1CGPA

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*A
publication title Crystal structure of a CAP-DNA complex: the DNA is bent by 90 degrees.
pubmed rcsb
total genus 59
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cgpA01
1HSJA 4S04A 1K7AA 4XSZF 4ZU7A 1TQPA 1YLLA 2ZKZA 4A12A 3LOIA 4FX0A 1ZRFA 1H1IA 4L11A 4D7TA 2XKPA 1U8RA 2O6GE 1IN6A 3J80K 4ESJA 4KUMA 2I45A 2GA1A 2VT2A 2ZMEB 5E1XA 1IAWA 2Z2SB 2ETEA 1BOAA 3EJKA 5JI6A 2Z3YA 3KEOA 2QJVA 2XKOA 3QRFF 5I0UA 1BI3A 3KP4A 4CDGA 2M87A 2P5VA 1WWXA 2IXIA 5L3FA 3CUQC 4R1HA 5LBQA 4NHJA 2ESNA 4HLXA 4U7BA 1H0MA 3WW3A 3QPHA 1R58A 1SD7A 3E5QA 3I0TA 3KMHA 4L5JA 3ZMZA 2HOEA 3T8TA 4IESA 1FBSA 2OZJA 3ERED 3FWEA 5AVPA 3W6KB 2Z9OA 2YU3A 2XRNA 5DV5A 3KZZA 4QLCU 1LEBA 4XFGA 4P9UA 3QU6A 1WI9A 3ECHA 2HS5A 2VBXA 2Q8KA 5HDKA 3RPQA 2FQPA 1A04A 1J0RA 2GC3A 4HVRA 2QM3A 5EEGA 4LFUA 3EDPA 2QDRA 5K8SA 1C0WA 1U12A 5CVUA 1O3TA 3EQLF 2E1NA 2PN6A 2IXHA 3V7CA 4EROA 1WSUA 4LB5A 2WC2A 2EVXA 4IVNA 1LDKB 2HR3A 4HYEA 4AVPA 1IUYA 4CXFA 4M73A 2GA2A 1P92A 1X82A 2F5FA 1HXDA 5D4RA 1QXRA 3HRSA 2NAZA 2BEOA 4FHTA 4AVAA 3KLNA 1S29A 2WTEA 1S6LA 4YYOA 2O1QA 4RGRA 5F6FA 1RC6A 2C0ZA 1ZG1A 4EMSA 3ZMVA 3CLOA 4D0PA 1XB4A 3VHRA 5BS6A 4G6DA 5LEJA 2NS0A 2ADUA 3BROA 2EV0A 1TNTA 3S2WA 4I2OA 1ON2A 2OD5A 3IRQA 1EYBA 5BV6A 4UV9A 2VOPA 3FHZA 3K69A 2EFNA 4PIZA 2A5YB 1F9NA 3FM3A 5BMZA 5FLJA 1UIKA 4EM0B 5LGNA 2JPCA 1I6XA 2XAGA 3DF8A 4P9GA 4N9HA 1KQ8A 4I01A 3COAC 2K27A 4AVCA 4HV5A 4PJYA 2ZFWA 1WLTA 4HBNA 2Q2EA 3ML6A 2KIUA 1YW8A 4I0BA 3L2CA 1QGPA 4M71A 4Q5SF 3ETQA 2XAJA 3OD0A 4UVAA 4Q47A 2P7VB 3KGZA 3FMSA 1U5TA 4XFCA 1OD5A 5J8CA 3VFZA 2PFWA 2P5LC 2O61A 3HQXA 1OKRA 1UB9A 2HKXA 3FJSA 2BGCA 3HHGA 1ZZ6A 1Q43A 3I59A 5JHUA 3KLOA 1FYKA 2J5PA 5KVRA 3WG9A 1YFXA 1EV7A 1PDNC 4MGKE 5L3DA 2MBFA 4ETSA 2D5FA 2VODA 2E1CA 1IXSB 3G73A 2NYXA 5LHIA 1MDMB 5BPDA 4MEYF 3U9GA 3V4GA 2IXCA 1XE7A 3I54A 2P6SA 2B5HA 4XEZA 1V70A 5FQ0A 4JBAA 2W25A 4EJWA 5BUVA 1YHFA 4LEJA 3M70A 4XFFA 3CUOA 1ZRCA 3BP8A 3RI4A 2Q0AA 3H7YA 4HDVA 3ECOA 2QVSB 3S0MA 1XD7A 4OIQF 3SQNA 4YG2F 1IPJA 1CAUA 2OZ6A 4MQVA 3SXWA 2B8MA 4I3PA 3KP7A 3KP6A 3HTSB 3NL1A 4UBGA 1LEAA 4KWLA 3OGJA 1AOYA 2DI3A 3V8JA 5DDGA 3SFZA 1B9NA 3MZHA 1OMIA 1VTNC 3M8EA 2YPRA 1J5YA 1KYWA 1CGPA 5LHGA 5D5UB 5LGTA 1EP0A 3MQ0A 3LSTA 4ZYGA 5CVRA 4EJVA 2EA2A 2DK8A 1Z91A 1FI2A 4RGSA 1QY4A 5FLHA 5KHKA 2H0VA 4B09A 3ELNA 2EFWA 3KEQA 5LEKA 1W7PB 1MJBA 4IEXA 2RN7A 2ZXJA 3F8CA 3IDCB 3KE2A 2A6HF 4EM2A 1WRJA 4HA8A 1F5TA 3F8NA 1Z05A 5FDBA 1SD4A 4HX8A 4ZZDA 2KRFA 1IRFA 4PCQA 3TO7A 1P2FA 2AS5F 3HRUA 3MFKA 1W4MA 4OINF 4B29A 1Y9QA 3SHRA 2HJIA 3FXUA 3F3XA 2XL9A 2IJLA 3C3VA 4MV2A 5C6CA 3HRMA 1O5UA 4WF2A 3BY6A 5FLXZ 2LF7A 1X8EA 4XFIA 4R8HA 2AXLA 5KBFA 1FPQA 3JSPA 3MYXA 4P96A 3LA2A 5FCCA 3RKWA 4HW0A 2DBBA 5D4SA 2Y0OA 2HEOA 1MZBA 3GUDA 1PUEE 5KHIA 4A2UA 5DD8A 4N0BA 4O5VA 3F21A 1T38A 1XGSA 3VB2A 2FU4A 1TLHB 1UCRA 1CAXB 3IKTA 2OPKA 4Z82A 2Z5UA 1ZLKA 3U10A 2QUFA 1SMYF 4ESFA 4I7HA 1BI2A 2QENA 1EY2A 3BJAA 5E8GA 2CV6A 2RVCA 3DL3A 3NVCA 5KK1A 5F64A 2FBHA 2RV8A 3FXQA 3BDDA 1H1MA 2Q30A 5JFRA 3DPLC 2PG4A 2IA0A 5K1YA 4Q0QA 4B8XA 3MDPA 3PQKA 3ZMTA 2UY9A 3H1MA 3IIAA 4HLTA 4WK8F 2BNNA 3DV8A 2QBYA 3ZQ7A 3LAPA 4TLFA 1VR3A 4RGUA 5FFXA 3LAJA 4U88A 1SFXA 3KP3A 4YFNF 1PP8F 4KIGA 4PGGA 3GBFA 4JTNA 2V79A 2BYVE 2PQQA 2E7WA 1XE8A 5JVTA 1DP7P 3DEUA 4Z07A 2BV6A 2LF8A 2VT3A 3EUHA 1O57A 4P55A 4UVCA 2B0LA 5ICCA 5HDGA 2CYYA 3O3KA 2DTRA 3R0JA 3R6SA 3RYKA 1ZZ8A 1IN7A 4HZFA 4XETA 4FT8A 3EHKA 4PZJA 2P17A 2HFHA 3H3ZA 4XF0A 5L3EA 1AWCA 3P9CA 2IP2A 3E97A 3C3WA 2ETHA 1S8NA 3E6BA 4G6QA 3Q9SA 3GWZA 5F1RA 2UYBA 2KXLA 2FBIA 3IRRA 2K4BA 2QZ8A 3V7RA 1IN4A 3OTFA 2RC4A 1YO5C 4S05A 1OR7A 4RAYA 3LA7A 3TDUC 3JSOA 5I0RA 1CF7A 4FAGA 1ZZ9A 4DNCA 1I5ZA 2A07F 3F6VA 4IPAA 1QZYA 3FMRA 4XFBA 4BYYA 3KSCA 4FBFA 3FX3A 1JHFA 5FD6A 3WGHA 2XV4S 1L3JA 2QCSB 5K5OA 4H0EA 1FYLA 5L3GA 2MNGA 4HX7A 1O7FA 2IXLA 4CYDA 3REOA 4I0AA 2ESHA 1ZG5A 3ST7A 1J1LA 4YNIA 1X7NA 2YSRA 2EJRA 5FO5A 1BI1A 1V3FA 3IDBB 4OMYA 3H7JA 2F2EA 3TOAA 1RUNA 2CAVA 2L4MA 3R4KA 3CO2A 1YFHA 3OF1A 3S7EA 2D40A 2WFPA 1ZLJA 5JR7B 3O14A 2O3FA 2ZNYA 3LFKA 1PM7A 1OYYA 4ZYEA 3MPBA 3HRTA 3J80Z 3BCWA 1MD0A 2GZWA 3H3UA 1NYWA 3CJXA 4BHBA 5DCMB 2PTMA 1J9IA 4UHTA 4HF1A 3I53A 4Q0PA 4MTEA 1OFNA 3ZP5A 2RDPA 1CAWB 3RKYA 4AD9A 3CL1A 1CAVA 2FA5A 3OCPA 3F8BA 2RQPA 4GXOA 4UXAA 4HSJA 4LLLA 1T0FA 5CVVA 2D93A 1XN7A 4Y13A 3FM5A 4G7OF 5LRSA 2GQQA 1I1GA 2IA1A 2XVCA 4XLNF 3JAMK 4XF1A 2DPUA 1YFUA 1MJAA 4LULA 2D1HA 1X8MA 5I8SA 1YQAA 3KCCA 2G7UA 1XCBA 3HSEA 2V09A 2Z69A 4CICA 3DXJF 2FNAA 1ZRRA 1HQCA 5D5VB 3T8RA 2EAAA 3FF5A 3ROUA 4OIRF 1FX7A 3QOPA 3GO5A 2IXKA 3WU0A 2FMLA 2ZJ2A 1XDSA 4KWJA 1EH6A 5JSRA 2V6CA 1KQ0A 3E5XA 1U3EM 5JCTA 1NXMA 1F4KA 2O03A 3H1WA 4LG0A 5I91A 5J7MA 2KJCA 3IWZA 3K1MA 1BM9A 4IRIA 5ILVA 5ILSA 2L4AA 1UCXA 3GVAA 2Y0MA 2IC1A 2YX4A 2HWVA 2A6EF 1G3TA 3D5LA 4Q29A 2MH2A 4LD5A 4A5MA 4GO1A 2CWEA 1EH7A 1L0OC 4IEVA 3FMQA 3P7NA 1ON1A 3QPTA 3LQQA 1SFUA 3T0YA 3R61A 1SQ4A 3RNSA 2OAZA 5E1WA 1B1BA 4E2SA 1WKMA 3V8KA 4A0ZA 3WODF 1IF1A 3GYHX 4KN4X 3C1DA 3WGGA 2LNBA 2OQGA 2CFXA 4BXUA 1QBJA 3MWMA 4KL1A 2FE3A 3F22A 5FGMA 2OYZA 4L18B 1NZCA 2DW4A 2WWYA 2K4JA 2VBZA 4I98B 1UHMA 4MGIE 2K9ZA 4G7ZF 3HT2A 5BOXA 1KGSA 2HQRA 3IHUA 2CW0F 4RB0A 4I02A 3RPUA 1FP1D 2EK5A 2UZKA 3BALA 4LUKA 1KA8A 2UXXA 1FY7A 1LR5A 4Z2YA 4X6RB 2K0GA 1S7AA 3S7IA 3BPXA 3WW2A 4I09A 2D5HA 1TW3A 2J5OA 4IRGA 1JXSA 4RB2C 2DFIA 4LLOA 1O3QA 4XSXF 4LA2A 3LQRA 1BI0A 2MH9A 2YR2A 3ISPA 2FQ3A 4U7DA 2A68F 1BJAA 2GU9A 2XAQA 1J3RA 5D1IA 2VE8A 2EFOA 5HI0A 1U2WA 2P8TA 4HVQA 1BN5A 1FBQA 2OBPA 4OMZA 1RL3A 4O3MA 1FP2A 3WTZA 2BNOA 1TBXA 2P4WA 2QQBA 4YARA 2CAUA 4G7HF 3EYYA 4HX4A 5EEHA 3HHHA 3PVBB 4WCGA 3SCGA 3WW4A 2DU9A 4A6EA 4LG0B 1T98A 2MLGA 1XSXA 4TV7A 1T2KA 5BY5A 2A3SA 3LWCA 2X4HA 1YYVA 5J3UA 2VBYA 4L2NA 1FT9A 3NEUA 3KP2A 3FZ3A 2CGPA 1IXRC 4L5IA 2L3DA 4A6DA 4EQQA 2H6BA 2ZBKA 2COMA 3L2HA 4HLYA 4IETA 3Q5FA 1Z7UA 5KHHA 3GX4X 1D8JA 1FLIA 1ZZ7A 4M72A 1FOKA 4AQ2A 5ICEA 5L3BA 4A0XA 3BU7A 4UUVA 4AIKA 3ULQB 3UKNA 4OFGA 1KU3A 3QACA 4AIJA 4WXDA 3DPTA 1IZ1A 2PLYA 4IRHA 1QO0D 4KFCA 2VECA 2JTVA 4XBFA 3IL2A 4Q0UA 1ZRDA 1XCVA 4CZZA 3U2RA 2FOKA 2MLKA 2V9VA 3O6BB 2JT1A 4Y17A 4E2GA 3CUQA 3PQJA 1J3QA 3BPVA 2M30A 5DD4A 4AXOA 4Q48A 3JZVA 1FXZA 4MHGA 3AAFA 1REPC 1LQ1A 4PGHA 4JV4A 1K78A 1UHWA 2M1BA 2M5WA 2GC0A 1RI7A 3E6DA 2VOOA 3KETA 1LB2A 3LA3A 1YW7A 3L9FA 2ET7A 2CG4A 4MH0E 4U0VA 5DUIA 4PDKA 4KA4A 3M1EA 3PNAA 1UD1A 1JUHA 1BIAA 1F1ZA 2GH2A 5FPZA 4R79A 1R5HA 4KNYA 1U5TB 1TNSA 2GIVA 3GFMA 5HLGA 3HT1A 4IF4A 5E18F 1ONVA 4EGYA 4MEXF 4K2EA 3VODA 3I59B 1ZREA 5HS7A 4AQ6A 1XRUA 3TOBA 2Q0OA 2ELHA 4M9XA 4QM9A 2RNJA 4LA3A 2Z33A 4WBBA 3ELKA 3M7GA 3J81K 4BH9A 3FE5A 4CO8A 4XFHA 2LDUA 2N7GA 3DQVC 4EJTA 2LKPA 5FQ0B 4HMZA 1O5LA 4QM8A 3GW2A 5E16A 1K6OA 3QAHA 5H20A 5AONA 3QP6A 3NKTA 4JTOA 4WVZA 4HN1A 1P4WA 5D6EA 1CAUB 5BXXA 2MPFA 4G94A 1IXCA 2MC3A 1K79A 2LSOA 3LWFA 1R36A 4MNUA 1YWKA 2HYFA 3U1DA 5A2QK 4ZU5A 4BAYA 4OLLA 4LB6B 1HKTA 1LDDA 1EPZA 4KMUX 3JTHA 4O9GA 1JGSA 2W84A 1ZZBA 4OIOF 2NRAC 1XGOA 1K78B 2ZKLA 2STTA 4X6QB 2H27A 1E2XA 3D0SA 4HN0A 3ZN1A 3K9TA 4KU7A 1BC8C 1OYIA 3ABTA 1RIOH 3TGNA 1USSA 1XGNA 1YTYA 4PIYA 1XMAA 1LRHA 4AIHA 5CJ9A 4L0ZB 4H7LA 4KT5C 3VOEA 4L9VA 4LK1F 3WTSC 4KYWA 3F72A 4IEOA 3H1YA 5IT9K 1W5TA 2G7HA 3SCFA 2ATFA 4QMAA 5HS9A 3CDHA 2IVMA 3K1NA 2XAHA 3N4MA 4KMFA 2EA4A 1TQMA 3H9AA 2HQNA 2PHDA 1IN5A 2JZYA 4O6JA 3U11A 2XIGA 3I7DA 1TQIA 4N9IA 1GQGA 1O4TA 2CQKA 2HTSA 2VBWA 1XDUA 1G4DA 4LLGF 1S7OA 3TKYA 4YSFA 4QGNA 5BQTA 2ZO4A 1G6NA 3ZMSA 2ZMEA 3WTUC 4ZU4A 3KGLA 4GYGA 2K86A 4WZCA 3CJNA 5KHGA 2QVOA 1S3JA 1D5VA 3ZPLA 1WGPA 3H92A 3TO9A 4RB3C 3T1BA 2L02A 3EETA 3GEZA 2UXNA 5FD5A 1Y0UA 4IJAA 2TDXA 3HIFA 2DQRA 5I0SA 3WTVC 1HW5A 1E17A 4LGWA 2XL7A 4YIFA 3D82A 1YFWA 2RKHA 5H6RA 2K7LA 3L09A 4BHPA 5L3CA 1QNTA 3JTGA 1SEFA 2QBYB 2X0LA 2W24A 1CX4A 3K1PA 4LLNA 2QQ9A 1YUDA 3J7AO 5E1RA 2PAEA 4ENJA 1U5TC 2KJBA 2GC1A 4M74A 4BQAA 1T39A 1NHAA 4GCVA 2XASA 4L9JA 4L9TA 1B4AA 3IWFA 1LKNA 1OPCA 3PLQA 3DFGA 2V1XA 3B02A 2STWA 3BWGA 1D3YA 1MGTA 2VC0A 3RZZA 3CTAA 1FSHA 3ZMUA 1UW8A 1GHCA 2A61A 2ISYA 2GAUA 1IPKA 1TQ5A 5FPXA 2DT5A 3JAMZ 5JR3A 1WQ2A 4WX9A 5FFZA 1RTVA 2B9UA 1ZVFA 2E7XA 4F8AA 5CVIA 2FF4A 3EO6A 3GYDA 2IA2A 3EQEA 4UNOA 3QU3A 3DP7A 3FZVA 4XFAA 1DPRA 3V7SA 2D2WA 3TNPB 3GF2A 5ED4A 3LZZA 2R7DA 1ZX5A 3NSTA 4A5NA 3MAJA 5CADA 1GQHA 2OA2A 1ZGJA 4HF2A 4UXNA 1Q1HA 3IBMA 3QP5A 3E6MA 1YG2A 1FBUA 1RGSA 2H09A 3WE2A 1DPUA 1CF7B 5FLIA 3NW4A 2DK5A 2OU2A 2IT0A 3RIRA 1HW2A 4GYIA 3BJOA 1Z6RA 1XMKA 2D1VA 4R52A 3CLPA 1VP6A 1B59A 3PFIA 2EFPA 5HDNA 4KN7X 5I8YA 1ZHFA 1BIBA 4HVOA 1RZ4A 4G8XA 3RJPA 2P7CB 1O3SA 3UKTA 1G3WA 1U6GA 4XF3A 4JK1X 4IHSA 4L9NA 5HLHA 2QLZA 2CSOA 1HW1A 4O9EA 2PMUA 3HYIA 3GLXA 5FB2A 3FFQA 2EFQA 4QGMA 2Y75A 3HOSA 2BNMA 3HUGA 3F23A 2F5CA 4ZYDA 1G3SA 4MQ9F 2Q4SA 5JSOA 4ZZLA 2W57A 1W5SA 5BPXA 2C6YA 5H6QA 2PA7A 2NNYA 3MEXA 3Q9VA 4XRFA 3ABUA 2FXAA 5EZWA 3SMHA 2DCTA 2OA4A 1R5GA 2R7FA 1H9TA 4BNCA 4IEWA 1MDMA 1ZARA 4MTDA 2QQAA 2GXBA 2IPQX 1OI6A 1ZGAA 4MGRA 4HOBA 3FXRA 2RGVA 1TW2A 3EBRA 4HSLA 1RNLA 4MX3A 4M6XA 3HSFA 1IW7F 1R1UA 3RYRA 1CAVB 3C7JA 1R1TA 5JAXA 1V4RA 1R7JA 2O0YA 4NB5A 2WV0A 1HKSA 3NQOA 2MA3A 2QWWA 5E17F 2PHLA 4HAMA 3H50A 3F8MA 1STZA 4KIBA 1ZH5A 1YS7A 2OZUA 4Y15A 5LLQA 4UVBA 2FBKA 3TO6A 2PJPA 5KHJA 5DUKA 2YX7A 2EV5A 4DQ2A 4IEZA 1SD5A 3BB6A 2ZCWA 2ZNZA 2Q1ZB 3T5XA 4ORFA 4WWCA 3JW4A 2PAKA 1TTYA 5CVJA 4EJOA 1FSEA 1J59A 2DO7A 2PEXA 1LJ9A 4YFKF 2IW5A 4XF4A 4BHCA 2ET1A 1BBYA 4FX4A 1W7PA 1KYZA 2G9WA 1SAXA 2FRHA 2O8XA 5T3NA 4EWEA 4EJUA 4G9YA 2D45A 4Q4ZF 2QYOA 1SMTA 4ENKA 3OV8A 1B9MA 5ILUA 3SZPA 4EGZA 1MKMA 3I64A 3U0ZA 4EV0A 3RYPA 5HVQC 1UIJA 4E70A 1SD6A 4HV6A 4U0WA 4HF0A 4IXAA 5LGUA 4K8FA 4CGZA 3SXYA 3N97A 1OYWA 3R0AA 1FZPB 3BOQA 5I93A 5DCFA 3BZ6A 1YFYA 5AIPA 4LTAA 3CEWA 2F4PA 4HDUA 5CYVA 3NJZA 1QQIA 4YFXF 5IT3A 1ZAOA 2L01A 3B73A 1DGRA 3DN7A 4KU8A 1EH8A 1J75A 4IEYA 4QXKA 4Q0VA 4UV8A 2M8EA 1KU2A 4HQEA 2MD5A 4EM1A 1X3UA 4AVBA 3GFLA 2DQLA 1CAXA 1LVAA 1ULYA 2NNNA 1R23A 1DDNA 4D7SA 2CO5A 2O8QA 3M8FA 1BC7C 4KWKA 2VE9A 3ZDSA 5D6FA 1ZG3A 5JSPA 2OQRA 1DZRA 1JHHA 1QZZA 4ASNA 1GXQA 1HBXG 3I71A 4QX5A 2JRTA 2ISZA 2QNKA 2PI0A 1R1VA 1LDJA 2FSWA 4ONUA 2P6TA 2VPVA 4QGLA 1WA4A 2PBIA 1HKQA 1Z9CA 3ES1A 3TDZC 4HQMA 3J81Z 2PMHA 5LRRA 4Q0SA 4WXCA 1B6AA 4RB1A 2HKOA 4F7ZA 3M3IA 1YLFA 1YW9A 4WXHA 3W6JB 3SCHA 2XLAA 3CO7C 2EV6A 5D5XB 3K0LA 1KU9A 4ZYHA 1D8KA 1J7KA 4M9ZA 2VQAA 4LK0F 3TNQA 3P9KA 4DINB 1XGMA 1RUOA 3RDIA 4IHTA 1R00A 2V1DA 1ODDA 3OOPA 4JQFA 4KDPA 3VEPA 4ZH4F 3ACLA 1P4XA 4L0YB 3L7WA 3WE3A 3GXOA 2MHFA 3G7DA 5A2QZ 1PMIA 3CF6E 4U0YA 2PQ8A 4CHUA 2XROA 1Y3TA 1ZZCA 3ZMDA 1W7PD 3ZN0A 3MCZA 2EB7A 2E9QA 1NE4A 2IXJA 1T6SA 1XSVA 5CLSA 3HTUA 3M9AA 3HSRA 1P4AA 3O2PE 2HYGD 1DUXC 1I27A 2UYAA 1GXPA 3CUQB 2HZTA 3SHFA 4KICA 5FLXK 1LNWA 4QWQA 2XLGA 2KKOA 3G3ZA 5DYMA 2JPBA 1SFEA 1J58A 4RGXA 4GULA 1J2XA 3D0JA 2VN2A 2P5KA 1FYMA 1G3YA 5J6XA 4RAZA 4MGZE 2EWNA 3BPZA 4E2QA 5IT9Z 1KQ9A 1R22A 2GWRA 2VONA 3GZ6A 1FWZA 2BE5F 3CO6C 2W85A 1P6RA 4IEQA 4KIFA 4NQWA 2K02A 2R3SA 5DEQA 4AWXB 1SFNA 2L54A 1J3PA 3C18A 3E5UA 1PP7U 4IEPA 3WGIA 2Y48A 4LJZF 4XLPF 2XHKA 2VC1A 1QPMA 3ES4A 2DAOA 5HLIA 3WTXC 1DGWA 3UKVA 5ERIA 4P9FA 4FAHA 1NE6A 1UFMA 2FEZA 2PFBA 3HOTA 4JVAA 4J1WA 3GFJA 3H8UA 4RS8A 4XF9A 4EWAA 4YRDA 3F8FA 5EFUA 2EA7A 1VJ2A 3I5UA 5BPIA 1Z6TA 2V1UA 5DCMA 3I4PA 4MZUA 3V8LA 5CU1A 1U78A 4EWDA 4LMYA 4P5OA 1ZNPA 3L00A 3WW1A 1CAWA 2DPDA 3RKXA 3USSA 4M9SA 4HBLA 4ENMA 1FNNA 5E1ZB 2XUBA 2HGCA 2UWMA 2VXZA 4META 5D8KB 3IC7A 1MJ9A 3KFWX 4RD7A 2UY8A 3TQNA 4OOIA 3DKWA 3MZYA 5J48A 4OIPF 2F5DA 4UBHA 2FMYA 1O7LA 2ACJA 5C8WA 3WTYC 3R60A 4MGYE 1GVJA 2XAFA 2H6CA 2PYTA 1QXJA 2KIFA 5K5RA 2KIMA 5I0TA 4IEUA 5AIQA 3SZTA 3BJ6A 4MUVA 4LUMA 5LHHA 3P9IA 1USTA 5TRDA 2FNPA 4IERA 2PAMA 5J8FA 2F5EA 3RTRA 5HOOA 2DLLA 1XSDA 3LAGA 4NVPA 3FHIB 3K2ZA 2H94A 2Z99A 3KP5A 4J1XA 5D8LB 4YIIA 5TJJA 4M6YA 4PIXA 1I1SA 2XLFA 3WU1B 1FC3A 3EYIA 1O3RA 3GZ5A 4ESBA 2HTJA 2XGXA 3F6OA 3KZYA 1HSTA 3E3VA 5ICGA 5HS8A 1H9GA 2A69F 4EVIA 1Q5OA 1IRGA 3I58A 2JSCA 5ICFA 2HDCA 1Z1DA 5E20A 1QWRA 3WTWC 4ENNA 5I8TA 1Q3EA 5D5WB 4A0YA 1ZN2A 1JE8A 3NRVA 3E6CC 4OU0A 1KU7A 4ON0A 1ZYRF 1DZTA 5E8IA 5K5QA 6PAXA 1YIOA 1UPIA 2M45A 3IKVA 2GC2A 2IRFG 1IN8A 4GGGA 3GFIA 2BBYA 3WTTC 1L3LA 1YS6A 4BIFA 2GXGA
chains in the Genus database with same CATH superfamily
2BY2A 4S04A 1K7AA 1JOBA 2CUJA 4FX0A 2ZGKA 4D7TA 2EZHA 1C8M2 1D4VB 3NJVA 1CZSA 4CUGA 2O6GE 1XG1A 2NYYA 2Z2SB 4HPKA 4D5FA 4D3WA 5EGOA 1XJAA 2XKOA 3KP4A 1BVVA 1IV6A 4XIDA 3CUQC 4R1HA 5EJCA 2F17A 4Y4RA 1H0MA 2F6CA 2BP6A 2FOWA 1PO12 2EZLA 4NR1A 3ZMZA 2HOEA 4IESA 4A44A 3SEEA 1AR72 5AVPA 3W6KB 5LATA 2BVVA 5DV5A 3KZZA 3NV4A 4P9UA 2HS5A 3RPQA 1J0RA 4HVRA 1OLTA 2QM3A 2DFFA 2DVBA 3EDPA 1ZQ3P 1H4HA 4MSVA 1VBD2 2IXHA 4LB5A 4BK4A 2EVXA 2HR3A 4YM2A 3WG2A 2GA2A 1UXXX 4BE0A 5GZDA 4ITVA 2H0BA 5A80A 3TP0A 1HXDA 2FCVA 4S2FA 3SJMA 3DLLF 3WG1A 1COV2 3HJEA 3HOXJ 5HCAA 1VBA3 1X9TA 3KLNA 2R7WA 4OUSA 3LEKA 1RC6A 1NCRC 3UESA 2C0ZA 4EMSA 2KFDA 4Y20A 2DYCA 3PNVA 1XB4A 2FZ2A 5LEJA 3CMGA 4XIKA 3CKHA 4KGQA 3S2WA 4I2OA 3IRQA 2LREA 5GTIC 4UV9A 3CZJA 4YW6A 2A5YB 3FM3A 5FY5A 4AE2A 2AQFA 1UIKA 1OSGA 4EM0B 5LGNA 3H42B 3K70D 1XS9A 2CUEA 3I9V2 2XAGA 3AP4A 5F0FA 4P9GA 4C91A 4XDQA 2WZPP 4I01A 2YC0A 4QSHA 1I3AA 4PJYA 3KCXA 2A5WA 2KIUA 1YW8A 5F5IA 4QQHA 1QGPA 1QZEA 3OD0A 1RMU2 4UVAA 3R4UA 3BCAA 1WJEA 3OYJA 2ZHKA 2KA3A 1U5TA 5IVYA 3LFUA 5J8CA 1RINA 1RETA 2PHWA 1W6PB 2P3KA 3W5NA 3HHGA 1Q43A 3I59A 1FYKA 2J5PA 3WG9A 5FV3A 3F0CA 4FOWA 2LY1A 3WUDA 1MEC3 2E1MC 3RRDA 5FLVA 4FQZA 5DAVA 1NK2P 1IXSB 4QKBA 3MI8A 2M7BA 1MDMB 2TBVA 1LFBA 5DPNA 3U9GA 1ULEA 2IXCA 2V4AA 1BEV3 1XE7A 5T55A 4TTGA 4BCUA 3I54A 2XB5A 2P6SA 2EINH 4P1WA 2W47A 4XJUA 1S7EA 1U9OA 4JBAA 2XJQA 5J3LA 1O4ZA 5FZOA 4PBOA 2BQPA 4C2MJ 2RS52 3M70A 3X29B 1UNBA 3BP8A 5C33A 2EZKA 2HNHA 2JDAA 2Q0AA 3H7YA 2QVSB 4OIQF 4YG2F 4FTSA 2M34A 2QCOA 1XE0A 4I3PA 3ACHA 2ARAA 1S0GA 2DA2A 1R4NB 3WQ1A 3NJXA 4B4CA 2DI3A 3BT9A 1A5JA 2VW0A 1ASJ2 3SFZA 1VTNC 4JGYA 4V19K 3M8EA 2C26A 2ZMEC 1LE8B 5C9AC 5LGTA 1EP0A 1IQAA 4MHRA 1HXS1 5CVRA 3J7ZI 2EA2A 1Z91A 2H0VA 3N7JA 1R5ID 1UYZA 2HWF2 4RQPC 5LEKA 1OA4A 1UPSA 4L8QA 1MJBA 4IEXA 5JPNB 3CC7I 2RN7A 1AHSA 3F8CA 4ANJA 4AI9A 1NA1A 2X09A 2IGMA 1Z78A 1SC7A 3FUQA 1FMVA 1X4OA 4DOZA 1SD4A 2XHNA 2RS13 3KV6A 1IRFA 3H9GA 2FDHA 4W6XA 2AS5F 2IFWA 2LRDA 1W4MA 2HWB2 3SHRA 2IJLA 4FPYA 4W8JA 4PLNA 4R9DA 1CX1A 3FBMA 3S32A 2RDSA 3BY6A 5JOWA 5IOZA 1T8IA 3P5JA 5KBFA 1V5FA 3JSPA 2W7NA 2DFHA 1WMEA 4LBJA 4HW0A 3JRFA 3DECA 1ETQA 1AKHB 1SFPA 4UI9L 5DD8A 3BOPA 2HQ5A 4N0BA 2GM4A 2B42B 3AL0B 2QF7A 3F21A 3AYAA 3VZNA 1T38A 1MS8A 3G2BA 3LSMA 3OIOA 1RUI3 1W6OB 2LK2A 3AYEA 4PF1A 5CKMA 1QJY2 1NZIA 4FQGA 3IKTA 2OPKA 2VTFA 1KFUL 2VOVA 3U10A 4L92A 1SMYF 2BW3A 1VQOI 4ESFA 3DWLE 2QENA 2HWD3 2WR9A 5E8GA 2ZACA 5DS9A 5ABJC 2KD7A 1ETVA 2F6BA 5EZHA 2HBUA 3V42A 2YU2A 5FZBA 3MW4A 2Q30A 1JTXA 5JFRA 1D4M1 5FZ1A 3KF3A 2P81A 3H1MA 1T6GC 4HLTA 2IXSA 1UZYA 1UMZA 4M3BA 3DV8A 3ZQ7A 2VC9A 4TLFA 1VR3A 1DZQA 2KDOA 1PP8F 4BQ4A 1W8FA 3GBFA 4JTNA 2V79A 2BYVE 2NOGA 4LO7A 1LECA 1FIPA 3GF6A 3ZFEA 1JYCA 2BV6A 4JQTA 4E7HA 1JTYA 2DFCA 3D5SC 1IS5A 3K3NA 2A7AA 3EUHA 3HKZN 1O57A 2B0LA 5ICCA 4QPIC 1JZ6A 4XNFA 1EAH1 1QMJA 3ZR8X 1C5HA 4UWDA 1WA6X 3EHKA 1DQ5A 4PZJA 2HFHA 3NNFA 4CXXA 4MG2A 3K51A 5C70A 4PCRA 3G71I 5L3EA 2CQ7A 1UKRA 3NJYA 1HRI1 5F0HA 2ETHA 3E6BA 5D8AA 1X2MA 3KS7A 4OUMA 4YVWB 3FLTA 3GWZA 3K46A 3QQAA 2WZR1 1GU3A 1YX5A 4OYUA 3CQZJ 1DIWA 1FNZA 3GBWA 4LITA 3AYCA 3IRRA 1PX3A 1C1FA 4JX4A 1F2NA 3ZO0B 4BY1J 4S05A 4RAYA 2NMNA 3JSOA 3OPZA 3DTEA 5I0RA 3G1OA 1HQNA 2XJRA 2ZC2A 1SDWA 4DNCA 5E3LA 4IPAA 1NY72 1Q56A 3UGGA 2BZDA 1P9QC 1ITYA 1SPPB 4QX8A 2ZEWA 4BYYA 4RLFA 2ERFA 2DBNA 1MS1A 3VYSB 2UWCA 2BBAA 4MFEA 1XYOA 1JUMA 4I0AA 1ZG5A 4NQWB 3HAGA 1OQDA 2JIGA 5FO5A 3RFRA 3T1MA 3GZEA 1CIWA 2F2EA 2E5NA 2KP6A 2WWUA 3H5NA 1PO21 2CAVA 5IYDJ 3JBG1 1YFHA 1V6KA 3OF1A 3S7EA 1ZLJA 4HNUA 5JR7B 1IO2A 2O3FA 5FY7A 1PM7A 1OYYA 2DMUA 2OUMA 4PQ9A 4HETA 2XF5A 2HYXA 3HRTA 3GHNA 4D94A 3H0OA 1AYM3 3Q0VA 2ECBA 3J80Z 3BCWA 2R7SA 4XDOA 5T5LA 2VVDA 2PTMA 4UHTA 4ABZA 3I53A 4DBRA 1CAVA 3F8BA 5HCBA 1JKOC 2AREA 1T0FA 2X48A 3PUHA 5CVVA 4Y13A 4G7OF 1GMMA 2EIDA 2WO3A 4EQVA 2D44A 1K4TA 2XVCA 3AMMA 2HOTA 3I2DA 3AZXA 1IG3A 5F8PA 1GV9A 2DODA 2R1BA 4NWWA 1RUJ2 5JXIA 2RMU1 4XF1A 2COBA 3OWTA 1B8IB 2IUWA 1FMD2 2JA2A 2G7UA 1UWWA 3DKXA 1FEXA 1HOMA 2YY1A 4DXRA 4LORA 1UAIA 1KD7A 1ZRRA 3HGGA 4AFCA 4OI1A 4NO4A 3OUHA 3CCYA 3GO5A 3L2RA 1JODA 4Q4Y3 2IXKA 2FMLA 3POFA 2DA7A 1XDSA 1EH6A 1KQ0A 5JCTA 2WT2A 3CMEI 3CMMA 4P9XA 2D6LX 1WJBA 2V5YA 3VWBA 1H89C 1SZBA 2KJCA 1JMUB 1BM9A 2HQAA 4ISRA 3L2WA 4EATA 1G3TA 5A7NA 1HB3A 3C7HA 1AR81 4A5MA 4GO1A 2CWEA 1EH7A 3VBOC 3ZLIA 2E19A 4IEVA 3FMQA 1ON1A 1SFUA 3T0YA 1AX1A 3R61A 1RUD2 3RNSA 2OAZA 5GAHJ 3CCSI 4QB6A 3WODF 4Y52J 2ELKA 4NAMA 2LNBA 2CFXA 3RG0A 4BXUA 4LK6A 2O8OA 3S15J 3W6VA 3HOVJ 1MZ5A 3MWMA 4KL1A 3F22A 4Y4YA 2YFUA 4F91B 1OOPC 1RUG3 5CBLA 4L18B 1UX7A 3VBHA 3S5QA 1A8DA 4Q27A 1XXNA 3H3LA 4DZPA 5FXXA 4J19A 4LIVA 4TN7A 2K4JA 4I98B 3RSNA 3AMQA 2K9ZA 3C7GA 3J7LA 2IFRA 3HT2A 5JI7A 1SVLA 4PJMA 3H8RA 3RPUA 2DA5A 1FP1D 2EK5A 2UZKA 3ZFGB 5FP3A 2R7EB 4LUKA 1AJOA 1OC1A 1LR5A 4X6RB 1QJEA 3TOJA 4WM7C 3S7IA 3WP6A 4Y3OA 4I09A 1QJFA 4M4RA 1R49A 2V72A 3VBRC 5IPAA 2IS2A 4XSXF 4LA2A 3LQRA 2Q8CA 4RHV1 2CQXA 2YR2A 3JB4C 2FQ3A 1XNDA 4XUQA 3UV9A 2XAQA 2VE8A 3ZRGA 2ARXA 4GJZA 1DGWY 1U2WA 1RL3A 4OMZA 3B9CA 1OLME 1LOGA 3ZQIA 1G7YA 1VRH2 2CAUA 2QQWA 1XNAA 3SCGA 5EEHA 2MSYA 4A6EA 4LG0B 2X29A 1WD4A 1REDA 1A3KA 2X4HA 3VV1A 4I30A 1KONA 4L2NA 2LBFA 3NEUA 3NWSA 3PURA 3HQRA 1VBE1 1DFQA 2CGPA 4EQQA 2COMA 3T1LA 2J1AA 5A7QA 3GX4X 1FLIA 2W00A 1FOKA 2R7XA 3O0WA 5ICEA 1XYPA 4B1RA 4NC6A 3O12A 5EEAA 4OFGA 4AIJA 1R1ZA 4E8CA 4IRHA 2A3YA 1MZ6A 2D6PA 2W0XA 3N9NA 1QF3A 2JTVA 3K4BA 4IV3C 3VLBB 3IL2A 1N47A 1AYN2 1ZRDA 1X9PA 4AFAA 4RM3A 3GDBA 1C4RA 2V9VA 5KAIC 5DAXA 2K9SA 1S1AA 1Z0HA 5JXJA 1HXS3 5CKNA 2YB7A 1T2XA 1BYHA 3I2FA 3JZVA 4MHGA 1REPC 3BTAA 4JV4A 3K77A 1K78A 4P5YA 3V0AB 2DUQA 2UURA 2VOOA 4II3A 1JI8A 3LA3A 5IVVA 2CG4A 3H8OA 3OS2A 4LHSA 3BCBA 1C8NA 2C4XA 1QDOA 5DUIA 2YG0A 1OLQA 3PIPF 4KA4A 4Y5Z0 1UD1A 1F1ZA 3CCEI 4R79A 4KNYA 2GIVA 4IE0A 5HLGA 4IF4A 1ONVA 3KPHA 1S0DA 2QUOA 2VQCA 2Y6FA 2W1SA 4LOCA 3K4NA 3CDLA 3EMRA 3VODA 5HS7A 2JKBA 1H8VA 3A0BC 1AF9A 4CCNA 4KGGA 2ZZQA 1ETOA 3TOBA 4H7MA 4LIUA 1UYPA 3BTCA 4DEVA 3MIDA 4U87A 1K5MA 3VBFA 5F7UA 4CO8A 3Q3SA 4EJTA 3H3VK 4IEJA 3F9KA 4ASMB 1F36A 1A6QA 4LQRA 3VHPA 3V65A 2W1UA 5E16A 2JG9B 5AONA 3U1XA 3QP6A 2HXIA 1LOEA 3BG9A 5BXXA 2WWJA 2RREA 2MC3A 4S2GA 2C9KA 3SC7X 4JRAA 1IHMA 1YJLA 1UMHA 2Y9ZA 2X5IA 4LBQA 1HKTA 1LDDA 1EPZA 2EICA 3MLLA 1D4M3 3TMOA 2W84A 3HGYA 3IAPA 2JD4A 4OIOF 2ZKLA 1SANA 3T30A 3C7OA 3UNGC 4HN0A 2W82A 5DAPA 1GZWB 3AJYA 4LXLA 2ZHNA 4KU7A 1GLHA 2Y8KA 2VTXJ 1WJDA 1QGLA 1RIOH 1XGNA 1S0CA 4A3JJ 5BNPC 4Y1VA 1XMAA 1LRHA 4GKXA 2XRLA 3VBUC 3WTSC 3F72A 1EAH3 2X8KA 2B46X 4B43A 1KQRA 1RVF1 3ZSMA 1WW5A 3CMAI 3HG9A 3S16J 3TP3A 2ECCA 5IYBJ 1I3HA 4CP1A 3J9SA 2JDUA 2WZR3 4Z6YA 2TRTA 4QQPA 2EBIA 1VBA2 2XIGA 4DJAA 2VM9A 1TQIA 3O1OA 4N9IA 4MO7A 2CQKA 1W0PA 4AG4A 4NE9A 5KXEA 3Q9OA 4LLGF 3WSOA 2A75A 3I3LA 4BJTA 4YSFA 1OQ1A 2VMCA 4WVMB 5BQTA 3H9JA 2BY1A 1JKQC 1S0JA 3FXKA 4FTEA 3I2OA 3RS6A 1Z67A 3CJRB 4ZU4A 1B35C 4GYGA 2K86A 1QNYA 4WZCA 4CEYB 2VI6A 2DJIA 3GCXA 2XQRA 1S3JA 3CCQI 2J1EA 1WGPA 3EETA 4HANA 1Y0UA 5KCMA 4YZ2A 5C3OA 5I0SA 1ULCA 2PHFA 1D1BA 4PJNA 4G9SB 4AHWA 2M0CA 1DLLA 5F27A 4YIFA 3D82A 4KQ7A 1YFWA 5DG2A 5H6RA 4E4DX 2YYOA 1PO23 3JBG3 3JTGA 5LBFA 3PTRB 4CP9B 1PNFA 4NOTA 2WY7Q 2JQ7A 4YGCA 4CH7A 2X0LA 2QQ9A 3J7AO 4FXKB 4G6TB 2QDNA 2VL8A 4XUOA 1OFCX 3SH5A 2WIIB 4DXTA 5BNOA 3ZR6A 4M74A 1TME1 2R4GA 1NHAA 4TYSA 1V9U1 4L9JA 1DGRM 1ZGWA 1B09A 3PLQA 4H55A 2J1RA 3LMMA 1MEC2 4GH4B 1T95A 3B02A 1D1CA 3BWGA 4QPGB 4PDWC 2VC0A 3CJQB 3CTAA 2XJPA 1TQ5A 2GAUA 1VMJA 3JAMZ 4RGKA 1X36A 2E7XA 3EO6A 3GYDA 1Q1VA 3EQEA 2JE7A 3I4MJ 1GT0C 3FZVA 2YPDA 1VAKA 2RMU3 1HX6A 1SFOJ 1UU5A 4XE9A 3LZZA 4MHUA 2X1CA 2AR6A 2R7DA 3ZFFC 3NSTA 4A5NA 5L9VA 5CADA 1PMHX 1UL9A 4HF2A 4UXNA 4MGTA 2QBXA 1X50A 1LAJA 1Q1HA 2ZHLA 3QP5A 4UFJA 3E6MA 2D6NA 1YG2A 2H09A 5FP8A 4AU7A 5FLIA 2AQEA 1QH7A 3NW4A 2HWC3 5FPBA 3FBYA 2C1FA 2VJIA 1XMKA 4R52A 4PSXA 1B59A 1D2QA 1N77A 1SBEA 1GOGA 4KN7X 4JHZA 1BIBA 3TBDA 1XNBA 4UW4A 1TG7A 1E3HA 2P2KA 3LKJA 2OPWA 5F04A 1ENHA 2VULA 3M7AA 4JHTA 2QLZA 1W8NA 2D43A 3HYIA 1AR83 2Y75A 1U0AA 1H8AC 4ZYDA 2Q4SA 4MQ9F 4COWA 2M8GX 5JSOA 3HXLA 2V7FA 1ULPA 1BW6A 2W57A 4K6BA 4A3ZA 4AWDA 3S93A 5H6QA 2RS12 1MNDA 5GALA 1W04A 3MEXA 4V1PA 5FMCA 4OUEA 3ABUA 2FXAA 5FRMA 4E7LA 1XC5A 2R7FA 4IEWA 1MDMA 3WNPA 2D3PA 4MTDA 3T0AA 4IKFA 1ZGAA 1B72B 2W08A 2I2SA 2WNUA 4BPZA 4RSUA 5FUPA 1GYKA 2RGVA 2MEV1 4HSLA 3TEXA 3LEIA 2E33A 1KDMA 3VBFC 1R7JA 2O0YA 3GNEA 4NB5A 3PNYA 1MSEC 4FQ4A 2OW4A 1I9RA 1ZH5A 3AJZA 4X8NA 2VW2A 3PL8A 5EPAA 3NNLA 2YMZA 1RUI2 2YC2A 4RYDA 5JZGC 2JWTA 4EN6B 5DUKA 1BZWA 4IQPA 1OHFA 1OLRA 2Q1ZB 1FTTA 2R063 2HWD2 4N4OB 3P3PA 5FLMJ 1LNSA 1WCSA 2R041 2Z4FA 2BWCA 4BXSV 4Y1UA 2P5BA 2DO7A 3CP8A 2PEXA 1JKPC 4URTA 3OYWB 1DBNA 2IW5A 1OCTC 2XC7A 3VD9A 2G9WA 2UV1A 1SAXA 2FRHA 2O8XA 2F4MB 4EJUA 2D45A 4XACA 2QYOA 1U5YA 4ENKA 1UMIA 5ILUA 2H1KA 4Q4X1 2NP0A 1D0ZA 1WBLA 1MKMA 1H6YA 2VQ0A 1DGRN 4EV0A 2LKSA 3VDAA 4CP2A 4RAGA 4A7ZA 5FFOC 1VBE3 3RYPA 4C1XA 5J40A 5HVQC 1VQPI 4U0WA 1WH7A 5H9RA 2DUOA 4OHYA 4IXAA 4CGZA 1F15A 1C3HA 3N97A 2HPMA 1OURA 1FZPB 3BOQA 4E8DA 2Y9YA 4IZZA 1SLCA 3WHTA 2VNGA 1UG2A 4LTAA 4XRSG 3OSDA 2F4PA 4P9YA 4XJ9A 3N05A 1ZAOA 2L01A 2AO9A 3POYA 1KXGA 1AKHA 5JIUA 4KU8A 5ACA1 1VIWB 3AG2H 2XGEA 3PJYA 2M8EA 1W6OA 2MD5A 4JGZB 1IOAA 4AVBA 2EAKA 2DQLA 1R23A 4IL7A 4D7SA 1V5EA 2O8QA 3QLQA 4LNVA 5EJ1B 3F2ZA 4AYUA 1MMDA 1JS9A 1X1PA 3ZYBA 3BOWA 4ASNA 4IE7A 1ETYA 3MD2A 1W8OA 2ME6A 1CR7A 2VIXA 2P6TA 2VKVA 1XBFA 2QQLA 3AP7A 2VPVA 4QGLA 4NDLA 4UFLA 4JDNA 4BISA 1Z9CA 1ZELA 1BXHA 4HQMA 1R4MB 3M1HA 1SMVA 1B6AA 2XAUA 3KHBA 5C3SA 4F7ZA 1MPXA 1YW9A 4WXHA 5CG9A 5IK5A 2LC2A 3GTPJ 5IY5H 3ZN5A 4CVUA 2XLAA 1XC6A 1PGL2 3RQ4A 5D5XB 4IOCF 3BTXA 2ES3A 1VFCA 1OFSA 1RUOA 4LKDA 4JQFA 4XCBA 4N90A 2VD7A 1R9TJ 3AMHA 1SFKA 4ZH4F 1CJDA 1G9CA 5BNOC 3ACLA 4IO9F 3ZQGA 3WE3A 1AYM2 1HLCA 1RUH1 3MEPA 2XROA 4CDQC 4CCKA 1NE4A 3JRIA 1CQ9A 1YJ9I 4CSWA 3DEMA 2QSGX 4YVWA 5HCHA 3HTUA 2FX0A 3HSRA 4X1EA 4ZDLA 2JA5J 3DXUA 1I27A 5F6KA 3CUQB 1NCQA 5FLXK 3RZLA 2WAAA 2KKOA 3G3ZA 1G8XA 4AI8A 5CEHA 2VNOA 4RGXA 4GULA 1J2XA 2VN2A 3ECQA 1SPPA 4OULA 5J6XA 4RAZA 2VZQA 1YJNI 5IT9Z 3AYDA 2YZ4A 2VONA 4MOAA 4HSTA 3GZ6A 2L5QA 3B6AA 4NNJA 2XPUA 5F0CA 1UY4A 5IVJA 4NQWA 4Q4Y2 1UYYA 4QHOA 5DEQA 2O9LA 1SFNA 2L54A 5JXGA 4DPNA 2IZWA 1MH4A 2EQRA 4XURA 5IHRA 4F52A 4AHZA 1JYNA 4LOSA 4P9FA 3PUSA 2PFBA 3HOTA 2VCBA 2EA7A 1LHWA 1Z6TA 3I4PA 1NCRB 2TUNA 5J1RA 2KM2A 1FV3A 3PSIA 2ADEA 2VR4A 5FKMA 3RKXA 3C2BA 4ENMA 1VQLI 1MS9A 1D0HA 2WNUC 5D8KB 5EDNA 3IC7A 1RUG2 1ULDA 3KT4A 4E4ZA 4RD7A 3T09A 2UY8A 1ULFA 5KXBA 4OIPF 2F5DA 1STMA 2DBIA 4KISA 4ZKTB 1O7LA 5C8WA 3WTYC 3R60A 3IAQA 1YIPA 4CCCA 4O65A 3W5MA 1B8IA 5K5RA 3GTKJ 5I0TA 4IEUA 2RJLA 5AIQA 4XZPA 1WPKA 4Q8KA 4A69C 2OXBA 2FNPA 2L9VA 1T08B 1YO8A 3PHMA 5FO7B 3RTRA 5BNGA 2Z79A 5LW9A 2LG4A 4M0NA 3LAGA 4L99A 1GWKA 1ETWA 3GHMA 1OXCA 4YIIA 5DZGA 5TJJA 4M6YA 2VJ4A 1I1SA 2XVKA 4OHVA 5A32B 2YU9J 4S2HA 4I99C 1PGW1 4ESBA 3M3YJ 5J4YA 1V9U3 3F6OA 1TP4A 2E1MB 5ICGA 3UT0A 5JLVA 4EVIA 1Q5OA 3ZMOA 1U0JA 4ENNA 3O5SA 2NPIA 3N7LA 3DPRC 2ZBJA 3A02A 4CCOA 4HSRA 1MBHA 4XYXA 2ARBA 4XW3A 1ZBE1 1ZYRF 2VE1A 6PAXA 1YIOA 1FATA 3IKVA 2L7FP 2JJ6A 2IGKA 2BBYA 2MGQA 3LSEA 4E7JA 1YS6A 2XONA 2WN2A 1GNZA 1DQ0A 1HSJA 5GPCA 4XSZF 1SLLA 1LPQA 2R7TA 1YLLA 3ZXAC 3LOIA 2OF7A 2X05A 3X2QH 5EHDA 1HA8A 4ESJA 2VT2A 2ZMEB 5C9AB 1LGBA 5J09A 2ZGMA 3ZFGA 2QJVA 1HXS2 3QRFF 1BI3A 2P5VA 2I10A 4FPEA 1WWXA 5FBJA 3C2GA 4NHJA 3JCIA 4HLXA 4U7BA 4M00A 4RQPB 4F93B 1I39A 5IVFA 1BR4A 3ILRA 2CWMA 3WW3A 1R58A 4YFWA 3K2AA 3PM1A 3E5QA 5SV5A 5L7OC 2B7EA 1QA6A 2VBBA 3KMHA 3HQUA 3WNNA 2OZJA 3FWEA 3DCFA 5M3MJ 2EF6A 2RE9A 4QLCU 1LEBA 2B63J 5GKAC 1W2UA 2VBXA 3WG7H 3BG5A 1A04A 5HNHA 2GC3A 5EEGA 4LFUA 3FXOA 5B3SH 2ZAAA 3L2QA 2QDRA 4QPOA 4E7KA 3EQLF 2DURA 1WSUA 2GNDA 2R5YB 5EF6A 5C4JJ 2AXTC 1LDKB 2WZ8A 3PIGA 2MEV3 4CXFA 3OBRA 2RAEA 2OCCH 3ZX7A 1X82A 1RUE1 4XN0A 5D4RA 3SEZA 5IVCA 4Z2AA 2DA4A 5JHFA 1P7JA 5EQUA 4DIQA 2NAZA 2CNAA 3RZKA 3A0NA 5A6ZA 5DQ0A 4FHTA 5FZGA 2WTEA 1S6LA 2R1DA 2R0QC 1W2OA 4QX7A 1XNTA 5A3TA 5CNAA 3VKMA 3BUCA 3CLOA 4W97A 4PT6A 1JZ3A 3DYPA 4AFBA 3L2YA 1ON2A 2OD5A 1W06A 1CZVA 1VE0A 1I6HJ 5ABJB 5BV6A 2R043 2VOPA 4AVVA 3K69A 2EFNA 4PIZA 2DDBA 1F9NA 2EXIA 3QPSA 3ILNA 2Y64A 3V0AA 1W90A 3FC0A 4HT1T 4N9HA 2ICWG 2JG8C 1Q8OA 1D4M2 4QHBA 2R7VA 1NCQC 3KHCA 4HV5A 1HKDA 2O14A 4Q4X3 4A3MJ 2EPFA 4HBNA 3NO8A 1H9PA 3GCWA 1XPWA 2QEXI 4PFOA 1OVSA 4K40A 4M71A 1G9DA 4L97A 5HPOA 2BDRA 4LHNA 1TL8A 1I5PA 1HRV1 1OKRA 3MIGA 2LD5A 1BL0A 1UB9A 4XBLA 2Y60A 2HKXA 4EZ4A 1VLNA 2R071 3KQRA 5JHUA 4XILA 3KLOA 5FZEA 4QPIB 3LPGA 3TYJA 2NS7A 3ZIXA 1PDNC 2JECA 1GUIA 1QQP1 2MBFA 1EAH2 5FZDA 5K7HA 2VODA 2E1CA 3DXTA 3C8XA 5JMCA 2E53A 5BPDA 4MEYF 5ACA3 1HV1A 3KQ4B 3TN91 4ZC3A 1SAUA 4XEZA 5BUVA 1KJRA 1YHFA 2VQLA 4COYA 2VCMA 2WZR2 4LEJA 4UF0A 1ETKA 3BI3A 3CUOA 2G9FA 3OGSA 3ECOA 3NV2A 1W99A 5A6XA 2OZ6A 3ZYFA 2AH2A 4RDUA 2Y6KA 1J09A 2HEVF 3KP7A 3KP6A 3HTSB 1X3ZB 1LEAA 3HEIA 2NMOA 3V8JA 3POGA 1B9NA 3RGBA 3HNBM 3HOYJ 1X33A 3N9PA 1J5YA 4JAAA 5D5UB 3GTLJ 3S1MJ 2HWE1 2WA3A 4YW3A 4WM8A 3BTIA 2RDQA 4MYEA 1GZWA 4LLFA 3FHQA 2Y0IA 3ELNA 1H2NA 3HBKA 2LROA 4RN5A 1VQ4I 4QWNA 1E57A 2ZXJA 4CDXC 3IDCB 2E6VA 3GALA 1HJFA 1PO22 3JBG2 4HA8A 1LODA 1C28A 3AX4A 2CW8A 2QQIA 4HX8A 4OZXA 4MIMA 2WO1A 4C2TA 3BTLA 4YELA 4OINF 1VBB1 3OIQA 1RUH3 1RKTA 2KIQA 3VPRA 2WS91 3HPNA 4AR2A 5E79C 3ABKH 3C3VA 2AZ5A 4MV2A 3VB9A 5C6CA 2ZA9A 4WF2A 4FPHA 2LF7A 2V26A 4R8HA 3JRAA 1FPQA 3HPHA 2EXJA 4UFIA 2VNRA 2DBBA 2CQNA 1LTEA 4DUVA 2L9LA 3GUDA 1PUEE 1NG0A 4A2UA 1VB4A 5CA6A 2R7OA 1IS4A 3SDBA 1HJGA 1UF2C 1GR3A 4WVMA 2RMU2 1TLHB 1Q8QA 3DTIA 4Z82A 1ZLKA 3VD4A 5DUXA 2QUFA 4AI0A 2JDYA 4BQQA 1CVNA 4CEYA 4CTEA 3TEDA 3N7MA 2A73B 4UOJA 2L7KA 3AKZA 1ULGA 4XUTA 2A6VA 2RVCA 1NQJA 2HWC2 5F37A 5F64A 3RQIA 1ZRIA 4NHMA 3FXQA 5CQEA 1H1MA 1IV8A 1V00A 3AL6A 1YCIA 1RMU3 1GZCA 3MDPA 5FZCA 2ZSIB 2UY9A 4B44A 3FK6A 3SLIA 2FCUA 1HB4A 4CP9A 3LAPA 5FFXA 3LAJA 3LSHA 4U88A 3BZKA 3KP3A 5ISLA 4YFNF 4KIGA 2XBO1 3OYHA 1EKEA 4WVVA 1Y4WA 3VBOB 1MSFC 5JVTA 1AR82 1DP7P 3DEUA 1L7RA 3AKRA 4CCLA 1XB9A 3U14A 3O1RA 3T0DA 2VPRA 2DA1A 1IKPA 5APAA 2NN8A 4GH4A 1P7IA 4P55A 4QPGA 3M2MA 3H9QA 5HDGA 2DDUA 3VL8A 4DZGA 3O3KA 2DTRA 3R6SA 1X3WB 4AEDA 3N35A 1ZZ8A 4HZFA 3VD3A 4XETA 4FT8A 1OOPB 2P17A 2YGLA 3H3ZA 4BBSJ 4HK9A 1AWCA 2IP2A 2RS53 2UU8A 4QPQA 1S8NA 5FO8B 4ZY9A 3JD71 2FDFA 3A4CA 1AL0G 2VBPA 1H2LA 4YGEA 1LUJB 5D21A 4CRQA 2UYBA 2J22A 4QIWN 5TISC 5FZFA 3AC0A 3NKGA 4WM7B 1G9FA 1RITA 1OR7A 3LA7A 3JB8A 4H4KC 1RYYA 3VBRB 1ZZ9A 3D6EA 1I5ZA 2A07F 2ZGTA 3FMRA 3ZYJB 4XLCA 2R062 3KSCA 4AAPA 3J7MA 4FBFA 2JEMA 4IHXA 1Y6IA 3HC7A 4XBQA 4GXLA 3WDUA 2GNMA 2CGNA 1HF0A 2K9MA 2XV4S 1AU7A 1BOBA 5K5OA 1FOXA 4H0EA 1MVQA 2MNGA 4HX7A 2IXLA 3BQZA 2XWBB 4NUBA 2ESHA 4N7UA 2LFBA 1J1LA 4DW6A 2MYSA 3H5AA 1BI1A 3AKQA 3VDDC 4OMYA 3VZKA 2L4MA 3OR2C 3ATGA 5FZ0A 5FZ4A 1C1LA 2R30A 3URFA 3VBSC 1G9BA 1VBE2 3GZTB 4UYBA 1R1A1 2ZNYA 3NRUA 1GKBA 4BQYA 2AEYA 2Y31A 1BK0A 2K40A 1MBKA 4GFBA 2VZ3A 1MD0A 4E9KA 2GZWA 1B72A 3H3UA 1NYWA 3OYAA 5DCMB 1OA3A 1J9IA 3IUOA 2VL4A 2DYSH 1OFNA 3ZP5A 2XJVA 4IV3B 4QDQA 3CL1A 2FA5A 3GJAA 2RQPA 2F4IA 4N8MA 4FFGA 5IP6A 4HKOA 4HSJA 5KR7A 1PZ7A 4OQ9A 2EIGA 1XN7A 1F5FA 2GQQA 1I1GA 3IH3A 4XMYA 5CYYA 4UUSB 3KWVA 1PNGA 4XLNF 3Q0WA 4XDPA 1SG3A 3ZSKA 1YFUA 4AGGA 1MJAA 1SBDA 4Q26A 2D1HA 1X8MA 2DTWA 2HH9A 1XCBA 3HSEA 2Z69A 3BR1A 2PXJA 2CFOA 3AKSA 3MLKA 5CG8A 2X51A 3DXJF 5D5VB 2P3IA 2W95A 3T8RA 3OYWA 3PL0A 1POQA 3LE0A 3T2QA 4QX0A 1FX7A 1CWPA 3WU0A 5FR3A 4RFRB 4COZA 2X10A 1VQ5I 1LGCA 2V6CA 1WJ5A 4WM8C 1HDKA 3H1WA 2VZPA 5I91A 5J7MA 1DGWX 2XVGA 3IWZA 4IRIA 5EJ3A 5ILVA 3GVAA 1BQPA 2IC1A 1BK1A 2YX4A 1JU4A 2A6EF 1PUFB 3D5LA 2MH2A 4FPKA 2JDNA 4AQSA 5E3MA 4OWRB 3ASIA 4B4PA 3WP3A 4XJAA 3P7NA 5E8AA 3FK7A 4N53C 4AOCA 1B1BA 2DMPA 4P08A 1S0FA 5EV7A 2GMMA 1IF1A 2E7AA 3GYHX 3H0GJ 4KN4X 3C1DA 1QBJA 4DQAA 2XPJA 2OQ6A 1Y1WJ 2DW4A 3OS0A 2XF7A 2J7MA 3BGAA 2DOAA 3FIWA 1GWMA 4JGZA 4XHXA 4MGIE 1F5JA 4G7ZF 4F3QA 1MNMC 2DWRA 5BOXA 1KGSA 3EXUA 1F4HA 4WZFA 5B66C 4CYCA 2AENA 1VMHA 1HDPA 3BALA 4CU7A 4D7NA 4DEQA 1FY7A 4GRIA 1IG7A 2K0GA 3W20A 3BPXA 1TW3A 3SEPA 1PVC1 1K3IA 5A7WB 3HZJA 1HRV3 4DS0A 5BNPB 1BI0A 2MH9A 3ISPA 4U7DA 2R073 2A68F 1GZTA 1S5LC 2EFOA 3VBUB 2CHHA 2VJ5A 5DMYA 2P8TA 4O3MA 4P14A 4AVSA 1D7PM 2BNOA 3PU3A 4MLOA 1GP4A 1TBXA 2HEWF 1AL21 1ALYA 3J8F1 3BIEA 4BUPA 4G7HF 3BC8A 3WW4A 3PVBB 4WCGA 3T2PA 2DU9A 1T98A 4F92B 2KMUA 5F39A 3ZSJA 1QKQA 1T2KA 3TN93 3S1NJ 1PHMA 1YYVA 3OL4A 2VBYA 1FT9A 3OOUA 1S2BA 2L3DA 2XH6A 2ZBKA 5F1JA 3Q5FA 5KHHA 1LHNA 1D8JA 1AZDA 1ZZ7A 4AC0A 1WGXA 1UQXA 4AQ2A 3JREA 2ID3A 3BU7A 4UUVA 5DUUA 4AIKA 3ULQB 3HDDA 3UKNA 1BKZA 1KU3A 5L36A 2VXRA 4WXDA 3DPTA 4AEDC 4W6YA 1QO0D 1IS6A 1H0BA 1JOPA 4ZDPA 4KFCA 1B35B 1QDCA 2VECA 2Y69H 5FYZA 2DT7B 3CLQA 4CZZA 3LSGA 3U2RA 2J42A 2MLKA 3O6BB 3CUQA 1J3QA 2BHYA 4Q48A 2HWE3 1G9AA 1QH6A 3SZGA 1MVEA 4I76A 1LQ1A 4M0HA 3IMMA 1UHWA 3OY9A 2GC0A 1QHHD 2RS31 1R71A 1PYVA 1HDDC 2VH9A 4LHKA 1ZBA1 5H9SA 3D8CA 1TT5B 4MH0E 3VZJA 4DXZA 2QA4I 2XMLA 4HNTA 3EB7A 1N1VA 4NHXA 3ZPOA 1W8UA 5C4WC 1VQ9I 2Y6LA 1JXNA 3M1EA 1BIAA 4WV8A 5FPZA 4PK4A 3GLLA 2LLKA 4DOUA 1VBB3 3ESWB 2WS93 5FMDA 3QWLA 4XN3A 1SDDB 5M0TA 1TME2 1V9U2 3WXPA 4MXWB 3K4AA 2W1OA 2Y30A 4AQ6A 4PDWB 1XRUA 2FQ4A 2Q0OA 4FETA 4M9XA 3OGGA 5I0DA 2DUPA 2J1UA 1ENRA 4DYQA 2Z33A 4WBBA 4RGAA 1W0OA 4XVHA 2BRTA 2VXDA 4BH9A 3CC2I 4YG6A 4K20A 1MACA 2LDUA 1K45A 1NCRA 2VZ1A 4DNYA 2FUG2 3DQVC 2BUKA 5FYIA 3ONQA 4HMZA 1O5LA 5F3EA 1JN2P 3LIGA 3LSDA 2OT7A 5IVEA 3ZFFB 1MZFA 2LMDA 1JU3A 3NKTA 3IAM2 4JTOA 1FMWA 4G3YC 4S0HB 4HN1A 4U2AA 1UHSA 2R0FA 3VD7A 4AGRA 1P4WA 1CAUB 4OMDA 1MS4A 4PBPA 3DTKA 1EJ9A 3SFIA 1G86A 3U1DA 3MKZA 1UZCA 1OBNA 2W46A 2KISA 1JGSA 1H88C 1ZZBA 1K78B 2W1QA 4GKYA 3FBNB 3S14J 3D0SA 3A01B 3K9TA 3ZN4A 4DB5A 5DUWA 4YZ1A 4N43C 3BTJA 3U07A 1YTYA 3DEEA 2A71A 4AIHA 3PVOA 3POIA 2LKXA 5CJ9A 3GZUC 1AR91 4H7LA 5GLUA 2VQHA 1QJU3 4OI0A 2Y6JA 2VZVA 2JDMA 5IP9J 2VCAA 2K85A 4FPFA 4QAWA 3A22A 1MMNA 1W5TA 3W2VA 5A7SA 4R4ZA 2D6MA 2EIMH 5HS9A 1H2MA 4S2DA 3VKLA 5HV0A 2MEV2 3MF6A 2XAHA 4QX2A 3RJRA 3VBFB 3JD73 2P0WA 3LCPA 3PVNA 1VAMA 4NIGA 5J98B 1JZ7A 2R7RA 3PO3J 2PHDA 5F6LB 1Y43B 4O6JA 3U11A 4A7KA 1WLWA 3I7DA 1O4TA 3BR2A 2DTZA 1RUC1 2HTSA 3QODA 1G4DA 4D6QA 1S7OA 1YX3A 5FOJB 4ES9A 2BFUS 2ZMEA 2EIEA 2FZ1A 3AKTA 4YFZA 4EEFG 5C9AA 5J96B 4XM3A 3MN2A 1D5VA 5TGTA 2OS2A 2R042 2JIJA 3RMYA 4RB3C 3NQHA 1BBT1 3E7LA 3GEZA 5A1LA 4LBQB 2JE8A 2BY3A 4IJAA 1YITI 2DQRA 4B1MA 1HW5A 2ZMKA 2CV2A 4LJHA 2GOXB 1UG0A 1F8VA 4Q4X2 1JZ5A 2Z42A 4QU2A 3ABMH 1QNTA 2IS6A 4PLMA 2JA6J 2YUSA 2QBYB 1OH4A 4C1WA 1ORKA 1R1A3 4P5HA 2XPVA 3K1PA 5EG0B 4A3LJ 1YOVB 2PAEA 4OHZA 4ENJA 4K7JA 4YEJA 3UGFA 1W0TA 1D2SA 2R5YA 4QHZA 2GXAA 4GCVA 2Z5WA 2XASA 1JYIA 2QQJA 4QKDA 3RZHA 2W1WA 3DFGA 2V1XA 5FJ8J 4QD2A 2STWA 1W9FA 4B3AA 2RM21 2BOJA 1GHCA 1IPKA 4MFDA 5FY0A 5LY2A 5ACA2 3OYLA 2HZDA 1K5JA 3I2HA 1RTVA 3I8TA 3DKQA 3VKFC 4F8AA 2FF4A 4BIOA 3A1YA 3WCRA 2AHQA 4BLJA 1D0GA 4FFIA 4NN0A 3QU3A 2V9PA 3DP7A 1EF4A 4XFAA 3UR3C 3P6BA 5T54A 5DM6F 2W2IA 4XQWA 2Y0SA 2D2WA 1V0AA 3GF2A 1GLNA 4SBVA 1MH3A 3MAJA 1S0BA 1GQHA 1QJY1 5ABJA 3WZ1A 4ASKA 1N1SA 3BTZA 2DMQA 1RGSA 4D1QA 3LFIA 2Q8DA 1DPUA 1CF7B 2DK5A 2OU2A 1Z6RA 4LBKA 1VP6A 3PFIA 2EFPA 1GWLA 3K4CA 2A6ZA 5A1FA 5I8YA 1ZHFA 2RQQA 2KPMA 3CZ6A 4HVOA 3RJPA 4G8XA 1O3SA 2QZ3A 3GCMA 1U6GA 5FJKA 2NVYJ 4XF3A 4L5EA 1JYVA 4IHSA 4L9NA 4C0BA 5HLHA 4NIAA 2R49A 5J37A 1HW1A 4JRLA 1V54H 4ISQA 3CF2A 2D5VA 1OT5A 2EFQA 3MF9A 1GV5A 2BNMA 2VKHA 2F5VA 1G3SA 2NM1A 4ZZLA 2A6WA 3FHAA 2PA7A 4QPIA 2JMWA 5BNOB 3SMHA 3POJA 4Z1VA 1R5GA 3LPFA 2EILH 1H9TA 1ZARA 2GXBA 2QQAA 1RUH2 4CDQB 1OI6A 4MGRA 1OVPA 3HMYA 2FDGA 1TW2A 4M6XA 3HSFA 3WY6A 1LKXA 2PMZA 3RYRA 3C7JA 3B9IA 4DRVA 3W2AA 2ZABA 1ZYBA 2WT1A 2F4OB 1S4CA 1HKSA 2PJRA 4AZZA 3H50A 3F8MA 3MW3A 1STZA 4KIBA 1NKGA 2OZUA 2R0HA 4UW6A 4JX6A 5JDBA 4OZOA 3TO6A 2WAEA 3LEMA 4DFSA 3PTYA 4KMQA 3RJ2X 3A23A 4UFHA 4AHXA 2WAQA 1IRZA 3T5XA 2FDIA 2PAKA 1TTYA 5CVJA 2B45X 1Y8QB 2VAUA 2ZB9A 1FSEA 3BZCA 3KVAA 3ZQHA 4YFKF 4M3GA 5CQGA 1QIQA 2ET1A 1BBYA 4Y7NJ 1AL23 4FX4A 4XXAA 2GSYA 3J8F3 2D7FA 1LOAA 1K83J 2CV0A 5T3NA 4G9YA 2M2EA 2OTJI 2GP5A 3OV8A 1UU6A 4RR3C 4C3JJ 1APNA 3KYDB 3I64A 3N9OA 1GOHA 5FZMA 3U0ZA 4AEMA 4JQRA 4E70A 1Q8VA 4HV6A 1MBGA 4HF0A 1JZ2A 4AYBN 5LGUA 3S1QJ 1E3PA 4Y5TA 1OYWA 3R0AA 5I93A 3FKIJ 5DCFA 1YFYA 4E4HA 3CEWA 3QH7A 2FBEA 5F3IA 5LA9A 1O6UA 2ZTNA 3K4ZA 4CDWC 3B73A 2WNUB 2GN7A 3JU9A 1LGNA 2BY0A 3KF5A 4A45A 1EH8A 2P37A 4PI2A 3OL3A 1J75A 5GP9A 1DYKA 4IEYA 1G2HA 3RQ0A 1UU4A 4C3IJ 4B8EA 4M4PA 2RR11 4EM1A 2RS33 5A3UA 1CPNA 3GMEA 4YW2A 1LVAA 4XRMA 1ND3C 1DDNA 2JRMA 2CO5A 1ZBA3 4BQ5A 2E32A 1BC7C 3WP4A 1VALA 5D6FA 4YIRX 1Y9MA 1U8BA 1V6IA 1WCKA 3B5LB 2WSVA 2JB4A 2DT6A 5FZ8A 3RVHA 2ISZA 2QNKA 1R1VA 4IUGA 2VZTA 5FXVA 1POGA 2VJJA 4YZ3A 2PBIA 3W9AA 1CQTA 2X6YA 1PGW2 3ES1A 1OH3A 3ZXFA 3J81Z 2PMHA 1LOFC 2VMHA 1VQNI 2W68A 2VKDA 4QXCA 2UWBA 2HKOA 1YLFA 1AR61 3SCHA 4E7IA 2ZMLA 5LB6A 2EV6A 3VBOA 1EA3A 3EUKL 3DPRB 4ZYHA 1DQ4A 1J7KA 1P8JA 2VQAA 4LK0F 1XGMA 4IW3A 1XSRA 1OPMA 2XJSA 5J1YA 2V1DA 4KDPA 1JOJA 1QOOA 1XU2A 4YGBA 3VEPA 4YRVA 4L0YB 2CDOA 3L7WA 3GXOA 2UWAA 4ATFA 4W50A 1BVP1 1OOPA 2QKLB 5A2QZ 1S0EA 2PQ8A 1QEXA 1Y3TA 1ZZCA 2A5ZA 1W7PD 1BJQA 3MCZA 4P00B 2EB7A 2J1TA 2LALA 2AACA 3OG2A 3MKYB 4GJYA 3LSJA 4LBNA 3KYLA 3O2PE 4PJLA 1VQ6I 1DUXC 2X6OA 4FE7A 2UYAA 4WM7A 3IIIA 4KICA 5A7PA 3PNTA 4H14A 3K3OA 5JR2A 2K9QA 3SH4A 5FZAA 4V2VA 3VBRA 5JWPA 5GZGA 4WVWA 4DBQA 1SFEA 2KQRA 5L7OB 2VNVA 2UUZA 2VMIA 1FYMA 1I3QJ 4QX3A 5H9PA 2R5ZA 1G3YA 3HEFA 2CUFA 2EWNA 4E2QA 4XKCA 2GWRA 1AR93 2WNOA 2JE9A 4Q8LA 1PJRA 3K4LA 4BJ6C 2BE5F 3WF0A 3CO6C 1BCXA 1P6RA 3HM5A 1JH5A 2K02A 2R3SA 4BEHA 3OBTA 3OBAA 4RS5C 3WV6A 1J3PA 2Y34A 3C18A 1ULOA 2ZOEB 2L0KA 2XHKA 3MZ8A 1QPMA 4OHXA 5ERIA 2ZPXA 1NE6A 1JUIA 1UFMA 3AL5A 2XF6A 2XPWA 4UW3A 3H8UA 2ZX2A 1MS0A 2YC4A 5LCWL 1N25A 3F8FA 2I8DA 5FMBA 1VJ2A 3A7QA 5BPIA 2WSUA 4IGQA 1RUC3 5IUQA 3WQ0A 5DCMA 3L2VA 1YNAA 2I5UA 2A70A 4GWIA 4CUBA 3L00A 2JJ7A 2OC6A 4IV3A 4BKXA 4HBLA 1FNNA 2JXAA 5E1ZB 2XUBA 2HGCA 1SFYA 2VXZA 4NROA 3ZM8A 1MJ9A 3JRGA 4GMP0 1BBT3 4OOIA 4UUSA 5E6HA 4E7ZA 1LJ7A 4UW5A 5IJRA 2XAFA 5B4NA 4W65A 2JG8B 3Q8FA 4KT6A 1ZK8A 2KIMA 1NCQB 3WHUA 3RZMA 1RKWA 3BJ6A 3O8HA 4MUVA 4QDRA 4NHKA 2CW7A 4L0PA 1USTA 5IFTA 2CUZA 5K7FA 2ZJCA 5C71A 1TZOA 1T56A 2F5EA 5A6QA 4V2GA 1C57A 5FPLA 2KT0A 3WNLA 3KVBA 1XSDA 4NVPA 1Y9GA 1PK6C 1WLCA 5D8LB 1HRV2 1L7QA 4LT5A 2R072 5LBEA 3T3YA 5JVGF 2B7YA 2VMEA 5A1AA 2MD0A 3BR0A 1I1EA 5GLVA 3E3VA 4AI3A 3TWIA 4FOQA 2A69F 1IRGA 3KZIC 4AFDA 3I58A 2RM23 2RJ2A 2MABA 3PVEA 1WJFA 2CL2A 1PUFA 4KJZA 2HDCA 5E20A 5LBCA 3WTWC 4KH9A 3TN92 3ZCOA 3UKGA 2HU9A 4AVTA 3OYDA 4XTPA 3IM0A 1DZTA 4M3CA 2E63A 5E8IA 3O8GA 2D6OX 2BXZA 4A41A 3RZJA 1A35A 4B48A 2DU1A 5IAVA 4F3JA 1IN8A 3THDA 5A70A 2DU0A 2GXGA 5FP4A 2W48A 5LBBA 1H9WA 4YZ4A 3MVPA 4A12A 1ZRFA 1H1IA 4L11A 2IBDA 4JX0A 2XKPA 4A3GJ 4PQQA 3D1NI 1U8RA 3J80K 4KUMA 2QKDA 2I45A 4UAPA 1IAWA 1D1AA 5FK7A 2G1MA 2ETEA 3EJKA 5JI6A 3UETA 2Z3YA 3I97A 3KEOA 4BLIA 5I0UA 4CDGA 1KDKA 5B5EC 2HWE2 3WDXA 5L3FA 4K3UA 4QTRA 1YC61 2ESNA 1Z3YA 5C8CC 5FKKA 3QPHA 2E2HJ 1SD7A 3OSGA 4XZUG 4CDXB 5A7WA 5BNPA 3I0TA 1Y1VJ 2ZZJA 3HJRA 1FBSA 2QKMB 3ERED 2CDPA 2BU9A 3VBUA 2YU3A 4XFGA 1FJLA 2PMZN 4JKKA 3ECHA 2Q8KA 5CAZA 4XK4A 1VBB2 4XJZA 5FRAA 2WS92 5K8SA 1C0WA 1U12A 5CVUA 2NLRA 2PN6A 5CPRB 4EROA 2WC2A 1HCRA 4IVNA 2R32A 5ERLA 2XUMA 4HYEA 3KM5A 4AVPA 1UOGA 2LTPA 1ZA7A 3S6PA 3QBQA 2LR8A 3OEAA 1E3OC 4B3NA 4P9IA 2DMTA 3HRSA 1NOVA 2BEOA 4Q5OA 4AVAA 1S29A 3J7HA 2O1QA 3PIOF 5GLWA 2KHMA 1VBA1 5IP7J 2FDJA 4IE4A 1CONA 4P02B 1B35A 3M4OJ 1N3PA 5IAXA 2NS0A 2ADUA 3NNMA 1TNTA 5CFDC 1I50J 3WDTA 2WLPA 3C2UA 4KNCA 4DYRA 3FHZA 3I2KA 4YM0A 5FLJA 2PN5A 2SBAA 1I6XA 2B9SA 2BW8A 5DM7F 1E5RA 3COAC 2K27A 2ENRA 4AVCA 2ZFWA 2JD9A 2Q2EA 1UY3A 3ML6A 4I0BA 4ZHNA 3WDVA 1H30A 3JR9A 2P7VB 3HWJA 1W3VA 2DYRH 2ZEYA 3LEGA 3DLAA 5GZEA 5IK7A 4CZCA 1IZ3A 5E88A 3HUGB 3J7AY 3FJSA 3ZXEA 2DF7A 1ZZ6A 4MXWA 2ZGUA 5HODA 5KVRA 1QJU2 1EV7A 2BV4A 4PDWA 1YI2I 5EZGA 1APLC 3FL7A 4IV1C 3RSJA 4MGKE 1N1YA 5L3DA 4Q1RA 2D5FA 4BQ3A 5LHIA 4URAA 3PUBA 5A3PA 1X19A 2K5CA 5HCFA 5IFPA 2B5HA 4FASD 1V70A 2X1EA 2W5FA 1SHWB 3TB0A 1A36A 1BEV1 1O8PA 3JD72 2RR13 3IZOA 5F3CA 4A4AA 3ZFFA 5K0UC 1WMDA 4BU2A 4F83A 1ZRCA 3L2UA 1UY2A 4HDVA 2MW8A 3KT1A 1CESA 3O1MA 3S0MA 1XD7A 1CAUA 4NHLA 4MQVA 1U5ZA 3PUQA 2LUWA 5HNFA 4BOWA 2R92J 4UBGA 4KWLA 2K46A 2O0OA 3OGJA 4GAZA 2IAIA 5DDGA 1GV2A 5FPAA 1OMIA 5B1AH 2YPRA 3V56A 5L19A 5LA1A 3RI9A 1H4GA 3LSTA 4ZYGA 2ZXQA 1FI2A 5FLHA 4M3FA 5KHKA 1EPWA 3A01A 1W8HA 1AR63 3BG3A 4C8DA 1ENSA 2EFWA 3I55I 3KEQA 5DUVA 1W7PB 3KV4A 5FYCA 3VDDB 2GDFA 3ZYRA 1YIFA 1LEDA 1VBC1 3KE2A 3F8NA 3I3DA 1Z05A 3VBSB 4ZZDA 2A6TA 4NIDA 2KRFA 2ZEXA 3WINE 1R1A2 3B93A 4PCQA 3CD6I 5ANNA 1P2FA 5LWBA 1V55H 3DGTA 4CUCA 2VKEA 3MFKA 4B29A 1Y9QA 2HJIA 1PVXA 3FXUA 3F3XA 2DCJA 1KGYA 3INAA 5F2WA 1W0UA 1WBFA 1Z7S1 5A33B 1YRNB 4IGOA 3HRMA 2JUGA 4XRSA 1X8EA 2GN3A 4AHYA 1QJZA 4C3HJ 1HQWA 2WAOA 4P96A 3LA2A 5FCCA 5D4SA 2HEOA 1OA2A 4P9WA 1S55A 1A8MA 4KG0A 4XMIA 5JZGA 1XGSA 4UF0B 5FP9A 5JIAA 3ZYIB 3VB2A 2FU4A 5FTTC 1CAXB 2P6HA 3MUY1 2P3JA 1EY2A 5FYTA 3BJAA 1LOBA 4BMEA 2ZSHB 2ZHMA 1XSQA 1IRXA 4XQDA 2YGMA 1MZEA 2HWD1 2CV6A 3DL3A 5KK1A 4HXCA 2FBHA 1US2A 2LS6A 4UB8C 3DPLC 2PG4A 4M3CF 4WM8B 3BKZA 5K1YA 4B8XA 3PQKA 3ZMTA 3IIAA 1MS5A 4XABA 1HB1A 2BNNA 2QBYA 4RGUA 4RAFA 4DY5A 3DCQA 5EG0A 4PGGA 2PQQA 1XE8A 2EXHA 2OUHA 2L9NA 4Z07A 2DTYA 1WD3A 4N53B 4JX5A 1LFUP 2D3RA 3ACIA 4BL0B 2NVQJ 1PM4A 3A2KA 1NQDA 2CYYA 3WNXA 2NZ9A 3RYKA 4BQWA 4NWVA 4FXGB 3IAS2 4BBRJ 1HRI3 2WRAA 4L9BA 3DYOA 4KBZA 1W3XA 5KXCA 1RESA 3RZOJ 4XF0A 3C3WA 4G6QA 4NBQA 3PUAA 3PO2J 4XOGA 3B00A 5FKLA 2VOWA 5BYNA 3MHZA 2XWJB 5EWSA 3HKZA 2KR2A 2KXLA 2FBIA 2QZ8A 3IH2A 1IN4A 3V7RA 1J83A 2RC4A 3VUOA 1YO5C 5C3PA 5JLWA 4BS9A 3TDUC 1CF7A 4FAGA 3KCYA 3WQ7A 3F6VA 3T4HB 1QZYA 3VHNA 2NVTJ 2XXZA 1OD3A 3ITQA 3U75A 5HXVA 2B39A 2VMFA 1RR7A 3WGHA 3OYBA 5FYMA 3ZR5A 1V6OA 4Z2WA 2X53S 3AVSA 4Y33A 5KXDA 2DCYA 1OCZH 3ON7A 2WNVC 5EYYA 1BA5A 1AL22 5FYHA 3ST7A 3J8F2 2ZXWH 4YNIA 5JI9A 1X7NA 4KITB 3RWNA 4Z8BA 3RWKX 1R091 2JA8J 2PLV1 2ZX3A 2GP3A 2L2OA 1V3FA 3V64A 2AEZA 3TOAA 4TZDA 3R4KA 2CTVA 2VOKA 3LNQA 2WFPA 2PMWB 3O14A 5BNNC 5FZLA 3LFKA 2QQPA 2G9ZA 2DA3A 3MPBA 5CFCA 1OCOH 5JXHA 3WNMA 4CDQA 1H2KA 1VAVA 5EIYB 1K61A 4ARXA 1Y8RB 4AEJA 4HF1A 4AEDB 4Q0PA 3RKYA 4AD9A 4RLQA 2CY6A 1WW6A 2QQ8A 1W6QA 4JKLA 2RNGA 2D93A 1DP0A 1DP3A 3IN9A 3U4SA 3WVJA 2IA1A 1K42A 5FPVA 3O1UA 2CRGA 2RS32 1HN0A 5A3OA 3JAMK 2DPUA 3WF3A 4Y22A 1ZBA2 5I8SA 1JHJA 1WJAA 1YQAA 2V09A 2Q8OA 1W2TA 2P1BA 4CCEA 4CICA 3AFGA 4FPOB 5C4WB 2DMNA 1RRJA 2DOEA 3FLRA 4CU8A 4BDZA 2K3FA 4RA2A 1IPSA 4GMP1 3CDZB 3AVRA 1GBGA 4EJRA 3ROUA 2BVBA 4FOYA 3AXEA 3CBNA 4GB31 3NARA 2ZJ2A 1W8TA 4BB3A 4A93J 5AFEA 1DQ1A 1U3EM 1NXMA 1F4KA 4Q4Y1 4D9JA 1AHDP 4ZTFA 1M1EB 4Q2FA 4GQ7A 3D5OA 1RB8G 4B3XA 3LSIA 1M4WA 3T08A 1U9NA 1UCXA 2Y0MA 4FPJA 2IVJA 2D6KA 4Q29A 3IPVB 4LD5A 1X58A 3QPTA 4X0GA 1IG0A 1MBJA 1NXD1 4K1YA 5E1WA 1V6MA 3T0BA 2FHRA 2XVLA 2OQGA 3IDEA 3M3QA 4CEWC 3PUIA 1RC9A 2WN3A 2V1NA 4OAYA 3KIOA 4FFFA 5FGMA 1NZCA 2VPLA 3FFZA 2RVAA 5AC91 2O5RA 1RUG1 1UHMA 4M3DA 2HQRA 3LDBA 3IHUA 2CW0F 2TEPA 3QD6A 3WNOA 2ZFUA 2C24A 1O4YA 4FSJA 1N3OA 4UY8I 3WG4A 2BVMA 1S7AA 1NLSA 1WMFA 1VQKI 3SEQA 4RHV3 2J5OA 3OY8A 1PZ9A 1JXSA 5FY8A 4NJ4A 1W1WE 1GZ9A 1W39A 2DFIA 2JB8A 4LLOA 1UXZA 5E89A 4N43B 2DJNA 2O8KA 4NIIA 3BPSA 3B7MA 1BJAA 1W28A 1AR92 5HI0A 1TMF1 3NAUA 2X6WA 3ZXKA 1H1AA 3GJBA 1RPWA 3ZKUA 1BN5A 2OBPA 2GALA 1FP2A 4XOPA 1OF4A 3QH6A 5T52A 2P4WA 4CDUC 1K4SA 1MQTC 4CPBD 3BIWE 2XB6C 3EYYA 3GBGA 2KL4A 3HHHA 4HX4A 3DPRA 2P3YA 3SISA 1XSXA 3WUCA 1YI9A 4TV7A 5BY5A 2A3SA 3T2OA 2WAFA 5J3UA 1WI3A 5J36A 3FZ3A 2K2SA 1IXRC 4A6DA 3L2HA 2YUEA 3DU6A 4HLYA 1Z7UA 1MW7A 4B7KA 2AGSA 2JX9A 4W1UA 3FXMA 1RUC2 4JP0A 1RXFA 1E0EA 3QACA 3I2IA 1IZ1A 4AFMA 1F4AA 2W9XA 4QB2A 1QHGA 2K3PA 1W2AX 4Q0UA 2KDZA 1XCVA 1DQUA 3VSKA 1RHI1 1PVEA 4Y17A 2C9AA 2YROA 3BPVA 2OUJA 2M30A 5DD4A 2IGNA 1BBT2 3P3NA 2VG9A 3AAFA 2EH3A 4PGHA 2L9RA 3OOXA 4CYCB 2M1BA 1RI7A 5L7OA 3B6CA 1YW7A 3L9FA 4YVSA 2ET7A 2HBTA 3PFYA 3A21A