2W94A

Native structure of the discoidin i from dictyostelium discoideum at 1.8 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 62
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w94A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w94A01
4HG6B 3OG2A 3U37A 1F4HA 2LS6A 1UMHA 1US2A 1UYXA 2L9LA 2XHNA 3MV11 1HN1A 5IFTA 3VD5A 2DDUA 4Z2AA 2VMEA 1SDDB 4OZOA 4AG4A 2V5DA 4DEQA 1K3IA 1WKYA 3GM8A 3WF3A 4D8MA 4DUVA 2VZOA 3T2QA 2W1UA 3IB3A 4P08A 5FUIA 5HXMA 1SG3A 5C70A 2WABA 5J1XA 1KEXA 1ULOA 3MBWA 2J7MA 2JD9A 1DLCA 3MO4A 3ACHA 2CCVA 1J83A 3JXSA 1JU3A 2ZXQA 3WMPA 4JHZA 2ZEXA 5DMYA 1DYOA 3AC0A 3FL7A 1JI6A 3HNYM 4UAPA 3A21A 4ZZ8A 2JDAA 3UETA 3WNOA 4QX1A 3FHQA 3C8XA 4CU6A 4UOJA 2J1TA 2ID4A 2VCAA 4QPWA 2J1RA 3VD4A 3T2OA 3K46A 1O8SA 1GOGA 5A1AA 4BK5A 1EUUA 1JZ2A 2W91A 3GGLA 2XQXA 3BN6A 4ZY9A 3A7QA 4PF1A 4E8DA 1JZ8A 2VZUA 2W92A 4XUTA 2HLEA 2W46A 4XUQA 3ACGA 3WNMA 3WNKA 3E1F1 2W1WA 3ZM8A 2BGOA 4OMDA 3T09A 2VQTA 1JHJA 3HNMA 1JZ5A 1UY4A 5JXIA 4RN5A 3WNLA 4W50A 5C71A 1ULPA 2WN2A 2W1QA 4XUOA 2E31A 2OKXA 3OB8A 1PX3A 3PUIA 1K45A 3C7EA 4L0PA 3WNPA 4DXTA 1K42A 2Y6JA 4A3ZA 2C9KA 3I3BA 3K4AA 5IFPA 2VCCA 4LPLA 3THCA 1UXZA 3WQBA 1UWWA 2VQUA 4QX2A 4E8CA 4CU8A 3ACIA 3CDZB 4DXRA 5IHRA 2VJXA 3MUZ1 4W4ZA 1JYVA 1UY1A 3NJXA 2ORZA 4MO3M 5JXJA 1TVGA 4KMQA 4BXSV 3T0BA 4ZXEA 2W95A 2VMDA 1GQPA 2QQLA 2VZSA 2VZQA 2E33A 1K12A 1PMJX 2W47A 2Y6LA 3GDBA 3IIIA 5LCWL 1GMMA 4IUGA 5CYYA 2ZEZA 1PX4A 3FHAA 3THDA 3D3AA 2E26A 2DCJA 3K75B 2VZVA 4P02B 1OF3A 1US3A 4KI5M 1WCQA 4GWIA 1UY3A 1W0NA 4P00B 2CDPA 4QDQA 2YC4A 2B4KA 2VM9A 2W3JA 1UMIA 2VZPA 4DUWA 3FN9A 2WO1A 2WDBA 2RJ2A 4LHSA 4CU9A 5LA1A 1XC6A 2VZTA 3HNBM 2VZRA 4TXWA 2WN3A 3CQOA 2BGPA 1KGYA 4MGQA 1JZ3A 4MGSA 3MV01 2BBAA 1L7RA 4A41A 3OGSA 4JX0A 3WSOA 1IQDC 2Y6GA 2JE8A 2Y6KA 1NUKA 3W5NA 3I3EA 1W8NA 1W9TA 5IYYA 4KWUA 1GU3A 2V4VA 3CZJA 3DYMA 2EICA 2VOTA 1NAEA 3VD7A 2EIEA 3GXUA 3CMGA 2V72A 5JXHA 2W87A 1H6XA 4ZZ5A 2YFUA 3P1IA 1GOHA 3T08A 3ECQA 3F2ZA 2QQNA 2CE6A 4BK4A 1P8JA 1PMHX 4BDVB 2J1SA 2RVAA 3WMQA 3P6BA 2WZ8A 2KD7A 4JKKA 2QQJA 4LKSA 2CDOA 3A22A 4XVHA 2WYSA 5IJRA 1W99A 3CIHA 3DYOA 2YG0A 1LNSA 2QQOA 3VDCA 2WAOA 3LE0A 1JZ4A 4CUBA 3K77A 5G04L 4FI9A 3NNGA 3WF2A 2EIDA 4Q56A 1JYXA 2VZ1A 2RV9A 2YB7A 2ZEYA 3I2HA 5JXGA 3ACFA 4ARYA 1UY0A 4QB1A 4XUPA 3K4ZA 5DQ0A 1CZSA 3VD3A 1J84A 1NKGA 4XZUG 4DUXA 1F4AA 3CKHA 1JU4A 5I0DA 1JZ7A 3WNNA 3OGVA 4W8JA 1CZVA 3C7HA 2YFZA 4QX0A 1GNYA 3C7OA 4DXSA 4A44A 2R7EB 5JR2A 2LW8A 4BJ0A 1JYWA 3A23A 1NX9A 2Y64A 3UESA 2VO5A 5JMOA 5CZKA 3BGAA 3MUY1 1BHGA 1CIYA 2CGYA 4A45A 1RYYA 5EIYB 2J1UA 2J1AA 3LEGA 1OT5A 3T2PA 4CUCA 3HPNA 1H6YA 3VD9A 3WF0A 2QQMA 5G05L 1UYZA 2PQSA 2VTFA 3T0DA 1D7PM 3J7HA 4PT6A 3C7FA 1UY2A 2W94A 4GWJA 1SHWB 3PUHA 2VL4A 1OD3A 2BZDA 3HOBA 1DP0A 2JKXA 1O59A 4PQQA 5LA0A 1TG7A 4DEVA 3LEKA 2Z4FA 3IAQA 2CGZA 2J1EA 3SKVA 2YC2A 4YPJA 2WUHA 3IAPA 3OBAA 4XUNA 3WF1A 3NRUA 1XNAA 5EJ1B 3I2KA 3OEAA 5EJZB 3I2JA 3I97A 4M4RA 3K4DA 4OUEA 2QBXA 3NQHA 3CZUA 4D0QA 2EIBA 2VCBA 2WBKA 4MADA 3LQCA 4P5YA 3VDAA 3LPGA 2W9XA 2W1SA 3I2FA 3ABZA 2C26A 2DCKA 4QDRA 1GOFA 2E32A 2X09A 4OMCA 4LQRA 2B9VA 1I5PA 2QQIA 2ORXA 1W9SA 1EUTA 2VR4A 4A6OA 5DPNA 4JKLA 3IDAA 2WO3A 4XURA 4JKMA 3SEEA 3WF4A 4TTGA 5F7UA 2HYXA 2WZEA 1XNTA 4MOAA 2VMFA 1JYNA 1W8OA 3I2GA 1OH4A 1UX7A 3EB7A 4UI9L 2XONA 1UZ0A 4GZ9A 3LEIA 3I3DA 4CUAA 3SKJE 5HPOA 2VZ3A 2X05A 2BERA 2VMCA 4QB6A 4QX3A 3T0AA 3WEZA 1YQ2A 4ARXA 1MPXA 1O8PA 2J22A 3C7GA 4QDSA 4CU7A 3ETPA 3HJRA 4M4PA 3LPFA 3SEPA 1UYYA 3DYPA 5C7GA 1T2XA 1GUIA 4QAWA 2Y6HA 2QQKA 4A42A 2WAAA 4RYDA 3NJVA 4CVUA 3OEBA 3OGRA 1W9WA 4QB2A 5JUVA 4A4AA 1JZ6A 2X10A 3W5MA 1CX1A 5DN2A 1L7QA 1OF4A 3I2IA 4AAXA 1CZTA 2XOMA 4OYUA 3EYPA 5B4XA 3HEIA 1XPWA 2WO2A 3DECA 5B4NA 2Y8KA 2VC9A 2WQ8A 2C4XA 1UXXX 3VDBA 3HN3A 3UNPA 2ZEWA 5LA2A 4ET7A 2W5FA 2J1VA 1R64A
chains in the Genus database with same CATH superfamily
5LK7B 1BBDL 5D4JA 3MF6A 1E90A 4LSRL 5FKAB 2XNAB 3IDBB 1B6DA 4QLRA 2E75C 4GRWB 3OLGA 1TSRA 4QGMA 3NUKA 4ZQTA 2CGNA 4N5ED 3TN0C 4KOBA 3GJEA 4LASL 1L0YA 2OJ1A 3V5HA 3WLWD 4RA3A 4IEXA 4KNTA 1CXEA 5C0CB 2QSCL 1T0MB 4GW1A 4AXWB 5BV7L 1G7PA 3MBXH 1O7VA 5D6DA 1GWKA 2O30A 1CE6B 1RERA 2YOCA 2LTQB 4ODXB 1XGYH 1ZT7B 1YI9A 3SKOB 1A6CA 3FQWA 4FG4A 5GZFA 3I2OA 3E9UA 3FOMB 4ZXBC 4RSUA 5F5QA 2ADGB 3ZZ1A 2GN3A 2GAUA 1WSST 4AAPA 4XJAA 3ZYGA 4IRSB 4J7RA 3EGDA 4NIHA 1SOSA 5EBLA 5K9JH 1H2KA 3MBWA 5HVGB 4QNPF 4KKPA 5AKTA 1TZIB 2RR12 3CZNA 1ZD6A 3G3LA 1N10A 4UOZA 2JG9A 3IMRA 2BBVA 1S4CA 1M9SA 3NNJA 5J3HD 1UFGA 1W2KT 2BK8A 3DARA 3QDJB 5GGUB 5JXEA 3M8LA 4AZ8A 3RU8H 3L3OC 3UJJL 2DTYA 3CH1A 4RGOL 4M7LT 4NRZB 1AYM3 1S7XA 4MDJA 4CDUA 5AW1B 1WPCA 2PR9A 1OOPC 4GAZA 2VCAA 4N4YB 1A9BB 4NUGH 1NGQL 4WWOA 1O8SA 4K23L 2NQYA 2PPDA 1SLBA 3TVMC 3F7QA 4JPSA 4LNRA 2VLKE 1FL3B 2F8VA 2CK2A 1EVTC 2Q0AA 2YFOA 3CZKA 3SPGA 1YNTF 5KXBA 4PRNB 2IFFL 3UMTA 2AKRA 3PABA 4UUJB 3NAPA 2GY5A 1OTUC 1MCCA 2O5ZL 3BP4B 3L3KA 4OHXA 2XG3A 2HLEA 1LP9F 3O8XB 4C1WA 4L29B 3VA6A 3MUGA 4L1SA 4JB9L 4GJTB 5J11C 1ZSHA 4KVPA 5C0RH 4U33A 1G9DA 3DOSA 3WNMA 2B16A 1B9ZA 1YPZB 3WIHL 3UTTB 5HYJD 2ATPB 1I82A 2BVQB 2DQTL 3S4SG 1BMGA 4K73A 1JOIA 3VNYA 3RGVC 5JPMB 4E42A 3OSDA 1PZDA 2AV1B 3MLXL 1OSYA 2BU9A 1RMFL 2WWKO 2YAOA 4JFOB 4A68A 4COWA 5ACA3 1NEPA 2CKBA 3DO7B 3IJSA 1KJ2A 4P59L 4AG4L 5C71A 3U2SB 4RCAA 1JE6A 1RV6X 2WLNA 5F7YC 2WSKA 4OJDH 4BQWA 4HIQA 2E31A 4YFWA 3WI9A 1JGVH 4ZYKA 3ULUD 1LWJA 3MNWB 4F20A 4AHXA 2X9XA 2EIZB 5JHBA 3AP4A 4G4FA 2W0FA 3L3JA 5DHVH 5FLUA 2WXKA 1VGEH 3QNYA 3CF6E 1IAOA 5KUMA 4AQ2A 4B3VA 3KHQA 5HV0A 5FZOB 2BVOA 4H8WL 2WXQA 3PHOA 1RXFA 3FZUD 2C7UA 3NSTA 3I2CL 1NGYA 3IDJA 3PDOB 3T4AC 4DB5A 4Z82A 5F5IA 4LPLA 5K5YA 1HWGB 3DUUB 3EOTL 2HRPL 1TO4A 4X6BB 5I0SA 4QXCA 4HZLB 4PJGF 4UQDA 3IMVA 3ZYOA 1NCRC 1CCZA 4KI5F 2GN7A 4AYUA 4HFWA 1BZWA 2Y1ZA 2E6PA 1OP5H 4BQ2A 1JZJA 2GBTA 4G8IA 5JXAL 2WLQA 3BMWA 4GO6B 1C08B 4HSQA 4YUEH 5A7OA 2H9GB 1RUG1 1QFWH 5A2FA 4G8GB 1CAXB 5F2WA 2C3VA 1AOHA 1WS7A 3BH8A 3F84A 4X6FB 1XRUA 4RS5B 5IWFA 4JRYA 1OA2A 1BSIA 1DN0A 1AMYA 1LNUA 1J9CT 1TSHA 4HCGA 1P5UA 3F62A 4FQ2H 5D2NB 5J8OA 2K4WA 4KKAC 3OKLA 4K15A 4XOCA 1CR9H 4DXZA 4ZXEA 5IW6A 4GXLA 4XYXA 1EANA 3WIFA 1BK0A 5KVFL 1QRND 2JELH 2C3GA 4IMLB 1GZPB 1NLBL 2P24A 2VZSA 2AEQH 2XKNA 4ELMA 3IDXL 5TGBA 1U5ZA 1S7UA 2WNEA 5BNOC 4IBLT 4MSWB 2D5HA 3MJ8B 3KV5A 1CBVH 4HPKA 3TIEB 3LD8C 1OSEA 4IU2A 5FK7A 3KPSD 4QGYA 3KWUA 4G83A 1JHTA 1TNRA 1FV1B 2R2HA 4JO2H 1DU3D 3SQBA 4XHQA 3QZWB 3MRHB 4RX4A 1ED3A 4JDVB 5FV3A 2C0ZA 1RKRA 3DV4B 1QGLA 3V6OA 3IJYB 4ZMAT 5JHDE 2Y23A 3N1MC 1R093 1I3RA 1CQ9A 1CK0L 3BTYA 4G9FB 3TPKA 3RDTA 1MN4A 5A6XA 4F3FA 1IQWL 3O1PA 1TQVA 5C0AB 2YMTA 4M7JH 1LRHA 1OTUD 5EOQH 1RK1A 2BOBB 4JM0A 1NCAH 5AOKA 3Q6GL 1BD2D 2FUQA 2YAQA 4DGVH 1G9MH 2HLAB 1XGTB 1UO9A 2JI1A 1Q8MA 3BFWA 3O6FD 4GAJL 1KGXA 4HS3B 4TQIA 4LCYA 3SZKC 1UT2A 3WT3A 2OTWA 2E8YA 2Z0UA 2DQJL 3FJSA 3UJQA 1FGVH 2K2SA 2KH2B 2OAAA 2VZRA 4AV0A 4AV5A 2Z31D 3PJSB 5CJOH 3VBFB 3W11C 4IRJA 3L1OL 3LEYL 1GYAA 1BQPA 4N43B 5C0ND 1FFTB 2ARJQ 3W58A 4A41A 4JX0A 5ERWB 5HTSA 2Q1FA 2XLAA 4Q29A 2YGLA 3EBGA 5MEPB 3I3EA 4LK7A 1NFKA 4E4DX 1RMFH 2B1AH 4KWUA 1RUML 5AD0B 1QBLH 4Q4V1 4ZFQA 4AQ1C 4XHXA 4R4ZA 4KX8A 1G1OA 1AZBA 4LCWB 2ZWNA 1G6NA 4AWDA 1RVF2 2N1KA 5C07D 2RS51 1MZFA 3DBSA 4LUMA 2CPUA 3C9NA 3INUH 4KK9C 5HHNB 1UF2C 4JVUA 2X88A 1CD1B 2I9LB 3DDFA 2HRGA 5J6HB 4K6BA 3ABGA 4FI7A 5GZNA 1T1YB 2NMNA 5KJRL 4PR5B 3BRGC 1I9EA 2IALA 1M1XA 1DQIA 4WI2A 5HHQB 3QPXH 3FQ4A 1EBAA 4HFUL 4X6DE 3U7WH 4X4XA 4LAQL 1PGSA 3WZ1A 3KLLA 4PGDB 4WEUD 3T1FA 1RK1B 3FSAA 3WMQA 3RZCA 4PREA 3D30A 4IU3B 1TME3 4JY4A 5DMIL 3QE5A 3BYYA 4KZDH 2E7MA 1JUFA 2IDTA 1AR92 4F8PA 2ZGLA 3D3VB 3VDDC 1ZKAA 2JB5L 4I88A 4YGVB 3OAUL 5HDBE 1UTDA 2QDWA 1DVZA 3FB7A 4M48L 2RFXB 4JY5H 2R0LL 2VDNB 4OLUL 2IWGA 4CVWA 4YHZL 5JYLA 3ZVXA 4XXCC 1QKZH 2TSAA 4Q2ZB 4PLKD 5I76B 5F1KC 3ULVL 5EWIH 3P9MB 1BJMA 1JZ4A 2BY2A 3MXWH 4OGXH 5JW4R 3N1PC 4DP7X 2NQDA 3NSYA 4LSQL 1M71B 1N18A 1UJ3B 4XPHL 4DCQB 5C0EB 3F2LA 2XLGA 3POWA 1W05A 2WZ5A 3NSJA 1MDTA 1NBZB 3W82A 5AD0A 3EO9H 1TTFA 1AR81 4WWKA 4FPHA 4FFTA 3LN5B 4HJTA 3TAYA 1RLBA 5AC91 2J4WL 1YN7A 2QVFB 1FNYA 1B2YA 1XNCA 4OM0L 4B0MB 3VQ2C 1W8WA 1INDH 3MIGA 2Q3AA 3HZMA 4G7QB 2K8QA 4NQTA 4KY1L 5BZDB 1TE1B 4MFHA 3I2HA 1LB2A 2QADD 4JPVH 4CVZA 1DJSA 1VFMA 1WE5A 1VESA 2B1HH 2ZUVA 3RL2B 2WINB 5DHVA 2B42B 4B4QA 4I2OA 4D3CL 2RMU3 5DQ0A 1ZRCA 2VDQB 1T1YA 1NGWB 3I9GH 5F3IA 2P52A 1MAML 4H0HB 4NRYA 5DHYA 2PPFA 3ZKXC 3PPEA 4QRTA 5CWSB 5EG6C 1WFNA 1U8CA 1DJZA 4DQOH 1N3PA 3MYXA 5JCTA 3I2IA 4IBSA 3O45A 5LBVA 3OD4A 1G0XA 2VH5L 3AJ7A 2EKSB 4KKCC 1G9NH 4XMUA 1XL6A 2J88L 1RVF3 1BJ1J 2ZOLA 5FP7A 3VWJB 4NFDA 3ZIYA 5E4EC 3DHUA 4S2DA 1TZ8A 1FV2A 5G55A 5EZWA 1G9BA 1J05A 3F8UB 1NBVL 3PAVA 4JGUA 2X53S 1X7QA 3GI9H 4JQVC 1FRGL 3ABKB 2VBPA 3FB6A 4KRPB 5CJOL 2ESVD 5FECB 2W0XA 4Q4V2 1GYKA 2MHFA 2VMIA 1CIYA 2UZXA 1UCXA 2BVVA 3DGCR 4YDKL 1YYLH 4XMVA 1Q56A 4LLFA 5C9AC 4M43H 1EXUB 4LA3A 3RPQA 3HPNA 4HJJH 3OSKA 1KDKA 2ZSVA 2HH9A 3DJ9A 2C9UA 3NIDF 4O2CB 4YO0A 2XIIA 4A7GA 4CADA 5J9PA 3FUEA 3S8GB 2VXUL 3W39B 4PT6A 1IE5A 3ZSSA 2WOYA 4I9XA 3KZ8A 3ZDSA 3HEIB 4NQDB 4OKDA 4MS6A 3IF1A 4GWJA 3QI9B 5FK9A 5C0DA 3V0VB 4IDJL 5ESAB 4EN8B 3HOBA 3EJRA 3S36H 4XC1H 2IC2A 1IB5A 3GRWL 1Z3GH 4K8RH 2E4FA 3VFPB 2GJZA 4TNFA 3LOIA 1MHPH 4PQQA 2VH9A 3O4LD 3ZXLA 4R7NA 4IGBC 5TDNB 1Z9NA 2FJFA 4NKDB 4A2FA 2A73B 4G6MH 4XTRD 2F6AA 3OTTA 3CD4A 3U0TA 4UT6L 1UWFA 3VTTA 4OH2A 1A1NA 3NRUA 1TFHA 3EO0B 1IM3A 1WC7A 5D7LD 2V7HB 5F2FA 1ND2B 2WNWA 3F58H 4RA0C 1AYN1 3P3NA 4QUOA 3BOWA 4Z7AA 3JD73 4XNUH 3BZ4B 1T1ZB 2GSGA 1MWAA 5FZLA 2YPLA 4CC0A 3KT1A 1LP9B 3GWJA 3VI4B 3LPGA 1GGBL 3PYCA 4X6EA 3NO8A 2NDFA 1U8LA 2K70A 3FONB 2EO1A 5AUMB 3ROUA 3IKCA 1C4RA 3WE6A 4AEDB 3PCYA 3NK3A 1E30A 3ZTJG 1MFAH 4HIJA 3HC0B 1J1LA 4F9LA 1ZWIB 3AT9A 1MFMA 2YQGA 4A55A 3MICA 4MD5A 1LEKA 3OOXA 1LOGA 2A0LC 4AKOA 2NY3B 3KYAA 1DEDA 2GFBA 5LBSL 3OLIA 2NTFB 3L1GA 3FH5A 4BFGA 4HPOL 1SJEA 1FYHB 4AEJA 4N68A 3VI3B 4IV1C 4LOFA 4NNYA 5EO9B 1SEBB 5D7IA 2UYLB 3STZB 4FX5A 4NO0B 3LKPB 2J6EA 1U8JA 4KGLA 4PV8B 3WUZA 4WSGA 5DUXA 4IKNA 3HLAB 3P3RA 4DRVA 1B4JL 1T66C 4X80L 3TN93 2Z4QA 1RZJC 1MY5A 1DCEA 3CUPB 3KYNB 4G42B 1JD7A 4JN1L 4KX9A 5I9QB 2FJHA 2VDKH 1XGQA 3UC0H 3QRFM 3VXUD 4MZUA 3VKOA 2Y2TA 3CVHL 4HGMA 3TN92 4L5FH 4WO4C 2DYCA 4Z7QE 1O8PA 2GMMA 1J12A 3BUQA 4FBFA 3WXWL 5HDQL 5I24A 3GK8L 1NMBH 1R091 4P9XA 4YGCA 3THPA 5C5UA 1AQHA 1HHKA 4WM7A 4NIGA 4CSTA 1IGIL 1QLRB 4LSRH 3LDBC 2Y5QA 4FOWA 1A0QL 4QKFA 5MERB 1FL3A 1E43A 5DVNA 5IVBA 1QRNE 2CMRL 3P0VH 3QW9A 4Q6IB 5GISH 5F7HA 2ADEA 1YHFA 1TEIA 1LOFA 3ZKUA 2G9HA 4PB0H 1TJMA 3BO8B 3UROR 2EDQA 2E7BA 3B5GA 4N6RB 4QRPD 2BIHA 2V17H 3QHZL 3SOBL 2DF3A 2PYED 3KLAA 3H3PL 4WI3A 2PHLA 5FYJE 4LLOA 2UY6A 1BFTA 1YFWA 1X9UA 1J1OH 1U8MA 1YJLA 2VBBA 2Y7QA 2WO2A 4HIHB 2VXVH 1VACB 5DRWA 3WY3A 4ZD3H 2MCMA 3K3OA 1JF6A 4FP8H 5D1XE 3VX0A 3ZO0A 3RWHA 3EBIA 2GAZB 4HUXB 2EDLA 5E7BA 3MRIA 1T21A 1YEIL 4AQ1A 5JNYB 2ZEWA 2P3JA 3DK0A 2KPNA 5EF2A 4WFGD 1M1SA 2EH8L 1OM9A 3O11A 1LTXA 4P2AA 5DJXB 2HP4A 3BIBX 4OCSH 2AK1H 3S37H 5I19L 4GG6F 2EDRA 2LS6A 4QPGB 5E8AA 3DHPA 3ZE2F 1XZ0A 4LCWD 5DVMA 3UL2A 1P69B 4IRJC 2RS13 4N90A 3JB8A 4E4HA 4MA3A 5GGTA 1XSQA 1FE8L 3NABH 3ZQWA 1NLDL 1FSKB 5FFLA 2QLVB 4R7DA 3FT1A 3KPSB 4TM9A 3ULAB 3GM8A 3FFDA 5KUKA 2FL5A 1FIEA 4JDZB 1F3DH 5B3JF 5GSVA 2L8AA 3Q8CA 4JVWA 1ACZA 4XAWH 3Q9QA 3FF7A 1BDYA 4ZFOB 2VE1A 4EWAA 4HLEA 3MLRL 3GYRA 1YZZA 3WDXA 3QEGL 2W52A 1SFPA 3FO9B 3LDKA 4C90A 4ZDHA 4L2LA 5IB4B 1OFSA 1EV2E 1C12A 3DGDA 4GQ9H 5LHDA 3DRQA 1DLCA 2OUJA 4UBDD 3GBFA 3RYRA 2NR6D 4O2EA 3ACHA 3GTNA 2XBO3 4IV3C 2ZXQA 1K4CA 2ICWJ 4XMPH 1VR3A 2UY6B 4RGKA 3P4OB 4B1MA 3GIZH 4IEVA 5ALCL 5JOFA 4N43A 4JGJA 2AQ2A 2HJKA 4RBPK 1PQZB 2DFBA 4PP2A 5KSBF 1KLUA 2XWZA 2MTPA 1EDQA 5DK0A 1ZNPA 2WSDA 2R9HD 4TSCL 3ROLB 4UTAL 3V9EA 1S1AA 4YVSC 3BB6A 3REWB 3Q8BA 2BW4A 4X99B 3BKCL 1G4RA 1BA9A 1BMWA 3TNNB 5TQ2H 2AJ3A 4UTBL 3IDNA 2YZ1A 5KC6A 3ATFA 4DO5A 3VWKA 1JDDA 2A3WA 4UUJA 3NAPB 3GJFA 3WCSA 5DRXA 4I4WA 2OPCA 2Z93A 1ZZCA 4WM7C 4NCC2 1CUOA 5DJZA 1TJGL 4KTDL 4ZFGL 4CP0A 1JGDB 5JI7A 5FXCH 1BBJB 1BOYA 5IK3B 2R072 5H35B 3NCMA 2XN9D 1LEMA 1PO13 2UZPA 3EG9B 3IFPA 3MRLA 1B09A 3K2UL 1T5XB 2R15A 2WFPA 1PKQE 4FOVA 4GRLC 4HIEB 1BYHA 4Q4IA 5AAMC 4YG3A 1J1PL 3T8XA 3UJTH 4MCMA 3VBFC 1B9KA 3EHBD 4LCYB 2OMBA 1QATA 3FO1B 3ORJA 1RD6A 3MQIA 2IO5A 3CX5K 1TQWA 2MHAB 3G6DH 4QHMA 1AG6A 3WFDL 3LKQA 8CGTA 3ZE0F 4P9HH 1PZ8A 4KRLB 3FB8B 1WS8A 4UT7H 3T3ME 1LEGB 5F89B 4ZO8A 4L8SC 4PTTA 1X33A 5DMGD 2JFCA 3MOBL 4OHVA 3PU8A 4DIQA 3POYA 1OAQH 2VAAB 3I75B 3MREB 5EMYA 5I8KH 5KVEE 4XNMB 1RJLB 3O2DH 4OLZH 5J1TC 4XO3A 4DKFH 4NAOA 3FN0L 4HBCH 4MCNA 4OSUH 3VUAA 2VUJA 3KLKA 1LYQA 2B7YA 1T2QL 2UY9A 3MR9B 1DL7H 3WN5A 4ENED 2J6EH 3H53A 4CDXA 1KCRH 1L3NA 3HE6B 3TA3B 4URTB 1AKJB 5L4IA 4PVLA 4YWGL 1AS8A 5EJ3A 4F24A 2XQBH 3TH2T 1ZPLA 3KPSE 5ANHA 3WN5C 1PIFA 5G4MA 5FXVA 3L5HA 1KIUB 3RDJA 2F5AH 5CBAA 1G8WA 3THCA 2MNWA 4D7PA 5EP9A 4AGVA 2PWFA 1GGUA 1TNNA 2NXYD 4UW4A 4QX2A 1SHXA 1RL3A 3B9VA 1T4KA 3C6LC 5MENE 2CA3A 3S3DB 1MAKA 1CTMA 3ZDYE 3CVIH 5TFSL 1F15A 3VB8A 3CSFA 4IBZA 2XJRA 3APFA 1CGSL 2I07A 2JCCF 3FN3A 3BAEH 4RMSA 2FQPA 4LSPL 5JZ7C 3N35A 3RJ2X 4W93A 2E7QA 5FC9A 4LLVB 4C4KO 3Q5OA 4JMXA 3N2JA 4OFYA 3DXUA 3DSFH 2R2EB 1MCSA 2QLYA 4JHAH 1D3CA 3NA9L 5FQ0A 1U3HC 1U3HB 2XWTA 1MVQA 4FOQA 2SLIA 3QRLA 1DZRA 1OP3H 1B35C 4XDPA 3HB3C 4KNQA 4FZEL 4WGKA 1DVTA 2X87A 2PF6A 2APXA 1I9RA 2N7BA 5D21A 2CUIA 2ZGSA 4WTXA 3CG8A 4PBWD 3DSNB 3RNQA 3GIZL 4C1XA 2P5BA 1VDGA 1JOBA 4MB4A 4HS6A 3K0WA 2OSLA 4G7SB 3NJYA 4ICWA 3KG5A 3N0AA 4YIQA 1IIKA 1KYOJ 1U93B 5GRZA 4QRUA 4Y9BA 4DP4X 3DUHA 3L4ZA 4PJFF 3LN5A 1M42A 2BVTA 3MGOA 3GEFA 4WKZA 1NIAA 2Z4TA 3ZXFA 2DIJA 2VITB 4UV7L 1A7OL 3PAUA 4X6CE 4Z7UF 2CLRB 5AOIA 3EJTA 1KV7A 4NNPL 2D6MA 3CIQA 1H3TA 4JRWA 5TE4H 2XL9A 5MENA 4XBLA 4N0FB 1FN4A 4KXZH 4KTGA 5A6YA 2JTDA 4A6SA 5FKPA 3QJQB 1ZX5A 5SX5K 4MMZC 5ISZE 4LBQD 2VZPA 2N59A 1PS3A 2E7HA 1EEYB 3RJDA 4AFMA 1K5NB 5ABDE 2WLLA 4MAUL 3HAEG 4COYA 1AGFB 5LA1A 1MW1A 1S7VA 2VZTA 4MG2A 1X5ZA 3CQOA 4AL8C 1TQBB 4PRBA 1VLXA 4U1JA 5I0ZA 1JNLL 4RFT0 2Y1YA 1VP6A 2Z79A 3TXAA 3VI3E 1QOOA 2BP0B 4AI2A 4AM0B 1AS6A 4Y22B 2JE8A 4Y2OA 5CFCA 4UTCA 3OWRA 3BOVA 5C0BD 2ADFH 4QWNA 2Q2LA 5AYTA 4RDQF 1J5HA 1Q9LA 1KYAA 5C0CD 4IBTA 4UU9B 1CD1A 5KBMA 3V6ZB 4P2OA 3FT2B 3Q06A 1VBA3 2BDRA 2BPA2 5DS2A 2IDUA 2F18A 1ZT1B 3DYMA 2B14A 2P5PA 3OKLB 4NO2B 4RNRA 2NY5C 1MEXL 1AVBA 3VA2C 1RUJ1 4BISA 4OIFA 4CSPA 1VAHA 1AZUA 5ETUB 3LPWA 5I5IA 1MG2C 3MA7B 4J12A 3PXLA 5J12C 3BZEA 5J1AB 1KEMH 3ECQA 3NPSB 4LUKA 1E42A 4XXWC 4Z7NF 3WP6A 3LQZA 3A24A 3G6JE 4S1SH 1HHIA 4HKXA 1SFYA 4OM0H 1D4M2 4PJCA 1BVLB 1JPTH 3OJBA 3GJFH 5C0DB 2FCVA 3ILRA 4K5MA 2BRRL 1GCFA 3QQNA 1JJUA 5FR3A 2AJXH 1EVUA 1P9MC 2KD7A 4LKSA 1MCJA 3IDIA 2A6ZA 1R24B 2FCTA 1CS6A 3W57A 2OLDA 3GSXA 2VN5A 4Y4FB 5FKBA 1W99A 4RGND 2OW6A 4LEXH 3K6FA 4P2RD 4P4KC 4LSPH 1DANT 4L4TE 1HZHH 2BOBA 5GLUA 3PDQA 3LE0A 4CUBA 1RJYA 1TYJA 4KMTH 1E4JA 4P48A 3VXOB 2W38A 4YC2B 1LOFC 2OKXA 4L5FE 5FYIA 3DETD 3GMLB 4YNYB 4D0BB 2H5UA 1DBBL 2DIAA 5GRVL 1YNLH 1OCWH 3J07A 5ADPH 2EIDA 4FZEH 4D0DA 4FERA 5I1LA 1LECA 1OQDA 4NPYA 2WUBH 5IK4A 1CMOA 4I7ZC 1F2QA 1DSFH 1WD4A 4DGYH 4KQ7A 4KK5C 1JFQH 1VGKB 2WVVB 3FQTA 3MLTB 3R0NA 3DO3A 3TN0B 4Q4V3 3ZPYA 1OE2A 4AYFA 1CICD 1HQRA 1CD9B 3MF9A 4W9KC 2I85A 3ARED 3FCSA 1QKQA 1N8ZB 5KWYC 4OD2B 4ORFA 2VQ1B 2ADJA 4Q1PA 5MEPA 3PTRB 4JO1H 3WXPA 1JYIA 1XH2A 1OLMA 1UB6B 4NHUA 1L7IH 3FHEA 1HU8A 3H9AA 2DFCA 1UACL 2DYPD 2ZYSA 1S9XA 1UD5A 1OBNA 3BVDB 4WNSA 3BTXA 1UCTA 2YD5A 3BSZA 3T0EC 1HHIB 4ABUA 4F7EA 3OXRA 4AI8A 5BNOB 4PYGA 5IG7B 2ZUQC 2WO3B 2NZ9A 3WO4B 2OJEA 3B7YA 1CFTA 5EU6D 4IRZA 4IEFA 2NYYC 3N06B 1DQ6A 1JYWA 5L0QC 4EIUA 4N22A 1U9KA 4YPGA 2D31B 1KPVA 5HGHB 2OXGB 5IHZA 2Q4SA 3OCPA 4ZS7H 1Q8VA 3LEYH 3SDXF 2DUOA 3EDKA 4WRLA 2F19H 1I5ZA 3VUOA 5BNNA 5AFAA 5HDOA 3WAKA 4JY4B 2HSIA 2X4NB 1DE4B 1YMMD 3C6LD 5T5NG 1BQRA 2FX7H 4D7BA 2A3XA 1HILA 3ATAA 2X29A 2R062 4WJ5B 3ZO9A 4NPYB 3VRJB 2N7AA 3UGXA 3WF0A 1XF4A 3F58L 1FQ9C 3T2LA 1PYWA 4I02A 1L9TA 2OM5A 3C08L 3QG7L 2WSPA 1DR9A 3WTUA 4ISVA 3VXTA 3N43F 1ASJ3 3W9AA 3DIFA 1LWRA 1N7MH 3PQYE 3Q2NA 3QZMA 2FLRT 1T04B 3FTGB 3S5LG 3VXUA 2DBIA 1DBML 4H4NA 5SWSE 4XNXH 3KPRA 1OA3A 1NEZG 1ZRDA 1EJFA 3AMPA 5F39A 3JV4B 3PXJA 3W2DH 3LKSA 5B1CA 1KEML 4I0CC 2DUQA 2B0SL 5JHDD 2ATPA 2BVQA 4JO4H 2CWSA 1NMAL 5H37H 5BZDA 4E4SA 1I8KB 4IIQC 5DJAB 1LGBA 5I82A 1KJ3H 2AXGB 2HJIA 1UHVA 5FYKU 1RZ8B 5KTEL 1K2DB 2QVMA 3IAPA 1FV3A 2JIJA 1KJ2B 1Y6KR 3TCTA 3CN0A 2WO7A 3PREA 5DEJA 1Q72H 3QEQA 4NIDA 3QDGD 3LH9A 4R2GB 5CWSA 1ENSA 2BGCA 3OEAA 4XCFH 4I18A 4IHBA 4JKWA 5DC4B 5FYLH 4BXVA 2VW1A 5BUVA 4DMIA 3T2NH 1RQ5A 3FOMA 2H4EA 3GSOA 1EERB 1G7MA 1RSYA 3JQOB 4XPHH 5AVWB 3ATEA 2XJPA 3CSYB 4FXLA 3PAYA 2EALA 2AJUL 4ZUWA 4ACTA 3RA7H 1FO0L 2ERJB 2ERJC 3ZDWA 1S0JA 1VBB2 4DNLA 4ZTPL 4AIZA 5IW3A 1I75A 1IGJB 2CQVA 4OZHA 5I1CH 5C8WA 2B9VA 4KY1H 4BFFA 3L9RB 4WZFA 2ORXA 3DIFB 4D9QE 1S7RB 5E8PB 2PTUA 2WLIA 4EN9B 1OD5A 4KTYA 2ZOKA 3ARBA 5HHME 1H4HA 1DQLH 4JKLA 4TSBH 4WFEE 2JXAA 5DPNA 2BDNL 3SEEA 5I8CA 1JNHA 2AEQL 2CWMA 4DZBB 2XXZA 2DQCH 4KKRA 3UZQA 3K7UA 4NWTH 3QDJD 4EN3B 5AAWA 4X7DC 4CDUB 4MHHG 3E97A 2R4SH 3FQXB 2XONA 2YSTA 1UZ0A 4G6AC 2JWPA 1LO2L 1RL1A 1NAMB 3M1OA 3QHZH 5LRRA 2F7RA 2PP8A 4YM2A 3MCG1 4KZ0A 4AEKA 3FJTA 1MJUH 2IGLA 2XOTA 1T66D 4M1CD 2V7NB 2VZ3A 2W9DL 2HFEA 2NUTB 5EZJA 3H3ZA 4FPGA 4HFUH 1I85C 4YZ4A 1L5GB 4JZNA 1MJ7L 3ATDA 4PRPE 3SDCC 1TZOA 5HHOD 4UAOC 4JHBA 2LVEA 3CGTA 1DQJB 3KHOA 2E7LC 2PHXA 4PLJD 4ADIA 4JY6B 3DYPA 5C0CE 4MQ7B 5GJTL 5AB1A 2QFRA 1FH5L 1U8KA 4K3DL 3NIFB 3CEWA 1DLHB 1MCOH 4IESA 2Y72A 4XQDA 1EO7A 5DDJ3 1ND0A 4NQCB 4R4XA 1AQDB 2A6KA 3LRLA 1CURA 3UAEA 4F7CB 4ONFH 3PWLA 4DKTA 1TLKA 2XWBA 1MZ5A 3JQXA 2MRYA 1K4DA 1H5BA 4QI3A 4F37F 1XD0A 5CGTA 2JXMB 3FAWA 3CXHJ 3TO4D 4BFOA 6FABL 1UQXA 4FXGA 4NMIA 4AAXA 3D39A 4JZOB 4XXCA 5DCCA 4EKJA 2P37A 1NCNA 2BWDA 3MV8E 4XCEA 4TSVA 4GUPA 2AEIT 4NZUL 4CRPA 5I91A 3BAYA 1J0KA 2A6VA 2D03H 2V8MA 4OCMC 5D93C 1OD9A 5E0QA 3DRTB 2IMMA 3B6SA 4L9LC 3CBJB 2UXVA 2VOXA 2L7EA 3RZCC 4IJ3B 1H8VA 4O02B 5CEZH 1JHKL 2BSTB 2ZBJA 3HE7D 4XP6L 3F7YA 4LCCC 4MMYB 3INUL 4LKXA 4N2OA 2QZ5A 4FOMA 2OXBA 3U14A 4XTPA 2FNWA 1UENA 1BVKB 3ARDA 4B50A 4CMMA 2PWDA 2DDUA 2NY3D 4YAQB 1AGBA 1U8IA 5DA4A 5TH2B 1WBLA 3FCTA 3I84A 2FGZA 2HBTA 3GLAA 3HJ0A 3ECWA 3QNFA 3VBHA 1AD0A 2C3XA 1VAVA 1NEUA 2V5DA 3WS6C 3RUGF 5FPXA 1V3LA 4YHML 2AEOA 3IDYB 5JOYA 1V9U2 3PGFL 4IGOA 2JWYA 4OCWH 3BKCH 1D9KC 3H6JA 2VH5H 1AYOA 1SXBA 1W2TA 4EDXA 1T4WA 1A7BA 1OE3A 2XUWA 4H20H 4HJGA 1S0FA 1WFUA 1SF3A 2PLTA 1QFPA 2IADB 4PV9A 4XO8A 4G5ZL 4BA6A 3HR5B 2G4GA 3RX7A 3HVDA 3KGUA 5DD1H 3EH2A 1EWHA 4J3UA 4IMLA 1IC7H 3D9AH 4OULA 4J23A 3JZ7A 3VGIA 4MSWA 1RUE1 3MRBA 4UIMB 1QYGL 5HYQA 2QDNA 3QT2A 4ZMXA 2AEYA 3AY4C 1SXZA 3AS1A 4Y1TA 1N8OE 4PW9A 5L7XL 2AK4B 1OL0A 4MJ5A 4CDHA 3KS0H 3FNKA 4Z78B 3X1EA 1AXSB 2HT3C 5CNHA 4GSRA 1RUI3 5JW3H 1XFPA 3ZZSA 1KTLA 1AHKA 3F7KA 2EE0A 4KAQL 5F72S 2XLLA 3EO9L 5I6LA 1C5DA 1YMMA 2ETEA 3DRTA 2EIZA 2YAMA 4IL7A 5JIHA 3T4YB 2HMID 1QDOA 2JE7A 1XH3A 4QOKB 1QW8A 4UNTA 2A0LD 1YC7A 3GXUB 2DOCA 1D5XB 3M17B 4E68A 5C8CC 3TRSB 3FH8A 2DI9A 2HEYF 1NSNL 2IAMB 3M4FA 2DZEA 3AWFA 3ZE1B 4UYQA 1U93A 5AOZA 5FYCA 4B8EA 1COV1 1BQHB 2JJSA 2LW3A 1A4KA 4XPGH 1IVLA 2RALA 5C0FA 3KL0A 5HVWA 3B2VH 3WIHA 3KT7A 2VXSL 4UDTA 1N1TA 2VTXA 4JFFD 3WDVA 2LM3A 3B2DC 3X2QB 5MENB 1BZ8A 4NUPA 3JYCA 5CM1A 4AW4A 2IXKA 2J73A 1XYOA 5IVYA 5I8YA 1JWUA 2RJMA 5KBDA 5DR5H 1ACXA 1HSAA 4DPRA 3NDYE 2FLBT 2IF7A 2AENA 4S1RL 4OZIE 3L3HA 3BEVA 1AGEB 2JIXA 2Y3AA 2BGOA 3NJIA 4Y9GA 3T3PF 4BA0A 5BUGA 1R19A 1JHJA 3N6YA 4L2YA 2OMWA 2IQAA 5JXIA 3C5SA 1DQKA 4CCNA 4J3SA 4MJ5B 4Q4W1 1TT6A 2WN2A 3QFDB 3UTSB 2Y26A 1DJXA 3BXNB 3QUYA 1E7VA 4WI0A 3GMRA 3RVTD 3AFLA 3IWUA 1AL21 1K45A 1S3KH 5B38B 1FAYA 3C5ZB 2IXJA 4LQ1A 1J8SA 1JHKH 4QYAA 4LBAA 5FMDA 5FO7A 1N6QH 4IOSD 4NJ9L 4JHUA 4G1MB 4Z5RB 1ZV5A 2EO9A 1JW6A 3MRGA 1ONQA 1ADQL 1J8HE 2D4FA 3IMSA 3OXSA 3QPQC 5GGSB 5LCVL 4AHYA 4KVNH 5HD8C 4PJ8A 1IUZA 4MXVE 1PHMA 1T4KB 2APBA 3DX6B 1UPSA 1F56A 3QUMB 4DO4A 5A6LA 3RSJA 3MGUA 2Q87A 5AOJA 3DUIA 3RHWF 3DI2B 4K94H 4X99A 3T8VA 1VRH1 4P2QB 4AUJA 4HKLA 1D5RA 1ORSB 2A99A 3VFMB 2C24A 5C4WB 1IIIA 2VDOL 1GW6A 2VDOB 3NCXA 1NOAA 4H7VA 4U1SA 3RWFA 4DXRA 1JI1A 4GEIA 1F2XK 3MV7D 4JGNA 4JG1L 3MNWA 5AFEA 4FPEA 3T0VA 4Q0PA 4Y1UA 5I1GL 1BFVL 4GEJA 5H2BA 1TVGA 3BT2H 4ODTH 2GJ6D 1B35B 4P2YA 2JICA 4MNGE 3IPEA 2XI9A 3IE4A 5IK3A 3I4IA 1YSOA 5FXXA 4PLJC 4P06A 1A1NB 3IFPB 5HHXH 1UIKA 3K2IA 2Z42A 4RHV1 1RIRA 1UXSA 3OZLA 5ACMA 1E5UI 1RH8A 4UILH 2Z5WA 4HH8A 5DURB 3FHAA 3CVBA 1HDMB 4N2FA 3LKRA 5IESL 3LIUA 2P49B 4NUGL 5F6IB 2E26A 2VZVA 2F54D 5I75C 1S5HA 4E9SA 3P73B 1IBBA 4K21A 1NCDH 3IGAB 5D1XD 2FSEA 3FT0A 3KM1A 2NSXA 2R56L 4AHWA 2ILLA 4C57C 4FP3A 2BNUB 2H45A 1N68A 1NPNA 5FM8A 3WP4A 4Y88A 1UY3A 3TASA 4QYOA 3SBRA 1HJBC 5LN4A 5FEBA 1M57B 1WITA 4ZTOH 5GGQL 4WNQA 3L9EA 4F2FA 1T22A 4NUJA 4JQXC 1PZ9A 2CO6A 4XNZB 4B9ZA 2W3JA 5HPMA 1CVNA 2EH8H 4PJBE 3D3VA 5LBCA 1JHTB 2BFGA 5HVHC 2ZMLA 2HFFB 4MNGA 4XJ8A 3AYAA 1NXD1 1M7DB 1UZ8B 1AZVA 4JHWL 2VDPB 1QHQA 4HLZG 4LLYA 2VY0A 3O8XA 3ZRCC 2K8MA 4FFYL 4P5KB 4QCIA 5FW6A 3SGKC 4CN4A 1JPEA 3RTQC 1JZ3A 2BBAA 4AIEA 2UV3A 2QTVA 5EIVA 4EUPB 4WV1A 1DN2A 2D31A 2CHZA 3QUZD 1IAIL 2Z4QB 1IKNA 2X5IC 1BXHA 2WWMD 1WMXA 2A1WH 1UC6A 5DZEA 3ERXA 4Y5VC 5KSAD 5IJKC 1JERA 4XN2A 3IZOA 2NY4C 4HDIB 1U91A 2EICA 1HESA 2ZX9A 4U3XA 5F3BA 4E36A 2PLV2 4E2SA 3J9SA 3ZY7A 1J86A 2LT9A 2P1BA 3VBRB 3VBRC 3QFJE 5AZ2L 3D0JA 4UQ2B 4F2MA 4KO9A 3V0JA 3E6FB 4YDLB 3AM2A 4HSCX 3UGFA 3P1IA 3Q3GB 1AJKA 1A7RL 2P5WD 4E41E 1FLRL 2FO1A 2VLKA 2QQNA 5IVXE 5FZOA 4AXOA 1U5YA 5C8JB 5CD3B 4PJBA 1GTFA 4YW4A 1OQXA 5B22A 2J57A 2PCYA 1N5YL 4E0RB 4IBUA 4ZD3L 1VIWB 2EDWA 2P43B 4WHYG 3UG3A 4NR1A 1RUOA 5MI0C 4U6VH 4QHBA 2VKXA 1M05A 2HWE1 4HKOA 3A4DA 4OIIL 4DVBA 2YBSA 2XXGA 4CCJA 3ECVA 4A2HA 2WJ7A 2WMPA 2AANA 2PELA 1W6QA 3DL3A 2WA3A 2NYYD 1BVZA 2R29L 1RSFA 1KCKA 1BXVA 4M7KL 2LRPA 2HB0A 1NFDA 3L4TA 1RUF1 2HWD2 3LH8A 3U4SA 5D72L 3K6DA 4ZW5A 2F58L 5EO0A 4Q6YA 1LNSA 2QQOA 1A3RL 3T65A 4QCIB 4U1IA 4MMZB 3V2AR 2FO4A 5IB2B 3ULVC 3K77A 2QVIA 4Q4Y3 4UAOB 4ODTL 3R4UA 4OCLC 5LNDA 1ZLUH 2VW2A 4ELDA 1VFAA 1YC8A 2WJSA 3QQDB 4FI9A 3E80A 1YUHB 4P5MA 3PUIA 3QD6A 3WNXA 4N9OB 4QHNB 4RBPH 4N2LA 5FIEA 1SCSA 1NGXA 5F9JB 3AX4A 2IAND 3CH8A 3DGTA 1ADQA 4H55A 5AB0A 1G9AA 4ZPIA 4PIXA 4UILL 4PJEB 1MW3A 2YB7A 2ZEYA 1E4XI 3SCMD 3QJZA 2MQGA 3Q9OA 1LDPL 1BYPA 4QB1A 3OXRB 5KS9E 5T33H 4F2EA 5ESAA 5AKVA 1IFGA 2AZ5A 1SEBA 3P3YA 5D7JC 5D7IB 4XZUG 5GGVL 5C3PA 4OJYA 4E5XB 2QQNL 2BHYA 1MS0A 1CYWA 1J58A 4I0PD 1J9QA 2VC2H 4W8JA 4YVNA 4YPGB 4WDIA 4NO0D 5LAXA 4XO4A 1DUYA 1L7TL 3O2VL 1SGKA 1JNHB 3C8HA 5DF0A 5GGSY 3WTSA 4B5EA 4YZFF 2PMZA 3UO8B 3C3VA 4F58L 1XGQB 1GBGA 5DGRA 3Q05A 5IFJB 4CE8A 1OXYA 1FZMB 1YHPA 2DB8A 4V11A 4UMGA 4UOW0 4ZPTB 4AVKA 1KSRA 4AQTA 4XHJD 1E6OH 4IEOA 2WSVA 1CN1A 1AO7E 2QNKA 1DHKA 1RC6A 3MLSH 5J96B 3V9CA 4XPBL 1U8HB 3M2MA 4D9LH 5K9KA 1PZCA 1IG3A 1NCTA 3L4YA 4ELME 1PFCA 2DYRB 4WUUA 1WUVA 4AEHL 1J1XL 3VI4A 3P30L 3F85A 4HMEA 1MW2A 2CGYA 2YUEA 3LKOA 3FONA 2LROA 4YSQA 2ZOOA 3EDEA 2NY5L 4ZMNA 3HRZC 3RI8A 4YK4C 3TV3H 4KGGA 4LFHD 1IEBA 4F8LA 4LKFA 3O45B 2A9BA 4ABVA 5LBBA 1L6PA 1WZ1H 2APFA 4M5SA 1BAFH 3HC0A 3SGDH 1TU2A 5DQJA 4CEWA 4DN3L 3AXEA 3H1YA 2L0DA 5ENWB 3NV4A 4NPRA 3VNZA 4Y3OA 3GKWH 3LCYA 1ULDA 1JNNH 4X5RA 5CILH 2CPCA 2I5YH 3QB7C 4AK1A 4IJ3C 1WA0X 1X7QB 4XPTL 3TX4A 1CAUA 2CHHA 4K4KA 4Z7VE 4XB8A 5E8NA 5IATA 5KYNA 1NH6A 2UYBA 2B4CL 3QYCA 3NL1A 4N9HA 4NVPA 1RI8A 4DFIA 3ALQA 1D5IL 1HH6B 3F00A 4DEVA 1MHEA 3CTTA 3W21A 4GW4A 3NH7H 4HEPA 1BBT3 4OLXH 2AABH 4I18B 4JRXB 4UOW1 5DG1A 4EI5D 3MZTA 3TBSA 2A83A 2WXJA 2X2JA 4ONGH 3ZFEA 1QJY3 5IFHL 3RWIB 5EU6B 5I1KH 5J9PB 1REEA 4OLWH 5D1QB 2X44D 4XE9A 1W80A 2RH0A 5MP6L 4LCVA 1NCAL 1UA6H 1RHI2 5I8TA 2XTJE 4NKOA 3UPAA 4JJHA 3FW6A 4HF5H 1QR1B 1IC4H 3S3CB 3QZWA 2FBRA 4OW6A 1RURH 2ED8A 4XOBA 4BFNA 2Q8OA 3QYNA 3JD71 1WEJL 4YL9A 3L3IB 3NJGA 5IKCB 4ZS6C 2MSPA 3OMNB 3BW9A 5F1NA 4FGMA 3U4XA 1HB3A 2WZAA 3MZHA 3NP4A 1E65A 2WNGA 5ABJC 4P4KD 1MUJB 4AMKH 2VL5B 3S5LB 3WW4A 2HT4C 5CBAB 5SX4H 2DCYA 1VBC3 3M1HA 3V0AB 3A4EA 4UNUA 5TDOA 3GSUA 3W9EB 4WM8C 1H0DA 2AJZB 2X5PA 3CZGA 3ZMEA 2J42A 4JFYB 1L7IL 4FFWD 3KJ6L 5FZIA 5EPMB 2DQIL 3QR1A 4HHWA 1TUPA 2PHRA 3SDYL 3O6KL 3FT9A 3DF0A 2HX7A 4BZ1H 4JE0A 2HKFH 3N44F 5MHSE 5DUMH 3OL2A 1CIWA 1H30A 3EB7A 5EU5A 5B1JC 4AGRA 1X9PA 4UM8B 5LGHH 3GJBA 1KXTA 2Q76A 4EQVA 2CBPA 1RIHH 5C2BH 1REDA 4CUAA 4Q9CA 3GMMA 4Z7OB 4MAZA 3QNYB 3UBGA 1OPMA 1UD2A 3JV4A 1XAKA 2YGPA 4MXVA 3G7DA 1HOCB 3PURA 4GMP3 3FQ1A 4EN2A 2XX1A 5DMIH 3EDDA 5DLMH 4DESA 4ZW6A 5JDBA 2DBJA 1GJUA 3MGOB 1KYUA 5IMLB 1K2DA 1ET5A 1LLAA 5TE7H 1T2XA 4AYGA 1BJ1H 2DEWX 4IEQA 4MXWH 3FQNA 1J0YA 3D48R 4BHUA 2YGMA 3HBKA 4B6ZA 4JKPH 4RYDA 4UQ3B 3QORB 5D7LE 5G5DA 1RCYA 3NYKA 1CBJA 1C12B 3DBXA 1N7ML 1G6RL 3ARGD 1JZ6A 4RWYL 1FVCB 1TLMA 4TQPA 2FDBP 4PCTA 3IJHB 4DN3H 1MXDA 5F88B 5IW6B 1XNDA 2D98A 2AAAA 5H94A 1MQTB 5LDUA 4KZEL 3P4LA 1T7VA 3MBEB 4GUOA 4PJ9A 3QUXB 2TUNA 1CJDA 1L9OA 3ECBA 2XTLA 1PD6A 4TUKH 4KITB 4CEWC 5I76A 2VO8A 3TEXA 2HBUA 1X4ZA 4MBOA 3TA3A 4Y1ZA 2NUPA 3SH3A 2XN9E 4F7MB 5CFAA 4ENEC 2BZCA 1KIQB 4G6JL 2YPVH 5E1RA 1IFRA 4MDIA 4FAHA 1FPTL 1MFBH 1ZVYA 3TESA 1HHGA 2VXTL 4X8JB 3BDYL 1NDGA 5JQ6H 1W6NB 3KAAA 3PS6A 4XWOD 3OHXB 5I6XB 4TOYL 1LK2B 1IM9D 1A6AA 3WFHB 4B97A 1HX6A 2D8KA 5BV7C 3AROA 1XXDC 1HJGA 5CSBA 3VW3H 1J88A 5E0FA 5KBFA 1EFXA 5LXGH 1I3GL 2XPYA 4PRDA 3ZO0B 1CWVA 2O6EA 2R69A 2WBXA 5HHOB 4U2ZA 1FO0H 5IROA 4ILDA 2LUWA 3IMUA 1FNFA 1HCVA 1CK0H 1RIUH 2BOCB 4WW1B 3MLWL 4LLDA 1G7PB 4QRTB 2FQFA 1R3IL 1RPKA 3VO0A 1ZHNA 2DWDB 5FO2A 5GZND 1HRV2 2BSSB 4LCCA 4J8RB 4G8EA 4FTSA 1ZANH 1IC5H 1WICA 4JFZH 1U8QB 1PTZA 1W6LA 4QXVA 4PW4A 2HEVF 2V2XA 4O5LL 1HKLL 3WFZA 2O0OA 1GIGL 3S88H 4AGNA 1JPFA 2CCVA 1P4BL 3E2HC 1JU3A 1HXS3 1DQLL 4TSBL 2C1OA 3S3BB 1E5RA 2BVOB 3HC3H 3VWJA 1DYOA 5F89A 3S98A 3OPUA 5I1DB 1JXFA 5EIIB 2HKFL 3SDDC 2NW2A 2OZ4L 1RVF1 1OC1A 4CW1B 4XF1A 3QXUA 1D7FA 2FL5B 4FJZA 4PMEA 4MRCA 1XGRA 1W15A 1AXTH 1PY0A 2I9TA 2XUMA 3MCLH 3U9UB 1NKOA 2VVFA 1KZYA 2ITCB 3X12A 2J25A 2CIKB 4OGYL 1CDBA 1ZZBA 4MKTA 3ROOB 4W65A 1TG8A 2IANB 2QHRH 3GRWH 1A6TB 4XP4H 3EJQA 2IIJA 3RPIA 1LQBC 4J3OG 3TCLA 3ZHFA 4ABWA 5EEVA 3I2DA 2I60L 3MYJB 4OZGE 1IKOP 1WLDA 4QAMB 1TIUA 4JFXA 2W60A 3ILFA 3WKML 4BJLA 1JRHL 3QIUD 4G6ML 1CLYH 2F7QA 2PP9A 4KI5D 5TQ0H 1MHCB 2UY7B 1E5SA 5D1ZD 5LWYH 2P24B 2OK0L 5AC93 1BX2A 3KPQA 1DBKL 2C1PA 3MZGB 4EBQH 3OR7A 1I85A 1L9NA 1QZNA 2CK0H 4PB0L 1S0EA 4R5VA 5F9TA 2BW5A 1QSEE 2Y2YA 4R96A 2W46A 3KR3L 3SE4C 5EBWA 4Q4X2 4W6WA 4S1DC 3U79A 5AW0B 4HALA 4Q58C 3RVHA 1EPFA 4AM0Q 5A7NA 1TZGH 1HVXA 4NWWA 4Y22A 3H9YA 4JFED 1F5JA 1SLVA 3APBA 1XAUA 3S0MA 1QTPA 4LBMA 1ZLSH 3BWUC 4YM0A 4OQ9A 1J0IA 3G6AB 2I25N 2WKLA 1GYUA 2VVDA 3URFA 2HWB3 4C0BA 4LAQH 1UOGA 2CHXA 4PTUA 4LEBA 2SODB 4ZOCA 3SE9H 2X0WA 4JM2C 1N3OA 3CDZA 1AHWB 1E4XH 5DWUH 3WFBL 2LU5A 3KCPA 4XILA 2DUPA 1WCUA 2VE6B 3ZPDA 2YBKA 5CCJA 5IQ9B 2FDKA 2DQGH 3EADA 4GAYA 2COVD 1NLRA 3H9SB 2O61A 5K9OB 5EBMB 3D0LB 3X13B 3U6RB 3POJA 4B96A 3MRIB 3NIGB 5D55A 1D5ZA 2HT3D 5AEAA 1QWRA 1N26A 2O8QA 3C5XA 3LIZA 4QOKD 3RKDD 4F37K 3JBG2 4AJ0A 4AQAB 1EJ6A 1KD7A 4YVWA 3GSNL 4U1KA 4CAGA 4N0FA 4X5XA 3S3PA 3T0XA 4ZMZA 1PCSA 2DTMH 2CDEA 1U8CB 3C6EA 1UOBA 1RUKL 4U3SB 1NGYB 3IDJB 1EAH1 1TQTA 3KPQB 1RY7B 4K7PX 5D2LB 3DV6B 2PHUA 3C8DA 4MA7L 4BUHA 3FFZA 1EDYA 4X9FA 4XH2B 2ESVE 2ZXEB 1GWMA 4QHUB 2HVKB 5EBWB 1UB5A 3BUYA 3WYRA 5EO1A 2NXZD 4MO3M 1TJXA 2B1HL 3NG5A 3WDUA 4K5OA 3MLWH 2VUAA 4ZPVB 1EFXD 3T0BA 4FEMA 4NZRH 5C0BB 3M88A 1I31A 4PS8A 2Q8BL 3BPNC 5HHVL 3V65A 2AFNA 3QNZA 3KYKH 4GMSH 4WUUE 4L97A 2ZSWA 3F7LA 4TMPA 1GIGH 2OR7A 1EX0A 1XIWC 3CHPA 5CU1A 4APQA 2FJHB 4JKNA 1AHWA 2DL2A 3MRPA 5E2JA 1DSWA 1D9KB 2EXJA 2HT2C 3P4OA 5KBKA 5CYYA 3WIIH 2ZEZA 1RZGB 1PX4A 2HLFD 1W0VB 4MLSA 3R18A 1YPZA 4EEEA 2K46A 1FFRA 3RTLA 5DZGA 3GGWB 1PGL1 2MOGA 3MAWA 3H9SA 1TPXC 3SDCD 1JWSA 2OX0A 1HV0A 2ZAHA 1ZLUK 4KI5M 1NDTA 12E8L 4ZUWB 1LK3H 3PVOA 4MJIE 1FI8C 3COOA 3GBGA 4MMXC 5SV8A 4M1CC 4M9PA 4FKKA 3JCIA 1MPAL 1BOGB 4MJ6B 1I9JL 4G6KL 2QKSA 3BZFB 4WCYL 5FGBC 4Z7VA 5HYSB 4COZA 1NCGA 2RA1A 5F3CA 1KUMA 4IV3B 1LOAA 3ARXA 2ZCWA 4F15C 4FNLH 1HNFA 1OP5K 3T2TA 3IJEB 4G1MA 4Z5RA 2QSCH 2OMVB 1BCXA 5FOBA 5CEZL 3QIUC 1GP5A 2NCEA 3N36A 2DM3A 5FYKH 1LWHA 1OK0A 4IE0A 2Q3XA 4NC0B 1W0WA 5E99H 1B2WH 4OFQA 3S36L 1YIPA 4B29A 2JSFA 2NY7H 5E5UB 4DP9X 4RQPC 4HXBH 1UD1A 4PDWC 5BNNC 1CF8H 2AXHA 3GFUA 2X0UA 4HUVA 1L7RA 2XA8L 4LHJB 1L6XA 1IAKA 2DQ6A 5FYJD 1Z3GL 2XDVA 1KFUL 5DDHB 2ATKA 4POUB 4N2EA 5HCBA 4P23C 1UOKA 2ZCKH 1V9U1 5GGUA 5CNAA 3ARTA 3GUFA 4NPMA 5DAQA 3EBHA 4Y4KD 5IEHA 1KDMA 5E9DE 3T0ED 4FFYA 2MJWA 1Q1JH 4NQED 1I8MB 3RI9A 2WVVA 1JIBA 2J6EL 3KEHA 2MPAH 4KXZI 3VN4A 2CGPA 3B5TA 3LXBA 5ERLA 4KKLD 3HR6A 4BSVB 5JXHA 4E0RA 1JPSL 1MFDH 3BP7A 5PCYA 1BF8A 3TT1H 4KVNL 1ZHKA 2W68A 1UWXH 3MRFB 2GY7B 4FQQA 4NIAA 3VHPA 1SYSB 4PG2C 2WT1A 3WW1A 5B21A 3K1DA 2ZKLA 2LE9A 4AY0A 4JVPA 4MJ6A 4TVPE 1DZQA 4EIBA 4IHOB 1POV1 1XNKA 1WP6A 1X5XA 4IQHA 1OOPB 2XJQA 4GBXC 2J1SA 3NEXA 2ZWYA 4LOUD 3JBG1 1I1FB 2BQPA 2X41A 4RGGA 5BXFA 1MW0A 2W5PA 4NKIH 4W6YB 4F7KA 4YHNB 5IY5B 3DV4A 1S4IA 1YEFL 2Q1EA 4QF1A 1P5VB 3EFOA 4DH2A 3A22A 3WKYA 1MCEA 4A6YL 5I1AA 1RUAH 3HNSL 4NDMB 4E4ZA 5JSOA 4L8DB 2VPVA 4FS0A 3CIHA 1E5AA 1WUZA 5IQ7L 1HN0A 5DTFB 4BM7A 3DX2A 3OWEA 3POFA 3ZOIA 2IEPA 3MV9B 1CLOH 1WMDA 5A7EA 1NGXB 4LOEA 5F9JA 1U12A 2XTJC 1IQAA 5E8OA 2FX8L 2X4NA 1IAKB 2BTVC 3QI9A 2RFXA 4WHDA 2OZ4A 2A6IB 4Q4X3 4B7LA 3AVRA 5HHXL 4YFZA 3O41B 4YXKL 4MA1C 2ZXBA 3ARBD 2XQYA 3PWVA 2EEFA 4HH9B 3MRRA 1SXSA 2W65A 2OX5B 3AZZA 2X4PB 3B43A 3IFLL 4GI8A 3QULA 3LZFH 4LGPB 2GJPA 4TVPH 3JZYA 4UV4H 4YSOA 4JE4B 5FW7A 5HCHA 4XBPB 1NIBA 3BVNB 2UWEF 1PEWA 1AR72 3ZTDC 5C6PB 3DN7A 1BVNT 2X4OA 4XUPA 3BGMB 3T6ZA 4ZUUB 4APQD 4OM1L 4U1LA 4C0HA 2QR0B 1OZTG 4WI8A 3U4EA 1CN4A 1DTUA 5J3UA 1VKXA 1WYJA 2BSEA 3AREB 1A1MA 2JKJA 3ULUL 1FXZA 2EE3A 5FZEA 5I0DA 5ICYA 1KBWA 2YD8A 3ZBMA 1AX0A 3TCXA 2WFF1 5GJSL 4H5SB 1A9VA 2YHJA 1KT2B 1OWWA 4JFYA 3B7SA 4P2OD 3B7MA 1MWAB 3TC9A 3N7LA 4N8VA 2VUCA 3UAJA 1GSMA 1RZ8A 1NDMB 4DT2A 4LR4A 3BSZH 5GZOA 1DQ5A 3O1OA 4S0TD 3QA3A 2ZPXA 4U1NB 1IEAA 4X8NA 1AHSA 2EC9U 3RFRA 3BQVA 2CO7A 4HISA 2PR4L 1BKZA 3KWTA 3T04D 1W90A 4BH9A 3MREA 5IF0A 1V7MH 4JFDD 3OHXC 3OGOE 4AQEB 5ILTL 3T4YA 2JG8B 3OKOB 4YNIA 5EUOF 2VLRB 3NH7L 3ZXDA 5DQ9A 1ZHBB 4GKNA 5JOPD 2XJKA 2Y0IA 1MRFL 5DFWH 2OMUA 2MCPL 4MGKE 3HUJB 3IT8A 2H6PB 5HGGS 1A4AA 3KBPA 4I77H 4TL5A 4TLUA 4Y1VA 4WWNA 3BVXA 2DF7A 1NC2D 3SHSA 4N0YH 2R29A 2BNQD 3GMPA 1IHMA 2B3RA 3HE6C 3US9A 2FNBA 3QIWC 5FZ3A 4NQQA 4HX1A 3RZZA 2MEV3 2ALWA 4JPIA 1D7PM 3B01A 5FY4A 4GG6A 2DTWA 5IBUG 1J3RA 3ZFGC 5F44A 4JGZC 4PBDA 1M71A 4DCQA 1KPVB 2CKBH 1MH5A 4L37A 2RQ8A 5HGHA 1P0SE 5J0BA 4Q27A 2DQEL 1HRI3 1VKXB 2AUYA 1DF0A 3ZFFA 4HSLA 4F8NA 3B3BA 1TJHL 2WLYA 3F7PC 1JGUH 1XTLA 2GABA 3RWGB 5IFAL 1W9YA 4ZFFA 3FTUA 3EH3B 5FFOA 3BUTA 4UTBH 2JKTM 1YRZA 4W9ZA 3TPUB 1R5IA 3L2MA 4LHKA 3MDJA 1UWYA 2XL7A 5LA9A 1QJFA 1T1WB 2GSIB 5EBGA 2XZAH 5TH2A 2GUYA 1JAEA 3SCMB 1CICA 3WF1A 1HHHA 1J8HD 3QFDA 3P3PA 5CU5A 2YA1A 5ALCH 1E4KC 1A78A 1TJGH 4GAJH 4I85A 3V4VA 4N1HB 1DGLA 4WFHD 3ARGA 2PN5A 3BPOB 3E8UH 1RU9L 2XFXB 2OIIA 1EZLA 2XH6A 4RAUA 4LE3A 3OKKB 4OUEA 1TJIH 3ULVE 4POZC 3O2DA 4ERSL 3SLIA 3H1MA 3UJJH 5JO5A 4Z1VA 3VDAA 4YHPA 4TRPH 2JJTC 2OMUB 2QPUA 5IFJA 1SUHA 5KSBA 1SDDA 4AE2A 2W1SA 2P48B 3MFAA 3I2FA 4NC1E 4E9VA 2YD0A 5CVRA 5C6CA 2LR4A 5LEKA 3WFHA 3TJHD 3A3YB 4O9HL 1QSEA 2GHZA 4LPCA 4U1MA 4RSVA 1RMU1 4YRDA 3SE3A 1BXUA 4R7LA 4JPIB 5C08E 3N9PA 3VGEA 5LKNA 4AYID 4A6OA 4U1SB 4Z77A 3P0GB 5F6HI 3LKQB 3MUUA 4N3TA 5EHFA 3WFEH 4JZRA 4PY7A 1USQA 1FHNA 2F4LA 4LPTA 4IGBB 4H1LB 1GGTA 4HW6A 1Q1PA 3LA3A 4AF9A 1RUQH 1GC1H 4B1LA 4IDZA 3B5HA 1AJOA 1INQA 1XBFA 4MGZE 1HOCA 2SEBB 5AVQB 3HQRA 5AAPA 1R5IB 4JBSA 4GZ9A 4X6RB 5KHJA 1E27B 2EDEA 4L8BB 2GHWB 4OGZA 2RCSH 5HYJB 2F8OA 3IXAA 3I3DA 5CCGE 2VWEC 3RZJA 2N7SA 5AAMA 3AUWB 1S7TB 4O2FA 2VN6A 3MC0A 4LSUL 2BERA 2EDMA 3V4PB 2KR2A 1A8DA 1CGXA 4WW2C 6TAAA 4F7PA 4AVBA 2X9WA 4XPVA 1MS8A 4M6OH 3QACA 3I6KB 3J8F2 4GB33 5C9AB 4XBGA 5I26A 4H25A 3ZFGA 3FN0H 3FQYA 4HBCL 3CLPA 1QKZL 2FUTA 4U6YA 3SDXB 5D8AA 5JW5A 3X11B 4A7QA 4GKYA 4QMEA 5FGCB 5IIEB 1KCRL 2EIMB 2IADA 3FDWA 4PV9B 3SJVB 4MZ2A 2W08A 4YBQD 5DZOA 5FYJH 3ILNA 3BEVB 5E6RB 2XV2A 3NJVA 2YD3A 4XNXL 5CEYB 2Q8DA 1Q8OA 3VTMA 5L0QB 3Q48A 2Y24A 3GKWL 4LLUB 5DN2A 1NCQA 3M6DA 1VZHA 1AGDB 3EAKA 2F54B 3GMRB 4R4ND 2G5RA 2ED9A 3SYOA 1QBBA 43C9B 2EVFA 1YAZA 3KYMA 4PW3A 2C3WA 3GI8H 4R26L 4BUGA 2XR4A 4TVPD 2ZG3A 4GAGH 3QG6B 4NT6A 1MQTC 5LGKA 2BOJA 3W59A 1BP3B 1KULA 4CMHB 4KFZC 4XXDB 4BFIB 1JYCA 1BIIB 3CJXA 4KK6D 3MX0B 3QBTB 5FZHA 3WJJC 3PJNA 3QIBC 2F53A 3X1BA 5KVGH 2EAAA 1Z3RA 1F4HA 1OCZB 4M1GH 1D5XA 5IHUH 1EV11 1BMV1 1P6WA 1PDKB 3MRLB 1AXYA 3N1QC 2OTUB 3SYAA 4C55A 3LKJA 5FMBA 2IC1A 1FBIL 2QFPA 1G9NL 1E6JL 5E6UB 5FA3B 3ZYBA 1S0CA 1SDAB 2AXFB 2WP3O 3O6LH 2VC2L 3RWDB 2I27N 3EFDH 1KB5B 4AIXA 4OI0A 2HEWF 3NFSH 4QPGA 2AJUH 2BP8A 1M2OA 4OCXH 4QHMB 1XZ0B 5ES4B 1NT0A 4A7YA 5FDWB 1KC5H 3OLDA 1ZRUA 2CH8A 2Y6SC 3GMMB 3SO3B 1JGEB 4LPVA 4NIKB 5TK2A 3FOLA 5K9JL 3K2OA 4H26B 1U3NA 3OMAB 3NQKA 2NYYA 3VHNA 3O1VA 1KLGA 1ZAGA 2GP3A 3NCEB 4IKKA 4WHTB 1TQCB 1XDTT 2I2SA 5J1XA 1ZLVH 1ZA3B 2HX8A 3W38A 2GVYA 1MCBA 3VFGH 1HXKA 2ZP8A 3QEUA 4UMSA 2ALAA 5FYBA 4ES8A 1M05B 5K7PA 4C8DA 3VTAA 4ZXKA 4F7TA 4QHKI 1XV8A 3LN4A 2X4SB 5DVLA 2DVDA 5FYTA 3Q0HA 4A7GF 5C4WC 3RVWD 4BZ1L 1YYNA 1RULL 5ESQA 2RG4A 5JMRA 1F97A 2MQCA 1ORQB 2DKUA 4ELKA 2DWEB 3MUGB 2HH0L 4XN8A 5IQNA 5GS2H 4KHXH 3S48A 1I3RB 1PM4A 5L9RA 3ZXGA 3OKMB 4N90E 2DCZA 1P7BA 4XCYA 3H50A 5DZNA 1W8TA 3P54A 1MFUA 1BD2B 1J87A 1XT5A 4AEDC 3N3HA 1L0QA 4BK5A 2BFVH 2W91A 3LYRA 2HLAA 2HRHA 3D07A 1ETZA 4S2GA 3V0GA 1IT9L 1D5IH 1LE9A 1QBAA 2WTRA 4WVMA 3U9WA 1N0XH 2BP3A 2NY6C 1IARB 2ZGTA 3VWKB 4YK4B 4GRLD 5C4WA 1JVKA 4WO4A 3WJMB 2W92A 2GBUA 3LA7A 3NFNB 1R24A 3JT2A 2EXYD 2FH8A 4LE8A 1JL8A 1LO5B 1GGBH 3PF2A 3WEBA 1XB3A 5EC2A 4HV8B 3EGDB 2D43A 3WQ0A 1IV8A 1UXLA 3LZLA 4P23A 5CSZB 3VFTA 5J89A 4YW6A 2D4DA 4MB5A 5D1XC 1WV7T 4P9HC 1BREA 4HLTA 3RDTD 3OGCA 3CLEL 2PA7A 2M83A 4HIEA 4JFPB 4OCRL 1TEYA 1UH4A 2VLJE 2YK1L 2YA0A 3LZRA 4R26H 1R0AL 3OKNB 2B9AA 1TTUA 4NJAH 1UZWA 3SCFA 2ZCLH 4V33A 1RINA 3DOHA 3P4MA 2AJXL 3GMLA 2QVKA 4PJHB 3SKJH 5C7XH 4B3NA 5JR1L 1ZHNB 2DWDA 4PJFB 2YWYA 1XNBA 1CT8B 4D0DB 5I1LB 1YY8B 4AQAA 4JGZB 3R06A 1VEMA 2D9QB 5CIPA 2XJVA 1BAGA 1O5UA 3QJSB 4CP2A 4E9WA 4P2OC 1P5UB 4NUQA 3GSOB 4G1EA 4HP5A 5C6TH 4DSYA 2ZKNA 1GPOH 1C7TA 2W07B 5ANNA 1GAFH 1KLFA 3X3GL 5JLZB 1TO5A 2GSYA 3ON7A 3SDYH 4JANA 4NEHB 1FPN1 3THML 2N7GA 2DM4A 3ES4A 3VBUA 3F64A 3WJJA 4U1JB 1VADA 4M6AA 1HE8A 5FUOL 5I16B 3DJSA 1O0VA 2YGNA 5DVOA 2H1PL 5F6IC 4YLCA 1WJ3A 2P2KA 1FMD1 4KRPC 2B08A 5LASA 5CFCB 3DXTA 1MSPA 3MUZ1 4DHLA 4FQ2L 12E8H 2JCCB 4YC2C 2DLGA 2RMNA 3SKNB 1GKEA 4WTZG 2VDLH 4GO8A 2P34A 3MPCA 2XN2A 3BIKB 5CBEA 4D8PA 4NHCL 4P5KA 9CGTA 1ONQB 4DK3A 4PY8I 3VSQA 5FPUA 5KSAC 4YHKH 5DRZA 3V5KB 2ENQA 2PCFA 1HJFA 3PVEA 1A6UL 5IK8A 3R0MA 3N41B 3IMWA 1F8VA 4NQVA 3MV8A 4XWGL 1EIBA 5IB1B 1PMJX 4UNVA 1JWSB 3JWDH 5CGMA 2Y6LA 1THAA 1P4UA 3IIIA 3FO2A 4TQHA 4W9EC 3FU3A 5L4MA 5IVJA 1QVOA 3HAEA 1T3FB 4NOTA 3STBA 2GC7C 4GD4A 1BZ7B 5EF0A 1OANA 4I0PA 1W9XA 4OJFL 1EEQA 4FQHB 4U6XB 1Z6JT 5F7EH 3THTA 4AFAA 1WCBA 2X6BA 4Q0QA 1LEGA 2KMWA 5F7MC 3FO0H 3HKZA 3CC1A 2ADDA 3LSEA 3KYOB 3BKMH 3KCPB 5TJWK 5C8JA 4NQXA 3ZE0B 1QFUH 5EDSA 1NIDA 3KJ6H 3B94A 2P42B 3M7FB 3DX8B 3MCKB 4F7CA 2NY4B 2F68X 3A6CL 2ZOLB 3RVVC 3LKSB 4JY5L 3MFFA 2O61B 2B4KA 3ZIMA 2E53A 5KXDA 1J5OH 3ZYFA 4NO5A 2X5IB 2DPKA 2H1LM 5I0WA 3C6LA 5HI0A 3TTYA 3E5UA 1AZZC 5AYQA 3S6CA 5D2NC 2IWFA 5AVPA 1EAPA 3H54A 4Q0XH 4GAFB 1RZJL 1XEUA 3J27A 5T3XE 3VBUC 3SE3C 5IMMB 3BAIA 5MI0B 2HJLB 4L3EA 3RGVA 2AVGA 1K5MB 4L1LA 1CLCA 1FFQA 4NQUA 3UJIL 1ZREA 1URLA 3FCSB 1KXVA 3ALWA 2BSTA 4ZAKD 1ES0B 1LJ7A 1W72H 4RAHA 5EORL 3WV6A 3SKJL 2JLPA 4IEPA 4NJAL 4S1DD 5DD6B 2KM2A 4HBQA 2V4VA 4QKNA 1NGPH 1HIML 5FCUL 1MEC3 2JQMA 1LOEA 2WXFA 4LVHB 3A4FA 4U6XA 1E4KA 1OCOB 2DJ4A 1MFEL 3GHBL 1CPNA 2BVUA 2PYEE 5C6WH 1A14H 4XP1L 1KCUL 3NSCA 1ETB1 5TQ2L 2FJSA 4NP9A 2BNNA 5I75B 1YQVL 1YO4A 2YKKA 1JUIA 3S7IA 2CV6A 5JOXA 2WZPD 3WJLA 5I1JH 1SNRA 2G2RA 3WD5A 3AVEA 5K59E 1E28B 1VBE3 1N0LA 1G87A 4R8WH 1JOJA 4BCUA 4CDUC 1YWKA 1R5WA 4XN7A 5F88A 5GLTA 2W9DH 1KB9J 3D2UB 4B60A 3D25A 1ZT4A 5IJVA 1S0IA 5CB7A 1BBT1 1PX8A 2AI0L 5KSUB 1M56B 3IU3B 5BRZE 4P9ML 3SDDA 4HWBL 1DHKB 2X70B 3MXWL 2VW0A 2PXJA 1PD1A 1MRDL 2KLSA 4PWJA 1JDAA 1F58L 4AZ8B 3ARFB 3E3QE 4WIQA 2WYIA 2ZJSL 3FKUS 1FLTX 2ZYRA 3NJHA 1W6OA 3RIFK 4BK5C 5L8JB 3KPOB 2FZ1A 4J1UA 4AEDA 3VXMB 2ZCZA 1BMV2 4HD5A 3X1FA 4XPFH 3H3BC 1SRDA 4X80H 3ILQD 5DHDA 1JYXA 5T5PA 4YFEA 2O8OA 3L5WA 2VZ1A 4DOUA 5FHBL 1RZPA 4KHTH 4QRRA 2Z8WC 3B1TA 3E0GA 2G60H 4ARYA 2XRAH 2OMNA 3G7TA 3NACL 1OP3K 2IGFH 3AG3B 3GO1L 5TF0A 2YPKB 4BCYA 2CNZA 4N20A 1C57A 4HK8A 1SYVB 5FY7A 3VD3A 3LEVL 3N7KA 1WTLA 5D5ME 5KJRH 5CZRA 1KFAL 5BRQA 4AH2A 4LVNB 3PWPD 4TUUA 3HG4A 2BSSA 4LCCB 2BNUA 4YBHA 1NFIB 2CSGA 2IBBA 4AE0A 4QHLB 1D2QA 4JFSA 4IEZA 2E6QA 3B2UC 1J5CA 5DJYA 5CEXB 2QT6A 3TFKD 4PGBB 1F1GA 1OT4A 4PY7B 2ZUUA 5D1QD 2FQGA 3PQYD 1HIXA 2F53E 1DO6A 3EBRA 3CXDH 3NT0A 3NNFA 1TCRB 5I1DA 1U2CA 3H3PH 3PV7A 3IU3A 1W06A 4JM2D 1ZJBA 3DVIA 5FK9B 5K1JA 2Q86B 4Z3JA 1CGPA 1MNUH 1Z5LA 2ZD0A 4WI0B 4IBWA 4ZYKB 3SC7X 5I28A 1CGSH 2XJSA 3EUUA 3WSQH 1BZDA 1CZ8L 2WLHA 3MJ7A 1M6OA 4TKWA 4QJ5B 2BWCA 4FL4B 2BVEA 3O6FC 4PIBA 2GK0B 2EIKB 5DJCA 4EF3A 4N8CH 4NKDA 4ZUTB 1RYYA 2KL6A 2ZTBA 4UZSA 1JWMB 2EYTB 2G9HB 2OXHB 3X14B 5BYNA 2VXUH 3UZQB 4EN3A 5D1QC 1G0DA 1UXMA 3D39D 4F57H 5EORH 4HLJA 3TEUA 1MUJA 4Y19E 1TVBB 2Z8RA 1KEGL 1OB1B 2FIKB 3U78A 5A2LH 4UQCA 2FB4H 3NNLA 2DQUH 3FUDA 3C7FA 1MQTA 3SITA 2ZYIA 4IIQB 5ACLA 1A14L 4K8RL 4TTDC 3VI3F 1O6SA 5I66B 1TKWA 1MFVA 3P69A 4CDWC 3FPXA 3ASWA 3P3UA 4NO3B 5GS3A 3GS0A 5EDXA 4PPTA 3VXQA 1WZAA 5E8DH 2QJVA 3DPRC 4D6RA 4W9IC 3WO4C 5F1IB 1DQDH 1KCBA 4LIQE 2WXHA 1OAXL 2WBJD 1YEGL 3KPRB 4GKZA 3RRDA 2LU3A 4I2XB 5FB8B 1F11B 1Y1DA 2EKSA 2BSCA 3VD1A 3DV8A 4NYLB 5I74B 1DO5A 2FJGB 1I8LC 3AREC 2Y5EA 2D7NA 4DPAX 4NBXB 1O3RA 4QQ2A 5E5MB 1V6JA 2V5RA 5IT6A 4A7SA 4QRPA 1Z9SA 4C83A 2WQWA 5GGQH 4P4RA 2BV4A 4FPFA 2D3PA 1GC1L 1F4YH 3LKRB 4PRIA 3U6RA 3X13A 3LQCA 1L0PA 1QJU2 3O1RA 3TEYA 2YU2A 3ETTA 4GQRA 1IKFL 4ATTA 2CGRH 3LZZA 4IBQA 2GTWB 1NTDA 5ID1B 1ZS8A 3B9CA 2BP5M 2FYVA 3TO4C 3W56A 4XTMA 4HAKA 1GOFA 2OXGA 1W72A 2X09A 4RGMB 5E03A 2IVFC 4DOHB 1JK9A 2G0LA 5IHZB 4OUOA 1VE0A 2GNDA 3BODA 1ZHLA 3GHPA 5CF3A 2OV0A 3UG5A 2X2IA 3RWEA 3V0EA 1I5PA 3T1LA 3VRIB 2PTMA 1CDHA 4YXHH 3DA0A 5J1AA 2VR4A 4PJDB 2YKLL 1SVZA 1Q38A 3T0EB 2VLRD 2ZPKH 4ODBD 1FPN2 2VQ4A 4FFVC 1RZKC 4BWTA 1TF4A 4Z7OF 4DPNA 2YBRB 4XB7A 1JN6A 4IERA 2QADC 3LS4L 5CGYD 1DVFD 2YLHA 1DQ4A 3AXDA 1TNFA 3VZNA 3TNNA 4HJ0D 3IDIB 3VGHA 4E5XA 5LCVH 2BNQB 1UH2A 3HG1E 3REVA 4BKLA 3B69A 1S5IL 3N44B 3QEQE 2J1WA 2YPDA 4F7PB 4DW2H 1ZYBA 1XL4A 4Y5TA 4CRQA 1W0PA 4WHCA 4OUMA 3ZDXE 3FYEB 2O5YH 2WQSA 1OA4A 4TF4A 2W60B 2C9QA 4A7ZA 5CLWA 3HFML 4D9RD 3HI6L 5ICXA 3MBXL 1UN1A 3JWNG 5GZCA 1FZMA 1BQSA 4JFUA 3RWGA 2HLFC 4LVHC 1JV2B 3K6SA 5CUSL 4U1HA 3G5YB 4FYRA 3B8SA 2E9JA 5TDOB 3W9EA 1SEQL 2BW8A 1QSFB 4B9IA 3L4VA 3ZHNA 1TCMA 2J22A 4ZU5A 1A6AB 3WDWA 3VD0A 3C7GA 5FLJA 3ETPA 4R96B 1TTBA 1SJVA 4LIVA 2ERFA 2IDSA 3KBHE 3HT2A 3G9AB 3B37A 2K7QA 4I48A 3MRQB 2ADIB 4DZ8A 5D1ZI 4MVBD 4J4PD 1VEPA 2C6SA 4JZNB 1VBA2 3ZDZB 3WFCL 4MD0B 5CP3A 1F3JA 1N8ZA 2EAEA 3B9KC 3G5ZA 1W9WA 5E4AA 2AYHA 3VV1A 3NFSL 4YM3A 2W80C 3VRIA 3ARPA 3LZNA 4PI0A 3VYOA 4ZQKB 4JCMA 1LE5B 4N2GA 4OCYH 4QKBA 4RHV2 1RUNA 2P44B 2ARWA 3SGEI 2KBGA 2R51A 3M8OH 4FF9A 1A2YA 3NJFA 4MAYD 4MKMA 2ATAA 5IFAH 3WFDH 4ESKA 5I8SA 4ZRGA 3QWQB 5AZEL 1E2VA 1D4VB 4PJ8D 3PUQA 5JPMA 1O9WA 4FA7B 2W2IA 3OGCB 1CI3M 4ZUVB 1A6VH 4RMTA 4ET7A 4U1IB 1JVLA 5K39A 1UZ6F 4XEZA 3CXFA 3VFWB 1Z7S2 3E6BA 3RWDA 2WNKA 3ZT7A 4XR8C 4CA4A 2W9LA 5I2IA 3UPCA 4FT8A 3MV11 1WZLA 2NYZA 2O5ZH 2J12B 3HMXH 4OT1L 4N8MA 2X1OA 4ZAKA 4N2KA 1I8IB 3H3LA 3D05A 5L2JB 1G5AA 1NCIA 1INQB 1QSFA 3PFQA 3MPBA 4FZ8H 5D7JD 3P5BA 5DA0B 4PJDE 3ETSA 4MS8D 1IKFH 4YSAA 3FUHA 3PDOA 2I07B 3A47A 3NN8B 1MQKL 3MRCB 5E94A 4Z3IA 1PU0A 5CGBA 3HB3B 1CAWA 1I6XA 4XE5B 1U0AA 2M1KA 2MQ0A 1R4XA 5HVHB 3PIJA 2ENJA 2JDMA 2E86A 2WIIA 2IWKA 4LLMB 4XMPL 5SWZE 2OCCB 3DTDA 5BQ7A 2JD9A 4K9JA 3EMRA 5APAA 4LT5A 2ZPKL 3WE1A 4ELKB 2HAZA 5IMOB 4OLLA 3SCMC 4YXHL 1PG7L 5DAVA 1W0VA 5LQBL 4PHXA 3BRDA 2APVA 5DTFA