3VZOA

Crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) n35h mutant with glu78 covalently bonded to 2-deoxy-2-fluoro-xylobiose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
b'ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGHFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
molecule tags Hydrolase/hydrolase inhibitor
source organism Bacillus circulans
publication title Strategies for modulating the pH-dependent activity of a family 11 glycoside hydrolase
pubmed doi rcsb
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vzoA00
3WP6A 3WR0A 3VZLA 3VL9A 3LGRA 2BW8A 4XQWA 1XYPA 1ENXA 3RI8A 3AKSA 3VHOA 3AMQA 3RI9A 1OA4A 3M4FA 3AKRA 4HK8A 4HKOA 1OLRA 1TE1B 2DFBA 1M4WA 1REDA 2BWAA 2JENA 3MFCA 2D98A 1XNDA 4S2FA 3B5LB 1XYNA 1AXKA 1F5JA 2B46X 2BWCA 3WQ0A 1QH6A 3EXUA 3VZOA 2DCZA 3AKQA 3WT3A 1NLRA 1IGOA 3ZSEA 3VZKA 1H4GA 4NPRA 2NLRA 3VHNA 3HD8B 3WQ7A 1T6GC 4HK9A 1C5HA 2B42B 2D97A 1REEA 3VZJA 3WP5A 3WQ1A 1XNBA 5K7PA 1W2UA 3WY6A 1KS5A 1HIXA 3VZNA 1H0BA 1H4HA 1UU4A 1UU6A 4XPVA 1REFA 2F6BA 3VHPA 4S2GA 1UKRA 2BVVA 2NQYA 2Z79A 1HV1A 3MF6A 4HKLA 1PVXA 2JICA 4H7MA 3AMNA 5EJ3A 2VUJA 1H1AA 3VGIA 1KS4A 4HKWA 2DCKA 1BK1A 3VLBB 1OA3A 2JEMA 3WP3A 3WX5A 1XNKA 4S2DA 2VULA 2B45X 3VZMA 3MFAA 4XQDA 1H8VA 1QH7A 3O7OA 1C5IA 3WP4A 1XNCA 1XXNA 1OA2A 3LB9A 5K9YA 1BCXA 2VG9A 5HXVA 3AMMA 1BVVA 1UU5A 3VL8A 4XQ4A 2VGDA 1OLQA 3WXPA 4IXLA 1HV0A 1YNAA 2C1FA 4S2HA 2QZ3A 3AMHA 2DCJA 3AKPA 3MF9A 3AKTA 2DFCA 2QZ2A 2DCYA 3AMPA 3B7MA 1XYOA
chains in the Genus database with same CATH superfamily
4RFT0 1GP5A 4OHZA 2Y0OA 4GZ9A 3FHQA 4M00A 1LHVA 3I2HA 4DFSA 3N4MA 3UL2A 3RJ2X 1PMIA 1GBGA 3CJIB 4HBNA 2W08A 4OYUA 2W46A 4UW4A 5IVBA 1ND3C 2ZZJA 1ZX5A 1WD3A 2J1AA 2WNOA 4XFAA 4AGRA 3K4DA 1DYPA 1SEFA 3BALA 1AR93 3CJIC 1IKPA 1NA1A 3MZHA 1TME1 1LEMA 2DFBA 2YB7A 4YGBA 5FUPA 5LB6A 1W3VA 4M4PA 3BODA 3X29B 4A3XA 3MFCA 1N3OA 3OCPA 1QXPA 4E4SA 1PGSA 5KHJA 3B5LB 4CU9A 1MPXA 1OQEA 1SZBA 1RUF1 4Q4V2 4UW5A 4YZ4A 1QNWA 4DIQA 3BU0A 1H2KA 2MNGA 4XUNA 1V9U2 1H6XA 1VRH3 2J1RA 2BOJA 2RMU2 2Y64A 4XUPA 3U0ZA 2PYTA 2Y6FA 1DF0A 3WF2A 3ZSEA 3SLIA 3ZN6A 2LS6A 3TEWA 4IV3C 5DG1A 3NVCA 1K45A 3VHNA 2UY9A 5JSRA 3JZVA 5C8CC 1T6GC 1D4M2 1CZVA 2P6HA 3ME2A 4EV0A 5K7PA 1XNBA 3AC0A 5FMCA 2OPKA 4ISRA 2YGLA 5CFDA 3AYEA 4QPGC 1ZRRA 2R071 4XF1A 3J9SA 4IE6A 4D3WA 5IVVA 1LCLA 1RINA 1WA6X 1XU1A 2A6VA 2ZMNA 5D2AA 3T30A 1WLDA 4UF0B 1YCIA 1RUH2 4NAMA 3AVRA 4XPVA 2AEYA 2YROA 3OPWA 5C4WB 3U37A 1UKRA 3AP6A 3VBHB 3T2PA 3CHXA 2P3KA 1CAXB 3MF6A 2XPJA 3OUHA 1JS9A 1FV2A 2CL2A 4LT5A 3F95A 4BQ3A 3AMNA 3SKVA 1ULEA 5C4WC 1S55A 3LPFA 1W0OA 4LUKA 2WA3A 3H8RA 1N3PA 4IEWA 2DU1A 5FRAA 1JZ7A 1DZTA 1MZFA 2ZGLA 1G9AA 1VBA1 5JZGC 4CDWB 5CVRA 2JEMA 1YIFA 2ADEA 4V2VA 4TWTA 5LY1A 2JXAA 1R1A1 2ZGTA 1WW6A 4NN0A 5ISLA 2FDHA 2PAEA 3UYJA 4XJAA 4IEPA 2WNUA 3POSA 5K0UA 3BTYA 4XEZA 1XNCA 3I2OA 1C8M2 1QOOA 1PZ7A 3KVBA 2D5HA 4HLTA 4AHYA 4RQPB 5DAXA 4A7YA 1AR71 1AYM1 3AP5A 2K46A 2CDPA 3A0NA 3NV4A 4NOTA 2RS32 3B3QE 4C1WA 2AGSA 4QX2A 4AQSA 5DAQA 3OD4A 3OY8B 4UT5A 3O1OA 3KQ4B 5CISA 4RHV3 4CA9A 5LA0A 2RS33 1HV0A 5JXIA 2R043 2C1FA 2VECA 1WCSA 4JKLA 4RHV1 1W6QA 3AKPA 1UOJA 1QMJA 1RHI2 1RUC1 2HBTA 1TNFA 2QZ2A 3T1LA 4BK4A 3PVOA 1CAVB 1XPWA 3U75A 4IEQA 1AX0A 3JD73 3WR0A 1WW7A 4EN7B 2JDUA 2PQQA 1SLCA 5F9TA 2VVEA 4NVPA 2QQLA 5DQ0A 2C26A 1ENXA 2R072 2QCSB 3FJSA 3I3BA 3K51A 2WDBA 4DNYA 4DS0A 3LD8A 4JGZA 4QX5A 4OMDA 3SITA 4FOQA 1VBC3 2VU9A 3ZDSA 4CCJA 5GLUA 4A4AA 3VDDB 4CDUC 4CDXC 4W6YA 4Q27A 2RS52 2JENA 2FMDA 3OGRA 4JTOA 5IJRA 5F3CA 2D98A 2Q8DA 5AVPA 1K5MB 3AZXA 3PTYA 3N9NA 3FLRA 4BK5A 3WF3A 5JSOA 4TYSA 2HWE1 1CD3G 4ZY9A 2IZWA 3H7JA 1E5IA 4EROA 1W6NA 3MIHA 4EQVA 3LCPA 2HWB3 1GR3A 1LRHA 2XDVA 3EJKA 3IAQA 1W2TA 3KV9A 5CADA 1MS1A 1MVQA 1RL3A 3SEEA 3EQEA 2GSYA 1FATA 2VZPA 3ILNA 3T0AA 1ULFA 4LO4B 4QPIC 1NLQA 1ST8A 3DUIA 3ZXKA 2YC0A 2BFUS 2WO1A 2O14A 1HRV2 2VUAA 3S7IA 2QVSB 5IW0A 5BNQA 4HK9A 4FXGB 4RS5B 1W6OA 3USUA 3JU9A 3TN93 3ZFFB 1LJ7A 2ZPXA 5JI7A 3WY6A 1KXGA 3WNPA 1CONA 3GGLA 1Z7S2 3VZNA 3S57A 3TEZA 3VBOB 5T55A 1ULCA 5DAVA 1SMVA 2P6CA 1PVC2 1UL9A 2Q8EA 1XNTA 3B00A 1X33A 3M70A 4AI2A 1RUI3 4KU8A 1V70A 5IK7A 2ZBJA 2X5IA 1ZRFA 1VMFA 4O9EA 2ZJCA 3ZSLA 3E6DA 1WMDA 2XONA 4D6RA 1S0FA 3ABZA 1JZ3A 4HKWA 1PO13 2DCKA 1YQ6A 2QQJA 5IVYA 3VLBB 5FWJA 1DZQA 4AEKA 4RGKA 4TLGA 4KH9A 2YPJA 3CKHA 3WX5A 4JRAA 4URTA 1IG0A 1VALA 2CY6A 4NUBA 3ZPOA 3IMNA 5GLZA 5APAA 5I93A 3KT4A 4QQ2A 1EV11 4B7KA 1HXS1 1AL23 5C5TA 3WD5A 4Y3OA 3WP4A 2YFZA 3S5QA 3T4VA 3UK9A 3B9IA 1QJU2 2JJ6A 4OLLA 4R9CA 5L9RA 4HL0A 2AUYA 4IL7A 4PBPA 4NE9A 1BMV2 3GCXA 2WABA 1U5ZA 4EE2A 2UY8A 2JIGA 1AR63 5ANNA 1UU5A 2CAUA 5A80A 2QQPA 2XLFA 3KT7A 3ZX7A 1HQLA 3ZSKA 4CCKA 3GBGA 1ND2A 4FI9A 1ZZ7A 2P3YA 3WINE 1ZBE2 4LBLA 2WO2A 4SLIA 1PIV3 3FHAA 4O7XA 1ZZ8A 4GQ7A 5FYZA 3GDBA 5FY0A 5FZ3A 3I3MA 1JUIA 1WUVA 3N9QA 1R093 2CDOA 5C3PA 1ENQA 2ZABA 5E1RA 2VCMA 1C1LA 3JBG2 3UKNA 1PNFA 2VBPA 3IDBB 4XETA 1RUD2 5A6ZA 2BBVA 1SLTA 2R49A 4BA6A 2GMMA 3WOGA 5L9BA 3T0DA 4OMCA 1ZZBA 1PMHX 3ZMNA 4BQ5A 1OKQA 4QGNA 1NXMA 4UOJA 3ZKUA 2UWCA 1VMHA 1POQA 3PJQA 2GN7A 5FK7A 2W1WA 4QM9A 4RGAA 4IV3A 2GC1A 1UZZA 1US2A 2DDUA 2TUNA 2D6OX 1WW4A 5FPZA 2VNOA 1NA1B 2HEWF 3EO6A 4K40A 1W8WA 1NYWA 1SLLA 5BYNA 4CEYA 1GQHA 1Y43B 2DCZA 2WT1A 2BRTA 3J8F2 4FVVA 3HEIA 3PNAA 5CFDC 1QY4A 4L99A 1ZBA2 2VMEA 2WT0A 4FTEA 3FWEA 1O3QA 2XUEA 2E26A 1O6UA 4AFDA 5I0UA 5LA9A 4QAWA 1SQ4A 2ZX0A 5FAXA 2ZX1A 2OKXA 3FX3A 3KCYA 1RIRA 4BMBA 2CSGA 2PHUA 2P3IA 3I8TA 3UV9A 3BU7A 2JDKA 2JDMA 4BLIA 1REEA 4QB6A 1SBDA 3B02A 3LA2A 4XAEA 4MV2A 4F3JA 4PDWB 4L97A 2YPDA 4MYEA 1AL22 5JUVA 5KHHA 2W1QA 2WLQA 3NO8A 5LW9A 1YXWA 2JE9A 5CEHA 3IIIA 1B35C 4OZOA 3USSA 2Z4FA 2ZKNA 3NRUA 4OI4A 4Y4YA 5BNPA 1QNYA 1REFA 1Z0HA 4BU2A 4ATFA 1DYKA 5FK8A 1W9TA 5A7OA 4I0WB 5A3LA 2VY0A 1DLCA 3FUQA 4ZS3A 3HQRA 1GQGA 2ET1A 1ULGA 4FSJA 2PHRA 3ZYJB 2ZGRA 3HN1A 1CAXA 5FZKA 3D82A 4XBLA 1NCRC 5AVAA 1BBT1 2VW2A 2J1UA 4XZPA 2WWJA 4FPKA 4MG2A 4M3CF 4OUSA 4W8JA 4NO4A 5DUUA 4P14A 5FP9A 1S4CA 5I0SA 1Y9QA 2GAUA 2WC2A 1YFWA 4E2QA 1S0DA 4H2AA 3DN7A 4COZA 3RZKA 4MLOA 3IN9A 3B94A 3AP7A 5FLIA 2IXJA 5CYYA 5K0UB 5A32B 5LCWL 3RPQA 4Q0UA 3IZOA 1GV9A 2WL1A 5A3PA 5LZ6A 2H6BA 2DCTA 3I3DA 5HI0A 1GZWB 5F32A 2Q8OA 4QX1A 2VW0A 1YYNA 2H0VA 2QFEA 4IXLA 2O8QA 2YXSA 5GKAC 1H9WA 4MGSA 4LKFA 4AI3A 4RD7A 3ZFEC 3WW2A 5AFBA 1WLWA 4QU1A 1GZCA 2Q1ZB 3AMHA 5JMCA 2HWF1 4KGQA 1LTEA 3H8UA 3N9OA 2DVGA 4Q4Y1 1WBLA 1DU3D 3RZZA 3O1RA 2HYXA 1J59A 1KDMA 4QB2A 5A7QA 2RG4A 4YVWB 3LWCA 2OA2A 2XR4A 1BQPA 4IDZA 4CVUA 2JDAA 5JI9A 3B01A 5CFCA 3T4HB 2B4KA 1XB9A 1O59A 1WD4A 1AR81 3SEPA 4PLOA 4L11A 4QKDA 5J98B 2OZJA 2UU8A 1BZWA 3AZZA 4HSLA 4Y1VA 5KBFA 1GICA 2Q30A 3GHNA 2WN3A 2BTVC 4CUBA 2VMGA 4UFMA 4CCNA 3POJA 1YO8A 3JD72 2A3WA 4YW2A 5C7GA 3NW4A 3MIDA 4QQOA 5H9RA 2ARXA 2QDRA 1V6MA 1W6PB 4ET7A 5J3UA 2XWJB 2BYVE 2NMOA 2YU2A 3HT1A 5FMOS 3WG3A 4A44A 1BVP1 1VE0A 1RUF3 2X10A 2YBSA 3VZOA 5G05L 2YC4A 4AEMA 1Q8QA 1QJFA 1W05A 3GZEA 3AP4A 3C8XA 4L2NA 4AI1A 2E33A 4LO6B 1AR72 4UF0A 1OT5A 5F1RA 3A22A 3ENRA 3TEYA 2VQTA 1CGPA 3MGUA 3VBHA 2WYFA 2RMU3 3PJYA 1FNZA 4RR3C 1JW6A 1OI6A 3OYWB 1OH3A 1W8NA 3CZUA 2VNVA 2GP5A 2A6XA 1FNYA 3HPNA 1JZ8A 3CQOA 3J26N 4OI0A 2BQPA 3J7HA 1MACA 1NLSA 2JDNA 3K77A 4AWDA 4BQ4A 4MGZE 4BE3A 4LITA 4AHWA 3HT2A 3ZVXA 1CR7A 2MEV2 4CEYC 4Z1VA 2WNUC 1W9YA 2H6CA 3FFQA 1JI6A 1AZDA 5FY1A 2K2SA 3PUSA 4CRQA 3VB9A 2W92A 2AEZA 1OD3A 1Y7BA 2BVBA 4WVMB 2WQ8A 5C3SA 5FZOA 1PNGA 3ITQA 3ZR5A 4HVOA 1QDCA 2E63A 4YM1A 1QEXA 5FY8A 1QXRA 4LO7A 3MYXA 3PL0A 1W8FA 2W9XA 4FXKB 4CCDA 4HETA 3NNMA 1ZRDA 4A45A 2V09A 4KL1A 1A3KA 3IT8A 5CKNA 1UYYA 5JOYA 2A3XA 5DAPA 1H2LA 1CPNA 3AZWA 4YG3A 1JMUB 4JVAA 4CCOA 3C7FA 3LKJA 5DUVA 2DUPA 3WF0A 4AVSA 5JOWA 4XQDA 1QH7A 4L0PA 5ERLA 4FAHA 1W6QB 1RMU2 1Q8VA 2HJIA 5IUQA 3THPA 1IHMA 2X29A 4QXCA 1FV3A 4JCKA 2VCCA 1YI7A 3UNPA 2GP3A 3VDCA 1E5RA 1UY1A 4YWAA 5G04L 5LBEA 3VBUB 1WCDJ 1UY3A 3KLSA 3ZO0B 3KMHA 3D3AA 2K9ZA 2VMHA 3GZUC 4N9HA 2PHFA 4JKKA 2EVXA 3JCIA 4GWNA 4XJ8A 3E5UA 3RZLA 1GSLA 5FBZA 3VBUC 5BNNC 4N53A 4YM3A 5JR2A 5FFOC 1V9U3 2QZ3A 1W03A 3N35A 2XJPA 3POGA 1WCKA 4W65A 3VBRC 4AEDC 2ZX2A 1ENSA 2A3YA 2VQAA 4CE8A 4C8DA 4E9KA 3FLTA 1BHGA 1MZ5A 5ACA2 5F3IA 1RUC3 3NAPA 1UO9A 3BUCA 1Z7S1 3WNKA 3IAPA 4FPJA 2X53S 4QDSA 1EAH3 2IFWA 2PLV2 1VBC2 3JD71 1N1VA 4IERA 3R4DB 4AXOA 4Y5Z0 4Q4Y3 4CEWA 2ZKLA 1A8DA 1NT0A 5HCAA 4FPGA 1GOHA 2W2IA 4XBNA 2C6SA 4FP2A 4PIZA 1PGW2 2VR4A 4QHZA 4GXLA 2HWE3 2P34A 4OUMA 3OSDA 4CU6A 4QD2A 3TEXA 4IETA 1H1MA 5FV3A 3THDA 3SXWA 2HWB1 3S6PA 5DUWA 3USUB 1YEWA 5F37A 1UAIA 2ZHLA 3JUUA 2CU5A 1EP0A 3GYDA 4Q4W3 1GUIA 3R05A 4GALA 1F15A 1T6BX 3CF6E 3NNJA 1Q3EA 5KHGA 2ZEZA 1H4GA 2X5IC 4V1PA 4YGEA 1HJGA 1YRZA 4AAPA 5L7OC 1SDDB 4CP9B 3ZYBA 2X5IB 4BH9A 2VZ3A 1VAKA 1VBB3 2WIIB 5A7WB 3VKMA 2IXCA 4LEJA 5C9AB 1UZ0A 4GB33 5E89A 3JXSA 4INDA 5C33A 5KWRA 3O1UA 2VNGA 2RJLA 1JU4A 4FFGA 4Q4X1 1EUUA 3QD6A 4OFGA 1W99A 1V6IA 4CCLA 3WNLA 4PDWA 5AC93 1J1LA 4CZSA 2JG8C 2D6LX 1UOFA 2F6BA 4PIXA 5ANQA 5H9SA 1UF2C 4HT1T 4GMP3 3RGBA 3GNEA 1G9FA 4YW7A 2VTXJ 2R16A 4RN5A 1W8UA 3VBHC 4YG0A 4GMP1 3N7KA 1POV1 3B9CA 3NNLA 2OUHA 5FOBB 2D7FA 4PJYA 2ZGQA 3NV3A 1FI2A 2EAKA 4GB32 1RUI1 4QHBA 4BDVB 1P8JA 2GC2A 4QKNA 3ZOIA 3H50A 2X05A 4K21A 1NAEA 4AGVA 4CDWC 3MHZA 5DDJ1 5GM0A 3EYPA 1RVF1 4Y22B 2A6YA 4YZ3A 4YSFA 1ND3B 4Q8KA 3T09A 2WS93 4BM8A 4EZ4A 3MW3A 3O14A 4XW3A 2G19A 5FTTC 1GP4A 5CU1A 3VN4A 5KXEA 1HB3A 2VOKA 3UKTA 1AYN2 1QJU3 3H8XA 3VD3A 4QQLA 4W6WA 3D4KA 5FIXA 3IB3A 3RRDA 1CZSA 4BIFA 1HKDA 4NAOA 2D44A 5A32A 1DP0A 4GJZA 4E4ZA 4QKBA 4N9IA 3T2TA 2ZGMA 2XHKA 4P9GA 3RVHA 4BQXA 4QT6A 1CAUB 5LRRA 4COYA 3ELNA 3ACGA 1LENA 1OKOA 1S2KA 4IE7A 4K1YA 4X8PA 3O0VA 4DRRA 3H7YA 5HCHA 2ZMKA 4UFIA 2RDQA 5EXOA 3PDQA 5LK7B 4NWWA 2JG9A 1L3JA 1LECA 1TMF3 2JDYA 2XBO1 1A6CA 3WSOA 4JAAA 3POBA 3M4FA 4FCAA 4NIHA 3SCFA 4E8DA 1D2QA 1UYXA 3PURA 2NM1A 1MEC1 1Z7S3 3HIFA 4ASMB 1PZ9A 4AEJA 3U4XA 1U5IA 3H1WA 4LK7A 5A3MA 5IVCA 1K5JA 5A3OA 1AXKA 2XHNA 2EIBA 3TRSB 2EIEA 2Y60A 1LOGA 1W9FA 2OW4A 3WNXA 4AVTA 4JZRA 4XBQA 1LODA 2YFUA 4XFCA 3LA3A 1IGOA 4XF9A 2BNMA 2XL9A 1J83A 3U07A 2BV4A 3VZKA 3ZYPA 2C0ZA 5FO9B 2UWAA 3PMSA 5FLHA 4MGQA 2VE1A 1W6MA 2VZRA 2WZPP 3LEMA 1F35A 4Y5TA 4A7KA 5A6XA 4NIDA 1CQ9A 1UPSA 5D8AC 4QPIB 2RR11 3S0MA 4GIQA 1F8VA 5FYTA 2Z69A 3ZXGA 2JECA 1S0IA 2DBNA 5EWSA 1US3A 2HKXA 4QGLA 2XQRA 3V0BB 1KS5A 4UFLA 4FPOB 4RQPC 3BYWA 4XMIA 4EYUA 2UWBA 3HNBM 4V2WA 3U10A 1YLLA 2D40A 2GH2A 3BCWA 2WWUA 2WZEA 5LA2A 3OD0A 3OB8A 3W9AA 1U0AA 3MIBA 2QQMA 4HKLA 4YM2A 2FDJA 3R0RA 4PF1A 2WQ4A 3BTAA 3SHRA 4BYYA 1RUH3 1S1AA 3KV5A 4PF5A 3AFGA 1X7NA 1C1FA 1WW5A 2ZGSA 3GBFA 3AZYA 3VBSC 4M3CE 4P9WA 5A1FA 2VUCA 1FOD3 3FN9A 1KS4A 2ZEYA 4I3PA 3VGIA 3WF4A 5AC91 4KNCA 1CZTA 5HPOA 1WMFA 1MS0A 5FPLA 1BMV1 4KU7A 1DBNA 3ON7A 3MPBA 2TEPA 1CAWA 2WZR1 3CJXA 2NP0A 1HXS2 1OA2A 2FQPA 2IFRA 2VD7A 2VOTA 2W91A 3KQRA 3LB9A 4P00B 2VO5A 4A3ZA 4HFSA 4A6SA 1QJEA 3VD5A 5CFCC 4BQ1A 4IV1B 5AFEA 1RUJ3 2D3SA 3GALA 5A33B 3VDDC 5B4XA 4XXAA 5FZCA 3NV2A 1L7LA 2XLGA 4UAPA 3Q8CA 5CFCB 4TLFA 4ONUA 2PN5A 3M8LA 4NROA 4XURA 4UXAA 5LY2A 1OQDA 3W5MA 4DXTA 3N7JA 5EV7A 2D6PA 3WDUA 1EPZA 2C5DA 2DCYA 5LATA 3A23A 4QX3A 3CJIA 4MSVA 4XYXA 3APBA 3WG4A 2MEV1 3PIGA 4UFHA 4NWVA 3U4SA 4D69A 1KFUL 3MW4A 3Q8AA 1KJLA 4N53C 4FFFA 4AOCA 4LO8A 1XYPA 4C0BA 1RXGA 4XDPA 4OCTA 4A2UA 3WLUA 2ZEXA 4YLZA 4M0HA 3ACHA 2ZXQA 1VB2A 2D43A 2JE7A 4GULA 5CG9A 2EICA 2VTFA 3AKRA 3SKJE 1ZRCA 5C71A 3O12A 5FKCA 5EYYA 3RQ0A 2ENRA 3P6BA 4ARXA 1R082 4CCEA 1XRUA 1ZM1A 4B8EA 1QJX2 3BIWE 1X50A 2I45A 3MIGA 2JD9A 3LEIA 4TSVA 1G86A 1XYNA 2XJSA 2DBIA 5FYSA 2VZQA 3OYWA 3Q8FA 4AFAA 1N1TA 4K6BA 1V6LA 3JQWA 3VBFA 1GWKA 4LUMA 2ORZA 4QXBA 4IGQA 1RGSA 2PXJA 4Y4RA 1HRV3 3KF5A 3PUHA 1H9PA 4QPGA 2DU0A 3CLPA 4ASKA 3HQXA 5FYCA 4CUGA 2NZ9A 2B5HA 2J1EA 2WZ8A 1VRH1 3AP9A 2YG0A 5IHRA 3EB7A 3AXEA 1LOFC 2P17A 4Y33A 4ZXEA 3WQ7A 1PM4A 3I2IA 4AFCA 4WVMA 2B42B 4GB31 1R083 2JDPA 2V73A 4L9BA 4G3YC 1VRBA 4HSJA 5FY9A 1EUTA 3LIHA 5C4WA 1Y9GA 3U78A 4UWDA 1UX7A 4WM7B 5A3TA 4ZU7A 3LDRA 3IIAA 1BYHA 1H0BA 4P5HA 4X8NA 2HWC3 5DZGA 2E6VA 5C9AA 2G1MA 2HWD2 3QCWA 4M01A 1B35B 3AK0A 2A7AA 1W39A 3B93A 1POV3 4IUGA 4CXXA 4XF0A 4AE2A 5DDJ3 3BI3A 5FBJA 2AZ5A 2WR9A 4NIAA 1PO21 4YW4A 4GMP0 1DGLA 2IC1A 4Z92B 5JSPA 3THCA 2Q5TA 2BU9A 2VVFA 1UX6A 2E53A 2RV9A 4IEZA 3DF0A 4H7LA 1DQ6A 4UYBA 1AJOA 4RQPA 3MFAA 2XJUA 1RUH1 4JV4A 1H8VA 5A7SA 2WS91 2WAOA 1JOJA 1LHOA 2YU1A 1Q8PA 1NKGA 2AR6A 1OF3A 4J1XA 3OY8A 4ES9A 5FP8A 1HN0A 4COUA 4ZU4A 4GA9A 5KC6A 2IXLA 4DZGA 4LBNA 1MR5A 1YJLA 1UY4A 5FZ7A 1RUF2 5B4NA 1KQRA 3WG1A 1ND3A 2SLIA 3H9AA 4CEWC 1OUSA 4Q0SA 3KD4A 4XFFA 5IFTA 5K0UC 1CAVA 3GZAA 5BNOC 1NA1C 4XIOA 1QHDA 4HZFA 3R6SA 1GZ9A 3MF9A 1I1EA 3AKTA 3DYMA 3ROUA 2JG9C 5I8TA 2DFCA 4RA0A 2VXJA 5CZKA 1NUKA 2EXIA 5BNOB 4Y24A 1EAH1 2RS13 3ZFEB 1AL0G 4F8AA 2G9ZA 1UCXA 3ZYFA 1H8TB 2ZAHA 4BZ4A 2JE8A 1QJY3 5SV5A 1ND2B 3RI8A 1APNA 3VDDA 1OLME 5J96B 2RM23 1CPMA 2QE3A 3RJRA 4KQ7A 1H8TC 3POIA 1HN1A 4FFIA 3LZZA 1H30A 5DDJ2 4WZFA 1DZRA 2BGCA 4IESA 1JZ6A 4HOOA 3NKTA 4HKOA 1Q8OA 1ZA7A 1LOEA 2EAAA 4AL9A 2MEV3 2GNMA 2YV8A 2ZA9A 3NQHA 3IMMA 1W6NB 1Q8SA 2CGPA 4X6RB 4UBGA 2ERFA 3HR9A 2Y6JA 4SBVA 4XCBA 4CP9A 4EWEA 2TBVA 1LGNA 1YUDA 3C7HA 3FHIB 4JTNA 2QJVA 4Q26A 1LAJA 1WA4A 4Q4W1 2I74A 3HOBA 3FBYA 3OEBA 3MPPG 2RR13 1OH4A 1CWPA 2O0OA 1TEIA 2VZSA 5FQ0A 1RUJ2 3ILRA 3JQXA 3LIGA 1GP6A 2X8KA 1O4TA 2P3JA 3LE0A 2PAKA 3D5OA 5GZDA 3KF3A 1FPN1 1ODNA 1ASJ2 3WHUA 4AQ6A 2J1VA 4F7ZA 3TBDA 1IZ3A 1LHNA 2GNBA 3HD8B 3MIFA 4IW3A 4AAXA 3WQ1A 2W95A 4XJUA 2R063 4ES8A 2B7YA 3IBMA 5FOJB 5HV4A 3CNAA 3QACA 4WVWA 5HCFA 1TMF2 1VBB1 3IDAA 5JXJA 1NZCA 2VZTA 1FPN3 3ZYHA 3DCQA 3V0AB 3HBKA 1HIXA 3MEPA 3O1SA 1RUG1 5FWEA 3KM5A 1UU6A 1FMD1 2BNOA 4Q5OA 3RSJA 1OLMA 2K0GA 5FYUA 3VHPA 4S2GA 5JAXA 2Z79A 4XFHA 2Z42A 4W6XA 4BOWA 3Q8EA 4U2AA 3RYKA 2OS2A 1W9SA 5F5CA 1C28A 1Q5OA 1STMA 4XIKA 4MHRA 2A73B 2R6QA 3NJXA 4X6QB 4ZPIA 4W4ZA 2R042 2LM3A 1G9DA 1H1IA 5A7PA 1HLCA 1GWLA 2EXJA 3SCGA 1SPPB 2ZHKA 1SFNA 1N1YA 2QUOA 4IEUA 4NPMA 4COVA 4CUAA 1HDKA 1NQDA 2WNVC 3I49A 2JB8A 3NJZA 4CSWA 3AL6A 2Y6KA 3QOPA 4O61A 2GNTA 4OUEA 1EV13 4HG6B 3MUZ1 1OMIA 4EN8B 3UGGA 2VBBA 2WA4A 1NY71 5F5QA 1R092 4BCUA 1E5HA 1COV2 3ZIXA 3VL8A 5FP4A 2GC3A 3HNMA 3WDVA 2XJRA 2A70A 2NYYA 3WW1A 1ZBE3 4Q0PA 4E4HA 1CVNA 5I0RA 3AL5A 4Z07A 1OURA 2XOMA 2SBAA 3H3LA 4U36A 1W2NA 2RVAA 1RJ8A 1ZBE1 2DCJA 5FMBA 1AR83 3RWKX 1MQTC 1F4HA 3B7MA 3AYDA 2BFUL 4DY3A 1F5FA 3OOXA 4PT6A 1MQTB 4BMEA 1GZWA 3BPSA 1CIYA 3M7AA 4Y1YA 5ABJC 4LULA 2B8MA 4D6QA 1TMF1 4GH4B 2PLV1 4XMAA 3VKOA 4Q4V1 2ZGKA 5GJ6A 1B09A 1ZREA 4D7TA 1OOPB 2Y6HA 4LXLA 4KWUA 4QQPA 1IOAA 5FO8B 5D8AA 1VLNA 1W3XA 3HAGA 3KZ4C 5FYHA 3RYPA 4B1LA 2GZWA 1G8WA 2XKOA 1REDA 3P3NA 1XNDA 3W5NA 3LPGA 2BDRA 1N47A 1XE7A 1GMMA 4FTBA 2PLV3 2HBUA 3L2HA 5KC5A 3ZSMA 1O3RA 1RTVA 1RJ7A 2FDKA 3BOWA 1OSGA 1QKQA 1RUD1 4Q4W2 1GWMA 2QKDA 3C3VA 2Y38A 4KWJA 3NJVA 1QGLA 5JXGA 1URXA 1VAMA 2W3JA 2ZCWA 4XILA 2PTMA 2WSUA 3N3HA 4YFWA 3MUY1 1Z78A 2F4LA 4AW7A 4PIYA 1UMIA 3ES1A 4MH0E 4D0QA 4IEOA 3TNQA 4KG8A 3V65A 3GJBA 3F2ZA 4EZHA 1TVGA 3ZR6A 5GZGA 2GALA 4CDQC 4DUWA 4MGTA 1IS5A 1IS4A 4GAZA 5FP3A 5A1AA 1D4M3 3E1F1 3PMEA 5BNPB 1XC6A 3PIJA 1W2OA 1JYWA 2Z5WA 4CDUB 4I3GA 4CDXB 1PK6A 1WCUA 1MS4A 1XU2A 4N43A 1JOBA 4MVTA 3I2GA 2W52A 4JGYA 1PO11 2E31A 2J1TA 1K5MC 4QPWA 2BVVA 2LALA 4YFZA 4CXYA 3FUOA 4WM8A 4FAGA 4LLFA 3WDWA 1SBEA 4FPEA 2RS12 4OULA 3NNGA 1WLCA 1EY2A 5FXXA 1JZ5A 2LROA 2FHRA 1AL21 3N9LA 1W2AX 5EJ3A 1PMJX 2QQNA 3SCHA 3GBWA 4XXPA 2HEVF 2R1BA 1B35A 2W68A 4IEYA 3KSCA 3M3CA 1C4RA 4YM0A 4XFIA 4Z82A 5AC92 1WCQA 3IDCB 3IKWA 2YZ4A 4UI9L 2WSVA 1UPIA 2VCAA 4S2DA 1A34A 4Q4Y2 4LR4A 3H3ZA 1QIQA 3S7EA 1VBD1 4LBQD 4R9AA 3KHBA 3ZFFC 1AYM3 4FOVA 5CB7A 1ZVFA 1W04A 4QGMA 3RZHA 1CN1A 4YGCA 2D3RA 3ZXLA 5FPVA 2C4XA 2WAAA 3LFMA 2OYZA 1IQDC 4E2GA 3WQBA 2C24A 5C70A 4NHYA 2AH2A 4PQ9A 4XQ4A 1UYPA 5JLVA 3O0XA 1PZ8A 1VR3A 2CYFA 2Q1FA 1JYNA 5GLWA 1QJY1 3ZFGA 5FZHA 3KS7A 4I0BA 4S2HA 2P2KA 4CPBD 4YARA 4OVEA 2W39A 4DEQA 3UESA 4FPHA 5D1IA 2XKPA 4JX0A 4I30A 4LTAA 2G9FA 2WFF2 5GZEA 2L9LA 3J8F3 5JVVA 3ZMOA 2IWGB 4MOAA 2ZS6B 2OVUA 4D6SA 5JPMB 5BNOA 1JBCA 2YBKA 3CZJA 1OVPA 2E7QA 3VD9A 2HLEA 3FFZA 4ZKTB 2Q1MA 4E27A 5FZLA 2D6NA 1OA4A 1NE6A 2A5ZA 1POV0 1W8TA 3KB5A 4QPGB 5T54A 4HK8A 5A6YA 5EIYB 1ZZ6A 1TE1B 5D21A 1SLBA 3OGGA 4FOWA 2VCBA 4MXWA 1R1ZA 3VBRA 3NAPB 3H0OA 2MPFA 1RUI2 3WCSA 4YVSA 5ACA3 1NQJA 1ENRA 4S2FA 1CJDA 2JG8B 1YHFA 3CO2A 4N90A 3LDKA 1W06A 1IPSA 1AR82 1K3IA 2DVBA 4LA3A 3NAPC 1I5ZA 1D0HA 1K12A 3WT3A 1S0EA 4KI5M 1BEV2 2OZ6A 2WYSA 1AX1A 4OI2A 1DQ5A 4XF3A 3D8CA 4BPZA 3GF6A 2WN2A 4EN6B 4CYDA 5JZGB 1JYCA 5T3NA 5FQ0B 1QOSA 3GZTB 1OPMA 4XJZA 2CWSA 1GNZA 2A1XA 4QX0A 3I4IA 2RMU1 3QBQA 2VMIA 3ZN5A 5IATA 2HWC1 2Q8CA 1AUYA 3MICA 3DXUA 5FZOB 3BOPA 4P08A 5IVEA 3AYCA 3D6EA 1M06G 1PGW1 1YFXA 1NXD1 4PCRA 4DINB 4RR3A 1MS8A 3LOBA 1VRH2 5FY4A 5CIRA 1HV1A 2GMPA 5GALA 4IE0A 3ZXEA 1HB4A 4YZ1A 5EYXA 4H7MA 4JC1A 5A7WA 1VMJA 2R073 2WQZC 2BUKA 3ZXDA 4QPYA 3K4AA 1PO12 1S2BA 5L7OA 4DMIA 4NHKA 1FOD2 1QXJA 3SH5A 2VTXA 1LOCA 4MADA 4CDQA 1O8PA 3GXUA 2WNEA 1KJRA 3ES4A 1HB2A 2G9GA 3ZYGA 3WP3A 5M0TA 3J4UH 5FXVA 3HJRA 3CIHA 1DQ2A 3CU7A 1JYVA 1S0CA 2RE9A 2BPA2 2D6KA 4D94A 4IEXA 2C9KA 4N43C 2R062 1C5IA 2QQOA 3K46A 2OPWA 3JB4C 3ACFA 5FZAA 2J22A 2ZGNA 5FZEA 5K9YA 1HXS3 1BCXA 1WLTA 3PVEA 4LHNA 4D7YA 4BXSV 1CX4A 3O1MA 4L92A 4JRLA 4Q4X2 3ILFA 4P5YA 4QX7A 5FYYA 2FBEA 5FZFA 4AYUA 2P4EA 4C91A 5J37A 4AR2A 2NMNA 4GKXA 1BJQA 1JN2P 4H55A 1O3TA 1L7QA 2WNVA 1ZYBA 2D3PA 1F4AA 2V4VA 2JB4A 2P5BA 3D0JA 4M3CA 3AB0A 5ABJA 5J7MA 1QJU1 4GWMA 5FZ6A 1ASJ1 4AFBA 2KD7A 5DG2A 4XZUG 4HPKB 3W20A 2PHDA 3DKWA 2R30A 4I2OA 2A6WA 1NCRB 3ALQA 4LBQB 1DGRN 1NX9A 3IDEA 3LSEA 2ZX3A 3K48A 2UYBA 2CHHA 3FMGA 3Q8BA 5F5IA 3W21A 2DVDA 4UFJA 3WP6A 4BQ2A 3J7NA 1UMZA 4FT8A 1PVC3 1FX5A 3MLLA 4XHBA 1SG3A 3LGRA 3ZLIA 2KA3A 5KR7A 1AF9A 5F6LB 4F83A 3PLQA 2WFF1 3QLQA 3UJQA 1F31A 3VHOA 3ZSJA 3M3OA 1MQTA 4RS5C 4URAA 4WBBA 1TNRA 2ZZQA 5FYVA 1C8NA 2PA7A 4FP3A 1QJY2 1CAUA 1CESA 3FZ3A 4GWIA 1LHWA 2ET7A 4NRQA 3AFKA 1KFXL 3I7DA 1SLAA 2ID4A 2WO3A 3NL1A 3C7GA 1AX2A 3R4UA 4A41A 1F5JA 2E32A 3K3NA 3J7LA 3OG2A 5T5PA 3EXUA 2PELA 2W87A 2WT2A 5F3GA 3BPZA 2J1SA 2VOXA 1OPOA 4LHKA 4O65A 1PX4A 2YHJA 4CCCA 4EWDA 4BB3A 2H0BA 3I3EA 4ORFA 1LU2A 3HMYA 3OF1A 3PU8A 4R4ZA 1D2SA 1VAVA 5T5LA 1UWWA 2R061 5EJZB 1AYN1 1NG0A 3OGJA 5FDBA 2AREA 1HJFA 2Y6LA 3HBZA 2ETEA 4O9GA 3WUCA 1DQ0A 2Q4SA 3RS6A 3M3IA 2YYOA 4B1MA 4DUVA 1W2UA 3OUJA 3SISA 1QWRA 4OHYA 1FMD3 4JQRA 4QB1A 5FO7B 4RL7A 2IUWA 1ULPA 3BB6A 1SBFA 3INAA 3K3OA 1FOD1 2VQ0A 1X8MA 1ZBA3 4M4RA 1A78A 1OVSA 1W6MB 1XSRA 2EXHA 1KEXA 3JBG3 1VBE3 3ETQA 1R1A2 4P02B 3MI8A 2PHLA 3AM2A 4QPIA 4AQTA 3CMGA 3PUAA 5IK5A 4XTMA 1JU3A 2JWPA 5FYMA 1H1AA 4GKYA 4QDQA 1LR5A 5J09A 1UW8A 2OQ6A 4WM8B 3LAGA 3W58A 3A0KA 4OQ9A 5BNNA 2ATFA 1ZNPA 1TZOA 2HWD3 5BY5A 4MZUA 1VBE1 4AEDA 2QQWA 5IAVA 3E5XA 1Q56A 4UBHA 3I2DA 2WZR3 2PFWA 3VZMA 1RHI1 1RUC2 3FLPA 4I0AA 1GU3A 5A3UA 4G4FA 1GZTA 4XTPA 3O7OA 1AHSA 2WS92 2J7MA 3CBNA 1C8M3 1IPJA 2QNKA 1O3SA 2R1DA 2ZTNA 1UY0A 1SCSA 2D93A 2WNUB 3FE5A 4YZ2A 2RS31 2IXHA 1IQAA 1T2XA 3ZXAC 5FPUA 1U5XA 4CP1A 2GC0A 3NMBA 5A7NA 1QDOA 3T1MA 2VGDA 3KGLA 3SNMA 4GH4A 2HWF3 3OPZA 4OHVA 1QU0A 5J36A 4BJ0A 1RUNA 1RVF2 3E6BA 1QQP2 4B4PA 1VPHA 3OEAA 1LOAA 2W47A 4QMAA 1MS5A 2OXBA 5E8AA 3ZFFA 4IEVA 2D5FA 3ECQA 3AMPA 1W8OA 2ZGOA 3GJAA 4KGGA 3WCRA 4IV1A 1ZRIA 2QQKA 5A33A 4ARYA 1BBT2 5EQUA 2JG9B 1GYKA 5FR3A 3VL9A 4BQWA 4YNIA 1W8ZA 4XACA 4AFMA 3OGVA 2BW8A 2PAMA 4BHPA 4B29A 4LNVA 1YFUA 4N7IA 4MGIE 2UURA 2HWE2 2VNRA 5JR7B 5T50A 3C7EA 2E7AA 1CX1A 1X8EA 1HQNA 2VVDA 4QDRA 2F4PA 1PX3A 5KXCA 1RUE3 4DUXA 5FZIA 1KITA 1PHMA 4HN0A 1M4WA 2A71A 2W94A 2DUOA 2IVIB 2QQVA 4JGZB 4LBKA 1S0JA 4OHXA 4QX8A 3MLJA 1YIPA 5LEJA 5L36A 1OXCA 2XJQA 2ZMLA 3WNMA 4YW6A 1HQWA 4Y20A 2BWCA 5B2GB 3CL1A 1PK6C 3KHCA 3VBRB 4RFRB 4JGZC 4MO3M 3AKQA 1XE8A 3N9MA 3BTXA 4ZS2A 1J3PA 1UMHA 1K5MA 2JG8A 4Q1RA 4ZZ8A 4GD4A 1V6NA 1PK6B 4PLMA 2QQIA 1JYTA 2R0FA 3KVAA 5FKBA 3V56A 2NLRA 5GLTA 5JPNB 1LHUA 1D0GA 3TAYA 4BISA 1SFPA 4RHV2 2Y33A 3ST7A 1GNYA 2OQ7A 2BNNA 2AC1A 5JZGA 3VBFB 2BERA 5E88A 1NE4A 2XVGA 3I54A 4QXKA 5LWBA 4WVVA 1J84A 3MV01 4NRPA 5DAWA 5LEKA 4COWA 2P1BA 4BWOA 1PO22 1W6OB 5JOXA 5LASA 4YG6A 1FT9A 1GLHA 1JHJA 3MIEA 2ZOEB 3MDPA 3NSTA 4IQPA 4NPLA 5H9QA 1YQ8A 2AENA 2DTWA 1PVXA 2XWBB 3B69A 2MHFA 3KV4A 3T2QA 1VJ2A 4J6GA 3KT1A 1LOFA 2KR2A 5FMOL 5KHKA 2FZ1A 2FCUA 2VUJA 4ZHNA 3A4UA 5JMOA 5LRSA 2IXIA 4CP2A 4WM7A 4LIVA 1D7PM 3K4ZA 1CAWB 3S5AA 1GKBA 2BBAA 4TXWA 4YVWC 5L7OB 3HNYM 1NY72 1H6YA 3CEWA 3POWA 4Y1XA 3IPVA 3P3PA 4LE4A 1G9CA 5J48A 3VHRA 1RUG2 3OUIA 4LBJA 5C9AC 4XFGA 1S2EA 3VKLA 2VZVA 1RITA 1UY2A 2XJTA 1MS9A 2CGNA 1RMU3 5FJHA 3E97A 1O7FA 2LW8A 5HXVA 4OI1A 1KRIA 1COV3 1YFYA 3RNSA 5LBFA 4QQHA 5FMDA 1W90A 1QF3A 2RJ2A 4C1XA 1R091 1COV1 1RHI3 2JKXA 3SMHA 5FXZA 2CGOA 2HWB2 1GANA 5FUNA 3WXPA 1PIV1 3O1TA 4LJHA 1X9PA 4FFHA 3OBZA 1AXZA 2VL4A 4LLOA 2R32A 3I2JA 3K75B 4FPCA 1JZ2A 5KHIA 4K3UA 3RYRA 5IVJA 5LA1A 4K7JA 4WZCA 1PVC1 2DF7A 2GNDA 2V4AA 4YPJA 2ES3A 1XNAA 4AI8A 4B7EA 4M0NA 3UGFA 4KBZA 3J8F1 3O1VA 3AZVA 4YRDA 4LBQA 2LRPA 1IKQA 3HQUA 4MXVA 5DUXA 2LTNA 1DCSA 5L73A 3N36A 1OD5A 4E2SA 3THTA 1AR92 1XSQA 4JHZA 5FYBA 4PLNA 2Y0IA 5EHDA 4DB5A 2NPIA 2JD4A 2WLPA 2VMFA 3ZFEA 2V5YA 2W1UA 2XB6C 4CXWA 1FPN2 5FY5A 1OOPC 1E57A 3DPRA 2DUQA 4EJRA 3MLKA 3LSDA 4B4QA 1LGBA 4DY5A 4FTSA 4AF9A 4ZONA 2CTVA 4E4DX 4RS5A 4XFBA 5JDBA 1UIKA 1D4VB 1DDLA 1MZEA 2Q0AA 4IV3B 4HVRA 2FDGA 4XCAA 3U11A 5CG8A 4IGOA 5A3NA 4NJ4A 4AGGA 5C5UA 2VZ1A 1UZVA 2BP6A 5C8CB 5EJ1B 4NPRA 5ACA1 1AYN3 1YJKA 2JIJA 5FZBA 4MGYE 3RMXA 3OBAA 2BEOA 3KCXA 1EV12 1C5HA 3VZJA 1G7YA 4FQZA 5F2WA 1VBA2 1DGWX 3E5QA 3J7MA 5LBCA 1F9KA 1RUG3 4CPBA 4I01A 4CDQB 3RWNA 1YQ2A 3ACLA 2XVLA 3VUOA 3IM0A 1HX6A 1UU4A 4QM8A 5IYYA 3TOJA 2HWD1 3ZXFA 1WMXA 3AJZA 2ARAA 1O91A 1R64A 4MGKE 1WKYA 2UYAA 5FZ4A 2JICA 4LPLA 1LKNA 4PHZA 4BXFA 2O1QA 4JDMA 2EIDA 4CP0A 3T2OA 4PI0A 4EN0A 3V64A 2TNFA 4NHLA 1V6KA 2EXKA 3LA7A 4P9JA 5EZWA 4AHZA 4D7SA 4DOUA 3A7QA 2E7TA 1W28A 2ZHNA 3BVCA 4UW6A 3ZIWA 1OA3A 1KD7A 5I0TA 5T5OA 1XNKA 3POFA 1YC61 2B45X 5CBLA 2Y6GA 5ABJB 3P5BA 1OF4A 3L2YA 1A8MA 1C8M1 2YC2A 2GN3A 4GH4C 4H3WA 4R4XA 3M3QA 4XUTA 3RDIA 4AVCA 1PO23 1XXNA 4HPKA 4Z8BA 3WNNA 1H2MA 3KCCA 1AR61 4AI0A 3T0BA 3VBOC 5C3OA 2JDZA 2WRAA 2Z2SB 4UW3A 4YZ5A 4K8FA 2YMZA 4Y1UA 1UNBA 3DYPA 4LKEA 4OZXA 1LOBA 3KV6A 2XVKA 5JXHA 1OLQA 4BQYA 3N9PA 4YW1A 1RXFA 1I3HA 4NMIA 3WHTA 2RR12 3L9JT 4E8CA 5IK4A 4Q8LA 1N3QA 1OQ1A 4LO5B 2N7GA 1JUHA 2O8OA 4MHUA 2QTWB 2ARBA 2VMDA 3VBSB 3AJYA 4Q4V3 1H8TA 1F2NA 5T5JA 1VBD2 2KXLA 2PMWB 5HCBA 2VAUA 4Q1PA 5JIAA 3C2UA 3OJBA 2DYCA 4XHXA 1ZZ9A 1S0GA 3N7MA 4XAAA 1FAYA 4JDOA 1WWYA 2BGOA 1WBFA 4LA2A 1RC6A 2A75A 4AHXA 2VJXA 3K2OA 3MO4A 1DQ1A 4IE4A 5IVFA 2W1SA 3AMQA 5FZ1A 1MEC3 3HVDA 1Y9MA 2ARCA 2QQUA 2WFF3 3HN3A 3G6JB 1EAH2 3NNFA 1SCRA 2RS51 4IV1C 1OLRA 3MV11 2P37A 4LBMA 4WV8A 4AG4A 2PHXA 4NHXA 2J42A 1NCQB 1GOGA 1VB4A 1BKZA 1OFNA 2BWAA 2CNAA 2ILMA 2XH6A 1Y3TA 4CCMA 5DZFA 2YY1A 1YWKA 2XJVA 3DL3A 5FZ8A 2GMEA 2B46X 4Y5SA 3AXDA 1NCQC 2VOWA 1JTZX 1DQ4A 1YQ5A 4QWNA 4RSUA 3WVJA 2OT7A 2OX0A 1DHKB 2EF6A 1RYYA 2R7EB 3ZYRA 4AVVA 4BIOA 3AYAA 3TN92 3ETPA 2WJSA 1W6PA 2WUHA 4HONA 1NLRA 4K9SA 3WNOA 5A6QA 5I0DA 3BN6A 1DLLA 4PBOA 3VKFC 1W9WA 1VIWB 1L7RA 4EWAA 1ACCA 4XE9A 3TNPB 2VUDA 5A70A 5F6KA 2WFPA 3V0AA 3WP5A 3NKGA 2PHWA 3O0WA 2ADDA 3IWZA 1U5YA 1W8HA 3POEA 2RHPA 4FQ4A 5JOZA 1BXHA 1ULOA 4NIIA 5JIUA 3PTRB 2BGPA 1QJX3 1H2NA 1OUXA 5HBAA 1NZIA 5FLJA 1JZ4A 3AX4A 3DEMA 3FBMA 1UYZA 4C90A 4AZZA 1BLZA 4LE3A 3PVNA 5K8SA 1ZBA1 3VKNA 3EBRA 4Q0VA 5CKQA 4Y26A 2JKBA 5IFPA 1CJPA 4GJYA 2LUWA 3DECA 5CFDB 1LB2A 1UD1A 1UIJA 5HV0A 1SPPA 4DXZA 4TZDA 1FXZA 1QOTA 3WEZA 1JYIA 4FPLA 3LQCA 2CV6A 1R1A3 3ORJA 2NN8A 4NIGA 5F2SA 4JGYB 1VBD3 3ASIA 4DXSA 2HH9A 3GHMA 1UQXA 1VBA3 1WMEA 1XQNA 3OBRA 2A6ZA 1X36A 2VMCA 2VULA 3I2KA 4TTGA 1FMD2 1U12A 2HEYF 3LOIA 4KWLA 1SHWB 4JGYC 5CKMA 5DPNA 1RMU1 4PDWC 3UETA 4C0HA 1DGWA 5FCCA 1TQ5A 4Z2WA 1BEV1 4Q2FA 2YBPA 3VD4A 1J58A 4WM7C 3WUDA 2Y26A 1BBT3 1XBFA 5FPBA 1YQCA 3NJYA 4XF4A 3N7LA 2JX9A 4LOSA 4YVWA 1HRI3 4KBBA 3LEGA 5A3WA 1AR73 1BVVA 4DO0A 4QKFA 1I6XA 5FXWA 2R041 3KWVA 1V9U1 5BUVA 4TN7A 4GWJA 4IE5A 3ZN4A 3C7OA 1W0NA 1YNAA 1XJAA 3CDZB 3I59B 3WZ1A 2PHTA 1ONAA 4R8HA 1J1TA 4LOTA 1JH5A 2HYKA 3ZXJA 5L9VA 4ZU5A 1HRI1 2WINB 1FYUA 1X82A 3DKQA 3O5SA 4YGDA 5TSWA 1W0PA 2RDRA 5KXDA 4LK6A 5FPXA 1DFQA 3BGAA 4YW5A 3RZMA 1JXNA 3VDAA 1O4YA 1OOPA 4JDNA 4XQWA 5EP9A 5FZMA 2RJKA 4Y20B 1ZA4A 1ODMA 3AKSA 4XUOA 5D8AB 3ZFGB 4Y1ZA 4XABA 4R52A 1RUE1 2VOVA 3MW2A 4L8QA 4LKDA 2WZR2 2EA7A 4CU7A 3RI9A 3OGSA 1SDWA 4FOYA 3R4SA 3PU3A 5H9PA 3TWIA 1HRV1 4R9DA 4J1WA 3ZFGC 2XUMA 5C8WA 1G9BA 4P9XA 3RZJA 1XOYA 2FD8A 4XJ9A 1BK0A 4CEWB 4RYDA 4JHTA 4XJWA 3URFA 3O1PA 1TME3 2XL7A 4W50A 4AK3A 4HANA 2OUJA 4QU2A 3RG0A 2B9UA 3ZYIB 4I02A 4D8MA 2CWMA 1QH6A 3A21A 3ZN6B 5C6CA 2ZX4A 1KDKA 1LNSA 5EPAA 1ULDA 1G6NA 1IS6A 4J25A 3MBWA 1EPWA 3VD7A 5F39A 3ATGA 3SH4A 4LQRA 2XLAA 1PGL2 3WDTA 3WV6A 4MXWB 3WW4A 2YDEA 3HWJA 3DXTA 3FC0A 4WVZA 1RB8G 1RUOA 5GZCA 4R9BA 1UOBA 5JCTA 3TN91 5CA6A 1UZWA 3DYOA 4CDXA 4CDUA 4CU8A 2EIGA 4N43B 4XUQA 3U1XA 1N1SA 3PHMA 2FMYA 3AVSA 1Q43A 2E9QA 2XMLA 3QH6A 1LESA 4Q4X3 5K4LA 3U14A 1QJZA 3WDYA 1Y4WA 2I2SA 5FPAA 1AR91 5I8SA 4N7UA 1V6OA 5LK5A 1TG7A 3SC7X 2W5FA 3H42B 2VZUA 1ZZCA 4ZXKA 1XE0A 5FREA 3IPVB 5FZDA 2NQYA 1OHFA 1VBE2 1SFYA 2ZEWA 3KGZA 2RDSA 3DV8A 4LKSA 4CDWA 1C3HA 4B4RA 1DIWA 2QDNA 2WWSA 2AYHA 2IVJA 3QH7A 4YW3A 3SH3A 1EYBA 4YYOA 3WDXA 3EHKA 1AJKA 5LBBA 2ZGUA 3W59A 3SQOA 5C3RA 1O4ZA 5IWFA 5C3QA 1S0BA 3G7DA 3VBUA 1OBNA 5DABA 2R0HA 3VBOA 2DWRA 2G4IA 5FZ9A 1J3RA 4I09A 4RR3B 2FZ2A 1IG3A 4DXRA 1VP6A 4PI2A 3WF1A 4Q0QA 2RM22 5F7UA 4N53B 5FP7A 1PGL1 1NOVA 2YGMA 2XBO2 1CIWA 4AQ2A 2ZAAA 5IAXA 4ATEA 4Q29A 1ASJ3 3T3YA 3P1IA 4DQAA 4AI9A 1HW5A 2DURA 4FPYA 4HXCA 1UZYA 3OPTA 1LEDA 5FY7A 1YI9A 5F5AA 2QBXA 2DVAA 4HN1A 3UGHA 5KXBA 5IT6A 1IPKA 4DRVA 1HB1A 1QQP3 1AYM2 3Q9OA 1GFF2 1TME2 5FYIA 2CAVA 2HWF2 2WKKA 1BEV3 3RFRA 3WG2A 2AACA 1V0AA 4LORA 2RS11 1QQP1 4AVBA 2VQUA 3H3UA 3DPRC 5J1XA 4H14A 1RUE2 5JWPA 2XBO3 1C57A 1XYOA 4ASLA 5GZFA 1UKGA 2ORXA 2VM9A 3UT0A 2RS53 5T52A 1GOFA 1OFSA 2Y34A 4ISQA 2GU9A 3VZLA 2KM2A 3DPRB 1DYOA 4CTEA 4YVSC 3NV1A 1UOGA 2JDHA 2WNVB 4EN9B 3UKVA 3H1YA 4A42A 3E6CC 1AVBA 1UN1A 4K20A 2F17A 3PUIA 2V5DA 1IS3A 3LFIA 4YVSB 1RUD3 1V6JA 2RM21 2PQSA 2XQXA 4G9SB 5C8CA 1LGCA 5I91A 4NHMA 1MEC2 1SACA 5DN2A 4CUCA 3M2MA 3ZDVA 1VBC1 4NRMA 3I3QA 4UFKA 4P9YA 4KMQA 4XDQA 4ITCA 4DEVA 4NR1A 3BTZA 3WQ0A 4DPNA 1O5UA 4JQTA 3M1HA 2XG3A 5FUIA 1D4M1 1LU1A 4KG0A 1JODA 5FZGA 3JB8A 2VW1A 1LULA 3H1MA 4IGPA 4WM8C 4XOGA 5BXXA 5A1LA 1AR62 2FDFA 1QJX1 3D0SA 2ZHMA 3I2FA 4P9LA 2FCTA 2GH8A 3TB0A 1ALYA 5DMYA 4QXHA 5FJKA 1SLIA 2YUEA 4ZZ5A 3GM8A 2OIIA 1WZXA 4XC9A 1GQPA 3OTFA 2D97A 5FZ0A 2BOIA 2BZDA 2C9AA 2RDNA 2VBDA 5DZEA 4CEYB 4HMZA 4P9IA 3LDBA 4K1ZA 3ZM8A 2WO7A 1X9TA 1O5LA 1E5SA 3NWKA 4HVQA 1AXYA 5F3EA 1DGRA 3I97A 2ZACA 3ACIA 3PUQA 4AVAA 5E16A 3JBG1 3TYJA 3VBFC 3M3EA 4B3NA 1H4HA 4Z2AA 5BV6A 1UXXX 3OBTA 4PQQA 3ZKYA 2VC9A 1R081 3V0BA 4LBOA 5L19A 1V00A 4MX3A 2VPVA 4MUVA 1KGYA 1WGPA 3ZPYA 3BIEA 3RMYA 1GNHA 2D6MA 4Y22A 2VXRA 2HWC2 3BKZA 4XVHA 3VV1A 1OC1A 3LEKA 5CAZA 2VH9A 2IXKA 2XXZA 5SV8A 1J3QA 3RZGA 3H8OA 1I9RA 1BK1A 3GCWA 3LF7A 5GLVA 3WW3A 5HXMA 2XGXA 4XDOA 2FDIA 4LMFA 4LHLA 2W0XA 1MVEA 2DVFA 2DTYA 1MZ6A 5CNAA 5BPXA 3S30A 5E6HA 2EALA 4A7ZA 1ND2C 3POYA 5DXDA 2Y8KA 5BNPC 1UXZA 2DV9A 4LHSA 3VBSA 5EFUA 2WBKA 4LIUA 1PIV2 1RUJ1 2X09A 3EMRA 2FCVA 3UJOA 3DGTA 2VG9A 4A6OA 1VBB2 1K42A 5I8YA 1RVF3 4M3CB 5F8PA 1JOPA 3AMMA 4KWKA 5BNNB 4OQ8A 1JHNA 1O8SA 4BLJA 4AEDB 3VDBA 2I07B 4QHOA 2E51A 1HRI2 2ZGPA 4K8RB 5IK8A 1NCRA 2B39A 2GDFA 3PVBB 4FO9A 4META 1DG6A 1PM7A 4FBFA 1JYXA 4FPFA 2VZOA 4OHWA 4JKMA 3FL7A 1MS3A 2BJSA 1I5PA 4RGGA 2V72A 3T08A 4N8MA 2B9VA 3I59A 1NCQA
chains in the Genus database with same CATH topology
4RFT0 4OHZA 2Y0OA 4M00A 1LHVA 4DFSA 3N4MA 3UL2A 3RJ2X 1PMIA 1GBGA 3CJIB 4HBNA 2W08A 4UW4A 1ND3C 2ZZJA 1ZX5A 1WD3A 4XFAA 4AGRA 1DYPA 1SEFA 3BALA 1AR93 3CJIC 1IKPA 1NA1A 3MZHA 1TME1 1LEMA 2DFBA 4YGBA 4A3XA 4COZA 3X29B 3BODA 3MFCA 1N3OA 3OCPA 1QXPA 4E4SA 1PGSA 5KHJA 3B5LB 1OQEA 1RUF1 4Q4V2 4UW5A 4YZ4A 1QNWA 1H2KA 2MNGA 1V9U2 1VRH3 2RMU2 3U0ZA 2PYTA 1DF0A 3ZSEA 3SLIA 3ZN6A 4IV3C 5DG1A 3NVCA 3VHNA 2UY9A 5JSRA 3JZVA 5C8CC 1T6GC 1D4M2 5K7PA 3ME2A 4EV0A 1XNBA 2OPKA 4ISRA 2YGLA 5CFDA 3AYEA 4QPGC 1ZRRA 2R071 4XF1A 3J9SA 4D3WA 1LCLA 1RINA 1XU1A 2A6VA 2ZMNA 1WLDA 1YCIA 1RUH2 4XPVA 2YROA 5C4WB 1UKRA 3AP6A 3VBHB 2P3KA 1CAXB 3MF6A 2XPJA 1FV2A 2CL2A 4LT5A 3AMNA 1ULEA 5C4WC 1S55A 1W0OA 4LUKA 2WA3A 1N3PA 4IEWA 2DU1A 5FRAA 1DZTA 1MZFA 2ZGLA 1G9AA 1VBA1 5JZGC 4CDWB 5CVRA 1YIFA 2JEMA 4TWTA 2JXAA 1R1A1 2ZGTA 1WW6A 4NN0A 2PAEA 4XJAA 4IEPA 2WNUA 3POSA 5K0UA 4XEZA 1XNCA 1C8M2 1QOOA 1PZ7A 2D5HA 4HLTA 4AHYA 4RQPB 4A7YA 1AR71 1AYM1 3AP5A 3A0NA 3NV4A 4NOTA 2RS32 3B3QE 4C1WA 2AGSA 4AQSA 3OD4A 3OY8B 4RHV3 2RS33 1HV0A 2R043 2C1FA 2VECA 1WCSA 4RHV1 1W6QA 3AKPA 1QMJA 1RHI2 1RUC1 1TNFA 2QZ2A 3T1LA 3PVOA 1CAVB 4IEQA 1AX0A 3JD73 3WR0A 1WW7A 4EN7B 2PQQA 1SLCA 5F9TA 2VVEA 4NVPA 2R072 1ENXA 2QCSB 3FJSA 3K51A 4DNYA 4DS0A 4JGZA 4QX5A 3SITA 4FOQA 2VU9A 1VBC3 3ZDSA 5GLUA 3VDDB 4CDUC 4CDXC 4W6YA 4Q27A 2RS52 2JENA 2FMDA 4JTOA 2D98A 5AVPA 1K5MB 3AZXA 3PTYA 3FLRA 5JSOA 4TYSA 2HWE1 1CD3G 2IZWA 3H7JA 4EROA 1W6NA 3MIHA 3LCPA 2HWB3 1GR3A 1LRHA 3EJKA 5CADA 1MS1A 1MVQA 1RL3A 3EQEA 2GSYA 1FATA 3ILNA 1ULFA 4LO4B 4QPIC 3DUIA 3ZXKA 2YC0A 2BFUS 1HRV2 2VUAA 3S7IA 2QVSB 5BNQA 4HK9A 4FXGB 4RS5B 1W6OA 3USUA 3JU9A 3TN93 3ZFFB 1LJ7A 2ZPXA 5JI7A 3WY6A 1KXGA 1CONA 1Z7S2 3VZNA 3VBOB 5T55A 1ULCA 1SMVA 1PVC2 1UL9A 4AI2A 3B00A 1X33A 3M70A 1RUI3 4KU8A 1V70A 5IK7A 2ZBJA 2X5IA 1ZRFA 4O9EA 2ZJCA 3ZSLA 3E6DA 1WMDA 1S0FA 4HKWA 1PO13 2DCKA 3VLBB 1DZQA 4AEKA 4KH9A 2YPJA 3WX5A 4JRAA 4URTA 1VALA 2CY6A 3IMNA 5GLZA 5I93A 3KT4A 4QQ2A 1EV11 4B7KA 1HXS1 1AL23 3WD5A 3WP4A 3UK9A 3B9IA 1QJU2 2JJ6A 4OLLA 4R9CA 4HL0A 2AUYA 4IL7A 4PBPA 1BMV2 1U5ZA 2UY8A 1AR63 1UU5A 2CAUA 2QQPA 2XLFA 3KT7A 3ZX7A 1HQLA 3ZSKA 3GBGA 1ND2A 1ZZ7A 3WINE 1ZBE2 4LBLA 4SLIA 1PIV3 1ZZ8A 4GQ7A 1JUIA 1WUVA 1R093 1ENQA 2ZABA 5E1RA 1C1LA 3JBG2 3UKNA 1PNFA 3IDBB 4XETA 2BBVA 1RUD2 1SLTA 2R49A 4BA6A 2GMMA 3WOGA 1ZZBA 1OKQA 4QGNA 1NXMA 2UWCA 3PJQA 2GN7A 4QM9A 4RGAA 4IV3A 2GC1A 1UZZA 2TUNA 2D6OX 1WW4A 5FPZA 2VNOA 1NA1B 2HEWF 3EO6A 4K40A 1NYWA 1SLLA 5BYNA 4CEYA 1GQHA 1Y43B 2DCZA 2WT1A 3J8F2 4FVVA 3PNAA 5CFDC 1QY4A 4L99A 1ZBA2 2WT0A 4FTEA 3FWEA 1O3QA 4AFDA 5I0UA 1SQ4A 2ZX0A 5FAXA 2ZX1A 3FX3A 3KCYA 1RIRA 4BMBA 2PHUA 2P3IA 3I8TA 3UV9A 3BU7A 4BLIA 1REEA 1SBDA 3B02A 3LA2A 4MV2A 4F3JA 4PDWB 4L97A 4MYEA 1AL22 5KHHA 2WLQA 3NO8A 1YXWA 2JE9A 1B35C 3USSA 2ZKNA 4OI4A 4Y4YA 5BNPA 1QNYA 1REFA 1Z0HA 4ATFA 1DYKA 4I0WB 5A3LA 2VY0A 3FUQA 1GQGA 2ET1A 1ULGA 4FSJA 2PHRA 3ZYJB 2ZGRA 3HN1A 1CAXA 3D82A 4XBLA 1NCRC 5AVAA 1BBT1 2VW2A 4XZPA 4FPKA 4M3CF 4OUSA 4NO4A 5DUUA 4P14A 5I0SA 1Y9QA 2GAUA 2WC2A 1YFWA 4E2QA 1S0DA 3DN7A 4MLOA 3IN9A 3B94A 3AP7A 5FLIA 2IXJA 5K0UB 5A32B 3RPQA 4Q0UA 1GV9A 2WL1A 2H6BA 2DCTA 5HI0A 1GZWB 2Q8OA 2VW0A 1YYNA 2H0VA 2QFEA 4IXLA 2O8QA 2YXSA 5GKAC 1H9WA 4AI3A 5AFBA 4RD7A 3ZFEC 3WW2A 1WLWA 3AMHA 1GZCA 2Q1ZB 5JMCA 2HWF1 4KGQA 1LTEA 3H8UA 2DVGA 4Q4Y1 1WBLA 1DU3D 3RZZA 1J59A 1KDMA 4YVWB 3LWCA 2OA2A 1BQPA 5JI9A 3B01A 5CFCA 1WD4A 1AR81 4PLOA 4L11A 5J98B 2OZJA 2UU8A 1BZWA 3AZZA 4HSLA 4Y1VA 5KBFA 1GICA 2Q30A 3GHNA 2BTVC 2VMGA 1YO8A 3JD72 2A3WA 4YW2A 3NW4A 3MIDA 4QQOA 5H9RA 2ARXA 2QDRA 1V6MA 1W6PB 5J3UA 2XWJB 2BYVE 2NMOA 3HT1A 5FMOS 3WG3A 1BVP1 3VZOA 1RUF3 4AEMA 1Q8QA 3AP4A 4L2NA 4AI1A 4LO6B 1AR72 5F1RA 3ENRA 1CGPA 3MGUA 3VBHA 2RMU3 3PJYA 1FNZA 4RR3C 1JW6A 1OI6A 3OYWB 4OI0A 2A6XA 1FNYA 3J26N 2BQPA 1MACA 1NLSA 4AWDA 4MGZE 4BE3A 4AHWA 3HT2A 3ZVXA 1CR7A 2MEV2 4CEYC 4Z1VA 2WNUC 3FFQA 2H6CA 1AZDA 2K2SA 4CRQA 1Y7BA 2BVBA 4WVMB 1PNGA 4HVOA 1QDCA 2E63A 4YM1A 1QXRA 4LO7A 3MYXA 4FXKB 4HETA 1ZRDA 2V09A 4KL1A 1A3KA 3IT8A 5JOYA 2A3XA 1H2LA 1CPNA 3AZWA 4YG3A 4JVAA 5DUVA 3LKJA 2DUPA 4AVSA 5JOWA 4XQDA 1QH7A 4FAHA 1W6QB 1RMU2 1Q8VA 2HJIA 5IUQA 3THPA 1IHMA 2X29A 1FV3A 4JCKA 1YI7A 5L36A 3VBUB 1WCDJ 3KLSA 3ZO0B 3KMHA 2K9ZA 2VMHA 3GZUC 4N9HA 2PHFA 2EVXA 3JCIA 4GWNA 4XJ8A 3E5UA 1GSLA 5FBZA 3VBUC 5BNNC 4N53A 4YM3A 5FFOC 1V9U3 2QZ3A 3N35A 4W65A 2XJPA 4AEDC 1WCKA 3VBRC 2ZX2A 1ENSA 2A3YA 2VQAA 4E9KA 3FLTA 1MZ5A 5ACA2 1RUC3 3NAPA 1Z7S1 4FPJA 2X53S 1EAH3 2IFWA 2PLV2 1VBC2 3JD71 1N1VA 4IERA 3R4DB 4AXOA 4Y5Z0 4Q4Y3 4CEWA 2ZKLA 1A8DA 5HCAA 4FPGA 4XBNA 4FP2A 4PIZA 1PGW2 4GXLA 2HWE3 2P34A 4OUMA 4QD2A 4IETA 1H1MA 3SXWA 2HWB1 3S6PA 5DUWA 3USUB 1UAIA 2ZHLA 3JUUA 1EP0A 3GYDA 4Q4W3 3R05A 4GALA 3CF6E 1Q3EA 5KHGA 1H4GA 2X5IC 4V1PA 4YGEA 1YRZA 5L7OC 2X5IB 4BH9A 1VAKA 1VBB3 2WIIB 3VKMA 2IXCA 4LEJA 5C9AB 4GB33 5E89A 4INDA 5C33A 5KWRA 2VNGA 2RJLA 4Q4X1 3QD6A 4OFGA 1V6IA 4PDWA 5AC93 1J1LA 4CZSA 2JG8C 2D6LX 2F6BA 4PIXA 5H9SA 1UF2C 4HT1T 4GMP3 3GNEA 1G9FA 2R16A 3VBHC 4YG0A 4GMP1 3N7KA 1POV1 3B9CA 5FOBB 2OUHA 2D7FA 4PJYA 2ZGQA 3NV3A 1FI2A 2EAKA 4GB32 1RUI1 4QHBA 2GC2A 3H50A 4K21A 4AGVA 4CDWC 5DDJ1 5GM0A 1RVF1 4Y22B 2A6YA 4YZ3A 4YSFA 1ND3B 4Q8KA 2WS93 4BM8A 3MW3A 3O14A 4XW3A 5FTTC 5CU1A 3VN4A 5KXEA 2VOKA 3UKTA 1AYN2 1QJU3 4QQLA 4W6WA 3D4KA 3RRDA 4BIFA 1HKDA 2D44A 5A32A 4E4ZA 3T2TA 4N9IA 2ZGMA 2XHKA 4P9GA 4QT6A 1CAUB 5LRRA 4COYA 3ELNA 1LENA 1S2KA 4K1YA 4X8PA 3O0VA 4DRRA 3H7YA 2ZMKA 5EXOA 5LK7B 4NWWA 2JG9A 1L3JA 1LECA 1TMF3 2XBO1 1A6CA 4JAAA 3M4FA 4FCAA 3SCFA 1D2QA 2NM1A 1MEC1 1Z7S3 3HIFA 4ASMB 1PZ9A 4AEJA 3U4XA 1U5IA 3H1WA 5A3MA 1AXKA 3TRSB 1LOGA 2OW4A 3WNXA 4AVTA 4XBQA 1LODA 4XFCA 3LA3A 1IGOA 4XF9A 2BNMA 2XL9A 3U07A 3ZYPA 3VZKA 5FO9B 2C0ZA 2UWAA 3PMSA 5FLHA 1W6MA 2WZPP 4A7KA 1CQ9A 1UPSA 5D8AC 4QPIB 2RR11 3S0MA 4GIQA 1F8VA 2Z69A 3ZXGA 2JECA 1S0IA 5EWSA 2HKXA 4QGLA 3V0BB 1KS5A 4FPOB 4RQPC 4XMIA 2UWBA 3U10A 1YLLA 2D40A 2GH2A 3BCWA 3OD0A 3W9AA 1U0AA 3MIBA 4HKLA 4YM2A 3R0RA 3SHRA 2WQ4A 3BTAA 4BYYA 1RUH3 1S1AA 4PF5A 3AFGA 1X7NA 1C1FA 1WW5A 2ZGSA 3GBFA 3AZYA 3VBSC 4M3CE 4P9WA 4I3PA 1FOD3 3VGIA 1KS4A 5AC91 4KNCA 1WMFA 1MS0A 1BMV1 4KU7A 1DBNA 3MPBA 2TEPA 1CAWA 2WZR1 3CJXA 2NP0A 1HXS2 1OA2A 2FQPA 2IFRA 3KQRA 3LB9A 4HFSA 5CFCC 4BQ1A 4IV1B 5AFEA 1RUJ3 2D3SA 3GALA 5A33B 3VDDC 4XXAA 3NV2A 2XLGA 5CFCB 4TLFA 4ONUA 2PN5A 3M8LA 4UXAA 1OQDA 3N7JA 5EV7A 2D6PA 3WDUA 1EPZA 2C5DA 2DCYA 3CJIA 4MSVA 4XYXA 3APBA 3WG4A 2MEV1 4NWVA 4D69A 1KFUL 3MW4A 1KJLA 4N53C 4C0BA 4LO8A 1XYPA 4A2UA 3WLUA 4YLZA 4M0HA 1VB2A 2D43A 2JE7A 4GULA 5CG9A 3AKRA 1ZRCA 3O12A 5EYYA 3RQ0A 2ENRA 1R082 1XRUA 1ZM1A 4B8EA 1QJX2 3BIWE 1X50A 2I45A 3MIGA 4TSVA 1G86A 1XYNA 2XJSA 4AFAA 3OYWA 1N1TA 4K6BA 1V6LA 3JQWA 3VBFA 4LUMA 1RGSA 1HRV3 1H9PA 4QPGA 2DU0A 3CLPA 3HQXA 2NZ9A 2B5HA 3AP9A 1VRH1 3AXEA 1LOFC 2P17A 3WQ7A 4AFCA 4WVMA 2B42B 4GB31 1R083 2V73A 4L9BA 4G3YC 4HSJA 5C4WA 4WM7B 4ZU7A 3IIAA 1BYHA 1H0BA 4P5HA 4X8NA 2HWC3 5DZGA 2E6VA 5C9AA 2HWD2 3QCWA 4M01A 1B35B 3AK0A 2A7AA 1W39A 3B93A 1POV3 4XF0A 4AE2A 5DDJ3 2AZ5A 1PO21 4YW4A 4GMP0 1DGLA 2IC1A 4Z92B 5JSPA 2Q5TA 2VVFA 1UX6A 2E53A 4IEZA 3DF0A 4H7LA 1DQ6A 1AJOA 4RQPA 3MFAA 2XJUA 1RUH1 4JV4A 1H8VA 2WS91 1JOJA 1LHOA 1Q8PA 2AR6A 4J1XA 3OY8A 4ES9A 4COUA 4ZU4A 4GA9A 5KC6A 2IXLA 4DZGA 4LBNA 1MR5A 1YJLA 1RUF2 1KQRA 3WG1A 1ND3A 2SLIA 3H9AA 4CEWC 4Q0SA 3KD4A 4XFFA 5K0UC 1CAVA 3GZAA 5BNOC 1NA1C 4XIOA 1QHDA 4HZFA 3R6SA 1GZ9A 3MF9A 1I1EA 3AKTA 3ROUA 2JG9C 5I8TA 2DFCA 4RA0A 2EXIA 5BNOB 4Y24A 1EAH1 2RS13 3ZFEB 1AL0G 4F8AA 1UCXA 1H8TB 2ZAHA 4BZ4A 1QJY3 5SV5A 1ND2B 3RI8A 1APNA 3VDDA 5J96B 2RM23 1CPMA 2QE3A 3RJRA 4KQ7A 1H8TC 3LZZA 1H30A 5DDJ2 4WZFA 1DZRA 2BGCA 4IESA 3NKTA 4HKOA 1Q8OA 1LOEA 2EAAA 2MEV3 2GNMA 2YV8A 2ZA9A 1W6NB 1Q8SA 2CGPA 4X6RB 4UBGA 2ERFA 3HR9A 4EWEA 4SBVA 2TBVA 1LGNA 1YUDA 3FHIB 4JTNA 4Q26A 2QJVA 1WA4A 4Q4W1 2I74A 3FBYA 3MPPG 2RR13 2O0OA 1TEIA 5FQ0A 1RUJ2 3ILRA 3JQXA 2X8KA 1O4TA 2P3JA 2PAKA 3D5OA 5GZDA 1FPN1 1ASJ2 3WHUA 4AQ6A 4F7ZA 3TBDA 1IZ3A 1LHNA 2GNBA 3HD8B 3MIFA 3WQ1A 4XJUA 2R063 4ES8A 2B7YA 3IBMA 5FOJB 3CNAA 3QACA 4WVWA 5HCFA 1TMF2 1VBB1 1NZCA 1FPN3 3V0AB 1HIXA 3MEPA 1RUG1 3KM5A 1UU6A 1FMD1 2BNOA 3RSJA 2K0GA 3VHPA 4S2GA 5JAXA 2Z79A 4XFHA 2Z42A 4W6XA 4BOWA 4U2AA 3RYKA 1C28A 1Q5OA 4XIKA 2A73B 2R6QA 4X6QB 2R042 2LM3A 1G9DA 1H1IA 1HLCA 2EXJA 3SCGA 2ZHKA 1SFNA 1N1YA 2QUOA 4IEUA 4COVA 1HDKA 1NQDA 2WNVC 3NJZA 3QOPA 2GNTA 1EV13 1OMIA 4EN8B 2WA4A 1NY71 5F5QA 1R092 4BCUA 1COV2 3ZIXA 3VL8A 2GC3A 3WDVA 2XJRA 2A70A 2NYYA 3WW1A 1ZBE3 4Q0PA 1CVNA 5I0RA 4Z07A 2SBAA 4U36A 1RJ8A 1ZBE1 2DCJA 1AR83 1MQTC 3B7MA 3AYDA 2BFUL 4DY3A 1F5FA 1MQTB 4BMEA 1GZWA 3M7AA 4Y1YA 5ABJC 4LULA 2B8MA 1TMF1 4GH4B 2PLV1 4XMAA 3VKOA 4Q4V1 2ZGKA 5GJ6A 1B09A 1ZREA 4D7TA 1OOPB 4QQPA 1IOAA 5FO8B 5D8AA 1VLNA 3HAGA 3RYPA 3KZ4C 2GZWA 1G8WA 2XKOA 1REDA 3P3NA 1XNDA 1N47A 1XE7A 4FTBA 2PLV3 3L2HA 5KC5A 3ZSMA 1O3RA 1RTVA 1RJ7A 3BOWA 1OSGA 1QKQA 1RUD1 4Q4W2 2QKDA 3C3VA 2Y38A 4KWJA 1QGLA 1URXA 1VAMA 2ZCWA 4XILA 2PTMA 2WSUA 3N3HA 4YFWA 1Z78A 4AW7A 4PIYA 3ES1A 4MH0E 4IEOA 3TNQA 4KG8A 3V65A 5GZGA 2GALA 4CDQC 1IS5A 1IS4A 1D4M3 3PMEA 5BNPB 2Z5WA 4CDUB 4I3GA 4CDXB 1PK6A 1MS4A 1XU2A 4N43A 4MVTA 4JGYA 2W52A 1PO11 1K5MC 4YFZA 2BVVA 2LALA 3FUOA 4WM8A 4FAGA 4LLFA 3WDWA 1SBEA 4FPEA 2RS12 4OULA 1WLCA 1EY2A 2FHRA 1AL21 5EJ3A 3SCHA 3GBWA 4XXPA 2HEVF 2R1BA 1B35A 2W68A 4IEYA 3KSCA 3M3CA 1C4RA 4YM0A 4XFIA 4Z82A 5AC92 3IDCB 3IKWA 2YZ4A 2WSVA 1UPIA 4S2DA 4Q4Y2 4LR4A 3H3ZA 3S7EA 1VBD1 4LBQD 4R9AA 3ZFFC 1AYM3 4FOVA 5CB7A 1ZVFA 4QGMA 1CN1A 4YGCA 2D3RA 3ZXLA 2OYZA 4E2GA 2AH2A 4PQ9A 4XQ4A 5JLVA 3O0XA 1PZ8A 1VR3A 2CYFA 5GLWA 1QJY1 3ZFGA 3KS7A 4I0BA 4S2HA 2P2KA 4YARA 4OVEA 2W39A 4FPHA 5D1IA 2XKPA 4I30A 4LTAA 2G9FA 2WFF2 5GZEA 5JVVA 3J8F3 3ZMOA 2IWGB 2ZS6B 2OVUA 5JPMB 5BNOA 1JBCA 2E7QA 3FFZA 4ZKTB 2Q1MA 4E27A 2D6NA 1OA4A 1NE6A 2A5ZA 1POV0 3KB5A 4QPGB 5T54A 4HK8A 1ZZ6A 1TE1B 1SLBA 3OGGA 4FOWA 4MXWA 1R1ZA 3VBRA 3NAPB 3H0OA 2MPFA 1RUI2 3WCSA 4YVSA 5ACA3 1NQJA 1ENRA 4S2FA 1CJDA 2JG8B 1YHFA 3CO2A 4N90A 1AR82 2DVBA 4LA3A 3NAPC 1I5ZA 1D0HA 3WT3A 1S0EA 1BEV2 2OZ6A 1AX1A 4OI2A 1DQ5A 4XF3A 3D8CA 4BPZA 3GF6A 4EN6B 4CYDA 5JZGB 1JYCA 5T3NA 5FQ0B 1QOSA 3GZTB 1OPMA 4XJZA 2CWSA 1GNZA 3I4IA 2RMU1 3QBQA 2VMIA 3ZN5A 2HWC1 1AUYA 3MICA 3BOPA 3AYCA 3D6EA 1M06G 1PGW1 1YFXA 1NXD1 4PCRA 4DINB 4RR3A 1MS8A 3LOBA 1VRH2 5CIRA 1HV1A 2GMPA 5GALA 3ZXEA 4YZ1A 5EYXA 4H7MA 4JC1A 2R073 2WQZC 2BUKA 3ZXDA 4QPYA 5L7OA 1PO12 1S2BA 4DMIA 4NHKA 1FOD2 1QXJA 3SH5A 1LOCA 4CDQA 2WNEA 1KJRA 3ES4A 2G9GA 3ZYGA 3WP3A 3J4UH 3CU7A 1DQ2A 1S0CA 2RE9A 2BPA2 2D6KA 4D94A 4IEXA 4N43C 2R062 1C5IA 3JB4C 5K9YA 2ZGNA 1HXS3 1BCXA 1WLTA 3PVEA 4LHNA 4D7YA 1CX4A 4L92A 4JRLA 4Q4X2 3ILFA 4C91A 2FBEA 4AYUA 5J37A 2NMNA 4GKXA 1BJQA 1JN2P 4H55A 1O3TA 2WNVA 1ZYBA 2D3PA 3D0JA 4DOUA 4M3CA 3AB0A 5ABJA 5J7MA 1QJU1 4GWMA 1ASJ1 4AFBA 5DG2A 4HPKB 2PHDA 3DKWA 2R30A 4I2OA 2A6WA 1NCRB 3ALQA 4LBQB 1DGRN 3IDEA 3LSEA 2ZX3A 3K48A 2UYBA 3FMGA 3WP6A 2DVDA 1UMZA 4FT8A 1PVC3 1FX5A 3MLLA 4XHBA 3LGRA 2KA3A 1AF9A 5F6LB 4F83A 3PLQA 2WFF1 3QLQA 3UJQA 1F31A 3VHOA 3ZSJA 3M3OA 1MQTA 4RS5C 4WBBA 1TNRA 2ZZQA 1C8NA 2PA7A 4FP3A 1QJY2 1CAUA 1CESA 3FZ3A 1LHWA 2ET7A 3AFKA 1KFXL 3I7DA 1SLAA 3NL1A 1AX2A 3R4UA 1F5JA 5T5PA 3EXUA 2PELA 2WT2A 3BPZA 2VOXA 1OPOA 4LHKA 2YHJA 4EWDA 2H0BA 4ORFA 1LU2A 3HMYA 3OF1A 4R4ZA 5T5LA 1D2SA 1VAVA 2R061 1AYN1 1NG0A 3OGJA 5FDBA 2AREA 4O9GA 3HBZA 2ETEA 3WUCA 1DQ0A 2Q4SA 3RS6A 3M3IA 2YYOA 1W2UA 3SISA 4OHYA 1QWRA 1FMD3 4JQRA 5FO7B 4RL7A 3BB6A 1SBFA 3INAA 1FOD1 2VQ0A 1X8MA 1ZBA3 1A78A 1W6MB 2EXHA 3JBG3 1VBE3 3ETQA 1R1A2 3MI8A 2PHLA 3AM2A 4QPIA 4AQTA 5IK5A 4XTMA 1H1AA 4GKYA 1LR5A 5J09A 1UW8A 4WM8B 3LAGA 3W58A 3A0KA 5BNNA 2ATFA 1ZNPA 2HWD3 5BY5A 4MZUA 1VBE1 4AEDA 3E5XA 1Q56A 4UBHA 3I2DA 2WZR3 2PFWA 3VZMA 1RHI1 1RUC2 3FLPA 4I0AA 4G4FA 4XTPA 3O7OA 1AHSA 2WS92 1C8M3 1IPJA 2QNKA 1O3SA 2R1DA 2ZTNA 1SCSA 2D93A 2WNUB 3FE5A 4YZ2A 2RS31 1IQAA 2IXHA 3ZXAC 1U5XA 4CP1A 2GC0A 1QDOA 3T1MA 2VGDA 3KGLA 3SNMA 4GH4A 2HWF3 3OPZA 4OHVA 1QU0A 5J36A 1RUNA 1RVF2 3E6BA 1QQP2 4B4PA 1LOAA 5E8AA 4QMAA 1MS5A 4IEVA 2D5FA 3ECQA 3AMPA 4KGGA 2ZGOA 3WCRA 4IV1A 5A33A 1BBT2 2JG9B 1GYKA 3VL9A 4YNIA 4AFMA 2BW8A 2PAMA 4BHPA 4B29A 4LNVA 1YFUA 4N7IA 4MGIE 2UURA 2HWE2 2VNRA 5JR7B 5T50A 2E7AA 1X8EA 1HQNA 2VVDA 2F4PA 5KXCA 1RUE3 1KITA 1PHMA 4HN0A 1M4WA 2A71A 2DUOA 4JGZB 4LBKA 1S0JA 4OHXA 3MLJA 1YIPA 5LEJA 2XJQA 2ZMLA 1HQWA 4Y20A 2BWCA 5B2GB 3CL1A 1PK6C 3VBRB 4JGZC 3AKQA 1XE8A 1J3PA 1K5MA 2JG8A 4Q1RA 1V6NA 1PK6B 4PLMA 2R0FA 3V56A 2NLRA 5GLTA 5JPNB 1LHUA 1D0GA 3TAYA 4RHV2 3ST7A 2BNNA 5JZGA 3VBFB 5E88A 1NE4A 2XVGA 3I54A 4QXKA 4WVVA 5LEKA 4COWA 4BWOA 1PO22 1W6OB 5JOXA 4YG6A 1FT9A 1GLHA 4IQPA 3MIEA 2ZOEB 3MDPA 3NSTA 5H9QA 2AENA 2DTWA 1PVXA 2XWBB 3B69A 2MHFA 1VJ2A 4J6GA 3KT1A 1LOFA 5FMOL 5KHKA 2FZ1A 2VUJA 3A4UA 5LRSA 2IXIA 4CP2A 4WM7A 1CAWB 1GKBA 4YVWC 5L7OB 1NY72 3CEWA 3POWA 4Y1XA 3IPVA 3P3PA 4LE4A 1G9CA 5J48A 3VHRA 1RUG2 4