2ZHMA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
143
structure length
143
Chain Sequence
SQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 37
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhmA00
4FOYA 4FOQA 3VKMA 3SH4A 4YFZA 1GBGA 1ULEA 4XMAA 4FOVA 2VY0A 2ZGMA 1Q8SA 4UW6A 3LCPA 4BLJA 5CAZA 4IQPA 5T55A 4YGBA 2FMDA 2NP0A 3SITA 5JOXA 2A3WA 2CYFA 2DVGA 1WW5A 4GKYA 4Y24A 3MPPG 3WUCA 4XXPA 2OVUA 2P3JA 2GDFA 1H9WA 1ULDA 2OW4A 4LBQD 2VU9A 2VW2A 2ZHLA 1FNZA 3W59A 4LBJA 4LBQB 3C2UA 4WV8A 3M3OA 1DQ1A 4Q1PA 3OYWB 5AVAA 1KDKA 1LJ7A 3ZYRA 4FOWA 2ZMNA 2W39A 4FVVA 4XBLA 2GNDA 4H55A 3QLQA 1HQLA 4R9DA 5DUUA 1CONA 1KQRA 2WNEA 3V0BB 3LSDA 3BODA 1F5FA 1I1EA 1C4RA 3FFZA 5CBLA 3HMYA 1WW7A 1MACA 1ONAA 1SFYA 1UKGA 2OUJA 4XBQA 5F9TA 4FPHA 3WG2A 1HLCA 1DLLA 1LGNA 4Q26A 2DVAA 5LK5A 5T54A 1DZQA 5T52A 1MS1A 4JRAA 1SLTA 5GZGA 3ILFA 1WLDA 1R1ZA 4UW4A 1W6PB 3AZWA 2LALA 3RG0A 2WT0A 1H30A 2YZ4A 1GZ9A 5DXDA 2GNMA 3N7MA 2ZHMA 3AFKA 1J1TA 1W6QB 1OKQA 4AGGA 3SH5A 4XJ9A 4YGCA 1Q8PA 1G9CA 3V0AA 3R4SA 1ULGA 1LGCA 5T5JA 1SBFA 2V5YA 1YYNA 3AYCA 1PZ7A 1IOAA 3ZXJA 1Z0HA 2AYHA 2P37A 1AXYA 4XIKA 4Y1VA 5EYXA 3VKOA 2EIGA 2DU0A 1QKQA 3B9CA 1D2SA 1V6JA 3USUA 4DS0A 1UPSA 3WHUA 1WD3A 2AGSA 5GLWA 2GN7A 2EF6A 5JDBA 4M3CB 3OY8A 1FV3A 4YW2A 2DUOA 1SACA 3AP6A 1LECA 1URXA 4YG6A 2SLIA 2RHPA 1LOEA 1GANA 3ZSMA 2ZGOA 2ENRA 1A78A 3IMNA 3TB0A 5JOWA 2JJ6A 3POYA 3RMXA 5HCAA 1UX6A 2D6OX 2UURA 3DUIA 3O0XA 1CPMA 1VAMA 3V65A 4YM2A 1Y7BA 1JUIA 3Q9OA 1BYHA 1NLSA 4F83A 2D3RA 3GNEA 1LOCA 4HANA 5DUVA 3DGTA 3SLIA 3WG4A 4UW3A 1V6NA 2C9AA 4P14A 4LBMA 2E53A 2ZHNA 2ZGSA 4U36A 5IK7A 2H0BA 1CESA 2E7TA 1QMJA 4XYXA 1AX0A 5GLUA 3TAYA 5GZFA 3D5OA 5GJ6A 3N35A 3VKLA 2ZA9A 1WCSA 4D69A 2DTWA 1LHVA 3HN1A 3N7KA 1AJKA 2VH9A 3R05A 3I8TA 3NV2A 1LU1A 4Y20A 4P9WA 4C1XA 2UWCA 3M3CA 1APNA 1SLBA 1RINA 1WLCA 3AYEA 3WDYA 4AVSA 4Q8KA 4YZ2A 2A6ZA 1MS5A 2E51A 1GNHA 1W6OA 4YLZA 1G9DA 1JYIA 2AENA 3WNXA 1ULCA 2CL2A 2D7FA 4YZ4A 3N36A 2W08A 3WCSA 2EXIA 4BM8A 2I2SA 4NO4A 1DYPA 4Q27A 4WVVA 4XHXA 1LENA 3ILRA 1ZA4A 3OBTA 4XOGA 5DUWA 1SCSA 5GALA 3AYAA 1WUVA 4Y1UA 1I3HA 3WG1A 2CNAA 3AP7A 1LHUA 2ZGUA 4Q1RA 2E6VA 5SV8A 4YFWA 1DBNA 5CA6A 1YI7A 4JCKA 1W6QA 4YZ1A 5H9QA 2DU1A 1LHWA 3A0NA 1MS9A 1N1VA 2DVDA 2EAKA 4XMIA 2YMZA 4AGRA 4XJAA 3U4XA 1YIFA 2DYCA 4K1ZA 3UJOA 1A3KA 1O4ZA 2UWBA 3VKNA 1OQ1A 2UWAA 4Q8LA 5BYNA 4YGDA 2G4IA 3FBYA 1IKPA 1ENRA 2ZABA 1W6MA 2D43A 2SBAA 4P9YA 1SBEA 3PMEA 4YW1A 3PJQA 3UJQA 5JLVA 3A4UA 1GZWB 4AYUA 2Z42A 1JW6A 4KBBA 2R16A 2GNTA 2YY1A 2VXRA 4XJUA 4Z8BA 2ZAAA 2UU8A 1N47A 3FLRA 2ZGNA 4SLIA 2EXKA 1BKZA 1VAVA 1F9KA 2AR6A 1W6NB 2PELA 2A6YA 2AREA 2NMNA 4M3CF 2ZMLA 1LOAA 3WHTA 1YRZA 5GZDA 1C1LA 3T2TA 3M2MA 1DHKB 2ZACA 1WLWA 3ILNA 1GSLA 4YW5A 2ZGPA 1LCLA 2ZGKA 1MZ6A 1VLNA 1LOBA 4YG3A 1LOFA 4JC1A 3UK9A 2XB6C 2ZZJA 3IPVB 3WDUA 3JUUA 2A71A 2GMEA 3ATGA 1G86A 1HQWA 1MR5A 1GZCA 2E7QA 2OUHA 3AX4A 1CQ9A 5EYYA 1G9FA 1JXNA 4ITCA 4Y22B 2ZGRA 3AK0A 3AYDA 1HDKA 4YZ5A 2KM2A 4CTEA 3PVEA 4AVVA 1LODA 4NOTA 4XXAA 4DRVA 2A5ZA 3WCRA 1WD4A 5DZFA 1IS6A 2W52A 5GZEA 2EXJA 3AJZA 2DURA 1AZDA 2P34A 1AX1A 1CJPA 2VW0A 3N7LA 1CPNA 2CTVA 2GNBA 4LBNA 1IKQA 2NMOA 3KM5A 4PF5A 3ZVXA 3I4IA 2JE9A 3O12A 3ZPYA 4M3CE 2EALA 3ZSJA 3O5SA 1S0GA 4K1YA 4LBKA 1PZ9A 4XTPA 1YO8A 3OPZA 4DFSA 2NN8A 1G9BA 2R0HA 3WDWA 5IT6A 1WW4A 5CB7A 1UZZA 3N7JA 4BOWA 4YG0A 1IS4A 3B01A 1S0CA 3W58A 1G9AA 5JOZA 1ENSA 1GKBA 4FPFA 5EXOA 1LESA 1JN2P 4YM3A 3O0WA 1UN1A 3WDXA 1JHNA 1CIWA 1H9PA 1FX5A 1GV9A 1V00A 2GN3A 4FQ4A 3T1LA 2P2KA 4RA0A 3WZ1A 2R1DA 4UW5A 2A3YA 4GWMA 5GM0A 2D3PA 4WVWA 4XE9A 3ENRA 2NYYA 2W68A 1JYCA 1C57A 2A3XA 1SBDA 1W0OA 4FP2A 3FLPA 4LBQA 3JU9A 4FPOB 4FPYA 4YW3A 3OYWA 2PHWA 4XILA 4U2AA 3B3QE 5F5QA 5T5PA 5DZGA 3WDVA 3ZXEA 1LU2A 2DUQA 1DGLA 2ERFA 1N1YA 3ZXFA 1VIWB 2DUPA 3AP5A 4BQ1A 4BPZA 3V0BA 1N3PA 2R1BA 1S0EA 1DQ5A 3V0AB 1LGBA 1G8WA 1MS3A 1VALA 4PBOA 4YZ3A 1LHOA 3RSJA 1X50A 3RS6A 3OJBA 1BJQA 3GALA 5GLVA 4XJWA 1D0HA 1W0PA 3FUOA 4YW4A 4Y1ZA 2CWSA 3USUB 1N3QA 4HL0A 3QCWA 4TZDA 3ZYPA 5JMCA 3WDTA 5FRAA 1W6PA 2NZ9A 3L2YA 3OY8B 1XQNA 2D6PA 1LTEA 1ZM1A 1DQ2A 2R49A 1AXKA 1QDCA 2A6WA 1SLLA 1U0AA 2FHRA 3RQ0A 5HCFA 1UAIA 3BOPA 3WV6A 4GWNA 1DQ4A 1S0DA 3NV3A 4DRRA 5DG2A 2WKKA 5KXEA 3IKWA 2ZGLA 2ZKNA 3KQRA 3BTAA 3MW4A 3VUOA 4FQZA 1O4YA 2LTNA 3ZSLA 3POWA 3RMYA 1MS8A 2DWRA 2ZHKA 4FP3A 1LHNA 4BLIA 1Q56A 3OBRA 1QNWA 1KJLA 2WQZC 3B69A 1GICA 4FPLA 4M3CA 3APBA 1TEIA 1QOTA 1NXD1 1Q8QA 3VV1A 3WLUA 5GZCA 2DV9A 3INAA 2XG3A 1DYKA 1IS5A 1C1FA 2EXHA 1MZ5A 4ZKTB 1LOFC 2P3KA 2ZGQA 3MW3A 4XZPA 4GKXA 5T5LA 3O0VA 5DG1A 3AJYA 3FLTA 4PBPA 1LEMA 5KXBA 1Z78A 1B09A 3ZXLA 4XBNA 2A75A 1DFQA 2NM1A 1S0IA 4MYEA 4YM0A 3POSA 4GA9A 4K20A 1AX2A 1S1AA 4Y20B 5KXCA 1KITA 1MVQA 1JOJA 1DIWA 2YV8A 3N3HA 1AXZA 3CNAA 1QF3A 4FPKA 3SNMA 5H9SA 2PHXA 4BMBA 1BZWA 2HYKA 2PHRA 5GLTA 1WBFA 4I30A 1DQ6A 3AP4A 1GYKA 5JOYA 1DQ0A 1QU0A 2DVBA 4GXLA 5T5OA 5T50A 4XJ8A 4P9XA 1W6OB 5DZEA 4WZFA 1V6LA 3AXDA 4L8QA 4R9AA 5DUXA 1QOOA 3M3EA 1OFSA 2PHTA 2Q5TA 3A0KA 5IUQA 2GALA 4W65A 3WVJA 4AGVA 4OZXA 4ISQA 2JDZA 2JE7A 1FAYA 2ARBA 2D6KA 3NWKA 1LEDA 2WJSA 5IK8A 1FYUA 2R0FA 2VW1A 3AP9A 4YM1A 2VUAA 4TYSA 3T1MA 1MS4A 2YXSA 4XDQA 2ZGTA 5IK5A 1BQPA 4RL7A 1ENQA 1GLHA 1JBCA 2ES3A 3PVOA 2D6LX 3PVNA 4Y1YA 3WG3A 4LBLA 5E8AA 2ARXA 3R4UA 1S0FA 3HR9A 1KDMA 4FPCA 1N1SA 3MW2A 4AWDA 1G7YA 1W6MB 3AZYA 4R9BA 2PHFA 2WT2A 4CZSA 1PZ8A 1RIRA 1S0JA 1SLCA 2JECA 3B00A 1UL9A 2CY6A 3OGGA 4AVTA 3VKFC 5EWSA 5KXDA 2WSVA 4DQAA 1YXWA 2B7YA 5JVVA 5FREA 3AZZA 5E89A 2WT1A 2JKBA 3WOGA 1AF9A 1SLAA 4FPJA 3ZXKA 5IK4A 4Y1XA 2TEPA 4ZXKA 2P3IA 3IN9A 1QGLA 3H0OA 4FPGA 1V6OA 3V64A 1WBLA 5H9PA 4ATFA 4K21A 3WUDA 2C5DA 1UZYA 1GNZA 2A70A 1UMZA 1A8DA 2PHUA 1Q8VA 5E88A 3ZSKA 2DVFA 3UL2A 4R9CA 2AUYA 4XTMA 1LOGA 1QNYA 2GMMA 1CVNA 2ZMKA 2WSUA 2A6VA 4ATEA 1F31A 1V6MA 2D6NA 1EPWA 1SLIA 1GZWA 2V73A 1ULFA 4GALA 1LULA 4XHBA 1AVBA 3BIWE 3SH3A 1N1TA 3M1HA 2D3SA 1WW6A 4PQ9A 3D4KA 4XJZA 5CNAA 2BQPA 2WLQA 3RRDA 4FPEA 4ISRA 1Q8OA 4LBOA 3D6EA 3AZVA 1W6NA 3AXEA 4M00A 2DTYA 1FNYA 2D6MA 3ASIA 1SCRA 4M01A 4Q2FA 4PCRA 1FV2A 2D44A 2GMPA 1BXHA 2AH2A 5GLZA 1FATA 1V6IA 2A6XA 1AJOA 3NV1A 4XIOA 4ASMB 1QOSA 3NV4A 1CN1A 1N3OA 1HKDA 1RITA 3SISA 4DPNA 1MVEA 1MS0A 2JD4A 2CWMA 1QDOA 4BMEA 1CR7A 4CRQA 3M3QA 1KRIA 3MEPA 2YROA 3IM0A 3AZXA 3IPVA 4YGEA 5HCBA 4Y26A 4C1WA 1KJRA 3FUQA 2A7AA 3LSEA 1S0BA 5H9RA 2ZBJA 1IS3A 1V6KA 4Y22A 5L73A
chains in the Genus database with same CATH superfamily
4FOYA 4FOQA 2D5HA 1ULEA 2E32A 4IE0A 4XMAA 5C9AA 5J1XA 2ZGMA 3LAGA 4QU1A 3LE0A 5FLHA 3ZFEB 3IDBB 3NW4A 4N7IA 4MH0E 4IQPA 4IUGA 2ILMA 1VR3A 4AAPA 4IV1B 4E27A 3TN91 4D7TA 4JDNA 3SITA 2A3WA 3DV8A 2DVGA 4HXCA 1POV1 3ZIWA 2VM9A 4QU2A 1CIYA 5A7NA 4IE6A 4XF0A 3ZM8A 3HQRA 4ES9A 3ZYFA 1MQTA 4WBBA 1H9WA 3U10A 3GGLA 2EIDA 2VU9A 2VW2A 4HONA 1FNZA 4ET7A 3W59A 1AL22 3CBNA 2RM23 3C2UA 4LBJA 1EAH1 4WM7C 2RG4A 4EWAA 1YFUA 1JZ5A 1XE8A 1LJ7A 1PK6B 3G7DA 3ZYRA 2WFPA 2V4VA 2ZMNA 4XEZA 5A70A 5DMYA 3H8OA 2XMLA 3U78A 2RS31 5C5TA 3CMGA 3QLQA 4R9DA 4CUAA 1CONA 1RUH1 2WNEA 2ZTNA 3NNGA 4HKWA 4P5HA 4A41A 3CDZB 2HLEA 4Q0QA 1I1EA 2AEZA 1O3SA 3HMYA 1YC61 1JZ2A 1WW7A 5IFTA 1PO13 4NPLA 3N9QA 5FBZA 3WP5A 4CUGA 4F3JA 1HLCA 1LGNA 5LK5A 5T54A 3B5LB 4KWUA 2WS92 1TE1B 1JI6A 2WWUA 3RZKA 2P6CA 1ODMA 4N53B 5BNPC 3Q8CA 1XB9A 2B9UA 5LBCA 1W6PB 1GP6A 2LALA 2XBO3 4PI2A 4TXWA 3RG0A 1ZZCA 2CGPA 4NIDA 5F6LB 1NG0A 4PQQA 1SEFA 4AI0A 1H8TC 3NNLA 2VZSA 2ZHMA 3AFKA 1EUTA 4QX0A 4XJ9A 5FY7A 1R1A3 4YGCA 1G9CA 3VHRA 1KEXA 4RS5B 1WCUA 5T5JA 1PIV2 1SBFA 3AYCA 1O59A 1YYNA 4ORFA 4V1PA 5C4WC 1PGSA 1Z0HA 5BNPA 2AYHA 2P37A 4MLOA 3ZFFA 5EYXA 3AKRA 1RC6A 2HWF1 3B9CA 4IE7A 4BDVB 2BFUS 1HJGA 4Z2AA 5BNNB 2HWD3 1UW8A 1VBD3 1H1MA 1H8TA 2GN7A 1RJ8A 3NNJA 4O9EA 5FMOS 3B93A 4CP0A 2EF6A 3NJVA 1BBT2 1RXFA 3PLQA 2XVKA 3UGGA 4XAEA 2ARCA 1SACA 3PIGA 4MZUA 3UV9A 3UNPA 5F5IA 1RUD2 2VO5A 2V72A 5C3OA 3O1MA 5C4WA 2YDEA 1C28A 4IE5A 3ZSMA 4AG4A 5I0TA 2J1EA 4N43C 1R083 1YNAA 3TB0A 4A7KA 1PO23 5HV0A 2D6OX 4BQWA 2WAOA 2QQPA 3WEZA 2E33A 1QJU3 4GH4C 3D3AA 1W8NA 3I2OA 1RUJ3 3V65A 4YM2A 5ABJC 2HJIA 2P5BA 5A7SA 4F83A 1VRBA 2JD9A 2D93A 3P1IA 3VBUB 3ZXDA 5DUVA 4XCBA 5I8YA 2IXKA 5JR2A 1BEV1 4COVA 4D6SA 5FYZA 1YHFA 1BHGA 3VBRC 2PQSA 5JSRA 2C9AA 1US3A 4LLFA 3RYRA 1W8ZA 2ZHNA 2ZGSA 3KCYA 1OD3A 3MF6A 5DQ0A 3C3VA 2L9LA 1TQ5A 5FZOB 3QBQA 3D5OA 4RN5A 5GJ6A 3RI9A 2VBBA 2WQ8A 1X7NA 1RUE3 2W2IA 3POIA 4Q0UA 5FCCA 3BI3A 5D8AB 1J1LA 1HRV1 1NA1B 3EBRA 2Y26A 3VBRA 1LU1A 1QHDA 3FHQA 2UWCA 1PK6A 4OI1A 1APNA 1NCQB 2PAEA 2QE3A 1K12A 3JQWA 1WLCA 3LFIA 4LHLA 4W6WA 2I45A 4LMFA 1WCDJ 4UAPA 5AC92 4YRDA 2ZX4A 4OI4A 3NNMA 4OVEA 5JOXA 1ULCA 1QJY2 2D7FA 4YZ4A 1CZSA 1QJX2 1W8UA 3N36A 1EV12 3OF1A 4BM8A 5CEHA 4LIVA 4NO4A 2PA7A 5DUWA 3ZYJB 4H7MA 5JSPA 2K2SA 1JZ8A 4PIYA 1AYN2 3AYAA 1UIJA 4Z92B 4TSVA 2BWAA 4CP9A 4I2OA 1I3HA 2VCMA 1SZBA 1DGWX 4OI0A 1UYXA 3MYXA 1H6YA 1DBNA 5A80A 5JZGB 2VG9A 5H9QA 4UI9L 1MS9A 2F17A 4AGRA 3MFCA 4XJAA 3I3DA 3BTXA 3SCGA 3OG2A 3UJOA 3FWEA 2XHNA 2HWC2 2UWAA 1TZOA 3BU7A 4Q8LA 3VDCA 4QDQA 1UPIA 1IPKA 1J58A 2GH8A 1NKGA 3AMHA 1NLRA 1AL23 1W6MA 2D43A 2MPFA 1SBEA 3PMEA 4HMZA 1TMF1 3PJQA 1A34A 5C3RA 2YU2A 4SBVA 3POGA 2GNTA 2YY1A 3KT7A 4Z8BA 2ZAAA 3KCCA 3H42B 3ZN6B 4NN0A 2VMGA 5LW9A 2ZGNA 4SLIA 1XRUA 4AI8A 3JB8A 5LASA 3OGSA 1DGWA 5F3GA 3WF1A 2EXKA 5C8WA 3RZGA 2IUWA 4OMDA 3CHXA 5B4NA 2IXCA 4RR3C 2PELA 2A6YA 2LRPA 2AREA 2XJTA 4IEYA 5E6HA 5C5UA 3NNFA 3ZOIA 2NP0A 3NJZA 4DXRA 4E8DA 2WS93 4LA2A 3C7GA 4P9LA 1WLWA 3ILNA 3VBFB 1UU6A 4XUNA 4HKLA 4BIOA 2EICA 3VL8A 1VLNA 4OUMA 1DCSA 4YG3A 4JC1A 2XB6C 2ZZJA 1CAVA 4RR3A 5LY2A 1JHJA 1GZCA 3HEIA 3AX4A 4FAGA 1CQ9A 3TNPB 5JXGA 2PN5A 4MXVA 2CGOA 1UZ0A 1RMU1 4OUSA 1W3VA 1HDKA 1WMFA 4YZ5A 3T2PA 4DEVA 3PVEA 4L0PA 1LODA 1PIV3 4XF4A 2DCKA 4DO0A 4QXBA 1GWMA 1IG0A 3D0SA 3MLJA 5LWBA 1CAXB 5GZEA 5L9RA 3PHMA 2R062 1VBB2 5FLJA 4XQWA 4XABA 2OZJA 3W20A 1BBT3 4LBNA 1IKQA 1ST8A 2VAUA 1B35B 2NMOA 2QQLA 3MFAA 3WP3A 2YC0A 4NHYA 3ZVXA 1RUD3 5A3PA 5JAXA 1NZIA 4O65A 1ASJ2 4QD2A 3E5UA 1FOD3 4OQ9A 4K40A 4CDWC 4FBFA 1PZ9A 2B4KA 2J1UA 2GC3A 2O8OA 2NN8A 3PJYA 2R0HA 3SKJE 2IFRA 2Q8DA 5CFDC 4E4DX 3BTYA 1WW4A 3AC0A 4LO8A 5LEJA 4S2FA 3HD8B 3N7JA 3JD72 1OUSA 4BZ4A 4YG0A 1IS4A 1O4TA 5G04L 1S0CA 4PDWC 1O6UA 3W58A 4FPFA 1GKBA 1XNDA 3MO4A 5EXOA 1JN2P 4QQLA 4YM3A 3WF4A 1PM7A 4NWWA 3WDXA 4Q4W1 3T1LA 1GV9A 3NQHA 5ANNA 2P2KA 1HXS2 5DAQA 3WZ1A 2VOWA 4GWMA 5HXMA 1ZZ6A 5HBAA 2D3PA 5AFEA 4WVWA 5IWFA 3ENRA 1MEC2 1JYCA 2A3XA 2XUMA 4FP2A 4QKFA 3T3YA 3FLPA 5FXWA 3JU9A 3ZFGC 5KHHA 5T5PA 2A73B 3B3QE 3RZZA 1M4WA 2DUQA 5FY9A 1YFXA 4CU6A 2MEV1 3FBMA 3ZXFA 1VIWB 4NWVA 5K9YA 3ZSEA 5FKCA 1H8VA 4AQ2A 3H8RA 3V0BA 2R1BA 1DQ5A 1W8HA 2Y33A 3H1WA 2YGLA 5AC93 3RSJA 1CX4A 4B3NA 3WQ1A 3U07A 4XCAA 4QX2A 4GQ7A 3GALA 5A6XA 3ZFGA 1D0HA 1W0PA 2VL4A 2XL9A 3FUOA 1D4M1 4YW4A 3GBGA 1QJY3 4LUMA 1QJX3 1R092 3K51A 1EV13 3P6BA 3H9AA 5FBJA 4AVAA 5EFUA 3WDTA 5LBFA 3J7NA 4P08A 2OKXA 2FMYA 5FRAA 5EJZB 1AYN3 3OY8B 4CXWA 1LTEA 3VZJA 3TEYA 1ZM1A 2R49A 2YUEA 1QDCA 1SLLA 1U0AA 4CCLA 2C24A 3PUHA 5DAPA 3ZXGA 3BN6A 2WRAA 2XLGA 4Z1VA 5IAVA 3BOPA 3WV6A 4C0HA 4HN1A 1T6BX 1POV0 1DQ4A 4JGZB 4FFFA 1TME2 2VECA 3NV3A 2EVXA 1OI6A 2WKKA 1OLQA 3FN9A 3IKWA 5KHKA 5FY5A 5FZ1A 3S0MA 3WT3A 2HEWF 2OQ7A 3VUOA 2HWC3 3VHOA 1O4YA 2LTNA 3POWA 3RMYA 1MS8A 4FP3A 5I93A 1LHNA 4IEQA 2WO2A 4I01A 1ZRCA 3B69A 4XF9A 3LEMA 1NXD1 4JHZA 3VV1A 2BGOA 4B4RA 4AFDA 1B35A 4LK7A 5FUNA 1XYOA 4EWEA 1DYKA 2RDNA 1OVSA 3LIHA 2HWB2 1GQHA 4H7LA 3DECA 1RUF1 2ZEXA 5I8TA 5T5LA 2Q1MA 3BVCA 4LNVA 4YVWC 4LKDA 5FZ3A 4ZXEA 3I59B 2NM1A 1W8OA 2JKXA 4CCDA 5A1LA 5IATA 3M4FA 2UYBA 1S1AA 4Y20B 5FZ0A 3SNMA 1BMV1 1DIWA 2YV8A 1AXZA 3CNAA 1QF3A 5H9SA 5AFBA 1YQ5A 2PHRA 2I07B 3GBWA 1C8M1 3VD3A 3ZR6A 4CXXA 5FPUA 5JOYA 3LB9A 1QU0A 2DVBA 5T5OA 5T50A 2WN3A 4GMP3 1ZRRA 3VZKA 2FD8A 1QOOA 1OFSA 2PHTA 3A0KA 5D2AA 4RQPB 2ORZA 1OD5A 4CEYC 2XL7A 2GALA 4NRMA 5FFOC 3FHAA 3WVJA 3P5BA 4OZXA 4AGVA 4B7EA 5A1FA 4GB32 3KS7A 3KQ4B 1YLLA 3WQ0A 5L19A 2CU5A 2D6KA 1YQ6A 3ES1A 5EJ3A 2R063 2R0FA 4XFHA 1VBB3 2PLV1 4QB6A 3E6CC 4YM1A 3KSCA 1REDA 3ETQA 1MS4A 2VE1A 5A3OA 4KG8A 4RL7A 4BYYA 1Z7S2 5J96B 2D6LX 1EUUA 1XNTA 4AZZA 1ASJ3 5FYIA 1JOPA 1GU3A 4HSJA 4IEOA 4XURA 2QQKA 4KGGA 4LR4A 4OMCA 4CCMA 4URAA 4IESA 2BUKA 2RE9A 4QX3A 4QHBA 2PHFA 2WT2A 5FZAA 1RIRA 1S0JA 3RJ2X 2Z5WA 3E1F1 3R4DB 4AR2A 2BBAA 5KXDA 4RYDA 1U5IA 1E5HA 4KU7A 4DQAA 5FIXA 4HPKA 1YXWA 1ENXA 1GOFA 2X10A 3JD73 1XNBA 5FREA 2X5IB 2WT1A 1JMUB 2XLFA 1PNFA 4FPJA 4Y1XA 2TEPA 4AHWA 2PAMA 3H0OA 3V64A 2C5DA 4CP1A 2PTMA 4XFCA 2ET7A 1AR82 1HXS3 1FMD2 2ADDA 2WWSA 3RYPA 1RJ7A 4J6GA 3UL2A 1OA3A 3AM2A 2BRTA 4Y5TA 1MEC3 2ZEYA 3HNMA 3O7OA 5FOBB 4NRQA 1F31A 4ATEA 2D6NA 2QCSB 2RVAA 4WM8C 3ZN4A 1GZWA 5JUVA 1NE4A 3DPRC 2IFWA 3PL0A 1LULA 3PTYA 4PIXA 1N1TA 4GWIA 2VNOA 1WW6A 4AK3A 3MDPA 4AQTA 2YPDA 2B46X 5JWPA 4IEUA 3RRDA 3MIDA 4ISRA 4LBOA 1NYWA 3D6EA 1TNRA 4IW3A 3AXEA 3LA7A 1FNYA 2VCCA 2D6MA 1UOJA 2FDJA 3ABZA 4Q2FA 2W47A 4X8NA 4PLMA 4WM8A 5LB6A 4AF9A 4CDUB 5KBFA 3WNLA 5C8CB 1FATA 2JIJA 2A6XA 1V6IA 1UX7A 3DPRA 4XIOA 1R093 2QQIA 1QOSA 3CJIC 3NV4A 4XW3A 3OUJA 1MVEA 2AEYA 2RDRA 4S2HA 3KHCA 4K3UA 3SHRA 1CR7A 2ET1A 1C5HA 4CSWA 4HOOA 4K7JA 5A7OA 3AZXA 2RS12 2QKDA 1UWWA 2QJVA 3ZDSA 1UOGA 4YWAA 1OQEA 3AL6A 2R32A 2ZS6B 4YVSB 1VBC1 3J8F1 5A3MA 3U11A 4Y22A 4NHKA 3G6JB 3I97A 4RQPA 3CJIA 2W1UA 4CDQC 4FOVA 1TME3 2XJUA 3VDDB 2ARAA 4Q5OA 5FPBA 3A21A 1Q8SA 1C5IA 2YBSA 2BVBA 1SDWA 3LWCA 5T55A 5FZMA 3K2OA 3RZJA 4KMQA 1QIQA 1WW5A 3AB0A 4QWNA 4Y24A 4QXCA 2VZOA 2WO3A 1W2UA 4E9KA 1DGRN 4C8DA 1AR72 5FXVA 1ZBA1 2P3JA 5JSOA 2VVDA 4GULA 1VBE1 1W9WA 3WSOA 3SCHA 2HWB3 1YQ2A 4BCUA 4LBQB 3ZKUA 1UY3A 3FJSA 4DINB 4E4SA 2BNOA 2R041 5IVBA 3BIEA 1UY0A 3OYWB 3THCA 2YFUA 3IBMA 3MF9A 2D98A 4FOWA 2W39A 5AVPA 4IXLA 1HQLA 3S30A 4AQSA 4UOJA 1KQRA 4F7ZA 2VULA 5BNQA 4EN0A 1HN0A 2Y60A 4LK6A 3WNMA 1F5FA 1QQP1 1C4RA 3FFZA 4AWDA 5ACA1 1RUNA 4Q4X2 3U14A 4MVTA 1MACA 2WO7A 2Y6JA 4Q4V2 4XBQA 5TSWA 4FPHA 3WG2A 5BNOB 4Q26A 1DLLA 2FDGA 2DVAA 4QAWA 5FPXA 1OHFA 1MS1A 2RM21 4JRAA 2ZX1A 3OGJA 3HT1A 3AZWA 3KGLA 3I3MA 4GB33 2PHLA 5FZ8A 1X9TA 2EIEA 1ZYBA 4LEJA 1JU3A 2Q30A 2YZ4A 3VGIA 5F3CA 1OH4A 2IC1A 3N7MA 3TNQA 1OKQA 4HKOA 2X29A 1HIXA 5FZGA 5FZ7A 2KXLA 1KXGA 1VMFA 4LORA 4OHXA 2FQPA 3N4MA 4QPIB 1PZ7A 3PURA 1Z7S3 4NPRA 1PO11 4MO3M 2DU0A 1D2SA 3USUA 4DS0A 2WZEA 2JIGA 1K5MC 4S2GA 2AACA 2PYTA 2JDYA 4NRPA 2XLAA 1CAUA 4IETA 5A7WA 5JDBA 1FV3A 2XBO1 4YW2A 3PUSA 3EXUA 1LOEA 2ZGOA 2JJ6A 1R1A1 4EV0A 1UX6A 1RUJ2 2VPVA 1PMIA 3IWZA 4PF1A 3SCFA 4DZGA 3JXSA 1K5MA 1U12A 1HX6A 4DY3A 1VB4A 3VDDA 1PGW1 1ZREA 1O5LA 4Y5Z0 3HQUA 3GNEA 1P8JA 5FPZA 1XSRA 2VQTA 1AR83 3VBOB 4HANA 5LATA 2HWD1 2Y0OA 4QDRA 1VBD1 2HH9A 4OQ8A 3IDCB 4M0HA 1T2XA 1SG3A 3LEKA 4LOTA 3OSDA 4HT1T 4LE4A 2E53A 2XQRA 4U36A 5A3NA 3NRUA 2H0BA 3T4VA 4WM7B 2VVEA 2E7TA 3KV4A 3I2HA 1QMJA 1R081 5A32A 3TAYA 4GJZA 3ON7A 5GZFA 1PO21 3N35A 4IEXA 4K8RB 4QGNA 4R4XA 3VZLA 2E7AA 2OPWA 3EJKA 4FXKB 3WP6A 3W5NA 1QJU1 4D69A 2NQYA 5M0TA 3HN1A 3N7KA 2Z69A 1AJKA 2VZRA 4UBGA 3NV2A 2QVSB 5C9AC 3M3CA 2JDKA 1W0NA 4GIQA 3VD4A 4PT6A 5EHDA 3ZYIB 4BQ2A 5A33B 2VZQA 5CVRA 1O3RA 5FYMA 5FPVA 4AVSA 5LY1A 2XH6A 1XC6A 1WA6X 2A6ZA 4CCNA 4YZ2A 1W6OA 1JYIA 1VAKA 4UFJA 2OT7A 2RMU2 3T08A 3AMPA 4COWA 2CL2A 2RS13 4JGYB 2V4AA 4WVMA 5FP3A 4D7YA 4W6XA 2W08A 4JRLA 4KH9A 4XFGA 2WFF2 2I2SA 5F5CA 3WCSA 1J3PA 4I0AA 4GD4A 4Q27A 2W5FA 2JG9C 1MQTC 1RUE1 1ZZ8A 5HCHA 2CGNA 1SCSA 5GALA 3TEXA 4Y1UA 3WG1A 3ALQA 1JYWA 2PXJA 2K9ZA 2ETEA 3W9AA 1RUI2 1UMIA 3H1YA 3RNSA 5BV6A 2RJLA 1AL0G 4YFWA 5CA6A 1W8FA 5F39A 2GC2A 4JCKA 4K9SA 4YZ1A 1OLME 4TWTA 5FQ0B 2P6HA 3M3IA 4XFFA 5C6CA 2JG9A 2ZJCA 1AR73 2DYCA 1QJEA 4K1ZA 4P9JA 1TVGA 1A3KA 1O4ZA 4P02B 1EY2A 4AFCA 5BYNA 3VBSC 2G4IA 1ENRA 2YU1A 5K0UC 3QACA 2RS32 1O5UA 3RVHA 1QY4A 3BUCA 4N43B 4MHRA 5JLVA 3A4UA 3CJXA 2VXRA 4XJUA 2UU8A 4E4ZA 4GH4B 2BTVC 3LDBA 4MV2A 5ABJB 5F6KA 3VBSA 5K0UA 2QZ3A 1W6NB 4Q0VA 5CFCA 2WDBA 3MPBA 4Q4X3 4ZZ8A 2F4PA 3VD7A 1RUG2 2DBIA 1LOAA 2W3JA 2ZMLA 4Q4V3 4FI9A 2ZXQA 3VBHB 1JZ6A 4OLLA 3WNPA 3VBOA 2ZACA 1XXNA 1AL21 3ZFFC 4FAHA 1CWPA 1RVF2 1US2A 2ZGKA 2XJQA 4C0BA 1ZRFA 2JG8B 2Y6KA 4H3WA 4QDSA 4J25A 3JBG2 3WDUA 5HCAA 5J37A 2A71A 3ATGA 2CDPA 2E7QA 4KBZA 3ECQA 1LR5A 5A3LA 1O3QA 1G9FA 1JXNA 1E57A 3EMRA 1NT0A 4RD7A 3AK0A 3AYDA 4PLNA 4OHYA 2JDAA 3OTFA 4XXAA 2XPJA 3VHPA 4AEMA 3WCRA 3NAPB 5DZFA 4QPGB 5L7OB 3X29B 5J98B 4Q29A 4ARXA 4PIZA 2GZWA 2WS91 5LBEA 2BFUL 2HWE1 1JYXA 2P34A 2VUJA 1VP6A 3KMHA 1CJPA 4I3GA 3KVBA 5FP7A 1CPNA 3ZFEC 4ZZ5A 5FMOL 3LPFA 4LE3A 4IV1C 4FXGB 3WXPA 3AFGA 1DLCA 1FOD2 3EB7A 3ZPYA 2VMDA 4AVBA 5CISA 2EALA 4FTBA 2LW8A 2W95A 3A23A 4K1YA 4Y4RA 5IFPA 1QJZA 4NUBA 1G9BA 1I5ZA 1UYZA 2QQUA 3ZFEA 1OLMA 1UZZA 3N9LA 4IV1A 2WQ4A 2GH2A 5FDBA 3Q8AA 1UU5A 1H4GA 1NUKA 1GFF2 1NY72 2RJ2A 3KV5A 4K6BA 4RSUA 1W8TA 2OX0A 3S6PA 3URFA 5JOZA 4Y4YA 1BBT1 1PK6C 4ZS2A 1OQDA 3D8CA 1UN1A 2B9VA 1VBA1 1H9PA 1CIWA 1V00A 3ACGA 1ND2B 1RUD1 1UQXA 3MBWA 2Q8EA 4EROA 5J3UA 4FFHA 4UW5A 2A3YA 5GM0A 2O0OA 1X82A 3T0AA 4F8AA 1PNGA 4QB2A 1W0OA 4FPYA 4JKKA 3S7IA 1FPN2 4U2AA 1J3RA 1RHI2 5F5QA 3JQXA 4QXHA 4UXAA 2GP5A 3M8LA 4DOUA 2J7MA 3S5QA 2DBNA 2VGDA 5LRSA 3FE5A 3WP4A 4N53C 1RYYA 4N9IA 1ND3B 2QQWA 5FY0A 1EP0A 1OBNA 3V0AB 1G8WA 1MS3A 4PBOA 1Y43B 2R072 3RS6A 5JPNB 1PVC2 2NLRA 1BJQA 4JAAA 1OFNA 2WNUB 3VZNA 1WA4A 2RMU3 3FFQA 3OBZA 3AVRA 4Q4Y2 3QCWA 4RS5C 2WFF3 3ZYPA 1OKOA 1OA4A 3R6SA 5JMCA 4N53A 5IAXA 5IVVA 5F2SA 5CIRA 1W6PA 1XQNA 4AVCA 2D6PA 2BZDA 4KWLA 4A3ZA 1RUI3 2D97A 3ORJA 1ZX5A 4GWNA 4IEWA 4RS5A 4DXSA 5AC91 1S0DA 2XVGA 2PAKA 5DG2A 2YGMA 2RS51 5KXEA 3DEMA 1AR92 1SDDB 3KQRA 2E63A 3LA3A 5IVJA 1QJY1 1QJX1 5BNNA 2LUWA 4A3XA 2DWRA 5F5AA 4BLIA 1LNSA 4LTAA 2RS33 3OBRA 3BCWA 4KU8A 1GICA 1AYN1 4IL7A 3VBUC 4MSVA 2E31A 5FMBA 4CP2A 2JE8A 2Y8KA 1W05A 5J09A 4XPVA 1H1AA 1MZ5A 1S2KA 2P3KA 3OUIA 4MGQA 3OGVA 2WAAA 2XJPA 1HRI1 3O0VA 1D7PM 3MIFA 2W9XA 1Z78A 5IW0A 3PIJA 1S0IA 4E2SA 3IIAA 3POSA 4PDWB 1RUG3 4K20A 3RJRA 3VBUA 2HWC1 3T1MA 4BMBA 1X33A 2X09A 2VBDA 4FPKA 3IB3A 4B4PA 2PHXA 4ZONA 2BGPA 1BZWA 5D8AC 2LM3A 4UF0B 4DUXA 1NA1C 5GLTA 1RVF3 1OURA 3AP4A 3LEIA 1RMU2 2DCYA 3UKVA 1RUC1 3K4AA 1NCQC 2YC4A 4P9XA 4XJ8A 3JBG3 2Y6GA 2YG0A 3NSTA 4WZFA 5FZOA 4AEJA 3MZHA 5BPXA 2XKOA 4L92A 1ZBE2 3P3PA 4W65A 5IUQA 5F37A 5D8AA 1NA1A 1KFXL 3HVDA 3K48A 1W39A 4ISQA 1G6NA 2ARBA 4IGPA 4LPLA 3H7YA 4TTGA 2TNFA 3KT4A 4GJYA 1NCQA 4AFBA 5IK8A 1FYUA 5JMOA 3LD8A 2UYAA 3I2FA 4AQ6A 3ACFA 3I54A 1GUIA 4DUWA 1ENQA 2WL1A 4Y1YA 4BQ1A 4GMP1 2VZUA 4AOCA 4LBLA 1IQDC 3DCQA 4LUKA 3VL9A 5JZGC 2WNUA 4L11A 2KA3A 2BNNA 4QQHA 3MW2A 3KV9A 4B8EA 1XBFA 1O3TA 1PGL2 1SLCA 1Y4WA 4XUPA 3N9NA 3OGGA 2FCVA 3AKPA 1WGPA 3LKJA 1CAWB 1Y9QA 4D3WA 2R061 3CZUA 1VBB1 5JZGA 5A6YA 2XGXA 1HV0A 2YB7A 4ZY9A 4ZXKA 3IN9A 2XOMA 2V5DA 1QGLA 4FPGA 4KQ7A 1V6OA 4ATFA 1WBLA 4RFT0 2JICA 4K21A 5H9PA 1UY2A 4BIFA 5IVEA 1GNZA 1A8DA 2VNVA 3NJYA 1Q8VA 5E88A 1ASJ1 3SC7X 2AUYA 3P3NA 4R4ZA 1MPXA 1HV1A 1BK1A 1L3JA 4DY5A 1X36A 2WSUA 3AMQA 1AYM2 4LXLA 2Y6LA 1FPN3 4PJYA 1RHI3 2V73A 4BQ4A 4IGOA 4XHBA 3JD71 4A44A 1J59A 3VBFC 3ZN6A 2ATFA 4PQ9A 4XJZA 2VMCA 4YVWB 1F4HA 1POQA 3PNAA 1DDLA 2WLQA 2XXZA 1NZCA 3AZVA 2DTYA 3ZIXA 2R073 1UOFA 2RDSA 1PVC3 4S2DA 1FV2A 2Y64A 1JZ3A 1GWKA 1HXS1 3MIGA 1BXHA 2AH2A 3VDBA 1MZFA 5A7PA 3NV1A 4HVRA 4Q4Y3 1I5PA 1NAEA 1F2NA 3U1XA 3VBFA 1HKDA 3WW4A 4DPNA 1MS0A 2JD4A 2Y34A 2CWMA 1QDOA 1VPHA 3DYOA 2VNGA 3M3QA 3AKQA 5HCBA 4CEWB 4XQ4A 1KJRA 3SQOA 3OD0A 2A7AA 3LSEA 3VZOA 2XJVA 2YFZA 3FC0A 3HBZA 4JX0A 5FY4A 3WNOA 2WZR2 4QKBA 2WZPP 1B35C 3ITQA 1MZEA 3SH4A 4YFZA 5FPAA 4DMIA 1REEA 2O8QA 2OPKA 2VY0A 3Q8BA 4HK8A 2C6SA 4J1WA 3LCPA 1AR93 1CAXA 4ES8A 4MG2A 4QGMA 1AR62 4BQ3A 3ELNA 4C91A 1R091 1YIPA 2FMDA 3B9IA 4YGBA 2GC0A 2CYFA 2QQVA 3AL5A 4XQDA 1GOGA 4GKYA 3W21A 1OXCA 1OOPB 1GMMA 4MHUA 3WUCA 1RUF2 1PMJX 4QM8A 4QX1A 4XETA 4OHVA 3VLBB 4XXPA 4EQVA 2GU9A 5DAVA 4INDA 4OI2A 4CE8A 1FXZA 1KGYA 1ULDA 2XDVA 2WLPA 3BB6A 2ZHLA 3HPNA 3THDA 5JXJA 2DCTA 3KLSA 1BMV2 4XFAA 3LF7A 5LA9A 1V9U2 2WABA 1XU2A 5F2WA 1F8VA 4AHZA 1KDKA 4QB1A 1OMIA 1NXMA 2VR4A 4MGYE 4XBLA 1PX4A 3MLLA 1JODA 5DUUA 4I3PA 3ROUA 1NQDA 3H8XA 3O14A 3LSDA 4EZHA 2PFWA 2Q1ZB 4X8PA 2C4XA 2FDHA 1E5SA 1RMU3 4UFKA 4QQPA 4RGGA 4A6SA 1SFYA 1ONAA 1UKGA 1W03A 4FT8A 1XU1A 3KCXA 3MHZA 5CFCB 1COV2 4D8MA 3LOBA 2HWB1 5T52A 4B1LA 2JENA 3O1RA 1F15A 1OT5A 1SLTA 1YEWA 3ILFA 5GZGA 1ZBE3 3WW2A 1WLDA 3POBA 1R1ZA 2FCUA 1H0BA 3I3BA 3JCIA 2WT0A 1H30A 4QHOA 3I3QA 1GZ9A 5DXDA 2GNMA 3KVAA 5FAXA 3ST7A 1QH6A 1J1TA 1W6QB 3SH5A 3HAGA 2CAVA 5J48A 1ZA7A 1Q8PA 4A7ZA 4HVQA 5FY1A 1H4HA 1LGCA 1ULGA 3R0RA 2V5YA 4RFRB 2WNVB 4XIKA 4Y1VA 1Y9MA 3VKOA 3VKMA 2QFEA 3WHUA 2VQ0A 3OD4A 5I8SA 4JGZC 5FJKA 2AGSA 5GLWA 1S2EA 4LQRA 5KHJA 1DF0A 1NCRB 2IVJA 1QEXA 1SHWB 4M3CB 3OY8A 3BPZA 5A3TA 3N9OA 3AP6A 1DYOA 4GB31 5FYUA 2FDKA 1LECA 1URXA 4YG6A 1WWYA 2SLIA 2RHPA 3ZX7A 1GANA 1UY1A 4HETA 4CDQB 2ENRA 5JOWA 3POYA 4EJRA 3DN7A 4JGZA 1CPMA 3IIIA 3A22A 5FZ6A 1WMEA 1JUIA 4ZU7A 1NLSA 1SQ4A 1ULOA 3D0JA 5GKAC 2W92A 4CDXB 1XNKA 2WA4A 1LOCA 1SPPB 3QOPA 3CO2A 5FO7B 1YJKA 4O9GA 3SLIA 1VRH2 2CSGA 3WG4A 1V6NA 3ZYGA 4YSFA 3DKQA 4CCKA 4WZCA 1DGRA 3H50A 1AYM3 2DCJA 3A7QA 4LBMA 5FZ4A 5IK7A 5B2GB 2IXHA 1OF4A 3N9PA 3ES4A 2ZA9A 4XDOA 3ZPOA 3K4ZA 2DTWA 1LHVA 1ALYA 5C33A 1I9RA 4IEZA 2G9GA 4Z07A 1W3XA 3I59A 3R05A 3I8TA 4Y20A 1ZZ7A 4RQPC 5LA2A 4P9WA 1OUXA 1AR81 1FMD1 5C3SA 1SLBA 4R8HA 3DYPA 5FK7A 1O8PA 1W2OA 2R7EB 5FXZA 1VBC2 1YUDA 3AKSA 3J8F2 4MXWB 5FWEA 4Y33A 3WDYA 2WBKA 3WQBA 4Q8KA 1MS5A 2E51A 4RHV2 1G9DA 2AENA 3WNXA 4HBNA 5LCWL 1DYPA 4WVVA 2WZR3 1S55A 1RTVA 1H6XA 5EPAA 1WUVA 2VZ1A 2VD7A 1JYNA 4NPMA 3V56A 2CNAA 4HK9A 1LHUA 2ZGUA 2W1WA 4Q1RA 2OYZA 1AR63 5CADA 2E6VA 2W1QA 5SV8A 5FZFA 1YI7A 1XE0A 1W6QA 5JIAA 4UT5A 2VBPA 1LHWA 1XNCA 3A0NA 1N1VA 2DVDA 3BPSA 2EAKA 1X9PA 1RUF3 2YMZA 5DPNA 2IZWA 2R042 4IV3B 2RS11 3FZ3A 1LRHA 2RJKA 4YGDA 4ZPIA 1IKPA 2IXLA 2X53S 5FO8B 5I91A 2LROA 3GHMA 4N7UA 4EN9B 4EZ4A 3TBDA 1U5YA 1V9U3 3K75B 3C8XA 3POJA 5A3WA 4AXOA 3UJQA 3WF0A 3ZN5A 5KC6A 2VZ3A 2WIIB 1F5JA 2Z42A 1QQP2 4AYUA 1FT9A 5FZEA 4OULA 4DNYA 5BY5A 2X5IA 4HG6B 1N47A 3H3UA 1DG6A 4QT6A 1H2NA 4BU2A 3IAQA 3PU3A 1BKZA 1OPOA 4LJHA 5FZCA 4B7KA 5CKNA 4GZ9A 2AR6A 1OVPA 2VUDA 3UGFA 1AR71 3E6BA 2NMNA 2VOKA 4M3CF 2D40A 4NJ4A 3WHTA 1V0AA 5GZDA 1C1LA 5LA0A 2JDUA 1COV3 2XHKA 1DHKB 3M2MA 1GSLA 3NJXA 2ZGPA 1W28A 1LCLA 4AEDB 2V09A 1MZ6A 3GYDA 2BPA2 4CDUC 5C8CC 1XOYA 3RPQA 3OGRA 1LOFA 3UK9A 1UU4A 1J83A 1UD1A 3IPVB 3JUUA 4JKLA 5EYYA 3S5AA 3E5XA 2ZPXA 4IE4A 3MIBA 3OPTA 3K3NA 5DDJ2 2ZGRA 3GXUA 1NX9A 3LPGA 4CTEA 4CU8A 3UKTA 4AVVA 5C9AB 3W5MA 4Q4X1 5C70A 2JEMA 4CYDA 4DRVA 4Q4V1 4P9GA 4YVSC 4CDUA 4GMP0 2EAAA 5CZKA 5C8CA 4NMIA 5T3NA 5JI7A 3AJZA 5FP8A 4A2UA 3HNYM 2DURA 3K4DA 2VMIA 3ZMOA 3NL1A 3VDDC 2CAUA 5A3UA 3UKNA 3CLPA 4V2VA 4OCTA 2VW0A 1IPSA 1IZ3A 2B8MA 2CTVA 2GNBA 2WNOA 5DZEA 4PF5A 4ARYA 2G9FA 2JE9A 2Q4SA 5CKQA 1XSQA 1MQTB 1PGW2 4XZUG 4YVSA 1IPJA 5FZ9A 4NHXA 3O5SA 4OUEA 1XNAA 4CUCA 1PMHX 2JX9A 1UOBA 2YC2A 3OPZA 1R64A 4XF1A 4I0BA 5E16A 2WINB 4DFSA 3B02A 1KFUL 4BOWA 3MIHA 4HZFA 4BQYA 5FMCA 4K8FA 5JR7B 1M06G 1VRH3 1G9AA 3LZZA 1ENSA 2RR12 2WWJA 1LESA 2W87A 3RWKX 3O1TA 1JHNA 1FX5A 4CA9A 3LDRA 1XYPA 4NROA 4Y3OA 1ZZ9A 4COZA 2PHDA 2XJSA 5DN2A 4ZU5A 5FZDA 5LRRA 2O14A 4LBQA 1RUJ1 1C57A 1ZRDA 3AKTA 3DKWA 4UBHA 4FFGA 5FTTC 4YW3A 1K45A 3OYWA 2PHWA 4QX7A 4XILA 1H2KA 5BNOC 5DZGA 4JV4A 3WDVA 1LU2A 5FZIA 1DGLA 2RV9A 3MLKA 1N1YA 3IZOA 2UY8A 4ASLA 3AP5A 1WCKA 2DUPA 1JUHA 5FP4A 2P17A 2HEVF 4BPZA 1DU3D 1N3PA 2O1QA 5FZKA 1VBC3 3J8F3 4YZ3A 4AHYA 5IHRA 4MGZE 3OJBA 3FMGA 4Q0PA 5BNPB 4RHV3 4XJWA 5BNOA 1LAJA 4COUA 3FX3A 2WO1A 4RGKA 4CCOA 3TN92 3ME2A 4R52A 4QPIC 1H8TB 3WQ7A 3B94A 3MICA 4JVAA 4Y5SA 3TEWA 1H1IA 3L2YA 1J3QA 4IERA 4MUVA 1IQAA 1AXKA 3CKHA 3UGHA 2A6WA 5C4WB 2OIIA 1IG3A 2FHRA 5HCFA 1UKRA 3ACLA 2QZ2A 1VBE3 1EAH2 2VTXJ 3F95A 3OEBA 5DAXA 4DRRA 4QPIA 3WD5A 5FZHA 3O1SA 2R043 2BP6A 2RMU1 3GHNA 4L97A 2WFF1 2ZHKA 1RUH2 2TUNA 4E2GA 3ETPA 5C7GA 2Y38A 1KJLA 2WQZC 4JQTA 1RL3A 3KWVA 3RYKA 4DXZA 4EN7B 3Q8EA 3VBOC 1GR3A 1QOTA 2XUEA 2VTFA 2YBKA 2YPJA 4A45A 4OFGA 3WLUA 1QQP3 5GZCA 1ODNA 3EQEA 3PTRB 5ACA3 2XG3A 1RUI1 1AUYA 5HPOA 1C1FA 2EXHA 2TBVA 5FYCA 3MW3A 4GWJA 4C90A 5K7PA 5DG1A 5KXBA 1LEMA 4AHXA 3GJBA 4XBNA 1DFQA 2A75A 4YM0A 3GCWA 4MYEA 3VBRB 2GSYA 1AX2A 3LFMA 1V70A 4YYOA 5KXCA 1KITA 5CG8A 3AMNA 5FJHA 1W2AX 3SEPA 1WBFA 2B5HA 1GYKA 3GZEA 4GXLA 1W2TA 4HN0A 4WM7A 2HKXA 2HWF2 2VQAA 3IAPA 1IGOA 3NKTA 3M3EA 4GAZA 3I2JA 1L7RA 3FHIB 3CEWA 3KF5A 5DDJ3 5IYYA 2HWE2 5FY8A 2Q8OA 2BDRA 1OA2A 4J1XA 4FTSA 4JGYC 3WINE 4CP9B 3QD6A 1UXXX 1FAYA 1RUG1 3NWKA 4PHZA 4N8MA 3GBFA 5C71A 3OB8A 3RZMA 4M4RA 2VW1A 2JWPA 4LO4B 2QNKA 3EHKA 4XACA 3I2IA 4TYSA 4X6QB 5A33A 4DB5A 1RVF1 5FYVA 4XDQA 2C9KA 1ZZBA 4AAXA 5IK5A 1BQPA 3J26N 1W9FA 4CPBA 4DEQA 3JBG1 5FPLA 4JGYA 5E8AA 4LIUA 3R4UA 4UWDA 3OUHA 1WMDA 1SFNA 1GP4A 1N1SA 1BEV2 1PIV1 1W6MB 4FO9A 4JTOA 4X6RB 2E9QA 3AZYA 3J9SA 1A8MA 3UETA 3ZR5A 2JECA 2JDMA 1UL9A 2VCAA 2Z2SB 3VKFC 4JZRA 3MV01 1HB1A 1VBA2 3S57A 2B7YA 4QMAA 5JVVA 2CDOA 1E5RA 3CU7A 3L9JT 2QTWB 1SLAA 3WOGA 3ZXKA 2DF7A 5IK4A 1C8NA 2FCTA 5FQ0A 3BALA 3LIGA 2RR13 1E5IA 2P3IA 3K46A 4D94A 1HRV2 1L7LA 1XJAA 3MGUA 5DAWA 5ISLA 5KC5A 2W0XA 4IGQA 3TOJA 3WUDA 5A6QA 1UZYA 2A70A 3RI8A 4AI1A 1UMZA 1D4VB 4AFMA 1FOD1 2QQJA 3DXTA 4L2NA 1A6CA 2AC1A 2B39A 4XTMA 1BVP1 2BWCA 4D7SA 4QPYA 4UFLA 1LOGA 1QNYA 2GMMA 1CVNA 2NPIA 5F7UA 2A6VA 4CXYA 4N43A 2WR9A 1V6MA 2W91A 4P5YA 3VBHC 1EPWA 1NLQA 3WX5A 3I49A 4BA6A 3ZYBA 1ULFA 4LHNA 5FKBA 1CAVB 4RR3B 2R6QA 3BIWE 3SH3A 4GH4A 3MUY1 1U5ZA 3TYJA 3UYJA 2YBPA 2BQPA 3PVBB 5ABJA 1NY71 2JG8C 5EZWA 2J22A 2BOJA 4BWOA 1W6NA 3ZMNA 4JDOA 4BB3A 2VMEA 3I2GA 4PCRA 2OS2A 2D44A 4PLOA 2GMPA 1OH3A 4LOSA 3H3LA 3VBHA 5GLZA 3VB9A 5A6ZA 3TN93 5FUIA 1EYBA 3ZLIA 5I0UA 1CN1A 2BV4A 2MNGA 2VMFA 1POV3 1AHSA 1Q43A 3PDQA 3NAPC 4E2QA 2XJRA 4QPGC 5BNNC 5L7OC 2JG8A 1FPN1 4IDZA 1RHI1 2EIBA 4W4ZA 4IEVA 4BXFA 1JYTA 1KRIA 4YGEA 5FXXA 1W90A 4ASKA 4BE3A 2RS52 1S2BA 4NVPA 4Y26A 3FUQA 3S7EA 4KNCA 5H9RA 3T09A 3UT0A 2DDUA 3U4SA 1V6KA 5L73A 4KGQA 5F3IA 4ZU4A 1EAH3 4P00B 5KR7A 1GBGA 1TMF2 2VZPA 4OZOA 5HI0A 2R071 4AFAA 1W9SA 1PVC1 3J4UH 4UW6A 1EPZA 3NAPA 3SXWA 1EV11 3E97A 1BLZA 2VXJA 4QPGA 2GAUA 4BLJA 2W1SA 2Z4FA 5CAZA 5L7OA 4Q4Y1 4D6QA 4UFMA 2IVIB 2EA7A 5IJRA 1RUH3 5KHIA 3HWJA 2HYXA 3MPPG 2PMWB 4G9SB 4CDWB 1HRI2 5FYHA 4CCJA 2N7GA 2OVUA 3GM8A 2GDFA 3ZYHA 3RZHA 5CFDB 2C1FA 2OW4A 3HT2A 4L99A 4LBQD 1IHMA 1VMHA 4BXSV 1ACCA 4WV8A 5FR3A 3M3OA 1DQ1A 1ND2C 4QPWA 4Q1PA 4YPJA 1O7FA 5AVAA 1JU4A 1YJLA 4UFHA 1AR91 2KD7A 3L2HA 1RUC2 4FVVA 5EP9A 2JB4A 1NE6A 2DFBA 2GNDA 3C7OA 4H55A 5DABA 3LEGA 3V0BB 3O1UA 2YHJA 3BODA 3MUZ1 5CBLA 1D2QA 2E26A 3HOBA 1ND2A 1C3HA 3HBKA 2X05A 2OUJA 3VHNA 3ZFGB 5F9TA 2HWF3 2WC2A 1ND3C 1UY4A 3LOIA 3IDAA 1DZQA 4A6OA 5ERLA 3QH6A 4A42A 4DXTA 2HWE3 4OHWA 2WNUC 1UXZA 4YARA 4N90A 4UW4A 3VD9A 3IDEA 4XUOA 3KT1A 2ZX0A 3U37A 3DF0A 1QWRA 2ZCWA 3AVSA 1D0GA 4AGGA 3WNKA 2BU9A 2C26A 1UZWA 2HBTA 2JXAA 1ND3A 4E4HA 1UF2C 1VJ2A 3ACIA 3R4SA 1Y3TA 4XVHA 3V0AA 5FP9A 1W2NA 3HQXA 1IOAA 3ZXJA 3NVCA 4W8JA 4COYA 5LA1A 1AXYA 4LITA 2EIGA 2J1VA 1QKQA 1V6JA 1QJFA 2I74A 3IT8A 1UPSA 4Q0SA 4BHPA 1WD3A 1YI9A 2OXBA 2YYOA 1U5XA 1OF3A 3KD4A 2BJSA 1BEV3 3C7EA 1ZBE1 2BNMA 2VJXA 5JXHA 2DUOA 3I2DA 4LO5B 4Q4W2 4UYBA 4OHZA 2H0VA 4CCEA 3N9MA 1VBA3 3IMNA 4H2AA 1A78A 2KR2A 3RMXA 2XWJB 3JZVA 4A7YA 2BBVA 3PU8A 2PQQA 1KS4A 2UURA 3DUIA 3O0XA 2IXIA 1VAMA 5LZ6A 4FTEA 3EYPA 1HRV3 1Y7BA 3Q9OA 4TLGA 1BYHA 2QDRA 4LO6B 3O1OA 1CZTA 3CZJA 2D3RA 2MEV2 2LS6A 4AI3A 4XUTA 3DGTA 5IVFA 4JHTA 4UW3A 2P1BA 4EN6B 1JZ4A 1GP5A 1W04A 1UYYA 1PGL1 1UCXA 4P14A 4TLFA 1JH5A 4WVZA 3U0ZA 4QXKA 5J36A 4CDWA 5JIUA 1CESA 4W6YA 1D4M2 3RWNA 2QDNA 2X8KA 3ZO0B 5I0RA 4XYXA 1AX0A 5GLUA 5CFDA 3TRSB 2FZ2A 2G19A 3VKLA 2JDNA 2ZX2A 1KD7A 2ZX3A 4LHKA 5FLIA 1WCSA 3DYMA 2VH9A 4XUQA 4PDWA 3NMBA 1HB2A 4C1XA 3IMMA 4CU7A 2JDHA 5ANQA 1MEC1 1YCIA 4QKNA 2BW8A 3EO6A 3J7MA 3KF3A 4UF0A 1RINA 1QXRA 1S4CA 1DP0A 3AYEA 4MGTA 1GQGA 2VOVA 1PM4A 3C7HA 4N9HA 4CPBD 4AI2A 1AYM1 1PVXA 4AL9A 4CEYB 2J1RA 5LBBA 1GNHA 3MV11 4YLZA 1OC1A 3T0BA 5CG9A 2RS53 4EN8B 1ZVFA 1GZTA 1NOVA 2EXIA 4QQ2A 3QH7A 4RGAA 4XHXA 1LENA 3ILRA 5HV4A 1ZA4A 3OBTA 4XOGA 3RFRA 1TMF3 1WKYA 4G4FA 5EV7A 3BKZA 1HJFA 3BOWA 4BISA 2ZEWA 4YNIA 3ZXAC 2IXJA 2ZZQA 3AP7A 3JB4C 2QQOA 3LA2A 4HPKB 5EQUA 1REFA 2Q8CA 3WW1A 3WY6A 2XQXA 3WR0A 4EYUA 2DU1A 2H6CA 2Y0IA 5K8SA 3GF6A 4I09A 4XMIA 1LKNA 3U4XA 1HRI3 1YIFA 3H7JA 3E6DA 2UWBA 5HXVA 3VKNA 1OQ1A 4QHZA 1LB2A 3FBYA 4E8CA 5D1IA 4LLOA 2ZABA 2WZR1 4TN7A 1TME1 2SBAA 4P9YA 2B42B 1UNBA 3GZTB 3Q8FA 1C8M2 4YW1A 2XONA 1GZWB 1WLTA 1JW6A 4KBBA 2R16A 3K3OA 1AR61 1CAWA 1RUC3 4LA3A 1GQPA 3FLRA 4KWKA 3H3ZA 5FOJB 1VAVA 2VZTA 3POEA 1F9KA 5IVYA 3ACHA 3CF6E 3LGRA 3H8UA 3HNBM 1J84A 4WM8B 1YRZA 2FDIA 3NO8A 2XVLA 3T2TA 3DPRB 4QM9A 2PLV2 4BJ0A 4B29A 1QH7A 4YW5A 3KGZA 1V9U1 5FO9B 1YQCA 2BGCA 4M4PA 2P4EA 4URTA 1LOBA 5CKMA 4QKDA 2DFCA 2VUCA 5FZBA 1YWKA 2GMEA 3BTZA 1G86A 1HQWA 1MR5A 3T0DA 2VOTA 2OUHA 4LKEA 2VZVA 2FZ1A 3VD5A 4XFIA 2XKPA 4YVWA 4Z2WA 5EIYB 1QXJA 4ITCA 4HLTA 4PI0A 4NR1A 4Y22B 3WF3A 3KZ4C 4BQ5A 2KM2A 3CJIB 4JKMA 5L9BA 3F2ZA 3T2QA 4CEWC 2ZOEB 4NOTA 2A5ZA 5E1RA 4LKFA 1WD4A 5FYBA 1GWLA 1XE7A 2WZ8A 1IS6A 2W52A 2EXJA 5K4LA 4CCCA 1COV1 3PUAA 4G3YC 1AZDA 1AX1A 5APAA 3N7LA 2VTXA 2D5FA 2VOXA 2WA3A 1FI2A 3M70A 5F8PA 3BU0A 4MGSA 4Q4W3 3KM5A 1WCQA 3I4IA 4CEWA 1PX3A 3O12A 4HFSA 4CEYA 5KHGA 1JYVA 4M3CE 1OOPC 3ZSJA 1QXPA 1CZVA 1S0GA 4LBKA 4XTPA 1YO8A 1H2LA 3VN4A 1Z7S1 4D6RA 3WDWA 5IT6A 2J1AA 1YFYA 2J1SA 5CB7A 4NHMA 3GZAA 2MEV3 4JDMA 2ORXA 4QX5A 3LQCA 3B01A 3HN3A 4LHSA 1OOPA 2JDPA 2BEOA 3I7DA 1OLRA 3KV6A 3O0WA 3O1VA 1HB4A 3GJAA 4QQOA 3K77A 2C0ZA 1SMVA 4FQ4A 2GN3A 4ZS3A 2ID4A 4RA0A 4DIQA 1D4M3 2R1DA 4MX3A 2CV6A 3AMMA 5A1AA 3PUQA 4XE9A 2Q0AA 1L7QA 3UESA 2NYYA 2W68A 4AEKA 1SBDA 1DZRA 1JS9A 4FPOB 2Y6FA 1W9TA 5C3QA 2CHHA 2WN2A 5CFCC 3ZXEA 4BK4A 2ERFA 2VMHA 3MIEA 2VQUA 4CUBA 4MGKE 5FK8A 5FYTA 3PUIA 3OOXA 1RUOA 1T6GC 5LEKA 1UO9A 1VRH1 2W94A 4QX8A 2FDFA 1S0EA 2VNRA 1UMHA 1LGBA 1VALA 2G9ZA 1W99A 3CQOA 4FFIA 1LHOA 4META 1X50A 2RDQA 3WW3A 4YW6A 2FBEA 1K5JA 3SEEA 4QGLA 1ULPA 1WMXA 5GLVA 2MHFA 2QBXA 3GCXA 1DZTA 4NE9A 4Y1ZA 4Z82A 2F6BA 3OPWA 2CWSA 3USUB 1N3QA 1RGSA 1YFWA 2GC1A 3H1MA 4HL0A 4I02A 1H2MA 5J7MA 4TZDA 1JTZX 2P3YA 3SKVA 1NQJA 4FCAA 2WNVC 5CYYA 1CD3G 3J7HA 5A7WB 1CAUB 2NZ9A 1HQNA 1W06A 3BYWA 1DQ2A 1ZBA2 2K46A 4AI9A 1XYNA 1RB8G 1NCRC 1W8WA 1VBE2 1XPWA 2UY9A 5CU1A 3RQ0A 1UAIA 1GOHA 4KL1A 4I0WB 3DL3A 4LO7A 4MADA 5JXIA 3VDAA 2XR4A 1HW5A 4O7XA 2X5IC 4XF3A 3T4HB 5I0DA 1K5MB 2WNVA 3C7FA 4XC9A 1Y9GA 4M0NA 2ZGLA 4RHV1 5I0SA 2ZKNA 1F35A 4DUVA 1UZVA 3BTAA 3MW4A 3LDKA 4FQZA 5B4XA 3THTA 4MOAA 3ZSLA 5G05L 4MGIE 1UIKA 4KWJA 1SFPA 1NCRA 2WUHA 1Q3EA 1Q56A 1QNWA 5F32A 2BVVA 2BERA 4FPLA 1C8M3 1ZRIA 4M3CA 4BH9A 3APBA 1TEIA 3POFA 4CDXC 1HN1A 5ACA2 1Q8QA 4D0QA 1K3IA 5F1RA 1K42A 3I3EA 2DV9A 3INAA 1OSGA 3CIHA 5BXXA 2VVFA 4CDQA 4KG0A 5A32B 3TEZA 1IS5A 4ZKTB 1LOFC 2ZGQA 2RM22 4XZPA 4GKXA 3ZKYA 4AW7A 3OEAA 4BQXA 3AJYA 5D21A 3FLTA 4PBPA 3ZDVA 4LULA 1VB2A 1B09A 1STMA 1VMJA 3ZXLA 3B7MA 4GA9A 4CDXA 4XFBA 5C3PA 3WNNA 1SPPA 1MVQA 1JOJA 3N3HA 4H14A 4EE2A 1CX1A 2HEYF 5LK7B 4NHLA 2PLV3 2HYKA 4LT5A 1TG7A 4I30A 3T2OA 1DQ6A 1DQ0A 2BOIA 1OPMA 2DCZA 4HVOA 3VZMA 1PO12 1W6OB 1W9YA 1WZXA 2GP3A 3I2KA 2XWBB 4JTNA 2Q1FA 4ONUA 1V6LA 3AXDA 4L8QA 4R9AA 4WVMB 5DUXA 5FYSA 1HB3A 2Q5TA 2VCBA 5FYYA 5JCTA 1O91A 1BVVA 1YQ8A 2XBO2 5FZLA 3RDIA 4NIGA 4W50A 2JDZA 2JE7A 4B1MA 2JB8A 5FMDA 1RXGA 1LEDA 2H6BA 2WJSA 5L36A 4FSJA 1X8EA 1R1A2 3AP9A 4AE2A 2VUAA 3FL7A 4XAAA 3TWIA 4MXWA 2YXSA 5FWJA 2BYVE 2ZGTA 3WF2A 2JG9B 2ZEZA 1CGPA 1BK0A 1GLHA 1JBCA 2ES3A 2ZKLA 3KHBA 3PVNA 3PVOA 2QQNA 4L9BA 3WG3A 2B45X 2ARXA 3DXUA 3RGBA 1S0FA 2HWD2 2R30A 1VBD2 1KDMA 3HR9A 4FPCA 4B4QA 3GZUC 5DDJ1 5FUPA 1G7YA 4A4AA 4R9BA 3T30A 1ZNPA 4LKSA 1PZ8A 3SMHA 3OBAA 4IV3C 3B00A 4CZSA 2CY6A 3GDBA 3USSA 4AVTA 5EWSA 4BK5A 2WSVA 3MI8A 3BGAA 1R082 4NAMA 2Y6HA 2QQMA 2VC9A 3AZZA 2IWGB 5E89A 1PO22 1TNFA 2JKBA 3HJRA 3OCPA 4UFIA 1AF9A 5F3EA 2OQ6A 3VBSB 3D82A 1QJU2 3KB5A 5K0UB 2A1XA 2HBUA 2J42A 2J1TA 4O61A 1VE0A 4V2WA 2WYSA 1O8SA 4IV3A 4NIAA 5IVCA 2Z79A 2PHUA 5SV5A 3PMSA 3ZSKA 2AZ5A 2DVFA 3E5QA 1KS5A 4R9CA 5EJ1B 4EWDA 3THPA 1FMD3 2ZMKA 2G1MA 5KWRA 3CL1A 2ADEA 4JQRA 1SLIA 5JPMB 4GALA 5BUVA 2ZAHA 1AVBA 3M1HA 1X8MA 5FV3A 4NIHA 2D3SA 1F4AA 4NAOA 3D4KA 3M7AA 5CNAA 4AEDC 2OZ6A 1BCXA 3O1PA 1RUE2 4FPEA 1Q8OA 3RZLA 2RR11 3U75A 4M00A 4KI5M 3ASIA 2W46A 3ZFFB 1SCRA 4M01A 4YW7A 4CVUA 1I6XA 2F4LA 4NIIA 4CU9A 1PHMA 1AJOA 4ASMB 4XDPA 5A7QA 1N3OA 1UYPA 1RITA 4ZHNA 3SISA 4AEDA 3NKGA 1JZ7A 1GNYA 1JOBA 2QUOA 4BMEA 1CJDA 4CRQA 3J7LA 3MEPA 2YROA 2K0GA 1Q5OA 1ZBA3 2OA2A 3IM0A 3IPVA 2WYFA 4C1WA 3HIFA 4OYUA 4IEPA 1S0BA 5JI9A 2ZBJA 4P9IA 1IS3A 5L9VA 4HSLA
chains in the Genus database with same CATH topology
4FOYA 4FOQA 2D5HA 1ULEA 5C9AA 4XMAA 2ZGMA 3LAGA 5FLHA 3ZFEB 3IDBB 3NW4A 4N7IA 4MH0E 4IQPA 2ILMA 1VR3A 4E27A 4IV1B 3TN91 4D7TA 4JDNA 3SITA 2A3WA 3DV8A 2DVGA 3ZIWA 1POV1 4QU2A 4XF0A 4ES9A 1MQTA 4WBBA 1H9WA 3U10A 2VU9A 2VW2A 1FNZA 3W59A 1AL22 4LBJA 2RM23 3C2UA 4WM7C 1EAH1 4EWAA 1YFUA 1XE8A 1LJ7A 1PK6B 3G7DA 3ZYRA 2WFPA 2ZMNA 4XEZA 2RS31 3QLQA 4R9DA 1CONA 1RUH1 2WNEA 2ZTNA 4HKWA 4P5HA 4Q0QA 1I1EA 1O3SA 3HMYA 1WW7A 1PO13 4F3JA 5FBZA 3WP5A 1HLCA 1LGNA 5LK5A 5T54A 3B5LB 2WS92 1TE1B 4N53B 5BNPC 2B9UA 1W6PB 2LALA 2XBO3 3RG0A 1ZZCA 2CGPA 5F6LB 1NG0A 1SEFA 4AI0A 1H8TC 2ZHMA 3AFKA 4XJ9A 1R1A3 4YGCA 1G9CA 3VHRA 4RS5B 5T5JA 1PIV2 1SBFA 3AYCA 1YYNA 4ORFA 5C4WC 4V1PA 1PGSA 1Z0HA 5BNPA 2AYHA 2P37A 4MLOA 3ZFFA 5EYXA 3AKRA 1RC6A 2HWF1 3B9CA 2BFUS 5BNNB 2HWD3 1UW8A 1VBD3 1H1MA 1H8TA 2GN7A 1RJ8A 4O9EA 5FMOS 4CP0A 3B93A 2EF6A 1BBT2 3PLQA 2XVKA 1SACA 4MZUA 3UV9A 1RUD2 5C4WA 2YDEA 1C28A 3ZSMA 4AG4A 5I0TA 4N43C 1R083 1YNAA 3TB0A 4A7KA 1PO23 2D6OX 2QQPA 1QJU3 4GH4C 1RUJ3 3V65A 4YM2A 5ABJC 2HJIA 4F83A 2D93A 3VBUB 3ZXDA 5DUVA 5I8YA 2IXKA 1BEV1 4COVA 1YHFA 3VBRC 5JSRA 2C9AA 4LLFA 3RYRA 2ZHNA 2ZGSA 3KCYA 3MF6A 3C3VA 1TQ5A 3QBQA 3D5OA 5GJ6A 3RI9A 1X7NA 1RUE3 4Q0UA 5FCCA 5D8AB 1J1LA 1HRV1 1NA1B 3EBRA 2Y26A 3VBRA 1LU1A 1QHDA 2UWCA 1PK6A 4OI1A 1APNA 1NCQB 2PAEA 2QE3A 3JQWA 1WLCA 4LHLA 4W6WA 2I45A 1WCDJ 5AC92 4YRDA 2ZX4A 4OI4A 4OVEA 1ULCA 1QJY2 2D7FA 4YZ4A 3N36A 1QJX2 3OF1A 4BM8A 1EV12 4NO4A 2PA7A 5DUWA 3ZYJB 4H7MA 5JSPA 2K2SA 4PIYA 1AYN2 3AYAA 1UIJA 4Z92B 4TSVA 2BWAA 4I2OA 1I3HA 1DGWX 4OI0A 3MYXA 1DBNA 5JZGB 2VG9A 5H9QA 1MS9A 4AGRA 3MFCA 4XJAA 3SCGA 3UJOA 3FWEA 2HWC2 2UWAA 3BU7A 4Q8LA 1UPIA 1IPKA 1J58A 2GH8A 3AMHA 1NLRA 1AL23 1W6MA 2D43A 2MPFA 1SBEA 3PMEA 4HMZA 1TMF1 3PJQA 4SBVA 2GNTA 2YY1A 3KT7A 4Z8BA 2ZAAA 3KCCA 3ZN6B 4NN0A 2VMGA 2ZGNA 4SLIA 1XRUA 4AI8A 3JB8A 1DGWA 5C8WA 2EXKA 2IXCA 4RR3C 2PELA 2A6YA 2XJTA 2AREA 4IEYA 3NJZA 2WS93 4LA2A 4P9LA 1WLWA 3ILNA 3VBFB 1UU6A 4HKLA 4BIOA 3VL8A 1VLNA 4OUMA 4YG3A 4JC1A 2XB6C 2ZZJA 1CAVA 4RR3A 1GZCA 4FAGA 3AX4A 1CQ9A 3TNPB 2PN5A 4MXVA 2CGOA 4OUSA 1RMU1 1WMFA 1HDKA 4YZ5A 3PVEA 4XF4A 1LODA 1PIV3 2DCKA 3D0SA 3MLJA 1CAXB 5GZEA 3PHMA 2R062 1VBB2 5FLJA 4XQWA 2OZJA 1BBT3 4LBNA 1IKQA 3MFAA 1B35B 2NMOA 3WP3A 2YC0A 3ZVXA 1RUD3 5JAXA 1ASJ2 4QD2A 3E5UA 1FOD3 4K40A 4CDWC 4FBFA 1PZ9A 2GC3A 2O8OA 2NN8A 3PJYA 2R0HA 1DDLA 2IFRA 5CFDC 4E4DX 1WW4A 4LO8A 5LEJA 4S2FA 3HD8B 3N7JA 3JD72 4BZ4A 4YG0A 1IS4A 1O4TA 1S0CA 4PDWC 3W58A 4FPFA 1GKBA 1XNDA 5EXOA 1JN2P 4QQLA 4YM3A 1PM7A 4NWWA 3WDXA 4Q4W1 3T1LA 1GV9A 2P2KA 1HXS2 3WZ1A 2VOWA 4GWMA 1ZZ6A 5HBAA 2D3PA 5AFEA 4WVWA 3ENRA 1MEC2 1JYCA 2A3XA 2XUMA 4FP2A 3FLPA 3JU9A 3ZFGC 5KHHA 5T5PA 2A73B 3B3QE 3RZZA 1M4WA 2DUQA 1YFXA 2MEV1 3FBMA 3ZXFA 1VIWB 4NWVA 5K9YA 3ZSEA 1H8VA 4AQ2A 3V0BA 2R1BA 1DQ5A 3H1WA 2YGLA 5AC93 3RSJA 1CX4A 4B3NA 3WQ1A 3U07A 4GQ7A 3GALA 3ZFGA 1D0HA 1W0PA 3FUOA 2XL9A 4YW4A 1D4M1 3GBGA 1QJY3 4LUMA 1QJX3 1R092 3K51A 1EV13 3H9AA 4AVAA 5EFUA 3WDTA 2FMYA 5FRAA 1AYN3 3OY8B 1LTEA 3VZJA 1ZM1A 2R49A 2YUEA 1QDCA 1SLLA 1U0AA 3ZXGA 2XLGA 4Z1VA 3BOPA 3WV6A 4C0HA 4HN1A 1POV0 1DQ4A 4JGZB 1TME2 2VECA 3NV3A 2EVXA 1OI6A 2WKKA 1OLQA 3IKWA 5KHKA 3S0MA 3WT3A 2HEWF 3VUOA 2HWC3 3VHOA 1O4YA 2LTNA 3POWA 3RMYA 1MS8A 4FP3A 5I93A 1LHNA 4IEQA 4I01A 1ZRCA 3B69A 4XF9A 1NXD1 3VV1A 4B4RA 4AFDA 1B35A 1XYOA 4EWEA 1DYKA 4H7LA 2HWB2 1GQHA 1RUF1 5I8TA 5T5LA 2Q1MA 4LNVA 4YVWC 5JPNB 3I59B 2NM1A 3M4FA 2UYBA 1S1AA 4Y20B 3SNMA 1BMV1 1DIWA 2YV8A 1AXZA 3CNAA 1QF3A 5H9SA 5AFBA 2PHRA 2I07B 3GBWA 1C8M1 5JOYA 3LB9A 1QU0A 2DVBA 5T5OA 5T50A 4GMP3 1ZRRA 3VZKA 1QOOA 1OFSA 2PHTA 3A0KA 4RQPB 1OD5A 4CEYC 2XL7A 2GALA 5FFOC 3WVJA 4AGVA 4B7EA 4OZXA 4GB32 3KS7A 1YLLA 3WQ0A 5L19A 2D6KA 3ES1A 5EJ3A 2R063 2R0FA 4XFHA 1VBB3 2PLV1 3E6CC 4YM1A 3KSCA 1REDA 3ETQA 1MS4A 4KG8A 4RL7A 4BYYA 1Z7S2 5J96B 2D6LX 1ASJ3 4HSJA 4IEOA 4KGGA 4LR4A 4IESA 2BUKA 2RE9A 4QHBA 2PHFA 2WT2A 3RJ2X 1RIRA 1S0JA 2Z5WA 3R4DB 5KXDA 1U5IA 4KU7A 4DQAA 4HPKA 1YXWA 1ENXA 3JD73 1XNBA 5FREA 2X5IB 2WT1A 2XLFA 1PNFA 4FPJA 4Y1XA 2TEPA 4AHWA 2PAMA 3H0OA 3V64A 2C5DA 4CP1A 2PTMA 4XFCA 2ET7A 1HXS3 1AR82 1FMD2 3RYPA 2WWSA 1RJ7A 4J6GA 3UL2A 1OA3A 3AM2A 1MEC3 3O7OA 5FOBB 4ATEA 1F31A 2D6NA 2QCSB 4WM8C 3ZN4A 1GZWA 1NE4A 3DPRC 2IFWA 3PTYA 1LULA 4PIXA 1N1TA 2VNOA 1WW6A 4AK3A 3MDPA 4AQTA 2B46X 5JWPA 4IEUA 3RRDA 3MIDA 4ISRA 4LBOA 1NYWA 3D6EA 1TNRA 3AXEA 3LA7A 1FNYA 2D6MA 4Q2FA 4X8NA 4PLMA 4WM8A 4AF9A 4CDUB 5KBFA 5C8CB 1FATA 1V6IA 2A6XA 3DPRA 4XIOA 1R093 4XW3A 1QOSA 3CJIC 3NV4A 1MVEA 4S2HA 4K3UA 3SHRA 1CR7A 2ET1A 1C5HA 4K7JA 3AZXA 2RS12 2QKDA 2QJVA 3ZDSA 1OQEA 2R32A 2ZS6B 4YVSB 1VBC1 3J8F1 5A3MA 3U11A 4Y22A 4NHKA 3G6JB 4RQPA 3CJIA 4CDQC 4FOVA 1TME3 2XJUA 3VDDB 1Q8SA 1C5IA 2BVBA 1SDWA 3LWCA 5T55A 1WW5A 3AB0A 4Y24A 1W2UA 4E9KA 1DGRN 1AR72 1ZBA1 2P3JA 5JSOA 2VVDA 4GULA 1VBE1 3SCHA 2HWB3 4BCUA 4LBQB 3FJSA 4DINB 4E4SA 2BNOA 2R041 3OYWB 3IBMA 3MF9A 2D98A 4FOWA 2W39A 5AVPA 4IXLA 1HQLA 3S30A 4AQSA 4F7ZA 1KQRA 2VULA 5BNQA 4EN0A 1F5FA 1QQP1 1C4RA 3FFZA 5ACA1 1RUNA 4Q4X2 4MVTA 1MACA 4Q4V2 4XBQA 5TSWA 4FPHA 3WG2A 5BNOB 4Q26A 1DLLA 2DVAA 5FPXA 1OHFA 1MS1A 2RM21 4JRAA 2ZX1A 3OGJA 3HT1A 3AZWA 3KGLA 4GB33 2PHLA 1ZYBA 4LEJA 2Q30A 2YZ4A 3VGIA 2IC1A 3N7MA 3TNQA 1OKQA 4HKOA 2X29A 1HIXA 2KXLA 1KXGA 4OHXA 2FQPA 3N4MA 4QPIB 1PZ7A 1Z7S3 4NPRA 1PO11 2DU0A 1D2SA 3USUA 4DS0A 1K5MC 4S2GA 2PYTA 5JDBA 2XLAA 1CAUA 4IETA 1FV3A 2XBO1 4YW2A 3EXUA 1LOEA 2ZGOA 2JJ6A 1R1A1 4EV0A 1UX6A 1RUJ2 2VPVA 1PMIA 3IWZA 3SCFA 4DZGA 1K5MA 1U12A 1HX6A 4DY3A 1VB4A 3VDDA 1PGW1 1ZREA 1O5LA 4Y5Z0 5FPZA 3GNEA 3VBOB 1AR83 4HANA 2HWD1 2Y0OA 1VBD1 3IDCB 4M0HA 4HT1T 4LE4A 2E53A 4U36A 2H0BA 4WM7B 2VVEA 2E7TA 1QMJA 1R081 5A32A 3TAYA 5GZFA 1PO21 3N35A 4IEXA 4R4XA 4QGNA 3VZLA 3WP6A 2E7AA 3EJKA 4FXKB 1QJU1 4D69A 2NQYA 3HN1A 3N7KA 2Z69A 1AJKA 4UBGA 3NV2A 2QVSB 5C9AC 3M3CA 4GIQA 3ZYIB 5A33B 5CVRA 1O3RA 4AVSA 2XH6A 4YZ2A 2A6ZA 1W6OA 1JYIA 1VAKA 2RMU2 4COWA 3AMPA 4D7YA 2CL2A 2RS13 4JGYB 4WVMA 4W6XA 2W08A 4JRLA 4KH9A 4XFGA 2WFF2 2I2SA 3WCSA 1J3PA 4I0AA 4Q27A 2JG9C 1MQTC 1RUE1 1ZZ8A 2CGNA 1SCSA 5GALA 4Y1UA 3WG1A 3ALQA 2K9ZA 2ETEA 3W9AA 1RUI2 3RNSA 3H1YA 5BV6A 2RJLA 1AL0G 4YFWA 5CA6A 2GC2A 4JCKA 4K9SA 4YZ1A 4TWTA 5FQ0B 3M3IA 4XFFA 5C6CA 2JG9A 2ZJCA 1AR73 2DYCA 4K1ZA 4P9JA 1A3KA 1O4ZA 4AFCA 1EY2A 5BYNA 3VBSC 2G4IA 1ENRA 5K0UC 3QACA 2RS32 1O5UA 1QY4A 4N43B 5JLVA 3A4UA 3CJXA 2VXRA 4XJUA 2UU8A 4E4ZA 4GH4B 2BTVC 4MV2A 5ABJB 5F6KA 3VBSA 5K0UA 2QZ3A 1W6NB 4Q0VA 3MPBA 4Q4X3 2F4PA 1RUG2 2ZMLA 1LOAA 4Q4V3 3VBHB 4OLLA 3VBOA 2ZACA 1XXNA 1AL21 3ZFFC 4FAHA 1RVF2 2ZGKA 2XJQA 4C0BA 1ZRFA 2JG8B 4H3WA 3JBG2 3WDUA 5HCAA 5J37A 2A71A 3ATGA 2E7QA 3ECQA 1LR5A 5A3LA 1O3QA 1G9FA 1JXNA 1E57A 4RD7A 3AK0A 3AYDA 4PLNA 4OHYA 3OTFA 4XXAA 2XPJA 3VHPA 4AEMA 3WCRA 3NAPB 5DZFA 4QPGB 5L7OB 3X29B 5J98B 4Q29A 4PIZA 2GZWA 2WS91 2BFUL 2HWE1 2P34A 2VUJA 1VP6A 3KMHA 1CJPA 4I3GA 3ZFEC 1CPNA 5FMOL 4LE3A 4IV1C 4FXGB 3WXPA 3AFGA 1FOD2 3ZPYA 4AVBA 4FTBA 2EALA 4K1YA 1QJZA 1G9BA 1I5ZA 3ZFEA 1UZZA 4IV1A 2WQ4A 2GH2A 5FDBA 1UU5A 1H4GA 4K6BA 1GFF2 1NY72 4RSUA 3S6PA 4AE2A 3URFA 5JOZA 4Y4YA 1BBT1 1PK6C 1OQDA 3D8CA 1UN1A 1VBA1 1H9PA 1CIWA 1V00A 4EROA 1ND2B 1RUD1 5J3UA 4UW5A 2A3YA 5GM0A 2O0OA 1X82A 4F8AA 1PNGA 1W0OA 4FPYA 3S7IA 1FPN2 4U2AA 1J3RA 1RHI2 5F5QA 3JQXA 4UXAA 3M8LA 4DOUA 5LRSA 2VGDA 3FE5A 3WP4A 4N53C 4N9IA 1ND3B 1EP0A 3V0AB 1G8WA 1MS3A 4PBOA 1Y43B 2R072 3RS6A 1PVC2 2NLRA 1BJQA 4JAAA 1OFNA 2WNUB 3VZNA 1WA4A 2RMU3 3FFQA 4Q4Y2 3QCWA 4RS5C 2WFF3 3ZYPA 1OA4A 3R6SA 5JMCA 4N53A 5CIRA 1W6PA 1XQNA 4AVCA 2D6PA 4KWLA 1RUI3 2D97A 1ZX5A 4GWNA 4IEWA 4RS5A 5AC91 1S0DA 2XVGA 2PAKA 5DG2A 2YGMA 2RS51 5KXEA 1AR92 3KQRA 2E63A 3LA3A 1QJY1 1QJX1 5BNNA 2LUWA 4A3XA 2DWRA 4BLIA 4LTAA