3VZOA

Crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) n35h mutant with glu78 covalently bonded to 2-deoxy-2-fluoro-xylobiose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGHFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Strategies for modulating the pH-dependent activity of a family 11 glycoside hydrolase
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vzoA00
3EXUA 4HKOA 1C5IA 3ZSEA 3HD8B 3AMHA 1UU5A 1XYOA 1PVXA 3AKTA 1H0BA 2BWAA 1H4HA 1XXNA 1F5JA 4XQWA 3MF9A 2NLRA 1XNKA 3MFCA 3VHNA 3VZNA 3WY6A 2QZ2A 2VUJA 1OLQA 2VGDA 1XYNA 2JENA 1KS4A 2VULA 1OLRA 3VZLA 3AKRA 1H8VA 4S2FA 2VG9A 3WT3A 3WQ0A 3AMMA 2D97A 2DCJA 4HK8A 1H1AA 2QZ3A 3MF6A 1OA4A 1HIXA 1AXKA 3M4FA 4S2HA 4XQ4A 1M4WA 4NPRA 1C5HA 1BVVA 3VZOA 1IGOA 1H4GA 1QH7A 1XNCA 2DCKA 4S2GA 1REFA 3WP6A 3O7OA 2JEMA 1OA3A 1QH6A 2NQYA 1REEA 1TE1B 2Z79A 2DCYA 2F6BA 3WP4A 3LGRA 3VGIA 2D98A 2B45X 3VLBB 2BW8A 2JICA 3WP3A 3AKQA 1HV1A 5EJ3A 1BCXA 4XQDA 3WQ1A 1T6GC 3B7MA 4HKLA 1UU4A 2DFCA 1NLRA 1KS5A 1XNDA 1XNBA 3RI9A 2DFBA 3WQ7A 4IXLA 3AMQA 5K9YA 3AKSA 1ENXA 5K7PA 3VL9A 2DCZA 3VZJA 1OA2A 2BVVA 4H7MA 1YNAA 3LB9A 4HKWA 3RI8A 5HXVA 1UKRA 2BWCA 1BK1A 3B5LB 3AMNA 1W2UA 1REDA 4S2DA 3VZMA 3VZKA 2B46X 4XPVA 3VHOA 2B42B 3VHPA 3WR0A 2C1FA 3WX5A 3WXPA 3VL8A 1UU6A 3WP5A 1HV0A 1XYPA 3MFAA 4HK9A 3AMPA 3AKPA
chains in the Genus database with same CATH superfamily
1UIJA 1W9SA 2CGOA 3VBUA 5A3NA 1W2OA 3H7JA 3OBZA 4N53C 3HPNA 5K4LA 4XACA 2WNUB 4YARA 2BBAA 2JWPA 4OHXA 4QXHA 1RUF3 5FY5A 5K0UC 1PIV3 4YGBA 3TEXA 2FZ1A 4AFCA 1LNSA 4G9SB 1NE6A 2ZHNA 1DGRA 1WCQA 5DG2A 3GALA 2LALA 4AHWA 1I6XA 4BLIA 4CE8A 3RZHA 3KM5A 1SLTA 3M3QA 4YPJA 4CDUA 4GJYA 1RUD1 3D5OA 4PBOA 3JD73 2NMOA 4CZSA 1ALYA 2PYTA 2JDZA 4QB1A 1QJEA 2WS92 2EF6A 3LFIA 1RTVA 2LRPA 4I0BA 4QKBA 3VBHC 5JMCA 2AENA 1ZZBA 2VTXA 4Q29A 5T50A 3ZX7A 1AX1A 5BXXA 4BCUA 4Q4Y2 3KVBA 1AL23 4A3XA 4YW3A 5I8SA 2K46A 2IFWA 4NUBA 3W21A 4EWDA 1SFPA 2Y0OA 5JXIA 3LIGA 4Z92B 3PMSA 1JYIA 1Z7S2 3V64A 4X8PA 1UOBA 1IG3A 5FO8B 3I2IA 1W6MB 1ND2B 1Y43B 2GMEA 3CZJA 1RVF2 1JZ8A 3K4AA 4ASKA 5KWRA 2AYHA 5LY2A 3WEZA 3BALA 3KHCA 1W90A 4AQ6A 5IVBA 2B7YA 2JD4A 2PXJA 4LBOA 4WV8A 5FZMA 5BYNA 1NY72 2W94A 2DCKA 4Q27A 3P6BA 5L9RA 4C1XA 1AR63 5GLVA 2ZX0A 3OOXA 4OCTA 1VRH1 2DVBA 1JOPA 3ZN6B 2BOJA 2N7GA 3KLSA 1VBD1 5I0SA 1XSRA 3E6CC 2Z79A 5JLVA 2YPDA 4JDNA 1PVC3 1RUH2 2VBBA 5HV0A 2EICA 3VDAA 2J22A 3FLPA 1HJFA 2ARCA 1VBC1 5DAWA 5DABA 1OVSA 1FAYA 4ZZ8A 5CFCC 1YQCA 2D6OX 4QPGC 1XJAA 1YJKA 5IVYA 2BFUS 5C8CB 1UX6A 4N90A 4KWLA 4TYSA 2HWE1 5FMOS 3Q8AA 3BYWA 4P14A 1MS3A 4IESA 3LEMA 3VB9A 3WNOA 5I0TA 4HPKB 4KI5M 2JG8A 4NHXA 1NOVA 2P3YA 3HBZA 3ZMNA 2XJPA 1DQ2A 3AMQA 4IXLA 4QDRA 5A7WA 3I3MA 1S0GA 1ONAA 2WWUA 2XBO1 5DDJ1 1GBGA 2JE7A 4MGQA 1KJRA 4XFAA 3JZVA 4H7MA 1X9PA 2QVSB 2Y60A 4HKWA 1OH4A 4L0PA 4LBMA 4O9EA 4QKFA 3RI8A 5F3CA 3ZMOA 2UWCA 4JGZA 4XAAA 4D6RA 5GZCA 4BXFA 4M3CA 3QBQA 2JDMA 2R6QA 4HOOA 2HWD3 3ECQA 1R1A2 2LW8A 1V6NA 3NNMA 3VDCA 1VPHA 2Q1ZB 4ISQA 3VN4A 2E51A 3KV6A 1PZ7A 1AF9A 2C1FA 3VL8A 2XLAA 1X7NA 3GM8A 1UU6A 3HBKA 1WMXA 1WBFA 3CBNA 4MGZE 4H3WA 5FMCA 3AP9A 5FY1A 3WW2A 2YGMA 4HONA 4CCMA 2WWJA 4HVRA 4RD7A 3LE0A 4PDWA 1TG7A 1H1IA 3AYCA 4LHSA 3ZSEA 2VVEA 4GH4C 2R071 5LATA 4AAPA 1GICA 2H0VA 4NHYA 1W6OB 1ACCA 4LPLA 3HEIA 4PI2A 4ZHNA 4LO7A 3AFKA 2VZTA 1O3QA 4D69A 1QOSA 2PLV3 1GZTA 3DCQA 4FXKB 2TUNA 3BOWA 4XVHA 1PX3A 1U5ZA 4U36A 4AVBA 4AI2A 2GSYA 3H1WA 4Q4X2 1FV3A 2VUJA 1WCKA 2DUPA 3O1SA 3SITA 5CKNA 3N3HA 4BJ0A 5BNPA 4MHRA 3W9AA 4JGYC 3OCPA 1MEC3 1YQ5A 3QACA 5ISLA 2C26A 3POFA 1OMIA 2B8MA 1X9TA 4D3WA 4ORFA 2VO5A 3C7EA 3VKLA 4MX3A 2DVDA 1JHNA 3KGZA 4HANA 3E97A 2X5IB 4ONUA 1UW8A 3WW3A 1JU3A 3MLLA 1JU4A 5EJZB 4NPLA 1MZEA 1HB2A 4Y20A 2H6CA 2RR12 4PLOA 4CCEA 3JD72 4R8HA 4YW6A 2VR4A 3OG2A 3AP6A 1PGW1 3LSEA 2NP0A 3VZOA 1BVVA 4M4RA 3I2HA 4RGGA 1UZWA 4MO3M 2UY8A 3B00A 4CCNA 5F2SA 4RGKA 4CP0A 1GU3A 4QM9A 1QDOA 4PHZA 3MEPA 2ZGTA 2JEMA 3C7GA 1JOJA 2Y6KA 3ACFA 3VBOA 4OVEA 4XF3A 1HLCA 3N7KA 2XGXA 3RQ0A 2G9GA 3MZHA 2B45X 4Q4Y1 5J96B 5KHJA 3VUOA 1OD5A 2YGLA 4YGCA 1AR73 5JXHA 2FZ2A 4LOSA 5FWEA 5J1XA 1Z7S1 2A5ZA 3WSOA 2RS32 4D6SA 4XMIA 1AYM1 1LOCA 2LUWA 3HN1A 5D21A 4CU7A 1QNYA 1RVF1 3PURA 4KQ7A 1KS5A 4CVUA 4NMIA 4NR1A 4TLGA 5A80A 3ZYFA 4BK5A 2V4AA 2JG9C 3HNMA 4W6WA 1GSLA 1TME3 1Q8PA 1PVC2 5F3GA 2XJUA 2YC2A 3VBFA 4RSUA 4WM8C 3NW4A 2UYBA 4CU8A 5FPXA 1EYBA 1OLMA 3LWCA 4WVMB 4OHZA 2HYXA 2ID4A 1DLCA 2OQ6A 1J1TA 3MIFA 1JZ6A 5IK7A 3C2UA 1O8PA 1O91A 2W1WA 1BBT3 3CMGA 3O0XA 3VZMA 3AYDA 4P00B 5FLIA 1JH5A 1Q8QA 1RUH1 3S57A 4Y4RA 3GF6A 1LAJA 1H8TA 3LA2A 1FOD1 3T0BA 3OB8A 3WG3A 4C0HA 5BPXA 3UJQA 3ZSJA 3ETPA 4CPBA 5J3UA 1W8NA 1VBE1 4CP1A 4EE2A 5HCHA 3SCGA 1LGBA 1NZCA 3PU3A 3ACIA 3C7FA 1AXZA 2VUAA 1STMA 1UAIA 1J84A 3N35A 4UAPA 3WDXA 1U5YA 4ZS2A 4BQ5A 1LGCA 4EV0A 3RZJA 1W0NA 2FCUA 4YVWC 1G7YA 3IIAA 2F4LA 3PVBB 1YLLA 5DZEA 4MYEA 1LR5A 5ANNA 1J59A 4JHTA 1F4AA 1OF3A 4GA9A 1OD3A 1W6QA 4D7TA 1JZ5A 1CONA 4RYDA 3VBUC 3DECA 4XILA 1DF0A 1N3PA 1XNKA 3MFCA 3NV4A 5G05L 1J58A 3H3LA 4J1XA 4KNCA 1R1A1 4QKNA 5F3IA 5FZHA 2MNGA 1GQHA 1VAKA 3A7QA 3EHKA 1BK0A 4JQTA 4QHZA 5E89A 3OUIA 2VCMA 4CUCA 2VGDA 4YSFA 2Q1FA 1JZ3A 3QH7A 2ADDA 4DXTA 2VZ3A 4CYDA 1ASJ3 2FHRA 4QDSA 3ZR6A 5FYCA 4ZU4A 3VZLA 3D82A 4NIAA 2RDNA 4Q0VA 3B69A 4QHOA 3RGBA 3VKFC 4FAHA 2OKXA 2DCJA 4QAWA 2ARAA 1H1AA 3AP4A 4IUGA 3ZYIB 1H9WA 3SEPA 4BQ2A 2D7FA 5FMBA 2W68A 3ZPYA 5C7GA 1NCRA 1U0AA 1HIXA 2QQNA 5FQ0B 1W6NB 2GNMA 5HCAA 4W65A 5C9AB 1BZWA 4XQ4A 5FZLA 2QDNA 5T3NA 1M4WA 5FZEA 3LPFA 4LO6B 4QX3A 1LOBA 3ZDSA 2WRAA 4Y1UA 4YVSA 1IGOA 2VXJA 4YGEA 5FO7B 2AGSA 5FYZA 4IEQA 1NG0A 1PNGA 4R9AA 5CZKA 1BMV1 2W9XA 5FIXA 1JHJA 2FBEA 3RVHA 5AC93 1LHWA 3HQUA 4N8MA 1F31A 2R042 2NN8A 4YG0A 3ZXKA 4LO4B 3RMXA 2VVFA 3M3EA 4QM8A 4WVWA 5FY7A 4EYUA 3HN3A 2BNNA 1GZCA 4AG4A 5HPOA 1ND2A 1FV2A 3QH6A 4K8RB 4DFSA 4XDOA 1RUF1 1PIV1 5FZ0A 2LROA 4LBNA 2Y6HA 2J1SA 1GKBA 5EJ3A 2VZSA 3WF4A 5BNOA 3KT7A 2ZEXA 3DGTA 3LIHA 4FPOB 1WLCA 1S0CA 5LBEA 5CADA 4COZA 5FDBA 3UYJA 5CBLA 2H0BA 3ZN6A 3T0AA 3JD71 1BKZA 1UXXX 2W3JA 2XQXA 1HQWA 5JIUA 4A42A 4QB2A 5FYYA 2EXKA 4BQ3A 3OPWA 3UJOA 3ATGA 1DG6A 3AL6A 3AK0A 5FJHA 4COVA 2E53A 2KXLA 3EQEA 5ABJC 2FQPA 4A45A 1AL21 3ZFEA 3WHTA 3GZAA 4E4SA 3VD5A 4QU2A 2XVLA 3BOPA 4Y33A 3PIJA 1AR72 3R4UA 1ENSA 1DGLA 2VZVA 3AMNA 4OHWA 5C5TA 3TNPB 3LOBA 5FR3A 2RHPA 2VCCA 1F8VA 3CEWA 2BP6A 2ZEWA 4CDWB 1LU1A 2YC0A 3PU8A 4HPKA 1XSQA 2HJIA 3GJAA 4GWIA 3WP5A 2FDJA 4B1LA 1ZBA2 3L2YA 3GHMA 2EIEA 3ZN5A 3VD7A 5DAPA 1TME2 3VDDC 1QJU2 3FC0A 4TTGA 4AOCA 2JB8A 1AR61 4W6XA 2D5HA 1WW7A 3EXUA 2VMEA 5JXJA 1HXS2 3AP5A 1GOGA 4P9LA 4RR3B 2HLEA 2UWAA 3I7DA 4AWDA 3A21A 4BE3A 2VXRA 1Q8VA 3ENRA 4UBGA 1PVC1 4LUKA 3MGUA 1BYHA 4UFMA 5KXBA 1S2EA 3H50A 4NWVA 3RZZA 1QJY2 4CEWB 1C8M3 4PDWC 2OX0A 1GV9A 1LEMA 3GGLA 2NPIA 4KWJA 4XJZA 3ACHA 4P5HA 4WZFA 4Y22B 4YZ4A 2DVFA 3ES4A 2P17A 3CJIA 4YGDA 1VRH3 2Y0IA 5DN2A 2XJVA 1YFXA 3FUQA 2XL9A 3P3NA 3X29B 1EV12 2RMU3 2VULA 3HVDA 1OXCA 2W2IA 2WZR1 2WIIB 2Y64A 1POV0 3KB5A 3NQHA 5DZFA 3VBSB 2IFRA 1HB4A 2E7QA 4S2FA 1JYCA 3FWEA 1VB2A 3F2ZA 5JR7B 2XMLA 2HWC3 3T30A 3IPVB 4DRRA 5A33B 3MIHA 4CP9B 2E32A 2FDFA 3LFMA 4UOJA 1GP5A 5BNPC 1L7RA 2QJVA 3ACLA 3MICA 3VBHA 4ARYA 1PNFA 5BNNB 2A71A 3E5QA 1H1MA 1LOGA 5KR7A 1UYXA 2HWD1 4JHZA 4NHLA 1HN0A 4GQ7A 3IKWA 1OQ1A 5DZGA 4CXYA 1QJZA 3A4UA 3KVAA 3ILRA 3J7MA 3VD3A 1QJX2 2CWMA 4DINB 1ASJ2 1H4GA 1QH7A 4GALA 2W1SA 4QDQA 3SMHA 1PZ9A 4A2UA 4B7EA 4JAAA 2ZGNA 1A78A 3DXUA 1BHGA 2V09A 2XBO3 4O7XA 4OI4A 2WFF2 4TWTA 2PHWA 3W5MA 1V6IA 4CP2A 5F2WA 2X5IA 4ES9A 2R1BA 3ROUA 4D0QA 2D98A 4A41A 4K6BA 1CZVA 1KDMA 2Y6LA 5LK5A 3O1PA 3AL5A 5LA9A 3AKQA 4KU7A 1NLQA 4N9IA 3N4MA 4PBPA 1JMUB 5EWSA 5FZAA 3T1MA 4EZHA 4QX7A 4AAXA 2PLV1 3NV3A 4AZZA 1OOPB 1GP4A 3VBOC 1AJOA 1BXHA 3OEAA 4K7JA 3NMBA 2VMHA 3C3VA 4HLTA 4NAOA 1V6KA 1NLRA 1ZBE3 4META 3ZKYA 4B3NA 5L73A 3A23A 2C9KA 4HSLA 3LA3A 4Y3OA 4E9KA 3V56A 4QXCA 3SH5A 2YZ4A 4NN0A 4XFGA 1RHI3 4LIUA 2VNOA 4QPGA 4LE4A 3VZJA 1MEC1 1SLAA 4GKXA 1SLIA 4F7ZA 2D3PA 3AZYA 5LW9A 1K42A 2JJ6A 2Z2SB 1UKRA 4JVAA 4PF1A 4C1WA 4Q26A 4P02B 4TLFA 3OD4A 2Y6JA 2ZGKA 3KSCA 3ILFA 5J09A 1G9FA 1VAMA 2J1UA 4S2DA 1UNBA 3FJSA 1C28A 3GHNA 2ZAHA 1I3HA 3HNYM 1QXPA 5FZ4A 3MW4A 3LD8A 3WX5A 2YMZA 1TEIA 3POEA 4KH9A 4LLFA 5FZ7A 5FYBA 4AFDA 4IGPA 3K75B 5A6ZA 2VW2A 1NXMA 4NHMA 4QGLA 4DXRA 5F6LB 3TAYA 1H2MA 3DKQA 1UXZA 4GZ9A 4P9XA 4WVMA 4YRDA 4MLOA 5FBZA 3RYRA 1COV3 4KL1A 3J9SA 4KWUA 1H8TC 4EN0A 4QPIB 1E5HA 1O3RA 1UU5A 4L97A 1DU3D 1ODNA 4NRQA 1PGL2 5F5IA 1F5JA 3MDPA 4RA0A 1RUD2 4JDOA 2NYYA 4A3ZA 1JOBA 4CCLA 3M3CA 1N1TA 1W8ZA 3N7JA 3WY6A 4U2AA 4XUTA 1YCIA 1YC61 5FZ8A 5A3MA 5FYIA 4XW3A 4PQQA 5AVAA 3PMEA 3UGHA 2BFUL 4QXKA 3MW3A 1PO23 5FMOL 1JUHA 1XB9A 4BWOA 5JMOA 1PMJX 1RUI3 5FZ6A 3POJA 4P5YA 4W50A 4Y4YA 5IHRA 4AK3A 5C3OA 1T2XA 2ZX4A 1ZZ9A 5GLTA 4LORA 4AVAA 1DBNA 4CTEA 1S2KA 3UT0A 2WNUC 3RZLA 2HWB3 3GJBA 1BBT1 3Q8EA 4EZ4A 2VZUA 4NPMA 1GZ9A 5FXZA 3B02A 1TNFA 1UOFA 1AX2A 3LEGA 4NPRA 4XJWA 4YG3A 5T5LA 2EALA 5FOBB 1VRH2 3MIGA 4LA3A 4Q2FA 5ACA3 1PGSA 5FK8A 3WVJA 4A44A 4I01A 4LITA 2E31A 3ES1A 4PIZA 3WP6A 5FYVA 4YM3A 3BTZA 1ZZ6A 5JZGB 2XPJA 2FDHA 1JI6A 1H9PA 4V1PA 2HWC2 1REEA 4XUOA 2WNOA 2I2SA 1VBC2 3LA7A 4YLZA 4ATFA 5C8WA 1LULA 3IZOA 5F3EA 4NIGA 3KT4A 5T52A 3WNKA 2GC0A 1K5MB 1FX5A 1VBA3 1ZNPA 5EYXA 5L7OB 2CAUA 4NJ4A 4NO4A 2HWE2 3ABZA 1T6GC 4E27A 5FZIA 1QF3A 1FATA 1FOD3 3M70A 3MYXA 3POYA 2K0GA 1S4CA 1V6JA 5LBCA 1ND2C 1VALA 2W0XA 4EQVA 2WQ8A 2R49A 3DF0A 3I49A 2VMDA 3LQCA 2XBO2 5DDJ2 5FZ1A 1V00A 1W2AX 4OZOA 1LGNA 3ZM8A 2Z4FA 1PM4A 1RL3A 4IV1B 4RQPA 4TSVA 1CAWB 3THDA 1SHWB 3CL1A 3NNFA 1OA2A 1UIKA 1W2NA 3S7IA 3LB9A 3NJYA 2RG4A 5B2GB 3AXDA 2PAEA 1WMEA 2PAKA 2Q8EA 5A6YA 1GWLA 2XWJB 3B5LB 4P9GA 5FKBA 1W2UA 2JG9A 3FFQA 2ZGMA 4GWNA 4JTNA 2B46X 3T09A 4HSJA 2B42B 2A6WA 3BU7A 4LBKA 5FY8A 3WR0A 1OFNA 1RIRA 3IWZA 1W6PB 4LBQB 5AFEA 2RDRA 4A7ZA 4Q4W1 4E2QA 2VMIA 1WZXA 1UZZA 1XYPA 1ZA4A 1UMZA 5IFPA 1RHI2 5C8CC 1O7FA 4WVZA 2ZKNA 3WDVA 4XE9A 3DL3A 1F4HA 3J7HA 2HEYF 5AC91 1RUOA 5IVCA 2PHLA 4MGIE 3T1LA 3AMHA 5EPAA 4QQOA 3TWIA 3USSA 1QWRA 4AR2A 4CDWA 4YW4A 1E5SA 3HMYA 5IAXA 3DEMA 2QDRA 3BPSA 2OZ6A 3MF9A 2PA7A 4XF1A 2BU9A 3EJKA 1V6LA 2ZX2A 1MACA 3DYOA 2ZGSA 1OLQA 3ZIXA 3USUA 1KGYA 3BPZA 3IDCB 2A6ZA 3T2TA 5IK4A 1QOTA 2XG3A 1F15A 5C4WB 1X8EA 2ORZA 3AKRA 4UWDA 4UFJA 1DIWA 4C91A 2VOWA 1RUC3 1PHMA 5L36A 5C3SA 2LTNA 2KR2A 2VJXA 2XHKA 1MVEA 3CJIC 1E5RA 2PHTA 1ZZ7A 2VZPA 1PGW2 3OGJA 4H55A 5EP9A 2OT7A 4Y22A 2DU0A 1PGL1 3GCWA 4NRPA 3JU9A 3DPRB 2CAVA 4OQ8A 4XXPA 3RYPA 2B4KA 2ZCWA 4YM1A 2OPKA 5FKCA 3TYJA 4ZKTB 3T2PA 3H3ZA 1PO22 1PK6B 2VH9A 2ZOEB 3PTRB 3NV1A 2FCVA 5CB7A 5JOWA 4YZ5A 4LQRA 2P5BA 1H6YA 4I3GA 1VMJA 1KFUL 4IE4A 3SQOA 4CU6A 1QMJA 3ZLIA 2GH8A 1AXYA 4K1ZA 4MSVA 1MQTB 5BNNA 2ZHMA 4O9GA 4FO9A 1E5IA 5FK7A 4AQTA 4D8MA 4NAMA 2D6KA 1SG3A 5KXCA 4GXLA 4L99A 1AYM2 4EROA 1D4VB 1DGWA 5M0TA 3E5XA 1C8M1 2X5IC 1W9TA 1CIWA 1IKQA 1U5IA 4FPEA 3H8OA 3MPBA 3BUCA 3AC0A 4DY3A 1CAUB 1JZ4A 4UW5A 4OMCA 5JI9A 4H14A 5AVPA 5L9VA 3KWVA 1RUJ3 1MZFA 5LA0A 1IPSA 2RMU1 3JBG3 4LMFA 1YNAA 2ET1A 4NWWA 1RXFA 2ZBJA 4R4ZA 5T5JA 3BGAA 2HWC1 4GKYA 1UPSA 1GR3A 1OOPA 1FOD2 1KJLA 4DUVA 4XIOA 3ZSLA 3OYWA 1SQ4A 1VBE2 2PQSA 2VZRA 2WNVB 2QQIA 3LSDA 4P9JA 3RSJA 3WW1A 5ABJA 3RWKX 5IVEA 3SNMA 3URFA 4K9SA 4LT5A 2HKXA 5A1FA 3MFAA 4RS5A 4AEDB 5LBFA 3SC7X 4QMAA 4IV3A 3LEIA 2WZR3 2VL4A 3OEBA 4QX0A 4ASMB 4AHZA 4ARXA 2IXCA 1K45A 5BY5A 1JTZX 3LEKA 5FZOA 4PJYA 2W39A 2DF7A 2VOTA 5FZ9A 2O8QA 4LTAA 4GB33 4LULA 1NXD1 1CJDA 4L92A 1IOAA 2JE8A 4IGQA 3DUIA 1W99A 1XXNA 1AL0G 1H4HA 2QKDA 4FFGA 1X36A 3K4ZA 2ZHLA 1UQXA 5I0UA 1LHVA 3VDDA 2FDIA 1AR83 4MOAA 2VY0A 4Q4V3 1PZ8A 4MXWA 1RYYA 1ZVFA 2Q8CA 1ZA7A 1MS0A 3I54A 1WMFA 2TEPA 1V0AA 1ZBE1 4TXWA 1VBB3 4QPIA 2AZ5A 3B9IA 5C33A 2X10A 3N7LA 1GP6A 3QOPA 2CY6A 4D7SA 4UW6A 5E8AA 1SPPA 1GMMA 1RHI1 2JE9A 1RC6A 2R7EB 3NAPB 5GZDA 1HRI1 3JCIA 4AGGA 1UZVA 4XAEA 3O1VA 1M06G 1CZTA 5F5CA 4Q8KA 1QEXA 4AFAA 4AEJA 2P3KA 4IQPA 4S2HA 3SCFA 3FZ3A 5IVJA 5FTTC 1BMV2 3VKMA 5FZFA 5HCFA 3JB8A 4JRLA 4YM0A 3ZDVA 5DAQA 4ZZ5A 2DU1A 1US2A 2LM3A 2Y33A 2RS51 2VCAA 4XETA 1MS8A 2YFZA 3ELNA 1REFA 3POGA 1ZYBA 1J1LA 4PF5A 5FP3A 1LOFA 4LIVA 3T3YA 1OA3A 2NQYA 3WNNA 2W87A 3MV11 1HX6A 1RUF2 1PIV2 1Q56A 1COV1 2V73A 3L2HA 4AGRA 3BU0A 1D0HA 2ZEZA 3OGGA 3VLBB 3J7LA 3LAGA 4N7UA 3INAA 4L9BA 4B4QA 3DYMA 3LZZA 3OGRA 4ZXEA 2WA4A 4XJ9A 2VTXJ 3OGSA 1W9FA 2BGOA 3C7HA 2DFCA 1D4M3 3D0JA 1YI7A 1UY3A 1XNDA 1XNBA 4JKKA 4KBBA 4BQ4A 1W9WA 5A6QA 1OFSA 5C9AC 4FOWA 4CPBD 2D93A 3N36A 3RFRA 1AL22 4IEYA 1FPN3 4IGOA 3VL9A 4Y1VA 1OQDA 2XVGA 3WINE 1PO21 5FWJA 2PN5A 2WA3A 1K5MA 4AVSA 1RUI1 5L7OA 3I4IA 2DUOA 4FOVA 1W28A 4PLMA 1ND3B 5F6KA 1ENQA 2ZGQA 4FTSA 4K3UA 4RQPC 5JOYA 3FE5A 4AW7A 5CVRA 2R063 1PM7A 3AJZA 5JCTA 1MR5A 1APNA 1UZ0A 2HWB1 4YFWA 3KV9A 1DFQA 4E2SA 2B9VA 2YFUA 1AR62 2BTVC 3G6JB 4Y5TA 4BQWA 3U10A 2O0OA 1EAH3 4UF0B 1VB4A 1RUJ2 2WSUA 2W1UA 3IMNA 4AYUA 5ACA1 4ET7A 1WLDA 2PHXA 3JBG2 5C5UA 5IATA 3AZXA 5FLJA 1I1EA 1C5IA 2XUMA 1G9CA 2IXIA 3PJYA 1MS1A 1VE0A 3MPPG 1XYOA 3I2KA 3D3AA 2V72A 3H1MA 1OC1A 2D6NA 1D7PM 2HBUA 1SCRA 4JRAA 4Z07A 1H0BA 5FPBA 4FCAA 1ZRCA 2SLIA 1UYPA 4LBQA 4GD4A 3FL7A 2E26A 3H3UA 2JKXA 1VBA1 1O5UA 3ZKUA 4MV2A 2XKOA 3O1TA 4K8FA 3ZSMA 1DCSA 2QZ2A 4J1WA 5DUXA 1MVQA 5ANQA 4DUWA 2WWSA 3OPZA 3WNPA 4K1YA 1W3VA 2WZR2 3B3QE 1EY2A 4CDWC 2QQLA 3MLKA 3FHIB 1R1ZA 4CSWA 1QXJA 1OLRA 2WINB 4XTMA 1DQ1A 2WNEA 3E6DA 2ZGOA 4KG0A 1O4YA 2F17A 2ARBA 1Q5OA 5FREA 3NJVA 4AI9A 4PI0A 1XU1A 2R0FA 1SLBA 2XUEA 2HWD2 3BODA 3R4DB 5JIAA 4A4AA 4RR3C 5FZGA 4Q4V2 3N9PA 5LRRA 4LR4A 1DQ6A 3D0SA 2J1TA 5CKQA 2WO7A 5FCCA 3VHRA 1YWKA 4GAZA 1CJPA 3NV2A 1LCLA 5HV4A 1OH3A 3OY8A 2GP5A 4R4XA 4Y1ZA 5F5AA 4CEWC 1IQDC 4PCRA 2P4EA 3FUOA 3QLQA 4UFKA 5CG9A 4BQ1A 2RS13 2C6SA 2DYCA 3LKJA 4NHKA 2QQVA 2WNUA 4ZPIA 3CNAA 5GLZA 3S5AA 2VPVA 1ZRRA 1LU2A 5L9BA 1UMIA 5FYTA 2BERA 2DURA 3VGIA 2HEVF 3PUHA 4XFFA 3VBSC 4DXZA 4YG6A 3BB6A 2PLV2 4C8DA 3DPRA 1TVGA 4XXAA 1KDKA 4W6YA 4NROA 3ZSKA 1S0BA 3WDYA 2CTVA 1OVPA 4OULA 1BQPA 4Q4W3 1PK6A 2QNKA 2FDKA 2J1EA 4AEMA 3N9NA 2ORXA 5BNNC 4LA2A 1YFWA 5C3PA 5EQUA 4FOYA 4A6OA 4CRQA 1MEC2 5FYHA 1WD4A 1DYPA 1C1FA 5K7PA 1MQTA 3I59B 2ADEA 3AP7A 2D44A 1WA6X 4YW5A 5IFTA 3WF0A 2VQAA 3SLIA 2ZGUA 3M2MA 2NM1A 4IW3A 3H8RA 1V9U3 3I2DA 1W6MA 4A6SA 3BI3A 5FZKA 1RUC1 4UFHA 2VMGA 5EZWA 4P08A 4Y5Z0 5A32B 1GWKA 3PLQA 4XZUG 3WDWA 3VZKA 2W91A 2J7MA 2YV8A 4DO0A 1BEV1 2VE1A 2QQJA 1NX9A 1OPMA 1ZRDA 2D3SA 5JDBA 1W0PA 5EJ1B 1HV0A 2AEYA 3ZR5A 1W8TA 4XFIA 3WNMA 1JBCA 1GANA 3ITQA 3AYAA 4FQZA 1OOPC 4BOWA 1W2TA 2VW1A 1UYZA 3MV01 1RUG3 3A22A 3BN6A 4HKOA 4IEPA 3ALQA 2BGPA 3B94A 3KQ4B 4Q1PA 1Z0HA 3WOGA 4MGSA 2WO2A 1OUXA 4E2GA 3POIA 1AUYA 1CX4A 4QX8A 4QPYA 4EN7B 4RS5C 2OIIA 2ILMA 4IV3C 1I5ZA 5I0DA 4CU9A 2XJSA 3WF1A 5C8CA 5HBAA 2WABA 4W8JA 2NLRA 1VMHA 2W5FA 3OF1A 4JQRA 3VZNA 5F32A 3W20A 1GNHA 2OUJA 2XR4A 1W8HA 3ORJA 2WDBA 4LHLA 1VIWB 2ZA9A 3N9LA 1CAXB 1W05A 4OHVA 4OUSA 2WT2A 2A3WA 4MZUA 3ZXGA 1Y9GA 4OUEA 3DV8A 3V0BB 1UMHA 4NE9A 1C4RA 3H8XA 5JI7A 3NNLA 4COUA 4BA6A 1RUJ1 1W8OA 2ZMLA 4MH0E 1N3OA 3OBRA 2CWSA 3JBG1 4UW4A 2D97A 3ZXAC 3O0VA 1XRUA 4Q0PA 2F4PA 1BBT2 1OKQA 3ACGA 5HI0A 3K3NA 4DS0A 1IKPA 2GU9A 3POWA 4IE7A 4QPIC 3P5BA 4XJ8A 3WQBA 4WM7B 2J42A 1XNAA 2Y38A 3OUJA 1YXWA 1U5XA 2QQMA 4LBJA 4M0HA 3ZFGB 4JTOA 2IXKA 3N9QA 4XIKA 2SBAA 2QE3A 4AI8A 3GYDA 1XNCA 1SCSA 1C8NA 1RUE1 5GKAC 2P6HA 5J7MA 2RJKA 3MUY1 4K21A 4C0BA 1D2SA 5CFDB 4UFIA 5LEJA 3PVEA 4QGMA 4Z2WA 2BDRA 3JQWA 2GC1A 4LK7A 1W6OA 2ATFA 5A1LA 5E16A 2PELA 2PAMA 2DCTA 2UU8A 1NYWA 2ZGPA 3OPTA 3DKWA 3AFGA 4XF0A 4GB31 3O1OA 4PIXA 3WP3A 2Q4SA 1P8JA 5CKMA 2ZZJA 4QPWA 5A1AA 3IBMA 1LOFC 4FPKA 1DZTA 4HMZA 5F9TA 2X29A 3AZVA 2A1XA 1AR81 4HZFA 1UY1A 1A8DA 3PNAA 4Q4V1 1K3IA 5FPAA 2CV6A 3K46A 4CDUB 2UYAA 3MIBA 1HB3A 1H2LA 2GMPA 5FAXA 3KV4A 5BV6A 2GALA 1B09A 1IS5A 3NNJA 2ET7A 1H2KA 1VBB1 2D6MA 2DUQA 3U07A 2Y8KA 2MEV3 2D6PA 2DTYA 4O65A 3RZGA 1LENA 2Q8DA 2HWF3 2VQUA 5JZGC 3GNEA 4X6RB 1DP0A 1HW5A 4URAA 2QQUA 4YW7A 2JDKA 3K51A 1W39A 2J1VA 4Q4W2 1ULCA 3IM0A 2A6YA 1W06A 2FMDA 4N7IA 1K5MC 4IERA 2XONA 3SISA 1RMU1 5L7OC 5FLHA 1D0GA 5JOZA 1YHFA 1ULFA 4FOQA 3I3QA 1Q43A 4LE3A 3AMPA 5AC92 1TMF3 3CZUA 3AKPA 3U0ZA 5E1RA 3AX4A 4A7YA 4DRVA 1I5PA 1YQ2A 1NQJA 3FHQA 1PMHX 1V9U2 2XLFA 4P9WA 3UGFA 3WG4A 4B7KA 1S0IA 4BH9A 3KCYA 4XDPA 2RM23 4CDQB 2QBXA 1HRI3 1HN1A 1WMDA 2PMWB 2VM9A 4AGVA 3TB0A 2HBTA 1R083 3KGLA 5J98B 1BJQA 3KCXA 2XKPA 1YQ8A 2GNDA 4ZU7A 1FXZA 1AR91 1W03A 1TNRA 5DAXA 2D43A 3K48A 1W0OA 1NA1B 1T6BX 4UF0A 4BHPA 5A3OA 3OUHA 1FT9A 4G4FA 2RS53 1AX0A 3O12A 2WT0A 4MGYE 4DOUA 1D4M1 1KQRA 4HVOA 4XUQA 5JXGA 4BK4A 2WO1A 1JYWA 2JG8B 2ZGRA 2B5HA 2JB4A 3FLTA 5DUUA 1QQP3 1FPN1 1US3A 2O1QA 1UN1A 1DGRN 5GLWA 2R30A 2CL2A 1UY0A 2YU2A 5IW0A 2E7TA 4GMP3 1DZQA 4JGZB 2VAUA 3SXWA 4M3CB 1IZ3A 4ZU5A 3WUCA 1SZBA 1S1AA 5DPNA 2X09A 3IB3A 2R061 2XHNA 3J7NA 3LOIA 1YEWA 3I2JA 4Z2AA 3T4HB 1SFNA 1D2QA 3APBA 4V2WA 3JXSA 4XABA 2W52A 3RZKA 1QDCA 4BZ4A 1N1SA 1EAH1 1Y9MA 5A3UA 2I07B 1QH6A 3H9AA 3WW4A 4LKSA 4XUPA 3ZXEA 3CU7A 3M1HA 4E4HA 1OHFA 4YZ1A 2QFEA 5H9PA 1ULPA 3WF2A 1NCQB 2Z5WA 5IVFA 2CNAA 3S5QA 2ZAAA 1O5LA 1C8M2 2EXHA 4RHV3 1F5FA 4K40A 1HDKA 1BLZA 5KHGA 4DQAA 2Q30A 2OUHA 2DVAA 1UU4A 3VD4A 2O8OA 5BNQA 3WDTA 3TEZA 4AI0A 4IDZA 2A3XA 2DBIA 3KZ4C 4LNVA 2RMU2 3U4SA 2WS93 4QT6A 3DPRC 5GZFA 3AKSA 2JIGA 2EA7A 4QQHA 1HJGA 1RJ8A 1KEXA 1YI9A 3AJYA 3H8UA 4LO8A 2ZHKA 1W9YA 2VZQA 3M8LA 1PK6C 2J1RA 4KU8A 5GZGA 4MG2A 2EAAA 1F2NA 2FDGA 5FQ0A 1CESA 2BWCA 1W6NA 3KQRA 4FFFA 5FRAA 4LKEA 5C9AA 4A7KA 1FMD1 1UOGA 1MQTC 3PL0A 3LPGA 4RN5A 3VHOA 5F7UA 2OW4A 2AUYA 2VNGA 2VNVA 4Y20B 4YYOA 2WN2A 3I59A 1IS6A 2XJQA 3M3IA 2EIDA 3EYPA 2WUHA 5A3TA 1UO9A 5F1RA 3LCPA 4FVVA 4L11A 2DTWA 3KHBA 5F37A 2RS11 5JUVA 4COYA 3GXUA 1LHNA 4FPCA 4XF9A 3ZXJA 5LRSA 2KD7A 2WQ4A 1JYXA 2D6LX 3VBOB 3RWNA 4KWKA 4QWNA 2IWGB 4ZXKA 4BISA 1H30A 1W8UA 2RE9A 4XC9A 2Y26A 3ZYRA 3CO2A 1UY4A 3BVCA 4K20A 4Q0QA 4XQWA 5FP8A 3WCSA 2WYSA 4CCOA 4C90A 1QIQA 2ZS6B 3CLPA 3MUZ1 2WC2A 2GZWA 1CPNA 2FD8A 1ZBE2 5D8AB 3IIIA 2WZPP 1Y7BA 1C1LA 1DYOA 4AVCA 5KC6A 3CF6E 1JS9A 4GWMA 4RFRB 1WCSA 1UYYA 2BQPA 1PX4A 4RGAA 5D2AA 4KGGA 5LY1A 2ES3A 2VD7A 5FYUA 1ST8A 4N43B 3VDBA 1WW5A 5A70A 5C3QA 2IVIB 1HRI2 3Q8FA 4LEJA 3N9OA 3WQ0A 4CXXA 2E33A 3AMMA 1KRIA 2IZWA 3VBFB 1AHSA 4HK8A 1XC6A 2J1AA 3TN93 2JDAA 4DZGA 1V9U1 2CYFA 2LS6A 1MS4A 2WT1A 2ZZQA 1A3KA 2FCTA 3E1F1 4BQXA 3AZZA 4EJRA 3S6PA 1F9KA 4FPJA 3PDQA 3M4FA 5B4XA 2C4XA 2Y6GA 3HWJA 4NOTA 5GLUA 4CUBA 5IK5A 4J6GA 2RS52 1DHKB 5FXVA 3WCRA 4M01A 5CU1A 2VC9A 2KA3A 2QTWB 4ISRA 5IT6A 5JPMB 2WAOA 1HQNA 3NWKA 1AYN1 4F3JA 1NZIA 2P6CA 2JXAA 2IVJA 4RR3A 1CR7A 1COV2 3O7OA 4HT1T 2WLQA 1QJFA 2VMCA 3CIHA 3IMMA 5CNAA 2XXZA 1JUIA 1ULDA 2CSGA 1RUG1 1ZZCA 1N1VA 4QQLA 3MW2A 5FZDA 5FP9A 4ASLA 5JSPA 4CEWA 1ULGA 2GNTA 5C3RA 3ZYHA 5T54A 1BCXA 3ZFGA 4L8QA 1BEV3 2RJLA 1UPIA 3NAPC 4LO5B 3UK9A 1C57A 1WBLA 4H2AA 4QHBA 4UW3A 2BUKA 2D40A 2GN3A 3QD6A 4Q4X3 5FP7A 4I0AA 2HH9A 3FX3A 3ASIA 3PUIA 3VBSA 3VBRB 1O3TA 2PHUA 5CYYA 2PHRA 1RUI2 4MUVA 2E63A 2R32A 4NVPA 3IPVA 5A33A 4AL9A 5FOJB 4CP9A 5E88A 3TBDA 1SBDA 1HKDA 1DLLA 1VMFA 3OTFA 4LBLA 4LUMA 5HXVA 3ZO0B 3JQXA 4HN1A 1QXRA 2BRTA 4RHV2 1GOFA 2RV9A 4BIOA 3Q8CA 2HWB2 2O14A 3EB7A 4PT6A 3U75A 4UFLA 2JDUA 1XQNA 3PTYA 1SDWA 4IEXA 1NCRB 2RR13 2A3YA 5FJKA 5A7NA 3EBRA 3RZMA 1ZRFA 1GWMA 5SV5A 5ACA2 2RJ2A 4YVSB 3T2QA 5LA2A 5E6HA 4FPFA 5CEHA 1O4TA 4XOGA 4DB5A 3UETA 4JX0A 5C6CA 1RITA 2VQ0A 3HD8B 3FHAA 3HOBA 5CA6A 3OGVA 3I8TA 1HRV1 5H9RA 4AFBA 3WZ1A 1B35B 5LASA 3NJXA 3R6SA 1VBA2 4JDMA 1KITA 4AF9A 3K4DA 2E7AA 2BWAA 1Z78A 2OZJA 1FNYA 4OUMA 1LKNA 1NQDA 3VHNA 5BNOB 5EIYB 1EUTA 3PIGA 2GNBA 1LRHA 1VRBA 1ND3C 2EIBA 2G9ZA 2RS33 2WZEA 2YG0A 5KHKA 4AQ2A 4H7LA 1RUE3 5DUVA 5LA1A 1EPZA 4CA9A 4BIFA 3OD0A 3OJBA 4Q0UA 4I09A 1KS4A 3M3OA 5JVVA 5JAXA 3ILNA 3SH3A 4CDQA 2AREA 5EFUA 2Q0AA 2XB6C 1H8VA 2XWBB 3CKHA 2VG9A 3WT3A 2YPJA 3K3OA 4AFMA 2A70A 4BMBA 3RJRA 2MEV1 3R0RA 2I45A 2BOIA 5A3LA 4JC1A 3ZFEB 2QZ3A 3GCXA 2EXJA 1NA1A 2AC1A 1QU0A 3EMRA 2HWF1 4HFSA 5A7PA 3ZFFB 4R52A 2UWBA 1LOAA 5KXEA 4IEZA 2GDFA 3FMGA 3GBGA 4OLLA 4CEYB 2W95A 5LWBA 4J25A 4EWAA 1C5HA 1A34A 4QU1A 4CCDA 2VBDA 4XDQA 4IE5A 1OURA 1PO11 2ZACA 1JZ7A 2GAUA 3SKVA 5L19A 4XJAA 5GALA 2WSVA 1ZZ8A 1TMF1 1WCUA 2VMFA 2ZGLA 1JYTA 2GN7A 3M7AA 3HT2A 1TE1B 4QGNA 3TN92 5FPUA 3A0KA 1G8WA 1BVP1 3TEWA 4N9HA 1WWYA 3VKNA 4MGTA 2RM21 5JWPA 2RVAA 4QKDA 1YIFA 2JICA 5JOXA 1A6CA 1J3PA 1HV1A 3WG1A 2JDNA 1R081 3W5NA 4FTBA 3WQ1A 5A7OA 1XPWA 4GULA 3I2FA 4R9BA 4HKLA 1N47A 4CDXB 5FO9B 2E9QA 1RMU3 2BV4A 1YFUA 2XL7A 2OQ7A 2VUCA 3WG2A 1EUUA 4EN6B 1SMVA 4N53B 5DXDA 2XJRA 3P1IA 3RRDA 1S2BA 4AHXA 2C9AA 3WQ7A 4FT8A 4YFZA 1LOEA 1CIYA 4HBNA 5IVVA 5K0UB 3CJIB 1CZSA 1ZM1A 3TNQA 1RUC2 3WHUA 4IE6A 2VZ1A 3ZXDA 4B4RA 1V6MA 1NCQA 4I2OA 3ETQA 1X8MA 1DDLA 2GC2A 2W08A 1QQP1 2WZ8A 1MPXA 3U78A 5FYMA 4DIQA 4Z82A 3RYKA 1BEV2 3PUAA 1JODA 2VOKA 1POQA 3MIDA 4IEVA 1AR93 2Z42A 1PMIA 2R16A 1MS5A 3IAPA 2VU9A 4GMP1 3O1MA 1LECA 1UL9A 1A8MA 4RFT0 4LBQD 5APAA 3VBHB 2Z69A 2A6XA 3NVCA 4PIYA 2X53S 5FPZA 3MO4A 3J8F3 4OI0A 5JZGA 4XFHA 2NMNA 4QXBA 4BLJA 1FI2A 1JW6A 3V65A 3U37A 3K2OA 4UXAA 2GC3A 3N9MA 2WKKA 2R043 4FPHA 2QQPA 5J48A 1GNYA 4CCCA 5JSOA 4G3YC 2OA2A 4WVVA 1KXGA 3GBWA 1X50A 3ZYGA 1AVBA 4MHUA 4GWJA 2ERFA 1XE7A 3KF5A 2YBPA 3PUQA 4SLIA 4FP2A 2YROA 1CAVB 2VVDA 4Y26A 2JIJA 4RHV1 4D94A 2BBVA 1HQLA 1GOHA 1ODMA 5FV3A 4UBHA 3OBTA 4IV1A 3ZYPA 1CAWA 1YJLA 3WLUA 4FBFA 1JYVA 1L7QA 3AYEA 4IL7A 4Y5SA 2WS91 4D6QA 2P3IA 3DXTA 1VJ2A 1Q8SA 2BGCA 4XUNA 4AHYA 4YWAA 3S30A 4AI1A 4B1MA 5F8PA 5CFCB 4QPGB 5CISA 2HYKA 1YFYA 4KGQA 3ZXLA 1CWPA 1Q3EA 2E6VA 3BTXA 3I3BA 1JXNA 3I2OA 3WUDA 1RB8G 5D8AA 4P9IA 1W6PA 1AXKA 4HETA 4OQ9A 3FN9A 4F8AA 1RUE2 1LODA 2ETEA 2VQTA 3L9JT 1SLLA 1GYKA 4LKFA 5B4NA 4N43A 5FYSA 1UZYA 3THPA 3BCWA 3H42B 1ZBA3 3OBAA 3NO8A 4S2GA 1WLTA 2Q1MA 1DZRA 1QHDA 1AZDA 1Y3TA 1QJU3 1UWWA 5H9QA 1NY71 3C7OA 3NSTA 3KMHA 3SKJE 3LF7A 2G1MA 2W1QA 1HXS3 3BIWE 3LDBA 4GB32 4M3CE 4LJHA 1I9RA 2CGNA 2GP3A 1O3SA 2P2KA 4BB3A 3IDBB 4JKMA 4DPNA 5I8YA 1FNZA 1J3RA 1L7LA 2VOVA 3THTA 2L9LA 3POSA 3TRSB 1AR82 1FMD3 4XCBA 5FP4A 3BTYA 3ZOIA 5BUVA 5JPNB 2X05A 4YW1A 1WGPA 2BNMA 1IG0A 1QJY3 1UY2A 1OPOA 1KFXL 4Y24A 4FP3A 4XHXA 3HIFA 5FZBA 4WM7C 3BKZA 4XMAA 4ATEA 1VBB2 2OVUA 4AI3A 3HJRA 2DFBA 2WLPA 4GH4B 1OSGA 1YQ6A 5H9SA 1CQ9A 5C4WA 5K9YA 3ZFGC 3DYPA 4Q1RA 4V2VA 1VP6A 3ZYJB 2DCZA 1XE8A 1UKGA 4X8NA 1EV13 1HB1A 3MI8A 4FFHA 5LCWL 1ZRIA 1GZWB 5EYYA 3WNLA 5FMDA 1V70A 3C8XA 5CFDC 2G19A 4X6QB 1JYNA 2IXLA 4XZPA 4ES8A 2K2SA 3TN91 4AQSA 2A6VA 4AVTA 1RMU2 4KBZA 1IPKA 2G4IA 4XYXA 3UESA 4ZY9A 1TZOA 4JGYB 2WJSA 3VBRA 2V5DA 1JN2P 3WXPA 4E8DA 1N1YA 1CGPA 1YIPA 3B93A 4EN9B 2AACA 5CFCA 1F35A 1QJX3 4YNIA 2A73B 4Y1YA 1POV3 1R093 3AVSA 4UT5A 3VD9A 1SACA 4BPZA 4CDUC 3MLJA 1Y9QA 2WFF3 1R64A 4E4DX 5I93A 3Q8BA 3UL2A 2ENRA 4BYYA 2ARXA 1AR92 1NE4A 4LHNA 1PVXA 3D8CA 3F95A 3T2OA 4CUAA 5DMYA 2VNRA 3SH4A 3AZWA 1XOYA 1L3JA 4URTA 4OYUA 2QQOA 3TOJA 4I02A 5KHIA 3TEYA 1UD1A 1D4M2 1C3HA 1DQ5A 1CAUA 3E6BA 4FPGA 4MADA 4MGKE 4HG6B 2QQKA 4KMQA 3J8F2 4QQ2A 2PTMA 2OYZA 1RJ7A 1AYN3 4OFGA 4Q0SA 2DBNA 5FZ3A 2JDPA 1XYNA 2OS2A 4Q4X1 1FPN2 3PVOA 3W58A 1URXA 1OKOA 2AH2A 2K9ZA 1TQ5A 5IJRA 1NUKA 4DMIA 2H6BA 1B35A 1RXGA 1J3QA 1O6UA 4XBQA 4RQPB 4HXCA 5HCBA 4XF4A 2A75A 3FBMA 5FXWA 2VW0A 2ZX3A 3MF6A 4DEVA 1NKGA 1MZ6A 3U14A 2WNVA 2R062 4CDQC 1Q8OA 1WW4A 5LB6A 4AVVA 4FSJA 1MZ5A 3VKOA 5ERLA 4CCJA 2JG9B 1G6NA 4AEDA 3THCA 2RR11 1EAH2 1EP0A 2ZTNA 1Y4WA 4WM8B 2VOXA 2X8KA 5C71A 1NA1C 2C5DA 2XQRA 3N7MA 2UURA 2EXIA 3LDKA 4NIDA 2IUWA 5HXMA 1OLME 4HVQA 2DWRA 1ENRA 1OUSA 1WD3A 4FPYA 2DCYA 3LGRA 1X33A 2WL1A 3ZFFA 4JV4A 2YU1A 3PUSA 5LK7B 2JG8C 5CG8A 4CEYA 3S7EA 5KC5A 2ZXQA 4PQ9A 4QX5A 1AJKA 3SHRA 4XQDA 4Q5OA 3UKVA 1UCXA 3B7MA 1RUD3 1GQGA 2ZMKA 1ULEA 3A0NA 3JUUA 3BTAA 4JCKA 3V0AB 1IQAA 3MHZA 4DUXA 4JGZC 3RI9A 2RS31 4BXSV 4YVWB 4COWA 3ZN4A 5KXDA 3UNPA 2BYVE 4ITCA 3USUB 3T4VA 1J83A 4IETA 5FUIA 5FZCA 3NAPA 4Z1VA 1W04A 5LBBA 1HRV3 4WBBA 1VAVA 5IYYA 4IE0A 5EXOA 1WW6A 2ZEYA 3VBUB 4YM2A 3W59A 1FMD2 3I97A 2P3JA 1MS9A 4UI9L 1BK1A 4QB6A 4NIHA 4CDXA 2EVXA 3HQXA 3T0DA 5DUWA 5JSRA 4OZXA 1UX7A 4LXLA 5FXXA 2CDOA 4LLOA 4N53A 2Y34A 1NCQC 2BZDA 3NJZA 5F5QA 5I0RA 1ZX5A 3CHXA 1IS4A 3EO6A 5K0UA 1JZ2A 2RS12 5AFBA 4HK9A 2OXBA 5K8SA 1QGLA 1O4ZA 1VBD3 3S0MA 4LOTA 2NZ9A 4CXWA 3NKGA 3GBFA 3AB0A 3GDBA 2ZJCA 3D6EA 1U12A 3GZEA 4I0WB 1QKQA 3ME2A 2GH2A 2JD9A 1LEDA 5DG1A 3FBYA 1VBC3 3MBWA 4JZRA 2KM2A 4I30A 4YZ3A 4TZDA 1W8WA 4GJZA 1RGSA 1QOOA 4QQPA 3RG0A 3WV6A 4BQYA 2MHFA 2XDVA 2HWE3 5IUQA 4XHBA 3G7DA 4YW2A 1SFYA 5KHHA 3KT1A 2JECA 1DYKA 3HT1A 3NL1A 4UYBA 1PO13 2ZMNA 2I74A 3ST7A 1R092 5J37A 2HEWF 3J26N 1LJ7A 5T5PA 2JENA 1SLCA 5FPLA 2CHHA 2V4VA 4M3CF 5DDJ3 1DQ4A 1CX1A 3KS7A 3P3PA 3B01A 1LHUA 5GJ6A 4QX1A 2C0ZA 2YXSA 1ND3A 5CAZA 5DQ0A 1CAVA 4IV1C 1XBFA 3I2GA 2JKBA 2GMMA 4PLNA 3WDUA 1RUNA 4BDVB 3CQOA 2QUOA 3I3EA 4DNYA 4R9DA 4XURA 1CVNA 4BU2A 4Q8LA 1CD3G 2P34A 2P37A 1AYN2 4M0NA 4XEZA 5FY4A 3OSDA 3OYWB 4CUGA 2QQWA 4JKLA 3U1XA 4B8EA 2AEZA 3Q9OA 2OPWA 5FY9A 5ABJB 2CGPA 4E4ZA 1CN1A 3H1YA 2VCBA 3HR9A 1RUG2 2D3RA 2D5FA 2YB7A 3J8F1 4O61A 4RS5B 5D8AC 5DAVA 4FTEA 1K12A 2R073 3IDAA 4IV3B 3UV9A 2JX9A 2F6BA 3HNBM 2EAKA 1YO8A 4INDA 2R041 3QCWA 5A7WB 2WR9A 4N43C 1O59A 5FZOB 2BW8A 1E57A 2G9FA 3ZPOA 1K5JA 1LESA 3VBFC 4P9YA 3VDDB 3RJ2X 2YC4A 3WD5A 5IK8A 1LTEA 4MXWB 3BIEA 3NRUA 2FMYA 1OI6A 1YUDA 4IEWA 2WYFA 5FPVA 2TNFA 1NAEA 1GNZA 3DN7A 2IXHA 1SBEA 3AXEA 2JDHA 2QCSB 2Q5TA 1S0DA 3H0OA 1S0JA 3VV1A 4NIIA 2ZPXA 5IWFA 5LEKA 3WNXA 5A3WA 2XVKA 1IHMA 4FFIA 4QD2A 4PDWB 5FFOC 1SDDB 1XE0A 1SPPB 1WLWA 2R1DA 3GZUC 3B9CA 3KF3A 4IEOA 4W4ZA 5A7SA 5C4WC 1G9DA 5KBFA 1REDA 1S0EA 2EIGA 2W46A 5FY0A 1AR71 4LHKA 4MXVA 1GUIA 2JDYA 1QNWA 3VHPA 5A6XA 1QY4A 4GIQA 4AEKA 4GH4A 1DGWX 3RPQA 3SCHA 2CU5A 1GQPA 4B4PA 4Z8BA 2DVGA 3FLRA 4D7YA 2PFWA 3U4XA 2DDUA 2WAAA 4TN7A 3IAQA 1IPJA 2XOMA 1GZWA 1X82A 4MVTA 1LHOA 4SBVA 3U11A 3ZYBA 1ZBA1 3WF3A 1HRV2 5GM0A 1GFF2 4AXOA 2IC1A 1TME1 3RNSA 1QJU1 1XU2A 1YRZA 2AR6A 3CDZB 5EHDA 3SEEA 3T08A 5BNPB 4Q4Y3 3VBRC 4ZONA 3J4UH 2PHFA 4B29A 4HN0A 1HXS1 1NLSA 4XBLA 1V6OA 2RDSA 3NNGA 1XNTA 3AKTA 5A7QA 2VZOA 1ZREA 4XFCA 1KD7A 5FUNA 4YZ2A 5LZ6A 3O1UA 1Z7S3 4OI1A 4JGYA 5IAVA 2WN3A 5C70A 3IT8A 4LKDA 2W92A 1AYM3 5I91A 4NRMA 4CCKA 3HQRA 4OHYA 1RVF3 2BJSA 2YHJA 3UKTA 1YYNA 2A7AA 1EPWA 1QJY1 2ZKLA 1WCDJ 1S55A 2WFPA 1VBD2 2WQZC 3UGGA 2CDPA 2IXJA 5FBJA 1NCRC 3D4KA 1IS3A 2B39A 4EWEA 1WUVA 1WKYA 4XJUA 2R0HA 2PQQA 2ZABA 1N3QA 2MEV2 4BMEA 5D1IA 4DXSA 4XTPA 3E5UA 4AE2A 1EV11 1GLHA 4R9CA 4LK6A 4YVSC 4ZS3A 4BM8A 2HWF2 1G9AA 2XLGA 5A32A 4HL0A 2YY1A 3PVNA 3RS6A 1WA4A 4L2NA 3RDIA 1CPMA 5G04L 1OA4A 3POBA 1RUH3 4FI9A 2VBPA 3MIEA 1UOJA 1FYUA 1SBFA 1VLNA 1W3XA 1B35C 3KCCA 3UKNA 1PO12 3JB4C 1SEFA 2Y6FA 1VBE3 4WZCA 1W8FA 2YUEA 3LDRA 5A3PA 5SV8A 4FAGA 1TMF2 3O1RA 3FFZA 4FQ4A 3PHMA 5BNOC 3ON7A 2BNOA 2XJTA 3K77A 4OMDA 1QJX1 2WNVC 2XH6A 3IN9A 1ASJ1 1POV1 2C24A 5GZEA 1R091 1VR3A 5T5OA 2VTFA 4E8CA 2RM22 4DY5A 3H7YA 2BVBA 3PJQA 1LB2A 4IEUA 3WP4A 4AEDC 3I3DA 4M00A 2P1BA 1R082 3R4SA 2V5YA 2WFF1 3AVRA 2YDEA 2UY9A 3IDEA 4FPLA 2WBKA 3O14A 2DV9A 3O5SA 5T55A 3O0WA 2PHDA 4F83A 5J36A 2Q8OA 4GMP0 2ZX1A 1CAXA 1R1A3 2YBSA 3ZFEC 4WM8A 1NT0A 1OQEA 1G86A 1H6XA 2B9UA 4OI2A 3ZFFC 1OF4A 1H2NA 4DEQA 3V0BA 4XBNA 3KD4A 5FUPA 1DQ0A 1H8TB 2VUDA 4CEYC 2MPFA 2R072 5TSWA 4XCAA 1ENXA 1QQP2 4QX2A 3RMYA 5CIRA 1G9BA 4Y1XA 1OT5A 2BVVA 4EN8B 2YBKA 3CJXA 4FXGB 4I3PA 4XFBA 2BPA2 4WM7A 3NKTA 5EV7A 2TBVA 3V0AA 1S0FA 1OBNA 2RDQA 3KV5A 4KG8A 4RL7A 4XPVA 2W47A 3ZXFA 1ULOA 4YVWA 1RINA 1W6QB 5F39A 3ZVXA 3HAGA 2VECA 2BEOA 3GZTB 3AM2A 3R05A 4M4PA 3ZIWA 5CFDA 1UF2C 5I8TA 2WO3A 2YYOA 5JR2A 3OY8B 4CDXC 1O8SA
chains in the Genus database with same CATH topology
1UIJA 2CGOA 3VBUA 3H7JA 4N53C 2WNUB 4YARA 4OHXA 1RUF3 5K0UC 1PIV3 4YGBA 2FZ1A 4AFCA 4G9SB 1NE6A 2ZHNA 1DGRA 5DG2A 3GALA 2LALA 4AHWA 1I6XA 4BLIA 3KM5A 1SLTA 3M3QA 4CDUA 1RUD1 3D5OA 4PBOA 3JD73 2NMOA 4CZSA 1ALYA 2PYTA 2JDZA 2WS92 2EF6A 1RTVA 4I0BA 5JMCA 3VBHC 2AENA 1ZZBA 4Q29A 5T50A 3ZX7A 1AX1A 5BXXA 4BCUA 4Q4Y2 1AL23 4A3XA 4YW3A 5I8SA 2IFWA 4EWDA 2Y0OA 4Z92B 3PMSA 1JYIA 1Z7S2 3V64A 4X8PA 5FO8B 1W6MB 1ND2B 1Y43B 2GMEA 1RVF2 5KWRA 2AYHA 3BALA 4AQ6A 2B7YA 2JD4A 4WV8A 4LBOA 5BYNA 1NY72 2DCKA 4Q27A 4C1XA 1AR63 5GLVA 2ZX0A 1VRH1 2DVBA 3ZN6B 2N7GA 3KLSA 1VBD1 5I0SA 3E6CC 2Z79A 5JLVA 4JDNA 1PVC3 1RUH2 3FLPA 1VBC1 1FAYA 5CFCC 4QPGC 2D6OX 1YJKA 2BFUS 5C8CB 1UX6A 4N90A 4KWLA 4TYSA 2HWE1 5FMOS 4P14A 1MS3A 4IESA 5I0TA 4HPKB 2JG8A 3ZMNA 1NOVA 3HBZA 2XJPA 1DQ2A 3AMQA 4IXLA 1S0GA 1ONAA 2XBO1 5DDJ1 1GBGA 2JE7A 1KJRA 4XFAA 3JZVA 4H7MA 4LBMA 2QVSB 3RI8A 4HKWA 4O9EA 3ZMOA 2UWCA 4JGZA 5GZCA 4M3CA 3QBQA 2R6QA 2HWD3 3ECQA 1R1A2 1V6NA 2Q1ZB 4ISQA 3VN4A 2E51A 1PZ7A 1AF9A 2C1FA 3VL8A 2XLAA 1X7NA 4MGZE 1UU6A 1WBFA 4H3WA 3AP9A 3WW2A 2YGMA 4HVRA 4RD7A 4PDWA 1H1IA 3AYCA 3ZSEA 2VVEA 4GH4C 2R071 1GICA 2H0VA 1W6OB 4LO7A 3AFKA 1O3QA 4D69A 1QOSA 2PLV3 4FXKB 2TUNA 3BOWA 1U5ZA 4U36A 4AVBA 4AI2A 2GSYA 3H1WA 4Q4X2 1FV3A 2VUJA 1WCKA 2DUPA 3SITA 3N3HA 5BNPA 3W9AA 4JGYC 3OCPA 1MEC3 3QACA 1OMIA 2B8MA 4D3WA 4ORFA 3VKLA 4MX3A 2DVDA 1JHNA 3KGZA 4HANA 3E97A 2X5IB 4ONUA 1UW8A 3WW3A 3MLLA 1MZEA 4Y20A 2H6CA 2RR12 4PLOA 3JD72 4R8HA 3AP6A 1PGW1 3LSEA 2NP0A 3VZOA 1BVVA 4RGGA 2UY8A 3B00A 4CP0A 4QM9A 1QDOA 3MEPA 2ZGTA 2JEMA 1JOJA 3VBOA 4OVEA 4XF3A 1HLCA 3N7KA 2XGXA 3RQ0A 2G9GA 3MZHA 2B45X 4Q4Y1 5J96B 5KHJA 3VUOA 1OD5A 2YGLA 4YGCA 1AR73 2FZ2A 1Z7S1 2A5ZA 2RS32 4XMIA 1AYM1 1LOCA 2LUWA 3HN1A 1QNYA 1RVF1 4KQ7A 1KS5A 4NR1A 2JG9C 4W6WA 1GSLA 1TME3 1Q8PA 1PVC2 2XJUA 3VBFA 4RSUA 4WM8C 3NW4A 2UYBA 5FPXA 1EYBA 3LWCA 4WVMB 4OHZA 1J1TA 3MIFA 5IK7A 3C2UA 3O0XA 1O91A 1BBT3 3VZMA 3AYDA 5FLIA 1JH5A 1Q8QA 1RUH1 3GF6A 1H8TA 3LA2A 1FOD1 4C0HA 3WG3A 5BPXA 3UJQA 3ZSJA 5J3UA 1VBE1 4CP1A 3SCGA 1LGBA 1NZCA 3N35A 1AXZA 2VUAA 1UAIA 3WDXA 1U5YA 1LGCA 4EV0A 4YVWC 1G7YA 3IIAA 3PVBB 1YLLA 5DZEA 4MYEA 1LR5A 1J59A 4GA9A 4D7TA 1W6QA 1CONA 3VBUC 4XILA 1DF0A 1N3PA 1XNKA 3MFCA 3NV4A 1J58A 4J1XA 4KNCA 1R1A1 2MNGA 1GQHA 1VAKA 3EHKA 5E89A 4YSFA 2VGDA 3QH7A 4CYDA 1ASJ3 2FHRA 4ZU4A 3VZLA 3D82A 4Q0VA 3B69A 3VKFC 4FAHA 2DCJA 1H1AA 3AP4A 3ZYIB 1H9WA 2D7FA 3ZPYA 2W68A 1NCRA 1U0AA 1HIXA 5FQ0B 1W6NB 2GNMA 5HCAA 4W65A 5C9AB 1BZWA 4XQ4A 5T3NA 2QDNA 1M4WA 4LO6B 1LOBA 3ZDSA 4Y1UA 4YVSA 1IGOA 4YGEA 5FO7B 2AGSA 4IEQA 1NG0A 1PNGA 4R9AA 1BMV1 2FBEA 5AC93 1LHWA 1F31A 2R042 2NN8A 4YG0A 3ZXKA 4LO4B 3RMXA 2VVFA 3M3EA 4QM8A 4WVWA 2BNNA 1GZCA 4AG4A 1ND2A 1FV2A 3QH6A 4DFSA 1RUF1 1PIV1 4LBNA 5BNOA 5EJ3A 1GKBA 3KT7A 4FPOB 3DGTA 1WLCA 1S0CA 5CADA 4COZA 5FDBA 5CBLA 2H0BA 3ZN6A 3JD71 1BKZA 1HQWA 5JIUA 2EXKA 3UJOA 3ATGA 1DG6A 3AK0A 4COVA 2E53A 2KXLA 3EQEA 5ABJC 2FQPA 1AL21 3ZFEA 3WHTA 3GZAA 4E4SA 4QU2A 2XVLA 3BOPA 1AR72 3R4UA 1ENSA 1DGLA 3AMNA 4OHWA 3TNPB 3LOBA 2RHPA 1F8VA 3CEWA 4CDWB 1LU1A 2YC0A 4HPKA 2HJIA 3WP5A 1ZBA2 3L2YA 3GHMA 3ZN5A 1TME2 3VDDC 1QJU2 3FC0A 1AR61 4W6XA 2D5HA 1WW7A 3EXUA 1HXS2 3AP5A 4P9LA 4RR3B 2UWAA 3I7DA 4AWDA 4BE3A 2VXRA 1Q8VA 3ENRA 4UBGA 1PVC1 4LUKA 3MGUA 1BYHA 5KXBA 3H50A 4NWVA 3RZZA 1QJY2 4CEWB 1C8M3 4PDWC 1GV9A 1LEMA 4KWJA 2NPIA 4XJZA 4P5HA 4WZFA 4Y22B 4YZ4A 2DVFA 3ES4A 2P17A 3CJIA 4YGDA 1VRH3 2Y0IA 2XJVA 1YFXA 3FUQA 2XL9A 3P3NA 3X29B 1EV12 2RMU3 2VULA 2WZR1 3KB5A 2WIIB 5DZFA 1POV0 3VBSB 2IFRA 2E7QA 4S2FA 1JYCA 3FWEA 1VB2A 5JR7B 4DRRA 2HWC3 3IPVB 5A33B 3MIHA 5BNPC 2QJVA 3ACLA 3MICA 3VBHA 5BNNB 1PNFA 2A71A 3E5QA 1H1MA 1LOGA 2HWD1 4NHLA 4GQ7A 3IKWA 1OQ1A 5DZGA 1QJZA 3A4UA 3ILRA 1QJX2 2CWMA 4DINB 1ASJ2 1H4GA 1QH7A 4GALA 3SMHA 1PZ9A 4A2UA 4B7EA 4JAAA 2ZGNA 1A78A 2V09A 2XBO3 4OI4A 2WFF2 4TWTA 2PHWA 1V6IA 4CP2A 2X5IA 4ES9A 2R1BA 3ROUA 2D98A 4K6BA 1KDMA 5LK5A 3AKQA 4KU7A 4N9IA 3N4MA 4PBPA 5EWSA 3T1MA 2PLV1 3NV3A 1OOPB 3VBOC 1AJOA 1BXHA 4K7JA 2VMHA 3C3VA 4HLTA 1V6KA 1NLRA 1ZBE3 4META 4B3NA 5L73A 4HSLA 3LA3A 4E9KA 3V56A 3SH5A 2YZ4A 4NN0A 4XFGA 1RHI3 3VZJA 2VNOA 4QPGA 4LE4A 4F7ZA 1MEC1 1SLAA 4GKXA 1SLIA 5CFCA 2D3PA 3AZYA 2JJ6A 2Z2SB 1UKRA 4JVAA 4C1WA 4Q26A 4TLFA 3OD4A 2ZGKA 3KSCA 3ILFA 5J09A 1G9FA 1VAMA 4S2DA 3FJSA 1C28A 3GHNA 2ZAHA 1I3HA 1QXPA 3MW4A 3WX5A 2YMZA 1TEIA 4KH9A 4LLFA 4AFDA 2VW2A 1NXMA 4NHMA 4QGLA 5F6LB 3TAYA 1H2MA 4P9XA 4WVMA 4YRDA 4MLOA 5FBZA 3RYRA 1COV3 4KL1A 3J9SA 1H8TC 4EN0A 4QPIB 1O3RA 1UU5A 4L97A 1DU3D 1PGL2 1F5JA 3MDPA 4RA0A 1RUD2 4JDOA 2NYYA 3M3CA 1N1TA 3N7JA 3WY6A 4U2AA 1YCIA 5A3MA 4XW3A 5AVAA 3PMEA 2BFUL 4QXKA 3MW3A 1PO23 5FMOL 1JUHA 4BWOA 1RUI3 4Y4YA 4AK3A 2ZX4A 1ZZ9A 5GLTA 4AVAA 1DBNA 4CTEA 1S2KA 2WNUC 2HWB3 1BBT1 1GZ9A 3B02A 1TNFA 1AX2A 4NPRA 4XJWA 4YG3A 5T5LA 5FOBB 2EALA 1VRH2 3MIGA 4LA3A 4Q2FA 5ACA3 1PGSA 3WVJA 4I01A 4YM3A 3ES1A 4PIZA 3WP6A 1ZZ6A 5JZGB 2XPJA 1H9PA 4V1PA 2HWC2 1REEA 2I2SA 1VBC2 3LA7A 4YLZA 4ATFA 5C8WA 1LULA 3KT4A 5T52A 2GC0A 1K5MB 1FX5A 1VBA3 1ZNPA 5EYXA 5L7OB 2CAUA 4NO4A 2HWE2 1T6GC 4E27A 1QF3A 1FATA 1FOD3 3M70A 3MYXA 3POYA 2K0GA 1V6JA 1ND2C 1VALA 2W0XA 3DF0A 2R49A 2XBO2 5DDJ2 1V00A 1LGNA 1RL3A 4IV1B 4RQPA 4TSVA 1CAWB 3CL1A 1OA2A 1UIKA 3S7IA 3LB9A 5B2GB 3AXDA 2PAEA 1WMEA 2PAKA 4P9GA 2XWJB 3B5LB 1W2UA 2JG9A 3FFQA 2ZGMA 4GWNA 4JTNA 2B46X 4HSJA 2B42B 2A6WA 3BU7A 4LBKA 3WR0A 1OFNA 1RIRA 3IWZA 1W6PB 4LBQB 5AFEA 4A7ZA 4Q4W1 4E2QA 2VMIA 1UZZA 1XYPA 1ZA4A 1UMZA 1RHI2 5C8CC 1O7FA 4WVZA 2ZKNA 3WDVA 4XE9A 3DL3A 2HEYF 5AC91 1RUOA 2PHLA 4MGIE 3T1LA 3AMHA 4QQOA 3TWIA 3USSA 1QWRA 4CDWA 4YW4A 3HMYA 2QDRA 2OZ6A 3MF9A 2PA7A 4XF1A 3EJKA 1V6LA 2ZX2A 1MACA 2ZGSA 1OLQA 3ZIXA 3USUA 3BPZA 3IDCB 2A6ZA 3T2TA 5IK4A 1QOTA 2XG3A 5C4WB 1X8EA 3AKRA 4C91A 1DIWA 2VOWA 1RUC3 1PHMA 5L36A 2LTNA 2XHKA 1MVEA 3CJIC 2PHTA 1ZZ7A 1PGW2 3OGJA 4H55A 4Y22A 2DU0A 1PGL1 3JU9A 3DPRB 2CAVA 4XXPA 3RYPA 2ZCWA 4YM1A 2OPKA 4ZKTB 3TYJA 3H3ZA 1PO22 1PK6B 2VH9A 2ZOEB 3NV1A 5CB7A 5JOWA 4YZ5A 4I3GA 1KFUL 1QMJA 2GH8A 1AXYA 4K1ZA 4MSVA 1MQTB 5BNNA 2ZHMA 4O9GA 4FO9A 4AQTA 2D6KA 5KXCA 4GXLA 4L99A 1AYM2 4EROA 1D4VB 1DGWA 3E5XA 1C8M1 2X5IC 1CIWA 1IKQA 1U5IA 4FPEA 3MPBA 4DY3A 1CAUB 4UW5A 5JI9A 4H14A 5AVPA 1RUJ3 1MZFA 2RMU1 3JBG3 1YNAA 2ET1A 4NWWA 2ZBJA 4R4ZA 5T5JA 2HWC1 4GKYA 1UPSA 1GR3A 1OOPA 1FOD2 1KJLA 4XIOA 3ZSLA 3OYWA 1SQ4A 1VBE2 3LSDA 2WNVB 4P9JA 3RSJA 3WW1A 5ABJA 3SNMA 3URFA 4K9SA 4LT5A 2HKXA 3MFAA 4RS5A 4AEDB 4QMAA 4IV3A 2WZR3 4ASMB 4AHZA 2IXCA 5BY5A 1JTZX 4PJYA 2W39A 2DF7A 2O8QA 4LTAA 4GB33 4LULA 1NXD1 1CJDA 4L92A 1IOAA 3DUIA 1AL0G 1H4HA 1XXNA 2QKDA 3VDDA 5I0UA 1X36A 2ZHLA 1LHVA 1AR83 2VY0A 4Q4V3 1PZ8A 4MXWA 1ZVFA 1MS0A 3I54A 1WMFA 2TEPA 1ZBE1 1VBB3 4QPIA 2AZ5A 3B9IA 5C33A 3N7LA 3QOPA 4D7SA 2CY6A 4UW6A 5E8AA 1RHI1 2JE9A 1RC6A 3NAPB 5GZDA 1HRI1 3JCIA 4AGGA 1M06G 4Q8KA 4AFAA 4AEJA 2P3KA 4IQPA 4S2HA 3SCFA 3FZ3A 5FTTC 1BMV2 3VKMA 5HCFA 3JB8A 4JRLA 4YM0A 2DU1A 2LM3A 4XETA 2RS51 1MS8A 3ELNA 1REFA 1ZYBA 1J1LA 4PF5A 1LOFA 1OA3A 2NQYA 1HX6A 1RUF2 1PIV2 1Q56A 1COV1 2V73A 3L2HA 4AGRA 1D0HA 3VLBB 3OGGA 3LAGA 4N7UA 3INAA 4L9BA 4B4QA 3LZZA 2WA4A 4XJ9A 2DFCA 1D4M3 3D0JA 1YI7A 1XNDA 1XNBA 4KBBA 1OFSA 5C9AC 4FOWA 2D93A 3N36A 1AL22 4IEYA 1FPN3 3VL9A 4Y1VA 1OQDA 2XVGA 3WINE 1PO21 2PN5A 2WA3A 1K5MA 4AVSA 1RUI1 5L7OA 3I4IA 2DUOA 4FOVA 4PLMA 1ND3B 5F6KA 1ENQA 2ZGQA 4FTSA 4K3UA 4RQPC 5JOYA 3FE5A 4AW7A 5CVRA 2R063 1PM7A 3AJZA 5JCTA 1MR5A 1APNA 2HWB1 4YFWA 1DFQA 4E2SA 1AR62 2BTVC 3G6JB 3U10A 2O0OA 1EAH3 1VB4A 1RUJ2 2WSUA 3IMNA 4AYUA 5ACA1 1WLDA 2PHXA 3JBG2 3AZXA 5FLJA 1I1EA 1C5IA 2XUMA 1G9CA 2IXIA 3PJYA 1MS1A 3MPPG 1XYOA 3H1MA 2D6NA 4JRAA 1SCRA 4Z07A 1H0BA 4FCAA 1ZRCA 2SLIA 4LBQA 3H3UA 1VBA1 1O5UA 4MV2A 2XKOA 4K8FA 3ZSMA 2QZ2A 4J1WA 5DUXA 1MVQA 2WWSA 3OPZA 4K1YA 2WZR2 3B3QE 1EY2A 4CDWC 3MLKA 3FHIB 1R1ZA 1QXJA 1OLRA 2WINB 4XTMA 1DQ1A 2WNEA 3E6DA 2ZGOA 4KG0A 1O4YA 2ARBA 1Q5OA 5FREA 1XU1A 2R0FA 1SLBA 3BODA 2HWD2 5JIAA 3R4DB 4RR3C 4Q4V2 5LRRA 4LR4A 1DQ6A 3D0SA 5FCCA 3VHRA 1YWKA 1CJPA 3NV2A 1LCLA 3OY8A 4R4XA 4Y1ZA 4CEWC 4PCRA 3FUOA 3QLQA 5CG9A 4BQ1A 2RS13 2DYCA 3LKJA 4NHKA 2WNUA 5GLZA 3CNAA 2VPVA 1ZRRA 1LU2A 2DURA 3VGIA 2HEVF 4XFFA 3VBSC 4DXZA 4YG6A 3BB6A 2PLV2 3DPRA 4XXAA 1KDKA 4W6YA 3ZSKA 1S0BA 3WDYA 2CTVA 4OULA 1BQPA 4Q4W3 1PK6A 2QNKA 4AEMA 5BNNC 4LA2A 1YFWA 4FOYA 4CRQA 1MEC2 1WD4A 1DYPA 1C1FA 5K7PA 1MQTA 3I59B 3AP7A 2D44A 4YW5A 2VQAA 3SLIA 2ZGUA 3M2MA 2NM1A 1V9U3 3I2DA 1W6MA 1RUC1 2VMGA 5EZWA 4Y5Z0 5A32B 3PLQA 3WDWA 3VZKA 2YV8A 1BEV1 1OPMA 1ZRDA 2D3SA 5JDBA 1W0PA 1HV0A 4XFIA 1JBCA 1GANA 3AYAA 4FQZA 1OOPC 4BOWA 2VW1A 1RUG3 4HKOA 4IEPA 3ALQA 3B94A 4Q1PA 1Z0HA 3WOGA 4E2GA 4EN7B 1AUYA 1CX4A 4QPYA 4RS5C 2OIIA 2ILMA 4IV3C 1I5ZA 2XJSA 5C8CA 5HBAA 2NLRA 3OF1A 4JQRA 3VZNA 1GNHA 2OUJA 4LHLA 1VIWB 2ZA9A 1CAXB 3ZXGA 4OHVA 4OUSA 2WT2A 2A3WA 4MZUA 3DV8A 3V0BB 1C4RA 5JI7A 4COUA 4BA6A 1RUJ1 2ZMLA 4MH0E 1N3OA 3OBRA 2CWSA 3JBG1 4UW4A 2D97A 3ZXAC 3O0VA 1XRUA 4Q0PA 2F4PA 1BBT2 1OKQA 5HI0A 4DS0A 1IKPA 2GU9A 3POWA 4XJ8A 4QPIC 4WM7B 2Y38A 1YXWA 1U5XA 4LBJA 4M0HA 3ZFGB 4JTOA 2IXKA 4XIKA 2SBAA 2QE3A 4AI8A 3GYDA 1XNCA 1SCSA 1C8NA 1RUE1 5GKAC 5J7MA 2RJKA 4K21A 4C0BA 1D2SA 5CFDB 5LEJA 3PVEA 4QGMA 4Z2WA 3JQWA 2GC1A 1W6OA 2ATFA 5E16A 2PELA 2PAMA 2DCTA 2UU8A 1NYWA 2ZGPA 3DKWA 3AFGA 4XF0A 4GB31 4PIXA 3WP3A 2Q4SA 2ZZJA 3IBMA 1LOFC 4FPKA 1DZTA 4HMZA 5F9TA 2X29A 3AZVA 4HZFA 1AR81 1A8DA 3PNAA 4Q4V1 2CV6A 4CDUB 2UYAA 3MIBA 1H2LA 2GMPA 5FAXA 5BV6A 2GALA 1B09A 1IS5A 2ET7A 1H2KA 1VBB1 2D6MA 2DUQA 3U07A 2MEV3 2D6PA 2DTYA 1LENA 2HWF3 5JZGC 3GNEA 4X6RB 1HW5A 3K51A 1W39A 4Q4W2 1ULCA 3IM0A 2A6YA 2FMDA 4N7IA 1K5MC 4IERA 3SISA 1RMU1 5L7OC 5FLHA 1D0GA 5JOZA 1YHFA 1ULFA 4FOQA 1Q43A 4LE3A 3AMPA 5AC92 1TMF3 3U0ZA 3AKPA 5E1RA 3AX4A 4A7YA 4DRVA 1NQJA 4P9WA 1V9U2 2XLFA 4BH9A 3WG4A 4B7KA 1S0IA 3KCYA 2RM23 4CDQB 1HRI3 1WMDA 4AGVA 3TB0A 5J98B 1R083 3KGLA 1BJQA 3KCXA 2XKPA 2GNDA 4ZU7A 1FXZA 1AR91 1TNRA 2D43A 3K48A 1W0OA 1NA1B 4BHPA 1FT9A 4G4FA 2RS53 1AX0A 3O12A 2WT0A 4MGYE 4DOUA 1D4M1 1KQRA 4HVOA 2JG8B 2ZGRA 2B5HA 5DUUA 3FLTA 1QQP3 1FPN1 2O1QA 1UN1A 1DGRN 5GLWA 2R30A 2CL2A 2E7TA 4GMP3 1DZQA 4JGZB 3SXWA 4M3CB 1IZ3A 4ZU5A 3WUCA 1S1AA 2R061 3LOIA 1SFNA 1D2QA 3APBA 2W52A 1QDCA 4BZ4A 1N1SA 1EAH1 2I07B 1QH6A 3H9AA 3WW4A 3ZXEA 3CU7A 3M1HA 1OHFA 4YZ1A 2QFEA 5H9PA 1NCQB 2Z5WA 2CNAA 2ZAAA 1O5LA 1C8M2 2EXHA 4RHV3 1F5FA 4K40A 1HDKA 5KHGA 4DQAA 2Q30A 2OUHA 2DVAA 1UU4A 2O8OA 5BNQA 3WDTA 4AI0A 2A3XA 3KZ4C 4LNVA 2RMU2 2WS93 4QT6A 3DPRC 5GZFA 3AKSA 2EA7A 4QQHA 1RJ8A 1YI9A 3AJYA 3H8UA 4LO8A 2ZHKA 3M8LA 4KU8A 5GZGA 1PK6C 2EAAA 1F2NA 5FQ0A 1CESA 2BWCA 1W6NA 3KQRA 5FRAA 5C9AA 4A7KA 1FMD1 1MQTC 3VHOA 2OW4A 2AUYA 2VNGA 4Y20B 4YYOA 3I59A 1IS6A 2XJQA 3M3IA 5F1RA 3LCPA 4FVVA 4L11A 2DTWA 2RS11 4COYA 1LHNA 4FPCA 4XF9A 3ZXJA 5LRSA 2WQ4A 2D6LX 3VBOB 3RWNA 4KWKA 4ZXKA 2IWGB 1H30A 2RE9A 2Y26A 3ZYRA 3CO2A 4K20A 4Q0QA 4XQWA 3WCSA 4C90A 2ZS6B 3CLPA 2WC2A 2GZWA 1CPNA 1ZBE2 5D8AB 2WZPP 1Y7BA 1C1LA 4AVCA 5KC6A 3CF6E 4GWMA 1WCSA 2BQPA 4RGAA 4KGGA 2ES3A 4N43B 1WW5A 1HRI2 4LEJA 3WQ0A 1KRIA 3AMMA 2IZWA 3VBFB 1AHSA 4HK8A 3TN93 4DZGA 1V9U1 2CYFA 2WT1A 1MS4A 2ZZQA 1A3KA 4EJRA 3AZZA 3S6PA 1F9KA 4FPJA 3M4FA 3HWJA 4NOTA 5GLUA 5IK5A 4J6GA 2RS52 1DHKB 3WCRA 4M01A 5CU1A 2KA3A 4ISRA 5IT6A 5JPMB 1HQNA 3NWKA 1AYN1 4F3JA 2JXAA 4RR3A 1CR7A 1COV2 3O7OA 4HT1T 2WLQA 5CNAA 1JUIA 1ULDA 1RUG1 1ZZCA 1N1VA 4QQLA 3MW2A 4ASLA 5JSPA 4CEWA 1ULGA 2GNTA 5T54A 1BCXA 3ZFGA 4L8QA 1BEV3 2RJLA 1UPIA 3NAPC 4LO5B 3UK9A 1C57A 1WBLA 4QHBA 4UW3A 2BUKA 2D40A 2GN3A 3QD6A 4Q4X3 4I0AA 3FX3A 3ASIA 3VBSA 3VBRB 1O3TA 2PHUA 2PHRA 1RUI2 4MUVA 2E63A 2R32A 4NVPA 3IPVA 5A33A 5FOJB 5E88A 3TBDA 1SBDA 1HKDA 1DLLA 3OTFA 4LBLA 5HXVA 4LUMA 3ZO0B 3JQXA 4HN1A 1QXRA 4RHV2 4BIOA 2HWB2 1XQNA 3PTYA 1SDWA 4IEXA 1NCRB 2RR13 2A3YA 3EBRA 1ZRFA 5SV5A 5ACA2 4YVSB 4FPFA 1O4TA 4XOGA 4DB5A 5C6CA 1RITA 2VQ0A 3HD8B 5CA6A 3I8TA 1HRV1 5H9RA 4AFBA 3WZ1A 1B35B 4AF9A 3R6SA 1VBA2 4JDMA 1KITA 2E7AA 2BWAA 1Z78A 2OZJA 1FNYA 4OUMA 1LKNA 1NQDA 3VHNA 5BNOB 1LRHA 2GNBA 1ND3C 2RS33 5KHKA 4AQ2A 4H7LA 1RUE3 5DUVA 1EPZA 4BIFA 3OD0A 3OJBA 4Q0UA 4I09A 1KS4A 3M3OA 5JVVA 5JAXA 3ILNA 3SH3A 4CDQA 2AREA 5EFUA 2Q0AA 2XB6C 1H8VA 2XWBB 2VG9A 3WT3A 2YPJA 4AFMA 2A70A 4BMBA 3RJRA 2MEV1 3R0RA 2I45A 5A3LA 4JC1A 3ZFEB 2QZ3A 2EXJA 1NA1A 1QU0A 4HFSA 2HWF1 3ZFFB 4R52A 2UWBA 1LOAA 5KXEA 4IEZA 2GDFA 3FMGA 3GBGA 4OLLA 4CEYB 4EWAA 1C5HA 4XDQA 1PO11 2ZACA 2GAUA 5L19A 4XJAA 5GALA 2WSVA 1ZZ8A 1TMF1 2ZGLA 2GN7A 3M7AA 3HT2A 1TE1B 4QGNA 3TN92 3A0KA 1G8WA 1BVP1 4N9HA 3VKNA 2RM21 5JWPA 1YIFA 2JICA 5JOXA 1A6CA 1J3PA 1HV1A 3WG1A 1R081 4FTBA 3WQ1A 4GULA 4R9BA 4HKLA 1N47A 4CDXB 5FO9B 1RMU3 2E9QA 1YFUA 2XL7A 3WG2A 4EN6B 1SMVA 4N53B 5DXDA 2XJRA 3RRDA 4AHXA 1S2BA 2C9AA 3WQ7A 4FT8A 4YFZA 1LOEA 5K0UB 4HBNA 3CJIB 1ZM1A 3TNQA 1RUC2 3WHUA 3ZXDA 4B4RA 1V6MA 1NCQA 4I2OA 3ETQA 1X8MA 1DDLA 2GC2A 2W08A 1QQP1 4Z82A 3RYKA 1BEV2 2VOKA 4IEVA 3MIDA 1AR93 2Z42A 1PMIA 2R16A 1MS5A 2VU9A 4GMP1 1LECA