SFPA 2PHDA 1LAJA 1DYPA 4BB3A 4DB5A 2ZEYA 4HSLA 4OHXA 2PLV3 1J3QA 3ZR6A 1PM7A 2ZMNA 5IHRA 4JDNA 5HBAA 3ZFFC 1I9RA 1PMIA 1W6QA 1V6OA 3ELNA 3LEIA 2VTXJ 2R6QA 4RQPA 1RUF3 3VLBB 1G6NA 2PA7A 3V0BA 1T6BX 3TEXA 5JUVA 2D93A 3A7QA 4Q4Y2 1ZA7A 2VNGA 4GALA 1K5MB 4GMP3 3ZN6B 3WF3A 1V6JA 2VGDA 1VE0A 5BUVA 3A4UA 4RS5B 4W65A 5T55A 3USSA 5EJ3A 2GN7A 4HBNA 2K9ZA 1WBLA 3LQCA 4PCRA 3WNXA 1MPXA 1LOBA 3ME2A 2VXRA 2WR9A 3B69A 1IGOA 3WHTA 4JGZC 1D4M1 5C8CB 4C91A 1SLCA 2B45X 2DU0A 3W59A 3NWKA 4MGSA 5JCTA 4UBGA 4W4ZA 1U0AA 1CJPA 4HN0A 1OQ1A 2DUQA 4WM7C 1N1YA 1OMIA 2WIIB 3AKSA 5F2SA 5DG2A 2CWMA 3EHKA 4P9IA 1XE8A 1PGSA 4YVWC 3VZMA 5F5CA 1SCRA 3WW1A 5K9YA 1FX5A 1UYPA 1W8WA 1ZBE1 2VCMA 1HB3A 2ARAA 4HKLA 3BOPA 4COVA 1XE7A 2EF6A 3SCHA 1M4WA 2CY6A 3RZLA 1UY0A 2XVKA 1RHI2 4FPCA 1AYM2 4N43B 5A1AA 3IN9A 1AR71 4AVSA 1RUE2 4OUEA 4W50A 4Y1VA 2OVUA 2D6KA 2YC0A 1CAUB 1FOD2 1OA2A 5IYYA 4OUSA 3TYJA 2XBO3 5CISA 3VBFA 5DAPA 3WXPA 2VMGA 2OS2A 4H3WA 5JZGB 3SEEA 4NWVA 1ZBE2 1A3KA 5DPNA 4DEQA 4AEKA 4FPJA 2HWE3 4OQ9A 4MUVA 1W2TA 1AYN1 4IERA 4EZ4A 5KHIA 5CG9A 1QDOA 2D3RA 5KHJA 5FYUA 3J4UH 4FP3A 2DV9A 4ZXKA 4CCKA 3LZZA 2AZ5A 4FPOB 3POWA 1VBC1 3NRUA 1AJOA 1GQGA 1DDLA 1Z78A 1ASJ3 4NRMA 4YVSA 3BPZA 5FYYA 1XU1A 1NT0A 2QZ3A 5IVCA 4C90A 3VKFC 1CZVA 1I5ZA 1MS4A 1KFUL 1LGCA 4Q4V2 4LIVA 4MGZE 1S0FA 1XNDA 3AYDA 2YROA 4M4RA 4QXCA 3ZVXA 2FDHA 2G9ZA 3TN92 1W05A 4A3XA 4CU8A 4DO0A 3J7LA 1EP0A 2XLGA 4M0HA 3BTYA 3H3LA 1RITA 4Q4X1 4GB31 1DQ5A 3I54A 3WT3A 4IEXA 3RFRA 4JDMA 3JUUA 1YO8A 5DUVA 4HLTA 5BNOA 2W1SA 5ABJB 5E89A 4FPFA 2ZPXA 3RSJA 3HBZA 4GMP0 3NL1A 2PAEA 2KXLA 1GZTA 3MO4A 4L9BA 4RHV1 2YU2A 2BWCA 4R9BA 4QHOA 4XUTA 4QGLA 3UGFA 1JHNA 4ZS2A 3AMNA 5KC5A 2WWSA 1WBFA 4I3GA 3B7MA 4Q1PA 4QWNA 5FZ0A 2D6NA 4KH9A 3VN4A 1NE4A 1AL22 1AXYA 2HH9A 4NN0A 1C4RA 2BTVC 4D0QA 1HRV3 3POIA 1OOPC 4HPKA 4DZGA 5B4XA 3VHOA 3HEIA 2EVXA 2VBBA 4IETA 1JOPA 5DDJ2 2VBDA 2WA4A 3FHQA 1PVC2 2QZ2A 3OYWA 3FLTA 3PMEA 2XKPA 4URTA 2ETEA 3I3DA 1UOJA 1XPWA 2ZGLA 1YFUA 5CU1A 1IPJA 1WKYA 2OX0A 1O6UA 2A3XA 5DUUA 1IS6A 2VE1A 2V4AA 4NIHA 3J26N 2OQ7A 3OB8A 4HN1A 3RG0A 3RVHA 3WLUA 2ZGUA 4W6XA 5IJRA 1O3SA 3D3AA 4UFKA 5DDJ1 1R1A3 4Y20B 1W6PB 4C1WA 1KITA 1CJDA 3AFKA 3C7EA 2P3KA 5BXXA 3J7HA 5FZAA 1R1ZA 3O1SA 2JKXA 1OUXA 5AC93 2Y6FA 4IEUA 4CXWA 2HEWF 4QAWA 2GMPA 4P02B 3U75A 1RUOA 3AB0A 5T52A 2PFWA 3SMHA 2A6VA 1QOOA 3LEMA 1OUSA 1EV11 1O4ZA 1UW8A 5AVPA 3WCRA 3SKJE 2VO5A 3WQ7A 1LGNA 3AL6A 4QPGC 5HCFA 3T1MA 4KQ7A 4LHKA 4EN6B 3B94A 4IE4A 4BWOA 4WM8B 5C71A 1CAWB 2JD4A 1BXHA 4QKFA 3VBFC 4RGGA 1OPMA 2Z4FA 5FY9A 3KZ4C 2BPA2 2WS92 4FOVA 4DRVA 2JG9A 2RS31 2W3JA 2WYSA 2XWBB 1BK0A 3O0WA 5FYCA 2RV9A 3HT2A 4MGYE 2C9AA 5I91A 3RZGA 2JG8A 4RYDA 4YGEA 2J1UA 4UW4A 4TZDA 2UY8A 2PAKA 2OPWA 2YBKA 3OY8B 3DEMA 5DAQA 2FDIA 2K46A 5FZ1A 4Q4V1 4JCKA 1ND3B 5FP9A 3HOBA 1TQ5A 1CAWA 1DQ2A 2WNOA 3I97A 5A70A 4HL0A 3AP5A 1TG7A 3VD9A 3USUA 1JOJA 4HFSA 2WZR2 3NAPC 2JECA 2F6BA 4GKYA 2XLAA 5D8AC 5A3PA 1ONAA 1WCUA 1MS9A 5JI7A 3UJQA 4CEYA 4W6YA 4JDOA 3VBSC 5LA0A 2VULA 2DVFA 3KV4A 4OHVA 1QH7A 4XFHA 4AVBA 2ZGMA 3M4FA 2HWB1 3HAGA 1EAH2 1QH6A 4EROA 5D21A 4KGQA 5K7PA 3O5SA 1OLRA 2JWPA 2Y8KA 1Q5OA 3RI9A 4ZXEA 4IUGA 3WNNA 2HWF2 4R9DA 1W28A 1NOVA 3OOXA 4NO4A 1X7NA 3N7LA 5GZFA 5LA2A 3POBA 1NQDA 2RS13 2WZPP 3LA2A 3MLLA 4TTGA 1WCKA 1H2LA 3HWJA 3KWVA 4GWMA 2J1EA 4LA2A 3KT1A 2WKKA 4FAGA 5ACA1 5JSRA 3GZAA 1CN1A 1QJEA 1ST8A 2DWRA 4I0WB 4KG0A 4XVHA 2C4XA 3T4HB 2WLPA 2D6MA 3LDRA 4BLIA 4DNYA 1Z7S1 1ZRRA 3KMHA 2DTWA 2QQPA 1GZCA 1X36A 1YQ2A 4XUOA 1WCSA 3EXUA 4UBHA 2XPJA 1S0GA 2F17A 2R16A 3CU7A 2RHPA 2WO3A 1ZNPA 4TWTA 4YVWB 1HXS3 4QX7A 1AXZA 5FP3A 3ZFEC 2ZX0A 4OI2A 4CXXA 4YYOA 3OUHA 4MOAA 1FV2A 1QNYA 1DBNA 1PX3A 3OBTA 4Z92B 2QKDA 2VZVA 1HJGA 1APNA 2ZMKA 1S0IA 1IKPA 4P9LA 3AYCA 2RS33 4MGQA 4GKXA 1W6MB 2PTMA 4NPRA 4UW5A 3D5OA 1JZ5A 2HEYF 5A3TA 3H7JA 4YG0A 1HQNA 3ZXFA 3NV1A 4NPLA 4IGOA 4B1LA 1YWKA 2VW2A 4NUBA 2RS51 5BNOB 2XVLA 1DU3D 5HV0A 2P3JA 4NHKA 1G9FA 4Y24A 5D2AA 2C0ZA 4QHBA 1W6NA 4BDVB 1RUG1 1MVQA 2OUHA 3WF1A 3ZYPA 4BA6A 4LBOA 2Q0AA 4F83A 5I93A 5JOYA 3ZO0B 1W8UA 1QJU2 1N47A 2JEMA 5C4WC 1ULCA 4ONUA 3TN93 3AKRA 3N7KA 3ZYIB 4CSWA 5KC6A 3AP6A 3GZUC 3MLKA 1VBA2 4CDXB 2ZOEB 5F3EA 1H4GA 4ZONA 5J48A 3AL5A 5FK7A 1Y9MA 4O65A 1PO21 4MLOA 4CDUB 4GD4A 4YG3A 5GZEA 2RM21 4FXGB 4CTEA 2HEVF 3UYJA 3HMYA 4EQVA 1H9PA 5J36A 4IEOA 3PDQA 2WNUB 3JQWA 1VBA1 1W3XA 4X8NA 4AOCA 4I2OA 2NZ9A 1YC61 5EFUA 4HT1T 4QB6A 3I59A 1YJLA 2TBVA 2XJUA 3EBRA 4K1YA 5CADA 1ENRA 1WA4A 1UYXA 3KB5A 4LBMA 2QDNA 5JIAA 4CDWC 3KCXA 4MO3M 4N53C 3CJIB 3AP7A 1QGLA 4AVAA 2Z5WA 1HRI3 1V9U3 2B39A 2XBO2 2G4IA 3EB7A 3CO2A 4ZY9A 4JKKA 4H14A 1WW7A 4K7JA 3ACHA 4P5YA 5C8WA 2R041 3AMPA 5EWSA 4AVCA 1W0OA 1G86A 3VZLA 3AXEA 3HT1A 1DZQA 3LWCA 5GALA 4IEWA 2YBSA 4PT6A 1GWKA 2W92A 4Y33A 4CEWB 1HIXA 4QGMA 2W0XA 4IEQA 2OW4A 3RWNA 1RUD1 1FI2A 1GP4A 1XC6A 4X8PA 3U07A 2ZHMA 3KCCA 2BVBA 4L11A 3WF4A 5FZKA 1N1VA 5F3CA 1ZZ8A 2CAUA 1LOAA 4LO6B 2DBNA 3I49A 1HXS2 2Z42A 3VDCA 2JDHA 2R1BA 3GGLA 3ABZA 3OG2A 1CAVA 1SPPB 3Q8BA 3R4SA 4FCAA 4JGZA 4JGYC 3VBHC 4FT8A 3BTAA 4QQOA 3VD5A 4QXHA 4RR3B 1NZIA 4M4PA 4Y5TA 1OOPA 5IWFA 4ET7A 2RJKA 4LT5A 2CSGA 1VRH1 3TOJA 3BIWE 3WW3A 1QF3A 2RDRA 3PNAA 5CKNA 5FXVA 3U78A 4FO9A 2D44A 3S5QA 2IVIB 3MW2A 4YWAA 3P5BA 4QPGB 1B09A 4ES8A 4BQ5A 3HN1A 2HWB2 4AI0A 4DXSA 5JPMB 1EAH3 1QXPA 5IK7A 2EXIA 4NHXA 1Y9QA 5CA6A 1IZ3A 1X82A 1PZ7A 1X33A 2WQZC 3T3YA 1HJFA 2BV4A 5F8PA 1O4TA 1DYKA 2X8KA 3OPTA 1JYIA 4ORFA 3N9QA 1HV1A 1K12A 2X53S 2WZR3 4JRLA 4YRDA 3RJ2X 2WABA 3A0NA 1VR3A 5A7SA 4AFCA 4AYUA 3ECQA 5IVYA 1P8JA 3ACFA 4QPGA 1ULFA 2E51A 3IDBB 5A7PA 3NKGA 4FFIA 5C4WA 3TEZA 2QQWA 3CZJA 4XIOA 2XXZA 5FPXA 2KM2A 3ZPOA 1YI7A 4B1MA 4ZS3A 3DECA 4ASKA 1R091 1ZZCA 2PQQA 3CKHA 5JZGA 5D8AB 2IXIA 1EPZA 1AX0A 2VQ0A 3C8XA 3M7AA 4YW7A 2Y26A 1OURA 3N9MA 1QXJA 3TWIA 4QPWA 1H6XA 1W6PA 3FE5A 4UF0A 5ISLA 1IKQA 1D0GA 1C1FA 1DYOA 1UZWA 2PELA 4QPIA 1HX6A 4LR4A 5H9QA 1LU1A 2DVAA 4CA9A 1L7RA 2FCUA 3HNYM 1LCLA 3IMMA 4JRAA 3WX5A 4BK5A 2RM22 1PGW1 1Y4WA 4QM8A 3PURA 3H9AA 4ISRA 4GIQA 4OI0A 1IOAA 1LESA 1UO9A 2ZEXA 2BP6A 1QDCA 1RXGA 1WLWA 3GJAA 1Q56A 1GNYA 1R1A2 3IIAA 4U36A 3IAPA 4MXVA 1BLZA 4AFAA 1PK6A 5C33A 5C9AB 3VBUC 1W3VA 1RUJ2 1SBFA 4V2VA 4CU9A 5C3RA 2BGOA 1AYM3 2Y38A 4XF4A 1JZ8A 2YXSA 2QJVA 5LEJA 5JXIA 4FP2A 4FXKB 4Q8LA 1GOGA 4JZRA 4FOWA 2P37A 2VMCA 1W9SA 2V72A 4BXFA 1QY4A 1UYZA 2QQUA 4UT5A 1LOGA 1VBC2 4AGRA 2I74A 1AYN3 4LOTA 3H8XA 2WRAA 3RZKA 1O3TA 3ROUA 4QX5A 4YW4A 4Y5SA 5F5IA 4JGYA 1GZWA 4WVMB 4GA9A 1SHWB 2VZ1A 5FMDA 2XLFA 4CXYA 1CAXB 2VOVA 4YZ5A 4YNIA 1GU3A 3V0AB 3MIEA 5CFDC 2IXLA 3MUY1 1V00A 2CAVA 3DPRA 1OXCA 5BNNA 4CUGA 1W8ZA 2ZHKA 2WO2A 1SQ4A 2PAMA 3UL2A 1NUKA 1NA1B 4LJHA 1ZBE3 3VZJA 4RL7A 3SITA 4AHXA 2XMLA 3WY6A 1HQWA 3ZN4A 4LE3A 1C5IA 3GBFA 1DIWA 1NY72 3MICA 4LO4B 4Y4RA 5ACA2 1XYOA 1BEV3 2D3SA 1AR92 2JKBA 2W2IA 2ZXQA 4XJAA 1CWPA 2HWD3 3RRDA 3SH5A 1VLNA 1VAMA 2VOWA 2YDEA 4O7XA 5FJKA 2ZX3A 1I3HA 1RMU3 1W9TA 4D6SA 3MHZA 4HMZA 2CHHA 1W2UA 4KMQA 1BJQA 1EUUA 3LIHA 3KV9A 5FZGA 3RYPA 1GSLA 5GZCA 4R4XA 4BIFA 4ITCA 2D6OX 3R05A 4PLNA 4WM8A 4KWLA 2IXHA 3PMSA 3KHCA 4XJ9A 3UESA 1OVPA 1DCSA 3WQ1A 4NIAA 3VKOA 1ZA4A 2W94A 5FP7A 4ATFA 2ZAHA 5EHDA 4YM2A 5KR7A 1WW6A 4LIUA 1OF4A 3VKNA 3PL0A 2P6CA 4DUWA 1R081 5E16A 2WYFA 2DUOA 2W68A 3WNLA 4D6RA 2UU8A 4Q8KA 1T6GC 2NP0A 1VIWB 2XG3A 4N7IA 4UW3A 4QMAA 2DCTA 3THTA 1F31A 2JE7A 1F4HA 4IGQA 5FO9B 3FFZA 1QJX2 3E97A 2ZGOA 1ND3A 1V0AA 1ULPA 1X9TA 3E6BA 3OBRA 4LK7A 4N53A 3PLQA 4TYSA 3VBRB 2ENRA 2WT2A 3I3BA 4CDQA 4Q0SA 4K3UA 4QQHA 3ASIA 4I01A 4E2SA 4X6RB 1W9WA 1AJKA 4XXPA 3SLIA 4O9EA 4UFMA 1SDWA 3IPVB 1QQP1 3G7DA 3MW3A 1JYXA 3S7IA 2CV6A 4Y1ZA 5HXMA 1YQCA 2XVGA 4AE2A 4CUCA 2D40A 5GZDA 3O1UA 4B4QA 4Q5OA 3TAYA 5FPZA 1H8TA 4DUXA 3W20A 3GNEA 1FPN1 1BHGA 4BMEA 2TNFA 3PJYA 5CVRA 1UZ0A 4GB33 4UI9L 1X8EA 5A7QA 2BW8A 1C8NA 3DN7A 5DN2A 5T50A 3ZXJA 4XC9A 1HRI1 1V9U1 4XDQA 1Y9GA 1QOTA 2X09A 2ET7A 4I30A 5T5PA 5H9PA 1YXWA 1ND2A 3X29B 4Q4Y3 4YVSB 3TBDA 5EJZB 5JXHA 4XPVA 4AEDC 4COYA 4CDUC 1H8TC 1QKQA 1G9AA 5F5AA 1XU2A 5FBJA 2WN2A 4CCEA 4FSJA 1WA6X 1ODMA 2YGLA 4G3YC 5CB7A 5JSOA 1SLIA 1CX4A 2V09A 2A6YA 2A6XA 4ZKTB 1AR62 2HLEA 2R1DA 2WNEA 1ZX5A 3OYWB 4HVRA 5A7NA 3V64A 1VBB1 1NLRA 5LASA 5I0SA 1ASJ2 3I4IA 5JWPA 1DQ6A 1VB2A 4CPBD 3B02A 3OEAA 3DPRC 3G6JB 2BNMA 3MI8A 3ZFFA 1LTEA 2ZAAA 3OPWA 1ZRCA 2J1VA 5FUIA 3JBG3 5IK8A 1TZOA 2V5DA 3IIIA 4JV4A 3JD71 5LBFA 1QJY2 1W6OB 2W95A 5D8AA 1DZRA 1R092 2WA3A 2E53A 2ET1A 2ZZJA 4HKWA 5C3PA 2R0HA 1SPPA 3VD3A 5A6XA 3R4UA 3S30A 4RGKA 4XDOA 2XGXA 1UOGA 5G05L 3WOGA 2ERFA 2WJSA 2W52A 3IBMA 3LDBA 2RR13 4H7LA 5FKBA 2NYYA 4QU2A 4SBVA 1XNAA 1SFYA 4C0HA 1UOFA 1XQNA 4XBNA 3OD0A 1FMD1 4XURA 2RS11 3K3OA 4FPHA 4QU1A 4BQXA 4W8JA 1RHI3 5A7WB 2D6LX 1SLTA 1K45A 3JB4C 4YGBA 5FZ3A 4CDXA 2HYKA 1GQPA 1D4VB 1GMMA 1WLDA 4NVPA 3GZEA 4PIYA 3HQRA 3CNAA 3MIGA 3BTXA 2ZMLA 1J3RA 1RUC2 1SDDB 2XL7A 3OEBA 4CVUA 3GHNA 3ZFGB 4I3PA 1H2NA 1YRZA 1PO11 5FXZA 4K21A 1I1EA 1HXS1 3NNMA 4QDQA 1MZEA 5JXGA 1S0EA 4EWEA 4ZU7A 3EJKA 1RUI1 4TSVA 1IQDC 1DZTA 5DZGA 1L3JA 2XKOA 1TME3 2D5FA 5A7WA 2VY0A 2RDNA 5BV6A 4ASLA 3MF6A 2ZGQA 4P08A 3VD7A 5EYXA 5M0TA 1KDKA 3WQBA 3PUAA 5CKQA 4CDWA 1H1MA 2D5HA 2VQUA 5HI0A 1RIRA 4LBLA 4F8AA 3H8RA 1O3QA 4NR1A 2VOXA 3K2OA 1FNYA 1VRH3 2YPJA 1MVEA 4XZUG 5CKMA 3KF5A 3PVBB 2ORZA 5FZDA 1VBD2 2JDMA 1UOBA 2H6CA 4LEJA 1OT5A 1AVBA 5E6HA 1GNHA 5FZBA 4KWUA 4WM7A 1YI9A 3D6EA 1BK1A 5I0TA 1PHMA 2QQIA 5FYIA 3RQ0A 2VNRA 1W99A 2J1SA 5KWRA 1AX1A 3P3PA 3AYEA 2WINB 5IFPA 1NXD1 3VB9A 4WBBA 4EN9B 1OLME 4QKBA 5FYSA 2K0GA 4PI0A 1RUD3 2QNKA 3VHNA 2ZTNA 3M3EA 3N7MA 5DG1A 2QUOA 1CAVB 4JGZB 3QBQA 3CIHA 4Q0PA 1JZ3A 1JYWA 2KD7A 4LKDA 4ARXA 1J58A 2BGCA 2BERA 5I8SA 5A3NA 1YQ6A 4WM7B 3RGBA 3JXSA 4YVWA 4CCCA 3KV5A 4GWNA 2VQAA 5FQ0B 3SKVA 2IC1A 3VGIA 4AQSA 4NOTA 2NN8A 4CDQB 1C8M3 3VZNA 1RUG2 1PK6B 2CL2A 5L7OB 4NIDA 2YV8A 2UWCA 5L73A 2DFBA 1CIYA 1KS4A 4QX1A 4LTAA 1JODA 4B7EA 1D0HA 5F3GA 3C7GA 1UXZA 2VMDA 5FZLA 5FZFA 4A42A 4R8HA 4PDWB 2LM3A 2GP5A 2B8MA 4JVAA 2OQ6A 4JQTA 3A0KA 1UQXA 4NHMA 5A32A 4JX0A 2YHJA 2A70A 4AK3A 2MNGA 1NCQA 3PIJA 1LKNA 1S0JA 3C2UA 4Y5Z0 4K9SA 4TXWA 2Q8CA 3BOWA 3ZDSA 2A6WA 1MS8A 2DDUA 2BUKA 2WT0A 4UF0B 2O8QA 3L2HA 3Q8AA 5C9AC 2OZ6A 2W1WA 2HWD2 3HN3A 4WVMA 1W2OA 2TEPA 2QQJA 4IV3B 5BNNC 4GWJA 3DCQA 4M3CB 1QJX1 5H9SA 2XOMA 1C8M2 1JZ2A 1ZREA 4N9HA 3DPRB 3AX4A 3CHXA 3J8F3 4GMP1 3AZWA 2G9GA 5J09A 1ZBA1 2WSVA 1BYHA 4K40A 5JOXA 5J96B 1GBGA 2ZGSA 3VBOA 2CTVA 2F4LA 3T2PA 2BGPA 1GOHA 4XFBA 3MFAA 2YYOA 2W08A 3H1YA 4LBQA 1XB9A 2PQSA 5EQUA 5FPLA 5FPUA 1OD3A 3IB3A 3W5MA 4IE0A 1MS5A 5DUXA 2ES3A 2A75A 4EZHA 1RVF3 4L92A 4HPKB 4AI8A 4E4ZA 4M3CA 3VDDB 3EMRA 1UMIA 5FZ4A 4CP9A 5FOBB 3RZJA 3OGSA 4I0BA 1W9YA 3ZXAC 1VBC3 3JBG1 3LGRA 3E6CC 4LA3A 5DMYA 2VNOA 3INAA 4LLOA 3VBOB 1SLAA 2JG9C 1RGSA 1XYNA 3I3EA 3LEGA 1B35B 4E27A 2ZX4A 1A34A 4BQ3A 3GCWA 3SCGA 3VHPA 1RL3A 1JU4A 4L0PA 4BMBA 4XAAA 5KXDA 1GOFA 1AUYA 4RQPB 3VV1A 5F6KA 2AGSA 3PVEA 2VC9A 1SEFA 5BNNB 4XJWA 1Y43B 2X29A 5DAWA 3O1PA 2HBUA 3LOBA 4AQTA 5IVJA 3RZZA 3UKVA 2JDPA 1R093 5EZWA 4NIIA 3D8CA 1AR83 3WCSA 1OBNA 3I7DA 3HBKA 2IWGB 2YU1A 4HONA 1OF3A 4AQ6A 1RXFA 4F7ZA 1XBFA 4UOJA 1LOEA 5FYVA 5EIYB 4XFIA 1XJAA 1ULGA 1WD3A 5L9RA 5KXBA 3ETQA 4PJYA 1A78A
chains in the Genus database with same CATH topology
1FPN3 1SBDA 2ZABA 1MEC1 2ZKNA 3FHIB 1TME1 3WDTA 4HK8A 4XFFA 4YW3A 2RMU1 4LNVA 2CGNA 4CRQA 1PZ8A 4PIXA 2R043 2UYAA 2CGOA 4WV8A 3FLPA 2DUPA 4B3NA 3FLRA 3AKQA 1G8WA 3IT8A 1R1A1 3HD8B 2PHRA 2VMHA 5A3LA 1D2QA 1QJY3 3UJOA 3M3CA 4COUA 1BBT1 3S6PA 3KT4A 4FPYA 4RGAA 3N36A 1S2BA 1AL0G 1PVC1 1RUNA 5C6CA 2UYBA 4IEPA 4MVTA 3O7OA 3THPA 1RUH2 3WG1A 4AWDA 1N3OA 4XFAA 4KNCA 1D4M3 4M3CF 4MYEA 2Q5TA 3NSTA 3DGTA 3MPBA 1GKBA 3H3ZA 3ZSJA 1A6CA 4LLFA 4Q0VA 4Q2FA 2CNAA 1IHMA 3IM0A 1QU0A 1VBE1 3FMGA 5DXDA 1AZDA 2WFF1 3OF1A 2ATFA 1ZRFA 2R062 3DUIA 1Y3TA 3LOIA 1BBT3 3TNPB 5LK7B 2E63A 1Z7S3 3DKWA 1A8DA 1TE1B 4YM3A 4YGCA 3RMXA 4Q4W1 2BQPA 2RR12 1GYKA 4GB32 5KC6A 3FZ3A 1TME2 2PHXA 4AHYA 1G7YA 1N3QA 3AKPA 3WW2A 4QM9A 2BBVA 3AFGA 5C8CA 2F4PA 3ZSMA 2Q1MA 4MXWB 4QQLA 5KXCA 2PYTA 2TUNA 2A73B 2SBAA 3AJZA 3AXDA 3U10A 1RUH1 1FPN2 2EXKA 4GH4B 4L97A 1O7FA 2HWC1 1WGPA 4BIOA 2YMZA 4Z2WA 4E4DX 1KDMA 2GMMA 4SLIA 4HANA 4Z82A 3P3NA 1J1LA 3H7YA 1UIJA 1XNKA 1S1AA 2LUWA 2WLQA 4D7YA 5GZGA 4MZUA 3ZXLA 4MGIE 1OI6A 4KU8A 3VBRC 2Q1ZB 3VBFB 1NA1C 1NY71 2XL9A 3QD6A 3W58A 3TN91 3MIFA 3ZX7A 1V6IA 3MDPA 1JN2P 5JLVA 1HW5A 1ZZ6A 3RS6A 4KL1A 1AR72 2DTYA 3SH3A 4FTEA 1VAVA 1W0PA 1MEC2 3JBG2 4Y20A 1RVF1 1C28A 2O1QA 2Y0IA 5T5OA 5F9TA 3ZYGA 4YZ3A 2GAUA 1RUD2 3BODA 1SCSA 5JVVA 2BFUS 2XUMA 2QE3A 1AR63 5GLZA 1AYN2 1S2KA 2JENA 4Q29A 3ZPYA 1H2KA 1DG6A 2ZGRA 1MQTB 4L99A 1YJKA 1RVF2 2NMNA 2BEOA 2HWB3 1CIWA 3BCWA 4DRRA 1S0DA 4KWJA 1LEMA 4JAAA 2XJQA 5I8YA 3WG2A 5JDBA 3PHMA 1DGWX 3LSEA 3FBMA 2JG8C 4EWAA 1LULA 2WNVA 1Q3EA 1CAXA 2QVSB 3WQ0A 3KCYA 2A3WA 3CJIC 4RSUA 4LUMA 4WZCA 3J8F2 1CPMA 5JMCA 4XZPA 3GHMA 3T1LA 1TNFA 2YY1A 3VBOC 4F3JA 4MV2A 3SHRA 5BNPC 2HWC3 1F9KA 2NMOA 4D7SA 4QXKA 5FO7B 2EAKA 4C0BA 4FPEA 4GH4A 1EV13 2VU9A 2ZX2A 1PIV3 5L36A 3IDEA 3HR9A 4OHWA 4XBLA 5D1IA 1RMU2 1VB4A 1H8VA 4CDQC 5BNQA 3NJZA 5IT6A 4AGVA 1ZBA2 1BZWA 3H8UA 4GXLA 1AR93 1I6XA 1MR5A 4BM8A 3MFCA 2ZHLA 5JOZA 1WLTA 4LBQD 1GQHA 5FO8B 3D4KA 2R061 4DY5A 3WG3A 4PIZA 1HDKA 4XIKA 1AR81 3H1MA 1Y7BA 2Y0OA 4Q0QA 3M1HA 2H0BA 4P9YA 1PGW2 2I07B 1UPIA 2R072 5GLTA 5J98B 1D2SA 4NWWA 1S0CA 1UCXA 1U5XA 1C5HA 3B9CA 3MYXA 3SNMA 5EYYA 1VBA3 2LTNA 1CVNA 4C1XA 5FBZA 4QGNA 4ZU4A 5BYNA 3ZYJB 3E5QA 5SV5A 4YM1A 4XHXA 3ZSLA 1BEV2 1CESA 1NCQB 1IS3A 1V6LA 5FQ0A 5BNPA 1VBE3 2MEV2 1TMF3 2WNUC 3VL9A 5FAXA 2WC2A 1VJ2A 2FQPA 4G9SB 3WV6A 4OLLA 1G9BA 3VKLA 2P17A 3AP4A 3R6SA 1OQDA 3QLQA 1MZFA 5FMOS 3TNQA 1LB2A 4I09A 3D0JA 4BPZA 2DVBA 3WINE 2RM23 2XJRA 4FQZA 1TEIA 1G9DA 3NV2A 3ZFGC 5F6LB 1COV3 4IEYA 4CDUA 2ZGNA 3WZ1A 3ZFEA 3KT7A 1UL9A 1RUC3 5BPXA 3SCFA 4FAHA 1LHUA 2DF7A 2SLIA 3M70A 1ND3C 3H3UA 1GLHA 2VVDA 1NA1A 1RUJ3 3N4MA 4Q4W3 3ZFFB 4E4SA 2RS12 5F1RA 2EAAA 4XFCA 1ENQA 1SLBA 5KBFA 1NYWA 4GH4C 1JTZX 5AC92 1BKZA 4UXAA 2VECA 2A3YA 2HJIA 4J6GA 1NG0A 4RA0A 2YUEA 4HKOA 1YIPA 3MEPA 1PO12 2CYFA 2I45A 1Q8OA 5J3UA 2EIGA 2X5IC 2PHUA 4YM0A 2AYHA 1UF2C 1NQJA 3GZTB 4Q26A 1SFNA 1SLLA 1V6MA 1C3HA 2B7YA 3AMHA 5SV8A 4LO5B 3J9SA 2AENA 3ZFGA 2PHTA 1POV1 3ZIWA 1N1SA 4RS5A 3LSDA 3QH6A 1HRI2 1V9U2 5I0RA 3DV8A 4FOYA 4LULA 1W6NB 1VBE2 3B9IA 4AEMA 2K2SA 1QJY1 3AZXA 4KBBA 2A7AA 2WFPA 3JD72 3RYKA 4Y22B 2RS52 1GICA 4LBJA 2FZ1A 3KS7A 1NXMA 1WUVA 5B2GB 4AG4A 4AF9A 2E6VA 5CFCC 1VBB2 2GSYA 5T5JA 3WUDA 3ZSEA 4M01A 1WD4A 4IV3C 1YNAA 3WP6A 1ZVFA 3I59B 2H6BA 1PO22 2DCKA 2V73A 5AC93 2AR6A 2Q4SA 4O9GA 2E7QA 2X5IA 4AGGA 2FMDA 3E5UA 1HQLA 2PN5A 4K1ZA 1QJX3 2EXJA 2VUJA 3WW4A 4AVVA 4DQAA 2VUAA 1OKQA 4LUKA 3VDDC 1UU4A 1PIV2 3WDUA 1GNZA 1LR5A 2MPFA 1FYUA 1Q8QA 4BYYA 1YCIA 3VBSA 1EAH1 1ENXA 1OA4A 2GC1A 4OUMA 5FREA 4MH0E 4YLZA 3K48A 1YFXA 1LECA 5T54A 4JTOA 3J8F1 2PLV1 1FATA 5HXVA 4MSVA 2OZJA 2WZR1 5K0UC 4MXWA 4RQPC 3EQEA 2IFRA 1HKDA 2JG9B 4H55A 1CGPA 3APBA 1UU5A 1DF0A 2E7AA 2ZCWA 4FPLA 4I0AA 3V0AA 4R9CA 5CFDB 1OQEA 2GALA 2O0OA 3WDYA 1UU6A 5J7MA 2UY9A 3IPVA 3ZN6A 1V6KA 1E57A 3LA7A 5I0UA 3RMYA 5F5QA 2P2KA 1VP6A 5AFEA 4AEDB 3VUOA 4XBQA 1H8TB 4S2FA 3ILFA 2FBEA 1MQTC 2VVEA 1RUI2 4B4PA 1EPWA 2H0VA 1BVVA 4YARA 4XOGA 4AVTA 4CEYB 1C1LA 3LCPA 3RYRA 1K5MC 4R4ZA 3AK0A 3PVNA 1V6NA 1RUC1 3WP5A 1EYBA 1QJU3 3M8LA 2X5IB 2XB6C 3MGUA 3OPZA 2XWJB 1X50A 3FBYA 4BLJA 3JZVA 3VBHA 2RR11 4Q4W2 2UWBA 1W6QB 4N43A 1OSGA 3WG4A 4AI3A 2WFF3 1REDA 1LOCA 3O14A 3MW4A 2R32A 4A7ZA 4META 1WW4A 2NPIA 1XNCA 2WNVC 1MS0A 3B00A 4KU7A 4RR3A 3ZN5A 3ZMOA 2P3IA 4JTNA 1OOPB 2GN3A 2RS32 4JC1A 3RI8A 5DZEA 3ILRA 3UK9A 3VBRA 2ZKLA 1GFF2 4AQ2A 4PBPA 5KXEA 2HWC2 4D3WA 3GBGA 2JX9A 1UD1A 3AP9A 1ASJ1 3KD4A 1COV1 4N43C 2YGMA 3GF6A 4YW2A 5IK4A 2VPVA 4PQ9A 1POV3 1QWRA 4EN8B 2A6ZA 4XEZA 1QXRA 2NQYA 4PLMA 1QNWA 2WFF2 2FMYA 1BBT2 4YFZA 3ENRA 1RC6A 1YFWA 3WR0A 4WVWA 4XETA 2OYZA 1CR7A 1WCDJ 4Z07A 3E5XA 2GC2A 3OTFA 4J1XA 3HQXA 3ZSKA 1HRV2 5HCAA 4D69A 4FTBA 3UV9A 4YVSC 3UKTA 2XJVA 3SH4A 2XJPA 2D6PA 4M3CE 1JUHA 4PBOA 1RUI3 1U5IA 1QHDA 3WD5A 3N3HA 3UKNA 1H1IA 2QCSB 4BCUA 3FX3A 5FCCA 4AI1A 1Q8VA 2DFCA 3NKTA 2HKXA 2JDZA 4XE9A 3VKMA 1H30A 3JD73 2ZS6B 3KM5A 4CP0A 3POSA 1LODA 2B5HA 4S2GA 1FXZA 5A3MA 2B42B 4XMAA 4A7YA 3U4XA 1WMDA 4E2GA 4DOUA 3VZKA 1REEA 2EA7A 5EV7A 1KQRA 3TB0A 3L2YA 5BNPB 5E8AA 4QPYA 3OJBA 1LHVA 3AZVA 3QACA 1BVP1 1PK6C 4OZXA 3JU9A 2GU9A 4X6QB 4AFBA 1W6MA 3D0SA 5GJ6A 1PO13 1CQ9A 1AL23 1Q8SA 2R0FA 4OI1A 1PNGA 2D98A 5CG8A 1YLLA 4XF3A 2QDRA 2OUJA 1SBEA 1ZZBA 2BYVE 4DPNA 1LJ7A 2CGPA 4QPIC 3CJXA 4YGDA 3ZXDA 4S2HA 4XTPA 1ZBA3 1H9WA 5H9RA 1U12A 4XMIA 3OGJA 2KA3A 2JG8B 1LGBA 2EXHA 1FOD1 2HWF3 4OFGA 4Q4Y1 1TMF2 4PDWA 3ES4A 3BALA 3MIDA 4AW7A 1A8MA 1LU2A 1FT9A 5CIRA 1KJLA 3KSCA 3KQRA 1VALA 4B8EA 1SACA 3ILNA 3OGGA 1OPOA 2PLV2 4A7KA 3ALQA 4D94A 2WT1A 3H50A 1O3RA 3T2TA 5GKAC 1VBB3 1YYNA 1VAKA 1AXKA 1EY2A 4U2AA 2IXCA 2R073 4AFMA 4B7KA 3D82A 1O5LA 4XQDA 3FJSA 2JXAA 2BNNA 2C5DA 5C4WB 3I8TA 4BH9A 1DGRA 4EWDA 2MHFA 3KGZA 1JXNA 2FHRA 2BVVA 1ND2B 3ZXEA 2GNDA 1C8M1 1J1TA 3FWEA 4P9GA 5IUQA 3V56A 1REFA 3ZXKA 1POV0 1RMU1 3NAPB 1RUJ1 1JW6A 5LRRA 1HV0A 2GZWA 1U5ZA 2P34A 1MS3A 1CD3G 4WVZA 3C3VA 2NLRA 1AF9A 4YZ4A 2R071 4AHWA 4COWA 4G4FA 5KHHA 1KJRA 3IKWA 4YW5A 3MZHA 4QD2A 1B35A 5JR7B 3ZMNA 4YZ2A 1Q8PA 1YFYA 4ATEA 4ES9A 1QJU1 2JJ6A 1OFSA 3VBUA 1XRUA 1UAIA 3MF9A 4H7MA 1WLCA 5LK5A 1J59A 2ZGKA 3IWZA 4JQRA 3VHRA 4KGGA 1VBD1 1FOD3 2HWF1 4IL7A 3MLJA 1Z7S2 4EN7B 4B4RA 1PVC3 4IESA 3QCWA 1AHSA 5C8CC 2Q30A 5T3NA 4XW3A 5ABJC 1LENA 5L7OA 4DXZA 1PO23 3POYA 1CPNA 1N3PA 4OHZA 1FNZA 4XF1A 1XXNA 3Q9OA 4EV0A 2ZHNA 5BNOC 3VZOA 5K8SA 1TMF1 3KLSA 4BZ4A 4ASMB 3WDVA 1UZZA 5EXOA 2ZA9A 4IV1A 2ILMA 3LA3A 5JPNB 5CAZA 5AC91 2RS53 4R52A 4PF5A 1J3PA 2R063 4FPGA 5A33B 3PJQA 4KG8A 4PDWC 2AREA 4Z8BA 3NV3A 4IXLA 4XJUA 2ZGTA 1QQP3 2MEV3 5GM0A 2ZZQA 5LEKA 1NCRA 1TNRA 1GR3A 2WSUA 2WS93 3WP3A 2CWSA 4Q4V3 4CZSA 4CP1A 3B3QE 1PGL2 5CFDA 1DQ1A 3CL1A 4HVOA 4XTMA 5L19A 1DGLA 3B5LB 3RNSA 1S0BA 1WMFA 4AEJA 4XYXA 3CEWA 1KD7A 1H0BA 1R083 4CP2A 1F5JA 3E6DA 4XHBA 4AEDA 1MEC3 4FVVA 4Z1VA 3ACLA 1FMD2 1GANA 5HCBA 1KFXL 1CONA 4LBNA 1W39A 1NLSA 2BFUL 2XH6A 2RJLA 1RINA 2R042 3WUCA 4CEWC 4DFSA 1K5MA 1LHOA 4HETA 3CLPA 2WS91 4XFGA 1N1TA 3BU7A 5DZFA 4XJ8A 4YFWA 3S0MA 5JIUA 1AX2A 1UKRA 1O4YA 2D97A 2GDFA 3H0OA 1JUIA 1GZWB 5DDJ3 2DVDA 3NV4A 4P14A 3M3OA 1B35C 3FUOA 3NO8A 2A5ZA 3B93A 1LRHA 1EV12 1COV2 3O0VA 1AR61 2FZ2A 2Z2SB 4HZFA 4RR3C 3B01A 4RHV2 3HIFA 4FPKA 2I2SA 2JICA 4IV3A 2NM1A 1QQP2 4R9AA 3CJIA 2IXJA 1LOFA 1MZ5A 5I8TA 4D7TA 3NAPA 1BQPA 2ARXA 3V65A 4BE3A 3PVOA 2BNOA 1ZZ9A 4BHPA 2VH9A 3VL8A 2R49A 2D7FA 4OULA 1ULEA 4ZU5A 1BMV1 3IDCB 1LEDA 1RUF2 3O12A 4RD7A 1X8MA 1YIFA 4L8QA 1FV3A 2C1FA 3FFQA 3PTYA 5T5LA 2ZX1A 3S7EA 2DYCA 4RS5C 2OPKA 2B9UA 2G9FA 2GC3A 1URXA 3ZXGA 5E1RA 5TSWA 4QQ2A 2GMEA 3AZYA 1DQ4A 4EN0A 3M3QA 1RUH3 1DLLA 1UPSA 3M2MA 1QMJA 5FFOC 2DCZA 3U0ZA 1OFNA 4MX3A 4YG6A 2GNTA 2UWAA 1OLQA 3USUB 3LB9A 3RJRA 1NZCA 2HWE2 5GLVA 4A2UA 2WQ4A 3AMMA 1UKGA 3AYAA 5GLWA