1CGPA

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a CAP-DNA complex: the DNA is bent by 90 degrees.
pubmed rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*CP*AP*TP*A
total genus 59
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cgpA01
2XROA 3CUOA 3VEPA 3I5UA 3KEQA 1IXRC 1Z7UA 1U6GA 4Q0PA 1KGSA 3O3KA 4IRGA 2F5DA 1FWZA 3CJNA 3WTTC 1H0MA 2XL9A 2R7FA 4MGKE 1T2KA 2ELHA 4I02A 2BV6A 4AQ2A 1D5VA 3WTYC 2PJPA 4M9SA 4EGZA 4HDUA 4EJVA 1YYVA 3M8EA 3WTZA 1EYBA 3QP6A 3CO2A 3EBRA 3SXYA 2R3SA 1FT9A 2XLFA 3Q9VA 2GU9A 3S2WA 4RAZA 1S3JA 1XGMA 3JTHA 1QXJA 2KIFA 2GAUA 1XB4A 1IPJA 5HLHA 3CO6C 3M9AA 1YHFA 1YFHA 5FLXZ 5D8KB 4MEYF 2UYBA 1IN4A 1R5GA 2M87A 3RI4A 2VC0A 3DN7A 1IRGA 3MQ0A 3KE2A 5ICEA 2L4MA 1Y0UA 4KMFA 4I0AA 1FYLA 3WGIA 1EP0A 3NKTA 1OPCA 2ZCWA 1SD5A 2WC2A 3R60A 3LOIA 3NJZA 1DDNA 1MJ9A 1VTNC 4TLFA 3DF8A 4FAGA 3E6MA 4EGYA 2FNAA 1TNTA 4A0YA 3GWZA 2W85A 5KHHA 3V7RA 3FWEA 5I91A 1WLTA 4KN4X 2VT3A 3IDBB 3ABTA 1IN7A 3GUDA 3SMHA 3SCGA 2HTJA 5IT3A 1VR3A 4OMZA 3JAMK 4KN7X 4AD9A 3G3ZA 1W7PB 1ZHFA 1KU7A 3S7IA 1ON2A 3LQQA 4E2SA 2E9QA 1H1MA 4EJOA 2CYYA 2PG4A 3BJAA 5ILVA 3ETQA 2V79A 2FBKA 1JXSA 4XF9A 2A07F 2P5KA 3KCCA 1R22A 4ETSA 3BU7A 3QU6A 4HW0A 1JHFA 4YNIA 5ICCA 2M1BA 4RB0A 2VBYA 2Q8KA 1W4MA 4LB6B 5FDBA 1SFEA 3F22A 4ZYDA 2NNNA 1XSXA 1J1LA 3PLQA 5E8IA 2PYTA 3ZN0A 2QQAA 4M72A 2J5OA 3R6SA 4HQEA 1DP7P 4HVQA 5E18F 5JFRA 4KDPA 2HKXA 5FO5A 3D0SA 3J81K 1EY2A 2EFQA 5TRDA 1LDKB 2HS5A 3GLXA 4LUMA 1A04A 1ZYRF 1EH7A 3FHIB 3H3UA 1CX4A 2Z2SB 2GA1A 5JSRA 3J80Z 4D7SA 5LGUA 1FSEA 2HYFA 1YTYA 4CDGA 3ECHA 2ESNA 2WV0A 2IXHA 3HTUA 1LDDA 2UY9A 3TDUC 3VFZA 2ZFWA 4AVBA 1J2XA 1I1GA 4R52A 1AWCA 5KHIA 1XN7A 3HRSA 1NYWA 5C8WA 3ZMTA 2P8TA 4UBHA 3PNAA 3G73A 2PBIA 4QGMA 2MHFA 4HA8A 5BOXA 1USSA 4LLNA 1LEBA 2FBHA 3BB6A 1ZGJA 3C1DA 2XRNA 4HOBA 2I45A 4A0XA 2M30A 1HW1A 3F8CA 5HOOA 5CADA 2ISYA 3H50A 3O2PE 5LBQA 3F72A 4HDVA 2QLZA 2K4BA 3WE2A 2Z3YA 4IVNA 2ZNYA 3RKYA 1SEFA 4ZZDA 4IEZA 3I64A 1LRHA 1RC6A 3EETA 5JHUA 2O8QA 2V09A 5I8TA 1XE7A 1TBXA 3IRRA 4CYDA 3RIRA 3OD0A 1HKTA 4IF4A 2K4JA 1BBYA 4B29A 4L0YB 5ED4A 3COAC 1O7FA 2RVCA 2PAEA 3IKTA 2IW5A 1XCVA 4ESFA 1SFNA 1Z91A 2XL7A 3FJSA 4EJUA 2NNYA 2D93A 4EJTA 4WK8F 2WTEA 3M8FA 3F8MA 1F9NA 3TKYA 1X82A 1SFUA 5J8FA 1J9IA 1JGSA 2H27A 2XASA 1P4WA 3R4KA 1IZ1A 4QLCU 4JV4A 5L3FA 2WFPA 5D5UB 4XFBA 1OYYA 2VONA 1Z9CA 3U0ZA 4XFIA 4Q4ZF 5LHHA 1QWRA 4ENNA 2LDUA 4LLLA 4GULA 3SCHA 1QXRA 4YIFA 1IN8A 2OPKA 2Y48A 5DCMB 2O8XA 3SHRA 3E5XA 3T5XA 4EM1A 1ZZ9A 4WVZA 1O5LA 1H1IA 1DGRA 4Y17A 4DNCA 3KGLA 3B73A 1XSVA 1R1VA 4HYEA 2PAKA 2PTMA 2QNKA 5HLIA 4OOIA 3SZTA 4GYGA 4OIPF 4XEZA 2D1VA 2ZJ2A 4P9UA 1H9GA 3TO6A 4MHGA 3I59B 2ACJA 3K0LA 4ENKA 1HW5A 2HOEA 2GC2A 3HRUA 4L5JA 5DD4A 3WGGA 1FPQA 2XV4S 4LMYA 5FLIA 4L18B 3HRMA 3P9KA 4M74A 2RQPA 1CAUB 3CUQC 1K79A 4IHSA 5DYMA 5KHGA 1EPZA 3ACLA 2C0ZA 1BI3A 4G6DA 3G7DA 4Q0UA 4IEOA 4KWKA 5AVPA 1K7AA 4EWEA 3WODF 3I71A 1BJAA 2ZKLA 3ZQ7A 3H8UA 4LLGF 4KIBA 3RKXA 2CWEA 1F5TA 1B9NA 4DINB 2H0VA 4IRIA 2QWWA 3WGHA 4CXFA 4N0BA 2FF4A 4JTOA 4U0VA 4E70A 3PVBB 3ECOA 1U12A 3USSA 4LFUA 4A6DA 4I0BA 4L9NA 4LB5A 2MLGA 2LF8A 1GHCA 2CG4A 1ZRDA 2Z9OA 3RKWA 1XDSA 4HF2A 4FHTA 4GYIA 2GIVA 4G8XA 4G7HF 3H1MA 3BWGA 2XAQA 1XRUA 2RN7A 2R7DA 2CV6A 1P6RA 1Z6TA 2W25A 1CAVA 3LWFA 2EWNA 2D5FA 1CAVB 2HWVA 3KMHA 1S7AA 2GC1A 3FM5A 2VODA 1YQAA 4M71A 4ZYHA 3E6CC 4GGGA 2EA4A 4L5IA 3I53A 1D8KA 2W57A 2RKHA 4UXNA 1XD7A 3WU0A 1G6NA 5KBFA 1OD5A 2STTA 2Q30A 4GXOA 1QGPA 1FNNA 3DKWA 1QQIA 5FD5A 1RNLA 4RS8A 4JBAA 3CLPA 4KYWA 1OKRA 2QUFA 1MGTA 4XFHA 1YW8A 4LLOA 2OA4A 5CVUA 1V70A 1V4RA 3D5LA 1SFXA 1UD1A 1E17A 1DPRA 4K8FA 1IAWA 4UVBA 3BPXA 1O4TA 4RD7A 4KUMA 2QJVA 2Z69A 2O6GE 3EHKA 4IESA 2LNBA 1VP6A 3O6BB 4L0ZB 1XCBA 3MEXA 5KVRA 4N9IA 4EQQA 3BOQA 4J1XA 2J5PA 3FZ3A 1R5HA 2BBYA 4U88A 1ZZ7A 4PIXA 1FBQA 2P17A 1KQ9A 3GFJA 1Z6RA 3OCPA 2TDXA 4XETA 4FBFA 2JTVA 3AAFA 5FQ0A 2G9WA 4LG0A 4YIIA 5BV6A 5D5VB 3CL1A 4Q47A 2RGVA 2UZKA 5HDKA 3P7NA 4XSXF 1GVJA 4XF1A 3BZ6A 5JR7B 5DUKA 3I7DA 2X0LA 4ASNA 1ZZ6A 3GYHX 1ZGAA 4LD5A 3H1WA 1YFYA 1SD7A 2IXLA 2NAZA 4KA4A 5E20A 4L11A 5EFUA 2COMA 4X6RB 2AXLA 3CUQA 1LB2A 2KJBA 2B0LA 5CYVA 2QDRA 4XBFA 1D3YA 1HKQA 2GXGA 3H1YA 3MYXA 5F64A 2P5LC 3T8TA 2IA1A 2STWA 4CGZA 3WU1B 2Y75A 4BH9A 4AIJA 1UFMA 5L3DA 2KJCA 4D0PA 3KP4A 4BNCA 1Y9QA 3LA7A 5EZWA 2EFWA 1NE4A 3QU3A 4M6XA 1FZPB 4F8AA 4XRFA 5L3EA 5E1RA 1PUEE 3HQXA 3IC7A 4KL1A 4AXOA 3M70A 3ISPA 4IEXA 4E2QA 3JW4A 2XKPA 3F23A 5E8GA 1T39A 1O3QA 2VXZA 3BY6A 3RDIA 5BPIA 1OI6A 4A2UA 4OMYA 3K2ZA 4MGZE 3LA2A 3WG9A 3O14A 2K7LA 4JK1X 4G94A 4PCQA 2UWMA 2EVXA 3V4GA 2H09A 5FLHA 1NZCA 3SFZA 3ES1A 2DFIA 3HHGA 3TNQA 1FI2A 1U5TA 1ZH5A 4UV8A 1GQGA 4YSFA 3F8BA 4J1WA 1S29A 3VHRA 1PP7U 1W7PA 2OA2A 2FRHA 1X8MA 5A2QK 2OQGA 4HLYA 4ORFA 1ZG5A 2FBIA 5D1IA 3OGJA 1CGPA 3OTFA 1X8EA 3CUQB 5J8CA 1LVAA 3QPHA 3JZVA 5CVVA 3HOTA 1VJ2A 5CLSA 2IPQX 3ES4A 2MNGA 1ZLKA 1T6SA 5BPDA 3T1BA 5E1ZB 2FE3A 2IT0A 2QVSB 5I8SA 4KFCA 3VODA 2Y0OA 1JHHA 3CF6E 4UVCA 4HMZA 3U10A 5DCFA 5I0RA 2P7VB 3RYRA 5I93A 1STZA 2EFOA 5FCCA 4NQWA 1B9MA 4E2GA 3CO7C 3MCZA 2DLLA 4KU7A 1J59A 3FHZA 5C6CA 1ON1A 5CVIA 3LAGA 2MC3A 3EJKA 2BEOA 4ENMA 2DPUA 1XE8A 1CF7A 1SMTA 2PMHA 2YX4A 2EV5A 3BJ6A 3GF2A 3IIAA 2H6CA 5T3NA 2K02A 3QP5A 2Z33A 2EA7A 5L3CA 5CJ9A 1UCXA 2RDPA 4NHJA 1TLHB 1C0WA 1NE6A 1QPMA 3H7JA 2M45A 3QPTA 4P55A 5DV5A 3V8KA 3I59A 3GZ6A 4MH0E 2D2WA 4QGNA 4S04A 1SAXA 3IBMA 4IEQA 2ZXJA 1P4XA 1W5SA 3FMQA 1ZRRA 2K0GA 4JVAA 4RAYA 2P6TA 4KT5C 1IRFA 4PJYA 3HUGA 3C3VA 4EWAA 5ILSA 2OD5A 3GO5A 3VOEA 3CTAA 3IKVA 1WSUA 4IEUA 2GWRA 2VBXA 2A6EF 2A6HF 2HYGD 3F6VA 1RTVA 4EWDA 2HFHA 4HF0A 2BNNA 2G7UA 3IRQA 1Q5OA 3NSTA 4FX4A 5BY5A 2ZO4A 4I7HA 1F4KA 1K6OA 1H9TA 3ZP5A 4AQ6A 2DK8A 4QMAA 3ML6A 1FY7A 3R0JA 4WXHA 2AS5F 1YFXA 1W5TA 2LSOA 3S7EA 3RZZA 1O57A 4YARA 4PIZA 4B8XA 1YG2A 3GX4X 2PAMA 5BQTA 2XUBA 2XVCA 1GQHA 4YFNF 4A6EA 4U0WA 2V1XA 4PGGA 2HKOA 1NXMA 2ATFA 2IP2A 1XMKA 1QBJA 2FXAA 2UY8A 1ZVFA 2JSCA 2HEOA 4OFGA 2PMUA 4IHTA 3BP8A 2OYZA 3QACA 3KLOA 3KP3A 1PMIA 1FYKA 2BYVE 4QM9A 2A61A 2YU3A 1O3RA 1O3TA 5LGNA 2YSRA 1O5UA 4H7LA 3W6JB 1YO5C 4IPAA 4KU8A 4LEJA 1J3QA 1CAXA 2EJRA 3SZPA 4BHPA 1Y3TA 4FX0A 2A69F 2QYOA 3WW1A 2EAAA 1G3WA 3TOBA 2V1UA 1ULYA 1BIAA 4HX8A 3RYPA 3FXUA 1U3EM 3DXJF 3W6KB 4BQAA 3DV8A 2LKPA 1FOKA 2L3DA 2QCSB 1EH6A 2EK5A 3IL2A 4RB3C 2Q0OA 2QQBA 3K1MA 2PFWA 5JR3A 3ZMVA 2XGXA 2NRAC 2VE8A 2O61A 2EB7A 3WTWC 1IF1A 2L02A 3MDPA 4MTEA 2P4WA 1KU9A 5H6QA 1TQPA 5HS7A 2BGCA 5IT9Z 2NS0A 2F5EA 4I01A 2BNMA 5HI0A 2DQRA 4OINF 2ZMEA 3U1DA 5DCMA 2W24A 1MZBA 3JSOA 3S0MA 5FLJA 1B1BA 4CO8A 1ZARA 1LR5A 3EYYA 3FZVA 4R79A 5E1XA 5FQ0B 1TQIA 2PI0A 1ZLJA 2D40A 1DGWA 3E6BA 1P92A 2E1CA 2K9ZA 5I0SA 2P5VA 2RV8A 4O9EA 4WF2A 2V1DA 3N97A 2FA5A 1BN5A 2UYAA 1OYWA 5EEHA 2E1NA 1JE8A 4CICA 3ZMZA 1RGSA 1E2XA 3SCFA 2PHDA 1ZG3A 3HOSA 3BALA 1FLIA 3V7SA 3HSEA 4UHTA 5L3BA 5J7MA 2XAHA 1OMIA 2GC3A 3EUHA 5LLQA 4ZH4F 4HLXA 2DBBA 2YR2A 4L9JA 1BC8C 1RUOA 4MQ9F 1YUDA 3L9FA 1IN5A 1KYWA 1ZX5A 4UXAA 2JPCA 4IEWA 2OU2A 4YRDA 5F1RA 3BPVA 2B9UA 3IHUA 1XGNA 5CVJA 4FT8A 4XSZF 2CW0F 1EH8A 4CZZA 2DPDA 3EQEA 1AOYA 3ROUA 3GFLA 2PQQA 2KRFA 3F8FA 1W7PD 4IXAA 5J48A 1V3FA 5I0UA 4MTDA 3HYIA 3ULQB 3GVAA 2RNJA 4YFKF 4EMSA 2QQ9A 2ESHA 2FEZA 5FLXK 4LGWA 2ET1A 1RUNA 2ZNZA 3EDPA 2FQ3A 4RGRA 3TO9A 5D5XB 1MDMA 2D5HA 5LHGA 3KP5A 5HS8A 2HR3A 1Q1HA 2EFPA 2VOPA 3CJXA 2H94A 4Y15A 4YYOA 5I0TA 1RI7A 3LWCA 2F4PA 1R00A 3KZYA 2E7XA 1HSJA 3ZDSA 1P2FA 1Z05A 1PDNC 1XDUA 1FP2A 2O1QA 2ETHA 3OOPA 3FXRA 4A5MA 5DDGA 3SQNA 1Q3EA 1OYIA 4UBGA 4LJZF 1U5TC 5EEGA 1LDJA 5FD6A 1MD0A 4KWLA 1I6XA 3ABUA 4ZYGA 3BCWA 3GW2A 1YS7A 1ONVA 3LSTA 1K78A 5BS6A 3GFIA 1S6LA 1CAWB 1P4AA 4ESJA 3WTUC 1DPUA 4R8HA 2ZKZA 2G7HA 2IRFG 4ENJA 3KZZA 1XGSA 3DEUA 2PN6A 4HZFA 3HHHA 2NYXA 5AIQA 3L2HA 3SXWA 2H6BA 3J80K 1TTYA 4P9FA 1O3SA 1FP1D 3RJPA 1R7JA 1WI9A 5I8YA 4ONUA 4PGHA 1X3UA 4LULA 3J81Z 4BYYA 5E16A 3QOPA 3WTVC 5HDNA 2E7WA 4UUVA 2GZWA 1WGPA 1J75A 1B4AA 3WW4A 1QZZA 4XFFA 1HW2A 4WZCA 1UHMA 4OIQF 3IWZA 3KP6A 2IXIA 4LK0F 1USTA 2Q4SA 5BUVA 3MWMA 1U5TB 2L01A 1REPC 3N4MA 5TJJA 4HV6A 2HJIA 2RC4A 4HVRA 2A68F 1UHWA 4AVCA 2W84A 2MBFA 1UIJA 4KMUX 1XSDA 3DPLC 3Q9SA 5E1WA 4KNYA 5J3UA 4UNOA 2PLYA 1QY4A 3P9CA 4A5NA 5FPZA 4GCVA 1Z1DA 3LFKA 5JCTA 2P6SA 3TDZC 2MLKA 4K2EA 1PM7A 1JUHA 4MGYE 3E97A 1UB9A 4DQ2A 3SHFA 4HSJA 3C18A 4PIYA 1D8JA 4WBBA 1R58A 1QO0D 2HTSA 3ZMUA 4AVPA 2XAFA 3ZMSA 2B8MA 4KICA 4ZZLA 3WW3A 5BXXA 3HT2A 2GA2A 4ESBA 5K5QA 1WKMA 4F7ZA 2Y0MA 3L2CA 4WCGA 3H9AA 3F8NA 4Y13A 5L3GA 5FB2A 4XLNF 2ADUA 3R0AA 3U11A 4WWCA 1PP8F 4BAYA 1BIBA 3ELKA 1UPIA 2EV0A 3I54A 3KLNA 2YPRA 2ETEA 4HBNA 1R23A 1HQCA 2OZJA 4KWJA 3NVCA 3MPBA 4ZYEA 1DZTA 3KGZA 1SD6A 2K86A 3WTXC 3FMRA 3REOA 1HSTA 4PDKA 4ON0A 5LGTA 1K78B 1WRJA 1MJAA 4WXDA 2MH9A 3LQRA 5HVQC 1G3SA 1I1SA 3HSFA 1KQ0A 1LEAA 1O7LA 3K9TA 3UKTA 1T98A 2XAGA 4MEXF 4AWXB 5E17F 3RPQA 2IVMA 4PZJA 2UXXA 3F21A 2KIUA 1KQ8A 4EJWA 2EFNA 4HV5A 1OFNA 2X4HA 3BJOA 1B59A 3F6OA 1YLFA 3V8JA 6PAXA 4JTNA 5JSPA 1BI2A 3H3ZA 1FBUA 2DQLA 4BXUA 4WX9A 4D7TA 2CGPA 1HKSA 3BROA 4ZU7A 3KEOA 2OBPA 2O0YA 4KIGA 3U2RA 4HVOA 1DZRA 3FMSA 3TQNA 1R1TA 4HN0A 1XGOA 2HQNA 2GXBA 4L9TA 2Z99A 3GFMA 1U8RA 2MD5A 4Q48A 4QX5A 4LA2A 4LG0B 4I3PA 5D4RA 4O5VA 1BM9A 3PQJA 2O3FA 1NHAA 1R36A 4U7BA 4XFCA 1I27A 2Z5UA 3I58A 3NW4A 3K69A 1IXCA 2DAOA 3LAPA 1HXDA 5J6XA 2ZMEB 1CAXB 3OV8A 4XF3A 2XKOA 5CVRA 2IXKA 3UKNA 2CFXA 1QNTA 3K1PA 1KU3A 5AIPA 3I0TA 4CHUA 5DEQA 2MA3A 4L9VA 2VC1A 1KA8A 2FQPA 2HZTA 4QM8A 1YLLA 2FMYA 3BDDA 1YS6A 2KIMA 3I4PA 1LNWA 4RB2C 2F5CA 5D8LB 3OF1A 4HQMA 3FF5A 4I09A 2VE9A 1KYZA 1TQ5A 4IEYA 3KFWX 1BI0A 2A3SA 2DI3A 3FXQA 4O6JA 5KK1A 3R61A 4LK1F 2UXNA 2V9VA 4EV0A 1J7KA 2QM3A 3JTGA 5FFZA 4H0EA 3F3XA 2N7GA 1TQMA 4TV7A 2VQAA 2PA7A 3ZN1A 1FSHA 2DU9A 2DW4A 3GXOA 4UVAA 5ICGA 4BIFA 1S8NA 3FFQA 2EV6A 3LAJA 1ZRCA 2VECA 1RL3A 3HRTA 2LF7A 2HQRA 1ZRFA 3B02A 1B6AA 4G6QA 1ZNPA 3EYIA 1G3YA 3QAHA 2QBYB 4MZUA 1R1UA 5JI6A 3DL3A 5BMZA 4HLTA 1GXQA 3L00A 1EV7A 2K27A 4O9GA 2PFBA 4MGIE 1ZZBA 5LEJA 2XIGA 2XLAA 4I2OA 4MGRA 2FU4A 3GEZA 4AIKA 2QENA 2EA2A 4JQFA 4ZU4A 3DQVC 2XAJA 2A5YB 4META 1TW2A 3QRFF 4NVPA 4XF4A 4XFAA 1MKMA 3WW2A 1TNSA 4HX4A 4IEPA 1L3LA 1WQ2A 5FGMA 2M5WA 1TW3A 1LJ9A 1IXSB 4YG2F 4LA3A 5KHJA 4IERA 5D5WB 4QXKA 2IXJA 3P9IA 5HLGA 3TNPB 5FPXA 1WWXA 2CAVA 1J3PA 1ZAOA 3MAJA 4OIRF 2DTRA 4QGLA 4IETA 5AONA 4Q0VA 4EM0B 3IDCB 3KP7A 3D0JA 1OR7A 5JVTA 2HDCA 2VBZA 3VB2A 1CAWA 3V8LA 4MUVA 1ZZCA 4G9YA 5FFXA 3RYKA 3D82A 1MDMB 2FOKA 4HN1A 2DO7A 4G7ZF 3T8RA 3RTRA 3HT1A 1T0FA 4LUKA 4Z07A 2L4AA 3NEUA 2IA2A 3L09A 1ZREA 1CAUA 4EROA 1MJBA 2BNOA 1CF7B 1ZN2A 2DK5A 2O03A 1DUXC 4BHBA 3ERED 4IEVA 3L7WA 1QZYA 4WXCA 3KETA 4M9XA 4R1HA 4U7DA 2JRTA 4A12A 1F1ZA 2P7CB 2IA0A 4UV9A 2Q0AA 4M6YA 5K5OA 5BPXA 4IRHA 1U78A 4X6QB 1ZZ8A 2Q1ZB 1BI1A 4ZU5A 1L3JA 4OLLA 2YX7A 1UIKA 1U2WA 4AIHA 3RNSA 3H92A 1YW7A 1ODDA 4P9GA 1LKNA 4RGSA 4IJAA 4A0ZA 1HBXG 3EQLF 3PQKA 2QBYA 3E6DA 5DUIA 3TGNA 3GZ5A 4MX3A 4HBLA 3HIFA 5JAXA 4YFXF 4EM2A 3ST7A 4GO1A 2XLGA 3M7GA 3ELNA 4Q5SF 1J3RA 4L2NA 5K8SA 3KP2A 3NL1A 1G4DA 1L0OC 3WTSC 5IT9K 1YFWA 3HSRA 4Q0QA 1J0RA 4M9ZA 2VOOA 4MQVA 2OQRA 3GBFA 1FX7A 4HAMA 4AVAA 3MZYA 3UKVA 3HTSB 4FAHA 2QZ8A 2ISZA 3RPUA 4Z2YA 1T38A 4Q29A 1X7NA 3CLOA 3MZHA 1YW9A 3IWFA 1ZG1A 3E5UA 4N9HA 1SQ4A 4RGXA 5D4SA 5HDGA 3TO7A 4B09A 2OAZA 3J7AO 3FM3A 3EO6A 1Q43A 4EVIA 5LHIA 4OIOF 5H6RA 4XLPF 1J58A 2MPFA 3MFKA 3FX3A 2FNPA 3LA3A 1SD4A 4OU0A 4O3MA 2OZUA 3U9GA 4HF1A 2GQQA 1FC3A 3E5QA 4Q0SA 3GYDA 4XF0A 1J5YA 3KSCA 1FBSA 2D45A 1IUYA 5K5RA 3M1EA 2IJLA 4HX7A 2VT2A 4RGUA 2QVOA 3C3WA 2KKOA 2B5HA 3ZMDA 2JT1A 3H7YA 3FE5A 1RIOH 2L54A 5CU1A 3WE3A 4LTAA 2CAUA 2ET7A 5F6FA 3ZPLA 1YIOA 4BHCA 2VN2A 4P96A 2V6CA 2CQKA 4U0YA 1IN6A 2OZ6A 5DD8A 2IC1A 2CSOA 5D6FA 3JSPA 4HSLA 5LRRA 4KIFA 3CEWA 4NB5A 5A2QZ 1SMYF 1LQ1A 5KHKA 5K1YA 2GH2A 2ZBKA 3DP7A 4P5OA 1KU2A 2F2EA 3Q5FA 4MV2A 4Z82A 1S7OA 5ICFA 4QWQA 3JAMZ 3DFGA 5ERIA 3DPTA 4S05A 2KXLA 3M3IA 2GC0A 1UW8A 1FYMA 1IW7F 2FMLA 3BPZA 2C6YA 2HGCA 4RB1A 2PHLA 1WA4A 3NRVA 1FXZA 5LRSA 2MH2A 3PFIA 2F5FA 1RZ4A 2XHKA 3TOAA 3LZZA 5HS9A 2WWYA 2VBWA 1IPKA 3K1NA 4I98B 4G7OF 1I5ZA 1G3TA 2BE5F 1XMAA 2FSWA 3T0YA 2CO5A 1YWKA 5LEKA 2IXCA 4M73A 2VPVA 5ILUA 4XFGA 2DCTA 2M8EA 3V7CA 5H20A 2DT5A 1UCRA 1BOAA 3NQOA 3E3VA 5JSOA 5D6EA 2PEXA 1YFUA 2JPBA 4MNUA 1GXPA 3C7JA 3CDHA 2Q2EA 2D1HA 2PQ8A 1BC7C 2JZYA
chains in the Genus database with same CATH superfamily
4W6WA 3SISA 4Q0PA 2PHUA 5IUQA 3T30A 4DY3A 1NY72 2ADDA 1W6NA 2YPJA 3O3KA 3DUIA 2F5DA 3WTTC 4K6BA 2G9FA 1R4NB 2PJPA 4A3LJ 4EGZA 1SDWA 5GP9A 1QDOA 2HYXA 1NH3A 2QQVA 3WR0A 3LDBA 3ZIXA 3SXYA 2A75A 2W00A 2YYOA 3Q9VA 2ELKA 4RAZA 3KM5A 1PX4A 3KT7A 5L7OA 2KIFA 2RHPA 1AA7A 1X58A 1U5ZA 4G6TB 1DF0A 1I3HA 4CTEA 1IPJA 3WP5A 4XTPA 3WT3A 2E19A 3JREA 4ITVA 3AP4A 4OMCA 2VJXA 1K5MA 3T4VA 3K4MA 2V4VA 2XWBB 4E8CA 2EQRA 4BDVB 4Q4V2 2ME0A 4BZ4A 1R71A 2YU9J 5C8CB 1RUG2 4K8RB 4WM7B 3CU7A 4OMDA 1WMXA 2WC2A 3NJZA 1DDNA 1MJ9A 3DF8A 5CB7A 4AGRA 2VL8A 3P3NA 2ZGKA 2FNAA 1TNTA 1F8VA 3GWZA 2IZWA 1QU3A 4EEFG 2C9KA 4TN7A 4KN4X 2VT3A 3HZJA 3CCQI 4I76A 4BLIA 4RGAA 4NIIA 3GUDA 3S5QA 2HTJA 5FPLA 3GBGA 5IT3A 1MZ5A 1VR3A 4GH4A 3JRHA 1ON2A 4HSRA 1CWPA 3SDGA 4E7JA 2PG4A 2L5QA 2V79A 4QXBA 2FBKA 1LOGA 1LU2A 2CQ7A 1COV2 1VNDA 3KCCA 1FMD3 5ICCA 2M1BA 3NKGA 2Q8KA 1W4MA 3L1PA 3S93A 3C7OA 1KFXL 3F22A 1DG6A 5FZAA 2Q1FA 1XSXA 4F3JA 2Z1DA 3I2OA 2QQAA 4M72A 2J42A 4MGSA 4HVQA 4JDNA 2KRHA 2XGEA 2W91A 2ZAAA 3J81K 1KXGA 2WY7Q 5GPAA 3GLXA 4AI1A 3DKYA 2Z2SB 2GA1A 3J80Z 2OQ7A 4D7SA 2JE9A 4YZ1A 1ODNA 4BKXA 1YTYA 2OUHA 4RS5B 3C2UA 4LHKA 1HJGA 2YXSA 2QKLB 2DUPA 3CHXA 3CJIB 2ZJQF 2WS93 5CISA 4XK4A 4F93B 4ASMB 2I10A 2RJKA 3AMNA 4IV1C 4MVTA 1FMD2 1XN7A 1COV3 4YG6A 3ZMTA 1R4MB 3G1MA 4QB2A 1RUI1 4QGMA 2W87A 3G1LA 2QQLA 3D6EA 1LEBA 1MBEA 4DPNA 1YQ5A 3FXJA 1VRBA 3I3EA 1ZGJA 1GP5A 5FOBB 2DUOA 3LDRA 3QQAA 2IGNA 1H1AA 3F8CA 1HLVA 1RMU3 1Y8QB 2ISYA 3MPPG 2BRTA 2XOMA 5LBQA 3F72A 5EGOA 2GMEA 2DDBA 1RESA 3ORJA 3H36A 3RKYA 3PO3J 4AFAA 2Z79A 3T2OA 3I64A 2JB8A 1LRHA 3A02A 3CP8A 4IQ4A 3MKWB 2JG9C 3EETA 3S5AA 5JHUA 2V09A 1XE7A 1TBXA 3IRRA 3OD0A 4XUNA 4N4NB 1OJLA 2J1VA 3GBWA 3ZFEB 1MQTB 4QDQA 1CIYA 1BBYA 4WM8A 3AL0B 1O7FA 4NHXA 2FOWA 3DTKA 2DU1A 3NV1A 3WY6A 2XGCA 3NQHA 5IVBA 1XTAA 1MBKA 4EJTA 1XOYA 2RM23 2WA3A 4W50A 1SFUA 5J8FA 1AYM3 2H27A 3UR3C 4OZOA 1P4WA 3OUHA 1EF4A 4C30A 3R4KA 1JZ4A 5DZEA 3LSIA 4QLCU 2XAUA 3IPVA 1XQNA 2RS53 4H7MA 3TN92 3TL4X 1OYYA 4FCYA 3ZYPA 2OT7A 4RFRB 4WM7C 1V5FA 3SCHA 1IG0A 4IGQA 4YIFA 2Y48A 3BR3A 3AYEA 3CF2A 2M8GX 4XXPA 2BV4A 3C2GA 1JI6A 1H1IA 3KGLA 4LE4A 1VQLI 1YC61 2QNKA 3SZTA 4ZXKA 4P9UA 5C70A 2GC2A 3RCOA 4Y26A 2Y30A 4L5JA 3T08A 1DGWY 3PIPF 3WGGA 4LMYA 5FLIA 4M74A 2RQPA 2NS7A 2RS52 4IHSA 5EP9A 1ZK8A 4L92A 3FBMA 2C0ZA 2ZHNA 4Q0UA 3VBOA 2X53S 4A7KA 3DLAA 1W0NA 4EWEA 3WODF 2YUSA 2UWCA 3GHNA 5DDJ3 2VZTA 1F5TA 2YU1A 1B9NA 4DINB 4QX1A 2H0VA 2G9ZA 4BLJA 4IRIA 4LBOA 4CXFA 2K46A 4X8NA 1D1BA 4JQRA 3ZO0B 2XB0X 4JTOA 5L9VA 3GZNB 4DMIA 4BQ1A 4LFUA 4M3EA 4W6XA 4A6DA 4I0BA 4LOCA 2B63J 3ZN4A 4LB5A 1JHJA 2ZEZA 2LF8A 3SH4A 2CG4A 1WKYA 2Y69H 3FFZA 4HF2A 5FZ7A 2LTNA 2QQUA 3IKWA 2WBMA 4IW3A 2XAQA 1XRUA 2RN7A 2CV6A 1ZQ3P 3LWFA 4CU8A 1W6QB 2DFBA 3S1NJ 2VODA 5FZIA 4DS0A 1PIV3 3HJEA 1TWHJ 1D8KA 3LDKA 3G1OA 3ZQLA 3J7ZI 2QQIA 1QGPA 1DU6A 3CCUI 2C9AA 3DKWA 4NWVA 1VBE3 4RS8A 3KCXA 3CLPA 1N78A 1QJY1 5A3WA 3VZMA 1U5XA 4XBQA 1JODA 3BOPA 2PQSA 4LLOA 5CVUA 1QPIA 1V70A 3D5LA 3PUFA 1E17A 4A3IJ 3S32A 1S0DA 2Y8KA 2E2IJ 3AJYA 1PK6B 2ZEWA 4S2GA 2WNUB 2Z69A 1DQ2A 4AVVA 5IK7A 3WV6A 4B1RA 4N53B 5KVRA 1Q8QA 2RS51 5HV0A 3GCWA 1OOPA 4U88A 2QGUA 5BNOA 1KQ9A 1NUKA 1JT6A 3LOBA 3WLUA 3AAFA 3E1F1 4E4HA 4GKXA 1JTYA 5D5VB 3CL1A 4Y3OA 1MS3A 3HXLA 2E60A 4QX7A 3WG7H 4NOTA 4XRSG 2X1EA 2BY0A 4MHUA 5B3SH 5I0DA 5JR7B 1QKQA 3BG7A 3I7DA 2X0LA 4ASNA 4ARXA 1ZGAA 3H1WA 1JUSA 5C4WA 2COMA 2OV7A 2AXLA 3CUQA 4JX4A 3GGLA 2H8WA 4UB8C 1NK3P 1Z0HA 5FY0A 1RUJ1 2XH6A 2I8DA 3FN9A 1IUFA 1ASJ2 3H9JA 4YFZA 2E32A 2STWA 2CGNA 2Y75A 2R5ZB 2JUCA 5A6XA 3I3QA 1NE4A 1Y8RB 4E7ZA 4Q4X3 4HFSA 1JH5A 4J6GA 5E1RA 3HQXA 1OC1A 1XB9A 4AXOA 1S9HA 2WAEA 5ISLA 3S3OA 4UYBA 2K9NA 3VHOA 2P37A 4E2QA 5E8GA 3FLRA 4YRVA 3RI8A 4UW5A 3BY6A 2D6PA 1DQ0A 4A2UA 4OMYA 3H3VK 3K2ZA 4MGZE 2ZGPA 2QQKA 3LA2A 3WG9A 3ZMOA 3BVCA 2RS12 3V65A 3O14A 4HK8A 1R5ID 3UETA 3WU2C 4G94A 4XKBA 5AFBA 1W04A 4NIAA 4EN8B 3FLTA 1NZCA 4XMYA 3ES1A 2DFIA 3TNQA 1QRYA 3H1CA 3I55I 3J26N 4LO4B 2E7QA 3QBQA 5CFCC 2LYCA 1UOFA 1VBB2 1UZWA 5A70A 1APNA 3WQBA 3OYIA 1PP7U 1EUUA 5A2QK 4AOCA 1H2KA 3VBFB 1D0YA 3J7LA 1X8EA 4XLAA 3B93A 5C71A 3FBNB 3HNMA 1QJY3 3JZVA 3QPHA 1T0FC 4FFIA 3AB0A 1Y9MA 5L9RA 1OLMA 1T6SA 1VFCA 2IT0A 1RUC3 2VM9A 2Y0OA 1JHHA 5F8PA 1H2MA 3MV11 3M4FA 1HXS1 3K6GA 4RR3B 2P7VB 3O1VA 3W59A 5I93A 3G4SI 3AG3H 4XOGA 2E26A 5JVVA 4DFSA 1B9MA 4E2GA 3CO7C 4KU7A 5C6CA 5CVIA 1YJWI 3GTLJ 2MC3A 1JJ8C 1QJU1 3RI9A 2JVHA 1EV11 2V7FA 4TZDA 1XBFA 2D7FA 1WJBA 3BJ6A 5FROA 3GJAA 3GF2A 1LOEA 1T6BX 3IIAA 4N53A 3QP5A 5CJ9A 3BTJA 4N7IA 2RDPA 4RGKA 1H9WA 1I3QJ 1ORKA 3IAM2 2M45A 3QPTA 3OG2A 4FP2A 2PLV3 1AHSA 1HN0A 3I59A 3GZ6A 3A22A 4FQ4A 4JZRA 4S04A 1SAXA 1YRZA 1GUUA 4B7KA 2ZXJA 3THTA 1AR93 1FV3A 1BBT2 2B7EA 4KT5C 4PJYA 4AGGA 3C3VA 1OOPC 4N90A 3VOEA 3CTAA 3AKRA 2DURA 2XVKA 1O8PA 4E8DA 2VKHA 4D0QA 1GZTA 1OSGA 4XPVA 1WLWA 3RWKX 3UJQA 1H2NA 1IGNA 2ZO4A 1J83A 4SBVA 2L7MP 1H9TA 4XHXA 1PMJX 1FOXA 3ZFFB 3WP3A 3U4XA 4QMAA 4WXHA 1ACIA 3VBSA 1W5TA 4UI9L 2LSOA 3RZZA 1O57A 4YARA 1X4PA 4PIZA 5LASA 3ZYFA 4B8XA 1YG2A 3GX4X 2ARCA 3TN91 5BYNA 2XVCA 3I2GA 1GQHA 4E7HA 3APBA 3TYJA 1XMKA 1CESA 1JTXA 1QBJA 2ID3A 3POWA 4V2GA 1ZBE2 2F5VA 3JRGA 3QACA 3KLOA 1FYKA 4YELA 4E27A 1NOVA 1BR1A 1O3RA 2EXHA 2YSRA 1E3OC 4LEJA 1J3QA 1MSFC 1CAXA 1D2QA 3SZPA 4BHPA 4BMEA 3K48A 2A69F 2EAAA 1QZEA 3SDBA 1ULYA 1JHNA 3ZXSA 3MV01 4BEHA 1V00A 4XOPA 5M3MJ 1YQ8A 5FZLA 2W5FA 2LKPA 1W6NB 2QCSB 3IL2A 2Q0OA 2K85A 3EYPA 3CF5F 3ZMVA 2NXNB 3A0BC 4CCKA 3ZQFA 2L02A 3NJVA 2E36A 1XYPA 1TQPA 2KT0A 5HS7A 2BGCA 2Q8CA 3IH4A 2X9DA 2VOVA 1GWKA 3J7AY 3U1DA 2GNDA 2JDPA 2OF7A 3OL4A 4CO8A 3FL7A 2PX9A 4RS5A 1ZARA 3EYYA 4BE0A 5E1XA 5FQ0B 2XQRA 2NLRA 4XCBA 3SEQA 1LOAA 5FUNA 4BQWA 1WHUA 1M4WA 4BISA 4A3BJ 2E1CA 3KB5A 3FKJA 2WYFA 3VPRA 4ZTJA 2RV8A 1ULCA 4O9EA 4GALA 3N97A 4RR3C 4LG3A 2HZDA 2UYAA 3ZGKA 5EEHA 3T2TA 4CICA 2VUMJ 4NBQA 3SCFA 5APAA 1MZFA 1Y39A 1U0JA 1MBJA 3EUHA 5LLQA 3O1UA 3RJ2X 3VBUB 2XWJB 1YUDA 4COYA 2XUMA 1ZX5A 1RHI2 3UGGA 5GZFA 4V2FA 4BJ0A 1ODMA 4OWRB 1UMIA 2V5YA 4Z8BA 5FYHA 1RUH3 3U78A 3A01A 5CVJA 2BOIA 2HYKA 2DPDA 4LO8A 1AOYA 2JX9A 4K9SA 5FO8B 3GFLA 3F8FA 2R072 1H8TA 1BOBA 4MTDA 3WF1A 1DGLA 1EAH2 3E1SA 3H8OA 3QYFA 3POSA 1WZ2A 4QQHA 3OOXA 2QQ9A 4A44A 1B35C 2ET1A 3GZEA 5BNNC 1R093 2FQ3A 3C2BA 4RGRA 4CU7A 5T5OA 5J98B 5HS8A 1Q1HA 1OISA 1RKWA 2VOPA 1YE9A 1BZWA 1TNFA 1W90A 2H94A 1OVPA 4PJ0C 1X50A 4F55A 2HWE3 3DWLE 2Y6LA 2BXZA 3T3YA 2CRGA 3KZYA 3OYMA 4A3ZA 1HSJA 4QPGB 3P5BA 1P2FA 3H5RA 1Z05A 3MZ8A 2O1QA 2ETHA 3QPSA 3FXRA 1RXGA 3BQYA 5DDGA 1OYIA 4UBGA 1UMHA 1MMGA 2KHMA 1I6XA 3SC7X 4ZYGA 5HODA 1YS7A 1ONVA 2ICWG 3LSTA 1K78A 2VMFA 1VRH1 3H3LA 5A7NA 4HSTA 2QQPA 4BJTA 4FPEA 1DPUA 1Z7S2 1JW6A 1FOD2 4EZHA 2I74A 1TWAJ 1QHDA 1WCUA 2IRFG 3KZZA 1F4AA 3RZHA 1UX6A 2PMWB 3OOUA 3L2HA 3SXWA 2H6BA 4RMNA 3IUOA 1XYOA 4Q4X2 1FP1D 3RJPA 3S3MA 5IFPA 1X4OA 1X3UA 4LULA 3VYRB 3K75B 5HDNA 4UUVA 2EZHA 2GZWA 1B4AA 1GV2A 3WW4A 2DDAA 2XF7A 2W48A 5FO9B 1JYWA 2W95A 1VRH2 3PTRB 4J01A 4YM3A 2OXBA 1U5TB 1REPC 5TJJA 3P5JA 3P3PA 2RC4A 2DA1A 2ZMKA 1QQP1 4CPBA 4LBNA 4AVCA 5J36A 5CEHA 2W84A 3LEIA 4P9YA 3W5MA 3Q9SA 1YQ6A 4KNYA 4BXFA 3SEEA 2ZX1A 1QJFA 5HNFA 2A6VA 2TNFA 4K40A 2B46X 4QQLA 1ONAA 3VKLA 2GALA 4XRSA 4MGYE 3E97A 3KF3A 1UB9A 4DQ2A 1AR71 4HSJA 1R58A 2R061 1QO0D 3WD5A 3ZMUA 4RHV3 3C7GA 1OQDA 3CMEI 2ZTNA 2VVFA 1IRXA 3ZMSA 4JGYA 4I0WB 4CDWA 4C90A 1OQEA 2B8MA 4KICA 1HB4A 3PUIA 3WW3A 4QPOA 3HM5A 5C8CC 5DAQA 2GA2A 3TEYA 5B1AH 1WKMA 4F7ZA 2Y0MA 3L2CA 2D98A 4NO4A 5FMBA 4FFHA 3BR1A 4CEWA 1QJU3 3F8NA 4AVSA 2R071 3J8F2 1JUPA 4WWCA 1VLNA 5CFDC 2ZA9A 1UPIA 3JR9A 2EV0A 3S17J 3KLNA 2YPRA 5DG2A 1X2NA 3K4NA 1R1A1 2EZLA 1AYN1 1TWGJ 3ZCOA 1VAMA 2HBUA 3KGZA 4M3CA 2RQQA 1VBE2 1RHI1 3WUCA 3WTXC 3Q8AA 3FMRA 3REOA 5J1XA 4CDUC 5EJZB 4E9KA 3U14A 2MH9A 4UF0B 5B1BH 1G3SA 3NV4A 1NZIA 3TAYA 4DYCA 4C3IJ 4GWJA 4QDRA 1RUE2 2VNRA 1XJAA 2GLOA 1MMDA 5EPAA 3RPQA 4YVSB 1XC5A 2OJED 2UXXA 2FDFA 1KQ8A 3KZIC 2QQ8A 5FYVA 3A2KA 4LXLA 1FV2A 3K4JA 6PAXA 4JTNA 3NV3A 1YJ9I 4O7XA 1FBUA 1W0TA 2DQLA 1UAAA 4BXUA 3JCIA 2FDKA 1SLBA 3OYJA 4IV3A 2DODA 1RVF3 4KIGA 2YFUA 1UYXA 2Y33A 4NRMA 5IAXA 3TQNA 2C24A 2BW3A 3AYCA 4PSWA 4V19K 1U8RA 2YROA 3ZSJA 4XURA 5D4RA 1GUIA 1X3ZB 3PQJA 2O3FA 3ZXLA 2ID6A 2YB7A 2WN2A 2Z5UA 3I58A 3K69A 3LEKA 4LHSA 2LUWA 4R4ZA 1F5FA 2GP3A 5J6XA 5JPNB 4JGYB 2BY2A 4XF3A 2XKOA 2NYYA 1W06A 3UKNA 2CFXA 3K1PA 1QJEA 4CUCA 1GZWB 4CHUA 5DEQA 2HZTA 4QM8A 1MS1A 4XR6A 1VBA1 3I4PA 1IV6A 1DYKA 5D8LB 2UU8A 4QTRA 2ZGQA 3JRBA 5EZGA 1BI0A 2A3SA 2DI3A 3U21A 5GLTA 1JZ7A 1D1CA 1AXZA 2UXNA 2VQHA 2Y9ZA 2KP6A 1QJZA 5C8CA 3JTGA 1A8DA 1FATA 4N43A 3F3XA 4P9LA 2OUJA 3FBIB 3MW3A 1WLDA 2PA7A 4YGEA 2IGKA 4ZDOA 3W3CA 5A33A 4IQJA 2DU9A 2JA2A 1W3XA 3M8JA 1A8MA 2VC9A 4BIFA 1AYM2 3ZOBA 2JUGA 1RUE3 3FFQA 4P9IA 1ZRCA 2VECA 3VD7A 3HRTA 4NMIA 1K6YA 1B6AA 5K7HA 4G6QA 2M34A 3I3BA 1LGCA 2HPIA 4LNVA 5FP9A 1A6QA 1S2KA 3VLBB 2QBYB 4MZUA 4FASD 1MS4A 1X1DA 5DTDA 1AJOA 5JI6A 5FPUA 3DL3A 4UFIA 5KCMA 1YIJI 2JDKA 2ZJCA 2K27A 3H5NA 1SC7A 3JBG1 2HDWA 1WD4A 4ASLA 2VUJA 3KS7A 5C44J 4ZS2A 4P9XA 2MC4A 4X1EA 4LHLA 4I2OA 1GR3A 4B43A 1UYPA 2BZTA 4AIKA 1SVMA 2EA2A 4JQFA 1US2A 2WZPP 4ZU4A 3L9JT 1DCSA 3QRFF 4XFAA 1UU4A 1QH6A 3HOVJ 4LO5B 2GNBA 1RMU2 1L3LA 3K2OA 3F0CA 1TW3A 1P8JA 1IXSB 3JUUA 3PFYA 3CMAI 2QUOA 4PI2A 2WT0A 5KHJA 3GCXA 1IQDC 3J7NA 4IERA 4QXKA 1OCZH 3P9IA 1EV12 2ZSHB 2CAVA 1SFYA 2E31A 2DT7B 1HF0A 2A73B 1N1YA 3BTIA 3F2ZA 4EM0B 3KP7A 5FYMA 4IE7A 3VB2A 1A35A 2AQFA 1C1FA 5FXWA 2XG3A 1ZZCA 1OPMA 4ITCA 1A78A 3RYKA 1MDMB 2VZSA 4G7ZF 2OTJI 3A0HC 2GH8A 2XMLA 5DAWA 2R93J 3OPZA 3NEUA 1QVUA 1ZREA 1YNAA 4EROA 1MJBA 5F32A 3FHAA 2E35A 4AHWA 4IXLA 2IGOA 2RAEA 3ERED 5JZGC 3KETA 1MZEA 4A12A 2RJLA 3CDZB 5T54A 1YYNA 3BT9A 1Z77A 1V6JA 2P7CB 2HVRA 1Y1WJ 3NO8A 2DF7A 4P02B 1RUF2 1BI1A 4FTHA 3VWBA 2L0KA 1HDKA 1RB8G 3ILNA 4A0ZA 3JRIA 5SV8A 3I4MJ 3DU6A 1SLCA 3E6DA 3VHPA 1G2HA 4MX3A 4BIOA 5JAXA 4YFXF 4EM2A 5FPAA 5A7OA 4BWOA 4LLFA 3WHCA 5K8SA 1GOHA 3KP2A 3N7LA 1VAVA 4RA0A 3HVDA 3POEA 3WCRA 3HSRA 3FISA 4Q0QA 4YVSA 1OQ1A 2OQRA 1FX7A 2UUZA 1RKTA 4HAMA 4F52A 2JG8A 4CDQA 4FAHA 4CDQB 2XDVA 5IYDJ 4Q29A 5K0UC 1YW9A 4KG8A 3CCRI 4NWWA 5D4SA 4XYXA 2YGMA 5C4JJ 2B39A 1NCQC 3J7AO 3EO6A 1Q43A 2P3KA 4A45A 4EVIA 3J8F3 5LHIA 4GZ9A 1VB2A 1TNRA 1RINA 3DTIA 1IKQA 2DV9A 4GMP3 2CH0A 3FX3A 2FNPA 3LA3A 1JYIA 4RLFA 3GZTB 3ONQA 3TEZA 3BYWA 4IOAF 1OKQA 2HVSA 2GQQA 1FC3A 1DQ4A 1AKHA 2SBAA 3AVRA 1IUYA 1ZM1A 3CJIC 2WNVB 2F48A 2QKDA 1ENSA 2L54A 1PGW2 4QHOA 3NNMA 5F6FA 2HU9A 1UMQA 2IVIB 3OYGA 5DD8A 2IC1A 2KDOA 3JSPA 3ZR5A 3CEWA 4NB5A 5K1YA 2GH2A 5CZKA 1CR7A 1XNCA 1BL0A 1XSQA 1FEXA 1GOGA 1UWWA 2ARXA 5ICFA 4QWQA 4XN3A 1VBB3 1IW7F 1AL0G 3QODA 3UJOA 2TUNA 2HGCA 1WCKA 1W8HA 1WA4A 4DXTA 5LRSA 3G6EI 1RVF2 3ENRA 4AI3A 1N75A 3LZZA 1BKZA 2CW7A 5HS9A 2PN5A 4G7OF 4QXCA 2Y31A 2WS91 2CO5A 5F2SA 1D7PM 4XFGA 2DCTA 2M8EA 5H20A 3V7CA 3E0JB 3T09A 1GFF2 2PEXA 1SMVA 4CDXB 3N9MA 2L7KA 3DBLB 4CP9A 2XROA 3VEPA 3KEQA 1D4VB 2WQ8A 3Q8CA 4AHZA 1Z7UA 4CDWC 5DABA 2RM21 1X9PA 3RGBA 2WNEA 2WT2A 1H0MA 2XL9A 3GALA 4NROA 4QD2A 4AEJA 4MGKE 1T2KA 1JYNA 4OI0A 4I02A 2ZAHA 3VYSB 3V56A 3WG2A 4M9SA 2E53A 2A5WA 4HDUA 1RUD3 2X09A 4EJVA 3AP5A 3ZXKA 5LK7B 4XN0A 3MIHA 5IYCJ 5JMOA 4PJJA 3OD4A 1S3JA 4QQ2A 1TMF2 4DUVA 1XGMA 4XJ8A 3B00A 5M5WJ 5DXDA 3SEPA 5HLHA 5F3EA 3O0XA 2M0MA 1R49A 1YFHA 1MVEA 5EXOA 1QOSA 2HWC3 3B01A 3CQZJ 1PO21 1IN4A 5G04L 1V9U1 4X0GA 1CJDA 3N9LA 3BUCA 2VC0A 1ZYBA 2IFRA 5ICEA 2ADEA 2IS6A 1FYLA 1FPN2 3WGIA 1EP0A 1DHKB 2DVFA 1JXNA 1OPCA 2ZCWA 1SD5A 2DYSH 2UV1A 3R60A 4LBQD 4AFMA 4RL7A 1ITYA 4HKOA 4FXKB 1JTZX 3L2UA 3N7MA 5J3LA 4Q4W1 5IAVA 3OJBA 2A05A 3MUY1 3T4HB 2R7SA 3ZR8X 3FWEA 2BVLA 1C57A 4CDQC 5JMCA 1R083 2HBTA 3IDBB 3MKYB 3ABTA 2E34A 1WH5A 5GZCA 3WF4A 5FOJB 4OMZA 4KN7X 2QKMB 1XSRA 2A3YA 1W7PB 4XKVA 1KU7A 4E2SA 1FMWA 3I97A 3BJAA 2HEVF 1B72A 1JXSA 5M0TA 3PIOF 1QEXA 1IOAA 3BU7A 3LD8A 4M6VA 3QU6A 4YNIA 4JKMA 4RB0A 2VBYA 3FXMA 5LY2A 5FDBA 4IE4A 1PYVA 1SFEA 1O8SA 4QX0A 3VHNA 3AK0A 2VMHA 3PLQA 3HN1A 2PYTA 5DZGA 1NG0A 3R6SA 2DT6A 5E18F 4RDUA 3QH7A 5FO5A 3D0SA 2VBBA 1TG7A 3VBUC 4LUMA 1WCDJ 1EH7A 1GU3A 3H3UA 5JSRA 3POJA 2VCMA 1FOD3 2LVSA 1SANA 2HYFA 1N3QA 2ESNA 1ZR4A 2WV0A 3HTUA 2UY9A 3I2HA 3AMHA 1MMSA 4OAZA 3VFZA 2ZFWA 4AVBA 3CP2A 5CIRA 2Y38A 1YX5A 1AWCA 1HKDA 1NYWA 5C8WA 1JU4A 4FTBA 3OYDA 3PNAA 1AXKA 3BIEA 1JT0A 2XJQA 4QX8A 3LSPA 3TMOA 2FBHA 3C1DA 4IZZA 4OHVA 4S0HB 4FQZA 4C1XA 4HOBA 4A0XA 1XNAA 4NNJA 4B47A 3KVAA 4FE4A 1IG3A 2V1NA 1Z7LA 1DQ5A 3H50A 4XUOA 3ASNH 3B5LB 2QLZA 2K4BA 1NA1A 1T33A 1TME3 3CJTB 1WCMJ 4ZZDA 1D0ZA 4GAZA 3NWTA 1SHWB 3LSGA 3ZOIA 1PIV1 2ZX0A 2BW3B 4CYDA 4JOMA 3RIRA 1VBD2 3BI3A 3G71I 1IQAA 4AI0A 3V42A 2HOTA 1U0AA 2LG4A 2TCTA 4NC8A 4IF4A 3I3MA 2K4JA 4B29A 4L0YB 3IV5A 2DA2A 1JKQC 4B8EA 1YCIA 2VZQA 1MNMC 2EZKA 1V5GA 4MXWA 1Z91A 1JKRC 2NNYA 2D93A 2M4GA 5DAXA 3M8FA 1ZA7A 1X82A 4YIRX 1AR73 3VZOA 3EUKL 1JGSA 1XMXA 1DQUA 4XL9A 1HDDC 2XASA 5EEAA 3V64A 4XLCA 4A69C 4LO7A 3V0AB 5D5UB 4PBOA 3F9KA 3POYA 5ERLA 1S2EA 4JQTA 3WP6A 2XXZA 3CMMA 4Q4ZF 3ASIA 5LHHA 4XHBA 3H42B 4ENNA 2M7AA 4LLLA 2BZDA 4K20A 4UF0A 4RYDA 1ETOA 5DCMB 4KGGA 3RSNA 4J19A 4YLZA 1GLHA 5FRNA 1H4HA 4WVZA 4K3UA 4Y17A 3IIIA 1EJ9A 1XSVA 1GSLA 4RQPA 3WX5A 2EPFA 2KQRA 2PTMA 1RJ8A 5LA9A 5LK5A 5CG9A 3JCUC 3I59B 1X33A 4ENKA 1HW5A 1VQ8I 2NVQJ 4I6ZA 2KFDA 1VPHA 1FPQA 2XV4S 3WF0A 3T1MA 2D97A 2CQXA 2RDNA 2MW8A 1RUH1 5IOYA 3P9KA 2ZPXA 4FFFA 3T2QA 1CAUB 3CUQC 5DYMA 5EJ1B 1H4GA 3ACLA 4XXAA 1BI3A 3QYEA 2AHQA 4G6DA 1YEWA 3G7DA 4FPYA 3CMYA 1PK6A 1IV8A 4KWKA 5J1UA 3I71A 2QSGX 1D0HA 1VZ0A 4DOUA 3H8UA 4LLGF 1OUXA 3ME2A 5E6HA 1PZ8A 3BN6A 3OGSA 4XAAA 2XPWA 4MFDA 2QWWA 2XR4A 3G6JB 4E70A 4CEWC 3RZGA 1RYYA 1U12A 9ANTA 2MLGA 1VBD3 2WWUA 3RKWA 2KISA 2HXIA 2LKSA 1XDSA 4Y7NJ 2GIVA 5FAXA 2IBDA 3BWGA 1DIWA 3RMYA 1IKPA 2W25A 1CAVA 1AF9A 2VASA 4RS5C 2EWNA 1CAVB 2HWVA 3KMHA 4FO9A 2R7OA 5C7GA 3FM5A 2GP5A 5F3IA 3AZZA 2NMOA 4GGGA 2P3IA 4XJ9A 3V0AA 2RKHA 4V2WA 5IVEA 2ZXIA 1G6NA 3WSOA 2Q30A 5ABJA 3BG6A 2XJVA 3FDYA 3A01B 4YZ2A 1RNLA 5FD5A 2P0WA 2PXJA 4XBLA 2W4SA 4YGDA 5GAHJ 1MGTA 3WDXA 2HWB2 5GZEA 1W1WE 1UD1A 1DPRA 1JUMA 5GAEJ 3BPXA 2WZR1 1S0IA 3H5AA 2X51A 1FIAA 2O6GE 3EHKA 2LNBA 2HOAA 4L0ZB 3MEXA 2A6ZA 2HWB3 4J1XA 3FZ3A 4M3FA 3LMMA 4XORA 2F4MB 2KMUA 2VB6A 4BACA 3CZ6A 4PIXA 3WNMA 1D5YA 2NOJB 3HOXJ 2X5IA 2LBFA 5FQ0A 2G9WA 4CCOA 3SJMA 2WINB 3HOWJ 4YIIA 2NM1A 5BV6A 2WRAA 3RZMA 5JPMB 4B48A 1BEV1 3KQ4B 4RQPB 1GNYA 4H4KC 2AH2A 5TGTA 4CSWA 4XF1A 5EQUA 5DUKA 4GWMA 1S5LC 1KFUL 4PCRA 1S4CA 1O4ZA 2IXLA 3VD4A 4L11A 2WFF3 1HRI3 5ANQA 4X6RB 2JG9A 4BCUA 3MIFA 5CYVA 3KV9A 4PT6A 2F17A 2QDRA 3D3AA 1UKGA 3OEAA 3GTJJ 4QXHA 1WPKA 2GXGA 3H1YA 2X8KA 3MYXA 3QCWA 5F64A 4L5EA 2P5LC 1SACA 3T8TA 2XF6A 3MFAA 4CXXA 4F83A 4BH9A 2VMCA 1UFMA 5L3DA 1IO2A 3KP4A 1OCCH 4BE2A 2HDDA 2SLIA 2VNGA 2LD5A 4XNFA 2JICA 2WWSA 5C3EJ 4X6AJ 3WDWA 1HQWA 4QAWA 1MEC3 5HBAA 1KONA 2EAKA 2VBPA 4FTSA 4COWA 3JW4A 2W9XA 2GBYA 2XKPA 5IK5A 5FKOA 5FP4A 1Z0XA 3OYKA 4YVWC 5HXVA 3Q0WA 3I4IA 2K7LA 1OH4A 3T1LA 1UG0A 4AE2A 2EVXA 3JBG3 4JGZB 5EJCA 3CNAA 3ZSLA 1FI2A 3VBSB 4CYCB 2CWMA 3ZFGC 1U5TA 3PU3A 1F35A 2EALA 3PUSA 3F8BA 4J1WA 2Z4FA 3ZVXA 1UOJA 1C8M1 1S29A 3VHRA 3AM2A 3CCLI 3DYPA 2OQGA 4ORFA 1VBE1 4S2DA 3GF6A 3OGJA 1CGPA 3OTFA 5A32B 2O5RA 1AYN2 2BVBA 1TT0A 4MXVA 4OAYA 1YRNA 1ACCA 1UY0A 4CXWA 3HOTA 1GKBA 5E8AA 4YVSC 2EIGA 3R05A 2VQLA 1ZLKA 5E1ZB 2FE3A 3J7HA 4LBLA 5I8SA 3SH5A 4D8MA 2AENA 3VODA 5FUPA 3UESA 4A3KJ 2GIZA 2F4IA 3CF6E 5DS9A 2JDHA 1BXHA 1AL22 5BNOC 2EFOA 5FCCA 3CIHA 5CKQA 3MCZA 5IYBJ 2E33A 5K4LA 4HONA 4A4AA 3FHZA 4F91B 1LOFC 3W58A 1WW4A 3LAGA 2HWD2 2RR11 2WUHA 1W36D 3GTOJ 4GKYA 1XE8A 1UOBA 5FK7A 5F27A 1LFUP 2PMHA 4FOWA 2D6LX 1AJKA 5L3CA 3JRFA 2L7FP 1UCXA 4C0BA 2HWD1 1NE6A 2W1WA 1QPMA 4GB32 3OEBA 1RUC2 3MLJA 4MH0E 5A80A 4QGNA 5CYYA 3SQOA 5KAIC 4IEQA 1H30A 2QTWB 1P4XA 4W1UA 4UUSB 1W8WA 1BCXA 2K0GA 2Z5WA 1IRFA 3HUGA 4EWAA 5ILSA 1V6MA 1XG1A 2OD5A 1UZCA 3GO5A 4Q1PA 3ZXGA 3IKVA 3V0BB 2GWRA 2VBXA 2QSFX 1XNBA 2A6HF 4II3A 4BMBA 1VI0A 4AC0A 3MIEA 1TT5B 3MKLA 4XE9A 1PMHX 2R32A 3BR5A 1W99A 2XVLA 3IRQA 4R9DA 1Z78A 1MH4A 2E2HJ 1HQNA 3VDDB 3ZP5A 2V6EA 2IGMA 4DQAA 1DZQA 2CDPA 2AS5F 4C9YA 4KMQA 2DCEA 3HKZA 5ABJC 3VZJA 2ARBA 5B5EC 4AU7A 5K0UB 1NA1C 2VW0A 4A6EA 2VW1A 2D3SA 5ACA1 4PGGA 1NXMA 2X48A 5K7ZA 2E51A 1X1CA 1NG7A 2Y0IA 5JVGF 4S2FA 2CQNA 3QPLA 3C7EA 1LGBA 2PMUA 3SFIA 4IHTA 3M3CA 5EG0B 3ZN5A 3KP3A 3BG5A 2BYVE 3WNNA 2PELA 2O0OA 2A61A 3ZQIA 4ZY9A 4PFOA 1O3TA 5L19A 3HB9A 1IJWC 1O5UA 2MG4A 1JMUB 4IPAA 4KU8A 1LHWA 2EJRA 1Y3TA 1VQ6I 2QYOA 1G3WA 4A42A 3TOBA 2V1UA 4NIGA 1BIAA 5JXHA 5LA1A 3D5SC 1UZYA 3DXJF 1KJRA 1ULPA 1W6PA 5BNGA 3ECQA 2I5UA 3K1MA 2PFWA 2RS32 2E5NA 3HEFA 1I50J 3CD6I 2Y6FA 2NRAC 1VMJA 3WTWC 3ITQA 1R082 2R063 3VBSC 3MDPA 5FZBA 1ENXA 3N7JA 5HCHA 2ZZQA 4LK7A 2WN3A 4I01A 3ZYRA 2BNMA 3O0VA 4GB33 4AZZA 4OINF 2ZMEA 5DCMA 2O14A 1HXS3 3VGIA 5FLJA 3FIWA 1W2UA 2RMU1 5FZOB 3VZLA 1N1SA 1S0EA 1LAJA 5FXXA 2XPUA 4CYCA 2YC0A 2PI0A 4AAPA 1DGWA 3H35A 3E6BA 4U2AA 1D4M2 2ZJRF 5CA6A 5FZ4A 1P92A 1N1TA 2V9PA 3TW6A 3OR2C 2OW4A 1QJX2 4KITB 2P5VA 3OSGA 3WG4A 5BNNA 1LUJB 1B8IA 4JDOA 3POBA 3P1IA 1F4HA 1JE8A 2OKXA 3ZMZA 3MLLA 5DUVA 1QHHD 4PDWB 2OPWA 1WUVA 4DNYA 4D7YA 1FLIA 3V7SA 2VQGA 2XAHA 3NJYA 3WNXA 2WZR2 2YR2A 5CFDB 1BC8C 1RUOA 1KYWA 4UXAA 3KD4A 4IEWA 2OU2A 1ENRA 3SH3A 3BR6A 2VI6A 3W2WA 4UWDA 4AVZA 2BW8A 2WO2A 1ZGWA 2JWPA 2GOXB 1K4TA 5J37A 2DVBA 2EIEA 4QKDA 2CW0F 1EH8A 4AIDA 4CZZA 3VL8A 4GIQA 2XSDC 2VLAA 5EYYA 3DCFA 1V3FA 2E71A 1UOGA 3HYIA 3GMEA 3OBZA 1RUG3 4A3DJ 3GVAA 2WAQN 4YFKF 2ESHA 1PGL1 5FLXK 2EH3A 4YW1A 5FIXA 3KZ4C 1W9WA 1GMMA 3BG9A 2LK2A 5D5XB 2WIIB 2R7TA 2D5HA 4XMAA 4HPKA 4QPIB 5FR3A 2ME6A 4UW4A 1RI7A 1VQMI 2P81A 2X5IB 1R00A 2LBFB 1QDCA 4D1QA 1ZBA2 2E63A 4Q4W3 1VQKI 3AJZA 5LD2C 1CQTA 1YX3A 3SQNA 2A3WA 5D21A 4LJZF 4CXYA 5EEGA 3K4AA 5FBJA 3JD73 4BE1A 4XKCA 3HOBA 2K9MA 3ABUA 4DXRA 3TW7A 3K10A 1JZ2A 2YMZA 2R5YA 4DGWB 2MEV1 2XUEA 2J1AA 3NARA 1V6OA 5FZMA 1I3AA 1KQRA 3GFIA 4KBZA 1S6LA 3MD2A 1Z3XA 1CAWB 3CLQA 4ESJA 4OI1A 4R8HA 2ZKZA 1VMFA 5LZ6A 2N8GA 2VZOA 4ENJA 1XGSA 4HZFA 2R1DA 2NYXA 2UWBA 4ARYA 2FZ2A 4COUA 3C2HA 2P1BA 1W6OA 1O3SA 1IDYA 5IW0A 4ONUA 5DMYA 4PGHA 3ZDVA 2OTLI 3QOPA 3WTVC 3C7FA 2E7WA 3FUQA 1KZHA 3JD72 1REFA 1ZA4A 4N8MA 4XFFA 1CONA 3UGHA 2RS33 3JU9A 5F1JA 2DUQA 4Q4W2 1USTA 3CC7I 5AC93 1W0OA 3MWMA 3N4MA 1K5MC 2WFF2 1D0GA 4BXSV 4HVRA 1UHWA 1FNYA 3HOUJ 2ILMA 4OQ9A 4A41A 4PJLA 1W6MB 2MBFA 5T50A 5FWJA 1UIJA 4D9JA 2CUZA 3CC4I 4LHNA 3HWJA 5L7OC 4UNOA 5BNQA 4A5NA 3LFKA 2AO9A 5CAZA 1PM7A 4XDOA 5LA0A 4B4CA 3I3LA 4JX0A 4PIYA 1D8JA 1BQPA 1G59A 3KLSA 1TMF1 4AVPA 5J47A 3ON7A 3MLKA 4HXCA 3PL8A 2IUWA 5ANNA 3AZVA 4P9WA 1LESA 2X6WA 4L8QA 1TZLA 3PUQA 3AKTA 4ESBA 3H9QA 5K5QA 2HWC1 4WCGA 3B3QE 3H9AA 3JQXA 4Y13A 5L3GA 5FB2A 3ELKA 5EIYB 1VAKA 5FPBA 2XJTA 4Y1XA 3ZYHA 1HRV1 2ETEA 3M4OJ 1JGGA 1HQCA 1ND2A 4JX6A 4KWJA 4XIDA 1DZTA 3SEZA 1SD6A 1K61A 3RZOJ 2OC6A 3WF2A 2XBO3 2WS92 1QH7A 1VBB1 1K78B 3ZX7A 4WXDA 2VZRA 2RR13 2VD7A 3LOCA 5JLVA 1BMV1 1I1SA 4IE5A 3HSFA 4ET7A 1KQ0A 5JWPA 4PLMA 1VQPI 2WKKA 1B35A 2OCEA 2XAGA 1OFSA 2W92A 5E17F 3W2VA 1HB1A 2RS11 2BWCA 1LE8B 3F21A 2KIUA 1NLRA 2EFNA 2LTPA 4HV5A 4LK6A 1OFNA 1JOJA 2JRMA 5FMOL 3BJOA 3F6OA 2WZ8A 2Y64A 5JSPA 4IV1A 5T5JA 3S1MJ 4BA6A 4BY7J 1WLCA 3VUOA 1WH7A 2VG9A 3O1PA 2HWD3 1HKSA 3BROA 4ZU7A 1XXNA 3U4SA 2EBIA 2JA8J 5EWSA 4XLHA 5FTTC 2GXBA 3GFMA 5CBLA 2JA5J 4HG2A 1Y43B 1JZ3A 4UOJA 4O5VA 1RUJ2 4IHXA 4QX2A 3K2AA 2XGDA 1NHAA 4AI2A 1ULOA 5FYYA 3ZMNA 1PM4A 5BNOB 1T2XA 1MBGA 4Q2FA 4CZCA 3LAPA 2DJNA 4OHXA 2LLKA 4XQ4A 1LVKA 5FKBA 2ZMEB 2H8RA 1CAXB 5JDBA 2DCZA 3DLLF 2HEWF 4R9CA 4W4ZA 5CVRA 5IVFA 2IXKA 3Q9OA 5SV5A 2KLOA 5A6ZA 1ND2B 2FQPA 2VXDA 2FMYA 3BDDA 4O65A 2EIMH 1LNWA 4KWUA 4RB2C 2EXIA 2ZGLA 1V54H 4BDYA 1C8NA 4AHYA 1UZZA 2CL2A 3ZQCA 2VE9A 1SFPA 2W68A 1KYZA 1TQ5A 2VOXA 4O6JA 4C1WA 3M7AA 3S1RJ 4LK1F 4NAMA 2V9VA 3PL0A 4EV0A 4XBNA 2QM3A 1FPN1 2DA6A 4ZC3A 3PVOA 5FFZA 1Z67A 4DXZA 5JLWA 1B09A 4TV7A 2VJIA 2VQAA 4N7UA 3ZN1A 3TOJA 1MEC2 3TP0A 5ICGA 4JCKA 1QVTA 4WVMB 2HWE2 2DN0A 1RL3A 3K3OA 4KH9A 2LF7A 3FXKA 2F4OB 3EYIA 3KWVA 1G9CA 5FZFA 3SITA 4LBMA 1G9FA 1W6OB 4QKNA 2L9VA 1GXQA 2JJ7A 1POV0 1EV7A 5J40A 4MGIE 5A7PA 4K7JA 2XB5A 1VQ9I 2TEPA 4V2VA 3ZFEC 5LEJA 3VYUB 2O8KA 5L73A 2GM4A 4FOVA 4MGRA 2FU4A 2RM22 1ZRIA 2B9VA 3CMGA 2ZHKA 1GP6A 2A5YB 3MMYB 4META 1JUIA 3WW2A 2MEV2 1TNSA 4IEPA 3WHUA 1TP4A 1N25A 1WQ2A 2PMZA 1P7JA 2DFHA 2VTFA 2DCJA 2B4KA 1TWFJ 3E7LA 3K4ZA 3V0BA 2IXJA 3TNPB 3VKFC 1HV1A 1J3PA 1R091 4QGLA 1PNFA 5LBCA 3IDCB 4L9BA 2P2KA 4P1WA 1AXYA 2ORZA 2ID4A 5JVTA 2HDCA 2RE9A 3PO2J 2VAUA 1DLCA 4UUTA 4M00A 1FMVA 5FFXA 3D82A 3MIGA 2FOKA 1ASJ3 2DO7A 4HN1A 2P5BA 3T8RA 1X19A 3AKSA 4DYQA 4XUPA 5LFAA 1GQPA 3BCAA 3HT1A 1T0FA 2FZ1A 4LUKA 4Z07A 3OB8A 2W46A 3LFMA 1UAIA 2W0XA 4BE3A 3PMEA 2DK5A 2R7VA 4BHBA 1QZYA 5F2WA 4R1HA 1VQOI 2JRTA 3M3YJ 3JBG2 1H2LA 3TEWA 1F1ZA 1VQ7I 4UV9A 2NP0A 5BPXA 2WNVA 2EIBA 4AEDB 2QF7A 1ZZ8A 4PF1A 3ZSEA 2YX7A 3DTEA 4AIHA 1IDZA 3H0OA 3RNSA 3AFHA 1LKNA 4BQ4A 4RGSA 4BQ2A 4IJAA 2IS1A 4Y24A 3PQKA 2BUKA 1HCRA 1CD3G 2QBYA 3BODA 2YBSA 3TGNA 1KS5A 1JBCA 1RITA 3ACGA 3GZ5A 1V5EA 4HBLA 3N36A 4FPFA 5A7SA 3A0KA 3ST7A 3UYJA 2XLGA 3M7GA 4Q5SF 4SLIA 1J3RA 5FZDA 4L2NA 2GDFA 1L0OC 3WTSC 1VQ4I 5IT9K 3DBHB 1IS6A 1LFBA 1J0RA 4M9ZA 4JGYC 3IMMA 4MQVA 4GWIA 4OULA 1K42A 4C2UA 1ETYA 4JGZC 3L2RA 3MZYA 5JOYA 1D4M1 3UKVA 3HD8B 3K4LA 2K9LA 1ZBE3 2Y6HA 3MZHA 4IE6A 1K4SA 3IWFA 2CU7A 4N9HA 1F36A 1SQ4A 2LC2A 3AXEA 2ZOEB 1PZ7A 4RR3A 3RRDA 1XPXA 2AR6A 2FBEA 3KEYA 4A3GJ 4FISA 3A0NA 4YFWA 2MPFA 3VL9A 1R081 1SD4A 2QBXA 3HBZA 3I2KA 3IAQA 4NN0A 2B45X 1IC8A 1RUD1 4HF1A 2RS31 5IVVA 3FK6A 3S14J 5IP7J 2UURA 3KSCA 3PJQA 2CNAA 3S3NA 3OYNA 1SAUA 3HNBM 3N35A 2HXOA 3OGVA 1TMF3 3BR0A 2JT1A 3H7YA 3FE5A 3PNVA 5E3MA 3I9V2 5CU1A 2M4KA 3ZPLA 3KT1A 1YIOA 4P96A 3WHTA 1RUD2 2CQKA 4U0YA 4RFT0 1RUI2 2RNGA 3KYCB 2OZ6A 1LOFA 4NDLA 3DPUA 5FY9A 4XABA 1BBT3 4KIFA 5A2QZ 1SMYF 1LQ1A 1FMD1 4KI5M 4PLOA 2ZBKA 1OA3A 1VBC2 1KU2A 3QD6A 3Q5FA 4EJRA 4Z82A 1S7OA 3KVBA 5EV7A 2WZR3 2JDMA 3DFGA 1B8IB 4HKWA 2VPLA 2FDJA 2KXLA 3M3IA 2GC0A 4CP1A 1FYMA 4Y1YA 2CGOA 4NC7A 2PHLA 2P6HA 5F6KA 1D2SA 3PFIA 2DCKA 2XHKA 3TOAA 4UW3A 2VBWA 1IPKA 4I98B 3I3DA 2DA7A 1QJX3 5FWEA 2R1BA 1UXXX 2RMU3 3I8TA 1MQTC 1GZ9A 3NNGA 1LU1A 5ILUA 2LKXA 1OUSA 2ZHMA 5L9BA 3WOGA 1IHMA 2ZXWH 3E3VA 1X3WB 1G9BA 4MO3M 3C7JA 2BY3A 4FFGA 2D1HA 2PQ8A 1YXWA 1FOYA 4MYEA 3I5UA 1U6GA 1QF3A 4D6RA 1KGSA 3OYWA 2LALA 1WMEA 1SEUA 4IRGA 3RZLA 1FWZA 2BV6A 5A3MA 1D5VA 2P4EA 4B3XA 3I49A 3D5RC 4GFBA 5IWFA 3PURA 2HYJA 1WCQA 3S2HJ 4ZKTB 2BVVA 2YS9A 3QP6A 3CO2A 3LFUA 1FT9A 2D44A 2XLFA 3OY9A 1W0UA 2LRPA 4PLNA 1QXJA 1MS0A 3PIGA 1Q8OA 1EKEA 3M9AA 2E6VA 1UMZA 2BGOA 2DVAA 1E5SA 1EPWA 1ETXA 2UYBA 3RI4A 3EUHC 1LHVA 2CJJA 1IRGA 3MQ0A 1ND3A 3KE2A 2FHRA 2L4MA 4AYBN 4KMFA 4I0AA 1AL21 3NKTA 3UKGA 3POFA 2R0QC 1VTNC 4TLFA 1W9SA 2DFCA 4FAGA 1EA3A 4QPWA 1JZ6A 2ZB9A 5FMDA 3ERMA 4EGYA 2VO5A 4A0YA 2W85A 5DM6F 2VNOA 4YW6A 4EN6B 4Q4Y1 5I91A 1WLTA 3AYDA 2DJIA 3CJRB 1IN7A 3POIA 3SCGA 2M2EA 1FNZA 4YM1A 4UY8I 3T2PA 4AD9A 3DU5A 3AP6A 4Q4X1 1TC3C 3S7IA 4Y1VA 3DBRB 4BM8A 4LKSA 1H1MA 4EJOA 1C8M2 5ILVA 3ASOH 4MADA 3A21A 1Z3YA 1NCQB 2P5KA 3HG9A 4QU1A 2VCCA 1R22A 4DEVA 2VCBA 4ETSA 4HW0A 1JHFA 3RKQA 3WG1A 3HBKA 2CV0A 3SKJE 2GMMA 2P6CA 2NNNA 5F0CA 5E8IA 1AR82 2J5OA 2HWE1 1DP7P 4KDPA 2HKXA 2E2JJ 3ZKUA 1EY2A 2EFQA 5TRDA 4BB3A 1X1BA 2HS5A 3ZIWA 4LBQA 1A04A 1ZYRF 3THPA 3ACFA 1OD3A 2E5ZA 1GANA 2XPJA 5A3LA 4CU6A 1FSEA 4CDGA 1OLRA 1NLQA 1NTCA 3Q8EA 3SLIA 2F6BA 2BXYA 4BXXJ 4UFKA 5IP6A 1YOVB 2R92J 2R7ZJ 1RUE1 1XU2A 1F31A 1K83J 2K40A 1SLTA 4NR1A 5HCFA 5KHIA 3HRSA 2WA0A 3ACHA 3GM8A 1JZ8A 5FYSA 4UBHA 3IM0A 3G73A 2MHFA 4HA8A 1R64A 1BVP1 1XU1A 3MIDA 3VBFA 1MW7A 3SYTA 1O6UA 2A6WA 4HNVA 1OPOA 2CV2A 2JE7A 2I45A 1R1A2 1WFXA 4BEHB 1QGLA 1HW1A 1XE0A 3RZJA 1S55A 4B1LA 3HC7A 2AEZA 4OI2A 4IVNA 4NHKA 3WXPA 2ZNYA 1V9U3 3D1NI 2OVUA 4WV8A 2JG8C 4DUXA 3EUAA 2VR4A 1RC6A 1ULDA 2O8QA 5I8TA 2J1RA 2L9SA 4PI0A 4W6YA 3FHQA 2R7UA 2FJ1A 2W2IA 1MH3A 2WNUA 3O1MA 5ED4A 2RVCA 2PAEA 3IKTA 1SG3A 4AAXA 4ESFA 1SFNA 3NAPB 4IV1B 2XL7A 4EJUA 2EINH 4EYUA 5TSWA 4FOQA 2WTEA 1MQTA 2VH9A 1S0FA 3F8MA 2ZABA 1SPPA 1J9IA 4F92B 4RSUA 4UFMA 4YW5A 4PUSA 2QQJA 3TEXA 3FK7A 3HAGA 3AMPA 5FZ8A 2MABA 2WB1N 2WFPA 4XFBA 1O4XA 1QQP2 1BMV2 2VONA 1Z9CA 4IL7A 4XFIA 2MSYA 1QXRA 2A5ZA 3O1TA 1IN8A 1UQXA 1XNDA 2OQ6A 2OPKA 2VBDA 4II2A 5LATA 1UKRA 3SHRA 4LT5A 1BR2A 4D69A 5B66C 4AL9A 3T5XA 3P6BA 1TVGA 1XNKA 5A3NA 1ZZ9A 2Y0SN 1O5LA 2W1QA 4D94A 5CKTA 3B73A 4IOCF 3RG0A 1R1VA 4HYEA 1HRV2 3HQUA 2PAKA 3UNGC 4YEJA 5JUVA 5HLIA 3NNFA 5GTIC 1PJRA 4OOIA 2V5DA 4GYGA 3K4BA 4XEZA 1H9GA 3TO6A 5J1RA 3N9QA 3K0LA 2HOEA 5FKLA 1WMFA 5H2FC 3HRUA 2YZ4A 5JHFA 1WJDA 4KBBA 3BKZA 4L18B 1OF3A 3ZN6A 3J9SA 1ZBE1 1K79A 2HVQA 4XQFA 2JA7J 3GTQJ 3VD5A 2BFUL 1ZBA3 1SBDA 2CV1A 3IDEA 4IEOA 1QMJA 3ZRGA 4A93J 5AVPA 3TRSB 2C5DA 3BGAA 3ZQ7A 5IVJA 4KIBA 3RKXA 2CWEA 2ZZJA 3ILFA 1OURA 3AG4H 1VQ5I 1R1A3 1BJQA 2GOMA 3VKNA 3WGHA 4N0BA 2CW8A 1S0BA 2FF4A 5CNAA 1SCSA 1H9PA 2XRLA 4U0VA 3PVBB 2KPMA 2VUCA 1X1PA 4CRQA 4QWNA 3HOZJ 3WG3A 2VXJA 1SBEA 4XKWA 1GHCA 2Z9OA 2JIGA 3LSMA 4FHTA 1H8AC 2K3PA 2KZGA 4GYIA 2JIJA 2XQXA 3B9IA 1SLIA 2LW8A 1P6RA 4GJYA 2D5FA 2GC1A 3JD71 1YQ2A 2VULA 3ZXJA 1YQAA 3ZN6B 4ZYHA 2X5IC 3E6CC 2Y26A 1M06G 4L5IA 4A7YA 2W57A 2VCAA 1JYVA 1XD7A 5KBFA 1OD5A 4GXOA 3IPVB 4TSVA 2A71A 3CDLA 4YW3A 3LQCA 4AI8A 3HUGB 4GMP0 1OKRA 2JWTA 2A6XA 1SCRA 2W1SA 4XFHA 4CCDA 2OA4A 4TLGA 1V4RA 4HNUA 2PHFA 2Z16A 1S1AA 4H3WA 1RR8C 1AR83 4K8FA 1OFCX 1IAWA 1O4TA 5FLMJ 2ZGSA 4MHRA 2BHZA 1H6YA 2Q2EB 4ZDLA 5JI9A 3O6BB 2BFUS 3I2JA 1XCBA 1AR61 3BOQA 1FYUA 2WQZC 3M1CA 2J5PA 1R5HA 1UY2A 1C8M3 1RPWA 2P17A 2EZIA 4Y5TA 3GFJA 2WB1A 1NA1B 1Z6RA 3OCPA 4ABZA 1KDKA 3VBRA 4FBFA 2JTVA 4LG0A 3ZPOA 4Q47A 2UZKA 3RVHA 5HDKA 3P7NA 2IAIA 5IVYA 5C5UA 4XSXF 1RIRA 3BZ6A 5F5AA 1H8VA 4LD5A 1YFYA 4IV3C 2NAZA 3MVPA 1LEDA 4XIOA 5KXBA 5EFUA 3AL0C 2W94A 5D8AB 5B4XA 3IAPA 2KJBA 5CQGA 2WABA 4XBFA 3MEPA 1D3YA 3NNLA 1ULFA 1W05A 1X9TA 1PO13 1LHUA 2P34A 5GADJ 4N53C 2IA1A 3WU1B 1M1EB 4YM2A 2KJCA 4D0PA 5A6QA 4BNCA 3LA7A 3KHBA 4M6XA 1FZPB 4F8AA 3OIPA 1WW7A 5FZOA 1PUEE 2R6QA 5A3UA 1G86A 4EZ4A 4ZTFA 1SLAA 4IEXA 1A34A 3F23A 5EG0A 3G2BA 1T39A 5K7PA 4M3CB 2VXZA 1QNWA 1K12A 5HV4A 4Q4V3 1J84A 3OS0A 1E3HA 4URTA 1OLQA 1W9TA 1W6MA 2AGSA 3FLPA 4A3XA 2H09A 1T08B 1QIQA 3SFZA 3HHGA 1JYXA 1V6KA 3L2WA 2O9LA 4RAFA 1ZH5A 4UV8A 4OHYA 2P3YA 3CCMI 2R073 1WI3A 1W7PA 1DFQA 1IGOA 1OH3A 3T0BA 2JVGA 5JI7A 2QCOA 2FBIA 5D1IA 4DRVA 5J8CA 2R7RA 3WQ7A 1LVAA 1OA2A 1VJ2A 3HR9A 5CLSA 3O8GA 2ZEXA 2IPQX 3K77A 2MNGA 2VVEA 5BPDA 2EXKA 1SLLA 3A4CA 1BYHA 3OBTA 4KFCA 4FXGB 1OBNA 2IS4A 5IPAA 3K70C 1HV0A 2GNMA 5BNPB 4AVTA 4NRPA 1VBC3 1RRJA 1STZA 4NQWA 3PUBA 5FO7B 1J59A 3C8XA 3RZKA 4D7MA 3WNOA 2BEOA 2RS13 1BHGA 4ENMA 1HOMA 2KIQA 1CF7A 1UN1A 2ZHLA 1SMTA 2X6XA 3LSKA 3BZCA 2H6CA 5T3NA 2K02A 4D5CA 4JRLA 2L9LA 2Z33A 2EA7A 4LKFA 3K7AJ 1UU5A 4NHJA 1DDLA 3AMQA 4KG0A 3H7JA 1QHGA 5DV5A 2JECA 1J09A 3V8KA 1IS4A 4N43C 2D2WA 2NS8A 3IBMA 4P5HA 3H0GJ 1W5SA 3FMQA 1ZRRA 3QOEA 5DUXA 2KL4A 2P6TA 2HWF1 4YG0A 4Q8LA 2HLEA 5IJRA 4Y4RA 3LIGA 2QZ3A 1TL8A 3ZYJB 2FQ4A 1WSUA 5KC5A 1A36A 3AZYA 5FY7A 2A6EF 3M07A 2R5YB 1WZXA 3WNPA 2M3AA 2X10A 2HYGD 1R1ZA 5A7WB 5E3LA 1UG2A 4W8JA 5HXMA 2ZGOA 4EWDA 4D7NA 4Q4Y2 1JI8A 4XUTA 4HF0A 2BNNA 3NSTA 4XJUA 2WJSA 2AUYA 3RFRA 5A33B 4HEA2 4I7HA 4RQPC 2VOWA 1SDDB 2DK8A 3PNTA 2ZC2A 4DBQA 3S7EA 3OPWA 3CCVI 3LSDA 4R9AA 2WV1A 1RVF1 1FTTA 2IEKA 3GCMA 2DMQA 4YFNF 3GTGJ 2BP6A 4JAAA 1RUC1 4OYUA 4AWDA 4U0WA 2V1XA 1YHQI 2HKOA 4CP9B 3RQ4A 4V1PA 3H9GA 2FXAA 3N05A 2QQWA 3BP8A 2Z42A 4LOSA 2OYZA 1UY4A 1PMIA 1W9FA 2VQTA 4QM9A 2RR12 2YU3A 1O4YA 5AC91 4H7LA 4C8DA 2EF6A 1YO5C 3IN9A 2PJRB 3EPZA 4FX0A 2A3XA 3WW1A 3BTXA 2DOAA 4OUMA 5GZDA 4MOAA 3VYTB 2ZGTA 3VDCA 2JD9A 4HX8A 3PMSA 2DVGA 3FXUA 5FZEA 2WQ4A 3W6KB 4A6SA 2QEXI 3DV8A 5DAVA 3OYWB 1FOKA 4DO0A 1AKHB 4ZXEA 2ZMNA 4RLQA 3KYDB 3NAUA 3VBHB 2ZGUA 3OYAA 1S7EA 2VE8A 2FUG2 2EB7A 2BERA 1NT0A 3KIOA 2P4WA 2NZ9A 1KU9A 5H6QA 3ETPA 1PHMA 1LHNA 2NS0A 1ETQA 5HI0A 4JRAA 2DQRA 1BLZA 3TBDA 3KF5A 3JSOA 3S0MA 1F15A 1GWMA 4O61A 4XJAA 5FY4A 3FZVA 3A23A 3SZGA 2D40A 1V0AA 3U1KA