4EN0A

Crystal structure of light
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
145
Chain Sequence
NPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 14
total genus 27
structure length 145
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4en0A00
1PK6C 4KGQA 5L36A 4EN0A 2WNUA 2R32A 2TNFA 1WCKA 2JG8B 4TWTA 2WNVC 2KA3A 1XU1A 4KG8A 2RJKA 3K51A 5TSWA 5HBAA 2ZJCA 3K48A 2WNVB 2WNUC 1S55A 2O0OA 3ALQA 2X29A 1D4VB 4NN0A 4TSVA 3WD5A 4MSVA 2HEYF 2R6QA 3IT8A 5KC5A 2WNUB 3V56A 4G3YC 1A8MA 4RSUA 3B94A 5KWRA 1U5ZA 1I9RA 3B93A 3TYJA 2ZPXA 1DG6A 1DU3D 4G4FA 4DB5A 4QQPA 1TNRA 2HEVF 4OUMA 2JG9A 3AB0A 4OULA 2RE9A 2Z5WA 3QBQA 1ALYA 3QD6A 2Q1MA 3ME2A 4KGGA 5L19A 5CIRA 2OIIA 2JG9B 2Q8OA 4D7YA 1RJ8A 1GR3A 2AZ5A 1KD7A 1PK6B 1U5XA 3FC0A 4GIQA 2JG8A 4DOUA 5BNQA 2RJLA 3L9JT 1TNFA 4E4DX 4F3JA 4MXWA 2E7AA 4MXVA 2WNVA 4OUSA 2HEWF 4QQOA 1D2QA 3LKJA 4N90A 1U5YA 2TUNA 4MXWB 3B9IA 1RJ7A 1D0GA 2JG8C 1OQDA 1O91A 4QQ2A 2QE3A 4HT1T 4QQHA 3MI8A 3URFA 1OSGA 1KXGA 1XU2A 1PK6A 1IQAA 3TWIA 1C3HA 4J6GA 1JTZX 5KC6A 4E4SA 1JH5A 1C28A 1OQEA 4QPYA 4QQLA 2QDNA 2JG9C 2R30A
chains in the Genus database with same CATH superfamily
1APNA 1PM4A 3LE0A 5FY0A 1Q8OA 1DQ2A 4FOQA 5L36A 5F2SA 1KEXA 2VMFA 1MACA 3MW4A 3VZKA 2VOWA 3IIAA 1YFWA 1UOGA 3A7QA 3ACGA 3FHAA 3EB7A 3G6JB 3MDPA 2PHFA 3PLQA 2D7FA 1RUC3 3NJVA 3U78A 4AI0A 4AQ2A 3BUCA 2E51A 4WV8A 2PHRA 2GNDA 4K8FA 5E16A 5BPXA 3S7IA 2ORZA 1JU4A 3C7EA 1YEWA 3U14A 1V00A 2WNUC 2QQPA 3I2JA 4FPLA 2OZJA 4GWJA 2TEPA 2BRTA 1DLCA 4XHXA 3C3VA 3MV01 1FPN2 4BXSV 3OY8A 3V56A 1Q43A 2GMMA 3GBWA 3IMNA 4Q4Y3 3ZYGA 2I74A 1LOEA 4YW6A 1O3QA 1SFNA 1QNWA 4EN6B 2G9GA 2E7TA 4FPFA 4AI1A 2OA2A 1VBD1 3JZVA 3TBDA 5A3UA 4QGMA 2DCZA 4YGEA 1PX4A 1AR91 4GKYA 1KJRA 2JEMA 2J22A 5IFPA 5FZIA 1WW6A 2AEYA 2DWRA 4UW3A 2HWD3 1WUVA 1ZZBA 3JD72 1LHVA 4QB6A 2GH8A 4PIYA 4JGZB 4LO6B 2Y6JA 5FP9A 1GBGA 3P1IA 2WWJA 4RHV3 5FBZA 1HRV3 3VUOA 2DCJA 3T30A 4D69A 4DNYA 4GB33 4KQ7A 3MLKA 2CY6A 4XABA 3QD6A 4JRLA 1I6XA 3IB3A 4BISA 4RS5C 1GMMA 1POV3 5I8TA 4Q26A 5A1FA 5A70A 1MEC3 3CBNA 1RUH2 2Y6FA 2ZGKA 3SMHA 3UKNA 4HXCA 2NP0A 1AR83 2Z4FA 4XF9A 2Q8OA 2KD7A 2XHKA 1RJ8A 2J1TA 1D4M1 1TQ5A 4J25A 4LK6A 2UU8A 2AZ5A 5FZOA 4HSJA 3T08A 1UZYA 2Z69A 1ND2C 1B35B 1DYKA 3THDA 1NG0A 2RJLA 5BNPC 3ZYPA 2WNOA 3K75B 1PMIA 4GWIA 1TNFA 4A41A 4AQSA 1DGRA 1XOYA 5LK5A 4MZUA 2GC0A 3BN6A 3H8UA 2EXHA 2VOKA 4HLTA 4IETA 4ZXKA 2ET1A 1SMVA 1AR61 2GNBA 3WLUA 4HG6B 1QQP3 4LIVA 4R9AA 5FP3A 3I4IA 3BOPA 1UAIA 2IXIA 2WDBA 3KQRA 3SITA 1OT5A 1UY0A 3WF0A 5F5QA 1OH4A 3LQCA 1LULA 4XZPA 3NNLA 4CXWA 3O1OA 2QQLA 5CNAA 3SLIA 2VAUA 4AI8A 5A3WA 4XOGA 3ZXFA 4QKDA 3LGRA 5CZKA 4CXXA 5H9SA 4JGYA 1ASJ2 2XOMA 4JQTA 1IQAA 1LTEA 4NOTA 4AEDB 3VDDC 1XNDA 3K4AA 1ODNA 2RVAA 4GWNA 4AE2A 3FN9A 4PQ9A 5CBLA 4D7TA 2JDPA 1ULEA 4BIOA 3J26N 3VGIA 3E6DA 2VNRA 2D3RA 4KWUA 4CEYC 2A3WA 2X5IC 3FUQA 3HQRA 3KHCA 5T50A 1UXXX 3AJYA 4Q4W3 4FT8A 2ZGLA 4YRDA 5D8AC 5F1RA 5JZGC 2WO2A 4LBQA 2KR2A 4B1LA 3HIFA 1DHKB 1WCDJ 4GULA 4GJYA 3VBHB 1UZVA 1PNFA 2CAUA 1H1AA 2E6VA 3AK0A 1ASJ1 3BVCA 3OBRA 1T6GC 4LE3A 4XMAA 1W8ZA 4QHBA 4LBQB 4GJZA 1H9WA 5FZ6A 1GWKA 4NRQA 3WCSA 4PHZA 5FBJA 5FRAA 5A6QA 3O1TA 1EAH1 1CD3G 1SLCA 2LRPA 5K8SA 3E6BA 3WUCA 2HYKA 1GQPA 1S4CA 2YPJA 4OMDA 1S0FA 3ZN5A 1I1EA 4Q0UA 1VBC3 3PJQA 4W6YA 4RSUA 1QXJA 1NZIA 2YFUA 1MPXA 4CP9B 1CX4A 5A3MA 5IVBA 3UNPA 1GWMA 2NYYA 2V73A 4LBMA 4DMIA 3WOGA 3GBFA 2WYFA 3WZ1A 3OGJA 4E4ZA 1Q8SA 4MLOA 2Q5TA 3LOBA 5FYCA 1OKOA 2WL1A 3KCXA 3TNPB 3VBUB 2E53A 1IS5A 1RUD3 2GP5A 3ZFGC 2K2SA 1AYN2 3M70A 1AR93 3S30A 2WABA 5F6KA 5C4WA 2YGLA 3AVSA 3IIIA 3CJIC 3EO6A 2ZKLA 4QM9A 1YJLA 2W92A 2VMHA 3NNFA 2W87A 1Q8VA 4MGIE 4Q29A 1ZNPA 2FDHA 1F5FA 3MZHA 3T2OA 1W6NB 4COYA 1US2A 3I97A 5F3EA 5C4WC 2P6HA 2AC1A 2UWCA 2R1DA 4IL7A 1U0AA 5FZCA 1JYXA 3PVEA 4OHYA 3AMHA 2YUEA 3NAPB 3OEAA 1YQ2A 2SLIA 4UBGA 1J1TA 1N1TA 5J09A 3O12A 5DN2A 3NNJA 4AI2A 5FDBA 4RS5B 4XUQA 3AM2A 1MZFA 3PIJA 4UXAA 4W6XA 2E32A 1D2QA 2V5YA 5FUIA 5FYVA 5GLTA 1D4M3 5AFBA 4Z8BA 2FCUA 2RM22 2IVJA 4OLLA 4NIDA 1JYWA 4BCUA 3ZLIA 1MEC2 3KMHA 1AVBA 1JYIA 2MEV3 4YM0A 4K9SA 1K12A 1R093 4XQ4A 1W8TA 3A21A 3SEEA 5K9YA 1YCIA 4BLIA 2ZABA 4JX0A 4LBQD 1FATA 1YLLA 3IDAA 3RNSA 4B1MA 1KS4A 4FCAA 4URAA 1KRIA 2ET7A 2VL4A 2WZR2 2XH6A 3ABZA 4LHLA 2QQWA 4RD7A 3TN93 5A33B 2XJSA 3VZMA 3JB8A 5K7PA 4NHLA 3N7LA 4YPJA 4JTOA 4IGQA 4AI9A 4YFZA 3ZVXA 1XNKA 3OSDA 3J9SA 4LT5A 1QHDA 3VBOA 4AXOA 1REFA 3PVOA 2ZEXA 3WQ1A 3POSA 3TEWA 3HWJA 5BNPA 1SLIA 4C90A 1ZBA3 1JYCA 1QNYA 4HZFA 3ROUA 1BBT2 3NNGA 4QT6A 4KG8A 4Q4Y1 2W0XA 3R4UA 3K51A 5HBAA 3KGZA 3WHUA 3K48A 3P5BA 3GHMA 1G86A 4S2HA 1Y9MA 2BWCA 1S55A 2PA7A 2VC9A 1LOFA 3ITQA 3RWKX 1G8WA 4AHXA 4YZ2A 3NV1A 1QOOA 4NE9A 4A3XA 5FYSA 3TRSB 2RS31 3WW4A 2WNUB 2HWD1 1FMD1 3AL5A 1MZEA 1LOFC 5JR7B 1OH3A 4LLOA 1IPSA 3SEPA 4JKMA 5FPXA 3M3CA 3BIEA 1K5MB 2VOXA 4WZFA 4E9KA 2JB4A 3AZXA 2Q1FA 4YG0A 1IKPA 5FMBA 4KL1A 2GC3A 4YW3A 1O59A 1DU3D 2QVSB 2ZGUA 1NOVA 3F95A 1BK1A 4GXLA 2C0ZA 4EV0A 5T5LA 3CF6E 2VCAA 1POV1 5H9RA 3DXTA 1PVC1 1RINA 4MVTA 3N7JA 2WFF1 2WRAA 3AB0A 3AFGA 1WBFA 3B01A 3SCFA 2PHWA 5DUWA 4E2GA 1M06G 4CUAA 4IV3C 5C3RA 5KHGA 1LU2A 1ODMA 2XWJB 3UKVA 2DBIA 3T2PA 5ACA1 1WMXA 2OXBA 1GQHA 3DYPA 1PVXA 1XE8A 2H0BA 2Y33A 3I2KA 5D1IA 1GFF2 2RS53 4KH9A 3ME2A 4A42A 1LHNA 1E5SA 1RUH3 4Q0QA 2VMDA 2HBUA 4IEOA 1H6XA 1RTVA 4HMZA 3WQ0A 1CIYA 4LUKA 4K8RB 4LBLA 5A7WA 3UT0A 3X29B 1CJPA 4D7YA 5CFDC 1TME3 1WCQA 3KVAA 2QQOA 4IEZA 4IE4A 3M1HA 4UWDA 3WY6A 4YSFA 5JPNB 1A78A 1HRV2 2DTWA 1CONA 2UWBA 2V09A 3CJIB 3LDRA 2BW8A 3NV4A 2VZOA 5EJ3A 2DDUA 5BYNA 3OUIA 2MHFA 4CCOA 2HWC2 5FZFA 3S7EA 3HVDA 3JQXA 3VHOA 1CPNA 2D6NA 2BGPA 5J3UA 5FO8B 3GJBA 3LKJA 3W5NA 1DZRA 1OOPC 4LJHA 1U5YA 3FL7A 4NIAA 5DPNA 5A3LA 4I02A 5SV8A 5J36A 2CAVA 1DGRN 2OUJA 5JAXA 3USUB 1CN1A 1ACCA 1BCXA 4RN5A 1QWRA 1QXRA 3RMXA 3VDCA 1GNHA 5CG8A 3PHMA 5CYYA 2XVGA 3AMQA 1N3PA 1REEA 3KGLA 4TXWA 4YVWA 4LBKA 3WG2A 5DAWA 5FYIA 1HB1A 2VQAA 5FY7A 3MO4A 1JYTA 3RZHA 1H4HA 3KHBA 5EFUA 1C1FA 1SLTA 4SBVA 1LOAA 4XJWA 4QM8A 3T09A 3OTFA 1YQCA 2CSGA 1C8M1 4IEXA 1H4GA 1JH5A 4QKNA 5IW0A 4IERA 4AL9A 5BNOB 5KXCA 2PFWA 4QQLA 5J37A 2XQRA 2C4XA 4I3PA 4WM7C 5LWBA 4KG0A 5CKNA 2GALA 4KMQA 3HBKA 4Y1VA 4XZUG 3MICA 4LKDA 4HK9A 5K0UC 4I3GA 4OZOA 4KGQA 4A6OA 5C70A 2WQZC 1UMHA 2WNUA 2WNEA 2JENA 5HCFA 1LNSA 3GCXA 4D7SA 1QXPA 1CZSA 4NAOA 5DDJ2 3I8TA 1XU1A 2R072 3POWA 2ZJCA 3AKPA 3FWEA 4CEWB 4O61A 5HPOA 1KDKA 3F2ZA 5FXWA 2X05A 4JKKA 4E27A 1Z7S1 1HB4A 2ZGMA 1CJDA 2VR4A 1V6LA 4MSVA 4Z2AA 4CYDA 1OA4A 1XSQA 2A75A 5KC5A 1RUOA 1PO13 4C0BA 3EJKA 5CAZA 2VBPA 1VBC2 2ZGTA 3GJAA 4ONUA 3WV6A 4A44A 1DP0A 4LO5B 3FLPA 3E5UA 5FY5A 3SXWA 4LO7A 1AF9A 2VY0A 2IXKA 2PAEA 3EMRA 4LMFA 5LATA 2BNNA 2XHNA 4L97A 3VDDA 1OC1A 4A2UA 5IK5A 1S0DA 5FY8A 4CCDA 5L9VA 2XMLA 1PO21 2YC4A 3PJYA 4DUVA 1R1A1 2XR4A 4YARA 5KXBA 1JMUB 4DXZA 3UETA 1NE4A 3POFA 1WBLA 3H7JA 4LHSA 4ZU4A 4AVVA 1LOBA 1U5IA 4YVSA 1ZZ8A 3WQ7A 3AP9A 1DFQA 1F4AA 3J8F2 1R64A 1UOJA 3IDBB 1PGL1 1CAUB 3O14A 1JZ6A 4XFFA 4A4AA 2ZXQA 4Y4RA 5I0SA 1VBB3 1R081 2JJ6A 2IUWA 2QTWB 3AP6A 4UFKA 4XXPA 5FYYA 2WT0A 4D6QA 5IVYA 2WAAA 1FX5A 1PVC3 5JXIA 2G1MA 1DQ4A 1HN0A 1S0CA 4DIQA 2ADDA 2LW8A 1MQTB 2MNGA 4R52A 4Y1XA 1UX7A 3A0KA 4E2SA 3D0JA 4RGKA 2JECA 3WF3A 5KR7A 3E6CC 3RZGA 2I07B 2GSYA 3L9JT 1IPKA 1ZZ6A 2CNAA 4QPWA 3KWVA 2E33A 4HANA 3WHTA 3QOPA 4FPJA 3PURA 4CZSA 2WS93 1AR71 1HJFA 1NCQC 1WA4A 2ENRA 3OUJA 2OQ6A 1FPN3 4J1XA 5DAQA 4YW5A 4I09A 3VBSA 4LR4A 5BY5A 3HN1A 2QZ2A 2RM23 4YWAA 4JV4A 3VHNA 3ZFEA 5FMCA 3TAYA 1G7YA 2NMOA 4P9IA 4XFGA 4XUOA 1NCQA 1OQDA 3KM5A 4JRAA 5A3OA 4BM8A 3LPFA 3TN91 3AX4A 4OI1A 1ZRCA 5F7UA 4RFRB 2NM1A 5FLIA 4A7YA 2PAKA 1Y7BA 1RUF1 2RS11 4GZ9A 3U11A 1VAVA 4KWLA 5FMOS 3AXEA 4YW1A 4HKWA 3H9AA 5EQUA 1JTZX 2WUHA 5KC6A 4HONA 1L3JA 5JZGA 1HV1A 2G9ZA 2AACA 3PU3A 4FXGB 4QXCA 5L73A 5CADA 2DCKA 2ZHNA 1NT0A 2X09A 3JCIA 3LF7A 5A80A 2E7QA 4RGGA 4D3WA 1GZWA 1JODA 3OGVA 4COUA 2PELA 2D40A 1N3OA 4TWTA 1VP6A 2D6KA 2J1RA 4CVUA 4ISQA 5H9QA 4FO9A 4CDUB 2ZEYA 1UYYA 1CVNA 5GJ6A 4Q1PA 3TEXA 1H0BA 4AHYA 4IEYA 2VXJA 3APBA 4LBJA 1RMU2 1VBE1 3WW3A 4AEDA 1OFSA 4XTMA 3B69A 3GALA 1O3SA 4QXKA 4QPIC 3GZAA 3I2DA 3UJQA 4CCKA 1DGWX 5FZGA 4QDSA 5FPAA 3N9MA 1TVGA 1BEV3 1KS5A 1TMF1 1HXS2 2P3KA 2HKXA 5JOYA 4A7ZA 4QGNA 3BB6A 3TYJA 1W6MA 3ZFGA 1AR62 4BDVB 4AR2A 3ZYJB 1GWLA 4O7XA 1OA2A 5DAXA 4DXSA 4FAHA 5GZCA 1TNRA 2H0VA 3PTYA 4Z92B 1C57A 1C8NA 2VG9A 1D0HA 3ZX7A 2CGNA 2DYCA 2ZX3A 4N9HA 4WM7A 5LRRA 5FPBA 5LRSA 4LA3A 4OUEA 3FMGA 4EWAA 2DCTA 1KDMA 1LU1A 4GQ7A 1RVF1 2VGDA 1YYNA 1Z78A 4WVZA 3E5QA 1OUSA 3JBG1 4URTA 2VQTA 5CFCA 3FLRA 1PGW1 5DABA 1FYUA 1QIQA 2W3JA 2ZGQA 3AC0A 3DL3A 2ARBA 4IE0A 1W90A 3ZSJA 3I3QA 5BNPB 4GH4A 3HNBM 2BBAA 5GKAC 5JR2A 1EV11 3DN7A 3IM0A 4PDWA 1F8VA 2ZKNA 1VBB1 3OGRA 2BEOA 3R4SA 3D4KA 4XAEA 5EV7A 5A7PA 3H50A 4XC9A 3CU7A 1GV9A 2CL2A 2DVDA 2E26A 3BPZA 1RHI1 4O65A 4P9JA 1RUD2 4NHXA 5APAA 5FY9A 4V2VA 5IWFA 3V0BA 3O1VA 4CEWC 3W59A 1LEMA 3Q8AA 4ET7A 1LB2A 2D93A 2HWB1 4PDWC 4CCMA 4EWDA 3VD4A 3O7OA 1H2KA 2VZ3A 1D0GA 1JHJA 5I0DA 4FVVA 3T0DA 4XF3A 1QF3A 2A71A 3C7FA 4R9DA 2KXLA 1YIFA 4XUPA 1AX2A 3SNMA 3CQOA 1AR73 1C8M3 1UYXA 4UFLA 4YZ4A 4PF1A 5FY1A 3WG1A 2R063 3ZKYA 3RZMA 1BJQA 2UY8A 3MI8A 4HETA 4M01A 4RFT0 1ZRIA 3DF0A 3MLJA 5C8CC 1OSGA 1Q3EA 2DU1A 1SQ4A 5F37A 4CRQA 3PU8A 1XC6A 5IVCA 5A7SA 2R0FA 4BQ3A 1S0EA 3N7KA 2RG4A 3UJOA 3C7OA 4ISRA 1LODA 1VAKA 3L2HA 5EZWA 2LALA 5JIUA 1C28A 4A7KA 5JUVA 2BFUL 1UWWA 3AKTA 1OUXA 2XJUA 5FYHA 4MHRA 1MS5A 2Q30A 3NVCA 3AFKA 4TN7A 5DMYA 2RS52 1PK6C 1W2OA 4HBNA 1JOPA 3L2YA 2JDZA 4RQPB 4CP0A 1RITA 1RL3A 4IEPA 2CDPA 2HWE2 2AH2A 2BV4A 1DQ5A 2VZTA 1UIKA 2Y60A 3KLSA 4LIUA 1MS0A 4ZZ5A 4DQAA 3WDTA 3RI9A 3LPGA 3MIEA 1W2TA 4OZXA 4UF0B 1QJU2 2VZRA 2Y26A 3NNMA 3VBRC 5BV6A 4Q4V1 4BIFA 1LHUA 3NWKA 1WCSA 4NPLA 2EIGA 3KT4A 1HB3A 2JD4A 5HCBA 4NRMA 3D3AA 1A3KA 2R1BA 3LDKA 3VBRA 3QH7A 2FZ1A 3U1XA 5C8CB 3B94A 1GOGA 3KV4A 1UW8A 5FUNA 4Q5OA 1G9DA 5FWEA 4XCBA 4JGYC 1GUIA 1BLZA 4Q4Y2 2ZAAA 4YLZA 3SC7X 1PGSA 4CE8A 2EICA 3ES1A 2WQ4A 3H7YA 4XHBA 1J58A 4AVCA 4G4FA 2BNOA 5FIXA 2YHJA 1XYPA 3TEZA 1BMV1 3UYJA 4BPZA 4MYEA 4BU2A 1GP4A 1ULOA 2QNKA 2X5IA 3OB8A 3J8F3 5CEHA 4IW3A 2RE9A 1V6IA 4AG4A 5G05L 4Y1UA 1RUJ3 1VBA3 5ABJA 1CQ9A 4OQ9A 3QBQA 4P5HA 3PUQA 1UD1A 3H8RA 3PUSA 1S0BA 2OPKA 3AZVA 2UYBA 2O8QA 3ILFA 3GNEA 4LUMA 3RQ0A 2B45X 5CFCB 1QJX2 4XXAA 3BTYA 4XFBA 5ABJC 2ZGNA 1W3XA 3NKTA 1RUF2 1YI7A 1Q5OA 4UW6A 3QLQA 4GIQA 4DOUA 3SH4A 3HAGA 5BNQA 4AQ6A 5AFEA 1SLBA 3KQ4B 5C9AB 1WMDA 2ILMA 4YNIA 4HVRA 2BOIA 2XJQA 3JB4C 4WVVA 1O3TA 3ZYIB 4UFMA 1IGOA 2EAAA 3ZXGA 3KSCA 3UV9A 1WLTA 4UOJA 1UZZA 1UIJA 3HMYA 4M00A 4QX7A 5C3PA 1EUUA 1W03A 3GF6A 4Z07A 5A7WB 2P37A 1H2NA 5IK4A 2RJ2A 3TEYA 4ZPIA 1G6NA 1GOHA 4PI2A 4L2NA 4NPMA 3B00A 2VZ1A 3DYMA 5CU1A 2YU1A 3RFRA 1YRZA 3A4UA 4OI2A 3MPBA 4YYOA 2WS92 3WDYA 1OBNA 2DUPA 2QZ3A 2HLEA 2ZMNA 2W9XA 3VL9A 4CUCA 4Z2WA 5GLUA 1Q56A 2JDMA 5ACA2 5JMCA 4TLFA 1XU2A 4CDQA 2EAKA 3LEGA 4XIKA 3CJXA 1ZREA 3I2FA 3WW1A 2XJTA 4EN8B 2YROA 1W06A 1HRI3 2ZX0A 2VPVA 1JOBA 3BYWA 2OT7A 1PHMA 3H1MA 1OVSA 3HOBA 3J7LA 5GLVA 4O9GA 1AXKA 5J96B 3DCQA 1WD4A 1ULGA 1VBE3 1I3HA 4HPKB 5FZ4A 5BUVA 4P9WA 5LASA 1UOBA 1GQGA 4LO4B 4P08A 1W2AX 2XPJA 3OOXA 3KV9A 4XFAA 2VQ0A 3KCYA 2F4LA 3MGUA 2WA4A 3JBG2 4B8EA 4BZ4A 2RDRA 3S0MA 3WEZA 3I3DA 4UW5A 2BOJA 4P00B 1VE0A 5FKCA 1EP0A 3VDAA 4XIOA 4C91A 1RUC1 2PHXA 5IYYA 4RR3A 2O8OA 3O1MA 1WMFA 1Y3TA 5EXOA 4BE3A 4LBOA 4EZHA 2VJXA 5DZEA 1TME2 3K3OA 3AXDA 1VAMA 4IEVA 4CP1A 2BFUS 2WN3A 5FO7B 1NA1B 1U5ZA 2G4IA 1I9RA 1AYN1 3DUIA 4IV3A 5A32A 1ENXA 4LO8A 3BTZA 4I2OA 2EIBA 1J84A 4RR3C 4DRVA 5LEKA 4XVHA 3VKFC 1NYWA 1QOSA 4YGDA 1JYNA 1ULCA 1E5HA 2WSUA 4AGRA 4CDXB 5DUVA 1C5HA 2WR9A 2X53S 3AMMA 3CLPA 4KBZA 1SFYA 2JDAA 1ZZCA 1AXYA 1DLLA 2ZHKA 2VZSA 1DDLA 2CTVA 2VMIA 1N1YA 4YG3A 2ZCWA 4COVA 2W08A 2R042 2RMU3 3NKGA 1FNZA 4LKSA 1PO12 1SEFA 2FCVA 3PUAA 4NIIA 2R062 1XYOA 4EROA 3O1SA 5E88A 2YGMA 4RQPA 3UL2A 1SPPA 2ZX4A 4L11A 1AYM1 3M8LA 1OQ1A 2B46X 2GP3A 3PDQA 4KU7A 4YW2A 3W9AA 4DO0A 1UZWA 1HIXA 1J3QA 2Y64A 3AKSA 2WZ8A 1OF4A 3ZM8A 2R073 4QPIA 3SHRA 4B4RA 4RQPC 5JSRA 2B9UA 1KITA 5HV0A 5C3OA 4CCJA 2WZR3 4WM8A 2ATFA 5FK7A 5C5TA 3RZLA 1MEC1 5IHRA 3AYCA 2A6VA 2HEWF 1FAYA 1YO8A 1RUJ2 2R061 4QKFA 2OYZA 4YVWC 1S2EA 3OD4A 3ZFFB 4FP2A 2P34A 4KBBA 1KFXL 4KI5M 1VLNA 4Y26A 4MXWB 5EJZB 1PIV2 1RJ7A 3DV8A 3JQWA 4C0HA 4CUBA 1SCRA 3GZEA 5DDJ3 4B7EA 4IV3B 2IFWA 3SKJE 1ZBA2 2V5DA 3MYXA 4EN9B 1W2NA 1F31A 1ZA7A 2ZS6B 3AL6A 2DCYA 2WT1A 1QQP1 4XUNA 5FZ0A 4UI9L 1QH7A 3TWIA 2VOTA 3WDUA 4DS0A 1ULDA 2VUCA 4N9IA 4DEQA 1JXNA 3H1YA 1OQEA 2VCCA 1UNBA 2Q1ZB 1SHWB 2PQSA 5DAPA 2QDNA 1H8VA 3PUHA 3O0WA 4X8NA 3AJZA 4S2GA 1BEV2 1NY72 2C9KA 3CNAA 1UY3A 3ECQA 3NAPA 4OHZA 4CXYA 4CEWA 2WZEA 2TNFA 3MFAA 4JC1A 3K3NA 5FXVA 2VVFA 3RJ2X 1H2LA 5CKQA 1R082 4JQRA 4K7JA 4QDQA 1IPJA 3ELNA 1K5MA 4M0NA 4AFAA 1CIWA 3NL1A 1QEXA 1LESA 4Q4W1 1W6QB 3AP5A 1BBT3 1ZM1A 4HPKA 2DV9A 5FO9B 3TNQA 2HWC3 4CDXC 4HK8A 5FZBA 1W0PA 5LBBA 2HEYF 1BXHA 3IT8A 1WMEA 3ACIA 3P3PA 4N7UA 3VBUA 2WIIB 2JE9A 4INDA 3VBHA 1SLAA 1SG3A 1WCUA 2VBDA 3FUOA 2Z2SB 3B9CA 3OBAA 5T5OA 3VL8A 4CP2A 4CU6A 5KWRA 1OLME 3PIGA 2FHRA 4PT6A 2FDIA 2ZX1A 1N47A 4NWWA 3OCPA 4WM7B 4D94A 1Q8PA 1BKZA 3PMEA 5FCCA 2BJSA 1PMHX 2OS2A 2Y6HA 1XQNA 3IMMA 3M3OA 4CU9A 4FOWA 1AL23 1RUNA 1LEDA 4GKXA 2ARAA 1DG6A 4XW3A 1F5JA 4M3CE 1RUI3 1SZBA 4R4XA 3INAA 4Y24A 3ZXEA 2HEVF 2R043 1Y4WA 3H3UA 1RB8G 4XE9A 2D6LX 2XBO2 3VD7A 1WLWA 5GLWA 5L7OB 4OULA 5K0UA 1AR81 4AAXA 3O1UA 3E1F1 3BU7A 5FPUA 1IKQA 3POJA 2QCSB 2RS12 4KNCA 4M3CB 5FZ7A 5IVFA 2HWB2 3H8XA 1JUIA 3ZMOA 3ZMNA 2A3YA 1URXA 5FZEA 3CIHA 3S5AA 4FOVA 1HXS3 4BH9A 3IBMA 3ZFEC 3ZXLA 1YC61 4CPBA 1XNTA 4CTEA 1V6NA 2JDNA 2D98A 1ZA4A 4JDOA 2DUQA 3OGGA 5F5CA 2W1WA 1JBCA 1GZTA 1QJY3 5FFOC 4A6SA 3MFCA 3LSDA 2J1EA 1W6PA 4JGZC 2OPWA 5LBEA 4FFGA 3WNOA 3V0AA 2TBVA 4F8AA 3VKLA 5HV4A 2Y0IA 3S57A 5LW9A 3ZYFA 1LAJA 1WW7A 1WW5A 2K0GA 5CA6A 2BPA2 2WZPP 1BHGA 1O91A 2JE8A 3ZFFA 1NLQA 2RR12 3NRUA 4HT1T 4YVSC 2JKBA 4AVSA 1VBB2 3GYDA 3WNPA 5CISA 5FZ1A 2J1VA 4QU1A 1HX6A 4GMP1 3WR0A 5D21A 3OGSA 5LB6A 4JDMA 2HWE1 3Q8EA 1BYHA 2YC2A 4IXLA 5FZLA 3VKMA 4IV1B 2OKXA 2RDQA 1HKDA 1L7LA 3MIDA 4ARXA 4F7ZA 2ZZJA 3AMPA 1STMA 1XXNA 1R091 1UO9A 4H2AA 2GZWA 1UU4A 2WO3A 2RV9A 4S2DA 1NCRC 1DZTA 4Y3OA 5A7NA 3LEKA 1ASJ3 5SV5A 3RS6A 1O8SA 5EP9A 5GLZA 1O4ZA 3ENRA 2JG9C 4CDQC 3WQBA 2VW0A 3C7GA 1W8NA 1OLRA 1YJKA 1ZBE3 3MV11 4I30A 2BVBA 4YZ5A 5FTTC 5JSPA 1C8M2 3KF5A 5A1LA 1FNYA 3IWZA 3JD71 2JWPA 2HWF1 2YY1A 3WP5A 2ZGRA 4ASMB 2V4AA 3MHZA 1J1LA 1VBC1 2Y6KA 2ZGOA 1W39A 3BODA 3FBYA 1UN1A 2XVLA 3LZZA 4XJ9A 3K46A 1PGL2 5DG2A 5C71A 3T0AA 3B7MA 2X29A 1W3VA 3LFMA 1QKQA 5E6HA 2FMYA 2XWBB 1LENA 5KHIA 1YUDA 3U4XA 1HN1A 5LY1A 1XE7A 2ZGSA 1AUYA 1COV1 2R0HA 4LITA 4NR1A 4YGCA 1HW5A 2LM3A 1QJY2 1VRH1 4C1XA 2O14A 5J98B 4AGGA 4Q4X2 3ZKUA 1RUD1 1BBT1 4FI9A 5T5PA 2P6CA 2XLGA 1AJKA 2BVVA 2Q0AA 2A1XA 5LA2A 3RSJA 4B3NA 2D97A 1OPOA 4J1WA 4IV1C 3IPVA 1N3QA 3KB5A 3POGA 4M3CA 4NROA 5FMOL 4A45A 2JIJA 2Q4SA 2RMU1 2ZPXA 1SACA 1W6OA 4FAGA 4L9BA 2D5FA 4UBHA 3VKOA 5C3QA 5F5IA 1VBA2 2VD7A 1TE1B 1CAVB 1HQNA 1GANA 3N35A 4QB2A 2YZ4A 1Y43B 5E8AA 2C5DA 2VTFA 5JPMB 3I3BA 2VZPA 5LCWL 3V0AB 2WWUA 4RL7A 2XQXA 4XQDA 3T0BA 1POQA 3SQOA 2W1QA 1ALYA 1HRI2 1QJFA 1JYVA 2WZR1 1XE0A 2HYXA 2XUEA 1CPMA 2C9AA 1WKYA 3RG0A 2VNOA 3PVBB 1LGCA 2Y8KA 3LFIA 5LY2A 1JZ5A 4X6QB 5ACA3 3HNYM 4EE2A 3LDBA 1ST8A 3WF2A 2VULA 5ANQA 2RS51 2Q8CA 5C7GA 1A6CA 2VECA 1IQDC 3LEIA 4GH4B 4NVPA 1YWKA 4PLOA 2ZAHA 4QPGB 2MEV1 3VBHC 1W6NA 4OUSA 3QACA 1W99A 3HBZA 4MOAA 4MUVA 3M7AA 1SBFA 4BQ1A 1UYZA 2VTXA 2VVEA 5D8AB 2AEZA 2OUHA 3ZN6A 2VCMA 1DIWA 2XL9A 4D6SA 5FV3A 4DRRA 5C9AC 5I8YA 3MEPA 5LZ6A 5C4WB 4C1WA 4MGTA 3I59A 5LA1A 2W46A 2B5HA 2XKPA 1WLDA 2F17A 3LIHA 2B7YA 5FQ0B 2PYTA 4QQ2A 3VD3A 1JZ2A 2WFF2 2WKKA 4XDQA 2BNMA 5FZ9A 1OLMA 1J3PA 3N9NA 2IC1A 1JS9A 1M4WA 1B09A 1PK6A 3ZSKA 1QJZA 5K4LA 1X50A 2DVAA 1YQ5A 3NO8A 2WO1A 4PIXA 4E8CA 5FYUA 4NUBA 3LA3A 4OYUA 3E5XA 4JHTA 2OVUA 2O1QA 5A7OA 2QQVA 2ES3A 5FMDA 3ZYRA 4GH4C 1GU3A 2ZZQA 3POIA 1ULPA 4TTGA 3D5OA 4H7MA 4CEYB 1YXWA 5HI0A 5KXDA 3ACHA 4HVQA 2JDKA 2HWC1 3LCPA 5KBFA 2OQ7A 3ZO0B 1WCKA 4PBOA 2Q8DA 2RS33 3FX3A 2A3XA 3KV6A 3P6BA 2NZ9A 1RUG3 4ZY9A 1FMD3 3ZXAC 3HNMA 4AYUA 5C3SA 3BTAA 1W0OA 4W4ZA 1AR82 2E9QA 1S2KA 4RR3B 3MW2A 2ZEWA 1C5IA 3PVNA 2O0OA 4LQRA 4UYBA 4WM8B 4TSVA 4Y1YA 5I0RA 5F8PA 4XBQA 2C1FA 2ZBJA 4P14A 4Q4X3 1AL21 4K3UA 3WX5A 4DY3A 3CO2A 3ZYHA 2W2IA 4Y1ZA 1UXZA 3FJSA 2RDNA 3M3QA 2EA7A 2J42A 3ETPA 1JZ7A 5DUXA 2R041 3MF9A 4DINB 5FZ3A 1NKGA 1V70A 1GP6A 4P5YA 4XURA 4DFSA 3KT1A 5F39A 3FBMA 5AVAA 2BZDA 3IAQA 5JDBA 3B93A 2IFRA 1X8MA 2ZEZA 2FDGA 1DGWA 5EJ1B 3N9LA 2YC0A 5GM0A 4BWOA 4MHUA 1IS3A 1COV3 3W20A 3MIGA 5IATA 1W8OA 1VRH3 2A6YA 4XEZA 3RPQA 4Y4YA 1VBD3 5FR3A 1X33A 1XNAA 1VALA 2XUMA 5EWSA 1J3RA 1VMFA 3K77A 3LAGA 3SH5A 3ZDSA 3THPA 4FSJA 4M4PA 3ASIA 4XDOA 3IZOA 1SCSA 1WLCA 2QJVA 4JKLA 5H9PA 4BOWA 2G9FA 1J59A 1WD3A 3IN9A 4QKBA 1X9PA 4EYUA 1YQ8A 5FP8A 1QJY1 1VRH2 4QDRA 3U4SA 3MIBA 4ZONA 3CZJA 3DXUA 3LSEA 3FC0A 3ZIXA 4QAWA 1H6YA 1PZ8A 4FPKA 2PLV1 3M2MA 5JOWA 4E4HA 1X7NA 2NMNA 1DBNA 2WQ8A 2I45A 4CDUC 1G9BA 4MXVA 4R4ZA 1RMU3 2WNVA 1JUHA 5HXMA 1MVQA 4MV2A 5A6YA 1AX1A 2VM9A 1ZYBA 1R1A2 5FLJA 1UX6A 2VBBA 4GMP3 4I0WB 4XFIA 5F6LB 3WNMA 2JG8C 3QCWA 4BQWA 4U2AA 1W9WA 3HD8B 2W94A 2GN7A 1AXZA 2PHUA 5DQ0A 1UF2C 5FYMA 4CDWA 4M0HA 4JTNA 1FPN1 4QPGC 5L9BA 1QY4A 1QJU1 3OEBA 2RM21 1OURA 3IAPA 3U75A 4B7KA 3NQHA 4X6RB 5I8SA 5L7OC 3FFQA 1NQDA 2EALA 1AR72 2DVBA 3MF6A 4EJRA 3AMNA 4XBLA 4MGQA 4CDWB 4CPBD 4IE5A 4N53B 3VD9A 1OPMA 4XF4A 1SBEA 4N8MA 3BPSA 4E4SA 1Q8QA 1COV2 4ZXEA 1ONAA 1OA3A 2VUJA 4L99A 2F4PA 3ZR6A 5L7OA 1NLSA 1NA1C 2IXJA 4MO3M 2CGOA 5C6CA 4LHKA 2RS13 5FUPA 1MS9A 5T52A 4B4PA 4WZCA 5IK8A 2C24A 1QU0A 1IOAA 5FP4A 1MR5A 1ZVFA 1IS6A 3KVBA 4BMBA 1SPPB 4HOOA 5FPZA 1DCSA 3B5LB 1PO11 4CDXA 1OLQA 1RUI2 3OUHA 2P1BA 1UZ0A 3WNXA 3AVRA 2FMDA 4DEVA 5FAXA 3VHPA 1LHOA 3WDVA 5C9AA 5J7MA 3AP4A 3LA2A 5F2WA 2WLQA 5FYZA 2XONA 5FP7A 1DF0A 2EXJA 3EHKA 1XRUA 2HWF2 4UW4A 1OMIA 2BQPA 3VZLA 2CWSA 4BXFA 4ITCA 5ISLA 5IVJA 3VKNA 3ETQA 1UL9A 4DUWA 2D44A 1BMV2 3D8CA 4Y22B 5B2GB 5KHKA 4FQZA 4RGAA 2L9LA 2I2SA 2OX0A 4WVWA 3BCWA 2RHPA 1LCLA 4S2FA 4NO4A 3W5MA 1HRV1 4OFGA 3FLTA 1K3IA 3LIGA 2D6MA 4O9EA 3E97A 4QQPA 4ZS2A 3ZIWA 1X82A 1R083 2GMEA 2OZ6A 2P17A 1QGLA 2WC2A 4YVWB 3OPTA 2XVKA 3PTRB 1NCRB 4PJYA 5HXVA 3H8OA 2W47A 4YW4A 1WWYA 1O8PA 3KCCA 4Y20A 3ST7A 3UKTA 5A3NA 2QDRA 2RMU2 5FK8A 4HKLA 1IS4A 3NJZA 4OHVA 2JB8A 2D3PA 3THTA 5JMOA 1JZ8A 4UAPA 3VBFC 2DURA 4F83A 2IXCA 1TMF2 1PZ9A 4MGYE 3BKZA 3JXSA 3M4FA 1QDCA 5KXEA 1J83A 1O3RA 4DZGA 3FHIB 3M3EA 4Q1RA 1F4HA 4P9LA 3UESA 1H30A 2DFBA 4LPLA 1GICA 1PM7A 3WF1A 1GZWB 3V64A 4AHZA 1DQ6A 2PN5A 1GR3A 2WA3A 1JU3A 3AZZA 4AGVA 1KD7A 3MIHA 2WYSA 5FZHA 4NRPA 2BGCA 4AVAA 1N1VA 2XBO1 1S0GA 3EQEA 1NY71 2QQMA 3ORJA 4MXWA 1KFUL 5L9RA 1OXCA 2VXRA 1OD5A 1B35C 2XJPA 3ZPYA 2AUYA 3A23A 3MLLA 1XSRA 1LOCA 4IE6A 4DXTA 2FD8A 1R092 1FXZA 1PIV3 4QWNA 3WSOA 4EQVA 5IVVA 1MQTA 3WW2A 4E2QA 2PLV3 1PMJX 2ETEA 5FZAA 4PDWB 1B35A 4XCAA 5JXGA 1RMU1 1VBE2 2Z42A 5FZKA 4ZHNA 1EV12 4PCRA 2W1UA 1F9KA 4K1ZA 1G9AA 4XF0A 5FREA 3VZOA 2VW1A 4R8HA 4MX3A 4H7LA 5FXZA 4EN7B 1NCRA 1OKQA 1Z7S2 3N7MA 3NJXA 3LOIA 5BNNC 1E5IA 3ZFEB 2FQPA 2VU9A 3R0RA 3CZUA 2QQIA 4ES8A 1IHMA 3MBWA 2JICA 1OD3A 1FV3A 4OVEA 4Y22A 4TLGA 1D7PM 2JX9A 2AR6A 2ARCA 4FQ4A 1RUG1 4HN0A 4QX1A 1GZCA 4D6RA 1K5MC 2AYHA 1UPSA 2W91A 5CFDB 1BVVA 1W28A 5GZGA 5F32A 4XYXA 1CZVA 1N1SA 1EPZA 2H6BA 4W8JA 4XTPA 1LKNA 1EAH3 3RZJA 1IG3A 4RYDA 4QX0A 3VBRB 4Q4X1 1W05A 1G9FA 2WNVC 3ACFA 3OJBA 2GNMA 3VBOB 4RA0A 5FZDA 4YVSB 2P3IA 2FDJA 3ZYBA 3AZWA 2CV6A 5EYYA 2WNVB 3VBOC 1MS8A 4NIHA 4WBBA 4AF9A 2VCBA 4COWA 1HV0A 2Y34A 1CAUA 2BYVE 2ZTNA 3WVJA 2FDFA 2B9VA 4P9XA 4JCKA 1RXGA 5EPAA 3LD8A 3WD5A 5AC93 5ANNA 3OBZA 4K21A 3U10A 3ZXKA 3VD5A 4B4QA 1XBFA 3V0BB 1V6OA 3NV3A 4AEKA 4LE4A 5FOBB 3H0OA 3T3YA 4NPRA 1A8MA 3Q9OA 2A73B 1ZZ7A 1W8WA 1GYKA 1LOGA 3JUUA 4IGPA 4Q4V3 1ENSA 1ZBE2 5C8WA 1K5JA 1UCXA 5JI9A 2IWGB 3BGAA 2PLV2 1AZDA 4ZU7A 1VB2A 2LTNA 4ATFA 5J48A 4AVTA 4N53A 1QJX3 3LEMA 3BI3A 3HN3A 1NA1A 3CDZB 5A32B 4GB32 3CEWA 2BGOA 4WVMA 2VW2A 3ZR5A 1AR92 2YB7A 1GZ9A 1H8TB 1HLCA 1W8UA 2YFZA 2Z5WA 4Q8KA 2DF7A 3D6EA 1RUE2 2A6XA 3GGLA 3KV5A 4N53C 4PIZA 4BJ0A 4CUGA 1XPWA 3AP7A 1W0NA 1W6MB 2PHLA 3AYAA 1VJ2A 4DPNA 4YM2A 5JSOA 4FFHA 4BK4A 4IEWA 2NLRA 5GZEA 1DQ1A 4N43C 4JGZA 4W6WA 1JN2P 4I0AA 3USSA 1F15A 4ARYA 1RUJ1 5B4NA 5EIYB 2DTYA 2KM2A 4Z82A 4LBNA 4META 4Z1VA 5FWJA 3KT7A 2WINB 2YPDA 1RUE3 2CHHA 1MS1A 1VR3A 2ZHMA 4NMIA 1RUH1 3A22A 4YW7A 1MVEA 2H6CA 2IXLA 2ZA9A 3PMSA 2BBVA 4RHV2 1QJU3 3P3NA 3B9IA 3AKQA 1T2XA 1XYNA 1FOD2 3OY8B 1MZ5A 1RC6A 3BTXA 1W9TA 5DZGA 3LA7A 1SFPA 4AEMA 3RYKA 5BNOA 3W58A 1VPHA 1XNCA 4HL0A 4BB3A 3OG2A 5DUUA 5F5AA 1HQWA 1NE6A 4H3WA 4IUGA 2QQJA 5AVPA 2ERFA 2RS32 3RWNA 3POBA 4B29A 3URFA 4Y5SA 1U12A 4Y5Z0 1BVP1 4LHNA 3USUA 3WNLA 1PIV1 2J1SA 1CR7A 2VZQA 3ZFGB 1OOPA 2EXIA 1KXGA 1NUKA 4HFSA 5DAVA 3N9OA 2C26A 4AAPA 2B39A 4BLJA 1ZBA1 5KHHA 4PLNA 1FOD3 4FP3A 4Q0SA 5LEJA 2WT2A 3KZ4C 1XNBA 4QX2A 4QPYA 1RYYA 3FE5A 1GLHA 1UKRA 1DZQA 5FOJB 1W9FA 2QQUA 4WM8C 2N7GA 3SCHA 4K6BA 1VRBA 2YV8A 2GU9A 3I59B 2PMWB 4U36A 4V2WA 4Y5TA 2FCTA 2DBNA 3CJIA 2KA3A 3I54A 2RJKA 3VDDB 2VZUA 2WAOA 1I5ZA 4QXBA 2RR13 2ZX2A 1RVF2 2JE7A 4FTBA 2WSVA 1AX0A 1D4VB 3U07A 1DYPA 1WZXA 2ZMLA 5GZDA 1SBDA 2D3SA 3HQUA 5JZGB 5DG1A 3DKQA 5I93A 3SCGA 1IZ3A 5JIAA 3DPRB 4AK3A 1GSLA 3EXUA 4ZU5A 3J7HA 4CU7A 2WFF3 1T6BX 1C1LA 5AC91 2VMCA 4OCTA 4CCEA 1DGLA 3UGFA 2DFCA 1QMJA 3HJRA 1CAWA 3D0SA 3CHXA 5DZFA 4EZ4A 3JU9A 1KQRA 3I2OA 3EYPA 4ES9A 1X8EA 1CESA 2JG9A 3IPVB 4PQQA 3WP6A 3WUDA 1FT9A 2QBXA 1W9YA 3HEIA 3NV2A 2EXKA 1RUC2 3I3EA 1YIPA 1W6OB 1PO23 3A0NA 2P3YA 4PBPA 4GA9A 3WDWA 2RDSA 1TG7A 2W39A 1TME1 2HJIA 5JVVA 5I91A 1ZRDA 1EAH2 3N9PA 3I2HA 5FQ0A 2XBO3 2Q8EA 3B3QE 4PLMA 2YBKA 3EBRA 4QB1A 2B42B 1LRHA 4OI4A 2WJSA 4Q0PA 3K4ZA 4MGSA 5A3TA 5CIRA 1F2NA 2GC1A 4CDUA 2OIIA 4G9SB 2LROA 2X5IB 1H9PA 1JW6A 3N36A 1PK6B 2EVXA 1UPIA 4N7IA 3G7DA 2ID4A 3MW3A 4JZRA 4DXRA 1QH6A 1EUTA 2K46A 4FPGA 4BQ2A 5A3PA 4OQ8A 2GDFA 3ATGA 1ND2B 1AYM3 4LLFA 4LOTA 1VBD2 4YG6A 5D2AA 5T55A 1V9U3 3VDBA 3ZSEA 3WCRA 1CAVA 2JKXA 3FFZA 3T4HB 4JDNA 1H2MA 4QX8A 1HQLA 2Z79A 2R071 2ZOEB 4UFIA 4LULA 4M4RA 4QPGA 2YBPA 1NLRA 2XGXA 4H55A 1ND2A 1RUE1 2BP6A 2A5ZA 3CKHA 3POEA 5EHDA 3DEMA 1YFUA 3J7NA 4NJ4A 3OD0A 3KD4A 4FFIA 4AFDA 3KS7A 1SDDB 4Y33A 3VBSB 3ZN6B 3O1RA 3ILRA 5EYXA 3MUY1 3D82A 2YYOA 2D43A 4QQHA 2ORXA 5JXHA 2YG0A 4UF0A 2SBAA 1V9U2 1GNYA 2WBKA 4AI3A 4FPCA 5F9TA 2Y38A 5IVEA 4AWDA 5T54A 3R4DB 2ZGPA 1JZ4A 5FJKA 3PUIA 3OPZA 1EYBA 4CSWA 5JI7A 3RGBA 2UY9A 2W5FA 3RRDA 5BNNB 4XF1A 1JI6A 2HBTA 4HSLA 4PF5A 4QXHA 1D4M2 1O6UA 3T1MA 2R30A 4K40A 4AFBA 1WA6X 2VQUA 4D8MA 1NXD1 4CA9A 1JOJA 1Z7S3 4EN0A 5IT6A 1FOD1 5LK7B 5IAVA 5LA9A 2ZACA 3VB9A 3AZYA 1CAXA 2GH2A 4QHOA 3GBGA 2B4KA 3GDBA 3T2QA 1POV0 2YMZA 4Q27A 2Y6LA 2HWD2 4IESA 4LKEA 4XMIA 5TSWA 3RZZA 4BQXA 1NX9A 5JOXA 1ZRFA 4CCCA 4GMP0 4YGBA 1YNAA 2X8KA 1JZ3A 2XLFA 4UT5A 5A7QA 4NN0A 2PHTA 2W95A 1LR5A 5BXXA 1R1A3 4R9CA 4QMAA 4TYSA 4XPVA 2VO5A 5BNNA 1LGBA 1QJX1 1UU6A 2NQYA 1H1MA 4IE7A 4QHZA 1ND3B 4Q4V2 4QX5A 5FXXA 3ZPOA 2BUKA 4XBNA 1ULFA 1QOTA 2BU9A 1ND3C 2P2KA 3RI8A 1OI6A 3WXPA 4IQPA 1SDWA 3HT2A 1CGPA 4DY5A 4QD2A 5IJRA 3VZJA 1VMHA 3ZOIA 2AENA 4OUMA 4AZZA 4FOYA 3TN92 3THCA 2J1UA 3H1WA 1BEV1 4OHXA 1TMF3 3T1LA 1NZCA 3VHRA 1MS4A 4FPOB 4MADA 2LS6A 3CMGA 4KWKA 4C8DA 2XJVA 1K45A 2EIDA 4OHWA 1RUI1 2UYAA 1BK0A 4ATEA 3UK9A 2Q1MA 3VLBB 2P4EA 2PAMA 3WDXA 2WFPA 1TEIA 1LHWA 2ARXA 2A7AA 4FXKB 3I2IA 5GALA 4CU8A 5J1XA 2WS91 5C5UA 1RVF3 1I5PA 1JHNA 5FZ8A 1GNZA 1DYOA 1U5XA 4LOSA 4UFJA 2JG8A 1NCQB 2FZ2A 3CL1A 4FTSA 5FJHA 1MS3A 4F3JA 3R05A 3O5SA 4N43B 2WLPA 1PX3A 3NW4A 3ACLA 5G04L 5F3CA 3ZSMA 2GN3A 2P3JA 3I7DA 1HXS1 1UKGA 2NPIA 3GXUA 4JHZA 4XFCA 2YU2A 4AQTA 4XAAA 2XL7A 4L92A 4JGYB 1EV13 4N90A 3DPRA 1UMIA 3WP4A 1RUF3 2E63A 2TUNA 3O1PA 5CVRA 4QGLA 4JAAA 3WT3A 1E57A 5I0TA 1XJAA 2ZHLA 2QKDA 1V0AA 5E89A 1FI2A 2QE3A 3DPRC 4YM1A 4AVBA 1OF3A 3HQXA 1CZTA 2GMPA 3FZ3A 1W6PB 2IXHA 2UURA 1FV2A 2WN2A 3DECA 5FLHA 5JCTA 2R49A 1Z0HA 3NAPC 1AL22 1C3HA 1S0IA 3AYDA 4J6GA 1W2UA 3H3LA 3ON7A 1LGNA 4N43A 4Q8LA 4XUTA 3TOJA 4HVOA 5DXDA 3BU0A 4NAMA 2IZWA 5C8CA 2XLAA 4LKFA 1H8TA 2HWE3 3LWCA 1P8JA 2RR11 1ZRRA 2PXJA 4AOCA 5IK7A 1OOPB 4MGKE 4H14A 5JLVA 1O4TA 4CCLA 2FDKA 4YZ1A 3ILNA 2JG8B 1OVPA 3ZDVA 3AKRA 3VBUC 4YM3A 5A6XA 3DGTA 1RIRA 1L7QA 1UMZA 1NAEA 2GC2A 4BK5A 4XILA 4CP9A 5LBFA 4LA2A 4RS5A 2DVGA 3RYPA 5BNOC 2BDRA 4NWVA 3K4DA 3I3MA 3FHQA 1CAXB 2Y0OA 1O4YA 2XJRA 5FY4A 3VN4A 2PHDA 1OHFA 3MUZ1 3UGGA 3WNNA 1X36A 1SLLA 4CDWC 3UGHA 1W8HA 4IDZA 1VIWB 3OYWA 1AJOA 3WINE 1PGW2 5HCAA 4MGZE 2PQQA 4P02B 5F3IA 5FYTA 5A6ZA 5IFTA 1PZ7A 2QUOA 3JBG3 3VBSC 1WW4A 3VBFA 4D0QA 4DB5A 2K9ZA 4K20A 3IDCB 5GZFA 4I01A 4SLIA 5A33A 2JXAA 3Q8FA 1CWPA 2VMGA 5CB7A 2A70A 2CU5A 4XETA 4YFWA 2CWMA 4QX3A 2BERA 3VBFB 3H42B 2VMEA 2EIEA 5FKBA 3C7HA 1VB4A 4XACA 1S0JA 2R16A 4UFHA 1W9SA 3LB9A 1TZOA 5T5JA 3RZKA 2XG3A 1A34A 4Q2FA 4W65A 4XJ8A 3RMYA 4V1PA 3R6SA 3B02A 1CAWB 1RHI3 3MPPG 4KGGA 3J8F1 1V9U1 4BMEA 2JDUA 3MIFA 3S6PA 1QQP2 4LEJA 2QQNA 2HWB3 1EY2A 1RUG2 1VBA1 1L7RA 4GB31 4LXLA 2AREA 5A1AA 2DVFA 2GAUA 4MG2A 4ZKTB 4E4DX 2IVIB 4BA6A 4AFCA 1AYM2 1UY1A 2E7AA 2D6PA 4FFFA 1XB9A 2BWAA 4NHYA 3ZFFC 4BHPA 2XKOA 5FPLA 4IEUA 4QPIB 3DKWA 1K42A 4KU8A 5CFDA 4M3CF 3ZSLA 1ND3A 3BIWE 2VUAA 4E8DA 3Q8BA 2V72A 2DUOA 5FYBA 1GOFA 3WF4A 3WP3A 2VUDA 1PVC2 1UOFA 1W04A 1O5UA 1LJ7A 2OW4A 4COZA 4ASKA 4AEDC 4AHWA 4Q4W2 5T3NA 2JIGA 4P9YA 3WG3A 3C8XA 3N9QA 2VNGA 1KGYA 2W68A 1ZBE1 3BOWA 3POYA 1AL0G 3AYEA 1PNGA 4XFHA 1YI9A 2QQKA 5IUQA 4TZDA 3JD73 1WGPA 2A6ZA 2GNTA 2HWF3 3OYWB 1G9CA 4FPHA 3PL0A 3N3HA 5LA0A 4DUXA 2CGPA 1E5RA 3GZUC 3IKWA 1F35A 1IG0A 2AGSA 2D5HA 2MEV2 2QFEA 2R32A 1GKBA 2VH9A 3BALA 4XDPA 5JWPA 3I49A 1US3A 5CKMA 2VVDA 3T4VA 5CFCC 4BQ4A 1HRI1 4L0PA 1V6MA 1RXFA 1V6JA 2DU0A 2YDEA 5FPVA 3GM8A 3SKVA 1VMJA 2PTMA 3RDIA 5CG9A 5ERLA 2ZMKA 1MQTC 3S5QA 3NJYA 3HT1A 3ALQA 4QU2A 3J4UH 1YFXA 3ES4A 4IV1A 4GD4A 4L8QA 3I2GA 4XJAA 3SISA 4BQYA 1UY2A 4ZZ8A 2NN8A 3NMBA 2R6QA 2MPFA 3RVHA 1GP5A 3KF3A 1V6KA 4G3YC 1CX1A 3U0ZA 1NQJA 1X9TA 4FBFA 2D6OX 2JDYA 4BYYA 4OI0A 4Y20B 1BZWA 2JD9A 4ORFA 3ZXDA 2X10A 5IAXA 2A6WA 3T2TA 3HPNA 4I0BA 3ZN4A 2HH9A 3Q8CA 2YBSA 3GCWA 4RHV1 4AEJA 5HCHA 4HKOA 5LBCA 5K0UB 4MH0E 4PI0A 4AW7A 2CYFA 4X8PA 4FPYA 2WO7A 3HR9A 1H8TC 1HDKA 2R7EB 5F3GA 4Q0VA 2WWSA 3V65A 3VV1A 1W8FA 3WNKA 4YZ3A 2VZVA 3TB0A 1AYN3 1FMD2 1QDOA 3H3ZA 1W6QA 4CCNA 1BQPA 2E31A 1YFYA 2VOVA 2VTXJ 4ASLA 2P5BA 3K2OA 1UQXA 1LECA 1YQ6A 5JXJA 1S2BA 2LUWA 1ENRA 4LK7A 5FZOB 3W21A 5AC92 4AFMA 1UY4A 2W1SA 5FZMA 1RGSA 5KHJA 3PNAA 4XJZA 5L19A 5M0TA 1H1IA 4XQWA 1O7FA 4IGOA 2B8MA 3GHNA 2JG9B 3OPWA 4NHKA 5I0UA 4CEYA 4CDQB 3J7MA 1UYPA 2VNVA 3OF1A 3ZXJA 1AR63 4GALA 4R9BA 5JOZA 3GZTB 1O5LA 4OMCA 4FTEA 5D8AA 2V4VA 5ABJB 1QJEA 1YHFA 2BTVC 1UU5A 2J7MA 4GAZA 4W50A 1ENQA 2ADEA 2G19A 3O0VA 1R1ZA 1REDA 4QQOA 1Y9GA 1EPWA 2YXSA 1PO22 3NSTA 4A3ZA 2XDVA 1AHSA 3QH6A 3SH3A 5C33A 1HJGA 1ZZ9A 3DYOA 2CDOA 2F6BA 1KJLA 3RJRA 3IDEA 1RHI2 4BQ5A 2C6SA 4K1YA 2FBEA 1MZ6A 2UWAA 2VE1A 1NXMA 1C4RA 3OBTA 4NHMA 5B4XA 3VZNA 2J1AA 1HB2A 1A8DA 1D2SA 4LORA 4WVMB 1S1AA 2XB6C 4FPEA 4HN1A 5DDJ1 3RYRA 1ZX5A 4NIGA 4P9GA 3M3IA 1Y9QA 2XXZA 4LNVA 1DQ0A 3N4MA 4IEQA 1OFNA 2W52A 4ZS3A 4KWJA 3O0XA 3U37A 2EF6A 4GWMA 3C2UA 4LTAA 4XJUA 2JDHA 3WG4A 5E1RA 2Y6GA 4EWEA 4JVAA
chains in the Genus database with same CATH topology
1APNA 1Q8OA 1DQ2A 4FOQA 5L36A 1MACA 3MW4A 3VZKA 2VOWA 3IIAA 1YFWA 3G6JB 3PLQA 3MDPA 2PHFA 4AQ2A 2D7FA 1RUC3 4AI0A 2E51A 4WV8A 2PHRA 2GNDA 4K8FA 5E16A 5BPXA 3S7IA 1V00A 2WNUC 2QQPA 4FPLA 2OZJA 2TEPA 4XHXA 3C3VA 1FPN2 3OY8A 3V56A 1Q43A 2GMMA 3GBWA 3IMNA 4Q4Y3 3ZYGA 2I74A 1LOEA 1O3QA 1SFNA 1QNWA 4EN6B 2G9GA 2E7TA 4FPFA 4AI1A 2OA2A 1VBD1 3JZVA 3TBDA 4QGMA 2DCZA 4YGEA 1AR91 4GKYA 1KJRA 2JEMA 1WW6A 2DWRA 4UW3A 2HWD3 1WUVA 1ZZBA 3JD72 1LHVA 2GH8A 4PIYA 4JGZB 4LO6B 1GBGA 4RHV3 5FBZA 1HRV3 3VUOA 2DCJA 4D69A 4DNYA 4GB33 4KQ7A 3MLKA 2CY6A 3QD6A 4JRLA 1I6XA 4RS5C 1POV3 5I8TA 4Q26A 1MEC3 3SMHA 1RUH2 2ZGKA 3UKNA 2NP0A 1AR83 4XF9A 2Q8OA 2XHKA 5J48A 1RJ8A 1D4M1 1TQ5A 2UU8A 2AZ5A 4HSJA 1UZYA 2Z69A 1ND2C 1B35B 1DYKA 5BNPC 1NG0A 2RJLA 3ZYPA 4AQSA 1PMIA 1TNFA 1DGRA 5LK5A 4MZUA 2GC0A 3H8UA 2EXHA 2VOKA 4HLTA 4IETA 4ZXKA 2ET1A 1SMVA 1AR61 2GNBA 3WLUA 1QQP3 4R9AA 3I4IA 3BOPA 1UAIA 2IXIA 3KQRA 3SITA 5F5QA 4XZPA 1LULA 5CNAA 3SLIA 4AI8A 4XOGA 3ZXFA 3LGRA 5H9SA 4JGYA 1ASJ2 1IQAA 1LTEA 4NOTA 4AEDB 3VDDC 1XNDA 4GWNA 4AE2A 5CBLA 4PQ9A 4D7TA 4BIOA 1ULEA 3J26N 3VGIA 3E6DA 2VNRA 2D3RA 4CEYC 2A3WA 2X5IC 3FUQA 5T50A 3AJYA 4Q4W3 4FT8A 2ZGLA 4YRDA 5D8AC 5F1RA 5JZGC 4LBQA 3HIFA 1DHKB 1WCDJ 4GULA 3VBHB 2CAUA 1PNFA 3OBRA 1H1AA 2E6VA 3AK0A 1ASJ1 4LE3A 1T6GC 4XMAA 4QHBA 4LBQB 1H9WA 3WCSA 5FRAA 1EAH1 1CD3G 1SLCA 5K8SA 3E6BA 3WUCA 2HYKA 2YPJA 1S0FA 3ZN5A 1I1EA 4Q0UA 1VBC3 3PJQA 4W6YA 4RSUA 1QXJA 5A3MA 1CX4A 2NYYA 2V73A 4LBMA 4DMIA 3WOGA 3GBFA 3WZ1A 3OGJA 4E4ZA 1Q8SA 4MLOA 2Q5TA 2WL1A 3KCXA 3TNPB 3VBUB 2E53A 1IS5A 1RUD3 3ZFGC 2K2SA 1AYN2 3M70A 1AR93 3S30A 5F6KA 5C4WA 2YGLA 3CJIC 3EO6A 2ZKLA 4QM9A 1YJLA 2VMHA 1Q8VA 4MGIE 4Q29A 1ZNPA 1F5FA 3MZHA 1W6NB 4COYA 5C4WC 2UWCA 2R1DA 4IL7A 1U0AA 3PVEA 4OHYA 3AMHA 2YUEA 3NAPB 2SLIA 4UBGA 1J1TA 1N1TA 5J09A 3O12A 4AI2A 5FDBA 4RS5B 3AM2A 1MZFA 4UXAA 4W6XA 2V5YA 1D2QA 5GLTA 1D4M3 5AFBA 4Z8BA 2RM22 4OLLA 4BCUA 1MEC2 3KMHA 1AVBA 1JYIA 2MEV3 4YM0A 4K9SA 4XQ4A 1R093 5K9YA 1YCIA 4BLIA 2ZABA 4LBQD 1FATA 1YLLA 3RNSA 1KS4A 4FCAA 1KRIA 2ET7A 2XH6A 2WZR2 4LHLA 4RD7A 3TN93 5A33B 2XJSA 3VZMA 3JB8A 5K7PA 4NHLA 3N7LA 4JTOA 4YFZA 3ZVXA 1XNKA 3J9SA 4LT5A 1QHDA 3VBOA 4AXOA 1REFA 3PVOA 3WQ1A 3POSA 3HWJA 5BNPA 1SLIA 4C90A 1ZBA3 1JYCA 1QNYA 4HZFA 3ROUA 1BBT2 4QT6A 4KG8A 4Q4Y1 2W0XA 3R4UA 3K51A 5HBAA 3KGZA 3WHUA 3K48A 3GHMA 1G86A 4S2HA 2BWCA 1S55A 2PA7A 4AHXA 1LOFA 1G8WA 4YZ2A 3NV1A 1QOOA 4A3XA 3TRSB 2RS31 3WW4A 2WNUB 2HWD1 1FMD1 1MZEA 1LOFC 5JR7B 4LLOA 5FPXA 3M3CA 1K5MB 2VOXA 4WZFA 4E9KA 3AZXA 4YG0A 1IKPA 4KL1A 2GC3A 4YW3A 1DU3D 2QVSB 2ZGUA 1NOVA 1BK1A 4GXLA 2C0ZA 4EV0A 5T5LA 3CF6E 1POV1 5H9RA 1PVC1 1RINA 4MVTA 3N7JA 2WFF1 5JOZA 3AFGA 3AB0A 1WBFA 3B01A 3SCFA 2PHWA 5DUWA 4E2GA 1M06G 4IV3C 5KHGA 1LU2A 2XWJB 3UKVA 5ACA1 5D1IA 1GQHA 1PVXA 1XE8A 2H0BA 1GFF2 2RS53 4KH9A 3ME2A 1LHNA 1RUH3 4Q0QA 4IEOA 1RTVA 4HMZA 3WQ0A 4LUKA 3X29B 5CFDC 4LBLA 4D7YA 1CJPA 1TME3 3WY6A 4YSFA 4IEZA 3M1HA 5JPNB 1A78A 1HRV2 2DTWA 1CONA 2UWBA 2V09A 3CJIB 3NV4A 2BW8A 5EJ3A 5BYNA 2MHFA 2HWC2 3S7EA 3JQXA 3VHOA 1CPNA 2D6NA 5J3UA 5FO8B 3LKJA 1DZRA 1OOPC 1U5YA 5A3LA 4I02A 5SV8A 5J36A 2CAVA 1DGRN 2OUJA 5JAXA 3USUB 1CN1A 1BCXA 1QWRA 1QXRA 3RMXA 5CG8A 1GNHA 3PHMA 2XVGA 3AMQA 1N3PA 1REEA 3KGLA 4YVWA 4LBKA 3WG2A 2VQAA 1H4HA 5EFUA 1C1FA 1SLTA 4SBVA 1LOAA 4XJWA 4QM8A 3OTFA 1C8M1 4IEXA 1H4GA 1JH5A 5KXCA 4IERA 5BNOB 2PFWA 4QQLA 5J37A 4I3PA 4WM7C 4KG0A 2GALA 4Y1VA 3MICA 4HK9A 5K0UC 4I3GA 4KGQA 2WQZC 2WNUA 2WNEA 2JENA 5HCFA 4D7SA 1QXPA 5DDJ2 3I8TA 1XU1A 2R072 3POWA 2ZJCA 3AKPA 3FWEA 4CEWB 1KDKA 4E27A 1Z7S1 2ZGMA 1CJDA 1V6LA 4MSVA 4CYDA 1OA4A 2A75A 5KC5A 1RUOA 1PO13 4C0BA 3EJKA 5CAZA 2ZGTA 1VBC2 4ONUA 3WV6A 4LO5B 3FLPA 3E5UA 3SXWA 4LO7A 1AF9A 2VY0A 2IXKA 2PAEA 5IK5A 3VDDA 2BNNA 4L97A 4A2UA 1S0DA 1PO21 3PJYA 5KXBA 1R1A1 4YARA 4DXZA 1NE4A 1WBLA 3H7JA 4ZU4A 4AVVA 1LOBA 1U5IA 4YVSA 1ZZ8A 3WQ7A 3AP9A 1DFQA 3J8F2 3IDBB 1PGL1 1CAUB 3O14A 4XFFA 5I0SA 1VBB3 1R081 2JJ6A 3AP6A 4XXPA 2WT0A 1FX5A 1PVC3 1DQ4A 1S0CA 1MQTB 2MNGA 4R52A 4Y1XA 3A0KA 4E2SA 3D0JA 2JECA 3E6CC 2I07B 2GSYA 3L9JT 1IPKA 1ZZ6A 2CNAA 3WHTA 4HANA 4CZSA 3QOPA 4FPJA 2WS93 1AR71 1NCQC 1WA4A 2ENRA 4YW5A 3VBSA 1FPN3 4J1XA 4I09A 4LR4A 5BY5A 3HN1A 2QZ2A 2RM23 3VHNA 4JV4A 3ZFEA 3TAYA 1G7YA 2NMOA 4P9IA 4XFGA 1NCQA 1OQDA 3KM5A 4JRAA 4BM8A 3TN91 1ZRCA 3AX4A 4OI1A 2NM1A 5FLIA 4A7YA 2PAKA 1Y7BA 1RUF1 2RS11 3U11A 1VAVA 4KWLA 5FMOS 3AXEA 4YW1A 4HKWA 3H9AA 1JTZX 5KC6A 1L3JA 5JZGA 1HV1A 4FXGB 5L73A 5CADA 2DCKA 2ZHNA 4D3WA 3JCIA 2E7QA 4RGGA 1GZWA 4COUA 2PELA 2D40A 1N3OA 4TWTA 1VP6A 2D6KA 4ISQA 5H9QA 4FO9A 4CDUB 1CVNA 5GJ6A 4Q1PA 4AHYA 1H0BA 4IEYA 3APBA 4LBJA 1RMU2 1VBE1 3WW3A 4AEDA 1OFSA 4XTMA 3B69A 3GALA 1O3SA 4QXKA 4QPIC 3GZAA 3I2DA 3UJQA 1DGWX 1BEV3 1KS5A 1TMF1 1HXS2 2P3KA 2HKXA 5JOYA 4A7ZA 4QGNA 3BB6A 3TYJA 1W6MA 3ZFGA 1AR62 3ZYJB 4FAHA 5GZCA 1OA2A 1TNRA 2H0VA 3PTYA 4Z92B 1C57A 1C8NA 2VG9A 1D0HA 3ZX7A 2CGNA 2DYCA 2ZX3A 4N9HA 4WM7A 5LRRA 5LRSA 4LA3A 3FMGA 4EWAA 2DCTA 1KDMA 1LU1A 4GQ7A 1RVF1 2VGDA 1YYNA 1Z78A 4WVZA 3E5QA 3JBG1 4URTA 5CFCA 3FLRA 1PGW1 1FYUA 2ZGQA 3DL3A 2ARBA 3ZSJA 5BNPB 4GH4A 5GKAC 1EV11 3DN7A 3IM0A 4PDWA 1F8VA 2ZKNA 1VBB1 5EV7A 2BEOA 3R4SA 3D4KA 3H50A 3CU7A 1GV9A 2CL2A 2DVDA 3BPZA 1RHI1 4P9JA 1RUD2 3V0BA 1LB2A 4CEWC 3W59A 1LEMA 2D93A 2HWB1 4PDWC 4EWDA 3O7OA 1H2KA 1D0GA 4FVVA 4XF3A 1QF3A 2A71A 4R9DA 2KXLA 1YIFA 1AX2A 3SNMA 1AR73 1C8M3 4YZ4A 3WG1A 2R063 1BJQA 2UY8A 3MI8A 4HETA 4M01A 4RFT0 3MLJA 3DF0A 5C8CC 1OSGA 1Q3EA 2DU1A 1SQ4A 4CRQA 2R0FA 1S0EA 3N7KA 3UJOA 4ISRA 1LODA 1VAKA 3L2HA 5EZWA 2LALA 5JIUA 1C28A 4A7KA 2BFUL 3AKTA 2XJUA 1MS5A 2Q30A 3NVCA 3AFKA 2RS52 1PK6C 4HBNA 3L2YA 2JDZA 4RQPB 4CP0A 1RITA 1RL3A 4IEPA 2AH2A 2HWE2 1DQ5A 3KLSA 1UIKA 1MS0A 4DQAA 3WDTA 3RI9A 3MIEA 4OZXA 5BV6A 1QJU2 2Y26A 3VBRC 4Q4V1 1LHUA 3NWKA 1WCSA 2EIGA 3KT4A 2JD4A 5HCBA 1A3KA 2R1BA 3VBRA 3QH7A 2FZ1A 5C8CB 3B94A 1UW8A 1G9DA 4JGYC 4Q4Y2 2ZAAA 4YLZA 1PGSA 3ES1A 2WQ4A 3H7YA 4XHBA 1J58A 4AVCA 4G4FA 2BNOA 1BMV1 2YHJA 1XYPA 4BPZA 4MYEA 2QNKA 2X5IA 3J8F3 2RE9A 1V6IA 4AG4A 4Y1UA 1RUJ3 1VBA3 5ABJA 1CQ9A 3QBQA 4P5HA 1UD1A 1S0BA 2OPKA 3AZVA 2UYBA 2O8QA 3ILFA 3GNEA 4LUMA 3RQ0A 2B45X 5CFCB 1QJX2 4XXAA 4XFBA 5ABJC 2ZGNA 3NKTA 1RUF2 1YI7A 1Q5OA 4UW6A 3QLQA 4GIQA 4DOUA 3SH4A 3HAGA 5BNQA 4AQ6A 5AFEA 1SLBA 1WMDA 2ILMA 4YNIA 4HVRA 2XJQA 3JB4C 4WVVA 1O3TA 3ZYIB 1IGOA 2EAAA 3ZXGA 3KSCA 3UV9A 1WLTA 1UZZA 1UIJA 3HMYA 4M00A 3GF6A 4Z07A 2P37A 1H2NA 5IK4A 1G6NA 4L2NA 3B00A 5CU1A 1YRZA 3A4UA 4OI2A 3MPBA 4YYOA 2WS92 3WDYA 2DUPA 2QZ3A 4Z2WA 2ZMNA 3VL9A 5ACA2 5JMCA 5GLUA 1Q56A 4TLFA 1XU2A 2EAKA 4XIKA 3CJXA 1ZREA 3WW1A 2XJTA 4EN8B 2YROA 1HRI3 2ZX0A 2VPVA 3H1MA 1PHMA 5GLVA 4O9GA 1AXKA 5J96B 1WD4A 1ULGA 1VBE3 1I3HA 4HPKB 5BUVA 4P9WA 1GQGA 4LO4B 2XPJA 4XFAA 2VQ0A 3KCYA 3MGUA 2WA4A 3JBG2 4B8EA 4BZ4A 3S0MA 4UW5A 1EP0A 4XIOA 4C91A 1RUC1 2PHXA 4RR3A 2O8OA 1WMFA 1Y3TA 5EXOA 4BE3A 4LBOA 5DZEA 1TME2 3AXDA 1VAMA 4IEVA 4CP1A 2BFUS 5FO7B 1NA1B 1U5ZA 2G4IA 1I9RA 1AYN1 3DUIA 4IV3A 5A32A 1ENXA 4LO8A 4I2OA 4RR3C 4DRVA 5LEKA 3VKFC 1NYWA 1QOSA 4YGDA 1ULCA 4AGRA 2WSUA 4CDXB 5DUVA 3CLPA 1C5HA 2X53S 3AMMA 1SFYA 2ZHKA 1ZZCA 1AXYA 1DLLA 1DDLA 2CTVA 2VMIA 1N1YA 4YG3A 2ZCWA 4COVA 2W08A 2R042 2RMU3 3NKGA 1FNZA 1PO12 1SEFA 2R062 1XYOA 4EROA 5E88A 2YGMA 4RQPA 3UL2A 2ZX4A 4L11A 1AYM1 3M8LA 1OQ1A 2B46X 4KU7A 4YW2A 3W9AA 1HIXA 1J3QA 3AKSA 2R073 4QPIA 3SHRA 4B4RA 4RQPC 5JSRA 2B9UA 1KITA 2WZR3 4WM8A 2ATFA 1MEC1 3AYCA 2A6VA 2HEWF 1FAYA 1YO8A 1RUJ2 2R061 2OYZA 4YVWC 3OD4A 3ZFFB 4FP2A 2P34A 4KBBA 1KFXL 1VLNA 4Y26A 4MXWB 1PIV2 1RJ7A 3DV8A 3JQWA 4C0HA 1SCRA 5DDJ3 4B7EA 4IV3B 2IFWA 1ZBA2 3MYXA 4EN9B 1F31A 2ZS6B 2DCYA 2WT1A 1QQP1 1QH7A 3TWIA 3WDUA 4DS0A 1ULDA 4N9IA 1JXNA 3H1YA 1OQEA 2Q1ZB 2QDNA 1H8VA 3O0WA 4X8NA 3AJZA 4S2GA 1BEV2 1NY72 3CNAA 3ECQA 3NAPA 4OHZA 4CEWA 2TNFA 3MFAA 4JC1A 2VVFA 3RJ2X 1H2LA 1R082 4JQRA 4K7JA 1IPJA 3ELNA 1K5MA 4M0NA 4AFAA 1CIWA 3NL1A 4Q4W1 1LESA 1W6QB 3AP5A 1BBT3 1ZM1A 4HPKA 2DV9A 5FO9B 3TNQA 2HWC3 4CDXC 4HK8A 1W0PA 2HEYF 1BXHA 3IT8A 1WMEA 3P3PA 3VBUA 4N7UA 2WIIB 2JE9A 4INDA 3VBHA 1SLAA 3FUOA 3VL8A 5T5OA 2Z2SB 3B9CA 4CP2A 5KWRA 2FHRA 2ZX1A 1N47A 4NWWA 3OCPA 4WM7B 4D94A 1Q8PA 1BKZA 3PMEA 5FCCA 1RUNA 3M3OA 1XQNA 4FOWA 1AL23 1LEDA 4GKXA 1DG6A 4XW3A 1F5JA 4M3CE 1RUI3 4R4XA 3ZXEA 3INAA 4Y24A 2HEVF 2R043 3H3UA 1RB8G 4XE9A 2D6LX 2XBO2 1WLWA 5GLWA 5L7OB 4OULA 5K0UA 1AR81 3BU7A 1IKQA 2QCSB 2RS12 4KNCA 4M3CB 2HWB2 1JUIA 3ZMOA 3ZMNA 2A3YA 1URXA 4FOVA 1HXS3 4BH9A 3IBMA 3ZFEC 3ZXLA 4CTEA 1V6NA 2D98A 1ZA4A 4JDOA 2DUQA 3OGGA 1JBCA 1QJY3 5FFOC 3MFCA 3LSDA 1W6PA 4JGZC 3V0AA 2TBVA 4F8AA 3VKLA 2Y0IA 1WW7A 1WW5A 2K0GA 5CA6A 2BPA2 2WZPP 1O91A 3ZFFA 2RR12 4HT1T 4AVSA 4YVSC 2JKBA 1VBB2 3GYDA 1HX6A 4GMP1 3WR0A 4JDMA 2HWE1 1BYHA 4IXLA 3VKMA 4IV1B 4F7ZA 1HKDA 3MIDA 2ZZJA 3AMPA 1XXNA 1R091 2GZWA 1UU4A 4S2DA 1NCRC 1DZTA 5SV5A 1ASJ3 3RS6A 5GLZA 1O4ZA 3ENRA 2JG9C 4CDQC 2VW0A 1OLRA 1YJKA 1ZBE3 4I30A 4YZ5A 2BVBA 5FTTC 5JSPA 1C8M2 1FNYA 3IWZA 3JD71 2HWF1 2YY1A 3WP5A 2ZGRA 4ASMB 1J1LA 1VBC1 3BODA 2ZGOA 1W39A 3FBYA 1UN1A 2XVLA 3LZZA 4XJ9A 1PGL2 5DG2A 3B7MA 2X29A 1QKQA 2FMYA 2XWBB 1LENA 5KHIA 1YUDA 3U4XA 1XE7A 2ZGSA 1AUYA 1COV1 2R0HA 4NR1A 4YGCA 1HW5A 2LM3A 1QJY2 1VRH1 4C1XA 5J98B 4AGGA 4Q4X2 1RUD1 1BBT1 5T5PA 2XLGA 4B3NA 1AJKA 2BVVA 2Q0AA 3RSJA 2D97A 1OPOA 4J1WA 4IV1C 3IPVA 1N3QA 3KB5A 4M3CA 5FMOL 2ZPXA 2Q4SA 2RMU1 1SACA 1W6OA 4FAGA 4L9BA 2D5FA 4UBHA 3VKOA 1VBA2 1TE1B 1CAVB 1HQNA 1GANA 3N35A 2YZ4A 1Y43B 5E8AA 2C5DA 5JPMB 3V0AB 4RL7A 4XQDA 1ALYA 1HRI2 2WZR1 1CPMA 2C9AA 3RG0A 2VNOA 3PVBB 1LGCA 4X6QB 5ACA3 2VULA 2RS51 1A6CA 2VECA 4QPGB 4NVPA 4GH4B 3VBHC 1YWKA 4PLOA 2ZAHA 2MEV1 1W6NA 4OUSA 3QACA 3HBZA 4MUVA 3M7AA 1SBFA 4BQ1A 2VVEA 5D8AB 3ZN6A 2OUHA 4DRRA 5C9AC 1DIWA 2XL9A 5I8YA 3MEPA 5C4WB 4C1WA 3I59A 2B5HA 2XKPA 1WLDA 2B7YA 5FQ0B 2PYTA 4QQ2A 2WFF2 2WKKA 4XDQA 2BNMA 1J3PA 2IC1A 1M4WA 1B09A 1PK6A 3ZSKA 1QJZA 1X50A 2DVAA 3NO8A 4PIXA 3LA3A 3E5XA 2OVUA 2O1QA 2ES3A 3ZYRA 4GH4C 2ZZQA 3D5OA 4H7MA 4CEYB 1YXWA 5HI0A 5KXDA 4HVQA 2HWC1 3LCPA 5KBFA 3ZO0B 1WCKA 4PBOA 2RS33 3FX3A 2A3XA 3ZXAC 2NZ9A 1RUG3 4AYUA 1FMD3 3BTAA 1W0OA 1AR82 2E9QA 1S2KA 4RR3B 3MW2A 3PVNA 1C5IA 2O0OA 4WM8B 4TSVA 4Y1YA 5I0RA 4XBQA 2C1FA 2ZBJA 4P14A 4Q4X3 1AL21 4K3UA 3WX5A 4DY3A 3CO2A 4Y1ZA 3FJSA 3M3QA 2EA7A 5DUXA 2R041 3MF9A 4DINB 1V70A 4DFSA 3KT1A 3FBMA 5AVAA 5JDBA 3B93A 2IFRA 1X8MA 1DGWA 2YC0A 5GM0A 4BWOA 1IS3A 1COV3 3MIGA 1VRH3 2A6YA 4XEZA 3RPQA 4Y4YA 1VBD3 1X33A 2XUMA 1VALA 5EWSA 1J3RA 3LAGA 3SH5A 3ZDSA 3THPA 4FSJA 3ASIA 1SCSA 1WLCA 2QJVA 5H9PA 4BOWA 2G9FA 1J59A 1WD3A 3IN9A 1QJY1 1VRH2 3MIBA 3LSEA 3FC0A 3ZIXA 1PZ8A 4FPKA 2PLV1 3M2MA 5JOWA 1X7NA 2NMNA 1DBNA 2I45A 4CDUC 1G9BA 4MXVA 4R4ZA 1RMU3 2WNVA 1JUHA 1MVQA 4MV2A 1AX1A 1ZYBA 1R1A2 5FLJA 1UX6A 4GMP3 4I0WB 4XFIA 5F6LB 2JG8C 3QCWA 4U2AA 3HD8B 2GN7A 1AXZA 2PHUA 1UF2C 4CDWA 4M0HA 4JTNA 1FPN1 4QPGC 1QY4A 1QJU1 2RM21 4B7KA 4X6RB 5I8SA 5L7OC 3FFQA 1NQDA 2EALA 1AR72 2DVBA 3MF6A 4EJRA 3AMNA 4XBLA 4CDWB 4N53B 1OPMA 4XF4A 1SBEA 4E4SA 1Q8QA 1COV2 1ONAA 1OA3A 2VUJA 4L99A 2F4PA 5L7OA 1NLSA 1NA1C 2IXJA 2CGOA 5C6CA 4LHKA 2RS13 1MS9A 5T52A 4B4PA 4WZCA 5IK8A 1QU0A 1IOAA 4BMBA 1MR5A 1ZVFA 1IS6A 5FPZA 3B5LB 1PO11 4CDXA 1OLQA 1RUI2 3WNXA 3LOBA 5C9AA 2FMDA 5FAXA 3VHPA 1LHOA 3WDVA 5J7MA 3AP4A 3LA2A 2WLQA 1DF0A 2EXJA 3EHKA 1XRUA 2HWF2 4UW4A 1OMIA 2BQPA 3VZLA 2CWSA 4ITCA 3VKNA 3ETQA 1UL9A 2D44A 1BMV2 3D8CA 4Y22B 5B2GB 5KHKA 4FQZA 4RGAA 2I2SA 4WVWA 3BCWA 2RHPA 1LCLA 4S2FA 4NO4A 1HRV1 4OFGA 3FLTA 4O9EA 2D6MA 3E97A 4QQPA 3ZIWA 1X82A 1R083 2GMEA 2OZ6A 2P17A 1QGLA 2WC2A 4YVWB 2XVKA 1NCRB 4PJYA 5HXVA 4YW4A 3KCCA 4Y20A 3ST7A 3UKTA 2QDRA 2RMU2 4HKLA 1IS4A 3NJZA 4OHVA 2D3PA 3THTA 3VBFC 2DURA 4F83A 2IXCA 1TMF2 1PZ9A 4MGYE 3M4FA 1QDCA 5KXEA 1O3RA 4DZGA 3FHIB 3M3EA 4Q1RA 4P9LA 1H30A 2DFBA 1GICA 1PM7A 1GZWB 3V64A 4AHZA 1DQ6A 2PN5A 3AZZA 1GR3A 2WA3A 4AGVA 1KD7A 3MIHA 4AVAA 2BGCA 1N1VA 2XBO1 1S0GA 3EQEA 1NY71 4MXWA 1KFUL 2VXRA 1OD5A 1B35C 2XJPA 3ZPYA 2AUYA 3MLLA 1LOCA 1R092 1FXZA 1PIV3 1MQTA 3WW2A 4E2QA 2PLV3 2ETEA 4PDWB 1B35A 1RMU1 1VBE2 2Z42A 1EV12 4PCRA 1F9KA 4K1ZA 1G9AA 4XF0A 5FREA 3VZOA 2VW1A 4R8HA 4MX3A 4H7LA 4EN7B 1NCRA 1OKQA 1Z7S2 3N7MA 5BNNC 3LOIA 3ZFEB 2FQPA 2VU9A 3R0RA 4ES8A 1IHMA 2JICA 1FV3A 4OVEA 4Y22A 4FQ4A 2JX9A 2AR6A 4HN0A 1RUG1 1GZCA 1K5MC 2AYHA 1UPSA 5CFDB 1BVVA 5GZGA 4XYXA 1N1SA 1EPZA 2H6BA 4XTPA 1LKNA 1EAH3 3VBRB 4Q4X1 1G9FA 2WNVC 3OJBA 3VBOB 2GNMA 4RA0A 4YVSB 2P3IA 3AZWA 2CV6A 5EYYA 2WNVB 3VBOC 1MS8A 4WBBA 4AF9A 4COWA 1HV0A 1CAUA 2BYVE 2ZTNA 3WVJA 4P9XA 4JCKA 3WD5A 5AC93 4K21A 3U10A 3ZXKA 4B4QA 3V0BB 1V6OA 3NV3A 4AEKA 4LE4A 5FOBB 3H0OA 4NPRA 1A8MA 3Q9OA 2A73B 1ZZ7A 1GYKA 1LOGA 3JUUA 4Q4V3 1ENSA 1ZBE2 5C8WA 1UCXA 5JI9A 2IWGB 2PLV2 1AZDA 4ZU7A 1VB2A 2LTNA 4ATFA 4AVTA 4N53A 1QJX3 1NA1A 5A32B 4GB32 3CEWA 4WVMA 2VW2A 1AR92 1GZ9A 1H8TB 1HLCA 2Z5WA 4Q8KA 5JLVA 2DF7A 3D6EA 1RUE2 2A6XA 4PIZA 4N53C 3AP7A 1W6MB 2PHLA 3AYAA 1VJ2A 4DPNA 4YM2A 5JSOA 4IEWA 2NLRA 5GZEA 1DQ1A 4N43C 4JGZA 4W6WA 1JN2P 4I0AA 3USSA 1RUJ1 2DTYA 2KM2A 4Z82A 4LBNA 4META 4Z1VA 3KT7