1CGPA

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*A
publication title Crystal structure of a CAP-DNA complex: the DNA is bent by 90 degrees.
pubmed rcsb
molecule tags Transcription/dna
total genus 59
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cgpA01
4RB0A 2UY8A 3S7EA 3ZP5A 2GC2A 1PMIA 4U7DA 4HLYA 4E2GA 3UKVA 4YFXF 2HFHA 1WKMA 1E17A 3MFKA 4LK0F 1YIOA 3RZZA 4IJAA 1D3YA 5CLSA 3IDCB 1LQ1A 3GWZA 3V4GA 2JSCA 5DYMA 2ESHA 1R23A 5JAXA 4UBGA 2L01A 4PIYA 3V8KA 2MC3A 5HLHA 4HDUA 4MGIE 2HWVA 2PHLA 2OD5A 5KHJA 3R0AA 1JE8A 3EDPA 3DPTA 2GXBA 2VOOA 4JV4A 4KYWA 5E8GA 5ICFA 3OGJA 2L54A 3CEWA 2UXXA 4Q29A 1IN7A 1FC3A 2DW4A 4EJVA 3KZYA 2IXLA 2PN6A 1U12A 4LK1F 2KIMA 1MDMA 2PG4A 3C7JA 1YFYA 1KQ9A 4LEJA 1YS6A 3R0JA 2XAGA 4HF0A 5FLHA 3KFWX 2Z99A 3I59B 2Z9OA 2H0VA 2P5KA 4G94A 3HTSB 4I01A 1W7PD 4P96A 2NNNA 2GAUA 5LRSA 2M30A 1DZRA 2GH2A 2P4WA 2QLZA 2BEOA 2ET1A 2ZBKA 2LF8A 3GF2A 1J5YA 4KN7X 1NYWA 2A69F 3SCGA 1ZRDA 3PLQA 1K79A 5HDKA 3F8BA 1K78A 3OF1A 4EMSA 1TQPA 4O9GA 1MGTA 4KNYA 3DV8A 4RD7A 4HQEA 1P4XA 5LLQA 1J7KA 1ODDA 3F72A 3GZ5A 2UYBA 3JTHA 3N97A 1T39A 3RJPA 4ENKA 1Z9CA 1CF7B 5E1WA 5L3GA 4LUMA 4R1HA 1KA8A 3CTAA 2NRAC 4X6RB 4AVAA 3HOSA 5FQ0B 2Y0OA 1O5LA 2P5LC 2Q1ZB 2F5DA 3CO7C 3V8JA 4OMYA 3DQVC 2HOEA 4YFKF 4IRIA 3USSA 1SMYF 3R60A 1HKTA 1J3RA 3D0JA 1RL3A 1D8KA 4MGKE 3CUOA 2QQAA 3W6KB 2XL7A 1USSA 2XROA 2XL9A 3K0LA 4BAYA 2GC1A 4CYDA 3NW4A 4G6DA 2CWEA 5E17F 1W5TA 2O8QA 1G3WA 2BV6A 3SQNA 2ZKZA 2EFQA 3F6VA 4YIIA 4EV0A 1AWCA 1YYVA 3FMRA 3F23A 4GULA 5JFRA 3CUQA 4RGSA 5CU1A 2D5HA 2HTJA 1OPCA 5F64A 2XRNA 4XETA 1P92A 1LEAA 3E6CC 2KJCA 4D7SA 4L9NA 3IKTA 4KIGA 1IN6A 1RUOA 4UV9A 4XLNF 3WW4A 3GVAA 1ON1A 1HW5A 2GWRA 2E7XA 4WX9A 3B73A 5K8SA 2LF7A 1DZTA 4XEZA 2VXZA 3J7AO 4MTEA 3E5UA 3WTUC 4O6JA 3CLOA 1H1MA 3H92A 3PQJA 2PA7A 4A5MA 5AIPA 4L18B 2V1DA 3MPBA 5BUVA 5DCFA 3SXWA 2PQQA 2E1CA 2PQ8A 2RNJA 1P6RA 2Y0MA 3FHIB 3Q5FA 1IRGA 3GFIA 3PVBB 3HSRA 2FSWA 4KMUX 4M9XA 2FBHA 2VE9A 2MLKA 1MDMB 3Q9VA 1IPKA 3WGHA 2FXAA 1B1BA 2HEOA 2ZKLA 3OD0A 4PJYA 4JBAA 2FNPA 1F4KA 2G7HA 1OD5A 3FF5A 1RNLA 1I6XA 4WF2A 4KICA 2D2WA 4HN0A 2DCTA 2PYTA 1U5TC 4LLOA 4TV7A 1XCBA 4HVQA 2QVSB 2LNBA 3HRUA 4Z2YA 3WTZA 4YRDA 2KJBA 2K27A 4XBFA 1Q1HA 5E1ZB 1YUDA 1QXRA 4XFBA 2CO5A 1XD7A 1R22A 4QMAA 3T8RA 4D0PA 4AQ2A 1UD1A 1HXDA 5EFUA 3GUDA 4IEZA 1I5ZA 5BMZA 3FXQA 1CAUA 3MDPA 2RC4A 3H1MA 3GYHX 3F3XA 4G8XA 2CFXA 1RUNA 3BALA 4NB5A 3DKWA 2M45A 3RYPA 1EH6A 3T1BA 2A6HF 4A0XA 1XDUA 3WW3A 1W5SA 1VR3A 2QVOA 2M5WA 3WODF 1DDNA 1J9IA 5DUIA 4HX4A 5E20A 2HKOA 4RAYA 4B29A 3KGLA 1X82A 4HDVA 4R8HA 1XSVA 1RC6A 4Q47A 1MJ9A 1T0FA 4PGGA 3S2WA 2BNMA 4KIFA 1QBJA 1DGRA 1R1TA 2PI0A 3WTXC 2D45A 2DBBA 1G3YA 1ZLKA 4WK8F 1T2KA 3H9AA 3E3VA 1YG2A 4UUVA 4I0AA 2C0ZA 3GYDA 2XKOA 3ERED 3KE2A 2DO7A 4LB6B 3ZMTA 3KP4A 1OKRA 2PFBA 1EPZA 3RI4A 4HBNA 4J1XA 2VBZA 3U10A 3E6DA 1HBXG 4ZZLA 4MGYE 1ZN2A 1FY7A 1FBQA 2YSRA 3JSPA 3ETQA 1ZG3A 2ATFA 3S0MA 1U6GA 4MZUA 3IC7A 1F1ZA 2N7GA 2PLYA 3HTUA 3JAMZ 3SMHA 1IN8A 4ESJA 4ASNA 3ELKA 2ZCWA 4CZZA 4RB2C 2EA2A 2G7UA 1UCRA 4EJUA 4L5JA 1JXSA 3R61A 1WI9A 4L0YB 2MHFA 1FYLA 3B02A 4XSZF 4DNCA 3KEOA 1RI7A 4MNUA 1SFUA 4CXFA 5A2QZ 2XAQA 4CGZA 2A6EF 1QZZA 3KEQA 4A12A 2UYAA 3LQRA 2IJLA 2E7WA 1XDSA 2XAJA 1Y9QA 2PMUA 4AD9A 1X7NA 1IXSB 4D7TA 2DFIA 2WV0A 3ROUA 4EGYA 3MZYA 5I8SA 4HLTA 5C6CA 4BNCA 3DP7A 1ZZ8A 4HV6A 1FT9A 4EGZA 1MJAA 5D5UB 4O3MA 4WBBA 2HQRA 4LB5A 1ZNPA 1BI2A 1XSDA 2FOKA 1XGMA 4IVNA 1ZZ6A 1B59A 4Z82A 2EFNA 2IA0A 3KETA 5AVPA 2WWYA 4YSFA 1W4MA 4GO1A 2RV8A 2MH9A 3L00A 3COAC 2HR3A 4A0YA 3IDBB 2OPKA 3FM5A 2VONA 3I4PA 1J1LA 2AS5F 3CO6C 1CAUB 1XMAA 3I54A 4K2EA 1CAXA 4LTAA 4MEYF 5FQ0A 2Z2SB 5BQTA 5JR3A 1TQ5A 3HHGA 2BYVE 4XFGA 2Y75A 3KGZA 1V70A 3ABTA 5I0TA 2RKHA 2EA4A 4BYYA 3GZ6A 4AVBA 3WE2A 4HX8A 3UKTA 2FF4A 3FJSA 1XN7A 4I3PA 3TO9A 2MA3A 4LA2A 4Q0UA 3H7JA 1KQ8A 1WWXA 4NQWA 3VOEA 2FMLA 1YFWA 1ONVA 1O4TA 2AXLA 2K86A 3LSTA 2EV0A 2IT0A 1HKSA 2H27A 5I0UA 5KHIA 4MH0E 3L7WA 2IA2A 1TQMA 4HF1A 5DV5A 3TO7A 2KIFA 4RS8A 1U5TB 1WQ2A 4B8XA 3EHKA 4EVIA 1TW2A 4KDPA 1XGNA 5J48A 5CVVA 4OINF 2XUBA 2QBYA 2NAZA 1GXQA 1IXCA 5HOOA 5IT9Z 1Q43A 4EWDA 3RKYA 2A61A 3PQKA 1DPRA 3ZMZA 5F1RA 1QQIA 1LRHA 2O6GE 5FPZA 3O2PE 3JW4A 1NE4A 2IXJA 3WTVC 5FD5A 4ZH4F 2VBYA 4Q0PA 4FX4A 1B9MA 1R00A 4RGXA 5HDNA 2GC0A 5DEQA 1S6LA 2OA2A 4UVCA 2ETEA 2XLAA 2X4HA 3F8MA 3AAFA 5J8CA 3E6BA 4RGUA 1IF1A 4YYOA 2R3SA 5D4SA 3W6JB 4BH9A 2CQKA 3O6BB 1Z1DA 2CGPA 1SQ4A 3ZMSA 2W85A 1R1VA 4G7HF 4M73A 1MJBA 5EZWA 1S3JA 4MV2A 4IETA 1IAWA 2B0LA 2Q8KA 2CAUA 1UHWA 3JAMK 1YQAA 4HLXA 1B6AA 4IEVA 1MD0A 3NRVA 3F22A 2Q2EA 1S7AA 1GQHA 3SFZA 4RB1A 1PDNC 4BIFA 4HA8A 3SZPA 2P7VB 3U2RA 4QGLA 3K9TA 1FYKA 1QNTA 4ESFA 2V79A 3WTSC 1J3PA 5ERIA 4LD5A 5A2QK 1R36A 4G7OF 3H3ZA 3CDHA 1VJ2A 5J8FA 3DN7A 3KP2A 1IW7F 4A6DA 2BGCA 4LLLA 1L0OC 2CAVA 5E18F 1SD5A 1SMTA 4MQVA 4L5IA 2FEZA 3BU7A 1A04A 4F8AA 1KYWA 2F5FA 2JPBA 1U78A 2M8EA 5FFZA 4CICA 5JHUA 1FSHA 3MQ0A 5D8LB 1ZAOA 1YLLA 2IW5A 2FBKA 2B5HA 1CAXB 4I02A 2CG4A 4XRFA 1R5HA 4S04A 1OYYA 3TNPB 4HV5A 4XF3A 4ENMA 2VBXA 1FSEA 3FZ3A 3NKTA 4BHBA 4KMFA 3HRSA 1OYWA 1G6NA 1UFMA 2P7CB 3K2ZA 1ZHFA 3FHZA 4WXHA 3N4MA 2I45A 2D1HA 4UVAA 4NHJA 4HN1A 4EM2A 2XAHA 3GO5A 3ZN0A 2D40A 2DT5A 4OFGA 1L3LA 2XAFA 2KRFA 1ULYA 2F5CA 3EYYA 3QPHA 3OCPA 4BQAA 4EROA 2NYXA 1ZRCA 2Z69A 5CVIA 3KCCA 5I0SA 4I7HA 1ZX5A 1G3TA 2PAKA 2Z5UA 2BE5F 4EJOA 1NE6A 4OIPF 2QBYB 3MWMA 5CADA 3QPTA 3T8TA 4HX7A 4YG2F 3K69A 4LMYA 1SEFA 5D6EA 4N9HA 3QU6A 5ICEA 2JPCA 1YHFA 1UIKA 2M87A 4HF2A 4HVOA 3M9AA 1ZLJA 5CYVA 5L3BA 2VECA 1BOAA 5K5QA 1SFXA 5KVRA 4P9GA 3BZ6A 2OZ6A 3L09A 5FLIA 4IEYA 3P9KA 5CVRA 2HYGD 1Z05A 1YTYA 1ZREA 3CLPA 4QXKA 1WLTA 4CO8A 2V6CA 2ZMEA 2ISZA 1S29A 1BIBA 4WXCA 1KU7A 1FOKA 5IT9K 3CO2A 1YW8A 4R79A 3BPZA 3NQOA 3QP6A 4IERA 1UW8A 2VN2A 3TOAA 3HOTA 4AVPA 2QZ8A 4GXOA 2V1UA 3M70A 3ST7A 1H9GA 1QWRA 4QM8A 2OBPA 2FQ3A 4E70A 1FP1D 1CAVB 1DUXC 3OTFA 1I27A 1YS7A 2ESNA 1VP6A 4N0BA 3J80Z 3BB6A 2GU9A 1BIAA 1J2XA 4L2NA 3K1PA 2VE8A 2ET7A 5I8TA 1REPC 2W24A 2EFPA 3OV8A 4JTNA 2PFWA 5BXXA 1X8MA 1PP7U 1IPJA 2E9QA 2PJPA 4M71A 4ZU5A 3FWEA 2L02A 3HSEA 4LFUA 2R7FA 3JTGA 1DPUA 2JTVA 3RKWA 3QACA 4LUKA 2HKXA 3SHFA 5H6QA 3U0ZA 4AWXB 1BN5A 5ILUA 2VT2A 5LGNA 1ZARA 4OIRF 3I53A 1LDKB 2YU3A 5I93A 4KL1A 1IUYA 4ETSA 2FU4A 5JCTA 2F5EA 2GC3A 4WZCA 3BPVA 1C0WA 2PEXA 2EFWA 3ABUA 1LR5A 4JVAA 3TQNA 1YFXA 5J7MA 2XASA 1BC8C 5TJJA 3RNSA 1F5TA 1XSXA 1HQCA 2DPUA 2IXCA 4KWKA 1KGSA 1GVJA 1O7LA 3IWZA 1U2WA 2PHDA 3E5XA 1ZRRA 4HMZA 4EM0B 3MZHA 4LGWA 1X3UA 4I0BA 3LAGA 5J3UA 1QO0D 3BP8A 3ZMVA 5E16A 3GFJA 1U5TA 3M1EA 2FRHA 5LGUA 5BY5A 3MAJA 1BI0A 3KSCA 2DK5A 2VT3A 4S05A 3FM3A 4I98B 5FFXA 1EY2A 3V7RA 4BHCA 2CYYA 1Z6RA 3DFGA 4NVPA 5HVQC 5DD8A 3I64A 4H0EA 4IEPA 5ILVA 5FO5A 3LA3A 3WU0A 3E5QA 1JHHA 4BXUA 1YFUA 1BM9A 2XVCA 3IRRA 2HZTA 3H50A 1R7JA 2QQBA 2DK8A 1RGSA 3IIAA 4FBFA 2W25A 4L0ZB 1XE7A 3R4KA 1Z7UA 1EH7A 4PGHA 2DQLA 4ENJA 3CJNA 4U0YA 4HVRA 5LHIA 4XFHA 2XIGA 5FLXZ 2BNOA 1ZG5A 1G4DA 4KU8A 1FX7A 3LA2A 4HBLA 1UB9A 3BJ6A 4Z07A 3ES1A 3TDUC 5H20A 2OZJA 5L3FA 1O57A 2ZMEB 4HYEA 2ZFWA 4O5VA 4IEWA 3E6MA 3T5XA 2PTMA 2DU9A 2BBYA 3FMSA 3ULQB 1SD4A 4QX5A 3P9IA 3MYXA 5D5XB 2DI3A 1CGPA 4ESBA 2E1NA 3KP5A 2LDUA 4QLCU 1W7PB 2UWMA 2H6BA 1XGOA 2Q0OA 3EETA 2OQRA 1FWZA 3ACLA 1P2FA 3I0TA 1P4WA 3GLXA 3M3IA 3FX3A 1YW9A 4FAHA 2ZNZA 2QM3A 2IXHA 4WWCA 3JZVA 5T3NA 3LFKA 1EH8A 1H9TA 3H7YA 3F6OA 4P9UA 5I8YA 3U9GA 4RB3C 2DAOA 1ZZ7A 4MQ9F 4KIBA 2IXIA 3IRQA 3TGNA 1RZ4A 1H0MA 3SZTA 5FPXA 2P6TA 2FMYA 4M6XA 5DDGA 2LKPA 4LLNA 3VFZA 4AVCA 2K4JA 4XSXF 2OA4A 2HS5A 3NEUA 3LWFA 4AIKA 3GXOA 5FD6A 4JQFA 1JGSA 4EWEA 4Q5SF 2MPFA 5DUKA 5L3EA 3RDIA 3TDZC 3BROA 1S7OA 4P5OA 3J80K 1FBSA 1TNTA 1O3SA 5BPDA 5FCCA 3L9FA 4CDGA 3NJZA 1D5VA 1BJAA 2GA2A 4KWJA 2J5PA 1Z6TA 4EJWA 4AIHA 4KU7A 3LQQA 1X8EA 3WTWC 1FNNA 2PAEA 3GFLA 5CVJA 3WU1B 3LZZA 3KMHA 1FP2A 5H6RA 3O14A 3NSTA 4XF4A 2DQRA 2FA5A 3VODA 3HSFA 4PIXA 1ZZBA 2EV6A 1ZZCA 2MLGA 5LHHA 5JSRA 2EJRA 4GGGA 2PMHA 5D4RA 3DF8A 2EK5A 1UPIA 4L9VA 3VB2A 3JSOA 2EWNA 1XE8A 1YLFA 4ON0A 2KIUA 1LDJA 2WTEA 2MH2A 2XHKA 2A68F 4U0WA 3QRFF 2DPDA 2UXNA 2VQAA 4XFAA 2VBWA 4XFIA 5E1RA 3EUHA 4HQMA 3GBFA 5DD4A 3U1DA 3WW1A 4RGRA 2RGVA 3HRTA 1NZCA 1Y0UA 3PNAA 3SXYA 3OOPA 1O7FA 3L2CA 3EJKA 3D82A 4LULA 4WCGA 1ZH5A 1ON2A 4RAZA 2G9WA 5BPXA 1LNWA 3BPXA 5HS9A 3MEXA 2QDRA 1PUEE 4XFFA 3HIFA 3LAJA 3ZQ7A 4HW0A 1IXRC 3RPUA 5JI6A 5CJ9A 5JSOA 4LG0A 4QGMA 1FBUA 2EVXA 1LJ9A 5J6XA 1E2XA 4LJZF 2FE3A 4KT5C 4A5NA 2H94A 4IEUA 5D5WB 4Q0QA 4M72A 4N9IA 2P17A 4E2QA 1FLIA 1CAVA 5ILSA 2ADUA 3V7SA 2FQPA 5FB2A 2D1VA 1YWKA 4OIOF 5JR7B 3FE5A 4P9FA 3TO6A 5FLXK 1U8RA 2A3SA 2MBFA 2IVMA 4IPAA 4UVBA 4IEXA 1KU9A 1NHAA 1HKQA 6PAXA 4QM9A 1U3EM 2VC1A 4FAGA 2FBIA 2CSOA 4UV8A 2ZXJA 3KZZA 4META 5K1YA 1QY4A 1GXPA 3FFQA 2A5YB 5HLGA 1WSUA 3LAPA 1AOYA 2QCSB 4K8FA 4KN4X 4O9EA 2RDPA 1QPMA 3VEPA 3RIRA 3PFIA 5F6FA 1TQIA 4H7LA 2H6CA 3CUQC 4HZFA 2OU2A 3ZMUA 3P9CA 1TNSA 1TTYA 4MX3A 2ZO4A 4J1WA 5JVTA 5KK1A 2VPVA 3E97A 3ELNA 3L2HA 4M6YA 1QGPA 4PDKA 3RTRA 3P7NA 3KLNA 4KA4A 4YNIA 2UZKA 2B9UA 2K7LA 3NVCA 1UCXA 3FXRA 3TKYA 1PP8F 2FNAA 2EA7A 5I0RA 3U11A 4U88A 3O3KA 3HRMA 2Y48A 2K4BA 1HSTA 2OZUA 2HYFA 1USTA 5FLJA 1KQ0A 1XRUA 2DLLA 2VOPA 5KHKA 3WGGA 2EV5A 1J59A 2WC2A 4UXNA 2O1QA 5K5OA 1QZYA 5D8KB 1S8NA 2JRTA 3WTYC 2P6SA 4QGNA 2GA1A 2VC0A 4KWLA 3F21A 1OFNA 1BI1A 1BC7C 4OOIA 3RPQA 2VODA 3LOIA 3S7IA 4KFCA 4FX0A 2Z3YA 3BOQA 4IF4A 5HDGA 3K1NA 5LGTA 2O3FA 5HLIA 3REOA 4Y15A 1O3QA 2XLFA 1V3FA 1XGSA 4ZU7A 3RYKA 5JSPA 2X0LA 3BJAA 1BI3A 1EP0A 1YO5C 4OU0A 4MGRA 1IRFA 2L4MA 3WG9A 2OQGA 4AIJA 2ISYA 4A2UA 2P8TA 2QNKA 4LG0B 3H1WA 4G7ZF 1RIOH 2HJIA 1FI2A 5E8IA 1TW3A 1CX4A 3BDDA 4EQQA 4I2OA 2Z33A 1LKNA 2Q0AA 4JTOA 1NXMA 2GIVA 2W57A 5KHHA 1IN5A 2A07F 1O3RA 5KHGA 1I1GA 3GX4X 1W7PA 4L9TA 4BHPA 1KU3A 2JT1A 3C3WA 3QAHA 4YIFA 3WGIA 2MNGA 2C6YA 5LHGA 5K5RA 5TRDA 5C8WA 1G3SA 1VTNC 1SAXA 1MZBA 2EB7A 1UHMA 2COMA 4IRHA 3UKNA 5HS7A 2V09A 3ZN1A 1PM7A 2QJVA 1YW7A 4FT8A 2QWWA 3V8LA 2IC1A 2RVCA 2CW0F 1J58A 3D5LA 3F8CA 2XV4S 4OIQF 2Q30A 5D6FA 4AQ6A 2ZNYA 4UBHA 1O5UA 4HSJA 1F9NA 1P4AA 2V1XA 3IWFA 4G6QA 3RKXA 4G9YA 3HHHA 3T0YA 2YPRA 1Y3TA 4UNOA 2R7DA 2HTSA 1WGPA 5DCMA 2XKPA 1DP7P 1I1SA 2O03A 1HSJA 4LLGF 1K78B 1LVAA 1OI6A 2UY9A 2IP2A 4L11A 2DTRA 1MKMA 3CL1A 3DPLC 1KYZA 3J81Z 4EJTA 4ZYDA 1R5GA 5LBQA 5HS8A 3IBMA 5LEJA 3QP5A 1ZGJA 1YFHA 1IZ1A 2YX4A 3EO6A 1SFEA 1LB2A 3ZPLA 4HOBA 3FXUA 1ZZ9A 5ICCA 1FPQA 4PIZA 1T6SA 5ED4A 2D93A 2STTA 1ZRFA 4Q4ZF 4I09A 1J75A 1UIJA 3BJOA 4LA3A 1TLHB 4XLPF 2ZJ2A 4X6QB 4IEQA 3MCZA 4IRGA 5CVUA 3Q9SA 3GFMA 2L4AA 1Q3EA 4P55A 1T38A 2L3DA 3HUGA 5AONA 5IT3A 1K7AA 2HQNA 1SD7A 1L3JA 4ONUA 4U0VA 2GZWA 2NNYA 1IN4A 1ZYRF 2RN7A 4B09A 4E2SA 3I71A 2QENA 3ZMDA 4YFNF 5L3CA 3IKVA 4IEOA 3G3ZA 2STWA 5L3DA 4AXOA 3G7DA 4Q0VA 1ZVFA 2P5VA 3I5UA 2IXKA 3HT2A 2RQPA 2QQ9A 3H8UA 1K6OA 1CAWA 3EQEA 1GHCA 2OYZA 3IHUA 4A6EA 4OLLA 4UXAA 3C18A 3DEUA 4MUVA 3CUQB 2NS0A 1R1UA 2PAMA 4EWAA 3H1YA 1KU2A 3I58A 3R6SA 2WFPA 1XMKA 3KP6A 2PBIA 1TBXA 3KLOA 2LSOA 3ISPA 4XF1A 5D1IA 4XF9A 1FYMA 3DL3A 1WRJA 1Z91A 5E1XA 3ECOA 4DQ2A 4GCVA 3H3UA 1XCVA 3TNQA 5FGMA 5BOXA 2ETHA 4EM1A 3D0SA 4OMZA 1HW1A 1LEBA 1JUHA 1EV7A 2O0YA 3VHRA 2MD5A 3HYIA 1B4AA 2F2EA 3IL2A 3C1DA 3M8FA 2O61A 3F8FA 3FZVA 3ES4A 2V9VA 3WTTC 4MGZE 4WVZA 3WE3A 5BV6A 1WA4A 2IRFG 3HT1A 4ZYGA 1J0RA 1Q5OA 2XLGA 3ML6A 4JK1X 2B8MA 4MHGA 2GXGA 1EYBA 3SCHA 2HGCA 5BS6A 1SFNA 4DINB 2JZYA 5ICGA 3CJXA 4HSLA 2TDXA 4L9JA 3I7DA 5EEHA 4ENNA 5D5VB 1B9NA 1ZGAA 2ELHA 3I59A 4IHTA 1O3TA 5I91A 4Q48A 2K02A 3BY6A 2IA1A 3LWCA 3SCFA 4CHUA 2OAZA 1XB4A 1FZPB 2QUFA 3FMQA 2D5FA 3CF6E 3QOPA 3DXJF 2H09A 5BPIA 2CV6A 4ZU4A 4M74A 1OR7A 4HAMA 5EEGA 2XGXA 3EYIA 4F7ZA 3ECHA 1DGWA 1V4RA 3SHRA 2K9ZA 2O8XA 3BWGA 1LDDA 4PCQA 5AIQA 5KBFA 3HQXA 4QWQA 4MEXF 3RYRA 1QXJA 4ORFA 5DCMB 1STZA 3K1MA 4ZZDA 4A0ZA 2HDCA 5LEKA 4IHSA 4YARA 1OMIA 3F8NA 3C3VA 2M1BA 4FHTA 2YX7A 3NL1A 3ZDSA 1CF7A 4XFCA 2ACJA 4Q0SA 3G73A 3EBRA 4IESA 2EFOA 2QYOA 1SD6A 4IXAA 4ZYEA 3KP3A 2KXLA 3M7GA 3GEZA 1HW2A 4U7BA 1RTVA 2K0GA 4R52A 1JHFA 3KP7A 1T98A 3BCWA 4ZYHA 5LRRA 4KUMA 3GW2A 4UHTA 4WXDA 3QU3A 2BNNA 2GQQA 4Y13A 5HI0A 3TOBA 4MTDA 4PZJA 1J3QA 4GYGA 1ZG1A 2W84A 3J81K 4GYIA 1BBYA 1FXZA 3V7CA 3EQLF 2IPQX 2YR2A 5FDBA 4M9ZA 3LA7A 3WW2A 4Y17A 1R58A 4TLFA 1GQGA 4XF0A 1OYIA 1H1IA 4M9SA 1CAWB 1D8JA 2Q4SA 2KKOA 3M8EA 2J5OA 2EAAA 2F4PA
chains in the Genus database with same CATH superfamily
3WF0A 2EIBA 3W5NA 2PHRA 1Z7S3 2ZGQA 4ZPIA 4E2GA 2XB0X 2HFHA 4V2WA 2LRDA 3VZNA 4E7SA 1WKMA 2ZHKA 3G1MA 5DM6F 1GP6A 3RZZA 3RZHA 4IJAA 1VBC1 1D3YA 1B35B 1PYVA 2V1NA 1F2NA 3MPPG 1LQ1A 3GWZA 4QPYA 3V4GA 1HRV2 1N75A 1GNHA 1R23A 2VJ5A 2ZXQA 3WQ1A 4UBGA 2RDNA 4PIYA 5HLHA 1GZCA 4HDUA 3B7MA 2HWVA 3GZAA 2OD5A 3R0AA 3MLJA 2GXBA 1CR7A 1XSRA 2E2HJ 4JV4A 2VZSA 3HWJA 4KYWA 5CB7A 3OGJA 4DXRA 3POIA 3FBNB 1VBE3 1GSLA 4H14A 5AC92 1WJBA 2IXLA 4MYEA 4NIHA 4KGGA 2J1VA 1VBB3 4CVUA 2ZACA 1U12A 4OI2A 1MBHA 4N43C 3HPHA 2ZC2A 1YFYA 1N1SA 1S72I 4LEJA 5F0CA 2AO9A 1QMJA 1W6OA 3PVNA 3KFWX 2Z99A 4AU7A 3DBHB 2P5KA 3HTSB 4I01A 3THPA 1W7PD 3PVEA 3OPTA 1RUE3 5LRSA 2P1BA 3HXLA 1VBD1 4AEJA 5FZ8A 2P4WA 1JJ8C 4CDQA 1NYWA 3V0BB 4Y4YA 3SCGA 2W1OA 2ZXWH 1ZRDA 1F5FA 4NC7A 3F8BA 1K78A 4NC6A 1QJX3 2VNRA 5FR3A 3PUBA 4FFHA 2QEXI 3MV01 1AJOA 1J7KA 2DTYA 2XONA 3GZ5A 4XPVA 3WP3A 3JTHA 2WT0A 4ENKA 3GJBA 3J7YJ 5L3GA 1JI8A 1OJLA 3ZSEA 2QQKA 2R062 2CU5A 5C3RA 3HOSA 5C3OA 2Q1ZB 1O5LA 3ILFA 2FDGA 1I3HA 1ULDA 1YXWA 3USSA 1SMYF 2VXDA 1D1BA 1HKTA 1CWPA 2Q8CA 1RMU3 3HVDA 3I3QA 3CUOA 3O8GA 2V6EA 2VCMA 3NKGA 2QQAA 1T2XA 1UXZA 3FK7A 4CXWA 1WD3A 1UZCA 2XROA 1T8IA 3JBG1 3Q3SA 1AL21 5E17F 1W5TA 2ZKNA 1LGNA 1RINA 4BQYA 3MIDA 3SQNA 2ZKZA 1YI2I 4RAFA 1EPWA 2ZXHA 1AWCA 1SFOJ 1YYVA 2LG4A 3POWA 4FPEA 5JFRA 3CUQA 3AL0C 1OPCA 1LULA 4YZ4A 2BWCA 5FAXA 1V5FA 3U37A 3RKQA 4Y1UA 3E6CC 2R7WA 2KJCA 2W2IA 4LJHA 3O0WA 2ARBA 4AVSA 1IN6A 4Q5OA 1RUOA 3S15J 2HBUA 4UV9A 1X19A 4ZTJA 4PBOA 1MS0A 2LK2A 3C2UA 1OA4A 1ON1A 1HW5A 3PNTA 4XKWA 4FTBA 2V72A 4LIUA 4CXYA 5K8SA 4XEZA 2VXZA 5FKKA 2XGCA 3RSJA 2NVQJ 2HLEA 3WTUC 1IG7A 1F4AA 2NMOA 2X48A 3LIHA 2HYXA 4O6JA 1H1MA 1YC61 5GADJ 4IDZA 4O61A 1BLZA 2BUKA 4A5MA 5AIPA 4L18B 2E1CA 1US2A 2RNJA 2BW3A 1LOGA 3Q5FA 2RS32 3O5SA 3GM8A 2VG9A 3HSRA 2FSWA 4YVSC 4B3AA 2FBHA 2VE9A 1CD3G 1ZBE2 1MDMB 3KYCB 2HEOA 2AQEA 2SLIA 4RMNA 4D8MA 2JENA 2LTNA 4MGSA 1YX3A 4TSVA 4LHKA 1VBA2 4E7HA 2DCEA 4Y4RA 1V9U3 2JB8A 1I6XA 4WF2A 4FISA 1A8MA 1OLTA 2W48A 5EDNA 4HVQA 2QVSB 4XBFA 1YUDA 5T5OA 2DURA 1R22A 5FYZA 3T8RA 2WV1A 4UFIA 5LZ6A 3NV1A 1XB9A 2PMWB 5BMZA 1W05A 3PM1A 1CVNA 1WI3A 2ADEA 3BALA 3CJIC 5LA1A 4WM7A 2WYFA 1POV3 2P5BA 3VBRA 1EH6A 1XDUA 1SLTA 1FAYA 3L1PA 1ITYA 4HG6B 2QVOA 2CV1A 2VAUA 2XBO2 3CF5F 2Y30A 1QHHD 5C8CA 3CZJA 2WNOA 3ZQCA 3X2QH 1J9IA 1ALYA 4HX4A 2HKOA 4ZDLA 3MD2A 3I2JA 2ES3A 2V4JC 2VW0A 3NWKA 2P34A 1MJ9A 4Q4Y3 3VBUB 1UMZA 4PGGA 1PHMA 2D6OX 1UU6A 3DYPA 1NG0A 1RPWA 2PI0A 1AHDP 1SHWB 2OVUA 1VB4A 1XS9A 1LPQA 1VQNI 4UF0A 3GYDA 3ZXGA 3KE2A 5JMOA 3OGVA 2VL8A 3ZMTA 1OKRA 3RI4A 4HBNA 3U10A 4XHBA 1IPSA 3E6DA 4BE0A 2BVBA 5C3QA 1ZN2A 4XJ9A 1VLNA 1FY7A 1VRBA 4HFSA 4A45A 2D5VA 1ZG3A 3KV6A 1U6GA 4MZUA 3EUKL 3IC7A 1L7LA 3ZFEB 3HTUA 1IN8A 4CU9A 5LA9A 1OLRA 4OHYA 3JREA 2VL4A 2EA2A 4KNCA 3R61A 2MHFA 1IV8A 5A32A 4XSZF 3KHBA 4RR3C 2LY1A 3KEOA 2CY6A 3LSMA 1E57A 4DQAA 3HEFA 3CCEI 2F6BA 5K7PA 2XAQA 4CGZA 1V6NA 4LBKA 1QZZA 4A12A 5C70A 3SKJE 4FP3A 2WNEA 2R041 4BK4A 2XAJA 4YPJA 3MIBA 1X7NA 1PGSA 4Y24A 1IXSB 4L0PA 4EGYA 3MZYA 1ZZ8A 4RQPA 1AUYA 4Y1VA 4YG3A 2OV7A 1YO8A 1DBNA 5GZGA 2PN5A 3OSDA 3PDQA 4LORA 4QXCA 4XUTA 4LB5A 2XJQA 3AB0A 3THCA 1XSDA 1D4M3 3LDRA 4IVNA 1IOAA 1POV0 4GH4C 2EFNA 4B44A 4YSFA 4UUSB 1KJLA 2M34A 2MH9A 2VMHA 5FY1A 3COAC 3IM0A 3ZR8X 2A3XA 3BOWA 3IDBB 5J98B 5J1YA 2AS5F 3CO6C 5JR2A 1VBC2 5DDJ3 2R5ZA 3I54A 5A3WA 5IY5H 5FQ0A 5BQTA 2BYVE 2VUCA 4KH9A 1V70A 3ABTA 3JUUA 3AMQA 4PHZA 3UGHA 1X2MA 4IV1C 1IGNA 4OQ9A 3FJSA 3P3PA 3QOEA 5LY2A 1YJWI 1WWXA 1IRZA 2K2SA 4PI0A 3FK6A 3QODA 5CQGA 3VOEA 3VBFB 1YFWA 2F48A 1O4TA 2L5QA 4CP2A 1DYOA 1RUH3 1IQAA 4OAYA 1E5SA 4RLQA 1QA6A 2FD8A 1WZXA 5FZOA 3DUIA 2HWC3 3A0KA 4YZ3A 1WQ2A 4B8XA 1LE8B 4X6AJ 3PNVA 4KDPA 1Q1VA 4XIOA 5J48A 1QJU1 2EPFA 3T4VA 5FKMA 4OINF 3VBSB 2QBYA 1GXQA 1IXCA 5HOOA 1Q43A 1BYHA 4EWDA 4BE2A 2V4VA 2A75A 4FASD 4W65A 3HQRA 5FZLA 2VM9A 1QPIA 2XSJC 2LH9A 1DPRA 3ZMZA 5F1RA 3O2PE 2ZB9A 1NE4A 4I99C 4XRMA 2RMU1 2VKVA 4NHYA 3L2UA 2VPLA 2JKBA 1OCOH 2LD5A 2VBYA 3POGA 2R073 5FXXA 1J1TA 4FXGB 1TT5B 2XLAA 3J9SA 2VO5A 3AYAA 5J8CA 3EXUA 1SBFA 3E6BA 5FIXA 1N3QA 3TYJA 5JZGC 1VQKI 4DYCA 4LE4A 2QQ8A 3O6BB 3LNQA 2CGPA 2IWGB 2W85A 4YVWB 2DMUA 5EZWA 1D4VB 2JWTA 5C3EJ 1HRI3 1RKWA 2JJ7A 1AVBA 5BNQA 3JBG2 3NV4A 1AL22 2LREA 1UHWA 3D5RC 4DUWA 1AZDA 2PHWA 4IEVA 3K6GA 2W94A 1AYN1 3J8F2 1QRYA 2Q2EA 3ZFFB 1S7AA 1GQHA 3SFZA 1VQ7I 4PJMA 3KD4A 2P7VB 3U2RA 3K9TA 1FYKA 1WJAA 4AK3A 4DZPA 4FOWA 1UYPA 5JOWA 1GBGA 4NUBA 4X8PA 1PVEA 1R36A 3CDHA 5J8FA 4D69A 3KP2A 3I3DA 4IGQA 4QU1A 2CTVA 2BGCA 5DUUA 5FY0A 2CAVA 2VXRA 3ZXKA 3KT4A 3K75B 1V0AA 1SMTA 4GB31 1YRNB 5FRMA 1SCSA 1LGCA 1W39A 2VPRA 3BU7A 3OYBA 1V5EA 2XPJA 5FFZA 5JHUA 3VPRA 3MQ0A 1ZAOA 3D1NI 3PSIA 2B5HA 4ARYA 4I02A 4BBSJ 4EN8B 1R5HA 2JJ6A 4CEYB 2VZOA 2TCTA 3TNPB 5FYSA 2ZX3A 3IAQA 3RJRA 3AFKA 3NKTA 3FZ3A 5C9AC 3W5MA 3RZMA 4L9BA 1OYWA 5SV5A 2EF6A 3VD5A 4R9CA 1W2UA 1UOGA 4EM2A 3CC2I 2ZMEC 3ZN0A 5FK8A 2D40A 1J83A 3BOPA 2G19A 1DDLA 5GM0A 1L3LA 2XAFA 2XOMA 1FMWA 5DN2A 4QHBA 4OUMA 3OCPA 5LD2C 1QH6A 2BVLA 1QJFA 3JR9A 3UR3C 3PIJA 1DQ6A 4P14A 4Y20B 3CZUA 4FQGA 1X1CA 2KHMA 3OYGA 2BE5F 2R30A 1C1LA 5A7OA 1GR3A 4K1YA 4OIPF 3KYDB 3QPTA 1ZYBA 3TRSB 1G2HA 3FIWA 1TWCJ 3VHOA 1SEFA 2E19A 2VTXJ 1VMFA 3QU6A 4CP0A 3TW7A 3CZ6A 2JPCA 1QIQA 1RB8G 4LHSA 1UIKA 2CW8A 1PK6A 5F9TA 2JE7A 5IK5A 5CYVA 4Y26A 4XCBA 2VECA 1BOAA 2J1UA 4IHXA 3POFA 3M8LA 4P9GA 5BNNB 4R4ZA 4XN3A 5CVRA 2HYGD 3ZM8A 2DVFA 3CLPA 5J3LA 5C5TA 2GMPA 1QQP1 4BQOA 2P2KA 1BQPA 3X29B 1S29A 1GQPA 4WXCA 4PQQA 5IT9K 1YW8A 3NQOA 3BR3A 3ZFGB 1LEDA 4LBQA 2X8KA 5CYYA 1IS5A 3OUIA 4NNJA 2JA6J 2E7QA 5GP9A 2Z42A 2WDBA 4FTSA 2V1UA 1CZTA 4M0NA 2OBPA 2V9KA 4CDWB 1PMJX 2X5IB 3OTFA 1OA2A 1YS7A 4Z2WA 4N0BA 2GALA 2D6PA 3J80Z 3BB6A 4L2NA 2VE8A 3RWKX 4D3WA 5C44J 2RNGA 4XC9A 5FLMJ 2PFWA 5FUIA 5FZ1A 2E9QA 3GZEA 1W6PA 1V54H 2L02A 3HSEA 1JTYA 2H1LA 2IZWA 5LY1A 2JTVA 3OOXA 4NE9A 4HKWA 3ZR6A 3U0ZA 3OSFA 1NCRC 5CFDC 1YX5A 4JGYB 5GLWA 4XIKA 3ZQLA 5B1AH 1U8BA 1A6QA 5A70A 1UY3A 2M9HA 2PEXA 2EFWA 5FREA 1N78A 4JVAA 4GDFA 4NPMA 4Y5SA 5J7MA 1BC8C 3RNSA 1SZBA 2FCUA 2WNUA 2BXYA 1HQCA 2R042 4KWKA 3WG4A 1OCTC 1U0AA 2HWF1 1KGSA 5IVEA 1O7LA 2PHDA 4UUTA 2V73A 1MS8A 4HMZA 3MZHA 4LGWA 5J3UA 1V6IA 3SEPA 1C1FA 4RS5C 5LGUA 3MAJA 2FZ2A 2DK5A 5ABJC 2BXZA 3FM3A 4I98B 4CZSA 5FFXA 1JN2P 3Q8CA 5FMCA 4XTMA 1Z6RA 2ZGOA 5B66C 2DA7A 2VE1A 1AF9A 4NDLA 2LOOA 1V55H 3IRRA 2HZTA 2QQBA 1RGSA 2DDAA 3ZSKA 4OHWA 3JQXA 1WMDA 1XE7A 3PL0A 3MLKA 1Z7UA 4PGHA 1G7YA 2DQLA 4QPIB 2VQCA 3KCYA 3CJNA 5F08A 1W8OA 3U4XA 2A7AA 2WSVA 4Z07A 3WY6A 3U1XA 2BY2A 2IS4A 3HOVJ 5L3FA 4W6XA 1O57A 3HOBA 2DU9A 2BBYA 3ZQGA 2ZEXA 3P9IA 1GZ9A 2L7KA 2DI3A 3ZYIB 3POYA 4QLCU 1W7PB 1S0EA 2Q0OA 1XGOA 3AP6A 3ACLA 3U1KA 1X9TA 2CNAA 1P4WA 1HA8A 1YW9A 2QM3A 3MZ8A 3LFKA 4LBMA 1C5HA 5GTIC 3MW2A 5E8AA 3H7YA 1DYKA 3PJQA 2DMPA 4RB3C 4MQ9F 1GFF2 2IXIA 1QJU2 3QYBA 2MG4A 1QVTA 2KZGA 4QXHA 2P6TA 2FMYA 2QCOA 4DBRA 3ZSLA 1CONA 2LKPA 2W7NA 3BZCA 2XMLA 1FPN1 1E3HA 3VFZA 4XSXF 1FEXA 3N3HA 2OA4A 4XMIA 3NEUA 1K12A 1DU6A 4JQFA 4PF5A 3CESA 1K83J 3IH2A 1W9YA 1VQMI 1LJ7A 3RVHA 5IW0A 2RMU2 1OF4A 2MPFA 4L8QA 1FMD3 2HYJA 2FDJA 3J8F3 1IRXA 4JX4A 3BROA 4U2AA 3CMEI 1O3SA 2RG4A 2EZKA 3LFUA 3NJZA 2WB1A 1Z6TA 4AIHA 2L9RA 1FNNA 2PAEA 2JE9A 4LPLA 1W90A 3KMHA 1FP2A 4G3YC 5H6RA 2ICWG 5B3SH 1NX9A 2ZGKA 2DQRA 3VODA 4LOSA 5JIAA 4PIXA 4F91B 4QPGC 1AR81 4CCNA 4NWVA 4XHXA 5L7OA 5JSRA 2WWSA 4NIGA 2EJRA 2HVSA 4IV3B 1Q8OA 2EILH 2X51A 4L9VA 2QQWA 5FPLA 2HQAA 1XE8A 5J1UA 2VZVA 5ACA3 1P8JA 4BLJA 1AYN2 3MKLA 4GH4A 3HUGB 4BEHA 2A6YA 2DPDA 2ZAAA 2VBDA 4CDXC 4W4ZA 3MKZA 1Q8QA 3IAPA 1H6YA 5JPNB 2EQRA 5DD4A 1YITI 1FNYA 4Q4X3 4RGRA 1Y9MA 3NJYA 3KB5A 4E7LA 4UYBA 1H2MA 4GB32 3OYFA 2NLRA 1HJGA 4RAZA 3NAPC 2DA5A 5BPXA 4K7JA 4C2TA 2AQFA 4E7KA 1SBDA 4C91A 3MEXA 3MFAA 1UOFA 4CEWC 3LAJA 3ZQ7A 1TNFA 2AUYA 5F1JA 1O4ZA 5DUWA 3WQ0A 1X4PA 3OPZA 5FZGA 2YC2A 1RUF1 3UGFA 5GLUA 2VNOA 4IEUA 2WN2A 2X1EA 1JZ8A 4D9JA 4V2FA 4M72A 2NVXJ 4E2QA 2ZJQF 4Q4V1 3A22A 1A6IA 2DCYA 1W3XA 3IAM2 3OYCA 2X1DA 4AGGA 4TTGA 2OQ7A 4BWOA 4OIOF 4P9FA 3BODA 2A3SA 4C30A 2MBFA 1X3ZB 1WA6X 3JCUC 6PAXA 2QF7A 2WZEA 4FQ4A 4FAGA 4BE1A 3LD8A 4AC0A 2XJVA 5IP6A 2LMDA 3FFQA 5BNOA 2XR4A 3QPLA 1WSUA 2KMUA 3LAPA 1AOYA 4A6SA 4O9EA 3K4AA 5EV7A 2GNTA 3PFIA 3AKTA 1NG6A 3HAGA 4OZOA 4DRVA 1Y6IA 3OY9A 4DUXA 4MX3A 4YZ2A 2VPVA 4XABA 4TYSA 4BACA 3L9JT 1QGPA 3RTRA 1TME1 4C90A 4Q1RA 4JKKA 4IW3A 2DTZA 2A70A 1QQP2 5M3MJ 1K61A 2K7LA 2JDMA 5GZCA 1AYM3 4M3EA 3POJA 2VJIA 2EA7A 3VD3A 1MZ5A 4E27A 4ZDOA 2V7FA 3O3KA 1G8XA 1C3HA 1RJ7A 2K4BA 2OZUA 3T0DA 2GOXB 1WJFA 2DLLA 3HKZN 2DA3A 1J59A 4UXNA 5EJCA 4C1WA 5K5OA 3N7KA 1QZYA 2JRTA 3V65A 3WTYC 2P6SA 3GCMA 4M4PA 1ASJ3 2KDZA 5GKAC 3A0NA 3F21A 1BI1A 1PO21 5T50A 1ETQA 1BC7C 3APBA 3RPQA 2WO3A 3LOIA 4KFCA 5FMBA 4Q8LA 1MBJA 3K1NA 5F37A 3H8RA 2XGEA 3B94A 3S1NJ 3AYEA 2MGQA 5D8AB 3A0BC 1GLNA 2JDPA 2A5WA 1UQXA 2E33A 5CZKA 1AU7A 1BI3A 2GP3A 4A3IJ 2R4GA 3DTKA 3BZKA 4AIJA 3F9KA 2ISYA 1YHQI 2OTJI 1GKBA 2X6OA 3H5AA 1FI2A 1TW3A 1S2EA 4HK8A 2YB7A 1W8ZA 1NXMA 2ZFUA 5IAXA 4YM0A 3HG9A 2W57A 1GU3A 1I50J 1FOYA 5TGTA 1IN5A 1SLLA 1O3RA 5KHGA 2HWF2 3QAHA 3O0XA 1PNFA 2MNGA 3E1F1 5C5UA 2C6YA 2WKKA 5K5RA 5C8WA 1G3SA 2OPWA 2FDHA 3GCXA 1UAIA 1UY2A 1B72A 3UKNA 3NRUA 5JIUA 1Z3XA 1XBFA 2QWWA 3V8LA 4YG0A 4KT6A 2RVCA 2DCJA 1WLWA 4AEMA 2XV4S 2DVGA 3WNLA 5D6FA 1MPXA 1U0JA 2K85A 3U14A 1F9NA 3OYLA 4BBRJ 1DCSA 2FCTA 3NMBA 3DBLB 5KC6A 3DU6A 2WIIB 2MD0A 4LBLA 2YPRA 4UNOA 2R7DA 3Q9OA 1WGPA 5DCMA 2XKPA 1DP7P 2RR13 4FOYA 1LVAA 2RDQA 2KISA 2IP2A 3CDLA 1LFUP 4L11A 3PJRA 3O1TA 3ALQA 3WDVA 1UZ0A 1K45A 3WOGA 1NT0A 3IBMA 5LEJA 1B35C 3AZXA 1FMVA 3FC0A 1ZGJA 1UX6A 1YFHA 4DOUA 1IZ1A 3PUAA 4DMIA 1SFEA 3FXUA 1RR8C 4PIZA 3NNMA 1TWAJ 2STTA 1MVEA 3BJOA 1TP4A 1TLHB 4XLPF 4PDWB 1APNA 1PO13 2ZJ2A 2AHQA 3MCZA 4IRGA 2TNFA 1YRZA 2RMU3 3PUIA 3O1VA 3U21A 1Q3EA 1VAKA 4P55A 4C9YA 2CQQA 2L3DA 1U9NA 4GAZA 1K7AA 4LOCA 3OBZA 3RZKA 2NNYA 2QENA 4YFNF 3I2OA 3IKVA 3JCIA 3I3MA 2WABA 1IUFA 3G7DA 1ZVFA 2P5VA 2D3RA 5K0UB 2RQPA 5JWPA 1OHFA 4ATEA 3GTLJ 1MZEA 4LG3A 1H2KA 1GHCA 1DZQA 4UOJA 1FPN2 3DEUA 5IFPA 2QUOA 1NCRA 1W8WA 1BR1A 2NS0A 3DECA 4HANA 2RDRA 4EWAA 3H1YA 4NRPA 1KU2A 2WFPA 4QPWA 5KXBA 4FOQA 3FXMA 1WRJA 1MS5A 2WLQA 1DYPA 1JS9A 2ZGNA 4NBQA 2WSUA 3B00A 1OURA 3CCUI 3H3UA 4D7MA 2H1KA 2WR9A 5FWEA 1K5MA 1XCVA 5LBBA 3TNQA 4YRVA 5FGMA 1G9DA 3AP9A 3K4JA 1FV2A 5E3NA 4D6SA 4OMZA 3BVCA 2KZVA 3FBMA 4AEKA 4FPFA 4ISRA 2LY9A 2O0YA 1RIRA 3VHRA 3HYIA 2ZPXA 2XC7A 2O61A 3F8FA 3UNPA 3FZVA 3MW3A 2V9VA 4LKSA 2YFUA 1HJFA 3PVOA 4BB3A 1AR82 1QH7A 1IGOA 4RS5A 3ZYFA 3CP8A 1Q5OA 5ABJA 2WZR1 3BCBA 2CYFA 5IATA 2UURA 2WRAA 2J1SA 4MHGA 1N1YA 3DKXA 2C9KA 1NK3P 4IE6A 4O7XA 2VVEA 5BS6A 1DLCA 2WADA 3IKWA 4JKLA 2Y6GA 5EEHA 4ENNA 3GZNB 1A35A 1O3TA 2K02A 3BY6A 4AIDA 4CHUA 2C1FA 1BJQA 1W0OA 3AL0B 4DEQA 3FMQA 1TE1B 3DPRB 2H09A 5EEGA 5FP4A 3BI3A 2K9ZA 2O8XA 3GHNA 3OMYA 3MN2A 1A5JA 3UYJA 2JEMA 1IS6A 4QD2A 1QXJA 2VCAA 2BGOA 4Q27A 3VYUB 5LEKA 4P9WA 2PJRB 1VAMA 5L73A 3BQYA 4A3BJ 3KWVA 2M1BA 2YX7A 3KM5A 3PIGA 4XFCA 2ACJA 4Q0SA 3G73A 2Q8DA 1XXNA 3M1HA 1P7IA 1SD6A 3I4MJ 2X85A 4M3GA 1RUF2 1W6MB 4NPRA 5IK4A 3HNYM 4ZYEA 1MNEA 2KXLA 2CFOA 4HKLA 3WX5A 3S30A 2VNGA 5LK7B 1E5IA 2YBSA 2BZDA 5EYRA 4Q4V2 4XXPA 3GW2A 5G04L 4BLIA 4YVSB 3CCJI 3QH7A 2OUHA 4CA9A 4JOMA 3FHAA 2BNNA 5F3GA 1GUUA 4BK5A 1ZBA1 4LT5A 4B43A 2XPVA 3J81K 2DUOA 3V7CA 5FDBA 1QQP3 3VUOA 2V9PA 4N53B 1MQTA 3GXUA 4M9SA 1CAWB 1UG2A 1D8JA 2KKOA 1HXS2 2J5OA 4XURA 3T09A 4JKMA 4GIQA 4PFOA 1MSFC 1LHUA 3C7FA 3ZP5A 5H9SA 3LPGA 2WBMA 4QPQA 1PMIA 1RUG1 4U7DA 2G9FA 5FJ8J 3UKVA 4ATFA 1E17A 3WUDA 3EB7A 1WKYA 3FKJA 2HEWF 3SITA 2XQXA 1YIOA 3HBKA 4BKXA 3NV3A 2AH2A 2NYYA 3CJIB 4AZZA 2ADDA 4DGWB 2BOLA 3VDDA 1BJZA 2QSGX 1TME2 1URXA 3W20A 4UFJA 3IPVB 5FZMA 2Y6JA 4MGIE 2MC3A 1NA1A 2PHLA 5EQUA 5KHJA 2FZ1A 2WS93 2RS11 1VALA 1OCPA 3OL4A 5FYBA 5FXZA 2L54A 3CEWA 1CZSA 4Q29A 5HCAA 1IN7A 1FC3A 4Y5TA 2B7YA 2W46A 2PN6A 4FPHA 3C7EA 3JRGA 3VN4A 1SDDB 2KIMA 4B48A 2PG4A 3C7JA 3KLSA 2NOGA 2D6LX 3VBUC 4XONA 2K46A 1X1DA 2XAGA 5T55A 3WP4A 4YLZA 4LBQD 4OHVA 3ECQA 1PO22 2Z9OA 4G94A 3INAA 1DQ1A 3WD5A 2NNNA 2GAUA 2C4XA 1BCXA 5KAFC 5T54A 4LO8A 2M30A 2QLZA 2BEOA 4CCLA 2ZBKA 4KN7X 1J5YA 4NWWA 4ZYAA 4GJYA 1CZVA 1EAH1 3PLQA 4G12A 5HDKA 1H9WA 4ZXKA 3WNNA 4BQNA 4QQHA 4AYBN 4AFMA 4AFBA 4KNYA 1X1BA 4RD7A 5FROA 3G71I 1E3OC 1OLQA 3M1CA 2GNMA 1Z9CA 4BS9A 3ZFEC 3VKOA 4RFRB 4R1HA 2X6WA 4QQOA 4YGDA 2W1SA 1NAEA 1HN1A 1YQ5A 3CTAA 4X6RB 2Y0OA 3C7GA 2F5DA 3CO7C 3N35A 3V0AB 3DQVC 4YFKF 1O4XA 2YU1A 4A3KJ 1RUJ3 2EZIA 4RAGA 2VKEA 1XNKA 1FOD3 2VOVA 4SLIA 2QE3A 3MI8A 3W6KB 4X0GA 5FZ3A 5M5YJ 2Y2ZA 1USSA 5EJ1B 3VV1A 4NQWB 2GC1A 2VJXA 4PSWA 4JX6A 4GMP0 1WUVA 1ZA4A 2CWEA 5TISC 2O8QA 3LIGA 5A6XA 2BV6A 4NJ4A 5AFEA 3AG1H 4YIIA 4EV0A 1VQPI 4AW7A 1OFCX 1COV1 3F23A 3TN93 2K9SA 1NCQA 2D5HA 1ND2A 4S2GA 1JODA 2ZJRF 3DEWA 2XRNA 3W59A 3MMYB 2W1WA 1CQTA 4XETA 5B4NA 1P92A 2YXSA 4EN6B 4L9NA 5GPAA 2ID3A 2OTLI 1WVRA 3WW4A 1UAAA 4X8NA 1FOWA 2YHJA 5A33B 2E7XA 1TZLA 3SJMA 4NR1A 3FUOA 3VKLA 4C1XA 3VDAA 4CU7A 3CCSI 1FPN3 3H92A 5B1BH 2XG3A 1F15A 3H3LA 3CMGA 1JTXA 3MF6A 3P3NA 3BTAA 5DCFA 1MMDA 4UFMA 2CV0A 5HV0A 2PQ8A 3FHIB 2R32A 1BEV1 1IRGA 3GFIA 1UX7A 4CA0A 2FXAA 3OD0A 3VBFC 5J40A 2QKDA 1Z7S1 4PJYA 1NK2P 3BTZA 4JBAA 2TEPA 1LOBA 2BHZA 1W6OB 1XNDA 1HCRA 5EHDA 3KF3A 2PQSA 4AE2A 2DCTA 5EP9A 4IE7A 1XCBA 2LNBA 1YCIA 2LYCA 5JI7A 4CDQB 4Z2YA 5FKCA 2XWJB 2VZ3A 1QXRA 1VI0A 1XD7A 3I2GA 3GTGJ 2M2EA 4QMAA 4AI1A 1K5JA 3O1RA 4FCAA 2F4LA 4UFLA 1G9CA 2DVDA 3IZOA 4CRQA 3VSLA 1VBE1 1KXGA 1LNSA 4BXFA 1CAUA 3GTKJ 3HN3A 3QQAA 1ZR2A 4P1WA 2QSHX 3H1MA 1POGA 3GYHX 4XUNA 3F3XA 1BOBA 1UHSA 1VBB1 2CFXA 1YJLA 1RUNA 4AG4A 5IYYA 1W6NB 2VQ0A 1DU0A 3RYPA 5A3TA 2W4SA 5IP7J 1LTEA 3T1BA 4A0XA 3I9V2 2WY7Q 2E53A 2P37A 3N9MA 1DU3D 2M5WA 1Y8RB 1LOFA 3OYHA 1JU3A 2WZ8A 5H2FC 5FMDA 2VXJA 3HDDA 4XQ4A 3K70D 2JWPA 1I5PA 2PELA 2GP5A 4NOTA 3AK0A 4R8HA 2WZR2 1RUE1 2IEKA 1ZKGA 3K4BA 5EWSA 1Q8SA 3KIOA 2DT6A 4YVWC 1NKGA 1QBJA 1DGRA 1R1TA 3WTXC 1QJX1 3C2HA 2EXKA 1ZLKA 4WK8F 1RUF3 3E3VA 2WFF3 4V1PA 3T4HB 5EZGA 2LLKA 1YOVB 3SFIA 2WLPA 3ZFFC 3IDAA 1OQYA 3TP3A 5FYIA 2Z1DA 4JX0A 3K4LA 1EPZA 2R1BA 2VLAA 4J1XA 2JICA 4QX1A 4BL0B 4ISQA 2M4GA 1PX3A 1W06A 5HXVA 3NNFA 4PSXA 1FBQA 2YSRA 3JSPA 4R9DA 4WVMA 1S0BA 1B35A 1YIFA 3S0MA 1RMU1 2A3YA 2PLYA 3JAMZ 5KHDA 4ESJA 2A1XA 4JQRA 2GN3A 4ASNA 3ELKA 4CZCA 3AC0A 1I6HJ 1UCRA 4L5JA 5E3OA 3CCMI 2HVQA 4B4CA 4OHZA 1SFUA 1HXS3 3H8OA 4GQ7A 5A2QZ 5GPCA 5A7PA 4C3JJ 3IV5A 4COVA 1OBNA 3OR1C 1CJDA 2E7WA 1XDSA 2PMUA 5F8PA 2Y64A 3CCVI 2BW3B 2J1AA 2JIGA 4D7TA 2QQNA 2OIIA 2Q8EA 1ZM1A 5EXOA 1R1ZA 5C6CA 1HV0A 4BNCA 1ZBA2 1GICA 4UW3A 4HV6A 5G05L 1S5LC 2VOTA 4FO9A 3H0GJ 1WBFA 4LBJA 5DS9A 3TOJA 5A3UA 1ACIA 2R0HA 1XGMA 1ZZ6A 3V0BA 2SBAA 4Z82A 4Q4W3 3KETA 3BTJA 2CJJA 1W4MA 4GO1A 1OH4A 1RUG2 1RXGA 4CP9A 2PHUA 4HONA 1SBEA 1VRH1 4P9XA 3WU2C 3FM5A 2VONA 2IS6A 1GNYA 3I4PA 5BNPC 1J1LA 4IXLA 2JDAA 3AP5A 3J7NA 1W2OA 1ZGWA 1ULFA 3QYEA 4V2VA 2Z2SB 4XOTA 3VBRB 2O7OA 4YW5A 1SVMA 2EA4A 2RS12 3GZ6A 4AVBA 2JVGA 3IH4A 5BNNC 4HX8A 1MMGA 5F0FA 3SKVA 3DTIA 3OS2A 3UKTA 4BQ5A 2XAUA 5TSWA 1V9U1 4I3PA 3TO9A 2MA3A 4LA2A 4CYCA 3H7JA 2AENA 4D94A 3H0DA 1NG7A 3ZFGC 4C2UA 3WDWA 2AXLA 5JMCA 2K86A 3LSTA 1XTAA 4NIIA 1HKSA 2H27A 3ZPYA 1JYXA 5I0UA 4I0WB 2Y0SN 1S0DA 2IA2A 2G1MA 4HF1A 3TO7A 1MBEA 4CDWC 2X5IC 1YIPA 1TEIA 1RUC3 1TW2A 1XGNA 2WAAA 5CVVA 2VULA 5JOZA 2NAZA 2EZLA 4AI2A 1POV1 5E6HA 2W5FA 1EAH2 3RKYA 4MFEA 1I39A 2LC2A 1V6MA 2NVUB 1W2NA 2R0FA 4FTHA 4XJUA 3VBHB 3FFZA 3OOUA 2DFEA 2IXJA 4IHVA 4ZS2A 3T08A 4KISA 1RHI3 4Q0PA 2ZX0A 4FX4A 4DB5A 1OD3A 5JI9A 1CIWA 4XKBA 5A32B 2ETEA 2X4HA 2WAEA 3AAFA 3GTPJ 4AEDC 4JGYC 3B3QE 4RGUA 1IF1A 2R3SA 2DMNA 5A1AA 4W1UA 2HWB3 2HZDA 2YPJA 2CQKA 2B45X 1Z1DA 1SQ4A 4RFT0 1S3JA 2VUAA 1X9PA 3LDBA 4MV2A 3MKWB 1PUFB 2B0LA 2DFCA 1S55A 2CAUA 4YW7A 4RQPB 4HLXA 2JQ7A 2IBDA 3LEIA 1MVQA 1HB1A 4D6RA 3DTEA 4BIFA 2WBKA 4HA8A 3VBOB 4AVZA 1QNTA 1COV2 1F5JA 3OY8A 3PUFA 4ESFA 4M3FA 5F32A 3ZN5A 1J3PA 3A02A 4G7OF 2HEYF 2JUGA 3H3ZA 3DN7A 3W6VA 4LLLA 2D3SA 3L2RA 2I2SA 2ZMLA 5E18F 4NHMA 1XPWA 1SD5A 3OGGA 2BBAA 3ZXEA 2FEZA 2MYSA 2Q5TA 3SC7X 2L9VA 4F8AA 1ULPA 4OMCA 3K4NA 2W82A 2R5ZB 4BA6A 5D8LB 2IW5A 2FBKA 2BY0A 2CG4A 4E4SA 3S2HJ 4QPIC 5K9YA 2YUSA 1RYYA 3IN9A 3QD6A 4HV5A 1YI7A 2JDYA 4E7ZA 1Z0XA 4P02B 3A1YA 4KMFA 3HRSA 1G6NA 1UFMA 3WVJA 3K2ZA 1ZHFA 4RN5A 4RHV3 1X50A 4QB6A 2D1HA 4UVAA 2W68A 4NHJA 4XYXA 4JCKA 1D4M1 4YELA 2BFUL 4XJ8A 4XKCA 4H3WA 2DBNA 2L9NA 3K77A 1BEV2 4UW6A 2YY1A 3O12A 1LODA 5FYMA 4PUSA 2VC9A 3OIOA 1Z7S2 1QVUA 4BQAA 4WM8A 4LKDA 2Z69A 4GWJA 1PZ9A 2A5ZA 1S0JA 4I7HA 1ZX5A 4AM3A 1G3TA 2PAKA 5DDJ1 2VZPA 2Z5UA 2OS2A 2QBYB 3VZLA 1A34A 2F17A 3CDIA 4M3CA 3T8TA 1M4WA 3VDXA 1AR63 4K9SA 4Z2AA 1F9KA 2G9GA 5D6EA 3TL4X 3L2WA 4RYDA 3HN1A 1UZWA 2B9SA 5ICEA 1VBE2 1N47A 1TVGA 2WA0A 1VBB2 4HVOA 1O8SA 2VR4A 5KVRA 1RUH1 1YTYA 3BTXA 1T6BX 4CO8A 5LFAA 3ITQA 4CUGA 2HWC1 1FOKA 1KU7A 3DWLE 3ZN6B 4FCYA 4R79A 3ZIWA 1N77A 2Y9YA 5A3PA 2VZRA 3A03A 4N4OB 3JB8A 3ZQFA 4GALA 2VN2A 3TOAA 3HOTA 1XNCA 5CKTA 3M70A 2FQ3A 1PX4A 2BWAA 1DUXC 4IV3C 2ZHMA 1QJX2 5IHRA 3K2OA 2E7AA 3OBTA 3OWTA 4A7YA 4AI9A 2LR8A 1AR73 5FZCA 2EFPA 4KITB 5A6QA 3MLLA 5FZKA 4UI9L 1YQ2A 2R071 1IPJA 1GMMA 2PJPA 4M71A 3FWEA 4BXXJ 5GAGJ 4ASMB 2PMZN 4QSHA 5C4WB 3AP7A 3AG3H 3DBRB 4XQFA 2QQVA 5H6QA 4GFBA 1RMU2 5ILUA 2VT2A 5LGNA 1OFSA 3DU5A 4BMBA 2PX9A 1HRI1 3RZLA 2L9SA 3NJVA 1IUYA 2YC4A 2BBVA 5AFBA 2FU4A 2F5EA 2VMFA 3BPVA 3HC7A 4ZZ8A 3H9QA 5FYUA 1YFXA 4ABZA 3WHCA 2GMMA 2XASA 1F5TA 5L19A 2ORZA 4JDNA 3IWZA 4C3IJ 4L99A 3DEMA 3E5XA 2JG9A 5LA0A 4A3LJ 1JZ7A 3ZMVA 3D8CA 3FLRA 1H8TA 3M1EA 5BY5A 1LE8A 1UY4A 3B01A 1BI0A 3KSCA 2VT3A 5FYVA 4S05A 3DLLF 3N9QA 3VBSA 2R7XA 1C4RA 1LGBA 1Z67A 3ILNA 2CYYA 3DFGA 3QBQA 4P9LA 3ME2A 5DD8A 5KAIC 3I64A 4FI9A 2P3IA 2PHXA 3CCYA 3FBIB 3L2QA 1VQ8I 1PZ8A 2WT2A 3H50A 1IO2A 2VOKA 2WNVA 2DK8A 1VRH2 3IIAA 1BR2A 2AACA 1P7JA 1V00A 4ENJA 1CJPA 4HVRA 2R7TA 3PIPF 3GLLA 1PK6B 1RUD3 5CKMA 5FLXZ 2BNOA 1FIAA 1D5YA 2VW1A 2JDKA 5DQ0A 2OKXA 1VMJA 4KU8A 2JG8A 4KG0A 4HBLA 3BJ6A 3ES1A 4BU2A 4OULA 1XJAA 4F93B 5H20A 1OKOA 3AM2A 4O5VA 3VDBA 2ZFWA 4F3JA 3CP2A 3E6MA 5DG1A 1V9U2 2CWSA 3FMSA 3ULQB 1MS3A 4LBQB 4QX5A 3OYJA 1CGPA 1W28A 2WAOA 3WNPA 3GBWA 4S2FA 4HNUA 5CPRB 2A6XA 2WO7A 3I0TA 2ZA9A 3M3IA 2LFBA 2ZNZA 1YQ6A 1DGRM 1JW6A 2IXHA 4DUVA 4BCUA 3JZVA 5T3NA 3W9AA 1EH8A 3MF9A 1H9TA 4LIVA 5A7WA 3U9GA 2OQ6A 3DKQA 2DAOA 3FL7A 4CDUA 1ND3A 2LW8A 3ZR5A 4Q8KA 2NP0A 4M6XA 3PNYA 5DDGA 4YIRX 1RRJA 4LLNA 2K4JA 3FKIJ 2V5YA 1KEXA 3GMEA 4JAAA 5KXCA 1X3WB 3PTYA 3EUHC 4XRSG 2X1CA 3WQBA 3GXOA 4E4ZA 1OQEA 1HIXA 4ZTFA 5FD6A 1JGSA 4FTEA 4EWEA 5JOYA 2WL1A 5D8AC 3RDIA 4CEYA 3K4ZA 4P5OA 3J80K 4HNTA 4K1ZA 1TNTA 5BPDA 3WDUA 3S3NA 4A3DJ 2J5PA 4KU7A 3LQQA 1PIV3 3WTWC 3SISA 5CVJA 2OXBA 5HODA 2E26A 3O14A 2YU9J 3S5AA 3Q0WA 4A69C 3S16J 1ZZBA 1ZZCA 1KITA 4XUPA 1WCDJ 1BW5A 3POBA 1W36D 5D4RA 3DF8A 2EK5A 3C7HA 3VB2A 3OS1A 3DXUA 1W8UA 1PVC1 1W9FA 2JXAA 1VFCA 5JLVA 4H2AA 4Y20A 4YG6A 2JDHA 2WTEA 5JVGF 4U0WA 4A3EJ 4PLOA 3EPZA 4D7NA 3M3EA 5EGOB 3BCAA 5JLWA 5JXGA 4BXSV 3GBFA 3U1DA 3WW1A 2RGVA 2VUJA 1NZCA 1Y0UA 1IS4A 3SXYA 4M0HA 2HVRA 3OOPA 3L2CA 1N3PA 3EJKA 4LULA 2HDDA 2G9WA 2QQOA 3S1QJ 2VQUA 3BPXA 5HS9A 4WV8A 1PUEE 4XFFA 5FMOL 3HIFA 2QDNA 1IXRC 2BU9A 3T3YA 4JGZC 5JI6A 1ULOA 5CJ9A 5JSOA 1UYZA 3M3CA 2EVXA 4B1MA 1E2XA 4UFHA 4UWDA 1NLRA 4KT5C 1ULGA 1U5ZA 5T5JA 5D5WB 1Y7BA 3ZXAC 2OW4A 1D4M2 4Q0QA 2X6XA 2ZZJA 2P17A 3OGSA 4IQ4A 5ILSA 1DGRN 2X5IA 2LVSA 4E4HA 4CU6A 1FTZA 1Y1WJ 3G4SI 2R7VA 5FB2A 2IFRA 4PDWC 3LE0A 5JR7B 5KCMA 2AEZA 3TO6A 3VSKA 3VL9A 1MBKA 4IEXA 4XW3A 4QM9A 1VQ9I 3WCSA 5DDJ2 1U3EM 2YUEA 2DCKA 3RG0A 2Z79A 3USUA 5DAWA 5K7FA 1QY4A 2ARXA 5K0UC 3NWTA 4OI0A 1FYUA 1MH3A 1QDCA 2ZGRA 1WW4A 2EIDA 4JYKA 2J22A 3DYMA 1Y43B 4HZFA 2OU2A 1I3QJ 3S93A 2ZO4A 4J1WA 2H8RA 3CCRI 4XLHA 4XNFA 5KK1A 5L36A 4YGBA 2QGUA 1RUH2 5M5XJ 4PDKA 3P7NA 4B7KA 3KLNA 1W8HA 5FY8A 4KA4A 3PO2J 4AVVA 1R093 2UZKA 2KLOA 1QJEA 1YI9A 3VD7A 5FPAA 2HWC2 1UCXA 3ZOIA 3TKYA 1CPNA 4LBNA 2FNAA 5I0RA 3T0AA 4MXWB 4U88A 4WZFA 5B4XA 3I2DA 2GMEA 3HRMA 4QKBA 1HSTA 4RA0A 1D0ZA 5L7OB 1USTA 2HWD3 4NHKA 1KQ0A 3I4IA 5KHKA 5KXDA 4Z1VA 3WGGA 2E6VA 2DUPA 4CE8A 1OSGA 2LY2A 3G2BA 1OLMA 4NAMA 4HSTA 1QU0A 1S8NA 4BEHB 1WCKA 5FZBA 1FMD1 3J8F1 1UG0A 1U5YA 2VODA 2R072 4BISA 1MS4A 2E2JJ 4IF4A 1S1AA 2O3FA 2P0WA 2X29A 1T33A 5HLIA 1WH5A 4Y15A 2VTXA 1TG7A 3DPRC 2R93J 1MBGA 4PBPA 4IL7A 5FK7A 4XLEA 3ZQQA 4ZU7A 2B42B 1BK1A 5JSPA 2FX0A 2WQ8A 1EP0A 2OPTA 3TEXA 1U5XA 2YBPA 4QWNA 2WT1A 1HRI2 4ES8A 2FUG2 3WG9A 3BIEA 3O1UA 4YZ1A 4IKFA 1F35A 3O1SA 2QNKA 2CU7A 4MLOA 3H1WA 4FE4A 5ACA1 1CX4A 3AMNA 3OYAA 3S6PA 4BM8A 3BC8A 2Z33A 4FOVA 1BL0A 1W8FA 1W9SA 5KHHA 1MS9A 5EIYB 1I1GA 4HPQA 1W7PA 4L9TA 1C8NA 1VRH3 3ONQA 4BHPA 2WAQA 3AG2H 3TAYA 4YIFA 3AJZA 3OBAA 1DGWY 2UV1A 5TRDA 2M0MA 4Q4X1 1ETYA 4OHXA 5A1LA 1ETXA 1NLQA 1W6QA 2COMA 4A42A 5ERLA 1OOPA 4D5FA 4FT8A 2VKDA 1XNBA 3R4DB 5J1XA 1T0FC 2CW0F 4LK7A 3D5LA 3TWIA 1K42A 1YIJI 2ZNYA 1O5UA 2V1XA 1FX5A 5BNOB 4G6QA 2KPMA 4N53C 2K9MA 2RAEA 4M00A 2W3JA 1WW5A 4KBBA 2CH0A 2Y26A 4XUOA 2D7FA 1WW7A 2EINH 2UY9A 2ZXIA 1ORKA 1NH3A 3W58A 1D0HA 1MKMA 4B3XA 1KYZA 3C2BA 1HV1A 2YX4A 1JUSA 2R16A 3EO6A 1XQNA 2VMGA 1ZZ9A 2RJKA 4QPOA 1T6SA 3FDYA 1UMQA 1RUI3 4IV3A 1MR5A 4I09A 1J75A 1UIJA 2VW2A 3N9OA 2HOTA 2QBXA 5CVUA 1MMSA 2AZ5A 1Y39A 3T2PA 3BU0A 3HUGA 3WZ1A 5IT3A 5DG2A 4EN7B 4ONUA 4U0VA 2GZWA 4FE7A 3J7ZI 3I71A 4NC8A 2STWA 5L3DA 5GLVA 3HT2A 1QDOA 1JXNA 2WWUA 2IVJA 3ZGKA 1K6OA 2K5CA 3CBNA 3IHUA 4EN0A 4A6EA 4K40A 1F43A 1F4HA 4DPNA 3N7LA 1LESA 3R6SA 1XPXA 5H9RA 3KP6A 1AYM1 2PBIA 3GCWA 3KLOA 2LSOA 2W95A 1BXHA 5D1IA 4XF9A 2ZEWA 4AHYA 3BIWE 5E1XA 2RVAA 5EZHA 2MFZA 5FO7B 4IL6C 1ENQA 3MIEA 2BY3A 2ETHA 3LSKA 2VMEA 4EM1A 3LSPA 1QNWA 1LEBA 1JUHA 3M2MA 5EF6A 1WLDA 2DVAA 2MD5A 1QEXA 1B4AA 2F2EA 3KCXA 3C1DA 1ASJ1 3KQRA 2KRCA 3ES4A 4MGZE 3PHMA 4CCCA 4OCTA 4UB8C 4JK1X 2B8MA 1PVC2 2GXGA 4EE2A 3SCHA 4NAOA 3O8HA 3F95A 1SFNA 4DINB 4AF9A 1HC8A 2CQ7A 1FJLA 4HSLA 2TDXA 5IYBJ 3RZGA 3BYWA 2ELHA 2ARCA 3I59A 4ZONA 2H8WA 3WLUA 3HKZA 3LOBA 2OAZA 2P4EA 2DVBA 5C71A 4N8MA 1D0YA 3CF6E 3JRDA 3QOPA 2DOFA 2NS7A 1OR7A 4HAMA 4LK6A 2XGXA 3ECHA 1DGWA 1V4RA 1HX6A 1GOHA 2AGSA 2KQRA 3FXOA 4ZDPA 1LDDA 4PCQA 5AIQA 5KBFA 3RYRA 2R7SA 5DCMB 1AA7A 1Y1VJ 4M3DA 2WJSA 3HL2A 1LOEA 4IHSA 4YW3A 3C3VA 4QAWA 1CF7A 2KA3A 4RGGA 2EFOA 5IWFA 3M7GA 1AXZA 4U7BA 2K0GA 2HBTA 4YFWA 4HK9A 1TNRA 4HRIA 3KP7A 3K4CA 1B8IA 2RS53 4G6TB 4Y52J 4BGDA 2CL2A 1R64A 4MHUA 1LOAA 3ZLIA 3QU3A 3OSGA 2CDOA 4B4PA 5HI0A 4MTDA 4PZJA 2DYRH 3KT7A 1ZG1A 2W84A 2RR11 1BBYA 1T08B 3EQLF 2EH3A 4M9ZA 3LA7A 1OCZH 1DQ0A 2Q1MA 2V26A 1H8AC 4XF0A 4XTPA 3QYFA 1Z7LA 5GLTA 2R0QC 3RZOJ 3OYNA 4RSUA 5LBFA 5D8AA 2EAAA 3DF0A 4RB0A 2UY8A 2KRHA 4XORA 4R9AA 1HQWA 2WO1A 4HLYA 1J09A 4YFXF 2LM3A 4JRAA 5D21A 4CDQC 1DLLA 2DYCA 4R4XA 3WF4A 4K20A 3M4OJ 5CLSA 1PO11 1ETVA 2RHPA 3H8XA 2PXJA 1K5MB 3PU8A 5FUPA 5IVJA 5KNLA 4GRIA 3DPTA 4FPCA 1VQOI 5CKNA 3ZXJA 2VOOA 1JYNA 5E8GA 2OT7A 2UXXA 2DW4A 3ILRA 5F5QA 4LK1F 1T95A 2NVYJ 1UZZA 3TEZA 1KQ9A 1IS3A 1IKQA 1YS6A 3R0JA 4HF0A 2XUMA 3WV6A 1FMD2 2H0VA 5LWBA 4IHWA 5KWRA 4TWTA 5FFOC 4P96A 4KMQA 4QX0A 4IQJA 4XUQA 1DZRA 3PL8A 3LSIA 2LF8A 2A69F 1D0GA 3AMPA 3VWBA 4N7UA 3I2IA 1TQPA 3BN6A 1MGTA 3VZJA 2VMDA 4FPKA 2QFEA 1P4XA 5LLQA 3POSA 3A2KA 4P9YA 5JHFA 3F72A 3UJQA 1ODNA 1IQDC 3RJPA 3AZYA 1SACA 3LFMA 1W2AX 2VJ4A 3OEBA 5ACA2 3T2OA 3AYCA 5DPNA 2NRAC 4AVAA 4E8DA 4OMYA 1UELB 3V8JA 1YJNI 1C28A 3PJYA 2HOEA 2RQQA 4IRIA 1DQUA 3OB8A 3THDA 3D0JA 1RL3A 5JDBA 5F6KA 4MGKE 3IMNA 4N43A 2GM4A 2VUDA 2XL7A 4Q4X2 1SANA 3PFYA 4N4NB 3K0LA 4BAYA 3ZX7A 3WF1A 4CYDA 4YM1A 3LPFA 4G6DA 4AHZA 1IDYA 2ZMKA 2EFQA 4A3MJ 2L0KA 3QPSA 2ELJA 2O9LA 3LGRA 3ZVXA 2VKHA 3FMRA 1JT6A 2K9QA 2YBKA 4GULA 3I2KA 2HTJA 1HB4A 1MQTB 3VYSB 5M5WJ 4KIGA 3RI8A 3AKPA 2O8KA 5BNPB 4XLNF 3E0JB 3GVAA 3S1MJ 3ABMH 1XSQA 5DXDA 2GWRA 2QTWB 4WX9A 3BKZA 4EQVA 1SEUA 4PF1A 1KONA 4YFZA 2JVHA 2LF7A 3J7AO 4RLFA 2BOIA 3P1IA 5DZFA 3WG1A 1NA1B 3EUAA 3CLOA 3VBRC 4AI3A 3U4SA 4BJ5C 3HOXJ 3GZUC 1UJ8A 3LFIA 3BTIA 5A7QA 2E51A 3SXWA 1P6RA 2Y0MA 1HOMA 1MACA 3PVBB 4KMUX 4M9XA 3Q8FA 5BNGA 2MLKA 2XDVA 4LO7A 1B1BA 2D6KA 5L9BA 1VNDA 3ZXLA 1VZ0A 3LSRA 5EG0A 3TEDA 2FNPA 1H8VA 4EZHA 2KR2A 1SFKA 2G7HA 2CUFA 3FF5A 3DPRA 2D2WA 4HN0A 5DUVA 5GZFA 4OYUA 4LLOA 4TV7A 3BG6A 2EAKA 2I10A 5J37A 4LXLA 3HRUA 4HPKA 2W39A 4CUCA 4YRDA 2KJBA 4AI0A 4Q26A 3W2WA 2WS91 2LBFA 2CO5A 1QKQA 1AYM2 2PJRA 1PVC3 1O59A 2GLOA 4AQ2A 1HXDA 2RJLA 3H3VK 1GLHA 2DFHA 5EFUA 3FHQA 1I5ZA 1BKZA 3FXQA 2RC4A 5A80A 3RSNA 3HPGA 4G8XA 3VBHC 1ETWA 4YGCA 3BR2A 4A3JJ 4XOPA 2VQHA 4AUXA 1N1VA 2A6HF 4FPGA 4AEDB 3WW3A 1W5SA 4QB1A 1JKQC 3ZYBA 1ASJ2 1OA3A 1DDNA 5DUIA 2WWJA 1KDMA 3NWSA 3KGLA 5HNHA 4FP2A 4YVSA 1X82A 3NO8A 4HDVA 1XSVA 4Q47A 1K6YA 3K51A 3RQ0A 4Y1YA 1WHUA 3J26N 1LFPA 1T0FA 3IB3A 3M07A 1BR4A 3S3OA 2BGPA 4GXLA 1IC8A 3WF2A 2BNMA 3CD6I 3ZQIA 2FDKA 3TBDA 3QH6A 4QB2A 4RQPC 1YG2A 4UUVA 2DWRA 2FBEA 1MSEC 2O5RA 3LSGA 2BW8A 2XKOA 1D0XA 2DO7A 1NCQB 1QOOA 1ND2B 3VBOC 2FQ4A 5CQEA 5M3FJ 3HJRA 2K40A 4XE9A 4BPZA 1YJKA 1RUJ1 1H2NA 3CJIA 1N1TA 2N7GA 5FZ0A 1FOD1 3UT0A 1BBT3 1BK0A 1S0CA 2ZCWA 4ARXA 4W6WA 4RB2C 4RA2A 2G7UA 2ZMNA 4NIDA 4EJUA 1YEWA 1WI9A 4L0YB 4TLGA 3B02A 4AYBA 3AMHA 4Y5Z0 1QJY3 2DMTA 4WVWA 5FV3A 5LASA 3LQRA 3R4SA 1ACCA 3ZDVA 2CS3A 4GWNA 2IJLA 3TN91 1OXCA 1TL8A 1G59A 1UPSA 2DJIA 5I8SA 1TZOA 4HLTA 3S8PA 2AR6A 3DP7A 2LKSA 1AX0A 4EGZA 5FKNA 2ME6A 2VH9A 2RR12 4CCDA 3N9LA 5FZAA 5D5UB 2BFUS 4XBNA 4O3MA 3B5LB 4WBBA 2HQRA 5CG9A 4COZA 1SLAA 5FWJA 3V64A 1MMAA 5E88A 4FETA 2IA0A 2DTWA 4IQPA 4K8RB 5AVPA 2IAIA 2L2OA 4NROA 2RV8A 2IGOA 3THTA 3L00A 2HR3A 4A0YA 2OPKA 2PLV3 2MEV3 1OVPA 4QDRA 3MKYB 4Y33A 1CAUB 1PO12 3BG5A 1XMAA 4RR3A 1CAXA 4MEYF 1GT0C 4DXSA 3L2VA 2JA7J 1BA5A 5JR3A 4ES9A 2Y75A 1AR93 1UOJA 3W2VA 5H9PA 2RKHA 4BYYA 2WAQN 3WE2A 3VLBB 1V6OA 1XN7A 4Q0UA 2VCBA 4K6BA 4NQWA 3S32A 1XC5A 1ONVA 2J1TA 2EV0A 2IS1A 3T2QA 1VIWB 2M7AA 2D44A 1J84A 5KHIA 4MH0E 2CRGA 2BV4A 3L7WA 1F31A 2NXNB 5EPAA 5DV5A 3OGRA 5F3IA 2Q1FA 1NQDA 2AYHA 2B39A 3ORJA 3NV2A 4RS8A 1U5TB 2K3FA 3EHKA 2P6CA 3WHUA 1GYKA 5DAQA 1GZWB 2CUJA 4MO7A 4GA9A 3LOCA 2TUNA 2XUBA 2E1OA 2Y60A 1AHSA 3UESA 2R7OA 5A6ZA 2B4KA 1R9TJ 3PQKA 4J19A 4AL9A 1GANA 2GDFA 2MW8A 1QQIA 4BQ4A 5A33A 2OC6A 2JD9A 4WVMB 4J00A 5C4WC 4I30A 2W00A 3WTVC 1JGGA 2YYOA 1B9MA 1R00A 4RGXA 2GC0A 1S6LA 4UVCA 4AOCA 4IV1A 2DYSH 3BUCA 1R1A3 4YYOA 2WFF1 2ZX2A 3W6JB 1XNAA 1RKTA 3ZMSA 1R1VA 3AKZA 4M73A 1FOXA 2R1DA 2CGNA 1H88C 1XYPA 1QF3A 4L5EA 4DIQA 3ABZA 1LU2A 2R92J 2Q8KA 3JAMK 1YQAA 2VCCA 3T1MA 3RWNA 1B6AA 1JT0A 2CQXA 3VYTB 3NRVA 3F22A 3GTMJ 1JUPA 2ZAHA 2HH9A 1W04A 3SZPA 3JD73 4FPOB 3D5OA 3AG4H 2V79A 3WTSC 3B93A 5ANNA 4LD5A 5A2QK 3CNAA 1WWYA 5GJ6A 2LUWA 1VJ2A 1WLCA 3BT9A 1IW7F 4A6DA 2RM23 4MHRA 2JB4A 4CCJA 3MV11 4QQLA 4EJRA 5CBLA 4XK4A 1NQJA 4B3NA 1HXS1 4CP9B 3A0HC 3A01A 1VB2A 3T2TA 1KYWA 2F5FA 2JPBA 1JOJA 1W6NA 4XRFA 4ZC3A 5JZGA 1OYYA 1JZ5A 3AKQA 5EJZB 1PK6C 4XF3A 4ENMA 2VBXA 1FSEA 1IG3A 2HWE2 1G9BA 4BHBA 1SLIA 2E1MC 3ZXFA 5J96B 4QHOA 2YMZA 1JUMA 2P7CB 3SLIA 3OYKA 3FHZA 3N4MA 2I45A 2J1RA 4HN1A 4CYCB 2XAHA 3I2FA 3HPNA 1HLCA 2JK3A 4LQRA 4Q4W1 4OFGA 2P6HA 2NN8A 2KRFA 2ZOEB 3FXLA 3EYYA 1JZ3A 3K3OA 2Z16A 3KS7A 5CA6A 1W8NA 4KBZA 5ANQA 2XJRA 3VGIA 2ZGSA 5LK5A 3O1MA 1STMA 3WNXA 1VPHA 4EJOA 1NE6A 4P9IA 3HMYA 5F5CA 1SFYA 1VF9A 4OAZA 1UU5A 5FJKA 5DMYA 2BQPA 3K69A 2EIMH 4MO3M 5FPBA 2WS92 4LKEA 4FQZA 4MOAA 1OUXA 3ZIXA 2A6TA 3IDEA 4DXZA 2E71A 4ASLA 1JYIA 1UN1A 2IXSA 1YHFA 4HF2A 2W91A 1ZLJA 5C9AA 1RJ8A 2OZ6A 4RDUA 3AVRA 4M3CE 3CIHA 1ZREA 3I55I 1WLTA 1MZ6A 1QGLA 2V6CA 2ZMEA 2ISZA 2P3YA 1BIBA 1NZIA 1RUC1 3KYLA 4MGTA 4IERA 5KXEA 1CQ9A 3I8TA 2PHFA 1X33A 4RBOA 1OUSA 3OBRA 2ID6A 3ZYHA 4AVPA 2QZ8A 5DUXA 2WNUC 3RS6A 3ST7A 2NS8A 4QM8A 4E70A 1FP1D 3H5NA 2LRPA 1ZQ3P 1CAVB 3WR0A 2QQPA 1I27A 4WVVA 1VP6A 1J2XA 3PUHA 1RVF3 3K1PA 5I8TA 5CFCB 3FLPA 1SPPB 2W24A 4LE3A 1WJ5A 3OV8A 4JTNA 3KV4A 2WQZC 3OY8B 4IE0A 3IH3A 5IVYA 1RHI1 2Y0SA 2B9VA 3LL7A 3I3EA 2OUMA 2FHRA 4ZU5A 1LU1A 1JH5A 5T5PA 1MEC2 3K4DA 2R7FA 4CSWA 3VKNA 2EIKH 4MG2A 3LQCA 2ECCA 1RUJ2 2HKXA 3SHFA 3I3BA 1W0UA 4AWXB 1BN5A 4CU8A 1FOD2 2HWB1 2Y34A 2EXJA