2ZHMA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
143
structure length
143
Chain Sequence
b'SQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
total genus 37
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhmA00
5HCBA 3UJQA 2ZMNA 3AX4A 2OW4A 3ZXJA 4GXLA 5H9RA 1MS9A 4YW2A 3IPVA 4YGBA 2JE7A 1DFQA 5T52A 3SISA 3B3QE 5GALA 2GNMA 2W52A 4M00A 4NOTA 1QF3A 3A0NA 1N1TA 3POWA 1I1EA 3T2TA 3AJYA 1GKBA 4LBOA 4XJAA 2A7AA 3I8TA 2UWCA 1KDKA 1GZWA 1WLDA 1CONA 3ZXLA 1BXHA 3WG1A 4XYXA 2VH9A 2GNTA 4MYEA 1W6OB 4FPJA 5L73A 4CRQA 2ZZJA 3AYDA 5JOWA 3WHUA 1MR5A 3HN1A 3AYEA 4XZPA 1Q8VA 4R9DA 3WDUA 1YXWA 4YGCA 1IS5A 4F83A 1MACA 3ILNA 1QNWA 4YW1A 1ONAA 1Q8SA 1WD3A 3FLPA 2PHTA 4M3CB 3VUOA 3AZZA 2Q5TA 2ZGMA 3GNEA 1FV3A 1GANA 1LEDA 1IKQA 1MVEA 2UURA 4TZDA 2CYFA 4YM1A 2D6PA 3VKFC 4SLIA 3USUB 2A6WA 3N7LA 4XOGA 5KXCA 4LBJA 1UPSA 3VKNA 2EF6A 1W6NB 3D4KA 5E89A 2YXSA 1H9WA 2WJSA 3JU9A 4YZ1A 1C4RA 2EALA 2YROA 4XIKA 1AZDA 1IOAA 1SCSA 2ZMKA 3INAA 4M3CE 1GZ9A 2DTYA 1CJPA 5CNAA 5EYXA 2ZHMA 4GA9A 1GNZA 4Q1PA 5KXEA 2ZKNA 5GZEA 3WDVA 3MW3A 1V6JA 1AX0A 1DQ0A 5H9PA 3TB0A 1GZCA 3D6EA 4P9XA 3RS6A 2ES3A 3OJBA 3DGTA 4ATEA 1B09A 4XTPA 4K20A 3SH4A 4AGVA 5GM0A 4PCRA 5GZDA 2CWMA 2H0BA 4BOWA 2PHUA 3QLQA 1W6QB 4PBOA 3RMXA 2NM1A 1FYUA 1RIRA 4Y1YA 3AZYA 3MW2A 5GLUA 4YZ2A 5GLVA 1DLLA 1GICA 3WNXA 1N3OA 4AVVA 1FV2A 4XBLA 4HL0A 3AXEA 4RA0A 5GLZA 1BYHA 1DGLA 2BQPA 5LK5A 3OYWB 2DURA 2AUYA 4GWNA 2EIGA 1LHWA 1DHKB 4M3CF 5T55A 3N7MA 4YM0A 2AH2A 3CNAA 1DBNA 3PVOA 2JE9A 2Z42A 3NV2A 4C1WA 2A6YA 3HR9A 4R9BA 5CBLA 1N1SA 2A3XA 2CY6A 2LTNA 5T54A 1W6QA 1LOFC 4YFWA 1WD4A 3IN9A 3WOGA 3RRDA 1MS3A 1G8WA 1AXKA 2DVBA 2GNDA 3RG0A 3UL2A 3WCRA 4CZSA 3ILRA 1VALA 2EAKA 4DQAA 3B01A 4AYUA 1WLCA 2ZGRA 1V6OA 3AYCA 3VKLA 1S0DA 3ZXFA 2R1DA 1HLCA 1LOAA 3WDWA 4YZ3A 3UK9A 1APNA 1AX1A 4FPHA 3Q9OA 1HQLA 4FVVA 3KM5A 1WBLA 1N3PA 5IK8A 3OBRA 3ZSKA 4YW3A 1LHNA 2TEPA 1LGCA 4BLJA 4ZKTB 5DZGA 2JDZA 1QGLA 3N3HA 3OPZA 3VKOA 4YZ5A 5IK7A 1Q56A 1W6PA 2WT2A 1JXNA 1LTEA 1TEIA 5CB7A 2YY1A 3DUIA 1JYIA 1YI7A 2SLIA 2ZGOA 2W39A 5DG2A 3ZXEA 2JJ6A 2R1BA 3WLUA 3AP6A 1FATA 2DV9A 1W6PB 2EXHA 4CTEA 4XIOA 1YIFA 1LECA 1SLBA 1LEMA 2ZACA 4K1ZA 3N35A 1N3QA 1W6OA 3V64A 1SACA 2NN8A 2RHPA 1WW6A 3QCWA 1JYCA 1SBEA 2D6OX 4LBNA 2D44A 2AR6A 5EXOA 3OGGA 1F9KA 2VW2A 3V0AA 2UWAA 3T1MA 3WVJA 2EXIA 4OZXA 4YW5A 1QDOA 4GWMA 5E8AA 3R4SA 1N1YA 4FPCA 5DUUA 2DVDA 1QU0A 1MS1A 4ATFA 4XTMA 2D6LX 2DVFA 2KM2A 2ZHLA 4FP2A 1QMJA 3ILFA 3O0VA 4FOVA 4PF5A 2A71A 4YM3A 3FUQA 4FPLA 4JC1A 1LESA 2WQZC 1DYPA 3A4UA 4XJ9A 1DQ5A 2WNEA 1F31A 3N7KA 1S1AA 4LBQA 4FPOB 1LOGA 1V6MA 3SNMA 2ZGKA 3BTAA 5E88A 1G9CA 3WZ1A 1BKZA 1OFSA 2VU9A 2YV8A 4XJZA 2DVAA 1O4YA 1JW6A 3POYA 2E7TA 1DYKA 1ULFA 3FUOA 2A3WA 4BM8A 1AXYA 4LBKA 1G9FA 1KRIA 4XMIA 3A0KA 4ITCA 2UU8A 5AVAA 2A6ZA 3OYWA 4ISRA 2E6VA 2CL2A 3USUA 1WLWA 2OUJA 5IK4A 1QOSA 1A8DA 1Q8OA 1UX6A 4FPYA 1HDKA 2OVUA 2ZBJA 1LHUA 2WKKA 2ZGTA 1IS6A 1NLSA 2ZGSA 3M3QA 4WVVA 1NXD1 3BIWE 1LOBA 2CTVA 1C1FA 2A75A 4K1YA 3W59A 3ZXKA 2PHWA 3M2MA 5JDBA 1A3KA 1Y7BA 1LJ7A 2XG3A 1WUVA 1LULA 3PMEA 3V0AB 2ZA9A 1O4ZA 1GSLA 1Z0HA 1LU1A 1UN1A 3LSDA 3MW4A 4JRAA 3FLTA 4LBMA 1CIWA 2PELA 2ENRA 4L8QA 5DZFA 1Z78A 4FQ4A 1X50A 4ASMB 2P34A 4Y26A 1GLHA 1URXA 2PHFA 2W08A 2D6NA 3D5OA 5GZFA 1SLAA 5BYNA 5JLVA 1J1TA 1MS4A 2C9AA 4YG0A 2GMEA 1QKQA 3RMYA 1W0OA 3ATGA 4LBQB 4YG6A 5F9TA 1JUIA 3WDYA 1QOOA 5H9QA 2R0FA 5T5OA 4UW4A 3W58A 1UMZA 2JKBA 3O5SA 3OBTA 4GKYA 5FRAA 3AP7A 3ZSMA 1LOEA 1W6MA 1MS8A 2D6MA 4DPNA 1W0PA 2D3SA 4UW6A 3B69A 4AWDA 2ARBA 4FOQA 3ZYRA 1VAVA 1AVBA 2GALA 5T5JA 3R4UA 3BODA 5DZEA 1DQ4A 3MEPA 4Q26A 5CAZA 5EYYA 1G86A 1R1ZA 5JOXA 2ZGUA 3ENRA 2GN3A 1AJKA 1EPWA 1S0IA 4TYSA 3WG4A 1CN1A 1SBDA 3O0WA 5IK5A 1WW4A 1CR7A 1GZWB 2ZGNA 3AZVA 2GMMA 2SBAA 2G4IA 2E51A 4HANA 2EXJA 5IUQA 2P3IA 2ZHKA 4BQ1A 2P37A 3ZYPA 2ZGPA 3OY8B 4FP3A 1SLLA 1UZZA 2ZGLA 4Y1UA 1OKQA 2R16A 3V0BA 5JOZA 1LODA 1KITA 1SLTA 4JCKA 5JMCA 5F5QA 3ZVXA 2ZABA 1G9DA 4Y20B 4RL7A 2JECA 2P2KA 3AYAA 4BMBA 3ZPYA 2DYCA 5T5LA 4C1XA 1SFYA 3LSEA 1A78A 2NP0A 1V6KA 2A3YA 1CVNA 2DUOA 1ENQA 3WCSA 4FPGA 2P3JA 1C1LA 2R0HA 3JUUA 5KXBA 1BQPA 3NV4A 2ZGQA 3C2UA 1MS0A 2V73A 4WZFA 1I3HA 4XBQA 2I2SA 3ZSJA 2AGSA 3SITA 1DQ2A 1S0GA 1HQWA 3AP9A 3BOPA 4XBNA 4Y1XA 4Q8LA 3AP5A 1W6NA 4DRRA 3RSJA 3IPVB 1LHVA 4ZXKA 5GLTA 2GN7A 4GALA 1D2SA 1DZQA 2NZ9A 2R49A 2VUAA 4XJUA 3AFKA 4WV8A 2B7YA 1XQNA 3PVEA 1S0FA 1AX2A 3ASIA 3FBYA 1SLIA 1LGBA 1S0JA 3L2YA 5JVVA 3RQ0A 2YZ4A 5T5PA 4FPKA 3IM0A 4M3CA 1D0HA 1MVQA 2VW0A 4P9YA 1VLNA 3TAYA 1JHNA 1VIWB 1FAYA 1F5FA 4XXPA 1UKGA 5FREA 1WW7A 1YYNA 3KQRA 3PJQA 1LHOA 4Z8BA 5DXDA 4FOYA 5GJ6A 4PQ9A 1IKPA 2CWSA 4YW4A 1CPMA 1DQ1A 1Q8QA 1UAIA 3H0OA 3N7JA 3O0XA 3I4IA 4FPFA 1UL9A 1QDCA 1CPNA 3SH5A 2A6XA 1WW5A 1LOCA 1N47A 4D69A 3M3CA 1ZA4A 2WT1A 4UW3A 3SLIA 1JBCA 2A5ZA 1LOFA 3V0BB 1V6NA 4Y1VA 4FPEA 2XB6C 3M1HA 3POSA 1AXZA 1DQ6A 4YGEA 2EXKA 4H55A 4BMEA 1BZWA 1PZ9A 3FFZA 2P3KA 2VY0A 2WLQA 5H9SA 4FQZA 3WDXA 1LGNA 1ULEA 3VKMA 4XJWA 1LCLA 2YMZA 2VXRA 2ZHNA 3MPPG 5DUXA 3U4XA 3AK0A 2D6KA 4XMAA 3T1LA 4U2AA 2WT0A 2DUQA 4Q27A 1S0CA 3WG3A 5HCAA 3O12A 1MZ5A 3AZXA 3WG2A 1VAMA 3NWKA 3NV3A 1GNHA 4XHBA 4YG3A 1C57A 4BLIA 1FNZA 5JOYA 4YM2A 3M3EA 2E7QA 4DFSA 4KBBA 5GZCA 4R9AA 5DUVA 4DRVA 4YGDA 1N1VA 4DS0A 4XHXA 3SH3A 3WDTA 4YFZA 1GYKA 1FX5A 1MS5A 1KJLA 1SBFA 4AVSA 2AYHA 1Q8PA 2D3PA 2GMPA 1LU2A 4YLZA 2A70A 1PZ8A 3LCPA 1V6IA 4Y20A 2D43A 4PBPA 4XILA 4P14A 1G9AA 4LBQD 4P9WA 1U0AA 4I30A 4M01A 3NV1A 4Q1RA 1QOTA 5EWSA 2DWRA 4Y1ZA 2ARXA 1S0EA 3OY8A 3AP4A 3V65A 3WUCA 1BJQA 1V00A 3R05A 4K21A 1ZM1A 4WVWA 1AJOA 3N36A 1CQ9A 5GZGA 1GV9A 3WV6A 2W68A 5HCFA 3APBA 1RINA 4AVTA 2DU0A 2C5DA 1CESA 2UWBA 3AXDA 1RITA 2V5YA 2ZAAA 1HKDA 5SV8A 4AGRA 1MZ6A 4Y22B 1FNYA 2DTWA 3B9CA 1KDMA 1SCRA 2AREA 5CA6A 1S0BA 3IMNA 2NYYA 1SLCA 2D7FA 1QNYA 5DG1A 1OQ1A 5T50A 1WCSA 1ENRA 4LBLA 4BPZA 1IS4A 2AENA 5GLWA 2JD4A 2GNBA 2VW1A 1AF9A 1GBGA 2A6VA 1KJRA 2WSVA 3AJZA 2PHXA 3UJOA 1G7YA 1KQRA 2HYKA 4UW5A 2DU1A 4XJ8A 3FLRA 4FOWA 4YZ4A 4NO4A 2D3RA 5IT6A 1LENA 3AZWA 3VV1A 1UZYA 1V6LA 2NMOA 1ENSA 2CNAA 2PHRA 4XDQA 2DUPA 1G9BA 3WUDA 5KXDA 1YO8A 2GDFA 1ULGA 3IKWA 2OUHA 4R9CA 2E53A 1YRZA 3M3OA 1IS3A 1DIWA 4Y24A 4Y22A 2NMNA 5DUWA 1WBFA 4Q2FA 4U36A 2FMDA 1JOJA 3B00A 3HMYA 2WSUA 4XE9A 2FHRA 4AGGA 1H9PA 1W6MB 3ZSLA 4IQPA 2LALA 1ULCA 4Q8KA 1H30A 3GALA 4GKXA 4ISQA 1PZ7A 3WHTA 1JN2P 2ZMLA 1ULDA 2ERFA 4W65A 3PVNA 4XXAA 2DVGA
chains in the Genus database with same CATH superfamily
2FCVA 3IWZA 2EIBA 3HWJA 3OEBA 1C8NA 2VCBA 4AAPA 4EROA 5HV4A 3AX4A 4CU6A 4GXLA 4HVOA 5H9RA 3WW1A 4CXWA 1QJX3 4GMP1 5A32B 1ZZCA 2JE7A 3URFA 5M0TA 2VCMA 2UY9A 2W52A 5GALA 4NOTA 1QF3A 4H2AA 3T2TA 4QT6A 1GKBA 3S0MA 2A7AA 3ZLIA 4G4FA 2VVEA 1WLDA 1O8PA 2BV4A 5L9BA 4JTOA 4D7SA 3JB8A 3E6CC 2WZR1 2QQIA 3UKVA 5ABJA 1V70A 3S30A 4MYEA 1W6OB 3HNBM 3FFQA 3U1XA 3ZO0B 5JXJA 5LZ6A 5JOWA 4BK4A 1MR5A 1DLCA 2R062 2R32A 2B8MA 4AHWA 2QQLA 1YXWA 3DL3A 4YGCA 4S2DA 1IS5A 5CG8A 1H6YA 1X36A 5DAWA 3NJVA 1UZWA 3ILNA 3OUHA 3VGIA 1PO21 4YW1A 3SQOA 3VUOA 3GNEA 2UURA 1IKQA 1OA4A 5KC5A 4TZDA 1UY0A 1PVC2 4C8DA 1XNBA 4L99A 3GZTB 1QH7A 2BU9A 3T0AA 1O59A 1UPSA 5E1RA 3J7MA 5FZ7A 3D4KA 4QQPA 3T4VA 3RVHA 1RUC3 2YXSA 2VPVA 2JIGA 4P5HA 4Q4Y3 4EWAA 5KHKA 3H1YA 2EALA 3POBA 5LEJA 4FTBA 1IOAA 5FZ6A 1O3TA 5E6HA 5FXZA 5I8YA 5EYXA 1OQDA 2WNOA 1HRI2 1YUDA 1RUE3 5FZGA 4OCTA 1OQEA 4XPVA 4MGKE 1DQ0A 5FP9A 3TB0A 3ZN5A 4Z92B 4I3PA 2I74A 2PFWA 2XOMA 2OIIA 2FDJA 3OEAA 1W9YA 2HWC3 4P9XA 3WD5A 4ATEA 4QHBA 4XTPA 3SH4A 1K5MC 5FXXA 3J7LA 4PCRA 2HEVF 4Y3OA 3VBOB 4YARA 4Y33A 2PHUA 2XJSA 1W6QB 2XJTA 3QBQA 4GH4C 5DMYA 4GJYA 2GU9A 1RIRA 2Y26A 3AZYA 5GLUA 2B9UA 4OHVA 5JR7B 3ZFFC 3H8XA 2P5BA 4IERA 5FY0A 1VRH3 2J1VA 1DLLA 3PLQA 2K9ZA 1WA6X 3WNXA 4JGYA 2BFUL 4XBLA 4IEPA 4PI2A 3AXEA 1BYHA 3WQ1A 4XAEA 4K6BA 4NPLA 5JSOA 2WQ8A 4DXTA 5FAXA 1W2OA 5A1LA 3I2DA 1ZRDA 5FWJA 1DHKB 1YC61 2WFF3 2YFZA 3IT8A 4Q4W1 3VHRA 2J1UA 4IEYA 4QU1A 3NV2A 3ZIXA 4C1WA 4OHXA 2BGCA 3HR9A 3P6BA 4R9BA 5CBLA 1O5LA 1HJFA 2V09A 4QM8A 2ZX4A 1WD4A 2VMCA 3HVDA 3NJZA 4XDPA 3PNAA 4M0HA 4CZSA 3ILRA 1NQDA 4CDUB 3B01A 4AI8A 4OHYA 4AYUA 4BIFA 4FAHA 1NYWA 5IVJA 5I91A 4DOUA 2PQSA 5D8AA 3AYCA 3BALA 4QPYA 4RN5A 4YZ3A 1MQTB 4NHLA 1PO11 1D2QA 1ND3B 2B42B 2YBSA 3Q9OA 1HQLA 1XSQA 3VHPA 3OBRA 2AACA 2Q8EA 4GD4A 1RMU1 4EZHA 2J1SA 2PLV2 2QQKA 2VJXA 1VBE1 5DZGA 1FOD1 4RS5B 3WF2A 1RXFA 2QQJA 3GCWA 4OUSA 2FDFA 1V0AA 1OMIA 1Q56A 1Q43A 5C5UA 2HWD2 4JQTA 3O1PA 2MEV1 3K48A 3DYMA 3DUIA 1JYIA 5E16A 1YI7A 2QVSB 2W39A 4MGIE 3KHCA 2OZJA 2P4EA 2DV9A 4GIQA 4XIOA 3UYJA 3GCXA 3PDQA 4MGTA 1NCQC 1SLBA 2WWUA 1LEMA 2ZACA 4Q4W2 2QQMA 4QXKA 1W6OA 2UYAA 2ZEWA 3KV5A 4XFGA 3V64A 3VBSA 3LE0A 1WW6A 4MXWA 4XF9A 2ZX3A 4HFSA 2D44A 5FPUA 1RUI3 2BW8A 2VOKA 3DYOA 3V0AA 3T1MA 2Y0OA 4OZXA 2GC3A 4FPCA 5DUUA 1PMJX 2FD8A 2Q8CA 1AYN3 3NO8A 3HEIA 4MADA 1DCSA 2DVFA 2IXCA 2ZHLA 5FIXA 3ILFA 1W3XA 4PF5A 3FUQA 5FZDA 1D4VB 2VZPA 4JC1A 4CP9B 4IE7A 1LESA 2WQZC 4MH0E 1DYPA 4E2GA 1QWRA 4OZOA 3RYPA 1IPKA 1HN0A 3U37A 1AR63 5JPMB 3A4UA 3D82A 3LEMA 4BXFA 4ZY9A 3IMMA 1F31A 3N7KA 1BBT2 2WO2A 3H1MA 4N9HA 3NNLA 2YYOA 5FZ1A 4XF1A 1LOGA 2P1BA 3NMBA 3LDKA 5F5IA 1L7RA 1G9CA 3BTAA 4QXCA 5FZIA 3BYWA 1BKZA 1ZX5A 1Y9MA 3POYA 3K51A 1ULFA 1IGOA 1ND3A 1NCRB 1AUYA 3VD5A 2PAMA 2YUEA 4NIHA 3ZFEA 4AI9A 3OYWA 5AVPA 3SEPA 3TN92 3MUZ1 4ISRA 5EJ3A 2E6VA 4XURA 2E7AA 4XCBA 2WDBA 3USUA 1WLWA 4EE2A 1POV3 2DCYA 2C4XA 1QOSA 1A8DA 1Q8OA 1UX6A 3JBG1 2VC9A 4ZU5A 3U10A 4CEYC 2RG4A 2OVUA 1BLZA 3MLKA 2WKKA 4N9IA 1IS6A 1NLSA 4XUPA 3U78A 4PHZA 4Y5TA 3BIWE 2DDUA 3VD3A 3E5XA 4CP2A 2GH2A 3HN3A 3LQCA 1NE4A 4Z1VA 2OYZA 1Y7BA 3EMRA 4LK6A 2EICA 3C7OA 2PLV3 2C9KA 2HWF3 4LKSA 4QB1A 1JI6A 3PMEA 5FXVA 4IV3C 1UN1A 1GSLA 1IPJA 1LU1A 1NY72 3DECA 4FCAA 4JRAA 4QDSA 1R64A 5L36A 1XOYA 2PELA 2X09A 2BUKA 2WNUA 4ARXA 2PLV1 3UESA 4Y26A 1UQXA 2WO3A 2Y33A 1URXA 1V9U3 1NUKA 2W08A 3ZYIB 3NNMA 4HN1A 3D5OA 1EAH2 1XNTA 5FOJB 3VBFC 4CXYA 4E2QA 1OH4A 2VO5A 4Q4W3 4AQ6A 1YEWA 2VUCA 2HLEA 2WC2A 1PIV3 4I0WB 4LBQB 1M06G 3VBOA 3WDYA 5IVFA 1ZA7A 5KHJA 5H9QA 2R0FA 2Y64A 1OUSA 4GAZA 1G6NA 4Q4V1 2XH6A 2MHFA 5FUIA 3B5LB 4GKYA 5FRAA 1R1A2 5EZWA 3WQ0A 1RVF2 2P3YA 1BHGA 4YVSC 1EV12 4PIXA 5FYCA 4AWDA 2VCCA 3VBUA 1CD3G 3O1UA 1VMJA 3R4UA 3BODA 4EZ4A 2JKXA 4AFMA 1OLMA 5CAZA 5EYYA 1REDA 1JZ5A 3VDAA 2PHDA 4FFHA 5JOXA 1TME1 4OMDA 3ENRA 5A7SA 1EYBA 1S0IA 1YJKA 4TYSA 4Z82A 3WG4A 3HBKA 1CN1A 5C6CA 5FO7B 1WW4A 2GC0A 3ZXDA 1CR7A 4YPJA 2G4IA 2RDRA 3GHMA 1W8FA 1UF2C 1XC6A 2QFEA 4HANA 2EXJA 2ZHKA 2G9GA 3N9PA 4QWNA 4UOJA 4PF1A 3EJKA 1SLLA 4OI4A 1UZZA 2C24A 2ZGLA 1OKQA 2R16A 1X9PA 1YQ2A 1LODA 2Q8OA 4KI5M 4JCKA 3W5MA 2ZABA 3O1SA 3OG2A 1QQP1 4YVSA 1RUF2 1FPN2 2J42A 5LY2A 3MHZA 2JECA 1EAH1 4QMAA 1SFYA 3LSEA 1A78A 1JH5A 1RUJ3 1ZNPA 1L3JA 2DUOA 5FK7A 1GP4A 4COZA 1MZEA 3N9QA 2BEOA 2ZGQA 4PIYA 1R093 4AG4A 3BN6A 5I0TA 1UPIA 2E63A 1I6XA 4ASLA 3WW2A 4WZFA 2V73A 5FZ0A 4B1LA 3LOIA 4RR3B 3SITA 1DQ2A 1S0GA 1HQWA 3FHIB 3IDCB 1W6NA 4A3XA 1LHVA 4ZXKA 4GALA 1AR61 4R8HA 4ZU7A 4CXXA 4XJUA 1I9RA 1R081 4UT5A 2B7YA 3J7NA 1LRHA 1EV11 4NMIA 2AEYA 4RFT0 2ZCWA 2PMWB 1OC1A 4HPKA 5FYUA 2OPKA 2LRPA 4M3CA 5AC91 1MVQA 2VW0A 3AVSA 1HB1A 2WO1A 3C3VA 2QQNA 5CA6A 2YGLA 5CFDA 5F1RA 5JCTA 3IZOA 1CIYA 1HRV3 1ZZ6A 3ACLA 3JQXA 3MIGA 3H3LA 4YW4A 1PIV2 3O0XA 4WM8C 3I4IA 3MIBA 4FPFA 3THDA 3MF9A 5CKQA 1EY2A 4HKLA 3HNMA 1WW5A 1Z7S3 2A6XA 3M3CA 4UW3A 3SLIA 1TME2 1LOFA 1ULOA 4BZ4A 1O7FA 3RJRA 5C3SA 4FPEA 3AKSA 1BEV3 4IV1C 1RVF3 3M1HA 2FDHA 3AMHA 3POSA 1JYNA 2JIJA 2ZPXA 1S2EA 4NIIA 1PZ9A 2HWE3 2ZEZA 4F7ZA 1F15A 1SDDB 2WLQA 5H9SA 5EFUA 1VBD3 3VKMA 4XJWA 1HB3A 1MEC3 5F2WA 2QQVA 5J36A 2XJRA 3MPPG 1UOJA 5DUXA 3AK0A 3I59B 1XB9A 3I97A 4AXOA 1S2KA 1UKRA 1D4M1 3AZXA 3VDDB 1LNSA 1YQ6A 3RZZA 1X33A 2DFBA 3KWVA 1C8M2 3FBMA 5C9AA 2AZ5A 1C57A 3P3PA 4YSFA 5JOYA 4OYUA 3HJRA 3ON7A 3M3EA 2E7QA 4YM2A 4KBBA 3UKNA 1JS9A 1VMFA 4YGDA 1N1VA 1W90A 4DS0A 3UV9A 1FX5A 1MS5A 3CL1A 1QJU2 3WT3A 2D5FA 5K4LA 2JDMA 5IFTA 3A7QA 1NE6A 5SV5A 2XBO2 4FAGA 1ND2B 1K5MA 5BNPC 3ACGA 1U5YA 2GP3A 3PVBB 3VBRB 4LBQD 1XBFA 1COV1 2J22A 3MLLA 4NAOA 1U0AA 4I30A 3NV1A 4Q1RA 1QJZA 2HBUA 4BQ5A 3POJA 4KGQA 2XL9A 3OY8A 4K9SA 3WUCA 3OTFA 3TEZA 3ZFGB 4HSLA 3CLPA 1RHI3 2W68A 2ET7A 2WNVB 1CESA 5JXGA 4Y22B 1BMV1 3BTYA 1OLRA 1S0BA 1HXS2 2NYYA 2D7FA 1QNYA 5DG1A 5FYYA 4LEJA 3T3YA 4AI0A 1AHSA 1RUH3 3MIEA 1H2KA 5FKCA 2RMU1 3HBZA 3GJAA 3WINE 4LQRA 5C3OA 1VJ2A 1AF9A 4IW3A 2A6VA 3AJZA 4HXCA 4QGNA 3GZUC 4PLOA 2ZS6B 1KQRA 4XJ8A 1YQ5A 3J8F2 1DP0A 4OLLA 4YZ4A 5GKAC 4QDRA 2D3RA 4LORA 1H1MA 3AZWA 3KVAA 1S2BA 4Q0PA 2CNAA 5D2AA 1HV0A 2DUPA 1W0NA 4B1MA 1CX4A 3WUDA 3ZFGC 4Q0QA 1EUTA 4COUA 4KG8A 1ULGA 4YYOA 2G9FA 2OUHA 3ZX7A 1GOHA 2E53A 4LHLA 4H14A 1DG6A 2OXBA 4QX0A 4Y22A 2NMNA 3U07A 1TMF1 3MI8A 4XETA 3VBUB 3VD7A 4E4DX 1QEXA 2HWE2 5AC93 4Q2FA 2OKXA 1JOJA 2QDNA 3JBG3 3CKHA 4JGZC 1OOPB 1GWKA 1H9PA 1NZIA 4AEDB 1AR72 5LRSA 4NE9A 1ULCA 4UF0A 2YPDA 4GKXA 1DGWA 1R083 1XSRA 4XFBA 3WF1A 1QJX1 4GMP3 3PURA 2ZMLA 4IE6A 4BHPA 3A22A 4NN0A 4XXAA 1G9DA 3CO2A 3VBHA 2RMU3 4F8AA 3RWNA 3U14A 4NIAA 3KT7A 4N7IA 4B4PA 3JD72 3ZXJA 1HJGA 4KWUA 4ZPIA 1YI9A 3IPVA 4IEXA 4YGBA 1RUC1 4Q4Y1 3B3QE 3VZNA 1I1EA 1RJ8A 2GP5A 4O61A 1RB8G 4TTGA 1RUJ1 2ADDA 5CYYA 1NOVA 1OVSA 1QJU3 3HOBA 1RL3A 4D7YA 1GZWA 5JSPA 1BXHA 4A4AA 3AKPA 1QJY3 4KG0A 1WMFA 2QUOA 4CCMA 5JMOA 3FJSA 4GH4B 1ZRFA 4FPJA 3U0ZA 3HPNA 5J7MA 4NHXA 5IYYA 3AYDA 1ZZBA 2VMEA 3WHUA 1CZVA 4IV1B 5IVEA 1X8EA 2RV9A 1UY2A 3ZKYA 4CEYB 5KWRA 5JIAA 4Y5SA 3OGSA 3RJ2X 1W8TA 4DB5A 5C4WB 1Q8SA 1WD3A 4IGQA 2PHTA 2RS33 4IEZA 4M3CB 4JAAA 3MUY1 2PHLA 2Q5TA 2ZGMA 1NLRA 5EJ1B 1GANA 3OD4A 2ATFA 2ZXQA 4UAPA 5I93A 5A3WA 3VKFC 1U12A 4COYA 4SLIA 4CEWA 4GZ9A 1ACCA 1RUH2 4XOGA 2IVJA 4MO3M 4CUGA 1YQ8A 4P9IA 2VD7A 3VKNA 4CP1A 1W6NB 4CU8A 1DZRA 4CCLA 3H8OA 3IBMA 2TUNA 4OI0A 3O7OA 4RR3A 1XU1A 1QJX2 4COVA 4YZ1A 1C4RA 4GJZA 4XIKA 1GUIA 3WNKA 2W1UA 3DEMA 3ACIA 4M3CE 1GZ9A 1CJPA 4IEOA 5CNAA 3LGRA 4XQ4A 3QH6A 2ZKNA 2TBVA 2HWE1 2UY8A 3JZVA 3B9IA 3PJYA 1GZCA 1PK6C 1OH3A 5FZFA 1OVPA 5A33A 1B09A 5GM0A 2PAEA 2RJ2A 1J3QA 2VL4A 1D0GA 2H0BA 4W6WA 5HXVA 4BOWA 4PBOA 1ALYA 2NM1A 4KNCA 1FYUA 5J1XA 3VBUC 3CDZB 4Y1YA 2XHKA 3MW2A 4Y4YA 5FP7A 4CDQA 1ZVFA 5C3PA 4CU7A 2VE1A 3AMMA 3AC0A 3RFRA 2QQPA 1ULPA 3VBFB 2IC1A 5GLVA 3QACA 2YU1A 1N3OA 2BWAA 1FV2A 3H8UA 4HL0A 4W8JA 3OGRA 5GLZA 1C3HA 1I5PA 2AEZA 2XMLA 2Y60A 4QX3A 5LK5A 2WZ8A 3NSTA 2AUYA 4V2WA 5FLJA 2IWGB 1FOD3 4AQTA 5HV0A 1VBC1 4LJHA 4M3CF 4LT5A 4NWWA 4H7MA 1TMF3 1SFPA 3AMQA 4YM0A 3CNAA 5HXMA 3PVOA 2VZOA 3H8RA 5LA1A 2QE3A 1N1SA 1ZZ9A 2HKXA 5BNOC 3GDBA 3BKZA 2N7GA 4YFWA 1UOFA 4QQOA 2WA4A 2GNDA 1G8WA 4O7XA 3T2PA 1MQTC 3RG0A 3UL2A 5C4WC 1CAWB 1W2NA 2EAKA 2HWC2 4META 1WWYA 1C8M1 2ZX2A 3I2JA 1WLCA 2BGPA 5D1IA 3LEGA 4BU2A 2QTWB 5F39A 1S0DA 3ZXFA 2VMIA 3BOWA 5CG9A 3ZYHA 4QPGB 2OZ6A 4BXSV 5IWFA 1PNFA 2W94A 4DUXA 1VRH2 1XE7A 2ZJCA 3BU7A 1UU6A 3ORJA 1LGCA 4PDWB 1QGLA 4HKWA 1W2AX 3VKOA 3MFCA 2OX0A 1XNDA 4XEZA 5KC6A 1JOBA 1KXGA 5B2GB 1F4HA 1W6PA 2WT2A 1JXNA 4PLNA 4EN8B 1JZ3A 4LNVA 5CB7A 5A3PA 3RZJA 2YY1A 2WFF2 4IL7A 4QX5A 3RZGA 1SFNA 1OBNA 3T09A 2H6CA 1SG3A 1RMU2 5DG2A 4JRLA 4KWJA 4G3YC 3B93A 1VBB1 4M0NA 1SMVA 2EXHA 2K46A 3R0RA 5A7OA 2WZR3 4QXHA 1UWWA 1YIFA 2C1FA 1C5HA 2IXJA 2WNUB 3N35A 5J48A 2NN8A 2Y6GA 4LBNA 2AR6A 2YHJA 2UWAA 4JHTA 3I3DA 1E5RA 2WA3A 3CU7A 4GQ7A 4XQDA 1COV3 2JXAA 1QU0A 2RS52 5I8SA 2XQRA 3FHQA 4FO9A 1VPHA 4FP2A 4XFHA 2C26A 2BBVA 3M8LA 3K3NA 3LDBA 1UOBA 1CAXA 4UYBA 2Y6FA 4RHV2 2VZQA 4QX7A 5FBJA 4GB31 2JB4A 3BPSA 3TEWA 1DQ5A 2WNEA 5DPNA 1SDWA 5CIRA 1FMD3 4FPOB 4JGYC 2ZGKA 5AFBA 5E88A 3WZ1A 2YV8A 2XJQA 4XJZA 3H42B 3ALQA 3NL1A 5A80A 3LWCA 1DYKA 3Q8EA 3QOPA 2A3WA 1POV1 4AAXA 4BK5A 1JOPA 1G9FA 2ZZQA 4UXAA 1KRIA 2DCJA 2XJVA 2ZEXA 5AVAA 2DFCA 3QH7A 1NG0A 4MGYE 4EN0A 1RUNA 4BJ0A 2FDGA 3PUAA 1UYPA 5LBFA 3HIFA 4DY5A 4YNIA 2OUJA 5FJHA 1AL22 4JZRA 5F2SA 5FLIA 4FPYA 4XUNA 3BUCA 3D0JA 4AHXA 1TZOA 2ZGSA 1RUD2 3VBFA 3C7HA 2ZAHA 3RWKX 5JXHA 3J26N 5KHIA 2CTVA 1JU3A 1KGYA 1OD3A 4DIQA 1PGL1 3RYKA 1ZBE2 3M2MA 5JDBA 1ND2C 1MZFA 1PVXA 5DABA 2CAVA 1LJ7A 1YWKA 4TN7A 4D6RA 2G1MA 1WUVA 1ODMA 1RYYA 2XG3A 2QZ2A 5FO8B 5FZBA 5A3TA 3FMGA 5FYIA 1W8HA 4CCDA 1H8TC 4H7LA 1VRH1 3WX5A 2DCTA 2J1TA 5DZFA 1BBT3 1Z78A 4FQ4A 1H2NA 3DKWA 2W1SA 1HQNA 3IDEA 1GLHA 1MQTA 2C0ZA 3NQHA 1SLAA 5BYNA 1UYYA 2PAKA 3I3QA 4KU8A 4XZUG 3TBDA 4CDQB 1UMHA 1B35A 1ZZ8A 5EP9A 1QKQA 1AR93 1W9FA 3GM8A 3RMYA 4JGZA 4A3ZA 4YG6A 2UYBA 4CDUA 5F9TA 1JUIA 1CX1A 2Z69A 5FYSA 4R4ZA 2DBNA 4AEMA 4PI0A 3ACFA 2WABA 4PIZA 5T5OA 4AFAA 4BDVB 4ZZ5A 3KZ4C 3OBTA 4AE2A 3AP7A 1LOEA 1W6MA 2RS53 3PL0A 2RM21 4LOTA 4QAWA 4W4ZA 3WQ7A 3ES4A 2ETEA 2J7MA 5FOBB 1R091 1VAVA 2ZX1A 5T5JA 3BCWA 1Q5OA 1DQ4A 1PO23 3MEPA 5J96B 1G86A 3KGLA 1QXPA 4UBHA 2ZGUA 1OSGA 1BCXA 3MGUA 1R1A1 3W21A 4QM9A 1EPWA 5BPXA 1F2NA 3WXPA 4A7KA 5DQ0A 1GOGA 1SHWB 3DXTA 1SBDA 1XNKA 1W8UA 2BZDA 3GF6A 2F4LA 4QKFA 3V56A 3AZVA 4JGYB 2ZGNA 5JWPA 5IK5A 2BWCA 2JEMA 2SBAA 3EXUA 4IEQA 4TLFA 2VAUA 4INDA 3U75A 3EBRA 2E51A 2RDSA 3DN7A 3OSDA 5DN2A 4XABA 5LBCA 3ZMOA 3MFAA 1EAH3 4QPIB 4XF0A 1D4M2 4Y1UA 5FMBA 1K45A 1JYTA 3NVCA 1YCIA 3C8XA 3K77A 1KITA 3ES1A 2CDPA 1OFNA 4N53A 3P5BA 4Y20B 1STMA 1AL23 4ZU4A 5CADA 4EN9B 4RL7A 4PDWA 4BMBA 3ZPYA 4C1XA 5T5LA 5A7PA 5HPOA 3LFMA 5A7WA 1V6KA 2VVDA 3GXUA 3EO6A 4N43B 4I09A 5CFCA 1A6CA 2R0HA 1W8NA 4WZCA 1BQPA 1WCQA 3NV4A 1UD1A 2MEV2 4S2FA 2BJSA 1CZSA 1OA3A 1QHDA 3VHNA 3PMSA 1W06A 2YGMA 1MS0A 3ELNA 3H9AA 3I3BA 4PT6A 4XBQA 5FY8A 3WF3A 5FZ4A 3ZSJA 3ME2A 1FPN1 5ACA1 2CGOA 1ASJ3 4K8RB 4CCEA 3IPVB 3H1WA 2CSGA 3P1IA 5A3UA 3SKJE 1KS5A 1DZQA 2NZ9A 3NAPA 3WR0A 2MPFA 4CCCA 3USSA 3PVEA 3DYPA 2D5HA 3FBYA 4WVMB 2DCZA 2QQOA 3L2YA 3RQ0A 4DY3A 4URTA 2VM9A 3IIIA 2R042 4LIUA 3IM0A 2A1XA 1D0HA 1VLNA 3LKJA 2R073 1FMD1 4LO8A 4RFRB 1FAYA 1F5FA 1OOPA 2AC1A 4P00B 1YYNA 2V4VA 1PMHX 4Z8BA 1LHOA 3F95A 4HG6B 5KR7A 4AF9A 3VDBA 4I0BA 4PQ9A 2I07B 5LK7B 2CWSA 1UAIA 2VZRA 5FYHA 2X5IA 1QJY1 2CGNA 3I2HA 3KF3A 4EWEA 4D69A 1UXZA 2VZ1A 2A5ZA 2HJIA 3E97A 1RUJ2 1OPOA 4GWJA 4Y1VA 5F3EA 4YWAA 2K0GA 1AXZA 3AKQA 3I2FA 4H55A 3WP6A 2P3KA 4YW7A 2F6BA 5BUVA 2EAAA 3A21A 1RTVA 5FJKA 3I2KA 4E4ZA 1LCLA 3TYJA 2VXRA 2ZHNA 2VZ3A 1Y9QA 4DXZA 3JXSA 4U2AA 2WT0A 4LO7A 1S0CA 4QKNA 3VBRA 1NAEA 5JPNB 3PUQA 1VAMA 1UY4A 2VNOA 2WS93 4GWIA 2O0OA 3J4UH 3ZYGA 4XHBA 1DYOA 3JCIA 1RJ7A 3I7DA 5ANNA 3IAQA 2QNKA 3IB3A 2JE8A 1VB4A 4R9AA 4YFZA 1UNBA 1W9TA 3H7JA 1GYKA 3MPBA 1EUUA 4HT1T 4IV3B 4ASKA 1KJLA 1O91A 1SBFA 2JDYA 4AVSA 4YLZA 1HRV2 1LU2A 1GWMA 1PZ8A 3HQUA 3LCPA 1V6IA 5K7PA 4Y20A 2VTXA 5FY1A 2KXLA 2Y6HA 1VR3A 4GB32 4XILA 4D94A 4P14A 5JIUA 3BTXA 3ZM8A 1VBC3 4B7EA 1NX9A 1W03A 5A3NA 4M01A 1Z7S2 4C90A 1YIPA 2XLGA 2TNFA 1W2UA 4Y1ZA 2RDNA 4N43C 2WINB 2ZOEB 2Z2SB 2WNUC 1ZBA1 3NJYA 1VE0A 4FXGB 4CA9A 3SCGA 1ZREA 1PIV1 1V00A 1FT9A 2MEV3 2RS11 1AJOA 4LA3A 1KD7A 3N36A 5T3NA 2ZEYA 1CQ9A 4MUVA 3POFA 3O14A 1RUH1 5HCFA 5TSWA 4OHWA 2C5DA 3AXDA 1TNFA 5SV8A 2V5YA 4N43A 4CEYA 5CISA 4B3NA 1MZ6A 1W9SA 4LIVA 3B9CA 2YDEA 3M4FA 4FTSA 3IMNA 2FDKA 4NIGA 4A42A 1UYXA 2FCUA 4N53B 2VQAA 5F5AA 3ZSEA 4BPZA 2VULA 2JG8B 1IG0A 1SPPB 3K3OA 2GNBA 5CFDB 2DBIA 5FKBA 3S57A 2Y8KA 1KJRA 2O8QA 2YU2A 4XFCA 2PHXA 4LUKA 4AI2A 2CHHA 2JWPA 3W9AA 3K4AA 2HYKA 4TWTA 5L7OC 3CEWA 4LKEA 4BH9A 1JU4A 3O1OA 5CZKA 1LENA 1OD5A 2XBO3 4HETA 4XF4A 3U4SA 1UZYA 5B4NA 5C8CA 2PHRA 4XDQA 3THCA 4DZGA 3CJIA 3KVBA 4B29A 3IKWA 2ID4A 1JODA 2LUWA 5FPVA 5F3CA 4EJRA 4CDXB 3TEYA 4RQPA 5JXIA 3WNNA 4Y24A 3UGGA 3S5AA 1LAJA 5DUWA 5CU1A 4DEVA 5FPBA 5CVRA 2FMDA 1KFUL 2WSUA 2A73B 4J1WA 1DU3D 4AGGA 4C91A 2RS31 4MXVA 4JDOA 2F17A 1H30A 3GALA 5FQ0A 2WN2A 4OFGA 4ISQA 4HSJA 1PZ7A 2QDRA 1JN2P 1ULDA 4CCNA 2ERFA 3RI8A 3VD9A 5K0UB 1FPN3 2DVGA 5HCBA 3UJQA 2YC0A 2Q4SA 4ORFA 4D8MA 5LATA 2OW4A 1MS9A 1UCXA 3KSCA 5T52A 2BVBA 2WLPA 1IG3A 1BEV1 3NKTA 2GNMA 4K3UA 2WYFA 1CZTA 3HQXA 3POWA 3MIHA 2FDIA 3UNPA 4RS5C 5IW0A 2R061 4LBOA 5DAQA 1BK1A 4XJAA 2FBEA 1KDKA 1HB4A 4XCAA 4Q4V3 1CONA 4FFFA 3ZXLA 2ZX0A 1V9U1 4QGMA 1OOPC 2VH9A 2JDHA 4CRQA 4K7JA 5FPXA 2GC2A 1UIKA 3B02A 1QJFA 2FCTA 2HWD3 4NPMA 3AYEA 4XZPA 1PVC1 3VB9A 1Q8VA 3NNGA 2KR2A 4F83A 1QXJA 5AC92 5FO9B 1VBB2 1QNWA 5C5TA 4NPRA 4UFIA 3FLPA 4ES9A 5FP3A 3AZZA 4I2OA 4XFIA 2W2IA 1FV3A 1LEDA 4NR1A 1EP0A 1MVEA 4JV4A 4E4HA 1AYM2 3WF4A 3T30A 4FFIA 5JZGC 3AVRA 4XUQA 5LRRA 3ZYJB 4NHMA 4K8FA 1W2TA 2A6WA 3N7LA 5KHGA 5KXCA 1J3RA 4N8MA 3AKTA 5EIYB 5E89A 1H2LA 3JU9A 1AYN2 4AOCA 2YROA 1FXZA 1SCSA 3HAGA 4LK7A 2ZMKA 3INAA 4S2HA 2CU5A 2W1QA 2ZHMA 3CZUA 4GA9A 3ZKUA 4Q1PA 5KXEA 2HWB3 3BU0A 2BPA2 1WMEA 5FCCA 3WDVA 1WKYA 2LW8A 3SISA 3MW3A 1V6JA 1AX0A 1AR62 5DDJ2 3D6EA 1OA2A 1POV0 3RS6A 4UFJA 2GH8A 3FL7A 2XJPA 4AGVA 4K20A 2C6SA 5GZDA 2CWMA 1K12A 2ZKLA 2BFUS 3QLQA 4S2GA 4OI1A 3RMXA 4CCKA 5C9AC 2W47A 3CBNA 2VZSA 4AI1A 3RGBA 4D6SA 5G04L 5LBEA 2OS2A 3NKGA 4NWVA 4CDQC 2XVLA 3BI3A 1GICA 4Q4X2 3W5NA 1W8WA 2WYSA 3LA2A 3KB5A 1PNGA 2GSYA 1IPSA 3LAGA 4AK3A 3OYWB 3Q8AA 4Q0UA 4GWNA 2ARCA 1DGRA 2EIGA 1LHWA 3LD8A 2EVXA 5T55A 1TNRA 4QPGA 3N7MA 1O3SA 1PGL2 2AH2A 4E27A 2Q8DA 1DBNA 3J7HA 2JE9A 4AHZA 2Z42A 2XVGA 4AFDA 2X10A 3JB4C 2A6YA 1ST8A 4AEDC 4AW7A 2LTNA 2A3XA 1JYWA 1W6QA 1LOFC 2IXIA 4NJ4A 1NY71 2WUHA 3DCQA 3IN9A 3WOGA 3ZPOA 1J59A 3IIAA 3RRDA 1AXKA 2DVBA 4MV2A 3WCRA 1U5ZA 5C3RA 1VALA 4DQAA 2XWJB 3WW3A 3VD4A 1CAVB 3LA3A 1O5UA 1VBE2 5FYMA 4BIOA 3ZFEB 5LCWL 3UKTA 1RUG1 3VKLA 2VQUA 2R1DA 3CJIC 2HH9A 2W92A 1HX6A 3UK9A 1APNA 1AX1A 4FPHA 4UWDA 3ETPA 3KV9A 4DNYA 1U5IA 4FVVA 1N3PA 3ZSKA 1LHNA 3MV01 2TEPA 3CZJA 2NQYA 3I3EA 4ZKTB 4IXLA 2VOTA 2ADEA 3N3HA 3OPZA 3FN9A 2BNOA 3ECQA 1MEC1 4L9BA 4BE3A 1E57A 5LWBA 1YFWA 2E33A 4ONUA 2JG9B 4EWDA 1LTEA 3ZDSA 2R063 4CPBA 2QJVA 1TMF2 2SLIA 4AL9A 3ZXEA 2JJ6A 2R1BA 2FQPA 1L7LA 3AP6A 4BCUA 1FATA 3KD4A 4IEUA 1AR71 3PUHA 2E9QA 3AMPA 4CTEA 1QJEA 1H1IA 1CJDA 4PDWC 4K1ZA 2XUEA 1OXCA 1N3QA 2WFF1 5FPLA 1PVC3 2RHPA 4MXWB 4Q29A 3VBSB 2D6OX 2RMU2 5J98B 5JAXA 3AFGA 3OGGA 1F9KA 4QPGC 2Y34A 3WVJA 3D3AA 3PTRB 4NHYA 5DDJ1 4GWMA 4WVZA 3TEXA 3R4SA 1N1YA 1RUC2 2J1AA 2DVDA 4Q4Y2 5B4XA 3TNQA 2V72A 2Z5WA 1HB2A 3BB6A 4LE4A 4ATFA 2D6LX 1J58A 2KM2A 3OCPA 4A2UA 1NT0A 3OB8A 3O0VA 3J8F1 2YBPA 1CAVA 2QKDA 2VG9A 4FOVA 3W20A 2BERA 3QD6A 4FPLA 1VBA1 4MOAA 3E5UA 3OPTA 5A3OA 5K0UA 1KEXA 4XJ9A 5ISLA 4QKBA 3UGHA 2PXJA 5FYTA 4LBQA 2VZUA 3D0SA 5C3QA 2RVAA 3SNMA 4A6OA 1GWLA 3JQWA 4AVAA 1OFSA 2CGPA 2J1RA 4H3WA 4BM8A 3PU8A 1RMU3 4LE3A 1IQDC 1F5JA 1WMDA 5JZGA 5F32A 3A0KA 4IV1A 4KGGA 5I0RA 5D8AB 4HVQA 1AR81 4QGLA 2CL2A 2EA7A 4YW6A 2WFPA 4CEWB 4JVAA 5IK4A 2DF7A 1GR3A 3LIHA 2VBDA 1VBE3 1GQHA 1VRBA 2HBTA 1WA4A 5JUVA 1HDKA 2ZGTA 1JMUB 2CV6A 4MGQA 4CCOA 4WVVA 1NXD1 4SBVA 4WM7C 1LOBA 3U11A 4JX0A 3TN91 1QJU1 2A75A 3W59A 3ZXKA 5IAXA 2W0XA 3PUIA 5CFCC 2PHWA 3K4ZA 2VNVA 5FMCA 1ZYBA 3BPZA 4OULA 5FMOL 1DDLA 2KA3A 3A23A 2V5DA 4QX2A 4RSUA 1XE8A 1O4ZA 2W5FA 1Z0HA 1M4WA 2ZA9A 2QCSB 3FLTA 1UX7A 4DUVA 1CIWA 4QPIC 4GMP0 1H1AA 2VQTA 4J25A 4DEQA 1QQP3 1NKGA 1RXGA 1VBA2 2IUWA 2P34A 4MSVA 4ASMB 1RUG3 4P9JA 2WR9A 4BQWA 2FMYA 5C70A 4LKDA 2PHFA 2LROA 2D6NA 4O9EA 4UI9L 1PMIA 1MEC2 4AZZA 3CIHA 4LXLA 2P17A 2W91A 1UIJA 2Z79A 2C9AA 1XNAA 2GMEA 1W0OA 4KL1A 4FT8A 3ZXAC 1ZBA3 3S7EA 1QOOA 2BNNA 4QQ2A 5ABJC 1C8M3 3OUIA 4UW4A 1O6UA 1UMZA 3LZZA 1GP5A 4CP9A 3O5SA 3PTYA 5F6LB 1PK6B 1RUD3 4NHKA 1W0PA 2HWD1 4RGGA 1D7PM 5BNNA 2VXJA 3B69A 3BTZA 1REFA 3DXUA 3ZYRA 2VTFA 3E5QA 1NA1A 4JQRA 1AVBA 2ET1A 3EB7A 4CE8A 1ZBE3 5DZEA 1CWPA 2VMHA 4LHSA 3ROUA 1RUD1 3DKQA 1R1ZA 5CEHA 4OQ8A 4LMFA 1OPMA 4L11A 4EV0A 2GN3A 1AJKA 3K46A 1I5ZA 2RE9A 4XW3A 1UYZA 2B4KA 1GZTA 3E6DA 2VOVA 3AMNA 1BVVA 3WP4A 5BY5A 1RUI2 1K3IA 1RUE1 4Z2WA 5IUQA 3ZFGA 2WZEA 3WNOA 2P37A 3ZN4A 2X5IC 3ZYPA 3OY8B 1L7QA 2D40A 1PO12 5A32A 4Q4X1 5HBAA 4X6QB 3TNPB 1J1LA 4BQXA 5LEKA 3RZLA 2IXHA 5JOZA 4NVPA 1Y3TA 2JICA 3ETQA 5F5QA 4DXSA 5LY1A 2BDRA 2HWB1 4AFBA 1LR5A 1VBD1 4QDQA 2P2KA 2G9ZA 1UO9A 1W99A 3AYAA 2DYCA 3JD71 5FYBA 4AEKA 4CUBA 5ABJB 2NP0A 2A3YA 5LASA 2RR11 4C0BA 2HYXA 3LIGA 3P3NA 5HCHA 1RGSA 1TG7A 2XONA 2VCAA 4I3GA 5A3MA 3J8F3 2AGSA 4DRRA 3AP9A 3BOPA 3ZXGA 3HT2A 2KD7A 4MZUA 4HLTA 3RSJA 3VDDA 1AR83 3N9NA 4HK9A 4PQQA 5GLTA 2BTVC 2GN7A 4R52A 4CVUA 2R49A 2VUAA 3FHAA 3AFKA 3NAPB 4WV8A 3WNPA 1XQNA 4E8DA 1S0FA 1AX2A 5FY9A 1SLIA 1LGBA 3B94A 3MDPA 5FMOS 1QQP2 1DGWX 4QX8A 1E5IA 3KV4A 4DUWA 1RUG2 2NPIA 5EHDA 1QH6A 4P9YA 2R6QA 1X8MA 5FZHA 2J1EA 1BK0A 1XJAA 3DPRC 4XXPA 5C4WA 5FREA 3KT4A 3LB9A 3LPFA 5CFCB 1O4TA 5DXDA 4FOYA 4RD7A 2JG8A 3C7GA 5GJ6A 1D4M3 3E1F1 5A7WB 3T2OA 1IKPA 1CPMA 1X9TA 3H0OA 3ITQA 4QB2A 4E4SA 2R30A 1UL9A 2ORZA 2R041 1QDCA 5ACA2 2Q0AA 3SH5A 4AVCA 3CJIB 3POEA 4UFMA 2O1QA 1J3PA 1N47A 1ZA4A 2PYTA 2WT1A 3LDRA 1WCDJ 4R4XA 5C8CB 2X8KA 4XAAA 3V0BB 4QKDA 1V6NA 1U5XA 3RDIA 2WRAA 5FFOC 1YHFA 5A70A 1US3A 1POQA 2EXKA 2RJLA 3SCFA 2VY0A 1TQ5A 2XBO1 4B4RA 1V9U2 4FQZA 1NCRC 1HRI1 3KT1A 1QIQA 1QJY2 3EQEA 1RUE2 2YMZA 4DO0A 3U4XA 1ASJ2 1OHFA 2D6KA 3IAPA 3T1LA 4QB6A 3WG3A 4Q27A 2YC4A 4YVWA 3DPRA 1ODNA 5HCAA 3O12A 1MZ5A 1W3VA 2VUDA 3I54A 3WG2A 3WP3A 4CCJA 5FTTC 3VZLA 3H50A 3NRUA 2P6HA 3VHOA 3WF0A 4GH4A 2X53S 4UF0B 5L7OA 4BLIA 1FNZA 4LPLA 4DFSA 2WQ4A 2YFUA 4BQ3A 1W04A 3ZFFA 5DUVA 3NAPC 3SH3A 3HD8B 1WMXA 3M7AA 3RZKA 1GQPA 1YFYA 1JYVA 3GHNA 1EV13 2GMPA 2D3PA 2AYHA 1Y4WA 3GYDA 2ILMA 2VMGA 1UW8A 5F6KA 2W87A 4IETA 4OVEA 1JYXA 2VOWA 4AQ2A 4LLOA 4MHRA 4W6YA 3X29B 5A1FA 1WLTA 5EWSA 5BXXA 1JZ8A 1IQAA 2DWRA 2HEWF 1NQJA 2ARXA 3ABZA 1HXS1 3KF5A 4X8NA 1GQGA 4WVWA 4K21A 4IEWA 1ZM1A 4AVBA 1XYOA 5BNPB 5GZGA 4D7TA 1GV9A 1H6XA 4IV3A 4LITA 4KWLA 4LO6B 3NNJA 4LHKA 3S5QA 5C8CC 2BRTA 3APBA 1RINA 3GBGA 3CHXA 4AVTA 2UWBA 4AGRA 1HKDA 3NJXA 5C7GA 1F8VA 1FNYA 1KDMA 1SCRA 4LTAA 3AKRA 2X5IB 5EJZB 4HN0A 3RNSA 2JB8A 1OQ1A 1HW5A 5T50A 2D98A 1ENRA 3AM2A 4N90A 4V1PA 5BNOB 1GNYA 4XF3A 3AB0A 1RUF3 4TLGA 1PGW2 2WS92 3VDDC 3IDAA 1B35C 1XXNA 2VW1A 2XR4A 5APAA 3WQBA 2X29A 3LA7A 1GBGA 5IJRA 5L9VA 3UJOA 2H6BA 5BNPA 2ARAA 2JDUA 2YBKA 3H7YA 4UW5A 3FLRA 3SKVA 3RZMA 1TE1B 4NO4A 4QQHA 5IT6A 2IXLA 4ZXEA 3T2QA 1UMIA 2NMOA 1ENSA 4GB33 5EQUA 3S7IA 3MZHA 5ERLA 3DF0A 3MBWA 4O9GA 1VBC2 4TSVA 5FLHA 2JENA 1YO8A 4D6QA 4BQ2A 2GDFA 3N9MA 5FQ0B 3M3OA 3T0BA 1XRUA 3FC0A 3BVCA 4XUTA 3KLSA 4M4PA 1RC6A 1NA1B 1RUOA 1LB2A 3D8CA 2BGOA 4U36A 4AR2A 3VBRC 4XE9A 2FHRA 3WW4A 4LULA 2WAAA 3ZSLA 4IQPA 4LLFA 3ST7A 4Q8KA 2PTMA 3ZN6A 4CPBD 2W9XA 1KS4A 4FSJA 3SMHA 3WHTA 2RS12 1UOGA 2QZ3A 3PVNA 4A7ZA 2FZ1A 1RUF1 2XL7A 4WM8A 5G05L 1VAKA 2ZMNA 3K2OA 4HBNA 4YW2A 5A6ZA 1DFQA 4IEVA 1HN1A 3NW4A 2VNGA 1AR91 3R6SA 4M00A 2RM23 3A0NA 1N1TA 1E5HA 2WN3A 3AJYA 3I8TA 4RR3C 2UWCA 1HRI3 4BQYA 4E2SA 4LO5B 1NXMA 3ZYBA 3PU3A 3ZFFB 3WG1A 4XYXA 3OF1A 5FR3A 2IZWA 3WNMA 4XACA 3MIFA 5C9AB 5C33A 2GNTA 1H4HA 5L73A 3SEEA 1JZ7A 2ZZJA 4WM7B 4P9GA 3VBOC 4A6SA 3VZJA 4AI3A 3HN1A 2FZ2A 2K2SA 4R9DA 3WDUA 2R043 5IAVA 3I59A 4F3JA 5IFPA 1XU2A 2IFRA 1MACA 1W9WA 3SCHA 1PX3A 2R072 4KMQA 2V4AA 4XFAA 1ONAA 3LPGA 4HZFA 3ZR5A 5FWEA 2G19A 5L19A 4B7KA 5D8AC 3BGAA 3ZYFA 3FX3A 2CYFA 4M4RA 4YM1A 1H8VA 2D6PA 5DAPA 1JZ4A 3O1TA 1X82A 3USUB 4EN7B 1AL21 2QQUA 1F35A 4LBJA 3OBAA 3WEZA 4D3WA 2EF6A 1COV2 2F4PA 3KCYA 4ES8A 3CF6E 3OD0A 1YLLA 2E26A 1H9WA 2WJSA 4KU7A 4L2NA 4BWOA 5JZGB 1AZDA 1XPWA 2XGXA 4N53C 1QY4A 3CMGA 3TWIA 2DTYA 2WS91 4ZHNA 1GNZA 3RI9A 2PQQA 5LB6A 4RHV3 1GU3A 5GZEA 1OF3A 5C8WA 5LA0A 5H9PA 2HEYF 4IE5A 5FUNA 2E32A 4AFCA 1PX4A 4X6RB 1P8JA 2VZTA 2ES3A 1SQ4A 2W46A 3OJBA 3DGTA 4JTNA 4NRPA 2VZVA 4AQSA 4OMCA 5EPAA 5FZ3A 4JGZB 2DCKA 4QD2A 4Q5OA 1X7NA 2B45X 3KS7A 1BVP1 1XYNA 3AL6A 2XLAA 2W95A 1NA1C 2XDVA 2YC2A 2HWF1 4KBZA 5J3UA 3VBSC 4LOSA 5IVVA 4DXRA 1NZCA 2JG9A 2XLFA 1Y9GA 4YZ2A 4XQWA 2VR4A 1A8MA 3FWEA 4AVVA 3T08A 4RA0A 2Q1ZB 2RS13 2XKOA 1AYM3 1YFUA 4HK8A 4CUCA 1DGLA 1US2A 2BQPA 4HOOA 5FXWA 3GBFA 3HT1A 2DURA 1OF4A 1Y43B 4JKLA 4QHOA 4QQLA 5IVCA 3VZOA 4QX1A 5BV6A 2W3JA 1IZ3A 3KHBA 2ORXA 1YFXA 1AYM1 1GFF2 2RM22 4FTEA 1W8OA 1J84A 3ZR6A 4JKKA 2Y6JA 2XKPA 2P6CA 1PK6A 3EYPA 5T54A 2CY6A 4CYDA 1MPXA 3VZKA 2LS6A 4DMIA 3VZMA 2VBPA 4CUAA 1H8TA 1BMV2 1MS3A 1AL0G 2WL1A 5FV3A 3ACHA 4HMZA 5HI0A 3C7FA 4IE0A 2ZGRA 3GJBA 3KMHA 4OI2A 1V6OA 5FZOA 4N7UA 3T0DA 4BA6A 5FZLA 1A34A 4HKOA 3K75B 3GGLA 1HLCA 1LOAA 4OHZA 2WWJA 3OGJA 1C5IA 3WDWA 3ZDVA 4URAA 4QPWA 3KM5A 1WBLA 2HWC1 3WSOA 5IK8A 4NRQA 1OT5A 3POIA 4YW3A 1NCQB 1OI6A 3KCCA 4BLJA 4V2VA 2JDZA 4YZ5A 1JTZX 2RR13 5FZKA 5IK7A 4ZS2A 1FI2A 3SXWA 4AHYA 3VL9A 3VDCA 1TEIA 1CAXB 3NNFA 3ZIWA 4QPIA 1SEFA 4ET7A 4Z2AA 1R092 2ZGOA 3THPA 1VMHA 3MLJA 3POGA 3KV6A 3WLUA 1PO22 1W6PB 2RS32 5D21A 5LW9A 3TN93 1K42A 2WAOA 4Q0SA 1LECA 2XWBB 3KQ4B 5A7NA 4XDOA 3I3MA 5F5CA 3KGZA 1SACA 4A7YA 3QCWA 3G6JB 1JYCA 1SBEA 2YG0A 2VUJA 3GZAA 4JDMA 3IDBB 1T2XA 5EXOA 1ENXA 2B9VA 4NRMA 2D97A 2VW2A 2XUMA 4Y4RA 3WY6A 2EXIA 1NCRA 4YW5A 1QDOA 1C28A 5E8AA 3OGVA 3LEIA 1MS1A 5F3GA 1JHJA 4XTMA 5C71A 1QMJA 4FXKB 3MICA 2A71A 4WBBA 1Q3EA 4IDZA 4JKMA 4YM3A 4G9SB 4LKFA 3BIEA 4J6GA 2HWF2 5FMDA 4XVHA 3WP5A 1ZRCA 1WCKA 4L92A 4WM8B 4BB3A 2JG9C 3WNLA 2Y6KA 1ZRRA 4IGPA 1S1AA 2QBXA 4QHZA 2BP6A 1H0BA 5FZEA 3ZN6B 2Y0IA 1B35B 1V6MA 2OQ6A 2XHNA 1UY3A 4EYUA 2E31A 2VU9A 5LA2A 4BYYA 2DVAA 1VBB3 3CQOA 4BQ4A 1O4YA 1GOFA 1JW6A 2E7TA 4RHV1 3FUOA 5FY4A 2O8OA 1AXYA 4LBKA 5I0SA 5IVBA 5J09A 3O1VA 1VBD2 4XMIA 3G7DA 2JDKA 2RS51 5F3IA 1PHMA 1W05A 4ITCA 4UFHA 2UU8A 4IE4A 3RYRA 2A6ZA 4XFFA 3SC7X 2WNVC 4DINB 1HIXA 1XNCA 5CKMA 2JDAA 4ZZ8A 3J9SA 4L0PA 2XVKA 3I2OA 1ZBE1 1QXRA 1RUI1 4HONA 5I0UA 3T4HB 3VN4A 5FK8A 4OQ9A 4OUMA 4CDUC 1T6GC 1GMMA 3HNYM 2GZWA 5FPAA 5I8TA 1R1A3 2L9LA 1FOD2 1LHUA 2ZBJA 3M3QA 4HVRA 4IUGA 3UGFA 3M3IA 1AYN1 2VGDA 4W6XA 1C1FA 4K1YA 3PIJA 2JX9A 3Q8BA 4KQ7A 1A3KA 2HWB2 5FUPA 2VOXA 2OT7A 2YPJA 3F2ZA 5AFEA 1LULA 3V0AB 5A33B 4RS5A 3I2GA 3LSDA 2RR12 3MW4A 4LBMA 3TRSB 1Z7S1 3L2HA 2ENRA 4L8QA 5FZ9A 1VB2A 5FZMA 1DF0A 1X50A 2VMFA 4FFGA 3C7EA 5J37A 1E5SA 3OPWA 5LBBA 4QU2A 1TVGA 5DAXA 2EIDA 5F7UA 2OA2A 2BNMA 2EIEA 4I02A 5GZFA 3ZMNA 5JLVA 1J1TA 1RHI2 1MS4A 3LEKA 4NIDA 4YG0A 2WIIB 4GULA 4AEJA 3ATGA 4LO4B 1HXS3 1ND3C 1ZRIA 4MGZE 5FY7A 1JUHA 4ARYA 4UFKA 3UETA 1K5MB 4K40A 3W58A 2JKBA 1ZZ7A 4X8PA 3ZFEC 4CDXC 1OLQA 1XE0A 3THTA 2W1WA 3ZSMA 5A6YA 5IHRA 5JI7A 1MS8A 2D6MA 4DPNA 2D3SA 3OUJA 2BYVE 4UW6A 5EV7A 2CDOA 5A6QA 4J1XA 2ARBA 4FOQA 4IESA 2VVFA 5JR2A 2PA7A 1XYPA 4D0QA 2GALA 4CDXA 4I01A 3HQRA 4Q26A 2Z4FA 2OPWA 2WZR2 1EPZA 3DPRB 5A7QA 4PJYA 3O0WA 1GZWB 2D93A 2GMMA 3N9OA 2JG8C 4Z07A 5F37A 5IATA 4KH9A 3LFIA 4W50A 4BQ1A 2P3IA 1YQCA 1ASJ1 1OUXA 3JBG2 2ZGPA 4FP3A 2VECA 1O3QA 1AR73 3Q8CA 3V0BA 3FZ3A 3PHMA 1R082 1S55A 1SLTA 5KHHA 4IGOA 4LUMA 5JMCA 4EN6B 3ZVXA 1PGW1 4CDWC 4WM7A 1YJLA 1NCQA 1UXXX 2BOIA 1TME3 4KWKA 4ZS3A 1CVNA 1FMD2 1ENQA 2RDQA 1BEV2 2VMDA 4FPGA 2P3JA 4LA2A 1C1LA 3JUUA 3WCSA 5KXBA 3LOBA 3I49A 2H0VA 3C2UA 2XXZA 1I3HA 2I2SA 3KCXA 4B8EA 4XBNA 1H2MA 4O65A 4Y1XA 4Q8LA 3AP5A 5FZOB 2B39A 3AL5A 5FPZA 4LR4A 1D2SA 1WZXA 1JZ6A 1CAWA 3E6BA 2JDNA 3VBHB 1K5JA 3GBWA 4MVTA 1W8ZA 5I0DA 1JZ2A 3ASIA 3K4DA 4COWA 4E8CA 1H8TB 1S0JA 1WGPA 3R4DB 5JVVA 2YZ4A 1UZVA 5T5PA 1PM7A 3PUSA 5A1AA 5KBFA 1H4GA 4Y5Z0 4E9KA 4FPKA 2GC1A 5JI9A 5FBZA 3TAYA 4P02B 5FZAA 5CFDC 1JHNA 1VIWB 1UKGA 2RJKA 1WW7A 3PJQA 1YNAA 3KQRA 4FBFA 2XPJA 2BVVA 3DV8A 4A41A 2JDPA 5FP8A 1DQ1A 1Q8QA 1W39A 3N7JA 4YRDA 4MGSA 1GP6A 5BNOA 4C0HA 4YVSB 1CPNA 1RHI1 3H3ZA 1LOCA 1OURA 2Y38A 1OLME 5FZCA 2WO7A 5JSRA 1JBCA 2WNVA 2GAUA 4NAMA 2I45A 2BBAA 5FY5A 2XB6C 4YGEA 4BMEA 1DQ6A 1BZWA 3FFZA 5IVYA 1UY1A 4Q4V2 3WDXA 1UU4A 1LGNA 1ULEA 4UFLA 4XUOA 2WZPP 5K8SA 2IFWA 2PN5A 4XMAA 1RVF1 1AR82 5CKNA 1KFXL 2DUQA 4I0AA 4MLOA 2X05A 1AR92 1LKNA 4YVWC 2VNRA 3MIDA 3NWKA 2VQ0A 3NV3A 1GNHA 4L97A 1O3RA 1S4CA 4MG2A 2Y6LA 4YG3A 4P08A 2R071 4RYDA 1CAUB 3M70A 2QQWA 3VL8A 5GZCA 5BNNB 3VBHC 4DRVA 3PIGA 4XHXA 5K0UC 3WDTA 1PGSA 3Q8FA 5BNQA 1NLQA 1Q8PA 1F4AA 4FI9A 2R7EB 2A70A 2B46X 5FDBA 3S6PA 2D43A 3UT0A 4PBPA 4WVMA 2IXKA 4B4QA 4EQVA 1G9AA 5ACA3 4Q0VA 4P9WA 1REEA 2Q30A 2ZTNA 3N4MA 4CSWA 1QOTA 1S0EA 2WWSA 4A45A 3AP4A 1ND2A 4P9LA 3MV11 1VBA3 2XQXA 1BJQA 3R05A 4P5YA 4XC9A 3V65A 2Q1MA 4CDWA 4RGAA 1J83A 2B5HA 4CEWC 3EHKA 3WV6A 5FYVA 3L9JT 4ZONA 5FP4A 4CU9A 2CAUA 2Q1FA 2DU0A 1SPPA 1RITA 2ZAAA 3RPQA 2YB7A 5DDJ3 5L7OB 3N9LA 3MF6A 2DTWA 2XJUA 2AREA 3MO4A 4RQPB 1HRV1 1ZBA2 1SLCA 3MYXA 2VTXJ 1UU5A 1WCSA 3RZHA 2WBKA 3I2IA 2OQ7A 2O14A 2VBBA 4LBLA 3JD73 1HV1A 4QXBA 4YVWB 1IS4A 2AENA 3B7MA 5GLWA 2JD4A 3TOJA 4TXWA 3O1RA 2IVIB 1IHMA 3VLBB 5F8PA 2WSVA 2BOJA 3FE5A 5LA9A 4Q4X3 2JD9A 5ANQA 1G7YA 4RQPC 2LM3A 4PLMA 2DU1A 4HPKB 1W28A 4FOWA 4LHNA 1CGPA 4UBGA 5DAVA 3CJXA 4CP0A 3LF7A 3VV1A 1V6LA 2MNGA 3OOXA 1O8SA 3ZOIA 1PM4A 5L9RA 5FZ8A 1G9BA 4BISA 5KXDA 1BBT1 4R9CA 5FYZA 1YRZA 1IS3A 1DIWA 3OBZA 3H3UA 1OKOA 4JHZA 4A44A 4AEDA 1WBFA 5K9YA 4MX3A 3HMYA 3B00A 4NROA 1DZTA 1UZ0A 1PO13 1CAUA 1W6MB 5A3LA 5A6XA 4RGKA 2LALA 3GZEA 4CDWB 1WCUA 4OUEA 1T6BX 3SHRA 3O1MA 4NUBA 1SZBA 4W65A 1VP6A 2NLRA 1DGRN 4MHUA 5BNNC 4JDNA
chains in the Genus database with same CATH topology
3IWZA 3HWJA 1C8NA 4EROA 3AX4A 4GXLA 4HVOA 5H9RA 3WW1A 1QJX3 4GMP1 5A32B 1ZZCA 2JE7A 3URFA 5GALA 2UY9A 2W52A 4NOTA 1QF3A 3T2TA 4QT6A 1GKBA 3S0MA 2A7AA 4G4FA 2VVEA 1WLDA 4JTOA 4D7SA 3JB8A 3E6CC 2WZR1 3UKVA 5ABJA 1V70A 3S30A 4MYEA 1W6OB 3ZO0B 3FFQA 5JOWA 1MR5A 2R062 2R32A 2B8MA 4AHWA 1YXWA 3DL3A 4YGCA 4S2DA 1IS5A 5CG8A 1X36A 3ILNA 3VGIA 1PO21 4YW1A 3VUOA 3GNEA 2UURA 1IKQA 1OA4A 5KC5A 4TZDA 1PVC2 1XNBA 4L99A 3GZTB 1QH7A 1UPSA 5E1RA 3D4KA 4QQPA 1RUC3 2YXSA 2VPVA 4P5HA 4Q4Y3 4EWAA 5KHKA 3H1YA 2EALA 5LEJA 4FTBA 1IOAA 1O3TA 5I8YA 5EYXA 1OQDA 1HRI2 1YUDA 1RUE3 1OQEA 4XPVA 4MGKE 1DQ0A 3TB0A 3ZN5A 4Z92B 4I3PA 2I74A 2PFWA 4P9XA 2OIIA 3WD5A 2HWC3 4ATEA 4QHBA 4XTPA 3SH4A 1K5MC 4YARA 4PCRA 2HEVF 3VBOB 2PHUA 2XJSA 1W6QB 2XJTA 3QBQA 4GH4C 2GU9A 1RIRA 2Y26A 3AZYA 5GLUA 2B9UA 4OHVA 5JR7B 3ZFFC 4IERA 1VRH3 3PLQA 1DLLA 2K9ZA 3WNXA 4JGYA 2BFUL 4XBLA 4IEPA 3AXEA 1BYHA 3WQ1A 4K6BA 5JSOA 5FAXA 1ZRDA 3I2DA 1DHKB 2WFF3 3IT8A 4Q4W1 3VHRA 4IEYA 3NV2A 3ZIXA 4C1WA 4OHXA 2BGCA 3HR9A 4R9BA 5CBLA 1O5LA 2V09A 4QM8A 2ZX4A 1WD4A 3NJZA 3PNAA 4M0HA 4CZSA 3ILRA 1NQDA 4CDUB 3B01A 4AI8A 4OHYA 4AYUA 4BIFA 4FAHA 1NYWA 5I91A 4DOUA 5D8AA 3AYCA 3BALA 4QPYA 4YZ3A 1MQTB 4NHLA 1PO11 1D2QA 1ND3B 2B42B 3Q9OA 1HQLA 3VHPA 3OBRA 1RMU1 2PLV2 1VBE1 5DZGA 1FOD1 4RS5B 4OUSA 1OMIA 1Q56A 1Q43A 2HWD2 2MEV1 3K48A 3DUIA 1JYIA 5E16A 1YI7A 2QVSB 2W39A 4MGIE 2OZJA 2DV9A 4GIQA 4XIOA 1NCQC 1SLBA 4Q4W2 1LEMA 2ZACA 4QXKA 1W6OA 2UYAA 4XFGA 3V64A 3VBSA 1WW6A 4MXWA 4XF9A 2ZX3A 4HFSA 2D44A 1RUI3 2BW8A 2VOKA 3V0AA 3T1MA 2Y0OA 4OZXA 2GC3A 4FPCA 5DUUA 1AYN3 3NO8A 2DVFA 2IXCA 2ZHLA 3ILFA 4PF5A 3FUQA 1D4VB 4JC1A 1LESA 2WQZC 4MH0E 1DYPA 1QWRA 3RYPA 1IPKA 1AR63 5JPMB 3A4UA 3D82A 1F31A 3N7KA 1BBT2 4N9HA 3H1MA 2YYOA 4XF1A 1LOGA 1G9CA 3BTAA 1BKZA 1ZX5A 3POYA 3K51A 1ULFA 1IGOA 1ND3A 1NCRB 1AUYA 2PAMA 2YUEA 3ZFEA 3OYWA 5AVPA 3TN92 4ISRA 5EJ3A 2E6VA 2E7AA 3USUA 1WLWA 1POV3 2DCYA 1QOSA 1A8DA 1Q8OA 1UX6A 3JBG1 4ZU5A 3U10A 4CEYC 4EWDA 3MLKA 2OVUA 2WKKA 4N9IA 1IS6A 1NLSA 3BIWE 3E5XA 4CP2A 2GH2A 1NE4A 4Z1VA 2OYZA 1Y7BA 2PLV3 2HWF3 3PMEA 4IV3C 1UN1A 1GSLA 1IPJA 1LU1A 1NY72 4FCAA 4JRAA 5L36A 2PELA 2BUKA 2WNUA 2PLV1 4Y26A 1URXA 1V9U3 2W08A 3ZYIB 4HN1A 3D5OA 1EAH2 5FOJB 3VBFC 4E2QA 4Q4W3 4AQ6A 1M06G 2WC2A 1PIV3 4I0WB 4LBQB 3VBOA 3WDYA 5KHJA 5H9QA 2R0FA 1G6NA 4Q4V1 2XH6A 2MHFA 3B5LB 4GKYA 5FRAA 1R1A2 5EZWA 3WQ0A 1RVF2 4YVSC 1EV12 4PIXA 4AWDA 3VBUA 1CD3G 3R4UA 3BODA 4AFMA 5CAZA 5EYYA 1REDA 2PHDA 5JOXA 1TME1 3ENRA 1EYBA 1S0IA 1YJKA 4TYSA 4Z82A 3WG4A 1CN1A 5C6CA 5FO7B 1WW4A 2GC0A 3ZXDA 1CR7A 2G4IA 3GHMA 1UF2C 4HANA 2QFEA 2EXJA 2ZHKA 2G9GA 3EJKA 1SLLA 4OI4A 1UZZA 2ZGLA 1OKQA 2R16A 1LODA 2Q8OA 4JCKA 2ZABA 1QQP1 4YVSA 1RUF2 1FPN2 1EAH1 2JECA 4QMAA 1SFYA 3LSEA 1A78A 1JH5A 1RUJ3 1ZNPA 1L3JA 2DUOA 4COZA 1MZEA 2BEOA 2ZGQA 4PIYA 1R093 4AG4A 5I0TA 1UPIA 2E63A 1I6XA 4ASLA 3WW2A 4WZFA 2V73A 3LOIA 4RR3B 3SITA 1DQ2A 1S0GA 1HQWA 3FHIB 3IDCB 1W6NA 4A3XA 1LHVA 4ZXKA 4GALA 1AR61 4R8HA 4ZU7A 4XJUA 1I9RA 1R081 2B7YA 1LRHA 1EV11 4RFT0 2ZCWA 4HPKA 2OPKA 4M3CA 5AC91 1MVQA 2VW0A 3C3VA 5CA6A 2YGLA 5CFDA 5F1RA 5JCTA 3ACLA 1HRV3 1ZZ6A 3JQXA 3MIGA 4YW4A 1PIV2 3O0XA 4WM8C 3I4IA 3MIBA 4FPFA 3MF9A 1EY2A 4HKLA 1WW5A 1Z7S3 2A6XA 3M3CA 4UW3A 3SLIA 1TME2 1LOFA 4BZ4A 1O7FA 3RJRA 4FPEA 3AKSA 1BEV3 4IV1C 1RVF3 3M1HA 3AMHA 3POSA 2ZPXA 4F7ZA 1PZ9A 2HWE3 2WLQA 5H9SA 5EFUA 1VBD3 3VKMA 4XJWA 1MEC3 5J36A 2XJRA 3MPPG 5DUXA 3AK0A 3I59B 4AXOA 1S2KA 1UKRA 1D4M1 3AZXA 3VDDB 3RZZA 1X33A 2DFBA 1C8M2 3FBMA 5C9AA 2AZ5A 1C57A 3P3PA 4YSFA 5JOYA 4YM2A 3M3EA 2E7QA 4KBBA 3UKNA 4YGDA 1N1VA 4DS0A 3UV9A 1FX5A 1MS5A 3CL1A 1QJU2 3WT3A 2D5FA 5SV5A 1NE6A 2XBO2 4FAGA 1ND2B 1K5MA 5BNPC 1U5YA 3PVBB 3VBRB 4LBQD 3MLLA 1COV1 1U0AA 4I30A 3NV1A 4Q1RA 1QJZA 4KGQA 4K9SA 3OY8A 3WUCA 3OTFA 3ZFGB 4HSLA 3CLPA 1RHI3 2W68A 2ET7A 2WNVB 1CESA 4Y22B 1BMV1 1OLRA 1S0BA 1HXS2 2NYYA 2D7FA 1QNYA 5DG1A 4LEJA 4AI0A 1AHSA 1RUH3 3MIEA 1H2KA 2RMU1 3HBZA 3WINE 1VJ2A 1AF9A 2A6VA 3AJZA 4QGNA 3GZUC 4PLOA 2ZS6B 1KQRA 4XJ8A 4YZ4A 3J8F2 4OLLA 5GKAC 2D3RA 1H1MA 3AZWA 1S2BA 4Q0PA 2CNAA 1HV0A 2DUPA 4COUA 1CX4A 3WUDA 3ZFGC 4Q0QA 4KG8A 1ULGA 4YYOA 2G9FA 2OUHA 3ZX7A 2E53A 4LHLA 4H14A 1DG6A 3U07A 4E4DX 4Y22A 2NMNA 1TMF1 3MI8A 4XETA 3VBUB 5AC93 2HWE2 4Q2FA 1JOJA 2QDNA 3JBG3 4JGZC 1OOPB 1H9PA 4AEDB 1AR72 5LRSA 1ULCA 4GKXA 1DGWA 1R083 4XFBA 1QJX1 4GMP3 2ZMLA 4BHPA 4NN0A 4XXAA 1G9DA 3CO2A 3VBHA 2RMU3 4F8AA 3RWNA 4B4PA 3KT7A 4N7IA 3JD72 3ZXJA 1YI9A 3IPVA 4IEXA 4YGBA 1RUC1 4Q4Y1 3B3QE 3VZNA 1I1EA 1RJ8A 1RB8G 1RUJ1 1NOVA 1QJU3 1RL3A 4D7YA 1GZWA 5JSPA 1BXHA 3AKPA 1QJY3 4KG0A 1WMFA 2QUOA 3FJSA 4GH4B 1ZRFA 4FPJA 3U0ZA 5J7MA 3AYDA 1ZZBA 3WHUA 4IV1B 1X8EA 4CEYB 5KWRA 5JIAA 3RJ2X 5C4WB 4DB5A 1Q8SA 1WD3A 2PHTA 2RS33 4IEZA 4M3CB 4JAAA 2PHLA 2Q5TA 2ZGMA 1NLRA 1GANA 3OD4A 2ATFA 5I93A 3VKFC 1U12A 4COYA 4SLIA 4CEWA 1RUH2 4XOGA 4P9IA 3VKNA 4CP1A 1W6NB 1DZRA 3IBMA 2TUNA 4OI0A 3O7OA 4RR3A 1XU1A 1QJX2 4COVA 4YZ1A 1C4RA 4XIKA 4M3CE 1GZ9A 1CJPA 4IEOA 5CNAA 3LGRA 4XQ4A 3QH6A 2ZKNA 2TBVA 2HWE1 2UY8A 3JZVA 3B9IA 3PJYA 1GZCA 1PK6C 5A33A 1B09A 5GM0A 2PAEA 1J3QA 1D0GA 2H0BA 4W6WA 5HXVA 4BOWA 4PBOA 1ALYA 2NM1A 4KNCA 1FYUA 3VBUC 4Y1YA 2XHKA 3MW2A 4Y4YA 4CDQA 1ZVFA 3AMMA 2QQPA 3VBFB 2IC1A 5GLVA 3QACA 1N3OA 2BWAA 1FV2A 3H8UA 4HL0A 5GLZA 1C3HA 5LK5A 3NSTA 2AUYA 5FLJA 2IWGB 1FOD3 4AQTA 1VBC1 4M3CF 4LT5A 4NWWA 4H7MA 1TMF3 4YM0A 3AMQA 3CNAA 3PVOA 2QE3A 1N1SA 1ZZ9A 2HKXA 5BNOC 2N7GA 4YFWA 4QQOA 2WA4A 2GNDA 1G8WA 1MQTC 3RG0A 3UL2A 5C4WC 1CAWB 2EAKA 2HWC2 4META 1C8M1 2ZX2A 1WLCA 5D1IA 1S0DA 3ZXFA 2VMIA 3BOWA 5CG9A 4QPGB 2OZ6A 1PNFA 1VRH2 1XE7A 2ZJCA 3BU7A 1UU6A 1LGCA 4PDWB 1QGLA 4HKWA 3VKOA 3MFCA 5KC6A 1XNDA 4XEZA 1KXGA 5B2GB 1W6PA 2WT2A 1JXNA 4PLNA 4EN8B 4LNVA 5CB7A 2YY1A 2WFF2 4IL7A 4QX5A 1SFNA 2H6CA 1RMU2 5DG2A 4JRLA 4KWJA 4G3YC 3B93A 1VBB1 4M0NA 1SMVA 2EXHA 3R0RA 2WZR3 1YIFA 2C1FA 1C5HA 2IXJA 2WNUB 3N35A 5J48A 2NN8A 4LBNA 2AR6A 2YHJA 2UWAA 2WA3A 3CU7A 4GQ7A 4XQDA 1COV3 2JXAA 1QU0A 2RS52 5I8SA 4FO9A 4FP2A 2BBVA 4XFHA 3M8LA 1CAXA 4RHV2 4GB31 1DQ5A 2WNEA 1SDWA 5CIRA 1FMD3 4FPOB 4JGYC 2ZGKA 5AFBA 5E88A 3WZ1A 2YV8A 2XJQA 4XJZA 3ALQA 3NL1A 3LWCA 1DYKA 3QOPA 2A3WA 1POV1 1G9FA 2ZZQA 4UXAA 1KRIA 2DCJA 2XJVA 5AVAA 2DFCA 3QH7A 1NG0A 4MGYE 4EN0A 1RUNA 3HIFA 4DY5A 4YNIA 2OUJA 1AL22 5FLIA 4FPYA 3D0JA 4AHXA 2ZGSA 1RUD2 3VBFA 2ZAHA 3J26N 5KHIA 2CTVA 1PGL1 3RYKA 1ZBE2 3M2MA 5JDBA 1ND2C 1MZFA 1PVXA 2CAVA 1LJ7A 1YWKA 2XG3A 1WUVA 2QZ2A 5FO8B 3FMGA 1H8TC 4H7LA 1VRH1 3WX5A 2DCTA 5DZFA 1BBT3 1Z78A 4FQ4A 1H2NA 3DKWA 1HQNA 3IDEA 1GLHA 1MQTA 2C0ZA 5BYNA 1SLAA 2PAKA 3TBDA 4KU8A 4CDQB 1B35A 1ZZ8A 1QKQA 1AR93 3RMYA 4CDUA 4JGZA 4YG6A 2UYBA 5F9TA 1JUIA 2Z69A 4R4ZA 4AEMA 4PIZA 5T5OA 4AFAA 3KZ4C 3OBTA 4AE2A 3AP7A 1LOEA 1W6MA 2RS53 2RM21 3WQ7A 3ES4A 2ETEA 5FOBB 1R091 1VAVA 2ZX1A 5T5JA 3BCWA 1Q5OA 1DQ4A 1PO23 3MEPA 5J96B 1G86A 3KGLA 1QXPA 4UBHA 2ZGUA 1OSGA 1BCXA 3MGUA 1R1A1 4QM9A 1EPWA 5BPXA 1F2NA 3WXPA 4A7KA 3V56A 1SBDA 1XNKA 3GF6A 5JWPA 5IK5A 3AZVA 4JGYB 2ZGNA 2BWCA 2JEMA 2SBAA 3EXUA 4IEQA 4TLFA 4INDA 3EBRA 2E51A 3DN7A 3ZMOA 3MFAA 1EAH3 4QPIB 4XF0A 1D4M2 4Y1UA 3NVCA 1YCIA 1KITA 3ES1A 1OFNA 4N53A 4Y20B 1AL23 4ZU4A 5CADA 4EN9B 4RL7A 4PDWA 4BMBA 3ZPYA 4C1XA 5T5LA 1V6KA 2VVDA 3EO6A 4N43B 4I09A 5CFCA 1A6CA 2R0HA 4WZCA 1BQPA 3NV4A 1UD1A 2MEV2 4S2FA 1OA3A 1QHDA 3VHNA 3PMSA 2YGMA 3ELNA 1MS0A 3H9AA 4XBQA 3ZSJA 3ME2A 1FPN1 5ACA1 2CGOA 1ASJ3 3IPVB 3H1WA 1KS5A 1DZQA 2NZ9A 3NAPA 3WR0A 2MPFA 3USSA 3PVEA 2D5HA 3FBYA 4WVMB 2DCZA 3L2YA 3RQ0A 4DY3A 4URTA 2R042 3IM0A 1D0HA 1VLNA 3LKJA 2R073 1FMD1 4LO8A 1FAYA 1F5FA 1OOPA 1YYNA 4Z8BA 1LHOA 4AF9A 4I0BA 4PQ9A 2I07B 5LK7B 1DGRN 2CWSA 1UAIA 2X5IA 1QJY1 2CGNA 4EWEA 4D69A 2A5ZA 2HJIA 3E97A 1RUJ2 1OPOA 4Y1VA 2K0GA