2ZHMA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
143
structure length
143
Chain Sequence
SQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-9
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhmA00
2A3WA 4FPOB 1GICA 3WG1A 4M3CE 4YGBA 1G7YA 3ENRA 3AJYA 1LHVA 4Z8BA 3N3HA 2E51A 2JE9A 3UJOA 1LEDA 1G86A 5GLTA 1U0AA 3O0XA 3RG0A 2YROA 3V0AA 3SLIA 4YW2A 2B7YA 2WT2A 1ZA4A 3AYAA 3POYA 2UURA 1LECA 3QLQA 1SCRA 2NYYA 4XYXA 3GALA 1UX6A 2PHRA 3VKMA 5DG1A 2ZGOA 3O0VA 3WDXA 3OBTA 4CRQA 3WCRA 2H0BA 1WCSA 3LSDA 2JDZA 1IOAA 3BODA 3O5SA 1S0FA 3T2TA 1LEMA 4U36A 3NV1A 3D4KA 4M01A 3SH4A 4P9XA 5EWSA 2A7AA 2FHRA 1G9AA 1GYKA 1AXKA 1CN1A 5CA6A 5L73A 5T5PA 4Y1XA 5AVAA 3RS6A 4GA9A 2NN8A 2R1BA 1GLHA 1LOEA 1MR5A 2A70A 3ASIA 3WCSA 2JD4A 3B9CA 1S1AA 1AF9A 3PMEA 4AGRA 1IKQA 1Q8VA 4K1ZA 5DZFA 2BQPA 4LBLA 1SACA 4PBOA 1NXD1 4GALA 4BM8A 5HCBA 3V65A 1SCSA 2A3XA 1APNA 2GNMA 3MW2A 1MS5A 4Q1RA 3WDTA 3WZ1A 4YFZA 3ZPYA 2D43A 4LBMA 2KM2A 3ZYRA 2WSVA 4FOVA 4M3CB 1LULA 3RRDA 2D7FA 2GMPA 4FPKA 4GXLA 1BJQA 1UKGA 3M1HA 1LJ7A 2JE7A 2YV8A 1W0OA 4NO4A 2A6YA 2GN3A 1MACA 3WG3A 4DRVA 3V0AB 1H30A 5JOXA 5E89A 5JOWA 4CZSA 1G9BA 2ZHKA 1JYIA 1A3KA 3B01A 2ZHLA 2D6PA 2WT1A 2EXJA 1YO8A 2A6WA 1MZ5A 4XILA 3PJQA 3FUOA 2ZMKA 5IK8A 1S0BA 4Q8LA 2D6KA 5KXCA 4DRRA 2GMEA 3AZVA 1DYKA 1QMJA 4XE9A 4Y1ZA 3OBRA 4YGCA 1QDCA 4XZPA 1DHKB 1GKBA 1LOAA 1V6NA 5HCFA 1D2SA 1QF3A 4YZ5A 2SLIA 1JOJA 5CB7A 1F9KA 1S0CA 2NP0A 5T5JA 1QU0A 3UJQA 5IK4A 2VY0A 5GM0A 5GLUA 3NV4A 1AZDA 5EYYA 2RHPA 2DWRA 2DU0A 5GZFA 3WHTA 1IS6A 2GNTA 3HMYA 5CNAA 5IK5A 3VKFC 4C1XA 5KXDA 1LOFC 3WUDA 3OJBA 1DGLA 4GWNA 1PZ7A 2VUAA 3KM5A 5T5LA 3DGTA 1FNZA 2PHTA 4LBJA 4PF5A 1YRZA 1MS8A 2R1DA 4BQ1A 1HQLA 1QNYA 3M3EA 3V0BA 4XHBA 4BLIA 1KDMA 2NMOA 2NM1A 4P9YA 3AYDA 4P9WA 1LCLA 1V6IA 1JHNA 5T54A 5KXBA 2FMDA 1ONAA 1CJPA 1SBFA 1DBNA 3OYWB 3SNMA 1WW4A 4AWDA 4DFSA 2Z42A 3NV2A 4UW3A 1SLBA 3AJZA 3AX4A 4YM3A 2OUJA 3AP6A 2C9AA 4Y22B 5KXEA 2AUYA 1QOTA 5DUUA 2DV9A 1GNZA 1ENSA 1HDKA 2V73A 2AYHA 3WNXA 1Q8QA 2DUQA 3T1LA 1WW5A 1H9WA 1LENA 2PELA 3W59A 4FPGA 5H9RA 4YM2A 2TEPA 3VKNA 2E53A 3SH5A 1C1LA 4GKYA 3RSJA 3TB0A 2CWMA 4LBKA 2VXRA 2AR6A 1FNYA 4Y24A 5SV8A 4Q26A 1I1EA 2I2SA 1IKPA 4K1YA 1AXYA 1JXNA 1KQRA 3AP7A 2AREA 2DTYA 1FV2A 5DG2A 1HQWA 1X50A 3LCPA 2AH2A 2ES3A 3ZXFA 1OFSA 2D3SA 4HL0A 4AVTA 2ZA9A 1URXA 1AX1A 4XDQA 1WD4A 1V6OA 3AYCA 3D5OA 4YGDA 1DQ2A 3NV3A 2LALA 1LOCA 2ZGQA 1N3OA 5DUWA 2GALA 2VU9A 1H9PA 1Q8OA 3ZXLA 3N7LA 2OVUA 3V0BB 1GNHA 1W0PA 2P37A 3OGGA 4BPZA 2CWSA 3M3CA 1Z78A 3AZXA 1W6MA 3AXDA 1CR7A 4YW4A 5IT6A 4XXAA 1LOFA 1VAMA 2WKKA 3JUUA 5E8AA 5FRAA 1C1FA 5BYNA 2P34A 1W6PB 2V5YA 4FQZA 1HLCA 2UWBA 1GV9A 2YY1A 3ILNA 1CPMA 4XMIA 3WG4A 1MS9A 1UAIA 3T1MA 1JN2P 1J1TA 1QOOA 1DQ1A 2OUHA 3M3QA 4K21A 1W6OA 4W65A 2DUOA 4YG6A 3PVNA 2P3KA 3R05A 1N1YA 1ULDA 1LESA 1QKQA 2R0FA 4SLIA 3AZZA 4AYUA 3MW4A 3D6EA 2DURA 1IS5A 1N47A 1S0JA 5FREA 3WOGA 1FATA 2JECA 2A6VA 3RMXA 3W58A 1Q8PA 1GZ9A 1QOSA 2D6OX 1ULEA 3AK0A 1FYUA 3OYWA 4JCKA 2ZGTA 1RITA 3WUCA 4XTMA 2D3PA 2PHWA 2JJ6A 4LBNA 4R9AA 1CIWA 1Q56A 3B69A 2ARXA 3ZSMA 2W08A 2DVFA 1SBDA 2ZGKA 1DQ4A 2GDFA 4AGGA 2DVBA 2DYCA 1JYCA 4Y22A 3FLRA 1N1SA 5T5OA 2UWAA 3IPVA 1SLTA 1GBGA 3PVOA 1G9CA 1DQ0A 1LHOA 2D6LX 4FPEA 1CPNA 1SLAA 4ITCA 3HR9A 2WT0A 1CONA 3IM0A 4XJWA 3SITA 1O4YA 1MS4A 1W6MB 3ZXJA 1SLLA 2VH9A 2GN7A 2W68A 5GALA 3OY8B 3AYEA 1FAYA 2ZGPA 2R0HA 5F5QA 5E88A 3V64A 4GKXA 2GNBA 2CNAA 3AP4A 1NLSA 3AP9A 4FQ4A 3LSEA 4Q1PA 2A71A 1LHWA 3N35A 1GSLA 1MS0A 4H55A 4PBPA 1S0IA 1LHNA 4R9CA 5DZEA 3M2MA 5GZDA 4YZ2A 5GLVA 4TZDA 3NWKA 2EIGA 5GJ6A 5H9QA 4YG0A 1DLLA 1W6OB 2A3YA 4ZXKA 3MPPG 1O4ZA 1UMZA 2A6XA 2EALA 3FUQA 4XIOA 4D69A 2D3RA 2ZGMA 1WBLA 4U2AA 3O0WA 3FBYA 1Y7BA 1PZ9A 3OPZA 1Q8SA 2DVDA 1WUVA 2DTWA 2WNEA 2ZMLA 2ARBA 1CQ9A 1LODA 2ZGRA 3VKOA 2DVGA 1AVBA 3VKLA 5T52A 2EXIA 1ULCA 4Y20A 4ZKTB 1LGNA 3WDWA 4RL7A 2ZACA 1W6PA 1UPSA 1MZ6A 2R49A 3B00A 3VV1A 5GZCA 1F31A 1JBCA 1MVQA 2EAKA 1AJKA 3CNAA 1V6KA 2A5ZA 1YYNA 3M3OA 1GZWA 1YIFA 1V6LA 1UL9A 1DQ5A 1F5FA 2ZGSA 3IPVB 4FPCA 4XJAA 1LGBA 1BXHA 1YXWA 2D44A 4R9BA 5GZEA 3WDUA 1EPWA 2C5DA 5IUQA 3A0KA 3AZYA 5T55A 3IKWA 3IN9A 2PHUA 3INAA 4YZ1A 4XJZA 3O12A 1ENQA 5T50A 4ATFA 2UWCA 2P2KA 3ZSLA 1JUIA 1LOBA 5EYXA 1MS1A 1PZ8A 2AENA 2CYFA 3FLTA 1DQ6A 5GZGA 4XMAA 4GWMA 4ISRA 3N7JA 2AGSA 3SISA 2PHFA 4OZXA 4PQ9A 4AVVA 4JRAA 2WLQA 5CBLA 3ZSJA 1QDOA 1MS3A 2GMMA 3WDVA 1I3HA 3HN1A 2LTNA 4HANA 3ZXEA 1CESA 3WV6A 1GANA 1DIWA 4LBQA 5DUVA 1ULGA 4R9DA 4FPFA 1AXZA 5CAZA 2ZGUA 4UW6A 1LU1A 4RA0A 2ENRA 2NZ9A 3Q9OA 4UW5A 4XXPA 4YGEA 1W6QA 4XJUA 3RQ0A 3RMYA 4ASMB 2Q5TA 1WW6A 3USUA 4FP3A 3WVJA 4Y26A 4XOGA 4YM0A 3ZVXA 3JU9A 1VALA 3OY8A 2CTVA 4Y20B 4NOTA 2EXKA 1N3QA 2ZBJA 4YM1A 1QNWA 1W6NA 5EXOA 2VW0A 4K20A 1GZWB 3POWA 4YW1A 3C2UA 2EF6A 5GLZA 2D6MA 1LU2A 2EXHA 1WLDA 1MVEA 5JDBA 1KJRA 2G4IA 4FOYA 4DQAA 5GLWA 1B09A 2DU1A 1Z0HA 4P14A 1YI7A 4FPHA 5DUXA 5DZGA 3R4UA 4UW4A 1DFQA 4FPJA 1LTEA 2WJSA 4XBLA 2D6NA 2P3JA 2XB6C 2GNDA 1QGLA 4CTEA 2W52A 4M3CA 1UN1A 4XBQA 4YFWA 5JLVA 1DYPA 2W39A 1A78A 4L8QA 1WLWA 1BYHA 1CVNA 1WLCA 2HYKA 1N1TA 5JOZA 3AFKA 4BLJA 2ZHNA 5LK5A 3ILFA 5F9TA 4FPYA 3UK9A 1S0GA 1ULFA 1RINA 3ATGA 1D0HA 4WVWA 1TEIA 1VLNA 3U4XA 2YXSA 3TAYA 2CY6A 1KJLA 2ZGLA 3BIWE 4FP2A 3ZSKA 2ZGNA 1OKQA 4XJ9A 2ZMNA 1OQ1A 4LBQB 4WV8A 1VIWB 2ZABA 5DXDA 3MEPA 5JMCA 1BQPA 1G8WA 3I4IA 4YLZA 2JKBA 3N7MA 1KDKA 1W6QB 1LGCA 2ZHMA 2A75A 3ILRA 4M00A 3USUB 1WBFA 1S0DA 1ZM1A 4FPLA 4KBBA 4Y1UA 2VW1A 4AVSA 3H0OA 4XHXA 4FOWA 3A0NA 2ERFA 4MYEA 1HKDA 1W6NB 2ZZJA 4JC1A 4BMBA 1IS4A 4LBQD 2R16A 5H9PA 3AXEA 1V6JA 5H9SA 4ISQA 4Y1YA 2YMZA 3ZYPA 4C1WA 1WW7A 2DUPA 1KRIA 1GZCA 1FX5A 3B3QE 3POSA 3PVEA 4DPNA 2ZAAA 3FLPA 4YG3A 3ZXKA 3QCWA 3R4SA 1IS3A 1ENRA 1XQNA 3MW3A 1AX2A 3DUIA 1WD3A 3AZWA 1SFYA 1BKZA 4YZ4A 4LBOA 3L2YA 1AJOA 4YZ3A 2E6VA 3WG2A 1FV3A 1C4RA 1KITA 4XBNA 1SLCA 2VW2A 3IMNA 3WLUA 4Q2FA 1AX0A 1S0EA 1N3PA 3GNEA 2YZ4A 1G9FA 4I30A 5HCAA 4WZFA 3WHUA 5JOYA 1UZZA 1G9DA 1C57A 1SLIA 1SBEA 4Q8KA 1A8DA 4M3CF 3SH3A 4YW5A 2ZKNA 4PCRA 2PHXA 3BOPA 3AP5A 3A4UA 4Q27A 4XTPA 3FFZA 3N7KA 1V00A 1JW6A 2A6ZA 1DZQA 3I8TA 2E7TA 2UU8A 2DVAA 3VUOA 4TYSA 2WQZC 2XG3A 4WVVA 4YW3A 4BMEA 1BZWA 2CL2A 2P3IA 1V6MA 2NMNA 4IQPA 4F83A 4ATEA 4AGVA 1UZYA 4BOWA 2WSUA 3WDYA 2E7QA 1LOGA 1N1VA 4XJ8A 2OW4A 1LHUA 3KQRA 4DS0A 4Y1VA 3UL2A 2SBAA 4FVVA 1VAVA 3N36A 3BTAA 4XIKA 5IK7A 4FOQA 1R1ZA 1RIRA 5JVVA 3APBA
chains in the Genus database with same CATH superfamily
1ST8A 4N8MA 4FPOB 3WG1A 4YPJA 1LHVA 3N3HA 4MGTA 1HB3A 4PQQA 3JB4C 2W47A 1U0AA 5BNOB 1RTVA 2RE9A 4EN8B 3S6PA 3FN9A 2UURA 3B5LB 4CCJA 3A21A 3VKMA 1HIXA 2VZTA 1WMXA 5FZ1A 3POGA 4DY5A 3A7QA 4XACA 3LSDA 4Y5TA 2JDZA 4QQPA 1IOAA 1CX4A 3O5SA 1TME3 3T2TA 4B1MA 1LEMA 2BRTA 1AR91 4YVWA 3MLLA 3T0AA 3NAPB 3Q8AA 5FZ6A 1H2NA 2FHRA 5IVCA 3OSDA 1UY2A 1GYKA 3G6JB 5C6CA 1AXKA 1CN1A 1D4VB 3ACFA 1U5ZA 1I5ZA 5FY7A 4AHXA 1AR83 1CAWB 3POIA 4Y1XA 5A7WB 5CA6A 4M4RA 1TMF2 1TNFA 3POFA 3ZN6B 3ZSMA 2X5IB 5FXXA 1BMV2 2EA7A 4UFIA 2D40A 4NHMA 4NIHA 1IKQA 2XHNA 4A3XA 4PBOA 1HRV3 2PLV2 3WF0A 4D7SA 3LGRA 5F1RA 1KGYA 1EV11 5HCBA 4CA9A 1IQAA 2A3XA 1APNA 1RUG3 4KWKA 1MS5A 2BBAA 3WZ1A 3ZSEA 3BOWA 4YFZA 1DF0A 2QQIA 3T2OA 2PQQA 1W9SA 4V2VA 4GJZA 1CD3G 1HRI3 2WLPA 3RRDA 2D7FA 2GMPA 4FPKA 3E6BA 1BJQA 1ENXA 1R1A1 2R6QA 3DXUA 5FWJA 5DPNA 1LJ7A 5IVVA 1X82A 1NCQB 1XJAA 4NO4A 3TNPB 4E2QA 3N9QA 1YWKA 4RS5B 2RM21 1D4M3 2XJTA 5JOWA 2Y38A 1LR5A 4B4QA 4CZSA 2VOVA 2CHHA 4F8AA 2D6PA 3HNBM 2WT1A 2EXJA 4LEJA 5F3EA 1YFYA 5F3GA 1UZWA 3FUOA 3KMHA 1FPN3 5FY8A 2D6KA 3GBFA 3T4VA 4CCDA 5KXCA 4DRRA 2GMEA 3I49A 3AZVA 1DYKA 4Z07A 4P08A 2WO2A 4I0BA 4F3JA 3OBRA 4YGCA 4OLLA 2DCTA 1I5PA 4G4FA 4HKWA 1DHKB 4YVSA 1LOAA 5K0UA 4PHZA 3SCFA 1PO12 3J7MA 2VG9A 2VMHA 2XLAA 3ZXDA 3U75A 1HXS1 4XDPA 4IESA 5CB7A 3SQOA 1XE7A 3N4MA 1S0CA 5T5JA 3M4FA 2OPKA 4URTA 1VPHA 4NR1A 5BNOA 4EN9B 2JDMA 1UYXA 1H8TC 5ABJB 5IK5A 2GNTA 4DXTA 4C1XA 3MYXA 1LOFC 1JI6A 3OJBA 1PX3A 2X8KA 4TN7A 1L7QA 5B4XA 1QJU2 4GMP0 4L9BA 5A1LA 2JIJA 5LK7B 3J8F3 4E4SA 2X10A 4RGKA 5DDJ2 5FZHA 3I2KA 3UYJA 2TNFA 4CU7A 3MFCA 5FYYA 3IWZA 2PTMA 3VBUC 2YC2A 2HWE3 4DXZA 3V0BA 5C8CB 2VZSA 3CF6E 4XHBA 5IAXA 5BNNB 3AYDA 3EYPA 1YLLA 2HWB2 2QQLA 5HPOA 2FDKA 1SPPA 1RJ7A 2QZ2A 4PI0A 4RFT0 4RN5A 2PAKA 4I0AA 5CADA 3T0DA 3ACHA 4AWDA 2YU2A 2Z42A 4NUBA 1QJX1 3NV2A 1SLBA 4NHXA 4AQSA 2HBUA 4YM3A 1YUDA 5C71A 2C9AA 3S7EA 1QXPA 2DFBA 2JDNA 2E31A 1GNZA 1C5HA 1HDKA 4Q4X3 2OZJA 4IEVA 3T1LA 3V56A 4IV1A 3W59A 3I2HA 2TEPA 2XWJB 5FP8A 3AKPA 5F32A 1C1LA 3BKZA 2BOIA 4EYUA 5M0TA 1CZVA 3K75B 4LBKA 2VXRA 1TME2 1K3IA 1VBA1 2GAUA 2JDUA 2AR6A 1FNYA 2KXLA 3HD8B 4MXWB 5CG8A 3T09A 1HN1A 2CV6A 2I2SA 1WMEA 2WQ4A 3HT2A 3QH7A 4Y4YA 3ZPOA 2Y64A 4RS5A 1OH3A 3LDRA 3J9SA 3AP7A 1HQWA 1X50A 4EV0A 2AH2A 1XNAA 4HL0A 5IAVA 1AR82 1URXA 2K46A 2J22A 2OQ7A 5CKMA 3ECQA 1V6OA 3D5OA 3K77A 4CU8A 4B4PA 3ALQA 4IV3C 2Z4FA 2E26A 2ZGQA 5F2SA 5A7SA 1N3OA 5DUWA 2BZDA 2GALA 1AYN3 1Q5OA 1YC61 1WA6X 2YYOA 1YQ8A 3KGZA 1HRV2 3MICA 3BTXA 4BPZA 4ZHNA 4DUXA 5FZOA 5IVJA 2WYFA 3ZR6A 1JYNA 1RUG2 1RUNA 1UZVA 3KCYA 4YW4A 4C90A 5IT6A 1R64A 1VAMA 2WKKA 1HRI2 3JUUA 1Q43A 2BGCA 4RHV3 3U10A 5BYNA 3TEWA 2ZEWA 2XONA 5FP9A 2ZZQA 3UETA 1TVGA 2VE1A 2UWBA 1Y9QA 2YY1A 4IE0A 3GCWA 1XNDA 3AMNA 4XMIA 4XQ4A 1J3RA 1MS9A 5ANQA 2O0OA 2Y6HA 4PLNA 5A32B 1IGOA 1JN2P 2VNGA 1J1TA 4OCTA 1D4M2 4JTOA 1DQ1A 3HOBA 3M3QA 2EAAA 2WDBA 3HN3A 1KD7A 1C8M1 5J7MA 2HEWF 4G9SB 3TN91 5L19A 1YQ2A 5FY0A 4Q5OA 1QKQA 4C0BA 4QDSA 3AZZA 2Q8DA 1KFUL 1UU4A 4UFHA 1MZEA 2DURA 2WBKA 4CUGA 1FPN2 3NVCA 3USSA 1IS5A 1N47A 1S0JA 2VVFA 5FREA 4IEWA 4DZGA 1FATA 2R063 2JECA 4HZFA 2ADDA 3RMXA 1QOSA 2Y6JA 1ULEA 3HJRA 1ALYA 5JIAA 5A33A 4XTMA 1OMIA 1BBT1 4N43A 4MVTA 2JJ6A 3BVCA 1CJDA 4L97A 1CIWA 3VZJA 2WN3A 5BXXA 4AGGA 2IXHA 4M0HA 2QQVA 4GZ9A 1N1SA 4AG4A 1SLTA 4BK5A 1GBGA 1K12A 3VBSC 4CPBD 3MLKA 1OF4A 4CDQA 2Z2SB 5FJHA 5I0DA 4YW7A 5IFTA 3SITA 5FXZA 1MQTC 3J8F2 2VOWA 2WN2A 2YFZA 4OYUA 1SLLA 4UBGA 4NPLA 4LORA 5CKNA 1BVVA 4IL7A 1M4WA 1UIKA 3AYEA 1EAH3 2ZGPA 2R0HA 3SEPA 2HWE2 4H7MA 4HN1A 4NIIA 4FQ4A 1NLSA 1DCSA 3RDIA 1VMFA 2W1QA 3N35A 3WNLA 2V4AA 1MS0A 4LHKA 3CBNA 5A7NA 2OYZA 2ET7A 3VBUB 3CIHA 3P1IA 5CYYA 2MEV3 5C4WC 3D3AA 3OGVA 2RS13 2VC9A 4K7JA 1W6OB 2A3YA 4P9JA 1REDA 1JUHA 1O4ZA 5FZAA 1JS9A 5KHJA 2ZGMA 2XJSA 1H1IA 4QX0A 3FBYA 3OUIA 5EJ1B 2WFPA 3OPZA 3I3BA 2WZR3 2WNEA 4A2UA 4Q4X2 4PJYA 1D2QA 1LODA 1QXRA 2W5FA 3LPFA 3ETQA 3NNMA 2ZGRA 4IERA 4K8RB 2GC1A 1T6BX 2RDQA 1J83A 1X9PA 2PN5A 5T52A 2J1AA 2EXIA 1ULCA 1RUC1 2Y8KA 2HEYF 4LUKA 4ZKTB 4CDWA 3WDWA 4RL7A 2ZACA 2R49A 3B00A 4QGMA 1HX6A 1F31A 3M3OA 1YYNA 3SCHA 1GZWA 5A32A 3KLSA 3UT0A 3GJAA 1BXHA 5GZEA 4XF1A 2VUCA 2XJVA 3D0SA 1EPWA 3FJSA 3T0BA 2VECA 2F4LA 4LA2A 4AI3A 1W0NA 3IKWA 1D0GA 1IG3A 4E4ZA 4W6WA 3H1WA 4QD2A 3WW2A 3INAA 1W2OA 4WVMB 4XJZA 4ATFA 1JYVA 3MF6A 1UY4A 5EYXA 3WW3A 2E32A 4AXOA 1AYN2 1X9TA 4XFHA 1YFXA 5FWEA 3RVHA 2ZX4A 4XMAA 5GZGA 4IV3B 1NAEA 2AACA 2JB8A 4AFBA 1IPJA 1JOBA 4KGGA 1RGSA 3BALA 3SISA 1RUJ3 4OZXA 4PQ9A 3WQ1A 3O1PA 3D82A 4JRAA 2B46X 1GP5A 3JZVA 4RHV2 1W2UA 1ACCA 4Q0PA 4R8HA 3ZSJA 3WDVA 1ZZBA 3GZEA 3RZZA 2RDRA 5FYCA 1I3HA 4HK8A 2LTNA 1CAUB 1JYTA 1W8WA 4CCEA 4XDOA 3CDZB 1ZZ8A 4MGIE 2IFWA 5D2AA 1AXZA 4FO9A 4GB33 4RA0A 4ASMB 2WINB 2ARAA 2YUEA 4E8DA 2AC1A 1H8TA 1U12A 1QXJA 4OUMA 3VB9A 4YM0A 1NOVA 1NX9A 1VALA 3JU9A 4Y20B 5IVYA 4NOTA 3MV11 4H3WA 3SHRA 4CDXC 1MZFA 4TXWA 4CP1A 2XBO1 5L36A 1QNWA 1W6NA 2JEMA 4A42A 5IVBA 1WCQA 1BVP1 3TWIA 2L9LA 3EBRA 1GMMA 2R062 2VTXJ 2Q4SA 3E5UA 3K4DA 4GH4C 1OA3A 4UYBA 2Y0IA 3VBUA 5FDBA 2GU9A 3T3YA 1NY72 2W87A 4HN0A 1WLDA 1WZXA 2YBSA 3NL1A 1VBB3 3GHNA 3I54A 5FXWA 1B09A 4P14A 5DZGA 3R4UA 5FYTA 1DFQA 2VMIA 1LTEA 1PO21 3PHMA 2D97A 3O1SA 1JODA 2D6NA 2R041 2YDEA 2BWCA 3MBWA 4HSJA 5A7OA 5F5AA 5A3PA 2RR13 4XBQA 1UN1A 4YFWA 2W39A 2VOTA 1R091 2JD9A 3G7DA 1AR63 1ODMA 3LEGA 4M4PA 2HYKA 3AFKA 3UESA 2WNUA 5D21A 3VHPA 3RI9A 5F9TA 3RJRA 3VBSB 4BQYA 2W0XA 2YXSA 4QGLA 2BGOA 2CY6A 1EAH2 3PUHA 2CGNA 2E9QA 4FP2A 4EWAA 1MQTB 2ZGNA 4YNIA 2VZOA 2EIEA 1LRHA 1OKQA 3OGSA 4OUSA 4XJ9A 2Q30A 4NHYA 4LE3A 1OQ1A 4FT8A 4LBQB 4X6QB 5JSPA 1OBNA 1W8HA 3E6DA 4L11A 2WZPP 2O14A 2MEV2 1HV1A 1VRH3 2RMU3 3I4IA 4HT1T 4YLZA 3VDDB 2R7EB 3ILRA 1LGCA 2RS12 4FI9A 5FZ9A 2J1UA 4M00A 3HBKA 1NLRA 2P5BA 2OXBA 4ONUA 4E9KA 5C4WB 1WMFA 1YQ5A 2I74A 1NA1A 3A0NA 1POV0 5KHIA 2ERFA 4MYEA 2WZR2 4JC1A 1GP4A 4LBQD 2LUWA 2R16A 3AXEA 3VBRA 2OKXA 4ISQA 3ZYPA 1LAJA 4QHZA 5FY5A 3ZLIA 4DEVA 1EPZA 1OF3A 1UY1A 4OULA 2QKDA 1FX5A 3PVEA 3MI8A 4DPNA 1YFUA 4I09A 4YG3A 3R4SA 5D1IA 1AUYA 1ENRA 5JPMB 1XQNA 3MW3A 2Q1ZB 3DUIA 3RWNA 3OGRA 1XYOA 3AMPA 5JR2A 2VAUA 1SFYA 2BFUS 5BPXA 1BKZA 4BQ3A 4N9HA 3CMGA 2O8OA 4JGZC 4ZS2A 3WLUA 1C28A 2IZWA 1SLCA 1TMF1 2JDAA 4Q2FA 1X36A 5E16A 1BMV1 2HLEA 3ZYBA 5LZ6A 2ZX0A 3AKQA 4G3YC 2EVXA 4I30A 4WZFA 1YJKA 3N9OA 2PLV1 3MLJA 1GU3A 5SV5A 1NZCA 2UY8A 5CVRA 4KGQA 4BU2A 3VD4A 4PCRA 3AP5A 3O14A 4QPGA 1RUJ2 1V00A 1NLQA 4NN0A 1DZQA 5FMOS 1YEWA 2D93A 2UU8A 1UWWA 2KR2A 1F4HA 3KF5A 3PDQA 4N9IA 4D8MA 1RUI3 4FSJA 5FMCA 4CEWC 4LKFA 1ASJ3 1U5XA 4BMEA 4OHVA 3ST7A 1PK6C 1V6MA 5EJZB 3B94A 3MDPA 4GB32 1COV3 4AOCA 1UZYA 2E7QA 1LOGA 2QQJA 4XFAA 5JWPA 4DOUA 2C9KA 5FMOL 3T4HB 2P3YA 1WKYA 1CIYA 1O6UA 5JZGA 3N9PA 4MH0E 4R4ZA 2YG0A 2LROA 3K3NA 3OB8A 3JXSA 3BTAA 4XIKA 4IGPA 5FO8B 4EJRA 3ZIWA 4X6RB 2ZKLA 2VOXA 4IW3A 1DZRA 3EO6A 4FFHA 2YB7A 4M3CA 4XF3A 4XVHA 5GALA 1GICA 3S57A 1PO11 4YGBA 1G7YA 3ENRA 4KU7A 4CDXB 1UU6A 3B9IA 5FKBA 4Z8BA 3HQXA 2E51A 2JE9A 1VBB2 4GH4B 4D7TA 3GXUA 3V0AA 3SLIA 4YW2A 2B7YA 2WT2A 1UX6A 3U14A 5FIXA 3WDXA 1OC1A 2ZGOA 4CE8A 2WYSA 2YGLA 1XYNA 2RR12 1QJU1 2ZX1A 4Y5Z0 2FCVA 1AR62 4Z82A 1S0FA 2HWD3 3ACGA 3IAQA 5DDJ1 3LA3A 1W8UA 4FXGB 4O9GA 4ET7A 3NV1A 4GAZA 3D4KA 3SH4A 1Z7S3 5EWSA 4LLFA 2AEZA 2VNVA 5A80A 3ZN4A 3CQOA 5L73A 3WNNA 3OEAA 2R1BA 1LOEA 1MR5A 2IFRA 3ASIA 1JZ8A 3TEZA 1A34A 2BBVA 2Q8OA 1WCUA 1VRH2 2RMU2 4A6SA 4AGRA 2ZAHA 4IXLA 5I0RA 4MOAA 1SACA 3VN4A 4XEZA 4CP9B 2BPA2 4HVOA 4JVAA 4N7IA 4BM8A 5J3UA 4AQ2A 2W1WA 1SCSA 1CAXB 2HWF1 2V09A 3MW2A 3OTFA 4Q1RA 4UF0B 3WDTA 1UW8A 3ZPYA 3T2QA 1QH6A 4Y4RA 5A3NA 4FOVA 4YSFA 4COZA 2ID4A 5FY9A 2HJIA 5BY5A 4LJHA 1UKGA 5EZWA 2F6BA 2VQ0A 2XGXA 4MGKE 1XSRA 2WA3A 1ZA7A 2GN3A 4IV1C 2VULA 4QQLA 4BQ2A 1J59A 5JOXA 5E89A 4OHWA 2ZHKA 4E27A 3IDCB 4LMFA 5EJ3A 3B01A 3UGFA 1AR81 1XNCA 3H8RA 4FTSA 3ZFFC 4JKMA 4XILA 4IEPA 5E1RA 4AHYA 4RQPC 5FTTC 1S0BA 5IK8A 3HBZA 4LO5B 4CVUA 5I0TA 1QMJA 4XE9A 1HB2A 3IZOA 3CHXA 4NMIA 4JV4A 2GSYA 2MPFA 5E6HA 3RZLA 1D2SA 1F4AA 4AI8A 4EE2A 2BV4A 4IDZA 1JOJA 1RYYA 4WM7C 5BNQA 3U37A 2ORXA 1QU0A 5IK4A 1D7PM 3FMGA 5GM0A 1HRI1 2FDGA 4EWDA 5K8SA 4KI5M 5EYYA 4XUQA 2DU0A 2RS33 2JXAA 1WA4A 3ES4A 2XVKA 3HMYA 5CNAA 3OUJA 5APAA 4I2OA 2JIGA 1RUI2 3VKFC 1T2XA 3CJXA 5IVEA 3IB3A 4BIFA 2NLRA 1ASJ2 1DGLA 1YJLA 3I2FA 3K4AA 3KM5A 3BIEA 4E2GA 5T5LA 1NQJA 3POEA 3LA2A 4XQDA 2PAEA 1YFWA 1COV2 1NKGA 4CEWB 4PIXA 4MV2A 3DYPA 2R1DA 4BQ1A 2X53S 4B1LA 1OPMA 1TNRA 5FYVA 4ZU7A 1PK6B 2XLFA 2WAOA 3OGJA 4BLIA 1QY4A 4QHOA 2NM1A 3OPTA 1FPN1 1LCLA 4RD7A 4QXCA 1V6IA 1O3QA 2O8QA 5FXVA 5T54A 4KU8A 5CISA 2ZS6B 3OYWB 4GD4A 4P5HA 5J96B 3BU7A 5FCCA 1PGW1 4PIYA 4NPMA 4UW3A 1SQ4A 2OUJA 4Y22B 1UU5A 5FFOC 5KXEA 2AUYA 2AYHA 1REFA 3PURA 1CAXA 4N43C 1OLMA 4BCUA 1E5HA 1WW5A 1H9WA 1LENA 2DF7A 1RMU3 2PELA 3LE0A 4FPGA 5H9RA 5LCWL 3I2OA 3JCIA 3VKNA 2E53A 1DGRN 3M7AA 1ZYBA 3AVRA 2P17A 3EB7A 4GKYA 1GUIA 3J8F1 4QQHA 1GZTA 3ABZA 4JHTA 4QX5A 4XF9A 3TB0A 2HWD2 4Q0UA 4Y24A 5SV8A 4Q26A 1NXMA 3NKGA 4CDQC 3IT8A 1U5IA 2HWE1 2XMLA 1Z7S2 3KHBA 1W8TA 3LDKA 2XVLA 3MIDA 2DTYA 4Y5SA 3K4ZA 3LCPA 4I02A 4S2FA 2XOMA 1US2A 2Q0AA 4AQ6A 4CUBA 2EIBA 4DY3A 2ZA9A 2XJPA 2JG8A 4QU2A 3RYPA 5JSOA 1WD4A 2VCAA 1JMUB 3WP3A 1JZ6A 2QE3A 3H8OA 3NV3A 5GZFA 1GFF2 1Y3TA 2LALA 3LEKA 4CCLA 1LOCA 2BYVE 5LY1A 2VU9A 4FXKB 4P5YA 4BH9A 5FQ0A 5C8WA 2AEYA 4JGZA 1JYWA 3WNPA 3V0BB 1IHMA 3QH6A 2P37A 5EIYB 3OGGA 2CWSA 1Z78A 1W6MA 1UXZA 3O1TA 4AFMA 3AXDA 4JDNA 4Q4X1 1UPIA 1CR7A 1SPPB 2FZ2A 4BA6A 3KD4A 5K9YA 1QJY3 3RGBA 1RJ8A 5E8AA 4Z2WA 4B7KA 1C1FA 4LKDA 5FV3A 1CGPA 2P6HA 1PNGA 3DYOA 4QWNA 5DAVA 3TOJA 4CP0A 4DMIA 3WG4A 5FPBA 2IXLA 1SG3A 1UAIA 2XR4A 4YARA 4GJYA 2XJQA 3URFA 4FFIA 2OUHA 4CDWC 3PU3A 4EROA 4W65A 1DZTA 2DUOA 4AHWA 4YG6A 3PVNA 4IV1B 4CEWA 1PGL1 3R05A 2XLGA 1XYPA 4LKSA 3O1OA 4JGYA 1PK6A 2VCBA 3D6EA 3MW4A 4OZOA 4RYDA 4ASKA 5BUVA 4JDOA 5C70A 1W99A 2WAAA 5LEKA 1UF2C 2XL9A 3WQ0A 4RSUA 3W58A 1AYN1 1IPKA 1GZ9A 1Q8PA 2WC2A 3QBQA 1ULPA 3OYWA 3E97A 2ZGTA 4FFFA 4LA3A 2XPJA 5JXGA 3WXPA 4LR4A 2GDFA 5ACA3 1VBE3 1XE0A 2DVBA 4RHV1 4Y22A 5LBBA 3FLRA 4O61A 5CZKA 2Q1FA 1GWMA 1REEA 2RS32 3PVOA 4WM7B 1VAKA 1G9CA 2XKOA 2XVGA 5JCTA 2MHFA 2D6LX 2ETEA 1CPNA 1SLAA 1ZZCA 1X8EA 5FMDA 1CONA 4Q0VA 5FZOB 4ZZ8A 5FZDA 1MS4A 3WP5A 4TWTA 1ZBA1 2ZEXA 2QZ3A 2WS93 1I6XA 3R0RA 5I0SA 2W68A 3KB5A 2HYXA 3OY8B 5C5UA 3NNGA 1MEC1 2FMYA 1XBFA 4FCAA 5E88A 2GNBA 5F5QA 2CNAA 5FYSA 3R6SA 5AC93 2H0VA 2QVSB 3EHKA 4MHUA 4Q1PA 2A71A 2Y6KA 4UI9L 4AI1A 4PBPA 4PLMA 4BISA 4Q4V1 5KWRA 3BYWA 3ACLA 3M2MA 1GQPA 2R061 5GLVA 4TZDA 1KFXL 1NCRC 2VPVA 2GC3A 5GJ6A 5H9QA 1NY71 3WP4A 3TEXA 1JU4A 3FUQA 2EALA 2BU9A 2RVAA 3EQEA 4XIOA 1WBLA 2GH2A 2YPJA 2QUOA 1F2NA 2WNOA 2QBXA 3GM8A 4NAMA 1VBD3 4QX2A 2DTWA 1CQ9A 2G1MA 4D7YA 1DDLA 2DVGA 1RMU2 1AVBA 2IC1A 5F37A 5FK7A 3CZJA 3KWVA 2ET1A 5A33B 4AFCA 1ZRRA 4N43B 1P8JA 3O1RA 4KQ7A 5FK8A 2VZUA 2EAKA 3BI3A 2QNKA 1V6KA 4DNYA 4S2DA 1YIFA 1EAH1 1AHSA 4XQWA 1UL9A 1DQ5A 2WNUC 1SFNA 2D44A 3VLBB 1F15A 3AMHA 5G05L 1H2KA 2CDPA 1QJEA 4WVZA 3JD73 4CDQB 2CAUA 4YW6A 5FO9B 3K3OA 2RS11 2P2KA 2Z5WA 3I2IA 1LOBA 1MS1A 1YQCA 1PZ8A 4I01A 4E8CA 2CYFA 1HQNA 2VBDA 4L2NA 3VDCA 3ZFFA 5JAXA 1AR93 4AZZA 4GWMA 4UOJA 2WZEA 3VZKA 4RQPA 4ISRA 3E5XA 4LQRA 2WZR1 2PHFA 4MGYE 4OVEA 2DCJA 4JRLA 1XNBA 1QJY2 1T6GC 3S30A 3Q8BA 5CBLA 5EHDA 1QDOA 1NA1C 4QHBA 4ES8A 4O7XA 3WV6A 4OI1A 3AKRA 4AW7A 3VBRC 4WM7A 5DUVA 4R9DA 3EXUA 4FPFA 2PXJA 2VZPA 1OH4A 1LU1A 2ENRA 2CDOA 4XJUA 3RMYA 4XF0A 1BLZA 1WW6A 3USUA 5C7GA 2FDHA 2QQMA 4XOGA 1I9RA 3WNKA 3ZVXA 1OI6A 1YI9A 5LATA 3OY8A 2X29A 4MXVA 3T2PA 1DLCA 4CDWB 1N3QA 3IIAA 4WZCA 3BGAA 4UFJA 5IATA 3NNJA 4S2HA 3AB0A 1GZWB 1RUH3 2PAMA 3POWA 3LAGA 3LOIA 1E57A 5GLZA 2D6MA 3S0MA 3DF0A 2UY9A 4IEOA 4DQAA 3THPA 1RUJ1 4QKFA 4UW4A 4FPJA 5FBJA 1F5JA 1UO9A 5KHGA 4MGZE 5FZLA 5ACA2 1VBE2 1W39A 4KBZA 4H14A 4XBLA 3LWCA 3NRUA 2IXKA 4QPGC 1UNBA 4AI2A 4COYA 2W52A 5JLVA 1A78A 4L8QA 2RG4A 5FZ8A 5J09A 1WLCA 2A73B 4GB31 1XNKA 4X8PA 5JR7B 5KC5A 2ZHNA 4AVAA 3RYRA 1S0GA 3HT1A 2WS92 1D0HA 2VQUA 4QPIA 4B8EA 3MIHA 4HPKA 5DAQA 1IQDC 1RHI3 4LT5A 4QKNA 1HXS3 5AC92 2XUEA 3H42B 2ZMNA 4BQXA 1JZ7A 3RWKX 2YFUA 5DXDA 2IXCA 1BQPA 1G8WA 1OT5A 2GC2A 4YYOA 2JKBA 3N7MA 5JZGC 4Q0SA 4NE9A 3C3VA 1H8TB 5FZ0A 1BHGA 1WBFA 1S0DA 1VBB1 1ZM1A 2ZX3A 4FPLA 4JHZA 2QQOA 1IPSA 1POV3 1W9TA 2DDUA 2VW1A 4Y1UA 4AVSA 5LEJA 1NCRB 5CFDA 2X05A 4XHXA 2Z79A 3MZHA 1ZRFA 4FOWA 4HMZA 3NJYA 1HKDA 1W6NB 2P4EA 4KL1A 4DINB 1VBD2 3RFRA 4P9IA 2IVIB 5H9PA 2YU1A 4CDUA 1V9U3 1S2BA 4Y1YA 2G19A 4C1WA 2RR11 5J98B 1AYM3 1AR61 3WHTA 4AEDC 3VD3A 1UCXA 3B3QE 3IDEA 4RFRB 3BUCA 3QCWA 4AL9A 1IS3A 5I0UA 1VBC3 5D8AA 3O1VA 1AX2A 2ZX2A 5F8PA 5C9AA 3J7HA 2OX0A 3CZUA 2JE8A 3WT3A 4YZ4A 3FC0A 3JQXA 2FZ1A 4YZ3A 5HV0A 2E6VA 1FV3A 1ND2A 1KITA 2RDSA 2VW2A 4LKEA 1V70A 3VZOA 3JD72 1OQEA 2JG9A 2RMU1 3OUHA 5JSRA 3QACA 2WNUB 3GNEA 2YC4A 1VR3A 3ZMNA 1OVPA 2C4XA 1G9FA 3HWJA 1FXZA 2TBVA 3WHUA 2VMEA 2JKXA 2PYTA 1UZZA 4BWOA 1VBA3 1C57A 4NRQA 1AR92 1A8DA 4XAEA 4M3CF 5CFCA 4YW5A 5HBAA 1L3JA 3WF4A 3BOPA 3U4SA 1JZ4A 4NJ4A 2A6ZA 4FTEA 4PDWA 2WQZC 2XG3A 4WVVA 3GGLA 4QX1A 1JZ2A 2XJRA 3O1UA 1ZRCA 2F4PA 3NJXA 4YW3A 4A4AA 1BZWA 2CL2A 5AFBA 2HWC3 5A6YA 4IQPA 5C33A 3KS7A 1W03A 1NA1B 2XQRA 4AAXA 1SEFA 3MIFA 3VBRB 1TG7A 1LHUA 2GP5A 1J58A 1DGWA 2Y6LA 3H7YA 1FI2A 3UL2A 2SBAA 1VAVA 1DGRA 1H8VA 3N36A 5ERLA 5IK7A 1R1ZA 5IW0A 5JVVA 4ASLA 3UNPA 3E6CC 1W04A 3BU0A 1O5UA 4AFDA 1UXXX 3AL5A 5IWFA 1RUH2 5A6ZA 1OOPC 5I93A 4M3CE 1K42A 2EIDA 3HQUA 4BDVB 4BQ4A 3AJYA 1RUF3 3KT4A 2CAVA 3M70A 3UJOA 1LEDA 1G86A 1FT9A 5GLTA 2HKXA 4XPVA 4HSLA 3IAPA 1C8M3 3MIGA 3QLQA 3AYAA 3WQBA 1LECA 1NCRA 3U1XA 4CCCA 1VRBA 2PHRA 3GALA 5FY1A 1RUI1 5DG1A 3VZNA 1OSGA 3DYMA 4CRQA 1ASJ1 2H0BA 1GWLA 1UOFA 5I8SA 5JMOA 3BODA 5LWBA 2YGMA 1COV1 1ZZ6A 4OQ8A 4U36A 4CCMA 1MPXA 4QPGB 2VBBA 2IXIA 4CU6A 2A7AA 1RHI2 5FYZA 1ODNA 1HXS2 1NUKA 4LPLA 4XF4A 2R073 5T5PA 2VZVA 3RS6A 4GA9A 2NN8A 3THTA 2A70A 3GF6A 4AEJA 1CWPA 3KF3A 3ZO0B 3WCSA 1PVXA 1WGPA 2I07B 5GKAC 2WL1A 1Q8VA 4K1ZA 4XZUG 4BQWA 1AL23 2BQPA 1XPWA 4LBLA 1UYYA 3SMHA 3MGUA 3DN7A 1NXD1 4W6XA 3VBOA 2IXJA 1RUD1 3WNOA 3A22A 4ZS3A 5JZGB 3KV5A 3V65A 4IE5A 2J1SA 5FZCA 2BTVC 3VD7A 5FUNA 5A3UA 3FZ3A 4X8NA 2D43A 3IMMA 4LBMA 2KM2A 3ZYRA 1BCXA 3B02A 4S2GA 2WSVA 4M3CB 3FHIB 1LULA 1W9YA 1V9U2 3I7DA 4KH9A 2PMWB 4TLFA 1ND3C 1AYM2 2JE7A 5F6LB 2YV8A 1WCDJ 1QHDA 5F2WA 1W0OA 3B7MA 4KMQA 2A6YA 4MGQA 3FFQA 1O3RA 1MACA 3WG3A 3V0AB 1H30A 3DKQA 1VBC2 4CP2A 3RZGA 1A3KA 1W05A 2ZHLA 4BHPA 1YCIA 1YNAA 1YO8A 2A6WA 4GWJA 3IDBB 2ZMKA 4RR3A 1GP6A 2Q1MA 2QDRA 5J37A 2QQNA 1JU3A 2C24A 4CCKA 2JG8C 3NW4A 5F3IA 1V6NA 1VBA2 4YZ5A 3UGHA 1EYBA 2VCMA 4P9GA 1OUSA 1F9KA 3HVDA 3WEZA 2DCZA 2PHLA 3LIHA 4OFGA 2ZEYA 4W50A 2VY0A 4N53C 1OPOA 3NV4A 4NIAA 1ZBE3 2RHPA 1VP6A 1NQDA 3I3EA 4QPWA 5LBCA 4AR2A 2G9FA 5BV6A 3WUDA 3GCXA 1Y4WA 4NIGA 1HJFA 4GWNA 4JQTA 2VNOA 1PZ7A 2VUAA 5CIRA 4ZU4A 2HWC2 2BFUL 3DGTA 1FNZA 1PIV3 2PA7A 2PHTA 4H7LA 3VBFC 5A1FA 3CJIA 1RUE3 4L92A 5A7PA 3HPNA 4A41A 1QNYA 1W9WA 5L7OC 2WA4A 4QMAA 1HJGA 1KDMA 3PUSA 3UKTA 4P9YA 4HKOA 2UYAA 1VE0A 2ADEA 1JHNA 2BNMA 3DV8A 3MIBA 5J1XA 2FMDA 1ONAA 1CJPA 4HONA 1SBFA 1R083 4JGYC 4K9SA 4D0QA 1WW4A 4NPRA 1PVC3 5FZBA 3K46A 4DFSA 2IWGB 2P6CA 1RUF2 3AJZA 1B35A 2OT7A 3AP6A 2VGDA 2V4VA 3DKWA 4JKLA 5A70A 1QOTA 5DUUA 1OOPB 2DV9A 3BTZA 1EUUA 1C8M2 1ENSA 2V73A 2XL7A 2KA3A 4WM8A 4XFCA 3TBDA 2RS31 3U0ZA 3PIGA 2J42A 4ZONA 3WP6A 4YM2A 1OLME 1CX1A 5FYBA 1H2LA 3SH5A 5T3NA 3WW1A 1X7NA 4XUPA 3ZKYA 3LQCA 5KHKA 3WF2A 4OI0A 1I1EA 2DBIA 1VJ2A 1IKPA 1K45A 2D5HA 4K1YA 3S7IA 4NROA 4Q4Y3 2YBKA 4AVCA 2E33A 3NNLA 4QQ2A 2X09A 3OPWA 3ZFGC 3MO4A 1FV2A 1O7FA 3W9AA 5A7QA 4AEDA 2R072 4LO8A 4AVTA 5C5TA 1S2EA 3DPRA 5HI0A 3UKVA 4PLOA 4YGDA 1DQ2A 4XFBA 5LBEA 5LASA 5I8TA 2IUWA 2PFWA 3OG2A 4CEYA 1AL22 1RVF3 3KHCA 2OVUA 3N9NA 1W0PA 1C3HA 4J6GA 3M3CA 3ZYJB 1O3TA 5FZ7A 1E5IA 1VMJA 3Q8CA 1WWYA 4IGQA 2HWB1 3MHZA 4XXAA 4JQRA 4NAOA 1J3PA 1EY2A 2VZ1A 5FRAA 1H4HA 1W90A 3DCQA 2P34A 3I59A 1W6PB 3R4DB 4UWDA 1GV9A 1W8NA 5K4LA 4FAGA 1JZ3A 4NRMA 4CXWA 1QEXA 5JXIA 4XABA 3WR0A 2VOKA 5IHRA 4K21A 2J1RA 5LBFA 2P3KA 1LESA 3QD6A 1FOD3 1NE6A 1E5RA 2R0FA 5A3WA 3D0JA 3FL7A 3I2DA 3K51A 5TSWA 3VD9A 5JXJA 4JTNA 1TME1 2GH8A 3JBG3 3NAPC 2A6VA 3VDBA 4CXXA 2QQUA 2D6OX 5FPLA 3ZXGA 3AK0A 2CGOA 1FYUA 1OQDA 4N7UA 3O7OA 3M3IA 2Y0OA 2D3PA 3POJA 4D3WA 4I3GA 4R9AA 3W5NA 4Q29A 3B69A 4BXSV 2ARXA 1H0BA 1RL3A 1PMJX 1QJY1 1DYOA 2DVFA 1SBDA 2JG8B 1DQ4A 2X5IC 2ZGKA 4J25A 3VHOA 4EZ4A 4A3ZA 3RPQA 3IPVA 1OOPA 1ZBE2 2O1QA 4D6QA 4F7ZA 1H4GA 1DQ0A 3MUY1 4Q4W3 5FQ0B 3ZX7A 1LHOA 3C7GA 4FPEA 2WUHA 4JGZB 4N53B 4ITCA 4XJWA 1HRV1 1ZZ9A 2WT0A 3IM0A 5FAXA 1W6MB 3WNMA 1PIV2 2QQPA 5FP3A 3ZDVA 1FMD3 1RUG1 2VH9A 2GN7A 4URAA 1RUE2 2VQAA 4KG0A 2R32A 1FAYA 1W28A 3V64A 4GKXA 2K9ZA 3AP4A 4LHNA 1NCQC 3ZIXA 3FX3A 3LSEA 1W8OA 1SZBA 3VBFB 1LHWA 4AAPA 3H1YA 4H55A 2JICA 3GBWA 4NRPA 4R9CA 5DZEA 3MUZ1 4GMP3 4HVRA 4YZ2A 5L7OB 4QM9A 5F3CA 3NWKA 4DUWA 1R082 2RJKA 4YG0A 1DLLA 3UV9A 4C8DA 1D4M1 1PVC2 3S5AA 3FBMA 1UMZA 2DCYA 4D69A 4NVPA 1ZREA 4IUGA 1CAVA 4U2AA 5DN2A 1OKOA 2BW8A 4JGYB 5KBFA 3K48A 5ACA1 1VBE1 5I91A 3C7FA 4K40A 1Q8SA 3VZLA 4O9EA 5LA0A 1A8MA 4XFIA 5EV7A 5FUIA 4BJ0A 3VKOA 3QOPA 2IVJA 3RZMA 3VKLA 2WIIB 2XUMA 5F5IA 2VMCA 3I97A 5A6XA 1W2NA 4E4DX 3PLQA 2ARCA 2W91A 5FYHA 3J4UH 1W6PA 1UPSA 1MZ6A 2KD7A 1NZIA 2WS91 1UKRA 3LEIA 1JBCA 1MVQA 5GLUA 1AJKA 2D98A 4Q4Y2 1QQP3 4ZU5A 4AI9A 4QM8A 1ND3A 4XJAA 1LGBA 4LUMA 4R9BA 3TRSB 3AFGA 4Y3OA 3P3NA 5FUPA 4QPIC 2C5DA 5A6QA 1PHMA 5IUQA 2BVBA 5JPNB 3A0KA 1H2MA 3AZYA 4K8FA 1JYXA 2WR9A 3IN9A 1XXNA 4IE7A 3ZFGB 3O12A 1ENQA 3IIIA 4IEQA 4OHXA 5T50A 2UWCA 3H8UA 1JOPA 1JUIA 3ZSLA 1RVF2 5FLIA 3FLTA 4MUVA 2BDRA 3PIJA 3AL6A 5BNNC 2VBPA 4QKDA 3A23A 3N7JA 1VBD1 2J1TA 2CU5A 4A45A 4AVVA 2VMGA 2YHJA 5CFDC 2GMMA 1MS3A 4UXAA 3ZM8A 3ZR5A 3HN1A 4YWAA 4AFAA 1OFNA 4TLGA 4CCNA 1H6XA 1GANA 2WFF3 4YRDA 4CDUC 2VTFA 2MNGA 2ZGUA 2WZ8A 3Q9OA 4N53A 1DU3D 1W6QA 4XW3A 2H6CA 2Q5TA 4IEZA 5FPXA 3WVJA 4Y26A 5LA9A 3FWEA 2HWF3 5D8AC 4NHKA 5C9AC 1Q3EA 2CTVA 3JD71 1FOD2 4UT5A 3W21A 1QH7A 2EXKA 4AQTA 5FZMA 5JXHA 2ZBJA 4TSVA 4YM1A 4Z1VA 4LHSA 5EXOA 3VBFA 1ZRDA 1OUXA 3H3UA 3GDBA 1ZZ7A 1ND2C 2VW0A 3LB9A 3JBG2 3NJZA 4K20A 4BYYA 4DIQA 2JG9C 1BEV3 3GYDA 5L7OA 3C2UA 1K5MA 2EF6A 4IETA 5FP4A 2NPIA 1LB2A 1LU2A 2Y33A 2EXHA 5JDBA 3ZFEA 2G4IA 2UYBA 4FOYA 5FY4A 5GLWA 2K2SA 1YI7A 1XSQA 4FPHA 5DUXA 2YPDA 3P3PA 2Y60A 2J1VA 5L9BA 3LFIA 5CFCC 2RS53 2VTXA 5FYUA 2P3JA 4EN0A 3WF1A 4CTEA 1HN0A 2OIIA 4Q4W2 4IEYA 1BK1A 5K7PA 3OOXA 4OHYA 2J1EA 3ZFFB 1BYHA 1CVNA 2BERA 3ZYHA 5FZ4A 5DMYA 5JOZA 4PDWC 4NIDA 3MF9A 4RQPB 4BLJA 4E2SA 5LK5A 1AR73 4WVWA 3UK9A 3ATGA 4HBNA 1FMD2 4IEUA 4L0PA 5FZKA 1TEIA 4AK3A 3TAYA 2WO3A 2ZGLA 3BIWE 5DQ0A 4AHZA 3LKJA 4IGOA 3U11A 5A1AA 1GWKA 1O4TA 3H1MA 3GHMA 2LS6A 1VIWB 4V2WA 5F5CA 2BOJA 5DAPA 1RUOA 1J1LA 2JENA 1RUH1 1KDKA 1GQGA 3ZFGA 3USUB 3N9LA 4FTBA 1NT0A 4QPYA 2OQ6A 4KNCA 1RXGA 3KCXA 3MIEA 2GZWA 2GC0A 4A44A 5CU1A 5DAWA 2VL4A 2H6BA 2WNVA 1X8MA 1V6JA 2B5HA 5H9SA 2YMZA 1WW7A 3PL0A 1GZCA 2W92A 3DECA 4CYDA 4DXSA 4XUOA 3F95A 3W20A 2W94A 2ZAAA 4META 1VB4A 3J7LA 1OHFA 1NYWA 2OZ6A 1WD3A 4M0NA 1RHI1 5FR3A 2RJ2A 1QQP2 3OBAA 4R52A 4ZPIA 4LBOA 3L2YA 5I8YA 1AJOA 2JDKA 3WG2A 4XBNA 5CG9A 3VL9A 3IMNA 5FLHA 1E5SA 1S0EA 3AKTA 1N3PA 4LULA 4EZHA 5EFUA 2YZ4A 3P5BA 5HCAA 3DL3A 5FJKA 2DFCA 4QPIB 3X29B 2XJUA 4HPKB 4W6YA 4BB3A 3L2HA 2R30A 1G9DA 5HV4A 2CGPA 1POV1 1SLIA 1SBEA 1XC6A 1O8SA 4RGAA 2A1XA 4NWVA 3SH3A 3SXWA 1UYZA 4Z2AA 4DO0A 3A4UA 4Q27A 3VBOC 4ZZ5A 3ZOIA 3AVSA 3N7KA 4ARXA 5KR7A 1JW6A 1V9U1 3NAPA 5A3TA 3I8TA 3H50A 2E7TA 3LA7A 5FKCA 2MEV1 1AYM1 2DVAA 3E1F1 4C91A 3OD4A 2VO5A 3SKVA 1CAWA 3I3QA 5A7WA 1OLQA 2WFF2 3OF1A 1VMHA 2G9GA 2LRPA 3ZN6A 4PIZA 3ON7A 1OD5A 1VBC1 2NMNA 2X5IA 5CFDB 1OD3A 4ATEA 2BP6A 5DAXA 5F7UA 4BOWA 2WSUA 4FBFA 4LO6B 4CDUB 4XJ8A 4P9LA 1V0AA 3CEWA 4QB2A 1UX7A 5LB6A 2HWF2 1UOJA 2B8MA 3GZTB 4Y1VA 4FVVA 4Y33A 1X33A 1DGWX 4E4HA 4PI2A 4FOQA 3APBA 5D8AB 1HV0A 5C9AB 2A3WA 3PTYA 2WWUA 1HB1A 4RR3C 1BEV2 1NCQA 3NJVA 1QWRA 1W2AX 2PHDA 5FOJB 5ANNA 1ND2B 1EV13 1H1MA 3LF7A 3O0XA 2VVDA 2YROA 3RG0A 2JG9B 3KVAA 3VD5A 1XOYA 2B42B 2BEOA 1ZA4A 3POYA 4L99A 1K5JA 5FZ3A 1SCRA 2NYYA 4XYXA 4V1PA 2RS52 3O0VA 4B4RA 3OBTA 1WCKA 3WCRA 1R1A3 2WABA 1WCSA 2HWC1 4WBBA 2FBEA 4W8JA 2W2IA 4FAHA 5CFCB 2G9ZA 2WO1A 1A6CA 2BUKA 2RM23 1SHWB 1AR72 1RC6A 4KWLA 4M01A 4ES9A 4P9XA 1TZOA 3TNQA 4A7YA 1G9AA 4PDWB 3NNFA 3CJIC 4QDQA 4QU1A 5FMBA 5KC6A 5AVAA 4QX3A 2Q8EA 4KWJA 5LRRA 1GLHA 1GOFA 2HH9A 2JD4A 3B9CA 1S1AA 1AF9A 3AM2A 1CZTA 3PMEA 5ABJA 5DZFA 1PM7A 2F17A 2ZOEB 1RUF1 1XU2A 2Y6GA 3T08A 3AC0A 3ZDSA 2W95A 3N9MA 4GALA 3ETPA 1PNFA 5F39A 3ZXAC 1ZBA3 3BN6A 3BCWA 2GNMA 4QXKA 2OS2A 1B35C 3EMRA 1MEC3 5HCHA 1O8PA 1W3XA 4GXLA 3GZAA 3C7OA 5L9RA 5C8CA 3BTYA 5JUVA 3M1HA 1U5YA 5CKQA 4Q4V3 4WM8C 5BNNA 3AKSA 3ROUA 5FBZA 1XU1A 1UMHA 2FCUA 1KXGA 3KVBA 3KV4A 4SBVA 4CUAA 5IFPA 3RNSA 4OQ9A 1Y43B 3AMQA 4DRVA 1PGW2 3HAGA 1G9BA 4LTAA 1JYIA 4QDRA 2VXJA 1H1AA 1J3QA 4UAPA 2R071 3THDA 1Y9GA 2VZQA 1MZ5A 4OUEA 2BGPA 3OCPA 3PJQA 4HXCA 4Q8LA 4QB6A 1KEXA 4Y1ZA 1AL21 2FDJA 3WW4A 2XKPA 3DPRC 3W5MA 5ISLA 4LO4B 1QDCA 4XZPA 4LNVA 1GKBA 5HCFA 5A3MA 4DXRA 1QF3A 1ZNPA 1QJX3 4LLOA 2SLIA 1ZX5A 3F2ZA 2LW8A 3HIFA 3PUAA 4CEYC 4MXWA 2VZRA 2NP0A 3UJQA 3GZUC 2N7GA 3VDDC 5LA2A 1AZDA 5FPUA 1NE4A 2DWRA 1VRH1 1IS6A 4CCOA 3Q8EA 1OVSA 4IEXA 2B39A 3VBHC 5KXDA 2WO7A 3VBOB 3IDAA 3SEEA 4MG2A 2XWBB 4P00B 2D5FA 2ZPXA 1Y9MA 2BNOA 4LBJA 3OD0A 4XUTA 2VZ3A 4PF5A 5IJRA 1YRZA 3C7EA 1MS8A 1HQLA 1YHFA 3M3EA 3PUIA 4GULA 4XCBA 2NMOA 5B4NA 2W1SA 4P9WA 3I2GA 4UFLA 5LA1A 1SDWA 4JX0A 2RV9A 5KXBA 4K3UA 2XH6A 5FYIA 2JDPA 3B93A 3PNAA 5FOBB 4XAAA 1DBNA 3SNMA 3ME2A 4XETA 4CU9A 2VR4A 3AX4A 2ZJCA 5C3OA 2JB4A 1EV12 2QTWB 5FP7A 4LIUA 4BXFA 2WRAA 4RR3B 4COWA 3DEMA 5EPAA 5JI7A 1ZBE1 3WNXA 1Q8QA 2DUQA 1PGL2 3NQHA 2B9VA 2XXZA 3GJBA 5IYYA 3SKJE 2RDNA 3NSTA 1C5IA 1R1A2 3CLPA 3AMMA 1OA4A 3RSJA 3MPBA 2CWMA 1PIV1 2J7MA 4HG6B 2FDIA 4CPBA 1RUE1 2RM22 1AXYA 1JXNA 1OXCA 2C26A 1KQRA 2OA2A 3KCCA 4HFSA 4MLOA 4LHLA 4PT6A 2AREA 3TN93 5DG2A 4ZXEA 2ATFA 3ZXFA 2LM3A 3DXTA 2ES3A 4AEKA 1QJFA 1OFSA 2D3SA 3WY6A 3KT7A 4JKKA 4W4ZA 1AX1A 1GQHA 4CXYA 4XDQA 1SDDB 3AYCA 2HEVF 3ELNA 3VHRA 1R081 1VB2A 4FFGA 2BJSA 3CU7A 4EWEA 4QT6A 4BIOA 1PVC1 3BPSA 3CJIB 3LZZA 1LKNA 3ACIA 2W3JA 1H9PA 3VGIA 1Q8OA 3ZXLA 3N7LA 3LPGA 1GNHA 2K0GA 2VD7A 4P02B 3U07A 1ZBA2 3AZXA 1BBT3 3S5QA 3RI8A 3RZKA 4D94A 3MFAA 3E5QA 1RB8G 1LOFA 2VNRA 5KHHA 1MEC2 2Y34A 4QKBA 4LOTA 1PMIA 2V5YA 3WSOA 4FQZA 1HLCA 3ILNA 4Q4V2 3WINE 1CPMA 1B35B 1ULOA 2FD8A 4I0WB 3ORJA 1F35A 2DCKA 3BB6A 1UZ0A 3T1MA 4Q4Y1 1QOOA 3PUQA 2NQYA 3CKHA 3EJKA 1US3A 4PF1A 4LE4A 4WM8B 1W6OA 4D6RA 3K2OA 3UGGA 1W06A 1W8FA 1DG6A 1N1YA 1ULDA 2GP3A 5BNPC 2FQPA 4SLIA 4AYUA 5C3QA 4BK4A 1QIQA 4MSVA 3ITQA 5FO7B 3SCGA 2JX9A 2XQXA 3H9AA 5HXMA 4DUVA 3WOGA 2VVEA 2HWD1 2VUJA 1RVF1 3C8XA 4QB1A 2E7AA 1TE1B 4GIQA 4JCKA 1Z7S1 1RITA 3WUCA 1QJX2 1WMDA 1UOGA 1EUTA 4AEDB 2PHWA 3H7JA 4LBNA 4OI4A 1Q56A 4OI2A 1L7LA 2VJXA 2VQTA 3DPRB 1UQXA 2W08A 4QQOA 4BZ4A 3KV6A 1HW5A 2DYCA 1JYCA 4LOSA 4B3NA 4IE6A 5T5OA 2UWAA 4O65A 5AFEA 4CEYB 4MGSA 3VHNA 2YC0A 3KGLA 1SMVA 4A7ZA 3I3MA 1RUC3 3RYKA 4AI0A 1RXFA 1UY0A 3C7HA 3HR9A 3I2JA 4J1WA 3ZN5A 4QX7A 1O4YA 2W46A 1POQA 3ZXJA 4C0HA 4WVMA 1G6NA 2QQWA 2ZTNA 4HOOA 3LD8A 5EQUA 3VBHB 2Y6FA 2XHKA 3KT1A 1YIPA 4MX3A 3I59B 1FOD1 3AP9A 1IG0A 4IV3A 4LIVA 4R4XA 4TTGA 1AL0G 2QJVA 1JHJA 1GSLA 5GZDA 1S0IA 1LHNA 3H3ZA 5LRSA 5JIUA 3JBG1 1KS5A 1O5LA 2EIGA 1W3VA 3ZYFA 2ZCWA 4LXLA 4ZY9A 1CZSA 3NKTA 4N90A 3MPPG 2A6XA 1CAUA 1W9FA 5FZFA 4ZXKA 4EN7B 1KS4A 2D3RA 1PMHX 3O0WA 1S4CA 5FPVA 1W8ZA 2Q8CA 3CL1A 3HNMA 1K5MC 1Y7BA 1PZ9A 2W9XA 3ES1A 3WQ7A 4DB5A 4YVWC 2DVDA 1BK0A 1WUVA 1PX4A 2ZMLA 2ARBA 3ZFEC 2BNNA 4QGNA 4Q4W1 2JDHA 3KV9A 5A3OA 5LY2A 1XB9A 4Y20A 1LGNA 4QXHA 3FE5A 4MADA 2WWSA 4A7KA 2ZEZA 1O91A 2EICA 2WWJA 5FPAA 1FMD1 5F6KA 3VV1A 5GZCA 3CNAA 1JZ5A 2FDFA 2A5ZA 1V6LA 2Z69A 5J36A 1F5FA 1ZVFA 2ZGSA 3IPVB 4FPCA 2OPWA 5FZGA 1YXWA 3PTRB 1NG0A 3TN92 3PJYA 1XRUA 4HKLA 3WDUA 3WX5A 5C3PA 2QQKA 5T55A 4GMP1 4CSWA 3JQWA 2PHUA 4YZ1A 2XBO3 4HK9A 5JI9A 2JWPA 5L9VA 4KG8A 2DBNA 2AENA 5FPZA 1DQ6A 1UD1A 3POBA 1BBT2 1UMIA 2AGSA 4MHRA 3VBSA 4COVA 2C6SA 5C3SA 3ZYGA 3HQRA 4ARYA 2WLQA 2ZXQA 1PO23 4A6OA 3NO8A 1MQTA 5CEHA 1UIJA 2R043 2QFEA 2BWAA 2VMDA 3ZXEA 4HANA 1CESA 3FHAA 1LNSA 2WNVC 3UKNA 1DIWA 4LBQA 1CAVB 1R093 1ULGA 5CAZA 4D6SA 3U78A 4QXBA 4UW6A 2CSGA 3VDDA 2E63A 2NZ9A 4UW5A 4YGEA 3RZJA 4XXPA 3RQ0A 1QQP1 1GR3A 1RUD3 2B45X 4FP3A 3SC7X 5K0UC 4YVSC 1STMA 5C4WA 3VBHA 1M06G 5G04L 4XUNA 1RMU1 2XDVA 2ILMA 2P1BA 4MZUA 3P6BA 4Z92B 5C3RA 3PMSA 3WF3A 4K6BA 4NHLA 2V72A 4HVQA 4H2AA 5BNPB 5BNOC 4YW1A 1S2KA 4LK6A 2HBTA 1HB4A 4LO7A 5J48A 1ND3B 1PM4A 1MVEA 1KJRA 1WLTA 3ZKUA 2DU1A 1Z0HA 3I3DA 2TUNA 1UYPA 2W1UA 3HEIA 4QAWA 1SFPA 4NWWA 5LW9A 4IE4A 1ZRIA 2WJSA 3GBGA 3T30A 2B9UA 3PU8A 1OLRA 3LDBA 3PVBB 2XB6C 3ZMOA 2GNDA 1QGLA 5A3LA 3LEMA 2WFF1 1TQ5A 3KSCA 1DYPA 2VMFA 4JAAA 1WLWA 1RUC2 2QCSB 1N1TA 1YQ6A 4GWIA 1PGSA 2QDNA 3ILFA 4FPYA 4INDA 5DABA 1ULFA 1RINA 4COUA 1H6YA 4J1XA 5FZEA 1VLNA 3U4XA 1KJLA 3ZSKA 1DP0A 3THCA 3TYJA 5EP9A 1UY3A 2RJLA 3RZHA 3CO2A 3WD5A 2JDYA 4OMCA 4GQ7A 4WV8A 1TMF3 3FHQA 4I3PA 1XE8A 2ZABA 3MEPA 3OEBA 5JMCA 2PQSA 1W6QB 2ZHMA 1BEV1 2A75A 4JDMA 4JZRA 2ORZA 3M8LA 2PLV3 3VZMA 2WQ8A 4LITA 4XC9A 4LK7A 1F8VA 4KBBA 5FZIA 3OBZA 1OA2A 3H0OA 4QX8A 1UOBA 3L9JT 4B7EA 4EQVA 2ZZJA 3BPZA 4BMBA 1IS4A 2RS51 4RS5C 2VUDA 4UFMA 1KRIA 2DUPA 1GNYA 1K5MB 2VCCA 3HNYM 2I45A 3KQ4B 5AVPA 4YVWB 4EN6B 3POSA 1O3SA 2BVVA 3ZYIB 3FLPA 3ZFEB 3ZXKA 3Q8FA 3JB8A 4HETA 1AR71 1GOGA 3LFMA 4OMDA 1JH5A 3LIGA 3AZWA 5HXVA 4CDXA 1XNTA 4OHZA 4ORFA 3VL8A 1C4RA 1EP0A 4GH4A 2C1FA 1J84A 4BE3A 1AX0A 1S55A 4XCAA 3LOBA 3KZ4C 3NMBA 2XBO2 3D8CA 4AE2A 3O1MA 4XFGA 3J26N 2VM9A 5JOYA 1IZ3A 4AVBA 4BQ5A 4MO3M 3MV01 4HLTA 1PO13 4Q0QA 5BNPA 4AF9A 5ABJC 3TEYA 4Q8KA 5AC91 4AEMA 1L7RA 2ZKNA 2PHXA 4XTPA 3J7NA 3FFZA 4UBHA 5FLJA 3RJ2X 1PO22 4UFKA 5IVFA 3VUOA 4TYSA 3H3LA 4CUCA 2R042 3IBMA 2C0ZA 1OURA 1QJU3 2P3IA 1R092 5FYMA 5C8CC 2YBPA 4XFFA 5DDJ3 4F83A 4AGVA 4XURA 3H8XA 2V5DA 3WDYA 2AZ5A 2WNVB 1QJZA 1N1VA 1RUD2 4CP9A 4B29A 2B4KA 2OW4A 3KQRA 5B2GB 4DS0A 1JTZX 1W2TA 1C8NA 2HWB3 4UF0A 2Y26A 4KWUA 4DEQA 2FCTA 1O59A 1GOHA 1RIRA 4RGGA 4YVSB 5K0UB 3VDAA
chains in the Genus database with same CATH topology
4FPOB 3WG1A 1LHVA 3N3HA 3JB4C 1U0AA 5BNOB 1RTVA 2RE9A 4EN8B 3S6PA 2UURA 3B5LB 3VKMA 1HIXA 4DY5A 3LSDA 2JDZA 4QQPA 1IOAA 1CX4A 3O5SA 1TME3 3T2TA 1LEMA 1AR91 4YVWA 3MLLA 3NAPB 1H2NA 2FHRA 1GYKA 3G6JB 5C6CA 1AXKA 1CN1A 1D4VB 1U5ZA 1I5ZA 4AHXA 5CA6A 1AR83 1CAWB 4Y1XA 3ZN6B 1TMF2 1TNFA 2X5IB 1BMV2 2EA7A 2D40A 4NHMA 1IKQA 4A3XA 4PBOA 1HRV3 2PLV2 4D7SA 3LGRA 5F1RA 1EV11 5HCBA 1IQAA 2A3XA 1APNA 1RUG3 4KWKA 1MS5A 3WZ1A 3ZSEA 3BOWA 4YFZA 1DF0A 2PQQA 1CD3G 1HRI3 2WLPA 3RRDA 2D7FA 2GMPA 4FPKA 3E6BA 1BJQA 1ENXA 1R1A1 2R6QA 1LJ7A 1X82A 1NCQB 4NO4A 3TNPB 4E2QA 1YWKA 4RS5B 2RM21 1D4M3 2XJTA 5JOWA 2Y38A 1LR5A 4B4QA 4CZSA 2VOVA 4F8AA 2D6PA 2WT1A 2EXJA 4LEJA 1YFYA 3FUOA 3KMHA 1FPN3 2D6KA 3GBFA 5KXCA 4DRRA 2GMEA 3AZVA 1DYKA 4Z07A 4I0BA 4F3JA 3OBRA 4YGCA 4OLLA 2DCTA 4G4FA 4HKWA 5K0UA 1DHKB 4YVSA 1LOAA 3SCFA 1PO12 2VG9A 2VMHA 2XLAA 3ZXDA 3N4MA 1HXS1 4IESA 5CB7A 1XE7A 1S0CA 5T5JA 3M4FA 2OPKA 4URTA 4NR1A 5BNOA 4EN9B 5ABJB 1H8TC 5IK5A 2GNTA 4C1XA 3MYXA 1LOFC 3OJBA 2X8KA 1QJU2 4GMP0 4L9BA 5LK7B 3J8F3 4E4SA 5DDJ2 2TNFA 3MFCA 3IWZA 2PTMA 3VBUC 2HWE3 4DXZA 3V0BA 5C8CB 3CF6E 4XHBA 5BNNB 3AYDA 1YLLA 2HWB2 1RJ7A 2QZ2A 4RFT0 2PAKA 4I0AA 5CADA 4AWDA 2Z42A 1QJX1 3NV2A 1SLBA 4AQSA 4YM3A 1YUDA 2C9AA 3S7EA 1QXPA 2DFBA 1GNZA 1C5HA 1HDKA 4Q4X3 2OZJA 4IEVA 3T1LA 3V56A 4IV1A 3W59A 2TEPA 2XWJB 3AKPA 1C1LA 4QT6A 4LBKA 2VXRA 1TME2 1VBA1 2KXLA 2GAUA 3HD8B 2AR6A 1FNYA 4MXWB 5CG8A 2WQ4A 1WMEA 2CV6A 2I2SA 3HT2A 3QH7A 4Y4YA 4RS5A 3J9SA 3AP7A 1HQWA 1X50A 4EV0A 2AH2A 4HL0A 1AR82 1URXA 3ECQA 1V6OA 3D5OA 4B4PA 3ALQA 4IV3C 2ZGQA 1N3OA 5DUWA 2GALA 1AYN3 1Q5OA 3KGZA 2YYOA 3MICA 1HRV2 4BPZA 1RUG2 1RUNA 4C90A 3KCYA 4YW4A 5IT6A 1VAMA 2WKKA 1HRI2 3JUUA 1Q43A 2BGCA 4RHV3 3U10A 5BYNA 2ZZQA 2UWBA 1Y9QA 2YY1A 1XNDA 3AMNA 4XMIA 4XQ4A 1J3RA 1MS9A 2O0OA 4PLNA 5A32B 1IGOA 1JN2P 2VNGA 1J1TA 1D4M2 4JTOA 1DQ1A 3M3QA 2EAAA 1KD7A 1C8M1 5J7MA 2HEWF 4G9SB 3TN91 5L19A 1QKQA 4C0BA 3AZZA 1KFUL 1UU4A 1MZEA 2DURA 1FPN2 3NVCA 3USSA 1IS5A 1N47A 1S0JA 2VVFA 5FREA 4IEWA 4DZGA 1FATA 2R063 2JECA 4HZFA 3RMXA 1QOSA 1ULEA 1ALYA 5JIAA 5A33A 4XTMA 1OMIA 1BBT1 4N43A 4MVTA 2JJ6A 1CJDA 4L97A 1CIWA 3VZJA 5BXXA 4AGGA 2IXHA 4M0HA 1N1SA 4AG4A 1SLTA 1GBGA 3VBSC 3MLKA 4CDQA 2Z2SB 3SITA 1MQTC 3J8F2 2VOWA 4UBGA 1SLLA 1BVVA 4IL7A 1M4WA 1UIKA 3AYEA 1EAH3 2ZGPA 2R0HA 2HWE2 4H7MA 4HN1A 4FQ4A 1NLSA 3RDIA 3N35A 1MS0A 4LHKA 2OYZA 2ET7A 3VBUB 5C4WC 2MEV3 2RS13 4K7JA 1W6OB 2A3YA 4P9JA 1REDA 1JUHA 1O4ZA 5KHJA 2ZGMA 2XJSA 1H1IA 3FBYA 2WFPA 3OPZA 2WZR3 2WNEA 4A2UA 4Q4X2 4PJYA 1D2QA 1LODA 1QXRA 4IERA 3ETQA 2ZGRA 2GC1A 2PN5A 5T52A 2EXIA 1ULCA 1RUC1 4LUKA 2HEYF 4ZKTB 4CDWA 3WDWA 4RL7A 2ZACA 2R49A 3B00A 4QGMA 1HX6A 1F31A 3M3OA 1YYNA 3SCHA 1GZWA 5A32A 3KLSA 1BXHA 5GZEA 4XF1A 2XJVA 3D0SA 1EPWA 3FJSA 2VECA 4LA2A 4AI3A 3IKWA 1D0GA 4E4ZA 4W6WA 3H1WA 4QD2A 3WW2A 3INAA 4WVMB 4XJZA 4ATFA 3MF6A 5EYXA 3WW3A 4AXOA 1AYN2 4XFHA 1YFXA 5GZGA 2ZX4A 4XMAA 4IV3B 4AFBA 1IPJA 4KGGA 1RGSA 3BALA 3SISA 1RUJ3 4OZXA 4PQ9A 3WQ1A 3D82A 4JRAA 2B46X 3JZVA 4RHV2 1W2UA 4Q0PA 4R8HA 3ZSJA 3WDVA 1ZZBA 3RZZA 1I3HA 4HK8A 2LTNA 1CAUB 1ZZ8A 4MGIE 2IFWA 1AXZA 4FO9A 4GB33 4RA0A 4ASMB 2WINB 2YUEA 1H8TA 1U12A 1QXJA 4OUMA 4YM0A 1NOVA 3JU9A 1VALA 4Y20B 4NOTA 4H3WA 3SHRA 4CDXC 1MZFA 4CP1A 2XBO1 5L36A 1QNWA 1W6NA 2JEMA 1BVP1 3TWIA 3EBRA 2R062 4GH4C 2Q4SA 3E5UA 3VBUA 1OA3A 5FDBA 2Y0IA 2GU9A 1NY72 4HN0A 1WLDA 3NL1A 1VBB3 3GHNA 3I54A 1B09A 4P14A 5DZGA 3R4UA 1DFQA 2VMIA 1LTEA 1PO21 3PHMA 2D97A 2D6NA 2R041 2YDEA 4HSJA 2BWCA 2RR13 4XBQA 1UN1A 4YFWA 2W39A 3G7DA 1R091 1AR63 2HYKA 3AFKA 2WNUA 3VHPA 3RI9A 5F9TA 3RJRA 3VBSB 2W0XA 2YXSA 4QGLA 2CY6A 4FP2A 1EAH2 4EWAA 2CGNA 2E9QA 1MQTB 2ZGNA 4YNIA 4OUSA 1LRHA 1OKQA 4XJ9A 2Q30A 4LE3A 1OQ1A 4FT8A 4LBQB 4X6QB 5JSPA 3E6DA 4L11A 2WZPP 2RMU3 2MEV2 1HV1A 1VRH3 3I4IA 4HT1T 4YLZA 3VDDB 3ILRA 1LGCA 2RS12 4M00A 1NLRA 4E9KA 5C4WB 4ONUA 1WMFA 2I74A 1NA1A 3A0NA 1POV0 5KHIA 2ERFA 4MYEA 2WZR2 4JC1A 4LBQD 2LUWA 2R16A 3AXEA 3VBRA 4ISQA 3ZYPA 1EPZA 4OULA 2QKDA 1FX5A 3PVEA 3MI8A 4DPNA 1YFUA 4I09A 4YG3A 3R4SA 5D1IA 1AUYA 1ENRA 5JPMB 1XQNA 3MW3A 2Q1ZB 3DUIA 3RWNA 1XYOA 3AMPA 1SFYA 2BFUS 5BPXA 1BKZA 4N9HA 2O8OA 4JGZC 3WLUA 1C28A 2IZWA 1SLCA 1TMF1 4Q2FA 1X36A 5E16A 1BMV1 2ZX0A 3AKQA 4G3YC 2EVXA 4I30A 4WZFA 1YJKA 2PLV1 3MLJA 5SV5A 1NZCA 2UY8A 5CVRA 4KGQA 4PCRA 3AP5A 3O14A 4QPGA 1RUJ2 1V00A 4NN0A 1DZQA 5FMOS 2D93A 2UU8A 4N9IA 1RUI3 4FSJA 4CEWC 1ASJ3 1U5XA 4BMEA 4OHVA 3ST7A 1PK6C 1V6MA 3B94A 3MDPA 4GB32 1COV3 1UZYA 2E7QA 1LOGA 4XFAA 5JWPA 4DOUA 5FMOL 5JZGA 4MH0E 4R4ZA 5FO8B 3BTAA 4XIKA 4EJRA 3ZIWA 4X6RB 2ZKLA 2VOXA 1DZRA 3EO6A 4M3CA 5GALA 4XF3A 1GICA 1PO11 4YGBA 1G7YA 3ENRA 4KU7A 4CDXB 1UU6A 3B9IA 4Z8BA 3HQXA 2E51A 2JE9A 1VBB2 4GH4B 4D7TA 3V0AA 3SLIA 4YW2A 2B7YA 2WT2A 1UX6A 3WDXA 2ZGOA 2YGLA 1XYNA 2RR12 1QJU1 2ZX1A 4Y5Z0 1AR62 4Z82A 1S0FA 2HWD3 5DDJ1 3LA3A 4FXGB 4O9GA 3NV1A 3D4KA 3SH4A 1Z7S3 5EWSA 4LLFA 3ZN4A 5L73A 2R1BA 1LOEA 1MR5A 2IFRA 3ASIA 2BBVA 2Q8OA 2RMU2 1VRH2 4AGRA 2ZAHA 4IXLA 5I0RA 1SACA 3VN4A 4XEZA 2BPA2 4HVOA 4JVAA 4N7IA 4BM8A 5J3UA 4AQ2A 1SCSA 1CAXB 2HWF1 2V09A 3MW2A 3OTFA 4Q1RA 3WDTA 1UW8A 3ZPYA 1QH6A 4FOVA 4COZA 2HJIA 5BY5A 1UKGA 5EZWA 2F6BA 2VQ0A 2XGXA 4MGKE 2WA3A 2GN3A 4IV1C 2VULA 4QQLA 1J59A 5JOXA 5E89A 4OHWA 2ZHKA 4E27A 3IDCB 5EJ3A 3B01A 1AR81 1XNCA 4FTSA 3ZFFC 4XILA 4IEPA 5E1RA 4RQPC 5FTTC 1S0BA 5IK8A 3HBZA 4LO5B 5I0TA 1QMJA 4XE9A 4JV4A 2GSYA 2MPFA 1D2SA 4AI8A 1JOJA 4WM7C 5BNQA 1QU0A 5IK4A 3FMGA 5GM0A 1HRI1 4EWDA 5K8SA 5EYYA 2DU0A 2RS33 2JXAA 1WA4A 3ES4A 2XVKA 3HMYA 5CNAA 5GZFA 3WHTA 4I2OA 3VKFC 1RUI2 3CJXA 4BIFA 2NLRA 1ASJ2 1DGLA 1YJLA 3KM5A 4E2GA 5T5LA 1NQJA 3LA2A 4XQDA 2PAEA 1YFWA 1COV2 4CEWB 4PIXA 4MV2A 2R1DA 4BQ1A 2X53S 1OPMA 1TNRA 4ZU7A 1PK6B 2XLFA 3OGJA 4BLIA 1QY4A 2NM1A 1FPN1 1LCLA 4RD7A 1V6IA 1O3QA 2O8QA 5T54A 4KU8A 2ZS6B 3OYWB 4P5HA 5J96B 3BU7A 5FCCA 1PGW1 4PIYA 4UW3A 1SQ4A 2OUJA 4Y22B 1UU5A 5FFOC 5KXEA 2AUYA 2AYHA 1REFA 4N43C 1CAXA 4BCUA 1WW5A 1H9WA 1LENA 2DF7A 1RMU3 2PELA 4FPGA 5H9RA 3JCIA 3VKNA 2E53A 1DGRN 3M7AA 1ZYBA 4YSFA 2P17A 4GKYA 5JCTA 3J8F1 4QX5A 4QQHA 4XF9A 3TB0A 2HWD2 4Q0UA 4Y24A 5SV8A 4Q26A 1NXMA 3NKGA 4CDQC 3IT8A 1U5IA 2HWE1 1Z7S2 2XVLA 3MIDA 2DTYA 3LCPA 4I02A 4S2FA 4AQ6A 4DY3A 2Q0AA 2ZA9A 2XJPA 2JG8A 4QU2A 3RYPA 5JSOA 1WD4A 3WP3A 2QE3A 3NV3A 1GFF2 1Y3TA 2LALA 1LOCA 2BYVE 2VU9A 4FXKB 4BH9A 5FQ0A 5C8WA 3V0BB 4JGZA 1IHMA 3QH6A 2P37A 3OGGA 2CWSA 1Z78A 1W6MA 4AFMA 3AXDA 4JDNA 4Q4X1 1UPIA 1CR7A 2FZ2A 4BA6A 3KD4A 5K9YA 1QJY3 1RJ8A 5E8AA 4Z2WA 4B7KA 1C1FA 1CGPA 1PNGA 3TOJA 4CP0A 4DMIA 3WG4A 2IXLA 1UAIA 4YARA 2XJQA 3URFA 4CDWC 2OUHA 4EROA 4W65A 1DZTA 2DUOA 4AHWA 4YG6A 3PVNA 4IV1B 4CEWA 1PGL1 3R05A 2XLGA 1XYPA 4JGYA 1PK6A 3D6EA 3MW4A 5BUVA 4JDOA 5LEKA 1UF2C 2XL9A 3WQ0A 4RSUA 3W58A 1AYN1 1IPKA 1GZ9A 1Q8PA 2WC2A 3QBQA 3OYWA 3E97A 2ZGTA 4LA3A 2XPJA 3WXPA 4LR4A 2GDFA 5ACA3 1VBE3 2DVBA 4RHV1 4Y22A 3FLRA 1REEA 2RS32 3PVOA 4WM7B 1VAKA 1G9CA 2XKOA 2XVGA 2MHFA 2D6LX 2ETEA 1CPNA 1SLAA 1ZZCA 1X8EA 1CONA 4Q0VA 1MS4A 3WP5A 4TWTA 1ZBA1 2QZ3A 2WS93 1I6XA 3R0RA 5I0SA 2W68A 3KB5A 3OY8B 1MEC1 2FMYA 4FCAA 5E88A 5F5QA 2GNBA 3R6SA 2CNAA 5AC93 2H0VA 2QVSB 3EHKA 4Q1PA 2A71A 4AI1A 4PBPA 4PLMA 4Q4V1 5KWRA 3ACLA 3M2MA 2R061 5GLVA 4TZDA 1KFXL 1NCRC 2VPVA 2GC3A 5GJ6A 5H9QA 1NY71 3WP4A 4XIOA 3FUQA 2EALA 3EQEA 1WBLA 2GH2A 2YPJA 2QUOA 1F2NA 1VBD3 2DTWA 1CQ9A 4D7YA 1DDLA 2DVGA 1RMU2 1AVBA 2IC1A 2ET1A 5A33B 4AFCA 1ZRRA 4N43B 4KQ7A 2EAKA 2QNKA 1V6KA 4DNYA 4S2DA 1YIFA 1EAH1 1AHSA 4XQWA 1UL9A 1DQ5A 2WNUC 1SFNA 2D44A 3VLBB 3AMHA 1H2KA 4WVZA 3JD73 4CDQB 2CAUA 5FO9B 2RS11 2P2KA 2Z5WA 1LOBA 1MS1A 4I01A 1PZ8A 2CYFA 1HQNA 4L2NA 3ZFFA 5JAXA 1AR93 4GWMA 3VZKA 4RQPA 4ISRA 3E5XA 2WZR1 2PHFA 4MGYE 4OVEA 2DCJA 4JRLA 1XNBA 1QJY2