4EN0A

Crystal structure of light
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
145
Chain Sequence
NPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 14
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 27
structure length 145
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4en0A00
1C3HA 2X29A 1DU3D 2E7AA 1GR3A 3B9IA 5KC6A 4MXWA 2HEVF 1TNRA 2WNVA 2QDNA 3TYJA 2WNUC 3V56A 3L9JT 2ZPXA 3MI8A 5CIRA 4QPYA 5L36A 4QQ2A 1OQEA 2JG9C 2JG8B 2Q1MA 4E4DX 2JG9A 2RJLA 4OULA 1A8MA 5KWRA 3IT8A 4MXWB 1O91A 1IQAA 1OQDA 4RSUA 1U5XA 3B94A 1RJ7A 3ALQA 4KG8A 5BNQA 5HBAA 2ZJCA 1ALYA 1RJ8A 2HEYF 2WNUA 1TNFA 4EN0A 3URFA 1PK6B 4QQLA 4OUSA 3B93A 2RJKA 4KGQA 4DB5A 1S55A 1I9RA 4F3JA 4G3YC 3QBQA 4E4SA 4D7YA 4MXVA 4MSVA 2O0OA 5TSWA 2WNVB 3AB0A 3FC0A 1C28A 2Z5WA 2AZ5A 2WNUB 3ME2A 4HT1T 2RE9A 5KC5A 2JG8C 1XU1A 1JTZX 3LKJA 4TSVA 4QQOA 4OUMA 4TWTA 2R6QA 2JG8A 2Q8OA 4KGGA 2JG9B 4J6GA 4DOUA 1U5ZA 4G4FA 1JH5A 2HEWF 4QQPA 2TUNA 2TNFA 1KD7A 1D4VB 4NN0A 1D2QA 1DG6A 2OIIA 2WNVC 4GIQA 3TWIA 2QE3A 1D0GA 1KXGA 5L19A 4QQHA 3K48A 2R30A 1PK6C 4N90A 1PK6A 2R32A 3K51A 3WD5A 1XU2A 3QD6A 1WCKA 1OSGA 1U5YA 2KA3A
chains in the Genus database with same CATH superfamily
4E2GA 3GBWA 4UXAA 3N9PA 4B8EA 4TLFA 1YXWA 2OXBA 4L97A 4CDWA 5E16A 3CF6E 3AVSA 4Z2WA 2VQTA 2HEVF 3JD73 2P6HA 4KBZA 3R4SA 3W5NA 4FAHA 2IZWA 2ZPXA 3NKTA 2W91A 4JV4A 2BU9A 4MUVA 2E51A 1MQTC 1LAJA 4Q27A 4QPYA 1F4HA 4BJ0A 1YYNA 3OG2A 2VR4A 5IW0A 4CSWA 1UIKA 1IGOA 4BYYA 2UYAA 1FPN3 4XBNA 1LTEA 3RI9A 1NYWA 2ZZJA 1VBB1 2PA7A 3E5QA 1C1FA 2B9VA 4QPIB 3ROUA 2UY9A 1ND3B 3ZXJA 1LNSA 4A7KA 3SEEA 5CKNA 1NX9A 4CDXB 1LGCA 3AP4A 4GMP0 2C6SA 3RYPA 5EIYB 1JODA 1TME2 3AK0A 3CQOA 4BISA 1NLRA 5DAQA 3VZOA 3U4XA 5A6YA 1J1LA 1LOFA 1C8M1 5A7SA 2TBVA 3W21A 3W59A 2EIBA 1OT5A 1SLLA 2XUEA 5IVJA 1MVEA 1BKZA 5FY1A 2VUJA 4HXCA 2C0ZA 3WNLA 4FAGA 2Y64A 5DABA 1TE1B 3ZYGA 5LRSA 4Q0SA 5A32B 1RUJ1 5J7MA 5APAA 3K3OA 2O8OA 4XJZA 2CHHA 4N53A 5FP9A 1XNBA 5JVVA 2IXJA 2QUOA 2Z42A 1ALYA 2HEYF 2ZJCA 3VBRA 3AZXA 1R1A2 1PNFA 4EN8B 5FYTA 1SBFA 1XSQA 3J4UH 1UZVA 3N9OA 4GJYA 2YY1A 3AL5A 1UCXA 2MEV3 3KV5A 4EZHA 3B69A 5CG8A 1US2A 5GZCA 3POWA 3PTYA 1GOHA 2RS12 4LBQA 1O6UA 3LOBA 3I3MA 1NG0A 3OOXA 1WW4A 1DGRN 3I2HA 4SBVA 4B3NA 1O4ZA 3KWVA 2NM1A 4PDWC 1FYUA 4DFSA 1ODNA 4AR2A 1W39A 3ACHA 2JB4A 3H1MA 3ZPYA 5C3RA 4UW4A 3WP6A 2CGPA 2VAUA 2OZ6A 4O65A 1L7LA 1QOOA 3M3OA 3WHUA 1ST8A 2JJ6A 1JI6A 2PYTA 2VNRA 4IEOA 2BNNA 3VBOA 2ETEA 4CP0A 2JIGA 2RE9A 1RUE3 1C4RA 4WZCA 1DGLA 3JQXA 1ZNPA 2A6ZA 3Q8FA 4I3GA 1WW7A 3VHOA 4D6SA 2F17A 2Y6FA 4P14A 1AVBA 4HKOA 4J6GA 1U5ZA 1GUIA 2WINB 1CJDA 4GKXA 2DF7A 3H3LA 3U75A 2GN7A 5LB6A 3LDKA 1O3TA 4ZPIA 4XDPA 1Q8VA 5C4WC 3NSTA 4BQ2A 4EWAA 2WDBA 1RB8G 3ZFGA 4CEYC 3F95A 2JDMA 2YPJA 3KQRA 3ENRA 1WCSA 2HWE1 4ISQA 5F39A 1SMVA 2A6XA 4LXLA 3ZMNA 4CEWC 2YFZA 3Q9OA 2VW0A 1JYNA 1DQ0A 1N3OA 2BGCA 3MIGA 4FO9A 4CPBA 1XB9A 1OQ1A 4UOJA 1UXXX 1UZ0A 4N7UA 4HG6B 4IE7A 3O7OA 3MO4A 1QHDA 5FREA 3MV11 2R062 3ZFFA 1D7PM 3NWKA 2WN2A 1GZCA 2UYBA 3LIHA 4QXKA 1VIWB 2P17A 2VBBA 2E7AA 3ABZA 1F4AA 5EWSA 4LO6B 4Q26A 4XQWA 2ATFA 2V72A 5A3WA 3DL3A 1UAIA 5IFPA 2QQNA 1DQ5A 3JUUA 1GNYA 1V70A 2PELA 2QDNA 4B4PA 2BNMA 1XYPA 4N43A 1OF3A 3PMEA 1PGSA 2W92A 4CUAA 5A7WA 3AMPA 2VOWA 4URAA 3GDBA 2BFUS 3VBHC 2R072 1G6NA 2XJSA 2E7QA 3AP9A 3NNGA 4B7KA 5FYIA 1QXJA 3LAGA 3VUOA 1W6QA 5KXEA 1Z0HA 3ZSEA 3M7AA 4ARYA 5B4NA 4OULA 1S0DA 5JPMB 1QF3A 1A8MA 3I97A 4DXTA 2XLGA 4A41A 5KWRA 1N1SA 2WZEA 4R9DA 4EN6B 2N7GA 3CEWA 1TME1 4NHLA 3KCXA 1COV3 1WZXA 5F3IA 5KHKA 1NXD1 1ULFA 1CN1A 5F2WA 1LCLA 2YFUA 3H9AA 5A1FA 1DF0A 1VJ2A 2J1AA 3AL6A 3N9LA 1OOPB 3H7JA 5FYZA 4Q0PA 3BI3A 1O7FA 2HWF2 1DQ4A 1RJ8A 2I07B 4FOWA 2FDGA 5I0TA 1O4TA 3NJXA 1HQLA 3NV2A 1QJX3 4YW4A 1F9KA 2R16A 4NVPA 5LA0A 1R1A1 4RS5C 2AREA 2PHUA 4Y20B 3T4HB 3APBA 4QHZA 4XMAA 2YU1A 2BTVC 2J22A 4GQ7A 1BJQA 3ZLIA 3U1XA 1W2NA 4JGZC 2RS11 4Y24A 1UQXA 2E9QA 4RR3A 4BOWA 4DMIA 3GJBA 5DZEA 1FOD2 1QIQA 5C9AB 5F3CA 2Q4SA 1GZWA 1NCRC 3SH4A 4P9WA 1JS9A 1HN0A 2LUWA 4Q1PA 3RVHA 3KQ4B 2GMPA 4A6SA 4HBNA 4OHVA 1W9YA 1RIRA 1YJLA 4C90A 3ZXDA 1QXPA 2DU0A 3HQUA 1U12A 1KITA 2GALA 2JG8C 1XU1A 2WWSA 3OBZA 3EBRA 1PVC2 5FJKA 4LHLA 3FUQA 5IK4A 5FAXA 3MF9A 5K9YA 3WW1A 1ND3A 1NQDA 4J1WA 4QQPA 4CDWC 2PLV2 4BQXA 1D4M2 1EV12 4WM7C 1VRH3 4XAEA 1XJAA 4A7YA 5FZKA 3E5XA 4R9AA 5LA9A 2BUKA 5JZGA 4EJRA 5DG2A 1U5IA 1UU6A 1VALA 3VBFC 4A3ZA 1RUNA 2J1TA 1UYZA 2QQOA 2D6PA 5E8AA 3K46A 4XTPA 3DKWA 3GCXA 1J3QA 2DTYA 3CDZB 3CU7A 3ZN5A 3GBGA 4ZKTB 1IOAA 1PZ7A 1PK6C 1W04A 3J8F2 4UFJA 5H9QA 3ZSJA 2O14A 1UOJA 5CFCA 4PLNA 4PQ9A 1YFWA 4PI2A 5LCWL 4JX0A 3WQBA 3MLKA 3MYXA 5A3OA 4XJUA 4LBKA 1AR63 1SLIA 4QXBA 4RHV2 5C3SA 4NUBA 4YWAA 1LOFC 4Q4V3 1Q8QA 3DCQA 2UWCA 1NY72 2DYCA 3ETPA 4PHZA 3C7OA 2EF6A 4Q4Y3 1UKGA 2NQYA 4IQPA 4XYXA 5E1RA 3AMQA 4W65A 5K8SA 4NHMA 4N7IA 1NLSA 4NIAA 4MGIE 3CJIC 4D94A 2VW1A 2ZEXA 4AVCA 3JBG3 3TYJA 3VBRC 4YZ4A 5GLWA 3USUB 1GMMA 4FQZA 4QDQA 2VCAA 1QDOA 1VBA3 4IGQA 3DKQA 2GNDA 2Q5TA 2ZGQA 2BERA 2JDNA 3AX4A 5IWFA 2BPA2 3O0VA 2UURA 1QJY3 5FRAA 2WC2A 4ZHNA 1F5JA 1AUYA 2R071 4Q4X1 4NPRA 2WUHA 1B09A 1BBT2 3NMBA 1PM7A 2CU5A 2JENA 2OW4A 2XJRA 3O0WA 4Y4YA 1JU4A 1VAVA 1C5HA 4BCUA 3HT1A 1UF2C 4RGGA 1SDDB 2JDYA 3RZGA 5EPAA 5FLHA 1O91A 2W1UA 1SBDA 3VBOC 2XPJA 5FZFA 4RA0A 2B4KA 4ZY9A 3U14A 3MPPG 1OH4A 1GWMA 3NNJA 3WQ1A 1RJ7A 5F3EA 2NYYA 2DDUA 3JD72 3WW2A 1W8WA 2CV6A 3HOBA 5FZDA 3O1UA 4ASMB 1XPWA 3U78A 3C7HA 2JIJA 5I0UA 4XACA 3VBUA 5FXWA 3FHIB 4QQLA 4RYDA 2HWF1 4PF5A 1K5MA 2X10A 2GAUA 4DB5A 5JR7B 1FPN2 4AQSA 2E32A 4N9HA 5K0UC 3UETA 2PMWB 2Y6HA 4CCCA 3LFMA 4D7YA 1O59A 5JCTA 1CAVA 4W4ZA 2FCTA 4HMZA 1OPMA 2W46A 1W8HA 2AEZA 2RR13 4UW3A 1HB1A 1KEXA 3LA3A 4I0BA 4FPOB 3TBDA 3MIDA 3WX5A 3THTA 2GDFA 2ZX4A 1J83A 4XFCA 3ZR5A 4U36A 1PIV3 1T6GC 3HPNA 4IDZA 3HIFA 1FOD1 1Y7BA 4XDOA 5A7NA 3KLSA 5FFOC 5KC5A 1WA6X 1AR83 3OGSA 3R4DB 5DZGA 3I2FA 1FT9A 4KWJA 1WD4A 2DTWA 3H8OA 4QMAA 5EJ1B 3E6BA 4AVBA 1S2EA 4YM2A 2B46X 2P4EA 4MV2A 1PVC1 1WUVA 3LSDA 3GHNA 2MEV2 4Y22B 2C9KA 2JDZA 1X9PA 2PXJA 1WW6A 1D2QA 3LOIA 4P02B 4AVTA 4YFWA 3FUOA 3WP4A 2QQPA 1GYKA 4LIUA 4WVZA 5IK8A 1DDLA 1J1TA 3FJSA 1EV11 1CQ9A 2RS53 1S0IA 4OHXA 1MS3A 2MHFA 3F2ZA 4K8FA 2WZ8A 4E4HA 1WA4A 5AFBA 1YI7A 1TVGA 1XNCA 3KT4A 3TN93 1WMEA 4PQQA 4JRAA 1MS4A 3WNMA 2VUCA 4NR1A 4META 2DVDA 1RUH3 2OUJA 3RYRA 5FOBB 1UWWA 3C3VA 1XU2A 1W05A 2WRAA 2IVJA 4MH0E 3VBSB 1OI6A 5DUVA 4LJHA 2VVDA 3M3QA 1ENRA 3VKOA 1NZIA 4RHV1 2H6BA 4DO0A 1AJOA 1H8TC 1SLAA 1UL9A 5FPLA 2AACA 3D6EA 1NY71 1W9SA 4UW5A 4BXSV 2EALA 1V6JA 2DURA 1BYHA 3G6JB 3OEAA 4XC9A 4XFIA 2HH9A 5T5PA 4AEKA 5C9AA 4Y4RA 1TG7A 3GZAA 4AZZA 1ND2A 2J1EA 2X5IB 3N7MA 2BJSA 4R4ZA 3LIGA 4A45A 1WW5A 2DBIA 3BCWA 4QQ2A 2YDEA 1JOBA 2BGPA 1UYYA 2F6BA 2GNMA 4CCLA 4FSJA 4AAXA 1ZRRA 4RL7A 4E4DX 4AL9A 1PMJX 4L2NA 2XMLA 4LORA 4Q0QA 1D0HA 2RJ2A 2VZQA 4M0HA 4Z2AA 5FY0A 4KU7A 4RR3C 1DQ2A 5F37A 1HIXA 1XNDA 5FMOS 1BBT1 3VB9A 4KG0A 3OD0A 3HVDA 4F83A 3I3EA 2RMU1 4S2FA 4Q1RA 4YVWA 3OY8A 4HFSA 4QX0A 3T08A 1UY1A 3D4KA 4YYOA 3C7EA 5CEHA 1IKPA 2RVAA 1WKYA 2WYSA 5AFEA 1H6YA 1VPHA 1ND3C 1H4HA 4LK7A 4N8MA 1REEA 1BK1A 3JD71 1JUHA 3LA7A 1DGRA 1ZA7A 3V65A 4K1YA 5BNNB 2VZTA 4TTGA 3O1MA 1KRIA 5JZGC 2VQAA 4DQAA 1HB4A 3M3IA 5I0SA 1J59A 4XQ4A 3SHRA 4U2AA 4MGQA 5CYYA 2B39A 4XIKA 3T4VA 1FPN1 3ZSKA 4YW7A 5C3QA 4CP9A 5GLTA 3RG0A 2C1FA 2J1RA 2O0OA 3I8TA 4AQ6A 3AYCA 1AL0G 1PMHX 3AB0A 4HKLA 1DZQA 3GZUC 4LO5B 3D3AA 3T1MA 5CFCC 1M4WA 2FZ2A 1DFQA 2E63A 1BCXA 5AC93 2A3XA 1VRBA 2A3YA 2BYVE 4AI0A 4IEQA 5A3PA 2RDRA 2BBVA 4QWNA 4KGGA 4L92A 2WKKA 1W9WA 4BWOA 4D6QA 4KNCA 3WT3A 3D8CA 3VHRA 4Q8KA 4ZU4A 4CCMA 1KD7A 3OPWA 1B35C 4O61A 2Q8CA 1V6MA 3JXSA 5JIAA 4QHOA 5LY1A 1A34A 1OF4A 1QGLA 3WW4A 4LQRA 2LW8A 2MEV1 4GIQA 4IV3A 4L99A 3VZLA 3A7QA 1Y9GA 3K75B 1WLWA 1OA4A 3NAPB 5D21A 3IN9A 4DUVA 4MGYE 4PJYA 2VZVA 3DYOA 2W2IA 4HK9A 2AEYA 4IEPA 5GM0A 1F35A 2OPKA 2JDKA 3WY6A 2R063 2D3PA 3K51A 2ERFA 1FV2A 1RUC2 2QQLA 2IFRA 2QTWB 3AP5A 4KWKA 3T0BA 4AG4A 5IAVA 1SG3A 4W6WA 3VGIA 4CDQC 4BU2A 4UYBA 3HN3A 1GU3A 2LM3A 4BQ3A 1J84A 4M3CB 2Y0IA 4LMFA 2ZHMA 1PX3A 2W08A 3MF6A 5JSPA 1JZ3A 4D3WA 3A4UA 1ZYBA 1AR93 3L2HA 5IJRA 4GKYA 3SQOA 3OGJA 3U07A 1E5SA 2VOVA 4BB3A 5A3TA 5LBEA 3DN7A 2D97A 4XHXA 4Y1ZA 3VBUC 4AHZA 3WNKA 5J48A 5BNOB 3KF3A 1K5MC 4K20A 2VMDA 3P6BA 5I8TA 4XF3A 1CX4A 4BQWA 3NV4A 3IWZA 4QPWA 4Z07A 4JCKA 3CO2A 2VXRA 5FZLA 5FP8A 1V00A 1CONA 4X6QB 4L0PA 1Y9MA 4QPGB 3I49A 1QXRA 1JOPA 2GH8A 2IC1A 2WO2A 2WT2A 1Y4WA 1GOFA 2VGDA 2WR9A 2XOMA 2Y26A 1GSLA 3KB5A 1NCQB 1POV1 4XFBA 5F5AA 2JX9A 4Q4V2 1AYN3 4D7SA 4MXWB 1S0GA 2YROA 2QJVA 2HWB3 4ET7A 1BEV2 4Q4Y2 1DZTA 1GNHA 1W0OA 4MZUA 4K6BA 2VCCA 2Q1ZB 2GSYA 3BPZA 4NROA 4QX1A 4Q2FA 5B4XA 4TZDA 1G86A 1PO13 4CCEA 1DBNA 4XUOA 3JBG2 2WNUA 1GLHA 4NOTA 4FPFA 1H1IA 3K77A 2KR2A 3I59B 3U4SA 1RVF2 1VBA2 4WM8A 4AFBA 3PUIA 3CL1A 4FXKB 2JDPA 1UY2A 3ASIA 4XFFA 5A7QA 1QJY2 4HSJA 3V0BA 3QBQA 1IG3A 1NA1B 4BIFA 1UKRA 2EAKA 3WG4A 3EYPA 2FZ1A 1S2BA 4ZS3A 5EFUA 2P6CA 4L9BA 4AGRA 4DINB 4QU1A 2WWJA 2XVGA 4ES8A 1ZZ9A 4HN1A 1X36A 1VB2A 4OQ8A 4BQYA 1G9AA 1DZRA 3DXTA 4D0QA 3KD4A 4CYDA 2BWCA 3INAA 5DXDA 5F6LB 3BTXA 3GF6A 3NJYA 2X5IA 1MS9A 4LR4A 3WF2A 2B7YA 3EO6A 4IEWA 1UY0A 2EVXA 1YI9A 3AZZA 5LEKA 4IL7A 3H50A 1COV1 2QFEA 4MOAA 4UF0B 4EV0A 1RC6A 4CUBA 2XQXA 3R6SA 4J25A 3ZSLA 2PLV3 4G4FA 1D4M3 2P2KA 2ADDA 4HPKB 5FZOB 3WVJA 4ISRA 4YZ3A 3RZHA 5D8AA 4B29A 4Y1UA 1YQ5A 2DFBA 1ND2C 1D0GA 4XEZA 3WNPA 4GJZA 1ODMA 3WV6A 2RR12 1G8WA 4M3CF 3J8F3 1ASJ2 3OYWB 3ELNA 2D3SA 3AKTA 1GKBA 5FXVA 4MX3A 2QKDA 2VMCA 3AC0A 4IEUA 4YM0A 1CD3G 3ZN4A 1ZBE3 1PIV2 1T2XA 1V6LA 4LO8A 2VECA 4AI9A 3IM0A 4MADA 2YBPA 3ZYFA 3IIIA 3A23A 1D2SA 4FFIA 1FMD3 5IT6A 5BNNA 1Z7S3 3ME2A 1VBC2 4GH4C 1RUC1 4IEVA 5FZCA 1ZZBA 3SKVA 3WXPA 1DYKA 2ZGKA 2NN8A 1GFF2 2D6KA 2HWC2 4YVWC 1JYIA 3PVBB 2ZHLA 4O9GA 4COYA 4XJWA 5G05L 2YUEA 1EAH3 3JB8A 2WFF2 2XKPA 5A33B 1MS1A 4XFAA 5B2GB 1RUD3 1VRH1 1R093 2RS52 4FOQA 4RQPB 3AKPA 4MHRA 2CL2A 3LSEA 4TXWA 4UAPA 2NMNA 1R083 2VVFA 3MPBA 3NW4A 1ENSA 1JUIA 2R0HA 1ULPA 3NQHA 1W8UA 1ZZ8A 3OB8A 1ULGA 3TN92 3WG3A 1LOGA 3WNXA 5IATA 1AYM3 2C5DA 2VVEA 3CNAA 1UN1A 5FZEA 1J3RA 5SV5A 1W6MB 5IVVA 4J1XA 1OA3A 1YRZA 2HYXA 2RG4A 2R7EB 5KR7A 3BU0A 2FBEA 3JU9A 4QM8A 1AR61 3MIEA 4Q5OA 5FK8A 4AFDA 1W3VA 4MGKE 4NO4A 2RDQA 1W6NB 4Q4V1 2AYHA 5FCCA 1HW5A 1VAKA 2GZWA 5C5UA 4BIOA 3RZMA 4I2OA 1BEV1 5JMOA 1S4CA 3POSA 1HN1A 4IV1B 3PNAA 4Q4Y1 4XTMA 1CZSA 2X09A 3ILRA 2XKOA 4NPLA 4XZUG 3AKRA 2ARXA 3JBG1 4B4QA 5L9RA 1NKGA 2A7AA 2ZEYA 1ENQA 1JYTA 3ZN6A 2W3JA 3POYA 1MPXA 5FUPA 1BXHA 1VBA1 2WO3A 1VBE2 5FZ7A 5HV0A 4OZXA 4M3CA 4IV3C 1G9CA 4KWLA 2RS32 2VH9A 1QJY1 1UNBA 1IPSA 2KM2A 1H4GA 4QKBA 4Q29A 4CXYA 4XUTA 1LENA 3LDRA 3K4ZA 3M1HA 1AJKA 2ZMLA 4H14A 3AMNA 4IGPA 5ABJB 5FLIA 1WD3A 3FFZA 4YVSC 3GM8A 1PO23 5IYYA 4IE5A 2QQVA 3DF0A 1SLCA 3KCYA 4FPHA 5CISA 1GICA 5BNOA 3DPRC 3LGRA 3LZZA 3QACA 2ZKLA 5T54A 3TEWA 2JG9B 1NE6A 2BRTA 3DYPA 4LBJA 4BK4A 4LE3A 5BUVA 2FMYA 5E89A 5EHDA 2RHPA 3O12A 4QPGA 3RMYA 4E2SA 4H7MA 3E6CC 3H7YA 4MLOA 2WO1A 4UFMA 3BB6A 2XQRA 3KS7A 5L73A 1KFXL 1OPOA 3J7MA 4QT6A 4AYUA 3AMMA 5L7OB 4XMIA 1A8DA 2E31A 1W8TA 4QKDA 4GALA 1KXGA 4ASKA 4DXSA 5C8CA 3GCWA 4AEDC 1GP5A 1N3QA 2YMZA 3PUAA 4CA9A 4YGBA 3VKFC 4Y26A 1A3KA 3PURA 2RR11 1TEIA 3FL7A 4QDRA 1LHVA 1PGL2 5AC92 3IDEA 2P1BA 2XL7A 3I59A 4UFHA 2CAVA 5IVBA 4XUQA 1S0JA 1QOSA 1WMFA 4Y5SA 1YFXA 1PIV1 4OI1A 2GP5A 3H8RA 4NAMA 4LOSA 1L7QA 3U37A 5A1LA 2X29A 4H2AA 1DU3D 1AR81 1XC6A 1H2NA 3NV1A 2FDFA 3B9IA 1VBC1 1W0NA 3B02A 1OUSA 2WJSA 3UKNA 4AVSA 4Q8LA 4OI4A 3O1PA 1HXS3 2WNUC 1FNZA 5CFDA 2J7MA 2P3JA 3SEPA 2NPIA 3GHMA 4WM8C 1Z78A 3GALA 4A44A 5F1RA 5FYYA 4YW2A 4OQ9A 5JOYA 2BEOA 5L36A 2ZA9A 1CAUB 4W6YA 2RS51 1POV3 4DUWA 2V4VA 4UF0A 1UMZA 5LBBA 3POGA 4LO4B 4XBQA 1QWRA 5T55A 5ANQA 3TN91 3N7JA 2VUAA 4YZ1A 4JGYA 4X6RB 2ZKNA 1HQWA 1IG0A 2D43A 5EJ3A 1O5LA 1RUH1 2ZHKA 4UBGA 1YEWA 4Y1XA 4XIOA 4YM3A 3VDDC 3RDIA 1HDKA 1SQ4A 1W06A 4S2DA 5JIUA 3QCWA 1HX6A 3ZFEB 2ZBJA 5BXXA 2P3YA 2ZAAA 4LBMA 2PHLA 1G9BA 1AR92 4XF9A 2I45A 2VL4A 4XQDA 5F9TA 1UU5A 4K21A 4HLTA 4LK6A 5HXVA 3OPZA 3T3YA 3URFA 4RFT0 2Q8DA 1N1YA 3RZKA 2VW2A 3RS6A 5D8AC 2ARBA 5BPXA 4OZOA 4YG0A 3SH3A 2GC1A 2YPDA 4V2VA 1BK0A 4K1ZA 2YZ4A 4GXLA 1O3SA 4MG2A 1RXFA 4QX8A 1VBE1 1N3PA 4NPMA 5EYYA 2A1XA 1AYN2 3SCGA 3ZKYA 3ACGA 4OYUA 1OLME 2GC0A 2HWB2 2HWD3 1YUDA 1SBEA 2BOJA 4RQPA 2E6VA 2B5HA 2W95A 4LEJA 4CE8A 1SFNA 5BNPC 1O8SA 4DY3A 3AYDA 2WS93 1JTZX 3LEKA 1LGNA 1PO12 4FPEA 3RZZA 1AHSA 1O5UA 3NRUA 2QQKA 3UGFA 5JOZA 2PHRA 2YC2A 1XOYA 4GMP1 2HEWF 3PL0A 5A6QA 4M4PA 3OBTA 1BQPA 5JI7A 1W2UA 4IESA 1LHOA 1CPNA 4I0WB 3MHZA 3IDCB 4ITCA 3I7DA 3UV9A 3V0AB 4M01A 2Y0OA 5CNAA 1I5ZA 1QH6A 2VD7A 1WLCA 2VMGA 3KM5A 5LRRA 3THDA 1HRI2 1W6NA 4YPJA 3WEZA 4QQHA 4XXAA 1BMV2 2JDHA 4L8QA 2FDJA 3WCSA 3W5MA 4W8JA 2FDHA 3KF5A 4HANA 4P9YA 2IXIA 4XVHA 4XILA 2LALA 1RUC3 2XONA 1QNWA 2ZXQA 5FZIA 2JDUA 4SLIA 3UYJA 5FO7B 1U5YA 4QPIA 1YFYA 5BYNA 1PGL1 5AC91 1W3XA 3QOPA 3AVRA 1OVPA 4CDXA 4B1MA 1QNYA 4QKFA 3OCPA 1DGWX 4RFRB 3THPA 4FPYA 3ZXGA 4NJ4A 5DAXA 5FY7A 3UJQA 4IEZA 3TNQA 5KC6A 1EPZA 3P5BA 4NRPA 3JB4C 4AF9A 4BXFA 1M06G 4NHYA 1YLLA 5CU1A 3MIHA 1AL22 3V56A 3FHAA 3OF1A 4YFZA 4QGLA 4IUGA 5A32A 5FZBA 3EHKA 4MVTA 1YHFA 2ZGPA 3C7GA 1ULDA 1YNAA 4QKNA 4FCAA 2UWBA 4AAPA 4GWNA 3N3HA 5FQ0B 1HV0A 4JDOA 4OHYA 2JG9A 4CU9A 1ZBE2 4R4XA 3T2QA 1RUG3 4LHNA 2YBKA 4CDUB 2P3IA 2GNBA 3QH6A 4JKLA 1FMD2 3S7EA 1Z7S2 1BEV3 2R061 4JVAA 2PAKA 1HKDA 1W99A 3PVOA 1S0BA 3BTYA 3M3EA 1L7RA 4ATFA 3BN6A 2ID4A 4N53C 1EUUA 1MVQA 1GZTA 1ZVFA 2J1UA 3OUJA 1EAH2 3ZYIB 2A73B 5E88A 3WG1A 1RINA 3FLTA 3I2IA 4AI2A 1RVF3 2WIIB 2ENRA 2ZGOA 1RUD2 2D5FA 1R092 2D5HA 5IK5A 1AR91 2OKXA 2P3KA 4M00A 3H1YA 1R082 3CLPA 3N9MA 1FI2A 4CP1A 3FWEA 5H9SA 4YGCA 5FYHA 1AYM2 5FZ4A 3M8LA 2F4PA 4HN0A 5C8CC 3HD8B 2XB6C 5FZ1A 3D5OA 4BQ5A 1XXNA 2VOXA 3M3CA 2P5BA 3C7FA 4HK8A 2ZHNA 1F2NA 4A6OA 1ULOA 2V73A 2XH6A 3IKWA 4QB2A 4Z8BA 5GZGA 3LD8A 4XJ8A 5FY9A 5I0DA 4CU6A 1PVXA 1AYN1 2BOIA 3RRDA 2DV9A 3RJRA 1MQTB 1OD5A 2HWB1 3K2OA 5IUQA 1YQ2A 2R6QA 1UY4A 4TN7A 5A1AA 3VKNA 2ZCWA 1PO11 4MGTA 5LK7B 5CZKA 4QXCA 1GZ9A 3ZXKA 2OZJA 1Y3TA 1HB2A 2OQ6A 3DUIA 5DG1A 3ZFGC 1H2LA 4BE3A 4EROA 1ZBA2 3LA2A 2XVLA 1HB3A 3ZM8A 1WLDA 3AP7A 3MLJA 4FFGA 5CFDC 1ASJ3 4GZ9A 4Y33A 3ZFEA 4BMBA 3GJAA 4DS0A 3FHQA 5C7GA 3MUY1 2R30A 5C8CB 3B9CA 1HRI1 4PIXA 1EY2A 1QQP3 4CVUA 1PO22 5CAZA 2VULA 3ITQA 1LHUA 1BMV1 3ZFFC 1CIYA 4UI9L 4I3PA 1YQ6A 4W6XA 5HCAA 5FJHA 2OVUA 1JYVA 1RMU2 5FZ8A 4JGYC 1C1LA 1VBC3 1MS0A 2EIGA 2YU2A 2HWC3 1W8FA 1QY4A 1QMJA 1VLNA 1WBFA 2D7FA 5GLZA 5FMDA 3ST7A 5T5OA 4P9XA 2WFF3 4AEMA 1CR7A 1LR5A 4MO3M 2PLV1 4LE4A 1D4M1 4I0AA 4PDWB 4N43C 1GANA 5IAXA 3HN1A 3OUIA 2OA2A 4GA9A 3L9JT 1STMA 2W9XA 3Q8BA 1XE0A 3T0DA 1ENXA 1OOPA 1Y9QA 2ILMA 1XBFA 1AL21 1I1EA 4AFAA 1J58A 1JZ7A 1W6PB 2ORXA 2WA4A 3PDQA 3H3ZA 4QU2A 2WZR3 2PHFA 3IDBB 3ZVXA 3WDVA 3J8F1 4WVMB 1XE7A 1BVVA 2VZOA 4CU8A 5JXIA 4JAAA 4TYSA 4Y20A 1SPPB 2ZZQA 3ATGA 1HRV3 5DPNA 1W90A 1JZ6A 2HYKA 1ZBE1 2HBUA 1LEMA 2PHXA 5FP7A 5FZAA 5F7UA 1US3A 1MEC3 3IT8A 4Y1VA 3VHPA 5C4WB 3DGTA 4ZONA 1FMD1 5FUIA 4AK3A 3AZVA 1QJFA 3B94A 1Z7S1 2FHRA 3J7HA 4P9IA 4CEYB 4IERA 3TAYA 2WABA 4ATEA 5K7PA 4AHXA 2D98A 4LOTA 1RUI2 4LHKA 1HXS2 1JZ2A 3OGVA 1XYNA 2UY8A 4CEWB 4EN0A 5L9BA 1VP6A 3LEGA 3UKVA 4AVVA 2DFCA 1EAH1 5EP9A 4IGOA 4CZSA 2WBKA 3OBAA 1UMIA 1RUD1 2UWAA 1VBE3 1OMIA 1R091 2RJKA 4KGQA 2OPWA 2RS33 1E5IA 1DGWA 1KS5A 3POEA 1R081 3VLBB 4PIYA 4UT5A 5JOWA 5DAPA 1GP6A 1YIFA 2YHJA 5IK7A 2JE7A 3H42B 3VD5A 3PIJA 1EPWA 4MSVA 4YG3A 1AYM1 4AGVA 5FZGA 2EIDA 1K45A 2ES3A 3N36A 2YB7A 3WF4A 1AXYA 3K4AA 4AFCA 4AW7A 1VB4A 1JYXA 5FMCA 3V64A 3WQ0A 4INDA 5T3NA 4GMP3 3IPVB 1ZM1A 1O8PA 3VV1A 4QDSA 2BBAA 5FKBA 3UGGA 4QPIC 3FBYA 5A7PA 4BQ4A 4FP2A 2VU9A 3VBHB 4FPLA 1H6XA 3PIGA 4CDXC 1V6OA 4LBNA 2VOKA 1JH5A 1W8ZA 4ORFA 2VMFA 1CZTA 2ZOEB 5C71A 3BPSA 4XXPA 4Z82A 3WUDA 2VUDA 3ILNA 1LOBA 2WL1A 2C4XA 2QQMA 4JDMA 3MZHA 2H6CA 2VO5A 4TLGA 1UU4A 4C0HA 5C70A 1KDKA 4HL0A 3UKTA 1SHWB 2PN5A 2BZDA 1ZBA1 3PU8A 3OSDA 1CAWB 5GJ6A 1VMJA 2E7TA 3USUA 3BTZA 4Q4W3 2WT1A 5FPBA 5L9VA 4H7LA 3MDPA 5F3GA 2HWD2 4MGSA 4GB33 1AR62 2CY6A 2Y38A 4FT8A 1YJKA 2VTFA 2WS92 1PO21 2XWJB 1UZYA 4LBQD 1RL3A 4KL1A 1U0AA 4RS5B 2Q8EA 3VHNA 3BTAA 2PAEA 3KHBA 4FVVA 1SFPA 2ZGSA 4PT6A 1Q3EA 4YGDA 3IZOA 1W2OA 1GNZA 1X8MA 4CUGA 1GR3A 2J1SA 4AFMA 3KSCA 2W39A 3D0JA 1TNRA 4JGZB 4QX3A 3WDUA 3KCCA 4GWMA 3AZWA 5KHHA 3HQRA 4BLJA 1VBD3 4XFGA 4DPNA 1NCRB 3ZXAC 3ZDVA 2NZ9A 3P3PA 4BQ1A 5T50A 5ACA3 4MYEA 4AGGA 4HVQA 1I3HA 1ZRDA 2JG8B 1APNA 4IEXA 4XW3A 3HAGA 2XJPA 4GD4A 4WBBA 1JYCA 2B45X 3VN4A 2ZMKA 3WHTA 3ZYBA 3EJKA 1IS3A 4OHZA 4CDWB 4WM7B 1REFA 1LODA 5A3LA 1KDMA 2RV9A 3KVBA 2V4AA 2WWUA 2O8QA 4Y3OA 4RSUA 1WWYA 4EE2A 1CIWA 3T1LA 4COZA 4LLFA 3EQEA 3VBFB 5J09A 3ALQA 5BNQA 4UFKA 3PHMA 4NHXA 1FATA 2E33A 2WSVA 1JHJA 2ZAHA 4PLOA 5JR2A 5FYVA 1EUTA 1LRHA 1PK6B 2R1BA 2GH2A 1W8OA 5J37A 1SCRA 3I2OA 1RUI1 1SZBA 1RUOA 1HXS1 2Z2SB 4A42A 3B93A 2C9AA 2NMOA 1S55A 1IS4A 2VM9A 2ZGNA 3OGRA 1RTVA 5C6CA 2PHTA 3LE0A 1LHWA 2EA7A 2ZS6B 1MS5A 3PVEA 3O1OA 4FPCA 3WDXA 4Y22A 2IXCA 5FBZA 1RUG2 4CEYA 2QZ2A 4MXVA 3VD9A 3B5LB 2BW8A 2BVVA 2ARCA 4OMCA 2VBPA 1X82A 2VE1A 2LS6A 2ZGTA 1DQ6A 1WMXA 3CJIB 3KZ4C 4IXLA 4XF4A 1Q8OA 1DCSA 1SLBA 3NV3A 4Y1YA 3VBRB 3FX3A 3VL9A 3BODA 1LHNA 1JBCA 3ZDSA 1Y43B 4NRMA 1F31A 1ZZCA 5EJZB 4FOYA 3AP6A 2JDAA 5DQ0A 4AI8A 5A3UA 3TNPB 2RM23 2OS2A 4LLOA 4LHSA 4LBQB 3RMXA 3BUCA 4DXRA 5C3OA 2WAAA 3VBSA 4NN0A 1SPPA 2VCBA 4FFHA 3WDWA 2WSUA 1DG6A 4BHPA 2C24A 3MIFA 4D6RA 1HRI3 4AWDA 4X8NA 3ZKUA 3IMMA 5K4LA 3E5UA 1OOPC 5FPZA 3TRSB 3VBOB 1E57A 3ZX7A 5FOJB 3D82A 3LPFA 5HI0A 3WQ7A 2A6YA 5HV4A 1XNAA 1GQGA 2ZACA 4XF0A 4GWJA 1NOVA 5F5CA 4FTSA 4GULA 1K42A 5DDJ3 5FPVA 1LOCA 3HJRA 5BV6A 1FV3A 4P08A 2OT7A 1NZCA 1UD1A 3IAQA 3P1IA 2W1QA 4XJ9A 4OI0A 4YW1A 2HWD1 5J1XA 5IVCA 4LBOA 2GU9A 5FKCA 2P34A 3B01A 4YM1A 2CWMA 5D1IA 5K0UB 1NAEA 2WS91 3A0KA 3H8UA 2FD8A 4I30A 3ACIA 5C9AC 3ZPOA 5KHGA 2BNOA 1AL23 3N35A 4M0NA 2VMHA 1OD3A 2XR4A 3RPQA 1XNTA 1RYYA 2DVGA 2V5YA 2VTXA 2CTVA 4RD7A 2XBO3 3IPVA 1YCIA 5CIRA 3BOWA 3R4UA 4QB6A 4HVRA 1DP0A 1ONAA 5I8SA 2QVSB 2FMDA 3USSA 3MUZ1 2WA3A 4O9EA 4DEVA 3VZNA 2VBDA 5FR3A 2W1SA 1QQP2 3JCIA 1ULCA 2HBTA 5HPOA 1JZ8A 4KBBA 2NP0A 1V6IA 3THCA 2D6OX 2B8MA 1H2KA 2IWGB 5AVAA 3WSOA 4N9IA 3GGLA 1QKQA 5GKAC 1IQAA 2GC2A 1AXZA 2VNGA 2VPVA 2Y6LA 1U5XA 4JRLA 3S5QA 5FP3A 5DAVA 2VXJA 1AX2A 3LEMA 4JZRA 1CAWA 1UX6A 4W50A 5A7WB 4KG8A 2VQ0A 3RFRA 3WOGA 4NHKA 5T5JA 1V6KA 4CCOA 4XPVA 1JMUB 4IE4A 3DEMA 5A7OA 2WQ4A 3CHXA 3S6PA 3T0AA 5I8YA 5JXHA 2DCZA 1W6QB 2G9GA 4OLLA 4D7TA 3J26N 4OUSA 1I9RA 2IUWA 4G3YC 2WZR2 2BVBA 4RS5A 4WV8A 5FY5A 3SNMA 1CWPA 2EXKA 1Q5OA 1SDWA 1FAYA 3SMHA 3TEZA 1OBNA 3SISA 5EV7A 1J3PA 3T09A 3MEPA 1HRV2 4EYUA 1UMHA 2QQWA 1H8TB 1Q8SA 3AZYA 4KI5M 4XURA 5FZ6A 3PUQA 4JTOA 5CA6A 1ULEA 1MEC2 1RUG1 1L3JA 3OGGA 3NAPA 1LJ7A 3KGLA 4ZS2A 5EQUA 1NCRA 5C8WA 4LBLA 1JN2P 5ANNA 4XJAA 5FP4A 1OXCA 4TSVA 2DU1A 5J96B 2XL9A 3HBZA 3J9SA 2JD4A 2JG8A 2XLFA 2Q8OA 3S0MA 1XNKA 1CJPA 3FFQA 4QGNA 1AR73 1C8NA 1TMF3 1V0AA 2XUMA 3KV4A 2LTNA 4DEQA 1AF9A 1JXNA 2BQPA 2XWBB 2BDRA 4NIGA 2WAOA 3TEXA 1RVF1 1ZBA3 2ET7A 3ILFA 3LF7A 4PI0A 2OIIA 1MZEA 4RR3B 4WM7A 3WNOA 1VE0A 2AENA 3E6DA 3S7IA 3N9QA 2BGOA 1GZWB 2QE3A 2BV4A 3W9AA 5A3NA 3PJQA 3VD3A 5KXCA 2W0XA 1P8JA 4K9SA 3VBFA 2OQ7A 3GNEA 3N7LA 3RZJA 1HJFA 2QQUA 1OUXA 2XJTA 4AHWA 1ZA4A 1UY3A 1RMU3 1E5RA 4EN7B 3K3NA 3NJVA 2IFWA 1KS4A 3DECA 1PK6A 2R32A 4P9GA 4LIVA 5DUUA 1CX1A 4NAOA 2B42B 2W68A 3MV01 3O1TA 1WCKA 4YW3A 1ACCA 1UYXA 3O14A 1HQNA 1LEDA 4I09A 2VY0A 4QGMA 4XETA 3ZIWA 2KA3A 1E5HA 5IFTA 2JE8A 1YC61 1CESA 5JZGB 4LPLA 1V6NA 1NCQA 2K46A 2ZGLA 1UX7A 4COVA 2VMIA 4MXWA 3H3UA 1QJEA 1RHI3 4HETA 4JHTA 1SCSA 2MPFA 4FI9A 3CJIA 5GZDA 4WVVA 1LGBA 3BKZA 3I4IA 1S0EA 5CFCB 1QH7A 4JQTA 5ERLA 4JQRA 4RN5A 4H3WA 4Q4W2 3WZ1A 5I0RA 1ASJ1 3T2PA 3CKHA 3RWKX 1JHNA 4GB32 4LUMA 5LEJA 4LITA 1HJGA 4CRQA 3T2TA 4DUXA 1WCDJ 1XE8A 2CSGA 1FX5A 2ZABA 3E1F1 4S2HA 3WDYA 2A3WA 1QQP1 1YO8A 2DUOA 5LBCA 5C5TA 2J42A 1B35B 1NA1A 3MW2A 3S30A 3O1RA 3HNBM 4YZ5A 3ZYRA 5A6XA 1DHKB 1S0CA 1AXKA 3GBFA 3UNPA 2JEMA 4CTEA 4FPJA 1HLCA 3OTFA 2ZGMA 1DLLA 3AFKA 1RUI3 1W9FA 2HWC1 2R0FA 2PQQA 4AQ2A 5HBAA 2I74A 2WFF1 3E97A 3FN9A 4OUEA 1VBD2 3POIA 1LULA 4AEJA 5A70A 3SH5A 4Z92B 1Q8PA 4S2GA 3SCHA 3SITA 5JLVA 3TOJA 3DV8A 2NLRA 3VBSC 5ACA2 5FZ9A 3W20A 1W2TA 4XFHA 4BPZA 5LBFA 4F3JA 4HPKA 2CGNA 5KXBA 1LOEA 5FZOA 5FZMA 4CDQB 4R9BA 1JOJA 2A5ZA 5K0UA 1AX0A 4YZ2A 4EWDA 1H2MA 1UPIA 2Z4FA 4XUPA 2WZR1 4I01A 2QNKA 3DYMA 3FMGA 3IAPA 3VZMA 3AJZA 3MIBA 3MW4A 2PFWA 2X5IC 4A3XA 1YQCA 2D3RA 4EN9B 2ZEZA 5AVPA 1HRV1 2WLQA 1TQ5A 4PBPA 3WF0A 4FQ4A 2YXSA 4HT1T 3BIWE 3OYWA 1MEC1 2DVAA 3VBUB 1XSRA 4QQOA 1K5MB 4OUMA 5LA1A 1CGPA 3WLUA 5FXZA 3WP5A 3ZYHA 5FUNA 2DUPA 3RNSA 3SXWA 2JXAA 2TNFA 2GNTA 2AGSA 1CAVB 3HT2A 1QJU3 1W0PA 4YW5A 2J1VA 1ZRCA 1V9U2 1MACA 5HXMA 4WVWA 4AQTA 4C0BA 2RS31 4RGKA 1H1AA 3AYEA 4P5YA 5A33A 3CZUA 1W2AX 4Q4X2 1WCUA 4HKWA 4UFIA 3BIEA 4N90A 1PHMA 2BWAA 5BNNC 5GZFA 1MZ6A 1JYWA 1UZWA 3EXUA 3QD6A 1RUF3 1OSGA 3IBMA 3ZOIA 3PJYA 4QXHA 4DRVA 2X8KA 4YGEA 1K3IA 4ZU5A 2ZEWA 1W03A 1F5FA 4AOCA 2RM22 2X05A 1MZ5A 3HQXA 1W6MA 5F5IA 4BK5A 4BZ4A 4RGAA 2D6MA 4V1PA 1REDA 1ZRIA 3VKMA 1DYPA 1RXGA 1H8TA 3AXEA 4JKKA 4K7JA 1N1TA 4JHZA 2ARAA 1ZRFA 3WDTA 3VDCA 4NIDA 2VCMA 4QX7A 3O1VA 4Q0UA 2Q0AA 2QCSB 4IV1A 4R8HA 1X7NA 4DNYA 4XF1A 1GV9A 3QLQA 3ECQA 1LU2A 4QX5A 2YGMA 5DDJ2 5FIXA 5CADA 2CWSA 5GLUA 4Q4W1 5JXGA 4XDQA 1DIWA 5ISLA 4ZXEA 4D8MA 4GB31 2V09A 1R64A 5KXDA 4OCTA 4A7ZA 3N7KA 5KHJA 3KT1A 3RSJA 1O3RA 1K5JA 1SEFA 3NAPC 4AVAA 2W52A 4PIZA 1PM4A 3KGZA 4NWVA 1ND2B 2PAMA 5ABJA 2G1MA 4XZPA 1WMDA 3BU7A 5LZ6A 5DMYA 2VZPA 2AR6A 3JZVA 3M4FA 4BLIA 1LECA 2XBO2 3JQWA 2Z69A 5FZ0A 4JDNA 5LY2A 4QAWA 2R042 5A6ZA 1VBD1 1QU0A 1GP4A 2ZX2A 2JD9A 3L2YA 4M3CE 3FLRA 5DUXA 3KHCA 5FV3A 2Q30A 1GWLA 5ACA1 4AI1A 3I3BA 1W28A 4GH4B 3OPTA 4C1WA 3ACLA 2WNEA 2OX0A 2W47A 5FK7A 4YVWB 3OY8B 2WNVB 3ETQA 3SKJE 3SLIA 5L7OA 1PMIA 4LKSA 3M2MA 2YG0A 4FFFA 5F2SA 5BNOC 3A21A 1MR5A 1QJZA 3AJYA 3KT7A 2YC4A 5JI9A 2WQZC 3MBWA 2VMEA 3EB7A 3I2JA 2CDPA 3LKJA 1XYOA 4TWTA 3LDBA 3LPGA 5FY4A 5GALA 3GYDA 5FYMA 4DOUA 4QPGC 4FXGB 1UIJA 3KMHA 3B7MA 1NCQC 2Z79A 1D4VB 5EXOA 3BGAA 4V2WA 4DRRA 1VR3A 3OBRA 4CP9B 1B35A 1UO9A 4AXOA 4JC1A 4DY5A 1OURA 3TWIA 3OUHA 3RQ0A 2C26A 2CGOA 2G19A 5HCBA 1VBB3 1YFUA 3SCFA 5L19A 1V9U1 2UU8A 2EICA 2KXLA 5CG9A 1IZ3A 1MS8A 2EIEA 1NE4A 2LRPA 2A75A 2PHDA 2XDVA 3KV9A 3EMRA 4HSLA 1VAMA 4LTAA 1F15A 3NJZA 4R9CA 1CVNA 2FCUA 4GAZA 4Y5Z0 1C8M3 3MFAA 4FOVA 1UYPA 4URTA 5LATA 1CAUA 3WD5A 1LU1A 5FYBA 3J7NA 3W58A 2ZMNA 3U0ZA 3N4MA 2XG3A 4AI3A 1NA1C 1S2KA 1NQJA 4P00B 2G9FA 1R1ZA 3ZYJB 5FDBA 1RUJ3 1AR72 1TMF2 2HLEA 2RMU2 3NO8A 3VKLA 3AKSA 4CDQA 4IE0A 4CCDA 1QEXA 5JDBA 4FTEA 1G9FA 4IV3B 1H1MA 5IVEA 1IS5A 1UXZA 1OFSA 3C2UA 4FP3A 2RM21 4HOOA 5F5QA 4FBFA 2XJVA 3IMNA 5FLJA 1YWKA 4A2UA 2OYZA 4YVSB 1PNGA 3IDAA 5C33A 1ZREA 1OKQA 3D0SA 3R05A 1OQEA 5FO9B 4G9SB 3DPRB 5JSOA 4XOGA 2G4IA 4KU8A 5FWEA 4E8CA 2E26A 4PF1A 1CAXB 3GZEA 3CZJA 2RJLA 2QZ3A 2W5FA 3Q8CA 2VNVA 4O7XA 2JWPA 3KVAA 3CBNA 2K9ZA 1IS6A 1K12A 3DXUA 3GZTB 4ZXKA 5DDJ1 1JZ4A 2GMEA 2BP6A 2ZX0A 4MHUA 1X8EA 3GXUA 4E8DA 3MW3A 3H8XA 1ZX5A 1OA2A 3B3QE 2ET1A 5FO8B 5EYXA 2GMMA 3VD4A 2QQIA 1RHI2 3VDAA 2Y34A 3ZO0B 4AEDB 2A71A 4YRDA 4C91A 1TNFA 2VZSA 2Y6GA 5FXXA 4LUKA 5EZWA 4CXWA 5JWPA 3RWNA 1BZWA 4ZZ5A 3H0OA 2JICA 3HMYA 1EP0A 5DZFA 3UESA 4DXZA 2Y8KA 2HWE3 1N1VA 2XBO1 2RDSA 4ARXA 2R041 2SBAA 1WGPA 4OVEA 1BVP1 3TEYA 4WZFA 4IE6A 2AC1A 3RYKA 2CYFA 3V0AA 2CNAA 1VMHA 1OFNA 5TSWA 2AH2A 5CKQA 3FC0A 4RQPC 4PBOA 1UPSA 2Z5WA 1WBLA 4NE9A 3HNMA 3OD4A 4JTNA 2AZ5A 2WNUB 3U11A 4XUNA 5GLVA 1OKOA 1PGW2 1W6OB 3IIAA 4WM8B 5I91A 1H9PA 3AFGA 1RUE2 2IVIB 2HKXA 3O5SA 3VDBA 3MLLA 2GC3A 2IXHA 4XE9A 4XHBA 4ES9A 4YSFA 3I3DA 2CDOA 1MZFA 4XCAA 5I93A 3V0BB 2WFPA 1O4YA 2EAAA 4COWA 2JKBA 3BALA 4LKEA 1RITA 4YG6A 4CCKA 3LQCA 4R52A 2CAUA 1POV0 4HZFA 1H8VA 2BFUL 1JU3A 5J98B 2JB8A 2Q1FA 3VDDB 3MICA 3K48A 2VOTA 1SACA 4IV1C 5FZHA 2VNOA 4OI2A 3ZYPA 1BHGA 2DVBA 1KFUL 1SFYA 2MNGA 5G04L 1KJRA 2YBSA 1GQHA 1TME3 2D44A 3AKQA 5FQ0A 2JECA 2Y33A 1I5PA 5D8AB 3WNNA 4XBLA 5FMBA 3ACFA 3LWCA 3NNLA 1C3HA 3WF1A 5FBJA 4FTBA 3KV6A 4C8DA 4CDUA 2FDKA 2IXLA 3I54A 4GH4A 3WF3A 3O0XA 5ABJC 2QQJA 3POFA 3RZLA 1QJU2 1AR71 1LOAA 1OVSA 1TMF1 4P9LA 3ZR6A 1T6BX 4L11A 4QB1A 2G9ZA 2WNVA 1KQRA 5D2AA 1R1A3 1WCQA 1AX1A 1ZZ7A 4H55A 4F7ZA 5LASA 4LA3A 1LESA 3UGHA 2XGXA 4LKFA 3O1SA 1RGSA 2JG9C 1DLCA 3ON7A 5BNPB 5JXJA 4B7EA 1JZ5A 2H0VA 3POBA 4FPKA 2RS13 2WNOA 5FTTC 5HCFA 1UZZA 4OHWA 1DQ1A 5DAWA 1H0BA 3IB3A 1YIPA 3UL2A 2OUHA 4QM9A 3WCRA 1RUF2 5JSRA 1RMU1 1H9WA 3J7LA 1G7YA 3PTRB 1QOTA 3WUCA 3PU3A 5L7OC 2L9LA 5F6KA 2XLAA 5C3PA 3A22A 4ASLA 4QHBA 1XQNA 3S5AA 5CBLA 3B00A 2YYOA 4QX2A 4NIHA 1COV2 3I3QA 2JKXA 4PCRA 5FY8A 2A6VA 3LEIA 2P37A 2PQSA 3WP3A 1MQTA 3TB0A 1RHI1 5BY5A 4NRQA 2R1DA 5H9RA 2Y6JA 1QJX2 2XHKA 2VZ1A 3FZ3A 1Q43A 1W8NA 5CKMA 3BVCA 4E4SA 3AYAA 4X8PA 4ZU7A 3PVNA 5KBFA 2XXZA 1Q56A 5FPXA 4XABA 5H9PA 2D6LX 5KHIA 2VZRA 2DWRA 3ZXFA 4EZ4A 2DCKA 4YARA 2WYFA 5A3MA 2E53A 4FPGA 2YV8A 5JMCA 2W94A 2ZTNA 5LWBA 4CPBD 4YVSA 2W87A 5J36A 4K3UA 5JPNB 5DUWA 4UW6A 1XRUA 5LW9A 4QD2A 3PLQA 1H30A 1UOGA 3DPRA 3AMHA 3WR0A 3UJOA 3ZN6B 3ZXLA 4D69A 1PGW1 2EXIA 2DCYA 4YNIA 1CAXA 1X50A 1OLQA 2K2SA 4ONUA 2A70A 1RUE1 1OH3A 4YW6A 3X29B 2WLPA 1NT0A 1V9U3 2GN3A 5FPAA 2JE9A 4B1LA 3PUHA 4C1XA 5M0TA 3QH7A 2O1QA 1VRH2 3R0RA 4AE2A 4HVOA 3HWJA 3ZFEC 2F4LA 3VZJA 5DN2A 1IKQA 5FYUA 3HBKA 5JOXA 4LNVA 2DCTA 4PDWA 3WINE 4BH9A 1F8VA 4P5HA 1IPJA 2R073 4Q4X3 4N53B 3ZXEA 2WQ8A 2XHNA 2ZX3A 3MFCA 4LKDA 1X33A 4NIIA 1GWKA 4AEDA 4CCJA 4YLZA 3T30A 3VD7A 1CZVA 5HCHA 2KD7A 3A0NA 3LCPA 1EYBA 1SLTA 1W6PA 3FBMA 1UOFA 4XCBA 1AZDA 5FYSA 3T2OA 2Y6KA 3CIHA 1PZ8A 4BA6A 5CB7A 3RJ2X 4WVMA 4E4ZA 1IQDC 4HONA 5F32A 4UBHA 4Y5TA 4KQ7A 5CVRA 3VL8A 2H0BA 4CU7A 2PHWA 5FZ3A 4CP2A 3Q8AA 4Q0VA 1A78A 2VG9A 2WN3A 5C4WA 2HWF3 3FE5A 2A6WA 2RDNA 2W1WA 3AXDA 5FYCA 3NNFA 2ADEA 2XVKA 3UK9A 4KWUA 1LKNA 1QJU1 3Q8EA 3AM2A 3HEIA 3H1WA 4K40A 3I2GA 2R49A 3MI8A 1VBB2 1IPKA 1YQ8A 1W6OA 1DYOA 1S0FA 3ZIXA 4CEWA 1GBGA 3LFIA 3I2DA 2Q1MA 2DVFA 3ZSMA 5IHRA 3ES1A 1ZZ6A 1C8M2 1VMFA 2ZGRA 4UFLA 1FXZA 2HJIA 5F8PA 1UOBA 5IVFA 2VTXJ 2FCVA 1C5IA 1IHMA 4BDVB 2VZ3A 5T52A 4OMDA 2XJUA 2VQUA 1FOD3 1NUKA 2DBNA 1PX4A 2LROA 1RUJ2 3ZFGB 1POQA 2VJXA 5JAXA 1OQDA 1URXA 2YGLA 1RUF1 2ZX1A 5LA2A 5LK5A 4AHYA 5A80A 3BOPA 1I6XA 1NXMA 3ORJA 4NMIA 5CFDB 1G9DA 3OEBA 3VDDA 4BMEA 1S1AA 1KJLA 1A6CA 5T5LA 4B4RA 4BM8A 4Z1VA 3WW3A 1PVC3 3BYWA 2TEPA 3M70A 3CJXA 4IETA 5GZEA 3RI8A 1BLZA 3SC7X 3UT0A 1QDCA 1PZ9A 2R043 2DUQA 2EXJA 4LA2A 4CUCA 1O3QA 3ZFFB 1EV13 3VBHA 3NVCA 4IW3A 2QDRA 4IEYA 4NWWA 1GOGA 3CMGA 4DZGA 2QBXA 4KMQA 2SLIA 4JGYB 4EQVA 4EWEA 3P3NA 4LULA 4PLMA 1QJX1 1OC1A 2I2SA 3PMSA 2PTMA 4E2QA 3K4DA 4DIQA 2DCJA 3WG2A 5J3UA 5JUVA 4ZZ8A 1X9TA 5SV8A 1C28A 3FLPA 4N43B 2K0GA 3G7DA 1NLQA 1OHFA 1OLMA 3ZMOA 2WO7A 2IXKA 1LB2A 1JW6A 4COUA 4RHV3 2VZUA 3HR9A 1C57A 1KGYA 4E27A 5BNPA 4LT5A 3HNYM 2B9UA 1AR82 1CPMA 4CXXA 4GWIA 5FWJA 4CCNA 4CDUC 5E6HA 2WZPP 2TUNA 2ZGUA 4OFGA 3U10A 3LB9A 1N47A 4MGZE 1WLTA 3N9NA 4UWDA 4I02A 5FPUA 1FNYA 2HWE2 3PUSA 2WNVC 2D93A 2FDIA 2ORZA 3OJBA 2D6NA 2D40A 2EXHA 2YC0A 1TZOA 3C8XA 4K8RB 1GQPA 1HV1A 4JGZA 4JKMA 1W9TA 2Y60A 3I2KA 4M4RA 4KH9A 2X53S 3NNMA 3RGBA 1UW8A 4E9KA 3S57A 4P9JA 2FQPA 3NKGA 3VZKA 2GP3A 2XJQA 3NL1A 3MGUA 5IVYA 4A4AA 4XAAA 1BBT3 2WT0A 3POJA 4F8AA 2VC9A 5FMOL 1RUH2 2RMU3 4LO7A 2V5DA 1OLRA 2AUYA 3ES4A
chains in the Genus database with same CATH topology
4E2GA 3GBWA 4UXAA 4B8EA 4TLFA 1YXWA 4L97A 4CDWA 5E16A 3CF6E 4Z2WA 2HEVF 3JD73 3R4SA 4FAHA 2IZWA 2ZPXA 3NKTA 4JV4A 4MUVA 2E51A 1MQTC 4Q27A 4QPYA 1YYNA 1UIKA 1IGOA 4BYYA 2UYAA 1FPN3 4XBNA 1LTEA 3RI9A 1NYWA 2ZZJA 1VBB1 2PA7A 3E5QA 1C1FA 4QPIB 3ROUA 2UY9A 1ND3B 3ZXJA 4A7KA 4CDXB 1LGCA 3AP4A 4GMP0 3RYPA 1TME2 3AK0A 1NLRA 3VZOA 3U4XA 1J1LA 1LOFA 1C8M1 5BV6A 2TBVA 3W59A 1SLLA 1MVEA 1BKZA 2VUJA 2C0ZA 4FAGA 1TE1B 3ZYGA 5LRSA 4Q0SA 5A32B 1RUJ1 5J7MA 2O8OA 4XJZA 4N53A 5JVVA 1XNBA 2IXJA 2QUOA 2Z42A 1ALYA 2HEYF 2ZJCA 3VBRA 3AZXA 1R1A2 1PNFA 1SBFA 3J4UH 2YY1A 1UCXA 2MEV3 3B69A 5CG8A 5GZCA 3POWA 3PTYA 2RS12 4LBQA 3LOBA 1NG0A 4B3NA 1WW4A 1DGRN 4SBVA 1O4ZA 2NM1A 4PDWC 1FYUA 4DFSA 1W39A 3H1MA 3ZPYA 4UW4A 3WP6A 2CGPA 2OZ6A 3WHUA 1QOOA 3M3OA 2JJ6A 2PYTA 2VNRA 4IEOA 3VBOA 2BNNA 2ETEA 4CP0A 2RE9A 1RUE3 1C4RA 4WZCA 1DGLA 3JQXA 1ZNPA 2A6ZA 4I3GA 1WW7A 3VHOA 4P14A 1AVBA 4HKOA 4J6GA 1U5ZA 2WINB 1CJDA 4GKXA 2DF7A 2GN7A 1O3TA 1Q8VA 5C4WC 3NSTA 4EWAA 1RB8G 3ZFGA 4CEYC 2YPJA 3KQRA 3ENRA 1WCSA 2HWE1 4ISQA 1SMVA 2A6XA 3ZMNA 4CEWC 3Q9OA 2VW0A 1DQ0A 1N3OA 2BGCA 3MIGA 4FO9A 1OQ1A 4N7UA 3O7OA 5FREA 1QHDA 2R062 3ZFFA 3NWKA 4QXKA 1GZCA 2UYBA 1VIWB 2P17A 2E7AA 5EWSA 4LO6B 4Q26A 4XQWA 2ATFA 3DL3A 1UAIA 1DQ5A 3JUUA 2PELA 1V70A 2QDNA 4B4PA 2BNMA 1XYPA 4N43A 3PMEA 1PGSA 3AMPA 2VOWA 2BFUS 3VBHC 2R072 1G6NA 2XJSA 2E7QA 3AP9A 4B7KA 1QXJA 3LAGA 3VUOA 1W6QA 5KXEA 1Z0HA 3ZSEA 3M7AA 4OULA 1S0DA 5JPMB 1QF3A 1A8MA 2XLGA 5KWRA 1N1SA 4R9DA 4EN6B 2N7GA 3CEWA 1TME1 4NHLA 3KCXA 1COV3 5KHKA 1NXD1 1ULFA 1CN1A 1LCLA 3H9AA 1DF0A 1VJ2A 1OOPB 3H7JA 4Q0PA 1O7FA 2HWF2 1DQ4A 1RJ8A 2I07B 4FOWA 5I0TA 1O4TA 1HQLA 3NV2A 1QJX3 4YW4A 1F9KA 2R16A 4NVPA 1R1A1 4RS5C 2AREA 2PHUA 4Y20B 3APBA 4XMAA 2BTVC 4GQ7A 1BJQA 4JGZC 2RS11 4Y24A 2E9QA 4RR3A 4BOWA 4DMIA 5DZEA 1FOD2 5C9AB 2Q4SA 1GZWA 1NCRC 3SH4A 4P9WA 4Q1PA 2LUWA 2GMPA 4HBNA 4OHVA 1RIRA 1YJLA 4C90A 3ZXDA 1QXPA 2DU0A 1U12A 1KITA 2GALA 2JG8C 1XU1A 2WWSA 3EBRA 1PVC2 4LHLA 3FUQA 5IK4A 5FAXA 3MF9A 5K9YA 3WW1A 1ND3A 1NQDA 4J1WA 4QQPA 4CDWC 2PLV2 1D4M2 1EV12 4WM7C 1VRH3 4A7YA 3E5XA 4R9AA 5JZGA 2BUKA 4EJRA 5DG2A 1U5IA 1UU6A 1VALA 3VBFC 1RUNA 2D6PA 5E8AA 4XTPA 3DKWA 1J3QA 2DTYA 3ZN5A 3CU7A 4ZKTB 3GBGA 1IOAA 1PZ7A 1PK6C 3J8F2 5H9QA 3ZSJA 5CFCA 4PLNA 4PQ9A 1YFWA 3MLKA 3MYXA 4XJUA 4LBKA 1AR63 1SLIA 4RHV2 1LOFC 4Q4V3 1Q8QA 2UWCA 1NY72 2DYCA 2EF6A 4Q4Y3 1UKGA 2NQYA 4IQPA 4XYXA 5E1RA 3AMQA 4W65A 5K8SA 4NHMA 4N7IA 1NLSA 4MGIE 3CJIC 4D94A 2VW1A 4AVCA 3JBG3 3TYJA 3VBRC 4YZ4A 5GLWA 3USUB 4FQZA 1QDOA 1VBA3 2GNDA 2Q5TA 2ZGQA 3AX4A 2BPA2 3O0VA 2UURA 1QJY3 5FRAA 2WC2A 1F5JA 1AUYA 2R071 4Q4X1 4NPRA 1B09A 1BBT2 1PM7A 2JENA 2OW4A 2XJRA 3O0WA 4Y4YA 1VAVA 4BCUA 1C5HA 3HT1A 1UF2C 4RGGA 5FLHA 1O91A 1SBDA 3VBOC 2XPJA 4RA0A 3MPPG 3WQ1A 1RJ7A 2NYYA 3JD72 3WW2A 2CV6A 4ASMB 5I0UA 3VBUA 3FHIB 4QQLA 2HWF1 4PF5A 1K5MA 2GAUA 4DB5A 5JR7B 1FPN2 4AQSA 4N9HA 5K0UC 4D7YA 5JCTA 1CAVA 4HMZA 1OPMA 4UW3A 2RR13 3LA3A 4I0BA 4FPOB 3TBDA 3MIDA 3WX5A 3THTA 2GDFA 2ZX4A 4XFCA 4U36A 1PIV3 1T6GC 3HIFA 1FOD1 1Y7BA 3KLSA 5FFOC 5KC5A 3R4DB 1AR83 5DZGA 1FT9A 4KWJA 1WD4A 2DTWA 4QMAA 3E6BA 4AVBA 4YM2A 2B46X 4MV2A 1PVC1 1WUVA 3LSDA 3GHNA 2MEV2 4Y22B 2JDZA 3LOIA 1WW6A 1D2QA 4AVTA 4YFWA 3FUOA 3WP4A 2QQPA 1GYKA 4WVZA 1DDLA 1J1TA 3FJSA 1EV11 1CQ9A 2RS53 1S0IA 4OHXA 1MS3A 2MHFA 4K8FA 1WA4A 5AFBA 1YI7A 3TN93 1XNCA 3KT4A 1WMEA 4JRAA 1MS4A 4NR1A 4META 2DVDA 1RUH3 2OUJA 3RYRA 5FOBB 3C3VA 1XU2A 4MH0E 3VBSB 1OI6A 5DUVA 2VVDA 3M3QA 1ENRA 3VKOA 4RHV1 2H6BA 1AJOA 1H8TC 1SLAA 1UL9A 3D6EA 1NY71 4UW5A 2EALA 1V6JA 2DURA 1BYHA 3G6JB 4XFIA 4AEKA 5T5PA 5C9AA 3GZAA 1ND2A 2X5IB 3N7MA 4R4ZA 1WW5A 3BCWA 4QQ2A 2YDEA 2F6BA 2GNMA 4FSJA 1ZRRA 4RL7A 4E4DX 4L2NA 4Q0QA 1D0HA 4M0HA 4KU7A 4RR3C 1DQ2A 1HIXA 1XNDA 5FMOS 1BBT1 4KG0A 3OD0A 4F83A 2RMU1 4S2FA 4Q1RA 4YVWA 3OY8A 4HFSA 3D4KA 4YYOA 1IKPA 5AFEA 1ND3C 1H4HA 1REEA 1BK1A 3JD71 1JUHA 3LA7A 1DGRA 3V65A 4K1YA 5BNNB 1KRIA 5JZGC 2VQAA 4DQAA 5I0SA 3M3IA 1J59A 4XQ4A 3SHRA 4U2AA 2B39A 4XIKA 1FPN1 3ZSKA 5GLTA 3RG0A 2C1FA 3I8TA 2O0OA 4AQ6A 3AYCA 1AL0G 3AB0A 4HKLA 1DZQA 3GZUC 4LO5B 3T1MA 2FZ2A 5CFCC 1M4WA 1DFQA 2E63A 1BCXA 5AC93 2A3XA 2A3YA 2BYVE 4AI0A 4IEQA 2BBVA 4KGGA 4L92A 2WKKA 4BWOA 4KNCA 3WT3A 3D8CA 3VHRA 4Q8KA 4ZU4A 1KD7A 1B35C 1V6MA 5JIAA 1QGLA 3WW4A 2MEV1 4GIQA 4IV3A 4L99A 3VZLA 1WLWA 1OA4A 3NAPB 3IN9A 4MGYE 4PJYA 4HK9A 4IEPA 5GM0A 2OPKA 3WY6A 2R063 2D3PA 3K51A 2ERFA 1FV2A 1RUC2 2IFRA 3AP5A 4KWKA 4AG4A 4W6WA 3VGIA 4CDQC 2LM3A 4M3CB 2Y0IA 2ZHMA 3MF6A 2W08A 5JSPA 4D3WA 3A4UA 1ZYBA 1AR93 3L2HA 4GKYA 3OGJA 3U07A 2VOVA 3DN7A 2D97A 4XHXA 4Y1ZA 3VBUC 4AHZA 5J48A 5BNOB 1K5MC 4K20A 5I8TA 4XF3A 1CX4A 3NV4A 3IWZA 4Z07A 4JCKA 3CO2A 2VXRA 1V00A 1CONA 4X6QB 4QPGB 1QXRA 2GH8A 2Y26A 2IC1A 2WT2A 4EN8B 3MFAA 1AR62 2VGDA 3KB5A 1GSLA 1NCQB 1POV1 4XFBA 2JX9A 4Q4V2 1AYN3 4D7SA 4MXWB 1S0GA 2YROA 2QJVA 2HWB3 1BEV2 4Q4Y2 1DZTA 1GNHA 1W0OA 4MZUA 4K6BA 2Q1ZB 2GSYA 3BPZA 4TZDA 4Q2FA 1G86A 1PO13 1DBNA 3JBG2 2WNUA 1GLHA 4NOTA 4FPFA 1H1IA 3I59B 1RVF2 1VBA2 4WM8A 4AFBA 3CL1A 4FXKB 3ASIA 4XFFA 1QJY2 4HSJA 3V0BA 3QBQA 1NA1B 4BIFA 1UKRA 2EAKA 3WG4A 2FZ1A 1S2BA 5EFUA 4L9BA 4AGRA 4DINB 4ES8A 2XVGA 1ZZ9A 4HN1A 1X36A 1VB2A 1G9AA 1DZRA 3KD4A 4CYDA 2BWCA 3INAA 5DXDA 5F6LB 3GF6A 2X5IA 1MS9A 4LR4A 2B7YA 3EO6A 4IEWA 2EVXA 1YI9A 3AZZA 5LEKA 4IL7A 3H50A 1COV1 2QFEA 4EV0A 1RC6A 3R6SA 3ZSLA 2PLV3 4G4FA 1D4M3 2P2KA 4HPKB 3WVJA 4ISRA 4YZ3A 5D8AA 4B29A 4Y1UA 2DFBA 1ND2C 1D0GA 4XEZA 3WV6A 2RR12 1G8WA 4M3CF 3J8F3 1ASJ2 3OYWB 3ELNA 2D3SA 3AKTA 1GKBA 4MX3A 2QKDA 4IEUA 4YM0A 1CD3G 3ZN4A 1ZBE3 1PIV2 1V6LA 4LO8A 3E6CC 2VECA 3IM0A 1D2SA 1FMD3 5IT6A 5BNNA 1Z7S3 3ME2A 1VBC2 4GH4C 1RUC1 4IEVA 3WXPA 1ZZBA 1DYKA 2ZGKA 2NN8A 1GFF2 2D6KA 2HWC2 4YVWC 1JYIA 3PVBB 2ZHLA 4O9GA 4COYA 4XJWA 2YUEA 1EAH3 3JB8A 2WFF2 2XKPA 5A33B 1MS1A 4XFAA 5B2GB 1RUD3 1VRH1 1R093 2RS52 4FOQA 4RQPB 3AKPA 2CL2A 3LSEA 2NMNA 1R083 2VVFA 3MPBA 3NW4A 1ENSA 1JUIA 2R0HA 3TN92 1ZZ8A 3WG3A 1ULGA 3WNXA 1LOGA 1AYM3 2C5DA 2VVEA 3CNAA 1UN1A 5SV5A 1J3RA 1W6MB 4J1XA 1OA3A 1YRZA 2FBEA 3JU9A 4QM8A 1AR61 3MIEA 4AFDA 4MGKE 4NO4A 4Q4V1 1W6NB 5FCCA 2AYHA 1HW5A 1VAKA 2GZWA 4BIOA 4I2OA 1BEV1 3POSA 4Q4Y1 4IV1B 4XTMA 3PNAA 3ILRA 2XKOA 3AKRA 2ARXA 3JBG1 4B4QA 2A7AA 1ENQA 3ZN6A 3POYA 1BXHA 1VBA1 1VBE2 4OZXA 4M3CA 4IV3C 1G9CA 4KWLA 2RS32 2VH9A 1QJY1 2KM2A 1H4GA 4Q29A 1LENA 3M1HA 5ABJB 4H14A 1AJKA 2ZMLA 3AMNA 5FLIA 1WD3A 3FFZA 4YVSC 1PO23 3DF0A 1SLCA 3KCYA 4FPHA 1GICA 5BNOA 3DPRC 3LGRA 3LZZA 3QACA 2ZKLA 5T54A 2JG9B 1NE6A 4LBJA 4LE3A 5BUVA 2FMYA 5E89A 2RHPA 3O12A 4QPGA 4E2SA 4H7MA 3H7YA 4MLOA 3BB6A 3KS7A 5L73A 1KFXL 1OPOA 4QT6A 4AYUA 3AMMA 5L7OB 4XMIA 1A8DA 4GALA 1KXGA 5C8CA 4AEDC 1N3QA 2YMZA 4YGBA 3VKFC 4Y26A 1A3KA 2RR11 1TEIA 1LHVA 1PGL2 5AC92 3IDEA 3I59A 2XL7A 2CAVA 1S0JA 1QOSA 1WMFA 1YFXA 1PIV1 4OI1A 2X29A 1DU3D 1AR81 1H2NA 3NV1A 3B9IA 1VBC1 3B02A 2WJSA 3UKNA 4AVSA 4Q8LA 4OI4A 1HXS3 2WNUC 1FNZA 5CFDA 2P3JA 2NPIA 3GHMA 4WM8C 1Z78A 3GALA 5F1RA 5JOYA 5L36A 4YW2A 2BEOA 2ZA9A 1CAUB 4W6YA 2RS51 1POV3 1UMZA 5T55A 4LO4B 4XBQA 1QWRA 3TN91 3N7JA 2VUAA 4YZ1A 4JGYA 4X6RB 2ZKNA 1HQWA 2D43A 5EJ3A 1O5LA 1RUH1 2ZHKA 4UBGA 4Y1XA 4XIOA 4YM3A 3VDDC 3RDIA 1HDKA 1SQ4A 4S2DA 5JIUA 3QCWA 1HX6A 3ZFEB 2ZBJA 5BXXA 2ZAAA 4LBMA 2PHLA 1G9BA 1AR92 4XF9A 2I45A 4XQDA 5F9TA 1UU5A 4K21A 4HLTA 5HXVA 3URFA 3OPZA 4RFT0 1N1YA 2VW2A 3RS6A 5D8AC 2ARBA 5BPXA 4YG0A 3SH3A 2GC1A 4K1ZA 2YZ4A 4GXLA 1O3SA 1VBE1 1N3PA 5EYYA 1AYN2 3SCGA 2GC0A 2HWB2 2HWD3 1YUDA 1SBEA 4RQPA 2E6VA 2B5HA 4LEJA 1SFNA 5BNPC 4DY3A 3AYDA 2WS93 1JTZX 1LGNA 1PO12 4FPEA 3RZZA 1AHSA 1O5UA 5JOZA 2PHRA 4GMP1 2HEWF 5JI7A 3OBTA 1BQPA 1W2UA 4IESA 1LHOA 1CPNA 4I0WB 3IDCB 4ITCA 3I7DA 3UV9A 3V0AB 4M01A 2Y0OA 5CNAA 1I5ZA 1QH6A 2VMGA 1WLCA 3KM5A 5LRRA 1HRI2 1W6NA 4QQHA 4XXAA 1BMV2 4L8QA 3WCSA 4P9YA 4HANA 2IXIA 4XILA 2LALA 1RUC3 1QNWA 4SLIA 5FO7B 1U5YA 4QPIA 1YFYA 5BYNA 1PGL1 5AC91 3QOPA 4CDXA 1QNYA 3THPA 3OCPA 1DGWX 4FPYA 3ZXGA 3UJQA 4IEZA 3TNQA 5KC6A 1EPZA 3JB4C 4AF9A 1M06G 5CU1A 1YLLA 3MIHA 1AL22 3V56A 3OF1A 4YFZA 4QGLA 5A32A 3EHKA 4MVTA 1YHFA 2ZGPA 1ULDA 1YNAA 4FCAA 2UWBA 4GWNA 3N3HA 5FQ0B 1HV0A 4JDOA 4OHYA 2JG9A 1ZBE2 4R4XA 1RUG3 4LHNA 4CDUB 2P3IA 2GNBA 3QH6A 1FMD2 3S7EA 1Z7S2 1BEV3 2R061 4JVAA 2PAKA 1HKDA 3PVOA 1S0BA 3M3EA 4ATFA 4N53C 1MVQA 1ZVFA 3ZYIB 1EAH2 4AI2A 2A73B 5E88A 3WG1A 1RINA 3FLTA 1RVF3 2WIIB 2ENRA 2ZGOA 1RUD2 2D5FA 1R092 2D5HA 5IK5A 1AR91 2P3KA 4M00A 3H1YA 1R082 3CLPA 1FI2A 4CP1A 3FWEA 5H9SA 4YGCA 1AYM2 3M8LA 2F4PA 4HN0A 5C8CC 3HD8B 2XB6C 3D5OA 1XXNA 2VOXA 3M3CA 4HK8A 2ZHNA 1F2NA 4Z8BA 2V73A 2XH6A 3IKWA 5GZGA 5IK8A 4XJ8A 1PVXA 1AYN1 3RRDA 2DV9A 3RJRA 1MQTB 1OD5A 2HWB1 5IUQA 2R6QA 3VKNA 2ZCWA 1PO11 5LK7B 1GZ9A 3ZXKA 2OZJA 1Y3TA 3DUIA 5DG1A 3ZFGC 1H2LA 4BE3A 4EROA 1ZBA2 3LA2A 2XVLA 1WLDA 3AP7A 3MLJA 5CFDC 1ASJ3 3ZFEA 4BMBA 4DS0A 2R30A 3B9CA 1HRI1 4PIXA 1EY2A 1QQP3 1PO22 5CAZA 2VULA 1BMV1 1LHUA 3ZFFC 4W6XA 4I3PA 5HCAA 2OVUA 1RMU2 4JGYC 1C1LA 1VBC3 1MS0A 2EIGA 2HWC3 1QY4A 1QMJA 1VLNA 1WBFA 2D7FA 5GLZA 3ST7A 5T5OA 4P9XA 2WFF3 4AEMA 1CR7A 1LR5A 2PLV1 4LE4A 1D4M1 4I0AA 4PDWB 4N43C 1GANA 3HN1A 2OA2A 4GA9A 3L9JT 1ENXA 1OOPA 1Y9QA 2ILMA 1AL21 1I1EA 4AFAA 1J58A 1W6PB 2WA4A 3H3ZA 4QU2A 2WZR3 2PHFA 3IDBB 3ZVXA 3WDVA 3J8F1 4WVMB 1XE7A 1BVVA 4JAAA 4TYSA 4Y20A 3ATGA 2ZZQA 1HRV3 2HYKA 1ZBE1 2PHXA 1LEMA 1MEC3 3IT8A 4Y1VA 3VHPA 5C4WB 3DGTA 4AK3A 1FMD1 3AZVA 3B94A 1Z7S1 2FHRA 4P9IA 4CEYB 4IERA 3TAYA 4ATEA 5K7PA 4AHXA 2D98A 1RUI2 4LHKA 1HXS2 1XYNA 2UY8A 4CEWB 4EN0A 1VP6A 4AVVA 3UKVA 2DFCA 1EAH1 4CZSA 2UWAA 1RUD1 1VBE3 1OMIA 1R091 2RJKA 4KGQA 2RS33 1KS5A 1DGWA 1R081 3VLBB 4PIYA 5JOWA 1YIFA 2YHJA 5IK7A 2JE7A 1EPWA 4MSVA 4YG3A 1AYM1 4AGVA 2ES3A 3N36A 1AXYA 4AW7A 4AFCA 1VB4A 3V64A 3WQ0A 4INDA 5T3NA 4GMP3 3IPVB 1ZM1A 3VV1A 4QPIC 3FBYA 4FP2A 2VU9A 3VBHB 4FPLA 4CDXC 1V6OA 4LBNA 2VOKA 1JH5A 4ORFA 2ZOEB 4XXPA 4Z82A 3WUDA 3ILNA 1LOBA 2WL1A 4JDMA 3MZHA 2H6CA 1UU4A 4C0HA 1KDKA 4HL0A 3UKTA 2PN5A 1ZBA1 1CAWB 5GJ6A 2E7TA 3USUA 4Q4W3 2WT1A 4H7LA 3MDPA 2HWD2 4GB33 2CY6A 2Y38A 4FT8A 1YJKA 2WS92 1PO21 2XWJB 1UZYA 4LBQD 1RL3A 4KL1A 1U0AA 4RS5B 3VHNA 3BTAA 2PAEA 4FVVA 2ZGSA 1Q3EA 4YGDA 1GNZA 1X8MA 1GR3A 4AFMA 3KSCA 2W39A 3D0JA 1TNRA 4JGZB 3WDUA 3KCCA 4GWMA 3AZWA 5KHHA 4BLJA 1VBD3 4XFGA 4DPNA 1NCRB 3ZXAC 2NZ9A 3P3PA 4BQ1A 5T50A 5ACA3 4MYEA 4AGGA 4HVQA 1I3HA 1ZRDA 2JG8B 1APNA 4IEXA 4XW3A 3HAGA 2XJPA 4WBBA 1JYCA 2B45X 3VN4A 2ZMKA 3WHTA 3EJKA 1IS3A 4OHZA 4CDWB 4WM7B 1REFA 1LODA 5A3LA 1KDMA 2O8QA 4RSUA 1CIWA 3T1LA 4COZA 4LLFA 3EQEA 3VBFB 5J09A 3ALQA 5BNQA 3PHMA 1FATA 2WSVA 2ZAHA 4PLOA 1LRHA 1PK6B 2R1BA 2GH2A 5J37A 1SCRA 1RUOA 1RUI1 1HXS1 2Z2SB 3B93A 2C9AA 2NMOA 1S55A 1IS4A 2ZGNA 1RTVA 5C6CA 2PHTA 3PVEA 1LHWA 2EA7A 2ZS6B 1MS5A 4FPCA 3WDXA 4Y22A 2IXCA 5FBZA 1RUG2 2QZ2A 4MXVA 3B5LB 2BW8A 2BVVA 1X82A 3CJIB 5FPZA 2ZGTA 1DQ6A 3KZ4C 4XF4A 4IXLA 1Q8OA 4Y1YA 1SLBA 3NV3A 3VBRB 3FX3A 3VL9A 3BODA 1LHNA 1JBCA 3ZDSA 1Y43B 1F31A 1ZZCA 4FOYA 3AP6A 4AI8A 3TNPB 2RM23 4LLOA 4LBQB 3RMXA 3VBSA 4NN0A 3WDWA 2WSUA 1DG6A 4BHPA 3MIFA 1HRI3 4AWDA 4X8NA 3E5UA 1OOPC 3TRSB 3VBOB 3ZX7A 1E57A 5FOJB 3D82A 5HI0A 3WQ7A 2A6YA 1GQGA 2ZACA 4XF0A 1NOVA 4FTSA 4GULA 5DDJ3 1LOCA 1FV3A 1NZCA 1UD1A 4XJ9A 4OI0A 4YW1A 2HWD1 4LBOA 2GU9A 2P34A 3B01A 4YM1A 2CWMA 5D1IA 5K0UB 2WS91 3A0KA 3H8UA 4I30A 5C9AC 5KHGA 2BNOA 1AL23 3N35A 4M0NA 2VMHA 3RPQA 2V5YA 2DVGA 2CTVA 4RD7A 2XBO3 3IPVA 1YCIA 5CIRA 3BOWA 3R4UA 4HVRA 1ONAA 5I8SA 2QVSB 2FMDA 3USSA 2WA3A 4O9EA 3VZNA 1QQP2 3JCIA 1ULCA 4KBBA 2NP0A 1V6IA 2D6OX 2B8MA 1H2KA 2IWGB 5AVAA 4N9IA 1QKQA 5GKAC 1IQAA 2GC2A 1AXZA 2VNGA 2VPVA 4JRLA 1U5XA 1AX2A 1CAWA 1UX6A 4KG8A 2VQ0A 3WOGA 4NHKA 5T5JA 1V6KA 4XPVA 2WQ4A 3S6PA 5I8YA 2DCZA 1W6QB 2G9GA 4OLLA 4D7TA 3J26N 4OUSA 1I9RA 4G3YC 2WZR2 2BVBA 4RS5A 4WV8A 3SNMA 2EXKA 1Q5OA 1SDWA 1FAYA 3SMHA 3SISA 5EV7A 1J3PA 3MEPA 1HRV2 3AZYA 1H8TB 1Q8SA 4JTOA 5CA6A 1ULEA 1MEC2 1RUG1 1L3JA 3OGGA 3NAPA 1LJ7A 3KGLA 1NCRA 5C8WA 4LBLA 1JN2P 4XJAA 4TSVA 2DU1A 5J96B 2XL9A 3HBZA 3J9SA 2JD4A 2JG8A 2XLFA 2Q8OA 3S0MA 1XNKA 1CJPA 3FFQA 4QGNA 1AR73 1C8NA 1TMF3 2XUMA 2LTNA 1AF9A 1JXNA 2BQPA 2XWBB 1RVF1 1ZBA3 2ET7A 3ILFA 2OIIA 1MZEA 4RR3B 4WM7A 2AENA 3E6DA 3S7IA 1GZWB 2QE3A 3W9AA 5KXCA 3PJQA 2W0XA 4K9SA 3VBFA 3GNEA 3N7LA 2XJTA 4AHWA 1ZA4A 1RMU3 4EN7B 2IFWA 1KS4A 1PK6A 2R32A 4P9GA 5DUUA 2B42B 2W68A 1WCKA 4YW3A 4I09A 3O14A 1HQNA 1LEDA 4QGMA 2VY0A 4XETA 3ZIWA 2KA3A 1CESA 5JZGB 1V6NA 1NCQA 2ZGLA 4COVA 2VMIA 4MXWA 3H3UA 1RHI3 4HETA 1SCSA 2MPFA 3CJIA 5GZDA 4WVVA 1LGBA 3I4IA 1S0EA 5CFCB 1QH7A 4JQRA 4H3WA 4Q4W2 3WZ1A 5I0RA 1ASJ1 1JHNA 4GB32 4LUMA 5LEJA 4CRQA 3T2TA 1WCDJ 1XE8A 2ZABA 1FX5A 4S2HA 3WDYA 2A3WA 1QQP1 1YO8A 2DUOA 1B35B 1NA1A 3MW2A 3S30A 4YZ5A 3ZYRA 1DHKB 1S0CA 1AXKA 3GBFA 2JEMA 4CTEA 4FPJA 1HLCA 3OTFA 2ZGMA 1DLLA 3AFKA 1RUI3 2HWC1 2R0FA 2PQQA 4AQ2A 5HBAA 2I74A 2WFF1 3E97A 4AEJA 1VBD2 1LULA 4Z92B 3SH5A 1Q8PA 4S2GA 3SCHA 3SITA 5JLVA 3TOJA 3DV8A 2NLRA 3VBSC 5ACA2 4XFHA 4BPZA 4F3JA 4HPKA 2CGNA 5KXBA 1LOEA 4CDQB 4R9BA 1JOJA 2A5ZA 5K0UA 1AX0A 4YZ2A 4EWDA 1H2MA 1UPIA 2WZR1 4I01A 2QNKA 3FMGA 3VZMA 3AJZA