2ZHMA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
143
structure length
143
Chain Sequence
SQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-9
total genus 37
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhmA00
2ZBJA 1N3OA 1V00A 1KDMA 1DGLA 5T5OA 1S0GA 2AENA 3RRDA 5F9TA 2UU8A 1AJKA 4GWNA 4XBLA 5GLTA 3V0AA 4PCRA 1J1TA 1LTEA 1S0EA 2P37A 4FPYA 2V73A 3HN1A 5IUQA 3OBTA 1IS4A 3AYEA 1SBFA 4DRVA 1VAMA 2DU0A 2YY1A 3TAYA 1LOCA 2EXIA 4FPEA 4RA0A 2PELA 5IK4A 1V6NA 1LGNA 2UWCA 3CNAA 4P14A 3INAA 4MYEA 3QCWA 1N1VA 1QGLA 3T1LA 1V6MA 2P34A 3WG1A 1KQRA 1UN1A 3OY8B 3POWA 1JOJA 1Q8SA 2TEPA 3N3HA 1MZ5A 5DUWA 4YW2A 2NM1A 4PQ9A 1UKGA 3O12A 3AX4A 4DFSA 4YGBA 4FPOB 2I2SA 3MW2A 4BMBA 3RMYA 5IK5A 1AX1A 1JXNA 3FLRA 2OW4A 3OYWA 5JLVA 1LOAA 4W65A 2P3JA 5GZEA 3GALA 3OPZA 4ASMB 4YM3A 4YW5A 3WDWA 1DIWA 1N1SA 3W59A 5HCAA 1ULEA 4DPNA 4XE9A 1LOFA 1LECA 5GM0A 1IKPA 2DURA 2GNTA 1SLAA 3AJZA 1AXKA 1I1EA 1Q8PA 1UL9A 1CR7A 1PZ9A 2GN7A 4ATFA 4BM8A 2D6LX 4L8QA 1DQ4A 3WLUA 3N35A 3O0XA 1QOOA 1G9BA 3WV6A 1I3HA 1LODA 4K20A 4M00A 3NV1A 4I30A 3IM0A 3AXEA 3FUOA 3AZZA 2NZ9A 2E6VA 1CONA 3OBRA 3R4UA 4LBJA 1AZDA 4XJZA 2UURA 2A7AA 1LCLA 1AX0A 4NOTA 2DYCA 2DTYA 1LOEA 3JU9A 1W6OA 1F5FA 1ONAA 1WW6A 3M3CA 2ZGOA 2ZGQA 2JD4A 3N7LA 4TZDA 3LSDA 4NO4A 1G9DA 1SLCA 1QMJA 1ZM1A 2ZHNA 3AP6A 4YGDA 3ILFA 3N7JA 5JVVA 2NMNA 3FUQA 3WVJA 2D44A 2GNDA 1MS0A 4XJWA 3R05A 4ATEA 1MR5A 2DVFA 4OZXA 1O4ZA 4PBOA 4CZSA 3GNEA 4P9YA 1JW6A 1VIWB 1FNZA 1FYUA 1S0CA 4AVVA 3H0OA 2CYFA 1MS5A 3SNMA 2ZABA 4C1WA 1S0IA 2DVAA 2A71A 3WDUA 1AF9A 2EF6A 3SITA 1S0BA 1CVNA 3RG0A 2D3PA 1DLLA 2VH9A 4JC1A 1GV9A 5GZCA 4FPKA 2A6WA 2W39A 3A0KA 1MS1A 4UW6A 5JOYA 1D0HA 2DVGA 2ZMKA 4GKXA 3UL2A 3DUIA 2ES3A 2JE9A 1G8WA 3VKNA 2R1DA 4FQZA 1S0FA 1LEMA 1N3PA 2A5ZA 3ZSJA 1JYCA 3VKOA 1C1LA 1APNA 1G9FA 3APBA 2AREA 1DHKB 4YFZA 1Q8OA 1HQLA 4TYSA 1QDCA 2A6YA 2EIGA 3D6EA 2D6MA 2BQPA 1LENA 1Z78A 4XTPA 4XJ9A 3M3EA 1C57A 3FLTA 1UPSA 1H30A 5EXOA 1MS4A 2VW2A 4Q26A 1ENRA 4SLIA 1GZWA 1ZA4A 5DZFA 1A8DA 4GKYA 4Q27A 5JDBA 1KRIA 1QOTA 2DUQA 1W6PA 2ZGUA 2C5DA 4GALA 2JECA 4BLJA 1EPWA 4FOWA 4Y26A 4FPLA 1CN1A 3ZXKA 4FOQA 4FOVA 5L73A 3ZXLA 3WOGA 2CY6A 2ZGSA 4YZ4A 2D3SA 3SH5A 4CRQA 1B09A 1WW4A 5GLUA 3V0BB 2ZMNA 3RQ0A 4R9AA 4Y1UA 1SBEA 4Y24A 5DG2A 3OGGA 1V6LA 2ZZJA 1FAYA 2ZACA 5GZDA 2DVBA 3POSA 2D43A 3ZYPA 2CTVA 2WLQA 4AGVA 1W6MA 2D6KA 2DV9A 1RIRA 3A0NA 3B01A 4Y1ZA 1H9PA 2NP0A 4PF5A 3ASIA 2YZ4A 2P3IA 5FREA 4AVTA 1NLSA 4FPHA 1W6QA 3W58A 3U4XA 2ZGMA 3SH3A 4DRRA 1GKBA 1W0OA 1JBCA 1X50A 2WT1A 2ARBA 2GMEA 1FATA 4R9BA 5GLVA 1SLLA 1LOBA 2CL2A 2AGSA 2CWSA 4FP2A 1YO8A 4XHBA 3HR9A 1QNWA 3IPVB 4H55A 1CPNA 2YXSA 4LBNA 4YW3A 1G9AA 2WNEA 1CPMA 2CNAA 1N3QA 1W6NA 3AZWA 1S0JA 2P2KA 3B3QE 1ULDA 4XIOA 1F31A 4XJAA 3T2TA 1GZ9A 4U36A 5GALA 1OQ1A 1QNYA 3BOPA 4LBLA 2D6NA 2E7TA 3IPVA 1G86A 4PBPA 5CNAA 5GLWA 3N7MA 2ZAAA 1URXA 3WCRA 1LU2A 1IS5A 4YZ2A 2E53A 4ZXKA 4BOWA 5DZEA 3V64A 1MVEA 1Q8QA 5IT6A 1DQ2A 4YZ1A 2PHTA 1AXZA 4UW3A 1WLCA 1SFYA 3USUA 1FV3A 1MS8A 3NV4A 1OFSA 4Y22B 5T52A 3WUCA 4UW5A 1V6KA 2C9AA 4HANA 2LTNA 2VUAA 3OY8A 3AZVA 5GLZA 3MW4A 1QOSA 2A3YA 2XB6C 2DTWA 4LBQA 3WHUA 1HQWA 2YROA 4Q1PA 1VALA 4WVWA 1DQ0A 4WVVA 5F5QA 1Q56A 2PHUA 3ENRA 3LCPA 5E8AA 1G7YA 3AYDA 3AZXA 5KXEA 5KXCA 1LHUA 3WDXA 1WW5A 3OJBA 4WV8A 1MZ6A 2OUJA 1QKQA 4FVVA 3OYWB 2G4IA 4LBMA 3AJYA 5DUXA 5E88A 3IKWA 3O0VA 2DUOA 2PHFA 4XIKA 2E51A 1CIWA 1DZQA 1AXYA 2A6XA 3R4SA 2D6OX 2R16A 1ULFA 2WSVA 3FFZA 4YM0A 4M3CF 1JUIA 2EXHA 2ZMLA 4JRAA 3WZ1A 1UAIA 5H9QA 4BPZA 4YZ5A 1A78A 3M2MA 3AYCA 3AP9A 3WCSA 1CESA 4GA9A 3WHTA 5JMCA 3PMEA 1Q8VA 3D5OA 4YGEA 4BLIA 1G9CA 4LBQB 4YM2A 4LBKA 2DWRA 2UWBA 1MACA 1ENSA 1SCSA 2DU1A 4K1ZA 1D2SA 5GZFA 4XYXA 5HCFA 4Y1VA 4ISRA 1KJLA 4M3CB 4CTEA 3TB0A 5DZGA 3USUB 2A75A 3ZXFA 3ILRA 4BQ1A 1F9KA 4XDQA 3RMXA 4R9DA 3JUUA 2ZGLA 4LBOA 4Q1RA 1QU0A 5EYXA 1MS9A 2ARXA 1A3KA 2Z42A 4YG3A 4XMIA 4YW1A 3ZPYA 2SLIA 3ZSKA 4FQ4A 2A6VA 3IMNA 3PVOA 5JOZA 1V6JA 1AJOA 1GYKA 4Y20A 3WG2A 1O4YA 1CJPA 3D4KA 1GZCA 3AZYA 3SLIA 1NXD1 1PZ7A 1V6IA 5CA6A 2EXKA 2W08A 3NWKA 1GBGA 3WG3A 1U0AA 2VY0A 2HYKA 5DUVA 3POYA 2AUYA 3SH4A 3HMYA 4P9WA 3WG4A 1AX2A 1QDOA 3AYAA 2ZHMA 2PHRA 4GXLA 3LSEA 3PVNA 1BZWA 3B00A 1BQPA 1SLTA 3PVEA 1HDKA 4R9CA 1LESA 4Q8LA 1LOGA 4U2AA 4JCKA 2WT2A 2ERFA 1LHWA 4ZKTB 5JOXA 2ZGKA 4XHXA 4YFWA 5T5JA 3RSJA 2XG3A 1N47A 2A3XA 3MEPA 1LJ7A 4HL0A 1JHNA 1R1ZA 4FPCA 1FX5A 2KM2A 4RL7A 5T5LA 1S0DA 2WQZC 1WBLA 3DGTA 1DQ1A 3MPPG 2PHWA 5GZGA 2W52A 3V0AB 1N1YA 3AXDA 2P3KA 1YRZA 3I4IA 2GMMA 2D3RA 5IK7A 2DUPA 1FNYA 2VW1A 3RS6A 1AVBA 1JYIA 3KM5A 1BKZA 2W68A 3UJOA 2JE7A 2R49A 2JKBA 2GDFA 1YI7A 5JOWA 4XMAA 1W0PA 3VKFC 4Q2FA 4DQAA 2AH2A 2RHPA 3AK0A 2LALA 1LGCA 2H0BA 1BYHA 4ISQA 3WUDA 5IK8A 5DUUA 5EYYA 1S1AA 5CAZA 3V65A 1LEDA 2YV8A 3ZXEA 2Q5TA 3MW3A 1DQ6A 1VAVA 1VLNA 3FBYA 3AP7A 2A6ZA 4M01A 4P9XA 4XOGA 3ZSMA 4D69A 2JDZA 3M3OA 5HCBA 2VW0A 3M1HA 2NYYA 4FPJA 1GICA 1ULGA 2R1BA 1HKDA 1IOAA 1MVQA 2ENRA 3QLQA 3ILNA 4XJUA 1DYKA 1IS6A 3L2YA 3BIWE 4AVSA 3C2UA 1YXWA 2ZGRA 1KJRA 4XILA 1HLCA 3M3QA 4XXPA 5T5PA 1WD4A 3N7KA 2DVDA 3I8TA 4AYUA 1C1FA 5BYNA 1OKQA 1KDKA 1TEIA 2OUHA 1WLDA 4Q8KA 1YYNA 1IKQA 4YGCA 5DXDA 4YG0A 1KITA 1YIFA 5SV8A 2EAKA 3VKMA 1UZZA 5KXBA 1WBFA 2B7YA 3NV2A 2NMOA 3VKLA 2GNMA 3AP4A 3VV1A 1Y7BA 2GALA 3ZYRA 1W6MB 1SLBA 5GJ6A 1WCSA 1SCRA 1BXHA 1ENQA 2ZGPA 2R0FA 2V5YA 2WKKA 5DG1A 5KXDA 4YG6A 3VUOA 4Y22A 1MS3A 2D7FA 1PZ8A 4XTMA 1RITA 1GLHA 3B69A 4AWDA 1UX6A 2ZHLA 3AP5A 1SLIA 3T1MA 4LBQD 5H9PA 1WUVA 5T50A 1GANA 2AYHA 3ATGA 3WDTA 1DYPA 2SBAA 1LU1A 1LOFC 3ZVXA 4UW4A 5FRAA 4WZFA 1W6PB 1RINA 2WT0A 1WD3A 2WSUA 4Y1XA 1FV2A 4YW4A 5H9SA 2OVUA 4KBBA 1WW7A 3NV3A 4K1YA 1IS3A 3N36A 4Y20B 5E89A 5T54A 1ULCA 1LHNA 3ZXJA 1UZYA 2GMPA 2AR6A 2D6PA 2ZKNA 3AFKA 2EXJA 3PJQA 4K21A 1GSLA 2A3WA 2ZGTA 3IN9A 3V0BA 4BMEA 1CQ9A 3KQRA 1Z0HA 2WJSA 1LHVA 4YLZA 4AGGA 1N1TA 1GNZA 3O5SA 4XZPA 2ZHKA 4DS0A 3Q9OA 2ZGNA 2YMZA 3WDYA 1DFQA 2NN8A 1GZWB 3A4UA 3UK9A 1W6OB 5CB7A 4XJ8A 4XXAA 4FPGA 4AGRA 1LHOA 1W6QB 5LK5A 3UJQA 5T55A 3SISA 1SACA 4C1XA 1H9WA 1JN2P 2VU9A 5H9RA 4FOYA 2FMDA 2CWMA 2FHRA 4GWMA 4M3CA 1QF3A 5CBLA 1DQ5A 2GNBA 1DBNA 1GNHA 5EWSA 1WLWA 1W6NB 3BTAA 3FLPA 4Y1YA 5AVAA 2E7QA 4YM1A 1SBDA 3O0WA 3WNXA 3ZSLA 2R0HA 2JJ6A 4FP3A 2GN3A 4Z8BA 4XBQA 4YZ3A 3BODA 4IQPA 1V6OA 1BJQA 1LGBA 4F83A 1C4RA 2ZA9A 2UWAA 2VXRA 4FPFA 4XBNA 3B9CA 2A70A 3WDVA 4ITCA 1LULA 1XQNA 1UMZA 2PHXA 4M3CE 2EALA
chains in the Genus database with same CATH superfamily
4L92A 5C5UA 1U5XA 2W5FA 4XBLA 1UZVA 2XJQA 4MXVA 1ZZ9A 2O1QA 2QQWA 2J1VA 1J1TA 1LTEA 1RVF3 3LKJA 1WLTA 3K48A 4MGZE 1QWRA 4AQ6A 5ACA3 2VOTA 4LLOA 5BY5A 1SBFA 4DRVA 3VD4A 1RUI1 1CAXB 3J26N 4BK5A 2UWCA 4CCLA 2QUOA 3ZIWA 2Y6LA 5K7PA 1QGLA 3WG1A 3CKHA 1KQRA 1W8OA 1Q8SA 4YW2A 1MZ5A 3WW4A 2ZX0A 4LULA 3RYRA 4EN0A 1LRHA 4TXWA 2VAUA 4COUA 2RS13 4DFSA 2I2SA 5A3MA 1BMV1 4EZ4A 5IK5A 1AX1A 2P4EA 3OYWA 5FTTC 3MIEA 4YM3A 1MEC2 2JDHA 2JDNA 1BEV3 4YW5A 4NUBA 5F3IA 3MIHA 4IEVA 4JHZA 1IKPA 5FYZA 2GNTA 2Q4SA 1SLAA 2BFUL 4LT5A 2P5BA 2IFRA 1Q8PA 1IGOA 4JDOA 4LE3A 5BNNB 4KGQA 3LQCA 4ATFA 1X8EA 4ET7A 4L8QA 5DAVA 1DQ4A 4Y5TA 1PX3A 5HPOA 4N90A 4K20A 5TSWA 3WV6A 4R4XA 4A44A 2QQOA 3IM0A 3AXEA 3L2HA 1MZEA 3LPFA 3PUSA 3AZZA 4ONUA 2NZ9A 2WA3A 2E6VA 4LBJA 2VC9A 1G6NA 3U37A 5CFDB 2UURA 3NJVA 5LASA 5FYCA 1QJY1 5IAXA 1LOEA 3POGA 2PLV1 1EV12 1F5FA 1RUH2 2WNUB 5FPZA 1D2QA 2ID4A 2ZGOA 4URAA 2JD4A 3FN9A 5I0TA 3AMNA 3R0RA 4AHZA 1ZM1A 3N7JA 1RUE2 5JVVA 1TG7A 4YYOA 2NMNA 1TME3 2D44A 5F3CA 4QX3A 3R05A 3WNMA 4ATEA 1HJFA 1EP0A 3OBAA 4OZXA 1UX7A 5HCHA 3WSOA 2X53S 4CZSA 1W9TA 4AVVA 3J7MA 1FYUA 4RD7A 1RUD2 2CYFA 3SNMA 5IVVA 3WDUA 3AFGA 3NKGA 1AF9A 3IMMA 1PGL1 1S0BA 1CVNA 1FMD1 1GQHA 3QACA 4LR4A 2OQ7A 3RG0A 2QDRA 3VZLA 2D3PA 4DEVA 2W39A 2YGMA 4UW6A 1MS1A 2BDRA 1D0HA 4LEJA 1MQTB 1RB8G 4K6BA 3WNLA 4LKEA 3H8RA 4B29A 2XJRA 3H1MA 3VB9A 3H42B 5FQ0A 4DNYA 3DPRB 4FQZA 1A8MA 1JYCA 3LFMA 1APNA 1NLQA 3APBA 4QDQA 3O1TA 1ZRCA 1US3A 3I7DA 1OBNA 3I3BA 1QDCA 3UGFA 4MGTA 4NHLA 1VBB3 2X09A 4YW7A 3I59A 4BQ3A 1C57A 1RTVA 5EXOA 3GZEA 3EBRA 5A7OA 1GZWA 2J22A 2VMCA 3IT8A 1MQTA 1QJU3 1R1A2 5SV5A 3I2KA 2ZX3A 1OF4A 4GKYA 1QOTA 1W6PA 4XUPA 1COV2 4S2HA 5CFDC 4GALA 4PT6A 5ANNA 2WZR1 3K46A 2JD9A 4BLJA 5CYYA 1JYNA 1AR92 1L7QA 2XJUA 4FPLA 1JZ2A 3JD72 1SFNA 4P02B 1Y4WA 2DCZA 2CY6A 1XE0A 3SH5A 2D3SA 1F5JA 3WOGA 4CDUB 4KWUA 5GLUA 4Y3OA 5CFCC 4L11A 3WW1A 3RQ0A 4Y1UA 4DB5A 5J3UA 5DG2A 3ON7A 3OGGA 2ZZJA 1FAYA 2ZACA 4ZY9A 4B7KA 3U75A 2VULA 4O65A 2BWCA 5LA9A 3IWZA 2D6KA 2DV9A 3QH7A 2DBNA 4IXLA 4XFFA 4Y1ZA 2Y38A 4XW3A 4RQPA 3TEXA 1NLSA 5I8TA 1ASJ1 2QQMA 2JG9A 3AC0A 3W58A 3U4XA 1JTZX 5FK7A 3W20A 3SH3A 1GKBA 4YVSA 2WT1A 2GMEA 3MLLA 2W47A 5K9YA 3HR9A 1RMU1 2BEOA 3NNGA 1CX1A 2G1MA 3K4DA 4HMZA 3E1F1 4QHOA 2XUMA 1OOPB 3KGLA 2P2KA 1NUKA 1FXZA 4AHXA 1HRI1 3VL9A 3O1PA 4UBHA 2GC2A 3ZDVA 4BQYA 3KV4A 4QXCA 1F31A 5FY5A 2ZPXA 5C3OA 4GMP3 5FYTA 1IG3A 2Z5WA 4W8JA 2QQNA 2VJXA 3C7FA 1HB4A 2EIDA 4LLFA 4XUNA 3PUAA 4OHXA 1LU2A 5F5AA 4CEYC 4YZ2A 3KT7A 5CISA 4BOWA 2XPJA 2JDYA 2KR2A 2ORZA 2W94A 2R7EB 5L7OC 1TNFA 3MGUA 1FV3A 3USUA 3RZLA 3I3DA 4Y22B 1W8UA 4PQQA 4UW5A 1V6KA 4E2QA 1V9U3 1PVXA 1EV13 3MFAA 3MIDA 4C0BA 4DMIA 1UU5A 4WM8C 1QOSA 1AHSA 1ULPA 2Y26A 4I09A 4YNIA 3KHCA 1HQWA 1O8SA 2YROA 1VALA 3C7OA 4WVVA 3WF0A 3ZYFA 3PTRB 2AZ5A 5FZOB 2H6BA 3NW4A 5E8AA 3T0DA 4CDXB 1WW5A 3OJBA 2VZUA 2BPA2 1QKQA 3E6BA 4F8AA 3MUY1 4CEYB 2G4IA 2WZEA 2ORXA 4AFCA 4C91A 2BBAA 1VBD1 3HT2A 1CIWA 1O6UA 3H7YA 3HWJA 4QPGC 3RI9A 4HSLA 3TN91 5A6ZA 4Q4X1 4M3CF 1JUIA 2EXHA 2ZMLA 4W6XA 2HJIA 4IE7A 5BNOB 3LDRA 5FBJA 2C4XA 3WR0A 5LA1A 4RQPB 3LIGA 1YC61 2G19A 4YGEA 2W1SA 3EB7A 1OT5A 4P9JA 4YM2A 1YJKA 4CDQB 2WAAA 2YG0A 2DU1A 2JENA 1S4CA 3NJXA 5F7UA 1GP6A 5GZFA 4XYXA 4Y1VA 2B45X 4M3CB 3VBHC 4QPIB 4CTEA 1C28A 2WAOA 2VOVA 5JSPA 3T0AA 5D8AB 4DUXA 4KL1A 4XDQA 2XH6A 4Q0UA 2FDGA 4E27A 3ABZA 3HNBM 4LBOA 5KR7A 2HLEA 1HRV3 2IXLA 4V1PA 5EYXA 2ARXA 2Z42A 4YW1A 3ZPYA 4XMIA 5I0SA 2TBVA 3HEIA 1O7FA 4R52A 4LNVA 5JOZA 1V6JA 1PGW1 1GFF2 1H8TB 1O4YA 1LKNA 1YQCA 1L3JA 3CHXA 3U78A 3SLIA 1W90A 5DABA 1IQAA 1W3XA 2Z69A 4LXLA 3NWKA 1GBGA 3KF5A 2AUYA 2JEMA 4LHLA 1WGPA 1W2AX 4BCUA 1NX9A 2ZHMA 1CAVA 4GXLA 3TN92 4O7XA 1C5IA 3PUQA 4NVPA 4RFT0 1FT9A 1SLTA 2P3YA 4AHYA 2K9ZA 4FAGA 4R9CA 1LESA 4Q8LA 5A32A 3H1YA 1HRI3 1LOGA 1CAUA 1HRI2 2WT2A 3POJA 5B4NA 1LHWA 3JCIA 1JODA 1REEA 1RVF1 1X7NA 1RUC1 4XHXA 5FY1A 3RSJA 1J1LA 2XG3A 2WFF2 4L2NA 5A7SA 4NRQA 1I9RA 3A23A 3H7JA 3I2GA 4I0BA 1SMVA 1D4M3 1FX5A 4ZS3A 3ZFEA 3NNMA 2VMDA 4ZU4A 4QDSA 2YB7A 1S0DA 3DGTA 1DQ1A 3OEAA 2PHWA 4AQSA 3ST7A 5FBZA 1YRZA 4HBNA 2XQRA 4J6GA 4XFIA 1ACCA 2OZ6A 1R083 5IFTA 4NE9A 1VB4A 2RS11 5F39A 4BA6A 1AVBA 2B8MA 3ZN6B 1E5IA 3K75B 1GQGA 2JE7A 2R49A 4INDA 4RHV3 1YI7A 1NY72 2D5HA 1W0PA 4AR2A 3VKFC 4Q2FA 2AH2A 2RHPA 3B9IA 4D0QA 1NZCA 1PO23 1KGYA 1Y9MA 1LGCA 3ACHA 1AR63 3N9LA 3DKWA 1JZ7A 5DUUA 2VQAA 4JTNA 5EYYA 5LBCA 1LEDA 3UNPA 2VE1A 2YPDA 2ZX1A 4IERA 1VLNA 2A6ZA 4IV3C 1NCQA 4Y5SA 2JDZA 1ZREA 4PDWA 1GWLA 2ARAA 5EQUA 3S0MA 2ENRA 4Y4YA 1FPN3 4YWAA 3ILNA 2OIIA 5FY8A 4XJUA 4HPKB 2WINB 2QJVA 2QNKA 4GMP1 4HFSA 5T3NA 1ZBA1 1PM7A 2ILMA 2PYTA 1COV3 1KJRA 4XILA 5A1LA 3M3QA 1GWKA 4RSUA 5FYBA 2V4VA 2VZOA 4URTA 1OKQA 5BYNA 1KDKA 4QPIC 3SKJE 1H8TA 4NIHA 2DBIA 5KC6A 3E6CC 3EXUA 3VDDB 5JUVA 4YGCA 4CDWA 4O61A 5JPNB 1KITA 5SV8A 1US2A 4IGPA 1AYN1 4B4RA 1UZZA 5CG8A 4Q4V3 3HVDA 3DXUA 2XR4A 4BDVB 3QOPA 1UIKA 1QQP3 2NMOA 3DYPA 4H7LA 4FBFA 5FFOC 3VKLA 2GNMA 5FZ7A 5FZEA 3GF6A 1Y7BA 1OURA 3RZGA 1WCUA 1O59A 3WW3A 1BXHA 3AL5A 2VVFA 4RGAA 5C8CA 3VUOA 3RPQA 1QIQA 5FZ3A 1MS3A 3O1SA 1W9WA 2VNVA 4JKMA 3UYJA 4N43B 1GLHA 3D82A 4AWDA 3AP5A 2OZJA 4W4ZA 1RUNA 3SCFA 1OH3A 4A3XA 2WZ8A 3ATGA 1W9SA 3VBSB 3BYWA 5CEHA 1U5ZA 2YFZA 3UKVA 3FMGA 3LOIA 2IZWA 5EPAA 4OI0A 4LORA 4UW4A 2B5HA 1ALYA 1RINA 5FYIA 2WSUA 5C8CB 5IVCA 2W1QA 2OVUA 1JYVA 5JSRA 4K1YA 2WDBA 1YJLA 5T54A 3RI8A 2YPJA 2VUDA 4QM9A 4K21A 2PLV3 5AFBA 1GSLA 3IN9A 5L19A 1AR81 4A2UA 5EP9A 3RYKA 5ACA1 3ACGA 3KQRA 4YLZA 2XGXA 4AGGA 5HXMA 1N1TA 3FFQA 1UMIA 3HAGA 2DFBA 2MEV3 4QQ2A 3J7LA 4ZZ8A 3URFA 3VDBA 1K5MC 3LEKA 5A3OA 2ZGNA 5KWRA 4E9KA 2WFF1 3WDYA 5FZ0A 1WZXA 1YWKA 3E5XA 2WNOA 4XJ8A 3HOBA 5EJ1B 1OPMA 4Q0PA 2XKPA 5LK5A 1TNRA 2QE3A 3GXUA 2PAMA 1PVC1 4RR3C 2O8OA 4Q0VA 2EA7A 1NKGA 4AOCA 4C0HA 4QX8A 4OQ9A 5FWEA 4HKWA 5G05L 2K0GA 2WN3A 2FMDA 4LO7A 3VBUC 3VBRB 2CWMA 5LZ6A 4GWMA 1NA1C 1QF3A 5BNPB 5CBLA 2GNBA 4QGMA 3T4HB 4KWKA 2O8QA 3RFRA 5AFEA 4ORFA 2C24A 2JIGA 3NAPA 4HXCA 1DBNA 3ZMNA 3FC0A 5EWSA 3C7GA 3CLPA 5D1IA 5FLHA 1NY71 2E7QA 3ZSLA 3WNXA 4JGYA 4OULA 5I0DA 1D0GA 4OI4A 2BTVC 2RM22 1AR71 4Y5Z0 1OVPA 1J83A 3BODA 4IQPA 1V6OA 5FMCA 5J09A 1O5LA 2XONA 3RVHA 3O1OA 2XLGA 4M4RA 4XBNA 3B9CA 1U5YA 4JVAA 1UYZA 3WDVA 4ITCA 2I07B 1LULA 2HKXA 4QQOA 1RMU3 3M3IA 4M3CE 4S2DA 3M8LA 5FZ6A 1N3OA 1V00A 3KVBA 5BNOC 1UOJA 4NPLA 2F4LA 3GM8A 4C90A 5T5OA 1S0GA 2AENA 3S7IA 4LMFA 2UU8A 5F9TA 5DAWA 5GLTA 4XF4A 2RS33 1QJY3 1UY0A 4COVA 1S0EA 3IAPA 3N9OA 4FPYA 5M0TA 1OLRA 2VZTA 4CPBA 2VQUA 2JXAA 3EYPA 3TAYA 2EXIA 1O91A 4RA0A 3WINE 1V6NA 2FZ1A 4YPJA 4J25A 4P14A 1XRUA 1RUG2 2OQ6A 4XCBA 4IESA 1RUG3 2LW8A 3T1LA 4ZS2A 1HB3A 1UN1A 3JBG3 2Y64A 1JOJA 1IG0A 3N3HA 1VBC2 5DUWA 4KNCA 3I3QA 2XBO1 3WF2A 3GCWA 3KMHA 3AX4A 1L7RA 3MW2A 3SXWA 1UQXA 4WM8B 1YEWA 4IW3A 4QKNA 3BTXA 3FLRA 4CEYA 1V9U1 2DFCA 1LOAA 1JHJA 2P3JA 2CGNA 3GALA 3OPZA 4ASMB 5FKCA 3MICA 1DZTA 1N1SA 4AXOA 3W59A 4QPYA 2RM21 1LR5A 5GM0A 4DPNA 4MOAA 2DURA 5K4LA 1QJFA 5CKNA 4AEKA 1JZ5A 2FD8A 1K5MB 2HWB3 5LRSA 4TLFA 3K77A 1CR7A 2OPWA 4GWJA 5FY9A 4BM8A 5J48A 2D6LX 3MF9A 4CU8A 4LA2A 2XVGA 1ZBA3 5EJ3A 4DIQA 2CAVA 3POBA 1I3HA 1LODA 2WNVA 5E1RA 3NV1A 3WP6A 4QQHA 3CIHA 2VNOA 3FUOA 2WN2A 4RYDA 1AZDA 2HWE1 1W8TA 4CUBA 1VAKA 2BP6A 3JQWA 2VMGA 4BZ4A 4NIDA 3JU9A 3THTA 3GJBA 1UKRA 1WW6A 3M3CA 3GDBA 4CA9A 3VZOA 3MBWA 3WD5A 1EAH2 4A6OA 4CCKA 1G9DA 4LQRA 3VD5A 1SLCA 2QZ2A 4IV1A 3AP6A 3LIHA 4YGDA 3B94A 5FLJA 3FUQA 1NZIA 2YBPA 3LF7A 2WL1A 4UI9L 4EN8B 1C8M2 2DVFA 2WO1A 4EQVA 2WNUC 3GNEA 1EUTA 1FNZA 1S0CA 4QDRA 3NQHA 3CEWA 4GIQA 1MS5A 5F2WA 5LWBA 4CCCA 4D6RA 5L9BA 2A71A 3SITA 4FXKB 2PFWA 3CZJA 2J7MA 1HV0A 2ZEYA 3PUHA 1GV9A 2VGDA 1XU2A 3A0KA 2IC1A 1JOBA 1UYXA 2ZMKA 1SDDB 4PDWB 4QD2A 4Q0SA 3DUIA 4XDPA 2ES3A 3VKNA 2WLPA 3BU7A 5A7NA 2Y6JA 1VJ2A 1N3PA 1W8FA 2A5ZA 4WVZA 4TSVA 1S55A 4DOUA 1BVP1 5FKBA 2AC1A 4ES9A 1GOGA 4A42A 1Q8OA 2RV9A 1HQLA 2ADDA 5J98B 2RMU1 3D6EA 2BRTA 3ZKYA 2C26A 3T2QA 5A80A 5HXVA 5I93A 1LENA 5A7QA 4XTPA 3ZO0B 2VNRA 2JIJA 1UPSA 1H30A 1NXMA 4HONA 4OMDA 3ACLA 5FY0A 5FR3A 4CXXA 4PIXA 2I74A 4UT5A 3J8F2 4UBGA 1ZYBA 4OCTA 4NJ4A 2RR11 4Q27A 4AEDC 5BNQA 1KRIA 5LCWL 3U4SA 1PVC3 4BQ4A 1GOFA 3AKPA 2UYBA 4NROA 2FZ2A 4E4ZA 1NA1A 1EPWA 2KA3A 3ZXKA 1POV1 1CN1A 1RC6A 2ZKLA 5FZOA 4D3WA 1EYBA 2ZOEB 2ZGSA 4CRQA 3LDBA 5FP8A 4Z92B 1UCXA 2J42A 3ACIA 2XHNA 2ZMNA 2MPFA 1YFXA 1EV11 4CCJA 1JZ8A 3BI3A 2Y6GA 4MSVA 1V6LA 4WM7B 4A4AA 4E2SA 4JX0A 3FX3A 1W6MA 5DAQA 4AF9A 1UMHA 4M0HA 2ETEA 1A34A 4I3GA 1XPWA 4QM8A 5FAXA 3H8UA 3S6PA 1K5JA 4IEYA 4LIUA 4PF5A 3OPWA 3I97A 4DXSA 4P9GA 1JZ3A 4IETA 2YU1A 4WBBA 4AEJA 5FPBA 2HWC3 3T4VA 1W0OA 1JBCA 5D2AA 1VMJA 5C33A 5GLVA 1SLLA 2PLV2 2CL2A 1OC1A 2AGSA 2CWSA 2Q0AA 2Y33A 4D8MA 4FFGA 4H55A 4UOJA 1G9AA 2LM3A 4HETA 1QXJA 1N3QA 1W6NA 1PGW2 1S0JA 2GH2A 4P08A 1C5HA 3H8XA 4MXWB 1OMIA 2VVDA 1QJU1 3BU0A 2XLFA 1ULDA 3SQOA 5E16A 4WM8A 2BU9A 4MV2A 4XETA 1W8NA 3T2TA 2HWE2 2PQQA 4QHBA 5GALA 3BOPA 2E7TA 5L9VA 4KU8A 5GLWA 3ZSEA 1GR3A 4NIAA 5LRRA 4Q4V2 2WYFA 1O3RA 1VMHA 2E53A 3THPA 5DZEA 5FZIA 1ZZ7A 3J7HA 5BNPA 1MVEA 3CQOA 1AXZA 1QJX3 1QJX2 4QQPA 4XQDA 5FO7B 1MS8A 3NV4A 3HQXA 3NL1A 3VZNA 3OD0A 2VXJA 3OY8A 4LKFA 2VZSA 1HRV1 2JDAA 5GLZA 4XFCA 3TYJA 3LAGA 3KCYA 3ZKUA 3OEBA 3H9AA 4OUEA 3E6DA 4V2WA 2XJTA 3WHUA 3BALA 3DPRA 5FP9A 3AKRA 1DQ0A 4LO8A 2LRPA 1ZRRA 1Q56A 3MIFA 2WBKA 3POIA 1KFXL 4JQRA 5KHHA 3ZXGA 3CJIB 4EV0A 5JWPA 3AYDA 3VL8A 2WRAA 4CDWB 4CEWC 2VBDA 5FUIA 2PN5A 1GNYA 2XJPA 4BQ5A 1Q43A 3IDBB 4NAOA 3AJYA 5J96B 1AR62 5A1AA 2W92A 5L9RA 4QPGB 1F4HA 3O0VA 2PHFA 4XIKA 2E51A 4EWDA 1RUF2 1DZQA 4UWDA 5CFCB 2A6XA 2RMU3 2D6OX 1ULFA 1VRBA 2MEV2 2WSVA 3BPSA 3MF6A 1HX6A 2HWC2 3FFZA 4XEZA 4YM0A 3ZR5A 4Q4X3 4IUGA 1DCSA 5A33B 4DZGA 3KT4A 4LHNA 1CESA 2VQ0A 2VTXA 3HNYM 3VN4A 4Q4V1 2HWE3 3D5OA 2GC3A 2HBTA 1HN0A 4LBKA 4ZU7A 1J3PA 1MACA 1SCSA 3LE0A 4CE8A 3KCCA 1I6XA 1ND2C 4JKLA 1UOBA 1ODNA 4KQ7A 2VNGA 1KJLA 1Z7S2 1YIPA 1XYPA 2RDNA 1ODMA 5DZGA 3TB0A 5JIUA 1BBT2 1T6GC 5BXXA 2BFUS 3SCHA 4BQ1A 1ND3B 4H7MA 5FZAA 3VZMA 1K3IA 3WNKA 1A3KA 2RM23 3L9JT 2EIEA 2A6VA 2QQIA 4CCOA 4YW6A 2JDUA 2Y60A 2CGPA 1W3VA 4NRPA 4B3NA 4QX5A 1UIJA 3FHAA 3Q8CA 5LY2A 3AZYA 2J1AA 1NXD1 2OYZA 5C6CA 5CA6A 1AR73 2Q30A 1XNDA 1KEXA 2VCBA 5C70A 3WG3A 5DUVA 2AEZA 4JDNA 1VBE1 3WP5A 2HEYF 5C4WB 4LO5B 4META 1DYOA 1XOYA 2JG8B 4NN0A 3S57A 1RUF1 1AX2A 4KG8A 3KWVA 3LSEA 4AEDB 1XYOA 3B00A 1BQPA 4XAEA 3NSTA 3PVEA 4H3WA 1VR3A 1UY1A 3GYDA 5LB6A 2R043 3KQ4B 3NO8A 2P6HA 2R042 5A7WB 4U2AA 1HXS1 3N9QA 2D40A 4WM7A 4ZKTB 3K51A 3WNNA 2VZPA 1E5RA 2RJLA 3KB5A 4I0AA 5FZMA 2J1SA 2ZGKA 4YFWA 5EFUA 3KF3A 4PI0A 3S5AA 1RUC3 1VMFA 2BVBA 2Q1MA 4NIGA 2CU5A 4A45A 3AB0A 2L9LA 4HL0A 1AYN3 1R1ZA 1UWWA 2VOKA 1O3SA 2CSGA 2IXKA 3A22A 3OG2A 3KZ4C 1O3QA 5IJRA 2ET1A 1W0NA 3KS7A 3ME2A 3IIIA 3V0AB 2BGCA 2ZEZA 5APAA 3OUHA 4I2OA 1Z7S3 2J1EA 3KD4A 3CDZB 4HKLA 2C6SA 3RS6A 1ZZ6A 3LA2A 5FMOL 3IDEA 3RJ2X 5LW9A 4CDUC 4QGNA 3S7EA 1K12A 2JKBA 2FDJA 3MV11 4DQAA 1NE6A 1VBD2 3OGSA 3NRUA 3RZHA 1BYHA 5IK8A 4MADA 4PLNA 3ZXAC 3RZZA 2JDPA 5ACA2 5FDBA 3SMHA 4PIYA 3ZX7A 5FP4A 1DQ6A 1VAVA 5KHKA 1I5PA 2CHHA 1AL23 2RJ2A 4D69A 3KCXA 4MVTA 3M3OA 2DDUA 1FI2A 5HCBA 1J84A 2RS31 5BPXA 1I5ZA 5LBFA 1IOAA 3QLQA 4ARXA 1DYKA 1OLME 4BHPA 1AR72 1OKOA 3IIAA 4A3ZA 1YXWA 4NHMA 2MEV1 1YNAA 5T5PA 1WD4A 4AL9A 2X05A 4DXRA 1OHFA 4AYUA 1NG0A 1OI6A 2H0VA 2IUWA 2JB4A 3NVCA 4BISA 3MZHA 1TEIA 2V09A 2OUHA 1Q3EA 1T6BX 4R8HA 1CZSA 4NAMA 1MEC3 1ND2B 1IKQA 1YYNA 1NT0A 1QH7A 5DXDA 5J1XA 2XBO3 5FZLA 3VKMA 4AI3A 4BQXA 3NJYA 1REFA 3Q8EA 2FBEA 4Z1VA 1VBB2 1WBFA 1E57A 3AMHA 1H6YA 1REDA 1TE1B 4QWNA 1RUC2 4I0WB 5GJ6A 1WCSA 3JZVA 4IGOA 4DXZA 2BGPA 1ENQA 3PL0A 1HRV2 3C7EA 5ABJB 1Y9QA 5I0RA 1XNCA 1PZ8A 4DO0A 5JZGA 4OFGA 4XTMA 1W2OA 4D94A 1YFWA 1BHGA 3T1MA 3CJXA 5JR2A 1PIV2 5DQ0A 5T50A 3QH6A 2OPKA 4FT8A 3ELNA 2VECA 1XNKA 4DY5A 1ZZ8A 2FDHA 1LOFC 1RUD1 3OOXA 1J3QA 3ZVXA 1R092 4M4PA 4CDWC 2BNOA 2VMFA 4WZFA 5A1FA 5ABJA 4Y1XA 1UU4A 2MHFA 3TBDA 5DDJ1 1F35A 1H8VA 1RUD3 2XHKA 3NV3A 5A70A 3VBHB 2O14A 1H2NA 1LHNA 5FZKA 3UGHA 1UZYA 1IHMA 2AR6A 2D6PA 2ZKNA 1RUJ2 2EXJA 2WYSA 3AFKA 1OH4A 4IV3B 4N43C 4P5HA 3V0BA 2IXHA 4BMEA 4FTEA 2EICA 4YVWB 4ZXEA 1CQ9A 3BPZA 3HQUA 1Z0HA 1RUH1 1LHVA 2WWSA 3KGZA 4P9LA 4RS5A 3BIEA 3MIBA 1QXRA 1GNZA 2QQUA 4RQPC 4EROA 4ES8A 4K9SA 4DS0A 2RS12 2VZ1A 2YMZA 1RUE1 1OA4A 4GULA 2WNUA 1QQP1 3UK9A 1W6OB 1XJAA 5J36A 4AGRA 2FCTA 1LHOA 1W6QB 2IXJA 4FCAA 2VUJA 5LBEA 1PK6A 3J7NA 2OKXA 2NPIA 1O8PA 4EN7B 2R071 3GGLA 4C1XA 4IV1C 3GBGA 1H4HA 3ZDSA 1NE4A 3VDDC 3ZOIA 1JS9A 4EYUA 1Y3TA 1BEV1 3T30A 3D8CA 2FHRA 4R4ZA 1GP4A 1R64A 1A6CA 1PO13 4Q4Y3 1PO12 2DCJA 2RDRA 4RS5C 1AYN2 2Q8OA 1W6NB 3H3LA 3JD71 2RMU2 3FLPA 4MUVA 1WMEA 2FCUA 5K0UB 4QT6A 3O0WA 1BVVA 2Y6FA 3I2OA 3VBUB 1SZBA 1ULOA 1YUDA 2R0HA 4BK4A 1FMD3 4N7UA 3OUIA 2R32A 4RR3B 4W6YA 4K3UA 4HN1A 1UYYA 2IVIB 1C4RA 1VRH3 3ETPA 3MLJA 4BU2A 4LHSA 5DDJ3 5C9AB 2UWAA 3JQXA 4QX0A 2A70A 3P3NA 1ND3A 4JDMA 1UMZA 3J9SA 5K0UA 2EALA 1BLZA 2ZBJA 3NV2A 4LOSA 5G04L 3SC7X 4Z2WA 4RGGA 2YGLA 4FO9A 1DGLA 4WZCA 2Q8EA 3RRDA 2W95A 4GWNA 2LS6A 1DF0A 4UFMA 1C8M1 3B93A 2G9GA 4HVRA 1RUJ3 5C9AC 2P37A 4TWTA 1EUUA 5DN2A 5IUQA 1IS4A 5KHJA 2HWF3 5FMBA 4BB3A 1GU3A 4AFDA 2YY1A 2WIIB 1LOCA 4K8FA 2QCSB 2BZDA 4FPEA 4UF0A 4XUQA 2PELA 5HV4A 5IK4A 1LGNA 2VOXA 5FOJB 3CJIC 3I2IA 1N1VA 1XU1A 1V6MA 2P34A 3MPBA 3OY8B 1J3RA 3POWA 2TEPA 1JYTA 2WR9A 1UKGA 3O12A 5FWJA 4BQ2A 1UO9A 1JOPA 2QKDA 4BMBA 3N9MA 2PAKA 1JXNA 3ZLIA 2OW4A 1KS4A 2WC2A 4NHKA 1POV0 4YRDA 4W65A 2K2SA 4XACA 5FMOS 1WCKA 3USSA 3BKZA 4OI1A 2P1BA 2RS32 1ZZBA 3U11A 5HCAA 3VBHA 1LOFA 3DXTA 1ZA7A 5C3QA 1RYYA 4E8DA 1X9TA 2HWD1 2R063 2RS51 4ASLA 4HZFA 4KWJA 3ZN4A 1AXKA 1UY3A 4D7TA 1I1EA 4FTBA 3D3AA 1PZ9A 2GN7A 3O7OA 5JZGC 4N9IA 5A6QA 4YVWC 1FPN2 2R061 1QOOA 1CD3G 1LNSA 4I30A 5IVFA 1YQ8A 1CAUB 4OHYA 1TMF2 1AYM3 1KD7A 1CJDA 1CONA 1MZFA 4XURA 4AVCA 4XJZA 2ZEXA 2ATFA 1QJEA 3LEGA 4ZU5A 1AX0A 2XKOA 3NNFA 4NOTA 2DTYA 2VUCA 5ANQA 1RUI2 3T2PA 1D4M1 3F95A 2ZGQA 3LDKA 3N7LA 4TZDA 4NO4A 3G6JB 4LITA 4G4FA 1W2UA 3WT3A 2VCMA 4NR1A 2GAUA 2TUNA 3EO6A 4OHVA 4AI0A 3AKTA 4XJWA 3TEWA 1BBT3 4MGYE 5LY1A 4PBOA 4XPVA 1HW5A 1JW6A 1VIWB 4IEZA 3VHRA 4KMQA 1XYNA 2F4PA 3H0OA 3WP3A 4CP9A 5KBFA 2DVAA 5FZGA 3B5LB 1OA3A 2EF6A 4CXWA 2W1WA 4WM7C 2GU9A 5LK7B 5JI7A 5A3NA 2HWB1 5IATA 4AI8A 3DN7A 1R082 4JC1A 2VTFA 2HWD2 2A6WA 3NNLA 2HWD3 2CDPA 2DVGA 4NPRA 4GKXA 1SEFA 2HWC1 3CBNA 4XABA 4A6SA 2JE9A 3S30A 1G8WA 2R1DA 1S0FA 1XNTA 1K45A 4JZRA 2QBXA 2W2IA 3I59B 3VKOA 1C1LA 4EZHA 2FDFA 2EAAA 1G9FA 3GJAA 5F6LB 3I2HA 1DHKB 1ND3C 1OUXA 1UZWA 1WWYA 4YFZA 5LEJA 1CAVB 1EAH3 1RMU2 1TMF1 2A6YA 2I45A 1T2XA 2BQPA 2XXZA 1Z78A 5L7OA 1LAJA 2PAEA 3FLTA 4CUCA 2VOWA 1TMF3 1MS4A 4C8DA 4AFBA 2WNVC 3C7HA 2VL4A 4SLIA 3POEA 1R1A3 1HB1A 1ZA4A 2C0ZA 2WS92 5DZFA 1A8DA 5FPAA 5K8SA 1BK0A 2DUQA 1RUH3 1SPPB 1RGSA 4XVHA 5FY4A 2R073 2C5DA 3AVRA 2RG4A 5IVYA 4AI1A 4CCDA 3GHNA 1AYM2 4UAPA 4Y26A 1VBA3 5A3WA 2QFEA 5I91A 1VBA2 5IYYA 1CAWB 4FOQA 4CXYA 3ZXLA 1RUE3 5J37A 4BE3A 4HVQA 3DL3A 3V0BB 1E5HA 1SBEA 1RL3A 1H8TC 4QPIA 3OCPA 4W50A 1W05A 4QGLA 5FPUA 4XAAA 5BNNC 2DVBA 1B35B 3POSA 5IVJA 2D43A 4L97A 3PJYA 5FMDA 4QB1A 4AGVA 4XF0A 5CVRA 3MIGA 2OX0A 5CFCA 1RIRA 3B01A 5I0UA 3WF1A 2W9XA 2NP0A 5FREA 2PMWB 2WNVB 1F2NA 2P3IA 2YZ4A 1WCQA 3R6SA 4OYUA 1W6QA 4QKBA 5CKMA 5LEKA 2ZZQA 3K3OA 2JICA 2BNNA 1DG6A 4R9BA 4PLOA 5AC93 5AC92 3UT0A 5FP3A 5F37A 2Q1ZB 1RJ7A 4XHBA 4FP2A 3ZMOA 4QHZA 2HEWF 4CDQC 1VBE2 1RHI3 1SQ4A 2YXSA 1FPN1 4LBNA 4QB2A 3WF4A 2J1UA 3RZMA 1V70A 4E4HA 3ZYJB 2KXLA 5FJHA 3AZWA 1AL0G 3ZN5A 2ZTNA 3B3QE 1ZNPA 1ZBE2 3ALQA 3DPRC 4K8RB 2PHDA 1RHI1 3KHBA 4RHV2 2RR13 2RDQA 1ST8A 4XIOA 4L9BA 1FOD3 2BV4A 3HJRA 4IEOA 1R1A1 1F15A 1GZ9A 1F8VA 1QNYA 4PBPA 4LBLA 2D6NA 3IPVA 1G86A 3E5UA 4B8EA 3N7MA 1C8M3 3BUCA 2ZAAA 5B2GB 4D7YA 3WCRA 1IS5A 1QH6A 2VQTA 4ZXKA 2CGOA 1OLMA 5FLIA 3V64A 4CDXC 1Q8QA 1DQ2A 4UFJA 2Y8KA 1XC6A 4UW3A 1NYWA 5A3TA 1WLCA 1SFYA 1YQ6A 2WS93 5FIXA 2Y6HA 4AQ2A 1DLCA 5FUNA 4AZZA 2LTNA 2VUAA 2JWPA 3AZVA 4N8MA 3R4DB 3FJSA 2WA4A 3ZXDA 3SEEA 1AR93 2A3YA 4LO6B 2XB6C 3ZFFB 2DTWA 2XUEA 4Q1PA 3AMPA 5EHDA 3RWKX 4LKDA 2Y34A 1KS5A 2R6QA 2JDKA 3CZUA 4XQWA 3LFIA 4JAAA 4BYYA 1QY4A 5F1RA 2FMYA 4ZZ5A 2YDEA 3PIJA 4JHTA 4BQWA 1LHUA 5KXEA 5KXCA 4YVSB 2WUHA 2F17A 1W03A 5FZ9A 3ZYIB 4FSJA 4MO3M 3VBFC 1L7LA 2GP3A 5DUXA 2XLAA 3FBMA 1UPIA 4KBZA 2J1TA 3IKWA 4WVMA 2DUOA 2VD7A 3DYMA 3JB4C 5IVBA 1AXYA 3U14A 3J8F3 3UKTA 5JZGB 2R16A 1X33A 4J1XA 4JRAA 4MGSA 3VBOC 3WZ1A 1W2TA 5H9QA 4BPZA 4YZ5A 1A78A 3M2MA 3AYCA 2XOMA 2D93A 3AP9A 3WCSA 4GA9A 3WXPA 3K4ZA 4D7SA 3BTZA 3IDAA 3DV8A 4XFHA 3WEZA 4OUMA 4AFMA 3DECA 4UXAA 2LROA 2UWBA 2XQXA 4ARYA 4HK9A 5A6XA 4MGKE 2VZVA 3NNJA 5ISLA 4K1ZA 4KU7A 1D2SA 2IWGB 3AMMA 4LK6A 4S2GA 5FPLA 4NIIA 4FFIA 3BGAA 4XCAA 1C3HA 3WQBA 2WO3A 1UU6A 4GAZA 5B4XA 2A75A 3PURA 3FWEA 1M4WA 4AEDA 3LOBA 4BXFA 4GQ7A 4IEWA 3RMXA 3MUZ1 3A21A 4R9DA 1JI6A 2ZGLA 1QU0A 4B1LA 5C4WA 1MS9A 3KV9A 2VZQA 2SLIA 4N53A 4FQ4A 3LEMA 3NMBA 4OMCA 3PVOA 1FMD2 3LD8A 2D98A 3GHMA 1GYKA 3TNQA 3WG2A 1CJPA 3HPNA 4Q4W1 2Z79A 3D4KA 1GZCA 1PZ7A 3ITQA 3OGJA 2YC0A 1TVGA 4JGZA 3WX5A 4CCMA 1U0AA 2VY0A 2PXJA 1SFPA 3POYA 3ZPOA 3SH4A 2IVJA 1RXFA 2BGOA 4I01A 4P9WA 5FZ8A 2ZS6B 4QQLA 3AYAA 3O1MA 3H50A 1QJZA 3NKTA 3PVNA 3T08A 1AYM1 1DGRA 1PM4A 4A7ZA 3THDA 1YQ5A 4HN0A 3RGBA 3I3EA 3B02A 4MZUA 3WNOA 2BVVA 4QKFA 1WMFA 3WQ0A 1U12A 4IE6A 5FQ0B 1YQ2A 3TN93 2RJKA 1UXZA 1N47A 3EQEA 1LJ7A 2DF7A 4MGQA 5C8CC 3UESA 4JGZB 1CZTA 1HB2A 1AL22 4FPCA 5FYYA 4FFFA 4GB31 4Z82A 3JBG1 2KM2A 1D7PM 2XVKA 4X6RB 5T5LA 1WBLA 2UYAA 3BN6A 3GZTB 3VBSC 5GZGA 5F3EA 1X8MA 2W52A 3HD8B 3T3YA 1N1YA 3VD3A 1IPJA 1OFNA 4PLMA 4MHUA 4AI2A 3I4IA 2GMMA 3UV9A 3MDPA 2BNMA 2Y0OA 3NAPB 1P8JA 2DUPA 1NAEA 1FNYA 4EWEA 1BEV2 3KM5A 1W8WA 2W68A 1IPSA 3F2ZA 2FDKA 1ZBE3 1PNFA 2GDFA 5FPVA 1XSQA 4DEQA 4QB6A 1SPPA 3RZJA 2X5IC 3AK0A 4Q4W2 2LALA 3VGIA 4Q4W3 4YSFA 4Z07A 4ISQA 2H0BA 3LEIA 4KI5M 3U07A 3VBSA 1ZBE1 3WUDA 2QQPA 2YV8A 3ZFEC 3MW3A 1ASJ2 3FBYA 1VRH2 4BJ0A 5A7WA 3PU8A 4FFHA 3DEMA 4M01A 4P9XA 3W9AA 3ZSMA 1BCXA 3M1HA 4FPJA 1GICA 1UOGA 5CG9A 3I2FA 4QMAA 3IAQA 3MYXA 1GMMA 3ES4A 3EJKA 3WQ1A 2ZCWA 4LUKA 5FYHA 5CKQA 1IS6A 3BIWE 3OB8A 4LK7A 2X29A 3A7QA 4AVSA 3FL7A 3C2UA 1RVF2 4HT1T 2ZGRA 2R072 4Q4X2 3RJRA 1HLCA 1W9YA 4NWWA 3N7KA 2DVDA 3I8TA 1PIV3 3VHNA 4KH9A 4XFBA 2RE9A 5FCCA 1WLDA 3K4AA 4Q8KA 2X8KA 1RUI3 5AVPA 4CU6A 4YG0A 1MEC1 4BIOA 2EAKA 3LZZA 5LA2A 1XXNA 1Z7S1 2VPVA 3ZFEB 5KXBA 3M4FA 4FXGB 2Z4FA 3MHZA 1WMXA 3ZFGC 5D8AA 1HXS2 5LBBA 5FP7A 4CP0A 1XSRA 2CAUA 2RS52 4N43A 2FDIA 5I8SA 3AP4A 1JUHA 1DP0A 4JRLA 1V0AA 3ZYRA 1W6MB 5C4WC 1SCRA 4XUTA 5CADA 1J58A 3TRSB 2ZGPA 5I8YA 2V5YA 4G9SB 5KXDA 2B9VA 5C3PA 5FY7A 2D7FA 2QDNA 1RITA 3DYOA 4IE5A 1UX6A 4I3PA 1SLIA 1DZRA 5F5CA 2CV6A 5H9PA 2VZRA 1WUVA 5LATA 1GANA 2AYHA 2VM9A 3WDTA 2B4KA 2VVEA 2YFUA 4MHRA 3SCGA 2ZEWA 2SBAA 4KG0A 1LU1A 1IPKA 1NCRC 5FRAA 1SDWA 3OD4A 4YW4A 4BXSV 1WD3A 1X82A 4AHWA 5L36A 1RUF3 1ASJ3 3IBMA 4FI9A 1JU4A 2WQ8A 2XJSA 4KBBA 1WW7A 5FYVA 2R062 4Y20B 1PO22 4O9EA 5E6HA 5E89A 1ULCA 4LO4B 3ZXJA 1XBFA 2R041 3LGRA 3PJQA 3ZFFA 1GUIA 2ZGTA 4O9GA 3T0BA 5CIRA 5DMYA 1OOPA 1XNAA 3U0ZA 3ZFFC 1JZ6A 3O5SA 4E2GA 4TLGA 4CP2A 3OTFA 5FZDA 3LPGA 4LJHA 4DUVA 1GQPA 1AUYA 3FE5A 2NN8A 1F4AA 1POV3 1GZWB 3I49A 1KFUL 1HQNA 4XXAA 3D0SA 1R081 5FZ4A 3TWIA 3UJQA 3SISA 4XF1A 1OQEA 3AL6A 1JN2P 3ZYBA 2GP5A 4FOYA 2HWF2 4JQTA 5BNOA 1Y43B 3PIGA 4IEXA 2K46A 3OSDA 1DQ5A 2GH8A 4BIFA 3VZKA 3VHOA 1OOPC 1GNHA 3OGVA 1WLWA 4QPWA 5FO9B 3BTYA 1W04A 3QBQA 3MLKA 3HIFA 4UFIA 3T09A 2BERA 2B39A 4YM1A 2RS53 3H1WA 2UY8A 4FP3A 2B42B 2JJ6A 1CAWA 2GN3A 3FHIB 4XBQA 3RDIA 3VBOA 4Z8BA 5C3SA 5KC5A 2AEYA 3O1VA 4XDOA 1BJQA 1LGBA 4F83A 1UY2A 1UYPA 2BYVE 4YVWA 3BCWA 2Y0IA 1VRH1 4Z2AA 5J7MA 5FXVA 1NCRA 2Q1FA 4QX2A 4JGYB 3SEPA 4AVAA 1DDLA 1COV1 2ZJCA 4FPKA 4OHWA 4B4QA 1AR82 1KDMA 3Q8FA 1FOD2 1AJKA 1DU3D 3EHKA 4HKOA 5JXHA 3WP4A 3V0AA 2WFPA 1VBB1 4DUWA 4PCRA 3UGGA 4Q4Y2 1TQ5A 4PF1A 4HSJA 4GJYA 2V73A 3CO2A 3HN1A 1JU3A 5F5IA 2B46X 3AYEA 3OBTA 5DAXA 3GBWA 4N9HA 1VAMA 4CDQA 2DU0A 4EN6B 1C8NA 3EMRA 1DGRN 4AVBA 4YVSC 4HK8A 1QHDA 1STMA 3GCXA 5FYMA 3CNAA 3P3PA 3INAA 4MYEA 3QCWA 5FZCA 1QJX1 4NHXA 5F8PA 2NM1A 2P17A 4PQ9A 4QAWA 3JB8A 1HIXA 2ZAHA 3E97A 1VPHA 1VE0A 1SHWB 4YGBA 4FPOB 3KV6A 3AMQA 3D0JA 3JD73 3RMYA 3FHQA 4CCEA 3NJZA 1PX4A 4AAXA 1HN1A 1RXGA 5A6YA 5GZEA 4CSWA 1R093 5C9AA 5IHRA 5JXGA 5JIAA 3CU7A 3WDWA 1DIWA 1ULEA 1NQJA 3CF6E 2VCAA 1LECA 4XE9A 3TEZA 3VD9A 3LWCA 1PMHX 3N4MA 2Q8CA 1R091 3AJZA 2BOJA 3ETQA 4CCNA 4D6SA 1UL9A 4UFLA 1TME2 3I2DA 3AM2A 4B1MA 4XF3A 4X6QB 3WLUA 4IV3A 3ORJA 1MQTC 4OHZA 3N35A 3O0XA 3BVCA 4TN7A 1G9BA 4M00A 1RJ8A 5FXZA 3OBZA 1HXS3 1FOD1 4AE2A 1QQP2 3TEYA 2PA7A 1PMIA 3V56A 2LUWA 4AFAA 1OPOA 1PIV1 2EIBA 4LKSA 1ZRIA 3M7AA 3OBRA 1GP5A 1GWMA 3R4UA 1JZ4A 1UW8A 3ZFGA 2A7AA 3H3UA 1LCLA 2DYCA 3HT1A 1W6OA 3GZAA 3CL1A 1ONAA 4LA3A 4OUSA 5FK8A 2Z2SB 2OA2A 1CAXA 3LSDA 2VBBA 1H2LA 2E31A 2A73B 4GWIA 1QMJA 1UZ0A 2RR12 2ZHNA 4HLTA 5BNNA 3ILFA 4AQTA 1RUOA 2ADEA 5HV0A 3WVJA 2GNDA 2JE8A 1MS0A 2XBO2 4V2VA 4FTSA 1M06G 1MR5A 2HEVF 1O4ZA 4P00B 1IQDC 4P9YA 3N9NA 3VD7A 4XZUG 2ZABA 3OF1A 4H14A 4C1WA 1OSGA 1B35C 1Q5OA 1S0IA 3ZFGB 2JDMA 5CFDA 3PDQA 5IFPA 3O14A 4LOTA 2ET7A 2IXCA 2X10A 5A7PA 1DLLA 2VH9A 5GZCA 3T2OA 1YFYA 4OZOA 2V4AA 4K40A 5IW0A 5JOYA 3IZOA 2DCTA 4K7JA 1ZZCA 3TOJA 3OPTA 3UL2A 4EWAA 1H0BA 2W87A 1BMV2 2QQVA 2A1XA 4AK3A 2B9UA 1LEMA 3IDCB 3PLQA 4IGQA 1KXGA 3ZSJA 2ZXQA 5HBAA 1CZVA 3ACFA 4CEWB 2YHJA 2KD7A 4CU7A 4HPKA 1UOFA 1XB9A 4DINB 2AREA 1Y9GA 5FO8B 4TYSA 2E26A 2EIGA 5C5TA 3W5MA 4N53B 1VBD3 2D6MA 3P1IA 2F6BA 3H8OA 2JKXA 3M3EA 4XJ9A 2G9ZA 3RWNA 4J1WA 2HH9A 2VW2A 1W8ZA 2NLRA 4F7ZA 4Q26A 2QTWB 1ENRA 2HWF1 2VG9A 5JDBA 3KLSA 2ZGUA 1YLLA 2WZR3 2JECA 4FOWA 4AEMA 3VBOB 2WWUA 4DY3A 4FOVA 5L73A 4GB33 3VBUA 4DXTA 2DCKA 2BWAA 4YZ4A 3X29B 1B09A 1WW4A 2XVLA 1W39A 4R9AA 4Y24A 2GC1A 4P5YA 1O4TA 1WA6X 5GZDA 4QKDA 1WMDA 2YU2A 3ZYPA 2CTVA 2WLQA 4NWVA 4CVUA 2C9KA 2Q8DA 5EV7A 3A0NA 3B7MA 3WNPA 4JGZC 5FPXA 1H9PA 4NRMA 4QPGA 2XL9A 3ASIA 4AVTA 4A7YA 5FV3A 4FPHA 1X36A 4W6WA 3ES1A 2ZGMA 4DRRA 5CU1A 1X50A 2XL7A 4IE4A 2ARBA 2BJSA 1FATA 3M70A 2G9FA 3PU3A 4N53C 2ARCA 3AKQA 5IWFA 1LOBA 5JSOA 4ZHNA 4IE0A 1YO8A 3W21A 3ZN6A 1QNWA 3IPVB 5FZHA 1CPNA 4Y4RA 4YW3A 2WNEA 4PJYA 1CPMA 1VBC3 2OT7A 2BOIA 2CNAA 1DGWX 3BOWA 4WVMB 1YHFA 4X8PA 5FYSA 1YFUA 4RS5B 2JG8A 4OVEA 5L7OB 1VBC1 4COYA 3PUIA 1OQDA 4XJAA 3AKSA 4U36A 5A3PA 4IEUA 1OQ1A 5CNAA 5FZ1A 4IV1B 2E32A 1D4VB 2RDSA 3KV5A 3K3NA 2VR4A 1W2NA 1CGPA 1PK6B 1PGL2 1U5IA 1URXA 1HJGA 5JI9A 4QXBA 1PNGA 2YYOA 3H3ZA 3SHRA 5JPMB 2YC4A 3N9PA 4YZ1A 2VZ3A 2JB8A 2PHTA 3C8XA 3ZIXA 5IT6A 5JLVA 5DPNA 5D8AC 1W9FA 3MFCA 3WUCA 1OFSA 1TME1 3Q8AA 5T52A 2WS91 1YCIA 2C9AA 4HANA 4Q29A 1ZVFA 1B35A 1CX4A 4NMIA 3U10A 1O3TA 4MG2A 3MW4A 3IB3A 3VBFA 3DKQA 4RFRB 3ZM8A 4X8NA 2VMIA 5ERLA 1AR91 4LBQA 4LIVA 4WVWA 5F5QA 4OI2A 5A3LA 4LE4A 4B4PA 2PHUA 5F32A 2E63A 2E9QA 3ENRA 4KGGA 4KWLA 4IEQA 3LCPA 4GJZA 2R30A 1G7YA 2YC2A 2J1RA 2WWJA 3AZXA 4LPLA 2QZ3A 3WDXA 5JMOA 4WV8A 1MZ6A 2OUJA 4FVVA 3OYWB 4LBMA 1GOHA 1H2KA 1JMUB 3SKVA 4ASKA 2P6CA 3RZKA 1UXXX 4PDWC 3Q8BA 4QX7A 5E88A 1RUJ1 2YBSA 5CZKA 1QJU2 3ZYHA 3HNMA 4Y33A 3R4SA 3RYPA 3JBG2 3E5QA 3VBFB 1PGSA 4CDXA 1NQDA 4GH4C 1UAIA 4CUAA 5FZFA 3VDCA 1ENXA 5LA0A 5JMCA 3WHTA 1JYXA 3PMEA 1Q8VA 4JV4A 4BLIA 1H1MA 4HVOA 1G9CA 4LBQB 1S2KA 5HI0A 2DWRA 4Q5OA 1ENSA 2CDOA 2TNFA 1ZRDA 5HCFA 1ND2A 1OA2A 2ZX2A 4S2FA 4ISRA 3VDDA 5IVEA 2VO5A 3WQ7A 4PI2A 3USUB 2PQSA 1XNBA 3ZXFA 3ILRA 1PO11 1F9KA 3HN3A 3WW2A 4QU1A 1NCRB 1OVSA 3JUUA 2GSYA 4Q1RA 4YG3A 2WZR2 3ZSKA 3IMNA 1OF3A 4OLLA 1AJOA 1GZTA 4Y20A 1CWPA 3VHPA 3I54A 1ZBA2 1W06A 5BV6A 1RHI2 1XE7A 1ZX5A 2D97A 4RHV1 3THCA 1V6IA 2PHLA 4QXKA 2EXKA 1SG3A 2W08A 3ROUA 3I3MA 2HYKA 3MV01 1AR61 3J8F1 2QQLA 2QQKA 1H1IA 3HMYA 1HV1A 3VLBB 3WG4A 4QU2A 1QDOA 3U1XA 2PHRA 1YI9A 1BZWA 1H1AA 2N7GA 4AAPA 2XJVA 3AVSA 4N7IA 5FOBB 3KT1A 1HDKA 1CIYA 1EY2A 4UYBA 3J4UH 3P5BA 4JCKA 4BWOA 2ERFA 2V5DA 1OD3A 2E7AA 2VMEA 4CPBD 1UY4A 5KHIA 3MI8A 1JYWA 2IXIA 4RGKA 5JOXA 5T5JA 2W91A 1H2MA 3MEPA 2A3XA 4AG4A 2GC0A 1W99A 4SBVA 1JHNA 2PTMA 1NA1B 5BNPC 4CP1A 4RL7A 5EJZB 2WQZC 5JAXA 2XDVA 3MPPG 4G3YC 3G7DA 4IEPA 3QD6A 4LUMA 3WF3A 1ZRFA 4CP9B 4QXHA 3AXDA 2P3KA 1PHMA 2D3RA 4XUOA 3VZJA 5FXWA 4LHKA 5IK7A 1LB2A 3UETA 5JCTA 1UNBA 1VP6A 2VW1A 1WA4A 4CDUA 2W46A 3PVBB 1H4GA 2NQYA 4CU9A 2QVSB 3MO4A 5EZWA 1BKZA 4ZONA 1JYIA 5A32B 2DCYA 2JX9A 2YUEA 2XWBB 3C3VA 3PMSA 4PHZA 3UJOA 3O1RA 4GMP0 3VBRA 5JOWA 4MLOA 4XMAA 1PO21 4XF9A 1QEXA 3HBZA 3BB6A 4RR3A 2X5IB 4COZA 2JG8C 4IDZA 5JXIA 4HG6B 1J59A 3FZ3A 1S1AA 5CAZA 3HQRA 4JGYC 3LA7A 3LB9A 2Q5TA 3V65A 3ZXEA 1DGWA 3KSCA 3AP7A 4MGIE 4XOGA 3NAPC 3GZUC 1K5MA 1XE8A 2W0XA 2EVXA 2VW0A 4MH0E 4XQ4A 2NYYA 5FYUA 3I2JA 3TNPB 4CUGA 4MX3A 4YARA 1ULGA 2R1BA 4GZ9A 1HKDA 1MVQA 2XMLA 1VBE3 3K2OA 5A33A 5FJKA 2FCVA 3L2YA 4I02A 1QJY2 3W5NA 1PVC2 2O0OA 2VCCA 4XXPA 1BK1A 1C1FA 3PNAA 5KHGA 4XFAA 4AI9A 1AR83 1NLRA 2Y6KA 4P9IA 4L0PA 3VBRC 4TTGA 3POFA 5F3GA 4JKKA 5A3UA 4Q0QA 1YIFA 2GZWA 2OS2A 4FAHA 4D6QA 4NHYA 2QQJA 1JH5A 4PIZA 4UF0B 2ZX4A 1POQA 2B7YA 1RUG1 2W1UA 4MXWA 5FZBA 4Q4Y1 3DCQA 2VBPA 3VV1A 1S2EA 2WQ4A 1IZ3A 2GALA 4GH4B 4B7EA 2UY9A 1SLBA 5C8WA 2E33A 2RVAA 5GKAC 2R0FA 1UF2C 5BUVA 2WKKA 5DG1A 1WKYA 4YG6A 4Y22A 3CMGA 1V9U2 4ZPIA 1W28A 4COWA 1OLQA 4CYDA 3B69A 4M0NA 2WABA 2ZHLA 1O5UA 2WO2A 4LBQD 3OGRA 3S5QA 2VTXJ 1EPZA 1VB2A 5K0UC 3KVAA 1DYPA 1E5SA 3OUJA 4XFGA 4EE2A 4RN5A 5C71A 1OUSA 1W6PB 2WT0A 3JXSA 2H6CA 3DF0A 1S2BA 1FV2A 4QX1A 5H9SA 4E4DX 1PMJX 5IAVA 1EAH1 2HWB2 1X9PA 1IS3A 3N36A 4L99A 1UD1A 2WO7A 4GH4A 5F2SA 1AL21 3PHMA 2GMPA 2FQPA 3PTYA 1OD5A 4E8CA 2A3WA 4IL7A 4F3JA 2JG9C 1D4M2 2WJSA 2WZPP 1H6XA 2D5FA 3CJIA 3ZYGA 4XZPA 2OXBA 1K42A 2ZHKA 2BW8A 1NCQC 2WFF3 3LA3A 1TZOA 3Q9OA 1NCQB 4CEWA 4A41A 4UFKA 1OXCA 4GB32 3RNSA 1DFQA 1VBA1 3A4UA 4AW7A 1MPXA 5CB7A 1PK6C 1W8HA 4FPGA 3O1UA 2JG9B 2HBUA 3HBKA 1NOVA 5T55A 4BH9A 4OQ8A 1SACA 2X5IA 4E4SA 1H9WA 2VU9A 4JTOA 5H9RA 3ECQA 3UKNA 4EJRA 5F6KA 4M3CA 1BBT1 5DAPA 2W3JA 4GD4A 3ZR6A 5D21A 1QXPA 2C1FA 5JR7B 2IFWA 4HOOA 3BTAA 1WCDJ 5FUPA 4Y1YA 5AVAA 2V72A 1SBDA 2BUKA 4UFHA 4H2AA 5C7GA 5JXJA 2VMHA 4XC9A 3WY6A 4YZ3A 2HYXA 4NPMA 5AC91 3P6BA 4EN9B 5C3RA 2BBVA 5EIYB 4LTAA 2MNGA 2AACA 2YBKA 5DDJ2 2ZA9A 4A7KA 5ABJC 2VXRA 4FPFA 3VDAA 5FXXA 1XQNA 2XWJB 2PHXA 3GBFA
chains in the Genus database with same CATH topology
4L92A 1U5XA 4XBLA 2XJQA 4MXVA 1ZZ9A 2O1QA 1J1TA 1LTEA 1RVF3 3LKJA 1WLTA 3K48A 4MGZE 1QWRA 4AQ6A 5ACA3 4LLOA 5BY5A 1SBFA 4DRVA 1RUI1 1CAXB 3J26N 2UWCA 2QUOA 3ZIWA 5K7PA 1QGLA 3WG1A 1KQRA 1Q8SA 4YW2A 1MZ5A 3WW4A 2ZX0A 4LULA 3RYRA 4EN0A 1LRHA 4COUA 2RS13 4DFSA 2I2SA 5A3MA 1BMV1 5IK5A 1AX1A 3OYWA 5FTTC 3MIEA 4YM3A 1MEC2 4YW5A 1BEV3 3MIHA 4IEVA 1IKPA 2GNTA 2Q4SA 1SLAA 2BFUL 4LT5A 2IFRA 1Q8PA 1IGOA 4JDOA 4LE3A 5BNNB 4KGQA 4ATFA 1X8EA 4L8QA 1DQ4A 4N90A 4K20A 5TSWA 3WV6A 4R4XA 3IM0A 3AXEA 3L2HA 1MZEA 3AZZA 4ONUA 2NZ9A 2WA3A 2E6VA 4LBJA 1G6NA 5CFDB 2UURA 1QJY1 1LOEA 2PLV1 1EV12 1F5FA 1RUH2 2WNUB 5FPZA 1D2QA 2ZGOA 2JD4A 5I0TA 3AMNA 3R0RA 4AHZA 1ZM1A 3N7JA 1RUE2 5JVVA 4YYOA 2NMNA 1TME3 2D44A 3R05A 4ATEA 1EP0A 4OZXA 4CZSA 2X53S 4AVVA 1FYUA 4RD7A 1RUD2 2CYFA 3SNMA 3WDUA 3AFGA 3NKGA 1AF9A 1PGL1 1S0BA 1CVNA 1FMD1 1GQHA 3QACA 4LR4A 3VZLA 3RG0A 2QDRA 2D3PA 2W39A 2YGMA 4UW6A 1MS1A 1D0HA 4LEJA 1MQTB 1RB8G 4K6BA 4B29A 2XJRA 3H1MA 5FQ0A 4DNYA 3DPRB 4FQZA 1A8MA 1JYCA 1APNA 3APBA 1ZRCA 3I7DA 1QDCA 4NHLA 1VBB3 3I59A 1C57A 1RTVA 5EXOA 3EBRA 1GZWA 3IT8A 1MQTA 1QJU3 1R1A2 5SV5A 2ZX3A 4GKYA 1QOTA 1W6PA 1COV2 4S2HA 5CFDC 4GALA 2WZR1 4BLJA 1AR92 2XJUA 4FPLA 3JD72 1SFNA 3WOGA 2DCZA 2CY6A 4CDUB 3SH5A 2D3SA 1F5JA 5GLUA 5CFCC 4L11A 3WW1A 3RQ0A 4Y1UA 4DB5A 5J3UA 5DG2A 3OGGA 2ZZJA 1FAYA 2ZACA 4B7KA 2VULA 2BWCA 3IWZA 2D6KA 2DV9A 3QH7A 4IXLA 4XFFA 4Y1ZA 2Y38A 4XW3A 4RQPA 1NLSA 5I8TA 1ASJ1 2JG9A 3W58A 3U4XA 1JTZX 3SH3A 1GKBA 4YVSA 2WT1A 2GMEA 3MLLA 5K9YA 3HR9A 1RMU1 2BEOA 4HMZA 2XUMA 1OOPB 3KGLA 2P2KA 1FXZA 4AHXA 1HRI1 3VL9A 4UBHA 2GC2A 1F31A 2ZPXA 4GMP3 2Z5WA 4LLFA 4OHXA 4CEYC 1LU2A 4YZ2A 3KT7A 4BOWA 2XPJA 5L7OC 1TNFA 3MGUA 1FV3A 3USUA 4Y22B 4UW5A 1V6KA 4E2QA 1V9U3 1PVXA 1EV13 3MFAA 3MIDA 4C0BA 4DMIA 1UU5A 4WM8C 1QOSA 1AHSA 2Y26A 4YNIA 4I09A 1HQWA 2YROA 1VALA 4WVVA 2AZ5A 2H6BA 3NW4A 5E8AA 4CDXB 1WW5A 3OJBA 2BPA2 1QKQA 3E6BA 4F8AA 4CEYB 2G4IA 4AFCA 4C91A 1VBD1 3HT2A 1CIWA 3H7YA 3HWJA 3RI9A 4QPGC 4HSLA 3TN91 4Q4X1 4M3CF 1JUIA 2EXHA 2ZMLA 4W6XA 2HJIA 5BNOB 3WR0A 4RQPB 4YGEA 4P9JA 4YM2A 1YJKA 4CDQB 2DU1A 2JENA 5GZFA 4XYXA 4Y1VA 2B45X 4M3CB 3VBHC 4QPIB 4CTEA 1C28A 2VOVA 5JSPA 5D8AB 4KL1A 4XDQA 2XH6A 4Q0UA 4E27A 4LBOA 2IXLA 1HRV3 4V1PA 5EYXA 2ARXA 2Z42A 4YW1A 3ZPYA 4XMIA 5I0SA 2TBVA 1O7FA 4R52A 4LNVA 5JOZA 1V6JA 1PGW1 1GFF2 1H8TB 1O4YA 1LKNA 1L3JA 3SLIA 1IQAA 2Z69A 3NWKA 1GBGA 2AUYA 2JEMA 4LHLA 1WGPA 4BCUA 2ZHMA 1CAVA 4GXLA 3TN92 4RFT0 1C5IA 4NVPA 1FT9A 1SLTA 4AHYA 2K9ZA 4FAGA 4R9CA 1LESA 4Q8LA 5A32A 3H1YA 1HRI3 1LOGA 1CAUA 1HRI2 2WT2A 1LHWA 3JCIA 1X7NA 1REEA 1RVF1 1RUC1 4XHXA 3RSJA 1J1LA 2XG3A 2WFF2 4L2NA 1I9RA 3H7JA 4I0BA 1SMVA 1D4M3 1FX5A 3ZFEA 4ZU4A 1S0DA 3DGTA 1DQ1A 2PHWA 4AQSA 3ST7A 5FBZA 1YRZA 4HBNA 4J6GA 4XFIA 2OZ6A 1R083 1VB4A 2RS11 4BA6A 1AVBA 2B8MA 3ZN6B 1GQGA 2JE7A 2R49A 4INDA 4RHV3 1YI7A 1NY72 2D5HA 1W0PA 3VKFC 4Q2FA 2AH2A 2RHPA 3B9IA 1NZCA 1PO23 1LGCA 1AR63 3DKWA 5DUUA 2VQAA 4JTNA 5EYYA 1LEDA 2ZX1A 4IERA 1VLNA 2A6ZA 4IV3C 1NCQA 2JDZA 1ZREA 4PDWA 3S0MA 2ENRA 4Y4YA 1FPN3 3ILNA 2OIIA 4XJUA 4HPKB 2WINB 2QJVA 2QNKA 4GMP1 4HFSA 5T3NA 1ZBA1 1PM7A 2PYTA 2ILMA 1COV3 1KJRA 4XILA 3M3QA 4RSUA 4URTA 1OKQA 5BYNA 1KDKA 4QPIC 1H8TA 5KC6A 3E6CC 3EXUA 3VDDB 4YGCA 4CDWA 5JPNB 1KITA 5SV8A 1AYN1 4B4RA 1UZZA 4Q4V3 3QOPA 1UIKA 1QQP3 2NMOA 4H7LA 4FBFA 5FFOC 3VKLA 2GNMA 3GF6A 1Y7BA 3WW3A 1BXHA 2VVFA 4RGAA 5C8CA 3VUOA 3RPQA 1MS3A 4N43B 1GLHA 3D82A 4AWDA 3AP5A 2OZJA 1RUNA 3SCFA 4A3XA 3ATGA 3VBSB 1U5ZA 3UKVA 3FMGA 3LOIA 2IZWA 4OI0A 4UW4A 2B5HA 1ALYA 1RINA 5C8CB 2WSUA 2OVUA 5JSRA 4K1YA 1YJLA 5T54A 3RI8A 2YPJA 4QM9A 4K21A 2PLV3 5AFBA 1GSLA 3IN9A 5L19A 1AR81 4A2UA 3RYKA 5ACA1 3KQRA 4YLZA 2XGXA 4AGGA 1N1TA 3FFQA 3HAGA 2DFBA 2MEV3 4QQ2A 3URFA 1K5MC 2ZGNA 5KWRA 4E9KA 2WFF1 3WDYA 1YWKA 3E5XA 4XJ8A 1OPMA 4Q0PA 2XKPA 5LK5A 1TNRA 2QE3A 2PAMA 1PVC1 4RR3C 2O8OA 4Q0VA 2EA7A 4C0HA 4HKWA 2K0GA 3VBUC 2FMDA 4LO7A 3VBRB 2CWMA 4GWMA 1NA1C 1QF3A 5BNPB 5CBLA 2GNBA 4QGMA 5AFEA 4KWKA 2O8QA 4ORFA 3NAPA 1DBNA 3ZMNA 3FC0A 5EWSA 3CLPA 5D1IA 5FLHA 1NY71 2E7QA 3ZSLA 3WNXA 4JGYA 4OULA 1D0GA 4OI4A 2BTVC 2RM22 1AR71 4Y5Z0 3BODA 4IQPA 5J09A 1V6OA 1O5LA 2XLGA 4XBNA 3B9CA 1U5YA 4JVAA 3WDVA 4ITCA 2I07B 1LULA 2HKXA 4QQOA 1RMU3 3M3IA 4M3CE 4S2DA 3M8LA 5BNOC 1N3OA 1V00A 4C90A 5T5OA 1S0GA 2AENA 3S7IA 5F9TA 2UU8A 5GLTA 4XF4A 2RS33 1QJY3 4COVA 1S0EA 4FPYA 1OLRA 2JXAA 3TAYA 2EXIA 1O91A 4RA0A 3WINE 1V6NA 2FZ1A 4P14A 1XRUA 1RUG2 4IESA 1RUG3 3T1LA 5DUWA 1UN1A 3JBG3 1JOJA 3N3HA 1VBC2 4KNCA 2XBO1 3KMHA 3AX4A 3MW2A 3SXWA 4WM8B 3FLRA 4CEYA 1V9U1 2DFCA 1LOAA 2P3JA 2CGNA 3GALA 3OPZA 4ASMB 3MICA 1DZTA 1N1SA 4AXOA 3W59A 4QPYA 2RM21 1LR5A 5GM0A 4DPNA 2DURA 4AEKA 1K5MB 2HWB3 5LRSA 4TLFA 1CR7A 5J48A 4BM8A 2D6LX 3MF9A 4LA2A 2XVGA 1ZBA3 5EJ3A 2CAVA 1I3HA 1LODA 2WNVA 5E1RA 3NV1A 3WP6A 4QQHA 2VNOA 3FUOA 1AZDA 2HWE1 1VAKA 3JQWA 2VMGA 4BZ4A 3JU9A 3THTA 1UKRA 1WW6A 3M3CA 3VZOA 3WD5A 1EAH2 1G9DA 1SLCA 2QZ2A 4IV1A 3AP6A 4YGDA 3B94A 5FLJA 3FUQA 2WL1A 4EN8B 1C8M2 2DVFA 2WNUC 3GNEA 1FNZA 1S0CA 3CEWA 4GIQA 1MS5A 2A71A 3SITA 4FXKB 2PFWA 1HV0A 1GV9A 2VGDA 1XU2A 3A0KA 2IC1A 2ZMKA 4PDWB 4QD2A 4Q0SA 3DUIA 2ES3A 3VKNA 2WLPA 3BU7A 1VJ2A 1N3PA 2A5ZA 4WVZA 4TSVA 1S55A 4DOUA 1BVP1 4ES9A 1Q8OA 1HQLA 5J98B 2RMU1 3D6EA 5I93A 5HXVA 1LENA 4XTPA 3ZO0B 2VNRA 1UPSA 1H30A 1NXMA 3ACLA 4PIXA 2I74A 3J8F2 4UBGA 1ZYBA 4Q27A 5BNQA 2RR11 4AEDC 1KRIA 1PVC3 3AKPA 2UYBA 2FZ2A 4E4ZA 1NA1A 1EPWA 2KA3A 3ZXKA 1POV1 1CN1A 1RC6A 2ZKLA 4D3WA 1EYBA 2ZOEB 2ZGSA 4CRQA 4Z92B 1UCXA 2ZMNA 2MPFA 1YFXA 1EV11 4MSVA 1V6LA 4WM7B 4E2SA 3FX3A 1W6MA 4AF9A 4M0HA 2ETEA 4I3GA 5FAXA 4QM8A 3H8UA 3S6PA 4PF5A 4IEYA 4P9GA 4IETA 4WBBA 4AEJA 2HWC3 1W0OA 1JBCA 5C33A 5GLVA 1SLLA 2PLV2 2CL2A 2Q0AA 2AGSA 2CWSA 4H55A 1G9AA 2LM3A 4HETA 1QXJA 1N3QA 1W6NA 1PGW2 1S0JA 2GH2A 1C5HA 4MXWB 1OMIA 2VVDA 1QJU1 2XLFA 1ULDA 5E16A 4WM8A 4MV2A 4XETA 3T2TA 2HWE2 2PQQA 4QHBA 5GALA 3BOPA 2E7TA 4KU8A 5GLWA 3ZSEA 1GR3A 5LRRA 4Q4V2 1O3RA 2E53A 3THPA 5DZEA 1ZZ7A 5BNPA 1MVEA 1AXZA 1QJX3 1QJX2 4QQPA 4XQDA 5FO7B 1MS8A 3NV4A 3HQXA 3NL1A 3VZNA 3OD0A 3OY8A 1HRV1 5GLZA 4XFCA 3TYJA 3LAGA 3KCYA 3H9AA 3E6DA 2XJTA 3WHUA 3BALA 3DPRA 3AKRA 1DQ0A 4LO8A 1ZRRA 1Q56A 3MIFA 1KFXL 4JQRA 5KHHA 3ZXGA 3CJIB 4EV0A 5JWPA 3AYDA 3VL8A 4CDWB 4CEWC 2PN5A 5J96B 2XJPA 1Q43A 3IDBB 3AJYA 1AR62 4QPGB 3O0VA 2PHFA 4XIKA 2E51A 4EWDA 1RUF2 1DZQA 5CFCB 2A6XA 2RMU3 2D6OX 1ULFA 2MEV2 2WSVA 4XEZA 3MF6A 4DY5A 1HX6A 2HWC2 3FFZA 4YM0A 4Q4X3 5A33B 4DZGA 3KT4A 4LHNA 1CESA 2VQ0A 3VN4A 4Q4V1 2HWE3 3D5OA 2GC3A 4LBKA 4ZU7A 1J3PA 1MACA 1SCSA 3KCCA 1I6XA 1ND2C 4KQ7A 2VNGA 1KJLA 1Z7S2 1YIPA 1XYPA 3TB0A 5DZGA 5JIUA 1BBT2 1T6GC 5BXXA 2BFUS 3SCHA 4BQ1A 1ND3B 4H7MA 3VZMA 1A3KA 2RM23 3L9JT 2A6VA 2CGPA 4B3NA 4QX5A 1UIJA 3AZYA 1NXD1 2OYZA 5C6CA 5CA6A 1AR73 2Q30A 1XNDA 3WG3A 5DUVA 3WP5A 4JDNA 1VBE1 2HEYF 5C4WB 4LO5B 4META 2JG8B 4NN0A 1RUF1 1AX2A 4KG8A 3LSEA 4AEDB 1XYOA 3B00A 1BQPA 3NSTA 3PVEA 4H3WA 1VR3A 3GYDA 2R043 3NO8A 2R042 4U2AA 1HXS1 2D40A 4WM7A 4ZKTB 3K51A 2RJLA 3KB5A 4I0AA 5CG8A 2ZGKA 4YFWA 5EFUA 1RUC3 2BVBA 2Q1MA 3AB0A 4HL0A 1AYN3 1R1ZA 2VOKA 1O3SA 2IXKA 3KZ4C 1O3QA 2ET1A 3KS7A 3ME2A 3V0AB 2BGCA 4I2OA 1Z7S3 3KD4A 4HKLA 3RS6A 1ZZ6A 3LA2A 5FMOL 3IDEA 3RJ2X 4CDUC 4QGNA 3S7EA 2JKBA 4DQAA 1NE6A 1VBD2 1BYHA 5IK8A 4PLNA 3ZXAC 3RZZA 5FDBA 5ACA2 3SMHA 4PIYA 3ZX7A 5KHKA 1DQ6A 1VAVA 1AL23 4D69A 3KCXA 4MVTA 3M3OA 1FI2A 5HCBA 2RS31 5BPXA 1I5ZA 1IOAA 3QLQA 1DYKA 4BHPA 1AR72 3IIAA 1YXWA 4NHMA 2MEV1 1YNAA 5T5PA 1WD4A 1OHFA 4AYUA 1NG0A 1OI6A 2H0VA 3NVCA 3MZHA 1TEIA 2V09A 2OUHA 1Q3EA 4R8HA 1MEC3 1ND2B 1IKQA 1YYNA 1QH7A 5DXDA 2XBO3 3VKMA 4AI3A 1REFA 4Z1VA 2FBEA 1VBB2 1WBFA 1E57A 3AMHA 1REDA 1TE1B 1RUC2 4I0WB 5GJ6A 1WCSA 3JZVA 4DXZA 1ENQA 1HRV2