1CGPA

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
b'PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*A
molecule tags Transcription/dna
publication title Crystal structure of a CAP-DNA complex: the DNA is bent by 90 degrees.
pubmed rcsb
total genus 59
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cgpA01
1D5VA 4RB3C 2PMHA 5JSPA 2CO5A 1U5TC 3C7JA 2A07F 2MPFA 2VC0A 3ROUA 2DPUA 1RL3A 1EH6A 5KHGA 2Q0OA 2QLZA 3AAFA 1Z91A 1OPCA 5LBQA 1UIKA 2W25A 5IT9K 2Y48A 3P9CA 3MEXA 3RYRA 4CXFA 4OOIA 3IBMA 3FE5A 1J0RA 4XSZF 2E7XA 5I8YA 4META 3NJZA 4WXCA 2XAFA 2PAKA 4U0VA 1TW3A 5LRRA 4RS8A 3UKNA 1I6XA 3TOAA 4XF9A 1UHWA 4PZJA 1YFHA 1UW8A 4AD9A 2OA4A 1MD0A 4U7BA 4NHJA 3LOIA 5EZWA 4M9XA 4Q48A 1GHCA 5D8LB 4Y17A 3ABTA 3M3IA 3MFKA 2IXIA 1UHMA 4IPAA 1ZZCA 2OU2A 4EJVA 4EROA 2CAVA 2COMA 2RC4A 3BU7A 2DCTA 3KSCA 1MDMB 3LA7A 1SD5A 1P6RA 3L00A 5DCMB 1E2XA 2F2EA 2M1BA 2OAZA 5DYMA 2G7UA 2M30A 4BHBA 1MJAA 1U12A 1LRHA 2XAGA 2HQRA 3HQXA 2P7VB 4YIIA 3O2PE 2EV0A 1ZH5A 2QYOA 4WVZA 3J80Z 1FBSA 2QBYA 4YFXF 3HRTA 2RKHA 1JHFA 3ACLA 4XF1A 4FT8A 3DPTA 3NQOA 4M6YA 2J5OA 5HOOA 1ODDA 5H6RA 1I5ZA 2GXGA 1USSA 2Y0MA 1ON2A 3NL1A 2STTA 2Z3YA 2DO7A 1IXCA 1KQ8A 4S04A 5ICCA 4LK0F 4I09A 4MQVA 2B0LA 3M8EA 3E6MA 4WXHA 4IEWA 3HOTA 3F8BA 3R60A 2YPRA 3CUOA 2RDPA 3VHRA 2Y0OA 2KIUA 4UVCA 1KA8A 1MJ9A 2MNGA 4HLXA 3GUDA 2JTVA 4YG2F 5CVVA 3F3XA 3GFJA 3CO2A 3R6SA 1TLHB 4IEQA 4OLLA 4RB0A 3MWMA 2HFHA 5JVTA 1IN5A 1K7AA 3TQNA 3EHKA 3GO5A 1PP8F 2IXHA 3SHFA 4EJUA 3S2WA 3ULQB 1IZ1A 2BBYA 4JK1X 1BIAA 1ZAOA 1O7LA 1RNLA 4QLCU 4K2EA 1IRGA 2V6CA 5I0RA 3BJOA 3DFGA 5DD4A 3CUQA 3QAHA 1H9GA 1XSVA 3FMQA 4IEYA 4HYEA 3I71A 3JZVA 3RKYA 3O6BB 4KWLA 1F1ZA 4KU7A 2UY9A 5AONA 2W57A 2O3FA 2PFWA 2R7FA 2HGCA 2ADUA 3NW4A 4ENNA 4Q29A 3HTSB 2L3DA 3PNAA 3FM5A 1HKTA 3EUHA 2E1NA 2NS0A 1JGSA 4XFBA 2AS5F 1I1SA 3KETA 3F8NA 3K1MA 1HQCA 4LB6B 2EA7A 1P4WA 1CF7A 4R1HA 3JW4A 3FHIB 3HSRA 5D1IA 4LJZF 3WODF 3HRUA 4EWAA 2EVXA 1YW8A 3TKYA 5FD5A 3NRVA 1V3FA 2A69F 3LA3A 1J9IA 4JTNA 5BV6A 4L18B 2C6YA 4QX5A 4RAZA 3RDIA 3LQQA 2QBYB 1NYWA 2O8XA 1CAVA 2XVCA 1SFEA 4KYWA 4Y15A 1YLFA 3MAJA 1FYLA 3ABUA 3FZVA 2CSOA 4BYYA 5C8WA 4MHGA 5E20A 2K02A 4PGHA 3RPUA 4IJAA 1SFXA 2XAJA 3KP7A 4HVQA 1SD6A 2ACJA 2K86A 6PAXA 4XRFA 3KEOA 4A0YA 2EA2A 4QGNA 1T39A 2XLGA 5DUKA 3OOPA 2XLAA 4EWEA 2O6GE 4M74A 5FPZA 4RGSA 4CO8A 1FXZA 4G8XA 1YWKA 3HT1A 1LEBA 1CAWB 4OIOF 4P9GA 1SAXA 2P6TA 2Q2EA 3KZZA 1G3TA 3I59B 3B02A 3HIFA 4D7TA 4ESFA 4KIGA 2OZ6A 5I0SA 3KFWX 3R61A 5DV5A 3SCHA 2A5YB 4HLTA 2L4AA 4WBBA 2VOOA 2OPKA 2D40A 1FBUA 3IKVA 4MGRA 5E17F 1MGTA 4N9IA 2GH2A 2BE5F 5KHJA 4L0ZB 4HF1A 2MH2A 1WA4A 4O9EA 1FP1D 1KYWA 4CZZA 2YX4A 4GYGA 4M71A 4LA3A 2EV5A 1HBXG 4KDPA 2GC0A 5FCCA 1J5YA 4RB2C 2P5LC 2OBPA 3SXWA 2Q1ZB 3LWCA 2K7LA 1J3PA 4M6XA 4MTDA 2Z99A 5KVRA 4LTAA 2RV8A 1TBXA 2WFPA 1OYWA 2IA0A 2VPVA 3IDCB 1K79A 2QCSB 4GGGA 2M5WA 2YX7A 2FOKA 1C0WA 4MGZE 1H0MA 1CX4A 5DCMA 4NB5A 2CFXA 5KBFA 3C1DA 4A2UA 1R58A 1GVJA 1KQ9A 4MH0E 3BALA 2V1XA 3DQVC 4BHCA 2PBIA 1BC7C 3GVAA 4BHPA 4U88A 2OYZA 3KMHA 3HRSA 1LNWA 1FC3A 2IVMA 3DXJF 1X8MA 4G7HF 1FT9A 2KRFA 3RNSA 2J5PA 5D5XB 4DNCA 4ZU4A 3CL1A 3CLOA 1ZG3A 4HW0A 4MGIE 2MH9A 4HBLA 2ZCWA 1J75A 1KU9A 3WGIA 3BWGA 5BMZA 3ZPLA 5D5VB 4JV4A 3WW2A 4XFGA 5I8SA 3G3ZA 4ZYEA 2STWA 4CHUA 1J2XA 3FX3A 4D7SA 1OD5A 3REOA 1FP2A 2HYGD 5L3GA 4EM0B 3OV8A 4HX4A 5ED4A 1H1MA 4XFCA 4BH9A 2F4PA 3EQLF 3VFZA 3ST7A 4P96A 1R23A 3WTUC 1EY2A 1XGMA 3BB6A 5KHHA 2L02A 1YYVA 1E17A 1O3TA 3KGZA 1LKNA 3FM3A 4LGWA 1G3YA 4AWXB 4I01A 3H92A 1S7AA 4WZCA 3F22A 3M70A 1BC8C 3MZHA 4PCQA 3KP4A 1A04A 1QXRA 1IUYA 3HTUA 2DW4A 3BJ6A 1FLIA 5KHKA 2IT0A 2FF4A 1QWRA 5CVIA 2V79A 4IRHA 4MQ9F 2VQAA 3WTVC 2HR3A 2HZTA 4CDGA 4YFNF 2LDUA 2AXLA 4L9VA 4PDKA 4FBFA 5J3UA 2QWWA 2CW0F 3GX4X 1STZA 4IF4A 2DBBA 5E18F 5FD6A 5CVUA 4A6DA 1NE4A 3IWFA 3C3VA 2Y75A 1DGRA 4KWJA 3GFLA 1JE8A 5TRDA 4ORFA 4PIXA 4LMYA 4BXUA 1FYMA 3DPLC 2VECA 4QM9A 2DQLA 1X82A 3I7DA 4AQ2A 2GIVA 2DI3A 3V7SA 2Z69A 2CYYA 4HN1A 4Q0PA 4QM8A 1O3SA 2FQPA 2NNYA 4LUMA 4WK8F 3JSPA 4I98B 4BQAA 1XCBA 3SCGA 3K9TA 5I0TA 1QXJA 1WGPA 1UCRA 3LAJA 3TOBA 3FJSA 3ECOA 4LFUA 4QWQA 2GC3A 2IRFG 4XFFA 3D0JA 4L5JA 2F5EA 2PA7A 1R36A 3U11A 3TNQA 2DTRA 3E6CC 1RI7A 4OMZA 2RGVA 1G3SA 3ZMZA 2H09A 1FNNA 1G4DA 3V7CA 3GEZA 3F6VA 4UV8A 4AVAA 2PQQA 4ENJA 2B9UA 5FGMA 4N0BA 4ZU5A 4DINB 4A6EA 3H1MA 1J7KA 3CLPA 2A6HF 4X6RB 2B5HA 1XGNA 2UYAA 2IXKA 4QGMA 4UVBA 3ELKA 5FFZA 1S29A 2HTJA 3F72A 5TJJA 4AIJA 1FSEA 4LLLA 2O1QA 5T3NA 4LUKA 3N97A 4J1XA 1KQ0A 4KMFA 4MGYE 5BPDA 2HQNA 2NRAC 4I02A 2LNBA 1YS6A 5LHGA 2XL7A 2QUFA 4ENKA 1XMKA 3FF5A 5JR7B 1ZGAA 4B09A 2EFQA 5BQTA 1ZLKA 4O6JA 2IPQX 5K5RA 1ULYA 5ERIA 1YW9A 2GA1A 3RI4A 2EFNA 2L01A 2IA1A 4E2GA 1Y0UA 2IXCA 5I93A 2MLGA 1H9TA 1VJ2A 1EPZA 1J59A 3E5QA 3IIAA 4XLPF 4U7DA 2ZNZA 1S3JA 2XV4S 2DT5A 3D0SA 1EP0A 2PTMA 3ZP5A 2VODA 5HS8A 2GAUA 3ML6A 4I0AA 5AIPA 3DV8A 3ZMSA 4HAMA 4UVAA 1XSDA 4D0PA 2XROA 3LQRA 5FQ0A 4FX0A 5HI0A 5J7MA 2HEOA 1YO5C 1BI3A 1NZCA 2XL9A 4EM2A 4UXAA 3PLQA 3WGGA 4A5NA 1R5GA 3H50A 4ASNA 5DEQA 2K4JA 1X8EA 4B29A 1FBQA 2Z2SB 3TGNA 2MD5A 1LDDA 3R0JA 4X6QB 3H1YA 1XCVA 5LHIA 4ZZLA 2FSWA 5HVQC 4KWKA 1YS7A 3RKXA 2BEOA 4NQWA 2RN7A 5A2QK 4ZZDA 3BOQA 2O8QA 1PMIA 1QGPA 2XKOA 1WI9A 2EA4A 5D4RA 1IN7A 2EJRA 1R1VA 2RNJA 3FWEA 4PIYA 4HF2A 2FXAA 3GWZA 4GYIA 3I58A 3S0MA 1WWXA 1FSHA 2OA2A 4OINF 2PLYA 3KP5A 4HV6A 3TO9A 2R7DA 1Q43A 3HSEA 2PQ8A 5D8KB 3E6DA 3LAPA 4MGKE 1AOYA 2FMYA 5FPXA 3HUGA 4JBAA 3R0AA 3BP8A 2M45A 1PUEE 5HLHA 2XIGA 4G7OF 5E16A 3EETA 2PHDA 1FX7A 3OCPA 3F23A 4Q5SF 5CVJA 1EYBA 4KIBA 2KJCA 1T98A 2E7WA 2P8TA 1Z7UA 4RGXA 2OQGA 2JPBA 4LULA 4HQEA 1Z1DA 1FPQA 1BI2A 1W5SA 4WXDA 2QNKA 3SZPA 1QO0D 3I53A 3SHRA 1USTA 1QZZA 1YG2A 4OFGA 2FQ3A 2MC3A 4AVCA 2P6SA 1ZLJA 2PG4A 3KLOA 4Z07A 1YFWA 3RTRA 3ZDSA 1B4AA 2JRTA 3QRFF 3L9FA 3E97A 1R22A 1ZZBA 2GQQA 3OGJA 3ZMDA 1ZARA 2MA3A 1REPC 4Z2YA 4LG0A 3OF1A 1IPKA 1SMYF 3RPQA 5JCTA 4LK1F 3NSTA 4IHSA 3IWZA 1UCXA 2EK5A 5D5UB 2V1UA 1MZBA 2K4BA 3UKTA 3CUQB 5LRSA 2Z33A 4KT5C 1SD7A 5HLGA 1U78A 1W7PD 4Q47A 5A2QZ 2LF7A 3V8KA 1VP6A 3PFIA 2PYTA 1OKRA 1P4AA 4ZH4F 3M1EA 4IRIA 1Q1HA 1XB4A 5AVPA 4MEYF 1J1LA 4EJWA 3U1DA 4YFKF 4J1WA 4LG0B 2QVOA 4Q4ZF 1HSJA 5ILUA 4U0YA 1QBJA 3V4GA 1IXRC 4R8HA 4P9FA 3EBRA 5IT3A 4O5VA 1S6LA 3LAGA 4O3MA 3JSOA 2JZYA 4CGZA 4IESA 2D2WA 4Q0VA 3D82A 3HYIA 4QMAA 3HHHA 3V8LA 3JAMK 1U5TA 4YIFA 1SD4A 3E6BA 3K2ZA 3MCZA 1Z9CA 1GQGA 2XKPA 3WTYC 2B8MA 1F5TA 4IEXA 3QP6A 4FAHA 3JTGA 1YFXA 2CG4A 4XBFA 5FQ0B 5E1XA 4L9JA 5H20A 2O61A 1OI6A 3ZN1A 5LGUA 1L3JA 1ZZ8A 4L0YB 4XFHA 1Y3TA 2CAUA 4K8FA 4YYOA 1R1UA 1B9NA 4ZYGA 3GLXA 1KGSA 4ENMA 1ZNPA 1FY7A 1B9MA 4U0WA 1MKMA 2WC2A 1RIOH 5BXXA 2IC1A 2WV0A 3E5UA 3WU1B 3IL2A 4LLNA 3I0TA 5AIQA 1SFNA 5FB2A 2CQKA 3SQNA 4AVPA 4KICA 2X4HA 4KA4A 1TQMA 5EEGA 4CICA 2F5FA 5BOXA 2VBZA 2HOEA 3I5UA 2ZO4A 2PHLA 3OD0A 5LGTA 1K6OA 3KP6A 5E1RA 4IEUA 3UKVA 1X3UA 1YQAA 3RZZA 3SCFA 5H6QA 2PJPA 3CEWA 3C3WA 2KKOA 2DLLA 1F9NA 3P9KA 4E2QA 3WTTC 3KE2A 4DQ2A 1YTYA 1LQ1A 3MYXA 3M8FA 1ZRFA 5JSRA 3JAMZ 3R4KA 1W7PB 3BDDA 4LA2A 3V7RA 2IP2A 1TQ5A 3O14A 4KL1A 1D3YA 2ZKLA 3GW2A 2D1VA 2XAQA 1ZX5A 5CJ9A 3I54A 5E8IA 3FXRA 1RUOA 4L9NA 2RQPA 4HVRA 2HDCA 3BY6A 1CAXA 4GULA 1T38A 2GU9A 3ETQA 4UBGA 2IJLA 2YSRA 4M72A 2VOPA 1EV7A 1DDNA 5FLJA 4JQFA 2GC1A 1CF7B 1TTYA 3BPXA 4OMYA 3CO7C 5J8FA 4HV5A 3W6JB 1PP7U 5K5QA 4KU8A 2X0LA 1LB2A 2ESNA 5J48A 1UFMA 1DGWA 1BIBA 5JSOA 4M73A 2D1HA 3H3ZA 4UHTA 1UIJA 5F6FA 4PIZA 4A5MA 4S05A 3CO6C 2PEXA 3P7NA 4BAYA 3I4PA 1DPUA 2VONA 4P9UA 2P5VA 1FWZA 3BZ6A 3KP3A 4OIRF 3U2RA 4KFCA 4EV0A 2MLKA 4XSXF 3V8JA 4AIHA 4Y13A 4MV2A 2EFPA 3RYPA 1T0FA 2OZJA 2E9QA 1TNTA 4RAYA 5KHIA 3NVCA 2CV6A 3KEQA 4EJOA 4RB1A 5I91A 2DAOA 4EQQA 3N4MA 5J6XA 4A12A 3VOEA 2UWMA 4YARA 3T0YA 4EJTA 2UXNA 2E1CA 2OQRA 4KNYA 1OMIA 2ET1A 4ETSA 1SFUA 2IXLA 1GXQA 4XFAA 1IPJA 1HKQA 2PAMA 2Q30A 4I0BA 4AXOA 4H7LA 2DU9A 5E8GA 2W24A 1EH7A 3LA2A 2JT1A 1TQPA 5EEHA 2BNOA 1YFYA 4LB5A 3KGLA 1RGSA 1WQ2A 1RUNA 4FAGA 2KXLA 3WW1A 4YSFA 2VBWA 3IDBB 3EYIA 4HN0A 1GXPA 1ZZ7A 1CAXB 2D5FA 4LLGF 2QQBA 1ZG5A 3J81K 2D5HA 2ZBKA 4FX4A 3HOSA 4HX8A 3HRMA 3F8MA 1TW2A 4E70A 1I1GA 3QU3A 2I45A 4PJYA 1MJBA 1BI0A 4JVAA 2EFOA 4IHTA 5LLQA 2GA2A 3H9AA 4WX9A 2BYVE 3QPTA 5L3EA 3VEPA 2ETHA 2H94A 2H6CA 1LJ9A 1IAWA 3FHZA 1XSXA 3GXOA 5FLXK 2OZUA 1OFNA 1V4RA 3QP5A 3HSFA 1QZYA 1DP7P 2KIMA 1CAWA 3K1PA 4HBNA 3BPZA 2Z9OA 1ZZ6A 1O7FA 4I7HA 1CGPA 5FLHA 3WTZA 5BUVA 1ZVFA 4RGUA 3TNPB 5BY5A 4HA8A 1U8RA 4ESBA 1O5LA 1ZRRA 2D93A 2LKPA 2R3SA 3B73A 2P17A 1OYIA 2G9WA 2QZ8A 2ZFWA 1IW7F 3EYYA 2UZKA 1QQIA 1RTVA 1HSTA 5LEJA 4IEPA 2HKXA 3SXYA 2V1DA 4JTOA 2MHFA 1FZPB 1ZZ9A 2FMLA 2EB7A 3WGHA 2Z5UA 4IETA 2BGCA 4UNOA 5L3DA 1NXMA 1Z05A 3PVBB 4LLOA 4R79A 2KJBA 3WTWC 3M9AA 4GCVA 3L2HA 3CJNA 3FMRA 5LGNA 2DFIA 1H1IA 4HOBA 4O9GA 3WE2A 3TO7A 1SQ4A 2EFWA 3C18A 5KK1A 2BNMA 4RGRA 3K69A 2Q8KA 4EMSA 4HZFA 3K1NA 3H7JA 5C6CA 4OIPF 1QPMA 2F5DA 2VN2A 2IW5A 1YW7A 2FBIA 5CLSA 5FFXA 5JR3A 1YUDA 1RC6A 2ZMEA 3RIRA 2RVCA 3FZ3A 1S8NA 1LR5A 2Q0AA 4KIFA 3H1WA 3QOPA 4HX7A 3M7GA 3S7IA 3DL3A 4Q0SA 1XRUA 1I27A 2NYXA 3RJPA 2ISZA 2N7GA 2ISYA 5IT9Z 2QM3A 4HDVA 2GXBA 3G73A 4BNCA 5HDGA 1O4TA 1BBYA 1LDJA 5J8CA 5CYVA 3ZQ7A 4HSJA 2VE9A 4MEXF 5FDBA 4G6DA 5DUIA 1UD1A 1XGSA 5ICEA 1NE6A 2VBYA 2DQRA 1J3RA 4EVIA 3F8CA 2GWRA 1ZRDA 4L11A 2K9ZA 5JAXA 5JHUA 2HKOA 3EJKA 2EV6A 4M9SA 2XHKA 5D4SA 1PDNC 3E3VA 3WE3A 4F7ZA 2GZWA 3VB2A 3RYKA 4YNIA 2F5CA 3GZ5A 3Q9VA 1FOKA 2XLFA 4EGYA 1OYYA 1P92A 2BV6A 3WU0A 2M8EA 2ZXJA 1KYZA 3H8UA 3U9GA 1KU7A 1W4MA 4NVPA 1D8JA 3DP7A 3O3KA 4HVOA 3F8FA 2FA5A 3LSTA 3T8RA 2FE3A 1YFUA 1ONVA 4ON0A 5ILVA 2IA2A 1HW1A 2JPCA 2OD5A 4I2OA 1R1TA 4HMZA 2CWEA 4RD7A 2Q4SA 2L54A 2UYBA 4UXNA 3DKWA 1B59A 4IERA 2QQ9A 1DZRA 2DK8A 3WG9A 1YIOA 2HS5A 1KU2A 2D45A 3LZZA 4WWCA 5LEKA 2O03A 1X7NA 4QGLA 5DCFA 2PN6A 3ZMTA 5DDGA 3SZTA 1YHFA 2W85A 3FXUA 4G9YA 1CAVB 4IVNA 3DN7A 4A0ZA 3EDPA 4XEZA 2IXJA 4TV7A 5HDNA 4IXAA 5DD8A 5HS7A 3EQEA 4WCGA 2QDRA 3GZ6A 3KLNA 1J3QA 1YLLA 3ES1A 1OR7A 2ZKZA 3ZN0A 2V09A 1XGOA 3U10A 1O57A 3I64A 4H0EA 2C0ZA 2XRNA 2YR2A 1ON1A 2FBKA 3P9IA 2H0VA 2FNPA 1U6GA 2HTSA 1VR3A 5I0UA 1XDSA 3BJAA 1DPRA 4Q0QA 1VTNC 3J81Z 2ESHA 3MZYA 2H6BA 1KU3A 2UXXA 2QJVA 4EM1A 2WWYA 1V70A 3ES4A 3HHGA 3FFQA 4B8XA 2NNNA 2QVSB 1O3RA 2V9VA 1JXSA 3MPBA 3WW4A 5HLIA 1ZRCA 2ETEA 4MZUA 3QU6A 2A3SA 5F64A 1J58A 4CYDA 1AWCA 2P5KA 4Q0UA 3J80K 2A6EF 2XAHA 3DF8A 3T5XA 5EFUA 3LWFA 1BN5A 4L9TA 1WRJA 3SMHA 3W6KB 4AQ6A 2O0YA 1XN7A 1T2KA 3IRQA 1DZTA 4GXOA 3GFMA 2G7HA 5E1WA 4EWDA 1Y9QA 5FLIA 1CAUB 4TLFA 1XD7A 1UPIA 2VE8A 4Z82A 1JHHA 1Z6TA 3GYHX 1FI2A 2VT3A 2PI0A 3WTXC 1UB9A 2M87A 3GF2A 3CJXA 2FRHA 1RZ4A 2VXZA 2GC2A 1F4KA 2PFBA 3IRRA 5BS6A 1DUXC 4UUVA 4F8AA 4HDUA 2DK5A 3ZMUA 4HLYA 5HDKA 3IC7A 2K27A 2NAZA 2WTEA 4KUMA 2LF8A 5K5OA 3CUQC 4IEVA 1LVAA 3FXQA 4GO1A 4P55A 5BPXA 4WF2A 1ZG1A 2H27A 4MX3A 4XFIA 5D6EA 2VBXA 1P4XA 1BI1A 3T1BA 3WW3A 4YRDA 4OU0A 4MNUA 2MBFA 4IEOA 4KMUX 2ET7A 4UBHA 2P4WA 1R00A 5HS9A 5ICGA 1Z6RA 1HXDA 2EWNA 3Q5FA 2UY8A 1U2WA 1B1BA 3RKWA 3D5LA 2DPDA 2FBHA 4ZU7A 3VODA 3GBFA 3G7DA 3OTFA 1GQHA 1ZREA 2HWVA 4HQMA 4L2NA 4ZYHA 1SEFA 4G94A 1IRFA 1ZGJA 3PQKA 3H3UA 4PGGA 2L4MA 2ELHA 1WSUA 3L09A 3E5XA 4HSLA 1IN6A 1R5HA 5FO5A 3H7YA 4M9ZA 3L2CA 2TDXA 3CDHA 3TDZC 2HYFA 1G6NA 2QQAA 4AVBA 2A68F 5CADA 4FHTA 2FU4A 2XUBA 1QNTA 3GFIA 5K8SA 1L3LA 2VT2A 2BNNA 4IRGA 4AIKA 3KZYA 1EH8A 3PQJA 2YU3A 4UV9A 3TDUC 5LHHA 3IHUA 3I59A 5K1YA 3KP2A 3ECHA 3ZMVA 1IXSB 3CF6E 3USSA 3QACA 5I8TA 1BM9A 2VC1A 4ZYDA 3F21A 5ICFA 4I3PA 3WTSC 1D8KA 5F1RA 1MDMA 2K0GA 4IEZA 2JSCA 1XDUA 1S7OA 5CVRA 2PMUA 3DEUA 3IKTA 3BROA 3F6OA 4ONUA 5D5WB 1TNSA 4P5OA 5JFRA 4MUVA 1K78A 1U5TB 1ZN2A 3K0LA 4R52A 1QY4A 2KIFA 1XE8A 4XF3A 3GYDA 2HJIA 3LFKA 2EAAA 2FEZA 4EGZA 2CGPA 2ZJ2A 3J7AO 4KN4X 1FYKA 2A61A 5E1ZB 3TO6A 2LSOA 4OIQF 1O5UA 3QPHA 1NHAA 4KN7X 2XASA 1B6AA 4N9HA 1ZYRF 2ZNYA 2FNAA 1P2FA 4HF0A 1G3WA 3BPVA 4XLNF 3COAC 4XF0A 3SFZA 4E2SA 4G7ZF 1U3EM 4G6QA 1TQIA 2QENA 4LD5A 3CTAA 1Q5OA 3S7EA 1W7PA 1LDKB 1IF1A 1PM7A 3EO6A 4LEJA 3MDPA 4XF4A 5L3CA 1HKSA 4ESJA 4A0XA 3KCCA 1XE7A 1WKMA 1T6SA 4MTEA 3NEUA 3HT2A 2XGXA 2ZMEB 3L7WA 4XETA 5JI6A 3ERED 4QXKA 1HW2A 1WLTA 1JUHA 4BIFA 1IN8A 3U0ZA 1Q3EA 5BPIA 1L0OC 1ZHFA 3JTHA 5D6FA 3ELNA 1IN4A 1LEAA 2P7CB 5CU1A 2PAEA 1XMAA 3ISPA 4L5IA 2ATFA 1HW5A 5L3BA 3BCWA 1CAUA 3T8TA 3MQ0A 3FMSA 1BOAA 5ILSA 1BJAA 5L3FA 2W84A 1W5TA 3NKTA 1R7JA 1O3QA 5FLXZ 1SMTA 1K78B 3Q9SA
chains in the Genus database with same CATH superfamily
4CEYA 3K4LA 5JOXA 2PMHA 3GTLJ 1GANA 1NZIA 2DPUA 2HXIA 1BL0A 2Q0OA 1OPCA 4EATA 2W25A 5C7GA 3MEXA 2VOVA 1ENHA 2PHFA 3IBMA 4P9LA 3CHXA 5I8YA 3HPGA 4META 4BQ5A 2XAFA 5LA9A 1TW3A 3N9MA 1PGW2 2BZDA 5EEAA 1WLCA 1KQRA 2CUFA 3JRGA 2VVEA 3DUIA 3FBYA 4Q48A 3VYRB 1PMJX 5D8LB 2OT7A 3Q0UA 5EG0B 3KVAA 5GAHJ 4RQPA 4DXRA 1D2SA 5IAVA 4IPAA 1AR91 1ZGWA 1HJGA 2ZX4A 2DCTA 1MDMB 4NHYA 1AR62 1JZ4A 4P9YA 5KC6A 1RVF3 1E2XA 1TG7A 4FCYA 4DXTA 1ASJ2 1R1A2 2EH3A 2R7EB 3T3YA 2M30A 1S2BA 3QCWA 3ZR8X 4NAOA 4CU8A 1U12A 1LRHA 1BBT3 2HQRA 3IB3A 4S2GA 2EV0A 1ZH5A 2WNUB 2QYOA 1JUSA 1DIWA 1JOJA 4YFXF 2IUWA 2KRCA 3ACLA 3WSOA 4FT8A 3FXOA 4CRQA 2DCYA 4UY8I 4M6YA 1VBE3 1VBE2 4JGYA 1RIRA 1I5ZA 2GXGA 2Y0MA 1R082 3LSPA 4IHYA 1IXCA 3IZOA 5DABA 5IK4A 2JQ7A 4XM3A 4JGZA 1WZ2A 2VC9A 4LK0F 4MQVA 3M8EA 3PUIA 3AJYA 5GPCA 1W8ZA 3C7OA 3F8BA 4ES9A 5BNOB 3ZLIA 2KIUA 5DAVA 2BY3A 1MJ9A 1HX6A 2JTVA 3F3XA 3T30A 1HC8A 3CO2A 1TLHB 4RB0A 3MWMA 5AC93 2HFHA 2GNMA 3OB8A 1WW7A 2EXHA 3EHKA 1EKEA 4EJUA 1U5YA 4BJTA 4CCDA 4JK1X 4YG0A 1CZTA 2F48A 1N1TA 4PUSA 3GTJJ 2VZSA 4K2EA 4QHOA 2KZVA 3P5JA 5I0RA 3JQXA 3DFGA 3VKMA 1SC7A 1UG0A 3KZIC 2FCUA 5DD4A 2OKXA 3M3CA 1IZ3A 3VGIA 1H9GA 4PQQA 4HYEA 2X6WA 1YHQI 2XH6A 2UY9A 3ALQA 5FLVA 5A70A 5LK5A 1IDYA 1UZVA 2JDPA 1LECA 3T0AA 2Y6JA 2FOWA 2F4IA 3V0BB 2W08A 5DM7F 4PI2A 1O91A 4FO9A 3PUBA 4MFDA 2R7TA 1AX1A 3BCBA 3H5AA 2OCEA 4QD2A 1P4WA 3PVOA 3POSA 2K2SA 3MPPG 3OSDA 3VBUA 3FHIB 1VNDA 4LJZF 1KZHA 1AX0A 3BZKA 4XJ8A 2XVKA 2ELJA 2LY2A 2A69F 3JB8A 3POFA 1J9IA 1N47A 5BV6A 4L18B 3AMNA 4AF9A 3RDIA 2G9ZA 3ABKH 1NYWA 1SFEA 3K4BA 3I3MA 3MAJA 5LASA 5FUNA 1MNEA 2DVAA 1DQ5A 3V0AA 2BVBA 3SISA 3UGGA 1CESA 2VQUA 2WAFA 4N53B 4HVQA 1YEWA 2ACJA 3MIHA 2LTNA 4DYRA 4A0YA 3KEOA 1HCRA 5L7OC 4CO8A 3ZFEB 1S7EA 4G8XA 4CXXA 1CAWB 1YIPA 1JTYA 1NG6A 1SAXA 2Q2EA 3KZZA 5FYHA 2GALA 3I59B 3K51A 2PLV1 4N53A 4W8JA 1MQTB 1HQNA 4ESFA 4YW7A 5HODA 4AFCA 2DCEA 5I0SA 4QU1A 1W36C 5FXVA 2L4AA 4WBBA 1WJ5A 2OPKA 4HXCA 2BVLA 1OCCH 5E17F 5GLWA 3CQOA 3ZMNA 2VZRA 4DXZA 4KISA 2VPRA 4XDPA 4GJYA 3PSIA 2MH2A 1F31A 3IT8A 4NDLA 5DQ0A 1FP1D 1KYWA 3LMMA 4CZZA 4LA3A 4M71A 4AFDA 5JIAA 1HBXG 2GC0A 1B72B 4IV1B 3WF3A 4RB2C 4I3GA 4NIAA 2E34A 3UK9A 3ZFFA 3WDWA 2LREA 2HBUA 2D98A 1J3PA 2LW8A 3MIBA 5KVRA 1Q8PA 1W28A 1J09A 2IA0A 2Y0SN 5FK8A 1K79A 2A6XA 3HPNA 2AENA 4FOYA 5FREA 1OLQA 2OCCH 2HWD3 2R5YB 1COV3 2FOKA 3LEIA 3D5RC 3JD71 5D8AA 1F43A 1OXCA 4N7IA 5DCMA 2VZPA 2ZMEC 2CFXA 1F9KA 4CCOA 3G6JB 1OA3A 5FZ4A 1MBJA 5HXVA 1UPSA 2KT0A 4S0HB 1QNWA 1N75A 4BHCA 5FRNA 1MBEA 2PBIA 3DGTA 3GVAA 1X4PA 1FMWA 1I3HA 2VAUA 1LNWA 1DYKA 2ZMLA 2LR8A 1GKBA 3ZQLA 3NWTA 1FT9A 2KRFA 2J5PA 5D5XB 5E3OA 3FHNA 3CL1A 2HLEA 1ZG3A 2ZFUA 3POBA 4QKDA 3VZMA 1IQAA 4HBLA 2VU9A 1TMF3 3ZKYA 5M0TA 3WP6A 4JV4A 3WW2A 4XFGA 2HWF1 4CDXA 3G3ZA 4ZYEA 2STWA 5AFEA 1J2XA 2H8RA 3OGGA 1ZYBA 3L2WA 4D7SA 1UAAA 1NLSA 1OD5A 1X1BA 4LK6A 1WZXA 2A05A 1PNFA 5BNOA 4EM0B 3OV8A 2ORXA 4XFCA 1SBFA 1PO21 3ENRA 3POYA 5FP9A 5T50A 3WTUC 1QDCA 1PGW1 1UELB 1JHJA 1PVC2 3MVPA 5LBFA 2JENA 2WZR3 4OMCA 4GMP3 1W0PA 4ISQA 3K4ZA 4I01A 2Y8KA 3K70C 4UFJA 1OQYA 2HVQA 2NPIA 1WH5A 2M7AA 4PCQA 3WNMA 4DEQA 1G9DA 2P1BA 4LIUA 4AVZA 1W6NB 1POQA 2BOLA 3K4MA 1IUYA 2NM1A 3HTUA 2IXSA 1X19A 1S0FA 1FLIA 2FF4A 2VMGA 1O4XA 4M0NA 1C4RA 4XIOA 4B7EA 4MQ9F 1MSFC 4L9BA 2HR3A 2LDUA 3WQ1A 4FBFA 4QPGC 4P00B 2QWWA 3H9QA 2W87A 4AWDA 3VBFA 1ASJ1 1R1A1 5FD6A 1NE4A 3AMPA 4QX1A 3SLIA 2WAEA 4KG0A 4AEDB 1ETOA 3AB0A 3WNLA 3I7DA 2QSGX 2DI3A 2Z69A 3LF7A 2LS6A 4F3QA 4QM8A 3G2BA 1FV3A 1PGL1 2FQPA 3CCJI 3FXKA 2ORZA 3WF0A 3MMYB 4Q4V2 5I0TA 1QXJA 3MIFA 1WGPA 3ZYHA 1NY71 3TOBA 4LFUA 4BMEA 2IRFG 3D0JA 5BNGA 2XF7A 2DA7A 1R36A 2JD4A 4RQPC 2C1FA 2DTRA 3TNQA 3IPVB 3KYCB 1UN1A 1QQP3 2X6YA 3WDXA 1URXA 1C5IA 1G3SA 1FNNA 1OCPA 3GEZA 2C5DA 1SLIA 3VDCA 4AVAA 2XXZA 5FGMA 3DEEA 4N0BA 3GALA 2HWC1 2WLQA 4EN8B 4FTEA 1J7KA 4X6RB 4TYSA 2V6EA 4IV1C 2WZEA 4XUOA 3A22A 1RUG3 4INDA 5C4WA 1RR7A 4QPYA 2XJRA 4B3XA 4XN3A 4IEJA 3N97A 4J1XA 2VIXA 3L2UA 3T4HB 1TZOA 4AGVA 5A3NA 3JU9A 4UAPA 1FMD2 4ITVA 2HQNA 1FOXA 1SMVA 2UU8A 4YZ5A 1W8NA 4N4NB 2LNBA 1YS6A 4FQGA 2P6CA 2QUFA 4ENKA 5EP9A 3AK0A 1TWFJ 1ZGAA 1ZLKA 4ANJA 1ENQA 1O6UA 4NJ4A 1ULYA 3OYBA 1AYN2 4PDWB 2GA1A 5CFCC 2L01A 2IA1A 2VZTA 4Q2FA 4E2GA 3AYAA 2UV1A 2DMQA 2VCBA 2VNOA 1RR8C 2YUSA 1H9TA 1BR1A 3OYDA 1VJ2A 1EPZA 1I3QJ 4W50A 2ZGLA 1PUFA 4E7LA 3D0SA 2XV4S 3D4KA 4F92B 3OGVA 5B1BH 2GAUA 3M1CA 3ML6A 5CQEA 4R4ZA 3K48A 4XXAA 3ZMSA 4QB1A 5HXMA 3AZVA 5HI0A 2YMZA 2HEOA 1YO5C 4KGQA 2XL9A 4EM2A 4GH4C 3PLQA 2CQQA 3N05A 1V00A 3ZFFC 3NARA 1SPPA 4B29A 2FUG2 4COZA 3TGNA 5J1YA 4GMP1 2N8GA 2VOXA 4IZZA 2BQPA 1OCOH 5LHIA 4AC0A 5HVQC 3ASOH 1YS7A 3BR6A 4KMQA 3RKXA 4NQWA 5A2QK 5C9AA 1WI9A 5D4RA 1IN7A 4AVSA 4DRRA 1R1VA 4B3NA 4PIYA 1CIWA 2RM21 2FXAA 2W1OA 4Q8LA 5CAZA 3VDDC 2PLYA 3KP5A 4NHKA 1MZ6A 3JBG1 2HI3A 4HV6A 3TO9A 2CS3A 4AEDA 3HSEA 2KISA 1DGRN 4HNTA 4B4PA 3E6DA 1HLVA 3ZFGA 2L7FP 2A6VA 5FPXA 1AA7A 2EXKA 1I9RA 3GTKJ 5GZFA 1I50J 4CCMA 3I3BA 4LBQA 1S0GA 3EETA 5C71A 3OCPA 4R9DA 4MHRA 2XVGA 1Q56A 3CCRI 3LSIA 4XN0A 1EYBA 1VBA3 3X2QH 2CSGA 4ZYAA 1ZQ3P 3VD7A 2M2EA 2RMU2 3TEWA 2OQGA 1C57A 1WA6X 2PHRA 5JZGA 1D5YA 3OGSA 1H6XA 3PUQA 4WXDA 2ARBA 4DYQA 3AG2H 3I53A 1QZZA 2QKDA 3AP7A 2FQ3A 1I5PA 5H2FC 2W47A 2ZHNA 1YFWA 2Z1DA 3ZDSA 4OUEA 4OCTA 1OOPC 1R22A 3L1PA 1XC5A 2P6HA 3DYPA 3PU8A 1QEXA 4GD4A 3WD5A 4BWOA 4L92A 4MSVA 1AR81 3NSTA 3IWZA 4CZCA 2EK5A 3T08A 1HB2A 3NAUA 2Q1MA 3UKTA 3CUQB 2Z33A 4KT5C 1U78A 5HLGA 5A2QZ 5HCFA 2ME6A 4ZH4F 3M1EA 5FBZA 4C1WA 5EV7A 1XB4A 4DW6A 3O1MA 2WY7Q 1BQPA 2ZX1A 3JRAA 3U1DA 4LG0B 5IWFA 1HSJA 3VL8A 5CG9A 2H0BA 3V4GA 4AE2A 1IXRC 2EF6A 3MIEA 5IT3A 3DWLE 5IP6A 2VZOA 4P9IA 4O3MA 4OI1A 2JZYA 2D6KA 1OURA 1WW5A 1SVLA 1QJU3 4CEWC 2Y6HA 1U0JA 3AG1H 4BEHA 4XC9A 3K2ZA 3O8GA 1GQGA 3WTYC 1F5TA 3QP6A 5IP9J 4QDQA 3BU0A 4UYBA 2PQSA 3ZN1A 4MLOA 2DA4A 3JB4C 4XFHA 1VBE1 4ZYGA 2ZJRF 1ZNPA 2NN8A 1XXNA 4FFIA 5FZOA 3MUZ1 5F3CA 1CZVA 2GH8A 4RR3C 5BXXA 3WU1B 3VUOA 4LLNA 4BJ6C 3RWKX 1QHGA 2CQKA 3SQNA 5F08A 1ETVA 4KA4A 3K7AJ 5BOXA 3I5UA 2CQ7A 3G1OA 1JU4A 5DZFA 4IEUA 3RSJA 3HPHA 1S0CA 5ANQA 1YRZA 4TWTA 1AR92 4DOUA 2OV7A 4MGSA 1H2LA 2FDKA 2DLLA 1A8MA 2VJXA 4QX7A 4DQ2A 4E7KA 1YTYA 1LQ1A 3SH5A 5LA1A 4XOGA 3VBOB 3JAMZ 2OPWA 2IP2A 3ZQGA 1DYPA 1PO23 5KXBA 1D3YA 4QPIC 4N90A 2D1VA 2XAQA 2ECCA 5IVEA 2PMZN 1O8PA 4GA9A 3CIHA 3FXRA 2K85A 4YZ1A 3B94A 2CFOA 1OUSA 5C44J 1LODA 1DF0A 2GU9A 2X51A 3ETQA 1H4HA 4M72A 5FLJA 2GC1A 3BPXA 3CO7C 5J8FA 4C2TA 4HV5A 2G4IA 2YU2A 3GTMJ 2RS12 1OCRH 1PP7U 1MVQA 2J7MA 4CDWA 1NH3A 2DA1A 2RE9A 5J48A 1JYNA 4BEHB 1DGWA 4M73A 1W0OA 2D1HA 2EIJH 1WPKA 4UHTA 1UIJA 5F6FA 1XNDA 3S15J 4BAYA 1F35A 1DPUA 4Q4W1 1VMHA 1QIQA 5FKOA 3WINE 4QKNA 2WAQA 3W5MA 1MEC2 1W6OB 1K4TA 1FATA 2Y26A 4CP9A 2MLKA 4XSXF 4BQYA 3ZR6A 2BWAA 2XWJB 2WNVC 4MV2A 3D6EA 4Z1VA 1TNTA 3I2FA 1DQ2A 4XHXA 1JBCA 1LE8B 3AC0A 3I2GA 4GB33 5A6XA 3CJIC 5I91A 4GFBA 2DAOA 1JT6A 4EQQA 3B69A 1H2MA 4ARXA 4BIOA 4A12A 2UWMA 1T33A 1DDLA 3JRHA 1I39A 1R6RA 2OQRA 1XB9A 4KNYA 1SFUA 4P5YA 5C33A 5F04A 2VMCA 1QJU1 2DU9A 5E8GA 1EH7A 2JT1A 1R4NB 1TQPA 2PHTA 1AHDP 4X8NA 4B8EA 2NVTJ 5C4JJ 1RGSA 1RUNA 4FAGA 2KXLA 1JYTA 1U0AA 1M1EB 1VBC2 3POIA 3IDBB 4MXWB 4A41A 1S1AA 4FSJA 4XDQA 1CAXB 4LLGF 4YM2A 3OIQA 2HYKA 1KJLA 2ZBKA 3RQ0A 2VI6A 2JEMA 2XSJC 4E70A 3BCAA 3QU3A 3GJAA 4AHYA 5B5EC 4JVAA 2EFOA 3ZCOA 2GA2A 4EN7B 1OH3A 4WX9A 4BJ5C 2BYVE 4PFPA 4HPQA 3QPTA 4XCAA 5L3EA 1OKQA 4FP3A 3KIOA 4MOAA 3MHZA 2WNUA 2X05A 1D1BA 1ZR4A 1JYCA 5FP4A 2R0QC 3AP9A 2NOJB 1OFNA 1COV1 1V4RA 2CU5A 1QA6A 1PHMA 3HSFA 1QZYA 4CSWA 4HBNA 1LEMA 5HLTA 3BPZA 2Z9OA 5C5UA 1H2NA 1PZ9A 1ZZ6A 1UOJA 2BW3A 3WHCA 4OVEA 3WTZA 1F2NA 4RGUA 1UX7A 2QQ8A 4ESBA 2D43A 2BBAA 2VJ4A 2LKPA 4CEYC 3NV3A 4J25A 3I4NJ 2QZ8A 1IW7F 2UZKA 4QPGA 2V1DA 3WGHA 3B7MA 2BGCA 4OHZA 5L3DA 2WSUA 3PIOF 3FL7A 3PVBB 4LLOA 4R79A 3M9AA 4GCVA 3PJYA 3NV1A 1H1IA 1QVUA 2HU9A 3WE2A 3CF5F 3TO7A 4O9GA 1SQ4A 3C18A 2OJED 2Q8KA 1PK6C 3K1NA 1PO22 3OY9A 4E9KA 4CEYB 4QX2A 4OIPF 3S2DJ 4UF0A 2RM23 4U36A 3WG1A 3TW7A 2IW5A 4ZONA 3CCEI 5JR3A 3TYJA 1YUDA 2R7ZJ 3J7MA 1S8NA 4AIDA 2HEYF 5FZIA 2A6YA 1RUF2 5G04L 3M7GA 3S7IA 2VBBA 2JIJA 4D6SA 4K1ZA 2CQNA 2BZTA 5FR3A 3R4DB 4ZXKA 3NAPC 2DOAA 3Q8FA 1LFPA 5F0FA 5HDGA 1BBYA 4FPJA 5CIRA 1EPWA 3NMBA 1VE0A 3UESA 4MEXF 1RUH3 4PF1A 3VKNA 5FDBA 5FZEA 5FMCA 2G9GA 1UD1A 1X2MA 1XGSA 1NE6A 2DFHA 2L7ZA 3S8PA 1SACA 2RR12 2DVBA 2M3AA 3LGRA 2RJLA 2HKOA 5C4WB 5T5LA 1FIPA 4JYKA 2BVMA 2ID6A 4CU9A 2E31A 4F7ZA 2GZWA 1UQXA 4C2UA 5IVVA 2O7OA 3FISA 3GZ5A 4YZ4A 4EGYA 4XDOA 3BVCA 3WU0A 2M8EA 4PT6A 3H8UA 1RC9A 1WVRA 1MH4A 3U9GA 2DCZA 1W4MA 4NVPA 2R5ZA 5EF6A 3MF6A 1AVBA 1WCDJ 4HVOA 3LSTA 5M5XJ 5HCAA 4JQRA 5ILVA 5JLXA 2IA2A 4J19A 1HW1A 1HRV1 2OD5A 3WNOA 4I2OA 1R1TA 4HMZA 4RD7A 2LG4A 2L54A 3WG2A 2QQ9A 3BLYA 3DLLF 1VBD2 2HWE1 1ULFA 4WM7A 1XPXA 3MICA 1XYPA 2Y0IA 1KFXL 1X1AA 5F0CA 2RDQA 3FUQA 5LEKA 3UGFA 4QGLA 5DDGA 4II2A 1YHFA 4XCBA 4LOSA 3HJEA 2ZJQF 4AEMA 2QQOA 4RLFA 4GQ7A 1EF4A 2IXJA 5FZ9A 2LUWA 3IUOA 2QDRA 2ZGPA 2JWTA 2FCTA 1J3QA 5F3EA 3GLLA 5AFBA 1DQ0A 2WT1A 4Y20A 2LD5A 3UETA 3U10A 4FASD 4H0EA 2C0ZA 4W6WA 4DUXA 1POV1 2CNAA 5F6LB 1WMFA 2HTSA 1VR3A 5ISLA 1DPRA 1CD3G 2HWC3 1KU3A 2WWYA 1ONAA 1NK3P 3ES4A 3HHGA 1WJFA 5BNPC 1Z7S3 3S6PA 3WW4A 1J58A 4Q0UA 2RDSA 2A6EF 2XAHA 4N7UA 1H88C 3N35A 3I55I 1JXNA 1S2KA 3AKRA 2G19A 3W6KB 4LBOA 2O0YA 1XN7A 1AF9A 2R32A 3IRQA 4DYCA 1DZTA 1S72I 1YRNB 4QX8A 3GFMA 1MS8A 3ASNH 4EWDA 5FLIA 4AGGA 1N1SA 4IHWA 4TLFA 1XD7A 1WMXA 3U4SA 1YCIA 2M87A 3GF2A 1OHFA 3W21A 3ZXGA 1RXGA 2FRHA 2BGPA 1A3KA 3AP5A 3ZDVA 3CP8A 1U5ZA 4XJAA 2ARXA 1DQ4A 2W68A 4UW3A 2PFBA 1SCSA 5BS6A 5A1FA 2WQ8A 4HLYA 2R30A 2SLIA 2KR2A 3IC7A 4LPLA 2AQEA 2XJUA 3JBG3 2HWB1 4KUMA 2LF8A 4IEVA 1LVAA 1JMUB 4P55A 2VBPA 3GBGA 1RUE3 4YRDA 4OU0A 1ALYA 1YIJI 3INAA 5FPAA 2CUZA 1MMDA 2MBFA 1VI0A 5JVGF 4M3CE 1RMU3 4XMAA 1R00A 3W59A 1W2TA 2CUEA 1POV0 3URFA 2Y69H 3DKXA 1Z6RA 2UY8A 1LGBA 3RKWA 3G7DA 3J8F3 1M06G 1MS5A 1R093 1B72A 2COBA 1WCSA 4IV1A 4E7HA 1RINA 2R7UA 3TN91 3WDYA 1ZGJA 3KZ4C 3PQKA 1U5IA 4A42A 2W1QA 2VCMA 4YVWB 5B2GB 4AUXA 1QVTA 3ZQQA 4HSLA 2MC4A 1G6NA 5J09A 4AVBA 2NYYA 4FHTA 3ORJA 1QNTA 3RFRA 4JX0A 2JDUA 4G6TB 1AXZA 4Z2AA 2VCAA 3PQJA 3FLRA 2YU3A 4UV9A 3BOPA 1R49A 5L9RA 4GB31 5IVCA 5LHHA 3IHUA 3R05A 3I59A 3KP2A 2ZEZA 3AMQA 3ZMVA 1UU6A 3C2GA 2JDMA 3CF6E 3OOUA 3QACA 2VG9A 2VC1A 1SG3A 2XJSA 5G05L 4Y4RA 2D6PA 4DOZA 4QX0A 4FFGA 1VRH2 1RUG2 4I3PA 3KYLA 4IEZA 2I5UA 3A03A 3QH6A 5CVRA 3IAM2 5KAIC 3WCRA 2XJTA 5D5WB 5FZ0A 5JFRA 4EJRA 2DDBA 5FZ7A 2IS2A 2KIFA 3GYDA 3VHOA 1IOAA 2HJIA 3LFKA 3GBWA 2FEZA 3EB7A 5JXGA 1K45A 2ZJ2A 4KN4X 1EUTA 1FYKA 4LO4B 3TO6A 2WNUC 1O5UA 3NWKA 5IHRA 1DG6A 3BUCA 2LROA 4P1WA 1VPHA 5GKAC 2FNAA 3ZQIA 1FOD1 1AZDA 3C7HA 4RGKA 2R043 4XF0A 3E0JB 1TQIA 2VUAA 1E5SA 2QENA 1HLCA 3V64A 1MZFA 2ELKA 1ACIA 1LDKB 3PMEA 3VDDA 1IF1A 4LEJA 3OYHA 1K42A 3TEXA 5L3CA 1HKSA 3NJXA 3ZSJA 3LEKA 5T55A 1WMDA 5LWBA 1WKMA 1MEC1 4MTEA 1ETWA 3A0BC 1WLTA 1JUHA 4BIFA 1IN8A 1L0OC 1W6QA 1ZHFA 2WWSA 1ND3B 3ELNA 2OC6A 4AGRA 1IN4A 1LEAA 4BB3A 4JQTA 1XMAA 3CZ6A 3ISPA 4TZDA 3UR3C 1JYXA 2HWB3 4BISA 1RUJ3 1GZTA 3T8TA 5FZOB 1YC61 3R4SA 1APLC 1PVC3 2LRPA 2NZ9A 3DTKA 5IFPA 1HJFA 3LNQA 4NIHA 1W5TA 3NKTA 3RZHA 1O3QA 2HWF2 3WDUA 4M01A 4X6AJ 3OYGA 2VOTA 3GNEA 2JK3A 1K78B 1QJZA 1SZBA 1D2QA 1EV13 1WBLA 5JSPA 2CO5A 1U5TC 5M5WJ 2UWCA 1KJRA 1JI6A 3G4SI 1RL3A 2XF5A 4OHVA 2WABA 4AW7A 1Z91A 3B9CA 1UIKA 5IT9K 2Y48A 3P9CA 2E7QA 5C8CB 3KLSA 4CXFA 4OOIA 2B7YA 4Y1VA 5FKCA 1JUPA 2YBKA 2E7XA 4NPMA 2QQKA 3CBNA 2WINB 2PAKA 5LRRA 2WUHA 3GDBA 4P9XA 3TOAA 3OYWB 1WWYA 1YFHA 1UW8A 5EZWA 4M9XA 2VJJA 4UB8C 2BWCA 4Y17A 3ABTA 3MFKA 2OU2A 4EROA 4QIWN 2CAVA 1CJDA 5KXCA 4J00A 3AMHA 2R49A 1SD5A 1P6RA 1QOOA 2FZ2A 2HQ5A 1IS4A 3VBHA 5DYMA 2MW8A 1O4ZA 2EIEA 4BHBA 1XJAA 2NOGA 1DQ1A 3NV2A 1G9BA 3VBRC 3HQXA 2KL4A 2NQYA 3O2PE 4O61A 3AFKA 2Y64A 3D5SC 4YELA 2QBYA 3HRTA 2R072 4LO6B 1W6OA 3DPTA 3F95A 3O0WA 1CPMA 1ODDA 5CPRB 2Z3YA 2JRMA 1QKQA 2DO7A 1AX2A 3M1HA 4S04A 1XE0A 2OQ7A 4RYDA 1Y1VJ 3ZIWA 1WJDA 5FKBA 3ZPOA 2GN3A 2AQFA 1LE8A 2RDPA 2RQQA 3VHRA 1NCQC 4FE4A 3TEYA 2JMWA 3A0NA 1W6MA 5K7PA 3SEQA 2P34A 5T5PA 4YG2F 4JX6A 3N7LA 5FY1A 3K4CA 5CKNA 3GFJA 1CQ9A 5A3TA 4YVSB 2DMPA 5KWRA 1IN5A 3AX4A 4OWRB 1K7AA 3TQNA 3AYEA 3SDBA 4PLMA 2BOIA 3S3MA 1K12A 1IUFA 3M3OA 2BBYA 4FQZA 5T52A 1FOYA 3GJBA 1C8M3 1GP4A 5IATA 3A0HC 3LPFA 2TBVA 3QAHA 3FMQA 1ZTRA 3OPTA 4P9WA 4H4KC 2PHXA 1DQUA 3JZVA 4L5EA 3O6BB 4KWLA 3JCUC 1F1ZA 3M4OJ 5AONA 1B35A 2O3FA 4W65A 3PNAA 4G3YC 3I2OA 3L9JT 3BT9A 1W8OA 2NS0A 1EV12 4XFBA 3A1YA 3FHAA 1MS4A 3K1MA 4OZXA 4LB6B 1SEUA 4CDQA 5FWEA 3AMMA 3JW4A 3HSRA 2ZGUA 4N43A 3S57A 1V3FA 3AL5A 3I3QA 4XOPA 3THPA 1UZYA 3QODA 1QNYA 4E7JA 2M0CA 4QX5A 3IMMA 3FBIB 2X53S 4Y3OA 5IK7A 3TEZA 3ACIA 1W8WA 2O8XA 3UNPA 1FYLA 4JKLA 2CSOA 4XVHA 4ZXEA 3WG3A 3WOGA 4MHGA 5E20A 1Z77A 1VB2A 4PGHA 5KHDA 2XR4A 4IJAA 2KFDA 2XAJA 3ZO0B 3CMAI 1QJY1 1K5MC 2K86A 5DS9A 4Y22B 3HJRA 1UY0A 1JGGA 5DUKA 1UMIA 4EE2A 4NBQA 3PFYA 1IC8A 3TWIA 1ZBE2 2V72A 2X6OA 4XQ4A 4BUPA 2GIZA 1G3TA 3CJQB 2VQ0A 1GYKA 3AVRA 1RJ8A 4WZFA 4D7TA 3KFWX 1QZEA 2R7SA 4HLTA 5T54A 2ZHLA 1AR72 3GCWA 3KEYA 4XABA 1PNGA 1FBUA 2QQVA 3F2ZA 2A7AA 4MGRA 2GH2A 2BE5F 5KHJA 4HF1A 4O9EA 2XQRA 4BY1J 1OQEA 4GYGA 1F5JA 4KDPA 2VZ1A 1J5YA 2P5LC 1VRBA 2VUCA 2OBPA 3S5AA 2Q1ZB 4JOMA 2K7LA 4BXSV 4MTDA 4GH4A 4HANA 3IH2A 1IDZA 3U37A 3ZVXA 4FFHA 4LK7A 3BR2A 1TBXA 2WFPA 5JMOA 1AL23 1XS9A 1NKGA 5JMCA 2YX7A 3OYFA 1C0WA 1Y56A 4RHV1 4XJZA 4ASLA 4BQ1A 1VBB1 5EJ3A 1GVJA 2EALA 1W03A 5FZDA 3BALA 3HC7A 2V1XA 4CP2A 2DCJA 3RKQA 3P1IA 1NA1B 3WQ7A 5FZHA 1QJY2 5K7HA 5FZ6A 4ITCA 1QU3A 4G7HF 3RNSA 5FKMA 4DB5A 2TRTA 1ODNA 2AEYA 4PLNA 1KONA 2XONA 4DRVA 3CLOA 2PLV3 3KF5A 1CONA 2RS31 3FKIJ 4GKXA 2JSPA 2MH9A 2X1EA 3OUIA 1J75A 5D5VB 4HKOA 4OQ9A 5I8SA 3E1F1 2CH0A 2ZXIA 2AZ5A 2QTWB 1UZ0A 5T5OA 4YVSC 2D97A 3O1VA 2OS2A 2HYGD 4B1MA 3TBDA 4HX4A 1H1MA 2E2IJ 3VFZA 4XR6A 5ANNA 3L2VA 4CA0A 1R23A 1XGMA 3BB6A 2L02A 1YYVA 5GPAA 2DYRH 3OOXA 2AUYA 4G9SB 4XBNA 5CFDB 3FM3A 3H9GA 4LGWA 1I6HJ 4QXHA 2KDOA 3F22A 3M70A 1ZELA 1GU3A 5FPLA 3ZRGA 2VKDA 2HVSA 1QXRA 4AQTA 2Z4FA 2BDRA 4A69C 2DW4A 1NLQA 3JD73 4WVMB 2ZZQA 5E8AA 2R061 4M4PA 1BK1A 2RS11 4IRHA 4MFEA 1UNBA 2VQAA 1ND3A 2HZTA 3PUAA 3SEEA 2AXLA 2QQIA 4L9VA 3AM2A 5J3UA 1RUD3 2CW0F 2EXJA 3GX4X 5E18F 5CVUA 4A6DA 3DPRC 3IWFA 3BR3A 2ZXQA 3C3VA 1DGRA 4BE0A 2V73A 3GFLA 1BKZA 1JN2P 1JU3A 5TRDA 2ARAA 4BXUA 1FYMA 3DPLC 4CDWB 4XAEA 4HN1A 4OI0A 2K9QA 5FJHA 4JCKA 4LUMA 4NUBA 4WK8F 4BQAA 1RB8G 4JX5A 4ARYA 2M34A 3ECOA 2GC3A 3FKJA 3BYWA 1X1DA 2PA7A 2WNEA 2XC7A 2DTZA 1KEXA 1RHI1 4RA2A 1RUE1 4IOAF 3MKYB 1KFUL 4XK4A 1G86A 2H09A 1VQ8I 3V7CA 2HWE2 4UV8A 1BW5A 2J22A 4ZU5A 5EGOB 3H1MA 2HDDA 1XGNA 5LB6A 1CR7A 2A6WA 4QGMA 2K9SA 1QJFA 5FZKA 1V5EA 1RESA 3F72A 1FSEA 4DNYA 4RFT0 2O1QA 3HNBM 5T3NA 4LUKA 2DFBA 1JZ6A 5IUQA 2Q2EB 1KQ0A 1KD7A 4KMFA 4MGYE 1CJPA 2NRAC 3RGBA 4I02A 2WA4A 2XL7A 2B9SA 3EUAA 1XMKA 3FF5A 5IYDJ 2MSYA 2IPQX 3WY6A 3S16J 5K5RA 5F1JA 4XRSG 2VZUA 3IP4B 2VMDA 2EFNA 4EQVA 2IXCA 3LDRA 1FNZA 2GLOA 1F4AA 5FJ8J 1RUC2 2WBMA 2DA6A 3AP4A 4XLPF 4U7DA 2ZNZA 1S3JA 1EP0A 4CA9A 5IP7J 3ZP5A 4XAAA 3TEDA 5HS8A 1IO2A 3NJVA 1PIV3 3PL8A 1MBKA 2P2KA 2VTXA 5I0DA 2R16A 3OYKA 5FQ0A 3WG7H 5IOZA 3LSKA 4FX0A 5J7MA 1BI3A 4UXAA 2LH9A 4A5NA 1R5GA 4ASNA 2K4JA 1TEIA 3QQAA 5KXEA 4FPYA 1UKRA 2FSWA 4XOTA 5J4VA 3PU3A 4JGZC 5FYUA 1QJX2 1QJX3 3NAPA 1N3QA 3BR0A 1SVMA 2RN7A 5FYCA 3ABLH 3J4UH 2XKOA 4FOWA 4DUWA 4AI9A 3T0BA 2CY6A 3V56A 4HF2A 4GYIA 5FKKA 3Q0WA 3I58A 1WWXA 4BBRJ 2QQMA 1LESA 1FSHA 4GALA 2WO3A 2D6OX 2ZXWH 1YYNA 1S0JA 1RUI3 2PQ8A 3KX2A 2YU9J 5CQGA 5D8KB 5DUWA 4PK4A 2KD7A 3HOBA 3F0CA 3DPRB 2JG9C 4MHUA 2FMYA 3LFUA 3R0AA 3BP8A 2IS1A 5GAGJ 5B4NA 4Q1RA 1PZ8A 3OYWA 4XLHA 2CV0A 3FK6A 3HNMA 1FX7A 3Q0VA 2WO2A 4N53C 3F23A 3LFMA 1T56A 2QQNA 2RR13 2KJCA 1T98A 2VO5A 1OD3A 1Z7UA 3VD4A 4I76A 2IZWA 4IGOA 1LHNA 1AR61 1FPQA 4IOCF 1QQP1 2D6NA 1TVGA 1RHI3 2QNKA 3OYLA 1US2A 4B4RA 3SHRA 4ZPIA 1USTA 4LBQB 4OFGA 1NUKA 5CFDC 3HBKA 4CUCA 2P6SA 1H9PA 1W2UA 4S2FA 4Z07A 1CX1A 1GLNA 3ZN6A 2J1AA 1NX9A 3S30A 3K4KA 2KLOA 4YGEA 3ZMDA 1ZARA 2CGNA 1K83J 1VQ9I 4PHZA 5GJ6A 4YLZA 3MV01 3HEFA 1IPKA 2WNVA 1SMYF 3RPQA 3DXTA 4LK1F 4XNFA 4DO0A 2OX0A 1VIWB 3S1RJ 1BR4A 5D5UB 4RA0A 1J83A 3FXLA 5GADJ 1DGLA 1IKPA 4BQQA 3V42A 3V8KA 1POGA 3PFIA 2VQCA 3CD6I 3LKJA 3WV6A 5AVPA 3VHPA 4YFKF 5JZGC 4GXLA 4Q4ZF 5JIUA 4R8HA 5FIXA 4P9FA 2DDAA 3EBRA 4HFSA 4CGZA 1WD3A 2D2WA 2VR4A 4Q0VA 4B7KA 3D82A 3PJQA 2BY2A 3HYIA 5L9VA 3HHHA 3V8LA 3BG9A 4DBQA 4Q1PA 3W58A 2TEPA 3OG2A 3SH4A 3MCZA 2LY1A 2CWSA 1A34A 2FJ1A 4GWMA 4IHXA 3POEA 1YFXA 4PI0A 5E1XA 4IV3C 1APNA 4I0WB 1JKRC 5FXXA 1JW6A 1DU0A 2Y33A 5J37A 4QWNA 4BKXA 4L0YB 1Y3TA 4IE5A 1FY7A 2B42B 3HVDA 4H7MA 2B63J 1MKMA 2WC2A 2W48A 1BJZA 3RVHA 1D0ZA 2IC1A 5FTTC 3E5UA 3IL2A 3I0TA 4Q4X1 1SFNA 3LEGA 3IV5A 2WO7A 1AR73 1QHDA 2XPJA 2X4HA 5DUXA 2JB8A 5LBBA 3I56I 1GSLA 2BOJA 4BQXA 2HOEA 5K0UA 5GLZA 2LLKA 1SFPA 4ZDPA 1K3IA 5F5CA 1U9NA 2RS33 4Y1ZA 3UKVA 5CKTA 2DJNA 3RZZA 3VZNA 2PJPA 2JKXA 9ANTA 2KKOA 2R063 1IGOA 1F9NA 2WR9A 4E2QA 4RS5B 1BBT2 3MYXA 2A70A 3ME2A 3AFHA 1VBB2 1GWMA 3M8FA 3R4KA 4QPWA 4LA2A 3PIGA 4BOWA 1LAJA 1DHKB 4AYUA 1GZWA 2WNOA 3LDKA 1PGL2 2O9LA 5C70A 2GN7A 3ZKUA 2LC2A 3I54A 5E8IA 1NXD1 1RUOA 1QGLA 4YW1A 1RUC3 2F17A 4FPLA 2HDCA 2HOAA 4CCNA 4XL9A 4GULA 5B1AH 1T38A 5EXOA 4UBGA 2DBNA 2YSRA 2W52A 2JJ6A 5APAA 1DDNA 4G4FA 4IXLA 1CF7B 1SHWB 1UY4A 4ZTJA 2JE7A 3H9JA 5FYMA 1H9WA 1OPOA 3W6JB 5K5QA 4KU8A 1V55H 4K7JA 1VAMA 4B44A 1LB2A 2ESNA 1UFMA 4FPOB 5JSOA 2WV1A 2QQWA 4RGGA 1WCMJ 3H3ZA 3RMXA 5B4XA 2WZPP 4CDXB 3CO6C 2PEXA 1J1TA 5FLMJ 2ES3A 4YM1A 1TMF2 5E88A 3S1MJ 3OS1A 2X1DA 2P5VA 4P9UA 2WAOA 1WMEA 4BQWA 3PTRB 2IGMA 1U9OA 4OIRF 3U2RA 4KFCA 4E7IA 4EV0A 1B09A 2XB5A 4EYUA 3T1MA 3V8JA 5LK7B 3A02A 3J7YJ 5A32B 2EFPA 2ZGTA 2NVXJ 3RYPA 3PUSA 2E9QA 1YI2I 3NVCA 3O1PA 3KEQA 2VB6A 3ON7A 3QOEA 4PDWC 2UWBA 3N4MA 4AG4A 5GLTA 4RS5A 3GMEA 4YARA 3NKGA 4NO4A 1VLNA 4Q4Y3 2G0EA 4AR2A 1OMIA 1Y8QB 2RS53 1GXQA 4XFAA 3FIWA 1IPJA 2PAMA 3UJOA 4I0BA 5J40A 4WV8A 4A6OA 3LA2A 2ZSIB 1SFOJ 4A44A 5EEHA 4LB5A 2WWUA 2W82A 1LENA 2QQJA 4DUVA 5A7OA 2M4GA 5EHDA 2VBWA 4X8PA 1GXPA 5FZ8A 2JXAA 3O12A 1SANA 3ZSEA 3F8MA 2I45A 5ACA3 1MJBA 1WH7A 4Q4X3 2LVSA 5LLQA 1WJCA 1ENXA 4LOCA 3H9AA 3A7QA 1IV8A 5F2WA 1AL21 3VEPA 4E7ZA 2ETHA 3CDIA 1OFSA 2H6CA 3FHZA 2LKSA 5KNLA 3DF0A 3QP5A 5DDJ2 3N7MA 3CJRB 4XJUA 4Z8BA 4LOTA 1D4M2 2BHYA 1CAWA 1S0DA 5L9BA 2X8KA 1CGPA 5FLHA 1WBFA 1ZVFA 3WUDA 4WVVA 3SYTA 3TNPB 5BY5A 4FTSA 2JVHA 5C3SA 1ZRRA 2D93A 4GWNA 3B73A 2P17A 2VKEA 4NC6A 5E3MA 2GBYA 4IX7A 2HOSA 1W36D 2VUDA 2DT6A 4Y33A 3G71I 3EYYA 2Y2ZA 1QQIA 3KD4A 1RTVA 3ZOBA 3AKPA 5LEJA 4IEPA 3TOJA 2HKXA 3SXYA 1IV6A 2W39A 4CCKA 2P3YA 2FMLA 1BEV1 2Z5UA 1PIV1 3BN6A 3VSKA 3VDAA 2KJBA 2QA4I 2R0HA 1BEV2 3CMMA 4HOBA 2WB1N 4LKDA 2BNMA 4RGRA 4N43C 1JTXA 1YX3A 3OD4A 1TL8A 2E1MC 3H7JA 4XXPA 3CCMI 2V5DA 5LATA 1B8IB 5FMOL 1E5RA 3R0RA 2IVJA 2F5DA 1HRV3 2VN2A 4HRIA 1TWAJ 5JOYA 2FBIA 5FFXA 1RC6A 2L9LA 3RIRA 3FZ3A 4ZKTB 1AYM3 1LR5A 4A3EJ 3S3OA 3CZJA 4NRMA 2ERFA 4Y1UA 4HX7A 4TTGA 3AFGA 3DL3A 1CWPA 1XRUA 5FZCA 5ACA2 1I27A 2ISZA 2I8DA 2JA5J 2N7GA 5SV8A 5IYBJ 4CP1A 1D0GA 2ISYA 3JRFA 2QM3A 2JA2A 4HDVA 1GQPA 2GXBA 1UU4A 3HNYM 3G73A 5FROA 1LDJA 1Q1VA 1JOPA 2BPA2 3ZQ7A 4HSJA 3K75B 2VE9A 1UYYA 2RR11 5GM0A 4G6DA 4XQFA 5DUIA 2E53A 4RFRB 5FY0A 3ZYJB 5ICEA 1GFF2 2WNVB 2DQRA 1J3RA 1LHWA 4EVIA 4Y1YA 1XNTA 3U14A 3O0XA 2EZLA 3WR0A 2JG8A 5JHUA 4M3DA 1SCRA 3MKLA 1VQKI 3CMYA 4FPCA 5JXJA 4M9SA 5D4SA 1BR2A 4LBLA 4JP0A 2DWRA 3WE3A 2Y0SA 1FOKA 2XLFA 1UZWA 2BV6A 2ZXJA 4LT5A 1KYZA 4D69A 1Y4WA 4UW4A 5KC5A 2VD7A 5A6ZA 1KU7A 2B45X 3O3KA 1UYXA 2QKMB 1GV5A 2YGMA 5IW0A 1YFUA 5FP8A 4CUAA 4XIDA 3HQRA 3VKOA 1TZLA 1NK2P 2PHWA 3POJA 4IQJA 1YOVB 2DU1A 3VV1A 2UYBA 4UXNA 4XLEA 1BVP1 4IERA 3GTOJ 4Y20B 2DK8A 3WG9A 5LZ6A 3P5BA 3KVBA 2D45A 1Y8RB 2O03A 1ULCA 5DCFA 2PN6A 3ZMTA 5F7UA 2AREA 4GIQA 3G1LA 2W85A 2ZX0A 2Z16A 1CAVB 2BW3B 3OSGA 1R081 2XG3A 4JRAA 4IVNA 4A0ZA 4A3KJ 4XEZA 2D6LX 5AC91 1TMF1 3SJMA 4QU2A 3BKZA 4TV7A 5HDNA 4BE1A 5HS7A 5DD8A 1BW6A 3WDTA 2IFRA 4A3MJ 1YLLA 1YRNA 3KT7A 5FY4A 1LCLA 3RMYA 2VJ5A 2ZKZA 2K3FA 3ZN0A 1TNFA 1XGOA 2Q8OA 3EPZA 4DZGA 3T1LA 2VL4A 3CC7I 5I0UA 1UG2A 5CA6A 3HOVJ 1HB1A 2GP5A 2H1LA 3MEPA 3VKFC 4CCLA 2F6BA 3C7FA 2GMPA 2NNNA 5FYBA 1O3RA 3MPBA 4FE7A 3S5QA 1FAYA 4AI0A 2A3SA 5EDNA 3UJQA 4HT1T 4XZPA 3NNLA 3BTXA 1VQ7I 3LB9A 3VPRA 5A3UA 2P5KA 3T2QA 2Z5WA 3T5XA 1BN5A 4OI4A 4RR3A 2A3WA 2BRTA 3AKSA 2WY8Q 4RLQA 1UPIA 1C28A 4Z82A 3I2JA 1S4CA 1FI2A 3GYHX 2VT3A 1UZCA 3RJRA 2EIGA 3ZYIB 1RUG1 1UB9A 2ADEA 3CJXA 1JOBA 1KDKA 2QE3A 3ZX7A 1Z78A 4LJHA 4TN7A 4AAPA 2GC2A 1F4KA 4FQ4A 3IRRA 2VBDA 2GXAA 2DK5A 1OJLA 3ECQA 4DGWB 3K6GA 3D8CA 1HRI3 1UYZA 4AFMA 1VZ0A 5FP7A 5J98B 3CUQC 1T0FC 2EZKA 4ZZ8A 3FXQA 4WF2A 5D6EA 1OCTC 1P4XA 2DOEA 3WW3A 2QZ3A 1OLMA 4KMUX 4UBHA 2P4WA 3H0OA 5HS9A 2B7EA 5SV5A 3PM1A 4IE7A 2O5RA 3GBFA 5A3OA 1WFXA 1GQHA 3SEPA 2HWVA 4HQMA 2KDZA 4CPBD 4Q4W2 3I2KA 1SAUA 3ATGA 2KIQA 1IRFA 5FY5A 1XNAA 3KWVA 4CDWC 3H3UA 4PGGA 2D5VA 2JE9A 1R5HA 2OPTA 5JVVA 1WJAA 3Q3SA 3H7YA 1GUUA 1OQDA 2YDEA 2TDXA 3CDHA 3TDZC 4HETA 2HYFA 5A7PA 4BQ2A 2NS8A 2A68F 5CADA 2RNGA 1L3LA 2BNNA 3NO8A 2CWMA 3VBOA 4AIKA 3KZYA 1EH8A 1NCQA 3TDUC 4E4HA 4I99C 3RQIA 2NVUB 1AU7A 2FDFA 3ECHA 1YI7A 2DDUA 1JJ6C 3J7NA 1N1YA 3USSA 5I8TA 4Q27A 2IBDA 3RG0A 3GZUC 5ICFA 5EYYA 2RS52 4BQOA 2XOMA 3A23A 2FDIA 4YVWC 3DEUA 1WLDA 3OEAA 1LOAA 2R7QA 2RDRA 3C7GA 2L9SA 1TT5B 2AACA 1VBD3 3F6OA 1AR63 4ONUA 2L9RA 1TNSA 4P5OA 1W6PB 2XUMA 1ZN2A 1QY4A 3JD72 3JREA 3I49A 2XBO3 2NLRA 4DFSA 2X09A 2EAAA 3JXSA 2CGPA 3GHMA 3HXLA 5E1ZB 4MXWA 2LSOA 4IE6A 3SZGA 4OIQF 3A4CA 1D1CA 1PZ7A 5EZHA 5ACA1 5ABJB 3QPHA 1B6AA 4N9HA 1R091 4OQ8A 2VQHA 3CNAA 1WKYA 4ATFA 1G3WA 5FUIA 1RUI2 3ONQA 1U5XA 4PSXA 3BPVA 3NJYA 4GH4B 3K4JA 4E2SA 4Y5SA 4D6QA 4R4XA 4UUSB 2J1EA 1LOFA 3PIJA 3D3AA 3OYNA 1K6YA 3H5RA 3DPRA 4KI5M 4XF4A 4FCAA 4JHZA 2WL1A 3DYMA 1W1WE 2EIMH 3KCCA 2C26A 3HT2A 3NEUA 2M8GX 4BK4A 5JI9A 5JI6A 3ERED 1GICA 2PLV2 5IVBA 3U0ZA 1UHSA 4YZ2A 4ZS3A 3SKJE 3K46A 3U75A 4NWWA 4P14A 4BGDA 2B4KA 2PAEA 3CF2A 5FY7A 2A5WA 1RUF3 4UB6C 3AL0B 4FTHA 3NAPB 1BYHA 3RZOJ 1CAUA 2KA3A 5ABJC 3MQ0A 5DMYA 2OUJA 2RVAA 2YPJA 3DEMA 3RZGA 3PNYA 3RZLA 2JECA 3SKVA 5FLXZ 1SMTA 5GZCA 5JUVA 1RXFA 4C2MJ 2WS93 1PVXA 4RB3C 5JDBA 1FNYA 1UY3A 2D6MA 1H2KA 2A07F 3ROUA 3AXDA 1D4M1 1EH6A 2BVVA 5KHGA 5K4LA 3ZXFA 4H55A 4X1EA 5GZEA 1W0TA 1WCQA 5E3LA 2AYHA 5DAWA 1ZA4A 2WZ8A 2W95A 2R6QA 3N7JA 3MW3A 2W00A 5JOWA 4YW4A 1J0RA 4XSZF 4U0VA 4BJ0A 3UKNA 4Q26A 2E60A 1I6XA 4XF9A 4PZJA 1DGRM 2OA4A 4U7BA 3FC0A 2BP6A 3AKZA 3ZSLA 1FPN2 1S9HA 5CBLA 4KQ7A 1QOTA 2ZAAA 3APBA 4ZZ5A 1Z7LA 2W1UA 2F4MB 2DV9A 4BA6A 2RC4A 4LG3A 3OYJA 4DQAA 2CMPA 4LHKA 3KSCA 1R71A 1HB3A 5DCMB 3HL2A 2ID3A 1F15A 2ZKNA 2M1BA 2OAZA 2WKKA 4F91B 2Q8DA 2G7UA 5FZFA 1V6IA 2YG0A 1MJAA 2HDWA 2DTWA 2XAGA 4YIIA 4LE3A 1JUIA 4WVZA 1IG0A 3J80Z 1FBSA 2XVLA 3O1UA 2RKHA 4XF1A 3BQZA 3JBG2 4Y52J 1CIYA 4CP0A 3OYAA 1WJBA 4AM3A 2J5OA 5HOOA 4XLCA 1USSA 1VMJA 5CNAA 2K9LA 3H0DA 2M7BA 1KQ8A 4AFAA 4L97A 5ICCA 1NCRC 5C3RA 4WXHA 3SFIA 4IEWA 4S2DA 3HOTA 4N43B 3R60A 3CUOA 2I74A 2Y0OA 3OY8B 5DDJ3 1X9TA 4HLXA 2VPLA 4NHMA 1RVF2 3HBLA 3ZM8A 1P8JA 4XBLA 3R6SA 3CJTB 4NN0A 3AYCA 5JVTA 3MI8A 2Y34A 1IS6A 3ZYGA 4I30A 1PVEA 3SHFA 4V2FA 3S2WA 3DXUA 3I97A 5C4XJ 3ULQB 1IZ1A 2KHMA 1US3A 1BIAA 1QMJA 5F0HA 1NOVA 4LKSA 1IRGA 2QKLB 4HEA2 3OY8A 2V6CA 3BJOA 2E2JJ 2DCKA 3CUQA 3DKQA 3PVEA 3KCXA 1HB4A 1XSVA 3OL3A 1E57A 3RKYA 4XUTA 1JJ8C 5EPAA 3MN2A 2W57A 3ACHA 5HNFA 2PFWA 2R7FA 5IY5H 3ZXKA 2HGCA 2ADUA 3NW4A 5FAXA 4Q29A 2L3DA 3WQ0A 2LALA 2Q8EA 2AXTC 4PQ9A 4ZJZA 1AXYA 4K9SA 3J7HA 2AS5F 1I1SA 3VBUC 1X58A 3KETA 1VBC1 2LOOA 4UOJA 5FY9A 1FMVA 1ZK8A 3I9V2 3RSNA 3AL6A 1SDDB 1MBGA 1W0NA 1H8TA 2L7MP 3BQYA 5LW9A 5C3QA 3TKYA 5FD5A 3NRVA 3OGRA 1MS3A 3LA3A 3ERMA 2VXDA 2C6YA 3ZSKA 2WIIB 4RAZA 3LQQA 2QBYB 2XVCA 1YLFA 1G59A 4YZ3A 3ABUA 1HV0A 1DBNA 2A1XA 2GMMA 4BYYA 2K02A 1GMMA 3RPUA 4E7SA 1SFXA 2NMNA 3KP7A 1Y0NA 1SD6A 4DIQA 4XRFA 4QGNA 2XLGA 3FHQA 2CGOA 1VQPI 2XLAA 2O6GE 4M74A 5FPZA 1FXZA 1LEBA 3NNGA 1A6CA 4P9GA 4EZ4A 3QPSA 1H1AA 2P6TA 3GF6A 1BCXA 2KQRA 1E0EA 1X50A 3B02A 3HIFA 4EN0A 3KT4A 5LD2C 3R61A 5DV5A 3RCOA 1TE1B 2XJVA 4FTBA 4PJLA 4BACA 3DU5A 1OISA 2ZGQA 4FOQA 1MGTA 5JPNB 1TWCJ 4PSWA 2MGQA 4NRQA 1REFA 4CDUB 3WU2C 3OPWA 2E1OA 3AG4H 3LSEA 2XJQA 3HD8B 3PO3J 3IH4A 4CYCB 1JHNA 3LWCA 1VQLI 2Z99A 2Y6LA 2ZACA 3K4DA 3GCMA 4K6BA 3CMEI 1OYWA 2VPVA 1ENRA 2QCSB 2J1SA 1TP4A 3ZFGB 2XPVA 1HN1A 1I3AA 1Z3XA 2CRGA 2FDJA 1CX4A 1ZBE1 1K5MA 2VMHA 3VYSB 2E7AA 3ETPA 5KBFA 2B9VA 3R4UA 2R5YA 3DQVC 4B48A 1MIJA 2OYZA 3KMHA 3HRSA 3POWA 1VBD1 3DXJF 1X8MA 2HVRA 4DNCA 2XWBB 1W5CC 3M07A 3N3HA 2CU7A 1LNSA 3EXUA 4Y7NJ 1KU9A 1XMXA 3DU6A 3WGIA 4AI8A 2QF7A 3BWGA 5J1XA 4UFMA 1PGSA 1OVSA 1RUH1 1O8SA 3QBQA 2H8WA 5HNHA 4A4AA 1X36A 3REOA 1B8IA 5A7SA 1FP2A 2NVQJ 5L3GA 2XBO1 2DURA 2DMNA 4OHYA 4BH9A 2F4PA 3AVSA 3MV11 2YB7A 3VZJA 4P96A 3H36A 1HDPA 5KHHA 1P9QC 1E17A 1UY2A 3ZXDA 1U8BA 3TMOA 4KWUA 1RUJ2 2W0XA 5FO9B 1MBFA 1G3YA 4AWXB 5FRAA 5ERLA 3H92A 1S7AA 3K2OA 2XB6C 2ZGMA 1BC8C 3MZHA 1A31A 5IT6A 1LHUA 1QJX1 4A3IJ 2JVGA 1K61A 1N25A 2VJIA 5KHKA 2IT0A 3AZXA 4NAMA 1UAIA 5F9TA 1QWRA 5CVIA 2V79A 1XX5A 3PTYA 5F6KA 1VBB3 3V0BA 4YFNF 4PDKA 1MNDA 1STZA 4IF4A 3ZFEA 3BTZA 2DBBA 3AYDA 4ZDLA 1UZZA 3O5SA 3SH3A 4QT6A 2ZB9A 4I6ZA 4KWJA 3NRUA 1T6GC 1AR82 3QH7A 2C9KA 2W3JA 1ULGA 1AJOA 4ORFA 4C1XA 5BNQA 4LMYA 2ADDA 3OBRA 2TCTA 3I3EA 3JCIA 3MZ8A 4QM9A 2DQLA 1X82A 1YQ5A 5H9RA 4AQ2A 2GIVA 3V7SA 3AZYA 4Q0PA 3PSFA 1MACA 2JA8J 3AZZA 3HOZJ 2NNYA 1GNHA 5IVJA 2WYSA 1W6NA 4I98B 1XCBA 4QPQA 3SCGA 5L36A 3K4NA 1W8FA 4B1RA 1E3OC 3BG6A 3LAJA 2BGOA 3VZKA 3FJSA 2JD9A 3OR2C 1NLRA 2F5EA 3U11A 2QUOA 4BMBA 2XPUA 3VBSA 4AFBA 3ZFGC 2CW7A 4OMZA 2RGVA 4YFZA 1BMV2 1G4DA 3DYOA 2ZAHA 3B00A 3HOXJ 3F6VA 2X5IA 2PQQA 1MZ5A 4P5HA 4ENJA 2B9UA 2AEZA 4A6EA 1ODMA 2D3SA 2JDKA 2WN3A 3CLPA 2A6HF 3WHBA 1S29A 3LSDA 3BTIA 5TJJA 4AIJA 3EYPA 1YXWA 1FMD1 4K3UA 4U87A 1ULEA 5K7ZA 1FEXA 4RM2A 3SEZA 5BPDA 5LHGA 2X48A 4LQRA 5JR7B 4B09A 2EFQA 4O6JA 1XQNA 3PHMA 3O7OA 1OT5A 2YXSA 3VZOA 2HWC2 4BY7J 3PVNA 3HOWJ 3BZCA 1Y7BA 5I93A 1STMA 4BDVB 3KHBA 1ERDA 1MPXA 2E63A 3S3NA 1J59A 5A3LA 3E5QA 3IIAA 2WFF1 3O1SA 4AYBA 1YX5A 2PTMA 3WF2A 4BCUA 2BU9A 4CVUA 2VODA 1ND2C 2DVFA 4I0AA 3DV8A 4YG3A 1OLRA 1KDMA 1ZRIA 2NP0A 2E19A 1H8TC 3MBWA 4HAMA 1XSDA 2XROA 5F8PA 4NR1A 2A3XA 4JGZB 3E7LA 4PF5A 3WGGA 3H50A 5DEQA 4V2VA 4RM3A 1FBQA 2Z2SB 4BPZA 5J1RA 1V6KA 5DAQA 3J7ZI 1XCVA 1Z3YA 4ASMB 1UJ8A 1W06A 4QQHA 1MZEA 4LMFA 1A8DA 4RQPB 4R9BA 4BK5A 3CCQI 2C24A 1P7JA 2JIGA 4Y24A 2ZMKA 1QGPA 3AJZA 2EA4A 1H6YA 2EJRA 2ZX2A 2HXOA 5CKMA 5A33B 3S0MA 3WF1A 2OA2A 4OINF 3F9KA 3LIHA 4B4QA 4H14A 4COVA 1OF4A 3RPUD 4MVTA 1VALA 4RAGA 4XHBA 3LAPA 4MO7A 3DBRB 3DEWA 1V5FA 2FDGA 3DLAA 2XSDC 2UUZA 1PUEE 3GZNB 5HLHA 4XRMA 2VKHA 1DCSA 4G7OF 3U4XA 3WNPA 4JAAA 3V0AB 4NIIA 5E16A 3X29B 2FQ4A 4B43A 5J3LA 4Q5SF 5CVJA 3T2TA 4KIBA 1HDKA 1OA2A 5DAPA 2E7WA 2P8TA 1WLWA 4RGXA 3TN93 2JPBA 4DXSA 2GMEA 3WF4A 4EEFG 2ZGSA 3M2MA 1X2NA 3VYTB 1BI2A 3CKHA 1W5SA 3W6VA 1E3HA 1QO0D 1YG2A 2Q8CA 1ETYA 2MC3A 3OEBA 4AVCA 4BZ4A 2R5ZB 1UX6A 1ZLJA 5CB7A 1V5GA 4O7XA 3RTRA 4QHZA 1B4AA 1RYYA 3QRFF 2BJSA 1FIAA 3L9FA 4PLOA 1V9U2 3MIGA 2WS92 1QRYA 4IQPA 2MA3A 4FXKB 3M4FA 3ASIA 1T95A 1REPC 3OF1A 2P5BA 4IHSA 4YW2A 3TRSB 1GOGA 5F32A 2FCVA 1H0BA 3BTCA 1SD7A 1RRJA 4HK9A 1W7PD 4OUMA 2V26A 2HWE3 1YNAA 5IPAA 1JKPC 1VFCA 2O8OA 4KNCA 2R073 2V4AA 3HN3A 3FXJA 4HSTA 4WM8C 1JKQC 1Q1HA 3A0KA 3GGLA 1YJLA 4MEYF 1J1LA 4EJWA 4J1WA 4U0YA 2XF6A 4W1UA 3ZYPA 2EZIA 1LTEA 4O5VA 3HAGA 1S6LA 3LAGA 3UV9A 1GLHA 4Y26A 1POV3 1FTZA 4AK3A 4QMAA 2QSHX 3JAMK 4YIFA 4UF0B 4PCRA 1FOD3 4Q4Y2 2NS7A 4Z2WA 2M4KA 1Z9CA 4CYCA 2XKPA 2B8MA 4IEXA 4FAHA 1Z7S1 3JTGA 1PVC1 2E36A 1I1EA 3N7KA 3N9NA 3B3QE 1JODA 2ENRA 4KGGA 2B39A 3ILRA 1SLAA 4D7MA 3BG7A 2DU0A 5H20A 1OI6A 5LGUA 1L3JA 5H9QA 1ZZ8A 1BOBA 1RUD2 3I3LA 4YYOA 4AEDC 5TSWA 4CZSA 1KGSA 2J1RA 3CJIA 1SVOA 4LO5B 2HEWF 4JX4A 1H8AC 4WM8B 4U0WA 4MYEA 1JTZX 2ZABA 5IYCJ 4XQWA 1RIOH 2WV0A 5FK7A 2EPFA 4RGAA 5AIQA 3N9QA 1GV2A 4KICA 1TQMA 1W99A 4FPFA 1TME3 4CICA 4FISA 2F5FA 1W9TA 3HM5A 5EQUA