3AMPA

E134c-cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
255
structure length
255
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVCIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
total genus 56
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ampA00
2BWAA 3AKPA 4S2GA 4HK9A 3LGRA 1W2UA 3VLBB 1KS5A 3VHPA 3ZSEA 3O7OA 1XYOA 1TE1B 1OA2A 2VUJA 2VULA 1H4GA 1REFA 3WP5A 2D98A 2QZ3A 1XYPA 2B46X 1IGOA 3VL8A 3WP4A 3EXUA 2JEMA 2D97A 4XQWA 1H0BA 5HXVA 1H4HA 2BW8A 2F6BA 1XNDA 1H1AA 1C5HA 3WT3A 4S2DA 1QH7A 1OLQA 1UU5A 2JICA 3WQ7A 3AMQA 3AMHA 3VGIA 3AKTA 4XPVA 1QH6A 1UU4A 3VL9A 1BK1A 2VG9A 1T6GC 2C1FA 3RI8A 1XNCA 2NQYA 2VGDA 4S2FA 4HKWA 4HKOA 3M4FA 4S2HA 3MFCA 4HK8A 3WX5A 1F5JA 1H8VA 4IXLA 3WP6A 2Z79A 1XNKA 1YNAA 3VZNA 1HV0A 4XQ4A 4NPRA 3AKRA 3VZMA 3WY6A 3AKSA 1M4WA 2DCYA 3VHNA 1OA4A 3AMNA 1UU6A 3AMMA 3VZJA 2QZ2A 3HD8B 3AMPA 3MF9A 1OLRA 3VZKA 5K7PA 1BCXA 3AKQA 2DCZA 1HIXA 2DCKA 3B7MA 4HKLA 5K9YA 2B45X 3B5LB 1REEA 1XNBA 2DFCA 1ENXA 3WR0A 5EJ3A 3MFAA 3WQ1A 3VHOA 1BVVA 2DCJA 3VZLA 3LB9A 2BWCA 1NLRA 1REDA 3MF6A 2NLRA 3WXPA 2DFBA 4H7MA 2B42B 1OA3A 1XXNA 3VZOA 4XQDA 1C5IA 1KS4A 3RI9A 2BVVA 3WQ0A 2JENA 3WP3A 1AXKA 1XYNA 1UKRA 1PVXA 1HV1A
chains in the Genus database with same CATH superfamily
2HWC2 4CEYB 4DEQA 3I2KA 1MS1A 1PVC2 2DVFA 2HWB1 3PHMA 3O0XA 1U0AA 1C8M1 2R063 5LK5A 5FAXA 3SKJE 3UJQA 1SEFA 3ETPA 3Q8FA 4E27A 4R4ZA 1CIYA 3JB8A 4LNVA 5A33A 2JG8A 4CPBA 5LB6A 1HRI3 3M3EA 3VLBB 1FV2A 1J3QA 1KS5A 3NWKA 1GOFA 4OMCA 1LOCA 4YZ2A 4NIHA 1XYOA 2B9VA 3QACA 1NKGA 5LA2A 1ENQA 4AFCA 2BV4A 3KV4A 1D4M1 3VDDB 4AAXA 1DP0A 3BU0A 5C9AC 1POV1 2WYFA 5FYMA 2UWAA 1OBNA 1RUF1 3NKGA 4FCAA 4NE9A 3RJRA 2RS11 2Y0OA 3TEWA 1F2NA 2GMMA 2C6SA 3ZSJA 5IWFA 4WVMA 2J1UA 5JVVA 5ABJB 3T0BA 5C3PA 4URTA 4S2DA 1DLLA 2QKDA 4DUWA 3ZXDA 2WRAA 3GF6A 4EZHA 1OFNA 4L99A 3O1SA 4LHLA 2W1WA 1UPSA 1G9AA 4BJ0A 3WEZA 4GKYA 3VBUC 4MGSA 5G04L 2PELA 3Q8BA 3WW4A 2RS52 4NRPA 5AC93 2NQYA 1US2A 4K1YA 1LGBA 4D7YA 1STMA 2YXSA 4QXKA 5FYCA 5FLJA 4NWVA 4OZXA 4CP1A 2RS13 5FK8A 5H9QA 2JDAA 1AL23 4RS5A 3FHQA 1ND2B 4A4AA 4CXYA 5T3NA 4CDQA 4DEVA 2RDQA 2XB6C 1RTVA 2EXKA 4NROA 4FPFA 3C7OA 3WNMA 1ZZ7A 4HBNA 5C8CC 4UT5A 4YVWA 3POGA 4AHYA 3ASIA 1OH4A 2VU9A 4UOJA 1JOBA 4NOTA 2XLFA 3NAPA 4Y5SA 3H7JA 1DYOA 2D7FA 5LCWL 2BRTA 2VZSA 3JZVA 1DGRN 4XC9A 4ZS2A 1RHI3 4JDOA 4AHZA 2BOJA 5FZCA 3BTAA 2CGOA 3CKHA 3ZYPA 5ABJC 3I2JA 3LIHA 4G9SB 5C8CA 4Q2FA 3PURA 4Q27A 1CPMA 3SEEA 4LHKA 1IKQA 3HT1A 4XMIA 1AL0G 4KU7A 5KBFA 5ANQA 4YZ5A 4PJYA 4OHXA 5FMDA 3S5QA 1PMIA 1DQ5A 3WV6A 1Q3EA 2ZGUA 4I0BA 4FTEA 2PHUA 2W39A 4AWDA 4RQPA 4LUMA 1SBEA 2OIIA 4LLOA 1B09A 4KWLA 1AX2A 1BBT2 2P34A 4MVTA 1BVP1 4N9HA 4RHV2 2K9ZA 2VW1A 1VAVA 4TYSA 1AR81 3UKVA 3FLTA 1NX9A 5EJZB 4COYA 2VCCA 4LLFA 3RI9A 2BVVA 2VOWA 3GCXA 4MGYE 2ZZJA 3DKQA 3CJIC 4XZUG 1RUF2 3LFIA 5KHIA 1O3RA 4P14A 1JXNA 1NT0A 2C0ZA 4M0HA 3E6CC 1YO8A 4JTOA 1LRHA 2VJXA 4OFGA 1F31A 4LO4B 3RMYA 2HWF3 3VKMA 2XMLA 4K20A 1ZA7A 2CDOA 3B9CA 3W20A 1W2UA 3AP6A 4N9IA 1X7NA 3WF0A 1RUE2 1OQ1A 1W9FA 1VPHA 3EMRA 1ZYBA 3ZSEA 3O7OA 5DUWA 1OA2A 2RS31 3O1UA 3BODA 3WP4A 4YM2A 4CA9A 1OSGA 2P2KA 1WW6A 2WAOA 2JG9A 1HRV2 2OA2A 1E5IA 1ULGA 2B5HA 5DAWA 2CAVA 3L9JT 5FMOS 2W3JA 2A3YA 2W1UA 4PI0A 2PN5A 3IPVB 4XQWA 5CFDC 5CKMA 4XFCA 4L0PA 5I91A 1N1SA 4P9YA 5SV5A 3WT3A 4EN8B 3AJYA 3R6SA 1HRV3 2CL2A 3HNBM 5FZ9A 4ZZ8A 4GAZA 5C4WB 3DPRB 1S0EA 5BYNA 5GZFA 2VW0A 3H8UA 4HSLA 4L97A 3IDEA 3D82A 5LBFA 3K77A 3AP5A 2ILMA 1L7RA 1C1FA 3KGZA 3POFA 4XE9A 1NE6A 3PUSA 5CFDA 4XF3A 1WMXA 1EAH1 5FP3A 4QX5A 1T6GC 2BGOA 2C1FA 2OPKA 1LTEA 3DXTA 1W6OA 2VGDA 3I2DA 5A6XA 5CADA 3PNAA 3O1VA 1G9DA 3HQXA 1F15A 1DHKB 1UNBA 2E32A 2G4IA 1D7PM 2PQQA 4S2HA 5GLTA 4ASKA 2EF6A 3DF0A 3C3VA 4FQZA 5FP4A 1W2TA 3W58A 1FXZA 2DU0A 2HWB3 1QJY2 3OYWB 5SV8A 5JSPA 2TBVA 3CBNA 3WVJA 3N4MA 3JBG2 4LKDA 5DZFA 1FMD2 4Q0UA 1UYXA 3RZKA 1QJEA 4Q0VA 4PF5A 3UJOA 2QQIA 1ZRDA 2B9UA 5CYYA 3OGGA 5BY5A 1WWYA 1OUXA 3RZJA 3ZLIA 2VZPA 5FKBA 5EHDA 3GZTB 4W8JA 2JJ6A 3VBFA 1NQJA 1G9FA 3LOIA 3ZYJB 3U10A 3ORJA 4CDXA 5K9YA 2B45X 3VBSA 1RIRA 3CMGA 3R05A 3ZIWA 1OF3A 4CUCA 1MACA 2P4EA 5DZEA 3V65A 1F5FA 1VRH3 1EUUA 3KS7A 3I59B 3POYA 5HCAA 1IOAA 5L36A 3VKFC 5I0UA 1RUI1 4MHRA 3SHRA 1I3HA 2RG4A 3MPPG 2XBO1 3KMHA 2F17A 2Y38A 3D0SA 4XBQA 5L73A 2FDKA 2RM22 1H1IA 1TVGA 4IV1C 4FO9A 1KEXA 2IVIB 3MHZA 4LBOA 3FFQA 5IW0A 4JTNA 1F35A 2R042 4YVSA 4PIXA 2CV6A 1TMF1 1GQGA 1JOJA 1XB9A 4N53B 1WLTA 3UGFA 2FHRA 1OURA 3OYWA 4NWWA 3GBWA 2AGSA 4QU2A 5LA0A 4DY5A 3J8F1 2CWSA 1V9U2 4J6GA 1PX4A 4LBQA 3VDCA 4CUGA 4Y4RA 1HLCA 4FOQA 3OEAA 3LDKA 4SLIA 2W95A 1JOPA 3ZXKA 1R083 1XSQA 2VZOA 4XF1A 1NY72 2ZGKA 3ES1A 3BTXA 3KQRA 1C1LA 2EICA 3J4UH 2GALA 4FI9A 4UFKA 1OOPB 3I97A 4B7EA 4E8DA 1MEC3 2D98A 3HN1A 4RN5A 2WT1A 3VL8A 2BFUS 4LBQD 4D7TA 3LEIA 4QB1A 1JZ8A 4Z8BA 2D97A 1S2EA 5FPXA 2OUHA 4FPKA 5DABA 2DUPA 2YU2A 1H1AA 5F37A 5J98B 2R49A 4QKBA 5KHJA 2ETEA 1ZZ6A 3WQ7A 1S0CA 5M0TA 5BNPB 4ASLA 2X29A 4JKMA 2IZWA 4N7UA 5FP9A 5FO8B 4HL0A 2GMPA 1UU4A 5HBAA 4WVVA 1IG0A 1BK1A 1WBFA 4JKLA 5AFBA 2PMWB 2XPJA 1QDCA 1ND2C 1YUDA 1FT9A 4PQQA 5IFPA 1W8OA 1EPZA 2XJQA 2WUHA 4YFZA 5IVJA 1AX1A 1CJDA 3SH3A 2UYAA 5F6LB 1K3IA 3WHUA 2HWF2 1HDKA 4GWIA 1HQLA 4NPRA 1I5PA 4LBLA 3SQOA 1AR91 2Y8KA 5DPNA 4GWNA 1DYKA 5CU1A 5J36A 2OKXA 2A6WA 1ZBA2 4LA3A 4Z82A 4JGYA 1J1TA 1DCSA 3MW2A 1MZ6A 4GALA 4XFAA 3KM5A 4MXVA 4XW3A 5FY5A 3ZKUA 2R0FA 3ZM8A 4BMBA 4DY3A 2CHHA 4EE2A 4F3JA 5JSRA 4RS5C 2TUNA 1UY4A 4XTMA 3VDDA 3EBRA 2YGLA 1NAEA 2RMU1 5GJ6A 1UF2C 4OLLA 1A8MA 4TLGA 4RSUA 1YHFA 3THTA 4Q29A 2VAUA 4Q4X2 1SBDA 1QXRA 4JGYC 4A45A 5JPMB 3RZGA 1OMIA 2VBBA 3OB8A 5F3IA 3UGHA 1S0BA 3SC7X 2XL7A 5HV4A 2D6MA 1QNWA 1TMF2 4C0BA 4CDWB 3DYOA 1R081 1W6MA 3LZZA 4DO0A 2CSGA 1BVVA 2DCJA 2VD7A 1PK6A 4QB2A 5FIXA 1VRBA 1FNZA 1X8MA 3HMYA 3OBAA 3SCGA 2XKOA 3HJRA 1W2NA 3BPSA 1C8M2 2B42B 2D40A 4ISQA 3ZYIB 2PLV3 2XVGA 2PYTA 4IETA 1BKZA 1IS4A 4G3YC 4IE0A 3KB5A 2OS2A 4N43B 3KF5A 1O6UA 3IM0A 2YHJA 3WP3A 3JUUA 4LIVA 1BMV2 1FYUA 1P8JA 5LA9A 1W03A 3LA3A 2PHFA 2OQ6A 4AVBA 2XJTA 3BI3A 2R043 1AYM3 2PFWA 2YZ4A 4DS0A 3HT2A 2C9KA 1RUJ3 2RR11 4FP3A 4QHZA 2WNVC 1RUOA 3KF3A 1RUC2 4LJHA 4O7XA 5CB7A 4QDRA 5A3TA 4LKFA 2ZHLA 1S0JA 3BGAA 5EP9A 5A3UA 1PM7A 3ZMOA 3NO8A 4BPZA 1PO21 5JOXA 5FZ8A 3N7JA 1GWKA 1NA1A 4ZZ5A 3HPNA 2Y33A 4JHTA 2WZ8A 4L2NA 4BM8A 4DUXA 3KT7A 1JS9A 1Y9GA 3OJBA 2A70A 2W5FA 3PJQA 4PCRA 1XRUA 4O61A 1VRH2 3MUY1 4Y26A 4MGQA 2VUCA 4XJ9A 3DPRC 4Y1YA 1C8NA 1GOHA 2DTWA 2ZJCA 3E1F1 4FTSA 1K5JA 2WT0A 3PUHA 4Q8LA 5JIUA 1EUTA 1QKQA 5FYHA 4ZU4A 3O1PA 4L9BA 4YW3A 4FFGA 2AEYA 4NRQA 3RZZA 3WDVA 1D2SA 1H6YA 1PK6B 1YFUA 5GLVA 1NE4A 5FYZA 3W5NA 5F5CA 2VMGA 4IEQA 1FX5A 1ENRA 1UL9A 3ZPYA 1W9SA 2DVDA 2GN3A 4LORA 2LALA 4IV3B 2WZR2 3BU7A 3CQOA 4P9WA 2BERA 3U78A 1Q43A 3W59A 2F4PA 4K8RB 4LO7A 1OLMA 3JQWA 4BLJA 4HZFA 1DZQA 1W28A 4CE8A 3RZLA 1AYN1 1AR72 1IS3A 4QDSA 3RZHA 3WX5A 2VZTA 4QDQA 2YBPA 1DDLA 5EFUA 1W8ZA 4HN1A 5FYIA 1RUH1 2VC9A 3NSTA 1G9BA 2OT7A 2VNVA 2D6KA 2YPJA 1HJGA 2YYOA 4C1XA 3O1RA 3T0DA 5C9AA 1CAVA 5JMOA 1N1YA 2VVEA 1LGNA 4F8AA 1UN1A 4QM8A 5LASA 4FXGB 4D7SA 4RYDA 5KHKA 5FUNA 2XUMA 5A70A 1QF3A 1RUJ2 3NNMA 3QH7A 1R1A2 2IXCA 5LBBA 2E26A 5FBZA 5AC92 3U4XA 3WNKA 4Q4V2 3WD5A 2VXJA 4MUVA 5IFTA 4TTGA 4QX1A 2HWD3 3OUJA 4LOTA 3TAYA 4B4RA 4KG0A 2D3PA 2I45A 3M3CA 1JYVA 5F3GA 4JGZC 2VMDA 4TWTA 2PTMA 5FOBB 3A0KA 2R16A 2WIIB 1PGW1 5DXDA 1A8DA 3OSDA 4NRMA 3VBUB 3S0MA 3INAA 5HI0A 4LE4A 3KZ4C 3P1IA 2FZ2A 1QEXA 3MIGA 3VZLA 5FUIA 1GZ9A 1OOPA 5FXVA 4AAPA 1KFUL 4HMZA 4YG3A 3JD73 2E7QA 2R1BA 2XR4A 3PVOA 4KBZA 2MNGA 4BQ2A 2CYFA 3PMEA 4E4HA 5GLZA 1UZ0A 2P5BA 1ZBE1 1LOFA 2ZHNA 4YGCA 2VECA 4P5YA 3U37A 4EWAA 3S57A 2E63A 1GWMA 4MGKE 1NCRC 3MO4A 3KVAA 1XYNA 2X05A 4Y22B 3Q8EA 3VDDC 4EQVA 1VJ2A 2RS32 3RYRA 1S0FA 3H1YA 4OULA 4QKDA 1R64A 3BPZA 2R32A 4YZ1A 3F95A 1TME2 4JAAA 1RUJ1 3GJBA 4HSJA 4XMAA 4QKFA 3AJZA 1QWRA 1W9TA 2QFEA 2XONA 2A3XA 5TSWA 4CPBD 3O5SA 4Q4Y3 3WG2A 4BQ3A 3H0OA 3TWIA 5F5IA 5HPOA 1K5MA 4A41A 5I0SA 1JZ6A 1U5ZA 1WD3A 3R0RA 4Y3OA 4QKNA 1R1A1 3K75B 2JDUA 4DQAA 1F4HA 4KL1A 4XUNA 2B46X 1AL22 1IGOA 5EXOA 1Y9QA 3DECA 4IEOA 5LRSA 4YW5A 1RINA 1HRI1 3WF2A 1GP6A 4I02A 3AVSA 1DQ0A 2VMCA 1WLCA 2HH9A 2RJLA 5BNPC 2YFUA 5JI7A 3WG4A 2J1TA 2HKXA 5A6ZA 1XE7A 5FY4A 4QX2A 4BIFA 4R52A 5HCFA 2NMNA 1DLCA 2ZMNA 1HN0A 5AC91 1AR61 2PAEA 4DB5A 1NA1B 4Q4W2 5D21A 3WQBA 3AX4A 1LR5A 1ZVFA 5C8CB 3I8TA 2HBTA 2WZPP 5CFCC 2VCAA 4Q4W3 1PO11 2D6LX 2JDPA 4RQPC 4F7ZA 4FPEA 5E88A 3BKZA 3GZAA 2R041 5KXDA 2XWBB 3OOXA 2BUKA 1Y43B 2VBDA 1LOGA 4LBQB 4ET7A 3D8CA 3GGLA 2B39A 1WBLA 3GCWA 4Y1ZA 3A23A 1HB2A 1O5LA 5FMCA 1FI2A 4RGGA 5EPAA 4KBBA 2WAAA 1H1MA 3PUIA 3V0AA 3WHTA 1RUNA 2YPDA 3B93A 4B4QA 3PVEA 4V2WA 5LY2A 4KWJA 2WSVA 5F2SA 2RS51 4OHWA 5FJKA 5GZDA 1LODA 4A7KA 3F2ZA 2BNMA 3OUIA 4D3WA 5J48A 2ZS6B 1AYM1 1Y9MA 5LEJA 2VOVA 3AYEA 1HQWA 1GZCA 5FRAA 5C4WC 2C9AA 5E89A 4LKEA 1UPIA 2YC2A 1UKGA 4BXFA 4E4SA 2AZ5A 2YBSA 5J37A 3AYAA 4E2QA 3LAGA 1DFQA 1N1VA 2WL1A 3M70A 4CUAA 1J3PA 4B1LA 1NA1C 4CP9A 4LR4A 1WW4A 2ZBJA 4XETA 2OX0A 1E5HA 2HWD2 4LITA 4XF9A 1RUC3 5G05L 4JHZA 5A7SA 5A7WA 4PLNA 1A34A 4FT8A 5IVFA 4YG6A 4BH9A 2WNEA 4LOSA 4UBHA 3AXDA 2IXKA 1HXS1 4QX8A 4AG4A 3VDBA 2WWSA 5FO7B 1TME1 2V09A 3G6JB 3PDQA 5AVAA 3VDAA 3HWJA 4YM3A 4PI2A 4A44A 4KG8A 5GM0A 3B02A 5KXCA 2BTVC 4XQDA 1W2OA 1V6JA 1DF0A 4EN9B 3V0BB 1W6NA 4ITCA 4IUGA 1KJLA 1N1TA 1OT5A 5FPAA 4BISA 5I93A 1WZXA 4Y20A 2VMFA 4FPHA 5FZIA 4LULA 5JOWA 1CPNA 4CEWB 1AR93 5JR2A 4JC1A 4N90A 4KH9A 2RMU3 4R9DA 1TNRA 4MXWA 3U0ZA 3H9AA 1UIKA 4MV2A 4PLMA 4XABA 3IDCB 1W99A 1HXS3 2A6ZA 3GXUA 4JGZA 2W9XA 4ZS3A 1CVNA 4BE3A 4AGGA 3UL2A 3WUDA 1COV2 3CZJA 4R9CA 3OY8A 3VHPA 4NIGA 3M3OA 2VULA 4K6BA 1CAXB 3I2HA 3USSA 4Q0QA 3VKOA 4N53A 2I2SA 2ZKLA 1BEV3 4LBKA 1AX0A 1Q8SA 3A7QA 4Z92B 5A80A 3VV1A 3LF7A 1S1AA 1V6KA 4QMAA 5HXVA 1SMVA 1HN1A 2JWPA 3TYJA 1PMHX 1ASJ3 2FCVA 3RNSA 1COV1 4RR3A 2PAKA 3WDUA 3AFKA 4RGKA 4FBFA 1TQ5A 3NNGA 1UY3A 4AE2A 4MG2A 1OXCA 2N7GA 2NZ9A 3I2OA 4BQYA 1RJ8A 1DGWA 1PIV2 3M7AA 3UYJA 4Q8KA 3KSCA 5LY1A 3GJAA 4GD4A 3PTYA 1SDWA 1APNA 3VBSB 4QPYA 5JPNB 1GFF2 4QXHA 4XXPA 5A3NA 1LULA 5C3QA 1W6PB 4XFIA 4Q0SA 4URAA 2R1DA 3PVBB 3RZMA 2IVJA 3M4FA 5J96B 1GR3A 3FX3A 2P6CA 3ZYGA 4ORFA 2R0HA 2RDRA 1J83A 1O7FA 4UFMA 3VZNA 1LEDA 3ACHA 4P08A 2GSYA 5K0UA 2IXIA 1AYN2 5A1AA 1U5XA 1I9RA 2BZDA 5FQ0A 3AZYA 3VZJA 5JWPA 5CEHA 3KCXA 3KQ4B 2R6QA 4DRRA 3MF9A 2BFUL 4FVVA 4AEDC 1WCQA 4WZCA 4BHPA 2W92A 4QQPA 4BQ4A 3VD4A 3ZYHA 2LM3A 5I0TA 4D6SA 2DCKA 1VBB2 4HKLA 2JDZA 2GU9A 4EWDA 5JOYA 3AC0A 2RDNA 2FBEA 1JYIA 1W6OB 3OBZA 5DUUA 1ULOA 2DFCA 4R9BA 4NMIA 4LBJA 1UOFA 2ADDA 5FLIA 3OBRA 2VTFA 4K7JA 3NJZA 1CONA 1O4ZA 1RC6A 3K4AA 3PU3A 3WDYA 4IE7A 3FLRA 4XFHA 1RUE3 1LECA 4BDVB 4AFMA 5L9RA 3O1MA 4XHBA 3MF6A 1QGLA 3ZYBA 4CRQA 3MBWA 3ZXAC 4MOAA 4MGZE 3ZDVA 2D43A 2WQ8A 2SLIA 4V1PA 4AZZA 4MGTA 2GN7A 2CTVA 4KGGA 3HNYM 4A3ZA 3GZUC 2NM1A 3O0WA 3AYCA 3TBDA 5D2AA 2J1EA 2JX9A 4YSFA 5C70A 2WFF3 1PGL1 3KD4A 4Z2AA 3AP7A 2BQPA 1RHI2 1HV1A 1LCLA 1O4TA 4GMP1 4CDQB 4ATFA 1ND3A 2J7MA 4RS5B 3V56A 1HB1A 4IW3A 1UCXA 2ZOEB 3TOJA 2WJSA 5ERLA 5DAQA 2RS53 2XJPA 3MIFA 4JVAA 4AI2A 4HK9A 3LGRA 4A2UA 1FAYA 2ZEWA 1TZOA 5FZ7A 3VD7A 4CUBA 2WT2A 3CDZB 1YIFA 3WLUA 2VOTA 4JGYB 5I0RA 3DL3A 1KQRA 2H0BA 2Q4SA 1R1ZA 1W9WA 2ZGLA 3T08A 4B1MA 1W6NB 1IKPA 2NYYA 4OVEA 3T4HB 3EXUA 4AHXA 2ARCA 4MLOA 4O9EA 1W8WA 4YNIA 5KWRA 1MQTA 1LU2A 5T55A 1H4HA 1G7YA 4EWEA 1WW7A 1OKOA 2I74A 2VZRA 3T30A 5L19A 5JR7B 5F3EA 3M8LA 4E2SA 2Q8EA 5GZGA 3VUOA 2JICA 1FOD2 2GNMA 1XSRA 1WCDJ 1QJX3 2GH2A 3NV3A 3BIWE 4FPCA 1RUG1 2DU1A 2DYCA 3ZR6A 1XJAA 1XOYA 1KDKA 2VG9A 4QGLA 2NN8A 4N43C 5E8AA 1BXHA 4OQ9A 3SNMA 3TNQA 1ZBA1 2JG8B 1YC61 2Y6LA 4OYUA 2D5HA 5C5UA 1RHI1 3PVNA 2FZ1A 3ZSMA 3P3PA 3D6EA 2XLAA 1PZ8A 2L9LA 2YC4A 4IEUA 4XAEA 2O1QA 5GLWA 4D6QA 3FL7A 1UAIA 3AKRA 4UYBA 3HEIA 3WDWA 1O4YA 2FDJA 4AGVA 4AVSA 4Y33A 4AOCA 5I8YA 2A3WA 4UF0B 2ZEXA 2YV8A 2HEWF 2RJKA 3ZPOA 3GHMA 2VR4A 4QXCA 5IHRA 1HB3A 2ES3A 1W3VA 2W91A 4C1WA 3KLSA 2FCUA 3H8XA 2HWF1 4M0NA 3UNPA 3LSDA 2VMIA 3GNEA 4COVA 1MZEA 4EN7B 1Q8QA 4XYXA 3RRDA 4RD7A 1H9PA 2NP0A 2DDUA 2FMYA 2OUJA 4TLFA 3NRUA 1NCQB 3DKWA 1PM4A 5EJ3A 3IZOA 3CL1A 3SLIA 4AVCA 4B7KA 4Q1PA 1UOGA 2O8QA 1VBA3 2R072 2UY9A 4RHV1 1QOOA 2GC0A 2CY6A 1VMHA 3WCSA 1UXXX 3ZFEB 4DUVA 3WNNA 5C4WA 4EZ4A 1MR5A 1WCSA 5FXXA 3DPRA 5KXBA 5CIRA 2HYKA 2KA3A 5K0UC 1TNFA 1PGSA 4R4XA 2ZAHA 1J58A 1ONAA 1C57A 1LB2A 1NXD1 4UAPA 1BLZA 1RXFA 4NHMA 4XCBA 2SBAA 4TZDA 3HN3A 1WUVA 1DBNA 4DINB 1QMJA 5FBJA 1QJY1 4I2OA 1HJFA 2GC1A 5A7OA 4AEKA 4W6YA 1KDMA 1RJ7A 3SISA 2GC2A 3IAPA 3WDTA 3I3BA 4KU8A 4AEDA 2V72A 4IEVA 3AP4A 2VMEA 1YRZA 5FZDA 1AL21 1W9YA 4A7ZA 3FUQA 2EIBA 2VCMA 3I3QA 2CGNA 4YVSC 2OYZA 1UIJA 4C0HA 5JXIA 5FYBA 1DYPA 1LJ7A 3DEMA 1DZRA 5KXEA 4KWKA 2XJRA 2BBAA 5A3LA 1JYTA 4BK5A 2JDKA 3ALQA 4LHSA 4QPWA 5IVBA 3PLQA 2GDFA 1FOD1 1O8SA 1R092 1D2QA 2EIEA 2ARAA 1OKQA 3ZFFA 1Z7S3 4BXSV 5GLUA 5FR3A 2ID4A 1ZRRA 1JODA 1NCQA 1K12A 1JU3A 3JBG3 4GZ9A 3MZHA 4AQ2A 4DXTA 1J59A 1YWKA 3C7EA 4X8PA 1WA6X 3NQHA 5F2WA 1ND3B 4FSJA 1ND2A 3K51A 4Z07A 1O59A 2GAUA 1ZBA3 2EALA 5LBEA 1CZSA 3I59A 5KR7A 1XC6A 4OQ8A 2VM9A 2FDFA 4QGMA 5FZBA 1CX4A 3AVRA 2HYXA 4H2AA 4HETA 1VBD1 3VKLA 3WW3A 3CF6E 1RUG3 4HONA 2CGPA 3CZUA 3NMBA 1NCRB 5A3OA 2WFF2 4BU2A 4DPNA 3H1WA 1IHMA 4CXXA 1UQXA 1WA4A 3VHRA 2VCBA 2VW2A 2BP6A 5C71A 3E6DA 3FUOA 3EQEA 5I8SA 3ZN6B 3O14A 5FZKA 4IXLA 3MPBA 2ZGMA 1MS0A 2XHKA 2Z79A 5FYVA 4ZXKA 1K5MC 2WS92 4C90A 2E33A 4EN6B 1J84A 5L9BA 4XDQA 4M3CE 2DCYA 4HG6B 4H3WA 2G19A 2YBKA 3OY8B 2EXIA 1QHDA 3OUHA 3H3LA 2HWE1 2GNTA 2WZR1 2QTWB 3M1HA 1OFSA 4BMEA 4IEPA 4DXSA 3N9LA 5KC6A 1ASJ1 3KWVA 5H9RA 1LHVA 1ND3C 1HXS2 5FKCA 5JSOA 2Q1MA 4AGRA 3MIHA 3RVHA 3ITQA 3LEKA 4IV3A 5FP7A 1GSLA 1RUH2 2XVKA 2VQAA 1VB4A 2WLPA 5LZ6A 1JZ2A 5CG9A 4CCMA 1YQ5A 1VBE2 1LOAA 3AM2A 3PIGA 3RQ0A 4KNCA 4Q4X3 2BNNA 2XH6A 1YEWA 1PO23 3POWA 4WM7B 3ZDSA 2EA7A 2J22A 2VQTA 5FZAA 4BQWA 4GJZA 5J1XA 4EROA 2E7TA 3CEWA 2XDVA 3CJXA 3N7MA 4MH0E 3VHOA 2R061 2QQNA 2ZGNA 2CDPA 5F1RA 4YARA 4QWNA 5FZ6A 3IDAA 1F8VA 1R091 4GULA 5DAPA 1BK0A 4NPLA 1QOTA 1C28A 4PDWB 5BNPA 1JZ7A 4H7MA 4FPOB 1H8TB 2I07B 1ZRIA 2E9QA 3CNAA 2JE8A 4J1XA 5FJHA 4UFJA 1XXNA 4K9SA 3VZOA 3S7EA 1IPKA 4XUTA 2ZXQA 1EY2A 4ATEA 3SCHA 2BDRA 3WQ0A 1GBGA 1VP6A 2Q1ZB 2WBKA 3VBFB 4AEMA 3K2OA 4XACA 4YGBA 3T4VA 3I2IA 3MIBA 5FV3A 4BOWA 2RV9A 1BMV1 4OUEA 1RUE1 2E51A 3UT0A 2B7YA 4NUBA 2F4LA 3W21A 1SLLA 1AR82 1W8TA 5T5LA 2YC0A 2WINB 3WW2A 1JZ4A 1SPPB 2BNOA 1GNZA 2VUJA 2R30A 1YI9A 3OGVA 4GXLA 4X6RB 5FLHA 1FNYA 4YW7A 3OGSA 3OF1A 1MPXA 1RMU2 1E57A 4C8DA 4P02B 4HOOA 1X82A 3ACIA 2F6BA 1XNDA 4XFGA 1UY2A 4GA9A 4N8MA 1LEMA 1N3PA 2TEPA 2WWUA 1RVF1 5FYYA 1IQAA 4MXWB 2WSUA 4N7IA 5FY1A 4CXWA 3KHCA 1OD5A 3FMGA 4E4DX 1VBE3 3K4DA 3TEYA 4ES9A 3Q8AA 4CDWA 1BEV1 1GOGA 4PIZA 4QAWA 2W2IA 3AKTA 3ME2A 1O3TA 5DG1A 2IC1A 2ZGOA 2JE9A 2XXZA 4XUOA 3GALA 4TSVA 3AB0A 5C8WA 3VD5A 4UW5A 1X8EA 1QQP3 4NIIA 1CAUA 3OD0A 5F7UA 5DQ0A 4YVWC 3OPWA 4JQRA 4NO4A 1JU4A 5B4NA 3UKNA 2WQZC 1H8VA 3LPGA 5CBLA 3OPTA 5F3CA 3BOPA 5B4XA 5A7WB 1SFNA 4YW1A 2ZEYA 4GMP3 5FDBA 2OXBA 2Y34A 4ONUA 4AFDA 5CG8A 3H50A 4K3UA 1AJOA 2X10A 1H30A 1MS9A 3MI8A 3MW3A 1K5MB 1YJLA 4HVRA 4IGQA 4AFAA 1XE8A 3RSJA 1WMEA 4LBNA 4NR1A 5FYUA 3G7DA 5FCCA 3D5OA 3HNMA 1LU1A 3RGBA 1UO9A 4JDNA 2Q30A 3UGGA 4CCOA 3WG3A 3JCIA 1VIWB 2EXHA 2GH8A 1IZ3A 1JTZX 2ZKNA 4Y20B 4CCDA 3U75A 4AI1A 4ISRA 4MX3A 1KD7A 2BVBA 2BGPA 1U5IA 1W39A 2QQMA 3H3UA 4CCNA 4IDZA 1MS5A 4NHKA 2ZABA 3MEPA 4A3XA 4Q4V1 1S4CA 2JDMA 1CZVA 2AC1A 4YW2A 3ZSLA 4KI5M 2ZX2A 2D3SA 3EO6A 3CIHA 4Q4Y2 1NOVA 1D4M2 3NV2A 3LFMA 1HQNA 2JIGA 1REDA 4GWJA 1US3A 3GBFA 3T0AA 3VD3A 5BNOB 1CGPA 3J7HA 5FY9A 2R062 4D69A 1KRIA 1CJPA 5LA1A 3CU7A 5CFDB 5IAXA 2ZX4A 1RUI3 3PMSA 4XTPA 4RA0A 3TN93 4Q0PA 3I7DA 1PMJX 5CZKA 5LATA 2ZHKA 5DMYA 1OOPC 1W2AX 2JDHA 5JCTA 2WKKA 1G9CA 1UZZA 2Z42A 2AEZA 2EXJA 4XF0A 4UW3A 2FDIA 1DQ1A 2WO3A 1ZRFA 1QJU1 2BWAA 2MEV1 2QUOA 5FXWA 1WMFA 4BLIA 2WZR3 3JU9A 5JAXA 2BPA2 1JHJA 1QY4A 1LHNA 2ZX0A 1QQP1 2A73B 3C7FA 3PU8A 4UFHA 1I6XA 1QJY3 2EVXA 1RL3A 3DYMA 3VB9A 3UK9A 1AR63 2Q8DA 4AF9A 3J8F2 4NAMA 2G1MA 4IEWA 5BV6A 2A6XA 2DTYA 4CEYA 2MPFA 5FQ0B 1UYPA 1HW5A 3T09A 4AHWA 4QU1A 1HRI2 1O3SA 4FQ4A 1RXGA 1BYHA 2WA3A 1XNTA 2PHTA 4OI4A 1IPSA 4NHLA 1MVQA 3B00A 5EJ1B 3IMNA 3POSA 4LBMA 4BQ1A 5A1LA 1V9U3 4O65A 5IK4A 2Z69A 1QH6A 2PXJA 4UXAA 4CCLA 5JLVA 1S0DA 3DN7A 3IKWA 4P5HA 2YMZA 3PTRB 1EYBA 5BXXA 1MS3A 2IXHA 2JD9A 2FQPA 2BOIA 2VZQA 3LPFA 3MLKA 4YZ3A 3S30A 5L7OC 1GMMA 2QNKA 1KGYA 3H7YA 4JQTA 4I3GA 4WV8A 4YLZA 3THPA 4AQTA 1YI7A 4CU6A 1UY0A 1CX1A 4WM7A 4AEDB 5CKNA 4U2AA 3TEZA 3UETA 5EWSA 3WP6A 1W6QB 2JECA 2PHDA 5IT6A 1IS5A 1ENSA 2EIDA 2Y0IA 1NZCA 1VBB1 2H0VA 3R4DB 4IERA 2ZGTA 3E6BA 4QPIC 4TXWA 4LIUA 5FPZA 1SHWB 1FOD3 4UI9L 3A21A 1V70A 3LEMA 4CP9B 5FZMA 5I0DA 3SXWA 2ZPXA 3L2YA 1V6NA 5IVYA 2P6HA 1YCIA 4ARYA 1DQ2A 3LDBA 4HN0A 4Q4Y1 5A1FA 1CN1A 3T2OA 2D5FA 1OHFA 1QJZA 2QJVA 3EHKA 3JD71 5A32A 1RUF3 3SKVA 4CDUA 4XBNA 3EB7A 2BEOA 5LRRA 5BNQA 3ZO0B 5E1RA 1ZA4A 2XVLA 3POEA 2OZJA 3AP9A 3L2HA 4QB6A 1PX3A 1REEA 4HPKA 3KT4A 2Q8OA 1W6PA 4QQ2A 1AR92 5F39A 4N43A 4COUA 1VBD3 3GDBA 3LKJA 3IMMA 1R1A3 1K42A 5EZWA 3ZN5A 1XNAA 3SMHA 3I3DA 4XJAA 1UMIA 1AR83 4FOVA 5EIYB 2C5DA 1PVC3 1H8TC 4BQXA 1NCRA 4D6RA 1PIV1 3LB9A 4X6QB 1VBC2 3H8RA 1W8UA 4CDQC 1X50A 2R073 5FZLA 4P9JA 4UWDA 2WNVB 5C5TA 3BALA 2YY1A 1YFYA 1ZREA 1JBCA 1UOBA 1POV3 3O12A 3ILNA 3SH4A 4M01A 2VZVA 3WDXA 3BVCA 3ZIXA 2VE1A 5C33A 2WNUC 3PL0A 5JOZA 1AXKA 1GU3A 3LE0A 4P9IA 2BYVE 4XUPA 5LW9A 2D93A 4FPJA 3LDRA 2W87A 1CESA 5B2GB 2AYHA 4ZHNA 1S0IA 1SZBA 1UOJA 2P3KA 3WNLA 2RR13 3ZYRA 3AKPA 5FFOC 2WO2A 3X29B 4CZSA 3Q9OA 1EP0A 2GZWA 4E8CA 2FCTA 4YM0A 4AW7A 1VBA1 3LD8A 1V6OA 4CTEA 2DVBA 4B3NA 4DOUA 2JKXA 2C4XA 3ELNA 3BTZA 3WNOA 5A6QA 2UYBA 1OF4A 2E7AA 2GP5A 5ACA2 4EV0A 3B01A 5DDJ1 2ZMKA 3SEPA 5BUVA 3RFRA 1LESA 1RB8G 5T54A 3MUZ1 3ROUA 5J3UA 2HWD1 2K46A 2JG8C 3P5BA 1G6NA 3NL1A 1RMU1 4BB3A 1HRV1 2W47A 3ATGA 5K0UB 1CZTA 3ST7A 4Y22A 2A6YA 1NXMA 1OLQA 1UU5A 1Y4WA 4PHZA 1A3KA 1Z7S1 3ILRA 3VBRC 5IK5A 1GZWA 3VGIA 1Y3TA 5J09A 5JXJA 1QNYA 4NHYA 4CU7A 1AYM2 3CJIA 2VL4A 4QX0A 1HX6A 4HLTA 4QXBA 1BEV2 5F8PA 2JB4A 3WCRA 5JDBA 4MGIE 4SBVA 3BCWA 3K4ZA 4LEJA 3RS6A 1GUIA 4F83A 4HKWA 4HKOA 4D94A 3MFCA 1LOEA 3I4IA 4HK8A 4WM8A 3ZFGB 4ZU5A 1F5JA 4R8HA 3ZMNA 3B69A 3V0BA 5CAZA 3TB0A 1TG7A 2ZGRA 3ZFEA 4QPGC 1SCSA 2IFRA 1D4VB 2X5IC 3ZFFC 1M4WA 1W3XA 2GNDA 3POBA 1OA4A 2W94A 3AMNA 1UU6A 3AMMA 3QD6A 5GZCA 5JMCA 4BA6A 3USUA 5D1IA 5BNOA 4XJZA 2V5DA 4Q5OA 1UD1A 5FMOL 4XIKA 3AMPA 3WOGA 1JYXA 1ASJ2 2RR12 4WM8C 3VD9A 1ACCA 1QXJA 3UV9A 1DGRA 4UW4A 4HXCA 4Y5Z0 4YG0A 2UWBA 1RUI2 3ZFEC 2W46A 1ST8A 1IG3A 2DCZA 2A1XA 1HIXA 3ZVXA 2P3YA 2ADEA 2XBO2 2LRPA 1TEIA 3IT8A 2AACA 2LW8A 4RHV3 2C26A 4QQOA 2D44A 4QX7A 4DXZA 4UW6A 1ENXA 1WD4A 3NAPC 4XDOA 2DUOA 2WWJA 3MLLA 2UWCA 1JYNA 1ZZ8A 1JHNA 1PNGA 3C7HA 1DU3D 3TEXA 2J1AA 1SLCA 4GH4C 3ENRA 3U1XA 3J7MA 2R071 2Y6KA 3K48A 4AVVA 1NY71 3E5UA 1XQNA 1H2KA 3V0AB 3NW4A 2ET1A 4LA2A 2EAKA 3IAQA 5JZGC 4Y24A 3N9PA 4YGEA 4M3CA 2PLV1 4NPMA 2A75A 1Q8OA 3U4SA 4FTBA 4XJ8A 1PK6C 4NIAA 5C3OA 1E5RA 1UKRA 2XJVA 4OMDA 5FOJB 2JB8A 4PIYA 2EIGA 3N9OA 5T50A 1RUD1 5ACA1 5EYXA 2HLEA 2OPWA 3USUB 1ZZ9A 1EPWA 5FY8A 1S0GA 1F4AA 1EV12 3N36A 4NIDA 4PLOA 2Z2SB 4COZA 1W8FA 2ORXA 2W1QA 5FZOB 5IVVA 2PHWA 4P9XA 4CYDA 3KCYA 1FV3A 1AXZA 2HEYF 1S2BA 5FZ4A 3RWKX 2VTXJ 1UX6A 5BPXA 4ASMB 4QD2A 4R9AA 1GQPA 3RMXA 5IK8A 3RG0A 3ZOIA 3RDIA 1RGSA 4OUMA 4Y1UA 5F6KA 2PAMA 1QJX1 3V64A 4EJRA 1HKDA 4QQHA 4AFBA 3FHIB 2YB7A 2IXLA 3U14A 4M00A 3ACGA 1OI6A 2OW4A 1VE0A 3BYWA 3DGTA 4GH4B 3VBHA 3N35A 4RQPB 3TNPB 3LOBA 3ZXEA 1OQEA 1CAWA 2W0XA 3GZEA 4Q4V3 1DQ4A 2WQ4A 3ABZA 2D3RA 4W65A 4CEWA 3AMQA 3C7GA 5FPVA 5L7OB 3FBMA 5E16A 1GKBA 1SPPA 2NMOA 3ZN4A 4OCTA 5F5QA 2JIJA 1FPN1 3I3EA 4K1ZA 2X8KA 5A3PA 4XHXA 2PA7A 4IEZA 4JGZB 4K21A 1FMD3 2DUQA 2OVUA 5JXGA 1GV9A 3ON7A 4WVWA 3A22A 5FYTA 4ARXA 4AXOA 4L92A 3HAGA 3JQXA 2VPVA 3QBQA 1ODNA 1LHWA 4HT1T 2B8MA 2KD7A 2QQWA 4WVMB 1W8NA 1WLDA 1YNAA 3N7LA 2LTNA 3SITA 3Q8CA 2ENRA 3VZMA 2Y6HA 4ZU7A 5BNNB 5HV0A 3J7NA 3AKSA 3FFZA 4J25A 2V4VA 3RPQA 2P37A 1PHMA 5FZFA 5FZOA 2WFF1 4PDWA 1AZDA 1XBFA 2WN2A 4WM7C 5FZ1A 1MZ5A 2DURA 4OUSA 4PBOA 4OZOA 4MO3M 5FZGA 3BIEA 5DAXA 3ZFFB 4XIOA 1X9PA 3KVBA 2J1VA 4I3PA 2B4KA 2K2SA 3KV9A 4AQ6A 5K7PA 5HCHA 1ULPA 4RGAA 5A33B 2D6OX 1ZRCA 2XJSA 5DG2A 4WM8B 3ZYFA 4DZGA 2JXAA 4ZPIA 3AZWA 3D4KA 2AR6A 4YM1A 3VBOA 2A7AA 2PLV2 4GIQA 5IYYA 3WR0A 1MS4A 5L9VA 1BJQA 3KT1A 3OPZA 2X09A 1NZIA 1BZWA 1MQTB 2H6BA 2Y6FA 1PO22 3OGRA 3CLPA 5T5PA 1CWPA 1VBD2 2DBNA 2Z5WA 4QHOA 1COV3 5ABJA 4CDXC 3DUIA 1V6IA 4EN0A 5FP8A 1YFXA 1VALA 1C4RA 3J7LA 2X5IA 1RUC1 1RUD3 1UZYA 2LS6A 4AL9A 3MV01 3BTYA 4A42A 3IBMA 1B35A 5A7QA 4AK3A 1ZNPA 2A5ZA 4E2GA 3LA7A 2CNAA 2WZEA 4CDWC 2VUAA 1VRH1 1QJU2 2MEV2 4CCJA 4XFFA 3MLJA 4IGOA 3U07A 1SBFA 3ZSKA 3T1MA 4Q1RA 3ECQA 2DCTA 3KV6A 4CCCA 3NKTA 3PUAA 4YGDA 2QE3A 1ZX5A 2Y60A 4JCKA 2CWMA 5CA6A 4S2GA 4LO5B 5A6YA 3URFA 3WNXA 3NNJA 1FMD1 2JDNA 2UURA 2WNOA 2WN3A 4UFLA 3IIIA 1V0AA 3M3IA 3O0VA 1KFXL 3WNPA 2Q8CA 2VZ1A 3WF4A 4CP0A 5C3SA 3ACFA 3NNLA 2XKPA 4BYYA 3KGLA 4X8NA 4I30A 2D6NA 2MHFA 1VBE1 2WO1A 1F9KA 2HWC1 3O1TA 3LIGA 4AEJA 4YVWB 4CCEA 5CFCA 1J3RA 3FHAA 2HWE3 3OEBA 3H1MA 3UESA 2RS12 3QH6A 4XZPA 1N47A 1VB2A 2J1RA 4W50A 3NV1A 4AI0A 1CD3G 1LKNA 4J1WA 1Q8VA 3KCCA 1V6LA 4AI9A 2ATFA 1YIPA 3AMHA 1OPMA 4Z2WA 3K3OA 3D0JA 4XPVA 1MEC1 5CNAA 1JH5A 4QT6A 3MIDA 3VL9A 1V6MA 1Z7S2 5LBCA 3FE5A 2RVAA 4YVSB 3K3NA 1XU2A 1OUSA 4KGQA 5K8SA 3ZXFA 3AK0A 5DN2A 4S2FA 1SLAA 2XQRA 4QPGB 4YYOA 1GYKA 5FXZA 5DAVA 3D3AA 2VNRA 5I8TA 2G9FA 4XJWA 2VNOA 1W6MB 3TRSB 4GH4A 3VBHB 3B3QE 1HV0A 1EV13 1I5ZA 2LROA 3WINE 5DDJ2 1MZFA 3T1LA 5KHHA 1QJFA 3WY6A 4BCUA 3AZVA 2XGXA 2WS93 2Y6JA 3O1OA 3DYPA 2VVDA 3CHXA 4IV3C 3UKTA 2X53S 2BU9A 3HD8B 2GC3A 1W0OA 4AI8A 5BNNC 4LMFA 1DIWA 1VLNA 1NYWA 2VZUA 1OLRA 1ZBE3 1W0PA 4JRLA 2V73A 3NJYA 4XVHA 1AHSA 4WVZA 1BCXA 1O8PA 3AKQA 1GZTA 1LENA 2ZAAA 4AI3A 3AZXA 4CEWC 3B7MA 1R093 4Y4YA 4B4PA 2ZHMA 5CFCB 2VUDA 5KHGA 2V4AA 3KHBA 3R4SA 4L11A 2RDSA 2W52A 4KWUA 3ZXLA 2HEVF 1UWWA 1W05A 1D0GA 1SDDB 1JUIA 3DXUA 4XCAA 4IQPA 3LCPA 4IESA 4M4PA 1L7QA 1GZWB 1MEC2 4FFHA 4O9GA 3WQ1A 2PHXA 2QQLA 2RE9A 5JZGB 1YQ8A 5CVRA 1CQ9A 4YW6A 1NLSA 1S55A 4G4FA 4YFWA 5HXMA 1MQTC 4H55A 1AR62 4UF0A 2VY0A 2DFBA 2Z4FA 3HBKA 1ULFA 1WCKA 1I1EA 3M3QA 4H14A 2AH2A 1BBT1 1VBC3 1WW5A 3VBOB 3ZFGA 4Y1VA 1DQ6A 1K45A 2WA4A 4QPIB 1KS4A 4YZ4A 1URXA 1U12A 1UYYA 3IIAA 3PUQA 1MS8A 4WBBA 3B94A 3J26N 3OG2A 4Q26A 1UZVA 1SLIA 1JYCA 1SCRA 3ZN6A 1FATA 2PHLA 4NHXA 1IPJA 2C24A 4XJUA 5A3WA 1A6CA 2E31A 3OCPA 1AF9A 2VQUA 2HBUA 1JUHA 5FREA 1JN2P 2VXRA 1KITA 3TN92 1QOSA 4ZY9A 4FP2A 4MADA 1H9WA 4Q4W1 2ERFA 5CISA 5D8AA 1G8WA 1UW8A 1YXWA 3DV8A 1NLQA 4FFIA 4DMIA 1Q56A 1REFA 1WKYA 4LK7A 2FDGA 2VMHA 2RHPA 2LUWA 4JZRA 1WCUA 1CAUB 3AL6A 3JXSA 4MHUA 4XEZA 1JYWA 4PDWC 1LOBA 3AXEA 1PZ9A 2G9ZA 4LXLA 4FPYA 4IL7A 3T2TA 3DCQA 3E5XA 1RUH3 1QU0A 2BW8A 3BN6A 1UMHA 3MYXA 5FZ0A 4OI1A 5FZHA 3WSOA 2UY8A 2HWE2 2XLGA 3VBFC 4OHYA 1PO13 2QQVA 3ACLA 2VVFA 5JXHA 4FFFA 4MZUA 4DIQA 1V00A 1X36A 4IE6A 2UU8A 3VBOC 4CU9A 5GZEA 1EV11 2WNUB 3I3MA 2IUWA 1RITA 3H8OA 4ES8A 2JD4A 2QQUA 4LTAA 4RR3C 4HPKB 4Y1XA 2QQJA 3IWZA 3ZXGA 2AREA 4XUQA 5IVCA 3GM8A 4QGNA 1WMDA 4JX0A 1N3QA 3BB6A 5C3RA 3JBG1 3N9QA 4A6SA 1XNKA 3NJVA 2JKBA 5IUQA 2WDBA 5FZEA 2VO5A 4XXAA 1ULCA 1QJX2 4W6XA 4RL7A 4IE4A 2FMDA 5DDJ3 4BZ4A 1MVEA 2D6PA 1XPWA 4I0WB 4Q4X1 5T5JA 3NNFA 4GJYA 1NCQC 4FOYA 4LO8A 3B9IA 4JV4A 4OI0A 1RUG2 4CCKA 2CU5A 4XAAA 2YFZA 5K4LA 4CSWA 1YJKA 5IVEA 3R4UA 2FD8A 1BBT3 1CAXA 1AUYA 1VBC1 5FPBA 2JG9B 1OVPA 2Y64A 3MV11 5HCBA 2HJIA 1BQPA 2BGCA 3IPVA 1A78A 4AR2A 3FZ3A 3VBRA 2ORZA 4DNYA 1ULEA 5FUPA 4A7YA 3POJA 5IK7A 3B5LB 4PBPA 3OBTA 1PVC1 3RWNA 5FTTC 3N9NA 3ZR5A 5DUXA 3FC0A 1YQ2A 2V5YA 1H2MA 4H7LA 5DZGA 1H2LA 2A6VA 1J1LA 1SG3A 4KQ7A 2P3IA 2XWJB 3TN91 4GMP0 3WF3A 4PQ9A 3FLPA 2RJ2A 3N7KA 3HIFA 5JI9A 2QBXA 1UXZA 2ET7A 2BWCA 2YUEA 2ZX3A 1C8M3 1SACA 1AYN3 4MYEA 1GP4A 2NLRA 5FWJA 1QJU3 2MEV3 1X9TA 4OHZA 3PJYA 1OA3A 1W6QA 1G86A 5FPLA 1Z78A 1GWLA 2QCSB 2VBPA 1RUD2 3EJKA 2YU1A 3NVCA 5FO9B 3MDPA 4P9GA 1KJRA 3AZZA 1OD3A 2GMEA 2OQ7A 1SLBA 3QOPA 2ZTNA 3FN9A 4EYUA 2XHNA 2VH9A 4CDUC 4K40A 4DRVA 2XUEA 4FPGA 2JG9C 2AUYA 1UYZA 2G9GA 4IV1B 5GALA 2VTXA 1GANA 5EYYA 2YROA 4CEYC 1AR73 1JI6A 4LT5A 3ZX7A 4GKXA 3RJ2X 3VBRB 2ZCWA 3WP5A 2QZ3A 4I09A 3K46A 2WFPA 3FWEA 1XYPA 3NAPB 5DUVA 3N9MA 1V9U1 4XOGA 2WNVA 2P17A 4HFSA 3HOBA 2JEMA 3CO2A 4K8FA 4AQSA 5BNOC 4LUKA 4XDPA 2KR2A 1H0BA 3W9AA 1C3HA 2OZ6A 4XFBA 4YRDA 3T2PA 2BBVA 1XE0A 3A4UA 2E53A 4GB32 1JMUB 2PQSA 4BQ5A 5IAVA 1X33A 2QDRA 4ZXEA 3GHNA 3IN9A 2DWRA 1YYNA 2JDYA 5EQUA 1HB4A 3ZFGC 4D8MA 4ZONA 5ISLA 2RM21 1VMJA 4INDA 1LAJA 3H42B 1S2KA 2XG3A 3M2MA 1UMZA 4W6WA 1VBB3 2Q0AA 2X5IB 4P9LA 1VAKA 2QQOA 5C6CA 4E4ZA 2WO7A 4LE3A 2GP3A 1XNCA 3VBHC 5F9TA 4GB31 2DVAA 1ZM1A 4COWA 5E6HA 5A32B 2HWC3 4XURA 4CDUB 4NN0A 3I2FA 3VKNA 5IATA 1QDOA 1ULDA 3WW1A 2ZGPA 4RR3B 5D8AC 3LEGA 1FPN3 3ETQA 1RYYA 4XQ4A 4HVQA 1SLTA 4HVOA 1D4M3 2IWGB 2ZGSA 4I01A 4IV1A 4N53C 5A3MA 3VHNA 1Z0HA 1DZTA 1QQP2 1Y7BA 2O8OA 2WYSA 4GQ7A 3S5AA 3VBSC 3RYKA 4B29A 1YLLA 2QZ2A 1VBA2 2XOMA 1TMF3 1YFWA 2J1SA 4D0QA 2WC2A 2DBIA 2WLQA 3A0NA 2ZEZA 3I2GA 1WGPA 4M3CB 2J42A 1YQCA 1O5UA 4LPLA 1PIV3 4GB33 2O14A 3WG1A 4Z1VA 1H8TA 2YDEA 5AVPA 4UFIA 3WUCA 1PGW2 1LHOA 3W5MA 2XBO3 2ZX1A 3HQUA 4OHVA 2DVGA 1POQA 1T6BX 1L7LA 1PO12 5BNNA 1CIWA 1PGL2 4NVPA 4AYUA 4CP2A 4QM9A 2EAAA 3QLQA 1LOFC 5FY7A 2Q5TA 3JD72 4DFSA 1W04A 5T52A 2O0OA 2RMU2 2W68A 4M3CF 4NAOA 5GKAC 1EAH2 5LWBA 3HR9A 3AYDA 4JKKA 4W4ZA 2QQPA 1CAWB 3FBYA 1NLRA 3J8F3 1XU1A 1R082 2GNBA 1SFPA 1ZZCA 4IE5A 1VR3A 3WXPA 3H3ZA 4XILA 4QQLA 1DGWX 2YG0A 3APBA 5KC5A 2FDHA 1W8HA 3POIA 3THCA 2XJUA 1T2XA 4LK6A 2RS33 3AL5A 4FPLA 2WS91 1POV0 2HWB2 1LHUA 4HANA 4U36A 3EYPA 5J7MA 1AVBA 2P3JA 3OD4A 4IGPA 1PVXA 3WF1A 1AR71 4DXRA 3VBUA 5CKQA 3U11A 1GNHA 4AVTA 1W0NA 3LQCA 1O91A 3WZ1A 3OTFA 2VQ0A 3NJXA 4YPJA 2DV9A 1SQ4A 1H6XA 2ZACA 2IXJA 4YW4A 1Q5OA 3MIEA 1NG0A 1AJKA 2TNFA 2Y6GA 2YGMA 1GQHA 5C9AB 1AXYA 1D0HA 3N3HA 2W08A 4RFRB 4MSVA 3IB3A 3C2UA 1QIQA 1E5SA 4XBLA 1ZZBA 3VN4A 1YQ6A 3E5QA 1TE1B 3SH5A 1B35B 1H4GA 1Q8PA 3I49A 3QCWA 4L8QA 1U5YA 5FZ3A 2K0GA 1RVF2 1UX7A 2E6VA 2NPIA 4M4RA 4V2VA 1DGLA 4OI2A 4BK4A 5H9PA 5JUVA 2R7EB 5H9SA 1OPOA 5A7NA 2Y26A 1UZWA 4TN7A 2WR9A 3SCFA 4CDXB 1C5HA 4FAHA 4GWMA 5JZGA 4XF4A 1RVF3 3T2QA 5LEKA 1OQDA 2ZZQA 1QH7A 2DF7A 4LQRA 2AENA 1GNYA 1W06A 1L3JA 2W1SA 1SFYA 2QQKA 3JB4C 5A7PA 1JZ3A 3MW4A 5IJRA 3KV5A 1QXPA 3HQRA 1KXGA 3AFGA 5FPUA 2XQXA 4IEYA 2VZ3A 1JW6A 4QPIA 3FJSA 1CR7A 5EV7A 3MICA 3RI8A 4CVUA 4LHNA 3BOWA 1VMFA 2QVSB 1DG6A 3S6PA 3I54A 3P3NA 3P6BA 3GYDA 1UY1A 1JZ5A 5C7GA 5FK7A 2WABA 5FY0A 3PIJA 4B8EA 5FWEA 4NJ4A 5F5AA 3ZKYA 2P1BA 3HBZA 2PHRA 1OLME 2VOXA 2H6CA 1NQDA 5JIAA 1O3QA 1FPN2 1N3OA 4RFT0 4JRAA 4PF1A 1PZ7A 3LSEA 4QHBA 5D8AB 1B35C 4ZKTB 4AVAA 3BUCA 4WZFA 5FMBA 3J9SA 3VZKA 3ES4A 1GLHA 1GP5A 3IDBB 4LO6B 4QPGA 3S7IA 4CU8A 2ZGQA 4LKSA 4JDMA 4C91A 1PNFA 3E97A 5FYSA 3T3YA 2VOKA 1ODMA 1BHGA 1NUKA 3LWCA 4BIOA 1XNBA 3ZXJA 5LK7B 4Y5TA 3ILFA 1W90A 1OH3A 2JE7A 4META 1OVSA 2ARBA 2IFWA 5AFEA 2BJSA 3MFAA 5T5OA 5L7OA 1H2NA 4I0AA 4FOWA 1GICA 2Q1FA 3RYPA 4PT6A 2CAUA 2WNUA 3GBGA 1IS6A 2QDNA 1ZBE2 1RMU3 2XL9A 2A71A 4UBGA 5ACA3 5ANNA 4QX3A 2ARXA 1ALYA 3OGJA 2VNGA 4BWOA 4E9KA 2KXLA 4A6OA 1M06G 1LNSA 3MGUA 4FAGA 1LGCA 3CJIB 2ZMLA 1OC1A 4IEXA 2ZA9A 1EAH3 4YWAA 1VAMA 1C5IA 4KMQA 1WLWA 3NV4A 4FXKB 2JENA 4P00B 1IQDC 2KM2A 2RM23 1CAVB 3THDA 3C8XA 3LA2A 5F32A 1TME3 3HVDA 5APAA
chains in the Genus database with same CATH topology
2HWC2 4CEYB 1MS1A 1PVC2 2DVFA 2HWB1 3PHMA 3O0XA 1U0AA 1C8M1 2R063 5LK5A 5FAXA 3UJQA 1SEFA 4E27A 4R4ZA 3JB8A 4LNVA 5A33A 2JG8A 1HRI3 3M3EA 3VLBB 1FV2A 1J3QA 1KS5A 3NWKA 1LOCA 4YZ2A 1XYOA 3QACA 4AFCA 1ENQA 1RB8G 3VDDB 1D4M1 5C9AC 1POV1 2UWAA 1RUF1 3NKGA 4FCAA 3RJRA 2RS11 2Y0OA 1F2NA 2GMMA 3ZSJA 4WVMA 5JVVA 5ABJB 4URTA 4S2DA 1DLLA 2QKDA 3ZXDA 3GF6A 1OFNA 4L99A 4LHLA 1UPSA 1G9AA 4GKYA 3VBUC 2PELA 3WW4A 2RS52 5AC93 2NQYA 4K1YA 1LGBA 4D7YA 2YXSA 4QXKA 5FLJA 4NWVA 4OZXA 4CP1A 2RS13 5H9QA 1AL23 4RS5A 1ND2B 5T3NA 4CDQA 2XB6C 1RTVA 2EXKA 4FPFA 1ZZ7A 4HBNA 5C8CC 4YVWA 4AHYA 3ASIA 2VU9A 4NOTA 2XLFA 3NAPA 3H7JA 2D7FA 3JZVA 1DGRN 1RHI3 4JDOA 4AHZA 3BTAA 2CGOA 3ZYPA 5ABJC 4G9SB 5C8CA 4Q2FA 4Q27A 1CPMA 4LHKA 1IKQA 3HT1A 4XMIA 1AL0G 4KU7A 5KBFA 4YZ5A 4PJYA 4OHXA 1PMIA 1DQ5A 3WV6A 1Q3EA 2ZGUA 4I0BA 4FTEA 2PHUA 2W39A 4AWDA 4RQPA 4LUMA 1SBEA 2OIIA 4LLOA 1B09A 4KWLA 1AX2A 1BBT2 2P34A 4MVTA 1BVP1 4N9HA 4RHV2 2K9ZA 2VW1A 1VAVA 4TYSA 1AR81 3UKVA 3FLTA 4COYA 4LLFA 3RI9A 2BVVA 2VOWA 4MGYE 2ZZJA 3CJIC 1RUF2 5KHIA 1O3RA 4P14A 1JXNA 2C0ZA 4M0HA 3E6CC 1YO8A 4JTOA 1LRHA 4OFGA 1F31A 4LO4B 3RMYA 2HWF3 3VKMA 4K20A 3B9CA 1W2UA 3AP6A 4N9IA 1X7NA 1RUE2 1OQ1A 1ZYBA 3ZSEA 3O7OA 5DUWA 1OA2A 2RS31 3BODA 3WP4A 4YM2A 1OSGA 1WW6A 2P2KA 2JG9A 1HRV2 2OA2A 1ULGA 2B5HA 2CAVA 3L9JT 5FMOS 4XQWA 2A3YA 2PN5A 3IPVB 5CFDC 4XFCA 5I91A 1N1SA 4P9YA 5SV5A 3WT3A 4EN8B 3AJYA 3R6SA 1HRV3 2CL2A 5C4WB 3DPRB 1S0EA 5BYNA 5GZFA 2VW0A 3H8UA 4HSLA 4L97A 3IDEA 3D82A 3AP5A 2ILMA 3KGZA 1C1FA 4XE9A 1NE6A 5CFDA 4XF3A 1EAH1 4QX5A 1T6GC 2C1FA 2OPKA 1LTEA 1W6OA 2VGDA 3I2DA 5CADA 3PNAA 1G9DA 3HQXA 1DHKB 2G4IA 4S2HA 5GLTA 2PQQA 2EF6A 3DF0A 3C3VA 4FQZA 3W58A 1FXZA 2DU0A 2HWB3 1QJY2 3OYWB 5SV8A 5JSPA 2TBVA 3WVJA 3N4MA 3JBG2 5DZFA 1FMD2 4Q0UA 4Q0VA 4PF5A 3UJOA 1ZRDA 2B9UA 3OGGA 5BY5A 3GZTB 2JJ6A 3VBFA 1NQJA 1G9FA 3LOIA 3ZYJB 3U10A 4CDXA 5K9YA 2B45X 3VBSA 1RIRA 3R05A 3ZIWA 1MACA 5DZEA 3V65A 1F5FA 1VRH3 3KS7A 3I59B 3POYA 5HCAA 1IOAA 5L36A 3VKFC 5I0UA 1RUI1 3SHRA 1I3HA 3MPPG 2XBO1 3KMHA 2Y38A 3D0SA 4XBQA 5L73A 2RM22 1H1IA 4IV1C 4FO9A 4LBOA 3FFQA 4JTNA 2R042 4YVSA 4PIXA 2CV6A 1TMF1 1GQGA 1JOJA 4N53B 1WLTA 2FHRA 3OYWA 4NWWA 3GBWA 2AGSA 4QU2A 4DY5A 3J8F1 2CWSA 1V9U2 4J6GA 4LBQA 1HLCA 4FOQA 4SLIA 3ZXKA 1R083 4XF1A 1NY72 2ZGKA 3ES1A 3KQRA 1C1LA 3J4UH 2GALA 1OOPB 4B7EA 1MEC3 2D98A 3HN1A 2WT1A 3VL8A 2BFUS 4LBQD 4D7TA 4Z8BA 2D97A 5FPXA 2OUHA 4FPKA 2DUPA 1H1AA 5J98B 2R49A 5KHJA 2ETEA 1ZZ6A 3WQ7A 1S0CA 5BNPB 4ASLA 2X29A 2IZWA 4N7UA 5FO8B 4HL0A 2GMPA 1UU4A 5HBAA 4WVVA 1WBFA 1BK1A 5AFBA 2XPJA 1QDCA 1ND2C 1YUDA 1FT9A 1EPZA 2XJQA 4YFZA 1AX1A 1CJDA 3SH3A 2UYAA 5F6LB 3WHUA 2HWF2 1HDKA 1HQLA 4NPRA 4LBLA 1AR91 4GWNA 1DYKA 5CU1A 5J36A 2A6WA 1ZBA2 4LA3A 4Z82A 4JGYA 1J1TA 3MW2A 4GALA 1MZ6A 4XFAA 3KM5A 4MXVA 4XW3A 2R0FA 4DY3A 4BMBA 4F3JA 5JSRA 4RS5C 2TUNA 3VDDA 4XTMA 3EBRA 2YGLA 2RMU1 5GJ6A 1UF2C 4OLLA 1A8MA 4RSUA 1YHFA 3THTA 4Q29A 4Q4X2 1SBDA 1QXRA 4JGYC 5JPMB 1OMIA 1S0BA 2XL7A 2D6MA 1QNWA 1TMF2 4C0BA 4CDWB 1R081 1W6MA 3LZZA 1BVVA 2DCJA 1PK6A 1FNZA 1X8MA 3HMYA 3SCGA 2XKOA 1C8M2 2B42B 2D40A 4ISQA 3ZYIB 2PLV3 2XVGA 2PYTA 4IETA 1BKZA 1IS4A 4G3YC 3KB5A 4N43B 3WP3A 3IM0A 2YHJA 1BMV2 3JUUA 1FYUA 3LA3A 2PHFA 4AVBA 2XJTA 2R043 1AYM3 2PFWA 2YZ4A 4DS0A 3HT2A 2RR11 1RUJ3 4FP3A 1RUOA 2WNVC 1RUC2 5CB7A 2ZHLA 1S0JA 1PM7A 3ZMOA 3NO8A 4BPZA 1PO21 5JOXA 3N7JA 1NA1A 4L2NA 4BM8A 3KT7A 3OJBA 2A70A 4PCRA 3PJQA 1XRUA 1VRH2 4Y26A 4XJ9A 3DPRC 4Y1YA 1C8NA 2DTWA 2ZJCA 4FTSA 4Q8LA 2WT0A 5JIUA 1QKQA 4ZU4A 4L9BA 4YW3A 3RZZA 3WDVA 1D2SA 1PK6B 1YFUA 5GLVA 1NE4A 2VMGA 4IEQA 1FX5A 1ENRA 1UL9A 3ZPYA 2DVDA 2GN3A 2LALA 4IV3B 2WZR2 3BU7A 4P9WA 3W59A 1Q43A 2F4PA 4LO7A 3JQWA 4BLJA 4HZFA 1DZQA 1AYN1 1AR72 1IS3A 3WX5A 1DDLA 5EFUA 4HN1A 1RUH1 3NSTA 1G9BA 2YPJA 2YYOA 2D6KA 4C1XA 5C9AA 1CAVA 1N1YA 2VVEA 1LGNA 4F8AA 1UN1A 4QM8A 4FXGB 4D7SA 5KHKA 2XUMA 1QF3A 1RUJ2 3QH7A 1R1A2 2IXCA 5FBZA 5AC92 3U4XA 4Q4V2 3WD5A 4MUVA 2HWD3 3TAYA 4B4RA 4KG0A 2D3PA 2I45A 3M3CA 4JGZC 4TWTA 2PTMA 5FOBB 3A0KA 2R16A 2WIIB 1PGW1 5DXDA 1A8DA 3VBUB 3S0MA 3INAA 5HI0A 4LE4A 3KZ4C 2FZ2A 3MIGA 3VZLA 1GZ9A 1OOPA 1KFUL 4HMZA 4YG3A 3JD73 2E7QA 2R1BA 3PVOA 2MNGA 2CYFA 3PMEA 5GLZA 1ZBE1 1LOFA 2ZHNA 4YGCA 2VECA 4EWAA 2E63A 4MGKE 1NCRC 1XYNA 4Y22B 3VDDC 1VJ2A 2RS32 3RYRA 1S0FA 3H1YA 4OULA 3BPZA 2R32A 4YZ1A 1TME2 4JAAA 1RUJ1 4XMAA 4HSJA 3AJZA 1QWRA 2QFEA 2A3XA 5TSWA 3O5SA 4Q4Y3 3WG2A 3H0OA 3TWIA 1K5MA 5I0SA 1U5ZA 1WD3A 3R0RA 1R1A1 4DQAA 4KL1A 2B46X 1AL22 1IGOA 5EXOA 1Y9QA 4IEOA 5LRSA 4YW5A 1RINA 1HRI1 4I02A 1DQ0A 1WLCA 5BNPC 2RJLA 5JI7A 3WG4A 2HKXA 1XE7A 4BIFA 4R52A 5HCFA 2NMNA 5AC91 2ZMNA 1AR61 2PAEA 4DB5A 1NA1B 4Q4W2 3AX4A 1LR5A 1ZVFA 5C8CB 3I8TA 5CFCC 2WZPP 4Q4W3 1PO11 2D6LX 4RQPC 4F7ZA 4FPEA 5E88A 3GZAA 2R041 5KXDA 2XWBB 4LBQB 2BUKA 1Y43B 1LOGA 3D8CA 2B39A 1WBLA 4Y1ZA 1O5LA 1FI2A 4RGGA 3V0AA 4KBBA 1H1MA 3WHTA 1RUNA 3B93A 4B4QA 3PVEA 4KWJA 2WSVA 2RS51 4OHWA 5GZDA 4A7KA 1LODA 2BNMA 4D3WA 5J48A 2ZS6B 1AYM1 5LEJA 2VOVA 3AYEA 1HQWA 1GZCA 5FRAA 5C4WC 2C9AA 5E89A 1UPIA 1UKGA 4E4SA 2AZ5A 5J37A 3AYAA 4E2QA 3LAGA 1DFQA 1N1VA 2WL1A 3M70A 1J3PA 1NA1C 4LR4A 1WW4A 2ZBJA 4XETA 4XF9A 2HWD2 1RUC3 4PLNA 4FT8A 4YG6A 4BH9A 2WNEA 4UBHA 3AXDA 2IXKA 1HXS1 4AG4A 2WWSA 5FO7B 1TME1 2V09A 3G6JB 5AVAA 3HWJA 4YM3A 4KG8A 5GM0A 3B02A 5KXCA 2BTVC 4XQDA 1V6JA 1DF0A 4EN9B 3V0BB 1W6NA 4ITCA 1KJLA 1N1TA 5I93A 4Y20A 4FPHA 4LULA 5JOWA 1CPNA 4CEWB 1AR93 4JC1A 4N90A 4KH9A 2RMU3 4R9DA 1TNRA 4MXWA 3U0ZA 3H9AA 1UIKA 4MV2A 4PLMA 3IDCB 1HXS3 2A6ZA 4JGZA 1CVNA 4BE3A 4AGGA 3UL2A 3WUDA 1COV2 4R9CA 3OY8A 3VHPA 3M3OA 2VULA 4K6BA 1CAXB 3USSA 4Q0QA 3VKOA 4N53A 2I2SA 2ZKLA 1BEV3 4LBKA 1AX0A 1Q8SA 4Z92B 3VV1A 1S1AA 1V6KA 4QMAA 5HXVA 1SMVA 3TYJA 1ASJ3 3RNSA 1COV1 4RR3A 2PAKA 3WDUA 3AFKA 4FBFA 1TQ5A 4AE2A 2N7GA 2NZ9A 1RJ8A 1DGWA 1PIV2 3M7AA 4Q8KA 3KSCA 3PTYA 1SDWA 1APNA 3VBSB 4QPYA 5JPNB 1GFF2 4XXPA 1LULA 1W6PB 4XFIA 4Q0SA 2R1DA 3PVBB 3M4FA 5J96B 1GR3A 3FX3A 3ZYGA 4ORFA 2R0HA 1O7FA 3VZNA 1LEDA 5K0UA 2GSYA 2IXIA 1AYN2 1U5XA 1I9RA 5FQ0A 3AZYA 3VZJA 5JWPA 3KCXA 2R6QA 4DRRA 3MF9A 2BFUL 4FVVA 4AEDC 4WZCA 4BHPA 4QQPA 2LM3A 5I0TA 2DCKA 1VBB2 4HKLA 2JDZA 2GU9A 4EWDA 5JOYA 2FBEA 1JYIA 1W6OB 5DUUA 2DFCA 4R9BA 4LBJA 5FLIA 3OBRA 4K7JA 3NJZA 1CONA 1O4ZA 1RC6A 3WDYA 3FLRA 4XFHA 1RUE3 1LECA 4AFMA 4XHBA 3MF6A 1QGLA 4CRQA 3ZXAC 4MGZE 2D43A 2SLIA 4V1PA 2GN7A 2CTVA 4KGGA 3GZUC 2NM1A 3O0WA 3AYCA 3TBDA 2JX9A 4YSFA 1PGL1 2WFF3 3KD4A 3AP7A 2BQPA 1RHI2 1HV1A 1LCLA 1O4TA 4GMP1 4CDQB 4ATFA 1ND3A 3V56A 4RS5B 3TOJA 1UCXA 2ZOEB 2WJSA 2RS53 2XJPA 3MIFA 4JVAA 4AI2A 4HK9A 3LGRA 4A2UA 1FAYA 2WT2A 1YIFA 3WLUA 4JGYB 5I0RA 3DL3A 1KQRA 2H0BA 2Q4SA 1R1ZA 2ZGLA 1W6NB 1IKPA 2NYYA 4OVEA 4AHXA 3EXUA 4MLOA 4O9EA 4YNIA 5KWRA 1MQTA 1LU2A 5T55A 1H4HA 1G7YA 4EWEA 1WW7A 2I74A 5L19A 5JR7B 3M8LA 4E2SA 5GZGA 3VUOA 2JICA 1FOD2 2GNMA 1WCDJ 1QJX3 2GH2A 3NV3A 3BIWE 4FPCA 1RUG1 2DU1A 2DYCA 4QGLA 1KDKA 2VG9A 5E8AA 2NN8A 4N43C 3TNQA 1BXHA 3SNMA 1ZBA1 2JG8B 2D5HA 1RHI1 3PVNA 2FZ1A 3ZSMA 3P3PA 3D6EA 2XLAA 1PZ8A 4IEUA 2O1QA 5GLWA 1UAIA 3AKRA 3WDWA 1O4YA 4AGVA 4AVSA 5I8YA 2A3WA 2YV8A 2HEWF 2RJKA 3GHMA 2ES3A 4C1WA 3KLSA 2HWF1 4M0NA 3LSDA 2VMIA 3GNEA 4COVA 1MZEA 4EN7B 1Q8QA 4XYXA 3RRDA 4RD7A 1H9PA 2NP0A 2FMYA 2OUJA 4TLFA 1NCQB 3DKWA 5EJ3A 3SLIA 3CL1A 4AVCA 4B7KA 4Q1PA 2O8QA 1VBA3 2R072 2UY9A 4RHV1 1QOOA 2GC0A 2CY6A 3WCSA 3ZFEB 5C4WA 1MR5A 1WCSA 5KXBA 3DPRA 5CIRA 2HYKA 2KA3A 5K0UC 1TNFA 1PGSA 4R4XA 2ZAHA 1J58A 1ONAA 1C57A 1LB2A 1NXD1 4NHMA 4TZDA 2SBAA 1WUVA 1DBNA 4DINB 1QMJA 1QJY1 4I2OA 4AEKA 2GC1A 4W6YA 1KDMA 1RJ7A 3SISA 2GC2A 3WDTA 4AEDA 4KU8A 4IEVA 3AP4A 1YRZA 1AL21 4A7ZA 3FUQA 4C0HA 2OYZA 2CGNA 4YVSC 1UIJA 1DYPA 1LJ7A 1DZRA 5KXEA 4KWKA 2XJRA 5A3LA 3ALQA 3PLQA 2GDFA 1FOD1 1R092 1D2QA 3ZFFA 1OKQA 1Z7S3 5GLUA 1ZRRA 1NCQA 3JBG3 3MZHA 4AQ2A 1J59A 1YWKA 4X8PA 1ND3B 4FSJA 1ND2A 3K51A 4Z07A 2GAUA 1ZBA3 2EALA 3I59A 4QGMA 1CX4A 4HETA 3WW3A 1VBD1 3VKLA 3CF6E 1RUG3 2CGPA 1NCRB 2WFF2 4DPNA 3H1WA 1IHMA 1WA4A 3VHRA 2VW2A 3E6DA 3FUOA 3EQEA 5I8SA 3ZN6B 3O14A 4IXLA 3MPBA 2ZGMA 1MS0A 2XHKA 2Z79A 4ZXKA 1K5MC 2WS92 4C90A 4EN6B 4XDQA 4M3CE 2DCYA 4H3WA 3OY8B 2EXIA 1QHDA 2HWE1 2GNTA 2WZR1 3M1HA 1OFSA 4BMEA 4IEPA 5KC6A 1ASJ1 5H9RA 1LHVA 1ND3C 1HXS2 5JSOA 2Q1MA 4AGRA 3MIHA 4IV3A 1GSLA 1RUH2 2XVKA 2VQAA 1VB4A 2WLPA 5CG9A 1VBE2 1LOAA 3AM2A 3RQ0A 4KNCA 4Q4X3 2BNNA 2XH6A 3POWA 1PO23 4WM7B 3ZDSA 2EA7A 4EROA 2E7TA 3CEWA 3CJXA 3N7MA 4MH0E 3VHOA 2R061 2ZGNA 5F1RA 4YARA 1F8VA 1R091 4GULA 1QOTA 1C28A 4PDWB 5BNPA 4H7MA 4FPOB 1H8TB 2I07B 2E9QA 3CNAA 4J1XA 1XXNA 4K9SA 3VZOA 3S7EA 1IPKA 1EY2A 4ATEA 3SCHA 3WQ0A 1GBGA 1VP6A 2Q1ZB 3VBFB 4AEMA 4YGBA 3MIBA 4BOWA 1BMV1 1RUE1 2E51A 2B7YA 1SLLA 1AR82 5T5LA 2YC0A 2WINB 3WW2A 2BNOA 1GNZA 2VUJA 2R30A 1YI9A 4GXLA 4X6RB 5FLHA 1FNYA 3OF1A 1RMU2 1E57A 1X82A 2F6BA 1XNDA 4XFGA 4GA9A 1LEMA 1N3PA 2TEPA 1RVF1 1IQAA 4MXWB 2WSUA 4N7IA 1OD5A 3FMGA 4E4DX 1VBE3 4ES9A 4CDWA 1BEV1 4PIZA 3AKTA 3ME2A 1O3TA 5DG1A 2IC1A 2ZGOA 2JE9A 3GALA 4TSVA 3AB0A 5C8WA 4UW5A 1X8EA 1QQP3 1CAUA 3OD0A 4YVWC 4JQRA 4NO4A 3UKNA 2WQZC 1H8VA 5CBLA 3BOPA 1SFNA 4YW1A 4GMP3 5FDBA 4ONUA 4AFDA 5CG8A 3H50A 4K3UA 1AJOA 3MI8A 1H30A 1MS9A 3MW3A 1K5MB 1YJLA 4HVRA 4AFAA 1XE8A 3RSJA 1WMEA 4LBNA 4NR1A 3G7DA 5FCCA 3D5OA 1LU1A 4JDNA 2Q30A 3WG3A 3JCIA 1VIWB 2EXHA 2GH8A 1IZ3A 1JTZX 2ZKNA 4Y20B 4AI1A 4ISRA 4MX3A 1KD7A 2BVBA 1U5IA 1W39A 3H3UA 1MS5A 4NHKA 2ZABA 3MEPA 4A3XA 4Q4V1 4YW2A 3ZSLA 2ZX2A 2D3SA 3EO6A 4Q4Y2 1NOVA 1D4M2 3NV2A 1HQNA 1REDA 3GBFA 5BNOB 1CGPA 4D69A 2R062 1KRIA 1CJPA 3CU7A 5CFDB 2ZX4A 1RUI3 3PMSA 4XTPA 4RA0A 3TN93 4Q0PA 3I7DA 2ZHKA 1OOPC 5JCTA 2WKKA 1G9CA 1UZZA 2Z42A 2EXJA 4XF0A 4UW3A 1DQ1A 1ZRFA 1QJU1 2BWAA 2MEV1 2QUOA 1WMFA 4BLIA 2WZR3 3JU9A 5JAXA 2BPA2 1QY4A 1LHNA 2ZX0A 1QQP1 2A73B 1I6XA 1QJY3 2EVXA 1RL3A 3UK9A 1AR63 4AF9A 3J8F2 4IEWA 5BV6A 2A6XA 2DTYA 4CEYA 2MPFA 5FQ0B 1HW5A 4AHWA 1HRI2 1O3SA 4FQ4A 1BYHA 2WA3A 2PHTA 4OI4A 4NHLA 1MVQA 3B00A 3IMNA 3POSA 4LBMA 4BQ1A 1V9U3 5IK4A 5JLVA 2Z69A 1QH6A 4UXAA 1S0DA 3DN7A 3IKWA 4P5HA 2YMZA 5BXXA 1EYBA 1MS3A 2IXHA 3MLKA 2FQPA 3S30A 4YZ3A 5L7OC 3H7YA 2QNKA 3THPA 4WV8A 4I3GA 4AQTA 4YLZA 1YI7A 4WM7A 4AEDB 4U2AA 5EWSA 3WP6A 1W6QB 2JECA 2PHDA 5IT6A 1IS5A 1ENSA 2Y0IA 3R4DB 1NZCA 1VBB1 2H0VA 4IERA 4QPIC 2ZGTA 3E6BA 5FPZA 1FOD3 1V70A 3SXWA 2ZPXA 3L2YA 1V6NA 1YCIA 1DQ2A 4HN0A 4Q4Y1 1CN1A 2D5FA 1OHFA 1QJZA 2QJVA 3EHKA 3JD71 5A32A 1RUF3 4CDUA 4XBNA 2BEOA 5LRRA 5BNQA 3ZO0B 5E1RA 1ZA4A 2XVLA 2OZJA 3AP9A 3L2HA 1REEA 4HPKA 3KT4A 2Q8OA 1W6PA 4QQ2A 1AR92 4N43A 4COUA 1VBD3 3LKJA 1R1A3 5EZWA 3ZN5A 3SMHA 4XJAA 4FOVA 1AR83 2C5DA 1PVC3 1H8TC 1NCRA 1PIV1 3LB9A 4X6QB 1VBC2 4CDQC 1X50A 2R073 4P9JA 2WNVB 3BALA 2YY1A 1YFYA 1ZREA 1JBCA 1POV3 3O12A 3ILNA 3SH4A 4M01A 3WDXA 3ZIXA 5C33A 2WNUC 5JOZA 1AXKA 4P9IA 2BYVE 2D93A 4FPJA 1CESA 5B2GB 2AYHA 1S0IA 2P3KA 2RR13 3ZYRA 3AKPA 5FFOC 3X29B 4CZSA 3Q9OA 1EP0A 2GZWA 4YM0A 4AW7A 1VBA1 1V6OA 4CTEA 2DVBA 4B3NA 4DOUA 3ELNA 2UYBA 2E7AA 5ACA2 4EV0A 3B01A 5DDJ1 2ZMKA 5BUVA 1LESA 5T54A 3ROUA 5J3UA 2HWD1 2JG8C 1G6NA 3NL1A 1RMU1 1HRV1 3ATGA 5K0UB 3ST7A 4Y22A 2A6YA 1NXMA 1OLQA 1UU5A 1A3KA 1Z7S1 3ILRA 3VBRC 5IK5A 1GZWA 3VGIA 1Y3TA 5J09A 1QNYA 3CJIA 1AYM2 1HX6A 4HLTA 1BEV2 3WCRA 5JDBA 4MGIE 4SBVA 3BCWA 4LEJA 3RS6A 4F83A 4HKWA 4HKOA 4D94A 3MFCA 1LOEA 3I4IA 4HK8A 4WM8A 3ZFGB 4ZU5A 1F5JA 4R8HA 3ZMNA 3B69A 3V0BA 5CAZA 3TB0A 2ZGRA 3ZFEA 4QPGC 1SCSA 2IFRA 1D4VB 2X5IC 3ZFFC 1M4WA 2GNDA 5GZCA 1OA4A 3AMNA 1UU6A 3AMMA 3QD6A 5JMCA 4BA6A 3USUA 5D1IA 5BNOA 4XJZA 5FMOL 1UD1A 4XIKA 3AMPA 3WOGA 1ASJ2 2RR12 4WM8C 1QXJA 3UV9A 1DGRA 4UW4A 4YG0A 4Y5Z0 2UWBA 1RUI2 3ZFEC 2DCZA 1HIXA 3ZVXA 2XBO2 1TEIA 3IT8A 4RHV3 4QQOA 2D44A 4DXZA 4UW6A 1ENXA 1WD4A 3NAPC 2DUOA 3MLLA 2UWCA 1ZZ8A 1JHNA 1PNGA 1DU3D 1SLCA 4GH4C 3ENRA 2R071 3K48A 4AVVA 1NY71 3E5UA 1XQNA 1H2KA 3V0AB 3NW4A 2ET1A 4LA2A 2EAKA 5JZGC 4Y24A 4YGEA 4M3CA 2PLV1 2A75A 1Q8OA 4FTBA 4XJ8A 1PK6C 1UKRA 2XJVA 5FOJB 4PIYA 2EIGA 5T50A 1RUD1 5ACA1 5EYXA 3USUB 1ZZ9A 1EPWA 1S0GA 1EV12 3N36A 4PLOA 2Z2SB 4COZA 2PHWA 4P9XA 4CYDA 3KCYA 1FV3A 1AXZA 2HEYF 1S2BA 5BPXA 1UX6A 4ASMB 4QD2A 4R9AA 3RMXA 5IK8A 3RG0A 3RDIA 1RGSA 4OUMA 4Y1UA 5F6KA 2PAMA 1QJX1 3V64A 4EJRA 1HKDA 4QQHA 4AFBA 3FHIB 2IXLA 4M00A 1OI6A 2OW4A 3DGTA 4GH4B 3VBHA 3N35A 4RQPB 3TNPB 3LOBA 3ZXEA 1OQEA 1CAWA 2W0XA 4Q4V3 1DQ4A 2WQ4A 2D3RA 4W65A 4CEWA 3AMQA 5L7OB 3FBMA 5E16A 1GKBA 2NMOA 3ZN4A 5F5QA 1FPN1 4K1ZA 2X8KA 4XHXA 2PA7A 4IEZA 4JGZB 4K21A 1FMD3 2DUQA 2OVUA 1GV9A 4WVWA 4AXOA 4L92A 3HAGA 3JQXA 2VPVA 3QBQA 1LHWA 4HT1T 2B8MA 4WVMB 1WLDA 1YNAA 3N7LA 2LTNA 3SITA 2ENRA 3VZMA 4ZU7A 5BNNB 3AKSA 3FFZA 3RPQA 2P37A 1PHMA 2WFF1 4PDWA 1AZDA 4WM7C 1MZ5A 2DURA 4OUSA 4PBOA 3ZFFB 4XIOA 4AQ6A 4I3PA 2K2SA 5K7PA 4RGAA 5A33B 2D6OX 1ZRCA 2XJSA 5DG2A 4WM8B 4DZGA 2JXAA 3AZWA 3D4KA 2AR6A 4YM1A 3VBOA 2A7AA 2PLV2 4GIQA 3WR0A 1MS4A 1BJQA 3KT1A 3OPZA 1BZWA 1MQTB 2H6BA 1PO22 5T5PA 3CLPA 1VBD2 2Z5WA 5ABJA 1COV3 4CDXC 3DUIA 1V6IA 4EN0A 1YFXA 1VALA 1C4RA