3AXDA

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase v18y/w203y in apo-form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
MKDFSGAELYTLEEYQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKSPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDYTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Rational design to improve thermostability and specific activity of the truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase
pubmed doi rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 59
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2011-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3axdA00
4YW3A 5CAZA 2HYKA 1A8DA 1HDKA 4FOQA 4P9YA 3A0NA 3ZSKA 3AXDA 4JC1A 3C2UA 3FLTA 2YMZA 4XTPA 4BQ1A 1QOSA 5IK8A 3WCRA 2NN8A 3WDTA 1IS5A 1KDKA 2DUOA 4XILA 4DFSA 1YRZA 3ENRA 2EF6A 1MACA 2ZHLA 4ISQA 1Y7BA 1SFYA 4YW1A 4DS0A 1DGLA 1RITA 4ZKTB 4FOYA 2UWCA 3OBRA 4Q26A 2ZGNA 4FPJA 3O0WA 4IQPA 3POWA 1XQNA 4Y1VA 3MPPG 3N7JA 4GKXA 1AZDA 2ZGSA 2XG3A 1FYUA 3BIWE 1I1EA 1W6MA 1S0IA 1C4RA 1UL9A 3ASIA 3SNMA 2VH9A 2YV8A 3AX4A 1JXNA 2EXHA 3D6EA 4K1ZA 1RIRA 3AZVA 4UW5A 1A78A 1W6QB 4UW4A 4XOGA 5KXEA 1LOGA 1DQ4A 1DQ5A 1WW4A 2AYHA 3POSA 1ULDA 2DTWA 3W59A 3A0KA 2ZMLA 4GXLA 1C1FA 4ASMB 4LBKA 2WLQA 1IS4A 1CIWA 1GV9A 3APBA 5E8AA 4Q8KA 3WOGA 4TYSA 1V6NA 2ENRA 1CQ9A 3SH5A 2ZHMA 2D3PA 4YGBA 2NM1A 2VW2A 1AX2A 3AYCA 1NXD1 4XHBA 5GM0A 3M3QA 3CNAA 5T5PA 3VKNA 1QNYA 4Q27A 4UW6A 5HCFA 2W52A 1SACA 1LODA 3WHUA 2A6ZA 4Q8LA 2AR6A 1O4ZA 3V0BB 5CB7A 5GALA 1V6OA 1LHUA 2GMEA 4XJUA 1SLAA 2FHRA 2NZ9A 1MS3A 1BYHA 1GANA 4XIOA 5AVAA 2R49A 5DUWA 3MW4A 3PVEA 1GSLA 3SISA 5DUVA 5JDBA 2ZGPA 1G9FA 2EALA 1DBNA 3AYDA 1TEIA 1JW6A 3BOPA 5IT6A 1HLCA 2PHUA 3BTAA 2A71A 1DHKB 2DU0A 3AK0A 3DGTA 4FPYA 1CESA 1LGNA 1JBCA 4K20A 3WVJA 5DZFA 4ATFA 3AP9A 3M3CA 4YM3A 5DXDA 4BLJA 1S1AA 2DTYA 2R0HA 3IM0A 2DURA 2A5ZA 1JN2P 1D0HA 3LCPA 3N7KA 4K1YA 4W65A 1JHNA 2NMNA 4SLIA 1AXKA 2OUHA 3O0VA 3R05A 1IKQA 1FNZA 1N3OA 3V0AB 1NLSA 4Y1YA 5F9TA 5H9RA 2R1DA 2AH2A 1SLTA 2CY6A 2ERFA 4M3CE 2A70A 5DUUA 4C1WA 3IPVA 1FATA 2SLIA 2ZGOA 4H55A 1C1LA 2JE9A 4M3CF 1LOFC 1QDCA 2JECA 2W39A 2D3RA 2UWAA 4YZ4A 1H30A 2GMMA 5GZFA 3SITA 3HN1A 1FAYA 1N1SA 3UJQA 2E6VA 2D6PA 2ZABA 3UL2A 1IOAA 3RSJA 1LOAA 3AYEA 3TB0A 1HQWA 1MS4A 4YFWA 1Z78A 1LECA 1Z0HA 4FQZA 2D6NA 2A6VA 4GWMA 4HL0A 4OZXA 1LULA 1MVEA 1W6OB 4NOTA 3AXEA 3L2YA 5FREA 1CR7A 1VAMA 3ILRA 5L73A 2GALA 3IN9A 3OGGA 3USUB 4YG0A 1PZ7A 1WLCA 4UW3A 3LSDA 1DZQA 1LEMA 2DUPA 2E53A 4YW4A 5JOXA 2C9AA 4YW5A 3POYA 1SLCA 2JKBA 4Y22B 1V6KA 1SBDA 2CWMA 3FUOA 3WDXA 2DWRA 3SLIA 3V65A 1S0GA 1G9DA 4XTMA 4XJWA 3VUOA 1GBGA 4LBQA 2ZGQA 5GLZA 2A6XA 2R16A 2VW0A 5T52A 5HCBA 3OY8B 3NV1A 2VW1A 4D69A 1W6PB 3PJQA 3ILNA 2P3JA 2DV9A 2GNBA 2CTVA 5H9SA 5GZCA 1G8WA 1VAVA 1V6IA 4M00A 1GZWB 2AREA 2E7TA 4LBNA 5JVVA 5EYYA 2ZZJA 3AZYA 4YM0A 1LU2A 2FMDA 5T50A 5EYXA 2TEPA 3ZXKA 1DYKA 4XHXA 3WHTA 1N1VA 2OUJA 2WT0A 4XMIA 1Q8PA 1AX0A 3WUDA 1QMJA 4FP3A 2AENA 1W6NA 5T5OA 1W6MB 2I2SA 2NMOA 1C57A 1N47A 2ZBJA 5T5LA 2R0FA 3JU9A 3WG3A 1AJOA 4FPFA 4Y1UA 4XBNA 2P37A 1DQ2A 1AJKA 4XMAA 1R1ZA 2EXKA 4TZDA 1KJRA 2YXSA 1IKPA 2A6YA 2WT1A 2EXIA 5CNAA 3B01A 3Q9OA 1ONAA 1G7YA 1AVBA 2NYYA 1FV2A 5IUQA 4DPNA 1LHOA 3D5OA 3I4IA 3MW3A 4R9BA 3RQ0A 1X50A 4BOWA 1SBEA 5SV8A 1QKQA 5GLUA 1PZ8A 3AZWA 2VY0A 4MYEA 1S0JA 1YXWA 3A4UA 3FLRA 5H9PA 4F83A 5JOYA 1MS8A 3WG4A 2AGSA 2VXRA 2AUYA 3AP7A 4XXPA 1GZ9A 2EXJA 4NO4A 1ULEA 2A3WA 4M3CB 4DRVA 1YI7A 1URXA 1UZZA 1YIFA 3FFZA 3R4UA 2WQZC 1I3HA 3WCSA 3M2MA 2D44A 1WBFA 2UURA 4YZ1A 1BQPA 5KXDA 4BPZA 1JYIA 1VLNA 2DVAA 2DVDA 2A7AA 2ZACA 1W0OA 3M3EA 2EIGA 1GLHA 1W6QA 1LHWA 3AFKA 1WLWA 1QF3A 1MVQA 3R4SA 3M1HA 1V6JA 2GNMA 1B09A 4Y1ZA 1F31A 2DU1A 1MS0A 4M01A 3N35A 4FPKA 2E7QA 4CTEA 4P9XA 5T5JA 1MS9A 3FBYA 4YGCA 4PBPA 3VKLA 5GLWA 3OJBA 1SLLA 2WKKA 2RHPA 4Y24A 1AF9A 3RMXA 1LOEA 2PHTA 3O5SA 2P3KA 1HKDA 2GN7A 2E51A 3DUIA 3IPVB 2ZMKA 2UWBA 4R9CA 4Y20A 1DFQA 5FRAA 5JMCA 3RMYA 3OYWB 2SBAA 2JJ6A 4FVVA 4XXAA 2DVBA 3OPZA 2R1BA 3H0OA 4FQ4A 4I30A 3ZVXA 1LHVA 3AJZA 3AZXA 3NV3A 4XYXA 5E88A 1G9CA 1S0DA 1AX1A 5T54A 1WBLA 3UK9A 1D2SA 2H0BA 3FUQA 2CNAA 1Q8OA 4XJAA 2ZGMA 1LU1A 3GNEA 4U36A 2C5DA 2GNTA 4XIKA 2W68A 1ULFA 1CVNA 4FPCA 4GKYA 2DVGA 2WSUA 3ZXEA 1ULCA 2V5YA 4XE9A 3HMYA 1U0AA 3PVNA 3VV1A 1GNZA 3MEPA 4AWDA 4YFZA 3WDUA 1DLLA 3VKFC 1V6LA 2PELA 3INAA 3V0AA 4YGDA 1G86A 3T1LA 1S0EA 3O0XA 3QCWA 1DYPA 3RG0A 1H9PA 1LESA 5KXCA 3UJOA 4CRQA 4BM8A 1V00A 3MW2A 4LBJA 1Q8VA 1ZM1A 2ARXA 3ILFA 1QDOA 5DZEA 2GNDA 2A75A 2P2KA 4YZ3A 1DQ1A 1ENQA 4HANA 1FV3A 3ZYRA 2OVUA 1UAIA 4WVVA 4Y1XA 1LOCA 1MS5A 3WZ1A 2ZGUA 2P3IA 5CA6A 3BODA 1KITA 3N3HA 1PZ9A 3WDYA 5EXOA 3W58A 2P34A 2V73A 4FPLA 3USUA 3ZXLA 4AGRA 3WG2A 4GWNA 2GN3A 3VKMA 2D43A 3N7MA 1JYCA 2XB6C 2VU9A 4YZ5A 4FPOB 4LBMA 4YGEA 5IK5A 1ZA4A 4AVVA 1GNHA 2WNEA 1S0CA 3KQRA 1S0FA 3T1MA 1APNA 3ZYPA 3U4XA 2GMPA 2D3SA 5GZDA 3OY8A 3HR9A 3PMEA 4AYUA 1N1TA 1W6PA 1VALA 3AP4A 5GLVA 1KRIA 3VKOA 1ENSA 4ISRA 2PHXA 4PF5A 3ZPYA 1UKGA 2ZGKA 1OQ1A 4CZSA 3B9CA 2A3XA 1GZWA 5E89A 1N1YA 1UPSA 4ZXKA 1KJLA 4FOWA 3TAYA 1A3KA 2LTNA 1AXYA 1LHNA 1N3PA 1LGBA 2VUAA 4WV8A 4XDQA 2ARBA 2ES3A 5DZGA 1LGCA 5KXBA 3QLQA 5T55A 3B3QE 5HCAA 1SCSA 2NP0A 4Q1RA 3FLPA 1GZCA 4R9DA 1YO8A 1G9AA 1Q8QA 3NV2A 1VIWB 5LK5A 3PVOA 4AVSA 1MS1A 1OKQA 2KM2A 3M3OA 4Z8BA 2CL2A 3NV4A 1BJQA 3JUUA 3SH4A 4BMBA 4JRAA 2ZGRA 1WD4A 4ITCA 4L8QA 1LTEA 1GKBA 4P9WA 4PBOA 4AGGA 1JUIA 4FOVA 1WLDA 1QOOA 3KM5A 4BMEA 4P14A 1WUVA 3WG1A 2PHWA 5CBLA 2JD4A 1QU0A 5IK7A 2ZKNA 1CPMA 3WDWA 5GZEA 3AZZA 2D6KA 2PHFA 2ZA9A 1J1TA 2GDFA 3N36A 4YW2A 3RRDA 2YROA 3AJYA 4XZPA 1IS3A 2DUQA 2OW4A 4JCKA 4AGVA 4DQAA 3SH3A 1FX5A 5JOWA 4Y20B 2YY1A 4Q2FA 3I8TA 4M3CA 5JOZA 1ENRA 5DUXA 2A3YA 3T2TA 4LBOA 3IKWA 3N7LA 1UMZA 1WW6A 1HQLA 4FPEA 1SCRA 2Q5TA 1LCLA 2D6LX 5DG2A 2ZGTA 4YG6A 5H9QA 3ZSJA 3B00A 2A6WA 3LSEA 4LBLA 2ZAAA 3WV6A 1FNYA 4AVTA 3V0BA 2DYCA 2ZHNA 2CWSA 2D6OX 4WZFA 1AXZA 1WCSA 2PHRA 3WUCA 4YM2A 3ZXJA 3O12A 4K21A 1Q56A 1KDMA 1UN1A 1UZYA 1LOBA 1GYKA 2JDZA 4GA9A 3V64A 4U2AA 1SLIA 3ZXFA 2D6MA 2JE7A 1LOFA 3WDVA 1DQ6A 1V6MA 4GALA 4FPGA 3RS6A 1WW7A 3OBTA 4YZ2A 1BKZA 1LEDA 1QOTA 3WNXA 2BQPA 2UU8A 4R9AA 2CYFA 1MZ6A 1SLBA 5IK4A 1WD3A 3B69A 4XJZA 1F9KA 2ZMNA 1QGLA 2Z42A 3AP5A 1UX6A 1OFSA 2D7FA 2LALA 2YZ4A 4LBQB 3WLUA 3AP6A 3OYWA 4YLZA 1QNWA 1Q8SA 1IS6A 1MZ5A 1W0PA 1DIWA 2WJSA 4XBLA 4LBQD 5GZGA 2DVFA 5BYNA 4YG3A 1ULGA 1KQRA 2WSVA 4DRRA 1YYNA 3AYAA 2WT2A 4RA0A 1JOJA 1F5FA 2ZHKA 1S0BA 1GICA 3GALA 1CN1A 1O4YA 1RINA 1SBFA 5GJ6A 3ATGA 4YM1A 1CONA 1CJPA 3IMNA 1N3QA 2B7YA 1WW5A 4XBQA 5F5QA 4FP2A 2ZGLA 5JLVA 1EPWA 4PCRA 1W6OA 1BXHA 4XJ9A 1W6NB 3NWKA 2G4IA 5GLTA 3ZSMA 1H9WA 4RL7A 5EWSA 2EAKA 2W08A 4BLIA 1G9BA 3D4KA 4C1XA 5DG1A 1MR5A 1CPNA 1BZWA 3ZSLA 4XJ8A 1DQ0A 4Y22A 4KBBA 4Y26A 4Q1PA 4ATEA 4WVWA 4PQ9A 1LJ7A 1LENA 4FPHA
chains in the Genus database with same CATH superfamily
5JAXA 4YW3A 2WFF1 2XR4A 3RZMA 2DCKA 1HDKA 4Y5SA 4P9YA 5LWBA 5LBBA 4F3JA 1WMFA 2XWBB 4BQ1A 1QOSA 3GCXA 5FK8A 3WCRA 5BNNA 2Y33A 2RS32 2UYAA 1PO21 4I02A 2FBEA 3ENRA 4QQHA 3IMMA 4ISQA 2GC3A 1DGLA 3PVBB 4DXZA 2R073 4D7YA 2ZXQA 2ZGNA 5FQ0B 3EMRA 1J59A 2WL1A 4LJHA 1L7LA 5BNOB 2Y6GA 4E4DX 1V70A 3MPPG 5A1LA 4JZRA 2LRPA 5FAXA 4CSWA 3BIWE 4I3GA 5I0RA 1OF3A 4ZHNA 1IGOA 2EIEA 3ASIA 4ZZ5A 3QH7A 2YV8A 3ZMOA 2VMCA 1CAWB 4A7ZA 4CXWA 1RIRA 3AZVA 4IEVA 2W46A 5F39A 3IB3A 4UW4A 1ENXA 1VBC2 1PIV3 1DQ5A 3E6BA 4ASLA 2DTWA 4A4AA 3K2OA 3I2HA 4ASMB 5F1RA 4JX0A 5F5AA 2WLQA 1IS4A 3APBA 1PNFA 1UU5A 3VZNA 1A34A 4NRPA 1WCDJ 4B7EA 1JZ6A 2ENRA 2JIJA 1CQ9A 3E5UA 4QPIC 5F3CA 4YGBA 2YBSA 1YFXA 2NM1A 4LLOA 3AYCA 5A3OA 2GC0A 2XPJA 3N4MA 1VRBA 2OZJA 1REEA 3F2ZA 4B4PA 3KV5A 5BNPC 4NIIA 3VKNA 2AZ5A 1QNYA 2VNOA 4MVTA 4NR1A 4Q27A 4UW6A 5HCFA 2W52A 3T08A 1TQ5A 3W21A 4BQWA 2IUWA 4Z2WA 3TN92 4CDUB 1KD7A 2XMLA 2AR6A 5FMDA 1O4ZA 4ZXEA 2XBO2 4DXRA 1ZBA3 3O1TA 3C8XA 5A3WA 4RYDA 2HBTA 3VL8A 2BUKA 2XL7A 3NL1A 2RR11 5FZIA 2IVIB 4CEYC 4NIDA 1BYHA 1GQPA 3FFQA 3N9PA 2R49A 1FOD1 1H2NA 1PMHX 5SV5A 3PVEA 3SISA 2DBIA 3OG2A 3GJBA 1W8WA 2ZGPA 4P08A 4OCTA 1TEIA 1COV3 3ST7A 5IT6A 5EJZB 3BTAA 4OULA 1O7FA 2IXCA 2JEMA 4FPYA 2RS12 2YG0A 3HBZA 4K20A 5FOBB 3WVJA 1A6CA 1IPSA 3BALA 3C7FA 3KD4A 4N8MA 1S1AA 2DURA 2A5ZA 4BQ4A 1VRH2 1D0HA 1UNBA 2P3YA 2J22A 2BNOA 4QMAA 1AXKA 3J4UH 2VNGA 1FNZA 4P02B 3THPA 3ZFFB 5F9TA 2Y38A 3USSA 2QNKA 2AH2A 1SLTA 4C1WA 2VNVA 5DUUA 3QH6A 4DMIA 4BZ4A 2JE9A 2E63A 1OD3A 2UWAA 4YZ4A 3SITA 1AR81 1FAYA 1N1SA 3SMHA 5BV6A 4CP9A 1AL22 3UL2A 4AAXA 5DDJ2 1RUD2 1MS4A 4AR2A 1PIV1 4F7ZA 4WM7A 4FQZA 2X29A 2A6VA 4C8DA 1LULA 4QM9A 2JDNA 4J1XA 1VBA2 5FO9B 4AHXA 3J7MA 4AEMA 5HI0A 2GALA 4CEWA 1ASJ1 3PUAA 1US2A 1PZ7A 4HN0A 2FZ1A 4CDXB 1DZQA 5IVVA 5EHDA 1K12A 3ZFFC 5C8CC 1RVF2 3JBG3 2YU2A 2HWD3 3WW2A 4DOUA 1JOPA 2JXAA 1ZRCA 2JKBA 1V6KA 3PLQA 2DWRA 1C28A 1OFNA 1AYM3 4Q4X2 3O1SA 3HN3A 1STMA 2PFWA 3VUOA 2P17A 2WYSA 4Q0QA 2R16A 5A33A 1ZBA1 3DF0A 4QB2A 3WQ1A 4RFRB 3POJA 2VW1A 1X9PA 1K5MB 1OQEA 3PJQA 2GNBA 3LFIA 3VBSB 2QQJA 1GP4A 1AUYA 2GP3A 4EN6B 3AMQA 1O3RA 1GZWB 2H6CA 2JB8A 3BN6A 3J7LA 1XC6A 3HVDA 2YGMA 2BV4A 5T50A 1DGRA 1QH7A 4CDXC 1COV1 1ZZCA 4WM8A 3GZAA 1OUSA 3FBMA 3HT2A 4XHXA 1N1VA 2VD7A 4MXVA 5FCCA 5C3PA 2WABA 5J36A 4IV1B 4E4ZA 1AX0A 3PIGA 3PUIA 5F32A 1FPN3 2AENA 3OSDA 3BKZA 2R32A 2RJ2A 4PIZA 2WA3A 2AEZA 1NKGA 2ZBJA 2YYOA 4AHWA 4Y1UA 1B35A 5FY4A 2P37A 1H8TA 2BOJA 3OPWA 5J98B 2Y60A 1R1ZA 3DCQA 1W2OA 1K5MC 4CDQA 4INDA 4GD4A 5HXMA 1IKPA 2A6YA 2D5FA 3ABZA 3Q9OA 3VBSC 2YFZA 4XACA 1G7YA 4TXWA 1NA1A 4ZU7A 4QGMA 2DCYA 1X9TA 5EQUA 5CU1A 1VBB1 1EYBA 3T2QA 2VAUA 1JYVA 4DPNA 3PTYA 1XU2A 1KFUL 2XLAA 1X50A 3HAGA 1SBEA 2BWAA 4R9BA 5A1AA 1VE0A 2VY0A 1S0JA 2QQOA 3A4UA 5FP4A 4F83A 1MS8A 3MGUA 4IV1C 4RQPC 3WG4A 5JR2A 1BVP1 5CVRA 3KSCA 4XXPA 4EN7B 3VBUC 5FQ0A 3SQOA 5C9AB 1RHI3 5I0DA 1EAH2 5BNOA 3OD0A 4D8MA 4X6RB 2FDHA 2UURA 1PVXA 1D4M3 2W95A 1UKRA 2JE8A 4QQPA 3U1XA 5KXDA 2Q1MA 3JBG1 1BBT2 4L99A 1WA4A 1JYWA 2HWD1 4BPZA 3RWNA 1NT0A 2IFWA 3AFGA 2DVDA 2XUMA 1CAWA 1RXGA 5A3PA 1AYM1 2VOWA 4AAPA 2EIGA 4BCUA 2Z79A 5B4NA 3F95A 2ZX3A 4BXFA 1PGSA 1POV1 5IVFA 1QJY3 4B3NA 3T4HB 2XWJB 3WXPA 4XQ4A 3KV6A 1VBD3 4M4PA 1H4GA 4QXKA 5EZWA 3N35A 2XJRA 2NLRA 4MGQA 3OOXA 1HRV3 4YARA 4NRMA 2JG9C 5CYYA 1MS9A 1IZ3A 1Z7S1 2JIGA 3C3VA 3FBYA 2I07B 3K3OA 3OJBA 1SLLA 4GULA 4PBPA 3VKLA 5C6CA 4JQRA 3OBZA 1ZRFA 3G7DA 4OUSA 1ALYA 2CSGA 1HB2A 2W3JA 2LROA 2GN7A 4QXBA 4D3WA 3DUIA 3IPVB 2QQUA 1FPN1 1DFQA 4CDWA 4AF9A 3AB0A 1NCRC 2RJLA 4IE4A 3T30A 5FBZA 5K8SA 1GU3A 1QJU3 2DVBA 1HRI2 3PU8A 2WS92 3RJRA 1BLZA 3AJZA 4UFKA 3UGGA 4XYXA 4DIQA 3KS7A 1K45A 4CP2A 2YBKA 1UY2A 3BPSA 3EO6A 1S0DA 5EV7A 4GH4C 5T54A 1E5SA 4B29A 1D2SA 4R52A 4XUPA 4XZUG 2QFEA 2G19A 2E7AA 3KHBA 2WO1A 3I2JA 1TZOA 3GNEA 4MLOA 3O1RA 3IZOA 1FMD3 2Y26A 4E2GA 2VOVA 4LHNA 3TEWA 4K3UA 2BERA 2R043 3HMYA 1U0AA 1W8FA 3RZKA 3I59B 1G6NA 3AVSA 3VV1A 1GNZA 4OMDA 5FUIA 3WDUA 3U0ZA 1DGRN 3RZHA 5FYCA 4FAGA 3O7OA 4Y33A 3O0XA 3T1LA 1RUOA 4TLFA 1DYPA 1GUIA 1W99A 1X8MA 2QJVA 4JKMA 1OHFA 1H8VA 1RUC3 5FYUA 4CRQA 1D4M1 4QX3A 2JG8C 4LO8A 1H1MA 2CHHA 1ZM1A 2ARXA 4H7MA 1QDOA 1SHWB 1OLRA 4GB33 3T0DA 4XCBA 3CU7A 1C8M2 3WINE 2AC1A 4NRQA 4IL7A 1IG3A 1JUHA 1ENQA 1UYYA 4UI9L 4COWA 3AMNA 5EPAA 5D8AA 4LXLA 1GWKA 1QJY1 2VMHA 2YPJA 1LR5A 5C3OA 1QJZA 3E5QA 3LDBA 2FDFA 3N3HA 1PZ9A 5EXOA 5D21A 2JDHA 4D94A 1NCQC 1VBD1 2V73A 3JQWA 2IC1A 4Q4V2 5J96B 3P1IA 1K5JA 2VQTA 1HRV1 4UOJA 2TNFA 5CKMA 4BU2A 1RUG3 4I3PA 5LA9A 5FXWA 2IWGB 4LBMA 3MUZ1 2JDPA 2ADDA 4NIAA 1JODA 4N53B 4COVA 5CEHA 4NJ4A 2VZQA 2WNEA 1BHGA 1S0CA 2VMIA 3KQRA 3T1MA 3U4XA 2D3SA 4HXCA 5GZDA 1RUNA 1CZVA 3PMEA 3POBA 5FYIA 1ZYBA 4AYUA 1GP5A 3AP4A 1QJU1 1VALA 5GLVA 3EYPA 1QJEA 2ET7A 4NUBA 1EUTA 4NIHA 3ZPYA 1T6GC 1OQ1A 2WA4A 4CZSA 5CFCC 2ATFA 2CDOA 2A3XA 1GZWA 5F3EA 5JSPA 4O65A 3I2OA 1PVC3 1RUJ3 4LUMA 1LGBA 4XDQA 3BU0A 3WNNA 2BVVA 1LGCA 5T55A 3NAPC 3IDBB 4NPMA 5HCAA 1SCSA 2NP0A 3FLPA 1K3IA 4Q4Y3 4JGYC 2VQ0A 3HT1A 2QE3A 1Q8QA 4FXGB 4JKLA 3POFA 4PI0A 3PVOA 3ZN5A 2R041 1MS1A 4OI1A 4AI8A 3M3OA 5J37A 2CL2A 1H1AA 3B94A 4HK9A 3FHQA 1BJQA 3JUUA 1Y9MA 4X6QB 3RFRA 3UKTA 4C91A 2ZGRA 1WD4A 2YU1A 3MICA 2ZEXA 5DMYA 4PBOA 1BMV1 4HK8A 4S2DA 4FOVA 3WNKA 1RUC1 2YC4A 4BMEA 2PHWA 2QTWB 1EV13 2WNUB 5A32B 1LB2A 4QHBA 2PLV1 1F35A 1CPMA 5LW9A 3AZZA 3DPRA 1W8NA 3ZXAC 4XEZA 1J1TA 5FTTC 3N36A 3ZXDA 5L7OB 3WD5A 3DL3A 3AJYA 4BWOA 5TSWA 4Y20B 5C9AA 5HCHA 2W1UA 5FY0A 3ZSEA 4XFBA 1W2AX 4OHYA 4P9IA 4I0BA 3IKWA 4LBOA 2PA7A 4CCKA 1SCRA 2Q5TA 3ZSJA 3KWVA 4YG6A 1RUG1 2A6WA 4LBLA 2ZAAA 1V9U3 3ON7A 3WV6A 3K4DA 2ZHNA 3LDKA 5C8WA 3RZZA 1AXZA 3FWEA 1WCSA 2WNUC 2W94A 4YM2A 2VZOA 3J7HA 3N9OA 4K21A 3LOBA 2Z69A 3I2DA 4XUTA 5KHHA 1XYOA 2J1SA 1NQDA 2JDZA 5LATA 4U2AA 2UYBA 3ELNA 1SLIA 4BJ0A 2VTFA 1CZSA 3HWJA 1E57A 1NLQA 2DCZA 1WW7A 3ZFGC 3QACA 1BKZA 1GOFA 1NG0A 2XJTA 4R9AA 3SCFA 4FSJA 3ZDVA 1JYTA 1MZ6A 2WQ4A 2Y6JA 4IEOA 5IK4A 3QD6A 1VPHA 1DGWA 3B69A 2WWUA 4LO7A 4XJZA 3ZFEB 1RUJ1 5HPOA 2BGPA 1MQTC 4HMZA 1R093 4IGQA 4HSLA 1QGLA 1UOJA 2OA2A 3WP3A 4N90A 4Q4Y1 4LHLA 1CIYA 1QNWA 2YB7A 1MZ5A 3PIJA 5I8TA 1S2EA 4O9GA 1OI6A 1O8PA 1PK6A 5LA2A 2LUWA 1KQRA 4AFDA 3VHNA 4YWAA 4LA2A 4PLOA 5L9BA 3AYAA 2XONA 4L2NA 2J42A 2VZTA 4KMQA 4HKWA 2VG9A 4LULA 1JYNA 1O59A 2DF7A 3ES4A 1CN1A 1RINA 2J1EA 1ZZ8A 4QKDA 1UXXX 2F4PA 4YM1A 5F5QA 1OOPB 1EV11 4TN7A 2ZGLA 1PO22 1W6OA 4RS5B 3MIFA 5DAQA 1BXHA 1KXGA 3Q8EA 3NWKA 1H9WA 1ND2C 1DZTA 2JDAA 4OMCA 5EWSA 3NNFA 1PX3A 5ABJA 1UCXA 3I59A 4TTGA 5JOXA 2B9VA 5DG1A 1M4WA 2W1WA 3ZPOA 1AR73 1BZWA 3MLJA 2IFRA 4JV4A 5AVPA 4KBBA 4YVSC 2BPA2 4ATEA 4JDNA 4PQ9A 1TNRA 4FPHA 5ANNA 4IERA 4GWIA 4GMP1 5CAZA 2VXJA 1NUKA 1V9U1 2X5IC 2XKOA 3VBRC 2VZ3A 3DXUA 2XHKA 1O3SA 2VVEA 5A7WA 5FZMA 3SKJE 1IS5A 2DUOA 4NHKA 3SHRA 1W90A 1YRZA 2ZZQA 1MACA 1QQP3 3RZGA 1PGW1 4LNVA 3NJYA 2Z4FA 4IQPA 3O0WA 2F4LA 2VVDA 5FMCA 4PIXA 4OQ8A 4YW7A 1VJ2A 1CAVB 3BTYA 5FZOB 1PX4A 4UBGA 3N7JA 1CZTA 1RUF3 4GKXA 2XJVA 5J3UA 2ZGSA 2W0XA 3NNGA 1FYUA 2WWJA 4LTAA 1W6MA 1UL9A 2JDMA 4J1WA 4MADA 4B4RA 1MZEA 5F8PA 4C90A 5IJRA 4S2FA 2WN3A 1JXNA 4N53A 5A7NA 4K1ZA 5ACA3 2VZPA 4EN9B 1W6QB 1J1LA 1WW4A 3W59A 4CE8A 1ULDA 5FYVA 2RR12 1CAUB 3A0KA 1OF4A 3S0MA 2QQMA 4LIUA 1FOD2 5C70A 1J3RA 3WQ7A 1J3QA 4JGZB 2X05A 3IIIA 4IE6A 5I0SA 3HD8B 4AHZA 1QEXA 3L2HA 4AK3A 3WY6A 2OZ6A 4I0AA 1GWLA 5FOJB 2VW2A 4LQRA 4HBNA 4AI2A 4XHBA 1CD3G 2VVFA 4FCAA 1X36A 3CNAA 5T5PA 4QX0A 1WZXA 3OUIA 4C0HA 5FPXA 4N43B 1D7PM 5JWPA 2KA3A 1LODA 3LPGA 3WHUA 2A6ZA 3MIEA 2E9QA 4Q8LA 3ZYIB 3V0BB 5CB7A 4IDZA 1OXCA 4W6YA 4NMIA 3VDAA 3WSOA 1ODMA 1Q5OA 1LHUA 2GMEA 3NVCA 3BGAA 4QX2A 4XIOA 2WFF3 4IEQA 5AVAA 3UGFA 5LY2A 5DUWA 3VBOC 3JXSA 3MDPA 5FDBA 2Q1ZB 1GSLA 1AR71 3OB8A 4E9KA 3O14A 4JHTA 2EALA 1DBNA 3AYDA 3UNPA 2OPWA 1UWWA 4AFBA 1DHKB 3ETQA 4ZS2A 4E8CA 2DU0A 3DGTA 5A32A 5LA1A 3RI9A 3UT0A 1PIV2 2RMU1 5L7OA 1KEXA 2K2SA 4P5HA 1QQP1 4I01A 5FY5A 5IVYA 4OHXA 3LQCA 3IIAA 3LCPA 4W65A 2FDKA 5EFUA 1ASJ2 1IKQA 1N3OA 5CFDC 1S55A 5FUPA 1GMMA 2W5FA 1HQNA 2ETEA 4EWDA 3GF6A 3WF1A 4Q4W3 4CCMA 3H8XA 2R1DA 5LA0A 5FP9A 2CY6A 1RUF1 3MV01 3MIGA 4S2HA 2ZGOA 2ZX0A 3MBWA 1LOFC 5K0UA 4QM8A 2W39A 5A3UA 1SDDB 1GR3A 2GMMA 1WMEA 4BQYA 3VL9A 4A44A 1F5JA 4EWAA 4ZY9A 4KNCA 5ACA1 1HN1A 2E6VA 1CX1A 3RSJA 1ZBA2 3AYEA 3GZTB 3LA3A 1HQWA 4QB1A 1ND3C 5FMBA 2BDRA 1Z0HA 4QB6A 1O5LA 1QJFA 1QY4A 4HL0A 4MHRA 4RHV3 4NOTA 1U5XA 3AXEA 3RRDA 3UKVA 1VAMA 4BQ5A 1GP6A 1HXS1 3I54A 4CUCA 3OGGA 4MGYE 1WLCA 2P1BA 3VHPA 1GFF2 3LSDA 1BEV3 1X8EA 4DXSA 1YUDA 1COV2 4W6WA 4YW5A 3G6JB 3ZFEA 3CDZB 1SLCA 3VBFC 5A6QA 5FPBA 2CWMA 2QZ2A 3FUOA 5IVJA 2JDYA 4LEJA 5FYSA 1XPWA 2ZX4A 4R4ZA 3V65A 3LWCA 2KR2A 4KWLA 4AL9A 3HPNA 4XJWA 1L7RA 1XSRA 5GLZA 2VW0A 2JB4A 5T52A 5HCBA 5KC6A 3BPZA 2D5HA 3PDQA 1W6PB 1Q43A 4LPLA 2OS2A 2CTVA 5H9SA 4NHMA 3DYOA 1Y9GA 3WP6A 3NSTA 2BEOA 4GIQA 2HEWF 4QPWA 4UFJA 5JVVA 5EYYA 2ZZJA 5G04L 1UF2C 1EY2A 1XSQA 2WWSA 2PTMA 4CCJA 1OOPA 5IW0A 4XMIA 5LBCA 1O6UA 4RS5A 1QMJA 3I3DA 4QPIB 5T5OA 3IDCB 4FXKB 1U5YA 1N47A 1AR93 3ACIA 2R0FA 3WG3A 2XQXA 1AJOA 4FPFA 3RGBA 4XBNA 2BNMA 5BNPB 1DQ2A 1ODNA 3MI8A 1AJKA 1AHSA 4XMAA 2HWC3 4H2AA 4TZDA 3MF9A 4Q4W1 1AR83 3GZEA 3HJRA 2J1UA 3JBG2 1OUXA 2HWD2 3RDIA 1O8SA 1UD1A 4CEYB 3I4IA 1O3QA 2QDRA 1AYM2 2ARCA 1F4AA 1QKQA 5GLUA 1H1IA 1NXMA 3FLRA 1YXWA 2RDRA 4MYEA 3M70A 1ASJ3 2AGSA 1BK0A 5A7SA 3ZR5A 2FCVA 4XQWA 2AUYA 4V2WA 4C0BA 1GZ9A 4NO4A 2EIBA 4RHV1 4A3ZA 1ULEA 1CAVA 3DKWA 1YI7A 1URXA 1C5HA 1UZZA 2IZWA 2XLFA 3DV8A 1I3HA 3DYMA 3GDBA 3M2MA 3PJYA 2OX0A 5FZOA 3ZDSA 1BEV1 4COZA 3ZKYA 3U4SA 1JU4A 1HV1A 3NRUA 3K77A 2B46X 2ORZA 1W8OA 4AQ6A 4OUEA 2Q8OA 1JYIA 4A7KA 2DVAA 3S30A 2A7AA 2ZACA 1GOGA 1UOBA 1FPN2 3B93A 3M3EA 5IAVA 2B39A 1GLHA 1W6QA 2O14A 1WLWA 2EAAA 3ACLA 1V0AA 3DXTA 4A6OA 3MFAA 4UXAA 1V6JA 4QHOA 5FZ6A 1B09A 5FZBA 5FK7A 1F31A 3M3IA 2KD7A 4JGZA 4QU2A 3KCXA 4COYA 3KHCA 2GH8A 2YHJA 5KBFA 2YFUA 5CZKA 3RMXA 1FT9A 1LOEA 2PHTA 2UY8A 3KB5A 4O9EA 1DF0A 4N43A 1XE7A 2E51A 4XURA 1SZBA 1UY3A 2ZMKA 2IXLA 2UWBA 4R9CA 4IEZA 2VL4A 3LFMA 5JMCA 5FUNA 3TNQA 5C8CB 3OYWB 2E32A 3GBWA 1W39A 2X53S 4ARXA 3VZJA 2JJ6A 4KG0A 1AR91 4M0NA 1RHI2 4IEXA 5FPLA 1J84A 3ACFA 2EICA 4FQ4A 4I30A 1VBB3 3ZVXA 1LHVA 3H8RA 2HYXA 3NV3A 2HWC1 2BYVE 1E5IA 4AG4A 1G9CA 1D4M2 1VP6A 2NQYA 5FLIA 3MIBA 1UPIA 3I7DA 5I91A 2H0BA 2D93A 1YJLA 1TME3 1NQJA 3IWZA 4J6GA 3UV9A 1Q8OA 1JZ8A 1LU1A 3FJSA 1GQHA 4QDSA 2W68A 5KHIA 1REFA 1ULFA 2UY9A 4HSJA 3KZ4C 1QJY2 1ULCA 2FQPA 2DBNA 3KCYA 2V5YA 4XFCA 4XE9A 4PQQA 3IT8A 4AI9A 3PVNA 4CUBA 1RYYA 1VBD2 3GYDA 4AWDA 1OSGA 1DLLA 3AVRA 4YGDA 1S0EA 5FYZA 2YBPA 1HRV2 3RG0A 1LESA 3AC0A 1LNSA 4MOAA 1XNAA 4BM8A 4D6QA 2ZX2A 4LBJA 4AEDC 2Y6HA 5A70A 2QZ3A 1POV3 2X09A 3ILFA 4HPKB 2GNDA 3AL6A 5DZEA 2A75A 2P2KA 4ZU5A 4QKBA 2RVAA 2QDNA 1YQ5A 4HANA 3ZYRA 4AE2A 4OFGA 4WVVA 3ZYFA 3O1UA 1LOCA 1MS5A 2Q8CA 1QJU2 5JR7B 5A6ZA 1TE1B 1Z7S3 1RUE3 2P3IA 1KITA 5CA6A 4ZPIA 3W58A 2VULA 3WP5A 2BBAA 4FPLA 4E4HA 3K48A 2WZEA 4PJYA 1J58A 2K46A 5DAWA 4NWVA 4RQPB 4CYDA 1VR3A 4IETA 4PF1A 3HQUA 4CCEA 5BY5A 4G4FA 5FXVA 1WMXA 3KQ4B 4LKSA 3WW1A 3SCHA 5IK5A 4CCLA 3A21A 1FMD2 3I3BA 2VR4A 3VZKA 3ZKUA 3ZYPA 4K8RB 3E5XA 2L9LA 1GNYA 1WKYA 2R042 1KFXL 4RGKA 2YC2A 5FZ3A 5F37A 4KU8A 4XFGA 1N1TA 1W6PA 5FY7A 5JPMB 1KRIA 2PHXA 1ULPA 2JWPA 4IV3C 4YVWB 3W5MA 4O7XA 1BMV2 2VO5A 1SFPA 3CHXA 4XDPA 5C5TA 1RUC2 4GJYA 2O0OA 4KL1A 4ZXKA 1HJFA 3HEIA 4FOWA 1WCQA 2LTNA 2GU9A 4ZU4A 1AXYA 1LHNA 1XNDA 2D98A 1MEC3 2C4XA 1TME1 4GB32 4WV8A 2XKPA 5DZGA 5KXBA 3QLQA 1T2XA 3VN4A 4FT8A 1XOYA 4QPIA 2HWF3 4XAEA 2VZRA 2R061 2JG9B 2XHNA 4XFIA 1YO8A 2R7EB 2ZKLA 4LIVA 2QQPA 3BIEA 4IE7A 4UFMA 5LK5A 4Y4YA 3VDCA 4LT5A 4AVSA 1R083 4K6BA 5FP7A 3NV4A 4Z07A 4LR4A 5BNPA 2RS31 2Z2SB 3H9AA 3HNBM 3T0BA 1MPXA 4P9WA 1UQXA 4YVWC 1RUG2 1NCRB 1WLDA 4K9SA 1QOOA 3KM5A 2Q30A 3WG1A 2XQRA 5JXJA 2VTXA 2JD4A 1QU0A 4CEYA 5F5IA 2WNVC 3WDWA 4A6SA 1ULOA 2XXZA 5K4LA 2HWB3 3CJIC 2GDFA 4BIOA 2MEV3 2YROA 3M8LA 4GH4B 1E5RA 1CJDA 3K46A 1UX7A 1C5IA 2DUQA 2OW4A 3PHMA 3TOJA 4DQAA 1RUE1 2QQIA 4F8AA 5A6XA 3ES1A 3ITQA 4QQ2A 4CXYA 5T3NA 5DUXA 3S6PA 1CWPA 1VBC1 2PHDA 4Q0PA 4IGOA 3T2TA 3N7LA 3QOPA 1UMZA 4FPEA 3T0AA 5F7UA 5KXEA 1LCLA 1KS5A 5H9QA 2ZGTA 1PVC2 1RUJ2 5EP9A 3B00A 4CDUA 4OUMA 3LSEA 5FMOL 3HBKA 1FNYA 2Z5WA 4BQXA 2P4EA 4RGGA 4AFAA 2DYCA 2XLGA 2D6OX 2MHFA 4QPGB 4N9IA 3TNPB 3ZOIA 4Q4Y2 2K0GA 3WT3A 4GQ7A 2MNGA 2FDIA 1KDMA 4UBHA 2LM3A 2EVXA 3BOWA 4GA9A 4AI0A 2JG8B 1ZRDA 1HN0A 4H7LA 1V6MA 2Y64A 4Z82A 4FPGA 3RS6A 4HZFA 1VB2A 3OBTA 5FZEA 5I8SA 2BQPA 2VCMA 1R1A3 5FYBA 3RYKA 2CYFA 5FPZA 5IFTA 1W8ZA 1ZBE1 2NPIA 3GM8A 3P6BA 1EV12 3K51A 4JTOA 1UIKA 4N7IA 1JZ5A 4MUVA 4UFIA 1SDWA 1MEC1 2VQUA 4DEQA 2VC9A 1NCQB 2B5HA 3ACHA 2O8QA 1VBE3 1UX6A 1OFSA 4UAPA 2HWF1 4QPGC 3ZFFA 5C8CA 1U5IA 3MHZA 3OYWA 5K7PA 4QQOA 5DPNA 1BVVA 1Q8SA 4OI0A 4IXLA 2BU9A 1DIWA 2QQKA 1R081 1PMJX 2DVFA 2PMWB 2FCTA 2VUJA 4YG3A 3U07A 1ULGA 5BYNA 1JZ4A 3P5BA 3TYJA 4QT6A 1HB1A 3K3NA 2PLV3 5FZ9A 2WZ8A 2XVLA 4RA0A 1GWMA 2B4KA 4FFFA 3HQRA 3HNMA 4LK7A 1GICA 3QBQA 2XJQA 3GALA 1V9U2 2F17A 2DDUA 3I2GA 3OGRA 2DCJA 1CONA 3FHIB 4XBQA 1O4TA 4FP2A 3DKQA 5JLVA 4URAA 1KGYA 1W06A 5CFCB 3AMMA 3NNMA 2HWB1 1PGW2 2A73B 2MEV1 2ZCWA 4Y5TA 5FY1A 2E26A 4CDXA 1G9BA 1F2NA 4BH9A 5D2AA 2VZ1A 2XJPA 1UIJA 3NAPB 4XJ8A 4YRDA 1DQ0A 2W47A 5B2GB 4Y26A 2RG4A 4WZCA 2O1QA 4BISA 3CF6E 3DN7A 5I93A 3KV4A 4JGYB 4A3XA 5A1FA 4Z92B 3LE0A 4KI5M 2HYKA 3ZSKA 4FOQA 5KC5A 1R092 3AXDA 4HPKA 1OMIA 1XJAA 3FLTA 2YMZA 4JC1A 4NE9A 4YW6A 3WDTA 1K5MA 1NY71 3WX5A 4XILA 3WW3A 1GZTA 5FYTA 4DFSA 2MPFA 1RVF1 1SFYA 3CMGA 3VBSA 5LCWL 1RITA 4EV0A 4FOYA 3OBRA 1TNFA 2LS6A 4FPJA 1YI9A 2XGXA 4L97A 5DAPA 5FKCA 4EROA 3J9SA 2BGOA 1UYXA 2OQ6A 3HQXA 3T3YA 4L11A 1W9TA 3DYPA 4PDWC 4XUQA 1AZDA 1R1A1 4IV1A 4RQPA 4QAWA 5FZCA 4AQSA 1I1EA 1XNCA 1J83A 3MO4A 5K9YA 1C4RA 4P9JA 3W5NA 4JDMA 4JRLA 2VH9A 3H3LA 1ZZ9A 1ZVFA 2VNRA 5FXZA 2IVJA 3IBMA 4UW5A 1A78A 1VBE1 1AR63 4XOGA 4A7YA 1LOGA 2VGDA 2ZMLA 3AMPA 4HFSA 5LB6A 3U78A 5FJKA 1OT5A 4ONUA 3LPFA 5G05L 5E8AA 1CIWA 1F15A 1AR72 4FTSA 5F6KA 5A3NA 4CU9A 3FX3A 4WVMB 4TYSA 5FZ7A 2ZHMA 4OI4A 1POQA 4ET7A 3SKVA 4LE3A 1AX2A 1NXD1 1NLRA 5GM0A 3VD9A 2GH2A 3ALQA 4XCAA 2N7GA 3PURA 3ZFGB 4E2QA 1D4VB 1QQP2 2RDQA 5E6HA 1L3JA 2JG9A 2B45X 3A23A 4TWTA 1H6XA 3KT4A 2FHRA 1MQTB 1GANA 5BUVA 4GMP3 3PU3A 5FZHA 2P5BA 3H50A 5EJ1B 2XH6A 1RUF2 4FAHA 5DAVA 1GOHA 5FYMA 5JDBA 4AXOA 5LZ6A 2QKDA 1DLCA 1G9FA 1NCRA 3RZLA 1JW6A 3B9IA 3BOPA 4A42A 1HLCA 1OBNA 4OZOA 2RDSA 2A71A 3C7EA 2RS53 5FZ0A 3AK0A 4Q0SA 4YPJA 5ACA2 4OI2A 1CESA 1LGNA 3FE5A 1JBCA 3E6DA 1XYNA 3MLLA 2VOTA 3VZMA 3MIDA 3M3CA 1YCIA 3VDDC 5IVEA 2A1XA 5DXDA 3IM0A 1RUI3 2R0HA 1NYWA 4GH4A 4GZ9A 4XFFA 3WQ0A 5C4WC 2J1AA 1UZ0A 3N7KA 4K1YA 1JHNA 1PO13 2IXHA 2OUHA 3R05A 1JU3A 1SEFA 1XBFA 1XRUA 2PAMA 3MLKA 3VBHC 1NLSA 4RFT0 2OYZA 3S7EA 1RMU3 1SMVA 2A70A 5A80A 1ND2B 4QXCA 3IPVA 4QD2A 2GC2A 4H55A 4M3CF 4R4XA 2QBXA 2JECA 1QDCA 4J25A 1IPKA 4MX3A 3VD4A 2D3RA 5GZFA 1UMHA 3FL7A 3HN1A 1ZZ7A 2D6PA 1W9SA 2ZABA 3JB4C 3CBNA 1L7QA 3IAQA 4YVSB 2G1MA 1AR61 4MXWB 2XJSA 3TB0A 5FMOS 4YFWA 4YSFA 1Z78A 2WO2A 2D6NA 1RUH3 2RV9A 1YQ6A 2JG8A 2BOIA 1MVEA 3L2YA 2WFF2 2QCSB 2X5IB 2IXKA 3VBRB 5JZGC 2JICA 4DO0A 3ILRA 1JH5A 2Y34A 3IN9A 4RSUA 4BB3A 2JKXA 4UW3A 1JZ7A 1DU3D 4RR3C 4E8DA 1P8JA 2WDBA 4MG2A 2G9FA 2JX9A 1CGPA 2WS91 4Y22B 5FP8A 3WDXA 4X8NA 1UYPA 4Z1VA 2WQ8A 3RYPA 4QKNA 1NCQA 3SLIA 1S0GA 3JD73 3K4ZA 3PUHA 3EB7A 2BWCA 1J3PA 2ZGQA 2A6XA 4URTA 2QVSB 4LO5B 1M06G 3TRSB 4D69A 3POGA 1UU4A 4UFHA 3ILNA 2AACA 1YFUA 1IPJA 2Y0IA 4KQ7A 4R8HA 1G8WA 4Q4W2 4CXXA 1VAVA 1V6IA 5J7MA 4FTEA 2HH9A 2H6BA 2JDUA 3N9QA 4M00A 2AREA 3PNAA 2E7TA 4LBNA 5APAA 4XETA 4YM0A 1LU2A 5JXIA 4DINB 1W9YA 3ZXKA 2RMU3 2V4VA 1DYKA 1UO9A 3J26N 5HXVA 3WHTA 2OUJA 2RS51 2WT0A 1CX4A 3ROUA 1Q8PA 2VM9A 5FLJA 3WUDA 3KCCA 3MF6A 5CFCA 5F3GA 2I2SA 5J48A 1C57A 3JZVA 1RUI1 2WLPA 4RHV2 4IEWA 3JU9A 5AC93 5FPUA 1VMJA 3EBRA 3ZO0B 1PO11 3SEPA 4NIGA 5BNNC 1BEV2 3NAPA 3A22A 1KJRA 4P00B 2WT1A 2EXIA 4QKFA 5CNAA 1ONAA 2R6QA 2OKXA 1OA2A 4JGYA 1RMU1 4EWEA 1HW5A 2VCBA 3ZYBA 2NYYA 1FV2A 1H4HA 5IUQA 1LHOA 3D5OA 3I3QA 3IDAA 3T2OA 4AZZA 5SV8A 2B9UA 3VBOB 1PZ8A 1HXS3 2W2IA 3AZWA 5H9PA 1RXFA 1W2NA 5JOYA 3PMSA 4B4QA 3BTXA 1HV0A 4B7KA 2WO3A 3A7QA 4JDOA 3ZIWA 4XF3A 4XUNA 3D3AA 1RUH1 2WO7A 3PTRB 2W92A 2EXJA 2A3WA 1YC61 2Y8KA 4M3CB 4DRVA 3SC7X 3ZMNA 3FFZA 3WCSA 2WQZC 4BXSV 4IEUA 3LA2A 5CKQA 3WF0A 4EE2A 4H3WA 4LO4B 3ZM8A 1UU6A 1VLNA 1FXZA 5CFDB 5JI7A 4ZS3A 4H14A 2CAVA 1PGL1 2PQQA 3LEKA 1WWYA 3JD71 5HV0A 1LHWA 4AVCA 2WUHA 3AFKA 1UMIA 1AR92 3R4SA 2QQWA 3M1HA 2GNMA 3HNYM 2PXJA 3ETPA 4Y1ZA 1DZRA 2DU1A 2HWC2 2K9ZA 4Q0VA 5JIAA 2WNUA 5JXHA 1AR82 2E7QA 2WFPA 4P9XA 2P6CA 1ND3B 1QXJA 4W4ZA 1VAKA 2WKKA 5GLWA 3VBUB 3W20A 3H3ZA 1AF9A 2J1RA 2O8OA 3I97A 3WEZA 1OLQA 3ZFGA 1XU1A 3ZXGA 2RDNA 4CP1A 4Y20A 5FRAA 2F6BA 1I6XA 2DFBA 3OF1A 4NWWA 4EZ4A 4FVVA 1BCXA 2ZS6B 4XXAA 4Q5OA 5AC91 3VBFB 2EIDA 4CU7A 3OPZA 1MQTA 4MGKE 3H0OA 4LMFA 5IVCA 5E1RA 5HV4A 4OHZA 4FFHA 4LUKA 1C8NA 1AX1A 1WBLA 3UK9A 4Y3OA 4UYBA 4CEWB 1DGWX 2CNAA 4N9HA 4XJAA 2R30A 2ZGMA 3N9LA 1DP0A 4U36A 2C5DA 4TSVA 4XIKA 2BJSA 4LHKA 4BIFA 1OLMA 3J7NA 1CVNA 3KMHA 4FPCA 4GKYA 5E16A 3ZXEA 4AVBA 4QX7A 1W04A 5F6LB 1DDLA 4YFZA 4N7UA 4AEJA 4Z2AA 3INAA 3PL0A 1G86A 1YFYA 1TG7A 1H9PA 2VOKA 2WBKA 3ZYHA 5KXCA 1PMIA 1Q3EA 2HKXA 3LAGA 3MW2A 1ND2A 4WM7C 3WF4A 4BK4A 5FY9A 1Q8VA 4QPYA 1WCUA 1O3TA 4QU1A 4CEWC 4HLTA 4AFCA 5A7OA 3B02A 3AM2A 3C7HA 3HIFA 4WM8B 4YVSA 4MXWA 1UAIA 2QQNA 4W6XA 2W9XA 4Y1XA 1W9FA 3B5LB 4DXTA 3GZUC 4QGNA 2ZGUA 3BODA 1HB3A 2RM23 5CKNA 2EA7A 2X5IA 3WDYA 3VBRA 1VBB2 2CV6A 2XL9A 1BK1A 3RNSA 3WG2A 3FN9A 4GWNA 2GN3A 2Y6LA 2ZEZA 2D43A 1SG3A 3PUSA 2HJIA 3MZHA 1TME2 4M0HA 2G9ZA 3IAPA 3WR0A 4YZ5A 5LBEA 4YGEA 2IXIA 4DNYA 4FO9A 1ZA4A 4XF4A 2J1VA 2V4AA 2PN5A 5FJHA 5C5UA 1APNA 4K7JA 1RC6A 4KWKA 4IEYA 3V56A 5KHKA 3CEWA 3HR9A 4MO3M 4WM8C 4CUGA 3BVCA 2HWE3 1PNGA 2J7MA 1S4CA 2C24A 2GAUA 3HOBA 5KR7A 2ARAA 1RJ8A 3LDRA 4BDVB 5CG8A 1ZREA 2ZX1A 5A6YA 4ES9A 5ANQA 4DUXA 5E89A 1W2TA 1H2MA 1KJLA 4A2UA 1B35C 1H2KA 5FV3A 3H1WA 2VUAA 4ZONA 4B1LA 1H8TC 3KF3A 1SQ4A 2ES3A 4IEPA 4CDQC 3RZJA 1AYN3 2PAEA 3B3QE 1PM4A 1GZCA 2VUDA 3MV11 1NA1C 1EP0A 2BZDA 1ZRRA 2WZR3 1G9AA 1Z7S2 1VIWB 1RUE2 5FP3A 3BB6A 4L0PA 4XF1A 4AFMA 3UKNA 1IG0A 4W50A 4BMBA 1VMHA 1UY0A 3KV9A 4JRAA 3RVHA 4L8QA 4ITCA 4HVQA 1LTEA 3AKSA 3CO2A 3O1PA 2ZEWA 1JUIA 4MZUA 4CUAA 3M7AA 4ORFA 1JS9A 2C9KA 4P14A 5CBLA 4NPLA 2VMGA 3RYRA 1CAUA 5JCTA 5BNOC 3J8F3 1W9WA 2I74A 2X8KA 2W87A 3VBOA 2ZA9A 5A7PA 3ZN4A 5J09A 4PIYA 4UWDA 3CKHA 2Y0OA 3T4VA 3GGLA 5FPVA 2D97A 3ME2A 2PYTA 1TMF3 2YPDA 1FX5A 2RM21 4WVZA 4BK5A 4CDWB 3NJVA 4Q2FA 4M3CA 5JOZA 2VCCA 3FC0A 3THDA 3LGRA 4K8FA 1YQ8A 3OEBA 1ZBE2 1WW6A 1HQLA 2VJXA 5KHJA 2D6LX 3T2PA 1REDA 5LBFA 1JYXA 5CISA 1MEC2 1W28A 2YGLA 3V0BA 4CU6A 2BGCA 3KGLA 5CFDA 3WUCA 3L9JT 2HWF2 3O12A 3GHMA 4G9SB 5FY8A 3U14A 1QJX3 1UN1A 4BHPA 1UZYA 1LOBA 1GYKA 1OA4A 1LJ7A 5FFOC 3V64A 1R082 5FXXA 4NHLA 3WNMA 4AEDB 1D0GA 2D6MA 2JE7A 4EN0A 1LOFA 4ES8A 5LRSA 2HWE1 2CAUA 4HN1A 1DYOA 4GALA 1Y3TA 4CDUC 1YNAA 2R071 2V09A 2Q8DA 3WNXA 4CDWC 4Q0UA 2CU5A 1SLBA 5C3SA 1ND3A 4AEKA 1WLTA 1WD3A 1ST8A 2R063 3VBUA 3CJXA 4MH0E 2E31A 5IATA 2V5DA 4LE4A 2HWB2 3D0JA 1AYN1 3AP5A 2RS33 3UGHA 5JMOA 2MEV2 1QXRA 1XYPA 1GQGA 2D7FA 2YZ4A 4LBQB 3AP6A 1X7NA 4LLFA 4YLZA 1VB4A 5ERLA 1IS6A 2WZR1 4NHXA 1W0PA 1NZCA 2WJSA 4XBLA 1JMUB 4FFIA 4KU7A 1DCSA 4LBQD 3VBFA 3ZIXA 2DCTA 4XDOA 5GZGA 5I0UA 3NQHA 1O5UA 2WRAA 2D40A 4P9LA 2CGNA 2IXJA 5D8AB 1YYNA 5D1IA 3OBAA 1JOJA 1F5FA 2C6SA 2ZHKA 3ZLIA 5IVBA 1O4YA 3H1MA 4META 2E33A 3ACGA 2VE1A 5C71A 3VGIA 3IMNA 2Y6FA 1NY72 4IV3B 1YLLA 3J8F1 4KGGA 3NNJA 4XJ9A 1W6NB 5C7GA 5AFEA 2G4IA 3ZSMA 5I0TA 1VBC3 4RL7A 2EAKA 2W08A 1OLME 4K40A 4C1XA 1TMF1 3UESA 1CPNA 1NX9A 4LKFA 4XABA 2VZVA 3EXUA 3ZSLA 1R1A2 5A3MA 4RGAA 4Q1PA 3TEXA 4WVWA 3WP4A 1LENA 3D82A 5D8AC 5H9RA 2BP6A 4QWNA 4HKLA 1A8DA 3NW4A 3A0NA 4UT5A 4XTPA 3BU7A 3C2UA 1VMFA 5IK8A 1Y9QA 2NN8A 1VBE2 1KDKA 4HVRA 5LASA 4YYOA 3RJ2X 3TN93 2EF6A 2ZHLA 4YW1A 4DS0A 1Y7BA 1QJX1 2BRTA 2XBO3 3H42B 3WQBA 2ZAHA 4AVAA 2UWCA 4ZKTB 2JDKA 4Q26A 1ZBE3 3POWA 4XF9A 1XXNA 5F2WA 1XQNA 2WNVB 4GWJA 2PLV2 4Y1VA 3BCWA 2ZEYA 2ZJCA 1W8HA 4CPBD 3K75B 4KG8A 3VHOA 3ZYJB 2HEYF 3CJIB 2XG3A 1W8UA 1JOBA 5FBJA 5IHRA 1S0IA 3SNMA 1QIQA 3AKRA 1ZZBA 4WBBA 3O1OA 3AX4A 2EXHA 3D6EA 4MSVA 2RS13 1D2QA 1Y4WA 1DQ4A 2ZPXA 2AYHA 4ARYA 3POSA 4GXLA 3VD3A 1VRH3 1C1FA 5F3IA 1TVGA 3I3EA 3DPRB 4LBKA 4Q8KA 1F8VA 1GV9A 3C7GA 3WOGA 3UYJA 1V6NA 2GP5A 3SH5A 3MPBA 2D3PA 4O61A 3ZR6A 2VOXA 2HLEA 4Y4RA 2YC0A 2YUEA 4D6SA 3M3QA 1XNTA 2AEYA 4BYYA 4LKEA 2OXBA 2XVKA 3GBFA 1SACA 4HVOA 3VZLA 4IESA 2RE9A 3JQXA 5BPXA 2BNNA 1AL23 2WAAA 2Q4SA 3MYXA 5DDJ3 1QXPA 1RUD3 5GALA 1V6OA 4ZZ8A 4JTNA 4MGZE 2WN2A 4XJUA 3CZJA 1SLAA 1JHJA 2NZ9A 1MS3A 4IE5A 1VBA3 1OKOA 4BQ3A 5CADA 2VMEA 1OPOA 3D0SA 3MW4A 1UXZA 4L92A 3DPRC 5DUVA 1W3XA 3LIHA 3KLSA 5J1XA 5FWEA 1T6BX 4COUA 1RB8G 4OYUA 1RVF3 1UZWA 3H3UA 2PHUA 4Y5Z0 1NE6A 2ILMA 1XE8A 3NNLA 5C9AC 3WNOA 1AR62 4Q4X3 5DZFA 4ATFA 3LEGA 3AP9A 3N9MA 4YM3A 3TN91 4BLJA 2DTYA 4A45A 2XBO1 4PHZA 5EJ3A 1JN2P 3T09A 3MFCA 1PM7A 1POV0 1KS4A 2NMNA 2WC2A 2XDVA 3O0VA 1XNKA 4SLIA 3NKGA 3V0AB 3VB9A 1US3A 4Y1YA 3VZOA 1LAJA 3K4AA 3GXUA 2ERFA 4M3CE 1AL0G 5JXGA 1PK6B 1FATA 1W3VA 3THTA 4IW3A 2SLIA 4YNIA 1C1LA 4I0WB 1H30A 4NAMA 5C3QA 3UJQA 1OURA 3NMBA 3BTZA 2RS11 4CCCA 1IOAA 1LOAA 5LRRA 3VD5A 2QQLA 1C3HA 3D8CA 1LECA 3ORJA 1QHDA 2VCAA 4GWMA 4OZXA 4UF0B 5FREA 1W6OB 4AEDA 1VRH1 5FZLA 1CR7A 4B8EA 2WNOA 4RN5A 5L73A 1RL3A 3I2KA 3USUB 4JKKA 5JIUA 3X29B 4YG0A 5ABJB 4HG6B 5FO8B 1ACCA 1LEMA 2TBVA 4QQLA 1SPPB 2DUPA 2E53A 4YW4A 1IHMA 2OT7A 1H2LA 2W1SA 2C9AA 2X10A 3H7YA 1RHI1 4BE3A 1K42A 2HBUA 2RS52 3POYA 4MV2A 1PK6C 1SBDA 4IE0A 1YFWA 5HBAA 4PDWB 4XTMA 1G9DA 4KWJA 1GBGA 1RUI2 4LBQA 3EHKA 1AL21 2WR9A 5I8YA 1IQAA 3OY8B 4QDRA 5DDJ1 3NV1A 5A7WB 1PO12 1RUD1 3WF3A 3Q8BA 4EJRA 4AI3A 2LW8A 1ZA7A 1R64A 4CP0A 2P3JA 2DV9A 4D7SA 4D0QA 4IUGA 4XQDA 3U11A 3FHAA 1YHFA 5GZCA 1VBA1 1EAH3 3SXWA 3LB9A 1RMU2 5DAXA 5FZ1A 4LHSA 1LKNA 3AZYA 2FMDA 3LZZA 4PI2A 5EYXA 5ABJC 2TEPA 1YWKA 3WF2A 4GJZA 1BBT3 1JI6A 1DG6A 4RD7A 3S7IA 1EPZA 3I2FA 4XVHA 4LO6B 4HETA 4IV3A 3ZN6B 4CCNA 1OQDA 4FP3A 3POEA 1W6NA 4Q4X1 1W6MB 1WA6X 1WCKA 4NHYA 2NMOA 3AL5A 5FLHA 1RUH2 5T5LA 3OEAA 4V1PA 3DEMA 3SCGA 4EZHA 1JZ3A 2WIIB 3POIA 2ADEA 1ZX5A 2EXKA 2FMYA 5DABA 1S2BA 1YIPA 2YXSA 3CZUA 4V2VA 3SEEA 3TBDA 4E27A 3B01A 4KGQA 3AKQA 4OLLA 1AVBA 1LRHA 5FZDA 4CA9A 3GHNA 3OCPA 3O1MA 3MW3A 5LY1A 1PGL2 3RQ0A 1E5HA 4X8PA 4OVEA 2XJUA 3JD72 3EQEA 4BOWA 1X33A 4G3YC 3VD7A 5C3RA 2FD8A 5L9RA 3U37A 3PUQA 4YVWA 2G9GA 3OUHA 1UYZA 5CG9A 5CIRA 4MGTA 2VXRA 2VBDA 3AP7A 2OIIA 3H8UA 2TUNA 4CPBA 1OD5A 2BW8A 1FMD1 1HRI3 4N53C 2WS93 4XPVA 2WNVA 1YIFA 1CAXB 4XW3A 3R4UA 2D44A 1WBFA 4FI9A 5AFBA 3H8OA 3CJIA 1I5PA 3ECQA 3VDDB 4YZ1A 5LEJA 3JCIA 1BQPA 2RMU2 4QGLA 5IWFA 5C4WB 2VBPA 3CQOA 2Q8EA 2ET1A 5C33A 5A7QA 3VBHB 1W0OA 4B1MA 4LORA 1W0NA 1I9RA 2ZOEB 1QF3A 3R4DB 4XFHA 4DY5A 1MVQA 4AI1A 5AC92 4P5YA 3JB8A 4GB31 1ZZ6A 1MS0A 2CDPA 5FZAA 4M01A 1H6YA 4LA3A 4TLGA 4FPKA 1EAH1 4CTEA 5T5JA 5FZ8A 2CGPA 2C1FA 4YGCA 3FMGA 4I2OA 2VMDA 3Q8CA 2J1TA 2RHPA 4Y24A 1OPMA 4I09A 3O5SA 1BBT1 4S2GA 2B8MA 2BFUL 5JZGB 2FZ2A 2P3KA 1HKDA 1HXS2 3AKPA 1C8M3 4QHZA 1NZIA 4OHWA 4RR3B 5KWRA 5L19A 3RMYA 3MUY1 4BA6A 1YQ2A 5K0UB 5KHGA 2VBBA 3CIHA 2SBAA 4PT6A 4A41A 5A3TA 5FWJA 5A3LA 2R1BA 3H1YA 2VZUA 3AZXA 4AW7A 2ID4A 5E88A 4Q4V3 1EUUA 2XOMA 4CU8A 4XF0A 5L7OC 5JI9A 4QPGA 3OTFA 3OGSA 1W8TA 2W91A 3OPTA 1XB9A 4GAZA 4QX5A 3C7OA 3FUQA 3R0RA 2VMFA 2GNTA 3KGZA 3ZX7A 4MHUA 5LK7B 1U12A 4M4RA 1PVC1 2WZPP 3NKTA 2DVGA 2WSUA 3KVBA 3RI8A 1WMDA 4DZGA 3KT1A 2JENA 3MEPA 5K0UC 1UOGA 3VKFC 3V0AA 1V6LA 2PELA 1HRI1 5L36A 4ASKA 3QCWA 3BYWA 3TEYA 4LITA 3UJOA 1XNBA 1O91A 1V00A 2VECA 3P3NA 4DY3A 5ISLA 5F2SA 3FZ3A 4CVUA 4AQTA 4HONA 3LF7A 1YQCA 4KH9A 3GJAA 5BNNB 4YZ3A 4P9GA 1X82A 2WINB 1DQ1A 3RPQA 1W03A 1FV3A 2ZTNA 2OVUA 4Q29A 3OUJA 1NAEA 4UF0A 3WZ1A 3ZFEC 4FBFA 4LKDA 3E1F1 3ZYGA 3AKTA 3WNPA 3VDBA 4DUVA 5L9VA 3H7JA 2P34A 3ZXLA 3USUA 4AGRA 5FIXA 4XFAA 5DQ0A 3GCWA 2XVGA 4QX1A 4DB5A 3I49A 4HKOA 5FO7B 3VKMA 3VLBB 1SPPA 3N7MA 1JYCA 3P3PA 5JSRA 3MIHA 3LKJA 2XB6C 2XUEA 2VU9A 5FZGA 1YEWA 3Q8FA 4FPOB 5FYYA 1OH3A 4QXHA 1OC1A 3U10A 3LOIA 2CGOA 4AHYA 4AQ2A 4AVVA 1GNHA 4PDWA 1C8M1 4BQ2A 2C0ZA 1S0FA 2GMPA 5LEKA 1HB4A 3BUCA 3OY8A 4NPRA 3WW4A 2BBVA 1OA3A 3W9AA 4CCDA 1OOPC 3BI3A 2DFCA 1ENSA 1QH6A 4ISRA 4PF5A 3VKOA 5DN2A 1UKGA 2ZGKA 1W2UA 4RS5C 3GBGA 3B9CA 2GZWA 4Q4V1 3I3MA 3KVAA 1N1YA 1UPSA 5FYHA 3TAYA 1NOVA 1A3KA 3U75A 1UY4A 2ORXA 1N3PA 1UY1A 2RJKA 3TWIA 4GMP0 4JQTA 2ARBA 3LIGA 3ZN6A 1WGPA 3S57A 4Q1RA 3VHRA 4R9DA 3M4FA 5FPAA 4NN0A 2VUCA 5FKBA 5FZ4A 4SBVA 1W05A 3NV2A 4XAAA 1R091 2FCUA 3LA7A 2RM22 3EJKA 4W8JA 1OKQA 2BTVC 2KM2A 4Z8BA 2WYFA 4JAAA 3SH4A 5BNQA 4OQ9A 4IGPA 1GKBA 3E97A 4DUWA 2Y6KA 4HOOA 2P6HA 4JHZA 1UZVA 3CL1A 4AGGA 5JPNB 4EN8B 5FR3A 3OGJA 1WUVA 3IDEA 1MZFA 5IK7A 2ZKNA 4KWUA 1QWRA 2C26A 4UFLA 2V72A 3UETA 1RGSA 5GZEA 1ZRIA 2D6KA 1PHMA 2PHFA 3Q8AA 2YDEA 2Q0AA 2W1QA 4L9BA 4YW2A 4WVMA 1OH4A 1ZNPA 4XZPA 1IS3A 2B42B 2HWE2 4AGVA 2BVBA 4JCKA 5JOWA 3SH3A 5JUVA 1I5ZA 2YY1A 1U5ZA 3I8TA 3I2IA 1ENRA 1CAXA 2R072 4NAOA 3URFA 4AOCA 2A3YA 3S5QA 5IFPA 3VDDA 5DG2A 4EYUA 5C4WA 4MGIE 3NJXA 1UW8A 1JTZX 5B4XA 2FDGA 4AVTA 1YJKA 3LEMA 4JGZC 4DEVA 1OVPA 3S5AA 2CWSA 4LOTA 1AYN2 4WZFA 1S2KA 2PHRA 2PHLA 1PO23 3R6SA 3VBHA 3ZXJA 4CP9B 5IYYA 2GC1A 1Q56A 2OPKA 2VTXJ 2WZR2 4HT1T 5M0TA 2GSYA 4KBZA 4PLNA 4WM7B 3THCA 4XUOA 4EQVA 3OGVA 1HIXA 3ZXFA 2VPVA 1H0BA 3LD8A 4JVAA 4FTBA 3WDVA 3CLPA 1DQ6A 4N43C 3AMHA 1HJGA 1NE4A 4OHVA 2VQAA 4YZ2A 5F5CA 1LEDA 1QOTA 2H0VA 2UU8A 2PQSA 4FFGA 1A8MA 4E2SA 4QX8A 5EIYB 4CCOA 2VZSA 1F4HA 3WNLA 1F9KA 2PAKA 3J8F2 5JZGA 2ZMNA 1SFNA 2Z42A 1OVSA 4XC9A 1UOFA 3OD4A 2JD9A 5JSOA 2Q1FA 5IAXA 1RJ7A 4RR3A 2LALA 5FZKA 3WLUA 4LK6A 5A33B 3B7MA 5BXXA 1Y43B 2BFUS 1TMF2 4NVPA 5FZFA 1JZ2A 4PLMA 4E4SA 1FI2A 2WSVA 3LEIA 4LOSA 4DRRA 1IQDC 3TEZA 2WT2A 1S0BA 1XE0A 3RWKX 1SBFA 5GJ6A 3ATGA 4D6RA 4D7TA 1CJPA 2QUOA 1N3QA 2B7YA 1WW5A 2HEVF 5GKAC 4QDQA 2KXLA 1EPWA 4PCRA 3E6CC 3O1VA 1QJX2 2FDJA 2I45A 5GLTA 3KF5A 4NROA 4MGSA 4BLIA 3NJZA 2RR13 1B35B 3DECA 2OQ7A 3D4KA 1FOD3 1H8TB 1MR5A 4CDQB 4Y22A 1HX6A 3N9NA 2QQVA 3KT7A 2WAOA 1RTVA 3NO8A 1NA1B 2R062
chains in the Genus database with same CATH topology
5JAXA 4YW3A 2WFF1 2DCKA 1HDKA 4P9YA 4F3JA 1WMFA 2XWBB 4BQ1A 1QOSA 3WCRA 5BNNA 2RS32 2UYAA 1PO21 4I02A 2FBEA 3ENRA 4QQHA 4ISQA 2GC3A 1DGLA 3PVBB 4DXZA 2R073 4D7YA 2ZGNA 5FQ0B 1J59A 2WL1A 5BNOB 4E4DX 1V70A 3MPPG 5FAXA 3BIWE 4I3GA 5I0RA 1IGOA 3ASIA 3QH7A 2YV8A 3ZMOA 1CAWB 4A7ZA 1RIRA 3AZVA 4IEVA 4UW4A 1ENXA 1VBC2 1PIV3 1DQ5A 3E6BA 4ASLA 2DTWA 4ASMB 5F1RA 2WLQA 1IS4A 3APBA 1PNFA 1UU5A 3VZNA 1WCDJ 4B7EA 2ENRA 3E5UA 1CQ9A 4QPIC 4YGBA 1YFXA 2NM1A 4LLOA 3AYCA 2GC0A 2XPJA 3N4MA 2OZJA 1REEA 4B4PA 5BNPC 3VKNA 2AZ5A 1QNYA 2VNOA 4MVTA 4NR1A 4Q27A 4UW6A 5HCFA 2W52A 1TQ5A 4Z2WA 3TN92 4CDUB 1KD7A 2AR6A 1O4ZA 2XBO2 1ZBA3 3VL8A 2BUKA 2XL7A 3NL1A 2RR11 4CEYC 1BYHA 3FFQA 2R49A 1FOD1 1H2NA 5SV5A 3PVEA 3SISA 2ZGPA 1TEIA 1COV3 3ST7A 5IT6A 3BTAA 4OULA 1O7FA 2IXCA 2JEMA 4FPYA 2RS12 3HBZA 4K20A 5FOBB 3WVJA 1A6CA 3BALA 3KD4A 1S1AA 2DURA 2A5ZA 1VRH2 1D0HA 4QMAA 2BNOA 1AXKA 3J4UH 2VNGA 1FNZA 3THPA 3ZFFB 5F9TA 2Y38A 3USSA 2QNKA 2AH2A 1SLTA 4C1WA 5DUUA 3QH6A 4DMIA 4BZ4A 2JE9A 2E63A 2UWAA 4YZ4A 3SITA 1AR81 1FAYA 1N1SA 3SMHA 5BV6A 1AL22 3UL2A 5DDJ2 1RUD2 1MS4A 1PIV1 4F7ZA 4WM7A 4FQZA 2X29A 2A6VA 1LULA 4QM9A 4J1XA 1VBA2 5FO9B 4AHXA 4AEMA 5HI0A 2GALA 4CEWA 1ASJ1 1PZ7A 4HN0A 2FZ1A 4CDXB 1DZQA 3ZFFC 5C8CC 1RVF2 3JBG3 2HWD3 3WW2A 4DOUA 2JXAA 1ZRCA 2JKBA 1V6KA 3PLQA 2DWRA 1C28A 1OFNA 1AYM3 4Q4X2 2PFWA 3VUOA 2P17A 4Q0QA 2R16A 5A33A 1ZBA1 3DF0A 3WQ1A 2VW1A 1K5MB 1OQEA 3PJQA 2GNBA 3VBSB 1AUYA 4EN6B 3AMQA 1O3RA 1GZWB 2H6CA 2YGMA 5T50A 1DGRA 1QH7A 4CDXC 1COV1 1ZZCA 4WM8A 3GZAA 3FBMA 3HT2A 4XHXA 1N1VA 4MXVA 5FCCA 5J36A 4IV1B 4E4ZA 1AX0A 1FPN3 2AENA 2R32A 4PIZA 2WA3A 2ZBJA 2YYOA 4AHWA 4Y1UA 1B35A 2P37A 1H8TA 5J98B 1R1ZA 1K5MC 4CDQA 4INDA 1IKPA 2A6YA 2D5FA 3Q9OA 3VBSC 1G7YA 4ZU7A 1NA1A 4QGMA 2DCYA 5CU1A 1VBB1 1EYBA 4DPNA 3PTYA 1XU2A 1KFUL 2XLAA 1X50A 3HAGA 1SBEA 2BWAA 4R9BA 2VY0A 1S0JA 3A4UA 4F83A 1MS8A 3MGUA 4IV1C 4RQPC 3WG4A 1BVP1 5CVRA 3KSCA 4XXPA 4EN7B 5FQ0A 5C9AB 1RHI3 1EAH2 5BNOA 3OD0A 4X6RB 2UURA 1PVXA 1D4M3 4QQPA 1UKRA 5KXDA 2Q1MA 3JBG1 1BBT2 4L99A 1WA4A 2HWD1 4BPZA 3RWNA 2IFWA 3AFGA 2DVDA 2XUMA 1CAWA 1AYM1 2VOWA 2EIGA 4BCUA 2Z79A 2ZX3A 1PGSA 1POV1 1QJY3 4B3NA 2XWJB 3WXPA 4XQ4A 4QXKA 1VBD3 1H4GA 5EZWA 3N35A 2XJRA 2NLRA 1HRV3 4YARA 2JG9C 1MS9A 1IZ3A 1Z7S1 3C3VA 3FBYA 4GULA 2I07B 3OJBA 4PBPA 1SLLA 3VKLA 5C6CA 4JQRA 1ZRFA 3G7DA 4OUSA 1ALYA 2GN7A 4D3WA 3DUIA 3IPVB 1FPN1 1DFQA 4CDWA 4AF9A 3AB0A 1NCRC 2RJLA 5K8SA 5FBZA 1QJU3 2DVBA 1HRI2 3RJRA 2WS92 3AJZA 4XYXA 3KS7A 4CP2A 3EO6A 1S0DA 5EV7A 4GH4C 5T54A 4B29A 1D2SA 4R52A 2QFEA 2E7AA 3GNEA 4MLOA 1FMD3 2Y26A 4E2GA 2VOVA 4LHNA 4K3UA 2R043 3HMYA 1U0AA 3I59B 1G6NA 3VV1A 1GNZA 3WDUA 3U0ZA 1DGRN 4FAGA 3O7OA 3T1LA 3O0XA 1RUOA 4TLFA 1DYPA 1X8MA 2QJVA 1OHFA 1H8VA 1RUC3 4CRQA 1D4M1 2JG8C 4LO8A 1H1MA 1ZM1A 2ARXA 4H7MA 1QDOA 1OLRA 4GB33 3CU7A 1C8M2 3WINE 4IL7A 1JUHA 1ENQA 4COWA 3AMNA 5D8AA 1QJY1 2VMHA 2YPJA 1LR5A 1QJZA 3E5QA 3N3HA 1PZ9A 5EXOA 4D94A 1NCQC 1VBD1 2V73A 3JQWA 2IC1A 4Q4V2 5J96B 1HRV1 2TNFA 1RUG3 4I3PA 2IWGB 4LBMA 4COVA 4N53B 2WNEA 1S0CA 2VMIA 3KQRA 3T1MA 3U4XA 2D3SA 5GZDA 1RUNA 3PMEA 4AYUA 1ZYBA 3AP4A 1QJU1 1VALA 5GLVA 2ET7A 3ZPYA 1T6GC 1OQ1A 2WA4A 4CZSA 5CFCC 2ATFA 2A3XA 1GZWA 5JSPA 1PVC3 1RUJ3 4LUMA 1LGBA 4XDQA 2BVVA 1LGCA 5T55A 3NAPC 3IDBB 5HCAA 1SCSA 2NP0A 3FLPA 4Q4Y3 4JGYC 2VQ0A 3HT1A 2QE3A 1Q8QA 4FXGB 3ZN5A 4AI8A 3PVOA 2R041 1MS1A 4OI1A 3M3OA 5J37A 2CL2A 1H1AA 3B94A 4HK9A 4X6QB 1BJQA 3JUUA 3UKTA 4C91A 2ZGRA 1WD4A 3MICA 1BMV1 4PBOA 4HK8A 4S2DA 4FOVA 1RUC1 4BMEA 2PHWA 1EV13 2WNUB 5A32B 1LB2A 4QHBA 2PLV1 1CPMA 3AZZA 3DPRA 3ZXAC 4XEZA 1J1TA 5FTTC 3N36A 3ZXDA 5L7OB 3WD5A 3DL3A 3AJYA 4BWOA 5TSWA 4Y20B 5C9AA 3ZSEA 4XFBA 4OHYA 4P9IA 4I0BA 3IKWA 4LBOA 2PA7A 1SCRA 2Q5TA 3ZSJA 4YG6A 1RUG1 2A6WA 4LBLA 2ZAAA 1V9U3 3WV6A 2ZHNA 5C8WA 3RZZA 1AXZA 3FWEA 1WCSA 2WNUC 4YM2A 4K21A 3LOBA 2Z69A 3I2DA 5KHHA 1XYOA 1NQDA 2JDZA 4U2AA 2UYBA 3ELNA 1SLIA 3HWJA 1E57A 2DCZA 1WW7A 3ZFGC 3QACA 1BKZA 1NG0A 2XJTA 3SCFA 4R9AA 4FSJA 1MZ6A 2WQ4A 4IEOA 5IK4A 3QD6A 4LO7A 1DGWA 3B69A 3ZFEB 4XJZA 1RUJ1 1MQTC 4HMZA 1R093 4HSLA 1QGLA 2OA2A 3WP3A 4N90A 4Q4Y1 4LHLA 1QNWA 1MZ5A 5I8TA 4O9GA 1OI6A 1PK6A 2LUWA 1KQRA 4AFDA 3VHNA 4LA2A 4PLOA 3AYAA 4L2NA 4HKWA 2VG9A 4LULA 2DF7A 3ES4A 1CN1A 1RINA 1ZZ8A 2F4PA 4YM1A 5F5QA 1OOPB 1EV11 2ZGLA 1PO22 1W6OA 4RS5B 3MIFA 1BXHA 1KXGA 3NWKA 1H9WA 1ND2C 1DZTA 5EWSA 5ABJA 1UCXA 3I59A 5DG1A 1M4WA 1AR73 1BZWA 3MLJA 2IFRA 4JV4A 5AVPA 4KBBA 4YVSC 2BPA2 4ATEA 4JDNA 4PQ9A 1TNRA 4FPHA 4IERA 4GMP1 5CAZA 1V9U1 2X5IC 2XKOA 3VBRC 1O3SA 2XHKA 2VVEA 1IS5A 2DUOA 4NHKA 3SHRA 1YRZA 2ZZQA 1MACA 1QQP3 1PGW1 4LNVA 4IQPA 3O0WA 2VVDA 4PIXA 1VJ2A 1CAVB 4UBGA 3N7JA 1RUF3 4GKXA 2XJVA 5J3UA 2ZGSA 2W0XA 1FYUA 4LTAA 1W6MA 1UL9A 4J1WA 4B4RA 4C90A 1MZEA 4S2FA 1JXNA 4N53A 4K1ZA 5ACA3 4EN9B 1W6QB 1J1LA 1WW4A 3W59A 1ULDA 2RR12 1CAUB 3A0KA 3S0MA 1FOD2 1J3RA 3WQ7A 1J3QA 4JGZB 5I0SA 3HD8B 4AHZA 4AK3A 3L2HA 3WY6A 2OZ6A 4I0AA 5FOJB 2VW2A 4HBNA 4AI2A 4XHBA 1CD3G 2VVFA 4FCAA 1X36A 3CNAA 5T5PA 4C0HA 5FPXA 4N43B 5JWPA 2KA3A 1LODA 3ZYIB 3WHUA 2A6ZA 3MIEA 2E9QA 4Q8LA 3V0BB 5CB7A 4W6YA 1Q5OA 1LHUA 2GMEA 3NVCA 4XIOA 2WFF3 4IEQA 5AVAA 5DUWA 3VBOC 3MDPA 5FDBA 2Q1ZB 1GSLA 1AR71 4E9KA 3O14A 2EALA 1DBNA 3AYDA 4AFBA 1DHKB 3ETQA 5A32A 2DU0A 3DGTA 3RI9A 1PIV2 2RMU1 5L7OA 2K2SA 4P5HA 1QQP1 4I01A 4OHXA 3IIAA 3LCPA 4W65A 5EFUA 1ASJ2 1IKQA 1N3OA 5CFDC 1S55A 4EWDA 1HQNA 2ETEA 3GF6A 4Q4W3 2R1DA 2CY6A 1RUF1 3MIGA 4S2HA 2ZGOA 2ZX0A 1LOFC 5K0UA 4QM8A 2W39A 1GR3A 2GMMA 1WMEA 3VL9A 1F5JA 4EWAA 4KNCA 5ACA1 2E6VA 3RSJA 1ZBA2 3AYEA 3GZTB 3LA3A 1HQWA 1ND3C 1Z0HA 3VBUC 1O5LA 4HL0A 1QY4A 3RRDA 4RHV3 4NOTA 1U5XA 3AXEA 3UKVA 1VAMA 1HXS1 3I54A 3OGGA 4MGYE 1WLCA 3VHPA 1GFF2 3LSDA 1BEV3 1X8EA 1YUDA 1COV2 4W6WA 4YW5A 3G6JB 3ZFEA 1SLCA 3VBFC 2CWMA 2QZ2A 3FUOA 4LEJA 2ZX4A 4R4ZA 3V65A 3LWCA 4KWLA 4XJWA 5GLZA 2VW0A 5T52A 5HCBA 5KC6A 3BPZA 2D5HA 1W6PB 1Q43A 2CTVA 5H9SA 4NHMA 3WP6A 3NSTA 2BEOA 4GIQA 2HEWF 5JVVA 5EYYA 2ZZJA 1UF2C 1EY2A 2WWSA 2PTMA 1OOPA 4XMIA 4RS5A 1QMJA 4QPIB 5T5OA 3IDCB 4FXKB 1U5YA 1N47A 1AR93 2R0FA 3WG3A 1AJOA 4FPFA 4XBNA 2BNMA 5BNPB 1DQ2A 3MI8A 1AJKA 1AHSA 4XMAA 2HWC3 4TZDA 3MF9A 4Q4W1 1AR83 3JBG2 2HWD2 3RDIA 1UD1A 4CEYB 3I4IA 1O3QA 2QDRA 1AYM2 1QKQA 5GLUA 1H1IA 1NXMA 3FLRA 1YXWA 4MYEA 3M70A 1ASJ3 2AGSA 4XQWA 2AUYA 4C0BA 1GZ9A 4NO4A 4RHV1 1ULEA 1CAVA 3DKWA 1YI7A 1URXA 1C5HA 1UZZA 2IZWA 2XLFA 3DV8A 1I3HA 3PJYA 3M2MA 3ZDSA 1BEV1 4COZA 1HV1A 2B46X 4AQ6A 1JYIA 2Q8OA 4A7KA 2DVAA 3S30A 2A7AA 2ZACA 1FPN2 3B93A 3M3EA 2B39A 1GLHA 1W6QA 1WLWA 2EAAA 3ACLA 3MFAA 4UXAA 1V6JA 1B09A 1F31A 3M3IA 4JGZA 4QU2A 3KCXA 4COYA 2GH8A 2YHJA 5KBFA 3RMXA 1FT9A 1LOEA 2PHTA 2UY8A 3KB5A 4O9EA 1DF0A 4N43A 1XE7A 2E51A 2ZMKA 2IXLA 2UWBA 4R9CA 4IEZA 5JMCA 5C8CB 3TNQA 3OYWB 3GBWA 1W39A 2X53S 3VZJA 2JJ6A 4KG0A 1AR91 4M0NA 1RHI2 4IEXA 4FQ4A 4I30A 1VBB3 3ZVXA 1LHVA 3NV3A 2HWC1 2BYVE 4AG4A 1G9CA 1D4M2 1VP6A 2NQYA 5FLIA 3MIBA 1UPIA 3I7DA 5I91A 2H0BA 2D93A 1YJLA 1TME3 1NQJA 3IWZA 4J6GA 3UV9A 1Q8OA 1LU1A 3FJSA 1GQHA 2W68A 5KHIA 1REFA 1ULFA 2UY9A 4HSJA 3KZ4C 1QJY2 1ULCA 2FQPA 3KCYA 4XFCA 2V5YA 4XE9A 3IT8A 3PVNA 1VBD2 3GYDA 4AWDA 1OSGA 1DLLA 4YGDA 1S0EA 1HRV2 3RG0A 1LESA 4BM8A 2ZX2A 4LBJA 4AEDC 2QZ3A 1POV3 3ILFA 4HPKB 5DZEA 2GNDA 2A75A 2P2KA 4ZU5A 2QDNA 4HANA 3ZYRA 4AE2A 4OFGA 4WVVA 1LOCA 1MS5A 1QJU2 5JR7B 1TE1B 1Z7S3 1RUE3 2P3IA 1KITA 5CA6A 3W58A 2VULA 3WP5A 4FPLA 3K48A 4PJYA 1J58A 4NWVA 4RQPB 4CYDA 1VR3A 4IETA 5BY5A 4G4FA 3WW1A 3SCHA 5IK5A 1FMD2 3VZKA 3ZYPA 3E5XA 2R042 1KFXL 4KU8A 4XFGA 1N1TA 1W6PA 5JPMB 1KRIA 2PHXA 4IV3C 4YVWB 1BMV2 1RUC2 2O0OA 4KL1A 4ZXKA 4FOWA 2LTNA 2GU9A 4ZU4A 1AXYA 1LHNA 1XNDA 1MEC3 2D98A 4GB32 1TME1 4WV8A 2XKPA 5DZGA 5KXBA 3QLQA 3VN4A 4FT8A 4QPIA 2HWF3 2R061 2JG9B 4X