2WN3A

Crystal structure of discoidin i from dictyostelium discoideum in complex with the disaccharide galnac beta 1-3 galactose, at 1.6 a resolution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
254
structure length
254
Chain Sequence
b'AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 60
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn3A01
3EYPA 2VMDA 2Y6KA 5JXIA 3T0BA 5JUVA 2VJXA 2YFUA 3WF2A 1MPXA 2QQJA 4PQQA 2JE8A 1HN1A 3T0AA 2EIEA 3WNNA 3HNYM 3T08A 1UYYA 2VCAA 2QQKA 3NRUA 4LHSA 4XUOA 1OT5A 4HG6B 3EB7A 4ET7A 2J1TA 2VZRA 1JI6A 3VD7A 4QDSA 2W1WA 1EUUA 2WYSA 3I2HA 3C7EA 2BZDA 2ORXA 1UY3A 1J83A 1JU3A 2VC9A 3AC0A 1W9SA 2VZ1A 3CZJA 3MBWA 2VZPA 3VD4A 2YG0A 5IYYA 3FHAA 3MO4A 2QBXA 4QDQA 3DYOA 2J1UA 4MO3M 5IJRA 3THCA 1F4AA 1I5PA 3ETPA 2W1SA 3THDA 4P5YA 1UYXA 2W95A 1GOGA 1JZ6A 5EJ1B 2QQNA 3P6BA 5G04L 3I3DA 3CDZB 3SKJE 2J1AA 2VZTA 4AG4A 2Z4FA 1XPWA 3C8XA 3K4ZA 4CUCA 5JXJA 3F2ZA 3NJXA 2EICA 2W92A 2OKXA 4CU8A 2V72A 3UNPA 4PT6A 1KEXA 4UOJA 1JZ8A 1LNSA 5DN2A 3GM8A 5IFTA 3HJRA 2C26A 2WO3A 2W1QA 3CQOA 4RN5A 1UY0A 3ACHA 1GUIA 1TG7A 5FUIA 2W91A 5LA2A 2XONA 3HNBM 4QB2A 4A41A 4ARYA 4QX0A 3CIHA 2DCJA 3IB3A 2JDAA 1UXZA 5B4NA 3VDBA 4LPLA 1JYVA 2BBAA 4LKSA 4OMCA 1JZ7A 3CZUA 1GOHA 4CUBA 3WF0A 3WMPA 3A7QA 4FI9A 1DYOA 2J1SA 2W5FA 5DQ0A 1PX3A 1JZ3A 2YC4A 3FN9A 2JD9A 4BXSV 1GOFA 1ULPA 2KD7A 4A44A 1GMMA 2JKXA 4M4PA 1GNYA 4W8JA 2J1VA 1R64A 3K4AA 2CGZA 1WKYA 2W3JA 2VZOA 1T2XA 4XVHA 2BERA 4XUTA 3WEZA 4DEQA 3PUIA 5DPNA 3VD5A 4YPJA 2ID4A 4CUAA 1GU3A 4KWUA 3LE0A 1O59A 3WNMA 4BK5A 2HYXA 3P1IA 4QB1A 2VM9A 1L7QA 2ZEYA 3I3EA 1JZ5A 2Y6HA 4QAWA 4P00B 5LCWL 1H6XA 3D3AA 5IFPA 1US3A 2VMFA 3ABZA 4QPWA 1D7PM 2YB7A 3MV11 2VR4A 3WNKA 3IIIA 4BK4A 4CU9A 4ZZ8A 2VZSA 1UY4A 3LEKA 1UX7A 4D8MA 3MUY1 3GGLA 2W94A 1O8PA 3OGRA 4GWJA 2V4VA 4QB6A 1RYYA 1W8OA 1PX4A 2VQUA 1H6YA 1OH4A 4A6OA 4XUQA 3VD9A 3GXUA 3HOBA 2X10A 1NKGA 1XC6A 3WF3A 2BGPA 2CDOA 2WBKA 3WQBA 3WNOA 3WF4A 2B9VA 1JU4A 4E8DA 3DYPA 2VQTA 5C70A 4QX2A 4TTGA 4DUWA 2VZ3A 4XZUG 2QQMA 2X05A 4MGSA 2WAOA 2ORZA 4PF1A 2WO2A 2E33A 5CYYA 4BDVB 5JMOA 1YQ2A 4P02B 2J1EA 5IHRA 4E8CA 2Y6LA 2CCVA 2E26A 4LQRA 3HNMA 4JKLA 1W9WA 4QX1A 2Y6JA 1P8JA 4BJ0A 4GWIA 2CGYA 3ACFA 3SEPA 4JX0A 3T2QA 2VCBA 3ACIA 2ZEXA 1JYNA 3OG2A 3WSOA 1L7RA 5EIYB 4DXTA 3NJVA 4RYDA 3IAPA 1CZTA 1IQDC 3C7HA 3A23A 2VL4A 4ZXEA 1JZ2A 1DLCA 3FHQA 3JXSA 5A1AA 3WMQA 5C7GA 3LEIA 4Q56A 1W0NA 1ULOA 4OMDA 1PMHX 2CE6A 4A4AA 1US2A 2VOTA 1KGYA 1CZSA 2YFZA 2Y6GA 2ZXQA 5LA1A 4DEVA 4GZ9A 3U37A 5I0DA 4Z2AA 2WN2A 2VZUA 3HEIA 3MV01 1UY2A 4CVUA 3WF1A 4XUNA 2W47A 4ZZ5A 3LEGA 2VTFA 2VO5A 3ACGA 1NUKA 5G05L 3IAQA 2Y8KA 2DCKA 4A3ZA 3A21A 4JKKA 3BN6A 2J7MA 1F4HA 1UYZA 3VD3A 2VZQA 3K75B 3ECQA 4QDRA 4KMQA 4JKMA 1DP0A 3OB8A 1XNAA 5DMYA 3BGAA 3SKVA 2R7EB 1JZ4A 2QQLA 2W9XA 1K12A 2J1RA 2B4KA 4KI5M 2C4XA 4XURA 3NNGA 3LQCA 1W8NA 4ZY9A 4DUVA 1K45A 2BGOA 4XUPA 1W99A 4A42A 2YC2A 2ZEWA 3OEAA 4QX3A 2W1UA 4P08A 3I2JA 1GQPA 4UAPA 4IUGA 5JXGA 3T0DA 1UXXX 1O8SA 3I97A 2Y64A 4JHZA 2WN3A 2XHNA 3UETA 1J84A 3C7GA 1CIYA 5JXHA 2VMCA 2VCCA 2VMEA 2V5DA 3GDBA 2CDPA 2E32A 2LS6A 2WZEA 1BHGA 2W46A 3LPGA 3E1F1 2J22A 1UWWA 2HLEA 4MADA 4ARXA 5HXMA 1CZVA 2XOMA 2DDUA 2QQIA 1WCQA 2WABA 5B4XA 5F7UA 4L0PA 2ZEZA 2RJ2A 3MUZ1 1TVGA 2QQOA 3K46A 1OF4A 3OGSA 1W9TA 3SEEA 1K42A 5C71A 3VDAA 4M4RA 3A22A 4DXRA 3UESA 3VDCA 3WNLA 2WAAA 4MGQA 3J7HA 3I2IA 1JYWA 4CU6A 4OZOA 2RV9A 4W50A 3I2FA 1OD3A 3NQHA 1XNTA 2RVAA 3W5NA 3OBAA 2EIBA 3DECA 4OYUA 3HN3A 3OEBA 3CMGA 3ZM8A 5LA0A 1JHJA 3K4DA 2E31A 3T09A 1OF3A 3IDAA 1K3IA 4OUEA 1NX9A 5J1XA 4AAXA 1JYXA 5EJZB 3LPFA 4W4ZA 1UMHA 2WZ8A 1UMIA 3HPNA 3T2PA 1EUTA 3WNPA 4D0QA 2VZVA 3W5MA 4A45A 4TXWA 1SHWB 2XQXA 3PUHA 3K77A 4CU7A 1CX1A 2WO1A 3I3BA 2X09A 3T2OA 2LW8A 2PQSA 5CZKA 1PMJX 2WUHA 3I2GA 2WDBA 1NAEA 1SG3A 3C7FA 4DXSA 3C7OA 4DUXA 2EIDA 1SDDB 1UY1A 2C9KA 2WQ8A 3CKHA 4UI9L 5HPOA 5JR2A 3I2KA 3OGVA 1UZ0A 4MOAA 3FL7A 2L9LA 2W87A 3DYMA
chains in the Genus database with same CATH superfamily
1JDAA 1AZVA 2VMDA 2QBWA 3P0GB 5GGTH 4Q2FA 1ZT1B 5FXWA 3T0BA 3MRQB 4DQOL 2PHTA 2XBDA 3WF2A 3QDJB 1WZXA 3ZYFA 1V6MA 1OAUL 4Y5XC 5HHPB 2DWEB 1SPPB 4M1CD 1I8MA 2V5RA 4W6YA 1U95B 4B1MA 5EBMB 4HFSA 1YHPA 4XMPL 2FX8L 3ZT7A 4Z3FA 1E4XH 4QRRA 2D3JA 2E7CA 4MKMA 1HJFA 2PPCA 1X5HA 4W4OA 1A6UH 1FIGL 1FZOA 1QSFA 2DURA 3M8OL 1I8AA 3UTSA 2E86A 1AO7A 5EN2B 3TT3H 3VBFC 4AHZA 3EBGA 4OFKA 4IS6B 3UH8A 2RMNA 3LZNA 4HMDA 4XVTL 4YHPB 4IBTA 5E5LA 3RZCC 4PBOA 1A1NA 3WHXB 2NY6D 4IW4C 1XV8A 2WUBH 3TT1H 2GUYA 3BKML 3FJSA 4L8DB 3KPSB 4EROA 5J48A 3RB7A 4QRPE 4DK6A 1SOXA 3MBWB 4EV0A 3JV6A 4JPIB 4E36A 2PLV1 2NW3A 2QSCH 3L95A 3QUZB 2P5EB 1BZOA 3JVGA 3RIFK 4EZMA 4JZOA 5B7MA 5JOZA 5IESH 5CG8A 4ZXBB 1SCSA 4LTAA 1J0JA 1BQUA 1HE7A 3VXMD 3VA2C 4XPGL 5KVGH 1HJBC 3Q1EA 2EALA 4JY6B 4E5XB 1XB9A 2QQLL 5C0DA 4OQ1A 1F3DH 1FN4B 1JV5A 1NCOA 1YC7A 4Z7VB 2VDPH 1MCLA 1P84J 3O3AA 3ARDB 4U3SA 2NMNA 3JTTA 3ZSSA 2GCYA 4WVWA 5CBLA 1RZGA 3QE5A 1BM3H 3DJSA 4Q6KA 1AFVL 1ZT4A 2D8KA 1LNUA 2K70A 1JBJA 1FL6B 3W82A 1F90H 2P28B 5I0VA 3I3DA 3DVGB 4BKSC 1UM5H 3CDZB 1KJMB 1XZ0A 5ECGA 1HB2A 1LO3H 4H20H 2VXTH 4XCBA 3UJJL 2DRUA 1G7HA 1H2MA 4N2AA 3Q05A 4NWUL 2ZTBA 1RZIB 3GSQA 1JD7A 4LF3A 4RFOL 3MV8D 3SB3A 3FSWA 3KYMB 1H15A 5J89A 3HMYA 5DZOA 4AJVA 2V72A 4GKXA 1RCYA 4AVJA 1TU2B 3CXDH 3EO1B 2KDYA 2P5WE 3I9AA 4UQ3A 3TA3C 3IS1X 4FPJA 4JBSA 4M1GL 5TK2A 1LE9A 5DN2A 4CILA 5KC5A 3JD72 3H3PH 2CNYA 4NQDE 2WFF3 2EKJA 12E8H 1VBC2 3KXFD 4QLWA 2AK1H 1PIV2 2W1QA 5HHVL 3OY8A 3F6IA 4X6FA 3GBWA 1O0VA 5AFAA 5FK9B 3TPUB 5G4MA 3WFHA 2XBO1 5ERWB 1NOFA 2NY6B 3RIAF 5A6YA 1KXQE 1KV7A 2CGRH 1IBBA 4QRBA 3TVMC 4TRPH 4D9QD 1YQ5A 4ONHB 1F6AA 4MNHA 3RFRA 4IJTA 1QP1A 4L48A 5EWIH 1NAML 1DBBH 4OSUL 3DDGA 1XSQA 2IZWA 3FTZA 1BPLB 3JT0A 4JJ5A 4RZCA 5B1BB 2QQUA 4PBVC 3GSUB 5EEUA 1NA1C 4BA6A 3TCXA 1UB5B 1ZHBA 3DRTB 1IQDA 3VXMB 4P2OA 3UAAA 4JN2A 1A7NL 5JORA 2Q20A 1JHTB 3TNPB 1EHLL 2L0DA 1C8M1 3B3IA 3NGBB 4G8FA 2WOBA 4Q2ZB 4U6YA 5EG6C 3AY4A 4EF3A 1D4M3 4YHYC 1TFPA 2X89A 4H26B 4CSSA 5FYKL 4HLZG 5IIEB 3SJVD 3D4YA 4JTOA 3VBUB 1U8CA 5ESVB 4LBKA 2VM3A 3VRLE 1AYRA 1LK3L 4U1MA 3WFCH 4IBVA 3BPNC 5JHDA 3U6XS 3EYVA 5E7BA 4PBDA 4V1PA 4ZTOL 5FPXA 5E9DD 2VZOA 4MJIE 1BJ1J 1WCKA 4C55A 1SEBA 4KZ0A 2GMMA 2I2SA 3EZJB 4Y1UA 3OPZL 1UXSA 1A7BA 3MV8B 2UZYA 2KI6A 2BJML 2ZQKA 3HR9A 4K7FA 1ASJ3 2OK0L 4PJDA 3G6AB 4AQ1A 3UTZA 2HX8A 3U0TA 2WXQA 4RA0A 1JYIA 2D3LA 3CHOA 1VBB3 2A77H 4IDJL 5LN8A 2XUWA 1QRNE 4QNPE 1MRDL 3B2VL 3CZSA 3KXFB 4HXAH 5DK0B 1X44A 1RFDL 1UZ8A 2R2EB 4FQ1L 4G3YL 4NBXB 4P23A 4Q6YA 4D8OA 4OLUH 3MIGA 5CN2A 4J3VA 1FVDA 1A8ZA 1KYAA 1WS8A 2VE6B 1US3A 3KT4A 5CADA 4NFBA 3UMTA 3UG3A 5CD3B 5MEND 3SQOA 4PS8A 5LK7B 2PO6D 2WLPA 5BXXA 4R26L 3V9CA 1ESOA 2Q7YA 4I77H 4KQ0A 3IMRA 5H9PA 4L1LA 4XNQA 4S2HA 3CFBB 3LOBA 1KEMH 3PIJA 2OW6A 4CU9A 3OHXA 4NKIL 5A6XA 1B6DA 2XMLA 3OKKA 1MLCB 8PAZA 3FT3B 2DVGA 1TT6A 2AEQH 3FBYA 5HGDB 5FZ1A 2QDVA 4IDLA 3WN5B 5LNDA 2Z7WA 4OCXL 2RJLA 4JZNB 4XTRD 3MUY1 4LOSA 4HPOL 4I1NB 4PWFA 3DWTA 3QUZC 4HIXH 5I6KA 5CGBA 2BZCA 4HWNA 1WAAE 4ZXBC 4XVJL 4K8FA 3ARBA 2RS12 2Y23A 1ZS8A 4GRWF 3FTXA 1HDMB 4RESB 1ITBB 4XXWC 3MRFA 3U4BH 3CLPA 4Y1TA 3SJVB 3HOBA 3KBEA 1GNZA 4F37K 4N43B 3WCSA 1XC6A 1LVEA 3ARDC 3J8F1 1T22B 5CAYB 1O5LA 1WZMA 1RU9L 1CG9A 5E9DB 1MI5B 2XTLA 4A63A 1A1OA 1BFSA 1S7TB 4K8RH 2JFCA 2AUYA 1EDHA 4YFDB 1A3QA 4Z1PA 2WQAA 4PB0L 1RPQA 1V6KA 1XGZA 5DTFB 2Z8RA 1IGMH 1BFTA 1VALA 4WFED 4KMTH 1EZUA 2DQTH 4IK6A 5FCUL 4MVTA 3HVDA 1E5RA 5E6SB 2Q3AA 3S36L 1F02I 2OPWA 2XQYA 2IPTH 2DQEH 3MW2A 1QFOA 2KBGA 4DCQA 4PF1A 5I0UA 4O9HL 4YHKH 4M1CC 2MEV3 3JQWA 5T1KA 4CP1A 4J3OF 1A6ZB 1OPGH 3PTRB 3ALXA 4FQCH 3ZYHA 2LAGB 3LDBB 3MX0A 3QWNA 3ZLQC 1UPIA 1PG7W 1SFYA 1J0YA 5BOZG 1W72B 2PR4H 4H8WL 3BZ5A 2CCLA 3HZMB 5HYEA 2LAAA 1MWAH 3D4CA 4G8IA 4EPSA 3GUTB 4DY3A 5MENB 4JHAL 2IXKA 5F2FA 3T0VA 3A0NA 1ID5I 4XMAA 3NJGA 4NBYB 4O58H 5ICUA 1H1IA 5JOWA 1EA9C 4IKIA 1FGVL 3BSHA 5C08A 1HHKB 2W81C 4PAZA 4L3CA 5MP6L 4L9LA 4UU9A 5C7XL 2NY6C 4QRQA 4FTEA 1IAKB 3EO0A 4PUBL 4BJ0A 3EJUA 2HRGA 1OALA 2WLMA 2YAOA 3UC0L 4Z76B 1XAUA 5DJ6A 3FJTA 1P6AB 2HFFB 2IF7A 1ORSB 3VX0A 1JOBA 3IAPA 3N04A 5DS2A 3KCYA 4F7EA 1QFWH 2WA4A 2Q8EA 4ANXA 1W8FA 4P48A 3B3BA 3BVWA 4ZQKB 1TVBA 3I9PA 1NCTA 4XF9A 2O4EA 1SJHA 2VERA 3FO9A 4MQ7A 4XTPA 2JKNA 4G43B 5I74B 3M7OA 3LMJL 3ULUD 1RLWA 3H42B 5SWZE 3ZDYE 4F7TA 3QJZA 3VBUC 2B4CL 1MJUL 5CJXC 3VXPB 1I8LA 5HHOD 1Z7S2 1CZSA 2IVIB 2Y6GA 1MIMH 2YFZA 3IDYB 1OB1A 3BH9A 3O4LA 5DFWH 3RWCA 3B9IA 3DI3B 3B01A 2Y5TA 1AR93 4OTXL 1X5ZA 3TZVA 2NY4D 2A6DA 4X8JB 1OPMA 3MV01 4G72B 2GEEA 4JLRA 4GWNA 3QUKA 4IEVA 2Y36H 2F6AA 4E41D 4D0BB 5FK7A 2YXVA 1OP9A 3D0SA 4LBEB 2WXFA 1M1XB 1PYWA 3T3PE 2UXFA 4D8PB 3WLUA 4CCEA 2YRZA 5CWSB 1N4XH 5TDOA 1S0EA 3BOVA 1LHUA 4YHNB 4UBGA 4UFMA 1OWWA 2GPZA 3BFOA 3ARPA 1CZ8H 4XBNA 2ENSA 3CFIC 4DMIA 2C24A 3A6CL 4X98A 2DKUA 5DD6B 2FX7H 5DMYA 5DJDA 1DZRA 1NXD1 4Q4Y2 4NZFA 2QQLA 1P4BL 4MKTA 1JZHA 2PWDA 1LOAA 4PGZA 5IVOA 4IK7A 4IGPA 1IT9H 2ENYA 3NNGA 3FQRB 1LP9F 5DLLA 1POV1 1C8M3 3CUPA 3MVSA 4N28A 4ODTL 1YO8A 4CADA 1KS5A 4HEMA 2W1UA 1N2RB 2D7OA 4QKTA 5EZIH 5J6GB 4KTGA 2V17H 4P4KB 5IB5A 4LDEB 1O8SA 1MNUH 2Y64A 2XNAA 3I59B 3QDGE 3WN5C 3T1WA 4RVBA 1E57A 3W58A 1J84A 3C7GA 4AEKA 5JXAL 4CXWA 7TAAA 2C7UA 1CIYA 4R97B 2VAAA 2A73A 5FDWB 3SGDH 1JCKA 1QD0A 1H9PA 2XY1A 3F12B 3D2UA 5CINH 4A2UA 3HBQA 4M5SA 4K7PX 4JFEB 4WDIB 2HLFD 3NACH 4H1LA 4E2QA 5J96B 2CJUL 2O8QA 1H3PL 2NY7H 3WO4B 2A0LD 5E6UB 5HHOB 4E4SA 1GWMA 4N43C 3HZKB 2PMWB 1QKZH 4GRWE 2ZTNA 5L2KE 3MPPG 3I2OA 2CG9X 2HRHA 1QNIA 4D3CH 5LEJA 1KFUL 1CZVA 3GBFA 2NY4B 4GSUA 4PJEE 4RHV2 2ZP8A 4BQ9A 2ESVD 3IJYA 4XH2A 1X3DA 3U7YH 1HT6A 3HZVA 4E41B 7PCYA 1OURA 2EZ0D 1O7FA 3WDJA 1WO2A 4L0PB 3UAJA 4W4NA 4LO9A 4U6TA 1R33A 2GIXA 1XOYA 5BUPA 3V7MA 1WBLA 4WFFE 3P9MA 1CAXB 4MNGE 4FQHA 3ZDSA 5B38A 1N3QA 4HJJL 5JLZA 3MUZ1 1L5GB 1S9VA 4HKXA 4NIHA 2M83A 1I53A 3WE6B 5DSCB 4IXLA 1BP3B 4XF0A 1GLHA 4NPKA 3QIBA 5CU5A 5CVRA 1XYOA 3PV7A 4MCZA 2Q1ZB 2I9TB 1W16A 3UESA 3UROR 2FMYA 4UWDA 5T52A 1W6NA 1GKEA 3E8VA 4G1EB 5EEXA 4MDIB 3P3SA 2JXMB 5I6XC 2PYTA 3BGMA 3J7HA 3MZTA 1LU2A 2AJVL 3I2IA 2Y2YA 3H0TB 1FO0H 4HJEA 3IMBA 4N2DA 1E5IA 4TNFA 5SV5A 4PS7A 2RV9A 1TQCB 4YLBA 2N7BA 2DDQL 3BZEB 3U2SA 4Z07A 5IB2B 2XR4A 1P6FA 3ETSA 2NY3D 1J05B 5E5MB 1EEYB 3VFWA 4AYID 3J8F3 5FXXA 1G9CA 3H9HB 4R96A 4TUOB 1G7QA 4XTRC 3DECA 3ATEA 2EVFA 3SCFA 1J86A 2AR6A 5A2CA 3OPZA 1VRSA 1FFPB 1VFBA 4HF5H 5IVXF 3AM8C 1QHPA 1UWXK 3HG4A 3IJHB 5DHYA 3FBQA 3SY0A 2VDQL 3GBEA 1ZSDA 5I1KH 4PV8B 4BQWA 4S2FA 1OVZA 3LPOA 1NX9A 4COWA 4LAQL 5F72S 5JIUA 3ZQXA 1PZCA 4AM0B 2ICEA 1UD4A 2XJSA 5I74C 2WQUA 2GAZB 1JZGA 5HYQB 4EQVA 1F35A 1M9SA 4D0QA 5E4EB 3W5MA 2ESVB 4Z8BA 1HNGA 3IDYC 3I6KA 4OUUA 3IDJA 4BXFA 2B9BA 3JTSA 4OGXH 5I26A 4F2EA 5C0EA 1DSFL 1AD0B 3AMNA 5C09A 3BTYA 1QJZA 3REWA 5BRQA 2FJSA 3ZZ1A 4LSDA 3O45B 3K6OA 1WBXA 5AUMA 2F68X 3WG7B 1QHDA 1LWJA 1DQ4A 4NQVA 1W2KT 2CK0L 1T03L 2RFXB 4NXKA 1LOCA 2CO6A 4KAQH 3ZBMA 1AG0A 2ZCKL 3BYYA 4FNUA 4EI6A 3AZWA 1SXCA 4R8WH 2X6UA 3BKYH 5C0IA 1WTLA 1I7TA 2J8UE 4MGZE 3ISWA 1NCWL 1YUHA 3RWIA 5HYJB 1QMJA 1W04A 4GMP3 4BOWA 3KV5A 1E5BA 1IL1B 4UM8B 4TYUA 4DXZA 1KB9J 1AGEB 1T2QL 5JDSB 1TTUA 5DHVB 1OHFA 1Q72H 4A2LA 3ZT5A 5HGAA 2VXUL 3JWNC 3K91A 2DI7A 2NY3B 4MB1A 4XC1H 6FABH 5LW9A 5JIIA 4P4KC 4GQPH 4OGZA 1DGWA 2P8LA 2DVAA 3WW4A 1WFIA 1JTZX 1DVZA 4JFFE 5GS2H 5I6OA 2IXIA 4LBNA 3X14A 5J6SA 3OJDA 5J8OA 3H2WA 4R97C 5IWLC 2I60L 1CJYA 1U3HA 2W80C 4LBJA 1GGIH 4JMXA 3KV4A 3VI4A 1O9ZA 4GUCA 2XPGB 1WCSA 4N0YL 5A7WB 3ULUC 2WNVB 2CDGA 2R2HA 3KH3A 3SKNB 2ZGNA 2HG5B 4KNTA 5DUUA 3C9NB 3WO4C 2XXFA 3C6LA 3H7YA 1KB5H 1D3CA 1RMU3 1IEAA 2GNDA 1G1YA 1RJZA 4PJBF 3V0WL 5CP3H 3BXNB 2Y5EA 5FZLA 5FZFA 3FYEB 4QXTB 3UYJA 1QVOB 3AC0A 2YWZA 3ZTCC 2NY4C 3AFGA 3FB7A 3V4VL 1UKGA 2R27A 3CZJA 5TDPA 4FS0A 1PEWA 1H5BA 4UW6A 4LLWB 4DHLA 1L9SA 2Y6FA 4LARH 4HFUL 1E5SA 1WISA 4QDQA 3RUGE 3AKQA 4Z3IA 1S7SB 2X4NB 2BGCA 3PJYA 3L5IA 1F4WL 5C6WH 1CD3G 2CO7A 3BVDB 4FQIL 5ITBL 1UEMA 1BAFL 5IROD 1HHJA 2F18A 1SLWA 3QS3A 1CB4A 3MF6A 1DDTA 1MZFA 4IU2A 1CLOL 5HDBF 35C8L 3MBEA 1MN4A 1WWAX 3MO1B 4JRXE 1R46A 4YSUA 1NC4A 1BQHA 5L8LB 4QQLA 4BEIA 4LSSL 4K23L 4Z7UA 5KG9B 5K7PA 4RS5A 5GRVL 4HLJA 4ZSOA 5DJ0A 1FLRL 1M4KA 3N41B 5DS8A 2R063 2V2XA 1EFQA 1K4CB 4NLHA 5E8OB 2O0OA 1HL8A 2PAMA 4YVSA 1SPDA 2TUNA 1TQCC 4KVCL 2YU2A 1LO2L 4OU3A 1BEV1 1QXJA 2JECA 3HAEG 2LABA 1NWOA 4KBPA 4I01A 3CJIB 3SYCA 4NQXA 4LBMA 3KPLA 1BZ7A 2ZX5A 1R3LA 4FZEH 1AR2A 3BCFA 1OAZL 1MPAH 4IV1B 2OMUB 1Z9MA 1WDAA 4X5WA 4DW2L 4LSVH 1KB3A 3UBXB 3VBRB 4IBUA 1CD8A 3HJRA 3MUJA 4TQEL 1VACB 5F6HI 1G7JA 1H9WA 3D33A 3IF1A 1X7QB 4H7LA 2HLFC 1GY2A 3W9DA 5FYHA 2FJUB 4CEWB 4E27A 1XH3B 1R9FA 3BVTA 5FYZA 5D1ZD 2L04A 5D7KE 1BLNB 5FP4A 2A0LC 3HNBM 1CD1A 4KQ3L 3EFDH 1R3HA 4QB2A 1D0HA 1UVQA 5A3WA 5BMFL 4QX0A 1VBE2 2BVYA 3RU8L 3MFGB 2JI3A 5SV3A 4NLAA 1UXZA 4F8AA 4DGVL 2OMWA 5E4EC 3GJFA 1Y7BA 2JIGA 2VG9A 4AZ8B 1COV3 1H6TA 4PJ9D 2OR9H 2HN7A 2YD3A 5EIIG 4PS3A 4OI7A 1AJOA 2EZ0C 3BWAB 3OSDA 3SDYH 5A7OA 1UEYA 5E08L 4PJCB 2FX9H 4K5LA 1WFJA 3PWLB 1G9BA 1SM3L 3CVHL 2JKSA 2F15A 1JTOA 5I0ZA 3HA0A 2H0PA 5KSBB 3GGWB 3GSOB 3AACA 1S2BA 3WIIL 1IBFA 1GTNA 1CDYA 1G87A 2HJKA 3MOAL 2X6VA 2N7GA 1SYSB 2A6KA 5F1NB 2PWFA 5L6YH 1NMBL 1FOD1 4UINL 2YGPA 2ET1A 4OCYL 1ND2A 3TV8A 1HWHB 1A9EB 4BIFA 5LXGH 4OJDH 3MRPB 3ULSB 1FT9A 4M03A 4ODVH 2ZD0A 3DGDA 3Q7JA 4OF5A 3APFA 3MXWL 1LK2A 2TSBA 4F2ME 3L4YA 3WW1A 4B9JA 2W65A 5ICZA 3WS3A 4FXKB 3UL2A 1I1YB 3IGAA 3OPUA 4PJIA 5DJ2A 5E99L 5EOCJ 3TWCL 4AEFA 1KEGL 4DEQA 1XHHA 5DDHA 1OE3A 2ILLA 3PPSA 3H3BC 3VD5A 3C2SA 4FPHA 1M7IA 1KBKA 5FGCE 3V6BR 3ZTEA 4WSJA 3UABA 4JAAA 3U4KA 4AHXA 2NP0A 3M1HA 1MCIA 2NY3C 2X4UA 5F7LB 1Q43A 3QPXL 5AEAA 4F3FB 3M70A 5JOXA 2GC2A 2JKWA 1FHGA 1FL3B 4JG0H 2OPKA 2G75A 3IFPA 1MZZA 4TPRH 5J0BA 4AVSA 1FAYA 4QAWA 3UCRA 1QASA 1Q56A 4EI0A 3TPKA 4P00B 4BM8A 3ULAB 2PCFB 1A8MA 1MEC1 5D1ZB 2WWOA 5IATA 4N90A 1EFXA 2VL5A 3S6CA 2DM7A 4RFEA 4A68A 2FYYB 3H8XA 1W0YT 2VULA 1ILSA 2WNVC 3CH1B 4LLQA 3HUJA 1FYTE 1OM3H 4FNLH 2WQ4A 4HIHB 4S1RL 4AITA 1J1LA 1QI5A 3NJKA 3RWGB 2VLRD 4PJ9B 2DQDL 4YQXL 3OTFA 4EN9B 2VLME 1ZHKA 5GJTL 1PQZB 5FMCA 2R2BB 4XCNB 5BS0A 5I6LA 3WG1A 2VXQH 5GZND 5I0TA 3FFDB 2BRRL 3AXEA 4I9WD 4LU5L 4PJBE 4AIOA 1DFBH 4KOCA 3VXTA 2RA1A 1IC7L 5KYXB 1TJXA 3G5YB 3S4SA 4BFOA 3VFVB 4PGDA 4FFVD 1S46A 4PRDB 1AR1D 4WWOA 3VTTA 3Q1SL 4ZMTA 1LHNA 2WQSA 3R06B 1MACA 2WBJA 2R041 2E9GA 3NCJL 3L3JA 1RUQL 3KWWB 1U3JA 1UIJA 3DJ9A 2LW3A 3QDAA 4LVNB 4PJ5A 2DQUH 3QNYB 1QYGL 1G1CA 1RL3A 5JQ6H 2DLGA 4FJYA 1U8JB 4X6EA 4IRJD 1R24B 1X5AA 3H9ZA 5LBSL 4A7VA 4K55A 4OZHB 3M1BA 2FAUA 2XWXA 3C2AH 4B9YA 1AL21 5DD5H 1NINA 2UVFA 3MLYH 4NC0B 4OAWB 5GGRA 5KN5A 1W2OA 2WO2B 3WFZA 4AR2A 3ZRSA 3QZLA 3WLBB 2VLLB 5CEXB 2E33A 3CJIC 2O30A 1Z5LA 2OR8A 4A6YL 1P7BA 5E2UL 4IV1C 4FMFA 3B5GA 4HS3A 5I73B 3SGEI 1X6LA 3FSOA 1Z0HA 3VBRC 5F88A 4YSPA 1MIEH 1PG7H 5FZ8A 2Y6LA 1ZV2A 1SVBA 1DQDH 2Y2WA 3ELQA 3GMLB 3RMYA 1UKTA 4CEWC 5BZZA 2EE0A 3P73A 2NZ9D 1EQWA 1KCLA 2XIDA 3HNMA 5BNXD 4QKFA 5HI0A 1NFIB 2X3AA 2Z1KA 4NO0A 4IV3B 4QX1A 1WAEA 4ODUA 1U8PA 4OFQA 1RJYB 2VLRB 1CXEA 2KPWA 4G6ML 4X80H 5CIPA 5F1IA 3M3CA 1KENH 4HWZA 1N64H 2VSKB 5GRXG 3L4XA 2EDOA 3GI8L 4FABL 4CGTA 1L3WA 3ESUF 3GMQB 3RPIB 1L7RA 5LO7A 1FBIL 2XKPA 2FGWH 5B1AB 4AW7A 3UKNA 2JF1A 4AQ8C 1BLZA 4HH8A 2YBRA 5DK3A 5L9DL 4RWYL 4KTDH 2CY6A 3SCMA 2A1XA 5DZ9A 4O02H 1MREL 5K8SA 1A0QL 4LO7A 2EIJB 4OZFH 1RZFL 5LBGA 1FZJB 2VMJA 1AR1B 3GBNH 2AV7B 3IN0A 4B27A 4A7GF 3P0YH 2ARWA 4A2DA 1FFTB 4XI5D 4TLTA 3L1GA 1CESA 2VRKA 2APFA 1ZTXH 5I23A 3RGHA 2E9BA 1X7TA 3VSUA 2DQCL 5C0JB 3L3HA 5GZCA 2ZG2A 2GY7B 4GZ9A 4IBYA 4X0KA 4BH8A 1NCAH 2WN2A 4IRJB 4R4ZA 3FO0H 3VNYA 3CO2A 2XBZA 3ASNB 1LO0L 4FXKC 1YAIA 3O9WD 2VIRA 1HOCA 4J3TA 4ZZ5A 3MGUA 4PRNB 5KSVA 3VW3L 1I4FA 4HUNB 3L9RA 4QQOA 5A2BA 2BNRE 4PIBA 4Q7DA 4DKDC 4JKKA 2QDWA 3V4VA 4ANUA 3JZVA 4EWAA 3VFNB 4UOW1 5HDQL 5C07A 1F2QA 4CCOA 5FFLA 1WA0X 3G3LA 4L3FA 3RP1A 3RURA 5DUML 4AGOA 4FPGA 2J1WA 4XAWH 4JS7A 4UF0A 3EOBB 4UTBH 3NH7H 4BA0A 3ECVA 3TIEB 1A6PA 5D1ZC 1K12A 2W9XA 1N0XH 1GGBH 2WLZA 4CN4A 3EADA 1G4MA 1TMF1 2G4IA 4BLIA 4PY8I 3MGTB 3Q43A 2FLBT 3E6HB 5C0CD 2HWF2 4XBEL 1FI8C 1FOD3 3DI2B 3FQNB 5E2VH 2OMBA 1SMOA 3HR6A 1TNMA 1UFUA 4PJ9C 2WWKT 3ZKMC 5BJTA 4CXXA 5JXGA 4AYMC 1LEGB 1GZHA 4PJGB 5DC2A 2NYKA 3L3GB 4XWGH 2DBLH 5FY4A 3VXRD 5T1MA 2ODIA 3NCFB 4CPBD 3KLAA 1TETL 4JFHE 4YWGL 3V6OE 5HCHA 4N0RA 4GXVH 3DVFA 4NFDA 3IMSA 1MFAH 1Z9SB 1M2VB 4YNYA 1JN2P 4LGRB 1WA2X 1RUH3 1IFHH 2ETWA 1R5VA 1JS4A 4N9IA 1CD0A 3KQ4B 5D2LB 5EZLB 4TSCL 5H35B 3TH3T 2BP6A 2GSYA 3GC3A 2IXCA 5CILL 1OM9A 2HWB3 4F8PA 5HXMA 2QZ3A 2CHNA 4JFOB 4LVNC 4P2QD 4UT6L 5C8JA 3VXNA 4UT9L 3F83A 2WZPP 1TFHA 2NYZA 3UBHA 1PO21 3IDGA 4GFTB 5BV7L 4PJXA 3O9WB 4ZDHB 1UJ3A 1OD9A 4DPCX 2JQMA 3MRHB 2RJ2A 2BS71 3M3IA 1S7VB 1OIOA 2IH3A 2VABA 1H0BA 4PWJA 3KPMB 3M8LA 2CKBL 2IH1B 1I3GL 1HSAA 1Y0LA 2YUXA 4MMYA 1HV1A 1VPOH 4WM7A 1K42A 4CC4A 5ANNA 1W6PB 2Q8BL 4QPGB 1MY7A 1B2YA 2TRYA 3CFMA 3CVHA 4JQXA 4M8QA 2IADA 4M4RA 3VDAA 2XV3A 5I73C 2HWZL 1GYCA 3F58L 3LFIA 3AMKA 1OF0A 1QPXA 4HD9A 2HWE2 4HIPA 4L23A 4KWLA 4OM1L 5C0CB 4CU6A 5FP7A 4GG6E 2QV2A 4XBPB 5DD1H 3CVIL 2EDWA 4IV3C 2YS4A 4FOVA 3I50L 4PW3A 2CV6A 3OUIA 5BUGA 3DVNA 2A1WL 1SMDA 2RVAA 2Y07L 3D08A 4RX4D 4QKXB 1SMVA 5GZOA 2R043 1YCIA 3VCLA 1HQRB 4EI5A 1IAOB 5GZNC 5FYMA 3TO2B 3VGGA 1EHXA 3OEBA 4JHWH 3DHMA 3VXRB 5BZDA 1J5CA 5AAMA 5GISL 4E5XG 4J5VA 3MNWA 3NJFA 3CLFL 1NGPH 1U8MA 2H45A 4DGUA 5I0YA 5I30L 5ID1A 1OY3B 1F5JA 2CMRL 3W57A 4FFVC 1R5IB 1IGJA 2VDOH 2YPDA 4KHXL 1AR1C 2IAND 3RB5A 2BY2A 4P46A 3HFMH 1FCCA 1N10A 4P4RB 1AL23 3FTYA 3SOTA 1YQVL 3MRCA 3V52L 3SKOA 2UXGA 4HK0B 3WOVA 3OUJA 3MRIA 2J4WH 4P2QB 4GRWH 5DZLA 3QEQE 3GZEA 3KBHE 4CE8A 3VUOA 2CK2A 4XNMB 2VUAA 1HX6A 2XN2A 2P3JA 5DUXA 2DUOA 1RZKC 4YDZA 2QE3A 4HIEB 1BIIA 4IRJC 4HK3J 3K7UA 3KLHD 3OUHA 3B9DA 4HWEL 4NIYE 1S8DA 2V2TB 1A5FL 3RVWD 1VBE1 3ETQA 4G42A 1FQ9C 3FT4A 2CCWA 2NCMA 2P48B 3LAFA 3NABH 3OAUL 4XP9H 3T71A 5I0WA 1PMJX 4W6WB 2YD2A 2X87A 1BMZA 3KDMA 3HIFA 4PJDF 5D7IE 3JWOH 1B88A 3OKMA 4CGUB 1UJTA 4J8QA 4FQLH 3CC1A 4L1HA 1URZA 4EZJA 1ICTA 2DMCA 1IVTA 1D5XA 4OCSL 4ZS2A 2C9KA 1ZVSA 3IJ7A 2PW1B 4PDWA 3MLTB 4EIBA 4Z3GA 5HI4D 2H3NA 2FZ1A 4NZTL 4XGZA 4J3OH 4I87A 4AGPA 1NIDA 2NZ9C 3GHEH 4QPIA 1VZGA 2D0FA 3SE3C 1CAWB 2XZZA 3EYPA 2F2HA 2FE0A 1AXKA 2B59B 3MLRH 3ZVVA 1AZZC 3CLWA 3CFQA 5D2AA 1BQRA 2O5NA 2Q87A 2AC1A 1QSFE 3N85L 4HEPG 2PYFA 3WE1A 1JZIA 4PRAB 3WJMB 2JE8A 1IEBB 1DQ6A 1JFQL 3Q13A 1A47A 1WIUA 3KPPA 4LCYB 3T0AA 3TBSA 2E8YA 2BDRA 2DYCA 1W6MB 1XGYL 5LBSA 5IR1B 1E30A 2DWYA 2ZWNA 2YEQA 1UD5A 4M62H 4LPWA 5TFSL 3TONA 3GJBA 2JE9A 3O8XA 5C0RL 2D98A 4JG9A 1KJLA 4BHPA 4WTXA 3OV6A 3GB7B 1QU0A 1G9FA 1AVAA 2BFGA 2D7MA 2ZSWA 2R23B 4CKVX 4TYSA 1ZVNA 3NJJA 4WI5A 4XI5C 3L3DB 4A6YA 1G7MB 1EEZB 3FZUD 1U8IB 3BPCB 3HG1A 7FABL 3RAJH 5EHDA 5DZJA 4AWDA 2PTVA 2J71A 5F9AC 5G5DB 1RULL 4N2LA 4XNXL 4CW1A 1YEEL 3H6JA 1B4JL 3FT9A 5AVTB 4BWOA 3K0YA 4XBQA 1I8IA 4M8VA 1S78D 1K4DA 1GYWA 2DQHH 3GMMA 3IGLA 3KV6A 3O9WC 1HVXA 5I75B 3PNAA 3GMRB 1MQKL 1NCHA 3TJEL 3V8CA 4KL1A 2YPLD 2HLAB 1DFQA 1C7SA 4DK5A 1CWPA 1TMF3 3A4EA 1F8TL 4LPTA 1F4AA 2IPUG 2QCSB 3DIDA 3AREA 3PJLA 2R56H 1HOEA 2EH7L 2FT6A 3CFDA 2DFCA 1A3RL 1OTTD 3NSXA 3VFRA 1ZVFA 4PGBB 1QA9B 2IQ9H 4D7BA 4QPGC 4JANA 1S3RA 4MNQA 1H0DB 1I82A 2Y34A 4G70B 4WWKA 3C5JA 3EBRA 3FNKA 5FOJB 2JXAA 3OBRA 3V4PA 4E9TA 1YUDA 3PL0A 1YPZB 4NEHB 4GI8A 1OSZA 4JO8A 5CZVH 3K4ZA 4M3CE 1JHLH 3G9AB 2HH9A 5FKAA 3C8KA 4Q8LA 1DN2A 2BP0B 1AYM2 3O4OB 2FEJA 1ZBA1 2BNQD 5A7PA 3U9PL 1F3RB 2F53D 2HTLC 1INEH 3P69A 2EDYA 5C0AA 5KTEL 1X8MA 5EXOA 3UNPA 3D39D 5HDLA 5KHGA 4U3HA 5AD0B 3AXLB 4HZ1A 4QXVA 4I3PA 4PG9B 4QXWA 5SWSD 1PO23 3MRDB 3OR6A 4P8QA 3C60D 4KO6A 4LLMB 1BK0A 1DQ5A 5F7MC 5LGHH 2EE3A 4HOMA 1BQSA 9CGTA 1TME3 3RA7H 2HVKA 4OGYL 4B29A 3DETC 5AB9A 5C1MB 3MRJA 4NKDA 5IMMA 4WFGE 1NGZA 5KVDH 1PKQE 1DZBA 2YIHA 2JDAA 1TLKA 3K3OA 1HX0A 4N8MA 3HE6D 5EBLA 1REFA 5C3SA 1T6BX 5CXPA 5AZEH 2YPLB 3H56A 2FBRA 4JO1L 5FTTC 4UM9A 1OKQA 4YG3A 1G6RH 3MAWA 4AEIH 3A7QA 1V3LA 2C5DC 4L2NA 1R4XA 4LIQE 1JZ3A 2EYTA 5HHMD 1JPGA 2Q1EA 1S0JA 5B1KA 2YC4A 4R8HA 3UPRB 4ZRGA 3QD6A 4KY1H 4FBFA 4L3EE 4GPVA 1GOFA 4DB5A 3U75A 4LVHB 5K39A 2ZMLA 5AZ2L 3VFMA 2ARJQ 4NNXA 5J9PA 1ZWIA 3PFUA 4JDVB 1TKWA 2R16A 2NUTA 1HH9B 3B7SA 5CUSL 3UMNA 5CNHA 4AQOA 4QXGL 1OP4A 1XGQA 1ZAGA 3QUML 3MYJB 4R4BB 1TZAA 3FTSA 4J39A 2BNQB 2PWGA 1BCIA 3FXIC 2F53B 3ESOA 4OLYL 1UWEL 2PCXA 3P4NB 4UT6A 2E46A 4C8DA 3D39B 2WPGA 4UT9A 4E2SA 4X6CA 1LDPL 3J9SA 3S5QA 4RISH 4GKOA 4UCFA 1DQMH 1CICD 2H26B 3LXBA 3Q6FB 3QEHA 4JKPL 4N2HA 1MS4A 4M7LH 3R6SA 4RAVB 3FH7A 4PRHA 1FIEA 2R83A 4S2DA 4OF3A 3AU0A 4CRQA 3BEWA 1XF2B 1C8PA 5EPAA 4XP5H 3D3AA 2JKRM 3WXPA 3PFQA 1TZGH 3F65A 4PY7A 2RDRA 3CLEH 4LRNL 3MGOB 2CKBA 5GHWH 4BQ5A 1ULCA 1T20A 3DA0A 3SMHA 3JUZA 4X9FA 5F9JA 3ZDXB 5DMJB 4YHZL 1G6VK 2ZOKA 4K21A 2FJFA 4TZDA 3PAUA 3QISA 3IMVA 3HE6B 1R1ZA 4XJWA 3BH8A 1HHHA 3PGCA 3SO5A 1VB4A 2KERA 4ALAL 5CEZE 2AXGB 3OR7B 4C56D 4YDIH 3OMNB 3S88L 1P7HL 1M9WA 1N5AB 3KLHC 1R3KB 5KWYC 1J1XH 3RVWC 3B94A 3UFIA 1ZGLA 4HUUB 4G7VH 4HQQL 4LSPL 4NHCH 1V7NH 2ZPKL 1T0MB 3N1QC 5I75C 4YUEL 5T5FL 4CN1A 1IHMA 3NJZA 1PX4A 4IEFA 1KJ2L 5HHMB 3OPTA 3MV9E 4AXOA 1IM9B 3VKNA 2FIKA 1OOPB 4HKJB 4NB7A 3BWUC 3PABB 2F74A 2H9GB 2XT1B 5E23A 1J9QA 2VYRE 1RUD2 3GXUA 4HS8H 5GGVL 1IAIM 1MJ8L 3O1VA 3SQBB 3RTQA 2BGPA 3RIAK 5FZBA 1IE5A 4UYBA 2X42A 1NJ9A 3UZEC 3CX5J 1U0AA 3GXTA 3BZDA 5HI4C 5A3NA 5HYIA 5FYJU 1AR62 3HC4L 3NCBB 3DUSB 3L45A 4NM4H 3JWNG 3PL6A 2CR6A 5D72L 5DJZB 3BZFA 4J8RB 4EIGB 3FUNA 3SZKC 2I27N 5DHDA 5F7BA 3OGJA 3ZSEA 1HINL 3IMWA 3ZGHA 2RG4A 2ZICA 2F7PA 4FFWD 4U1LA 1ZK9A 2F8OA 2ZX6A 4LPVA 4J6GA 3O4OC 5I15L 1CICB 5I8KH 4BWTA 1J9RA 1FRGH 1S7RA 3CZFA 3ZXAC 4MD0B 1Q94B 1U93A 4WTQA 4K7PY 4YVUA 3SDCA 2TEPA 2CO2A 3ESNA 3H9AA 4G82A 3OZ9L 4OZ4A 2O26U 4AEHH 4P02B 2OTUA 3WQ1A 4F57L 4XW3A 3QARA 4ATTA 3U0PA 4I0PA 4W68A 3HOGA 2PQQA 3OJVC 4R0LB 4FTDA 4M6ML 1IBGH 2BS8A 4DQAA 1RPKA 2BX5A 4FXGB 2RM23 3VBHA 4U6VL 3FZUC 3PWVB 1JPSH 3ZFEB 1KTCA 3MODL 3P11H 4G7SB 5FO7B 2KUTA 3P9WB 3FB6A 3TX4A 2J43A 4C56B 2HKXA 4FZ8H 2X4SB 3QO1B 1O3QA 2H6PB 2ZEXA 1J5IA 4Y19D 3EYUL 2DOCA 3S37L 1O3RA 1S78C 3OZKA 2RR3A 2V3FA 3IWZA 1Q4NX 2N1TE 2BY0A 4CDXA 1KTRL 2QHRL 4JRYD 2AMUA 1EJFA 1PGW1 4LLYA 1DLCA 5LK5A 5DRXA 4G1MB 1RZ7H 1XE0A 3D0LA 5FCCA 1NUDA 4Q56A 4Q5OA 3AQZA 1IS4A 4E9RA 4OMDA 2CJ3A 4JK0D 3ABLB 1WLHA 3L7EA 3UIZA 3FTVA 1S55A 2R0HA 1OTTC 1IQWH 1US2A 3S5LG 1AQ8A 5B3JF 1FNGB 4LVHC 4YE4L 4JFQB 2Y06H 3AMPA 3AP9A 1AIFA 3W9AA 5ACA1 4META 3W59A 3G04A 1B90A 1MELA 3H50A 1VIWA 5JIAA 4K94H 3V0AB 3HHMA 4CDUB 3KCWA 2CHWA 2L4OA 3WF1A 1AX2A 5FHBL 3KLDA 5I1IL 4NYLB 2H32A 3MUHL 3DBXA 4GG8B 1NEZB 2VO5A 1NCQA 4AGVA 4JZJB 1B35B 2B1OA 4HT1H 1FPN2 1KBGH 5GRUH 2X7LA 3RWFA 2N4IA 5DXWA 2K46A 2LT9A 2Y6TE 3PCYA 4HEME 4JY4B 1HCVA 1DJZA 3GSVA 5GLZA 3UO1L 1LEDA 2AEPH 3L8QA 1NMAH 2VC2B 1GZQB 3HE7A 2K9FB 3WIFB 5FQ0B 4N6RB 3VI4F 5JIMA 2F7RA 1UA6H 4XXCA 5JPMB 2ORBL 4N53B 5A3ID 3X3FL 4XURA 4ZFFA 4NQQA 1BFOB 5AB0A 2WWNA 3ECBA 1K45A 1TNNA 2W0LA 1WW5A 4XUPA 5JOYA 1XGUB 3W0WA 1B0RB 2A3WA 5FYCA 4AMKL 3HE6C 4Y19B 1MWAB 3LKRA 2W07A 4W6XB 1PK6B 3AL6A 4PLOA 4HPKA 4XXDA 1GQPA 3VHNA 2ATPA 4IUGA 4LE3A 4D7SA 1C16B 5ES4B 4JRYB 1DBAH 3WS6A 4FFGA 1R47A 2WXMA 3VXSA 3HG2A 4X2UA 2GEQA 1QQP2 4D7TA 5HI5D 4UNIA 1NIFA 3D50A 4M01A 3OAYK 4L8BA 1ZLUH 2G5UA 2PAEA 3S8FB 4ZKTB 1OOPC 4HJUA 4OJEH 2WZEA 2GJZA 1LE5A 4PPTA 1I3RA 3LPGA 3W39A 3JBG3 2JK5A 4GO6B 3ZQWA 4TWTA 4YK4B 1OLMA 2PHWA 4RAUB 5CFCA 5LLIC 3STZA 4AKQA 5IT2H 3ZR6A 4KHTL 4NBZB 2LU4A 5EYYA 4Q4IA 3ZTDC 3FQ2A 1I1AD 3G6JA 5BXFB 2RMU2 2F5AH 2UYLA 1MXGA 4Z7UF 4ENED 1AIZA 4PW4A 5E1GA 4BRVA 3MKKA 3VZNA 4CP2A 2Q5BA 5DD0H 5DI8B 4Y4HC 3N44F 3ZX1A 1BXHA 2FWLB 3LNHA 1UOBA 1AX0A 4PIXA 1ET5A 3NZSA 2D2CC 1NCRA 4GJZA 1WYJA 1JMXA 2J25A 1TVGA 5FP3A 5FR3A 1V54B 3CNAA 1CICC 4JFZH 1RUG2 1W9TA 3NMEA 2RS51 2VNRA 4I5BB 1S4CA 3FFZA 5F37A 2ZF8A 4P9ML 2WAAA 1CN1A 3VFGL 4CMHB 3UTPD 1GQGA 2EKSA 1KPUB 4TVPH 4F58L 2KA3A 1KBPA 2PTTB 1MFDL 1UENA 2BOCB 4R0LC 5DMKA 4B3VA 4OCRH 2WNOA 4ZUUA 3ARTA 4FXGC 1AP2B 2OMZA 3UCQA 4AQZA 5MERB 4AIZB 3FC0A 2WNUB 4HJGB 3ZFEC 2QHLA 1TZHB 2ZXGA 3RRDA 5JW3L 2ZP0T 3OBAA 3U30C 4JFWA 4NNPL 3MLJA 5F96L 2IWGB 2OR7A 3M1CA 4KITB 4XETA 3UTTE 2CDFB 2I9LB 3QUMA 1GBGA 1Z1WA 3VQ2C 3IPVA 3WG4A 1FVEB 2X5PA 5BNPA 2WP3T 1D5ZB 1M57B 3ETBF 5CSBA 4FA6A 1VAMA 2OW4A 3HD8B 3ZVXA 1E5UI 1GHFH 1R3JA 1R17A 2Y69B 3D0AA 5EORH 1XH2A 5ILTL 3CHQA 2F7QA 3BQUD 4CN6A 5BQ7B 2OA2A 4LIUA 4LULA 2GC4C 1QOTA 1KIPA 2ZX7A 5A80A 4HW6A 3UPCA 2FJHA 4UWQB 1S7WA 1CAVB 3E2HB 2DJSA 4N25A 1IGFL 3TBWB 1BLIA 4RMWA 1V70A 2HEYF 4X6RB 4M7KL 1Q9WB 2XQXA 4PJIF 1RHI2 3V0AC 2D5FA 4PS4L 4ZBJA 3U14A 2C34A 4CDUC 5B3JE 1JK8B 1RMFH 3SIKA 4RSUA 2TAAA 5E6IA 2AV1A 1YEGL 2KT6A 4H88L 2WP3O 4KUCD 4WHDA 4DZGA 2YD0A 4RMQA 5J11B 1H3UA 1LWRA 2N1KA 3POSA 3LN5B 4JZJC 2Q6WA 4J6RL 2VLKD 4OZIB 1B35C 3UBXG 4QXCA 3GO1H 1PY0A 1UY1A 3OJBA 1FDLH 4PJHB 2FZ3B 3ES6B 2J8OA 2PR9A 4OVVA 3P4OB 4PRIE 1ZXKA 3GMOB 4PP2B 3VV1A 1DE4B 2NT1A 1I9RL 3GBML 4JO3H 2X2UA 5JPMC 4N53C 4WM8B 4X7SL 4E2GA 2ZXDA 3BAYA 4IGOA 4MGTA 3HUJF 4Y1AE 3RWEB 1QQP1 2TBVA 1A6WH 5DJAA 5H4YA 5ISZD 4WVMB 1U91B 3VI4E 1TDQA 3ZT6A 2XXMB 5CCJA 5EOQL 2D6PA 3RGBA 1PK6C 3QNXA 3PXHA 4F9PC 4I0AA 2FDFA 2Z7UA 1W3XA 1GY1A 5T33L 1I1FB 5GGQH 1FO0B 4ES9A 3J26N 4PLNC 1MFBL 3MUUA 4Q4X2 4COVA 4LCWE 5FLVA 5I1LA 1YY8B 3FFCD 3MIDA 2NTFA 2XTJE 3GI9H 4OHWA 3M1OA 1MUJB 3BQUB 3DOSA 1Q9KA 3QJHB 4PJ7A 4RMVA 4TSBH 3OX8B 4I0BA 1YN7B 1YDPA 2LUWA 2OL3B 3H9SA 3RFZB 4XDQA 3VZMA 2B2XH 2G4GA 3ETTA 3I8TA 4OZGA 5FYVA 2W9EH 4YK4C 4X5PA 5INCA 3KHCA 5ANMA 3KCXA 3J8F7 3NYKA 3PDQA 1ZS2A 3OJMB 1YQCA 4NJ4A 3IMNA 3MU3A 5DZNA 1AGDB 1ZA3B 3V9EA 3RWHA 3T0XA 4MGIE 4XP6L 4M02A 43C9B 2PHLA 2DMHA 5AKVA 1YEWA 3ZDZB 1Y9GA 5T5PA 4AI8A 1D6VH 5D1QB 1IGIH 2QBXA 2WM0A 3PNWB 4I2XE 4YDKH 5FO8B 1EAQA 3TCLB 3ULVE 4I8DA 2V2WB 1TJHH 2VLJD 2Y22A 2A4CA 1XNDA 1B4TA 1RUAL 2WXIA 1EANA 4HUVB 4AFMA 1AJ7H 5FFOA 1MH5A 3J27A 3K0WA 5D1XA 2VAUA 4DEPB 3L2LA 4K5MA 2HJFA 2YZ1A 4Q27A 5I8EB 4MA8L 1UG9A 4IRSD 4NNYA 1ET8A 4PWEA 1FWXA 5F8QC 3P6BA 1IBZA 4E4HA 5A3IC 1SOQA 4CMHC 1EJ6A 3QG7L 1FFNB 2QSTA 3PGDB 5HVGB 4C8XA 2XVLA 4LRIA 4BM7A 2Y0OA 4DP6X 1UH3A 5ISZB 3EOAB 4DINB 3RKPA 2YC1B 3QDME 3QCVH 3NJMA 4HN1A 5EBWB 1M6OB 4Y24A 1E6OL 1I3HA 1CC3A 2DYPD 4MXVA 4F15B 2WNUC 2OPCA 5KBKA 4QRUB 2ENJA 1RK0A 2XVGA 2F7IA 5L73A 4DETA 1WA1X 3ESMA 2XXCB 4P99A 1VRH2 2P3KA 4NPYA 4BRJA 1UM4H 3H2QA 1XYNA 1UU4A 5FIXA 2NUPB 1E2VA 2IAMA 4U31A 4PT6A 4KJYA 5HI5C 3FFCB 4JN1H 2LRPA 4NRMA 5DXDA 5I1HL 2XWBB 3CXHJ 2WO3A 1RIVH 4AJ0A 4AX3A 1X6NA 1I7UA 3R4UA 4X6DA 4PD4K 5IV2B 4A6SA 4OFYA 5AOMA 2YBPA 3K1DA 4LLUB 4Z7WE 5IQ9A 4FQ2H 1HFUA 4ZW5A 1DYPA 1FG9C 1FFOA 1Z66A 3PQYA 2Z7YA 4AT6B 5DRNA 3NIDE 5FAAA 2CLZA 2CL2A 2BSEA 3QCTH 4P5TA 2D44A 2DCJA 2DCYA 5KBFA 2V4LA 1LTEA 1F5FA 2O5ZH 1AXTH 4ELMA 2AREA 3E2HC 4ENEC 1V6JA 4OIFA 3K3NA 1AD9A 4HUXB 2DLFL 4AQEA 1EO5A 2K8MA 3VQLA 3EFOB 2JKIS 4Y9GA 2RTTA 3BJ91 5JR1H 3OXRB 1BF8A 1F4YH 1UH2A 1PZBA 3L4WA 3TA4D 1GC1C 3QUHA 5FUOH 3V5DB 2VLJB 3WDHA 2QQWA 1G9MH 1KB5B 5C0GA 1CJDA 4JFXB 3L2HA 2BVTA 1PZAA 4PJIE 4QWWD 3X12B 2XI9A 2NR6A 1M2OA 2W5FA 3PURA 4P9LA 4R2GD 5J11C 3ET9F 4MYWB 3Q9PA 3BAXA 4HGWB 1XSKA 4YL9A 5HGHA 4D9LL 5IEHA 2WANA 3TBVA 2UZPA 5D2NA 1A6CA 3SXWA 1CE1L 1LJ7A 5FYTA 4GQ9L 4IRSB 4QRPD 4CUGA 4UDTA 4LLVB 3HS0B 4MXWL 4YGBA 3EGSB 4WFHE 4FI6A 1F58L 6TAAA 3GLDA 5AYUL 5ICYB 3VFPA 1EX0A 1USZA 4ONGL 4UT7H 5FDYA 1SXBA 4Q0XH 3NTCL 5KC6A 3S5ZA 1E8ZA 5IUCA 1PZ2A 3DRQB 3DVIA 3P1VA 1CI5A 3U46A 2CM5A 4LSRL 5FKPB 4NWTL 2XJKA 1UWGH 4WV1B 4DP9X 5A2IH 1VKXA 1SLUA 5H94B 3AUVA 2EYRB 4B7KA 1A7RL 1S9YA 3WOGA 2VM9A 1E40A 4YLCA 5C7ZA 4ZTPL 3AXIA 5H4ZA 1LR5A 1I1EA 2WWMD 1LOBA 3PMSA 2UWEE 1S9WB 2XFGB 3UJTH 1SZBA 1RK7A 1P1VA 1N1VA 2VDKL 4FTVE 3BQUC 3X11A 3P30H 4RGOH 1WK0A 4X4ME 4GAZA 2YB7A 2FD6L 3JZ7A 3RFZC 2XZQL 2YSSB 4I18A 4AIEA 4KX7A 3ZHNA 4ZQTA 5HXVA 1K8IA 3VD0A 2E6VA 1D6EB 4UOQA 4KRPD 3Q5YA 4NJ9H 4OD3H 4PJXF 4ZAKA 2RD0A 2DVFA 3VE0B 2FR4A 2EEBA 5CJQL 1JOPA 4FQJH 5DD3H 2HUHA 1UYWH 1FUNA 3T6QC 4UW4A 5D1QC 1AR82 1H6YA 4R2GB 1LOFA 1NCNA 4A6OA 2DQGH 2Y72A 3ZE2E 4Z95H 3D85D 1P7KA 3LD8A 5IWFA 5IT6A 2ZYSA 3K6SB 2D3NA 3OTTA 1CDHA 1MHHB 2X10A 5GLTA 5FECA 4QRPB 2AJYH 4FPEA 2WBKA 2UWCA 5F7EH 3CMOL 3OYWB 4DEPC 2VQ1A 2CSPA 3PJNA 4X7TB 5GQBA 1M7DA 5JHLL 2ZOLB 4GSDH 1V0AA 5GSVA 2VRAA 1ODUA 3D2TA 2DQJH 1QFUH 3B2MA 5FGRA 2QV4A 4C0HA 3WSQL 2D4FA 4JL1A 1JTTA 4BZ1L 1ZLUK 4FDWA 1XSIA 5C70A 4AUYA 2QDRA 5F7YC 1NFDA 2A3TA 2Z64C 4TTGA 3PUSA 3GF8A 5DAVA 4CSTA 5LWYL 5CZRA 1J88A 5HJBA 3WIAA 5EIIA 1H8OA 2AJUL 2BC4B 2OTPA 1DGRN 4FQ4A 1NEUA 4ISVA 4F15C 2JJVA 5ESQB 5BVPL 3SQOH 4JPWL 5GS1A 1L7IL 2AJZB 1DBJL 2DQFA 4P59L 3DUUA 4WI7A 2Q7AA 4ZS7H 1NGQH 4L1SA 3TN0D 3QQ4B 3MLZH 2YU1A 2IFFH 4MJID 5CSZA 1E9PA 2EDTA 5IHBA 1Z7JA 4WEUD 1OSPL 1NZIA 1N8ZB 1S5IH 1ZBE2 3W37A 3PDOA 2ICWJ 3NV1A 3I6LE 2NQDA 5F3FA 3L4UA 4POYA 2J6EL 1XIWD 3IKCA 1VBA2 5DG2A 4LLDA 4HPHA 1WPCA 3QFDA 3AADB 4GKNB 3KGSA 1J0KA 3B7RL 1BEYH 4EN0A 4OD2B 1NXMA 1VBC3 1PIV3 1UZ6F 3QORA 4KRPB 4K2UH 4Q0SA 3WX5A 2CGYA 1QRND 5CEZH 3BLPX 4JG1H 4R4FH 1KJVA 1QEXA 4XHQA 3UPAA 5EIYB 1JWUB 4NUJB 4GW1A 1CZTA 4KKPA 3ENRA 4XHJD 2Q5TA 4GO9A 4QHKJ 1GYVA 4O9EA 2ZUXA 3GNML 2NNAB 1W05A 2V3EA 1CE6A 1W8WA 3D85B 1DQJB 1LO4L 4PRPB 1DQLH 1AAJA 5E00B 5HP5A 5E8EB 5AW0B 1CBVH 3CPLB 4ZPTB 4XNYL 3AX4A 3TEUA 3VGBA 4HUCA 3HHSA 1HRI1 2H1PH 3MREB 4XNZB 3GLAA 3ZE0F 3DKWA 1HW5A 4PJFE 1QFPA 2VOTA 4IRSC 4WBBA 4XF4A 3HS0C 5T5NF 1ADQA 2WLNA 3HEIB 25C8L 4M29A 1MQTB 1K3ZA 5D70H 5C07E 2BIPA 4Z77B 5E7FA 3WELA 1W9XA 4GWMA 3QXUA 1RK1A 1J1OH 1FG2A 4G6AD 2MQCA 4KMLB 1MRFH 1IOAA 1E8WA 4ZMAT 1EZLA 3VXUA 3L9YA 4WV1C 6PAZA 3VGHA 1GTFA 1YEJL 2FECI 2YXSA 4NHUB 4NUMA 1GGCH 3P9LB 2CJTA 1JBCA 3C5XA 3E8UL 3TN0B 1QATA 3BPOB 5HJ3A 4WGVB 4FKKA 1HKFA 1THAA 3ECQA 3SZ6A 1PZ5A 4EOWL 1RVF1 3PXJA 1SF5A 5TE4L 1I8KB 2R4RH 1GGUA 4YHIB 1RIHH 1XIWB 1L0QA 5I9QB 5I1AA 3S3SA 1KFXL 2ZCWA 2AJSL 1XNCA 2ZOUA 1HH6A 5LN4A 5EIVA 4DNLA 4Y88A 3PHQA 3MACH 4WW2F 4OQTL 1H6FA 3NA9L 3GXNA 3URFA 1LAJA 2C9AA 2LGNA 2NLJA 3O6FA 4MBRA 3WQ7A 4DQOH 1J8SA 1GV9A 4XXAA 2A6IB 3COOA 1CDCA 1QRNB 3SGEH 2YPKA 1OAUH 1Z0MA 2AZ5A 1ND0B 3O7OA 4KTEL 3CDGB 4Y5XA 4UQAA 3OD3A 4JFYA 4MUVA 3I3QA 4XMPH 2FX8H 1ZSHA 1WWYA 1T04A 1PSKL 3POYA 1AYOA 2X9YA 2EA7A 1WE5A 3FONB 3MJWA 2PCPB 3IGKA 2JICA 4HG4K 1IILE 2C1OA 1FIGH 4MJ5A 4MQTB 4QWWC 5IG7B 3M8OH 4PJXE 1NSNL 4R2GC 4ZJ9A 1VP6A 4MGYE 3LEXA 4XN5A 3CJJA 5DYFA 2P6HA 3VBFA 1E67A 4XVTH 2VQ0A 2ADIA 1BVNP 1LCLA 1W2NA 3DGCR 3RZCA 2RS13 1W9FA 2VOVA 2FL5B 3BKMH 4TUUA 1TENA 1NH6A 2WXOA 2WNEA 2OMTA 2XA8L 5I66B 1EDQA 1F18A 2XWCA 2O6EA 5AL8A 2GTZB 4KJPD 1KDKA 1ZRRA 3OKDB 3BUYB 1HL5A 2XWZA 4NKMA 4GXUN 4ODXB 4R52A 3OKOA 1WT5C 1J7VR 4XPGH 2SBAA 1RUE2 1TQUA 2BNUB 3WDTA 5SWZD 2CBTA 5ABZA 2QQLH 4Z0XA 3DL3A 3ZYJA 3W9EA 5LDUA 4JCMA 2XV6B 1KT2A 4IEXA 3KS7A 1BBT1 5KYWA 3ZK0A 1T1WA 4AH2A 1F13A 1AFVH 3VWJD 5JMOC 2WWMC 3IDIB 4ODSL 5EUKB 4YLZA 4PTTA 3V2AR 3MIFA 3TH2T 3E3QE 4MGQA 4KO7A 1QLRB 4Q9CA 4OUSA 4H8PA 2ICWI 3UJJH 2B7DT 4JFDA 1W6QB 5D21A 4XF1A 3LKNB 1HHGB 4Q29A 3KCPB 2GKIA 2TRHA 4NWUH 4ZW8A 3SDAD 4Y4FD 2Q30A 3WVJA 4TF4A 1RSYA 3O3EB 4L4JA 4MXWA 4RFOH 3UXFA 3C6SA 5D71L 2N7SA 4HWUA 3QH7A 1NQBA 4H1LH 4KRPC 5DUBB 1YY9C 3SBRA 3TBTB 1QEWB 1BMGA 3CSGA 3RIKA 4QHLB 1OD5A 3L6FB 1UT1A 2EIBA 3KW8A 4LSTL 4BZYA 1XH1A 2C9QA 4M1GH 3MZHA 3L16A 4BMEA 3BAEL 3Q8AA 4DAGL 3S96A 1FZKA 2IOMA 2K1MA 2CSGA 2FO1A 4KO9A 1SY6L 5HHVH 1W2TA 4MB3A 1GRWA 5HYSB 3ZKUA 1YCSA 3DEMA 2FHBA 5DC4B 3CV5A 4FT8A 3EYFB 3D07A 3IJSA 3UX9B 4AVTA 1KGCE 2JB5L 3SBWC 2W0PA 3EYOB 4IOSA 3GS7A 5C8CB 4WLCA 4XNZC 3TVMA 5IJDC 3QDGD 1NAMH 4OSUH 1ZZCA 3WP5A 3MRGB 3UEZA 2R8SL 3LEVL 3WHUA 1KMGA 4NQSB 5FLHA 4BKTC 1TEIA 3C5SB 1MQTC 2XG4B 5EU4B 3GSWB 1SHWA 1NA1A 2GTWA 1T4KB 1A7NH 3GMPA 1X5JA 4CRPA 2JCCB 3MJ7A 5SWZB 3ZDYB 1Z7S3 2UXVA 2D3RA 4FQQA 4PR5A 5C3OA 1U6AL 4QRSB 3ZYOA 3WDYA 1EHLH 5DS1A 4NOBA 4M5YL 1QQDA 2AJ3A 3ZFGB 4X6CF 5L2KD 4X8PA 1DBML 5FYKH 5CGMA 2PW2A 5IHWA 5I1DB 2ALWA 3VWJB 2CBQA 4CA4A 1CBJA 2GDFA 4R9BA 3LKSA 3O1MA 2UUDH 3E1ZA 4NT6A 3TN0C 3BPOC 1LK3H 2GTQA 2RS31 3WG2A 4DEUA 3KR3L 1CMOA 4ZTOH 3LF7A 3B9AA 3QFJE 1WW4A 3IMMA 3T3PB 5I9QC 2XTSA 1XIWC 4WFFD 1UZ0A 2DQMA 3SDAB 4O2EA 4Y4FB 2CRMA 1LQSR 1G7LA 1XGPA 3F7QA 4H8VA 3ASOB 3G5XB 3ZE1F 1IGCL 3OPZH 4FAAB 1WLTA 5FBZA 5A7SA 4V2VA 2Y6KA 4JPQA 4BH9A 2BJMH 3RG1C 2YA0A 5E8DH 4YDMA 2VJXA 2OK0H 1ZT1A 4Q4Y3 3MRQA 3BW9B 3RWDB 1DDLA 3QDJA 2YROA 1WAPA 4IDJH 4KKLD 5AYTA 5HHPA 3MR9B 4XHJC 2ZGSA 2DWEA 1MRDH 1SPPA 3B2VH 2XL9A 3H42L 1A4KB 1U95A 1RFDH 4FQ1H 4PWGA 5EBMA 4G3YH 3U1XA 1CQKA 4XUOA 1O9VA 1QR4A 2EEFA 3GTTA 4ZO7A 1VMJA 1NPUA 4WHYG 2YKLL 3WXWL 1J59A 3VD7A 5JO5A 2R1DA 1SLAA 3GHNA 1L3NA 4R26H 2ADDA 5K33A 4PM1A 5EN2A 4IS6A 2P7TB 4P5MA 3QDGB 5CHNB 4HBNA 4L1TA 4NKIH 5GALA 3WHXA 3MDPA 2Q2EB 2VJ0A 2EXWD 4OI0A 2J6WA 4OCXH 2J6EA 1KY6A 2XZAL 3KPSA 1N59B 4HPOH 4L8DA 5T3ZE 2R1WB 1DJIA 3MBWA 4MNQE 4JPIA 4PGEB 3QUZA 4QHMB 2P5EA 4XVJH 4QXHA 3UERA 4ONOA 4ZXBA 3SH3A 3D0VB 5L2KB 3PU8A 4WNQB 4XXWA 5L4FA 2XL7A 4X5LA 4IEUA 1IPSA 5SWQB 4JY6A 4PJEB 4LSQL 4E5XA 3WFDL 1FN4A 2W1SA 4Z7VA 3WY3A 1EZSA 2ZUSA 3EH1A 5T3XL 4HPYL 3ARDA 1RU9H 2HKHL 3BIWE 2IXLA 5LBBA 1VE0A 4F7PB 1UASA 3GALA 1GW0A 3KVBA 4PB0H 3I2CL 4MNGB 4YSTA 1FL6A 2JI1A 4Y9CA 2CUAA 3H1YA 3DVGA 1O3TA 4HJ1A 1GSKA 4OF6A 5FCUH 3HG0A 3ZXFA 1DBNA 3TYFB 1UWYA 3S36H 3T1LA 3VQMA 3S34L 4RIRA 4CUCA 4L1BA 1RZIA 3O2WL 2K45A 4O9HH 3Q2VA 4A55A 3IETB 3KYMA 4Y5TA 4Y5VB 4HUWB 4UOJA 4GSRA 1TU2A 1WWCA 3EO1A 4H8WH 1LNSA 1RH8A 1VCBC 3LSEA 1DDHB 5HDWA 4DESA 4F33B 1F00I 3PU3A 5C0ND 4JHAH 3T4AB 1DLFL 4QQ2A 4RN5A 3U9WA 4G8AC 4Z8FL 5EO9B 2ZKYA 1LOGA 1UY0A 3EBIA 4TNGA 3VL9A 4W9JC 3T04D 4PCSA 1FGVH 3SYAA 1H3TA 1FNSL 1KF9B 3CXFA 5MP6H 2YZ4A 5LA2A 5C7XH 1ZE3H 1AY1L 4QXUL 3O2DL 2CPUA 5FK9A 4AI1A 5C9AB 2JCWA 1KG0B 4PUBH 5ERWA 1M05B 2O6CA 2A71A 2OAAA 5C8CC 3UC0H 3CQQA 3RBGA 1WEJL 5T1DL 5BNQA 3VDBA 4JFFD 4ONHA 1WF5A 5IUSA 4WF7A 4EZHA 4Y8DC 1JYVA 4LPLA 4KJPC 2QZ2A 4OQTA 4HEPA 3LDRA 1X36A 2VDMB 3GSUA 4Q4EA 1TTBA 1UB5A 3DRTA 4WVZA 3RYPA 3GPEA 2QQNL 4FEIA 3WF0A 1MAML 2BY1A 3CDFA 3O1PA 2I26N 2NPLX 2CLRB 3FOLB 2VXSL 4JM2D 3VGIA 3BP5B 3FN9A 3BRFA 3ZFGC 2IGLA 3LMJH 4G9FE 5EV7A 4BXSV 1FVCB 2APBA 3VWJC 1ULPA 2C0ZA 4ZMOA 2B4CH 1MJUH 4H26A 1KWGA 4IE4A 5IIEA 4FKEA 3VBUA 5CJXA 5ESVA 5CJ8A 3VMPA 2R29A 4X0NA 2XPZA 3QQDB 3GIZL 1F3DJ 4X6CE 4B9PA 2JIJA 4OTXH 1ZX5A 3KLLA 2VOXA 3QACA 3BKJL 3K4AA 1WKYA 4G7YL 4Z7QF 5BVJB 1P4IL 3SDAC 1D9KD 4Y4FC 5APAA 3WEZA 2DQ6A 3AVRA 2DL2A 3PUIA 3RPQA 5FY1A 2DI8A 2VH5L 1AR71 1HIML 3DJRA 4I30A 1PJWA 3MV8A 2RACA 2J8UB 2XQYK 3L3OB 1QLEB 1YUKB 3CSBA 3LE0A 4YM2A 2A6XA 1BOGB 4O51A 3ZE1E 3V0EA 2XXGA 5DZFA 5ISLA 4JRXD 3Q2WA 4ZFOB 3VBOA 5BRZE 5BZXA 3GJEB 3A6CH 3LNIA 3OWEA 4HVQA 3IDNB 4OCWL 5GS3A 4LOFA 3KXFA 5DK0A 2K78A 4JGJA 2R2EA 5T55A 1H6XA 1P4BH 4S1QL 2VE6A 3WY4A 2BTVC 4ODTH 5D7EA 5AKRA 4AEJA 3MV11 1OQXA 3NVQA 4JFFB 5DQJB 1D5IL 3IIIA 3B2PA 4WRLA 1JF1B 5FF6B 3CFBA 4G6JL 3G6JF 5EF0A 2YBSA 5K0UB 1CXIA 5SX4I 5HYFA 4X9YA 4B7EA 2OZNA 3ARZA 4N4YB 5JIKA 1MLCA 2RS33 2FUTA 3FT3A 3O12A 5HGDA 1KYFA 2WKOA 3WN5A 5JXAH 3ZTNL 2DLTA 4JZNA 4GKZA 2W1WA 1IPKA 5D4JA 5D7KD 2B20A 4M8UA 4P3DB 1OP3K 5IB4B 2E53A 3P0VL 4JM2B 4Z7OB 1OH4A 3GHMA 3JBG1 4LESA 1FV1B 2CJUH 1HDMA 1H3PH 3PJSB 4L4TE 2BINA 5D7LE 4LEJA 2VUKA 1XXDC 4PQXA 1OAQL 1E3XA 1T22A 4TNVF 1H4HA 3KPQB 4OQ8A 3SITA 5GLWA 4HBQA 5E9DA 1MI5A 3NCWA 3RUGB 1S7TA 2EXJA 4IQPA 5LB6A 2XZCL 4HH9B 4E8DA 1D9KB 3MUGB 5FY8A 2HFGL 3VLBB 2ZZJA 5DTFA 3VYOA 4U1NB 4LCIL 3TWYA 4BZ2L 2H0VA 4HJJH 4IEWA 2BUKA 3C5ZA 4FXLA 4HCGA 3RYRA 2X0WA 4P2RE 3DX0A 4MS6A 4JRXB 3UKTA 3NJNA 1IKOP 1BZ8A 4KKLC 5JDBA 2VW1A 4G8GE 3VZLA 4GYBA 3K2OA 1BIHA 2D6LX 3IDMB 4HC1L 4JHUA 1BGXL 1A6ZA 4Y5VC 3DARA 1YQ2A 3LHPL 3OGCB 3QS2A 3VMNA 2AQRA 4FAGA 1PLGL 3HZMA 3T4AC 3WAKA 4P5SA 3E9UA 2OLDA 1EERB 2IDFA 3GUTA 2AJVH 3QI9D 1I3VA 3KW7A 3R18A 2ROYA 1E4WL 1DVQA 2Y6JA 5IK8A 3U6XA 1HHKA 2DDQH 1R1A2 5C9AC 2BK8A 1LM8V 2Q76B 5GZGA 1IAKA 1I85C 2EXWC 2FH6A 3AAZB 5HI3D 4XFBA 3P3PA 4Z76A 3RIFF 2QT6A 4A2HA 1M42A 2H7WA 2EDMA 2FLRT 2HFFA 3EFFB 4ZYKB 1TTCA 4Z1VA 1VBE3 2RGSA 4QF1A 2VDQH 1KIUB 3TF7C 3AM8A 4ISQA 3RPBA 2OX0A 4B7IA 1FYTD 4ZQKA 3B1UA 3QNZB 4I88A 3USUB 4D0DB 3NIGB 5IVFA 5IF0B 4QTHB 3VACA 4DFIA 2VLMD 4APXB 7PAZA 1V9U1 2VE1A 4G43A 2XQRA 2WL1A 3CZGA 4JO4L 1BBDL 1NY71 4J2XA 1O6UA 1QOSA 4PTUB 4P9YA 3F7PC 1RUJ2 4RFRB 5F1RA 1QWUA 1AXYA 3VXPA 3AMMA 5LA1A 2GY5A 2JMRA 2WO4A 2VZUA 5IB3B 2VMGA 1DSFH 4TVSa 1LXMA 3SKJL 1RUI2 1INDL 1A8DA 2VUCA 4ZK8A 4X8JA 3V56A 1CXFA 4L8SB 3RBSA 1QBML 3IXAB 4QHZA 4D0BA 1JGEB 1ZLSL 43CAB 4LBEA 1M1XA 2CK0H 2FT8A 4J6IA 1QNZL 4D8PA 4F2MB 5L2JB 3S8GB 3L3OC 1T03H 1H8TB 2AEZA 3ROUA 5CWSA 4KU8A 5FPZA 2ZCKH 1IAIL 4CJ1A 4S2GA 4XQWA 4YHNA 5FO9B 3AUWB 2DWDB 4X5QA 3T6ZA 1FX5A 5C0NC 2J2ZB 2XKOA 3I2DA 1NCWH 3QI9B 4YGVB 5FGCB 5HD8D 2A9BA 5DD6A 3SKVA 4PJ7F 1C5BL 1WQVT 3N1MC 1IKNC 3U9UB 1HJCA 5TF0A 5TGBB 3M2MA 5C5UA 1LB2A 5IREA 4LO4B 1T2QH 3ILRA 4ZUVB 2EO7A 3GYRA 4PJ6A 2VXUH 2XJLA 4TOYL 4OZGF 1FP5A 4B6ZA 1U8QB 5I1JL 3SD5A 1QJY2 3ZSKA 4ICWA 1N2RA 3GKZA 4U1JB 5E95B 3ELNA 1TYRA 3BP7B 2DMKA 4KFMA 5J6GA 1OLME 4P4KA 3TN91 4BWWA 4AGGA 4U7KA 1JZDC 4XABA 3I59A 1CIDA 3WTWA 1QUPA 1AXSB 2JTYA 2OTWB 1OAKL 5I8SA 1XSJA 3G6JE 1NA8A 1FYTB 2I60H 2JB6B 4N26A 3RLSA 4ZMZA 1EV12 4LBQB 2VISB 5IWLA 2QVMA 2GJJA 2VN4A 5FDWA 4JM2C 4UFKA 4N0YH 3F12A 3GDBA 5E1AB 5CR1A 4BGDA 4X6QB 2R9HD 4JFEA 5IM7B 4WDIA 4QHOA 1BD2E 4C91A 3NFPA 5ADPL 2PXJA 3NRUA 1QSEE 1EHNA 4K9SA 3AY2A 2J22A 5HHOA 3EHBB 5AW5B 3HZKA 3V0WH 4MADA 2IWKA 5F3GA 3ABKB 1E3FA 3IVKB 3V4VH 2R072 3PHOB 5FUPA 2DDUA 1STMA 2FBJL 5KXEA 1D9KC 4HJTA 4E41A 3O2DA 5E0FA 2X12A 4HFUH 2WTRB 4IRZL 1NLRA 2HPOA 4L0PA 4AKOA 5FCSH 4MXVF 1ZVYA 2FHCA 1F4WH 1CAXA 1FV2A 1G84A 4FQIH 5ITBH 1L5GA 1BAFH 3NIFF 4Y2NA 3RDTC 4XYXA 4IBLT 2OJEB 5KHIA 3LRSB 5DSCA 3WE6A 1UD1A 1HJGA 2XA3A 2ZCHL 3LV3B 1P9MC 1GZCA 3SDDD 1CLOH 4OVUA 35C8H 3TYJA 1J5DA 1AUYA 2Q4SA 4XPVA 3UZVB 2GC1A 2I9TA 1SFPA 4LSSH 4K23H 4X6DF 4GXLA 1BV8A 2JDMA 4G1EA 3S5LA 4MDIA 1FLRH 4OF0A 2JXMA 5KVEL 4F1SA 1PX8A 2BNRD 1CYXA 1VDGA 3H0TA 4ACTA 3QOPA 4ONFL 1S9XB 5JZ7D 4KVCH 4V1DE 1N12A 1LO2H 3GLZA 3IM1A 3SPIA 2AZUA 1YYML 4ELMF 1TQ5A 4WKZB 3BRDA 3BZEA 1LGBA 2BDNL 5IB2A 5IK3B 1OAZH 1CGTA 1J05A 1T80A 1EEYA 3LZLA 5E5MA 4DW2H 3NWKA 3ECUA 4HJIA 3H9HA 3HN3A 4TUOA 5DR5L 3LOWA 5L9BA 1WFMA 1FYHB 3MXVL 3THTA 4TQEH 5TE6L 1D2SA 3WP6A 3V5KB 1C5DB 2V2TA 1FFPA 3MJGX 2JG8B 3IJHA 3X13B 4XQDA 2ZXWB 4PV8A 4KQ3H 1OCRB 4KKRA 5DHEA 2QKSA 4B95C 5BMFH 3LPFA 3L1EA 4AM0A 4ZI8A 3RU8H 1ZZBA 5AVZB 3WI9A 3MZGB 5HHXL 2GAZA 3FN0H 2BSTB 2Y4SA 4AUJA 4DGVH 5FB8B 5HYQA 4UANA 3FSZA 5HHNB 2XN9E 3ERXA 2FJGB 2HVBA 2AQ2A 1TYEB 2GJPA 2EVIA 1AQMA 2ESVA 2Z6FA 2E7LC 1KN4L 4UFIA 5E08H 2V33A 4JFHD 5CM1A 1SM3H 3CVHH 1VZIA 3TIDB 3T2OA 2C1FA 3INUL 4NKQB 1AD0A 1ROWA 4L8SC 5CZKA 3LXAA 1MCBA 3WIIH 1SACA 2E63A 2EXHA 3DUIA 1TTFA 3MOAH 4K73A 3ZTJG 1RUF1 5JAXA 2WDBA 2WT2A 3O45A 1NMBH 1QHQA 3LS5L 4UINH 5AB2A 1H8TC 4OCYH 1CO1A 3FRUB 3SDDB 4YZ2A 1YJDL 2RFXA 2VN7A 1YFWA 5KR7A 5FRAA 1HXKA 3MXWH 1XU2A 4HANA 3H53A 3CJXA 3LPWA 3QI9C 5IFJB 1VJ2A 3Q3GB 4FHKA 4FCHA 4ZU5A 2BNRB 5E99H 3TWCH 5HYJA 1KEGH 4Y16D 2VN6A 3IMTA 2F8VA 1IL1A 4UM8A 2FDBP 1JPFB 4JCLA 1OEZW 4MMXB 5DC0A 4KX9A 5JDSA 1K5JA 5DHVA 2B1AL 1S7XB 4HKZA 4ZNEA 1C9SA 4L11A 5HI3C 5GXBB 1W80A 3QPXH 1ENQA 1V9U3 3H9SE 1BG9A 1MG3C 1JGDB 1UATA 1WVZA 2HWF3 4NWWA 2HEWF 1CT8B 4BSWB 4R7XA 3N40P 3ZL4L 3VMOA 4BZ2A 1OK0A 1OT5A 1HL4A 5MHSE 3BCDA 4TQ8A 1O75A 4C90A 2VZRA 3F7LA 5FYSA 1IG0A 1MFCL 1KBWA 1IBHA 1NCIA 3DO4A 1RZKL 1R34A 3L3IB 1RQ5A 3FQUB 4PH8A 1ONQB 1QFWI 1LENA 2X38A 1C08B 2NCEA 2XPGA 5A7WA 4FAHA 5FZMA 2WNVA 4HC1A 4NRPA 2QVIA 3SKNA 1F6LL 4S1RH 2HG5A 4XCFL 3C9NA 4L05A 2DQDH 4HUMB 3QJQB 4YQXH 3EHBC 1WD8A 3QZOA 5GJTH 5ACZB 1OKOA 1JU3A 4KGLA 3GJFK 2L3BA 5LNEA 2VDNB 3BXNA 1FATA 4QXTA 2VZ1A 1QVOA 1ZTMA 1NFDF 5AWNL 1REEA 3RNSA 2BRRH 4UQ2A 2I07B 2W60B 1WV7T 3X3GL 4QGLA 3T1MA 4LU5H 1DF0A 3EXUA 4LLWA 1IC7H 5F8RC 1XCXA 3A0OA 3QXAB 5KBNC 4U36A 2J88L 3LZQA 3RJDA 1S7SA 2X4NA 3QEQD 3Q1SH 4OHZA 3Q44A 4AZZA 1RUC3 1Y6KR 3NCJH 3PREA 4MXVE 1RUQH 3VFSB 1XWVA 2EE2A 4IOFD 2UY9A 3B1TA 1MRCL 5HD8C 1QYGH 3B9KD 2X4OB 3K72B 3BSZL 4DWHA 3MO1A 4EVNB 1LMKA 4M0HA 5LBSH 1L9OA 3FYIB 4LHQB 5KG9A 2K3HA 1C7TA 1QPPA 4CDQB 4XNBA 4IJ3B 1DZTA 4YO0B 4H7MA 2YD9A 3MJ9L 5JXED 1J58A 3PWJB 3CIQA 1K4CA 1NC2D 5E8OA 1D7FA 3KL3A 3L9BA 2HWE3 3J07A 2F54D 2W92A 1M71B 1SUHA 1VFAB 1T6GC 1YMHB 4A6YH 1ZVHA 5CBEB 3CJIA 1ZRDA 3HW7A 5E2UH 3TBYB 4DN4L 4UYPA 3U1QA 2XKNB 5GSRB 3WEMA 2OMUA 4AVHA 4ELME 4GG6B 2PHFA 4IV1A 2R39A