3AMPA

E134c-cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
255
structure length
255
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVCIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
total genus 56
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ampA00
1XYNA 1M4WA 3VHPA 4XPVA 1HV0A 3WR0A 1IGOA 1PVXA 1F5JA 1XNKA 3VLBB 1UU4A 1OA3A 3WQ1A 4S2FA 1BK1A 2JENA 2NQYA 3WP4A 3AKQA 1OA4A 2BVVA 2NLRA 4IXLA 2B42B 3WP6A 3VZKA 1C5HA 1HV1A 3M4FA 1T6GC 3AKTA 2QZ3A 3WQ7A 3WQ0A 1UU6A 3VZJA 3WXPA 3MF9A 3RI9A 3LB9A 1XXNA 1UKRA 2D98A 3VHOA 3VL8A 3WP5A 2QZ2A 1H0BA 1H4GA 1OLQA 2VGDA 3AKSA 3AKRA 4H7MA 3RI8A 3VZOA 3WT3A 1YNAA 5HXVA 1C5IA 1REEA 3MFAA 4XQDA 1OLRA 1ENXA 2VULA 3B7MA 3VHNA 3VL9A 2DCZA 4HKWA 1H8VA 1TE1B 1HIXA 5K9YA 3HD8B 4HK9A 3MF6A 3MFCA 3AMPA 1KS4A 3AMNA 3WY6A 2BW8A 2Z79A 3AMMA 3ZSEA 1H4HA 4XQ4A 1XYOA 4XQWA 2VUJA 2B45X 1H1AA 1UU5A 3VZMA 1AXKA 1NLRA 4S2DA 3EXUA 2BWAA 4HKOA 4S2HA 2DFCA 2C1FA 3VZNA 2VG9A 1QH6A 2F6BA 1BCXA 2JEMA 3WX5A 1QH7A 1REDA 1XNBA 2JICA 3AKPA 3VZLA 5EJ3A 1OA2A 1XNDA 3WP3A 5K7PA 4S2GA 4HK8A 1XYPA 4NPRA 4HKLA 1W2UA 3AMHA 1REFA 2D97A 3AMQA 1KS5A 3VGIA 2DCYA 2DCKA 3B5LB 3O7OA 2B46X 2DFBA 1BVVA 3LGRA 2BWCA 2DCJA 1XNCA
chains in the Genus database with same CATH superfamily
1CZVA 2RR12 5T52A 3SISA 3AJYA 4NR1A 3E6CC 3UGFA 3GCXA 4P9XA 1HX6A 1SBEA 3L2HA 1UXZA 3ZPOA 2HWF1 2WYFA 4LOTA 2VY0A 5J48A 2OIIA 1K5MB 2O8QA 1C4RA 1S0CA 1FNYA 4LK6A 2VMIA 2G19A 2YFUA 2WWJA 5FYYA 1H8TB 4Y1UA 2G4IA 5D21A 4QB1A 3WP4A 2PHLA 2P4EA 5CYYA 5FYUA 1WBLA 3DKWA 4HETA 3M3OA 1AUYA 2ZHKA 3WP6A 1C1FA 1LU2A 1RUG3 5IUQA 4ATFA 4UT5A 4C0HA 4W6YA 4B7EA 2SBAA 4LHSA 4N53C 1BMV1 1DBNA 4N8MA 4FOYA 1VRBA 1OHFA 5F6LB 3WW1A 1W0OA 2Q8DA 2CY6A 2H0VA 1WLCA 1LJ7A 1C1LA 3ZR6A 4ZY9A 2D93A 3D82A 3S7IA 4Z92B 2LROA 2JDKA 3N9OA 3IPVB 1SFNA 3UYJA 3VDCA 2QQPA 2YG0A 1XSRA 3OSDA 1UPIA 2ZX2A 1YNAA 1JUHA 4OLLA 2AEZA 4QQLA 3KMHA 4OHXA 1W6OA 4GH4C 4GMP3 1ZZBA 3DYOA 2GNBA 3BB6A 4XHBA 4FAGA 4WVWA 5E89A 3FLRA 1W6MA 2LUWA 2Y0IA 3FBMA 4LBOA 5EWSA 3S57A 5FZ0A 4K6BA 3HQXA 2DU0A 1AYN1 2JD4A 4IDZA 5CNAA 4BQXA 2RS52 4ES9A 2BQPA 2W9XA 4CXXA 4XW3A 3WY6A 2BW8A 3KV4A 2DBNA 2I45A 1WLDA 2F4PA 3VBOC 3ZFEB 5JOZA 1VAKA 4OQ8A 3AXDA 4TXWA 3THCA 2PYTA 3OGSA 4E2GA 1AX0A 1HJGA 1LEMA 3J9SA 5JLVA 3SCHA 3JBG2 1PHMA 4X6RB 1UY0A 3VN4A 1Y4WA 4BMEA 4FPOB 1VMFA 5FWJA 2P34A 4CTEA 1D0GA 2WYSA 1DLLA 1QXPA 2CHHA 4UW6A 2RMU2 1A34A 3ETPA 5KR7A 1QH7A 4CEYB 5IWFA 2ZX0A 3FN9A 4LA2A 3WCSA 1E57A 2ET1A 4YM1A 4LEJA 3U10A 1OOPA 3V64A 3I3MA 4HT1T 3ZMOA 4DZGA 2VZOA 3AYAA 2B4KA 3AP7A 4LUKA 3OB8A 4QMAA 3R05A 1XYPA 2DVFA 3B69A 4BDVB 3ZSJA 2WN2A 5J09A 1OH3A 3GBGA 1DQ2A 4BISA 2RS53 4HOOA 4Q4X2 4E27A 3BGAA 3K2OA 2P6HA 4QM9A 1WCQA 1IOAA 4J6GA 5FP4A 1UMZA 5FP8A 4JQTA 3B00A 5FZ7A 3I2GA 2WFF1 3O7OA 4LK7A 3ALQA 4HSJA 4IV3C 3VHRA 5FPUA 1SDDB 1MEC2 3DXTA 4YZ4A 2GALA 1HV0A 4QKDA 1DZRA 1NE4A 2ARBA 3KV5A 4P9LA 3PTRB 1MQTA 1CAXB 3GF6A 1IPSA 1WW5A 1WGPA 3HQRA 5F3CA 2RR11 3C7GA 4KG0A 2ZX1A 3ME2A 3GHNA 3DPRC 2W94A 3M3IA 1QJEA 1ZNPA 3BU0A 2RMU3 4A7YA 1ZRFA 3AP6A 1W06A 4KNCA 1X82A 3KF3A 1JZ4A 2D6NA 1ZVFA 4Y26A 4YM0A 3R6SA 3NMBA 2JDZA 3S0MA 4K1YA 4CU8A 1T2XA 1BVP1 1WW4A 3QLQA 4LO7A 2J1RA 3M4FA 1RXGA 3AKTA 5T5LA 3AVRA 1N3OA 5K0UB 1VIWB 4ASMB 3SHRA 1CX1A 3RI9A 1RC6A 2IVJA 1MACA 3A7QA 4IE6A 1XXNA 2YYOA 4NROA 4PHZA 2I07B 2HBTA 2CL2A 5JWPA 2JKBA 4QX5A 4TWTA 4UFJA 3WG1A 4DXRA 2VOXA 3KVAA 3OUJA 3D5OA 4NE9A 5LATA 1F8VA 1OC1A 5B2GB 1DGWX 3ZYJB 3IIIA 5A80A 3UNPA 1OQDA 4A44A 1UX6A 4YSFA 4PIZA 1MEC3 1OKQA 2BZDA 2EA7A 2UY9A 3LDKA 3MFAA 2BOIA 3T2TA 4Y1XA 1C57A 3WQBA 1W05A 1A6CA 3TAYA 4WBBA 4N43A 4YW3A 1WMXA 2DCZA 5J1XA 4X6QB 2YU1A 4MHRA 1YQ2A 2O14A 3U11A 1PGW2 1OH4A 4ZU4A 4D7YA 3UKNA 2KXLA 3WNOA 4LHLA 4BM8A 4IUGA 2N7GA 1B35A 3GM8A 1HB3A 3RDIA 3OEBA 5FY5A 1YJKA 3MHZA 3THDA 5BYNA 4YNIA 2BDRA 3VBRA 3NJYA 4D69A 1W90A 2O8OA 3OBRA 4JGZC 5BNPC 3GJBA 2VUJA 4JGYA 4N90A 4QKBA 3BOWA 5JSPA 2VZ1A 3FJSA 3ZR5A 4IEZA 4QXHA 5T55A 3WF3A 4COZA 2DUQA 3WNKA 4DXZA 3LA7A 1GQPA 1UN1A 1GOGA 1LHUA 2CDPA 2CV6A 2Y6FA 1F15A 3JBG1 3OYWB 2QQLA 2ADDA 4KMQA 2A6YA 3LEKA 4INDA 1J1LA 5HCFA 4O65A 2W46A 4AEDB 2BRTA 2VG9A 2JDMA 2SLIA 3LPGA 1DGRA 5F32A 4C90A 1W9SA 2VTXJ 4AXOA 4X8PA 3DYMA 2RHPA 4HMZA 2FBEA 2RMU1 4QHBA 1ULCA 1VB2A 4Q0VA 3V56A 1UIKA 2PAMA 2WFPA 4UW4A 3VD7A 3CHXA 4CDUC 4L9BA 1IQAA 4EN8B 2GMEA 4XXPA 5FZCA 1MR5A 4GH4B 2D6KA 4AVBA 1TNFA 1ZZCA 4IEPA 4M3CE 4AQSA 4H14A 4H3WA 2JDYA 2W92A 4JAAA 5DZEA 3ZIXA 4BU2A 4OI1A 3W5NA 1I5PA 1KS5A 5KXEA 4LBMA 2Y34A 3GDBA 2ZGQA 1QNYA 3D3AA 1IKPA 2R062 5LY1A 4Q4X1 4CYDA 1VMJA 2JG9A 3ZN6B 2WJSA 5L9BA 3OBAA 1CIYA 1UZYA 3VBOB 1QKQA 1XJAA 2YUEA 1KQRA 1KDKA 1ZYBA 2EXJA 1W99A 1YI7A 4DINB 2WO7A 1YYNA 1MEC1 5D8AA 3FHAA 1UOBA 2BGOA 3RZLA 3GALA 2GAUA 5DAXA 5FR3A 5C33A 5ERLA 1YI9A 2GC3A 3D4KA 2Y6JA 5FZOB 3KS7A 3WSOA 1UYPA 2YDEA 2ZEXA 4M3CA 3PJQA 1S0DA 4Y33A 2XL9A 1MS5A 5DQ0A 2KR2A 1YUDA 2J42A 2HWD2 2LM3A 3MO4A 1WMEA 1ASJ2 1OT5A 5BV6A 4YVWA 3PDQA 1D4M2 1UY3A 4FP2A 4ONUA 5J3UA 3MIEA 1MZ5A 1LOEA 4BK5A 4E4SA 1RUI2 1X9TA 3RRDA 4BH9A 1Q3EA 2WQ4A 1CD3G 2W0XA 5EP9A 3DKQA 3QACA 1OSGA 1GZWB 1OLQA 2R063 1FOD3 1WMDA 2R32A 3VZOA 3ZXJA 2VVEA 4BIOA 1DU3D 1PK6C 1UOJA 1OQEA 2FMYA 2WWSA 2XONA 1WWYA 3EO6A 4UW3A 4Y20B 3MPBA 3ST7A 4GJYA 4J1WA 2WA4A 4C0BA 1CQ9A 4EN9B 1ZA4A 2ZGOA 3AZWA 4AVTA 5CAZA 1RUC2 3B7MA 1V6LA 4IV3B 2MEV3 3HN1A 4W4ZA 4NJ4A 3N36A 5FZHA 2OVUA 4QPYA 1DDLA 2ZGLA 2ZCWA 1JYCA 2ZBJA 3UJQA 5FP9A 2QE3A 1DGRN 2P3JA 2RDSA 3KV6A 1D7PM 4I02A 1MZFA 1MS9A 1X9PA 1PGW1 3DPRB 1A8MA 1WCKA 4RGAA 4URAA 4DOUA 2XUMA 4Q1RA 5DUWA 3AP5A 4QQ2A 3ZLIA 1WZXA 4C8DA 2HEYF 1W8UA 3S6PA 2B9UA 1ASJ3 3HR9A 3QH6A 3ZN5A 1J3QA 1D4M3 1QF3A 1RIRA 1QOSA 1RGSA 1RL3A 4MGYE 5G04L 3WV6A 3H8RA 1LOAA 1F4AA 4IEUA 2DFCA 4HXCA 1RUI3 4RL7A 1SBDA 3VBHA 3DXUA 4LULA 5FLJA 3SKJE 2GC1A 2E32A 2QCSB 4UWDA 3AZYA 3I2HA 2R0HA 4CP1A 4XETA 1SG3A 4CCNA 2BNMA 2UWBA 1ND3C 2BEOA 3GBFA 3KHBA 1QDCA 3U0ZA 2WZEA 4IEVA 1XOYA 5CBLA 2FCUA 2WO3A 2XBO3 3KZ4C 4Y4YA 2OX0A 1CJPA 4B4RA 2G9GA 2ZTNA 4MGSA 2CWMA 4AQTA 1FYUA 4OULA 4MOAA 2GH8A 3DECA 4R9AA 1GNHA 4K7JA 3MLKA 5LBCA 5C8CA 5HCAA 3VD5A 5JAXA 3H3LA 3KCYA 4CCJA 5I0DA 3CF6E 1C8M2 3ZSKA 2PA7A 2DWRA 3BCWA 4PLOA 3LGRA 1KGYA 2XQRA 5IVVA 1OBNA 2WWUA 3POWA 2VU9A 2VZVA 2WNUC 2R061 4R9CA 4XFBA 4D8MA 4OI4A 3T0BA 4JGZB 1GWMA 2W95A 3ILRA 2ZHNA 4LKDA 3ZYHA 1DYKA 1RUH2 5BNQA 1QJY2 1XNKA 1F9KA 3FUQA 3BTAA 4NWWA 3BYWA 4AAXA 3CU7A 3KM5A 4AVCA 4N43C 5IVEA 4XJUA 1PNFA 2VUCA 4WVMA 1SZBA 3H3UA 2C9KA 5LEKA 3R4UA 3ZYIB 1I9RA 5CKNA 5IATA 1NQDA 2NLRA 4IXLA 3S30A 1QMJA 3KLSA 4LO5B 3ZXGA 1VPHA 4E4DX 1V6OA 1W8OA 1ENQA 1WW6A 3H0OA 3IN9A 1V6NA 4LQRA 5BXXA 3KGZA 3JQWA 4FPLA 5LRRA 5J96B 2QVSB 2YZ4A 3CZUA 4RA0A 2OYZA 5GM0A 3LWCA 5T5OA 2Q8EA 2ZJCA 2HWD1 1UZZA 3MPPG 5FXVA 3AJZA 2VVDA 1TEIA 1ASJ1 4PIXA 4CDUB 1RMU2 1VE0A 1YO8A 2ZKNA 4FVVA 2FDIA 3HT2A 2XPJA 3ZPYA 2DURA 1C8M3 1RUI1 4Y22B 3ZSLA 4BLIA 4NN0A 3X29B 1O3SA 2D6MA 3NNLA 4ZU7A 1UXXX 4XABA 1BQPA 4L2NA 1NCQA 2C26A 3MEPA 3RVHA 4YVSA 1VBC2 4FPJA 3PHMA 4QHOA 1Z78A 5A32B 4ATEA 1H2MA 5FO8B 1JYVA 1CVNA 3O12A 5FPAA 1JOPA 1RUH3 1HIXA 5I8TA 3DUIA 4QPIC 1OPMA 4JQRA 3H1WA 3WF0A 1RUC1 5A1LA 3LQCA 4CVUA 5KC5A 2Z79A 5KHJA 1FAYA 1SLBA 3LDBA 2VQUA 3PURA 3IB3A 3VD4A 1G8WA 4KG8A 1N3QA 4UFKA 5CKQA 5E1RA 4B29A 2VCCA 5CIRA 5IK8A 1ZA7A 1DGWA 5FZLA 2ETEA 2A3XA 3K75B 1JZ8A 1O4TA 2B5HA 3EMRA 4CCEA 5I0TA 2VCAA 3N9PA 5GZEA 1JZ2A 1S0EA 3PTYA 1YQCA 1WMFA 5APAA 4QX3A 5FP7A 3CJIA 4CDXB 4ISQA 4NIIA 3FWEA 1XRUA 4QQPA 1LAJA 1QJU1 4XJ9A 1LB2A 1H2KA 4SBVA 2C5DA 2OT7A 2VOWA 5F5AA 5F9TA 5J36A 3WF1A 1BXHA 3MIFA 1ZRRA 4TYSA 3WF2A 1YHFA 3SCFA 5ABJC 5CG9A 2HYXA 4DO0A 4PDWA 5GZDA 4QU2A 2HWC2 1VBC3 3VZLA 1S4CA 3CBNA 4BQYA 3WLUA 4BWOA 1SACA 1SPPB 1OA2A 5C9AB 2WZ8A 2WNVC 4MGKE 5JI7A 4AFBA 2PHFA 4FO9A 5FZEA 2VBBA 2EICA 4FPYA 4TN7A 3O0XA 5CADA 3ES4A 3LE0A 3PU3A 1H1MA 5FP3A 1POV0 3TOJA 3VGIA 1O59A 3CMGA 2NMOA 1RYYA 2IUWA 3I4IA 1Y43B 2D5HA 5HI0A 5JZGC 1LEDA 1UYYA 2B46X 1JU3A 2DBIA 2OPKA 2ORXA 2RS32 5F3EA 2XVLA 1WCUA 3OYWA 5FPBA 1I5ZA 2QQVA 5ACA1 3Q8BA 1CAWB 3OUHA 1C8M1 3U78A 3VDBA 1CN1A 3I3DA 3AXEA 4NIAA 5A6YA 3RZGA 3CIHA 2CTVA 4FPCA 3IMNA 1YFWA 5DG2A 1S55A 3POBA 3R4DB 4QB2A 3WUDA 2PHUA 3K4AA 1GANA 3I2KA 3MV01 3OGRA 4JVAA 5CA6A 1RUH1 5GZFA 1MS0A 1WUVA 3ZN4A 1QJY1 1BK1A 2PFWA 1OURA 1MZ6A 2ZAHA 4P9IA 1Y9QA 4YZ5A 4XUNA 2VXRA 2WO2A 4OFGA 2HWC3 5FMCA 5D2AA 3VBFC 2LW8A 4NUBA 4Z2WA 5FY1A 5K8SA 2AGSA 2AREA 2DVDA 1UKGA 3FE5A 4RFRB 3ACGA 4YZ1A 3MF9A 3K3OA 1VJ2A 4GZ9A 5DDJ2 2UYAA 3N4MA 3J7MA 5IK5A 3DGTA 4B4PA 2DF7A 4HLTA 2DV9A 2YFZA 4XDPA 1TZOA 1YIFA 4M3CF 3FZ3A 4CP9B 2ZACA 3RZMA 1G7YA 1F2NA 1RMU1 4FP3A 1MS4A 1NQJA 4EWEA 3CJXA 2RS33 5AC91 4IEWA 2FDFA 3NVCA 5C3OA 3WNMA 4XQDA 1JZ3A 2DDUA 2Z42A 2GNMA 2YB7A 1RUJ1 1DLCA 3Q8AA 2VMDA 2ZX3A 1LU1A 3ENRA 2YV8A 2GMMA 4HK9A 1NZCA 4Y5SA 3MF6A 3ZDSA 4ARYA 1EV12 5FMDA 3RZZA 4CDWC 5FBJA 5I0SA 1SEFA 2ERFA 5H9SA 3KCCA 4JHZA 2RE9A 2X10A 3NV3A 4B1MA 4YARA 4FSJA 4MX3A 1W9TA 4I3GA 5FLHA 5FZIA 3UETA 4Y3OA 2VR4A 1H1AA 4CU7A 3POEA 5C8CC 4PQ9A 3WG3A 2ZGKA 3ZMNA 3E97A 4JTNA 1NAEA 3GHMA 4Q1PA 2G9FA 5FKCA 2QQUA 4WM7C 3RWKX 4EROA 5AVAA 2PHDA 5FZ3A 1U5IA 1QJFA 2XXZA 1BEV2 1H30A 1QIQA 2F6BA 2XG3A 5L19A 1OPOA 4NIHA 1GLHA 1NYWA 2EAKA 1JHNA 3OY8A 1QU0A 3ZXAC 3V65A 4J25A 2DVGA 4CCLA 4YGCA 4ES8A 5A1FA 5JXGA 4Y24A 5GLVA 3O1SA 4DY3A 2BYVE 4QXBA 2YROA 5JXHA 4AOCA 2HWC1 3K4ZA 5A7NA 2MPFA 3LOBA 3I59A 3SEPA 1HB2A 3KF5A 5FZ1A 1W2UA 3AC0A 3ZXLA 4Z1VA 1XU2A 1NCRC 4QPIB 2YBSA 3FMGA 2W1UA 2FQPA 4OCTA 3B02A 3J4UH 2Q1FA 4E2SA 2OS2A 1AR62 4MVTA 1DZQA 1OVPA 4M0NA 3RFRA 1C3HA 4ZZ8A 5BNNC 1R64A 3K3NA 4FPKA 3MI8A 3N9LA 1CAVA 3WZ1A 3UL2A 3T09A 3KT1A 2WBKA 4AI1A 2QNKA 1IQDC 5IVBA 1YQ8A 1U0AA 5A70A 1KFXL 3CQOA 1OA3A 3T3YA 5L7OA 2VW2A 3OD4A 3IIAA 1WA4A 2A75A 2VNVA 4P9WA 2KA3A 1BHGA 2JWPA 2C6SA 4AHYA 4DEQA 4AWDA 3M8LA 2ZHLA 2OQ7A 4RQPC 3JUUA 4LKSA 5DN2A 3BPZA 4CDQA 5JSRA 4F83A 4OHWA 1ND2A 4LXLA 4XBLA 1IG3A 1JMUB 1KDMA 1V6JA 2D40A 2D3PA 4OMDA 3BN6A 2A3YA 4RR3C 3T0DA 5FYMA 3HIFA 1GZCA 1Q8VA 3LEMA 2WNVB 4WM8B 4AQ6A 5CFCB 1S0BA 1NA1A 4UOJA 5DDJ1 4Q0SA 4A6SA 2CWSA 4K40A 2J1VA 3OPWA 3VBSB 2EIEA 3BTYA 4O9EA 4R9BA 2FHRA 1AR63 3RS6A 4LBKA 3N9QA 5KXBA 2WQZC 5JCTA 4CPBA 1AL21 4LKEA 4QGMA 1OLRA 1O4ZA 5DUXA 4I0AA 5A7SA 4C91A 5C3SA 3AP4A 1L7RA 3LSEA 4L11A 5JZGB 1O3QA 3NAPC 1XBFA 3POYA 2G9ZA 4RS5A 1QNWA 3ZIWA 3N35A 4UF0B 1UMIA 2W1QA 1ULFA 2TBVA 2EALA 2W3JA 4NHKA 3UK9A 4ARXA 2UY8A 1CIWA 2WSVA 2YMZA 3ZSEA 5FOJB 2WFF3 1EV11 5FXXA 3J7HA 1LHVA 3OGGA 3J8F1 5IVYA 5C3RA 4OUSA 5KC6A 1FT9A 3ZXKA 2VMFA 2B8MA 3TB0A 4K9SA 4G3YC 1EUUA 3SQOA 4A4AA 3VBFB 2RR13 5CVRA 1SFYA 1W2NA 4COWA 5A7PA 5HBAA 4E2QA 4V1PA 5A33A 5I8YA 2FCVA 2VPVA 3IDEA 3NSTA 4Z82A 2WO1A 3UT0A 4ITCA 2XHNA 3M7AA 3ROUA 1BEV1 5CFDC 1NX9A 4GWJA 1RUOA 2Y6LA 4B8EA 5BNOC 4Q8LA 1W2AX 3N7JA 4N9HA 4M00A 4TLGA 4XF3A 3I97A 3OTFA 1AR82 5K7PA 1HJFA 4GXLA 4H55A 3U4SA 2ORZA 1JW6A 2H0BA 2WNOA 3RZHA 2D7FA 2KD7A 3HNMA 4R9DA 2VAUA 4O61A 4QDQA 2JKXA 4LIVA 1NY71 1O6UA 4CXYA 4AGGA 2B39A 2QDNA 2VMHA 4MG2A 2VZRA 2C0ZA 4LBQB 4CDWB 4DY5A 1XC6A 4GB31 3VDDA 3VD9A 1JHJA 4YZ3A 1PO12 4CDXA 3NJVA 3LCPA 4QXCA 4WVZA 1AR61 1SLLA 5ISLA 2EXHA 4IGPA 1DYOA 1GU3A 1IZ3A 4KWLA 1RUF2 3M3QA 3ZYBA 1LENA 3I3BA 4FPEA 1W2TA 2WS92 4QD2A 5T5PA 4Z8BA 2VW0A 4CCOA 5JOXA 2D3SA 2LTNA 4WM7B 1HRV2 1O5LA 3HPNA 2VO5A 2VC9A 2ARCA 3B94A 3ZFFC 3MIBA 2Q8OA 1FXZA 4KH9A 4QPGB 4XXAA 1TVGA 5FXZA 3WEZA 3AYEA 2ZHMA 3I3EA 4MADA 4Q4W2 3TN92 3PIGA 5IHRA 3EYPA 4DUVA 3CLPA 2V4AA 1UU6A 2AUYA 3WXPA 3ZFGA 1AR83 1GYKA 3JBG3 4XFAA 2OW4A 1H2NA 1LKNA 2UWAA 3VL8A 4ZHNA 4LT5A 4FTSA 2OZ6A 4LHKA 1GFF2 2HJIA 3LKJA 1F4HA 2A5ZA 2XLAA 4P9GA 1LCLA 3ZYFA 1Q8OA 4LNVA 4RYDA 2MNGA 2GP3A 2PQQA 5H9QA 4AHZA 3HMYA 1REEA 4JTOA 1SLCA 1NCRB 2VNGA 3KQRA 4GWIA 2JXAA 3AZVA 2OUHA 3NNMA 1HRI2 1PO13 2BGPA 4P08A 4XCBA 4Z07A 3ZYRA 1H2LA 3HEIA 3VBUC 2XUEA 5DZFA 4CEWA 2CSGA 4GMP0 1DG6A 5BNNB 3HD8B 1RUF3 3O0WA 2P6CA 2LS6A 3AX4A 3USUA 2WS93 4XUQA 2GDFA 2IC1A 4IV1C 2Z2SB 4BB3A 2VOVA 3MIDA 3H42B 2JX9A 1CONA 3U4XA 1HRV3 5CG8A 5EJZB 3F95A 2XGXA 4Q29A 5A3TA 3HWJA 3IT8A 3B93A 4GJZA 4Q4X3 5FZ8A 4CE8A 1ALYA 1GKBA 3ZXEA 3M2MA 3W21A 1R092 4LITA 4FQZA 1E5IA 4IESA 2WAAA 1D2SA 1UU5A 3PUAA 4RQPB 1AXKA 1NLRA 4CUAA 3IWZA 1LGNA 1GQHA 2XJTA 3EXUA 4AAPA 1W28A 1V70A 2EAAA 3VB9A 2ZEYA 5JMOA 4YGEA 2VZUA 4CP9A 1G86A 1WW7A 1YC61 2C1FA 2W52A 5DAVA 1HN1A 2VQ0A 5B4NA 4RR3B 4CCCA 3SC7X 3ZM8A 1TQ5A 2VW1A 1ZZ7A 1PO21 4HG6B 3POFA 4IW3A 2X09A 3IMMA 4JC1A 4QKNA 4H7LA 2HWE2 1JTZX 4XOGA 5IVFA 1W6QA 5C4WC 1CPMA 2GSYA 5GZGA 2V5YA 5LA1A 1CAUA 1JZ6A 4FFGA 1W6PB 2RJ2A 4UYBA 4XJWA 2IWGB 1CPNA 2ZABA 5JIUA 2IZWA 2WT1A 1YWKA 3UGHA 2PLV1 2B7YA 1O3RA 3ZDVA 1O8PA 3O1UA 1AR81 4XVHA 1LOFA 4YM3A 4KU7A 4N53B 4YFWA 1FV3A 2X5IA 1GMMA 3B5LB 1YQ6A 3V0AA 1UX7A 2BWCA 1KFUL 2DCJA 3KWVA 4CU9A 1BJQA 3POJA 4EQVA 3ACHA 3WNXA 4XPVA 4EN7B 1AF9A 2PHXA 1G9FA 3E6DA 5FFOC 3WR0A 5JPNB 5F3GA 3MLLA 3SXWA 1US3A 4OHVA 2Y6GA 4KU8A 3T4HB 4ASKA 1W6NB 3C7FA 3ELNA 1QJX2 2OUJA 1PO11 4NOTA 3OGJA 5JOYA 4MV2A 5T5JA 3VLBB 2PHRA 3OBZA 1OUXA 2JG8A 4YFZA 5CISA 4YGDA 4FXGB 3WQ1A 4S2FA 3PUIA 3RSJA 1RUF1 1XE7A 1XQNA 4XJAA 1UYZA 4XDQA 3SNMA 2WS91 2VH9A 4CUGA 2RDQA 2HWE3 3ES1A 5A3UA 3K4DA 1HRV1 1OI6A 4AK3A 2C9AA 3EBRA 1QWRA 1VBE2 2VL4A 2UU8A 2Y6KA 3AZXA 3VKOA 5CFDB 3NNGA 4Q4W1 1UY1A 3TN91 4XDOA 5BNOB 3M70A 2YHJA 2K9ZA 2HWB2 2IXKA 2VNRA 4HPKA 1TMF2 1H0BA 1VAVA 2GP5A 1JODA 5I93A 1LTEA 3KV9A 2UYBA 1XNAA 4FQ4A 5C5UA 1QJZA 3QBQA 4NHLA 1C5IA 2YU2A 1AYM1 1GR3A 1NXD1 3KB5A 4A3XA 1ENXA 4CRQA 5LW9A 2VULA 1AX1A 1KEXA 3CL1A 1C28A 2JIGA 1SHWB 3JB8A 1OUSA 1QJX3 4GA9A 1HRI1 4AGVA 1QDOA 2Z69A 1GUIA 3D6EA 3JZVA 1Q8QA 2WABA 3O14A 5FOBB 4QU1A 4R52A 1IPJA 1UY4A 3KQ4B 1N1SA 3POIA 1KXGA 4YYOA 3ZXDA 4R8HA 4BQ2A 1GICA 1WLTA 2IXLA 3WHTA 1PMIA 3QOPA 4XYXA 3T1LA 2R30A 2CYFA 4GQ7A 4XQ4A 4AG4A 4LBQD 1POQA 1UWWA 3WG4A 1NLSA 4I30A 4XMIA 5BPXA 2QQOA 2W47A 3ZFFB 2FMDA 3LFIA 2YBPA 5FY8A 2VZSA 5L36A 4WM8A 5CFCA 4CA9A 1ZZ6A 3C8XA 1R091 3WD5A 2BWAA 3MIGA 4SLIA 4YGBA 1Y3TA 3VBSA 1QXRA 3N9MA 1JUIA 1W03A 1K5MA 1TMF3 2D3RA 2O1QA 4D6RA 4AFAA 1OF3A 3B01A 4M4RA 1H8TA 1IG0A 4CXWA 1OOPC 2W87A 5LWBA 1ZBA1 1YLLA 1GZ9A 5J98B 2YBKA 2A73B 3RYPA 5DMYA 3ZX7A 4LA3A 3J26N 4YW1A 1QY4A 1XNDA 2HWE1 4ZS2A 1Z7S2 2XVGA 4TSVA 4ASLA 5ABJB 2C24A 2DYCA 2HWD3 4W8JA 1GP4A 2Y64A 2Q1MA 3VBUB 2Z4FA 1ZREA 2Y26A 2BNNA 2V4VA 3VV1A 1QJU2 1J3RA 3V0BB 2D97A 1AJOA 1NOVA 2RDRA 3ZFGC 3IPVA 1BLZA 5FXWA 1LOGA 5JXJA 4LO8A 1EAH2 3SMHA 3SH5A 2VCMA 4IV1B 5FQ0B 1BVVA 4UAPA 4HVQA 3AP9A 2ZA9A 1MQTC 4MO3M 2TNFA 5FK8A 1ACCA 1R082 2GH2A 1JYNA 1JYTA 1AR92 3AZZA 5FWEA 3LDRA 4A7ZA 2XDVA 3ZVXA 3D0SA 1W9YA 4LUMA 2OQ6A 4IQPA 2IFWA 1NXMA 3HBKA 1RUC3 5FZMA 1J3PA 2WKKA 2WZR1 1S2KA 3ZO0B 3NNJA 1QJX1 2V09A 3RGBA 1E5RA 3ZFEA 4PF1A 3AKQA 4EJRA 1F5FA 1OA4A 1HB4A 1GZTA 2VCBA 3MDPA 4N7UA 3WW4A 5ACA2 5KHGA 2AEYA 1DQ5A 1YEWA 4P9JA 1GBGA 2WA3A 5A7OA 1URXA 3EJKA 3J7NA 5FZGA 1Z7S3 5C4WB 2JDPA 4XAEA 4MLOA 5L9RA 4A6OA 3WP5A 3RJRA 2A6XA 2GC0A 2C4XA 1VBE1 1OFNA 3JB4C 3NL1A 4FCAA 5BNPB 3BKZA 1X8EA 4E8CA 3QD6A 2WLPA 1PNGA 1QJU3 1JYIA 5EQUA 4LTAA 4LHNA 4CEYA 3JU9A 4XTMA 2VQAA 2HWB1 2ZEZA 2BERA 2VNOA 2HKXA 1TMF1 1XSQA 3P6BA 3T0AA 5JUVA 1FNZA 4EV0A 4NHYA 1RUNA 3GCWA 2DTWA 3P5BA 2PAEA 1OD5A 4M01A 4EN6B 1AR93 1PGL2 1IS3A 1SQ4A 4XJZA 2Q8CA 4OUMA 1X8MA 5TSWA 3VHNA 3A0NA 1B35C 1NE6A 2WT0A 4IETA 2VBDA 4JCKA 5JDBA 1JU4A 3VBRC 5H9PA 3CKHA 2VBPA 5DPNA 4JGYC 1W3VA 4XBNA 3OBTA 5KHKA 5HCHA 3MW4A 1GNZA 4ZXKA 1WKYA 3TWIA 4L0PA 5AC92 3WDVA 4XEZA 5ACA3 1ZX5A 2X29A 1POV3 4GKXA 2BV4A 4XZUG 4HN1A 3OD0A 5CU1A 3I2FA 4OYUA 4NRQA 2E63A 2VMEA 4A45A 2AYHA 1RUJ2 1EPWA 1CAXA 2VXJA 2XMLA 4A2UA 3ITQA 4XFGA 4ET7A 4E4HA 5I0RA 3OCPA 4UW5A 4KGQA 4L92A 4XF9A 3IBMA 1YQ5A 4FOVA 5E16A 5EFUA 1VRH2 1YFYA 4LLFA 4MXVA 4GKYA 1N47A 1AXZA 1QJY3 2ATFA 3K46A 4Y4RA 1A8DA 5IAXA 2E7QA 4DMIA 5H9RA 4TLFA 3D0JA 2RM22 4ZS3A 4JRLA 2HH9A 1W6OB 4PBOA 1PM4A 4BQWA 2YPDA 4Z2AA 1CWPA 1FMD2 2YGMA 4XFIA 5K0UA 1UY2A 4Y1ZA 3H9AA 1LHOA 2R7EB 4IGOA 2EF6A 1W6MB 4AEKA 1J59A 4Q27A 1KD7A 4KWKA 1KJLA 2IFRA 4BJ0A 4CCMA 1KJRA 1AR72 2JG9C 4HKLA 1Z7S1 4BXSV 4KL1A 1Z0HA 1ZZ9A 2QBXA 4QB6A 1H6YA 5C9AC 2JE7A 3OPZA 4XF0A 3IM0A 1RMU3 2PQSA 4RN5A 5AC93 2I74A 3T08A 3ZXFA 3ON7A 5IVCA 5D8AC 1D2QA 3ETQA 3VHPA 1A3KA 3LF7A 3PIJA 1EAH1 3PNAA 4CUBA 1DCSA 1RUJ3 1ZRDA 3S5AA 2JE8A 1RB8G 1R081 1U12A 3RYRA 1AR91 4G9SB 2ET7A 3NV4A 3ACLA 5DXDA 1V0AA 1UYXA 2X53S 1PK6B 3ECQA 5A6XA 3OUIA 5T50A 3BI3A 1QQP2 2BTVC 2R6QA 1W39A 1UF2C 3SLIA 3VKLA 1LECA 3P3PA 4MGIE 4QT6A 3W5MA 4YVWC 3E5QA 2D5FA 2B42B 2WNEA 1C5HA 1VALA 4EZHA 1IS4A 1T6GC 1OOPB 1HN0A 1ONAA 2FCTA 1FMD3 4XHXA 3T2PA 4P14A 4YW4A 4DXTA 5LBFA 5AFEA 2WR9A 4XFCA 4LBNA 5AVPA 3JQXA 4AFDA 2HYKA 2NPIA 1POV1 5IFTA 4YRDA 4AEJA 4KI5M 3P1IA 3FLPA 1K45A 1XNTA 2VTXA 5JXIA 3WCRA 4A3ZA 4AEDA 1S0IA 1H9PA 2NYYA 3LZZA 4UFMA 2CNAA 1V9U2 2VGDA 1DFQA 2R072 4H7MA 1MVQA 2V5DA 3W59A 3WNPA 2ZMNA 5JI9A 4D6SA 1MZEA 3H7JA 1HXS2 1H9WA 4XBQA 4DRRA 2VVFA 2FDGA 3WDYA 2Q4SA 5FUIA 3IKWA 4OHYA 1R1ZA 5G05L 4EZ4A 1PZ9A 2Y60A 1MQTB 4MZUA 4GH4A 4HKWA 4IGQA 4URTA 1CESA 5GJ6A 5KHHA 1PGL1 4QPWA 3AMPA 3AMNA 5GLWA 4BK4A 4XF1A 1ND3B 4AR2A 1MS3A 4AFMA 3RQ0A 5FZDA 3U1XA 3CEWA 1Q56A 2YPJA 1K3IA 2ZGSA 3ZN6A 1NUKA 4XQWA 2E7TA 3KT7A 4QHZA 1G9AA 3H3ZA 5FYZA 1BBT1 1RVF1 1AL22 2CGOA 5FY4A 1LGBA 3T2OA 3VBOA 4MGQA 4EN0A 3BPSA 4G4FA 1PZ8A 4I3PA 5B4XA 1HW5A 1W8WA 4FOWA 3VBHC 3O1MA 1CR7A 3OEAA 2Y33A 4QQHA 5C3QA 3AVSA 4B1LA 4DEVA 4PQQA 1RUD2 1ZRIA 2J22A 2XKOA 4NPMA 2Y8KA 1DF0A 3WDUA 2WNUB 2P1BA 1V9U3 5LY2A 1XNBA 2R073 5FZOA 1UAIA 1VRH1 4FPHA 1HLCA 1HXS3 3G6JB 3J8F2 5A3WA 1R1A2 1MS8A 2GZWA 3VUOA 3M3CA 1OVSA 3K77A 3MW2A 2RM21 4Q2FA 4DB5A 4N43B 4FAHA 1APNA 3H8UA 2F4LA 2BU9A 2ZMKA 3ASIA 2P3IA 5EYXA 1FMD1 1UD1A 2FZ2A 4P5YA 5DDJ3 2GNDA 3A22A 5FZBA 1DQ1A 1GZWA 4AF9A 2WRAA 3AB0A 3VBRB 1RTVA 3W20A 1AR71 3RJ2X 3PU8A 5KXCA 4JKKA 4Y20A 3C7OA 4JGYB 4XUOA 5ANQA 2E26A 1AL23 2VD7A 5EPAA 1SCSA 3LPFA 5IJRA 4IV3A 1IGOA 3BIWE 5SV8A 3O1VA 2EXIA 1QEXA 2RVAA 4Y1VA 5A7WB 4NHMA 1UIJA 3PL0A 4COYA 1F5JA 2BP6A 3SITA 3VKMA 2NMNA 3H1MA 3LIGA 5FPXA 1GWKA 4V2VA 1NY72 5FYTA 4RD7A 3A4UA 3DPRA 3O5SA 2O0OA 1ZBE2 1NKGA 1RHI2 2BVVA 1EV13 1QQP1 5GLTA 4XAAA 3LIHA 3BVCA 4GB32 3L9JT 4QQOA 1JOJA 5C8WA 3J8F3 5LEJA 1N3PA 2P2KA 1R1A3 2W1WA 1JOBA 1DQ4A 1M06G 4UFHA 3FHIB 4FFHA 3WHUA 3V0BA 2IXHA 4CCKA 4PF5A 1G6NA 4OZOA 1TME2 3BODA 3MYXA 4P02B 3GZTB 1ODMA 1TG7A 3MIHA 5C6CA 2ZOEB 3TRSB 1NCQC 5A6ZA 2OA2A 3C2UA 4YVSC 2Y0OA 2VMGA 2D6OX 2E31A 3WT3A 1ULPA 2JG9B 1OMIA 4TTGA 1BEV3 4AE2A 5ANNA 1EPZA 5FREA 1V9U1 1W9WA 2VECA 2R071 5E6HA 1XPWA 1J58A 1UZWA 1U5XA 1HXS1 1LULA 4I09A 4LO6B 5D8AB 1X33A 4BQ1A 5K9YA 3T2QA 1CGPA 3MFCA 1IKQA 1XE0A 1WD3A 2R042 3GYDA 1WD4A 4C1WA 4MH0E 4XUPA 1US2A 5FY0A 3KGLA 4AI9A 1ZBE3 3T4VA 4M3CB 5F2WA 1RHI3 4U2AA 1YRZA 1YIPA 1ST8A 3PVNA 4GB33 1SLIA 3GGLA 4MYEA 4MGZE 2E53A 2BBVA 5LA0A 1RUE2 3MICA 1NT0A 2J1SA 3LA2A 3CJIC 4JGZA 4YVWB 5FYCA 2XJPA 4E9KA 4OI0A 4HKOA 3VKNA 2GMPA 3JD72 4HANA 1TME3 4WVVA 3U14A 1CZTA 2ZZQA 3NJXA 1BYHA 5FKBA 3GJAA 2E6VA 3RZKA 2JEMA 2QKDA 3HJRA 4PDWC 1REDA 3ZSMA 2OZJA 1W8TA 1RUD1 3ZYPA 3NV2A 3THTA 4PBPA 1D4VB 5KBFA 4EWAA 3KD4A 3M3EA 2XL7A 1LODA 2NZ9A 3NKTA 4NHXA 5I0UA 3OOXA 2ADEA 4BA6A 2WINB 4HK8A 1S2EA 4Q0QA 1R1A1 2WDBA 5FZKA 4CDUA 1AXYA 1E5HA 3AMHA 2R043 3WINE 2ARXA 4BQ5A 1XE8A 2VQTA 5DZGA 2UWCA 2W39A 1PO22 2BNOA 3R0RA 5IYYA 1H6XA 2VOKA 4UI9L 4Y22A 4PJYA 2X05A 3O1TA 2QQNA 4AEDC 4Q4V1 1LR5A 2YY1A 4IE5A 1FX5A 2A71A 3DN7A 1RUE3 3GZUC 4P00B 3NJZA 5A32A 1NZIA 3POSA 2ZMLA 4DNYA 5FJHA 3EB7A 5I91A 4KWJA 1DIWA 1W0NA 5FZ4A 2XJQA 4O9GA 4QX1A 3JD73 2PLV2 1PX3A 1VMHA 3HVDA 3VBHB 1ZZ8A 2QFEA 4NWVA 1FPN2 5JPMB 5A3PA 5JR7B 4JZRA 5FPZA 2XJRA 5GKAC 3TNQA 3BU7A 2J1UA 2XOMA 4JKLA 2R1DA 1O5UA 2ZKLA 1SLTA 4V2WA 5FO7B 2ID4A 4FPFA 3BALA 3AK0A 3PMSA 2TEPA 2WIIB 4U36A 1HKDA 2DTYA 3MW3A 4MUVA 5FYHA 1ZBE1 5LCWL 2P17A 1C8NA 1RHI1 4PI2A 4NVPA 3T30A 5LA9A 2K2SA 1XB9A 2WAOA 4Y5TA 1WLWA 3PVEA 3Q8FA 3Q8CA 3G7DA 2ZGMA 4YZ2A 3MZHA 4HVOA 2HLEA 2V72A 4Y5Z0 3I2JA 3URFA 3FL7A 5C8CB 1PO23 2AR6A 2BBAA 2BJSA 2P3YA 1TME1 3N7LA 3AKSA 5FPLA 1LESA 4RGGA 2XLGA 1AVBA 1A78A 1JYWA 3L2YA 3ACFA 3S5QA 1WA6X 4CP0A 2CGPA 1S0FA 4IL7A 4XFHA 3TEYA 1SPPA 1PK6A 5C9AA 3I3QA 5DABA 2RDNA 2CGNA 1ULEA 4IEOA 2XWJB 2ZGNA 5DAQA 1UNBA 4QM8A 1W8FA 1W8HA 4EYUA 2PLV3 4XZPA 5GALA 1P8JA 4YW5A 4JX0A 2ZX4A 1FPN3 1LNSA 2DVBA 1S0GA 4FPGA 4AL9A 4PI0A 1UZ0A 4WVMB 3E6BA 5LBEA 4M0HA 1EUTA 2W1SA 2R041 3PUHA 3S7EA 1RUG1 1AYM2 1PZ7A 2PHWA 1CAWA 1W3XA 4NO4A 4NAOA 1W8NA 1DP0A 4XIKA 3HNYM 3NRUA 4BHPA 1G9BA 2VM9A 3O1PA 1RUE1 2AZ5A 4BCUA 1JBCA 2PHTA 5FIXA 4LLOA 1OF4A 4UXAA 3JD71 5EV7A 2DU1A 4LBLA 2ZXQA 3VKFC 4XE9A 2BUKA 3AFGA 4FFIA 1NCQB 4GALA 1WCSA 3ACIA 4GMP1 4GWMA 4YVSB 3VDAA 2QQIA 5FMOS 5EJ3A 4KQ7A 1K12A 3WDTA 2A6VA 5F8PA 2W91A 4ZZ5A 1L3JA 1L7LA 1ND3A 1B09A 3ZYGA 4Q4W3 3TN93 4R4ZA 3QH7A 5EYYA 2K0GA 3Q9OA 1FATA 1OLME 3SKVA 4B3NA 3WDXA 2VZPA 1ZBA2 4KWUA 5F37A 2EIGA 3NWKA 4BZ4A 1AYM3 1QOOA 1RJ7A 1IHMA 1RINA 4FI9A 1N1YA 2CDOA 2DUOA 5F5CA 2XR4A 4NRMA 4QDRA 5L7OC 1LRHA 1NLQA 1K42A 1RXFA 1E5SA 2WNUA 1HRI3 2WSUA 3LFMA 1X7NA 3CJIB 4RGKA 5KXDA 2PN5A 4IEQA 2OKXA 1PVC2 1STMA 4ZU5A 4Q8KA 2XH6A 3FX3A 2GNTA 4CDQC 4I0BA 3ATGA 4IEYA 5CKMA 3W9AA 4LOSA 1VR3A 1IS5A 1ND2C 1Y9MA 3NAPB 2JDNA 4QX0A 1U5YA 1FPN1 1GOFA 3AL6A 3DL3A 3FC0A 4PDWB 1S2BA 5J7MA 3A0KA 1OLMA 2YXSA 5A7QA 4AFCA 2Q1ZB 2QZ3A 4DIQA 2ZGTA 3WQ7A 1W2OA 3DV8A 4MSVA 3WQ0A 4PT6A 1R093 5DAWA 1NA1C 4OI2A 4BE3A 5IK4A 2D98A 5EHDA 1NG0A 4AI3A 2W08A 3N3HA 5IFPA 2RS51 2GN3A 3HQUA 4HN0A 3CDZB 1G9DA 4CCDA 4NIDA 2ARAA 4K8RB 2WZR2 4ZKTB 4ISRA 3FLTA 1V00A 1VBD2 1SLAA 2J1TA 4OVEA 3SH3A 5IK7A 3O1OA 1LHNA 3IZOA 4DFSA 1F31A 3AKRA 3RI8A 2BFUS 2JB4A 3GBWA 1ZBA3 3KCXA 2OPWA 5FCCA 2XWBB 4Q0PA 4QGNA 4QWNA 4JV4A 5A7WA 4XMAA 4Y1YA 2CAVA 4RS5C 3AYCA 4N9IA 4Q26A 4OMCA 5IAVA 4LBJA 5L9VA 3WVJA 4FTEA 3WNLA 2DCTA 4XC9A 1MVEA 2ZPXA 5GLZA 2JDUA 1V6MA 3HNBM 2VTFA 2D6LX 4HSLA 4LORA 2D43A 3MGUA 1W9FA 3H8OA 2P37A 3EQEA 1PVC3 4HBNA 4AVAA 3AMMA 1VP6A 4MXWB 4QPIA 4YWAA 1W04A 4K3UA 3CZJA 5FMOL 4J1XA 5FYBA 5HV0A 2JE9A 3W58A 4C1XA 4I2OA 1JXNA 2MHFA 4D7SA 2HEVF 5M0TA 4LR4A 1JH5A 4DRVA 5C3PA 2XVKA 4K20A 2XJUA 1EY2A 3DEMA 3AL5A 4AI8A 3GNEA 3NKGA 5FK7A 1PIV2 4PLMA 2RJKA 2PAKA 1VLNA 4GULA 1FOD2 4YW6A 1CZSA 1BKZA 4W50A 3VZNA 3RNSA 2WZPP 3UKTA 4QAWA 2WZR3 1PGSA 2JDAA 3P3NA 1VBD3 1BK0A 4FFFA 2P3KA 4UBGA 5HXMA 2A1XA 2JICA 4W6WA 1N1TA 4LIUA 2Q0AA 2MEV2 1OQ1A 1PMHX 1VAMA 3GZAA 4LE4A 2WC2A 2E7AA 4RHV2 1ULDA 5CB7A 5FO9B 5IT6A 1JZ7A 5ABJA 3C7HA 3MUY1 1I6XA 2EXKA 3DF0A 3WDWA 2XJVA 4D3WA 1VBE3 1UW8A 1HDKA 2R49A 2VZQA 2WNVA 4FT8A 1Y7BA 1YFXA 2CAUA 3NW4A 2WLQA 4OQ9A 3SH4A 5HCBA 4FBFA 3VDDC 4OHZA 3WOGA 2DCYA 2BPA2 2H6CA 3AM2A 2HWB3 2QQKA 2WQ8A 5FV3A 3O1RA 4CDXC 4AEMA 2QQMA 3HN3A 2DFBA 1W8ZA 3HT1A 2JB8A 2B9VA 3WP3A 4AW7A 1XNCA 5GLUA 4A7KA 4NIGA 2W5FA 4JRAA 5JZGA 3I2OA 1O3TA 4F3JA 1Y9GA 1GP6A 1T6BX 3OGVA 1PIV3 2ZGUA 3CNAA 2J1EA 2EIDA 5E8AA 1Q5OA 3BUCA 2BFUL 3B3QE 3HBZA 4UF0A 5FYSA 1HQWA 2Z5WA 4YW2A 3RWNA 2X8KA 2XQXA 4LJHA 3C3VA 1VB4A 3N9NA 1MPXA 1PX4A 1SDWA 2JENA 5HV4A 4K8FA 3OY8B 4LO4B 4D7TA 1PVC1 1OKOA 1QXJA 4META 4XURA 2W68A 2XBO2 3JXSA 3FBYA 2BVBA 4DXSA 1HV1A 2NM1A 4JDMA 5I8SA 4AZZA 4RHV3 1RJ8A 3E5XA 4XCAA 1SBFA 5LASA 3D8CA 3VZJA 1YCIA 2IVIB 4YG3A 5LK5A 3POGA 3VBFA 3HOBA 3I59B 4NMIA 3I49A 1I3HA 2ZS6B 3IDBB 2PMWB 4D6QA 4AYUA 4NAMA 1MS1A 4CU6A 4PCRA 2H6BA 2RV9A 4GD4A 5C71A 2JECA 4E4ZA 3A23A 5T54A 3GZEA 2WL1A 1VBB2 1S1AA 2R0FA 4CEWC 1VBD1 3KT4A 3O0VA 3BTZA 4XTPA 1JZ5A 1JS9A 4AVSA 4XJ8A 1CAVB 4IERA 5FTTC 5E88A 3UV9A 5LRSA 5BY5A 3WG2A 4AGRA 5A3MA 3B9IA 4HVRA 4ORFA 4L99A 4DQAA 4EWDA 3OJBA 1KS4A 4JDOA 5LK7B 2XLFA 5L7OB 5LZ6A 3U75A 5IVJA 3K48A 2A6WA 1F35A 4CDWA 2PTMA 2ZAAA 4LBQA 1Q8SA 1DQ6A 1DZTA 3JCIA 3LAGA 4CDQB 4ZONA 3RMYA 3WF4A 1ODNA 1YFUA 1EAH3 1JN2P 3VZMA 1ND2B 1K5JA 5EJ1B 1JYXA 3ORJA 4QDSA 4QXKA 4GWNA 1UZVA 4Q0UA 1R083 2YC2A 4S2HA 2D6PA 4KGGA 3LD8A 3FFQA 2JDHA 1GQGA 2Q30A 3OPTA 3LSDA 4F8AA 3TNPB 4BQ3A 1NA1B 1PIV1 2DVAA 3N7KA 4WM7A 3H1YA 4AHWA 2XHKA 1YJLA 4CZSA 1IPKA 1FOD1 4I01A 2CU5A 4QPGA 1KRIA 4YLZA 3WNNA 1VBB3 1EP0A 2XJSA 4AI2A 3RMXA 2WT2A 1BBT2 4OUEA 4XILA 1RVF2 2IXCA 4HL0A 2VE1A 2GN7A 5F39A 2WN3A 4QX2A 3Q8EA 1XU1A 4GIQA 5FDBA 1V6IA 2MEV1 2NN8A 4NPRA 2QDRA 1AZDA 1LOFC 1X36A 2GU9A 4LKFA 3T1MA 4RHV1 4PLNA 5JIAA 4RS5B 2YC4A 4DUXA 3BIEA 2X5IC 1TNRA 4YM2A 2F17A 1X50A 2HEWF 1REFA 3AMQA 1O4YA 3BOPA 3UGGA 5F2SA 4ZXEA 4TZDA 2FD8A 3PUQA 4XFFA 4LMFA 4FXKB 1NCRA 1XYNA 3NV1A 2FDHA 4LPLA 2W2IA 5FMBA 3UESA 4AHXA 3R4SA 3ZKUA 1OXCA 1D4M1 2JG8C 2PELA 4L8QA 2GC2A 3BTXA 1KITA 5HPOA 5BNNA 3PVOA 2KM2A 2UURA 5DG1A 1CJDA 4A41A 2BOJA 5FZAA 1GNYA 5A33B 4K1ZA 4DPNA 3IAQA 1LOBA 4UFLA 4YPJA 2DUPA 2YGLA 3TEXA 1UQXA 5JMCA 1O91A 1OFSA 2NQYA 5FZ9A 4HFSA 1QOTA 4YG0A 1BBT3 4CUCA 5F7UA 1RVF3 3TEWA 5F6KA 1SMVA 4RQPA 3LA3A 1VBA2 1ZM1A 2P5BA 1ZRCA 4N7IA 2XBO1 2VMCA 1Q8PA 2PXJA 3LB9A 5FY7A 5L73A 3UJOA 4UBHA 3FHQA 3ABZA 3INAA 3H50A 3VHOA 1HB1A 2E9QA 4EE2A 3PJYA 4L97A 5F1RA 4RR3A 5A3OA 1H4GA 3FUOA 2QJVA 3A21A 1AJKA 3U37A 4KBZA 3HAGA 4BMBA 1LHWA 3ILFA 3IAPA 1VRH3 1PM7A 1UCXA 4R4XA 3USSA 5JOWA 3VDDB 3NO8A 3I54A 2VUAA 3CO2A 1W6PA 4H2AA 3MBWA 2R16A 4YG6A 1VBB1 2A6ZA 5FAXA 2RM23 2LALA 4Q4Y2 2ZEWA 3VL9A 3DYPA 1I1EA 1TE1B 1O8SA 1QHDA 2Q5TA 3I2DA 5JVVA 2JIJA 1COV2 4QX7A 3NAPA 2OXBA 4RFT0 5JR2A 5F5IA 2AENA 4JHTA 4YW7A 5FRAA 3NNFA 4N53A 1IS6A 5DAPA 5LA2A 5F5QA 3F2ZA 1XYOA 1AR73 1CX4A 1GP5A 1W0PA 2ENRA 2J7MA 4WM8C 3LOIA 3MLJA 4XIOA 5LB6A 3DCQA 5LBBA 1UMHA 4GAZA 5CFCC 5C7GA 5FUPA 3NQHA 3VBSC 3U07A 1VBA3 1K5MC 5FLIA 3ZFGB 4B7KA 1W6NA 3UKVA 2I2SA 5AFBA 1H8TC 3N7MA 4DS0A 5A3NA 4P5HA 1QH6A 2HBUA 1N1VA 1ULOA 4BXFA 2ILMA 1J83A 2ES3A 3K51A 3WX5A 5SV5A 1SCRA 3E5UA 1G9CA 3OG2A 2FDKA 5JSOA 5GZCA 1UOFA 2A3WA 2QTWB 1QQP3 4IE7A 4HZFA 1AX2A 3H7YA 4XACA 5FZFA 3RYKA 2R1BA 2VOTA 4W6XA 5FPVA 2XKPA 3IDCB 2JJ6A 4OZXA 1RITA 4JDNA 2RS12 5CFDA 2AACA 4Q4Y3 3WW2A 4CEWB 1UOGA 3B9CA 4IE4A 4S2GA 4MXWA 3TBDA 5BNOA 2AC1A 5J37A 3USUB 3TEZA 1COV3 2WUHA 1FI2A 4DUWA 3E1F1 1GWLA 1Q43A 1L7QA 2J1AA 5T3NA 4COUA 1YXWA 3RZJA 3MUZ1 2RG4A 5KWRA 3MV11 1PMJX 4UFIA 2XB6C 4BOWA 4CSWA 3KHCA 5DUVA 4PIYA 2ZZJA 5DUUA 3LEGA 1GOHA 1D0HA 1BZWA 1M4WA 2HWF2 2RJLA 4Q5OA 1J1TA 5FYVA 2D44A 3EHKA 4XUTA 5FZ6A 5C5TA 1LOCA 1PVXA 4P9YA 4QX8A 4BIFA 3ZOIA 3ZFEC 4HONA 1WCDJ 4AVVA 5C70A 1UU4A 3IDAA 3I7DA 1O7FA 1ENSA 5A1AA 1BMV2 4QGLA 2QQJA 5EXOA 3ZKYA 4Q4V2 1W6QB 1B35B 3PVBB 3VZKA 5EIYB 1OD3A 1VBC1 5IW0A 5EZWA 1CAUB 3ZFFA 4AQ2A 1AHSA 4IE0A 1DGLA 4K21A 2RS13 2Y6HA 4B4QA 1ULGA 3AFKA 3WUCA 4MGTA 1UKRA 2ZGPA 4NPLA 2VUDA 4CEYC 1HQNA 4X8NA 3TYJA 1VBA1 4AI0A 4D94A 2QZ2A 2L9LA 2BGCA 4QKFA 2FZ1A 5D1IA 2Y38A 1J84A 2X5IB 1RUD3 4O7XA 5FY9A 1EYBA 5HXVA 3V0AB 1S0JA 4FTBA 2JD9A 4CPBD 4LE3A 2HWF3 1AYN2 2VZTA 4QPGC 2K46A 4JKMA 2TUNA 1H8VA 1UO9A 1WBFA 3VBUA 3RG0A 4BPZA 1SFPA 2JG8B 5FBZA 4Q4Y1 1DQ0A 2IXJA 4MHUA 3SCGA 1H4HA 3I8TA 1DHKB 1COV1 3KVBA 4IV1A 1UPSA 4A42A 5FQ0A 1DYPA 1GV9A 5KHIA 4Q4V3 2B45X 2EVXA 4IEXA 4I0WB 4D0QA 4WV8A 1H1IA 3QCWA 1AL0G 4S2DA 4BQ4A 2A70A 4ZPIA 3M1HA 5A3LA 3WW3A 4CP2A 3I2IA 2QQWA 4NRPA 2LRPA 1U5ZA 1GSLA 3PUSA 5CEHA 2YC0A 2G1MA 3ILNA 4HPKB 3APBA 4WZFA 5FYIA 2V73A 1BCXA 3C7EA 5A6QA 1V6KA 1QGLA 5CZKA 5FUNA 4XF4A 4M4PA 3VD3A 4BLJA 4E8DA 3GXUA 5F3IA 3J7LA 5K0UC 3LEIA 2RS31 1HQLA 2VZ3A 3PLQA 4FOQA 1RUG2 3OF1A 3AKPA 3RPQA 2QUOA 5K4LA 2E33A 2EIBA 1AYN3 2NP0A 5FJKA 1JI6A 5C4WA 3H8XA 3SEEA 3AYDA 3PMEA 3FFZA 1LGCA 2VJXA 2IXIA 4BYYA 5BNPA 1ENRA 2WFF2 2RS11 4RSUA 4W65A 3KSCA 2E51A 5BUVA 1FV2A 2AH2A 3THPA 2ZGRA 2DCKA 4COVA 2FDJA 4F7ZA 4KBBA 1UL9A 4WZCA 2A7AA
chains in the Genus database with same CATH topology
2RR12 5T52A 3SISA 3AJYA 4NR1A 3E6CC 4P9XA 1HX6A 1SBEA 3L2HA 2HWF1 2VY0A 5J48A 2OIIA 1K5MB 2O8QA 1C4RA 1S0CA 1FNYA 2VMIA 1H8TB 4Y1UA 2G4IA 3WP4A 2PHLA 1WBLA 3DKWA 4HETA 3M3OA 1AUYA 2ZHKA 3WP6A 1C1FA 1LU2A 1RUG3 5IUQA 4ATFA 4C0HA 4W6YA 4B7EA 2SBAA 4N53C 1BMV1 1DBNA 4FOYA 1OHFA 5F6LB 3WW1A 1W0OA 2CY6A 2H0VA 1WLCA 1LJ7A 1C1LA 2D93A 3D82A 3S7IA 4Z92B 3IPVB 1SFNA 2QQPA 1UPIA 2ZX2A 1YNAA 1JUHA 4OLLA 4QQLA 3KMHA 4OHXA 1W6OA 4GH4C 4GMP3 1ZZBA 2GNBA 3BB6A 4XHBA 4FAGA 4WVWA 5E89A 3FLRA 1W6MA 2LUWA 2Y0IA 3FBMA 4LBOA 5EWSA 4K6BA 3HQXA 2DU0A 1AYN1 2JD4A 5CNAA 2RS52 4ES9A 2BQPA 4XW3A 3WY6A 2BW8A 2I45A 1WLDA 2F4PA 3VBOC 3ZFEB 5JOZA 1VAKA 3AXDA 2PYTA 4E2GA 1AX0A 1LEMA 3J9SA 5JLVA 3SCHA 3JBG2 1PHMA 4X6RB 3VN4A 4BMEA 4FPOB 2P34A 4CTEA 1D0GA 1DLLA 1QXPA 4UW6A 2RMU2 1QH7A 4CEYB 2ZX0A 4LA2A 3WCSA 1E57A 2ET1A 4YM1A 4LEJA 3U10A 1OOPA 3V64A 4HT1T 3ZMOA 4DZGA 3AYAA 3AP7A 4LUKA 4QMAA 3R05A 1XYPA 2DVFA 3B69A 3ZSJA 5J09A 3GBGA 1DQ2A 2RS53 4Q4X2 4E27A 4QM9A 4J6GA 1IOAA 1UMZA 3B00A 2WFF1 3O7OA 3ALQA 4HSJA 4IV3C 3VHRA 1MEC2 4YZ4A 2GALA 1HV0A 1DZRA 1NE4A 2ARBA 4P9LA 1MQTA 1CAXB 3GF6A 1WW5A 1WGPA 2RR11 4KG0A 2ZX1A 3ME2A 3GHNA 3DPRC 3M3IA 1ZNPA 2RMU3 4A7YA 1ZRFA 3AP6A 4KNCA 1X82A 2D6NA 1ZVFA 4Y26A 4YM0A 3R6SA 2JDZA 3S0MA 4K1YA 3QLQA 1BVP1 1WW4A 4LO7A 3M4FA 3AKTA 5T5LA 1N3OA 5K0UB 1VIWB 4ASMB 3SHRA 3RI9A 1RC6A 3TRSB 1MACA 1XXNA 2YYOA 2I07B 2CL2A 5JWPA 2JKBA 4QX5A 4TWTA 3WG1A 2VOXA 3D5OA 1F8VA 5B2GB 1DGWX 3ZYJB 1OQDA 1UX6A 4YSFA 4PIZA 1MEC3 1OKQA 2EA7A 2UY9A 3MFAA 3T2TA 4Y1XA 1C57A 1A6CA 3TAYA 4WBBA 4N43A 4YW3A 2DCZA 4X6QB 3U11A 1PGW2 4ZU4A 4D7YA 3UKNA 2KXLA 4BM8A 4LHLA 2N7GA 1B35A 1YJKA 5BYNA 4YNIA 3VBRA 4D69A 2O8OA 3OBRA 4JGZC 5BNPC 2VUJA 4JGYA 4N90A 3BOWA 5JSPA 3FJSA 4IEZA 5T55A 4COZA 2DUQA 4DXZA 3LA7A 1UN1A 1LHUA 2CV6A 3JBG1 3OYWB 2A6YA 4INDA 1J1LA 5HCFA 4AEDB 2VG9A 2SLIA 1DGRA 4C90A 4AXOA 4X8PA 2RHPA 4HMZA 2FBEA 2RMU1 4QHBA 1ULCA 1VB2A 4Q0VA 3V56A 1UIKA 2PAMA 2WFPA 4UW4A 4CDUC 4L9BA 1IQAA 4EN8B 2GMEA 4XXPA 1MR5A 4GH4B 2D6KA 4AVBA 1TNFA 1ZZCA 4IEPA 4M3CE 4AQSA 4H14A 4H3WA 3ZIXA 4JAAA 5DZEA 4OI1A 1KS5A 5KXEA 4LBMA 2ZGQA 1QNYA 1IKPA 2R062 4Q4X1 4CYDA 3ZN6B 2JG9A 2WJSA 1UZYA 3VBOB 1QKQA 2YUEA 1KQRA 1KDKA 1ZYBA 2EXJA 1YI7A 4DINB 1YYNA 1MEC1 5D8AA 3GALA 2GAUA 1YI9A 2GC3A 3D4KA 3KS7A 4M3CA 2YDEA 3PJQA 1S0DA 2XL9A 1MS5A 1YUDA 2HWD2 2LM3A 1WMEA 1ASJ2 5BV6A 4YVWA 1D4M2 4FP2A 4ONUA 5J3UA 3MIEA 1MZ5A 1LOEA 4E4SA 1RUI2 3RRDA 4BH9A 1Q3EA 2WQ4A 1CD3G 2W0XA 3QACA 1OSGA 1GZWB 1OLQA 2R063 1FOD3 1WMDA 2R32A 3VZOA 3ZXJA 2VVEA 4BIOA 1DU3D 1PK6C 2WWSA 1OQEA 2FMYA 4UW3A 3EO6A 5C9AC 4Y20B 3ST7A 4EN9B 3MPBA 5KXCA 4C0BA 4J1WA 2WA4A 1CQ9A 1ZA4A 2ZGOA 3AZWA 4AVTA 5CAZA 1RUC2 3B7MA 1V6LA 4IV3B 2MEV3 3HN1A 3N36A 2OVUA 4QPYA 1DDLA 2ZGLA 2ZCWA 1JYCA 2ZBJA 3UJQA 2QE3A 1DGRN 2P3JA 4I02A 1MZFA 1MS9A 1PGW1 3DPRB 1A8MA 1WCKA 4RGAA 4DOUA 2XUMA 4Q1RA 5DUWA 3AP5A 4QQ2A 2HEYF 3S6PA 2B9UA 1ASJ3 3HR9A 3QH6A 3ZN5A 1J3QA 1D4M3 1QF3A 1RIRA 1QOSA 1RGSA 1RL3A 4MGYE 3WV6A 1LOAA 4IEUA 2DFCA 1RUI3 4RL7A 1SBDA 3VBHA 4LULA 5FLJA 2GC1A 2QCSB 3AZYA 2R0HA 4CP1A 4XETA 2BNMA 2UWBA 1ND3C 2BEOA 3GBFA 1QDCA 3U0ZA 4IEVA 5CBLA 4Y4YA 2XBO3 3KZ4C 1CJPA 4B4RA 2G9GA 2ZTNA 2CWMA 4AQTA 1FYUA 4OULA 2GH8A 4R9AA 1GNHA 4K7JA 3MLKA 5C8CA 5HCAA 5JAXA 3KCYA 3CF6E 1C8M2 3ZSKA 2PA7A 2DWRA 3BCWA 4PLOA 3LGRA 3POWA 4R9CA 2VU9A 2WNUC 4XFBA 2R061 4OI4A 4JGZB 3ILRA 2ZHNA 1DYKA 1RUH2 5BNQA 1QJY2 1XNKA 1F9KA 3FUQA 3BTAA 4NWWA 3CU7A 3KM5A 4AVCA 4N43C 4XJUA 1PNFA 4WVMA 3H3UA 5LEKA 3R4UA 3ZYIB 1I9RA 1NQDA 2NLRA 4IXLA 3S30A 1QMJA 3KLSA 4LO5B 3ZXGA 4E4DX 1V6OA 1ENQA 1WW6A 3H0OA 3IN9A 1V6NA 5BXXA 3KGZA 3JQWA 4FPLA 5LRRA 5J96B 2QVSB 2YZ4A 4RA0A 2OYZA 5GM0A 3LWCA 5T5OA 2ZJCA 2HWD1 1UZZA 3MPPG 3AJZA 2VVDA 1TEIA 1ASJ1 4PIXA 4CDUB 1RMU2 1YO8A 2ZKNA 4FVVA 3HT2A 2XPJA 3ZPYA 2DURA 1C8M3 1RUI1 4Y22B 3ZSLA 4BLIA 4NN0A 3X29B 1O3SA 2D6MA 4ZU7A 5I91A 1BQPA 4L2NA 1NCQA 3MEPA 4YVSA 1VBC2 4FPJA 3PHMA 1Z78A 5A32B 4ATEA 1H2MA 5FO8B 1CVNA 3O12A 1RUH3 1HIXA 5I8TA 3DUIA 4QPIC 1OPMA 4JQRA 3H1WA 1RUC1 5KC5A 2Z79A 5KHJA 1FAYA 1SLBA 1G8WA 4KG8A 1N3QA 5E1RA 4B29A 5CIRA 5IK8A 1DGWA 2ETEA 2A3XA 1O4TA 2B5HA 5I0TA 5GZEA 1S0EA 3PTYA 1WMFA 3CJIA 4CDXB 4ISQA 3FWEA 1XRUA 4QQPA 1LB2A 1QJU1 4XJ9A 1H2KA 4SBVA 2C5DA 2VOWA 5F9TA 5J36A 1BXHA 3MIFA 1ZRRA 4TYSA 5ABJC 1YHFA 3SCFA 5CG9A 4PDWA 5GZDA 4QU2A 2HWC2 1VBC3 3VZLA 3WLUA 4BWOA 1SACA 1OA2A 5C9AB 2WNVC 4MGKE 5JI7A 4AFBA 2PHFA 4FO9A 4FPYA 3O0XA 5CADA 3ES4A 1H1MA 1POV0 3TOJA 3VGIA 2NMOA 3I4IA 1Y43B 2D5HA 5HI0A 5JZGC 1LEDA 2B46X 2OPKA 3RDIA 2RS32 2XVLA 3OYWA 5ACA1 1I5ZA 1CAWB 1C8M1 1CN1A 3AXEA 2CTVA 4FPCA 3IMNA 1YFWA 5DG2A 1S55A 3R4DB 3WUDA 2PHUA 1GANA 4JVAA 5CA6A 1RUH1 5GZFA 1MS0A 1WUVA 3ZN4A 1QJY1 1BK1A 2PFWA 1MZ6A 2ZAHA 4P9IA 1Y9QA 4YZ5A 2VXRA 4OFGA 2HWC3 3VBFC 4Z2WA 5K8SA 2AGSA 2AREA 2DVDA 1UKGA 3FE5A 4YZ1A 3MF9A 1VJ2A 5DDJ2 2UYAA 3N4MA 5IK5A 3DGTA 4B4PA 2DF7A 4HLTA 2DV9A 1YIFA 4M3CF 3FZ3A 2ZACA 1G7YA 1F2NA 1RMU1 4FP3A 1MS4A 1NQJA 4EWEA 3CJXA 2RS33 5AC91 4IEWA 3NVCA 4XQDA 2Z42A 2GNMA 1RUJ1 2ZX3A 1LU1A 3ENRA 2YV8A 2GMMA 4HK9A 1NZCA 3ZDSA 3MF6A 1EV12 3RZZA 4CDWC 5I0SA 1SEFA 2ERFA 5H9SA 3KCCA 2RE9A 3NV3A 4YARA 4FSJA 4MX3A 4I3GA 5FLHA 1H1AA 5C8CC 4PQ9A 3WG3A 2ZGKA 3ZMNA 3E97A 4JTNA 3GHMA 4Q1PA 2G9FA 4WM7C 4EROA 5AVAA 2PHDA 1U5IA 1BEV2 1H30A 2F6BA 2XG3A 5L19A 1OPOA 1GLHA 1NYWA 2EAKA 1JHNA 3OY8A 1QU0A 3ZXAC 3V65A 2DVGA 4ES8A 4YGCA 4Y24A 5GLVA 4DY3A 2BYVE 2YROA 2HWC1 2MPFA 3LOBA 3I59A 1W2UA 3ZXLA 4Z1VA 1XU2A 1NCRC 4QPIB 3FMGA 2FQPA 3B02A 3J4UH 4E2SA 1AR62 4MVTA 1DZQA 4M0NA 1C3HA 5BNNC 4FPKA 3MI8A 3WZ1A 1CAVA 3UL2A 3KT1A 4AI1A 2QNKA 1U0AA 1KFXL 1OA3A 5L7OA 2VW2A 3OD4A 3IIAA 1WA4A 2A75A 4P9WA 2KA3A 4AHYA 4AWDA 3M8LA 2ZHLA 4RQPC 3JUUA 3BPZA 4CDQA 5JSRA 4F83A 4OHWA 1ND2A 4XBLA 1KDMA 5ABJB 1V6JA 2D40A 2D3PA 2A3YA 4RR3C 3HIFA 1GZCA 1Q8VA 2WNVB 4WM8B 4AQ6A 5CFCB 1S0BA 1NA1A 5DDJ1 4Q0SA 2CWSA 4K40A 3VBSB 4O9EA 4R9BA 2FHRA 1AR63 3RS6A 4LBKA 5KXBA 2WQZC 5JCTA 1AL21 4QGMA 5DUXA 1OLRA 1O4ZA 4C91A 4I0AA 5JZGB 3AP4A 3LSEA 4L11A 1O3QA 3NAPC 3POYA 4RS5A 1QNWA 3ZIWA 3N35A 1ULFA 2TBVA 2EALA 3UK9A 4NHKA 2UY8A 1CIWA 2WSVA 2YMZA 3ZSEA 5FOJB 2WFF3 1EV11 1LHVA 3OGGA 3J8F1 5KC6A 4OUSA 1FT9A 3ZXKA 2B8MA 3TB0A 4K9SA 4G3YC 3VBFB 2RR13 5CVRA 1SFYA 4COWA 5HBAA 4E2QA 4V1PA 5A33A 5I8YA 2VPVA 3IDEA 3NSTA 4Z82A 4ITCA 3M7AA 3ROUA 1BEV1 5CFDC 1RUOA 4B8EA 5BNOC 4Q8LA 3N7JA 4N9HA 4M00A 4XF3A 3OTFA 1AR82 5K7PA 4GXLA 4H55A 1JW6A 2H0BA 2D7FA 4R9DA 1NY71 4AGGA 2B39A 2QDNA 2VMHA 4CDWB 2C0ZA 4LBQB 4DY5A 4GB31 3VDDA 4YZ3A 1PO12 4CDXA 3LCPA 4WVZA 1AR61 1SLLA 2EXHA 1IZ3A 4KWLA 1RUF2 3M3QA 1LENA 4QD2A 4FPEA 2WS92 5T5PA 4Z8BA 2VW0A 5JOXA 2D3SA 2LTNA 4WM7B 1HRV2 1O5LA 3B94A 3ZFFC 3MIBA 2Q8OA 1FXZA 4KH9A 4QPGB 4XXAA 3AYEA 2ZHMA 4Q4W2 3TN92 3CLPA 1UU6A 2AUYA 3WXPA 3ZFGA 1AR83 1GYKA 3JBG3 4XFAA 2OW4A 1H2NA 1LKNA 2UWAA 3VL8A 4LT5A 4FTSA 2OZ6A 4LHKA 1GFF2 2HJIA 3LKJA 2A5ZA 2XLAA 4P9GA 1LCLA 1Q8OA 4LNVA 5H9QA 2MNGA 4AHZA 2PQQA 3HMYA 1REEA 4JTOA 1SLCA 1NCRB 2VNGA 3KQRA 2JXAA 3AZVA 2OUHA 1HRI2 1PO13 4Z07A 3ZYRA 1H2LA 3VBUC 5DZFA 4CEWA 4GMP0 1DG6A 5BNNB 3HD8B 1RUF3 3O0WA 3AX4A 3USUA 2WS93 2GDFA 2IC1A 4IV1C 2Z2SB 2VOVA 3MIDA 3U4XA 2JX9A 1CONA 5CG8A 1HRV3 4Q29A 2XGXA 3HWJA 3IT8A 3B93A 4Q4X3 1ALYA 1GKBA 3ZXEA 3M2MA 1R092 4FQZA 4IESA 1D2SA 1UU5A 4RQPB 1AXKA 1NLRA 3IWZA 1LGNA 1GQHA 2XJTA 3EXUA 1V70A 2EAAA 4YGEA 1G86A 1WW7A 2C1FA 2W52A 2VQ0A 4RR3B 1TQ5A 2VW1A 1ZZ7A 1PO21 4JC1A 4H7LA 2HWE2 1JTZX 4XOGA 1W6QA 5C4WC 1CPMA 2GSYA 5GZGA 2V5YA 1CAUA 1W6PB 4XJWA 2IWGB 1CPNA 2ZABA 5JIUA 2IZWA 2WT1A 1YWKA 2PLV1 2B7YA 1O3RA 1AR81 1LOFA 4YM3A 4KU7A 4N53B 4YFWA 1FV3A 2X5IA 3B5LB 3V0AA 2BWCA 1KFUL 2DCJA 1BJQA 3WNXA 4XPVA 4EN7B 1AF9A 2PHXA 1G9FA 3E6DA 5FFOC 3WR0A 5JPNB 3MLLA 3SXWA 4OHVA 4KU8A 1W6NB 3ELNA 1QJX2 2OUJA 1PO11 4NOTA 3OGJA 5JOYA 4MV2A 5T5JA 3VLBB 2PHRA 2JG8A 4YFZA 4YGDA 4FXGB 3WQ1A 4S2FA 3RSJA 1RUF1 1XE7A 1XQNA 4XJAA 3SNMA 4XDQA 2WS91 2VH9A 2HWE3 3ES1A 1HRV1 1OI6A 4AK3A 2C9AA 3EBRA 1QWRA 1VBE2 2UU8A 3AZXA 3VKOA 5CFDB 4Q4W1 3TN91 5BNOB 3M70A 2YHJA 2K9ZA 2HWB2 2IXKA 2VNRA 4HPKA 1TMF2 1H0BA 1VAVA 5I93A 1LTEA 2UYBA 4FQ4A 1QJZA 3QBQA 4NHLA 1C5IA 1AYM1 1GR3A 1NXD1 3KB5A 4A3XA 1ENXA 4CRQA 2VULA 1AX1A 3CL1A 1C28A 3JB8A 4AGVA 1QJX3 4GA9A 1HRI1 1QDOA 2Z69A 3D6EA 3JZVA 3O14A 1Q8QA 5FOBB 4R52A 1IPJA 4YYOA 3ZXDA 1N1SA 1KXGA 4R8HA 1GICA 1WLTA 2IXLA 3WHTA 1PMIA 3QOPA 4XYXA 3T1LA 2R30A 2CYFA 4GQ7A 4XQ4A 4AG4A 4LBQD 3WG4A 1NLSA 4I30A 4XMIA 5BPXA 3ZFFB 2FMDA 5L36A 4WM8A 5CFCA 1ZZ6A 3WD5A 1R091 2BWAA 3MIGA 4SLIA 4YGBA 1Y3TA 3VBSA 1QXRA 1JUIA 2D3RA 1K5MA 1TMF3 2O1QA 4AFAA 3B01A 1H8TA 1OOPC 1ZBA1 1YLLA 1GZ9A 5J98B 2A73B 3RYPA 3ZX7A 4LA3A 3J26N 4YW1A 1QY4A 1XNDA 2HWE1 1Z7S2 2XVGA 4TSVA 4ASLA 2DYCA 2HWD3 2Q1MA 3VBUB 1ZREA 2Y26A 2BNNA 3VV1A 1QJU2 1J3RA 3V0BB 2D97A 1AJOA 1NOVA 3ZFGC 3IPVA 1LOGA 4LO8A 1EAH2 3SMHA 3SH5A 4IV1B 5FQ0B 1BVVA 4HVQA 3AP9A 2ZA9A 1MQTC 2TNFA 1R082 2GH2A 1AR92 3AZZA 4A7ZA 3ZVXA 3D0SA 4LUMA 4IQPA 2IFWA 1NXMA 1RUC3 1J3PA 2WKKA 2WZR1 1S2KA 3ZO0B 1QJX1 2V09A 3ZFEA 3AKQA 4EJRA 1F5FA 1OA4A 4N7UA 3MDPA 3WW4A 5ACA2 5KHGA 1DQ5A 4P9JA 1GBGA 2WA3A 1URXA 3EJKA 1Z7S3 5C4WB 4MLOA 3WP5A 3RJRA 2A6XA 2GC0A 1VBE1 1OFNA 3JB4C 3NL1A 4FCAA 5BNPB 1X8EA 3QD6A 2WLPA 1PNGA 1QJU3 1JYIA 4LTAA 4LHNA 4CEYA 3JU9A 4XTMA 2VQAA 2HWB1 2VNOA 2HKXA 1TMF1 1FNZA 4EV0A 1RUNA 2DTWA 2PAEA 1OD5A 4M01A 4EN6B 1AR93 1PGL2 1IS3A 1SQ4A 4XJZA 3VHNA 4OUMA 1X8MA 5TSWA 3A0NA 1B35C 1NE6A 2WT0A 4IETA 4JCKA 5JDBA 3VBRC 5H9PA 4JGYC 4XBNA 3OBTA 5KHKA 3MW4A 1GNZA 4ZXKA 3TWIA 5AC92 3WDVA 4XEZA 5ACA3 1ZX5A 2X29A 1POV3 4GKXA 5CU1A 4HN1A 3OD0A 2E63A 2AYHA 1RUJ2 1EPWA 1CAXA 4A2UA 4XFGA 5I0RA 3OCPA 4UW5A 4KGQA 4L92A 4XF9A 3IBMA 5E16A 4FOVA 5EFUA 1VRH2 1YFYA 4LLFA 4MXVA 4GKYA 1N47A 1AXZA 1QJY3 2ATFA 1A8DA 2E7QA 4DMIA 5H9RA 4TLFA 3D0JA 2RM22 4JRLA 1W6OB 4PBOA 1FMD2 2YGMA 4XFIA 5K0UA 4Y1ZA 3H9AA 1LHOA 2EF6A 1W6MB 4AEKA 1J59A 4Q27A 1KD7A 4KWKA 1KJLA 2IFRA 1KJRA 1AR72 2JG9C 4HKLA 1Z7S1 4KL1A 1Z0HA 1ZZ9A 2JE7A 3OPZA 4XF0A 3IM0A 1RMU3 5AC93 2I74A 3ZXFA 5D8AC 1D2QA 3ETQA 3VHPA 1A3KA 3PNAA 1EAH1 1RUJ3 1ZRDA 1RB8G 1R081 1U12A 3RYRA 1AR91 4G9SB 2ET7A 3NV4A 3ACLA 5DXDA 2X53S 1PK6B 3ECQA 5T50A 1QQP2 2BTVC 2R6QA 1W39A 1UF2C 3SLIA 1LECA 3P3PA 4MGIE 4QT6A 4YVWC 3E5QA 2D5FA 2B42B 2WNEA 1C5HA 1VALA 1IS4A 1T6GC 1OOPB 4XHXA 1ONAA 1FMD3 5AFEA 4P14A 4YW4A 4XFCA 4LBNA 5AVPA 3JQXA 4AFDA 2HYKA 2NPIA 1POV1 4YRDA 4AEJA 3FLPA 3WCRA 4AEDA 1S0IA 1H9PA 2NYYA 3LZZA 2CNAA 1V9U2 2VGDA 1DFQA 2R072 4H7MA 1MVQA 3W59A 5JI9A 2ZMNA 1MZEA 3H7JA 1HXS2 1H9WA 4XBQA 4DRRA 2VVFA 3WDYA 2Q4SA 3IKWA 4OHYA 1R1ZA 1PZ9A 4MZUA 1MQTB 4URTA 4GH4A 4HKWA 1CESA 5GJ6A 5KHHA 1PGL1 3AMPA 3AMNA 5GLWA 4XF1A 1ND3B 1MS3A 4AFMA 3RQ0A 3CEWA 1Q56A 2YPJA 3ZN6A 2ZGSA 4XQWA 2E7TA 3KT7A 1G9AA 3H3ZA 1BBT1 1RVF1 1AL22 2CGOA 3VBOA 1LGBA 4EN0A 4G4FA 1PZ8A 4I3PA 1HW5A 4FOWA 3VBHC 1CR7A 4QQHA 1RUD2 2XKOA 1DF0A 3WDUA 2WNUB 1V9U3 1XNBA 2R073 1UAIA 1VRH1 4FPHA 1HLCA 1HXS3 3G6JB 3J8F2 1R1A2 1MS8A 2GZWA 3VUOA 3M3CA 3MW2A 2RM21 4Q2FA 4DB5A 4N43B 4FAHA 1APNA 3H8UA 2ZMKA 3ASIA 2P3IA 5EYXA 1FMD1 1UD1A 2FZ2A 5DDJ3 2GNDA 1DQ1A 1GZWA 4AF9A 3AB0A 3VBRB 1RTVA 1AR71 3RJ2X 4Y20A 4JGYB 1AL23 1SCSA 4IV3A 1IGOA 3BIWE 5SV8A 2EXIA 4Y1VA 4COYA 4NHMA 1UIJA 1F5JA 3SITA 3VKMA 2NMNA 3H1MA 5FPXA 1NY72 4RD7A 3A4UA 3DPRA 3O5SA 2O0OA 1ZBE2 1RHI2 2BVVA 1EV13 1QQP1 5GLTA 4GB32 3L9JT 4QQOA 1JOJA 5C8WA 3J8F3 5LEJA 1N3PA 2P2KA 1R1A3 1DQ4A 1M06G 3FHIB 3WHUA 3V0BA 2IXHA 4PF5A 1G6NA 1TME2 3BODA 3MYXA 3GZTB 3MIHA 5C6CA 2ZOEB 1NCQC 2OA2A 3C2UA 4YVSC 2Y0OA 2VMGA 2D6OX 3WT3A 2JG9B 1OMIA 1BEV3 4AE2A 1EPZA 5FREA 1V9U1 2VECA 2R071 1J58A 1U5XA 1HXS1 1LULA 4I09A 4LO6B 5D8AB 1X33A 4BQ1A 5K9YA 1CGPA 3MFCA 1IKQA 2R042 1WD3A 3GYDA 1WD4A 4C1WA 4MH0E 3KGLA 1ZBE3 4M3CB 1RHI3 4U2AA 1YRZA 1YIPA 3PVNA 4GB33 1SLIA 4MYEA 4MGZE 2BBVA 2E53A 1RUE2 3MICA 3LA2A 3CJIC 4JGZA 4YVWB 2XJPA 4E9KA 4OI0A 4HKOA 3VKNA 2GMPA 3JD72 4HANA 1TME3 4WVVA 2ZZQA 1BYHA 2E6VA 2JEMA 2QKDA 4PDWC 1REDA 3ZSMA 2OZJA 1RUD1 3ZYPA 3NV2A 3THTA 4PBPA 1D4VB 5KBFA 4EWAA 3KD4A 3M3EA 2XL7A 1LODA 2NZ9A 3NKTA 5I0UA 4BA6A 2WINB 4HK8A 4Q0QA 1R1A1 4CDUA 1AXYA 3AMHA 2R043 3WINE 2ARXA 1XE8A 5DZGA 2UWCA 2W39A 1PO22 2BNOA 3R0RA 2VOKA 4Y22A 4PJYA 4AEDC 4Q4V1 1LR5A 2YY1A 1FX5A 2A71A 3DN7A 1RUE3 3GZUC 3NJZA 5A32A 3POSA 2ZMLA 4DNYA 4KWJA 1DIWA 2XJQA 4O9GA 3JD73 2PLV2 3VBHB 1ZZ8A 2QFEA 4NWVA 1FPN2 5JPMB 5JR7B 5FPZA 2XJRA 5GKAC 3TNQA 3BU7A 2R1DA 1O5UA 2ZKLA 1SLTA 5FO7B 4FPFA 3BALA 3AK0A 3PMSA 2TEPA 2WIIB 4U36A 1HKDA 2DTYA 3MW3A 4MUVA 1ZBE1 2P17A 1C8NA 1RHI1 4NVPA 2K2SA 1WLWA 3PVEA 3G7DA 2ZGMA 4YZ2A 3MZHA 4HVOA 4Y5Z0 3URFA 5C8CB 1PO23 2AR6A 3N7LA 1TME1 3AKSA 1LESA 4RGGA 2XLGA 1AVBA 1A78A 3L2YA 4CP0A 2CGPA 1S0FA 4IL7A 4XFHA 1PK6A 5C9AA 2CGNA 1ULEA 4IEOA 2XWJB 2ZGNA 4QM8A 2PLV3 4XZPA 5GALA 4YW5A 2ZX4A 1FPN3 2DVBA 4FPGA 1S0GA 4WVMB 3E6BA 4M0HA 2R041 3S7EA 1RUG1 1AYM2 1PZ7A 2PHWA 1CAWA 4NO4A 4XIKA 4BHPA 1G9BA 1RUE1 2AZ5A 4BCUA 1JBCA 2PHTA