1CGPA

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a CAP-DNA complex: the DNA is bent by 90 degrees.
pubmed rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*A
total genus 59
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cgpA01
2GA1A 3MWMA 4Q4ZF 3N97A 3FXQA 4ON0A 5KHKA 1XGMA 3KZYA 2BNOA 2AXLA 3ETQA 1IXRC 3MZHA 4IESA 2D1HA 4M9ZA 4H0EA 4O6JA 2K9ZA 2XAHA 3P9IA 3T5XA 3S2WA 5D8KB 3FWEA 4LTAA 3TKYA 1GQHA 3SMHA 1G6NA 3O2PE 1U5TA 2Q2EA 1UCRA 2RV8A 1OYYA 3F8CA 3FJSA 1J0RA 4WCGA 3EO6A 4B29A 3DXJF 2IA1A 1UCXA 2GC2A 2V1UA 2JTVA 5CVIA 5FLHA 4X6QB 2Q4SA 3M8FA 2KJBA 2XROA 1LEBA 1KU3A 2DU9A 4U0YA 1BBYA 4XF1A 4B8XA 1RZ4A 1RGSA 1O3QA 5F6FA 4HX7A 5J8CA 4ENKA 3D5LA 2XRNA 2XKPA 4K2EA 4P55A 5JSOA 2E7XA 2IA2A 3HSRA 1R22A 3F23A 1ZLKA 3H9AA 2O6GE 2HJIA 1STZA 1H9TA 3RIRA 4IJAA 3GFMA 4L0YB 2EFPA 5JI6A 3H1WA 1Z6TA 2GXBA 5J7MA 2DBBA 2OYZA 2M87A 5HDNA 4L11A 1SFEA 2OZJA 2OZ6A 3EUHA 2PEXA 2JT1A 2H6BA 5ILUA 2ZNYA 5C6CA 4HOBA 3TOAA 5HVQC 1XN7A 2UY8A 2QVOA 3CJNA 4Q0UA 3KP2A 2XAGA 5LEJA 3EYYA 1IRFA 3I53A 3TO7A 2GA2A 2XUBA 4NB5A 2ISYA 3HT1A 2AS5F 4NVPA 4XF0A 1O5LA 1IXCA 2GH2A 1B59A 4IF4A 4R52A 2H27A 4HSJA 4BHCA 5F1RA 2EA2A 2EFNA 2VQAA 3R60A 5L3BA 3GLXA 1SEFA 2IW5A 1YUDA 4QM9A 4KYWA 5E17F 3RKXA 5LHHA 3JTGA 4IEWA 1OYWA 3FMQA 2BEOA 5LRRA 1DPRA 1REPC 3GZ5A 4HMZA 4UVCA 2WTEA 2ISZA 4EJWA 2ACJA 1J3PA 1J59A 2ZCWA 1C0WA 3QU3A 4KICA 2O1QA 3IHUA 3J81Z 2IT0A 1YO5C 2MBFA 2M30A 3NRVA 4MTEA 4O9EA 4R1HA 2FBHA 5ILSA 2GC3A 3H92A 3VFZA 4OIPF 3JAMK 1YLLA 3E3VA 5JHUA 4Q29A 3SHFA 2QBYB 1JXSA 4JBAA 4D7TA 2RVCA 1DPUA 2VE9A 4UVBA 1BIAA 4GO1A 2DCTA 1DZRA 1Y9QA 4PIZA 4O9GA 4O5VA 1P4WA 3ES1A 1TNTA 4RAYA 2GU9A 5KBFA 1Z1DA 4P96A 3SCHA 2R7DA 4IEUA 3RYRA 2ETHA 2A07F 3HOSA 2FU4A 2M1BA 1RUOA 3EDPA 5FD6A 4RGSA 2D5FA 2BYVE 2F5FA 2V79A 2K4BA 1AOYA 1KGSA 3W6JB 2ZFWA 5E1ZB 1BI3A 4I0BA 3K69A 4TLFA 3WG9A 1WGPA 5LRSA 5FPZA 2UYAA 4LGWA 2MH9A 4MUVA 1JHHA 1HQCA 4XFGA 4ZU7A 2PJPA 5L3GA 4ETSA 1HW2A 2A69F 5I0SA 1NE6A 1O4TA 4Z82A 4KL1A 3LWCA 1CAWA 4OMZA 2TDXA 2IXLA 5CVRA 2CG4A 1UD1A 3F72A 3IBMA 2IP2A 4LB6B 2CAUA 4EM0B 4Y13A 2XLGA 2KIFA 3COAC 3D0SA 3MEXA 3R0AA 3RPUA 1GVJA 2RNJA 1IN6A 4EQQA 4XEZA 3HRTA 3C3WA 3BPVA 3TQNA 3HRUA 5I8TA 2K02A 1SD6A 4ONUA 1YFYA 4PGHA 2V09A 3L7WA 1GHCA 2D2WA 4HQMA 2N7GA 4I09A 5A2QK 4N0BA 3Q9SA 1IW7F 2JPCA 5HS7A 2A6EF 4PZJA 3ZPLA 5TJJA 3WTUC 1Q1HA 3SZPA 1PUEE 1BIBA 4HLYA 1T0FA 3P9CA 2XAQA 1ZNPA 5EEHA 4ESBA 1HBXG 3NW4A 4MTDA 4EVIA 2W57A 1ZHFA 3ULQB 1Z9CA 4MGZE 4KIFA 1P4AA 4Q0VA 2PFBA 3JZVA 5JR7B 3ZP5A 2YX7A 3KEOA 3K1NA 1IXSB 3I64A 2ESNA 1UIKA 4GULA 1W7PA 2XAJA 1VP6A 1FY7A 4HBLA 2H6CA 3DP7A 4YARA 1X3UA 3OCPA 3TOBA 4ZH4F 2RGVA 4XFCA 1BI1A 2P5KA 3OV8A 1S6LA 1B9NA 4KMUX 3BROA 1HW1A 2COMA 1LDKB 4QGNA 1YW9A 3WGGA 3I7DA 4UBGA 1FBUA 5I91A 4MQ9F 4I3PA 3K1MA 4IRIA 2JRTA 4XF4A 5KVRA 1ZZCA 2PQ8A 3E6CC 1XRUA 2KJCA 4MX3A 3EHKA 1NHAA 2J5OA 1NXMA 4A5MA 2PQQA 1JE8A 4I2OA 4A0YA 3KGLA 4KIBA 4JTNA 3O14A 3U10A 1S8NA 2L01A 5FGMA 5BV6A 4BAYA 5KHJA 2CAVA 2FSWA 4MGRA 1WLTA 2UZKA 2EA7A 1FZPB 4HA8A 1CAVA 1RIOH 4Q0QA 1CGPA 3FM3A 2ESHA 3F22A 4TV7A 3E5XA 1OD5A 4OU0A 4MZUA 1MZBA 4IRGA 3K0LA 2XAFA 2MPFA 1PDNC 2O3FA 4A0XA 3BPZA 2Q8KA 3KSCA 4YRDA 4IETA 2VE8A 4LG0B 4P5OA 1IAWA 2V9VA 2FEZA 2VBXA 2D5HA 3F8BA 3GVAA 5CYVA 3ERED 2PMUA 4Z07A 3EBRA 3K9TA 1H0MA 5HLIA 5DUKA 2PAEA 3HIFA 2HEOA 3CLPA 4UHTA 4JK1X 1FI2A 3E6MA 1MD0A 4K8FA 4KFCA 3V4GA 3REOA 2O61A 5BS6A 3TO9A 2F2EA 4WBBA 1LQ1A 1XD7A 3DQVC 3UKVA 3HRSA 3U0ZA 1EV7A 1W4MA 3J80Z 4CO8A 5D5WB 1KYZA 3OGJA 4CYDA 4MGIE 2LSOA 3ROUA 4L5JA 4CDGA 1UIJA 3IDCB 3GXOA 1FSHA 3RDIA 3ML6A 1YYVA 2RC4A 4WWCA 1CAUB 1RI7A 1K78A 2W25A 3LAGA 2K7LA 4A12A 4QGLA 2EFOA 3E5QA 3N4MA 1IZ1A 2R7FA 4EV0A 4MV2A 5D4RA 4RGUA 5FQ0B 5ICFA 3H1MA 4NQWA 2M8EA 4BYYA 2GIVA 3CO6C 1ZLJA 4Q5SF 5FB2A 1LJ9A 3OF1A 4DQ2A 3HOTA 1XGSA 4QGMA 3IIAA 1FOKA 2PFWA 4BHBA 2ETEA 3F6VA 2KRFA 4RB2C 5TRDA 1CF7B 1IRGA 3I59B 3CF6E 2YSRA 5AIQA 4A0ZA 4PIYA 3HHHA 5KK1A 5CVJA 2ZXJA 5L3DA 3RJPA 1R1UA 3J7AO 1O5UA 3USSA 2Y75A 1CAXA 3IKVA 2ET1A 4XETA 2CSOA 4YIIA 1R00A 1VR3A 3JAMZ 2ZO4A 2PLYA 5BOXA 4DINB 1ZVFA 1S7OA 4GXOA 3H8UA 4N9IA 4L5IA 2PTMA 2G7HA 1J5YA 1ZGJA 3NKTA 1Z6RA 4EGZA 5D6FA 2XV4S 5CVVA 4RB1A 1T39A 3WW4A 4ENNA 3BDDA 2MHFA 4LMYA 1JGSA 3JSPA 4QX5A 4MHGA 3NJZA 2V1XA 1CAVB 5LGTA 2NAZA 4IERA 2VODA 3ZN0A 4Z2YA 1L0OC 3HUGA 4XSXF 3ZMDA 4LUMA 4YG2F 2P5LC 5BY5A 5E20A 4JQFA 3M3IA 1TBXA 4KU8A 3J81K 2DI3A 4LG0A 4KU7A 1ZZ7A 5I8SA 3VOEA 2HYFA 2QCSB 4JTOA 1USTA 2Z5UA 2CV6A 3ELNA 3OD0A 4MNUA 3LZZA 4YFXF 2L4MA 1TQPA 4IXAA 3HRMA 5HI0A 4XSZF 1H1MA 2P5VA 2K0GA 1BC8C 4HDVA 2GQQA 4OIRF 4FX4A 1Z05A 3QRFF 1WSUA 3M8EA 3S7EA 3GUDA 3BJOA 3CUQC 2GXGA 3MZYA 3CEWA 2HKXA 1BM9A 5F64A 2K86A 5DD4A 5IT3A 4IEXA 2OPKA 4D7SA 3WTTC 4KA4A 2VN2A 2XLAA 5L3CA 1X7NA 1MGTA 5J6XA 2PG4A 2W85A 4M9XA 2UWMA 5I93A 2LKPA 4KN4X 4XFHA 3QP5A 4HF0A 1TW2A 1HSJA 5J3UA 3O6BB 3UKNA 1I6XA 1QGPA 2A3SA 1KU9A 2V6CA 2EK5A 4L9TA 1FT9A 2XVCA 1O57A 2K27A 3I54A 5DV5A 4LB5A 3EETA 3F21A 1ZRFA 2VOOA 2PHDA 1O3SA 2IA0A 1FBQA 2DQLA 4E2QA 3T1BA 4LLLA 2ZKLA 1ZZ6A 1I1SA 3JTHA 1OPCA 4M6YA 1G3YA 2CW0F 2EAAA 4AD9A 4HX4A 3KLNA 1FYLA 1E2XA 3I0TA 4LD5A 1J3QA 2PMHA 3OTFA 2PHLA 1FWZA 4XFAA 1ZRDA 3GFIA 5IT9K 5I0UA 1BN5A 2UXXA 1ZX5A 1IN4A 3DF8A 1SMYF 1SD5A 1FNNA 1XB4A 3C1DA 3JSOA 4FX0A 2DFIA 2NS0A 3C18A 1ZGAA 3IL2A 2Z9OA 5HS8A 1FSEA 4FHTA 1NYWA 2NYXA 4IEOA 2QM3A 2FQ3A 3BZ6A 3I58A 3P9KA 4QWQA 2M5WA 4J1WA 4GYIA 2HQRA 1O7FA 3RI4A 2D45A 1OKRA 4FAGA 1HW5A 3QOPA 4M71A 3QP6A 2B9UA 1QY4A 2YPRA 4UBHA 1VJ2A 3R61A 2E1NA 3FX3A 3H3ZA 3BJ6A 4Y15A 3WTZA 1ZZ8A 2HTSA 5HLGA 1EH8A 1G3WA 2H09A 2HOEA 2MD5A 3LOIA 2QJVA 2P6SA 5K5QA 1GXPA 3IC7A 3RKYA 2A68F 1CAXB 3ZMSA 4WK8F 2G9WA 4L2NA 4EM1A 2QLZA 4NHJA 1EPZA 3WW3A 4RB3C 1PP7U 3I71A 1LVAA 4OFGA 4EWDA 3L2HA 1A04A 5FLIA 1XCBA 1QXJA 2NRAC 6PAXA 3CO7C 1DGWA 2MLKA 2GC0A 2QNKA 5JR3A 5I0TA 2QQAA 2VONA 3DFGA 5E1RA 4MQVA 3GBFA 5FFZA 5E8IA 1XDUA 3PLQA 2PBIA 1UW8A 2X0LA 5BMZA 4GGGA 3EYIA 4M6XA 3B73A 2WV0A 3E6DA 2OZUA 4HBNA 4KWJA 1S3JA 3WTYC 4PIXA 4FT8A 3WTVC 1ZZBA 2MA3A 2HDCA 3CUOA 4EJUA 4ZU5A 2CO5A 4LA3A 4ENJA 5BXXA 3BOQA 3LA2A 2A5YB 3R6SA 2ZKZA 2PAKA 3R0JA 3PQKA 3HT2A 2OQGA 2EFWA 1IN7A 3K2ZA 1ONVA 4AXOA 2W24A 3FHZA 1ZG3A 3QU6A 3KP7A 3GFJA 3CJXA 1HKQA 2E9QA 2F5EA 2P17A 3SCFA 5CVUA 1G4DA 2DW4A 1YIOA 2XIGA 1X8MA 4UV9A 2LDUA 2Y48A 4Y17A 2HS5A 5I0RA 3KP5A 3V8KA 1I1GA 4EJTA 1X8EA 5BUVA 2CQKA 1KYWA 2IXIA 3ZMTA 1T2KA 3LA7A 5H6RA 4ZZDA 2B0LA 3IWZA 4AIJA 3ZDSA 4M9SA 3BJAA 4EROA 3JW4A 2YU3A 3FF5A 4CHUA 4OINF 3J80K 3RTRA 1D8JA 1CAUA 1YW8A 2QENA 4KT5C 5DD8A 1MKMA 4PCQA 2EV6A 4CICA 3LA3A 1WWXA 3SQNA 2PI0A 1LRHA 2HWVA 3GZ6A 3ZMZA 2F4PA 5I8YA 3E5UA 3H7JA 4L18B 5AIPA 4IEYA 2Y0MA 2FBIA 4U88A 2G7UA 1Z7UA 3SXYA 4Q0PA 1Y3TA 1FLIA 4KDPA 1J2XA 1T6SA 2HKOA 3D82A 1HXDA 5ICGA 4N9HA 3CTAA 4RGXA 3IWFA 3L9FA 1BC7C 3EQEA 1QPMA 3H1YA 4ZU4A 1XE8A 4S05A 4JVAA 1ZG5A 4KWKA 4IEVA 1ZN2A 2XASA 3GO5A 2FNPA 3DV8A 2ZJ2A 1IPJA 5K5OA 1LNWA 4CXFA 2EA4A 1J7KA 3GYDA 4AVCA 4G6QA 5K5RA 2FRHA 2LF8A 1UPIA 3TNQA 1XGOA 1EH7A 1FP1D 2QQ9A 1LB2A 2WWYA 5FCCA 3LAJA 3NEUA 4HVQA 4PGGA 3T8TA 5D6EA 4DNCA 4O3MA 3MYXA 3SCGA 4XBFA 3BWGA 3D0JA 1OI6A 1ZG1A 3BALA 4LA2A 3GEZA 3GYHX 4HQEA 1QZZA 5FO5A 3U2RA 1FC3A 1U3EM 4QXKA 3MAJA 1Y0UA 3FMRA 2IJLA 4BHPA 3MDPA 3W6KB 1V70A 3PNAA 3KETA 3U9GA 1EY2A 2FMLA 5D5UB 4ORFA 1U2WA 3TO6A 2PA7A 5CLSA 3RYKA 5D4SA 1JUHA 1U5TC 3F8NA 1U12A 1EP0A 4EWAA 3ABTA 2Y0OA 1T98A 3PVBB 2VPVA 1K7AA 4U0WA 5BPIA 1R23A 5AVPA 4L9VA 2GAUA 2UYBA 1UHMA 1UHWA 2E1CA 3F8FA 3HTUA 4ZYHA 4WXCA 3CDHA 4R79A 2YR2A 3C3VA 2D93A 2XL9A 3CUQA 4LK0F 2FQPA 1DUXC 3IDBB 2OU2A 5H6QA 1T38A 5JAXA 5DYMA 2VXZA 5HS9A 2FXAA 2YX4A 3S0MA 1XMAA 1R1VA 3ELKA 2QBYA 1MDMB 2EJRA 3WU0A 4WVZA 3DPLC 4WX9A 4LLNA 1TTYA 4YFNF 4M73A 2FNAA 3BPXA 5A2QZ 2HGCA 1PM7A 3KP3A 3MCZA 4AIKA 1P2FA 1WI9A 1YFWA 4PJYA 2F5CA 2OBPA 4U7DA 5LLQA 3WTXC 1K78B 2JPBA 2KIUA 3CL1A 4OMYA 1RNLA 3I59A 1SFNA 1WA4A 3WU1B 2J5PA 2ZBKA 4E2GA 1R5HA 4J1XA 2BV6A 1USSA 1YFXA 4A5NA 4IPAA 4Q47A 1JHFA 3RYPA 1QNTA 1O3RA 1U8RA 3WE2A 1CAWB 1YQAA 5D5VB 1ZH5A 5CADA 3BU7A 2STWA 1FP2A 1DGRA 1YG2A 4IEPA 3SHRA 2PN6A 1QWRA 1F5TA 4S04A 4RD7A 3L09A 3WGIA 4ZYGA 2PYTA 1U78A 2LF7A 4GCVA 3DN7A 4EJOA 3FFQA 3BP8A 1R36A 2QZ8A 3FXRA 2VOPA 4KIGA 2QUFA 2VBYA 4LLGF 4U7BA 3G3ZA 1FYKA 2A6HF 5ERIA 2IXJA 2VBZA 4HV6A 1W5SA 2EWNA 5LHGA 4LJZF 4HLXA 1L3JA 4G9YA 1IF1A 3ACLA 3NVCA 2IRFG 4YYOA 1LDJA 2C6YA 5EEGA 4L9JA 1ZYRF 4LULA 3RPQA 2BE5F 1SFXA 1TQIA 1ULYA 1YTYA 4UXNA 3TNPB 3LFKA 3VEPA 1QQIA 1P4XA 4B09A 1LKNA 4HYEA 2Z3YA 3SFZA 4Q48A 4KWLA 3FXUA 4U0VA 3DKWA 4RS8A 1ZRRA 4G7HF 2P7VB 1J58A 2Q1ZB 2BGCA 4A6DA 2R3SA 1R1TA 2EV0A 3TDZC 1U6GA 3KEQA 3BB6A 5FDBA 2MH2A 4A2UA 5FQ0A 1R5GA 1XE7A 1B9MA 3GX4X 1B1BA 4G6DA 3KGZA 4LFUA 4BQAA 5E1WA 3G7DA 4YNIA 2O8XA 1ON2A 5H20A 3OOPA 4XLNF 1UB9A 1BI0A 3IRQA 3FHIB 1IUYA 2RN7A 5FLXK 1LEAA 1UFMA 3KP4A 3SZTA 1H1IA 2IXCA 5KHIA 3B02A 1U5TB 5HLHA 1F1ZA 2Q0OA 3CUQB 5BPXA 2V1DA 3MQ0A 5DCFA 3V8LA 1FX7A 2KIMA 4P9GA 4BIFA 4PDKA 1QO0D 2OAZA 4AWXB 3FE5A 1OFNA 5JFRA 3T0YA 4MGYE 4RB0A 4KN7X 3PQJA 4FBFA 5FLXZ 3KFWX 3TGNA 1MJ9A 3LQQA 1V4RA 1Q3EA 1G3SA 5ICEA 2DO7A 5C8WA 4IHSA 4G8XA 5E18F 1E17A 3AAFA 3BY6A 2IXHA 2FBKA 1D5VA 1WQ2A 3L00A 4XF3A 2O8QA 4WZCA 2E7WA 2JZYA 2KXLA 1V3FA 4QM8A 4MH0E 1OMIA 3QPTA 1S29A 2F5DA 1OR7A 2VC0A 3NQOA 3F6OA 2VECA 1K79A 1KQ0A 1ODDA 4EWEA 3WW2A 1VTNC 3E6BA 3MPBA 3FM5A 3KMHA 2DK5A 4R8HA 2OQRA 4QMAA 3O3KA 1KU7A 1KQ8A 1B6AA 3WW1A 1YS6A 4GYGA 1I27A 4WF2A 4I98B 3F8MA 5BPDA 3V8JA 4I0AA 3LAPA 4Q0SA 1ZARA 2H0VA 4I01A 2KKOA 2OD5A 1XGNA 2A61A 2Z2SB 1XSDA 3ECHA 1DP7P 4WXDA 4ENMA 2NNYA 2FOKA 3RZZA 2Z99A 5DCMA 3Q5FA 5AONA 3L2CA 2P8TA 3H50A 1EYBA 2GWRA 4UVAA 4IEQA 2GZWA 2WC2A 1NZCA 4OOIA 1TLHB 5EZWA 5J8FA 5LEKA 5E1XA 4LLOA 5EFUA 4UXAA 5CU1A 1QXRA 1Q5OA 4MEXF 3H7YA 4JV4A 3ZMUA 4AVAA 4CZZA 2Q30A 1J9IA 4UNOA 1EH6A 3LSTA 2OA2A 1ZRCA 1MJAA 2QDRA 3GFLA 1FYMA 2ZNZA 3WE3A 1IN8A 2DTRA 4OIQF 4UV8A 1WRJA 4BNCA 1GQGA 1OYIA 1KA8A 1D3YA 1W7PB 2IVMA 4YIFA 4WXHA 3FZVA 1P6RA 1XDSA 5DDGA 4L0ZB 5DEQA 1D8KA 1Q43A 4ESFA 4EGYA 2IC1A 5D1IA 3S7IA 2DPDA 1DZTA 3ST7A 3ES4A 2L3DA 3QAHA 2Q0AA 4CGZA 5HDKA 4OLLA 4HW0A 2VT3A 2QYOA 5K8SA 3KZZA 5DCMB 1DDNA 1YFUA 3PFIA 5LGUA 1F4KA 1RUNA 1Z91A 1SFUA 2CWEA 3G73A 4AQ6A 2M45A 3VODA 4ZZLA 3TDUC 1IN5A 3DPTA 2JSCA 2L4AA 5E16A 1WKMA 3F3XA 4MGKE 2X4HA 5JSPA 2EVXA 2CYYA 4UUVA 2HFHA 1LR5A 4XFIA 4M72A 2Z33A 5E8GA 4HV5A 4HDUA 2FA5A 2QWWA 1FXZA 3ISPA 4LUKA 2ET7A 2BNNA 2H94A 4LK1F 2QVSB 2LNBA 2FF4A 4BXUA 3ABUA 1TQMA 1AWCA 4HX8A 4F8AA 1CF7A 2HTJA 2DT5A 3ZN1A 2UXNA 1I5ZA 2STTA 2DK8A 4ESJA 1R58A 1HKTA 5HOOA 1K6OA 1RL3A 2C0ZA 2VC1A 3IRRA 3EJKA 1S7AA 4HF2A 4XF9A 5ILVA 4P9FA 3VB2A 2DQRA 1SQ4A 3ECOA 2D40A 1MJBA 3M70A 1O7LA 4ASNA 1YFHA 1LDDA 1L3LA 1YW7A 5BQTA 2WFPA 4HLTA 3K1PA 4X6RB 3M7GA 3C7JA 4HAMA 3QACA 1P92A 1G3TA 1RTVA 2RKHA 1GXQA 3M1EA 3FMSA 4YFKF 4P9UA 3M9AA 2PAMA 4BH9A 5D8LB 1J3RA 1SD7A 1TW3A 4RAZA 4META 2BBYA 3I4PA 4XFBA 1QZYA 1W7PD 4H7LA 3T8RA 3I5UA 2B8MA 1SD4A 3NSTA 3KLOA 3LWFA 2BNMA 2ZMEA 1HKSA 4G7OF 2HQNA 3HYIA 4IVNA 3ZMVA 1YWKA 2DAOA 2P7CB 5LBQA 3V7CA 4IHTA 4HF1A 4I7HA 5FPXA 2MLGA 3DEUA 3EQLF 4MEYF 5HDGA 2B5HA 2QQBA 2HZTA 1KU2A 3V7SA 4AIHA 1J75A 3KP6A 5ICCA 1YS7A 5FFXA 3HQXA 1FBSA 2EFQA 3U1DA 2MC3A 2XL7A 3CO2A 3VHRA 4G7ZF 4I02A 1YLFA 2W84A 1ZZ9A 4KMFA 1ON1A 4ZYEA 2VBWA 1TNSA 4YSFA 4XLPF 4HVOA 2ATFA 1HSTA 2O0YA 2XGXA 1R7JA 4HVRA 3KCCA 1B4AA 4EM2A 2I45A 4L9NA 1MDMA 4KNYA 4HSLA 2L02A 2O03A 4HN0A 1FPQA 1ZAOA 2EB7A 3UKTA 2UY9A 3QPHA 1TQ5A 3CLOA 3H3UA 1W5TA 1SAXA 1PMIA 3HHGA 2FE3A 3HTSB 1RC6A 3V7RA 4XFFA 2EV5A 4KUMA 3MFKA 1F9NA 3WGHA 3LQRA 2CGPA 4HN1A 2D1VA 2ADUA 4EJVA 1SMTA 5L3FA 2ZMEB 2DPUA 1NE4A 5DUIA 3BCWA 3FZ3A 1X82A 3GF2A 5LHIA 1H9GA 1ZREA 3P7NA 4E2SA 4IEZA 5T3NA 5IT9Z 2K4JA 3HSEA 2HYGD 4G94A 4AVBA 2MNGA 2RQPA 5JCTA 2DLLA 4AVPA 1J1LA 2IXKA 4HZFA 4QLCU 2XLFA 5L3EA 3ZQ7A 5CJ9A 5KHHA 4E70A 2VT2A 2FMYA 2L54A 2NNNA 2XHKA 3Q9VA 3GW2A 4EMSA 3E97A 4M74A 3RNSA 2HR3A 1KQ9A 2IPQX 2Z69A 1O3TA 4LEJA 2GC1A 5FD5A 3WTSC 5JSRA 5KHGA 1QBJA 3R4KA 4IRHA 3U11A 5ED4A 5J48A 4OIOF 2P6TA 4A6EA 3WTWC 4F7ZA 3IKTA 2OA4A 5D5XB 2XKOA 1XSXA 1YHFA 4RGRA 3HSFA 5JVTA 1CX4A 1PP8F 1XCVA 3SXWA 5K1YA 3RKWA 2RDPA 3GWZA 4AQ2A 4FAHA 4XRFA 3DL3A 3NL1A 5LGNA 3KE2A 3WODF 1IPKA 1BOAA 1XSVA 1XMKA 4ZYDA 2ELHA 4D0PA 1BI2A 2P4WA 5FLJA 1BJAA 2CFXA
chains in the Genus database with same CATH superfamily
4XBQA 1U5YA 3GJBA 3FXQA 1ZM1A 5KHKA 5EJ3A 3ETQA 3K70D 2D1HA 3WY6A 1LGCA 1MBJA 2K9ZA 4PLOA 4BMEA 5D8KB 4NPRA 3FWEA 1GQHA 3DWLE 4DUWA 5LY1A 2PMZN 3VDXA 1UXXX 1AUYA 1W8TA 4IQPA 1OYYA 1N78A 1QMJA 1RUI2 2BUKA 3VDDC 2NZ9A 2JA7J 4QPIA 5EIYB 5C5TA 4B29A 2IA1A 2GC2A 2JTVA 5CVIA 1NCRC 2P3KA 4X6QB 5FLHA 3KWVA 5L9RA 4DXZA 5FXXA 2HI3A 4C3HJ 2BVVA 3PUSA 5EJCA 2WKKA 4P9JA 2W1QA 1RVF2 2E31A 1W06A 1KU3A 4B8XA 5M3MJ 5FK7A 4K6BA 5GPCA 2DBIA 1EV11 4ENKA 1X19A 2CUEA 2BOJA 3RZKA 2LG4A 1DU3D 4B47A 3ZYGA 5JSOA 2E7XA 4QPYA 2LK2A 1WLCA 2IA2A 4Y1XA 3WD5A 1F36A 2RJ2A 1LNSA 1ZLKA 3IAQA 4I99C 2ELJA 3H9AA 2VQHA 3VBFC 2O6GE 2HJIA 2VCMA 5FYTA 4FXGB 4IJAA 3H9JA 3GFMA 1CONA 1W9FA 3HNBM 4XKVA 1GUIA 2P3YA 3WG4A 1Z6TA 2HWE3 2Y6JA 2XJUA 5J7MA 5FZ6A 3WNNA 1WBFA 2M87A 4AFAA 2O8OA 4LMFA 5DN2A 4LQRA 2OZ6A 4CTEA 1F4AA 5FP4A 2OW4A 1DGRN 2PEXA 3BCAA 2XB0X 2H6BA 2C4XA 3ZIXA 2I2SA 3HAGA 5C6CA 2ZJQF 4CP0A 3AMQA 4HOBA 5HVQC 3AG4H 2QVOA 1HLVA 4YW2A 4Q0UA 4AUXA 1IRFA 3I53A 3HOBA 3HXLA 2X29A 5F3IA 3OMYA 4Z8BA 5M0TA 5F8PA 1W6NA 4PJNA 2JG8C 2DN0A 4TXWA 4CP2A 5FUNA 4DYRA 3THDA 3NV1A 5E6HA 4C2MJ 4NVPA 5EYXA 1Q1VA 1B59A 2HOAA 2H27A 4FI9A 2Y6LA 2EFNA 3ZO0B 5L3BA 2VBBA 4IE4A 1SEFA 2IW5A 3GALA 5KWRA 4DIQA 4DYQA 3FDYA 3FMQA 2BEOA 1REPC 5JLXA 3GZ5A 1KFUL 5EV7A 2ISZA 4EJWA 3RGBA 1BXHA 1GOFA 3B93A 1WJ5A 4QPIC 3KZIC 4FQGA 4RM3A 5ILSA 1NUKA 3O1VA 2X05A 1NQDA 2W5FA 3UNGC 5KCMA 2UV1A 5JHUA 3SHFA 1DPUA 2DOEA 4G4FA 4UVBA 5HCFA 3CF2A 1DZRA 3LDBA 2D3RA 4IGOA 3ES1A 3FBNB 2GU9A 1A6IA 2L9VA 5KBFA 1MBHA 3CCLI 4P96A 1FEXA 3PFYA 2XPJA 2ETHA 4NMIA 1QVUA 2G4IA 4HKLA 2M1BA 1RUOA 1DBNA 2HWC1 5FD6A 1HQWA 2BYVE 3LSRA 1COV2 1UOJA 2F5FA 3S15J 2V79A 1PK6B 3IZOA 4P08A 1CQTA 2X6WA 4RGGA 4C3JJ 4TLFA 3WG9A 5LRSA 2A3WA 5FPZA 1MMDA 4X8NA 4LGWA 2H0BA 2NMOA 3MLKA 3AJZA 4ETSA 5DG1A 1HW2A 1HC8A 3KM5A 5I0SA 4HOOA 5LBBA 4YM2A 4FTBA 3LWCA 4OMZA 1W9TA 5CVRA 2CG4A 3A0NA 1SLAA 5FP7A 3FLPA 1XXNA 3T2QA 3C2GA 1W3VA 4RLQA 3A0HC 2JG9B 3R0AA 2RNJA 5CFDB 1B35B 4AK3A 3HRTA 4A6SA 3S3MA 3FBYA 3TQNA 3TAYA 1P7IA 1SD6A 4ONUA 4L9BA 2BW3B 4NHLA 1GHCA 1HKDA 3S32A 3JBG3 4YZ3A 2N7GA 4I09A 4N0BA 1RB8G 1LOFC 5HS7A 4A3MJ 1VFCA 4LBJA 4PLMA 2JD4A 2XAQA 5EEHA 1ITYA 3IAM2 3A7QA 1CZSA 4AE2A 1Z9CA 4LK7A 1P4AA 3U21A 1Y0NA 4W50A 2QZ2A 1GVDA 4F3QA 2YX7A 3NJYA 1ORKA 2ESNA 3LSIA 3SYTA 1GKBA 4A44A 3F0CA 4GULA 5E88A 1PIV2 3OYIA 1UY3A 1TZLA 4HBLA 2O9LA 1XNDA 2HWD1 2HPMA 3LSMA 4SLIA 4ZH4F 3BR2A 4QPGA 3OV8A 2VMHA 4AVSA 4KMUX 1ULDA 5J1UA 2XGEA 2COMA 4QGNA 5DXDA 1RUG1 3JXSA 3WGGA 2ADEA 4UBGA 5F5CA 2XXZA 4XF4A 3UL2A 2WZ8A 3VZOA 3NV4A 3E6CC 3I2KA 1XRUA 5C3QA 4A41A 1NHAA 4DXTA 1NXMA 1LFUP 2GN7A 3Q8CA 1XG1A 1JE8A 1JJ6C 3TEWA 4QTRA 4JTNA 3ZIWA 4KITB 2AACA 3O14A 1J83A 2FDJA 4AW7A 4RBOA 2I5UA 2L7ZA 1WLTA 2ZGTA 3ZR8X 5ISLA 2EA7A 4QX2A 3ABKH 5F3CA 5FZDA 4Q0QA 2ESHA 2X1EA 1R091 1F43A 1LOFA 2WT0A 3DYPA 1PDNC 3K3NA 3VBOC 3JCUC 1W9WA 2LMDA 4IETA 1VBA1 4NHKA 1F31A 5FRAA 2V9VA 3I3DA 3BTLA 1AHSA 1FTTA 4Y26A 3K77A 2WB1N 2ZXQA 3OYHA 4DGWB 2PAEA 2XB5A 1FI2A 3ACIA 3AYAA 1X58A 4NBQA 5C70A 4B4PA 3REOA 4RS5B 1RVF1 5FJ8J 2DA7A 2DMPA 5GLZA 2V7FA 3P3PA 2ZGOA 2ZFUA 1EV7A 3BOWA 3J80Z 3LSHA 4CO8A 5D5WB 3OGJA 4CYDA 1L7LA 4OZXA 4L5JA 1VPHA 3IDCB 2D97A 1FSHA 3QPSA 3CP8A 3A23A 3RDIA 2CJJA 3ML6A 2RC4A 1RI7A 3V65A 2W25A 3ZQGA 4RDUA 1UELB 1OT5A 3FISA 2WAQN 4QGLA 5FZEA 2CV2A 2XC7A 4QKFA 2R0HA 2LP0A 4RGUA 2GOMA 3IDAA 4BYYA 3MKYB 3MW3A 1NCRA 5ANQA 4AYBA 2FUG2 5J36A 4KJZA 4DQ2A 3POIA 1XGSA 1FOKA 1XBFA 3T30A 1X1PA 4AFDA 4CU6A 4CDXC 5JVGF 2VO5A 1CF7B 4LK6A 4YZ1A 4AQSA 3CF6E 3I59B 3PVNA 2VVFA 5A3PA 3HHHA 2RS52 5CVJA 1E0EA 1F15A 1O5UA 2EIEA 2JK3A 3USSA 3OWTA 5CEHA 4II2A 5JPMB 1HRV1 2XRLA 4YIIA 4AWDA 4DZPA 4FOQA 2ZO4A 3NJVA 2OPTA 1D0YA 3ZOBA 2J7MA 1Z21A 5B4NA 2M4GA 4N9IA 1LFPA 4EEFG 1J5YA 1JT0A 4QHBA 4AFBA 1Z6RA 2HBUA 3PUBA 5CVVA 1T39A 3WCSA 2VJ4A 1ACIA 3D5RC 4YM0A 1GLHA 3EPZA 1GP4A 4K3UA 3I8TA 4QX5A 4MHGA 2I10A 2V1XA 4BIOA 1NLRA 2W39A 2GP5A 2WYSA 3VD7A 2DF7A 5FOBB 2ARCA 1K4TA 3LGRA 4XSXF 1H88C 2P5LC 2YPJA 2LR8A 5IYDJ 4G6TB 1E5IA 2AQEA 2B42B 3ZXFA 4KU7A 1ZZ7A 5KC6A 2HYFA 3PO3J 2QCSB 1USTA 2WSUA 4JKMA 3WNXA 1HV0A 2E1MC 1QJU1 3TRSB 3SEQA 2VOKA 4IXAA 3I2JA 4WM7B 2P5VA 1BC8C 1VIWB 4OIRF 3ZQLA 1DQ4A 5JZGB 3K4KA 3QRFF 2ZKNA 3OS0A 4D0QA 3GUDA 3VHNA 2VBDA 2K86A 4CA9A 4GZ9A 4LXLA 2JDKA 5CG8A 2Y0IA 4D7SA 3DKQA 4KA4A 5IOZA 1BBT3 5L3CA 3CZUA 2C26A 2RS31 1MGTA 5J6XA 1QJX1 3FBIB 2WABA 3PL0A 5C5UA 2UWMA 3ZGKA 4YG0A 1ULGA 1PO12 4XFHA 1F35A 2YROA 1UMHA 1TG7A 3NRUA 1S9HA 1QGPA 3ZN6B 4L9TA 1UO9A 2KIQA 1FT9A 1GFF2 1HRV2 1MQTC 3OB8A 4UWDA 1O57A 1H1AA 4B4RA 3EETA 3VYTB 1FJLA 3ZXSA 3USUB 4RM2A 3WUCA 1AYM2 1K5MC 5A1AA 1O3SA 2IA0A 1S0JA 2DQLA 4E2QA 3T1BA 1RUF1 3ORJA 3N9NA 1ZZ6A 1I1SA 3JTHA 4P9LA 1G3YA 3Q3SA 4NWWA 2BW8A 3RS6A 5JLWA 2QZ3A 2LKXA 1E2XA 3RZJA 3I0TA 2I07B 3GBGA 2PMHA 2PHLA 4RA2A 1FWZA 2XUMA 3F2ZA 4XFAA 1OQ1A 1ZRDA 2VC9A 4XQWA 4J6GA 3MIFA 1BN5A 2UXXA 1QJY3 3CQZJ 1SD5A 1HN1A 2JG8A 4XQ4A 3JSOA 2DFIA 5HNFA 3IL2A 2W7NA 1S1AA 5HS8A 1NYWA 2NYXA 1QQP3 5BNPA 1YC61 3OSGA 1FNYA 5EJ1B 3U78A 2H1LA 2EIJH 3GHNA 2Y6HA 2JUCA 1MSEC 4XMYA 2HQRA 3LSEA 1W0PA 2HZDA 3MUY1 4FAGA 1WW5A 1LKXA 1SZBA 4YVWB 2AGSA 2CL2A 2B9SA 5HV4A 3QP6A 3ATGA 4CYCB 1P8JA 2IZWA 4ASLA 2V26A 1W9YA 3DPRB 4TSVA 2B4KA 2HTSA 2CWMA 1G3WA 2BBAA 2H09A 5FZLA 1K12A 5C9AB 2R92J 3RKYA 3ZMSA 4Y4YA 4A42A 3ASNH 4EM1A 4NHMA 4LITA 2QLZA 4RR3B 2TRTA 1PP7U 1BMV1 4EWDA 3RZLA 1UU5A 1A04A 1AL23 1XCBA 1QXJA 2NRAC 4CH7A 2A6TA 6PAXA 4GKYA 1DGWA 1CJPA 2GC0A 2QNKA 2X48A 1ENSA 3SH4A 3GF6A 1B09A 3O1SA 5E1RA 5BNNB 3GBFA 1NCQB 3VYUB 5F2SA 3PLQA 1T95A 3EYIA 1RUF2 4CCCA 2V4VA 3AP7A 3E6DA 3ZSEA 4I0WB 3O0XA 4HBNA 4PIXA 1UNBA 5T5LA 1QJX3 3J9SA 5FKMA 3WTVC 2R042 1ND3C 2CO5A 4QB1A 3LQCA 4ENJA 3MF6A 4XR6A 2IVIB 2WO7A 4J01A 3R0JA 5H9QA 3HT2A 4XLAA 2EFWA 3HD8B 4LHNA 1N3PA 2W24A 1ZG3A 3TP0A 2ARXA 1N1TA 3QU6A 2F5EA 2RG4A 2P17A 5A6YA 3JRBA 3OY8B 2LDUA 5HXMA 2HS5A 2MABA 1NCRB 4EJTA 5BUVA 2CQKA 3ZYHA 1KYWA 2VOWA 4ZZ8A 1T2KA 1QJU3 2HQ5A 3LA7A 4NPMA 4MG2A 2GNTA 3IMNA 4AI2A 1D2SA 4JDNA 4B43A 2WFF1 3IWZA 3ZDSA 2PMZA 4N43C 3ZFEC 3KT1A 4NDLA 4A3BJ 3JW4A 3FF5A 3LDRA 4BWOA 1T2XA 3VD4A 3RTRA 1U9OA 4NIGA 2LROA 5HXVA 4PCQA 2HVQA 4CICA 3LA3A 1WWXA 3UK9A 4BMBA 4FPKA 3H0DA 1GLNA 1UY4A 3GLLA 5IK8A 1QJEA 2ZGNA 2DODA 4JGZC 3VDBA 2VMDA 4LHKA 3GZ6A 3ZMZA 1HRI2 1E3PA 2RR12 3ZPYA 3OIPA 5IOYA 3H7JA 1OPOA 3BTIA 3RI8A 3PJRA 3OR2C 1BBT1 1BMV2 2HPIA 3J7AY 3I3MA 1TWHJ 1MEC2 3HZJA 1UKGA 3LEIA 4XIKA 2FBIA 2EIMH 2G7UA 1BQPA 3T08A 2R7TA 4Q0PA 5JXIA 3J26N 4HSRA 3KV5A 4JDMA 2KRHA 3C7OA 1Z0XA 4RGXA 2P4EA 1UZWA 4ZU4A 3CESA 4F52A 1ACCA 4JVAA 4ZJZA 4IEVA 4JGYA 2EXHA 3VBUB 3MKLA 3A0KA 2FZ2A 4C9YA 4CXFA 2EA4A 1J7KA 2O7OA 5FJKA 3SEEA 2JB8A 2XBO3 2HWE2 4GJYA 5FKLA 4PGGA 2N8GA 3CP2A 3TBDA 1DQ2A 1BR4A 2JVHA 4JHTA 2DV9A 4JGZB 3HNMA 4NE9A 1A78A 5FZOB 3DU6A 3BWGA 3RSNA 1JXNA 2I74A 1MS8A 3H9GA 4QXKA 3B9IA 3MAJA 1Y0UA 4M0NA 3MDPA 3W6KB 1KQRA 2FMLA 2WIIB 3ZQQA 2WZPP 1JKRC 1PVC1 2PA7A 2WZR2 5H9RA 3ZN6A 2VTFA 3J8F1 2VVEA 5FP9A 2WS91 1DP0A 4XYXA 2VE1A 3HOXJ 2VPVA 4DY3A 4U0WA 5AVPA 4XOGA 1QJFA 2EALA 1YIPA 2GAUA 2F5VA 3HTUA 1OLMA 1T0FC 2XG3A 5CKQA 4ZYHA 3CDHA 2XPWA 1ZA4A 3C3VA 2D93A 5F0HA 1IUFA 4KBBA 2W87A 4Z1VA 1DUXC 2HWB3 3IDBB 4DUXA 5H6QA 4XQFA 5HS9A 1R4NB 4BQ1A 1R1VA 3ELKA 4FTHA 2QBYA 5EGOA 1MDMB 1UAIA 4UYBA 1G9AA 1LAJA 2BWCA 5CA6A 1JW6A 2K9QA 5DDJ2 4AL9A 1HLCA 1UMIA 3HN3A 4LLNA 2DDBA 4IL7A 4A3XA 1S4CA 4AI9A 1WCSA 3GJAA 2XJQA 5A2QZ 2R0FA 3GTLJ 1X3WB 2KT0A 3KP3A 4H2AA 3A01A 1WI9A 3TL4X 3RVHA 4U7DA 1K78B 1K42A 4KNCA 3CL1A 3ASIA 1G86A 1OJLA 2VASA 1RNLA 3I59A 1VRBA 1VRH2 1M4WA 1QRYA 3BC8A 4J1XA 5CIRA 4XQDA 3GZNB 1YFXA 1COV3 4HNVA 4IPAA 3ZKUA 4F3JA 1JHFA 3S14J 2VJXA 3KF5A 1O3RA 1NX9A 1LESA 4FOYA 2BGPA 1YQAA 5D5VB 4RS5A 2DTZA 3BG9A 3PTRB 3D5SC 1F9KA 2BVMA 1MNMC 1AX2A 2M2EA 4Q1PA 3H5RA 3WGIA 4FISA 5EHDA 4GCVA 1R36A 3FXRA 1PYVA 2QUFA 2ZHMA 5K0UB 4LLGF 4JZRA 3O1RA 2ZA9A 1XE0A 4HV6A 1ZGWA 1ETQA 2DURA 2X10A 1IF1A 3NVCA 5HV0A 4E4SA 4L9JA 5G05L 2BFUL 1ZYRF 4CZCA 3HMYA 3L2WA 5GLTA 3VBFB 1TQIA 2QQJA 1YTYA 4N90A 3TNPB 1H8AC 2P6CA 3G4SI 3CMGA 1P4XA 4B09A 5J37A 1LHUA 4HYEA 1SFKA 3ZFFC 2Z3YA 1E3OC 4N53C 1UXZA 2WAAA 2ZGKA 5L9BA 4BQWA 4G7HF 2YUEA 2BGCA 2R3SA 3CC2I 1QH6A 1E5RA 4CDXA 1U6GA 5F9TA 3FL7A 3AG2H 3S1NJ 1PO23 2RE9A 1R4MB 5FZAA 3IB3A 5FQ0A 1R5GA 1XE7A 3ZKYA 4G6DA 3JRFA 1QOTA 4LFUA 1ZR4A 1CPMA 3U4SA 5H20A 2WAQA 1I9RA 3CJQB 3O0WA 3POGA 1R9TJ 2PHRA 1UB9A 1IUYA 3AL6A 2M3AA 3K75B 1WJDA 4NN0A 4IW3A 5BNNA 3T4VA 2XQXA 1VRH1 3KV9A 4MHUA 1U5TB 1F1ZA 1YJLA 1RC9A 2HWD3 5BPXA 5F32A 1AR81 1RUH3 1MMNA 1FX7A 3M07A 3TEYA 4CUBA 4IOAF 1T6GC 3AZYA 2X6OA 4MIMA 1SLBA 2OAZA 3OOXA 5JFRA 2ZSHB 3ZXAC 5C8CB 5J09A 4XJ8A 3TMOA 2HDWA 4YVWA 3LQQA 4YW3A 5A7WA 5C8WA 4JHZA 5E18F 1POV3 1S55A 3BY6A 2IXHA 2P6HA 3R05A 1H6YA 4XF3A 4DFSA 2JSPA 3QYFA 2E2JJ 1WUVA 1H8TA 2ECCA 4QM8A 3QPTA 1H4GA 3MF9A 2F5DA 2AC1A 2UWBA 3ZCOA 3JBG1 5J1YA 3DEWA 1VQ5I 4AG4A 1Y1VJ 2CDPA 3FM5A 5FLVA 3ABMH 4MFDA 2OQRA 1UG2A 5J96B 4K1YA 4QMAA 4AHXA 3I4NJ 1KQ8A 1B6AA 3N36A 3WW1A 2JDNA 2X6YA 5ERLA 2RR11 1I27A 3THCA 4I0AA 1VQ6I 2OD5A 5FZFA 3HQUA 3POYA 3RG0A 4XTPA 4P9WA 2V6EA 3OYFA 2FOKA 3P5JA 3RZZA 4YM1A 5C3RA 3Q5FA 4BL0B 3LSGA 2P8TA 3H50A 5F5QA 1HA8A 4IEQA 1U5ZA 4OOIA 1NA1B 1JBCA 5IAXA 5J8FA 3OUJA 5E1XA 4LLOA 2CU5A 4BE1A 3TWIA 2COBA 4MEXF 3R4UA 5BNOC 2YC4A 2M4KA 1J9IA 4UNOA 5IVCA 3NWSA 5FY0A 3PSFA 2CNAA 4LIUA 4AYBN 3WE3A 1IN8A 4N7IA 4UV8A 3ZXKA 3PL8A 1JOJA 3BQYA 3Q8AA 1OYIA 2IVMA 4GQ7A 4YIFA 1UMQA 3Q8EA 1P6RA 2BOIA 5KXCA 5DEQA 3OYWB 3PJQA 2IC1A 5D1IA 4FFIA 3O1TA 5FZCA 3QAHA 5IYCJ 2CSGA 2J1AA 3QLQA 5JXGA 1MS0A 4YG3A 4W6WA 2VT3A 4OI1A 4QXBA 5A7QA 1H30A 1JKOC 3K6GA 5K8SA 5GAHJ 4LOTA 4AEDB 1YFUA 1F4KA 1SFUA 2CWEA 4OHXA 5DAVA 4AQ6A 2NVUB 5T5PA 1HXS3 2RS53 4C91A 3JRCA 1TZOA 2BHZA 1D0ZA 1IN5A 2ARAA 2JSCA 2L4AA 3NMBA 4WZFA 5JSPA 4D5FA 4OHWA 2EVXA 5A7OA 2A71A 1V6KA 2QQOA 2PN5A 1UL9A 1TWGJ 2R061 3T0DA 2WV1A 3KVAA 5CKMA 2ZJCA 4HG2A 2Q8OA 1BEV3 4LUKA 3EYPA 1C1FA 2H94A 2ZAAA 1OQDA 1JZ6A 4CDWA 2LNBA 2VOVA 3S1MJ 5EF6A 3K4ZA 1TQMA 4HX8A 3S93A 1CF7A 4IE5A 4F8AA 2RQQA 4AI0A 1I5ZA 2QQPA 4Y7NJ 4XW3A 2XJPA 3WQ1A 1K6OA 1RUH2 1RL3A 2WRAA 2C0ZA 1CQ9A 3EJKA 2VC1A 3IRRA 1VBD3 4A3DJ 4COVA 5BYNA 1VMJA 3ETPA 1W9SA 2W94A 5H9PA 4P9FA 2DQRA 3CHXA 4A93J 4CXXA 1FOYA 3WU2C 3ZQFA 1HQNA 1YW7A 2WFPA 4HLTA 5GAGJ 3QACA 3I2HA 2CQ7A 2ZS6B 2ADDA 2HVSA 4BBRJ 3M1EA 3GZAA 1I50J 4YFKF 4P9UA 2VAUA 3HOVJ 5FUPA 4G3YC 5F6LB 1J3RA 1SD7A 1C8M3 4RAZA 2OQ7A 3IM0A 2QQVA 1NOVA 1ST8A 2XGDA 2V9KA 5F3EA 2VI6A 2R043 1CIYA 1EUUA 1MBFA 3NSTA 3KLOA 1W6OA 2QGUA 4G7OF 2YFUA 3ILRA 4GB32 5CPRB 4XKBA 2O14A 5DM6F 2MLGA 4MEYF 1R5ID 3AC0A 2YUSA 2HZTA 3AMPA 4CUCA 3CCUI 1PGL1 1RINA 1YXWA 2EFQA 1MS3A 2EIKH 4HG6B 3T4HB 2VJJA 1U5XA 1YLFA 4Z92B 1ZZ9A 2TBVA 1YX3A 1ON1A 2VBWA 3AK0A 1CZTA 3UNPA 3V0BA 2H8WA 2O0YA 4BY1J 4A7ZA 3P3NA 1MDMA 4KNYA 4XK4A 3OYNA 2JICA 4OUMA 3HOZJ 4JX4A 1ZAOA 2PQSA 1TQ5A 5DAWA 1W5TA 4DPNA 2RS12 4MVTA 5F7UA 3LF7A 4KUMA 3MFKA 2QSGX 2LFBA 3OY9A 1PVC3 5K0UC 2D1VA 2ADUA 1SMTA 2EAKA 2DPUA 2X5IA 1NE4A 4KG0A 1YI7A 2VR4A 5DUIA 3BCWA 1AR91 3MIDA 5E3NA 5LHIA 1ZREA 2X1DA 4IEZA 5T3NA 1AR82 3ZFGC 1YNAA 3EB7A 4LO6B 3HSEA 1AVBA 3WHUA 5JCTA 5DAPA 3WNOA 1J1LA 4HZFA 1TWFJ 5L3EA 4WVVA 4LR4A 2NMNA 3CDZB 2FMYA 2L54A 3H8OA 3Q9VA 3GW2A 5FZ7A 1W0OA 3VBHB 5FY4A 4M74A 4COZA 2Z69A 1NLSA 3U1KA 5AC92 4IRHA 5ED4A 5J48A 4OIOF 4HKWA 1GBGA 2CH0A 3O1MA 3WTWC 1PGSA 3LMMA 4D7NA 1WW7A 3ZXEA 1W6QB 5D5XB 1YHFA 3C2BA 4BJ6C 4FFGA 2JD9A 2QQKA 1FV3A 5JVTA 5A80A 5K1YA 2XJTA 2ZOEB 3GWZA 4FAHA 1VAMA 1YE9A 4URAA 4ISQA 4CDUA 3NV3A 5LGNA 3QYBA 4HANA 1XMKA 1DP3A 2ELHA 3MW4A 1VBD2 3K70C 1GWKA 3GDBA 1WMXA 1BKZA 4Q4ZF 3RMYA 4ON0A 2AXTC 3TOJA 3OPWA 1RR8C 2RS11 1JYVA 4IESA 3S6PA 3WNPA 1VBB2 3ON7A 3FHAA 3HB9A 3FBMA 4LTAA 3DGTA 3SMHA 1G6NA 2HU9A 1Y8QB 2R1DA 4V2FA 3U75A 3BI3A 1UQXA 4DMIA 3WSOA 3F8CA 1R081 1EV12 4WCGA 5E89A 2R7RA 2DVFA 3W9AA 2XAUA 3DXJF 4OWRB 2BTVC 5LATA 3ECQA 4KGGA 1CX1A 2ZZJA 2XROA 1B8IA 5FZ4A 3WX5A 1AYM3 1LEBA 4CCKA 3ASOH 1BBYA 4OI0A 1RGSA 1RUI1 4M3EA 5IP6A 3AKZA 5B1AH 3HOWJ 3F9KA 3DKXA 4K2EA 4BM8A 2DFCA 2CMPA 4GXLA 4FPJA 1R22A 4B8EA 4DOUA 3IV5A 1H9TA 3RIRA 5C44J 1OUXA 2ZACA 5BNGA 1FOD2 2JDMA 2ZEXA 3ZSMA 5HDNA 1JZ4A 1SFEA 4B1MA 5J4YA 1JYNA 4BDVB 1N1SA 3KV6A 2CQNA 2ZMNA 5FXVA 1EA3A 4B7EA 2JT1A 1AZDA 5ILUA 2ZNYA 5A70A 5F0FA 1HDPA 1ZRIA 1LEDA 3WEZA 3CJNA 1YJWI 3VBUC 3FKIJ 3TO7A 3V64A 1YQCA 3FN9A 4URTA 1Z77A 3OUIA 3VBOA 1ZA7A 3P6BA 3HT1A 4W8JA 2XMLA 3VBRA 4XF0A 1VRH3 1O5LA 1IXCA 2DCKA 2Y64A 4R52A 4BEHA 4HSJA 5F1RA 2EA2A 2VKVA 2ZXWH 2FDIA 4XUOA 3AL0C 4KYWA 2PLV3 3RKXA 2X09A 1JYXA 5IYBJ 2XOMA 4IEWA 1DPRA 1VBE2 5DUWA 4UVCA 2WTEA 3FXKA 1IS6A 2LY1A 2ACJA 1J3PA 1J59A 4WVMA 4KICA 4Y20B 3BTXA 2WQ4A 2MBFA 1W5CC 1LCLA 4MTEA 4O9EA 5GZGA 2FBHA 3GZTB 1LHVA 3H92A 3IUOA 2CGOA 1YLLA 5KHDA 2HWC2 3E0JB 4W1UA 2WQZC 1SLLA 2XJVA 3VUOA 4BQXA 2QBYB 1JXSA 4JBAA 4D7TA 5A6QA 4MYEA 2VE9A 4OYUA 4PIZA 1EV13 4GALA 1P4WA 4P9YA 4RAYA 3LPGA 2R7DA 3HJEA 2YYOA 4CA0A 2FU4A 1OR7C 3L2VA 3HNYM 4JQTA 3R0RA 4Y33A 2IUWA 3JD73 4YWAA 4AVVA 3J4UH 3EDPA 5CQEA 2E6VA 2D5FA 2MD0A 3MMYB 1D4M3 4UB8C 1AOYA 3W6JB 5LA1A 1BI3A 5I0DA 3K69A 4LLFA 1ODMA 2UYAA 5A1LA 2R072 4MUVA 5A33B 2QDNA 4ZU7A 3B94A 2NS7A 5L3GA 2WNVA 5FLMJ 1ZBA3 5DDJ3 3D6EA 2JWTA 3F72A 2J1EA 2D3PA 4LT5A 2CAUA 3PU3A 3RPUA 4XEZA 4P02B 3BPVA 1LTEA 2NVTJ 4HRIA 1W36D 4E7HA 2HNHA 2K02A 2UWAA 4GWIA 4WM7C 5CAZA 3M1CA 3KYLA 1YFYA 5AFEA 2YGMA 1ULOA 2LUWA 5FROA 2D2WA 1X9TA 3OYMA 2JPCA 4PI0A 2A6EF 2MGQA 4Q4V2 2DWRA 4HT1T 2KA3A 1KS5A 1PIV1 3SZPA 3H5NA 1BIBA 1R1ZA 2UURA 4RQPB 3LFIA 5GALA 1W6QA 3KT4A 2W57A 4BE3A 5FR3A 5FV3A 3JD72 4O7XA 3M8JA 3JZVA 4JQRA 4AAXA 1YHQI 1DF0A 1D4VB 3O1PA 3I64A 2DUOA 1NH3A 2BGOA 4DXSA 1W7PA 3IDEA 2VNOA 3AB0A 1FY7A 3DCQA 5EXOA 4D69A 5HCAA 3ZLIA 2RJKA 3ZPOA 4U2AA 4XFCA 2P5KA 3G1LA 1S6LA 2CUZA 1LDKB 4N7UA 4LKSA 5C4XJ 4I3PA 3WQ7A 1SC7A 4IRIA 3LFMA 2UU8A 4CDXB 3HOUJ 2L9LA 1MQTB 3DYMA 3C7EA 3NNFA 2KJCA 4NR1A 4MX3A 3WG1A 5B4XA 2WN3A 4A5MA 2VG9A 3GTJJ 4DQAA 3U4XA 2DA3A 1SLIA 1S8NA 1RUG2 3W59A 5BV6A 1VBD1 1RHI1 5KHJA 2CAVA 5IY5H 4MGRA 3BQZA 2UZKA 1FPN2 1FZPB 3ZN5A 4HA8A 4BQYA 2WWUA 2JA5J 3E5XA 1OD5A 2ARBA 3ZYPA 4IHXA 3K0LA 2XAFA 3A1YA 4COYA 2GSYA 2P81A 2Q8KA 3RZHA 2PHUA 2VE8A 1XNBA 1GSLA 2JE7A 1MNEA 2HWB2 3DPUA 1ZELA 4W97A 2FEZA 5EDNA 2D5HA 3D3AA 1FYUA 3LSJA 1AYN3 4Z07A 3VKOA 1JZ2A 5HLIA 2WBMA 5DUKA 4XLCA 3PUAA 3E6MA 4BQQA 2A6XA 4K8FA 5K7PA 4YGEA 4QXCA 4MADA 1IV8A 4CEYB 1LQ1A 4UFJA 3THTA 3CJIB 3ZMOA 2GN3A 2HYXA 3J8F2 1VQPI 3VBUA 5F3GA 5KXBA 1DGWY 1JZ8A 2RJLA 2LSOA 3ROUA 4CDGA 1UIJA 2LKSA 3BOPA 4Q4X3 1RUJ2 2XF5A 1WJBA 1YYVA 4IGPA 5FXZA 1K78A 2EXJA 1J09A 2K7LA 4ZYAA 4H55A 4PI2A 1NK3P 4A12A 4YW7A 5EYYA 4UFMA 3E5QA 2R7FA 1PIV3 3BT9A 5ICFA 3H1MA 4NQWA 3MGUA 2M9HA 1QQP2 5TSWA 1LJ9A 3KCXA 2VKEA 3F6VA 1US3A 2CQQA 2E35A 4NC7A 5B2GB 3HC7A 2BWAA 2YV8A 2OTLI 5JMCA 2YSRA 3BVCA 5AFBA 4PIYA 3QCWA 3POEA 2ZXJA 2FD8A 1R1UA 1A8DA 2VM9A 3TW7A 1OF4A 5JDBA 2EQRA 3IKVA 3PVEA 3HPGA 5A3NA 1R00A 1VR3A 3JAMZ 4CCDA 2PLV1 1RUG3 1ZBA2 1GWLA 2DCYA 1IGOA 4GXOA 3H8UA 5T55A 1UJ8A 1OA3A 2IFRA 2PTMA 9ANTA 2H8RA 5FY8A 1IJWC 5HLTA 2RM22 2GALA 3N7JA 3NKTA 3SKJE 4CXWA 3MVPA 3MIHA 3VLBB 3P5BA 1HX6A 5FJHA 2R32A 3BDDA 1OLTA 4BJTA 2GNDA 3HKZN 1CAVB 1ETXA 3VHOA 2NAZA 3ZN0A 4Z2YA 3M3EA 3RJRA 3HGGA 2D43A 4YG2F 3J7YJ 3A22A 4E8DA 4KG8A 2A5ZA 3FXMA 4IZZA 4LG0A 2JG8B 3VKNA 2VQCA 2LALA 1LU1A 5C7GA 3VOEA 3M4FA 3NNLA 4MLOA 4N8MA 2B63J 2D6NA 3ELNA 3OD0A 3LZZA 5E8AA 4YFXF 2ZX0A 2L4MA 2LBFB 2IS2A 4I6ZA 3HRMA 5HI0A 1PGW1 4XSZF 4CDWC 3RMXA 1XU2A 2RS32 2GQQA 2RMU1 2ZGLA 2WA4A 4A3KJ 3M8EA 4JRAA 2W95A 1H9WA 1QQP1 3BJOA 1R71A 3W3CA 3T2OA 3MZYA 2LBFA 2HKXA 1BM9A 5IT3A 4QPQA 3A0BC 3ZVXA 3WTTC 4RL7A 2VN2A 3TW6A 1AYM1 1PX3A 2E7TA 1X7NA 3H1CA 3CCRI 4BB3A 1Y8RB 1RESA 1EF4A 3QP5A 4F93B 1SACA 3FUOA 5DZGA 1LGBA 1I6XA 2V6CA 2A3SA 1KU9A 2EK5A 1XNTA 4GWJA 2W00A 2MEV3 2K27A 3I54A 5DV5A 2DCZA 1V0AA 3F21A 5KNLA 3FK6A 2PHDA 2ZJPF 2BU9A 2HLEA 1MMAA 4LLLA 3NNGA 2JVGA 2W1UA 1OPCA 2EAAA 4QPGC 3KLNA 4Q2FA 1IGNA 4E4ZA 3OG2A 5EYRA 1SVMA 4R4ZA 4MO3M 1FMWA 3GFIA 3IH3A 3AMNA 5DZEA 3BTAA 1SMYF 1X2MA 2P34A 2ZAHA 3QOEA 1XB4A 3C1DA 5IP9J 2Y8KA 2NS0A 1ALYA 2Z9OA 1O59A 4DS0A 3OBRA 4FHTA 4IEOA 4Z2WA 1MS5A 5FYHA 2QM3A 1C8NA 2YC0A 1AR62 2KZGA 3BZ6A 3I58A 2FHRA 2MSYA 4U36A 5FWEA 4GYIA 4M3FA 3RI4A 2DYSH 4CCJA 3FXOA 4FPOB 3QOPA 4M71A 4ZDPA 3S2HJ 2IGOA 5IP7J 2VMEA 5LA9A 1BL0A 4P9XA 1ZZ8A 3WV6A 5GTIC 5HLGA 2CWSA 2ES3A 1UU6A 4JYKA 5FUIA 3CCVI 2MD5A 1KEXA 4OZOA 3LOIA 4OMDA 5K5QA 1L7QA 2G9WA 4WK8F 2YU1A 4C8DA 4L2NA 5DPNA 4NHJA 5HNHA 5KAIC 3S57A 1DGWX 4B44A 1U9NA 2DTYA 2BY1A 5JR3A 5I0TA 2QQAA 2VKHA 1BJQA 3N9OA 1DYOA 5K0UA 3DYOA 3ZXDA 1BK0A 4MXWA 1K83J 5FFZA 5E8IA 1XDUA 2PBIA 5GM0A 1GV9A 3B73A 2WV0A 3I9V2 4K8RB 1LOAA 1S3JA 2VVDA 4FT8A 4L0PA 1LOCA 2HDCA 3CUOA 3IMMA 4LA3A 1QHGA 3LA2A 3R6SA 2ID3A 2PAKA 1Z67A 2OQGA 5JIAA 1MIJA 3K2ZA 1ONVA 3FHZA 4RMNA 3W2AA 3GFJA 1HKQA 4MGSA 5J47A 3ZFEA 4RHV1 3ZFGA 2DW4A 1YIOA 1X8MA 4UV9A 1FOD3 2Y48A 1ND2C 2YDEA 4Y17A 2Z42A 2ELKA 1IRZA 5I0RA 4JCKA 3T0AA 2OKXA 3ZMTA 4K7JA 3EUKL 1S0GA 4S2DA 5H6RA 4ZZDA 3I2FA 4QPIB 4QKBA 2B0LA 4OHYA 4UW3A 4EROA 2JQ7A 2W92A 4CHUA 2JIJA 4CCMA 2QCOA 1WGXA 3J80K 4Q4W1 5TISC 2DBNA 2WQ8A 5FY9A 1CAUA 1YW8A 4MXWB 4NWVA 5C4JJ 2EXKA 4KT5C 2GMMA 3AX4A 1SHWB 1GMMA 3VGIA 4IV3B 4E7SA 2NPIA 5FYZA 1IG0A 2XQRA 1SLTA 3VWBA 4RQPC 2R7OA 1LRHA 4Z2AA 3H3VK 1A6QA 2F4PA 4GKXA 3K4BA 3E5UA 1PJRA 4EE2A 1WD4A 1RJ8A 4LHSA 1T6BX 4XILA 2WYFA 4TLGA 4U88A 5FZIA 1IS5A 5LA0A 1Q8OA 2VL4A 1FLIA 3M3QA 1ND2B 1A6CA 4KDPA 3G1MA 4QKDA 2DOAA 2HKOA 5EGOB 2BY2A 3LKJA 4IOCF 3APBA 1JU3A 3BTJA 1B72B 3L9FA 2RDSA 2W0XA 1W04A 1XNAA 1G8XA 3OL3A 1ZG5A 4DXRA 3WVJA 1OLRA 2XASA 3GO5A 2FNPA 2E36A 2ZJ2A 3H36A 1AR71 1IPJA 3HBLA 1LNWA 2D6OX 4AVCA 2K9NA 5F0CA 2LF8A 1XGOA 1FP1D 1LEMA 3RQ4A 1LB2A 4XAEA 5FCCA 1CVNA 1N3OA 1WCMJ 4BQOA 1S0IA 4PF1A 3SCGA 1IDZA 2WS92 4ZZ5A 1YJNI 4XBFA 4ZTJA 1OI6A 4X0GA 3BALA 4YG6A 3GEZA 1KDMA 1M1EB 4HQEA 2JE8A 1QZZA 3U2RA 5LA2A 2LYCA 4BCUA 1REDA 1G9BA 2V73A 4RA0A 3ZYJB 3KETA 3U9GA 1RKTA 2IWGB 2VZ1A 4MGTA 2ZHKA 3S17J 4PBPA 1HN0A 4QPGB 1D2QA 1OH3A 1U5TC 4XRSA 3OIQA 1W6OB 4EWAA 3H8XA 1ULCA 5TGTA 1K7AA 3H9QA 3DTKA 4NHXA 4UUSB 1LPQA 2VGDA 4ABZA 2E1CA 5DQ0A 4WXCA 1TMF3 4R79A 2BFUS 2YR2A 3GM8A 4C0BA 3OYGA 4XM3A 4LK0F 2FQPA 1NLQA 1NZIA 4YRVA 1UZCA 2OU2A 5JAXA 3VDDB 2XH6A 2ZMLA 4CDQA 3S0MA 4MSVA 1W3XA 4NIIA 4D9JA 3SEPA 2EJRA 3PMSA 1G2HA 4CPBD 4WX9A 2KHMA 2FDHA 2D44A 3CBNA 4JGZA 1W0UA 3BR0A 2VCBA 2WNOA 1AL22 1MEC3 2RS51 1GZCA 2D7FA 4NIAA 3MCZA 4DJAA 3OYBA 2F5CA 2OBPA 1YI9A 2HYJA 4M00A 2ME0A 2B7YA 2ZBKA 5DDJ1 4KBZA 5L19A 2OTJI 4RFT0 4A5NA 3QH6A 2WUHA 3WNKA 1XNCA 2R5ZB 3VD9A 1X3ZB 1W36C 2ZBJA 5FKKA 1VF9A 3BGAA 5A3MA 2LREA 5CADA 2STWA 1FP2A 3SHRA 2FQ4A 2PN6A 3NKGA 4TYSA 5FYMA 1OCRH 3OPZA 1AF9A 4ZYGA 2PYTA 1GZWB 1XS9A 3FC0A 2QZ8A 3E1SA 4U7BA 1EPWA 4AEDA 4FCYA 1UZ0A 2VBZA 2EWNA 1TT5B 4CCEA 1OH4A 5FY7A 4HLXA 1L3JA 2W68A 3INAA 4LJHA 2IRFG 3GTMJ 3I49A 1QJU2 3OYCA 1ULYA 3LFKA 2CYFA 2DCEA 4L97A 2VXRA 4KWLA 2FCUA 4CEYA 4ES9A 5GZFA 3DKWA 3SQOA 4C1XA 1OFCX 1SPPA 2BPA2 3HEIA 1RUD3 1QDCA 2EICA 4A6OA 1DIWA 2ZGRA 3Q8FA 1Y7BA 3I3BA 4XJAA 2E32A 3T2TA 5LZ6A 1HB3A 4A2UA 3GX4X 1GOGA 1JZ7A 4XMIA 5E1WA 4YNIA 3W58A 3M8LA 2O8XA 1ON2A 3OOPA 3FHQA 1ENRA 1AL21 1N77A 3IRQA 3FHIB 2RN7A 1MBGA 3VSLA 1ULFA 1G8WA 1LEAA 2IXCA 5C8CC 1UN1A 1VB4A 2Q0OA 1LJ7A 2L9SA 3CCJI 1VE0A 2LC2A 1GR3A 3V8LA 1FIAA 4QKNA 1UG0A 2KIMA 4P9GA 4BIFA 5BNPB 1OURA 1Q8VA 1RYYA 1U5IA 1PUFA 1OD3A 2R5ZA 4JX0A 5FMOS 4KN7X 1MVQA 4AHZA 4FBFA 3WDXA 3TGNA 1VB2A 1V4RA 1B8IB 2L0KA 3POBA 4IHSA 4G8XA 4XXAA 2Q5TA 4XE9A 4FOVA 1WQ2A 3L00A 2O8QA 2DDAA 2JDHA 4WZCA 2E7WA 5BNNC 2KXLA 1V3FA 3FXLA 3FFZA 4MH0E 4Y3OA 2VECA 2KDOA 1K79A 3J7HA 4EWEA 3AJYA 2YU2A 1BOBA 3IPVB 2Y33A 3RQIA 4WM7A 2X9DA 1UX6A 2PHTA 4RS5C 1KU7A 3VZMA 3ZOIA 1L7RA 1YQ2A 5FZ8A 1YS6A 3OGRA 2JG9A 4CDQB 3BKZA 4CEYC 3VDDA 2ZZQA 1NA1C 1RIRA 2BJSA 2W2IA 4Q0SA 1W0TA 4AQTA 4GA9A 2A6YA 2A61A 2Z2SB 1DP7P 2Q1MA 4RAGA 4NRPA 3QBQA 2NNYA 4AFCA 1CZVA 4PSXA 3VYRB 5DCMA 4CCNA 2OT7A 3VL9A 3L2CA 1TMF2 2X5IC 5FZKA 2GWRA 5CFCB 1JT6A 1JUIA 4UVAA 1X4OA 1QHDA 1TLHB 4XBNA 1GV5A 1OOPA 5EZWA 2P3IA 5IYYA 4XUNA 1JH5A 1KZHA 1QXRA 1Q5OA 3H7YA 4AVAA 4CZZA 3I2OA 2DVGA 4NRQA 3DUIA 4UF0B 1W2NA 1SBDA 2ECBA 3VBHA 3VYSB 2VQTA 2M7BA 3S5AA 1SFOJ 5FMOL 4BNCA 1KA8A 1D3YA 1W7PB 3ZN4A 4WXHA 5IJRA 2VUMJ 4GH4A 5DDGA 1D8KA 1Q43A 4ESFA 4BE0A 4EGYA 3K4DA 3S7IA 3ST7A 2R041 4X8PA 3ES4A 1KFXL 2CFOA 2A5WA 4IV1A 2EPFA 3N3HA 1ENHA 2VIXA 5E3LA 3MIEA 1QU0A 2B45X 2J1VA 3RFRA 1BW6A 2ZGPA 2EZHA 2NOGA 1NY71 4BQ5A 4G9SB 3GXUA 1XC6A 3PFIA 5LGUA 4PT6A 1PMHX 2L7MP 4INDA 4Y24A 1OOPB 3CMMA 3K4AA 2WL1A 2L2OA 1S0FA 4BQNA 3CJTB 1IHMA 1S5LC 3F3XA 4MGKE 3BU0A 5JPNB 3WT3A 2WFF2 4AM3A 5LCWL 1FIPA 1WJEA 2CYYA 3CDIA 4IEJA 1W2TA 1LR5A 3RZMA 3A2KA 5FMCA 1SEUA 3V56A 3EMRA 2Z33A 5E8GA 4HV5A 4HDUA 2FA5A 2ET7A 3NAUA 1OLQA 1SLCA 2QVSB 2DA4A 2FF4A 1QKQA 3OR1C 4XCAA 2VNVA 2HTJA 4N53A 1GU3A 3ZN1A 1FOWA 3BTCA 2STTA 2X85A 4ESJA 1HKTA 2D3SA 3VSKA 2GH8A 2E19A 1BEV2 1PVXA 5M5XJ 4DW6A 5CNAA 2RVAA 1YO8A 2FX0A 4N4NB 1SQ4A 2OJED 1MJBA 2VBPA 2GNBA 3ESWB 4PUSA 4X6RB 4HAMA 1P92A 4AR2A 3OBTA 4FPFA 1RTVA 3Q9OA 2RKHA 4XN0A 1TW3A 3WDTA 4PJJA 2EXIA 3NV2A 3KHCA 4S0HB 1QZYA 4YEJA 1W7PD 4JRLA 4Q27A 1YQ5A 5D8AA 3IAS2 4P5HA 5JIUA 4LBKA 2YG0A 2B8MA 1SD4A 3A01B 2XBO2 2BNMA 1URXA 3LSKA 3HYIA 3ZMVA 5DS9A 1YWKA 3DLLF 1JMUB 4IHTA 4D94A 4P14A 2VZOA 3PIOF 2WWSA 1ETWA 2QQBA 1UY0A 1J75A 3KP6A 1ULPA 4Q26A 4EN8B 1FBSA 3U1DA 2MC3A 2A05A 2XL7A 3PM1A 4ZDLA 5FPLA 3PSIA 4I02A 5IWFA 2W84A 2R7EB 4KMFA 2VPRA 1TNSA 4XLPF 4HVOA 1DU0A 1NG7A 2XGXA 4AIDA 4BDYA 1MH3A 1B4AA 3A03A 4EM2A 4L9NA 4LO8A 3AZZA 2JDZA 3KLSA 1W6PB 2EB7A 3WG3A 4LOCA 3QPHA 2JB4A 3CLOA 1MH4A 1PMIA 5JXJA 1Z7S2 3HTSB 5K7ZA 3C7GA 3LQRA 3E1F1 4EJVA 1W6MA 3RZGA 4GDFA 2ZMEB 1RITA 1DYPA 3N9PA 4LNVA 3KS7A 3IH2A 2C1FA 4LBQD 3A4UA 3HQRA 3ERMA 2K4JA 3T09A 1R49A 2RQPA 3BCBA 4FPHA 4AVPA 4GB33 2E1MB 2XLFA 5KHHA 5CJ9A 4PDWB 2VT2A 2DOFA 2LRPA 2NQYA 3AMHA 1NXD1 2XHKA 5M3FJ 5FKBA 4EMSA 3E97A 2R5YB 2D5VA 2YBPA 5JSRA 4F55A 1J84A 3U11A 1WLWA 4XLEA 4DUVA 2P6TA 3WF3A 2E26A 4A6EA 1ZR2A 2R0QC 1G9FA 2OA4A 3LL7A 1CPNA 2MC4A 2R7UA 2KRCA 2BXZA 3HSFA 1JJ8C 2VQLA 1XCVA 3QODA 3RRDA 3RKWA 3WNMA 2XHNA 2RDPA 4E9KA 1FPN3 4AQ2A 2ZMEC 2AHQA 5JOZA 1G9CA 1APLC 4QDRA 3HUGB 4ZHNA 1XSVA 4ZYDA 4D0PA 2DA1A 1QJY1 2QQUA 2BVBA 2Y31A 4YW6A 3TEDA 3KZ4C 4F91B 1WBLA 2WAEA 3BZKA 2J1UA 2GA1A 3MWMA 3PU8A 4A3FJ 3AL0B 4COUA 1RETA 4XMAA 2BNOA 5FZ0A 1IXRC 1FMD3 2B39A 1XQNA 1WVRA 1R092 4H0EA 1F5FA 2VY0A 2GLOA 5FYBA 3P9IA 4RGKA 5ABJC 5C4WC 4XKCA 3TKYA 3O2PE 4GJZA 1U5TA 2Q8CA 2Q2EA 1UCRA 1B35A 1BR2A 2RV8A 5EG0B 4XDPA 3M3OA 1V55H 1J0RA 1FNZA 3EO6A 4QQLA 2QQLA 3JRGA 1VBB1 4CRQA 2V1UA 2WR9A 3O5SA 4XURA 1WW4A 1K5MB 1QIQA 4GH4C 5FWJA 3M8FA 2W9XA 1W6NB 3V42A 4LO4B 1D0HA 1Z3YA 5LASA 2H1KA 1JTYA 2DU9A 3J7LA 1LHWA 1VBC1 1NG0A 1RUI3 1O3QA 5F6FA 1YQ8A 2W1SA 5J8CA 5DUUA 2DU0A 4PLNA 2KISA 4HEA2 5T50A 4HFSA 1A8MA 3H5AA 2IS6A 3HSRA 1D1AA 1GV2A 3F23A 2FD5A 2A3YA 5DAQA 1POV1 1W90A 4IGQA 4L0YB 5JI6A 2WO3A 1NY72 2KFDA 5CFCC 1COV1 2WA0A 1C8M2 2R1BA 2GXBA 1NCQA 4QQOA 1AJOA 1A34A 2VD7A 3KPHA 2A75A 1LE8A 1BW5A 3AP9A 2VOTA 1WZXA 5LK7B 2EIGA 3MV01 5FP3A 2XGCA 2WADA 2ID4A 3OBAA 3TOAA 1XN7A 3K10A 1I3QJ 3ZYBA 1IQAA 2ZHNA 3MFAA 1GT0C 1SANA 2XAGA 1JN2P 4E7KA 2GA2A 1VBE1 4GMP1 2XUBA 2DA2A 2ISYA 3AL5A 2AS5F 4NPLA 2JRMA 2GH2A 3AZVA 4SBVA 1VLNA 4N43B 2HYKA 3WG7H 4BHCA 3R60A 1ZKGA 3GLXA 3LE0A 3B00A 4QM9A 2OPWA 4DO0A 5E17F 5LHHA 3JTGA 5D8AB 1OYWA 1GZWA 4LKDA 3K4JA 1V5GA 1V6LA 2K2SA 4HMZA 1PNGA 2ZCWA 1C0WA 3QU3A 1YJKA 2O1QA 3IHUA 5GP9A 1UOBA 4UI9L 3J81Z 1YO5C 2M30A 2IGNA 2WT1A 1ENQA 1AX0A 3LEGA 4OIPF 3EUHC 3JAMK 4MGQA 4LBMA 1ND3A 2WJSA 4Q29A 3NAPB 2GOXB 4O9GA 5D8AC 4O5VA 1XNKA 5J1RA 2DUPA 1TNTA 2MFZA 1X36A 3SCHA 1V9U3 2A07F 2M7AA 3VV1A 1V6OA 4AEMA 5HPOA 1ODNA 3K7AJ 1FMVA 4ASKA 2K4BA 4IX7A 1S7EA 5FYVA 4JX6A 4JGYC 4HK8A 2LVSA 3BIEA 3HN1A 1RUE2 2ZMKA 1WCDJ 1JHHA 3RSJA 3S5QA 3LOBA 4XFGA 1H2KA 1C4RA 4ZXKA 1IZ3A 1NE6A 1KGYA 4Z82A 4KL1A 3CC4I 1CAWA 2TDXA 1HRV3 4S2FA 3LEKA 4LB6B 4AFMA 3PIGA 4EM0B 1CWPA 1EAH3 3L2QA 4Y13A 1QJX2 4ARXA 2D6PA 3W5NA 2PXJA 1RJ7A 5FKOA 3CJIC 3MPPG 4YZ2A 2SLIA 1OC1A 5EJZB 3D0SA 3WZ1A 4ITCA 5F2WA 1VZ0A 5LB6A 4NJ4A 3C3WA 2LTNA 3B9CA 3ZSJA 3HRUA 1X50A 5I8TA 2LLKA 1X1CA 1G9DA 1B72A 3AZWA 4A4AA 2WLPA 1VBA3 5LK5A 3L7WA 4C30A 2E33A 4PQ9A 3Q9SA 1IW7F 1HCRA 4PZJA 5FBZA 1FMD2 1JTZX 3KHBA 3WTUC 3DXUA 1R093 3FK7A 4HLYA 1T0FA 1HBXG 3NW4A 2WINB 5GJ6A 2LM3A 3CIHA 1TL8A 4FP2A 2P3JA 4OULA 4Q0VA 1ETKA 2PFBA 3ZP5A 1Y43B 1Q8QA 4NAOA 1JUMA 4RQPA 3SNMA 2CRGA 2YS9A 4LIVA 1BYHA 2BBVA 2XAJA 2DFBA 4Q4W2 1TVGA 1VP6A 3OSDA 1UAAA 3DP7A 3PDQA 3M1HA 4YARA 1JGGA 5CZKA 3OCPA 4Y52J 5FK8A 1TWAJ 3TOBA 4ZDOA 1G7YA 2D98A 5E3OA 2JECA 2RGVA 1BI1A 3N9QA 3BROA 1HW1A 1YW9A 3I7DA 1FBUA 5I91A 3K1MA 4FCAA 2JRTA 5IHRA 3H0OA 2KL4A 5C3EJ 1SAUA 5KVRA 3BG5A 4RN5A 1ZZCA 2PQ8A 2VXJA 2XVKA 5FRNA 2PELA 3C2UA 4PK4A 3EHKA 5FFOC 3WDWA 2J5OA 2OVUA 2WAOA 1DFQA 4I2OA 4A0YA 3ONQA 4KIBA 1XJAA 4AGVA 3U10A 2L01A 5FGMA 3BG6A 2XWBB 4BAYA 3OS2A 1ONAA 2LD5A 2MW8A 2FSWA 4H3WA 4A3IJ 4PDWC 4M4PA 2R4GA 5DABA 1RIOH 4TN7A 2XWJB 1CGPA 3UYJA 3F22A 4TV7A 2JXAA 2VXDA 1MACA 4MZUA 2V5YA 4U87A 2ZGQA 1H6XA 4IRGA 3VBRC 2MPFA 4XBLA 2I8DA 1WJCA 2O3FA 2YPDA 1AU7A 3G6JB 4YRDA 2L7KA 4OUEA 4WVMB 1FMD1 4CEWB 2Y60A 5GTHC 4P5OA 1IAWA 1BVP1 4YZ5A 2J22A 3AKPA 2VBXA 1GZ9A 1XSQA 1JYCA 3GVAA 5CYVA 4C90A 1CN1A 1H0MA 3HIFA 2HEOA 3CLPA 4JK1X 4WM8B 1MD0A 4UY8I 2WZR3 3V4GA 3VBRB 5BS6A 4FPLA 3LSPA 3UKVA 3U0ZA 4PCRA 2LS6A 1W4MA 1RUE3 1WKYA 3H35A 1KYZA 1XMXA 4M3DA 4MGIE 4GD4A 4BQ2A 1H4HA 5BNQA 3GXOA 2KZVA 3BG3A 2E53A 3AKSA 2TUNA 4OQ9A 2IGKA 2W1WA 2HWC3 1HRI3 1I3AA 2J1RA 4C2UA 1BA5A 4CXYA 3MLJA 2W46A 2M8EA 1H2NA 2GIVA 2WB1A 1K6YA 4Q5SF 3SKVA 4NIDA 1PO22 4EQVA 3OF1A 4QGMA 3ACGA 3PNVA 2PFWA 2ETEA 2L7FP 3NNJA 5ANNA 4AOCA 4RB2C 4BU2A 1IRGA 4MFEA 1UX7A 2P2KA 4M3GA 2JDPA 5L3DA 3J7AO 1DHKB 4DBRA 1X4PA 2P5BA 2WA3A 2XF7A 5DTDA 1W8UA 3TBIA 5FZMA 3IKWA 2FDGA 3ACHA 1UKRA 1S72I 5GZDA 4D7YA 5M5YJ 2PLYA 4DINB 1YOVB 4IXLA 1S7OA 2M8GX 3N7KA 5IK4A 1D0XA 4L5IA 1JKPC 2G7HA 1WCKA 3WOGA 5EPAA 4A7YA 1ZGJA 4EGZA 2CS3A 5D6FA 2XV4S 4OHZA 2PHFA 1IS3A 3I56I 3WW4A 3D1NI 2MHFA 4A7KA 1LOGA 1OHFA 1LULA 5JOXA 2E5ZA 2RDRA 3OEBA 1WD3A 4IERA 2VODA 4Q8LA 1N25A 3HUGA 3G6EI 2CGNA 1QNYA 1KDKA 1MW7A 3ZMDA 1R1A3 3X2QH 2XVLA 5E20A 4JQFA 3M3IA 2XSJC 2Q8DA 5A32A 1TBXA 1MR5A 2WNEA 2DI3A 1PMJX 2UWCA 2J1SA 2XVGA 3ENRA 4OHVA 2F48A 2R7XA 2OUJA 1W2OA 2F4MB 2KPMA 1AR83 4FE4A 4MNUA 2BY0A 1JU4A 2VCAA 2DFEA 4NROA 5ACA3 1YEWA 4TTGA 2TEPA 1H1MA 3R4SA 1JUPA 2K0GA 4HDVA 4CPBA 1OVPA 1QJZA 4FX4A 5A3OA 4XPVA 1DQ1A 2C6SA 4YIRX 1WSUA 4QDQA 2AEZA 3S7EA 2W3JA 4B3AA 2GXGA 2WY7Q 4QHOA 1V54H 3CEWA 1PO21 3LB9A 2IXSA 5F64A 5FZOA 3D5OA 4EN7B 1GP6A 3GCXA 1MVEA 4QQ2A 1ZBE3 4CDUB 2KD7A 4KQ7A 1RUF3 3ZR6A 3E7LA 4KN4X 4XICA 4R9DA 4PSWA 1XTAA 4HF0A 1TW2A 1HSJA 2GMEA 3O6BB 2CY6A 3UKNA 3RWNA 1JYTA 2A3XA 5HBAA 3VHPA 4LB5A 1R6RA 1N1VA 1ZRFA 2VUJA 1FBQA 3LSDA 2L5QA 4ZS3A 1I39A 4JAAA 1GNYA 4AI1A 4M6YA 1I6HJ 3ME2A 4AD9A 1O8SA 1DGLA 4LD5A 1J3QA 3OTFA 4NNJA 1Z7LA 5IT9K 4BXSV 5I0UA 1IPSA 2R6QA 4CSWA 1E5SA 3J7NA 2AEYA 1VQNI 3FKJA 4JOMA 2BERA 4W6YA 3C18A 1ZGAA 1Y39A 1PX4A 2VUAA 4DRVA 3BPSA 1JI6A 1C5IA 3ZMNA 3WF2A 3UGFA 4CUAA 1FSEA 2XJRA 2FQ3A 1O4YA 3P9KA 1B35C 4QWQA 2M5WA 4PJ0C 1DYKA 1O7FA 4CEWC 1OKRA 1RVF3 3LIGA 4M01A 4Y5TA 5DMYA 5JOYA 5FO7B 4YZ4A 5DZFA 3DEMA 1GUUA 2B9UA 1QY4A 2YPRA 5CFCA 1VJ2A 3H3ZA 4FSJA 4Y15A 3WTZA 4GWNA 3ZFFB 1KONA 1FV2A 1EH8A 1AKHB 1YCIA 4PJLA 4X6AJ 1OCZH 3WDUA 2GP3A 3IC7A 3CCMI 4Y22A 3AP6A 3CZ6A 1DQ0A 1Y9GA 3M7AA 3OL4A 4E27A 3CC7I 3WW3A 3UV9A 3U14A 1LVAA 2R7VA 3L2HA 5FYYA 3GTOJ 1CJDA 3WQBA 5JR2A 1WLDA 5DAXA 2VNGA 3KT7A 2R073 2WNUB 3O7OA 2L9NA 2VONA 2W47A 3DFGA 2FMDA 4MQVA 4KGQA 3VKFC 2G0EA 4ZKTB 1YRNB 4N43A 4KT6A 5BMZA 4GGGA 4QHZA 5F6KA 2Y9YA 4KWJA 4E8CA 1W03A 2F4IA 4UAPA 5C33A 2MA3A 2ZGUA 3HVDA 4ZU5A 2A5YB 1GDTA 1AHDP 3O1UA 3PQKA 4XCBA 1ASJ2 3ZXGA 1IN7A 4QPOA 3KP7A 3CJXA 4PFPA 2CW7A 5E79C 5CVUA 4ES8A 1G4DA 4Y4RA 2XIGA 2O0OA 2JKXA 3N7MA 3SITA 2BQPA 3KP5A 3V8KA 2NOJB 1I1GA 1X8EA