2WN3A

Crystal structure of discoidin i from dictyostelium discoideum in complex with the disaccharide galnac beta 1-3 galactose, at 1.6 a resolution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 60
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn3A01
3F2ZA 2Y6GA 4TXWA 2VMDA 3FHQA 2E31A 1GOFA 4ARYA 3CZUA 3MBWA 4QDRA 1US3A 5A1AA 1UYYA 4LPLA 1UY4A 1UMHA 1O8PA 1H6XA 4CVUA 5DQ0A 3LEGA 2VCBA 2W95A 4HG6B 4TTGA 2VCCA 3FL7A 1UWWA 1JHJA 3VD7A 1K45A 1R64A 3FHAA 3IAPA 4BXSV 4D0QA 1L7QA 3EB7A 2WYSA 3HNBM 1W0NA 4MGSA 4A45A 3IB3A 2VZPA 5CYYA 2V5DA 2QQMA 1JI6A 2VJXA 2XQXA 5C71A 5JXHA 3OB8A 3GGLA 2VZSA 4QX0A 4FI9A 3THCA 3OGSA 3I97A 1P8JA 2KD7A 1XNTA 5IFPA 3ACHA 3NRUA 3LEIA 5CZKA 3PUHA 4W8JA 4BDVB 1JYNA 1DLCA 4KWUA 2ZEXA 3I2JA 1D7PM 2W47A 2VZUA 2WABA 2CCVA 4A3ZA 2E32A 3LQCA 4LKSA 1K3IA 1JU4A 1LNSA 3I2GA 2QQIA 4A6OA 3VD3A 2CGZA 4XZUG 1MPXA 3WMQA 1ULPA 3GDBA 3T2PA 2DDUA 3I2KA 1JZ5A 4DUXA 3WNLA 4XUTA 4OUEA 4ZZ5A 4Z2AA 2JDAA 1UY2A 4KMQA 5I0DA 2VQUA 2QQOA 5B4NA 3T2OA 5JUVA 1OD3A 1GQPA 3CMGA 3WF4A 4OZOA 3T0AA 2J1VA 3VD4A 1JZ8A 3WF1A 3WF3A 4A42A 5IJRA 3UESA 3THDA 3MV01 3MV11 2WUHA 1L7RA 1DYOA 3ECQA 3C7EA 3ETPA 1SDDB 1UY3A 1XPWA 1WKYA 3ZM8A 3UETA 5LCWL 4ET7A 1KEXA 2VZ1A 3ABZA 2HYXA 2QQKA 2WO2A 2HLEA 1J84A 1PX4A 1W8NA 1K42A 3A21A 2WO3A 1SG3A 1GMMA 4QX2A 2E33A 2J1AA 1GUIA 3NJXA 2VO5A 3WNOA 1OT5A 4KI5M 1W99A 2BGOA 2W91A 4CU9A 4RN5A 3SKJE 5IFTA 1NUKA 4L0PA 4CU7A 5EJZB 2JKXA 2YC2A 3K4DA 1F4AA 4P00B 1UXXX 1GU3A 5G05L 5C7GA 5HXMA 1K12A 2YC4A 1DP0A 1NAEA 2C4XA 4IUGA 4MO3M 3HOBA 4OMCA 3OG2A 2YFUA 2OKXA 2B4KA 2VZRA 4OMDA 5IYYA 3VDCA 4QX1A 4PQQA 5IHRA 2ORZA 2Y6KA 2VR4A 1T2XA 2BBAA 3C7GA 3CKHA 3DYOA 3NJVA 2VZ3A 4GWJA 4QB1A 5J1XA 2VZVA 2VOTA 2EICA 1GOHA 2XONA 5LA2A 1W8OA 3ACGA 1OF3A 1YQ2A 3A7QA 3T08A 5LA0A 3U37A 4QB2A 3C8XA 4GWIA 1CX1A 1F4HA 3ACFA 3HNMA 3VDAA 2VL4A 3DECA 4XUOA 4DUWA 1JYXA 3IIIA 1UYZA 2C9KA 4LQRA 3K75B 2W87A 2W1WA 2Y6HA 1I5PA 4LHSA 4DXRA 5JXIA 2X09A 3WMPA 4UOJA 1CZVA 2CE6A 3CQOA 1NKGA 2LS6A 2ZXQA 3WF0A 4QB6A 3W5MA 3C7FA 3IDAA 1BHGA 4M4RA 4ZZ8A 4BJ0A 2WO1A 2WAAA 2J1UA 2JD9A 3WNMA 2CDOA 2J7MA 1NX9A 5FUIA 2Y6JA 3T0BA 5JXGA 3MUY1 2Y8KA 4QPWA 2W3JA 5G04L 3I3EA 1UZ0A 5EJ1B 3K77A 4CU8A 1JZ2A 2VC9A 4ARXA 4QAWA 3OEBA 4XVHA 2WQ8A 4YPJA 2QQLA 1CZTA 3CDZB 2J22A 1CZSA 3JXSA 1RYYA 4E8CA 4BK5A 3D3AA 3CZJA 4MGQA 3CIHA 2J1RA 1O59A 4A4AA 2ZEYA 3P6BA 3VD9A 4CU6A 4P02B 2VQTA 2X10A 2RVAA 2V4VA 4DUVA 4XUQA 2DCJA 2B9VA 3E1F1 3I2IA 4D8MA 1JZ7A 2VM9A 2LW8A 4XUPA 2VMFA 2WN2A 2WZEA 1WCQA 1JYWA 1JU3A 2CGYA 2ZEZA 4DEQA 3I2FA 3T0DA 1US2A 3HNYM 2W1SA 2DCKA 4P5YA 1EUTA 5JR2A 4DXTA 4JKKA 1H6YA 2CDPA 4MOAA 4AG4A 2W94A 2ID4A 2VTFA 4JKMA 1CIYA 1O8SA 1UYXA 4BK4A 3FN9A 4PF1A 3HN3A 1UY0A 3WNNA 3I3BA 3NNGA 1W9SA 4UAPA 1JZ4A 3VDBA 2VZOA 1UXZA 4XUNA 1OH4A 4XURA 2W92A 3MUZ1 5DN2A 3ACIA 1TG7A 3A23A 2W1QA 4ZXEA 4RYDA 2WBKA 3OEAA 3WEZA 3WNKA 2Y64A 5C70A 4A44A 3A22A 2J1SA 4GZ9A 2C26A 4QX3A 2ORXA 1JZ3A 1PX3A 4W4ZA 4CUCA 5JMOA 2QQJA 4JKLA 4MADA 2L9LA 2XHNA 3VD5A 2VCAA 3SEEA 3K4ZA 1W9WA 2YFZA 1J83A 2EIBA 3K4AA 3AC0A 5F7UA 3LPGA 2PQSA 3BN6A 3MO4A 2RV9A 1GNYA 3OGVA 3DYMA 2W46A 2VMCA 3WSOA 3T09A 3K46A 3IAQA 2JE8A 4ZY9A 3WF2A 2J1EA 4Q56A 3HJRA 2W5FA 4AAXA 3PUIA 1EUUA 4JX0A 2J1TA 3W5NA 4QDSA 4UI9L 3BGAA 2EIDA 4W50A 2VMEA 1OF4A 1XNAA 1PMJX 4M4PA 4QDQA 1GOGA 3WNPA 2VZQA 5EIYB 4DXSA 2XOMA 1JZ6A 2QQNA 1W9TA 5LA1A 1IQDC 2Z4FA 2YG0A 5DMYA 2BERA 2ZEWA 1KGYA 1TVGA 1XC6A 2WDBA 3SKVA 3OBAA 1ULOA 1UMIA 2R7EB 2Y6LA 2YB7A 3C7HA 4E8DA 3LE0A 3NQHA 1PMHX 2WZ8A 4OYUA 1HN1A 5B4XA 3DYPA 3LEKA 3T2QA 1UX7A 2WN3A 4CUAA 3OGRA 5DPNA 4DEVA 3J7HA 2WAOA 2W1UA 2X05A 3WQBA 3I3DA 4PT6A 2E26A 1SHWB 3SEPA 2BZDA 2BGPA 3EYPA 3GM8A 4A41A 3C7OA 3HEIA 1JYVA 2QBXA 3HPNA 2W9XA 4JHZA 5JXJA 3P1IA 3GXUA 2VZTA 1UY1A 5HPOA 3UNPA 3I2HA 4P08A 3LPFA 2RJ2A 2V72A 4CUBA 2EIEA
chains in the Genus database with same CATH superfamily
4WUUE 3O0RL 4C4KT 1D5IL 4OCRL 1NCRB 4LEXH 4FQXA 3OAYH 4I5BA 4RFT0 3ML8A 4BFFA 1BD2A 3HZMA 1ZHLA 2DPKA 4OLEA 2JQMA 3NFPB 1VADA 2VUOA 4EIBA 4L11A 3LKQA 3ZOAA 2W9DH 4EN3D 3HMWH 4EMZA 4NRPA 1JP5A 1OY3B 2VXTL 1MJ8H 1QUPA 2J5WA 1J1OH 3ZKMD 1LDSA 2E9BA 1DO6A 1Y6KR 3RL1A 2PYTA 2JF1A 2IMMA 2MCPH 3AZWA 2AK4E 3T2NL 4FZEL 1UFUA 1OF2B 3O2DH 1XCQA 3IFNH 4JFSA 1IVLA 1WBXB 3GALA 4HONA 4IXLA 2HX7A 3U4EB 5EF2A 3DSNB 1VKXB 3ST7A 2F7RA 5IB3B 2R1XB 3UBXG 3TCXA 4I0WB 1IRAY 1QSEB 4J8RA 4U1MB 4HPOH 3PYCA 4U1LA 4L4TE 1JHJA 2XC8A 4XVTH 3CVHA 4X4MA 2WZ5A 4JFDA 4IMKA 3WO3B 3D85B 3FFCA 5HPMB 2R2BB 1JWUA 3S5LG 5IKCB 1SFYA 4IIQB 2WYSA 4MAZA 4MGSA 1KEML 4ZUUB 3ZE2F 4YZ4A 5IK8A 4PP2A 2BSED 4GMTH 4PRNA 3KPTA 2UX7A 4AYDC 1GSMA 1U41A 2Z65C 2V5DA 3LRHA 3PV6B 1FLRH 1UUNA 3KPQA 4W9HC 1WIUA 1DANT 4PGBA 5HGDB 1WLDA 4ONUA 1JYIA 43CAB 3I59A 2HRPH 1NOFA 3DSNA 3GGLA 4Q4Y2 5C5TA 3JB8A 3BSGA 3T6QC 1XCQB 2LV4A 3F2LA 3WKNA 1OTSC 5LCVL 1YCIA 1TQCB 4GAJL 3LRKA 5IJDC 4QU2A 4CSZA 3LKRA 4YO0B 3QNYA 3G5XA 3KE0A 2A77L 3RWCA 1IGCH 2WSKA 1ZEAH 5C08E 3I2JA 5I28A 3PP3H 3RYPA 4NI6A 3TTYA 4QTHB 3FC0A 1J9QA 1CBVL 2W47A 4YXKH 2ED7A 5I6OA 5B38G 3N9NA 1HL8A 4DVRL 4JY6B 4TULL 4I87A 1T83C 3AUVA 4ZFZB 1S0EA 4J6GA 4I7ZC 3WEBA 3RZHA 4KI5C 1UD3A 1KYOK 5GZCA 4HEPA 3OAUH 1ZBE3 5EO1A 1P9MA 4IRJD 2Q7YB 5A16A 5CB7A 5F71A 1MFBH 4I85A 5AW2B 2APXA 3X1NA 5IW0A 5I91A 2AQTA 4DUXA 3LSDA 5CBEB 2VJ8A 3VBSC 12E8L 3QWOB 4JO4H 5DSCA 4YW1A 3GXUB 2OMYA 1P2CB 2ATAA 2BSTB 5JYLA 3KWXA 4LLWB 4M02A 2FSEB 2YK1H 2P8MA 4K9EC 5E4EB 3ATBA 1NDMA 3B7SA 4ELKB 4HL0A 4RGKA 2NQDA 3QH3B 5IIEA 1B4TA 5C08A 3RIKA 4JDMA 1BKZA 4E9WA 2ADGB 1SLLA 4M01A 4GP4B 5I16A 3P73B 1HQRA 3ZKXC 4M43L 4QNPE 5I17B 4L99A 1SBFA 4LBJA 5IJRA 4L1BA 5JOYA 1GBGA 3TL5A 1QW9A 2ED8A 2WUHA 3J7NA 5GGSA 5DG2A 4LARL 3WFEL 1AR91 2BRTA 4HWUA 1AR93 1FNGB 2BNRB 4XH2A 1ZLSH 3LEVL 5CP7A 2I45A 2P47B 4JM0A 4URKA 4G1MB 4CMMB 4MGTA 2ZUYA 3REVB 4UFHA 3I75A 1D6VH 4NO0D 3UETA 1K5MA 3VI4F 4DMIA 2V5RA 3GBFA 1XF4A 5EZOL 3F62A 3ZE1E 3QI9D 1JWMB 5FA3B 3KLDA 1HRV1 3PG2A 2QDRA 4B9CA 4BWUA 2FATL 4KK6D 2GC2A 1CFQA 2WP3O 2J1XA 1B35B 4J2QA 1UKTA 2BWQA 4IMLB 4PY7A 4IEQA 5BO1L 1RUQL 1OGAB 1T1YA 3BQVA 3NCJL 3QUZC 1W8UA 4MXWB 5IT2L 3MRJB 1BWMA 3QEQA 1FI2A 3E2HC 1ND0A 3FQNA 2AEPH 2XKOA 2EQDA 3N85H 1QTPA 1XEDA 1OCZB 1BZ9A 2R073 4HBQA 2WLQA 1ND2B 5I8EA 4FPHA 2H2SC 4FL4C 4KK9D 3KWUA 3UEQA 2B20A 2CXKA 5DURB 4NWTH 4Q14A 3FS9A 1JGUL 1ORSB 2G9ZA 2NY7L 2P5EA 3H9SE 4QPEA 1WC7A 3R4SA 1FQ9C 4XFAA 3BAJA 3ZFFB 2EE2A 4X8JA 5F9WB 3LOBA 3FSWA 1DYZA 5EU5B 4U1JA 3HBKA 1JZFA 2HN7B 3ZRFC 1XXFC 4GO6B 2GBVA 1OO2A 2NXYB 4H3WA 3ZW3A 4HN0A 4F9PA 5IR1A 1H5BB 2EINB 4DN4L 4ETYA 3BEWB 4GUPA 1J1TA 4JG1H 2WIIB 3ZQXA 2JIGA 1T2XA 1QD0A 1J58A 3A4DA 4NJAL 3B9KD 4YZ2A 5L2JB 2RM21 1N4XL 1CL7H 2TAAA 1IL1B 1XCTA 4HSAC 4KX8A 2F54D 4OI0A 5HDQH 1WBLA 2FBRA 1KDJA 4KQ3L 4YXLH 1L9SA 3U6RA 2D73A 5DJ0B 4FTEA 1Y0LA 1R5VA 2H26B 1ZVHA 2CBTA 2NTSP 4W9GC 5L8JB 4JE4B 1NMAH 3VWJD 3LB6C 1A6WL 1AANA 1R5VB 3D48R 5DJ0A 3B43A 4AEDB 5KAQF 1CR9H 4LHLA 3GZKA 4NQEE 4WI0B 2D40A 1IAIH 2W87A 4AK3A 3MOQA 4I13B 4FNLH 2Y6HA 1DCLA 3LHAA 5C0EB 2B1HL 3QP3A 2ZPKL 5D7LB 3S35H 1YEDA 3CJIB 5H9SA 4P9GA 3BUCA 3QUYA 4EYUA 2CE6A 2GVYA 1MRDH 1TTAA 2EUXA 3EJZD 3MBEB 3WAJA 2E5EA 3BQUD 1CL7I 5HJDA 1L5GB 4LB8A 5EUOF 3SDCB 2AEYA 2DZEA 3VFNB 3H9YA 3NDZE 1OT4A 3SDYL 4HD9A 5EU5A 1IB5A 4JGZB 4TN9A 3CVBA 3C60A 4Y1YA 1PK6B 2YMTA 5AOZA 1NJ9B 4ZUTA 2AGSA 4FJ6A 1ZGLP 3FT0A 2O14A 4Y9GA 2AK4B 1ND2A 4N26A 4ZTPL 5KSBF 4BXFA 4WV1A 3CSBA 4JFFD 1S0BA 2A3WA 2NOYA 3H3BC 4X80L 2ZGKA 4AQ2A 3UG5A 1GGBL 2F74B 3S36H 1WA0X 3FQNB 5TE6H 1K8DA 2AJ3B 1CR9L 4PJDF 3U4BH 1ZXKA 2XTJB 4KBPA 2G1MA 2V2TB 5LK7B 1OTTC 1IFRA 4JFYB 3T1WA 1JPTL 4NRYB 4M8QA 5SWZD 5ACMA 2A9AA 2FO4B 4GRMA 4F2EA 2I5YH 2YD5A 1PIV2 2V7NA 1JAEA 1W8TA 4G5ZL 1NCJA 5AW0B 3RB5A 3S2CA 3R7RA 2C7UB 1KBWA 4IV3B 3BFWA 1TMF2 1C5DB 5FO8A 1VESA 2ZKHH 1I9IL 4OD3H 4KKCC 1J8KA 5TPWL 3OKKA 4XPHH 2K45A 5DRXA 5GZOA 5DUML 1YN6A 4B4PA 3ZDZE 4YSQA 1RLBA 4JQXA 3T4YB 1X4XA 2P1YA 1A3RL 3KVAA 1NDGB 1ZVSA 4UQ2A 4ODSH 4Z7IA 3RZCA 2F8VA 4QXGH 2PELA 2YA0A 1I1YA 4U3SA 1QNWA 1FPTH 4WU7B 2X10A 3ROOB 1IZ3A 3MPPG 5I8EB 4AFAA 1STMA 3CCHB 2N7SA 3FB7A 1IKNA 1KCBA 2XFXB 1IBGH 2E59A 2NY3C 3E1F1 1W16A 3VU2A 1LHZA 4M1DL 5DZ9A 4MD4B 2CNZA 1FV2A 3TO4D 5FPVA 2ZF9A 5HHPB 5IQ9A 2VM9A 1W6NA 5DMKB 3GSOB 3RVTD 3BRGC 4JPWL 1CDBA 3S37X 1N6UA 1WCQA 4HIEB 1LDPH 4NENA 4XJ8A 1BQHA 5FREA 4G8IB 4GT7A 1OBNA 4F7TB 4FXGA 3ON7A 3FF7A 3MUJA 1KXGA 5A7WB 2GTWB 2G75B 3VFSB 2AXFA 5IOPB 4YQXH 4MA7L 4Y8DC 2EXYD 4ZFQA 1WCSA 1MFEH 3GTTA 3KD4A 3HB3B 3J26N 1OK8A 2J55A 3FF8A 4OD2A 1WW6A 1MH5B 3QDHA 4K7JA 1JN2P 2PWGA 1W39A 1JPFB 4G43B 4YX2H 4BLIA 4DP8X 4PJEA 1A4AA 5CBAA 4URAA 2FBJL 4TUKH 1CX4A 5F2FA 2XBO2 4HPHA 2D0FA 1UYXA 2VXVH 4JRLA 2ZACA 2F61A 2G19A 4YDIH 4FKHA 2CH8A 3KYAA 3MXWL 2HH0H 1VPHA 3OZ9H 2G2RB 2BP0B 1EAOA 2JKBA 4ATWA 4QU1A 1RIUL 1HQ4B 4NO0A 4MH0E 4FP8H 5E8NB 5TQ0H 1EHKB 1RZJL 1SYSB 5DR5L 4NN6B 3CSYA 5FC9A 4OF5A 3LFIA 1AR62 3ZTDC 2E63A 4J3OD 5AVXB 1UB6A 1H0DA 3QUKA 4KRPD 1Z0NA 3N9QA 3BZEB 3GO1H 3H42B 4FAGA 3S7GA 4F58L 4XBGB 5I1KL 5JDBA 5A7WA 2Y64A 5KXDA 5FJKA 1Z6JT 3BD3A 1BPLB 2EEBA 4WGWB 1DBML 4OUOA 3ZYJB 3HC0A 3OD3A 4YZWA 1AZZC 3MLPA 3FQWA 3OG6B 2CK0L 3MVSA 2IFWA 5AW3B 3UTOA 3TOJA 2BVBA 4CXWA 1AHWC 1HE8A 2RS13 3FUKA 4BINA 1QLFB 5AB2A 1R082 1JZEA 3ULVE 5EBGA 1ZA3B 3MHZA 5IGXH 2G5UA 4WUUD 4KTGA 4GNKB 2HYKA 5GS0L 2R2BA 3CCHA 4Z3FA 4ORGB 4TL5A 1U0AA 1ETA1 4KRNA 2WO3B 4BEIA 2EIBA 3QI9C 4X7CC 1R091 3TEXA 1S0JA 3LPGA 4Q6IB 2LAGB 3OC5A 2QZ3A 3MO4A 2Z8SA 4Q1RA 4QGLA 4F1ZA 1GNHA 1VBA2 4UI2A 1KENH 5EUKA 4RZCB 1VJ2A 4UTAH 3ZN6A 1CS6A 1XAKA 4HGWB 3K46A 3L9RA 4PGEA 3Q9OA 1TOXA 4PH8A 2QZ2A 4ATFA 1E5CA 4R7VA 4HFUL 3SISA 4Y9CA 5DZJA 1PLAA 3DV6A 4KTEH 3RTQD 1G7LB 1B0IA 1H3UA 4KKNA 3KPPB 4AVVA 2R062 1RSFA 2FEDD 2R29A 3W5NA 1I8IB 1J9TA 4LQ1A 3QC6X 4MFHA 5ACA3 3UTTB 1WZKA 1F5WA 4P46B 4F2MB 1FPN3 4WVRA 3VGGA 3F8UB 1RMU3 3VI3B 1G84A 1ASJ2 2E9QA 5FY4A 1GCFA 1FVCB 1UZ6F 2DQTH 2IFFL 4NKIL 2LQRA 2OSYA 5KVEH 4YHIA 4HIHB 3KH3A 2QUOA 5D1XC 2XTJE 3C09B 5DK0B 3C09C 1AQKH 4JGZC 1MFMA 2F7QA 3Q2NA 4JO1H 4NPKA 4XO9A 2R6QA 2AK4A 3DIVA 4LGSB 3JXAA 1NFIB 4O4YL 5SV8A 1BBDL 1L7IH 4HIQA 1XF2B 4E4HA 3OLDA 2GNTA 3EYQD 4E8DA 3MLYH 3F6LA 3W39B 2CUMA 5JW5B 3O3UN 4JFEA 1JHTA 4NHMA 5HV4A 4TLFA 1KYOJ 3HC2A 4Q9BA 4WI7A 4Y5XB 3J7HA 4IW4C 1GW0A 2FGWL 3D2TA 5CJXC 5E4AA 4O00A 2RB8A 2L4OA 1H8TB 3M3IA 3V0IA 2W60B 3MR9A 1RVF1 1GZHC 1ZT4A 2ZWSA 1LJ7A 2WZPD 5HHMB 1D6EA 4TVPH 1PKOA 3ULUE 1VMJA 2HZHA 3RHWF 1OPOA 2H9GB 4QQLA 3U78A 5E5LA 5JIQA 5E23A 3QEQD 1VZHA 4MQ7B 4YFWA 1CF8L 1YI7A 2NT0A 2NMSA 3TF4A 2NNAA 2Z4QA 3VFPB 5D96C 1UD4A 1X5JA 2XN1A 3H7BB 3E5UA 1HYSD 1ZVYA 1Y0LB 2H26A 5DD6A 4NUBA 1BF5A 4BA8A 4G11A 4HWNA 4URTB 3UFIA 2GYSA 5CSZB 1BBDH 1L7IL 3FRUA 2P43B 1GYKA 4JFZL 4GQ9L 3V4VB 4ETQA 1J5CA 4AE2A 3S96B 2JIXA 4JRYB 4RZKA 3HC4H 2WLKA 4G4FA 3D8CA 2B1OA 3WHXA 1RVFH 1TCRA 4K1YA 1UB5A 3X11A 1ALYA 1MJ7H 5FWEA 4WW1A 1E4WL 4NOBA 4PJBA 1DSFL 2RS33 4RCAA 3CFEB 3VFOB 3UBGA 3UJOA 1NAML 2FQDA 5F8RC 4KQ0A 3D2UD 3BAYA 3MBWA 1S8DB 5J3UA 2VYRE 2D03H 3TBBA 1CD0A 2Z93B 5K39B 4O2EA 3VRJB 1BBT2 4G9FD 1CLCA 4GKSB 4JZNA 5FZOA 4OLZL 3DXAB 4NRQA 3PIJA 1FL3A 3QDJB 4RGOL 5IQLA 1W0WA 2Z0UA 3DHMA 4N8VG 1NT0A 1A6WH 3VXNA 4F33A 2PN5A 2X5IC 4S2FA 3INUL 1EIBA 1INEL 5HGHA 4UUJB 4PIRF 1T22A 1FAKT 2YS4A 2Y25A 4M48H 5I15H 1MVUB 2ZPXA 4QKFA 1W0WB 2EO1A 2VDPL 2ZKYA 4UV7L 1D7FA 3LDBC 4Y5VB 1KJ2H 1ECYA 3HBGA 1MVQA 2MEJB 4N8CL 1WFUA 3P11H 1OHFA 4YG3A 2QTEA 4HUVA 2CNAA 4C0BA 3P4NB 4AQSA 3PIGA 5IVEA 2CSPA 1IC5H 4H7MA 4DKDC 1IBZA 3CBRA 1UD1A 3CIAA 1T04B 4PJBE 4FJYA 2HEVF 2PLV3 4R9CA 3S7IA 2V8LA 1R3IH 2NLRA 2AJVH 3IRCA 4KH9A 4WNJA 3U7AA 3VL8A 2P8LA 4ZOBA 4HOZA 4FQXC 4HUCA 4YVNA 4GSXA 1XD1A 4B29A 1M4KA 5INDA 1IM9D 3N7MA 4S1DD 4D9QD 1G7MA 1FNGA 2BNRA 4XH2B 4GG6B 3TB0A 6FABH 1P8JA 2KD7A 2ZMNA 4AI0A 4XZ4A 1QQP2 5IFPA 1PYWA 4H26B 4F7CB 1BVNT 2C9UA 2AEOA 2X4UA 3Q7JA 4F2FA 4DO0A 5FF6B 3N1FC 3TBTB 1CXHA 4MNQE 4KH2A 3VWKA 2DLTA 2WWMD 5LG1A 5JOPE 4FA7B 1VBC1 3FBMA 3LOWA 2VZUA 4LEEA 5HD8C 4WKZB 2ENPA 1N6QH 1S9WB 5LWBA 4R6UA 1FUNA 1QOOA 3QEGL 4N5ED 4XP9H 4JDTL 4LP4A 4D9RD 4BK5C 1K3IA 3I2GA 3ZXDA 1MIEL 2P8MB 5DUPL 1WCKA 1NEZG 4QYAA 4JZJA 4A6OA 4WW1B 4CC4A 1MPXA 3K8LA 3QUML 4NSKA 1UWXK 2OMYB 4G9FE 5IWFA 2CRIA 5BPPA 1TF4A 1I75A 4L1TA 1FCGA 4AITA 5K33A 1A9VA 2BU9A 1UHVA 1CLYH 1HZHH 1AQDA 4TNWK 5IBLC 2B59A 3I6GA 1IC7H 2V2WA 5LN4A 1ILUA 3SD5A 8FABA 2WQ4A 4KROB 4UM8A 1FMD1 4BUHA 3H7BA 4X4ZA 1TME2 4UAOB 4WGKA 4P9JA 3UPAA 3WSQH 1R3KA 7FABH 4NQVB 4X42A 1BSIA 2KDGA 3CMGA 3O0RH 4ELMB 2QLYA 5C0BE 3IRZA 2FHRA 2HWE2 2A3YA 1UASA 1V3LA 1G9NC 2D4DA 2HTLC 4NT6A 2WGXA 3CUPA 4R0LC 3VWJB 1J0IA 4HT1T 4PBPA 2Z7WA 1IIIA 2LFEA 1W8ZA 1GHFH 5DO2C 5F7EL 2OTWB 3AREC 1TJGL 2Q8CA 1CONA 1F00I 4AT6A 4MCZA 4ZUWA 4GJYA 4Q4X1 2IDFA 3DX3A 1Q1JL 1Q9KB 5BUGA 2ARAA 8CGTA 4FI7A 1G7PA 4HHGA 4L8SB 4KC3B 2VT0A 2VW4A 4LLFA 5KVDE 5C86A 2HT4D 2Y36H 3BYYA 2VE6B 2WAHA 3MUGA 3DETD 1PVXA 5BNOC 4UW5A 3ARDB 3MQIA 5ID1A 1XSRA 2F5AL 2AMUA 3PUSA 1WD4A 2XU9A 3BDYL 1QRNE 1Z5YD 1NGZA 1VHPA 4KVPA 5HI3C 1A8DA 2HYXA 3SGKC 1BFVH 2BSDA 2WVTA 4PJAA 1K42A 2YBGA 4EKJA 2F0CA 4UOZA 1C1EH 1IBYA 1JRHH 2CBPA 2E7CA 2OMWB 4OT1H 4U1NA 1I3HA 1FVDB 1B9ZA 4MNQD 1S9YB 3EJJX 2H2PD 4HIHA 5HPMA 5IKCA 4LCYB 3UTZA 4Q0XL 1CAXA 3POHA 1ID5I 1TQBB 1JD9A 2HKHH 1CD1B 2N1TE 2DYRB 5FUZH 5LGHH 2LTNA 1CG9A 4XIOA 2UWEB 1AXYA 5FEBA 5K9KB 1EK3A 4G3YL 1FO0A 1O7DC 1TJGH 5HTSA 5HHNB 4MAYA 3P3NA 3GBDA 2E9JA 2EC8A 3BOWA 3MLTB 3OKNA 2FR4B 4Y20A 1T1XA 4NBZB 1NWOA 4NRXA 1G7LA 4GAJH 1B2WH 1H0DB 3QUKB 2OCJA 4MB1A 2CK0H 4MCNA 3A6CL 2IBZX 3G5ZA 3KGZA 4IUGA 1ZLUH 5L7XH 1R3HB 3S36X 4ZAKA 4EIUA 3VQ1C 2C3WA 2ZOEB 3IXTB 5DJ8B 5F96H 1QRNA 4RMQA 1MWOA 2AXWA 2AV1B 3MCG1 4OHZA 1AKPA 2UY8A 2YEZB 3QUZA 3QIUB 5D8AB 2CUAA 5ISZD 4HMDA 1LEGA 2VR4A 3O4LD 3GXFA 4X98A 3ZBMA 4LCCB 1RU9H 1QWRA 3I6SA 3CKHA 3JTTA 1JRHL 3FNKA 3M17B 2BY0A 3WDTA 1O6TA 4IGBA 2Q2LA 4TVPE 2VLRB 2LT9A 3ULUH 4AHZA 5J7MA 2ZWKA 5FKPB 4OIIL 3OD4A 5C8JB 4UNUA 4MXWL 3OXRA 2FX8L 1NBYB 3ILNA 1BMV2 1RIVL 3LQZB 1U8JB 4UW4A 1TT6A 3AM8C 3VBUC 1PDKA 2GBAA 5GGUB 1C12A 1LOFA 1EO5A 2WWMC 4QAMB 1R5IA 3BRDA 5H94A 3ALQA 4YBQD 4XFCA 3F7YB 2F5BL 4FQLH 3MTRA 2QKIB 2I9LB 4GPVA 4Z5RB 2GY5A 3RWGB 5IJBC 5F8QC 3NPSC 5J57B 2VDQL 3WDHA 4QXTB 4N0YL 1SCRA 4QT6A 1HKLH 1KB5A 2Q7NA 3RVVC 4RRPA 4E9VA 2EJ1A 3DMMB 3KL3A 2DKUA 3QK0A 2IFFH 2R1WB 4LPUA 1Z9SA 2DIEA 3QJOA 1AO7A 4PY8I 4NX0A 4JTOA 2B14A 3GB7A 4P49A 5KJ7E 3HWJA 1CGVA 2ZXQA 1CAVB 4D6SA 3BP6A 4K3UA 3FB7B 1XZ0A 3B8SA 1EAQA 3GZAA 3D3VA 1QHPA 4LCWE 4YMPA 4XBEH 3U11A 4PIZA 1BD2E 1ONQB 3QNZB 4HEME 3QQDB 3EH4B 3OBRA 2OMNA 3QEUA 4IGBD 3VSUA 4F7EB 4JDZA 4N9GA 2YC1B 1EPFA 5DTFA 4K6BA 4Y19D 4LHNA 1YIPA 3D09A 4BHUI 3TPUB 1JFQL 2QT6A 1DYPA 5HYJB 5FP8A 1DSWA 5GS2H 3LF7A 4YWGL 5EZOH 1ZMYA 4OFYD 1X9PA 4BZYA 2XV2A 3FTWA 2AKRB 4C4KO 1VZIA 1NCDH 3SH3A 1QQP3 3R1GH 3PURA 3L4VA 4NWUL 3N44F 4FLRA 4YDJA 1J5HA 1F3DJ 3GZOA 3VFTA 3ZE1F 3H2WA 4E5XA 4JO5A 4EI5C 2E7TA 2P6CA 1DGRA 4CNIB 3AL6A 3OKYA 1OLLA 1D2OA 3GSXA 4L29B 4Y2DC 5GISH 4JFYA 3AREA 2D97A 4YSFA 4GALA 3NCJH 2LTQB 2ZT9C 1QJEA 4Z7QE 3IB4A 1QR1A 3V6BR 5JHAA 1MS1A 2LALA 1OFSA 4OZIF 1S2BA 5KBLA 1BG1A 4JV4A 4M8RA 1V7NL 3GF8A 4L9DA 4BQCA 4BIFA 4FP2A 1IAOB 4KKAC 4PJ9B 2XFXA 2EEXA 4YLCA 2D7TH 1V70A 4E8CA 2AEIT 3GBNH 1NGPH 4LSSL 1XMEB 4PVMA 4YL4A 4B1MA 3TNNA 3QPQC 1PTZA 3SDXF 2OFQA 5AOKA 5LVEA 3ZDZB 5KVFH 5I6XC 1L7TH 5SWZE 3KAAA 3BHBA 5KS9B 2Q8BL 4P4KA 2PO6C 3SE8L 4X7EC 1BD2D 3SH4A 1QATA 1UX6A 1J48A 4N0FB 1A0QH 1L5GA 1LHWA 2C3VB 1AC0A 3QJUB 1OSPL 2JCCB 3MBEA 3UGEA 3OBTA 3MCLL 1U92B 3S0PA 5D2LA 1V6OA 4ZPIA 1WUVA 3GSRA 4NN0A 4Q4IA 5K9JL 1A6ZB 1RMFL 4G9DA 4IJ3C 5IEHB 2IDCA 1M7XA 2J1KA 5J6HA 4MJ6B 4MMYA 4OZIA 5E7FA 1NZRA 3RX7A 2E6PA 4S1SL 3WD5H 1V7NH 5JDSA 4KKCD 3H9HB 2VDPH 3TWIA 1ET5A 1QTYT 3Q13A 1R1A2 3HRZB 4CDWC 1CIUA 2HFTA 3FSVA 1DJXA 3C6SA 4XILA 2CDPA 3FTGB 3BHBB 3FT3A 5KS9A 5HGAA 4LVHC 2PFWA 3BDXA 3B9EA 4JS7A 1G6RB 4LSPL 4WEBH 2RJMA 3O3BB 1CIYA 1XBDA 2NR6A 2MRYA 4F92B 3LKJA 4LIUA 4AEHL 2DRUA 4EJ1C 5LBCA 1H9VA 2EYTB 2JSFA 5AW6B 4GUPB 1GWMA 3HZ3A 3KLLA 3H8UA 2C1PB 4LLVA 1JTPA 4K9EL 5D2LE 2ZXGA 4AW7A 2HJFB 1OCWL 2WVVB 5EOQL 2BRQA 5AUMB 5EZPA 1WA6X 2BP6A 4YLBA 4HLTA 1ADWA 4DPNA 4ZMQA 5D5MF 4PV9B 1UC6A 2XJUA 1ASQA 3V52H 4WRLA 3ZPYA 4M3CB 1QFWI 3ECBB 1IGJA 3GIZH 5SV5A 4HDIB 3W0WE 2CCLA 4HXBL 1U2YA 4ZODA 3ZR6A 4HSCX 5C6PB 5I1CH 4GBXB 3MSPA 1YEKL 3TF7C 4N2HA 5C8JA 3MA9L 3I50L 5GGQH 1S5HA 4I4WB 2R23A 3TPUA 3TONA 4NDMA 4HS6A 1MS4A 3F7RA 1YYLH 1ASJ3 4PTTB 1P7QD 3NJLA 1JPTH 2XUWA 4IOIA 3D82A 1KGUA 2K0GA 5IJCC 3Q6GL 1J83A 1AR81 1KCSL 4W6XB 1EFQA 4KQ7A 2ZXBA 4U3HA 4K3JH 2D7MA 4YFEA 2UZIH 1H15A 5GGTA 5JW4M 2GAUA 4P59L 3BWUF 4Q27A 1I1FA 3BT2L 3KHQA 2HFGL 4OD3L 4OHXA 3I75B 3MROB 3N06B 4KNCA 4XZUB 4M5TA 3K2UH 3RGHA 4QX5A 4B6ZA 1WLTA 2YBRA 4Z1VA 3GLZA 3EO9H 4NO5B 4FFWD 1AKJB 2Q2EB 4AUYA 1KTCA 1FPTL 1RUE1 3AQZA 5TDNB 5JNYA 2RHPA 3HPJA 2P80D 4QDSA 1I3GH 5GZND 3J8F3 3RQ0A 4H7LA 5FDBA 4DKTA 2BFVH 3NL1A 3MA9H 4M4PA 1NOLA 5F7EH 4ZXBB 3VBFB 1JN6A 1OQDA 4XW3A 1TZIB 5ICZA 4KVNH 3O2VL 3R4RA 2JEMA 3ZR5A 3V0AB 4U6XA 2Y36L 4GKNB 1L3JA 5CSBA 3IT8A 4R97B 3CK0H 4WDIA 1MG3C 4HOXA 4GD4A 1C5HA 1FGNL 5BW7A 4TSVA 2IUWA 2VN3A 2VN4A 1DBJH 4H8VA 2UZIL 5D7JA 3IJHA 4ZDHA 1UKGA 3CVDA 1R3HA 4MAUL 2D4FA 2KZWA 4MRBA 1YRZA 3N40F 2WZ8A 2DQDH 4Z3HA 1CFNA 2NMOA 5ANME 3FU0A 2CDEB 2ZA9A 2R69H 5DHMC 3RRDA 3TV3L 1EDYA 1W9YA 2NTFA 2CA4A 5TFSL 1OXCA 2NDGA 1LE9A 3N04A 4P2OB 1OQEA 3L9YA 1ZS8A 3DHPA 2AI0H 3HRPA 4XCEB 2FLRT 3I3DA 5JHLH 1W6PA 1TEIA 5FO2A 3D08A 2AEQH 3W59A 3V0WH 4MJIB 3ZYZA 4HOOA 1XIWA 2F58L 1RUC1 3FFZA 2B77A 3DUIA 1Q94A 1RV6X 2YARA 4X9IA 3ILPB 3OJBA 1RJLB 3BP7B 4ZNEA 2I24N 2W9XA 1NCAL 2O6CA 3GO1L 5D7LD 1U3HA 2PF6A 1KCUL 4CCMA 4DNYA 4F58H 1HYRC 2VAJA 2ZX7A 5F7KC 1HRI3 4BCXA 1QO3B 2VZTA 2JELL 1AR73 4A68A 2OQJA 2KQNA 1DBJL 2HWE1 4K8FA 3SCFA 3SDAA 1TTRA 2IH9A 1DTUA 2X4RA 5D6CA 2BFUL 2EIGA 2MTAA 4LHJB 4B3NA 4JZJB 4OHVA 3O9WC 2E9IA 3S3BB 3BESR 1LP9F 3MLXL 4G7VL 1C57A 4Q4X2 2F18A 3H85A 4JPVL 1N18A 3MCYA 4LKCA 1UU6A 2BC4A 3PQYB 3ULUL 7TAAA 4JFOB 4MMXC 1OGTA 2CHHA 3EGXA 7PAZA 1ZCRA 3ZFEB 5HYJD 3FRPG 5FIEA 4AIXA 5FPZA 2X1WL 4L2YA 5ICXA 3V0HA 1DLFH 3LJ3A 3TBDA 4ICWA 2AENA 2YPVH 2WUCH 3VZLA 2GDFA 4U1KB 2F6BA 2DBLL 3UEZA 1QNYA 1XO8A 1UYYA 1YLLA 3FU7A 1AFVH 1QWNA 2F58H 5GS0D 1HHGA 2PLTA 3UJIH 4IU3B 1NLBH 1O8PA 2IMNA 3LV3B 1QFWM 1HCVA 4ABQA 4HPYH 3BODA 5FXXA 2ARJA 3SY0B 1CLOH 4IRSD 5SX4H 4V2CB 1ETB1 4JG5A 1TQSA 3B3QE 3EXUA 2HUEA 1R1CA 3PXJA 2IPUG 1DQML 3EBRA 1E90A 4HU2A 1F86A 4Y2LA 2OMUB 4NJ4A 1AHKA 2JG9C 5IWLA 5BV6A 4JANA 2JDKA 1U8NA 2FYVA 4RX4A 2FZ3A 4PJGE 3IPEA 4L4JA 4CTEA 2FHBA 4LIQH 3WDIA 3QDAA 4A2LA 2WFPA 3T0ED 3MACL 3HT2A 4X6QB 5F8PA 1QBAA 1GZQA 2IH1A 3SYAA 2XOMA 3L95A 3DBSA 2BSSB 1NBCA 3MGOB 4JFUA 3D0AA 2VWEC 1K2DA 2DLGA 1AQKL 3S34H 1S1AA 4ZXBA 4LLOA 4YAQA 1BAFL 3WDWA 1LXMA 5HCBA 3CVHB 1E6OH 1RUOA 4BSJA 4GXUM 3F6IA 4P5KB 4MNQB 5D1XA 5KSAC 5L8LB 4LPTA 4RS5B 3S6PA 3ROLB 2JFCA 3UYRH 2WTRB 4JFQA 1T22B 4AYGA 1FATA 4B53A 4QKNA 2RCSH 4AQEA 3O6FC 5F3HA 4OFVA 2DDQL 1TYJA 2DQEL 1XNTA 1OF2A 2FB4H 1MRFL 3SJVB 3VG9B 1WW5A 3QR2A 2V33A 4HK9A 2E0PA 5C3PA 3PUHA 3BPSA 1XR9B 3WN5B 5GISL 3FUOA 3J4UH 3DGGA 3KBPA 5GJTL 2D7NA 3DTXA 4Q0UA 5JZGC 1IBFA 3FAWA 3WD5A 1JGVL 4OZGA 5E4EC 4DN3H 3RS6A 3OY8A 2BIQA 2BMKB 4PJ8A 4A6YB 4FPLA 4TVPL 4KUCF 1XMWA 4B9GA 2XZAH 2X2JA 4MCYA 3RU8L 1KG0A 3VD3A 4BIOA 4KY1L 5DT1L 1SCSA 4F15B 3GRWH 3G6JA 3TVMA 3WJJA 1YYNA 3QHFH 4KDTC 2QVKA 2EIJB 4DP2X 1FOD2 1WA2X 2GP5A 3QUXC 1UACH 2R23B 1W72L 2DUPA 3ZMNA 2FLBT 3WNJA 1KGCE 2Y0OA 1EPZA 4Z2AA 3V0GA 4WV8A 1ZVNA 4KMQA 1QA9B 1X5FA 1SY6A 5I74C 4WCYL 2AQ3A 3IBEA 2VAAA 4TOYH 1EV12 2B2XL 3L3JB 1DBKH 4MMZA 3LNIA 2H4EA 3BZFA 1E4WH 2IAMA 4BWWA 1ZIBA 3BH9B 2IEPA 3GGWB 1R9FA 3B93A 2YSSB 4Q29A 2OZNA 1MZ5A 5FZOB 4OVEA 4EUPG 1J0KA 2L3BA 3O3AA 4Q6YA 1S9KC 4E42B 1UNBA 2VVEA 5FBZA 4W81A 2YSSA 3BXNB 3C5JA 4XI5D 3EDFA 3RNQA 5J48A 4H0HB 4OR1A 3KYMA 3C6LC 3RWEB 4XZPA 3ETPA 5FFOC 1GXEA 2EDLA 3V5DB 1N3PA 3ROLA 1DGWX 3QXUA 3EJCA 4WGVB 5D2NA 1HCFX 1N2RB 1YYMH 3PTYA 4URTA 1RUKH 3EHBC 3QRLA 4MXVF 5KC5A 1W2KT 1PX4A 3PHOA 3P11L 5DK0A 5GJSL 3FTVA 4U3CA 1GMMA 3WHE0 4LL1A 5DD3L 3PDDA 3VFUA 1FL6B 2X4TB 3WIIL 4FLQA 1UT9A 4K5MA 1R3IL 5G4MA 3I2CL 4PBXA 4A7VA 3TN0B 1DQLH 4MLSA 5KANG 5EJZB 1BFSA 1PD1A 5JZGB 4XMLH 4B27A 3P2TA 2AJYL 3NSDA 3CHSA 3BGMB 4PCTA 2HRLA 2BNQA 1FIGH 1TDQA 3CHOA 1IGIH 2I60L 5CEYA 5B38B 2PTUA 4YM1A 4MD5B 1KGXA 2D5HA 1L6PA 4OKVA 3I50H 4IW3A 2CLRA 1MFDL 1IGCL 4ZK8A 2WO4A 2O4EA 4O02L 2IV9A 2K9FB 4LORA 1QFOA 2CO3A 1HAUA 1KB9J 5JCTA 4HULB 3BCWA 3WFHB 3AZVA 1GZHA 1UCTA 4LSTH 5ICXB 2NR6D 3BB6A 1F13A 1MCHA 1PG7X 1DQ6A 4M6MH 4CAGA 5F7HA 4OJFL 1REIA 2Y6KA 1EAPA 4YJZL 2VDKB 4WTWA 2A5UA 2R063 2VDKH 3QEGH 3DYOA 3JV4A 4YW3A 4P2CG 3RL2A 3WN5C 2NT1A 3NJJA 43C9B 5A33A 1ZPUA 4XF0A 1MW3A 4B3VA 1EGJL 5CEZH 3F85A 3U4AA 3K7UA 5HGBA 4JVWA 1LWRA 2X42A 4WW2A 3FQXA 1WG3A 4WWKA 3G6AB 3T08A 4OI2A 5KUMA 4YZ5A 1S5IH 2NY6D 3MZHA 3RI5F 1MJ8L 2JCCE 4CJ1A 4L9BA 3VNYA 2WOBA 4FG0A 2D3VA 5FPXA 2NQCA 5T1LA 4M3HA 4QGYA 3AG1B 4FQXD 3BIKB 3ZTNL 2W2IA 3CFKA 3GD1C 5AOLA 2VD7A 2RMU1 3DKWA 2QTVA 4LK4A 1SM3H 2DQCH 4U1KA 2EALA 4KVNL 4LSTL 4LBKA 4YGCA 3W37A 1JZJA 2HEYF 5L9DH 3R8BB 5B1CA 1E40A 1E0OB 5CFDA 3IDAA 4Y1TA 3FMGL 4J6RL 3POJA 5GSRB 4YK4B 1YEEH 3PRZA 1OV8A 3Q05A 3TBYA 2WO1A 3BVCA 1UGKA 2E51A 2WNUA 2JD9A 2W9EL 4DKFL 1KPVA 1Z9SB 5C4WA 1TZHA 3KDMB 3QQ4B 4KQ4L 5A32A 4HCFA 3GSNB 4XN2A 1KB5B 2ZGMA 3WFZA 4O51B 2PCXA 2WUBH 3B2PA 4LCCC 5C2UB 4Y1AE 1LQBC 2NMNA 3WQ7A 2FWLB 2I9LA 3V2AR 1QDOA 2BNMA 3TV3H 1NMCB 1N67A 5T5OA 2GU9A 4NC2B 3NABL 2IVFC 4LVEA 4AKQA 4XP1L 3UPRA 1GYUA 4B50A 1UJ3C 2YBKA 2JX9A 3HRZC 5JOXA 4GRWB 1D5MB 3LEXA 3TCTA 5EIIA 1UL9A 4XMIA 3HQRA 1KACB 2A6KB 4GQRA 4GB9A 2RS32 3EDKA 3H3PL 4PD4J 4MVTA 2VLRA 3BZDA 3JQOB 1WBFA 4Q0XH 1O3SA 4YXKL 1VBD2 1P7KA 4B41A 2DICA 5DD1L 3BP4A 4WU5A 1ULVA 3ABMB 3NV3A 2EVFA 2RDSA 3BKML 3IJ7A 1C3HA 2RR3A 4KMTH 3S5ZA 1A9EB 5A2JH 1QU0A 2BY3A 3BEVA 1SFNA 3H9SA 4LLQB 1W3VA 4NN5C 1UWEL 1ULCA 2H0JA 1AIFA 2ZYRA 3T9WA 1I7UB 5KXBA 2OL3A 2CBQA 1M6UA 3G5ZB 2XJKA 3ZIYA 1UENA 2QQWA 4LLQA 4LQFL 4FLHA 2UXTA 2Q87A 5TH2A 4IE5A 1VGKB 5E6YA 4AXOA 4PREB 4QF1B 3AKTA 1TZGH 4LKXA 1OT1A 1N4XH 1RU9L 3KPRB 4MA1C 5D7IB 4ZSOA 5K9QG 3HJEA 1OP3K 3PHQB 3U9PL 2WUCL 4GWMA 3ZT7A 4AGRA 2F9BT 4NBYB 3TJHD 1B3IA 3PABA 5F1KC 3W2DL 2EAKA 1UOVA 1F90H 4DVBB 3RYKA 1I3RA 5F0LB 3DX2A 2ZEZA 3I2FA 2XKUA 4M43H 1UOGA 1ZRDA 2JDHA 1TMF3 4TUOB 1RIVH 1US2A 1O7SA 2EDJA 3WG1A 3HI5L 4U1IA 3WO4C 2E6JA 4Y16A 1DCSA 3VXPA 1V9U3 4M7ZC 1YY8A 1S6NA 4X6BB 1JV2A 5FX3A 5JR2A 1GGIL 3PQYD 1G9EA 2ZUXA 4MOAA 3FN3A 3Q8FA 5FLIA 3IFPB 1RJ7A 2DBJA 4DAGL 2NR6C 1EXUB 1K4CA 4WFED 3TC9A 3MUGB 4ZMTA 4NQSB 4J3OG 3V4VH 4U1GC 2X4PB 3SDCA 3BPOB 1S3RA 2VW6A 4HS3B 4RSVA 4XO8A 5AFBA 2YRBA 3UGHA 5JR1L 1KPVB 2CK2A 4K2UL 2HX9A 3V5HB 1GZPB 3C5XA 4Y4FD 3RI9A 2EYTA 3MW4A 4L3EA 3BVNA 3UTPE 2NY5H 1AZDA 5E2JA 2QQNL 2P24B 5C6TH 2YYOA 4Q8KA 4GP5B 5L36A 3I3MA 1IM9A 4R4ND 3O3BA 4JR9H 4Y5YB 5T5FA 4DKEL 5BO1H 4A7QA 1YFYA 5IVBA 2ZP8A 1BZWA 3MRHB 1Z5HA 1PLGH 2EIZA 2N01B 2YRZA 1AXZA 4K0OA 4WI0A 4LRIC 1S7WB 4NHCH 4AEJA 3CN0A 3LAGA 2F74A 1MCOL 3PWPB 4HOWA 4HAGA 3AVEA 1V00A 5T3ZE 2WXFA 4L1DA 3S2AA 2ZAHA 1GYCA 3L5XL 2KLTA 3O11B 4B8EA 2RE9A 4QOKE 4GZ9A 1DVTA 3S5LA 4HSQA 2YGOA 4N1HB 1PGW2 1PK6A 2ENQA 4MJ6A 4MMYB 4WWKB 3VXSE 3O6FD 2DI7A 1XSJA 2DQUL 2XJLA 1HXYB 3PP4L 3JYBA 4W4ZA 4F3JA 4BHPA 2ZGLA 3FUNA 3PVNA 1PMYA 1R3JB 5DT1H 1S0GA 5DMJB 2R071 4YPGA 4R83A 1JNNH 3AU1A 4N22A 2WBWB 1BCXA 3B1TA 3AC0A 2GPZA 2MQ0A 1KTRL 1BVZA 2UZYA 3FPYA 5DDHA 5IQOA 4HETA 3ZE1B 1J5OH 5BOZG 3I7DA 1NGPL 3HS8A 1J1XH 3L7EB 4X8JB 4ZQKA 4ATTA 3QCWA 4WM8A 1BYNA 3V55A 4XPGL 2DFBA 2O26U 3T09A 1QFWH 3J8F7 3LIZH 4PI0A 3TVMD 1E5IA 3REWA 4XB8A 4QXGL 2J6WA 4M1GL 3HJRA 2XQRA 4TZDA 4IBTA 4N6RB 4HZLB 2RR11 4Q0PA 4J4PD 3EJTA 2XGXA 5BRZE 1EUUA 3T3PB 1IGFH 4PG2A 1OUXA 4MSWB 3X13A 4BUGA 2VDLB 3TJEL 4IEVA 4RDBA 2RMU2 3I2OA 1BMZA 2FCBA 5CJ5A 1HHIB 2DV9A 2Z92B 1DUYB 4H0GA 5HYSA 2JXAA 3LEMA 1OGAA 1T1YB 2W0FA 4W9JC 1L0PA 5E8EB 2P8LB 1J0ZA 3V0JA 1MCKA 4AFBA 3HNTL 2WHVA 4AGVA 1N5AA 4R8WL 4OFYA 1HINH 5E5UB 4B5EA 3BLBA 1MRDL 1V55B 5F6LB 4OLYH 2X0VA 4MA7H 1T1WB 2ODIA 1QFUL 2OSXA 3V64A 5KXCA 4UT7H 2Y3NA 5AVZB 4BRJA 1ST8A 5E70A 2ZG1A 3SGKA 3OF6A 2IQAA 3O3DB 1CE1L 2F1AA 1H2LA 5I5JA 1HB1A 3ALXA 4M6NH 1A7PL 1ONQA 3LTVA 4XJZA 3WHUA 4CUAA 5KWRA 4HKXB 2LRPA 2GALA 2ATPB 1Q56A 4FFVD 1D7DA 5FW8A 1OOPB 5D4JA 1KTKE 2OJEA 4WJ5B 2IZWA 4G6KL 5HDRA 5AAWA 1K4DA 4IEOA 1A6TB 1MWAA 1H3PH 4MQXD 1TTFA 4MX3A 1NKOA 3U25A 2W8CA 3HI6H 2PCYA 3HMXH 3LH2H 1UOWA 4RMSA 3U2SA 4QOKD 2OPCA 1VBD3 3RX8A 3SJVD 4LFHD 3EYPA 4AVHA 4KJYB 3HEIA 1C5BH 3LA3A 2C5DA 3SE9H 4Z5RA 1B0WA 3DJZA 1MIML 5FYLL 5FOBB 3DX6B 4P2YA 3DX7A 4DGIH 4DP9X 1NE4A 4BZ1A 2F6AA 4P57B 5JXJA 5C09E 4AXWB 5EFUA 3O4LA 3QUYD 5DRNA 1FHGA 2QZ5A 3QQ9C 1HX6A 1C7TA 4IERA 4OLUL 3L4CA 1SQ2N 1JERA 2XLGA 4HPKA 3CPLB 3SMHA 5AZEH 4NCDA 3APFA 3LPFA 4G1MA 4EJRA 1BEYL 4BA0A 4TRPL 5DA4A 1OD7A 1QX1A 2NLJB 3BYTA 4JDZB 5JIDA 2NNAB 2Z4QB 3VFPA 3VH8A 4F8PA 3S3PA 3N6YA 3BGFC 3QQDA 4LCUB 2XLFA 1U5ZA 2OX5B 3DUSA 3HIZA 4GMTL 4UT6H 4C4BA 4QKBA 4P2RD 4GY4A 5L88L 5JA8B 1DUYA 5HYSB 3NP4A 5J6GA 1TQUA 2FDJA 5L9BA 3A67L 3QZWB 5BXXA 1IAKA 3GI9L 4DINB 1RP8A 4EO5A 4IQHA 4NPYB 5E1QA 2ED9A 2DEYX 3QFGA 4P9WA 1F6AA 4UIKL 1KIQA 1UY4A 4KTEL 2O6FA 2EDFA 4HAFA 3T71A 1WIPA 1H4HA 3G04B 3M7OA 1H6XA 1IGMH 4KY2A 1Q8VA 2MEV3 3WS3A 1P4LA 3LEGA 4WM8B 3U30C 5LHDA 1S7UA 2WTRA 4JFQB 5T3ZL 3EOTL 2YZ8A 4Z76A 1D2PA 1ZHKA 2Y4SA 4RFNC 1JS9A 1AZCA 3AS3A 1SM3L 2DQCL 3MRBB 1QYGH 3DUUA 3P3YA 3DI2B 4DVRH 3WE6B 3QRFM 4UQ3A 5L9DL 4NKIH 4GSRA 4BXSV 2D43A 4XP5H 2G3MA 2JKRM 3SKJL 5M95B 1BBT1 1MPAL 3QXWA 4TSCH 3LB9A 1H8LA 1KJVB 4QRSA 4QRPA 1GZQB 3K6OA 4XOEA 4PJGB 5HVHC 5KJRL 4LP8A 3LD8B 3OZ9L 2EDYA 3NESA 1RK0A 4C8XA 1XXNA 1ZTXL 4DNLA 1JL8A 4XFBA 4PJ5B 2XIIA 3ZKYA 4OZHE 1PZ8A 2H3KA 5EBLA 1CAWB 4O9HL 3ULVD 4OIFA 4XETA 1G7QB 3OKMA 3NEOA 3N9PA 1DVZA 2DYSB 3LKPA 1S7TA 5AW9B 3OGSA 3QO1B 2W81C 1KDMA 5FZBA 3LAFA 1TFPA 2GTQA 4HK8A 4COVA 2VBBA 5JIHA 3IDEA 4OFGA 4IU3A 3SBWC 4NZRH 3MIBA 4GQQA 5IHUH 3DROA 5FS5A 1A14H 5EBLB 4Y5YA 1AY1H 5C0BA 1DVXA 3SBRA 2NPLX 4LF3B 1G5AA 1MI5B 4MDIB 3BKZA 1DJHA 5C3RA 1RP9A 1L9TA 4LO5B 2YPDA 1QJU3 3M45A 3LD8A 3LHPH 1QJU1 1H9WA 2YLKA 3T4AA 1FDLL 4IBZA 4XP5L 5LBEA 1OGTB 4ORGA 1UZ8A 2ZCZA 3BSHA 4TUJB 5JUEL 3VX1A 1S2EA 1O3QA 2HWD3 1TFHA 3MAWA 2UY6B 1AGCA 3WMQA 1E9PA 1AXKA 4CCCA 3WKYA 1FFNA 2Y6SC 3BVXA 1O5PA 3D85D 1BXAA 1JE6A 2BNUB 1G1OA 3U2JA 5FDWA 1A02N 1NUGA 4N2MA 3VQLA 5JIPA 4DFSA 2IALB 4LQFH 3AY4A 2UY7A 4YHLL 3ECVA 5DJXA 1AZBA 1CFMA 1P4LB 2HP4A 3C2AH 3FAXA 1QO3A 4WI2A 4L8BA 5ID1B 5JQ6H 3E5QA 4RFRB 4RQPB 1FNHA 4LHUA 5GHWH 2VITA 4UBGA 4B1LA 3FPXA 5LGJA 1WP6A 3ZIWA 3Q9QA 1QHOA 2NSQA 1LO5A 3FQUB 4X6CE 2EXHA 4WWID 4KL1A 5GS1B 3E6FA 4Y9FA 3QUZD 4ZZFA 1R092 3QA3B 1Z7S1 3FO9A 3QIBC 4H0IA 2PQQA 1U0QA 5MEND 4XOCA 3KPRA 4KPHH 4A42A 2UX6A 3BUTA 5F1NA 1AG0A 3L4YA 2BP0A 2RAMA 4RA0C 4F7CA 3H1MA 1QABA 4QGTA 1KCVL 2K70A 2ZYSA 1ODNA 4Q26A 4NQVA 3O0LA 1QNZH 1OTSD 3KXFE 3DIFA 3MKGA 2YRPA 1W8HA 4BZ2L 1O6SA 1DQDH 1MDTA 1WWAX 2X88A 1YCSA 3RVWC 2BV4A 5C8CA 1CCZA 1HXMA 5HXVA 1ZBA1 3TWYA 4PTUB 4S11A 4R9HA 2HLEA 1HXS1 4Y2DD 5E2WL 2YXWA 3MBED 5H37A 5I6NA 2JI2A 4G6AD 3SO3B 4APXA 1NFDE 2YQGA 3C2AL 4PRHE 4S10A 4UILH 2J8UF 5IV2A 1SG3A 2VY0A 2YD0A 5IVXA 3KBEA 1GUIA 2RD0A 2OQ6A 1W99A 3AMNA 1BVKA 3I6KB 4OQ9A 1W8FA 1G87A 1VBE2 1FYTB 4NHCL 2H6PA 3OOXA 4H20L 2DU0A 2EDKA 2XN9E 5IMLB 1JHLL 3L81A 5D6DC 2DCZA 3EYOA 3HG0A 2WPGA 5HXMA 2DH3A 2QQKH 3KW7A 4MGYE 2N56A 1WZLA 3TNMB 1ERNA 3HAGA 5A7SA 1QY4A 4PW3A 3U4XA 4UQ2B 5I0TA 2XX0A 3GSNA 2FE0A 4OJEH 1JUFB 2G4EA 2D6NA 5FZCA 2F54E 1KN2L 1SY6L 4HJEA 1Y7BA 3OPWA 4CCEA 4KHXH 3TASA 2Z64C 4XDOA 2C7UA 3TEYA 4U1SA 4HV8B 4NGHH 1SN2A 2BCMA 4PWIA 3T0VA 4JO2H 2IOOA 5E6HA 5HV0A 1J9CT 3S3SA 3ME2A 2QQLL 1BIHA 3B34A 1HHHB 2H3NB 3D3VE 3DJRA 4G8EA 4QPIC 4W6XA 2VZVA 4Z1PA 5A7NA 3E38A 4F8NA 1JYCA 1SBEA 1H9PA 5T8IA 2G9GA 2X87A 1LO0H 1SJVA 2DQJH 4L8DB 4HIXL 2WLJA 5HJBA 2HEWF 3AP9A 5GS1C 1Q8MA 2GQHA 4KTDH 1EAH1 4ZMAT 1JF1B 4ZMLA 4LBMA 1UOKA 2WKOF 4JKWA 3QPXH 3VXUE 4YC2B 3TZVD 5E88A 4KKRA 2FJSA 3AG3B 1FI8C 2WXJA 1IAMA 1NLDH 2XV3A 1LEKA 1ZLUK 2VTXA 5CINL 4LA3A 2WYTA 3CC5A 1JVOA 4O02B 2B5HA 3O1RA 4GKSA 4I0KA 1AGBA 1Z5LB 3FQYA 4JZNB 1GKEA 4R8WH 5BZWB 4DESA 4OCTA 3ZN5A 1RUNA 1VAMA 1W6LA 3SH5A 4PS7A 2B0SH 1AVBA 2X29A 3USUA 1XBFA 4M4RA 4V1DD 1IC5L 3ERXA 1U5IA 3JD72 3D51A 1NM9A 4JRFA 5JOFB 3ULSA 1CESA 4WF7A 3W39A 2M2DA 1HILA 2F5AH 2CDOA 2J6EH 4HT1L 1UA6L 3MI8A 4O61A 1NX9A 4HIXH 3B3IA 1DBNA 1MLCA 2HH9A 4DHLA 2QQQA 1DHKA 3PL6C 4QPGC 1XV8A 3H8XA 4DP7X 1RXLA 1NA1B 2LGNA 3ZMOA 4N2AA 1J8HD 5DD6B 2NW2B 2W80C 1RUJ2 1XE7A 4R8HA 4QPWA 1BEXA 1VIWB 1MZFA 4XJAA 1I1RA 2ZWZA 5E99H 5DD5L 3G5WA 3UDWA 2A73B 1UIJA 1H3PL 4YG6A 2GEQA 2WMPA 5I1EH 4YW6A 3KPLB 5FGCB 4G8GD 3RURA 4XCYB 1S7SA 3ZFGA 2XQBH 5B39A 1P1ZA 3ELNA 3FTZA 4RHV3 4XBLA 3ZX7A 3RY6A 1RFDL 3KPLA 1V6LA 3H0OA 1CPUA 4PJHE 4Q4X3 1C5BL 5DVPA 4IRSB 3LSEA 4YC2C 1F1GA 1PGRB 3H3KA 4KFZC 1OM3H 1FV3A 4AFDA 4L3EB 5PAZA 1AXTH 3O6FB 5IJKC 4IDJH 2GAZB 1SYVB 4YGVA 4HS3A 1RUH1 2DN7A 3V6FB 1MSPA 4J3SA 1J88A 2YFNA 4MGQA 2QQPA 3DO3A 1WCUA 1MCSA 2XL7A 4JKPL 3HG1D 3PHSA 2ZF8A 3T0EB 2ED6A 1W6OA 4NROA 4C58B 2IXCA 4YDLB 3VLBB 4RFOH 4JL1A 4PF5A 4ILDA 2NNXA 2WXMA 3C6LD 1OP5H 2Y34A 1I7RA 4YW5A 3VJ6A 1TETH 1D2SA 3MEPA 5T1KA 4EI6B 3BD5A 1WZAA 1ZV5A 3AWEA 4FQ1L 3EO0B 3K1KC 4K94L 4OB5H 3HZVB 4KJWD 3AQYA 3UOAB 4XPAH 4EVNB 1KD7A 1OFNA 2DCJA 1RD6A 1TKWB 3KLSA 3I2IA 2IGLA 2XNAA 5T1MB 3H0TB 3SQOH 3ZQWA 4ZOAA 1EEZB 1ZAGA 3ZPOA 3BPLC 2JQAA 4O5LL 4KUZH 3RWDB 3QIWA 3GCWA 3ILRA 2Y24A 1SLIA 2CLZA 3P4LA 4YN3A 3B7RL 4DEQA 1CMOA 4LKXB 4ZSOB 3IF1A 3ZKUA 3VCLB 1QSFA 2O5XH 1O4TA 3QAZB 2W1SA 3VRIB 1C8NA 4RMUA 2GABA 2VDQH 4HOMA 3SPVA 2VDQB 1EHLH 4KAQH 4XF9A 4XBPB 4DGWC 1B4RA 2OL3B 1WUZA 4MUVA 3D07A 5B7FA 5IB2B 4L4VD 1FNEB 3GHBL 4IU2B 5HHXL 5DZVA 3GLEA 3H9SB 3GRWA 2MQ3A 3IGAA 4LXFA 1KG0B 3O6LH 3UZVA 4N0UA 5DS2A 3PWUA 1WAAF 2QMKA 1EZUA 3HN3A 2F1BA 4J4PA 4PJ8B 4A6YA 1WT5C 3TJHC 1LHUA 5EU3B 2HB0A 4J6RH 4HEMA 4B9ZA 4EN3A 1MQTA 1MY5A 3DTXB 3FQTB 3MRDB 1IHMA 5FCSH 5GGVY 3MIDA 2VZOA 1UXZA 3NT0A 1E27B 1EVUA 2ITDB 1T83A 3SQRA 3UACA 4PRIB 1UWXH 2IGFL 5FXWA 1KIRA 4HC1H 3U0TB 3QH7A 1WFIA 3V6ZB 4TLTA 2XZQL 4AGNA 2FSEA 4AQEB 1ORQA 4OZFB 2WXNA 4KUCD 1ZV2A 2IOMA 4GBXC 4NZRL 5INCA 5IJVA 2BDNL 2OL3L 2BOLA 1N5YL 2JIJA 5D2NE 4PS8A 4MA3A 1PCXA 4ALAH 5CBEA 4IBVA 4OLVL 5T1KD 5FO7A 3EJKA 4CCDA 2WV3A 5GRJL 2MCG1 4BV1A 5CZVL 1JOPA 4UOQA 4L5FH 3VTAA 2BSRB 1CFVH 2B46X 4FQIH 2B9UA 3V0EA 5FKPA 2EXSA 3AJ7A 3T0EC 1GZTA 4LO9A 3DETC 3D33A 4GAYB 4P4RA 1LKNA 3RZCD 3CZSA 4GKZA 4X6FB 5F6KA 3PE9A 5EU3A 4KGGA 4WY7H 4ZFZA 3D0SA 3JTTB 1BZQK 1N9PA 1U2HA 2R0WL 5AKSA 3K4AA 4LBQA 3NH7H 4ZPTA 3X14A 3ZY7A 3ROUA 3ZSMA 4QNPF 5I24A 2W46A 5FY7A 3GSNH 4XMKH 2ATKA 1FNFA 4PJXB 4A37A 3WW3A 2LVCA 3VXTA 2X6MA 4N2EA 3WP3A 1S7XB 3QJQB 5FYJH 3L2MA 2ESVE 4HC1L 1BLIA 5IB1A 2HBTA 1RJZA 4D9RE 2D31B 5FKCA 4L9LA 4GMSL 1F58L 3NV4A 3QNXB 3R06A 3WXWL 2HWF1 4S2SA 1NPNA 1T4KA 1BW8A 5I8KL 3URFA 3FQXB 1TZGL 2GT9A 2KPWA 2OXHB 1KV7A 5DJYA 3VGFA 3QUHA 3HUJE 4POYA 3S7EA 4P23A 3WNPA 4D0BA 2KQMA 4YSAA 2KT6A 1BVLB 2WLIA 4H5SA 5EN2A 1P6FA 1ZNPA 2FQFA 2Q20A 4IEFB 5HP5A 5IMOB 3FJTA 1HJCA 5I0YA 3PDQA 3T4HB 3N85L 1NCQC 1LO4H 3NIDF 1G7JA 4X4KA 1FCCA 4AK1A 4HD5A 3LRGA 3FSAA 2GNBA 1JWUB 5F70A 4BGDA 1XDTT 3D85A 3FFCB 1SQMA 4NP4L 4ZMNA 3FB8B 2B15A 4BQWA 2A9MH 1KGYA 2ZXAA 2R4SH 4U3SB 3VVVA 1UM4H 3OBAA 3ZIXA 1WZ1H 3SDDD 2QVTA 1WEJL 1H9DA 2NPIA 2BNUA 5IK3B 2H0VA 3GS4A 2WXKA 4FJZA 3VM5A 4DJMA 3LE0A 3SB3A 3R4DB 1PGL1 4LLYA 1HN1A 3H4FA 4C83B 2BBVA 4YWGH 4AEHH 1GJWA 4K23L 3OGRA 2DJ4A 3RL1B 3Q5TA 3U9UA 3WJMB 1MVFA 1WWWX 2X05A 4KTYA 2FECL 1SN0A 4ISRA 3WQBA 1LOEA 1KF9B 2V7NB 4NJAH 4OAWA 2GC3A 3ARWA 3DOHA 5CN1A 1X5AA 3CJIA 2BNQD 2QVIA 4CRPA 1I8LC 4DKEH 1MCBA 3H56A 2BZDA 4RGOH 1EJFA 1I3VA 4QHMA 4ABUA 2GH2A 1EANA 2JJTC 3DV4B 4NFDA 4P9YA 3MLUH 1K8DB 1R3KB 2OR9H 3PU3A 4FULA 1VIWA 2CALA 1I53A 2BWIA 4U0QB 4YDVA 4DFHA 1K5WA 2YBPA 2ICWI 3U6RB 4AYFB 5KHJA 1J8RA 1XB3A 3FBQA 4U05A 1CPNA 4HIJA 4WHDA 3ARZA 2R1BA 1NJ9A 4ZUTB 4AM0Q 1TU2A 5HPOA 5TE4H 4NPJA 5LWYH 5HI5D 1R081 3IZOA 4P08A 2X1PA 4U6XB 3PP4H 4G9FB 3DJTA 1NGWB 5CM1A 5I18L 5C0NC 4CBPA 2XA8H 4LT7A 3FFDB 2OJZL 1CQYA 2WIIA 5I75C 1YJLA 4CPBD 2XVLA 2VMDA 4HEPG 2ZTBA 4PB9L 3VG0H 2VQAA 4GMP1 1SPPB 1NSNH 1UUSA 3B2UC 4GO9A 4QJ4B 4CDQA 1O7DE 2VLRE 4HZFA 1DEEB 4IGOA 3LS5H 2ADYA 5D7LA 5FWQA 1EXGA 2Z3FA 4AGMA 4BCYA 5FZHA 4L97A 2JQZA 1X6LA 2WXIA 1FV1A 1ZHNB 1FFOB 5CJQH 4LSVH 1PYWB 4LBNA 2ICWB 3V4PB 3VXOB 4D2NA 3A0NA 3V4PH 3FH7A 1IZJA 1P5UC 3QWQB 3WLBA 4ZFOL 2DQ6A 4M7JH 4GG6A 4R26L 3OAWA 4ANUA 2VCBA 3BMVA 3VKLA 4CSWA 3V10A 4NPYA 4WFHE 4TTGA 4YSUA 3RDTB 2EUWA 2Z35B 4PWEA 3A0KA 4AOFA 4M3CF 1TJHH 5JHDE 3MNDA 2AJSL 5CEZE 3A47A 5LDUA 1SRDA 2BVOA 4GUQA 1ILSA 5DHVA 5LWYL 1F2XK 1TQBC 2QGCA 4MXWA 4ORFA 1LP9A 4NUJB 1TPXC 2GITB 5E6ZA 4ZXKA 4FQ2H 4GEJA 3ZSTA 1INDL 2WNVC 1KJRA 1G9HA 4PYGA 5L2JA 5E8OB 5T5NG 2GITA 2CKBH 2GZWA 4W9ZA 2IXQA 3KM1A 3OJDA 4QRBA 4AI2A 3M88A 3NMBA 2D0GA 4YVSB 3IDGA 2J6EL 4KI1A 5MEPB 3VDDA 2ARJQ 3MJWA 5IR1B 2D9QB 3IETB 4MRCA 4AGPA 5DZFA 1SEBB 4PJXE 1LHVA 3GCXA 2VZSA 1HH6B 4ZOCA 4NO4A 4BZ1L 3DX7B 1OQXA 2DIJA 2LR4A 2P4EA 4Q5OA 3I97A 2EH7H 3M7AA 1ZZ6A 4EWDA 4C56B 1QEXA 5DD5H 1YI9A 4WSJA 3BQUA 2YBSA 3HEIB 4KJYA 5D93B 5HGHB 1ZM1A 1UM5L 5GGSB 3LEIA 4HH8A 5EPMB 1UWFA 3MFCA 4PRHD 1UCXA 2XL9A 5I16B 1M1XA 1GVIA 2K78A 3T6WA 3QXDB 1PG7W 3LH2L 3BKJL 2R0LL 1AXTL 2QGDA 2NY0B 4M93C 1INDH 2G4IA 5FP3A 2HVKA 2CGZA 1EEUA 4EPSA 5A6MA 3FONA 4X4YA 1E4XI 2WLMA 4ZO7A 5A2AA 3IMBA 1LEIA 1ZIAA 2IFRA 2QSQA 3M1BB 2RS52 4BQ9A 3QIUD 3BT2H 3AFLA 32C2A 3MOAL 2PCFA 3NOIA 2NZIA 5E8AA 4EDWH 4ODBD 5LDSA 2MHAB 1ZLVH 4FQ1H 4HHWA 1D7BA 5I0DA 4JRXE 4IE7A 4E9KA 3PMEA 4XVSH 2BNRD 3I84A 4OSUL 4G6FD 3AK0A 1R24B 3O45B 4IKIA 1JRHI 3BQUC 5FUCE 3UBXA 2KL6A 1DLFL 2NY1B 3WCYA 4A7SA 3FOMB 4YVWA 2HVBA 4YHKH 4UNTA 3WEAA 4AHXA 1HHIA 4EQVA 5EIVA 5FLHA 2VH5L 2WQXA 3ZVVA 3DPBB 3UO1L 4JN2B 2J5LB 1ETZB 3C87A 2BC4B 2ADFL 1DVUA 1POV1 4XP6H 4E4DX 3ALPA 2PTMA 5F37A 3GYRA 2GI0A 5LGJB 3L1OL 1DJYA 4KAQL 2VITB 5B1KA 5JQHC 1G7IB 3N42F 4PJIE 2EVGA 2YU1A 5F5AA 2VERA 2I07B 1IE4A 3DMMD 1XU2A 1KNOB 3QO0A 5EEXA 2A70A 3QWOA 4ET7A 5CCGE 2UY7B 3ABZA 1WBYA 5APAA 3MW2A 1YZZA 4Y9EA 3J8F1 4N9HA 3O12A 3HFMH 1OTTD 1AP2A 5DDHB 3BOVA 2V6HA 3L45A 1F4XL 1QJY3 1IV8A 3CIQA 3IMSA 2WXHA 1AGCB 1O9VA 1TME1 3BTXA 3FXIC 2OJ1A 3S8GB 1CXIA 1QR1B 5HHOE 3DI3B 1OTUC 1UZ8B 1VFBB 1WSST 5JXAL 1IGTB 2J8HA 4AVCA 4CU9A 5A7EA 3ULVF 1ZJBA 3L7FA 3MRNA 1A78A 2AI0L 4AEIL 5BNOB 4PRPB 3EYSL 3FUQA 2BVEA 3Q6FA 2JKXA 3D39D 1ZS8B 4UM9A 4AH2B 3ISYA 4JHAH 4RMBA 1IOAA 4ZO9A 1WFTA 3VYOA 1JPGB 1RZPA 4FKEA 3AS0A 2NN8A 2YPLE 5ISZB 2ESVB 5IROA 3GSWA 3RAJL 4ASLA 4OZHF 4NHXA 2W0PA 5CZVH 2WYFA 4YEFA 3GSQB 1RUH2 1OE3A 1S7TB 1X5LA 3EJZC 3ZPDA 2WP3T 5IFAH 1A6VH 3HOBA 4OMCA 4DS0A 1H4GA 1VBC2 3NQIA 2EYSB 3ZN6B 1RZKC 43CAA 1EEYB 2WNXA 3V0VA 4QHUA 4A1RA 5IYYA 3L1GA 4YIQA 4DP1X 2YHGA 2ZX8A 4W6YA 3D0VB 5AVQB 3VBRB 4XBEL 3ARDD 6CGTA 1HIML 3MIFA 2VSKB 3NH7L 3D06A 4QRSB 1UKRA 3JQWA 4NHKA 2ZCLH 4I18B 3ARSA 2EICA 2G5RA 1VFMA 1CDHA 2FAUA 3EG9A 3IDJB 4PRDA 4N8MA 4MNHA 4YVUA 1S4CA 3CJXA 4CC1A 3KJ6L 3B7UX 1QEWA 1I1AB 4UIMB 2VB5A 5TDNA 5JNYB 1RI8A 4MQXC 1CX1A 2R8SL 4XBMA 1NBZB 2X7LA 4JAMA 3KT4A 4XBGA 4FC3E 1UYZA 1D4M2 5BZDB 2ZZJA 1ZDSA 3ZN4A 1BVOA 5L4JA 3IVKB 3ZE0B 1I1FB 5FYSA 3PJLA 3FZ3A 4P9IA 5FZIA 3QJFB 4DXRA 4QXVA 2AW2A 4R4XA 5H2BB 2JKLA 4NAJA 2AXJA 2AK4D 2G5BA 1LHOA 1RUG2 4B9KC 4XOAA 3B5GA 4G5AA 4X6CF 1PG7H 2R2CA 3DHJA 2JJ6A 5H9RA 4JQIA 2VAUA 4GWNA 3GBNL 4LSSH 4ZZ8A 1AJ7L 5CCKH 2R4SL 4CCKA 2XVKA 2W1NA 2H0PA 4Y19A 3B01A 2FZ2A 1WEJH 4OUUA 2X89D 3P30H 1OAQL 3RY5A 2J7MA 1TMCB 2DQGL 2E7HA 4KXBA 3UC0L 4F3FA 1FN4A 2DU1A 3BEVB 5IW6A 2ICEA 5BZDA 1JXNA 2QKSA 2G9HB 4XE5B 2CR0A 1U4FA 4LBOA 3KW8A 2R2EA 5CGYC 1LILA 2VLRD 5FXCH 3UYRL 1MVYA 5DEGB 2RCSL 3HG4A 4CW1B 2WNVA 5G04L 2GTWA 2XUMA 2F7IA 2CLZB 1A5FH 5IBUB 1FFTB 2P52A 3EH1A 1DSFH 4HWZA 1MI5E 2VC9A 3LKNA 4UQIM 3IPBA 5FYLD 5D6DA 3IWUA 4KDTA 1BLNA 3OAYK 1CZTA 3O41B 1PJWA 4UU9B 1YMHA 3OTFA 5FY9A 4AFCA 2XBDA 1D5XB 2JMRA 3QJVB 4LAQL 4JPIB 4OIAA 2BW8A 1CZSA 1AI1H 1MAML 4PS4L 2HBUA 1LEMA 5LEJA 4LLMB 5DEZA 2P37A 1QQDB 2IH3A 3BI9X 4QHUB 5FYUA 1J3RA 3O7OA 4QOKB 3RKPA 3RZCB 4QRQB 5TE4L 3KG5A 4LOFA 2BRRL 2HT4C 3ETBJ 4YHML 2XB6C 3LGRA 4FOWA 1YJDL 5HGAB 5HYQA 2ZGTA 3VKNA 2BVQA 3P69A 4RISH 4KV5F 1VACB 3STZB 4KHXL 3JWOL 1DE4B 4RGMC 1XQ4A 2I7SA 2Y06L 1VBE1 3MJ8A 5E9DE 2JICA 5ERWB 2W1QA 2HMIC 3H3UA 4TOYL 4S1RH 1B90A 1A4KA 2RQEA 4B60A 4NC1E 3WEOA 4K71B 2HXAA 3DC0A 2FO4A 4GRMB 4JQVA 4CADA 4QQOA 4XUPA 5C4WC 2FEEI 5D7JD 1FC1A 1HJBC 4X9HA 1M9SA 4Z7WE 2PXYA 4I2XB 4MMXB 1AHWB 3B9VA 5AG8A 4I1RA 5E2UL 3VXSB 2JG8A 4OCSH 1UZVA 4OGZA 1ACZA 1SHXA 3C2UA 5BNPB 3F65A 1DVYA 3CX5K 5KHGA 1CZ8H 4E9TA 3H7LA 3MGTA 5C0CA 4L18A 1T2QH 4Y4FA 2OUJA 5C7XL 3WTUA 2ZONA 2XXGA 2B3IA 2BVPA 1QASA 1AAJA 1G6RH 1E9OA 5K59E 3NIFF 2FT8A 1HKDA 2AERT 3E9UA 3FO0L 4KJWC 3P5BA 4B7KA 2ETEA 3IDYC 2XBO1 4OQ1A 3ZUCA 3MCKB 3WENA 2XBO3 2DYPA 2AQNA 4FCAA 4CYDA 1I31A 4QRRD 1SNRA 3WKMH 1QJU2 3A6OA 2DWSA 1ZHBA 4ES8A 3DPBA 1RZKL 1LTXA 1R3JA 1AGFA 3F7PC 5F9JA 5F9TA 4WNQA 1RK1A 3R0MA 3LSOA 2WZR2 4UAHA 4Y1XA 3QJXA 1KGYE 4N53B 1FZMA 4RD7A 3BZ5A 4AWJC 4AQAA 5BJTA 3EHBD 5A1FA 4IEWA 3R0NA 1OAKH 1QJZA 2N59A 3A23A 1VPOH 4YBLB 3QS2A 4X8PA 1JGLH 1TJMA 2Y07H 2YK1L 5HHMD 1DUZB 1PM4A 4XC3L 4A44A 2C5DC 32C2B 1S7QA 1YNTA 2E7MA 3NG5A 3NFNA 3RVVD 2CJUH 7FABL 3QW9A 3V5KA 1COBA 5IVZB 4D8PB 3H2QA 3O1OA 4G8EB 4WEUD 3HG2A 4KO5A 1HNGA 3ZGIA 2L9LA 3LN9A 4TNGA 4FXKB 1W6MB 1OSEA 3DDGA 3F3HA 3L4ZA 1ENSA 4CDUA 2VMHA 2BQPA 2MFNA 1T7YA 4GI8A 4EZMA 3GMPB 4WZCA 1MQKH 2BVQB 5HBBA 3KJ4B 2APSA 3U0WL 2ZGRA 1URIA 5FXZA 3H7YA 2EH8L 2HUHA 3HNSH 4PIXA 2B4CL 4XTPA 4F15C 1XR8B 4PSPA 1ULGA 3H42L 2DWDA 4K8RC 2GSYA 4LL4A 4DH2A 2W5FA 1A3RH 2NXYC 2ZXDA 3NYKA 1HV0A 3I9GL 2ZYIA 4LGPB 5GGSY 3VBOB 4GS7C 1FL3B 1GIGH 3QDJA 2DVDA 4QM9A 4OI1A 3RKDC 4K1ZA 1BEV3 3ZLIA 4AGGA 4HUUA 1C1EL 3B6SB 2EYRA 4JHVA 3SBQA 2R0ZH 1NBYA 2L8AA 3AITA 3D34A 2GHZA 2NCEA 3ZTNH 1PX8A 1PMJX 3SKOA 5I8OH 1QLRB 3NO8A 2VLLB 3OUIA 4RSUA 1BVKB 1DQQB 1X3DA 3PABB 4X5LA 2IAMB 5CZXC 5AL8A 4M9PA 2VR9A 1A6AB 4GFXA 3VYNA 4A2HA 2IPUK 2M1KA 5EU7E 3M1HA 4N8VA 4OLWL 3EUDA 3C3VA 4NO2B 4BM8A 3OLEA 3P02A 2XYCA 1JXGA 3T3PF 3CHXA 5F7AA 3QUZB 3UIYA 1GGIH 3FLTA 2PXYD 5JHDB 1C08A 2A4EA 5JXEC 2B45X 1VAHA 2WDBA 4V11A 4DEWA 1E4KA 2R7EB 5FAAA 3KMHA 5GGVL 1SFDA 4HJJH 3S57A 3MYJA 4HF5H 2EO7A 2RMU3 5E6RB 4JO3L 4JM2D 5DPNA 3MLTA 1QZNA 3IMMA 2E76C 2VXVL 3ARFC 4L1HA 3AU0A 3RRQA 2WAOA 2W1UA 3L6FB 3QG6A 3ZYBA 9CGTA 4M6AA 3QEHA 4B9FA 2BMKA 5JHBA 2WNEA 2V3DA 1AJKA 1B2YA 1NCQA 5FY8A 4A2UA 1JCKA 3D5OF 4KO6A 1IKFH 2DM3A 1UAIA 5GGRY 3I02A 1CAXB 2ERFA 3CZUB 2E26A 3KHCA 1KEMH 1U95A 4YSOA 3BSZH 4MLIA 5F9AC 3L3DB 2AVFA 2VQ4A 3QUXD 4E9RA 4N2OA 1TMF1 2AJXH 2NQYA 3APDA 2Q8DA 1U8CB 5AKVA 2ODHA 4QMEA 5EZJB 1AE6H 2ZXWB 4QRTB 2B39A 4K9SA 3VA2C 2WZPA 4Y2OB 4G9FA 3VSTA 2AABL 1CLOL 4D9QE 3FCUB 4K20A 1BBJA 3BUPA 4ZRGA 3GXUA 3CHQA 4KMTL 4O65A 5DSCB 1D9KB 3NVQA 5JXEA 4FNTA 4HIJB 3SOTA 4S1QL 2YQ2A 3LPPA 3KDPB 4QHLB 4BBWA 1Q8SA 1HKLL 3O2DA 2RIKA 3DXAE 2JJSA 1B6DA 4K3DH 1CFVL 3K1DA 4GRLD 4PJFF 4D3CH 3L16A 4JM2A 3STBA 1C1FA 4AI9A 4IEFA 4BH9A 1G43A 2PR4L 2UZXA 3ESUF 1UN1A 1JNNL 5F6IC 3NV2A 3C5SB 4ODXA 4QI3A 3ZE2B 1PZSA 1RZ7H 4A6YH 1KULA 4ARYA 1J1XL 4JFFE 2VL5A 2A3TA 1O6UA 1MNNA 5D2NC 1N47A 1US3A 4OULA 2Y7QB 4JRYE 5F6HI 2YLHA 3LDRA 3CH8A 1KTBA 1FORL 2WSPA 3HB3C 2JH2A 1ZANL 2MIZA 5IB1B 1D9KC 2DLEA 1W2UA 4Q52A 4XX1G 3PNRB 1BWWA 3UTSE 1JPGA 4JM2C 3VXTB 3NVCA 3WT3A 5KVFE 5K0UC 4AI7A 4WHTB 2GUOB 4UTAA 4YW7A 4N90E 5K0UB 3QIBD 2ZCHL 4WFGE 4ODWB 3THPA 2EDXA 1EGJA 5CBLA 3LMJL 3NIDB 2VWEE 3VA6A 1KV3A 4IK7A 4XOGA 3S3JA 4AWDA 4LKCB 3TZVB 3LN5B 5DCCA 3HG1B 4F80A 1UURA 5D1ZC 2D44A 1KRIA 4HXCA 2HTLD 3ARFB 3PL6A 3MRBA 1EAPB 2Z1KA 4LAJH 3DX1A 1QKZL 5TPWH 2AZAA 2A4CA 4BH8B 4Z7NF 4OZIE 4JR9L 1QLEL 1R6VA 4Q9QL 4U1LB 4R0LB 2WD0A 5J3HD 1YNKH 1NQDA 1SHMA 1B35C 3LNEA 1MEC2 5IFHH 3ZKSD 1WAPA 5IK5A 2P5WD 4TL4A 4Y1UA 5MHSE 3U0TA 1QWHA 4Q2ZB 3FMGA 4R90H 2R1YB 5A40E 1H2KA 3WG4A 1X8MA 4HXAL 1OSPH 2K3HA 2Q7AA 1SDWA 2ZEXA 4EROA 3CFDA 3CFTA 3AZXA 1GKBA 3OQ3B 2C1FA 2Y7QA 5AL0A 3OGGA 1QSZA 3QNFA 1OWWA 3NFPA 3VI3E 4NLHA 2XJQA 4XO5A 1IEAA 2EDEA 4LKSA 4XPTH 2XPYA 4HUWA 1D2QA 1X5ZA 5I23A 3BKCH 4OF6A 2UZXB 4GAYA 4PRAA 4XNAA 1U9KA 2CQVA 1MFCL 1TQTA