1F9KA

Winged bean acidic lectin complexed with methyl-alpha-d-galactose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
234
structure length
234
Chain Sequence
ETQSFNFDHFEENSKELNLQRQASIKSNGVLELTKLTKNGVPVWKSTGRALYAEPIKIWDSTTGNVASFETRFSFNITQPYAYPEPADGLTFFMVPPNSPQGEDGGNLGVFKPPEGDNAFAVEFDTFQNTWDPQVPHIGIDVNSIVSSKTLHFQLENGGVANVVIKYDSPTKILNVVLAFHSVGTVYTLSNIVDLKQEFPNSEWVNVGLSATTGYQKNAVETHEIISWSFTSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC LECTIN
publication title Carbohydrate specificity and salt-bridge mediated conformational change in acidic winged bean agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 44
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f9kA00
3AYCA 1YYNA 2ZKNA 5EYXA 1C1FA 5H9SA 3ILNA 4RA0A 5GLUA 3INAA 4FP2A 5T50A 3ZPYA 1V6MA 4LBNA 1QNYA 1VAVA 2B7YA 4YZ5A 3OBTA 5HCBA 3HMYA 1ULGA 3RS6A 1LJ7A 1KQRA 1WLDA 2FHRA 1LU2A 2YZ4A 1S0FA 1CR7A 4UW3A 4Z8BA 3NV3A 1GZ9A 2GNBA 5CAZA 1LGNA 1WD3A 3HR9A 3WCSA 1KJLA 1F5FA 3BODA 1WCSA 4ITCA 5GZCA 3GALA 3N35A 1LODA 4HL0A 3AZXA 1N1SA 2DUPA 2A6YA 1JW6A 3RSJA 2P3IA 1W6OA 1UX6A 1GANA 5AVAA 2GN3A 2ZGUA 5H9RA 1IKPA 1WLCA 3DGTA 4XBQA 2Z42A 2GMMA 4FPLA 4Y22A 5T54A 1CPMA 1S0JA 1C4RA 2R1BA 4K1YA 1BYHA 5CB7A 4FPCA 4Y1UA 3V64A 3ZSKA 5GZFA 1JYCA 2H0BA 5T52A 1AXYA 1JHNA 3WDYA 5GJ6A 1RINA 2KM2A 1F31A 1CQ9A 4GA9A 1G9CA 1DQ0A 1YIFA 1ZM1A 4P9YA 5KXBA 1N3OA 3ILRA 4DRRA 1N3PA 3IKWA 2ZHLA 1JYIA 2DTWA 1AXZA 1U0AA 4XE9A 4DFSA 1ONAA 5JVVA 2V73A 5GZGA 1LU1A 2SBAA 3FBYA 3ZVXA 3OGGA 2A7AA 5DXDA 4C1XA 5GLTA 2CL2A 3AX4A 3R4SA 1TEIA 1Q8SA 3AP4A 1G8WA 1LEMA 1GLHA 2D6OX 3AYDA 3M2MA 1LOAA 3ASIA 2PHWA 4L8QA 4K1ZA 5T5PA 2SLIA 2DVFA 1HLCA 2ZGMA 4FPGA 4FQZA 4NO4A 4XOGA 1H9WA 2ZHMA 5H9PA 1ENRA 4FQ4A 2R1DA 3MPPG 3V0AA 3ATGA 1ULDA 4FOYA 2NMOA 2W68A 2R0FA 1S1AA 4DS0A 1KDMA 3ZSLA 4XZPA 1Q8PA 2ZA9A 2ZGSA 5DZFA 1G9AA 1GNZA 2WT1A 4XIOA 2A70A 5HCAA 4I30A 3T1MA 1VALA 1MACA 4ATFA 3SITA 2E7TA 1AJKA 4Q2FA 4Y1YA 1Z0HA 3M3CA 4FPHA 1W6MB 4XDQA 1V6LA 2C9AA 4R9BA 3OBRA 5KXCA 2E51A 1YO8A 4DQAA 1MZ5A 1SLIA 1N1TA 3N36A 4YM0A 4K21A 4K20A 1B09A 4Y20A 4ZXKA 3IPVA 1IS3A 4CTEA 3O0VA 3MW4A 3D5OA 2ZGQA 3WZ1A 1V00A 3SLIA 1RIRA 1UN1A 1DIWA 1QOTA 4FPJA 2ZGKA 3D6EA 4R9AA 1MS3A 4XILA 1CONA 2Q5TA 3PJQA 3SNMA 3WHUA 3LCPA 5DUUA 1LENA 3AP9A 3MW2A 3WDWA 3V65A 3WLUA 1W6QB 1LOGA 2V5YA 3AFKA 4P9WA 3A0NA 4LBQD 1SLLA 3W58A 3M3QA 1DQ5A 2ZHNA 2VU9A 2ZACA 2E6VA 2PELA 1C57A 2WT0A 2OUJA 1C1LA 2WNEA 1NXD1 1SLBA 1W6NA 4HANA 5HCFA 5LK5A 4DPNA 2DWRA 2I2SA 3W59A 1S0GA 1WLWA 1LOFC 4IQPA 1LULA 1N3QA 5BYNA 3RG0A 1QU0A 1V6KA 4P9XA 4Q27A 1HQLA 1UMZA 2LALA 1CPNA 4FVVA 1S0IA 1VAMA 3MEPA 1SLTA 3PVEA 5JOZA 1FATA 1Q8QA 1DGLA 1S0EA 1EPWA 3BTAA 4LBQA 5T5OA 3VV1A 2PHTA 4PBPA 4YW3A 1OKQA 4U36A 1JUIA 3AP6A 1JXNA 4RL7A 4LBJA 4YGDA 1Q8VA 3AZWA 2ERFA 1LECA 1N1YA 3OPZA 3ZXJA 1DBNA 3UJQA 2NM1A 4YM1A 2WQZC 3NV1A 1V6IA 2ZAAA 3AK0A 4AGVA 2P37A 1BZWA 1ULCA 1DQ6A 2DUQA 1ZA4A 4M3CA 1FAYA 4JCKA 2VW2A 3UK9A 3H0OA 1URXA 2EXHA 2JECA 3VKOA 1MS8A 1UKGA 4FOVA 3GNEA 2ZABA 2VXRA 4XXAA 2ZGLA 2JJ6A 2WKKA 4UW6A 3WUCA 2DVDA 3ILFA 1AF9A 2AYHA 3N3HA 1LESA 4ISQA 1KRIA 4AVTA 3UJOA 2YY1A 2DURA 5IK8A 2A75A 4M3CE 4ATEA 4FOQA 2D6KA 1LTEA 1I1EA 3TAYA 3JU9A 1DHKB 4DRVA 3RQ0A 4UW5A 3FFZA 5EXOA 5T55A 2YROA 3AJZA 3B69A 3KQRA 3ZXFA 1LCLA 2D6NA 1O4ZA 1PZ8A 2D6LX 2VH9A 2W52A 2ZZJA 3FLPA 4Q8KA 4ZKTB 2ZMLA 1I3HA 3RRDA 1DQ4A 4LBMA 2P2KA 2NYYA 2AENA 4YZ3A 1W6QA 4YM3A 4XHXA 1W6PB 4FPEA 4XTPA 2UWAA 4YM2A 3WOGA 1BJQA 3CNAA 3WG2A 1S0BA 2D7FA 1FYUA 2E53A 5DG2A 2R16A 2GALA 1A8DA 3USUA 1UPSA 4GKYA 5SV8A 2DU1A 5E8AA 3V0BB 1UAIA 5E89A 1QF3A 2P3KA 3SH4A 1WUVA 1AXKA 1J1TA 2D6MA 1SFYA 3M1HA 1DFQA 4GWNA 1UZYA 1V6JA 4M3CF 2VW1A 1QGLA 4ISRA 3U4XA 4W65A 3N7JA 4Q1PA 2RHPA 3AYEA 2A3XA 3OY8B 4FPOB 4AGGA 2DYCA 3PVNA 5GLWA 1LOCA 5DUWA 1LOEA 3N7KA 3B01A 5KXDA 3QLQA 5GLZA 1BKZA 4Y1XA 5IK4A 1KJRA 2ZGPA 3WVJA 2EF6A 3ZSMA 4TZDA 1LOBA 4BLJA 2D44A 1FX5A 1G9DA 1S0CA 2G4IA 3N7LA 1SLAA 4XHBA 1G9BA 3O0XA 1JOJA 3B3QE 1CIWA 1FNYA 3IM0A 3WDTA 1MS0A 5IUQA 2NZ9A 1V6OA 2ZGTA 3LSEA 4PQ9A 4SLIA 4XJAA 4GALA 3WHTA 1CN1A 2A6XA 2GMPA 3LSDA 4FP3A 1WW5A 4WV8A 1GKBA 3POSA 1QMJA 3N7MA 4OZXA 1GBGA 5EWSA 4Q26A 1WD4A 2CNAA 1MS9A 3AJYA 4U2AA 4UW4A 3PMEA 2EXIA 1OQ1A 4Y26A 3ZXKA 1R1ZA 1DLLA 1BXHA 5EYYA 1BQPA 1MS5A 1MZ6A 1LHNA 3OYWB 3QCWA 4LBKA 5DZEA 3SH5A 3ZSJA 2FMDA 4AVSA 1GYKA 1WBFA 3SH3A 2GN7A 3WCRA 4YW2A 3WDXA 1VLNA 2ZMKA 4XXPA 2CY6A 4WVVA 1GSLA 4AVVA 2BQPA 1Q8OA 1W0OA 5IK5A 1MR5A 4YW1A 2JKBA 3POYA 2DTYA 1DQ2A 4YFZA 1GZWB 1FV3A 1LHUA 3I8TA 3V0AB 1W6PA 2W39A 4YW4A 2C5DA 2XG3A 5DUXA 1FNZA 2JD4A 3D4KA 4XJ9A 2A3WA 2CYFA 3TB0A 3WDVA 3IMNA 2EXJA 4YW5A 2ENRA 1D2SA 1QOSA 4AWDA 4BQ1A 3B00A 4GKXA 4XYXA 1AVBA 4M01A 1W0PA 1DZQA 2DVBA 2A6VA 1HKDA 1GV9A 4XJUA 3WDUA 2WSVA 4XIKA 4C1WA 2A6WA 3V0BA 1AX2A 5IK7A 2D6PA 2ZGNA 3AXDA 2HYKA 4LBOA 4M00A 5IT6A 1Y7BA 2CTVA 4YZ2A 5JOXA 3O12A 2A3YA 2DVGA 2OVUA 1AX0A 5DG1A 1G7YA 3AP7A 2CWSA 5JLVA 1CESA 4YFWA 2E7QA 1YRZA 1DYKA 4YGBA 1XQNA 2P3JA 2DUOA 4Y20B 2AUYA 3IPVB 1AZDA 3OY8A 3VKMA 2A5ZA 4XJ8A 5F9TA 2VUAA 2OW4A 2WSUA 3BOPA 1QNWA 1SCRA 3FUQA 5FRAA 3WG1A 1W6MA 3NV2A 1WBLA 2PHRA 4YG6A 3T2TA 4WZFA 5GZDA 2R0HA 1SACA 4BM8A 2NMNA 1CVNA 1FV2A 1NLSA 5JMCA 2AREA 2LTNA 3A4UA 1N47A 4FOWA 3ENRA 5H9QA 2YMZA 3NV4A 1W6NB 1Q56A 2EXKA 3MW3A 3NWKA 3RMYA 5CBLA 3ZXEA 2GNMA 2ARBA 3WNXA 3O5SA 4BLIA 1SBDA 4XMAA 2GMEA 1KITA 2ZHKA 1CJPA 4NOTA 4Y1ZA 1SBFA 1QDOA 2ES3A 5GALA 1DYPA 3RMXA 2UU8A 3VKFC 4MYEA 2EAKA 1N1VA 1H30A 2AH2A 3VKLA 1LEDA 3WV6A 4LBQB 3BIWE 4R9DA 5DZGA 2PHUA 1SLCA 3ZYRA 1SCSA 2ZBJA 2AR6A 1MS1A 1SBEA 3OYWA 1WW4A 4PBOA 3B9CA 5T5LA 1ULFA 5DUVA 3A0KA 1LHWA 4Y1VA 3UL2A 3VUOA 1UZZA 1QDCA 1AJOA 2JE7A 3C2UA 4H55A 4PCRA 3L2YA 4Q1RA 4R9CA 3PVOA 4YGCA 3ZYPA 1YI7A 2D43A 4M3CB 1G9FA 1GNHA 4FPKA 3FLRA 4YG0A 3WG3A 1UL9A 4BMEA 1KDKA 4YG3A 3AYAA 5FREA 1IS6A 2DV9A 4CZSA 1GZWA 3AZZA 1G86A 2UWBA 3OJBA 4XJZA 2EIGA 2PHFA 4XMIA 1D0HA 5KXEA 1W6OB 1LHOA 4WVWA 3AP5A 5GLVA 3AZVA 2VY0A 2YXSA 4JC1A 2VW0A 3R4UA 4FPFA 1JBCA 2P34A 4Y22B 4GWMA 3M3OA 3JUUA 1APNA 1V6NA 2UURA 2ZGRA 5L73A 2XB6C 1IOAA 1QKQA 4TYSA 2D3SA 1Z78A 3SISA 3IN9A 2EALA 2DU0A 2JDZA 4FPYA 2GNDA 4KBBA 5F5QA 5JDBA 1HQWA 2NN8A 1HDKA 1RITA 5CA6A 4BOWA 4Y24A 3APBA 1GZCA 4XBLA 4CRQA 1WW7A 1DQ1A 1PZ7A 3WG4A 1GICA 4GXLA 1ULEA 3AXEA 1IS5A 4YZ1A 3Q9OA 5CNAA 4P14A 5JOYA 1YXWA 3DUIA 1S0DA 2D3PA 4XJWA 3WUDA 4AGRA 4PF5A 5GM0A 2W08A 3FUOA 4ASMB 2GNTA 2JE9A 2DVAA 4Q8LA 4AYUA 2ZMNA 1MVQA 2A71A 4YGEA 3FLTA 4BPZA 2AGSA 2R49A 2CWMA 2WLQA 1WW6A 3O0WA 3R05A 2WJSA 1H9PA 2TEPA 3M3EA 3I4IA 5GZEA 1JN2P 1LGBA 4JRAA 1IKQA 1O4YA 3ZXLA 1AX1A 4XBNA 1ENSA 3T1LA 3USUB 3AZYA 4F83A 1A78A 1MS4A 1X50A 1LOFA 1OFSA 2ARXA 3HN1A 2NP0A 2A6ZA 2YV8A 3VKNA 3KM5A 1PZ9A 4XTMA 4D69A 1MVEA 2UWCA 1QOOA 4YLZA 4BMBA 1LGCA 2ZGOA 5T5JA 2D3RA 1A3KA 1F9KA 2PHXA 4YZ4A 5JOWA 1ENQA 2GDFA 3POWA 1LHVA 2OUHA 2WT2A 5E88A 1VIWB 4LBLA 1IS4A
chains in the Genus database with same CATH superfamily
3AYCA 3K4ZA 5C71A 1GZTA 5BUVA 4BQ5A 1JH5A 2E7AA 4XC9A 5FKBA 2VNGA 5GLUA 4D8MA 1QJZA 3ZPYA 1ODNA 1QJU2 1US3A 2R042 2DBIA 4YZ5A 5DABA 5HCBA 2W46A 1WLDA 3CEWA 1PGSA 3GBWA 4GMP3 1RUF3 3OSDA 1CR7A 1UWWA 4L92A 3UT0A 2XH6A 4BK4A 1VJ2A 3KZ4C 1GZ9A 3NV3A 4Y5Z0 1YJLA 2GNBA 4CCCA 2XKOA 3HR9A 2GAUA 1KJLA 4ITCA 3N35A 1LODA 3HQXA 4H7MA 2C26A 1N1SA 2DUPA 1NCQC 4CDQA 2VE1A 4Z1VA 1JW6A 3BPSA 3RSJA 1UX6A 4ARXA 2XVKA 2ZGUA 4EWDA 1GP5A 1VRH3 2R073 4RYDA 5CG9A 4EROA 2Z42A 4FPLA 3KV4A 1M06G 1X9PA 1PO22 1C4RA 2DCKA 2Y38A 5CB7A 5C3SA 4Y1UA 3V64A 5J96B 3E6CC 3ZSKA 2R30A 3J7LA 5GZFA 5T52A 4D6QA 5K9YA 2DCYA 5GJ6A 1ODMA 5I0DA 1O3TA 1FPN2 3LAGA 1RJ8A 5BNNC 2F4PA 4OMDA 3HT1A 1X82A 3VBFB 2BYVE 1BVVA 1TZOA 1VBE2 1OVPA 2ZEYA 3LPGA 4UWDA 1N3PA 4YVWB 3I49A 5TSWA 1O8SA 1AXZA 1S4CA 3B7MA 3RNSA 5JVVA 1U5ZA 1LU1A 2HWC1 4MHUA 3ZVXA 5BNOA 3BI3A 1HB2A 1PVC1 3WT3A 1AYM2 3AX4A 3VZOA 3R4SA 4CP1A 5FZBA 4BQWA 1TEIA 4L9BA 1G8WA 4Q4Y1 3U07A 3GBGA 2OZ6A 2VMEA 4UBGA 3ASIA 5KC5A 3NJXA 1XXNA 4K1ZA 4WZCA 3TNPB 1R093 1HLCA 5APAA 2Q8EA 1L7QA 2Y8KA 3FWEA 5JIUA 4QHZA 2RMU1 3RVHA 4FQ4A 2PAKA 2P6HA 5CKMA 3EHKA 5A33B 5AC91 3V0AA 2NMOA 1CD3G 4LT5A 3H3ZA 5C5UA 2VZRA 1NX9A 2WYFA 3OEAA 3ZSLA 4DS0A 2QQOA 3ZDSA 1H4GA 2JEMA 3CJIC 2Q1MA 4X8NA 5FOBB 5DZFA 5BPXA 3KV9A 1GNZA 2VZSA 4QPGA 1QJU1 2A70A 4YVSB 2R041 4QHBA 3T1MA 3M4FA 2PTMA 4LE4A 3BUCA 4ATFA 2HWF3 2AC1A 5DDJ2 2QQIA 1AJKA 4Q2FA 4LA3A 4Y1YA 1NCQB 2RS53 1MEC3 4OHYA 1V6LA 2JX9A 3OBRA 1VBB3 3LA3A 2IXJA 3J26N 1XYNA 5F37A 1W8ZA 3HQUA 4N7IA 4KI5M 2RDRA 2WN3A 4E8CA 3O0VA 3MW4A 3PL0A 1O3SA 1V00A 3SLIA 2LW8A 4LHSA 1DIWA 4XILA 4R9AA 1DGRA 1MS3A 1HXS3 3B5LB 2Q5TA 3WHUA 4ZZ8A 5DUUA 3CIHA 2Y34A 4DXRA 3MW2A 2BOIA 1W6QB 5G04L 2V5YA 4BE3A 2Y60A 3AFKA 3A0NA 1NYWA 4K8FA 4Z82A 5K0UB 2CDPA 2IXKA 2XJSA 4BJ0A 1PO21 2A73B 2VU9A 2ZACA 1A34A 3WF1A 2PELA 2WT0A 2VVFA 1C8NA 1NXD1 3LDKA 3E5UA 1YNAA 1QJEA 5F32A 1FPN1 2I2SA 2RVAA 3E97A 5D8AC 4QDSA 3FN9A 4OZOA 4LO7A 1PIV3 4Q4X3 4IQPA 1RUNA 1LULA 4BHPA 1VBE1 5A7OA 3MGUA 3RG0A 1GNYA 1LRHA 4P08A 2JB8A 3AMQA 4Q27A 4W8JA 4ZZ5A 1UMZA 4FVVA 3VBFA 4CCNA 5A6ZA 3BTXA 4FFIA 4HK8A 1NLRA 1SLTA 4OUSA 3WQBA 4YVWA 4CCKA 5JPNB 1DGLA 4LBQA 1EPWA 5T5OA 3WW1A 3HJRA 3SHRA 3VV1A 4MGTA 2PHTA 1FMD3 3H8OA 4U36A 3NNFA 1AYM1 4CEYB 4Q0PA 3SCFA 4EN6B 3ZXJA 3WP4A 4XUPA 2VVEA 1UF2C 1U5IA 1CAUB 2D93A 2P37A 3A7QA 3O1RA 4NIIA 1ND2C 2I45A 3THTA 4HKWA 4KL1A 4JCKA 4RS5C 2VW2A 4MGYE 1URXA 2JECA 4LO6B 2WWJA 4ZU7A 2IXLA 1WMFA 4UXAA 3GNEA 2PLV2 5FZ9A 4CXYA 1W8TA 1UY4A 2QBXA 1X7NA 1XBFA 3O14A 3MUY1 4NIAA 4OCTA 4UW6A 1UNBA 2IXIA 2VQUA 4CSWA 2B45X 3W20A 1I5ZA 4E2QA 1AF9A 2AYHA 3N3HA 1RUJ3 3UJOA 3ACHA 4R4ZA 1WA4A 3WW4A 2VTFA 3PUSA 5FZKA 4AFCA 2P17A 3VL8A 3VD9A 2NPIA 5DDJ1 1UY2A 4YVSA 2OT7A 5CEHA 4CEWA 3O1PA 2BOJA 3NMBA 3BU0A 2BFUL 3JZVA 4K40A 2B46X 4EZ4A 3FX3A 4V2VA 4H3WA 4FFFA 3VDDB 5A7WA 1W2UA 5T55A 2YROA 2QQKA 3B69A 3N4MA 2C1FA 2D6LX 1PMJX 2VH9A 2W52A 2ZZJA 3FLPA 3E1F1 3VBHA 5FR3A 2XJRA 2PFWA 2FZ2A 3I59B 3BOWA 2VNRA 4MO3M 5D8AB 3VZJA 3W9AA 2NYYA 4HETA 2AENA 4BQ4A 4YZ3A 1W6QA 1W3XA 3P6BA 4YM2A 4FPEA 2TBVA 4M4PA 2HJIA 3B9IA 5K0UA 3TN92 1YQCA 1S0BA 2XUEA 2D7FA 4CCMA 2Q1FA 4BXSV 2E53A 1XYPA 3EO6A 5DG2A 3ZSEA 2GALA 1A8DA 1H6YA 5FP7A 3JD72 4Q4V2 2FDGA 3OGRA 5CISA 3FMGA 3OD0A 1QF3A 4RHV3 2BV4A 2HWD2 4X8PA 3O1OA 1LNSA 3I3EA 1BCXA 3D0SA 3NAPC 4JKMA 4CCDA 1MQTC 3M1HA 5CYYA 1DFQA 1GP6A 1OKOA 3AKQA 4JDNA 4SBVA 4NMIA 2HWC3 5EV7A 4W65A 1UU5A 1ND2B 1IG3A 5LY2A 1W05A 3OY8B 1W8OA 3PVNA 1LOCA 5FCCA 3VDCA 4BB3A 4CEYA 1LOEA 1UKRA 2UYAA 4I0WB 4JHTA 4H7LA 1BKZA 5A1FA 3N9QA 1KJRA 5DAWA 5C9AC 5FZCA 5J48A 4LJHA 1VBC2 1K5MC 2VVDA 3T3YA 2ADEA 5LA1A 3PLQA 4LHNA 4TZDA 4QQOA 4AEJA 1EPZA 2PLV1 2VL4A 5JZGC 5FYYA 2WS92 5AC93 3ME2A 1JOJA 3B3QE 5FTTC 1D2QA 4C91A 1BK1A 1CIWA 1H8TC 3NL1A 3NVCA 3ZYGA 5A1LA 1MS0A 2NZ9A 1UXZA 2H6CA 2VQAA 3CJXA 2D5HA 3LSEA 4GALA 4GH4C 2J22A 3I3QA 2A6XA 2GMPA 3LSDA 4XJAA 1QJU3 3TOJA 3QOPA 2R043 2XQXA 5EWSA 4AR2A 1VAKA 3AL5A 4CDUC 1WD4A 1ZYBA 4U2AA 3CLPA 3ZXKA 3HWJA 5FY8A 2P3YA 1QXPA 2W92A 1R1ZA 1DLLA 4DINB 3BVCA 1YFUA 2WWUA 3KT1A 2XLGA 3FC0A 3G6JB 2X09A 4QMAA 1JUHA 2CGOA 3GCXA 4N90A 3U78A 2VM9A 5FY5A 3ZSJA 4FXKB 3ZPOA 5BNQA 3LEMA 1GYKA 3C7GA 1K3IA 4Q5OA 4UFJA 1OOPB 3VDDA 5IVVA 2FCVA 2N7GA 1D4VB 1IZ3A 4XXPA 2CY6A 4QKFA 4WVVA 5FJKA 2XL7A 2VOTA 5IK5A 1DLCA 5L7OC 4YW1A 5FZIA 3POYA 3I59A 5FUIA 1YEWA 2DTYA 4O9GA 3JB8A 3KS7A 1PO23 1WZXA 3LA7A 4NRMA 4EWAA 4YFZA 5CG8A 1MZFA 3TN91 2OQ7A 3WF0A 1CX1A 2C5DA 5C33A 2X5IB 3MI8A 5IFTA 1FPN3 4NHMA 2VQ0A 4QQHA 1HJGA 2ZJCA 3JD71 3M3IA 4Q4V1 4CXWA 2ENRA 1D2SA 1VBE3 4BQ1A 1UCXA 3B00A 5ACA1 1AVBA 3RI8A 2HWD1 4MXVA 4C1WA 2UY8A 2QDRA 3NJYA 2WSVA 2RDNA 3VZNA 3ZIWA 1AX2A 2D6PA 3MIBA 3ECQA 5J7MA 4LBOA 3USSA 1Y7BA 2CTVA 5JOXA 4TXWA 1OHFA 2OVUA 1AX0A 2QQWA 1K5MB 2BNOA 2GC0A 1U5YA 1CESA 3MIEA 3MICA 2WAAA 4QGMA 4UFHA 4YFWA 1YRZA 3WR0A 5CFCA 1UU4A 4J25A 4YGBA 4EN0A 3FHIB 5HV0A 3BCWA 3OEBA 3IT8A 2P3JA 4Y20B 5JZGB 3OY8A 1W8HA 4XF9A 1HN1A 3S6PA 4NE9A 3MZHA 1VMFA 3AB0A 4B4RA 1VBC1 5A3PA 2PAEA 3FUQA 1SCRA 4JKKA 1W6MA 1JU4A 2RS31 2DF7A 1PVXA 2FDHA 4Q0UA 4AFDA 1UZWA 2WS91 2XJVA 4LITA 1FV2A 1CVNA 1SHWB 3ZR5A 1AR72 4GIQA 4XFFA 4A7ZA 2AREA 4AEMA 2HBTA 4CDUB 2ORZA 3MYXA 5H9QA 3NV4A 4BCUA 5F5AA 3U0ZA 1W6NB 1Q56A 3RMYA 2PHDA 1R64A 3OCPA 3ZXAC 3JCIA 4LIUA 3ZXEA 3POEA 3U37A 3WNXA 4AI1A 4CE8A 1SBDA 4EWEA 2GMEA 2WQ4A 4AXOA 2WA3A 2RJLA 1C8M2 1SBFA 1QDOA 4A3XA 4CCJA 3G7DA 1RHI2 2EAKA 1VP6A 3Q8CA 3WV6A 3ZYRA 5DZGA 4Q0VA 1SLCA 4XFCA 4WVZA 3NRUA 2AR6A 4QX1A 5KHHA 4LO4B 4AHZA 4YW7A 4DY5A 2W1QA 3URFA 2Z79A 3A0KA 4DXZA 1LAJA 4N9IA 1EV12 3A21A 2X05A 3L2YA 5DPNA 3GJBA 4Y4RA 3ACFA 4EN9B 4L0PA 4MVTA 4YG0A 3WG3A 3VL9A 2FDJA 1GWKA 3FHAA 1YIPA 1W99A 1IS6A 4A41A 2ZS6B 3Q8AA 5LBFA 2EIGA 3DYMA 2X5IA 4CUCA 4W6XA 5B2GB 1TME2 3T0AA 5C3RA 3CMGA 1HW5A 5FXXA 3ZYJB 3OTFA 4YARA 2P34A 4RSUA 3FE5A 1X36A 3IWZA 4GWMA 1ZBA2 2J1EA 2YBPA 3WW2A 2Q0AA 2H0VA 4DO0A 2VZOA 3PHMA 2YPJA 2EALA 3IN9A 1IGOA 1VR3A 3SISA 5JSOA 2J1VA 2QQPA 3H3UA 4KWJA 3T09A 5CA6A 5FY0A 5KR7A 5LY1A 1PZ7A 2VBPA 5EZWA 5FP3A 4Y5TA 3LEIA 4NAMA 4P14A 2BBAA 4JAAA 4PF5A 5GM0A 3FUOA 1X8EA 2LM3A 1JYXA 1H8VA 4X6RB 2DVAA 4XUTA 1AR71 5JUVA 2A71A 1W9YA 4CU6A 4QM9A 2CWMA 2YDEA 4AEKA 4BISA 2Y64A 1WW6A 4XCBA 3ON7A 1F5JA 2JG9A 1H9PA 5LRRA 1W2NA 3M3EA 3I4IA 5CU1A 2JDYA 2WYSA 4JTNA 3ES4A 4F83A 1ENSA 4XUQA 1C8M1 1LOFA 1JZ6A 2VMCA 1RHI1 4FCAA 1YHFA 3THPA 3WNLA 4TLFA 3VKNA 4D69A 3OOXA 4PLNA 1JYTA 2D40A 2UWCA 5FYHA 3UKVA 1XU2A 4YLZA 1LGCA 1H2MA 3H1WA 1A3KA 4J1WA 2OUHA 1R1A2 4CDXB 5F7UA 4P9LA 3X29B 1NE6A 2ILMA 5H9SA 3UYJA 1EV11 3PUQA 4WM7A 5T50A 3RJRA 3IDCB 1V6MA 2K0GA 1O59A 1F15A 1SQ4A 3LKJA 3RYKA 3LF7A 3RS6A 3AMPA 3UESA 1KQRA 2FHRA 2YZ4A 1ZRIA 2HWE2 1S0FA 3D0JA 2Y33A 2Z69A 1NA1C 2L9LA 3TN93 4ASKA 5FAXA 4LMFA 1LGNA 4QXBA 1WD3A 5LATA 3WCSA 4A42A 1F5FA 5DAXA 2Y0IA 3GM8A 5F5IA 5L19A 4HL0A 5FY7A 1TME1 4Q4V3 4IESA 4UFLA 4AQSA 4PDWC 2P3IA 2YHJA 5HCHA 2KA3A 4LE3A 3K4AA 2VNOA 5AVAA 1WLCA 1ZBA1 3AMNA 1RB8G 5I8YA 2JKXA 3I2HA 2GZWA 3WSOA 2XJPA 2QQVA 4IEVA 5T54A 3POBA 3ZN6A 1S0JA 4AI9A 3C7EA 1BYHA 1VBA2 3NQHA 2B9VA 3M8LA 1CZSA 2ADDA 2KM2A 1G9CA 5JR2A 1ZM1A 4P9YA 1N3OA 4PIYA 1X8MA 4JGZC 1JZ5A 3HNBM 2XJTA 5IVYA 3KCYA 1VBC3 4DRRA 3IKWA 5JXHA 2ZHLA 1ZRDA 3GDBA 4DFSA 2ZEXA 4XEZA 2JG8A 5GZGA 2SBAA 4KGGA 4V2WA 2VUJA 2WS93 3DPRC 3OGGA 2A7AA 2BTVC 5DXDA 2LRPA 2CL2A 1NLQA 5I8TA 1KS4A 1OC1A 5C6CA 2QNKA 2XONA 3AP4A 1LEMA 4AQ2A 3ZYFA 1LOAA 3CBNA 3KT4A 4KU7A 2LUWA 1C5HA 5LK7B 4HPKB 4L8QA 2HWB2 2BJSA 3HQRA 3WNPA 4DOUA 3IZOA 4COWA 4OULA 3POGA 5C4WB 4XOGA 1UY1A 1VB2A 3P5BA 3PDQA 5H9PA 5BNPC 2R1DA 2G9ZA 5I93A 4FOYA 5E16A 3WW3A 3ES1A 1R1A1 1WCQA 2YBKA 2BBVA 1IPKA 1KDMA 5F8PA 5J1XA 2JDUA 1GQGA 1Q8PA 2ZA9A 1B35C 2BERA 2QQUA 2R6QA 1G9AA 1NA1B 4CDXA 2OKXA 4XIOA 1BHGA 5HCAA 4I30A 2QUOA 1MACA 4MV2A 5FYIA 3RJ2X 2E7TA 1O7FA 2HWE1 1Z0HA 5FZ3A 4EQVA 4QPYA 4I02A 4PDWB 3ETQA 4XABA 1L3JA 1YO8A 3VBRA 4AOCA 1GWMA 5KXCA 1MZ5A 1NE4A 1FOD3 1HIXA 1N1TA 4DUWA 5CFDA 4K21A 5A32A 1B09A 1ZBE2 4P9GA 4ZXKA 2VC9A 3IPVA 2WZPP 4CTEA 1F35A 5FV3A 1UN1A 4IE6A 1TNFA 4FPJA 5FPXA 3D6EA 5JOWA 1DZRA 4UOJA 2JDAA 3PJQA 4ORFA 1UW8A 1LENA 5DAQA 2G19A 2JENA 1LB2A 2J1AA 4YW6A 4IDZA 3I7DA 3J7HA 4P9WA 4PLMA 3W58A 4BIFA 1DQ5A 4JGZB 5EJ1B 3P3NA 3JB4C 4NWVA 1VBA1 2CHHA 1C57A 5I0SA 4K8RB 3SKJE 3KQ4B 3NKGA 4XCAA 4M4RA 4QDRA 1XNDA 4QXCA 5LBEA 4DPNA 3KCCA 1PNFA 5J3UA 3PU8A 4QAWA 1S0GA 4KWKA 4QQ2A 5ABJC 2CDOA 2OZJA 3H7YA 5LBBA 4IEOA 4WVMB 5I0TA 2HEWF 2EIDA 3C7OA 3ROUA 1CX4A 1V6KA 2WNVA 2IFRA 5BYNA 3VBSB 3K51A 2LALA 3C3VA 1CPNA 2Y6HA 4V1PA 3DYOA 2KR2A 3KGZA 1NCRA 1VAMA 2JDPA 1Y9MA 3AKSA 3MEPA 3PVEA 1Q8QA 4A4AA 4PBPA 1QEXA 2O14A 1AR73 2X53S 1JUIA 2QCSB 4XFGA 2GP5A 1JXNA 1J59A 4LLFA 2YGMA 2ET7A 2DFBA 4LBJA 4YGDA 2ERFA 2WFPA 1XSRA 5BNPB 2XLFA 2NM1A 4JRLA 4QB1A 1BEV2 2IUWA 2ZAAA 2HWB1 4O65A 1P8JA 3B02A 1OVSA 5D1IA 4D94A 5HXVA 1BZWA 5A3OA 3ZFEC 2P6CA 5A7SA 1OLRA 3VHPA 1R083 3BB6A 4HPKA 5C8CC 1C8M3 1ZA4A 1FAYA 4IGOA 5FZ1A 1B35B 1RHI3 4JHZA 1J1LA 1UKGA 3ITQA 1XOYA 5CADA 4TWTA 4AI3A 1QXRA 3LEGA 3PUAA 2RR13 4MH0E 3ILFA 5FO9B 1CAWB 4JQTA 3LIGA 1LESA 2WDBA 2XBO1 3D3AA 1RUG3 3VBOC 3DKWA 2OQ6A 5DQ0A 5FJHA 3PNAA 4IEUA 1QJX2 2XOMA 4ATEA 4OI4A 3S30A 4FOQA 4CP9A 4RQPC 3ACIA 5C8WA 4AEDC 1I1EA 2B9UA 1PO12 1RJ7A 4A44A 5LEJA 3JU9A 1JYVA 1RL3A 1DHKB 1ZBE1 4WM8A 4C8DA 3FFZA 3GBFA 1UOJA 5EXOA 4ZHNA 3AJZA 3AVSA 1GR3A 3KQRA 3K77A 3K4DA 2IXHA 2J1SA 4LOSA 1TME3 3S0MA 2XXZA 4FSJA 2XHKA 4NHLA 2J1RA 3UGFA 1ZBA3 1MZEA 2P2KA 4LXLA 3SEEA 1OD3A 4XHXA 1W6PB 2EIEA 3F2ZA 3WOGA 3CNAA 1O3QA 4PT6A 5F2WA 3WG2A 5IJRA 5KHJA 4IE0A 3ZFGC 3A22A 1JYWA 3USUA 3PVBB 5SV8A 5FMBA 4IXLA 2J1UA 3DCQA 4N7UA 1UAIA 3F95A 5E89A 5IFPA 1AR62 2P3KA 4CU8A 3DXTA 3SH4A 5BXXA 1AXKA 4E9KA 1WLTA 3R4DB 4H14A 4DUVA 1SFYA 1KD7A 2WC2A 4CDWC 3VBSA 3POJA 1REDA 2FBEA 1GU3A 4M3CF 1PK6C 1QGLA 3A23A 4N43A 3ZFEB 2XDVA 1QIQA 1RGSA 2RHPA 3AYEA 3EMRA 2A3XA 4FPOB 1HX6A 2W1UA 1NY72 1ZZ6A 1OA2A 5DAVA 1BEV1 3VDAA 3LEKA 3B01A 3WINE 4AI0A 5IK4A 1GUIA 1ULPA 1RUE2 2WL1A 3AKTA 1DGRN 1ZVFA 3WVJA 5FZ4A 2VGDA 2QQLA 1XB9A 4XQDA 1J83A 3GZAA 1FX5A 2ZX3A 4KH9A 1UXXX 5DAPA 5FYZA 2G4IA 1G9BA 1SLAA 4OUMA 4HN1A 4S2HA 4EE2A 2BWAA 2WO1A 4I0AA 4ARYA 3AFGA 1R1A3 3ZXDA 4IUGA 2VZQA 2J7MA 3WDTA 4FAGA 1GMMA 1UOGA 3IIAA 1V6OA 4SLIA 3WHTA 3CHXA 4OHXA 5BNNB 1TMF3 1W2OA 1CN1A 4CCEA 2WQ8A 4FP3A 1CAWA 1QJX1 2WN2A 1UD1A 2FDFA 4WV8A 4FO9A 2TNFA 3J7NA 2FMYA 1QMJA 4HKOA 4HT1T 5B4NA 1GQHA 2WBKA 2CNAA 4E2GA 1MS9A 3AJYA 1PO11 4UW4A 5FO8B 2EXIA 1NQJA 1BXHA 3LA2A 1LHNA 3OYWB 1XNKA 3PU3A 5DZEA 1UZ0A 1W0NA 1YFYA 4XFHA 1JYNA 4HBNA 2NLRA 4ZXEA 4IV1C 5FY1A 4OI2A 4NJ4A 1QQP2 2ZX1A 2CV6A 3ZFGB 5FZ6A 4AVVA 4CUBA 1Q8OA 1JTZX 1W0OA 2WWSA 4HVRA 1OI6A 1W2TA 2RS11 3VBUC 1VBA3 2RM22 5FYMA 2ARCA 2V09A 2W91A 3U75A 1W6PA 3LGRA 5DUXA 2JD4A 4OHWA 5BNNA 1PK6B 2CYFA 3CJIB 4IE7A 1SPPB 2GH2A 3IMNA 4YNIA 1QOSA 4RFRB 1AR61 4M0NA 4RFT0 1RUH2 4M01A 4AE2A 1RVF2 2Z5WA 2XJQA 3ZFFC 5A33A 3AXDA 1E5RA 4BDVB 1O5LA 4M00A 2FQPA 4A2UA 5IT6A 1WCKA 4D0QA 3O12A 4UYBA 4IE4A 4CCLA 4DNYA 5JLVA 1UO9A 2E7QA 1PGL2 3ZYBA 3BN6A 1DYKA 4N53C 1NY71 3C7HA 4IV3C 2OX0A 1XQNA 2ZKLA 4HG6B 1ASJ2 1RUE1 2RG4A 3ELNA 4E27A 5FBJA 2HWB3 4LLOA 4ZS3A 4QPIC 2YC2A 4RR3C 2OW4A 1RYYA 1OFNA 1S2EA 1NCQA 1EY2A 1ZNPA 1K42A 4IL7A 5A3LA 1OT5A 1XNBA 5FXVA 3T2TA 3PTYA 4S2GA 3RWKX 3J4UH 2ZXQA 1FXZA 4WZFA 5GZDA 2R0HA 5A6YA 4BM8A 2NMNA 2BPA2 1OUSA 4HLTA 3VN4A 3A4UA 1N47A 4FOWA 3W21A 4BWOA 4S2FA 1V9U2 1ULOA 1GP4A 1SZBA 4GJYA 5SV5A 3QD6A 1NZCA 4AZZA 5CBLA 2OPKA 4HN0A 2ARBA 2B4KA 2WFF2 1PGW2 1KITA 2W1WA 1CJPA 2X8KA 2ZHKA 4ZPIA 4CPBD 4PI2A 2YBSA 4C0BA 2ES3A 4XUNA 5GALA 1XE0A 5FUPA 4JKLA 1QJY2 4EN8B 4MYEA 5FWEA 4A6SA 3VKLA 2XWJB 3Q8EA 3BIWE 4F7ZA 1ZBE3 2VTXJ 4LR4A 1CAVB 1SBEA 5ACA2 3OYWA 1WW4A 4PBOA 3RDIA 1ZX5A 4AQTA 2VTXA 1IQDC 5A1AA 1QQP1 5HI0A 3MFAA 3VUOA 1AJOA 1W04A 3C2UA 4PCRA 3ZYPA 3I2KA 3IIIA 4CCOA 4RS5B 1PVC3 4I09A 2D43A 2HYXA 4M3CB 1G9FA 2RM21 3I2FA 4Q4Y3 3VD7A 1KDKA 2F17A 3ZFFB 3AZZA 4A6OA 1G86A 1QHDA 1D4M2 4JDOA 4XJZA 3T30A 1CAUA 2PHFA 4XMIA 1D0HA 5KXEA 1LHOA 2VMGA 3AP5A 2RS32 2RMU3 2YXSA 1RUH1 3R4UA 1RUOA 4N53B 3CJIA 1L7RA 1SPPA 4COYA 5F3CA 4FXGB 1RVF1 4Y22B 4IEYA 4HZFA 4NN0A 3M3OA 4URTA 4YSFA 3FHQA 5KHGA 2UURA 3BIEA 1QH7A 3ZX7A 5FPVA 4NHXA 4QPIB 4LKSA 1Z78A 1PM4A 2DU0A 1PGL1 2GNDA 3K2OA 2CGNA 3LB9A 1T6BX 3CDZB 1NT0A 2FCUA 1ASJ1 1YQ2A 2VBDA 5G05L 4Y24A 1COV2 2ZTNA 2X10A 4NRQA 4XBLA 1JZ3A 4E4HA 3KF5A 2WNUC 1ULEA 3AXEA 4YZ1A 3AVRA 4QB6A 3OBZA 5IVFA 5IVCA 3KT7A 5CNAA 5FZHA 1S0DA 4G9SB 2YU2A 3QH7A 1C3HA 2W95A 4QX7A 4ASMB 4QD2A 4Q8LA 4HFSA 1PMHX 4GJZA 4N8MA 1ZA7A 3FLTA 4YGEA 2AGSA 3KSCA 1BMV2 4YPJA 3O0WA 1V9U1 1NG0A 5LWBA 2C0ZA 2ZX0A 5BV6A 1JU3A 4UI9L 1LGBA 1UY3A 4L11A 1ZZ7A 2LROA 2Y6LA 2WFF1 4OHVA 1O4YA 1PGW1 1JODA 4PJYA 3T1LA 5D8AA 2D5FA 1QJX3 1W2AX 4CYDA 1MS4A 1O4TA 3NNJA 4KG0A 4DMIA 2FDKA 4LKEA 1OFSA 1QJY1 2O1QA 3NAPB 1MQTB 1PO13 2YV8A 3KM5A 2QE3A 4QM8A 1VMJA 4HVOA 4XTMA 5E6HA 4ZS2A 5C3QA 4EV0A 4PLOA 4BMBA 3MF6A 5EPAA 2V72A 1HV0A 2ZGOA 3S7EA 4YZ4A 3U4XA 5A3UA 1UPIA 4XF0A 3LFIA 1US2A 4O9EA 4LBLA 1YYNA 1CAVA 2ZKNA 2F4LA 1C1FA 5IAVA 3SCGA 2DDUA 3ILNA 1RUD2 4NROA 3INAA 4DXTA 5C9AB 4LBNA 1VAVA 4QKDA 3WP6A 2B7YA 1L7LA 1AYM3 2GP3A 3DXUA 3KLSA 4QU1A 4FBFA 4F3JA 1LJ7A 1EAH2 1XYOA 1ND3C 2MHFA 3T4HB 1ND2A 1WMDA 1XSQA 4IEPA 4RS5A 1LKNA 3QH6A 1D4M1 4GWIA 1WCSA 5GZCA 1H8TB 4YWAA 2PHLA 4YRDA 3ZM8A 1HQNA 1E57A 2A6YA 4GH4B 4LK6A 5A70A 2CAVA 4GD4A 5A7PA 4HOOA 4XURA 3UETA 3W5NA 1GANA 2GN3A 5H9RA 4LIVA 1A8MA 4KU8A 4NR1A 1REFA 4XBQA 1O3RA 1D0GA 4Y22A 4LHKA 4BQXA 2WNUB 4MGKE 1CPMA 5FK7A 4S2DA 4K1YA 1AL22 4IW3A 1F2NA 1JYCA 2BWCA 2VOXA 2X29A 2Y26A 1HN0A 3OBAA 1JHNA 1KXGA 2WRAA 1RINA 1T2XA 1F31A 5JSPA 4NWWA 5KC6A 5LEKA 2VCCA 5KXBA 5DDJ3 1COV1 1YCIA 3PJYA 4OUEA 4BQ2A 3ZXGA 1VMHA 1IG0A 2QKDA 2WAOA 5HXMA 2JDNA 3T4VA 2GC3A 1AR92 1JYIA 1U0AA 1ONAA 5L7OB 2CGPA 2D98A 2JG8C 3DF0A 1BMV1 1OURA 4XFIA 4FAHA 3EQEA 2YU1A 4DEVA 3UKNA 1NQDA 3THCA 4MADA 1OOPA 4DXSA 1RUF2 5FYVA 3MIGA 1H1AA 2PHWA 2AEZA 3OGSA 3WY6A 2DVFA 2GC2A 2ZGMA 4KMQA 4MX3A 4FQZA 4P00B 3HBZA 3L9JT 1H9WA 4Q0QA 2ZHMA 2BEOA 4COVA 1EUUA 4MGZE 3MPPG 2GU9A 3OGVA 3NAPA 2VUCA 2WO3A 4UFIA 3ATGA 3N9NA 2I07B 3ST7A 1YWKA 3S5AA 1F4AA 4J1XA 2C24A 4XAAA 1S1AA 2D97A 4HSJA 1ND3B 5FQ0B 3TNQA 1RMU2 4NPLA 1POQA 2IWGB 2ZGSA 1RUD1 4NIDA 3IBMA 4W50A 1QQP3 1DF0A 1XNTA 2WT1A 3ZYIB 3JQXA 4JGYC 3THDA 1VALA 3R0RA 5CZKA 3SITA 5C9AA 1EAH1 2EVXA 3M3CA 4FPHA 2P5BA 1K5MA 4NVPA 4R9BA 2RM23 2E51A 4LK7A 2XVGA 1SLIA 4XF4A 4Q4W2 4R52A 4AAXA 1UOFA 1OQDA 1OUXA 4Y20A 5JZGA 2G1MA 1IS3A 5FLIA 4Z07A 3WZ1A 3BTYA 1RIRA 4MZUA 4MLOA 2W2IA 1QOTA 3B93A 1F4HA 4XW3A 5E1RA 2YB7A 1W28A 5IVBA 1CONA 3RZLA 2PLV3 1RUH3 2CSGA 2LS6A 1ST8A 2VMIA 5JWPA 3AP9A 3V65A 1H2KA 4GH4A 3WLUA 4B1LA 1LOGA 1AYN2 1RVF3 3PIJA 2QZ3A 1SLLA 5JMOA 3RZKA 1QXJA 2O8QA 1OLMA 1AL21 2R062 4CDUA 2YUEA 2WNEA 1SLBA 1W6NA 5F6LB 5LK5A 4B8EA 2DWRA 3W59A 3IDAA 3N9MA 4UF0B 3W5MA 1WLWA 5FFOC 5JIAA 4QX3A 2BDRA 4XACA 5LB6A 4AVAA 1N3QA 2HH9A 3K3OA 3Q8BA 4NIGA 4KGQA 1AR91 1W39A 3POFA 1S0IA 3KWVA 3LQCA 5ANQA 5FYBA 4E4SA 4Z2AA 1FATA 3BTAA 2JIGA 4WBBA 1PNGA 5L7OA 3HN3A 4XUOA 2HWF2 5IATA 4RL7A 1XC6A 4GMP1 1LR5A 4A7KA 1WCUA 1Q8VA 1RUF1 1H4HA 1LECA 1MEC2 1V9U3 2RS52 3AZWA 4QKNA 3UJQA 3VZKA 3WF4A 5HPOA 3NNMA 1VBB2 3FJSA 3NV1A 1V6IA 4Q29A 3AK0A 4QT6A 2K2SA 4AGVA 3ETPA 1UU6A 2WZ8A 5FMOS 1K5JA 2WFF3 3VD4A 3J7MA 1ULCA 3ZYHA 1DQ6A 4HKLA 2DUQA 4BA6A 4HONA 1AR82 1RUC2 3UK9A 4BYYA 3H0OA 1QJY3 1I9RA 1H1MA 2GC1A 1HXS2 1MS8A 3VKOA 2PYTA 4OLLA 3LOIA 1OA3A 2YFZA 2VXRA 1WWYA 3JD73 2ZGLA 1XE8A 3PUIA 4INDA 4CDQC 1RMU1 5ACA3 5I8SA 3WUCA 2DVDA 4COZA 2HWD3 3I97A 1YFXA 4ISQA 3AL6A 3EB7A 2YY1A 1WCDJ 2VO5A 4AAPA 5FQ0A 2DURA 2QTWB 4RGAA 3IAQA 5IK8A 5F1RA 1CAXB 3E5QA 3NO8A 4JVAA 2ARAA 2D6KA 1Y43B 4K9SA 1WMXA 4Q4W1 4OYUA 2XUMA 1RXFA 3AMHA 5CKNA 5FZGA 4E4DX 1D4M3 3OUIA 4WM8C 3V56A 2QVSB 3ZN4A 3ZXFA 1FMD2 2RS33 2D6NA 2VCBA 3I54A 3MHZA 1O4ZA 1PZ8A 4Q8KA 4M0HA 3LD8A 4F8AA 5I0RA 2J1TA 1AYN1 4MXWB 1DQ4A 2BGOA 2VQTA 5BNOC 1JI6A 4GZ9A 1J3RA 2R061 2UWAA 3GGLA 4J6GA 1BJQA 4LUMA 4I3GA 2W0XA 1QWRA 1K45A 5F3IA 4O7XA 2P4EA 3N9OA 5FDBA 2YC4A 1COV3 1UPSA 3HIFA 2DU1A 1J84A 3LOBA 5CKQA 4ET7A 3H42B 5F5CA 3MO4A 3BALA 1J1TA 3BYWA 4NPMA 5LA0A 1RUJ2 4G3YC 3O1SA 4GWNA 1UMHA 5C7GA 3CU7A 2A1XA 4I2OA 4XF3A 3QBQA 4ISRA 2Q1ZB 4MUVA 2HWF1 3N7JA 4Q1PA 2KD7A 1SMVA 2XBO2 1PX3A 2RS51 1MEC1 2JXAA 3N9LA 4A3ZA 3MIFA 1RC6A 4QPGC 3RZMA 2QQMA 1VBB1 3N7KA 5L9VA 2IC1A 5GLZA 1YQ6A 5FZOB 1VBD2 2YYOA 1GWLA 4C0HA 4CDQB 2EF6A 2JB4A 1AR81 1RUC1 5JCTA 2G9GA 1LOBA 2RE9A 1HXS1 2D44A 1ZZCA 1NAEA 5FO7B 4XZUG 3RZJA 1G9DA 2VXJA 1S0CA 2WR9A 1E5SA 3IDEA 3N7LA 4XHBA 1TVGA 3NJZA 5IYYA 1XNAA 1C28A 2BP6A 5FYSA 4Y5SA 3RFRA 4JQRA 4L97A 3HEIA 3E6BA 3HT2A 1RUD3 3VHNA 2CU5A 1V0AA 3MDPA 1KFXL 3OG2A 4BQ3A 2H6BA 5L36A 2YGLA 1DDLA 3AKPA 1WW5A 5F3GA 1GKBA 4OZXA 1GBGA 5FZ7A 4DB5A 2IVIB 4QU2A 1EAH3 4Y26A 2HKXA 1CAXA 5D21A 1OQ1A 3RYRA 2XL9A 3DPRB 1BQPA 2Q4SA 2O0OA 5EYYA 1MZ6A 2XR4A 5J37A 2OA2A 3MV01 5ERLA 2E31A 3SH5A 5IW0A 3S57A 1FMD1 3POIA 1ZZ9A 5A3NA 1WBFA 2ZZQA 3WF2A 3SH3A 5DMYA 3H1MA 2BRTA 2UYBA 3VBFC 3WDXA 4PF1A 1VLNA 4OQ8A 2ZMKA 4P02B 4ZONA 4UT5A 4YVWC 4E4ZA 1GSLA 4EYUA 2BQPA 1WGPA 4JX0A 1X33A 2WNOA 2B42B 1UYXA 5EQUA 1OPOA 2JKBA 3UGHA 3WP3A 4CA9A 1DQ2A 3LDBA 1DGWA 1O5UA 1AL23 1GZWB 1UOBA 3U1XA 1LHUA 3H1YA 3M7AA 3V0AB 5FBZA 4N9HA 4YW4A 1RXGA 1BVP1 4QQLA 1ENXA 4CU9A 2WO7A 3WDVA 2EXJA 4YW5A 3PURA 3UV9A 2VOKA 4AWDA 5IAXA 4AHXA 4UFMA 4GKXA 1NOVA 4XYXA 1SDDB 3OPWA 1W0PA 5C4WA 5LZ6A 4QPGB 1AR93 2AACA 4XJUA 2ZOEB 4ES8A 5IK7A 1RUJ1 1GFF2 2HYKA 3LZZA 4AHWA 2Q8DA 4TN7A 3T2OA 4YZ2A 3VHOA 2DVGA 3I3BA 5DG1A 5J98B 1G7YA 4AI8A 2CWSA 1EV13 3GZTB 3T0BA 1NA1A 3N9PA 4B1MA 1AZDA 4DUXA 1VBD1 2A5ZA 4XJ8A 3BU7A 4YVSC 4CEWC 1Y3TA 4CUAA 2VUAA 1YI9A 1SG3A 5F9TA 3GF6A 1QNWA 5FZOA 5FRAA 1GOHA 1OH4A 3OF1A 3RPQA 4PDWA 1WBLA 2PHRA 4I0BA 4YG6A 4CP2A 3PIGA 5F2SA 3PMSA 1SACA 3KVBA 1TQ5A 1DZTA 3JQWA 3I2JA 2BFUS 5C5TA 1NLSA 5JMCA 2BNNA 2LTNA 5F6KA 3K75B 1HRV2 1Z7S2 2YMZA 2J42A 1RMU3 3ENRA 4EN7B 3VBHC 1GQPA 5FXZA 1NKGA 4AFBA 1OLQA 3T0DA 4FTBA 2VCMA 3BGAA 5ABJB 4QGNA 4BLIA 4XMAA 2BGPA 1S2BA 3O1UA 3JBG2 4QX8A 2RS12 1J3QA 3L2HA 3BPZA 4JGZA 2ZCWA 1OF3A 5A3WA 1HB1A 2ZEZA 2UU8A 4MGQA 3RMXA 5K0UC 4EJRA 2PQSA 3S5QA 4B7KA 1N1VA 4HMZA 2AH2A 5HBAA 1M4WA 4RHV1 5LA9A 4LBQB 4OMCA 4Q4W3 1SFNA 5KWRA 2WA4A 1SCSA 3I2IA 4OFGA 2BVBA 2E63A 1MS1A 3DPRA 1UIKA 5M0TA 3OB8A 4XETA 3GXUA 4WVMA 4AHYA 4MG2A 4B4QA 4GB32 3B9CA 1ULFA 4FTSA 2C9KA 2VZUA 4Y1VA 2JD9A 5C3OA 5FK8A 1UZZA 2JE7A 3ACGA 4H55A 4QX0A 2EICA 1AYN3 4YGCA 4OHZA 3T2PA 4CPBA 3HNYM 5C8CB 2B8MA 3K48A 1Y9QA 1W8NA 4FPKA 2WZEA 2E33A 4XVHA 2R063 5AFEA 4NHKA 1UL9A 4BMEA 5KBFA 4KBZA 5FYTA 4CEYC 2W47A 4BXFA 4LUKA 5BNPA 3LDRA 4TSVA 1GZWA 5FKCA 4Q0SA 3KV6A 2QDNA 1W6OB 2DBNA 4WVWA 3IB3A 5GLVA 3AZVA 2VY0A 3MLJA 3VBOB 4JC1A 2VW0A 3ABZA 3KD4A 4FPFA 4AG4A 2ZX4A 3MLKA 4OQ9A 1B35A 3DL3A 1JBCA 1K12A 2ET1A 5FWJA 3T08A 1OD5A 2VG9A 3JUUA 1APNA 1YJKA 2ZGRA 4R8HA 4RQPB 3WXPA 4AFMA 2OIIA 1W9WA 2XB6C 3FZ3A 4AEDB 4BIOA 1QKQA 4CEWB 1JOBA 2D3SA 2WLPA 3OUJA 2JDZA 1DCSA 4QX2A 2ATFA 3E5XA 5F5QA 3TRSB 3ZMNA 5JDBA 1UIJA 1HQWA 2BW8A 1HDKA 1RITA 4K6BA 3CKHA 3UKTA 3WX5A 3K3NA 5A7WB 3CQOA 2XJUA 2FD8A 2VUDA 2HWE3 2VZPA 4BQYA 1JZ8A 1DQ1A 3HOBA 3WG4A 1DG6A 3C8XA 1Y9GA 3M70A 4I3PA 1AR83 1RUC3 3VBHB 4NRPA 2W94A 1VE0A 3DUIA 4QGLA 4XJWA 3WUDA 2FCTA 4I01A 2JE9A 4AYUA 4ES9A 2ZMNA 2VOVA 4BPZA 5JXJA 1OMIA 2R49A 3VDDC 4LQRA 1HRV1 1TE1B 1Z7S1 1JMUB 2VAUA 2WLQA 3O1VA 4BH9A 2WJSA 3BTZA 3TWIA 2TEPA 3KB5A 1H2LA 3GYDA 5GZEA 4JRAA 5FLHA 1HJFA 3JBG1 3GHMA 4XBNA 3ZXLA 3AZYA 4B29A 3WNMA 1DU3D 1X50A 1UYPA 5ABJA 2ARXA 2B39A 1OPMA 2XVLA 2A6ZA 3SMHA 4CDWB 2NP0A 1VB4A 2BNMA 1PZ9A 2OS2A 3H3LA 3ZR6A 5J36A 4Y33A 1BBT2 5F39A 5T5JA 2D3RA 1F9KA 2WZR2 3TBDA 1ENQA 3POWA 5E88A 1LHVA 4Y3OA 2WT2A 4GB31 5C3PA 5EYXA 3EJKA 4RA0A 4FP2A 4PI0A 5T3NA 2XLAA 1QNYA 5FZ0A 2IXCA 5C70A 3OBTA 3HMYA 1ULGA 2AZ5A 2XKPA 1XE7A 4IEQA 3ZFEA 1LU2A 5C8CA 3P1IA 5CFCC 4UW3A 4Z8BA 5FOJB 1YFWA 1SFPA 3CZJA 2G9FA 4IETA 5CAZA 2PAMA 3BODA 3RZGA 2XHNA 3GALA 3MBWA 2YFUA 3AZXA 3WD5A 1EP0A 2HEVF 1EYBA 1DP0A 3ALQA 3TEXA 1W6OA 1E5HA 1CWPA 1IKPA 3DGTA 3VBOA 1KS5A 3O1TA 4R4XA 1W9TA 2GMMA 1HRI2 1ZZ8A 1U5XA 2R1BA 4RQPA 4FPCA 2WIIB 4AEDA 2H0BA 2XBO3 3AC0A 1AXYA 3WQ0A 5FIXA 3WDYA 2WUHA 1WA6X 4GA9A 5FZ8A 1CQ9A 2VZ3A 3MIDA 3UGGA 4BZ4A 5A3MA 1DQ0A 1YIFA 3WNOA 4UFKA 1VBD3 1VRBA 4IV1B 3ILRA 3VZLA 2EAAA 3MF9A 2YPDA 1D7PM 2DTWA 4XE9A 1J58A 3H50A 1V70A 1W3VA 5FY4A 2V73A 5B4XA 3WEZA 1W8FA 2ZEWA 4KNCA 3FBYA 5ANNA 4FTEA 3VBUB 5JAXA 1JHJA 1I5PA 4C1XA 2VECA 5GLTA 1IPSA 1POV1 1Q8SA 2HBUA 5EP9A 1GLHA 2D6OX 3AYDA 3M2MA 5EHDA 1OOPC 1U12A 1Q3EA 3ZFGA 4MGIE 2OPWA 2SLIA 5T5PA 5I91A 3VLBB 5A7QA 1AL0G 4OI0A 4FPGA 4NO4A 3VB9A 3AM2A 1GOGA 2BUKA 1ENRA 2R7EB 3MLLA 1BBT1 1GOFA 4LORA 2WZR1 1ULDA 3CF6E 4CDWA 3KHCA 2W68A 2R0FA 1PK6A 2X5IC 4AK3A 4D6RA 1F8VA 5CFCB 4IV3B 4FFGA 4XZPA 3HBKA 4FFHA 4PIXA 3H9AA 2PQQA 3GJAA 4P5HA 4RR3B 5FZEA 5EJ3A 1JZ2A 1QJFA 2YC0A 4XDQA 4E8DA 1DGWX 1W6MB 2JWPA 4L2NA 2C9AA 1CIYA 1BEV3 4DQAA 3H8RA 3I2DA 5FP4A 3N36A 4YM0A 4K20A 2JIJA 2Q8CA 4Z92B 1O8PA 3D5OA 3I2OA 1RUI2 2RJ2A 2ZGQA 3E6DA 4XQWA 2ZGKA 5BY5A 3SNMA 2VD7A 3LCPA 3GHNA 4HXCA 4K7JA 4PQQA 4RD7A 5LBCA 3SCHA 1YQ8A 3FFQA 3WDWA 4Z2WA 1ZRCA 2DCJA 3HNMA 3GZUC 1HRI1 2JDHA 4LBQD 3M3QA 3PUHA 2ZHNA 4QB2A 2JE8A 3ZKYA 1XU1A 2E6VA 1NUKA 2JG9C 3IMMA 5FMDA 4QWNA 2MEV2 2OUJA 3DV8A 2P1BA 1C1LA 2W87A 3KV5A 4HANA 5HCFA 4BU2A 4L99A 3ORJA 3EBRA 2W9XA 1W03A 3UNPA 1LOFC 3C7FA 2WINB 1HV1A 1AUYA 1ZREA 2BGCA 4LULA 4XDPA 1QU0A 4P9XA 2GSYA 3RZZA 1HQLA 4IV1A 3WQ1A 4KWLA 1E5IA 3WNKA 2W1SA 5JOZA 1S0EA 2DCTA 4TLGA 2XPJA 1UQXA 2XWBB 3KHBA 2ZAHA 4D7SA 2PMWB 4YW3A 1OKQA 3T2QA 2PN5A 3AP6A 3AMMA 2MPFA 3VBUA 1HRV3 1Z7S3 1ACCA 3VD5A 3OPZA 1N1YA 4WM7C 3SXWA 2TUNA 4AFAA 1DBNA 4MGSA 2RDSA 1OF4A 4YM1A 5K8SA 1W90A 2WQZC 2OXBA 1OA4A 5FP9A 3WNNA 4AVBA 2FZ1A 3DN7A 4GQ7A 1FOD2 2WO2A 4B4PA 4IERA 3I3DA 3JBG3 3RI9A 2RS13 2GH8A 2VULA 4M3CA 4Y4YA 4DZGA 2O8OA 2ORXA 2EXHA 4HSLA 5FZMA 1OXCA 3OD4A 5LA2A 5LRSA 5FZFA 3Q8FA 4FOVA 2F6BA 4AVCA 2ZABA 1YUDA 3ZFFA 3SC7X 3WQ7A 4XDOA 3VDBA 4QQPA 5K4LA 3S7IA 2QZ2A 3DYPA 3NNLA 4XXAA 4COUA 4JTOA 2JJ6A 1AR63 2V4AA 2WKKA 3MFCA 3HVDA 3LPFA 3NJVA 5IHRA 4GB33 2RJKA 4HVQA 4N53A 3FL7A 1KRIA 4AVTA 5FZDA 4A7YA 3VD3A 4IV3A 1C5IA 1OSGA 2A75A 3NW4A 1FT9A 3J8F2 4M3CE 2Z4FA 2BU9A 4QPIA 3U10A 1LTEA 4RR3A 3ZKUA 4YYOA 3TAYA 1ALYA 3MPBA 4KWUA 4NPRA 1STMA 2KXLA 1IHMA 1RUE3 5EJZB 4DRVA 3RQ0A 4UW5A 1HB4A 1RUI1 1CZVA 4LKFA 4XQ4A 1POV0 1LCLA 2JG9B 5FPLA 4D7TA 3SQOA 1CJDA 4NAOA 1UZVA 4ZKTB 4P5YA 2ZMLA 2ETEA 2VZTA 1I3HA 3RRDA 4LBMA 1KEXA 4GULA 1YQ5A 2BVVA 5A80A 2BZDA 1OQEA 1Y4WA 3NSTA 4CU7A 1UYYA 1KFUL 1OBNA 3KGLA 4YM3A 1UX7A 4XTPA 5A7NA 3ZMOA 1R082 2IVJA 2MEV1 1S55A 1A6CA 2VMDA 2JICA 2Y6JA 2ZPXA 1FYUA 4O61A 4JDMA 4MHRA 2R16A 3HD8B 4FT8A 4BK5A 2Z2SB 4GKYA 1REEA 4IGPA 5E8AA 3V0BB 2AEYA 4XPVA 1OH3A 2RR12 2VZ1A 3BKZA 4LHLA 4WM7B 1MQTA 2Y6FA 1WUVA 1XJAA 3ACLA 2D6MA 2I74A 1VRH2 1BK0A 1JS9A 2R072 1RUG2 1UZYA 1V6JA 4LO5B 2VW1A 3MIHA 4JV4A 3O1MA 5L9RA 3J9SA 1BLZA 5FY9A 2QJVA 3OUHA 4URAA 4AGGA 2DYCA 4XFAA 1POV3 1Q43A 5GLWA 4CDXC 4XAEA 2DFCA 5DUWA 3ZLIA 4QHOA 1YLLA 5KXDA 3QLQA 1FOD1 4G4FA 4Y1XA 2ZGPA 2VMFA 4CVUA 3HPNA 5ISLA 3VZMA 1HB3A 5JPMB 3ZSMA 3VBRC 4MOAA 4BLJA 1MPXA 2JDMA 5CFDC 1H6XA 5GKAC 1BBT3 4E2SA 5FPUA 4D6SA 2WZR3 3O0XA 3ZN6B 1H8TA 5I0UA 4QXKA 5FLJA 4PIZA 5IVEA 1UYZA 1FNYA 5CVRA 5FPZA 3IM0A 3GCWA 4LA2A 3ZIXA 5IUQA 1ZZBA 2RDQA 4OVEA 4LKDA 4PQ9A 2ZGTA 4AI2A 5CIRA 3CL1A 5IVJA 3J8F1 3OPTA 1R092 4JZRA 2Y0OA 3POSA 3N7MA 2ID4A 1WMEA 3EXUA 4XFBA 3RWNA 2WNUA 4Q26A 4QXHA 4XF1A 3PMEA 2CAUA 1ASJ3 2JG8B 1TNRA 1MS5A 3QCWA 4K3UA 4LBKA 3SKVA 1NZIA 4UBHA 3B94A 1KGYA 3H8UA 1O91A 4IEZA 4A45A 3FBMA 2FMDA 2WNVC 2XQRA 4AVSA 4D7YA 1ZRFA 4W4ZA 1W8UA 2GN7A 3WCRA 4YW2A 1W9FA 1NCRC 1OLME 1JOPA 5L9BA 4DIQA 5HV4A 1MR5A 2HLEA 4DY3A 1HRI3 5FPBA 3ZO0B 1R081 5JI7A 1FV3A 4IGQA 1EUTA 4QKBA 2QQJA 3I8TA 5A3TA 2W39A 2C4XA 3O7OA 4UAPA 2XG3A 5D2AA 5AFBA 1FNZA 3D4KA 3RYPA 4XJ9A 3ZDVA 2A3WA 4NIHA 3P3PA 3CO2A 2B5HA 2Q30A 3LWCA 3TB0A 4ONUA 5J09A 5FP8A 1XNCA 3OGJA 2RR11 1DYOA 2E26A 3HAGA 4IEXA 1DZQA 4JGYB 2DVBA 2A6VA 1HKDA 1GV9A 2QFEA 4P9JA 4XIKA 3WDUA 1VRH1 2A6WA 2R071 4HK9A 5C4WC 2ZGNA 3V0BA 1RUG1 4KG8A 4B7EA 4CXXA 1TMF2 4FI9A 3KVAA 4AW7A 4QDQA 2A3YA 1AHSA 3AP7A 1ND3A 5FUNA 4KQ7A 2V5DA 3VBRB 2VCAA 5A32B 5CFDB 3VKMA 2DUOA 2AUYA 3IPVB 1SEFA 5EFUA 1PIV2 4Q4X2 5F3EA 3R6SA 1H0BA 4ASLA 2WSUA 1I6XA 3BOPA 2FDIA 4D3WA 3U14A 3NNGA 3WG1A 2VMHA 3JXSA 3NV2A 3QACA 1X9TA 5DN2A 3I3MA 4H2AA 1W8WA 2MNGA 2VPVA 2E32A 2VR4A 4AL9A 2VBBA 5JXIA 1O6UA 2XMLA 2W3JA 3EYPA 3WP5A 2VNVA 1RTVA 5KHKA 2QQNA 2K9ZA 5A6XA 2EXKA 3MW3A 3NWKA 2DCZA 1J3PA 1XPWA 2GNMA 4LO8A 4P9IA 3U4SA 3O5SA 2R32A 1R091 3MV11 1CZTA 4CP0A 5KHIA 2Y6GA 4NOTA 4Y1ZA 4IE5A 2WABA 1S2KA 2WNVB 1DYPA 2YG0A 1IQAA 3VKFC 3H7JA 5A6QA 3DECA 4B3NA 1H30A 1NCRB 4ZU4A 1VPHA 3TYJA 1LEDA 1W06A 1G6NA 1XRUA 4R9DA 2PHUA 2XGXA 3KF3A 2HEYF 1WKYA 3NKTA 4X6QB 2NQYA 2W5FA 2ZBJA 3DKQA 4MSVA 4UF0A 5FYCA 1RUI3 1UY0A 4ZY9A 5JR7B 3MUZ1 3AKRA 4GAZA 4LEJA 2VZVA 5T5LA 5DUVA 2IZWA 4IEWA 1LHWA 3KCXA 3UL2A 1ZRRA 4RGKA 2K46A 2Q8OA 4GWJA 1QDCA 3VBSC 4R9CA 4Q1RA 4N43C 3PVOA 4LTAA 3VHRA 1YI7A 4RGGA 3U11A 2PA7A 1GNHA 1W9SA 1JZ7A 5FZAA 2UY9A 3FLRA 2Y6KA 5JXGA 4AF9A 2MEV3 2RV9A 4YG3A 5FPAA 1PX4A 3AYAA 4QPWA 5FREA 2DV9A 4LOTA 1PM7A 4CZSA 1H1IA 5LW9A 2UWBA 3OJBA 5LCWL 2EIBA 3CZUA 4OI1A 5K7PA 3LIHA 3GZEA 3TEWA 4AQ6A 5FZLA 2VJXA 1FI2A 3D82A 3K46A 1CGPA 1V6NA 5L73A 1TMF1 4JGYA 4C90A 4RN5A 1T6GC 4DEQA 4META 1IOAA 4CP9B 1SDWA 2VOWA 4TYSA 4ZU5A 5EIYB 1QH6A 2IFWA 3ZOIA 3D8CA 4PHZA 4FPYA 3TEYA 4KBBA 3LFMA 5LASA 1H2NA 2NN8A 1TG7A 4WM8B 3LE0A 1PIV1 3DEMA 4Q4X1 4BOWA 1YC61 3APBA 1GZCA 4CRQA 1WW7A 1IPJA 1GICA 2EA7A 4GXLA 3H8XA 3KMHA 1IS5A 3Q9OA 4W6YA 1UMIA 4RHV2 3I2GA 5JOYA 4NHYA 5BNOB 3RZHA 1YXWA 2D3PA 4AGRA 3IDBB 3IAPA 2W08A 1Q5OA 2GNTA 2HWC2 4GMP0 2E9QA 3VGIA 1MVQA 3WF3A 4CUGA 1PVC2 1QY4A 3R05A 3RGBA 2OYZA 4Q4Y2 1JN2P 1IKQA 2C6SA 4MXWA 1AX1A 4QX5A 3USUB 1PHMA 3PTRB 1A78A 5JI9A 3J8F3 3TEZA 4TTGA 5AVPA 4LPLA 3HN1A 5IWFA 1PMIA 5JSRA 2RMU2 3ZN5A 5FYUA 1NXMA 1MVEA 4EZHA 1QOOA 5AC92 2V4VA 4N43B 2ZX2A 2PHXA 4W6WA 5FMCA 5FXWA 4NUBA 2GDFA 4LNVA 1VIWB 1JZ4A 2PXJA 2JDKA 3SEPA 1IS4A 5FMOL
chains in the Genus database with same CATH topology
3AYCA 5BUVA 1JH5A 2E7AA 5GLUA 2VNGA 1QJZA 3ZPYA 1QJU2 2R042 4YZ5A 5HCBA 1WLDA 3CEWA 1PGSA 3GBWA 4GMP3 1RUF3 1CR7A 4L92A 2XH6A 1VJ2A 3KZ4C 1GZ9A 3NV3A 4Y5Z0 1YJLA 2GNBA 2XKOA 3HR9A 2GAUA 1KJLA 4ITCA 3N35A 1LODA 3HQXA 4H7MA 1N1SA 2DUPA 1NCQC 4CDQA 4Z1VA 1JW6A 3RSJA 1UX6A 2XVKA 2ZGUA 4EWDA 1VRH3 2R073 5CG9A 4EROA 2Z42A 4FPLA 1M06G 1PO22 1C4RA 2DCKA 2Y38A 5CB7A 5J96B 4Y1UA 3V64A 3E6CC 3ZSKA 2R30A 5GZFA 5T52A 5K9YA 2DCYA 5GJ6A 1O3TA 1FPN2 3LAGA 1RJ8A 5BNNC 2F4PA 3HT1A 1X82A 3VBFB 2BYVE 1BVVA 1VBE2 1N3PA 4YVWB 5TSWA 1AXZA 3B7MA 3RNSA 5JVVA 1U5ZA 1LU1A 2HWC1 3ZVXA 5BNOA 1PVC1 3WT3A 1AYM2 3AX4A 3VZOA 3R4SA 4CP1A 1TEIA 4L9BA 1G8WA 4Q4Y1 3U07A 3GBGA 2OZ6A 4UBGA 3ASIA 5KC5A 1XXNA 4K1ZA 4WZCA 3TNPB 1R093 1HLCA 3FWEA 5JIUA 2RMU1 4FQ4A 2PAKA 5A33B 3EHKA 5AC91 3V0AA 2NMOA 1CD3G 4LT5A 3H3ZA 4DS0A 3ZSLA 3ZDSA 1H4GA 2JEMA 3CJIC 2Q1MA 4X8NA 5FOBB 5DZFA 5BPXA 1GNZA 4QPGA 1QJU1 2A70A 4YVSB 2R041 4QHBA 3T1MA 3M4FA 2PTMA 4LE4A 4ATFA 2HWF3 5DDJ2 1AJKA 4Q2FA 4LA3A 4Y1YA 1NCQB 2RS53 1MEC3 4OHYA 1V6LA 2JX9A 3OBRA 1VBB3 3LA3A 2IXJA 3J26N 1XYNA 4N7IA 3O0VA 3MW4A 1O3SA 1V00A 3SLIA 1DIWA 4XILA 4R9AA 1DGRA 1MS3A 1HXS3 3B5LB 2Q5TA 3WHUA 5DUUA 3MW2A 1W6QB 4BE3A 2V5YA 3AFKA 3A0NA 1NYWA 4K8FA 4Z82A 5K0UB 2IXKA 2XJSA 1PO21 2A73B 2VU9A 2ZACA 2PELA 2WT0A 2VVFA 1C8NA 1NXD1 3E5UA 1YNAA 1FPN1 2I2SA 3E97A 5D8AC 1RUNA 4LO7A 1PIV3 4Q4X3 4IQPA 1LULA 4BHPA 1VBE1 3MGUA 3RG0A 1LRHA 3AMQA 4Q27A 1UMZA 4FVVA 3VBFA 4HK8A 1NLRA 1SLTA 4OUSA 5JPNB 4YVWA 1DGLA 4LBQA 1EPWA 5T5OA 3WW1A 3SHRA 3VV1A 2PHTA 1FMD3 4U36A 4CEYB 1AYM1 4Q0PA 3SCFA 4EN6B 3ZXJA 3WP4A 2VVEA 1UF2C 1U5IA 1CAUB 2D93A 2P37A 1ND2C 2I45A 3THTA 4HKWA 4KL1A 4JCKA 4RS5C 2VW2A 4MGYE 1URXA 2JECA 4LO6B 4ZU7A 2IXLA 1WMFA 4UXAA 3GNEA 2PLV2 1X7NA 3O14A 4UW6A 2IXIA 2B45X 1I5ZA 4E2QA 1AF9A 2AYHA 3N3HA 1RUJ3 3UJOA 4R4ZA 1WA4A 3WW4A 4AFCA 2P17A 3VL8A 2NPIA 5DDJ1 4YVSA 4CEWA 2BFUL 3JZVA 4K40A 2B46X 3FX3A 4H3WA 3VDDB 1W2UA 5T55A 2YROA 3B69A 3N4MA 2C1FA 2D6LX 2VH9A 2W52A 2ZZJA 3FLPA 2FZ2A 3VBHA 2XJRA 2PFWA 3I59B 3BOWA 2VNRA 3VZJA 5D8AB 3W9AA 2NYYA 4HETA 2AENA 4YZ3A 1W6QA 4YM2A 4FPEA 2TBVA 2HJIA 3B9IA 5K0UA 3TN92 1S0BA 2D7FA 2E53A 1XYPA 3EO6A 5DG2A 3ZSEA 2GALA 1A8DA 3JD72 4Q4V2 3FMGA 3OD0A 1QF3A 4RHV3 2HWD2 4X8PA 3NAPC 1BCXA 3D0SA 1MQTC 3M1HA 1DFQA 3AKQA 4JDNA 4SBVA 2HWC3 5EV7A 4W65A 1UU5A 1ND2B 3OY8B 3PVNA 1LOCA 5FCCA 4CEYA 1LOEA 1UKRA 2UYAA 4I0WB 4H7LA 1BKZA 1KJRA 5C9AC 5J48A 1VBC2 1K5MC 2VVDA 3PLQA 4LHNA 4TZDA 4QQOA 4AEJA 1EPZA 2PLV1 5JZGC 2WS92 5AC93 3ME2A 1JOJA 3B3QE 5FTTC 1D2QA 4C91A 1BK1A 1CIWA 1H8TC 3NL1A 3NVCA 3ZYGA 1MS0A 2NZ9A 2H6CA 2VQAA 3CJXA 3LSEA 2D5HA 4GH4C 4GALA 4XJAA 2A6XA 2GMPA 3LSDA 1QJU3 3TOJA 3QOPA 2R043 5EWSA 1VAKA 4CDUC 1WD4A 1ZYBA 4U2AA 3CLPA 3ZXKA 3HWJA 1QXPA 1R1ZA 1DLLA 4DINB 1YFUA 3KT1A 2XLGA 3FC0A 3G6JB 4QMAA 1JUHA 2CGOA 4N90A 3ZSJA 4FXKB 5BNQA 1GYKA 3VDDA 1OOPB 2N7GA 1D4VB 1IZ3A 4XXPA 2CY6A 4WVVA 2XL7A 5IK5A 5L7OC 4YW1A 3POYA 3I59A 2DTYA 4O9GA 3JB8A 3KS7A 1PO23 3LA7A 4EWAA 4YFZA 5CG8A 1MZFA 3TN91 2C5DA 5C33A 2X5IB 3MI8A 1FPN3 4NHMA 2VQ0A 4QQHA 2ZJCA 3JD71 3M3IA 4Q4V1 2ENRA 1D2SA 1VBE3 4BQ1A 1UCXA 3B00A 5ACA1 1AVBA 3RI8A 2HWD1 4MXVA 4C1WA 2UY8A 2QDRA 2WSVA 3VZNA 3ZIWA 1AX2A 2D6PA 3MIBA 3ECQA 5J7MA 4LBOA 3USSA 1Y7BA 2CTVA 5JOXA 1OHFA 2OVUA 1AX0A 3MICA 1K5MB 2BNOA 2GC0A 1U5YA 1CESA 3MIEA 4QGMA 4YFWA 3WR0A 5CFCA 1YRZA 1UU4A 4YGBA 4EN0A 3FHIB 3BCWA 3IT8A 2P3JA 4Y20B 5JZGB 3OY8A 4XF9A 3S6PA 3MZHA 3AB0A 4B4RA 1VBC1 2PAEA 3FUQA 1SCRA 1W6MA 2RS31 2DF7A 1PVXA 4Q0UA 4AFDA 2WS91 2XJVA 1FV2A 1CVNA 1AR72 4GIQA 4XFFA 4A7ZA 2AREA 4AEMA 4CDUB 3MYXA 5H9QA 3NV4A 4BCUA 3U0ZA 1W6NB 1Q56A 3RMYA 2PHDA 3OCPA 3ZXAC 3JCIA 3ZXEA 3WNXA 4AI1A 4EWEA 1SBDA 2GMEA 2WQ4A 4AXOA 2WA3A 2RJLA 1C8M2 1SBFA 1QDOA 4A3XA 3G7DA 1RHI2 2EAKA 1VP6A 3WV6A 3ZYRA 5DZGA 4Q0VA 1SLCA 4XFCA 4WVZA 2AR6A 5KHHA 4LO4B 4AHZA 4DY5A 3URFA 2Z79A 3A0KA 4DXZA 4N9IA 1EV12 3L2YA 4EN9B 4MVTA 4YG0A 3WG3A 3VL9A 1YIPA 1IS6A 2ZS6B 2EIGA 2X5IA 4W6XA 5B2GB 1TME2 1HW5A 3ZYJB 3OTFA 4YARA 2P34A 4RSUA 3FE5A 1X36A 3IWZA 4GWMA 1ZBA2 3WW2A 2Q0AA 2H0VA 3PHMA 3SISA 2YPJA 2EALA 3IN9A 1IGOA 1VR3A 5JSOA 2QQPA 3H3UA 4KWJA 5CA6A 1PZ7A 5EZWA 4P14A 4JAAA 4PF5A 5GM0A 3FUOA 1X8EA 2LM3A 1H8VA 4X6RB 2DVAA 1AR71 2A71A 4QM9A 2CWMA 2YDEA 4AEKA 1WW6A 1F5JA 2JG9A 1H9PA 5LRRA 3M3EA 3I4IA 5CU1A 4JTNA 3ES4A 4F83A 1ENSA 1C8M1 1LOFA 1RHI1 4FCAA 1YHFA 3THPA 4TLFA 3VKNA 4D69A 4PLNA 2D40A 2UWCA 3UKVA 1XU2A 4YLZA 1LGCA 1H2MA 3H1WA 1A3KA 4J1WA 2OUHA 1R1A2 4CDXB 4P9LA 3X29B 1NE6A 2ILMA 5H9SA 1EV11 4WM7A 5T50A 3RJRA 3IDCB 1V6MA 2K0GA 1SQ4A 3LKJA 3RYKA 3RS6A 3AMPA 1KQRA 2FHRA 2YZ4A 2HWE2 1S0FA 3D0JA 2Z69A 1NA1C 3TN93 5FAXA 1LGNA 1WD3A 3WCSA 1F5FA 2Y0IA 5L19A 4HL0A 1TME1 4Q4V3 4IESA 4AQSA 4PDWC 2P3IA 2YHJA 2KA3A 4LE3A 2VNOA 5AVAA 1WLCA 1ZBA1 3AMNA 1RB8G 5I8YA 2GZWA 2XJPA 4IEVA 3ZN6A 5T54A 1S0JA 1BYHA 1VBA2 3M8LA 2KM2A 1G9CA 1ZM1A 4P9YA 1N3OA 4PIYA 1X8MA 4JGZC 2XJTA 3KCYA 1VBC3 4DRRA 3IKWA 2ZHLA 1ZRDA 4DFSA 4XEZA 2JG8A 5GZGA 2SBAA 4KGGA 2VUJA 2WS93 3DPRC 3OGGA 2A7AA 2BTVC 5DXDA 2CL2A 5I8TA 1KS4A 5C6CA 2QNKA 3AP4A 4AQ2A 1LEMA 1LOAA 3KT4A 4KU7A 2LUWA 1C5HA 5LK7B 4HPKB 4L8QA 2HWB2 4DOUA 4COWA 4OULA 5C4WB 4XOGA 1VB2A 5H9PA 5BNPC 2R1DA 5I93A 4FOYA 5E16A 3WW3A 3ES1A 1R1A1 2BBVA 1IPKA 1KDMA 1GQGA 1Q8PA 2ZA9A 1B35C 2R6QA 1G9AA 1NA1B 4CDXA 4XIOA 5HCAA 4I30A 2QUOA 1MACA 4MV2A 3RJ2X 2E7TA 1O7FA 2HWE1 1Z0HA 4QPYA 4I02A 4PDWB 3ETQA 5KXCA 1L3JA 1YO8A 3VBRA 1MZ5A 1NE4A 1FOD3 1HIXA 1N1TA 5A32A 5CFDA 4K21A 1B09A 1ZBE2 4P9GA 4ZXKA 3IPVA 2WZPP 4CTEA 1UN1A 1TNFA 4FPJA 5FPXA 3D6EA 5JOWA 1DZRA 3PJQA 4ORFA 1UW8A 1LENA 1LB2A 2JENA 3I7DA 4PLMA 4P9WA 3W58A 4BIFA 1DQ5A 4JGZB 3P3NA 3JB4C 4NWVA 1VBA1 1C57A 5I0SA 3NKGA 1XNDA 4DPNA 3KCCA 1PNFA 5J3UA 1S0GA 4KWKA 4QQ2A 5ABJC 3H7YA 2OZJA 4IEOA 4WVMB 5I0TA 2HEWF 3ROUA 5BYNA 1CX4A 1V6KA 2WNVA 2IFRA 3VBSB 3K51A 2LALA 3C3VA 1CPNA 4V1PA 3KGZA 1NCRA 1VAMA 3MEPA 3AKSA 3PVEA 1Q8QA 4PBPA 1AR73 2X53S 1JUIA 2QCSB 4XFGA 1JXNA 1J59A 4LLFA 2YGMA 2ET7A 2DFBA 4LBJA 4YGDA 2ERFA 2WFPA 5BNPB 2XLFA 2NM1A 4JRLA 1BEV2 2ZAAA 2HWB1 3B02A 5D1IA 4D94A 5HXVA 1BZWA 3ZFEC 3VHPA 1OLRA 1R083 3BB6A 4HPKA 5C8CC 1C8M3 1ZA4A 1FAYA 1B35B 1RHI3 1J1LA 1UKGA 5CADA 4TWTA 4AI3A 1QXRA 2RR13 4MH0E 3ILFA 5FO9B 1CAWB 1LESA 2XBO1 3VBOC 1RUG3 3DKWA 3PNAA 4IEUA 1QJX2 4ATEA 4OI4A 3S30A 4FOQA 4RQPC 5C8WA 1I1EA 4AEDC 2B9UA 1PO12 1RJ7A 5LEJA 3JU9A 1RL3A 1DHKB 1ZBE1 4WM8A 3FFZA 3GBFA 5EXOA 3AJZA 1GR3A 3KQRA 2IXHA 1TME3 3S0MA 4FSJA 2XHKA 4NHLA 1ZBA3 1MZEA 2P2KA 4XHXA 1W6PB 3WOGA 3CNAA 1O3QA 3WG2A 5KHJA 3ZFGC 3USUA 3PVBB 5SV8A 4IXLA 4N7UA 1UAIA 5E89A 1AR62 2P3KA 3SH4A 5BXXA 1AXKA 4E9KA 1WLTA 3R4DB 4H14A 1SFYA 1KD7A 2WC2A 4CDWC 3VBSA 1REDA 2FBEA 4M3CF 4N43A 1PK6C 1QGLA 3ZFEB 1RGSA 2RHPA 3AYEA 2A3XA 4FPOB 1HX6A 1NY72 1ZZ6A 1OA2A 3WINE 1BEV1 4AI0A 3B01A 5IK4A 2WL1A 1RUE2 3AKTA 1DGRN 1ZVFA 3WVJA 2VGDA 4XQDA 3GZAA 1FX5A 2ZX3A 4KH9A 2G4IA 1G9BA 1SLAA 4OUMA 4HN1A 4S2HA 2BWAA 4I0AA 3AFGA 1R1A3 3ZXDA 3WDTA 4FAGA 5BNNB 3IIAA 1V6OA 4SLIA 3WHTA 4OHXA 1TMF3 1CN1A 4FP3A 1CAWA 1QJX1 1UD1A 4WV8A 4FO9A 2TNFA 4HKOA 2FMYA 1QMJA 4HT1T 1GQHA 2CNAA 4E2GA 1MS9A 3AJYA 1PO11 4UW4A 5FO8B 2EXIA 1NQJA 1BXHA 3LA2A 1LHNA 3OYWB 1XNKA 5DZEA 1YFYA 4XFHA 4HBNA 2NLRA 4IV1C 4OI2A 1QQP2 2ZX1A 2CV6A 3ZFGB 4AVVA 1Q8OA 1JTZX 1W0OA 2WWSA 4HVRA 1OI6A 2RS11 3VBUC 1VBA3 2RM22 2V09A 1W6PA 3LGRA 5DUXA 2JD4A 4OHWA 1PK6B 2CYFA 3CJIB 2GH2A 3IMNA 4YNIA 1QOSA 1AR61 4M0NA 4RFT0 1RUH2 4M01A 4AE2A 1RVF2 2Z5WA 2XJQA 3ZFFC 5A33A 3AXDA 1O5LA 4M00A 2FQPA 4A2UA 5IT6A 1WCKA 3O12A 4DNYA 5JLVA 2E7QA 1PGL2 1DYKA 4N53C 1NY71 4IV3C 1XQNA 2ZKLA 1ASJ2 1RUE1 3ELNA 4E27A 2HWB3 4LLOA 4QPIC 4RR3C 2OW4A 1OFNA 1NCQA 1EY2A 1ZNPA 4IL7A 5A3LA 1XNBA 3T2TA 3PTYA 4S2GA 3J4UH 4WZFA