2W94A

Native structure of the discoidin i from dictyostelium discoideum at 1.8 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 62
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w94A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w94A01
3U37A 2Y64A 2X05A 5LCWL 4MGSA 2J1AA 3HNMA 2HYXA 1GMMA 5CZKA 3LPFA 3WNNA 3ACIA 2J1SA 4ZZ5A 2W46A 4MOAA 1W9WA 1OF4A 2VOTA 2VQTA 4W8JA 3OEBA 3IB3A 3C7GA 1UMHA 2JDAA 5F7UA 5B4XA 4E8CA 2WO2A 2BERA 1JYXA 5G05L 3MUZ1 2LW8A 3IAQA 3T08A 2XONA 1GOHA 2YFZA 4CU8A 2W95A 1KGYA 2QQIA 5LA0A 5IFTA 5FUIA 2EIBA 4FI9A 4PF1A 2Y6KA 3I2IA 4RN5A 3HJRA 3NQHA 2C26A 2E33A 4XUNA 3HNYM 3WF4A 2C9KA 5IYYA 2RJ2A 3K75B 3LEIA 3A22A 3T2OA 1JZ6A 1GUIA 3MBWA 4KWUA 2YB7A 5C7GA 3OEAA 3VD4A 4DUVA 4D0QA 4TXWA 2OKXA 2B9VA 1CIYA 4MO3M 4DXSA 2XQXA 4AG4A 4QB2A 2W1UA 4DEVA 3AC0A 2Z4FA 3MUY1 1T2XA 3CMGA 2WQ8A 5C70A 2QQOA 3E1F1 2WUHA 3F2ZA 2W1WA 2VMDA 3NJVA 4XUOA 4QDRA 3JXSA 2JKXA 1TVGA 3K4DA 4JKKA 3W5MA 3D3AA 4OZOA 3OB8A 1JU4A 3ECQA 1UY0A 2VM9A 3C8XA 4PT6A 2BBAA 4CVUA 1H6YA 4AAXA 1XC6A 4XUPA 3A23A 3I2HA 1UYYA 1L7RA 2CGYA 3T09A 2RVAA 2VMFA 2VZ3A 3I2KA 2ZEWA 2V4VA 3LEKA 4OMDA 1UZ0A 3WF0A 1ULOA 3I2JA 2CE6A 5JUVA 1JYNA 3I2FA 2YC2A 2WAAA 4XUTA 4OMCA 4QX0A 2BGOA 4E8DA 3HOBA 2QQMA 2EIEA 2E32A 2W47A 4P02B 4P00B 1PMHX 1DP0A 4M4RA 1SHWB 5J1XA 3DYOA 3WNPA 1K42A 3EB7A 2QQJA 3IAPA 4CU6A 3VD9A 1NKGA 3PUHA 3FHAA 3CDZB 5G04L 1YQ2A 3WEZA 1D7PM 4A41A 1DYOA 3WSOA 1UYZA 4KI5M 4BK4A 4QDQA 4Z2AA 2QQKA 1OH4A 1P8JA 1PX4A 2VZQA 3HPNA 4P08A 1GNYA 4QB1A 4QX1A 4GWIA 4LPLA 2VC9A 3UNPA 2CDOA 2WZ8A 2VMEA 3T2QA 3K46A 2CGZA 4GZ9A 1WKYA 1EUTA 2YG0A 1W9TA 3OG2A 2ZEYA 2CCVA 3UETA 4CUCA 2VO5A 3ACHA 2J1TA 1UY4A 4XZUG 3I3EA 3T0AA 3WF3A 3OGVA 4DEQA 3DYMA 2BZDA 4W50A 3UESA 4ARYA 4JHZA 1UXZA 1LNSA 2VCAA 5JXJA 3CIHA 3IDAA 2YFUA 1UX7A 1XNAA 5DMYA 1O59A 2W94A 5LA2A 3WNKA 2VZ1A 2ZEXA 5HPOA 4TTGA 1JZ2A 2DCKA 2DDUA 1XNTA 2WZEA 4KMQA 2JE8A 1PMJX 3GM8A 3T0BA 1W99A 1UXXX 1JZ3A 2J1RA 2X09A 3NRUA 4XUQA 1SDDB 2WN3A 2E31A 2EICA 3A7QA 2C4XA 1JI6A 4A6OA 3W5NA 2XOMA 3FHQA 2J22A 2L9LA 3ETPA 5LA1A 1JYVA 2ZEZA 3HEIA 3VD5A 3SEEA 3WQBA 3DYPA 2WABA 2DCJA 2KD7A 3LQCA 1OD3A 2VJXA 1K12A 3MV11 2VL4A 5IJRA 2JD9A 1W8NA 1K3IA 4UOJA 3CQOA 4CUBA 3GGLA 1K45A 2W1QA 1J83A 1NX9A 3VD7A 5JMOA 2W87A 1F4AA 2BGPA 4BXSV 1EUUA 3LE0A 4Q56A 1DLCA 3C7FA 1UY2A 1O8SA 3J7HA 4JX0A 5DQ0A 4QAWA 4OUEA 2W5FA 1JU3A 3A21A 3K77A 1XPWA 3WNLA 3EYPA 1UYXA 5A1AA 3HN3A 4DXTA 1IQDC 4LKSA 5CYYA 2QQLA 3WF1A 3T0DA 5IHRA 5IFPA 2VZVA 4QX3A 2Y6JA 3ACFA 1KEXA 1JHJA 2RV9A 3I97A 2E26A 1TG7A 1GOGA 2J1UA 4XURA 2W1SA 2WYSA 3ACGA 4IUGA 1ULPA 2VZRA 3GXUA 3I3BA 3ZM8A 3SKJE 1O8PA 1NUKA 3PUIA 5EIYB 4CU7A 1JZ5A 4MADA 1UWWA 3IIIA 3VD3A 1OT5A 3VDAA 2WDBA 3NNGA 4A44A 2VCBA 2J1EA 2J7MA 5EJ1B 2B4KA 3K4ZA 4UI9L 1UY1A 5DPNA 1OF3A 3FN9A 2VCCA 4A45A 1US3A 4JKLA 5HXMA 4ZZ8A 3ABZA 2VZTA 1RYYA 2VTFA 4LQRA 3NJXA 4A3ZA 3DECA 4LHSA 1PX3A 2VZSA 2VZUA 2X10A 4RYDA 1JZ4A 3C7EA 2YC4A 2PQSA 1JZ7A 5JXHA 2W91A 4HG6B 4A4AA 3FL7A 2V5DA 1JYWA 4PQQA 2W9XA 2HLEA 5DN2A 3WNOA 1JZ8A 2Y6LA 3WMPA 3OBAA 4JKMA 5JXGA 1L7QA 3SEPA 4CU9A 3C7OA 3WMQA 1I5PA 3CZJA 3I3DA 2WO3A 2WN2A 4D8MA 4BK5A 4ET7A 1GU3A 1WCQA 3SKVA 4DUWA 4ZY9A 5JXIA 5EJZB 4W4ZA 1SG3A 3C7HA 1BHGA 1CZSA 4M4PA 2VZPA 3CKHA 4QPWA 1F4HA 2XHNA 5JR2A 4YPJA 4L0PA 1W9SA 2LS6A 1H6XA 4ZXEA 4QX2A 2CDPA 4XVHA 1GOFA 4QDSA 1NAEA 1W0NA 2ORXA 3BN6A 2J1VA 2VMCA 2Y6HA 2W3JA 3VDCA 2VQUA 4GWJA 2VR4A 2VZOA 4BJ0A 3WNMA 3THCA 3LPGA 3I2GA 2ORZA 2QQNA 2W92A 3BGAA 1UY3A 2EIDA 3GDBA 2WAOA 3MO4A 3MV01 2Y6GA 4DUXA 3OGRA 5B4NA 1CZTA 4DXRA 4P5YA 2WO1A 2ID4A 3VDBA 1R64A 1W8OA 3LEGA 3P6BA 4ARXA 2V72A 2QBXA 1US2A 2Y8KA 1UMIA 1J84A 4MGQA 4A42A 4CUAA 2R7EB 3OGSA 2WBKA 1CX1A 3T2PA 3THDA 1HN1A 3HNBM 1MPXA 4QB6A 4UAPA 5I0DA 4OYUA 5C71A 3K4AA 2ZXQA 3WF2A 1GQPA 3P1IA 4BDVB 3CZUA 1CZVA
chains in the Genus database with same CATH superfamily
1U9KA 2Y64A 1SLBA 1ZRIA 3FRUB 3LEVH 1YEFL 5CMAA 3AQYA 3OF6D 1EV12 2N1TE 1CONA 1JZEA 1FO0H 4LQ1A 2Y0SA 3BEWA 4KDTA 4BH7A 4FSJA 1NCNA 2AJXL 1QOTA 3FHIB 1J12A 2VLLA 4FFZA 4MXQC 3KLKA 1RUF2 3QUMB 4KBBA 4JK0D 1UEMA 1EV13 1H8OA 3EBHA 5ILTH 1RUF3 4JRXE 5FGCB 3OAZH 1QPXA 2KQMA 3M45A 2ZOEB 2H26A 4KTYA 4E41B 3OEBA 3MRKB 1PG7W 2B1AL 5L8LB 1G7IB 4P23A 2WO2A 3KLHC 4ZUSA 5IZ7A 2IDUA 4P46B 2B3IA 2GJPA 2YFOA 1JPFA 3Q1SL 1A7QH 3V6BR 1QJY1 2FWOB 3GNEA 4XXPA 4WV8A 1G6VK 2W95A 3L9RA 4H8HA 4XWOC 3SOTA 1GA2A 1TZHA 5FYJH 2HBUA 3O8XC 1NUGA 1JDDA 4BQBA 4QPGB 2NXYB 1DO6A 4M8VA 3VXUD 3VBHA 1T5KA 2DQGH 2H3KA 2Y7MA 2ZWSA 3O3AB 4X9YA 4TUOA 3U36A 4Z7AA 2JIXD 3Q48A 2P5PA 3SQOL 4QOKB 4WO0A 4M3CE 2XACC 1NGZB 4OQTH 3U4BH 4GEIA 4YAQA 2IAMB 1FZKA 1UVQB 3HNYM 3EUDA 5E0FA 2QVSB 3WF4A 2GIMA 4XNMA 1IGML 3USUB 4WW2C 1V6NA 2WTOA 1SY6H 4HWBL 4HEPG 5KYUB 5A32B 2O5XL 1HYRC 2VNGA 2E6PA 1OGAD 4C8DA 1QNZL 3NSCA 3BUYA 5D5MA 4DW2H 5FY7A 3ZMEA 4YBQC 3QUXA 5D1QE 1JZ6A 3L9YA 1RUC2 5DR5L 3PWNA 3TWCH 1RJLB 2X4UB 4KZEL 3U78A 3VD4A 2H6CA 3IETB 3NBNA 4HPOL 2NY2B 3BSZL 2WJ5A 4ONUA 3VFSB 5JHDD 5C3TA 2X2HA 5DA0B 2OMTA 5TQ2L 2Y60A 3DPRB 3CE1A 3WKNA 2WFF1 4B1LA 4AITA 2ARCA 2H8PA 5F7MC 4F33B 2DWYA 2R15A 2ZXAA 4WWNA 5C09B 4A6YH 3WO4C 4K94C 4Q4V1 1QTPA 4Y5TA 3NCCB 1ID2A 4OIAA 4ZTOL 1W2TA 1J5OL 1V9U2 3CFDB 1CVRA 3ZTDC 3LIGA 3S35H 2BVQB 4H20H 5GM0A 2AZAA 4AE2A 1AE6H 4XN7A 4ABWA 1NC4D 4TPRH 4XT1C 4JFEA 4P2CG 4ZMAT 1C5HA 1E6OL 2CAUA 3U30B 4ECNA 1H19A 3R8BB 4JKKA 3P2DA 4R9HA 2KA3A 2YUEA 2HA1A 2HLEB 3ROLB 1OGTA 4OZGB 2F8VA 1AYM1 2WGXA 3GTNA 2BOBB 4ZRGA 1N67A 3S7EA 2GMPA 1OP3H 4AEHL 5CNAA 4OIBA 4NUQA 1Z7S3 1MW0A 4PY8I 3FCTA 4CJ1A 4PFEA 4XPFL 4EJ1C 2GALA 4U0QB 3RDIA 5BNPA 2NYYC 4NN7C 2HLFC 4RFEB 2RVAA 2HJLA 3SPIA 1UACH 1VENA 4IDJH 2BEOA 1R093 4ASLA 2RACA 4WO4B 5IGXH 1TQBC 3DXAA 2B42B 5PCYA 3JTTB 3DUHA 3R19A 1NCTA 2VDLH 2VRKA 4MMXA 5K59F 1SPPA 3I2JA 3KT4A 1YECL 1XSQA 2ARJB 4P2OD 3I2FA 4QT6A 5MENB 3FZUC 5CBEB 3VD0A 4QMAA 2VOXA 4HLZH 3C2AH 4PJ7E 3ESVF 3QUMA 1KJVB 3HB3D 4YC2B 4CDWB 4OIIH 1RGSA 4DRVA 1AGBB 2HFTA 2VXSH 4DP7X 5D2AA 4URAA 2VDNB 2VERA 4XBNA 3KT7A 4Y8DC 5E70A 1JGIA 5T3NA 1HXMB 1VBA2 3KZ4C 1HJBC 2XQYK 2OW7A 2ZX9A 3R1GH 4JHUA 4KROC 3QFDB 4O00A 3MRKA 4S1RL 4A66A 3EYQD 2HN7B 2QLVB 2WIIB 3LEVL 1OUSA 2ZTNA 3EXUA 3KQRA 3BKMH 4ILDA 1VBA3 3WY3A 1VAMA 3ULVE 4HKZA 3QNFA 3ZDXB 4GUQA 2W65B 4P46A 1FO0L 3KH3A 3MUUA 1MF2H 5DHVA 1U8MA 3BGFB 1CXLA 3D2UD 1CF8H 3ZZLA 3HQXA 3PWPD 3UZEC 5DK0B 4LSUH 4F83A 3EF4A 1E4HA 1LM8V 3VO0A 2EVFA 2JV6A 2RDSA 1OQEA 3WEOA 4QPGA 1J1TA 3VGIA 3FHAA 2X9YA 3O3AA 1HXS2 1J1XL 5D1ZI 5I6MA 3MRIB 4QOKA 2GP3A 3GSOB 3FT1A 4QDQA 4ZS2A 5E89A 1UVQA 1RY7B 2VQ1B 3WFDH 1HXS3 1YN6A 2WTPA 1HQRA 4P08A 4WM8C 1ZTMA 3L3HB 1S0DA 1GP5A 4ZMLA 5EIQA 4QB1A 3GI8H 1A7QL 4RISH 4AT6B 2VY0A 5FYJL 2E7BA 4F1SA 1U0QA 3VI3B 2VC9A 1BXAA 3QO0B 1RJLA 3D69B 4ELMB 1EV11 1OBNA 2DQGL 2CLRB 1YEGH 2D7TH 4AYDC 3QFJE 4Z3TA 4LAQH 5FPZA 3ZDZB 3VFSA 1RUF1 1WKYA 1FZJB 4OQTL 3U4BL 3I4IA 2X9ZA 3NYKA 4KNSA 1UASA 4PREA 4I18C 3U79A 2ZEYA 4N2IA 3DPRA 3LKNB 2XTSA 2VWEE 5IB5B 4MRBA 4F33A 4JBSA 3TFKD 4G6FB 3MEPA 3E6FA 1YPZB 1KPRB 5CFCB 4S2FA 1ZD6A 4DW2L 4RFOH 3WFHB 2Z64C 1UXLA 1KYFA 5SWSB 4QJ5B 3TESA 3R4UA 2B08A 4G8EA 3U0PB 2XLGA 3TWCL 4ARYA 3TZVB 2BVQA 2D03H 2EE3A 1C4RA 1PFOA 3ELNA 1OP5H 1RUE2 1OTUC 4QCIA 1KGYE 5FYJD 2A0LC 3LPPA 4HC1A 3OWEA 4JQIA 4DPAX 3BLKA 2AV1A 3MZTA 3ROLA 1R24A 3SOBL 5ADPH 1UYPA 4RGNE 5HGHB 1RUE3 1ET5A 4A6YL 3SY0B 2CRIA 2FQFA 5AW5B 4ELKA 5AVAA 3AUVA 1ZDQA 1TCRA 3VFVB 1CJPA 3WQ0A 1RUH2 4RFEA 4XAEA 3S35L 4H20L 4NQCA 1I8LA 5I5RA 2OXBA 1AE6L 1II4E 4UW3A 5D7SH 4WO4A 4NIGA 5AB2A 4S1RH 5ECJE 2EICA 1EAH1 3IM0A 4W65A 3CH8A 3EGSB 2C4XA 3AZWA 1RUC1 4CCNA 2EE6A 2WP3T 4XI5D 1FHNA 3BPLC 1ENQA 2ARJA 3L08A 5DZEA 4CEWC 5MENA 4GD4A 3ZN6B 5G2NA 4HKXB 3V5HA 3RU8L 1DQJB 3TBDA 1KJVA 5E1AA 1G9FA 4QXCA 1DEEA 1AGBA 3OVUB 4AYEC 4QO1B 3WQBA 4F5CA 4WNSA 1UACL 4IDJL 5CIPH 1HXMA 5IGXL 1RUJ2 2VM3A 1OOPA 3LZFH 2CY6A 1BECA 3FK3A 1EXHA 2VDLL 2HN7A 1ZLSH 2WIIA 4RA0C 1WZAA 5BVPH 3KGTA 1V9U1 2ICWJ 1IIKA 4LO9A 4P2QB 1RUJ3 4A2LA 1IKQA 2W65A 5FZOB 3DTXA 3BSGA 4CADA 3LD8B 3WY2A 5FKCA 3C2AL 1AOHA 4NRXB 4AJ0A 4JQXA 4OIIL 5DK0A 4XBLA 3M88A 2CCLA 4PJDF 4HD5A 4NM8H 1GTFA 5IQ7H 2EYRB 2PR4H 3O7OA 3DOSB 3R1GL 5EOCH 2Q1MA 3MRIA 5FUNA 1JXJA 3GSOA 1JD7A 5E5LA 5KJ4A 5JW4M 2Q76B 2GHZA 4NYLB 3T3ME 1OD7A 4C90A 4UWDA 5C0GA 4NZTH 4ZO6A 4XCEA 4MQTB 4Q5OA 1MF2L 3AQDA 2JF1A 3L3HA 1CF8L 4YLZA 4IIQB 3ARVA 3Q5TA 2A75A 5JWPA 5TDPB 4LSUL 1SJMA 4MJID 3SE4C 5JOPE 2VDRB 3FUFA 1H2LA 2RG4A 3QO0A 4CCJA 2Z93B 3D69A 4ELMA 1NSNH 2HWZH 3B3QE 1MFBH 1AUYA 4MVTA 2J21A 4Y16C 2CALA 3N42F 5DMKB 2XWTA 3STBA 4YG6A 4N22A 3U7WH 1W2NA 3LKNA 5INCB 4BYYA 3WFDL 3H42H 5I0RA 5JTWA 4FFYA 5IB5A 1CESA 1B0RB 4DGIL 4IUGA 3IKWA 1KPRA 1NQDA 3GI8L 1VBA1 5CFCA 2YPLD 3WFHA 4RISL 1NUKA 4B9KC 2JI3A 3K1DA 3IDGB 3U0PA 3N1FC 4FOVA 1IO4C 1YEGL 2D7TL 4EN2A 2YGOA 4LAQL 3UGUA 3WLUA 3OHMB 3T8XB 5HBBA 4NENB 3TYJA 3BPCB 2J1EA 1R5IB 2B4KA 3EDDA 3BW9B 2HWE2 3FB7B 4XCFH 5HGHA 5DCCA 3QNZB 3T2TA 3SY0A 4JRYE 1P4LB 2AH2A 3O6KH 3EFDH 3FF8A 4RFOL 4XOCA 5FC9A 3U6XS 1HXS1 3FB5A 1CFMA 1O9ZA 2JKRM 2XVGA 3VRIA 2HWE3 1G1YA 3IRPX 1I3GH 3VFVA 5JPMB 5LVEA 4HJGA 4MS6A 4AF9A 4L9LA 3VQLA 3IFNH 1RYYA 1O6SB 2D03L 4FLHA 4P9HL 3RZHA 3DK0A 1X7QB 1KBBA 1RUAH 4QM9A 1G7QA 2VZUA 1JZIA 3EGSA 2ATKB 2OMBA 5CZXD 1AQKH 2BVYA 5ADPL 1Y0LB 4D9QD 2Y0OA 2NOYA 2W91A 5IHBA 3X1FA 2ZUXA 3GZTB 4HK8A 5D1ZA 4P2OC 1WPCA 4PJXA 3ZN6A 3WQ7A 1WDAA 2V9TA 1DQJA 1KDIA 2W1NA 4CVWA 3QXWA 3HB3C 2AV7B 3GKZA 4FI6A 4B41A 1QOKA 3SH4A 5D7SL 5D7IA 4XF0A 4WEBH 3T6WA 4JDEB 4YBLC 1YQ6A 3ISYA 1GHFH 1F4XH 4U2YA 4D3CH 3EYQC 5IREA 4XP5H 5EHDA 3T04D 2PABA 2WN2A 4P2QA 3IVKB 3FB8B 5FZOA 4NQDA 5H37G 4DERA 1DQDH 1VBB2 4JM4H 5DWPA 3SKVA 3LD8A 2GNDA 3RILA 3VMNA 4NRXA 3RTLA 1RUE1 5JXIA 3APCA 3PJSB 5BRPA 1VBB3 3L3GA 1MCJA 4ZMYA 2A5UA 1NDMA 5HI3D 5L7OA 2XHNA 1M7IA 4YHPB 1C1FA 4HZLA 1WH0A 2WWKT 3DOSA 3LZFL 2NX5E 3HZKB 3O8XB 1PL3A 1JHTB 4NQVB 1ZLSL 2PHRA 4S1QH 2Q76A 2LU7A 4GQPH 5AKRA 5AVSB 5BVPL 4GG6F 1SLXA 2FYVA 5CZVH 1RUH1 2PTVA 2NZ9D 4BQXA 1NAEA 1A4CA 4IIQA 1HWWA 2CLVB 2ORXA 5TDPA 2EVGA 2RS53 4WW2B 3IKCA 1MWAH 4AGMA 1F4YH 2WB1A 5BQ7B 3MJ6A 1IBHA 1N19A 2Z93A 4NM8L 4X5WA 5IQ7L 3N7KA 2PR4L 3MBWB 5D93C 5CU9A 4FMKA 3G6DH 5EOCL 1SEBB 1KULA 1E7UA 1U21A 5DMKA 2BFGA 5E6ZA 3H3LA 5JDJA 4CMMB 2P6CA 5I71C 3RRQA 3KGSA 4NPRA 1DQ6A 1B0RA 3KBFA 2XRAH 2WAOA 3PPEA 3TFKC 5FKAB 1RQ5A 1ENXA 1RUJ1 4YG0A 1GS6X 1FAYA 3OD4A 4J3TA 1LP9B 2MOVA 4J3SA 1HDMA 4R90H 1JRHH 3LXBA 4HMDA 2YUWA 2JE9A 3WO4B 1KXTB 1NSNL 4NOTA 2HWZL 4DFSA 3AADB 3VRLF 1MFBL 3N41F 5CCHE 4ZW5A 2CDGA 4ORZC 3A6OA 4QT5B 2IBGA 3JUYA 5IKCB 3OC5A 3T8XA 3IDXH 4Y4HD 4NENA 2BP8B 3BPCA 12E8H 1R5IA 3U7WL 3N7LA 2GN7A 3NAAH 4M5ZH 1KBKA 3BW9A 3H42L 1ASQA 2ZYSA 2AQRA 2ZOTA 3QNZA 4N5ED 2FQEA 2CHNA 5L88H 5DFWH 5AOKA 3I59A 1DR9A 2NPIA 3NKTA 3OMZA 4BWUA 1DVQA 3MX0B 4XE5B 4UI2A 2OZNA 3KPTA 1QSFE 2O4EA 5E08H 4NN7B 1X7QA 5DVNA 4XE9A 4M93C 4TV3A 1KTLB 3QWRD 2EO7A 1ZZ8A 1TQBB 2ATKA 4OH2A 3I6LD 1EFXD 1Y0LA 3QB7C 4JFYA 4XCFL 4XI5C 1IC0A 3D3VD 4IE4A 3UAAA 1LO5B 3HRZC 4AGRA 3O6KL 3EFDL 1YYLH 4ZZKA 4OQ8A 1A78A 2XL9A 1Q3EA 2X5IA 1UOKA 3ESUF 4NZRH 1NCDH 4RIRB 1FLTX 4EIBA 2EEXA 1I3GL 4K5PA 1GKBA 4FDWA 2AV7A 4GAGH 3EADA 5I17B 5LASA 5DU7A 4CXXA 4BEIA 5KTEH 3IFNL 1OLLA 2XCMC 4GRWH 4RAUB 3UZQA 4DT2A 4HJ1A 3JB8A 3E6DA 5JOZA 1RUAL 3IJEB 3OJVC 4N9HA 5EO1A 1BMZA 3O0RH 1S0IA 4RQPC 4NHMA 1AQKL 4KROB 3P4OA 4K5MA 1A1OB 1AGCA 3IVKA 4MGTA 3LZQA 2A4CA 1HRV3 2Q87A 3LIZH 4CDXC 4DGYH 4LFHD 4K9JA 1KTKE 3MUZ1 4KK9D 2HPTA 3X29B 1U8IA 5I8OL 1NWPA 1TYJA 3VXSD 1KS5A 4L3CA 3U2JA 1DHKB 3W56A 1XR9B 2DQIH 3ZLQC 2J25A 4Z5RB 4O5LH 2HWE1 1UO9A 3H0OA 2WLZA 4WEBL 3HZKA 4ODWA 1JHTA 1GHFL 1F4XL 1IGCH 4NQVA 4D3CL 1D2QA 4XP5L 3SQRA 5AW0B 4AEFA 2Y6KA 2MJWA 5A7SA 1AO7D 1DQDL 3F7VA 4I1RA 3D0AA 2CA4A 4JM4L 2AHIA 3CX5J 5I15H 4GW4B 3GMLB 3MJ7A 4G7SB 4BA8A 2G5UA 2QSCH 4WM8B 2EIZA 3HNVH 3NIDF 3WP5A 2YO3A 4N43C 1B4JH 4GB9A 3FUOA 1F6LL 3MBWA 1VBE2 4WBBA 1SEBA 4OF5A 4X4XB 1ZX5A 3OGCB 4OFPA 4S1QL 3MZHA 2EADA 2KLSA 4CMMA 4P9YA 4XMKH 3RZZA 1VBE3 2A9MH 5CZVL 1BFTA 2ZX5A 3QDMD 4I18B 1JK8B 4QB2A 2KZBA 5FKAA 1T4WA 4F2ME 4DEVA 1AANA 4TWTA 1I9IH 3ZSKA 2K6YA 1LP9A 5LGYA 1F4YL 4B9FA 5J8OA 1H6EA 4KHXH 1RJ8A 3ZPDA 4L4VE 3FTXA 3ROOB 1VBB1 3G6DL 3QIBD 5FXWA 5JOFB 5IKCA 4YDVB 3KEDA 4I9XA 4WZ9A 1E5AA 4F20A 2BP8A 4CCOA 3VH8G 1UU4A 4DGWC 1S7UB 1L3JA 4LT7A 4HVBA 3C3VA 1C5DB 4G9FB 2XRAL 4IEYA 2WPGA 5GALA 3D52A 4WK2B 2ERJC 1IU1A 1UY0A 3VBOC 3L5IA 1TU2B 1IKNC 1RXLA 3ARQA 4R90L 1JRHL 1KZYA 1AXTH 3BIAX 4XFHA 4B4PA 5I8TA 1KB5B 4AAXA 2PP8A 3MX0A 4XUPA 2Y5QA 1MFNA 3HE7A 3P4MB 3JQOB 1WW5A 4RQQB 4MKMA 4L3FA 5D2LF 3OPZA 2VZ3A 3GHBH 3RP1A 1A47A 1KTLA 3IDXL 2ZEWA 3MPPG 12E8L 2A1WH 3OKLA 5IVZB 2BOJA 3NAAL 4H0LC 1UCBH 4M5ZL 5CZXC 2C4FT 2FL5A 5IG7B 1VRBA 4DKEH 3LRHA 1LO5A 2CE6A 4GO9A 2P24B 3MRRB 4V2BA 2V2TB 3BPLB 1W6PB 5L88L 2ZUVA 4CEWB 4RIRA 2OQ7A 1YCIA 4BSVB 4JO2L 3PE9A 1JOBA 1KUMA 4BH9A 4UIMB 1IGYB 3JV6B 3HEIB 1OKQA 4FFIA 4L1SA 4W9FC 1DZRA 4K7JA 1TO5A 3TPUB 2EXIA 3NIGF 3PDDA 1I1AD 1U8QA 1G4MA 4HMEA 3NL1A 3ARFA 2YV8A 4Y9FA 2NMNA 4SBVA 2PWHA 1DQ1A 1YYLL 3DV4B 3QISA 3KPMB 4N28A 4NZRL 1A7PH 1NCDL 3LEYH 4JVPA 2L4OA 4WHYH 5E00A 5DD1L 1YO8A 4GAGL 2DV9A 1V3KA 3E8UH 3O45B 2ZYIA 1DHKA 4WHCA 3UZEA 5KTEL 4JTNA 5FYYA 5HCFA 4Z5RA 4YJZL 2ZKWA 5HI3C 1LNUA 5KSUB 1MVUA 4K3DL 5F3HB 2UYAA 3PIGA 4OZ4A 2APTA 1GS7A 3O0RL 1JXNA 5LGHH 4NI3A 3VXUB 5BVJB 4ZJ9A 3ULUH 4DPNA 4RZKA 3WJJC 4DP8X 2F74B 3F04A 3L3DB 2JIXB 2BH0A 3LIZL 3AMPA 4DGYL 1LWJA 4UINH 2NZ9C 2DLHA 5DUBA 4KVPA 1CAWA 2JNZA 4GQ9H 2QQKA 4N0UB 3GMLA 2I9LB 1HVXA 1SVCP 1RV6X 4AC4A 1Z5LB 1XEUA 2FT6A 3PVBB 1QW9A 2DQIL 1OGAB 4PJHB 1EQWA 2WKOA 4O5LL 4E9SA 4YLCA 4EZJA 3GHEH 4Y5Z0 1IGCL 3WTTA 3OGCA 3DO7B 2GTQA 2DZEA 3T2QA 4OJYA 4GP5B 2Z34A 2CGZA 1CTNA 3QWQB 4GZ9A 4Y16B 3V0DA 3VG0H 4AFBA 5HBAA 2YD5A 5JHDB 1JK8A 5I15L 1ASJ2 4R5VA 3TBTB 4G72B 4EV0A 3ZDYB 3PWVA 1XF1A 2WCPA 2QSCL 1WE5A 3OAYK 3HNVL 1A65A 3M07A 4UNUA 2SODB 3PUQA 1B4JL 2XFXB 1DLHB 1ASJ3 4MDRA 3IWVA 3UTPE 3DYMA 1KLGA 4HGMA 5A3TA 5KUMA 2FIKA 3WGUB 5JOFA 2BNRE 2QDNA 1IGFH 2BY1A 5EO9A 4N85A 4E9VA 4K40A 2CBPA 4PS4H 4XMKL 5AVZB 4Y4HC 5FM5O 1CDJA 4OLUL 2A9ML 1NC4B 2F08A 1D5MB 4X42A 5F88B 5TDOA 4HGWB 4ATFA 1C5DA 2MMXA 3HBQA 1GZQB 1T80A 2WNOA 4N5EC 5FYSA 1E8ZA 2F53D 3EO9L 3Q7JA 2BSDA 2G0KA 1RZKH 2GVYA 3BP5A 1TU2A 4HBQA 5HGDB 2C3WA 2BOIA 4O9GA 1KB5A 4GRLA 4UF7C 3MRPB 2V2XA 2RDNA 1NAMH 3P4MA 4KHXL 4C56D 4MD0B 4L8BB 3K1KC 4TTDD 3W9EA 5JW3H 3SGDH 4XR8C 4MZIA 1J9CT 4MXWB 2JKNA 1QW8A 4XUQA 3WMSA 1FGVH 4X8CA 1OVPA 2AACA 3RQ0A 1NXMA 2P3IA 3SCHA 1PJWA 5IG7A 4ASMB 2FATH 4KAQH 4TNVF 1AR72 4R4XA 2XY2A 1ZRFA 2V2TA 3US9A 1VBE1 1W39A 1W6PA 2Z79A 1IBFA 5LAPA 3E38A 2I7OA 3TN0D 4P2OB 3PMSA 1F6AB 4BSVA 1AXTL 3OXSA 4UIMA 5CU5A 1IGYA 4FTSA 1UH2A 3B1TA 3HEIA 3HB3B 4P49A 4X0KB 3VFGH 1MLBB 4UTBH 4OZXA 1ITBB 3MGTB 3SBWC 5FLIA 4ZHNA 2MTPA 3GHBL 1OZTG 4NC2B 4E5XB 1UWGH 2Y5TB 2ZGUA 2NQ3A 2A1WL 5CINH 1YUDA 4N2FA 3MVSA 4FQCH 2XTJE 2IALB 2YR3A 1UCBL 3ARPA 4K71C 4YBLB 3QDGE 1QI3A 1RHI3 4DKEL 1PSKH 5FYLH 3HA0A 3RWDB 1HQWA 3QW9A 4RA0A 3F05A 5FECB 4E9KA 1UQSA 3DV4A 1WWYA 2PFWA 4CUBA 1H8NA 3H8RA 1DUZA 2CM5A 4XMWA 4KK9C 2W1QA 3FAWA 3LFMA 4R97C 3D2UB 2ALAA 3GLEA 3PWPB 1HTYA 3AKRA 2AF2A 4QF1B 5A6ZA 4FP2A 4UFKA 4GXUM 3VJ6A 2WBJD 3K6NA 5F3HA 3U9UB 4EKXA 1S3KH 1DLCA 2XMLA 4QKFA 5E94A 1L9TA 4OZFA 4NQSA 1SLAA 3K6OA 3VXUA 3MREA 5BVJA 3P3UA 1RZPA 5D6DC 3O6LH 1E9OA 2BVOB 3M3QA 3L3DA 1KZQA 1Z9PA 1K6QH 4HVOA 4JDVA 1EJFA 1A7PL 3LEYL 3V6FB 5IF0A 1AX1A 2I9LA 4J6RH 3BTZA 2R6QA 2KKQA 5D7KD 2WOYA 3E8UL 3V8OA 2ZF9A 4KI5F 1OGAA 4PJHA 4OCLC 1MREH 1OF0A 1SHMA 4PD4K 1PZAA 3SE4A 5J9PB 2GDFA 2QQLA 4DB5A 1JV2B 3CQPA 1FO0B 5FFOA 5IHRA 1PMIA 5DHYB 3QBQA 1Y7BA 3ZPYA 2C4FU 4DQOH 3DO7A 2WY3B 5LGHL 5D93B 3AMLA 3ULUL 4L3EE 1M9SA 3S5ZA 4IBVA 3LS4H 4Y16A 5E8DH 2VUYA 3U0TB 4LBNA 1MNNA 2EO9A 4JHWL 5I71B 3HTLX 3KGZA 4GQ9L 3TBTA 1RSYA 4BQ9A 1LOFC 4XX1E 5GLZA 1DLHA 2AMGA 3E3QE 4NHUB 5CJXA 2LLGA 4W9LC 4PMFA 1A7OL 3GS4A 1WAEA 3GHEL 5LWYH 3OMAB 5A3PA 2D2OA 1UT1A 3QIBC 4Y1ZA 1AP2B 3VD3A 3SYAA 4MCMA 2H6UA 3M1CA 1BF8A 1MZ5A 3FQ4A 4YFWA 4I3PA 4PLNC 1NC4A 1F00I 1D5MA 4UDUB 4JM2D 4LBAA 3BLPX 4HGWA 4FF9A 5F88A 2HWB3 3RNQB 1EAPB 1GZQA 5CR1A 5E03A 3AYCA 2B59A 4WKXA 5FZBA 5L2KD 3ULUD 4JFPB 4F3JA 2JE7A 1V6IA 1G9NH 1MDAA 1PGW2 4MQSB 4JV4A 4YM3A 5CGBA 2VCCA 3T4HB 4HCRH 5FUCC 3NQIA 5DXWA 4L8BA 3BUTA 3RUGE 4HONA 3EGXB 4GULA 4BISA 1MCFA 4G6KH 4B0MM 1IGFL 1CZ8L 3I54A 2YRBA 3G5XB 4LSSH 4PS4L 5ACMA 3TA4D 5CSBA 1YFUA 4IGOA 4OTXH 4M93B 4MQ7B 4TNVK 2HUHA 5FP7A 5HHNB 2R1XA 2IJ0C 4UYQA 3VD1A 2OPWA 2OR7A 2QZ2A 4RDQG 1RZKL 3EH2A 3HRZB 5I19H 4P2OA 2I07B 3MRHB 4FPYA 3ZRCC 1BPVA 4PQQA 1NAML 4FG2A 4FTVE 4FT8A 3CXHK 4X0KA 1MLBA 5JW3L 4P3WA 3MGTA 1PK6A 2VD7A 1ASJ1 3WVJA 4A6YB 1PM7A 4OLVH 4M7LH 3VCLB 2P48B 1YFWA 3R4SA 1FGVL 1JXFA 1IAKB 2NY5H 1HLCA 4OI2A 3NCFB 5BNXD 1I1AC 2FATL 4KAQL 3RWDA 4RQPB 1J0KA 5IVEA 4O9HH 3GJFH 3MCKB 3PXLA 5LBSH 3G5VB 5D7LD 4F8TA 1F2XK 2E7CA 4L9BA 2OMUB 4FQQB 3U11A 4CDXB 3KMHA 4TKWA 3MDJA 3FLPA 4D8OA 5LJYH 4P5KA 2WSPA 3P30H 3PWPA 4QF1A 3VFGL 4M29A 4UTBL 5K8SA 2F68X 4D7YA 4MXVE 3APBA 1Q9KB 1UWGL 2XNAB 4AL8H 1WMEA 5JR2A 4H8PA 5CINL 2R063 4FQCL 5AVTB 1J5IA 5CO1A 2ZMKA 2W0FB 2WXPA 2TSBA 5B3JE 4BSJA 1FXZA 1PSKL 5FYLL 3RPIB 4AGGA 3H1ZA 4RS5C 1J9RA 2Y24A 2F7PA 3OJDB 2VXVL 4FOQA 2WLJA 2ZTBA 1FVCB 1B6UA 4Q97A 1L7LA 4X5XB 4I3GA 3V6FA 1W8ZA 2IFGA 2VDLB 4JFOB 4I0WB 5LGJB 3BN6A 7PCYA 1ZSHA 2HFGH 3UPRB 3CLEL 4TUUA 5F97E 2WXHA 4E4SA 1CGYA 5J9PA 2OFQA 4N43B 1AR71 1JV2A 2VQUA 1FO0A 1S3KL 4MJIB 4OFYD 5DHEA 3BB6A 5DHYA 4QKNA 1W80A 2V7HA 3Q9OA 3IM1A 3WHE0 4RFT0 1T7ZA 2HRGA 3KL0A 2AJVH 4NX0A 2BNNA 1R47A 3O6LL 2FZ3B 2PCPB 3U0TA 4FQXD 4ZAKD 5EZJA 3C2UA 1YQCA 2BSBA 2ZXDA 4L0YA 4WVVA 1K6QL 2YEZB 4Z8FH 4YXKH 5MHSE 4J6RL 3CJIA 5FYLD 2JI2A 2ZG3A 4G59C 1HEZB 2YPLB 3E8VA 1MREL 4FNRA 3DC0A 4NHUA 4G4FA 3OGRA 1HT6A 5B4MD 5GGVH 3ZVVA 3G6AB 2V2WB 4DQOL 1AP2A 4FQZA 1BBJB 5FXXA 4QHBA 4IGBD 3LS4L 1GY2A 1R64A 5E8DL 1BVZA 3PHAA 4HWNA 4M9PA 4Z7WE 2NQDA 4EWDA 1AQDA 1A9VA 4W6WB 2QBXA 1EAPA 4RESB 1YCSA 4CSPA 3BZEA 3B7RL 3DV8A 2WJSA 4JFPA 3L3OC 1JTOA 2ZQKA 5CWSB 1XGPA 4IRSC 4OQTA 2ERJB 3BN9D 4UT9H 2WBKA 5FYMA 3VBOB 1MS0A 4LSTH 5EDXA 3QOPA 4M01A 2V4LA 3JWDH 3UX9B 2GJJA 2R2BB 2PYTA 5LWYL 3O1UA 2Q6WB 4TTDC 3QH7A 3VGDA 3G5XA 4UOW1 1MCDA 4PU2A 3QFGA 1R5VA 1CPNA 4L37A 4Z7NB 3QZNA 1CXFA 3DO3A 5EF2A 1AC6A 5HHNA 2IXHA 2GU9A 2J8UB 1A66A 3K7UA 2Q3ZA 3HRZA 3K5SA 1ST8A 2I07A 1G9NL 3MRHA 1CVNA 5I0SA 3TN0C 3LSDA 7FABH 1WJ3A 4HCRL 3LDBC 5MERA 2Z31A 5SV8A 4KQ7A 2HYXA 4CMHC 2ADJB 4G6KL 4A6YA 2I2SA 2VH9A 3ACIA 1CICA 2XXMB 4LSSL 3VCLA 3B2VH 4QRPA 5CD3B 1J1LA 2WGNB 2ATFA 4RL7A 4OTXL 1H2NA 3SKMA 3AQXA 4YFZA 4RQPA 3QUGA 5CGYD 5L73A 3IB3A 5C4WC 3UO1H 4HIIB 3MIBA 3G5VA 2HEYF 1CLYH 1SDDA 2OMUA 5I19L 1YFXA 4CDXA 3THTA 2BERA 3DA0A 3AWEA 4XOEA 4E4DX 3HHSB 3TYFB 5JORB 1VAHA 1QUNB 4JFDA 5MEQB 3VZMA 2YFZA 2DEWX 2WBJC 5C0AE 1RJZB 1Q9KA 5B2GB 4OLVL 4M7LL 4XOAA 4I2OA 1QFUH 4L5FH 2TAAA 1GYKA 2NY5L 1NPNA 4YFEA 1PGW1 1G87A 2CHZA 4I0PA 3OUJA 4TYUA 3LNHA 4JO5A 5IFTA 4PF1A 4IKNA 3DIFA 3AYDA 1XBDA 4O9HL 2ADYA 5LBSL 4UBGA 2F0CA 4U7SA 2ZHNA 3O14A 4X5XA 5JOWA 2FBOJ 4UMGA 5F89B 5C0IB 2KDYA 3LZOA 3P30L 5HSFA 5LGJA 3RL2A 2Y2YA 3CV5A 3UPRA 1I4FB 4P5MB 3V9FA 4DN3H 4LUMA 3N9QA 4PEEA 3TNPB 4N43A 5C92A 3K75B 5F71A 3P4NB 5JW4R 3CFBA 1CAVB 1LD9B 1GUIA 2AJSH 2BWDA 2Q1FA 1W6NA 4R4ZA 1BVLB 2PCPA 4PWFA 1LGVA 2GT9B 5F3CA 5CIPB 1YJDH 3IKKA 2FQDA 1XX9C 1RIVH 2YEZA 3MFGB 5C08D 3SHRA 3HW7A 3TCLB 3T2NH 5C6CA 2HFGL 1HEZA 4KX8A 2AMUA 3F5WA 5FR3A 2NY0D 5FYTA 2LTQC 4B9JA 4UM9D 1X9LA 2WQ8A 4IK6A 3I7DA 2V2WA 1IGJB 3B6SB 3MLXH 1BBJA 1BF2A 2AJVL 3MRJB 5GGUB 3ZDVA 1BAFH 4XGZB 3JXSA 2GMMA 4MDIB 4JM2C 1R082 4W6WA 3DHPA 4Y4HB 1IM3D 4Z8FL 4YXKL 3ULUC 3HBKA 4ZS7L 4YFDB 5D2NC 1MCCA 3ZE0F 3CFTA 3B5GA 4PYGA 3VBOA 5J36A 1A6AA 1IKNA 2HVKA 4PT6A 2OA2A 2WM0A 3FONB 4IW3A 3SD5A 3IU3B 1VJSA 1F5JA 1PLAA 5T5NG 3O1RA 1OA3A 5I1KH 2XX1A 3T0EE 4TYSA 1NEZB 2YEVB 1C16B 5IOKA 4AKQA 1ZM1A 2B46X 4FKEA 4JE0A 3FH8A 4OZFG 4QXGH 4F7CA 3SBRA 2J8UA 1EFXB 2WLIB 3E5UA 2BSRB 3D3VB 4KU1A 4BM7A 5L4FA 1JHNA 4GKLA 4UT9L 4ATTA 2G2RB 4M6NH 3FAXA 4GKSB 3ZTCC 1JK9A 3R4DB 4LSTL 4Q4IA 3JWDL 3H42B 3MW3A 3DSFH 5T1DL 3AXDA 2ADJA 2JICA 3EJUA 2DYPD 5KVEH 5GSVB 2B5HA 2GKIA 4YZFE 4NPMA 1S7SA 3RVWD 4YHLH 1WEJH 4JQVC 4K71B 3J7NA 1T83A 2FLRT 4HIIA 3HNSH 1YNAA 3APDA 1LHZA 3BWSA 1CI3M 5J6HA 2HH0H 4Q8BA 2ZGOA 7FABL 2WNUA 4UILH 3TF4A 3GSNH 4LHUD 3E9UA 5JORA 4YM0A 1BV8A 4Q29A 1QUNA 3Q2NA 3DHJA 2CWRA 2XFGB 5MEQA 2WSUA 3WNXA 4R97B 4X7EC 4OCWH 3VXSB 1EX0A 1RZKC 4Y9CA 3WIFB 1RJZA 3WNPA 1OWWA 1JBCA 3B2VL 1MCQA 1W8TA 3GINA 4WSGA 2ZXCA 1MHHB 5A6LA 4E0RA 1U41A 1V5JA 2OBGA 3ZDWA 1UU6A 1GSKA 4P4KD 2G4EA 2C1PB 2J72A 4H2AA 4MS8D 4V1DE 5MP6H 3X1NA 3UO1L 4EI5A 2FHRA 2O8OA 2B5IC 3BCWA 1CLYL 3WSOA 3S7IA 1AO7B 5F89A 3QDJD 4UV4H 5C0IA 2ZP0T 1JXDA 3GBFA 3V5DB 1I4FA 1KG0B 4OM0H 3TFBA 1HRI2 3QJZA 3DTDA 3P3YA 1JRHI 4Q74A 1KB3A 5KANI 1CAVA 1OC1A 1FL5A 1H4GA 5L4JA 1MFDH 1QFUL 4DZBB 2APVA 2UWEF 3CVDA 5GLVA 3SYCA 5K39B 2EA7A 1BVLA 3QXVA 3X2QB 4MCZB 4BFKA 5BXFB 2EUWA 3DI2B 2GT9A 1IC4H 4FQXC 4ZAKC 5HYJD 4MSWA 2M26A 5CIPA 5E4AA 1UHVA 1QOSA 3UKTA 4XAAA 1D5BB 3BDXA 2FWSA 3TCLA 2R2HB 3GSUB 3QDMB 2Q86B 1DGWX 3VBFC 2MQGA 4Y8AA 3D50A 4L1BA 4DN3L 1TCMA 4HT1T 3FQWB 3RTQD 1CK0H 2IQAB 5B4MC 1NT0A 1IGJA 3B6SA 1MQ8A 2AJSL 1NICA 3BAJA 2JKTM 3IT8D 1Z6JT 2HMID 2J5WA 4UNVA 2D4DA 5GGUA 4IGBC 3QIBB 5AAWC 4XGZA 1LNSA 1R9FA 4MDIA 3WIHH 4Z3IA 3H9HB 5D70H 2IXKA 1YJDL 1E2ZA 2PPCA 1RIVL 5IFAH 4ALAH 3PGCA 3MI6A 3ZHFA 3T2NL 5B7FA 2EEBA 2UV3A 3JD72 1R0AH 2P46B 5C86A 4BQ2A 5FDYA 4FTDA 5IVXF 1JZHA 2WBXA 5E6IA 5JR7B 1A3ZA 3FONA 3JD73 3SGJC 3MLXL 1N2RB 2AP2A 2UY6B 4PJAF 4OI8A 3M4FA 1KDKA 1SXBA 1QTSA 1BAFL 1NIDA 1C16A 1MWAB 1B2WH 4HK0B 4HWUA 1AY1H 2YHGA 1RKRA 4PWKA 3ZSLA 1JGEA 4WW1B 4PJ5A 2KDGA 1PZ5A 1ZHLA 5DZVA 4HJUA 1DBJH 4PJBF 2YOCA 2G2RA 5E5RB 2ETWA 5EMYA 4GKSA 3TNQA 4C57C 1KJMB 1N9PA 2R8SH 3RWFB 2K8QA 2OTUB 3VG9C 2A6DB 3V6ZB 4HPHA 2J5LC 2E6QA 4DK6A 1XNCA 1WW4A 5GSVA 5E88A 4ONHB 5I1KL 2W39A 4XHXA 5IFJA 1XRUA 2IH1A 4WTZA 2PQQA 4KUCF 5CGYC 4QXGL 1CO1A 4H0IA 2JCWA 1I1AB 5EB9A 2VL4A 2CK0H 2VLKE 4NJAH 3MFAA 1NFIA 3OD3A 4M03A 2A9DA 4M6NL 3GGLA 4HUCA 5FS5A 5JMOA 1CXIA 2VDMH 3DSFL 4LCWE 1R081 5IROD 4DAGH 1G9NC 1VJ2A 2YPDA 1UD6A 4X6DB 4PLKC 4Z7QE 3U07A 2X4OB 1BJ1H 4KO9A 2GK2A 4YHLL 3N6YA 1ONAA 1LHUA 2C1PA 1OPGH 3KNBB 5D6DA 3HNSL 5DZFA 2P34A 4RS5B 2MOQA 2HH0L 2NLJB 2HRPH 3GSNL 4LL4A 3HNTH 4PRNB 3V5DA 5A1AA 5FV2A 2GC3A 5CVRA 3FH5A 4GT7A 1W06A 3MKGA 4TQIA 4OCWL 5JO5B 1QSEA 3CBJB 4FXKC 4EAEA 3Q6FA 2BRTA 2V73A 3AUWB 3FMGH 3UH8A 4DZBA 1JI2A 1U33A 5F7AA 4XOBA 4MQXD 1UB5B 3RFZC 1WVZA 5K39A 4QUOA 3WEBA 3LQMA 4MCZA 3AVSA 1XZ0B 1FH2A 3KM1A 4GRWB 4HPKA 1BOGB 3OJ2C 5DEJA 1D5BA 3VGGA 1DE4A 4PP2A 5FAXA 3ZIWA 2R2HA 2NY5C 1OSPH 4X7TB 1ZCRA 3GSUA 4NUMA 2Q86A 1DVXA 2MQ0A 4UV4L 5HHOD 4N1EA 4BFBD 1REEA 4QRAA 2Z4QB 1MI5B 3ARZA 1LOFA 1PIGA 4M5SA 3J8F2 1KXQE 2NY0C 3ZOIA 2IQAA 4LIQH 4R5TA 5DG2A 2G2PA 4YRDA 4F7EB 2W0LA 1MFDL 5H8DA 2X1XR 3WW2A 4FYQA 4LSQH 1JPGA 1JZ5A 1J1PH 2VAAB 2VULA 1A2YB 3QIBA 2QQUA 1CX4A 4CA4A 1IVLA 1IC4L 1ND2A 1QMJA 1EAQA 4YWAA 4GNKB 5DJZB 4AL8C 3QEUB 1ZZBA 1F3JB 1BWMA 1AGFB 4HP5A 4KXDA 5G5DB 1N3NB 1JGDB 3L3OB 2F53B 2VBBA 2NNCA 2JI1A 5A3ID 4ITCA 4XJUA 1CK0L 4IRSB 4JB9H 3C5JB 2OSYA 2FWLB 4U4IA 2A6KA 4YZ4A 4ZTEA 1N2RA 2UY6A 1U2CA 1PGSA 4C56B 5CLWA 3RVVD 5EULV 4GJTB 1OD5A 2ZPXA 5C0CA 1MDTA 4I89A 3WIHL 4HK0A 3D82A 3GZEA 5D70L 3SDAD 1HRI1 3QQXA 3S5QA 3DECA 4WW1A 1W8EA 3SGKC 3ZYZA 4PWEA 2P8MB 4ALAL 2D8KA 3KT1A 4PUBH 2NP0A 2HUEA 3ZKXC 1R0AL 3D5OA 4QQHA 5IUQA 1WV7T 3WO3B 1A6PA 4RGGA 5GGRB 5FGSA 5E56A 3TN0B 2OTUA 4XODA 4PJ7F 3LDBB 2O6EA 3BOWA 2CMRH 3WV6A 4XTRD 4CMHB 4ONHA 5BJTB 1GBGA 3LH8A 1N6QL 3RVWC 1D4M2 1B2WL 2GTWB 1AY1L 1MFEH 1XB8A 4WAFA 5JXGA 4OLYH 3EDFA 1IL1B 4O51B 2LFEA 4OCRH 1OK0A 3BTXA 4HLZG 2X12A 1ZRCA 5AW7B 5JMCA 5F7YC 4NPLA 4KK5D 1DBJL 3C08L 1D4M3 5EBGA 5C4WB 5D5ME 3A4EA 3MRNA 3ULVF 4FQPA 1TTUA 2R8SL 4GWMA 4OI4A 4B3VA 4OV6F 1PIV2 1Q8SA 4G8GD 3V95A 1BM7A 2HCZX 3FRPA 3UTOA 1NQJA 3N04A 4X6DA 5IK3A 4Z7UE 2X4OA 4EWAA 1RUI2 2WBJB 3JD71 4PMEA 2OS7A 2AEWA 3JWDC 1RITA 3DI3B 3WD5H 3AS1A 5IHZA 4P4KC 4B7EA 3KNBA 2GSIB 2BIOA 1RUI3 1P7BA 2CK0L 5ERWB 5J98B 3SDXB 4NJAL 2MPVA 4ZMTA 1XQNA 4PRNA 3ZRFC 1TNRA 2IPKB 1EANA 1CFQA 4J4PD 2VDML 2ZX6A 3UBHA 5HV0A 3NMBA 4ZNEA 4L8CB 3MO1B 1ULVA 4DAGL 3P5BA 2EEAA 1T5XB 2WYZA 1L4IA 3CHPA 5DLMH 1O4TA 5EBWA 1FMD2 1O91A 1RXFA 5CFDC 4OCTA 1FN4B 2JKIS 1W6MA 2XG4A 1INQB 4LLDA 1OPGL 1XZ0A 1SHWA 3WNMA 1GCFA 2J6EH 1FMD3 2D43A 1CFBA 2ZXEB 5AOZA 1ETA1 2E7TA 4YZ3A 3W11D 3WTVA 3LPGA 1WFTA 2ERFA 2HRPL 3HNTL 1N59A 4HFUH 2Z4QA 1MI5A 2GJ6E 3CDZA 3DGCR 3GDBA 3RFRA 2ITCB 1MQTA 1OI6A 3E6HB 3CMOH 5LB1A 4E9QA 3RTQC 2O6FA 1V7MH 3LIZA 4F7EA 2LTQB 3FMGL 4Q6KA 4EQVA 3VX1A 1ODAA 1KGXA 2XXZA 1JWUB 3SYPA 5GJTH 3SGDI 2VAAA 4P5YA 2CH8A 1ETJA 2YKLH 3LKPB 2HMIC 1C3HA 2D6OX 2ID4A 4YW2A 3UC0H 3Q3GB 5DJZA 1MH5A 4QXWA 3HG1A 4WK0B 4Z78B 4K23H 4JM2B 1OSPL 4L8SC 5GJ6A 4YYOA 1N3NA 2PTTB 4MGQA 3UTTD 3L3OA 5L2KB 4TUJB 3IDIB 3NDYE 4OZHA 4U1KB 4APXB 1MJ8H 2R7EB 2V7NB 3WN6A 4IRSA 4LIQL 4HEME 5GLUA 3ARYA 1SMAA 2EKSB 3OLGA 2WQRA 5D2NB 3LXCA 4HSAC 1CX1A 5DC2A 4GINA 2IMMA 3ETSA 4LSQL 4E41E 2BV4A 1HHJA 1J1PL 2V6HA 2HJKB 4AG4H 1XNKA 1A64A 3DXTA 2EYTB 3US1A 1EPWA 1KYOJ 1GJWA 3TBVB 3BP6A 3D05A 4JGNA 1OOAA 2P8MA 2LLNA 1WZMA 2CUIA 2AZ5A 1DJXA 3M8LA 1YJDC 3Q8CA 4JPIB 3FKUS 1E27B 1UJTA 3A3YB 2X0WA 2R043 4G71B 2A3XA 5FOJB 4GMP1 3FSVA 3RB7A 4AW7A 5BJTA 4Z6AT 1KRIA 2OL3H 3PJNA 5IVBA 3J8F1 1IL1A 4O51A 2BSCA 1A4AA 2WINB 4O58L 3DDGA 4PUBL 4UANA 3GMOB 3RYMA 3N50A 1LOGA 4W8JA 5C4WA 1NM4A 1OTTD 1VACB 2QVKA 4AY0A 3MRBB 1HOCB 5FW7A 2HKXA 4M43H 5D7LB 3C6SB 1XSKA 1NOLA 1J7VR 4DGVH 5JDSA 3VFMB 3RX5A 1UPIA 3T1MA 5CJQL 3QNYB 2DWRA 3IAQA 3GRGA 3LN9A 2LW8A 2YYOA 2CMRL 4R84A 4YHOH 5IROC 3P4LA 5FHAH 1FV1B 4ENZA 3ETQA 4AEDC 3H8XA 3U6XA 1NDTA 3CEWA 3S5YA 1MFEL 3N9GH 4OLYL 5E9DA 4TVPE 3OTFA 1NAMB 3PHOB 4JANB 4OCRL 1ZTXE 1SOQA 2UUDK 4XNZC 4OHXA 5LA0A 5C09E 1ZZ6A 3SDXA 3CSTA 2ZGNA 2VSKB 1Z78A 2B5IB 1XFPA 3IN2A 1ES0A 2IPKA 1ZA3A 1PG7H 4CP0A 1J5CA 2C9KA 3MO1A 2DURA 2C3XA 2Z3FA 1SCRA 2LW3A 4ZQTA 2RJ2A 1N3QA 2J1KA 4AQ1A 5IV2B 3D51A 1DANT 1CDIA 1FATA 1ETZB 1T1WB 4MQXC 1E7VA 1IBBA 5T54A 3WD5L 4KWUA 2XN9E 5TF1H 2R30A 2XUEA 3ATEA 4OZGE 5DFVD 1Z0MA 2R49A 4HWEH 4IESA 4J12A 3FOLA 4FQXB 4ZAKB 4H8WH 2PHFA 1PD6A 1J59A 3UMNA 3MV7E 1SUHA 4AGPA 3K6SB 1IEHA 2VOVA 4I09A 5F9WC 3PRZA 1D4M1 1OALA 4K20A 3RWGA 3VBFB 3FB6B 3HG3A 3UAJD 4N7IA 2ZUTA 3PU3A 4X9FA 3D0SA 5DLML 1FC2D 3CMGA 1JWUA 2BIMA 1R46A 4GIPD 2E7QA 3F2ZA 3LKPA 4ZX4A 4R7VA 1UT9A 1BZOA 2VMDA 2XIDA 3WW4A 5KHJA 3IS0X 3Q3GA 3V8CA 3S30A 1QZ1A 2J6EL 4IGBB 4WI0B 5MENE 1PIV1 4GH4C 5FMCA 4JM2A 5EPMA 1J0ZA 2R0ZH 3B8YA 4FPJA 4WTZG 4HFUL 5IJVB 1R3IH 1RUI1 2NY6D 3ASWA 3I74A 4TUJA 3T6QC 4BLIA 4XWGL 2V7NA 1OA2A 3CMOL 1SBEA 3GZUC 5A3IC 4EIGB 4H7MA 4V2WA 1YN7B 2EKSA 1HWHB 5D2NA 1MHCA 1QXPA 3BH8A 1WCKA 3DJRA 2DBNA 3TVMD 3FXIC 1H0DB 2BBAA 4LFHG 3FUNA 1EGJH 5GJTL 1EY2A 2YKLL 1T2JA 1BZ7A 2XOTA 4GKOA 4KZCA 3UC0L 5DD0H 4M3HA 6CGTA 3TBVA 4X99B 2VVEA 3SDAC 4AV4A 3SE8H 2EP6A 3EYVB 4K23L 2JCCB 3IMBA 1KGCE 1FMD1 4I30A 2X8KA 5T3XD 2XJPA 4XFCA 5BRZA 1MJ8L 5FPXA 4XP4H 1KLFB 3QK0A 4YGCA 3RGVA 1UZ8B 3ZYHA 2M83A 3EXLA 2GBAA 2WFPA 2BRRH 3VYOA 4IEOA 1G7LB 3VG9B 4JY5H 2J5LB 2PW1A 4XTRC 1QRNA 4MDJB 3S96B 2BWCA 1ZLEA 1KJLA 4GW1A 2ZYRA 5D1XC 3I9PA 3WTSA 2WINA 3KVDD 4JQVA 1N1VA 3GMOA 3SY6A 3OQ3B 4KK5C 4ASKA 2VYRE 2VM4A 2Y1VA 3MRBA 1HOCA 4XHJD 3TXAA 4A7SA 4HOXA 2VQ0A 3QD6A 2OYMA 2DWSA 4PJXF 3VI3E 4ALAC 3QNYA 1GZ9A 1GYWA 1P5VB 4AYMC 5DO2D 2W47A 1CBJA 1DP0A 1Y1DA 2YBGA 4NRYB 5SWZD 5J6GB 1HQNA 1FV1A 3MN8A 5HDRA 1V70A 3E7JA 1UB6B 4XTPA 2OL3L 5D7IF 1I7RB 4PJGA 1BZDA 1NAMA 3ASOB 4JANA 1NKGA 6PAZA 1YPZE 2DJMA 1U8NB 1S46A 3Q01A 5A2FA 4IXLA 2BSTB 2OX5A 4M43L 5SWSE 1BKZA 1UYZA 5TQ0H 4DGVL 3KPQA 4KVNL 1T89C 1GGIH 2R071 1WAAE 1VESA 3FTGB 4J4PC 2C9SA 3U1SH 1P8JA 3ATGA 1UL9A 3M17B 4YFLF 4YHOL 1XU2A 4G42A 3L2YA 5FHAL 3B2UD 2OA9A 3IRCA 3QEQA 1IZJA 4K2UH 3H4HA 5FYVA 4UAOC 5IATA 3LPOA 4FXKB 1WUZA 1GP6A 1T1WA 3CFJA 2QT6A 3N9GL 2VDOB 5LXGH 3AL6A 4Q1RA 3UCRA 2QFPA 4Y5VC 3RFZB 4KNQA 4C1WA 3FBKA 2LUWA 4HUXA 5D7HA 2Q7AA 2XIBA 3LZPA 5TE4L 5GS3A 4JRAA 4KWKA 3BU0A 4ZAKA 2VE6A 4PRIE 3W11C 4AJWA 4LVNC 3WV0A 5C08B 1G94A 1WBZB 1PG7L 3E0GA 4S0SD 4FBFA 1Z2KA 5KVDE 2UVEA 1RZFH 4N2DA 5JXAH 3PNRB 2DYRB 2IPUK 3GJFB 3GXUB 4KKLD 2NY0B 4JG0H 4UM9B 5DQ9A 4F9LA 3LX9A 2IBZX 4CXWA 5TF1L 4E9LA 1L9PA 2X42A 1XF3B 4YR6B 3AX4A 4IGBA 4WI0A 1WIUA 4HWEL 1W28A 2YQ2A 2MSPA 1V6OA 4X9BA 4H8WL 3LA3A 3ZOAA 2JDNA 3OAYH 1IM3B 5FY5A 5IJVA 5DMYA 1P7HL 5KANG 3RKDD 5F7KC 2RS13 4XIKA 1UWXH 2JMRA 3OR7B 1HQ4B 1QO3B 3CFEB 5B3NA 1K8DB 4X6CB 3J7LA 4HIQA 4MLOA 5FYIA 3VV1A 4PGJA 5FY0A 4BHPA 3BHBB 2K0RA 3FRPG 3KW8A 5F9OH 4CVZB 4X99A 2X09A 3MRLB 3EYVA 5E1GA 4YZWA 5KSBB 2R0ZL 4PLOB 2QMJA 1HIXA 1CGTA 4HAKA 5IMLB 1PM4A 1CLVA 1R3IL 4TQ8A 4UZSA 2NYKA 5A3UA 4N2EA 3HQRA 1FX5A 3W5NA 3BUIA 3ZKXB 1BFOB 1KLFA 2FUTA 5CN1A 5GIRB 2J22A 2RGSA 1QABA 1DANU 2FHFA 5LA1A 2MPAH 1QEWA 3PPSA 2FDHA 1G7LA 1M42A 3QJTB 1JV5B 3WUDA 4BRJA 1N8OE 2PYED 3K81A 3F6IA 4MDJA 3S96A 3F58L 2C9UA 2DYPB 4X4KA 5DD0L 3BAEH 3MGAA 2V8MA 5BO1L 1Z0HA 5DUXA 1Q94B 4N1CA 4G82A 4PVLA 4ANUA 5IBTH 3TPKA 3TTSA 3TBWB 2FD6H 2DH2A 3F00A 2YLHA 4OQ1A 4AUYA 4F91B 3GZAA 1OTTC 4JL1A 1GMEA 2HJIA 2JD9A 2WO3B 3HI1B 3KAAA 4XP4L 3ZYOA 4M1GH 5F7WC 2CUMA 1P5VA 4JFFE 4LCIH 3ZT7A 4KDWA 1GXEA 4SLIA 4LHUB 1NX9A 3K72B 2BRRL 4NRYA 5J6GA 1RIRA 1LAJA 1R5WA 4JY5L 4L23A 3VFRB 3EYUH 1NL0H 4MGZE 1UB6A 2WR9A 4IJTA 5DC9B 3BAXA 3RY4A 2P5EE 1I7RA 4HCRA 3V6OC 4I48B 4L1HA 2CO4A 1OLMA 3ZK0A 4PBWD 4P4KB 1BJQA 3UERA 1NA1C 4WI2A 5B38B 2BSTA 2RB8A 4NOBA 5FB8B 1DCLA 2ZPKH 1YAIA 2PLV3 1UA3A 3LVEA 3QDJB 5E23A 1OFSA 1DJWA 4GG8B 1ZANH 2JQAA 1M7XA 4LRNH 3T2LA 4AKPA 2IV8A 4XB3A 1XTMA 3NZ8B 3VXPA 1I8MA 3LTVA 4CDHA 3WL9B 5CYYA 1EYBA 5CFDB 2BIHA 1RL3A 2P5WA 1QPPA 2WNXA 3AG2B 3LNEA 1OPMA 5DFVC 2VDPH 4C83B 4U36A 3WW3A 4RDQF 4XMPL 2EDKA 4D0DB 1WFJA 3D0VA 5HYJB 2RV9A 4DNLA 3FQXA 4HS3B 5TQ0L 3FTZA 1WBZA 2Q3XA 1GGIL 1NLDH 1NBQA 1Y6NR 3TT1H 3NG5A 3UAJC 3F7PC 1W0PA 1ZPLA 1I8AA 3CX2A 2QL1A 3GJFA 3O4LD 5LBSA 2XBO1 3GXUA 4K2UL 4UM9A 4MNHA 3RTQB 3SKJE 4QRRD 3OGGA 3KPSD 4J3UA 1SDYA 4AE1A 5LXGL 3GRWH 1Q90A 2G3NA 2BK8A 1XF3A 4YR6A 1ZA4A 2VAUA 4A7GA 5I23A 1KCRH 4WUKH 3F2LA 3FQTB 4MNGB 3SJVA 3LMJH 4ZW3A 3EHBD 3W39B 3NNGA 1QVOB 1IM3A 4YHMH 2W9DL 4AV5A 3KPNB 3TN92 3VKNA 2BOLA 4L8SB 2NY6C 4FLSA 1RZFL 1AKPA 3OR7A 3QT2A 4U1MB 5JXAL 3CFEA 2WQSA 4XHBA 1K8DA 4PBXA 4X7DC 4X6CA 1O7VA 3UG4A 4JG0L 4IV1C 5DZPA 4X8GA 2ODHA 4U1JB 3TVMC 4WVWA 3TN93 1AD0B 1A3RH 4MAYD 1CXKA 4WU5A 3GBDA 5ERLA 1NC2A 4ZMWA 2VTFA 4K55A 3MRLA 2CQVA 4LHKA 5ICXB 3RWNA 1P7QA 4PLOA 1CN4A 3VXTB 3SGKA 5IMLA 1PNDA 1DYKA 4I7ZC 4QNPF 5B1JC 5IJKC 2WZR3 3AZYA 1F8TH 3ACLA 2PO6D 1NGXB 1BFOA 2LGNA 5KHHA 5GIRA 1ZLDA 3KV6A 2A1XA 4NIKB 4R8WH 4R7NB 1JV5A 4LGPB 5EU6E 5IY5B 1SVBA 4UM8B 5EUOA 5AVVB 2WVVB 1FORH 3GBWA 3UYOD 4MX7B 5F9OL 4BQCA 4JVAA 4Q9CA 1RVF2 3I02B 4RSYA 3BI9X 1UGNA 1YLLA 3TBWA 5L2JA 2KZ1B 3LHPH 1LMIA 2Y7QB 4XHJC 4Y5YA 4A38A 3Q43A 4RH4A 4Y1AD 3HI1A 4F7TB 2ALWA 2WO3A 2WO7A 3SITA 2PNDA 3QULB 3D4ZA 4ET7A 3RYRA 1KCSH 4JCWA 2AJ3B 1HL4A 1G7PB 1RUKH 2MPAL 3K72A 5DO2C 3SPVB 4EKJA 1KLUB 5JA9A 2RMU2 5CU1A 5BS0E 2E9QA 4XTMA 2APFA 2DTWA 3PDGA 4UT9A 3AYAA 1U91B 4YVWA 3BAEL 4AEDB 2WL1A 3CKHA 1CVSC 5KBKA 1PKQE 1F4HA 2ORBH 3FYEB 1S8DB 2J1UA 1I1EA 3VWJD 5IBTL 1QKZH 2C9AA 4WHYG 4P4KA 4Z1VA 3KS0J 2FD6L 3T4AB 1D5ZB 3AB0C 5B38A 2DS4A 2MQ3A 4XNZB 5FB8A 1LEGA 3RJRA 4BM8A 5F7DB 3L2NA 4M1GL 5I26A 4XUTA 1B0WA 4LCIL 2WS92 4GG8A 1S9YB 4X6BB 4BWOA 2FD8A 4QTHA 1FFOA 2QELA 1NL0L 2IAND 1N7MH 3B2UC 3EYUL 5E8NA 2CK2A 2YGLA 3WL9A 1M06G 2I26N 1QQP3 2OULB 3NABH 4JFXB 1FV3A 3M86A 2VR8A 1CE6A 2WQAA 4BJ0A 4D0DA 2I32A 4YVSC 3FU7A 4HS3A 4ZUUB 2ZKXA 4KBZA 3K6DA 4NC1C 4NQTA 4BFOA 4Y89A 5HHOB 2YAOA 3AZUA 4LRNL 1UY3A 4IETA 5F9WB 1ONQB 1XH1A 3PAUA 3VSQA 2XWDA 2O8QA 4KKLC 4XX5A 1O5LA 4AEJA 4Y4YA 4WFED 2WKOF 2WSVA 1XGTA 3GSNB 4JREC 3HKZA 2W60A 3IT8A 3VQ1C 2VDPL 4MNGA 1CYGA 1F6FB 1GYVA 2K78A 1GYAA 3W39A 3ZIXA 4GH4B 2YMOA 1JN6A 4FVVA 3KPNA 3ZT6A 4KK8D 1UMIA 5EG6C 3R0RA 1NLDL 4HKOA 3IMUA 3TT1L 4U1MA 3RKDC 5HI0A 4UXAA 4Q4W3 4CUAA 3S97C 3GMNB 5LWBA 1FFNA 4U1JA 2PPDA 1T4KB 3PP4L 4B9ZA 2CNAA 3GRWL 2EECA 3O6MH 5A6IA 4R4BB 3IXTB 1KCRL 2J44A 4WUKL 4WFGE 4IEUA 3LMJL 5ICXA 2H6PB 5EF3A 1XSOA 3VXTA 5DEZA 3SDAB 3VFOB 3ECUA 5ACLA 2VLRE 4B7LA 5L7XH 1BXXA 3QUKB 1PNCA 2MCG1 5EWIH 4K8FA 2IQ9H 2Y23A 4NNYB 2X4NB 5FP8A 3ECWA 1IBGH 1JWSB 4H8WC 1T7WA 1DFXA 4Y4FD 3CH1B 1KDMA 1UPSA 4R7NA 5B7MA 1A3RL 1TQSA 2W80C 5HDOA 5DVKA 4D2NA 4JGJA 4QEGA 2OUJA 4N3TA 1NCGA 2IXJA 4GSQA 2ZS6B 1S7VA 2VMHA 4GUPB 2BCMA 1HYSD 1IFHH 5D1XB 3WHE1 4HSJA 4K15A 4W93A 1OF4A 2Y7QA 3T6VA 1FNHA 1F8TL 2X1QA 4WUUD 2P47B 5E6UB 1NBZA 2AANA 3QULA 4BCYA 5KVFH 3M46A 4QGNA 2RIKA 2AJ3A 1G7PA 1JYXA 3FQRB 4R8WL 1GGCH 3SPVA 3O41B 2F4PA 4R6UA 5CG8A 1JF1B 3E97A 4GYBA 3AKTA 4G8GB 3PF2A 5IROA 1RC6A 1FORL 1VDGA 2ZIDA 4L05A 3TN91 1AYN2 1BX2B 3BXNB 4KNTA 2QQIA 3BVNB 5C8CA 4XCNA 3BC9A 3NFSH 1D5ZA 3LHPL 4FI9A 2I7SA 3OKKB 3KM5A 2DJUA 2Z0BA 4FGMA 1FPTH 1KCSL 4G3YH 4O2CA 1RUKL 1D2OA 3JWNH 4YSCA 3O9WD 1LRHA 2ZWLT 3L3JA 1IRAY 1XGUB 4M5YH 1FYHB 1KIPB 4BFRA 5ICZB 2HT4D 4UAOB 1LB2A 4JFXA 3T2OA 2ORBL 4G9FE 2NW3B 3TA3D 2A6JA 2VSDA 4U6XA 4Y5VB 2ZJSH 4RGKA 3D85D 4LLFA 1GGTA 2ES3A 4OUUB 5KUKA 2XYCA 4LLQB 3WDVA 1P6FA 4LVNB 4FJZA 4WEMB 5HHOA 5CEZH 2KR2A 2ZXWB 1YEDB 5CR8A 4MCYA 1ONQA 2W1UA 1RVF1 3AC0A 1KJRA 2BNUA 1LK2B 4OD3H 3TYGH 1N7ML 5FZ6A 2G19A 4DY5A 2ENYA 2OV0A 1CXEA 3HVDA 3GSNA 4TNEA 4OUSA 3NABL 4A68A 5DC0A 2VDMB 1X4YA 3CC5B 1OQXA 2EALA 2W1WA 4J23A 4A7YA 2XQYA 1AQ8A 2EXHA 2RMU1 3EHBC 4GH4A 1ZRUA 5DUWA 3D4KA 5CEXB 1REDA 3OSKA 2YKKA 4S2GA 4X6RB 5IB4B 5EJ3A 4XXCC 1KTJA 3HC3H 4C4BA 3D3AA 3KXFA 4IW4C 1CCZA 3FTYA 3UTTB 2F1BA 3T3PF 1XE0A 4J2XA 1DLFH 2A71A 4PDWC 3AMHA 1VIWB 2QPSA 4QWWD 5IVOA 1OAXH 4JN1H 4MAYC 4CVUA 4JMNA 4A2GA 3RUGF 3TO4D 5A2BA 4R4BA 4AIZA 5F0LB 4JDTH 2EXYD 1OT4A 2WS91 2RFXA 3T09A 1B09A 1JHLH 3GMRA 3VFOA 4QMEA 3QUKA 2WZPA 4YZ1A 2J73A 2IFRA 2Q8AH 3SPHA 3VXQA 2PO6C 5BZWB 1OIOA 2ESVD 2FX7H 2XXFA 4OCXH 4P4RB 1NYWA 3CH1A 4KI5D 4LRIC 3RX9A 3BAWA 3BVVA 4AZZA 4CDUC 4JQRA 4C0BA 2A99A 3O6ML 5HDQL 5KXDA 2JVUA 3T65A 4GUPA 3W21A 3GGWB 3L9BA 5FFGA 4XABA 5FK9B 2DWDA 5D1XA 4N0UE 5E95B 4EN3A 4HJEA 2BGOA 4NDMB 4XDQA 1B9ZA 3HOGA 4KHTH 1ZT1B 5EWIL 2IQ9L 4F57H 4JTOA 3NSFA 1NG0A 1OGAE 1V8HA 1PNGA 3WIHA 1IBGL 5KVGH 3AL5A 2E32A 4LQFH 4A7QA 3FQRA 2YBPA 1U95B 1UIJA 3LQZB 1LE5B 3KM2A 3I6SA 5KAQF 4FYTA 2E7LC 3UMTA 3WSQH 1BX2A 5JHDE 2FUQA 4HS6B 3BXNA 5A2IH 5HVHC 3EB7A 2ZCKH 2QQJA 1U93A 3VWJC 4KH9A 2NY3D 4FNQA 4V33A 5GLTA 3RYPA 3NSTA 1KDJA 4TF4A 1X5HA 2A6ZA 3N7MA 2P49B 4IOSD 3L8QA 5JHLH 3OKKA 5KVFL 3N1GC 1NA1B 1N64H 3DGGB 4NC0B 5KN5A 5CADA 3ENEA 4JPWH 4IU3B 1GGCL 1T89A 4IHOB 4J4PA 1PX4A 5C0RH 1XGUA 2CA3A 3PLQA 1KIPA 3MUJA 1R3HA 3P3SA 1WF5A 3BN3B 2PPEA 4LMQI 1HDKA 4DEQA 3FFOA 3GZOA 4QHUA 3RHWF 2X4TA 3WUZA 5FZ8A 4JFUA 2ZXGA 2NW3A 1N0LA 4OF7A 3NCEB 1TR7A 4RRPA 1Z32X 4OKVA 1BYHA 3ISRA 3FDWA 1X44A 3NFSL 4AYID 5J1TC 3GXFA 4QLRA 2WZ8A 3DEMA 2G60H 1GGUA 2XKOA 2QPUA 2JJSA 1AS7A 4LLQA 4G3YL 1FPTL 2D3RA 2PW2B 4B7IA 1YJKA 3IDCB 3N43F 1YEDA 2N1KA 4NN0A 1ULCA 4Y1XA 2BVPB 4H26B 2EUZA 1E67A 4M5YL 1JNNH 3ACHA 5FZ4A 1U4FA 4MNQD 5HGAB 2AC0A 2Q1EA 2K6ZA 3VRJB 5IESH 3V0BB 2D0GA 4OLXH 3D18A 3H55A 3CC5A 2WXIA 2EE9A 3ML9A 3WGVB 2ZJSL 2GBUA 4JHZA 2YBRB 2VGDA 4EQ2A 1A0QH 4UWQB 4FA6A 4PGBB 4Z7WF 5C9AA 1I53A 3ESMA 4KK8C 1HI6B 3EG9A 1A1NB 2H45A 3HN5A 2K8MA 3L4YA 4JFQA 5CEZL 5GS0H 1AYN1 2NY6B 3UTTA 4WM7A 3TYGL 2Z8RA 4OD3L 1MCWW 5HPOA 1VIWA 2XGXA 4W68A 1JZ2A 4IV1B 3TVMB 1PZ8A 1GRWA 3NMEA 1QAWA 4PJDB 5ANQA 4E4HA 3SQBA 4LSRH 2QJVA 4QPIC 4KBPA 1U3JA 2EEFA 1AGDB 1PMYA 5JOYA 4XZPA 4AQ8C 5CCGE 3FMGA 3NCJH 2MHFA 1RK7A 4WNQB 1ADWA 3OAWA 4XACA 1ROWA 5FO8A 3PWPE 3A7QA 1SOXA 3HPLA 3BOVA 1P5UC 3HC3L 1L7TH 1J88A 2FE0A 5BZWA 4QIRA 1XVSA 2G4GA 4P4RA 3FHQA 5A80A 1DLFL 1F3DJ 4Y4FC 2XKPA 2E8YA 3OSDA 1OAXL 3Q8AA 4JN1L 5CEZD 2DYCA 3AJZA 3ILPA 4RMUA 3PUUA 5G4OA 2XWZA 3IE4A 4JDTL 4Z77A 3CHXA 3KPRA 4BBWA 4ISVA 1JHLL 1WD8A 4A2DA 4ZYKA 3MI8A 5FK9A 2C3VB 1DF0A 5K9JH 3N42B 1HYSC 2FCTA 1POV0 5C9JB 1TNFA 4Z0XA 1ZT1A 4X6EB 3QZBA 2Q8AL 5BW7C 4N2BA 2FX7L 3QO1B 2I5YH 4OCXL 5DJCB 5KOMC 3WY1A 1U95A 1LE5A 4XN4A 3BJLA 5TSWA 4JHTA 3MTRA 1YYMH 2OMXB 5IB1B 5SWZB 2ZUUA 2NSXA 4BSWB 1BD2A 4Q56A 1HK6A 1TSHA 4GIOA 5BXXA 3UGEA 1ZE3H 3IJHB 1SFDA 5CAZA 2ITDA 3APFA 3DVFA 3B9IA 5I75C 2C7UA 2VLJE 1BVNT 4F57L 1CFSA 4FEIA 1MIMH 3AB0B 4YEEA 5H4ZA 3WQ1A 1T66D 5KVGL 4XJAA 2W5PA 1RVFH 1CLOH 4P8QA 5GRVK 4LQFL 1XPWA 3EYPA 4IU3A 5FPAA 3FHEA 2EYSA 2F9BT 3O9WC 4IHOA 2X9WA 4F7PB 1LODA 3VXRD 3H3PH 3QIWA 4U33A 3QLQA 3CPLA 4LASH 3O3UN 4O2FB 2DM7A 1U8LA 3Q9PA 3WSQL 1EBAA 2R23B 4UFJA 2VXQH 5FYJE 2HT4C 1E5ZA 2ZCKL 2BSED 3TA3C 1G84A 1N12A 5DQDH 1VALA 1A7BA 3V5KB 5ITBH 4LOEA 1RI8A 2ZT9C 5JHLL 1BA9A 2B45X 3ESNA 3ACFA 4Y20A 1N64L 3LNDA 1K5NB 5J6SA 2OL3B 3NCMA 4Y1TA 1GOGA 4JPWL 4E36A 4YVSB 5DJXB 4XURA 4CXYA 1V3JA 5C0RL 4RRPM 3UAJA 4MB3A 1J18A 1PDKA 5HGAA 2BVEA 3BI3A 2FDKA 2RH0A 3LJ3A 3AK0A 3V0BA 3VRJA 3O3BB 5DJ8A 5H9RA 5E4EC 4NO5A 2VJ0A 4JREB 1QFPA 4JR9H 2JB5H 4M00A 5AG8A 4LITA 3KDMA 1UWWA 2G60L 1MUJB 4PGBA 3S35X 1VMFA 5K1VA 2F4LA 4OGAD 1A1NA 4NQQA 4OJEH 5EJ1B 2WUBH 1XYPA 1WQVT 3S37H 3KVPA 1H8VA 4UI9L 1JNNL 3FU0A 4HK3N 2FGZA 2XJLA 3OM3B 4PJFB 4X83A 4IV1A 4QWWC 3TVMA 5F32A 5IESL 1US3A 4JKLA 1QJU2 4OLXL 4ZOBA 3KV9A 5DAWA 3GZPA 1OP4A 3TO4C 3VFWA 3ABZA 1AGDA 2EXYC 5IW1B 3T4YB 4EUPH 2VZTA 3PY9A 3BMVA 3IPEA 1GMIA 4MBOA 1A0QL 1OXCA 4WNQA 3MA7B 5DURD 1ZAGA 4LKDA 3I6GB 3S4SA 2X10A 2MCAA 5GS0L 3ZYFA 5B1JA 5IJKA 1DDTA 2DI9A 1RMU2 5FYJU 3DX7B 4KI5C 4HG6B 5E0QA 2X53S 4K5OA 5EU5A 1DQLH 3E6BA 2DL9A 4WZCA 2W9XA 4NXSA 4LSRL 3SO5A 2Q0AA 2PYEB 3ZIMA 4HH9A 5ABJC 4KMTH 1X7NA 2JIJA 2C3VA 4RX4D 3NCJL 4L4TE 3GSVB 35C8H 4X6EA 2QMKA 3QYMA 2NXZD 2WLNA 3CZGA 2QDRA 1L7TL 3QO1A 4H0GA 5DJCA 4OHWA 4MJIE 2CUHA 3LCPA 2FSEB 2XKUA 3K0YA 1YZZA 2HRHA 2OSXA 1AL23 1TENA 1KY6A 4KI1A 4NPKA 2VNOA 4MZUA 1H3UA 4MA3B 5AZEH 3T8MA 4BSWA 1T21B 1WFMA 4U3CA 4HPYH 5IVVA 4HJ0D 4I2XE 1Z66A 2A3YA 4DIXA 1SNRA 2AJYH 2NY3C 3ABLB 4LU5H 2F7OA 3GS7A 4FQ1H 2JB8A 3AB0A 2YPLE 4Z7OE 4ZXEA 1CLZH 3H3UA 1S9VB 4N9GB 2I5YL 4NRPA 3LYRA 1QACA 4P2AA 2XQYG 4K4KA 4PBVC 4QQPA 3ATAA 4O2FA 1AKJD 1YYML 1FNAA 4XNAA 1VAKA 2A70A 5I5MA 3JQXA 2R23A 3CFNA 1UZZA 4NKOB 3DKQA 3BKJH 1SOSA 4IOFD 1EV2E 4TM9A 3TIDA 1A7NH 3V5KA 3EJKA 2JB6B 1KENH 4O9EA 3ARGD 5EU3B 1MIML 3UTSD 1W9FA 4G8FA 2OL3A 1RVFL 1CLOL 1ESOA 2O1AA 5BNQA 2I25N 3ZZQA 3AVRA 4QRBA 2ET1A 5FP4A 3H3PL 2Z6FA 5CP3A 3IN0A 3K0WA 3SKNB 4IBYA 1FH5H 1SXZA 4LASL 3S6CA 3DKWA 3CSYB 3O4LB 2PTUA 2VXQL 3O3BA 4QRRB 3KPSB 4XAKD 4WVMB 5IW6B 3SMHA 4UZGA 5DQDL 3R06B 5FP3A 3NPZB 4D9QE 3QR2A 3WDYA 5ITBL 3WZ1A 1MUJA 4XVOA 4WV1C 3VVWA 3L17A 1L3NA 1VF5C 1YNKH 4YEFA 4A04A 3QPQD 1VGKA 3EHBB 3DUSB 1OEZW 3EZJB 2FK9A 5ANMB 3RPBA 5C1MB 3PABB 4PR5B 5C2BH 5CLYA 2Q7YA 4V2CB 5EUKB 4IBZA 4PB9H 2E86A 4PWGA 1GWMA 1ZRDA 4XNYH 2P5BA 2K0GA 4KGQA 3OGSA 3ZKND 4G3YC 3RIAF 5H37H 3U0WH 4PDWB 2EDBA 3RVXD 5C0BE 3JWNC 1V6JA 3FJTA 4IE0A 2X7LB 3LS5H 3OL2A 4MAYB 1HL9A 2RJMA 4JR9L 4P9MH 1FYTD 4QB6A 2JB5L 2PELA 4OYUA 4QKXB 2PCXA 2YEQA 2R1WA 5CP7A 3RZWA 4GG6A 3MA7A 2ZGQA 2X2JA 2GH2A 1ZDSA 4POYA 5C3SA 4HHAB 2WUBL 3L1EA 5EZIH 4JCKA 3KF5A 2OK0H 3S37L 4TLKA 4ZSOA 5KBPA 2PO6B 3DX7A 2IXLA 3V2AR 4JGYA 3NIDB 2PPFA 5HHQB 4P9XA 1IT9H 4IU2B 3NEEA 1K4DA 4AJVA 2WLYA 4CDUB 1KIQB 2PYEA 4HJJH 2MRYA 3V0JA 4MJ4A 1UM5H 2L7JA 1P1VA 3GSVA 4FQJH 3EO6A 4EBQH 3URFA 4NQXA 5DUUA 3C5SB 3QC5X 2YD6A 3UROR 5I0VA 2VMIA 3Q0HA 5ACA2 1IV8A 1NGWB 1Y6KR 4RRPG 3EDEA 2JDAA 3NZSA 3NIFE 4F2FA 2GY5A 2VVDA 3ZX1A 1ENSA 4MA3A 2OXGB 3THMH 2P4AB 1DQLL 5AL8A 4ABQA 3QZWA 2PHWA 4KMTL 4BOWA 1AYOA 2DBIA 4Z7QF 5KSVB 1EO8H 5FRAA 3VW3H 2XHKA 1C28A 35C8L 5HVHB 3POFA 1E57A 3ULVH 5SX4H 2NT0A 3VWJB 1XGRA 1QJZA 3CDGB 4MD5B 4HYTB 4LMFA 5DTFB 1QJU1 4R9CA 4Y1YA 1T66C 1WBFA 1VZIA 4PTUB 2X5PA 3I2IA 5HVFB 4UYBA 3B00A 3ZR6A 3NQHA 4CL7A 2Q30A 1NFKA 2RMNA 2Z0UA 5CKGA 5AZEL 1WLTA 2WANA 1KF9B 4LCYA 4RAVB 2IANB 4PGCB 4QRFA 3ESPA 4HPYL 2UZIH 3S3SA 3ULSB 3V10A 5D2LB 4WJ5A 3A22A 1LQBC 2VXUH 3MJGX 1RMU1 1XB6A 2AXWA 2AJYL 2YGPA 4LU5L 1H6UA 3SE3C 5J4MA 4FQ1L 2JDKA 5HHPA 3RB5A 5DHVH 2D93A 5EU3A 4J1UB 5EOCJ 3NJJA 4JAMB 3LQAH 3B3IB 3TCXA 4F7MB 4DXSA 1GZPA 4BB3A 2EDDA 3PJQA 1BZ8A 2BGCA 3O4LA 1UOWA