3AXDA

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase v18y/w203y in apo-form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
MKDFSGAELYTLEEYQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKSPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDYTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-glucanase
publication title Rational design to improve thermostability and specific activity of the truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase
pubmed doi rcsb
source organism Fibrobacter succinogenes
total genus 59
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2011-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3axdA00
4Y1VA 1A78A 1SLBA 5EWSA 1XQNA 5GALA 4Y20A 4FP2A 1WD3A 2ZGKA 3OPZA 5GLWA 4YFZA 2P34A 2YROA 1IOAA 1W0PA 3M2MA 1S0JA 3PVEA 3KQRA 4AVSA 1UX6A 2ZA9A 1AF9A 3AYCA 2FHRA 4JCKA 1BQPA 4XBLA 4K20A 4FPLA 4FPEA 2UU8A 3POWA 1I1EA 2LTNA 2CWSA 4YW3A 2ES3A 4Q27A 2ZHMA 5DZEA 1N3QA 4C1WA 1LHWA 1R1ZA 4UW3A 4TYSA 4Q8KA 1QOOA 2GNMA 4BMBA 1BZWA 2GN7A 4XJ8A 1SLIA 2GMMA 1W6PB 1G7YA 2PHFA 2GDFA 3SH3A 2AREA 2ZGMA 2ZHLA 2DTWA 3WV6A 3WCRA 4XBNA 2D6KA 5CBLA 1ULGA 1WW7A 3IM0A 1LHUA 2JDZA 1W6MA 2A75A 3BOPA 4H55A 1CVNA 1GZ9A 1W6NB 4GWNA 1JYCA 2UWAA 5E88A 3R05A 1HKDA 5T5LA 4XJ9A 1V00A 2OUHA 2ZGSA 3ZVXA 3RMXA 4YZ2A 1JYIA 1LGNA 1Q8QA 1QU0A 2OUJA 2NM1A 1N1YA 1NLSA 2A6XA 3WUDA 5GZGA 1G8WA 5FRAA 5GZCA 3VUOA 1KRIA 1ZM1A 4YM0A 2VH9A 3PVNA 2DVGA 2ZZJA 2D3SA 3WG2A 2DU0A 1LGCA 1S0GA 2YMZA 2NYYA 2DUQA 1CPNA 1RITA 2LALA 5DG1A 4XTPA 1DFQA 2NMNA 1B09A 4YM1A 5AVAA 1MS0A 3KM5A 5DZFA 1GNZA 1LOFA 1DGLA 5H9QA 2C5DA 4LBQB 5H9SA 4YGDA 2A7AA 2GNDA 4I30A 5H9RA 4YG3A 3N35A 1W0OA 3AZWA 3V0BA 1C57A 1DQ1A 2XB6C 3I4IA 4L8QA 3W58A 5JVVA 1HQWA 1WW6A 1IS4A 3WG3A 5IT6A 3TAYA 2PHWA 3VKOA 3ASIA 1UKGA 1WW5A 3O0VA 4M00A 1LU2A 3WCSA 1LOAA 1SLLA 1UPSA 2A3WA 5KXBA 1LHVA 4PF5A 3PMEA 5GLUA 4XZPA 1UZZA 3RMYA 4DQAA 1FYUA 3T1MA 4AVVA 3VKNA 2DV9A 4ATEA 1Q56A 4GXLA 1Q8VA 4YM2A 2R0HA 3V65A 3SH4A 3AXDA 5KXCA 2NP0A 3RG0A 3ZXJA 2PHTA 4DS0A 5T5JA 5KXDA 1VLNA 1LCLA 1RINA 3D5OA 3OBTA 2EXJA 4AVTA 2WSVA 3N7JA 3OYWB 4YZ1A 3JU9A 1DQ2A 1N1TA 2JKBA 2ZHNA 4WZFA 1CR7A 5DG2A 3USUB 3WZ1A 3WVJA 2W68A 3NV3A 5T55A 1WBLA 1GZWB 4FQ4A 4PCRA 3ZXLA 1BJQA 1BXHA 1LULA 2GMPA 2JE9A 3FLTA 3ZSLA 1GLHA 4DRRA 1S0FA 2YXSA 4Y26A 2GNBA 2TEPA 4GKXA 4PBOA 1MS4A 1SBDA 5T5PA 1VALA 3LSEA 1W6OA 5DXDA 3ZSKA 3M3QA 2WSUA 3LSDA 3AZVA 4FPHA 4M01A 4CTEA 4GKYA 2A6VA 3WG1A 2W08A 2D3PA 1FATA 2EXKA 3O12A 4XDQA 3IPVB 2ZABA 4FOWA 4LBMA 2DUPA 2W52A 3ZXFA 1C1FA 3DGTA 1EPWA 5GZEA 1KITA 3V0AB 5JOXA 3NV4A 1W6QB 2ZBJA 5JOWA 2A71A 2VW1A 3OY8B 3N7MA 2AR6A 3FUOA 1KDMA 4Y1UA 1LENA 3SH5A 1ENSA 2ZGPA 4XTMA 4YGCA 3SISA 3LCPA 1MS1A 3BODA 2P2KA 3OBRA 1ULCA 4FOYA 4BMEA 5JOZA 1D0HA 1CIWA 1WLCA 2WKKA 3C2UA 1ULFA 1DLLA 1SFYA 2G4IA 4P9WA 3Q9OA 1V6JA 3I8TA 1VAVA 5GZFA 1Z0HA 5HCFA 2ZMLA 3N7LA 3VKFC 1IS6A 5CB7A 1S0IA 1LGBA 3FBYA 4XYXA 3GNEA 4Z8BA 2D6OX 2UWBA 3AP7A 3T1LA 4CRQA 3M1HA 2H0BA 5SV8A 3CNAA 3WHUA 4UW6A 2A3YA 2DVDA 1APNA 1GV9A 3A0NA 3QLQA 1FAYA 1WLDA 4HANA 2R0FA 2VU9A 5GJ6A 2R49A 3WOGA 1UMZA 4YFWA 4XE9A 5E8AA 3WDVA 4CZSA 1AXZA 4FP3A 1LOBA 2NMOA 3AX4A 1SCRA 4Y1ZA 2W39A 4AGVA 1W6MB 4DRVA 2ZKNA 1MS9A 1ENQA 4Q26A 4BPZA 4ITCA 5GZDA 3ILFA 5LK5A 3OGGA 4AGRA 4F83A 4YG0A 1QOSA 4IQPA 4YG6A 2FMDA 2E7QA 1DQ6A 1ULEA 4DFSA 2D43A 1MR5A 3AYEA 5HCBA 3WDXA 3AP5A 3FUQA 4D69A 2ARXA 2DURA 1LU1A 1W6PA 1Z78A 2SLIA 4WVVA 1LOFC 4Y1XA 3WDUA 4P9YA 1N3PA 1UN1A 1SLTA 3AJYA 2R1BA 3MW3A 3M3EA 4MYEA 4NOTA 3GALA 4XMIA 2E53A 4AYUA 2ZGUA 4BM8A 5JOYA 2CWMA 1DQ4A 2B7YA 4FPOB 1HLCA 4BLIA 2DVAA 1MZ6A 1LHOA 1O4YA 4Y1YA 1Q8PA 2ERFA 1X50A 2D6MA 3POYA 1GNHA 2AUYA 4DPNA 1S0BA 3R4SA 4XJUA 4ZKTB 1S1AA 4YW4A 2ZMKA 1AJOA 4XHXA 1FV3A 1DYPA 1LOEA 4GWMA 1YYNA 1YXWA 1V6MA 5CA6A 1WW4A 5F5QA 1U0AA 1YI7A 2P3JA 5CAZA 1KDKA 3AK0A 3TB0A 5L73A 4YW5A 1MACA 2D6LX 4GA9A 3FLRA 2R1DA 1S0EA 1GYKA 3A4UA 4FPYA 3AJZA 1GANA 4NO4A 1AJKA 4FVVA 2GN3A 3WUCA 3ZYPA 3AP4A 2DYCA 3MPPG 1G86A 1CESA 4U36A 1G9FA 2YV8A 1G9CA 2ZGLA 3AP9A 3NV1A 1PZ9A 3BIWE 1LOGA 1S0DA 2PHRA 1H9PA 1I3HA 4GALA 3UK9A 3PVOA 4BOWA 1WCSA 1H9WA 1LECA 1QMJA 5H9PA 3MW4A 1C1LA 3N36A 4R9BA 1V6NA 4YW1A 4ZXKA 3APBA 1UAIA 3WDTA 3W59A 1JN2P 3IKWA 1JUIA 3JUUA 3H0OA 2EAKA 4PQ9A 1JHNA 3IMNA 1DYKA 2VW0A 3N7KA 4FPKA 5IK4A 5T52A 1FNZA 2DVBA 2JJ6A 3ZSJA 2DVFA 2ZHKA 3UJQA 3O0WA 2DUOA 5EYXA 1ENRA 1AXKA 2DTYA 1W6OB 4K21A 4WV8A 1LEMA 1MVEA 1MZ5A 1Q8SA 1QF3A 2A6YA 3D4KA 3OYWA 2ARBA 3R4UA 3ZYRA 4PBPA 2ZMNA 4TZDA 3WDYA 3AZYA 1YRZA 2CL2A 3T2TA 3USUA 1LESA 2A3XA 3RS6A 1DZQA 4LBJA 5DUUA 3VKMA 2GALA 1PZ7A 3MEPA 4XJWA 5DZGA 1GZWA 2UURA 3B01A 5JMCA 3O0XA 4XHBA 4AGGA 1AZDA 2XG3A 2ZACA 2AH2A 1JXNA 1QGLA 3BTAA 4Y22A 1WD4A 2WJSA 1QDOA 4Y20B 3AP6A 1SACA 1S0CA 2NZ9A 1GZCA 1KQRA 4XJZA 3SNMA 3ZXEA 5DUXA 3SITA 1CPMA 1MS8A 1VAMA 4M3CA 1H30A 1Y7BA 1JW6A 2V5YA 1ONAA 4U2AA 4XIOA 1URXA 3POSA 1IS3A 4ISRA 3AYDA 4RL7A 2D3RA 1D2SA 1LJ7A 4K1YA 4XJAA 3WHTA 2ZAAA 1O4ZA 4XBQA 2Q5TA 3V0AA 1LHNA 1HDKA 1JBCA 1W6QA 1BKZA 3B00A 3L2YA 3OY8A 1AXYA 2WQZC 2EF6A 2WT0A 2GMEA 5IK5A 1SBEA 4ASMB 2RHPA 3AZXA 2PHUA 5GLTA 1QOTA 1V6OA 3U4XA 3O5SA 5EXOA 2GNTA 1N3OA 3NWKA 4LBLA 3HN1A 1GBGA 1DQ5A 2D7FA 2YY1A 2DU1A 2UWCA 4Q8LA 5GLZA 2EALA 1F5FA 3NV2A 1FV2A 2WT1A 4JRAA 4YZ3A 1IKPA 1LODA 2AGSA 3WNXA 5DUWA 2V73A 1AX0A 1N1SA 1YIFA 2A5ZA 2C9AA 2ENRA 3B3QE 1SLCA 4K1ZA 4M3CE 2VXRA 4W65A 1V6LA 1YO8A 4ATFA 4C1XA 3AXEA 1LTEA 3WLUA 1V6IA 1WUVA 2KM2A 3B9CA 4XMAA 1UZYA 4YGBA 4FPGA 5JLVA 1G9AA 1DQ0A 2A70A 4FOQA 3RRDA 4YLZA 1TEIA 4HL0A 1CN1A 1C4RA 3UJOA 1F9KA 4ISQA 4Q1PA 4YW2A 5T5OA 2OW4A 3HR9A 4FOVA 1W6NA 1OKQA 2CY6A 3V0BB 3WG4A 2WLQA 3ZPYA 4JC1A 3D6EA 3VV1A 1F31A 3AYAA 1CJPA 1FNYA 1N47A 4R9AA 1DBNA 4XXAA 1RIRA 3MW2A 2EXHA 4FPJA 1A8DA 3ZSMA 1A3KA 2JE7A 4Y24A 3VKLA 5IK8A 1NXD1 3SLIA 2JECA 1AX1A 4RA0A 1JOJA 3IN9A 1SCSA 4UW4A 4XIKA 1SBFA 3RQ0A 3FLPA 1GSLA 3ILNA 4R9DA 4P14A 5GM0A 1DHKB 1QNWA 2D6PA 2EIGA 2P3IA 4P9XA 2PHXA 3ENRA 3OJBA 1MS5A 4LBQA 1QDCA 5FREA 5DUVA 1AVBA 4XILA 1IKQA 3FFZA 5CNAA 1QKQA 3A0KA 2CTVA 4AWDA 2D6NA 4YM3A 5HCAA 1UL9A 4SLIA 1IS5A 2E51A 4FQZA 4LBNA 4Q2FA 4M3CF 3RSJA 2A6WA 3M3CA 4LBQD 1N1VA 5T50A 1V6KA 3B69A 1CONA 2JD4A 1Q8OA 2E6VA 2NN8A 1WLWA 2SBAA 2ZGQA 1AX2A 1MVQA 2ZGOA 2PELA 4WVWA 2I2SA 3DUIA 4XOGA 1QNYA 4KBBA 3UL2A 5JDBA 2CNAA 2ZGTA 1PZ8A 2ZGNA 1ZA4A 1OQ1A 1SLAA 1J1TA 4FPCA 2Z42A 1VIWB 3N3HA 2DWRA 1G9BA 5E89A 1OFSA 5GLVA 2VW2A 1HQLA 2OVUA 4YGEA 4LBKA 3V64A 1ULDA 4BLJA 4R9CA 1BYHA 4BQ1A 2VUAA 2EXIA 2YZ4A 1KJRA 2D44A 1MS3A 2AYHA 4XXPA 3HMYA 1KJLA 1WBFA 4Y22B 2R16A 5KXEA 4FPFA 2P37A 3ATGA 2BQPA 5EYYA 2A6ZA 2WNEA 5IK7A 2ZGRA 4M3CB 3INAA 3ILRA 5F9TA 2HYKA 1G9DA 4YZ4A 4Q1RA 1DIWA 1GKBA 4OZXA 1GICA 4UW5A 5IUQA 4LBOA 1LOCA 2E7TA 2P3KA 3AZZA 1FX5A 3IPVA 4YZ5A 1LEDA 3ZXKA 3PJQA 2AENA 2VY0A 2WT2A 3QCWA 3WDWA 3AFKA 5T54A 2CYFA 3M3OA 5BYNA 1CQ9A
chains in the Genus database with same CATH superfamily
4Y1VA 1SLBA 3MUY1 5GALA 1XQNA 2HBUA 4Q5OA 4V1PA 5IATA 2Y64A 4A4AA 2ZGKA 3OPZA 5DDJ3 4D0QA 1W0PA 1EAH3 2J1VA 3LDBA 1ZBA2 3VDCA 4AVSA 2BERA 3AYCA 1DDLA 3MFCA 4BCUA 3VBFB 1D4M2 1RMU3 5C4WC 2BOIA 3POWA 2LTNA 2GAUA 2RM22 5A6QA 1VBA3 4YW3A 3RYPA 3MZHA 2PHLA 3N9OA 2GC2A 3AB0A 1V0AA 3ZDSA 2Y60A 4BISA 2ZHMA 2Y6GA 1LHWA 4AE2A 4YW6A 2WZR1 4KU7A 3FN9A 4TWTA 3DPRA 5J98B 1YEWA 3EB7A 2GNMA 4XJ8A 5LRRA 2CSGA 1X33A 1ZZBA 5I0TA 3SH3A 2ZGMA 3PIJA 1DYOA 2E33A 2ZHLA 3BN6A 3VL8A 2R6QA 2D6KA 2ZAHA 1IZ3A 1GUIA 1L7QA 1W9SA 4KGGA 5C3RA 4O65A 4RD7A 1PHMA 1LHUA 4QKNA 4CU6A 4QKBA 5LEJA 1F4HA 4XF1A 1REFA 5CFDA 1QJX3 1PMJX 5E88A 1VBC1 2AEYA 3ROUA 5T5LA 5EQUA 3HNMA 1QJY1 5EJ3A 1H2MA 2OUJA 4QM9A 3VDDA 1GZTA 5A7OA 1UOGA 1KRIA 5A3UA 1GP6A 2DU0A 1C8M2 3PDQA 2D5FA 4K7JA 5KBFA 1E5SA 2WN2A 4IE0A 2LALA 4HT1T 1GWLA 4F7ZA 5DG1A 4IEWA 1DFQA 2WS92 1FMD2 1JTZX 1B09A 3FJSA 1FPN3 1MS0A 1ST8A 3KM5A 5DAQA 1VBB3 1GNZA 1LOFA 5JCTA 4MGQA 1VMHA 1UXXX 1GOFA 4LBQB 5DPNA 4TTGA 1QQP2 2W9XA 4FBFA 3OTFA 4HBNA 2DCYA 4NHKA 4NHYA 2QE3A 3AL6A 3NNJA 3WW3A 4UFLA 3AZWA 3BKZA 3HT2A 3ES4A 2PQQA 3JQWA 1RUD2 2X09A 1PVC1 3AMNA 3WG3A 5F6KA 1BEV1 2ZXQA 1UKGA 2LS6A 1X9TA 1SLLA 2A3WA 3KF5A 4TN7A 4TXWA 4KNCA 3Q8FA 2Y6LA 2JDHA 1HXS2 1UZZA 4I0WB 3RI8A 4AVVA 3T1MA 2DV9A 1ND3C 1IQDC 1Q56A 1J58A 4GXLA 4YM2A 4ATEA 2R0HA 4TLFA 3V65A 1DGRN 2OT7A 4P9LA 2NP0A 3ZXJA 4DS0A 3KV9A 1KD7A 3ZM8A 5FUIA 4BQXA 3LFMA 5HV0A 3B7MA 4NRMA 4AI8A 2BNOA 1RUJ2 3OYWB 3DF0A 4CEYA 4P00B 2D98A 2HWD1 1ND2C 2FMYA 4WZFA 1CR7A 5DG2A 4QGLA 5AC93 4QPGB 4X6QB 3NV3A 2MHFA 1MPXA 1WBLA 2VZQA 5T55A 2RS12 1NE6A 1RC6A 3JBG1 1LULA 1O8PA 3N9MA 4M4PA 1B35A 2VJXA 3D0JA 3ABZA 5ACA3 4NPMA 2YXSA 4E4SA 5A7QA 1JU3A 5IAXA 5I8TA 2TEPA 2DFBA 1C5IA 4HSJA 4A7ZA 4KH9A 4UFIA 1W6OA 3ME2A 1NG0A 5DXDA 2XGXA 5JSRA 5CZKA 2R063 2AC1A 3N9NA 3WXPA 1XU2A 2OYZA 3E97A 1FATA 4XDQA 2WFF1 4LO6B 3EJKA 4XW3A 3WX5A 1U5YA 5FQ0A 4K3UA 4PDWC 4GZ9A 4Q4W3 3H1YA 2XL7A 2QTWB 4JX0A 4DB5A 3IDEA 1TVGA 3LWCA 3PUIA 3UKVA 4BWOA 4X8NA 5JOWA 1RUF3 1ZZ6A 2AR6A 3T30A 1KDMA 4V2VA 1JZ4A 3RZKA 3VZJA 3R6SA 2W95A 3SH5A 2VD7A 2WO2A 4OI4A 4YGCA 3WP6A 1C5HA 1POV1 3LCPA 2Y38A 4YVWC 3BODA 2P2KA 4GJYA 2WDBA 3J26N 4BMEA 2J22A 5JOZA 2XLFA 1CIWA 1RUE1 1WGPA 5L7OC 4KWJA 3C2UA 1ULFA 2OZJA 1SFYA 3ZX7A 3Q9OA 2JG8C 1H2NA 3I8TA 4D6SA 3K2OA 5FMCA 1UD1A 1Z0HA 1W8UA 4NHMA 5FPZA 5HCFA 5C4WB 1X8MA 1EY2A 1IS6A 2WA4A 1LGBA 3H7JA 3NJYA 4N9IA 4X8PA 4XYXA 4DXZA 4NHXA 5JSPA 3AP7A 2Q1ZB 3P3NA 1PO12 4CRQA 3RJRA 5SV8A 5CKMA 2HEVF 1ZBE3 3TOJA 4M4RA 3ZLIA 2XXZA 1FAYA 1OLRA 2RDQA 4WBBA 5GJ6A 4BH9A 5KXBA 4RR3A 4YFWA 4XE9A 4CDQA 4AFCA 3DKQA 1XXNA 1PK6A 3AKPA 3DXUA 1LOBA 2NMOA 3AX4A 3W20A 3K77A 1W6MB 2PLV3 2ZKNA 1ENQA 2Z5WA 2OPKA 4Q26A 2C9KA 4ITCA 4XFFA 4QB2A 3ILFA 5GZDA 3ZFGC 4F83A 5FPLA 4RGAA 1RUG3 1US2A 4LO4B 5A1FA 1DCSA 1T2XA 3OBZA 1RTVA 1RUH3 4QX0A 4G9SB 1YWKA 3NRUA 1ULEA 4IEPA 4DFSA 1PIV3 2ADDA 5HCBA 3WDXA 1AR81 4LO7A 3AP5A 3MBWA 4BXSV 1LU1A 1W6PA 3WDUA 3KGZA 4HVQA 3I7DA 3U0ZA 5IWFA 1N3PA 3MW3A 4BM8A 3M3EA 1EV12 2CAUA 1XYPA 2Y6KA 1PO21 2CGNA 2ZGUA 4MV2A 1CAWB 4MHRA 1AYM3 3IMMA 5JOYA 1HLCA 2BVVA 2D5HA 3NL1A 2DVAA 5KC5A 4LLFA 4QDSA 2FBEA 1Q8PA 2VVEA 2XKPA 2VQTA 3T0AA 3WF2A 4A45A 4YARA 4P9GA 5BNPA 4CEWC 3BPZA 4NIDA 1X50A 2D6MA 4CCCA 3UGHA 2AUYA 4DPNA 4IXLA 1S1AA 1W8NA 1QXPA 2IXLA 5JZGA 2RJKA 4GWMA 4GMP1 5D1IA 1YXWA 4P5YA 3ZMNA 1YI9A 3ELNA 2P3JA 1J1LA 1SPPB 3GHMA 1KDKA 3DYPA 4EZHA 3GZUC 4GA9A 5A3TA 4KBZA 3U78A 4A6SA 1W9YA 4ZXEA 4IESA 3AJZA 1GANA 2FQPA 2H0VA 2UY9A 3K3NA 1ND3B 1H2LA 1HJFA 2GN3A 4NO4A 4XVHA 1S4CA 2DBIA 4IV3B 5F2WA 5EHDA 4WVMB 1OOPA 1WMDA 1GWMA 3RZZA 2XVLA 2YU1A 1EUUA 5C3SA 3VHRA 2XBO3 1H8TC 1S0DA 1H9PA 3PU3A 3I3MA 3THCA 3CDZB 1HRI3 3AC0A 3KT1A 3MW4A 3N36A 1EYBA 1WWYA 4LTAA 4R9BA 4BYYA 1AR72 1CAXA 4Q0UA 1JN2P 2EIBA 2D97A 1YJKA 1ND2B 2VQUA 4UF0B 3JUUA 4ZY9A 3F2ZA 5FZDA 1MQTC 2MPFA 1ZREA 2I74A 1QJEA 1JHNA 1S55A 3IMNA 1DYKA 1OURA 4S2HA 4CCJA 5T52A 3U11A 1FNZA 5HXVA 4MG2A 4XZUG 3CF6E 2DVFA 2ZHKA 3NVCA 5F3CA 2DTYA 1OHFA 5K0UA 2QZ2A 3PU8A 4XETA 1Q8SA 4JGYB 1COV3 1MZ5A 1QF3A 2Q8CA 5BNNC 1W2OA 4D7SA 1LRHA 2TUNA 2Q8OA 1DGWA 2R072 2VBDA 3AZYA 2HWF3 4IL7A 3T2TA 3UESA 5AFBA 1VR3A 3USUA 2HWC1 2VNGA 2WABA 2PAMA 4LBJA 1PZ7A 3J7NA 3MEPA 4LULA 3VKMA 1MZEA 2UURA 3CJIC 2YC4A 3B01A 1LB2A 2CGPA 4AGGA 2AH2A 4PDWB 1JXNA 4E4HA 2XLGA 1WD4A 1WA6X 3EXUA 1KFUL 2JENA 4DMIA 1F2NA 2MEV2 1C8M1 4TLGA 5FK7A 1FXZA 1OI6A 5F5CA 4CDXA 4Q4V2 2J1TA 4QHOA 3WNNA 3SITA 2OQ6A 3VBRA 4IUGA 3O1VA 3K48A 3IB3A 4N7UA 1ONAA 4EROA 3POSA 4UT5A 1YHFA 2D3RA 1TG7A 4XAAA 4OHZA 1O3TA 4XCBA 1RXFA 1VJ2A 1W9TA 3WNOA 2ZAAA 2HYXA 4XBQA 4NIGA 3V0AA 3D8CA 3EO6A 1HDKA 4F3JA 2JG8B 3PL0A 4Y5SA 2VBPA 3O14A 3VD4A 1W6QA 1O3RA 3B00A 5EP9A 1OH3A 2BBVA 4LEJA 1U12A 3WR0A 3LA2A 2WT0A 5CFCA 1AL23 3HEIA 1VBD2 4XFCA 1OA2A 1OD3A 3WP5A 1NAEA 1QOTA 5TSWA 2P1BA 4S2FA 5C5UA 4CP2A 1Q5OA 4KL1A 1DU3D 4LBLA 3ZFFC 1GBGA 5B2GB 2VNRA 5BNOC 5F7UA 3VDBA 2UWCA 4JGZC 3M8LA 4Q8LA 5GLZA 1BVP1 2WT1A 1YUDA 3ZFGB 1EP0A 2F17A 3J4UH 1LODA 4IE4A 4ET7A 5DUWA 5LK7B 3N4MA 1RUJ1 1AX0A 2C9AA 2A5ZA 4M3CE 2VCMA 4QWNA 1I6XA 3BIEA 3S6PA 3OUIA 5FZ4A 3UYJA 4E4ZA 5FZ7A 1W2TA 2W3JA 5F32A 5FLIA 5FZCA 4XMAA 3AL5A 1W04A 2RS11 2OX0A 2RS52 1DQ0A 2A70A 3MI8A 4YLZA 5K7PA 2VOWA 1C4RA 2GSYA 2OXBA 5T5OA 3NAPB 5JIAA 1XJAA 2OW4A 1TMF3 4GJZA 1RUC3 5BNNA 5IW0A 4CEWB 4I02A 3WG4A 3IDBB 2ZX0A 3LIHA 1V9U3 4LQRA 1F31A 5FZ0A 1CJPA 1FNYA 2WO1A 3KQ4B 3OPTA 4XXAA 4B1LA 3MIDA 3NJVA 3PJYA 4CP9A 4W6WA 1DZTA 1WCKA 1A8DA 3ZSMA 5J09A 1HB4A 2YGMA 5IVJA 3S57A 1FOD1 2QFEA 2DFCA 2JDKA 4Y24A 4HVOA 1NXD1 3SLIA 1K5MC 2JECA 4H14A 1AX1A 1OVPA 4XIKA 5FYIA 4BIFA 3DKWA 2WWSA 1SBFA 1OF4A 3FLPA 3GZTB 4R9DA 5GM0A 2ZJCA 4P9XA 2F4LA 1UY1A 4OUSA 5FDBA 4OHYA 1QDCA 3K46A 5G05L 2Y33A 3LQCA 2QQVA 3Q8EA 4RGGA 5DUVA 1R083 4XILA 1QKQA 3A0KA 2CTVA 4KQ7A 2D6NA 4COYA 2R32A 1UL9A 1W90A 3Q8AA 5B4XA 4CP0A 1QJZA 4LBNA 4Q2FA 5C9AA 1H8TB 3FHAA 3RSJA 5A80A 3M3CA 5FKBA 2QQPA 2C1FA 3HT1A 5T50A 3FMGA 3I2GA 1V6KA 4PQQA 2E6VA 5JR7B 3RWKX 1OLQA 2G1MA 2ZGQA 1ZRIA 2BWCA 1AX2A 2ZGOA 1UOFA 5CVRA 3UL2A 3SEEA 3C7HA 4LUMA 2PYTA 1PO11 2Q30A 5JDBA 3C3VA 2ZGTA 1PZ8A 3UT0A 3UGFA 1WMEA 2B5HA 2XPJA 4Y5TA 2DCTA 3HNYM 3BALA 2V4AA 5E89A 3MLLA 1RUI1 2WYFA 3NW4A 3I49A 2W0XA 4QT6A 3TNQA 1BYHA 3VZNA 1UIKA 2D44A 3E6DA 2ZEWA 5FBZA 4CXWA 5C8CA 4B4QA 5BXXA 4ZU5A 4A6OA 3DEMA 1VMFA 3GF6A 1KJLA 2WZR3 3WW4A 1O5LA 2VOKA 2RJ2A 1HRV1 4FPFA 5F2SA 3KV5A 5FY5A 3TRSB 5BV6A 2P37A 5HPOA 1JYVA 2FD8A 3KCCA 1JYWA 4LNVA 3INAA 3EQEA 4RSUA 4NVPA 2VG9A 4YZ4A 3DCQA 3ZKUA 1BEV2 1RVF2 5ISLA 1VBC3 4HFSA 4OZXA 1ENXA 1GICA 4A3XA 1QEXA 5HI0A 1LOCA 3R4DB 1NX9A 2VXJA 3FHIB 5FV3A 1LEDA 3MYXA 1W06A 3ZIXA 3ZXKA 3RZGA 2WT2A 3AFKA 2CYFA 2CU5A 3M3OA 4JHZA 4HKOA 2BV4A 1CQ9A 1NCQA 4HONA 3VBOC 3ZDVA 5EWSA 4BB3A 3E1F1 3M70A 4Y20A 4QMAA 4ARXA 4FP2A 1WD3A 2JDUA 5GLWA 4COUA 2OA2A 1IOAA 1NY72 2YROA 3M2MA 3TEYA 5LB6A 3AVSA 3BI3A 5FY4A 1UX6A 2E26A 3RWNA 5LW9A 1AF9A 4JCKA 4PIZA 2VTXJ 1E5IA 4XBLA 4AQ2A 1F8VA 2R30A 3A23A 3NNFA 4Q4X2 1W99A 2RMU3 4AEMA 1ASJ3 1ZZ8A 3BPSA 2CWSA 3ALQA 4I0AA 4JZRA 3ZFFB 4XUTA 5BNOB 4IEOA 2ZKLA 4OMDA 4LE4A 1N3QA 3JBG2 5AFEA 2QQKA 4XQ4A 5C3PA 3B5LB 1SHWB 2ZZQA 4XFBA 5KHIA 2WNUC 1CAUB 4TSVA 2GN7A 3K4AA 2XJTA 3WNPA 1AR71 2GMMA 5A32A 2GDFA 4FCAA 5JUVA 3I97A 4A42A 5FXZA 3WCRA 3KV4A 4PIXA 1VP6A 4NWWA 1WW7A 3IM0A 3SCFA 5FUNA 1H1IA 2XOMA 5JI7A 1ZX5A 4X6RB 1JYCA 3R05A 4LUKA 4Y5Z0 3E6BA 1SFPA 4IDZA 5FYHA 2ZGSA 5FZFA 2WFPA 3OGVA 4FO9A 3WNMA 1Q8QA 4AAXA 5DQ0A 2HWD3 2R071 1RUOA 3ZN6A 2VPVA 2ZZJA 2CAVA 3WG2A 5FZIA 1S0GA 4BQ2A 1W9WA 2NYYA 2DUQA 4CDUA 1CPNA 3LPFA 1QWRA 2NMNA 5DZFA 4Q4Y2 1DGLA 1AYN3 1CZSA 1WMFA 4YGDA 3VBHC 1Q3EA 2GNDA 5H9RA 2W91A 4YG3A 4RS5C 3O1UA 4XQWA 3V0BA 4Q4V1 5JVVA 1C28A 1HQWA 3GBWA 1IS4A 2Y8KA 3WF1A 4DUVA 4MO3M 4PI0A 3I3BA 3GGLA 4K40A 2XJQA 5IT6A 3VKOA 4DXTA 3AKQA 4B4RA 1UPSA 5DAWA 3DV8A 2E63A 5FIXA 5FO8B 1HV1A 5GLUA 5LBEA 5L9VA 4JV4A 2G19A 1AHSA 2LM3A 3H8RA 3VKNA 2RDSA 4K8RB 1U5XA 2GH8A 4CSWA 3WP3A 1HB2A 1POQA 2O8OA 3SH4A 3MIBA 2R041 4N53B 3RG0A 1KGYA 5J7MA 1YLLA 1K12A 4QAWA 4DY5A 5T5JA 3P3PA 2WA3A 1RINA 3L9JT 1BK0A 2HLEA 5L9RA 1HW5A 2QCSB 4AVTA 1RL3A 2WSVA 3AKTA 1RUE3 4HZFA 4PT6A 4CUBA 4QPGC 2UYAA 1UCXA 2VCBA 1R1A3 2A1XA 3PLQA 4NMIA 4OZOA 1ZZ7A 2E9QA 3WZ1A 4GH4A 2W68A 4IEQA 3LAGA 3ACFA 4LXLA 3ZXLA 2WINB 2HWB2 4ZS3A 3OGJA 2JE9A 3BU0A 1JYTA 4L99A 3PUAA 3FLTA 4DRRA 4P08A 3WW2A 4QDQA 3HNBM 1UX7A 4Y26A 1VALA 4QXKA 2RS51 3B02A 2CGOA 3OF1A 1QHDA 3LSEA 4QQLA 4RN5A 4IGOA 3JXSA 5E16A 2ZCWA 2DF7A 4DOUA 3KCYA 4GKYA 4Z2AA 5J48A 2YU2A 2OZ6A 2F4PA 2ZABA 3CL1A 5FP7A 3ZXFA 1WCQA 4F8AA 1XNDA 4AQTA 1KITA 4HK8A 4Z1VA 5I8YA 1ULOA 1NCRC 5ABJC 4EJRA 2K46A 2A71A 3N7MA 1RMU2 1UU4A 3FUOA 4N8MA 1PO23 1VBA2 3VBOB 2IUWA 2QQUA 4DUXA 2VOTA 4B1MA 4C0BA 1MS1A 3AM2A 3B94A 1CIYA 3PTYA 3PUQA 5A33B 4B3NA 5CG9A 2WKKA 2XJSA 1W3VA 1AUYA 4P9WA 1PNGA 4NRQA 4IV1A 1W2AX 4NRPA 1GQHA 1VAVA 1VRH3 5GZFA 4CXYA 3DN7A 2VUDA 3FFQA 4YVSA 5F6LB 2YFUA 4XC9A 1X8EA 1S0IA 3I2IA 1RXGA 1WZXA 3DPRB 4YSFA 2D6OX 2J1AA 1JZ7A 4RR3C 2C4XA 3LEIA 2H0BA 5FUPA 4XFAA 4UW6A 1HIXA 5SV5A 1GV9A 1QJX2 2RR12 2WNUB 1WLDA 4G3YC 4HANA 4Q0QA 1O4TA 1VE0A 2R49A 3SCHA 4CZSA 3BTYA 2X29A 4QD2A 1YFYA 5FXXA 3E5UA 4DRVA 4RQPA 3VBFA 5CFDB 3HIFA 2YBKA 4QM8A 4BPZA 5LK5A 3JCIA 4YG0A 4IQPA 1J83A 1DF0A 2HWC2 3MDPA 2FMDA 1ZBA3 4O7XA 5FP9A 5FYCA 5FJHA 3U37A 4XAEA 1D4M3 2Y0OA 4LA2A 5A3OA 5CG8A 4I2OA 2X5IC 2RM23 2D43A 1MR5A 3GJBA 2VBBA 4CDWC 4D7YA 2GC3A 4D6RA 4NIHA 4IEZA 4QGMA 2W94A 4XMIA 3AJYA 2R1BA 4MYEA 4NOTA 5KC6A 3CU7A 3GALA 3O1RA 5DAPA 3BUCA 4FPOB 4BLIA 2BEOA 3T4VA 1MZ6A 1LHOA 2GP5A 1Q43A 4Y1YA 3VDAA 1XE7A 2ORXA 2BRTA 2ERFA 1NLQA 1SG3A 2FZ2A 1RB8G 3JZVA 1GNHA 3VBHB 4ZKTB 1S0BA 3OOXA 4XJUA 4Y3OA 3ZYGA 4QDRA 1AJOA 4RS5B 5E1RA 4WM7C 1RVF1 3OEBA 5ANNA 1NA1C 2VMFA 3BTZA 2VZSA 1GWKA 1YI7A 4FT8A 4BK5A 5CAZA 3JB8A 4IGQA 1MACA 2VM9A 4D3WA 1GYKA 3KLSA 4IV3C 1STMA 4B29A 3WQ0A 4FPYA 1WMXA 2G9ZA 1C8M3 2OKXA 3ZYIB 1RUNA 3NJZA 3WUCA 3ZYPA 3AP4A 2DYCA 1FT9A 3I2DA 3MPPG 2PA7A 1X7NA 2LUWA 1FMD3 1NY71 1W9FA 2C0ZA 2WS93 5JR2A 1YFWA 2VMDA 4OUMA 1NLRA 2BP6A 4AFBA 1QQP3 3PVOA 4DZGA 4Q4X1 1WCSA 1H9WA 1XBFA 5J96B 2WUHA 5ACA2 4ZXKA 2WNVA 5FY8A 3APBA 4QPIC 4R4XA 5LBBA 4MX3A 3UETA 1RUD3 3E5QA 4MGKE 3QACA 4QQ2A 2QBXA 1JUIA 1OKOA 4V2WA 2ZEZA 1B35B 5I0SA 2I45A 2HH9A 4QB6A 4LR4A 2Q4SA 3N7KA 5A3NA 5ERLA 5FPXA 3U4SA 4HETA 4JGYC 1HXS3 3UJQA 4CCLA 2DUOA 5EYXA 4FXGB 1ENRA 1RYYA 1AXKA 1TZOA 1W6OB 3BYWA 3VLBB 4CE8A 4MLOA 3VBSC 1LEMA 4NIIA 2A6YA 4Q4W2 5FMBA 3D4KA 3KSCA 3NO8A 3OYWA 2ARBA 3R4UA 3H9AA 4PBPA 2ZMNA 4PLNA 4EWAA 1YRZA 3J9SA 1HB1A 3GXUA 1LESA 5FQ0B 1FOD2 1DZQA 5DUUA 3NNMA 1GP4A 1KS4A 4Z92B 1HV0A 1UYPA 1RUJ3 3TEWA 2BDRA 3AKRA 5C70A 4COWA 2V5DA 1R092 4IEUA 2ZACA 5FPAA 3LD8A 1QDOA 3AP6A 1T6BX 4BQWA 1SQ4A 1S0CA 1NCRB 1UXZA 5ABJB 5FK8A 4RFT0 1KQRA 1JZ5A 3PUHA 3SNMA 3T3YA 4A41A 3FE5A 3PNAA 5FZEA 1MS8A 4M3CA 1H30A 4Q4Y1 2J1UA 4ARYA 2BGCA 4XIOA 3KVBA 1PX3A 1URXA 1YC61 3GHNA 4RL7A 3LB9A 3P1IA 3BTXA 2FDKA 1X36A 4IE5A 1XNCA 2B46X 5D8AA 3WHTA 5IJRA 4QX7A 1NT0A 1IPSA 4OYUA 3WNLA 3JD72 2VZ3A 2VTXA 1ZRFA 1BKZA 5KHHA 4QX1A 3L2YA 1AXYA 3WF4A 4CXXA 1TME1 1ZZCA 4RR3B 3CJXA 4ASMB 1GU3A 4CDQB 4AGVA 4HKLA 3AZXA 5GLTA 2O0OA 2NQYA 4CUAA 3ORJA 3VBUC 1RUI2 3RJ2X 1CAVB 3GM8A 3HQUA 4IETA 2O1QA 4LO5B 3VZLA 3DECA 3ZN5A 4DO0A 3FX3A 3NKTA 4ZZ8A 2IWGB 1GOGA 2B9UA 1XNBA 1UZVA 3NV2A 1OA4A 4LHLA 5F3EA 1IKPA 5C4WA 2AGSA 4DUWA 2WWUA 4FFIA 4B7EA 1N1SA 1YIFA 2FZ1A 2ENRA 1YNAA 5DAVA 5KHGA 1J59A 2VXRA 2BVBA 2WAAA 3OEAA 1HRV2 1YO8A 3W21A 3BVCA 4LIUA 1LTEA 1V6IA 1G9AA 2X5IB 4CDWB 2HWB1 4FOQA 1VAKA 1TEIA 1PO13 1CN1A 2XJRA 3NAPC 3UJOA 1F9KA 1YQ2A 2B9VA 3QBQA 4QKDA 4UFJA 2VVFA 4ZU4A 3TBDA 5B4NA 1W6NA 2AZ5A 1NXMA 4LMFA 4PJYA 1OXCA 2BWAA 2TBVA 2YGLA 5FP8A 4MXWB 2WLQA 1PGW1 4JC1A 3VV1A 4LK7A 1RIRA 4FPJA 3SKJE 2BTVC 2JG9C 1H6XA 2JE7A 5I0UA 3VKLA 5J3UA 3U1XA 5IK8A 3P5BA 4HPKB 1H4GA 4WM7B 1JOJA 4JDNA 1NA1B 3U75A 3ZFEC 2DCKA 3I2FA 4AHXA 5A6ZA 5KR7A 1CAWA 4K6BA 1DHKB 2D6PA 3SCGA 2P3IA 4JVAA 5J37A 2P6CA 2PFWA 5A3PA 5FPUA 4OMCA 1RMU1 1JMUB 3WP4A 3HBZA 4OCTA 1EV13 2VOXA 4QX2A 2ARCA 1VBA1 5FREA 4HLTA 4OI0A 5FYSA 1S2EA 4KMQA 4EV0A 1IKQA 2Y34A 3ACHA 3PMSA 4GQ7A 3TN92 1JYXA 4AWDA 3W9AA 3POGA 5HCAA 4P9IA 3RZMA 2BYVE 3O7OA 3TEXA 2E51A 4E2GA 1KEXA 4QXHA 2X10A 1CAXB 3EHKA 1XPWA 1N1VA 3EYPA 1PM4A 3IAQA 4I3GA 3LGRA 3I2KA 3B69A 1SPPA 2SBAA 2JD4A 2NN8A 2VZUA 4ES8A 5L19A 1OVSA 1XE0A 2J1RA 4QPIB 4YYOA 5LA2A 3ITQA 1H8VA 4KBBA 1GNYA 3ACLA 1GP5A 3CBNA 5LBCA 3ZPOA 4LIVA 4DEQA 3NNLA 4AHYA 1ND3A 4QX3A 3SKVA 1UKRA 1QJX1 1VIWB 2RR11 5K0UB 3T4HB 2ZS6B 3H7YA 3IDAA 2VTFA 2VW2A 5EZWA 4YGEA 1VBE2 4LBKA 4BLJA 2GH2A 3VBSB 4BQ1A 4XFGA 2EXIA 4MGTA 3J7LA 3AMHA 3I2JA 3KGLA 1Z7S2 5IVCA 2PN5A 3WQ1A 1CZTA 3BCWA 3HMYA 2XUMA 3ON7A 1H1MA 4AHWA 4B8EA 2A73B 1ND2A 4UF0A 5T3NA 1WBFA 1QJFA 1AR73 3T2OA 2HWE2 5KXEA 4E2SA 1UYXA 1AR62 2BQPA 5EYYA 4E27A 3OBAA 5AVPA 3WF0A 4GB32 4EE2A 3J8F2 2ZGRA 3ILRA 2QDNA 1KXGA 3H3ZA 3EMRA 2Q0AA 4QXCA 1XRUA 5FP4A 2WZEA 4UW5A 5IUQA 4ASLA 5LY1A 2P3KA 3AZZA 3IPVA 1H6YA 1FX5A 2OQ7A 3OUJA 3O1TA 1MEC2 3PJQA 1DG6A 2AENA 3QCWA 1IPJA 3WDWA 5T54A 2R073 1QY4A 3HWJA 4PDWA 2W1UA 5CKNA 3VGIA 5LWBA 2R042 5FZHA 5A7WB 5C5TA 2IVJA 5FOBB 4YFZA 4CPBA 1JI6A 4D7TA 2P34A 5FZKA 5FPBA 4W6XA 1S0JA 5F3GA 1REDA 2ZA9A 4MGZE 3GCXA 4JKKA 2FDGA 2MEV3 4K20A 5C3QA 2ORZA 4N43C 1C8NA 3MGUA 4YVWA 1W0NA 2VE1A 1X9PA 4HVRA 1ACCA 4Q4V3 3VBUB 2ES3A 2I07B 4INDA 4Q27A 4BDVB 5L7OA 5DZEA 4C1WA 2X05A 4JQRA 4NUBA 2JIGA 5BNQA 2JG8A 3Q8BA 2GC1A 4TYSA 5K9YA 3H3UA 2ETEA 2WLPA 1XC6A 5ACA1 1AL0G 1SLIA 4XCAA 1G7YA 3A7QA 2W87A 2WAOA 2AREA 2ZEXA 2DTWA 4OHWA 3WV6A 4ZONA 5CBLA 4EZ4A 3JQXA 5F5IA 2JDZA 3MLJA 2A75A 3BOPA 4OHVA 4H55A 1CVNA 5FZOB 1GZ9A 4GWNA 5FR3A 2UWAA 1VBD3 4JTNA 2B8MA 2C6SA 1Y9MA 5I0DA 4XJ9A 3T2PA 5LEKA 1V00A 1BBT2 1DP0A 1K45A 1LKNA 2OUHA 3RMXA 3ZFGA 1QJU2 3ZVXA 3CO2A 4Q4W1 5F8PA 1QU0A 1U5ZA 2NM1A 4AEJA 1IPKA 1W05A 1N1YA 1NLSA 3K51A 3MV11 5A70A 3NQHA 5GZGA 3VUOA 5DN2A 4IEYA 3I59B 1ZM1A 2QQIA 2DVGA 1PGL2 4LHNA 2VL4A 2YMZA 2EIEA 3KVAA 1RITA 5LCWL 1Y3TA 2JG9B 5FZLA 1R091 2IZWA 4AAPA 1W28A 2BGPA 5H9SA 1XB9A 2A7AA 1ULPA 5GKAC 3NSTA 2JDPA 3ZFEB 4JRLA 3ZMOA 1ZRDA 2RS53 2RE9A 3N35A 1L7LA 1W0OA 1C57A 2YUEA 3AMQA 2XB6C 3I4IA 4L8QA 3W58A 3X29B 4CEWA 1O5UA 1WW6A 1GFF2 1YFUA 2JEMA 3POIA 1EUTA 3ASIA 1WW5A 4XQDA 4M00A 1LU2A 3WCSA 3VD7A 4FTBA 2O8QA 1LHVA 3UV9A 3QOPA 4PF5A 3PMEA 2WBKA 4BE3A 4LITA 4OULA 3A22A 2PMWB 4XZPA 4WM8C 4OFGA 1FYUA 3RMYA 4DQAA 2E7AA 2YFZA 4N53C 1Q8VA 3KWVA 3JD71 4RHV2 1VPHA 3H8XA 2W5FA 2PLV1 4XPVA 5KXCA 3AXDA 4HOOA 4AEDC 1RUG1 1VLNA 1LCLA 2PXJA 5L36A 3O1OA 4ORFA 3HJRA 3LEMA 3N7JA 1RUH1 2RV9A 4AQ6A 4YZ1A 3VZOA 5C33A 3JU9A 3KCXA 1PIV1 2JKBA 4LJHA 1H8TA 3KMHA 4W6YA 5F5AA 4FQ4A 1GZWB 2WRAA 1NE4A 1BJQA 3OD0A 1BXHA 2GMPA 2QNKA 1KS5A 3WEZA 3E6CC 3KS7A 3G6JB 2JB8A 3ZSLA 2IVIB 1AYM1 3FBMA 2YHJA 4RYDA 2QQOA 3MPBA 4COVA 4AVAA 3TNPB 1MQTA 4GKXA 4PBOA 1J84A 1MS4A 1SBDA 4FFFA 5T5PA 3S5AA 2VZ1A 5FZ1A 2J1SA 3N9PA 1VMJA 4L0PA 4CCKA 3ZSKA 4E8DA 3M3QA 4GAZA 5FJKA 2XJPA 4M01A 4CTEA 1PMHX 4S2GA 2W08A 3QH7A 1AR92 2EA7A 2W1WA 3VD3A 4HMZA 1C1FA 1S2KA 1QJY3 5C6CA 5GZEA 1K5JA 4META 4CU8A 3OUHA 1V70A 3NV4A 5CYYA 2OPWA 2WNOA 3CJIA 3OY8B 4FSJA 1CD3G 1DGRA 3HAGA 1HQNA 1O7FA 1S2BA 2ZGPA 4XEZA 4XTMA 3SISA 2VMIA 1PM7A 2DDUA 4I3PA 3M4FA 3B93A 1D0HA 3NMBA 4UWDA 3G7DA 5EIYB 1WLCA 2G4IA 3VHPA 1V6JA 2PTMA 4MVTA 3DPRC 5IFTA 5FLHA 2BFUS 4N43B 2JX9A 3VKFC 2FCVA 2ZPXA 1PVC3 5CB7A 1I9RA 3TN91 1BEV3 3FBYA 3GNEA 1RVF3 3D3AA 2UWBA 1RJ7A 2L9LA 3M1HA 2BU9A 3CNAA 4LKEA 3LEKA 2Q1MA 1RHI2 4BQ3A 2DVDA 3NKGA 4I01A 4NR1A 4Z07A 3QLQA 3CEWA 2R0FA 2VU9A 4BQYA 3WDVA 1M06G 1YQCA 5CFDC 4BXFA 4KWUA 2BZDA 1NOVA 1JOBA 3HOBA 1E5RA 4Y1ZA 1GMMA 2JICA 1MS9A 4AGRA 2HWF1 3ST7A 3VDDC 1QOSA 4BQ5A 4RGKA 4CU9A 1UQXA 3ZFFA 3PTRB 5BNOA 1CX1A 2E7QA 4HXCA 3LA7A 2VZTA 4LHSA 3SXWA 1VBE1 4JGZA 4Q4X3 2KR2A 1I5PA 3JB4C 4C8DA 3J7HA 1CAUA 1L3JA 1NYWA 1AYN2 4KU8A 3FUQA 5A7PA 5A7NA 4BHPA 5KWRA 4CDUB 2DURA 1Z7S1 1Z78A 3KV6A 4KG8A 4Y1XA 1LOFC 5LA1A 3JBG3 4P9YA 1UN1A 3POBA 3S0MA 2JE8A 4NE9A 4DY3A 2Q1FA 3W5NA 3MLKA 4A2UA 2E53A 2VCAA 1JZ8A 3H50A 5F1RA 2B7YA 2RS32 4UXAA 1O4YA 1YQ5A 2HWE1 5CKQA 5FZ3A 4I0BA 1AR61 5FY7A 4E8CA 3T2QA 4QXBA 2HJIA 4GB31 4GWJA 3SEPA 4EYUA 4AZZA 3J8F1 1DZRA 1X82A 1YYNA 2WFF3 2EIDA 5CA6A 1DLCA 3SC7X 1TME2 1MEC1 3MO4A 3TB0A 2CDOA 2D6LX 4AF9A 3FLRA 3MIGA 1K5MA 2R1DA 5BPXA 1S0EA 2W47A 3PVBB 4WM8B 4XF3A 1AJKA 2X8KA 4HN0A 1IHMA 3E5XA 4A7KA 1CESA 2YV8A 4IW3A 1POV3 4CEYC 1ZRCA 4Q4Y3 3AP9A 3NV1A 4S2DA 3BIWE 4YPJA 1LOGA 1W8OA 3UK9A 1I3HA 4GALA 4AEDB 3QH6A 2J7MA 3UKNA 3TN93 4W4ZA 5H9PA 1C1LA 2YBSA 1V6NA 1UPIA 2FDFA 4MXVA 4NIAA 3WDTA 1SDDB 1B35C 5KHJA 3H1MA 3W59A 4FAGA 3IKWA 3H0OA 3KF3A 2EAKA 1I5ZA 5E6HA 3S7IA 5C8WA 4FPKA 3ZXGA 4QQPA 3VHOA 1JODA 3THDA 3ZSJA 5HBAA 2XR4A 3D82A 1TMF1 3KHCA 1W8WA 3LIGA 3ACGA 2IXIA 1BVVA 3VD5A 1K42A 1H1AA 1PGW2 1XSRA 1GQPA 4XUPA 1WKYA 3ZYRA 4TZDA 1H0BA 3WDYA 2LRPA 2WO3A 4MUVA 4CCOA 3ZN4A 4D94A 2Y0IA 3SMHA 2A3XA 2BW8A 4XF9A 1IG0A 4CVUA 2GALA 4XJWA 5DZGA 1BBT1 3AVRA 3GDBA 5FYYA 2IXCA 2DBNA 1QJU1 5IYYA 5JMCA 2OS2A 3O0XA 5DDJ2 1EAH2 1XOYA 2XG3A 4PLOA 2Z2SB 1AR83 1UY2A 1QGLA 3BTAA 4Y22A 3ZYHA 2VMGA 3O1MA 1ZVFA 1PGL1 4AI1A 4JHTA 2HWB3 1J3QA 2NZ9A 4SBVA 4NAMA 1CPMA 2JXAA 5IHRA 5CU1A 1OQDA 1JW6A 4H2AA 1NZIA 2HEYF 2J1EA 1IS3A 4ISRA 4UOJA 4XACA 4AQSA 1WCUA 1D2SA 1LJ7A 3ACIA 1O4ZA 1OSGA 3L2HA 4P5HA 1LHNA 1T6GC 3OG2A 4QQHA 3LOIA 2VULA 4AXOA 4LT5A 4GMP3 3I2OA 4LKDA 5HV4A 1HN0A 2O14A 4CDQC 3CHXA 1PK6C 2QQLA 3PUSA 2WQZC 1IGOA 2EF6A 2ADEA 2GMEA 5FYUA 4BK4A 2VZVA 4PHZA 3DYOA 4AI9A 5IK5A 2RHPA 3VBOA 5D21A 2PHUA 2VO5A 1UIJA 1V6OA 4RHV1 5DAXA 4JTOA 4R8HA 4RQPB 1GOHA 5EXOA 3AMMA 3HN1A 1BLZA 5A33A 1C3HA 2D7FA 4BZ4A 1F5FA 4OVEA 4YZ3A 1YCIA 1GR3A 5J36A 3VDDB 2RDNA 3VZMA 2K2SA 2V73A 4Q0VA 4BQ4A 1SLCA 1FPN2 1ALYA 1VBB2 4OUEA 4ATFA 3CZJA 2IFWA 1OD5A 2JD9A 2YG0A 3AXEA 3RDIA 3UKTA 1WUVA 2KM2A 3GBFA 4YGBA 3WLUA 5DMYA 1K3IA 2CV6A 2WNUA 4FPGA 3ZIWA 3RRDA 4Y4RA 5BNPC 2VECA 1HN1A 3H3LA 4HL0A 4XUQA 2J42A 1BCXA 2XUEA 3QD6A 2ET1A 4Q1PA 4YW2A 4MOAA 2ZX1A 3HR9A 2RR13 3PHMA 5FZ6A 3RZJA 4AVCA 3RPQA 1OKQA 2V4VA 2CY6A 5JZGC 5I91A 5F3IA 3EBRA 3WW1A 4HG6B 3WD5A 4RFRB 3ZXAC 3CQOA 1DBNA 1UZWA 5AVAA 2WN3A 2EXHA 2YB7A 3IBMA 2Q8EA 5JPMB 3I3EA 5I93A 1NQDA 1A3KA 1AR91 2DCZA 1QH6A 2HWC3 5A3LA 1OPMA 2RVAA 4QX5A 4UFHA 4ZZ5A 2Z4FA 3IN9A 3D0SA 4UW4A 4ASKA 3RQ0A 1GSLA 2XVKA 3ILNA 4PF1A 2EIGA 5L9BA 4D6QA 1OOPC 1PX4A 2EVXA 4LBQA 4IE7A 2QJVA 1W03A 4AEKA 2RMU1 5LA0A 4QU2A 4MGIE 3T09A 1ASJ1 4XUOA 5IVVA 5AC92 4ZHNA 2QQMA 2W92A 1AVBA 2W1QA 3VBHA 3M3IA 3WNKA 2C26A 4FAHA 4RS5A 4YM3A 2X53S 2G9FA 3IDCB 1IS5A 4SLIA 3THPA 4CEYB 1BHGA 3LF7A 2WNVB 3R0RA 4FQZA 3VHNA 5JXGA 4J1XA 3GCWA 4M3CF 2NLRA 1OLMA 4H3WA 1SZBA 3HPNA 1WLWA 2XQRA 2JDAA 4L9BA 4WVWA 2I2SA 3DUIA 1QNYA 2KA3A 4NJ4A 2CNAA 5FZBA 4LKSA 3WF3A 2R062 5K0UC 3VB9A 2ZGNA 1ZA4A 2AEZA 1RHI1 1J1TA 3LOBA 1J3PA 4FPCA 4GWIA 3VZKA 5CIRA 5A1AA 2C24A 3N3HA 2B45X 1G9BA 1UY3A 1UY0A 4IEXA 5EV7A 4OI1A 1HQLA 2OVUA 2P4EA 3V64A 2YPJA 2VUAA 2QQWA 2BBAA 3FHQA 5LASA 4AW7A 2P6HA 5FO7B 1ZYBA 4HN1A 1RUF2 3O1SA 2AYHA 1YQ6A 1JUHA 3FC0A 4QPGA 4XXPA 5I8SA 4C0HA 3T08A 5K8SA 1E57A 3ZR5A 3POJA 5A7SA 4Q0PA 4CUGA 5APAA 4FTSA 1SDWA 3Q8CA 2R16A 4CDXC 1AYN1 1E5HA 4JKMA 3ATGA 3RYKA 2NPIA 3VBRC 4CCNA 2A6ZA 2RS13 2F6BA 2ILMA 5IK7A 2BNMA 3FWEA 4M3CB 4C91A 2D40A 2IFRA 2VVDA 2HYKA 2RS31 4WVZA 5F9TA 1Y4WA 4IERA 5KHKA 1W8ZA 4JDMA 4LKFA 4Q1RA 5J1XA 4GULA 1DIWA 1F5JA 3KT4A 4LBOA 1UOJA 2W46A 5D8AB 4K9SA 4KWLA 3S30A 4UFMA 1ZBE2 2PAEA 3HVDA 2VY0A 4LK6A 1RJ8A 5LBFA 1XE8A 4B4PA 5CFCC 3IT8A 5BYNA 2FDHA 1FOD3 4JKLA 1A78A 1RGSA 2PLV2 2XONA 1NCRA 1CWPA 4DXRA 5ABJA 1H4HA 1R093 2Q8DA 2P3YA 1RUG2 3PVEA 3KQRA 1PK6B 2GU9A 2YC0A 2FHRA 2Z69A 1BQPA 4NWVA 5A3MA 4XABA 3VL9A 2BFUL 1RUH2 1W3XA 2BOJA 4FPEA 4FPLA 3RNSA 2UU8A 1I1EA 1PIV2 3N9LA 5FP3A 1R1A1 1O59A 1UO9A 1UU5A 4OI2A 2JDNA 5FYVA 3LE0A 1CX4A 4CPBD 4LO8A 5FWJA 1R1ZA 1JZ3A 3B9IA 3NJXA 4JDOA 4L11A 4UW3A 1OFNA 4HK9A 3MV01 3RVHA 4Q0SA 4Q8KA 1AYM2 1QOOA 4IE6A 4BMBA 1BZWA 1J3RA 4ES9A 3KD4A 4DEVA 1W6PB 5FAXA 2PHFA 5CISA 4O61A 3MFAA 3JD73 4XBNA 2VMEA 3LZZA 1PGSA 1TQ5A 1D7PM 1QXJA 1ULGA 5FZAA 3WSOA 4B7KA 1CGPA 2FCUA 2RG4A 3HD8B 3HN3A 1W6MA 1CAVA 2QQNA 5BNPB 4EQVA 1W6NB 3KZ4C 3UGGA 5FZ9A 3LPGA 1HKDA 4LLOA 1OUXA 5FZGA 3WQBA 2ZEYA 4YZ2A 1JYIA 1RUI3 1LGNA 3MF6A 1OF3A 2VZOA 4MSVA 4UBHA 2VQAA 2A6XA 3WUDA 3NNGA 5JZGB 4QU1A 5A6YA 4YWAA 1G8WA 5FRAA 5GZCA 2BPA2 4YM0A 2VH9A 3PVNA 5FPVA 3IIIA 2XLAA 2D3SA 5FWEA 3SHRA 1LGCA 3DL3A 2QVSB 3PIGA 2X5IA 3MICA 2XH6A 3IWZA 4CDWA 4AG4A 4XTPA 5DDJ1 1EAH1 1UMHA 2WYSA 4P02B 4UYBA 4YM1A 5ANQA 5H9QA 1HRV3 2C5DA 1PMIA 2XBO2 1JYNA 4I30A 3U10A 3F95A 1HRI2 1ZZ9A 4FTEA 4J6GA 1OOPB 2ZX4A 4XFHA 2QKDA 5FXWA 3DYMA 1DQ1A 1O3SA 1TNFA 1VRH1 2XJUA 3IIAA 4MXWA 5FMOL 1YFXA 3FL7A 4AFMA 5C9AC 4PI2A 4UBGA 2XDVA 2Y6HA 3TAYA 2PHWA 2Z79A 3O0VA 1WLTA 1LOAA 3MIHA 4CCMA 4HPKA 2XHNA 1W2UA 2PHDA 4WM7A 4MGSA 1NA1A 2VZRA 3TWIA 3TYJA 4J25A 4AFAA 1COV2 3MIFA 1YQ8A 2WZPP 2WR9A 1F15A 1QIQA 1UNBA 5FLJA 3LDKA 2PHTA 2HWF2 1HJGA 2OIIA 5IVBA 2WC2A 4IV3A 4CYDA 1ZNPA 2PAKA 4WVMA 2ZOEB 3GYDA 5KXDA 3OBTA 1ZBA1 3D5OA 4Y4YA 2EXJA 1OPOA 4MGYE 4A7YA 5C8CC 3C7OA 3ES1A 2XJVA 1D4M1 1UWWA 2JWPA 4BJ0A 1DQ2A 1N1TA 2RM21 2ZHNA 5IVYA 3USUB 1OUSA 3WVJA 2YDEA 4PCRA 4AR2A 4MH0E 3C8XA 2WWJA 1A34A 2TNFA 4EN9B 5FCCA 4XUNA 4QPIA 5F37A 1GLHA 1LAJA 1FPN1 1S0FA 1VBB1 1Y43B 5A3WA 2B39A 1W8FA 3RFRA 2GNBA 3BOWA 1YJLA 4M0HA 3GZEA 5FMDA 4CDXB 4Y33A 1OLME 1UY4A 2ZX3A 3VBRB 2XKOA 4JGYA 1Y9QA 2WSUA 4L97A 2WO7A 3AZVA 3LSDA 4FPHA 4R52A 1D2QA 4FFHA 2A6VA 2UY8A 3WG1A 4URAA 2D3PA 2EXKA 3O12A 3VBSA 4QHZA 3RI9A 4AFDA 3IPVB 2FDIA 4FOWA 4M0NA 1UW8A 2DUPA 2W52A 3K4ZA 4LBMA 3DGTA 1NCQC 3T0BA 5M0TA 1EPWA 1VBE3 4Z82A 2ET7A 3V0AB 2JKXA 1AL22 3VN4A 4AK3A 5JOXA 4N7IA 3MUZ1 1W6QB 2ZBJA 4A44A 5CEHA 3AKSA 4BIOA 1Z7S3 2VW1A 4OLLA 1F35A 4URTA 4YRDA 5CFCB 1JS9A 2W1SA 2EAAA 4Y1UA 1LENA 3I3DA 4FFGA 1ENSA 2LROA 2WS91 1FMD1 1W39A 4JAAA 1W8TA 4UI9L 3H8OA 2HWE3 3P6BA 4ZPIA 3OBRA 1JZ6A 2K0GA 1QQP1 1ULCA 1AR63 4FOYA 1YIPA 1XNTA 5FY1A 4YVWB 2FDJA 4GB33 1DLLA 1PVXA 3J8F3 5JXIA 4XDOA 2ZTNA 1M4WA 5AC91 5L7OB 3K4DA 1UYYA 5A1LA 2ZMLA 3N7LA 2RJLA 5JXHA 1RUD1 1LR5A 4Z8BA 3W5MA 3A21A 4AL9A 4JQTA 3WQ7A 3T1LA 1JZ2A 3WHUA 4XDPA 3IZOA 1MEC3 2A3YA 5A6XA 1APNA 1OH4A 5FYMA 3A0NA 5A7WA 2AACA 1HXS1 1TMF2 3S5QA 1RUC2 3ETPA 3WOGA 5FXVA 2WQ8A 1UMZA 3CZUA 4I09A 5E8AA 1AXZA 4FP3A 3RGBA 4DIQA 1SCRA 2GZWA 1V9U2 1XU1A 2W39A 2HEWF 2VR4A 4HKWA 5LATA 2R061 2R043 2YC2A 3V56A 3URFA 5BNNB 1H2KA 2VMHA 3OGGA 3I54A 1TNRA 4KI5M 2CHHA 4YG6A 2VUCA 3GBGA 3VBUA 3OPWA 4NHLA 4EWDA 2P17A 2D93A 1UOBA 1BMV2 4CP9B 4XF4A 3C7GA 3CLPA 5FZ8A 4CDUC 4DNYA 1DQ6A 1SMVA 3AYEA 5IFPA 4D69A 2ARXA 2XWJB 3C7EA 4NROA 1RUF1 2SLIA 1JU4A 4WVVA 3LFIA 1SLTA 1UYZA 1OQEA 4AYUA 5FBJA 2CWMA 1DQ4A 5C7GA 5JXJA 1R082 2VUJA 4CA9A 5FYZA 2HKXA 2QUOA 3OD4A 5FZOA 4LE3A 2N7GA 3NAPA 3OSDA 4CP1A 5FFOC 2P5BA 4E4DX 2EICA 3POYA 1A6CA 2V09A 4NN0A 4CCEA 4CUCA 3R4SA 2IXJA 4EN6B 4YW4A 2ZMKA 4MADA 4XHXA 1FV3A 1DYPA 1LOEA 3RYRA 2V72A 1IG3A 1OMIA 3C7FA 5IAVA 5C9AB 4DINB 3I59A 3RZHA 4XURA 1V6MA 1VRBA 4NAOA 5EJZB 1BBT3 1WW4A 5F5QA 1U0AA 5C71A 1QJU3 4LA3A 1GQGA 1ZBE1 3AK0A 5IVEA 4GIQA 5L73A 2JG9A 3LA3A 4YW5A 3ZO0B 3U07A 3A4UA 3ECQA 1QH7A 3ZFEA 1O8SA 4FVVA 3WY6A 5CADA 3BGAA 3POFA 1UMIA 3I2HA 1O3QA 1G86A 4U36A 1G9FA 2XMLA 1KFXL 4IEVA 4LPLA 1G9CA 4KGQA 2ZGLA 3H42B 3MF9A 4W50A 1CJDA 1PZ9A 4XF0A 2PHRA 2WZR2 3LDRA 1D4VB 3OGRA 4GH4C 4BOWA 1LECA 1QMJA 2PQSA 2ATFA 3BB6A 5I0RA 5C8CB 1UF2C 4YW1A 4OHXA 1DGWX 2FCTA 5FYBA 1UAIA 2JDYA 1NZCA 3GJAA 5LY2A 5JIUA 3N9QA 2Y6JA 4Z2WA 1UU6A 1A8MA 4O9GA 4PQ9A 3UNPA 2VW0A 5D2AA 5IK4A 5FY9A 4AVBA 2B4KA 1MQTB 2DVBA 2JJ6A 2ZX2A 5FZMA 1EPZA 2WIIB 3O0WA 1VBC2 3THTA 2ID4A 4BA6A 4K21A 5JAXA 5EJ1B 4GD4A 4RHV3 4WV8A 1FI2A 1MVEA 4QQOA 1QJY2 3POEA 1HX6A 1SFNA 4L92A 3ETQA 2CL2A 2VQ0A 4IGPA 1ZRRA 3RS6A 2VC9A 3TEZA 1CZVA 4J1WA 3T0DA 3AMPA 1GZWA 3KHBA 1R64A 4LOSA 1MZFA 2VAUA 3LEGA 4FXKB 4XHBA 1AZDA 2UYBA 4N90A 4QHBA 3CJIB 4UAPA 1NCQB 1OBNA 3RZLA 4AI3A 4KG0A 2E31A 2WJSA 5HCHA 4Y20B 3OB8A 1NQJA 1SACA 4P9JA 3WT3A 2RMU2 4H7LA 1D0GA 1GZCA 4KWKA 1EV11 1ASJ2 2CDPA 1L7RA 4XJZA 2XHKA 3ZXEA 1O6UA 5DUXA 2Y26A 3I3QA 1VAMA 2GP3A 4IV1C 1PVC2 4QX8A 1Y7BA 2XBO1 3S7EA 1OC1A 2V5YA 2VZPA 4U2AA 2XVGA 4YVSC 1HRI1 3AYDA 1Y9GA 2ARAA 4NPLA 4W8JA 4XJAA 4K1YA 1SEFA 2H6BA 5JSOA 2Q5TA 2JIJA 2XL9A 4EN0A 1JBCA 4CU7A 2BGOA 1AR93 4Q29A 1POV0 3U14A 3ZYJB 4OQ8A 5LRSA 3OY8A 5A32B 1SBEA 1U5IA 2GC0A 1ODMA 1G6NA 2VNVA 2YPDA 4RQPC 3VBFC 4ZU7A 4L2NA 1F4AA 3O1PA 1XYOA 1JOPA 3U4XA 1P8JA 3O5SA 1COV1 2GNTA 1N3OA 1ODNA 3KT7A 3NWKA 1O91A 4MHUA 5BY5A 1XSQA 2RDRA 2HWD2 1DQ5A 2YY1A 2DU1A 2E32A 5FYTA 1WA4A 3ZKYA 4AI0A 2IC1A 2EALA 1FV2A 4JRAA 4MZUA 4QPWA 4N43A 3WNXA 4JGZB 4LHKA 4AHZA 5C3OA 1IQAA 4K1ZA 1TE1B 2VGDA 2BJSA 3B3QE 3ZN6B 1PNFA 5DABA 4W65A 4COZA 1V6LA 4CCDA 4C1XA 4C90A 1VB2A 1WCDJ 3HQXA 5LA9A 1NKGA 3B9CA 5JLVA 1UZYA 1OA3A 4A3ZA 4E2QA 3CKHA 4OQ9A 4ISQA 2B42B 4AOCA 1RHI3 1VB4A 4UFKA 4QKFA 4FOVA 3ZSEA 2WFF2 1JH5A 4EN7B 5JI9A 3HQRA 3V0BB 4PIYA 2JB4A 3ZPYA 2QDRA 3D6EA 3OGSA 4ZS2A 3K75B 3AYAA 4DXSA 4R9AA 1N47A 5FY0A 1REEA 3MW2A 4D8MA 3VD9A 3BU7A 4YW7A 2G9GA 3DXTA 4EN8B 2MNGA 5FMOS 5FO9B 2R7EB 3OCPA 3MHZA 4RA0A 1SCSA 1AL21 1K5MB 4HSLA 4E9KA 4P14A 1QNWA 3ZR6A 2XWBB 1ZA7A 2PHXA 3ENRA 2VNOA 4LOTA 3OJBA 1MS5A 3ZOIA 1RUE2 2MEV1 3ZXDA 3H1WA 4GMP0 1R1A2 3J7MA 5JMOA 3GZAA 2RS33 4BU2A 3FFZA 2DCJA 5CNAA 2WNVC 2W2IA 3FZ3A 1QXRA 5EFUA 2VCCA 2WQ4A 2BNNA 4NPRA 2QZ3A 4AI2A 2A6WA 3ZYBA 2WZ8A 4GH4B 1LNSA 2BUKA 3PURA 4LBQD 4O9EA 2WL1A 2YBPA 1CONA 1Q8OA 3WINE 2H6CA 2JDMA 5JPNB 3KB5A 3HBKA 1MVQA 4XOGA 2PELA 5BUVA 4N9HA 5K4LA 5FOJB 5LZ6A 4PLMA 4LORA 4WM8A 1TME3 1OQ1A 1SLAA 3K3OA 3CIHA 4N53A 2Z42A 2XQXA 1RUC1 1VBD1 1XNAA 1UZ0A 5G04L 1US3A 2DWRA 1W8HA 1OFSA 5GLVA 2QQJA 1V9U1 4QPYA 4AEDA 1ULDA 3USSA 4R9CA 4K8FA 2YZ4A 1AR82 1KJRA 4WZCA 1MS3A 3M7AA 5IVFA 4EWEA 1NUKA 2KXLA 5HXMA 1BMV1 1PO22 3AFGA 1BK1A 1HB3A 1XYNA 2K9ZA 2KD7A 4XFIA 4Y22B 3H8UA 5F39A 1W2NA 4H7MA 4G4FA 2Y6FA 4QB1A 2IXKA 5EPAA 2WNEA 2VMCA 1VRH2 4R4ZA 4YNIA 1R081 1G9DA 2HBTA 3MIEA 5D8AC 1GKBA 1OT5A 4ONUA 3LKJA 2LW8A 3CMGA 4IV1B 2E7TA 4FI9A 4YZ5A 3IAPA 3ZYFA 5FTTC 4YVSB 4QGNA 2YYOA 5FKCA 1XNKA 5JWPA 3SQOA 2VOVA 1JHJA 2IXHA
chains in the Genus database with same CATH topology
4Y1VA 1SLBA 5GALA 1XQNA 4V1PA 2ZGKA 3OPZA 5DDJ3 1W0PA 1EAH3 4AVSA 1ZBA2 3AYCA 1DDLA 3MFCA 4BCUA 3VBFB 1D4M2 1RMU3 5C4WC 3POWA 2LTNA 2GAUA 2RM22 3MZHA 1VBA3 4YW3A 3RYPA 2PHLA 2GC2A 3AB0A 3ZDSA 2ZHMA 1LHWA 4AE2A 2WZR1 4KU7A 4TWTA 3DPRA 5J98B 2GNMA 4XJ8A 5LRRA 1X33A 1ZZBA 5I0TA 3SH3A 2ZGMA 2ZHLA 3VL8A 2R6QA 2D6KA 2ZAHA 1IZ3A 4KGGA 4RD7A 1PHMA 1LHUA 5LEJA 4XF1A 1REFA 5CFDA 1QJX3 5E88A 1VBC1 3ROUA 5T5LA 1QJY1 5EJ3A 1H2MA 2OUJA 4QM9A 3VDDA 1KRIA 2DU0A 1C8M2 4K7JA 2D5FA 5KBFA 2LALA 4HT1T 4F7ZA 5DG1A 4IEWA 1DFQA 2WS92 1FMD2 1JTZX 1B09A 3FJSA 1FPN3 1MS0A 5AVAA 3KM5A 5JCTA 1VBB3 1GNZA 1LOFA 4LBQB 1QQP2 4FBFA 3OTFA 4HBNA 2DCYA 4NHKA 3WW3A 2QE3A 3AZWA 3HT2A 3ES4A 2PQQA 3JQWA 1RUD2 1PVC1 3AMNA 3WG3A 5F6KA 1BEV1 1UKGA 1SLLA 2A3WA 4KNCA 1HXS2 1UZZA 4I0WB 3RI8A 4AVVA 3T1MA 2DV9A 1ND3C 4ATEA 1Q56A 1J58A 4GXLA 4YM2A 2R0HA 4TLFA 3V65A 1DGRN 4P9LA 2NP0A 3ZXJA 4DS0A 1KD7A 3B7MA 4AI8A 2BNOA 1RUJ2 3OYWB 3DF0A 4CEYA 2D98A 2HWD1 1ND2C 2FMYA 4WZFA 1CR7A 5DG2A 4QGLA 5AC93 4QPGB 4X6QB 3NV3A 2MHFA 5T55A 1WBLA 2RS12 1NE6A 1RC6A 3JBG1 1LULA 1B35A 3D0JA 5ACA3 2YXSA 4E4SA 5I8TA 2TEPA 2DFBA 1C5IA 4HSJA 4A7ZA 4KH9A 1W6OA 3ME2A 1NG0A 5DXDA 2XGXA 5JSRA 2R063 3WXPA 1XU2A 2OYZA 3E97A 1FATA 4XDQA 2WFF1 4LO6B 3EJKA 4XW3A 3WX5A 1U5YA 5FQ0A 4K3UA 4PDWC 4Q4W3 3H1YA 2XL7A 4DB5A 3IDEA 3LWCA 3UKVA 4BWOA 4X8NA 5JOWA 1RUF3 1ZZ6A 2AR6A 1KDMA 3VZJA 3R6SA 3SH5A 4YGCA 4OI4A 3WP6A 1C5HA 1POV1 3LCPA 2Y38A 4YVWC 3BODA 2P2KA 3J26N 4BMEA 5JOZA 2XLFA 1CIWA 1RUE1 1WGPA 5L7OC 4KWJA 3C2UA 1ULFA 2OZJA 1SFYA 3ZX7A 3Q9OA 2JG8C 1H2NA 3I8TA 1UD1A 1Z0HA 5HCFA 4NHMA 5FPZA 5C4WB 1X8MA 2WA4A 1EY2A 1IS6A 1LGBA 3H7JA 4N9IA 4X8PA 4XYXA 4DXZA 5JSPA 3AP7A 2Q1ZB 3P3NA 1PO12 4CRQA 3RJRA 5SV8A 2HEVF 1ZBE3 3TOJA 1FAYA 1OLRA 4WBBA 4BH9A 5GJ6A 5KXBA 4RR3A 4YFWA 4XE9A 4CDQA 4AFCA 1XXNA 1PK6A 3AKPA 1LOBA 2NMOA 3AX4A 1W6MB 2PLV3 2ZKNA 1ENQA 2Z5WA 2OPKA 4Q26A 4XFFA 4ITCA 3ZFGC 5GZDA 3ILFA 4F83A 4RGAA 1RUG3 4LO4B 1RTVA 1RUH3 4G9SB 1YWKA 1ULEA 4IEPA 4DFSA 1PIV3 5HCBA 3WDXA 1AR81 4LO7A 3AP5A 1LU1A 1W6PA 3WDUA 3KGZA 4HVQA 3I7DA 3U0ZA 1N3PA 3MW3A 4BM8A 3M3EA 1EV12 2CAUA 1XYPA 4MV2A 1PO21 2CGNA 2ZGUA 5JOYA 1CAWB 1AYM3 1HLCA 2BVVA 2D5HA 3NL1A 2DVAA 5KC5A 4LLFA 2FBEA 1Q8PA 2VVEA 2XKPA 4YARA 4CEWC 4P9GA 5BNPA 3BPZA 1X50A 2D6MA 2AUYA 4DPNA 4IXLA 1S1AA 1QXPA 2IXLA 5JZGA 2RJKA 4GWMA 4GMP1 5D1IA 1YXWA 3ZMNA 1YI9A 3ELNA 2P3JA 1J1LA 3GHMA 1KDKA 3GZUC 4GA9A 4IESA 3AJZA 1GANA 2FQPA 2H0VA 2UY9A 4NO4A 1ND3B 1H2LA 2GN3A 4IV3B 4WVMB 1OOPA 1WMDA 3RZZA 2XVLA 3VHRA 2XBO3 1H8TC 1S0DA 1H9PA 1HRI3 3KT1A 3MW4A 3N36A 1EYBA 4LTAA 4R9BA 4BYYA 1AR72 1CAXA 4Q0UA 1JN2P 3TN93 2D97A 1YJKA 1ND2B 3JUUA 1MQTC 2MPFA 1ZREA 2I74A 1JHNA 1S55A 3IMNA 1DYKA 4S2HA 5T52A 3U11A 1FNZA 5HXVA 3CF6E 2DVFA 2ZHKA 3NVCA 2DTYA 1OHFA 5K0UA 2QZ2A 4XETA 1Q8SA 4JGYB 1COV3 1MZ5A 1QF3A 4D7SA 1LRHA 2TUNA 2Q8OA 1DGWA 2R072 4IL7A 3AZYA 2HWF3 3T2TA 5AFBA 1VR3A 3USUA 2HWC1 2VNGA 4LBJA 2PAMA 3VKMA 1PZ7A 3MEPA 4LULA 1MZEA 2UURA 3CJIC 3B01A 2CGPA 4AGGA 2AH2A 4PDWB 1JXNA 2XLGA 1WD4A 3EXUA 1KFUL 2JENA 4DMIA 1F2NA 2MEV2 1C8M1 1FXZA 1OI6A 4CDXA 4Q4V2 3SITA 3VBRA 3K48A 4N7UA 1ONAA 4EROA 3POSA 1YHFA 2D3RA 4OHZA 1O3TA 1VJ2A 2ZAAA 4XBQA 3V0AA 3D8CA 3EO6A 1HDKA 4F3JA 2JG8B 3O14A 1W6QA 1O3RA 3B00A 2BBVA 4LEJA 1U12A 3WR0A 3LA2A 2WT0A 5CFCA 1AL23 1VBD2 4XFCA 1OA2A 3WP5A 1QOTA 5TSWA 4S2FA 4CP2A 1Q5OA 4KL1A 1DU3D 4LBLA 3ZFFC 1GBGA 5B2GB 2VNRA 5BNOC 2UWCA 4JGZC 3M8LA 4Q8LA 5GLZA 1BVP1 2WT1A 1YUDA 3ZFGB 1EP0A 3J4UH 1LODA 5DUWA 5LK7B 3N4MA 1RUJ1 1AX0A 2C9AA 2A5ZA 4M3CE 1I6XA 3S6PA 4E4ZA 5FLIA 4XMAA 2RS11 2RS52 1DQ0A 2A70A 3MI8A 4YLZA 5K7PA 2VOWA 1C4RA 2GSYA 5T5OA 3NAPB 5JIAA 2OW4A 5BNNA 1TMF3 1RUC3 4CEWB 4I02A 3WG4A 3IDBB 2ZX0A 1V9U3 1F31A 1CJPA 1FNYA 4XXAA 3MIDA 3PJYA 4W6WA 1DZTA 1WCKA 1A8DA 3ZSMA 5J09A 2YGMA 1FOD1 2QFEA 2DFCA 4Y24A 4HVOA 1NXD1 3SLIA 1K5MC 2JECA 4H14A 1AX1A 4XIKA 4BIFA 3DKWA 2WWSA 1SBFA 3FLPA 3GZTB 4R9DA 5GM0A 2ZJCA 4P9XA 4OUSA 5FDBA 4OHYA 1QDCA 4RGGA 5DUVA 1R083 4XILA 1QKQA 3A0KA 2CTVA 4KQ7A 2D6NA 4COYA 2R32A 1UL9A 4CP0A 1QJZA 4LBNA 4Q2FA 5C9AA 1H8TB 3RSJA 3M3CA 2QQPA 2C1FA 3HT1A 5T50A 3FMGA 1V6KA 2E6VA 5JR7B 1OLQA 2ZGQA 2BWCA 1AX2A 2ZGOA 5CVRA 3UL2A 5JDBA 4LUMA 2PYTA 1PO11 2Q30A 3C3VA 2ZGTA 1PZ8A 1WMEA 2B5HA 2XPJA 2DCTA 3BALA 5E89A 3MLLA 1RUI1 3NW4A 2W0XA 4QT6A 3TNQA 1BYHA 3VZNA 1UIKA 2D44A 3E6DA 5FBZA 5C8CA 4B4QA 5BXXA 4ZU5A 3GF6A 1KJLA 2WZR3 3WW4A 1O5LA 2VOKA 1HRV1 4FPFA 5BV6A 3TRSB 2P37A 3KCCA 4LNVA 3INAA 3EQEA 4RSUA 4NVPA 2VG9A 4YZ4A 1BEV2 1RVF2 1VBC3 4HFSA 4OZXA 1ENXA 1GICA 4A3XA 5HI0A 1LOCA 3R4DB 3FHIB 1LEDA 3MYXA 3ZXKA 3ZIXA 2WT2A 3AFKA 2CYFA 3M3OA 4HKOA 1NCQA 1CQ9A 3VBOC 5EWSA 3M70A 4Y20A 4QMAA 4FP2A 1WD3A 5GLWA 4COUA 2OA2A 1IOAA 1NY72 2YROA 3M2MA 1UX6A 3RWNA 1AF9A 4JCKA 4PIZA 4XBLA 4AQ2A 1F8VA 2R30A 4Q4X2 2RMU3 4AEMA 1ASJ3 1ZZ8A 2CWSA 3ALQA 4I0AA 3ZFFB 5BNOB 4IEOA 2ZKLA 4LE4A 1N3QA 3JBG2 5AFEA 4XQ4A 3B5LB 2ZZQA 4XFBA 5KHIA 2WNUC 1CAUB 4TSVA 2GN7A 2XJTA 1AR71 2GMMA 5A32A 2GDFA 4FCAA 3WCRA 4PIXA 1VP6A 4NWWA 1WW7A 3IM0A 3SCFA 1H1IA 5JI7A 1ZX5A 4X6RB 1JYCA 3R05A 4LUKA 4Y5Z0 3E6BA 2ZGSA 2WFPA 4FO9A 1Q8QA 2HWD3 2R071 1RUOA 3ZN6A 2VPVA 2ZZJA 2CAVA 3WG2A 1S0GA 4CDUA 2NYYA 2DUQA 1CPNA 1QWRA 2NMNA 5DZFA 4Q4Y2 1DGLA 1AYN3 1WMFA 4YGDA 3VBHC 1Q3EA 2GNDA 5H9RA 4YG3A 4RS5C 4XQWA 3V0BA 4Q4V1 5JVVA 1C28A 1HQWA 3GBWA 1IS4A 4K40A 2XJQA 5IT6A 3VKOA 3AKQA 4B4RA 1UPSA 3DV8A 2E63A 5FO8B 1HV1A 5GLUA 4JV4A 1AHSA 2LM3A 3VKNA 1U5XA 2GH8A 3WP3A 2O8OA 3SH4A 3MIBA 2R041 4N53B 3RG0A 5J7MA 1YLLA 4DY5A 5T5JA 3P3PA 2WA3A 1RINA 3L9JT 1HW5A 2QCSB 4AVTA 1RL3A 2WSVA 3AKTA 1RUE3 4HZFA 4QPGC 2UYAA 1UCXA 1R1A3 3PLQA 3WZ1A 1ZZ7A 2E9QA 4GH4A 2W68A 4IEQA 3LAGA 3ZXLA 2WINB 2HWB2 3OGJA 2JE9A 4L99A 3FLTA 4DRRA 3WW2A 4Y26A 1VALA 4QXKA 2RS51 3B02A 2CGOA 3OF1A 1QHDA 3LSEA 4QQLA 5E16A 2ZCWA 2DF7A 4DOUA 3KCYA 4GKYA 5J48A 2OZ6A 2F4PA 2ZABA 3CL1A 3ZXFA 4F8AA 1XNDA 4AQTA 1KITA 4HK8A 4Z1VA 5I8YA 1NCRC 5ABJC 4EJRA 2A71A 3N7MA 1RMU2 1UU4A 3FUOA 1PO23 1VBA2 3VBOB 4C0BA 1MS1A 3AM2A 3B94A 3PTYA 5A33B 4B3NA 5CG9A 2WKKA 2XJSA 4P9WA 1AUYA 1PNGA 4IV1A 1GQHA 1VAVA 1VRH3 5GZFA 3DN7A 3FFQA 4YVSA 5F6LB 1X8EA 1S0IA 4YSFA 3DPRB 2D6OX 4RR3C 2H0BA 4XFAA 4UW6A 1HIXA 5SV5A 1GV9A 1QJX2 2RR12 2WNUB 1WLDA 4G3YC 4HANA 4Q0QA 1O4TA 2R49A 3SCHA 4CZSA 2X29A 4QD2A 1YFYA 3E5UA 4DRVA 4RQPA 3VBFA 5CFDB 3HIFA 4BPZA 4QM8A 5LK5A 3JCIA 4YG0A 4IQPA 1DF0A 2HWC2 3MDPA 2FMDA 1ZBA3 1D4M3 2Y0OA 4LA2A 5CG8A 4I2OA 2X5IC 2RM23 2D43A 1MR5A 4CDWC 4D7YA 2GC3A 4IEZA 4QGMA 4XMIA 3AJYA 2R1BA 4MYEA 4NOTA 5KC6A 3CU7A 3GALA 4FPOB 4BLIA 2BEOA 1MZ6A 1LHOA 1Q43A 4Y1YA 1XE7A 2ERFA 2FZ2A 1RB8G 3JZVA 1GNHA 3VBHB 4ZKTB 1S0BA 4XJUA 3ZYGA 1AJOA 4RS5B 5E1RA 4WM7C 1RVF1 1NA1C 1YI7A 4FT8A 5CAZA 3JB8A 1MACA 4D3WA 1GYKA 3KLSA 4IV3C 4B29A 3WQ0A 4FPYA 1C8M3 3ZYIB 1RUNA 3NJZA 3WUCA 3ZYPA 3AP4A 2DYCA 1FT9A 3I2DA 3MPPG 2PA7A 2LUWA 1X7NA 1FMD3 1NY71 2C0ZA 2WS93 1YFWA 4OUMA 1NLRA 4AFBA 1QQP3 3PVOA 4DZGA 4Q4X1 1WCSA 1H9WA 5J96B 5ACA2 4ZXKA 2WNVA 3APBA 4QPIC 4R4XA 4MX3A 1RUD3 3E5QA 4MGKE 3QACA 4QQ2A 1JUIA 1B35B 5I0SA 2I45A 4LR4A 2Q4SA 3N7KA 5FPXA 4HETA 4JGYC 1HXS3 3UJQA 2DUOA 5EYXA 4FXGB 1ENRA 1AXKA 1W6OB 3VLBB 4MLOA 3VBSC 1LEMA 2A6YA 4Q4W2 3D4KA 3KSCA 3NO8A 3OYWA 2ARBA 3R4UA 3H9AA 4PBPA 2ZMNA 4PLNA 4EWAA 1YRZA 3J9SA 1LESA 5FQ0B 1FOD2 1DZQA 5DUUA 1KS4A 4Z92B 1HV0A 1RUJ3 3AKRA 4COWA 1R092 4IEUA 2ZACA 1QDOA 3AP6A 1SQ4A 1S0CA 1NCRB 5ABJB 4RFT0 1KQRA 3SNMA 3FE5A 3PNAA 1MS8A 4M3CA 1H30A 4Q4Y1 2BGCA 4XIOA 1URXA 3GHNA 4RL7A 3LB9A 1X36A 1XNCA 2B46X 5D8AA 3WHTA 3JD72 1ZRFA 1BKZA 5KHHA 3L2YA 1AXYA 1TME1 1ZZCA 4RR3B 3CJXA 4ASMB 4CDQB 4HKLA 3AZXA 5GLTA 2O0OA 2NQYA 3VBUC 1RUI2 3RJ2X 1CAVB 4IETA 2O1QA 4LO5B 3VZLA 3ZN5A 3FX3A 3NKTA 2IWGB 2B9UA 1XNBA 3NV2A 4LHLA