3AXDA

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase v18y/w203y in apo-form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
b'MKDFSGAELYTLEEYQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKSPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDYTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Rational design to improve thermostability and specific activity of the truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase
pubmed doi rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 59
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2011-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3axdA00
5F5QA 4DS0A 2RHPA 1QU0A 4XXAA 1CPMA 1LHWA 1WD4A 2VXRA 1SLTA 3V0AB 2ZGRA 2ZMNA 3HR9A 4YW5A 1DHKB 1CN1A 4M3CA 2ZGUA 2EXKA 4YG3A 4CZSA 3A4UA 2E51A 1BJQA 1VLNA 4Q8LA 4GKXA 5HCBA 3WHUA 1U0AA 3OY8A 2DVDA 3FLRA 4LBLA 4Z8BA 3AYCA 2NMOA 1GNZA 1GNHA 2D43A 2JD4A 3IKWA 4TYSA 4C1XA 2P3IA 1S0DA 1HQWA 4XJZA 1C4RA 5IK5A 4WVVA 2NZ9A 4P14A 4Y1YA 1IKPA 3RS6A 1QMJA 2GALA 1W6QA 3C2UA 3ZXFA 4GXLA 1V6JA 5DUWA 1Q8OA 1W6PA 3BOPA 3O5SA 5EYXA 2VW2A 3N36A 3OGGA 4FOVA 4GALA 5T5OA 3W58A 3HMYA 1MS9A 2GN7A 2R1DA 2OUJA 1IS3A 5AVAA 4Q2FA 1EPWA 4Y24A 4H55A 2GNDA 4I30A 5HCAA 2DVAA 1F31A 1S0FA 3WDYA 4Y1ZA 4XHBA 5CB7A 3ILFA 3ENRA 1HLCA 2YMZA 3WV6A 4Y1XA 2CYFA 3IMNA 4M3CB 2R0HA 1N1TA 1VAMA 2ERFA 3IM0A 3O12A 4JC1A 1S0JA 3VUOA 1VAVA 2DUPA 1UL9A 1BZWA 1DQ6A 3OY8B 4YGCA 1IS5A 4U36A 2GMPA 1W6NA 1IS4A 1CONA 1PZ7A 3POSA 4WV8A 3ILNA 1LHUA 4CRQA 1DQ1A 1V6NA 2WKKA 4Q1RA 1LEDA 1UKGA 1Z0HA 1AJOA 5CAZA 1MS5A 2VUAA 3RRDA 4YW2A 1CVNA 1W6QB 1SCSA 2CWSA 4BMBA 1YI7A 1W6PB 2JDZA 1GLHA 2GN3A 2ZKNA 3ZXJA 1KRIA 1QF3A 2SLIA 2JE9A 2DVFA 2B7YA 2I2SA 1AX1A 1CR7A 1IS6A 3APBA 3N3HA 5DUXA 3VV1A 2GDFA 1R1ZA 2WSUA 5H9SA 5FRAA 1AX2A 3V64A 3AXEA 1CJPA 2CWMA 4Y22A 3MW2A 1DYKA 4BLIA 1W6MA 1UZZA 5T50A 1Q56A 4Y20A 1FX5A 1FYUA 1ULDA 1GZ9A 1GKBA 3WOGA 4JCKA 2W39A 3AP5A 2DV9A 2ZHNA 3AZWA 3N7KA 1V6LA 2DURA 1MACA 1MR5A 3QCWA 1WLWA 4P9XA 3SLIA 3WG2A 1GBGA 5DG2A 4AVTA 3WLUA 4XBNA 1D2SA 1UMZA 2ES3A 4XTMA 1ULFA 2ZHKA 3LSEA 1LODA 1W6NB 1W6OA 5GZCA 1ULGA 1V6KA 2A3WA 2P34A 3FLPA 4HL0A 5L73A 4BOWA 4K21A 1MS1A 3WG3A 2ZGNA 4BQ1A 5EYYA 1G9BA 2EXJA 2VH9A 3JUUA 1H9WA 1WW5A 2UWBA 2D6KA 3FFZA 5BYNA 1QNYA 1WW7A 1ENSA 1AVBA 1TEIA 1UAIA 2D44A 4CTEA 4XJUA 3N7JA 3ZPYA 1J1TA 3M3OA 3FUOA 3WG4A 4C1WA 3RMXA 3ASIA 3AP6A 4UW6A 1LHNA 1W6MB 4FPEA 1FAYA 2R1BA 3N7MA 4Y20B 2YZ4A 3AYAA 1LGCA 2ENRA 2DU1A 1DYPA 1SCRA 1JYCA 4MYEA 3TAYA 1ZA4A 1JXNA 2BQPA 1ULCA 2ZMKA 4BPZA 2A71A 3VKFC 2PHUA 1LOBA 1I3HA 2G4IA 3NV2A 2D6PA 3BODA 4UW5A 2DVGA 2D7FA 2SBAA 5EWSA 4Y1VA 3GNEA 3UJOA 1YXWA 1UX6A 3UL2A 3DGTA 1W6OB 1AF9A 4NO4A 4WZFA 5GZEA 1KJRA 2E7QA 3BTAA 3OBRA 3OPZA 1H30A 1RIRA 3MPPG 4XHXA 1H9PA 1JW6A 3D5OA 4LBQB 3T1MA 2Q5TA 2FMDA 3MEPA 4SLIA 3ZSJA 2JE7A 2YV8A 4TZDA 5T5JA 2ZBJA 2AREA 1A8DA 5IK4A 3AZYA 1G9FA 5FREA 1LOGA 1Q8PA 1VIWB 1LOFA 4L8QA 3WG1A 1KJLA 4ATEA 1IOAA 4BM8A 3WDWA 2V73A 4ATFA 1N3QA 1DQ5A 1GZCA 1ULEA 4YZ3A 4YZ1A 1GZWA 4M3CE 1WBLA 4FPOB 1JBCA 4XZPA 2A6YA 3OYWA 3R05A 3V65A 3ZXKA 5GLZA 2C9AA 4FOYA 3AYEA 1WLDA 2XB6C 5CBLA 5SV8A 1JHNA 3RG0A 4XJ9A 2WT2A 3A0KA 3SH5A 1WD3A 3WUCA 4YM3A 2VU9A 1Q8SA 1QOTA 1SFYA 3A0NA 2W68A 3MW3A 3PVOA 4YGEA 1NXD1 4YZ5A 3WCRA 4FPLA 3FBYA 1ONAA 2GMEA 4JRAA 5KXDA 3DUIA 3WDUA 1YYNA 1Z78A 3Q9OA 4U2AA 4YFZA 1FNYA 3AXDA 3L2YA 4PF5A 4KBBA 5T5PA 3OJBA 3ZSLA 2UWAA 4PCRA 2VW0A 2LTNA 1QDCA 1GSLA 1GANA 1S0GA 2C5DA 4ISRA 4M00A 4YM1A 1SLIA 1V6MA 4Q26A 3SH3A 4FPFA 4FPJA 4AGGA 3SNMA 4GWMA 1NLSA 3IPVA 5DXDA 5GLWA 4YM0A 5GZGA 3D4KA 3UK9A 4DQAA 2ZGTA 1AJKA 2D6NA 1SLLA 3N35A 1W0PA 1GZWB 1W0OA 4Q27A 4AGRA 4XBQA 5E89A 3OYWB 4LBJA 5E8AA 2EALA 3U4XA 1DZQA 2JKBA 5IK7A 2E7TA 2NMNA 4R9DA 1HQLA 1G9AA 1LESA 1AXYA 5E88A 4YW1A 4AGVA 1LJ7A 3O0VA 2DUQA 3M3EA 3SITA 1JN2P 4Q8KA 1SBFA 3AP7A 2R49A 4K1ZA 1LGBA 1MS4A 1LOEA 2P37A 5KXEA 2OVUA 3FUQA 2CTVA 1D0HA 2DU0A 4P9YA 4PBOA 1N3PA 5CA6A 3V0BA 1FV3A 5H9QA 1BXHA 1UN1A 3ILRA 2A6ZA 3B01A 4XIKA 2ZMLA 1SLBA 3IPVB 1F9KA 2CL2A 2PHXA 3I4IA 5EXOA 2E6VA 4FP2A 4XIOA 1QNWA 1BYHA 2D6OX 1JYIA 3WDVA 3AZXA 2EIGA 1A3KA 1GYKA 1OFSA 2NN8A 2Z42A 4YLZA 2AGSA 1SBDA 3ZYPA 4LBQA 4YM2A 3ZVXA 1I1EA 4XXPA 4PQ9A 2A6XA 1HDKA 2ZGQA 3RQ0A 3SISA 3VKOA 2YROA 1LENA 5GZFA 4RA0A 4XBLA 1LGNA 4Y26A 3WDXA 4F83A 5F9TA 1LECA 1N3OA 1Q8QA 2XG3A 3FLTA 1VALA 2A3XA 5JOWA 1APNA 2UU8A 1DIWA 4LBQD 3WZ1A 2ZACA 5DUUA 5H9RA 1DFQA 1PZ8A 1OKQA 3ZXLA 4AYUA 3V0BB 1ENQA 1G86A 5DZEA 2NP0A 2PELA 3NV1A 4FVVA 3M3QA 1KDMA 1S0CA 3WUDA 4YGDA 1LU2A 1BKZA 4FQ4A 3VKNA 2ZHMA 1FV2A 3H0OA 1MS8A 4XJWA 4ZXKA 1V6OA 1SACA 5JMCA 4K1YA 1MS0A 1IKQA 2P3KA 2DVBA 4P9WA 2DTWA 1DGLA 1KITA 2WT0A 1CPNA 2D3SA 2P2KA 2DYCA 2WLQA 1V6IA 5H9PA 2HYKA 1YIFA 4UW4A 1LHOA 3B00A 3NV4A 3GALA 3O0WA 3QLQA 4FOWA 5JOZA 4GKYA 1CQ9A 2ZA9A 1MZ5A 3PVNA 1RITA 2WQZC 3WHTA 1F5FA 3O0XA 1MVQA 4FOQA 1BQPA 5GZDA 3AJZA 4FPHA 1HKDA 1JUIA 2D3PA 3B9CA 3MW4A 1S1AA 3PJQA 1KDKA 4PBPA 3T2TA 3HN1A 1LEMA 3IN9A 1DQ4A 1LU1A 4XILA 3RSJA 1SLAA 2ARBA 2DTYA 5GALA 2FHRA 5JOXA 2OUHA 3AFKA 1N1SA 1CIWA 4ZKTB 2R0FA 2AUYA 1CESA 4HANA 5GM0A 5GLUA 3WVJA 4ASMB 4K20A 2PHTA 2NYYA 4FP3A 4RL7A 1AX0A 1G9CA 2H0BA 3KM5A 4IQPA 3ZXEA 2W52A 1QGLA 1LOAA 2CY6A 4YW3A 3WDTA 3LSDA 2DUOA 1AXKA 1Q8VA 4YZ4A 4AVVA 1V00A 1C1LA 2A70A 2WSVA 2ZGKA 1C1FA 2ZAAA 1WW4A 1SLCA 4XE9A 3M3CA 2AR6A 4GWNA 2YY1A 3I8TA 5KXCA 1DQ0A 1MZ6A 4YG6A 2AENA 2OW4A 5DZFA 1G7YA 3B69A 2GMMA 2EXHA 1KQRA 5LK5A 2YXSA 5JDBA 1OQ1A 1N1VA 1DQ2A 5T52A 4W65A 2A7AA 1MS3A 1S0EA 3OBTA 4LBOA 5GLVA 5JVVA 5DZGA 1XQNA 1YRZA 3M2MA 2ZZJA 3N7LA 1WW6A 3D6EA 4FPGA 2ARXA 2W08A 4AVSA 2EXIA 1S0BA 2GNBA 3ZSMA 1UPSA 2VY0A 3USUA 4M01A 4R9CA 3JU9A 2PHWA 2ZGLA 2WNEA 1GV9A 4LBMA 1LTEA 1QOSA 2DWRA 4XMAA 5JLVA 2AH2A 2ZGPA 1JOJA 3AYDA 4XYXA 3RMYA 4WVWA 2D3RA 2WT1A 3AK0A 5IUQA 1O4YA 3NV3A 4R9BA 1Y7BA 3WCSA 3SH4A 3KQRA 2PHFA 1FATA 1LOCA 2A6VA 2JJ6A 3POYA 2KM2A 4LBNA 1C57A 5DG1A 1LCLA 1GICA 4YGBA 5HCFA 1LHVA 3LCPA 4LBKA 4GA9A 2AYHA 3AZVA 4YW4A 2A3YA 2GNMA 2WJSA 3B3QE 3AP9A 4XMIA 5T5LA 4XTPA 4M3CF 2PHRA 2GNTA 4Y1UA 1AXZA 1LOFC 1N47A 2NM1A 4XDQA 2CNAA 3AZZA 4XJ8A 2D6LX 3USUB 2ZGMA 5IK8A 2A6WA 2V5YA 5CNAA 4FPYA 3R4SA 1WCSA 4XJAA 4FPKA 4NOTA 2E53A 1MVEA 2TEPA 3ATGA 4ITCA 4DFSA 1DLLA 1ZM1A 3BIWE 1URXA 1N1YA 1O4ZA 5GJ6A 1WBFA 2UWCA 3ZYRA 4FPCA 3AP4A 3T1LA 1RINA 2A5ZA 5DUVA 2R16A 3VKMA 5IT6A 3W59A 1FNZA 2LALA 1X50A 1WLCA 1DBNA 4DPNA 2ZGSA 3PVEA 4YFWA 4DRVA 1UZYA 4AWDA 2D6MA 2P3JA 1S0IA 1QDOA 3M1HA 3INAA 1G9DA 5T55A 4BLJA 1QOOA 4UW3A 3V0AA 1B09A 3ZSKA 2UURA 4ISQA 5T54A 2VW1A 4YG0A 3PMEA 4FQZA 4Y22B 2ZGOA 1QKQA 4R9AA 1A78A 4XOGA 1YO8A 2ZABA 3UJQA 3NWKA 3AJYA 1PZ9A 2EAKA 2A75A 3R4UA 1SBEA 2JECA 4D69A 4OZXA 3TB0A 3POWA 3WNXA 1AZDA 1G8WA 2ZHLA 4YZ2A 3VKLA 1WUVA 2EF6A 3AX4A 5JOYA 4DRRA 4BMEA 5GLTA 5KXBA 3CNAA 1ENRA 4Q1PA 1LULA
chains in the Genus database with same CATH superfamily
4GH4B 3KV4A 2YGLA 4HBNA 2VXRA 4PQQA 1F4HA 1SLTA 1TZOA 3VBHA 3V0AB 1BLZA 4YW5A 4MO3M 1DHKB 5DDJ3 2HWE1 1CN1A 5APAA 2JG8B 4HVOA 5K7PA 5L9VA 1ND3B 4GKXA 4MADA 1ODNA 1GMMA 1XNAA 2Y38A 4LBLA 4UF0A 2DBNA 4HONA 1GNZA 3IKWA 3BYWA 4HN1A 5CADA 1UOFA 4A41A 4BJ0A 2P3IA 1SDWA 4MH0E 1HQWA 4QQOA 1FPN3 2WQ8A 5FZGA 3ES4A 1VBC3 3AMPA 4Y1YA 1SZBA 3T4VA 3VBOA 1QMJA 2BP6A 1W6QA 4K8FA 3S0MA 1V6JA 4PIZA 3KSCA 1W6PA 1G6NA 4NAMA 2X8KA 2XR4A 1FMD2 3OGGA 4JDNA 2P1BA 3KT4A 4HMZA 3JBG2 2R1DA 3MLLA 1IS3A 5AVAA 5FUNA 4EN6B 4Y24A 2VZ3A 5BNPC 4LE4A 3VZMA 1JYVA 5FTTC 1BEV1 1WLTA 3E5QA 4Q4X3 5FWJA 4XHBA 2WO2A 2OX0A 1NCQA 5LA2A 4BIOA 2PAEA 1W9FA 4QKDA 1AR72 5FQ0B 2JDUA 2V4AA 1Y3TA 1VMFA 1AYM2 4BHPA 1W04A 1N1TA 1VAMA 3VUOA 2VCBA 3O12A 3TNQA 1UL9A 2WZR1 1DQ6A 4YGCA 1W6NA 3FE5A 4B4RA 2VMHA 2PHDA 2VZUA 4WV8A 3ILNA 1LHUA 1X8MA 1V6NA 4QKNA 2ADEA 3HQXA 1Z0HA 4TWTA 3KCXA 1O7FA 4BMBA 1ZBE1 5J96B 1KGYA 1UY1A 3LAGA 1AL0G 4IV1C 3NQHA 3NAPC 4NUBA 3I2KA 2RS53 1ZNPA 1IS6A 5C5UA 5F39A 3VV1A 3ZYFA 4IV3B 4RGAA 2GDFA 1R1ZA 2WSUA 1QY4A 5FO7B 3LOBA 1GNYA 1O8PA 3KMHA 1CJPA 2CWMA 2C1FA 2JDNA 1DYKA 2XHNA 5FY9A 4OQ9A 1W6MA 4A7ZA 5KR7A 5T50A 2Z79A 2O8OA 4LO8A 4Y20A 4XFCA 4ES9A 3KV6A 2VZ1A 1ULDA 1RHI2 3WOGA 2YYOA 2W39A 3AP5A 4LULA 3ZFEB 1SMVA 3AZWA 4NHKA 4O9GA 3O1TA 2NPIA 3B94A 4XUOA 1MR5A 1VRH1 4LK6A 1RVF2 4AFBA 1GU3A 4KWKA 2GC3A 1PO21 3WLUA 1UMZA 2ES3A 1U5XA 2ZHKA 3GJAA 4QAWA 4UI9L 2VNRA 2P34A 3OEAA 1MS1A 2EXJA 4OCTA 2YFUA 4IUGA 5C8WA 3I7DA 2R072 2D6KA 3FFZA 4HKWA 3M3IA 5A6QA 1QNYA 3TYJA 3WT3A 2VZTA 1O3QA 5FZOA 3TEWA 2OZJA 4DUXA 1OBNA 4H7LA 4IEPA 3ZDSA 1J1TA 1PO13 1YFUA 2BNNA 4P00B 4AEKA 3J7LA 2UYBA 3RMXA 4UW6A 3U78A 5LEKA 3Q8EA 3HVDA 1WCDJ 3ZLIA 2PMWB 1XU1A 2XHKA 4I3PA 4Z2AA 1YUDA 1DGWX 4F3JA 1GOFA 1NQJA 4JHTA 4EN8B 1RUH3 5CEHA 4IEVA 1SCRA 3ETQA 1ZA4A 3EO6A 3AVSA 2AZ5A 3WW2A 1RUOA 4RR3B 2PHUA 1Q5OA 1H1MA 1LOBA 1MEC2 2XLAA 5EJ3A 3NO8A 4YVSA 1SHWB 1XOYA 3MIHA 4Q0SA 3GNEA 3KHCA 4QD2A 3UL2A 2WYSA 5FZLA 1W6OB 1AF9A 3DYPA 3VLBB 1C28A 2WA4A 4OI2A 5FZ9A 3E6BA 3O1VA 2XVLA 3MPPG 2BVVA 3JB4C 3NNFA 2ZX0A 1JW6A 1VB2A 2VJXA 2Q5TA 4NIGA 5BXXA 4TZDA 4SLIA 5ACA1 2BGOA 2HWD2 5A7WB 2KA3A 2WBKA 1JYTA 5L19A 5JMOA 1G9FA 2J1UA 2W9XA 4L8QA 1DGWA 5F2SA 3VBSC 4XF9A 3OCPA 2VUDA 3C7EA 1IOAA 1OT5A 5FZBA 2V73A 2BDRA 1GP5A 1GQHA 1GZCA 1UO9A 1GZWA 3MDPA 3I3DA 3OUHA 4H7MA 2VTFA 4HSLA 4YYOA 4M0HA 4HG6B 1QWRA 4QPIB 4QGLA 1COV1 2PLV3 2XB6C 4MZUA 5A6YA 1JHNA 1ZBA3 5ABJC 3WUCA 3A0KA 3ACIA 3AVRA 3MF6A 4NR1A 2WFF2 2VU9A 1Q8SA 3OBAA 4BDVB 4CDUB 2W68A 4NN0A 4Q0UA 4XFIA 4YGEA 4YZ5A 2GH2A 1R082 3FBYA 1ONAA 2GMEA 2ZTNA 4FFHA 4KG8A 5KXDA 3EXUA 1OOPC 3DUIA 4KU7A 1Z78A 4WBBA 4U2AA 5FUIA 1FNYA 3AXDA 4AFMA 3H3ZA 2VW0A 1X7NA 2LTNA 2QQLA 4LIVA 2C5DA 2IWGB 3N9LA 4ISRA 4YM1A 1SLIA 2R041 3URFA 2XPJA 1OHFA 1FMD3 4HFSA 5C33A 2VMCA 4FPFA 3WQ0A 5DXDA 3JD71 3JBG3 5FPAA 3A22A 4YM0A 2W1SA 1O4TA 4META 4HKOA 4WZCA 1VRBA 3I59A 2ZGTA 3GZAA 5FP4A 3VZJA 2J1EA 5BUVA 3SEEA 4EE2A 4Y5TA 4AGRA 2D98A 5E8AA 3U4XA 2XBO2 3UNPA 2Q8CA 4R9DA 2N7GA 1BCXA 1BK1A 1AR73 2P17A 4OLLA 5KBFA 4DUVA 2DUQA 3DPRB 2RDRA 3ES1A 3NNMA 1AYM3 4P9IA 2HWF2 3M3EA 4ZY9A 4Q8KA 2HLEA 2R49A 4K1ZA 2LM3A 3J26N 4RS5B 3SC7X 4EV0A 3CZUA 1DLCA 1LOEA 1NZIA 3ZO0B 2P37A 5KXEA 5FZEA 2JXAA 2ZEZA 3NJXA 3J4UH 4P9YA 2HWE2 1NZCA 2WDBA 2WUHA 1FV3A 1DYOA 1KFUL 1W28A 2VCMA 5ANQA 3CKHA 5JSOA 1FT9A 4Q4V1 1VPHA 3UYJA 3IPVB 1UX7A 1VR3A 1ZRIA 3LPGA 4P9JA 3S7IA 3POBA 4CDWC 3UGGA 3HBZA 4A4AA 3I97A 1BYHA 2FCUA 1AR91 2D5HA 4CP9A 3WDVA 1ZX5A 2VCCA 1HJFA 1RHI3 1ZZ9A 4COWA 2Y26A 5FZFA 1GYKA 2Z42A 3FWEA 2AGSA 1SBDA 4XW3A 1W2OA 5C3SA 1I1EA 3H3UA 4HPKA 1RVF3 2O0OA 3VKOA 1BEV2 4XUNA 4BQWA 3ZYGA 5JZGB 1LGNA 2LS6A 4Y26A 3S5AA 4Q4W1 5CYYA 4AI9A 2K0GA 4EWDA 3WNPA 5JOWA 1YFWA 2BU9A 2QQNA 3IWZA 3VHNA 2CU5A 4NHXA 1YQCA 5FYHA 4A3XA 3MGUA 2QTWB 4UFLA 1GWKA 1GQPA 1XNKA 1UU6A 2R073 3MLKA 3PUSA 3CF6E 4UFJA 3THTA 1S55A 4YGDA 5FJHA 2ZHMA 3HNMA 1OA2A 3H0OA 4N43B 2XJPA 3GZUC 5D8AB 5JMCA 5B2GB 4K1YA 1MS0A 1IKQA 4K8RB 4P9WA 1KITA 3OTFA 1CZSA 4ZZ5A 5A7PA 1NY71 2WT0A 1UNBA 3ACHA 1W39A 2G19A 2D3SA 4QX8A 1ZBE2 2P2KA 1W2AX 2WLQA 5H9PA 2HYKA 1YIFA 2FZ1A 3P3NA 3PUQA 4KWLA 3GALA 1O59A 2TBVA 2UY9A 4IV1A 1CQ9A 3NAPA 5I0UA 1MZ5A 3T0AA 1YQ5A 2WQZC 3O0XA 1MEC3 4FOQA 5GZDA 4AFDA 1HKDA 1JUIA 4Q0VA 3BU7A 4PBPA 4NRMA 3T2TA 5ISLA 2FDGA 2CDOA 1L7RA 1DQ4A 4DB5A 2RDNA 3GM8A 1VP6A 3PUAA 1O91A 4P9GA 4XILA 2W1WA 3I2IA 4CDQB 3ZXGA 1VRH2 1XSRA 1J84A 4ZKTB 2R0FA 4XUQA 5GM0A 1PO22 5IAVA 3WVJA 5FDBA 3DF0A 1H4HA 2WABA 3SXWA 2HWD3 3OD4A 2VE1A 4AEDC 2DFBA 2QQWA 3OGSA 1GQGA 3ON7A 1H8TC 5JPNB 1QGLA 5FP9A 2DCZA 4YW3A 2J1AA 4FI9A 5D2AA 4MSVA 5FUPA 4IW3A 3MIBA 3R0RA 3E1F1 2PHLA 2ZXQA 2ZGKA 1C1FA 3TEYA 2ZAAA 1D4M1 2RJLA 3VDDC 1EV13 2MEV3 4R4ZA 2JIGA 3D8CA 1NQDA 5EZWA 2R32A 2XGXA 4NHMA 4WM7C 2WFF3 1BBT1 5FO8B 3I8TA 1DQ0A 3POEA 4KQ7A 4WM8B 5BNQA 1R083 2WZEA 2AENA 2OW4A 2JB8A 5DZFA 1G7YA 5KWRA 1HXS1 4L97A 5LK5A 4NWVA 3PDQA 1N1VA 2DFCA 2W91A 3CJIB 4QT6A 4CU6A 5FYZA 5JVVA 3ALQA 3OBTA 1J83A 4FPGA 1NA1C 2XWJB 3D6EA 2OA2A 2Q8EA 3LEKA 1EAH1 4AVSA 2GNBA 4NVPA 2VY0A 4CE8A 2Y6GA 3SKJE 4R9CA 3S6PA 4CCJA 1JZ8A 1OD5A 4UFKA 2ZGLA 1UZVA 1ZZBA 1QOSA 2DWRA 4LBMA 3V56A 4KG0A 4AVCA 5JLVA 3ACFA 5IFPA 3VDBA 1JODA 3USSA 3AYDA 2WYFA 1DGRA 4CEWC 3N4MA 1CWPA 1X9TA 2D3RA 1LNSA 2GU9A 3AK0A 1PK6C 5IUQA 5BNOC 1O4YA 5CG9A 3NV3A 4R9BA 1Y7BA 2W0XA 2XBO3 3H3LA 5ACA2 2W47A 1QQP1 2OKXA 4AEJA 3FN9A 4ZHNA 3O1MA 3POYA 2C24A 3TN91 1RYYA 4N53C 3LA3A 3VBOB 1XYPA 2HWF3 3R6SA 5AVPA 2RM21 3OOXA 4LBKA 2OQ7A 3U07A 1LRHA 1NUKA 2GC0A 3O1UA 3B3QE 1COV2 5T5LA 1QJU1 4JDOA 2HWE3 5LBEA 5LZ6A 2GNTA 4Y1UA 1W90A 1XPWA 5ABJA 4NPMA 1AXZA 2VMFA 4LOSA 4W6WA 4XFFA 3USUB 3AZZA 4EWAA 2D6LX 5IK8A 2ZGMA 5FXWA 5BPXA 1E5IA 2A6WA 3H1MA 4FPYA 3R4SA 1WCSA 4L2NA 1YQ6A 2P5BA 1R1A1 2E53A 2NLRA 4FPKA 5BV6A 1OH3A 1MVEA 1PVC1 5C3QA 3ATGA 4C90A 1ZM1A 3BIWE 1NX9A 3ACGA 1URXA 4Y4RA 4CUGA 1L3JA 1O4ZA 1W9TA 1WBFA 2OZ6A 2R042 5SV5A 5IVYA 4Q0PA 4YNIA 5HV0A 4MG2A 1US2A 3JD72 4RHV1 5C3PA 2Z5WA 1XE0A 5EV7A 5C8CB 1DBNA 5FMCA 3T2QA 2ZGSA 3PVEA 1OD3A 2IXCA 3ZR5A 1IPSA 4LOTA 3HPNA 4IEQA 1BEV3 2D6MA 4LKEA 1QDOA 1HN0A 3H1YA 1REEA 3INAA 2HEYF 5JR2A 2CV6A 4EN7B 1C3HA 2WN3A 1RXGA 5CISA 5G04L 1NCQC 3POGA 3WF0A 5FYYA 1UXZA 4AI1A 3WNMA 2VW1A 4LLOA 3PIGA 2VOWA 2JX9A 4OHWA 1RB8G 4R9AA 4XOGA 5C9AB 3PJYA 2Y0OA 4CVUA 2WZR3 3VB9A 2E9QA 1CX4A 3TNPB 1W2NA 5FLHA 5AC91 4QHOA 5IWFA 4AHWA 1UF2C 4MHUA 5FYMA 1YI9A 1O5LA 2X5IC 3WNXA 3RI9A 1ZBE3 4CCLA 1X9PA 4YZ2A 4A42A 3I2HA 4Q4V2 4QQLA 3VKLA 5JOYA 3CU7A 4B29A 5FO9B 4NAOA 5KXBA 3RRDA 4Q1PA 1WCKA 5F5QA 4DS0A 1AR92 1ZRFA 5CVRA 1J3QA 4CDWA 1IZ3A 4FAHA 2ZX3A 2ZMNA 3BVCA 3DKQA 2BGCA 2ZGUA 4GWIA 3SCFA 2MNGA 5C4WB 1VRH3 2XJTA 4LT5A 1BJQA 3IMMA 4LHSA 5HCBA 1U0AA 1U5ZA 2DVDA 3OY8A 5FY4A 1PO23 3AYCA 1JUHA 1GNHA 2D43A 2PA7A 3HN3A 2W2IA 4H2AA 4N8MA 5CKQA 4A2UA 3AM2A 4C1XA 3VD4A 2DCJA 4Q4W2 1KS4A 2W46A 5J98B 2NZ9A 2XUMA 2YGMA 1RUC1 2E32A 2GALA 3ZM8A 2FBEA 4ORFA 1Q8OA 3B02A 2VMIA 4AEMA 5EYXA 4GAZA 3W58A 2R30A 4GALA 4B3NA 2ZCWA 4FOVA 3I3MA 4E8DA 1L7LA 4W50A 4Y5Z0 1MS9A 1PGL1 2WIIB 3WP3A 1EUTA 1DF0A 3IIAA 4JQRA 2OUJA 2XJQA 4QKFA 5LY2A 4Q2FA 1W8HA 1EPWA 4IERA 4KH9A 4CCKA 1AR81 4E8CA 2GNDA 4I30A 2VO5A 1AL21 1S0FA 1WCUA 2PAMA 1NY72 2WWSA 4D6RA 3VZLA 4BQ3A 4K7JA 3LWCA 5CB7A 1NG0A 2XKOA 4K6BA 1HLCA 4R8HA 2CGNA 2QKDA 2EVXA 3WV6A 4DNYA 3QOPA 3THDA 2CYFA 4M3CB 2BEOA 4COUA 2R0HA 3IM0A 5IJRA 2B9UA 1S0JA 5L9RA 1PIV1 3OUJA 5CKMA 1AR61 2QUOA 1BZWA 3BGAA 4GJZA 4JV4A 4U36A 3ZKUA 1VMJA 1IS4A 4PIXA 4YVSC 2J22A 4CRQA 5KHHA 4Q1RA 2MPFA 1UKGA 3KT1A 2VULA 2QVSB 5CAZA 4YW2A 5BNNC 3R4DB 3E97A 4IEOA 4X8PA 3W20A 1O8SA 4BE3A 5HI0A 2HEVF 2JE9A 1VE0A 1W8TA 5ACA3 3N3HA 5DUXA 3VGIA 1UY4A 1ENXA 3ZFGA 3CIHA 3JQWA 3PU3A 5FRAA 3V64A 5F8PA 3IAQA 3PURA 2E63A 4XCAA 4IGOA 3WNLA 5FZ6A 4AEDA 4CXYA 1OXCA 5IYYA 2VECA 1H8TA 5EP9A 3W9AA 5IHRA 3S30A 4JCKA 1UPIA 2DV9A 4L11A 1YEWA 2B9VA 2ZHNA 3KT7A 4ZPIA 3N7KA 1YQ8A 5FY0A 4AW7A 1D4M2 1COV3 4UT5A 5LBCA 1WGPA 3T30A 2JKXA 5FYIA 1GBGA 3I2GA 2Y8KA 1BBT2 3SMHA 2X10A 1AHSA 2BOJA 3Q8BA 4LE3A 4XBNA 4QWNA 3HQRA 3I3QA 3LSEA 2RS11 3OG2A 3RI8A 3UETA 3WF1A 3ZDVA 4CCMA 1HXS2 5A7QA 2VUJA 5L73A 4HL0A 3VL8A 4ASLA 2WNVB 1HRI1 1NXMA 5FZ7A 4BOWA 4BQ1A 1G9BA 1ND2B 2VH9A 3JUUA 3TEZA 2HWC1 4DZGA 4OYUA 1WW5A 2VGDA 2GAUA 3AKSA 1FXZA 2B39A 1WW7A 5J09A 1ENSA 1EAH2 1UMHA 1TEIA 3K77A 2R043 2VZOA 4W6YA 4XCBA 1B35B 3N7JA 4CEYC 4QB6A 3ZPYA 4CTEA 4LUKA 3WG4A 2K2SA 4BZ4A 4AAXA 3JD73 5FR3A 4BQ4A 4EWEA 3I3EA 4I01A 4FPEA 1FAYA 2R1BA 1HW5A 2QFEA 1K45A 5F3GA 2YZ4A 4AE2A 1EUUA 3AYAA 2ENRA 2DU1A 4CEWA 4CU7A 3TAYA 3NSTA 4CPBD 1KD7A 4Z1VA 1JXNA 3PMSA 4BPZA 2R6QA 1QQP2 3VKFC 3NV2A 1I3HA 3C7OA 1I6XA 5FV3A 1OF3A 2ATFA 1MPXA 4PI0A 2K46A 3TN92 5EWSA 4Y1VA 1YXWA 3WINE 2RM22 4N53A 4WZFA 4CP9B 4NO4A 1KJRA 3CQOA 1XBFA 4LHNA 4XFHA 4E2GA 5EHDA 1MZEA 5FOBB 3UGHA 1QJU2 1UY2A 2WNUA 5J7MA 4PDWA 1OFNA 2VVDA 2FMDA 3MEPA 4GJYA 4L9BA 4OMDA 2QZ2A 2ZBJA 3EBRA 4OUSA 4AQ2A 4N7UA 5BNPB 3AZYA 3DCQA 3N9QA 4AL9A 1Q8PA 4E4DX 4Q4V3 5DAXA 5FBJA 1SPPA 4ZONA 3RYPA 1PVXA 3ZYHA 4BM8A 1R1A2 3I2FA 5FP3A 1M4WA 3ZYIB 1PVC2 4ATFA 5FJKA 4YZ1A 4NIDA 3CEWA 4LA3A 5FY1A 3OYWA 3R05A 1GZTA 1AR93 5GLZA 2ADDA 3AC0A 3FHIB 5CBLA 2EIEA 4LA2A 2VZQA 2WT2A 4XJ9A 4JTNA 1WD3A 3SH5A 2VZSA 5FZ0A 4YSFA 4IEXA 1RXFA 2Y6JA 5I91A 2IC1A 4RHV2 3MW3A 3PVOA 3D0JA 1O3RA 4CCDA 3WQ1A 5LA9A 2BNOA 2VQUA 3MUY1 1F5JA 3PNAA 5FYTA 1HB1A 1QXJA 3CDZB 3RJRA 1WMXA 2ARCA 5CFCC 4ZS3A 3ZSLA 3OJBA 4Q4W3 5HXVA 3G6JB 4ZU7A 2XXZA 3KWVA 5I8YA 1S2KA 3NAPB 5KC5A 1OH4A 1VAKA 4DO0A 1CZTA 1V6MA 4Q26A 1W2TA 2W1UA 1NLSA 2EICA 5A6XA 5GZGA 4QDRA 3UK9A 1V9U2 2D6NA 3N35A 4TXWA 5AC92 1W0OA 4Q27A 3WQ7A 4LBJA 1JYXA 4Q5OA 5IVCA 1XXNA 5E6HA 4Z2WA 1G9AA 1LESA 4YW1A 4RSUA 4AGVA 2X5IA 1LJ7A 4KMQA 4XF0A 1UU4A 2JE8A 4CP1A 3T09A 1DG6A 1JN2P 3OUIA 1SBFA 2I74A 4AHYA 1KXGA 2DCKA 1XNTA 3MIDA 3C8XA 3ZFFA 5IVJA 3BN6A 1XNDA 2CTVA 3PHMA 4IXLA 2DU0A 3KF3A 3VZKA 1YNAA 4EN0A 3VBUA 5H9QA 1UN1A 1U5IA 2BBAA 3ILRA 2W3JA 2QDRA 4UYBA 2ZMLA 1SLBA 2XLGA 3KB5A 4URTA 1W3VA 4XEZA 5TSWA 5EXOA 2VZVA 3WNNA 2BVBA 2HWB1 3B9IA 2D5FA 1OI6A 1RUC2 3GCXA 2D6OX 4QU2A 1JYIA 1UOJA 2QJVA 1RUD1 3ZN6B 1A3KA 3VDAA 3RZJA 1OFSA 1UIKA 2NN8A 3NJVA 5FXVA 3HOBA 4JVAA 1PGL2 4LBQA 1GOHA 1D4M3 4BXSV 3MFAA 3ZVXA 3BPSA 1AR82 4GB31 2A6XA 2ZGQA 1X8EA 4PQ9A 3RQ0A 1AL22 1BBT3 1D7PM 2VNOA 4XBLA 2GC2A 3WDXA 5F9TA 1RL3A 4JGZA 3ZIWA 1ULOA 2VD7A 2XLFA 2XG3A 1HXS3 1RUF1 3FLTA 5DABA 2ZOEB 3K4AA 3PUHA 1APNA 2LW8A 2PAKA 2XWBB 4KNCA 4JZRA 4LBQD 4MHRA 1PZ8A 5DUUA 1OKQA 3TBDA 2WN2A 3WXPA 1ENQA 1G86A 1SEFA 4IEUA 2PELA 3RYRA 3DEMA 1PIV2 3WUDA 2BGPA 1BKZA 1AR62 3VKNA 4BYYA 2RVAA 3VBSB 1EAH3 3H42B 3KLSA 4JDMA 1V6OA 2GC1A 3J7NA 3KGZA 3THPA 2ORZA 2W92A 3OBZA 5F2WA 2P3KA 5AFBA 3WD5A 1ZZCA 1DGLA 2C26A 5LB6A 1MZFA 1AYN1 3ELNA 4LKSA 4LO7A 1WZXA 2LROA 4QPGA 4CDXA 3C3VA 1YQ2A 1UY0A 5BNNA 2PN5A 1CX1A 5JAXA 4X6RB 3NV4A 3O0WA 4FOWA 4NE9A 4RFRB 4AHXA 1ZZ6A 4WVMA 4CU8A 4OI0A 3BOWA 2ZA9A 1QQP3 4NPRA 3N9MA 1F5FA 3WHTA 1OOPB 1BQPA 3TN93 4BK4A 3MW4A 2D3PA 3PJQA 4D7YA 1S1AA 3PTRB 3S5QA 1WWYA 5K0UA 5JXJA 1D4VB 2RM23 1LU1A 4GMP1 3UGFA 1PX3A 4HSJA 4GIQA 1ULPA 4AZZA 4MGSA 5FPLA 3RSJA 1BK0A 5JOXA 2FHRA 4K3UA 5K8SA 1N1SA 1UD1A 1QJU3 1X36A 4HANA 4D6SA 2WQ4A 2JDPA 3B5LB 4ASMB 4F8AA 1NCRA 2QQIA 2PHTA 1YLLA 4RFT0 1S2BA 1VB4A 2RS12 4RL7A 4DOUA 3LPFA 1JOBA 1A34A 5FKBA 3ZXEA 5IVBA 1HRI2 2W52A 1PM7A 1HJGA 4GWJA 3LKJA 3HJRA 1PVC3 1POV1 3LSDA 5IVFA 2HWC2 2DUOA 4EJRA 1G9CA 3AL5A 4AVVA 2FZ2A 1JZ5A 2WSVA 4UFIA 1JOPA 1JS9A 2UYAA 5C70A 1VBA1 1W3XA 2RMU1 2VL4A 4CU9A 4A3ZA 3WY6A 4ET7A 4FTEA 2AR6A 4GWNA 3FBMA 2VM9A 4CEYA 4NIHA 4TN7A 2G9ZA 4RHV3 5F3EA 3TRSB 5A33B 4CA9A 1UYYA 3WR0A 4YVWA 4AVAA 2GP3A 5JWPA 5C6CA 2GMMA 1H0BA 2P6HA 3BIEA 5A1FA 5K9YA 5LA0A 2Q30A 5T52A 4QGMA 3FMGA 5JR7B 4F7ZA 4W65A 3U75A 1XU2A 4LBOA 5LWBA 4AHZA 5DZGA 4ARYA 1YRZA 1CAXB 3N7LA 3GGLA 4COZA 2RJKA 5J1XA 4M4PA 1S0BA 1K5MA 4R52A 1UPSA 3ZSMA 3JXSA 3K3NA 3H8RA 4MXWA 5L36A 4QM8A 5FPUA 5KC6A 4JGYA 2WNEA 4XMAA 1LTEA 5F5AA 1ACCA 4QXBA 1LAJA 2L9LA 1Q43A 2ZGPA 4BIFA 5AC93 5CFDA 4HETA 4WVWA 4XC9A 1KEXA 3MHZA 1QJY1 4KGGA 3WCSA 2TUNA 2Q1FA 3GDBA 3SH4A 5A32A 5LK7B 1GP6A 1UOGA 3PUIA 4EQVA 3CZJA 4EN9B 3RZMA 1V0AA 1DZTA 1LCLA 1OLME 4YGBA 4GA9A 3AZVA 1YC61 4YW4A 2GNMA 4DY5A 4AK3A 4DEQA 2WO1A 3AP9A 2J42A 4MUVA 4M3CF 2Q8DA 1DDLA 1EY2A 4ZXEA 2Q8OA 2BRTA 2B8MA 1LOFC 3WF3A 3GBGA 4Q4Y2 4XDQA 1F2NA 3LD8A 5CNAA 2V5YA 5FCCA 1U5YA 1XSQA 1CAWA 5IVVA 4ITCA 4XFGA 1TG7A 3WQBA 4DFSA 3E6CC 2JG9A 4O9EA 5FYUA 5CFCA 1RUC3 2CGOA 2NQYA 4J1XA 4FPCA 3AP4A 4RD7A 5A70A 4D8MA 1W8NA 1JTZX 2R16A 5IT6A 4NHLA 5FFOC 1W0NA 5L7OC 4QGNA 4QPYA 4CUCA 2WS91 4K40A 4YFWA 4GH4A 1AR83 2DF7A 4QQPA 1AL23 4N9HA 5B4XA 5T55A 2FMYA 3S7EA 3DXTA 3V0AA 2BJSA 2Y34A 3ZSKA 1RTVA 2VAUA 4ONUA 4E4SA 2JG8A 3ZYJB 1CD3G 4FO9A 3QBQA 1ND3A 3A23A 1QKQA 4FTBA 1PIV3 4OULA 1AR63 4LNVA 3RFRA 3ROUA 4AEDB 3BTXA 3CO2A 1H8TB 5DN2A 2EAKA 3Q8FA 4FT8A 2HKXA 1JHJA 1E5RA 3POWA 4LLFA 3DECA 3VDDB 3I2OA 3AMMA 2PTMA 2ZHLA 4WM7B 1WUVA 3AX4A 5E1RA 2ZZQA 3LA2A 3VBFC 3MIEA 3VN4A 3ITQA 3AMNA 1XNCA 3CNAA 3E5XA 1ENRA 2WO7A 1JZ3A 2HWB2 1DCSA 1LULA 3ZFGC 1J59A 5A7OA 2RHPA 1W8FA 1Y43B 3SHRA 4XXAA 4D0QA 1RUD2 5JXHA 5FY7A 1TQ5A 3KS7A 2BV4A 3H1WA 5FQ0A 2MHFA 1NA1B 3OF1A 5JXGA 3PVBB 1JH5A 2QQMA 4YG3A 1XC6A 3ZXAC 4CZSA 4I3GA 4GB32 3ST7A 2E51A 1VLNA 5I0TA 4Q8LA 3DYMA 4JKKA 2NMOA 5JPMB 3ZKYA 2C4XA 4KI5M 2F17A 2RS13 1S0DA 4A45A 1C4RA 4WVVA 1RUF2 5FLIA 3RS6A 4P14A 4SBVA 1IKPA 1HRI3 1PK6B 4GXLA 5BNOB 1CAUB 3AB0A 5DUWA 3O5SA 4V1PA 2HWC3 5T5OA 4B4PA 4BISA 1HB2A 4LIUA 1ZRCA 2GN7A 4TLGA 5FBZA 2JWPA 1VBB1 4N53B 2IXHA 4IV3A 2ZEYA 1LKNA 2YU1A 4XUTA 4IDZA 4BQ2A 2F6BA 4H55A 5HCAA 1AYN2 2B46X 1F31A 3WDYA 5CIRA 2JDAA 4BH9A 3A21A 3ILFA 2LUWA 4LHLA 4OQ8A 3ENRA 4L99A 5F5IA 3VBHB 1US3A 3ZFEA 4COVA 2P3YA 4Y1XA 5G05L 5T3NA 3IMNA 4LTAA 4QDQA 4CCNA 4JC1A 4AXOA 2YC2A 3H8OA 5A1AA 2DUPA 2HEWF 3LOIA 2QBXA 4Y3OA 2KXLA 1IS5A 2YBKA 4UF0B 2GMPA 1PZ7A 3POSA 4P02B 3FJSA 1PMJX 1FOD1 1MQTC 4I0BA 1MS5A 2VUAA 4MX3A 4ARXA 1W6QB 4B1LA 1SCSA 2CWSA 5I93A 1YI7A 1C5IA 1RUJ1 1W6PB 1C8NA 2W87A 2XVGA 5LATA 2WNUC 4LR4A 3ZXJA 1KRIA 2D93A 4PDWC 2DVFA 1JZ6A 1ZZ7A 2BZDA 1CR7A 4Y33A 3APBA 2K9ZA 1QH7A 5FZHA 3ORJA 3MO4A 5H9SA 4ZU5A 3AXEA 4Y22A 3WNKA 2OS2A 3CBNA 4CUBA 3AKRA 1Q56A 4QX0A 4XAAA 1FX5A 4UFHA 3UKNA 5IFTA 4Y5SA 1F15A 3CL1A 1GKBA 1OPOA 1NCQB 1OKOA 4Q29A 3QH7A 1Z7S1 3H50A 5DAQA 1VBA2 2RMU2 1MACA 4RR3A 2B45X 5CU1A 3QCWA 3RPQA 3O1OA 1IQAA 4N90A 4P9XA 5EFUA 5A3OA 3WG2A 3AKTA 4AVTA 2RR11 4A6SA 4QKBA 4V2VA 2VR4A 4GULA 4XTMA 1J3RA 2G9GA 3ABZA 3LF7A 1W6NB 1W6OA 4INDA 2IZWA 4C91A 1RJ8A 1K5JA 1V6KA 2A3WA 3FLPA 3HEIA 5GZCA 3D0SA 4K21A 1ZBA1 3ME2A 2ZGNA 3WG3A 5EYYA 3ZXLA 5FZ8A 1PGSA 4LPLA 5KHKA 2QE3A 2X5IB 1DGRN 4QPWA 2BOIA 5A7WA 2BUKA 1UAIA 1VMHA 2D44A 2IXLA 4XJUA 2J1SA 2X53S 3M3OA 2RS31 3FUOA 4C1WA 4QX1A 5FP8A 3ACLA 3AP6A 3EHKA 4LORA 4QHZA 1RMU1 4LUMA 1W6MB 3OD0A 4Y20B 3MUZ1 3K75B 1C8M1 1V9U1 4QPIA 1JZ4A 1QJY2 1JZ7A 4NWWA 2ZMKA 5FMBA 4RQPC 2A71A 4FAGA 1WMEA 3NW4A 4XQ4A 4UW5A 1X33A 2D7FA 5FZMA 2SBAA 1RUE1 3DXUA 5J48A 5DAPA 3WF2A 4AF9A 4C0BA 3LA7A 2WA3A 3DGTA 5GZEA 2LRPA 2E7QA 1YFYA 2PQSA 3BTAA 4UWDA 3VHPA 4IE0A 1OA3A 3ZFFC 1H30A 3IB3A 2BNMA 2DCTA 1H9PA 4MVTA 4LBQB 3D5OA 3K3OA 1XJAA 2VOVA 5D1IA 5EPAA 5FK7A 2JE7A 2VQAA 2YV8A 1VJ2A 5FZOB 4BK5A 2AREA 3VBUC 4C0HA 5IK4A 1IGOA 4S2HA 5FREA 1LOGA 2A1XA 1LOFA 4HOOA 3U4SA 1KJLA 3C7HA 4HLTA 4IE4A 4AQ6A 5A3WA 1N3QA 1RGSA 2IXJA 3TEXA 1HRV1 3V0BB 2HWB3 4M3CE 4MV2A 1LB2A 4FPOB 2A6YA 4L0PA 2C9AA 5FMOL 1RUD3 4FOYA 3AYEA 1WLDA 5IATA 4J25A 3RG0A 3VBRC 4IE6A 1KS5A 3DPRA 1QOTA 1S4CA 4X8NA 1SQ4A 4E2SA 2WS92 1NXD1 2Y6KA 2H6CA 4YVSB 3WCRA 5HXMA 5L7OA 2UY8A 4GB33 4XQWA 4RS5A 4OI4A 5FZCA 4I0WB 2VCAA 1JMUB 1GFF2 1YYNA 2BERA 3Q9OA 4YFZA 5T5PA 2BW8A 3ETPA 4QB1A 4PCRA 4JGZC 3M8LA 4P5HA 5JI7A 5LW9A 2VPVA 1GSLA 1XB9A 1GANA 1EYBA 2X09A 3NNLA 4G3YC 4AFCA 3P1IA 3MICA 2QQKA 3M7AA 1OVPA 4JQTA 4GWMA 5GLWA 3IPVA 3RWNA 4NJ4A 1GOGA 2VMDA 3D4KA 4QM9A 1ZYBA 3K2OA 1AJKA 1W0PA 4ZU4A 4QXHA 1GZWB 1AYN3 2QCSB 1I5PA 5IAXA 4XBQA 1Y9GA 2WFPA 1ZRDA 1H4GA 2EALA 1DZQA 3M70A 5IK7A 4OHXA 2NMNA 4QPGC 4CDXC 1J58A 1NLRA 1AXYA 4RYDA 5E88A 2ET7A 3E6DA 4OHVA 2IXIA 2ZX1A 1W05A 2WAOA 4OUMA 4E27A 3AP7A 3VBFA 3T0DA 1OF4A 5JZGA 2B4KA 4FBFA 1LGBA 4XF4A 1IHMA 1MS4A 3WEZA 2OQ6A 1W8ZA 2OVUA 5K0UC 1YJLA 2EAAA 3I54A 4NRPA 4GMP3 1N3PA 5CA6A 5A3PA 3KF5A 3KVAA 2Z2SB 1OQDA 2WLPA 4FXGB 4CEYB 3GHMA 1BXHA 5F32A 4AVBA 2BTVC 2PQQA 3HT2A 4Z92B 4N43A 1TNFA 2ZJCA 5D8AA 4XIKA 2VVFA 1QJZA 1NCRC 3I4IA 1H2MA 2PHXA 4LMFA 4FFGA 4XDOA 3I59B 3MV11 2E6VA 4IGPA 4FP2A 5FPZA 3O1SA 4RGGA 2F4LA 3SQOA 1QNWA 3C7FA 4CP0A 3BCWA 3N9PA 4AI2A 1POV3 1IG0A 3QACA 4HN0A 4FFIA 3RZLA 3DV8A 3P5BA 4BQYA 2FQPA 4AOCA 2ZKLA 4YLZA 3VD7A 2VG9A 2OYZA 3ZYPA 1VBB2 1VBA3 1PNGA 2QQJA 4YM2A 2RMU3 3AFGA 1WA6X 4XXPA 1VBD1 3SISA 4N9IA 2D97A 4QX2A 5GZFA 4OI1A 4NIIA 4RA0A 3CJXA 1W9WA 4H14A 4DINB 4S2FA 1LECA 1VBE1 4AI8A 1HB4A 1N3OA 4CP2A 4YVWC 2V09A 2MEV1 2UU8A 1DIWA 4CDQA 1W2UA 5H9RA 4AYUA 2YG0A 4UAPA 5A3TA 5DZEA 2XJRA 1RJ7A 3M3QA 1S0CA 3PTYA 3S57A 1LU2A 3NJZA 2BPA2 4XABA 4ZXKA 3RJ2X 1K5MC 3OB8A 5FZAA 2FDFA 4PLMA 2DTWA 2HH9A 4QXKA 1FOD2 1UCXA 2TNFA 3C7GA 2VOXA 3H9AA 4JGYC 1YCIA 4FFFA 3RYKA 1CPNA 5B4NA 1MQTA 2EA7A 1RUJ2 2DYCA 1V6IA 2JIJA 2VNVA 5CFDC 1W06A 2VMEA 2G1MA 1WCQA 2ZEWA 3K48A 1LHOA 1OPMA 4UW4A 5FMDA 4AFAA 5A3MA 1QJY3 1QJEA 5F5CA 2XL9A 2JENA 3PVNA 3MYXA 4FCAA 4HPKB 4BCUA 4LO5B 3AJZA 4FPHA 4WM8A 3SCGA 3B9CA 1KDKA 5J36A 1YHFA 2XONA 1Y4WA 2YUEA 1LEMA 1ND2C 3CLPA 3GBWA 1I9RA 3CJIA 1Z7S2 3NMBA 2DTYA 1Q3EA 3LIGA 5C71A 3Q8AA 1QHDA 2ZX4A 1EP0A 1CESA 3RGBA 3AMHA 5GLUA 1D2QA 2RR12 1T6BX 2RV9A 3ECQA 4K20A 3FHQA 5FZ3A 3EJKA 3HIFA 4FP3A 1AX0A 2I07B 2AACA 2PLV2 5AFEA 1ZBA2 4DUWA 3HT1A 4Q4Y1 2Y33A 5C3OA 4PHZA 1J3PA 2CY6A 2YBSA 5F6KA 4D7SA 4J6GA 4HK8A 1AXKA 1Q8VA 2JG9C 4YZ4A 1V00A 1C1LA 1QJX1 2A70A 5DAVA 5KHJA 4PT6A 1WW4A 1SLCA 1L7QA 4IV1B 5CKNA 5JXIA 3NKTA 5EJZB 2RS32 2IFWA 2JICA 4A7YA 3CMGA 1F4AA 4P9LA 3SEPA 1MZ6A 4AQSA 1RMU2 2WS93 2YC0A 3LEMA 2B42B 2JDMA 1RUG1 4YG6A 2R061 4NROA 2Q0AA 2V4VA 3B69A 4GH4C 4COYA 2P4EA 1C8M2 4E2QA 1OQ1A 3KHBA 1JI6A 4XDPA 3F2ZA 2QNKA 3I2JA 5FZ1A 1GUIA 1MS3A 1S0EA 5GLVA 1XQNA 2ZZJA 4BXFA 3BALA 3PLQA 4LK7A 4IL7A 2W08A 4RQPA 2JG8C 4B7EA 3USUA 4PI2A 1RUE2 5F6LB 1T2XA 4M01A 4W6XA 4DXRA 1ND3C 1E57A 3JU9A 3Q8CA 4IGQA 1V70A 3ZN5A 2P6CA 4RN5A 3POIA 1DZRA 1GWMA 2RE9A 3RMYA 1UXXX 4JX0A 2YBPA 1SFNA 3T3YA 1UYXA 3AKPA 4XFBA 2H0VA 1K12A 4ZS2A 2PHFA 2OXBA 3RZGA 5C8CA 2J7MA 1OLQA 2G9FA 3GBFA 4MXVA 2FDJA 4E4HA 1C57A 5DG1A 1HRV2 4KGQA 4IEYA 1LHVA 2Y0IA 3LCPA 5FP7A 4EROA 1UWWA 4YRDA 3KZ4C 1CZVA 5FIXA 2WJSA 4O7XA 2Y6HA 4G4FA 1AUYA 2PHRA 1BMV1 4G9SB 4AG4A 3VBRA 4HXCA 5ANNA 1N47A 5C9AA 2NM1A 2CNAA 4YPJA 5EJ1B 1RUI1 4XJAA 1UMIA 4BQ5A 3W5MA 1D0GA 4V2WA 3G7DA 4QX3A 3NVCA 1H8VA 3VD3A 4QQ2A 2FCTA 1N1YA 4D94A 2W95A 5A3UA 2Y6FA 5GJ6A 2ID4A 2UWCA 3QH6A 4JRLA 2YFZA 3UV9A 2Q1MA 1RINA 3T1LA 4BU2A 2A5ZA 3OGJA 5DUVA 1Y9MA 4L92A 1FNZA 4XPVA 3NKGA 1VBB3 1OVSA 1QEXA 1WMFA 4IV3C 4Q0QA 1POQA 3VZOA 4AWDA 1TMF1 4M0NA 2P3JA 1PX4A 1S0IA 1CAVA 3E5UA 5F3IA 3JB8A 3BB6A 2OIIA 3LB9A 3SCHA 3BKZA 4BLJA 1QOOA 3MIGA 2EIDA 1H6YA 3KD4A 1IPKA 3DL3A 2UURA 3ZFEC 2VBPA 3IDAA 5C4WA 1NKGA 1UOBA 4LKFA 1PM4A 4KL1A 1IG3A 5DAWA 3PMEA 4FQZA 4Y22B 5I8SA 4ZZ8A 5ABJB 3HWJA 3K46A 4LQRA 3LIHA 1YO8A 2OT7A 2ZABA 3J8F1 1WMDA 2A73B 3UJQA 3NWKA 3AJYA 1PZ9A 4D6QA 1UY3A 1FOD3 2A75A 3R4UA 5FKCA 3WW1A 1PMHX 4B8EA 3FFQA 2JECA 4YARA 1ODMA 2BYVE 3TB0A 4FSJA 2E26A 5FLJA 1W9SA 1RUJ3 4JTOA 4UBGA 2ET1A 2OPKA 4CSWA 4QU1A 3T0BA 1QXRA 3IDEA 4EYUA 2ILMA 4FXKB 4S2GA 1ASJ1 5FYVA 2QZ3A 2CHHA 1OMIA 5FPVA 2XQRA 4OMCA 2PXJA 3NRUA 5D21A 1QU0A 3POFA 1CPMA 1LHWA 1WD4A 2BFUL 2Z69A 3D82A 3UESA 4E9KA 1YFXA 4XVHA 4CXWA 5DMYA 2ZGRA 4DXSA 1TME1 1R1A3 3HR9A 4GQ7A 4MGQA 2ETEA 4M3CA 2EXKA 2I45A 1Z7S3 5EQUA 3U11A 3A4UA 4RR3C 3WNOA 1VBD2 1WA4A 3GYDA 2J1VA 3WHUA 5FPXA 3MF9A 5JSPA 3FLRA 4Z8BA 2QQVA 1GWLA 4MGKE 3T4HB 2RR13 4KBZA 2JD4A 4TYSA 4C8DA 5CG8A 1VBE2 4QHBA 1R091 4XJZA 5LBFA 5IK5A 2QDNA 1EV12 2MEV2 4NHYA 3ZXFA 3C2UA 4HKLA 4H3WA 3HD8B 3BOPA 4OFGA 2VOKA 2VW2A 3N36A 4NPLA 2XVKA 1PHMA 3HMYA 2QQOA 2JD9A 1H1AA 2GZWA 1FI2A 3O1PA 4URAA 2DBIA 1QIQA 5FAXA 2RS33 1ZREA 2DVAA 1SG3A 3RVHA 4DEVA 1BVP1 1RMU3 4Y1ZA 4CDWB 2VBDA 1GR3A 2YMZA 1LR5A 1C8M3 1V9U3 5LRSA 4Z07A 4QPIC 1T6GC 4HT1T 4X6QB 1ZVFA 4XETA 2ERFA 4D3WA 2R7EB 2BWAA 1VAVA 4ES8A 5A3LA 1PGW1 4CDUC 2HBTA 3OY8B 5LA1A 3MZHA 1RUE3 1CONA 2B5HA 3W21A 1RUNA 1DQ1A 3GF6A 2WNVA 2WKKA 4FTSA 1LEDA 1AJOA 1JU3A 1ND2A 5IVEA 1CVNA 5I8TA 4W8JA 4O61A 2PYTA 4P5YA 4WVZA 2JDZA 1GLHA 5LRRA 2GN3A 2ZKNA 2WZPP 5EIYB 5HBAA 3HAGA 1QF3A 2SLIA 2ZAHA 3PL0A 2CAUA 4DMIA 3GZTB 2B7YA 2I2SA 1AX1A 5L7OB 1B35A 3RDIA 4OHYA 3THCA 3D3AA 4B4QA 4KWJA 1AX2A 2O1QA 2YPDA 4XACA 5A1LA 2YB7A 3LEIA 3MW2A 1PMIA 3MI8A 4BLIA 1UZZA 4HK9A 5JCTA 4HVRA 1FYUA 1QH6A 2OPWA 1HRV3 2JEMA 1GZ9A 5HV4A 5DDJ1 1QJX2 3O14A 3POJA 1V6LA 2DURA 2VUCA 3ZSEA 2FDIA 4K9SA 1NE4A 2RDSA 1WLWA 4IEZA 3SLIA 2J1RA 3ZR6A 5DG2A 3DPRC 2IUWA 1D2SA 2VTXJ 1IQDC 1ULFA 3CHXA 4JKMA 4XUPA 1RUG2 2YU2A 1LODA 2R062 3IDCB 4GD4A 1FPN1 5IW0A 1ULGA 1VBC1 2C0ZA 4RS5C 4AI3A 3UKTA 4MGTA 4YW6A 3U37A 3WSOA 1H9WA 4XQDA 3ZPOA 4OHZA 2BWCA 2UWBA 1HIXA 5BYNA 4D7TA 3EB7A 5F1RA 3MIFA 1AVBA 4XFAA 3J7MA 1OA4A 3VBFB 2KD7A 5BNPA 4DY3A 2AEYA 4XURA 2XOMA 5FY5A 1E5SA 2JDHA 1W03A 3FC0A 4NMIA 3ZFGB 2FD8A 3MFCA 3ASIA 4Q4X1 4QQHA 1C5HA 3U1XA 3WF4A 1LHNA 2VOTA 1H1IA 4BB3A 3N7MA 3IBMA 1E5HA 2BFUS 1UW8A 2ZEXA 3M4FA 1HV1A 1LGCA 3AMQA 3OGVA 1DYPA 4UFMA 1JYCA 4MYEA 2Q4SA 2WZR2 4MLOA 2ZPXA 2BQPA 1ULCA 4W4ZA 4EZHA 2G4IA 2C6SA 2VZPA 4XF1A 2D6PA 1S2EA 5A6ZA 3BODA 2DVGA 4JHZA 3KGLA 1O3SA 1F35A 3UJOA 1UX6A 1YJKA 2Y6LA 4R4XA 2VQ0A 2YC4A 4JAAA 4LEJA 4XZUG 4XAEA 3OBRA 5JZGC 3U0ZA 3FX3A 2IXKA 3OPZA 3W5NA 1UYZA 1RIRA 4KU8A 4XHXA 3RWKX 5J37A 2VVEA 2GH8A 3T1MA 1BMV2 1K3IA 2RS51 3ZSJA 1X82A 3RZZA 2GP5A 3OSDA 1ZRRA 5T5JA 1A8DA 3ZN4A 5LCWL 1XYNA 3WP4A 1VIWB 3ZX7A 1KFXL 1RUI2 4N43C 3WG1A 4ATEA 1NE6A 2W1QA 2XMLA 5D8AC 4YW7A 3WDWA 1UIJA 2PFWA 4IE7A 1DQ5A 4YZ3A 1ULEA 3VDCA 2D40A 2YHJA 5C7GA 1WBLA 4XZPA 1JBCA 3IZOA 3V65A 3ZXKA 2Q1ZB 1HX6A 3AL6A 1NYWA 4CEWB 5SV8A 1ZA7A 1R64A 4S2DA 4A7KA 2ARAA 4HVQA 4OZOA 3BTZA 4Y4YA 1PNFA 3I3BA 4YM3A 3O1RA 1SFYA 4BWOA 3A0NA 4DIQA 5F3CA 4FPLA 4JRAA 1VBD3 4QB2A 1TMF2 5BY5A 3K51A 2HYXA 3VD9A 1MQTB 3GZEA 3LQCA 3WDUA 4IEWA 3LDBA 3L2YA 3KCCA 4PF5A 1H2LA 1VBE3 1TNRA 4KBBA 2UWAA 2WNUB 4UOJA 1QDCA 1S0GA 4PDWB 4M00A 4JKLA 4CDQC 2FDHA 4BQXA 1A8MA 4OUEA 2QQUA 1PO11 4FPJA 2ZS6B 3SH3A 1HN1A 3SNMA 3WW3A 4AGGA 4EZ4A 3T08A 1A6CA 3J8F2 5DPNA 2WNOA 1W8UA 3VHOA 1SPPB 3OEBA 3F95A 2WO3A 4DQAA 3OPWA 4E4ZA 1SLLA 1HV0A 5M0TA 3DN7A 1I5ZA 2CGPA 1JYWA 1RUH1 3FL7A 5E89A 3OYWB 3ZN6A 4TSVA 2CAVA 3H8XA 2JKBA 2Y60A 5E16A 4TTGA 2E7TA 4N7IA 1HQLA 1XE7A 1H6XA 1U12A 2WAAA 4A6OA 5LY1A 3NL1A 1YIPA 3P3PA 3O0VA 2HJIA 4DXTA 5K4LA 5FZDA 3LDKA 1UU5A 3SITA 1ASJ2 5JSRA 5A3NA 1H2KA 1XRUA 2WR9A 4WM8C 3T2PA 5FXZA 5HPOA 2CSGA 2E7AA 1TME2 3FUQA 1D0HA 3DKWA 4PBOA 3MLJA 1NAEA 2J1TA 3V0BA 3WP5A 5I0DA 3CJIC 1CJDA 1UZWA 5F37A 2V5DA 2WC2A 2XL7A 1W8OA 4IE5A 5JIAA 2HBUA 5FK8A 3VBSA 4OVEA 2A6ZA 3B01A 1J1LA 4B7KA 3A7QA 1F9KA 3KQ4B 2CL2A 5CZKA 3TWIA 1R092 3K4ZA 4XIOA 5FXXA 3SKVA 1JZ2A 3VBHC 1NOVA 4PLNA 4Q4Y3 3K4DA 1OURA 3AZXA 2EIGA 2PLV1 2AEZA 4RQPB 5JUVA 3H8UA 2VZRA 1P8JA 1QJX3 1TVGA 2WWJA 2ZX2A 5LEJA 1HDKA 1OUSA 1OOPA 2YROA 1LENA 2GSYA 2O14A 3VBOC 1H2NA 4F83A 1RUG3 3ZFFB 2R063 1Q8QA 4PF1A 3PIJA 1VALA 2A3XA 5C3RA 2WWUA 3LEGA 5ERLA 4AR2A 3MV01 3WZ1A 2ZACA 4AQTA 1DFQA 5F7UA 2NP0A 1EPZA 1WKYA 1TE1B 3VBUB 1FMD1 1STMA 3NV1A 4FVVA 1KDMA 4NIAA 4FQ4A 1PGW2 4TLFA 1FV2A 3JBG1 1MS8A 4XJWA 3HQUA 1RC6A 1SACA 2VNGA 4NRQA 4CDUA 5FYCA 5FYSA 2DVBA 5HCHA 1M06G 1W9YA 2XDVA 4QDSA 2VXJA 1UYPA 2XQXA 4CCOA 3EYPA 2IFRA 3IDBB 2C9KA 2Z4FA 4LITA 1F8VA 2DDUA 5I0SA 2VMGA 1GP4A 3VBRB 1AR71 4YWAA 3GXUA 3B00A 3NJYA 3ZMNA 3ZOIA 3QLQA 5JOZA 1AYM1 4GKYA 1OQEA 5FWEA 2RJ2A 5C5TA 1SDDB 3N9NA 5KHIA 3L2HA 1RITA 5A33A 1MVQA 2BBVA 3HNBM 2F4PA 3HBKA 5C8CC 3NNGA 5FY8A 3HN1A 3IN9A 3TOJA 1JYNA 3LFIA 4JGZB 2X29A 1UQXA 5DDJ2 3KV9A 1SLAA 2ARBA 1XE8A 2DCYA 5GALA 2OUHA 4IETA 3AFKA 1CAXA 1REFA 4QX5A 1CIWA 2IVJA 2RDQA 5LASA 2JDYA 3B93A 3MBWA 2AUYA 3BTYA 4CUAA 1OLRA 4I2OA 4IESA 2XH6A 1IPJA 2NYYA 3WX5A 1CAVB 5C9AC 4LO6B 4P08A 1FPN2 1O5UA 2H0BA 3PU8A 1VBC2 5L9BA 4AI0A 3KM5A 4CCEA 1RUI3 4IQPA 4CCCA 1LOAA 5A7SA 1HB3A 3NNJA 4J1WA 3WDTA 2QQPA 1RHI1 2YDEA 3B7MA 3FHAA 3JQXA 4QPGB 2KR2A 4CDXB 2FCVA 1CIYA 4DXZA 5BNNB 1CGPA 4LO4B 2AC1A 4ASKA 1RUF3 3IT8A 4I09A 3L9JT 1RVF1 3M3CA 4WVMB 4XE9A 5A7NA 5FZ4A 2YY1A 4Q4X2 2VTXA 1W99A 5KXCA 1BHGA 1QXPA 1NLQA 5GKAC 4UBHA 2IVIB 5K0UB 3H7JA 2X05A 1TMF3 1KQRA 2EXHA 2O8QA 2YXSA 5JDBA 3ZMOA 5FPBA 2VQTA 3BU0A 1DQ2A 3OGRA 4GMP0 5KHGA 2A7AA 5I0RA 2R071 4LKDA 3J9SA 3M2MA 1WW6A 2XJSA 3QD6A 2ARXA 2E31A 4O65A 1QJFA 2EXIA 5FYBA 5C4WC 1NCRB 1W8WA 5JIUA 2WRAA 5DQ0A 2PHWA 4MOAA 5LBBA 3ZIXA 1GV9A 3J8F3 2V72A 2FDKA 2AH2A 1JOJA 4XYXA 4BA6A 1SFPA 2WL1A 2WT1A 2H6BA 3P6BA 1POV0 3HNYM 2RS52 3X29B 2XUEA 3VHRA 4XF3A 1UKRA 4PIYA 2ORXA 1OLMA 3KQRA 4M4RA 1DU3D 1FATA 1LOCA 1MEC1 2A6VA 2JJ6A 3J7HA 3UKVA 5FOJB 2KM2A 1O3TA 4LBNA 2YPJA 4MGZE 4MGYE 1UZ0A 3KV5A 1ASJ3 1GICA 2VBBA 3JCIA 4YVWB 5HCFA 4QX7A 4B1MA 2AYHA 2A3YA 3GJBA 2WINB 3U14A 4UXAA 4A44A 3WP6A 1REDA 4HZFA 1O6UA 4XMIA 3LZZA 4CYDA 4XTPA 1TME3 4CXXA 3N9OA 3GCWA 2XJUA 2HWD1 4AAPA 1K5MB 4XJ8A 4LHKA 4I0AA 4MXWB 4MGIE 3VZNA 3H7YA 4JGYB 2RG4A 4NOTA 3LE0A 2TEPA 4QMAA 1R093 1DLLA 1OSGA 3BI3A 3AKQA 3OPTA 3KCYA 5JI9A 3DYOA 5CFDB 1Y9QA 3UT0A 3VDDA 3ZYRA 1EV11 3T2OA 2EIBA 4WM7A 1PO12 5A32B 3VKMA 1ZZ8A 1NT0A 2WFF1 2LALA 3EMRA 4Z82A 5FZKA 3W59A 2CDPA 1OC1A 1WLCA 1X50A 4DPNA 1R081 3BPZA 3MPBA 4PLOA 4DRVA 1UZYA 3RZKA 1DP0A 3IAPA 1YWKA 1JU4A 1RUH2 2JB4A 2W94A 1XNBA 3KVBA 3M1HA 2W5FA 2XKPA 4GZ9A 4UW3A 2E33A 1G9DA 1B09A 1NA1A 1BVVA 3JZVA 4CPBA 2Y64A 3RZHA 4ISQA 5T54A 1ALYA 2XJVA 3ZYBA 1OUXA 3FZ3A 3O7OA 4YG0A 5FMOS 3IIIA 1K42A 3I2DA 2ZGOA 3BUCA 1A78A 2VC9A 3RNSA 5FZIA 3ZXDA 5J3UA 1ST8A 3U10A 3EQEA 3I49A 3LDRA 1CAWB 4LJHA 1HQNA 3VD5A 4PJYA 1PK6A 2WNVC 2JG9B 4LXLA 1CAUA 1SBEA 2WZ8A 3VL9A 3WW4A 4QXCA 4OZXA 4D69A 5BNOA 5CFCB 2XBO1 2JDKA 1AZDA 1G8WA 5A80A 4I02A 2EF6A 4DRRA 3GHNA 5GLTA 4BMEA 4RGKA 1B35C 3LFMA 2HWF1 3LGRA 4KWUA 1XYOA
chains in the Genus database with same CATH topology
4GH4B 2YGLA 4HBNA 2VXRA 3VBHA 1SLTA 3V0AB 4YW5A 1DHKB 5DDJ3 2HWE1 1CN1A 2JG8B 4HVOA 5K7PA 1ND3B 4GKXA 4LBLA 2Y38A 1GNZA 3IKWA 4HN1A 5CADA 2P3IA 1SDWA 4MH0E 1HQWA 4QQOA 1FPN3 3ES4A 1VBC3 3AMPA 4Y1YA 3VBOA 3S0MA 1QMJA 1W6QA 4K8FA 1V6JA 4PIZA 3KSCA 1W6PA 1G6NA 2X8KA 1FMD2 3OGGA 4JDNA 3KT4A 4HMZA 3JBG2 2R1DA 3MLLA 1IS3A 5AVAA 4EN6B 4Y24A 5BNPC 4LE4A 3VZMA 5FTTC 1BEV1 1WLTA 3E5QA 4Q4X3 4XHBA 1NCQA 4BIOA 2PAEA 1AR72 5FQ0B 1Y3TA 1AYM2 4BHPA 1N1TA 1VAMA 3VUOA 3O12A 3TNQA 1UL9A 2WZR1 1DQ6A 4YGCA 1W6NA 3FE5A 4B4RA 2VMHA 2PHDA 4WV8A 3ILNA 1LHUA 1X8MA 1V6NA 3HQXA 1Z0HA 4TWTA 3KCXA 1O7FA 4BMBA 1ZBE1 5J96B 3LAGA 1AL0G 4IV1C 3NAPC 2RS53 1ZNPA 1IS6A 3VV1A 4IV3B 4RGAA 2GDFA 1R1ZA 2WSUA 1QY4A 5FO7B 3LOBA 3KMHA 1CJPA 2CWMA 2C1FA 1J59A 1DYKA 4A7ZA 1W6MA 5T50A 2Z79A 2O8OA 4LO8A 4Y20A 4XFCA 4ES9A 1ULDA 1RHI2 3WOGA 2YYOA 2W39A 3AP5A 4LULA 3ZFEB 1SMVA 3AZWA 4NHKA 4O9GA 2NPIA 3B94A 1MR5A 1VRH1 1RVF2 4AFBA 4KWKA 2GC3A 1PO21 3WLUA 1UMZA 2ES3A 1U5XA 2ZHKA 2VNRA 2P34A 1MS1A 2EXJA 5C8WA 3I7DA 2R072 2D6KA 3FFZA 4HKWA 3M3IA 1QNYA 3TYJA 3WT3A 1O3QA 2OZJA 4IEPA 4H7LA 3ZDSA 1J1TA 1PO13 1YFUA 2BNNA 4AEKA 2UYBA 3RMXA 4UW6A 5LEKA 1WCDJ 1XU1A 2XHKA 4I3PA 1YUDA 1DGWX 4F3JA 1NQJA 4EN8B 1RUH3 4IEVA 1SCRA 3ETQA 1ZA4A 3EO6A 1RUOA 2AZ5A 3WW2A 4RR3B 2PHUA 1Q5OA 1H1MA 1LOBA 1MEC2 2XLAA 5EJ3A 3NO8A 4YVSA 3MIHA 4Q0SA 3GNEA 4QD2A 3UL2A 1W6OB 1AF9A 3VLBB 1C28A 2WA4A 4OI2A 3E6BA 2XVLA 3MPPG 2BVVA 3JB4C 2ZX0A 1JW6A 1VB2A 2Q5TA 5BXXA 4TZDA 4SLIA 5ACA1 2HWD2 2KA3A 5L19A 1G9FA 4L8QA 1DGWA 3VBSC 4XF9A 3OCPA 1IOAA 2V73A 1GQHA 1GZCA 1GZWA 3MDPA 4HSLA 4H7MA 4YYOA 4M0HA 1QWRA 4QPIB 4QGLA 1COV1 2PLV3 2XB6C 4MZUA 1JHNA 1ZBA3 5ABJC 3WUCA 3A0KA 3MF6A 4NR1A 2WFF2 2VU9A 1Q8SA 4CDUB 2W68A 4NN0A 4Q0UA 4XFIA 4YGEA 4YZ5A 2GH2A 1R082 3FBYA 1ONAA 2GMEA 2ZTNA 4KG8A 5KXDA 3EXUA 1OOPC 3DUIA 4KU7A 1Z78A 4WBBA 4U2AA 1FNYA 3AXDA 4AFMA 3H3ZA 2VW0A 1X7NA 2LTNA 2C5DA 2IWGB 4ISRA 3URFA 4YM1A 1SLIA 2R041 2XPJA 1OHFA 1FMD3 4HFSA 5C33A 4FPFA 3WQ0A 5DXDA 3JD71 3JBG3 4YM0A 4META 1O4TA 4HKOA 4WZCA 3I59A 2ZGTA 3GZAA 3VZJA 5BUVA 4AGRA 2D98A 5E8AA 3U4XA 2XBO2 4R9DA 2N7GA 1BCXA 1BK1A 1AR73 2P17A 4OLLA 5KBFA 2DUQA 3DPRB 3ES1A 1AYM3 4P9IA 2HWF2 3M3EA 4Q8KA 2R49A 4K1ZA 2LM3A 3J26N 4RS5B 4EV0A 1LOEA 3ZO0B 2P37A 5KXEA 2JXAA 3J4UH 4P9YA 2HWE2 1NZCA 1FV3A 1KFUL 5JSOA 1FT9A 4Q4V1 3IPVB 1VR3A 4P9JA 3S7IA 4CDWC 3HBZA 1BYHA 1AR91 2D5HA 3WDVA 1ZX5A 1RHI3 1ZZ9A 4COWA 2Y26A 1GYKA 2Z42A 3FWEA 2AGSA 1SBDA 4XW3A 1I1EA 3H3UA 4HPKA 1RVF3 2O0OA 3VKOA 1BEV2 3ZYGA 5JZGB 1LGNA 4Y26A 4Q4W1 4EWDA 2K0GA 5JOWA 1YFWA 3IWZA 3VHNA 4A3XA 3MGUA 3MLKA 1UU6A 1XNKA 2R073 3VL8A 3CF6E 3THTA 1S55A 4YGDA 2ZHMA 1OA2A 3H0OA 4N43B 2XJPA 3GZUC 5D8AB 5JMCA 5B2GB 4K1YA 1MS0A 1IKQA 4P9WA 1KITA 3OTFA 1NY71 2WT0A 1W39A 2D3SA 1ZBE2 2P2KA 2WLQA 5H9PA 2HYKA 1YIFA 2FZ1A 3P3NA 4KWLA 3GALA 2TBVA 2UY9A 4IV1A 1CQ9A 3NAPA 5I0UA 1MZ5A 2WQZC 3O0XA 1MEC3 4FOQA 5GZDA 4AFDA 1HKDA 1JUIA 4Q0VA 3BU7A 4PBPA 3T2TA 4DB5A 1DQ4A 4XILA 4P9GA 1VP6A 1O91A 4CDQB 3ZXGA 1VRH2 4ZKTB 2R0FA 5GM0A 1PO22 3WVJA 5FDBA 3DF0A 1H4HA 3SXWA 2HWD3 3OD4A 4AEDC 2DFBA 1GQGA 1H8TC 5JPNB 1QGLA 2DCZA 4YW3A 4MSVA 3MIBA 3R0RA 2PHLA 2ZGKA 1C1FA 2ZAAA 1D4M1 2RJLA 3VDDC 1EV13 2MEV3 4R4ZA 3D8CA 1NQDA 5EZWA 2R32A 2XGXA 4NHMA 4WM7C 2WFF3 1BBT1 5FO8B 3I8TA 1DQ0A 5BNQA 4KQ7A 4WM8B 1R083 5KWRA 2AENA 2OW4A 5DZFA 1G7YA 1HXS1 4L97A 5LK5A 4NWVA 1N1VA 2DFCA 3CJIB 4QT6A 5JVVA 3ALQA 3OBTA 4FPGA 1NA1C 2XWJB 3D6EA 2OA2A 1EAH1 4AVSA 2GNBA 4NVPA 2VY0A 4R9CA 3S6PA 1OD5A 2ZGLA 1ZZBA 4LBMA 1QOSA 2DWRA 3V56A 4KG0A 4AVCA 5JLVA 3USSA 3AYDA 3N4MA 1DGRA 4CEWC 2D3RA 2GU9A 3AK0A 1PK6C 5IUQA 5BNOC 1O4YA 5CG9A 3NV3A 4R9BA 1Y7BA 2W0XA 2XBO3 5ACA2 1QQP1 4AEJA 3POYA 3TN91 4N53C 3LA3A 3VBOB 1XYPA 2HWF3 3R6SA 5AVPA 2RM21 3U07A 4LBKA 1LRHA 2GC0A 3B3QE 1COV2 5T5LA 1QJU1 4JDOA 2HWE3 2GNTA 4Y1UA 5ABJA 4W6WA 1AXZA 4XFFA 3USUB 3AZZA 4EWAA 2D6LX 5IK8A 2ZGMA 5BPXA 2A6WA 3H1MA 4FPYA 3R4SA 1WCSA 4L2NA 4FPKA 5BV6A 1R1A1 2E53A 2NLRA 1PVC1 1MVEA 3ATGA 4C90A 1ZM1A 3BIWE 1URXA 1L3JA 1O4ZA 1WBFA 2OZ6A 2R042 5SV5A 4Q0PA 4YNIA 3JD72 4RHV1 2Z5WA 5C8CB 5EV7A 1DBNA 2ZGSA 3PVEA 2IXCA 4IEQA 1BEV3 2D6MA 1QDOA 3H1YA 1REEA 3INAA 2HEYF 2CV6A 4EN7B 1C3HA 1NCQC 4AI1A 2VW1A 4LLOA 2VOWA 2JX9A 4OHWA 1RB8G 4R9AA 4XOGA 5C9AB 3PJYA 2Y0OA 2WZR3 2E9QA 1CX4A 3TNPB 5FLHA 5AC91 4AHWA 1UF2C 1YI9A 1O5LA 2X5IC 3WNXA 3RI9A 1ZBE3 4YZ2A 4Q4V2 4QQLA 3VKLA 5JOYA 3CU7A 4B29A 5FO9B 5KXBA 3RRDA 4Q1PA 1WCKA 5F5QA 4DS0A 1AR92 1ZRFA 5CVRA 1J3QA 4CDWA 1IZ3A 4FAHA 2ZX3A 2ZMNA 2BGCA 2ZGUA 3SCFA 2MNGA 5C4WB 1VRH3 2XJTA 4LT5A 1BJQA 5HCBA 1U0AA 1U5ZA 2DVDA 3OY8A 1PO23 3AYCA 1JUHA 1GNHA 2D43A 2PA7A 4A2UA 4C1XA 3AM2A 2DCJA 4Q4W2 1KS4A 5J98B 2NZ9A 2XUMA 2YGMA 1RUC1 2GALA 2FBEA 4ORFA 1Q8OA 3B02A 2VMIA 4AEMA 5EYXA 3W58A 4B3NA 2R30A 4GALA 2ZCWA 4FOVA 4Y5Z0 1MS9A 1PGL1 2WIIB 3WP3A 1DF0A 3IIAA 4JQRA 2OUJA 2XJQA 4Q2FA 4IERA 1EPWA 4KH9A 1AR81 2GNDA 4I30A 1AL21 1S0FA 2PAMA 2WWSA 1NY72 3VZLA 4K7JA 3LWCA 5CB7A 1NG0A 2XKOA 4K6BA 1HLCA 4R8HA 2CGNA 2QKDA 2EVXA 3WV6A 4DNYA 3QOPA 2CYFA 4M3CB 2BEOA 4COUA 2R0HA 3IM0A 2B9UA 1S0JA 1PIV1 1AR61 2QUOA 1BZWA 4JV4A 4U36A 4PIXA 1IS4A 4YVSC 4CRQA 5KHHA 4Q1RA 2MPFA 1UKGA 3KT1A 2VULA 2QVSB 5CAZA 4YW2A 5BNNC 3R4DB 3E97A 4IEOA 4X8PA 4BE3A 5HI0A 2HEVF 2JE9A 5ACA3 3N3HA 5DUXA 3VGIA 1ENXA 3ZFGA 3JQWA 3V64A 5FRAA 2E63A 4AEDA 2VECA 1H8TA 3W9AA 3S30A 4JCKA 1UPIA 2DV9A 4L11A 2ZHNA 3KT7A 3N7KA 4AW7A 1D4M2 1COV3 1WGPA 1GBGA 1BBT2 3SMHA 1AHSA 4XBNA 4LE3A 3LSEA 2RS11 3RI8A 1HXS2 2VUJA 5L73A 4HL0A 4ASLA 4BOWA 2WNVB 1HRI1 1NXMA 4BQ1A 1G9BA 1ND2B 2VH9A 3JUUA 2HWC1 4DZGA 1WW5A 2VGDA 2GAUA 3AKSA 1FXZA 2B39A 1WW7A 5J09A 1ENSA 1EAH2 1TEIA 2R043 4W6YA 4CEYC 1B35B 3N7JA 4CTEA 3ZPYA 4LUKA 3WG4A 2K2SA 4BZ4A 3JD73 4EWEA 4I01A 4FPEA 1FAYA 2R1BA 1HW5A 2QFEA 4AE2A 2YZ4A 3AYAA 2ENRA 2DU1A 4CEWA 3TAYA 3NSTA 1KD7A 4Z1VA 1JXNA 3PMSA 4BPZA 2R6QA 1QQP2 3VKFC 3NV2A 1I3HA 1I6XA 2ATFA 3TN92 5EWSA 4Y1VA 1YXWA 3WINE 2RM22 4N53A 4WZFA 4NO4A 1KJRA 4LHNA 4XFHA 4E2GA 1MZEA 5FOBB 1QJU2 2WNUA 5J7MA 4PDWA 1OFNA 2VVDA 2FMDA 3MEPA 4L9BA 2QZ2A 2ZBJA 3EBRA 4OUSA 4AQ2A 4N7UA 5BNPB 3AZYA 4E4DX 1Q8PA 4Q4V3 3RYPA 1PVXA 4BM8A 1R1A2 3ZYIB 1M4WA 1PVC2 4ATFA 4YZ1A 3CEWA 4LA3A 3OYWA 3R05A 5GLZA 1AR93 3FHIB 5CBLA 4LA2A 4XJ9A 2WT2A 4JTNA 1WD3A 3SH5A 5I91A 4YSFA 4IEXA 2IC1A 4RHV2 3MW3A 3PVOA 3D0JA 1O3RA 3WQ1A 2BNOA 1F5JA 3PNAA 1QXJA 3RJRA 5CFCC 3ZSLA 3OJBA 4Q4W3 5HXVA 3G6JB 4ZU7A 5I8YA 1S2KA 3NAPB 5KC5A 1VAKA 1V6MA 4Q26A 1NLSA 5GZGA 3UK9A 1V9U2 2D6NA 3N35A 5AC92 1W0OA 4Q27A 3WQ7A 4LBJA 1XXNA 4Z2WA 1G9AA 1LESA 4YW1A 4RSUA 4AGVA 2X5IA 1LJ7A 4XF0A 1UU4A 4CP1A 1DG6A 1JN2P 1SBFA 2I74A 4AHYA 1KXGA 2DCKA 3MIDA 3ZFFA 1XNDA 2CTVA 3PHMA 4IXLA 2DU0A 3VZKA 1YNAA 4EN0A 3VBUA 5H9QA 1UN1A 1U5IA 3ILRA 2QDRA 2ZMLA 1SLBA 2XLGA 3KB5A 4URTA 4XEZA 5TSWA 5EXOA 2BVBA 2HWB1 3B9IA 2D5FA 1OI6A 1RUC2 2D6OX 4QU2A 1JYIA 2QJVA 1RUD1 3ZN6B 1A3KA 1OFSA 1UIKA 2NN8A 1PGL2 4JVAA 4LBQA 1D4M3 3MFAA 3ZVXA 1AR82 4GB31 2A6XA 2ZGQA 1X8EA 4PQ9A 3RQ0A 1AL22 1BBT3 2VNOA 4XBLA 2GC2A 3WDXA 5F9TA 1RL3A 4JGZA 3ZIWA 2XLFA 2XG3A 1HXS3 1RUF1 3FLTA 2ZOEB 1APNA 2PAKA 2XWBB 4LBQD 4KNCA 5DUUA 3TBDA 3ZXLA 1PZ8A 3WXPA 1OKQA 4AI3A 3V0BB 1ENQA 1G86A 1SEFA 4IEUA 2PELA 3RYRA 1PIV2 3WUDA 1BKZA 1AR62 3VKNA 4BYYA 3VBSB 1EAH3 3KLSA 4JDMA 1V6OA 2GC1A 3KGZA 3THPA 5AFBA 2P3KA 3WD5A 1ZZCA 1DGLA 1MZFA 1AYN1 3ELNA 4LO7A 4QPGA 4CDXA 3C3VA 5BNNA 2PN5A 5JAXA 4X6RB 3NV4A 3O0WA 4FOWA 4AHXA 1ZZ6A 4WVMA 4OI0A 3BOWA 2ZA9A 1QQP3 4NPRA 3WHTA 1F5FA 1OOPB 1BQPA 3TN93 3MW4A 2D3PA 3PJQA 4D7YA 1S1AA 5K0UA 1D4VB 2RM23 1LU1A 4GMP1 4HSJA 4GIQA 3RSJA 5JOXA 2FHRA 4K3UA 5K8SA 1N1SA 1UD1A 1QJU3 1X36A 4HANA 2WQ4A 3B5LB 4ASMB 4F8AA 1NCRA 2PHTA 1YLLA 4RFT0 1S2BA 1VB4A 2RS12 4RL7A 4DOUA 3ZXEA