2WN3A

Crystal structure of discoidin i from dictyostelium discoideum in complex with the disaccharide galnac beta 1-3 galactose, at 1.6 a resolution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 60
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn3A01
4TXWA 2VMDA 5CYYA 4GWIA 3MUY1 5G04L 1JZ7A 3IDAA 1PMJX 3UETA 2WABA 2JD9A 2W92A 2VZQA 3C7FA 4GZ9A 1NKGA 2VZVA 5F7UA 3HN3A 1JHJA 3T2OA 4ZZ8A 4OMDA 4D0QA 2RVAA 1UXZA 1K12A 2W46A 2WBKA 4UI9L 2VZOA 4QDRA 1CX1A 3I3EA 3K46A 3VDAA 4ARXA 3ETPA 1UMIA 4QAWA 4L0PA 1JZ8A 4AG4A 1UY4A 3I97A 2JDAA 4QX3A 3I2FA 2OKXA 4BK5A 1GQPA 3SKJE 2J1VA 1US2A 4CUCA 3VD9A 1JYNA 1W9WA 3VD5A 5IHRA 2YB7A 4HG6B 3T09A 1XPWA 2J1RA 3C7OA 4AAXA 1JU4A 2BGOA 5JXIA 4MGQA 3VD7A 3P6BA 3I3BA 1O59A 4JKMA 3EYPA 1UZ0A 3DYPA 2VC9A 3WF1A 2LS6A 5IFTA 2VOTA 4ET7A 2BBAA 3LPGA 3BN6A 3ECQA 3WNOA 2E32A 2W1SA 4CU8A 4W4ZA 2VZSA 3T0DA 2QBXA 4P5YA 2V5DA 3W5NA 5IYYA 1W0NA 2WAAA 1J83A 2BERA 5LA2A 1NAEA 3J7HA 3WF4A 4A3ZA 4W8JA 3CZUA 4DUXA 2CDOA 3VDCA 4W50A 4Q56A 1H6XA 3EB7A 1D7PM 2J1AA 1PX3A 1GNYA 3P1IA 3A23A 3C7GA 2ZEZA 1I5PA 2WAOA 3JXSA 1GOHA 2WN2A 2B9VA 2EIEA 5HXMA 5DQ0A 1F4HA 1JI6A 4KI5M 3IIIA 4XVHA 4ARYA 3I2HA 1TG7A 3K4DA 4JHZA 3A22A 5A1AA 1OH4A 4LPLA 3WSOA 4QX1A 5IJRA 2J7MA 1UYYA 3FN9A 2W1UA 2XQXA 4LQRA 1DP0A 1J84A 4MADA 1PX4A 3GM8A 3FHQA 3A7QA 4OZOA 3WNPA 3OEAA 3OBAA 2WO2A 1NUKA 3ABZA 3CKHA 1W8NA 1XC6A 3AC0A 3WF0A 2WO3A 2BGPA 2QQJA 1CZSA 2ZEWA 2Y6KA 4DEVA 5JMOA 1TVGA 2QQIA 2YFUA 1EUUA 5JXJA 3IAPA 2VQTA 1UWWA 2X10A 2ORZA 2X05A 2VL4A 1O8PA 2WDBA 3LEGA 4XZUG 5I0DA 2J1UA 4A45A 3W5MA 4PF1A 2VMFA 3K77A 3F2ZA 2CGYA 2RJ2A 4PT6A 3MO4A 1XNTA 2R7EB 2VZTA 1P8JA 1CIYA 3T0BA 1ULPA 3WMPA 2WN3A 1W9TA 3GGLA 2VJXA 3I2GA 4M4RA 3MV11 3UNPA 2WZEA 3WMQA 2B4KA 2L9LA 1UY1A 3LPFA 2V4VA 5EJZB 3WEZA 4RN5A 4XURA 3K4AA 1JYVA 2QQOA 3HNBM 1XNAA 1JZ2A 4TTGA 1O8SA 5JXGA 5G05L 1CZVA 2WQ8A 3FHAA 2QQMA 1W8OA 2W1QA 1JZ4A 2DCKA 4BDVB 4P08A 3GXUA 4MO3M 5IFPA 5JR2A 1UYZA 2VZRA 4CU9A 1JYXA 2E26A 4CVUA 1IQDC 5LCWL 5C71A 1KEXA 4UAPA 2W3JA 5HPOA 3I2JA 2LW8A 4QB2A 2VMEA 1UYXA 4A42A 3T2QA 1NX9A 1ULOA 2Y6LA 3CQOA 4LHSA 4OUEA 3MV01 4KMQA 3OGSA 5EJ1B 3D3AA 4CU6A 3I2IA 4QDSA 3OGRA 2QQKA 2EICA 1R64A 3UESA 5C7GA 1L7QA 2E33A 2W1WA 2VO5A 2CGZA 4QPWA 4JX0A 3OB8A 4PQQA 5DPNA 3E1F1 2RV9A 3K75B 3LQCA 3C7HA 2W47A 2VQUA 2WZ8A 2ID4A 2KD7A 3CDZB 3THCA 2ZXQA 2VCBA 2XOMA 4MGSA 3WNKA 3NQHA 4ZZ5A 2X09A 1DLCA 4DEQA 1EUTA 5C70A 3MUZ1 1US3A 4MOAA 3K4ZA 3FL7A 3T2PA 4CUBA 3DECA 4XUOA 1W99A 3HPNA 4BJ0A 2JKXA 2ZEYA 2JE8A 2VR4A 3ACHA 4XUTA 4GWJA 3DYMA 2WUHA 5FUIA 2ORXA 5JUVA 4A6OA 1L7RA 4DXSA 2CE6A 4JKKA 2J1TA 4XUNA 2QQLA 3VDBA 1UY0A 1GOGA 4M4PA 3LEKA 5CZKA 3HNMA 1GU3A 2EIBA 2W87A 2HYXA 2J1SA 1H6YA 2C9KA 2CDPA 3VD3A 4YPJA 2W94A 1RYYA 2W5FA 2Y6JA 4RYDA 3LE0A 3OEBA 4IUGA 1SG3A 3ACFA 4QX2A 5B4NA 3GDBA 3NNGA 2VCCA 1JU3A 4ZXEA 2Y6GA 4A44A 4BXSV 3SEEA 2J22A 2Y6HA 4DXRA 3U37A 2VZ3A 1CZTA 2C26A 1JZ3A 5DMYA 4QDQA 3OG2A 3T0AA 4DXTA 3PUIA 5EIYB 2Y64A 1OF3A 2E31A 1OT5A 2DDUA 4CUAA 1SHWB 1GUIA 4FI9A 2W95A 3SEPA 3NJXA 3HJRA 3PUHA 1DYOA 1OF4A 5JXHA 3THDA 3NRUA 3CZJA 4LKSA 4QB6A 3C7EA 4DUWA 1HN1A 1K3IA 1LNSA 2YC2A 4DUVA 2W91A 4OMCA 1UMHA 1WKYA 2VCAA 3DYOA 3OGVA 2VMCA 2ZEXA 3I3DA 2XHNA 4A41A 2BZDA 4A4AA 5LA1A 4KWUA 4BK4A 5J1XA 3CIHA 3HNYM 3I2KA 2HLEA 1BHGA 2WYSA 1JZ6A 1UXXX 4ZY9A 2C4XA 4P00B 3WF3A 4E8DA 1UY3A 1JYWA 2Y8KA 2VZPA 4E8CA 3C8XA 1SDDB 2VZ1A 4CU7A 4UOJA 3A21A 1UY2A 1K45A 2YFZA 1KGYA 3IAQA 2EIDA 3LEIA 2V72A 1OD3A 3T08A 3WF2A 3ACGA 3SKVA 4JKLA 2J1EA 1GMMA 2W9XA 1F4AA 4P02B 1GOFA 5B4XA 4Z2AA 3VD4A 2CCVA 4XUPA 3HOBA 2PQSA 2Z4FA 1JZ5A 2XONA 4QX0A 3NJVA 3BGAA 2VZUA 3CMGA 5DN2A 1MPXA 4OYUA 3ACIA 4QB1A 1UX7A 3WNMA 2DCJA 2WO1A 4XUQA 2VTFA 3ZM8A 4D8MA 3WNLA 2YC4A 1W9SA 3MBWA 2QQNA 3WQBA 3HEIA 5LA0A 1PMHX 1WCQA 1YQ2A 2VM9A 2YG0A 1T2XA 3IB3A 3WNNA 1K42A
chains in the Genus database with same CATH superfamily
1TZHA 4PI0A 4QNPF 5CYYA 3U9UA 5FZFA 1GZTA 5B38B 3U83A 1XOYA 4GG6E 5G04L 1JGIA 3SY0A 4R5TA 4DRVA 2DI9A 2VC2L 3NRFA 4QJ4B 4GB32 3GGWA 5DC4B 4NJAL 4MMYA 2UY7A 4HOXA 1ENQA 1SOXA 4LORA 4R7LA 1ZV9A 3AYDA 5CJOL 3AY4A 1TQCB 2EXIA 5A6QA 3UG4A 1BK0A 3WDUA 1NCBH 2CU5A 1G7LB 5E2VH 3IJSB 1MG3C 3CSYB 2H1PH 2WNVB 3BD4A 3HRZC 2JKNA 5SX5K 1JBJA 1PTZA 4UIMA 3FN0H 4ZMTA 5IWFA 4L3CB 1MREH 4PJXB 4BQ1A 1HEZA 3SBPA 5D7LD 1ST8A 4RSUA 2OQJA 3JVGA 2HEWF 3KVPA 4Y0GA 1AXSB 3ZIMA 4JFZH 5FYVA 3SKUD 3L4WA 3NJHA 2H9GA 3BE1L 5D7EA 4PJ8C 1P4IL 3Q2VA 2OYLA 4HPYL 1R1CA 5TGBA 3SBWA 5C0RH 1FH5H 1GNZA 1K5MA 3VD9A 1DZBA 3WHXB 3L3OA 5E6IA 5ERWA 3O2VL 1LK3L 3IDJB 5BV7L 3T6QC 4EKXA 2X88A 2O0OA 1QSVA 1FI8C 3IGAA 1UU4A 5L4FA 1AD9B 3MGAA 4N22A 5GS2H 3VXPA 3KPLB 3MDPA 5LWYL 2CBMA 4JN1L 5E0QA 1G7LA 3B8YA 1SBBA 3X3GL 4G8GB 4JGYC 5KVGL 4PRDB 2OQJB 3BKCL 4H26B 3QEUA 1NZIA 2KT6A 2Y1ZA 3D51A 3WG1A 5GZEA 5FZBA 3W38A 3MRCB 1UL9A 1M9WA 1FIGL 5AFAA 1PLAA 4U6YB 2DAVA 3WF1A 1I1AC 3GSNL 4I2XB 1KACB 3QNYB 4IEOA 4QPIC 4BBWA 5BNXD 5C0IA 1MRCL 2BBAA 4HFWA 3ZDSA 3NTCH 4DERA 1SXNA 3RZCC 4IXLA 4TSCL 5EU3A 2ZS6B 4FOVA 2VH5L 3MRLA 4N2MA 1TJIH 4HKJB 2CTVA 4Q9QH 2CALA 3Q48A 3P0YL 4PVLA 3K71A 1WSST 5KZCD 4W4ZA 4S0TD 1XGZA 2BNQA 4JKPH 4N90D 2Q20A 4MHHI 1I9EA 4WO4A 1KG0A 4LCVA 1FLRL 2R29A 5EC1A 5A7SA 1TQTA 3BAXA 4LSTH 2R063 5C4WC 1LKNA 3SE3C 5IBLC 1GW6A 3ZT5A 1A1OA 5A70A 1W8ZA 3IU3A 1NAEA 4A3ZA 5IP4A 3B2DC 5F1OB 3UPCA 5B4MC 4MNHA 5J6GA 2WYHA 2EE9A 3VGDA 3GM0A 2COVD 4Q56A 4MHHG 3MLXL 4K2UH 2QQUA 2YN3A 4R9BA 3H7LA 4BFEA 3VD0A 3LN5B 4FA8A 4B27A 5HDQL 4QHZA 3NFNA 3CF6E 3P11L 4HZAA 4ZXKA 2PLV2 5AW1B 2YRLA 1RXFA 4RMQA 5JMOC 1YMMD 2ZEZA 4IQHA 2ADIA 3ROLA 2O1QA 1GOHA 1BD2A 5LK5A 3KPRA 1MQKH 4PJIB 1O0VA 3O3UN 1BLNB 1F4HA 3RDTD 3UGUA 3UJQA 2PP9A 4U31A 1XE0A 5C3SA 4JHVA 3V9FA 1WV7T 1LO3H 4HS8L 3TO4A 4R4ND 3QO0B 1ZS2A 3VXRD 2XPZA 2OK0L 4KKRA 4QF1A 1T3FB 5JQIB 2NTFA 3FB6A 1KJVB 1UADC 4IE6A 4GPVA 4KOBA 1TYEB 4Q2ZA 4QGNA 1MFDL 3BLBA 3ZKSD 2M83A 3FN9A 3MFFA 3TNPB 1YN6B 1K8IA 3LS5L 4YW1A 1J18A 3GC3A 5C0FB 3UPRB 3ZYOA 4MAUL 4YG0A 3LKNA 2C0ZA 3NV4A 2EIZA 4PGDA 3VFRA 4D8PB 1MS3A 2P80A 3S37H 1NUFA 4ZMQA 3P69A 3VXUB 3P9LA 4PS3A 4JB9L 4GW4B 1KEGL 5JR7B 4MLIA 5CM1A 2Q1MA 2WO2A 2I5YH 4NRZA 1LO0H 3SH3A 3O3AA 4AHWA 2WO3A 5FWJA 1A7OH 2BSRA 2ZX8A 5FO9B 2H4EA 2I69A 1LOCA 3LZNA 4KXAA 4ZX3A 2PW2B 3O3BA 4NO0A 4OI7A 5DTFA 1W9XA 1VP6A 5IB2B 3OAYK 4V2WA 5A7WA 2YFUA 3DOSA 1D4M3 3AAZA 2XA8H 3RI5K 4GAZA 5FUZH 4CSPA 1EY2A 1AR82 4AEDB 1WCBB 4OM0L 5IVXA 1DQML 5I1AA 5GGRY 4HIEB 3CFKB 4I85A 3ASWA 4N5UA 2IQ9L 2ZMKA 4A45A 1IGTA 1FL6B 4NFBA 2HKAA 1J12A 2VMFA 4PJBA 4XBPB 1GP4A 4FD0A 1HJFA 3H9SB 4HWBA 3LKSB 3RWIB 4DW2L 2RJ2A 2NQ3A 1JWUB 5TH2A 1CFNA 4WHDA 4HUUA 4Z8FL 1CVRA 5E03A 3BPNC 4HANA 3U14A 2OMTA 1WC7B 4B3NA 4NQTA 2YUVA 3VXSE 5ALBL 5A3LA 5CSZA 1VACA 3HQUA 3CBKB 3DVIA 4BKLB 3EYSL 2JVUA 1WZ1H 3L9BA 1E9QA 1T1YB 4K94L 4LESA 3TBYA 1ORQA 5C3PA 2OS2A 3P54A 2E6JA 1QASA 5F5AA 1BW8A 2IAMB 4LPUA 2O61A 5EIVA 5DK3A 2EP6A 2YBRA 2W80C 2G3ZA 2BGCA 5GZCA 3UGGA 4LCUA 3VBUB 2QT6A 1UOLA 3NRPA 4H13C 4HWBL 2Y7QA 5KSAC 1JERA 1RUG1 2BINA 1EEZA 4CP2A 3APNA 1NAMH 1SJHB 5C0BE 4Y9FA 4AQ1A 2QJVA 2VLKE 2CDEA 2VZRA 1KEGH 1U41A 1YMMB 5HGAA 5DRXA 2VBBA 2C1OA 1WA2X 5AZEH 1XQNA 1UZWA 4OFYD 4Q0VA 1XO8A 4P9XA 3HLAA 1T6WA 2MKWA 2Y1VA 1FUNA 5ACZA 1KPUA 3WKNA 3QI9B 5EIIA 5DVNA 5FFGA 2XWEA 1ZZ6A 2Y6LA 4XO8A 3HG0A 4PJDB 1R1ZA 5I19L 1ZGLA 2IXCA 2RS52 2FJHB 2ZGUA 3KH4A 2R4RH 5AYQA 5D7IE 2DS4A 2VUAA 1ZHLB 3ST7A 4DNYA 1MWAL 5K0UC 3UESA 4N0RA 3N42B 5FW6A 3ARDC 2Y36H 1ZT1B 1KPVA 4AQ1B 1NC4B 3HBQA 2MH4A 2BVBA 3UERA 1I3VA 2PYFB 5JHLL 5KHGA 4HPOL 3QK0A 3QH6A 1KCUL 2WL1A 1A7NH 3QORC 1IBBA 4WWKA 2N7GA 4Z8BA 5BO1L 2BU9A 4EIUA 1Q9KA 4KBZA 1EPZA 1KSRA 1L5GB 4Z3TA 2OL3A 1LMIA 3IDGA 3ZFFB 1GP6A 2ID4A 3FU6A 5K9KB 1WW4A 2F7QA 1S7QB 4IGOA 3OV6A 5ALBH 1V7NH 4LSQL 5AVQB 2XL7A 4WNQA 3HE7B 5CBLA 2GSIA 2HB0A 4AI8A 1CFVH 5F32A 3WN6A 5DK2B 4XILA 3FTGB 3JV6B 3F7QA 3T3MF 5C0BA 4LEEA 4LLYB 1WWWX 2YXVA 5EU7C 3H3ZA 1QO3A 3ZTNL 2ALAA 3AW5A 4P5SA 4ABUA 4GH4C 2C1FA 1HILB 2J1XA 3X2QB 4MOAA 4PCKA 4NC0B 4P0DA 1F90L 3PHQB 3ARBA 4IHOB 1ZSDB 3UYJA 4PLOB 1MCNA 3OKLA 1MFAL 1A6UH 2OR8A 3VFVB 4AYFB 1R47A 3MNZA 3UH8A 1YFYA 3BMWA 1GGBH 5F9DC 1UB6B 3QIWD 5IVXF 2WRAA 3CLPA 1CGPA 2PWHA 4CW1B 1HRI2 3NH7H 2AJXL 5FECB 5HYQB 4LRNH 2MMXA 3P4OA 4JY6A 2K0RA 3F58H 5I1DA 1POQA 3IFNL 2GH8A 4KRLB 1DTUA 1GZPA 4XDPA 1M53A 2FHRA 5KHIA 1OP9A 3VDBA 4FKEA 1Z9PA 1GOGA 1W6QA 4MCYB 4B53A 3ZFGC 1OAZL 5K9OA 4HGMA 1RQ5A 1W2NA 2ESVD 2GKIA 4NO2A 1KYOK 4QKNA 5DZOA 2P24A 1BP3B 2GJ6A 5E6SB 2GSIB 3PLYA 3SPIA 5ACLA 5TE7L 1R5WA 2QPEB 3OEBA 3ZDXF 1ERNA 1DGWA 4X7SH 1MFEH 3FT1A 3DXTA 4I13B 1GZCA 1M2OA 1MKFA 2ZWNA 3F7VA 3G6AA 3Q1EA 1LEKA 1XF4B 3SKJH 1AYN1 4XP4H 5F2SA 1KT2A 1HHJB 2GCYB 3CPLB 2ZICA 1PLBA 1HINL 3LS4H 3WKMH 2GBTA 4ICWA 3L3HB 1H3PL 3LIZA 2Y5TB 3V55A 3CSGA 2EEBA 4OZFG 1ZBE2 1AYN3 3WVJA 4UV7H 3PQYA 1GIGH 2ZTBA 3MA9L 1E57A 3ZYGA 4GAYA 2D4DA 3QUMA 3W57A 3KB5A 2PAMA 5C9AB 2R59A 4KMLB 2G9ZA 4SBVA 3POJA 3AMNA 2Q86B 5B39A 1KGXA 2PUQT 5TK4A 3NT0A 3T0AA 2PLV3 4JFYA 4DXTA 3RVXD 4HPKA 2WLLA 2IFWA 5EIYB 3FLPA 1QSFB 4A2DA 1SMVA 2EYTB 3CFIC 3VXNB 5FB8A 3QG7L 4KKBC 5E6IC 4XF3A 1I1FB 3C2AH 1MFUA 3CFUA 1BBDL 1BZOA 2W95A 3C60B 3GMPB 4LSDA 5DQ9B 4FI9A 1SLWA 3FF7A 5GSVB 4OQ1A 5GJTL 4EE2A 1SDWA 2Q7YA 1VLXA 3TYJA 3QJHB 1W0YT 5EEZA 1HXMA 1W91A 2ZJSL 3L3IB 1Q9WA 1UUSA 1WAEA 2DKSA 5KSVB 4V11A 2FDKA 1V6OA 4R7DB 3FK3A 4HUVB 4PPTA 4QD2E 2O5ZL 3PNRB 1YQ5A 4J25A 5BW7C 1GGCH 3FQ4A 3F7KA 3SDAB 1RVF1 1MXGA 4DP8X 3SE4A 1DVFD 2F74A 1A4KA 4NO4A 5KUMA 3AJ7A 1E7UA 4BSWA 4TRPL 4BM7A 3UG5A 1BVZA 5EOTB 3IBEA 4L4VE 4MMZC 4HF5L 3S7EA 2WYSA 3CN3A 2YXWA 4AJVA 1OE1A 4AZ8B 5IWLA 1LGCA 4KPHH 3WDVA 5CFDA 4I0PC 3MXWH 4JPKH 1XGRA 4IBTA 3KMHA 1J0HA 1O3RA 1YDPA 2BEOA 5CILL 2NY4D 2YKKA 2ZX9A 3COOA 3CFKA 3S36H 4BJLA 3C8XA 1BFOA 1JI2A 3ECBB 1U8KB 5EFIB 5A7EA 3QJSB 2OMXB 4LP4A 1CBVH 1PK6C 4JN1H 2UWEF 3BP6B 4A3XA 3G7TA 2G60L 1TZGH 3A47A 3BKCH 5KVGE 5KWYC 1CFNB 4NJ9H 1BG1A 3F7LA 4OBRA 1RJZB 1TJXA 3VDDB 3VWKC 4JFDD 3K2MC 4XPHH 3IMRA 2H2SD 5DRNA 4PJHB 2YGNA 5JIAA 3FO1B 2OR9L 4Y2NA 3KPNB 1N4XH 3SPHA 4B7LA 2ZCZA 5E5MB 4CBZA 3ZL2A 4PDWB 4QPEA 3O5SA 1ZHNA 1BVLB 4P07A 5DVPA 4BCZA 4X98B 2BPA2 3WE1A 5IR1A 3ARGA 1PM4A 4FQZA 1G7IB 2O8OA 4HIXL 4XVUD 3ZL1A 1O7DC 3FF8A 3T3PE 1LOFC 4TLFA 5C97A 1PG7X 3VBHA 2QHRH 4AK3A 1RUAL 2L0DA 5LBGA 2ZCLL 5DURB 1YPZF 3OQ3B 1WMFA 1CFTA 1OVSA 3NACH 2IPTH 1MS8A 5FZKA 1I53A 4TLUA 5D4QA 4KNCA 5C09A 2DVDA 4HCRL 3FCBA 1QRNE 1X8EA 1JN2P 3HC3H 2X4TB 1F97A 1UXLA 2FX8H 4J6RH 4K9EH 5CJ5A 3LA7A 4XJ8A 4XYXA 1OW0C 2XWTB 2AK4D 1U8HA 4UFLA 7FABH 4LSUL 1RUF2 3FT3A 4AGGA 3WFDL 3IBOA 4LLDB 1AJ7L 2DQJH 5JW5A 2F1BA 4GT0A 2QQNA 2VDPH 3O6FC 4KNTA 4Y2LA 5E8DL 4L92A 4MGZE 2WCSA 4RX4A 5E8OB 4RBPH 2YG0A 3L4TA 4PIRF 4Q4W2 3D18B 2JV6A 3A24A 4M1GL 4J2QA 1FNSH 2DV6A 1PZUB 4TXWA 4AQ6A 2HRPL 4MD4A 4W9HC 4XCEB 2XJRA 4GBXB 4PIYA 1OQEA 1S78C 4F8OA 4KKAD 4X6DB 2R2HB 4H8WC 3RWHB 2JECA 2EO1A 3O45B 1BLZA 2EINB 1M42A 3ZN5A 4LP5A 4QRQB 3N44B 5J12B 1ADWA 2CIKB 2H1LM 3HT2A 1MXDA 3KBEA 1QJY2 1IBFA 3HE6A 4Z82A 3MGTA 4XCFH 1FF5A 1MCDA 4UT7H 4NQEB 2X6MA 4WWKB 4OMDA 2DPKA 1UXZA 3FH8A 3M3IA 2XN0A 4GFTB 4PBXA 3GJFA 3JQOB 5I1IH 4FYRA 2ZHNA 1WWCA 3O11A 4XOGA 4FFWC 1U8HB 4QKXB 4XNXL 5GS1C 2BVOB 1UIJA 3U6XS 4NPYA 3B02A 4ARXA 1O7SA 3QNXB 3RWGA 5J1TC 2Z4QA 3R19A 5C0AD 2IGTA 4GY4A 3RGVB 1FIEA 1DDLA 4ZNEA 5J06A 3ZOIA 3OHXC 3IDNB 3S5LB 5KANI 3EDKA 1CD1B 2E5EA 2JDAA 5IW1A 4QX3A 3BALA 2EECA 4H25B 1CDCA 2EE2A 1HH6B 1MCOL 4HS6B 5G4NA 5BRQA 4NQVA 5HPMA 1Y3TA 3MCYA 3BEVB 1KB9K 3HKFA 1YNTA 4HV8B 2Q6WA 3TU6A 4M3KB 4R84A 4F58H 3S8WA 4O00A 3DMMB 4Q6IA 4XOAA 5T3ZE 1IPKA 3RZZA 1DBJH 5L36A 2VMHA 5B1JA 3MLSL 3ESNA 4IOFC 4QO1B 1NLBL 5KANG 2ZABA 1QSFD 2X4SB 3QQDA 3VQMA 1ENRA 1XNDA 3HMXA 3S3SA 3AITA 5T5NG 4OF3A 4B0MM 3CBJB 4RAVA 5JXIA 3CWGA 4MGQA 4XPHL 5TQ2L 1SN0A 1CLVA 3OKDA 5CINL 2XIBA 4K8RC 5F7BA 1YUHB 4FXLA 4U7SA 5C7ZA 2C3VA 2WGXA 4KROC 3EYPA 3KYKH 4QHLB 5L2KB 1AMXA 3KPSE 1MCKA 3M1BB 3DSNA 3TNMA 4YRDA 5C4WB 5EU4A 5FDBA 2ICWA 4H1LA 2X7LA 5FDYA 3D9AL 4NQXA 2EUWA 5F93C 3PJLA 2LS6A 3DJRA 4FJZA 3QZBA 3BTYA 3LQAL 2VOTA 2LVCA 5FDWA 1OCZB 3ILQD 2BFUS 2N0KA 1Z0MA 2RJLA 3RDIA 4YQXL 3WXPA 5IMLA 2XYBA 4CCCA 5GJTH 4UTBL 4P23B 1UQSA 3N41B 3VDDA 4YAQA 1RJZA 2OZ4A 2JWYA 4KJWC 1AD9A 4HOMA 1PSKH 4WEEA 3PAUA 3NBNA 3BCWA 4LF3A 3IWUA 4QOKB 5D2LB 5HDBE 2EDOA 1JS9A 1U8QA 4O02H 1LE9A 3GHBH 4L8BA 1U5ZA 5DAWA 3GEWB 3ARRA 4P5YA 3D0VA 3MLVL 1MHCB 4POZD 1OAXL 3O4OB 3ZN6B 1KIUB 4HJ0C 2O4EA 5DJDB 5IYYA 1TR7A 5DDHA 4LMFA 4PREA 3RY6C 4BH8A 1PIFA 1SQ2N 3PDOA 4XP1H 5I15H 3J7HA 2CJUL 4B9KC 4PRHB 4YPGB 4N4YB 2WMPA 3II1A 2BWQA 5I6MA 2Y22A 2EA7A 1YN7B 2ZZQA 1H6XA 1VHPA 1KNOA 2VR8A 2KHAA 5FCUH 4IGQA 5FMBA 3WS3B 1G9NC 3KPMA 2XNAB 4AXOA 4ALAL 4ECNA 1S9YA 3KJ4C 5HHQA 4KWJA 4ZMPA 4UW3A 4MNGE 1QMUA 3JXSA 3JD71 4UINL 1H8VA 1BREA 1ONQA 1W6OB 4UXAA 1RIHL 4L0ZA 1SBFA 2ZHLA 5DR5L 3DIFB 2OMVB 3VFOB 3FQUB 4XIKA 1DCEA 3QZPA 4WNJA 3SKMA 4D0CB 3VFTB 1UYWL 4I02A 1RU9H 1UGNA 3BKJL 3FUNA 3KXFB 3VXSD 2GI0A 1BXXA 3MODL 3UZEC 2XC8A 2AAVA 4XHJD 2DTML 2EVXA 4AQEB 5IM7A 2BRRL 5AAWA 2WAHA 4OI8A 5EF3A 2J2ZB 4FDWA 5I6XB 3T4VA 5E2UL 4LCUB 5GRVK 1B2WL 1ZZ7A 4QT6A 3GS7A 4YM0A 4F37K 5DDHB 5L6YL 5A2FA 5F6LB 4GKZA 2YIHA 1RIVL 2DBJA 3HI1B 2AAAA 2MNUA 4HYTB 4CVZB 4XN5A 3CUPA 2G9KA 1GGCL 2PTVA 3PWVA 1FCGA 4G1EB 5ICXB 5LAXB 2EVHA 2GJJA 1XC6A 1FJ1B 1N59B 3SJVD 5FBZA 1MZZA 1JGVH 2CUHA 2GK2A 4OZIF 1FT9A 4IEFB 1MS0A 2NSQA 2J6EH 4OULA 4CP9A 4BD4A 2WUBL 4PB0H 1JTPA 3T77A 1JZIA 4QPGC 2X44D 5CN3A 3KXFE 2Q8EA 1U0QA 3ULUD 4YSFA 1XGPA 1BVP1 1S9VB 3DX1A 3BWSA 2DJUA 3IGAB 5FHAH 1X5YA 2FT7A 1DQJA 2B77A 4E9TA 1PY4A 2PXJA 1XF3B 5AW5B 1WW7A 3RL2B 1ODMA 5FS5A 4WNSA 1IGIL 4F9LA 1KITA 3QXUA 1XIWA 2DTWA 2ITCA 4LRNL 5A7PA 2OSXA 2VAAA 3B2VL 4Q14A 1OWWA 2KUTA 4K4KA 4N9GB 2YU1A 3ZYBA 4MNGB 4KOCA 3ARGD 3SISA 2ICWI 2ODIA 5E95B 2SLIA 4MX7A 3DA0A 2YHGA 4PJ5D 1OGPA 4XOEA 2YOAA 1TJMA 5EYYA 1CIYA 1E27B 4I2OA 1T66D 1I1AA 2FBRA 4Q4V1 4PJBF 1MRFH 4JG1L 2PWDA 5KOVC 1TF4A 3ETBJ 3QR1A 1THAA 3MV11 1GJWA 1JXFA 1SRDA 1PVC1 1Q8VA 3LZLA 4PRHE 1WLTA 1A9EA 4EYUA 2FJUB 4MCMA 5DRWB 1DVQA 4I0WB 4E2GA 2ZXCA 5DK2A 3DETD 3U0WL 2QV2A 3GI8H 5LQBL 2AR6A 3MBEA 3BSZL 3PDGA 5IF0B 1MFEL 2ZX5A 5ID0B 4N1EA 4JKNA 4RCAA 1TQWA 3KW8A 5IV2A 3TH4T 2DL2A 3QIBB 2WLIB 3L95A 4XP4L 1CN1A 4P08A 5FMOL 5A3WA 3UJJL 1OLRA 4QOKE 5D2LE 3S37X 4ES8A 4Y16D 3WG3A 1OT2A 1XGPB 5FK9B 3LDRA 1F8VA 5FCUL 4ETQB 1B0GB 2OTWA 3E6DA 3RWNA 2M1KA 2VAAB 4UF0B 3V10A 5H8DA 3FFZA 2ADJA 5GLVA 1BZ8A 1F3RB 3RL2A 2O5YH 5L9DH 3PMEA 1G94A 2XTSA 2WJSA 1HHKB 5GJ6A 2LW8A 1YLLA 1JGVL 1HT6A 4QB2A 1ZHBB 3S96A 1NC4D 1W2AX 2DTYA 1JK8A 3GYRA 3FHIB 2ZX2A 4LHSA 4JQVA 5DVKA 3HAEG 4MJ4A 4F3FA 3AZWA 2DOCA 4BRVA 4Y5YC 3N06B 1FNSL 2Y6TE 3KPSB 5L2KE 5FXWA 3FO9B 3DRTB 3PWPB 4OU3A 5GRWA 2C3HA 5FO8A 2IBZY 1VAKA 2ZSWA 5F0PB 3TJHC 2E33A 4FAHA 1YA5A 1A7PL 1A6AA 3BQVA 3LNHA 1L7IL 4H0IA 3D2UA 3FB5A 4NNYB 4MJ5A 1RUD3 3IKWA 2VT0A 2X4UA 3AY4C 3OKEA 1T7WA 4ZDHB 4Z5RA 3CN1A 3UBXG 1TITA 1BGXL 3WFCH 4XXWA 3ROUA 4HJ1A 2Z5WA 1NINA 1XEUA 4ORZC 4DK6A 3GJEB 2CR6A 1INEL 2XTJB 2D7TH 3DPDA 2ZWLT 4OUUB 3T0VA 3S3JA 1QPPA 3QHFL 2Z4TA 4PJ9C 1IO4C 1UD1A 1FNGA 4LEXH 1SLBA 3QI9A 3CDZB 5CJBA 2DIJA 2PHRA 3URFA 1C5DB 1D6EB 1OY3B 5INCA 2A73A 1ES0A 4UDUB 5IKCB 4AHZA 3G5VA 2WLPA 3N41F 2JNZA 5EEXA 3ABKB 2DM4A 2I07B 1EZVX 3ML8A 4Z95H 1AYN2 3U9UB 4DF9A 3OY8B 1RUKH 4FFYA 4N8VB 1B4LA 3SKJL 3OYWB 5C0EA 2YPVA 4DN3L 1AE6L 4JHBA 4CUBA 2GNBA 3MREB 4Q9RL 1MN4A 4XAWH 1N3OA 1SBSH 3KD4A 4Y4KA 2CR3A 2GAZB 2Z8VC 4PTUB 2Q8AH 4RSVA 3T65A 1QZNA 5F3HA 2PPCA 5SV4A 2PR4L 4APQD 1KYOJ 2DQEH 2A9CA 3E8UL 3QR0A 4QYOA 4WJKB 3B9KA 1G7HB 4AH2A 5HYJD 5DJXA 1FA4A 3OD4A 2JFCA 5L9DL 1S0JA 2J25A 5EHFA 1FL6A 4XC9A 5K9QI 1RUJ2 2VW2A 5DDJ2 4MV2A 4A6OA 5HVFB 1AYM1 2I2SA 5IEHA 2ZX1A 4YGEA 4ZPTA 4X8NA 4ODHH 1I3RB 4OZHE 2R4RL 3JBG1 2L7JA 4YLQT 4Z5RB 5FV2A 4HMZA 2CBQA 4IDLA 1QO3B 2Y06H 3IN9A 4JGZA 1JWUA 2RM22 3SPVB 3AWEA 4CADA 1QFOA 2RS11 4L3CA 2ZOUA 4ZD3H 4G1MA 1E5YA 2H6PA 5DHYA 2N0MA 3QCTL 2KZKA 1KGWA 1UFGA 4ANVA 5A6IA 4BA8A 5IVNA 2APBA 3PU7A 1VMJA 4JDNA 3ZXJA 4LLMA 1MI5A 4QRTB 4MA8H 2FECL 3AROA 1P2CB 2YZ1A 3I75B 5I0WA 4JFEA 5C5UA 4UW5A 1VAVA 1MFCL 1YNLL 2B08A 1ZAGA 3QHFH 4GH7B 4XO4A 1CD0A 1P5VA 2EXTA 3GI9H 3BKYL 4OD3H 3RTQD 2VNRA 3CL1A 5CFCA 2CMRL 4ZMZA 4QNPE 4AI2A 4YVSC 3R7RA 3BPZA 5BPXA 4GXVL 3WDJA 1KBGL 1BWWA 2HWB1 2VQ1A 5JIMA 1L9SA 1IGML 3TPUB 4L99A 5J3UA 4OD1L 2XA8L 1MHHB 4JDVA 3NIFE 5E9DD 4X4YB 4QGMA 4W4OA 4B3EA 4POYA 2HWF1 3ALQA 5EHDA 4G7RB 2VYRE 1BA9A 4NOTA 2JXAA 3BAJA 2RIKA 4HUCA 4PJHE 4QRSB 1OOPB 5JOFA 5IMOA 3HR5A 4J3UA 1ENXA 1FGNL 1PJWA 3DX3A 5FA3A 4HU8A 2VDQB 4AE1A 3SQRA 2ZUUA 3B7SA 2ZGQA 3V0JA 1SHWB 5CEYA 3PWNA 2PYFA 1AC6A 2CGRH 4Q4Y3 5F6KA 1DDHB 2UXGA 2VMIA 1TPXB 2F2HA 4GAJL 2CO7A 2VMJA 2Z7UA 5C0BD 4QRRA 3LDBA 1RJLA 4BUQA 4XPTH 4HALA 3FUDA 5CVRA 1IFGA 1OQOA 2E0PA 1A1OB 1S7RA 5JHDB 4AQSA 2D3JA 4TQEL 3SD5A 1D7FA 5JTWA 5HV4A 4L4VB 4N1CA 3IMNA 1TNMA 1NBZA 4FS0A 3P3SA 1JODA 1ZOXA 1IGFH 3I3DA 4NCC1 4NYLA 3UL4A 5C2UB 1PCSA 2AENA 4MG2A 2NY2D 2QKIA 1X3DA 4K07A 3KCPB 5B7FA 3VGHA 3GTTA 4IEVA 3S4SG 3WSQL 1LK2B 3BZFA 1BQHB 1GWKA 1T5XA 3FMGL 2AVFA 3K74B 3BPNB 3FQRB 4LO8A 4GXFA 3LDKA 1INQA 4HKXA 1NGPH 3TBCA 3CFCL 2FCVA 4FQ4A 3NDYE 2C4FU 1KJ2A 4META 1XEDA 1GZPB 4NUBA 1I9RA 5EWIH 2VVDA 4YHLL 4TLTA 4N53B 1SHWA 4KFZC 4FQJL 1G1CA 4Q0SA 2F0CA 3AU0A 4U1KB 2VN6A 2PTUA 4R8WL 4Y88A 4KDTA 5AW0B 3RU8L 1QATA 3RQ3A 3ZR5A 2KLTA 1UB6A 4F20A 4L9BA 4G43A 1JXDA 1BQLL 3LV3B 5CIPA 5KVFH 3U0PA 1AI1H 1CL7I 1FNLA 4AJ0A 2VKWA 4JY4A 5FMDA 1O6SA 4IIQC 1ILUA 4J3OC 4W9IC 3ZY7A 2NY0B 2NY0C 3OWRA 2EYSB 4U3CA 4CMMA 4E9LA 1GA2A 3X14A 1GMMA 1JZDC 2A6KB 2BJML 3GRWH 1VCBC 3SOBL 4I09A 1Q1JH 2JKRM 3WGUB 4J1XA 3H9ZA 1BEYL 3HB3C 3F7YB 2YEVB 1GKEA 2ZIDA 1TMCB 3CK0H 3HHRB 4AKQA 2ROYA 1O5DT 5I30H 3NJVA 5A3NA 3MV8E 3B56A 1SM3L 1AR83 1BBT1 1OQ1A 2WS91 1MEXH 3F5WA 3B8SA 2NN8A 1V7NL 4LSQH 1TCRB 1Q90A 1DQVA 4M61B 1EV12 4KU7A 5FRAA 3T9WA 3WUWB 2WZ6A 3KDPB 3FSWA 3X13A 2NZ9C 3LNGA 1QJEA 3L3DA 2WZPA 1KXHA 1UGKA 2FO4A 4FNPA 4FG4A 3J2PA 4TYUA 5J57B 4G6JL 4QWNA 3ZDVA 4EZHA 1NC4A 1F00I 3KS0J 3USSA 4NRZB 2HRGA 3HAEB 2RDQA 1SLTA 4P9HC 3CHXA 2A6JB 3WXWH 1G9ML 1R081 1PMHX 2NT1A 3ARGB 3LHAA 4K7PY 2VGDA 1GGIL 4X0KB 4GIOA 3WNNA 5IBLD 3GZAA 1K42A 4ELMF 3PGFL 3ULUH 4J6GA 1CPUA 4FMFA 4NJAH 4MMYB 2YMOA 2V8LA 2AEQL 2UUDH 1G0YR 1OF2A 2AXGA 1BJ8A 4LA3A 4FP3A 3CC5A 2JD9A 3E38A 3H6JA 3NPSC 4XVOA 4GAJH 1F42A 5I5MA 1PY0A 2IC2A 1YEIL 1DO6A 3ZZLA 2VPVA 1NLDL 1RIHH 4X6CF 3RJRA 1HQRB 1MAML 4UTAL 4YZ2A 4JFWA 4HLZH 2UY7B 3QT2A 2NUPA 3LEVH 1TQBC 4P57B 1MREL 2QBWA 2I7SA 2B5IB 2ZCKH 5EO1B 3PVBB 5FAXA 3K91A 4FLQA 4LAQL 2RMU2 3O9WB 1IG3A 1VBD1 4WK2B 1JZJA 1E4HA 4EJ1C 5HGAB 4ZOEA 3D82A 2QZ2A 1T20A 2Y2WA 1SJHA 4MDJB 3C5JA 2PTTA 1IGOA 2EC9U 1KULA 4B8EA 4DNLA 4BK5A 5DYFA 5BS0D 1UWXK 5BV7B 2ETWA 4IBLT 4Z18A 3U4EB 5ABDE 4XAAA 3VBUA 2P3JA 4I3GA 5DGQA 2GIMA 1EIBA 8CGTA 1J5IA 4AC2A 2RE9A 3VRJA 3NV1A 3X1FA 2D3VA 5F0JB 2LFGA 4OJDH 5H2BB 2C1PA 5FZEA 3N4MA 4DKEL 1OE3A 2MSPA 2AJVL 4JFHD 4DGIL 4M1GH 3QIUD 2KM2A 4YDMA 3MX0B 4Z92B 1XB9A 5IAVA 2A6DB 3HZKA 3VD7A 1MWAH 5IVZA 2BIHA 2VDQL 1RGSA 4Y2DD 5A7BA 2R6QA 1WCDJ 4WI0B 1MF2H 3OKYA 3UIZA 2BY1A 1TJGL 4OFPA 2HVKB 4JY5H 2BFGA 3RVTD 1HQ4A 3WJLC 2GTWB 3BH8B 3SD2A 4FQ2H 4BGLA 4NIAA 4MXWA 1IGYA 3ARFA 3ZVVA 1TT6A 3O9WA 5C7XH 4U6YA 2APXA 4M62L 2JE7A 3U0TA 5C9AA 4L48A 1S0FA 4Q0UA 4Y4HB 4BFIA 5JNYB 2IXQB 4JO2H 3GYDA 3UZVA 1FVDB 3EGSB 4BHPA 3NFPA 4XP6L 4O58H 5DO8A 5JORA 1ZLSL 4C56A 3LIHA 1YRKA 2PWEA 5I1HH 1RZGB 4MCZA 1EAOA 3FUFA 1ASJ2 3VFSB 4HGWB 4LEOB 3I9GL 3W5NA 5H4YA 4TLSA 1ULEA 1RIUH 3PP3K 5EOCH 4F1ZA 2IV8A 5DMIL 4YXHL 1MCOH 3ZSSA 4GKOA 4W9ZA 3VFVA 3V4PL 5GS0L 2F8XC 3VWJC 4Z76B 2FJSA 3QS3A 4PRIA 4U1IB 1WWBX 4FRWA 2JWPA 3UAFA 3VXSB 4ZMXA 1JNNH 2APVA 1QTPA 3NSJA 3O6LH 4D69A 5TPWH 1J3RA 4X7FC 3CFBB 1B35C 5DJ0B 3GXPA 2HFTA 3NEOA 4MA3A 3POCA 4PP1D 2YPKB 3TA4D 2R9HC 2GABA 4Z7QB 5L8KB 3MNZB 4FT8A 1NLQA 1R083 2GTWA 2IXHA 4UAOC 3H9SE 3O6KL 4FA7B 1HZKA 3L2MA 3IJ9A 5IW3A 1ID5I 2B9VA 3AZZA 4RA0A 1NE4A 2GJRA 2YGVA 4M3JA 4JRXE 3CXHJ 1IEAA 1IGIH 4K5MA 3DTXB 1QJU1 4J4PD 5IBTH 5L0QC 4HIPA 4FSJA 3VXRB 1DUZB 1MSPA 2A9BA 2FB4H 4PJIF 4NMIA 4UNTA 5FFOC 5FQ0B 4QX1A 1UYYA 3EFFB 2PHWA 2A9AA 1G84A 2WKOF 3B37A 3K6FA 2W1UA 2XWJB 2P34A 2LU5A 3I02A 1T03H 3CXHK 2VLLA 5HDBF 1JGLL 1L0YA 2DEXX 3GM8A 1XR8B 3HI5L 5A3IC 1FE8H 4PW3A 5TSWA 4ABVA 4NKOB 1NC2A 1XDTT 1RHHA 3MUUA 4JZOA 1N47A 4JPIB 4D9RD 3M8OL 4QI3A 3AC0A 3N9GL 4ZO6A 2WVVB 1VRH3 5FZAA 3FQUA 4FYTA 1PO11 2Y3NA 3MLWH 4Z7AA 5JA9A 1PEWA 2RHPA 4P9HH 4WGKA 5F96H 4KL1A 1AGBB 3K5RA 4PCRA 3VXMA 1CXHA 3QXDA 1FVCA 4KZDH 4M6OH 5LBSL 4GRWF 4IBYA 3KLLA 3OAWA 4CTEA 2ZQKA 2A4ZA 3N2JA 4KDWA 1QD0A 2ZNWA 5DQ9A 5I0XA 1E30A 1SLAA 5TDPA 3BPOB 1E4XL 1XSIA 2JDUA 1V3MA 2XCMC 3WLUA 1F5WA 3L81A 5CZRA 4D3CL 3EBRA 3I8TA 3CNKA 4DIQA 2P49B 3BRDA 1RUF1 3F3HA 4LK7A 1IFHH 1E9PA 3GMNB 3AGWA 4YHZL 2P5BA 2RHEA 1GNHA 5FLIA 1G7QB 4HMDA 4HCFA 2BIIA 4AI7A 1YEKH 4TUOB 1FZKA 2JKIS 4HW6A 3ETBF 4PY8J 4XF9A 3MJ9L 1C1FA 5DJDA 5A1FA 2WKOA 1OM3H 4COVA 3JT0A 2GBUA 1T21A 3F7PC 4Z8FH 1FYHB 4AZZA 2F53D 1HB4A 4CC0A 3NKGA 1UU6A 1QJY3 5D1QE 2DQMA 4F57L 1LE9B 2DD8L 2HTKC 5I6PA 5EEUA 4JRYD 1Q9OA 3BAIA 4BA0A 4XNQB 1SXAA 4NN5B 2NY1B 2FECI 2QJDA 3FN0L 1AP2A 4EUPA 4WENB 4NRMA 1K5MB 3BUQA 5LB6A 3OVUB 4U0QB 3E5QA 4B5EA 4W6XA 2GVYA 5GSRA 5F3FA 4BQCA 3L3JA 4JDTL 5FZHA 4U36A 3RI8A 1U8NB 1UYZA 1X7SA 3SN6N 1INDH 3J07A 4XWGH 4A2HA 1MIEL 1E6JH 1N10A 3CSFA 4LPYA 5D1ZI 3WFDH 1AIFB 5INDA 1NT0A 1UC6A 4UV4L 5LEKA 2QDWA 3CVHA 2GH2A 1HXYA 5CFDB 4JFDB 1G7HA 1RH8A 4ZODA 4AH2B 3VTTA 4CGTA 2YDEA 4FI6A 4QY8A 3UBGA 3RX5A 2VXVH 1UYXA 4I2XE 5DT1L 3SGJA 4OUEA 2BWDA 3KR3H 2ZAIA 3Q8EA 3RWDA 3FZUD 4G6KH 2VGLM 3HRPA 4YSAA 4ASKA 1MCBA 1IRAY 4AM0Q 4P46D 4HK8A 1DQLL 4ZFGL 1CICC 2ILLA 2P47B 1ITBB 5GGQL 3CFBA 3S34L 3ETTA 1CX4A 4E4ZA 5D55A 3NP4A 3DX6A 1E4KA 2OMWB 3HS0A 2QVIA 4RWHA 5GJSH 4LHKA 4N8UA 1M9SA 4C57C 3WUDA 4PQQA 3ZPOA 1XF5B 2NY6B 5FZ3A 3AYAA 1JPTL 2YD3A 3NSYA 1W72A 1ZNPA 4LRIC 4HWUA 1A7NL 1CDHA 5I2IA 5JOZA 3G6DL 4JFDA 2QKDA 4MXVE 1ODNA 1PD6A 1KN2H 3KGRA 4NKDA 5GKAC 4NM4L 4ESKA 1VIWB 4P9LA 1L3NA 4EMZA 1A1MA 4Y22A 4HIHB 4PJXE 5DQDH 4P14A 1S9KC 1AGEB 2NDGA 3WCYA 3WZ1A 4XBEH 3QSKB 5M7QA 1W99A 2R8SL 3RURA 2D03H 2OR7A 2PYED 5CLWA 4AVJA 2WT0A 2XHKA 1RUC3 4S11A 3HPJA 4FP2A 3SJVE 2K45A 1CD9B 1PG7L 5J37A 5CZVL 2DLGA 5IZ7A 5I5JA 3AMQA 4AI3A 2BFVH 4WW1A 4OFVA 3FBQA 3HG1E 3KPRB 4GBXA 3QEHB 3HB3D 4NBXB 1UEYA 4PJ8A 4X99B 4YXKH 3ZLQC 1AJKA 1R1A2 5EZJB 4Y20B 2NY4C 4FTBA 2RCSL 1AQMA 4JDEB 4EZLA 4JJOA 3C5SB 4U7KA 1VGKA 2CCWA 1UAIA 2BO0A 4HEPG 4GG6B 3MNDA 3GZEA 2B7DT 3D9AH 5DU7A 3LEKA 4XPFH 1E90A 3W0WB 1RZKC 1A7QL 4UU9B 3LAFA 5EEWA 5ID0A 2CL2A 1WA0X 4IOIA 2EDEA 2CDPA 1EHKB 2VXSH 3EJZC 3HUJE 4YFLF 4XAEA 1UD6A 1P4LA 2VN3A 1KENH 4NHUB 1X9LA 5AWNH 1AF9A 5GISL 4LRIA 3QUYD 5E08H 3OF1A 2AGJH 2OMZB 3SIKA 5KS9F 2EDLA 4AQZA 4W6YA 4R97C 3VW3L 4JDTH 5F7LB 1T03L 4NHLA 1HH9B 1JUFA 5T3XE 4FFZA 2ERJB 3FBMA 3OLDA 3UAEA 3O0XA 1U4EA 4G5AA 1KFAH 1KDJA 3LHPH 3S0PA 2NYYA 5G4OA 1NSNL 2Y6GA 1O5UA 4EN3D 2AYHA 1DJSA 3NCJH 5F3IA 3RZMA 3SE3A 2AXFA 5FO7A 3FO2B 4JG0L 1I8LA 1QW9A 1NMAH 2JK5A 3EO1B 3SPJA 5D4HA 4A1RA 5CINH 2NY6D 5ICUA 5BV7H 3V4PH 5GS0H 2XJQA 1ROWA 3PQYD 3IXAB 3GSXA 1WQVT 5F96L 2AMUA 4QQPA 5JOXA 4IU3B 4JFQB 1RHI2 3ZXKA 5DEFB 3PGFH 3ULUL 3KDMB 4LVEA 1OOPA 1E2ZA 2OMUA 4RA0C 5ESQA 3EYVB 1MWOA 2FIRT 1OF3A 1REDA 1RMU3 4DQOH 3FUQA 2YRPA 5CP3A 3O0WA 1NUGA 5H37H 5CFCB 4NSKB 1HOEA 5JOPE 4ICXA 3CCHB 3SEPA 1T89A 3UYRL 5EU4B 2J5LC 3THPA 4RHV3 5I66B 2E9BA 2JCCF 1RJYB 4LASL 3NMBA 3KV9A 4B0MB 4BLIA 4ZO9A 2PYEE 1MHCA 3BVXA 3HB3B 4M8QA 3QDJE 1ZGLM 4ZU7A 2CHNA 3P2BA 3M17B 4Y5XC 5I8KL 1LCLA 2RR3A 2F19H 3FSAA 4O9GA 4BE3A 3QPXL 3FTSA 2YC2A 3AKQA 3ITQA 4Q89A 1IVTA 2AXFB 5FO7B 3MI8A 4IE4A 4YVWB 1VAMA 1FNFA 4OIAA 2FVNA 4R96B 3BIBX 2JKBA 4XJAA 1VPOH 2BZDA 2Q7AA 3O6FB 4PR5A 4PS7A 1ID2A 4XB8A 5GGUA 1IM3B 4TTDC 5FKCA 4BQ2A 1T22B 1YLBB 3RWFA 5DD0L 4H8PA 5FX3A 4HIJB 5I1CH 1VB9A 1QGLA 5GLZA 2PELA 3VRLF 2ICEA 5DSCA 5A6LA 4UYPA 1W8FA 1M7IA 2XWZA 4X2UA 5DS2A 2OZNA 3EFOB 4GI9A 3VI3B 1UXXX 3FYIB 3RNQA 5JR1L 2LALA 4IQPA 3OKOA 5C9KA 5C92A 3IK2A 2FAUA 4MKMA 3NSDA 3ZXAC 4ADJA 2ZCWA 3NESA 3FQ1A 4NQCA 4CU7A 3I6KA 4P9ML 4FA6A 1FN4A 3QIBD 3VA6A 5DZLA 4YW3A 3UDWC 1RUPH 3FU7B 3FOLB 5KAQG 2C9XA 2ZWYA 3MV9B 1B2YA 3HPLB 2XJVA 1OA3A 4M3CF 4NX0A 1DJXA 2VDQH 5KBFA 4P48A 3CN2A 1S7UA 4FG0A 1CGUA 1CQYA 3V0WH 3T6VA 4EUPG 2OX5A 1IL1B 1E67A 2IOOA 3QRLA 1RVFH 3PUUA 4JZNB 1C1LA 1I6XA 1NA1B 1DBNA 4JAAA 3NAPA 4S2DA 5F7YC 2W8CA 2TSAA 2IEPA 2FATL 3HIFA 4WHTB 5FHBH 4P02B 5AFEA 2P5PA 3QPQC 1PMIA 5JIHA 4GD4A 3EJTA 2Z3FA 4CADB 4JKPL 3CSPA 5I1LB 5I0VA 2PPEA 4ZTEA 4AMXA 1UZ8A 2IDSA 2KLRA 3ARFD 3HBZA 5L2KD 5IJKC 4MCNA 3K48A 3LB6D 4W70A 3UDWA 3GSVB 4CP0A 5DN2A 1CUOA 2PF6A 3Q5YA 1WLHA 1NE6A 4OGZA 3RKDC 1C16B 5I1EH 3R1GH 3GWJA 2F19L 1IC1A 1IMHC 5LK7B 1KIRB 1R6VA 2BZCA 2DQCH 1K5NB 3BGFB 4EWDA 4UMSA 1AGFB 1FN4B 4A7SA 4LLOA 2ALWA 5I74C 1KLFA 2J1YA 4UB0H 5DZVA 2AK4B 3DX6B 4KAQH 4OQTH 5F89A 1RUI1 1QDCA 4MZ2A 3MUJA 3ZE2E 4ODWA 1IGCL 4OVEA 4FQQA 3H9SD 3O2DH 5LA0A 4BH9A 3VBHC 1EAQA 1QBML 3ATDA 1MHEA 4X4ZA 3RWHA 1QEWA 2P3IA 4YNIA 2FL5B 3GSWB 4PRPA 1OMIA 4GWIA 4QLRA 5KOMC 4A7GA 5I1DB 2X6BA 1U21A 4HEPA 4XMTA 1X5IA 4O2FB 5FA3B 4F2EA 4ZOAA 5BZDB 2CHHA 5I1JH 3ZIXA 4HBCH 4IK7A 4P9IA 1CZ8L 1XXFC 1IT9H 3MOAL 2ZP8A 4WI9A 5DD5H 4X5RA 2ITCB 2IGLA 4O65A 2C5DC 1NCNA 3UTSE 2VLJB 4GNKB 1S7VB 4XP9H 1AXKA 1UF2C 1MF2L 2O6FA 3OPZH 1M6UA 4XFAA 2ZKLA 4KKAC 1RZ8A 4N85A 5CEYB 3STLA 3RRDA 1NFDE 4N86A 1S0EA 4Q2ZB 1GGTA 2ICCA 1M4WA 2PCFA 1KELL 3WLBB 4PI2A 3AL6A 4ZUVB 1J5OL 2QPUA 4BYYA 3EDEA 2VZOA 4GIPD 1N0LA 3C6LA 3QZMA 2OXGA 4M7JL 3SKOB 4F92B 1RZGA 4Y5VC 5ANHA 3VDAA 4Q2FA 2BMKB 5BQDA 4NSKA 2VN7A 4QTIL 3TWCH 2DF7A 3ACLA 2EADA 5IHLB 5KW9L 5C9AC 1F1AA 2P46B 3B3BA 1K5WA 5IQ7H 3JBG2 5I1GL 3GK8H 3FKUS 3UBHA 3CU1A 3CX5K 4NGHL 2KBGA 3PP4H 1ETZA 2JMRA 4P5TD 2AEIT 2W60B 3N91A 3ZDYF 1HHKA 4Q0XH 2VR9A 4KG0A 3TEWA 1V5JA 2Y1AA 2RJMA 1FPN1 4I77L 5EP9A 4FL4B 1N0LB 1BCXA 3HRZA 4JG0H 1A6CA 2J1RA 3KPQB 1WA4A 1UD4A 3PHOB 4UM9B 3DMMA 4OLZL 2AANA 3MRNA 1BX2B 2QR0B 3STLB 3GSUB 2NY0D 5B3JF 2FBEA 4N90A 2DQEL 5E89A 3D4ZA 4PAZA 3WIFB 2VLJA 3L54A 4AYBA 5DG2A 1JCKA 3QO1B 3II2A 3CLEH 3SKOA 3Q8BA 3WINE 4C55A 1ACXA 2BOCA 3IDIA 1A7RH 4TF4A 3VHRA 1DEDA 4ZUVA 3UTPD 1AZRA 2C3VB 1X7TA 3QQ3A 1VBA2 2BV4A 3MICA 1NOFA 4GP8B 1J0ZA 2B1AH 3LPGA 5B1JC 3RRQA 2Y0OA 1UT1A 3U1XA 4ZS7L 1FPN2 4N8VA 3WNOA 2EDHA 4J3TA 3GSRB 2W1SA 2YUEA 1A3LL 4LCYA 4XB7A 5FO2A 3VBOC 4JS7A 1XV8A 4PG2A 3VYOA 1C8M1 5JIQA 1Q9WB 3KPRD 3RA7H 1F3DJ 1U3JA 1YQ8A 3ZMNA 3H7BA 5D7IA 2SEBA 2Q7YB 4E4DX 1QLFA 5KS9B 2AGJL 2YYOA 4GH4B 1ZVSA 3BIKB 2DH2A 2HKHL 1W0NA 5L73A 3INUH 3GBNH 2GSGB 4HIIB 3EJUA 5CKGA 3S3BB 1GCFA 2BERA 2XB6C 1TO4A 5JHDD 3S8FB 3ZYIB 1FPTH 5I24A 3CZUA 1MNUH 1FZJB 3VU1A 4QRRE 3TBTB 2XNAA 2ZG2A 2B39A 2ARBA 1TNNA 4GW1A 4HX1B 5KJRL 2JB5L 2BOCB 1ZZ8A 3APBA 5DC2A 5IW6B 3QNZB 4ODTH 4HBCL 4J1WA 2WMPB 3IF1B 1ZRFA 5AVPA 5HDWA 1FVEB 1A6TB 1LQSR 4BE5A 3G9AB 5E1AA 1FZOB 5KVFL 4AWJC 2RS13 3D5OF 2V09A 3C7GA 4JN2B 3BW9A 4IGPA 5FZOA 4XE9A 4N6QA 5JHLH 3VKLA 2KDYA 4IYKA 3K6SA 2QVSB 4OJYA 4PJFF 1ILSA 4Z7NE 4TSCH 3OMNB 3VXOA 2FLMA 3LXCA 3BZEB 4KI5M 4Q8LA 1URIA 2BSRB 2J88H 3D3VD 3K4DA 1HNYA 3AG4B 2AXJA 3L3KB 4WGVB 4W68A 2UYAA 2E9IA 3JUZA 1CN4A 5L7XH 1I7UA 1HHHA 35C8L 3BGFC 3VG9C 1DFBH 2K70A 1ZV2A 3UROR 2XQXA 3EYFA 5AW7B 1S7VA 2QKSA 3KPNA 4BINA 4ODVL 1AOHA 1DP0A 2RR12 1RZJC 2CR0A 3HZYB 5HJGA 1IQDB 4NB7A 3S5QA 3JWDH 1YY8B 3FHQA 3QCVL 3LXAA 3OJDA 4ZFZB 1HWGB 4N3UA 1AGDA 2J55A 3VBRB 1TVDA 2RQEA 3RUGF 1UD8A 2FLBT 3TCXA 1I3HA 1GVIA 1WPCA 1NUKA 1TME2 2EYSA 3CXFA 3O2VH 2WT1A 5E1HB 2VQAA 3MIHA 4KAQL 1FOD2 1E4JA 3MRPA 3MCLH 3JTSA 3UX9B 5FR3A 1NA1C 5FYMA 4DEVA 3K6SB 1TVGA 3I84A 2DUQA 3IAPA 4DK3A 5IVZB 5DDJ3 2XJPA 2Y33A 5KAQF 4I3PA 1KC5H 5FW7A 4AKOA 3UT0A 4QXWA 3TJEL 2PYEA 2UURA 5FY7A 4XCFL 2XBO3 2CIKA 2GPZA 4QR7A 3UYPA 2CAUA 5BNOB 2KPWA 5D7LE 5HYEA 1HB2A 2WM0A 4IHOA 5IB4B 1XF3A 3VFGL 2I9LB 5FZ6A 3WEXB 4LCIH 4R90L 3O3EB 4G8EB 1JW6A 4LDEB 5IQ9B 2LTNA 2R7EB 5F7FA 4MA7H 4MD4B 2FGWL 4QHPA 1DG6A 4L8DA 1W9TA 4IS6A 1D5IH 3QEQD 1VB2A 1PO22 3MGUA 2P7TB 2BVOA 2CSGA 4K3JH 3RGBA 5CHNB 4ZMVA 1DFXA 1DE4B 4RFNC 1T7XA 1FBIH 3FBYA 1RK1B 3WW2A 5IVEA 2IZWA 1LO2H 3WEZA 3D7PA 4XURA 5A2JH 2HEYF 4KV5E 2WOBA 1NDMB 2PA7A 3TN0D 5DEZA 3ROOB 2QQOA 2P44B 2TBVA 3B7TA 4HL0A 4ONFL 4WEUD 1EGJH 4KVNH 5CFAA 3FMGH 2WQ8A 2NY2B 4KVCH 4ZUUB 5HHVH 4WVMA 3MW4A 1HU8A 4G9FB 1SJXA 1VEOA 4ASLA 1WG3A 4RMSA 3MJ8B 2HJFA 5FOJA 5MEPA 2V37A 1I1YB 4K8RB 4NWWA 1UMZA 5HI4C 1JYXA 3E6BA 1NEZA 1L7LA 5J36A 1OAUH 3WG2A 2GNDA 4UB0L 2Y6FA 5KXEA 3KEHA 1YNTB 2QLVB 2VL5B 1IM9B 2A6XA 2ARXA 2Q8AL 5IB3B 1XE7A 5LNGA 1MVUA 2W88A 1DBJL 4HS6A 2OP4H 1M56B 4B6ZA 4RDQF 2AJYL 3NSFA 4Z7VE 3C3VA 4XXAA 4KMQA 1NCJA 3N40F 3KPSD 3W9EA 1BMV2 4ZUUA 3WELA 3GMPA 3DKQA 3BJ91 2HWC1 5KXBA 1BYOA 1SYVB 4ONHB 2EYTA 5AB0A 5C7GA 3AVRA 3D4CA 3SE6A 3QWRA 4LSPL 2BNQE 1AKJA 5HY9A 1RK1A 3US0A 3OB8A 5FO8B 4ZTOH 2XQ0A 1V3JA 4PCYA 1DUZA 4BFKA 2BSCA 3HN1A 3FT0A 4NBZB 1Q4NX 1V05A 1UT2A 3GSNA 3MR9A 3N04A 3OAUH 3C60D 3MRNB 4OI9A 5CCHE 3V9CA 3VKFC 1OTUC 2GK0A 2WO7A 1ZE3C 3VM7A 5C3QA 2NPLX 1QSZA 3N7JA 5J7MA 2WLMA 4H40A 3S30A 1TIUA 3DGCR 5AWNL 2A6ZA 3K8MA 4MGSA 1EO8L 3FUHA 5JYLA 5CU9A 1GV9A 1UKSA 4BK8A 1HYRC 2L7UA 2DBIA 3BFOA 3L4XA 1MZYA 2JQMA 4K0OA 2WXHA 4NOFA 4KVCL 1GRWA 5AC92 1VGEL 4YGDA 1KIUA 4GMP1 3G5WA 2MPVA 3PPEA 3UGXA 5FKAB 5C08D 3TYFA 4Y4FA 5EFIA 4HXAH 4BJ0A 2E63A 1V9U3 2NY4B 4MQ7A 3BT2H 4MLOA 4OZFA 4MGKE 1O7DE 4TULH 1QDOA 2P45B 4O2EB 4ODTL 4BZ2A 5ESQB 1F3JA 3H6AA 2BFVL 4RFNB 4PJ5E 1LGNA 2AC1A 1SYVA 4ONHA 2RG4A 3JZYA 5D96B 2M26A 3ASIA 1LOEA 4AKPA 5IFJA 4MA7L 4F9LC 4JJHA 4JKKA 4XUNA 4QPIB 3B2MA 4EUPH 1JPEA 4HDIA 4NZFA 3D85A 4M4PA 3EOBB 4EN3B 3MFAA 4HLZG 1UWEL 3WJLA 2XOTA 1WVZA 2AK1H 4Q4V3 3RVHA 2K6YA 1FMD2 2YUXA 3WOVA 3P0GB 3OBZA 3HIZA 4JREB 4HWZA 3MEPA 4LCWB 4DQAA 3NIDE 1A5FH 1AR2A 2WTRA 2DY2A 3MJ9H 1MS5A 2JSFA 2Y7SA 3BYWA 4IUGA 1NZRA 4K7JA 3GNEA 3B00A 3D25B 4QXTB 4Q27A 3GI8L 4YDVA 5C0NC 2PMWB 4EUPB 4XNZB 5C86A 3HAGA 5DAQA 1I8MA 4GT7A 3NG5A 1XU2A 2Q8BL 4NIDA 4YDIL 1AIFA 2JJWA 3X12A 5INDB 3P2DA 4R4BB 4Q58C 3JZ7A 3VXMD 2QV4A 4BXSV 2NY7L 3DX8B 2Y6HA 5BNNB 2LLNA 2CWRA 4GRMA 3ZE0F 3ZUNC 2P5WE 3WFBH 5C0JB 1EHLL 1OCCB 2DEYX 3FZUC 2A6IA 2VRQA 5E2TH 4M6OL 1TTRA 5GZNC 1JZ3A 5JAXA 4HSQA 4IM8A 3DHPA 4PWHA 4RGNB 3O1TA 4FFZL 2JI3A 4P9YA 1EANA 1CYXA 2LGNA 1YO4A 4G9DA 1GC1H 2BSSA 3GHEH 2HWD2 4LBJA 3MLRL 4CUAA 3G5YB 3NAAL 1PQZA 1RURH 2N7BA 3TYGL 2AH2A 1SEQH 5IMOB 1AYRA 1A6PA 4R9HA 4XN2A 5E6RB 1FNZA 1SEFA 3ZFGA 3HE6B 4UOW1 5ESVB 4N2CA 1SFDA 4XPFL 4IEQA 2ZCKL 4LCWA 4RMWA 4ZFGH 4CPBD 3UACA 4QB6A 3C7EA 1ADQL 3O45A 3AYCA 2QTVA 1DJHA 1LODA 4Y4HD 1NXMA 1XBRA 4UWDA 4LXLA 1H0BA 2XJKA 5FW8A 5FJKA 4M7JH 4JMNA 4S1RH 3OGGA 2VCAA 1A3KA 1J11A 4ZK8A 3IPVB 4R5VA 5IQLA 2AJ3A 3DYOA 4QQOA 4XNBA 2D97A 1CLYH 2ZEXA 3DX7B 3L2HA 5LEJA 4IGBB 1SDYA 1NCWL 3BAKA 1KLUB 3OBTA 2D0HA 1H8TC 4PJYA 3T0ED 3ME0A 5DFTA 5F8PA 3GMOB 5D7IF 4M1DL 5SV3A 3WUCA 2A1WH 3QHZH 2B3RA 1BLNA 4CC4C 1MIEH 2FHBA 4HJUA 1J8SA 2GK0B 5DJ0A 5I66A 4PJEA 3ULVE 4I0PB 2DQFB 2XZAL 4P2OA 5E00A 2X4QB 2XLLA 4JRYE 5E94A 3ARBD 4FLRA 3SSGA 3QARA 5FO9A 4UOJA 3AMHA 4TUJA 5HD8C 2VQ4A 1K45A 2AFNA 2Z79A 1QBMH 3NJJA 4E42B 2NW3B 1IEAB 4U6TA 1XD0A 1ZIBA 4TV3A 3K2UL 1OD3A 3VZLA 4OFYA 1SFYA 4HAGA 1AP2B 4OLXH 4PWEA 5E56A 3QEQA 5EXOA 1UWEH 3MV7D 2TAAA 4BH7A 1H8SA 1W72L 2JKSA 3CAFA 4KNSA 1EK3A 1NG0A 2WNUA 1QNZH 4XDQA 3IGFA 5FWEA 2J72A 1X9RA 3L1OL 4V1DD 5E2JA 1UIKA 4YW6A 1R3KA 2VRKA 3X17A 5I1IL 2DQFA 5IJDC 4TNWK 4NENB 5FUOL 2D93A 1RZKL 4NP4L 3GXMA 1YI9A 3X3FL 2Y69B 3TONA 2O5ZH 3MRIB 3GJBA 4LOTA 5A7WB 2VDLB 3JWNC 1E5BA 3KPOB 4LOSA 2GU9A 4GWNA 4GJZA 5D1XC 4WBBA 3GXDA 3B7UX 1NAML 4FL4C 1UOVA 4OUUA 4MB1A 3OHMB 4FP8H 3N7MA 2CUAA 3KYMB 5CKMA 3LVEA 2DCJA 1QH7A 4ZDHA 4HBNA 1GZHA 2QQKL 4MJIA 3H7JA 2Z0UA 1SBSL 4M61A 2VW1A 1DSFL 3D39E 1XH0A 3GO1L 4W93A 2WINB 4HVBA 5IKCA 3VL9A 1LDSA 4MKTA 3VGBA 4FPCA 1WICA 2G75A 4YOKA 3MBWA 3SO3B 1CMOA 4DKFH 3IETB 5FFLA 3JWOC 5DEGA 1Q56A 3WJMB 3NDZE 2V6HA 5I8EA 3UTTA 1IAOB 2VM9A 2CG9X 5GGVL 3CJIA 3K72B 4U3SB 15C8L 4FEMA 3D4GA 4YSEA 2UUDK 3NIGE 5HGHA 1NCAH 5H94B 4DKEH 4TSAL 3S7GA 1IC5H 3QO0A 4MS8C 2WCGA 2XQYG 4U05A 5HI4D 5I1JL 1TNRA 3D3VE 1AI1L 3RBGA 4HA1A 4O9EA 4OGQC 2MHAB 1DVFA 4BRJA 5IJVB 4M3CE 3MTXA 4ZXBD 1KIRA 2GITA 4N43A 4NQSA 1U91B 3VI4F 4OZGB 2ZOLA 3WQ1A 4IOSD 1FDLL 4AEKA 5AB2A 1JHJA 1AHWA 3QCTH 3VWJB 3AP5A 5LA9A 3U36A 1VBA1 3MV7A 1FRGH 4X7TB 1QSEA 3FRPB 5E8EA 3C9NB 3NMEA 4K7FA 1Y4WA 1PZ5A 1UJ3A 3DN7A 1QWNA 3K46A 5FM5M 3SGJC 4MQXC 3RDTB 3ATBA 1OURA 2EAEA 2D40A 3EJKA 2OSWA 3BUBA 4NR1A 4OY9A 3V52H 3L9JT 4Q29A 4Q4Y2 4KXBA 3EADA 1C8M2 2DM7A 5CLYA 3CJIB 4KY2A 3F6JA 3TCLA 2OKXA 1W3VA 4YGAB 3SKJE 3FU3A 3IMBA 2OMBA 2CO2A 5H2BA 1LXMA 2E7BA 3D06A 4HQQL 4WO4B 3HQXA 4PRPD 4NRYB 3ZQ9A 4RAUB 4X80H 3DI3B 5MP6H 2E51A 4C8DA 2EXWD 3Q8AA 2XX0A 4WDIB 5GLUA 1F02I 4BSJA 5LLIC 1OXYA 4Z3EA 2VLME 2C6SA 4P5KA 3A0NA 4BKTC 4B9ZA 1T1WA 3H3BC 4PLNC 3RWDB 3QZOA 4J8RA 3TOPA 5IBUG 4ZMAT 3N3HA 3POYA 1N68A 3QP3A 3B2XA 1VRSA 2CA4A 4CCOA 3RJOA 1SLIA 3MACH 1H1AA 3WLWD 3KHCA 3EOTH 3WAJA 4A63A 4DGIH 3W56A 2H9GB 3GUFA 4P9MH 1FATA 1NCQB 4CW1A 2OJ1A 4W81A 4LQFH 5F7WC 5HVGB 3VFWA 1MS9A 4L8QA 1IBHA 4JVWA 3DJZA 5I26A 2VC9A 5BZZA 5FYKD 1PZ7A 2ZUQB 4M29A 3QCUH 2D3LA 4F7KA 1TJGH 4BV1A 1FO0A 3V0WL 4HUNB 3LNIA 3FONB 1ZHKA 2BNRE 4S1DC 3OZ9L 5JUEL 3U48A 4CUGA 1GS7A 3KL3A 4JCKA 1R9FA 3L45A 5FPBA 1MFMA 2NZ9D 4YDLB 2CSPA 5FLVA 5FGCE 5E1RA 3RTQC 2ESVA 1IGYB 3JV4B 1N6QH 4F91B 5F89B 4CU8A 1LHWA 1H0DB 4X83A 4AJYV 3CD4A 4ZT1A 1AQDA 3K6DA 3MV9D 4HWEH 2AJUL 3A4UA 2D43A 5E7BA 2JG8A 4I3SH 1J0JA 4OIIL 2VVEA 1DO5A 3G04B 1CAVB 1F6FB 3E1ZA 3NABL 4AQAA 5EEYA 2CO1A 3MCKA 4QM9A 5FP8A 2IBZX 4YDJB 1J83A 5LA2A 2DWYA 1D5ZB 2X9XA 4U6HB 4N0YH 1C5CH 3RHWK 1YNTF 3RPBA 2ZCHH 4IBSA 3QUZA 4QRUB 3V6FB 4IDJL 1J1TA 1HFUA 5FUZL 1G6RL 2DCZA 1HESA 5DMIH 4YXHH 3EBGA 4HKJA 2VXRA 4MJJA 3RU8H 1V8HA 4XI5D 4KDVA 4LARL 2X53S 2A70A 3EB7A 1KPVB 4OQTA 4HKXB 4P49A 4X6CA 3CHRA 3MV8A 3IU4H 5EPMA 3VSVA 1CR7A 2IFFH 4KI5D 3VWJD 4CSZA 3P1IA 2E27L 5I18H 2UZIL 5F8QC 1NXD1 3QDMB 3QPKA 1WIUA 4H2CA 3UPAA 4ZQTA 4N26A 1LP9F 1DZRA 4WLCA 5DEGB 1D5BA 4LLAA 5FZ8A 4OLXL 3RYPA 3MXVL 5F72S 1D5ZA 4KX9A 4XVHA 5LXGH 2WWKO 4GSRA 1W28A 4EROA 3BVCA 1MAMH 4BIOA 2ZHKA 4ZMOA 3QZNA 4CP1A 2JLLA 1JZFA 4CMMB 5AKSA 3PWJA 3DXAA 2YC1B 1DYZA 1FNGB 5EF2A 3OOXA 3I50H 4IRZA 4DFSA 2Q86A 1N64H 5B39B 4E5XB 3SDDD 4PJAB 2XKOA 2AEOA 3OMAB 5KSBE 1DVYA 2DKMA 3ECVA 1FHNA 4Y9CA 1NM9A 2NNFA 2Y2YA 5FP7A 2ZG1A 2A73B 4A2EA 4KI5E 4UT6H 3UJTL 1UM6L 2IFRA 4QXBA 5AUMA 4H4NA 3W11D 3WXWL 4LO7A 2HKHH 4HAKA 1H6FA 2I74A 2R2BA 2R27A 2ZYHA 5HHMB 4F83A 4QX8A 2BVPB 2OMYB 5F9OH 1T2QH 5T50A 4PRNB 4CGUB 1CQ9A 2HVBA 5I8TA 3AKSA 2FYYA 5ADPH 1KC5L 2MOVA 4N20A 2J44A 2D7OA 4PIBA 5T1LD 2P8PA 4MWFB 1ORQB 4J8QA 1QQP2 5E4AA 4I48A 5H9PA 4HKWA 3FNKA 4L1DA 1I7TA 1PO13 1QNYA 2WNUC 3H1YA 3BFQG 2XZCH 4RX4D 2WAQA 5ICZB 2GW5A 1BZ7A 4KK5C 4F8PA 4YG6A 2HH0L 5G55A 1MRCH 1ND0A 1UATA 4JBSA 4OJCA 4WFGE 3I49A 1TETH 4ODSH 2Q4SA 3KV4A 5C5TA 2HJLA 3LQAH 4IRZH 4PY7A 4N7IA 4K8RD 2D2CC 4XFCA 2WFF3 2W59A 3V2AR 3CBNA 1CGTA 4PJCF 4I7ZC 4YE4H 5HSFA 2BLFA 1SMDA 1BVNP 2VJXA 3MRPB 5IVBA 4IV1A 3I6LE 5BXXA 2G4EA 3KLDA 1B88A 1DQIA 4NUGH 1CC3A 1AX0A 3RIFF 3M3EA 1S9XA 3BDYH 4YHPA 4BIFA 9CGTA 1J86A 1WAPA 1QOOA 5HYIA 5J98B 4A6SA 5B38G 2P3YA 3NZ8B 1TLKA 1MFDH 4LITA 1JZ2A 3ULUE 1YEEH 1Z5HA 4FXGC 4S2FA 5DTFB 4XMPH 1O8SA 1OL0A 3FHAA 3UGEA 4YZ3A 1BVKA 2UXTA 4AQ2A 1KS5A 2WXJA 4R0LA 4TYSA 1XCTA 4PP1C 3PGDB 1KXVC 5FWRA 1UYPA 2GSYA 1CBJA 1UKRA 2XBO2 4HVOA 4KO6A 4AUUA 3AM8A 4JANA 1X7QB 3QUMH 2K0GA 4BU2A 2NY7H 2GMMA 4JMXA 4QKDA 3AVEA 4C0HA 2GY5A 3O2DL 1P5VB 2O26U 2JXMA 4XMLH 3ZPDA 1NWPA 2F6BA 3QUXC 1RSFA 4ALAH 3FQNA 1S9VA 4PBDA 3RZWA 6FABH 1AOZA 3ZFFA 2NP0A 5AOZA 3BW9B 4Q74A 4MGYE 2HRLA 5IHHA 4NI6A 1J3PA 5LZ6A 1FL5B 1WJ3A 3QJVB 3LZFL 2XG4A 4UUJA 1MJ8H 4BFBD 1L6XA 2CH8A 3HC4H 4LLWA 4AVHA 1OCWL 2B4CL 4YO0B 3LN5A 3UIYA 4PTTA 3LEXB 3RTQB 4TN9A 2WXIA 4XP9L 3UTOA 3B9DA 4CMHC 1AVBA 1W39A 2BJMH 4D7TA 2Z0BA 3EYQC 1RUI2 1W0VA 3RZCB 4YEFA 2DWXA 4LMQI 3B9CA 4K3HA 4A68A 1IAII 2WNVC 3NCBB 4ZJ9A 4F57H 1D4M1 2JEMA 3SLIA 1AKJD 1BG9A 3TNQA 1RKRA 3UOAB 2XR4A 4FXKA 4FQPA 1K4CB 3CZGA 1XF5A 1KXVA 2Z31D 4UT6L 3HTLX 3UJTH 1V3KA 1F9KA 2GJ6B 1YFUA 4YMPA 5DVOA 3PGCA 3THCA 3UKNA 4Y5TA 2OQ7A 4EZMA 4PS8A 5DD0H 4JPQA 2QGDA 5C07B 1RZJL 1RZPA 1YMMA 4AGRA 4M5YL 1LB2A 4XEZA 3PVNA 4X4XA 4FMKA 5JDJA 5IK5A 4JO3H 2H0PA 2JG9A 1I9RL 3V5HB 3N7KA 1G6RA 4JZJC 5BRZA 2DQ6A 1QR1B 1M3JA 2NLJB 3C6SA 3BRFA 1YQCA 1G6RH 4XTRC 4RR3A 2P5EB 5HYJB 2YD8A 3AUVA 1E5SA 3DVGA 3J9SA 4XHXA 4ZO7A 3RWJA 3PJQA 5L7OC 1IGCH 4YDKH 3QRBA 3ACHA 4KZDL 4LBEB 4GWJA 5K1NA 2AEYA 2ORXA 2ZGMA 4GP4B 5AZ2H 1N0XL 2COQA 1ZXKA 4JFXB 2F53B 1KJRA 2W52A 2BIOA 3PUQA 1SOKA 3PIJA 4DQOL 5D1ZD 3K1KC 3HT1A 5FHBL 4YYOA 3K80A 2Q87A 4LVOB 3UXFA 2K4AA 3B3QE 4CEYA 1DN0A 5E9DE 4CDXA 5A6XA 4IRJB 5EU6B 1CS6A 4XFGA 4G8EA 3QIUB 2IDFA 4QUOA 4WEBL 2JDNA 2FQFA 4NNYA 2W87A 2Y25A 4IK6A 5GGTA 4GO6B 4AVKA 1NEZG 5HI3C 3HE7A 4XBNA 2XG5A 3POHA 4O58L 4DS0A 2XZQL 3ZDWA 3BQUC 2J8HA 3OJVC 2ZKYA 1UWXH 2UU8A 3WUWA 1JWSA 4HFUH 3W2DH 3LRLA 1CAVA 3E9TA 5T1DL 3HZVA 1KFAL 1NGYB 3BAYA 5HHNB 2P5EA 1KB5H 2XTJC 1AE6H 4PLKD 3N9GH 1B90A 3CIAA 3MJ6A 4AGMA 1EEUA 3F85A 2H47C 3CH1B 1CB4A 2JK5B 4WM8C 5EA0H 1EGJL 4KVNL 4PHXA 2CKBB 4KQ4L 3QIUA 2GZWA 1UWFA 1VFBA 2IDCA 2UWEB 4PV9A 4ELDA 1A2YB 4YHKH 1VRBA 2VKXA 3M3OA 4M1DH 3U9PH 1SBEA 5JQHC 3L2NA 4Y4KC 2F54A 1L6PA 5F70A 1BVKB 1IAIM 3V7AE 4FQIH 1AL0G 4FPKA 3R8QA 1HI6B 5JWPA 1M3IA 3O3DB 3O6KH 3R8BB 1LAJA 3ZE1E 2J1KA 5FV1L 4AUYA 1XXDC 1ACYH 1FG9C 2FWOA 2C1OB 5F1NA 2K46A 2B59B 3AJZA 3CJXA 1BQKA 3QNXA 1SQMA 1OALA 1E5UI 1LGVA 1MLCA 3QUXD 4ZD3L 4JM0A 2ZWSA 5L0QB 1CIWA 1FFTB 2SBAA 3QFJA 2QDRA 5DJ6A 4LIVA 4TN7A 3POFA 1CI3M 3MMEA 3PUHA 3S0MA 1D5IL 1UWGL 4B1MA 4H2AA 3BZ4B 4NWTL 4OIFA 5A33A 4EN9B 4R2GB 2XSKA 3WY4A 3KPOA 4HD9A 2EXSA 3APFA 3FB7B 3N0PB 4BLJA 3R7QA 1RJ7A 2WWJA 3KHBA 5KVEH 1SJMA 4DUVA 4ZTOL 1QXPA 4Z7UB 1D7DA 1ASJ3 1T7VA 2DICA 1NOVA 4LA2A 1P7QB 2RJKA 3EJJX 4PWFA 3EBIA 4QWWC 3DV4A 2QPFA 5SWZB 5I1HL 1XSRA 4HSJA 2XZQH 3BJLA 5FCCA 2LTQC 3BD5A 3FTUA 5D8JH 3T3PF 1H2NA 1VBB1 1ULFA 3BP5A 2K7QA 4IKIA 2P37A 3B93A 2DQUL 1RIUL 5EOCL 4N0UA 4CN6A 4XNUL 1E65A 3MLWL 3RI5F 2CAVA 2Q8BH 2WT2A 1IAOA 5D5MB 3TURA 3EMRA 4BWWA 3LQZA 3WKML 3BSHA 2BSBA 1LK3H 1T20B 1C5BL 5E1IA 1O7FA 1CT8B 2BIQA 4P2CG 2V8MA 3AJYA 2YGLA 1YNAA 2WZR1 3IDCB 4AX3A 6PCYA 5C2BL 1NDGB 1LENA 3VYPA 5DS8B 2OX5B 4S0SD 4C47A 4ZYKA 5D1XA 1KGYA 5F5CA 4JFPA 2J2ZA 4DETA 1JFQH 2V72A 1NTDA 5GGQH 3KCYA 2PO6D 3S35L 1XR8A 4HHWA 5L7OB 4DP1X 4M6ML 3LSOB 3AP9A 3FBKA 1TQUA 5DHEA 4KU1A 4X6DA 4QJ3B 2O5XH 3AMKA 3HFFA 4OCWH 5LVEA 1BPVA 1H30A 1ROCA 3NRQA 35C8H 4PGBA 3GEFA 1PCXA 1MCPH 1SGKA 5HGGS 5F2FA 4PLJC 4H0LC 3OPTA 1OT4A 3DXAD 1MW3A 4PBVC 1JZ5A 4NOBA 4XNAA 2VXSL 1BZ9B 1YEGH 4K3JL 4KTDL 3EH5B 3CEWA 2XN9A 1OQDA 5DAXA 4WSJA 1J8RA 3TVMC 4DRRA 2F4PA 4L1LA 4P05A 2LQRA 3KXFD 2F4LA 1YJDC 1QWUA 3AABA 1RUH1 2YAMA 3SYOA 3V7MA 4FZ8H 1WS8A 1WWAX 2WQRA 2VTFA 1PF3A 1TVHB 2BHFA 4RMRA 3MIBA 2FUQA 3L3OB 5GZND 4B41A 7CGTA 2PAEA 1JNNL 4FTSA 3GIVA 4DIXA 2D3NA 5B2GB 3EGSA 4H0HB 4QXUL 3X1NA 2W0FB 4ODXB 1LHNA 5H35A 3OPUA 2GIYA 3J27A 5F9WC 4PVBA 2R1DA 3MYJA 3EG9A 4Y9GA 3MJWA 5T33H 3W59A 1ZGLB 1SNRA 3VVVA 1S0BA 1O3TA 5C0JA 1HWWA 4KU8A 3MCLL 4WAFA 4AMKH 3NOIA 5A16A 4YZ1A 3KWUA 3MUY1 4RGMC 1Q9OB 2ZHMA 1IAMA 1XH2A 1QW8A 2VC2H 5I76A 5TE6L 2JIJA 2AEQH 3HFML 5BS0A 3PWUA 4UT9L 1CD1A 1AZNA 1KWGA 2MOGA 3GSOA 2VZQA 3CLEL 3PRZA 1XB6A 1QA9A 2HFEA 3FQWA 2ZAAA 1KYAA 5CZXC 5B3JE 5IUCA 2DQIL 2G9GA 3IFLL 5FREA 2EO9A 1UZGA 5C7XL 3WF3A 4ZKTB 1L6ZA 2AV1B 5IT2L 2I24N 3K2KA 5B7MA 1NANH 2PO6B 1TTCA 2ZSVB 3SCFA 1W2KT 4QRRD 1MJJA 1MJ7H 2ADDA 2YPJA 3BH9B 4RIRA 1OSZA 3H56A 2JCCE 1KENL 3EF4A 4RHV2 4BQXA 4F15C 4K8FA 5FZCA 4EVNA 4XP1L 2NCEA 2NDFA 4HPYH 3RIAK 3WTWA 2JG9B 4N9IA 4Y7OC 1I31A 3RILA 1FYTB 1LWHA 3KCWA 3N43F 4I30A 4HETA 2R39A 4QGYA 1CE6A 4XXCA 3SGDH 1E5HA 1EO7A 3RPKA 4FZ8L 4AXWB 1OPGL 3BKZA 2WZ5A 1GZQB 3NP3A 4AL8L 5LGJB 5D1IA 4HG4K 4RFOH 3VXMB 1VRH2 3SDYH 4DJMA 2VUYA 3TBWA 3GLAA 3UP1A 3DROA 3O2DA 4NQQA 1LNUB 4FTVA 3UTZB 3V95A 4MQSB 4Q5OA 4NN6C 3IDNA 1KTDB 4DP0X 1R5VB 3ES1A 1ZBE3 3O1UA 1LEKB 1T66C 3F7VB 3I3BA 4TMPA 3RY5A 5LB1A 1O59A 4HH9B 1I7ZB 3WS3A 2NW3A 3U46A 1A4AA 2DWTA 2IXKA 1OA2A 5FM8A 4P4RA 2D5HA 1YEKL 2DURA 1X5GA 4LCWD 1O9WA 3ZR6A