3AMPA

E134c-cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
255
structure length
255
Chain Sequence
b'MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVCIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-glucanase
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 56
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ampA00
3MF6A 4H7MA 1HIXA 4XQ4A 3LGRA 3VZJA 2BWCA 3VL8A 1F5JA 1OA4A 2F6BA 2DCKA 2VUJA 3RI9A 1XNCA 2C1FA 2JENA 2D98A 2VG9A 3VZKA 1XNBA 2DCJA 1IGOA 4NPRA 2B42B 3ZSEA 1KS4A 1H4GA 1BCXA 4IXLA 1H8VA 2QZ3A 3WP5A 4HKOA 4S2GA 3WY6A 1H0BA 3WQ1A 3VGIA 4HKWA 4S2FA 3MFCA 1KS5A 1REFA 2JICA 1HV1A 3AKQA 1REDA 3AKSA 3VZNA 2DFCA 1UU5A 3AKTA 5K7PA 3WP6A 1XYPA 4S2DA 5HXVA 2D97A 1OA2A 2NQYA 3EXUA 1HV0A 2Z79A 1QH7A 5EJ3A 2BVVA 2B45X 2DCYA 4HK9A 1OLRA 3WR0A 3B5LB 3LB9A 1ENXA 1XYNA 2DCZA 3AMPA 1H4HA 3AMMA 3VHOA 1XNDA 2QZ2A 1TE1B 1M4WA 1UKRA 3WT3A 3WP3A 3AMQA 1XNKA 3VHPA 1H1AA 3VZOA 1BK1A 1QH6A 3MF9A 3O7OA 2JEMA 1BVVA 2BW8A 1XYOA 2DFBA 1W2UA 5K9YA 3AKRA 4S2HA 3WP4A 1PVXA 1OLQA 2NLRA 4XPVA 1NLRA 1XXNA 3VLBB 3WX5A 1T6GC 1YNAA 2B46X 3MFAA 3WQ7A 1UU6A 3WQ0A 2VGDA 1REEA 4HKLA 3B7MA 3VL9A 2VULA 3VZLA 4XQDA 4HK8A 3RI8A 1OA3A 1UU4A 3HD8B 3VZMA 3VHNA 3AMNA 1C5IA 1AXKA 3AMHA 3AKPA 4XQWA 3WXPA 1C5HA 2BWAA 3M4FA
chains in the Genus database with same CATH superfamily
4I09A 5CNAA 3UGHA 5A7PA 2WN3A 3CU7A 4IESA 1PGW2 2ZOEB 3QOPA 2D6LX 4IE4A 4LHKA 4Q26A 4NIIA 3N7MA 4CP2A 5JOWA 2F6BA 1TQ5A 5IT6A 2FDIA 2VUJA 2YUEA 4X6QB 2BOIA 3O14A 4YM2A 3H3UA 2E9QA 5DXDA 1CAUA 2VG9A 2VOXA 4GMP1 3DN7A 4JAAA 4CEWA 4D7SA 3TYJA 2UYAA 1IGOA 3MV11 5J98B 3VB9A 3RZGA 5A3PA 1VBD1 2HWE3 3K51A 3LEGA 3BPSA 1BMV1 2D3RA 1NOVA 1O5LA 4Y3OA 4BQYA 3ZXLA 1AHSA 5K0UB 4HKOA 4NVPA 3LAGA 4TXWA 1SFYA 3E6BA 1CPNA 2ZGOA 3LPFA 3TWIA 3U4SA 1Q8VA 4F3JA 4XIOA 4F8AA 5JXIA 4ZONA 1MS3A 4DY3A 4ET7A 1QXRA 1LNSA 2XMLA 1ZREA 4A3XA 3ZFFA 2AEYA 1FOD3 4PQ9A 2YB7A 4XJUA 2OYZA 4E27A 3RZLA 4KGGA 1W3XA 1PO13 4UW4A 1A8MA 1MQTA 3ZR6A 1OUSA 1YRZA 4M3CE 3FFQA 3ZFGB 2HEYF 2DVGA 2NYYA 3EXUA 2XLFA 5BV6A 3MBWA 2XJTA 1HRI2 2OUHA 1GP4A 5F8PA 4B3NA 1IS6A 1UY1A 2Z79A 4BQXA 1V00A 4NPLA 2VVDA 4L92A 5FPZA 5BNOB 5HBAA 1MACA 4Y1XA 5FIXA 3OPTA 1G8WA 3U11A 3FX3A 2XWJB 3H42B 1F35A 2P1BA 4DZGA 1AR62 3I2GA 2KXLA 3M2MA 1H30A 5L19A 4HFSA 4FPOB 1W8WA 2JDNA 2WLQA 3C7HA 1H4HA 3LFMA 2ZX0A 3ZYPA 1E5HA 1JU3A 2XQRA 4NN0A 4Q4X1 2GNDA 4V2WA 4FAGA 3U4XA 1PHMA 2WO1A 3TAYA 4URTA 1GZ9A 1TNFA 4JKKA 5DAPA 4R52A 5FZ9A 3CHXA 1RUD1 1ALYA 1HQNA 2K46A 2PAKA 2ID4A 2WDBA 5FY9A 3MV01 3ZYJB 3W58A 4A2UA 2YU1A 4DXSA 4BPZA 4MVTA 1CJDA 4QQOA 4J6GA 4HSLA 1CJPA 5A3LA 3O1VA 3JBG2 1RVF1 3H1WA 2CNAA 2VZQA 3RZKA 5D8AA 1HRI3 4LIVA 3WX5A 4I3GA 4P5HA 1OH4A 5A33A 2ZX4A 2HWF2 5F32A 2BYVE 1IPKA 1F4AA 4DNYA 1YNAA 1LEMA 3VD4A 1X36A 3POWA 5DDJ2 1N3OA 4SLIA 4BK5A 1GOFA 2GN3A 4OCTA 4WM7B 1AR63 3J7NA 3H8RA 5BXXA 2W95A 3ZYIB 5FWJA 4HK8A 3I2HA 3PTRB 2QKDA 4GH4A 2PAEA 2J1UA 1K12A 2WAAA 4QKFA 3VZMA 5L7OC 1PGL1 1OMIA 1U5IA 4Q8KA 3NWKA 4AVAA 5FXZA 4CDXC 5FOJB 2E6VA 3ENRA 3T0DA 3ZKYA 3ZSMA 4AWDA 1JYIA 2VJXA 3W5MA 3ORJA 4H7MA 1BBT1 3PUHA 4YZ3A 1SBEA 4DEVA 2B8MA 3IAQA 2V5YA 2FZ2A 3T30A 5CKMA 1LOEA 4YM3A 4KWUA 3JBG3 4Y1VA 4FPJA 3WNKA 4XYXA 4XILA 2X09A 1XNCA 3P3PA 1JYNA 1V6MA 5G05L 1XNBA 2IFRA 5EIYB 4I30A 2GP5A 1AF9A 2IWGB 2YU2A 3WNNA 2HWF3 4EN8B 1UN1A 2LALA 4FBFA 1EUUA 1LOBA 5DDJ3 3ZOIA 2VZTA 2FBEA 1W8ZA 3HMYA 3AP5A 3VD5A 2QUOA 1IS5A 2YBKA 2EVXA 3E6CC 1XU2A 3CLPA 4Z2WA 2EAKA 4G3YC 1C3HA 5EXOA 4BB3A 1T6BX 4UBGA 1HV1A 3WSOA 2VUDA 3SLIA 1W6NB 4M3CF 4AAPA 5GALA 3FLTA 3KT4A 3LSDA 3PU3A 4ASKA 5J3UA 2VPVA 4QGNA 3ZVXA 3IM0A 1QJZA 1UO9A 1R1ZA 1O6UA 2DU1A 2Y38A 2RJ2A 2ZX1A 2RV9A 3WW2A 4R4ZA 2A6VA 3I3BA 3HN1A 3EO6A 2FCTA 1XB9A 4AE2A 3Q8EA 3RVHA 1BLZA 3E5XA 5LB6A 4YFZA 1YUDA 5LY2A 1COV2 4H55A 3J9SA 1RGSA 1W8OA 2ADEA 4A6SA 4HK9A 3U14A 1O91A 2XKPA 5LBBA 1UQXA 2ZGNA 4CU9A 4ARYA 3B3QE 4XFGA 2DCTA 1W9YA 3LB9A 1GOHA 3H1YA 4N53C 4U36A 4OI1A 4TWTA 1SLTA 3POYA 4L9BA 2VXJA 4LO7A 1NZCA 2H0VA 3O0WA 5FKCA 3WNLA 2NM1A 1RUNA 1ZYBA 4AAXA 5A6QA 2R16A 1B35C 1DQ2A 1VBA1 1MZ5A 1QQP1 2XJQA 5L73A 3INAA 2D40A 4IEPA 2WNEA 3CO2A 4OHWA 5DAXA 2WT1A 2A3WA 5LCWL 5FJHA 1W6QB 1S1AA 2F17A 1AX0A 3NAPB 4NIAA 2ARBA 1WUVA 4UW5A 4KGQA 5K9YA 1QOOA 5L7OB 5FZ1A 3W59A 2JDUA 4OMDA 2IXLA 2G4IA 2RS52 4FXGB 4QX2A 4EJRA 5FPXA 4ZKTB 1JOJA 1S0IA 1WLCA 1YFWA 4CDXB 4OQ8A 5C9AC 2Y0IA 2Q1FA 1WD3A 1COV3 2RMU1 3ATGA 3HPNA 4L97A 4Q4W2 3FMGA 5EHDA 4CE8A 3A0KA 3M3OA 1LHVA 3MFAA 4JTNA 4AHYA 3ECQA 1JXNA 3O1MA 1ND2A 1REEA 1QJEA 2GC3A 1X7NA 1MVEA 3Q9OA 4EYUA 2W1QA 4JGYA 2CL2A 5BNPC 4AVCA 2EIDA 3HD8B 1RUF2 3DKWA 4CUGA 1HJFA 4LEJA 2WR9A 1KEXA 1JUIA 3TBDA 1AXKA 1GICA 1YFYA 1AYN2 1GNHA 4PIZA 5IJRA 1XE0A 4XBNA 4QX7A 2R7EB 3I2KA 2JE9A 2ZAHA 2AEZA 3RFRA 2W1SA 1YJKA 1OF3A 4GJYA 1KJRA 4DRRA 2A1XA 3V65A 1J3QA 4XUNA 4OZXA 3RI9A 3D3AA 5JIUA 4RGAA 2E51A 2RS53 4LE4A 5J96B 3SEEA 5AFBA 4B7KA 2HWD2 3GJBA 1KS4A 1OUXA 3T0BA 2D7FA 1JZ4A 3PL0A 2VZRA 3GZTB 4Q4W3 3MPPG 2W92A 5FY4A 1VB2A 4O7XA 1ULDA 1CZTA 2BV4A 3EHKA 1N1TA 4LK7A 4WZCA 3LDRA 1XSRA 1T2XA 4YG6A 4GIQA 4FO9A 4DY5A 3NV4A 2HKXA 2R6QA 1QGLA 4LHLA 1MVQA 4OHXA 5JAXA 1G9DA 1RUF3 1BYHA 1W9FA 4LA2A 4CP1A 2IVJA 1OBNA 1WLTA 1REDA 3AKQA 1AYN3 4XZUG 3NVCA 2WLPA 4QKBA 5FPVA 3L2HA 4XJ9A 2G9FA 1UYYA 5FZMA 2VMCA 3KM5A 2PHDA 3IPVA 4N53B 3WCRA 4BE3A 2BQPA 4BIOA 3BGAA 2AENA 3C7FA 1IG3A 4QDSA 2E53A 4SBVA 2GC2A 4A3ZA 4CYDA 5F9TA 2WS91 1CESA 1NX9A 1W9SA 1B35B 2X53S 2XGXA 5A1AA 3UYJA 1FOD1 1WCKA 4BU2A 4CEYA 3VBUA 1ENRA 2DWRA 2NMOA 1W6OB 2HWD3 3LQCA 2ZX2A 4PJYA 2D44A 1NCQC 1DG6A 5B4NA 5DUWA 1F31A 1QWRA 4RR3A 1V9U2 4HSJA 5FMBA 3BU0A 3VHOA 1JTZX 3JD72 2FHRA 4XCBA 2JD9A 2QTWB 1GMMA 4ZS3A 3VV1A 1YI9A 2A70A 4E4DX 4PI2A 4UYBA 5KXDA 5GKAC 5C9AB 2ZEWA 1IOAA 3PJQA 5F5CA 5FYVA 1RIRA 1LOCA 1JYTA 3FJSA 4K3UA 1O3QA 1R1A2 2PHWA 4HXCA 5J36A 4L2NA 4Y5SA 1DF0A 2LROA 5E6HA 2DV9A 3ZMOA 4MX3A 5F2WA 2OX0A 5AVPA 5FZAA 2YC2A 1Y4WA 4GALA 5BNPB 4YW3A 4CRQA 4P9WA 2Z69A 2BGPA 2E26A 3IDBB 4XFFA 5JOZA 3DEMA 4CA9A 4HBNA 3ZDVA 3I2DA 3VUOA 1PK6C 4MXWB 4CZSA 5G04L 4Y22A 3GZAA 4ZPIA 4ZY9A 4UFIA 2EXHA 4UW6A 2PLV2 4ISRA 4N43A 1LAJA 4E2GA 3VL9A 4Y20A 3S0MA 3UGFA 4LULA 2A71A 3OGSA 2A5ZA 4XQDA 1C8NA 3AX4A 1JH5A 1V9U3 4BISA 5JSOA 1VRH2 1S0FA 3GYDA 4PI0A 2XLGA 4LHNA 2VE1A 5CA6A 1GZTA 1HRI1 2JDAA 2XHKA 2WNUA 4P00B 4RHV2 2VTXJ 1HQLA 4XJWA 5C7GA 2ATFA 2KR2A 5FYZA 3PDQA 3WDTA 2CWSA 1VALA 2YZ4A 3DKQA 4CEWC 4CP9B 4FTSA 2UU8A 4QAWA 1Z78A 4XQ4A 3N9MA 1R1A3 3HBKA 4RFT0 1OXCA 5LRSA 2A73B 2XH6A 5DUUA 5FZOB 2QQPA 1GUIA 3PLQA 2DCKA 4GWJA 1SPPA 3QBQA 2IFWA 1ZX5A 5T52A 5EZWA 2QQVA 1NLQA 3ZXJA 4M3CB 1J3PA 3I3EA 4BM8A 1W8TA 1BCXA 1UZWA 4LO5B 1EUTA 3ZFFC 2PLV3 4LLFA 1H8VA 5FZKA 3T1MA 1RUC1 5JVVA 1RXGA 4P14A 5DN2A 1MQTC 1W6PB 2ZEYA 4A7KA 3VGIA 1E5RA 3JBG1 3HAGA 2G9ZA 3T0AA 4D6QA 1VRH3 2QVSB 4BZ4A 4EWAA 2V5DA 5CADA 3QLQA 4RHV3 1SFPA 1VBE2 1WA6X 4ITCA 4JQTA 3WHTA 4G4FA 3BODA 2I74A 4HVOA 4BMBA 1UU5A 2HWF1 5JPMB 4IL7A 5KHGA 1DYOA 2UY9A 2ZACA 5FYSA 5DDJ1 3GCXA 1NCQB 5A7QA 5IFTA 5IFPA 4W6YA 3BTXA 2W2IA 4HPKA 1WZXA 4I3PA 3N9PA 3PTYA 1LTEA 3LD8A 1GZWA 3VDBA 5C71A 3O12A 4C90A 4Q4Y2 3LOBA 2H0BA 3LDBA 2Y6LA 4BXSV 4KWKA 4IERA 1XU1A 4KH9A 1EV12 1POV1 4AFMA 5DG1A 3E1F1 1WLDA 3WW1A 1UW8A 1ENSA 1L7RA 5KXCA 4LIUA 2XL9A 1PMIA 1XNDA 3S5QA 2O8QA 3RS6A 1IKPA 1G7YA 1U5YA 1BKZA 3OEAA 2A75A 4B1LA 4UW3A 2H6BA 2R072 1PK6B 1S2EA 2J1VA 5E89A 2RHPA 3HBZA 5DAVA 1VBE3 5D8AC 1JZ6A 1ZM1A 2VOTA 3ELNA 2E63A 4UFJA 1CAXA 4N7UA 1HXS1 1SFNA 3ES4A 3MW2A 2CAUA 4A7YA 2OUJA 4BQ4A 5GZEA 3NSTA 5DMYA 1XYOA 4LBQD 4DINB 2GH8A 1S55A 1VP6A 3J4UH 5JR7B 3MZHA 2WYFA 3BPZA 1NLRA 4QU2A 4GH4C 4JRLA 4AI8A 4Q4Y3 1CAUB 4YM1A 4CEWB 5I8TA 1ONAA 4CUAA 1TMF2 4EE2A 2VBPA 4NMIA 1BEV1 3OGVA 3W20A 1MPXA 1EV13 4TYSA 3U78A 1D7PM 2QDRA 1ZZ9A 1ZZ8A 4PCRA 3VZLA 4YZ5A 2V4VA 4Z07A 2P34A 2QQKA 5FP7A 3NV3A 1I5ZA 5CFCA 5FYHA 5T5LA 2R073 3EMRA 3NKTA 3OUIA 3LSEA 1RUI1 1COV1 3WVJA 4QWNA 3M4FA 1F2NA 2MPFA 4OUEA 3WDXA 2R062 3QCWA 1W8NA 5FZ0A 2W0XA 2C24A 3P6BA 3UETA 4BA6A 4LOSA 4O61A 4CXXA 2GP3A 3AVSA 3Q8CA 5F39A 1MQTB 4FQZA 1G9FA 3X29B 4CDUA 4ZU7A 5IVEA 1N1YA 2FDFA 3ZO0B 4B1MA 2A6ZA 4HOOA 4R9CA 5T5JA 1MS1A 1TME2 1W05A 5J1XA 2JENA 4R9DA 4QQ2A 4GAZA 3VZKA 3VBFA 2NP0A 4QPYA 5KHHA 5FMOS 3RMYA 1W2OA 5GM0A 4YG3A 1SEFA 4XBLA 1GOGA 1DIWA 1TMF3 4BQ2A 4IE6A 3WDVA 4K1ZA 3GDBA 1RB8G 1VMJA 4LKSA 4Q4V1 2YYOA 1LENA 4QXKA 5IVCA 1UPIA 5F3GA 3ZN6A 1J83A 1JW6A 4MSVA 1UMZA 4MO3M 5JMCA 4RQPA 5T5OA 4YVSA 1FYUA 4IV3A 4A42A 3QH7A 4YWAA 4D94A 2I07B 4Y4RA 2BNOA 4ZZ5A 2VNRA 4Q4W1 5I0DA 3ILRA 4FT8A 2ERFA 2R063 1AR72 2J42A 4EN7B 3EBRA 3N36A 5FPAA 2JIGA 5F6KA 4NE9A 4Y5Z0 4AI9A 1GYKA 3WLUA 2VXRA 1TNRA 5JZGA 2RDSA 3NRUA 1TME3 3ZLIA 2LW8A 1RUF1 1GV9A 1US3A 2BVVA 4WBBA 5D8AB 2D43A 4CU8A 1AYN1 1PVC2 4LA3A 3MIDA 1O59A 4XUOA 5A33B 1KFUL 1UZZA 4QQHA 4QQPA 2DBNA 3HQRA 3I54A 1CZVA 4COVA 1W8UA 5C3PA 4YYOA 2OW4A 3CQOA 3ZMNA 3MI8A 2ARXA 3I97A 5LBEA 4IEVA 2ZGMA 4XFBA 2ZPXA 1RJ8A 3CNAA 3AL6A 1Q5OA 4GH4B 1DQ0A 1PIV1 2OA2A 4WM7C 4M00A 1XNKA 3WP3A 4PBOA 3VHPA 1WMXA 1QH6A 2ADDA 2NMNA 2GAUA 4CU7A 4O9GA 2JG9A 4IGQA 3R0RA 5JXHA 4TTGA 2B39A 1AR73 4DRVA 4YW7A 4LBOA 5HPOA 2FMYA 4YM0A 4JCKA 1ND2C 2GMPA 5I0UA 2VZ3A 1AL22 3T09A 1AUYA 2GSYA 2PELA 4JGYC 3T1LA 5CZKA 4MHUA 2FD8A 2VOWA 4EWEA 3PURA 4CDWA 3MIEA 1PVC3 1DGLA 1HRV1 3SISA 3PUIA 5GJ6A 1Q8PA 3OYWA 3WINE 1X50A 4XAAA 3VBOA 3VDCA 1JS9A 1BHGA 1RUH2 3R4DB 5F3IA 1FI2A 4FPEA 2AZ5A 3ZYBA 2W5FA 4H3WA 3I4IA 3BCWA 2VMHA 2VZUA 2P37A 1GU3A 3H3LA 5IW0A 1OD5A 4XFCA 2QQOA 4MGIE 1U12A 2RDNA 2X05A 3WHUA 4YVWA 2OQ6A 2R0FA 1HIXA 1FNZA 4WVWA 5EP9A 3N35A 5C8CA 4IE5A 4Q1PA 4UI9L 4LMFA 5A3TA 1NYWA 1WMDA 1V9U1 1O8PA 1WW4A 3SC7X 4CUBA 5BNQA 3O1OA 1W3VA 1DYKA 2LM3A 1GNYA 3DYPA 3KVBA 4KU8A 1AL23 4CPBD 4NIGA 3M8LA 2TNFA 3HQXA 4TZDA 5DPNA 1Q8SA 3OGGA 4YGDA 1RMU2 1VE0A 2DCJA 2RM22 3J7LA 4YZ4A 2B42B 2D6OX 2IZWA 3ZPYA 5JI7A 1ENQA 4AFDA 3VDDA 4AVTA 1R1A1 2YGMA 4Q29A 2YFZA 1F8VA 1ULEA 2JG8A 4P9GA 4BQ5A 1RUH3 3BU7A 3KQRA 3OD4A 1IPSA 1W9TA 4C0HA 1RUE2 4XFAA 2DVFA 1V70A 2E7AA 3K4ZA 2WBKA 3RMXA 2QQIA 1LEDA 5HCBA 2DFCA 4WM8A 3NNGA 4DPNA 1DP0A 3CJIA 3LOIA 4BK4A 4JV4A 3BTAA 5B4XA 2PLV1 3SKVA 4CEYC 3VBUC 1VBB2 5HCAA 5A6YA 2A3YA 2YBSA 2XHNA 3NL1A 4JQRA 5ANQA 4DUVA 3FC0A 3APBA 4X8NA 5IAVA 2PHLA 4RFRB 2A3XA 3CJXA 3D4KA 3H50A 1GQPA 2XVGA 3K75B 4RR3C 2RJKA 1VRH1 2V73A 3P5BA 5FLJA 1W2AX 4RHV1 4MGTA 1XJAA 1D4M2 4CCMA 4LBQA 4X8PA 2ZGTA 3R4UA 3AYCA 4FXKB 1ODNA 1RMU3 1WLWA 2BRTA 2E7TA 2RM23 5FYYA 1OVSA 4BWOA 4TN7A 1AYM1 1CX1A 1ND2B 2CDPA 5H9SA 1W6MA 3K4AA 4INDA 5CAZA 2IXKA 2NZ9A 5FY0A 2DBIA 4JGYB 5CKQA 2Z2SB 4QPWA 1UOFA 5FO9B 4COUA 3MHZA 1AR82 2IUWA 1RUE3 4OVEA 3U37A 5KHIA 1AXYA 4H7LA 1HB3A 5LA2A 4AQSA 5CG9A 4MYEA 2F4PA 4UAPA 2VZSA 3AP7A 4P02B 4W50A 1GKBA 1BVVA 1G86A 2HBTA 4XDQA 1VBB3 4H2AA 1JZ7A 1W2UA 1G6NA 2C26A 5JOXA 1HN0A 1EPZA 2CGOA 2EIEA 2ET7A 5DG2A 5EYYA 5FCCA 3RNSA 4NWVA 1GP6A 4NHKA 2WFF2 3KSCA 2MEV2 1JMUB 2NLRA 4YNIA 4Q1RA 2LTNA 3KGLA 3KS7A 4UF0A 1LHWA 5CFDA 3TRSB 4AFAA 4A7ZA 1VBE1 5FFOC 5FYMA 1D4M3 1ULOA 2OKXA 3FBMA 5GLWA 2W94A 2DF7A 2WNUC 1UY4A 4AQTA 2EXJA 2J22A 1YIPA 1J84A 3POGA 3HNBM 2WO7A 4NRMA 4XUTA 5LASA 2WWSA 1ZVFA 3EJKA 4YPJA 2WNVA 5GLUA 3H8OA 3T4VA 5HXMA 5FZLA 1PM7A 1WW6A 4ASMB 5L36A 1XOYA 1UKGA 3SCHA 1UNBA 3ZKUA 2JB8A 3AMNA 2YBPA 4XEZA 1GANA 4AEDA 1AR83 4LITA 3LZZA 5K8SA 3Q8AA 2BWAA 2VD7A 4HT1T 4FOWA 2BEOA 3POIA 3GBFA 3N7KA 3E5UA 4A44A 2EF6A 1QU0A 1Y7BA 1F5FA 3IPVB 5JDBA 4KQ7A 4Q0UA 2OS2A 5A3MA 1Z7S2 2DDUA 3NV1A 5HCFA 3QH6A 4UFKA 1S0CA 3KF5A 4OI0A 1JU4A 2WFF3 2MEV3 1ZRIA 2R071 3JQXA 5H9PA 3RSJA 3A22A 3WG1A 5IVFA 4MXVA 4PHZA 2VMGA 3EQEA 4NJ4A 1A6CA 2YPJA 4CEYB 3NAPC 3VBUB 4IXLA 2GC1A 4DMIA 5C3RA 2RJLA 4FCAA 4AVBA 1OKOA 2CAVA 2Y64A 3VBRA 2RDQA 1RUJ1 4D69A 4UWDA 1UCXA 2VUCA 5T3NA 1O4ZA 3DUIA 4S2FA 1Y3TA 3CZUA 4RR3B 2UWBA 5F3EA 5FK7A 4IETA 1EAH1 4GKXA 4NAMA 2A6YA 5A3WA 3OG2A 3HN3A 2DU0A 5JPNB 1C1LA 4CCEA 4ES8A 1KXGA 2WWUA 2SBAA 5LBFA 3VDAA 1VAVA 1TMF1 3KCCA 4QT6A 5A6ZA 2YC0A 1FPN2 1ZBE2 4AK3A 3RZMA 3MW3A 1H6YA 1GFF2 1XPWA 3E6DA 2WQ4A 4IEYA 5C70A 3KCXA 1YQ2A 3SKJE 1OC1A 5LBCA 2EXIA 5FMCA 5JLVA 4C0BA 1DZTA 1GZCA 1Z7S3 1CN1A 2VMFA 4HZFA 2BGCA 3FUOA 1MZFA 4AG4A 3D82A 3HIFA 4M0HA 4AYUA 4CCDA 3VKOA 1SZBA 1DLCA 4Y22B 2YY1A 5IVBA 1DHKB 2R061 3KB5A 2QQMA 1C57A 1F4HA 1MEC1 3AZXA 5FYTA 4DEQA 1CD3G 4N43B 1ENXA 5CVRA 4IQPA 2X5IA 1SLIA 4LBJA 5KR7A 1LRHA 2OQ7A 4LQRA 4Y20B 5JXGA 4ATFA 3RJRA 2F4LA 1RINA 5IYYA 1TME1 3T08A 2AC1A 2Q1MA 3WF1A 1V6LA 5F6LB 4ZXEA 4YW1A 1LR5A 1CR7A 3TOJA 2WNUB 1QDOA 4LOTA 1R082 3AP4A 1VRBA 1XNTA 5FREA 3PMEA 2XQXA 5IK4A 2VR4A 2EXKA 2JEMA 1OOPA 3E97A 3MEPA 4URAA 1FPN3 2D5FA 3UKNA 1CVNA 1ZBE3 2VNOA 3D0JA 3I8TA 1V6OA 1W8FA 2H6CA 3OGRA 2DFBA 4AEMA 3O1PA 1AR92 4AOCA 3K48A 2DURA 4JKLA 4S2HA 3RRDA 1SPPB 1O5UA 1HX6A 1OLQA 4XPVA 1UL9A 2ZGPA 5BNNA 4COYA 4B7EA 5H9RA 4HL0A 2Y6KA 2GZWA 5JMOA 1IPJA 3NNMA 2JB4A 5CFCC 3ES1A 2QNKA 1OF4A 2XUEA 3VN4A 3WG2A 2CTVA 5AC91 1X9TA 2VAUA 4QX8A 4CPBA 1AXZA 3WF3A 4PLNA 2P3YA 2GALA 2VW0A 1WD4A 3D8CA 3SEPA 4JTOA 4XF3A 4CDUC 2LS6A 4AQ2A 3WG3A 5KHJA 2CGPA 1DQ1A 2CHHA 4JHZA 1NCRA 5E16A 1SDDB 2GN7A 4E4HA 4X6RB 2VNVA 1KDMA 3AKPA 4NWWA 1UF2C 3M3CA 4P08A 1IHMA 2BUKA 1RXFA 4RL7A 3TEZA 2G19A 4V1PA 2BNNA 4CTEA 3SH5A 1PVC1 2XJSA 4DUXA 3UNPA 4OMCA 3VBFC 1R083 3V0AA 3UKTA 3AJYA 1OFNA 3ZXFA 5CU1A 3U75A 3KHCA 5JCTA 4PDWA 1AR93 4HPKB 1OLMA 3DCQA 1S2KA 1S0EA 1GZWB 1PGSA 1YXWA 2QQUA 1RUG2 3A0NA 1UX6A 4WVMA 2R1BA 5EV7A 4XBQA 2PHXA 2Y26A 3KV4A 4QPIA 4RQPC 1AL0G 4YVSC 1KQRA 3WNMA 4IV3C 2QZ3A 3WP5A 4KWLA 5FUNA 1POV0 2P3IA 3OPZA 3WOGA 2ZHNA 1PO21 4LKEA 5AVAA 3GBGA 4GD4A 4AFCA 3WQ1A 3CBNA 1HKDA 3S30A 3MFCA 3VD3A 5CISA 2DYCA 2WRAA 3EB7A 3OBTA 4CCOA 2JICA 4LR4A 5JZGC 2ES3A 4AHZA 1YCIA 1NG0A 3HOBA 2XG3A 4XJ8A 1YFXA 1ACCA 4JGZA 5K7PA 2CDOA 5LK5A 3KZ4C 2ET1A 1CAXB 4TSVA 5HXVA 1OFSA 2VMEA 5C3OA 3KMHA 4DS0A 2P4EA 3MICA 2ZGRA 4FPKA 5J48A 1AZDA 1NLSA 1X82A 4FFIA 4E4SA 1YEWA 3K4DA 1A34A 1HV0A 1UD1A 4ZS2A 3WZ1A 2ZMKA 3N3HA 5C4WA 2WWJA 5C3SA 3OPWA 3T2TA 3ACGA 1UYXA 1RUG3 2DCYA 4IGOA 4BDVB 3N9LA 2YXSA 1PZ8A 5FZ7A 1WCDJ 2Q4SA 2IXJA 1LOGA 1PMHX 2VCMA 3WQBA 1VMFA 1QKQA 4JZRA 4YLZA 3NW4A 4Y4YA 2HWE1 1NQJA 3MYXA 1N3QA 1ULFA 4NPMA 2DUOA 1YIFA 1KJLA 1SCSA 3OGJA 5CYYA 5FZHA 3O0VA 3OUHA 3TNQA 4DIQA 5CFCB 3VKNA 1RMU1 3USUA 4K8FA 1C8M2 4B8EA 1H1MA 5GZDA 1CIWA 3HR9A 3JXSA 2ARAA 2RS12 4K9SA 4NHYA 2XJVA 3THCA 4CDWC 5F7UA 5DABA 3U0ZA 1YYNA 3I3DA 3IKWA 2FDHA 1CX4A 2E31A 2CU5A 4WV8A 5FTTC 1VLNA 2C9KA 4BIFA 3ACHA 4QXHA 4CDUB 4CCKA 2LUWA 5JSRA 2ORZA 3VD9A 1PO11 1IQAA 2ETEA 2GMEA 4OI4A 3O1RA 2WL1A 3K77A 4C1WA 1RUE1 5DZFA 3I2FA 1HDKA 3J8F2 3KCYA 3H8UA 1K3IA 1IG0A 2PFWA 5A6XA 1PGW1 4I0WB 3U07A 3VBFB 1LOAA 2JDZA 2HJIA 4XF0A 1FV2A 4IDZA 3RGBA 1URXA 1JZ8A 1STMA 4CCJA 3AL5A 2A7AA 1QJU2 4AVSA 2WSUA 2ORXA 1K42A 3B7MA 3MLJA 5A3OA 5JIAA 4YVWC 2R042 3F95A 4PT6A 4B29A 5C8CC 2D6NA 4JDMA 2UY8A 4NIDA 3ZN6B 2BOJA 4C91A 5LZ6A 1O7FA 2D6PA 1OQEA 2MHFA 2XLAA 1D4M1 5FP9A 1FV3A 2K2SA 3M3IA 1UY3A 4RQPB 1XC6A 3AK0A 4YVSB 4IV3B 1G9AA 4J1XA 1C8M3 1ND3A 1ZNPA 4YW4A 2W1WA 2RS13 3VL8A 4A41A 4CCNA 1OLME 3OF1A 2ZMNA 1OA4A 3HNYM 3VDDC 4ES9A 2X29A 3A7QA 3AXDA 2W39A 1GSLA 4META 2PHRA 1HB2A 3SHRA 2P6HA 4IW3A 3NNJA 2JG8C 5JZGB 5FK8A 1QDCA 4XXAA 1AR81 3I59A 4XHBA 5SV5A 2ZX3A 3J8F3 4QM9A 4OQ9A 4RSUA 1JODA 3ZSEA 3OTFA 4MADA 1ZA4A 1VJ2A 2PQQA 4AI2A 2HWB2 2VU9A 4LUKA 3AVRA 3JD73 2AREA 4D8MA 2W68A 4E9KA 2WZR2 3CJIC 1DGRA 1QJU3 2JXAA 4Y1YA 1C1FA 1A78A 1H0BA 2E33A 2RR12 3H1MA 4HN0A 2BZDA 4P9JA 1YI7A 2R043 1APNA 1GQHA 2Q8OA 5KBFA 2JDPA 2Y60A 4LK6A 2WAOA 1QY4A 2UYBA 4BMEA 1JOPA 1AR61 2WFF1 3RYRA 2MEV1 1ZRFA 3BTZA 5FUIA 5I0TA 5DZGA 1MS9A 4LHSA 2VOKA 5LA9A 5KC5A 5IUQA 2VBDA 1YQ8A 5FV3A 1BZWA 1W2TA 1LGBA 3CIHA 2W9XA 2ZEXA 2TBVA 2X10A 2JG9B 3RJ2X 3KF3A 1W2NA 2XVKA 3AFKA 1BMV2 2VW1A 3S7IA 3OBRA 4GULA 1MR5A 4XE9A 1GLHA 2VVFA 2Q5TA 3GM8A 4AI1A 2XR4A 1LU2A 3CDZB 2W46A 2QQNA 5EJ3A 5FZBA 4CUCA 2G1MA 2AUYA 1J1TA 2FDJA 1HQWA 2ZZJA 2HEWF 4B4RA 3ZXGA 4CDWB 5ISLA 3RZHA 1X33A 2WUHA 3B00A 2HWB3 4XDPA 1G9CA 3PVOA 2XPJA 2EAAA 3C8XA 2WZR3 2XB6C 3OYWB 3UKVA 2O14A 5A3UA 2RR13 3FBYA 5KC6A 2OPWA 2Z5WA 1ZA7A 4LPLA 4D7YA 1W8HA 3THDA 5IK7A 3O1SA 2QFEA 2PXJA 2J1EA 2W1UA 2WSVA 1QJX2 3ALQA 4HN1A 2Y6FA 4HVQA 1LULA 5CFDC 1H8TA 2J1TA 3GBWA 4O9EA 5HCHA 2BW8A 5LRRA 4LE3A 2JD4A 3NNLA 4YVWB 4I02A 3SH4A 3CF6E 2Y34A 5C8CB 4NHMA 1S4CA 2Y6HA 5FZ3A 2WNVC 5IATA 1CQ9A 1ZZ6A 4YGBA 1WBFA 3VLBB 4ATEA 1MS8A 1IS4A 4Q4X2 4XACA 5FQ0A 4XMAA 2SLIA 3WV6A 1H2MA 4QXCA 2BDRA 2G9GA 3WQ7A 3N4MA 4QDQA 1HN1A 4HKLA 3OOXA 4LLOA 2VNGA 3VDDB 2VCCA 3S5AA 1RYYA 1UWWA 1UU4A 3JU9A 2YHJA 2JG8B 2I2SA 3ST7A 4MG2A 3FL7A 2XJPA 3WXPA 5I93A 2ZHMA 4Z82A 4Y26A 1S0BA 1DU3D 1WGPA 1JHNA 3FWEA 5LY1A 1P8JA 2HYXA 3MF6A 1QJX3 3IZOA 4WM8B 2BJSA 4QX0A 4MGYE 3CJIB 3DYMA 3LGRA 1Z0HA 3T4HB 4CDQA 3FN9A 5IWFA 4QQLA 2TEPA 4GMP0 4M4RA 5FOBB 5A32A 1EYBA 2YG0A 1Q8OA 3LPGA 4QX3A 2HEVF 3MUZ1 4NHLA 3VBRC 3IIIA 3JCIA 3ZSKA 4CVUA 1GNZA 3BB6A 3LA3A 1CONA 4Y1UA 3VBHA 2VTFA 4Q4X3 3AYAA 4AXOA 3R05A 3THPA 5F1RA 4LBQB 2I45A 4JDNA 5JSPA 1R081 2C4XA 2JE7A 2ZABA 4QXBA 3TEYA 3DPRA 3LA2A 3G7DA 4KU7A 4UT5A 2JKXA 3IMNA 4HKWA 1BBT2 4YSFA 5JOYA 1A8DA 1AR91 2XOMA 3B9CA 4UBHA 3RG0A 2J1SA 5FZDA 2BGOA 1KS5A 4WVZA 4F83A 3K3NA 2HBUA 1QJY2 3W5NA 4EQVA 1LGNA 5FP4A 5FY8A 4LBMA 4XTPA 2QQWA 4MGKE 4R9BA 3LEMA 4W65A 3H3ZA 2IC1A 4NRQA 2FMDA 3VBSA 1H2LA 4HVRA 4XVHA 1KD7A 3GXUA 4AFBA 1I5PA 2WA4A 2X5IC 2FDGA 5F3CA 5FZGA 1F9KA 5HV4A 1NA1A 1VB4A 3K2OA 5A1FA 5C5TA 4PQQA 3GALA 2ZXQA 2VECA 5T5PA 4OHZA 4UF0B 4YRDA 5CFDB 1EPWA 2XUMA 2ZGQA 4K20A 3NQHA 3WF4A 1H6XA 4L8QA 1V6NA 4AZZA 4AGRA 2RS51 1SLBA 2DTYA 5D1IA 2ZCWA 4QB6A 1OOPC 1YLLA 3DXTA 1H9PA 2WNVB 4P9LA 4YW6A 3BUCA 1WMFA 1BBT3 1LGCA 3TN92 3IAPA 2FCVA 5I8SA 3AMQA 2OZJA 3IDAA 3KLSA 3VZOA 1JN2P 3AZWA 5FAXA 4AEDB 4D6RA 2AH2A 1QJY3 2P6CA 4IE0A 1Y9QA 3BALA 5FZCA 4DUWA 2OZ6A 5JI9A 4Z92B 3H8XA 1LHNA 1RJ7A 1DGRN 4YFWA 4YGEA 2GDFA 4FSJA 4J25A 3K46A 2WT0A 3AKRA 3LF7A 1CAVA 1EP0A 4GKYA 2FCUA 3RYPA 5AFEA 4GB32 5I0RA 3GGLA 3TNPB 4P9IA 1T6GC 1ULPA 1GR3A 1DLLA 4MUVA 3SITA 1NCRC 3QACA 1ULCA 5T50A 3B9IA 3R4SA 3WG4A 2ZEZA 1QQP2 1SBDA 4UFHA 4QGLA 2BFUL 2DVDA 5A70A 5KXBA 4AI0A 4LKDA 3RI8A 4FPLA 2OT7A 2HWD1 5GZGA 3VHNA 4IEOA 5SV8A 3VBRB 1BQPA 1ZZCA 3ZXDA 3SH3A 3TN93 5GZCA 4PDWC 4K1YA 3I7DA 5J7MA 5FRAA 2C9AA 4FFGA 1NZIA 3ZYFA 5CEHA 5FXVA 3DV8A 5A7NA 1E5IA 2RMU2 1RHI2 5IAXA 4QPIC 4TLFA 5IK8A 4QPGA 5FY1A 2KA3A 1UZVA 2PN5A 1IKQA 2B4KA 5FY5A 3AC0A 3NO8A 1WKYA 2C1FA 5FZEA 3OEBA 1MS4A 2VBBA 3NNFA 4GB33 4CXWA 1NXMA 4UXAA 2P3KA 4XFHA 1Q3EA 1SMVA 5CKNA 4D3WA 5K4LA 5APAA 4XIKA 1LECA 3T2QA 1C8M1 3NJVA 3HEIA 3ZDSA 3P1IA 4JGZC 3H7JA 4XXPA 2RS11 1QQP3 4Q5OA 5FLIA 2AR6A 3IDEA 4C1XA 1QMJA 2X5IB 1OQ1A 3WNOA 1OSGA 1OH3A 4P5YA 1W04A 4Q0SA 4Q8LA 3H7YA 2JWPA 3PVBB 1W9WA 2VCBA 5FDBA 3VZNA 4AL9A 1XYPA 3B69A 4Q0VA 4AHXA 2JDYA 1UIKA 1TVGA 2JDHA 3JD71 5C8WA 3WNXA 3O1UA 1XSQA 4R8HA 3A21A 2VOVA 1N1VA 3CMGA 1OOPB 2RMU3 1B09A 1RHI3 2R041 5I8YA 5JWPA 3JUUA 2BP6A 3GJAA 1DFQA 3PIGA 4BLJA 3MLLA 1LOFA 4AGGA 3OD0A 5L9VA 1HJGA 2IXCA 4K8RB 5BNNB 2HLEA 1BVP1 2ZGKA 3DXUA 2W47A 1GWKA 1FXZA 3PVNA 4BJ0A 3GCWA 1SLCA 4PF1A 3MDPA 1XYNA 4KNCA 3LCPA 5FYBA 1JZ2A 3R6SA 3WF2A 5FR3A 3VKLA 3M3QA 4A45A 1YFUA 4PBPA 1H2NA 1M4WA 1CGPA 3DYOA 1QEXA 1LKNA 1TEIA 2CV6A 3POFA 3OBZA 4OLLA 5ERLA 5FJKA 5FYCA 1SACA 1WMEA 1NCRB 3CZJA 2GH2A 4XF4A 2WS92 2LRPA 2UWAA 1CPMA 1DGWX 1H1IA 1WCQA 3J7HA 3ILFA 2GNTA 5A3NA 2WQZC 3UJOA 3V0AB 2ZMLA 3USSA 4XDOA 2O1QA 4BOWA 4BQ3A 2RR11 4UOJA 3ZXKA 3LEKA 3MIGA 4XABA 3MGUA 3ZN5A 1U5XA 4XZPA 2XXZA 1PVXA 1XRUA 4HONA 3J26N 4PDWB 4JDOA 1XXNA 4CSWA 2B7YA 2Y0OA 2VC9A 4N7IA 4NOTA 4N9IA 1NQDA 3OY8A 1FX5A 4WVMB 3PUQA 4IEZA 3GZEA 2YDEA 4MGZE 3IBMA 4Q2FA 1LB2A 4OI2A 4QPIB 5IVYA 3K3OA 5GZFA 1ND3C 3ZYGA 1W06A 4PIXA 1JI6A 3NJZA 4YZ2A 2YGLA 5FP3A 4EN0A 5E88A 5FYIA 1C5IA 3GNEA 5LA0A 4CXYA 4XQWA 1OKQA 4JVAA 3D6EA 3ZXEA 1Y43B 3LIGA 4CP0A 1CAWA 4LO6B 4N43C 3UV9A 5FWEA 1QOSA 3ZFEA 2WS93 2XJUA 1JUHA 2HYKA 4JGZB 5BY5A 2Y6JA 1O3SA 3PNAA 3ETQA 2AYHA 2ZGSA 2CGNA 4ORFA 4RGKA 3GF6A 1EY2A 2C0ZA 3ZR5A 3L2YA 2ZGUA 5FZFA 4R4XA 1O4TA 4N9HA 3IIAA 5F5IA 1YWKA 5C4WB 4EROA 2XBO2 1H4GA 2BFUS 1IS3A 4NO4A 1UOJA 4ARXA 1QJX1 1RL3A 1ST8A 1PNGA 3MLKA 3LFIA 3PIJA 4XUQA 2YV8A 1X8MA 4AW7A 3MIBA 4UFLA 1S0GA 2Q0AA 4Q4Y1 1RITA 3O0XA 4BYYA 2BPA2 2NPIA 1CIYA 1SLLA 4K6BA 4FP3A 4G9SB 3SQOA 4CCCA 2JDMA 4OYUA 4KMQA 1EV11 1HLCA 2RDRA 5FLHA 2PQSA 4D6SA 1Y9MA 4YGCA 4FPYA 5C3QA 3N9OA 4IV1A 4DXTA 4KL1A 3USUB 3D5OA 3WUDA 1UYPA 1NE6A 4IE7A 4MGSA 1MZEA 3AFGA 1RUC2 2D6KA 4BQ1A 2ILMA 4E2QA 1DCSA 2GC0A 1ZZBA 5HI0A 3A23A 1JYXA 1AX2A 3ZIWA 4Q0PA 5EWSA 1YQCA 5CG8A 2WQ8A 1JZ3A 5GLZA 2P5BA 1NE4A 3VKMA 2XBO3 3WDWA 4C8DA 4JRAA 3RDIA 3B5LB 3W21A 4K40A 3O5SA 1H8TC 3F2ZA 3BTYA 4Y33A 2QZ2A 1TE1B 4KI5M 3I3MA 3AZYA 1D4VB 5F37A 4LBKA 4QGMA 1GBGA 1N1SA 2CWMA 2EIGA 1RTVA 2AACA 4FPHA 3AYDA 5FZ4A 1U5ZA 5J09A 3ZYHA 1ZRCA 1JYWA 1BXHA 3BKZA 4I01A 5GLTA 3ILNA 3POBA 2XVLA 1ND3B 4N8MA 4XF9A 2P2KA 4RS5A 4B4QA 4BQWA 2ZHKA 4ZHNA 3NMBA 1V6IA 4L11A 1RUC3 3ACIA 2Z4FA 1POQA 1ZBA2 3U10A 3S7EA 1ASJ2 3HWJA 3HJRA 3LEIA 2VL4A 3AP6A 3IWZA 4H14A 2VMIA 4RN5A 1QJY1 3I59B 4XOGA 4IEXA 5IK5A 2RE9A 4KG8A 2L9LA 3POSA 3RQ0A 2PHFA 1J58A 3WUCA 2ZKNA 5DZEA 1N3PA 5ABJA 4FQ4A 2QBXA 1HXS2 4UFMA 5DAQA 1SBFA 5EYXA 1GWLA 3SNMA 2A6XA 4CDQC 1QNWA 3ME2A 2W52A 4AR2A 1UMHA 1NXD1 4GWIA 2C6SA 3NKGA 5BPXA 3WCSA 3WNPA 2RG4A 1OI6A 3HQUA 2WZ8A 3FZ3A 1NY72 3AZZA 3IB3A 4COZA 3JQWA 3VBHC 4HLTA 2BWCA 3LKJA 3THTA 3OSDA 1BEV2 1K5MA 4NRPA 3DPRC 4XF1A 4EN6B 1L7LA 1NUKA 5FUPA 1POV3 3TN91 3KV9A 4BH9A 4EZHA 5KHKA 1VMHA 5M0TA 2WNOA 1AR71 3AJZA 3N9NA 1ZBA3 3Q8BA 1VBC2 1MS5A 1ASJ3 4AQ6A 5FXXA 4YARA 2QJVA 5A7WA 5LEJA 3WD5A 5FZ8A 2VQ0A 2FQPA 4YG0A 1RUI2 5EFUA 3VHRA 2IXIA 2VTXA 3LDKA 3U1XA 4DOUA 3RYKA 4FI9A 1WW5A 1HXS3 3FLPA 3M7AA 4QHOA 3PU8A 2P17A 1SLAA 2VCAA 1V6JA 3RPQA 3VBSC 1FMD2 1D0GA 2PTMA 2VH9A 3H9AA 1REFA 2WINB 4AF9A 3V0BA 2TUNA 5DAWA 1TG7A 4GB31 2UURA 2UWCA 3PVEA 1G9BA 4GWMA 3NJXA 3ZSJA 3BN6A 3H0OA 1PZ7A 2PMWB 1NA1C 2BBAA 3VD7A 1DZRA 1H8TB 2WABA 2R32A 2XWBB 1W03A 3B02A 4PF5A 1VPHA 4QHBA 2C5DA 1BEV3 1KFXL 3AP9A 5DUVA 3P3NA 5LW9A 3UJQA 4Q4V2 5EJZB 4I0AA 1GWMA 2VZOA 1GQGA 4HG6B 3SXWA 2ZHLA 4OUMA 3N9QA 1LCLA 5IVVA 1UXXX 3KGZA 4KBZA 2FDKA 2BBVA 2GNMA 1VBC3 5K0UA 1AVBA 1R64A 5FQ0B 1SDWA 4E4ZA 1AL21 1OQDA 1LESA 2DCZA 3MIFA 1RUI3 3LIHA 4L99A 2W3JA 3D0SA 1RHI1 3OJBA 4W4ZA 3FHQA 3SCGA 4LORA 1UY0A 5FMDA 4NROA 4EZ4A 3KWVA 1FMD3 1I6XA 4FFHA 2BERA 5D21A 4BLIA 4E8CA 1BK1A 2VVEA 1BJQA 1JBCA 1RUH1 3ZFGA 4N90A 2MNGA 4MHRA 1W39A 5ANNA 1K5JA 3FE5A 3POEA 2RS32 2EALA 4FAHA 3KT1A 5TSWA 1E5SA 2WA3A 2YFUA 4CDQB 4FTEA 3E5QA 4HMZA 5A1LA 3C2UA 2PHTA 5BNOA 3PJYA 2HWC2 1I3HA 4FFFA 5A32B 4CCLA 4Q4V3 1WBLA 2HH9A 3ZSLA 1QJFA 4LO8A 3OCPA 1QF3A 1S0JA 2B46X 1SCRA 2JG9C 2WKKA 3ZM8A 1PIV2 1FNYA 1UIJA 2WYSA 3VBHB 2ZBJA 4AEJA 2Z42A 4Z2AA 4XMIA 2XDVA 1K45A 5FO8B 5LK7B 3DPRB 4IUGA 1M06G 5FPUA 4DXZA 5EJ1B 2J1AA 2RM21 2WJSA 4Q27A 4XCAA 4XHXA 4COWA 2Y33A 2PAMA 4QPGC 3BIEA 4A4AA 2Y6GA 3B93A 2OVUA 4NIHA 2J7MA 2B9VA 1LJ7A 2VQAA 1XE7A 3MPBA 3VBOC 4XETA 4QMAA 2FZ1A 2OIIA 1HRV2 1Q8QA 1R092 1UMIA 3CKHA 1ULGA 2RS33 2D5HA 4U2AA 4TLGA 4XUPA 3VBSB 4DB5A 1FAYA 1Q43A 3AYEA 4XTMA 3ZFFB 1DDLA 3IT8A 4O65A 5J37A 2R30A 2JDKA 3EYPA 3KVAA 4ASLA 2HWC3 5LATA 1TZOA 5JUVA 1PZ9A 1VBB1 4WM7A 5EPAA 3ZXAC 1NA1B 4KWJA 3CEWA 4JKMA 4OZOA 2DUQA 4NHXA 5C33A 4QHZA 5IHRA 3ZX7A 1PIV3 4K21A 2ENRA 4BHPA 3HT2A 3URFA 5FYUA 4XAEA 2Y8KA 5FZ6A 5ACA2 1X9PA 2O0OA 1DGWA 2W87A 5T54A 2JJ6A 4ZXKA 2WIIB 2J1RA 2RVAA 2ZA9A 2OXBA 2VY0A 1WCSA 2DVAA 1RC6A 3BYWA 3IDCB 1FT9A 1LOFC 2D93A 3WW3A 4S2DA 5I0SA 2D97A 2NQYA 1HRV3 4EWDA 1R093 3UT0A 5KXEA 1O3TA 3AB0A 3AZVA 4R9AA 3LWCA 1CAVB 2OPKA 4WM8C 3WDYA 3FUQA 4J1WA 5E1RA 2ZAAA 3PMSA 1UPSA 4QU1A 4DQAA 4HETA 3C7EA 1UOGA 1J3RA 3AMMA 4Y1ZA 5ACA3 3DF0A 2PYTA 3ACFA 1ZRDA 1F15A 2QE3A 3DGTA 5A7OA 4ZU5A 1NKGA 4MZUA 1DYPA 3Q8FA 3KD4A 5FMOL 2XKOA 3POJA 5H9QA 1UKRA 1W6NA 3WT3A 4W6WA 4E8DA 1FATA 2V72A 1VBD2 1H1AA 2WO2A 1KGYA 1O8SA 2N7GA 4AEKA 2D3PA 1A3KA 2XBO1 4QX1A 4M4PA 5F5QA 3S6PA 1Y9GA 5A80A 2D6MA 1PM4A 2QQLA 1U0AA 1PMJX 1JOBA 1L3JA 2PHUA 4JX0A 4WVVA 1KDKA 3WP4A 1AYM2 4QPGB 5LWBA 3WEZA 2Q30A 3HVDA 1OT5A 4ISQA 3GHNA 1VAMA 1LHOA 3C3VA 3JB8A 1V0AA 4GWNA 2W08A 1W99A 2ZTNA 2QQJA 2VO5A 3NJYA 3VBOB 1AX1A 1XBFA 1Z7S1 4LTAA 2VGDA 3WQ0A 2IVIB 3I2JA 2GNBA 4KG0A 3ZFEC 4AVVA 2D3SA 3B01A 2VZPA 4ONUA 3L9JT 2ZGLA 2WN2A 1OVPA 4GMP3 4OHYA 5C6CA 3FLRA 3PUAA 3ACLA 3V64A 1C5HA 3N7JA 3ZYRA 1VBD3 2ARCA 3FHAA 3OBAA 5E8AA 1W6QA 1LODA 2VMDA 3NAPA 4KBBA 1SG3A 4MV2A 4W8JA 5FBJA 3VZJA 1H9WA 1VAKA 2WO3A 2YC4A 5L7OA 1SQ4A 2BTVC 5CB7A 2R49A 1E57A 1S0DA 4LBLA 4AGVA 5FXWA 2Q8CA 1DZQA 4Z1VA 4AEDC 4CDXA 4GZ9A 1W28A 1V6KA 2YMZA 1XE8A 2D98A 2O8OA 1AYM3 3I2OA 4XFIA 4XJZA 1FPN1 2Q1ZB 4XC9A 5HV0A 1RUD2 1ZBE1 4NPRA 1D2QA 5KWRA 3A4UA 3M70A 1YC61 4Z8BA 1SHWB 1UOBA 1W0PA 2CY6A 4LKFA 5CBLA 5FBZA 1L7QA 2QCSB 2AGSA 3MW4A 4JHTA 3RWNA 1RVF2 4LJHA 4IV1C 4I0BA 1H2KA 2YROA 5IVJA 4OULA 3JZVA 4RYDA 1X8EA 2GU9A 2ZZQA 4YW2A 4IEUA 1YQ6A 3KV5A 2VZVA 4RD7A 3ROUA 3BOPA 4P9YA 1ZBA1 4OHVA 1XQNA 1ASJ1 3WP6A 3W9AA 3ON7A 4FP2A 3UL2A 2EA7A 1OHFA 2WC2A 3C7GA 5I91A 1OA2A 3I2IA 4P9XA 5LA1A 4FOVA 1RUOA 1PGL2 1UY2A 1Q56A 4QKNA 3CL1A 4MH0E 1DQ6A 4YW5A 1QH7A 2CSGA 3RZZA 1RUJ2 1J59A 1JYCA 5GLVA 3M1HA 2A6WA 3OUJA 1YHFA 4LXLA 4V2VA 1EAH2 2JKBA 4Y24A 1RUD3 4Q0QA 5L9RA 1OLRA 1UZ0A 3V56A 2E32A 5FKBA 5FO7B 1NY71 5T55A 2WZPP 3OY8B 1CWPA 1JHJA 3SCFA 1W6MB 2K0GA 2WT2A 5JXJA 3AMPA 2R0HA 4WZFA 3GZUC 4QB2A 1ODMA 1RVF3 1YO8A 2B9UA 4LBNA 4CU6A 4QB1A 1GP5A 2X8KA 2JE8A 4RS5C 1HB1A 3PHMA 4HANA 3JB4C 4I2OA 3KV6A 1IQDC 4E2SA 5DUXA 3ABZA 4LT5A 3KQ4B 4EN9B 4QX5A 1VBC1 4N53A 3O7OA 1CAWB 4YZ1A 2DTWA 2DUPA 1QXJA 3ZFEB 3G6JB 1QXPA 4PLMA 3IN9A 3AXEA 3UESA 1PX3A 4FPFA 1J1LA 3T2OA 5ABJC 1MEC2 1B35A 1UXZA 4L0PA 5F5AA 3O1TA 2PA7A 1FMD1 3T2PA 1W6OA 2Q8DA 1RUJ3 4QKDA 2KD7A 1VIWB 4PIYA 4B4PA 1EAH3 1O3RA 2IXHA 5L9BA 2GMMA 3C7OA 1UU6A 1QIQA 1I1EA 4NUBA 1C28A 5FPBA 3TEXA 1W90A 2VUAA 3ASIA 1RUG1 5C9AA 3ZN4A 1HB4A 4XJAA 5BNNC 1OPOA 1K5MC 1UAIA 3AMHA 3MO4A 2E7QA 3WW4A 3LA7A 4QD2A 4F7ZA 4JC1A 2JECA 1WW7A 1OD3A 4RA0A 4FPCA 5BNPA 1HW5A 1KRIA 3I3QA 4IV1B 1F5JA 1LHUA 2QDNA 3LE0A 5AC92 4AHWA 3KT7A 4XW3A 4ZU4A 4NR1A 4MXWA 1MEC3 3PUSA 5FP8A 1MZ6A 1VBA2 3N7LA 4GA9A 1QNYA 3ZPOA 2P3JA 3AM2A 3DECA 1QHDA 4A6OA 2K9ZA 4BXFA 1NT0A 4OFGA 3OB8A 1PX4A 4S2GA 3WY6A 4D0QA 1QOTA 2WFPA 1WA4A 1D0HA 1UZYA 2RS31 1W0OA 2V4AA 2VZ1A 1D2SA 3TEWA 2KM2A 2HWC1 2Q8EA 4M01A 4CP9A 1ZRRA 3BI3A 3AKSA 3GHMA 1O4YA 3AKTA 3M3EA 4FPGA 5B2GB 1VR3A 4D7TA 5FZOA 1AJOA 3RZJA 1I9RA 5JR2A 5K0UC 3IMMA 2NN8A 5LEKA 3B94A 3NV2A 3BOWA 2JX9A 3HT1A 4LUMA 5FPLA 4M3CA 3TB0A 5AC93 4RGGA 4RS5B 4XURA 2BNMA 3T3YA 1KITA 5DQ0A 1PO22 4MGQA 4MOAA 1N47A 3MUY1 1VBA3 2EICA 4DO0A 2V09A 2B45X 5C5UA 4M0NA 3ZIXA 3WR0A 2JIJA 2R1DA 3UGGA 1LU1A 1W6PA 3ETPA 4QDRA 4ZZ8A 1DBNA 1AJKA 4LO4B 1W0NA 4IEWA 2VQTA 3ZFGC 1UYZA 2XJRA 5ABJB 1JZ5A 1R091 3J8F1 2ZKLA 3SMHA 1WCUA 1YQ5A 5F2SA 3WDUA 4LNVA 4PLOA 5FY7A 5C4WC 3KHBA 1JYVA 3FFZA 1OPMA 4DXRA 1C4RA 1NAEA 4GJZA 4NAOA 1QJU1 2VW2A 4Y5TA 5D2AA 5BNOC 1NCQA 4W6XA 3MF9A 2DVBA 3BIWE 4OUSA 3ITQA 1DQ5A 2W91A 5BUVA 3DL3A 4EV0A 1US2A 3HNMA 3J7MA 4GXLA 4FOQA 2B5HA 5ACA1 4IEQA 1DQ4A 2BVBA 4AI3A 1K5MB 2EIBA 1S2BA 1YJLA 1PO23 2HWE2 2ZS6B 1ZZ7A 5FZIA 5A7SA 5BYNA 3VKFC 5CIRA 4IGPA 3MIHA 2VM9A 4GQ7A 3QD6A 2CYFA 1CZSA 4FVVA 2WZEA 5A7WB 2VQUA 2VULA 1MS0A 3BVCA 3WF0A 1UX7A 2XONA 1PK6A 3FHIB 1OA3A 1WWYA 4QM8A 2ZJCA 2BU9A 1PNFA 2XL7A 4K7JA 1OURA 3I49A 4FTBA 1FOD2 1BK0A 2HWB1 4MLOA 4FOYA 3RWKX 4BCUA 3V0BB 3S57A 2YPDA 1PO12 3UK9A 2WZR1 5EQUA 1IZ3A 4DFSA 1XNAA
chains in the Genus database with same CATH topology
4I09A 5CNAA 4WM7C 3CU7A 4IESA 1PGW2 2ZOEB 3QOPA 2D6LX 4LHKA 4Q26A 4CP2A 3N7MA 5JOWA 2F6BA 1TQ5A 5IT6A 2VUJA 2YUEA 4X6QB 3O14A 4YM2A 3H3UA 2E9QA 5DXDA 1CAUA 2VG9A 2VOXA 4GMP1 3DN7A 4JAAA 4CEWA 4D7SA 3TYJA 2UYAA 1IGOA 5J98B 1VBD1 2HWE3 3K51A 1BMV1 2D3RA 1NOVA 1O5LA 3ZXLA 1AHSA 5K0UB 4HKOA 4NVPA 3LAGA 1SFYA 3E6BA 1CPNA 2ZGOA 3TWIA 4F8AA 1Q8VA 4F3JA 4XIOA 1MS3A 4DY3A 1QXRA 1ZREA 4A3XA 3ZFFA 1FOD3 4PQ9A 4XJUA 2OYZA 4E27A 4KGGA 1PO13 4UW4A 1A8MA 1MQTA 1YRZA 4M3CE 3FFQA 3ZFGB 2HEYF 2DVGA 2NYYA 3EXUA 2XLFA 5BV6A 2XJTA 1HRI2 2OUHA 4B3NA 1IS6A 2Z79A 1V00A 5FPZA 2VVDA 4L92A 5BNOB 5HBAA 1MACA 4Y1XA 1G8WA 3U11A 3FX3A 2XWJB 4DZGA 1AR62 2KXLA 3M2MA 1H30A 5L19A 4HFSA 4FPOB 2WLQA 1H4HA 2ZX0A 3ZYPA 4NN0A 4Q4X1 2GNDA 4FAGA 3U4XA 1PHMA 3TAYA 4URTA 1GZ9A 1TNFA 4R52A 1RUD1 1ALYA 1HQNA 3ZYJB 2PAKA 4A2UA 3W58A 4BPZA 4MVTA 1CJDA 4QQOA 4J6GA 4HSLA 1CJPA 5A3LA 3JBG2 1RVF1 3H1WA 2CNAA 5D8AA 1HRI3 3WX5A 4I3GA 4P5HA 5A33A 2ZX4A 2HWF2 4DNYA 2BYVE 1IPKA 1YNAA 1LEMA 1X36A 3POWA 5DDJ2 1N3OA 4SLIA 2GN3A 4WM7B 1AR63 5BXXA 3ZYIB 4HK8A 4GH4A 2QKDA 3VZMA 2PAEA 1PGL1 5L7OC 1OMIA 1U5IA 4Q8KA 3NWKA 4AVAA 4CDXC 5FOJB 2E6VA 3ENRA 3ZSMA 4AWDA 1JYIA 4H7MA 1BBT1 4YZ3A 1SBEA 2B8MA 2V5YA 2FZ2A 1LOEA 4YM3A 3JBG3 4Y1VA 4FPJA 4XYXA 4XILA 3P3PA 1XNCA 1V6MA 1XNBA 2IFRA 4I30A 2IWGB 1AF9A 4FBFA 2HWF3 4EN8B 1UN1A 2LALA 1LOBA 5DDJ3 2FBEA 3HMYA 3AP5A 2QUOA 1IS5A 2EVXA 3E6CC 1XU2A 3CLPA 4Z2WA 2EAKA 4G3YC 1C3HA 5EXOA 4UBGA 1HV1A 3SLIA 1W6NB 4M3CF 5GALA 3FLTA 3KT4A 3LSDA 5J3UA 2VPVA 4QGNA 3ZVXA 3IM0A 1QJZA 1R1ZA 2DU1A 2Y38A 2ZX1A 3WW2A 4R4ZA 2A6VA 3HN1A 3EO6A 4AE2A 3E5XA 4YFZA 1YUDA 1COV2 4H55A 3J9SA 1RGSA 4HK9A 1O91A 2XKPA 2ZGNA 3B3QE 4XFGA 2DCTA 3LB9A 4N53C 3H1YA 4U36A 4OI1A 4TWTA 1SLTA 3POYA 4L9BA 4LO7A 1NZCA 2H0VA 3O0WA 2NM1A 1RUNA 1ZYBA 2R16A 1B35C 1DQ2A 1VBA1 1MZ5A 1QQP1 2XJQA 5L73A 3INAA 2D40A 4IEPA 2WNEA 3CO2A 4OHWA 2WT1A 2A3WA 1W6QB 1S1AA 1AX0A 3NAPB 5K9YA 2ARBA 1WUVA 4UW5A 4KGQA 1QOOA 5L7OB 3W59A 2IXLA 2G4IA 2RS52 4FXGB 4EJRA 5FPXA 4ZKTB 1JOJA 1S0IA 1WLCA 1YFWA 4CDXB 5C9AC 2Y0IA 1WD3A 1COV3 2RMU1 3ATGA 4L97A 4Q4W2 3FMGA 3A0KA 3M3OA 1LHVA 3MFAA 4JTNA 4AHYA 3ECQA 1JXNA 1ND2A 1REEA 2GC3A 1X7NA 1MVEA 3Q9OA 4JGYA 2CL2A 5BNPC 4AVCA 3HD8B 1RUF2 3DKWA 4LEJA 1JUIA 3TBDA 1AXKA 1GICA 1YFYA 1AYN2 1GNHA 4PIZA 4XBNA 2JE9A 2ZAHA 1YJKA 1KJRA 4DRRA 3V65A 1J3QA 4OZXA 3RI9A 5JIUA 4RGAA 2E51A 2RS53 4LE4A 5J96B 5AFBA 4B7KA 2HWD2 1KS4A 2D7FA 3GZTB 4Q4W3 3MPPG 1VB2A 1ULDA 3EHKA 1N1TA 4WZCA 4YG6A 4GIQA 4FO9A 4DY5A 3NV4A 2HKXA 2R6QA 1QGLA 4LHLA 1MVQA 4OHXA 1G9DA 1RUF3 1BYHA 4LA2A 4CP1A 1WLTA 3AKQA 1REDA 1AYN3 3NVCA 2WLPA 3L2HA 4XJ9A 2G9FA 3KM5A 2PHDA 3IPVA 4N53B 3WCRA 4BE3A 2BQPA 4BIOA 2AENA 2E53A 4SBVA 2GC2A 4CYDA 5F9TA 2WS91 1CESA 1B35B 2X53S 2XGXA 1FOD1 1WCKA 4CEYA 3VBUA 1ENRA 2DWRA 2NMOA 1W6OB 2HWD3 2ZX2A 4PJYA 2D44A 1NCQC 1DG6A 5DUWA 1F31A 1QWRA 4RR3A 1V9U2 4HSJA 3VHOA 1JTZX 3JD72 2FHRA 3VV1A 1YI9A 2A70A 4E4DX 5KXDA 5GKAC 5C9AB 3PJQA 1IOAA 1RIRA 1LOCA 3FJSA 4K3UA 1O3QA 1R1A2 2PHWA 5J36A 4L2NA 1DF0A 2DV9A 3ZMOA 4MX3A 5AVPA 5BNPB 4GALA 4YW3A 4CRQA 4P9WA 2Z69A 3IDBB 4XFFA 5JOZA 4HBNA 3I2DA 3VUOA 1PK6C 4MXWB 4CZSA 4Y22A 3GZAA 4UW6A 2EXHA 2PLV2 4ISRA 4N43A 4E2GA 3VL9A 4Y20A 3S0MA 4LULA 2A71A 2A5ZA 4XQDA 1C8NA 3AX4A 1JH5A 1V9U3 5JSOA 1VRH2 1S0FA 3GYDA 2XLGA 4LHNA 5CA6A 1HRI1 2XHKA 4RHV2 2WNUA 4XJWA 1HQLA 2ATFA 3WDTA 2CWSA 1VALA 2YZ4A 4CEWC 4FTSA 2UU8A 1Z78A 4XQ4A 1R1A3 4RFT0 5LRSA 2A73B 2XH6A 5DUUA 2QQPA 3PLQA 2DCKA 3QBQA 2IFWA 1ZX5A 5T52A 5EZWA 3ZXJA 4M3CB 1J3PA 4BM8A 4LO5B 1BCXA 3ZFFC 2PLV3 4LLFA 1H8VA 3T1MA 1RUC1 5JVVA 4P14A 1MQTC 1W6PB 4A7KA 3VGIA 3JBG1 3HAGA 1VRH3 2QVSB 4BZ4A 4EWAA 5CADA 3QLQA 4RHV3 1VBE2 4ITCA 3WHTA 4G4FA 3BODA 2I74A 4HVOA 4BMBA 1UU5A 2HWF1 5JPMB 4IL7A 5KHGA 2UY9A 2ZACA 5DDJ1 1NCQB 4W6YA 4HPKA 4I3PA 3PTYA 1LTEA 1GZWA 3O12A 4C90A 4Q4Y2 3LOBA 2H0BA 4KWKA 4IERA 1XU1A 4KH9A 1EV12 1POV1 4AFMA 5DG1A 1WLDA 3WW1A 1UW8A 1ENSA 5KXCA 2XL9A 1PMIA 1XNDA 2O8QA 3RS6A 1IKPA 1G7YA 1U5YA 1BKZA 2A75A 4UW3A 2H6BA 2R072 1PK6B 5E89A 2RHPA 3HBZA 1VBE3 5D8AC 1ZM1A 3ELNA 2E63A 1CAXA 4N7UA 1HXS1 1SFNA 3ES4A 3MW2A 2CAUA 4A7YA 2OUJA 5GZEA 3NSTA 1XYOA 4LBQD 4DINB 2GH8A 1S55A 1VP6A 3J4UH 5JR7B 3MZHA 3BPZA 1NLRA 4QU2A 4GH4C 4JRLA 4AI8A 4Q4Y3 1CAUB 4YM1A 4CEWB 5I8TA 1ONAA 1TMF2 1BEV1 1EV13 4TYSA 2QDRA 1ZZ9A 1ZZ8A 4PCRA 3VZLA 4YZ5A 4Z07A 2P34A 3NV3A 1I5ZA 5CFCA 5T5LA 2R073 3NKTA 3LSEA 1RUI1 1COV1 3WVJA 3M4FA 1F2NA 2MPFA 3WDXA 3ZFFB 2R062 3QCWA 2W0XA 4BA6A 4CDUA 3X29B 1MQTB 4FQZA 1G9FA 4ZU7A 1N1YA 3ZO0B 2A6ZA 4R9CA 5T5JA 1MS1A 1TME2 2JENA 4R9DA 4QQ2A 3VZKA 3VBFA 2NP0A 4QPYA 5KHHA 5FMOS 3RMYA 5GM0A 4YG3A 1SEFA 4XBLA 1DIWA 1TMF3 3WDVA 4K1ZA 1RB8G 4Q4V1 2YYOA 1LENA 4QXKA 1UPIA 3ZN6A 1JW6A 4MSVA 1UMZA 5JMCA 4RQPA 5T5OA 4YVSA 1FYUA 4IV3A 3QH7A 4D94A 2I07B 2BNOA 2VNRA 4Q4W1 3ILRA 4FT8A 2ERFA 2R063 1AR72 4EN7B 3EBRA 3N36A 5F6KA 4Y5Z0 1GYKA 3WLUA 2VXRA 1TNRA 5JZGA 1TME3 1RUF1 1GV9A 2BVVA 4WBBA 5D8AB 2D43A 1AYN1 1PVC2 4LA3A 3MIDA 5A33B 1KFUL 1UZZA 4QQHA 4QQPA 3I54A 4COVA 4YYOA 2OW4A 3ZMNA 3MI8A 2ARXA 4IEVA 2ZGMA 4XFBA 2ZPXA 1RJ8A 3CNAA 1Q5OA 4GH4B 1DQ0A 1PIV1 2OA2A 3WP3A 4M00A 1XNKA 4PBOA 3VHPA 1QH6A 2NMNA 2GAUA 4O9GA 2JG9A 3R0RA 2B39A 1AR73 4DRVA 4LBOA 2FMYA 4YM0A 4JCKA 1ND2C 2GMPA 5I0UA 1AL22 1AUYA 2GSYA 2PELA 4JGYC 3T1LA 2VOWA 4EWEA 4CDWA 3MIEA 1PVC3 1DGLA 1HRV1 3SISA 5GJ6A 1Q8PA 3OYWA 3WINE 1X50A 3VBOA 1RUH2 3R4DB 1FI2A 4FPEA 2AZ5A 4H3WA 3I4IA 3BCWA 2VMHA 2P37A 1OD5A 4XFCA 4MGIE 1U12A 3WHUA 4YVWA 2R0FA 1HIXA 1FNZA 4WVWA 5C8CA 3N35A 4Q1PA 1NYWA 1WMDA 1V9U1 1WW4A 5BNQA 1DYKA 2LM3A 4KU8A 1AL23 3M8LA 2TNFA 3HQXA 4TZDA 1Q8SA 3OGGA 4YGDA 1RMU2 2DCJA 4YZ4A 2RM22 2B42B 2D6OX 2IZWA 3ZPYA 5JI7A 1ENQA 4AFDA 3VDDA 4AVTA 1R1A1 2YGMA 4Q29A 1F8VA 1ULEA 2JG8A 4P9GA 1RUH3 3BU7A 3KQRA 3OD4A 4C0HA 1RUE2 4XFAA 2DVFA 1V70A 2E7AA 3RMXA 1LEDA 5HCBA 2DFCA 4WM8A 4DPNA 3CJIA 3LOIA 4JV4A 3BTAA 2PLV1 4CEYC 3VBUC 1VBB2 5HCAA 2A3YA 3NL1A 4JQRA 3FC0A 3APBA 4X8NA 2PHLA 2A3XA 3CJXA 3D4KA 3H50A 2XVGA 5FLJA 4RR3C 2RJKA 1VRH1 2V73A 4RHV1 1D4M2 4LBQA 4X8PA 2ZGTA 3R4UA 3AYCA 4FXKB 1RMU3 1WLWA 2E7TA 2RM23 4BWOA 1AYM1 1ND2B 5H9SA 1W6MA 4INDA 5CAZA 2IXKA 2NZ9A 4JGYB 2Z2SB 5FO9B 4COUA 1AR82 1RUE3 4OVEA 5KHIA 1AXYA 4H7LA 4AQSA 5CG9A 4MYEA 2F4PA 3AP7A 1GKBA 1BVVA 1G86A 4XDQA 1VBB3 1W2UA 1G6NA 5JOXA 2CGOA 1EPZA 2ET7A 5DG2A 5EYYA 5FCCA 3RNSA 4NWVA 4NHKA 2WFF2 3KSCA 2MEV2 2NLRA 4YNIA 4Q1RA 2LTNA 3KGLA 3KS7A 5CFDA 1LHWA 3TRSB 4AFAA 4A7ZA 1VBE1 5FFOC 1D4M3 3FBMA 5GLWA 2WNUC 2DF7A 4AQTA 2EXJA 1YIPA 2WWSA 1ZVFA 3EJKA 2WNVA 5GLUA 1PM7A 1WW6A 4ASMB 5L36A 1UKGA 3SCHA 3AMNA 4XEZA 4AEDA 1GANA 1AR83 3LZZA 5K8SA 2BWAA 4HT1T 4FOWA 2BEOA 3GBFA 3N7KA 3E5UA 2EF6A 1QU0A 1Y7BA 1F5FA 3IPVB 5JDBA 4KQ7A 4Q0UA 5A3MA 1Z7S2 3NV1A 5HCFA 3QH6A 1S0CA 4OI0A 2WFF3 2MEV3 2R071 3JQXA 5H9PA 3RSJA 3WG1A 4MXVA 2VMGA 3EQEA 1A6CA 2YPJA 4CEYB 3NAPC 3VBUB 4IXLA 2GC1A 4DMIA 2RJLA 4FCAA 4AVBA 2CAVA 3VBRA 4D69A 1RUJ1 1UCXA 5T3NA 1O4ZA 3DUIA 4S2FA 1Y3TA 4RR3B 2UWBA 4IETA 1EAH1 4GKXA 2A6YA 2DU0A 5JPNB 1C1LA 4ES8A 1KXGA 2SBAA 1VAVA 1TMF1 3KCCA 4QT6A 2YC0A 1FPN2 1ZBE2 4AK3A 3MW3A 1GFF2 3E6DA 4IEYA 2WQ4A 3KCXA 2EXIA 5JLVA 4C0BA 1DZTA 1GZCA 1Z7S3 1CN1A 4HZFA 2BGCA 3FUOA 1MZFA 4AG4A 3D82A 3HIFA 4M0HA 4AYUA 3VKOA 4Y22B 2YY1A 1DHKB 2R061 3KB5A 3AZXA 1C57A 1MEC1 1CD3G 4N43B 1ENXA 5CVRA 4IQPA 2X5IA 1SLIA 4LBJA 1LRHA 4Y20B 4ATFA 3RJRA 1RINA 1TME1 2Q1MA 1V6LA 5F6LB 4YW1A 1LR5A 1CR7A 3TOJA 2WNUB 1QDOA 1R082 3AP4A 5FREA 3PMEA 5IK4A 2EXKA 2JEMA 1OOPA 3E97A 3MEPA 1FPN3 2D5FA 3UKNA 1CVNA 1ZBE3 2VNOA 3D0JA 3I8TA 1V6OA 2H6CA 2DFBA 4AEMA 1AR92 3K48A 2DURA 4S2HA 3RRDA 1O5UA 1HX6A 1OLQA 4XPVA 1UL9A 2ZGPA 5BNNA 4COYA 4B7EA 5H9RA 4HL0A 2GZWA 1IPJA 5CFCC 3ES1A 2QNKA 3WG2A 3VN4A 2CTVA 5AC91 1AXZA 4PLNA 2GALA 2VW0A 1WD4A 3D8CA 4JTOA 4XF3A 4CDUC 4AQ2A 5KHJA 3WG3A 2CGPA 1DQ1A 5E16A 1NCRA 2GN7A 4X6RB 1KDMA 3AKPA 4NWWA 1UF2C 3M3CA 1IHMA 2BUKA 4RL7A 4V1PA 2BNNA 4CTEA 3SH5A 1PVC1 2XJSA 3VBFC 1R083 3V0AA 3UKTA 3AJYA 1OFNA 3ZXFA 5CU1A 5JCTA 4PDWA 1AR93 4HPKB 1S2KA 1S0EA 1GZWB 1PGSA 1YXWA 3A0NA 1RUG2 4WVMA 1UX6A 2R1BA 5EV7A 4XBQA 2PHXA 2Y26A 4QPIA 4RQPC 1AL0G 4YVSC 1KQRA 4IV3C 2QZ3A 3WP5A 4KWLA 1POV0 2P3IA 3OPZA 3WOGA 2ZHNA 1PO21 5AVAA 4AFCA 3GBGA 3WQ1A 1HKDA 3S30A 3MFCA 2DYCA 3OBTA 2JICA 4LR4A 5JZGC 2ES3A 4AHZA 1YCIA 1NG0A 2XG3A 4XJ8A 1YFXA 4JGZA 5K7PA 5LK5A 3KZ4C 2ET1A 1CAXB 4TSVA 5HXVA 1OFSA 5J48A 3KMHA 4DS0A 3MICA 2ZGRA 4FPKA 1AZDA 1NLSA 1X82A 4E4SA 1HV0A 1UD1A 3WZ1A 2ZMKA 3N3HA 5C4WA 3T2TA 1RUG3 2DCYA 2YXSA 1PZ8A 1WCDJ 2Q4SA 2IXJA 1LOGA 1QKQA 4YLZA 3NW4A 4Y4YA 2HWE1 1NQJA 3MYXA 1N3QA 1ULFA 2DUOA 1YIFA 1KJLA 1SCSA 3OGJA 3O0VA 3TNQA 5CFCB 3VKNA 1RMU1 3USUA 4K8FA 1C8M2 4B8EA 1H1MA 5GZDA 1CIWA 3HR9A 2RS12 4K9SA 4CDWC 2XJVA 3U0ZA 1YYNA 3IKWA 1CX4A 4CDUB 4WV8A 5FTTC 1VLNA 4BIFA 2LUWA 5JSRA 1PO11 1IQAA 2ETEA 2GMEA 4OI4A 2WL1A 4C1WA 1RUE1 5DZFA 3J8F2 1HDKA 3KCYA 3H8UA 2PFWA 1PGW1 4I0WB 3U07A 3VBFB 1LOAA 2JDZA 2HJIA 4XF0A 1FV2A 1URXA 2A7AA 1QJU2 4AVSA 2WSUA 3B7MA 3MLJA 5JIAA 4YVWC 2R042 4B29A 5C8CC 2D6NA 4JDMA 2UY8A 3ZN6B 4C91A 1O7FA 2D6PA 1OQEA 2MHFA 2XLAA 1D4M1 1FV3A 2K2SA 3M3IA 4RQPB 4YVSB 3AK0A 1G9AA 4IV3B 4J1XA 1C8M3 1ND3A 1ZNPA 4YW4A 3VL8A 2RS13 3OF1A 2ZMNA 1OA4A 3VDDC 4ES9A 2X29A 3AXDA 2W39A 1GSLA 4META 2PHRA 3SHRA 2JG8C 5JZGB 1QDCA 4XXAA 1AR81 3I59A 4XHBA 5SV5A 2ZX3A 3J8F3 4QM9A 4RSUA 3ZSEA 3OTFA 1ZA4A 1VJ2A 2PQQA 4AI2A 2HWB2 2VU9A 4LUKA 3JD73 2AREA 2W68A 4E9KA 2WZR2 3CJIC 1DGRA 1QJU3 2JXAA 4Y1YA 1C1FA 1A78A 1H0BA 2RR12 3H1MA 4HN0A 4P9JA 1YI7A 2R043 1APNA 1GQHA 2Q8OA 5KBFA 1QY4A 2UYBA 4BMEA 1AR61 2WFF1 3RYRA 2MEV1 1ZRFA 5I0TA 5DZGA 1MS9A 2VOKA 5KC5A 5IUQA 1BZWA 1LGBA 3RJ2X 2TBVA 2JG9B 1BMV2 2XVKA 3AFKA 2VW1A 3S7IA 3OBRA 4GULA 1MR5A 4XE9A 1GLHA 2VVFA 2Q5TA 4AI1A 1LU2A 5EJ3A 2AUYA 1J1TA 1HQWA 2ZZJA 2HEWF 4B4RA 3ZXGA 4CDWB 1X33A 3B00A 1G9CA 2HWB3 3PVOA 2XPJA 2EAAA 2WZR3 2XB6C 3OYWB 3UKVA 2RR13 3FBYA 5KC6A 2Z5WA 4D7YA 5IK7A 2QFEA 2WSVA 1QJX2 3ALQA 4HN1A 5CFDC 4HVQA 1LULA 1H8TA 3GBWA 4O9EA 2BW8A 5LRRA 4LE3A 2JD4A 4YVWB 4I02A 3SH4A 3CF6E 5C8CB 4NHMA 2WNVC 1CQ9A 1ZZ6A 4YGBA 1WBFA 3VLBB 4ATEA 1MS8A 1IS4A 4Q4X2 5FQ0A 4XMAA 2SLIA 3WV6A 1H2MA 2G9GA 3WQ7A 3N4MA 4HKLA 4LLOA 2VNGA 3VDDB 1UU4A 3JU9A 2YHJA 2JG8B 2I2SA 3ST7A 2XJPA 3WXPA 5I93A 2ZHMA 4Z82A 4Y26A 1S0BA 1DU3D 1WGPA 1JHNA 3FWEA 3MF6A 1QJX3 4WM8B 4MGYE 3CJIB 3LGRA 1Z0HA 4CDQA 4QQLA 2TEPA 4GMP0 5FOBB 5A32A 1EYBA 1Q8OA 2HEVF 4NHLA 3VBRC 3JCIA 3ZSKA 1GNZA 3BB6A 3LA3A 1CONA 4Y1UA 3VBHA 4AXOA 4Q4X3 3AYAA 5F1RA 3R05A 3THPA 4LBQB 2I45A 4JDNA 5JSPA 1R081 2ZABA 2JE7A 3DPRA 3LA2A 3G7DA 4KU7A 3IMNA 4HKWA 1BBT2 4YSFA 1A8DA 1AR91 3B9CA 4UBHA 3RG0A 1KS5A 4WVZA 4F83A 1QJY2 1LGNA 4LBMA 4XTPA 4MGKE 4R9BA 3VBSA 4W65A 3H3ZA 2IC1A 2FMDA 1H2LA 4HVRA 1KD7A 4AFBA 2WA4A 2X5IC 1F9KA 1NA1A 1VB4A 5KHKA 4OHZA 3GALA 5T5PA 2VECA 5CFDB 4YRDA 1EPWA 2XUMA 2ZGQA 4K20A 4L8QA 1V6NA 4AGRA 2RS51 1SLBA 2DTYA 5D1IA 2ZCWA 1OOPC 1YLLA 1H9PA 2WNVB 4P9LA 1WMFA 1BBT3 1LGCA 3TN92 5I8SA 3AMQA 2OZJA 3KLSA 3VZOA 1JN2P 3AZWA 5FAXA 4AEDB 2AH2A 1QJY3 1Y9QA 3BALA 2OZ6A 5JI9A 4Z92B 1LHNA 1RJ7A 1DGRN 4YFWA 4YGEA 2GDFA 4FSJA 2WT0A 3AKRA 1CAVA 1EP0A 4GKYA 3RYPA 5AFEA 4GB32 5I0RA 3TNPB 4P9IA 1T6GC 1DLLA 1GR3A 4MUVA 3SITA 1NCRC 3QACA 1ULCA 5T50A 3B9IA 3R4SA 3WG4A 1QQP2 1SBDA 4QGLA 2BFUL 2DVDA 5KXBA 4AI0A 3RI8A 4FPLA 2HWD1 5GZGA 3VHNA 4IEOA 5SV8A 3VBRB 1BQPA 1ZZCA 3ZXDA 3SH3A 3TN93 5GZCA 4PDWC 4K1YA 3I7DA 5J7MA 5FRAA 2C9AA 3DV8A 2RMU2 1RHI2 4QPIC 4TLFA 5IK8A 4QPGA 2KA3A 2PN5A 1IKQA 3NO8A 2C1FA 1MS4A 4GB33 1NXMA 4UXAA 2P3KA 4XFHA 1Q3EA 1SMVA 4D3WA 4XIKA 1LECA 1C8M1 3ZDSA 4JGZC 3H7JA 4XXPA 2RS11 1QQP3 5FLIA 2AR6A 3IDEA 4C1XA 2X5IB 1QMJA 1OQ1A 1OSGA 4Q0SA 4Q8LA 3H7YA 3PVBB 5FDBA 3VZNA 1XYPA 3B69A 4Q0VA 4AHXA 1UIKA 3JD71 5C8WA 3WNXA 4R8HA 2VOVA 1N1VA 1OOPB 2RMU3 1B09A 1RHI3 2R041 5I8YA 5JWPA 3JUUA 1DFQA 4BLJA 3MLLA 1LOFA 4AGGA 3OD0A 2IXCA 5BNNB 1BVP1 2ZGKA 1FXZA 3PVNA 1SLCA 3MDPA 1XYNA 4KNCA 3LCPA 3R6SA 3VKLA 3M3QA 1YFUA 4PBPA 1H2NA 1M4WA 1CGPA 1TEIA 1LKNA 2CV6A 4OLLA 1SACA 1WMEA 1NCRB 2GH2A 4XF4A 2WS92 2UWAA 1CPMA 1DGWX 1H1IA 3ILFA 2GNTA 2WQZC 3UJOA 3V0AB 2ZMLA 3USSA 2O1QA 4BOWA 2RR11 3ZXKA 3MIGA 3MGUA 3ZN5A 1U5XA 4XZPA 1PVXA 1XRUA 3J26N 4PDWB 4JDOA 1XXNA 2B7YA 2Y0OA 4N7IA 4NOTA 4N9IA 1NQDA 3OY8A 1FX5A 4WVMB 4IEZA 2YDEA 4MGZE 3IBMA 4Q2FA 1LB2A 4OI2A 4QPIB 5GZFA 1ND3C 3ZYGA 4PIXA 3NJZA 4YZ2A 2YGLA 4EN0A 5E88A 1C5IA 3GNEA 4XQWA 1OKQA 4JVAA 3D6EA 3ZXEA 1Y43B 4CP0A 1CAWA 4LO6B 4N43C 3UV9A 1QOSA 3ZFEA 2WS93 2XJUA 1JUHA 2HYKA 4JGZB 5BY5A 1O3SA 3PNAA 3ETQA 2AYHA 2ZGSA 2CGNA 4ORFA 3GF6A 1EY2A 2C0ZA 3L2YA 2ZGUA 4R4XA 1O4TA 4N9HA 3IIAA 1YWKA 5C4WB 4EROA 2XBO2 1H4GA 1IS3A 2BFUS 4NO4A 1QJX1 1RL3A 1PNGA 3MLKA 2YV8A 1X8MA 4AW7A 3MIBA 1S0GA 2Q0AA 4Q4Y1 1RITA 3O0XA 4BYYA 2BPA2 2NPIA 4K6BA 1SLLA 4FP3A 4G9SB 1EV11 1HLCA 5FLHA 4YGCA 4FPYA 4IV1A 4KL1A 3USUB 3D5OA 3WUDA 1NE6A 1MZEA 3AFGA 1RUC2 2D6KA 4BQ1A 2ILMA 4E2QA 2GC0A 1ZZBA 5HI0A 1AX2A 3ZIWA