4EN0A

Crystal structure of light
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
145
Chain Sequence
NPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 14
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 145
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4en0A00
1OSGA 4OUMA 5CIRA 4NN0A 1PK6A 1A8MA 3WD5A 2JG9C 4MXWA 4KGGA 2RJLA 1KXGA 5KWRA 1PK6B 2JG9A 4OUSA 5KC5A 4G3YC 1OQEA 2R32A 4MXWB 4RSUA 2Q8OA 1JH5A 2WNUA 1GR3A 2RJKA 4D7YA 5BNQA 3ALQA 2OIIA 2JG9B 1DU3D 3FC0A 4KGQA 1DG6A 3LKJA 1OQDA 4KG8A 2HEVF 4GIQA 2QE3A 4DOUA 4DB5A 5HBAA 1XU1A 3V56A 3ME2A 4F3JA 2WNUC 2WNVA 2TNFA 4E4SA 4MXVA 1TNFA 2TUNA 2O0OA 2HEWF 2R6QA 1D2QA 2AZ5A 5KC6A 2ZJCA 3TYJA 1IQAA 1U5YA 2R30A 4QQ2A 4TSVA 3B9IA 3TWIA 1RJ7A 3K51A 4J6GA 2WNUB 5TSWA 3B94A 2WNVC 1JTZX 1S55A 4N90A 2JG8C 1WCKA 4QQLA 4OULA 2Z5WA 1XU2A 4MSVA 4QQOA 4TWTA 2JG8A 4QPYA 1D4VB 2HEYF 1U5XA 5L36A 1RJ8A 2QDNA 2RE9A 3MI8A 1ALYA 2E7AA 2WNVB 2JG8B 4G4FA 1C3HA 1TNRA 4HT1T 3B93A 1D0GA 3QD6A 4QQPA 3IT8A 2X29A 1C28A 5L19A 3K48A 3URFA 4EN0A 1I9RA 4E4DX 1O91A 3AB0A 4QQHA 2Q1MA 1PK6C 2KA3A 1KD7A 3L9JT 3QBQA 2ZPXA 1U5ZA
chains in the Genus database with same CATH superfamily
1O3SA 3E5QA 4QPIC 2V5DA 4JGYC 4RR3B 2Q8CA 3LPGA 3MUY1 4ITCA 3AYAA 5CFDA 2ZX3A 3IPVB 4CP1A 4EZHA 1V6IA 1OA2A 3NNLA 4OZXA 3USUA 4Z2AA 4QPIA 4NIAA 4D7SA 2EXKA 2JG9C 3A4UA 4A7KA 5F9TA 1O6UA 2BUKA 4OHXA 4S2DA 1FOD2 4XTMA 1EV13 1W9TA 1L7RA 3UV9A 2P3JA 2QQMA 4XTPA 2JG9A 2OZ6A 3E5UA 1OH3A 4CU9A 1ULCA 1AX0A 5A6XA 5IHRA 3WG4A 3U1XA 2D6MA 1NZCA 3AP6A 5CFCB 1SFPA 4AGGA 4HPKA 1RUE3 2RJKA 4FPJA 1SBEA 5BNQA 3WF2A 1XYPA 1W0PA 1MS1A 1AR81 2OIIA 4O65A 4PIZA 3SEEA 4ASMB 2V09A 1D4M1 3N7KA 5H9RA 3N9PA 5LB6A 2DFBA 4LXLA 3LKJA 1AX2A 4K9SA 4HKLA 1CN1A 2WA3A 4YVSB 4Q0VA 2VZQA 1S0DA 1PNGA 3E1F1 2HYKA 2WS92 3PU3A 2W2IA 2PLV1 1PGSA 3D4KA 2WFPA 5A33B 1PIV2 1Z0HA 4K8RB 4Q0SA 4W4ZA 4YSFA 5HBAA 3EHKA 5B2GB 5GZCA 3LFMA 1BBT3 3AMNA 1Z78A 3B02A 2WC2A 3ZXAC 2HWD2 1RUH1 3C3VA 5FRAA 3VD3A 5A1LA 5I8TA 1ASJ2 4CEYB 1B35C 1ND3C 1LR5A 1E5IA 1D2QA 1VBD2 1EAH2 2BVBA 1YQCA 4AEMA 2Q8EA 4KI5M 4XQWA 1U0AA 2UWCA 5FZ9A 1B35A 2ZGPA 1ND3A 1RITA 3MPPG 2X5IC 4R52A 5DAWA 5BNPB 2CGPA 1GWMA 2VMGA 4HK8A 5FWEA 3ITQA 1LTEA 3I3MA 5FO7B 2D6KA 4ZU5A 4D69A 1RHI1 1AR71 2R071 3HT2A 2X5IA 4RR3A 1LOGA 5I0TA 3GHNA 4BMEA 2HWE1 5FLHA 4NOTA 2PA7A 4EN6B 1BEV2 3IPVA 4K6BA 3PLQA 5GLVA 1J84A 4QQOA 1FYUA 5M0TA 2LW8A 2WZR2 3AFGA 5FYHA 4ET7A 4YVWC 2E7QA 1UCXA 1YXWA 5GLTA 1UYPA 4AEDC 1DGLA 4URTA 1SLTA 4YW3A 4Q1PA 1LHWA 2JKXA 4HVOA 4CCNA 2CWSA 1GQGA 2WJSA 4K7JA 3ACFA 4K1YA 4M3CB 1RXGA 4YVWA 1R081 2IXIA 2QQVA 3ZFFB 2GC0A 4AEKA 3OPWA 1PMIA 1QJU2 3O0XA 2V73A 4FAHA 3BU7A 3B01A 5CYYA 5FQ0A 4RYDA 1B09A 2DVDA 1DQ2A 3HNMA 2VBBA 4H7MA 4PHZA 1ZRFA 3P5BA 5C4WC 1IPJA 5IYYA 1SPPA 3A21A 4QWNA 4BIFA 4ZPIA 4AYUA 4H55A 2ES3A 1XB9A 5FYZA 3H3LA 4QB2A 5FLJA 1JBCA 1GZCA 1OFSA 1DQ6A 2WRAA 1I5PA 2NMOA 4MUVA 4PDWB 4SLIA 4CCMA 2Y6LA 5CIRA 2O1QA 2DUOA 2ETEA 4AEJA 1UXZA 2QBXA 4NPLA 4IGOA 4MVTA 5IK4A 4RHV2 1CPNA 4UYBA 1MS9A 3VB9A 1G6NA 4UFHA 5A3TA 5FKCA 3IAPA 3H1YA 1VE0A 4MGKE 4R4XA 4PLOA 4D6QA 1YCIA 3TBDA 1ULOA 5ERLA 1DFQA 1VB2A 4WBBA 3VD7A 2AGSA 3U07A 1W8TA 2J1SA 3ZDSA 2WFF3 5HV4A 4DXRA 1HRV3 2CU5A 4XHXA 5F2WA 5F8PA 4QGMA 1HB1A 4ZHNA 2ERFA 4LMFA 1GQHA 4QD2A 4F8AA 3IM0A 3RDIA 1QQP2 3C8XA 4DQAA 1OLME 3Q8EA 3ZXGA 4K40A 2XMLA 1LAJA 4CDXB 4LR4A 2CWMA 3WQBA 2WO2A 1VAKA 2Q5TA 3DKWA 3PTRB 1MZ5A 1RUI3 2I45A 4GD4A 4NHMA 1Q8PA 5FZGA 2NLRA 3J8F2 1ZREA 2ARBA 2PXJA 1JYWA 4MGYE 1W9FA 1PMHX 2GP5A 1AR62 4LBNA 2K46A 3ZKUA 4INDA 1C5HA 2WT1A 4BB3A 5ACA1 2IVIB 5FZEA 1W6PA 1TMF1 4R9AA 1J83A 3V56A 4YPJA 3ZFFA 1BCXA 1VBE1 5A70A 3O7OA 3KT7A 2RMU3 4N43A 3T2PA 1DZRA 3VBRB 3HBKA 3OBRA 2VCAA 3CBNA 1CD3G 3SH5A 5LW9A 4LNVA 4XFGA 2GH2A 3NNMA 4I01A 1F2NA 4L2NA 1H6XA 5FZAA 5F7UA 1HQNA 2XJPA 4K21A 5D8AB 1XYNA 4AI2A 3T1LA 4CCEA 1PO22 3B9IA 2X09A 3DPRC 4AI3A 1UOFA 1VPHA 3OCPA 2JDYA 5FV3A 1W03A 2WNUB 5FBZA 1L3JA 3H1WA 1PGL2 4TYSA 5KHKA 1GYKA 1UQXA 4N90A 5KHGA 5CAZA 2DTWA 4K20A 2QCSB 1WKYA 4QKNA 3RJRA 5FYVA 1H2KA 3LQCA 4LK6A 5EIYB 3ZR5A 2Z2SB 1QOSA 3ZYRA 4QX2A 3LEMA 3ZMNA 1FT9A 1HQLA 5LA9A 4BM8A 4EN7B 2ET7A 3MO4A 2JIJA 4UFIA 5FZKA 4QDRA 3I4IA 2OA2A 5EWSA 1CIYA 1OQ1A 2ZBJA 3AXEA 3MI8A 4GB32 4QXKA 4D8MA 2E7AA 4OI0A 4M0NA 4OUEA 5AC93 1G9DA 3ILNA 2AEYA 4GZ9A 2B7YA 3H1MA 1LNSA 1V6JA 3PUHA 4CDXA 5C8CC 4XDOA 2WT0A 2PAKA 2P3KA 5DUXA 1ZBA1 1QEXA 4QXBA 4RS5A 4QX1A 5C8CA 2R49A 1VBC3 3OGJA 4HANA 5CZKA 4CP0A 1LESA 3HT1A 1AJKA 4META 1JYVA 4AI1A 1IPKA 1VAVA 4P02B 3ETQA 2I2SA 1UOJA 5ABJB 3KZ4C 3OYWB 3WF4A 1DGRN 1HRI3 5E6HA 5FPVA 5FCCA 1MVEA 1QJZA 3E6BA 4JGZA 1SG3A 3OUHA 2PELA 3H7YA 1NOVA 3KB5A 3RI8A 3THTA 3BGAA 3TNQA 1UO9A 2WINB 1V6MA 5EHDA 1H4GA 5FJKA 1UWWA 4PF5A 1Y9QA 3NNFA 4GWJA 5A3WA 2R043 1G7YA 2DU0A 4BU2A 2YZ4A 3M7AA 2Z69A 4W50A 3VGIA 4XFHA 5C5TA 3DF0A 2CAUA 4NAMA 1BLZA 4MV2A 1XNTA 4N9HA 1OPMA 2KR2A 1PGW1 5C33A 1PZ9A 3GBWA 1RUJ1 1X36A 2GSYA 4DPNA 3WCSA 1LOFC 2WNUA 3VDDC 1I3HA 1ZA7A 4RN5A 2XVLA 2E33A 2P17A 3AKRA 5DUUA 1K5MC 1TME1 3FC0A 5FPUA 1DG6A 1FPN1 2XQXA 4P5HA 3UKTA 3VDDA 3H7JA 3RYKA 4TLGA 3W21A 1BMV1 3NRUA 2PHDA 5GM0A 4FPOB 4Z92B 1SCSA 4P5YA 2OVUA 4OFGA 1I5ZA 3RWNA 1MPXA 2QFEA 2MNGA 4LE3A 1UU4A 2Y64A 4Q5OA 2VM9A 5J98B 2OYZA 4DB5A 5KHHA 4H7LA 3I59B 3ZN4A 3BVCA 5GZEA 3VD4A 1GNHA 1NLRA 2DCYA 4LORA 1MQTC 5KXEA 2VOVA 2OT7A 1TNFA 3W5NA 3PIJA 3THDA 4A42A 4Y22B 1EV12 3KF3A 5FXVA 4ATFA 2VNGA 5F32A 5IT6A 1HN1A 4IV3C 5FYIA 2P6HA 3WOGA 2FDIA 1W2AX 4XF3A 1GZ9A 1JUIA 2MEV1 1W9SA 2D5FA 2XBO1 4IV3A 5DG1A 1RJ7A 1LU2A 1GZWB 1OUXA 3WLUA 4QXHA 1NCRB 2ZGLA 3EYPA 1RMU3 1RC6A 2C26A 2HLEA 2WZ8A 4R8HA 4P9XA 3TEXA 2VE1A 1ZBA3 3K77A 1VBA3 1LGBA 4YRDA 1LEMA 2DYCA 2QNKA 5FK8A 5LZ6A 2UWAA 2BPA2 1ONAA 4LLOA 1RIRA 3HJRA 1RYYA 3K75B 2VCMA 3J7NA 4LK7A 3FL7A 5EXOA 3WNPA 4MHRA 4BZ4A 4COVA 1W8ZA 1KDKA 3GZUC 1XXNA 4FP2A 4MGSA 1JZ7A 1RGSA 5GZGA 5DUVA 1C8M1 4O61A 1TNRA 2J1EA 4ATEA 3BOWA 4MADA 4JCKA 3VBFC 3H3ZA 4UT5A 2W1WA 5C9AB 2R16A 1RUD3 5EYYA 4C0HA 1H2MA 3K48A 3PL0A 1VJ2A 3UK9A 2G9GA 4BA6A 3VBFA 1NXD1 5FOJB 3LIHA 5DZEA 1O91A 2HKXA 4ARXA 3WDUA 3JB8A 4E4ZA 5A3UA 1AYM3 4LKFA 4P00B 2VOKA 1MACA 3L9JT 3QBQA 2A71A 3RRDA 3T08A 3VBOC 4FAGA 1AR91 2W94A 1BKZA 2K2SA 1OD3A 3J7LA 1ND2B 2HWC1 1QJX1 2VOTA 5FY5A 2W92A 4W6WA 4J1WA 1PHMA 3OB8A 4YG6A 4AHYA 1JW6A 3VBOA 3GJAA 5DAXA 1Q3EA 2GAUA 1GV9A 3JQWA 3GCWA 4QPGB 4MXWA 2NYYA 2EALA 3VZLA 4BWOA 4KGGA 1BHGA 4N9IA 4P9YA 1KXGA 5GLWA 5J3UA 1ENSA 1W04A 4XMAA 3OGVA 3O1OA 2ZGQA 5EJZB 3VBHB 5IVVA 4XF4A 3WDTA 4K8FA 4NAOA 1W90A 1K42A 2W0XA 1QJY1 1Y9GA 4R9BA 1NA1B 2R32A 4BMBA 4COUA 2Z4FA 4Z1VA 3JZVA 3NJYA 1DGWX 1GSLA 3A23A 1NCRA 4LA2A 3MLKA 4BXFA 5T54A 1DYKA 4YZ4A 4MH0E 2WS93 1DF0A 1RB8G 1NYWA 3WNXA 3M3IA 5JSRA 1PIV3 4UFKA 3JB4C 3Q8FA 3I49A 5GLUA 1FMD1 1HJFA 1CONA 1GWKA 4HSJA 1REDA 2QQWA 1KS5A 2VTXJ 1S2EA 1AR82 2A6XA 2LALA 2YV8A 2Y0OA 3MICA 3TB0A 3V0AB 1D4M2 3T0DA 4GA9A 5CA6A 1YQ2A 4CPBA 4COZA 3L2HA 4FPCA 1ASJ3 4LHKA 3SKVA 1O8PA 1OKQA 3HNYM 4URAA 2EA7A 3I2IA 1VR3A 1J3PA 2VVFA 1EAH3 2W9XA 5LATA 4R9DA 5FYMA 1CAXB 4ARYA 4FTSA 1DIWA 2E6VA 1NX9A 3LSDA 1ZNPA 1HRV2 3DN7A 4CYDA 1O7FA 3MW2A 1G9CA 5EJ3A 3AMHA 1H0BA 2BGCA 3T4HB 2FD8A 3CKHA 1AYN1 4I30A 2YBKA 1U5YA 1TG7A 4FFIA 5CBLA 1OD5A 1RUNA 3KGZA 2DWRA 1US3A 2PQSA 2YBPA 3FFQA 3H50A 3QLQA 4S2GA 5FMDA 3K4DA 1RUI2 2Y34A 3NVCA 2EAAA 4A4AA 2WZR3 3WINE 3EQEA 1LGNA 4XJ8A 3MV11 2WN3A 1ENRA 2QQLA 4DUWA 1RVF1 4FOWA 5E89A 3O1UA 2E9QA 2Y60A 5DAQA 5K0UA 1ZZBA 4BHPA 5LRSA 4LBLA 4P9IA 1RHI2 1HX6A 2R072 4OZOA 4JQRA 3RWKX 4B7EA 5A3NA 1WBFA 5DZGA 1NY71 4KBBA 2HWC3 1MS5A 2DDUA 1ALYA 2P4EA 3SLIA 5C7GA 4S2FA 3VLBB 4JDOA 3VHOA 1JU3A 4OLLA 2DVAA 4YWAA 1HIXA 3ZSEA 2BTVC 2YBSA 3BI3A 3EO6A 3N35A 1MS3A 3FLPA 3B5LB 2IXHA 2FZ2A 1IQDC 1R1A1 2J1AA 5DAVA 5A32B 1H8TB 3GALA 3TN93 4NIHA 3E97A 4IL7A 3KMHA 5FMOL 3AB0A 2BGPA 5CKQA 3TOJA 2YGLA 4LUKA 3SCFA 1XE7A 4RHV3 4WM8C 5T3NA 3RZGA 1OOPC 3C7OA 3KQ4B 3AKSA 1VBB1 4SBVA 2A6VA 2VCCA 4WM8A 1OOPA 4CDUB 1C1LA 3S7IA 2OZJA 3WF0A 4YG0A 1O3RA 5I8YA 3ZYGA 1QQP3 2RJLA 2XHKA 4XUPA 3BTYA 2VW2A 3LOIA 1HXS3 2GNBA 4GH4C 2UY9A 4C91A 3AYDA 4XJWA 4W8JA 5AC92 2DU1A 2VTXA 3LEGA 1WWYA 4X6QB 4G3YC 3WCRA 1MEC3 4XZPA 3AZYA 5IFPA 1SBFA 4GH4A 3WNNA 2VW1A 1UYYA 4Q4Y1 4ZS3A 4V1PA 3VV1A 5LRRA 4KWUA 3IMNA 4L11A 1AR63 1W06A 4BQ4A 1AYN3 1VBC2 4DEVA 3AJYA 3KS7A 3Q9OA 5JI7A 2VNRA 2XJRA 4RFRB 2FMYA 4V2WA 3LFIA 1POV1 1SBDA 4B3NA 4LBQB 4WM7C 3RMXA 3AK0A 3ZYJB 2JE9A 3ACHA 3I2KA 5FIXA 1XNAA 2HWB1 5C3OA 5FR3A 1S0CA 3KV6A 2VMFA 3RPQA 4FVVA 3M4FA 3QOPA 4WM7A 3SITA 4WVMB 3WP3A 2ZX1A 1F8VA 1S0FA 1QIQA 4BCUA 1X9TA 1CJPA 4E4SA 1WBLA 2YU1A 5J48A 1PO23 1MS0A 3E6DA 2J22A 4DXZA 3M1HA 3UT0A 1ZRRA 1QJFA 1TMF2 2PHXA 2R6QA 3LE0A 5F1RA 4E27A 5A32A 4Z82A 1VBE2 2VMCA 5LA0A 1DQ5A 5JZGC 1YQ5A 2GALA 3R0RA 1POV0 1W6OB 4M00A 3OSDA 4GKYA 2RG4A 1YI9A 1G86A 2WDBA 4Y33A 2LS6A 3T2QA 3VN4A 5G04L 3ZFGA 4FBFA 1Q56A 3SH3A 5FP7A 4YNIA 2WNVC 5K8SA 5KXDA 3S30A 4XBLA 2WIIB 3BYWA 4YGEA 2C6SA 4CDUA 4IE6A 2ORXA 5FYBA 5A80A 2JE7A 1ZBE3 4AQSA 1C4RA 5AFBA 4Q27A 1E5SA 2AH2A 3AZXA 3NV4A 4GB33 1XNDA 1KDMA 1DYPA 1GOHA 5C6CA 3S6PA 1NCQA 3KM5A 1O3QA 5J7MA 4F7ZA 2RHPA 2RE9A 3PVNA 2ZX0A 4IEXA 2JDKA 4JDNA 2PMWB 4X6RB 2RM21 5AVAA 1V00A 1KJRA 2R1DA 1W0NA 1ZRIA 1UPIA 2H0BA 2JB4A 3DL3A 3MIGA 4FCAA 4M0HA 3CU7A 4HOOA 1A8DA 3VKNA 3N9QA 1AX1A 5L19A 2OPKA 4BYYA 3P1IA 3ORJA 4JGYB 2VAUA 4GWIA 2FQPA 3KVBA 3OPTA 5JI9A 1YYNA 2YXSA 2EXHA 1UZVA 1H1AA 1ZBA2 1VBA2 4OUMA 1IS6A 1H9WA 4J1XA 4Y24A 3I3DA 3CJIC 2CAVA 3AMPA 4BQ2A 1W2UA 3T3YA 5JSPA 1LCLA 1V9U1 4GMP3 4IESA 4QPWA 1JS9A 4QKDA 2J7MA 2YC0A 2VUDA 3WF3A 2LUWA 1QDCA 4NHXA 4CPBD 4LIUA 4RQPC 1V6KA 3RI9A 5FP9A 4AHZA 1HV1A 2R063 3BB6A 1COV1 1ODMA 1OVSA 1RUF1 1YIFA 2H6CA 5J36A 2ARXA 1JZ6A 1W8FA 2D3PA 2JJ6A 4UW4A 5IAXA 4AI8A 5CFDC 1PVC1 5APAA 1X8MA 1ZYBA 4XCBA 1JZ4A 1DU3D 5L9BA 4LBMA 3WHTA 3UKNA 4KU8A 2YC4A 4CDWB 1AYM2 1W6NB 2C0ZA 1ENXA 1LULA 3N9OA 5FZHA 4CCCA 4DZGA 4TZDA 5CG8A 4JHTA 1HQWA 1ZRDA 2WNEA 4KG0A 4D0QA 2DURA 3ZSLA 1V0AA 1ULDA 4BISA 1YJLA 1FPN2 5HCFA 4HBNA 3E5XA 3ME2A 3WW3A 5LK7B 1AHSA 1PO13 2TNFA 1PX3A 4NPRA 1OUSA 4M4RA 2P1BA 3ZN5A 4CP9A 1N3QA 4XQ4A 5FP4A 4B4PA 1JZ8A 4CXXA 4XHBA 4Y1ZA 4PBOA 1OBNA 4HLTA 4UWDA 4IV1C 2YDEA 1XSQA 2AC1A 1SLLA 5JOXA 4GJYA 4BQ1A 1H9PA 1RUC3 4IV1A 3U11A 4FO9A 2JD4A 1ZZ6A 3AYCA 3GNEA 1Y9MA 2BWCA 4WVVA 1DGWA 4AOCA 2XJSA 1XPWA 1WCKA 1G8WA 2JEMA 2XBO2 3H0OA 1KFXL 3POIA 4MZUA 2P5BA 4AEDB 4LPLA 3ACIA 5FK7A 4D6RA 4XACA 3T2TA 3T4VA 5BNOC 3BTZA 1DZTA 2XVKA 4IERA 5FY1A 4Q26A 5L7OB 1VRH3 3EJKA 5F2SA 4C90A 5J37A 1U5XA 3KVAA 1REEA 1RUG1 3FX3A 1QGLA 5BNOA 3ZXKA 2MHFA 4Q4X1 3AKTA 1CAUB 3RFRA 1Q8VA 2WR9A 4N7UA 3RS6A 1DQ1A 1CZSA 5DN2A 2VMIA 4RR3C 3MZHA 3EBRA 1WLWA 1WCDJ 2UWBA 4UF0B 3BIEA 4AR2A 1UOGA 3RZKA 3VBSB 3BKZA 1C8M2 5J09A 1DHKB 3VKOA 3MLLA 1M4WA 2VR4A 1J59A 5FZBA 1LB2A 3PURA 2C1FA 3GM8A 4XFFA 3RZJA 3F2ZA 1D0HA 1VMJA 1YC61 4ORFA 3ZIXA 4YZ2A 4NHYA 1Z7S1 3WUCA 4L99A 5CFCC 4IQPA 3ZPOA 2Z42A 4YGCA 3I7DA 5DUWA 1YNAA 2JICA 5C3SA 2GC3A 2YGMA 1TEIA 4GWMA 4Y1VA 5CFCA 1AR92 4KBZA 3O14A 3O1MA 2WAOA 3PDQA 2HWC2 1QJX2 2DVGA 3CJXA 2VQAA 4A7ZA 1LGCA 2ZMLA 2RDRA 4J25A 2A1XA 4JX0A 2NQYA 3VKLA 4K3UA 4NJ4A 3WDWA 1N1VA 4YVSA 2XLGA 3HPNA 1S0JA 3ABZA 1SDWA 2XONA 4AAPA 4CRQA 3CNAA 3WQ1A 4AVVA 3HVDA 4NMIA 4Q0UA 5A33A 3TN92 2ZGRA 3AXDA 1QJY2 1AR83 1CESA 3IDCB 4CSWA 1O5UA 1D4M3 2IUWA 3WX5A 1FV2A 4CEYC 1A3KA 4OMCA 4QB6A 1OQDA 3WVJA 2XDVA 2WAAA 3PMEA 4GIQA 3FUQA 4HFSA 2N7GA 5AVPA 1QKQA 1TVGA 2PLV3 4Y20B 4KH9A 1KITA 2WQ4A 4Q2FA 4BOWA 4CEYA 1H2LA 4EN9B 5F3CA 3ZIWA 2RS31 5T50A 3ZYBA 4ISRA 2W52A 4GULA 3POGA 1WD3A 2W39A 1NAEA 3VD9A 3GBGA 3FZ3A 4JTNA 2IVJA 1HXS2 3C7GA 3T2OA 2VCBA 1RUH3 5BNPA 1UKRA 4UF0A 1E5RA 3O12A 3IDEA 2BYVE 5C70A 3M8LA 1XE0A 3VBSA 3TYJA 2BFUS 3LA7A 1MEC2 1JHJA 4LJHA 5FZ6A 4AHXA 5FXZA 5KBFA 2F4PA 2R30A 4DXSA 3RYRA 1FV3A 1Y7BA 4GXLA 4Q4W1 1W6MB 1G9AA 4DINB 2JDMA 3THCA 4P08A 4NIIA 4MO3M 4N53B 2YU2A 3ZFFC 3A0KA 1AYN2 2ZGOA 4N43C 3WP5A 2ZCWA 1LOAA 5B4NA 1RHI3 1AR73 2R073 4DMIA 3GJBA 3MW4A 4PQ9A 5I93A 4MOAA 3WV6A 3NSTA 2HBTA 4CXWA 2HWE3 3DXTA 2QZ2A 4M3CA 3D0JA 3LB9A 4XILA 3ENRA 3ZXFA 1W28A 3H8RA 3APBA 5EP9A 1GNYA 3F95A 4P9LA 3AZVA 3QH6A 3AFKA 4NR1A 4BQ3A 2UURA 3HMYA 2XJVA 3M3QA 1DYOA 1PM7A 3AVSA 2VZ1A 3AMQA 1OKOA 3OEAA 3A22A 4HONA 1SFYA 2VH9A 3AP7A 2VC9A 3FN9A 5FZFA 1GNZA 4YM2A 1HB2A 4PDWC 3VZMA 2WBKA 1R083 1AL21 1T6BX 4G4FA 2D6OX 2B9VA 4OMDA 5FZLA 5DDJ1 5LBCA 2GDFA 2QVSB 3B93A 3NKTA 5FUPA 1CX1A 1TE1B 2WKKA 1NY72 2WZEA 4PI0A 4PDWA 1PNFA 3CQOA 2G9FA 5K9YA 5LBEA 1ST8A 3N7LA 2JB8A 3W9AA 4PBPA 3R6SA 4AG4A 1I9RA 4F83A 4AW7A 1WMDA 1FI2A 1YUDA 3LDBA 4NRQA 2VJXA 3VUOA 4GALA 4OI2A 1ZZ7A 3B9CA 1R1A2 3OG2A 2Q30A 4A44A 5FWJA 2XWJB 3BCWA 4CVUA 4KL1A 1SHWB 1ZBE2 5D1IA 1P8JA 1WCSA 1JZ5A 2EAKA 4CDXC 4DNYA 3M3CA 1F35A 2C24A 1JOPA 4MG2A 5DPNA 3POFA 5FPLA 1VBB2 4XJUA 3RZLA 1YRZA 2B9UA 3MIEA 4HKOA 4RS5C 2VGDA 3DXUA 4AF9A 1UL9A 2RS11 1M06G 4P9WA 1PK6B 5BNNB 4FXGB 3UGGA 4EWEA 1UPSA 2QQJA 3ZYIB 3OF1A 1W9WA 2WYFA 2XOMA 5I8SA 2RDQA 4YGDA 3ZN6B 2DBNA 1K5MB 2OKXA 5FP8A 4UBHA 3USSA 5JSOA 2AREA 3RZMA 3OY8B 1FAYA 2E53A 4YW5A 1K5JA 4JGZC 1BVP1 2GH8A 4YFWA 3O1SA 2QTWB 2BZDA 1UN1A 2WLPA 3IWZA 2YROA 4Q4Y2 2YUEA 4QT6A 1QMJA 1ULGA 1RL3A 4JVAA 3VBRA 1YLLA 2WQZC 4O9EA 5D8AC 1MQTB 3I2OA 1POQA 2ZABA 3SQOA 4EV0A 4FPGA 1JYCA 1W9YA 5ACA3 4UW3A 1DCSA 1HJGA 1LKNA 5D8AA 1KJLA 4NWWA 1TMF3 2RR11 1AXKA 2WNUC 3LD8A 4C1WA 3TEYA 3S5AA 1VBE3 2NZ9A 3GGLA 2RS51 3J7HA 3KHCA 2VD7A 4XYXA 4ZU7A 2HWB2 5JIUA 3GXUA 1PM4A 5F5AA 5JMCA 1GP5A 2AZ5A 4ASKA 4CDQB 4A6SA 4XF9A 2OS2A 2R062 4COYA 4AGVA 5A3PA 2XGXA 2FCVA 3OUJA 4QQ2A 1GU3A 1Y4WA 3AMMA 1QXPA 4UAPA 5I91A 2V5YA 3UESA 3O1VA 1MZFA 2XXZA 4LBJA 5L73A 1UU6A 3AM2A 1YEWA 1K3IA 4QDSA 5FZ3A 3SCGA 5A6YA 2X05A 1JTZX 4UFJA 1VMFA 3O0VA 3ZYFA 4AGRA 1W6QB 1W8OA 3A7QA 4XCAA 4L0PA 2Z5WA 3N9NA 4XFCA 5FZ8A 2R1BA 1FX5A 1O3TA 2BFUL 2ATFA 3KV9A 1U12A 4MGQA 5IW0A 2VMHA 1H1IA 5LBBA 5E16A 5ISLA 4YW4A 1QF3A 1V70A 2VOXA 4DS0A 2XKPA 2PYTA 1FOD1 2CSGA 3NMBA 1S2KA 2JECA 3ZSMA 2HYXA 1RJ8A 1PO12 1SMVA 2BWAA 4XC9A 4KNCA 5A7PA 3JD71 2JG8B 3W58A 3ZFEB 1W8WA 5DQ0A 1F4HA 1ZX5A 4YM0A 5ABJC 1IOAA 4Y1UA 3WG1A 3AKQA 4IEQA 3RGBA 3OY8A 1F5FA 4Q29A 5HCAA 2VY0A 3EMRA 5ABJA 3KCYA 2YYOA 2RM22 2EF6A 3OYWA 4GJZA 4TTGA 3H42B 1C1FA 5FMBA 4GQ7A 4OQ8A 1CZTA 2VMDA 1UY1A 4Q4V1 1RUC2 2UY8A 2KA3A 3B3QE 1W39A 1KD7A 1PVXA 2ZXQA 2VBPA 3N7MA 4XFBA 3DCQA 1N1SA 1OF3A 4HMZA 5A6QA 2E31A 2HWF1 4B29A 1A8MA 5FY9A 1C5IA 1HLCA 1YQ6A 3JBG1 3WW1A 4Q0PA 4XOGA 1VRH2 2D93A 3N9LA 3KGLA 4XXPA 1UZWA 3U4XA 4OI4A 2HWD1 3HQXA 2ZAAA 5IVFA 5F3GA 3ZDVA 5BYNA 1J1LA 2ZHKA 4FPFA 1UMIA 2JENA 4I3GA 4AVCA 4CDQA 1VBD1 3CDZB 4Q8LA 4IE7A 4DEQA 2PHFA 2P3IA 2ZZJA 3BOPA 2ZS6B 2O8QA 1CAWB 5A3MA 3VZKA 3CO2A 3W59A 4FFGA 1RUJ3 3KV5A 2QQOA 1AUYA 5CADA 1CWPA 1W6QA 3LA3A 3CHXA 4U2AA 5EYXA 1COV2 1RUF2 1UNBA 1QHDA 2W46A 3ATGA 3I59A 1IPSA 1TME3 1EYBA 1S2BA 2BGOA 2BJSA 1FPN3 3K4ZA 3MV01 1X33A 1BEV1 1IS3A 4AK3A 3LWCA 3UGFA 1J3RA 4Y22A 1PVC2 4LO4B 1BQPA 4XQDA 4HK9A 3AX4A 3I2DA 2Y6JA 1WA4A 4A41A 5IAVA 5JR2A 4MLOA 3PUQA 1Q8OA 4HG6B 1NCRC 4UFMA 3VBUB 4QAWA 3RYPA 3WUDA 2SBAA 2X10A 5JXHA 1NG0A 5FYCA 5I0UA 3N36A 1QJU1 2O0OA 1GZWA 2P34A 3ZKYA 5JUVA 3H9AA 5KHJA 2DCKA 2ZGMA 4LO7A 1FNZA 2GMEA 2WA4A 5J96B 1CAVB 3I97A 1AL0G 2ZEWA 5L9RA 2ZEZA 3HIFA 1LHUA 1WGPA 2MEV3 1JUHA 2XBO3 2QQPA 2XHNA 3HN1A 4KMQA 4JHZA 3WG2A 3WDXA 2VQTA 3JQXA 3OBAA 4QMAA 1WMXA 3CEWA 2WT2A 3U78A 3POSA 2JDNA 1WZXA 2JWPA 3G7DA 3IIIA 4R4ZA 5C9AC 4QKFA 2QQNA 4XUNA 2PLV2 4QGNA 1IGOA 2VZOA 4WVWA 3SISA 5BY5A 4DUVA 4CCOA 3KT1A 5C9AA 1AF9A 2P6CA 5FY4A 4XJZA 2D3RA 3VDBA 2YFUA 2BNMA 4OI1A 5A1FA 2JDPA 1NE4A 2TBVA 5A7WB 5A7QA 2D40A 1C3HA 1RUH2 1C8M3 1SLCA 3KQRA 3PVEA 1SCRA 1ND2C 1YJKA 1D0GA 2CTVA 4IXLA 5BXXA 3VHNA 4HN1A 2VOWA 2JDAA 1OURA 4JKLA 4BQ5A 4DY3A 3V0BB 5K0UC 4QPGC 2WN2A 1ND2A 2B46X 4QU1A 2PHRA 3J8F1 1JMUB 1PMJX 1TZOA 2R7EB 3EB7A 4AI9A 4QPGA 4Y5TA 1OF4A 4W6YA 3VBHC 4CP2A 4CEWB 3NQHA 3IN9A 1AR72 1R091 1NA1C 2B42B 3NWKA 4NN0A 1AR93 5BV6A 1WMEA 1OT5A 2HWE2 2XLFA 4U36A 1QJX3 1ZVFA 2CGOA 3VBHA 2JKBA 3UKVA 4IEZA 4M4PA 5J1XA 4A45A 2CYFA 1NA1A 1QH6A 2GNMA 2NPIA 4IEVA 5FZMA 2O14A 3WG3A 1Z7S2 2VZRA 1NKGA 4AVSA 5HXMA 4Q1RA 1R082 5FY8A 1QY4A 5CU1A 3ILFA 2WNOA 3DUIA 1QJY3 1CPMA 4AHWA 1JODA 1Q8SA 1H30A 4MX3A 1UKGA 4BQXA 2YG0A 4W65A 3V0AA 1PGL1 3U4SA 4LBKA 3WY6A 2ZEYA 3KD4A 5A7OA 1UYZA 4KGQA 1NXMA 1W3XA 2XJTA 3IB3A 4LHSA 1O5LA 3PVBB 3VZNA 1FMD3 4Y1XA 1CAXA 2ZGTA 1S0GA 1YHFA 4CU6A 2IXJA 2L9LA 4A2UA 1UOBA 2F4LA 2J1RA 4XZUG 3WDVA 4IETA 2ZTNA 4RGKA 5JZGB 3DGTA 1XRUA 3OPZA 4JRLA 4QM9A 4X8PA 5T5LA 2K0GA 3Q8CA 4LUMA 3WW4A 1GOGA 3M70A 2RS32 4JTOA 2IFWA 5KC6A 1LOCA 4DIQA 4FPLA 5CEHA 5KXBA 4NPMA 3M2MA 1MR5A 5FPAA 2XWBB 3AL6A 3C7HA 4QM8A 3ZR6A 1G9FA 5C3RA 4EROA 3ZSJA 1WCUA 1EP0A 4BIOA 5IVBA 3WQ0A 1S0BA 4CU7A 1TQ5A 5TSWA 4B8EA 3IIAA 5IFTA 4XJ9A 2FHRA 3VZJA 1S55A 2CNAA 2NMNA 1AJOA 4FXKB 3WP4A 4ONUA 4OULA 4XAEA 5IVCA 3WSOA 3ST7A 3IDAA 3VHPA 1RVF3 4G9SB 3AZWA 3POWA 1OLQA 3J4UH 1WLTA 2WQ8A 1H8TC 5A3OA 1H4HA 5ACA2 4YFZA 5DMYA 4QB1A 4XUTA 3V65A 2ZOEB 4QX5A 5F39A 1ZM1A 2C5DA 2ZGSA 4IEPA 1H8TA 2JIGA 3ZFGC 5IVEA 5FOBB 5F5CA 4UW6A 3T09A 4ES9A 3UYJA 1H8VA 4HXCA 3BTAA 2A3XA 4CDUC 5FBJA 4CCJA 2IWGB 3B00A 2BU9A 5GZDA 4QDQA 4C0BA 1R1A3 1AL22 2YY1A 2E26A 2XR4A 4RA0A 3LZZA 2W3JA 4A3ZA 5DDJ2 1NCQC 4CCDA 5CKNA 1H6YA 4I0BA 1W0OA 3MFCA 3BUCA 4HL0A 2D44A 2WSVA 4EWAA 2X53S 1VBB3 1JHNA 1EUTA 3ASIA 3NAPB 3NV3A 3S0MA 2ZACA 3FLTA 4XABA 4ZZ5A 2EICA 2V4VA 4BH9A 1EPZA 3IMMA 2J42A 1URXA 4D6SA 2GNTA 4RQPB 4UOJA 3S7EA 2F6BA 3HD8B 2LROA 2OQ7A 1U5IA 2XJUA 3I2JA 1EV11 1QNYA 2VZ3A 2VO5A 1VAMA 2E51A 4NHKA 4UBGA 1YFWA 1HN0A 2MPFA 3ZSKA 5HI0A 1JU4A 3KWVA 5CFDB 4PIXA 4MYEA 3VD5A 3ETPA 3RMYA 5K7PA 5KC5A 3USUB 4QPIB 4C1XA 4Z2WA 3WEZA 4RSUA 3RQ0A 1RUE1 4LBQA 1XNCA 2CY6A 4Q4Y3 3OBTA 3ALQA 4Y26A 3LIGA 3O0WA 3NJZA 2JG9B 3HR9A 1UZYA 1W2NA 4EZ4A 4YW2A 5LCWL 5BPXA 1YFYA 1W2OA 4WVMA 3DV8A 4RD7A 1STMA 3ACLA 5JR7B 4KG8A 1D7PM 2XH6A 1POV3 2ZKNA 4YGBA 2D5HA 5FZ7A 1BZWA 4HPKB 1OC1A 5LA2A 4AQ2A 2A5ZA 1Q5OA 2UYAA 2XVGA 5HCBA 1ZZCA 4MGIE 1W8UA 1HKDA 2HWB3 3C7FA 4AE2A 1UX6A 2VW0A 5FYSA 4D94A 5LY1A 1BBT1 4S2HA 3FFZA 3NJXA 5IUQA 3WHUA 1ULPA 1XC6A 4FI9A 1W6OA 3AVRA 3WF1A 2DVBA 3CZJA 1J1TA 3U10A 3LGRA 5JCTA 2LRPA 4LO6B 2YFZA 4TXWA 4QX0A 2RR12 1CZVA 1SZBA 2RS52 2ZKLA 2VXRA 4FT8A 4CCKA 2B4KA 1PGW2 1QOOA 2R0FA 1RUJ2 1BXHA 4QX8A 3I3BA 1EY2A 3GZTB 2ZHMA 4J6GA 4XXAA 5GKAC 3ZOIA 1DZQA 4JDMA 4PJYA 3PMSA 4ES8A 1TME2 3MIHA 3SXWA 2BBVA 3NAPA 3ACGA 1B35B 1S0IA 3D8CA 1BMV2 1ND3B 4GWNA 1LECA 4IW3A 4TWTA 2XPJA 5G05L 3IDBB 4PF1A 3R05A 2OPWA 2DCTA 3FJSA 5FXXA 3EXUA 3T1MA 2VZVA 1UXXX 2X5IB 5I0SA 4YW7A 1G9BA 1FXZA 1JN2P 4LHNA 2Q0AA 3K4AA 2RDSA 1YQ8A 3S57A 4WV8A 4JGYA 2W87A 5T55A 2PQQA 2RM23 1SACA 3O1RA 3CZUA 3ZM8A 4XUOA 4B7KA 1UZ0A 2VMEA 3T30A 2YPJA 3BODA 2JDZA 2ARAA 4E8CA 2QKDA 1N1YA 5IVYA 4PCRA 1C28A 2QJVA 1ULEA 4ZY9A 2EIBA 4YVWB 3PHMA 2F17A 4YW1A 3JD72 2MEV2 3URFA 4L97A 2FDJA 5ANNA 2JDUA 3AKPA 3NW4A 4GAZA 3JUUA 4V2VA 5FPZA 4AZZA 2K9ZA 2UYBA 3QH7A 5FQ0B 1LRHA 4E8DA 1UIKA 5ANQA 2WZPP 3CF6E 3AL5A 1U5ZA 2PHWA 1GQPA 1SPPB 2YPDA 3BALA 5SV8A 2DVFA 2Y8KA 4Q4V2 2FDHA 2ADEA 1IKQA 3BN6A 1XQNA 1WW5A 2FCUA 4KWKA 5C4WB 4JKMA 4DXTA 2A7AA 2W68A 1UD1A 3ZYHA 3TAYA 2GN7A 1V9U3 4P9JA 3KCXA 2WFF1 5KWRA 2HWF2 2GP3A 3AYEA 3P3PA 1HRV1 2ZX2A 2ZGNA 4Q0QA 5FAXA 4CDWC 4LKSA 3JBG2 3QACA 5E1RA 1WMFA 4HZFA 2E7TA 2Z79A 5K4LA 4DRVA 3IZOA 4IGQA 4H3WA 4CDWA 3LEIA 1W6NA 1COV3 1RUF3 1JYIA 3O5SA 3I3EA 3AP4A 3T0BA 1N3PA 1V6NA 5FZCA 1GR3A 4D7YA 5FXWA 1ENQA 4LHLA 1RUI1 1KS4A 1JYNA 2P2KA 1PVC3 1NQDA 1OA4A 4LKDA 2VZTA 4LO5B 1Y3TA 2LM3A 2BNNA 5FY0A 3ZXJA 4NUBA 2XG3A 2CV6A 4Z07A 2BDRA 1IG0A 2ILMA 3PUAA 4NRPA 3SNMA 5JXJA 4H14A 4A6OA 4FQZA 1IHMA 1MZEA 5C5UA 2VULA 4I02A 5FO8B 5CKMA 1QXRA 2WSUA 3MW3A 1PX4A 4YVSC 4YM1A 2ID4A 4CCLA 2RMU1 1WW7A 1MS4A 1X9PA 2W08A 2JXAA 2J1VA 1YIPA 2W1SA 2QUOA 4NRMA 4XF1A 3ZMOA 4AXOA 4DUXA 5GJ6A 4CUAA 3QCWA 2PTMA 2V72A 2Q1ZB 2W1UA 4AFDA 4HVQA 1DDLA 4BE3A 2AR6A 4FFFA 2C9AA 2JE8A 1ZZ8A 1W6PB 1V6OA 3DYOA 4O7XA 2YB7A 5JXGA 4HKWA 4N43B 5H9PA 4JZRA 4AEDA 1LHOA 5L7OC 5FJHA 2BBAA 3KHBA 3MFAA 4DRRA 1YO8A 3K51A 4I3PA 2WO1A 3R4DB 4B1LA 3OOXA 1HDKA 5L7OA 4YM3A 3NV2A 3ZXLA 2VQUA 4OCTA 1FMD2 2D43A 2FMDA 3KSCA 5BNPC 1XU2A 1GLHA 1YI7A 2H6BA 4Y3OA 1CAUA 2DTYA 4XBNA 5C4WA 1KGYA 2BW8A 3D5OA 5I0DA 1JI6A 1SLAA 3OJBA 4QPYA 1OLMA 3VBSC 4IUGA 5JIAA 4XJAA 4CXYA 2ZX4A 1JYTA 1GP4A 2FZ1A 2HEYF 1V6LA 3DPRB 4LITA 4AVBA 1T2XA 1WCQA 1XSRA 2BEOA 2ZA9A 5GALA 5CISA 3GYDA 1MVQA 3D82A 1RUG3 2NN8A 4HETA 3SC7X 1CIWA 5AC91 1WLDA 3MUZ1 4Q4X3 4AVTA 4IEUA 4P9GA 5FUIA 4AAXA 3K46A 5FFOC 4NVPA 2EXJA 3VDAA 1S4CA 2OW4A 3QD6A 2EVXA 4QQPA 5KHIA 2G4IA 5FO9B 1DP0A 5JAXA 4EN0A 1VBC1 5JPMB 2JD9A 3DYPA 4IE0A 2GMPA 2YMZA 5FZIA 2Q1MA 2ZMNA 3HNBM 4W6XA 4LBQD 4QKBA 2C9KA 3MF9A 3M3EA 3OGGA 3POBA 1N1TA 1OSGA 2FBEA 4TLFA 1HRI1 1W8HA 2TEPA 4RS5B 3H8UA 5C8WA 5C8CB 1RVF2 1Z7S3 1C8NA 4LE4A 1A34A 2VNOA 1OLRA 5F5QA 2QQIA 2W95A 3K3OA 4AVAA 3OD4A 2FDKA 1VLNA 5IK8A 2WO3A 3KLSA 1R092 3PIGA 2D97A 4NO4A 2G1MA 2G9ZA 2DUPA 2Y6FA 3FHAA 2R041 4QGLA 5FZ0A 4AFCA 4AFBA 3P3NA 3HEIA 4XIOA 4MGZE 4ZXKA 3J9SA 2IFRA 3C2UA 4M3CE 5BUVA 1DQ0A 3FBMA 3NV1A 4CE8A 3D6EA 4JGZB 1R64A 2KD7A 4PLNA 1FNYA 2WUHA 2DV9A 3WR0A 3SH4A 5AFEA 1UY0A 3ZXDA 4OHYA 3K3NA 3GZAA 3LDRA 3FMGA 3NKGA 4Y20A 2VXJA 3AC0A 5E88A 3MDPA 3BPZA 4XURA 1ZA4A 4MGTA 2BVVA 1A6CA 1HW5A 4EJRA 3B69A 2HEVF 4LEJA 1GP6A 4NE9A 4CUBA 3DEMA 1UX7A 3DPRA 1O4TA 4ZZ8A 3ROUA 4N7IA 2VPVA 2P37A 1XU1A 2IXLA 1LU1A 2VZUA 2DBIA 1ZZ9A 2SLIA 4H2AA 2JX9A 5JVVA 3LDKA 4FPEA 3VDDB 2RS33 1REFA 1CVNA 2XL7A 4LOTA 4N53C 3ZO0B 1IS5A 4LTAA 4IEWA 2TUNA 5IWFA 3ZX7A 3U75A 1W6MA 1NLSA 1ZRCA 3UGHA 2P3YA 1LJ7A 3JU9A 2D3SA 2ET1A 3UL2A 1UW8A 1J3QA 2B5HA 2OXBA 4N53A 4NWVA 1GMMA 3K2OA 3OUIA 4XBQA 1BJQA 5LBFA 3I2FA 3VBRC 1IQAA 4LO8A 1W3VA 3FWEA 4I0WB 4ZXEA 3ZLIA 5LEKA 3RVHA 3UNPA 3UETA 1FATA 2OX0A 4Q4W3 1QWRA 1GOFA 1RMU1 5JWPA 3WW2A 4LBOA 2X8KA 2BV4A 1GFF2 3FHQA 2W1QA 4L92A 1VBA1 1WLCA 4Y4YA 2VZPA 3I8TA 2VU9A 3N9MA 1WW6A 4IV3B 1Y43B 2PAEA 4QHZA 3VL8A 2Y0IA 1SFNA 2GN3A 5LY2A 1I6XA 4UI9L 1VRBA 4LQRA 3ES4A 4MHUA 4PI2A 1L7QA 4FP3A 4I09A 5F3IA 2VUJA 4PT6A 2ZHLA 4FOVA 1XJAA 2VTFA 4AWDA 1SEFA 3JCIA 3HQRA 3MF6A 3R4SA 2ZHNA 3WNLA 1RTVA 2PN5A 1NUKA 2XQRA 4GKXA 3LOBA 1AL23 1CQ9A 1X82A 3MBWA 4Y4RA 3WDYA 4KQ7A 5DDJ3 4IGPA 1DBNA 5T5PA 2HJIA 3MIDA 5FP3A 1RUD1 3LF7A 3KT4A 5JOWA 4E2GA 2D7FA 1PZ8A 1RUOA 2GNDA 4ZKTB 1KFUL 2ZEXA 3AJZA 3MLJA 5FZDA 2D6NA 5IATA 3PNAA 2AACA 2B45X 3GZEA 2E63A 1AYM1 5GZFA 1T6GC 4CU8A 1PK6C 5DAPA 5BNNC 1JZ2A 2ADDA 4LLFA 2NM1A 1GWLA 2ZPXA 2OUJA 4E9KA 5L9VA 1OH4A 2VQ0A 2ZGKA 5F3EA 1VALA 1UF2C 3JXSA 3MIBA 1SLIA 2BP6A 5HPOA 4Z8BA 1PK6A 1LOFA 1UIJA 3VBFB 3VKFC 5BNNA 5JPNB 3TEZA 3WD5A 1UMHA 4DY5A 1JYXA 3PJQA 4LOSA 3J7MA 2DCZA 4E2SA 2D98A 4BQYA 3ZN6A 4FTBA 1K5MA 4OQ9A 2WO7A 3LA2A 5H9SA 5HXVA 4A3XA 1LEDA 5IVJA 2RS13 2PHUA 3OGRA 4OUSA 3RG0A 1H1MA 3HAGA 2VNVA 3VBOB 2CL2A 4BXSV 4AFAA 1OQEA 2ZZQA 3WZ1A 5C3QA 1AZDA 1W2TA 4MXWB 2Q8OA 1MZ6A 1JH5A 1OPOA 4UW5A 2CGNA 3SKJE 1MQTA 1DQ4A 4ZONA 2PHTA 2WS91 3PUSA 4N8MA 3H3UA 1XYOA 4Y1YA 1PIV1 3FLRA 4YYOA 4QXCA 2H0VA 1XBFA 2QQUA 4BK5A 2G19A 1RUE2 2I74A 5C71A 1GANA 5D2AA 4CDQC 1BK1A 1S0EA 1WUVA 5CG9A 3H8OA 5JXIA 1PZ7A 4DOUA 2W91A 3LEKA 4JAAA 2A3YA 3V64A 1ASJ1 4A7YA 3WNMA 3SEPA 3IKWA 2BERA 5T52A 3GDBA 1EAH1 2Q4SA 2RJ2A 3HOBA 4OHVA 2CHHA 5JOZA 4FPKA 2RR13 3ES1A 4RGGA 4XEZA 3BU0A 1GZTA 1V9U2 1OVPA 1X7NA 2RS53 3ILRA 4KU7A 5A3LA 5F37A 3VZOA 4IEYA 5A6ZA 3RNSA 1O4YA 2VVEA 5JOYA 2OQ6A 1CGPA 5FMOS 2XB6C 1BBT2 2DFCA 2GZWA 4XFIA 3PUIA 5KR7A 1UY2A 4B1MA 1VB4A 3TWIA 4CA9A 2IXKA 1SQ4A 5EV7A 3OBZA 4PLMA 3AP5A 1HB4A 2WZR1 4ZU4A 2EIDA 4L9BA 4M3CF 3ECQA 1N3OA 1F31A 2JG8C 1XOYA 2WWSA 3ZFEC 4X8NA 4QQLA 4KWJA 2J1UA 2O8OA 2VUCA 3THPA 5FYYA 1D2SA 4MSVA 1O8SA 2W5FA 3LAGA 4XIKA 2JG8A 3ZFEA 4OYUA 1F15A 1D4VB 3MHZA 4LT5A 1CR7A 1F5JA 2VECA 2A6ZA 3AP9A 3DYMA 4NROA 3NO8A 5L36A 2D6PA 1FOD3 2A73B 2QDNA 1UY4A 2RVAA 1NE6A 3WP6A 1Q43A 5K0UB 4FOQA 4HSLA 2ZMKA 3O1PA 5JDBA 3JD73 2A75A 3OD0A 4HT1T 2WL1A 2WWJA 3I2HA 4AI0A 1SLBA 1Q8QA 3N3HA 4BQWA 3TRSB 1JOBA 1W8NA 4CUGA 5LA1A 3L2YA 1OI6A 3U0ZA 3TN91 4DO0A 5D21A 5FLIA 2CDPA 4XFAA 3TNPB 5FPXA 2Q1FA 2XUMA 5FREA 4HN0A 2A6YA 4Q4V3 4RHV1 1CJDA 2GMMA 3DKQA 3FE5A 3Q8AA 1I1EA 4LIVA 1WA6X 3B7MA 1QOTA 5F5IA 4XVHA 2VL4A 1BYHA 2EIGA 3N4MA 2HWF3 5LWBA 3I54A 3NNJA 3WNKA 3G6JB 1UY3A 3AZZA 3JBG3 2AENA 1UMZA 3R4UA 1QQP1 2BNOA 1VP6A 1CAWA 2Y6HA 2ORZA 3P6BA 1HXS1 4QU2A 4FTEA 2HWD3 3PTYA 1RUG2 3LSEA 2C4XA 3NJVA 5C3PA 2WYSA 4Q4X2 5SV5A 4WM8B 1OOPB 1IS4A 1VBD3 3BTXA 1MEC1 4EE2A 4COWA 4XF0A 4IE4A 2ZGUA 1KRIA 1E5HA 4YZ3A 2WFF2 4FQ4A 4RFT0 2VG9A 3NNGA 3UJQA 3VBUC 4M01A 4B4QA 1QH7A 2D6LX 1AR61 3MEPA 2QQKA 2IC1A 1RXFA 4E4HA 1WD4A 2PAMA 5F6LB 3X29B 5IK5A 2B39A 4IEOA 3VBUA 1E57A 4GH4B 3KV4A 2GU9A 1LENA 5EFUA 4FSJA 1BEV3 1GUIA 2QE3A 1F9KA 3GHMA 5FZ1A 4BLIA 1L7LA 1XE8A 3S5QA 4QX3A 4HVRA 1CAVA 3I2GA 4RL7A 1GICA 2EIEA 4MXVA 1JOJA 2IZWA 1PO21 1QJEA 1UYXA 3POEA 1BVVA 2HEWF 1QJU3 2PHLA 3DECA 3E6CC 5EQUA 1AXYA 2RMU2 4WM7B 2EXIA 4K1ZA 3D0SA 4EN8B 2Y33A 3Q8BA 4WZCA 4AQTA 1OA3A 4XE9A 3KF5A 2IXCA 4WZFA 4I0AA 1W99A 4ISQA 1AXZA 2WWUA 5KXCA 4WVZA 1JZ3A 2R0HA 1WW4A 3B94A 1JXNA 3W20A 2FDGA 4UFLA 1QNWA 4YG3A 4D3WA 2Q8DA 3SCHA 1J58A 5FTTC 1ZBE1 5LK5A 4BLJA 3RZHA 3D3AA 3O1TA 4GB31 3GBFA 5A7WA 1IG3A 3PJYA 3ZFGB 4LA3A 2UU8A 1MS8A 3FUOA 5IJRA 2VUAA 3FBYA 4FPYA 4BJ0A 1N47A 1VMHA 3BPSA 5B4XA 5FUNA 4JKKA 2FCTA 4YLZA 5FZ4A 1C57A 5GLZA 4YZ5A 3V0BA 2Y38A 2LTNA 2WNVB 2AEZA 4Y5Z0 4CEWC 5HV0A 1YFUA 1O4ZA 2DF7A 3MPBA 2BQPA 1LHNA 2I07B 1NCQB 1XNKA 2NP0A 4QHBA 1OHFA 1IKPA 4YW6A 5LASA 3IT8A 3POJA 4CEWA 2X29A 1XNBA 4KWLA 4R9CA 3T0AA 5A1AA 2YHJA 4EWDA 5FY7A 1H2NA 1LOBA 2KXLA 4Q4W2 4XW3A 3J8F3 3HQUA 5FKBA 5CVRA 4XAAA 3RSJA 5EJ1B 2JDHA 5H9QA 4YZ1A 3VHRA 3U14A 4ASLA 2WLQA 2Y6GA 1R093 5HCHA 2A70A 1ACCA 3POYA 4JQTA 3ELNA 3FHIB 3MIFA 3HWJA 1OMIA 2RV9A 3A0NA 4EYUA 4FPHA 1NZIA 4B4RA 1GBGA 2V4AA 2BOJA 1NLQA 1NQJA 4GMP1 4PQQA 4AFMA 4CZSA 4OHZA 5A7SA 2HBUA 3NL1A 1HRI2 1HB3A 1W05A 5DG2A 5DXDA 5FYUA 2BOIA 3CLPA 1F4AA 2R061 1YFXA 5FPBA 5IK7A 3WQ7A 2ENRA 4UXAA 2Y26A 3SHRA 3OEBA 4Q8KA 3CJIB 5FZOB 2R042 4XPVA 4EQVA 1QXJA 2A3WA 2J1TA 1AVBA 2ARCA 2VBDA 2XJQA 2XUEA 2XKOA 3GCXA 4CTEA 4DFSA 5LEJA 1LODA 4Y5SA 2WABA 5EPAA 3H8XA 1QU0A 1SDDB 1US2A 2PFWA 2DUQA 2OUHA 5FMCA 2HH9A 1O59A 1VIWB 4TN7A 3U37A 3ON7A 1OXCA 4GMP0 1LOEA 5JLVA 4CUCA 5JZGA 5T5JA 3HN3A 3J26N 3LPFA 3OTFA 3RZZA 2B8MA 4FFHA 5FYTA 1APNA 2VVDA 4QX7A 3VKMA 3WT3A 4IDZA 1NT0A 1CX4A 4O9GA 3SMHA 5T5OA 4F3JA 1PO11 1A78A 3CL1A 4NIDA 2WNVA 4JV4A 4FOYA 4P14A 1BK0A 2QZ3A 2YC2A 3RJ2X 2XL9A 3MYXA 3W5MA 2AYHA 2RDNA 4ZS2A 2RS12 4RGAA 4AQ6A 5DABA 4BK4A 3BIWE 1KEXA 2ZJCA 3ZVXA 5JMOA 4XMIA 4OHWA 3C7EA 2GC2A 2FDFA 4TSVA 4XDQA 4QHOA 3UJOA 4LULA 4C8DA 4NIGA 3VDCA 3ZYPA 1RUC1 4XETA 1R1ZA 2BRTA 4LKEA 1EPWA 4IE5A 4CP9B 1UZZA 1DLLA 5E8AA 4BDVB 1UAIA 4YARA 3GF6A 3MGUA 5F6KA 1QDOA 1OFNA 1ODNA 3HBZA 2ZAHA 1DLCA 3N7JA 1RINA 3OGSA 4XDPA 1IZ3A 1RMU2 3CIHA 2E32A 5CNAA 4XUQA 1X8EA 4OVEA 5EZWA 1ULFA 3CMGA 1VRH1 4IV1B 3WNOA 3ZPYA 5I0RA 3IBMA 3KCCA 4NHLA 3TEWA 2DCJA 4BPZA 2A6WA 1KQRA 5CB7A 1EUUA 1K12A 2AUYA 3IAQA 1X50A 2QDRA 3VL9A 3CJIA 1S1AA 5DZFA 2XLAA 5FZOA 3NAPC 1HV0A 3WXPA 2GC1A 4E2QA 3PU8A 2KM2A 2CDOA 4D7TA 3M3OA 3PVOA 3ZXEA 1UU5A 5BNOB 4JRAA 4I2OA 1YWKA 5FDBA 4JC1A 3LCPA 1LHVA 4PIYA 2VZSA 4E4DX 5A7NA 4QQHA 1K45A 2W47A 1RUD2 2Y6KA 4RQPA 1GKBA 1DGRA 4AL9A 3INAA 3I3QA 4L8QA
chains in the Genus database with same CATH topology
1O3SA 3E5QA 4QPIC 4JGYC 4RR3B 4ITCA 3AYAA 5CFDA 2ZX3A 3IPVB 4CP1A 1V6IA 1OA2A 4OZXA 3USUA 4QPIA 4D7SA 2EXKA 2JG9C 3A4UA 4A7KA 5F9TA 4S2DA 2BUKA 4OHXA 1FOD2 4XTMA 1EV13 3UV9A 2P3JA 4XTPA 2JG9A 2OZ6A 3E5UA 1ULCA 1AX0A 3WG4A 2D6MA 1NZCA 3AP6A 5CFCB 4AGGA 4HPKA 1RUE3 2RJKA 4FPJA 1SBEA 5BNQA 1XYPA 1W0PA 1MS1A 1AR81 2OIIA 4PIZA 4ASMB 2V09A 1D4M1 3N7KA 5H9RA 2DFBA 3LKJA 1AX2A 4K9SA 4HKLA 1CN1A 2WA3A 4YVSB 4Q0VA 1S0DA 1PNGA 2HYKA 2WS92 2PLV1 1PGSA 3D4KA 2WFPA 5A33B 1PIV2 1Z0HA 4Q0SA 4YSFA 5HBAA 3EHKA 5B2GB 5GZCA 1BBT3 3AMNA 1Z78A 3B02A 2WC2A 3ZXAC 2HWD2 1RUH1 3C3VA 5FRAA 5I8TA 1ASJ2 4CEYB 1B35C 1ND3C 1LR5A 1D2QA 1VBD2 1EAH2 2BVBA 4AEMA 4XQWA 1U0AA 2UWCA 1B35A 2ZGPA 1ND3A 1RITA 3MPPG 2X5IC 4R52A 5BNPB 2CGPA 2VMGA 4HK8A 1LTEA 5FO7B 2D6KA 4ZU5A 4D69A 1RHI1 1AR71 2R071 3HT2A 2X5IA 4RR3A 1LOGA 5I0TA 3GHNA 4BMEA 2HWE1 5FLHA 4NOTA 2PA7A 4EN6B 1BEV2 3IPVA 4K6BA 3PLQA 5GLVA 4QQOA 1FYUA 2WZR2 3AFGA 4YVWC 2E7QA 1UCXA 1YXWA 5GLTA 4AEDC 1DGLA 4URTA 1SLTA 4YW3A 4Q1PA 1LHWA 4HVOA 2CWSA 1GQGA 2WJSA 4K7JA 4YVWA 4K1YA 4M3CB 3ZFFB 1R081 2IXIA 2GC0A 4AEKA 1PMIA 1QJU2 3O0XA 2V73A 4FAHA 3BU7A 3B01A 5FQ0A 1B09A 2DVDA 1DQ2A 4H7MA 1ZRFA 5C4WC 1IPJA 4BIFA 4AYUA 4H55A 2ES3A 5FLJA 1JBCA 1GZCA 1OFSA 1DQ6A 4MUVA 2NMOA 4PDWB 4SLIA 5CIRA 2O1QA 2DUOA 2ETEA 4AEJA 5IK4A 4MVTA 4RHV2 1CPNA 1MS9A 1G6NA 3H1YA 4MGKE 4R4XA 4PLOA 1YCIA 3TBDA 1DFQA 1VB2A 4WBBA 2AGSA 3U07A 3ZDSA 2WFF3 1HRV3 4XHXA 4QGMA 2ERFA 1GQHA 4QD2A 4F8AA 3IM0A 3RDIA 1QQP2 4DQAA 3ZXGA 4K40A 4CDXB 4LR4A 2CWMA 1VAKA 2Q5TA 3DKWA 1MZ5A 1RUI3 2I45A 4NHMA 1Q8PA 2NLRA 3J8F2 1ZREA 2ARBA 4MGYE 1AR62 4LBNA 4INDA 1C5HA 2WT1A 5ACA1 1W6PA 1TMF1 4R9AA 3V56A 3ZFFA 1BCXA 1VBE1 3O7OA 3KT7A 2RMU3 4N43A 1DZRA 3VBRB 3OBRA 1CD3G 3SH5A 4LNVA 4XFGA 2GH2A 4I01A 4L2NA 1F2NA 1HQNA 2XJPA 4K21A 5D8AB 1XYNA 4AI2A 3T1LA 1PO22 3B9IA 3DPRC 4AI3A 3OCPA 2WNUB 5FBZA 1L3JA 3H1WA 1PGL2 4TYSA 5KHKA 1GYKA 4N90A 5KHGA 5CAZA 2DTWA 4K20A 2QCSB 3RJRA 1H2KA 2Z2SB 1QOSA 3ZYRA 3ZMNA 1FT9A 1HQLA 4BM8A 4EN7B 2ET7A 3I4IA 2OA2A 5EWSA 4OI0A 1OQ1A 2ZBJA 3AXEA 3MI8A 4GB32 4QXKA 2E7AA 4M0NA 5AC93 1G9DA 3ILNA 2B7YA 3H1MA 1V6JA 4CDXA 5C8CC 2WT0A 2PAKA 2P3KA 5DUXA 1ZBA1 4RS5A 5C8CA 2R49A 1VBC3 3OGJA 4HANA 4CP0A 1LESA 3HT1A 1AJKA 4META 4AI1A 1IPKA 1VAVA 3ETQA 2I2SA 5ABJB 3KZ4C 3OYWB 1DGRN 1HRI3 5FCCA 1MVEA 1QJZA 3E6BA 4JGZA 2PELA 3H7YA 1NOVA 3KB5A 3RI8A 3THTA 3TNQA 2WINB 1V6MA 1H4GA 4PF5A 1Y9QA 2R043 1G7YA 2DU0A 2YZ4A 3M7AA 2Z69A 3VGIA 4XFHA 3DF0A 2CAUA 4MV2A 4N9HA 1OPMA 1PGW1 5C33A 1PZ9A 3GBWA 1RUJ1 1X36A 2GSYA 4DPNA 3WCSA 1LOFC 2WNUA 3VDDC 1I3HA 2XVLA 2P17A 3AKRA 5DUUA 1K5MC 1TME1 3FC0A 1DG6A 1FPN1 4P5HA 3UKTA 3VDDA 3H7JA 3RYKA 1BMV1 2PHDA 5GM0A 4FPOB 4Z92B 1SCSA 2OVUA 4OFGA 1I5ZA 3RWNA 2QFEA 2MNGA 4LE3A 1UU4A 5J98B 2OYZA 4DB5A 5KHHA 4H7LA 3I59B 3ZN4A 5GZEA 1GNHA 1NLRA 2DCYA 1MQTC 5KXEA 2VOVA 1TNFA 4Y22B 1EV12 4ATFA 5IT6A 2VNGA 4IV3C 3WOGA 4XF3A 1GZ9A 1JUIA 2MEV1 2D5FA 2XBO1 4IV3A 5DG1A 1RJ7A 1LU2A 1GZWB 3WLUA 1NCRB 2ZGLA 1RMU3 1RC6A 4R8HA 4P9XA 1ZBA3 1VBA3 1LGBA 4YRDA 1LEMA 2DYCA 2QNKA 2UWAA 2BPA2 1ONAA 4LLOA 1RIRA 5EXOA 4BZ4A 4COVA 1KDKA 3GZUC 1XXNA 4FP2A 1RGSA 5GZGA 5DUVA 1C8M1 1TNRA 4ATEA 3BOWA 4JCKA 3VBFC 3H3ZA 5C9AB 2R16A 1RUD3 5EYYA 4C0HA 1H2MA 3K48A 1VJ2A 3UK9A 2G9GA 4BA6A 3VBFA 1NXD1 5FOJB 5DZEA 1O91A 2HKXA 3WDUA 3JB8A 4E4ZA 1AYM3 2VOKA 1MACA 3L9JT 3QBQA 2A71A 3RRDA 3VBOC 4FAGA 1AR91 1BKZA 2K2SA 1ND2B 2HWC1 1QJX1 4W6WA 4J1WA 1PHMA 4AHYA 4YG6A 1JW6A 3VBOA 1Q3EA 2GAUA 1GV9A 3JQWA 4QPGB 4MXWA 2NYYA 2EALA 3VZLA 4BWOA 4KGGA 4N9IA 5GLWA 4P9YA 1KXGA 5J3UA 1ENSA 4XMAA 2ZGQA 3VBHB 4XF4A 3WDTA 4K8FA 2W0XA 1QJY1 4R9BA 4BMBA 1NA1B 2R32A 4COUA 4Z1VA 3JZVA 1DGWX 1GSLA 4LA2A 1NCRA 3MLKA 5T54A 1DYKA 4YZ4A 4MH0E 2WS93 1DF0A 1RB8G 1NYWA 3WNXA 3M3IA 5JSRA 1PIV3 3JB4C 5GLUA 1FMD1 1CONA 4HSJA 1REDA 1KS5A 1AR82 2A6XA 2LALA 2YV8A 2Y0OA 3MICA 3TB0A 3V0AB 1D4M2 4GA9A 5CA6A 4COZA 3L2HA 4FPCA 1ASJ3 4LHKA 1OKQA 2EA7A 1VR3A 1J3PA 2VVFA 1EAH3 4R9DA 1CAXB 4FTSA 1DIWA 2E6VA 3LSDA 1ZNPA 1HRV2 3DN7A 4CYDA 1O7FA 3MW2A 1G9CA 5EJ3A 3AMHA 1H0BA 2BGCA 4I30A 1AYN1 1U5YA 5CBLA 1RUNA 1OD5A 3KGZA 2DWRA 3FFQA 3H50A 3QLQA 4S2GA 1RUI2 3NVCA 2EAAA 2WZR3 3WINE 3EQEA 1LGNA 4XJ8A 1ENRA 1RVF1 4FOWA 5E89A 2E9QA 5K0UA 1ZZBA 4BHPA 5LRSA 4LBLA 4P9IA 1RHI2 1HX6A 2R072 4JQRA 4B7EA 1WBFA 5DZGA 1NY71 4KBBA 2HWC3 1MS5A 1ALYA 3SLIA 4S2FA 3VLBB 4JDOA 3VHOA 4OLLA 2DVAA 1HIXA 3ZSEA 2BTVC 3EO6A 3N35A 1MS3A 3FLPA 3B5LB 2IXHA 2FZ2A 1R1A1 5A32B 1H8TB 3GALA 3TN93 3E97A 4IL7A 3KMHA 5FMOL 3AB0A 3TOJA 2YGLA 4LUKA 3SCFA 1XE7A 4RHV3 4WM8C 5T3NA 1OOPC 3AKSA 1VBB1 4SBVA 2A6VA 4WM8A 4CDUB 1OOPA 1C1LA 3S7IA 2OZJA 4YG0A 1O3RA 5I8YA 3ZYGA 1QQP3 2RJLA 2XHKA 2VW2A 3LOIA 1HXS3 2GNBA 4GH4C 2UY9A 4C91A 3AYDA 4XJWA 5AC92 2DU1A 4X6QB 3WCRA 4G3YC 1MEC3 4XZPA 3AZYA 1SBFA 4GH4A 2VW1A 4Q4Y1 4V1PA 3VV1A 5LRRA 3IMNA 4L11A 1AR63 1AYN3 1VBC2 3AJYA 3KS7A 3Q9OA 5JI7A 2VNRA 2XJRA 2FMYA 1POV1 1SBDA 4B3NA 4LBQB 4WM7C 3RMXA 3AK0A 3ZYJB 2JE9A 2HWB1 1S0CA 3RPQA 4FVVA 3M4FA 3QOPA 4WM7A 3SITA 4WVMB 3WP3A 2ZX1A 1F8VA 1S0FA 4BCUA 4E4SA 1CJPA 1WBLA 5J48A 1PO23 1MS0A 3E6DA 4DXZA 3M1HA 1ZRRA 1TMF2 2PHXA 2R6QA 5F1RA 4E27A 5A32A 4Z82A 1VBE2 1DQ5A 5JZGC 2GALA 3R0RA 1POV0 1W6OB 4M00A 4GKYA 1YI9A 1G86A 3VN4A 3ZFGA 4FBFA 1Q56A 3SH3A 4YNIA 2WNVC 5K8SA 5KXDA 3S30A 4XBLA 2WIIB 4YGEA 4CDUA 2JE7A 1ZBE3 4AQSA 1C4RA 5AFBA 4Q27A 2AH2A 3NV4A 3AZXA 4GB33 1XNDA 1KDMA 1DYPA 5C6CA 3S6PA 1NCQA 3KM5A 1O3QA 5J7MA 4F7ZA 2RHPA 2RE9A 3PVNA 2ZX0A 4IEXA 4JDNA 4X6RB 2RM21 5AVAA 2R1DA 1KJRA 1V00A 1UPIA 2H0BA 3DL3A 3MIGA 4FCAA 4M0HA 3CU7A 1A8DA 3VKNA 1AX1A 5L19A 2OPKA 4BYYA 4JGYB 2FQPA 5JI9A 1YYNA 2YXSA 2EXHA 1H1AA 1ZBA2 1VBA2 4OUMA 1IS6A 1H9WA 4J1XA 4Y24A 3CJIC 2CAVA 3AMPA 1W2UA 5JSPA 1LCLA 1V9U1 4GMP3 4IESA 2YC0A 2LUWA 1QDCA 4RQPC 1V6KA 3RI9A 4AHZA 2R063 1HV1A 3BB6A 1COV1 1RUF1 1YIFA 2H6CA 5J36A 2ARXA 2D3PA 2JJ6A 4UW4A 4AI8A 5CFDC 1PVC1 1X8MA 1ZYBA 1DU3D 3WHTA 4LBMA 3UKNA 4KU8A 4CDWB 1AYM2 1W6NB 2C0ZA 1ENXA 1LULA 4DZGA 4TZDA 5CG8A 1HQWA 1ZRDA 2WNEA 4KG0A 2DURA 3ZSLA 1ULDA 1YJLA 1FPN2 5HCFA 4HBNA 3E5XA 3ME2A 3WW3A 5LK7B 1AHSA 1PO13 2TNFA 4NPRA 3ZN5A 1N3QA 4XQ4A 4B4PA 4XHBA 4Y1ZA 4PBOA 4HLTA 4IV1C 2YDEA 1SLLA 5JOXA 4BQ1A 1H9PA 1RUC3 4IV1A 3U11A 4FO9A 2JD4A 1ZZ6A 3AYCA 3GNEA 2BWCA 4WVVA 1DGWA 2XJSA 1WCKA 1G8WA 2JEMA 2XBO2 3H0OA 1KFXL 4AEDB 4MZUA 3T2TA 5BNOC 1DZTA 2XVKA 4IERA 4Q26A 5L7OB 1VRH3 3EJKA 4C90A 5J37A 1U5XA 1REEA 1RUG1 3FX3A 1QGLA 5BNOA 3ZXKA 2MHFA 4Q4X1 3AKTA 1CAUB 1Q8VA 4N7UA 3RS6A 1DQ1A 2VMIA 4RR3C 3MZHA 3EBRA 1WLWA 1WCDJ 2UWBA 3VBSB 1C8M2 5J09A 1DHKB 3VKOA 3MLLA 1M4WA 1J59A 2C1FA 4XFFA 1D0HA 4ORFA 3ZIXA 4YZ2A 3WUCA 1Z7S1 4L99A 5CFCC 4IQPA 2Z42A 4YGCA 3I7DA 5DUWA 1YNAA 2JICA 2YGMA 2GC3A 1TEIA 4GWMA 4Y1VA 5CFCA 1AR92 3O14A 2HWC2 1QJX2 2DVGA 3CJXA 2VQAA 4A7ZA 1LGCA 2ZMLA 2NQYA 3VKLA 4K3UA 3WDWA 1N1VA 4YVSA 2XLGA 1S0JA 1SDWA 4CRQA 3CNAA 3WQ1A 4AVVA 5A33A 3TN92 4Q0UA 2ZGRA 3AXDA 1QJY2 1AR83 1CESA 3IDCB 1O5UA 1D4M3 3WX5A 1FV2A 4CEYC 1A3KA 1OQDA 3WVJA 3PMEA 4GIQA 3FUQA 4HFSA 2N7GA 5AVPA 1QKQA 2PLV3 4Y20B 4KH9A 1KITA 2WQ4A 4Q2FA 4BOWA 4CEYA 1H2LA 4EN9B 3ZIWA 2RS31 5T50A 4ISRA 2W52A 4GULA 1WD3A 2W39A 3GBGA 3FZ3A 4JTNA 1HXS2 5BNPA 1RUH3 1UKRA 3O12A 3IDEA 2BYVE 3M8LA 3VBSA 3TYJA 2BFUS 3LA7A 1MEC2 5KBFA 4AHXA 2F4PA 2R30A 3RYRA 1FV3A 1Y7BA 4GXLA 4Q4W1 1W6MB 1G9AA 4DINB 4N53B 3ZFFC 3A0KA 1AYN2 2ZGOA 4N43C 3WP5A 2ZCWA 1LOAA 1RHI3 1AR73 2R073 4DMIA 4PQ9A 3MW4A 5I93A 3WV6A 3NSTA 5KXCA 2HWE3 4M3CA 2QZ2A 3D0JA 3LB9A 4XILA 3ENRA 3ZXFA 3APBA 4P9LA 3AZVA 3QH6A 3AFKA 4NR1A 2UURA 3HMYA 2XJVA 3M3QA 1PM7A 3AMQA 1SFYA 2VH9A 3AP7A 1GNZA 4YM2A 3VZMA 4PDWC 1R083 1AL21 4G4FA 2D6OX 5DDJ1 2GDFA 2QVSB 3B93A 3NKTA 1TE1B 2WKKA 1NY72 4PDWA 1PNFA 2G9FA 5K9YA 3N7LA 3W9AA 4PBPA 3R6SA 1I9RA 4F83A 4AW7A 1WMDA 1FI2A 1YUDA 3VUOA 4GALA 4OI2A 1ZZ7A 3B9CA 1R1A2 2Q30A 2XWJB 3BCWA 4KL1A 1ZBE2 5D1IA 1WCSA 2EAKA 4CDXC 4DNYA 3M3CA 1VBB2 4XJUA 1YRZA 2B9UA 3MIEA 4HKOA 4RS5C 2VGDA 4AF9A 1UL9A 2RS11 1M06G 4P9WA 1PK6B 5BNNB 4FXGB 4EWEA 1UPSA 3ZYIB 3OF1A 5I8SA 4YGDA 3ZN6B 1K5MB 4UBHA 3USSA 5JSOA 2AREA 3OY8B 1FAYA 2E53A 4YW5A 4JGZC 1BVP1 2GH8A 4YFWA 1UN1A 2WLPA 3IWZA 2YROA 4Q4Y2 2YUEA 4QT6A 1QMJA 1ULGA 1RL3A 4JVAA 3VBRA 1YLLA 2WQZC 4O9EA 5D8AC 1MQTB 2ZABA 4EV0A 4FPGA 1JYCA 5ACA3 4UW3A 1LKNA 5D8AA 1KJLA 4NWWA 2RR11 2WNUC 1TMF3 1AXKA 4C1WA 1VBE3 2NZ9A 2RS51 4XYXA 4ZU7A 2HWB2 5JIUA 5JMCA 2AZ5A 4CDQB 4XF9A 2R062 4COYA 4AGVA 2XGXA 4QQ2A 3AMMA 1QXPA 5I91A 2V5YA 1MZFA 4LBJA 5L73A 1UU6A 3AM2A 3SCGA 1JTZX 3O0VA 4AGRA 1W6QB 2Z5WA 4XFCA 2R1BA 1FX5A 1O3TA 2BFUL 2ATFA 1U12A 2VMHA 1H1IA 5E16A 4YW4A 1QF3A 1V70A 2VOXA 4DS0A 2XKPA 2PYTA 1FOD1 1S2KA 2JECA 3ZSMA 1RJ8A 1PO12 1SMVA 2BWAA 4KNCA 3JD71 2JG8B 3W58A 3ZFEB 5ABJC 1ZX5A 4YM0A 1IOAA 4Y1UA 3WG1A 3AKQA 4IEQA 3OY8A 1F5FA 4Q29A 5HCAA 2VY0A 5ABJA 3KCYA 2YYOA 2RM22 2EF6A 3OYWA 1C1FA 4GQ7A 4Q4V1 1RUC2 2UY8A 2KA3A 3B3QE 1W39A 1KD7A 1PVXA 3N7MA 4XFBA 1N1SA 4HMZA 2HWF1 4B29A 1A8MA 1C5IA 1HLCA 3JBG1 3WW1A 4Q0PA 4XOGA 1VRH2 2D93A 4XXPA 3KGLA 3U4XA 4OI4A 2HWD1 3HQXA 2ZAAA 5BYNA 1J1LA 2ZHKA 4FPFA 2JENA 4I3GA 4AVCA 4CDQA 1VBD1 4Q8LA 2PHFA 2P3IA 2ZZJA 3BOPA 2ZS6B 2O8QA 1CAWB 5A3MA 3VZKA 3CO2A 3W59A 1RUJ3 1AUYA 5CADA 1W6QA 3LA3A 4U2AA 5EYXA 1COV2 1RUF2 3RG0A 1QHDA 3ATGA 4AHWA 3I59A 1TME3 1EYBA 1S2BA 1FPN3 1X33A 1BEV1 1IS3A 4AK3A 3LWCA 1J3RA 4Y22A 1PVC2 4LO4B 1BQPA 4XQDA 4HK9A 3AX4A 3I2DA 1WA4A 4MLOA 1Q8OA 1NCRC 3VBUB 3RYPA 3WUDA 2SBAA 1NG0A 5I0UA 3N36A 1QJU1 2O0OA 1GZWA 2P34A 3H9AA 5KHJA 2DCKA 2ZGMA 4LO7A 1FNZA 2GMEA 2WA4A 5J96B 1CAVB 1AL0G 3HIFA 1LHUA 1WGPA 2MEV3 1JUHA 2XBO3 2QQPA 3HN1A 3WG2A 3WDXA 3JQXA 4QMAA 3CEWA 2WT2A 3POSA 4R4ZA 3G7DA 5C9AC 2PLV2 4QGNA 1IGOA 4WVWA 3SISA 5BY5A 3KT1A 5C9AA 1AF9A 4XJZA 2D3RA 2BNMA 4OI1A 1NE4A 2TBVA 2D40A 1C3HA 1RUH2 1C8M3 1SLCA 3KQRA 3PVEA 1SCRA 1ND2C 1YJKA 1D0GA 2CTVA 4IXLA 5BXXA 3VHNA 4HN1A 2VOWA 4DY3A 3V0BB 5K0UC 4QPGC 1ND2A 2B46X 2PHRA 3J8F1 4QPGA 3VBHC 4W6YA 4CP2A 4CEWB 3IN9A 1AR72 1R091 1NA1C 2B42B 3NWKA 4NN0A 1AR93 5BV6A 1WMEA 2HWE2 2XLFA 4U36A 1QJX3 1ZVFA 2CGOA 3VBHA 2JKBA 3UKVA 4IEZA 2CYFA 1NA1A 1QH6A 2GNMA 2NPIA 4IEVA 3WG3A 1Z7S2 4AVSA 4Q1RA 1R082 1QY4A 5CU1A 3ILFA 3DUIA 1QJY3 1CPMA 1Q8SA 1H30A 4MX3A 1UKGA 4W65A 3V0AA 1PGL1 4LBKA 3WY6A 3KD4A 4KGQA 1NXMA 2XJTA 1O5LA 3PVBB 3VZNA 1FMD3 4Y1XA 1CAXA 2ZGTA 1S0GA 1YHFA 2IXJA 4A2UA 3WDVA 4IETA 2ZTNA 5JZGB 3DGTA 1XRUA 3OPZA 4JRLA 4QM9A 4X8PA 5T5LA 2K0GA 4LUMA 3WW4A 3M70A 2RS32 4JTOA 2IFWA 5KC6A 1LOCA 5KXBA 4FPLA 3M2MA 1MR5A 2XWBB 4QM8A 1G9FA 4EROA 3ZSJA 4BIOA 1EP0A 3WQ0A 1S0BA 1TQ5A 5TSWA 4B8EA 3IIAA 4XJ9A 2FHRA 3VZJA 1S55A 2CNAA 2NMNA 1AJOA 4FXKB 3WP4A 4ONUA 4OULA 3ST7A 3VHPA 1RVF3 4G9SB 3AZWA 3POWA 1OLQA 3J4UH 1WLTA 1H8TC 1H4HA 5ACA2 4YFZA 3V65A 2ZOEB 4QX5A 1ZM1A 2C5DA 2ZGSA 4IEPA 1H8TA 3ZFGC 5FOBB 4UW6A 4ES9A 1H8VA 3BTAA 2A3XA 4CDUC 2IWGB 3B00A 5GZDA 4C0BA 1R1A3 1AL22 2YY1A 4RA0A 3LZZA 5DDJ2 1NCQC 4I0BA 1W0OA 3MFCA 4HL0A 2D44A 2WSVA 4EWAA 2X53S 1VBB3 1JHNA 3NAPB 3ASIA 3S0MA 3NV3A 2ZACA 3FLTA 4BH9A 1EPZA 1URXA 2GNTA 4RQPB 3S7EA 2F6BA 3HD8B 1U5IA 2XJUA 1EV11 1QNYA 1VAMA 2E51A 4NHKA 4UBGA 1YFWA 5HI0A 2MPFA 3ZSKA 5CFDB 4PIXA 4MYEA 5KC5A 3RMYA 5K7PA 3USUB 4QPIB 4C1XA 4Z2WA 4RSUA 3RQ0A 1RUE1 4LBQA 1XNCA 2CY6A 4Q4Y3 3OBTA 3ALQA 4Y26A 3O0WA 3NJZA 2JG9B 3HR9A 1UZYA 4YW2A 5BPXA 1YFYA 4WVMA 3DV8A 4RD7A 3ACLA 5JR7B 4KG8A 2XH6A 1POV3 2ZKNA 4YGBA 2D5HA 1BZWA 4HPKB 4AQ2A 2A5ZA 1Q5OA 2UYAA 2XVGA 5HCBA 1ZZCA 4MGIE 2HWB3 1HKDA 4AE2A 1UX6A 2VW0A 4D94A 1BBT1 4S2HA 3FFZA 5IUQA 3WHUA 1W6OA 2DVBA 1J1TA 3U10A 3LGRA 5JCTA 4LO6B 2RR12 2RS52 2ZKLA 2VXRA 4FT8A 1PGW2 2R0FA 1QOOA 1RUJ2 1BXHA 1EY2A 3GZTB 2ZHMA 4J6GA 4XXAA 5GKAC 1DZQA 4JDMA 4PJYA 3PMSA 4ES8A 1TME2 3MIHA 3SXWA 2BBVA 3NAPA 1B35B 1S0IA 3D8CA 1BMV2 1ND3B 4GWNA 1LECA 2XPJA 4TWTA 3IDBB 3R05A 2DCTA 3FJSA 3EXUA 3T1MA 2X5IB 5I0SA 1G9BA 1FXZA 1JN2P 4LHNA 2Q0AA 4WV8A 4JGYA 5T55A 2PQQA 2RM23 1SACA 4B7KA 2YPJA 3BODA 2JDZA 2QKDA 1N1YA 4PCRA 1C28A 2QJVA 1ULEA 4YVWB 3PHMA 4YW1A 3JD72 2MEV2 3URFA 4L97A 1LB2A 3AKPA 5FPZA 3NW4A 3JUUA 2K9ZA 2UYBA 3QH7A 5FQ0B 1LRHA 1UIKA 2WZPP 3CF6E 1U5ZA 2PHWA 3BALA 5SV8A 2DVFA 4Q4V2 1IKQA 1XQNA 1WW5A 4KWKA 5C4WB 2A7AA 2W68A 1UD1A 3TAYA 2GN7A 1V9U3 4P9JA 3KCXA 2WFF1 5KWRA 2HWF2 3AYEA 5FAXA 3P3PA 1HRV1 2ZX2A 2ZGNA 4Q0QA 4CDWC 3JBG2 3QACA 5E1RA 1WMFA 4HZFA 2E7TA 2Z79A 4DRVA 4H3WA 4CDWA 1W6NA 1COV3 1RUF3 1JYIA 3O5SA 3AP4A 1N3PA 1V6NA 4D7YA 1GR3A 1ENQA 4LHLA 1RUI1 1KS4A 2P2KA 1PVC3 1NQDA 1OA4A 4LO5B 1Y3TA 2LM3A 2BNNA 3ZXJA 2XG3A 2CV6A 4Z07A 2ILMA 3SNMA 4H14A 4FQZA 1IHMA 1MZEA 2VULA 4I02A 5FO8B 1QXRA 2WSUA 3MW3A 4YVSC 4YM1A 2RMU1 1WW7A 2W08A 1MS4A 2JXAA 1YIPA 2QUOA 4XF1A 3ZMOA 4AXOA 5GJ6A 3QCWA 2PTMA 4HVQA 2Q1ZB 4AFDA 1DDLA 4BE3A 2AR6A 2C9AA 1ZZ8A 1W6PB 1V6OA 4HKWA 4N43B 5H9PA 5L7OC 4AEDA 1LHOA 3MFAA 4DRRA 1YO8A 3K51A 4I3PA 3R4DB 1HDKA 5L7OA 4YM3A 3NV2A 3ZXLA 1FMD2 2D43A 2FMDA 3KSCA 5BNPC 1XU2A 1GLHA 1YI7A 2H6BA 1CAUA 2DTYA 4XBNA 5C4WA 2BW8A 3D5OA 1SLAA 3VBSC 3OJBA 4QPYA 5JIAA 4XJAA 2ZX4A 2FZ1A 3DPRB 2HEYF 1V6LA 4AVBA 5GALA 2BEOA 2ZA9A 3GYDA 1MVQA 3D82A