2WN3A

Crystal structure of discoidin i from dictyostelium discoideum in complex with the disaccharide galnac beta 1-3 galactose, at 1.6 a resolution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 60
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn3A01
4MO3M 2OKXA 4W8JA 3WSOA 3ACGA 2WZ8A 4LHSA 3K46A 2VZRA 2VC9A 3VD4A 1W8OA 4ARYA 1WKYA 3DYPA 4A3ZA 1US2A 3A22A 3VD5A 3OG2A 3FL7A 4JKKA 1DLCA 4D8MA 2HLEA 3THCA 1PMHX 1P8JA 2J1EA 1UXXX 4P5YA 2QQOA 2WQ8A 2PQSA 5HXMA 3LE0A 1UYYA 1GOHA 1D7PM 1UY0A 4L0PA 1JYNA 2BERA 2XQXA 4DXSA 1OF4A 3K4DA 3MV01 3HEIA 4OYUA 5G04L 2CDPA 1PX3A 2DDUA 3HPNA 2E31A 1SG3A 5DPNA 3A21A 1CX1A 2J1UA 1XC6A 2YC4A 4DUVA 3UNPA 4QX3A 1OT5A 5CZKA 2WBKA 3P1IA 4XUPA 2VZPA 2WAOA 1JU4A 4QPWA 1UYXA 4GZ9A 2DCJA 2VJXA 3WNOA 4LQRA 2Y6LA 3DYOA 3T2OA 5F7UA 3OGRA 4A42A 3WMQA 2Z4FA 4CVUA 2BBAA 2V72A 1L7QA 5JXJA 2BGPA 5JMOA 1UXZA 2RJ2A 3A23A 3VD7A 4XURA 2J22A 1K12A 3CKHA 1XNTA 3I3EA 2HYXA 3IAQA 1PMJX 4XUNA 3SKJE 1O8SA 3JXSA 1UMIA 2YC2A 5JXHA 1JZ4A 2WZEA 4CU7A 1ULPA 4DXRA 1J84A 2W91A 2VO5A 1JZ2A 1JZ6A 1KGYA 4A41A 2Y6HA 4IUGA 3VDAA 2VZQA 1XNAA 2VZSA 3HNYM 4FI9A 1ULOA 3I2GA 3WQBA 5JR2A 5IJRA 1OF3A 1O8PA 2VMCA 2DCKA 2W5FA 2J1VA 4TXWA 2VMFA 3C7OA 2QQNA 2WABA 4E8CA 1K42A 2ZEXA 4QB1A 3U37A 2Y64A 4DXTA 2W92A 4BDVB 4QX0A 5C70A 2JD9A 4ZY9A 3CQOA 3ZM8A 2WO2A 3A7QA 1CIYA 1US3A 1W9WA 2JKXA 4JKMA 2X05A 3PUIA 1O59A 3PUHA 2C4XA 2ID4A 2CE6A 1XPWA 3THDA 2LW8A 3UESA 2V5DA 1W9SA 4MADA 3D3AA 1K3IA 2CGYA 2EIDA 3HOBA 4QX1A 3CZJA 2W47A 1JZ5A 3T0DA 1SHWB 3I2JA 1OH4A 2ZXQA 2VZUA 3HNBM 1MPXA 5EJ1B 1JHJA 3MV11 1W0NA 2BZDA 2W9XA 4UAPA 4ET7A 2Y6KA 1K45A 4OMDA 4ARXA 4AAXA 2VZTA 3LPFA 2VCCA 5DQ0A 3NNGA 1NAEA 5I0DA 4GWJA 4CU8A 5A1AA 1W99A 2EIEA 1J83A 2VMEA 3K77A 5IHRA 2ORXA 3WEZA 2EICA 1L7RA 3SKVA 4DUXA 4BJ0A 2VZ1A 3ABZA 1UY2A 5LCWL 3WNMA 5HPOA 2EIBA 2YB7A 1UX7A 4A6OA 2YFZA 3IAPA 2J1SA 3I2IA 3BGAA 2VOTA 2VCAA 3AC0A 4JKLA 1TVGA 3IB3A 3DYMA 4PF1A 2WUHA 2W1SA 4TTGA 3GDBA 3LEKA 4XUOA 4DEQA 3HJRA 2QQLA 3VD3A 4CUBA 5IYYA 2Y6JA 3I2HA 2B4KA 3WF0A 1RYYA 3GM8A 3FHQA 5LA1A 3DECA 5C71A 4BXSV 1GOFA 1CZVA 4W50A 2QQJA 4A44A 1F4HA 2E32A 3CMGA 1JYVA 1HN1A 4OUEA 2QQMA 4ZXEA 2WO1A 3FHAA 3ACHA 4LKSA 4KMQA 1IQDC 3W5NA 4BK5A 3OGSA 1JYXA 3T0AA 1W8NA 5DN2A 2VQUA 4QB6A 3T2PA 3C7HA 2W1QA 4MGQA 1I5PA 1UMHA 4P08A 1JU3A 3WNLA 5B4NA 2ZEYA 2C9KA 3BN6A 4MOAA 3T08A 2KD7A 4RYDA 3SEEA 3I3BA 4QAWA 4BK4A 1GUIA 1YQ2A 2WYSA 3MUY1 2X09A 3ACFA 2VQTA 4A4AA 3I2FA 5LA2A 4LPLA 4AG4A 4D0QA 2X10A 1UYZA 4OZOA 1TG7A 2L9LA 3MBWA 3WF3A 5EJZB 1EUUA 4QB2A 2VTFA 4P02B 1GMMA 4KI5M 3I2KA 1OD3A 2YFUA 4M4RA 3GGLA 1GOGA 1DP0A 2VMDA 1NX9A 3CZUA 1BHGA 3P6BA 1JI6A 2LS6A 4KWUA 4HG6B 2W46A 2ZEZA 2VR4A 3GXUA 4E8DA 2CGZA 3MO4A 3WMPA 3VD9A 5LA0A 2W1WA 3NJXA 3OGVA 4UOJA 3UETA 3OBAA 1NUKA 2QQKA 2RVAA 3C7FA 2B9VA 4OMCA 3EB7A 3MUZ1 4CUAA 3K4AA 2Y8KA 5EIYB 5FUIA 4A45A 1JZ3A 2J1RA 1CZTA 4CU6A 1F4AA 5JXGA 2J7MA 1UY3A 1W9TA 3WF1A 3I97A 3OB8A 2J1AA 2VZOA 3OEBA 3T0BA 4GWIA 3ACIA 1LNSA 4DUWA 5DMYA 1DYOA 1CZSA 3T09A 2QBXA 3VDCA 2WN3A 5JUVA 4JHZA 2VZVA 1UY4A 4XVHA 3WNNA 4Z2AA 3E1F1 3K75B 5CYYA 3F2ZA 4XUTA 5IFPA 2W95A 2XHNA 4JX0A 3C7EA 3CIHA 3WNKA 2V4VA 2CDOA 2W3JA 4QDRA 2YG0A 1JZ8A 5B4XA 2W94A 4M4PA 2W87A 3FN9A 3C8XA 1KEXA 2Y6GA 5C7GA 3J7HA 4ZZ5A 4CUCA 3LQCA 2VM9A 3WF2A 1WCQA 4XZUG 1SDDB 3WF4A 2BGOA 4PT6A 4QX2A 2JDAA 3IIIA 3OEAA 3NQHA 2WN2A 2R7EB 2J1TA 2ORZA 1R64A 2JE8A 3K4ZA 2RV9A 3HNMA 1UY1A 4Q56A 2E26A 2XOMA 5J1XA 2WAAA 2QQIA 3IDAA 1H6YA 3CDZB 2VCBA 3LEGA 4ZZ8A 1UWWA 3EYPA 3ECQA 3SEPA 1JZ7A 1GQPA 2E33A 3C7GA 3NRUA 5IFTA 4RN5A 1GNYA 3W5MA 4P00B 3T2QA 1GU3A 3VDBA 4W4ZA 4MGSA 4PQQA 2W1UA 3ETPA 2ZEWA 4YPJA 4CU9A 2WDBA 5JXIA 3WNPA 1PX4A 3HN3A 3LEIA 4QDQA 4QDSA 2CCVA 2VZ3A 1UZ0A 2WO3A 2VL4A 2XONA 3I3DA 1NKGA 4DEVA 1H6XA 3LPGA 2C26A 3NJVA 5G05L 4XUQA 1T2XA 4UI9L 1JYWA 1EUTA
chains in the Genus database with same CATH superfamily
2BMKB 5CCGE 5BO0D 2PCPB 1AZNA 3ASNB 3PU3A 4DOHB 1QOSA 3IKCA 3JT2A 3T4YA 2CL2A 4XCCH 4KWJA 3IDMB 4LHSA 1NPJA 2ADFH 1X4XA 4PJFE 5D5ME 4LMFA 2JB6B 3TFBA 3DYPA 1KJ3H 4WI7A 4K2UL 2R0HA 1ZHLB 2MOVA 2YEQA 4RS5B 4D7YA 1MRFH 1YYMH 4OIIL 3WCRA 5ALBL 1JD7A 1QFWI 5IGXH 4CADA 2P17A 4MS8C 1E0OB 1QSEB 3EHBD 5GS2H 3JTSB 1RXFA 3UG3A 3WY3A 2C6SA 4Z7VE 4MGYE 4WI0A 4CN4A 1W04A 2HT2C 3BP7A 3MQIA 1GP6A 4FFHA 3ATEA 4ZQTA 4PW9A 3CSTA 4HKXA 3ZXAC 3BZEB 2JI2A 3UGFA 1PZAA 3LZFH 4I89A 1TQTA 1FV2A 2RE9A 2E4TA 3IU4H 5JYMA 3QULB 3RIFF 2HWC2 3MROA 1A21A 4XNUH 3ZTDC 1PMIA 2P4AB 3AXLA 1URIA 5FUZH 3TF7C 1T80A 4HUWA 2VLMD 1E9QA 3WEOA 4CCOA 3U4AA 5F7YC 2VLRA 4GAYB 4I3RL 1WW4A 4E41E 2IH3A 3MV01 4R90H 1H5BC 3DIFB 3OWRA 3BDYH 2VDOH 4G1EA 4Y1AE 2Y5TB 3RFZB 2A2QT 4UANA 5B7MA 1A1OB 1UA6L 3BCFA 2E31A 5F97E 2OL3L 1N18A 3L9EA 2FUTA 4M5TA 4XC3L 1CX1A 1NBZA 1ZA3B 2ADYA 1QLFB 1N1SA 2BXYA 3HZMB 5DMKA 1N4XL 2BS71 5GRJL 3SO5A 5MEQA 1AS8A 1FUNA 4GBXD 1UJ3B 4BQWA 4CCKA 2IPUG 2CJSA 5FKPA 2FR4A 1Q0YH 3FO2A 4PLJD 4EZJA 4FTEA 1T6GC 4GZ9A 1WZKA 1A4JA 3KPSD 4JMNA 4NCC2 2D3VA 4XN2A 5I1EH 3UG4A 4MJHA 3QZWB 5F7UA 2WLPA 3OGRA 2VJ0A 5GSRA 1KWKA 3DX6B 5FB8B 1KC5L 2R69L 2GTZB 4GIPD 2Q1EA 1K4DB 4L4VA 4OLEA 3V95A 3EMRA 3JWOL 5DHVA 4XT1C 3BZFB 2CRIA 2GEEA 2YA2A 2Z7ZA 4BZ1A 2F8XC 4EOWH 3WDWA 3EADA 2VNVA 3QQ4B 5D1XC 5HYSB 5JMOA 1M7UA 2V5MA 4B9YA 1U0QA 2BINA 3IFPB 4CVWA 2YWYA 5ISZE 5CGMA 4NI3A 4ADIA 2OUJA 5FFOC 5CKAA 1PD1A 3VGFA 3TBDA 3RURA 1Q1JL 1WCBA 4WJ5A 4U1NB 5F1IB 4X4XB 4L2NA 1KYOJ 4ZPVA 2AK4E 4JW3A 4MQSB 4QHKJ 3AMLA 5FM4A 5HP5A 1NBCA 4FFIA 1XIWC 1QO3B 2QQLL 3HPLA 3AKQA 5F9OL 5LATA 1P5VB 3MNWB 3PYCA 4CCJA 2DQHH 1ND2B 3K2UH 1YN6A 2VO5A 3CXDH 4AF9A 3DK2A 1G7PB 1KGYA 1FNEB 4BQ8A 3BD3A 3LKSA 1R3JA 4KTEL 1YFUA 4RZCB 3U79A 4L9LA 3NJFA 1NFAA 4JO3L 2QR0A 3X3GH 1E3XA 1OF3A 1RVF2 1BF8A 3ARED 4EVNB 2BJSA 2X5IC 5ITBH 3PJYA 3VZLA 1YQ5A 2X1WL 2JI3A 1WBYA 4QI3A 2NY1D 1HSAA 5F6IB 3VI4E 3TWCH 1OD5A 5KBMA 7PAZA 5FZLA 4HEMA 5C3IA 1TEFA 4OLVL 5B2GB 1LAJA 4KDVA 3RY6C 3U46B 4PJEA 1WRFA 3DBSA 2GAZA 1QHOA 2IQ9L 4H25B 5IOPA 2DQJL 4KH2A 5DUML 4Q4V2 4LMQI 3OPTA 1DBJH 1I3RA 1YNTA 4YSPA 3BSHA 1UM6L 4CDQC 3CFIC 3IETB 2MJWA 3TS8A 3AMMA 4KKCD 2WO2A 3BTYA 4WDIA 3LEXA 1BLIA 4I2OA 2ENSA 2IPUK 4JFQA 3O7OA 2MNJB 3B2DC 2J5WA 4PI2A 2Z34A 2WKGA 2XU9A 1HKFA 4L5FH 1OZUA 2OLDA 2FGZA 1TJIL 1HILA 4U1LA 3TBSA 1CQKA 3OGCA 2LW8A 1IM9B 1JXJA 4IEQA 1TCRA 4X5RA 4UINL 1ZX5A 1MFDH 2JK5A 1R0AL 4LT5A 1K3IA 2QGDA 1E3FA 4I9WD 2OKMA 4O51A 2NY2B 2BFVL 3A0KA 2BFUL 5HV4A 3SO3C 3GEFA 3MREA 1MUJA 2Z0BA 4WAFA 3KNBB 2UYBA 2PPEA 3FTUA 3NFPA 2Q0ZX 2VMJA 4M56A 4WV1A 4L8SB 2UWCA 3NN8A 1KIPB 2BZDA 4M5ZL 1O91A 4P57A 4LGPB 3JCIA 5I1GL 1M7IA 4LEOB 1R081 1IM3D 3U30C 5GZNC 3EJRA 5CSGA 2X1OA 5DFTA 2CR6A 4TRPH 2Z7UA 3AP7A 4AAXA 5CP3A 4G82A 1LGCA 5A3LA 2H6BA 2ZYIA 2IXQB 4XP4L 1X4ZA 2FEDD 1IIIA 2Q5TA 5E8DL 4KZDL 1H6FA 4XNZC 5KVFH 1RMU2 1UACH 3HLAB 1IBHA 4F33B 5BMFL 1YY9C 4BWUA 1AR61 1JFHA 4K40A 5DTFB 1ZTXE 2WZ6A 3GHPA 2JJ6A 4PCKA 4CSWA 3HS0C 1E50A 4WZ9A 3V6OA 3HOGA 1WK0A 4FI7A 1R3LA 1L5GB 4WHYH 4OKVA 1AIZA 3FYEB 5D1ZB 3O4LB 2EEBA 4DUXA 5I0ZA 2DYCA 4L92A 3L9YA 3DXAA 3SBWC 4Y2NA 1R4XA 3ABZA 2WINB 1F4WL 3ZE2B 1A02N 4WM8C 3FTYA 1U2HA 3KYOA 3CWGA 2YB7A 2DAVA 4MD0B 3HBPA 1ZXKA 1JDCA 1SUHA 4Y2OA 2D6MA 5DK0B 2F53B 2VG9A 3I2IA 4PJCE 5CD3B 4TSCL 1INDL 2R0KH 4R26L 2C34A 3PDGA 3GCWA 5E9DB 3KYKL 4LSRH 5TD4A 1DDHA 3BP5A 3TPKA 1G7HB 4TTGA 4MB5A 5E1RA 2EIZB 3AWGA 5J57B 4XUOA 3JUUA 2GI0A 1NJ9B 1B88A 4MD5A 1QABA 4UT9L 5C2BH 3PDDA 4I77L 5CINL 4GO6B 4A7YA 2ZUXA 1YCIA 4AM0B 1YVLA 1MCBA 4GG6A 1D4VB 5DD5L 3PU8A 4JQIL 2Y6JA 3ULVL 1CPMA 3L3OC 3NW4A 4PJAE 3JV0A 1WA2X 3EBGA 3GM8A 2FE0A 3HNVL 3ARGD 2VLJD 5JOFA 3F95A 2IADB 5L36A 3N9MA 4GQRA 4IYKA 4P23D 4OGXH 3LY6A 1A4KB 5C71A 1JF6A 2AAAA 4FLQA 3J8F3 5DK2A 5TFSH 2IANE 1D2QA 4MH0E 3OKKB 1CD9B 5C0BB 2NY6B 2CM5A 3QUHA 5DFAA 5DDHA 3OGJA 2A6DB 5D4JA 5AZ2H 1USQA 2EDNA 2J3SA 2ED8A 2CRZA 3CMGA 1T1YB 4BH8A 5BZDB 2VVEA 3QJRB 2Z9TA 1KCWA 1NC4A 2F9BT 5C0CB 5HHOE 4YDVB 1ZT7A 1X5FA 1TME2 1KJMA 1MFAL 1R091 4OZGE 1T83A 3B8YA 2IAMD 5DEGB 3RNQB 4EI6B 3S96A 5K9KA 1RUAL 4NRYB 3A6BH 4XO8A 4FI6A 1JGUL 1S0FA 3WTSA 3POSA 3BPLC 3CVHH 2KERA 2VQUA 1FFPA 1NFDF 2BC4B 4HHAA 4X7EC 5LNEA 2FLMA 4RWYL 4PF5A 2ZUQB 2OJ1A 1HKLH 4B3EA 3VVVA 4F7EA 3POJA 1CFBA 3SGJA 5HDQL 1OY3B 4R0LB 3MLRL 4OV5A 2XFXA 1WA6X 4J3BA 1J8RA 2BNNA 4C56B 3VD1A 2Q3AA 2DVFA 5HI5D 4G4FA 1UOGA 3SDCD 3N9NA 3G5VA 5KVDL 4Z2WA 5HI3C 4AUUA 1YPZA 1FNHA 2WXGA 4R2GC 3IRZA 2Q8CA 4XC3H 5TDOA 3CC5A 3HJ0A 3HAGA 2R8SH 3ACFA 2Y07L 3MI8A 5GLUA 5E4EC 4BSJA 4LPTA 5TE6H 2BNRA 4LF3B 3VI3E 1A2YA 2HJFB 3VYOA 2HXAA 2D9CA 5A2IH 2WZPA 3MF6A 4MVTA 1HI6B 1MDAA 2R4RL 5CJ8A 1MCDA 3ORJA 4G8AC 1RZ7L 2CIIA 4NKIH 1GKBA 3LF7A 5GZDA 5B3JF 2IG2L 3DOSA 2GABA 3VX1A 4AV4A 5IREA 2VMDA 1OD3A 3OR6B 3F6JA 2X8KA 1AKJB 2UY6B 2MWCA 2VABB 4JFYA 3ZKNC 1JZHA 3FQ4A 2NMNA 1KELL 4IEFB 2GJ6A 3MNZA 3ULVE 4AYGA 3MRKA 3PXLA 3TT1H 1T0MB 4X6DB 5IV2A 3VA6A 3TCTA 4FP2A 4AVBA 3G6AA 4XVUC 4FX5A 3UETA 3D39B 1T5WA 3VXRD 5FZAA 3PDQA 3I50L 3L13A 1ULFA 3NCYP 5DJAB 5AVAA 2LTQB 4P99A 3VXME 3VRLF 5CEZE 1EXGA 5JIQA 1NA1A 2VC2H 3MV9A 5C97A 1F3DJ 3WFCH 1X7QB 3CL1A 5F9OH 5AUMB 4RFNC 3KL5A 2PHFA 5DAVA 4Z3GA 3IGAA 1FGNH 1RUMH 3KM5A 2LM3A 2A75A 3BUIA 4WI3A 5EC2A 1EA9C 3TBWB 4Y22B 1Z3GH 3PABB 3UTTD 2IVJA 3HFML 1J8SA 2E7CA 1M3JA 4KTEH 1V6LA 3QI9C 1J48A 1EERB 1UB6A 3LKRB 4RAVA 5FPVA 2XZQL 3DPRB 3T09A 3ARBA 1NDGB 3HC0A 3O45B 2BNMA 1KCSH 3VWJA 3S5YA 2JXMA 2KXLA 5JDBA 3B5GA 2AS5M 3MV8B 2X70B 3QO0B 1RITA 5HHVH 1UOWA 5SWQA 3NSJA 4AI0A 1MLCB 3E1F1 4MB1A 2H1XA 4QXUH 4P5TB 3EW3B 3ISYA 1IGTB 5KVDE 5F2FA 3SITA 4MZIA 2NXYD 1MHCA 2G3XA 4HJSA 3UYPB 1SLVA 2PO6C 3IFNL 3WYRA 1BZ7A 2H41A 3IN0A 2X7LA 4JX0A 2ZNWA 3T2TA 4OLWH 4DAGH 4NZTH 3BMVA 4M48L 3WNKA 4BQ3A 3V4PH 1TOXA 4X8CA 43CAB 1TPXB 5C9JB 2CZNA 4P2RE 5DHYB 1ST8A 2GJZA 5C0FA 1JUFB 5B4XA 4Q4IA 1OE1A 4R7NA 1JPSL 1ETJA 4V1DA 5GGVL 1A9BB 3FN9A 3QDMB 4MCYB 1NTDA 1E9PA 4G3YH 3SE3A 3TZVC 1UXSA 1MS1A 4BHUA 3BXNB 4IDZA 3Q2WA 3ZSLA 4HLTA 1M2OA 5C5TA 4DEWA 2FX9L 4UBDC 3VFPA 4EE2A 1WCQA 4NO2B 3WEXB 3MO1B 4JDTH 3LSEA 5DEFB 4K15A 1YDPB 3BWAB 5JOPE 3WIFA 5DI8A 4M02A 3OEAA 3HRZA 4WW2B 5DJXB 2FD8A 2WZPP 1VGEL 4KQ4L 4MXVF 1LULA 4LOFA 4Z7QB 1CICA 2JVUA 3SKMA 5JXAL 2ZGNA 3BW9B 1G6RA 3ZTNH 2YPLB 2PYTA 1DEEA 3DTXB 1QQP1 3FUJA 1NMAH 5I1GH 2QKIC 3JVFC 1H9DA 1UY1A 4BH9A 3WNJA 4WEBH 4R9AA 4OAWA 2VCMA 3U0TB 1ZA6A 3EYFA 3VJ6A 3KBFA 1SLTA 3EYUH 2ATPB 1RY7B 3VXOB 2W59A 1Q9WA 1DVXA 2ZX7A 1IAMA 1Z0NA 3LEVH 3KLKA 3ZKXC 5AYTA 1HE7A 5ICZA 1MJUH 1IKNC 5EEYA 3L17A 2FSEB 4MZ2A 4POZC 1E90A 3D87B 3IJEB 4IU3A 3VDBA 3CHQA 1BYPA 2Z69A 3O2DH 4IRJD 1P2CB 4UQ9A 4Q0PA 5KSVA 2D3PA 1K5WA 4MDJB 4DO4A 3GI8L 3ZTEA 5J37A 1FFOB 4I0BA 4KXZH 3AFGA 3PRZA 4N2MA 2F74A 3L7FA 5EORL 3DJRA 3RWHA 2WXHA 3THML 1DBML 1THAA 1AX1A 2O6PA 4R9CA 4IRZL 4TVSa 1MCIA 2VDPB 3CXHK 1LWJA 3D85D 5AVUB 2O72A 3TN91 4J1UA 4M7LL 5CNHA 1T03L 1G9BA 3L7EB 4E2SA 3MW2A 2G3MA 1XB8A 1MCOH 1T2XA 3TB0A 3QJZA 1LO4H 3R18A 1HEZB 4NKQB 4HWBA 4Q4EA 3SYPA 1YUHB 4TUKL 3TBVB 1B4JH 1KB5A 4PJ5B 4RSYA 3SDYL 3LZNA 1WBLA 4CDWA 5D4IA 4W81A 4XVSH 3UTQB 2PFWA 4HG4J 4YLZA 4B9ZA 1H5BA 3EFDH 2VC9A 2MIZA 5CHNB 4ZZKA 4L3EE 1NGXA 1GJIA 4F80A 1B0GB 2QZQA 4JRXD 5DHXB 5INDB 1NAMH 5JLZA 3DCQA 3KVQA 1BYNA 2BHZA 3W39A 3U10A 3LXBA 4HJUA 4BELD 3J4UH 3TCLB 5GIRA 2ZJSL 3CH1A 3ZO9A 3FO9A 1U8JA 4I1NB 4JFFB 1YXWA 3V10A 3MLSH 1I8AA 2D7TL 4N1EA 4KROB 4NJAL 3GNEA 4Q0XL 3S7EA 4META 2G3NA 2VQ4A 2EALA 1A5FL 4APQA 4KZEL 3SKNB 5MEND 5GZEA 3MA7A 1L9QA 4JO1L 2W9DH 3B7RL 2C24A 1LNUB 3RDTA 2GY5A 1Z7JA 1A6VL 3H7BB 3U9UB 2XJQA 4YW5A 3U1SH 2DY2A 1QVOB 2APWA 3MJ8B 3OPZA 1RUAH 1OAYH 4R83A 3E9UA 4L3FA 4UB0H 1JGUH 1VBC2 4YFWA 1W8FA 3VBFB 1ADWA 4EJ1C 1CAWA 2CDPA 3AU1B 3ZN5A 5J9PA 4X6FA 4WI8A 5KS9F 1IL1A 3R4SA 5JORA 2ATAA 1S2KA 4N26A 3JWNH 4MLOA 1CU4H 1YJDC 3N06B 3QJFB 5DZNA 1MH5B 1CMOA 4OU3A 5FFOA 5T5FA 1ET8A 4KBPA 5DS2A 5JPMC 1CFVH 5TK2A 1WITA 5ESAA 3ZO0A 4B41A 4U36A 2A6JB 3QWRA 1S9YB 3QBQA 4FNPA 2BNQE 1CN1A 3HR5B 1D2OA 3RKPA 1XIWA 5EUOA 5A2KH 1R3IH 3SD5A 5B39G 1XEUA 2YAFA 2P7TB 1T0OA 4IS6A 5IFHH 2YAPA 4L4VD 3E8UL 2VDQH 1HXKA 3QDAA 4YHKH 5DMJB 3FFQA 5ID1B 4CVUA 1UOFA 4YX2H 2OJZH 1PFOA 2NZ1A 4LCYA 3PVNA 4Y1ZA 4XHBA 3DGGB 1L7QA 3T8XB 1PZUB 1HK6A 4EWDA 1XF2A 3PDOB 2CKBH 4FTVE 2N3JA 4MNQA 7FABH 1H1IA 1U8MA 4UF7C 4FPKA 4C55A 4M8QB 3AY2A 1NCCL 3EYVA 1A6AB 2XXCB 3L3DA 2X5IA 3QDJA 5CLTA 2IG2H 3CX2A 1I7TB 4O9HL 4J12A 5DA0B 2GIXA 3M17A 3OAYH 5K59F 5EUKA 4PJDB 2LQRA 5JHLH 2WOBA 1NCGA 4HETA 1E4HA 1OAKL 3WG7B 4BZ2L 3H8OA 5FWRA 4AW7A 5GS0D 1CR9L 1UMIA 1HS6A 2Z92A 4TVPL 4XO9A 5AVYB 3TT3L 4Z76B 5I1JL 5J8OA 1PZCA 2HJKA 1B0RA 5KVGL 1M2VB 5AAWC 2MCPL 5I2IA 5IK8A 5DVLA 5HDBE 1NIAA 1PGL2 3AT8A 2D4FA 3CZLA 1O9ZA 4F37K 4CDQA 3GBWA 1B2WL 3I50H 3W0WA 5KXBA 2WLYA 3GMOB 4K23L 1UURA 3OAZH 1A3LH 4UQAA 4LKEA 4IE0A 1GRWA 2Z31C 4B27A 3ZE1F 3H2WA 4IK7A 4IGBB 2CA4A 1II4E 2DBLH 3B69A 1RHHB 2YA0A 3WJLC 4I01A 2J72A 5ANMB 5BV6A 3NSXA 2AF2A 2VDML 3JUZA 5T33L 1KN2L 3N35A 2BIQA 1AGCB 2IAAC 3NTCL 1PSKL 5ERWA 2J1VA 5A3MA 4E9KA 4DKAA 2D5HA 4OSUL 2NX5B 2MQ0A 4WCYL 3ELNA 4OZ4A 1NOLA 3DKHA 2IZWA 3KPRE 4UBGA 1CQYA 4GQ9H 1KEML 2ZYSA 3CVHB 3GMLA 2V5RA 3C5SB 1S9WA 4OZHA 4BDVB 3LRMA 3ZZQA 3U4XA 4EZMA 2D6LX 1FCGA 1NCWL 3CE1A 1TEGA 4FHKA 1CLOL 3D52A 3O81A 4RX4A 1P69B 5GZNA 1J3RA 3FUIA 3POCA 4N8UA 4ZTPH 2BEOA 4XFCA 1SEBB 3CUPA 4LBEA 4R97C 2JCCF 4DVBA 4I09A 4PBOA 3E6DA 4M1GL 1QRND 4L18A 4N0UB 1MWAH 2W60B 2G3ZA 1FNFA 1NFIB 2HPOA 2YK1H 4LLYA 43C9B 3TBTB 3A4EA 3MSPA 4GXVH 3I2CL 3MRHB 3H1WA 1PEZA 1BAGA 4B53A 2VDRL 2AITA 5JW4Q 3HS0A 4GO8A 2PHUA 4WEUD 1JPSH 2Y7QA 4CE8A 4ZO8A 4XN1A 3K3NA 2WQRA 1BZDA 2C9SA 5LGHL 4RGKA 3D05A 4OCWL 2F17A 3SBWA 5IVCA 1C5DA 1IARB 4G7RB 2A0LD 4LBAA 4YO0B 1U2YA 4GLRI 3MGTB 5JHMA 4WM8A 4N5EC 5EJ1B 2X3AA 1WLHA 1E3ZA 2OXHA 1T1WA 2W9XA 2QHRL 2C9AA 3LZQA 4NZ8A 3CLFL 1AR91 1SJHB 1TDQA 2YC0A 3GS0A 4ARXA 1RUH1 5T8IA 1ZD6A 4M3KB 4TUOA 4FL4B 3OXRA 3QHFH 3RL2B 5KJRL 2AZ5A 2M26A 1X9TA 1J1TA 1A4BA 1AFVL 3MRLB 2A3YA 4AGVA 4WUUE 3RI9A 1PIGA 2ZNXA 4Z3TA 3CEWA 3VTTA 5F9TA 4M3CA 1YECH 1TG8A 1KCBA 4UYPA 4H8HA 5EO1B 3ES4A 1FZMA 3GXIA 3FLPA 4AL9A 4HBNA 4PRHD 4HALA 4NIGA 1YMHA 2I27N 3GRWH 1OW0C 2HX8A 1DDLA 3OJDA 1QSFB 4B7KA 3FT4B 3L3OA 4Y4KC 2C1PA 4AGPA 2H9GA 3SE9H 1ORSB 2D2OA 3MLKA 1SVZA 3NEXA 3MLUH 2XRAL 4A6YL 1H1AA 3N1FC 1NANH 4Q89A 5CKGA 5B4MC 1U3HB 3WNMA 4LA3A 4MUVA 4AZZA 4M6MH 4DIXA 2YFZA 2J1SA 4NLHA 3QXDB 3BGAA 1PO21 4P3CH 1QBLH 1OP5K 3J8F7 2AV7A 3IB3A 1MEC1 2VLKE 4WNQB 1RUD1 2LTNA 4GMTL 3F85A 4LAJH 1QNZL 5J6HB 4YDKH 3EDKA 4HSJA 1ZLVK 5FMDA 1OLLA 3SDAC 4AKQA 4JZNA 4AL8L 1IPJA 4KO7A 4ATEA 2D31A 2AXGA 1J05B 3N9OA 4Y1TA 5A3TA 4HOZA 5BS0A 2BVUA 4NQEE 1FNLA 5H94A 1AJOA 3VVWA 2RR12 3ENRA 1O6SA 3GMNA 1AR63 5EN2A 5F71A 2DFBA 1OGSA 3EIFA 2V6HA 3SDYH 4P2QA 3SGDH 1IVTA 1ORQB 3KPOA 3K6SA 3O3DA 3P11L 3FHQA 1BKZA 4DGIL 1UXLA 3H9SB 4R4NC 5C9AB 3AFKA 2X4QA 1GR7A 1T1ZB 3MYJB 2UVEA 5A2BA 4BXSV 4LK7A 3I6LE 3MPPG 1IQWH 4KMTL 5AW0B 1B4LA 3I02B 4HLZH 1OSZA 3BZ4A 3NA9L 4S2DA 1J9RA 1GY1A 5KANG 1DN2A 2P42B 3FHAA 2P5ED 4P59L 3HB3B 4IBVA 1OSEA 2FL5B 3QUXC 2IQAA 4HCRL 4NP9A 1Q8QA 4X80H 4JANB 4UOZA 4PVLA 4H0GA 1NH6A 2DIEA 3PP4L 4U31A 2EYTA 2RM21 1RZFL 1HNYA 1E5AA 1HRI3 1MI5B 1OVZA 3AMNA 4R4ZA 4AI2A 1S7UA 4DOHE 1DO6A 3WFHA 4BSWB 3VFRB 1UL9A 5HD8D 4PS8A 4W9JC 5C0IB 2F1AA 4MOAA 2I32A 2MNUA 4J28A 5FYKE 1NE4A 4ZMOA 5JDSB 4L48A 3BUBA 1JWSB 2V2TA 1B35B 4Y9BA 4XCNA 5KSUA 3IFLL 1U58A 4G7VH 3V7AG 1SEQL 2LFGA 5CXPA 3WE1A 2BNRD 1OTSD 5CFDB 2X09A 1MCNA 3ARFB 4WWNA 3QC6X 3N5AA 5DJ2A 3TYGH 1E5UI 1CR7A 1TYJA 2QZ2A 3SYCA 3DL3A 5EBLB 2WZPD 5FYMA 1V70A 2QV2A 1EV2E 5BZWB 5GSVA 2KZKA 3J2PA 1YO8A 1U3JA 2ZPKL 3ECBB 3SGEH 5FYLH 1AO7A 2I07A 3BSGA 1TG7A 2ADJA 2IH1A 1G7IA 2WJSA 1JN2P 1EUUA 3HI1A 2CLVB 1EAPB 4JFHD 5BV7C 4M93B 4KI5M 5TQ0L 2BVPA 1BVLA 3HNSH 3NIFB 2GJ6D 1SN2A 3WX5A 2WZR1 2J6EH 1R082 3QI9A 1IVLA 4ADGA 1QJX1 3SPVB 3RPQA 3CSYB 4XF3A 2B3RA 4QY8B 3PHQB 3MLPA 3GXUA 2V0AA 2JJVA 4WWKB 3HN5A 5IAXA 4U1KA 2DM4A 1VCAA 1DVZA 2YU2A 1POQA 2ESVD 4FSJA 3V2AR 4AITA 1H3PH 3TV3H 5FZOB 1N6VA 4L3CA 2ZMLA 1EO7A 1H0BA 4K3GA 3V0DA 3MV9D 2Y06L 3PJQA 2RVAA 3MRQB 4BZ2H 4U6VH 4COWA 3M2MA 2YARA 3BQUC 5FBZA 5H4ZA 4TVPH 5F0MB 5HI4D 1C9SA 4INDA 5FY9A 3E3QE 4JFSA 4FPYA 3L3HB 4NJ9L 1XWVA 4QKFA 4DY3A 4GQQA 4A45A 1G0XA 4PRBA 4YZ1A 1I1AD 3DX7B 4MRCA 4K23H 3RYKA 5A3IC 1U92A 4AI9A 4F2FA 2OR9L 1C7TA 5HYJD 2DMBA 3RVVD 2WWOA 2W0LA 1OA4A 3HG1B 2WLHA 3ARBD 4M1DL 3AROA 5FZMA 2VZOA 4GI8A 4MAUL 3GIZL 4GQPH 1MR5A 3UJJL 3VWJD 1RV6X 3TZVA 1LNSA 1YWKA 4M3JA 3P3TA 3ARWA 4QQHA 2C5DC 4KPHH 3VDCA 3WR0A 4OI0A 1WWBX 1DJWA 5I19H 2ZS6B 2VUKA 4OCSL 1PSKH 4ZW6A 3RVTC 1WCDJ 4YL9A 3NZ8B 5IVNA 1G5GA 4Y0GA 4Z2AA 4ZJ9A 5E2JA 1WBZA 2ITCA 3G6JA 5DJ6A 1LMKA 3SQBA 1MNUL 5AB9A 1KEMH 3AT0A 2XG5B 4JFDB 2CIKB 3F7RA 2V09A 1KXTB 4H8UA 4YL4A 4QF1B 1JWUB 2K0GA 2E7BA 3VFTB 3KHQA 4DPCX 1LM8V 5J09A 1FC1A 3WFEL 3KLHD 2QKIA 3I9GL 2XDVA 1C1EL 3S2AA 4QHUA 3QIWC 3WXPA 4V1DD 3SCHA 5DGRA 12E8H 1OAZL 5IQ7L 4R7DA 3HMXA 3DRQA 3PIQA 1JNHB 1L7TH 3HS9A 3QAZB 5GHWH 3LCYA 4B9PA 3J7HA 5E6ID 3RWEB 5BRZD 1QMUA 5FDWB 3IIAA 1L7IL 3MCG1 4RMTA 5CR1A 3K8KA 4L8CA 4AQ1B 2H3NB 3TBCA 2XI9A 1ZVYA 1R092 3BN3B 1S0DA 2RMU3 2B8OT 2WWNA 4BWOA 1LQSR 5IM7B 4HJGB 2GMEA 3QP3A 2IV9A 1AOZA 4P4RA 1LO2L 2D43A 2OJEA 2CKBB 3ZXFA 4R4BA 1BVOA 2V3FA 1A6UL 1JGVL 1ASJ1 4J25A 2Y25A 2OMUB 1ND0B 2YLHA 4AE1A 1DQ6A 1BF5A 3C6LC 3DROB 3N3EA 4KVCL 3ALWA 1CF8L 1X6LA 2DEXX 5C07B 4F91B 5KYUB 3LTVA 4K94C 1FVEA 1OD7A 4DKFL 3U0PA 4AQSA 1O6UA 1XMWA 4LCWD 5JZ7D 3TYJA 3F8UB 1W6LA 4FFTA 5MP6H 4RQQB 2VDKB 4N9IA 2NDGA 4L4JA 2Y9RT 5HJ3B 2NLJB 5AKRA 3N85H 1CIDA 3I6KB 4ANKA 1WHOA 5IIEA 3QQ9C 2XUEA 3WW3A 1S6NA 3EDJA 2R0ZL 3VGIA 1FE8L 4NKOA 1DJXA 3F2LA 4ZK8A 4P46C 3KDMA 3AKTA 4I48A 4X7CC 2NTSP 3BB6A 4QRUB 3BDBA 4BGDA 1NFKA 5CCKL 3CTTA 3FU9A 1DJZA 2VH5L 1ED3B 1H6XA 1ZLWK 4V11A 4HK9A 3Q6FA 4X8JA 4NENB 3I59A 2YZ4A 1PNFA 5IHUL 4JB9H 3AVSA 3MPBA 3KQRA 3LQAH 5DQDL 1PZ9A 3NEEA 1RIHL 3ROOB 2NUPA 3PWJA 5D7KE 5KN5A 5JHDD 5D1QC 3B7TA 1JYWA 4XVJH 4Q0QA 4C83B 1W06A 5BW7C 2PHTA 2P47B 1S7XA 1UCTA 2OKXA 4IIQB 1V27A 1OCWL 2DL9A 3PAYA 1PQZA 3FB8A 3T0EB 1NQDA 2X28A 4XFFA 2APVA 1U8LA 5GRUH 3H1ZA 3O4LE 1ADQA 5FZFA 2DYPB 4RISH 5SWZB 2YA1A 3X1EA 4HFSA 4XMKH 3ZE2E 4OFIA 2CWMA 1HU8A 4K8RD 1QYGH 3RP1A 3D50A 5JPMA 4IOSA 1MWAB 3MJ9H 5AOJA 4RAUB 1XDTT 1SVBA 1K2DB 2GB2A 2R15A 5EZIH 3VG0L 2CO6A 1K4CA 3VXNA 2Z93B 3VE0A 4APQD 4AUYA 4ZMNA 5JPNB 2F53E 2R29H 1CBVH 2Y22A 5E5UB 3RDTD 1CUOA 4BH7B 3QDGB 1PDKB 4KMTH 5E9DE 2OSYA 5EIVA 4ZXBC 5T3XE 3OD0A 1BREA 3RPIA 1IT9L 3G7DA 4FPCA 5D70L 2HG0A 4QT5B 3EH4B 4LE4A 1W6NA 4OI8A 4F15C 1FMD1 3J7LA 1BXUA 4WNSA 5CBAA 4XXCC 5CSZB 4PVBA 4TSAL 4XBNA 3UDWA 3ZHNA 3ZL2A 2XN0A 1JV2B 2FRGP 1TXKA 4HD5A 4PJGA 3ABMB 2Z0UA 3PP4H 3L9RA 4MMYB 3V4VA 4A2DA 3ECWA 2KR2A 3VBOB 1QJY2 4ADJA 1X4YA 2WBWB 1YEHL 3ATDA 4BISA 2YXMA 3MFFA 3NCEB 1XB6A 4EN3C 2GSIB 1MHPH 2ED6A 3FC8A 1MIEL 3RX8A 5DPNA 2WMPA 4XHJD 3QWRD 5C7XL 1C12A 1A0QL 3UNPA 1RQ5A 1H15A 1XIWD 2WBJB 5C0BE 5T1KD 3FF8A 1DQQB 5E2VL 4WHCA 3WKYA 3H7YA 3AQXA 3ZXLA 4BLJA 1D7BA 5C0AA 3B9KB 3WG2A 4MMZB 1OBNA 4IGOA 2B3IA 4AVKA 4YSSA 5AAWA 3CVDA 5C09B 5C0CE 4RH4A 1ONQB 4FQJL 3LAGA 1FGVL 2FCUA 3DYOA 4GP4B 3RNSA 2ZCKH 1UWXK 5BQ7A 5KSAC 4HSQA 5AVXB 2NYYD 4MNQD 2DF3A 3D25B 4NNXB 3QUYC 3TFKC 2ZAIA 4CMHB 1DCSA 3SJVA 1LQBC 3PQYD 4RGND 4PR5B 2BGPA 3HQXA 2UXTA 2Y6SC 4Z95L 2GBVA 2VIRA 1UB5B 4G8EB 3WJLA 3QS2A 5BJTB 4Y19A 2JE9A 4GEIA 5DVKA 1ZT1A 4G1MB 4FFZH 1J1PH 4HONA 2BSTA 3FU7A 1QQP2 1G87A 1KCUH 4H0LC 1HCYA 3O0LA 2WVUA 1XCQB 2FZ2A 1C16A 4JVUA 4C56E 2BZCA 4PIXA 3GYDA 3JYCA 5LCVH 3PUCA 5DCCA 3L5WA 4HG4K 2GSGB 2QQNH 4EUPH 4IK6A 4MX7B 2VERA 4ZT1A 1SLUA 2YC2A 3BH9B 3QEHA 3PWUB 1Z3RA 3W0WD 4E36A 2WZEA 4UFIA 3D18B 1DSFH 1DQ4A 4HC1L 2O5ZH 3L95B 1ZS8A 4MDIB 5E1HB 1BJMA 1FFRA 4ZOEA 3QCTH 2BVEA 2ZSVA 1FL6A 1XAUA 3DV8A 3RWGB 1NCJA 1FNGA 4HA1A 4YN3A 4FI9A 4M5YL 3ULUC 3DUIA 2P24B 3MRMB 1EEZB 1KLGB 2ILMA 4UQ2B 1JPFB 2VISA 4X6EB 2XR4A 1OP9A 1RZJC 5KW9L 3U75A 3CDGA 3HN1A 5E08L 5EZLA 1NGQL 2PWHA 3P69A 3TN92 4NHCL 2YQ3A 2YSSA 5C3RA 2VMFA 1JW6A 3NCBB 3OB0H 4UT6A 5DF0A 4NHMA 1JMUB 1N68A 1AE6H 1SJVA 2NXZB 3FOMB 3EJUA 4X6DE 4JRYB 3D39E 3QB7C 4O02L 2Z4TA 1OTTD 2GK0A 2RFXA 3RYMA 3VFSA 3MX0A 5MEPB 4PGEA 4ZUSA 4QX0A 1J0IA 3B2UD 1JZIA 3EO9L 4AH2B 4ZY9A 3L5IA 5IESL 2LU5A 1UYPA 2EIKB 2WLJA 1ZHKA 1FBIL 1NFDB 2JKXA 1GMEA 5H9PA 3VXTA 3WHUA 5KJ4A 1IZKA 1BG1A 4HJTA 2DQFA 4KRMB 3DI3B 5FV2A 1OF2B 4OI7A 3NV1A 2FTAA 4IJTA 4MJ5B 1AQ8A 4P9HC 5LAXB 1WFNA 2BQPA 4JKPH 3UESA 3AZVA 2QMKA 2FZ3B 4ELKB 3DX8B 3D3AA 4A7QA 4R96B 1PK6C 2CGYA 4LLOA 2YUWA 1OW0A 2PAKA 4HCGA 1XF5A 1IGCL 4Y4KA 4M6AA 1WLTA 4JDOA 3WXWH 4HANA 2PPFA 4FMVA 3GLZA 3LRLA 4Q2ZB 2N7AA 3ZRCC 1JBJA 3FQNB 2XJTA 1BAFL 3FH7A 4FQCL 3FONA 25C8H 1Q8MA 4ICWA 4PJBA 3MV8E 2DYRB 1Y1DA 4PRAB 4AG4L 4CUGA 3MV11 2GJRA 1VFMA 2VDPL 3STZA 3LIZL 1RMFL 5FPXA 5AWNL 4Z77B 4H7MA 1LO2H 4L8QA 4DW2H 3DHJA 3VKLA 5K1NA 1A22B 1DHKA 1MAJA 4YXKH 4UM9B 2IOIA 1R9FA 2XJPA 2K7PA 2CO3A 5D4QA 3BPNC 2ES3A 4G2AA 4M0NA 3PL6C 1E43A 3HS8A 1U91B 1NAEA 1RULH 3SDAA 4XBEL 5JUEH 2RD0A 4Q4Y3 4GQZA 2EDKA 5M94B 3QG7L 4GFTB 3QDME 2V2XA 3HG3A 4AK2A 3EJKA 4KNQA 3FHEA 3PF2A 3FZUC 3ZLIA 3IMBA 3G5XB 1WF5A 4H2AA 2AJZA 4L8BA 1R1CA 4LL4A 4PWEA 3SKVA 2QFPA 3OR7A 3WUWA 1J7VR 4NZJA 4XQWA 4I0KA 4PGBB 4QRQA 4R4FH 1GZWA 1LP9B 4ZW8A 5HPOA 1F9KA 1JRHH 2V7HB 1V3KA 3WTTA 2JENA 4QPGB 4ODTH 4R5XA 1OCRB 1ZGLM 3WQ7A 1SMVA 3MRIB 5L7XH 2OIIA 1G7QA 1TZAA 3A3YB 3AC0A 4P9JA 3ESNA 2YPLE 4YARA 1EZVY 4TKWA 5CJOL 2X4PB 5CCKH 5K9JL 1GMIA 5AZUA 5JR1L 3FT3B 3QUXA 3X11B 1A66A 4GKNB 2J25A 1FV3A 1JGDB 1RUH3 3DO4A 2BP8B 4CVXA 3FTZA 5BS0D 1NOAA 2VGDA 3IZOA 3NFSH 4QYOB 4ODVL 4LO5B 1BVZA 1BD2A 1C5CH 1ZSDB 3BTZA 1E9OB 1TTGA 3UKNA 2B4KA 4OM1H 4OCNC 4OLYL 2VMGA 3LD8B 2R83A 1MHEB 4LLQB 4MWFA 1LEIB 1RYYA 3AL6A 1D9KC 1OCWH 1S7QB 4FYQA 3U6XA 4CC0A 3GI9H 5INCB 4MHUA 1XFPA 5EOCL 3VHNA 1UF2C 1FC2D 2BCKB 5HVGB 1HDKA 4GKYA 1M7DB 1BOYA 3FN0L 3EJTA 3X1NA 5EZJA 1CT8A 4JCKA 2AAVA 3RILA 3PXHA 1WAAA 3HTLX 5DC2A 4Y1AD 4JFEA 4LOTA 4OUEA 2R042 1VFOA 2GMMA 4JPWL 3ZGHA 5IJVB 4KBBA 4NQTA 4WFGE 4S2SA 1S9VB 3KYNB 1OKQA 4C1WA 1CFNB 2AMGA 1BQHB 4Y16D 1HIMH 4G7YL 1J1LA 4Y1UA 4HEPG 3UTPE 5D70H 2MPVA 3R8QA 2ZOLB 3KPPA 2O61A 1DBAL 3LKQA 2CBPA 3WKQA 4PJ5E 3IVKB 1ZY9A 1G8WA 1QXPA 1YEIH 4HOXA 4TSAH 2JELL 3CX5J 2VCOA 4UQ3A 5B4NA 4RRPM 4DEUA 2EE2A 4ZFQA 2DQTH 3UL2A 4DQOH 4WTWA 1G9ML 2RS51 3I3BA 1YEJL 4XVUD 5FA3A 4IKLA 2RHPA 5KXCA 5E0FA 3CZSA 4HH9A 3FMGH 3I9IA 4L5FE 5F7KC 4JFFE 4U7MA 4XX1E 5F89B 4P2OA 3T2LA 3UKVA 4MA3A 4A39A 1VPOL 4EWAA 5ISZD 2E51A 5JA9A 3A47A 4OCXL 2AANA 3LNFA 1EZSA 3BQUA 4Y5XB 3U83A 3KW8A 3Q8CA 3IJSB 3TP4A 5FZEA 3RZHA 1DR9A 4ZTEA 4YNYA 4Y4RA 4HXCA 2G2NA 2A5ZA 1XCTB 4G6FB 4LSVH 1POV1 4AHYA 4JL1A 1N6UA 2AK4D 3MLWH 2YY1A 2CDGA 4K5MA 1TMQA 1ZDQA 2EQDA 4ZS6C 3VGDA 2P52A 1DG6A 1X33A 2CO2A 3KB5A 5DHEA 2RM23 4TULL 2GT9B 2RTTA 4YBLC 1JI6A 1XYNA 1IV8A 1T6WA 4KWUA 5JZGC 3K0YA 1AR92 2Q8AL 3S8GB 5FYIA 15C8L 1XE7A 4LITA 2BSBA 5C0DA 5I76A 4U1IB 5C4WB 2IPKB 2CGZA 4M43H 4PQXA 1HEHC 2GU9A 1GBGA 4L1LA 4G59C 2WIIA 1I3UA 2X4RB 3DBXA 4N0YL 3SKJL 2IXJA 1M3IA 2DBJA 4FHJA 4IIZA 4EN8B 1J59A 1KNOB 3LOBA 4YE0A 2NY0B 4NWUH 3ZTJH 5K69A 1WWCA 1VEPA 1XGZA 4FPLA 5FJKA 2ZXEB 2NW2A 3MUZ1 4NUGL 8FABB 2NP0A 1OF0A 2GIMA 3QIWA 5JNYB 5JXEC 2XXMB 4O58L 1CGTA 3POYA 1J0JA 3RWDB 4UTBA 2A77H 3ZDYB 2Y2TA 1G86A 2ED7A 3ZQWA 1RUKL 3CN2A 1ND3C 2J1AA 1NWOA 1PO22 5A6IA 1K85A 3RZCC 4DUWA 5CUSH 2E47A 2NW3B 1ZGLB 2EEXA 4HH8A 5G55A 1MEC2 3MRCB 3Q2CA 2R2BA 2F19H 4LVHB 1QJX3 1RUD2 4GBXB 2EXHA 4E9LA 3SBQA 3TLRA 1LESA 2XNAB 4PJDE 2NOYA 4PW4A 3RWIB 2C3XA 4HU8A 1ZLSL 4L05A 2WKOA 1G5AA 1WFJA 3KPSB 1GLHA 2GFBB 2ARAA 3ALPA 1SLAA 1Z7S1 4F83A 5D8AB 1DQLH 2MOQA 1KBVA 1WZ1L 4MNGA 1OSPL 5CS7A 5LXGH 3X3FH 3O12A 5CZXD 1W2NA 1E4XI 2B42B 2ZOKB 5KOMC 1DYKA 1BZWA 3C6LA 3EO9H 4AENB 4FP3A 4AOCA 4JFXA 1LOFC 4I2XA 3LGRA 2KC0A 1I4FB 2FDKA 4NSKB 3VGBA 2EXYD 5AAMC 4FXTA 3GZTB 5F5QA 2P46B 1F00I 1ZBE2 5PAZA 2PW1B 1D6VH 3FQTB 4P04A 2P1YA 4HIIB 3ZXKA 4BBWA 4CJ0A 3LN5B 5ANME 1VFBA 5ICYB 5I71C 1V00A 3JWDL 1ZNPA 1ML0A 2WXQA 4K3DL 4OHZA 4M6OL 5CU1A 3UO1H 4X6CA 5DRWB 4XPGH 3GRBA 4PG2C 5FLUA 5GGTA 3RIAK 2HKFL 4KDWA 1APNA 3S5LG 5BVJB 2Q86A 2DU0A 4EJRA 1N59A 5FK9A 4LSDA 4JN1L 2NX5E 4PYHA 1SEFA 5EFIA 1RVFL 2VITA 2QVKA 3CFUA 1OM3H 5IBTL 2F1EA 3ASOB 2W38A 4P46A 1VBD2 1JTPA 1UMZA 2JG8B 2D5FA 4PVMA 1JPTH 5D2LA 3JBG1 5CFCB 3QNZA 1LE9B 4QQ2A 3O8XC 1MHHA 1K8DA 4K7PL 1C5IA 4DCQB 4JCMA 4L4TB 4ATWA 1OOPB 1BBT1 1BDYA 2P9RA 1F6AB 3BN9C 4XP5H 2HTLC 4LGSB 5ES4B 2Z7YA 2IEPA 2ADEA 4PDWB 3AREB 3AU0A 1MPAL 2XN9A 2XV0A 4N0UE 5D1QA 3UZEC 3FX3A 3SHRA 3LHPH 3SH4A 2B4CL 1E6JH 5FW7A 4Y4HB 4HXAH 1WFOA 2OP4L 4RGMC 5DMIL 4HZLA 1CLVA 1QEWB 1TETL 3WSQH 4N0RA 3UPRA 2LALA 5DFVC 1JZ7A 3HI5H 4LJHA 4XBMA 1UQXA 3FH5A 2EDYA 4DEPB 3GLDA 3QG7H 3T2QA 1DJSA 1D5MB 4WHTB 4P14A 3INUL 1OAUH 4W4ZA 4IHOB 5C3OA 3ZHDA 1FH5H 4DPBX 3VH8G 3ETPA 4CU9A 1YCSA 5FYUA 3N40F 3UGEA 1JUHA 1LEGB 1LWHA 3VWKC 2YIHA 1F0LA 4MX3A 2NY3C 4DOUA 2J71A 2GC3A 5CD5C 4XMIA 5DZPA 5DJZA 3LNHA 2WZR2 4C54A 3R05A 1WE5A 2PYFA 5IKCB 2RCSH 4K9EC 4A7GA 1DQML 4ZXBA 3G9VA 1DCEA 1ZJBA 2IAND 2RALA 4ETQA 5CJOH 3GXFA 3PNAA 4GRLB 1WDAA 3HC3L 2VM3A 3QZNA 4XXCA 5DRZB 1EEUA 1KJVA 3X12B 5MEOB 1RUG1 1HQRA 1I7ZA 1KPUA 2EDQA 1FPTH 4OGZA 5HVFB 4NZUL 5EU7E 5GLZA 3BD5A 1TQBC 3PCYA 4DP1X 1UPSA 3BPSA 3SCFA 1QSFE 3LS4L 5MI0C 3C5ZA 2SEBB 1E30A 1CZ8L 3RGVC 3P02A 2XGXA 4EN3A 3H7LA 2EH8H 3QHZL 4IOSD 2FGWL 1BFVH 2K78A 2J1YA 3I75B 1IM3B 3WEBA 1CDCA 1U5ZA 2NCEA 4NPRA 2EXWC 3S0PA 2WNVB 2DWDB 3UABA 4A7VA 3A6CH 5IHZA 5LY2A 1K6QL 1YEKL 3MLZH 3NRQA 3HHMA 3OZLA 5I8SA 3O4OC 1A1MB 4JY4B 3E38A 3L2LA 4OUUA 5SX5H 3ZR6A 2YMXL 1P8JA 2EDDA 3MOBH 1H8TC 2OX5A 3QUKB 4ELMF 3KH4A 3D9AH 1LU2A 5DUXA 4NUJA 2YKLL 1HL5A 4PBDA 4YAQB 3FQXB 1P7KA 4YGVA 1XSIA 1JHLH 4KVNH 4RSVA 4N4YB 3TVMB 5KSAA 3M4FA 3WQ1A 1OKOA 2HBUA 3QUYA 2OA9A 2X6MA 4QGYA 3K4DA 4OYUA 3M1CA 3WI9A 1OE2A 2J12B 3ILDA 5FKCA 4BZ1H 5JQ6L 4IV3C 3TA3D 4IU2A 4P2YA 1TLKA 1EHXA 3APBA 1I9EA 2A74C 2JELH 1CGXA 3H9SE 4G43A 2AJSH 1MVUA 4MASA 5ACZA 4Z18A 1ENXA 5DHMC 4A7UA 3RE0A 4PBPA 5F3HB 2H32H 3ALXA 2J20A 2ZCHL 4MA8L 4W9GC 4QRRA 1FL3B 4OCYH 1EV12 4PLOA 1ZTMA 5IT2L 5I15H 1AC6A 5LUMA 3LS5L 3SGKC 3GIVA 1GYVA 1JG9A 3Q2LA 7PCYA 3QQ3B 3JV4B 1R1ZA 5FF6B 2OW6A 5GS0H 4AXWA 1NCAL 1SDAB 1DN0A 1F11B 3LH9A 2Y6LA 4FF9A 2DH3A 4KZCA 1MZEA 1YFXA 1S0GA 3PLYA 4N2LA 5F3EA 4UILH 2E46A 4OCXH 1S7TA 4Y4FB 1NDTA 2DIAA 5K93A 1CESA 5C8WA 1KTCA 1DBKH 2V37A 2Y1VA 1IOAA 2V72A 4HAGA 4UIMA 5DC4B 3VBRB 3NK4A 2YRPA 1EAH1 6FABL 3ARYA 2K9FB 4U1GB 3TAYA 3F84A 1MI5E 2VLJB 3ARGB 1W2UA 1CL7H 3US1A 1BBJB 5L2JB 1TTUA 5C2UB 2J8UF 5CGBA 1ASJ2 3K80A 3KPNA 5EBMA 4UI2A 3ZYJB 1ZM1A 4IEZA 3GO1H 1SBSH 1O4TA 3GHEH 4QM9A 5A3NA 2EIJB 3L4VA 5IWLC 3PTYA 3D08A 2DQDL 1IAOB 5HGAA 2XPGA 4KY2A 4ZFFB 1AGBA 4ZPTA 2BVOB 3II3A 2IAMB 4UDUA 1KTLA 5HHXL 1JF1A 4CU7A 4N0YH 3CU7A 3BDXA 3I85A 4YLCA 2WNUB 3TWIA 1AYN1 4DXRA 4JG1H 4EROA 3OG4B 3HE6B 1X9RA 1J8HD 4W9LC 2Y6HA 1MRDL 2BY3A 2TEPA 1JK8B 2G4EA 4TL5A 3ZFFC 4NUGH 2Q6WB 4BHPA 4NC2B 4Z7UA 1FAIL 1PD0A 4V2BA 1R1A1 3EFOA 2D6KA 4HN0A 1EEYA 5GLTA 4JGNA 1AL22 3NIFE 2WXOA 4QRPB 4Z1PA 1YQVL 3B00A 4O58H 3SDCB 3X17A 5IVXB 4LO4B 1JP5A 4FJYA 1PK6A 4DN4L 3WIHA 1BVKA 3ZZ1A 5JTWA 3VFGL 1XU2A 1R3HA 4MAYC 3KL3A 5D1ZI 1G7LB 3BU7A 1VBB1 3N44F 2FO8A 3O1SA 4E8CA 3SB3A 2OMYA 2ALWA 1FLRL 2Y64A 4RNRA 1DVFD 2I9LA 2CAUA 2W92A 1XGTA 3TTYA 3VXUB 4AEIL 2FCVA 3VZJA 4WY7H 5JW3L 4Z3JA 5LWYL 4H8WH 5DEJA 2CQVA 1CIYA 3BAXA 4AQTA 3GEWB 3U9WA 1QH6A 2R59A 5CP3H 2B46X 1EXUB 5EWIH 5J06A 3PUIA 1NL0H 2DQCH 3LIGA 3T65B 4DKEL 4FI8A 1PMYA 3EOBB 1YAZA 2VDKL 3SZ6A 3PL6A 3UROR 5DDJ3 2Y1YA 3BH8A 2A73A 3HZVB 7TAAA 4ALAC 5K39B 3HG1E 1XBRA 2L7JA 1QTYT 4X98B 1S7RB 3HI6H 3RIAF 4OLZL 1JPEA 2FIRT 1YQ8A 1Z9NA 2Z8VC 2JG9B 1IRAY 1PCXA 5C0RH 5KBDA 3UC0H 4UNVA 4R9DA 4CZSA 5C6CA 3FPYA 3OKMA 1A6WL 2CRMA 3BUYB 4F7TB 2TSBA 3KLAA 1JZ5A 1N5YL 1MS5A 3DXTA 1NEZG 3I8TA 2W1NA 2CPCA 2ZXQA 5L0QC 2AEWA 1FMD2 3ZFEB 3HNBM 1KIUA 3FO1B 4ZS3A 1BQLL 1PNDA 1UIKA 4DFIA 1UW8A 3FCSB 1TU2A 1OB0A 4NRZB 3G08A 4PJHA 2OMWA 3K7UA 3WJJC 5I28A 2J21A 4PJFF 5D5MF 2D6NA 3L2YA 3FOLB 4YGAB 4HKZA 1ULCA 4JFDE 2D40A 4YC2C 4PGJA 4DK3A 1AC0A 2Y6KA 5FAXA 3WUDA 3U0WH 3BVDB 4UW4A 3BPCB 2CDEB 1J0YA 4X42A 4NWTH 3UTTB 2OSLB 1QJY1 1MF2L 1XSJA 3SDAD 3UH8A 1U6AL 3PUAA 3TO4B 4CP9A 3KBHE 1NC2B 4PRNA 2Z91B 3QIUB 1DGWA 3ZDVA 1A6PA 4CSZA 1M6OB 3RKDC 1FNAA 4QWWC 5FAAA 4LBMA 1YEEL 2X4UB 3GGWA 3EOYG 5HYQA 4PS4L 2BP3A 1G9NL 5C0JA 1XF3B 3AP9A 4Y2DC 1G7YA 4HP5A 2YAHA 4QIRA 2AJXH 4GSQA 4ANVA 3ESVF 4X5WB 4ONGH 2IPTH 1KLFB 2NXYB 5IEKB 3BOVA 4JZJB 4KJQC 5IFAH 4JY5H 3VGHA 4AYFA 5F3CA 1IMHC 4JO8A 1WUZA 1S2EA 4KAQL 3TL5A 4Y5YC 2VOTA 5CLZA 1RHI1 2OMVA 4L1TA 3WFDH 4YSCA 4XEZA 4L3ED 4QJ5B 3PPSA 4NVPA 4AQEB 4JKLA 2X5PA 4XGZA 3QK0A 1OP3K 3WS3A 2HA1A 4KTGA 1UQSA 5L6YL 1N3OA 1AZCA 2WP3O 3IT8A 2VBPA 3WW1A 2JIXA 3T2NL 4I0PD 1U4FA 4LRIC 1MS3A 1EP0A 3LEKA 1LK2B 3H2QA 1BD2D 3HZYA 3NOIA 4NBYB 4YDZA 5C07E 3S36H 1JH5A 1P84J 5LHDA 3RZWA 1LO3L 3Q1SH 4LSPL 5IB2B 3GBMH 4LDCA 3RWCA 3QUZC 1FO0L 1JS4A 4YS4A 3X14B 2J88H 3I2HA 1DLLA 3EYOB 5CMAB 1DQJB 1SJEA 3JWOC 4GW1A 2G4GA 2EZ0C 2XWTA 1A3RH 1X8MA 1E8WA 2AEQH 4IM8A 2IWGA 4WU7A 1POV0 1NGZA 1ETZB 3L54A 2DL2A 3OZ9L 3MRJB 4YEFA 3QHZH 4N5UA 1VBE1 1PZ2A 4X99B 1RUI2 3NAAL 2D7MA 3FSZA 4V33A 1CYWA 3UXFA 5IMKB 1A8MA 4L97A 2B1AL 2APXA 5DUVA 5B39B 5F0LB 2XY2A 2WO1A 1IPKA 1N64H 3HHSA 3NZHH 4KI5E 5IBLC 4RD7A 4XBPA 2RDRA 4E42A 1DFBL 4C8XA 3W5NA 2AJUH 4E0RA 3F83A 2WLQA 1G9DA 1Q4NX 3UACA 5AKSA 2W0XA 3RI5F 3QJXA 5C1MB 5DN2A 3K5SA 1PG7L 2ZGTA 3VGEA 2BNQD 5T1LD 3V5DB 1CAUA 3GXDA 1NKOA 3N2JA 3R06A 3QAQA 4IRJB 2Y69B 4NCDA 3BVUA 2PXYB 3OYWA 2WO3B 3T0EE 2YBKA 4MGQA 1BMV2 5JZGA 2OFQA 4PJ7A 3K2KA 3VCLA 2AENA 2KD7A 2J43A 1I1RA 5JQ6H 2ADGB 1TTFA 4XXWC 1PNGA 4QQPA 1MDTA 5SWZE 2FCBA 4JBSA 1H6TA 1OUXA 4PCRA 4P2OD 3I6GB 2G5RA 1LHNA 2D7QA 3MGOB 2YD3A 1GY2A 2R56H 3PUQA 4ZU7A 3J7MA 2NDFA 4HS6B 2VQTA 3PGFH 4XBGA 1B09A 1RI8A 1Q0XL 4QXKA 4A4AA 3PXJA 3I2FA 2X0WA 1BOGA 3VI4F 1ZBA2 3QDGE 3T4YB 4LPLA 4XP1L 5ESVB 5F7LB 2I25N 1QZNA 3WO4C 2FZ1A 2I74A 3S35L 1A8JH 3U7YL 4XAWH 1O7SA 3WAKA 5EJZB 5I9QC 2ZGLA 2IGTA 1SLCA 3WF3A 1RIUH 4P5RA 2ITDA 2XFGB 1JXFA 5ICXA 5KYNA 5IMLA 1S3KL 2D7PA 1A78A 1RUE1 3EJCA 1UWXH 4XQDA 4JHWH 4CADB 3O3AA 4YHYC 4GRWH 1ND3A 1AQMA 1UKGA 3RZCA 3BP7B 3U7WH 3IDEA 2IO5A 3UZVA 1SPPA 1AGFA 2XZCH 1B9ZA 2NPLX 4HKXB 5KSBE 2R23A 4G83A 4E8DA 3MO4A 4YDJA 5I8KL 2GITB 3MROB 3QG6A 2F08A 5DD0H 3AXLB 4F20A 3RS6A 5BO1L 4AAPA 2V7NA 2RS53 4HUWB 2F8VA 3VGAB 5SWSA 4JNXA 1AANA 1MREH 1VDGA 5EU6A 1SXCA 5CJBA 2QQKA 2VLRB 4XCFH 1UXMA 3TIDA 3KH3A 2B9VA 3N3HA 2IH3B 1CGSH 1LCLA 3SH5A 2ZCLH 2QTVA 1SDWA 5C09E 2TSAA 3G9AB 1P53A 3QIWD 3H0TA 4G1EB 2CHXA 2WAHA 3KPRD 5F2WA 1R3KA 3CXFA 1GWLA 2H1LM 3GBNH 1LOFA 3BP4A 5AZEL 3JTBA 3RA7H 2K3HA 2BOCB 5AAMA 1RTVA 1NCDL 1FZOA 5FP8A 1IB5A 1H9WA 3VZKA 3SPJA 3V6ZA 5GGQH 1LRHA 5DMKB 3O5SA 3DA0A 2PCFA 5MEQB 3BKZA 3BPOC 5C6TL 1KN4L 3EFFA 2FR4B 3EJQA 5FKPB 1YC61 2IF7A 3FO2B 4PG2A 1MCFA 1FVCA 1EJOL 1A4JB 1HJFA 4NIHA 1TKWA 1I1YA 3AS1A 2AGJL 1Z9LA 1NAKH 3OLGA 3KVDD 3Q8FA 3U4KA 1HQWA 3Q3GA 4L99A 3CX5K 1V6IA 1KBPA 2DQEL 3NZSA 4MHHI 2XT1B 4L4VB 4GYBA 5CCHE 3T4AA 2CJTA 2X53A 4OW6A 5DHVB 1JOJA 3F2ZA 4NRMA 1BVNP 2XHNA 3C6LD 3O8XA 3QPXH 1G6RH 1CIWA 4ACPA 5L4FA 5B38G 5F39A 2DWEB 1IKQA 3GNMH 4E5XA 2PUQT 4AY0A 2X6BA 3D2TA 4E9YA 1H30A 5CAZA 5AC91 2W3JA 4K7FA 3BIBX 4OZFH 2VR3A 2CBMA 1KIQA 1QUNA 5I8OL 2VSMB 3HLKA 4PJCF 3UTSA 3OMIB 5FO7A 4GJYA 1QR4A 1WCBB 4WJ5B 5A7OA 4DKEH 4ZPVB 4ZZ5A 1JV5B 2MEV3 3JV5A 3FT1A 5CWSA 2CO7A 1MFCL 5AVSB 3HPLB 4AYDC 1BP3B 2BGOA 1YN6B 3AFLA 4TPRL 4PT6A 3ZK0A 1A7RH 3VO0A 3ULVC 2JDAA 3V6BR 4U3HA 2OVUA 2R6QA 3LKSB 1NUDA 4WJG3 1R3JB 1GSLA 4BIKA 4JRYE 3DUSB 3VWKA 4JG5A 1WJ3A 4PJAF 4ZG1A 2ORZA 1HXMA 4JM4L 4B5ZA 1CIUA 1MG3C 1FZKA 4F57H 4LLDA 2XN9D 2OCCB 4YXLH 2FH6A 1CPNA 1IQAA 4QKDA 1FI8C 1WBYB 1NFDE 2AABL 2XOMA 2J5LC 4EKJA 1HSAB 4OIAA 3BAIA 2X9ZA 5EH1A 4BFEA 4HWBH 1BX2A 1OB1A 4PJEB 2BOIA 2XWBA 4DP4X 5IOPB 2NUTB 2QVMA 4P2AA 4YDMA 3ZL4H 4QT6A 5K9QI 4OZGF 4X6RB 1VZHA 3USUA 4LHKA 1NIFA 1I3RB 1YNTB 4OB5L 5FYLE 3RGVA 3S37L 1S0IA 4CC4C 4WDIB 3LEXB 1PVC1 5C8CA 4WTQA 4Z7AA 1ZV5A 4JFQB 1YIFA 1NY71 4YHML 1BEV2 4CNIA 1K72A 3KS0H 3PJSA 2OI9B 4UTAL 3IGKA 4CVZB 4NQED 4A2GA 1HILB 4ZXBD 4U1LB 1J58A 3TBSB 3OGCB 3FB5A 3QISA 4KJWC 4URTA 3JBG3 3ZDZB 4QXBA 4CBZA 2JK5B 4KI1A 3C12A 4QTFA 3ZDXB 5G05L 3UGUA 4GIAA 1BBDL 1ZS2A 3FQRA 1XBDA 3MREB 5J11C 1MUJB 1MAMH 4YXHL 3CLPA 1UKTA 2J56A 3IMUA 1FVDB 3NFPB 3ZIYA 1YQCA 1AVAA 4MO3M 3OPZH 2D2CC 1V5JA 5D93B 4KX7A 4WV1B 3VI3F 3C5ZD 4OTXH 4AIZA 5BOPA 5DJ8A 3WSOA 5IT6A 4N43A 3NN8B 5TTRA 4EN3D 5A2CA 2PLV3 4RETB 3H0OA 4P57B 4F8QA 2AK1H 4KK6C 1M7IB 1Y6KR 4H8VA 2Z79A 2V5YA 4QD2E 1WKYA 3QNXA 5EPAA 5EC1A 3M7OA 1XU1A 4PJYA 5EF3A 3CPLB 3WHE0 1NBVH 1QWNA 1GS6X 1H0DA 3LMJL 4RFRB 4GXFA 1LP9E 3H54A 4ZD3H 4DFHA 2HH9A 1W9XA 4C4KO 1JS9A 3C2UA 1BLNA 4D8MA 3V5KA 1W72L 1PLGL 4XMPL 3SGKA 1CN4A 2R061 1JOPA 2VUJA 4XJ8A 5FYKD 2RA1A 4YW4A 1WZXA 3R6SA 3C6EA 2B1AH 5C7ZA 1EMTH 3QRLA 1R3LB 2QQOA 1PL3A 3BKCH 3QUYD 5IROC 4OKVB 1HL9A 3TFKD 4FFVD 4FFYA 4TOYH 4LT7A 5M7QA 1AXIB 5DWUL 5L9VA 3DXAB 4KXCA 1YI9A 1R24A 5D7JC 2ID5A 3ARVA 3KYOB 3MA9L 5KYWA 4Y2OB 1Z7S2 3URFA 5IZ7A 2DVBA 1WIOA 5D2NC 3TC9A 4N86A 3MCLH 1C8NA 2R1WB 2BNUA 4QRRD 5FZ7A 2AQNA 4OQTL 4F93B 3IMTA 1DDHB 3BP5B 5IWLA 4FQ2H 3HUJA 4R3SA 2AEYA 4E4SA 3K48A 3QFDB 1GIGL 3L3KB 1LOBA 4MD5B 5DURB 4HHWA 3VXPA 1OHQA 2Y5EA 4TLUA 2F7QA 4AYMC 5I8CB 2E9BA 3NIGB 2DCZA 4AQ6A 5BNOC 4Z7VA 4Q6IC 4I30A 3EZ8A 3IJYA 3LH2H 1U9KA 2QKDA 2P3YA 4XETA 2YROA 5JOFB 2WXKA 5K1VA 3U2IA 5FHAL 1UX6A 3PHMA 2TRYA 3V52L 3ZFFA 4C47A 3MJWA 1KJ2A 2GNTA 5DK2B 1RFDH 5D72L 1VRH2 3U4BH 1AXTH 3NNJA 5IEHA 1SOSA 4K5PA 5DDHB 3VD7A 3ZYOA 2WD0A 4BH8B 3B9AA 1NKRA 3FUEA 3HKZA 2I45A 1O5PA 1PTZA 1BBT2 1A7PL 1LYQA 4MV2A 1ZT7B 4MAYA 5L2KA 1KJMB 3MACL 5FP3A 3ZN4A 3N4MA 1JXDA 1YNLH 5K9KB 4JGMA 3S96B 5L7OA 5FM8A 1Y9GA 3TO2A 4TLKA 1KDIA 3VQLA 3QCUL 1W15A 4H88H 3GSVA 1MN4A 4AQOA 4P9GA 4MB4A 1FFPB 1XGPA 2AI0L 1MCHA 2WCGA 1J84A 2KL6A 1IGIL 5LN8A 4ZYKB 5FGRA 4YDIL 2FBOJ 4F7EB 4J39A 4Z5RA 5TF1H 2EDJA 4Z8FH 4JS7A 1PGRB 2XFXB 2FATL 4M29A 5HGGS 4OV5B 5FECA 4LEXL 4ZMWA 2Y0OA 3HE7A 3D0JA 3VBHC 3LQMA 3QH3B 1OARH 2MSPA 3VKOA 1YPZB 4P9YA 5TDOB 1REDA 4Q0VA 1I7RA 2GIYA 4ODSH 1RZPA 2K4AA 2LAAA 4PJBF 5I6PA 2BNRB 1A2YB 2WQUA 3B4NA 3DSFL 3GKWH 3ZXEA 2A6IA 1KN4H 3BUDA 4XPTL 3SDDC 1JVOA 2WABA 5FZCA 4RLDA 3MRDA 1GZ9A 2CU9A 3FTGA 3PFQA 1RUG2 4DXTA 2ZXGA 4XP6H 1DZ0A 3KHCA 1INQA 5DSCA 2CIIB 3ATBA 3MZHA 3WJJA 4HX1A 5CN3A 3EYSL 4MGKE 4LPUA 2JD9A 2Q7YA 3DOSB 1MQKL 3TJHD 4YGBA 1FQ9C 2OZJA 1KTDA 5J56B 3BIEA 4B6ZA 4JFYB 1WS7A 1W9WA 2UU8A 1AYN3 2HWE2 4DP0X 3U2SA 5EEXA 2GJ6B 3MNZB 4GWJA 3PUHA 2OTUA 4YIQA 2BP6A 1DQ1A 4XPFH 4BQ2A 2BSEA 3MRKB 3GJFA 3DHMA 4M7ZC 3VQ2C 4A7SA 1T4KA 5I0XA 4YWAA 3PG2A 2V5DA 3U1PA 1CVSC 3ZDYE 1BW8A 2O5YL 3G6AB 4NEHB 4G6AC 2WUBL 3E7JA 4IBUA 1T5WB 5J13C 3WUCA 3EJSA 4F7CA 1I8KA 4R7VA 2EC9T 5LGKA 2K1MA 1WSST 5ACLA 1NA1B 1U42A 3MV9B 3KGLA 3VNZA 2K70A 3WY6A 2VZUA 3MVSA 1X5JA 2GMPA 3SY0B 4I3SL 1DLFL 2GH2A 3IGAB 1XVSA 1VBB3 3ZU8A 2XX0A 3KPSE 5I75B 5EC2B 5J1AB 3PL0A 2OL3A 1V6JA 4Y5YA 4DGUA 1I1AB 1IS6A 4GRWB 2NY2D 3Q2VA 1K45A 3UERA 4KKZA 3ATAA 1UB6B 4RAVB 3ZT7A 2ZABA 3LPFA 3HG4A 3K6FA 1VF5C 4DK6A 3ARBB 1PLCA 3HC0B 3TX4A 3L1FA 3Q44A 4LRIA 4PIRF 2MPAL 4KTDL 1ZPLA 3VWJB 2ZJCA 2JXMB 4RBPK 3ELQA 3CFQA 3BVVA 4NPJA 3V65A 5BY5A 4XH2B 4HIEA 3HMWL 3ETTA 1RK1A 1V7NL 5A1AA 4ZX3A 2ZAHA 3NDYE 3QZWG 3QUZA 3CNAA 2E7MA 4PMEA 4QGLA 3LRGA 2G9FA 2EICA 1MHCB 3MLYL 4YPGA 2VTXA 1Q5OA 3O6FA 2R51A 2X7LB 5LBCA 2E86A 1FNSL 4AEJA 4E4DX 1OLME 2EAAA 2EIBA 2XPJA 2YGNA 5IHBA 1EAH2 2GJZB 2VERN 2G0LA 5C0FB 3FULA 4YHMH 1Q38A 1JDDA 4HZ1A 4R7NB 5HJGA 1AI1H 2JIXD 3II1A 4V1DB 2ZTBA 1SLXA 1L9RA 3N36A 1E9PB 2V8LA 3O4LD 4L4TE 2FJHA 1UXSB 4MYEA 4HSCX 1O7VA 3GF8A 1W6PA 1VRSA 2PN5A 4YK4C 2YPKB 3SCGA 3VFPB 3NCYS 5D96C 2NY7H 3QWOA 4DS0A 2QQLA 5A43C 4FKHA 4PP1D 1TZIB 1VERA 5I82A 5DI8B 3WIFB 1ZZ6A 1P6WA 2N0MA 3HRZB 4BOWA 4KXZI 3NCFB 4CJ1A 1B6DA 4YZ4A 2R0LL 1RZKL 5T3XD 3B7MA 4CEWC 4X4ZA 2NSQA 1ZEAH 1JSYA 4JJ5A 2QPEB 2CO1A 4PJIA 1G6RB 5DS8A 3KVPA 3PNWA 1EXHA 1KCKA 4NPLA 5EJ3A 2WVSA 1DEEB 1Q9KA 3QRGH 4OVUA 4XXWA 3GZPA 2YQGA 5GRWA 3KDPB 1BGXH 3GUTA 1H3TA 4OAWB 1RIRA 4ZPIA 1S7SA 1YJKA 1ZA6B 4EQ3A 3UFIA 4YMPA 3VJ6B 1KD7A 3KV9A 1R1A2 3FT2A 4GUPB 4P4KC 1Q9WB 1BXHA 5LEKA 1AZDA 4NN6C 4ZNEE 1RHI3 4YSRA 1J88A 3DO3A 1UOJA 3NH7L 4LSTL 3VRIA 4LHNA 4IU3B 1IGML 3QUMB 3T0AA 4DPNA 1BZ8A 2ORBL 2IOOA 4PD4J 5GISL 5KSVB 4U4IA 3UMTA 4JPSA 4AI3A 1A8ZA 1L9NA 1XAKA 2E75C 4WTXA 5HDBF 5IHWA 2OT7A 2HFGL 5C0CD 1UCBH 1NGYA 4TQEH 4UZSA 5TE4L 5F3BB 2F74B 3L7FB 1AR1C 2HKHH 1CB4A 2CLRA 2WQSA 4XC1H 3RWHB 3S4SA 5DXDA 3PJNA 1IC0A 3RBSA 5BNXD 3MA9H 4I5BA 1SACA 1BCIA 2ENJA 2VULA 2YMTA 5DD3H 2IDQA 4LU5H 2E7TA 4J1UB 3X1BA 2XBO3 3A24A 3AMQA 3ZR5A 1JBCA 5FOBA 5D7IA 3NSDA 5E6UB 4W70A 1KB5B 1CAVA 3RGBA 5JHDB 4KG0A 3BP6A 5LA2A 4CDWB 4UQIM 3P30H 3Q6GL 1H5BB 2XWDA 4C56D 4OZOA 3OJ2C 2XQYG 1UZYA 2DJMA 5EEUA 1WCUA 5HHOA 5JLZB 5ACA1 3AADB 2WNXA 2EDRA 1DGRA 5T3ZD 3W39B 2F61A 1GMMA 2JDPA 4CRPA 3H6AA 5GIRB 3ZXJA 3RZCD 3CH1B 3AAZA 3FO9B 1U8JB 4H0IA 1NMBL 4PJ9C 2DLIA 3VFUB 3MIBA 2HX9A 4HUVA 4DH2A 2AACA 1N6QL 2W46A 4YHNA 4S11A 5F32A 2QVTA 1NPUA 2UX7A 3O0VA 4APQB 3GT6A 5CEXA 2G5UA 3T8MA 5SWSD 2EKSB 4XNMA 3TH3T 1QKZH 3LNEA 1MCKA 3CFCL 5DC0A 5EU6D 3RDTB 4UOJA 1MXGA 1E40A 2FQFA 3E5XA 4FAGA 1ZVFA 3W37A 3H3LA 3QPQC 1JHTB 4U6YA 3UIYA 1OXCA 5L4MA 1Q56A 4W6XA 4R6UA 1AKJD 2EEFA 3SDXA 4N90E 5DS1A 4OFYD 4YUEH 3TRSB 3O6LL 3D0LA 3T77A 1W6WA 4DB5A 4CW1A 1CAWB 3EB7A 1IG0A 1OK8A 1TMF2 5J9PB 4X6FB 5DD6A 2KKQA 3QE5A 5EIYB 4D3CL 1IL1B 5FY5A 5JORB 1ZPUA 1MCRA 3JV6A 1NLDL 1I6XA 4YDIH 3CVBA 3BGFC 3VZOA 2P5WA 2GP3A 1H9PA 2HRPH 2OMXA 4OD2A 4XJ9A 4IMLA 4Q1PA 4OGAC 2G1MA 4XHQA 4NXSA 1HB2A 3ZO0B 1UM5H 4HOWA 1CZSA 3QFGA 1XIWB 4QRTA 5EUOB 1U8HA 4UT9A 5FYJH 4NXKA 4Q74A 2L7EA 4IQHA 2AEPL 1A14H 4JEGB 4BD4A 4RS5C 2V8MA 4IS6B 4JDMA 4G42B 4JQIA 1NAMA 5GS2D 3D6GA 3B3QE 3O8XD 4HFWA 4LCYB 3GCXA 2V9QA 2NY5L 3ILPA 2ZUVA 5FWEA 2LOEA 3SE6A 1XF2B 1S5IH 1RUQL 2UZIL 3C8DA 4LKXB 4ZXKA 4MNQB 2IMNA 2DQGH 1XF4A 3MBXH 5HSFA 5G5DA 3ZKMC 3U7AA 1V8HA 3EYVB 5DUJA 3CIHA 2Q7AA 4RGNB 4IOFD 3L3DB 3RGHA 3VXMA 3QDJB 4BUQA 2XDHA 2BSSA 1F4YH 1T1XB 2QJVA 5FIXA 4EN7B 3MV8D 1SN0A 4P9ML 3M17B 2GG1A 4U2AA 5EUKB 2EEDA 4BFNA 1ZKAA 1MCPL 4NI6A 4JRLA 4RMQA 4S1RL 4Z78A 1KFUL 4M4PA 2CPUA 1VBE2 4NM4L 1FN4A 1O4YA 3MUJA 4B4RA 3BWSA 4QRPE 2Z92B 3LQCA 2JB5H 4WGVB 1BFSA 3PWNA 5IVXE 4LSUH 1KBGL 1B0RB 3S34L 1CTNA 2O5YH 4AL8C 3OF6A 5I2IB 5BUAA 1J3QA 3VHPA 2OW4A 1QEXA 3NACL 2L8AA 4CDQB 1UJTA 2GBTA 3W0WB 1KGWA 4ZUUA 4CC4A 2XIDA 4LHLA 4BFRA 5EPMA 2D3LA 4ZMTA 3OUIA 5FZ1A 2ZKYA 4AWJC 1PY4A 5AVRB 5CD5D 3MW4A 1DQVA 1JNLL 3FFDA 4S2GA 4H20L 4C57C 3UGGA 3VXUE 3EDFA 4N53A 2A70A 1XTLA 1KB9J 3JT0A 4HUUA 4IBLT 1FORH 4YSFA 1MZ5A 5IBUB 1D0HA 3O9WC 3L48A 2YKKA 35C8L 6PCYA 3JBG7 1KENL 3A67L 1R46A 3NVCA 3SO3B 4OZ4B 2YPVL 5AC93 1EDQA 1TZGH 2YPLD 3GMLB 1Y07A 1S9WB 4OZHB 3QXWA 3RWJA 3DV4A 3HNTL 3DJSA 2PW2A 4J2QA 1PKQA 4DTGH 1ZT4A 1JOIA 1NCBH 2EYRA 3WKMH 1U0AA 1ADQH 3OKNB 2VPVA 5I5IA 1K5NA 3CUPB 4LBEB 2ZEWA 1YJDH 3KCYA 5KC5A 3WHXA 4DVBB 1L0PA 1GC1L 1RUE2 1L3NA 5I18H 2P2KA 4L11A 2DTMH 4QDQA 1MJ7H 4M7JL 5AOMA 3OHXB 1RUOA 3K51A 4LLYB 4XNZB 1NCOA 5J98B 2WSPA 3U9PH 4HULB 3EQEA 4OZXA 4NAJA 5M0TA 1DQTA 1KQRA 3CHRA 2WIMA 1NMCC 1GVIA 1LVEA 1RL1A 4ORGA 3NGBC 1I7UA 3UTTE 1LOGA 3NJVA 4AFDA 4XUQA 5C9KA 5IROA 2PF6A 1OPMA 3CZUB 2TBVA 2ZKXA 2DD8H 1NANI 1X9PA 1C5DB 4UDTA 4WM8B 5D7JA 3J27A 3W9EA 5HDRA 1JMZA 3N44B 2OXHB 1T1WB 2GAUA 4YM1A 1M7XA 2QFEA 5D2NA 2ZPXA 4W65A 3DC0A 5IQLA 1UEMA 2Y0SA 5E99H 3KBPA 1PS3A 3OXRB 4BCYA 4OCRH 3FSVA 5F6IC 3UBGA 5DFWH 2AH2A 3PV7A 2EE3A 4E5XG 1PVC3 4YSDA 5EXOA 5EBWA 4M3CB 3AQDA 4LTAA 1FZMB 2DV6A 5E9NA 1AY1L 2JICA 4FLHA 3B2VH 1YMHB 1E2WA 3OJDB 1CLZH 4Q6IA 1SMAA 1TVHA 3GRGA 3L3OB 1WD3A 2C1PB 2PPCA 2H9GB 4OD1L 1UYYA 3NMEA 4GKOA 4K5NA 3TN0C 4JRAA 1UY0A 3BVNA 4JFFD 5GS1B 1GANA 5ILTH 1INEL 1YG9A 3OMAB 4KROD 3D07A 1G84A 4X4MA 4JGYA 4Y8AA 3H85A 1XNBA 1QOOA 4J3TA 1TUPA 4XZPA 3LOIA 5HDLA 4MVBC 2HFGH 2AV7B 2EAEA 2PYEA 1M4WA 1XR8A 5IW1A 1QU0A 4WI9A 4M62H 5I66B 5IW6A 2J1UA 2YC4A 5C86A 4DUVA 3CFMA 1VPHA 4XPHH 4WTZG 1GKOA 1QASA 4LRNL 3BRGC 2VQ0A 2PR4H 2VNGA 2WSVA 2XUMA 1A7OL 3TCXA 3RQ0A 2D31B 3BPLB 2AXGB 3D3VA 4L8SC 4I0WB 4IJ3B 4IRSC 1RUC1 3P0VH 4IDLA 3WVJA 4Y9GA 5BS0B 2AJVL 5H94B 3WNOA 2VJXA 1O6SB 1PZBA 2FNBA 1QNIA 3GMNB 5EN2B