3AMPA

E134c-cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
255
structure length
255
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVCIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
total genus 56
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ampA00
1OA3A 4HK8A 3VL8A 3VL9A 3AKPA 2VULA 4H7MA 1OA4A 4HKOA 1XNBA 2JEMA 2F6BA 3VLBB 3MF9A 2BW8A 2BWAA 2JENA 1XNCA 2B42B 3AMQA 1UU4A 3VZJA 5K9YA 2DFBA 1H8VA 1HV0A 3WT3A 3AKTA 2B45X 1UKRA 1H4HA 1XNKA 3WP5A 2VGDA 3MFCA 3WY6A 1W2UA 4S2DA 3HD8B 4S2GA 1BK1A 2QZ2A 1HV1A 3VHOA 2VUJA 1H1AA 3AMPA 3WXPA 1XXNA 4XQWA 3AMMA 3VZLA 1YNAA 1OLQA 1REFA 1XYPA 1AXKA 1H0BA 1UU5A 3VZOA 2C1FA 4XPVA 2VG9A 3MFAA 2D98A 1NLRA 1C5IA 2Z79A 3RI9A 2DFCA 1KS4A 4HKWA 3VZNA 3VHNA 4S2FA 2QZ3A 3WP6A 2BWCA 1C5HA 2B46X 1PVXA 5EJ3A 1OLRA 1BCXA 3AMHA 2DCZA 1XNDA 3AKSA 3WP4A 4S2HA 1T6GC 1QH7A 3WQ7A 2D97A 2DCYA 3AMNA 1H4GA 1REDA 3WX5A 3LGRA 3B7MA 3VGIA 3B5LB 1HIXA 3O7OA 4XQ4A 2DCJA 3WQ0A 3VZKA 3MF6A 1KS5A 3WQ1A 1M4WA 3VHPA 5K7PA 1OA2A 3EXUA 2BVVA 4HKLA 4XQDA 3WR0A 1BVVA 2JICA 4HK9A 3RI8A 5HXVA 1XYOA 2DCKA 2NLRA 3VZMA 1REEA 1ENXA 2NQYA 1F5JA 4NPRA 3WP3A 1XYNA 1UU6A 3AKRA 1IGOA 3AKQA 4IXLA 3LB9A 3M4FA 1TE1B 3ZSEA 1QH6A
chains in the Genus database with same CATH superfamily
3CQOA 4LXLA 2RS31 4L11A 3CJIB 2X05A 2YGLA 2JDUA 3E1F1 4LO7A 2VULA 5FPAA 1SDDB 1LU2A 3PIJA 2NN8A 4KMQA 1GICA 2E53A 4BLIA 1OVPA 3MEPA 3MF9A 3MW2A 4IUGA 4YW3A 4GH4A 5FYHA 2BWAA 5A7OA 4KU7A 3ZFFA 4EN6B 2VQTA 3WF0A 1Z7S3 2BBAA 1XNCA 4MOAA 5FZOA 4LORA 2WQ4A 4B8EA 5FY7A 4JVAA 5C9AC 2H6BA 1QQP3 4QX0A 2VW1A 4LULA 2KR2A 2PQQA 4CUCA 2VCBA 1G8WA 2VW0A 3KWVA 3KT7A 4XFIA 3PUAA 1W2UA 4YVWC 1J84A 1OLMA 1IPKA 1UO9A 1I9RA 1CAVA 3H7JA 4LMFA 3W20A 3ZXFA 4CCKA 3ENRA 3LSEA 1BEV2 3OF1A 4AI0A 4RGGA 2JG9C 2F4PA 5FLJA 2YB7A 5LK5A 3RYRA 1LEDA 1WZXA 5A32A 2R32A 4RHV1 3AZZA 2WWUA 5CYYA 1HXS3 3WCSA 4YLZA 4D6SA 2QBXA 4G9SB 3TN91 1YNAA 4I02A 1WKYA 1HRV2 5LBEA 4UYBA 5FP8A 2MEV3 1TZOA 1TME1 3V64A 1PO21 3MICA 1ZA4A 3KD4A 3RZZA 4AVTA 2ILMA 4XPVA 3RMXA 2XQRA 4H3WA 4GMP0 2CL2A 3MFAA 1S0DA 2H0VA 1AX2A 2GNTA 1NA1B 1PGL1 2X29A 2PHXA 2WBKA 2Z79A 5HBAA 1VAMA 2KA3A 3LFMA 4MH0E 4MGQA 4LTAA 2GMPA 1Q5OA 3VZNA 3NV3A 4WM7A 3WP6A 4MGZE 5A33A 3I59B 4B1LA 2VZPA 3AL6A 4DRRA 2IWGB 3N4MA 1ODNA 1S0IA 1AX1A 3ELNA 4M4RA 4A41A 3AMHA 2RMU3 1FPN2 2XL9A 4WVVA 3HR9A 4A2UA 1IG0A 2PLV1 1N3PA 5KXCA 4JQTA 4C0HA 4WV8A 1YFWA 2R061 1FV3A 2VQAA 1L7RA 2XVKA 4ZU7A 5LATA 4BE3A 4LKDA 5B4XA 4OMDA 4MVTA 3RGBA 1BMV1 1ZBE3 5FZIA 4ASMB 1HN1A 5FMDA 1W8TA 3B5LB 1ZX5A 3JXSA 3O7OA 4W6YA 1X36A 4Q29A 5AC92 1AYN1 4RD7A 3I3QA 2HWF2 4AG4A 1W8WA 2XONA 2ETEA 3DCQA 2O8QA 1J3PA 1S0BA 1HB1A 1SLTA 3APBA 4IEWA 3WNLA 5ISLA 1OMIA 2ADEA 4QDRA 3POWA 4CCMA 3O1MA 1OLME 1UY4A 3C7HA 3PTYA 2IC1A 3BCWA 5CKQA 2JICA 3RI8A 1D4VB 2EA7A 2B39A 4LUKA 1IKQA 5FZ3A 2V73A 4XIOA 1NCQB 2WFF3 2O0OA 3NNGA 1NXD1 4BA6A 4EQVA 2HWC1 4YGBA 4N43A 2WO3A 3AKQA 1PM4A 2A5ZA 2W0XA 2WO1A 1MQTC 2YROA 3WNMA 3ME2A 1G9DA 2A3WA 1SLAA 1JYIA 3VL8A 3E97A 3T1MA 2IVIB 2Q1MA 4GIQA 4R9BA 1VBE3 4LEJA 1YFXA 3JBG2 4QQPA 4COYA 1JYWA 3WW3A 1BBT3 3VLBB 3OJBA 2WZR2 2R1DA 3OY8A 4WM8C 3VDBA 5A6QA 2D5HA 2WWSA 1GOHA 4M3CF 5ABJB 1DQ1A 4P9LA 3E6DA 1J58A 1C28A 3PVOA 5BNPB 1IPJA 1COV2 2B45X 2VVFA 3BTAA 1GWMA 4LBJA 4QKDA 5JSOA 2G9GA 4N43B 4PI0A 1LOAA 1SZBA 1UMIA 3A21A 1G9AA 5CFDB 3WHTA 4JKKA 5IT6A 4KBZA 4I0BA 3KV6A 3KMHA 4Y4YA 1J1TA 2WRAA 3A23A 3U78A 1UXXX 4RSUA 4LBMA 1CWPA 1LOGA 4QGNA 4OUMA 3AMMA 1F31A 4HPKB 5AC93 1RGSA 1O8PA 2IUWA 1NKGA 4XILA 2VY0A 3W58A 1X50A 2D44A 5A7WB 1RUC3 3ZSMA 3NVCA 5HV0A 4MXVA 5FY0A 5IVYA 4MGIE 1XYPA 3KGZA 1QOOA 2WLQA 3I2KA 1IOAA 1WMFA 3MPPG 4BM8A 2Y64A 1CAWA 5EWSA 2YG0A 5FK7A 5DUUA 4KWJA 3POSA 4EYUA 2SBAA 3T3YA 4URTA 4L92A 3L9JT 2JDAA 2Q0AA 5IJRA 3K4DA 4O9GA 1DG6A 2VH9A 1W9YA 1NZCA 3DEMA 4R9CA 2EAAA 4NPMA 1X33A 4Y1YA 5GLVA 3AKSA 4N53A 4Q1PA 3VBHB 3WP4A 3RZKA 3GZUC 2VU9A 4I0WB 5JVVA 1CGPA 1VBE2 1JYCA 3P1IA 4META 1TMF1 4GZ9A 2H6CA 5CNAA 2JIGA 1ULFA 2GC2A 4HT1T 4IE4A 4XTMA 1C57A 3HQUA 5G05L 5IYYA 2AEYA 3H1MA 1W8NA 1YQCA 1TVGA 2A6YA 2HWB1 5KHHA 3ROUA 2YYOA 3KCXA 4CCEA 4CP9B 2DCYA 4NN0A 4LOTA 5C3PA 4ZHNA 5L9BA 1YYNA 3FZ3A 4UF0B 3VGIA 3T30A 2BVBA 1IQDC 1SLCA 5JSPA 2WAOA 5CG8A 1MPXA 4KWUA 1PVC1 3J9SA 1UNBA 3VZKA 1SBDA 1KFXL 2BDRA 1A8MA 1NT0A 1CIYA 4QM9A 1M4WA 5FMOL 2ORXA 4GXLA 5T5PA 2QE3A 1PM7A 2PAMA 1S0GA 2XXZA 3B93A 4JRAA 4OYUA 1JZ3A 4Q4X3 3VBUB 3AM2A 4LKFA 5HXVA 3NQHA 3SMHA 1A8DA 4CEWA 5C70A 1H9WA 1ENSA 2I45A 1FMD3 3H42B 2AREA 3IAPA 2WC2A 2PA7A 1RHI2 4HVQA 3WV6A 3SNMA 2E6VA 3RZJA 3I3BA 3KF5A 3HIFA 4MX3A 2OIIA 4X8NA 4HVOA 1HXS1 3LB9A 4EN9B 3TN93 2PN5A 4JDNA 1QH6A 1KDMA 1N1TA 2OUHA 4PLOA 2QQOA 3ILRA 2PYTA 2VPVA 4Q27A 3VBSA 4MYEA 4GAZA 1RUJ2 3JD73 3O12A 5EFUA 1O3RA 3HT2A 4KQ7A 2ZKNA 1E5HA 2G9FA 2XLGA 3JCIA 2WL1A 2WFF1 5FQ0B 3LPFA 5E88A 1O59A 4PIZA 1CX1A 4MLOA 4ZONA 5FKCA 3Q8CA 1OOPB 3IDEA 1VBD2 1SBEA 2WZ8A 1OH3A 1UYXA 3BOPA 4FFIA 4Q4V3 1CJPA 5C4WC 5KBFA 1JHNA 1IS4A 5FZDA 5C7GA 1W6OB 5CVRA 4BWOA 2VW2A 3O0WA 1CAUB 4F7ZA 2AR6A 3B01A 1NZIA 4NRQA 1XPWA 2WFF2 1RUG3 3V0AA 4PF5A 4XUOA 3NSTA 1MEC2 2R30A 3H8UA 5DZGA 2P34A 1OH4A 4JGZB 2GC0A 3SISA 3VBFA 1RVF2 1CX4A 4OLLA 2Y26A 1ZA7A 3NNFA 4AQ2A 4AFCA 4QHBA 4BIOA 2P4EA 5EJ1B 1VBA2 2JDHA 2VAUA 5C3SA 1O3SA 3ON7A 2QQMA 3IWZA 3POGA 5FJKA 3CL1A 3VBOA 4RFRB 1WLTA 1ND2A 5CIRA 3ZFEB 4QPYA 4LIVA 4MZUA 2YY1A 2CAUA 3FHAA 1Z7S1 1PO11 4EWAA 3S0MA 4CDWC 2DBNA 1N1VA 4XAAA 1NY72 4AEJA 3TEXA 5C3OA 1HRV1 3OGGA 2E7TA 3HQRA 4GKYA 1CIWA 4J1WA 1MS9A 2CGNA 5FMOS 4YG3A 4ASKA 4LPLA 5H9SA 2JX9A 4RA0A 1X8MA 1A3KA 1UYYA 4NRPA 1NUKA 2FD8A 3V65A 2RS13 1W9SA 1VR3A 2RR11 2ATFA 2XL7A 5F3IA 5F32A 4QX5A 3POEA 1RIRA 4V2WA 5FYYA 3WP5A 1K3IA 3W9AA 2X10A 5FWEA 3VB9A 3WCRA 2A71A 3C7OA 2RM22 1ZRCA 4NIDA 4OHZA 3ZXDA 3QH6A 4AE2A 1F5FA 1KJRA 2ZGLA 3DPRA 2C24A 3BB6A 4NR1A 2R6QA 2QQUA 2XGXA 1NCQA 3M3CA 3MGUA 1MACA 2R0FA 4AHYA 1JYVA 3JZVA 4MGKE 3A0KA 2K2SA 1G9FA 1K42A 2WO7A 1K5MC 1SACA 2ZHKA 5J3UA 3CO2A 4QB2A 2FDHA 4DO0A 3NAPA 4MGTA 4D6QA 2WO2A 4BCUA 2N7GA 2VZOA 3QOPA 5G04L 3TYJA 2HWB3 3RYPA 1RXGA 1XYOA 4DXTA 1GZCA 1V9U3 3L2HA 1LULA 2YV8A 4R4ZA 4ISRA 1I3HA 3LEMA 4NPRA 3IDBB 2CWSA 4PIYA 3RYKA 3VBOC 1PO23 1BKZA 3ZXEA 5DZEA 4NE9A 4PIXA 2OQ7A 3FLRA 3HQXA 3KS7A 5T52A 4CCNA 5BNPA 1R081 1ULCA 3OY8B 2HWD3 1M06G 3UESA 1UX7A 1PHMA 3ZYJB 2Q8CA 1E5SA 2Y6HA 3MW4A 4HZFA 3KT4A 4BQ2A 4H7MA 2HWE2 5GLWA 2WKKA 3MDPA 3OOXA 2GAUA 1QOSA 3E5XA 4LHKA 4AK3A 4CU6A 4DEQA 4YG0A 2D5FA 2VQUA 4K8RB 4LHNA 1H8TC 3M1HA 3IIAA 3NNLA 3KLSA 4L2NA 1D4M1 2WNVB 3CF6E 5B2GB 1H6YA 3POBA 4RN5A 1O8SA 2KM2A 1ZZ8A 3PLQA 3ZYFA 5ACA3 4RQPC 1R1ZA 2WFPA 1EV11 1BK1A 2QZ2A 2ZMKA 3CDZB 3MIFA 3M2MA 2RG4A 3TRSB 3VBRB 3VBOB 4QX1A 3TAYA 1IPSA 5IHRA 4AEKA 4NAOA 4BPZA 3VZLA 2LTNA 4YZ4A 2Y6JA 4TWTA 4XBNA 2VCCA 1RUE1 1NCRB 2PHWA 2A6VA 1URXA 2HYKA 3JQWA 4L0PA 4J1XA 4CXYA 4WM7C 5KC5A 3O5SA 4AVCA 2WNUC 5FR3A 2VUAA 4ISQA 4QXKA 3FHIB 2SLIA 2WWJA 1OT5A 2KD7A 5CG9A 4PHZA 3D82A 1AR73 4KL1A 3N36A 1WBFA 1D0GA 4IDZA 4N9IA 3RI9A 1JZ4A 3UKTA 1XU1A 4JRLA 1OFSA 1W0PA 3I7DA 4UT5A 2OPWA 5A7PA 3KF3A 3R6SA 2P5BA 1SHWB 1S0EA 1ZBE1 2WJSA 1EAH3 3WOGA 1NAEA 2Y38A 1Q8PA 2AGSA 2CY6A 1PMHX 1IS6A 2ZEZA 1RUG2 3B3QE 4RS5B 5DUXA 4BXFA 2ZBJA 3AZWA 1QQP1 2RS53 1PIV3 1W6MA 2WQ8A 5I8TA 1RL3A 5E16A 2JD4A 3H7YA 3WQ7A 1RUNA 1RVF3 1W04A 2QJVA 4FAHA 1NLSA 5LCWL 2OQ6A 1IG3A 2VOXA 3LGRA 3N9MA 3NWKA 2ZGOA 4YM0A 1EAH1 2XVLA 2R1BA 1JOBA 4RQPA 4GALA 3WQ0A 4YW2A 2VZSA 5C9AA 3LDRA 2ORZA 2J42A 4K1YA 3WQ1A 4UXAA 3AYEA 4Q4W1 1B35C 2TBVA 1DF0A 1ENRA 1V70A 5FYZA 1RYYA 2WIIB 2JKXA 4XBLA 3HT1A 3R0RA 5E1RA 5IUQA 1JS9A 2RVAA 4B4RA 5JPMB 4I0AA 4QQLA 1OUSA 4BLJA 3TNQA 3RWNA 1V6KA 1OVSA 2BNNA 1NE4A 5CKMA 3GZTB 3ILNA 4FVVA 2VBBA 4GMP3 1GZWB 3AP9A 5LA0A 3OBZA 3MIEA 1C4RA 4YGCA 4Q4W2 5A80A 2D6NA 4UBGA 4CP9A 5HPOA 1D4M2 3D5OA 4UFJA 5JR7B 5F5AA 1OA3A 1XE8A 2GC1A 4MV2A 2GH8A 1HDKA 1SCSA 3OB8A 5T5OA 3VL9A 3WNOA 3OBTA 3QD6A 2MNGA 2UY8A 2NP0A 2YU2A 4A7ZA 4DEVA 2BW8A 4C0BA 4A44A 4Z2WA 2XB6C 2PHTA 1JZ8A 2W92A 2AACA 3TOJA 1SG3A 4R52A 1GZWA 1N1YA 1DGWX 3RMYA 4GULA 1US2A 1XNKA 2YC2A 5LA2A 2NM1A 4EZ4A 4AF9A 1EY2A 1KQRA 2HWB2 3HNBM 3IMNA 2ZGKA 4K8FA 4ITCA 4M00A 4HN0A 5LRSA 3MHZA 2VBDA 5FPXA 3A0NA 1YQ8A 4DUWA 1HN0A 3VBFB 3H0OA 3CEWA 2D7FA 2QQIA 3BOWA 3IKWA 3PJQA 3HWJA 5L73A 2G1MA 3GALA 3H50A 4CDUA 1XSQA 2UURA 4K7JA 2GN7A 4J25A 1KJLA 4I01A 2ZHLA 1YO8A 3VD7A 3NV1A 2IXHA 4BQ5A 4B29A 5I0RA 4DY3A 2ZS6B 2X53S 3I54A 1AXKA 4ZU4A 1OQDA 3PJYA 4LKSA 2P6HA 1MZEA 3UV9A 3TEWA 5FRAA 4ZY9A 5IWFA 5IFTA 4TZDA 2ZGNA 5LEKA 1LRHA 3RQ0A 1RUI2 4B3NA 5EV7A 3DN7A 4IV1C 3J8F1 4JKMA 5LY2A 4N9HA 2B8MA 3V0BA 1EV13 5JXIA 3U07A 2B46X 5DAVA 5A3PA 4YW6A 1JH5A 2D6OX 2RHPA 1JODA 3CU7A 4SBVA 4TTGA 1O7FA 3MIHA 1SMVA 2IXIA 2D6LX 2RJKA 3KHBA 1LGBA 2LW8A 5FY5A 2E7AA 1RUH3 3ABZA 4RGAA 5DAWA 3IDAA 2FDKA 2DUOA 2FDIA 3O1OA 1H8TB 1UPIA 4NUBA 5BNOB 5FZ4A 2A3XA 1DZRA 5A1FA 3M3QA 2DCJA 3D4KA 3OGRA 3LEGA 4P00B 1E57A 2Y0IA 4E2GA 5FYBA 2ARBA 2RR12 3I2FA 3WF3A 5K7PA 1J59A 4DXZA 4BQWA 1UCXA 1FOD3 2XJSA 3WLUA 2BVVA 1QJX1 1LNSA 3VBSC 3BPSA 1QXRA 4KG8A 4CCDA 4E2QA 2WNVA 1FAYA 3KHCA 2NQYA 5GZCA 1LGCA 3D8CA 1PIV2 1SCRA 5FZ9A 3ZR5A 5FZFA 5FIXA 3W59A 2V4AA 3ZR6A 1AYM2 3KVAA 4LQRA 1SFNA 3RFRA 3DYPA 4NIHA 2BV4A 2WLPA 3HN1A 1GP5A 3MYXA 2R16A 4Q26A 1LHWA 3JB8A 4PQ9A 3IT8A 1QGLA 1LOBA 2ZEYA 1UYPA 2LUWA 1JYXA 4MHUA 2JDPA 5GLTA 3CJXA 1VAKA 2R49A 2XHNA 4CCCA 4AVAA 2QFEA 1RB8G 1ZBE2 1S0JA 2GNMA 5AVPA 3VZJA 3H9AA 3RZGA 1DLLA 1RJ8A 3N35A 1RUC1 3PVEA 3LEIA 3QLQA 5FZ6A 1ZZ7A 2A3YA 1O91A 5GALA 1XNTA 5FP3A 1LR5A 2A6ZA 2VGDA 1O4TA 1LGNA 1TME3 4XFGA 4LBOA 1RUH2 4LE4A 4W65A 1OC1A 4ARXA 2ES3A 1QJY2 3S7EA 3KQ4B 2R062 2VR4A 2XJPA 5FV3A 5A7WA 1HV1A 1NY71 4DNYA 1AR93 2XUEA 5FJHA 4I09A 3UL2A 4UW6A 1S1AA 1YCIA 4CEYC 4KH9A 3AP7A 4FPFA 2GDFA 5H9PA 5BNNC 1SPPA 1F15A 1QJU2 3JBG3 4K3UA 2VNGA 4YFWA 4XJAA 4BZ4A 2GP5A 2WZR3 1Y9GA 2BOJA 4XMIA 2IXJA 2VXRA 1MS3A 3J7HA 2R073 4A6OA 5C5UA 3W5MA 1BQPA 4IEXA 3AJYA 2W1UA 5GZEA 4E2SA 1KS4A 3AVSA 1NXMA 1GQGA 4MSVA 4QU1A 3VHNA 2Q30A 1YEWA 4XJWA 4FTBA 2VNOA 2FBEA 4IERA 4OUSA 1LENA 1O4ZA 3LDKA 3TN92 1VRBA 4Y1XA 1NQJA 5J98B 5F1RA 1GP4A 1S2EA 1WW6A 1KD7A 1WCUA 2ARXA 2EAKA 5J48A 5M0TA 5JXGA 1NA1C 4EN0A 4BJ0A 1ULPA 1BEV1 3OBAA 4JHTA 3MO4A 1XSRA 3MV11 5JIUA 1AR63 4JGYB 4ZKTB 1CVNA 1U5ZA 4GB31 3ZFEA 4F3JA 3Q9OA 4YM3A 4Q4V2 4FCAA 2OKXA 4N7UA 2VOVA 3VDCA 5C5TA 1Y9MA 5FZGA 1PGSA 2V72A 3GM8A 4QXCA 4UAPA 1VBE1 4PDWB 5JOXA 3J8F3 1I6XA 5H9QA 4CDQB 3O1SA 2IXCA 1A78A 2RJLA 2XJRA 5T5LA 4O9EA 4P9XA 4GKXA 2CSGA 3AZYA 3WUCA 4BIFA 3CNAA 4FXKB 1IHMA 4CXWA 5F3EA 2ZKLA 5F2SA 5FYSA 1MZ5A 1R1A1 1D2QA 4HKLA 4PJYA 4RYDA 2PELA 5BNNA 2Q4SA 2AH2A 2ZABA 2DCKA 4WVWA 2QUOA 1VMFA 1DFQA 1K12A 2E51A 2UWBA 3WP3A 4KG0A 5C3RA 5H9RA 2RS51 3ZYGA 2BEOA 2D3RA 3T4HB 3VDAA 3J7MA 4X6QB 2UY9A 3NV2A 3ZSEA 5FQ0A 1OOPA 4HK8A 5A32B 5T50A 3UT0A 3DYMA 3PIGA 1H8TA 2IVJA 1ND2C 2NYYA 4GH4B 2XJUA 5JAXA 1VP6A 4HKOA 2JEMA 3E6CC 3OYWB 1VALA 3ASIA 1MQTA 2JG9B 2E7QA 2GC3A 4GWIA 5DZFA 4FOQA 3RWKX 3H3LA 5C8CA 1CZTA 1QJX3 2B9VA 2DFBA 2LROA 4EROA 4UW5A 1QF3A 3MPBA 2WZPP 3THCA 1VBB1 2LALA 1LJ7A 2Y34A 1LTEA 3B9IA 4Q4X2 3MIDA 5FP4A 3WY6A 4A6SA 1G9CA 4QB6A 2BP6A 1WCKA 2EVXA 4XMAA 4JAAA 1YWKA 3POFA 1N47A 2RV9A 2WAAA 3K2OA 3VHOA 4IETA 1CAWB 4CEWC 1MR5A 2D40A 4G3YC 1J3QA 4XETA 3NNMA 4XQWA 2ZAHA 2P37A 4QD2A 4XJ9A 2CHHA 2QQKA 4ZS2A 4ASLA 5T5JA 2V5YA 3UK9A 1DQ6A 1X9PA 3DPRC 3PUQA 4QQHA 4FSJA 2YPDA 4D0QA 3IPVB 3GXUA 4COWA 1VBB3 4D7YA 1FX5A 2PMWB 4DXSA 4CSWA 1HB4A 2BFUS 1GOFA 3FJSA 4R4XA 3QBQA 3WF4A 4IV3C 5J96B 3VZOA 1GKBA 4O61A 2Z42A 5LA1A 2J1SA 4JKLA 4UFIA 1O6UA 3NAPC 3P3PA 4Q0SA 1BMV2 2HBUA 4FPKA 1U5XA 2Y60A 1R093 1RUF1 5FZ0A 4YNIA 2FZ1A 1ND3A 2R041 5FPZA 1NYWA 3ZX7A 5C3QA 1AL23 4YVSB 3MUY1 2QKDA 1QJY3 2RM21 4CUGA 1ZBA3 5KHJA 5JDBA 3BALA 3ZOIA 5F5IA 2R0HA 4R8HA 3ZMNA 5IVFA 2HWF1 2C9AA 3AFGA 2O14A 3MV01 4A42A 4B4PA 4CRQA 1VPHA 1RUJ1 2BGPA 2HWE3 3ACGA 4K9SA 2IFWA 3PDQA 4FAGA 4YARA 1A34A 2X5IC 1B35A 2RS11 5F6LB 3BI3A 1UIKA 3JB4C 1NE6A 1Y3TA 2UU8A 3TNPB 4TXWA 1HB2A 2EXIA 1TQ5A 1UXZA 4Y24A 3EJKA 2DBIA 1UY2A 2DU1A 2ZZJA 3Q8EA 2BZDA 2DU0A 1LHOA 3I2IA 3WDYA 2HWC2 4ZS3A 3N7LA 1HQLA 5FZKA 5C4WB 5FY1A 2WYFA 3GBWA 1YC61 2C26A 3WF1A 1GFF2 5JZGB 3VDDB 3ZN4A 4HK9A 4QPIA 5CAZA 2BGOA 1PK6A 2RS12 4SLIA 3OBRA 5CFCB 2X5IB 2W68A 3B00A 4ZXEA 5L36A 1ENXA 3ZMOA 4A3ZA 4JGZC 4Q4V1 3AYAA 3R4SA 1QMJA 1BBT1 3GCXA 4QT6A 4PBPA 1S2BA 3WG2A 3WHUA 1OXCA 2GMEA 5DG2A 3U1XA 1UY0A 3LKJA 1RITA 5T3NA 1TMF2 3AP5A 1W6OA 1H2LA 5CBLA 2WA4A 1US3A 1JZ6A 1R092 1JZ7A 2OZJA 4LK7A 4EV0A 3S57A 2W3JA 2ET7A 4LBQB 5IVCA 1Q8OA 1YXWA 1JU3A 4AHZA 1TNRA 2J7MA 4R9DA 4LO8A 3I2DA 4CDWB 2XG3A 5CFDC 1H2MA 3SC7X 4K1ZA 1ZRRA 5FTTC 2GZWA 4LO4B 4XJUA 2X5IA 2ZXQA 2XOMA 3RZLA 3HEIA 4AQSA 2WYSA 4S2GA 4L8QA 5I0TA 1AF9A 2PHLA 5L7OB 3KGLA 4P9WA 4AI1A 2WN3A 1WW4A 2Z5WA 3GZEA 1OPMA 3H8RA 4EWEA 4AFAA 3FMGA 4N7IA 4IEZA 2BGCA 4PBOA 5F37A 1ODMA 3A22A 2VTXA 4M4PA 3AXEA 1V9U2 3ZXGA 3ZYRA 3FWEA 2J1EA 3I97A 1S0FA 2D3PA 3K3OA 2D6PA 4FOYA 4IV3B 2OVUA 2G9ZA 4LITA 4PI2A 2Y6GA 4V1PA 1W6NB 1W28A 1DIWA 1PO22 4L99A 5TSWA 4IESA 3ZSLA 4H14A 1H6XA 1K5MB 4B4QA 2QQJA 1H1IA 1ZM1A 3WG3A 2CWMA 3USSA 4FPCA 4EN7B 5GLUA 4AEDB 4AQ6A 4OZXA 1GUIA 3OD4A 3UGFA 3ZYHA 5D8AA 3GYDA 4GJZA 1QXJA 3SKVA 1GQPA 3VD5A 1KITA 4FI9A 4UI9L 5AVAA 2YU1A 3U14A 1ENQA 2C4XA 4Q4W3 2I07B 1MZFA 4XF1A 4XUTA 5FLIA 2VUDA 4ATFA 5J1XA 4E8CA 3I59A 4GH4C 3MIBA 5FYIA 4D94A 4BQ4A 1XNDA 4HMZA 3N9NA 3SCHA 1UYZA 3MW3A 2OPKA 2WR9A 1RUOA 2IXLA 2DYCA 3LA2A 1KXGA 5DPNA 2VC9A 1JTZX 4YM2A 2FQPA 1UZ0A 1W05A 2VJXA 4D7SA 1PX3A 4FFGA 4XF0A 2JJ6A 1UOJA 2HKXA 1DGLA 1U5YA 1R1A2 1PIV1 2P3KA 3FBMA 1QDOA 2YHJA 1POV1 1PMJX 4YPJA 2MPFA 4QHZA 5FP9A 2XR4A 1XU2A 3MF6A 1HRV3 3CZUA 5CA6A 3ES1A 1QDCA 3H8OA 3BGAA 3TWIA 4TN7A 1V6LA 1UF2C 3VBUA 4QX7A 2A1XA 1G86A 2QQNA 4OI2A 3SEEA 1XJAA 4JZRA 4ZU5A 5BNQA 2DCTA 2Z2SB 4XEZA 4XXAA 5A3TA 3B69A 5BV6A 1QHDA 4MXWA 4NHKA 4O65A 1W2NA 4NO4A 5LW9A 3O1RA 2BRTA 4CDUC 1IS5A 1DQ2A 1F5JA 1XYNA 2F4LA 3GF6A 3PMEA 4IXLA 1JN2P 4M01A 4CP1A 2NMOA 4HOOA 5LASA 2WSVA 3ZFFB 4AAPA 2K0GA 3FL7A 2RMU2 4IEVA 5FZOB 2QQPA 1ACCA 4FPHA 2AZ5A 4LBQD 5FMBA 1MQTB 2JG9A 3R4UA 1C1LA 1LKNA 4FPLA 3I3EA 3BTYA 1LAJA 1I1EA 2IFRA 1ZVFA 2QDNA 5L9RA 4C90A 2C9KA 1EUUA 1FPN1 1GU3A 1XNBA 1GQHA 4KBBA 4CP0A 1YQ2A 3SH5A 2DVAA 5HV4A 1QNYA 2CDOA 2DTYA 1CZVA 3GJBA 2F17A 3RJ2X 1WWYA 2XUMA 3ACIA 4GJYA 4YW5A 1NLQA 3DXUA 4PT6A 3BKZA 3SEPA 2ZZQA 4AFBA 4BXSV 3JBG1 1W8HA 5BNNB 1WUVA 3GCWA 4QX3A 3EHKA 5F6KA 4AI3A 1ZBA1 3T2TA 4GB32 2LM3A 1STMA 1QEXA 3UYJA 2XBO2 2JXAA 3ACHA 3OG2A 1CQ9A 1NX9A 1PO13 2WINB 2ZHNA 3GJAA 3NJXA 5E6HA 2ZA9A 3JUUA 1W3XA 2W47A 2BERA 1AR81 1ZRFA 4MGYE 5FZEA 3ZFFC 1Z0HA 1OQ1A 2W39A 1G9BA 3VBUC 4LJHA 4XC9A 1RUH1 4E4HA 1LU1A 1RINA 2E31A 4LHLA 5C6CA 4M3CB 2BFUL 3KT1A 4XJZA 4ET7A 2XJTA 4W6WA 3T2OA 1FOD2 1WGPA 3BPZA 1FYUA 2KXLA 4JGYA 2ZX2A 4OULA 3T2QA 5C8CB 2RR13 1HW5A 1BBT2 2DFCA 3RJRA 4OQ9A 1Q3EA 1XQNA 1WA6X 4Y1UA 4RS5A 1AYN2 2QZ3A 4S2FA 1B35B 4BDVB 1AUYA 5FAXA 1VJ2A 2XLFA 2ZTNA 2AYHA 3UJOA 1DZQA 5IVBA 3O0VA 4DFSA 1N3QA 2QVSB 3R4DB 3T4VA 1T6GC 2OZ6A 1XB9A 1UIJA 1Y43B 2PLV2 3PNAA 4GMP1 3HBZA 4C8DA 5IFPA 1SLIA 4AXOA 5FY9A 4UW3A 4CYDA 5EPAA 2XLAA 1VB4A 2CGOA 3U37A 2XPJA 1E5RA 2IZWA 5F39A 4IL7A 2XH6A 1GWLA 3ES4A 4QAWA 5FPUA 3I2JA 3O1VA 4XYXA 5FY8A 2OT7A 2XBO1 1JUIA 2ZCWA 4HLTA 4BH9A 4RS5C 1SEFA 1RUC2 4NIAA 3E6BA 4DRVA 5KHGA 4XCBA 3M3IA 1W90A 1RUI3 4QPIB 1NCRA 1W0OA 4LIUA 2XBO3 1EV12 1W0NA 3I3DA 4LA2A 2JDZA 3OUHA 1LOEA 3EXUA 4LT5A 5JMOA 3SXWA 4U2AA 5A1LA 5I91A 3ATGA 3AK0A 5FREA 4AEDC 3FLPA 1LOFC 2VUCA 3O14A 3QCWA 3VZMA 1HRI2 1UL9A 2R063 4BQYA 1YQ5A 2R042 5HCBA 1UOFA 3OUJA 3DL3A 4P14A 2DTWA 4PCRA 5D1IA 2CTVA 5J36A 1HKDA 3J26N 3M4FA 4NIGA 4NAMA 1TE1B 2W87A 5ABJA 1RC6A 5IW0A 3HN3A 4Y1VA 5EP9A 4OHXA 4AI2A 1FNZA 3J7NA 2P2KA 4WZFA 5F7UA 3IBMA 4YZ2A 3FUOA 4DMIA 3CKHA 4Y20B 1VBC1 3WW4A 3D0SA 5FYCA 1AYN3 3WNPA 2YFZA 1LOCA 1EUTA 4Y22A 2FDFA 2A75A 2HH9A 3VKNA 1F8VA 1ASJ1 3Q8FA 1E5IA 1H30A 1ZYBA 2ZX0A 4DUVA 5D8AB 1POQA 4AFDA 3MLJA 1RMU1 2P17A 4CDXB 1C8M1 5A3OA 2VO5A 2UYAA 5L19A 3E5UA 3MFCA 4XFHA 4OQ8A 5JOZA 3B9CA 1OPOA 4UBHA 1I5ZA 1SPPB 3ECQA 1CESA 3F2ZA 1BLZA 4JDOA 5IK8A 1X9TA 2A7AA 3MLLA 1BVP1 2BQPA 5L7OC 5L9VA 2Y33A 1XXNA 1DYOA 1WW5A 4QKFA 5FY4A 5FZCA 3VKMA 1OFNA 4KGQA 1FMD2 3CIHA 5JI9A 5FK8A 1A6CA 4XCAA 3WDWA 3BUCA 1ASJ2 2MHFA 2VMCA 3FBYA 1JU4A 3BODA 2XJQA 1V0AA 2VZ1A 1XE7A 3N9QA 1U12A 2Z4FA 1L7QA 2PXJA 3M7AA 1JMUB 2W46A 4HPKA 4HL0A 3C8XA 4H7LA 2D98A 1SLBA 3JD72 1NLRA 1DP0A 1GP6A 1RUD1 5D21A 2I74A 3ZPYA 1HRI3 1GANA 1DHKB 4NJ4A 4NVPA 5L7OA 2ZOEB 1GMMA 3INAA 5JSRA 4HXCA 4I30A 3RS6A 3P6BA 1KEXA 4Q8KA 1R083 4M0NA 1APNA 3T2PA 4K6BA 1JYNA 1PO12 2W1WA 4WVMB 4WM8A 4XBQA 4XF9A 5A33B 3VD9A 3VDDC 3PVNA 4KWKA 2EIGA 1X8EA 2VOWA 4FO9A 4RR3B 3T08A 2W08A 1FI2A 4IEOA 1PNFA 4JDMA 4TLFA 1GZTA 4XF4A 3DUIA 1LHUA 3WX5A 4DQAA 4C1WA 3IZOA 3FUQA 1S55A 4M3CA 3ZN6B 4AZZA 2VZRA 3K4ZA 3AP6A 4LR4A 4TLGA 3KB5A 3NAPB 3K51A 1RTVA 1S2KA 2JDNA 4QGLA 3SITA 4BQXA 3JU9A 5FZLA 3NO8A 1UZVA 4KU8A 3WDUA 3LAGA 1EYBA 3I49A 4MG2A 5LRRA 3KCCA 1UZYA 2RS33 4EZHA 3LSDA 3QACA 4FP2A 5F3GA 1WD3A 1LESA 1DYPA 1OA2A 2VNRA 2FMYA 3VBHC 1BVVA 2W91A 3VN4A 3ETQA 5EHDA 4D69A 1C1FA 2BJSA 2PHUA 4FXGB 4QPGA 4RR3C 4PLMA 4CEYB 1F35A 1ASJ3 4NIIA 2BYVE 3FLTA 3USUB 3AKRA 4GD4A 4CA9A 1ALYA 1IGOA 3HNMA 3L2YA 1RUG1 2VMHA 3LF7A 1QU0A 5LBFA 1AR62 3HAGA 1YI7A 1MS0A 4Q0QA 1X82A 4HSJA 3AB0A 3DECA 2ZGSA 2J1VA 3SH4A 1F2NA 5IK4A 4OI0A 5CB7A 5A3UA 1W6MB 5K4LA 4CUAA 4N53B 1F4HA 4FFFA 2JENA 3VBHA 3ZKYA 2VVEA 3URFA 3VBSB 5JMCA 2W5FA 1ULGA 1RHI1 3RG0A 3S5QA 1JBCA 1LECA 3AYDA 3EQEA 2O1QA 2OUJA 4NWWA 1BJQA 1CD3G 1K45A 2RDSA 3I2GA 3OEAA 5EYXA 4ZXKA 2B5HA 1QJY1 2BNMA 1W9FA 2E9QA 3OSDA 3DYOA 4ES8A 2WDBA 1TEIA 4Y5TA 5KXBA 3Q8AA 1ZBA2 2R043 2ZGTA 2VMIA 4K40A 4Q4Y2 4UOJA 3ZIXA 1V6OA 3U4XA 2A73B 2FDJA 1SQ4A 3D6EA 1ZZ6A 4Y5SA 2J1UA 3HVDA 3CHXA 1K5MA 3FE5A 2ZHMA 3KVBA 1C8M3 1PVC2 4IV1B 3EYPA 4KGGA 3O0XA 5EJZB 1QWRA 1AZDA 1UWWA 2JE8A 3OGVA 4BB3A 5KHIA 1GOGA 5JI7A 3TBDA 1PX4A 1OSGA 2OYZA 3WW2A 1DBNA 5IK7A 5DG1A 4DY5A 3LOBA 2JG8C 2VG9A 1DGRN 3NKGA 2DVBA 5A6YA 5CISA 2BU9A 2RMU1 4AOCA 3POYA 3ZKUA 4ATEA 4XACA 4CDXA 5F9TA 2E26A 1RUF2 1COV3 3PU3A 4HKWA 4EWDA 3AZVA 2DVGA 1GZ9A 1AR82 1MVQA 3LEKA 1NCQC 1WCDJ 3T1LA 1OLRA 1X7NA 1I5PA 1AXZA 2EXJA 5A7SA 1ULOA 2WS92 4Z1VA 4M0HA 1V6JA 5T54A 4YG6A 1LB2A 3ZSJA 1WD4A 1K5JA 3C7FA 4A4AA 3AL5A 2AC1A 2JG8B 2DURA 1WMXA 4E4SA 1WMEA 5BUVA 2LRPA 2VZUA 1TNFA 5LEJA 2CYFA 3IAQA 4P9YA 1MS5A 4CDXC 4XQ4A 3ZXJA 3I3MA 3N3HA 1NOVA 4A3XA 4NWVA 1VBB2 3LIGA 2K46A 3WG4A 3NW4A 3ETPA 5GZDA 4IEQA 1ULDA 3FN9A 4CEWB 2YBKA 5E8AA 4LKEA 2RDNA 3KCYA 4GWJA 3WR0A 5J09A 1AR72 3G6JB 4BK4A 5FPBA 1S4CA 3HBKA 4URAA 3VD4A 3PTRB 5FXZA 2WUHA 1IZ3A 3K46A 4L97A 1VMJA 2A6WA 4TSVA 1W6QB 4YW4A 3WDTA 4EN8B 3I2OA 2FDGA 2EXHA 3OGJA 2JG8A 4CU7A 5LBBA 5LZ6A 5EYYA 3MZHA 4GA9A 4AYUA 3W21A 4CDWA 1JZ2A 5FZMA 3ZN6A 4MHRA 1OD3A 2VZ3A 1XNAA 3A4UA 3AKPA 4XW3A 1J3RA 3WQBA 4CPBA 4V2VA 3CZJA 1UOBA 4CU8A 5ANNA 4AR2A 3KV4A 5A7QA 2G19A 2GN3A 2P3IA 1W39A 5FP7A 2VQ0A 4YYOA 3KV5A 5DAPA 3O1UA 1VE0A 5ERLA 1WLDA 4DUXA 1VRH1 1PNGA 2GH2A 1AJOA 2HWC3 3AMQA 4QDSA 4XF3A 4AHWA 3FHQA 3WT3A 1V9U1 3C3VA 3T09A 2AEZA 3AKTA 2AUYA 3K77A 4JTOA 5EXOA 1O3TA 5FMCA 3GHMA 3ZYIB 3ZVXA 3KM5A 5KXDA 3BYWA 2ZX4A 2PTMA 5CFCA 3USUA 5FXXA 1AJKA 2YZ4A 1YFUA 2Y6LA 3IB3A 2Q8EA 4Z92B 2RM23 2Q8DA 2J1AA 2FMDA 4LE3A 1SLLA 4XIKA 4NHMA 3BTXA 2HJIA 1IQAA 2P3JA 1HQNA 3ZXAC 4FTEA 3T0AA 3WD5A 1RUJ3 4B1MA 1TMF3 3SQOA 1REFA 3FC0A 5CZKA 1UY3A 2UWCA 5F5QA 4LOSA 4CCOA 3N7MA 5A3LA 4WVZA 1BZWA 1LEMA 1F4AA 5BYNA 3NRUA 1H0BA 1POV0 4LHSA 3CMGA 5FUIA 5A70A 4FOVA 4N90A 4W8JA 3K48A 3CJIC 5DDJ3 2VM9A 4B7KA 5CFCC 4RHV3 5FZBA 3ZYPA 2E33A 4JTNA 1R64A 5AFEA 5JZGC 5DAXA 5I8SA 3D3AA 4W50A 1U0AA 2AENA 2BWCA 4CXXA 4FPJA 4NHXA 2JKBA 5I0UA 2G4IA 2P1BA 3GGLA 4XFFA 3LOIA 3LPGA 1Z78A 2DVDA 2Y8KA 2GMMA 2DCZA 4Q4Y3 4YW7A 1WLCA 4S2HA 1QJU1 3AYCA 4YW1A 3PURA 1W6PB 1PGL2 2JIJA 2V09A 4WM7B 4DZGA 2J22A 5JOWA 1L7LA 1GWKA 1U5IA 2JB8A 1FXZA 2ENRA 1YI9A 3HJRA 2TUNA 1NCRC 3CJIA 4LLOA 4OHYA 3DF0A 1ZZBA 2ERFA 1Z7S2 3AMNA 3MIGA 4IW3A 1MS1A 4MO3M 3GZAA 4COZA 2VL4A 2ZGQA 4WBBA 4OZOA 2ZX3A 3U10A 4BMBA 3H3ZA 3AZXA 3P5BA 4YSFA 2C6SA 1W3VA 2VOTA 4AEDA 1LOFA 4QU2A 3PUSA 2VZTA 4JC1A 4MXWB 1VBA1 1G7YA 4COVA 2VXJA 4IE5A 1W6QA 5LWBA 1UKGA 2PHDA 2RE9A 4TYSA 4GB33 5BY5A 2XVGA 3SHRA 4OMCA 1QIQA 1QQP2 1GR3A 2W1SA 1CZSA 4HSLA 1WBLA 5ABJC 3TEYA 3QH7A 4UFKA 4XQDA 1AR61 1W99A 5GZFA 1MEC1 5JOYA 2W52A 3IMMA 3ZFGB 5FWJA 2NLRA 4F83A 1BEV3 2WNUA 5IVVA 1AVBA 3RZHA 2CDPA 4INDA 4QWNA 3R05A 1MS4A 1NG0A 1J1LA 2E63A 1AR92 1UU6A 3MBWA 4XXPA 3LDBA 3WF2A 1AL0G 1WCQA 2EICA 3THTA 1HXS2 2FCVA 2CAVA 3VD3A 3VKOA 3LD8A 1GSLA 4IE6A 1GNYA 2TNFA 1PZ9A 1PK6C 1OI6A 2MEV2 4BQ3A 3OYWA 2CNAA 2WSUA 3B94A 1HB3A 4JGYC 3UGHA 1GLHA 1WLWA 2WN2A 2B7YA 1C3HA 3PHMA 3ZIWA 3P3NA 1H2NA 3WSOA 4XVHA 1WMDA 3GBFA 4XE9A 5I0SA 1RUE2 5CU1A 4XOGA 3EBRA 4HONA 4RGKA 4XAEA 4Y4RA 5JPNB 1R1A3 2B42B 2R072 1UU4A 5I8YA 5KC6A 2V4VA 3GHNA 5K9YA 1H8VA 4XURA 4ES9A 1ZZ9A 4E4DX 1FPN3 5B4NA 4HN1A 3OEBA 1JOJA 1CN1A 1YQ6A 2VVDA 4AAXA 2HLEA 4K20A 5JUVA 3HD8B 1DDLA 1OUXA 2E32A 2PFWA 4X6RB 5HI0A 2VCMA 2WT2A 3M3OA 4IV1A 1Q8QA 2VUJA 2CV6A 2XJVA 2WT0A 1AR71 2WQZC 2YXSA 4IEYA 2W1QA 4AFMA 2B9UA 5BXXA 4BU2A 2Y6FA 3OUIA 2WA3A 4R9AA 4LBNA 4Y5Z0 5FBJA 2OW4A 4COUA 4C91A 4IGOA 5DAQA 4DOUA 4JHZA 1YFYA 3U11A 1SBFA 5HXMA 3PUIA 2YMZA 1UPSA 5FPLA 2YPJA 3VBRA 4B7EA 2XWJB 4CU9A 1OHFA 1XC6A 4UF0A 1ULEA 4QKNA 3POIA 2C1FA 4NRMA 1FATA 4AHXA 2DV9A 3BU7A 4FPEA 1CJDA 4LLFA 2ZGMA 5GJ6A 1YUDA 1XOYA 2B4KA 3OTFA 5FZ1A 2HBTA 3IM0A 4QGMA 2BPA2 4XUQA 1W9TA 2QTWB 1LHNA 3WUDA 1YLLA 4CZSA 1C5HA 4WM8B 1PZ7A 1OD5A 2Q8OA 2WT1A 1OF4A 4YGDA 1JUHA 4LBQA 2WABA 4IGPA 4N43C 1HJFA 2VMFA 1D2SA 1BCXA 1WCSA 1Q43A 4BISA 2WZEA 5D2AA 1PZ8A 5FZHA 3ST7A 4ZZ8A 5FO8B 5DMYA 1UZWA 4IE7A 4JCKA 1JI6A 1W9WA 3A7QA 2MEV1 2VD7A 1N1SA 2VMGA 4NHLA 4OHVA 4YRDA 4AQTA 4AVBA 3ACLA 4Q4X1 2OXBA 5FBZA 2K9ZA 4Q0UA 4HVRA 3OPTA 3HNYM 3LA3A 4PQQA 4D3WA 5JXJA 1H4GA 3LCPA 2ARCA 2VBPA 2XMLA 4GWNA 1YJLA 4Y33A 4XUNA 1AR91 2WNEA 3LFIA 4HETA 5AFBA 4M3CE 4BYYA 4DINB 3VV1A 5JXHA 3C7GA 4N8MA 4QPGC 1COV1 3RRDA 2GU9A 5JLVA 3F95A 4IGQA 3H3UA 2D6KA 3TB0A 2YGMA 4YZ3A 5FYTA 4CEYA 2X8KA 5FO9B 2ZEXA 1CPMA 4AEMA 3AXDA 4RQPB 2RDQA 2WZR1 2PQSA 3VHRA 4FFHA 4NOTA 4XDOA 4X8PA 2D6MA 5A3MA 4PLNA 4QMAA 4XDPA 1REEA 5FZ7A 5EIYB 3ILFA 3O1PA 1Y4WA 3V0AB 4P9IA 5LA9A 2D43A 2HYXA 2ZACA 4CP2A 2W9XA 2VCAA 5C8WA 2PLV3 5K0UC 1WW7A 2YBPA 3ZN5A 5JCTA 2GSYA 4HG6B 4L9BA 4Y22B 1EPWA 2XWBB 5GZGA 2A70A 3U75A 4XUPA 1WA4A 2EALA 5FOBB 1UD1A 1V6MA 4Z07A 1IKPA 4HANA 2VNVA 3DV8A 2EIBA 4YVSC 3ZDSA 1NQDA 4UFHA 3K3NA 1HJGA 3PVBB 1RVF1 2GNDA 5CKNA 2R071 4CCJA 3G7DA 1S0CA 2W94A 4J6GA 1DGWA 1BYHA 4AVSA 1HV0A 3WW1A 4BK5A 2VMDA 1DGRA 2DDUA 3ZFEC 2OA2A 1OBNA 5K0UA 3VBFC 1W8OA 4P5YA 5AC91 4PF1A 3CBNA 4OI1A 1JHJA 4NHYA 2P6CA 1DCSA 3B02A 2ADDA 3H8XA 5APAA 1KRIA 3ZO0B 5A3NA 3NJYA 4OHWA 3WXPA 3RDIA 1UW8A 1VBD1 2EIDA 1D4M3 2P3YA 4Y1ZA 5F5CA 3S5AA 4A7KA 4CTEA 4IEUA 3ZM8A 1ZZCA 4JX0A 4D8MA 4QQ2A 1GNHA 2VZVA 4HFSA 1UZZA 4LBKA 5CADA 1FNYA 1G6NA 1HX6A 1JXNA 1GV9A 4OUEA 5SV5A 3ZYBA 5E89A 4MGSA 3HOBA 1UY1A 3DPRB 2TEPA 1W2AX 1VAVA 2DWRA 3N9PA 4H55A 4UW4A 3ZXKA 3UNPA 1RUE3 1J83A 5IVJA 3UGGA 2L9LA 5IVEA 4DS0A 1C5IA 3T0DA 1OOPC 2RDRA 2PHFA 2JDYA 2QQWA 1AYM1 1UQXA 4YFZA 3HMYA 3NNJA 4YZ5A 3LE0A 3SH3A 4RR3A 4E27A 4FTSA 1VRH2 3SCFA 5EJ3A 1DQ5A 4KWLA 3ZXLA 1D0HA 1Y9QA 2VOKA 3TEZA 3KSCA 1POV3 1W8UA 4P9GA 4XFCA 5FKBA 1BK0A 4WZCA 4W4ZA 1YHFA 1RHI3 1VIWB 4YVSA 3RNSA 1ST8A 5C8CC 2ZGPA 1QH7A 3WG1A 5I93A 3OCPA 4KNCA 5JWPA 1KDKA 2UWAA 4P02B 5JIAA 1P8JA 4YZ1A 1CAXB 5ANQA 3OPZA 2ZAAA 1DQ0A 1RUD2 2NMNA 5DXDA 5F3CA 1ZREA 1DLCA 4CVUA 4XFAA 3ZPOA 1HIXA 5A6ZA 5I0DA 2Q1ZB 5FXWA 3EMRA 4XABA 4LO5B 5K8SA 3RVHA 4IE0A 2BUKA 3LQCA 2VZQA 4FPGA 1OKQA 1TME2 2QNKA 2W95A 3C7EA 4Q0VA 4CDUB 5DDJ1 1H2KA 3VHPA 5IAXA 1W6NA 3FFQA 3CLPA 3WNNA 1LCLA 3AJZA 3K75B 3POJA 5BNPC 1HLCA 3WDXA 1W8ZA 3OD0A 4PDWA 5GLZA 3BTZA 5FYUA 4IV3A 4E4ZA 4LUMA 3UKNA 3WEZA 3SCGA 4XFBA 1BHGA 2HEYF 2I2SA 4K21A 3AVRA 1VB2A 2HWE1 4FT8A 2VTFA 1AX0A 1QJU3 4A45A 1AL22 5J37A 2FCTA 1ND3C 1OF3A 3NL1A 1R082 2H0BA 5A3WA 1RUI1 1C8M2 1O5LA 1PVC3 1RMU2 2W2IA 3IIIA 4KI5M 1T6BX 4MADA 2PHRA 1PGW1 5FZAA 5ACA1 2BTVC 2JD9A 4U36A 2VE1A 1VBA3 2J1TA 3BN6A 2HEWF 2A6XA 4QPWA 4UFMA 4P5HA 5FYVA 2WS91 1DYKA 5F2WA 4XZPA 1QOTA 5FPVA 3SKJE 3OGSA 4FBFA 4PDWC 2XKOA 5HCHA 1MS8A 5FXVA 3PU8A 1NA1A 3SLIA 4DB5A 2ZGRA 1QY4A 1MVEA 2YUEA 2RS32 4QHOA 3H1WA 5FCCA 1XBFA 5DUVA 4XHBA 3LIHA 3DXTA 4ZPIA 5DUWA 4E9KA 1W03A 2WS93 1H4HA 2R7EB 3GNEA 2EXKA 4NPLA 1AR83 2JB4A 3M70A 3UKVA 2FZ2A 3BU0A 1DQ4A 3S30A 1EPZA 5FO7B 5A6XA 3PMSA 4QPGB 4Y26A 1EP0A 3DKQA 2YBSA 3BVCA 4IQPA 4Y3OA 1H1AA 1RUD3 5FZ8A 4AWDA 3AMPA 1CR7A 1W8FA 3JD71 1AYM3 3WINE 5FFOC 3KQRA 1HQWA 3KV9A 2ZEWA 3UETA 2ZX1A 3NJZA 4EE2A 3J8F2 1VMHA 1H1MA 3AX4A 5JZGA 1OLQA 1UX6A 1CAVB 1VLNA 3O1TA 3WNXA 1PMIA 2EIEA 1V6NA 2DUPA 2JDMA 3N7JA 3I4IA 1UU5A 4Q4Y1 1UAIA 4JGZA 4RL7A 4DXRA 2NPIA 3NMBA 3H1YA 2CGPA 5FUPA 5IAVA 3JQXA 1AXYA 1TG7A 2PAEA 1VBD3 3LZZA 4LO6B 5GM0A 4LNVA 5EQUA 1DZTA 3KZ4C 4ARYA 4BQ1A 2LS6A 5K0UB 3W5NA 5FLHA 4Z82A 4IEPA 4QQOA 1N3OA 1W6PA 2V5DA 4WVMA 1YIPA 5C33A 4AGGA 3ITQA 4F8AA 2OX0A 4AVVA 2HWD2 1YRZA 4Q8LA 3FX3A 3IDCB 2JDKA 2JE7A 1W06A 3RZMA 2VTXJ 1Q56A 3ACFA 3HPNA 4YVWB 1PGW2 1CPNA 1FV2A 2XKPA 3GBGA 3V56A 1V6IA 2FCUA 1ZNPA 3N9LA 4QPIC 3AC0A 3RSJA 5BPXA 1UMZA 3VUOA 2WNUB 1VBC2 2ET1A 2QCSB 4XDQA 5EZWA 2D97A 3K4AA 4FOWA 4ORFA 3NV4A 1MEC3 2DUQA 2VMEA 3S6PA 3THDA 3MUZ1 4N53C 5KHKA 3OPWA 3ZDVA 2BNOA 4MUVA 2YDEA 3VDDA 4FQ4A 2JE9A 2DF7A 1KS5A 3AFKA 3J7LA 4OI4A 1PK6B 1GBGA 4RFT0 2GP3A 5DQ0A 4AGRA 3J4UH 1AHSA 2JWPA 3D0JA 1R091 1RUF3 4G4FA 2ID4A 2HEVF 1XE0A 5BNOC 1VRH3 5DABA 2ZJCA 3WNKA 3IPVA 5LK7B 3DKWA 3IN9A 4LK6A 3PUHA 2YC4A 3T0BA 2C0ZA 5SV8A 4D7TA 4Q2FA 1UOGA 5CFDA 2BOIA 2JECA 3AP4A 4DPNA 3BIEA 2IXKA 2WNOA 3ZLIA 4FQZA 1FOD1 2QQLA 2YC0A 3WDVA 4YM1A 2ZMLA 5FYMA 1H9PA 2NZ9A 1JW6A 1F9KA 3LWCA 1MZ6A 4C1XA 1KFUL 4CCLA 2GALA 2C5DA 3EO6A 4QX2A 2FHRA 2X09A 4NMIA 1OURA 4ZZ5A 4LBLA 1YIFA 3DGTA 4BHPA 1OA4A 2EF6A 1Q8VA 4AI9A 2Y0OA 2F6BA 5CEHA 3E5QA 5C71A 3ORJA 2Z69A 2Y6KA 1EAH2 2ZMNA 2ARAA 1KGYA 4I3GA 3U4SA 4JQRA 5HCFA 5FUNA 4RHV2 5IK5A 5J7MA 1LODA 4W6XA 3VKLA 1UKRA 3NKTA 2QQVA 4XZUG 3N9OA 1O3QA 1DU3D 4AL9A 4S2DA 2XHKA 2RJ2A 4I2OA 1B09A 4H2AA 1LHVA 3ZFGC 2O8OA 1CONA 4XTPA 1VBC3 3MLKA 1ONAA 4OFGA 1O4YA 2XDVA 2DVFA 4P08A 5F8PA 5C4WA 3VKFC 3WVJA 3WZ1A 4EJRA 4UWDA 1QXPA 2ZPXA 1RXFA 2Q1FA 4A7YA 4DIQA 1RMU3 1FMD1 1T2XA 4CDQC 1W2OA 3C2UA 5BNOA 1SFYA 3GDBA 2UYBA 2ZGUA 3M8LA 4QDQA 1QNWA 1UN1A 1QJEA 1V00A 1ZRDA 2HWF3 3VBRC 1C8NA 4O7XA 2OS2A 4Q1RA 1CAUA 4ONUA 5LB6A 5KR7A 4FPOB 1QJX2 4XHXA 1GYKA 3U0ZA 4QB1A 3THPA 4AGVA 1D7PM 4FP3A 2GNBA 1L3JA 1BXHA 4QM8A 4Y20A 1PVXA 1W2TA 4Z2AA 4CE8A 5ACA2 1Q8SA 2VECA 2HWD1 1FT9A 4P9JA 3I2HA 4YWAA 4CPBD 3V0BB 1GNZA 1ND3B 4GWMA 4LA3A 5IATA 4AI8A 5FOJB 5KXEA 4BOWA 2D93A 3FFZA 4QKBA 4NROA 4HBNA 3N7KA 4QXHA 3BIWE 1ND2B 1ZRIA 4QX8A 4OVEA 5D8AC 3PL0A 1RJ7A 3UJQA 4JV4A 1REDA 1UMHA 2Q5TA 2BBVA 2XQXA 1OKOA 3B7MA 3LA7A 2CU5A 3ALQA 2J1RA 4GQ7A 5A7NA 4AW7A 3X29B 3ZFGA 1HRI1 3NJVA 2WNVC 4I3PA 5DDJ2 3EB7A 3M3EA 4D6RA 1XRUA 5T55A 1IS3A 4Q0PA 4Z8BA 5A1AA 1QKQA 1JOPA 4BMEA 1QJZA 1O5UA 1OQEA 4OCTA 1JYTA 1Y7BA 4CDQA 4Q5OA 5LY1A 4UFLA 1YJKA 4E8DA 5DN2A 5HCAA 4QXBA 3ZSKA 1QJFA 2QDRA 3S7IA 5C9AB 5GKAC 5FDBA 1JZ5A 2RS52 4FPYA 4XJ8A 2YFUA 3Q8BA 4CUBA 5JR2A 5KWRA 3I8TA 5LBCA 1CAXA 4YGEA 4YVWA 1AL21 1SDWA 3MI8A 3RPQA 2D3SA 1SFPA 2PAKA
chains in the Genus database with same CATH topology
2RS31 4L11A 3CJIB 2YGLA 4LO7A 2VULA 1LU2A 2NN8A 1GICA 2E53A 4BLIA 4YW3A 3MEPA 3MF9A 3MW2A 4EN6B 4GH4A 2BWAA 4KU7A 3ZFFA 1Z7S3 1XNCA 2WQ4A 4B8EA 4JVAA 5C9AC 2H6BA 1QQP3 2VW1A 4LULA 2PQQA 1G8WA 2VW0A 4XFIA 3KT7A 4YVWC 1W2UA 1IPKA 1I9RA 1CAVA 3H7JA 3ZXFA 3ENRA 3LSEA 1BEV2 3OF1A 4AI0A 4RGGA 2JG9C 2F4PA 5FLJA 5LK5A 3RYRA 1LEDA 2R32A 4RHV1 3AZZA 3WCSA 1HXS3 4YLZA 4G9SB 3TN91 1YNAA 4I02A 1HRV2 2MEV3 1TME1 3V64A 1PO21 3MICA 1ZA4A 3KD4A 3RZZA 4AVTA 2ILMA 4XPVA 3RMXA 4H3WA 4GMP0 2CL2A 3MFAA 1S0DA 2H0VA 1AX2A 2GNTA 1NA1B 1PGL1 2X29A 2PHXA 2Z79A 5HBAA 1VAMA 2KA3A 4MH0E 4LTAA 2GMPA 1Q5OA 3VZNA 3NV3A 4WM7A 3WP6A 4MGZE 5A33A 3I59B 4DRRA 2IWGB 3N4MA 1S0IA 1AX1A 3ELNA 3AMHA 2RMU3 1FPN2 2XL9A 4WVVA 3HR9A 4A2UA 2PLV1 1N3PA 5KXCA 4C0HA 4WV8A 1YFWA 2R061 1FV3A 2VQAA 2XVKA 4ZU7A 4BE3A 4MVTA 1BMV1 1ZBE3 4ASMB 3B5LB 1ZX5A 3O7OA 4W6YA 1X36A 4Q29A 5AC92 1AYN1 4RD7A 2HWF2 4AG4A 2ETEA 2O8QA 1J3PA 1S0BA 1SLTA 3APBA 4IEWA 1OMIA 3POWA 3PTYA 2IC1A 3BCWA 2JICA 3RI8A 1D4VB 2EA7A 2B39A 4LUKA 1IKQA 2V73A 4XIOA 1NCQB 2WFF3 2O0OA 1NXD1 4BA6A 2HWC1 4YGBA 4N43A 3AKQA 2A5ZA 2W0XA 2YROA 1MQTC 3ME2A 1G9DA 2A3WA 1SLAA 3VL8A 3E97A 3T1MA 2Q1MA 4GIQA 4R9BA 1VBE3 4LEJA 1YFXA 3JBG2 4QQPA 4COYA 3WW3A 1BBT3 3VLBB 3OJBA 2WZR2 2R1DA 3OY8A 4WM8C 2D5HA 2WWSA 4M3CF 5ABJB 1DQ1A 4P9LA 3E6DA 1J58A 1C28A 3PVOA 5BNPB 1IPJA 1COV2 2B45X 2VVFA 3BTAA 4LBJA 5JSOA 2G9GA 4N43B 1LOAA 1G9AA 5CFDB 3WHTA 5IT6A 4I0BA 4Y4YA 3KMHA 1J1TA 4RSUA 4LBMA 1LOGA 4QGNA 4OUMA 3AMMA 1F31A 4HPKB 5AC93 1RGSA 4XILA 2VY0A 3W58A 1X50A 2D44A 1RUC3 3ZSMA 3NVCA 4MXVA 4MGIE 1XYPA 3KGZA 1QOOA 2WLQA 4BM8A 1IOAA 1WMFA 3MPPG 1CAWA 5EWSA 5DUUA 4KWJA 3POSA 2SBAA 4URTA 4L92A 3L9JT 2Q0AA 4O9GA 1DG6A 2VH9A 1NZCA 4R9CA 2EAAA 1X33A 4Y1YA 5GLVA 3AKSA 4N53A 4Q1PA 3VBHB 3WP4A 3GZUC 2VU9A 4I0WB 5JVVA 1CGPA 1VBE2 1JYCA 4META 1TMF1 5CNAA 2H6CA 1ULFA 2GC2A 4HT1T 4XTMA 1C57A 3H1MA 3ROUA 5KHHA 2A6YA 2HWB1 5LEKA 2YYOA 3KCXA 2DCYA 4NN0A 1YYNA 3FZ3A 3VGIA 5JSPA 2BVBA 5CG8A 1SLCA 1PVC1 3J9SA 3VZKA 1SBDA 1KFXL 1A8MA 4QM9A 1M4WA 5FMOL 4GXLA 5T5PA 2QE3A 1PM7A 2PAMA 1S0GA 3B93A 4JRAA 4Q4X3 3VBUB 3AM2A 5HXVA 3SMHA 1A8DA 4CEWA 1H9WA 1ENSA 1FMD3 2I45A 2AREA 2WC2A 2PA7A 1RHI2 4HVQA 3WV6A 3SNMA 2E6VA 3HIFA 4MX3A 2OIIA 4X8NA 4HVOA 1HXS1 3LB9A 4EN9B 3TN93 2PN5A 4JDNA 1QH6A 1KDMA 1N1TA 2OUHA 4PLOA 3VBSA 3ILRA 2PYTA 2VPVA 4Q27A 1O3RA 4MYEA 1RUJ2 3JD73 3O12A 5EFUA 3HT2A 4KQ7A 2ZKNA 2G9FA 2XLGA 3JCIA 2WL1A 2WFF1 5FQ0B 5E88A 4PIZA 4MLOA 1OOPB 3IDEA 1VBD2 1SBEA 4Q4V3 5A32A 3BOPA 5C4WC 5JLVA 1CJPA 5KBFA 1JHNA 1IS4A 1W6OB 5CVRA 4BWOA 2VW2A 3O0WA 1CAUB 4F7ZA 2AR6A 3B01A 2WFF2 1RUG3 3V0AA 4PF5A 3NSTA 1MEC2 2R30A 3H8UA 5DZGA 2P34A 4JGZB 2GC0A 3SISA 3VBFA 1RVF2 1CX4A 4OLLA 2Y26A 4AQ2A 4AFCA 4QHBA 4BIOA 1VBA2 1O3SA 3IWZA 3CL1A 3VBOA 1WLTA 1ND2A 5CIRA 3ZFEB 4QPYA 4MZUA 2YY1A 2CAUA 1Z7S1 1PO11 4EWAA 3S0MA 4CDWC 1N1VA 1NY72 1HRV1 3OGGA 2E7TA 4GKYA 1CIWA 4J1WA 1MS9A 2CGNA 5FMOS 4YG3A 5H9SA 2JX9A 4RA0A 1X8MA 1A3KA 3V65A 2RS13 1VR3A 2RR11 2ATFA 2XL7A 4QX5A 1RIRA 3WP5A 3W9AA 3WCRA 1ZRCA 2A71A 2RM22 4OHZA 3ZXDA 3QH6A 4AE2A 1F5FA 1KJRA 2ZGLA 3DPRA 3BB6A 4NR1A 2R6QA 2XGXA 1NCQA 3M3CA 3MGUA 1MACA 2R0FA 4AHYA 3JZVA 4MGKE 3A0KA 2K2SA 1G9FA 1K5MC 1SACA 2ZHKA 5J3UA 3CO2A 3NAPA 4BCUA 2N7GA 3QOPA 3TYJA 2HWB3 3RYPA 1XYOA 1GZCA 1V9U3 3L2HA 1LULA 2YV8A 4R4ZA 4ISRA 1I3HA 4NPRA 3IDBB 2CWSA 4PIYA 3RYKA 3VBOC 1PO23 1BKZA 3ZXEA 5DZEA 4PIXA 3FLRA 3HQXA 3KS7A 5T52A 5BNPA 1R081 1ULCA 3OY8B 2HWD3 1M06G 1PHMA 3ZYJB 3MW4A 4HZFA 3KT4A 4H7MA 2HWE2 5GLWA 2WKKA 3MDPA 2GAUA 1QOSA 3E5XA 4LHKA 4AK3A 4YG0A 2D5FA 4LHNA 1H8TC 3M1HA 3IIAA 3KLSA 4L2NA 1D4M1 2WNVB 3CF6E 5B2GB 3PLQA 2KM2A 1ZZ8A 5ACA3 4RQPC 1R1ZA 2WFPA 1EV11 1BK1A 2QZ2A 2ZMKA 3MIFA 3M2MA 3TRSB 3VBRB 3VBOB 3TAYA 4AEKA 4BPZA 3VZLA 2LTNA 4YZ4A 4TWTA 4XBNA 1RUE1 1NCRB 2PHWA 2A6VA 1URXA 2HYKA 3JQWA 4J1XA 4WM7C 5KC5A 3O5SA 4AVCA 2WNUC 2VUAA 4ISQA 4QXKA 3FHIB 2SLIA 5CG9A 3D82A 1AR73 4KL1A 3N36A 1WBFA 1D0GA 4N9IA 3RI9A 3UKTA 1XU1A 4JRLA 1OFSA 1W0PA 3I7DA 3R6SA 1S0EA 1ZBE1 2WJSA 1EAH3 3WOGA 2Y38A 1Q8PA 2AGSA 2CY6A 1IS6A 1RUG2 3B3QE 4RS5B 5DUXA 2ZBJA 3AZWA 1QQP1 2RS53 1PIV3 1W6MA 5I8TA 1RL3A 5E16A 2JD4A 3H7YA 3WQ7A 1RUNA 1RVF3 2QJVA 4FAHA 1NLSA 2VOXA 3LGRA 3NWKA 4YM0A 2ZGOA 1EAH1 2XVLA 2R1BA 4RQPA 4GALA 3WQ0A 4YW2A 5C9AA 4K1YA 3WQ1A 4UXAA 3AYEA 4Q4W1 1B35C 2TBVA 1DF0A 1ENRA 1V70A 2WIIB 4XBLA 3HT1A 3R0RA 5E1RA 5IUQA 4B4RA 5JPMB 4I0AA 4QQLA 4BLJA 3TNQA 3RWNA 1V6KA 2BNNA 1NE4A 3GZTB 3ILNA 4FVVA 4GMP3 1GZWB 3AP9A 3MIEA 1C4RA 4YGCA 4Q4W2 2D6NA 4UBGA 1D4M2 3D5OA 5JR7B 1OA3A 1XE8A 2GC1A 4MV2A 2GH8A 1HDKA 1SCSA 5T5OA 3VL9A 3OBTA 3QD6A 2MNGA 2UY8A 2NP0A 4A7ZA 2BW8A 4C0BA 4Z2WA 2XB6C 2PHTA 3TOJA 4R52A 1GZWA 1N1YA 1DGWX 3RMYA 4GULA 1XNKA 2NM1A 4AF9A 1EY2A 1KQRA 2HWB2 3IMNA 4K8FA 2ZGKA 4ITCA 4M00A 4HN0A 5LRSA 5FPXA 3A0NA 3VBFB 3H0OA 3CEWA 2D7FA 3BOWA 3IKWA 3PJQA 3HWJA 5L73A 3GALA 3H50A 4CDUA 2UURA 4K7JA 2GN7A 1KJLA 4I01A 2ZHLA 1YO8A 3NV1A 2IXHA 4B29A 5I0RA 4DY3A 2ZS6B 2X53S 3I54A 1AXKA 4ZU4A 1OQDA 3PJYA 1MZEA 3UV9A 5FRAA 4TZDA 2ZGNA 1LRHA 3RQ0A 1RUI2 4B3NA 5EV7A 3DN7A 4IV1C 3J8F1 4N9HA 2B8MA 3V0BA 1EV13 3U07A 2B46X 1JH5A 2D6OX 2RHPA 3CU7A 4SBVA 1O7FA 3MIHA 1SMVA 2IXIA 2D6LX 2RJKA 1LGBA 2E7AA 1RUH3 4RGAA 2DUOA 1H8TB 1UPIA 5BNOB 2A3XA 1DZRA 3M3QA 2DCJA 3D4KA 1E57A 2Y0IA 4E2GA 2ARBA 2RR12 5K7PA 1J59A 4DXZA 1UCXA 1FOD3 2XJSA 3WLUA 2BVVA 1QJX1 3VBSC 4KG8A 1QXRA 4E2QA 2WNVA 1FAYA 2NQYA 5GZCA 1LGCA 3D8CA 1PIV2 1SCRA 3W59A 1AYM2 1SFNA 2WLPA 3HN1A 3MYXA 2R16A 4Q26A 1LHWA 3JB8A 4PQ9A 3IT8A 1QGLA 1LOBA 2LUWA 5GLTA 3CJXA 1VAKA 2R49A 4AVAA 2QFEA 1RB8G 1ZBE2 1S0JA 2GNMA 5AVPA 3VZJA 3H9AA 1DLLA 1RJ8A 3N35A 1RUC1 3PVEA 3QLQA 1ZZ7A 2A3YA 1O91A 5GALA 1LR5A 2A6ZA 2VGDA 1O4TA 1LGNA 1TME3 4XFGA 4LBOA 1RUH2 4LE4A 4W65A 2ES3A 1QJY2 3S7EA 2R062 2XJPA 1HV1A 1NY71 4DNYA 1AR93 4I09A 3UL2A 4UW6A 1S1AA 1YCIA 4CEYC 4KH9A 3AP7A 4FPFA 2GDFA 5H9PA 5BNNC 1QJU2 3JBG3 4K3UA 2VNGA 4YFWA 4XJAA 4BZ4A 2WZR3 4XMIA 2IXJA 2VXRA 1MS3A 2R073 1BQPA 4IEXA 3AJYA 5GZEA 4E2SA 1KS4A 1NXMA 1GQGA 4MSVA 3VHNA 2Q30A 4XJWA 4FTBA 2VNOA 2FBEA 4IERA 4OUSA 1LENA 1O4ZA 3TN92 4Y1XA 1NQJA 5J98B 5F1RA 1WW6A 1KD7A 2ARXA 2EAKA 5J48A 1NA1C 4EN0A 1BEV1 5JIUA 1AR63 4JGYB 4ZKTB 1CVNA 1U5ZA 4GB31 3ZFEA 4F3JA 3Q9OA 4YM3A 4Q4V2 4FCAA 4N7UA 2VOVA 1PGSA 1VBE1 4PDWB 5JOXA 3J8F3 1I6XA 5H9QA 4CDQB 2IXCA 1A78A 2RJLA 2XJRA 5T5LA 4O9EA 4P9XA 4GKXA 3AZYA 3WUCA 4BIFA 3CNAA 4FXKB 1IHMA 2ZKLA 1MZ5A 1R1A1 1D2QA 4HKLA 4PJYA 2PELA 5BNNA 2Q4SA 2AH2A 2ZABA 2DCKA 4WVWA 2QUOA 1DFQA 2E51A 2UWBA 3WP3A 4KG0A 5H9RA 2RS51 3ZYGA 2BEOA 2D3RA 4X6QB 3NV2A 3ZSEA 5FQ0A 1OOPA 4HK8A 5A32B 5T50A 1H8TA 1ND2C 2NYYA 4GH4B 2XJUA 5JAXA 1VP6A 4HKOA 2JEMA 3E6CC 3OYWB 1VALA 3ASIA 1MQTA 2JG9B 2E7QA 2GC3A 5DZFA 4FOQA 5C8CA 1QJX3 2DFBA 4EROA 4UW5A 1QF3A 3MPBA 2WZPP 1VBB1 2LALA 1LJ7A 4Q4X2 1LTEA 3B9IA 3MIDA 3WY6A 1G9CA 2EVXA 1WCKA 4XMAA 4JAAA 1YWKA 1N47A 3VHOA 4IETA 1CAWB 4CEWC 1MR5A 2D40A 4G3YC 1J3QA 4XETA 4XQWA 2ZAHA 2P37A 4QD2A 4XJ9A 4ASLA 5T5JA 2V5YA 3UK9A 1DQ6A 3DPRC 4QQHA 4FSJA 3IPVB 4COWA 1VBB3 4D7YA 1FX5A 2BFUS 4R4XA 3FJSA 2BBVA 3QBQA 5J96B 4IV3C 3VZOA 1GKBA 2Z42A 3NAPC 3P3PA 4Q0SA 1BMV2 4FPKA 1U5XA 1R093 1RUF1 4YNIA 2FZ1A 1ND3A 2R041 5FPZA 1NYWA 3ZX7A 1AL23 4YVSB 2QKDA 1QJY3 2RM21 1ZBA3 5KHJA 5JDBA 3BALA 2R0HA 4R8HA 3ZMNA 2HWF1 2C9AA 3AFGA 4CRQA 4B4PA 1RUJ1 2HWE3 4FAGA 4YARA 4K9SA 2IFWA 2X5IC 1B35A 2RS11 5F6LB 1UIKA 3JB4C 1NE6A 1Y3TA 2UU8A 3TNPB 2EXIA 1TQ5A 4Y24A 3EJKA 2DU1A 2ZZJA 2DU0A 1LHOA 3WDYA 2HWC2 3N7LA 1HQLA 5C4WB 3GBWA 1GFF2 5JZGB 3VDDB 3ZN4A 4HK9A 4QPIA 5CAZA 2RS12 1PK6A 4SLIA 5CFCB 3OBRA 5L36A 2X5IB 2W68A 3B00A 1ENXA 3ZMOA 4JGZC 4Q4V1 3AYAA 3R4SA 1QMJA 1BBT1 4QT6A 4PBPA 1S2BA 3WG2A 3WHUA 2GMEA 5DG2A 3LKJA 1RITA 5T3NA 1TMF2 3AP5A 1W6OA 1H2LA 5CBLA 2WA4A 1R092 2OZJA 4EV0A 4LBQB 2ET7A 1Q8OA 1YXWA 4AHZA 1TNRA 4R9DA 4LO8A 3I2DA 4CDWB 2XG3A 5CFDC 1H2MA 4K1ZA 1ZRRA 5FTTC 2GZWA 4LO4B 4XJUA 2X5IA 4AQSA 4S2GA 4L8QA 5I0TA 1AF9A 2PHLA 5L7OB 3KGLA 4P9WA 4AI1A 1WW4A 2Z5WA 1OPMA 4EWEA 4AFAA 3FMGA 4N7IA 4IEZA 2BGCA 4PBOA 3AXEA 1V9U2 3ZXGA 3ZYRA 3FWEA 1S0FA 2D3PA 4FOYA 2D6PA 4V1PA 4IV3B 2OVUA 1W6NB 1DIWA 1PO22 4L99A 5TSWA 4IESA 3ZSLA 4H14A 1K5MB 4B4QA 1H1IA 1ZM1A 3WG3A 2CWMA 3USSA 4FPCA 4EN7B 5GLUA 4AEDB 4AQ6A 4OZXA 3OD4A 5D8AA 3GYDA 1QXJA 1KITA 5AVAA 1ENQA 4Q4W3 2I07B 1MZFA 4XF1A 5FLIA 4ATFA 3I59A 4GH4C 3MIBA 4D94A 1XNDA 4HMZA 3SCHA 3MW3A 2OPKA 1RUOA 2IXLA 2DYCA 3LA2A 1KXGA 1JTZX 4YM2A 2FQPA 4D7SA 4XF0A 2JJ6A 2HKXA 1DGLA 1U5YA 1R1A2 1PIV1 2P3KA 3FBMA 1QDOA 2YHJA 1POV1 2MPFA 1XU2A 3MF6A 1HRV3 5CA6A 3ES1A 1QDCA 1V6LA 1UF2C 3VBUA 1G86A 4OI2A 4ZU5A 5BNQA 2DCTA 2Z2SB 4XEZA 4XXAA 3B69A 1QHDA 4MXWA 4NHKA 4NO4A 4CDUC 1IS5A 1DQ2A 1F5JA 1XYNA 3GF6A 3PMEA 4IXLA 1JN2P 4M01A 4CP1A 2NMOA 3ZFFB 2WSVA 2K0GA 2RMU2 4IEVA 2QQPA 4FPHA 2AZ5A 4LBQD 1MQTB 2JG9A 3R4UA 1C1LA 1LKNA 4FPLA 2IFRA 1ZVFA 2QDNA 4C90A 1FPN1 1XNBA 1GQHA 4KBBA 4CP0A 3SH5A 2DVAA 1QNYA 2DTYA 3RJ2X 2XUMA 4YW5A 2ZZQA 4AFBA 3JBG1 5BNNB 1WUVA 3EHKA 5F6KA 4AI3A 1ZBA1 3T2TA 4GB32 2LM3A 2XBO2 2JXAA 1CQ9A 2WINB 1PO13 2ZHNA 2ZA9A 3JUUA 1AR81 1ZRFA 4MGYE 3ZFFC 1Z0HA 1OQ1A 2W39A 1G9BA 3VBUC 1RUH1 1LU1A 1RINA 5C6CA 4LHLA 4M3CB 2BFUL 3KT1A 4XJZA 2XJTA 4W6WA 1FOD2 1WGPA 3BPZA 1FYUA 2KXLA 4JGYA 2ZX2A 4OULA 5C8CB 2RR13 1HW5A 1BBT2 2DFCA 3RJRA 1Q3EA 1XQNA 4Y1UA 4RS5A 1AYN2 2QZ3A 4S2FA 1B35B 1AUYA 5FAXA 1VJ2A 2XLFA 2ZTNA 2AYHA 3UJOA 1DZQA 3O0VA 4DFSA 1N3QA 2QVSB 3R4DB 1T6GC 2OZ6A 1UIJA 1Y43B 2PLV2 3PNAA 4GMP1 3HBZA 1SLIA 4AXOA 4UW3A 4CYDA 2XLAA 1VB4A 2CGOA 2XPJA 2IZWA 4IL7A 2XH6A 3ES4A 4XYXA 2XBO1 2ZCWA 1JUIA 4HLTA 4BH9A 4RS5C 1SEFA 1RUC2 4DRVA 3E6BA 5KHGA 3M3IA 1RUI3 4QPIB 1NCRA 1W0OA 2XBO3 1EV12 4LA2A 2JDZA 1LOEA 3EXUA 4LT5A 3SXWA 4U2AA 5I91A 3ATGA 3AK0A 5FREA 4AEDC 3FLPA 1LOFC 3O14A 3VZMA 3QCWA 1HRI2 1UL9A 2R063 2R042 5HCBA 3DL3A 4P14A 2DTWA 4PCRA 5D1IA 2CTVA 5J36A 1HKDA 3J26N 3M4FA 1TE1B 5ABJA 1RC6A 4Y1VA 4AI2A 4OHXA 1FNZA 2P2KA 4WZFA 3IBMA 4YZ2A 3FUOA 4DMIA 4Y20B 1VBC1 3WW4A 3D0SA 1AYN3 4Y22A 1LOCA 2A75A 3VKNA 1F8VA 1ASJ1 1H30A 1ZYBA 2ZX0A 1JYIA 5D8AB 4AFDA 4CDXB 3MLJA 1RMU1 2P17A 1C8M1 2UYAA 5L19A 3E5UA 3MFCA 4XFHA 5JOZA 3B9CA 1OPOA 4UBHA 1I5ZA 3ECQA 1CESA 4JDOA 2A7AA 3MLLA 1BVP1 2BQPA 5L7OC 1XXNA 1WW5A 3VKMA 1OFNA 4KGQA 1FMD2 5JI9A 1A6CA 3WDWA 1ASJ2 2MHFA 3FBYA 3BODA 2XJQA 1XE7A 1U12A 3M7AA 4HPKA 4HL0A 4H7LA 2D98A 1SLBA 3JD72 1NLRA 1RUD1 2I74A 3ZPYA 1HRI3 1GANA 1DHKB 5L7OA 4NVPA 2ZOEB 3INAA 5JSRA 4I30A 3RS6A 4Q8KA 1R083 4M0NA 1APNA 4K6BA 1PO12 4WVMB 4WM8A 4XBQA 4XF9A 5A33B 3VDDC 3PVNA 4KWKA 2EIGA 1X8EA 2VOWA 4FO9A 4RR3B 2W08A 1FI2A 4IEOA 1PNFA 4JDMA 4TLFA 4XF4A 3WX5A 3DUIA 1LHUA 4DQAA 4C1WA 4M3CA 3FUQA 1S55A 3ZN6B 3AP6A 4LR4A 3KB5A 3NAPB 3K51A 1RTVA 1S2KA 4QGLA 3SITA 1I1EA 3JU9A 3NO8A 4KU8A 3WDUA 3LAGA 1EYBA 5LRRA 3KCCA 1UZYA 2RS33 3LSDA 3QACA 4FP2A 1WD3A 1LESA 1DYPA 1OA2A 2VNRA 2FMYA 3VBHC 1BVVA 3VN4A 3ETQA 4D69A 1C1FA 2PHUA 4FXGB 4QPGA 4RR3C 4PLMA 4CEYB 1ASJ3 2BYVE 3FLTA 3USUB 3AKRA 1ALYA 1IGOA 3L2YA 1RUG1 2VMHA 1QU0A 1AR62 3HAGA 1YI7A 1MS0A 4Q0QA 1X82A 4HSJA 3AB0A 2ZGSA 3SH4A 1F2NA 5IK4A 4OI0A 5CB7A 1W6MB 4N53B 3VBHA 2JENA 2VVEA 3URFA 3VBSB 5JMCA 1ULGA 1RHI1 3RG0A 1JBCA 3AYDA 1LECA 3EQEA 2O1QA 2OUJA 4NWWA 1BJQA 1CD3G 5EYXA 4ZXKA 2B5HA 1QJY1 2BNMA 2E9QA 4ES8A 1TEIA 5KXBA 1ZBA2 2R043 2ZGTA 2VMIA 4K40A 4Q4Y2 3ZIXA 3U4XA 1V6OA 2A73B 1SQ4A 3D6EA 1ZZ6A 1K5MA 3FE5A 2ZHMA 1C8M3 1PVC2 4IV1B 4KGGA 3O0XA 1QWRA 1AZDA 5KHIA 5JI7A 3TBDA 2OYZA 1OSGA 5IK7A 3WW2A 1DBNA 5DG1A 4DY5A 3LOBA 2JG8C 2VG9A 1DGRN 3NKGA 2DVBA 2RMU1 3POYA 4ATEA 4CDXA 5F9TA 4EWDA 1RUF2 1COV3 4HKWA 3AZVA 2DVGA 1GZ9A 1AR82 1MVQA 1NCQC 1WCDJ 3T1LA 1OLRA 1X7NA 1AXZA 2EXJA 2WS92 4Z1VA 4M0HA 1V6JA 5T54A 4YG6A 1LB2A 3ZSJA 1WD4A 2JG8B 2DURA 4E4SA 1WMEA 5BUVA 5LEJA 1TNFA 2CYFA 4CDXC 4P9YA 1MS5A 4XQ4A 3ZXJA 3N3HA 1NOVA 4A3XA 4NWVA 1VBB2 3WG4A 3NW4A 5GZDA 4IEQA 1ULDA 4CEWB 5E8AA 3KCYA 3WR0A 5J09A 1AR72 3G6JB 1IZ3A 4L97A 2A6WA 4YW4A 4TSVA 1W6QB 3WDTA 4EN8B 2EXHA 3OGJA 2JG8A 5EYYA 3MZHA 4GA9A 4AYUA 4CDWA 3ZN6A 3A4UA 3AKPA 4XW3A 1J3RA 2GN3A 2P3IA 1W39A 2VQ0A 4YYOA 1WLDA 1VRH1 1PNGA 2GH2A 1AJOA 2HWC3 3AMQA 4AHWA 4XF3A 3WT3A 1V9U1 3C3VA 1O3TA 3AKTA 5EXOA 2AUYA 4JTOA 3GHMA 3ZYIB 3ZVXA 3KM5A 5KXDA 2ZX4A 2PTMA 5CFCA 3USUA 1AJKA 2YZ4A 1YFUA 4Z92B 2RM23 2FMDA 4LE3A 1SLLA 4XIKA 4NHMA 2HJIA 1IQAA 2P3JA 1HQNA 3ZXAC 4FTEA 3WD5A 1RUJ3 1TMF3 1REFA 3FC0A 2UWCA 5A3LA 5F5QA 3N7MA 4WVZA 1BZWA 1LEMA 5BYNA 1H0BA 1POV0 4FOVA 4N90A 3K48A 3CJIC 5DDJ3 4B7KA 5CFCC 4RHV3 3ZYPA 5JZGC 4JTNA 5AFEA 5I8SA 1U0AA 2AENA 2BWCA 4FPJA 2JKBA 5I0UA 2G4IA 4XFFA 3LOIA 1Z78A 2DVDA 2GMMA 2DCZA 4Q4Y3 1WLCA 4S2HA 1QJU1 3AYCA 4YW1A 1W6PB 1PGL2 2V09A 4WM7B 4DZGA 5JOWA 1U5IA 1FXZA 2ENRA 1YI9A 2TUNA 1NCRC 3CJIA 4LLOA 4OHYA 3DF0A 3AMNA 1ZZBA 1Z7S2 2ERFA 3MIGA 4COZA 1MS1A 5BV6A 3GZAA 2ZGQA 4WBBA 2ZX3A 3U10A 4BMBA 3H3ZA 3AZXA 4YSFA 4AEDA 1LOFA 4QU2A 4JC1A 4MXWB 1VBA1 1G7YA 4COVA 1W6QA 1UKGA 2PHDA 2RE9A 4TYSA 4GB33 5BY5A