2WN3A

Crystal structure of discoidin i from dictyostelium discoideum in complex with the disaccharide galnac beta 1-3 galactose, at 1.6 a resolution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 60
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn3A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn3A01
3IB3A 3I2FA 2YFZA 2XOMA 3DYMA 1NUKA 2VZRA 3OGSA 4HG6B 3E1F1 3I2JA 1K42A 3GDBA 1JI6A 1F4HA 5JXJA 4GWIA 5JUVA 4ZY9A 1H6XA 1GOFA 2LW8A 5C7GA 1PMJX 3DECA 1GOGA 2Y64A 3NRUA 3F2ZA 1XPWA 4FI9A 4CU8A 2WYSA 1W8NA 1YQ2A 4QB2A 3WF1A 4DUWA 3EB7A 5I0DA 3CQOA 4M4RA 2JKXA 2Y8KA 1JU4A 5DN2A 4OYUA 5LA0A 3C8XA 2WN3A 3ECQA 5HXMA 2CGZA 4ARXA 1JZ6A 1EUTA 3K4DA 2VZSA 3CMGA 3T2OA 4A45A 2VTFA 4XURA 1O8PA 1TG7A 3NQHA 3LPFA 4XZUG 5IFTA 3CKHA 3EYPA 3I2IA 1XNAA 2WO2A 5HPOA 2ZEZA 3VDCA 3IAQA 1JZ8A 3FHQA 1T2XA 2VQTA 2RJ2A 1WKYA 4JKKA 2CCVA 3FL7A 4M4PA 1JU3A 3VD7A 1UWWA 4QDRA 2W3JA 1WCQA 1UXZA 5JMOA 2VZ3A 2VZTA 1NAEA 3FHAA 3MUY1 2VCAA 1CZVA 3CZJA 2VZUA 1US2A 2L9LA 2R7EB 2B4KA 1SHWB 3SKVA 2VZPA 4P08A 3K75B 1ULPA 5F7UA 2ORZA 3P1IA 2WZ8A 1CX1A 4KWUA 1JYXA 5DMYA 3AC0A 3HNBM 4MGQA 2W87A 3HN3A 3BGAA 4KI5M 1BHGA 2DCKA 2ZXQA 3ZM8A 3ACFA 1OF3A 2J1UA 1O8SA 1PX3A 1UYYA 3LEGA 4YPJA 2QQLA 4DXRA 3IDAA 1RYYA 4UAPA 2BERA 2EIDA 3I2HA 2C26A 3WF3A 1JZ4A 2V72A 2LS6A 2E31A 4JHZA 5LA1A 4BK5A 4OUEA 3HNMA 4QX3A 4D8MA 1UX7A 4CUCA 4QX0A 3PUHA 4Z2AA 2EICA 4A42A 1UMHA 3BN6A 5IJRA 4P02B 1H6YA 2PQSA 1TVGA 3WMQA 4PT6A 3HEIA 2Y6LA 3OG2A 2X10A 2BGPA 2WAAA 3T0BA 4PQQA 1UY3A 4RYDA 1J84A 4XUNA 1L7QA 3T08A 1LNSA 2CE6A 2CDPA 1CZSA 2BGOA 2Z4FA 2VMFA 3MV01 4QAWA 1NKGA 1UXXX 5CYYA 2OKXA 1K45A 2B9VA 1XNTA 2YG0A 2E32A 4CU6A 2YFUA 2CDOA 2YB7A 3J7HA 2V4VA 2DDUA 4JKLA 3I3BA 5DPNA 4DEQA 2WO1A 1UY2A 1GMMA 2BBAA 3A7QA 2VL4A 3MV11 2HYXA 4QX1A 2QQOA 2WO3A 1I5PA 1W0NA 1K3IA 3GGLA 5FUIA 2KD7A 2QQJA 5JXIA 2W91A 3T2PA 3A22A 4KMQA 2QQMA 3LEIA 1JYWA 4DEVA 3DYPA 3I2GA 2CGYA 2VMCA 2C9KA 2RV9A 1PX4A 2VQUA 3I3EA 3LPGA 3MO4A 2DCJA 2E26A 1UZ0A 1KGYA 2W1WA 2J1TA 4UOJA 2W95A 3WF2A 4TTGA 3VD5A 4DXSA 5EIYB 1JHJA 3K77A 3W5NA 2W5FA 4QDQA 1CZTA 3MBWA 3WF0A 2QBXA 3I97A 3LEKA 3LQCA 4P5YA 3T2QA 4ZZ8A 2J22A 4ZXEA 2XQXA 4W50A 3JXSA 5C71A 5DQ0A 2VCCA 1R64A 1UY4A 2VR4A 4QDSA 1JZ2A 5IYYA 1GUIA 1F4AA 5EJZB 3SEEA 4AAXA 3A23A 1CIYA 4BXSV 1JYNA 4IUGA 3WNMA 3C7HA 4ET7A 2J1AA 1GQPA 1UY1A 3NJXA 2W9XA 4OMCA 5IHRA 2Y6KA 4W4ZA 2WAOA 4D0QA 3WSOA 2WUHA 1W9TA 3ACHA 2HLEA 3LE0A 3MUZ1 1GOHA 5B4XA 4MO3M 3CDZB 4XVHA 3K4AA 3SKJE 2WZEA 2VO5A 2YC4A 3UESA 3C7EA 3OBAA 3NNGA 3ABZA 1K12A 4QX2A 2E33A 4OMDA 2X05A 3OGRA 1EUUA 3ACIA 2VM9A 1XC6A 1US3A 4CU7A 2JD9A 5CZKA 1JYVA 3T0DA 4LHSA 3IIIA 2VMDA 2C4XA 5G04L 4GZ9A 5JR2A 4JX0A 5JXGA 2WQ8A 3VD3A 5G05L 4MGSA 2VC9A 2JE8A 4QPWA 4ARYA 3GM8A 1IQDC 4A3ZA 4A6OA 2W1UA 2V5DA 3D3AA 3NJVA 4A4AA 3HJRA 4RN5A 1P8JA 3VD9A 4LPLA 1W8OA 2BZDA 3UNPA 2WBKA 1J83A 1PMHX 2QQKA 3UETA 3C7FA 3OEAA 1SG3A 2Y6JA 4A44A 1GU3A 1OF4A 1W99A 4CUAA 3DYOA 4DUVA 2W46A 3THCA 3WNPA 2EIBA 3K46A 2VZ1A 4LKSA 2ORXA 3P6BA 2X09A 4L0PA 1KEXA 1UMIA 3HPNA 2VJXA 4PF1A 1SDDB 2ZEWA 1UYZA 4QB6A 2VZQA 3PUIA 2W47A 3WNLA 2VZOA 2VZVA 3WF4A 4UI9L 2W1QA 1MPXA 2XHNA 3GXUA 3K4ZA 5LA2A 4AG4A 3WMPA 4OZOA 3WNNA 4TXWA 2J1SA 1OH4A 2QQNA 4CUBA 4DUXA 3CZUA 4XUOA 1HN1A 3WNKA 4LQRA 2ZEXA 4BK4A 1JZ3A 2VMEA 2J7MA 3OEBA 3I3DA 1DYOA 4CVUA 2RVAA 3C7GA 1W9SA 2Y6GA 5IFPA 1L7RA 4BDVB 2ZEYA 5JXHA 5EJ1B 1DP0A 4MOAA 3HOBA 2W1SA 4ZZ5A 1OT5A 1O59A 2YC2A 4E8DA 3WEZA 1JZ5A 4XUQA 5B4NA 3U37A 3W5MA 2J1VA 3ACGA 2W94A 2WDBA 3THDA 3T0AA 3OGVA 2EIEA 2WABA 1UY0A 4W8JA 3HNYM 2VCBA 5A1AA 2Y6HA 2ID4A 4BJ0A 4XUTA 1UYXA 5C70A 3IAPA 1OD3A 4Q56A 2JDAA 3VDBA 3WQBA 1GNYA 3OB8A 4JKMA 4CU9A 3ETPA 4QB1A 3FN9A 3CIHA 2J1RA 1ULOA 2WN2A 4MADA 3VD4A 3I2KA 2W92A 5J1XA 2VOTA 4DXTA 4E8CA 3A21A 2QQIA 1W9WA 2J1EA 1DLCA 4A41A 3VDAA 1NX9A 3C7OA 3WNOA 4GWJA 5LCWL 2XONA 3SEPA 3T09A 4XUPA 1JZ7A 4P00B 1D7PM
chains in the Genus database with same CATH superfamily
3OKMA 2A9ML 1BQHB 1SCRA 3QQDB 5DUJA 3BMWA 5L8LB 4EEEA 1UYPA 2PPAA 1MELA 4OZFB 2V2XA 1J8HE 2R30A 1IGYB 3KGLA 1ENSA 3BKJL 2KKQA 3IETB 1UOWA 4MX3A 1WD4A 5AVAA 4GFTB 4TQEH 2DV9A 1B3JA 3F05A 3NACH 1H6XA 1X9LA 3VI4B 4NXKA 1TQBC 4JRYE 4IBZA 1JK8A 2H2PC 1KJ2A 3D39D 2NY0C 3HNVL 4GP5B 4OGXL 1ET8A 3HR5B 3PWLB 3QCTL 3QNYA 4GO9A 4YVUA 8PAZA 2YOAA 1ND3C 4FI9A 3O1MA 1P4UA 5C86A 4F57L 4KWKA 5AW5B 4D9QD 2VBDA 1MCPL 5FBJA 4BZ2L 2BUKA 2IGFH 3T1WA 4FQ4A 1EV13 3GB7A 1QEWA 2OL3L 1X5ZA 4HEME 2VYRE 1MFVA 4GSUA 1UD2A 2B14A 2ZG3A 4JZNA 4S2SB 4TPRH 4A1RA 3II1A 2XV0A 3LPFA 4ESKA 5JSPA 3I2IA 2W2IA 4R9DA 3OJMB 4XO8A 4AHWA 2YS4A 4ZAKB 3X3FL 3FUHA 3LQZB 2CO4A 3IGFA 4XJZA 1BGXL 4RH4A 3UCRA 1BD2D 1DEEA 4WY7L 5IF0B 2BVBA 3PWUB 3QZOA 3LKPB 2HJLB 2IFWA 3KG5A 1ZHBA 1HCVA 3PDGA 4OIIH 5CU1A 3V0BB 1XWVA 2HEVF 1WC7A 1DQDL 3M8OH 1TVHA 3BXNA 2O5YL 2BHZA 3BDBA 1K5JA 2WUCL 2F74A 2RJLA 4M48L 2PN5A 3MCKA 3X11B 1TNFA 4J6RH 1IS3A 2A4EA 4Y1ZA 3FU3A 4KITB 1GKBA 4WVRA 1PF3A 5BV6A 2AGJH 5MHSE 3WG2A 1PZDA 4G80B 2BWCA 1Z7S2 2L9LA 1C16B 3PJSA 2X6AA 4JFDB 1ADWA 3AFKA 3WD5H 4S2DA 3WIHL 3V4UH 5F0LB 5MI0C 4K9EL 2V2WB 1U33A 1GS7A 5AOIA 3MV9B 4YBLC 1ND2C 1YLBB 3HMWH 4UQ3A 1JYXA 1XU1A 4NZTL 5DMYA 1RXGA 1BFTA 2FYYB 2IPUK 3ARFC 1NCAH 5C0DB 4MGQA 4KY1H 4F37F 3IDXL 3NSDA 4JFEE 1I7RA 5IM7B 3WCSA 2BY3A 3U1XA 5L4IA 4NROA 5C9AA 2AV1B 3AQZA 3ZM8A 3N50A 2B3IA 3NJHA 4ZW3A 1E5SA 2R0KH 5FXCH 4S0HA 4HK9A 3R4RA 2EDDA 4XH2B 3BEWA 2WKOA 3JWNC 4HGWB 4YEFA 2OM5A 2K45A 2WFPA 4DXRA 4BH9A 2NNRA 3QWQB 4B9GA 4G6MH 3DX6B 3MR9A 4UAPA 2D7QA 3I2CL 3SISA 1RU9H 5E6HA 1FQ9C 1NLBH 1E3ZA 4B53A 2Y3NA 4RBPK 1ACZA 2A4CA 4BK5A 5I2IB 2IANB 4XWOD 1QWNA 2CWMA 3EW3B 1S9XA 4YL9A 4HBQA 5J1AA 3SKJH 4LPYA 3LQAL 2DIBA 2H0JA 3C2AH 1EANA 3IJYB 5J12B 3DO7A 2Y6SD 1FN4A 1HEHC 3D2UA 3HZVA 4M61A 5ALBL 4EE2A 4EBQH 5IBLD 3WP4A 3OZLA 3C8DA 1EZLA 1Y1UA 3CC5B 3GC3A 1G7JB 1RK0B 2E27H 3DV6A 5DJ2A 3VTAA 3VBHA 4ODWA 2F7PA 2P8LA 3QRGL 5AVTB 2KZBA 3MNDA 3UJJH 5F9OH 2G4EA 2R072 2X10A 4HZLB 2KL6A 1NOFA 5TH2A 3TBSA 3T0BA 3TO4C 3OR7B 1RMU2 2WT1A 1FE8H 3ILDA 4KZEH 1P0SE 3NPZB 3DARA 4P4KB 2BVYA 2VISB 3H7BB 4N2BA 5HHPA 4PJ9C 2RS13 1L0PA 2XIIA 3A6CH 3WS3B 1QXJA 1INEL 1GYUA 1M1SA 3QG6A 1T22A 1CAXA 1QFUL 4KXZI 4LUMA 2EJ1A 4QGTA 2OQ6A 1CL7I 1MVUB 4JDEA 5KSAD 3F7VB 5B4MD 2BSED 2VO8A 3V6FB 3RQ0A 5A1FA 2JQZA 5C0GB 1CD1A 3NPSB 5G4NA 4OF3A 2AJZA 5LCVL 4P2QB 3ZZLA 2PYFA 1VFUA 3L95B 1BG9A 3RGBA 1N12A 4A7UA 4ISQA 2DD8L 4GBXC 1VR3A 4PIRF 2VDNB 2Y7MA 3NSFA 3Q2CA 4XP5H 3OKEB 4LL1A 4QPEA 3V4PH 2AUYA 4MHUA 5HHOA 5HTSA 2YC1B 5D7LE 5DFTA 2WC7A 4R4BA 1TQSA 3SQOH 2V5SA 3ARQA 3PV7A 4LP8A 1BQHA 2Z92B 4WI9A 1O6VA 4XPHH 3DVGB 3QQDA 1T89A 4ABQA 3RRDA 1K5MC 3CVDA 4G8GE 4XN5A 4N0FB 4G6JL 2D0HA 4WFFE 1YJLA 5F32A 1IGYA 4QHLB 2GK0B 4LSUH 5F7EH 3DOSB 3LJ3A 3WMSA 4D8OA 1KS5A 3H8UA 2LFGA 4OCSH 4QX1A 1WW5A 4Q8BA 5JIKA 1AX2A 1K3IA 1RERA 3HR5A 3NSCA 5IK7A 2PKDA 1GRWA 3FQ4A 3ME0B 4NRMA 5GZDA 1N3NA 4LZKA 4KK9C 2LHAA 3CU1A 1EAH3 1YAIA 2PW1B 4ZFQA 3BPOC 2NLRA 1X5LA 3AJ7A 3WJMA 5IB4A 3ARYA 2ZOLB 3IRCA 3I2GA 2Y2TA 3G08A 4ONGL 3MRGA 1FNSL 3N43B 4JHWL 4LCYA 2GH2A 1U0AA 1UU6A 2H2PD 3QO1B 1OQEA 2NY0D 3IDBB 4KO7A 1MFUA 1ODUA 3DUSB 4S2SA 4APXB 1J0YA 3A47A 2W1WA 2BPA2 3VSQA 3N06B 3QA3B 1FYHB 5ICZB 1EK3A 1G7HB 2OTPA 3DVNB 1PX8A 5D2LE 3Q9OA 3RVWC 4ZAKA 1TZIA 2HVKB 3LQZA 4KH2A 4P3DA 1X4YA 1F4YH 1XF3B 5HHMB 2QZ2A 2WXGA 4XCBA 4YW7A 5LK5A 3KM2A 1JNNH 2HJLA 3BVTA 3LKPA 3ALQA 4UNTA 5GGQH 4TYUA 2J42A 4JFOB 4N85A 4XMIA 3D4KA 4IE0A 1QRNB 3ZBMA 4XC3H 4TQEL 2NMNA 4GW5A 5D6DA 3NACL 5T54A 2ENSA 2O93L 4Z7AA 3V0AB 2XDVA 1AAJA 1XNKA 2MQ0A 4LLAA 1R3KB 4NAJA 1YNTF 1C08A 3QYCA 1CF8L 3PGDA 2L8AA 4Z78B 1AF9A 4KJWC 5KVGL 3PURA 5I5IA 1RJZA 1U3NA 3FSWA 4L4TB 1QMJA 5DQDH 3GMPB 4FJYA 1VSCA 3KWXA 2V73A 4FQCH 4N1EA 2AW2A 4BXSV 3T6XA 1SJEA 3OF6D 4K5LA 3VXOB 1MFBL 4CDQC 2IGFL 3AT9A 4HS8H 1SBFA 4NCDA 1JTPA 5IBTL 3QUZA 1JW6A 4LIVA 1S7QB 2P5PA 2FYYA 4WF7A 1XRUA 1DVUA 2FDBP 3UTPE 3T1MA 4BH7A 3D3VA 2DUPA 3K2KA 1SBBA 2AV1A 2H8PB 3V4VH 1QJX2 2DMGA 3SKNB 3ATBA 3KS7A 2NY4C 1IC4L 4XDPA 5DRZB 3HKFA 3WFHB 3F7KA 4XH2A 2QSQA 3P3SA 1W6QB 1W9TA 2FCUA 1J9TA 1FFNB 2AJVH 4OTXH 5EU7E 3LE0A 3RMYA 1IZ3A 3ARFD 3M17B 2WLNA 3DX6A 5DJDB 4AT6B 2OYKA 1IAII 4PD4J 5C0BE 2VLJD 2MCAA 3QBQA 1LHVA 3O1VA 3M8OL 1UXLA 1ZT4B 3EF4A 2A3YA 1CPUA 1YEGL 4M5SA 5FK9B 1RUC1 5DC2A 2R39A 3TFBA 2XBO3 2H7WA 4M62H 1FNGB 1U3YA 1HHKB 1HRV1 4UM9B 4IE4A 3IJYA 4FQPA 1PJWA 2LVCA 3QZMA 3HG1E 3QCUH 3PL6A 4M8QB 3T0WA 2VM9A 5JSOA 2YKLH 1T1WA 3CX5K 2YGMA 3HEIB 1UA6H 5IJKA 4HN1A 2KA3A 4Q4V2 3HMWL 2NW3B 1JYVA 4DNYA 1NSNH 3MZHA 1X44A 2QV2A 5LVEA 1WV7T 3F12A 4P48A 1NCAL 1F0LA 3NRFA 1OP5K 4KY1L 4OGQC 1S4CA 2Q8OA 2R1XA 1P69B 5C0JA 2VISA 2VOXA 4I3PA 3W21A 4PQXA 4JN1H 3M7AA 4AIOA 2WQ8A 1FVDB 1BF2A 2ICEA 3LOIA 4OCRL 5K1NA 4G4FA 4ZHNA 2R0KL 5C8CC 1C5CH 2PPCA 3BH9B 4DP8X 3N4MA 4ZDHB 1GGTA 1YIFA 1MVUA 3H3UA 4NHCH 2P7TA 4MGKE 3HI6L 3P3NA 4CN6A 1MEC2 1L9NA 3BWZA 4G6ML 4UNIA 2ADGA 5GSRB 5FUCC 5IK5A 3ARUA 4M6OL 1RU9L 3X14B 4P2QA 5BRQA 1GZWB 3L95A 4FFTA 1IQAA 1HILB 2R0LL 1NCCL 4LL4A 4MQXD 3BZFA 3QIUC 3OKEA 4NUGH 2YC1A 4HUNB 3W9EA 2BVUA 2MTAA 4DPAX 3DVGA 1SFDA 3C2AL 1FOD1 2ZKNA 5EZWA 3B7MA 1BQPA 3JB8A 3H54A 2YLKA 4N0FA 4EBQL 3VQLA 1WITA 2WRAA 3GSQB 4NP9A 1AQKH 5FKAA 1N0LB 4HMEA 4WW2B 2E27L 1T5XA 2C4FT 5I76A 3OYWB 2IFFL 2IXIA 1UENA 3VU1A 1U5XA 4DAGH 3QWNA 3M70A 5E8PA 3THCA 2BVVA 3E3QE 3F5WB 4KZEL 3T6ZA 1DR9A 5AKRA 4PJBE 3U4BH 1DZRA 1G4RA 4N5EC 3R7QA 3VWKB 3A6CL 5LGHL 4BB3A 3KVBA 2J55A 3MC0A 4MA3B 4PJAE 4BZYA 2ZOLA 2J43A 4P5RA 4XNZC 5IB2B 4IGQA 2C9PA 2NXZB 3RHWK 5MEOB 4YVSC 2R1YA 2ATFA 3QO1A 4UQ2B 5BXFB 5HI4D 4OUSA 4FJZA 2OSXA 3DUSA 4APXA 3WLWC 1K5WA 4MB3A 1KTCA 1TVDA 3V4PL 3DVNA 2ZUQB 3H3KA 1UKTA 1XSJA 4RZCB 3ON7A 3I8TA 2HVKA 3KYOA 3M3IA 3MICA 2XC8A 3IMTA 3GSUB 2YMTA 3GSVA 3SQOL 2I07B 5C3LD 2NYYA 4FA8A 3H3ZA 1QBBA 4XPHL 3PLQA 5K93A 3DK0A 4H3WA 3VD0A 2NCMA 4OZ4B 4U1SB 5JSRA 1OEZW 3HG4A 1JZDC 4XTRC 4WW1B 4I9XA 4MMXC 2EH7L 3X1FA 3VZJA 4LQRA 1B6DA 4LSUL 1J0KA 1SHSA 5F7EL 4L37A 1QWRA 2HWB1 3S6CA 1DQ0A 1DBKH 2VRQA 2ZP9A 4Z7WB 4OCSL 3V0AA 2B5IB 2DKMA 3Q3GA 4Q4Y1 4I0WB 3OEBA 5ICYB 1R3KA 1DQIA 1Y6KR 3AROA 1IRAY 2EEBA 3QE5A 5KBKA 2WKOF 4Z78A 5J48A 3DGGB 4N1HB 1RUH3 4RIRB 4IBVA 4ISRA 4RSYA 1ULDA 4ISVB 4A39A 2ZOOA 2Y5TA 3CQPA 5EJ1B 4Y89A 2XETA 1A9BA 3ZX1A 5FA4A 3VI3E 4AE0A 1UOGA 2F5AH 3R4UA 4N2MA 4XJUA 1B09A 5IJDC 5C6CA 1NICA 5HDBE 1ET7A 2RDRA 2RDNA 4KJWD 4ZT1A 5FW7A 1YEWA 3AXHA 3EHBC 4IU3A 3VO0A 4KXBA 3U37A 5DRZA 5FK8A 3OQRA 3WFHA 5CZVL 2C5DA 4RGND 4CDUC 4FG4A 1QMUA 1FFNA 3ML8A 3KCYA 1YECH 4G70B 5JDSA 1JNNL 1PZ3A 1VAHA 3QCVH 1UWEL 4PG2A 2IJ0C 5DJDA 5A1AA 5FXVA 4XCFH 1UZ6F 1ZT4A 4XC3L 4RX4D 5BW7C 5C70A 4AEJA 4AZUA 3EBGA 3CU7A 3KLAB 1EPZA 2NY4D 3U25A 1QP1A 1F13A 3FCGA 3D85B 3PJQA 5LBFA 1H8SA 2AJXH 5INCB 1FNGA 2P44B 1HHKA 4YH6A 4Y26A 3D34A 4CDWB 2XVKA 2Z69A 1H3PL 1T6BX 2VXTH 3F83A 2Z64C 3P40A 4FQCL 4IKJA 4UILL 4EMZA 4HUXA 2WN2A 1MZEA 1C8PA 4Y2OB 4YX2H 1G1KA 5KBPA 1W16A 2WLLB 5DMGC 2H1PH 5SWZE 4XT1C 3JBG7 2BXYA 3GI8H 5I19H 4QLWA 4JO2L 2UWBA 1R1CA 1QABA 5FLVA 5AENA 1E9QB 4XBPB 1G0YR 2X7LA 1JGLH 1IO4C 1UU4A 4A7SA 3WNIA 5CFDC 1I1RA 5DZVA 2HWC3 1K8DA 5FFGA 4DZBB 4MXWL 1D0HA 3RNSA 4YM1A 4IIZA 4MDIB 4XFBA 5JOZA 1GZHC 3I2FA 4FAHA 3HBPA 5D4JA 3H3BC 3X14A 3IU4H 3B5HA 3E1F1 4LBQD 3K2MC 5L9RA 2ZXWB 1N3OA 1IT9L 2OYPA 3R05A 1HILA 3GDBA 1WUVA 1MFNA 2CA4A 3QEHB 3C09C 3W2DH 4XFHA 5FYLD 4M62L 3JWNE 4FOVA 4Y3OA 3DECA 4FI8A 4RGOH 4EZ4A 4Q4W1 3PABA 2XI9A 2H47C 1A1MA 2MJWA 3LD8C 4K23L 4PRPA 5CNHA 5EU6D 1QLFB 1MAKA 2CBOA 3QCUL 1HLCA 2VLKE 4GG8B 4YE0A 3CQOA 4LVOB 2YKLL 2APXA 1CL7H 3Q2WA 3ACFA 5DN2A 4JLRB 4LOSA 4YDVB 5DRNA 2YBKA 3NA9H 4XAAA 1F11A 2WXKA 4Y16B 3WT3A 3KPSB 4GKOA 4QTHB 3B3IA 4HU8A 4Y4FB 3PMSA 3O2DH 1GAFH 3WI9A 4NQEB 2GJ6B 3AREA 3VWKA 4FQQB 4JCMA 5FB8B 4JN1L 4K7FB 4Q6KA 2CNZA 2VLMD 2WBJC 3KDMB 3NQHA 4NQXA 4K5NA 4WM7C 2J5LC 2XWBA 1FO0A 4UW3A 1C5CL 1MY5A 1RZIB 2AEOA 1YUDA 2A3XA 2BFGA 4NHCL 4AI7A 1ID2A 3GXMA 3LRSA 2UZXB 3ALPA 3NIGF 4KTDH 5BXFA 3N85L 4LU5H 2ZX6A 1CN1A 1IG3A 2UU8A 5IVEA 1F4WH 1OTSD 3QORD 2RJ2A 3VBFC 2YD3A 3M3CA 3AB0B 2E7CA 5DWUL 4JO8A 1OK8A 3GSNA 2P45B 2BOBB 4UYPA 4APQB 2IO5A 3VD7A 2Y07H 1NFIA 1JU3A 3KPRD 3JUUA 1T1ZB 2P8PB 2VR8A 3A5VA 4ZKTB 1OTUD 2G4GA 3GSUA 3SJVB 2YDEA 4X7TB 4NQCB 3L8QA 3MYJB 2R0HA 2WXMA 2Y7QA 3INOA 5DF0A 2OUHA 2VZTA 5CJ8A 1QH6A 4R7NB 2PNDA 1I3UA 1SN5A 4ZTOH 5A6ZA 2CR0A 4KG0A 4WW1A 5L36A 1AQKL 3WLWD 5KHGA 4BYYA 3ZYZA 2CLRB 3C5ZB 1RZKH 3CHQA 1X7QA 4KU1A 3BSZL 3INUL 3FC0A 4G6AD 1NGXA 3A67H 4UT6A 1CYWA 2CAKA 2FGWH 4R0LB 3U4BL 5JOFA 3H2WA 3PXHA 1KIUB 4G6FD 1Z1WA 4N25A 5EU4B 3VI4E 1FT9A 3GEFA 4QTIH 1BMGA 4FZEH 2OCFD 2NXYB 2NSQA 5AVWB 2EUZA 4XF9A 5EZJA 2DQDL 3TF4A 1JXFA 4HWEH 1T0OA 2BNQD 3GIVB 4KNTA 3RDTB 1B0GA 4MSVA 5CEZD 4OHZA 2C6SA 1A1OB 3RAJH 4S1RH 3VFVA 4F24A 3B2XA 4DP7X 3IEAA 2QGDA 4NAQA 4FQZA 3WF3A 2I85A 1AQ8A 1DBBL 2XG5B 4HKBB 1MOEA 2MNGA 5KXCA 4I7ZC 4WJ5A 2ENQA 3BLPX 1JZHA 5E2JA 4B41A 2VLRB 1S55A 3HNMA 1ACYL 5D55A 1B4TA 4Y4YA 1IEAB 2P9RA 4N0YL 1A47A 2ED9A 3Q6FB 5D2AA 4AQAB 3QXUA 1HOEA 3GPEA 3NJFA 5E5MA 2BZ7A 2ZHMA 1AGCB 1D6VL 1DBKL 5B1CA 2AXWA 4CDWC 3EHBD 3KLAA 4YSSA 5F7LB 2IH3B 2L3BA 2WC2A 3KGUA 2EAEA 1V7NL 3MBEB 3QHZL 4K3EH 4YSQA 2VDPH 1R9FA 4PRDB 3I85A 4Z1PA 4ZMAT 2DTWA 4MGIE 4P2OB 3QUYC 1W6NB 5BOJA 5T1JA 4CNIB 4FPCA 4UXAA 4K2UL 5IQ7L 1WSST 3DIVA 1XE8A 2MRYA 3S4SG 1C57A 2WR9A 2MNUA 1HQRA 4NNXB 3VNZA 2ARJQ 2FR4B 2IXKA 1H8NA 3HC4L 2VB5A 2WLLA 3NCCB 3S35H 4JFDE 4LLYA 1IAIH 5EXOA 3PTRB 4J3XA 4BM7A 2JVUA 3RNKB 3FLTA 5DD6B 2EXWC 3TBYB 4B9JA 3HZMB 5FYJU 3ZYJB 3FS9A 3MV9E 2WVTA 5IOPB 3SODB 5CYYA 3PP4H 4GKLA 3FN0L 1XNTA 4JRXA 1FC2D 3I50H 4FSJA 1C12B 4BK8A 4TOYH 3W9DB 5IMMB 4DVBA 5JQ6H 1LRHA 5C4WA 3O5SA 4I02A 1NCTA 1M57B 3DVIA 1YECL 3WDXA 3J7HA 1JUFA 5D96C 4WVWA 3HG5A 4XCFL 4XPBH 1V6LA 4J5VA 1AR83 2FCBA 2ZKMX 4M7KL 4L8SB 2ZGTA 3ZN6B 4QQPA 1O9WA 4JFFB 1IC0A 4UNVA 3CLEL 3AL5A 3FT2B 4XNUL 1OT2A 3ULSA 3PNAA 1QHDA 2PHLA 2VXQA 3GGLA 2XHKA 2IANE 4IGBA 1QLFA 1ZLDA 5CCGE 3TA3D 2VXTL 1MUJB 2GT9B 2ZYHA 4GG8A 1CFTB 4LGPB 4OB5H 5KJ7E 1FMD3 4YRDA 3R1GH 3H8XA 4OVVA 3TPKA 5J0BA 4JLRA 4ZUVA 2QHRH 4YX2L 1N64H 3LMJH 1KXHA 1FIGH 4Y16A 2RV9A 3KPSA 3P73B 4QTHA 3THMH 1LOAA 2GJ6A 3DROA 3QJZA 4MDJA 4HBCL 1FX5A 5FMCA 4IE7A 1W8HA 3KDMA 3K3QA 1YAZA 1O9ZA 4UU9B 4OI9A 1S7VA 2B8OT 2D7OA 4U6XB 4UFJA 4K8RL 4NUQA 4PH8A 5DLMH 1FH5H 3FHIB 5BV7H 5CF3A 4MZ3A 1WBFA 4M0HA 2UZXA 2IALB 4QM9A 4BQCA 2ZKLA 1XAUA 4LRIC 4YHIA 1Y9MA 3O12A 3IU4L 2RDSA 3HR9A 1E5UI 1K9TA 3FQRB 1YMMB 4U4IA 4DZGA 3ZZQA 1CWPA 4JAMA 2XQXA 5H9PA 4NIYE 1T1ZA 3U36B 4FPJA 3W2DL 2P8MB 3UBXG 1SLIA 2PXYB 1FJ1A 3CL1A 4NEHB 4NQCA 4BJLA 2BH0A 4FTVB 4HKXB 2F53D 4ORGA 3GMRB 4RGOL 5C0AD 4Z3GA 2Y1VA 4CCMA 4R7NA 3Q9QA 1ASOA 3URFA 2RGSA 3C8HA 5MEQA 3B7SA 2X89D 1VLXA 1JGIA 2PTMA 3AU0A 1CL7L 3IXAA 2CLRA 3SEEA 3FRPG 1AG6A 1TOXA 4AAXA 1WP6A 3C5ZA 4WI0A 1KFUL 3NA9L 2EDEA 3JQOB 2R063 5BNNC 3ZHLA 4KI5F 3MLSH 1YYNA 3O2DL 1GAFL 3OSKA 2JNZA 2X1WL 3KYKH 4XN2A 4N2DA 1DJGA 3D69A 2PHXA 3LZZA 5AALA 1KCRL 3T4AB 4X7CC 3KCCA 2ZWKA 3RDTC 1LTXA 4DVRL 4WBBA 3T9WA 4ZUUB 3K91A 1AO7A 2DVBA 2WAOA 3UGGA 4N7UA 3GIVA 4G5ZH 3OUHA 3AZZA 4LOUC 1QR4A 3Q13A 4KTDL 1J05B 1RIHL 1XAKA 2EILB 2YAEA 2ZMNA 1ETA1 1GP5A 1F4WL 1KPVB 3AUVA 5E9DD 1BBT2 1ZVSB 2CDGA 2ZF8A 4FFHA 1FZKB 2GJJA 2LU4A 4R4NC 5CN3A 1RUNA 2HMIC 3ARGD 3IMUA 4IL7A 2NZ9C 2APWA 4PWGA 2Y07L 5GLZA 4UUJA 3ARSA 4GI6A 1TT6A 4HKBA 5E2WH 1XFPA 1FFOB 4Z5RA 3L5JA 4W6XA 1AS7A 2IAAC 5I75B 2DS4A 4WGVB 2VLRA 1IEAA 3DV4A 5TSWA 4FEMA 5DZJA 4L1HA 1YNAA 3Q6FA 4ZTOL 3IFLL 2H26B 1KTJA 4XW3A 1I7ZA 3DA0A 4F7EB 3LGRA 2AJSH 4I4WB 5I1GH 1RSYA 5T5FH 5A7OA 2L4OA 2YK1L 1RZKL 2IH3A 1US3A 5KSBE 3MBEA 4AI1A 1EV2E 4XHBA 4HXCA 1REIA 4XC1H 1QRNE 4CW1B 4P2OA 4XAEA 1W8TA 4B7KA 5A6YA 1E43A 4G8EB 1WWYA 5EULV 3ULVF 4MRBA 1Q1JL 4FZEL 4HPKB 4NNXA 3KBHE 4LSPH 2R59A 2N4IA 4LHQB 3MO1B 3QUMH 4L4TE 1VBB1 4S1DC 3RAJL 5GGSB 5ABZA 4A6OA 4JZJA 3RNKA 3D6GA 3HQUA 1RVFH 2WWMD 1FNZA 2P3JA 3ZYJA 1TR7A 3QUYD 5IOPA 2ALWA 1UVQA 4G1MA 2GIYA 4A38A 1IAOB 4QXVA 5ACLA 3GKWH 1C12A 3RJRA 4QOKD 1RXLA 3FCTB 1WIPA 3SGEI 3PV6A 2C3HA 3W9DA 1I9IL 5BVJB 1JGVH 1M3IA 4M29A 4R7DA 4QPGB 1TME1 3RGVC 2EE6A 4AYSA 3U7WL 3UL2A 4OFPA 5AW0B 1SZBA 2H9GB 4IDJH 1UM4L 3T8XA 4ZMQA 1I3VA 3D8MA 2X4PA 4X7EC 4AITA 3TN93 2ZOKA 4L8SA 1HQ4B 4U7KA 4YZFE 4AQ1C 4U7SA 1KJVA 3QK0A 4MV2A 2AXHA 1EO8L 4K3EL 1CDUA 1EIBA 2C1PA 1JYCA 5GJSH 5A70A 3IE9A 4JQIL 1W8UA 3MCYA 4PRIB 3BZDA 1VEMA 1MUJA 2PHFA 2UV3A 1CDHA 1AI1H 1CFTA 5F7AA 2WXIA 1DLFH 3LV3B 3Q2NA 4H1LH 3C08H 1UMIA 1WFTA 2O30A 5I23A 2O72A 5L2JB 3S35L 1TEYA 4FC3E 2WO2B 4HIQA 5A43C 1IAIL 2VJXA 2HYMA 3VDDC 4FFZH 4B9CA 5D2NB 1LXMA 3MN8A 2ZUSA 4U1NB 3DXUA 4AK1A 3QDGB 4KHTH 3PJYA 5F2WA 1J1OL 1NH6A 1ZLUH 1IILE 4TOYL 5JQ6L 3VFMA 1I1EA 3T1LA 5GS2H 5E08H 3S3SA 1CFQB 4INDA 2YJLA 2E7TA 2DQGL 3N9PA 1MRFH 2ADDA 3DKHA 4MB5A 1UQSB 1J5HA 2I2SA 2HH0H 2IALA 4IHOA 2RS53 4TXWA 5D8AA 1UG9A 4HG4J 1Y0LB 3KWWA 3UMNA 1HN1A 3FQRA 1YMMA 2Q1MA 2OL3B 1OKEA 2VE6B 3ZXAC 4BK4A 3GBNH 1SHWA 4WWKC 2P8MA 3Q2LA 4URTB 4EUPG 4HKXA 5EHDA 5KR7A 2O6DA 3GMRA 1URLA 4QUOA 1LILA 1P7KB 5GRXG 4K71C 4YQXH 1OM3H 3V6OE 1HJFA 4E4ZA 1UH2A 2CO2A 4XAKD 1W9SA 4YGVB 4XIOA 2DURA 4UF0B 3VM7A 3E2HB 3FB7B 3R1GL 2GIXA 4AEDB 1FNEA 4FG0A 3RKDC 1S7SB 3LMJL 5SWSA 1FIGL 4GKZA 1AHWB 1AYOA 3FOMA 4HMCA 5E8DL 4ZW6A 4P5TB 2O0OA 3NIFB 1TU2A 2ENPA 3HC3H 4XXWA 1KBWA 4G8IB 4W9GC 3TJEH 5FAXA 3T4AA 4OF8A 4GA9A 1AMYA 2VN6A 2VTXA 4CSSA 2HWE1 1VCAA 4N9HA 4WI3A 4CDHA 1EGJL 3WUWB 1SYSA 1JZJA 1NGPH 4K3HA 3LY6A 5CU5A 5DLML 1FH5L 3BAWA 4OUUB 3W5MA 4CTEA 4ZS3A 3JWOC 4U1HB 5EZLA 3T3ME 5HI0A 3RZLA 3VM5A 5JHDE 5KJRL 2OSLA 2VDRL 3IMSA 4LMQE 2MOVA 1G1YA 1QPPA 3MRQB 4X7FC 4GWMA 1ZVSA 2PW2B 2AMGA 2GTWB 3HMXA 3HAEH 3I9GH 3WTSA 2YMXH 5HYJE 3KT1A 2ZX7A 1I8IB 1NAMH 4MNHA 1FBIH 5FO7A 4Y4HC 4O5LL 3P3PA 4K3JL 2Q2EB 1FFOA 5H37G 1OD3A 1BREA 5I8EB 4OLWH 4BFGA 4BSWB 5ACZA 1OXYA 4OZIB 3MJ9H 2BYVE 2JDAA 3T2NH 3FUIA 1Z9NA 4XVUC 5TK2A 2O1AA 4OZGA 4BA0A 3M46A 3GT6A 5DUVA 1H0BA 2H26A 5GRZA 3V5KA 2HMID 4N22A 1NMCC 1UADC 2B4CH 1FYTA 2NZ9D 3DXAB 3ZN4A 1CXHA 2CKBH 4ZSOB 3CLFH 2VDML 1DZ0A 2EUVA 1G94A 1ZS8B 2QQNH 1PS3A 3BPSA 1QOTA 1SFHA 3LEXB 4JRFA 4CW1A 4Z7WE 3BHBB 1PO23 4ODTH 2ZZQA 4LBOA 5IVOA 3VXUA 1KDJA 2I27N 4XPAL 3FH8A 4Z7VB 2DIJA 5DA0B 1KCSL 3IWVA 5AW7B 3VFWA 4G5ZL 1TO4A 4AJWA 1Q8VA 4COVA 3GBMH 1S2EA 3ZKXC 4N28A 4Z0BL 5GALA 1XZ0B 4LSVH 2ATAA 2BXZA 3DYMA 1YRKA 5H9SA 3OGSA 2OQJB 3HI1A 1JV2A 3WEXA 4ZMZA 1ZY9A 5E2WL 2H6PA 3KHOA 1F15A 1GZPA 3IMBA 2X3CA 4XPFH 2EA7A 1K42A 1F4HA 1U91A 2VN4A 2XU9A 3HE7D 4RA0A 1UZ8B 4XVJH 1ZXKA 1UJ3A 3DK2A 4QPGA 1ROCA 1BQ5A 2WWKO 3F7RA 3N3EA 1QTYT 2YROA 4PJIE 4S1DD 1T03H 5BNOC 1FWXA 4LCCB 4PJCB 2EE0A 4RISH 4F1SA 1U8OA 5LBSH 4Z3IA 4DTGH 4OI7A 1RZ8B 4XMVA 2AJSL 3OKNB 5DZAA 4U49A 5I1GL 3U4AA 1GV9A 2RS33 3WF1A 2ARJB 1FNYA 2GP5A 1KYDA 1KZQA 5H4YA 5LA0A 3QULA 1VBE1 3GMLB 4XC1L 3D18B 3EO9L 1OH3A 4UFIA 5E4OA 4OF7A 3RGVD 1U41A 2IFGA 3QD6A 4W70A 1BLIA 1OSPL 1LJMA 2WOBA 1PG7H 3CMGA 2VTFA 3LRHA 1NPJA 4K55A 2NY3C 4QHUB 4N43B 4XURA 1TG7A 4HAGA 3LV3A 1RIVL 1H2LA 4RCAA 5FUZL 4V1DB 4ODHH 3N9MA 1OE3A 1R75A 5C3RA 2WO2A 3NJJA 4HUVA 2YD8A 3CFCH 1TO5A 4JY4B 3BW9A 3OJDB 4K7PL 3B56A 3JUYA 4N3UA 3U75A 4U1NA 1DLHB 1G1CA 1PCSA 2HWD1 2XKUA 2YPLD 1MSPA 3QDGA 1WZAA 4JKKA 1CLYH 2JCCB 3ARBD 3K51A 3SDCC 2WB1A 3LHPH 3O3BB 1JGVL 3W11C 1R5IB 2CO7A 4R84A 2B1AH 3DHMA 2RBLA 5GZOD 1OQOA 4L1DA 2FJGB 2XG4A 4IDJL 4BZ2A 3FHAA 3ZYGA 3P5BA 4PRBB 4FQHB 5LXVA 4TULH 4RL7A 3UAJC 4YK4B 1US2A 4J3VA 4GO6B 3NAPA 4AFBA 2OL3A 5A16B 4FLRA 4N90E 2VE6A 1WA2X 3E80A 2ADEA 3EDEA 4HALA 4RDQG 2F4PA 4Q0UA 3FO1A 4OLVL 2KBGA 1BQSA 5GSVB 3NJLA 4Q4Y2 4ADJA 1F2QA 1P7KA 4MH0E 4GIOA 1TTBA 3H9HB 4YWGH 4DGYL 1PK6B 3OLGA 1F6FB 4YGVA 2ZX1A 4COUA 4PJXB 5E6IC 1RUPH 3BMVA 3AXIA 3C08L 3O8XC 3EIFA 4Q5OA 1C5IA 4HA1A 1S7SA 4X6QB 2FJFB 5DFAA 1AHWA 2AK1L 3P9LB 3INAA 3O3DA 4Y4KD 3OB0H 3V0DA 2YRZA 3ILPB 4M7ZC 4P5TA 3WJJC 1YSOA 3KV6A 1QDOA 4JEGB 2X9WA 4FFZL 4G8IA 1YY8B 3EBIA 1UYYA 3D8CA 1KSRA 2NDGA 1BEYL 4ETYA 1W80A 3TV3H 4KHTL 5HXVA 2J6EA 1TSRA 1MH5A 1UWXK 5CWSB 3KPSE 3WUWA 2YBRB 2WNVB 3RVHA 5JOXA 4ZOAA 4M5TA 3RKDD 1PPIA 4KK8D 3DPBB 2GJ6E 4NQEE 4HVRA 5LJYH 4N9OB 1LE9B 3VBRB 5FXXA 3SKUD 1KEGL 2HH0L 3G9AB 4QRUA 3ZRCC 4GW4B 2GTWA 4CUCA 2DF7A 1AR1C 1I8IA 4J1UB 3MRIA 4X50A 1EAPA 4EV0A 1OD5A 4WENB 5GHWL 1A1NA 2WV3A 4BM8A 2SLIA 4AI2A 3GBNL 5ABDE 2XXFA 3QDJA 4UIKH 5B39G 5I8EA 1J3PA 1VBC1 2PQSA 1F97A 2HX7A 2XLFA 1BJ8A 4OZIA 2XZAH 2GAUA 3UL4A 3RGHA 1OM3L 5E56A 7FABH 4PCTA 4YQXL 4XNBA 5E4AA 3UK9A 2XFGB 5LY1A 1MDTA 4ONHB 1J18A 3SJVE 1J84A 1VMJA 4G9DA 4QGNA 4Y22B 2EINB 4LSSH 3WHE0 4KPHL 1GY2A 4PWIA 5IBUG 4GAZA 4ZSOA 2IOMA 5J3UA 1S9YB 3UYPB 5D1QC 2XR4A 5JI7A 2F54D 2R29H 2LUWA 4DWHA 2OX0A 5FKPB 4JMXA 3HC3L 3D39A 1CZSA 5F9AC 1XO8A 4KI1A 3TJEL 2BGOA 1OE2A 5K9OA 3AGWA 5GGTH 5T8IA 4PY7B 5FPUA 1DJHA 3FOLB 1UXXX 3P0YL 4NCC1 5M94B 3RBSA 2XQYK 3PY9A 4F91B 1POV1 4A7YA 1D5XA 2AERT 2Y5EA 4GAJH 1LK3H 5LB1A 1UKSA 3WW4A 1X5HA 2CDOA 1AGBB 5H35B 1XZ0A 1B0RB 5FP4A 4GINA 2ZWLT 4LARL 4XN7A 4XMTA 2YMXL 1WZ1H 1NAML 1FBIL 3TL5A 3FRUA 2R1DA 5E23A 4YHNB 1GGUA 5IVJA 1TQUA 3HHSB 2XT1B 2F68X 2K6ZA 3HBKA 2VL4A 3G6DL 2XXGA 4ZRGA 5IG7A 2HYXA 2DEXX 1W15A 1MLCB 4H7LA 2PO6D 1BD2A 1RK7A 3V8OA 4Z2WA 3L3DA 3TN0D 1HYRC 2FNBA 3JD72 2X28A 5DRXB 4AIEA 5DK0B 3CVHL 4GXUN 4ZS7H 4BLIA 4F7CB 2WLYA 1RZ8A 2WFF3 2JDYA 3OKNA 2O1QA 2B4CL 1YYLL 2ARJA 1Q72H 2CKBL 2WZPP 3L9JT 3KPPB 4HGMA 1SLAA 3FC8A 3EJYC 5LCVA 2RQEA 3V52H 1VB9A 1HU8A 3GMLA 3KVPA 3EOYG 1W6MA 3JT0A 4X5LA 1MZZA 4PBDA 3O4LD 3S88L 2F18A 2P26A 3LOWA 4J6GA 3G5VA 3ZE0E 2LALA 2SBAA 1H5BA 4N43A 3RWIB 5CJ5A 3L2YA 4QHUA 4UQBA 3W0WE 3EFOB 3SGEH 2QKSA 2XKPA 4M03A 4LCUB 3S5LB 4Z76B 1VZGA 1PGW2 1VRH3 2A3TA 4I2XB 4YYOA 1XGUB 3FQXB 1A6UH 3ESMA 1WBXA 35C8H 4HK8A 3C75A 5E1AB 3K77A 3MNVB 4OV6F 2PA7A 4JY4A 1WFOA 4X42A 3EYSH 4K9JA 3IM0A 2WJ5A 3ZTEA 3WKNA 2DWTA 3ZL4H 2EABA 4LSRH 1P6AB 1UQXA 3MMEB 2NY3D 2MH4A 5GZEA 5HGHB 4XP4H 3ARPA 3ZDXF 2XX1A 3DX8A 4XPFL 1MF2H 4YSAA 3I49A 1ZE3C 3O3BA 2A6KA 5MERB 3VD1A 3T4HB 4XVJL 4AJ0A 1R5IA 3OAZH 1ETZB 3AQYA 4X98A 2DBNA 1ITBB 5L2KD 1QUNB 1JZ2A 2AREA 4GPVA 3CDGB 2FJGA 1TNNA 2WHVA 3AG4B 3FU5A 1XCQB 1CAVA 3TGXA 3ILRA 4LIUA 4KK5C 2AQPA 3SHSA 5A16A 2D98A 1RUD3 4N2GA 4MBRA 3SDCD 4NB7A 1RUG2 1JXGA 4JRWA 4G1EA 3W11D 4PS3A 5GSVA 4G82A 3V4PB 2BM3A 1DBAL 3MLRH 5F39A 4JFFE 1ZDQA 2Y0SA 5C2BH 4O4YH 3U0TA 1PG7L 2HN7A 1DGWX 1H6UA 1QHOA 1PK6A 4PJXA 1GC1C 2E51A 1PZ9A 4MA8H 1YUKB 3CJXA 1LHUA 3UAJD 4JE0A 1HXMA 1GQPA 4OGAC 2D6LX 4TLKA 3AM2A 1KLUB 2VXSH 3MV7B 4OMCA 1S9WB 5CSBA 5F1OB 3IMMA 3L3JB 3ILPA 3WSOA 3T5WA 2VABB 2WQZC 4PJ7B 4DRRA 1SYVA 3QAZB 2Y2WA 2ZP0T 3QZWG 1OLMA 3F58L 2X53S 5FZGA 5AAMA 4OZGF 2ZWNA 4XFFA 5F97E 3KBFA 2Y1YA 1CLYL 3TPUB 5CWSA 2OAAA 2BIMA 3FSVA 1KDKA 3O8XD 2Y9RT 4WVMB 3RZJA 3GSRA 2JICA 4Z8BA 3DPBA 3QUHA 4Y2NA 1LE9A 5L19A 1T3FB 2B1AL 2EYSB 3E5QA 2WXJA 5EO9B 3VBRA 1GP4A 1KENH 2BSEA 3L4VA 3O6LL 4JREB 3OBAA 5T5PA 4GW4A 5TQ0L 3QACA 2UZPA 2VJ8A 4Y5VB 4Q26A 2B39A 3MJ6A 4TULL 1H8TA 3KLHD 5CUSH 4WEBH 3ZGIA 1I9JH 4XQWA 2IH1A 3BP4B 2EDFA 1S7UB 4EOWL 1KFAH 4KMTL 1GSKA 4OF0A 4YWGL 1W72H 2EAKA 3IIIA 3BCWA 2XN0A 2ZOEB 4PRNB 1CGYA 2H0BA 4PMFA 2NPIA 3CHXA 1R3JB 8FABA 5A2AA 4FTVE 4TVUA 4S2FA 1QPXA 1OP4A 3G6JE 3MFGB 1AXYA 3UYPA 1AQDB 4BQ3A 4GG6B 4GAFB 3F00A 1QQDB 1WISA 3RUGB 3GZPA 4YAQB 4FCHA 2HWF3 3VBUA 1P9MA 4BCZA 1RUAH 4NN5B 2CAUA 3JWDH 3FQ2A 5A3UA 4PY7A 3NJVA 3FOLA 1H6TA 4IBYA 5J57B 4AXWB 3S37H 1CGWA 1IGFH 4YSUA 3AZVA 4MHRA 2NCEA 3PPSA 1MJUH 2OX5B 4JM0A 4AMKH 1FV1B 4L4VE 2CYFA 1AR71 4LPLA 3M3EA 2DQHH 1IGJB 5D1QD 1RJ7A 5F1RA 1AGBA 2ZAAA 3RIFK 3BAIA 5H35A 4KOBA 4F3JA 1B0RA 5FYKH 1RZ7H 3D05A 4E9RA 1ND3A 1UEYA 1ZANH 3L48A 4LLMA 1AXTH 4M1DL 3VJ6A 1LKNA 4LHKA 4XZPA 4NVPA 3PDOA 4YHNA 3CJIC 3HHSA 1MCEA 4F15B 1Q38A 1F6LL 1PLCA 1TYJA 3GSWB 1QJY2 1OF4A 4BE5A 4OLYH 2XZAL 1D4VB 1HJGA 5KBDA 2JIXB 7FABL 4K8FA 4EIUA 3P3TA 4B4PA 2W46A 2ADIB 4IXLA 3M2MA 1B0WA 3GRWA 4J25A 5K69A 1NXMA 1NMAH 2JH2A 4M9OA 5CBAB 4MXWB 5DVMA 3WLUA 4BU2A 4M6AA 4LSSL 3K46A 5ESVA 1I7TA 4IBWA 1DGLA 3BB6A 4ZO9A 3HWJA 2UXFA 4N2OA 3FX3A 3EJCA 3X13A 3U0PB 2EDKA 1FLTX 3MGTA 1BYNA 3POJA 3GJEB 4TNFA 1U95B 4L29A 1COV3 4ZXKA 1ZMYA 4FYTA 5A32B 4AI9A 2ZEWA 3RWIA 4YG6A 4AEHH 4JM2D 4LHJB 2CHXA 5GLWA 3S5LA 2OLDA 2OR7A 2NUTA 3U9PL 4LHLA 3JBG2 4FL4C 3VXPA 2G9GA 5JWPA 4GAJL 1LK3L 3OF6A 4I0CC 4NQDB 3WVJA 3H9YA 1T04A 3EJYD 2XTJC 1Y9GA 3NJYA 1DVZA 3MNVA 3ENEA 3WMPA 4NHXA 4RAVB 4U1IB 4PREA 1WZ1L 2MNJB 5DD0H 2WKKA 2WINB 4Y2DC 1HWHB 2NNAB 3MMEA 2VUAA 1NGQL 3MLTA 5HGHA 3LIGA 3QDHA 3B5TA 2CIKB 2OTWA 3RZCC 1AOZA 4IKIA 4TNVK 1M1XB 3SY0A 5MERA 4GB31 1M2VB 4X7SL 1ETZA 1JZ3A 4RGNB 3QNZB 5LQBH 3GZEA 4O02H 5C8WA 2VMEA 1QUNA 1QBLH 3CDGA 1HNFA 2R4SH 3ARFA 4RGGA 2JE9A 3IN0A 1KIQB 3OKYA 1J9SA 4ZS7L 1T7WA 3OPZH 2GZWA 4OLEA 2VLJA 4N9GA 5IB3B 4MXVA 4IMKC 1THCA 2BTVC 3BPNB 3VBOC 3EGXA 2HKXA 1MCRA 3V52L 5EU3B 1HXS3 4YVWB 2JXMA 5HCFA 2E7DA 2X12A 3EH1A 1MCQA 4D8PB 3BTYA 4UOQA 4YXHH 2WAHA 2R23A 3E5XA 5FY1A 2RH0A 2DW5A 1GXEA 3GMMA 2VNRA 3G04B 2W1SA 2YWYA 5KYYA 4J3OG 4HEPG 1TKWB 1USZA 3WLBA 5FDWA 1O59A 4KK5D 1QQP1 4LBKA 3WHUA 5F7BA 1KLUA 1OA3A 3KL0A 35C8L 4PRIE 2X9XA 1JZ5A 1EPFA 4IETA 4PLNA 3R4DA 3EYSL 4P2YA 4PJ7A 4LE4A 4OZIF 3OGVA 2RR12 2APTA 4LSRL 4W8JA 4MMZC 5FKBA 3WCYA 4PQ9A 3FU7B 1TTRA 2VCBA 4AENB 4KC3B 4X4MA 4KKLC 4QRPD 5GIRB 2FUTA 3DUHA 3ETBJ 4L23A 3T0EB 4OGAD 4PV8B 1X33A 4JDNA 1RUE1 4YHYC 2WLPA 2HRGA 4OD1L 5D2NE 1E27B 1R1A2 2IQ9H 4WM8B 3WR0A 4BFRA 5LK7B 1H3XA 4PGBB 3JXAA 5D7SL 1BXHA 3PWPD 4FLHA 1AR62 1GNYA 4GQRA 4AY0A 3UROR 5JO5B 2EIGA 3BYWA 4EN9B 4FTEA 4Y5VA 1KTLB 3AVRA 2VN7A 5JPMC 4L2NA 1F3RB 3CZNA 2XLGA 3SKMB 3LFIA 5LUMA 2VAJA 5GGUA 1WFIA 4PS8A 2KLSA 3P4NA 2AQ3A 4RS5B 4TVSa 3U10A 1XF4A 2VDKH 5ECGA 5KXEA 1T4KA 2WXRA 3DRTB 4IU2B 4DESA 1MS3A 1ZZ9A 4MA8L 2KC0A 3IE4A 4PLOB 4R7LA 1R3JA 5J11B 1H1IA 4JTNA 2BVEA 3UTQB 4WKXA 4NM4L 5KVEE 1E50A 4E2SA 4W6WB 1BOGB 1AQDA 1A8JH 2ENYA 4GG6A 1QQDA 4QRQB 3GHBL 4X6FB 1N1YA 4YG3A 4IDLA 1QI4A 1O7DE 3RVUC 4JGYB 2M8XA 4AVTA 3TC9A 4MAYB 5DVLA 4F7MA 1E5HA 3IB3A 1K5MA 4AXWA 2NMOA 4TUKL 1V6OA 3EJZD 1NGYA 5AB2A 3BIKB 4K1ZA 3NIFE 2OX5A 4SBVA 5JLVA 2OFQA 3DSFH 3HRZB 1LOFA 4CXWA 1YPZB 1OMIA 3ATGA 5JXJA 1SMAA 2GBTA 1GOFA 3AY2A 2I5YL 4J6IA 5FYTA 3NV4A 2Z34A 3IMVA 1L9OA 3QORB 3NV2A 4WEBL 3GKZA 1I9JL 1VBD2 3EO0B 3MRJB 1B9KA 1OA2A 4KXCA 1LOGA 3UEZA 5J06A 4IJ3C 4MVBD 3UG4A 3B93A 3GSWA 3KPRB 1O7FA 2Y8KA 3WOVA 3FNKA 1F6AB 4P4RB 4LO7A 2A74C 1KIPB 1A9VA 3ESPA 3J8F7 1XE0A 1W72L 4AHXA 2HRHA 4AM0Q 2ZJCA 1MQTB 1AFVL 2DQEL 3F2LA 1ML0A 4MXWA 1FFQA 3C60B 5CBAA 1FPN2 2YXWA 3AMPA 1A4CA 2X5IC 4NYLB 3J07A 2DMKA 1C8M3 3KPTA 3B2MA 2BGCA 4P59L 2QQVA 1DQQA 3U0PA 4WDIA 4PJ8D 4LDCA 3VAEA 4N0CC 4PRHD 1U95A 4HUUB 3X3GL 1AKJD 3VZKA 5CR8A 3JWDL 3THPA 3BUYB 3DXAE 1PIFA 3BQUC 5AG8A 5A32A 3AY4C 4FQLH 4ZSOE 4Z18A 3WO4B 2BP0B 1W06A 3L2HA 5EEUA 1CIUA 1MJUL 4DKFH 1PO12 1VADB 2OI9B 3LZQA 5HHXH 2DQHL 5DHMC 3P4MB 3DURA 3KR3H 3HTLX 2ZOWA 5JHLH 2HAZA 1T1XA 1CG9B 1U3HB 1U92A 1YO4A 4Z7VE 1E5RA 2OKMA 3UTTB 4JO3H 5FYKL 3AABA 3GHMA 1ZANL 4MD5B 1AXTL 4BQBA 3ZE2B 2NNAA 3MUY1 1OUXA 2DM7A 3B4NA 2ZXCA 4PJXF 1MY7A 2CIKA 1M1XA 3IFOB 1ZTXH 1LGNA 2VAAB 4OLYL 5EIIG 5IFAH 5FZOB 3V64A 4CDQA 2BNUB 5T1KD 1RUJ2 3QRLA 3L1EA 4UT9A 2F08A 1ASJ2 5JW4N 2ZHKA 1NMAL 2ADFH 2HRLA 4QKTA 1LE5A 4K8RB 5M0TA 2R2CA 3EJQA 1PIV2 4Y2DD 2VVDA 5D1ZC 1LESA 3KCPB 1D2PA 3P3YA 4RX4A 4B9KC 1BF8A 2DVFA 4JDMA 4CKQA 3S36X 3RZCD 4KI5M 2FT8A 1WT5C 3N41B 4PJCE 3TH4T 1Q56A 2E9GA 3VGGA 3WKMH 4PSRA 3TTYA 2C3GA 4D8PA 2VKXA 2VR7A 3MA7B 2QZ5A 4XX1E 1OF3A 1BAGA 4PD4K 1ZRFA 2W0KA 4HCRH 1KBBA 1DBJH 3G04A 2FBEA 3RG0A 1RCYA 5DS8B 1A3ZA 4AEHL 2BQPA 3WTVA 1TKWA 1WBLA 4RD7A 1JWMB 2NY2C 4JQVA 9CGTA 2CK0H 1E8WA 1MWAA 4GI9A 4S10A 4U1KA 5FZ3A 3TYJA 2WO4A 3E6HA 4KROB 2Q9OA 4RGMC 1GICA 1RUQH 1NLRA 2XWXA 1E28A 4V1DE 4GQ9H 4HD5A 3SQBA 3BSZA 3L7EB 2ZOTA 3FU7A 4IKLA 3ULAB 3VSVA 4IEQA 1DJXA 4RWHA 1CTOA 1LK2B 4Y8DC 4ZO6A 1JFQH 1YEEH 4YR6B 5HBBA 1GQHA 4PGBA 5HY9A 1IBDA 3MGOB 1S2KA 2DLEA 2GALA 3SKOA 2JCCE 2DKUA 1MREL 3VMNA 4A2GA 2AK4D 1BVLB 1KTLA 3OPZL 3P2TA 1QHPA 2H3XC 4LBQA 1UY3A 3BJ91 1MEXL 3KMHA 2LLLA 1L7QA 1R24A 5C8CA 1G0XA 4IEFA 2FQGA 3N04A 4YXHL 1LNSA 3RL1A 2E46A 3AZYA 4K1YA 1U2CA 4IU2A 5EU6A 1O9VA 1XV8A 3TA3B 2K0RA 4IEOA 3EXJA 2GY7B 1Z2KA 3CDYA 5DEFB 3Q5TA 1IKNC 1F3DH 2QVFB 1KY6A 4W6WA 4HP5A 3FU0A 2HKFH 4JFHD 4AFCA 3SOTA 2H32H 5AWNH 4GUOA 4D3WA 2MHAA 1N47A 3KGTA 1VRSA 1Q9OB 3TESA 1A3LH 4XPTL 3ZYIB 1OVPA 1I1CA 2EYRA 3BIKA 4QHMB 1JL8A 5F9JB 5JR7B 3MOAL 1A78A 3HRZA 3ALWA 4JV4A 2L7UA 2IQ9L 1QAWA 3EADA 4OLUL 4XZUB 3U7AA 4ODSH 4M3CB 1J3RA 2CLVB 4N86A 1KCUH 4F3FA 3ZTJH 5I28A 3RYPA 1IKQA 3IDYB 5EN2B 4C8XA 2A7AA 3QORA 3O7OA 5FYYA 2WWSA 1WFJA 4R4XA 3MRJA 3CHRA 1F3DJ 3DCQA 5JXIA 3Q8FA 3FAWA 3LN5A 1WYJA 4GRLC 3KPRA 4LSQH 1MCWM 4P5KB 3UZEC 2VW4A 1JYWA 1Q90A 2EE3A 4GXUM 3DYPA 2VDKL 4FQXC 4DO5A 4YVSA 4ELDA 1MQTA 1XL6A 2ZSWA 3W59A 1GZQA 1KBKA 1N5YL 2X0WA 3AVEA 1URIA 2G60L 2EDOA 1RFDH 2B20A 4NYLA 2RS11 2ICES 1RZFH 1FZJA 2QGBA 4E4DX 1F58H 1CFBA 5B38B 3BP6B 5E1GA 1KJ3H 1L6XA 4HUUA 4OZXA 1AP2A 1M7XA 1CZTA 1HH6B 2OJZH 2ARAA 4FO9A 3ZUCA 2O5ZH 1BAFH 3QHTC 4ZPVA 4LT7A 7PAZA 3K71B 5CP7B 4MMXA 5H2BB 5ERWB 3RNQB 2DN7A 5EEXA 3CZUB 3MRDA 1WK0A 4NKIH 2AEZA 4F92B 4ZZ8A 1DSYA 3GZKA 4MXVF 3C9NB 4CCOA 5CMAB 4EXKA 1XIWB 2BNQA 5FF6B 3WIIL 2VNGA 1CG9A 3WJLC 2UZYA 3FB6B 1HRI1 1ZRDA 5BO1H 5E9DB 4AQEB 3SDYH 3BQUD 3X2QB 4IK7A 1Z9OA 1N5AB 4IRZA 4QXUL 4N8VB 2CXGA 4NZ8A 3ARGB 4H13C 1EV12 3B3BA 2YGLA 2CDEA 1V00A 1KGIA 2VAAA 3SBWC 4KV5E 4DP4X 1MCLA 2BNUA 1J5IA 4CCEA 2YAQA 3TYFB 1AZDA 4FXGB 4ORFA 1RUOA 1PY0A 4PJ7F 1ZGLM 5I6XC 4DN3H 5CP3A 2TSAA 4UTBH 3VZLA 1U42A 5FPZA 3TIDA 1ZV2A 1EAH1 1LJ7A 4J3OD 4E9KA 1WHOA 3A4UA 3IPVA 3KQ4B 3MA7A 2OW7A 3VKNA 2R2HB 5DK2A 1SUHA 4HMDA 3UAFA 1AJ7L 4WO4B 3Q2VA 2VBBA 3EOBB 4Z7QB 2ADYA 3BLBA 3ILFA 3PIGA 3CZFB 5BS0D 2EUXA 4DKFL 1JWMA 4DP9X 1MIML 2RACA 4XVHA 2X4UB 4DEPB 3I54A 2P3IA 4IRSB 4N8UA 4BFJA 3KR3L 3GINA 3FFCD 1QI5A 3SKJE 4WQOA 4JO3L 1P2CB 2AEWA 1MCOL 2VO5A 4I2XE 3ZT6A 4G43A 5CFHA 3L7EA 4QX2A 3ZMOA 4P04A 1K8IB 3ATEA 1OB0A 1LK2A 2IQAB 2NY2D 4ADGA 1ZTXL 2D40A 1E5BA 3V4LA 3GI9H 5DR5H 3QH7A 4FXKB 4OZIE 1SHMA 1XC6A 5C0CD 1SEBB 2XTJE 1ROWA 3MVSA 2N3JA 4YDNA 4B9PA 2ADFL 4GG6F 2FECI 4FABL 2YPVH 4JO1L 4MNQB 4MQ7A 1BVLA 3O6MH 1NE4A 4Y1AD 5C3OA 2V5YA 3CGTA 1XQ4A 1A6ZB 5G04L 4C0BA 4Q6YA 2VDRB 4D7PA 1XYPA 4J8RA 1SBSH 4GXLA 4I30A 4WNQB 4MSWB 4GQPH 4RRPG 4NFDA 1LYQA 5FHBH 2Z0BA 2HYKA 4ARYA 3UO8B 4HCRL 4Y9CA 1DBJL 1CWVA 4PYHA 1AR92 1BZ9B 1E42A 1QASA 1PBYA 2IBGA 2XWJA 3QFDB 4GUQA 1IQDC 3TA3A 3WINE 4A4AA 2CKNA 1U8JA 2COQA 1DJSA 3AT8A 5AKTA 2CK0L 2DWSA 2XTLA 3WL9A 3PFQA 2CRYA 4N6RB 2Q76B 1PY9A 4U1LB 2A9DA 3DETC 4XPVA 3WN5B 4K5MA 3CNAA 5T33H 1JWSA 1HINH 1RUQL 5FW6A 1FFRA 3IGLA 1GGYA 1ZAGA 4GIQA 5GPRA 4ONFH 5KSVB 4GQ9L 1XU2A 2VDMB 1BEV1 5FUOH 3LD8A 3MV7E 1Q9OA 2O5NA 1AYN3 3ZYIA 3OKLB 1HDKA 4JKWA 2FDIA 1VGEL 1YEEL 2PF6A 3OEAA 5CKQA 3NJKA 1G9BA 2RS12 3FSZA 4R97C 4M3CA 4J3WA 1FL6B 1PKQE 2BP8B 4EZJA 3C2UA 2HJFB 4X7DC 3QRBA 3BC9A 3NESA 2VXVL 5I1AB 2XBO1 2WWKT 1KNOB 2DWDB 3AKRA 4U1MB 2RJKA 3I75B 4MKMA 3I9AA 5F93C 1KXTB 1H15A 5F6IB 1OOPC 3UIYA 1Q5OA 3B9CA 4WM7A 2FHBA 2CJUH 3APNA 5C7ZA 1KOAA 2ORXA 2JDNA 5ABJB 1NC2B 1R17A 1COBA 2F6AA 4OIAA 2A6YA 4XFIA 1Z3RA 2F53A 5C0AA 4XC9A 4GSRA 1JPEA 3OC5A 3OWRA 2JJUA 4NRZB 3VBFA 2X89A 4XBGA 5E88A 1AXSA 4J28A 4HIPA 4Z0XA 4BWUA 5DEGB 3SPJA 4GRLD 2HKFL 3VFTA 3OKOB 2ZX4A 4IEUA 4UI9L 3T2LA 1FL5B 1B4JH 2IOOA 3UTSB 2BC4A 2QADC 2XHNA 4EQ2A 1X5AA 2APBA 3PNRB 5DWPA 3UDWC 2JJWA 4FQXD 4OGZA 4E2OA 5ID0B 2VECA 2JI1A 4IEWA 1DANT 3JTTA 2DCTA 4QPIC 4PGZA 3K71A 3RUGE 4DUXA 3RNQA 1FPTL 2DU1A 3CZUA 4JQIA 3S3PA 1ULCA 2XV6B 2G75B 3GS7A 4ELMA 5A33B 2DMBA 1P4IH 5CMAA 2FWUA 2YR3A 3NIDE 4WAFA 4RVBA 4AM0B 1QW9A 3K0WA 1OHFA 3I3DA 5E9DA 3SITA 1N5AA 1OLZA 2VMGA 3P11L 3ARGA 2YN5A 3S98A 5GZCA 2GNBA 4M3JA 1A7QH 3VNYA 1RJ8A 2W1NA 3EUUA 5CGBA 4ETQA 5JXHA 4AE1A 1O3RA 3JV0A 4H8QA 4P2RE 1XGYL 4YHOH 5C09B 1QU0A 5T3XH 3J7LA 2EXJA 3LDBB 4FXGA 1JNHB 3KHQA 3RBGA 2ZXAA 4EDWH 4ZOCA 5AW1B 1RFDL 5T5OA 5D93B 2FBJH 1RZFL 1UACL 2LLNA 2X70A 3S5ZA 2YC2A 4RMVA 5K4LA 5JLZB 4PRAA 3U1SH 1NGWA 3PQYD 3QXDB 3EYOA 3REVA 1LEIB 5F5AA 2J1VA 1UEMA 2A7BA 2R2HA 2OJZL 4NKDB 43CAA 4NHYA 2FWOB 1BAFL 3TH3T 3EOBA 1A7PH 5I1CL 5I8KH 1Q8SA 1POQA 2ERJC 1T5WB 3HNYM 1QNWA 5CCHE 1CU4H 4MTMA 2X4UA 1EQWA 2K9FB 4N8CH 3UC0H 3DBXA 5DJXB 2EDBA 4XUTA 3VN4A 4UZSA 4LOEA 2OZ6A 2E7BA 5DZOA 5IW0A 3KL3A 2LROA 3BWUC 1GPOL 5BO1L 4F2FA 2CO6A 3MPPG 3SDYL 2IOIA 3WQBA 4NQDE 2WLHA 3E0GA 2KZWA 3QUYA 1VAKA 1W90A 2XNAA 4JC1A 4WV1C 1PL3A 5EORH 5EPMB 4HHWA 5A3TA 1U93B 2O61B 4QOKA 4PTTA 5BV7C 2J1RA 4Y20B 3HE7B 4CCLA 2ITEA 3EYVA 1SEBA 3VZOA 5K9QG 1EGJA 4Q4IA 4JANA 3C8KA 4H1LG 5D7JC 1O4ZA 1KJRA 2R1BA 4QKXB 3MLYH 2IBBA 4UTBL 2R042 5SV4A 2BS8A 1MHEA 2EE9A 2EIZB 1LEDA 2XGXA 4Y5TA 1Q8QA 4ZMLA 1HB1A 4A6YH 5FDYA 3ZJAA 3TN92 4R90L 2CGPA 1DE4B 5JW3H 3ALXA 4KVNH 3EH4B 2Z31D 4QXKA 1HEZB 4H88H 3OMAB 1BFVH 3TLRA 1NCBH 3OL2A 4DP6X 1AUYA 5DYOB 3LNEA 1XMWA 4MD4B 5EUOE 1FL3B 4Y9FA 3V8CA 1I7UB 3T6QC 2Y6FA 2GHZA 2Q76A 4L1TA 3MDJA 4YNIA 3L3GB 2GUOA 1HSAB 3WN5A 2DEWX 4JDVB 3V65A 1DTUA 1JCKA 2BOCB 1MXDA 4ODBD 2R1WB 3PUAA 4XMKH 3F04A 3G7DA 5AUMA 1N7MH 2YPLB 1X4ZA 4QYOB 3L4TA 1XSRA 1F45A 2NNXA 5C9JB 5FQ0B 1QNZL 2WKLA 3IDGB 3ARBB 1V27A 4MS8C 3GI9L 5DR5L 2JG9C 5FZ6A 1ZLSH 1FL6A 3DETD 5IK4A 2WN3A 3CSYB 4OFIA 3T0EE 2YPVL 5GS0H 5HXMA 5I1AA 2ETWA 3S7GA 5BRPA 5BNPC 1AZCA 3LS4H 1C7TA 2YUWA 3H9SD 3LH2H 3NCYP 2VW2A 3OY8A 5FYHA 3I75A 4LR4A 1KXTA 1SBSL 3P69A 4FI6A 4E9VA 4JJHA 1EDQA 4QXGH 3HAEB 5E0QA 4EN3C 1D5BB 4BQYA 3D2TA 3O0RH 5ABJA 2DMCA 1NAMB 2D03H 4XMPH 3FONA 4XB7A 5TE7H 4EN2A 2DI8A 3FRPB 3UKTA 1H4HA 1E4KA 3CZSA 3I02B 2IC1A 2ZEZA 3BRDA 1CXKA 1AGDB 1GBGA 4LRIA 1XNBA 4E5XG 3DGCR 5HGAA 5TGBA 4FNSA 4TSCH 1LD9B 1EZVY 1K4DA 3KLSA 4XCNB 4FI7A 2HKHH 4WKZA 4JO4H 3CVHB 3MBXL 3P77B 5CZRA 5DEGA 5C5TA 5IT2H 1HINL 2V4LA 2IGLA 4Y4KB 1VE0A 3NSYA 4NLHA 1ZSDB 2CKBB 5DJ0B 1PGL2 2VLLA 1MW2A 1FLRH 3EUDA 5FUOL 1HRV3 4KNQA 1UZZA 2AJUL 1BXVA 3KPLA 4WSJA 2KQNA 3NA4A 1NAEA 4DIQA 2CHDA 3B43A 2AR6A 2G75A 1D6EB 3K1DA 2ZAHA 5E2TH 2VAUA 3N41F 4LCVA 4BKLB 5G5DB 1GSLA 4P05A 2NRDA 4AM0A 4N2HA 3F7LA 4LNVA 3FQUB 3ZL2A 5MEND 4BQ6A 5JVVA 4OGYH 1CXEA 5E0FA 4P57A 1YPZE 3DBSA 1EDHA 4DJMA 2OK0L 1WUNT 5EZIH 4LCWD 2AAVA 2CJUL 1UMZA 4NIHA 5E9NA 5E8EB 3HI5H 1NUNB 1FATA 1BHGA 5EC2B 5JW4M 3HVNA 3DNKA 5D7KE 3F64A 3W3BA 2AXFB 4BQ5A 1KJ2H 2BSRB 2YAMA 3LDBA 2AHIA 1J1XH 1O8SA 3KPRE 4UINH 3STZA 4B9YA 1VAMA 2FLBT 1CLZH 2XRAH 3LEGA 3VFUB 4OJCA 3IAGC 3HT1A 2W52A 1X9RA 2JJSC 2NZ9A 2EIDA 3RTQC 2K4WA 3V0VA 1HXYB 2HFTA 1QSFD 4WEEA 3K80A 3SE3A 4MG2A 1B4JL 4ANKA 1A0QH 4PB9L 3S4SA 5JLZA 5JOPE 2F6BA 3CH1B 3FYIB 3TBVB 1BMV1 2P5EE 1REDA 2FWOA 4UBHA 4E41D 1KBPA 1UM5L 1WLCA 1VZIA 2VWEE 3S96B 3AT0A 4JY5H 1RIUH 1T5WA 1XGRA 2GJZA 2P47B 4R26H 1QH7A 3SYQA 4V1PA 1O4YA 5FZDA 1EZVX 1RUH2 1P4IL 4EZHA 1UFUA 3HE6C 1E0OB 1FHNA 3KT7A 2JDUA 1YC8A 3KF5A 3B3QE 4IK6A 5BNQA 3MUGB 4H0HB 2YXFA 4L8DB 4GRWF 2K4AA 3HB3C 5FREA 2BBVA 4C1WA 4JZOB 5D5MA 4HIJA 4C4KO 4DFSA 5LAPA 1U93A 2WSPA 3UTTE 2BVQA 2HTLC 3HE7A 3ZE2E 4EI0A 5T3XL 1WZXA 4YMPA 2PO6B 4NN7C 3TN0B 2CDPA 4KNUA 4CYDA 2EDQA 2LM3A 3MYXA 3VGBA 2FBJL 4YZ5A 5C8JB 4CCDA 4P46C 3Q0HA 1SBDA 3I59B 5DDJ1 2ZYIA 3GBWA 2VXUH 1C7SA 1KCLA 1OZUA 1T2JA 3OX8A 2AACA 1WMXA 5GXBB 2DWRA 3QQNA 2YFUA 2P37A 2IDTA 2R83A 1HEZA 3RGVA 5D7JD 1A7PL 5K1VA 1IU1A 4QKNA 5BZXA 4B5EA 2V4VA 2VQAA 5DYOA 1DCEA 1T83C 1FL3A 3J2PA 3N9GH 3QZNA 3CXHJ 4N8CL 4ASLA 1ZZ7A 5ACA3 5IV2B 2M26A 4AQ1A 2VIRB 3L3GA 3VA2C 1FRGL 4JDVA 3K8MA 2VC2H 2Y23A 4N3TA 1UL9A 2BOCA 5HI5C 4FULA 5C08E 1VFBB 2TRYA 4ICXA 2P34A 2R1WA 2CHZA 5TFSL 1IPKA 2GHWB 2YPLA 4QYOA 1HZHH 5EORL 4Q9QH 5L9BA 3PCYA 4ZXBC 5FQ0A 3IDGA 3STLA 3X1EA 1CTMA 1DL7L 3ARBA 3KH4A 1DZTA 1XNDA 4HMZA 2CA3A 5T3NA 1TTGA 3A22A 1G7IB 5I1KL 1WCBB 3LEIA 4J1XA 4TZDA 5KHKA 1NL0L 3TYGH 5GZOA 2EZ0C 1BLNA 4MB4A 2OZ4A 5L2KB 1JV5A 5IWFA 3VBSB 2VMCA 4BRVA 2HWC2 3UBXA 4AEKA 4CP1A 2EO1A 2WLIA 3MLYL 3TWIA 5LRSA 4OM0H 4QNPF 1SDDA 3HFML 3QFJD 4MS8D 1AQHA 1HZLA 3NCEB 1QFOA 3MIEA 2IIJA 1NCRB 3ARRA 4ELMF 3L3KB 2PTUA 3FRPA 3IJHB 5DQ9B 3I02A 4H88L 1XE7A 1BFVL 5C3PA 5JA9A 2J1YA 3TVMC 5J37A 1FF5A 2A6IB 2EEDA 3VVWA 3KBPA 4XCNA 4BWWA 2V8LA 4XQDA 3CVHA 5TQ2H 2BNOA 1CFVH 5EB9A 5IHUH 3ASIA 1QA9A 1QRKA 1CIDA 4Y4KA 2D5FA 3JXSA 3U30C 4AYMC 1ZSDA 1JGEA 3VFPB 4L3EE 2Q7AA 2APVA 5L4MA 2YGNA 4XMKL 2B7YA 3MZGB 1ZLUK 1NEUA 4JFTA 3VGFA 1XF1A 5CM1A 2B1HH 5FLIA 1UT1A 5A6MA 4UCFA 4M56A 1OGAD 4AEMA 1AR81 5DHXB 1D6EA 1OFNA 2CTVA 4BDVA 2Y7LA 1JHLL 4XBEH 3ZZSA 4MYEA 3CFIC 4LDLB 1N8ZB 2X38A 5G5DA 5GS0L 4QM8A 1CS6A 4D7TA 2XWTB 3O45B 4M3CE 3GSOB 1GLHA 2HJKA 5F89B 1NEZB 4AUYA 4F7TA 5ADOL 5EF3A 2QTVA 4YNYB 4B3VA 3O0RL 3DPRC 4XMPL 4M1CC 5EC2A 3SQRA 1I31A 4FCAA 5TE7L 2Z7ZA 4FKEA 2A73B 2AXFA 3EO1A 4MXQC 5DHYB 5FIEA 3RILA 4X9BA 2PTTA 4TSCL 2XXMB 3VFUA 4JO4L 4MO3M 4PEEA 1HXYA 4HPOL 5IT2L 3VXNA 2F54A 3DDFA 2UX7A 3IN2A 2ZUTA 1S0GA 1QG3A 5FYVA 3V5DA 1W8WA 1FLRL 2CJSA 1RPQA 3C5XA 4RAUB 3S96A 2Q1ZB 1ZOXA 4Q4W3 5DHVB 2H6UA 2WD0A 2OW6A 1TVBB 4W6YB 1K12A 1MRDH 4JVUA 3RTQD 5E2TL 5HGDA 4QNPE 2JEMA 4XNXL 4DT2A 4WIQA 2YQ3A 2K46A 3E9UA 4IBLT 4LVNC 3DHUA 4EI5D 3ELNA 3S5QA 3RZKA 1LTEA 2JD9A 3MUGA 3S6PA 3NCBB 5L88L 4FP3A 2VVFA 2YGPA 1GKEA 3QP3A 5EZIL 5I8CB 1W2OA 2CV6A 4MA7L 5HV4A 5IHBA 3HI5L 1A5FH 2K6YA 2NLJA 2NT1A 5IQNA 2QSCL 5KSUB 2E47A 2X2IA 2O26U 4AQ8C 1CUOA 3ASWA 3HE6D 2PO6A 2Z35A 4I18C 2V9QA 3ZFGC 3TN0A 1J1XL 3QQXA 1HOCA 1LQSR 2I9LB 2R061 4ZNEE 5K33A 2CLZB 2XRAL 5E8OB 3CVIH 1YFUA 5JZGB 3HB3D 4MQTB 2IXCA 4JG1H 4FAAB 1NA1B 3SDDC 1USQA 3U7YH 3I59A 4WVVA 4QRRD 4D69A 2Y1ZA 1A0QL 4R5VA 3M07A 1AE6L 1P8JA 5DJAB 1EO5A 3KE0A 5T1MB 4WTWA 4FT8A 1T0PB 4NRQA 2BZDA 5LGKA 4AKPA 1NBQA 4JY5L 1RIUL 2AEPH 4XVSL 1J83A 2BY2A 4JM2B 4Z3EA 5KHJA 1PD0A 2DCYA 1HS6A 5L7OC 3PP3H 2YOCA 1RMFL 4P46D 5IV2A 2VIRA 2YD0A 4LBEB 1QYGH 3FFQA 4IEZA 4Z7QE 4MFHA 3MZTA 1XSKA 1SG3A 3HMYA 3CFNA 2FX8H 3S3DB 2XZQL 1KITA 1VFBA 1CGSH 5CU9A 4LE3A 3ZKMC 1JPSL 2IPKB 3VXTA 3SPIA 4WZFA 4NNPH 1NCIA 1LEMA 4J12A 4KJQC 5TD4A 1NIFA 5CR1A 1U4FA 4NWVA 1ZREA 1G7IA 3DX9B 4QPYA 1WCBA 3CFQA 4HJUA 1SHXA 4NLAA 3X12B 4QRAA 5L2KA 1XEDA 1WWCA 4UAOB 1JOPA 3D0VB 4EI6A 2VM4A 4AGPA 1J1TA 2DTYA 4P0DA 2XN9B 4EUPA 1RZGA 3B9EA 1PVC1 2B46X 5T3ZD 4Y1SA 4ZXBD 1DO5A 2YJQA 4EIZC 1HXKA 5AW8B 3PVBB 3IKWA 5AG9A 4MNQE 5CGMA 3SDCA 1R093 1JFHA 2IXJA 2VZOA 3WF4A 1NCRA 3MRKB 3L3KA 4BH8A 3IJHA 5DQ9A 3W82A 2XWDA 1MZ6A 1N3PA 5CS7A 3MEPA 2EZ0D 5AC93 4X8XA 3OKDB 1ZA7A 2A6IA 2D97A 1ERNA 3N9GL 3POFA 2JTYA 4PVNA 3UAJA 3D6EA 1W72B 2QKDA 3TF7C 3MLZL 4X9GA 4AEFA 2FECL 1FMD2 1CGUA 1MNUH 2KI6A 4BUGA 4ONUA 4RHV2 3HHRB 3ULUD 3QEQB 4LQ1A 3JTSA 1WAAE 4MJ5A 4CADB 3FF7A 4Z77B 3TVMD 1HZHL 2IPTH 4JGZC 4YGDA 4DB5A 5HI3C 2LU5A 2RVAA 4L2LA 1GTFA 3WFBH 1KG0B 3O8XA 5DJCB 5DI8B 1OL0A 4NKOB 2ZEYA 3IIAA 5EOCH 4MJ6A 3N1QC 5KANG 2DM4A 1DYZA 3BPCA 3TYGL 1LO5B 3WJJA 2F0CA 2D7MA 3PWPB 3ZYOA 3HT2A 1OAKH 3S7EA 3S3BB 1GGBH 1KN4H 3SGJA 3BUIA 2EVFA 3GSOA 3I3QA 3HG0A 5DT1H 4DP5X 5IMLB 1N6QH 5AOJA 2ZGSA 4N53B 1OP9A 3EF7A 3HN1A 3J8F2 2P24B 5EO1A 1VFAB 3MF6A 3J26N 2ZHLA 2A73A 4LORA 4HJSA 3MUJA 5IBUB 4HGKC 1V8HA 1E7VA 1DN2A 5A1LA 2GTZB 1UXMA 4RLDA 2LR4A 5AOKA 5TF1H 2WABA 2H45A 4IBUA 3OB0K 5TQ2L 4HLZH 1VENA 4Z3TA 5IHUL 4AZ8B 4WFHE 5D5MF 2VR3A 3K74B 1OV8A 5EOCJ 4M1CD 3RI5K 3IAPA 4HW6A 4DOHB 3HS0B 4MXQD 4IV1C 8CGTA 4Q56A 2D0FA 4P9IA 4RAUA 2WZR3 5FYZA 3UJQA 4FP8H 4I48B 1NLDH 5DHVA 3OB8A 2RS51 4QXHA 2GFBB 3UTSE 3ETPA 1CB4A 4RR3B 1AYRA 3ECUA 3DX2A 1OZTG 3FN9A 4M43H 3UJIH 3CH8A 4QRSB 1IAMA 2KLRA 4XNQA 1PM4A 5D1QA 3LPWA 1ULOA 5LRRA 5AOLA 2QDRA 1UW8A 4H55A 2RDQA 3FQYA 5GZGA 1AD0B 4DHLA 1UM6L 5DDHB 3HR6A 1A6PA 2ZGLA 5K9JH 1V05A 3L5WB 5I8OL 2PQQA 4BQXA 4FNLH 4QT6A 1HQWA 4JHAL 2YXMA 4PJEB 3KXFE 3UBHA 2G19A 5KSUA 1NCQB 1CFNB 43C9B 3PIQA 3L2NA 4L1SA 4D94A 1G9MH 4M01A 3SE4A 2E9QA 3W57A 3OVUB 2JJTC 3T09A 3NH7L 3AP7A 2I9LA 3WG1A 5DGRA 1YNKL 5ES4B 2GB2A 3O6FB 4ONOA 2C24A 3ZSMA 5JZGA 4Y0GA 1EMTL 4N0UB 1IKFL 1E6OL 5C09E 1NA1A 3ULUL 3FZ3A 5IHWA 5AKVA 3MJ7A 5DUBB 3FPXA 3SB3A 5EF2A 4PJ8B 2PAKA 4Z7UB 2P5WB 3GBFA 4PRHB 3WTYA 5JUVA 4G7YH 4XP1H 2HG5B 4PW9A 4UTCA 4GJTB 5LBGA 5DABA 1FIEA 5I1JL 4FYSA 4JM2A 5KN5B 1ZRIA 2E8ZA 2KDYA 2Q8BL 3SDDD 3NSJA 4CU8A 1RUF3 2WYSA 2J8OA 2OMZB 2W39A 1Q94B 4PF5A 2BPBA 2RB8A 2AKRB 3RQ3A 5DG1A 5J6HA 1H9DA 4XCYB 2DDQH 1B35B 3UO1H 4NO5B 4AVJA 1UWYA 1URXA 4JMNA 3N40F 1ZWIB 4P9HH 5BRZD 2ZT9C 2NY1D 5GS1B 2VULA 2NOYA 4LP5A 2MEV2 2ADJB 4PYGA 1O8PA 5HJBA 3GUTB 5J98B 1CGTA 4BUQA 1LU1A 3UKNA 5LN4A 1CD8A