1F9KA

Winged bean acidic lectin complexed with methyl-alpha-d-galactose
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
234
structure length
234
Chain Sequence
ETQSFNFDHFEENSKELNLQRQASIKSNGVLELTKLTKNGVPVWKSTGRALYAEPIKIWDSTTGNVASFETRFSFNITQPYAYPEPADGLTFFMVPPNSPQGEDGGNLGVFKPPEGDNAFAVEFDTFQNTWDPQVPHIGIDVNSIVSSKTLHFQLENGGVANVVIKYDSPTKILNVVLAFHSVGTVYTLSNIVDLKQEFPNSEWVNVGLSATTGYQKNAVETHEIISWSFTSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords ACIDIC LECTIN
publication title Carbohydrate specificity and salt-bridge mediated conformational change in acidic winged bean agglutinin.
pubmed doi rcsb
total genus 44
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f9kA00
3VKOA 2D6KA 2EXIA 3MW3A 4ATEA 1AJKA 3ZXEA 3ZXJA 1CQ9A 3MEPA 2VUAA 1DQ1A 2SLIA 2WKKA 2R1DA 2PHTA 4GKXA 3OBTA 3V64A 4Z8BA 3RSJA 3BTAA 1G9AA 1WBLA 2WSVA 3WG2A 2NMOA 4PF5A 1LGBA 2ZMKA 1Q8QA 5GZDA 3QCWA 2W08A 4PQ9A 1F5FA 3M2MA 3RRDA 3AZWA 4DQAA 4FP3A 5T52A 3AXDA 1ULGA 2ZHMA 4ZKTB 1G9CA 4SLIA 1FV2A 1Q8PA 4BLJA 1KJLA 3WCSA 1VAMA 1QF3A 1V00A 4HL0A 2BQPA 1APNA 2GALA 4K1YA 4M3CB 3ZYRA 1FNYA 1SLAA 3IN9A 3AFKA 4HANA 2VW2A 5JOYA 3UJOA 1N1YA 5KXDA 1GICA 3GNEA 1JYIA 4YM1A 4YG6A 4DRRA 1Q8SA 4M00A 4TYSA 2ZGRA 3OGGA 5SV8A 1YRZA 4Y22B 1LECA 1CJPA 3N7LA 1Z0HA 2EAKA 1BJQA 2ENRA 5CA6A 3VKMA 3PMEA 2EXHA 1DQ4A 2JD4A 2OVUA 3IKWA 4K20A 4WV8A 3M3CA 4YLZA 1NXD1 5JVVA 2ZGUA 1GNHA 2PHRA 3I4IA 5DXDA 3T1LA 1W6QA 4Y1XA 2DTWA 4C1XA 1Q8VA 2ZZJA 1F9KA 3BIWE 4UW6A 4YFWA 1S0CA 5GZEA 4BMBA 3IPVA 4GALA 4R9BA 2ZGKA 4M3CE 3M3EA 1LOFA 1O4ZA 2OUHA 3WHTA 3V0BB 3L2YA 2OW4A 2P3JA 4M3CF 1JW6A 3AZXA 3AP9A 4AGVA 5H9QA 1DYPA 3TAYA 5FREA 1W6OB 1WLCA 2LALA 4ASMB 1S1AA 2D6PA 1UPSA 2AYHA 2B7YA 1HKDA 3N7JA 1CN1A 2CY6A 2C9AA 1MZ6A 3B69A 3SLIA 2V5YA 1QOTA 3FLPA 3O0WA 1Y7BA 4NO4A 4PBPA 2DUPA 5T5JA 2DTYA 1DHKB 3WDUA 3FUOA 4Q26A 5H9PA 4XBQA 2ZMNA 3T2TA 3WUDA 5GZGA 3ZVXA 4FOYA 1URXA 3AZYA 3LSEA 3NV2A 1W6PA 1DIWA 3ILRA 4FOWA 4ISRA 4P9WA 5L73A 5KXCA 3AP6A 1BXHA 2NM1A 1FNZA 1C1LA 2R0HA 1UKGA 5DUWA 1WUVA 4DPNA 2GN3A 3B3QE 4XE9A 1IS5A 4YW3A 1V6IA 1VAVA 4FPHA 3NV1A 1CR7A 1G7YA 3M3OA 3M1HA 3OPZA 4YFZA 4YZ1A 5GZCA 1DQ2A 4UW3A 5GM0A 2GNDA 2RHPA 1SLIA 2DUOA 2A6ZA 1GV9A 3FUQA 1S0EA 1BZWA 1QNYA 5T54A 4FQZA 1YIFA 2DVFA 5EYYA 4I30A 4P9YA 4Y22A 1UZZA 1CIWA 3D5OA 3N35A 3UK9A 1MACA 1QOOA 4AGRA 1MZ5A 2D3RA 2I2SA 3AYCA 1MS1A 3O5SA 3C2UA 2DUQA 3AP5A 3HMYA 3ASIA 4XMAA 5EYXA 4FPOB 4DFSA 3POWA 1A78A 1XQNA 1MR5A 2CNAA 5HCBA 2DVBA 3FBYA 1S0FA 1DQ6A 3INAA 2A6WA 2D7FA 2NMNA 4FOVA 3PVNA 1LOAA 3OJBA 1SCRA 4YZ5A 1AX2A 4LBJA 1W6QB 2ZHLA 4Q8KA 1LENA 4RA0A 5T50A 3AJYA 2GMEA 1TEIA 3IPVB 1S0IA 1A8DA 4Q27A 3ATGA 3RMYA 1GSLA 1LGCA 4OZXA 3AYDA 3Q9OA 4BQ1A 1LHUA 3OY8A 4YM0A 1Q56A 5LK5A 1S0BA 4GWNA 2GN7A 1N3PA 3IMNA 4ISQA 1GLHA 1LOFC 1SLCA 2NP0A 3N7MA 4XXAA 3OYWA 3RQ0A 4PBOA 4XJUA 1N1VA 1W0PA 3MPPG 4YZ2A 4AWDA 2A75A 3W58A 2AENA 5GLWA 5JLVA 2GMMA 4XXPA 1I3HA 4XTMA 2VH9A 3DGTA 2ZGNA 1AX0A 1DGLA 4BM8A 2AR6A 1MS0A 1SCSA 1W6PB 3B01A 3WLUA 2CTVA 2WT0A 2Z42A 2YROA 1U0AA 1MS9A 3TB0A 1KRIA 2EF6A 1GZWA 1VIWB 1DYKA 2PELA 4CTEA 4KBBA 1RITA 1JOJA 1PZ9A 2A6YA 1AJOA 4K1ZA 4JRAA 2A5ZA 1W6MA 3O0XA 2PHFA 3FLTA 5CB7A 2UU8A 3VKLA 3WG1A 1MS3A 2CYFA 3AP7A 4XBNA 2CWSA 5KXEA 1N3OA 1G9BA 4XIOA 4Q2FA 2UWBA 4YW5A 1KJRA 2WJSA 2ZMLA 2DYCA 1S0JA 4D69A 4F83A 2JJ6A 3WHUA 3HR9A 2D6MA 1DLLA 1EPWA 3M3QA 1NLSA 5HCAA 1S0DA 2DWRA 2R16A 2UWAA 2V73A 3PJQA 3ZXKA 3D4KA 1V6KA 1FATA 1I1EA 4WVWA 2A6XA 1DZQA 1PZ7A 2YXSA 1DQ5A 4M01A 4MYEA 1QOSA 1KQRA 4YM2A 1QDCA 1IS3A 2E51A 4FP2A 1JBCA 2H0BA 1D2SA 5KXBA 2GNMA 2A3WA 3RMXA 2A3XA 5DG2A 4XJWA 4XHBA 1MS5A 2A71A 4P14A 5H9SA 3ZSMA 1MVQA 2ARBA 1UL9A 1B09A 1LU2A 1SLLA 3AZVA 3OY8B 4Y1YA 2WT2A 1CPMA 4YG3A 4LBQD 3WG4A 3AJZA 1LEMA 4Y20A 3WDXA 3R4UA 4LBNA 3ZXLA 2ZAAA 1ENQA 1GANA 1RINA 1SLTA 1ULEA 2P34A 3OYWB 4LBLA 1C57A 5E8AA 4U36A 2A6VA 2ERFA 2A7AA 1VLNA 2GDFA 5E89A 2WNEA 3NWKA 1Z78A 1ENSA 1LOBA 3N7KA 4YW1A 2Q5TA 2ZBJA 1ULDA 2VU9A 2EALA 1YO8A 4Q1PA 2ZGSA 1V6LA 1SLBA 1N1TA 4Y1ZA 3WG3A 2G4IA 4JC1A 3LSDA 3WDTA 4AVVA 4FPYA 1GZWB 3OBRA 4XBLA 1LHNA 3O0VA 1AXKA 2R0FA 3T1MA 2P37A 3POSA 3AP4A 1JYCA 1W6MB 1ZA4A 2D6NA 1AX1A 2E7TA 1IKPA 3I8TA 4FPJA 4Q8LA 3SH4A 1D0HA 3V0AA 2EIGA 4GA9A 1DBNA 2P3IA 1LTEA 1SBFA 1IKQA 4Y1VA 2LTNA 5JOXA 1OFSA 1MS4A 1YXWA 4XJZA 3WZ1A 4FPGA 3MW4A 2KM2A 3PVOA 3AK0A 1QMJA 2AUYA 3ZXFA 2SBAA 3N36A 4LBOA 1AF9A 4H55A 4XJ9A 4XMIA 3UJQA 1W0OA 1SBDA 1S0GA 2ZGPA 5EXOA 4XZPA 2DU1A 4AVTA 4FVVA 2AGSA 2EXKA 1MS8A 3FFZA 4XILA 2HYKA 4UW5A 4GWMA 1IS6A 2CWMA 1LODA 4Y24A 2D3SA 1GNZA 1UZYA 4ITCA 1DQ0A 4BOWA 1UX6A 3IM0A 5CAZA 5IK5A 4RL7A 2JDZA 4FPLA 3B9CA 2ZABA 2VW1A 3LCPA 1ONAA 1FAYA 2UURA 4AGGA 3SH5A 1KDKA 2ZACA 4YZ4A 1V6OA 5GALA 2A70A 5JDBA 1ZM1A 1J1TA 3D6EA 3HN1A 4BPZA 3QLQA 1R1ZA 1JHNA 2ZHNA 1V6MA 1UAIA 5H9RA 2D6LX 3APBA 4Y20B 3PVEA 4WZFA 1HQWA 5DUUA 1PZ8A 2P3KA 4WVVA 2ZGQA 1QKQA 3USUA 3H0OA 2YV8A 4UW4A 2VW0A 1QU0A 2TEPA 2ZHKA 5GZFA 2JE7A 3ZYPA 1N47A 1JN2P 1LOEA 1ULCA 4U2AA 3AXEA 1G86A 3GALA 4DRVA 3WOGA 1G8WA 1V6JA 1N1SA 3W59A 1GZ9A 1SFYA 1FV3A 1UMZA 2NZ9A 2W52A 1LGNA 4BMEA 1W6NA 4AVSA 2DVAA 2VXRA 1YI7A 1V6NA 2PHUA 2YMZA 5IUQA 2DU0A 1G9DA 3KM5A 3DUIA 2ARXA 5GLVA 5BYNA 2E53A 2YZ4A 3AYAA 4K21A 1FX5A 4JCKA 1GYKA 5JMCA 4W65A 4FPKA 1AXYA 1CESA 3V0AB 1OKQA 4YG0A 3ZSJA 4PCRA 5IK7A 4Y26A 3WDVA 3N3HA 2XB6C 1LJ7A 4YGCA 1WD3A 4XTPA 5GLUA 2P2KA 3WDYA 4YZ3A 4FPEA 4YW2A 2D6OX 3BODA 3U4XA 1AVBA 2GNTA 4XJAA 5DG1A 1BQPA 1LHWA 3JU9A 1WW6A 1C4RA 5HCFA 2C5DA 2YY1A 2CL2A 5T5LA 2FMDA 2ES3A 3WVJA 1HDKA 5DUVA 4NOTA 2D44A 3AX4A 2XG3A 4FPFA 2GNBA 4IQPA 5DZEA 5F5QA 1HLCA 3VKFC 1X50A 5EWSA 4FOQA 1LEDA 4XYXA 3BOPA 1GZCA 3R4SA 1LOGA 1H9WA 2E6VA 1SBEA 1C1FA 2JECA 4R9DA 4AYUA 4XJ8A 5T5OA 2W39A 3CNAA 1N3QA 1WLWA 4LBQA 2ZA9A 2DVDA 2R49A 3B00A 3NV3A 2DURA 4R9CA 4DS0A 4C1WA 1H9PA 1ULFA 1KDMA 2NN8A 3A4UA 1WW5A 3RS6A 3WUCA 2R1BA 1KITA 1LCLA 4XDQA 3USUB 4XOGA 4L8QA 1ENRA 4LBMA 5FRAA 2JE9A 1VALA 4BLIA 5JOWA 3UL2A 1LHVA 1A3KA 3KQRA 1O4YA 4YW4A 5IK4A 1BYHA 1H30A 1QGLA 3FLRA 2OUJA 1WD4A 2ZGMA 1QDOA 3SISA 1WW7A 1GKBA 5F9TA 1W6NB 4XHXA 5IT6A 2ZGLA 3WCRA 3ZSLA 5GLZA 4GXLA 2VY0A 4TZDA 1WCSA 3A0KA 1AXZA 5AVAA 1LHOA 2W68A 2WT1A 2ZKNA 3ENRA 1WW4A 3VKNA 4CRQA 3ILFA 2D3PA 3POYA 2FHRA 2UWCA 1RIRA 3NV4A 4FPCA 5GLTA 3R05A 4LBKA 4YGEA 1CONA 4M3CA 2AH2A 4ZXKA 2ZGTA 2DV9A 2PHWA 2WQZC 2WSUA 4GKYA 1GBGA 3SITA 1LULA 3VUOA 3WV6A 3V65A 1HQLA 1OQ1A 2D43A 1YYNA 1CVNA 1IS4A 5T5PA 4YGBA 1UN1A 3MW2A 3VV1A 1LU1A 1LESA 1WLDA 1SACA 2AREA 1LOCA 3ILNA 5E88A 5CNAA 3WNXA 5IK8A 5CBLA 4ATFA 5DZFA 4CZSA 3A0NA 4P9XA 2GMPA 4FQ4A 5GJ6A 1AZDA 2DVGA 3ZPYA 2NYYA 5DUXA 2A3YA 2ZGOA 3AZZA 1CPNA 1WBFA 2EXJA 3V0BA 1IOAA 1JUIA 2PHXA 4R9AA 5T55A 3ZSKA 4Q1RA 3RG0A 5JOZA 1BKZA 4YM3A 1MVEA 1W6OA 3AYEA 3O12A 4XIKA 3WDWA 4Y1UA 5DZGA 1DFQA 1Q8OA 3SNMA 1F31A 2E7QA 4YGDA 1G9FA 4LBQB 3SH3A 1JXNA 3JUUA 2WLQA 2JKBA 1FYUA 1QNWA
chains in the Genus database with same CATH superfamily
4A2UA 2W46A 1UU5A 4KWKA 4Q0UA 3CMGA 4DXTA 4NPMA 3ZXEA 1CQ9A 1ZYBA 2VUAA 5LBCA 1DU3D 1DQ1A 5A6YA 2WN2A 4IESA 1JYWA 1UXZA 1X9TA 4ZXEA 3V64A 1W99A 1IG3A 4DXSA 5CADA 1Q3EA 1A6CA 4Q4Y2 3N9LA 4XQWA 5GZDA 3QCWA 4PQ9A 4AG4A 4PIYA 1WCUA 2ETEA 1HRV3 3AZWA 4DQAA 1AUYA 3WW4A 1PGL1 2YHJA 3GCXA 5J98B 3WNLA 1FPN2 1KJLA 4UFHA 3CIHA 1SG3A 1PIV2 1QF3A 3WCSA 2MHFA 2R062 1XU1A 1XXNA 2BWCA 3EYPA 5J3UA 1SLAA 1IQDC 3ST7A 3BN6A 2VTXJ 4LHLA 4COUA 4NRMA 1N1YA 1GICA 4IV1A 3UKTA 1RUG1 1JYIA 3DXUA 4I2OA 1Q8SA 4M00A 4TYSA 3OGGA 1ALYA 1PVC2 1YRZA 2WO1A 1K45A 2TBVA 1VBB2 4DOUA 3MGUA 3THPA 1HX6A 3NMBA 5FMBA 3PMEA 2EXHA 3IKWA 3N9NA 4K20A 4WV8A 5FTTC 5FZLA 3UYJA 2CAUA 4MGSA 1W6QA 1V9U2 1S4CA 3EQEA 4P5HA 1F9KA 1BBT2 4YFWA 2OQ6A 4GALA 3WP4A 4W8JA 2BVBA 3H3ZA 1UOGA 1P8JA 3AKSA 4M3CF 4XFAA 1XE7A 2UY8A 1UZWA 4HN0A 3JD73 3HD8B 5H9QA 4EE2A 2BDRA 2LM3A 4QAWA 3BCWA 5LY2A 4LOTA 4Q5OA 2AYHA 2I07B 5F3IA 5LA9A 3I3DA 5C8CC 2CY6A 5IVJA 1HXS2 4OHVA 5FBZA 1ASJ2 3ZKYA 5DAXA 1W0NA 3VGIA 5KHJA 1QOTA 2VNGA 3AKQA 4B3NA 2IZWA 4CCDA 4G4FA 2DTYA 5A70A 3FUOA 5J7MA 1VMJA 4FFIA 2ZMNA 3K75B 1PX3A 2QQLA 3O1SA 1URXA 2DDUA 2WNUA 3LSEA 5A7SA 1C5HA 4NHLA 1JTZX 5F5IA 3VLBB 4EN9B 4ISRA 4P9WA 5BNPC 3AMMA 5FZGA 5L73A 4XUNA 2NM1A 4QT6A 3VZNA 1UKGA 1PX4A 2BW8A 2B42B 3B3QE 3MIGA 1CAVB 1AYN3 3O1MA 1H2MA 4D7YA 4YFZA 1QY4A 4YZ1A 3O7OA 2BWAA 3KCCA 1AR92 4JRLA 4IEOA 1SLIA 4LQRA 3SCHA 1BZWA 1T6GC 5T54A 3VN4A 4Q0SA 1QJZA 1YIFA 4RS5B 4P9IA 2DVFA 4DUXA 5EYYA 1OQDA 4LKEA 4P9YA 1D4M3 3MUY1 1UZZA 1US3A 4IXLA 3GBFA 3D5OA 1K5MB 3H3LA 4YVWB 3UV9A 4AGRA 1QOOA 3HBZA 1RUD3 2DUQA 3AMHA 2XWJB 3ASIA 3HMYA 3P3PA 3WY6A 4L92A 4Q29A 3G7DA 4FPOB 4DFSA 2E26A 2FDFA 1XQNA 1RMU1 2CNAA 2YGLA 4BB3A 1CZSA 2DVBA 3A7QA 1S0FA 1ND2B 1UYXA 4QKNA 3B94A 3J8F3 4RSUA 1HV0A 3DECA 4FOVA 2DCZA 1LOAA 2VOKA 4BIFA 2ZOEB 2HWD2 2WA3A 2ZHLA 3VDDA 3ZFEA 1ZRIA 4Q8KA 5T50A 4INDA 3H42B 1TEIA 1TME1 3ATGA 2XMLA 1X82A 3O1PA 1ODNA 2QZ2A 4LE3A 2YG0A 3LE0A 1OI6A 2WFF1 3OY8A 2CDOA 5D1IA 5LK5A 4AHYA 3IMNA 4ISQA 3S57A 1SLCA 4XXAA 2VZSA 4Z1VA 4JKLA 1AR82 3RQ0A 4XJUA 1W0PA 4YZ2A 3MPPG 3NAPA 4AWDA 5FPVA 4BXSV 1NYWA 4LE4A 2Y38A 4OZOA 4EN6B 1XC6A 2ZPXA 2VH9A 3CQOA 3I59A 4ZY9A 1AR71 1DGLA 1X8EA 2AR6A 4IETA 1SCSA 1W6PB 2GH8A 1J1LA 4KL1A 3H1YA 2WZR3 2CTVA 2RE9A 2ARAA 2V5DA 2WT0A 3CL1A 3IAPA 4KI5M 1O3TA 3S5QA 1VP6A 4K3UA 3TB0A 3ROUA 1A34A 1WA6X 4BDVB 2NQYA 5I0UA 1DYKA 5CVRA 4CTEA 1JOJA 4JRAA 3VKLA 4COVA 2ZEWA 4RR3A 5CB7A 2UU8A 3VDAA 2E7AA 3POJA 1LKNA 4OI4A 2E31A 1B35B 3KSCA 4XBNA 2CWSA 5A7WA 3GGLA 4WM7A 1PMIA 5FXZA 3GZAA 4Q2FA 4DXZA 2XJSA 5FY1A 3IB3A 5EP9A 3AL6A 5D8AC 3VHNA 4A6SA 5BUVA 4D69A 5JZGA 2B5HA 3WHUA 5KHIA 4B29A 1PGSA 2J22A 3C7FA 5A32A 2BVVA 3KZ4C 4JDOA 4HVRA 4BQYA 1EY2A 1UF2C 2X09A 3VD5A 4CDWC 5HCAA 3H8XA 4UFJA 4UWDA 2VVDA 3K4AA 3ZXKA 2C26A 1HRI2 1RUJ3 2PAMA 1V6KA 2VECA 3K4DA 3SQOA 3ZIXA 2NLRA 1FATA 1AR62 3GJBA 1I1EA 2ORZA 4Y5SA 2FD8A 4OHYA 1GP5A 3KQ4B 2VZUA 1PZ7A 2YDEA 5KHKA 1DQ5A 4M01A 4MYEA 1AYM3 4CP2A 4LJHA 4XACA 4PDWA 1RUC1 2VZ3A 1IS3A 2VE1A 4ASLA 5FZDA 4GULA 5I91A 5FZKA 3HWJA 4XF9A 3AC0A 1TNFA 3URFA 4XHBA 4Z82A 5FK7A 3T30A 4CEYC 5IATA 2A71A 4P14A 5FKCA 1Y3TA 5FQ0B 1MVQA 1OF4A 1FMD1 2ARBA 1LU2A 2HWB2 3GYDA 2IXLA 4Y1YA 2WT2A 4O65A 5A3WA 2JG8A 4LBQD 3MV11 1S2KA 1CZVA 5CFCC 1WA4A 2ZAAA 1ENQA 1RINA 3OGJA 3OYWB 4LBLA 5E8AA 1H1IA 1ZZCA 3K2OA 4U36A 5CFDA 5IVEA 2A7AA 2ZS6B 1VLNA 1YEWA 2WA4A 1LOBA 4XW3A 3N7KA 4TN7A 2EA7A 2Q5TA 4L0PA 4LKSA 1L7LA 3GJAA 3OD4A 4Q4Y1 4QKFA 3ZFFB 4FTSA 4YVSC 2VU9A 1F5JA 2JEMA 2Y6KA 4OI2A 3OGRA 1HV1A 3QBQA 1SMVA 1SLBA 1SPPB 4KH9A 4Y3OA 2XL9A 4JC1A 3ACIA 3BGAA 1PIV1 2MEV1 2OZJA 1JI6A 2R061 1GZWB 3HT1A 1OUXA 5FPAA 1TMF3 3C7OA 3UETA 1X36A 1JODA 4DB5A 3T1MA 4JQTA 2VD7A 3Q8FA 4IGQA 5ABJC 3CO2A 2X8KA 2HLEA 4HFSA 1D0HA 3LPFA 2HKXA 1MZFA 3OD0A 5IVFA 3KCYA 4WVMB 1DBNA 2P3IA 1LTEA 4Y1VA 2VBBA 2LTNA 3GHNA 3IZOA 1OFSA 1EAH2 1YXWA 1VBB1 1W9SA 1O5UA 2QQMA 3AKPA 3J4UH 4EYUA 3WQ7A 3MZHA 2R32A 1OLQA 1QMJA 3JBG3 4LKFA 1REFA 5CG8A 3BI3A 1KEXA 1TG7A 5ACA3 1S0GA 1IHMA 2ZGPA 1SFNA 1PM7A 2RM23 2VNRA 3CEWA 1V9U1 4RYDA 1OT5A 1R64A 2BTVC 5ANNA 1BBT1 4XILA 5JUVA 1WCDJ 1RUI2 3F2ZA 4M0HA 2D3SA 4AEJA 1QJY3 4FPLA 4JTOA 1ONAA 5H9SA 1FAYA 2FQPA 1ZZBA 4AGGA 3OUJA 2BNNA 1EPZA 4YZ4A 5GALA 3ZYIB 2A70A 2Z5WA 2J1UA 1YQCA 4CDUB 2VZRA 1HXS1 1ASJ1 1J1TA 3HN1A 1COV2 4JGYC 4WM8C 5LEJA 3QLQA 1OVSA 4N53B 2Q8DA 2G9GA 2ZHNA 5C8CA 4PLOA 4CXXA 3L9JT 1WCQA 1MEC2 4IEUA 4QPYA 2HWC3 4B8EA 5C3SA 5LA0A 2P3YA 5LATA 5HV0A 3H7YA 1VBD2 5DUUA 3AKTA 4IUGA 1VJ2A 3ETPA 4Q4X2 4QPGB 3O1VA 4AQ6A 1H2NA 5DABA 3HOBA 3PHMA 4YSFA 2TEPA 2JDUA 1AL23 5BNPA 1G86A 4DRVA 4HKWA 4V2WA 5J36A 2HYXA 5I8YA 2WNVC 1ZBE2 5EV7A 1GZ9A 1SFYA 1FV3A 1UMZA 2NZ9A 4BMEA 4C0HA 3TEYA 1BEV3 4RHV3 1ZRDA 1ZRRA 1AR91 4P9GA 1XB9A 3LKJA 1V6NA 3LDBA 3EO6A 2O0OA 5IAVA 5GLVA 5BYNA 1POV3 3EHKA 1EV13 4AFCA 1OHFA 2J1EA 3VBUB 4JCKA 1CD3G 1GYKA 5JMCA 1R093 2IXCA 2PLV2 4UFKA 3RJRA 5A6QA 1SEFA 1GU3A 3ETQA 3C3VA 5L7OC 1OKQA 4A42A 1J59A 4ZU4A 3U78A 4M0NA 2X53S 2WZ8A 1NQDA 4CCMA 3N3HA 5EFUA 1MPXA 3KHBA 4BISA 4QB6A 2XPJA 1MQTB 5FO8B 4AAXA 4K6BA 3ACGA 1RUF2 2HEVF 2Q1FA 2RS53 5DG1A 3RZJA 2BJSA 3BYWA 4YYOA 5LCWL 2DFBA 3B02A 3M4FA 4S2HA 4XFIA 5KC5A 1RVF2 2WINB 1O59A 2XGXA 2KD7A 5HCFA 1DGRN 2WQ8A 5T5LA 3VD3A 2FMDA 1R082 4D94A 3VBFC 1RHI2 3U75A 4FPFA 4LITA 1YUDA 2GNBA 4IQPA 1PO23 2PHDA 3Q8EA 1RUE3 5EWSA 4PI2A 2BOJA 4RQPB 2RMU1 3VBRB 1GZCA 4AEDC 2WIIB 1LOGA 1AR81 3W9AA 2JECA 1CAXB 1BMV1 1XE8A 5LA2A 4OI1A 4QX5A 4QU1A 3J9SA 2MNGA 3TN92 4DEVA 4LBQA 2ZA9A 3B00A 3KV9A 3NQHA 5K0UC 2W1UA 4CCCA 2GAUA 1H9PA 3MIEA 5FZBA 4Q4W2 4BJ0A 2RS33 2NN8A 3A4UA 2BBAA 2JX9A 5LK7B 5JOWA 5FY7A 5LA1A 1H2LA 2VUCA 3UESA 3RZMA 3BOWA 1NOVA 1PK6B 5IK4A 2CV6A 1US2A 5JPMB 3AKRA 3KLSA 2YC0A 2VZQA 4IE6A 4JHZA 2ZX4A 2XJTA 1WD4A 5FY8A 3VL9A 1VBE2 5J09A 1UQXA 3JXSA 2O14A 2XJVA 3LIHA 1W6NB 4KG8A 3SEEA 2ZGLA 2QTWB 1O3QA 3CBNA 4TZDA 1W05A 1OOPC 3ENRA 1YLLA 3V56A 3USSA 2HWE1 3ILFA 5JCTA 2FHRA 1UU4A 4C8DA 2F4LA 3M8LA 4LBKA 4Q4V3 4YGEA 4M3CA 2HBTA 1W8NA 1UY4A 2J42A 2CSGA 2CAVA 2WQZC 5D8AA 1GBGA 4AI0A 1LULA 4QDQA 1CX4A 4DINB 5M0TA 3V65A 4QKBA 5IFPA 1YYNA 1CVNA 5T5PA 3VBSC 1XSRA 1VBC2 5C70A 4IL7A 1AR61 4CDWA 1REDA 4CPBD 5LZ6A 5FY4A 3MW2A 1LESA 1PHMA 3MFAA 3CLPA 3WNKA 4UAPA 5E88A 1BHGA 3ILNA 5CNAA 3WNXA 3FC0A 5IK8A 1RUG3 1SDWA 3WQBA 3A0NA 1NA1A 4FAHA 3I54A 1OKOA 4H14A 2QQJA 1PGW1 1TE1B 2ZGOA 3SCFA 3HIFA 4CEYA 4ES9A 1IOAA 3BUCA 1JUIA 2OQ7A 2PHXA 4R9AA 4LOSA 4Q1RA 3U1XA 4DUWA 1NCRC 4L2NA 3WW1A 2P5BA 3RG0A 5JOZA 5CFCA 1W6OA 3POEA 3AYEA 4OQ9A 3KS7A 1Q8OA 4O61A 1JZ5A 1RGSA 5CU1A 4AI9A 4Q0QA 1WLTA 2WLQA 1JZ6A 2E9QA 1VRH1 2PXJA 4L9BA 3VKOA 2D6KA 1ZBA2 1E57A 1TVGA 3HT2A 5B2GB 5JSOA 1AJKA 2ZKLA 3AVSA 4MG2A 2QQNA 4BQXA 3ZPOA 4GKXA 2IVJA 4D8MA 2WWSA 5C5UA 4JVAA 4JDNA 1UX7A 1M06G 5G04L 1QQP2 4PF5A 3VBHC 4EROA 2VAUA 2VCMA 2V4VA 3TOJA 4MGYE 5ABJA 3QOPA 2RR12 3U07A 3ZFGB 4ZKTB 3I3EA 1FV2A 2A1XA 3S0MA 2JDAA 1VAMA 4IERA 1JHJA 4FAGA 1IG0A 2ARCA 3DYPA 4N43C 4XABA 5CKQA 3AFKA 4QB1A 2P6CA 3UJOA 3UT0A 2R072 5KXDA 1OUSA 1RUI1 1XNTA 3GNEA 4UOJA 4BHPA 5IHRA 5FPLA 4A45A 3O1OA 1GOHA 4YG6A 5FOJB 2XVLA 2HWF2 2HJIA 3M7AA 1CJPA 3S7IA 1QXPA 1Z0HA 3ZM8A 1BJQA 2ENRA 3N9PA 5F3CA 5FYBA 2TNFA 3VKMA 5JSPA 4MX3A 2OVUA 4YLZA 1W04A 2VMCA 4MHRA 4LMFA 1GNHA 5DXDA 3T1LA 1RMU3 4C1XA 4MGQA 1COV1 4CXYA 1Q8VA 4EQVA 2ZZJA 1Y9MA 3BIWE 4MSVA 4BMBA 3HNYM 5K9YA 4R9BA 3D0JA 1MEC1 2OUHA 5E16A 4JGYA 2KR2A 2OW4A 4J25A 4WM8A 2P3JA 2P4EA 5DAQA 1K3IA 1VBD1 2W94A 3ZFEB 1UW8A 3AP9A 3BALA 3VDDB 1DYPA 3TAYA 2VCCA 1WLCA 4GWIA 4ASMB 1S1AA 4BH9A 3RJ2X 4CP1A 4B4PA 4HOOA 1HKDA 4OMDA 3WNOA 3VUOA 3ZDVA 2GP3A 2E32A 2WFF3 1MZ6A 4JGZC 2AEYA 2YBPA 3B69A 3SLIA 3NVCA 4COWA 2X5IB 1ZBE1 3O0WA 4LO6B 4PBPA 1L7RA 5FZ9A 5FXWA 2AEZA 1DHKB 4HMZA 3MIHA 4ZPIA 4PIXA 4XBQA 4CEWC 5GZGA 2WNVA 4G3YC 1DIWA 3NAPB 5JR2A 5KXCA 3K51A 3OEBA 1BXHA 1DF0A 3W21A 4CU7A 5DUWA 1WUVA 4TXWA 5AC92 2PLV1 4YW3A 4QX2A 1FOD3 1V6IA 1QXJA 2BNOA 3MF6A 5CG9A 4NIHA 4DMIA 3TEWA 3NV1A 1CR7A 1HB3A 2CDPA 1WGPA 3M1HA 5GZCA 1O3RA 1OXCA 5F2WA 5JIAA 3PUIA 4BU2A 3PL0A 2DUOA 4IEYA 4CUGA 2A6ZA 4BQ4A 1DG6A 2MPFA 5A33B 1K5JA 1E5HA 4P9LA 4Y5Z0 3VBOC 5K8SA 5BXXA 4RR3B 4QM8A 4PJYA 1RVF1 1QJU2 2UYBA 5FP9A 1NY71 2D3RA 3O5SA 3C2UA 2JDHA 3LIGA 3P5BA 4ZONA 2AACA 3SKVA 5TSWA 1NX9A 4CPBA 5I8TA 4QQHA 5FMDA 1A78A 3LEKA 1MR5A 2QUOA 2RS11 5JZGB 2HH9A 3VBFA 5ISLA 2VMDA 5A32B 5L36A 2LRPA 4EWEA 1WKYA 4CP9B 4NUBA 2V72A 2NMNA 3PVNA 4CCLA 3WX5A 1AX2A 4LBJA 2Y8KA 2YFZA 4HK8A 2BBVA 2Y6HA 1NE6A 5C3OA 4NIAA 1R1A2 3IPVB 4AEDA 4GB31 1S0IA 1A8DA 2DBNA 4Q27A 5FPBA 3TN91 1W8FA 2PQSA 4OZXA 3AYDA 2D93A 4BQ1A 3OPWA 2C0ZA 1Q56A 1S0BA 2HEWF 4D0QA 5K0UA 1RUH2 1LOFC 2B46X 3WNPA 3N7MA 2NP0A 4E8DA 1OC1A 2PFWA 3DEMA 1FMD3 1H2KA 3I2IA 3HNBM 1N1VA 2JG8B 1VBE1 1UIJA 3DPRB 3NNJA 3W58A 2AENA 3ES1A 3DKQA 5FYCA 4S2GA 4XC9A 1I3HA 2EICA 4XUTA 4D6RA 1XRUA 5CFDB 1AX0A 1MS0A 4ORFA 3WLUA 3LOBA 4B4QA 3I2HA 5LBFA 2XLFA 4ZU7A 4Q4Y3 4Q0VA 2VZOA 4BE3A 5AFEA 4Z07A 3JQXA 1OOPA 2EF6A 2OYZA 3I2GA 4B7EA 1E5RA 4XCAA 4BQ2A 3ALQA 2A6YA 2A5ZA 2PHFA 3NL1A 3IIIA 3RZKA 2VR4A 2MEV3 3K48A 4IEWA 2RV9A 4S2DA 2JD9A 4XFBA 5FZEA 3CZUA 2UWBA 1HRV2 1K42A 2ZMLA 3VBSA 3PU8A 4QGMA 5FYHA 5GKAC 2JJ6A 2ET7A 3PUHA 3HR9A 3W5MA 4E27A 3M3QA 3RNSA 2QCSB 1NLSA 4C91A 1VBB3 1S0DA 2DWRA 4PI0A 3HJRA 2UWAA 3MV01 4X6QB 4TTGA 1QH6A 3GZEA 3JQWA 4ZU5A 2DBIA 4MLOA 5EPAA 3RFRA 1F2NA 2A6XA 3PVBB 3J7LA 1V9U3 1Z7S2 5FUIA 1QOSA 3LAGA 1BBT3 1KQRA 4CU9A 4YM2A 5BNOB 2VULA 4MGTA 1QDCA 2B39A 5KBFA 1JBCA 1HJFA 1D2SA 2OIIA 5FZ1A 1NCRA 4P9JA 4FTBA 2CU5A 1MS5A 4IGOA 4LLFA 4OHZA 4CDXB 2OPWA 4CXWA 3BTYA 4OUMA 4XVHA 2WO3A 3WG4A 4CE8A 2WFPA 1YWKA 1ZBA1 3AJZA 3KB5A 2D5FA 3PTYA 4Y20A 3WDXA 4DY5A 5LW9A 1HXS3 2K46A 1ASJ3 3ZMNA 3ZXLA 1QJX1 4MOAA 1SLTA 5J48A 1QH7A 5JSRA 3IAQA 1H6YA 2GDFA 1GR3A 4UF0B 3NWKA 4XETA 2OXBA 1NCQB 1IPJA 1ENXA 1ULDA 1QQP1 4GMP3 4HVOA 4W50A 4CU8A 3U37A 1UMHA 1WMFA 1PMJX 4Q1PA 4MGZE 3ZMOA 2F17A 2RR11 3FHAA 2ADDA 2XJPA 4GAZA 3VBHA 1N1TA 3AMPA 5CKMA 1C8M1 3WDTA 1F4AA 1S55A 3KD4A 3N9OA 4B4RA 3OBRA 3E5XA 1AR93 1C28A 2R0FA 5A7NA 5FYIA 3POSA 1W6MB 3I8TA 4FPJA 2D6NA 1AX1A 1JOPA 2E7TA 2R071 3B7MA 4R52A 4R4XA 5IYYA 1AYN2 2EIGA 1PNFA 2X10A 2Y6JA 3HEIA 4GA9A 4KGGA 2XUEA 4N43A 5FY0A 4NWWA 4COYA 1JYTA 2HWF1 5JOXA 1MS4A 3NJXA 4BYYA 3WZ1A 4FPGA 3CJIA 2JE8A 2RJLA 2Y6LA 4DZGA 1PO11 4YVWC 1K5MC 1UO9A 4O9EA 3N36A 3POBA 4D6SA 1TZOA 3PIJA 5J96B 4X8PA 1EP0A 1IQAA 1PNGA 1IGOA 1SBDA 3Q8AA 5F3GA 3RWNA 1D4M2 1FXZA 1VE0A 2G19A 1VR3A 2EXKA 4HXCA 2HYKA 3P6BA 4GWJA 4GWMA 5JMOA 1RUD2 4ITCA 2OS2A 2PA7A 3GCWA 1ND2C 3MLJA 4BOWA 1U5XA 1V70A 2JDZA 2V09A 1YJLA 5A3UA 4LO8A 5FMOL 2UURA 2PHLA 5A3PA 3RVHA 3IDEA 3QD6A 2JXAA 3MO4A 2JG9B 2ZACA 4Y4RA 1NXMA 3J8F2 1XJAA 4PLMA 2I74A 4GIQA 1X7NA 4Y4YA 4AE2A 1CAUA 2YC2A 2BERA 1RYYA 3D6EA 4GH4B 5A80A 4OCTA 1SFPA 4I0WB 2RMU3 1OPOA 1R1ZA 2ORXA 1F8VA 1JHNA 1UAIA 3AFGA 5H9RA 1EUUA 4CU6A 1WMDA 4MGKE 4JGZA 3PVEA 5FJHA 2RDQA 3RYKA 5I8SA 4XFHA 2ET1A 4XUQA 1PZ8A 2ZX3A 2P3KA 4WVVA 3USUA 1QKQA 3MIFA 4CEWA 5JWPA 4UW4A 2VW0A 3I3QA 2FZ1A 2JE7A 3DKWA 5AC91 1ULCA 4V2VA 4U2AA 4IV3B 3GALA 4PLNA 4HPKA 3T08A 1N1SA 4QQPA 4AEKA 5FFOC 3I2OA 3N9QA 5F8PA 4JAAA 1C3HA 4K7JA 2DU0A 3ACHA 3FBMA 1G6NA 2RG4A 3KM5A 3DUIA 2ARXA 3ZR6A 3AYAA 4K21A 4NHYA 4A3ZA 4QGNA 2WS92 1FX5A 5FUPA 4W65A 3CDZB 3LF7A 4IEXA 3LDKA 4NE9A 1AXYA 2LUWA 5C4WB 2QDRA 3V0AB 1GQHA 3OF1A 2Y26A 3VBOA 1B35C 2WBKA 4PCRA 3RPQA 2WYSA 4XF4A 4Y26A 3DN7A 3ZXGA 2HWE3 4GD4A 4H7LA 4CSWA 2VOWA 2XB6C 5GLUA 3WDYA 2EIEA 2PTMA 3AVRA 2R6QA 2VPVA 1A8MA 3ZOIA 1UOBA 2QNKA 3BODA 3RZHA 3WEZA 2Z2SB 1BQPA 4CCEA 1C4RA 1O91A 2YY1A 1IZ3A 3ZN6A 1Y9GA 4K9SA 4EN7B 2ES3A 1HDKA 5DUVA 3EXUA 3LFIA 4NOTA 2XKOA 3AX4A 4KGQA 2XG3A 1POQA 3B93A 5HXVA 4M4PA 2Y6GA 5F5QA 3WF4A 1HLCA 1UY3A 4HG6B 3VKFC 3ZYHA 5FZCA 1X50A 5DDJ2 4FOQA 2XBO1 3KMHA 1LEDA 1RUJ2 4GJYA 2ZX2A 2EIDA 3E6CC 2RDNA 4LIUA 1NA1B 1RUH1 3R4SA 3KF5A 4P00B 2CHHA 1AYM2 4XJ8A 2W39A 1F4HA 4QMAA 5K7PA 2VOVA 5FZOA 2J7MA 4OULA 2IXIA 1N3QA 4Y5TA 4C1WA 3LWCA 5EIYB 1KDMA 5FZ3A 3QH7A 5B4XA 4AOCA 5DAWA 4LPLA 4MXWB 1W9WA 1KITA 4LO5B 2BRTA 1W9TA 4XDQA 4XOGA 1ENRA 4LBMA 5FRAA 1VALA 1OLME 1LHVA 1A3KA 3KQRA 2P17A 2BV4A 4YW4A 1VRH3 4H2AA 4AFMA 3ZFFC 1FPN1 2WO2A 1H1AA 3WUCA 3MI8A 1NLRA 5JR7B 3ZXDA 1GKBA 2LROA 4XHXA 5IT6A 4N9IA 1W2OA 5DN2A 3OUIA 3FWEA 3NJZA 4GXLA 5FMOS 1MZEA 4NIGA 1HRV1 1O8PA 1H4HA 2WT1A 1GFF2 2JDMA 2ZKNA 1PVC1 3POYA 2VVFA 1Q5OA 1KS5A 2UWCA 1RIRA 5GLTA 4CCKA 4DUVA 4H3WA 5K4LA 2FDHA 2ZXQA 2AH2A 4ZZ5A 1TMF2 1HN0A 4GKYA 3SITA 1JMUB 5FY9A 4NIIA 1LB2A 3M70A 3UKNA 4NR1A 1ST8A 3WV6A 1M4WA 4F3JA 3LQCA 2J1VA 2RVAA 4IEPA 1GZTA 5C71A 5L9BA 4YGBA 3VV1A 3U10A 5LBEA 1Z7S1 1UWWA 2W1SA 3Q8BA 1LOCA 1TNRA 4IE7A 1DZTA 5LASA 5A7PA 1ULOA 2R043 3PMSA 3A21A 4YWAA 4AVAA 3PU3A 4P9XA 3T0BA 1YI9A 1VB4A 3MHZA 1H8TB 2RM22 4FQ4A 5HPOA 3G6JB 2DVGA 2FCTA 1HW5A 5I0DA 1CPNA 2GC3A 3ZSKA 4F8AA 1OD3A 4AI2A 1QJY2 1GUIA 4YM3A 1WMEA 4COZA 1JYXA 2G1MA 2XH6A 4N53C 4AI1A 5FBJA 3DL3A 4A41A 1F31A 3KV4A 2C6SA 1KFUL 2VCBA 5C9AB 1VBD3 3ZN5A 2VZVA 3JUUA 2JKBA 3AJYA 1FYUA 5C6CA 4I02A 4QPGC 3HPNA 2W3JA 4BQ3A 2EXIA 2XKPA 3MW3A 4ATEA 2HWC2 4XF1A 2PYTA 2SLIA 5C8WA 2ZZQA 3OBTA 4HT1T 4Z8BA 3UNPA 3RSJA 3BTAA 5BY5A 1G9AA 2UYAA 1WBLA 2WSVA 4DXRA 1GOFA 1NZIA 1AL22 1CAVA 5DPNA 4FI9A 2NMOA 1CZTA 1LGBA 1AYN1 2ZMKA 2W08A 2WNOA 3M2MA 5D21A 4QWNA 3NNMA 3L2HA 3RZZA 4IEQA 1KFXL 1CAWB 4FP3A 4FXGB 5ANQA 1BEV2 2PLV3 1ULGA 3AXDA 3IT8A 4RHV2 4CDQB 1ZZ6A 2QQVA 3VBUC 4BLJA 3I2KA 2QZ3A 2XHNA 4HL0A 1V00A 1XSQA 1ND3B 1NQJA 1OSGA 2BQPA 1APNA 3BTXA 1D4VB 1EV12 1F35A 3IN9A 2ZX1A 4YVWA 4RFT0 3WXPA 5BPXA 2VW2A 1R092 5JOYA 2HWD1 2W2IA 1C8NA 1MQTC 5D2AA 3WF2A 1W8OA 5J37A 4NROA 2YBSA 5IW0A 5SV8A 1VBA2 1OMIA 2VL4A 1LECA 1RVF3 3ELNA 2EAKA 1GP6A 4QXBA 3QACA 1ND2A 3N4MA 1PVXA 2JD4A 3CF6E 4UYBA 5JVVA 1NXD1 2H6CA 2PHRA 3I4IA 4ZZ8A 2XLGA 1HB2A 2DTWA 2RS13 4Y1XA 1OPMA 1U5IA 4UW6A 1S0CA 4NRPA 3U14A 3JB4C 2G9ZA 1DGRA 4RQPC 4PIZA 4LO7A 2Y0IA 4LLOA 3WHTA 3ZKUA 3V0BB 1PO22 4NMIA 3AZXA 1RUE2 3NJVA 4AGVA 2VJXA 1W39A 4QPIB 4GB33 5FREA 2D6PA 3TN93 1IPSA 2B7YA 3N7JA 1CN1A 1UXXX 1XU2A 1YJKA 2WAOA 2XHKA 3P1IA 4LTAA 5A6ZA 5I93A 3FLPA 1Y7BA 4NO4A 2DUPA 4CUBA 1W8WA 4E4HA 4AQSA 4Q26A 3T2TA 4JQRA 3WUDA 3OCPA 1UY2A 4FOYA 4NAOA 2VMIA 3AZYA 4L97A 1PK6C 3NV2A 1W6PA 1QWRA 3I7DA 3ILRA 4LO4B 4QPWA 2QDNA 4UXAA 3T2QA 1WMXA 1ZVFA 4I3PA 4RFRB 1BMV2 3LB9A 1C1LA 2WS91 3X29B 1BK0A 2GN3A 1PM4A 4XE9A 4FPHA 1W2NA 2IFWA 2F6BA 1G7YA 2BFUL 3M3OA 3OPZA 3IDCB 1W03A 3KVAA 4LK6A 1W90A 4B1MA 3ES4A 1HJGA 2GNDA 4LK7A 3ZDSA 1B35A 3S6PA 4AQTA 2K2SA 1HRI1 3FUQA 1QNYA 4IEVA 4UI9L 5E6HA 3H3UA 4I30A 5KWRA 1JH5A 4Y22A 1YFXA 4V1PA 1CIWA 3VB9A 5A1AA 4CYDA 5FZ7A 3ORJA 5FY5A 1MACA 3ZN4A 1JZ7A 4KQ7A 3TEZA 2I2SA 3AYCA 1MS1A 4Q4V2 5F39A 4FFFA 4IV1B 3VDCA 5FAXA 4XMAA 5EYXA 1ZRCA 5IVBA 4D7SA 1XOYA 4TSVA 3T3YA 1OH4A 5DDJ1 5HCBA 3UGGA 1DYOA 2HWB1 1DQ6A 4QD2A 3UGFA 2A6WA 2D7FA 1NG0A 4NRQA 1UIKA 2D98A 4YNIA 1SCRA 4YZ5A 3LDRA 2QQWA 1W6QB 2JENA 5EJ3A 5C5TA 3T4VA 4E4SA 4RA0A 3GZTB 4Z2WA 1W8ZA 3BPZA 5FLHA 4OI0A 3RMYA 1GSLA 1UU6A 5FQ0A 4EV0A 1LR5A 4YM0A 3SMHA 1I6XA 1OVPA 3RYPA 4GWNA 2GN7A 1N3PA 4BXFA 4QXCA 4YVSA 3OYWA 1NT0A 2VNOA 4PBOA 4QHOA 2BP6A 1AHSA 1VPHA 2A75A 1U5YA 4NHMA 4HETA 2GMMA 1QJX3 3E97A 3ZFFA 1UYPA 3I3MA 4XTMA 1NZCA 3DGTA 2C1FA 3AMNA 1ZA7A 2WNUB 3J7HA 2O1QA 1BCXA 4PHZA 4PQQA 1XBFA 4E2QA 2ATFA 5A1LA 3RI8A 5BNNC 1SPPA 2YROA 4Z92B 1EAH1 4CCOA 4LT5A 1MS9A 3SHRA 1GZWA 3RWKX 1YCIA 1VIWB 2PELA 4BQWA 4HKOA 2RR13 3OEAA 1RITA 2FBEA 1JZ8A 4AXOA 4KU7A 1C8M3 3O0XA 5LRSA 2BU9A 3JCIA 5IVCA 3ZFGC 2BUKA 1YQ8A 1MS3A 3GDBA 2CYFA 1OH3A 3H8UA 3JB8A 4LIVA 3THCA 1N3OA 5KXEA 1G9BA 4XIOA 1T6BX 5FYZA 1UNBA 4YW5A 3KGZA 1KJRA 2JB8A 4R4ZA 2WJSA 2WZPP 3FFQA 4W6XA 1RXGA 4AHWA 2VNVA 1GOGA 3KGLA 4AW7A 2W0XA 3KHCA 2HWF3 4HBNA 2VTXA 1UZ0A 1OBNA 3ON7A 2R16A 2WRAA 5FOBB 3CJIB 5LBBA 4ES8A 1PO13 2I45A 4QX8A 3D4KA 5JI7A 3FJSA 4WVWA 1DZQA 1BK1A 4JTNA 3NW4A 2WUHA 4CA9A 4XF0A 1FI2A 2Y34A 3U11A 1I9RA 4A44A 4Q4X1 4C0BA 4FP2A 2CGNA 4EN0A 2H0BA 2H6BA 4W6YA 5KXBA 1TME3 1J3QA 2A3WA 2K0GA 4XPVA 5EHDA 4XJWA 2BFUS 3WQ1A 5FYSA 5KC6A 2BPA2 3A22A 1UL9A 3AZVA 4N53A 5FYVA 3OY8B 3FE5A 3ZFEC 3VDDC 1CPMA 4EZ4A 2YB7A 5EQUA 2LS6A 2HWC1 2G9FA 2IWGB 5A6XA 4URTA 4LBNA 1XNKA 1GANA 1ULEA 4QPGA 4HKLA 1S2EA 1C57A 4DIQA 1RL3A 3LD8A 2HBUA 4S2FA 2X5IC 3NJYA 5FXXA 1ENSA 4NPRA 2IXKA 3HQUA 4JKMA 4QHZA 4GQ7A 1AL21 2WFF2 1KGYA 4JZRA 3I59B 1AR73 4AL9A 1CJDA 1V0AA 1YO8A 1KS4A 3NAPC 2QQOA 5AC93 4RHV1 1W3XA 2L9LA 4Y1ZA 3WG3A 2VXJA 4TLFA 5L7OA 3HVDA 1S2BA 4AVVA 2Q1MA 3VZJA 4CUCA 2V4AA 1RUF1 1UYYA 2VMFA 1DLCA 2JICA 4I01A 4XBLA 3WNNA 3U0ZA 1J84A 1AL0G 2BOIA 3O0VA 3VBUA 3BPSA 1YIPA 3LEMA 1R091 3GF6A 4NVPA 4BIOA 3ABZA 3SH4A 1FOD2 4XQ4A 4XUPA 1D0GA 4KBZA 4I3GA 4WM7B 1R081 1W8HA 5A7WB 1SBFA 1VBA1 2JIJA 1RHI1 2ZEXA 5F2SA 1MQTA 3MW4A 4RR3C 2KM2A 3PVOA 3VZLA 1CIYA 2IFRA 4HN1A 3ZXFA 4LBOA 2OKXA 4H55A 3UJQA 4XMIA 1XYPA 1W0OA 3HAGA 5EXOA 3WNMA 4A6OA 3A23A 4FCAA 1HIXA 4XZPA 2VVEA 2DU1A 2WR9A 4FVVA 2AGSA 4A3XA 3IDAA 5I0SA 3MDPA 3E6BA 4UW5A 2C9KA 1IS6A 5JZGC 1LODA 4MVTA 2H0VA 1UZYA 1DQ0A 3NNLA 4YW7A 3IM0A 4AEMA 2J1SA 1VAKA 2ZABA 1RUE1 2VW1A 3B9CA 3D82A 2VG9A 2DCKA 5IVYA 2X29A 4LUKA 1RUC3 4PDWB 4Q4W1 4RQPA 3ZN6B 2ZCWA 5LRRA 3SH5A 1SZBA 1RJ8A 1V6OA 5JDBA 5FO7B 1ULPA 3DYOA 1ZM1A 2XBO3 5A3NA 1CAXA 2WO7A 4LHSA 4BPZA 2DFCA 4FFGA 1LAJA 3EMRA 1DGWA 1OLRA 2BGOA 2D6LX 4J1XA 5FYYA 1NUKA 1DCSA 1D2QA 1OA4A 4WZFA 3VZKA 5L19A 1HQWA 2GC1A 4IE4A 4H7MA 3U4SA 3BKZA 4AHZA 4B1LA 2JG8C 5FV3A 3ZO0B 5GZFA 2FCUA 2ZHKA 3DPRC 3LGRA 5FP4A 1PK6A 4E9KA 1ZRFA 3PJYA 3E6DA 4UFLA 1FMD2 3T0AA 1G8WA 5APAA 4OMCA 1V6JA 5CFDC 1IPKA 4FO9A 1ZREA 4GMP0 1LGNA 1W8TA 1RC6A 1W6NA 3BB6A 4M4RA 4AVSA 1YI7A 5IUQA 2PHUA 1FPN3 3NO8A 1RUOA 3C7EA 1PIV3 3QH6A 3MUZ1 2XOMA 1VBC1 2R063 2VQ0A 3K3OA 5FZMA 3DF0A 2E53A 4LXLA 5I0TA 1LRHA 4OYUA 3S5AA 1H1MA 2IUWA 4NHKA 5LB6A 1CESA 4Q4V1 1ZNPA 3ZSJA 1Q43A 4QU2A 1F15A 1C5IA 3PUQA 4QX0A 1GQGA 1PVC3 5A1FA 2BNMA 1LJ7A 2VMGA 1WD3A 3BVCA 4YZ3A 1QJEA 2MEV2 4FPEA 5FR3A 2OPKA 1WZXA 2GNTA 4KU8A 1NKGA 2VUJA 4LHKA 4QGLA 1W2AX 4R8HA 2QQIA 3PTRB 3BTZA 2VQTA 1LHWA 1WW6A 1Y9QA 1L3JA 4RD7A 3NKGA 2K9ZA 2CL2A 3EJKA 4W4ZA 4TWTA 3ZYJB 1YNAA 4K8RB 2QFEA 2YU2A 2BGCA 4JX0A 1ZX5A 1Z7S3 2VQUA 3DYMA 5DZEA 2YPJA 1VMFA 1OURA 2Y33A 4UFIA 5SV5A 1H6XA 2PQQA 5DAPA 3TWIA 5BNOC 2BEOA 3DXTA 3D3AA 4ASKA 3BOPA 3KVBA 4FTEA 4JDMA 1H9WA 3OPTA 2E6VA 1O4TA 1SBEA 5F3EA 1C1FA 1SHWB 3H1MA 4PT6A 3FMGA 4R9DA 4CDXC 4EN8B 4NJ4A 3JD72 5C8CB 3H50A 2ZEYA 3HQXA 3NNFA 4NPLA 2DVDA 3NV3A 4DS0A 2DURA 4R9CA 4JKKA 3OGSA 1JOBA 1ULFA 5FP8A 2KXLA 3CJXA 3O1UA 4XAEA 1U12A 2R1BA 3GBGA 4URAA 4L8QA 2VCAA 2J1TA 3UL2A 2JDNA 3GZUC 5IJRA 5BNPB 1NCQC 1H30A 1QGLA 2Q1ZB 4XFCA 4A4AA 5I0RA 5BNNA 2OUJA 3GHMA 1QDOA 4PF1A 3SISA 4P08A 2N7GA 5F9TA 4I0BA 1JZ4A 1QJFA 4WZCA 5FZ8A 4BZ4A 2VMHA 2VY0A 4KWLA 1WCSA 3A0KA 2R7EB 5AVAA 1LHOA 1OA2A 2W68A 4QXKA 3WF3A 3VZMA 3ZFGA 2ZAHA 4MADA 4RS5C 4DY3A 5CISA 5LWBA 3OSDA 3NV4A 5DAVA 2XL7A 3OG2A 2FCVA 5F6LB 4LA2A 4ZXKA 5E1RA 1JU4A 2Q4SA 4J6GA 2E63A 3LPGA 4TLGA 5JXHA 4AFBA 5DMYA 1HQLA 1OQ1A 2D43A 2VOTA 3BIEA 4X6RB 4O7XA 5IVVA 5BNQA 2GSYA 4OUEA 5CIRA 5FYTA 3OGVA 1LU1A 1OD5A 3WINE 3FHIB 1WLDA 1SACA 2HWD3 2VZPA 3I2FA 4MH0E 3WP5A 5CBLA 4ATFA 5DZFA 2XLAA 4CZSA 2BGPA 4HSLA 5GJ6A 1AZDA 3POGA 4YPJA 3W20A 5CKNA 2B9VA 2NYYA 1PMHX 3MIBA 3AZZA 5C33A 4ARXA 2EXJA 4OFGA 3ACLA 2JG9C 5FZ4A 5T55A 4AI8A 4Z2AA 4KG0A 5FLIA 1AR83 4QQ2A 4A7ZA 1BKZA 4GH4C 4P5YA 3I49A 3C7GA 1DZRA 3O12A 4XIKA 3TNQA 3WDWA 5DZGA 4HONA 1DFQA 4YGDA 5JAXA 1G9FA 4N9HA 4LBQB 2Q8OA 1K12A 1JXNA 5FZIA 5FO9B 2X5IA 4A7KA 4RGGA 4UBHA 5A3MA 2QJVA 2RMU2 1QNWA 1QHDA 3PIGA 2YBKA 3AM2A 3SEPA 3WW3A 3FN9A 5FPZA 4D6QA 1XNAA 3ZXJA 2VQAA 3MEPA 4LHNA 2QBXA 1X33A 2ZJCA 2JDYA 2WKKA 2B9UA 2R1DA 2PHTA 4IV3C 3MIDA 2FDIA 2YUEA 2WZEA 4MO3M 2WZR2 2WL1A 2J1RA 1GP4A 1UY0A 2KA3A 3LEGA 5HV4A 3PDQA 3WG2A 1FOD1 3H9AA 3T4HB 1QJU1 1XPWA 1Q8QA 1T2XA 2W1QA 2QVSB 1F5FA 3RRDA 2WABA 2WLPA 1YFYA 2WS93 3K3NA 5T52A 1VMHA 3GBWA 3ECQA 1GNYA 2ZHMA 4NHXA 4ONUA 3J7MA 3KWVA 4META 4SLIA 1Q8PA 4I0AA 5A33A 1G9CA 5HI0A 3H7JA 5C4WC 2GALA 4K1YA 4M3CB 3ZYRA 4FBFA 1FNYA 3F95A 3I2JA 2GP5A 4YRDA 5D8AB 5HXMA 1YQ2A 4HANA 2FDKA 1HRI3 4XZUG 5F37A 3ACFA 4IE0A 5EJZB 4DEQA 1AR63 2QQKA 1BVP1 4LULA 4QM9A 1R1A1 2XQRA 4YM1A 4CDWB 4DRRA 3RZLA 2ZGRA 2HWE2 3SKJE 4Y22B 4BA6A 4KWUA 5LY1A 3TYJA 3N7LA 3R0RA 3SCGA 4NAMA 4CP9A 4LEJA 5CA6A 1Y43B 1DQ4A 3RGBA 4B7KA 5C3PA 4BK5A 4AK3A 3M3CA 5IWFA 2ZGUA 4FFHA 5DDJ3 4UT5A 1OA3A 4OVEA 2AC1A 3POFA 2DCYA 2HWB3 2VBPA 3HNMA 5GZEA 3IPVA 1XYOA 5JI9A 2ZGKA 4M3CE 3M3EA 1LOFA 1O4ZA 2CGOA 4CEYB 1J3RA 1YQ5A 3L2YA 2C4XA 1JUHA 1NA1C 4XDPA 4IGPA 1RXFA 3NRUA 1QEXA 1JW6A 3EBRA 5HBAA 4L11A 3D8CA 5CFCB 5C3QA 3VD4A 1W6OB 2LALA 2Y60A 5CYYA 1UPSA 1W2UA 4NIDA 3I2DA 1VRBA 2Q0AA 2JDKA 2C9AA 4P02B 1O7FA 4EWAA 1PGW2 5F5AA 2V5YA 3LOIA 5T5JA 2ZEZA 3DPRA 2QQUA 2R30A 2VZTA 2XR4A 3WDUA 3K46A 1YFWA 5H9PA 2RJ2A 4YVSB 3KV6A 3ZVXA 1YC61 4XDOA 5FPXA 1RJ7A 2P1BA 4FOWA 2F4PA 1GQPA 5FPUA 3B5LB 3AP6A 1FNZA 2QQPA 3LZZA 2R0HA 1E5IA 1SQ4A 4DPNA 1HB4A 1IS5A 1POV0 1VAVA 1VRH2 1KD7A 1YFUA 3TNPB 3WF0A 4AVCA 4QQOA 2Z4FA 1EAH3 1DGWX 2B45X 2WQ4A 1DQ2A 5ABJB 3MBWA 4UW3A 3PNAA 1OQEA 5GM0A 2RHPA 1RUNA 2ID4A 1ODMA 1UZVA 4XFGA 3WR0A 1GV9A 1S0EA 1W28A 4FQZA 4EWDA 2RDSA 4W6WA 1J83A 3ITQA 4OUSA 5L9VA 1BLZA 3LA7A 3N35A 3UK9A 3P3NA 1MZ5A 1RUI3 1X9PA 3NNGA 4QXHA 3VD7A 4FSJA 1O8SA 3JBG2 3CZJA 1XNCA 3AP5A 3E5UA 4XURA 3T09A 4N7UA 4ZHNA 3POWA 4YARA 5ACA2 3FBYA 4QX1A 2XJUA 1W8UA 1UMIA 3INAA 4UBGA 3ZXAC 4OHWA 2XJRA 5KHHA 3OJBA 3OTFA 4FT8A 1COV3 3T2PA 5BNOA 1H8TC 1ZZ8A 1GWLA 2WDBA 1LENA 3ZX7A 1W9YA 3JD71 3CU7A 4CDUC 2D40A 2GMEA 2R042 4L99A 1MEC3 1LGCA 4JGYB 4WM8B 3Q9OA 4N8MA 4CDXA 1LHUA 2E33A 3H8RA 1O3SA 3OOXA 4Q4X3 4E2SA 4EJRA 5FYUA 4MXVA 4E4ZA 2FZ2A 1NAEA 1GLHA 2ADEA 2X05A 3S7EA 2WWUA 2W95A 3VDBA 5CZKA 5C9AC 3FHQA 2XWBB 4E8CA 1JYNA 1HN1A 3IBMA 1ZBE3 3J26N 1STMA 4UF0A 2W92A 5GLWA 1NCQA 5JLVA 3MF9A 3I97A 4XXPA 2YPDA 2JWPA 3NSTA 4NWVA 5F5CA 4G9SB 4GMP1 2ZGNA 5DQ0A 2WNVB 5AVPA 4BM8A 2YGMA 5A3LA 3B01A 3T0DA 2Z42A 4N7IA 4XCBA 1U0AA 2YYOA 3KT1A 3B9IA 3ZSEA 1KRIA 5FZ0A 2DCJA 2OZ6A 2D97A 5FIXA 4RS5A 3RYRA 2EAAA 5JXGA 4K40A 4HLTA 4KBBA 1O5LA 4K1ZA 4AFAA 1PZ9A 3W5NA 1AJOA 3H8OA 2QE3A 1W6MA 3VBRC 5AFBA 3FLTA 5L7OB 1D4M1 2BZDA 3DCQA 4CDQC 1K5MA 4NN0A 3WG1A 3AP7A 1OF3A 1JYVA 1RUF3 2PAKA 4MHUA 1RUD1 3KF3A 4XF3A 3JZVA 1ND3C 4LA3A 3KT7A 1J58A 4J1WA 1XNDA 2XONA 1JZ3A 2DYCA 1S0JA 4F83A 3FZ3A 2GH2A 4E2GA 1R083 2VOXA 1VBA3 2D6MA 5T3NA 1RHI3 3RDIA 1DLLA 1EPWA 3J8F1 2RS52 4AQ2A 2V73A 3E5QA 3PJQA 2O8OA 1REEA 2VMEA 5KR7A 1H8VA 1CGPA 3VBFB 2BYVE 4BQ5A 4QDRA 3ZLIA 1E5SA 2YXSA 2HEYF 4QQLA 3I3BA 3GXUA 1NY72 1W9FA 1EUTA 2E51A 2JG9A 4AEDB 4LR4A 4D7TA 1JZ2A 2GNMA 4DNYA 3RMXA 2A3XA 5DG2A 5F1RA 4GH4A 1W06A 2RS12 5A7OA 2XXZA 4Q4W3 3ZSMA 2TUNA 4CVUA 1B09A 1SLLA 4YG3A 3VD9A 3PLQA 1LEMA 1H4GA 4QPIC 3RI9A 3R4UA 5K0UB 1JU3A 3UGHA 4K8FA 1WWYA 2GC2A 1U5ZA 2P34A 3WSOA 2NPIA 4BCUA 1L7QA 2A6VA 2ERFA 3MYXA 4GB32 5EJ1B 1VBE3 2RS32 3THDA 3OBAA 5E89A 2WNEA 5BV6A 1Z78A 2DF7A 2WAAA 2WZR1 3NKTA 2ZBJA 4C90A 2XVKA 4IV3A 2DCTA 3O1TA 5FZHA 3S30A 2W47A 1UOJA 3VHOA 4OHXA 2EALA 1OFNA 3D0SA 5FWJA 4QDSA 2JDPA 2ZGSA 2Q8EA 1W3VA 1V6LA 4E4DX 5FZAA 3SC7X 2AZ5A 4HK9A 2G4IA 1FT9A 3LSDA 3ZYGA 3E1F1 4FPYA 1OOPB 1SDDB 4XFFA 4RN5A 4CP0A 1GWMA 1HQNA 3Q8CA 1LHNA 3LFMA 1AXKA 4BWOA 2P37A 3AP4A 1JYCA 1UKRA 1ZA4A 5C4WA 4Q8LA 1IKPA 3V0AA 3MLKA 1VBC3 1CX1A 1JS9A 4LUMA 4RGAA 1X8MA 4ZS2A 1CWPA 1IKQA 2WWJA 4OLLA 2PMWB 5JXIA 4XJZA 1UPIA 3J7NA 3N9MA 5F6KA 3VBSB 1YHFA 2W87A 3WT3A 4AZZA 3AK0A 2AUYA 1RUJ1 2SBAA 4AVBA 1AF9A 5FKBA 4XJ9A 4IV1C 5JIUA 2EIBA 5FP3A 4A7YA 4AVTA 2IXJA 4QB2A 4O9GA 1AYM1 3FFZA 1MS8A 3TBDA 4UFMA 2IC1A 2A73B 2CWMA 2Y0OA 3THTA 4Y24A 1GNZA 1RUG2 1UX6A 5CAZA 4GZ9A 1LNSA 5C3RA 5IK5A 1OLMA 4RL7A 5FZ6A 3LA3A 5JXJA 3LCPA 2XUMA 2VM9A 4ET7A 5B4NA 4IE5A 1KDKA 4LKDA 5LEKA 4FXKB 1NCRB 1KXGA 3KT4A 4N90A 3ME2A 3TRSB 4MZUA 4BK4A 3GM8A 2ILMA 2WN3A 4GJZA 4IW3A 4XAAA 1V6MA 1ZBA3 2XDVA 2VC9A 3HN3A 4HZFA 1I5ZA 3APBA 4KNCA 4Y20B 4AI3A 1UY1A 3HQRA 1QIQA 1UOFA 2XJQA 2OA2A 2WC2A 4IDZA 2WYFA 2C24A 2ZGQA 4MXWA 5HCHA 3H0OA 2YV8A 2GC0A 3WQ0A 3ZYPA 1QU0A 1N47A 1JN2P 1LOEA 3POIA 4YW1A 5FLJA 2Z69A 3AXEA 3PUSA 1QQP3 1QXRA 5FK8A 3WOGA 3WP3A 1EYBA 1PGL2 3T2OA 3WF1A 4XEZA 2WNUC 3W59A 2JB4A 1TMF1 2W52A 5G05L 3K77A 4DO0A 2DVAA 1QJX2 2VXRA 3VBHB 3ZYBA 1Y4WA 1XNBA 2YMZA 5IAXA 5FXVA 2O8QA 3FL7A 3BU0A 2Z79A 5BNNB 1G9DA 4AR2A 4WVMA 4HVQA 3IMMA 2YZ4A 3K4ZA 2Y6FA 4SBVA 3MPBA 1WCKA 5F7UA 2IXHA 2R073 4FPKA 2LW8A 1D7PM 4YG0A 3JBG1 5IK7A 4JHTA 4N43B 5FYMA 3PUAA 1GMMA 3WDVA 1XYNA 1NE4A 4XTPA 2ZTNA 4YGCA 2P2KA 1C8M2 3MFCA 2RM21 3VHRA 5ACA1 3RZGA 2CGPA 3R4DB 4Q0PA 4YW2A 2D6OX 3U4XA 4CCJA 2JKXA 1AVBA 3AL5A 2IVIB 4XJAA 3CKHA 1UYZA 4XUOA 4WVZA 2GZWA 3CHXA 3R6SA 2JIGA 1QJY1 3JU9A 4LORA 4AF9A 3CJIC 5ERLA 2C5DA 2ZX0A 4EZHA 2D5HA 2XQXA 2R041 4X8NA 3MICA 3WVJA 2W91A 2D44A 3WD5A 2J1AA 2B4KA 1H8TA 3WW2A 5J1XA 4CDUA 5JPNB 1PO12 1RMU2 1H0BA 4AFDA 3VZOA 4QX3A 1J3PA 5IFTA 2W1WA 3IIAA 4XYXA 3HBKA 5L9RA 3WP6A 4JV4A 5FP7A 1CAUB 2FDGA 2W5FA 5F32A 4AYUA 5T5OA 2FDJA 2YC4A 3ZIWA 2RDRA 3AB0A 5C7GA 2Q8CA 3CNAA 4JGZB 1TME2 1WLWA 1NLQA 4XQDA 2R49A 5C9AA 4D3WA 1ACCA 2PN5A 3OUHA 1W2TA 3FX3A 1BVVA 3AMQA 3TEXA 1WW5A 2EVXA 3RS6A 3PURA 3USUB 1LCLA 4F7ZA 3OBZA 3VL8A 1ZZ9A 4BLIA 4CEWB 2JE9A 1BEV1 2XVGA 3O14A 5FUNA 1I5PA 1O4YA 5FZFA 1BYHA 3KCXA 3VHPA 3FLRA 4IEZA 4HPKB 4QKDA 2OT7A 5FDBA 2B8MA 3O1RA 5A3OA 2VTFA 2ZGMA 3IDBB 5EZWA 2VZ1A 5FJKA 1POV1 1WW7A 1EV11 2VUDA 1O6UA 2W9XA 1ZZ7A 3H1WA 3WCRA 3ZSLA 1VB2A 5GLZA 1AR72 2VBDA 2RJKA 1AXZA 4RGKA 3VBRA 1CAWA 3C8XA 3VKNA 5CEHA 1WW4A 4CDQA 4CRQA 1DP0A 4AHXA 2D3PA 4MGIE 4QHBA 2VGDA 1QJU3 4MUVA 3LEIA 4FPCA 3KV5A 1UCXA 3R05A 4Y33A 1ND3A 3DV8A 1CONA 3VBOB 5FMCA 4WBBA 2ZGTA 4AAPA 2DV9A 2PHWA 2WSUA 2RS51 3LA2A 4WM7C 2YFUA 4MV2A 1YQ6A 5KHGA 4OQ8A 1TQ5A 4HSJA 1IS4A 5FWEA 1UN1A 4ZS3A 4YW6A 2UY9A 4ARYA 2AREA 3IWZA 1PO21 3UKVA 3ZYFA 2QKDA 2GU9A 3ZR5A 1R1A3 2P6HA 2GMPA 3EB7A 3OB8A 3ZPYA 5DUXA 2A3YA 3MLLA 1HB1A 4PDWC 4QX7A 1WBFA 2PAEA 3V0BA 3SXWA 1RUH3 1GWKA 3BU7A 5A7QA 5FCCA 5A3TA 4KWJA 4LNVA 2Y64A 4QPIA 1MVEA 1RUC2 2FMYA 2RS31 1DDLA 2VO5A 4Y1UA 3SNMA 5FZOB 3C7HA 2E7QA 4I09A 1RB8G 3M3IA 3SH3A 2XBO2 4CUAA 1XE0A 4KMQA 2OX0A 1RTVA 2Q30A 2YU1A 1UD1A 4CCNA
chains in the Genus database with same CATH topology
4A2UA 4KWKA 1UU5A 4Q0UA 3ZXEA 1CQ9A 1ZYBA 2VUAA 1DU3D 1DQ1A 4IESA 3V64A 5CADA 1Q3EA 1A6CA 4Q4Y2 4XQWA 5GZDA 3QCWA 4PQ9A 4AG4A 4PIYA 2ETEA 1HRV3 3AZWA 4DQAA 1AUYA 3WW4A 2YHJA 5J98B 1FPN2 1KJLA 3WCSA 1PIV2 1QF3A 2MHFA 2R062 1XU1A 1XXNA 2BWCA 5J3UA 1SLAA 3ST7A 4LHLA 4COUA 1N1YA 1GICA 4IV1A 3UKTA 1RUG1 1JYIA 4I2OA 1Q8SA 4M00A 4TYSA 3OGGA 1ALYA 1PVC2 1YRZA 2TBVA 1VBB2 4DOUA 3MGUA 3THPA 1HX6A 3PMEA 2EXHA 3IKWA 4K20A 4WV8A 5FTTC 2CAUA 1W6QA 1V9U2 3EQEA 4P5HA 1F9KA 1BBT2 4YFWA 4GALA 3WP4A 2BVBA 3H3ZA 3AKSA 4M3CF 4XFAA 1XE7A 2UY8A 4HN0A 3JD73 3HD8B 5H9QA 2LM3A 3BCWA 2AYHA 2I07B 5C8CC 2CY6A 1HXS2 4OHVA 5FBZA 1ASJ2 5KHJA 3VGIA 1PGL1 1QOTA 2VNGA 3AKQA 4B3NA 2IZWA 4G4FA 2DTYA 3FUOA 5J7MA 2ZMNA 1URXA 3LSEA 2WNUA 3VLBB 1C5HA 4NHLA 1JTZX 4EN9B 4ISRA 4P9WA 5BNPC 3AMMA 5L73A 2NM1A 4QT6A 3VZNA 1UKGA 2B42B 2BW8A 3B3QE 3MIGA 1CAVB 1AYN3 1H2MA 4D7YA 4YFZA 1QY4A 4YZ1A 3O7OA 2BWAA 3KCCA 1AR92 4JRLA 4IEOA 1SLIA 3SCHA 1BZWA 1T6GC 5T54A 3VN4A 4Q0SA 1QJZA 1YIFA 4RS5B 4P9IA 2DVFA 5EYYA 1OQDA 4P9YA 1D4M3 1UZZA 4IXLA 3GBFA 3D5OA 1K5MB 4YVWB 3UV9A 4AGRA 1QOOA 3HBZA 1RUD3 2DUQA 3AMHA 2XWJB 3ASIA 3HMYA 3P3PA 3WY6A 4L92A 4Q29A 3G7DA 4FPOB 4DFSA 1XQNA 1RMU1 2CNAA 2YGLA 2DVBA 1S0FA 1ND2B 3B94A 3J8F3 4RSUA 1HV0A 4FOVA 2DCZA 1LOAA 2VOKA 4BIFA 2ZOEB 2HWD2 2WA3A 2ZHLA 3VDDA 3ZFEA 4Q8KA 5T50A 4INDA 1TEIA 1TME1 3ATGA 1X82A 2QZ2A 4LE3A 1OI6A 2WFF1 3OY8A 5D1IA 5LK5A 4AHYA 3IMNA 4ISQA 1SLCA 4XXAA 4Z1VA 1AR82 3RQ0A 4XJUA 1W0PA 4YZ2A 3MPPG 3NAPA 4AWDA 1NYWA 4LE4A 2Y38A 4EN6B 2ZPXA 2VH9A 3I59A 1AR71 1DGLA 1X8EA 2AR6A 4IETA 1SCSA 1W6PB 2GH8A 1J1LA 4KL1A 3H1YA 2WZR3 2CTVA 2RE9A 2WT0A 3CL1A 1O3TA 1VP6A 4K3UA 3TB0A 3ROUA 2NQYA 5I0UA 1DYKA 5CVRA 4CTEA 1JOJA 4JRAA 3VKLA 4COVA 4RR3A 5CB7A 2UU8A 2E7AA 4OI4A 1LKNA 3KSCA 1B35B 4XBNA 2CWSA 4WM7A 1PMIA 3GZAA 4Q2FA 4DXZA 2XJSA 5D8AC 3VHNA 5BUVA 4D69A 5JZGA 2B5HA 3WHUA 5KHIA 4B29A 1PGSA 5A32A 2BVVA 3KZ4C 4JDOA 4HVRA 5HCAA 1EY2A 1UF2C 4CDWC 2VVDA 3ZXKA 2VECA 1HRI2 1RUJ3 2PAMA 1V6KA 3ZIXA 2NLRA 1FATA 1AR62 1I1EA 4OHYA 1PZ7A 2YDEA 5KHKA 1DQ5A 4M01A 4MYEA 1AYM3 4CP2A 4PDWA 1RUC1 1IS3A 4ASLA 5I91A 4GULA 3HWJA 4XF9A 1TNFA 3URFA 4XHBA 4Z82A 4CEYC 2A71A 4P14A 5H9SA 1Y3TA 5FQ0B 1MVQA 2ARBA 1FMD1 4Y1YA 1LU2A 2HWB2 3GYDA 2IXLA 2WT2A 2JG8A 4LBQD 5CFCC 1S2KA 1WA4A 2ZAAA 1ENQA 1RINA 3OGJA 3OYWB 4LBLA 5E8AA 1H1IA 1ZZCA 4U36A 5CFDA 2A7AA 2ZS6B 1VLNA 2WA4A 1LOBA 4XW3A 3N7KA 4YW1A 2EA7A 2Q5TA 4Q4Y1 3OD4A 4FTSA 3ZFFB 4YVSC 2VU9A 1F5JA 2JEMA 4OI2A 1HV1A 3QBQA 1SMVA 1SLBA 4KH9A 2XL9A 4JC1A 1PIV1 2MEV1 2OZJA 2R061 1GZWB 3HT1A 1TMF3 1X36A 4DB5A 3T1MA 5ABJC 3CO2A 2X8KA 4HFSA 1D0HA 3OD0A 2HKXA 1MZFA 3KCYA 4WVMB 1DBNA 2P3IA 1LTEA 4Y1VA 2LTNA 3GHNA 1OFSA 1EAH2 1YXWA 1VBB1 3MZHA 1O5UA 3AKPA 3J4UH 3WQ7A 2R32A 1OLQA 1QMJA 3JBG3 1REFA 5CG8A 5ACA3 1S0GA 1IHMA 2ZGPA 1SFNA 1PM7A 2RM23 2VNRA 3CEWA 1V9U1 2BTVC 1BBT1 4XILA 1WCDJ 1RUI2 4M0HA 2D3SA 4AEJA 1QJY3 4FPLA 4JTOA 1ONAA 1FAYA 2FQPA 1ZZBA 4AGGA 2BNNA 1EPZA 4YZ4A 5GALA 3ZYIB 2A70A 2Z5WA 4CDUB 1HXS1 1ASJ1 1J1TA 3HN1A 1COV2 4JGYC 4WM8C 5LEJA 3QLQA 4N53B 2G9GA 2ZHNA 5C8CA 4PLOA 3L9JT 4IEUA 1MEC2 4QPYA 2HWC3 4B8EA 3H7YA 1VBD2 5DUUA 3AKTA 4Q4X2 1VJ2A 4QPGB 4AQ6A 1H2NA 3PHMA 4YSFA 2TEPA 1AL23 5BNPA 1G86A 4DRVA 4HKWA 5J36A 5I8YA 2WNVC 1ZBE2 5EV7A 1GZ9A 1SFYA 1FV3A 1UMZA 2NZ9A 4BMEA 4C0HA 1ZRDA 1BEV3 4RHV3 1ZRRA 1AR91 4P9GA 3LKJA 1V6NA 3EO6A 2O0OA 5GLVA 5BYNA 1POV3 3EHKA 1EV13 4AFCA 1OHFA 3VBUB 4JCKA 1CD3G 1GYKA 5JMCA 1R093 2IXCA 2PLV2 3RJRA 1SEFA 3ETQA 5L7OC 3C3VA 1OKQA 1J59A 4ZU4A 4M0NA 2X53S 1NQDA 3N3HA 5EFUA 2XPJA 1MQTB 5FO8B 4K6BA 1RUF2 2HEVF 2RS53 5DG1A 4YYOA 2DFBA 3B02A 3M4FA 4S2HA 4XFIA 5KC5A 1RVF2 2WINB 5HCFA 2XGXA 1DGRN 5T5LA 2FMDA 1R082 4D94A 3VBFC 1RHI2 4FPFA 1YUDA 2GNBA 4IQPA 1PO23 2PHDA 1RUE3 5EWSA 4RQPB 2RMU1 1GZCA 4AEDC 2WIIB 1LOGA 1AR81 3W9AA 2JECA 1CAXB 1XE8A 4OI1A 4QX5A 3J9SA 2MNGA 3TN92 4LBQA 2ZA9A 3B00A 5K0UC 2GAUA 1H9PA 3MIEA 4Q4W2 2RS33 2NN8A 3A4UA 2JX9A 5LK7B 5JOWA 1H2LA 3BOWA 1NOVA 1PK6B 5IK4A 2CV6A 5JPMB 3AKRA 3KLSA 2YC0A 2ZX4A 2XJTA 1WD4A 3VL9A 1VBE2 5J09A 2XJVA 4KG8A 1W6NB 2ZGLA 1O3QA 4TZDA 1OOPC 3ENRA 1YLLA 3V56A 3USSA 2HWE1 3ILFA 5JCTA 2FHRA 1UU4A 3M8LA 4LBKA 4YGEA 4Q4V3 4M3CA 5D8AA 2WQZC 4DINB 2CAVA 4AI0A 3VUOA 1GBGA 1LULA 1CX4A 3V65A 1YYNA 1CVNA 5T5PA 3VBSC 1VBC2 4IL7A 1AR61 4CDWA 1REDA 3MW2A 1LESA 1PHMA 3MFAA 3CLPA 5E88A 3ILNA 5CNAA 3WNXA 3FC0A 5IK8A 1RUG3 1SDWA 3A0NA 1NA1A 4FAHA 3I54A 4H14A 1PGW1 1TE1B 2ZGOA 3SCFA 3HIFA 4CEYA 4ES9A 1IOAA 1JUIA 2PHXA 4R9AA 4Q1RA 1NCRC 4L2NA 3WW1A 3RG0A 5JOZA 5CFCA 1W6OA 3AYEA 3KS7A 1Q8OA 1RGSA 5CU1A 4Q0QA 1WLTA 2WLQA 2E9QA 1VRH1 4L9BA 3VKOA 2D6KA 1ZBA2 1E57A 3HT2A 5B2GB 5JSOA 1AJKA 2ZKLA 4GKXA 2WWSA 4JVAA 4JDNA 1M06G 1QQP2 4PF5A 3VBHC 4EROA 5ABJA 3TOJA 4MGYE 3QOPA 2RR12 3U07A 3ZFGB 4ZKTB 1FV2A 3S0MA 1VAMA 4IERA 4FAGA 4N43C 3AFKA 3UJOA 2R072 5KXDA 1RUI1 3GNEA 4BHPA 4YG6A 5FOJB 2XVLA 2HWF2 2HJIA 3M7AA 1CJPA 3S7IA 1QXPA 1Z0HA 1BJQA 2ENRA 2TNFA 3VKMA 5JSPA 4MX3A 2OVUA 4YLZA 1GNHA 5DXDA 3T1LA 1RMU3 4C1XA 1COV1 1Q8VA 2ZZJA 4MSVA 3BIWE 4BMBA 5K9YA 4R9BA 3D0JA 1MEC1 2OUHA 5E16A 4JGYA 2OW4A 4WM8A 2P3JA 1VBD1 3ZFEB 1UW8A 3AP9A 3BALA 3VDDB 1DYPA 3TAYA 1WLCA 4BH9A 4ASMB 1S1AA 4CP1A 3RJ2X 4B4PA 1HKDA 2WFF3 4JGZC 1MZ6A 3B69A 3SLIA 3NVCA 4COWA 2X5IB 1ZBE1 3O0WA 4LO6B 4PBPA 1DHKB 4HMZA 3MIHA 4PIXA 4XBQA 4CEWC 5GZGA 2WNVA 4G3YC 1DIWA 3NAPB 5KXCA 3K51A 1BXHA 1DF0A 5DUWA 1WUVA 5AC92 2PLV1 4YW3A 1FOD3 1V6IA 1QXJA 2BNOA 3MF6A 5CG9A 4DMIA 3NV1A 1CR7A 1WGPA 3M1HA 5GZCA 1O3RA 5JIAA 2DUOA 4IEYA 2A6ZA 5A33B 1DG6A 2MPFA 4P9LA 4Y5Z0 3VBOC 5K8SA 5BXXA 4RR3B 4QM8A 4PJYA 1RVF1 1QJU2 2UYBA 1NY71 2D3RA 3O5SA 3C2UA 5TSWA 5I8TA 4QQHA 1A78A 1MR5A 2QUOA 2RS11 5JZGB 3VBFA 5A32B 5L36A 4EWEA 2NMNA 3PVNA 3WX5A 1AX2A 4LBJA 4HK8A 2BBVA 1NE6A 1R1A2 3IPVB 4AEDA 4GB31 1S0IA 1A8DA 4Q27A 3TN91 4OZXA 3AYDA 2D93A 4BQ1A 2C0ZA 1Q56A 1S0BA 2HEWF 5K0UA 1RUH2 1LOFC 2B46X 2NP0A 3N7MA 2PFWA 1FMD3 1H2KA 1N1VA 2JG8B 1VBE1 1UIJA 3DPRB 3W58A 2AENA 3ES1A 4S2GA 1I3HA 1XRUA 5CFDB 1AX0A 1MS0A 4ORFA 3WLUA 3LOBA 4B4QA 2XLFA 4ZU7A 4Q4Y3 4Q0VA 4BE3A 5AFEA 4Z07A 3JQXA 1OOPA 2EF6A 2OYZA 4B7EA 3ALQA 2A6YA 2A5ZA 2PHFA 3NL1A 2MEV3 3K48A 4IEWA 4S2DA 4XFBA 2UWBA 1HRV2 2ZMLA 3VBSA 4QGMA 5GKAC 2JJ6A 2ET7A 3HR9A 4E27A 3M3QA 3RNSA 2QCSB 1NLSA 4C91A 1VBB3 1S0DA 2DWRA 4X6QB 2UWAA 1QH6A 3JQWA 4ZU5A 4MLOA 1F2NA 2A6XA 3PVBB 1V9U3 1Z7S2 1QOSA 3LAGA 1BBT3 1KQRA 4YM2A 5BNOB 2VULA 1QDCA 2B39A 5KBFA 1JBCA 1D2SA 2OIIA 1NCRA 4P9JA 4FTBA 1MS5A 4LLFA 4OHZA 4CDXB 4OUMA 3WG4A 2WFPA 1YWKA 1ZBA1 3AJZA 3KB5A 2D5FA 3PTYA 4Y20A 3WDXA 4DY5A 1HXS3 1ASJ3 3ZMNA 3ZXLA 1QJX1 1SLTA 5J48A 1QH7A 5JSRA 2GDFA 1GR3A 3NWKA 4XETA 1NCQB 1IPJA 1ENXA 1ULDA 1QQP1 4GMP3 4HVOA 1WMFA 4Q1PA 4MGZE 3ZMOA 2RR11 2XJPA 3VBHA 1N1TA 3AMPA 1C8M1 3WDTA 1S55A 3KD4A 4B4RA 3OBRA 3E5XA 1AR93 1C28A 2R0FA 3POSA 1W6MB 3I8TA 4FPJA 2D6NA 1AX1A 2E7TA 3B7MA 2R071 4R52A 4R4XA 1AYN2 2EIGA 1PNFA 4COYA 4GA9A 4KGGA 4N43A 4NWWA 2HWF1 5JOXA 1MS4A 4BYYA 3WZ1A 4FPGA 3CJIA 2RJLA 4DZGA 1PO11 4YVWC 1K5MC 4O9EA 3N36A 5J96B 4X8PA 1EP0A 1IQAA 1PNGA 1IGOA 1SBDA 3RWNA 1D4M2 1FXZA 1VR3A 2EXKA 2HYKA 4GWMA 1RUD2 4ITCA 2PA7A 3MLJA 1ND2C 4BOWA 1U5XA 1V70A 2JDZA 2V09A 1YJLA 4LO8A 5FMOL 2UURA 2PHLA 3IDEA 3QD6A 2JXAA 2JG9B 2ZACA 1NXMA 3J8F2 4PLMA 4Y4YA 2I74A 4GIQA 1X7NA 4AE2A 1CAUA 4GH4B 3D6EA 4I0WB 2RMU3 1OPOA 1R1ZA 1F8VA 1JHNA 1UAIA 3AFGA 5H9RA 1WMDA 4MGKE 4JGZA 3PVEA 3RYKA 5I8SA 4XFHA 2ET1A 1PZ8A 2ZX3A 2P3KA 4WVVA 3USUA 1QKQA 3MIFA 4CEWA 5JWPA 4UW4A 2VW0A 2FZ1A 2JE7A 3DKWA 5AC91 1ULCA 4U2AA 4IV3B 3GALA 4PLNA 4HPKA 1N1SA 4QQPA 4AEKA 5FFOC 4JAAA 1C3HA 4K7JA 2DU0A 3FBMA 1G6NA 3KM5A 3DUIA 2ARXA 3AYAA 4K21A 4QGNA 2WS92 1FX5A 4W65A 4IEXA 1AXYA 2LUWA 5C4WB 2QDRA 3V0AB 1GQHA 3OF1A