3VZOA

Crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) n35h mutant with glu78 covalently bonded to 2-deoxy-2-fluoro-xylobiose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGHFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Endo-1,4-beta-xylanase
publication title Strategies for modulating the pH-dependent activity of a family 11 glycoside hydrolase
pubmed doi rcsb
source organism Bacillus circulans
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vzoA00
2DFCA 1W2UA 2Z79A 3AMMA 3EXUA 2QZ2A 1H8VA 2VG9A 2BWAA 2DCZA 1NLRA 1UU4A 1BK1A 3WQ7A 4S2DA 2JICA 3VHOA 3VZLA 4H7MA 1UKRA 3VL8A 1REEA 2B45X 3AKQA 4HKWA 5K9YA 1QH6A 1UU6A 2VULA 2NLRA 2B42B 3B5LB 4XPVA 1AXKA 3MFCA 2VGDA 4NPRA 1IGOA 3LB9A 3VZKA 4XQDA 4XQWA 1OLQA 1HV1A 4HKOA 3WX5A 2VUJA 3WY6A 3MF6A 3AKPA 3AKSA 3AMHA 2QZ3A 3WQ1A 4S2HA 2JENA 1BVVA 1KS5A 1BCXA 1XNBA 3MF9A 2D97A 3AMNA 3AMPA 3MFAA 2NQYA 1XNCA 1ENXA 1F5JA 4HK9A 3B7MA 2D98A 3VHNA 5EJ3A 3WXPA 1OLRA 3O7OA 2DFBA 5K7PA 3HD8B 3RI8A 4HKLA 1H4HA 3WP5A 2DCJA 3VZMA 3VLBB 1QH7A 1YNAA 1TE1B 5HXVA 3RI9A 3WP6A 3WR0A 1KS4A 1HV0A 2BWCA 3AMQA 4IXLA 1PVXA 1REDA 3WP3A 1OA2A 1XYNA 2DCYA 1H0BA 3WP4A 2JEMA 1XXNA 1XYOA 2F6BA 4S2GA 2DCKA 1UU5A 3VZNA 1C5HA 4XQ4A 3M4FA 2C1FA 4HK8A 3VGIA 1HIXA 1OA4A 3AKRA 3AKTA 2B46X 1H1AA 2BVVA 1OA3A 3WT3A 1XYPA 1M4WA 1C5IA 3VZJA 1REFA 3LGRA 3VL9A 3WQ0A 1H4GA 3VZOA 3VHPA 1T6GC 3ZSEA 2BW8A 4S2FA 1XNKA 1XNDA
chains in the Genus database with same CATH superfamily
2HWE2 4QMAA 4Y24A 4PLOA 4CDWC 4MHRA 5IUQA 3WF3A 4ATFA 2EXHA 1XSQA 3B02A 1PNFA 3B93A 5GLTA 5I0RA 1QNWA 1SLBA 1X33A 5EJ1B 2P3JA 3LKJA 1YXWA 4Y26A 2VQTA 3FN9A 4KU8A 3VKLA 4GXLA 3N9OA 4HBNA 1Z7S2 2PQQA 1XU1A 2HWF3 4XCAA 1IQDC 1W2OA 3IPVA 5DABA 1F31A 2QQOA 3C7GA 3MEPA 1TEIA 3J9SA 5FY1A 4BU2A 2XKPA 4PIYA 5BNPA 3I2JA 1RUD3 3THTA 1DGLA 1PO23 2GAUA 1ZBE1 2VGDA 2WFF2 3C8XA 3H0OA 3HBZA 2WNVA 3LE0A 1VRBA 4META 3W9AA 2TUNA 1W05A 5C7GA 5KC5A 2WN3A 1UYZA 3BTZA 2BFUS 4QKFA 4XYXA 4JC1A 2D6OX 3ILRA 3MIHA 3I3QA 4RHV3 4EE2A 2R1BA 2VH9A 4ES9A 5I0DA 4U36A 3SISA 4BQ1A 4RQPC 5C3QA 5GZGA 2VE1A 5CBLA 5F6KA 4GMP3 4QWNA 1QXJA 1W0PA 3V0BB 1AYM2 1UMHA 2NQYA 3GBWA 5DN2A 1XNCA 4LQRA 3J8F1 1LOFC 3MW4A 2UYBA 3NJZA 5FKCA 1PO12 4YNIA 5FPAA 1GNYA 2HH9A 5T54A 2OIIA 3ETPA 4BLJA 1GOHA 2ETEA 2P37A 5BPXA 3WEZA 3HPNA 1IZ3A 1MACA 1Z0HA 4FCAA 1VAVA 4CDUA 2PHXA 1Q3EA 3FFQA 2RS53 3DXTA 1NKGA 4AI3A 3MIEA 4A7YA 1DF0A 4QGLA 2AACA 4QX3A 1U5IA 3NJYA 2YC0A 4CP1A 1XE7A 2SBAA 1RB8G 4MGYE 5FZCA 2QDNA 4F3JA 2WZEA 1S0DA 1QQP2 3WD5A 4QKDA 5JMCA 3R4UA 2QCSB 3RZJA 2GSYA 2JXAA 2WYFA 3ZOIA 3JXSA 3IPVB 3OB8A 4XF9A 4P08A 4YYOA 4AI9A 3O5SA 1SG3A 4MGQA 1H6YA 2V73A 5BNPB 5C9AB 1Q8PA 5A7PA 4R9BA 3I7DA 3POEA 4EN6B 4EV0A 4LBKA 2WS91 4URAA 5A3LA 2FDIA 4Q0SA 3PL0A 3AKRA 4UOJA 3NV3A 1BBT2 1VAMA 3EO6A 1QWRA 1W6MA 1P8JA 1ZRRA 3AK0A 4IV1A 1EV12 1NUKA 1SQ4A 3T0DA 3RDIA 4Y20A 2YV8A 4B29A 1VBB1 3ZR6A 1M4WA 2B4KA 2X5IA 5G04L 2EVXA 3HN1A 4M00A 1UYYA 1DZTA 5SV8A 2YFZA 2WNOA 4E4SA 1FPN2 1Y4WA 3WUCA 5A1AA 3MIBA 1Y3TA 1BMV1 2RJKA 1FMD2 3KM5A 3O14A 2QQPA 1UO9A 4Z92B 4HFSA 4R4ZA 1BZWA 2JKXA 1VBA3 2MHFA 2WNUC 5FYSA 3WW3A 1IS5A 3GBGA 4TLFA 5JOXA 1MS4A 2ZGSA 3P6BA 3B00A 2V72A 1NZIA 3JQWA 1AL22 1PGSA 4LKDA 4QX5A 4NR1A 3ZM8A 1H8VA 4CDUB 2CYFA 3FHAA 3OGVA 2BPA2 3BCWA 1LOEA 1V6LA 5JAXA 2XBO2 5LA9A 3ZYJB 3POJA 1A8MA 4LNVA 2YGMA 2Y0IA 4F7ZA 5KWRA 1WCUA 1V9U2 2JDAA 5FWJA 3ATGA 1ENSA 3D5OA 5FFOC 5DQ0A 3AKQA 3ZX7A 5L19A 2PQSA 4UI9L 4G9SB 4XPVA 1VBD2 1JYCA 2R041 1RMU3 2CL2A 4OMCA 2DVBA 2RR13 4PI0A 3WCRA 4NUBA 5LATA 1C1LA 4TXWA 3S5AA 5KHGA 1DHKB 1RUJ1 1OKOA 2AEYA 4JAAA 2B9VA 1AX2A 1W6MB 4GA9A 2D3PA 4YW2A 5FZHA 4KWUA 3SCFA 4HN0A 1XNBA 2J1SA 3MF9A 4URTA 4JDNA 4IV1B 4W6WA 1LTEA 4BE3A 5C3SA 1AF9A 2ZPXA 3V65A 5A3TA 3ORJA 5A7WA 5FIXA 3ZKYA 2X5IB 3RJRA 5BV6A 5CEHA 3NWKA 4NMIA 5FZGA 4XUPA 2IUWA 3IIIA 3QBQA 5DG1A 5FP7A 4RR3A 1PGL2 4CEWC 1CN1A 1SCRA 2BEOA 2QFEA 5FXVA 1OLRA 1CIWA 4BJ0A 4E2GA 2E53A 3KB5A 1NCRC 4OULA 1J3QA 1H4HA 1RTVA 2O14A 2VTXJ 3JD71 3VDDC 3N4MA 5ISLA 1PVC1 3BALA 4UW4A 4A3ZA 1ASJ3 5FY7A 1FOD1 1S4CA 2VAUA 4XUOA 1RUC3 3IZOA 4IEYA 5FYYA 3ACIA 4Q4V1 1J3PA 4Y1ZA 2DURA 3DGTA 2WWSA 3N9MA 3X29B 5DDJ3 3C7FA 4Q0VA 2E9QA 1QJX2 5FQ0A 2OW4A 2AH2A 4O65A 4Z2WA 1CZVA 2IXCA 4LPLA 3ZFEC 2JDPA 3GCXA 5FO8B 1GU3A 1HQNA 1N3QA 2O8OA 4CP0A 4ZZ5A 5JOYA 5LWBA 4X6RB 2WKKA 1QNYA 3POWA 1AYN1 2VNVA 4J1WA 2Q8OA 3MICA 4OMDA 2EICA 5IVFA 1PX4A 2CNAA 3ZYBA 3Q8AA 3NNMA 1GFF2 1HRV3 2WO2A 1RUI3 1VR3A 3H1YA 2WNEA 4FPLA 1WBLA 3KV4A 3MV11 5FPLA 3KV6A 3W5MA 2Y64A 3PIGA 3FUQA 4Z82A 1WW7A 4CDQA 2A6YA 3AXDA 2OA2A 2W08A 5FMBA 4MX3A 4GIQA 4A7KA 1AR73 3PVBB 4PLNA 5FY5A 1FV3A 4K7JA 1WZXA 4J1XA 2E7AA 4RR3B 2VR4A 3E6CC 4EZ4A 4P5YA 4CYDA 4C0BA 3N36A 2W95A 4N7IA 4QM8A 1FNYA 3NMBA 3AMMA 2C5DA 1S0IA 2OZ6A 5K4LA 3OD0A 4JTNA 3UGHA 4K9SA 2R7EB 5ABJC 5BNNA 1NX9A 5LA0A 4HANA 5JIUA 2ZCWA 2L9LA 3HAGA 4FFGA 3SCGA 3SMHA 4FP3A 3Q8BA 5FQ0B 3K75B 5J09A 1NG0A 2DWRA 5FMCA 1AX1A 1E5SA 3S30A 2HWD1 3NV1A 2JG8A 2VC9A 3SXWA 4LBQD 2XPJA 3ZXFA 4WVVA 1LNSA 3AYAA 3NNJA 2E51A 4M01A 4K20A 1CESA 4AEDA 1XJAA 3FZ3A 2CDOA 5CKNA 4FO9A 1ULFA 4A4AA 2WJSA 2W52A 1AHSA 1LESA 4AOCA 3OBAA 5IK7A 3LOBA 1PGW1 1Q5OA 5IATA 4LOTA 4Q26A 1KDKA 1UOBA 4PJYA 2ZKLA 2LROA 1YQ8A 1IG0A 2SLIA 5CISA 1AR83 1TNFA 2NMOA 5FY0A 2W1SA 5A33A 3U78A 1BXHA 4MZUA 4CDQB 3WDWA 1XNTA 1AZDA 1G9FA 5BNQA 5HI0A 4IEWA 2C24A 3AZWA 3BN6A 4PIXA 3ZYHA 5IAXA 1G9AA 2FDGA 1OF4A 1S2KA 2UY9A 1TQ5A 1F2NA 1UPIA 5EP9A 3PU3A 4HONA 3L9JT 1ZBE2 2NM1A 4CXYA 2Y26A 3U37A 4MADA 1R091 4HLTA 4EJRA 2NP0A 1W6QA 1VIWB 5T5JA 4CXXA 2C6SA 3ZDSA 5HCAA 3FMGA 4QGNA 5KC6A 1LEDA 1SBEA 2Z4FA 4AEMA 4KGGA 3CLPA 1A3KA 1BHGA 5LASA 5LK5A 2VW2A 4BISA 5BNNB 1ZZCA 3RS6A 4ZKTB 1QJY3 5FPBA 4DQAA 2D40A 2XVGA 3DXUA 3WNKA 2VTFA 5JOZA 4BQYA 3WW1A 4GWNA 4CPBD 1XBFA 1HB2A 4LA2A 2JG8B 3J8F2 5DZGA 4KNCA 1AR61 4AFDA 1ZRIA 2PHDA 3TYJA 4AEDB 4IGPA 3BU7A 1UY0A 1DP0A 2A3YA 1MR5A 3M2MA 3GBFA 3AKTA 1HN1A 2XWJB 1YFWA 4ZPIA 1JS9A 2R073 4XETA 4OLLA 4QX7A 4OI0A 1B09A 1HJFA 2C0ZA 3C7OA 3H8UA 5FYZA 3FL7A 3PU8A 4NHMA 3BTAA 4AAXA 1BEV1 3UKNA 2NZ9A 1EAH1 1GMMA 1O6UA 4AHXA 5A33B 3D6EA 2RDRA 4YVSA 4L99A 2PN5A 3ZSJA 1CR7A 2DTYA 3LEGA 1LRHA 1DGWX 4QHBA 2Y38A 4I0AA 2A6ZA 2RJ2A 4HVRA 4K6BA 4FQZA 5FMOL 1H2KA 3RYPA 3ZFFC 4CZSA 2ZABA 2PYTA 3KT1A 2KM2A 1JYXA 1PIV1 2DFCA 2XLAA 2D6LX 3NSTA 3MW2A 3BIEA 5FZBA 2D44A 2VXJA 3FE5A 5FYCA 4QX0A 2WS92 1UXZA 1H2LA 1W6QB 3E5QA 4PF1A 4XURA 3H50A 3NKGA 4XUTA 3UKTA 1NQDA 3O0WA 5FZ9A 4S2DA 2EXKA 4QB6A 4LA3A 2FZ2A 2XJUA 3POBA 3VKMA 1RXGA 2RDNA 4L92A 4ATEA 5I0UA 5F3CA 4UW6A 1ZRFA 5EIYB 1LGCA 4HSLA 1ULCA 1VBB2 3FFZA 1VRH3 3PTYA 4Z2AA 5A1LA 3CMGA 3HJRA 2YC4A 4BCUA 1Z78A 4TSVA 5CFDA 1US3A 3U75A 1S0JA 1ZREA 1UYPA 1YYNA 2ZAHA 3VZKA 1BMV2 2J42A 4XQWA 2CWSA 2XR4A 2J1AA 3MF6A 4H7LA 1OXCA 1WA6X 1CGPA 5L7OA 3BTXA 4LUMA 2JB8A 5FYVA 5IJRA 2B7YA 3FLRA 2JDNA 2YPDA 5JI7A 3TN93 2YU1A 3UV9A 5DAWA 4Z1VA 5F5CA 1YCIA 2TEPA 3CF6E 4AXOA 4LR4A 1H8TC 2WT2A 3HN3A 2BRTA 3N9PA 3MPBA 2XJQA 1NCQC 3Q8EA 5KHKA 3K2OA 1PO11 2AZ5A 2P1BA 3CJXA 4YVSB 1X9PA 2ZS6B 3B7MA 1XE0A 3H1WA 4UFMA 5EJ3A 3UT0A 2RVAA 4BQ4A 3AZVA 3QACA 5AC93 1ZZBA 4N53A 5FV3A 1YWKA 5CFCC 2R042 2MEV1 2XG3A 4LBNA 4KBZA 4DOUA 3DF0A 4AHYA 4AQTA 3FJSA 5FXZA 1TE1B 5FZFA 1KITA 5CZKA 4LITA 1JODA 1RUJ2 3WUDA 1V70A 4EQVA 3D0SA 4XHBA 5E16A 3T1MA 1L7QA 1PMJX 1REDA 2BNMA 2ET1A 2R0FA 5F3IA 3DYOA 4XDPA 5EYXA 5FYUA 1KDMA 3WCSA 4K8FA 1R083 1NYWA 2VZ1A 3KWVA 4LHKA 1RYYA 5I93A 4XFHA 4Y5TA 3MI8A 1JOJA 3PUIA 5FMOS 3U4SA 4HT1T 5CFDB 2ILMA 2VNRA 3DL3A 1OLMA 3BIWE 1C8M1 2JIGA 3I2DA 2FBEA 1HXS1 2VMCA 1W6OA 4XHXA 1TME1 1US2A 2C9AA 2QQLA 3IWZA 4CUCA 2XB6C 4WVZA 5LCWL 1HKDA 2AENA 5L7OB 1OH3A 1PVC2 3PLQA 4HMZA 5C4WA 1ST8A 4NAOA 1FOD2 4XMAA 2FMDA 1LHNA 4ZXEA 5IK5A 1JYTA 3FHIB 1XOYA 1U5YA 2P34A 2RS13 5FXWA 1WCKA 3WV6A 4AR2A 4CU7A 4Q4V2 1Q8QA 1UNBA 4LHLA 2VBPA 1O91A 4RGGA 3I2GA 3VZOA 3WQ0A 5IVCA 5FK7A 4JHTA 3RRDA 2GNTA 1AVBA 3VZJA 4YSFA 1V6OA 2HLEA 1F15A 3I3BA 5JSRA 3OEAA 1QOTA 2AYHA 5KHHA 1GZWA 1UOJA 1QOSA 3VD4A 2XUMA 1JBCA 1CZSA 3N9QA 3CEWA 1XNDA 4FTSA 1SACA 2WL1A 5FCCA 4ASLA 3TEZA 2WWJA 4N53B 4AWDA 4Y22A 1AYN2 4BQXA 5JSPA 2VOXA 1QJZA 2QZ2A 4MSVA 1QJU1 2YU2A 5A7OA 3QH7A 1ZZ6A 4FPCA 4W65A 4XJ9A 5FBJA 4FTBA 1V9U1 2P17A 1CAVA 2JICA 4GB32 4QXKA 3VHOA 3SNMA 3HWJA 4BQ5A 1VBC1 2TNFA 1JI6A 4LORA 4NHXA 4ARYA 1QH6A 5JI9A 1LB2A 3LA7A 2NLRA 2B42B 2JDMA 4Q1RA 2VXRA 1XNAA 3AP7A 5LA2A 3DN7A 1JHNA 5FR3A 2XWBB 3LPGA 3OY8A 4GH4C 4XABA 5AFEA 3A21A 3E6BA 5K0UC 1KQRA 4NPMA 2A75A 3AZXA 1O7FA 1CX1A 1KFUL 1RINA 1W6OB 1GICA 2RHPA 4L11A 4N43A 3GHNA 2A6VA 2HWC3 4S2HA 5CG9A 4R9CA 4IEOA 3VD3A 2V5YA 1WCDJ 5C4WB 2ZJCA 4IE7A 5F9TA 2CSGA 4RD7A 4IE6A 5A7SA 1OUSA 3RPQA 2Q30A 4IEZA 1A6CA 2RM23 3AMPA 3D4KA 3AVRA 1QQP3 2VY0A 4KWKA 2W5FA 2UURA 2X10A 3IMMA 1W04A 2WLPA 5IFPA 4D3WA 1FAYA 1Q8OA 3CL1A 1MS1A 3EYPA 4IW3A 4K1YA 5GM0A 5FPUA 5GLZA 3E5XA 1GZWB 2HWD2 1GP4A 3RYRA 2HKXA 3LFIA 4GWJA 5E88A 4D69A 4B3NA 4AVSA 4BDVB 5JR2A 2MNGA 1BBT3 4Y22B 1G9DA 5FZEA 5IWFA 1TVGA 2FCTA 3LF7A 5L73A 4W50A 1UY4A 1AUYA 1U5ZA 1LGNA 3QCWA 3WP6A 3ZMOA 5GZDA 1QJX1 2VL4A 1RJ8A 2ZGTA 2W91A 3BKZA 3LDKA 5KHJA 2XL9A 1UZVA 3HR9A 1CAVB 3H1MA 1FPN3 1L7RA 1OF3A 4CDWA 4Y1YA 3NJVA 3NO8A 1FMD3 2WFPA 3E5UA 1UZZA 4FAGA 1H0BA 2ZGPA 1Q8SA 4MLOA 4NIDA 5EHDA 1OD5A 5C3OA 1X8EA 4TWTA 1NAEA 1SCSA 3OY8B 4QPGA 2IC1A 2WYSA 2YXSA 2JX9A 2JKBA 2D5HA 2BU9A 1HW5A 1HQWA 5I0TA 3PUAA 1FXZA 4HOOA 3U11A 1N3OA 2ZTNA 4P9GA 1OOPA 4OVEA 2RMU3 2DV9A 4N43B 2XBO3 1R092 2VQAA 1OVPA 1GWKA 4DIQA 1JZ5A 1MS0A 4XXAA 4SBVA 1OUXA 4AGRA 1RUD1 3UL2A 1PO21 3LD8A 3EMRA 1XPWA 3HIFA 1VBD3 4M4RA 4FTEA 1I5PA 3ZR5A 2IWGB 4YLZA 1POV0 2BW8A 2RS32 4DY5A 5FZLA 4RHV1 1MEC3 5IVVA 2OQ6A 2XDVA 2J7MA 2E32A 1RGSA 1F9KA 1QXPA 4OUMA 2BP6A 4RFT0 1R1A1 3TAYA 2CGPA 1OQDA 4NROA 1AR62 3VD5A 2Q1MA 2UY8A 2Q8DA 3ZPOA 2JDYA 3K48A 4GWMA 4QQPA 1XQNA 4ZS2A 4NIAA 5I0SA 1AL0G 2WABA 4QD2A 2V09A 4RSUA 3ITQA 1TMF3 4Q4Y3 1YQ2A 4MVTA 4DRVA 1HB1A 3A22A 3D0JA 4XUNA 1BEV2 3J4UH 1PK6C 2VVEA 4Q4W1 1RUE3 1EAH2 3OCPA 3WDYA 4Y1VA 4CDWB 4KMQA 5K9YA 2D43A 5M0TA 4DUVA 3TEYA 2E7QA 1W3XA 4EN0A 4NJ4A 3FBYA 4E2SA 4DUWA 1S2EA 4CCDA 1JZ7A 1PZ9A 3RZKA 1OLQA 3M70A 5DAPA 2GNDA 1EYBA 2WO3A 2YPJA 1RUH2 3WX5A 2A3WA 2VCCA 3DCQA 4ISRA 4QPGB 4XF4A 3K51A 5KXBA 1JZ6A 1PIV2 3OBRA 2ZGOA 4B8EA 4CDXA 4COYA 4ET7A 5A3UA 3MLKA 1OOPB 3MW3A 3ZYGA 1CWPA 1DQ6A 1YIPA 5F3GA 4B7KA 1COV3 3ACFA 3AP9A 4ISQA 1QU0A 4BK5A 1K5MC 1OH4A 1WMEA 3ECQA 4KL1A 3HT1A 4OCTA 2QUOA 1ZYBA 5JZGC 2ZEWA 1A78A 3D8CA 1VJ2A 3E6DA 2PHWA 2PFWA 5FUNA 4AEKA 2CWMA 1MZEA 1BJQA 3R4SA 3B01A 4LBLA 4QQLA 1ONAA 4I2OA 3MUZ1 4C91A 4NHYA 5C9AA 1UXXX 4B4RA 5FPVA 4IQPA 5FOJB 4XEZA 5K7PA 1UF2C 1U12A 4JGZC 3VZMA 2JE7A 2VD7A 1CONA 2VMEA 3NV4A 1I9RA 3VBSA 1LHVA 4IEQA 2XKOA 4XFFA 2WO1A 1RUG3 2XONA 4CUGA 4D7YA 3A7QA 4JDMA 3ZN6A 3PIJA 2GH2A 2WNUA 4A2UA 1N47A 3MLJA 2F4LA 5E1RA 5FYTA 4MHUA 4TTGA 2CHHA 1QY4A 4LO7A 5DG2A 1RUF2 2Q0AA 4Q0PA 3WNLA 1O4YA 3POFA 3V64A 3VBHC 3WDUA 4BQ2A 5J96B 1XXNA 4LO8A 5EXOA 1LAJA 2IXKA 3VBRC 4AF9A 1UCXA 3LA2A 1ULGA 2ARAA 2BERA 2P6HA 2VPVA 3VHRA 1ZBA1 3JUUA 5IVBA 1W03A 5FO7B 5LBFA 1HIXA 1D2SA 1POV1 3UYJA 3T4HB 4Q8LA 3W5NA 2MEV2 3DV8A 4CDXB 3NW4A 4PQQA 2OVUA 3UESA 2WAOA 3LGRA 4NE9A 3RZZA 1T6BX 2DVDA 2HBTA 2EAKA 4BQ3A 1RMU1 1YFYA 2JDHA 4WV8A 5LBCA 5T52A 4GALA 4V2VA 2RR11 3ZSEA 3M3IA 4ASKA 4W4ZA 5KXEA 4CEYA 3GJBA 1WGPA 1XNKA 3WW2A 2Z42A 3CO2A 1SDWA 1UIKA 3LFMA 4UT5A 4WZFA 5C6CA 4P9IA 3HOBA 1W28A 5LB6A 2PHRA 3BPSA 2A73B 1O59A 1C8M2 3T08A 4AFBA 3UNPA 1HXS2 2E7TA 2KR2A 2VBDA 1TME2 3AYCA 4ORFA 4SLIA 1UU4A 2J1RA 3VBSB 4CEWA 2GH8A 1AR91 4QDQA 2YUEA 3ZN6B 2WNUB 2WT0A 4JRLA 4XXPA 1E5IA 1B35A 4UF0A 1O3TA 1H6XA 1STMA 4KH9A 2CU5A 1ND2A 4D6RA 4DEQA 2ZA9A 3RYKA 2XVLA 1H1MA 1VB2A 2VO5A 2Y6FA 4NPRA 1GR3A 3A23A 1F4HA 3ALQA 3CKHA 4XQDA 4CEYC 2D5FA 1OSGA 3OGRA 4QDRA 4BWOA 4E8CA 2J1VA 2W87A 5L9BA 3V56A 3SITA 3JU9A 3ZFEA 2VVFA 3VKFC 5F2WA 5GJ6A 5I8TA 2VECA 1DYOA 2FDHA 2P3KA 4Q5OA 2WNVC 1BCXA 2DUPA 2JIJA 1QJU2 5FZOA 4LOSA 4L0PA 4QM9A 1DG6A 4JTOA 1WUVA 4QKNA 1IPKA 1MS5A 3WDXA 3ZN5A 4FXKB 4OUEA 2NMNA 2BDRA 2ZGMA 5FZ1A 2DVAA 5BY5A 3T2OA 1VBC2 2R062 1SDDB 4XFBA 4ASMB 3J8F3 4ZU5A 3S7IA 2E31A 4AW7A 2RG4A 4CEYB 1WBFA 5FLJA 3SH4A 3WG4A 5B2GB 5BYNA 1DQ2A 5A70A 2D6KA 1UZYA 2OT7A 4NRQA 1QH7A 4XF3A 1RUNA 3ES1A 2DBIA 4FPYA 5FY4A 4CEWB 4GZ9A 4D7TA 2WIIB 2YFUA 3ZSKA 1S55A 3DKQA 4AGGA 4EZHA 4MGZE 4TYSA 1J3RA 3WP3A 1ZA4A 3N3HA 1LJ7A 4CDUC 2JG9A 1AR71 4P00B 1W2AX 4BXFA 3VDDB 1B35B 1SFNA 4UF0B 3ST7A 4WM8A 5IK4A 4JGYA 1IS6A 2Y6HA 2CV6A 3GJAA 2B39A 1ND2B 3PNAA 5DUVA 4XFIA 4AE2A 4YZ2A 3P3PA 3U4XA 1GQGA 3VB9A 1H2MA 1YO8A 2JDKA 2OPKA 3GXUA 4XQ4A 3EQEA 1VB4A 4MO3M 2GZWA 4KWJA 1W9TA 1XU2A 2OQ7A 2VOTA 2WS93 4FOVA 5FREA 4YVWA 2P2KA 5AFBA 3ZFEB 1W90A 3ILNA 1UW8A 1NZCA 3ES4A 3WDVA 3MYXA 2XHKA 2NN8A 5FZOB 1QOOA 1REFA 1GZCA 3ZXAC 3KVBA 3GNEA 4R9DA 4P9XA 1K3IA 2OUHA 4UW5A 3GZEA 3VHPA 1UMZA 3DPRC 2AC1A 4IV1C 3F95A 1DQ0A 2D6PA 4BXSV 1OLME 5JDBA 4LE3A 1AXYA 1T2XA 2X5IC 4QHOA 3ZLIA 3B5LB 1D4M3 1W2TA 2QDRA 5DUUA 4IESA 3RSJA 1DFQA 1NLSA 3CJIC 1QEXA 1QDCA 1NXMA 2VMFA 2VZSA 3FLPA 4MOAA 4LHSA 4QQOA 4BIFA 5FZ0A 2BWAA 3ZXLA 4GB31 3BYWA 1HX6A 3H8OA 3CBNA 5FAXA 1W8WA 4OHXA 1IPJA 3VZLA 3Q8FA 4PDWA 1V6IA 4LULA 1WLDA 3AC0A 5GLWA 2JG9B 3OTFA 2Z69A 3RWKX 4JZRA 3TEXA 3OBTA 4LEJA 4CSWA 1SMVA 4IE4A 3U1XA 4WM8B 4JGYB 1OFSA 3CNAA 1W8HA 1RUD2 3NQHA 2G9ZA 1PO22 4XMIA 2WZR3 4N90A 3LB9A 4BA6A 3USSA 4LO6B 4NIGA 5JXHA 2GMEA 3PUHA 2VUJA 4DNYA 1ULPA 2ZX4A 4RHV2 1OURA 2Q1ZB 2Q1FA 2Y6GA 4IETA 4P9YA 5G05L 3S7EA 2BZDA 2ZXQA 1WA4A 1R1A2 1C3HA 4WM7A 4CRQA 1DIWA 2ZMLA 2VCAA 5CIRA 3N9LA 4YVWB 1RUJ3 3ZVXA 2ZGRA 5CU1A 4I0WB 3AMNA 4WZCA 1QJY1 3H7YA 3MGUA 5JUVA 2ZGNA 1CIYA 2QQWA 3AP5A 4COVA 2A1XA 1DGRN 4DO0A 3UJQA 2A6WA 1OC1A 1H30A 2GP3A 3J26N 4M0NA 4AFMA 3HNYM 1VALA 1S0FA 3H3UA 1QJFA 3NVCA 2PMWB 2WDBA 1URXA 4Q4W2 5EWSA 5FRAA 3C2UA 1VBE1 4EYUA 3L2YA 4LLOA 4NN0A 4HKLA 4LIVA 3MHZA 2G9GA 4K1ZA 2WA4A 4AVBA 4GAZA 4QKBA 2D3RA 2B9UA 4I3PA 3GZTB 4WBBA 3JD73 4RR3C 4YM2A 3RQ0A 2RS52 4BQWA 4C90A 5KXCA 4YW6A 4OFGA 1LKNA 4QPWA 3IBMA 2XMLA 3SEEA 5J1XA 5JXGA 1DQ4A 3LWCA 4L8QA 3WF1A 5JIAA 3ZXDA 3CQOA 2FDJA 4Q4V3 1PVXA 1JZ4A 3H3ZA 4PDWB 5CB7A 1WMDA 3NKTA 4BMEA 3GYDA 2WSVA 2DCYA 2Y0OA 1JHJA 5JCTA 1U5XA 4D8MA 2XQXA 3PJQA 3TNQA 2BGPA 4NO4A 1YJKA 1W9SA 1NE4A 3ZO0B 3ZXGA 4Z8BA 3AXEA 3U14A 2KXLA 5JMOA 3KF5A 3I2KA 4HK8A 4AL9A 5FZDA 1AYN3 4NVPA 5FPXA 3T0BA 4XIKA 3WOGA 2JD4A 1W99A 4K8RB 4MV2A 4BH9A 5BNOA 4WM7B 2BVVA 1ZRCA 2XJTA 4DEVA 3RG0A 3K77A 1VMFA 1ND3C 1KFXL 1VRH1 1RIRA 3THCA 3UGGA 4UW3A 3B69A 2Y6LA 3K3OA 4KU7A 4XJZA 3RVHA 3VL9A 1ZRDA 1S0BA 2QQMA 1HLCA 1PZ7A 3VDAA 3ZFGA 4KBBA 5A3PA 3C7EA 1LHOA 2PHFA 3WHUA 3VBUA 2RS31 2LW8A 1T6GC 1ULDA 1SLLA 1YQ5A 2OZJA 2VJXA 4C1WA 4CDQC 1QHDA 2WR9A 5E6HA 3VDBA 1W39A 4KG0A 4ZU7A 1W2NA 2YDEA 2D93A 5FY8A 1QMJA 3W20A 1H8TA 3EBRA 1SLTA 2DDUA 4U2AA 1DQ5A 1NCQA 2EXIA 3QH6A 4XFCA 3TN91 2A71A 3WF2A 5FOBB 4BZ4A 4Q4X3 5F32A 3NRUA 1ZBA2 3I54A 3ETQA 4LO4B 5IVYA 1W8OA 5IT6A 2PXJA 2ADDA 4I02A 2W0XA 3TOJA 4FP2A 5LW9A 5T5LA 4P9JA 1D7PM 3WNPA 3PUQA 2CDPA 2DBNA 4XFGA 3KS7A 4QPIC 5C5UA 4XW3A 2ARXA 1S0GA 3J7LA 2W1QA 2I07B 4L2NA 1MZ5A 5FZMA 5AC91 5L9VA 3C7HA 3OBZA 3RWNA 3I3MA 2VZOA 2Y34A 4YGEA 3BUCA 4OHYA 1YUDA 5BNNC 1RMU2 4DXSA 2D3SA 5T5OA 1RUH1 2AR6A 2RR12 1NT0A 3KGLA 4MGKE 3WY6A 3S5QA 3KHBA 3VV1A 4A45A 3S57A 3QD6A 2JB4A 1POQA 2VW1A 2YMZA 3AKSA 1SBFA 5FP3A 2WZPP 3ZSMA 2PLV1 4YM1A 3ASIA 4AZZA 2E26A 2JG8C 3WNXA 4E27A 3MIDA 3M7AA 2WT1A 5BNOB 3LQCA 2GALA 4AEDC 1RUOA 3DECA 1LODA 1R081 5FY9A 4Q29A 5A6XA 3PURA 1DYPA 1OHFA 2PAMA 1RVF1 2UWBA 2BYVE 2DU1A 3HEIA 1AR92 2WZ8A 5CYYA 5D8AA 4JRAA 5IHRA 3ZFGB 3POGA 5BUVA 3K4AA 3VBUB 5ERLA 3THPA 5ACA1 1J59A 3DYPA 3HD8B 5C8CA 3SKJE 3J7MA 1VPHA 3POYA 3ZPYA 3CHXA 1H8TB 3IAQA 3ZMNA 1DCSA 1NCQB 1JYWA 3SEPA 3IT8A 1MQTC 3JBG3 1ZNPA 4UWDA 1LGBA 1RUF1 2ZHLA 3CDZB 3H42B 2WWUA 4QQHA 4XBLA 2E6VA 3KT7A 3I97A 1I6XA 3ZXKA 4WVMA 1OA2A 4B4PA 2R49A 3NNGA 4IV3C 2IFWA 3WG2A 3O1UA 3WP4A 4FI9A 3U0ZA 1IKPA 1HJGA 3CU7A 2CGNA 4XJUA 3VZNA 4ITCA 4RL7A 2GDFA 3PDQA 2JECA 3ON7A 2QQVA 1AR63 1KGYA 2ET7A 3Q8CA 1JOBA 2HWB1 2VMDA 1S0EA 1GWLA 2A7AA 2J22A 3AFGA 3GDBA 3SLIA 4D6QA 1HRV2 5C5TA 5J48A 2R1DA 1RUI2 2FQPA 2Y6KA 2PHLA 4N9IA 3IMNA 4PT6A 2LALA 3P1IA 4HETA 2BBVA 3NJXA 4CUAA 2N7GA 5K0UA 3PHMA 4GULA 2A5ZA 2K2SA 2DYCA 5T55A 2DCTA 1LEMA 1BEV3 1RXFA 1VAKA 1APNA 2WAAA 4ARXA 5D8AB 3KMHA 1ZX5A 3ZIXA 1AR72 2QQUA 2LM3A 1HQLA 3BODA 4Y33A 1X7NA 1ACCA 1YI9A 1EUTA 5GLVA 4YW3A 2HWE3 1JTZX 1U0AA 4YVSC 5C8CB 2HWC1 1LULA 2CAUA 4XC9A 4BB3A 2GC0A 4KI5M 2FCUA 4YPJA 4M3CE 1PIV3 1W6PA 2H6BA 1SEFA 1W6NA 1D4VB 2ADEA 4N8MA 5B4XA 2RM21 1TNRA 1GP6A 4PLMA 3GGLA 2EF6A 2FCVA 2X29A 4QXBA 1UPSA 2ARBA 3UK9A 4ONUA 1DQ1A 3RZLA 4MUVA 3I4IA 1Z7S3 4EWDA 2A6XA 1HRI1 4HKWA 5E89A 1LOGA 2VMIA 4WVMB 4Y1UA 3ACLA 5FP4A 1VLNA 1UU6A 1K42A 2C26A 2JD9A 4CXWA 2DF7A 5A80A 5CAZA 1ODNA 1JU4A 1UAIA 2OPWA 2VMGA 2QNKA 4X6QB 2WFF3 1V6MA 4E4ZA 5JXJA 3VD9A 5J37A 1R1ZA 4BM8A 3KVAA 4DINB 2YY1A 1G86A 2UWAA 4HKOA 1XRUA 1L3JA 3WLUA 4XOGA 4DPNA 2EXJA 3T3YA 1DGWA 1EUUA 1GNZA 5CFDC 1RHI1 4LE4A 4LTAA 2Q8CA 2D6MA 3VBFC 2WN2A 3AL6A 1NA1A 2ZGLA 4NRMA 5K0UB 4GH4B 1GZTA 1AYM3 3TEWA 2R061 1CX4A 2GMPA 2XH6A 4LLFA 4P9WA 4UAPA 3AJZA 1F4AA 4YFZA 1G6NA 1PO13 1TZOA 5AVAA 1YLLA 3N7JA 4PI2A 4HSJA 1S2BA 1TG7A 3G6JB 2RMU1 5HCHA 2RDSA 3LSEA 5A3OA 5FLHA 1KJLA 3VLBB 5I91A 2BGCA 3W58A 4RS5A 3THDA 3UJOA 4ZHNA 3FHQA 1W6PB 2G4IA 2YZ4A 1V0AA 4MG2A 4HXCA 3KF3A 1W6NB 1WMFA 2W47A 3AB0A 4INDA 1CAXA 4XF0A 1HV0A 3AMQA 5ANQA 4IXLA 3NAPA 5GZEA 3UKVA 3ZDVA 1QJY2 1YFXA 2EA7A 4JKMA 4O9GA 2UU8A 1CD3G 3KT4A 1MEC1 2I2SA 2OS2A 2F6BA 2AUYA 1UU5A 4FVVA 4F83A 1C5HA 3MLLA 4YW7A 3MDPA 4PQ9A 4BLIA 2Y33A 1O3QA 1DDLA 1ODMA 1S0CA 1VBE2 3L2HA 3ZIWA 1NY71 2UWCA 5IK8A 1C8M3 5FYMA 3CIHA 2R072 1IHMA 3AP6A 4Q4Y1 1TME3 3AYEA 3VBOA 4UFLA 3AM2A 1EV13 3PVOA 3O1SA 1FYUA 2CY6A 1RUE1 4YGBA 4XF1A 3IKWA 1SPPA 2ERFA 1NA1B 1HB3A 1Q8VA 3WHTA 3OGJA 5H9PA 1GNHA 3MIGA 2Q8EA 2VQUA 5LEJA 1XC6A 2FDFA 4ZONA 4S2FA 4FPJA 2X05A 3W21A 3LEMA 2OKXA 1WW6A 2GU9A 3KD4A 1DZQA 1AL23 3MO4A 2EIGA 1BKZA 2R6QA 3HNBM 1COV1 5LY2A 2WUHA 4XE9A 5FZ3A 1CZTA 5JWPA 4RS5B 1OI6A 1YQ6A 1QJU3 3AL5A 5A1FA 3H8RA 1IKQA 1LCLA 4GWIA 5FYIA 1UKGA 2XQRA 1CAXB 3GM8A 4QPIA 5SV5A 1YIFA 2HWF1 1Y43B 1V9U3 3NAPB 4JGZA 1WWYA 4XILA 5CKQA 5DMYA 1VRH2 2B8MA 4IGOA 1N1SA 4XJ8A 2VULA 2VOKA 4ZY9A 3HQRA 4XFAA 1CAUA 4EN9B 3ABZA 5IAVA 2IZWA 2VNGA 1PMHX 4OQ9A 3LIHA 4XAAA 1A8DA 3RGBA 3V0AA 3VN4A 4RQPA 2C4XA 2QQJA 4GJYA 2BFUL 4XDOA 1HV1A 3BOPA 3ILFA 5F5AA 5I8YA 2ZBJA 1RUG1 3AKPA 3AMHA 1NE6A 1R64A 1YI7A 3NL1A 2QZ3A 4MGIE 4AI8A 4JQTA 5FYHA 2QQIA 1NXD1 1LOFA 3AFKA 4GMP1 1IPSA 1F5FA 1YRZA 3AJYA 3TN92 3VBOB 2VZRA 3DKWA 4YFWA 3VBRA 4LIUA 5EQUA 2X8KA 2KA3A 3O1PA 3W59A 1PHMA 1SPPB 2D6NA 4N43C 3BOWA 3ZSLA 2IXLA 1KEXA 3ZYRA 3M3QA 1Q56A 3FBMA 2O8QA 1YQCA 3IAPA 3LDRA 1QXRA 4X8PA 3FX3A 4E9KA 5FTTC 5CNAA 5AC92 3S6PA 1LU2A 2R0HA 5JR7B 3O1OA 3OEBA 3USUB 5GLUA 3R6SA 2GC3A 2DCJA 4HPKA 4O9EA 2LTNA 2RS51 5F7UA 4LK6A 5LEKA 1LHWA 4BPZA 5JZGB 4G3YC 1YNAA 5HXVA 3RI9A 4CCCA 4COWA 4F8AA 2PLV2 3T4VA 5JOWA 3LAGA 4QT6A 2ENRA 4TZDA 4DB5A 3KQ4B 1QJX3 2YGLA 2ZEZA 4QPIB 4CCMA 2AEZA 3O1RA 1R082 1RL3A 4JGZB 2ATFA 1LR5A 4Y1XA 4OUSA 4J25A 5F1RA 3CZJA 4UFKA 2R32A 1RVF2 2W39A 4LT5A 2YROA 4A41A 1CAUB 1O8SA 2HEWF 4DXZA 3V0AB 3M4FA 2RJLA 4M4PA 1L7LA 2C1FA 4LKSA 4RQPB 2JDUA 4PBOA 2LUWA 5ACA2 2FDKA 1O3SA 1J58A 1UOGA 2ZEYA 2B5HA 1QIQA 5HPOA 2BUKA 1JZ3A 3VBHB 4IE5A 2EIBA 2ZEXA 2XLFA 3MV01 2RS12 4QPGC 3VBRB 4GJZA 4OZOA 2VZ3A 4MXVA 5H9QA 1MVEA 2Y8KA 1X8MA 2DVFA 5A3MA 3IM0A 4YG0A 2ZHKA 1OOPC 3OPTA 3EJKA 4DUXA 1VBA1 2W2IA 3ZYIB 4ES8A 3QLQA 5LY1A 5FYBA 1ALYA 3TB0A 1KXGA 3LZZA 4CU9A 1SFPA 4IEVA 2YHJA 3D3AA 4V1PA 4MGSA 4P9LA 2H0BA 1W0OA 4YGDA 4AQSA 3WNOA 4HPKB 1R1A3 2GMMA 4GQ7A 2GNBA 2Q4SA 2VZTA 4WVWA 2IXHA 3BU0A 5KBFA 3OYWA 2HWB2 3I3DA 4M3CA 4QGMA 4CCKA 2O0OA 4RGAA 4I09A 1WD4A 3A4UA 3WQ7A 1N1VA 3MUY1 2ZHMA 5C3PA 3T2TA 1UKRA 3RZMA 3VL8A 1O5UA 1UX7A 5EYYA 2ZACA 3T2PA 2QE3A 4AEJA 1PX3A 4CU8A 1K12A 4Q4W3 4YGCA 1AXKA 3GZUC 2K9ZA 3EHKA 3R4DB 4HN1A 2XHNA 4XCBA 5FZKA 1S1AA 2WC2A 1AJOA 3U10A 2WLQA 3JB8A 1FATA 4YZ1A 1C4RA 5IVEA 4N7UA 3HQXA 2HWC2 2BVBA 3KCYA 4OHVA 2DVGA 3G7DA 3E1F1 4FFFA 1EPZA 2D97A 3I2OA 1UQXA 2P5BA 3B94A 4FOQA 4AVAA 2FHRA 2G1MA 5KR7A 2RM22 1NCRA 1W06A 3MFAA 3WQBA 2DU0A 4XIOA 5EPAA 4CDXC 3VDDA 1F5JA 3IN9A 1I3HA 3LPFA 4FAHA 2XXZA 3I2FA 5FO9B 3VHNA 3OPWA 4O61A 1HRI2 4LJHA 4GD4A 1E5RA 1OKQA 4AHZA 2XLGA 4LBOA 2WNVB 1GV9A 1NOVA 1ASJ1 1FNZA 4M0HA 4A6SA 4CE8A 5CVRA 3ZXJA 1RUC1 1ZBE3 5APAA 1WKYA 1ENQA 5I8SA 3PVNA 2VOVA 3HVDA 5FXXA 3PTRB 2PAKA 1X36A 2W94A 4AK3A 3DPRA 2VCBA 5BNPC 5C9AC 4QQ2A 4R9AA 3A0KA 5DDJ1 4CTEA 4D94A 2EIEA 3OYWB 4M3CB 4FSJA 5DAQA 3B9CA 5DXDA 4W8JA 1HDKA 4BOWA 2NPIA 4YWAA 1YHFA 1RHI2 4JV4A 1PM4A 1J1LA 4UXAA 5FBZA 4YW4A 3T30A 4LBQA 1IQAA 4PBPA 5FPZA 3VBSC 4D0QA 1GANA 3CJIA 5LK7B 5A32A 1XYNA 2BNNA 3K4DA 1UZWA 3GCWA 4QX1A 1D4M1 5A3WA 4S2GA 2VUCA 3POIA 3KSCA 3TBDA 1UIJA 2F4PA 3IDEA 1RJ7A 1JUIA 2GP5A 4A42A 4QXHA 4XBQA 1V6JA 4FXGB 2FZ1A 3JB4C 5FZ8A 5FDBA 2WA3A 1SZBA 4COUA 1HRV1 2D7FA 4JKKA 3WVJA 1BLZA 2DTWA 3FLTA 1RUI1 4UBHA 2F17A 4YG6A 1G9CA 1ZBA3 5CKMA 2WBKA 2RMU2 2VM9A 2FMYA 4BIOA 3RJ2X 1POV3 1SFYA 5E8AA 1OA3A 4EN8B 2VZQA 4GKXA 4QX2A 3M8LA 3H9AA 3MZHA 1FI2A 1M06G 3H3LA 1AJKA 1J1TA 3MBWA 4NRPA 4QU1A 5LBEA 4E4DX 5T3NA 1IS4A 1O4TA 1NCRB 4G4FA 4RGKA 2HYXA 4AI0A 1MS8A 2WZR1 3TWIA 1JXNA 2IXJA 4QX8A 4P5HA 4CU6A 4FPGA 4EWEA 3R0RA 4FPOB 2GC2A 1MEC2 2ZOEB 3WT3A 3IB3A 3K46A 5ABJA 1GWMA 2Z79A 4R4XA 1JH5A 1EY2A 1JZ8A 2HJIA 3EXUA 4CVUA 2XVKA 2VZPA 4R52A 2DCZA 3DPRB 4YM0A 1NY72 2WQ4A 4P14A 5JPMB 4AQ2A 4Y20B 3ME2A 4Q4Y2 1TMF2 1GSLA 4H7MA 1HB4A 3AYDA 1AR93 3LSDA 1GBGA 4CPBA 4H3WA 4E8DA 1VBB3 1RUE2 5FZIA 4LBQB 3OUJA 3WG1A 1CAWA 3CJIB 1O4ZA 3I3EA 2Z2SB 3KCXA 5A32B 2BBAA 3SQOA 3MFCA 2ZAAA 1DZRA 1IGOA 1DU3D 3WF4A 1LOBA 1O3RA 4NIIA 1B35C 1OD3A 5DAXA 2WRAA 1JZ2A 3INAA 2WQ8A 3I2IA 2BTVC 4W6XA 5HCFA 1ND2C 3KCCA 4Y4RA 4FPHA 3WQ1A 5KHIA 1AR81 1UMIA 4Y3OA 2KD7A 3OGGA 1JN2P 4LUKA 4YW5A 4CCNA 4A7ZA 1COV2 2W68A 1WCQA 2XGXA 5F3EA 2ORZA 1XB9A 4O7XA 3GZAA 1V00A 4B4QA 2OYZA 1UD1A 3BVCA 3IDCB 1Y9MA 4JCKA 1ENXA 4HK9A 3ZN4A 1W8NA 5JSOA 2HWF2 2ZGQA 2ZGKA 1BVP1 3WINE 1W9WA 3WXPA 1H2NA 3QOPA 5JLVA 1UOFA 3AP4A 2DFBA 3K3NA 2HYKA 2YBSA 4J6GA 1ND3A 2QKDA 3I49A 3SHRA 1A34A 2W1WA 3S0MA 2R043 5D21A 3OOXA 5ABJB 5LRSA 4DXRA 3E97A 1W9YA 2JE9A 4DMIA 1GLHA 1W3VA 1RUG2 2BJSA 2G9FA 3ROUA 2IXIA 4E4HA 5HV4A 4Y5Z0 1JW6A 2ZX3A 2XL7A 5A7WB 4DFSA 1WMXA 4IEXA 4YZ5A 5FLIA 2P3YA 5DZFA 2ZX1A 2JEMA 3BB6A 3VKNA 2XJPA 1CAWB 3PMEA 3WSOA 5TSWA 3ZKUA 4M3CF 2J1EA 4CCJA 1EPWA 1NLQA 2JG9C 3T1LA 4Q4X1 5F2SA 1OMIA 2BNOA 2R071 2VMHA 4WM8C 2V4VA 4JGYC 4OHWA 3H7JA 4OZXA 4FPKA 4AVCA 1LECA 5HV0A 1H1AA 1PVC3 1W8ZA 3UGFA 2PAEA 1FOD3 3JQXA 3P3NA 2OUJA 1YJLA 1OQ1A 4YARA 4PIZA 1WCSA 2ES3A 3P5BA 1IS3A 5F8PA 3ZFFA 2YB7A 2BOJA 1CPNA 5FZ6A 2VVDA 5L9RA 1DLCA 1O5LA 2XJRA 3HMYA 2LS6A 4R8HA 2W3JA 1WLCA 4TN7A 4XACA 1KJRA 2JE8A 4YVWC 5A7QA 4BMBA 3BTYA 4UFIA 4LXLA 5T5PA 2BOIA 2ZX2A 1UWWA 2YYOA 5J98B 2VBBA 2CGOA 3J7NA 5DUXA 3VKOA 1ND3B 4FOWA 1X82A 3UETA 4C1XA 3VD7A 5AVPA 4Q2FA 5EFUA 4RA0A 1RITA 4AYUA 4CCLA 1JMUB 4CP9A 4LO5B 3DEMA 3KZ4C 1CJPA 1W8UA 1ZVFA 4NWWA 2O1QA 4XZPA 1HN0A 4JX0A 4X8NA 1EP0A 5EJZB 2JWPA 3N7MA 4GB33 2H0VA 5B4NA 2YC2A 1D0GA 2B45X 2E33A 5F6LB 4MGTA 4AQ6A 1C8NA 1MQTA 3GF6A 2XUEA 3BPZA 1SLIA 4C8DA 1N3PA 1VBA2 2QQNA 4PDWC 2VZUA 1YEWA 5L36A 4H55A 1UN1A 3FWEA 1BQPA 1OT5A 3URFA 3JBG1 1FX5A 3O1VA 2MPFA 3OUIA 2TBVA 4IV3A 4IL7A 1LOAA 2DUQA 1F8VA 2JENA 3N35A 1GKBA 2PELA 2XJSA 1G8WA 3B3QE 1F35A 2P6CA 3OPZA 5F5IA 2VNOA 1I5ZA 5LRRA 4EN7B 3ACGA 2EIDA 3ZFFB 1SHWB 5FZAA 4XZUG 4CP2A 4QU2A 4WM7C 5F5QA 5CFCA 2JDZA 2AREA 2X09A 4DS0A 5C71A 2D98A 4LKEA 4YZ4A 1AX0A 5C33A 1JYIA 1Q43A 5A6QA 3A0NA 5K8SA 5LZ6A 4OQ8A 2HWD3 4Q1PA 4K21A 2ZGUA 3NV2A 4IE0A 4XBNA 3RI8A 4AI2A 4XJAA 4QB1A 1VBE3 5FMDA 5JVVA 2VUAA 1JU3A 1LU1A 1VMJA 3WG3A 5HCBA 4AHWA 1ZM1A 5C8WA 3NNFA 5DAVA 1GQPA 3OJBA 3WR0A 5DUWA 1LENA 2X53S 4CP9B 2K0GA 1KS4A 4AAPA 3ZYPA 1WW4A 1UL9A 2EALA 4FFIA 1QGLA 3I8TA 1K5JA 5IW0A 2IVJA 4QB2A 2K46A 4K3UA 3KV9A 2VZVA 1XYOA 2HWE1 2W92A 4EROA 3M3CA 1MQTB 1MS9A 1PZ8A 5IVJA 3FC0A 2RV9A 1IOAA 5JXIA 1GOGA 3DYMA 3RFRA 3M3EA 1OPMA 2V4AA 4OI2A 4XVHA 4ZXKA 3SH3A 1AXZA 1CVNA 1ASJ2 2B46X 2ZHNA 3PJYA 1BK0A 2A3XA 4I01A 4AVTA 1RUC2 2RS11 4IV3B 3K4ZA 1R093 4BK4A 1Z7S1 1ZZ7A 2CAVA 4QDSA 1C5IA 1QJEA 2WSUA 5DDJ2 3B9IA 5D1IA 1O8PA 4W6YA 1J83A 5H9SA 5BNOC 2WFF1 3KGZA 4YZ3A 5CFCB 4YG3A 4DZGA 4D7SA 2RS33 3JCIA 4IGQA 1D4M2 5FUPA 3VBFA 3IDBB 3ZFGC 2HEVF 4HG6B 3SKVA 5CA6A 1LHUA 3LA3A 4NHLA 2QTWB 4COZA 3VBUC 4UFHA 2ID4A 1JUHA 2ORXA 3TRSB 4LKFA 1NLRA 2I74A 4RFRB 1AYM1 1BK1A 1JOPA 2AGSA 4Z07A 4HVOA 4DXTA 4XTPA 2BV4A 5CADA 3WW4A 4LHNA 2GNMA 4IERA 4GH4A 4OYUA 1DLLA 1REEA 1LOCA 3OG2A 1EAH3 3HQUA 5C3RA 2IVIB 3NNLA 1D2QA 3AZYA 5A7NA 1JYVA 2GN3A 2WZR2 5HXMA 5GKAC 2XJVA 3LEIA 1GQHA 1ZA7A 1H9PA 4L9BA 4MYEA 1RUH3 3RZHA 5BXXA 1MZ6A 1W8TA 3F2ZA 1ZZ9A 4KQ7A 1YFUA 3PMSA 1RC6A 3FUOA 4JHZA 1OFNA 1BVVA 2PLV3 2VW0A 4AFAA 1DYKA 2JJ6A 1QQP1 5F37A 3KQRA 3N7KA 1N1YA 4H14A 1DBNA 3RZGA 3T09A 5LBBA 4HL0A 2VCMA 4CA9A 3O1TA 5F39A 1RVF3 1C1FA 2PHTA 1CJDA 4PCRA 1G7YA 2P4EA 4JQRA 1Y7BA 5FP8A 5HBAA 1ULOA 3OGSA 5FJHA 1ULEA 3O7OA 4UBGA 3RMXA 1JYNA 3O12A 1W9FA 1BBT1 3LIGA 3OF1A 5GALA 3T2QA 5D8AC 3VBFB 5ACA3 3AZZA 1EV11 3JD72 4JDOA 3MIFA 4H2AA 1YC61 2Z5WA 2ARCA 2P3IA 1VP6A 2VTXA 5C8CC 1ENRA 1FPN1 1XE8A 1AR82 1UZ0A 1FMD1 3IIAA 4TLGA 5IYYA 5LA1A 1RUF3 1VMHA 4DY3A 4PF5A 5L7OC 4XJWA 1Y9QA 4LK7A 1IG3A 3SC7X 4EWAA 2E63A 4AI1A 1OQEA 3I59A 2DCKA 5T50A 1GZ9A 2W46A 4OHZA 1AL21 2VUDA 5IFTA 4A44A 3PVEA 3MPPG 4BYYA 3VGIA 4GMP0 2QVSB 1WD3A 1OA4A 2IFRA 2OX0A 3WF0A 3DUIA 4KG8A 2GC1A 2PTMA 2XBO1 2ZZJA 3U07A 3VUOA 2PHUA 3M1HA 2HWB3 2MEV3 5J3UA 2R16A 3ZXEA 1PM7A 1PNGA 1K45A 5A3NA 4K40A 4JVAA 5H9RA 1XYPA 4L97A 5A6YA 4N53C 4GKYA 4CCEA 1NQJA 3KLSA 5EZWA 1KD7A 5DPNA 1VBD1 1BYHA 3M3OA 4NAMA 4Q0UA 4YRDA 4AFCA 2VU9A 1GOFA 3R05A 5FKBA 1MVQA 5FUIA 3WDTA 4E2QA 4NIHA 2W9XA 3OD4A 5ANNA 4B1MA 1SLAA 5D2AA 3LDBA 2WINB 1UY1A 3LCPA 1CQ9A 4Y4YA 3WNNA 3BI3A 2ZMNA 1QDOA 1W2UA 3APBA 2BGOA 3OSDA 3TNPB 4QHZA 4AGVA 4YM3A 1GUIA 1C28A 1FV2A 1SBDA 1PK6A 1WW5A 2VG9A 3HT2A 4Q4X2 5JPNB 2W1UA 4RYDA 1HXS3 4KGQA 1TMF1 3ZYFA 4MXWA 4OI4A 1GP5A 3GALA 1H1IA 4NOTA 1VE0A 3T0AA 3I2HA 4QXCA 5FJKA 1PGL1 1KRIA 3SH5A 1ZZ8A 1I1EA 4XDQA 1D0HA 1N1TA 3BGAA 3O0VA 1OVSA 2RE9A 1Y9GA 4A6OA 5C4WC 1HRI3 1G9BA 1H9WA 3AVSA 3I59B 2WO7A 1QF3A 1X9TA 4I3GA 5FP9A 4CUBA 5J7MA 3N7LA 3KHCA 4UFJA 3USUA 2OXBA 5J36A 1K5MA 1UX6A 4N9HA 2ZZQA 4FQ4A 5FK8A 4LBJA 5JZGA 3OUHA 4NPLA 2CTVA 1W8FA 2PA7A 4ZU4A 4BHPA 1PGW2 1W0NA 1KS5A 1OBNA 2EAAA 3IDAA 4I30A 4IEUA 5FZ4A 3WNMA 5FWEA 4FBFA 2I45A 1CPMA 2Y6JA 4NHKA 2ZX0A 4DRRA 1WLWA 1X50A 1RHI3 2QBXA 4XTMA 4P02B 3C3VA 4FOYA 4FT8A 4IUGA 4QPYA 2Q5TA 1UY2A 4IEPA 4LBMA 4B7EA 3ELNA 2Y60A 1MPXA 4IDZA 5A6ZA 1VBC3 1XSRA 2R063 4KWLA 4ZS3A 2A70A 3HNMA 3O1MA 1NA1C 1UY3A 3GHMA 4D6SA 4Q8KA 3WP5A 2C9KA 4I0BA 4QAWA 2YG0A 2RDQA 2ZMKA 2YBKA 3JZVA 3LEKA 3N9NA 1FT9A 4MH0E 2HEYF 5KXDA 4FPFA 4HZFA 2XOMA 1MS3A 1PMIA 2H6CA 1PK6B 2GN7A 2J1TA 3JBG2 4YW1A 3VBHA 4XAEA 4MXWB 4JKLA 2YBPA 2BWCA 2FD8A 3CZUA 3O0XA 1E57A 3H8XA 5GZCA 4RS5C 5C70A 5CG8A 2V5DA 1WLTA 3LOIA 2ZKNA 4Y5SA 3WZ1A 1E5HA 4PHZA 3RMYA 4A3XA 4UYBA 1DGRA 1GYKA 3NAPC 1UYXA 4NWVA 2VOWA 4RN5A 4FPEA 3VDCA 1C57A 2HBUA 1J84A 3J7HA 5FZ7A 4V2WA 1K5MB 2G19A 4HVQA 2VQ0A 4Q27A 1SLCA 5EV7A 2QQKA 3POSA 3PUSA 3RNSA 3SCHA 4FFHA 4CCOA 1MZFA 3HBKA 4ZZ8A 2J1UA 5DZEA 2BQPA 3EB7A 1OPOA 3Q9OA 4AG4A 3V0BA 2QJVA 3AX4A 1H4GA 1V6KA 1QKQA 2R30A 2WQZC 4OI1A 3VBOC 3ACHA 4XUQA 2NYYA 5GZFA 4AVVA 2DUOA 3D82A 4Q0QA 4C0HA 4B1LA 4LMFA 3KV5A 2LRPA 2UYAA 1V6NA 3ENRA
chains in the Genus database with same CATH topology
2HWE2 4QMAA 4Y24A 4PLOA 4CDWC 5IUQA 4ATFA 2EXHA 3B02A 1PNFA 3B93A 5GLTA 5I0RA 1QNWA 1SLBA 1X33A 2P3JA 3LKJA 1YXWA 4Y26A 4KU8A 3VKLA 4GXLA 4HBNA 1Z7S2 2PQQA 1XU1A 2HWF3 3IPVA 1F31A 3MEPA 1TEIA 3J9SA 2XKPA 4PIYA 5BNPA 1RUD3 3THTA 1DGLA 1PO23 2WFF2 1ZBE1 2GAUA 2VGDA 3H0OA 3HBZA 4QPIC 2WNVA 4META 3W9AA 2TUNA 5KC5A 2BFUS 4XYXA 4JC1A 2D6OX 3ILRA 3MIHA 4RHV3 2R1BA 2VH9A 4ES9A 4U36A 3SISA 4BQ1A 4RQPC 5GZGA 5CBLA 5F6KA 4GMP3 1QXJA 1W0PA 3V0BB 1AYM2 2NQYA 3GBWA 1XNCA 3J8F1 1LOFC 3MW4A 2UYBA 3NJZA 1PO12 4YNIA 5T54A 2OIIA 4BLJA 2ETEA 2P37A 5BPXA 4FCAA 1IZ3A 1MACA 1Z0HA 1VAVA 4CDUA 2PHXA 1Q3EA 3FFQA 2RS53 4AI3A 3MIEA 4A7YA 1DF0A 4QGLA 1U5IA 4CP1A 2YC0A 1XE7A 2SBAA 1RB8G 4MGYE 2QDNA 4F3JA 1S0DA 1QQP2 3WD5A 5JMCA 3R4UA 2QCSB 2GSYA 2JXAA 4XF9A 3IPVB 4YYOA 3O5SA 2V73A 5BNPB 5C9AB 1Q8PA 4R9BA 3I7DA 4EV0A 4EN6B 4LBKA 2WS91 5A3LA 4Q0SA 3AKRA 3NV3A 1BBT2 1VAMA 3EO6A 1QWRA 1W6MA 1ZRRA 3AK0A 4IV1A 1EV12 1SQ4A 3RDIA 4Y20A 2YV8A 4B29A 1VBB1 1M4WA 2X5IA 3VZJA 2EVXA 3HN1A 4M00A 5SV8A 1DZTA 4E4SA 1FPN2 3WUCA 3MIBA 1Y3TA 1BMV1 2RJKA 1FMD2 3KM5A 3O14A 2QQPA 4Z92B 4HFSA 4R4ZA 1BZWA 1VBA3 2MHFA 2WNUC 3WW3A 1IS5A 3GBGA 4TLFA 5JOXA 1MS4A 2ZGSA 3B00A 3JQWA 1AL22 1PGSA 4QX5A 4NR1A 1H8VA 4CDUB 2CYFA 2BPA2 3BCWA 1LOEA 1V6LA 5JAXA 2XBO2 3ZYJB 1A8MA 4LNVA 2YGMA 2Y0IA 4F7ZA 5KWRA 1V9U2 3ATGA 1ENSA 3D5OA 5FFOC 3AKQA 3ZX7A 5L19A 4G9SB 4XPVA 1VBD2 1JYCA 2R041 1RMU3 2CL2A 2DVBA 2RR13 1C1LA 5KHGA 1DHKB 1RUJ1 4JAAA 4YW2A 1AX2A 1W6MB 4GA9A 2D3PA 3SCFA 4CEYC 3WCRA 4F83A 4HN0A 1XNBA 3MF9A 4URTA 4JDNA 4IV1B 4W6WA 1LTEA 4BE3A 1AF9A 2ZPXA 3V65A 2X5IB 3RJRA 5BV6A 3NWKA 3QBQA 5DG1A 4RR3A 1PGL2 4CEWC 1CN1A 1SCRA 2BEOA 2QFEA 1OLRA 1CIWA 4E2GA 2E53A 3KB5A 1NCRC 4OULA 1J3QA 1H4HA 1RTVA 3JD71 3VDDC 3N4MA 1PVC1 3BALA 4UW4A 1ASJ3 1FOD1 1RUC3 4IEYA 4Q4V1 1J3PA 4Y1ZA 2DURA 3DGTA 2WWSA 3X29B 5DDJ3 4Q0VA 2E9QA 1QJX2 5FQ0A 2OW4A 2AH2A 4Z2WA 2IXCA 3ZFEC 5FO8B 1HQNA 1N3QA 2O8OA 4CP0A 5JOYA 4X6RB 2WKKA 1QNYA 3POWA 1AYN1 4J1WA 2Q8OA 3MICA 2CNAA 1GFF2 1HRV3 1RUI3 1VR3A 3H1YA 2WNEA 4FPLA 1WBLA 3FUQA 4Z82A 1WW7A 4CDQA 2A6YA 3AXDA 2OA2A 2W08A 4MX3A 4GIQA 4A7KA 1AR73 3PVBB 4PLNA 1FV3A 4K7JA 4J1XA 4RR3B 2E7AA 3E6CC 4CYDA 4C0BA 3N36A 4N7IA 4QM8A 1FNYA 3AMMA 2C5DA 1S0IA 2OZ6A 3OD0A 4JTNA 4K9SA 5ABJC 5BNNA 4HANA 5JIUA 2ZCWA 3HAGA 3SCGA 3SMHA 4FP3A 5FQ0B 5J09A 1NG0A 2DWRA 1AX1A 3S30A 2HWD1 3NV1A 2JG8A 3SXWA 4LBQD 2XPJA 3ZXFA 4WVVA 3AYAA 4M01A 2E51A 4K20A 1CESA 4AEDA 3FZ3A 4FO9A 1ULFA 2WJSA 2W52A 1AHSA 1LESA 5IK7A 3LOBA 1PGW1 1Q5OA 4Q26A 1KDKA 4PJYA 2ZKLA 2SLIA 1AR83 1TNFA 2NMOA 5A33A 1BXHA 4MZUA 4CDQB 3WDWA 1AZDA 1G9FA 5BNQA 5HI0A 4IEWA 4PIXA 3AZWA 1G9AA 1S2KA 2UY9A 1TQ5A 1F2NA 1UPIA 3L9JT 1ZBE2 2NM1A 2Y26A 1R091 4HLTA 4EJRA 2NP0A 1W6QA 1VIWB 5T5JA 3ZDSA 5HCAA 3FMGA 4QGNA 5KC6A 1LEDA 1SBEA 4AEMA 4KGGA 3CLPA 1A3KA 5LK5A 2VW2A 5BNNB 1ZZCA 3RS6A 4ZKTB 1QJY3 4DQAA 2D40A 2XVGA 5JOZA 3WW1A 4GWNA 4LA2A 2JG8B 3J8F2 5DZGA 4KNCA 1AR61 4AFDA 2PHDA 3TYJA 4AEDB 3BU7A 2A3YA 1MR5A 3M2MA 3GBFA 3AKTA 2XWJB 1YFWA 4XETA 2R073 4OLLA 4OI0A 1B09A 2C0ZA 3H8UA 4NHMA 3BTAA 1BEV1 3UKNA 2NZ9A 1EAH1 4AHXA 5A33B 3D6EA 4YVSA 4L99A 2PN5A 3ZSJA 1CR7A 2DTYA 1LRHA 1DGWX 4QHBA 2Y38A 4I0AA 2A6ZA 4K6BA 4HVRA 3RYPA 4FQZA 5FMOL 1H2KA 3ZFFC 4CZSA 2ZABA 2PYTA 3KT1A 2KM2A 1PIV1 2DFCA 2XLAA 2D6LX 3NSTA 3MW2A 2D44A 3FE5A 2WS92 1W6QB 1H2LA 3E5QA 3H50A 3NKGA 3UKTA 1NQDA 3O0WA 4S2DA 2EXKA 2FZ2A 4LA3A 2XJUA 3VKMA 4ATEA 4L92A 5I0UA 1ZRFA 4UW6A 1LGCA 4HSLA 1ULCA 1VBB2 3FFZA 1VRH3 3PTYA 4BCUA 1Z78A 4TSVA 5CFDA 1ZREA 1S0JA 1BMV2 1YYNA 2ZAHA 3VZKA 4XQWA 2CWSA 3MF6A 4H7LA 1CGPA 5L7OA 4LUMA 2B7YA 3FLRA 5JI7A 3TN93 3UV9A 4Z1VA 1YCIA 2TEPA 3CF6E 4AXOA 4LR4A 1H8TC 2WT2A 3MPBA 2XJQA 1NCQC 5KHKA 1PO11 2AZ5A 3CJXA 4YVSB 2ZS6B 3B7MA 3H1WA 5EJ3A 3AZVA 3QACA 5AC93 1ZZBA 4N53A 1YWKA 5CFCC 2R042 2MEV1 2XG3A 4LBNA 4DOUA 3DF0A 4AHYA 4AQTA 3FJSA 1TE1B 1KITA 1RUJ2 3WUDA 1V70A 3D0SA 4XHBA 5E16A 3T1MA 2ET1A 1REDA 2BNMA 2R0FA 4DPNA 5EYXA 1KDMA 3WCSA 4K8FA 1R083 1NYWA 4LHKA 5I93A 4XFHA 3MI8A 1JOJA 5FMOS 4HT1T 5CFDB 2ILMA 2VNRA 3DL3A 3BIWE 1C8M1 3I2DA 2FBEA 1HXS1 4XHXA 1W6OA 4ZU7A 1TME1 2C9AA 3IWZA 2XB6C 4WVZA 1HKDA 2AENA 5L7OB 1PVC2 3PLQA 4HMZA 5C4WA 1FOD2 4XMAA 2FMDA 1LHNA 5IK5A 3FHIB 2P34A 1U5YA 2RS13 3WV6A 1WCKA 4Q4V2 1Q8QA 4LHLA 3WQ0A 1O91A 4RGGA 3VZOA 3RRDA 2GNTA 1AVBA 4YSFA 1V6OA 5JSRA 1QOTA 2AYHA 5KHHA 1GZWA 1QOSA 2XUMA 1JBCA 3CEWA 1XNDA 4FTSA 1SACA 2WL1A 5FCCA 4ASLA 4N53B 4AWDA 4Y22A 1AYN2 5JSPA 2VOXA 1QJZA 2QZ2A 4MSVA 1QJU1 3QH7A 1ZZ6A 4FPCA 4W65A 4XJ9A 4FTBA 1V9U1 2P17A 1CAVA 2JICA 4GB32 4QXKA 3VHOA 3SNMA 3HWJA 1VBC1 2TNFA 5JI9A 1QH6A 1LB2A 3LA7A 2NLRA 2B42B 4Q1RA 2VXRA 3AP7A 3DN7A 1JHNA 2XWBB 3OY8A 5K0UC 4GH4C 5AFEA 3E6BA 1KQRA 2A75A 3AZXA 1O7FA 1KFUL 1RINA 1W6OB 1GICA 2RHPA 4L11A 4N43A 3GHNA 2A6VA 2HWC3 4S2HA 5CG9A 4R9CA 4IEOA 2V5YA 1WCDJ 5C4WB 2ZJCA 5F9TA 4RD7A 3RPQA 2Q30A 4IEZA 1A6CA 2RM23 3AMPA 3D4KA 1QQP3 2VY0A 4KWKA 2UURA 2WLPA 4D3WA 1FAYA 1Q8OA 3CL1A 1MS1A 4K1YA 5GM0A 5GLZA 3E5XA 1GZWB 2HWD2 3RYRA 2HKXA 5E88A 4D69A 4B3NA 4AVSA 2MNGA 1BBT3 4Y22B 1G9DA 5L73A 3WP6A 3ZMOA 1AUYA 1U5ZA 1LGNA 3QCWA 5GZDA 1QJX1 1RJ8A 2ZGTA 5KHJA 2XL9A 3HR9A 1CAVB 3H1MA 1FPN3 4CDWA 4Y1YA 3NO8A 1FMD3 2WFPA 3E5UA 1UZZA 4FAGA 1H0BA 2ZGPA 1Q8SA 4MLOA 1OD5A 1X8EA 4TWTA 1SCSA 3OY8B 4QPGA 2IC1A 2YXSA 2JX9A 2JKBA 2D5HA 1HW5A 1HQWA 5I0TA 1FXZA 3U11A 1N3OA 2ZTNA 4P9GA 1OOPA 4OVEA 2RMU3 2DV9A 4N43B 2XBO3 1R092 2VQAA 1MS0A 4XXAA 4SBVA 4AGRA 1RUD1 3UL2A 1PO21 3HIFA 1VBD3 4FTEA 2IWGB 4YLZA 1POV0 2BW8A 2RS32 4DY5A 4RHV1 1MEC3 4OUMA 1RGSA 1F9KA 4RFT0 1QXPA 3TAYA 2CGPA 1R1A1 1OQDA 1AR62 2Q1MA 2UY8A 3K48A 4GWMA 4QQPA 1XQNA 5I0SA 1AL0G 4QD2A 2V09A 4RSUA 4Q4Y3 1TMF3 4MVTA 4DRVA 3D0JA 1BEV2 3J4UH 1PK6C 2VVEA 4Q4W1 1RUE3 1EAH2 3OCPA 3WDYA 4Y1VA 4CDWB 5K9YA 2D43A 2E7QA 4EN0A 3FBYA 4E2SA 1PZ9A 1OLQA 3M70A 2GNDA 1EYBA 2YPJA 3WX5A 1RUH2 2A3WA 4ISRA 4QPGB 4XF4A 3K51A 5KXBA 1PIV2 3OBRA 2ZGOA 4B8EA 4CDXA 4COYA 3MLKA 1OOPB 3MW3A 3ZYGA 1DQ6A 1YIPA 4B7KA 1COV3 3AP9A 4ISQA 1QU0A 1K5MC 1WMEA 3ECQA 4KL1A 3HT1A 2QUOA 1ZYBA 5JZGC 1A78A 3D8CA 1VJ2A 3E6DA 2PHWA 2PFWA 4AEKA 2CWMA 1MZEA 1BJQA 3R4SA 3B01A 4LBLA 4QQLA 1ONAA 4I2OA 4C91A 5C9AA 4B4RA 4IQPA 5FOJB 4XEZA 5K7PA 1UF2C 1U12A 4JGZC 3VZMA 2JE7A 1CONA 3NV4A 1I9RA 3VBSA 1LHVA 4IEQA 2XKOA 4XFFA 4D7YA 1RUG3 4JDMA 3ZN6A 2GH2A 2WNUA 4A2UA 1N47A 3MLJA 5E1RA 1QY4A 4LO7A 5DG2A 1RUF2 2Q0AA 4Q0PA 1O4YA 3V64A 3VBHC 3WDUA 5J96B 1XXNA 4LO8A 5EXOA 2IXKA 3VBRC 4AF9A 1UCXA 3LA2A 1ULGA 2VPVA 3VHRA 1ZBA1 3JUUA 5FO7B 1D2SA 1HIXA 1POV1 4Q8LA 2MEV2 3DV8A 4CDXB 3NW4A 2OVUA 3LGRA 3RZZA 2DVDA 2EAKA 1RMU1 1YFYA 4WV8A 5T52A 4GALA 2RR11 3ZSEA 3M3IA 5KXEA 4CEYA 1WGPA 1XNKA 3WW2A 2Z42A 3CO2A 1SDWA 1UIKA 4WZFA 5C6CA 4P9IA 2PHRA 2A73B 4AFBA 1C8M2 1HXS2 2E7TA 3AYCA 4ORFA 1TME2 4SLIA 3VBSB 4CEWA 1UU4A 2GH8A 1AR91 3ZN6B 2YUEA 2WNUB 2WT0A 4JRLA 4XXPA 1B35A 1O3TA 4KH9A 1ND2A 2ZA9A 3RYKA 2XVLA 1H1MA 1VB2A 4NPRA 1GR3A 3ALQA 4XQDA 2D5FA 1OSGA 4BWOA 3V56A 3SITA 3JU9A 3ZFEA 2VVFA 3VKFC 5GJ6A 5I8TA 2VECA 2P3KA 2WNVC 1BCXA 2DUPA 1QJU2 4QM9A 1DG6A 4JTOA 1WUVA 1IPKA 1MS5A 3WDXA 3ZN5A 4FXKB 2NMNA 2ZGMA 2DVAA 5BY5A 1VBC2 2R062 4XFBA 4ASMB 3J8F3 4ZU5A 3S7IA 4AW7A 4CEYB 1WBFA 5FLJA 3SH4A 3WG4A 5B2GB 5BYNA 1DQ2A 2D6KA 1UZYA 4XF3A 1QH7A 1RUNA 3ES1A 4FPYA 4CEWB 4D7TA 2WIIB 3ZSKA 1S55A 4AGGA 4MGZE 4TYSA 1J3RA 3WP3A 1ZA4A 3N3HA 1LJ7A 4CDUC 2JG9A 1AR71 3VDDB 1B35B 1SFNA 3ST7A 4WM8A 5IK4A 4JGYA 1IS6A 2CV6A 2B39A 1ND2B 3PNAA 5DUVA 4XFIA 4AE2A 4YZ2A 3P3PA 3U4XA 1GQGA 1H2MA 1YO8A 2OPKA 4XQ4A 3EQEA 1VB4A 2GZWA 4KWJA 1XU2A 2WS93 4FOVA 5FREA 4YVWA 2P2KA 5AFBA 3ZFEB 3ILNA 1UW8A 1NZCA 3ES4A 3WDVA 3MYXA 2XHKA 2NN8A 1QOOA 1REFA 1GZCA 3ZXAC 3GNEA 4R9DA 4P9XA 4UW5A 2OUHA 3VHPA 1UMZA 3DPRC 4IV1C 1DQ0A 2D6PA 5JDBA 4LE3A 1AXYA 2X5IC 3B5LB 1D4M3 2QDRA 5DUUA 4IESA 3RSJA 1DFQA 1NLSA 3CJIC 1QDCA 1NXMA 4BIFA 3FLPA 4QQOA 2BWAA 3ZXLA 4GB31 1HX6A 5FAXA 4OHXA 1IPJA 3VZLA 4PDWA 1V6IA 4LULA 1WLDA 5GLWA 2JG9B 3OTFA 2Z69A 3OBTA 4LEJA 1SMVA 4WM8B 4JGYB 1OFSA 3CNAA 1RUD2 1PO22 4XMIA 2WZR3 4N90A 3LB9A 4BA6A 3USSA 4LO6B 2GMEA 2VUJA 4DNYA 4RHV2 2ZX4A 2Q1ZB 4IETA 4P9YA 3S7EA 4CRQA 4WM7A 1WA4A 1R1A2 1C3HA 1DIWA 2ZMLA 5CIRA 4YVWB 1RUJ3 3ZVXA 2ZGRA 5CU1A 4I0WB 3AMNA 4WZCA 1QJY1 3H7YA 3MGUA 2ZGNA 3AP5A 4COVA 1DGRN 3UJQA 2A6WA 1H30A 3J26N 4M0NA 4AFMA 1VALA 1S0FA 3H3UA 3NVCA 5FRAA 4Q4W2 1URXA 5EWSA 3C2UA 1VBE1 3L2YA 4LLOA 4NN0A 4HKLA 2G9GA 4K1ZA 2WA4A 4AVBA 2D3RA 2B9UA 4I3PA 3GZTB 4WBBA 3JD73 4RR3C 4YM2A 3RQ0A 2RS52 5KXCA 4C90A 4OFGA 1LKNA 3IBMA 1DQ4A 3LWCA 4L8QA 5JIAA 3ZXDA 4Q4V3 1PVXA 3H3ZA 4PDWB 5CB7A 1WMDA 3NKTA 4BMEA 3GYDA 2WSVA 2DCYA 2Y0OA 5JCTA 1U5XA 3PJQA 3ZXGA 3TNQA 4NO4A 1YJKA 3ZO0B 1NE4A 4Z8BA 3AXEA 2KXLA 4HK8A 1AYN3 4NVPA 5FPXA 4XIKA 3WOGA 2JD4A 4MV2A 4BH9A 5BNOA 4WM7B 2BVVA 1ZRCA 2XJTA 3RG0A 1ND3C 1KFXL 1VRH1 1RIRA 4UW3A 3B69A 1ZRDA 4KU7A 4XJZA 3VL9A 1S0BA 1HLCA 1PZ7A 3ZFGA 4KBBA 1LHOA 2PHFA 3WHUA 3VBUA 2RS31 1T6GC 1ULDA 1SLLA 2OZJA 4C1WA 4CDQC 1QHDA 1W39A 4KG0A 2YDEA 2D93A 1QMJA 1H8TA 3EBRA 1SLTA 4U2AA 1DQ5A 1NCQA 2EXIA 3QH6A 4XFCA 3TN91 2A71A 5FOBB 4BZ4A 4Q4X3 1ZBA2 3I54A 3ETQA 4LO4B 5IT6A 4I02A 2W0XA 3TOJA 4FP2A 5T5LA 4P9JA 4XFGA 3KS7A 4XW3A 2ARXA 1S0GA 2I07B 4L2NA 1MZ5A 5AC91 4OHYA 3RWNA 4YGEA 1YUDA 5BNNC 1RMU2 2D3SA 5T5OA 1RUH1 2AR6A 2RR12 3KGLA 4MGKE 3WY6A 3VV1A 3QD6A 2VW1A 3AKSA 2YMZA 3ZSMA 1SBFA 2WZPP 2PLV1 4YM1A 3ASIA 4E27A 3WNXA 2JG8C 3MIDA 3M7AA 2WT1A 5BNOB 2GALA 4AEDC 1RUOA 1LODA 1R081 4Q29A 1DYPA 1OHFA 2PAMA 1RVF1 2UWBA 2BYVE 2DU1A 1AR92 5D8AA 4JRAA 3ZFGB 5BUVA 3VBUB 3THPA 5ACA1 1J59A 3HD8B 5C8CA 3POYA 3ZPYA 3ZMNA 1H8TB 1NCQB 3IT8A 1MQTC 3JBG3 1ZNPA 1LGBA 1RUF1 2ZHLA 4QQHA 4XBLA 2E6VA 3KT7A 1I6XA 3ZXKA 4WVMA 1OA2A 4B4PA 2R49A 4IV3C 2IFWA 3WG2A 3WP4A 3U0ZA 1IKPA 3CU7A 2CGNA 4XJUA 3VZNA 4ITCA 4RL7A 2GDFA 2JECA 1AR63 2ET7A 2HWB1 3AFGA 1S0EA 2A7AA 3SLIA 1HRV2 5J48A 2R1DA 1RUI2 2FQPA 2PHLA 4N9IA 3IMNA 2LALA 2BBVA 4HETA 2N7GA 5K0UA 3PHMA 4GULA 2A5ZA 2K2SA 2DYCA 5T55A 2DCTA 1LEMA 1BEV3 1VAKA 1APNA 5D8AB 3KMHA 1ZX5A 3ZIXA 1AR72 2LM3A 1HQLA 3BODA 1X7NA 1YI9A 5GLVA 4YW3A 1JTZX 2HWE3 1U0AA 4YVSC 5C8CB 2HWC1 1LULA 2CAUA 2GC0A 4M3CE 1PIV3 1W6PA 2H6BA 1SEFA 1W6NA 1D4VB 2RM21 1TNRA 4PLMA 2EF6A 2X29A 3UK9A 1UPSA 2ARBA 4ONUA 1DQ1A 4MUVA 3I4IA 1Z7S3 4EWDA 2A6XA 1HRI1 4HKWA 5E89A 1LOGA 2VMIA 4WVMB 4Y1UA 3ACLA 1VLNA 1UU6A 2DF7A 5CAZA 2VMGA 1UAIA 2QNKA 4X6QB 2WFF3 1V6MA 4E4ZA 5J37A 1R1ZA 4BM8A 4DINB 2YY1A 1G86A 2UWAA 4HKOA 1XRUA 1L3JA 3WLUA 4XOGA 2EXJA 5CFDC 1DGWA 1GNZA 1RHI1 4LE4A 4LTAA 2D6MA 3VBFC 1NA1A 2ZGLA 5K0UB 4GH4B 1AYM3 2R061 1CX4A 2GMPA 2XH6A 4LLFA 4P9WA 3AJZA 4YFZA 1G6NA 1PO13 5AVAA 1YLLA 3N7JA 4HSJA 1S2BA 3G6JB 2RMU1 3LSEA 5FLHA 1KJLA 3VLBB 5I91A 2BGCA 3W58A 4RS5A 3UJOA 1W6PB 2G4IA 2YZ4A 1W6NB 1WMFA 3AB0A 4INDA 1CAXA 4XF0A 1HV0A 3AMQA 4IXLA 3NAPA 5GZEA 3UKVA 1QJY2 1YFXA 2EA7A 4O9GA 2UU8A 1CD3G 3KT4A 1MEC1 2I2SA 2F6BA 2AUYA 1UU5A 4FVVA 1C5HA 3MLLA 3MDPA 4PQ9A 4BLIA 1O3QA 1DDLA 1S0CA 1VBE2 3L2HA 3ZIWA 1NY71 2UWCA 5IK8A 1C8M3 2R072 1IHMA 3AP6A 4Q4Y1 1TME3 3AYEA 3VBOA 3AM2A 1EV13 3PVOA 1FYUA 2CY6A 1RUE1 4YGBA 4XF1A 3IKWA 2ERFA 1NA1B 1Q8VA 3WHTA 3OGJA 5H9PA 1GNHA 3MIGA 5LEJA 4S2FA 4FPJA 1WW6A 2GU9A 3KD4A 1DZQA 1AL23 2EIGA 1BKZA 2R6QA 1COV1 4XE9A 5JWPA 4RS5B 1OI6A 1QJU3 1IKQA 1LCLA 1UKGA 1CAXB 4QPIA 5SV5A 1YIFA 2HWF1 1Y43B 1V9U3 3NAPB 4JGZA 4XILA 1VRH2 2B8MA 1N1SA 4XJ8A 2VULA 2VOKA 4XFAA 1CAUA 4EN9B 2IZWA 2VNGA 3V0AA 1A8DA 3VN4A 4RQPA 2BFUL 1HV1A 3BOPA 3ILFA 5I8YA 2ZBJA 1RUG1 3AKPA 3AMHA 1NE6A 1YI7A 3NL1A 2QZ3A 4MGIE 4AI8A 1NXD1 1LOFA 3AFKA 4GMP1 1YRZA 1F5FA 3TN92 3AJYA 3VBOB 3VBRA 3DKWA 4YFWA 2X8KA 2KA3A 3W59A 1PHMA 2D6NA 4N43C 3BOWA 3ZSLA 2IXLA 3ZYRA 3M3QA 1Q56A 3FBMA 2O8QA 1QXRA 4X8PA 3FX3A 4E9KA 5FTTC 5CNAA 5AC92 3S6PA 1LU2A 2R0HA 5JR7B 3USUB 5GLUA 3R6SA 2GC3A 2DCJA 4HPKA 4O9EA 2LTNA 2RS51 5LEKA 1LHWA 4BPZA 5JZGB 4G3YC 1YNAA 5HXVA 3RI9A 4COWA 4F8AA 2PLV2 5JOWA 3LAGA 4QT6A 2ENRA 4TZDA 4DB5A 1QJX3 2YGLA 4QPIB 1R082 1RL3A 4JGZB 2ATFA 1LR5A 4Y1XA 4OUSA 5F1RA 2R32A 1RVF2 2W39A 4LT5A 2YROA 1CAUB 2HEWF 4DXZA 3V0AB 3M4FA 2RJLA 2C1FA 4RQPB 4PBOA 2LUWA 5ACA2 1O3SA 1J58A 2B5HA 2BUKA 3VBHB 2XLFA 2RS12 4QPGC 3VBRB 4MXVA 5H9QA 1MVEA 1X8MA 2DVFA 5A3MA 3IM0A 4YG0A 2ZHKA 1OOPC 3EJKA 1VBA1 3ZYIB 4ES8A 3QLQA 3TB0A 1ALYA 1KXGA 3LZZA 4IEVA 2YHJA 4V1PA 4P9LA 2H0BA 1W0OA 4YGDA 4AQSA 4HPKB 1R1A3 2GMMA 4GQ7A 2GNBA 2Q4SA 4WVWA 2IXHA 5KBFA 3OYWA 2HWB2 4M3CA 4QGMA 2O0OA 4RGAA 4I09A 1WD4A 3A4UA 3WQ7A 1N1VA 2ZHMA 3T2TA 1UKRA 3VL8A 1O5UA 5EYYA 2ZACA 2QE3A 4AEJA 4Q4W3 4YGCA 1AXKA 3GZUC 2K9ZA 3EHKA 3R4DB 4HN1A 1S1AA 2WC2A 1AJOA 3U10A 2WLQA 3JB8A 1FATA 4YZ1A 1C4RA 4N7UA 3HQXA 2HWC2 2BVBA 3KCYA 4OHVA 2DVGA 3G7DA 1EPZA 2D97A 3B94A 4FOQA 4AVAA 2FHRA 2RM22 1NCRA 3MFAA 2DU0A 4XIOA 4CDXC 3VDDA 1F5JA 3IN9A 1I3HA 4FAHA 5FO9B 3VHNA 1HRI2 4AHZA 1OKQA 2XLGA 4LBOA 2WNVB 1GV9A 1NOVA 1ASJ1 1FNZA 4M0HA 5CVRA 3ZXJA 1RUC1 1ZBE3 1ENQA 5I8SA 3PVNA 2VOVA 4AK3A 2PAKA 1X36A 5BNPC 3DPRA 5C9AC