2W94A

Native structure of the discoidin i from dictyostelium discoideum at 1.8 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 62
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w94A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w94A01
2VZ1A 1UXXX 2W1WA 1TVGA 4P02B 4Z2AA 3T0BA 1KGYA 1NX9A 3WNOA 1JZ3A 1W99A 4OYUA 1JZ2A 1XNTA 5G05L 2VZPA 4A6OA 4GWIA 1UMIA 1JI6A 2EIEA 1OH4A 2J1UA 3ABZA 4OUEA 4BXSV 2VOTA 3VDAA 1JU4A 4CUCA 1JU3A 1GOFA 1UY1A 1UY3A 2VR4A 1KEXA 2BGOA 3P1IA 2CGYA 2W5FA 4CU8A 1US3A 3T08A 1NUKA 2B4KA 2CE6A 4OZOA 3WEZA 3GM8A 3FHQA 3VD7A 1JYXA 1DP0A 4P5YA 4M4PA 4DUVA 3WNKA 3C7FA 2JE8A 1CX1A 1UY4A 4A44A 4QB1A 2LS6A 5C70A 5JXJA 2VMEA 2Y64A 4DUWA 4DEQA 1W8NA 2Y8KA 3NRUA 2W47A 4LPLA 3THCA 1UX7A 3LPFA 4W8JA 5B4NA 2VZSA 1W8OA 3OGSA 3FL7A 3OBAA 3ACFA 1OF3A 1GUIA 2ID4A 2QQMA 4P00B 2XOMA 1UYZA 1UXZA 2VZUA 2Z4FA 3OEAA 1K3IA 1US2A 4LHSA 5LA2A 3SKJE 3WF2A 4AG4A 4GWJA 3CIHA 2YB7A 2VQTA 4TTGA 5LA1A 1ULOA 5HPOA 3A7QA 4UOJA 1GOHA 5DQ0A 3ECQA 4QDRA 4E8CA 4JKKA 4CU6A 2WDBA 3WMPA 4JKLA 4LKSA 3HN3A 4MOAA 5JR2A 4BK4A 2QQJA 3K4ZA 1JYWA 1JZ4A 3I2KA 5CYYA 1GNYA 3MV11 2Y6KA 1PX4A 2VC9A 5G04L 3C7GA 3AC0A 2ORXA 2BERA 5J1XA 1OD3A 2YG0A 1W9TA 3WNMA 4Q56A 2WQ8A 2WBKA 3GDBA 4JX0A 3WQBA 3JXSA 5I0DA 5C7GA 4PF1A 3DYMA 4QB2A 1UWWA 3NJVA 1O8PA 3OGRA 1L7RA 1O59A 3CMGA 1UY2A 3I2JA 5C71A 4ZZ5A 1L7QA 2J1TA 2WAAA 2VMCA 2XHNA 2VZOA 3VD3A 3PUIA 1GU3A 2X09A 1EUTA 1CZTA 2JD9A 3WF1A 4DXTA 2HLEA 1K42A 2W87A 3VD4A 1WCQA 2VCAA 2W95A 3P6BA 3IB3A 1GMMA 3T2QA 2C4XA 1J83A 2ZEXA 4RN5A 2WYSA 1IQDC 1SDDB 1JYVA 2E33A 3CQOA 3VD9A 1XC6A 2WUHA 2VCBA 2VL4A 4FI9A 1EUUA 3LEGA 3K77A 4A41A 3I2GA 1RYYA 2QQOA 1PMJX 3C8XA 3ETPA 4D0QA 2RVAA 3IIIA 1JZ6A 2Y6LA 2QQNA 3UETA 4XURA 3CKHA 4XZUG 4CUAA 4D8MA 2Y6GA 2QQKA 3W5MA 2DCKA 3VDCA 4OMDA 4W50A 3WMQA 2DDUA 2XQXA 1YQ2A 4RYDA 4AAXA 2W1UA 3K46A 2W1SA 3GGLA 4L0PA 2X05A 5IYYA 3MO4A 4QB6A 3WF4A 3ACIA 1JHJA 2CDOA 2QBXA 3WSOA 4DUXA 2VCCA 1CZSA 2Y6JA 5F7UA 5DMYA 2WZEA 1W9WA 3OB8A 4KI5M 2X10A 3I2IA 3C7HA 3MUY1 1GOGA 3K4AA 3CZJA 5B4XA 2R7EB 5JUVA 2W1QA 1DLCA 1W9SA 1K12A 3T09A 4KMQA 3BN6A 2CDPA 4ET7A 2VM9A 1NKGA 4ARYA 3LPGA 4QAWA 2QQLA 1H6YA 4E8DA 5LA0A 2KD7A 3IAQA 2WN3A 1R64A 1JZ8A 4QX1A 2EICA 3SKVA 4HG6B 3HJRA 2BZDA 4QDSA 3BGAA 3C7EA 3I3BA 2J1SA 2WZ8A 1OF4A 2YC4A 3LE0A 2HYXA 4UAPA 5IJRA 3DECA 2QQIA 1UMHA 2V72A 3NNGA 1BHGA 2VZQA 5JXIA 3K4DA 3FN9A 3ZM8A 2V5DA 3PUHA 4XUNA 4BJ0A 2WO1A 2DCJA 4A45A 4A4AA 2BGPA 3CDZB 3MUZ1 4JHZA 2LW8A 5FUIA 5A1AA 2RV9A 3CZUA 5EJZB 1LNSA 3J7HA 4CU9A 2J1VA 1W0NA 4QX3A 4XUQA 2W94A 2CGZA 1H6XA 1D7PM 4KWUA 1JYNA 3GXUA 2J1AA 2VJXA 3HEIA 3U37A 4DXSA 3ACGA 3T0AA 3I3EA 3MBWA 1ULPA 2YFZA 3SEEA 1F4HA 3I3DA 3OEBA 3MV01 3I97A 3HNBM 2CCVA 5JXGA 1DYOA 2WABA 1NAEA 3DYPA 2V4VA 1UZ0A 2VZTA 2BBAA 2VZVA 4ZY9A 4MGQA 2W46A 4MADA 2YC2A 1O8SA 3OGVA 1WKYA 2PQSA 3HNYM 4MO3M 2W9XA 1HN1A 4XUOA 4CU7A 3HOBA 3HPNA 3T2OA 4A42A 3SEPA 4BK5A 4MGSA 5DPNA 1CIYA 2ZEWA 4OMCA 4ZXEA 3THDA 4XUPA 1I5PA 3FHAA 3T0DA 3W5NA 2J22A 1JZ5A 2VQUA 2E31A 4GZ9A 3IAPA 3C7OA 3A22A 5JMOA 3UNPA 3A21A 2XONA 3WF0A 3LEKA 2ZEYA 2W3JA 3IDAA 1UY0A 4CUBA 2VO5A 2B9VA 2E32A 3F2ZA 2VMFA 5JXHA 1XPWA 3T2PA 4UI9L 1K45A 2VZRA 2WO2A 1P8JA 5IFTA 3I2HA 2VMDA 2C26A 4QPWA 2J1RA 2WO3A 2OKXA 4DXRA 4QX0A 3WF3A 4XUTA 2YFUA 1F4AA 1MPXA 1PX3A 2ZEZA 5IHRA 5HXMA 4BDVB 4PT6A 5EJ1B 2ZXQA 3I2FA 3DYOA 2J1EA 3WNNA 3NQHA 1GQPA 4YPJA 5LCWL 3WNPA 3K75B 2E26A 5DN2A 3EB7A 2JDAA 2EIDA 2C9KA 1J84A 3LQCA 3LEIA 2VZ3A 4ARXA 2EIBA 3D3AA 2W92A 4XVHA 3A23A 2W91A 5EIYB 4TXWA 4W4ZA 1T2XA 2JKXA 3HNMA 3WNLA 4QX2A 4P08A 2WN2A 3VDBA 1TG7A 2ORZA 3NJXA 1PMHX 1UYYA 3VD5A 3ACHA 4A3ZA 1CZVA 1JZ7A 4QDQA 2VTFA 4ZZ8A 4CVUA 2WAOA 2Y6HA 4IUGA 3UESA 5CZKA 3EYPA 4DEVA 5IFPA 4LQRA 1SHWB 1SG3A 2RJ2A 2L9LA 4JKMA 3E1F1 1UYXA 4M4RA 3OG2A 4PQQA 2J7MA 1OT5A 1XNAA
chains in the Genus database with same CATH superfamily
1E30A 2VZ1A 3ETBJ 5DXDA 5DUXA 1TF4A 2FEJA 3QJFA 3BN3B 3S5LA 3T0BA 4NUQA 1ULEA 2EXHA 1CD1A 1WAAA 4HP5A 3RG1C 2E27H 4FXGA 1ZBE3 1BQKA 4I3GA 1KYOK 1Y18B 3UYRL 1P4BH 5F2WA 1UWXK 4X9YA 3KLHC 2OPWA 2ZUWA 3U07A 5L9DH 2YA0A 3FU9A 1N6UA 2VZPA 3NIGE 2A6ZA 3ZE0F 1A7OH 2JKNA 1OD7A 3L5IA 3UCQA 1EX0A 3X2QB 4UQ2A 1HHIA 1T1WB 5F3HB 1ONQB 2ZG1A 2VDOL 3PWUA 3LY6A 1FCGA 2ZAIA 1PLGL 5AKVA 5E8DL 3ABMB 5TE6H 4J27A 4LRIA 3HG1D 1GOFA 2R29H 1PO21 1PMIA 3ETBF 1MR5A 5M7QA 1UY3A 1X6NA 1MEXH 2MOGA 2VLRE 4PJAA 1FRGH 5GGTH 4PUBH 1EY2A 4CU8A 1XNDA 4YSTA 3WD5L 2WOBA 2W5FA 1MVEA 1VZHA 2XVLA 3DC0A 1QJX1 2IDCA 3L17A 3QQ3B 3P1VA 3B7RL 3H3LA 4WEEA 1FT9A 4ZXBB 1WAAF 4M1DH 4BSWA 4TSAH 3ARVA 1JYXA 4HT1T 4B3VA 3ZYIB 3N91A 3M07A 4JL2A 3QJHA 2VISB 4DP8X 1RL3A 3MRNB 4F9PC 4XC3L 2EE2A 4F27A 4HKOA 1BVVA 4EKJA 4MCYB 5J6SA 1CXLA 3HG4A 4WJG3 3EDJA 5FO7B 5FYLL 4WJ5A 4DW2H 2JDHA 2JJ6A 1KYAA 3NAPC 4GB33 4E2SA 4HMZA 4X6DA 5K9KA 2A77H 2QKIB 4OF8A 3K1KC 4BZ1L 5C70A 1FYTB 5IGXH 1FAIH 4DGVL 1RUH2 2FDJA 2CO3A 43C9B 4QQHA 5F6IB 5K1JA 1HNGA 1UKSA 3KS0J 3CAFA 3ABGA 2PCPA 4AI0A 1J0KA 1UYWH 3JWNC 4F5CE 5C0DB 3KVBA 1IE4A 2NOYA 2Y5EA 4E9VA 1UASA 1XYOA 4QKDA 3KL0A 5B4NA 4U2ZA 1MW2A 3LZNA 3FQYA 5FFOC 1NOLA 2C3WA 1E6OL 5LQBL 1G86A 1OBNA 2LVCA 2X38A 3GHEH 3Q3GB 3JB8A 1UZ8B 3OPUA 4PRDB 4XP1H 2OZJA 3R4RA 5I1HL 2YWZA 4HG4K 3O6FA 5K8SA 5GS3A 2WO3B 4OGXH 2VD7A 2E3VA 3LOWA 3RIAK 1O6TA 1Y7BA 2MRYA 5FREA 3D5OF 5LBFA 1RMU1 5T55A 2VO8A 4Z1PA 1FE8L 3GJFA 4E9XA 2PA7A 5JOFB 1TR7A 3E2HB 3U6RB 1FV2A 5EG6C 4ILDA 2ICWJ 1A9BA 2X42A 3DX9A 5AD0A 1Y0LA 1YUKB 1RERA 4G8GE 4ODTH 4MJID 4JKLA 2YBGA 3LKOB 4XJUA 1D9KD 1OO2A 5GRVL 1ZSHA 4JFFA 5BNNB 1BZ8A 1IT9L 1EEZB 4GB9A 2B9AA 4XPBH 4XAWH 1Z0HA 3GGWA 4Z3EA 4H8UA 1LO3H 4P9GA 2YPVA 3DXAD 3BTXA 1OAQH 4RFEB 3GNEA 3OY8A 2WKOA 2V5TA 3MKGA 4X0KA 4I3RH 2SLIA 1EAJA 3C7GA 3V4VA 5ICXA 3NIDB 3KPPB 2J21A 3LIUA 2R0LL 1IS5A 4CXWA 2Q7AA 4MLIA 4CVZB 2C3GA 2RACA 1TDQA 2MH4A 3GMQA 3VW3H 4JX0A 4KC3B 2JG8C 3BIKA 4B27A 3JVFC 2CGRH 4Z0BH 4ODSH 4GJZA 1I1CA 2WQUA 4N9GA 1IGOA 4PDWA 1WUVA 3HG1E 5DJ2B 2C7UA 5KVGL 1GZQB 4NP9A 2X5IA 2B9BA 5KW9H 4MD4A 4OLUH 1RUC2 4XPVA 2BNQE 3QARA 2FEEI 4MS6A 3T6XA 3ZTDC 5A3ID 3MV9D 2VXTL 3PIQA 2AXFB 1EUTA 1SVBA 2VXSL 3H2WA 2LFGA 5DD3H 3DX6B 4QXUH 1T2QH 3VGDA 4NWTL 1DBJH 1NG0A 4PV1C 3U6XA 1ENXA 3C2UA 1YPZA 4HJ1A 4J8RB 3GMOB 3HZVB 4Z7QE 2D44A 4RGND 5CP7B 4QMEA 5CFDA 2XN9D 2OCJA 3E6FA 2CWMA 5C3SA 1GC1L 4L2YA 1WSST 1XF5A 3B9KD 4HAGA 3KS0H 4Y5VC 1PKQA 1KDMA 1OC1A 2NXYB 4K8FA 3LEVH 1ZRRA 4JO1L 5BZDA 2XV6B 4RRPA 5G4OA 1AX1A 4PGCA 3AVSA 4BZ4A 3O1OA 1U8IA 2X6MA 3X1FA 3BP6B 3FB6A 4QXWA 3TA4D 2GNMA 1BMV1 1YCSA 1EUUA 5HHMB 5A6XA 2G0LA 1H3VA 1FHNA 1IG0A 3SKNA 3QIBD 5D96C 3CLEL 3HE6D 4PHZA 3S8WA 1HH6B 4KTYA 4PJHF 4OSUH 1O7VA 4Z7WF 1BZWA 3MMEA 4GQ9L 1TMF1 1XH3B 4BQXA 3FT2B 3KE0A 4G43B 4KV5F 1RHI3 5C2BH 4OHZA 2ZCKL 1VMJA 2OSLB 5HGAA 1S7UB 1C12B 5DJ8B 4I1PA 4CUAA 1IKNC 2HJKA 4LCWE 2WSUA 5EWIL 2RS52 2WNWA 4DK5A 5H37H 1VGKA 4FP3A 4RVBA 4Y4HB 4A67A 1UQSB 5CLWA 3EO9L 5IMMB 1YO8A 2R073 3E6FB 3L1FA 5IHBA 2VMHA 3H3ZA 3SO3C 4YPGB 3ARSA 1EAH2 3JYBA 2XQXA 4FAAB 3POEA 4ASKA 1ZVYA 5DJYA 3VYNA 5DYOA 4M3CF 2JB5L 4U6HB 5GJTL 4C83B 4DT2A 2Y1ZA 1CGXA 5LGJA 3BQVA 3KT1A 5JIPA 4Y9EA 2Y22A 4QYOB 1CTOA 6CGTA 5HVFB 3EFOA 1FE8H 2WVVA 3NFNB 4W9ZA 4FFIA 1TLKA 5BRZD 2FQGA 5C0BA 3SO5A 2EDQA 3ULVE 4HIXH 3F6JA 1R081 2O0OA 1KGWA 3HS8A 3OB8A 4RWYL 4DZGA 4D0DA 3UL4A 3QCUH 1HQNA 4L97A 2UX6A 3GEFA 4HJUA 3EXUA 2ZNWA 1UACH 5DS8B 4DN3H 1XGZA 3V0DA 2W1QA 4YSSA 3UC2A 1DLCA 4BCZA 3W9DA 3VZKA 1XGYH 1BJ8A 2FT7A 2HG5B 2Y2TA 4R84A 4X8JB 3PWPD 5D7JD 5GZNA 2OYLA 1I1RA 3RA7H 1M53A 4JDEA 5FP8A 3BJ91 3DX7B 5EU6E 4YFDB 1KXTB 4RR3C 3MTXA 3RKDD 3SGKA 5ICXB 3POBA 5TE4L 4NROA 1FL5A 4AQEA 1NDGB 1AQKL 2B3IA 2IFWA 3DTXB 3UT0A 3LZLA 3RWFA 3FRUB 3I3BA 2R8SH 4Z7UF 1DQJA 3GBNH 1S7RB 3BAIA 1OMIA 1CN1A 3BEWA 2X1OA 4NKMA 2O61B 3KZ4C 1D9KB 3C8HA 4S1QH 2WQ4A 3A0OA 5DJ0B 2D7OA 3VXMB 4FFWC 3H9SB 1N1YA 3WJMB 2YD4A 4KNTA 4M5ZL 5E2WL 1CS6A 5E5MB 2VXRA 3WLUA 4P4KA 4BU2A 1H5BA 4NZRH 1DUYB 2NDGA 1ZT1A 3OPTA 2V2XB 5FFOA 2J8UE 2JELH 1RVFH 3CBJB 4Y7OC 3QWQB 5LCVA 1UC6A 4M6OH 3FFZA 1OA2A 1LWHA 1TZGH 1M57B 1WYJA 3H9AA 4WO4B 2P5WA 3J8F2 5I1JL 3MW2A 1H9VA 2AMGA 2RS11 1AMYA 3T1LA 3L5JA 35C8H 1NOVA 4I9XA 4N43B 3O6FC 5ELIA 2RA1A 4AI9A 3BWSA 3PUAA 1FC1A 2OV0A 2LW8A 2VLKA 2RM22 2H0FA 2GUOB 3CXFA 2VQAA 3CZUA 3EJSA 2QHRL 4AQEB 5IP4A 3OGCB 5CU9A 5FPLA 3J7HA 4LCVA 2XRAH 3A4EA 3SBRA 1ZK9A 4QXCA 4YHZL 1MCBA 1YNKL 4QX3A 5IWFA 1J8HA 1T0NB 3QJUB 3WTSA 5K7PA 3RZKA 1PS3A 5KUKA 1MCJA 5C09B 3LA2A 1TT6A 2F5AL 1S6NA 1KTCA 3QUXB 3AL5A 4OVUA 4NPLA 1OFSA 4JM2B 2Y5QA 1A6TA 4B9PA 4LQFH 4G4FA 3RBSA 2RS33 1SMVA 2WNVC 4XMVA 3OEBA 4HKBA 4GSXA 4HCRA 1M7DA 1U8LB 4Y4YA 1FO0L 1A14H 4X4YB 5D5ME 2ZPKL 1MS1A 2R69H 3FAXA 2B2XH 2IFRA 1RZ8A 1CGUA 1FL6B 2AJVH 4J5VA 1KS5A 2BDNH 5D6DC 5F0LB 2NX5B 3TT3L 4HVOA 3ULUH 4ZOCA 1S0EA 2B08A 4FPHA 1O5UA 3R06B 2O8QA 4UZUA 3ULSA 2BOLA 4G5ZL 5F96L 5DYOB 1REDA 4QPYA 2PABA 4LSVH 3SJVB 1I3UA 4LE8A 1P7HL 1A21A 1LCLA 4MMZC 2CLVB 5HYSA 2RR12 3MRHA 3K8LA 3ARBC 3KW8A 5FO9B 1IE5A 1G0XA 3CX5K 4XP4L 4SLIA 2YD8A 4V1DD 2NSMA 1ZTXH 3OD4A 2O5NA 5FZ4A 2SEBA 1GFF2 1FFNA 1MFBH 3MGAA 4EDWH 4RBPH 3UTSD 4Q4X2 5AFBA 1WZAA 3LF7A 4XETA 3WP4A 2OZ4L 3CMOL 1IG3A 2CM6A 2NY1D 3RUGE 3VG0L 4M3CE 1YEKL 5BJTA 2Y07L 2AABL 5IK7A 1G9NC 1V6OA 4FPOB 5TDNA 1P5UA 3AAZA 5LAPA 4ELKA 3KYMA 4LFHD 3DXAA 3HNTH 4HS3A 2XQBL 4IKLA 5SWSB 2ZGUA 2VDNL 3LPWA 4GW5B 2JX9A 2ZEYA 1VACB 3BP4B 4DP0X 3MCG1 2AK4A 2J5LC 3L4ZA 1ZHKB 1KGXA 3P3UA 5DVMA 5KSAB 4XXAA 3PJSB 4LOFA 1FIGL 3WN5B 4KGLA 5E03A 1Z9OA 2CKBH 1WCUA 1SXAA 4H7MA 4CEWA 3B7TA 3DOIA 3ILPB 1AXKA 1EANA 1G7IA 4O02H 4MCNA 4KV5E 4K21A 4B9IA 3I2HA 4ONHA 5EA0L 5GSRA 1PZ8A 3PJQA 5DJZB 2J1RA 2P5EA 5FPZA 1UO9A 2J73A 3IFNL 4MVBD 1JWUB 2OMZB 4M6AA 1U9KA 2HT4D 3MRPA 1KPVA 4P4RA 1W72L 1A4AA 2HXAA 4N90E 1SOSA 1M71B 2E86A 4FNQA 5ANHA 4LOTA 1KIPA 1OF2A 1OWWA 2LVEA 5FOJA 3VGGA 4OD1H 1T22A 1C28A 5ANNA 4HPYL 3D6GA 3FU3A 4NM8H 5EOCJ 3GEWB 4NPYB 3DYOA 3WUWG 3O3DA 5FMOS 3USSA 5CLYA 4FYQA 4KKNA 1OTUD 4KH9A 3UPRA 3ETQA 3HC4L 4B41A 3B4NA 2RJKA 1I7TB 2FCVA 2NSQA 1OM9A 3CUPB 4UT6A 3O81A 5FYKU 2D3SA 2ATFA 5D2NA 4ODXA 5GSVA 5CJXA 3VXSA 2P5WB 1BFVH 2J6EH 3KYKL 1W2TA 5L4JA 5FMBA 2BIMA 3FOLB 3JD72 3D39A 1H0BA 4XNZB 4BMBA 2NDFA 4KZ0A 2VUDA 1AJ7H 4U3SA 1TEIA 3DUHA 5HHOB 5GJSH 5F1NA 4HALA 5J8OA 4ZKTB 1RZQA 2WAQA 1QSEB 3QFGA 1RSYA 1KLUA 3F85A 3ES4A 5I9QB 5FY7A 5FZDA 4PBDA 4KQ0A 2Y6SD 5F39A 1KJ2A 1QOOA 3H0TA 4EI5D 1W0PA 4XP5H 3ZPDA 1MREH 2V2TA 3OAUL 2C9XA 2WXRA 1R24B 3ZLQC 1H3XA 1NFDB 4Y4FC 5HJBA 4MZ3A 3TA3A 5BRZB 2EUWA 2ZGOA 3SQOL 3NAPB 2YUZA 4OR1A 3IN2A 3MACL 1IBZA 5KVEL 1FNSL 1CZVA 1ZA7A 1MFMA 4A2DA 3SCMC 5I17A 4C56B 2I07B 1L9NA 3DGDA 2KC0A 3GXFA 2EXSA 2J72A 4Y9GA 5I8KH 3FHIB 3ZKMD 4OQ9A 3UESA 4MXQD 2LU5A 3L8QA 4BB3A 4FTDA 4AOFA 1ND2B 2XWZA 3RZCA 1VBD1 2IXQA 2WNGA 3R8BB 1HQ4A 2VDNB 3QC6X 4OUOA 4DPRA 4Z82A 2PYFB 3VBHC 4DKFH 1TJHL 1B3IA 2BY1A 4MCYA 4YDZA 2AZUA 2VR5A 5CR1A 5JMOC 2NQ3A 3DPRC 1H1IA 2Z4QB 4I77H 2JCCB 2NY7H 4UNTA 4X9HA 1HJFA 3P40A 4PJDE 1URLA 5CIPA 3C6SB 1SRDA 1NGYB 4IQHA 5KYWB 3BIAX 5C0ND 3BWAB 3SGDH 3ZZQA 3REWA 5MENE 1JYTA 3TTSA 2FLRT 4PJGA 5KZCB 2IAMD 4LJHA 1DVSA 3WFDH 1LD9A 4CVZA 2AJXH 3QI9B 5JI9A 1ZMYA 1F15A 4J6GA 3EH1A 3NN8B 4IBLT 4JLRB 5GGVY 3RKDC 1LNUA 3Q1SH 4M7LH 2WZPP 1EEUA 5ACZA 2ZMLA 3LB6D 2ARJA 1D4VB 4JDZB 2EIEA 1HJBC 4QR7A 1AR1B 4YARA 4W9KC 3ABZA 2ZX2A 5IFHH 4C0BA 4F8AA 2DOCA 2A6KB 5DMIH 3L3IA 3DETD 4PRNA 3MFFB 5IESL 5L9BA 3H53A 1TETL 2CKBL 2N0KA 1HKFA 2BDRA 2P5WE 4AI3A 3NVQA 4P3CH 4GB31 5EBGA 4NOBA 1XT5A 2JCCA 3QRGH 1ZA4A 5E00A 5ICZA 1LHNA 2ED9A 3ILPA 2B4KA 2VB5A 1FYUA 3IAGC 1MCOL 4TULH 1SJXA 4OZOA 2GSMB 4PLOB 2VITB 4A6YH 2WBJB 2E56A 3DV6B 1N59B 2APBA 2QNKA 3VCLB 1ZHBA 1L7IL 3VFWA 4NGHH 4ZMTA 3V0AC 2EO7A 2BOBA 1DYKA 4JPIB 4NLAA 5A3NA 5AVVB 5TFSH 4YMPA 4QRRA 4B53A 1RPQA 4ZFGL 3B43A 4NRMA 1VADA 2R83A 3OMNB 4UV7L 4Q4V2 3PPSA 4HPOH 4HX1A 1NAMH 4R9DA 4UBHA 1SUJA 2F74B 4KVCL 4MWFA 2HVJB 2BNRD 3VWJB 1G6NA 3CUPA 3POJA 4IEWA 4N53B 5JXJA 4XNXL 2DU0A 4XJ9A 4HIIB 3I9AA 3X3GH 2OZ6A 5E6RB 3RNQB 5E4IA 2Y8KA 2W65A 3KV5A 1KEMH 2EH8H 2UZYA 4JM4H 4UIMA 3BDYH 4HT1H 1I1AD 2W9EH 4PIRF 2O5XH 1XV8A 1LRHA 3UIYA 1ID5I 1B4JL 1O5DT 2CKBB 2QQNL 1PG7X 3H9HB 3RA7L 4A2LA 5I0YA 5IB1A 4PI0A 5KXEA 3RZLA 1P4LA 4TVPD 5IHUH 2ZIDA 3PQYE 3ZE0E 1SJHB 4WEUD 1ZS8B 4KUZL 4Y8DC 5ALCL 1DFQA 1RZGB 4YSAA 2PAKA 1WCSA 2R4RH 3ISYA 1UOBA 1LK3H 2VQTA 3OKNA 1A0QL 2LFEA 1QW9A 5E8EB 5LGJB 5MEQA 1YN7A 2RAMA 3C60B 1AKPA 3ZFFC 2ZKHL 3R7RA 5CD3A 4PR5A 1W2AX 1I7UA 4O4YL 1AR63 3WE6B 2C1OA 4XVTH 2TRHA 4QDRA 1FZKA 4MAUL 4ZRGA 5M94B 1SJEA 5E89A 3WMPA 2B7DT 1TQUA 4OZHA 5E08L 3DPBB 3QEQD 3OMZA 1SY6L 5SWZE 3KWTA 1R082 3EFOB 1WA4A 3MRIB 1JYWA 3JQOB 1AR91 1RUE3 1MS5A 5J98B 3QJXA 3SDDC 5FFGA 5T3ZH 4ZQKB 1TZGL 1N0LA 3AP9A 1QBAA 3T4HB 4N2EA 1H30A 1UACL 4C1WA 1DVFB 2PWEA 4ES8A 1OGAB 5E1HB 1QLEL 3RVVD 4CP0A 4AC2A 1NEPA 5DQDH 2AK4E 1VMHA 5TQ0H 3S7GA 2CWSA 3CFCL 5L73A 3K0YA 1TQVA 5FA3A 3WFBH 3JXSA 3IU4L 4Z7VF 4P2RE 2X1WL 1E28A 3T4YB 2NMOA 5F5IA 3MV8E 1QRNB 1C12A 1NBYA 3OGOE 5DJ8A 1W90A 5IEHB 3UTSA 1M9WA 4O65A 4H40A 3DDFA 3QUMA 5A6ZA 1P1ZA 4HN1A 5KWRA 5D7HA 5A2BA 3ZR5A 3KWUA 1A6ZB 5BXXA 4E42A 3DX1A 2WAAA 1FZJA 3MRJA 3QFJA 4JKWA 5IW1A 3D4GA 3GZEA 3U2JA 3DIVA 1IS6A 2VXJA 3VXUB 4JFFE 5HHNB 1OVSA 2XJUA 2EDFA 1MW3A 1FBIH 5I75C 2WLIA 1S55A 1AD0B 1JDCA 3IRPX 2HLEA 2X89D 4A7TA 3FCBA 3VDDA 2CJSA 2RS12 1QNYA 5ECGA 3O6MH 1UZYA 2YJLA 2QSVA 3UJJH 3ULUC 4G8IA 2DEYX 2GMMA 1IHMA 3WW4A 1B09A 2QPDB 3UAFA 3SQRA 1UCXA 2EZ0D 5I1LA 2DYPB 2I9TA 5I66B 4QHUA 3VGAC 2CDGB 3TPUB 1IJ9A 1GYUA 3MTRA 3NIGB 4LIQE 5ILTL 2Q8DA 3GJEA 5AYUL 1YEGL 3F7VA 4O9HL 3FN3A 5F88A 3O1SA 3G08A 3PL0A 4IGQA 1VPOL 4XP6H 4AYEC 4KXCA 2ILLA 4FFYL 3PTRB 4IERA 1KOAA 1T04A 5I18L 5D2LF 4LKCB 3SPGA 3BRGC 2W2IA 3T1MA 3O0LA 3TH2T 1NCCL 2E7LC 4JHWL 1OUXA 1K3ZA 5I8CA 4AGGA 1IBGL 1JN6B 1C4RA 1QATA 3PVBB 2P3YA 2HZHA 3A47A 4U3XA 1L4IA 1NMAL 2FNBA 3HNVL 3HR5A 2ZUQC 1JXNA 4ALAC 3RNQA 1AR62 2B3RA 2XWRA 4LVOB 1WFNA 5D4JA 5EBLB 3LN4B 3TFKC 2DCKA 4ENED 4UNUA 4I88A 2QJVA 5KVFE 4EIZC 1IKFH 2WBJD 2AFNA 4H88L 1XR9B 3O8XD 3RVUC 5FZIA 2ITEA 4AFCA 5A3UA 2BS9A 2QQKH 3V4PL 5ID0A 1PYWA 2A7BA 3KXFB 4JCWA 5DDJ3 4JFOA 3K8MA 1BVP1 3PWLA 4A7GA 1IGML 3GF6A 4AENA 4K8RC 5HGGS 1HXS1 3POIA 4NO2A 3KBHE 2P8LB 1NCQB 3WSOA 2OMXA 4BINA 2F8OA 1IGJA 3KQRA 5LBCA 1AGCB 2Y6JA 2YBKA 4F7MA 1PIV1 3D8CA 3QXWA 4D3WA 4D0BB 4HGMA 4JQIH 5E23A 2PHRA 5EC1B 5IVBA 2WS93 2YN5A 1BQLH 5TF0A 3CSYB 5B1JC 4ZUSB 1FYHB 3APBA 3CZJA 4FJZA 3VG9B 3FQUB 4P2QB 4NQDE 4GQZA 3VFMA 1UHVA 3RWCB 2GHWB 3H2QA 3GSXB 5TPWL 1LQBC 2VM9A 3EH2A 4K3DL 1NUNB 1XZ0B 2VXVL 3OKMB 5HHVH 3EG9A 3V0AB 1TENA 4KRNA 3TEWA 5AEAA 1CLZL 4IU2B 4GIAA 1O91A 3DJTA 1OURA 1R64A 1IEBB 3LQAL 3T1FA 5KWYC 3LIZH 3Q8BA 2HEWF 4HMDA 3EW3B 2GQHA 3H6AA 4QXVA 3WQ1A 4JV4A 2DRUA 3X14B 5FWJA 1T2JA 4BFIA 4NXKA 3C7EA 2VSDA 1W0VB 3HAGA 1FO0B 4DZ8A 1UU6A 5IJRA 1DJGA 4EN3D 4A2EA 1P84K 2V09A 1RUJ1 3FMGA 1UMHA 3IKCB 4PJFB 4X9FA 4ZU5A 3IBEA 3LX9A 2Q8OA 1XHHA 2E8ZA 1ZD6A 4P9ML 3H9ZA 4S10A 1L9OA 1RJYA 5KUMA 5EU7C 4DO6A 2OMWA 4M62H 2HWF3 3RX9A 4A7KA 2JIXB 2LU3A 2FHFA 3GSRA 1CIWA 5C08B 1CONA 3GSXA 4CC0A 2R39A 2WLNA 4JGZC 5FY5A 3NT0A 2F18A 1CICB 1GZWB 4ZS7H 5BYNA 1ZTXL 3H6JA 2I85A 3PLYA 4X7TB 1SLCA 2FDIA 2Q20A 4HEME 2BNUA 1W06A 5FZCA 1EVUA 2UVFA 1IPJA 3DN7A 3PY9A 3TVMB 1XSJA 3OZKA 3WJJC 5LO7A 3OAWA 1AKJD 5HI4C 1U8CA 1RSFA 3X14A 3AMMA 4LBJA 2WCGA 1XB3A 5L2KD 1SFDA 1POV1 4L0PA 4QPIB 1QASA 1U36A 3EJPA 4RGOL 5EU6B 2BM3A 4HFWA 2H8PA 1MJ7L 3AXIA 4HJJL 4Q7DA 4XUQA 3UKVA 1CURA 4CCEA 2X8KA 5JXAL 1EO8L 3DMMA 2JJSA 1BOGA 3C08H 3D85D 5DZNA 3ZIYA 4D8PA 3GLZA 1GQHA 4BA6A 3SY0B 4XBEH 2CRZA 4Q9QL 5DQ9A 4LSRL 4XOEA 3U7WL 4WNJA 2YFZA 4OLWL 1QSEA 4R2GB 4KOBA 1Q1PA 4IESA 4XDQA 4Y5XA 2IV8A 3DK0A 4KO7A 4NZUL 2CGOA 3I6GB 3R8QA 3TBYB 1JPTL 2L0DA 2ZOKA 3BPNC 1C5BL 1UOKA 1S7QB 3DURA 2D7TL 1R3KB 5DZJA 4ZAKB 3ROLA 3ZYPA 4FQ4A 5KYNA 3J7NA 3IDIA 5DK2A 1I85C 1PY9A 3TCLA 3WN5C 2CSGA 3QUZA 2MFNA 4MD4B 5EZLB 1EBAA 4YFLI 1CL7H 3K1DA 3QXTA 1TMQA 4HUXB 3UK9A 4YVWC 1ILSA 5D8JL 3O12A 3HNYM 2G3MA 2LT9A 4HFWB 5EF0A 4FADA 35C8L 1I8IA 2DV9A 5DI8B 5K0UA 3ARDD 1KZYA 3IJEB 3IM0A 3I85A 3HOBA 1NSNL 2AQNA 3WJLA 5DUPH 3IBMA 4HUUB 2K9UA 3DV4A 4O2CB 3NVCA 1B0GB 3QCUL 1ZLSL 1JHTB 1LJMA 2XX0A 4LASL 4ZOBA 3T0DA 3H8UA 4MAZA 1G7MA 2O14A 3HG1A 5DUMH 2WFF2 2WT2A 3SYAA 2XXMB 4P3WA 2DIEA 2ZXGA 4AKPA 3C7OA 3IWZA 3A22A 1J05A 5JMOA 3P4NA 1AQKH 1SJMA 4PGBA 1NCQC 1VAKA 1VFOA 5D1XE 2D6PA 3RAJL 4WK4B 5E94A 4B5ZA 1RUQL 4PRIB 1UY0A 1I9JL 4TF4A 3ZN5A 2AV1B 3CK0L 2CA4A 1MAKA 1DUYA 1AZCA 1NY71 4UI9L 2NY1B 2FDBP 1JGIA 4L0PB 1BF2A 3VFVB 1T6VN 2D2CC 2VERN 1WGPA 4WKXA 2ZKHH 4XR8C 4V2VA 3NP4A 4H1LG 5D1XD 1JVOA 1U8KB 1L9PA 3COOA 2MTAA 3BI3A 4TNEA 3FO2B 1HNFA 1S7TA 2CDEB 2CD0A 4MAUH 5FYJU 3W38A 3W37A 3NRFA 4JS7A 1XF2B 4XCYB 2HBTA 5MP6L 1R17A 3AABA 1NANI 1RK1A 1JXFA 2ZX4A 2ZOWA 3SYCA 2WK2A 1MCRA 4F2EA 1J1OH 1CGPA 3QDHA 4N24A 1E3XA 1A0QH 1LDSA 1SNRA 4Q26A 1MPXA 4RMVA 3S3DB 2J8OA 3WS6A 2D6LX 2CIKB 4RAUA 5BRPA 3L3GA 3MPCA 3WFCL 4ANKA 3KLSA 4JG9A 3UBXG 5AKTA 3VFNA 1DQMH 4JHAL 3UTPD 3E5UA 4RQQB 4HPKB 1P84J 3G5XA 1GW0A 5T3NA 1KLGA 4XPHL 1Q9KB 3WNPA 3RILA 1OHFA 5B7MA 2NW2B 5F7LB 2XZQL 2H3NB 3GD1C 4APQB 1CICA 4P49A 4DN3L 3F7YA 3CVHL 3DHMA 1GZWA 3Q2NA 4XGZB 5K1VA 3LS4L 4NRPA 2IFGA 4A6YB 1RIUH 4XMPH 2XZCL 2D3RA 3MV7B 2A70A 5ACA3 3RU8L 3IMRA 2BSEA 1M3JA 2JTDA 1EO7A 1P4UA 3FFCA 4I02A 2XVGA 2JKJA 2QV4A 3B7UX 1IAIL 2EDOA 1L9MA 3A6CL 1NLDH 3NAAL 4DPAX 4JGZB 4I5BB 2ADGA 2YGOA 4GIQA 1CICC 4JY4A 3OKOA 4MXQC 2CJTA 1CYGA 4J8RA 2VLKD 4I3PA 4Y5TA 4L8DB 2Q0AA 2WXFA 2EAAA 3WG3A 1P4LB 2RQEA 1UG9A 2D7TH 4LKDA 1J0IA 4FEMA 3FQXA 4F20A 3MJ7B 3N0PB 1L7LA 4YVSA 3FZ3A 3NUKA 4GWMA 5AVSB 4KKBD 5GGSY 3KPNA 5I1IH 1V6KA 1JZ7A 4QDQA 2YPJA 4CMMA 4XFHA 3QEUB 3KHBA 2H6CA 1Q9WB 1QHPA 1HC1A 4IGBA 5AYTA 4HUVB 5C2UB 4POZD 4H20H 2F4PA 3IDIB 5DK2B 1H8TC 1LEMA 3B93A 4DEVA 4PS4H 4CDQA 1GANA 3POFA 1TTCA 4R3SB 1ASJ2 1E5UI 3EBGA 1EFXA 2VWEE 1A9BB 2AJSH 2L9LA 1M7UA 5AW4B 2ZXAA 2NXZD 2OMUA 3S0MA 3IJHB 2AJUL 4ZXKA 2MCG1 1RU9L 4XXDA 2OW6A 1QNIA 2C9VA 2DQFA 5DFVC 4IRSB 1ZZ7A 4YHKL 4AEDA 1OGAE 3OKKB 4Y4KA 3DX8B 3K72A 2BOJA 4H0GA 1M05A 3VSTA 5TJWK 4H8WL 1RULL 5FZFA 3BVXA 1MNUL 2UZYB 4L9LC 1W03A 2W39A 5F3IA 2PCFB 2N3JA 5KEZA 2QV2A 1VAVA 2WNUB 1VBB2 1UB5B 3S0PA 4UT9A 3L3JB 1C3HA 1INQB 2FZ3A 4X6EA 5JNYB 5C0DA 3FU7A 3JB4C 1OH4A 3M46A 1BLNB 2E7CA 2AI0H 4N3UA 4QXUL 1KB5A 3WXWL 3NTCL 1AS8A 4G6FB 2WANA 1YEDB 3GBDA 5J37A 2OXHB 3GM0A 1F1DA 2GSIB 4K7PH 1SEBA 4MYWB 3L4XA 1I3RA 3BLKA 1WCDJ 1A4CA 3GJFK 3Q06A 5I8KL 2CMRL 2DLEA 4PR5B 5I23A 4Q52A 1TCMA 2ZUUA 1NUKA 4N2AA 4XWGH 4H88H 3S3SA 3D6EA 1CU4H 4RETB 2HWF1 5EQUA 3LJ3A 3GM8A 5D1QC 2AK4D 1A25A 1HFUA 2BVTA 2FO4A 1VCAA 4PJ7B 5DFWH 4L2LA 3T65B 4Z3FA 1TTFA 3HI1A 4L5FH 4PJDB 4OFYA 5I1LB 4ODTL 1I7ZA 3D3VE 5LNDA 1G9ML 3BYYA 4KDWA 4DUVA 1DVFA 4G2AA 3ZYFA 2JKIS 4A7SA 3C7FA 1IT9H 1G0YR 2W59A 4TN9A 1HHJA 3HC4H 4YDKH 1UY4A 4NHKA 4OGYH 2J8UF 2V7HB 3QGVA 3R4DA 4LCYB 1BPVA 2WLPA 1ECYA 4YHKH 1KBBA 2NW2A 2P1YA 3BVNA 3ZXGA 1KQRA 3EF7A 3FUMA 4OCXH 5CIPH 3GXUB 2NZ9C 3LQAH 3S35X 1CVNA 2F6BA 3PNAA 4FFYA 4LBQA 4NYLA 1M56B 5GGRB 3OJBA 4L3FA 1MHEB 3MV9B 2GDFA 1AKJA 1THCA 2WLKA 1SHSA 3GBGA 2LLLA 3EH4B 1LHZA 4NHXA 1MHHB 2BVBA 1R092 5BRZA 2JI3A 3S7EA 4MA3B 1DJSA 5I6KA 1V9U2 4LOSA 3OTFA 1NMBL 2WTRA 2X9YA 4GQRA 4L4TB 4MNQB 4P00B 2WWOA 1LTEA 4NQEB 2WQRA 4K6BA 1TTRA 5KSVA 3JSSA 4GRMA 1J5DA 1HQ4B 3CIHA 1FDLL 1G7PA 1ENSA 4P46B 2XN1A 3WDTA 4RAVB 3BKZA 1BEXA 4D9QD 5C6WH 5DQ0A 3BMVA 3MXVH 2R69L 4Q4Y2 4Y4FD 3SKMA 1IJNA 1DCEA 3T77A 4BQ9A 4JKKA 3V52H 3K71A 4FOYA 3U7AA 4K7FA 1JTOA 4XW3A 4NAOA 4AQOA 4DB5A 1PIV2 1T03L 4F8TA 4MOAA 5CP7A 3KWWA 4P99A 3EYVA 3H9SD 2JDNA 3H7LA 2XUEA 3WT3A 4QHOA 1Q72L 1U6AH 2AEPH 1YEGH 4O9HH 4DN4L 1FAIL 1R3JB 2XWXA 4JRYB 4KKRA 4DGVH 4QJ5B 1WMEA 1QVOA 2LRPA 1G9AA 5FAXA 3RWEA 4U0RC 5D7LB 4S2FA 1LNUB 4JHUA 4U3CA 4M3JA 5CGTA 2VUOA 3DRQA 4BKSC 4KDTA 5K9QI 2LALA 1MNUH 1KCWA 1VJ2A 4P8QA 1BG1A 4XHXA 3GSOA 3S6CA 1HHKB 1NLBL 1EJOL 3V55A 5GS0D 1W0OA 4QX5A 5LW9A 1JYIA 4PMFA 4PM1A 4EI6B 4N25A 2DDQH 3VG0H 2J2ZB 4JVPA 4CDUA 1A7QL 2XUMA 1H8SA 2ICEB 5HVGB 2XZAH 2P5WD 3R6SA 4XPGL 3ME0B 3MLYH 4P2QD 5D2NB 5JA9A 1L7RA 2IPUG 3GMNA 3L3IB 3ZT5A 1D5MA 2FEDD 3VKOA 2GI0A 1G9EA 4AYID 4GULA 5FY8A 4FP2A 3NSTA 4MHHG 4M29A 4PRPB 2H1PH 3W3BA 4GG8B 4NZRL 3BN9D 5GGSA 4XRCB 1EYBA 1RJYB 4YFLF 3VD3A 2NUTA 4QPIC 1HOCA 1UH4A 5E9DE 5BUVA 4JRYA 5IFAL 2EIJB 2IWGA 2IFFL 1D7BA 1IQDA 1CLYL 5FYLE 4JO3L 4BK8A 3DKQA 5GLUA 2R2HA 3U0PA 5ABJA 1AXSB 1IAIM 3FT9A 4FQHA 2FVNA 1SCRA 1K42A 3R0NA 5MEOA 3WP6A 4NAJA 3ES6B 3PNRB 4JMXA 1GMMA 1E27A 4KJPC 1TZHA 4XACA 4I18B 3HG2A 1Q9LA 1SDDB 5H4YA 5T33L 3WXVH 1U92B 2MKWA 5DHYB 5CKNA 5JZGA 2X6BA 1GWKA 1LENA 3BAEL 3PTYA 4K1ZA 4N8VA 2E7TA 3KGRA 4JM4L 4FOWA 3G04B 3MV8A 4WTXA 4JFHD 4BZ1A 5JSPA 3FULA 5CJOL 3UX9B 4PV9A 5C0FA 2XWTA 3SBPA 1PNFA 2FD8A 3LKSA 1KCRL 4MSWA 2AGSA 2GJ6D 4HKJA 3M1BA 4K3EH 1PGSA 3D0VA 2AC0A 2YV8A 2PNDA 4K07A 3G6AA 4R90L 1TQSA 4AGNA 5IQ7L 3M3OA 1R1A3 2NZ1A 1H6TA 3ZT6A 4FLHA 4CDHA 1MRDL 2IXKA 1FYTD 1HS6A 5E6ZA 4C4KT 3QORA 3V0VB 2WD0A 4X80L 1FL5B 5IG7B 2VJ0A 2IGLA 2BVQA 3BUPA 3BAXA 4HV8A 2NY2B 4BK5A 5CFCA 1ZLDA 2FX8L 2W1UA 3BD4A 2R69A 2G2NA 4KOCA 5I1EH 1MCEA 2R2BA 3MO4A 2WXKA 4MQ7B 3AMNA 1JFHA 3N3HA 4NO5B 2VLJA 1SFHA 2J1YA 2NY6C 5D70H 3SBWA 1U4FA 2LU4A 2WVUA 4R26H 1R3IL 4MQSB 1PO11 2K4AA 3PWVB 2WZEA 2E75C 5A7OA 3PAUA 2DJ4A 4XZPA 3JTTB 1QUPA 2DYSB 3OB0K 3F5WA 2H2PD 3KCWA 4RRPM 2VRAA 4DP4X 4ZFGH 2ZWNA 1W9SA 1BZ7A 4YDLC 1G84A 4IDJH 1G6VK 1MZZA 5AVYB 5IJCC 4M01A 1GXEA 4ABWA 1H6UA 4IS6A 2J8UB 4LVOC 4GAGL 4BK5C 2A6DB 3GRWL 3DARA 5C09A 1VBA1 4X8NA 3TV8A 3MRPB 5T50A 2PR4H 1KEML 2EH8L 3T0EC 2WN3A 1RUQH 2KD7A 4ORFA 5KC6A 2WTOA 5I5MA 5HHPA 2EEAA 2Y1VA 2KH2B 3SE4A 4Z7UB 5DUBB 1E0OB 3CJXA 5I71C 4Y20A 3QH6A 1LP9B 5F3GA 4NEHB 1DBML 1E5ZA 1OKEA 2AQPA 1R1CA 4HIEA 1QSFB 4X99A 5GJTH 2OPKA 4G8AC 1D5RA 1T2QL 4OFPA 2VZQA 4NQSA 2FIKB 2PWGA 3S3CB 3FLPA 1LOCA 2CO7B 4JDTH 3PDGA 5SWZB 4OLVL 1BJ1H 4JGYA 1IBYA 3FONA 5IMKB 1FH2A 1N18A 3BPOC 4HS8H 4BFOA 2PTVA 3S30A 3DCQA 3VFSA 1QQDA 2G30A 2D9QB 1AGBB 4BISA 2ARJQ 1AQ8A 2IFFH 4AYDC 4A4AA 1OF0A 4UM8B 1Q43A 1KNOB 3OZ9H 5LVEA 4OIIL 3SPVB 3FCSA 4IOIB 3W58A 4BSVA 5EOQL 4D7BA 3O3DB 3T3MB 2RV9A 5EF1A 5IKCB 5EJZB 5E2JA 4ZD3L 5LBSH 1OI6A 2NY7L 2P48B 3OR6B 3P9LB 4NC1C 2VKXA 5F0PB 5K59F 1G4RA 2GITB 2AZ5A 3W2DL 1FZOA 4X8CA 2X0UA 2A9MH 3AYAA 4EXKA 5CEXA 2N4IA 3ZXKA 1ITCA 3T4AA 2Y7MA 1CLZH 3NZHH 4XCCH 4HIPA 5E6IB 1H6XA 5DSCA 5PCYA 3BB6A 1ASJ3 1C8QA 3GLEA 3G5YB 1JNNL 4FNTA 5IUCA 1K85A 3T0AA 5D1ZA 1R5VA 3RZCD 4G7YL 4JPVH 3SEEA 3ZO0A 4HU2A 2G5RA 4AZUA 2F5BL 3QZWA 4DAGL 4S0SD 5BV6A 5CEZL 2JDMA 5LDUA 4CEWB 2IAMB 1GKOA 3HZ3A 3CU1A 4PPTA 1CXEA 2XY1A 3QNYA 4MJIA 4ZXBC 2DEWX 3ML8A 4F9PA 2XTJB 4YDJA 3DYPA 3O3AA 4XWGL 4IXLA 1HAUA 1MFEL 1ODUA 3BUYA 5FLUA 2VZTA 5KVGE 2X88A 4XNYH 2XIDA 1XOYA 2W46A 4RIRA 1AR1D 2FIRT 4NQCA 4X5QA 1LE5B 4M3KB 1ND3A 1O8SA 1XD1A 2JMRA 4D0BA 5IATA 4QQPA 4LP5A 4X4KA 4PB9L 2C5DA 4CJ0A 4NPRA 2BVQB 4GYBA 1OL0A 3C12A 2G2RB 3VXUD 3O6LH 4DFSA 1RUI1 3IETA 3Q2LA 4E9YA 3EOAB 1VFMA 4NUGL 2FWOA 4FA7B 1UN1A 4PW9A 3B3IB 4NT6A 1O3SA 3AZWA 4XX1G 2WZ6A 4FYRA 3Q6FB 1NZIA 4P2CG 1N5AB 4YDIL 5D9SB 1ALYA 1HJGA 2F61A 2TNFA 5FV3A 3T6WA 1IUZA 3VFTA 4N1CA 5ILTH 4ISVA 1XNCA 3I50H 2QJDA 4GP8B 1SM3L 3AXLA 4JDEB 5BZWA 2O8OA 3LDBC 4HXCA 5IFJB 4U3SB 4UINL 3NESA 3MIFA 2DN7A 1MWAL 1U3HC 4Y5VB 4FVVA 1YECL 1POQA 3IFOB 3D39B 1AP2A 4LO9A 3NFSL 4IOFC 4OCXL 1G1OA 4YGDA 1TTUA 4OH2A 1H6FA 43CAA 4N43C 4BZ2L 3DUSB 3QISA 2BU9A 2V0AA 3KJ6L 3WE6A 3I6SA 1S7RA 2AKRB 3PDOA 2F5BH 2L7QA 4XO5A 1XPWA 4KAQL 1ZVSA 2D73A 1P8JA 2ZGSA 2DQIL 2HSIA 3L08A 3P4MA 5D71H 2WP3T 5IFTA 5GS1A 1ZHNB 5I1KH 5I6OA 2WWUA 5HHPB 3IDXH 1LR5A 1GGIL 3P30H 5JIAA 4APXB 2N1KA 3CN3A 5CJQH 2YEZB 1CDUA 4QX0A 1WD9A 5EUOE 5B38G 1EJ6A 2DM7A 4XF1A 4HV8B 1PX3A 5CGYC 3RTLA 5B3NA 1I1AA 1IEAA 3CFKA 4JM2C 5FAAA 5GZFA 1BP3B 1I31A 1QJY3 1JGLL 2E8YA 1MPAH 3O2DL 5KVFL 2YBRA 4I1NB 3M3IA 4PJBE 5KZCD 3FYIB 4AM0A 3TN0D 3ARFB 2E26A 2VAAA 4LMQE 1LYQA 2AC1A 1BVNT 2DQJL 1AIFA 4XFCA 3U1XA 4U6TA 5DLLA 3N7JA 3F64A 4FQZA 2MNUA 4E42B 2W9EL 2Q5TA 3ATFA 2EINB 1JH5A 2G9KA 4NJ9L 2HRPH 4R7NA 1ZBE1 4XVHA 1NAMA 4CW1B 1EPWA 1FXZA 4UOQA 2A38A 1WBZA 4BH9A 2VC2H 4M43H 4PCTA 2EUZA 1HZLA 4TXWA 2XBZA 4HK3N 2YOCA 4DAGH 2JKXA 4AI8A 1F58H 5I18H 1V9U1 3NSCA 4E41D 5EEZA 2MQCA 3IFPA 2DBJA 5FM8A 1TZ8A 4MJ4A 2YUEA 1UMZA 1VALA 2Z35B 4E2OA 1YHFA 2ARAA 2WUBL 3EOYG 1N5YH 4AXWA 2ZKXA 1OEZW 5I0ZA 1NICA 4WUUA 3LMJH 2ORZA 4HK8A 4O58L 5CEYA 4I30A 3NZ8A 5DC2A 2K8MA 3S37L 2XJRA 4YZ4A 3IT8A 1KCVH 3DDGA 4KK8D 4LSTH 2NT1A 5KANI 2HWB2 2R29L 5TDOB 2DM4A 5IW3A 2WXPA 4P9JA 1QFUH 4CVUA 2ZXCA 1JNLH 1OT4A 3C5ZD 4L3EB 1MFAH 2G60H 4DO4A 1G7LA 4ZMXA 3FBYA 3SH5A 1NGPH 4OLXL 5D8JH 1SEQL 4ZDHB 1DHKA 1H0DA 4HOWA 1YMHB 3OHXA 5HPMA 3QUYC 4IW4C 5K9KB 4NOTA 5F5CA 4DK3A 2WXIA 2DTWA 3ZDYF 1U41A 1GNZA 4OI0A 1JNHA 4M4RA 2EIZB 5JPMB 2YKKA 2UY9A 4NRQA 3TBDA 3MV7E 4FC3E 3ZYIA 2UWCA 3N44B 2W0PA 4N9GB 1GP5A 1POV3 4PRIA 5D1QB 1OAUL 2IO5A 1TJMA 4J4PA 1WQVT 3KM1A 5TFSL 3KR3L 5SV4A 4XBPB 5K39B 3UJIH 2ILMA 5A2JH 3CJIC 4L8CA 3MC0A 3AJYA 2OXGA 3RTQA 4QT6A 4ZS6D 3VBOB 3VBRB 5LJYH 2ZHKA 3VI3F 1F6LL 4M3CB 2V2WB 5C3QA 3N7LA 2XN9A 4X6DB 3F58H 3BH8A 4I8DA 5FHAL 7CGTA 1J0YA 4IETA 4UT7H 2Y38A 3MNVB 5FLVA 2MCAA 5EP9A 4F37K 2IANA 3NK3A 4APQC 5SWQB 1A4BA 1QWNA 5FYJH 3PL6D 2OMZA 3SDDA 5HDBE 1HV1A 1DQDH 3H42B 1GIGH 2ZGNA 2VDKH 3GSNH 4HXBH 4U33A 3ULUL 2BXZA 5TGBB 4UILL 2Y24A 4NKIH 3BALA 3GMLB 4MGIE 2EVFA 2X5IC 4G83A 1J86A 2WIIB 1GZPA 1NL0L 1U3HB 3ZSSA 1Q8OA 3N35A 3B2UD 3FHQA 1MSPA 2WA4A 3B6SA 5DXWA 1KN2H 3VA6A 2V7NB 3WFZA 1KMGA 3KVAA 1J8HD 4KQ3H 2IH9A 3JWNH 5BZDB 4XVTL 5A32A 3FO9B 4ANXA 5T33H 4OHVA 4RWHA 4TMPA 1DVTA 1FSKB 2C8NA 4GKYA 1NGWB 1UCBH 1CX1A 2YFNA 1E43A 4QRUB 4KITB 1T66D 4HHAA 3E9TA 3BN9C 4P2OA 2OL3L 1C1EH 4WEMB 2VW1A 2WJ7A 3IE4A 3PXJA 1RUF2 3QJZA 1E5BA 3LZQA 3NRUA 1MCQA 3HC0A 3HZKB 5LATA 4W6XB 5A16A 4MG2A 1X5JA 3LPFA 4UFMA 1IGIH 5A1FA 1F58L 1PZAA 1YQVH 3ZKXB 5IQ7H 5CKAA 4LKCA 2YA1A 2L4OA 2VC2L 1B35C 2Y3AA 4TVUA 4FDWA 2ZUTA 1SOXA 3CDGB 2B0SH 2HKHL 2HN7B 1GGBH 1KPRB 4UQ9A 3JWNG 4R3SA 2YQGA 1H2MA 4M8UA 2APWA 4UOJA 4RNRB 1RLWA 3VNYA 5C3PA 4GAAA 3H85A 3KT4A 1KJLA 4B0MM 1L9RA 3UTTA 4O5LL 4ZW8A 3PURA 3JZYA 1RZ7H 1D6EA 2DYPD 2DQCH 2IG2L 3L7FA 4BCYA 5C0GB 1R0AH 1SLBA 4CU6A 2OW7A 3U4EA 3CFMA 4I2XE 5CFDC 3WY2A 1WEJH 1K2DA 1LHWA 4BWOA 3HN3A 4BK4A 1AS6A 3WQ7A 3AWGA 1KYDA 1SLWA 1CVSC 4NUPA 3MGOA 4GSDH 3QXAB 2IH3B 5JW3L 2XI9A 3H2PA 2J12B 4YSPA 5L7OA 1D5IH 2VDMB 3HE7B 4JREB 3REVA 2R30A 2WNUA 2N7AA 3WLWC 1QSVA 1V6MA 5A7PA 4HLJA 2AXWA 1N64H 4P3DB 4XHJD 4LL9A 2WNVB 2ZCWA 4OCWH 1KTKE 4LR4A 2Y3NA 1NCHA 3W39A 4DNYA 5FDWA 2PXYB 1QOKA 2VC2B 3V5KA 4G7VL 2PHWA 1Y3TA 3ARFC 1Z9PA 3L1OH 4AFAA 2GTZA 1NAKL 5FKBA 4M7LL 3WUCA 3B3QE 1M2OA 3QQ9C 5C0NC 3LA7A 1LOFA 5FKAA 4FFYH 3QWOA 4JFYA 1O5LA 4IGPA 2AVFA 3CMGA 3WV0A 4FFFA 2MEV3 1RFDH 1UPIA 3T0XA 4ZZ5A 4K23H 1JCVA 5FF6B 1INEH 2XA8L 5I16B 3O3EA 4HEPG 5JHDD 5ADOL 5MEQB 1UD4A 1LO5A 5E5MA 5FP3A 1ZCRA 1OAJA 4WWNA 5SWZA 3FCTB 1PO22 3P2DA 4FXTA 4S2SA 2MEV1 3V95A 1U8HA 4H0IA 3A67H 3HCVB 1PZ7A 4MQXD 1E65A 5ESQA 4HOXA 1NIBA 3U1QA 2BS71 4PJBA 3MW4A 4D7TA 2B1HL 2QFRA 4LEXL 4AIOA 3V5DA 3O1RA 2W87A 3WDJA 3T6ZA 2BWCA 3ZOIA 4PY7A 5JYLA 2AXFA 1CPNA 2C4XA 4XC1H 2RALA 3VI4E 4YDKL 3F65A 5EFIA 5JIDA 1BYNA 3PFUA 1HHJB 1RUC1 3SQBA 5CCKL 5C0CE 2IXCA 1M6OB 2OM5A 1KCSL 2OTWA 1MLBB 5IWLA 1GRWA 5FCUL 3SBQA 1MY7A 2AJSL 2GSYA 1HLCA 1JYVA 1QWRA 2FDGA 4AJ0A 4HC1L 3S35H 2J88L 2ESVE 2IOMA 1QKZL 5IBTL 4XO9A 1VRBA 2VL4A 1EFXB 1KXQE 4TOYL 2RS13 4XAEA 2CO1A 2ZONA 4NSKA 1G1KA 2AJYH 4CN6A 4Q4X3 2VDPB 1JOPA 3DUUA 3MBEA 1H3PL 1DJXA 1JGUL 4L1DA 2QQOA 3NNLA 4NCC2 1U8LA 4Y1VA 3QUZB 3THMH 1RUPH 3TIDA 1A4JB 1GZTA 2D3LA 5JR1L 1WAPA 3QH3B 3GHPA 5JPMC 3QDJD 4JTOA 5EPAA 3UV9A 4NPYA 3M8OL 4F7PB 1JP5A 2CV6A 2X2JA 2PPDA 1G7QA 3NPSB 2DQIH 4EZJA 5EV7A 3VD1A 1CDBA 1A22B 2A6IA 1YUDA 5A7QA 1A2YB 5E5LA 2E6JA 1IBHA 1T4KB 4G1MB 4F8QA 5E9NA 4QJ4B 4GS7B 1SLIA 1H5BB 1OTUC 3QS2A 1FO0A 4HUUA 2Q2LA 3SCHA 2XA8H 1OVPA 2CJUL 1AL22 1N10A 3SQBB 4XPFL 1UB5A 2XL9A 3GZAA 4P0DA 3IDCB 4J6RH 2F54B 4BUQA 1MW0A 1QPXA 1UXSB 3BZFA 5D93C 5B38B 5L88L 1FGNH 1HI6A 1IC4L 3RY4A 3EGSB 2X05A 1MS8A 5GRZA 2EXYC 1TPXC 1DFXA 1ADQA 3C5ZC 1KCUL 5GGTL 9CGTA 3RFZB 2OAAA 4K9SA 1PLBA 3WF4A 2FJFB 2CLVA 2GJPA 5ERWA 5HYSB 2QBXA 2O72A 4OLYH 3HBPA 4HPYH 3RY6A 4A6YA 1CAUB 4PLOA 1GH7A 4ZMPA 4LA2A 1W05A 3EFDL 5D1XB 1NGXB 2E7HA 5IHZA 5E24E 3E97A 4FCHA 3RZWA 5IB5A 2Y69B 4LEOA 4Z0XA 1X8MA 1EXUB 3IJYB 5GLTA 1W72B 3KPOB 5BS0B 1JOIA 3O45A 4LF3A 4MRBA 1VERA 5IGXL 1OD3A 4P4KB 2NR6D 4X7TA 4KKQA 4EUPA 1R083 4K94L 4D69A 4FX5A 1TSRA 5HYFA 2PTTB 3VE0B 2YD7A 4Q9BA 4WVMA 4EPSA 2ZS6B 2YQBA 1ASJ1 4ZMNA 4AEFA 4OZGA 3FWEA 1B90A 4X5WB 2XY2A 3QS3A 4HKBB 4M7KL 2O5XL 1UYWL 3GKZA 4IKJA 3HLAB 2HP4A 4UZGA 1UD1A 1R5VB 5ENWA 2YSSA 3SODB 3ZZSA 2ET1A 2E7MA 4LNRB 2C9QA 1X5MA 3MJ9L 5DDHA 4BSJA 5A6MA 3QO0A 3CJIA 5IK4A 5J09A 2GN7A 2XTSA 4ADJA 3NCEB 4XMXA 3LN5B 3WS3B 4P4RB 2DL9A 5C9KA 2O6PA 2EDMA 1AXSA 1RHFA 3H55A 2Z31D 3RQ3A 5FK8A 4M93C 5KANG 4DSYA 1ZEAH 5B8CB 3DECA 4U05A 4YHML 3WHE1 1NGYA 5AAMA 4KKZA 4WO0A 2BINA 3GLAA 5FY1A 1DE4B 2BPA2 4YSDA 4G9FA 3K4DA 5CGYD 3PWNB 5E2TL 4JFHE 1YJDC 3D39D 4MAYA 4U1LA 4XCBA 1SOKA 4XJZA 1T6BX 4NQXA 4X4YA 1I7UB 4HVBA 1ZA3B 2XIBA 4W9JC 3HE7D 3HAEH 1ACYH 4HAKA 4X5PA 1KEGH 3AW5A 3NIDE 4R26L 1KXGA 4NOFA 4A45A 3KCPB 3DOSA 2A6WA 1KXVC 3ECWA 5LB6A 1YCIA 2N7GA 4PS8A 5HJ3B 4HH9B 5AVTB 3QEGH 2CR6A 2ED6A 4LSPL 4RGMB 3TZVB 5INCB 4Y4FB 3C60C 4NUJB 4WM8C 1OAUH 2VT0A 4TSBH 3Q44A 2NXZC 4UT6L 4LEJA 1M6OA 2OTWB 3O3BB 1CE6A 4N90D 3VFRB 4UFLA 1NDMA 2FX7L 4W6WB 2JG9A 2EE6A 4CU9A 1UJ3C 1J48A 3Q13A 2OP4H 1IAKB 2B5IB 2P9RA 4FFZA 4IU3B 3P9WB 4Y16D 5H37G 4L4VE 1YFXA 1R3JA 3FLRA 2WT1A 2BJML 2FWUA 2GUOA 5CB7A 2BMKA 1VMFA 3SDYH 4QRSA 2H5UA 4CN4A 1QJU2 5I8YA 1W8HA 3P73B 4ZQTA 1JWSA 3TNPB 1PGL1 1W6QA 1NCNA 5FPAA 3KPRB 4NNPH 2RM21 2W38A 1AJOA 1ANUA 2QADC 1BM3L 3ZTEA 3B9EA 4IBQA 2QZ3A 1DVUA 3BPOB 1QTYT 5ANME 3HNBM 4JTNA 3S2CA 5I0SA 3RSJA 1SYSA 1YZZA 1VJSA 3NJFA 3T0EE 3SE3C 5FO8B 2Q9OA 2HYKA 1VGEH 3GBMH 4O58H 2JB5H 5GRJH 5C7XL 4YBHA 1RUE1 4R9BA 3SQOA 4NJAL 1B0RB 2WABA 5DRZA 4HGKC 2DV6A 2CNYA 1FVCA 3BPCB 2QR0A 3CHQA 2CH8A 3OKEA 1VEPA 4IRSA 4X80H 1HILA 3IYLW 1D6VH 4G8EA 3X12B 4DHLA 1KBWA 3HMXL 4LHJB 1FATA 3U46B 5AW0B 1JMUB 2YC2A 2HB0A 3V0HA 2EA7A 5A70A 3KXFE 4EI5B 3KPNB 3ZFEB 5FUZL 4NWTH 4ODWA 2ZGKA 2D3VA 4HJIA 4NP4L 5AVUB 3HB3C 1L7IH 4U1KA 3SKJL 3KLAA 4META 4N86A 1F02I 2CLZB 4DO5A 3D2TA 2E7DA 4ZX5A 4NNYB 4PBWD 4FXGC 5IVZA 1U8JA 4CDUB 3UBHA 1D2OA 5ABAA 3PUUA 2P6CA 1W28A 5IK8A 4MRCA 1P1VA 5KTEH 2B1OA 3KXFD 2A6YA 2IWGB 3UL2A 1IQWH 2NY4B 1Q72H 3AS3A 1FNEA 3QUXD 4OAWA 4WFGE 1DJHA 1WA2X 5IOKA 4TUJB 2CU9A 1ZIAA 1R1A2 3NN8A 2FJSA 5LY2A 5FZEA 2C1OB 3HI6H 5AUMA 4YC2B 3BDYL 1JPEA 4C4BA 3O14A 1ML0A 3BLBA 3II2A 4XGZA 3GSQB 4G6JL 2ZQKA 1CQ9A 3D0LB 2A74C 5CHNB 3WNJA 5JHLL 4I5BA 3ZL1A 4OSUL 2C9PA 3HBGA 4R7VA 3ZXLA 1FG2B 3KYNA 2J43A 3NCWA 4F8LA 5K9JL 3KT7A 1X9UA 2VQ1A 2TSBA 2H0VA 3OF6D 4LDEB 3A6BL 4MASA 5DO2D 4ZNEA 2D93A 4IJ3B 4E4DX 3QWNA 4EE2A 3MZHA 4PYHA 4IGOA 4AZ8B 1EEYB 1T5WB 1QYGH 3ZVVA 1QAWA 4YAQA 4XJ8A 3MRQA 3N9LA 1ZZ6A 2OXHA 1PVC1 1QVOB 3MLTB 1ND0A 1DVFC 2P4EA 4RQPA 4NM8L 4AMKH 2Q8BL 4IEXA 1N3NB 1X36A 4HIXL 4PJDF 3PG2A 5B38A 1NEZG 4FPFA 2C1FA 4HCFA 3IDNB 3GPEA 4LDCA 2ZOEB 3V0FA 1MHEA 1W72H 2O6CA 3JVGA 3MV9A 2WW8A 2OS7A 3VQ1C 2LR4A 1BQLL 1TTAA 4PLKC 4F57H 3QDGA 3KVPA 12E8H 1TTGA 5DZEA 3ABLB 5J9PA 5I0RA 2RBLA 1TLMA 3WV6A 1IM9D 4YDIH 1SDAB 3HJEA 2JDAA 1MI5B 4F1ZA 1CFBA 3N50A 1EVTC 3NSXA 3L3DB 2HUEA 5D1ZI 4JFSA 1AR72 1CF8L 3I2CL 1RUF1 1IFGA 3ZKUA 4M5TA 5JIUA 5HY9B 3IVKA 1VBA3 5EHDA 3PWVA 4KTDH 3BOWA 2D6MA 3WFDL 4XXPA 3T2TA 4OJYA 4YHPB 3O1VA 1IL1B 4POUB 1XU1A 3O8XA 3JWOC 5FY9A 1WRFA 1ID2A 5A2AA 2WYHA 2FWLB 3GSWB 4C55A 1N4XL 2OVUA 3KEDA 4Q9RH 3EZJB 2J1WA 4QXKA 2WN2A 4OZFA 1ZRDA 2AVGA 3TURA 2DBLH 4OCLC 3FF7A 5FWEA 1GY1A 3CJIB 3FUEA 2GFBA 3AMPA 3X29B 3ELAT 4JZRA 5IB3A 1KELH 2VNCA 3KNBA 1M1XA 4A3ZA 1RZFH 1ACCA 2I26N 2R1DA 1KB5B 1SJEB 4HUXA 3EBAA 5J1SC 4CC4C 1OOPC 5L4MA 2G19A 4IEFA 3LGRA 3UTTB 4G8EB 4MXVE 4HISA 1OARL 2GIXA 2APVA 3IDJB 4KBPA 1FRGL 1YY8B 4LXFA 4U1HA 4DEPC 5B8CC 4LQRA 5DRZB 1TITA 1LOGA 5FYVA 2W9DH 5DC0A 2Z7UA 4LBEB 2RJ2A 4YEEA 4LSUL 3LNIA 5HVHB 4LLVB 5IQ9A 3ATAA 1OT1A 1A1MA 1RU9H 2ENJA 4Z7NF 4MAYC 5K9YA 2CNZA 4N0UB 1H9PA 4JGYB 2XDHA 1JZHA 5FA4B 2WKOF 4OHXA 4LCIH 5KBLA 5AAPA 1QRNA 1QMUA 3PDQA 5CJXC 3EOBB 5KJRH 4PDWC 2XKSA 1UD2A 4B9FA 4D6RA 4PRPD 1QWUA 1PNCA 3NGBB 3JWOH 3LTVA 1ZTMA 1S2BA 2XBO2 4UTAH 3US0A 4IJTA 1IZ3A 1RKRA 3HZKA 3SKOA 5H35A 4HUMB 3D51A 3MA9L 4GAJL 5GALA 1A9VA 2E6QA 4LPWA 5C0AA 1S5HB 3RJ2X 3AU1B 3UAJA 1ZSDB 4RMWA 3NH7H 3N85L 3VXUA 3QEQE 3ZKYA 2VN5A 1TZIB 1OGAD 5GGRA 3RGVD 2MHAB 1ES0B 1UIKA 3FT0A 3HN1A 2VXQL 2GBTA 1J5HA 4YM0A 4WI4A 5ETUA 3DVFA 3WZ1A 2XN0A 4LMFA 1LM8V 4PBPA 3R05A 1EJ8A 1BVLB 2DU1A 4HF5H 3WINE 1J0ZA 1MFEH 3N1PC 4A7ZA 3GXTA 3CH8A 3TT3H 3B9AA 2VQ1B 3FO1A 2WLMA 4U4BA 3S9DB 1WO2A 1UZWA 2FJHB 2X3CA 2NX5A 4ZFQA 2W68A 4Z7OB 4MNGE 2UYLA 3W9EB 4R0LA 2D0HA 2EEXA 5KS9E 2K6ZA 2FR4A 3OZLA 4Z76B 1R3IH 2GJ6B 3L4VA 4AVKA 4PJ9A 5J06A 2IH3A 4D9RD 1BF5A 4PJYA 4V1DE 1N64L 2YD9A 1ZDSA 2VAUA 3ZKQD 3LOIA 4YM2A 3TN92 4B97A 1IZKA 5D7LA 2IVJA 1LMIA 5IG7A 4HEMA 1G9HA 5FY0A 1MZYA 1HDMA 3O0VA 4LO6B 1J59A 4FNUA 3TN91 4XCAA 4C56A 4EN6B 4LMQI 4MB1A 5ITFB 1VIWB 4MMZA 1GR7A 1S7UA 4R5VA 4UTBL 4UFJA 3OKOB 2VISA 4WI7A 5CEYB 3PMEA 2VUYA 1C5CL 1KJ2L 5I0VA 1MQTA 5MEPB 5SX5H 3HPLB 1JGDB 4HT1L 5I16A 1LHVA 3RZMA 2X3BA 1XF1A 2AXGB 1NXMA 4D3CL 4AMXA 3NV4A 1QDOA 5BV7L 2I69A 4OJFL 1A3ZA 1MCLA 3UBFA 5LB1A 4HK3J 4YH6A 5LA1A 4FS0A 4GMTL 3EFFB 3ZE1F 8CGTA 2P8LA 5HPOA 1KJRA 1NCQA 3A7QA 5JZGC 2F54E 1SLXA 2HWZH 3VSUA 3RY6C 2CY6A 4FQXD 2BSRA 4PIYA 5DEFB 4IEQA 1CJYA 3ECQA 4YO0A 4ZUSA 3B1TA 1XE8A 2TEPA 4HCIA 4J1UA 1MFUA 4QKXB 2FQPA 2XG5B 1Z2KA 5EC1A 4P04A 4AH2A 1DQML 4L1LA 2BBVA 3FFOA 4K5NA 3M88A 5L7XH 2IQ9H 1IEHA 5ITFA 2FNWA 4YIQA 4YBQC 3UPRB 1HQWA 2VSKB 1X5HA 4NQCD 5GS2D 3C6LA 1SY6H 4X98A 3U78A 1RMU3 2BP8A 4AKQA 4IHOB 3LNDA 4LHQB 4P14A 1X9RA 5JR7B 4PBVC 1FPN2 1T89C 2Z9TA 3CFQA 4JRXD 1L7TL 3N9MA 3SH4A 4GXUM 5EU3B 5B3SB 5E1QA 1VDGA 3IF1B 2GU9A 3RPKA 3V65A 2NQDA 3VXRE 1H4GA 1S0JA 5E00B 1QA9A 3AY4A 4P23A 1DDTA 2IH8A 3OMAB 5FGCB 1KXVA 1WISA 2IGFH 4Y1AA 5I73C 2ADGB 3NSYA 3LKPB 5JXED 1ZLWK 2ROXA 4KVNL 4UNIA 1Q9OB 3UYPB 4QHUB 2NCEA 1OAKL 3L95B 5EIVA 3UYRH 1AIFB 5I15H 1O59A 3OGRA 2IANB 3BMWA 4F91B 3M17A 2J56A 4FI6A 4XH2B 1T04B 5HVHC 3VD0A 4P5KA 5KYYA 1E2VA 5IT2H 5DURB 1I3RB 1K5MC 4RS5B 5J7MA 4FNPA 2ZHLA 1S9YB 1YVLA 3JTSB 4AR2A 3C6LB 5D71L 4F8NA 5DK0A 5BW7A 4NKDB 4QOKB 4HIIA 3QZWG 1BFOB 3T4AB 2XJSA 4HPHA 1AG0A 2PCXA 1TJHH 1MCKA 3UTZB 3ILDA 3H1YA 2ZPXA 2H3XC 2OYPA 4XMAA 2AK1H 2Y0OA 2NNAB 3MNZB 3WHXA 3JV6A 3SCGA 4FG0A 5I6XC 3VBFA 5AW7B 2XFXB 1SJVA 1HW5A 1AH1A 4QQOA 4X6DF 1HRI2 1QH7A 3BRFA 4MXWL 1OY3B 1X5FA 4FI9A 3TBCA 1XF4A 1SEFA 3LRMA 3O3BA 3VFRA 1OE2A 2A4ZA 3DK2A 1CAXA 3WCSA 2UWAA 1UIJA 4N0UA 4F92B 2TAAA 3CSGA 1AL0G 5A6YA 2DWTA 2EDEA 4Y9CA 4EN2A 1PMJX 1C5DB 1FVDB 1J11A 4WGVB 1F35A 4OCYH 2Q1FA 4ONGH 3U4XA 1K5NB 2VBPA 4JGYC 1MHHA 2ICWB 2WYIA 1CGTA 5EIIA 3MRRB 1DVQA 1MRFL 1KIRA 5J6GB 4PTUA 3QZOA 1OSPL 1A8JH 1AVAA 4DVBB 4ETYA 3T2NL 3T0ED 3OAUH 1XQNA 2LLNA 4WUKH 3ZE2E 3QEQB 3UDWA 5EYYA 1H8NA 5CBEB 5AW5B 4ZYKB 1YPZE 3RL1B 5DUBA 3LFMA 4UT5A 4YM3A 1ORQA 4JKPL 3D18A 2Z69A 1CGSL 3P0YH 5E9DD 3WW2A 4N3TA 4AAXA 1ZTXE 4WJ5B 5FUOL 4QDGA 5LGYA 5DJDA 5IYYA 4YE4H 3BZDA 4QB6A 4QX8A 2B59B 4QX7A 1WLDA 2WXQA 5KXCA 3MLPA 4U1KB 3CEWA 3L4WA 1Z3GH 4OCNC 3KCPA 1UZ6E 2DH2A 5DS2A 4H14A 4HK9A 3T3MF 2VABA 3MRGA 4JN2A 1G9MH 4L23A 2ESVB 4WFHD 3DWTA 5CU1A 3OPZA 3C7HA 2BNMA 3FCSB 3NV3A 3K0WA 2HFEA 1U8PB 4Q6YA 4UM8A 4Y22B 3MICA 2VYRE 4LFHG 2XN9E 3N9NA 4WO4C 2OZ4A 2R7EA 1YECH 2F1BA 2FD6L 3MBWB 1FNEB 4BLIA 2JCWA 3LRGA 4ELKB 1A8ZA 4XN1A 3LPGA 3VU2A 5DZAA 1H6YA 3UCRA 3IGLA 2DJSA 2VM4A 2XTLA 1EWHA 2HVJA 3ARBD 3W82A 1PM4A 4FQ2H 2PO6D 5ABZA 1K8IB 5J5EA 2A99A 3FFDB 3OAYH 1NOAA 3Q9PA 4QRUA 1UOFA 4CRPA 5CAYB 2NY4D 2CNAA 3MCKA 4FQXB 3ZX7A 4URKA 3DMMB 4ODSL 4LVNC 4PJBB 4LBKA 2H8PB 5GHWL 2IJ0C 3QQNA 3HVNA 5BOPA 1YY9C 1F3RB 5EN2A 3OKEB 3QWRD 5HJDA 1RUAH 5HYQB 2K3TA 5EU5B 5BNNA 3CXDH 1RZJC 2PWHA 5D96B 5E1RA 4KWLA 3FTWA 4NQCB 4HVRA 3KD4A 4KU1A 3QH7A 1UM5H 2Z93A 5GRWA 2I27N 3BUYB 3IDUA 5KHHA 3NJKA 4LLDB 3AXEA 2NSXA 3CLWA 4Z8BA 4XPBL 1MHPH 3L3OA 5A7WB 4KY2A 4PRHD 5I74C 3AY4C 3D4KA 2X2HA 1WC7B 3BVCA 1QTPA 4MDIB 4EOWL 2NZ9D 1DUZB 2Q7YA 2YBRB 4PG2C 4E9SA 1JGUH 1ZVNA 3V6ZB 2EEBA 2J1ZA 5D8AA 2BP0B 2DLHA 3V4UL 4AMWA 4ELMA 4WWKB 4BH8B 3U11A 3NJMA 4HKZA 2ZABA 3TT1L 4XMIA 1B6DA 4F33B 1NCJA 5E4EC 1WBXA 3KGUA 3UJQA 2OKXA 4G7VH 2ITCB 2CPUA 4JQXC 2OYKA 4LVHB 5HCAA 4HCRH 1ZJAA 3I3EA 3U4AA 4Z77A 3QPKA 2QKIA 4YHPA 5EO1A 3CZKA 1NC2D 5D1QD 3D5OA 4O7XA 4B9KC 5A33A 2EH7H 1DBAH 4QF1A 5E6UB 4QXBA 3PVNA 5FGCE 3EH5B 3QCVL 2Q8CA 2Z64C 2ARWA 4PJGE 4GUPB 3KYAA 2QQKL 5DG2A 4G3YH 2F58H 1UA6H 3DUSA 4UDTA 1G7YA 4RGNB 3BYTA 1TEYA 4PDWB 1OV8A 3QUKA 2JE7A 4PV8B 1FVEB 4LHUG 4XNAA 5AKRA 2KLRA 3B7YA 5L9RA 3VBFC 4CDUC 3SDCC 2ADJB 2RMU1 5FF6A 5FXXA 3MLJA 3O45B 5CJ8A 2VECA 4RH4A 5E1IA 3N43B 1AFVH 5IB5B 3WTYA 3B2PA 4CPBA 1RHHA 1UFUA 1H3UA 1HQRB 1WFIA 3L9RB 4ELMB 5F96H 3PGFL 5HHMD 1RC6A 5LEJA 4R97B 3N1MC 4L9DA 2E46A 1DQQB 1BZ9B 2YAPA 3HE6B 3L4TA 4AUUA 4JHAH 5I0XA 4BEIA 2B5HA 5EEYA 2G4IA 3D85B 3W2DH 5KJ7E 3FUOA 4Q0UA 5F7DB 3HCVA 4XOCA 3FUKA 4E0RB 2HJKB 3HKFA 3GMMA 5BNPB 3FXIC 1T7VA 3DHPA 2JQMA 2VQUA 4F58L 3HRPA 3BKMH 5K5YA 3GJBA 2R0KH 5F3BB 4YNYA 3LFIA 4GAGH 2P1BA 1N2RA 2WQSA 2Z8SA 4GLRH 5I0WA 1GSLA 5CLZA 3NSFA 4JPWH 1BQ5A 2BRQA 1FVEA 2YHGA 4QHKI 3AY2A 4GKZA 4QGMA 3IDAA 1YRZA 4ZAKD 1HKLL 1U8MB 1N7MH 1C08A 3EJZD 4CJ1A 1CXFA 1TJGL 2DMBA 1WG3A 5E6YA 4WSGA 1VBC3 2HA1A 4MAYB 3CC1A 1BQSA 1VZIA 2DAVA 1HL5A 5T1LB 1OKQA 5F8QC 1H15A 5TSWA 4N22A 3MCLL 5HVWA 2BXYA 3B2UC 3FFDA 2QSTA 4OD2A 5DRNA 1DQ4A 1FN4A 3HMXH 4XTRC 4XIOA 3LN4A 1N47A 1XXNA 2ZUQB 4QTIH 3OGVA 4LXLA 2WWNA 5D7KE 2YFUA 4PGDA 4X6RB 4ZTPH 3ESNA 4G1MA 4AGOA 1UXWB 2MOVA 1DDHA 3HHMA 3Q8FA 4JO8A 1R34A 3WY4A 4OGAD 1PJ9A 2F54D 2ZXQA 3VN4A 2PP8A 3W9DB 4XXCC 1GQPA 1JF5A 4G9DA 1QJEA 2KQMA 3GS0A 5SX4H 1AR82 2ODIA 2GJ6A 4PJGB 2AJUH 2F74A 3VWJA 3X11A 3DIDA 2ICWI 4FE9A 3RU8H 1JWUA 2HTLD 2E7BA 4Y9FA 1RXGA 1H2LA 5IQLA 3SDYL 3RYKA 3BVTA 2YD1A 2FCTA 5CGBA 1F8TL 4WGWB 2X1QA 2XQYK 4LF3B 3ZBMA 5JPMA 2OP4L 1CO1A 1W39A 3S3PA 2ETEA 3ZW3A 1OAKH 2BH0A 3BVVA 2WXLA 5EORH 1GGCL 4C8XA 1UTDA 1N1TA 3WJMA 5KSBE 1O4YA 1ZX5A 3X3FH 1NFIB 5EBWB 2JKBA 4GRWE 3VV1A 4DGWC 4GRMB 4AYSA 1D9KA 4M61B 3E6BA 1T1YB 3UZQA 1IM9B 3VFPB 4IRJD 3KAAA 1S9VA 1T6GC 1U92A 2XYCA 4GMSL 3WEBA 5LUMA 2CAVA 2W0FB 2H1PL 3QIBA 4KKAC 3M6DA 3HPLA 1NIEA 3TV3H 4ONFL 4N90A 1RMFH 5D2LE 3BHBB 1J5CA 3RWJB 3D05A 4OM1L 2K78A 3VACA 2R4RL 3FDWA 5HGAB 2DBIA 1JS9A 3LIGA 5JDSA 1MRCL 4Y2DC 1NCBL 2YGPA 2BCMA 1AF9A 3HVDA 4KDVA 5BNXD 3NNJA 1KPUB 1YDPB 5F9OL 5B4MD 1JUHA 1MKFA 2BSRB 1MIEH 3MRBB 3CTTA 3HI5L 2VUKA 3DV6A 2PQQA 4XNZC 4DK6A 3URFA 1COV2 2CHNA 4JKMA 1UYXA 4MD0A 2PO6B 5H9PA 2V4AA 1HL4A 3UABA 4UNVA 5DUVA 4ZS7L 3OG2A 2HWC3 5K33A 1LEIB 3QJHB 4ATTA 3GS4A 4OQ8A 5ERLA 2F0CA 3MRFA 1NA1C 4G6AC 3SMHA 2DWXA 1CDJA 3QXUA 4EI6A 4F2FA 1LO4H 4YL9A 2W1NA 3ACLA 1BD2E 3AGVA 3BSZA 4S1DD 1BJMA 4Y33A 3VBSA 1CAWA 2KT6A 1FI8C 3GMRA 1JZ2A 1XNTA 4Q29A 4RHV3 5D8AB 3VLBB 1HCYA 1K6QL 2VDPL 4A6OA 2EF6A 4XP9H 5F6HJ 3HIFA 3QPXL 4O51A 3CQQA 1ACZA 5FYMA 3RKPA 3M3QA 5KW9L 4W6XA 4UFKA 4D94A 4BQ8A 2FL5B 3SE6A 5EUKB 4YLQT 1E9QA 2FATH 4XH2A 2VOTA 4CUCA 1QFUL 3FSOA 4Z7VE 1CL7L 3SJVD 1SVCP 3OKNB 2H2PC 3QYCA 1W3VA 5IW6A 1TQBC 1M7IA 5GGVL 1XGRB 2JTYA 4YUEL 2XQRA 1OSGA 1S2EA 4YO0B 2YOAA 1W6MB 1NKRA 3QIUD 3IGUA 4KWKA 3MV7A 3B9KC 4ZT1A 3MFGB 4G11A 5C92A 2R4SH 4GBXA 3RZCC 3ZY7A 2EJ1A 3BWUF 2YEVB 3QJRB 4N8VB 1BREA 4XI5C 5JTWA 2QPUA 4E9LA 1H3GA 1IKQA 4AVCA 4M4PA 3SD5A 5KVEE 3VBFB 3OUJA 1L6ZA 3BAJA 3ILEA 4LP8A 2V2XA 2NNAA 3MJGX 1P5UB 5I1CH 3QFDB 4NPMA 1ZDQA 2CO7A 4WWID 5JOZA 4QB1A 3VFTB 3HE7A 3REVB 5A3IC 4PH8A 2ZF9A 4UBDD 3BDXA 3F00A 1PNGA 4Q4V1 2VMEA 2D43A 1VFBB 3VH8G 3I02B 3KWVA 4TV3A 5F7DA 3LZFL 3ERXA 4LCWA 5EZIH 3U9UB 3L1EA 2ZGPA 3ZYOA 1CDIA 1M7XA 5IM7A 4U7SA 1BM7A 1REEA 3B94A 3SCFA 2NNRA 4M7KH 4WFGD 2VZSA 1HSBB 2Z91A 4YSRA 5IB3B 5IZ7A 2X6AA 2YPLA 1DO5A 4LESA 3VXMD 1NBVH 4RZCA 4YXLL 5EWIH 4HJSA 4GXVL 4P2OC 1A8MA 3UTQB 4JFQA 1JVLA 3TEZA 4GA9A 4MBOA 4QD2A 2G5BA 2QGDA 3OG6B 4KNUA 5KVGH 1I8LA 3IN0A 4DQOL 1R9FA