1CGPA

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
b'PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*A
publication title Crystal structure of a CAP-DNA complex: the DNA is bent by 90 degrees.
pubmed rcsb
molecule tags Transcription/dna
total genus 59
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cgpA01
3GF2A 4KWJA 2G9WA 3P9KA 2L3DA 1L3LA 2EV0A 5JSRA 4KN7X 1QBJA 1P92A 2L4AA 3REOA 3HQXA 2QUFA 2OAZA 3TGNA 2Z9OA 5KVRA 4KL1A 4FBFA 1TQIA 2VXZA 3NKTA 5D5VB 2QBYA 1W7PB 2EA2A 1DPRA 3BPXA 2A6HF 2EFPA 4QM8A 4QMAA 4OMYA 3I54A 1L3JA 2VOPA 1MJAA 1P2FA 1SMYF 4CICA 1EPZA 2PI0A 3WW2A 4YYOA 3EYYA 1SEFA 5E1RA 1A04A 2O1QA 4LG0A 1RTVA 2ACJA 2ZNZA 1F1ZA 2DO7A 1LVAA 1OYIA 3WTZA 2FE3A 5FDBA 3RKXA 1DPUA 4MHGA 1Q5OA 3T0YA 2QZ8A 5CYVA 2M30A 1S29A 3ZMZA 2D45A 4EJTA 3MYXA 4HV5A 4WXHA 4FHTA 3GBFA 3GFMA 3V8JA 1G3WA 2UXXA 2LDUA 1FI2A 4PDKA 3FM5A 3F8MA 1O7FA 3G3ZA 2PJPA 4E2SA 3O14A 5IT3A 2UYBA 2XRNA 4KN4X 4P9UA 2WFPA 2RKHA 1IW7F 1XMAA 1EV7A 4H0EA 2QENA 2LNBA 3DQVC 5KHGA 3KP6A 2DPDA 3I59A 2OZJA 4META 4ZU5A 4OINF 2F4PA 2FBHA 4HLYA 1O5LA 1X7NA 4EVIA 2HQRA 3LAJA 4LD5A 4AVBA 1T38A 2XHKA 4LLLA 3P9IA 3H9AA 2F5DA 2UY9A 3IIAA 4KNYA 3U11A 4U7BA 1XDSA 1E17A 4QGMA 4BYYA 4HVOA 4KUMA 5J7MA 1FX7A 5ICFA 5ED4A 3IHUA 2WV0A 5HDGA 3OOPA 5BV6A 3KP3A 2HQNA 3DP7A 5L3GA 4E2QA 1XGMA 1LR5A 4PZJA 3KGLA 4X6RB 1KGSA 3O6BB 3WW3A 2D5HA 2EFOA 4O9EA 2ETEA 1UCXA 1K79A 2FU4A 1QXRA 3HRTA 1P4AA 2EK5A 1EYBA 1LKNA 4HQMA 3SHRA 1XRUA 3LAGA 4ETSA 1Z9CA 1G4DA 3DFGA 2GXGA 3NVCA 2M5WA 5IT9Z 4UBHA 1U5TA 1ZGJA 2VN2A 1S7OA 2IP2A 2H94A 1JE8A 1W5SA 1Z6RA 2VT3A 4Z07A 5F1RA 2XL7A 3C7JA 4K8FA 2E7WA 1TW3A 1YG2A 5IT9K 2PG4A 1GVJA 4RGRA 1X8EA 3HHHA 3QRFF 4LB5A 3LWFA 2CFXA 2TDXA 2IA1A 2EA7A 4LG0B 3W6JB 1OMIA 2B5HA 3TDZC 5EFUA 2NNYA 3I7DA 3KP7A 4LLNA 1YW9A 1ULYA 5D8KB 4XLPF 1RI7A 4I7HA 4BIFA 2W85A 4LLGF 4I98B 3IKTA 1PP8F 2MD5A 3HTSB 1ZARA 1HKSA 1KQ9A 3PFIA 1HXDA 1LEBA 5CVJA 3M1EA 3I64A 3VODA 2VE9A 1B4AA 3T1BA 1J58A 2VC1A 1BOAA 1ZZ7A 4XFCA 4A0XA 3D5LA 3IWFA 2WWYA 3WTUC 3R4KA 4M73A 2DTRA 5CLSA 4P5OA 4G6DA 4EQQA 1VTNC 5L3CA 1F5TA 3G7DA 2X4HA 3L09A 3GFJA 4EROA 3I59B 5FLJA 2FF4A 3NL1A 5FO5A 1KA8A 3E6CC 1YHFA 4B8XA 1RNLA 4AWXB 1O7LA 3CTAA 5KK1A 4MGIE 1KU9A 3RKWA 3LWCA 3GFIA 4R52A 1WKMA 2ZNYA 4MGYE 2F2EA 1PP7U 4WX9A 4NHJA 1IAWA 1J3PA 1U5TC 4RB3C 5TJJA 3NW4A 3VB2A 2ET7A 4Q0VA 1L0OC 1KU2A 4A5NA 1O57A 1QXJA 1Z05A 2A61A 3ISPA 1R58A 1SMTA 4ENKA 2PAKA 1CAXA 3V7RA 2PTMA 5EZWA 5I8SA 3QU3A 3T8TA 5D4SA 1K78A 4AQ6A 2O03A 4ESJA 1REPC 2CV6A 1G3SA 2YPRA 1ZVFA 4M9SA 4PCQA 3C3VA 2PAMA 5DCMA 3Q9SA 4OFGA 1HQCA 1TQMA 3IWZA 5FD5A 2AXLA 1LDJA 1BBYA 2P7VB 3M3IA 4M72A 4TLFA 3M8FA 3WGIA 2UXNA 2UYAA 1T0FA 1ZRFA 4KYWA 5HLGA 3SCFA 3ZMSA 1R22A 2M1BA 4QWQA 1HSTA 4GYGA 4LA3A 5BMZA 1FSEA 4M71A 4RB0A 2OU2A 1ZLJA 4DNCA 1UPIA 6PAXA 4KWLA 1U5TB 3J7AO 1BN5A 1U3EM 2C0ZA 4LTAA 2DCTA 4NQWA 5J6XA 2QNKA 2PLYA 1XE8A 2VT2A 3HSEA 1D3YA 4Q0QA 1AWCA 2CQKA 1V3FA 1FBSA 5E8GA 3BOQA 3FHIB 2DQLA 2QVSB 2Q30A 4HZFA 4LK0F 4Z2YA 1MDMA 1HW2A 2K86A 4L5IA 5HS7A 2V1DA 2EFQA 1S6LA 1R1VA 4HBNA 2QQBA 4XSZF 2MH9A 1KYWA 2RN7A 3BB6A 5DYMA 1OYYA 2ZBKA 3V4GA 2IXJA 4XF0A 1XGSA 1BC7C 1W7PA 3GFLA 1ZNPA 2Q4SA 4HSJA 1HW1A 3SXYA 2GC1A 3IC7A 5J48A 3CL1A 1UHWA 1YQAA 3WGHA 3N4MA 1FYLA 5DD4A 3DXJF 1YFYA 3WTSC 4L5JA 4XFGA 3ES1A 3BJAA 4MTDA 1XSXA 4YFXF 4LJZF 1OI6A 4UV9A 2RDPA 4XEZA 3ABUA 3M7GA 1ZRRA 3SZPA 4ZH4F 5I0RA 4G7HF 1QO0D 3ABTA 3GZ5A 1YLFA 5FB2A 4Q4ZF 2FRHA 4HAMA 2UY8A 5E1ZB 2GH2A 4WZCA 1NZCA 3S2WA 2MPFA 4XFBA 4L9TA 2PBIA 4GCVA 5I0SA 5E20A 4OLLA 1J75A 4EM1A 4MQ9F 5FLXZ 5LEJA 1EY2A 3VEPA 5CJ9A 4RAZA 5BOXA 2I45A 3V7SA 3U9GA 4A12A 2OA2A 1QPMA 3SXWA 3M8EA 5DEQA 4ZYEA 5FLXK 2GWRA 4JTNA 1CAWA 3V7CA 3ZMDA 1CAUA 1HSJA 3H92A 3JTGA 4EGYA 3GX4X 3MAJA 3BJ6A 3WTYC 4BHPA 4PIYA 4N0BA 1O3TA 4IETA 2B9UA 2D93A 2JT1A 1K78B 4HQEA 3VHRA 3SMHA 3JW4A 2DBBA 4EV0A 5CVIA 1WSUA 1FC3A 2QCSB 3GUDA 3NSTA 4IEUA 1OPCA 2MC3A 3AAFA 4R8HA 3B02A 1B9NA 1Q43A 3SHFA 3I58A 2JZYA 2EV5A 4IHTA 4XF1A 2V09A 5FLHA 1IN5A 2GZWA 1XD7A 3F72A 4MNUA 3HRUA 3MQ0A 2KXLA 2KJBA 3E5UA 4JV4A 5ILVA 3EDPA 3K69A 1JHHA 3WTWC 3BCWA 1XMKA 1NE6A 3BALA 2J5PA 2OD5A 2XKPA 5ILSA 4YFNF 4OU0A 5HS8A 4PGHA 5JR3A 1ZG3A 5HDKA 3HTUA 3G73A 4FX4A 1FPQA 4G6QA 3F8CA 3H7JA 2CAUA 5TRDA 3IDBB 1MD0A 5DCFA 2XIGA 1U78A 2ZMEB 2R7FA 3GLXA 2PFBA 1YS6A 5JVTA 1OFNA 3EO6A 5D4RA 4YNIA 2XLGA 4YG2F 1G3YA 3JAMZ 4HMZA 1MDMB 5DUKA 2K9ZA 4LB6B 3HT2A 4KU7A 5D5UB 1DDNA 2EVXA 3USSA 3JAMK 1J2XA 3D0JA 1G3TA 1ZZ8A 1FBUA 3SZTA 1K6OA 2FNPA 2R7DA 5AVPA 4QGLA 3L7WA 5C6CA 3FXUA 4YFKF 4G94A 2V79A 3F6VA 3MPBA 3ZN0A 1IN7A 3WTVC 3BPZA 2IPQX 3IKVA 4XF3A 5I0UA 5JI6A 3KLOA 2IA0A 4KDPA 3BY6A 3CO2A 2DT5A 5BPIA 3TKYA 1DZRA 1TQ5A 2ZCWA 3DPTA 4CYDA 3FWEA 2HYGD 1FYKA 2D5FA 2COMA 3D0SA 3F21A 4PJYA 2V6CA 4UHTA 5AONA 2VE8A 3SQNA 1ZGAA 4JVAA 1FZPB 3SFZA 2HKOA 2HFHA 3IRRA 4LK1F 3WTXC 3KZZA 2FSWA 5JHUA 1JXSA 1Y3TA 2PN6A 3EETA 1IN8A 4KA4A 4RB1A 4AXOA 1PDNC 2XVCA 1ZH5A 5HI0A 3PNAA 2GC2A 2ZKZA 5E18F 4OOIA 3DKWA 4UV8A 1P6RA 4H7LA 2VBWA 2XKOA 3IL2A 2A3SA 1MJ9A 1TQPA 3KFWX 1CAWB 3CO6C 4GO1A 1CAUB 1EH8A 3L2HA 2VQAA 4ZYHA 4M74A 4ESBA 4WK8F 3QP5A 3ELKA 5ICCA 2DPUA 3H1MA 4D7TA 3T5XA 2YU3A 1WQ2A 2BNNA 3PLQA 3RZZA 5I91A 2H0VA 1JHFA 4UVCA 5J8CA 4O9GA 3K2ZA 3FXQA 4N9HA 4JTOA 2LKPA 1EP0A 4I01A 4ZU4A 1T2KA 3LAPA 3L2CA 4RGSA 5DUIA 3E6MA 3CO7C 1SAXA 3S7IA 4CHUA 4Q48A 2Z33A 5L3BA 2FA5A 5HS9A 1FNNA 4UBGA 5DD8A 3WG9A 4IJAA 4B09A 2IVMA 4U0WA 1ZX5A 2PQ8A 4DINB 3BP8A 1MGTA 4MV2A 2K02A 3FJSA 4KMFA 2YX4A 4OIQF 3RKYA 5HVQC 1R5GA 2R3SA 3CUOA 4IEWA 4L2NA 2MBFA 3WW4A 3HOTA 2DLLA 4QLCU 1ZG1A 4HYEA 3R61A 2F5FA 4PIZA 4U0YA 3HSFA 1O3QA 3NJZA 1Z6TA 3R60A 4YIIA 1SQ4A 1NE4A 3RPQA 3LQRA 2XV4S 3WU0A 3IRQA 1BI0A 3U0ZA 2PEXA 1BC8C 2NAZA 1Q3EA 2RNJA 4IEZA 2ZFWA 2D2WA 4LEJA 3HUGA 2PQQA 3QACA 2HR3A 2PHLA 1UIJA 1UFMA 1DGWA 3KE2A 2FOKA 2OYZA 1T98A 2H27A 3GWZA 3HHGA 3M9AA 4HF0A 3F22A 2GIVA 1VJ2A 5BPXA 1U6GA 1WI9A 4XBFA 2QVOA 4XSXF 1USSA 4D7SA 3GZ6A 2OQGA 2O61A 2FXAA 3WTTC 4M6XA 1U12A 5ERIA 2KRFA 2PYTA 1J9IA 3FZVA 2W24A 2O6GE 5I93A 2VODA 1J7KA 5CADA 4G9YA 3R6SA 4L18B 2P8TA 3H1YA 3S7EA 4ASNA 2M87A 3JTHA 4Q29A 5LEKA 4MGRA 2CG4A 2PAEA 2W25A 3PQJA 1NHAA 3O2PE 2NRAC 3LQQA 3CUQC 2HS5A 1OD5A 2ET1A 3WW1A 1KQ8A 1BI2A 2QYOA 5LHGA 4S05A 3H8UA 4EWDA 4IESA 4HW0A 2HYFA 3KZYA 4FT8A 3GXOA 3EQEA 4NB5A 4YSFA 1ZZ6A 3LOIA 1HW5A 2A5YB 3ZDSA 3R0AA 1LRHA 1SD4A 2E9QA 2K4JA 2KKOA 1XSVA 4UVAA 3C3WA 3FF5A 4KT5C 3HSRA 3P9CA 4IERA 3U2RA 4F8AA 4L0YB 2E1NA 4PGGA 4EMSA 1ZRCA 2BV6A 3RNSA 3I4PA 1E2XA 4LLOA 1CX4A 3ZMUA 2M45A 2XLFA 1Z91A 2HDCA 2CW0F 2IA2A 5DDGA 1IN6A 4I02A 1EH6A 2A68F 3GYHX 5FLIA 3CUQB 2QQ9A 1IXSB 2MNGA 2OPKA 1KU7A 2IXCA 4MGZE 1IUYA 4IEVA 3OF1A 2KIFA 3CLPA 4KICA 4IF4A 5LBQA 1UB9A 5FD6A 2BEOA 2DK8A 4HV6A 1H9GA 2Z69A 1BJAA 1STZA 4HDVA 1HKTA 3FMQA 4IEOA 2PMUA 3H50A 4WBBA 4OMZA 1NXMA 4AIHA 1W7PD 3K9TA 3ERED 3GYDA 1FOKA 1KQ0A 4UXNA 3JZVA 1UIKA 4HVRA 3C1DA 1S7AA 4MTEA 2QQAA 1YWKA 1ZZCA 3OD0A 2YSRA 3I5UA 2IXKA 4EWAA 4A5MA 1PUEE 4XFHA 4LULA 4KU8A 1IN4A 3Q9VA 1V70A 2CWEA 1Z1DA 2Y48A 1LJ9A 1DZTA 1PM7A 1OYWA 1RZ4A 4Y13A 2FBKA 2OZ6A 1CGPA 3RPUA 3WODF 4WXCA 2IXLA 2XAHA 2V1UA 4HX7A 2VC0A 3F8NA 4A2UA 1C0WA 1HKQA 4UUVA 2ZMEA 3F6OA 4LMYA 3KP2A 1ZZBA 2Q2EA 4U88A 4G7ZF 1ON2A 3MWMA 4P9FA 3ST7A 2GXBA 3E5QA 2ADUA 4HOBA 3UKTA 2Y75A 5T3NA 1ZREA 4CXFA 2XROA 3O3KA 3ELNA 2KIUA 1LDDA 3UKNA 3H3ZA 2IW5A 4HSLA 2DI3A 4G8XA 3QPHA 4R79A 3GW2A 3TOBA 5HLIA 5D6FA 5BUVA 2Z99A 5C8WA 4FAGA 5JCTA 5H20A 2IRFG 4IRHA 3LZZA 1B59A 4E2GA 2FQPA 4WXDA 3EBRA 1TNTA 2ETHA 2CAVA 2JSCA 2A6EF 2NNNA 3K0LA 3CJNA 4O5VA 2FMYA 2NS0A 2K0GA 4IHSA 2P5VA 1U2WA 2QDRA 1LEAA 4YRDA 1V4RA 4R1HA 5LRRA 3CLOA 2OA4A 4ONUA 3E6DA 4HLXA 4OIRF 4BHBA 1QWRA 3BROA 4RB2C 5LGNA 1FT9A 2RV8A 1FBQA 3ES4A 4A6DA 1SFEA 4P55A 2B8MA 4ZZDA 5J8FA 3I71A 1X82A 5FFXA 4WF2A 2MLGA 1LNWA 5LHIA 2OZUA 5ICGA 3HT1A 4DQ2A 4G7OF 4LUKA 4AVPA 2VPVA 5KBFA 3CJXA 2ELHA 3WE2A 1YS7A 1S3JA 2E1CA 4D0PA 4I3PA 4ENMA 5E1WA 1QZZA 4IVNA 3ETQA 3DEUA 1ZHFA 4N9IA 4EJWA 4XF4A 4YIFA 2VECA 1LQ1A 1B1BA 1W5TA 3HRMA 2IJLA 4KIGA 2CO5A 1R5HA 3QAHA 4HA8A 3EJKA 1WWXA 2Q1ZB 3NEUA 4EJUA 1YW8A 2GQQA 4Q47A 3QP6A 1XDUA 4XETA 1R1UA 1QNTA 4ORFA 1BIBA 3KEOA 4KIFA 4EJOA 3B73A 4HX8A 1QQIA 3I0TA 3KP4A 2O3FA 2P17A 1GHCA 3OGJA 1SFUA 4O6JA 4AVCA 1ZAOA 4IRGA 4M9XA 1Z7UA 5E8IA 3LA2A 5KHIA 2L4MA 3LSTA 5K5QA 3QPTA 1KU3A 2EV6A 4CZZA 1BI1A 4JBAA 1YLLA 1XSDA 1D8JA 2ZKLA 1TBXA 2RVCA 4OIPF 2QJVA 4ENJA 2GU9A 4J1WA 3EQLF 3E97A 4QM9A 4MH0E 2RGVA 1YIOA 3FM3A 5D5XB 1RL3A 5ILUA 1MZBA 4HF2A 4MEXF 1ZRDA 3DL3A 4Q0UA 2GAUA 3K1MA 5LGTA 4RS8A 3GO5A 2Z3YA 4AIJA 1VP6A 2XASA 2BBYA 1GXPA 2G7UA 1FLIA 2BE5F 3MZYA 3LA3A 5D1IA 1XGOA 3KP5A 2FEZA 4MEYF 2VBYA 1H0MA 3J81Z 4S04A 3TNQA 3KEQA 1ZG5A 2J5OA 2MA3A 4MUVA 3J81K 3PQKA 1QY4A 3ZP5A 2GA2A 2BGCA 4WCGA 3EYIA 3F23A 3WGGA 2ATFA 4I09A 3HRSA 1CAVA 1YFXA 4ENNA 1ON1A 3V8LA 3RJPA 4MQVA 4LFUA 5I8YA 3BZ6A 4AVAA 2CYYA 4IXAA 1JGSA 4GULA 1FSHA 1B9MA 1S8NA 4XRFA 1XB4A 1OR7A 2MH2A 1IRFA 1EH7A 5H6RA 5E17F 1SD5A 2JPCA 4GGGA 3DN7A 3SCHA 1FY7A 4IEXA 2OBPA 4L9NA 5AIPA 5EEHA 2F5CA 1SFXA 2XUBA 1NYWA 4K2EA 1P4WA 3OV8A 2HOEA 5EEGA 2IT0A 4KIBA 5LLQA 4GXOA 1HBXG 1XGNA 3TO9A 2HKXA 3ZMTA 4BQAA 2P7CB 4QX5A 3MZHA 2HZTA 3K1PA 2CGPA 4EM0B 3CUQA 4A0YA 1FYMA 1O3RA 1B6AA 1ZLKA 2K7LA 3GVAA 1FXZA 1O3SA 4L9JA 2DK5A 4HF1A 1BIAA 2HTJA 4UXAA 1ZN2A 3KGZA 1ZYRF 3FMSA 2VOOA 5FPZA 4WWCA 3ZPLA 3D82A 2ISZA 5FCCA 4FAHA 5L3DA 1USTA 2FMLA 2Y0MA 5JAXA 4RD7A 2P4WA 4ZYDA 4CGZA 2Q0AA 1R7JA 2Q8KA 4KWKA 2YR2A 1WGPA 2EFWA 2KIMA 4XFAA 3J80Z 3TQNA 1OKRA 1XN7A 2LF8A 5CVVA 3VOEA 4RGUA 1D5VA 1WRJA 2Z5UA 5FQ0A 3J80K 3HYIA 5I8TA 1I27A 4Y15A 1J5YA 1CF7A 5KHJA 3RTRA 1I1SA 4BXUA 3OCPA 4FX0A 2STTA 2YX7A 1W4MA 2UZKA 1WLTA 2UWMA 2EB7A 3H7YA 2QBYB 4WVZA 3Q5FA 3ML6A 5A2QZ 2ZO4A 3WU1B 1SFNA 1YFHA 3RYKA 3KCCA 1MJBA 4HDUA 1J3QA 1F9NA 2H6BA 3QOPA 3E3VA 3RYRA 3BDDA 5H6QA 1K7AA 4JQFA 4AD9A 5A2QK 3JSPA 1QZYA 2ZXJA 4IPAA 1J0RA 4BNCA 3L00A 3FFQA 4NVPA 1BI3A 2O8XA 2GA1A 2XAFA 2L54A 2D1VA 4O3MA 1UCRA 1CAVB 4A6EA 5HOOA 2EA4A 5KHHA 2A69F 2HEOA 1GXQA 2P6TA 2XAJA 4HBLA 4P9GA 4M9ZA 4ZZLA 1WA4A 4B29A 4E70A 5BY5A 1RUNA 3ZQ7A 4HLTA 1R23A 2BNOA 1G6NA 2EFNA 2E7XA 5CVRA 2P6SA 3IDCB 1MKMA 1DGRA 2L02A 4U7DA 4L11A 2ZJ2A 1R36A 3F8BA 2JRTA 1XCVA 1GQGA 3QU6A 1P4XA 1YO5C 4EGZA 1R1TA 5LHHA 1X8MA 1KYZA 3DPLC 2V9VA 2VBZA 2QWWA 2EAAA 4AIKA 3BPVA 1IF1A 3IBMA 2DQRA 4Q0PA 5I0TA 1I1GA 2XL9A 1RGSA 2XAGA 2Y0OA 4KMUX 1T39A 2PFWA 4MGKE 3BJOA 3KETA 2IXHA 1UD1A 1YW7A 2FNAA 2P5LC 2HTSA 2CSOA 2B0LA 2NYXA 4YARA 3COAC 4IEQA 3TDUC 2C6YA 1XCBA 4A0ZA 3KSCA 4BAYA 4I2OA 2D1HA 1DUXC 2K4BA 5BS6A 3RIRA 1O4TA 4AQ2A 3OTFA 4ESFA 3FXRA 2DAOA 4F7ZA 2XAQA 1IXRC 1I5ZA 3RDIA 2BNMA 1FWZA 1DP7P 3I53A 3M70A 3TO7A 4Q0SA 3TO6A 1YFUA 2PHDA 3ULQB 1PMIA 4IEYA 5K1YA 4JK1X 1XE7A 2GC3A 1J1LA 3JSOA 2IC1A 5HLHA 1QGPA 4LA2A 2VBXA 2MHFA 4UNOA 2Z2SB 3ZMVA 2BYVE 3P7NA 1RUOA 1LB2A 4MX3A 5FQ0B 5JSPA 1F4KA 1TLHB 2G7HA 1YFWA 3GEZA 1CF7B 2VONA 2DW4A 4M6YA 2K27A 3RI4A 1R00A 2X0LA 4Y17A 4Z82A 1FP1D 1SD6A 2XGXA 2WC2A 3H3UA 3SCGA 3W6KB 5D6EA 5F6FA 4CDGA 2D40A 5D5WB 5ICEA 3U10A 2IXIA 1ONVA 3DF8A 1J59A 3HIFA 3U1DA 3VFZA 5JSOA 3L9FA 3WE3A 4ZYGA 4XF9A 5FFZA 3N97A 1Y9QA 3K1NA 3MCZA 1YUDA 4ON0A 1JUHA 2PA7A 2M8EA 4IRIA 4L0ZB 4XFFA 3DV8A 4HVQA 2QLZA 3FMRA 1TNSA 4TV7A 2RC4A 1IPJA 1BM9A 3C18A 3UKVA 4HN0A 4ZU7A 3ECHA 2LF7A 1U8RA 1ODDA 5LRSA 5BQTA 2PMHA 3TOAA 4X6QB 1Q1HA 5L3EA 2MLKA 4LUMA 2O0YA 1RIOH 5KHKA 3BWGA 2F5EA 4U0VA 5DV5A 3E6BA 3NRVA 2W84A 3KLNA 2H6CA 2A07F 2Q0OA 1VR3A 1YYVA 4BH9A 2KJCA 4RAYA 1X3UA 4OIOF 4P96A 3FZ3A 2HJIA 3PVBB 5JFRA 1Y0UA 1UHMA 3EHKA 1YTYA 2FBIA 5E16A 3BU7A 1AOYA 5FGMA 2W57A 2DU9A 2ISYA 1O5UA 1H9TA 1FP2A 4LGWA 5E1XA 2DFIA 3ACLA 2FQ3A 2STWA 2GC0A 1IRGA 4Q5SF 5JR7B 3ZN1A 3CDHA 2JTVA 4MZUA 2ESNA 2EWNA 4EJVA 1H1MA 1I6XA 3CEWA 4RGXA 2QM3A 5K5OA 5HDNA 3MEXA 3HOSA 3LFKA 4EM2A 1TW2A 3T8RA 3LA7A 1D8KA 3ROUA 5J3UA 1IZ1A 2EJRA 3ECOA 5AIQA 2HGCA 4QGNA 1LDKB 3FHZA 3EUHA 3KMHA 4L9VA 1CAXB 2L01A 1RC6A 3FE5A 5D8LB 4KFCA 3TNPB 4I0BA 5CVUA 2LSOA 3FX3A 4QXKA 4XFIA 5CU1A 3CF6E 4BHCA 5LGUA 5DCMB 4I0AA 4EWEA 1J3RA 3F8FA 4HX4A 2V1XA 4UVBA 2AS5F 3MDPA 2HWVA 5K5RA 4PIXA 2ESHA 2O8QA 1IXCA 5BPDA 3H1WA 5L3FA 4CO8A 2JPBA 2RQPA 1T6SA 2XLAA 1ZZ9A 3V8KA 3MFKA 5BXXA 5FPXA 2N7GA 3E5XA 2WTEA 1TTYA 4XLNF 4IEPA 3R0JA 4GYIA 3F3XA 4J1XA 3NQOA 1H1IA 5K8SA 1GQHA 4HN1A 2P5KA 1SD7A 2H09A 1UW8A 3RYPA 1IPKA 2OQRA 3S0MA 5F64A
chains in the Genus database with same CATH superfamily
3IH4A 1YITI 4BEHB 3P9KA 1L3LA 1LODA 1DCSA 3VBHC 5JSRA 4KN7X 1QBJA 2L4AA 3REOA 1N78A 5JXGA 1E57A 4PQQA 2X5IC 2HVQA 4YW1A 2VCAA 5KVRA 4XLCA 5JZGA 4FBFA 3PUSA 2NVUB 1UXXX 2HXOA 3WG3A 2ZGQA 3K3OA 1AYM1 4BIOA 3BPXA 1X36A 2JIJA 3T0AA 3BG9A 4Q4Y1 4OMYA 2VOPA 1P2FA 1TMF1 2EXKA 1SMYF 1R5ID 1FMD3 1HDDC 2FX0A 4BUPA 2KD7A 2DCEA 4D1QA 1SEFA 4MVTA 2O1QA 4LG0A 4C3IJ 2ZAHA 2ACJA 1MS8A 2ZNZA 1F1ZA 1LVAA 3VBHB 3WTZA 4JX5A 5FDBA 1AXKA 4MHGA 3FUOA 3OSGA 2M30A 2X5IB 4WXHA 3N7LA 1RIRA 2UXXA 2HEYF 5JUVA 4GKYA 1QDCA 3NARA 1VBA1 1O4YA 1O7FA 3G3ZA 1LULA 5IT3A 3ZKUA 5FZEA 2IGKA 2BXYA 4Z6YA 1ACIA 2AQEA 4CXYA 4FVVA 1ZM1A 2EIDA 4H0EA 4COWA 5GALA 1Z7S1 3WP5A 2WIIB 3I59A 5A80A 3H1CA 4NRPA 1XE0A 3WP3A 4A7KA 4AVBA 2VNOA 1T38A 4YZ5A 3POEA 5IK4A 3E1F1 4LBQB 2X6WA 3UNPA 3IIAA 3U11A 4BJ0A 4K3UA 3K4JA 4QGMA 2WQ8A 4IGOA 4BYYA 4GWMA 5J3LA 4MXVA 3LSRA 1K4TA 3D5SC 5IOYA 4RN5A 2XPWA 4B3NA 5HDGA 3VPRA 1RUD2 4YM0A 2O9LA 3OOPA 5BV6A 3KP3A 2DU1A 4RLQA 5EJZB 4PZJA 2HWB3 2ME6A 1AJOA 2D5HA 4IUGA 2EFOA 4O9EA 2ETEA 2C4XA 4W6XA 2Y6LA 2E2IJ 2F5VA 4XQFA 3HRTA 2EK5A 1EYBA 1D5YA 1ULPA 1WA6X 5E79C 4OYUA 1WW6A 2YFUA 1KXGA 2GXGA 1XQNA 4UBHA 4A7ZA 3MHZA 1U5TA 4PSWA 1FOD1 4Y7NJ 3IPVA 1Z6RA 3OL4A 3SLIA 5JXJA 5F1RA 2XL7A 2XUMA 4LE3A 1TW3A 1EA3A 2PG4A 4RGRA 1SVMA 1S0CA 1XNBA 2RR11 1W8HA 2E71A 1YQ6A 3W6JB 1OMIA 2I5UA 3W21A 3X29B 5M5YJ 5D2AA 3I2HA 4XABA 1SHWB 4CCCA 1JS9A 1ULYA 4RHV2 4AFDA 2W85A 3OYWB 4ITCA 2MD5A 2OXBA 4O65A 3GM8A 2WAEA 3I64A 3VODA 4GB32 2VQTA 3T1BA 1XNDA 4TSVA 4AQTA 1JGGA 2VM9A 2VC1A 1ZZ7A 4XFCA 4CP1A 3FK6A 3D5LA 3BCAA 2XJPA 1FPN3 1DP0A 3R4KA 5L7OC 1SVOA 5ABJA 4P5OA 4G6DA 2X48A 1G9CA 5CFDC 1F5TA 3G7DA 2X4HA 3UK9A 3ZXJA 4M3GA 1W1WE 5FUIA 1JYXA 1ETXA 4BU2A 2AYHA 3NL1A 2O8OA 1W03A 1RNLA 4AWXB 4OHZA 3WR0A 1F43A 1PVC3 4MGIE 2WNUA 2VJ4A 2QQPA 3RKWA 4R52A 3VGIA 2VB6A 2IWGB 1T8IA 5CEHA 1PP7U 1JT0A 1D0XA 3O5SA 4XLFA 1RUF2 4Q0VA 4A5NA 3BZKA 1QXJA 3ISPA 3MLJA 1R58A 3MKLA 5FLMJ 2E7QA 5BYNA 5L7OB 4CVUA 2RJ2A 2KM2A 1SMTA 1H6XA 2PAKA 2BW3B 1CAXA 3V7RA 2JDPA 5CFDB 2O03A 4ESJA 4RAFA 3POBA 1G3SA 1GNHA 3BGAA 1WHUA 2DT6A 3C3VA 5F27A 5DCMA 3Q9SA 2QQIA 3IWZA 1SLCA 4JCKA 3M3IA 3B93A 4TLFA 3THDA 5CNAA 1T0FA 4NN0A 1V55H 3RZGA 3AP5A 1CPNA 1XU2A 2ARXA 1TE1B 4M3CB 2M1BA 2A6ZA 4TWTA 2L9SA 5B2GB 4QDSA 3SH4A 4DNCA 3BTYA 3J7AO 4NE9A 2DCTA 2VMCA 2HWC2 2QNKA 2WO2A 1K4SA 4Q8LA 1JMUB 3D3AA 1XE8A 2P3JA 3L2RA 1W8UA 3HSEA 3T2OA 1GUUA 3I9V2 1V9U2 1RHI2 1FBSA 3J7NA 2E26A 3W2WA 1LGCA 3FHIB 2QVSB 1PJRA 3QCWA 2IVJA 1H4GA 4LK0F 2A5ZA 4Z2YA 4L5IA 5FYYA 5HS7A 2V1DA 4FQGA 2HWB1 2QQBA 4S2FA 1AR83 1OYYA 4AZZA 1EF4A 4AK3A 5C33A 4JKMA 3ZN6B 1PIV3 1BCXA 1OPMA 2GC1A 5J48A 2D6OX 1YQAA 2QE3A 3WGHA 3N4MA 1FYLA 2DV9A 5JXIA 3S15J 2V73A 1QEXA 4XKWA 5JOXA 2VMHA 3ZXDA 4MTDA 3V0AB 1X58A 3RZHA 4YFXF 1FX5A 3S57A 4UV9A 1OD3A 2YU2A 3DPRC 5FRAA 2BW8A 3M7GA 3SZPA 4G7HF 4JX0A 2DMNA 1YLFA 2FRHA 3J9SA 3VBHA 1VLNA 1WCDJ 3VD5A 1NZCA 2D3SA 3L2UA 2F6CA 2JE8A 3DYMA 5DS9A 1G9FA 4BQWA 2PBIA 1W90A 5E20A 4OLLA 2AHQA 3GF6A 2BY1A 4XJ8A 5FKNA 5FLXZ 4DBQA 5LEJA 1N3QA 4XE9A 5JOYA 3VEPA 5CJ9A 3ABZA 1Q8VA 2OA2A 3L2YA 3LSGA 3D5RC 3ZXGA 3NJXA 3M8EA 3CCQI 2OPWA 1N1YA 5JLVA 1CAUA 4Q4X2 4E7HA 2DODA 4AFBA 3OSDA 1FPN1 5EGOB 4BHPA 2ZMEC 4A3CJ 3DPRB 2B63J 1CVNA 2DCZA 1EV12 2VPLA 2HVSA 3VHRA 4CA0A 1XNAA 3JW4A 1C28A 1DGRN 2GXAA 3NSTA 4XLHA 1MR5A 1LOAA 3B02A 2ZAAA 3CJTB 4FPGA 4QB6A 2DN0A 4LBQA 1XYNA 5FLHA 1SC7A 5D8AA 2JXAA 1D4M3 3MQ0A 1AZDA 1FV3A 1PVC1 3C7HA 1OLRA 2RDRA 2VD7A 3J7MA 3EDPA 3WTWC 4CP9B 2LH9A 3BALA 2OD5A 5ILSA 4NQWB 4B4CA 3JCUC 1W6QA 2L7FP 4JHZA 1HB4A 1D7PM 3OEBA 1H2LA 4JC1A 2ZMEB 4L5EA 1E3OC 1YS6A 4DS0A 3SH5A 5GAGJ 2Q2EB 4HMZA 4A3FJ 2GNDA 3M7AA 3MIHA 5DUKA 4K1ZA 4XQDA 4LB6B 3HT2A 2Y26A 1OC1A 2ZGTA 5D5UB 1G9BA 1WKYA 4QX7A 5DDJ3 2P0WA 1GP4A 3SZTA 2AUYA 1QGLA 5AVPA 4QGLA 5C6CA 2JDZA 3H9GA 1WPKA 4D6SA 3PUAA 2R7QA 1LTEA 3MPBA 3OYJA 4BKXA 1Z0HA 3FXOA 2D3RA 3CJRB 3B6AA 5LATA 2HWF2 4KDPA 3CO2A 2DT5A 1OT5A 2ZHKA 3HEFA 3TKYA 2ZZQA 2ZCWA 1QJX3 1SMVA 3FWEA 2HYGD 2HWD2 3C2UA 3F21A 4PI0A 1R1A1 3BQZA 2DA1A 2K9LA 3SQNA 1LFUP 4XQ4A 4JVAA 3SFZA 3OYWA 1HC8A 3WTXC 2XGDA 3K6GA 4FETA 4FFFA 3CJIC 3PUIA 2Z79A 1IN8A 3CDZB 5CQGA 1LHWA 1AR81 2DBIA 4L92A 3PNAA 3W58A 1MMSA 5E18F 4UV8A 4E6KG 1PIV1 4AYUA 1PZ8A 4H7LA 5FP4A 1E3HA 1MJ9A 1TQPA 3KFWX 3CO6C 2Z42A 1LOBA 4P1WA 3VBFC 3IIIA 5ICCA 3POYA 2VVEA 4MIMA 4A7YA 2YU3A 1WQ2A 2P3YA 1T6GC 2BNNA 3RZZA 5FKMA 2OUMA 3WG7H 2IS6A 3JXSA 1VBD2 5DAVA 3PVOA 1R9TJ 4ZU4A 3LAPA 4P14A 4RGSA 5DUIA 1H89C 3CJIB 4CHUA 1JW6A 2ZTNA 1FNNA 1KQRA 4UBGA 5DD8A 1W0TA 2IVMA 4U0WA 4DINB 1URXA 2BV4A 1MGTA 3QD6A 2K02A 1RUG2 1AL0G 4KMFA 2D7FA 5FPUA 1PUFA 5HVQC 3VWBA 1C8M2 4KGQA 4JGYA 3H5AA 2UV1A 4PFPA 2BW3A 1SFYA 4TXWA 2GIZA 5T54A 4Q27A 3VBFB 3T09A 4OUSA 3R61A 5GADJ 1UOFA 1OJLA 2DMQA 4WM8A 3S30A 3NJZA 4KG8A 2B9VA 2XV4S 4QAWA 5LBCA 1YX3A 2ZEZA 4XTMA 2FD5A 2XJVA 2X9DA 3RKQA 5F6LB 4AEJA 3W5MA 2DTYA 4P02B 3JRHA 3KX2A 3FC0A 3HUGA 2PQQA 3PVNA 1GP5A 2HR3A 3GHNA 4Q4V2 4BJTA 1D4M1 2H27A 4DUXA 3M9AA 2EH3A 2K46A 2RM22 4LPLA 3F22A 4YG3A 5L9VA 2BERA 5BPXA 1U6GA 1WI3A 2QEXI 5JI9A 3A23A 5DUXA 2YC4A 1UZVA 4IX7A 1F35A 2VNRA 3OBTA 1EUTA 2LK2A 1J9IA 3HVDA 3ZOBA 1Y1VJ 2UWCA 5I93A 5CADA 4CDXA 2W91A 3AKTA 4DYRA 1V5GA 1QDOA 4L18B 3U1XA 2R1DA 5LEKA 1DP3A 3RGBA 4MGRA 2PAEA 5K0UC 1JZ4A 5H9SA 3OIQA 2D97A 1ETVA 2HS5A 3WW1A 4MADA 2H1KA 5DDJ1 5JXHA 1H0BA 4S05A 4C91A 4EWDA 2LY9A 4IESA 3G1LA 2JENA 1ULDA 4KNCA 4PCRA 3W9AA 3EXUA 4NB5A 2EQRA 5EYXA 4A93J 3LOIA 1FAYA 2A5YB 2AEZA 5A6QA 4DPNA 2HQ5A 5EEAA 2E9QA 3ZR5A 2NQYA 2NPIA 4BXXJ 3C3WA 2AEYA 4KT5C 3U2RA 4L0YB 1W8OA 1QJX1 1ZRCA 1QJY3 2IAIA 4PDWA 1E2XA 4B7EA 3USUA 4LLOA 4WVVA 2V4JC 1DQ4A 2D98A 4ARXA 5L19A 1ACCA 3CIHA 5K0UB 2W1UA 3HKZA 2CW0F 2HOTA 4UW6A 4NJ4A 4XHXA 2QQ9A 2RS32 2VL8A 2DK8A 5C3RA 2HXIA 4HV6A 3S2HJ 5EGOA 4XOGA 4FE7A 4WBBA 4OMZA 3ZFFC 5FZ1A 2YC2A 1W7PD 1PX4A 1VPHA 4XN0A 5HV4A 2M3AA 2LUWA 1BK0A 1KQ0A 1SPPB 2BTVC 3JU9A 3N9QA 3S32A 1UMQA 3KVBA 1ZZCA 2FHRA 1GP6A 2JRMA 1PUEE 1RETA 5B5EC 2XPJA 1IN4A 1Z1DA 1HN0A 3DKXA 1PGL2 1CGPA 1GV5A 3LOCA 1K45A 3N9MA 5F0FA 3WODF 4LO8A 4XRSG 2W1SA 3OYHA 4UUVA 2ZMEA 2ZJRF 1MBEA 1WJ5A 3ZQGA 3ZFFB 1OF4A 5FZ3A 5HXMA 1OQDA 4BK5A 3KP2A 2Q2EA 4G7ZF 4P9FA 4PI2A 3W59A 2JKBA 5FO8B 3RS6A 1JH5A 4B4PA 1QVTA 1UJ8A 4AE2A 4RHV3 1L7QA 3ELNA 3CCEI 1YQ5A 1LDDA 4G8XA 3QPHA 2K9MA 4ZDLA 4R79A 1HRI2 3TOBA 5HLIA 5D6FA 4GB33 1XBFA 3QYBA 1HX6A 4A4AA 3M3QA 4XONA 1VBE3 4MGQA 4V2FA 3I3BA 3I2JA 4OAYA 2LKXA 5H20A 2IRFG 2FZ2A 3EBRA 2ETHA 5FZFA 1FATA 2A6EF 3K0LA 1W2UA 2FMYA 2NS0A 3LOBA 3HNYM 5HXVA 4YRDA 5AC93 4R1HA 1Q8OA 2JQ7A 3CP2A 2F4MB 1UAAA 2V5DA 2ZGLA 4FCAA 4BHBA 1QWRA 1ND2C 4EATA 2RV8A 2DA5A 2JEMA 4EJRA 1MMNA 2F6BA 5J8FA 5C5UA 2OS2A 4DQ2A 4G7OF 3POWA 4LUKA 4B47A 5KBFA 4EN9B 3CJXA 2ELHA 4JRAA 1YS7A 3ESWB 1MZ5A 4UFHA 1W9WA 4COYA 4ENMA 3LNQA 3PM1A 2NOGA 3VBOC 4CDQC 4IVNA 5FMOL 2IGOA 3NJVA 3DEUA 1ZHFA 4N9IA 4XF4A 2JA5J 4GIQA 3J7AY 1UU6A 1OCZH 5FMCA 3FK7A 1QJY1 5FAXA 4KIGA 2CO5A 1R5HA 3QAHA 4HA8A 1ND2B 4CEYC 4Q47A 1XDUA 3JRCA 2XB5A 2AH2A 2E60A 5GJ6A 3BTXA 1BIBA 2VXDA 4JX4A 4OCTA 2X10A 1BKZA 1LNSA 1T08B 4LHNA 4O6JA 4BXFA 4M9XA 5CPRB 4QPOA 2XOMA 1G2HA 2WRAA 1WJBA 3VBOB 4B4RA 2LOOA 1V9U3 4CDQB 1QNYA 3ZYRA 5F3GA 1YLLA 3MIFA 1D8JA 4PJMA 1S5LC 2ZKLA 4QKNA 4J1WA 4QHOA 4HG6B 5EXOA 1OH4A 2EIBA 4EN7B 1Q56A 5GZDA 4KG0A 4JGZA 4MH0E 5T55A 2VGDA 4CEYB 1XB9A 5FY4A 1RL3A 3I2GA 4K9SA 4C3HJ 1C1FA 3EMRA 3PHMA 1ZRDA 4Q0UA 2JA6J 4I99C 3DBLB 4NIHA 4MYEA 5E3OA 2MEV2 2JSPA 3BR0A 3HR9A 1W9FA 1IDYA 2DVFA 1UMHA 4KMQA 2FEZA 2VBYA 3KS7A 4S04A 4S0HB 4Y5Z0 4YGBA 3O1TA 3IKWA 5J98B 3ZXEA 3RZMA 3H0DA 4M4RA 1OCCH 3RQ0A 4MUVA 1IV6A 1S7EA 2MW8A 2YXSA 1W28A 1N77A 5FYVA 5FZAA 2UWBA 1JKQC 1JT6A 2OUHA 3WGGA 4EEFG 4BWOA 4CU6A 1T95A 1W8ZA 2X51A 1ON1A 5KHDA 3RJPA 2KDZA 1WCMJ 2GNTA 2WAAA 4RHV1 1UNBA 2WB1N 2VMDA 3LFIA 3B9IA 1B9MA 1AX0A 3OYLA 4ZPIA 4IDZA 2QQOA 3G71I 3NKGA 4KBZA 1VQ7I 2ICWG 4GB31 4XBNA 3X2QH 4OQ9A 4L9NA 1PK6A 1VBE1 2XUBA 1NYWA 2V26A 2M7AA 3OV8A 5EEGA 3ZSJA 2WUHA 1EV13 5CFCA 4DRRA 4R4ZA 2VMIA 1XGNA 5ANQA 3VB9A 2Q8DA 1WH7A 1X1DA 3LF7A 3MZHA 1VMHA 4GXLA 4EM0B 2B39A 1FYMA 1F4AA 4IL7A 2J1AA 2ZC2A 3GVAA 1H8TA 4L9JA 3B69A 2HTJA 1JJ6C 4HPKB 3MKYB 2G19A 4GH4C 2VOOA 5FPZA 3D82A 4A3MJ 2ISZA 2NN8A 2K3FA 4PLNA 2K3PA 4CA9A 1UX7A 2DVDA 2FMLA 3KYCB 1SFKA 5IYDJ 1W2TA 4ZYDA 3UT0A 3ZLIA 3OR1C 2ZBJA 1Y39A 1R7JA 4JQTA 5CISA 2Q8KA 3FBMA 5LA2A 1TVGA 1WGPA 1AJKA 4BQ2A 4AYBA 4QPGA 1XN7A 2LF8A 3NNJA 4AGRA 4JAAA 2M0CA 1BEV3 3RCOA 3AMQA 2E33A 2Z5UA 3J80K 5I8TA 1I27A 4Y15A 4EZHA 4IV1A 1CF7A 5B1AH 5JLWA 1NKGA 1IC8A 4BXUA 4YM3A 4COZA 3LL7A 4FX0A 3DKQA 3RJRA 4GH4B 1FOYA 2UZKA 4K1YA 1WLTA 1WVRA 2UWMA 3M3YJ 4WVZA 3ZFFA 2R7TA 2XWBB 4A3XA 1OOPC 4ZXKA 1YFHA 3RYKA 4BXSV 4AVZA 1GZTA 5FYBA 3RYRA 3NWSA 3T2TA 1DU3D 4QKBA 3S14J 5DABA 1K7AA 1AXYA 2HWD3 2R7WA 1V9U1 2J1EA 1RHI1 3JSPA 4RS5A 1B35A 2C5DA 4PBPA 4BNCA 3L00A 4EN6B 3SH3A 1Y4WA 1BI3A 2JDMA 1AU7A 2XAFA 3T3YA 5FRMA 3MLKA 2MYSA 4O3MA 3NNFA 5HOOA 3M4FA 1GXQA 2VCMA 4HBLA 5M3FJ 4BY1J 1QJZA 4P9GA 5IFTA 3OJBA 1OLTA 4HLTA 2BNOA 3AYAA 4LO7A 1ITYA 1FMVA 3TWIA 2E7XA 5DG2A 4Q1RA 1DGRA 2JDHA 4AEMA 3AZVA 4OWRB 1OLME 5BNNC 3BTLA 1GNZA 1OOPB 2JRTA 1XCVA 1NT0A 4O7XA 1YO5C 1X8MA 5FYUA 4PLOA 1JTZX 1S1AA 3HNMA 4LKSA 5FPBA 1IF1A 4ATEA 1VBD3 3F2ZA 3QQAA 2XL9A 1GOGA 2XAGA 1RUJ3 3I2OA 5KC6A 2DJNA 1XX5A 1UD1A 2FNAA 5F0HA 4ASLA 3PJYA 4S2DA 2B0LA 2W2IA 4YARA 4SBVA 2BOIA 5LBEA 2XVGA 3BIWE 2RS52 4C0HA 4MG2A 4A42A 3LSJA 1XTAA 1C8M3 3KSCA 1UX6A 4I2OA 3C2BA 1DUXC 4IGPA 5BS6A 3OS1A 4A6OA 5BNNB 3OGGA 1VF9A 2KA3A 4F7ZA 1MMDA 2CQ7A 2ID3A 2VJJA 2WADA 4QKFA 3UGGA 3I53A 4Q0SA 3TO7A 1EV11 2VJ5A 1R49A 3WG1A 5K1YA 4JK1X 1RKTA 2V6EA 2GC3A 2B46X 2CW8A 2IC1A 4M01A 3KHBA 3AXEA 1YYNA 4YGDA 4U87A 4UNOA 2FUG2 3WHTA 4Q4V3 1LB2A 1JI8A 4MX3A 5FQ0B 5JSPA 1F4KA 1TLHB 3GEZA 2VONA 1IUFA 2RM23 4CRQA 4NHYA 2K27A 1UU4A 4UW4A 1ZBA2 1VRH2 1A6CA 3I4MJ 4CDQA 2CMPA 5F6FA 2BVVA 3BYWA 3K7AJ 4II3A 5D5WB 5ICEA 1B8IB 3VFZA 1ETOA 3JCIA 5JSOA 1TWAJ 2CL2A 1UQXA 4ZYGA 4XF9A 5FFZA 2XB6C 1Y9QA 3ZRGA 5L9RA 5KXBA 1AR92 3PSFA 2GMMA 4L0ZB 2CS3A 3MVPA 1IPJA 1BM9A 5C5TA 2XJSA 3UKVA 3ECHA 4QWNA 5F0CA 5HCBA 5LRSA 4NC6A 4JZRA 5DM6F 3ZYHA 2KZVA 2E36A 4ZDPA 1Q8SA 5KHKA 3BWGA 2E32A 5K7PA 3NRVA 2H6CA 3ZPOA 2Q0OA 5CIRA 2A71A 1YYVA 2R7RA 3CCYA 3FXKA 1V6KA 2P3IA 2HWD1 3IMNA 1U9OA 5JFRA 1Y0UA 1P7JA 4XVHA 2HWE2 3HAGA 3EHKA 5E16A 1EPWA 3BU7A 5FGMA 4FQZA 2ISYA 1O5UA 5JDBA 2CUEA 5FWJA 4DOZA 2FQ3A 3OIPA 4NIDA 3OMYA 3ZR6A 1YQCA 3MFCA 3PL0A 3CDHA 3ZDVA 5FP3A 1I6XA 1YC61 3CEWA 2LW8A 2QM3A 3PSIA 3MEXA 5LW9A 3OYAA 5T5OA 4QDRA 1I3QJ 4EM2A 4BJ5C 3LA7A 1S2EA 2AC1A 1D8KA 3ROUA 4FOWA 4I3GA 2EJRA 3ECOA 3DU6A 2J1VA 5AIQA 1LDKB 3C7FA 3A02A 2L01A 2YU9J 2CUFA 1YJWI 4KFCA 3TNPB 1VBD1 4I0BA 3N36A 5LK7B 4RFRB 2A3XA 4LHSA 4BA6A 1NXD1 3THCA 5LGUA 4H55A 2OX0A 1SFPA 4I0AA 4M4PA 2DT7B 2R4GA 4EWEA 3VKMA 4UUSA 1Z77A 2K5CA 3MUY1 2WA4A 3KQRA 1ULOA 4NROA 2JA2A 1LEMA 4PT6A 5M5WJ 1IG7A 1RUI3 2OPTA 5TGTA 3PO3J 3G6EI 1C8M1 5A7QA 2XMLA 1NTCA 1VBB2 4V2GA 5F2WA 2N7GA 3E5XA 2R0HA 1TTYA 1WLWA 2R49A 3F3XA 1A31A 4HN1A 2P5KA 2X05A 1UW8A 1HKDA 2OQ7A 5KXEA 3RYPA 1IPKA 2WL1A 3S0MA 5F64A 1O59A 4FSJA 1BQPA 2M4GA 2JE7A 3GTJJ 1ENRA 3WG4A 1P92A 3VDDC 1V6LA 2HYKA 3TGNA 5EPAA 2Z9OA 1HRI3 3IM0A 2WQZC 4QB1A 4KL1A 4Q4V1 5FJKA 1NUKA 2SBAA 3NKTA 5D5VB 3SKJE 2RM21 4RMNA 5FMDA 2V4AA 2VZVA 3H8OA 1L3JA 3LSMA 4BQYA 2B7YA 1GZCA 4CICA 1NG0A 4ZKTB 1EPZA 2PI0A 4YYOA 3MKZA 3BR6A 3EYYA 1LHNA 4D6RA 4LBJA 3PJRA 1O8PA 3JD72 5F39A 4ZTFA 3S1MJ 5IP9J 3ACIA 1P9QC 1JZ7A 2DO7A 4ES8A 3RKXA 1DPUA 4DBRA 2BBVA 5CYVA 4LHKA 1QJFA 4HV5A 1ENSA 3V8JA 1ODMA 2GALA 3WP4A 3VZKA 4DRVA 2LDUA 2H8RA 4BACA 4CH7A 3FM5A 2EXIA 2P37A 2PJPA 3O14A 3MN2A 2VVDA 3V0BA 1Z67A 2VBPA 4KN4X 1R71A 1VQ6I 1HJGA 1JZ5A 2RKHA 3GCWA 1IW7F 1EV7A 2LNBA 4HEA2 5FWEA 5GLTA 2DPDA 4META 1LEDA 4ZU5A 3HBKA 1UY2A 1ASJ2 1O5LA 4EVIA 1CZVA 1WCKA 3P9IA 1AX1A 2G1MA 2RS31 4LR4A 3C2GA 4KNYA 4U7BA 4PF1A 1XDSA 1YHQI 4A3GJ 4F55A 5BNNA 1E17A 4E8DA 3WNNA 5FJ8J 3R4SA 4KUMA 1CIWA 1W6PB 1FX7A 2WLPA 5ICFA 2ZABA 4PJLA 1XS9A 1AR72 2HU9A 3OYMA 3DBHB 3S16J 3CMYA 5F8PA 5L3GA 2R042 5DAXA 1XGMA 2J22A 3LDKA 2XJRA 1F5JA 3KGLA 3O6BB 4X8PA 3WW3A 4CTEA 1KRIA 1XNTA 5DUVA 3GJBA 3A03A 3SHRA 2OUJA 5IFPA 1XRUA 2HPMA 1PYVA 4ETSA 1XC5A 1G4DA 3DFGA 2VNGA 1QOTA 2QSGX 1ZGJA 2VN2A 3RZOJ 1S7OA 1W5SA 2VT3A 3AG1H 2CH0A 2QQVA 4Z07A 2FOWA 3RG0A 1B8IA 1YG2A 1GVJA 2R7UA 4LB5A 2WS92 3LWFA 2CFXA 3WT3A 2TDXA 1B72A 4LE4A 2W4SA 4HNUA 3UGFA 1G9DA 2B5HA 4D6QA 1BA5A 2MGQA 3MO4A 4R9CA 1YW9A 3L2VA 5D8KB 2YBSA 4XLPF 1LHUA 3FFZA 1UY3A 2TRTA 3HTSB 1UKGA 1KQ9A 1HRI1 4QIWN 3PFIA 5JLXA 4WV8A 3M1EA 1OUSA 4QQPA 4D94A 1ULCA 2E7AA 3QH6A 2JUCA 3BR1A 1W2OA 2WWYA 5JWPA 3ACHA 1U0AA 1ZA4A 4E4SA 1S55A 4M73A 2BY3A 1VTNC 3RPUD 5L3CA 3SEEA 1POV3 2AREA 4F52A 1X2NA 3EUAA 3I3QA 1N1VA 5FZ8A 3ABKH 2FF4A 2EZHA 1HRV3 2Z16A 3OPTA 3PTRB 5IATA 4RGGA 1UZ0A 1W6NB 2LC2A 5F5CA 4E7ZA 1MIJA 4AI2A 2XDVA 1ENXA 2WY7Q 1WKMA 4BM8A 2GNBA 1MNMC 4RQPC 1M4WA 4WX9A 1IAWA 1J3PA 2RREA 1V0AA 3AFKA 3NW4A 1YRZA 4FXGB 2A61A 3KF3A 1LFPA 5FLVA 1ERDA 3ZSKA 3AFGA 2ZFUA 1SDWA 5I8SA 3T8TA 4CPBD 1K78A 1UY1A 2CV6A 1ZVFA 1SACA 2JDYA 1MQTC 2B9SA 1HQCA 1TQMA 5FD5A 4CUAA 2AXLA 2UXNA 2LVSA 2UYAA 3ASIA 1ZRFA 4K20A 2MG4A 3Q0WA 5FYZA 4M3EA 3RI8A 1R22A 1HSTA 4GYGA 4LA3A 3FLRA 4RQPB 1FSEA 3K70D 1ND3C 4MOAA 4M71A 4RB0A 3RWKX 3E1SA 3VBSC 3R0RA 3GCMA 1BN5A 1U3EM 3LPGA 4LTAA 1FIPA 3CQZJ 2WB1A 4NPRA 1S2BA 2VT2A 3PURA 1D3YA 1B09A 5D21A 3N7JA 3BPSA 3I49A 4H7MA 1V3FA 4Y5SA 4BLIA 3MFAA 2R7VA 5M3MJ 3IB3A 4C2UA 2Q30A 5CKMA 4LG3A 4DEQA 1MQTB 1HW2A 3AC0A 4YZ1A 1S6LA 2EIEA 3BTAA 5DYMA 2LM3A 2QQUA 3BLYA 4XF0A 1XGSA 3GFLA 4ZZ5A 2Q4SA 1UG0A 1ZTRA 4XC9A 3BTIA 3VV1A 1FV2A 1ND3B 3NV2A 1UHWA 5LY2A 2W5FA 3Q0VA 2QUOA 3DXJF 1YFYA 1VIWB 1QXPA 4X8NA 2J7MA 1TNRA 3BC8A 4L5JA 1TWFJ 4XFGA 4LBKA 4LJZF 2RDPA 4XEZA 3SEQA 5I0RA 3WDVA 5FZMA 1FNYA 1T2XA 2D44A 5JMOA 5FYSA 4HAMA 3QWLA 4II2A 3AKZA 2AZ5A 1OFSA 4L9TA 5L36A 4GCVA 5I0SA 4EM1A 5BNOC 3TW6A 3ZYPA 1QHDA 1TC3C 5FKBA 4BQ3A 4XZUG 3OUJA 1KONA 4HKLA 4XRSA 4RAZA 3BZCA 3V7SA 1LE8A 3U9GA 4A12A 2V1NA 2X1CA 1SLTA 2ID4A 3SXWA 5DEQA 4IHYA 5FKCA 4JTNA 3WHCA 1AKHB 2PJRB 5GZGA 3ZMDA 1RUE2 2DFBA 1RMU2 2DUQA 3WP6A 2MFZA 4DZGA 3GX4X 3KT7A 3BG7A 4N0BA 1O3TA 3WU2C 2D93A 5FMOS 5LFAA 4PBOA 3SMHA 4ATFA 1XNCA 2DBBA 4NUBA 1POV1 1UY4A 1GDTA 5CVIA 3LMMA 1WSUA 3GUDA 1OPCA 2FDGA 4XUPA 1BMV2 3SHFA 2JZYA 1R082 4IHTA 3LCPA 1HRV1 3WF4A 4PUSA 5BNOB 2VLAA 3C8XA 4RAGA 3F72A 5F5QA 2LR8A 4MNUA 2JWTA 1SVLA 1DHKB 2KXLA 3JRAA 3E5UA 2FDJA 4JV4A 2X8KA 1ZBA3 2GDFA 2RV9A 2XB0X 1XMKA 4OUEA 5HS8A 4PGHA 5JR3A 5HDKA 1NCRC 4OHYA 1YRNB 3HTUA 2JJ7A 3F8CA 4FXKB 4HK9A 4HNTA 4OZOA 4IXLA 3I3EA 2PFBA 5D4RA 1G86A 2TCTA 5DTDA 1G3YA 3TBIA 4CCDA 4JRLA 3ZYBA 1MDMB 4XIDA 2CQXA 3U4SA 3BOPA 2R073 4KU7A 1DDNA 1K5JA 3USSA 3MKWB 1G3TA 3LD8A 2A73B 5G04L 1VBC3 2R7DA 1SBDA 5DZEA 4AI3A 1ZGWA 3FXUA 3GZNB 2WV1A 4MSVA 4YFKF 4G94A 1COV2 3LSKA 2V79A 4JX6A 2V4VA 4Z2AA 3F6VA 1IN7A 2M0MA 1NCRB 1WUVA 1ULGA 3VBRC 3IKVA 4XF3A 5JI6A 1JUIA 2RDSA 2IA0A 3S3OA 5GZFA 3S6PA 1OA4A 5BPIA 4QT6A 1IRZA 2FQ4A 3DPTA 1W0NA 2QA4I 4RFT0 4HT1T 5EJ3A 2D5FA 2HWE3 1JZ8A 4PJYA 3IN9A 4UHTA 1QOSA 4AIDA 1ZGAA 2PLV2 2HKOA 1A5JA 1Y56A 4LK1F 4AEDC 1G9AA 2WAOA 2FSWA 1Y3TA 2PN6A 2XVLA 5IYYA 2E51A 1PDNC 3IP4B 3AM2A 3IH3A 3WF3A 4XRMA 2XKOA 3IL2A 2ARBA 3HB9A 1CAWB 3AYDA 2R7SA 3VBRB 1R4NB 1EH8A 2DMTA 3KV9A 2ZMNA 2DPUA 2I74A 4AOCA 1S0IA 1NY71 1HXS2 3K4NA 3H5RA 1YO8A 1W0OA 5I91A 1UXZA 2DCKA 4UVCA 3S8PA 2H0BA 1HDKA 2ZX4A 3BG6A 3K2ZA 1W6NA 3FXQA 4JTOA 2IVIB 3NAPC 1EP0A 4I01A 1T2KA 2VW2A 3L2CA 3PUHA 4QB2A 4AEDB 2NVYJ 3E6MA 2E34A 4IZZA 4LK6A 3S7IA 4Q48A 2NOJB 5L3BA 1A6QA 1MZ6A 1Y8QB 2RS51 3WG9A 4B09A 3BP8A 4CUCA 2VY0A 2YX4A 1GU3A 2I2SA 1VBB3 3PMSA 2R3SA 1JI6A 4DOUA 2R5ZB 4L2NA 2DBNA 3I55I 3HOTA 2DLLA 2DVAA 4AF9A 3P6BA 4YIRX 3M4OJ 3T08A 5A6XA 4J00A 3B00A 5DQ0A 3PJQA 3R60A 2PX9A 3RPQA 4I30A 3WU0A 3NAPB 3U0ZA 1BC8C 3ZMOA 1XPXA 1D0GA 5F5IA 2D2WA 4LEJA 5KAFC 4RQPA 2PHLA 3BUCA 3GWZA 2DFHA 1ZBA1 1VRH1 5T52A 3Q9OA 1PZ9A 2D6PA 1WI9A 3A1YA 5ACA3 1VB2A 2DA6A 4XSXF 1AYN3 1BK1A 1JYNA 1USSA 2F17A 4ITVA 1BHGA 2M34A 1S0EA 4AEKA 5IHRA 3WTTC 4YEJA 4HNVA 4MFEA 2PYTA 4FCYA 3JD73 4ZJZA 2W24A 2VODA 1J7KA 3S93A 4CP2A 4XIOA 5K9YA 1WW4A 3S7EA 2Y6GA 3JTHA 2NS7A 2CG4A 2W25A 2GN3A 1V00A 2R071 3PUQA 2ZGOA 2QQ8A 1VALA 5LHGA 1VBC1 5DMYA 3TRSB 3HMYA 2RS13 4HW0A 3N9NA 3EQEA 2Y64A 1Y43B 4IE7A 1V5EA 4YSFA 1OQ1A 4M3CF 5A3UA 5C8CC 5IOZA 3R0AA 4XIKA 1PGW2 1LRHA 2BHZA 2L7ZA 1FTZA 3BVCA 1XSVA 4B1RA 3O0XA 4PGGA 3NV1A 3H8XA 3QODA 2BV6A 2X1DA 1T33A 2JN6A 4Y22A 2HWE1 3RZJA 4LKDA 3ZMUA 2QZ2A 3ZSEA 3DEWA 3CCMI 4NOTA 1W8WA 3IAPA 5DDGA 2HQAA 1IN6A 4I02A 3DLAA 5FLIA 5GM0A 3F9KA 9ANTA 2RHPA 1IUYA 2WKKA 1HOMA 4FFIA 2ZGPA 2KIFA 1AKHA 4IF4A 4RR3C 4MXWA 1HA8A 5KCMA 1AR73 5C8CB 5FP7A 1HKTA 3H50A 1LENA 4QPIA 1V54H 4FI9A 2R043 3IAM2 4GWNA 2YPJA 4XAAA 2WZR2 3VZLA 1UN1A 2E53A 2NVTJ 5BNOA 1JN2P 1S0BA 3HBLA 3OD0A 4EWAA 2QQJA 2BUKA 4DFSA 4YRVA 4LULA 3PU8A 2D6NA 4E7IA 1PNFA 4DZPA 3ILNA 3MIDA 5FY7A 2CWEA 2JUGA 1F31A 1LJ9A 4S2GA 1UMIA 1RZ4A 4RR3B 4EYUA 1YRNA 2OZ6A 3N35A 5A7WA 3RPUA 2V1UA 1H8AC 2Q1MA 1W9YA 1C0WA 1HKQA 3A0KA 3HOYJ 4GDFA 1VBB1 3DCQA 3F6OA 3KLSA 4P9WA 4XDPA 4QHBA 3GALA 1YJNI 2EBIA 3IAS2 2GXBA 3E5QA 4L0PA 1DYKA 5ISLA 1WMFA 3S1NJ 1LOFC 1ZREA 4CXFA 2XROA 4DY3A 4EN0A 4QKDA 2W00A 4DYCA 3MF6A 1NCQC 2BOJA 5F32A 5EZHA 2DJIA 2CJJA 2LRDA 3KIOA 3OYDA 2VZUA 1WH5A 4AI9A 2VO5A 5JCTA 4YGEA 2WT0A 4LBQD 3VL8A 2JDAA 4QX1A 1FYUA 5ACA1 2CAVA 4GJYA 2RVAA 2NNNA 4DYQA 3CJNA 1APLC 2BBAA 2K0GA 2QDRA 3KM5A 2FDFA 1LEAA 1QZEA 1V4RA 4XHBA 3JD71 1PVEA 4Y4YA 2BQPA 2HOAA 1Z7S3 2B4KA 1IKQA 3V64A 4HLXA 3BN6A 1N25A 3AG3H 3AVRA 2R062 2ZGKA 5LGNA 2E35A 3RZLA 4PSXA 1MZEA 1ZRIA 4A6DA 3ES4A 3OY8A 1NCQB 4ZZDA 3RWNA 1ALYA 4WF2A 3AXDA 5LHIA 4TN7A 1V6IA 5ICGA 1OH3A 2BHYA 3HT1A 4G4FA 4AVPA 2RS11 2E1CA 3LDRA 1UYXA 5EDNA 4JQRA 2DA3A 3GTPJ 2CSGA 2Q8CA 2W47A 4A6SA 4F3JA 3ITQA 1YX5A 1W5TA 3FBIB 3LKJA 1JHNA 1W2NA 4HPQA 3EJKA 3LSIA 3NEUA 4EJUA 1M06G 1YW8A 1F2NA 3OYBA 4Z1VA 2JA7J 1R4MB 4ZDOA 1MVQA 1BVVA 5FXWA 4CCEA 1IS5A 4ORFA 3RI9A 3I3LA 2R7ZJ 3W5NA 3ZXLA 4HX8A 2IXSA 4XPVA 3PIGA 5CAZA 2HOSA 2P17A 2R5ZA 3T4HB 3O1VA 3TN92 4AVCA 1KJLA 2R0FA 2P3KA 1AR71 2IEKA 1RR7A 3AMHA 5K7HA 4IQJA 1YJLA 2E1OA 2FDKA 2R041 3HKZN 2QJVA 3FBYA 3EQLF 1XPWA 2VUMJ 4FPKA 1U5IA 1GV9A 1SLIA 5D5XB 3QPSA 1OURA 1GZWB 5ILUA 1MZBA 4XACA 2GAUA 3K1MA 2MABA 3HC7A 4RS8A 1GICA 3AG2H 3HN1A 5CKNA 2BBYA 2G9ZA 2G7UA 3RJ2X 1FLIA 1MH4A 4CDUB 1LPQA 4MEYF 1ENHA 1H0MA 1BOBA 2XSDC 4DXRA 3KEQA 5A7OA 2YU1A 1ZG5A 3NQHA 2WS91 2XJQA 2J5OA 5A3LA 2XAUA 3J81K 1MSEC 3OPZA 2GH8A 4IE4A 4WCGA 5J4YA 2ATFA 3TW7A 1KS5A 3HRSA 2BU9A 4XXPA 1NK3P 1BBT2 1CAVA 3TEDA 3BZ6A 4AVAA 4C0BA 3MZ8A 4IXAA 1JHJA 2NVXJ 2A6YA 2W0XA 1FSHA 1GMMA 4DXTA 2Y6HA 2DFFA 2MH2A 1EH7A 5DZGA 2FJ1A 1X1CA 5H6RA 2YMZA 1SD5A 1FY7A 2V9PA 4IEXA 3KB5A 1OVSA 4H3WA 1RUE3 3WNMA 1RMU3 1ZA7A 4GMP3 1W0PA 2ZX3A 4GJZA 2F5CA 1SFXA 2XGEA 1QJU2 5EYYA 3UNGC 2Y0IA 5A3WA 5LY1A 3BR3A 4AI1A 3WDXA 4C2MJ 3PDQA 3VKLA 4AVVA 2E63A 4QX2A 2HKXA 3PO2J 2DUPA 5FOJB 4BQAA 1Q1VA 2ZXHA 1R083 2HZTA 2G0EA 1NQDA 4A0YA 2XPUA 3S3MA 2K7LA 4G3YC 3T0DA 2VMGA 2R6QA 5C71A 1W5CC 1Z21A 1BR2A 4A3KJ 2DK5A 4RYDA 2QSHX 4NHXA 1PO13 2D6LX 1BXHA 1DBNA 2Y6FA 3CMGA 5C8CA 2DYRH 2R7XA 2WLQA 2ELJA 5FCCA 5GZEA 1IJWC 2DDUA 2KIQA 2V7FA 2IS1A 2Y0MA 2LMDA 2K9QA 2QF7A 1CJDA 3SEPA 3UL2A 2P4WA 1QIQA 4CEWA 1W6MB 1R1ZA 4OUMA 2DUOA 2JECA 2IGMA 2W87A 4CYCA 2PHFA 2WYFA 4KWKA 4QX0A 5FZCA 1VE0A 2KIMA 4XFAA 3J80Z 2QKMB 4XJWA 1OKRA 1I9RA 3IZOA 4C8DA 1QHHD 5K7ZA 3N9PA 4A69C 4ZYAA 1S0FA 4A41A 3HYIA 5CYYA 2VJIA 4NC7A 3KZIC 3CD6I 1PVXA 3RTRA 1AYM2 4E8CA 1COV3 1I1SA 3BR2A 1OR7C 2STTA 1W4MA 2EB7A 1TWGJ 4DGWB 1VAMA 3JRBA 3ML6A 3WU1B 1SFNA 1C3HA 1J3QA 2H6BA 3E3VA 4RGKA 4AD9A 3KD4A 2BFUS 5FBZA 4D7MA 5A2QK 1QZYA 2XGCA 2VI6A 3WX5A 3FFQA 4NVPA 2GA1A 5EJCA 4GQ7A 2VE1A 2L9LA 3WNOA 5C3EJ 2L54A 5IVCA 4URAA 2HEOA 5EWSA 2CV2A 4M9ZA 4ZZLA 1VQ5I 4B29A 4E70A 2WSUA 3C7GA 4BS9A 5J37A 2EFNA 1VBA2 5A3OA 3IDCB 3HJRA 1MKMA 1Z0XA 4L11A 3ZFGC 5A33B 1MVEA 4AGGA 3BG5A 3KCYA 1UU5A 3A4UA 1TWHJ 3ZYGA 2ZGNA 3QU6A 4BISA 3I2FA 4BQNA 1HXS3 1MMGA 2BDRA 2VG9A 1UG2A 3MF9A 5FZOB 2BVBA 2I8DA 1WMDA 3BPVA 2ZGSA 1VB4A 1I1GA 3FHAA 4IE0A 4HRIA 4KMUX 1ZR4A 1WCQA 1T39A 5J1RA 3ZYFA 3BJOA 2KISA 1NCQA 2P34A 2P5LC 2HTSA 1WMXA 2CSOA 3TAYA 3COAC 4PLMA 4XDOA 4IEQA 4ANJA 5EG0A 2C6YA 5C4JJ 5FZ7A 4CZCA 4XUNA 4DW6A 2PHWA 3HM5A 2BWCA 3ZFGB 2ZGUA 3ZR8X 2VQCA 4BAYA 3DLLF 3DTEA 1CZTA 1JOBA 1RUE1 3OTFA 4ESFA 1RMU1 1W6OB 1QH7A 4GMP1 2LALA 1I5ZA 3VDXA 2DWRA 3RDIA 2RAEA 3H3VK 1WZXA 4AI0A 2I10A 5C4WA 1OA3A 3M70A 2ZEYA 2VW0A 2WA3A 5F3CA 3B6CA 3ULQB 1VQ4I 2HEVF 2AACA 1XE7A 3M07A 4M3FA 1J83A 4LA2A 1X4OA 4YW2A 4FPCA 3SZGA 1BMV1 2JG8A 2Z2SB 3K2AA 1R081 4Y20B 2EZKA 3P7NA 5SV5A 4J19A 4XR6A 3OEAA 2O7OA 1OPOA 4LT5A 2ADEA 2G7HA 4FFHA 3AMPA 2DW4A 4BE2A 3E0JB 1FOD2 1PO11 4YW3A 4Y33A 4AVTA 4UT5A 3JB8A 1SD6A 2XGXA 2BRTA 3H3UA 2ZXQA 1F36A 3SCGA 2JE9A 2D40A 2L9NA 1SFOJ 1K83J 2A6XA 5EJ1B 3U10A 1LKXA 3DF8A 2VU9A 4B1LA 1UYZA 3HIFA 1G7YA 2VKHA 3L9FA 1FJLA 1NQJA 4YVSC 4KISA 1O8SA 3MCZA 1DIWA 2HBTA 3AYCA 1JUHA 1R1A3 2M8EA 4BEHA 3WD5A 4R9DA 3JRFA 3AX4A 2VQHA 5LBFA 4XCAA 5J96B 1GZWA 4FISA 3DV8A 3FMRA 1X9TA 1TNSA 3S1QJ 1LCLA 1PNGA 4V1PA 3LSHA 4BL0B 4HN0A 5LCWL 4BGDA 2JWPA 5TISC 2ZKNA 3SFIA 2KRHA 5HNFA 2C1FA 1Y6IA 5BQTA 2VULA 1JOPA 4CDUA 1COV1 3WQ7A 4FPHA 3Q0UA 3WLUA 5HV0A 3T1MA 4W65A 4QD2A 3K4ZA 3A01B 2WAFA 3PTYA 4X0GA 1FMD2 1UY0A 5FYIA 1KEXA 3QLQA 4AYBN 4OI0A 5JR2A 2KJCA 4AFAA 1X3UA 5A1AA 4FPEA 1G8WA 3WHUA 2RMU3 4YVSB 2HJIA 4LO6B 2XONA 1UZWA 2VXRA 4NAMA 1YTYA 1ONAA 3MD2A 2EILH 1VMFA 1MBJA 4UF0B 2PLV1 1N1TA 2DU9A 2VAUA 1H9TA 2ZOEB 4LGWA 2X5IA 5E1XA 2KP6A 2VPRA 4ET7A 2Y69H 4Q5SF 4XXAA 5J1XA 3OYNA 2OJED 3ZN1A 2EWNA 4EJVA 1W05A 1O4XA 4S2HA 2R7OA 1X1PA 5HDNA 3HOSA 4LLFA 1RESA 1WJEA 1TW2A 3T8RA 3L2WA 5J3UA 1DGRM 1IZ1A 1LOEA 1NX9A 3H0GJ 4LO5B 4QGNA 2ZGRA 2G4IA 3UGHA 1HXS1 2WZR3 4QHZA 1IGNA 3FE5A 5D8LB 3ZQHA 1PMHX 4K8RB 3ZX7A 5CVUA 2LSOA 3CQOA 2YGMA 3O0WA 5IYBJ 1HIXA 3CF6E 3LEMA 4OULA 4ISRA 1UZYA 2X1EA 1HJFA 2AS5F 1FTTA 3WF1A 2M9HA 3ASNH 2HWVA 2R93J 5K5RA 3LE0A 1I39A 2YV8A 1IXCA 2HDDA 4CO8A 1Y1WJ 2JPBA 4YW7A 1UYPA 2RQPA 2M2EA 2KRCA 2YC0A 3I3DA 1ZZ9A 5FPXA 5FP9A 3PL8A 5IVJA 2XF5A 4XLNF 3NQOA 3EUKL 3K4CA 1RRJA 1H6YA 3OGSA 1GR3A 1TNFA 2OQRA 4CU7A 3K70C 4KWJA 2DA7A 1JU3A 4COUA 1WD3A 2QUFA 2OAZA 3APBA 3VZJA 3CF5F 3M1HA 1GSLA 1S0DA 4KQ7A 3I2IA 2NM1A 3AVSA 2YUEA 3K75B 4HFSA 1DPRA 3FMGA 2EFPA 4QM8A 3B9CA 1A35A 4JKKA 3I54A 1SLAA 2HBUA 3U75A 4FTBA 3M1CA 1AVBA 1ODNA 5FZHA 3ABMH 2F4LA 3PU3A 1ZR2A 1TT0A 4Z92B 3EUHC 1A04A 4HANA 4CXWA 1RTVA 3AK0A 2FD8A 2R063 2X6OA 1QOOA 1OYIA 2FE3A 5J1UA 1Y7BA 3VBUC 2XF7A 1Q5OA 3T0YA 2QZ8A 1V6JA 2M7BA 2DDAA 3CHXA 1S29A 4EJTA 3HD8B 3MIBA 4FHTA 3GBFA 4CUBA 2EXJA 4QXCA 1G3WA 3A4CA 4YW6A 1XMXA 1WCSA 3F8MA 4E2SA 2QQWA 2R5YB 2XRNA 5JI7A 4IV3C 1CD3G 1PGW1 4ZTJA 1X19A 3NWTA 2EPFA 2QENA 4Y24A 3DQVC 2JB8A 4D3WA 3AZYA 2XRLA 3IDEA 2OZJA 2RMU1 3SKVA 3ERMA 4OINF 2F4PA 2FBHA 3VBUB 5LA1A 5HLTA 3PVEA 4G12A 3VDAA 1X7NA 2J1TA 3LAJA 4KT6A 4LLLA 1CR7A 3Q8CA 3H9AA 3C7EA 2UY9A 5JZGC 4XZPA 1C1LA 3RMXA 2CV0A 2ADDA 3ZQQA 3TN93 4P9LA 2WT2A 4HVOA 4D0QA 1SBEA 5J7MA 2WWUA 2YS9A 4IV3B 3G1OA 3IHUA 1YI7A 4XILA 5L7OA 2WV0A 1HV1A 3MIGA 1HDPA 4LBLA 3KVAA 5CFDA 2HQNA 5FR3A 2AQFA 4BE3A 4C3JJ 2VMFA 5IVVA 4E2QA 5FZKA 4C1WA 5A7NA 2WZR1 1ST8A 4X6RB 3HPGA 1KGSA 4A3JJ 5DUUA 4A3ZA 1UCXA 3WQBA 2LY1A 2WO3A 3MW4A 2WR9A 1CN1A 3LB9A 2L0KA 4M3CA 5JZGB 4GRIA 3LAGA 5DG1A 1Z9CA 4FP3A 2E19A 3NVCA 4ABZA 2VUAA 2M5WA 2A3WA 2IP2A 2H94A 1JE8A 3LFMA 2FMDA 2VXJA 1SLBA 2FCUA 1UAIA 1OKOA 4K8FA 1QU0A 1IGOA 1NG6A 5IT9K 1X8EA 2QTWB 3QRFF 4N53C 4U36A 5CKTA 2IA1A 4ZHNA 4YW4A 2FDIA 4LG0B 1VZ0A 4FPOB 4PJJA 4KBBA 5EFUA 3VYRB 3RSNA 4WVWA 1AR82 1RI7A 4I7HA 1G59A 4I98B 3IKTA 1PP8F 3VYSB 1HKSA 3ZN6A 1PIV2 1AA7A 4XLAA 1HXDA 2WDBA 4DQAA 1A34A 2VE9A 1B4AA 3LIGA 1HN1A 1J58A 3A01A 2CWSA 1W04A 2ID6A 4A0XA 1QJU3 2X53S 2CUZA 1A8MA 2ZMLA 3WTUC 3GTGJ 3V0AA 2DTRA 5T5PA 5IK7A 3LGRA 4N53B 5FMBA 3AP6A 3ZIWA 3HOZJ 2D5VA 1A78A 4AW7A 3GFJA 2V9KA 3I59B 5FLJA 5H9PA 3DGTA 1BZWA 4A3EJ 2VBBA 3A0NA 5FO5A 1KA8A 3VDCA 2R061 1JYCA 2KMUA 2D43A 1GKBA 3CTAA 5KK1A 1IOAA 3LWCA 1OF3A 2ZNYA 3Q8AA 2DFCA 4MGYE 4ISQA 4P08A 1KZHA 1MBFA 1U5TC 4RB3C 5TJJA 5C3SA 1JKRC 2VZ3A 3VB2A 2ET7A 1L0OC 1KU2A 3WF0A 3DF0A 3L1PA 3FN9A 2Q8OA 4HSRA 3AG4H 1RUD3 3DPRA 2FDHA 4LNVA 3QYFA 5EZWA 2HEWF 2VL4A 3QU3A 3GXUA 1REPC 2VJXA 4M9SA 4PCQA 1W8FA 2PAMA 1IPSA 1BBYA 2OF7A 3FKJA 3WGIA 3OOXA 4UWDA 2ZXIA 1DDLA 4XOTA 5FZLA 4KYWA 5HLGA 2J42A 3ZMSA 3BCBA 2Y31A 4DIQA 2DF7A 5IVFA 1YXWA 2JDKA 1JBCA 4CP9A 3CF2A 4P9YA 1UPIA 2V5YA 1U5TB 2PHXA 1WJDA 3TN91 4M0NA 4NQWA 3LEIA 5DN2A 2C9AA 4IE5A 2PLYA 2GOMA 3ON7A 4A3DJ 3POIA 2C26A 4Q0QA 5ABJC 4W97A 3K10A 3KHCA 1MS0A 1JUSA 5E8GA 1DQ2A 3BOQA 2WWSA 5ERLA 2K86A 3W2VA 1X9PA 2EFQA 4A3IJ 3DXUA 1R1VA 4HBNA 2VZPA 2MH9A 2RN7A 3V4GA 2WNUC 1PHMA 3BTCA 1Z3XA 2IXJA 1ZNPA 3FUQA 4HSJA 1ZELA 4LIUA 2A6WA 3IC7A 3CL1A 2X6XA 1XYPA 3ZGKA 4CCLA 5DD4A 1N47A 3WTSC 4PJNA 1XSXA 1RUC2 1OI6A 5ABJB 3DWLE 4JDNA 1QJX2 1ZRRA 4ZH4F 4IHXA 5M5XJ 3KT4A 4OI1A 3GZ5A 3V65A 5GPAA 1GWKA 2UY8A 5E3NA 5E1ZB 4WZCA 2PMZA 5G05L 3T0BA 4UW3A 2MPFA 5CG9A 3ABLH 1UYYA 5B1BH 2Y34A 2NMOA 4Y1UA 3W2AA 4AHXA 2VASA 2WNUB 3M8JA 1F9KA 4NIGA 2KR2A 1LHOA 4CCOA 5BOXA 3U37A 3UESA 4N43C 2I45A 1U5XA 1S0JA 4DNYA 2GWRA 1RUF3 2JB4A 3A22A 1UF2C 3V7CA 1JYTA 4AL9A 2L7MP 3AZXA 1QJU1 1REEA 3HPNA 3H92A 3JTGA 4EGYA 4XUOA 1MW7A 3VSKA 3MAJA 3WTYC 4RL7A 2LG4A 3AFHA 4PIYA 1ZKGA 2EZIA 4IETA 2B9UA 4B7KA 4MLOA 2JT1A 4HQEA 1HQLA 3VBUA 1FC3A 2MC3A 1DGWY 3AAFA 1LFBA 3MW3A 2VZSA 1Q43A 2W39A 3ZM8A 3OUHA 3I58A 2EV5A 4XF1A 2GZWA 3CJIA 3HRUA 1IG0A 2KJBA 3OYIA 5FKKA 1V6OA 5ILVA 3O1UA 3K69A 1QNWA 2B42B 4N43B 3OD4A 1JHHA 3DTIA 2D6MA 4YZ2A 5GKAC 4YFNF 2HWC3 4FX4A 1FPQA 4G6QA 2CAUA 5TRDA 1MD0A 3IMMA 4COVA 3VBFA 3S3NA 4W1UA 1U78A 2R7FA 3ZXAC 2W1WA 5JVTA 1KFXL 4YNIA 3K4KA 2XLGA 1RHI3 3RFRA 1RUD1 3PNVA 4JHTA 5A3NA 1H88C 3U14A 1ZYBA 4YW5A 4Q2FA 2K9ZA 3WOGA 4GWIA 4BQXA 2A3YA 4D5CA 1BLZA 3JAMK 4Q26A 1ZZ8A 1UKRA 1K6OA 2FNPA 5IVYA 3L7WA 3ZPYA 1MBGA 1RITA 3CJQB 3ZN0A 5JVGF 3WTVC 5KXDA 3BPZA 2A75A 5IVBA 5I0UA 1SLLA 5J40A 3OYEA 3BY6A 2ZEXA 3R05A 2CU5A 5CZKA 3KT1A 4BQOA 1TQ5A 4AI8A 2OT7A 2BOLA 2ZA9A 1FYKA 1W36C 2GP5A 3GGLA 3KF5A 4IE6A 5AONA 2VE8A 2AGSA 2ZX0A 4K40A 1V5FA 2F4OB 3IRRA 3KZZA 2QSFX 4XJAA 5JHUA 1JXSA 3NNLA 1KD7A 5D8AC 3EETA 4KA4A 2Z4FA 4RB1A 5E89A 5FK7A 2Y9ZA 2XVCA 1ZH5A 5HI0A 1FMWA 1JYVA 3DKWA 3CZUA 1P6RA 3QBQA 4XCBA 2VBWA 2A3SA 3G1MA 3POJA 1ETWA 3TB0A 1QRYA 1CAUB 2K2SA 4N53A 2CGOA 4CXXA 4Q4X3 4ZYHA 3RZDJ 5FY0A 3ELKA 3H1MA 3DXTA 4OQ8A 1IQDC 5IJRA 2PQSA 1VI0A 2ZX2A 1QJY2 2H0VA 1JHFA 1YI2I 4E4DX 4N9HA 1ZK8A 1FEXA 2LKPA 2X85A 5K0UA 3MICA 3CO7C 5IVEA 5DM7F 1SAXA 5D8AB 1A36A 2QFEA 2FA5A 3VUOA 1RJ7A 5F5AA 4GKXA 5FFOC 4MV2A 2XC7A 1R5GA 3A7QA 3HQUA 1W6QB 4QTRA 4XUTA 1RUF1 1VQKI 3S17J 2VH9A 2V72A 3WW4A 1NG7A 2W94A 5BNPC 4C9YA 3A2KA 1ZG1A 4W6WA 4HYEA 3O7OA 4PIZA 2F5FA 1SPPA 3P5BA 3CCJI 5APAA 3HSFA 1O3QA 4XMAA 1NE4A 3HJEA 2DDBA 3VZNA 1YE9A 3IRQA 1VFCA 3OS0A 5GLVA 1CZSA 3VD9A 2ZSHB 1Q3EA 2RNJA 4IEZA 1BW6A 5EZGA 2ZFWA 2VUCA 2WT1A 4U2AA 1UIJA 1UFMA 2FOKA 1T98A 4B48A 3M3OA 3HHGA 4LK7A 2O5RA 1KITA 3O0VA 1EJ9A 2Q5TA 2GIVA 1J84A 5EQUA 4XBFA 5GLUA 2QVOA 2LROA 4M6VA 4BBRJ 4D7SA 2OQGA 2HWC1 2CFOA 2HWF3 1U12A 5ERIA 2KRFA 5BNPB 1U0JA 3FZVA 2O6GE 3C7OA 1OKQA 2VZRA 2C6SA 1MBHA 4YLZA 4G6TB 4G9YA 2BPA2 4NR1A 2WAQA 3NV3A 4M3DA 4NAOA 2X6YA 3LQCA 2M87A 4Q29A 3INAA 4MO3M 2EINH 4YG6A 3PQJA 1NHAA 3R4DB 1UPSA 3LQQA 1POV0 3SISA 4ES9A 2XSJC 3A0HC 1KQ8A 4BJ6C 2Q1FA 3JR9A 2QYOA 3H8UA 5J1YA 4CCJA 3KZYA 1VBE2 4UY8I 3OL3A 4M3BA 4AUXA 4JGYC 1ZZ6A 1HW5A 3OBZA 5FY9A 1FMD1 1WBLA 2C24A 2K4JA 1BW5A 3KV4A 4UVAA 4LO4B 2M8GX 4E4ZA 3HSRA 5AC92 3P9CA 5FV3A 4X1EA 4K6BA 3RVHA 5C3OA 2E1NA 4WM8C 4EMSA 2Z5WA 4FO9A 3RNSA 1CX4A 3BIEA 3HWJA 1E3PA 4YM2A 2M45A 2XLFA 2YBPA 2HDCA 1LESA 3OGRA 5SV8A 3GYHX 5A32B 1IXSB 3DU5A 4Y4RA 2MNGA 1KU7A 4MGZE 3OF1A 3WG2A 3CLPA 4KICA 5H9QA 4GD4A 2OVUA 5FD6A 1RUG3 2LREA 1PUFB 4JGYB 3M3CA 1BJAA 1STZA 1XYOA 3FMQA 4A3BJ