5C3OA

Crystal structure of the c-terminal truncated neurospora crassa t7h (nct7hdeltac) in apo form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
297
structure length
260
Chain Sequence
GSMEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPHPPRYSIAYFCNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thymine dioxygenase
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
source organism Neurospora crassa
total genus 75
structure length 260
sequence length 297
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3oA00
1OBNA 1GP6A 1HB3A 1UO9A 5C3OA 5APAA 1ODMA 1GP5A 2JB4A 1BK0A 1QJEA 1W04A 2CSGA 2VBDA 3ZKYA 1OC1A 1W3VA 5C3SA 1QJFA 1HB2A 2BJSA 3ZKUA 2VBBA 2Y60A 1WA6X 4BB3A 5C3QA 2IVIB 2Y6FA 2VBPA 5C3RA 2IVJA 1BLZA 1W05A 1UOBA 2JB8A 1QIQA 1HB4A 1IPSA 1HJGA 2DBNA 2VCMA 1E5IA 2WO7A 1UNBA 1UOFA 1W3XA 2VAUA 1W2AX 1W03A 3OOXA 3ZOIA 3ON7A 1UZWA 1UOGA 2DBIA 2VE1A 5C3PA 1E5SA 1W2NA 2BRTA 1DCSA 4XAEA 1RXGA 2BU9A 1HB1A 1E5HA 1E5RA 1RXFA 1W06A 1ODNA 1HJFA 1W28A 1W9YA 1GP4A 1W2OA 4RGKA
chains in the Genus database with same CATH superfamily
2WS91 2E32A 2B7YA 4K6BA 4PF5A 1HX6A 1FPN2 1GWKA 1B35A 1D4M3 2GSYA 1HB3A 2UYAA 3MICA 5FAXA 4AGVA 3ZYIB 2IXCA 5IFPA 3H3LA 4Q4Y2 1UZVA 1WA4A 3EHKA 2B39A 1YQCA 2DUOA 1PM4A 5EQUA 4YGDA 2GNTA 2AENA 3USUB 3K3NA 4KNCA 1W0NA 3UKNA 4BQ1A 2K9ZA 1JZ8A 2CGPA 4KMQA 1SDWA 2QDNA 1IGOA 2CSGA 4YVSC 3ZKYA 1ZRFA 3SNMA 3WQBA 1VRH3 5A1AA 2OA2A 4GB31 3T2TA 1JYIA 3VZLA 5FY7A 4DIQA 2VM9A 2ZACA 2PLV3 5ACA1 5IWFA 1S2EA 2XVLA 3LB9A 4QB1A 3S7IA 3ZYJB 4A7YA 1V00A 4I0BA 2Y8KA 1EPWA 1Q56A 3PDQA 3VB9A 4AHWA 1WD4A 2QQIA 1WMXA 4XYXA 3T2PA 4CXYA 3ZR6A 4OVEA 3ZO0B 2WA4A 1ZZ6A 4AQ6A 3O1TA 5F2SA 5JI7A 2B8MA 2QNKA 1MR5A 1Y4WA 3AYAA 3SCHA 3TNQA 5FPXA 4EN6B 5I8SA 2FDFA 1CIWA 3AB0A 1UN1A 1W6OB 4NWWA 4QPIC 5JSRA 1EUTA 4MVTA 3GBWA 1QF3A 3OG2A 2GC2A 2XJRA 2DBNA 3RDIA 4FPJA 4IUGA 4PJYA 4PI2A 4AHZA 5FPUA 1N3PA 3O14A 5B2GB 4XJ8A 4MHUA 1UYYA 5EHDA 1YFYA 3VL9A 3ZYGA 3AZYA 1S0EA 2VZ3A 3MYXA 2ES3A 2TEPA 5GLUA 1HRI3 1WW4A 4MXWA 2B9VA 1K42A 2DCTA 1DQ4A 3NKGA 5F3IA 2BOIA 1XRUA 1W99A 5C3PA 5A1LA 2VXJA 3WNOA 2ARXA 1FOD2 4Q0PA 4CP9A 1V70A 5FDBA 2WZR3 4C1WA 4KH9A 2VZRA 3WDYA 5C8WA 4RGGA 2UURA 1NLQA 3W58A 3GDBA 2EXKA 3T1LA 2GNDA 1HIXA 3VHRA 3ZYPA 5JXGA 4J1WA 4FQ4A 4L0PA 2IXKA 5EYYA 5C9AC 1IHMA 1NAEA 4CCCA 4EV0A 1YRZA 5EYXA 4QHOA 1A78A 2CAVA 2YFZA 3H1YA 1R093 2C0ZA 4LKSA 1PO11 1LNSA 4EQVA 2FHRA 4I2OA 1S4CA 2BVBA 4ZS2A 5C70A 2W1SA 1RXFA 2VGDA 1OURA 1F15A 2R7EB 4HG6B 1T6GC 2A73B 2VOXA 4RHV3 5IT6A 5F3EA 5J7MA 2W0XA 3VBFB 4IEPA 1D0GA 2Z4FA 4KU7A 1UMHA 1PIV1 2UWBA 3OY8A 1AR82 2VMCA 3I3DA 1I5PA 3MLLA 3VZMA 1Q8OA 1XE8A 1US3A 2ZGSA 4V1PA 2WSVA 1PHMA 3WNXA 5FY9A 3VKNA 4LO4B 1WKYA 3WQ7A 4GWMA 3PLQA 1RUJ3 3QH6A 3NAPB 1JHJA 3WP5A 1WLTA 4RS5C 2P3KA 1XSRA 1EV11 4GXLA 5LBEA 3RPQA 3M3CA 3N4MA 2Y6LA 3U1XA 1VBD3 2P2KA 1JODA 3PVBB 3DL3A 1OOPC 1PGW1 2VMFA 2VZVA 3DEMA 4GKYA 4XJ9A 1C8M2 4QX7A 3GZUC 3HD8B 3AMMA 4A7ZA 4LBNA 3VBOB 3GCWA 4Q2FA 2CGNA 1GNYA 1C28A 5FMDA 4I30A 5J37A 2WO1A 1Y9GA 3RWNA 2DVFA 2BTVC 3UGFA 4AE2A 3EO6A 3KT1A 5KR7A 2Z79A 3FMGA 4URAA 3H8XA 1NG0A 1WZXA 5FLIA 4PIYA 3X29B 1UZ0A 4IV3A 2BJSA 2R071 3A21A 4LXLA 5FYHA 1Z0HA 5FZ9A 2XPJA 1VBA1 2RE9A 3UGHA 1BQPA 4LBKA 4J1XA 3VN4A 5BNNB 5FPAA 1S0BA 5D8AA 5F5AA 4KBZA 5H9PA 3DXTA 5CFCC 3VHOA 4AVAA 1F9KA 5BNOB 2RR11 1YQ8A 4LOSA 2Y6FA 4MX3A 1QH7A 1PGL2 1BLZA 1PO23 1GWMA 2RMU2 3H8RA 4L2NA 3LOIA 4HN1A 3NQHA 2RS12 3CIHA 1ZZ9A 2FBEA 1GQHA 4PBOA 2RDSA 3U0ZA 1MS4A 2AZ5A 5C8CB 2WABA 3PVOA 3TWIA 2ARAA 3NMBA 5BYNA 1ZREA 4XBNA 1QQP1 3WW3A 1HDKA 4CEWB 2O8QA 3BTYA 1QJX3 1VPHA 5CIRA 1IQDC 2AACA 4P9JA 4YLZA 2A6XA 4WVZA 3BTAA 3CQOA 1DQ6A 1W2AX 2DVBA 2LUWA 3PU8A 1MS9A 3U11A 4W65A 3WDUA 3WUCA 4QB2A 3MLKA 3IDBB 5K8SA 5L9VA 1BEV1 2O0OA 3A0KA 2IZWA 3MW3A 1DU3D 1UMZA 4WVVA 5JOWA 3R4UA 4YWAA 1CAWB 1OA2A 2AUYA 3H50A 1NCRB 2YDEA 1OLME 2AEZA 4LBMA 4Y24A 1FYUA 2BRTA 1ND3C 5I0RA 1RUE3 3OYWB 3VZKA 1NKGA 2XONA 5HCHA 4XAEA 4JKLA 3E5XA 4L99A 4QB6A 2X8KA 3OGGA 4UFKA 4IGPA 1JUIA 4P5YA 4Q8LA 3D0SA 4BE3A 2AR6A 1S0IA 4L92A 5FR3A 4MH0E 1E57A 2W3JA 4AYUA 4ZONA 1KRIA 1I6XA 1VBE2 3PJQA 2WJSA 1D4M2 4AI9A 3I3BA 1W06A 4YW1A 5JZGC 2I2SA 4ISQA 4DOUA 4N43A 2OIIA 3I2IA 3ABZA 1K5JA 3NNMA 2JG8B 3IDEA 4R4XA 4K40A 1RUC1 4QQOA 2Q1ZB 2CWMA 2P6CA 2WNEA 5DUUA 1VRH2 2BNNA 2RS31 4JC1A 5FXZA 4B7KA 1GV9A 3AVSA 1O8SA 5F39A 3H1MA 2JDPA 2R1BA 4CCMA 1P8JA 3TBDA 4M4PA 1FT9A 5J09A 1VALA 2PLV2 5IK4A 2VTXJ 4CCDA 4Q29A 4BDVB 4OI0A 1VP6A 1Y9MA 1ZBA1 1TMF1 5CB7A 1EAH1 2PHWA 2YC2A 2DURA 2JDAA 3NV4A 4WV8A 4W6WA 1BK0A 1GR3A 4H2AA 5J98B 2Q8CA 3WEZA 2Q1FA 1FMD1 3KF5A 1CAVB 2VBDA 2A6VA 2DFCA 4NOTA 3OJBA 3FBMA 4OLLA 3PUSA 1YQ6A 3KQRA 1K12A 2PQQA 2QQKA 4DEQA 2KA3A 4X6RB 3VUOA 4C8DA 1RUG3 2MHFA 4Y5Z0 3WCRA 1AYN3 1TEIA 2WZEA 2K0GA 4NHMA 4RQPA 1H2MA 3C7HA 1M4WA 1GLHA 5L7OC 1KS4A 1COV3 2NZ9A 2ZOEB 1SCSA 4PF1A 1HRI2 2VBPA 2IXLA 1AYM3 4ISRA 2HWB2 3T0DA 1IQAA 3PIGA 2JB8A 1RUF2 3AMHA 5JMCA 5B4NA 3ME2A 1VBC1 3OUIA 3APBA 4XXAA 1N47A 3SEEA 4XJWA 3V0BB 5G05L 4XMIA 2XL7A 2HWD1 3N9PA 4BQYA 4FPYA 4CEYB 5FMCA 4M3CF 3ZSLA 5DUVA 1H2NA 5DAXA 3K75B 2E9QA 2V4VA 4KL1A 5FZLA 2YYOA 2YB7A 3VZNA 3FLPA 3RZMA 4EN0A 4QKDA 4OYUA 4XFHA 4XJZA 4CPBD 4JAAA 5FLHA 4YGBA 2R061 3H9AA 3G7DA 3AX4A 5A33A 4Z2AA 4CUBA 4LLFA 4QX1A 1ZM1A 1AR73 1R092 1O5UA 2IFWA 2RS53 2ZGLA 4PDWC 4WZCA 5DXDA 5B4XA 5IVEA 5DZFA 4CVUA 2CGOA 5C4WB 1WBFA 4AAPA 5I8TA 1FPN1 4XDQA 4FPLA 4RHV2 2LROA 3J9SA 2WWSA 3POJA 1GNZA 3O5SA 2VOWA 1ZBE3 4Q4Y1 3UETA 2A3WA 2ZGRA 3D3AA 2NLRA 1QKQA 5I0SA 3RZJA 4AI2A 3CZJA 5A6QA 1FV3A 4IGQA 1QWRA 1V6IA 5FZFA 4A45A 1EP0A 2PQSA 4MLOA 4OHZA 1UPIA 2IXHA 3RI8A 3S6PA 2Q8EA 4HXCA 2W1QA 4HVQA 3MI8A 3S5AA 4AFMA 2PAMA 5FWJA 2W39A 1O5LA 1REDA 4FPCA 4NO4A 1UIJA 2VR4A 4LR4A 4Q0SA 4AFCA 1VBD2 2GU9A 1XXNA 1IKPA 3OUHA 4KG8A 3ZFGC 1KFXL 1WW5A 5A7NA 3ORJA 1LEDA 2HWC2 4PBPA 5ABJC 1PZ8A 3OUJA 1OF4A 5JR7B 1JS9A 1SQ4A 2WSUA 5FYBA 4MZUA 4BQWA 3VDDA 3MGUA 4GJYA 3RYRA 5FPLA 2DV9A 5EJZB 2JDHA 3PL0A 3THTA 5IK5A 1QU0A 4XCAA 1PX3A 3WG3A 2W87A 4YSFA 3OB8A 3TN93 1MS0A 1V6NA 3POEA 4N9HA 4GMP3 4BA6A 3BI3A 4HBNA 5DAQA 3S0MA 1ODMA 4AG4A 1BKZA 2PHTA 2CDPA 4XZPA 4CCJA 1TME3 1YFWA 5DMYA 4ET7A 1O3SA 1POQA 2CAUA 2IFRA 4X8NA 4IXLA 4NIHA 5GZDA 2VZ1A 3F2ZA 1LOGA 1PO22 1DP0A 3GHMA 3SITA 1W8TA 1S0FA 2WNOA 5C33A 2QQPA 1HV0A 2FCVA 4YW4A 4MGIE 1SMVA 2A71A 4CCNA 3WD5A 1DQ2A 3IIAA 5I93A 4Y1UA 3KHCA 1ENRA 2BFUS 3LDKA 1MVQA 2RV9A 5DPNA 1G9BA 1MS3A 1FOD1 1MQTB 1QJX2 1CZVA 3SCGA 3ZX7A 4I0WB 2RDQA 5CYYA 4ZPIA 5DAPA 3E6CC 3VBSC 1W90A 4H14A 5FXWA 3UV9A 2QDRA 5AFEA 3WDTA 1CVNA 1UOBA 2GP5A 2WO3A 1IS6A 1W8FA 2Y26A 5FZ8A 3WSOA 4UFJA 2WYFA 4WM8A 5FZMA 2D7FA 1UIKA 2XKOA 3WY6A 1SFPA 4OZOA 3N9OA 2WQ4A 3AP4A 4D6QA 5AVAA 4XQ4A 4C0HA 2WLQA 3NAPA 1RYYA 1RUE2 2VTXA 1OPMA 3Q9OA 4XJUA 1OF3A 3WCSA 4ATFA 5DZEA 3BU7A 4DQAA 5JSPA 1QJY2 1ASJ3 1IS4A 1DGLA 1UCXA 1WMEA 4CZSA 2BVVA 1GUIA 1R082 3VBOA 1ENXA 1AR81 2P34A 5IVBA 4RA0A 3ZIWA 2I74A 5F3GA 1BVVA 2DBIA 4BYYA 4CU8A 3MIEA 5ISLA 1GOFA 1VBB3 2WT2A 3HQXA 3M3QA 3U10A 4P02B 5IVYA 2E63A 1JHNA 3WNPA 1C8NA 3IN9A 2R32A 1JZ7A 2A7AA 4IL7A 2DVAA 2ZHLA 3ECQA 3HOBA 5KXCA 3O1RA 1KEXA 2AC1A 2VJXA 1LESA 3E6BA 4DUWA 1SLAA 4NR1A 2A3XA 4DUVA 2J7MA 2VVEA 1H8TC 1C8M1 4XHXA 2WRAA 5GLTA 3WF3A 2R043 3WW2A 4B1LA 3NKTA 3VBFC 1HB1A 2YC0A 4AK3A 3AC0A 5J96B 2A6YA 1O4YA 2LW8A 4C90A 5I8YA 2VMGA 2XBO3 3LFIA 2W1WA 4LO6B 4F83A 5A7OA 1JZ4A 3POYA 5FO7B 3HEIA 4BQ3A 4LBOA 3ITQA 1QHDA 1WMFA 5IJRA 2JG9C 1JYTA 4MYEA 2E31A 3WV6A 2QKDA 3ZYFA 5C8CA 2ZX1A 3AKSA 3T09A 4ES9A 2W92A 4CEWA 3GJBA 2BBVA 3J8F3 4Y5SA 4ONUA 3KT4A 2OQ7A 2VNVA 4B29A 4COWA 3I2JA 1W2OA 2ERFA 3IB3A 1J1TA 3L2YA 2XGXA 3KVAA 4AEKA 1PGL1 3SH3A 2RMU1 4XURA 5BUVA 2EXIA 3POGA 1UW8A 2RS11 1AX2A 1RUG2 1W2TA 2BP6A 4AVCA 1AYN2 1JU4A 4BXSV 1J84A 2VZUA 3RZHA 1GP5A 2YGMA 1NCRA 3GF6A 3M3OA 5FWEA 4TSVA 5LB6A 3S30A 5BNQA 5BNNC 5FP3A 5LA0A 1AYM2 2ZGNA 2Q8DA 1GU3A 2OS2A 5GALA 1KJLA 4M00A 4NUBA 2JICA 3BUCA 3I3MA 2H0BA 1RTVA 2CV6A 4U2AA 1OT5A 4ZY9A 3S57A 1CR7A 5IAXA 1UD1A 5DAWA 4AAXA 3HNBM 5LA1A 3TEZA 3W59A 1OA4A 4DUXA 4BISA 1Q8PA 4W8JA 1GWLA 1WCUA 3MEPA 2P3JA 1APNA 1F35A 1JYCA 5C3QA 2F4LA 2X53S 4CYDA 4MOAA 5C3RA 3POFA 3C8XA 2XKPA 4FT8A 3RYPA 2JG8A 1ZNPA 1Q5OA 5FTTC 2DU1A 1AR72 2RS52 4P9XA 5FQ0B 2QQJA 4Q26A 3BVCA 2W46A 2ZX2A 4AI1A 2QQNA 2VVFA 1ZZ7A 2YBSA 3DXUA 1VBE1 3LDBA 4LKFA 2WA3A 5BNPB 2VCMA 4N53A 3VDBA 4I0AA 1D4M1 3AZVA 1HW5A 2IXJA 5A6YA 1FNZA 2WO7A 1H4GA 1ZBE2 1LOFA 4PI0A 4CDUC 1OXCA 2Q1MA 4CDQB 3M2MA 1X9PA 2D5FA 3EYPA 4W50A 4HOOA 4MUVA 1LCLA 2JX9A 3SKVA 4JGZC 2AGSA 1YIPA 2D6LX 3WT3A 4E4DX 2GC3A 3WG1A 4UYBA 4BHPA 4BOWA 1Z7S3 4UFIA 1VRH1 4QX3A 3RG0A 1QMJA 2P17A 1LOAA 4AEDB 3HWJA 4E4SA 2EIEA 1W2NA 4PT6A 3WP3A 2PLV1 5A7QA 1TZOA 4DMIA 4LHKA 3MDPA 5CKNA 2J1TA 4LBQB 4N43B 1VAKA 2W47A 4ASLA 1UKRA 4IE4A 3CJIB 1IPKA 2JIGA 2QE3A 3NV2A 3WUDA 3MPPG 4YVWA 3OGJA 2Q0AA 1UL9A 3JCIA 3TN92 5A3UA 3VKOA 5IW0A 2Q5TA 1AVBA 3LIHA 1C1LA 1Y9QA 4FO9A 2D6OX 5DDJ3 1ZRDA 4MXVA 3VKMA 5FP8A 5FYVA 1N3OA 1TME2 5I91A 2LM3A 4NHYA 1BBT3 1GOGA 5KHHA 3ZFFA 1YLLA 2VZSA 4G4FA 3PU3A 1HRI1 3OPWA 2D93A 4M0HA 5DABA 2BYVE 4OCTA 5LBBA 4YPJA 2OW4A 4OHVA 3VKFC 3TYJA 2BWAA 2F17A 1RUF1 2XQXA 2WKKA 3VBRB 2WNVC 5JIUA 1W8HA 2DVDA 5C3OA 5F37A 4D8MA 1I1EA 1XNBA 5FUPA 4FFHA 1AXKA 3IBMA 5H9SA 3NW4A 2OX0A 2B46X 4A42A 4KG0A 4V2WA 1JYXA 2Y6KA 1UYZA 1X50A 4I01A 4MGZE 1AJKA 5CG8A 1U5ZA 1QY4A 2WWJA 2FDKA 3EJKA 3NNGA 1ALYA 2H6BA 3RQ0A 2D43A 4A2UA 1LGCA 1X82A 2WIIB 4Q8KA 3AKPA 3VZJA 4NVPA 4V2VA 4QPWA 4NPLA 2GDFA 5DUXA 1R091 5FUIA 1JZ3A 4Y5TA 3TNPB 1LOEA 4JX0A 1F31A 1IZ3A 3CZUA 1GICA 3AKTA 4IE0A 1WA6X 4LITA 5FIXA 5FBZA 4RHV1 1N3QA 1ONAA 4YM3A 4AHXA 1ASJ2 2RM23 2CHHA 4QQPA 4DXZA 3B00A 3C3VA 2VU9A 1GFF2 2CWSA 2IVJA 1AL23 4JGYB 5L9RA 1V6LA 3T1MA 4ZU7A 5BNOA 1IPJA 3WNKA 2HEVF 4QM8A 3B3QE 5A33B 1JYWA 5LBCA 2QBXA 1XJAA 1YI7A 1LODA 1V9U3 3FX3A 2G9ZA 1SLTA 5LRSA 1AUYA 3AMNA 3HAGA 1GYKA 1BVP1 5K9YA 2GC0A 1HQLA 3CLPA 1LHOA 3GZEA 4XILA 5C4WC 2SLIA 1VBD1 4YRDA 1C5IA 1Y7BA 3B01A 3C2UA 3PHMA 4XC9A 3WDVA 4DPNA 2R042 4H55A 3WG4A 3H0OA 3OOXA 2HWC1 2YC4A 4QQHA 3O1UA 1IS3A 2X5IB 3VBUB 5K0UA 2FMDA 1KDMA 2XBO2 5DN2A 3I2GA 4FPOB 3OTFA 4GA9A 2VVDA 2BFUL 4XFCA 3WQ0A 3AVRA 2FDHA 2EICA 5BV6A 5LW9A 3W9AA 2W52A 2G1MA 5FY1A 2JD9A 2XUEA 2RJ2A 3HBZA 2WNUC 3UKVA 2R30A 1W6QB 4K1ZA 3KMHA 3Q8EA 4S2HA 1MQTA 2IWGB 2R16A 3FLRA 5J1XA 1B35C 3LA3A 3J8F2 1CJPA 2ATFA 1DBNA 3CJXA 3MZHA 5KBFA 1J59A 2D6KA 4JHTA 5JAXA 2WFF3 4P5HA 1DDLA 1PO21 3J7NA 4AQSA 3VDDB 4BQ2A 1CZTA 1HXS2 4LMFA 3AKRA 5A1FA 2GAUA 1ACCA 4QQ2A 1DG6A 1NQDA 2XHKA 4LUKA 4A3XA 4AR2A 4AEMA 5LY2A 1AXZA 1QNYA 1NX9A 1CX1A 5JOXA 3HR9A 4MGSA 1XU2A 2MEV3 1C5HA 3DGTA 4IW3A 4OMCA 1OUXA 3T2OA 1QJX1 1K5MB 1JZ6A 2NP0A 4BIFA 2VUDA 4GH4A 2WC2A 5FFOC 1TQ5A 1GP4A 5GKAC 4XF4A 1R1A3 1DYOA 2LTNA 3GNEA 5L36A 3MLJA 4K1YA 2CTVA 2WAAA 3CNAA 3GBFA 1ZZCA 5FZEA 3HQUA 1V6MA 2VNRA 4SBVA 4FQZA 4QKFA 1N1VA 4QU1A 3BU0A 5EIYB 4K9SA 4LORA 4PIXA 2BV4A 2WZPP 3WF1A 1RUE1 2Y38A 2ZS6B 1XSQA 1XU1A 2A3YA 4UF0A 3VBHA 2R49A 3LF7A 1QJY1 1OC1A 5L9BA 4H3WA 1R081 4M01A 5E16A 4CU6A 5FOJB 5G04L 1UY1A 3DV8A 4DNYA 4LQRA 2P5BA 4WM8B 2IC1A 5FZ0A 5JSOA 3M4FA 3RFRA 4G9SB 1GZWB 2VBBA 5EJ1B 1W0OA 5KC5A 3W5NA 2DF7A 3FN9A 3SCFA 3NJVA 2WZ8A 1BHGA 4BB3A 3LE0A 4HN0A 3IIIA 1ENQA 3PMEA 4LPLA 2WDBA 1AX0A 2D3PA 2QTWB 4JRAA 3B9CA 1QDOA 3WHUA 1W05A 1DYKA 5FMOS 1QXPA 4RR3A 5FMBA 2V73A 3NJYA 1Y43B 1YI9A 1CQ9A 2D6MA 2HBTA 4QKNA 1HLCA 2YROA 5EV7A 5F5QA 2XXZA 5A3NA 3MV11 1PVC3 3ALQA 3FC0A 3FJSA 2VUAA 5FZHA 1JN2P 1HJGA 1JTZX 3ZFEA 3DYMA 4JQTA 4IEOA 2PHXA 4KGGA 5E89A 1XBFA 1L7QA 3L2HA 5FZ4A 1IG3A 3HMYA 2FZ1A 3IAQA 4TN7A 4FXKB 4YGEA 2VO5A 2ZHNA 2XJPA 4JTNA 4XFBA 2DUQA 4FI9A 4QGLA 2EIDA 3CHXA 1Q43A 3ZSJA 2E7AA 4XF9A 2FDGA 5CFDA 5DDJ2 2SBAA 1RUG1 4DXTA 1OD3A 4GKXA 1Q8SA 4FTBA 1AYN1 5E6HA 4QPGA 1DCSA 4HK8A 4NIAA 2ZX0A 3GGLA 1QXJA 1UZYA 4Q4X3 5E8AA 3ELNA 2VMEA 5F32A 3T3YA 3I2DA 1QJU3 3LAGA 1GMMA 5FYCA 3AL6A 4IV1B 4OHYA 4LHNA 1VRBA 2QQWA 1OHFA 3TAYA 3QCWA 4Y4YA 1AYM1 3R0RA 4Q4W3 1LENA 4UWDA 4Z07A 3ZYBA 4NWVA 1HQWA 4O7XA 1HV1A 5FY0A 5FQ0A 4AGRA 1REEA 3GJAA 1ODNA 1RL3A 5EXOA 4Y3OA 4A4AA 5BNPA 4JDNA 1CX4A 4OFGA 4P14A 4XVHA 4HSLA 1BYHA 2HEWF 1YIFA 1HJFA 4MGTA 3FE5A 5C5UA 5T5LA 5FYSA 5JLVA 3LCPA 2D97A 4IV3C 4LKDA 4M3CA 4A44A 1U12A 2Q30A 3ZXDA 4CDQA 3IMMA 3C7OA 1L7RA 4IERA 2OXBA 2VULA 2VOVA 1CJDA 5D8AC 5FYYA 1OBNA 3SH4A 1UY0A 2VUJA 2X09A 4RD7A 5F2WA 1PK6B 3KQ4B 1UMIA 1AR71 2Y6JA 2RS51 2ZGKA 3DUIA 2BUKA 4KQ7A 2PYTA 3SKJE 4D7YA 4MG2A 1HN1A 3DPRB 1S55A 3AMPA 5A7PA 3VDAA 4AEDA 3R4SA 2XJVA 4CCOA 3AFKA 2ZMLA 1ZRRA 5J36A 1RVF3 1ND2B 2RM22 4YG3A 1ZBE1 1LU1A 1UY3A 4LNVA 4D94A 1F2NA 5CNAA 1W04A 4LBQA 1XNTA 4Z82A 5A3LA 4QKBA 4Y33A 4QX0A 5JPNB 1WCKA 2IXIA 3CJIA 3GZTB 4OHXA 1CAUB 1QJFA 5IFTA 3JB8A 5HXMA 1V9U2 4WM7B 4A3ZA 1PIV3 1A34A 1YJKA 1POV0 3KZ4C 2LRPA 2AH2A 3ZM8A 4G3YC 4UBGA 3O7OA 3RJ2X 1GQPA 4N53B 4R9DA 4HKLA 4PIZA 3AZXA 2Z42A 3JXSA 5A3TA 3BOWA 1QJZA 4YG0A 1H2LA 3MF9A 3UNPA 1VB2A 1OFSA 1B09A 1LOBA 3A0NA 2TUNA 1IG0A 2ZBJA 1XE7A 5DZGA 3IDCB 1QIQA 3LOBA 1SPPA 5C71A 4CUCA 4CP2A 1JXNA 4FPFA 1MVEA 1VAMA 4ZU4A 1WW7A 1YFXA 1IPSA 4B4PA 2BW8A 2GN3A 1NE4A 1KITA 2B5HA 1YQ5A 1H4HA 2Y33A 3IKWA 2VW1A 2YHJA 5F6KA 4GMP1 2VZPA 3TN91 3VBRA 4CU7A 3PJYA 2Y0IA 2HKXA 4P9WA 4CUAA 1VR3A 1LJ7A 1W3XA 4OUSA 4PLNA 4YZ5A 1YYNA 1TME1 3HT1A 2CNAA 1FATA 4Q4V3 3ZOIA 5J3UA 1XC6A 3ON7A 2OKXA 2L9LA 4C1XA 4DY3A 2J1VA 1AF9A 4FP3A 4CP1A 4OQ8A 1W9TA 3N7JA 4BQ4A 3ZPOA 4CDXB 2RR13 3NV1A 4YVWB 5GJ6A 1WWYA 2OQ6A 3ILNA 1DF0A 4JDMA 4RSUA 2WT0A 2QQLA 3LFMA 3U78A 4IEQA 4CP0A 3RJRA 5L73A 2WZR2 1AR93 3ZXFA 3FL7A 1Q8QA 4XQWA 4FPHA 1ST8A 1R1A2 1W8UA 3MHZA 1QQP3 3IT8A 1EY2A 2ZKNA 3K51A 3ZFFB 5IVJA 4JGYA 1DHKB 4N7IA 4KU8A 1ULDA 3TRSB 3VLBB 4B1MA 4QHBA 2JDYA 3IM0A 3KV5A 4XPVA 3CF6E 5FYTA 3CU7A 3P6BA 3GHNA 1XNKA 4DFSA 4Q1RA 2EIGA 2QVSB 2QQOA 1NLRA 1DQ0A 2Q4SA 4BQXA 1S2BA 4UAPA 2FDJA 4FSJA 1W8OA 3WNMA 4CU9A 2D3SA 4ZZ8A 4DO0A 3I3QA 3CO2A 4J6GA 1ASJ1 2C6SA 2W08A 2DTYA 3POWA 4RQPC 5FZ3A 1XNDA 2VECA 3BPZA 1MEC3 1F4AA 3MV01 5EPAA 2X10A 4N8MA 5FYZA 5I0TA 2X5IA 3VBUA 1D2QA 5JPMB 4K3UA 1LTEA 3ZXJA 3CDZB 5GLVA 3PIJA 1QH6A 1V6JA 2YFUA 4YM2A 2XHNA 3BALA 1SZBA 1RUJ2 4W6XA 5CAZA 3F95A 1UZZA 4ASMB 5GZGA 1CIYA 4XW3A 1C3HA 1CONA 4IEXA 1X8EA 4K21A 4YFZA 1W6QA 4D7SA 5JXIA 1UY4A 2PXJA 5T52A 2XJTA 4BPZA 1KQRA 1W8WA 2JDZA 2R041 3D5OA 4XTPA 4EZ4A 5LEKA 3W21A 1D2SA 2XBO1 1PVC2 3HJRA 4EWEA 2DCZA 1RIRA 1U5YA 4TLFA 2QQMA 1T6BX 4QPIB 4CCKA 5J48A 3DCQA 4F8AA 3U37A 1AX1A 4BQ5A 1F8VA 4IQPA 2H6CA 4N9IA 1I9RA 4YZ1A 2ZHMA 4UBHA 5FPVA 1PZ9A 4DRVA 2JKBA 1K5MA 5JVVA 3V65A 2PAEA 2ETEA 3J8F1 3VHNA 1G9CA 3ZXAC 4I3GA 2GH2A 2D98A 4GALA 5K0UB 2Y64A 3J7MA 2OPKA 3PTYA 1HXS1 4UOJA 4QMAA 4GJZA 5FYUA 5GZCA 3IPVA 1OVPA 2D44A 2W1UA 4XUTA 1L3JA 1SHWB 3WOGA 2ZJCA 3LEMA 4R9BA 4QXBA 4Q4X2 1QJU2 2P6HA 1OSGA 1UU4A 5HV0A 5JR2A 5BXXA 5F9TA 2JE7A 1HQNA 1LULA 4X8PA 3MIHA 4Q4W2 3WW4A 1DQ1A 1SLBA 3TEYA 3VD4A 4YW5A 3POIA 1UY2A 3PURA 3RSJA 4NE9A 4FPEA 4LIUA 5FXXA 3O0XA 3E1F1 1AL0G 3VDDC 4NRPA 1UPSA 2ORZA 1C1FA 4RFRB 4DY5A 1GZWA 2HWE3 4CCLA 4Z2WA 3B7MA 4P9GA 4P9IA 1RXGA 3MBWA 4CRQA 1URXA 3M3IA 2JDKA 1CESA 2ZMNA 1JU3A 4R4ZA 2W91A 5JUVA 3WNNA 3AJYA 4N90A 5FZOA 1AHSA 4GH4B 5AFBA 4LT5A 3KVBA 3JZVA 4GULA 2JENA 1OA3A 1REFA 2ZA9A 3DKQA 4YZ4A 5FY8A 1OLRA 2YMZA 2EXHA 3HNMA 1UXXX 3FBYA 3LGRA 4A7KA 2A6WA 3KV6A 3N9NA 3H7JA 1OKQA 4RGAA 1BJQA 3OBRA 4CDWA 1RVF2 3K3OA 2C24A 4LBQD 4RS5B 1GQGA 5T54A 1JBCA 1UYXA 4BXFA 2O14A 2XWBB 4XUNA 4Z1VA 1OOPB 4XIKA 4LK7A 4UF0B 3VBHB 3MW4A 1PGSA 3ACGA 4D7TA 2R0HA 1OD5A 4FCAA 4Q4Y3 1QNWA 5A70A 2XJSA 4XTMA 5CKMA 5FZKA 3ETPA 1AR63 3VKLA 2WL1A 1N1YA 4LTAA 4GWNA 2VQUA 5EZWA 1J3RA 1XNCA 1SLCA 1RUH3 2QJVA 2JKXA 5HCAA 1CZSA 4K8FA 5EP9A 4NJ4A 3ZDVA 2NPIA 1LRHA 4FAGA 4WM8C 2WN2A 2ZZJA 3R6SA 5HCFA 4ARXA 3POSA 1FV2A 3MW2A 3NAPC 3GYDA 5ERLA 4IV1A 4I02A 5GLWA 2J1AA 4AOCA 4WVWA 4YARA 3BB6A 4E2QA 2EIBA 5K7PA 5C3SA 4RR3B 1O4TA 5F5CA 5FZGA 4Q0VA 4KWJA 3VHPA 4NAMA 4NIGA 1G6NA 1NA1A 5DUWA 3VBOC 3ZFEB 1RHI3 4Y22A 4DZGA 3UYJA 4XJAA 5DDJ1 3ZR5A 4YGCA 3B69A 4OI2A 4PHZA 1CGPA 4QDQA 1VMHA 4Q4V2 4XFIA 2A5ZA 4BK5A 1RC6A 1J83A 2GH8A 1A8MA 3AM2A 4DXSA 4NPMA 4ZZ5A 1SACA 1COV2 3B93A 3LDRA 2R0FA 3AL5A 2WR9A 3AP5A 3UL2A 1G9AA 1TVGA 2ZAHA 2EF6A 4XXPA 1LEMA 5FP4A 3BGAA 4AQ2A 5BNOC 1PK6A 2OUJA 3VD7A 5CFDB 4P9YA 3HBKA 3PUAA 3DPRA 1XPWA 5HCBA 3UK9A 1AR92 2VQ0A 2VAUA 3KT7A 3B94A 2ENRA 4QPGB 2BEOA 1DQ5A 1XYOA 4Y1VA 4OI4A 5HPOA 4R9CA 3VGIA 1ND2A 3QOPA 5DQ0A 1JZ2A 1WCDJ 2XVGA 2Y34A 5C8CC 5CADA 4AI3A 3NO8A 1HKDA 4CCEA 4J25A 3UT0A 3RZKA 2JEMA 3EMRA 4NROA 4CXWA 1VAVA 3NJZA 3KLSA 4CEWC 3Q8CA 1O91A 1E5SA 3OGVA 1BXHA 1BZWA 1J1LA 2A70A 2WFPA 4W6YA 4BJ0A 4AF9A 1CAUA 3M3EA 4FPKA 4IEVA 5FV3A 4WM7A 1HRV3 1OQDA 3O12A 1RINA 2C9KA 3SMHA 3U14A 4BU2A 1J3PA 1PX4A 4FP2A 3JD73 5A32B 3M1HA 4S2GA 5JZGB 5HI0A 4QX8A 5FBJA 3PMSA 1W6PB 2RM21 2XLAA 3FUQA 3OSDA 1E5HA 3GALA 4GQ7A 4OUMA 3LEGA 1MEC2 3Q8FA 4M3CB 1NCRC 5A3MA 3U4XA 3LZZA 2TNFA 1JOJA 2P3YA 1DYPA 4KWUA 2HYKA 4Y1ZA 5CKQA 3SC7X 4NAOA 2I45A 3RZZA 4A41A 4FTEA 1MZ6A 4P08A 1TNFA 1ZA7A 1KS5A 1V9U1 2YPJA 3IAPA 1VMJA 1G9DA 1W6NA 5LA9A 3GBGA 3ZIXA 4ES8A 4QGNA 2ZABA 1O4ZA 1SFNA 1NCQA 1DZRA 2NYYA 5GM0A 2NM1A 4AWDA 2P4EA 3ZN4A 1JOBA 1ULFA 1MZFA 4KWLA 4WVMB 2W5FA 1NUKA 2ZEXA 1W9FA 5T5JA 2OZJA 3MIBA 4YG6A 3D4KA 5C5TA 3U07A 1JYNA 3WDWA 5IUQA 4MHRA 3HN1A 3K77A 3N9LA 2ET1A 2XVKA 5A7WB 1H9PA 2HLEA 4CDXA 3BTZA 1U5XA 4LE3A 5FK7A 2JG8C 5APAA 2XJQA 4UW6A 1GSLA 2WNVA 1ZVFA 1IKQA 1NXD1 3ATGA 2C1FA 4C0BA 4MGQA 4AFAA 4B4QA 1QJEA 2MPFA 1LKNA 4N53C 5DG2A 3U75A 1O3QA 1LR5A 3LSDA 2QUOA 4ATEA 3H8UA 5L7OB 1JI6A 1LOFC 3DF0A 5IK8A 3MF6A 3KWVA 4MO3M 4TXWA 1SPPB 2PELA 1PM7A 1C57A 2B9UA 1NY72 3H1WA 5FCCA 5H9QA 5LATA 4NIIA 2RDRA 3WF4A 4BK4A 3ZKUA 3B5LB 4UT5A 2BNOA 2JDMA 3FFZA 4FFGA 1RUI3 2Z5WA 3WXPA 3DKWA 1WUVA 4LOTA 1WBLA 3B9IA 4FOQA 5IVFA 1DZTA 4AI8A 2VOTA 4LE4A 1JUHA 2RS13 4EJRA 1OKOA 2F4PA 2GMEA 2MNGA 2FMYA 4IDZA 2WZR1 2XUMA 2D40A 1QOSA 4M3CE 1YC61 2VZOA 4EROA 2VMIA 5KXDA 2DWRA 3CBNA 1R1A1 4FAHA 4AVBA 2QFEA 1HB4A 3PVNA 5CA6A 5CU1A 4KGQA 4S2FA 3LPGA 4E9KA 3M7AA 2ADDA 4YVSA 1E5IA 4NHLA 1EUUA 5IK7A 3SEPA 4PDWB 3MUZ1 2RJKA 3ZPYA 4CEYC 2HWE2 1UF2C 4L97A 2ZEYA 4BCUA 4HANA 1QOTA 2GZWA 2B4KA 3P3NA 3QLQA 3FWEA 3P5BA 4JZRA 4PCRA 5LASA 3ZDSA 4QU2A 2DCYA 3RMXA 2DFBA 4KI5M 1BMV2 3R05A 1G9FA 1POV3 1X33A 3MUY1 4GWJA 5EWSA 3VD5A 1ULOA 3FFQA 5EFUA 4HMZA 4XF0A 1UOGA 4IEZA 2ZMKA 4BLJA 1YQ2A 2OVUA 1RGSA 3T30A 1GKBA 2G9GA 2J1UA 1YUDA 3I8TA 5FYIA 3ACLA 3ZFFC 2ZX4A 3PUHA 2H0VA 5T55A 4EN7B 2VQAA 1LHUA 5FPBA 2BOJA 1VBB2 1VJ2A 4JV4A 5FREA 3IWZA 4D0QA 3WDXA 1RUD3 1N1TA 1OPOA 1RUJ1 2JD4A 3K2OA 4QPIA 3S7EA 4EN8B 1OLQA 4IEWA 4XDPA 4C91A 3A22A 1OH3A 1VBE3 3V0AB 2Y0OA 5E88A 3ZFGB 4AQTA 3MIDA 3JQXA 3DYOA 4Z8BA 1TG7A 4UFHA 3ZXLA 5ABJB 3RWKX 5I0DA 2EVXA 1UU6A 3PUQA 1AR62 3JQWA 1MACA 4JTOA 4IE6A 1S0JA 4RFT0 3H3UA 3OF1A 1PVC1 1RUH2 3LEKA 2TBVA 1UYPA 4NHKA 1K3IA 2DVGA 1W9SA 2OUHA 2UY9A 1T2XA 1V6KA 4EZHA 4GAZA 3BODA 5IAVA 3QH7A 3BKZA 2BBAA 1J3QA 2VD7A 3CL1A 2RHPA 3C7EA 4QHZA 1RMU3 3ZSKA 3ASIA 4JCKA 5FYMA 4E8CA 4RGKA 2Y6HA 2UWAA 3MIGA 1DZQA 4LKEA 1I3HA 1ZX5A 5IYYA 1RJ7A 2G19A 1OFNA 1YCIA 3L9JT 4QM9A 3SHRA 2XG3A 4BIOA 1UAIA 5C9AA 1RHI2 2ZXQA 4PQ9A 3JBG3 3P1IA 2JB4A 2UWCA 4GIQA 5CVRA 4TZDA 5FP9A 2VL4A 3V64A 2XLGA 3NNLA 1D7PM 4QT6A 1U0AA 4XDOA 3W20A 2NQYA 4LA3A 1IS5A 1GOHA 3OCPA 4Q4X1 3IMNA 3LWCA 1VE0A 5A7SA 1OUSA 1QJU1 3K4DA 1BCXA 3KSCA 4UI9L 3VBSB 4ZKTB 1NE6A 2W2IA 1SEFA 5GLZA 2D3RA 4Q4W1 4COVA 3WR0A 4B8EA 2ZHKA 3FUOA 5CZKA 3ZXGA 2J1EA 2PTMA 5K0UC 2RG4A 1KFUL 3HN3A 1OI6A 5CISA 5IVVA 2VCBA 2HWB3 1A6CA 2P1BA 3IPVB 3OPTA 5AC93 1O6UA 4K8RB 1RUF3 5JI9A 3O1SA 2JDUA 4RS5A 5FJHA 4LO5B 2UU8A 5FY5A 1VMFA 4INDA 4QX5A 4N7UA 2O1QA 5JCTA 1OOPA 3BPSA 5ANQA 3AK0A 2HWF3 5LK5A 1MQTC 3WG2A 1NYWA 2DCKA 4XAAA 5FO8B 3RZLA 3NJXA 5JXHA 3BTXA 4F3JA 3PUIA 5LA2A 3N7KA 1O8PA 4NRQA 5FZAA 1HRV2 1D4VB 1YO8A 4IE5A 4OULA 3SH5A 4AZZA 1UNBA 1IOAA 3JD72 4LHLA 5F3CA 2HBUA 3ACHA 3AXEA 2YU2A 4CPBA 2WBKA 2C4XA 5KC6A 1CWPA 1RVF1 3ZN5A 3ACIA 2PHDA 2WS93 1SLLA 3OD4A 1UZWA 3ES1A 4AEJA 4XFFA 4HVRA 4B4RA 4NMIA 5FZOB 5IHRA 3UESA 2PA7A 3KM5A 4META 1H8TB 5CFCA 4WZFA 5L19A 2XMLA 4GH4C 4XIOA 2B42B 4MGYE 3THPA 1Z7S2 4FFIA 4JDOA 2WO2A 2I07B 3OD0A 1VIWB 2JG9B 4RN5A 5HXVA 3WLUA 1YFUA 5FKBA 1MS8A 3KGLA 4CDWB 5JXJA 3AP7A 1Z78A 1DGRA 1JMUB 1PNFA 2EAAA 3OPZA 2YBPA 4GB33 5F5IA 3N35A 5FLJA 2FD8A 4GD4A 2Q8OA 1NZCA 1PMJX 2BGPA 3I49A 5ACA3 4QDRA 4AGGA 2PHUA 3Q8AA 3VBHC 2JJ6A 2Y6GA 2ZCWA 2HWC3 3J4UH 3WNLA 4I3PA 2ZEZA 4AVVA 1DFQA 4OHWA 3BOPA 1Q8VA 2WUHA 3POBA 2HJIA 5T5PA 1LHNA 1V0AA 1MS1A 3OBTA 1H6XA 1S0DA 1ND3A 3D6EA 2CDOA 1BBT2 4LBJA 4Q4V1 2ORXA 2XWJB 1COV1 2FDIA 4EWDA 4AXOA 4XQDA 1R1ZA 3UKTA 4NIDA 2OPWA 4OMDA 2F6BA 1FX5A 4RR3C 1RUI2 5A3PA 2QCSB 4QD2A 1NA1B 4LJHA 1LOCA 3A7QA 4LEJA 2ZGTA 4Y22B 3WINE 4ARYA 3I2HA 4LBLA 5FY4A 3RZGA 1ENSA 3ZFEC 1OMIA 4XCBA 2GC1A 3T08A 5A32A 1AR91 5F7UA 5JZGA 3D0JA 1J58A 4L11A 3BYWA 3ZN6A 1W6PA 1W3VA 3MO4A 3O1OA 2LALA 2BWCA 1UX7A 3OGRA 4OI1A 3T4HB 3A4UA 3TEXA 1HB2A 4HKOA 2YG0A 5D21A 1MZ5A 2JECA 3RI9A 4JVAA 4AW7A 3A23A 2YZ4A 4BMBA 3EQEA 1ZYBA 5KHGA 2QZ2A 3LIGA 1KD7A 5CFDC 3NSTA 3HQRA 3HT2A 2ZKLA 2DU0A 3OBAA 1W8ZA 4LA2A 4ASKA 3I2OA 2DDUA 1PO13 2GNMA 4LIVA 4QPGC 4WVMA 2CU5A 4B3NA 1M06G 1MEC1 3OGSA 2WINB 2BNMA 1AL22 2QZ3A 4YW3A 1BK1A 2VMDA 2VY0A 1I5ZA 1UWWA 4JGZB 4PLOA 3K4AA 4XF1A 2J42A 2WWUA 1PVXA 5LCWL 3ENRA 1QJY3 5A7WA 4AFBA 2FCTA 2PHRA 4XBQA 4CUGA 2PN5A 1R083 3EBRA 1RUD2 1LB2A 4XHBA 2ZGMA 4F7ZA 3USSA 2RDNA 4CE8A 1GZCA 4M0NA 1O3TA 2ZTNA 4R52A 2Z2SB 5BNPC 4UW3A 1QEXA 4JQRA 5FXVA 2E53A 1JW6A 4I09A 5L7OA 3G6JB 1EV13 4QXHA 5LRRA 4JKKA 3BCWA 1RUNA 3E5UA 4TLGA 1DLLA 4CDQC 2XLFA 3KS7A 1YJLA 1DGWX 4YM0A 5A3WA 1ZRCA 1SDDB 5FP7A 4XEZA 1XE0A 1HN0A 1WLCA 2GMPA 4NPRA 2YU1A 1W6NB 3I54A 1FNYA 3N3HA 5I0UA 5CBLA 2W94A 4LO7A 1RMU2 1NCQB 3AKQA 4S2DA 3ZVXA 4AEDC 4Y20A 3NV3A 1SFYA 2BZDA 5TSWA 2ZX3A 4IEUA 4E8DA 1H2KA 3AJZA 1LGNA 2R073 1UX6A 2WQZC 4Q0UA 3LPFA 1VBA3 2PFWA 2WFF2 5FO9B 5A6XA 4BH9A 3MFCA 3DECA 4N43C 3JBG2 3VDCA 1NY71 1LGBA 5FZ1A 4XUOA 4LLOA 3VL8A 3CJIC 3E5QA 4PDWA 4DXRA 2WNVB 1SLIA 1KDKA 5LEJA 3SLIA 5AVPA 4XACA 4D69A 3KF3A 4TYSA 4IGOA 2MEV2 2WLPA 4TTGA 4LULA 4QX2A 3LSEA 1WMDA 3J7HA 4OZXA 5HV4A 5KXBA 1JYVA 5FOBB 3UGGA 1UXZA 1FI2A 1UU5A 3AFGA 4HFSA 2VCCA 5GZEA 1S2KA 1XYNA 4NRMA 1X36A 5FK8A 4CTEA 5D1IA 5IVCA 4YFWA 1X9TA 3R4DB 3LA2A 4HLTA 2DTWA 2EA7A 3ROUA 2VCAA 1D0HA 1DIWA 1SG3A 1X8MA 4DS0A 5AC92 2HWE1 4URTA 3WVJA 1RB8G 1YNAA 2E7QA 4UXAA 3VD3A 3MPBA 1GZ9A 4KBBA 1CAXB 3VBRC 2GN7A 3V0AA 1BEV3 3T0BA 1BMV1 3ZFGA 5A80A 2HWF2 3FHIB 2OYZA 3SISA 4O9GA 5ABJA 1VLNA 3AP6A 2VMHA 3GCXA 1OQEA 3RVHA 4E2GA 1XNAA 1NLSA 3RMYA 2A6ZA 2KM2A 2NMNA 3AZWA 3NWKA 3USUA 3TOJA 4BZ4A 3GM8A 2XOMA 1W0PA 4YVSB 3AMQA 4ZHNA 1QDCA 2V5DA 1VBB1 2UYBA 2ZGQA 4QGMA 4COYA 3PVEA 4ZXKA 4U36A 1LHVA 3QACA 4D6RA 4ZS3A 1OH4A 3FHQA 5SV8A 3H7YA 3GZAA 5KWRA 2E6VA 3Q8BA 2VOKA 2WS92 4SLIA 1W8NA 4QDSA 4UW4A 4COUA 3UJQA 1PMIA 2WN3A 1ULCA 2PAKA 1DGWA 4HPKB 2VW0A 1UKGA 3E6DA 3AZZA 4XOGA 1RJ8A 1S0GA 1AR61 1PMHX 1ZA4A 2EALA 2O8OA 3I59B 3I7DA 4DB5A 2VUCA 4QPYA 2OZ6A 2XR4A 4JGYC 3MIFA 1RUH1 5T50A 4EN9B 3EXUA 5FJKA 1RUC3 5E1RA 3UJOA 3AYEA 4BLIA 1FAYA 3OEAA 1W6MB 2RS33 2WNUB 3E97A 3N7LA 4E4ZA 5F6LB 1W6OA 2R1DA 4GB32 4XZUG 3DYPA 3WQ1A 3H42B 3VV1A 5KHKA 1B35B 4MSVA 3K4ZA 4ITCA 1G86A 1F4HA 1XOYA 4H7MA 3VBSA 3MFAA 1PNGA 5ACA2 2VQTA 5FZ6A 4BM8A 3OEBA 5KXEA 2YPDA 2XDVA 4HKWA 1ZBA3 3JB4C 1TMF3 1EAH3 1TE1B 2XB6C 4FOYA 3H3ZA 4FOWA 3WF2A 3KGZA 2X5IC 1RHI1 3VBUC 2GNBA 1KJRA 1FMD3 1G7YA 1H8VA 4LHSA 4QWNA 1H0BA 2B45X 2A75A 2ZAAA 3D82A 2JWPA 5FRAA 3ST7A 3QBQA 4YYOA 1LAJA 3O1PA 4AI0A 5FPZA 4RYDA 2VNOA 4K7JA 4IESA 1E5RA 1NZIA 3O0VA 2XL9A 2QQUA 2A1XA 3ZMOA 1WLDA 1V6OA 1AXYA 3I2FA 4GZ9A 4CDUB 1NOVA 1H30A 3WP6A 1K45A 2EXJA 2HH9A 4X6QB 5DG1A 1FXZA 5K4LA 5C9AB 2CYFA 2ZGOA 3KV4A 4JRLA 4KWKA 5FZ7A 2K2SA 5A3OA 2DYCA 1YHFA 2AYHA 3LKJA 2W95A 3T4VA 1W28A 5FKCA 3N36A 1W9YA 2FZ2A 3PTRB 2ZEWA 4A6OA 5C6CA 2ADEA 3B02A 3FHAA 4RL7A 1AJOA 4HETA 5FMOL 1VBC3 1ULPA 3WX5A 1GP6A 4FPGA 2N7GA 3JUUA 1ZZBA 3KB5A 3BIWE 2CY6A 1UO9A 2C9AA 2HWD3 1H8TA 2W68A 1K5MC 4YW6A 1ULGA 3KHBA 3BIEA 4DRRA 3WF0A 3VBFA 1LHWA 3ZXKA 1YWKA 1YXWA 3HPNA 1GZTA 4EYUA 4IE7A 1HRV1 2FQPA 4MXWB 4B7EA 4ZXEA 4E4HA 2R063 2JG9A 3JD71 2G4IA 4M4RA 5FZCA 1DGRN 2GALA 2J1SA 4MADA 4XUPA 1PO12 5JOYA 2ZGUA 3HIFA 4CP9B 1RUOA 1FPN3 3KCXA 5C7GA 1L7LA 4P9LA 1OLMA 1Q3EA 3N7MA 4O61A 3ETQA 3T0AA 2C5DA 4HVOA 3LA7A 2Y60A 3CKHA 4R8HA 3I97A 1PIV2 1OVSA 1Z7S1 4XABA 2V4AA 2KXLA 1W39A 1SBDA 1H1AA 3INAA 4XFAA 2GP3A 5T5OA 1G8WA 3I3EA 1H6YA 1EYBA 1WGPA 1S0CA 4NN0A 2JE8A 3AP9A 3QD6A 5IATA 5LK7B 4LO8A 4YW7A 5LZ6A 1ULEA 1EV12 4WBBA 5FUNA 1S1AA 2OT7A 3C7FA 5BNNA 3TEWA 5CFCB 5CEHA 4OUEA 1F5FA 1PGW2 1PZ7A 3RGBA 1MPXA 3KD4A 4AHYA 2XH6A 5D2AA 4YNIA 3FZ3A 4XF3A 1UOJA 3ZYHA 1SCRA 3NNFA 3THDA 3OY8B 4L9BA 2JDNA 3ZMNA 4DINB 1CD3G 5JIAA 3O1VA 5BPXA 5SV5A 2ARCA 3AYCA 3SQOA 5JOZA 1H1MA 4L8QA 4HSJA 4HONA 4FBFA 1ZRIA 2ZPXA 4AFDA 4TWTA 5HBAA 2VE1A 2PMWB 3KCYA 4CDWC 5GZFA 2R072 1BBT1 3ZXEA 3AYDA 2XJUA 3IDAA 4ORFA 2BGCA 1VBA2 3BN6A 4AL9A 1JZ5A 2ARBA 2HEYF 2AREA 3RYKA 1R64A 3LEIA 1O7FA 5F8PA 4H7LA 1TNRA 5FZIA 2C26A 4D6SA 1F5JA 2RR12 1UQXA 1RUI1 2V72A 4W4ZA 3URFA 4Z92B 2LS6A 3ZLIA 5CG9A 2BU9A 3ZSMA 2ZZQA 1HXS3 2G9FA 5JDBA 3HNYM 1CPNA 1KGYA 2YBKA 5LY1A 1CPMA 2DCJA 3W5MA 3SXWA 4HT1T 1ND3B 4IV3B 2D6PA 1CAWA 4FVVA 4AVSA 1C4RA 4CDUA 1QQP2 1DLCA 4XE9A 4BMEA 4Y1XA 4E2SA 2VC9A 1FOD3 3OYWA 3ACFA 1U5IA 1X7NA 5D8AB 4IV1C 4JGZA 1US2A 4ZU5A 1MS5A 2ZGPA 5M0TA 1NXMA 2E7TA 1W9WA 3JU9A 5LWBA 4HZFA 3KV9A 3OBZA 4Y1YA 4OQ9A 3S5QA 4Q1PA 5BY5A 2BERA 2QQVA 5A6ZA 5FZBA 2VTFA 4JHZA 1NA1C 2ID4A 3RS6A 1VB4A 3K46A 1BEV2 2R6QA 1POV1 2RVAA 1CN1A 4CXXA 3CMGA 3LD8A 3ZN6B 2RJLA 1XYPA 2AEYA 4FFFA 3VD9A 1AL21 1GBGA 1MZEA 4NHXA 3PNAA 3EB7A 2ILMA 3M8LA 1Y3TA 3HVDA 4FOVA 2IUWA 2CL2A 4UFLA 4YM1A 3VZOA 4XBLA 4YW2A 5T3NA 4PQQA 1XQNA 4E27A 4Q0QA 2YUEA 4JKMA 5F1RA 1KXGA 2PHLA 2WT1A 4K20A 1RUD1 4QXCA 3GXUA 3WW1A 1WD3A 1AR83 1EPZA 1PK6C 2WAOA 4A6SA 3D8CA 4CSWA 2NN8A 2X05A 4D3WA 4O65A 2PHFA 3ZSEA 3DPRC 3TB0A 3CEWA 2VZTA 4AVTA 2BDRA 1W2UA 2BQPA 1JOPA 1ND2C 2JIJA 1LECA 3ILRA 3NVCA 2V5YA 3NL1A 2VZQA 2E51A 1STMA 5KHIA 2XQRA 1C8M3 1CAVA 1RUC2 1SBEA 2IVIB 2Z69A 3FLTA 3N9MA 3O0WA 2YY1A 2WYSA 1A3KA 3RNSA 4QXKA 2RS32 4P00B 4WM7C 2ET7A 1QOOA 4R9AA 3NRUA 1RMU1 4XMAA 4BWOA 5DAVA 2WQ8A 4IETA 2VG9A 3K48A 2JXAA 4UW5A 5H9RA 4YZ3A 1N1SA 1LU2A 3AXDA 5LBFA 1ZBA2 1TMF2 1EAH2 4XUQA 2WFF1 3J7LA 4Q5OA 3THCA 1O3RA 2EAKA 2BPA2 4FTSA 4GWIA 4UFMA 3ES4A 3JBG1 1FMD2 1UOFA 4HK9A 1NQJA 1WW6A 4EE2A 1ZZ8A 2X29A 1W03A 2YXSA 3V56A 3WZ1A 2P3IA 2KR2A 4QAWA 2W9XA 4EWAA 1GANA 1WLWA 1XB9A 4PLMA 2RMU3 4XFGA 4XETA 1QXRA 2MEV1 1CAXA 5JMOA 4Y20B 4IEYA 3V0BA 1JH5A 1NCQC 2V09A 3NNJA 2FCUA 4QQLA 4DEVA 2KD7A 2VPVA 5ANNA 4CEYA 4O9EA 2UY8A 3I4IA 1A8DA 1RITA 1WCSA 4CA9A 2VW2A 1WCQA 2D6NA 2E26A 1QGLA 3ILFA 1H1IA 2HWB1 3IZOA 3LQCA 4GMP0 4LUMA 5AC91 2JE9A 4CDXC 2K46A 2E33A 1NT0A 2HYXA 2VH9A 3J26N 4YVWC 3WHTA 1VBC2 2J22A 2NMOA 4Q27A 1H9WA 2VXRA 2DUPA 3N9QA 2YGLA 4LK6A 5C4WA 3ZYRA 2J1RA 2HWF1 2HWD2 3T2QA 1GNHA 2YV8A 4RQPB 4Y4RA 2GMMA 4HPKA 5EJ3A 2D5HA 3C7GA 3P3PA 5FZDA 3O1MA 3U4SA 4COZA 3H8OA 3M70A 4HL0A 3I59A 3I2KA 4MV2A 3WP4A 4YZ2A 2BGOA 2P37A 5JWPA 4FXGB 2R062 4MGKE 1AZDA 3KCCA 1OQ1A 1YEWA 1O59A 1SBFA 2VNGA 3RRDA 3DN7A 4Y26A 5KHJA 1W6MA 2WNUA
chains in the Genus database with same CATH topology
1OBNA 1GP6A 1HB3A 1UO9A 5C3OA 5APAA 1ODMA 1GP5A 2JB4A 1BK0A 1QJEA 1W04A 2CSGA 2VBDA 3ZKYA 1OC1A 1W3VA 5C3SA 1QJFA 1HB2A 2BJSA 3ZKUA 2VBBA 2Y60A 1WA6X 4BB3A 5C3QA 2IVIB 2Y6FA 2VBPA 5C3RA 2IVJA 1BLZA 1W05A 1UOBA 2JB8A 1QIQA 1HB4A 1IPSA 1HJGA 2DBNA 2VCMA 1E5IA 2WO7A 1UNBA 1UOFA 1W3XA 2VAUA 1W2AX 1W03A 3OOXA 3ZOIA 3ON7A 1UZWA 1UOGA 2DBIA 2VE1A 5C3PA 1E5SA 1W2NA 2BRTA 1DCSA 4XAEA 1RXGA 2BU9A 1HB1A 1E5HA 1E5RA 1RXFA 1W06A 1ODNA 1HJFA 1W28A 1W9YA 1GP4A 1W2OA 4RGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OBN A;  1GP6 A;  1HB3 A;  1UO9 A;  5C3O A;  5APA A;  1ODM A;  1GP5 A;  2JB4 A;  1BK0 A;  1QJE A;  1W04 A;  2CSG A;  2VBD A;  3ZKY A;  1OC1 A;  1W3V A;  5C3S A;  1QJF A;  1HB2 A;  2BJS A;  3ZKU A;  2VBB A;  2Y60 A;  1WA6 X;  4BB3 A;  5C3Q A;  2IVI B;  2Y6F A;  2VBP A;  5C3R A;  2IVJ A;  1BLZ A;  1W05 A;  1UOB A;  2JB8 A;  1QIQ A;  1HB4 A;  1IPS A;  1HJG A;  2DBN A;  2VCM A;  1E5I A;  2WO7 A;  1UNB A;  1UOF A;  1W3X A;  2VAU A;  1W2A X;  1W03 A;  3OOX A;  3ZOI A;  3ON7 A;  1UZW A;  1UOG A;  2DBI A;  2VE1 A;  5C3P A;  1E5S A;  1W2N A;  2BRT A;  1DCS A;  4XAE A;  1RXG A;  2BU9 A;  1HB1 A;  1E5H A;  1E5R A;  1RXF A;  1W06 A;  1ODN A;  1HJF A;  1W28 A;  1W9Y A;  1GP4 A;  1W2O A;  4RGK A; 
#chains in the Genus database with same CATH topology
 2WS9 1;  2E32 A;  2B7Y A;  4K6B A;  4PF5 A;  1HX6 A;  1FPN 2;  1GWK A;  1B35 A;  1D4M 3;  2GSY A;  1HB3 A;  2UYA A;  3MIC A;  5FAX A;  4AGV A;  3ZYI B;  2IXC A;  5IFP A;  3H3L A;  4Q4Y 2;  1UZV A;  1WA4 A;  3EHK A;  2B39 A;  1YQC A;  2DUO A;  1PM4 A;  5EQU A;  4YGD A;  2GNT A;  2AEN A;  3USU B;  3K3N A;  4KNC A;  1W0N A;  3UKN A;  4BQ1 A;  2K9Z A;  1JZ8 A;  2CGP A;  4KMQ A;  1SDW A;  2QDN A;  1IGO A;  2CSG A;  4YVS C;  3ZKY A;  1ZRF A;  3SNM A;  3WQB A;  1VRH 3;  5A1A A;  2OA2 A;  4GB3 1;  3T2T A;  1JYI A;  3VZL A;  5FY7 A;  4DIQ A;  2VM9 A;  2ZAC A;  2PLV 3;  5ACA 1;  5IWF A;  1S2E A;  2XVL A;  3LB9 A;  4QB1 A;  3S7I A;  3ZYJ B;  4A7Y A;  1V00 A;  4I0B A;  2Y8K A;  1EPW A;  1Q56 A;  3PDQ A;  3VB9 A;  4AHW A;  1WD4 A;  2QQI A;  1WMX A;  4XYX A;  3T2P A;  4CXY A;  3ZR6 A;  4OVE A;  3ZO0 B;  2WA4 A;  1ZZ6 A;  4AQ6 A;  3O1T A;  5F2S A;  5JI7 A;  2B8M A;  2QNK A;  1MR5 A;  1Y4W A;  3AYA A;  3SCH A;  3TNQ A;  5FPX A;  4EN6 B;  5I8S A;  2FDF A;  1CIW A;  3AB0 A;  1UN1 A;  1W6O B;  4NWW A;  4QPI C;  5JSR A;  1EUT A;  4MVT A;  3GBW A;  1QF3 A;  3OG2 A;  2GC2 A;  2XJR A;  2DBN A;  3RDI A;  4FPJ A;  4IUG A;  4PJY A;  4PI2 A;  4AHZ A;  5FPU A;  1N3P A;  3O14 A;  5B2G B;  4XJ8 A;  4MHU A;  1UYY A;  5EHD A;  1YFY A;  3VL9 A;  3ZYG A;  3AZY A;  1S0E A;  2VZ3 A;  3MYX A;  2ES3 A;  2TEP A;  5GLU A;  1HRI 3;  1WW4 A;  4MXW A;  2B9V A;  1K42 A;  2DCT A;  1DQ4 A;  3NKG A;  5F3I A;  2BOI A;  1XRU A;  1W99 A;  5C3P A;  5A1L A;  2VXJ A;  3WNO A;  2ARX A;  1FOD 2;  4Q0P A;  4CP9 A;  1V70 A;  5FDB A;  2WZR 3;  4C1W A;  4KH9 A;  2VZR A;  3WDY A;  5C8W A;  4RGG A;  2UUR A;  1NLQ A;  3W58 A;  3GDB A;  2EXK A;  3T1L A;  2GND A;  1HIX A;  3VHR A;  3ZYP A;  5JXG A;  4J1W A;  4FQ4 A;  4L0P A;  2IXK A;  5EYY A;  5C9A C;  1IHM A;  1NAE A;  4CCC A;  4EV0 A;  1YRZ A;  5EYX A;  4QHO A;  1A78 A;  2CAV A;  2YFZ A;  3H1Y A;  1R09 3;  2C0Z A;  4LKS A;  1PO1 1;  1LNS A;  4EQV A;  2FHR A;  4I2O A;  1S4C A;  2BVB A;  4ZS2 A;  5C70 A;  2W1S A;  1RXF A;  2VGD A;  1OUR A;  1F15 A;  2R7E B;  4HG6 B;  1T6G C;  2A73 B;  2VOX A;  4RHV 3;  5IT6 A;  5F3E A;  5J7M A;  2W0X A;  3VBF B;  4IEP A;  1D0G A;  2Z4F A;  4KU7 A;  1UMH A;  1PIV 1;  2UWB A;  3OY8 A;  1AR8 2;  2VMC A;  3I3D A;  1I5P A;  3MLL A;  3VZM A;  1Q8O A;  1XE8 A;  1US3 A;  2ZGS A;  4V1P A;  2WSV A;  1PHM A;  3WNX A;  5FY9 A;  3VKN A;  4LO4 B;  1WKY A;  3WQ7 A;  4GWM A;  3PLQ A;  1RUJ 3;  3QH6 A;  3NAP B;  1JHJ A;  3WP5 A;  1WLT A;  4RS5 C;  2P3K A;  1XSR A;  1EV1 1;  4GXL A;  5LBE A;  3RPQ A;  3M3C A;  3N4M A;  2Y6L A;  3U1X A;  1VBD 3;  2P2K A;  1JOD A;  3PVB B;  3DL3 A;  1OOP C;  1PGW 1;  2VMF A;  2VZV A;  3DEM A;  4GKY A;  4XJ9 A;  1C8M 2;  4QX7 A;  3GZU C;  3HD8 B;  3AMM A;  4A7Z A;  4LBN A;  3VBO B;  3GCW A;  4Q2F A;  2CGN A;  1GNY A;  1C28 A;  5FMD A;  4I30 A;  5J37 A;  2WO1 A;  1Y9G A;  3RWN A;  2DVF A;  2BTV C;  3UGF A;  4AE2 A;  3EO6 A;  3KT1 A;  5KR7 A;  2Z79 A;  3FMG A;  4URA A;  3H8X A;  1NG0 A;  1WZX A;  5FLI A;  4PIY A;  3X29 B;  1UZ0 A;  4IV3 A;  2BJS A;  2R07 1;  3A21 A;  4LXL A;  5FYH A;  1Z0H A;  5FZ9 A;  2XPJ A;  1VBA 1;  2RE9 A;  3UGH A;  1BQP A;  4LBK A;  4J1X A;  3VN4 A;  5BNN B;  5FPA A;  1S0B A;  5D8A A;  5F5A A;  4KBZ A;  5H9P A;  3DXT A;  5CFC C;  3VHO A;  4AVA A;  1F9K A;  5BNO B;  2RR1 1;  1YQ8 A;  4LOS A;  2Y6F A;  4MX3 A;  1QH7 A;  1PGL 2;  1BLZ A;  1PO2 3;  1GWM A;  2RMU 2;  3H8R A;  4L2N A;  3LOI A;  4HN1 A;  3NQH A;  2RS1 2;  3CIH A;  1ZZ9 A;  2FBE A;  1GQH A;  4PBO A;  2RDS A;  3U0Z A;  1MS4 A;  2AZ5 A;  5C8C B;  2WAB A;  3PVO A;  3TWI A;  2ARA A;  3NMB A;  5BYN A;  1ZRE A;  4XBN A;  1QQP 1;  3WW3 A;  1HDK A;  4CEW B;  2O8Q A;  3BTY A;  1QJX 3;  1VPH A;  5CIR A;  1IQD C;  2AAC A;  4P9J A;  4YLZ A;  2A6X A;  4WVZ A;  3BTA A;  3CQO A;  1DQ6 A;  1W2A X;  2DVB A;  2LUW A;  3PU8 A;  1MS9 A;  3U11 A;  4W65 A;  3WDU A;  3WUC A;  4QB2 A;  3MLK A;  3IDB B;  5K8S A;  5L9V A;  1BEV 1;  2O0O A;  3A0K A;  2IZW A;  3MW3 A;  1DU3 D;  1UMZ A;  4WVV A;  5JOW A;  3R4U A;  4YWA A;  1CAW B;  1OA2 A;  2AUY A;  3H50 A;  1NCR B;  2YDE A;  1OLM E;  2AEZ A;  4LBM A;  4Y24 A;  1FYU A;  2BRT A;  1ND3 C;  5I0R A;  1RUE 3;  3OYW B;  3VZK A;  1NKG A;  2XON A;  5HCH A;  4XAE A;  4JKL A;  3E5X A;  4L99 A;  4QB6 A;  2X8K A;  3OGG A;  4UFK A;  4IGP A;  1JUI A;  4P5Y A;  4Q8L A;  3D0S A;  4BE3 A;  2AR6 A;  1S0I A;  4L92 A;  5FR3 A;  4MH0 E;  1E57 A;  2W3J A;  4AYU A;  4ZON A;  1KRI A;  1I6X A;  1VBE 2;  3PJQ A;  2WJS A;  1D4M 2;  4AI9 A;  3I3B A;  1W06 A;  4YW1 A;  5JZG C;  2I2S A;  4ISQ A;  4DOU A;  4N43 A;  2OII A;  3I2I A;  3ABZ A;  1K5J A;  3NNM A;  2JG8 B;  3IDE A;  4R4X A;  4K40 A;  1RUC 1;  4QQO A;  2Q1Z B;  2CWM A;  2P6C A;  2WNE A;  5DUU A;  1VRH 2;  2BNN A;  2RS3 1;  4JC1 A;  5FXZ A;  4B7K A;  1GV9 A;  3AVS A;  1O8S A;  5F39 A;  3H1M A;  2JDP A;  2R1B A;  4CCM A;  1P8J A;  3TBD A;  4M4P A;  1FT9 A;  5J09 A;  1VAL A;  2PLV 2;  5IK4 A;  2VTX J;  4CCD A;  4Q29 A;  4BDV B;  4OI0 A;  1VP6 A;  1Y9M A;  1ZBA 1;  1TMF 1;  5CB7 A;  1EAH 1;  2PHW A;  2YC2 A;  2DUR A;  2JDA A;  3NV4 A;  4WV8 A;  4W6W A;  1BK0 A;  1GR3 A;  4H2A A;  5J98 B;  2Q8C A;  3WEZ A;  2Q1F A;  1FMD 1;  3KF5 A;  1CAV B;  2VBD A;  2A6V A;  2DFC A;  4NOT A;  3OJB A;  3FBM A;  4OLL A;  3PUS A;  1YQ6 A;  3KQR A;  1K12 A;  2PQQ A;  2QQK A;  4DEQ A;  2KA3 A;  4X6R B;  3VUO A;  4C8D A;  1RUG 3;  2MHF A;  4Y5Z 0;  3WCR A;  1AYN 3;  1TEI A;  2WZE A;  2K0G A;  4NHM A;  4RQP A;  1H2M A;  3C7H A;  1M4W A;  1GLH A;  5L7O C;  1KS4 A;  1COV 3;  2NZ9 A;  2ZOE B;  1SCS A;  4PF1 A;  1HRI 2;  2VBP A;  2IXL A;  1AYM 3;  4ISR A;  2HWB 2;  3T0D A;  1IQA A;  3PIG A;  2JB8 A;  1RUF 2;  3AMH A;  5JMC A;  5B4N A;  3ME2 A;  1VBC 1;  3OUI A;  3APB A;  4XXA A;  1N47 A;  3SEE A;  4XJW A;  3V0B B;  5G05 L;  4XMI A;  2XL7 A;  2HWD 1;  3N9P A;  4BQY A;  4FPY A;  4CEY B;  5FMC A;  4M3C F;  3ZSL A;  5DUV A;  1H2N A;  5DAX A;  3K75 B;  2E9Q A;  2V4V A;  4KL1 A;  5FZL A;  2YYO A;  2YB7 A;  3VZN A;  3FLP A;  3RZM A;  4EN0 A;  4QKD A;  4OYU A;  4XFH A;  4XJZ A;  4CPB D;  4JAA A;  5FLH A;  4YGB A;  2R06 1;  3H9A A;  3G7D A;  3AX4 A;  5A33 A;  4Z2A A;  4CUB A;  4LLF A;  4QX1 A;  1ZM1 A;  1AR7 3;  1R09 2;  1O5U A;  2IFW A;  2RS5 3;  2ZGL A;  4PDW C;  4WZC A;  5DXD A;  5B4X A;  5IVE A;  5DZF A;  4CVU A;  2CGO A;  5C4W B;  1WBF A;  4AAP A;  5I8T A;  1FPN 1;  4XDQ A;  4FPL A;  4RHV 2;  2LRO A;  3J9S A;  2WWS A;  3POJ A;  1GNZ A;  3O5S A;  2VOW A;  1ZBE 3;  4Q4Y 1;  3UET A;  2A3W A;  2ZGR A;  3D3A A;  2NLR A;  1QKQ A;  5I0S A;  3RZJ A;  4AI2 A;  3CZJ A;  5A6Q A;  1FV3 A;  4IGQ A;  1QWR A;  1V6I A;  5FZF A;  4A45 A;  1EP0 A;  2PQS A;  4MLO A;  4OHZ A;  1UPI A;  2IXH A;  3RI8 A;  3S6P A;  2Q8E A;  4HXC A;  2W1Q A;  4HVQ A;  3MI8 A;  3S5A A;  4AFM A;  2PAM A;  5FWJ A;  2W39 A;  1O5L A;  1RED A;  4FPC A;  4NO4 A;  1UIJ A;  2VR4 A;  4LR4 A;  4Q0S A;  4AFC A;  1VBD 2;  2GU9 A;  1XXN A;  1IKP A;  3OUH A;  4KG8 A;  3ZFG C;  1KFX L;  1WW5 A;  5A7N A;  3ORJ A;  1LED A;  2HWC 2;  4PBP A;  5ABJ C;  1PZ8 A;  3OUJ A;  1OF4 A;  5JR7 B;  1JS9 A;  1SQ4 A;  2WSU A;  5FYB A;  4MZU A;  4BQW A;  3VDD A;  3MGU A;  4GJY A;  3RYR A;  5FPL A;  2DV9 A;  5EJZ B;  2JDH A;  3PL0 A;  3THT A;  5IK5 A;  1QU0 A;  4XCA A;  1PX3 A;  3WG3 A;  2W87 A;  4YSF A;  3OB8 A;  3TN9 3;  1MS0 A;  1V6N A;  3POE A;  4N9H A;  4GMP 3;  4BA6 A;  3BI3 A;  4HBN A;  5DAQ A;  3S0M A;  1ODM A;  4AG4 A;  1BKZ A;  2PHT A;  2CDP A;  4XZP A;  4CCJ A;  1TME 3;  1YFW A;  5DMY A;  4ET7 A;  1O3S A;  1POQ A;  2CAU A;  2IFR A;  4X8N A;  4IXL A;  4NIH A;  5GZD A;  2VZ1 A;  3F2Z A;  1LOG A;  1PO2 2;  1DP0 A;  3GHM A;  3SIT A;  1W8T A;  1S0F A;  2WNO A;  5C33 A;  2QQP A;  1HV0 A;  2FCV A;  4YW4 A;  4MGI E;  1SMV A;  2A71 A;  4CCN A;  3WD5 A;  1DQ2 A;  3IIA A;  5I93 A;  4Y1U A;  3KHC A;  1ENR A;  2BFU S;  3LDK A;  1MVQ A;  2RV9 A;  5DPN A;  1G9B A;  1MS3 A;  1FOD 1;  1MQT B;  1QJX 2;  1CZV A;  3SCG A;  3ZX7 A;  4I0W B;  2RDQ A;  5CYY A;  4ZPI A;  5DAP A;  3E6C C;  3VBS C;  1W90 A;  4H14 A;  5FXW A;  3UV9 A;  2QDR A;  5AFE A;  3WDT A;  1CVN A;  1UOB A;  2GP5 A;  2WO3 A;  1IS6 A;  1W8F A;  2Y26 A;  5FZ8 A;  3WSO A;  4UFJ A;  2WYF A;  4WM8 A;  5FZM A;  2D7F A;  1UIK A;  2XKO A;  3WY6 A;  1SFP A;  4OZO A;  3N9O A;  2WQ4 A;  3AP4 A;  4D6Q A;  5AVA A;  4XQ4 A;  4C0H A;  2WLQ A;  3NAP A;  1RYY A;  1RUE 2;  2VTX A;  1OPM A;  3Q9O A;  4XJU A;  1OF3 A;  3WCS A;  4ATF A;  5DZE A;  3BU7 A;  4DQA A;  5JSP A;  1QJY 2;  1ASJ 3;  1IS4 A;  1DGL A;  1UCX A;  1WME A;  4CZS A;  2BVV A;  1GUI A;  1R08 2;  3VBO A;  1ENX A;  1AR8 1;  2P34 A;  5IVB A;  4RA0 A;  3ZIW A;  2I74 A;  5F3G A;  1BVV A;  2DBI A;  4BYY A;  4CU8 A;  3MIE A;  5ISL A;  1GOF A;  1VBB 3;  2WT2 A;  3HQX A;  3M3Q A;  3U10 A;  4P02 B;  5IVY A;  2E63 A;  1JHN A;  3WNP A;  1C8N A;  3IN9 A;  2R32 A;  1JZ7 A;  2A7A A;  4IL7 A;  2DVA A;  2ZHL A;  3ECQ A;  3HOB A;  5KXC A;  3O1R A;  1KEX A;  2AC1 A;  2VJX A;  1LES A;  3E6B A;  4DUW A;  1SLA A;  4NR1 A;  2A3X A;  4DUV A;  2J7M A;  2VVE A;  1H8T C;  1C8M 1;  4XHX A;  2WRA A;  5GLT A;  3WF3 A;  2R04 3;  3WW2 A;  4B1L A;  3NKT A;  3VBF C;  1HB1 A;  2YC0 A;  4AK3 A;  3AC0 A;  5J96 B;  2A6Y A;  1O4Y A;  2LW8 A;  4C90 A;  5I8Y A;  2VMG A;  2XBO 3;  3LFI A;  2W1W A;  4LO6 B;  4F83 A;  5A7O A;  1JZ4 A;  3POY A;  5FO7 B;  3HEI A;  4BQ3 A;  4LBO A;  3ITQ A;  1QHD A;  1WMF A;  5IJR A;  2JG9 C;  1JYT A;  4MYE A;  2E31 A;  3WV6 A;  2QKD A;  3ZYF A;  5C8C A;  2ZX1 A;  3AKS A;  3T09 A;  4ES9 A;  2W92 A;  4CEW A;  3GJB A;  2BBV A;  3J8F 3;  4Y5S A;  4ONU A;  3KT4 A;  2OQ7 A;  2VNV A;  4B29 A;  4COW A;  3I2J A;  1W2O A;  2ERF A;  3IB3 A;  1J1T A;  3L2Y A;  2XGX A;  3KVA A;  4AEK A;  1PGL 1;  3SH3 A;  2RMU 1;  4XUR A;  5BUV A;  2EXI A;  3POG A;  1UW8 A;  2RS1 1;  1AX2 A;  1RUG 2;  1W2T A;  2BP6 A;  4AVC A;  1AYN 2;  1JU4 A;  4BXS V;  1J84 A;  2VZU A;  3RZH A;  1GP5 A;  2YGM A;  1NCR A;  3GF6 A;  3M3O A;  5FWE A;  4TSV A;  5LB6 A;  3S30 A;  5BNQ A;  5BNN C;  5FP3 A;  5LA0 A;  1AYM 2;  2ZGN A;  2Q8D A;  1GU3 A;  2OS2 A;  5GAL A;  1KJL A;  4M00 A;  4NUB A;  2JIC A;  3BUC A;  3I3M A;  2H0B A;  1RTV A;  2CV6 A;  4U2A A;  1OT5 A;  4ZY9 A;  3S57 A;  1CR7 A;  5IAX A;  1UD1 A;  5DAW A;  4AAX A;  3HNB M;  5LA1 A;  3TEZ A;  3W59 A;  1OA4 A;  4DUX A;  4BIS A;  1Q8P A;  4W8J A;  1GWL A;  1WCU A;  3MEP A;  2P3J A;  1APN A;  1F35 A;  1JYC A;  5C3Q A;  2F4L A;  2X53 S;  4CYD A;  4MOA A;  5C3R A;  3POF A;  3C8X A;  2XKP A;  4FT8 A;  3RYP A;  2JG8 A;  1ZNP A;  1Q5O A;  5FTT C;  2DU1 A;  1AR7 2;  2RS5 2;  4P9X A;  5FQ0 B;  2QQJ A;  4Q26 A;  3BVC A;  2W46 A;  2ZX2 A;  4AI1 A;  2QQN A;  2VVF A;  1ZZ7 A;  2YBS A;  3DXU A;  1VBE 1;  3LDB A;  4LKF A;  2WA3 A;  5BNP B;  2VCM A;  4N53 A;  3VDB A;  4I0A A;  1D4M 1;  3AZV A;  1HW5 A;  2IXJ A;  5A6Y A;  1FNZ A;  2WO7 A;  1H4G A;  1ZBE 2;  1LOF A;  4PI0 A;  4CDU C;  1OXC A;  2Q1M A;  4CDQ B;  3M2M A;  1X9P A;  2D5F A;  3EYP A;  4W50 A;  4HOO A;  4MUV A;  1LCL A;  2JX9 A;  3SKV A;  4JGZ C;  2AGS A;  1YIP A;  2D6L X;  3WT3 A;  4E4D X;  2GC3 A;  3WG1 A;  4UYB A;  4BHP A;  4BOW A;  1Z7S 3;  4UFI A;  1VRH 1;  4QX3 A;  3RG0 A;  1QMJ A;  2P17 A;  1LOA A;  4AED B;  3HWJ A;  4E4S A;  2EIE A;  1W2N A;  4PT6 A;  3WP3 A;  2PLV 1;  5A7Q A;  1TZO A;  4DMI A;  4LHK A;  3MDP A;  5CKN A;  2J1T A;  4LBQ B;  4N43 B;  1VAK A;  2W47 A;  4ASL A;  1UKR A;  4IE4 A;  3CJI B;  1IPK A;  2JIG A;  2QE3 A;  3NV2 A;  3WUD A;  3MPP G;  4YVW A;  3OGJ A;  2Q0A A;  1UL9 A;  3JCI A;  3TN9 2;  5A3U A;  3VKO A;  5IW0 A;  2Q5T A;  1AVB A;  3LIH A;  1C1L A;  1Y9Q A;  4FO9 A;  2D6O X;  5DDJ 3;  1ZRD A;  4MXV A;  3VKM A;  5FP8 A;  5FYV A;  1N3O A;  1TME 2;  5I91 A;  2LM3 A;  4NHY A;  1BBT 3;  1GOG A;  5KHH A;  3ZFF A;  1YLL A;  2VZS A;  4G4F A;  3PU3 A;  1HRI 1;  3OPW A;  2D93 A;  4M0H A;  5DAB A;  2BYV E;  4OCT A;  5LBB A;  4YPJ A;  2OW4 A;  4OHV A;  3VKF C;  3TYJ A;  2BWA A;  2F17 A;  1RUF 1;  2XQX A;  2WKK A;  3VBR B;  2WNV C;  5JIU A;  1W8H A;  2DVD A;  5C3O A;  5F37 A;  4D8M A;  1I1E A;  1XNB A;  5FUP A;  4FFH A;  1AXK A;  3IBM A;  5H9S A;  3NW4 A;  2OX0 A;  2B46 X;  4A42 A;  4KG0 A;  4V2W A;  1JYX A;  2Y6K A;  1UYZ A;  1X50 A;  4I01 A;  4MGZ E;  1AJK A;  5CG8 A;  1U5Z A;  1QY4 A;  2WWJ A;  2FDK A;  3EJK A;  3NNG A;  1ALY A;  2H6B A;  3RQ0 A;  2D43 A;  4A2U A;  1LGC A;  1X82 A;  2WII B;  4Q8K A;  3AKP A;  3VZJ A;  4NVP A;  4V2V A;  4QPW A;  4NPL A;  2GDF A;  5DUX A;  1R09 1;  5FUI A;  1JZ3 A;  4Y5T A;  3TNP B;  1LOE A;  4JX0 A;  1F31 A;  1IZ3 A;  3CZU A;  1GIC A;  3AKT A;  4IE0 A;  1WA6 X;  4LIT A;  5FIX A;  5FBZ A;  4RHV 1;  1N3Q A;  1ONA A;  4YM3 A;  4AHX A;  1ASJ 2;  2RM2 3;  2CHH A;  4QQP A;  4DXZ A;  3B00 A;  3C3V A;  2VU9 A;  1GFF 2;  2CWS A;  2IVJ A;  1AL2 3;  4JGY B;  5L9R A;  1V6L A;  3T1M A;  4ZU7 A;  5BNO A;  1IPJ A;  3WNK A;  2HEV F;  4QM8 A;  3B3Q E;  5A33 B;  1JYW A;  5LBC A;  2QBX A;  1XJA A;  1YI7 A;  1LOD A;  1V9U 3;  3FX3 A;  2G9Z A;  1SLT A;  5LRS A;  1AUY A;  3AMN A;  3HAG A;  1GYK A;  1BVP 1;  5K9Y A;  2GC0 A;  1HQL A;  3CLP A;  1LHO A;  3GZE A;  4XIL A;  5C4W C;  2SLI A;  1VBD 1;  4YRD A;  1C5I A;  1Y7B A;  3B01 A;  3C2U A;  3PHM A;  4XC9 A;  3WDV A;  4DPN A;  2R04 2;  4H55 A;  3WG4 A;  3H0O A;  3OOX A;  2HWC 1;  2YC4 A;  4QQH A;  3O1U A;  1IS3 A;  2X5I B;  3VBU B;  5K0U A;  2FMD A;  1KDM A;  2XBO 2;  5DN2 A;  3I2G A;  4FPO B;  3OTF A;  4GA9 A;  2VVD A;  2BFU L;  4XFC A;  3WQ0 A;  3AVR A;  2FDH A;  2EIC A;  5BV6 A;  5LW9 A;  3W9A A;  2W52 A;  2G1M A;  5FY1 A;  2JD9 A;  2XUE A;  2RJ2 A;  3HBZ A;  2WNU C;  3UKV A;  2R30 A;  1W6Q B;  4K1Z A;  3KMH A;  3Q8E A;  4S2H A;  1MQT A;  2IWG B;  2R16 A;  3FLR A;  5J1X A;  1B35 C;  3LA3 A;  3J8F 2;  1CJP A;  2ATF A;  1DBN A;  3CJX A;  3MZH A;  5KBF A;  1J59 A;  2D6K A;  4JHT A;  5JAX A;  2WFF 3;  4P5H A;  1DDL A;  1PO2 1;  3J7N A;  4AQS A;  3VDD B;  4BQ2 A;  1CZT A;  1HXS 2;  4LMF A;  3AKR A;  5A1F A;  2GAU A;  1ACC A;  4QQ2 A;  1DG6 A;  1NQD A;  2XHK A;  4LUK A;  4A3X A;  4AR2 A;  4AEM A;  5LY2 A;  1AXZ A;  1QNY A;  1NX9 A;  1CX1 A;  5JOX A;  3HR9 A;  4MGS A;  1XU2 A;  2MEV 3;  1C5H A;  3DGT A;  4IW3 A;  4OMC A;  1OUX A;  3T2O A;  1QJX 1;  1K5M B;  1JZ6 A;  2NP0 A;  4BIF A;  2VUD A;  4GH4 A;  2WC2 A;  5FFO C;  1TQ5 A;  1GP4 A;  5GKA C;  4XF4 A;  1R1A 3;  1DYO A;  2LTN A;  3GNE A;  5L36 A;  3MLJ A;  4K1Y A;  2CTV A;  2WAA A;  3CNA A;  3GBF A;  1ZZC A;  5FZE A;  3HQU A;  1V6M A;  2VNR A;  4SBV A;  4FQZ A;  4QKF A;  1N1V A;  4QU1 A;  3BU0 A;  5EIY B;  4K9S A;  4LOR A;  4PIX A;  2BV4 A;  2WZP P;  3WF1 A;  1RUE 1;  2Y38 A;  2ZS6 B;  1XSQ A;  1XU1 A;  2A3Y A;  4UF0 A;  3VBH A;  2R49 A;  3LF7 A;  1QJY 1;  1OC1 A;  5L9B A;  4H3W A;  1R08 1;  4M01 A;  5E16 A;  4CU6 A;  5FOJ B;  5G04 L;  1UY1 A;  3DV8 A;  4DNY A;  4LQR A;  2P5B A;  4WM8 B;  2IC1 A;  5FZ0 A;  5JSO A;  3M4F A;  3RFR A;  4G9S B;  1GZW B;  2VBB A;  5EJ1 B;  1W0O A;  5KC5 A;  3W5N A;  2DF7 A;  3FN9 A;  3SCF A;  3NJV A;  2WZ8 A;  1BHG A;  4BB3 A;  3LE0 A;  4HN0 A;  3III A;  1ENQ A;  3PME A;  4LPL A;  2WDB A;  1AX0 A;  2D3P A;  2QTW B;  4JRA A;  3B9C A;  1QDO A;  3WHU A;  1W05 A;  1DYK A;  5FMO S;  1QXP A;  4RR3 A;  5FMB A;  2V73 A;  3NJY A;  1Y43 B;  1YI9 A;  1CQ9 A;  2D6M A;  2HBT A;  4QKN A;  1HLC A;  2YRO A;  5EV7 A;  5F5Q A;  2XXZ A;  5A3N A;  3MV1 1;  1PVC 3;  3ALQ A;  3FC0 A;  3FJS A;  2VUA A;  5FZH A;  1JN2 P;  1HJG A;  1JTZ X;  3ZFE A;  3DYM A;  4JQT A;  4IEO A;  2PHX A;  4KGG A;  5E89 A;  1XBF A;  1L7Q A;  3L2H A;  5FZ4 A;  1IG3 A;  3HMY A;  2FZ1 A;  3IAQ A;  4TN7 A;  4FXK B;  4YGE A;  2VO5 A;  2ZHN A;  2XJP A;  4JTN A;  4XFB A;  2DUQ A;  4FI9 A;  4QGL A;  2EID A;  3CHX A;  1Q43 A;  3ZSJ A;  2E7A A;  4XF9 A;  2FDG A;  5CFD A;  5DDJ 2;  2SBA A;  1RUG 1;  4DXT A;  1OD3 A;  4GKX A;  1Q8S A;  4FTB A;  1AYN 1;  5E6H A;  4QPG A;  1DCS A;  4HK8 A;  4NIA A;  2ZX0 A;  3GGL A;  1QXJ A;  1UZY A;  4Q4X 3;  5E8A A;  3ELN A;  2VME A;  5F32 A;  3T3Y A;  3I2D A;  1QJU 3;  3LAG A;  1GMM A;  5FYC A;  3AL6 A;  4IV1 B;  4OHY A;  4LHN A;  1VRB A;  2QQW A;  1OHF A;  3TAY A;  3QCW A;  4Y4Y A;  1AYM 1;  3R0R A;  4Q4W 3;  1LEN A;  4UWD A;  4Z07 A;  3ZYB A;  4NWV A;  1HQW A;  4O7X A;  1HV1 A;  5FY0 A;  5FQ0 A;  4AGR A;  1REE A;  3GJA A;  1ODN A;  1RL3 A;  5EXO A;  4Y3O A;  4A4A A;  5BNP A;  4JDN A;  1CX4 A;  4OFG A;  4P14 A;  4XVH A;  4HSL A;  1BYH A;  2HEW F;  1YIF A;  1HJF A;  4MGT A;  3FE5 A;  5C5U A;  5T5L A;  5FYS A;  5JLV A;  3LCP A;  2D97 A;  4IV3 C;  4LKD A;  4M3C A;  4A44 A;  1U12 A;  2Q30 A;  3ZXD A;  4CDQ A;  3IMM A;  3C7O A;  1L7R A;  4IER A;  2OXB A;  2VUL A;  2VOV A;  1CJD A;  5D8A C;  5FYY A;  1OBN A;  3SH4 A;  1UY0 A;  2VUJ A;  2X09 A;  4RD7 A;  5F2W A;  1PK6 B;  3KQ4 B;  1UMI A;  1AR7 1;  2Y6J A;  2RS5 1;  2ZGK A;  3DUI A;  2BUK A;  4KQ7 A;  2PYT A;  3SKJ E;  4D7Y A;  4MG2 A;  1HN1 A;  3DPR B;  1S55 A;  3AMP A;  5A7P A;  3VDA A;  4AED A;  3R4S A;  2XJV A;  4CCO A;  3AFK A;  2ZML A;  1ZRR A;  5J36 A;  1RVF 3;  1ND2 B;  2RM2 2;  4YG3 A;  1ZBE 1;  1LU1 A;  1UY3 A;  4LNV A;  4D94 A;  1F2N A;  5CNA A;  1W04 A;  4LBQ A;  1XNT A;  4Z82 A;  5A3L A;  4QKB A;  4Y33 A;  4QX0 A;  5JPN B;  1WCK A;  2IXI A;  3CJI A;  3GZT B;  4OHX A;  1CAU B;  1QJF A;  5IFT A;  3JB8 A;  5HXM A;  1V9U 2;  4WM7 B;  4A3Z A;  1PIV 3;  1A34 A;  1YJK A;  1POV 0;  3KZ4 C;  2LRP A;  2AH2 A;  3ZM8 A;  4G3Y C;  4UBG A;  3O7O A;  3RJ2 X;  1GQP A;  4N53 B;  4R9D A;  4HKL A;  4PIZ A;  3AZX A;  2Z42 A;  3JXS A;  5A3T A;  3BOW A;  1QJZ A;  4YG0 A;  1H2L A;  3MF9 A;  3UNP A;  1VB2 A;  1OFS A;  1B09 A;  1LOB A;  3A0N A;  2TUN A;  1IG0 A;  2ZBJ A;  1XE7 A;  5DZG A;  3IDC B;  1QIQ A;  3LOB A;  1SPP A;  5C71 A;  4CUC A;  4CP2 A;  1JXN A;  4FPF A;  1MVE A;  1VAM A;  4ZU4 A;  1WW7 A;  1YFX A;  1IPS A;  4B4P A;  2BW8 A;  2GN3 A;  1NE4 A;  1KIT A;  2B5H A;  1YQ5 A;  1H4H A;  2Y33 A;  3IKW A;  2VW1 A;  2YHJ A;  5F6K A;  4GMP 1;  2VZP A;  3TN9 1;  3VBR A;  4CU7 A;  3PJY A;  2Y0I A;  2HKX A;  4P9W A;  4CUA A;  1VR3 A;  1LJ7 A;  1W3X A;  4OUS A;  4PLN A;  4YZ5 A;  1YYN A;  1TME 1;  3HT1 A;  2CNA A;  1FAT A;  4Q4V 3;  3ZOI A;  5J3U A;  1XC6 A;  3ON7 A;  2OKX A;  2L9L A;  4C1X A;  4DY3 A;  2J1V A;  1AF9 A;  4FP3 A;  4CP1 A;  4OQ8 A;  1W9T A;  3N7J A;  4BQ4 A;  3ZPO A;  4CDX B;  2RR1 3;  3NV1 A;  4YVW B;  5GJ6 A;  1WWY A;  2OQ6 A;  3ILN A;  1DF0 A;  4JDM A;  4RSU A;  2WT0 A;  2QQL A;  3LFM A;  3U78 A;  4IEQ A;  4CP0 A;  3RJR A;  5L73 A;  2WZR 2;  1AR9 3;  3ZXF A;  3FL7 A;  1Q8Q A;  4XQW A;  4FPH A;  1ST8 A;  1R1A 2;  1W8U A;  3MHZ A;  1QQP 3;  3IT8 A;  1EY2 A;  2ZKN A;  3K51 A;  3ZFF B;  5IVJ A;  4JGY A;  1DHK B;  4N7I A;  4KU8 A;  1ULD A;  3TRS B;  3VLB B;  4B1M A;  4QHB A;  2JDY A;  3IM0 A;  3KV5 A;  4XPV A;  3CF6 E;  5FYT A;  3CU7 A;  3P6B A;  3GHN A;  1XNK A;  4DFS A;  4Q1R A;  2EIG A;  2QVS B;  2QQO A;  1NLR A;  1DQ0 A;  2Q4S A;  4BQX A;  1S2B A;  4UAP A;  2FDJ A;  4FSJ A;  1W8O A;  3WNM A;  4CU9 A;  2D3S A;  4ZZ8 A;  4DO0 A;  3I3Q A;  3CO2 A;  4J6G A;  1ASJ 1;  2C6S A;  2W08 A;  2DTY A;  3POW A;  4RQP C;  5FZ3 A;  1XND A;  2VEC A;  3BPZ A;  1MEC 3;  1F4A A;  3MV0 1;  5EPA A;  2X10 A;  4N8M A;  5FYZ A;  5I0T A;  2X5I A;  3VBU A;  1D2Q A;  5JPM B;  4K3U A;  1LTE A;  3ZXJ A;  3CDZ B;  5GLV A;  3PIJ A;  1QH6 A;  1V6J A;  2YFU A;  4YM2 A;  2XHN A;  3BAL A;  1SZB A;  1RUJ 2;  4W6X A;  5CAZ A;  3F95 A;  1UZZ A;  4ASM B;  5GZG A;  1CIY A;  4XW3 A;  1C3H A;  1CON A;  4IEX A;  1X8E A;  4K21 A;  4YFZ A;  1W6Q A;  4D7S A;  5JXI A;  1UY4 A;  2PXJ A;  5T52 A;  2XJT A;  4BPZ A;  1KQR A;  1W8W A;  2JDZ A;  2R04 1;  3D5O A;  4XTP A;  4EZ4 A;  5LEK A;  3W21 A;  1D2S A;  2XBO 1;  1PVC 2;  3HJR A;  4EWE A;  2DCZ A;  1RIR A;  1U5Y A;  4TLF A;  2QQM A;  1T6B X;  4QPI B;  4CCK A;  5J48 A;  3DCQ A;  4F8A A;  3U37 A;  1AX1 A;  4BQ5 A;  1F8V A;  4IQP A;  2H6C A;  4N9I A;  1I9R A;  4YZ1 A;  2ZHM A;  4UBH A;  5FPV A;  1PZ9 A;  4DRV A;  2JKB A;  1K5M A;  5JVV A;  3V65 A;  2PAE A;  2ETE A;  3J8F 1;  3VHN A;  1G9C A;  3ZXA C;  4I3G A;  2GH2 A;  2D98 A;  4GAL A;  5K0U B;  2Y64 A;  3J7M A;  2OPK A;  3PTY A;  1HXS 1;  4UOJ A;  4QMA A;  4GJZ A;  5FYU A;  5GZC A;  3IPV A;  1OVP A;  2D44 A;  2W1U A;  4XUT A;  1L3J A;  1SHW B;  3WOG A;  2ZJC A;  3LEM A;  4R9B A;  4QXB A;  4Q4X 2;  1QJU 2;  2P6H A;  1OSG A;  1UU4 A;  5HV0 A;  5JR2 A;  5BXX A;  5F9T A;  2JE7 A;  1HQN A;  1LUL A;  4X8P A;  3MIH A;  4Q4W 2;  3WW4 A;  1DQ1 A;  1SLB A;  3TEY A;  3VD4 A;  4YW5 A;  3POI A;  1UY2 A;  3PUR A;  3RSJ A;  4NE9 A;  4FPE A;  4LIU A;  5FXX A;  3O0X A;  3E1F 1;  1AL0 G;  3VDD C;  4NRP A;  1UPS A;  2ORZ A;  1C1F A;  4RFR B;  4DY5 A;  1GZW A;  2HWE 3;  4CCL A;  4Z2W A;  3B7M A;  4P9G A;  4P9I A;  1RXG A;  3MBW A;  4CRQ A;  1URX A;  3M3I A;  2JDK A;  1CES A;  2ZMN A;  1JU3 A;  4R4Z A;  2W91 A;  5JUV A;  3WNN A;  3AJY A;  4N90 A;  5FZO A;  1AHS A;  4GH4 B;  5AFB A;  4LT5 A;  3KVB A;  3JZV A;  4GUL A;  2JEN A;  1OA3 A;  1REF A;  2ZA9 A;  3DKQ A;  4YZ4 A;  5FY8 A;  1OLR A;  2YMZ A;  2EXH A;  3HNM A;  1UXX X;  3FBY A;  3LGR A;  4A7K A;  2A6W A;  3KV6 A;  3N9N A;  3H7J A;  1OKQ A;  4RGA A;  1BJQ A;  3OBR A;  4CDW A;  1RVF 2;  3K3O A;  2C24 A;  4LBQ D;  4RS5 B;  1GQG A;  5T54 A;  1JBC A;  1UYX A;  4BXF A;  2O14 A;  2XWB B;  4XUN A;  4Z1V A;  1OOP B;  4XIK A;  4LK7 A;  4UF0 B;  3VBH B;  3MW4 A;  1PGS A;  3ACG A;  4D7T A;  2R0H A;  1OD5 A;  4FCA A;  4Q4Y 3;  1QNW A;  5A70 A;  2XJS A;  4XTM A;  5CKM A;  5FZK A;  3ETP A;  1AR6 3;  3VKL A;  2WL1 A;  1N1Y A;  4LTA A;  4GWN A;  2VQU A;  5EZW A;  1J3R A;  1XNC A;  1SLC A;  1RUH 3;  2QJV A;  2JKX A;  5HCA A;  1CZS A;  4K8F A;  5EP9 A;  4NJ4 A;  3ZDV A;  2NPI A;  1LRH A;  4FAG A;  4WM8 C;  2WN2 A;  2ZZJ A;  3R6S A;  5HCF A;  4ARX A;  3POS A;  1FV2 A;  3MW2 A;  3NAP C;  3GYD A;  5ERL A;  4IV1 A;  4I02 A;  5GLW A;  2J1A A;  4AOC A;  4WVW A;  4YAR A;  3BB6 A;  4E2Q A;  2EIB A;  5K7P A;  5C3S A;  4RR3 B;  1O4T A;  5F5C A;  5FZG A;  4Q0V A;  4KWJ A;  3VHP A;  4NAM A;  4NIG A;  1G6N A;  1NA1 A;  5DUW A;  3VBO C;  3ZFE B;  1RHI 3;  4Y22 A;  4DZG A;  3UYJ A;  4XJA A;  5DDJ 1;  3ZR5 A;  4YGC A;  3B69 A;  4OI2 A;  4PHZ A;  1CGP A;  4QDQ A;  1VMH A;  4Q4V 2;  4XFI A;  2A5Z A;  4BK5 A;  1RC6 A;  1J83 A;  2GH8 A;  1A8M A;  3AM2 A;  4DXS A;  4NPM A;  4ZZ5 A;  1SAC A;  1COV 2;  3B93 A;  3LDR A;  2R0F A;  3AL5 A;  2WR9 A;  3AP5 A;  3UL2 A;  1G9A A;  1TVG A;  2ZAH A;  2EF6 A;  4XXP A;  1LEM A;  5FP4 A;  3BGA A;  4AQ2 A;  5BNO C;  1PK6 A;  2OUJ A;  3VD7 A;  5CFD B;  4P9Y A;  3HBK A;  3PUA A;  3DPR A;  1XPW A;  5HCB A;  3UK9 A;  1AR9 2;  2VQ0 A;  2VAU A;  3KT7 A;  3B94 A;  2ENR A;  4QPG B;  2BEO A;  1DQ5 A;  1XYO A;  4Y1V A;  4OI4 A;  5HPO A;  4R9C A;  3VGI A;  1ND2 A;  3QOP A;  5DQ0 A;  1JZ2 A;  1WCD J;  2XVG A;  2Y34 A;  5C8C C;  5CAD A;  4AI3 A;  3NO8 A;  1HKD A;  4CCE A;  4J25 A;  3UT0 A;  3RZK A;  2JEM A;  3EMR A;  4NRO A;  4CXW A;  1VAV A;  3NJZ A;  3KLS A;  4CEW C;  3Q8C A;  1O91 A;  1E5S A;  3OGV A;  1BXH A;  1BZW A;  1J1L A;  2A70 A;  2WFP A;  4W6Y A;  4BJ0 A;  4AF9 A;  1CAU A;  3M3E A;  4FPK A;  4IEV A;  5FV3 A;  4WM7 A;  1HRV 3;  1OQD A;  3O12 A;  1RIN A;  2C9K A;  3SMH A;  3U14 A;  4BU2 A;  1J3P A;  1PX4 A;  4FP2 A;  3JD7 3;  5A32 B;  3M1H A;  4S2G A;  5JZG B;  5HI0 A;  4QX8 A;  5FBJ A;  3PMS A;  1W6P B;  2RM2 1;  2XLA A;  3FUQ A;  3OSD A;  1E5H A;  3GAL A;  4GQ7 A;  4OUM A;  3LEG A;  1MEC 2;  3Q8F A;  4M3C B;  1NCR C;  5A3M A;  3U4X A;  3LZZ A;  2TNF A;  1JOJ A;  2P3Y A;  1DYP A;  4KWU A;  2HYK A;  4Y1Z A;  5CKQ A;  3SC7 X;  4NAO A;  2I45 A;  3RZZ A;  4A41 A;  4FTE A;  1MZ6 A;  4P08 A;  1TNF A;  1ZA7 A;  1KS5 A;  1V9U 1;  2YPJ A;  3IAP A;  1VMJ A;  1G9D A;  1W6N A;  5LA9 A;  3GBG A;  3ZIX A;  4ES8 A;  4QGN A;  2ZAB A;  1O4Z A;  1SFN A;  1NCQ A;  1DZR A;  2NYY A;  5GM0 A;  2NM1 A;  4AWD A;  2P4E A;  3ZN4 A;  1JOB A;  1ULF A;  1MZF A;  4KWL A;  4WVM B;  2W5F A;  1NUK A;  2ZEX A;  1W9F A;  5T5J A;  2OZJ A;  3MIB A;  4YG6 A;  3D4K A;  5C5T A;  3U07 A;  1JYN A;  3WDW A;  5IUQ A;  4MHR A;  3HN1 A;  3K77 A;  3N9L A;  2ET1 A;  2XVK A;  5A7W B;  1H9P A;  2HLE A;  4CDX A;  3BTZ A;  1U5X A;  4LE3 A;  5FK7 A;  2JG8 C;  5APA A;  2XJQ A;  4UW6 A;  1GSL A;  2WNV A;  1ZVF A;  1IKQ A;  1NXD 1;  3ATG A;  2C1F A;  4C0B A;  4MGQ A;  4AFA A;  4B4Q A;  1QJE A;  2MPF A;  1LKN A;  4N53 C;  5DG2 A;  3U75 A;  1O3Q A;  1LR5 A;  3LSD A;  2QUO A;  4ATE A;  3H8U A;  5L7O B;  1JI6 A;  1LOF C;  3DF0 A;  5IK8 A;  3MF6 A;  3KWV A;  4MO3 M;  4TXW A;  1SPP B;  2PEL A;  1PM7 A;  1C57 A;  2B9U A;  1NY7 2;  3H1W A;  5FCC A;  5H9Q A;  5LAT A;  4NII A;  2RDR A;  3WF4 A;  4BK4 A;  3ZKU A;  3B5L B;  4UT5 A;  2BNO A;  2JDM A;  3FFZ A;  4FFG A;  1RUI 3;  2Z5W A;  3WXP A;  3DKW A;  1WUV A;  4LOT A;  1WBL A;  3B9I A;  4FOQ A;  5IVF A;  1DZT A;  4AI8 A;  2VOT A;  4LE4 A;  1JUH A;  2RS1 3;  4EJR A;  1OKO A;  2F4P A;  2GME A;  2MNG A;  2FMY A;  4IDZ A;  2WZR 1;  2XUM A;  2D40 A;  1QOS A;  4M3C E;  1YC6 1;  2VZO A;  4ERO A;  2VMI A;  5KXD A;  2DWR A;  3CBN A;  1R1A 1;  4FAH A;  4AVB A;  2QFE A;  1HB4 A;  3PVN A;  5CA6 A;  5CU1 A;  4KGQ A;  4S2F A;  3LPG A;  4E9K A;  3M7A A;  2ADD A;  4YVS A;  1E5I A;  4NHL A;  1EUU A;  5IK7 A;  3SEP A;  4PDW B;  3MUZ 1;  2RJK A;  3ZPY A;  4CEY C;  2HWE 2;  1UF2 C;  4L97 A;  2ZEY A;  4BCU A;  4HAN A;  1QOT A;  2GZW A;  2B4K A;  3P3N A;  3QLQ A;  3FWE A;  3P5B A;  4JZR A;  4PCR A;  5LAS A;  3ZDS A;  4QU2 A;  2DCY A;  3RMX A;  2DFB A;  4KI5 M;  1BMV 2;  3R05 A;  1G9F A;  1POV 3;  1X33 A;  3MUY 1;  4GWJ A;  5EWS A;  3VD5 A;  1ULO A;  3FFQ A;  5EFU A;  4HMZ A;  4XF0 A;  1UOG A;  4IEZ A;  2ZMK A;  4BLJ A;  1YQ2 A;  2OVU A;  1RGS A;  3T30 A;  1GKB A;  2G9G A;  2J1U A;  1YUD A;  3I8T A;  5FYI A;  3ACL A;  3ZFF C;  2ZX4 A;  3PUH A;  2H0V A;  5T55 A;  4EN7 B;  2VQA A;  1LHU A;  5FPB A;  2BOJ A;  1VBB 2;  1VJ2 A;  4JV4 A;  5FRE A;  3IWZ A;  4D0Q A;  3WDX A;  1RUD 3;  1N1T A;  1OPO A;  1RUJ 1;  2JD4 A;  3K2O A;  4QPI A;  3S7E A;  4EN8 B;  1OLQ A;  4IEW A;  4XDP A;  4C91 A;  3A22 A;  1OH3 A;  1VBE 3;  3V0A B;  2Y0O A;  5E88 A;  3ZFG B;  4AQT A;  3MID A;  3JQX A;  3DYO A;  4Z8B A;  1TG7 A;  4UFH A;  3ZXL A;  5ABJ B;  3RWK X;  5I0D A;  2EVX A;  1UU6 A;  3PUQ A;  1AR6 2;  3JQW A;  1MAC A;  4JTO A;  4IE6 A;  1S0J A;  4RFT 0;  3H3U A;  3OF1 A;  1PVC 1;  1RUH 2;  3LEK A;  2TBV A;  1UYP A;  4NHK A;  1K3I A;  2DVG A;  1W9S A;  2OUH A;  2UY9 A;  1T2X A;  1V6K A;  4EZH A;  4GAZ A;  3BOD A;  5IAV A;  3QH7 A;  3BKZ A;  2BBA A;  1J3Q A;  2VD7 A;  3CL1 A;  2RHP A;  3C7E A;  4QHZ A;  1RMU 3;  3ZSK A;  3ASI A;  4JCK A;  5FYM A;  4E8C A;  4RGK A;  2Y6H A;  2UWA A;  3MIG A;  1DZQ A;  4LKE A;  1I3H A;  1ZX5 A;  5IYY A;  1RJ7 A;  2G19 A;  1OFN A;  1YCI A;  3L9J T;  4QM9 A;  3SHR A;  2XG3 A;  4BIO A;  1UAI A;  5C9A A;  1RHI 2;  2ZXQ A;  4PQ9 A;  3JBG 3;  3P1I A;  2JB4 A;  2UWC A;  4GIQ A;  5CVR A;  4TZD A;  5FP9 A;  2VL4 A;  3V64 A;  2XLG A;  3NNL A;  1D7P M;  4QT6 A;  1U0A A;  4XDO A;  3W20 A;  2NQY A;  4LA3 A;  1IS5 A;  1GOH A;  3OCP A;  4Q4X 1;  3IMN A;  3LWC A;  1VE0 A;  5A7S A;  1OUS A;  1QJU 1;  3K4D A;  1BCX A;  3KSC A;  4UI9 L;  3VBS B;  4ZKT B;  1NE6 A;  2W2I A;  1SEF A;  5GLZ A;  2D3R A;  4Q4W 1;  4COV A;  3WR0 A;  4B8E A;  2ZHK A;  3FUO A;  5CZK A;  3ZXG A;  2J1E A;  2PTM A;  5K0U C;  2RG4 A;  1KFU L;  3HN3 A;  1OI6 A;  5CIS A;  5IVV A;  2VCB A;  2HWB 3;  1A6C A;  2P1B A;  3IPV B;  3OPT A;  5AC9 3;  1O6U A;  4K8R B;  1RUF 3;  5JI9 A;  3O1S A;  2JDU A;  4RS5 A;  5FJH A;  4LO5 B;  2UU8 A;  5FY5 A;  1VMF A;  4IND A;  4QX5 A;  4N7U A;  2O1Q A;  5JCT A;  1OOP A;  3BPS A;  5ANQ A;  3AK0 A;  2HWF 3;  5LK5 A;  1MQT C;  3WG2 A;  1NYW A;  2DCK A;  4XAA A;  5FO8 B;  3RZL A;  3NJX A;  5JXH A;  3BTX A;  4F3J A;  3PUI A;  5LA2 A;  3N7K A;  1O8P A;  4NRQ A;  5FZA A;  1HRV 2;  1D4V B;  1YO8 A;  4IE5 A;  4OUL A;  3SH5 A;  4AZZ A;  1UNB A;  1IOA A;  3JD7 2;  4LHL A;  5F3C A;  2HBU A;  3ACH A;  3AXE A;  2YU2 A;  4CPB A;  2WBK A;  2C4X A;  5KC6 A;  1CWP A;  1RVF 1;  3ZN5 A;  3ACI A;  2PHD A;  2WS9 3;  1SLL A;  3OD4 A;  1UZW A;  3ES1 A;  4AEJ A;  4XFF A;  4HVR A;  4B4R A;  4NMI A;  5FZO B;  5IHR A;  3UES A;  2PA7 A;  3KM5 A;  4MET A;  1H8T B;  5CFC A;  4WZF A;  5L19 A;  2XML A;  4GH4 C;  4XIO A;  2B42 B;  4MGY E;  3THP A;  1Z7S 2;  4FFI A;  4JDO A;  2WO2 A;  2I07 B;  3OD0 A;  1VIW B;  2JG9 B;  4RN5 A;  5HXV A;  3WLU A;  1YFU A;  5FKB A;  1MS8 A;  3KGL A;  4CDW B;  5JXJ A;  3AP7 A;  1Z78 A;  1DGR A;  1JMU B;  1PNF A;  2EAA A;  3OPZ A;  2YBP A;  4GB3 3;  5F5I A;  3N35 A;  5FLJ A;  2FD8 A;  4GD4 A;  2Q8O A;  1NZC A;  1PMJ X;  2BGP A;  3I49 A;  5ACA 3;  4QDR A;  4AGG A;  2PHU A;  3Q8A A;  3VBH C;  2JJ6 A;  2Y6G A;  2ZCW A;  2HWC 3;  3J4U H;  3WNL A;  4I3P A;  2ZEZ A;  4AVV A;  1DFQ A;  4OHW A;  3BOP A;  1Q8V A;  2WUH A;  3POB A;  2HJI A;  5T5P A;  1LHN A;  1V0A A;  1MS1 A;  3OBT A;  1H6X A;  1S0D A;  1ND3 A;  3D6E A;  2CDO A;  1BBT 2;  4LBJ A;  4Q4V 1;  2ORX A;  2XWJ B;  1COV 1;  2FDI A;  4EWD A;  4AXO A;  4XQD A;  1R1Z A;  3UKT A;  4NID A;  2OPW A;  4OMD A;  2F6B A;  1FX5 A;  4RR3 C;  1RUI 2;  5A3P A;  2QCS B;  4QD2 A;  1NA1 B;  4LJH A;  1LOC A;  3A7Q A;  4LEJ A;  2ZGT A;  4Y22 B;  3WIN E;  4ARY A;  3I2H A;  4LBL A;  5FY4 A;  3RZG A;  1ENS A;  3ZFE C;  1OMI A;  4XCB A;  2GC1 A;  3T08 A;  5A32 A;  1AR9 1;  5F7U A;  5JZG A;  3D0J A;  1J58 A;  4L11 A;  3BYW A;  3ZN6 A;  1W6P A;  1W3V A;  3MO4 A;  3O1O A;  2LAL A;  2BWC A;  1UX7 A;  3OGR A;  4OI1 A;  3T4H B;  3A4U A;  3TEX A;  1HB2 A;  4HKO A;  2YG0 A;  5D21 A;  1MZ5 A;  2JEC A;  3RI9 A;  4JVA A;  4AW7 A;  3A23 A;  2YZ4 A;  4BMB A;  3EQE A;  1ZYB A;  5KHG A;  2QZ2 A;  3LIG A;  1KD7 A;  5CFD C;  3NST A;  3HQR A;  3HT2 A;  2ZKL A;  2DU0 A;  3OBA A;  1W8Z A;  4LA2 A;  4ASK A;  3I2O A;  2DDU A;  1PO1 3;  2GNM A;  4LIV A;  4QPG C;  4WVM A;  2CU5 A;  4B3N A;  1M06 G;  1MEC 1;  3OGS A;  2WIN B;  2BNM A;  1AL2 2;  2QZ3 A;  4YW3 A;  1BK1 A;  2VMD A;  2VY0 A;  1I5Z A;  1UWW A;  4JGZ B;  4PLO A;  3K4A A;  4XF1 A;  2J42 A;  2WWU A;  1PVX A;  5LCW L;  3ENR A;  1QJY 3;  5A7W A;  4AFB A;  2FCT A;  2PHR A;  4XBQ A;  4CUG A;  2PN5 A;  1R08 3;  3EBR A;  1RUD 2;  1LB2 A;  4XHB A;  2ZGM A;  4F7Z A;  3USS A;  2RDN A;  4CE8 A;  1GZC A;  4M0N A;  1O3T A;  2ZTN A;  4R52 A;  2Z2S B;  5BNP C;  4UW3 A;  1QEX A;  4JQR A;  5FXV A;  2E53 A;  1JW6 A;  4I09 A;  5L7O A;  3G6J B;  1EV1 3;  4QXH A;  5LRR A;  4JKK A;  3BCW A;  1RUN A;  3E5U A;  4TLG A;  1DLL A;  4CDQ C;  2XLF A;  3KS7 A;  1YJL A;  1DGW X;  4YM0 A;  5A3W A;  1ZRC A;  1SDD B;  5FP7 A;  4XEZ A;  1XE0 A;  1HN0 A;  1WLC A;  2GMP A;  4NPR A;  2YU1 A;  1W6N B;  3I54 A;  1FNY A;  3N3H A;  5I0U A;  5CBL A;  2W94 A;  4LO7 A;  1RMU 2;  1NCQ B;  3AKQ A;  4S2D A;  3ZVX A;  4AED C;  4Y20 A;  3NV3 A;  1SFY A;  2BZD A;  5TSW A;  2ZX3 A;  4IEU A;  4E8D A;  1H2K A;  3AJZ A;  1LGN A;  2R07 3;  1UX6 A;  2WQZ C;  4Q0U A;  3LPF A;  1VBA 3;  2PFW A;  2WFF 2;  5FO9 B;  5A6X A;  4BH9 A;  3MFC A;  3DEC A;  4N43 C;  3JBG 2;  3VDC A;  1NY7 1;  1LGB A;  5FZ1 A;  4XUO A;  4LLO A;  3VL8 A;  3CJI C;  3E5Q A;  4PDW A;  4DXR A;  2WNV B;  1SLI A;  1KDK A;  5LEJ A;  3SLI A;  5AVP A;  4XAC A;  4D69 A;  3KF3 A;  4TYS A;  4IGO A;  2MEV 2;  2WLP A;  4TTG A;  4LUL A;  4QX2 A;  3LSE A;  1WMD A;  3J7H A;  4OZX A;  5HV4 A;  5KXB A;  1JYV A;  5FOB B;  3UGG A;  1UXZ A;  1FI2 A;  1UU5 A;  3AFG A;  4HFS A;  2VCC A;  5GZE A;  1S2K A;  1XYN A;  4NRM A;  1X36 A;  5FK8 A;  4CTE A;  5D1I A;  5IVC A;  4YFW A;  1X9T A;  3R4D B;  3LA2 A;  4HLT A;  2DTW A;  2EA7 A;  3ROU A;  2VCA A;  1D0H A;  1DIW A;  1SG3 A;  1X8M A;  4DS0 A;  5AC9 2;  2HWE 1;  4URT A;  3WVJ A;  1RB8 G;  1YNA A;  2E7Q A;  4UXA A;  3VD3 A;  3MPB A;  1GZ9 A;  4KBB A;  1CAX B;  3VBR C;  2GN7 A;  3V0A A;  1BEV 3;  3T0B A;  1BMV 1;  3ZFG A;  5A80 A;  2HWF 2;  3FHI B;  2OYZ A;  3SIS A;  4O9G A;  5ABJ A;  1VLN A;  3AP6 A;  2VMH A;  3GCX A;  1OQE A;  3RVH A;  4E2G A;  1XNA A;  1NLS A;  3RMY A;  2A6Z A;  2KM2 A;  2NMN A;  3AZW A;  3NWK A;  3USU A;  3TOJ A;  4BZ4 A;  3GM8 A;  2XOM A;  1W0P A;  4YVS B;  3AMQ A;  4ZHN A;  1QDC A;  2V5D A;  1VBB 1;  2UYB A;  2ZGQ A;  4QGM A;  4COY A;  3PVE A;  4ZXK A;  4U36 A;  1LHV A;  3QAC A;  4D6R A;  4ZS3 A;  1OH4 A;  3FHQ A;  5SV8 A;  3H7Y A;  3GZA A;  5KWR A;  2E6V A;  3Q8B A;  2VOK A;  2WS9 2;  4SLI A;  1W8N A;  4QDS A;  4UW4 A;  4COU A;  3UJQ A;  1PMI A;  2WN3 A;  1ULC A;  2PAK A;  1DGW A;  4HPK B;  2VW0 A;  1UKG A;  3E6D A;  3AZZ A;  4XOG A;  1RJ8 A;  1S0G A;  1AR6 1;  1PMH X;  1ZA4 A;  2EAL A;  2O8O A;  3I59 B;  3I7D A;  4DB5 A;  2VUC A;  4QPY A;  2OZ6 A;  2XR4 A;  4JGY C;  3MIF A;  1RUH 1;  5T50 A;  4EN9 B;  3EXU A;  5FJK A;  1RUC 3;  5E1R A;  3UJO A;  3AYE A;  4BLI A;  1FAY A;  3OEA A;  1W6M B;  2RS3 3;  2WNU B;  3E97 A;  3N7L A;  4E4Z A;  5F6L B;  1W6O A;  2R1D A;  4GB3 2;  4XZU G;  3DYP A;  3WQ1 A;  3H42 B;  3VV1 A;  5KHK A;  1B35 B;  4MSV A;  3K4Z A;  4ITC A;  1G86 A;  1F4H A;  1XOY A;  4H7M A;  3VBS A;  3MFA A;  1PNG A;  5ACA 2;  2VQT A;  5FZ6 A;  4BM8 A;  3OEB A;  5KXE A;  2YPD A;  2XDV A;  4HKW A;  1ZBA 3;  3JB4 C;  1TMF 3;  1EAH 3;  1TE1 B;  2XB6 C;  4FOY A;  3H3Z A;  4FOW A;  3WF2 A;  3KGZ A;  2X5I C;  1RHI 1;  3VBU C;  2GNB A;  1KJR A;  1FMD 3;  1G7Y A;  1H8V A;  4LHS A;  4QWN A;  1H0B A;  2B45 X;  2A75 A;  2ZAA A;  3D82 A;  2JWP A;  5FRA A;  3ST7 A;  3QBQ A;  4YYO A;  1LAJ A;  3O1P A;  4AI0 A;  5FPZ A;  4RYD A;  2VNO A;  4K7J A;  4IES A;  1E5R A;  1NZI A;  3O0V A;  2XL9 A;  2QQU A;  2A1X A;  3ZMO A;  1WLD A;  1V6O A;  1AXY A;  3I2F A;  4GZ9 A;  4CDU B;  1NOV A;  1H30 A;  3WP6 A;  1K45 A;  2EXJ A;  2HH9 A;  4X6Q B;  5DG1 A;  1FXZ A;  5K4L A;  5C9A B;  2CYF A;  2ZGO A;  3KV4 A;  4JRL A;  4KWK A;  5FZ7 A;  2K2S A;  5A3O A;  2DYC A;  1YHF A;  2AYH A;  3LKJ A;  2W95 A;  3T4V A;  1W28 A;  5FKC A;  3N36 A;  1W9Y A;  2FZ2 A;  3PTR B;  2ZEW A;  4A6O A;  5C6C A;  2ADE A;  3B02 A;  3FHA A;  4RL7 A;  1AJO A;  4HET A;  5FMO L;  1VBC 3;  1ULP A;  3WX5 A;  1GP6 A;  4FPG A;  2N7G A;  3JUU A;  1ZZB A;  3KB5 A;  3BIW E;  2CY6 A;  1UO9 A;  2C9A A;  2HWD 3;  1H8T A;  2W68 A;  1K5M C;  4YW6 A;  1ULG A;  3KHB A;  3BIE A;  4DRR A;  3WF0 A;  3VBF A;  1LHW A;  3ZXK A;  1YWK A;  1YXW A;  3HPN A;  1GZT A;  4EYU A;  4IE7 A;  1HRV 1;  2FQP A;  4MXW B;  4B7E A;  4ZXE A;  4E4H A;  2R06 3;  2JG9 A;  3JD7 1;  2G4I A;  4M4R A;  5FZC A;  1DGR N;  2GAL A;  2J1S A;  4MAD A;  4XUP A;  1PO1 2;  5JOY A;  2ZGU A;  3HIF A;  4CP9 B;  1RUO A;  1FPN 3;  3KCX A;  5C7G A;  1L7L A;  4P9L A;  1OLM A;  1Q3E A;  3N7M A;  4O61 A;  3ETQ A;  3T0A A;  2C5D A;  4HVO A;  3LA7 A;  2Y60 A;  3CKH A;  4R8H A;  3I97 A;  1PIV 2;  1OVS A;  1Z7S 1;  4XAB A;  2V4A A;  2KXL A;  1W39 A;  1SBD A;  1H1A A;  3INA A;  4XFA A;  2GP3 A;  5T5O A;  1G8W A;  3I3E A;  1H6Y A;  1EYB A;  1WGP A;  1S0C A;  4NN0 A;  2JE8 A;  3AP9 A;  3QD6 A;  5IAT A;  5LK7 B;  4LO8 A;  4YW7 A;  5LZ6 A;  1ULE A;  1EV1 2;  4WBB A;  5FUN A;  1S1A A;  2OT7 A;  3C7F A;  5BNN A;  3TEW A;  5CFC B;  5CEH A;  4OUE A;  1F5F A;  1PGW 2;  1PZ7 A;  3RGB A;  1MPX A;  3KD4 A;  4AHY A;  2XH6 A;  5D2A A;  4YNI A;  3FZ3 A;  4XF3 A;  1UOJ A;  3ZYH A;  1SCR A;  3NNF A;  3THD A;  3OY8 B;  4L9B A;  2JDN A;  3ZMN A;  4DIN B;  1CD3 G;  5JIA A;  3O1V A;  5BPX A;  5SV5 A;  2ARC A;  3AYC A;  3SQO A;  5JOZ A;  1H1M A;  4L8Q A;  4HSJ A;  4HON A;  4FBF A;  1ZRI A;  2ZPX A;  4AFD A;  4TWT A;  5HBA A;  2VE1 A;  2PMW B;  3KCY A;  4CDW C;  5GZF A;  2R07 2;  1BBT 1;  3ZXE A;  3AYD A;  2XJU A;  3IDA A;  4ORF A;  2BGC A;  1VBA 2;  3BN6 A;  4AL9 A;  1JZ5 A;  2ARB A;  2HEY F;  2ARE A;  3RYK A;  1R64 A;  3LEI A;  1O7F A;  5F8P A;  4H7L A;  1TNR A;  5FZI A;  2C26 A;  4D6S A;  1F5J A;  2RR1 2;  1UQX A;  1RUI 1;  2V72 A;  4W4Z A;  3URF A;  4Z92 B;  2LS6 A;  3ZLI A;  5CG9 A;  2BU9 A;  3ZSM A;  2ZZQ A;  1HXS 3;  2G9F A;  5JDB A;  3HNY M;  1CPN A;  1KGY A;  2YBK A;  5LY1 A;  1CPM A;  2DCJ A;  3W5M A;  3SXW A;  4HT1 T;  1ND3 B;  4IV3 B;  2D6P A;  1CAW A;  4FVV A;  4AVS A;  1C4R A;  4CDU A;  1QQP 2;  1DLC A;  4XE9 A;  4BME A;  4Y1X A;  4E2S A;  2VC9 A;  1FOD 3;  3OYW A;  3ACF A;  1U5I A;  1X7N A;  5D8A B;  4IV1 C;  4JGZ A;  1US2 A;  4ZU5 A;  1MS5 A;  2ZGP A;  5M0T A;  1NXM A;  2E7T A;  1W9W A;  3JU9 A;  5LWB A;  4HZF A;  3KV9 A;  3OBZ A;  4Y1Y A;  4OQ9 A;  3S5Q A;  4Q1P A;  5BY5 A;  2BER A;  2QQV A;  5A6Z A;  5FZB A;  2VTF A;  4JHZ A;  1NA1 C;  2ID4 A;  3RS6 A;  1VB4 A;  3K46 A;  1BEV 2;  2R6Q A;  1POV 1;  2RVA A;  1CN1 A;  4CXX A;  3CMG A;  3LD8 A;  3ZN6 B;  2RJL A;  1XYP A;  2AEY A;  4FFF A;  3VD9 A;  1AL2 1;  1GBG A;  1MZE A;  4NHX A;  3PNA A;  3EB7 A;  2ILM A;  3M8L A;  1Y3T A;  3HVD A;  4FOV A;  2IUW A;  2CL2 A;  4UFL A;  4YM1 A;  3VZO A;  4XBL A;  4YW2 A;  5T3N A;  4PQQ A;  1XQN A;  4E27 A;  4Q0Q A;  2YUE A;  4JKM A;  5F1R A;  1KXG A;  2PHL A;  2WT1 A;  4K20 A;  1RUD 1;  4QXC A;  3GXU A;  3WW1 A;  1WD3 A;  1AR8 3;  1EPZ A;  1PK6 C;  2WAO A;  4A6S A;  3D8C A;  4CSW A;  2NN8 A;  2X05 A;  4D3W A;  4O65 A;  2PHF A;  3ZSE A;  3DPR C;  3TB0 A;  3CEW A;  2VZT A;  4AVT A;  2BDR A;  1W2U A;  2BQP A;  1JOP A;  1ND2 C;  2JIJ A;  1LEC A;  3ILR A;  3NVC A;  2V5Y A;  3NL1 A;  2VZQ A;  2E51 A;  1STM A;  5KHI A;  2XQR A;  1C8M 3;  1CAV A;  1RUC 2;  1SBE A;  2IVI B;  2Z69 A;  3FLT A;  3N9M A;  3O0W A;  2YY1 A;  2WYS A;  1A3K A;  3RNS A;  4QXK A;  2RS3 2;  4P00 B;  4WM7 C;  2ET7 A;  1QOO A;  4R9A A;  3NRU A;  1RMU 1;  4XMA A;  4BWO A;  5DAV A;  2WQ8 A;  4IET A;  2VG9 A;  3K48 A;  2JXA A;  4UW5 A;  5H9R A;  4YZ3 A;  1N1S A;  1LU2 A;  3AXD A;  5LBF A;  1ZBA 2;  1TMF 2;  1EAH 2;  4XUQ A;  2WFF 1;  3J7L A;  4Q5O A;  3THC A;  1O3R A;  2EAK A;  2BPA 2;  4FTS A;  4GWI A;  4UFM A;  3ES4 A;  3JBG 1;  1FMD 2;  1UOF A;  4HK9 A;  1NQJ A;  1WW6 A;  4EE2 A;  1ZZ8 A;  2X29 A;  1W03 A;  2YXS A;  3V56 A;  3WZ1 A;  2P3I A;  2KR2 A;  4QAW A;  2W9X A;  4EWA A;  1GAN A;  1WLW A;  1XB9 A;  4PLM A;  2RMU 3;  4XFG A;  4XET A;  1QXR A;  2MEV 1;  1CAX A;  5JMO A;  4Y20 B;  4IEY A;  3V0B A;  1JH5 A;  1NCQ C;  2V09 A;  3NNJ A;  2FCU A;  4QQL A;  4DEV A;  2KD7 A;  2VPV A;  5ANN A;  4CEY A;  4O9E A;  2UY8 A;  3I4I A;  1A8D A;  1RIT A;  1WCS A;  4CA9 A;  2VW2 A;  1WCQ A;  2D6N A;  2E26 A;  1QGL A;  3ILF A;  1H1I A;  2HWB 1;  3IZO A;  3LQC A;  4GMP 0;  4LUM A;  5AC9 1;  2JE9 A;  4CDX C;  2K46 A;  2E33 A;  1NT0 A;  2HYX A;  2VH9 A;  3J26 N;  4YVW C;  3WHT A;  1VBC 2;  2J22 A;  2NMO A;  4Q27 A;  1H9W A;  2VXR A;  2DUP A;  3N9Q A;  2YGL A;  4LK6 A;  5C4W A;  3ZYR A;  2J1R A;  2HWF 1;  2HWD 2;  3T2Q A;  1GNH A;  2YV8 A;  4RQP B;  4Y4R A;  2GMM A;  4HPK A;  5EJ3 A;  2D5H A;  3C7G A;  3P3P A;  5FZD A;  3O1M A;  3U4S A;  4COZ A;  3H8O A;  3M70 A;  4HL0 A;  3I59 A;  3I2K A;  4MV2 A;  3WP4 A;  4YZ2 A;  2BGO A;  2P37 A;  5JWP A;  4FXG B;  2R06 2;  4MGK E;  1AZD A;  3KCC A;  1OQ1 A;  1YEW A;  1O59 A;  1SBF A;  2VNG A;  3RRD A;  3DN7 A;  4Y26 A;  5KHJ A;  1W6M A;  2WNU A; 
#chains in the Genus database with same CATH homology
 1OBN A;  1GP6 A;  1HB3 A;  1UO9 A;  5C3O A;  5APA A;  1ODM A;  1GP5 A;  2JB4 A;  1BK0 A;  1QJE A;  1W04 A;  2CSG A;  2VBD A;  3ZKY A;  1OC1 A;  1W3V A;  5C3S A;  1QJF A;  1HB2 A;  2BJS A;  3ZKU A;  2VBB A;  2Y60 A;  1WA6 X;  4BB3 A;  5C3Q A;  2IVI B;  2Y6F A;  2VBP A;  5C3R A;  2IVJ A;  1BLZ A;  1W05 A;  1UOB A;  2JB8 A;  1QIQ A;  1HB4 A;  1IPS A;  1HJG A;  2DBN A;  2VCM A;  1E5I A;  2WO7 A;  1UNB A;  1UOF A;  1W3X A;  2VAU A;  1W2A X;  1W03 A;  3OOX A;  3ZOI A;  3ON7 A;  1UZW A;  1UOG A;  2DBI A;  2VE1 A;  5C3P A;  1E5S A;  1W2N A;  2BRT A;  1DCS A;  4XAE A;  1RXG A;  2BU9 A;  1HB1 A;  1E5H A;  1E5R A;  1RXF A;  1W06 A;  1ODN A;  1HJF A;  1W28 A;  1W9Y A;  1GP4 A;  1W2O A;  4RGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...