2W94A

Native structure of the discoidin i from dictyostelium discoideum at 1.8 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
254
structure length
254
Chain Sequence
b'AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 62
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w94A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w94A01
2VMFA 1DP0A 3HJRA 3ECQA 2CGYA 2VMCA 4QAWA 3WF1A 1WCQA 4QDQA 4CUAA 3PUHA 3NJVA 3W5MA 3VD4A 2VZPA 2DCJA 1EUTA 2VQUA 2Y6JA 2QQIA 3I3EA 3AC0A 2CGZA 4P08A 4W50A 3IIIA 2CCVA 4Q56A 2VZ1A 3CZUA 3K4DA 2VL4A 4KMQA 4P5YA 1PX3A 2VCBA 2ZEZA 5CZKA 4JKMA 2E33A 3WF3A 3C7OA 2J22A 1GUIA 4JKKA 3NRUA 1GOGA 3HN3A 4A45A 4ARYA 3FHQA 3WNOA 4RYDA 4LPLA 2J1UA 3D3AA 3A21A 3LEGA 4QB6A 4CU8A 3VDCA 3T0DA 4OZOA 2BBAA 4MOAA 1JZ2A 2YC4A 2WQ8A 1OD3A 4UAPA 3A22A 3T2QA 4CUBA 1JU3A 4XUNA 2J1EA 5EJZB 4FI9A 1UY1A 1K42A 1ULOA 3U37A 4ARXA 5HPOA 2W87A 3WNLA 1JYVA 1OH4A 2QQKA 2RJ2A 2Y6LA 4BK5A 5DQ0A 3OB8A 1OF4A 3FL7A 2VZQA 1K45A 5JUVA 4QX1A 3GDBA 2CDOA 4BK4A 3C7FA 3LPFA 5J1XA 3T09A 4KI5M 2VZRA 3SEEA 1JZ6A 1CX1A 2WUHA 4HG6B 2Y6GA 2QQLA 3OEAA 5JR2A 4TXWA 5JXHA 1UY4A 3HNMA 4DEVA 2WN3A 1O59A 3OBAA 4XUOA 4DXRA 2WBKA 2W1UA 4ET7A 3WSOA 1PMHX 4DEQA 2W47A 3NJXA 5C70A 1H6YA 4CU7A 2QQMA 2XHNA 4XVHA 1XPWA 2Y6KA 3VD5A 3UNPA 3T2OA 5IFPA 1W9SA 1GNYA 4OMCA 3ETPA 1NX9A 4ZY9A 2LS6A 5EIYB 2Y6HA 2VM9A 3VDBA 4CVUA 2W1SA 3DYOA 2EICA 1TG7A 4RN5A 4AG4A 1H6XA 2V5DA 1HN1A 1UYYA 5DMYA 3MBWA 3OGVA 4L0PA 2YFZA 1J84A 2V72A 1JHJA 2WN2A 1JU4A 1UYZA 2W1WA 2HYXA 3IDAA 3THCA 5DN2A 2W5FA 1UZ0A 2PQSA 1D7PM 3I3DA 2VR4A 1CZVA 5LA2A 5B4XA 3NQHA 2OKXA 2ZEWA 3CIHA 1W9WA 3THDA 1W99A 5C7GA 1IQDC 1CIYA 1JZ8A 1US3A 4PT6A 1JZ7A 4MGSA 4GWIA 2W9XA 2HLEA 3WMPA 1I5PA 4DXSA 5LA1A 1NAEA 2QQJA 2VZOA 4DUXA 2YB7A 1TVGA 2WO3A 1DLCA 4XZUG 1WKYA 3GXUA 2VOTA 3A23A 4A4AA 1O8PA 2BGPA 3OEBA 4ZXEA 2WDBA 4DUVA 4QX2A 2J7MA 4QX3A 4P02B 3T0AA 3VDAA 3ABZA 2E26A 1L7RA 1CZTA 2B4KA 2RVAA 2VJXA 2W94A 1UY2A 2ORXA 3VD7A 5CYYA 2X05A 3I2JA 4D0QA 1BHGA 3K4ZA 4CUCA 3A7QA 3JXSA 3HEIA 3W5NA 2WABA 1GOFA 2WZ8A 3T2PA 1GOHA 2EIEA 3ACHA 3CKHA 5LCWL 5JXJA 2ORZA 1J83A 1K12A 2VZSA 3ACIA 3EB7A 4E8DA 1JZ5A 3MO4A 1CZSA 2VQTA 1W0NA 2XQXA 2E31A 3WF4A 2J1RA 4LHSA 2L9LA 3LQCA 4ZZ8A 5LA0A 2J1SA 2W95A 1EUUA 5JXIA 3P1IA 4QB1A 2VMEA 2VTFA 4QDRA 2XOMA 3IAQA 1OT5A 1UY0A 3HNYM 4XUPA 5B4NA 2WAAA 1JI6A 3CQOA 2KD7A 1UY3A 1UMHA 3I2GA 1L7QA 1UMIA 3BN6A 2Y64A 5JXGA 3IAPA 3HPNA 4XUQA 2J1TA 2BZDA 3MUZ1 1R64A 3ACGA 2C26A 1NUKA 3MV11 2WZEA 3FHAA 3PUIA 4PQQA 3UESA 1PX4A 3CZJA 3ACFA 2LW8A 1ULPA 3CMGA 1UYXA 2B9VA 3I97A 3K77A 2W91A 2VZ3A 4XURA 2J1VA 4MO3M 3EYPA 4A42A 4BXSV 2C9KA 4A3ZA 3C8XA 3GGLA 3FN9A 2VZTA 5EJ1B 3C7EA 4AAXA 1MPXA 2VO5A 4M4PA 2WYSA 1NKGA 2BERA 2JD9A 2J1AA 5IHRA 3MV01 3WF2A 3SKJE 3WQBA 3BGAA 4UOJA 1JZ4A 5I0DA 2BGOA 3SKVA 3LEIA 2WO2A 4E8CA 3WNPA 2EIDA 1PMJX 1US2A 2E32A 5IFTA 2WAOA 4TTGA 4QX0A 4CU6A 4IUGA 3WNNA 3P6BA 5F7UA 3WEZA 3OGSA 1GU3A 5IYYA 1UXXX 1W9TA 2YFUA 3LE0A 2QQNA 1F4AA 2JDAA 4QB2A 4OMDA 3I2HA 1JYXA 1W8OA 4DUWA 5A1AA 1P8JA 5JMOA 1XNTA 3SEPA 4Z2AA 2X10A 2W92A 2YG0A 1JYWA 2YC2A 4OUEA 3I3BA 1RYYA 3C7HA 3GM8A 1K3IA 3I2FA 4A6OA 2QBXA 3T0BA 3ZM8A 1KEXA 3E1F1 1JZ3A 4DXTA 2QQOA 5C71A 3WNMA 1F4HA 4XUTA 3I2KA 3DECA 1UWWA 3VD3A 1KGYA 4JX0A 4MADA 3K4AA 3NNGA 5G05L 2XONA 2V4VA 3LEKA 4PF1A 1JYNA 2DDUA 1T2XA 4A44A 4GZ9A 2CE6A 3K75B 2W46A 2JKXA 2JE8A 2ZXQA 3K46A 3C7GA 4A41A 3MUY1 4P00B 4JHZA 2Z4FA 2RV9A 2ZEYA 4KWUA 1XC6A 5HXMA 4QDSA 1UXZA 3J7HA 3IB3A 1SDDB 4CU9A 2VZUA 1YQ2A 4QPWA 4LKSA 3UETA 2CDPA 5DPNA 2ZEXA 2W3JA 2VC9A 3OG2A 2R7EB 2VMDA 2X09A 2EIBA 4OYUA 3I2IA 3OGRA 1GQPA 2WO1A 2VCCA 1W8NA 3WMQA 2VCAA 3HOBA 5IJRA 4JKLA 4W8JA 2VZVA 1SHWB 5FUIA 4UI9L 4M4RA 2C4XA 3HNBM 2ID4A 3CDZB 1UX7A 4W4ZA 1O8SA 3DYMA 4BDVB 1GMMA 4LQRA 1DYOA 2W1QA 4BJ0A 3F2ZA 3DYPA 3LPGA 3VD9A 2DCKA 4YPJA 4ZZ5A 2Y8KA 3WF0A 4MGQA 4D8MA 1LNSA 3T08A 1XNAA 3WNKA 1OF3A 4GWJA 1SG3A 5G04L
chains in the Genus database with same CATH superfamily
1AIFA 2PPFA 1GYAA 1RL3A 3C60D 2UUDH 4RA3A 3RNKA 2YU1A 2CK2A 5E6SB 4SLIA 3T2NL 3O2DL 1REEA 4E41A 4R9HA 3L3HB 1K2DA 4LLVB 3U4KA 4M93B 3SYPA 1NAKH 1I9JH 2VMCA 5E7FA 5E16A 5BNOC 2ZX2A 1RUQH 3WEMA 1VFBB 4PWIA 4BFGA 4PJDF 4F8NA 2FJFA 3DJZA 1DVQA 5F89B 1BVZA 2IF7A 2EIKB 2MMXA 4XMPH 3RIFK 1VFAB 5FECB 4H14A 5ANHA 1OI6A 3TBDA 2DAVA 3A0OA 3DBSA 2M26A 1V3MA 5JI7A 1A4BA 5JW3H 1J05B 4E9VA 5T55A 3OR7A 1MCJA 3C5ZA 1JPTL 2VXVH 3GQFA 4ZZFA 4KJQD 2CUHA 5JIIA 5CIRA 1E5CA 3WP3A 2D3RA 2XG5B 1HV0A 4O02L 3PY9A 3IE9A 1KN2L 4M6MH 5A2IH 4G6MH 1AX2A 1G4RA 1P84K 4GQ9L 1XXFC 1RUPH 5CIPB 1XOYA 5FZOB 1DL7H 3WS6C 2VUYA 5F9OL 3A4EA 5D1QA 1X7NA 4ZS6D 1NIBA 1ZKAA 3VBHA 2OL3A 4GRLB 1VIWB 4AHWA 3FU8A 3HR6A 5C92A 1VBD1 4H26A 2EA7A 1OSGA 3UACA 4KAQH 1HCFX 4LGSB 4M6OL 4R5TA 2ICWI 1RJZA 1XB8A 2HYMA 5GS2D 5GGSY 3UJIL 4ADJA 4D9RD 5BXFB 5CF3A 1DBAL 2QMJA 3BFOA 3MNVB 4QXWA 1UOFA 4HSLA 1WBYB 5F2SA 5FLHA 2FZ3A 4Z9KB 1W8FA 2ADGB 2XWJB 3A6BH 3KS7A 1XMWA 1AR81 2HBTA 5FUNA 1FYTD 2VN5A 4HS8L 1D6VH 2VDPL 5C3SA 2HWE1 5KJ7E 2MCG1 5FP3A 5ID0B 2ESVB 1A2YB 4U3SA 1ZRUA 3WY2A 1TE1B 3BO8A 3IDCB 4HQQL 1ULOA 1HZLA 1FV1A 1R46A 1W6OA 2EYTB 1KYUA 2VH5L 3C2AL 4H25B 1KGXA 1JVKA 3CLWA 1BECA 4JGJA 5BV7B 5IB5B 1NCQA 1W2AX 3AFGA 2ATAA 3MPBA 3TB0A 3VDDA 3S8FB 5BZDA 3SO5A 1J0HA 2P17A 1XF5A 2WKOA 3ILEA 3RVTC 3BZ4B 4K55A 5HYJE 2NY6B 1IS4A 4P4RB 1U91A 4MGTA 3OOXA 3EW3B 3FPYA 5J1XA 3T09A 3L3JB 1H8TB 4LVNC 5CEZE 3GSRB 4HG6B 2IMNA 2RS11 4L9LA 3VB8A 2EDRA 2Y5QA 1NCUA 2XG3A 1J3RA 4N2HA 2ZKXA 2H0JA 4L4JA 1M7UA 5D5MF 5LBSA 5L2KB 2FR4A 5GALA 4B9KC 4NIIA 5FZAA 2W47A 4GULA 4LK6A 4N43B 4J6RL 4UFJA 2I25N 5EA0H 2FB4L 3ZX1A 4QRBA 3EJZC 3N0AA 1GYWA 4ADGA 3QH6A 5F39A 1MNUH 3GB7B 2AV7A 2BFVL 1N70A 1N47A 3CFJA 1CD8A 3F58H 4JG9A 1SN0A 3KPPB 3SDCD 2E7LC 4X7DC 1GYCA 4CZSA 3UNPA 2B77A 3JWDH 2HLFC 5HBBA 1WD9A 3QE5A 2ZKMX 2ATKB 1QFPA 3I49A 4U1KA 1HW5A 5SWZB 1KY6A 2HKFL 2YAPA 4OMCA 5K9JH 4D6QA 4J1UB 3NAPC 5GSRB 4DKAA 5KYUA 4TQIA 4FQQB 2Q1EA 4HWEH 4Q4W3 5K0UB 1J88A 1TMF1 4CPBD 1W16A 1P7BA 3PAVA 1AR61 1BQRA 3II2A 4MNQB 3SJVA 1BEXA 4HALA 1LHUA 4L3ED 4NCC2 4GB33 1A4AA 4ONHA 3DEMA 3EFOA 3FB8B 1QKQA 5I0SA 3H2WA 2P3IA 1BWWA 2DUOA 4OFDA 4Y7MA 2E56A 3RY4A 5DFVC 4KMTL 2X0VA 5LXGH 4QO1A 1NH6A 1D0HA 5LEKA 5E6YA 2EE0A 4DVRL 1P5VA 3HQUA 1VFOA 5IFAL 4OZ4B 5I1GH 5C0RL 1MY7A 4NUBA 5K4LA 1YUHB 4NPKA 2G5RA 5A6XA 2GK2A 1VMHA 1OOAA 4MJ5A 3A24A 2WT0A 2X7LA 1QJY1 1YQ5A 4Z7WB 4X9FA 4OJCA 3TL5A 1C1EL 4N8CL 2EEXA 4DW2H 3JQXA 3KPNA 4B9GA 4IGBD 3TX4A 3M8LA 1XH3B 1SLUA 1AZDA 4JQRA 4FQPA 2YPLB 3D3VB 4M7ZB 2OIIA 1PVC1 4YNIA 5K59F 1RMU1 1TNFA 3IDBB 4GMP1 2WT2A 4NENB 5BNPB 5I19H 5FAAA 1V70A 2JCCA 4Z7VF 2BMKB 3H8OA 4WDIA 3ZDXE 3TBCA 4OGZA 4A2LA 2ITEA 3VHOA 2MEV1 2OFQA 1ZLWH 3NDZE 4LLWB 1FBIH 2VN3A 1SLXA 1IARB 4XWGL 4EI6A 1RUJ3 2LV4A 3BP7A 3VWJA 3V65A 4YHOH 1MREH 5DS2A 5A40E 5F9JA 1BBDL 2LRPA 1I31A 4FT8A 2VDPB 4MB4A 3ZZSA 1HEJC 2JB5L 4X4KA 5DD5L 1JPEA 3SDXF 3NUKA 1IC4H 2B16A 3BN9D 1XF1A 4LO5B 1X5ZA 3V0WH 3WHE0 1QSFE 1BZ7A 4HVOA 4X4ME 1A9VA 5ISZB 2DCZA 3BKJL 4HF5H 2BP3A 3D2UA 3LKSA 3V0EA 4BSWB 5C0CD 1CICB 4QX2A 3Q3GB 5C2BL 1AKJD 1T03H 3ARZA 4MYWB 4P02B 2C9QA 1OSZB 1J1OL 2BIIA 1K8DA 2VRAA 2GTZB 3UTTA 2JJTA 1QMJA 4PYHA 1UY2A 5JLVA 1EHLH 5ADOL 2BP0A 1MCKA 2GABA 2Y7MA 2XRAH 4OKDA 4ZOCA 4YM3A 4X9HA 4YSFA 4ATTA 2OJ1A 4B5EA 1WPCA 5CJOL 2JKBA 3H3LA 5TJWK 3MGTA 4IQPA 1HXYB 4M1CC 3FLRA 1EERB 3PXHA 1J5CA 4YVUA 4RHV1 4ZAKA 3EXUA 1AQMA 3HMYA 1YRKA 4WW2B 3AMPA 1EO8L 1KNOB 4Q9CA 2BCKB 4IDJH 1N8OE 2JJTC 2BFUL 2VLJB 3DSNB 5IFJA 4NWVA 1BYPA 4WZFA 3FTGB 3HHMA 2VDKB 1OARH 3WX5A 3ARFA 2D7QA 3O6LH 1KC5L 4L05A 2VZSA 1DQ5A 1EAH3 4R3SA 3TZVA 4IEXA 4E8DA 1W0NA 4EIUA 5FA3B 5KSAD 2C1PB 5DJXA 1RZKL 2AANA 1FAYA 1G43A 5E2VL 5JUEH 3WTTA 4K8FA 1TEFA 2VAAA 2A71A 4H8VA 4WK0B 5HI3D 2G30A 4AKQA 2IANB 3D48R 4XMAA 2EDXA 2VAJA 2EILB 3GXNA 1KULA 1Z3RA 3ARFC 4TL4A 5L8JB 4WFGE 3P1IA 1LO2L 2YC1B 5CP7A 5FMBA 5FXVA 1F6LL 4P46B 2I07B 1BFOB 4HIEB 3OHXB 4PY7B 4RGKA 4K8RL 4EKJA 4FQIH 4CDUB 3SZKC 2MCPL 1OKOA 1UY3A 2Z1KA 3BP4A 2P8LB 1UOLA 3V6FA 3OQ3B 4FTVE 1W6QB 5HGDA 1L7QA 1ZK5A 2H9GA 4PB0H 3BJ91 2OMBA 3GO1L 1IJNA 2NTSP 2XFGB 4XCFH 4JRXD 2J44A 4AYID 4ZG1A 1SPPA 5DAVA 2JIXA 3D1MC 5FO7A 1JUHA 5CG8A 4ZMLA 3KYOA 3F7QA 1QSEE 3DX4A 2AXJA 3TH3T 2YMZA 3U7AA 4ZS6C 2ZF8A 2BWCA 1EAOA 1FPTL 3QIUD 1OGPA 4QYOA 3UIYA 4EI5C 4DKFL 3NIGF 4DRRA 1GW6A 2F7PA 4R26L 3CZJA 4PWKA 4JFDB 5FKPA 5HGGS 2BNOA 3BH8B 3MGOB 4U1MB 2K2SA 5L88H 2WXJA 4BFIB 3ROLA 3L3KA 4JQIA 2DLIA 4MCYA 5C09A 1FPN2 1CR9H 3KV6A 3KPQB 1L9RA 5EC2A 1OBNA 4ZFFB 1HQWA 1IGIL 1ODAA 5CZVH 3P4LA 1YC7A 4X6CE 1YAZA 3LWCA 3ABMB 4YDKH 5C0FA 3X1NA 2XUWA 4JG5A 3H6JA 4ITCA 2HUHA 2IXQB 2NYYC 1BCIA 1MCCA 2R7EA 2VABB 1VLNA 5DQJA 3ETQA 4PG2A 5FR3A 1KB5A 1TEIA 3EJTA 3QQ3B 3MW3A 1G0XA 1WIPA 4JFZL 1TJIL 1T5WA 1IG0A 5SWQA 1N7ML 1R24B 4OLZH 1MJ8H 2N1TE 4XC3L 3LA7A 1HKFA 1E9PB 3BEWA 1WIUA 1NCGA 3ZBMA 2ZUVA 1WWBX 2QJDA 5TF1L 2BVPB 3LS4L 35C8H 3VGFA 3MRGA 4O9HL 2FIRT 2G75A 4HLZH 5JYLA 1CX4A 1LESA 1UD6A 3MA7B 2WNVA 4AL9A 4K9EC 4C56A 3F7LA 3V7AE 4QCIB 3WIFA 4XO4A 3N7JA 3BGAA 4AV4A 3N9LA 1Q5OA 3ZO9A 3SKVA 4GKLA 1KJMB 3H42H 1KRIA 2A9CA 3FB7A 4LSSL 5CN1A 4EO5A 5AAPA 5CJ8A 1RHHB 5I74B 4HN1A 1IBYA 5L9RA 2WL1A 4WVZA 1I1EA 5D7IA 1MFAH 1E28B 2Y5TA 1KS5A 5J1SC 1PZAA 3EDFA 2XN9D 1FVEB 3VGGA 2APVA 3HKFA 3KQ4B 3WOGA 2ITFA 3LKRA 2LTQB 4XJ8A 4X98B 4GD4A 4DUWA 3OPZH 4WEMB 1E6OL 1B4TA 1XD0A 3ERXA 1LDPL 3SE8H 2P7TA 5FHBL 2Z6FA 3NSTA 3M1CA 4B9ZA 3GEFA 3C9NA 1YY9D 1D2SA 3T0WA 4PJ5D 1ENRA 1GQHA 3PWPD 5BUVA 3FB6A 4CKVX 1H8SA 3REWB 1GGTA 4UF7C 2PR4L 4F7TA 5E7BA 1G9NH 2YBKA 3L1GA 3MRIB 3C7HA 1Y07A 4PRNB 4YHZL 4WWKD 5HJ3B 4KKCD 4PS4H 3GHPA 4AGPA 4HCRA 5DVPA 3FTSA 3LNEA 3MRQB 4XBNA 5C9KA 2WSDA 3NAPB 2B7DT 3NPSC 3MBEB 1F4HA 2P1BA 2A6JB 1PNCA 1LWHA 4GW5B 2WR9A 5HHVL 1I75A 4IE4A 4J3UA 4XCNA 2GH2A 2EEBA 2BJML 1IAIH 4Y2DA 3RU8L 1OZUA 4YR6A 4MNHA 3SO3B 1CXHA 4KNQA 3AJZA 2D03L 3AYCA 5T52A 4K5LA 1U8LB 2BSSA 4POZC 1N64H 4HHAA 2J56A 4K8RB 4NJ9H 4B7EA 3GMQB 4FFVC 5EZJA 3T3ME 3FCSA 4OZIE 2UY6B 3N43F 3OXSB 1A9EA 2HJLA 4HU8A 4P9LA 5CCKH 1LVEA 4FQHA 4Y2DC 1K4DA 2CO7B 3AP9A 2GIYA 4JFHD 3PNAA 5JHLL 5SV8A 4W6WB 4AVVA 2V3FA 3MJ8A 1DQTA 1JW6A 4RA0A 1TZGH 3FLPA 3AFKA 4AFCA 2BRQA 1A8ZA 1X7QA 4G80B 3KXFB 5GS1C 3T65B 3VGBA 1HLCA 3BP5A 4Y3OA 1LO0H 1SN2A 2W80C 4HIXH 5FLUA 4DK5A 4P2RB 3RGBA 4HCGA 4C4BA 2CBQA 4G8IB 2GJPA 2BPA2 1NMCC 3KVQA 2E63A 3DVIA 1FZMA 4YE4H 3TO2B 3MHZA 1G86A 1CBJA 4CU9A 4Z1PA 4FOQA 5E2TH 1Q0EA 2EIBA 3S3BB 5DYOA 5E5LA 3AAZA 1N18A 3QEQE 3QGVA 4W9EC 3STZA 1XZ0B 2P28B 4FFWC 5BXXA 3LD8C 4QQPA 2YD5A 4U3HA 3BN9C 4HWZA 4I0PC 1LK2A 2IQ9L 1MWAA 2K9ZA 2VZVA 1I8LA 3HFMH 3O1VA 4J3OD 1MIEL 4X5XA 5GGSB 1DQ2A 3GALA 2X4RB 4Y1AD 3IGAA 4BQ5A 1CG9A 3OZKA 2AJYH 2FZ2A 3CQQA 1AGFA 2H1PL 1I85A 1NEZA 4HMCA 5HDLA 1KFXL 2PMWB 5A33A 4GWMA 2ADYA 4S11A 1RIUL 4YVSA 4LQRA 1ZEAH 1Q1JH 4TNWF 1G1CA 1A4JA 3TBTB 3ZZQA 3NMBA 1FZJA 1PYWB 1FVDB 2ZCLL 2X5PA 4Q29A 2BLFA 4Q0XH 5CNAA 3LPGA 4IHOA 1FL5B 4TNEA 5E88A 2P5WE 2K4AA 5BO1L 5EN3A 4OCRL 3WJLC 2K8QA 3B9AA 2IVFC 2F19L 5C97A 5J5EA 2Y2WA 1S3KL 4PF5A 3M3CA 4YVSC 1L4IA 4YHIA 3I9PA 1I7RA 3ZSMA 4DXZA 2DN7A 4LIQH 5AVVB 3GHEH 4ZUUB 4OSUL 5FM5O 1UD3A 2IGTA 3GSUA 1V9U1 2VUDA 3KHBA 4OI4A 5B2GB 5IVEA 1BQHB 2RA1A 4GAJH 5KEZA 1I9RA 3RJRA 1PEWA 4EUPH 4LBMA 5FGBC 3U4XA 4AZUA 1WHPA 4IMKA 3TT1H 4IBVA 2MQ3A 4FVVA 5KSAC 1W2NA 3ROOB 5E8NA 1LEIA 4J12A 3QUYD 3RNSA 5IVFA 3SYQA 2DBIA 3VBFB 3GMNB 1CF8L 3GK8L 3HBZA 4PGCA 3MPPG 5T1DH 4JZOB 3OAWA 5KVGL 3TP4A 3C60B 1IAOA 4JDMA 2X3CA 4IIZA 1YEGH 4XXCA 2K8MA 3L4WA 3PAYA 3G5YA 4I4WB 2AJXH 3FRPB 2ZHNA 1OD9A 3DV6A 4IMKC 2R0KH 3GXMA 4N68A 4NNYA 4AYDC 1TPXC 4YL4A 3JSSA 2GY7B 1WCUA 5E4EB 1RXGA 1KG0A 1UM5H 2VITA 4OGAC 3FQWA 2SODB 5DHYA 4JN2A 2XB6C 1S9WB 2GCYA 3CFKB 4YAQA 4MA1B 5A2AA 2AK4B 1ORQB 4ELMA 1HJFA 3DPRC 3N7MA 3T8MA 3GUTA 2HCZX 1RZIA 2ET7A 1DJHA 3DOIA 4XRCA 3UYPA 3C6EA 4CN4A 1LECA 4KMQA 1PX3A 4ENED 4IE5A 2UZXB 3TRSB 2BOJA 1FFNA 5BW7A 1BOYA 1BQSA 4X7CC 1W6NB 3O45B 4LESA 3BWSA 1NKOA 4AK1A 1OHQA 3SN6N 3WP5A 2PYFB 2Z8SA 4X6DB 1RVF2 2PWHA 3KMHA 1E57A 2QUOA 4UBGA 1NCQC 3M8OL 5DR5H 4P5MB 1ULCA 3T6ZA 3DRQA 4FFGA 2HFTA 2AJSH 2DQUL 3DK0A 3EKCA 1RGSA 1HQRB 4NKDB 3RI8A 1QRND 3T0DA 5BZZA 1JRHI 1VGEH 2FEDC 4ZW8A 5BW7C 4MA8L 2HFFB 3UBXA 3X3GH 4K7PL 1D2QA 4XTRD 1N1YA 2ENRA 2HJIA 4UNIA 4P2QD 3P11H 4H13C 2SLIA 3P3PA 4OLLA 3CD4A 4Y5TA 2JJSC 1EWHA 4LHUB 4Q8BA 3ARGD 4PR5B 3RWDB 4XP6L 3B3QE 1FYTB 3RWJB 3VBUA 3VZOA 2HMID 5JSPA 4RSUA 3MUGB 1IGMH 5DUVA 4G11A 1OKEA 4FXGB 1T2QH 1UOWA 1K45A 4I48A 3GDBA 3T8XA 1AL21 3US0A 5GLUA 1DQMH 3CTTA 4S0HA 2PELA 1EGJA 4FQ4A 1WZ1L 3MR9B 5C6TL 2B0SH 1GZTA 3VBUC 2J57A 4HZLB 1R5WB 2R2HA 4OJDH 3TNPB 2CWRA 3VFOB 1HXS3 3E7JA 4G1MA 3N7KA 2KPNA 4HCFA 2WTRA 5HYQB 3GJFH 2Z34A 4IIQB 2P48B 4LIQE 3HE7D 1U12A 3OBAA 4I0BA 3DUUA 1N3QA 4MX7A 4L8CB 1LENA 5FY4A 3BVUA 3MXWL 3VG9B 4NWTL 1AZNA 3POBA 4X8XA 1S5IL 1KT2A 3ATBA 1ZSDA 4ETQA 5JZGB 2WK2A 4UTCA 4HPHA 2DTWA 1YQ8A 4XVHA 5IMMB 1KJ2L 5T33H 3SPVA 1R1A1 3PCYA 3BP6B 3W59A 1P4IL 3P3NA 5D1XA 4RAHA 4L4TA 1MS3A 3LXCA 2D6OX 5T1JA 4JO4L 1J8HA 4FAGA 2WBJD 4UWQB 2FBJL 3SDCB 4M56A 1CAWA 1TCRB 4LPCA 3ETPA 1P9MC 5CGMA 3MU3A 4MTMA 4LB8A 3UTOA 1CPUA 4PHXA 3VM5A 1F11A 3WKYA 1CQ9A 2QVMA 2VWEC 1E67A 3IBOA 1T0NB 3HMXA 2W59A 4M7KH 1NBVH 5D1XC 3QDJE 2AQ3A 2A75A 5DF0A 1THCA 4TRPL 5F2WA 5ITFB 5IHLB 1MHEB 3WN5C 2O8OA 1YN7B 2HWB1 2O26U 2NPIA 2L7EA 2AJ3A 5A16A 3OKKA 5HHQB 5BMFL 4L3EB 1FQ9C 3UZVA 4OGXH 3WFDH 3U79A 4JDVA 1QWHA 3IJSA 4MGIE 1XGRA 3QZWA 5LQBH 3E5UA 2IPTL 1T80A 4LLDB 4LDEB 4HIPA 2E7TA 4NPMA 3CAFA 2IVJA 4S2DA 3VZNA 3E9TA 12E8H 2K6YA 4RETB 3US1A 2W1WA 2MSPA 1XF4B 1HL5A 4TNVK 5A7SA 3O41A 3S48A 4APQA 1FH2A 2N7GA 2XKNA 2QNKA 3WNIA 3K5SA 4DP8X 1XBFA 2NZ1A 1IC5L 3U07A 1VBC2 5E8EA 4OZIF 2JB8A 1QIQA 3FU5A 4MSWB 4WO4A 4N5EC 1ZVYA 3KPMB 4IGBB 1SYVB 4I18A 4MA3B 2DWEA 3BLKA 4U1NA 4K21A 3LIGA 5GZOA 1QNZL 4GS7C 3I4IA 1SLBA 5FXWA 4P4KC 4QT5B 4BV1A 4QRFA 4ZBJA 3C8HA 4I09A 5GS1B 2NNFA 1MRDL 1FE8H 3RHWK 2CMRH 3PGFL 5E1QA 4ERSH 2GMPA 2WNKA 5C8CC 5KHGA 1IILE 3CZEA 4WO4C 2WZ0A 4G1EA 4X9IA 4PJHF 2JELL 2OJZH 1ZOXA 1LE9A 4AYUA 4MQ7B 2ZONA 3QPQD 4GP4B 4XP1H 3VE0A 4XODA 1OH3A 3H3BC 1C8M2 3AM8C 3D07A 2VC2H 3FQUB 3NCJH 1HYRC 4ZFOB 1S7SB 5FV3A 3QC5X 3GTNA 3VCLA 4XNYH 3VMOA 4EOWL 1J5OL 4LOTA 2H0PA 3BWZA 2FMYA 5EF3A 3LF7A 4HAFA 4J3OC 3EJQA 1T1XB 2JECA 5FZEA 2WVVA 4GIQA 1XSIA 2IOOA 3K72A 1CL7I 3HRZA 4QX3A 4GKSB 3HLKA 4LT7A 1DJZA 3RWEA 5CILH 4H2AA 4RMVA 1TSHA 3HOGA 2DBLL 2FQFA 3FO0H 1UH2A 5C0DA 2BNRB 3H9SA 5CIPH 5C0CB 4LKDA 4E4SA 2DLHA 1AKJB 2XQ0A 3IKWA 4KU7A 1HHIB 1PIV3 4KKAC 3L4VA 4JE0A 2WLIA 4JREC 1U8NA 5T5FH 2OTWA 3HG1D 1CVRA 3HRZC 3JXSA 3B2UD 1DSFH 5CEYB 3PYCA 3PRZA 3BWUC 1KB9K 5MENA 1M4KA 3AZUA 2D5FA 2PLTA 4F5CE 4KKLD 1BVKA 3FFDA 5CFAA 4KRMB 4AUYA 5C5UA 1D5ZA 2JB4A 3BHBA 4HH9A 4JFOA 2ZOEB 3URFA 2QTWB 5KUMA 4FA8A 4MS6A 4YH6A 3U46B 1KJ2B 3T1LA 1KLGA 3I84A 5JA8B 1E2ZA 2WZ5A 3IF1B 3OR6B 2ZE0A 3GMOA 5IR1B 1VBE1 1HQ4A 4N90E 4V1DD 3EFDL 4NJAL 2CD0A 4K7FA 1JIBA 1Z9SA 4KY1L 5BPPA 1QH7A 2DQIL 3FSOA 1W39A 1RUE1 2CLVB 2YPVH 4PP1C 1TYEB 3SPGA 2QR0A 3N7LA 4IU2A 3BIAX 1VCBC 1IFHL 1ZT1B 1S0DA 5DFWH 5KSAB 3OGGA 1XTLA 2ZWKA 1OZTG 43C9B 1PK6A 2A6ZA 4PJ6A 3VXUD 4U49A 5GS0D 5BV7H 4NDMB 3QG7H 5AD0A 1KIQB 4AI7A 1CDCA 4YGEA 4E9YA 1THAA 4FPGA 4E27A 1KWGA 4OKVA 1SMOA 5DQDH 3TEYA 2VTXA 2AI0H 3K6IA 4F2MA 5GRVK 1JTTA 3IFLL 3PWNA 2AJZA 3OZ9H 1NFAA 1BQHG 2ICCA 3MC0A 2VGDA 1TPXB 3D4YA 3LSOA 4GXVL 1N2RB 1VPHA 3AMHA 4NNXB 2NW2B 5I16A 4M62H 3T6VA 4D0CB 4BA0A 5EZWA 3GNML 5GGTL 3H3ZA 2DKMA 3WS3B 2H4EA 4OQTH 3ZN6B 2C26A 4M5ZL 1SYSB 2R042 2GU9A 2RS51 5I0TA 3QJVB 4QWNA 5IB3B 1XX9C 3FRPG 4GAYB 2A2QT 4DGIL 4B3EA 3TIEB 2G9KA 2Z0UA 4YZ1A 4WCYL 1RU9H 1P7KB 1UYXA 1LOCA 1HI6B 1R47A 2DI7A 2B1OA 3NW4A 2A6DB 3ZXDA 2HSIA 1X6NA 1RK7A 3DUSB 1OK8A 2RE9A 4H44C 3QNXB 2V17H 4G70B 1OLRA 5I8KH 4NZJA 1OD5A 5EF1A 3QR0A 4KPHH 2A9NH 2CSPA 1IBGL 1PO13 1RUKH 4FKKA 3WGVB 4YZ3A 1O3QA 1NA8A 3QDAA 4Y2NA 2BM3A 2ZG2A 3ARGC 3UJJL 1ASQA 3MCYA 5DMKA 2Y69B 2HWC3 4GT7A 3BIBX 1F6FB 2CNYA 2FSEA 4FO9A 3NJHA 1HL9A 3REVA 1S9KC 2ATFA 4KJPC 3O2WL 3FUFA 4N24A 2AK1L 4W9HC 4WJ5B 1AZBA 4RFNC 1UA7A 2BK8A 2ZTNA 5CLTA 4NIGA 4LAQL 1RJLA 4NHXA 3DSFL 1HRV3 1QJU1 1B0RB 1CK0H 5T5NF 4ADIA 1FH5L 3UCQA 5KYXA 3CC5B 1E8YA 3P9WB 5FPXA 4GFXA 1RIVL 3OSDA 3A4AA 5T5LA 2EXWC 4GLRI 1VEPA 3EYQD 3KJ4C 4LHUG 4A2HA 4UNTA 4ZMAT 3W21A 4E8CA 4NYLB 4HJUA 4YEFA 1VADB 1MJJA 3FAXA 1VBB1 5T54A 1GY1A 2FK9A 5DT1L 3KLAA 1NGPL 4H5SB 3CFDB 1HJBC 2G5UA 2Z8RA 4U1GC 4YUEH 4ZW3A 2R1WB 2JQAA 1EEZB 5IYYA 2DFCA 4P5RA 2WWUA 3RVXC 3V4PA 1QKZH 2ESVE 2XY2A 4EVNB 3LE0A 4Z0XB 4QB2A 1MFCL 5HJBA 1JYXA 5ALCL 1J59A 4KUZH 1XIWD 3AKQA 5I5RA 1ZWIB 4FXLA 1D4M3 1NDMB 3K8MA 4HUWB 2FQDA 1N26A 1OOWA 4XVOA 5IB4B 3MX0B 4PJBB 4F57H 3NK4A 1FV2A 5K1JA 1TTRA 4LNVA 1O9ZA 5HHOD 2A83B 2GJJA 4S2SB 2GT9A 3GM8A 1K3IA 3GXPA 4MQXC 5DRZA 3TCLA 1S0JA 4A63A 5BNQA 2PCXA 4PJCA 3PWJA 2QBXA 3ILRA 4OFIA 3BUTA 1P7HL 4PJ5B 4DXTA 1FNFA 1HB3A 3MCG1 3QDGE 3QNZB 3EF7A 3WNMA 2GNBA 1SOXA 2DD8H 1PHMA 3EDKA 1YEJH 1LILA 4WWKB 4D7YA 3FT3A 2NZ9D 4PU2A 2FWUA 3VXRA 3CVIL 3O3EA 1LP9E 1KIPB 4XBEL 1UD4A 5L2KE 3D82A 4JC1A 1KEML 1WS8A 2A5ZA 4Z0BH 3VBOC 4Y4KD 3GSQB 4ICXA 4XILA 3HPLA 3H3PH 2IGLA 2QHLA 2X5IB 3B37A 5F1NA 1AI1L 3HNSH 5DO2C 4EZLA 5ESVB 2QJVA 5FM8A 4FLQA 3IU4L 5KR7A 5CFDC 3AVSA 2PCPB 4NQUA 3SGDH 5HXMA 4JHUA 2R071 1YEWA 3G08B 1KFGA 4D7BA 2B5IB 3I6LD 2CUMA 3J7HA 3OJ2C 1YC8A 3QBTB 5SWZE 3ZL4H 3U0PA 4X8JA 1OSEA 1MS5A 4S2FA 1OWWA 1WEJH 1WQVT 2X87A 4QPWA 2BC4A 3ZYRA 4N0CC 2CQVA 2RDSA 3DX6B 4OGQC 5IESH 5I0ZA 4MNQE 1IKQA 3KZ8A 3BGFB 3OJVC 4OJEH 2IADA 2VDKH 2XPGA 1LDSA 4O2EA 3U2SA 3GXDA 1CXEA 4HUXB 3NSYA 3ILDA 3WD5L 4IE0A 1YNAA 2FYYB 1ZA3A 3V4UH 2WQAA 3BPOC 2NY5C 3HS0A 3NEXA 1YEDA 3NZUA 4GS7B 4F7EA 5ERLA 4N9IA 2CDFA 4P4KB 3ATEA 4M3KB 1JMUB 4XQWA 4Z6AT 2DMCA 5KYYA 4FOVA 3I2IA 1KTKE 4G9DB 4OYUA 1LM8V 4OIFA 4DKTA 1GQPA 3ZTCC 4WV1A 2XBO3 3WFBL 5C8CB 3IDYC 5F7HA 2CV6A 5ESQB 4GSDH 5TDNB 4P5HA 4I77L 3HOBA 4JKLA 1Z5LA 5HDWA 3D34A 3D50A 1ED3A 4Z7WE 3HS9A 2W52A 2N0MA 2WWKO 5ACZA 3JBG7 4NSKA 4OLYL 1N59B 4P49A 3S34L 1RUI2 2NM1A 4PJGB 4Y9BA 1FO0B 3FT2A 2BIOA 4B27A 3D3VE 4R7NB 3TF7C 1IGTB 2FGWL 3QQDA 1T1YB 4UBHA 4LXFA 4HGWB 5E56A 3DYMA 4Y1AB 3WTVA 3O2VL 3DGGB 1JUFB 4ZOAA 1DYOA 3D4CA 1QBBA 4MLIA 1FHGA 3GBEA 5E1GA 1IGYA 3MODH 5LZ6A 1HWWA 4IKJA 5EBLB 4D8OA 4BWWA 4X80L 1FN4A 1CL7L 4HGMA 4MFHA 3AVEA 2DCKA 2XFXA 5SV3A 3DXAA 3ZXKA 3LAFA 3KBEA 4JREB 3SYCA 1RUG1 3VHPA 3SOBH 3US9A 1T66D 1HXKA 4OHXA 4KX7A 4HVBA 4K20A 4DHLA 2QT6A 4GAFB 3DWTA 2UZYA 2OL3H 3FUEA 1TR7A 2YRZA 4JLRA 4ZT1A 3VFVB 3UH8A 5JXEA 5ISZE 3LV3B 4YJZL 1QJZA 4OHYA 3MFAA 1YNTB 5C6WH 4WU5B 3S96B 3QOPA 1WZMA 5E94A 5LGJA 3QUYB 2FO4B 2B08A 4BWUA 2HA1A 5EBWA 3IWVA 1LGCA 4MJJA 4LNRB 4H7LA 3V6OA 1OPGL 3I3EA 1MCOH 3MLWL 2WNGA 4KKRA 5DJCA 4JGYC 1P7QD 4L11A 5DAXA 4FQXD 3T4HB 5C2UB 4JM2A 1O4ZA 2XJLA 3QJZA 1IL1B 4TULL 1JN6B 1F1DA 4XBPB 3S35H 1LB2A 1ZBE2 2ITDB 4IBUA 4LCWD 3KM2A 5DS8B 5E1IA 3U9WA 1Z9MA 4KXZH 4BHUI 4G9SB 4PRHD 4KBZA 2CLRA 4UQ3A 1Y9GA 1CE1L 1ZLSH 2VLJE 5TK2A 2HFGL 4KKNA 5D6DC 2X70A 1Y1DA 5ENWB 5DG2A 2ZTBA 2VCBA 5CR8A 4ZUWB 5JCTA 3ZOIA 2B59B 4Q4V2 1OUSA 2A7AA 4CP2A 3VV1A 4K7JA 4JM2C 4LLVA 5DEFB 5FAXA 5FWJA 1ZHBA 4XO9A 2DS4A 4XPAL 4NZFA 3QIWC 4EIBA 5HD8C 2QVTA 4BQ6A 5F89A 3X3FL 4X4XA 3PXJA 3FMGA 2IANE 3S7EA 1KOAA 3PS6A 3HQXA 3VDCA 3ZFGC 1JWSA 3WXVL 1F15A 1OB1A 4GO8A 4MOAA 5J8OA 3ABKB 2J12B 3A4DA 1J9CT 2X28A 4AMKL 4IK7A 2WQ8A 3BRGC 2JG9B 1CWPA 1TIUA 1AQKH 1TEGA 3FSWA 2AHIA 1INEL 1QRNB 5IVXE 3KWUA 4X7SL 4GJZA 3QRGH 1F2XK 2AVFA 5F7YC 5IOPB 1T4KA 5CS7A 3U9PH 1IU1A 5HPOA 4W9LC 4GG8A 1BXHA 1JYVA 3I75A 2XIDA 3N55A 2KZ1B 5KSBE 3ARGB 5IREA 5FUCC 3BKZA 4LK4A 5JQ6L 4XAKE 4M4RB 3JD73 3FL7A 3KR3H 5FHAH 4K5OA 4UT6A 1GZHC 3OY8B 4QQ2A 2R0ZL 3K3NA 5BJTB 3VM7A 1OLME 5GZGA 1LO3H 4GMTL 5DUBB 1OA4A 3SCMD 5SX5K 1N67A 3EG9A 5IP4A 3A4FA 5AYUH 3MNVA 4Q5OA 4YHKL 4KUCD 3THML 3MLPA 2DQEL 4JFDE 1LHVA 2GAUA 5AC93 4QLRA 2ADGA 2XWJA 2QPDB 3EYQC 5L9DH 3IDXL 1EZUA 4XE5B 3T1FB 1CVNA 1R3KB 1ZDSA 4RMUA 2D6PA 4NO5A 4KVPA 1S0FA 2ZAAA 2C9VA 4YSCA 1A2YA 1CFTA 4EN6B 3JTSB 3HE7B 4IW4C 4JL1A 2QSVA 5ESAB 1WLWA 4LRIA 2KERA 4PJ9A 2VM4A 5IQ9B 5BQDA 3PJSB 1QW8A 2EKJA 5CU5A 4RQPC 3BD3A 1AR91 3ZTDC 2MH4A 5A7OA 1Z3GL 3ABLB 2MQ0A 3GSXA 2EYSA 3TYFB 3SQBB 4NN7C 3OKDB 1S9YA 2L3BA 1L7LA 1MVYA 3QJHB 2Y6SC 5BS0A 2M2DA 2KPWA 4AHXA 4AMWA 3L4XA 4LRIC 2XH6A 4ANKA 2CCWA 4PJ9C 5KBKA 3Q6GL 1EO5A 3NFSL 4XB8A 4AJ0A 4HJJH 1DJSA 5I71C 5E08H 2DH3A 4HIHA 4F92B 2NSXA 4IEOA 4JY6A 5DZEA 1IKNC 3ZIXA 2PFWA 2HJKB 2W38A 5GS0L 1SDAB 4K3JL 1FNAA 3TVMA 1UXMA 4D3CL 1QQP2 4I01A 3PJYA 1F8TL 4YGAB 2BSRB 4IDZA 4CP9B 4AJVA 2Q4SA 1BSIA 4NMIA 3JQWA 3OVUB 4PGZA 1J9RA 3BKYL 3IVKB 3KGLA 5FOJA 3DROA 3KPRA 1JDDA 1BEV1 1UNBA 4XMZA 3DV8A 1X9RA 4GJTB 5CFHA 5AOZA 2ZNXA 4AM0Q 4L0PA 1T21A 3ZTJH 2HWD2 1LP9F 5EIIA 2DQTL 2ZAHA 3VBOB 2VXSH 2J73A 1DQ6A 1UENA 4JPKL 4UT5A 4PD4J 1C8PA 5E5UB 4A37A 5TK4A 3ILPB 3PWLB 2GSIB 4JHVA 5GSRA 3ZIMA 2Q1MA 2F8IA 3ARBD 2Y34A 5K0UA 4FDWA 1KBGH 5CFDB 4PLKC 1WH0A 1JCVA 1PLCA 1XSJA 5LK5A 4B7KA 3MIDA 3QHZH 4YW6A 4Y20B 4JW3A 3O2DA 4XF9A 3N1QC 3NIDB 4K7PX 1KFUL 1JGEB 4LLMA 3PUCA 4FULA 3FB8A 4Z3GA 1NCRA 2EDMA 4M8UA 4Q1RA 2HLEA 3IM0A 4ODTH 5TH2B 4QXKA 1EAQA 2XXGA 1G5AA 5HJGA 2ZD0A 3IMUA 3EYVB 3N44F 4JFEB 4P05A 5FJKA 1N9PA 1YUHA 2EO7A 4NHCH 1OOPA 2Y3NA 4IRJC 2KZKA 3NCYS 1B6DA 1NCRC 4O02A 5CEHA 4U4BA 1FORL 4XPTL 5GGUB 1N1SA 1M6OB 4J39A 4TSBL 1AGDB 4KO5A 4Q58C 1C5BL 2OTPA 1MRFL 2YPLA 5FXCH 1IM3A 2OPKA 2CO2A 2QGCA 4ZD3H 4TUOA 1REFA 2BVEA 1ST8A 4ICWA 3ZRFC 3T0AA 1W9XA 5I8CA 4K3EH 1DQJB 1YEIL 5J0BA 1A66A 2A3XA 4EDXB 3RUGB 4Z7WF 1NJ9A 3RZZA 1JGVH 5TTRA 1EJ6A 1XHHA 3OHMB 5EEYA 1VAMA 5E1HB 4P2RE 3BVCA 1HL8A 2ZWZA 3D0VB 5C0AD 3QI9C 4LLWA 2PPCA 1IAIM 1B9ZA 1X9QA 2EH7H 2OKMA 2OMUB 3PGDB 3KPSA 1DZBA 2DUQA 5DPNA 1MJUL 3B9KA 4WEUD 4LBQD 5FZGA 4M5YH 2BZCA 1S0GA 4AGQA 4Q9QL 5I5MA 4LL4A 1F41A 4H20L 5LBCA 1AGBA 6PAZA 3ACHA 2IO5A 1C1LA 8PAZA 1RKRA 3C6LD 3BQUD 4NN6C 1PZ7A 4J3OG 4GW4A 2WYHA 3IBMA 1F58H 1DSYA 4U7SA 2OR9H 1FG2B 3HNVL 2WXIA 1P5UA 2WXGA 4BSWA 3WG3A 1G9ML 5DK0B 3AXLB 3CJIC 3WINE 3AG2B 4OFQA 3SKJL 3ZDZF 4EBQL 3FFQA 4CCDA 2UVEA 4KJWD 5DEGA 1BPVA 2NY1D 1CN1A 4P14A 4BK8A 5CWSB 5TSWA 1F97A 3V9CA 1CU4H 3D8MA 3LMJH 3VYOA 5KTEH 3LZOA 3AQZA 3MBWB 4TSAL 2WS93 1CTMA 1Z9LA 1P5UC 2C5DA 1MS9A 1WFIA 2Z4QB 5FXXA 3HC3L 5GRJH 4A7UA 1BM3H 3KBPA 3IPVB 3VXUB 2Z91B 3CH1B 4NXKA 4WW2A 5T5JA 1KNOA 4YMPA 5IT2L 4HHGA 1NZRA 1OCWH 3IMBA 7CGTA 3DSNA 4CCJA 1OAQH 4J23A 4QF1B 3RWHA 5DLMH 5IMLA 1TVDA 4HMZA 1IQDB 1NGYB 2C5DC 5FMOS 2ZUSA 1FLTX 1N0XH 3NV2A 1U2YA 4XWOD 4K9EH 1A14L 3N6YA 1JTZX 1KB5H 4KWJA 3MFCA 4W6XB 4BGLA 3PUSA 4UIMA 3C12A 1BREA 2BDNH 3ZZLA 4R7DB 4JR9L 1EXUB 4Q4Y1 3WFEL 3ACFA 4PJ7A 1NCTA 1D9KD 2X9XA 2WHVA 5EU3A 1ULPA 4QKNA 3FB5A 1V6OA 2HT2D 5D7HA 4AF9A 4WHYG 2YC1A 5K39A 4WZ9A 5IHHA 4CP0A 1W8TA 3Q8AA 4P46A 2IXLA 4B4PA 2QQPA 3QIWB 3BZ5A 1V6NA 1G7PB 4CEWC 2GMMA 1SY6H 3INOA 3N1FC 3C5SB 1CTNA 3WW4A 2FVNA 2JSFA 5EPMA 4J6IA 3U9UA 3ZFGB 5I2IB 1JJUA 2BHUA 2LFGA 4OFGA 1H9PA 1MXDA 4NRYA 4DS0A 4NKMB 2DM7A 4MGKE 2Q87A 5JLZB 1ZZ8A 1PZBA 2VGLM 4XDPA 4A3ZA 2AK4E 3EYSL 5FP8A 2PO6C 3QFDB 2EDEA 5IVXF 3J2PA 1ZGLA 1G7JA 3D9AH 4BFEA 2V6HA 1J8KA 1YYNA 3MRRB 3PQYD 2PYTA 4XVTL 2VO5A 1OF2A 2Q6WA 1M7DB 5KSBF 5J3HC 4W9IC 1YCIA 2K0GA 3OUHA 1EEYA 2GJ6B 1ETB1 2JD9A 4Y4YA 4BFIA 4X6DE 4PRBA 4MDIB 3BOVA 3RJDA 3D39A 4LUKA 3JUYA 1IBBA 1TOXA 3L7FA 3WDHA 2WC7A 4MAYA 3A4UA 1SLLA 2BWIA 3EFFA 4BMEA 3JB4C 2F58L 2J20A 2H2PC 1AGEA 3K6NA 3FU9A 2HT4D 4H0GA 3QPXH 3Q7JA 4UQ2B 1NA1A 4XW3A 1IZ3A 1Z7JA 4WI7A 1C5CL 3CFCL 3H54A 4NWWA 3D69B 2IXJA 4FTSA 2C9RA 4DFSA 2FD8A 4MUVA 3Q2CA 2YBRA 1GP6A 5L73A 2B1AL 3PWVB 2YXVA 1E42A 4MAYC 5CCHE 1S6NA 1FYTE 2FX7L 2XZCH 3RPKA 2HT3D 2APBA 5JMOA 5GPRA 2R69L 2NW3B 3MV9B 4LCCB 1RJYB 3G6DL 2MPAH 3MV8E 3T6QC 1HL4A 1S0IA 2Q0AA 3BU7A 3H8UA 1OF0A 4HJGB 2BVPA 1T7VA 1EDHA 3MLXL 1XIWB 3WY1A 2ALWA 3MA7A 4EQVA 3GMPA 4LQFH 4I0AA 4NN7B 3BVDB 2CM6A 3IB3A 3V5HA 1BOGA 5C6PB 1U3ZA 5HHOB 4CUGA 4R4FH 3S5YA 1RUH3 1UADC 4PJFA 4CC4A 3NKGA 5G4OA 3TBWB 1R083 1DGWX 5FWEA 3HI1B 4TNGA 5CLWA 4UB0H 5I76A 3L6FB 3QORC 2LU3A 5I71B 4RR3C 2BIPA 1RHHA 1UWGL 4FOWA 4MSVA 1TQCC 1E9QB 3EADA 3TEWA 1W8EA 1NANH 2IBBA 4BU2A 3LRSA 2Y06H 2Q2EB 4YGBA 1QNIA 2NCMA 5EO0B 3S0MA 4MADA 1BK0A 1FVEA 4Q2ZA 2Z92B 1KCSH 1HEZA 4NIYE 1YPZA 2R0HA 2D43A 1JFQL 4DPNA 4LKCA 4LSTL 4HG4K 1UVQA 4GSXA 4HJSA 1CBVH 1VZHA 2YHGA 3APMA 1CS6A 3QXAA 1B35A 4A41A 1I4FA 2BPBA 4XPHH 3B6SA 4KWUA 3MRKA 1XC6A 4PIXA 5F7LB 2D4FA 1UXZA 5LK7B 1A6ZB 4IEWA 3MRIA 2WKOF 1TLKA 4LO9A 4Y8AA 3AJ7A 2CSGA 2PYED 2EDDA 3PABB 4L0ZA 4YRDA 2EZ0D 4QHNA 4M0HA 3SBWA 4NGHL 1DEEB 2J88H 2K7QA 2PAEA 4FF9A 1ZLUK 4A6YL 2A6JA 3NCMA 4PREB 3IJHA 1EZVX 1VERA 4AC2A 1H4HA 2CDPA 3NNLA 2CM5A 3BW9B 5F6HI 1HX0A 3EYUH 2YUVA 3LPPA 3GS7A 1RHFA 2F7OA 2WNXA 4JRYD 2BSEA 4AIEA 1ZLEA 4NQDD 2BU9A 2UYAA 5K9YA 3W20A 2H26A 2VJ8A 1U8LA 1I1FA 3RGVA 4JN1H 1KTDA 1NCWL 4OD2B 4M1GL 4NQSA 5AVQB 2AW2A 3OXSA 1DVFC 2PW1B 3KNBB 1RV6X 1Z7S2 3ON7A 1YA5A 1BIIA 1FC1A 2O5XH 1MJ7H 5AAMC 2XQRA 1HHGB 2YBGA 4Y4FD 5JO5A 2R6QA 1WJ3A 4KJYB 4FPYA 2ZUQC 1R3JB 2C4FT 4DKEH 3ULAB 1UCBL 3HNBM 4Z82A 2GNDA 4TSCL 5MI0C 2JI1A 3KXFA 4G80A 2E7BA 1PM4A 3VBRB 1AD0A 5KC5A 1RXLA 3FWEA 4AG4L 3NA4A 3D05A 2RR13 3ILNA 4TOYL 1AYN1 3BAJA 4WIQA 4MMXA 1VB4A 2WIIB 5FZDA 3H8XA 3U2IA 4AGMA 2UYLB 1CDBA 4ZO7A 3W0WE 2Y6FA 3AS0A 4MB1A 5I1AA 4MB3A 3LEMA 2ARBA 2Y8KA 2Z8VC 3QWOA 5IVXA 4KKPA 1UKRA 5BNNC 3MBXL 1UJ3A 2GITB 1DVUA 3ARSA 5I1DB 4META 4Y26A 2ICWA 4EJ1C 4YX2L 3OGCB 2X0WA 4JE4B 1XNAA 2ZCKL 4MMXC 3L9RA 3RVHA 1ZRDA 1AACA 3I9GH 3U48A 4G8EB 1AYM3 3K3OA 5EZIL 1TTFA 1BAFL 1WFUA 2W0XA 1DP0A 1GLHA 4RRPA 1LTEA 2VLKD 2X4RA 1A8DA 3QEUB 3IU3A 1R19A 1F3JA 1JPFA 2IWGB 4NN6B 4ELKB 3F83A 4OVEA 3UAJD 1RB8G 1UJ3C 4U6YB 3V79C 5GGQH 4PTUB 1JG9A 1X4XA 4MXQD 1G9AA 1SJHB 4XPFH 4N2KA 4MMYA 2DCJA 2O6CA 3B1TA 5CM1A 5KSVA 3MLTB 4XHJD 1EUTA 1FVDA 2LE9A 2BNRE 3CVHB 5EOQL 5C0CE 1R0AH 4QRSA 1XNKA 4IL7A 4UFIA 1XGPA 1BV8A 1FL5A 1LD9B 3MO1A 1UTDA 2QQIA 1ZPUA 4LHKA 3CH8A 3SHRA 2J8OA 2IALA 4H1LB 3RB5A 3BI9X 3RTQD 1UA6H 5J1AA 5SWSD 4UI2A 4M00A 1P7QB 4ECNA 1SHSA 1DQQA 3MJ9A 4UOW0 2CRYA 4WI5A 4Q4X1 5JDJA 1S7TB 4MMZA 3CFBA 3CNKA 4EDWH 1EFXD 3DTUB 2G4GA 4NFDA 2XJVA 4P5YA 2RG4A 4LQ1A 3V8CA 1AJ7L 1TZHA 4JANA 5EF2A 3BD4A 4PRHB 1RHI2 2O0OA 2CNZA 2CRMA 5C6CA 2JF1A 3I50L 3GMNA 5DURD 4KZEH 3G04B 2OW7A 5B1JA 5CXPA 3AS1A 5LLIC 3C60A 5IV2A 2FDKA 1H15B 1SLWA 4RYDA 1EGJH 4X5PA 4EPSA 4BZ2L 1O3TA 4MMZC 3P3UA 3TN91 3U0ZA 2WC2A 3A21A 2I69A 4CDGC 2LHAA 2BBAA 4A6YB 1JZ2A 1IGJA 5JSOA 4C57C 3I2CH 3IYLW 3QSKB 5FGCB 3LFIA 4GXLA 2H5UA 1RUC1 4FI9A 5AQ0A 1CFSB 2A3WA 1HKDA 4CEWB 3WEAA 2PR9A 3MVSA 1BWMA 1ORQA 2Q1FA 1LEKB 4EN0A 2ZX0A 3LHAA 3AWGA 1ASOA 3AGWA 2IFFL 4HDIB 4YLQT 1X6LA 3UYOD 3LDRA 2UZXA 3NJGA 4NQEB 5DC2A 2A4CA 1UATA 3LB9A 3C7FA 4LMQI 2FWLB 2HB0A 5JHLA 5JDBA 3VRIA 2DLFH 2EYRB 3J27A 1N6QL 4P5MA 1EV11 5DC9B 4ZFGL 1L3JA 2XWEA 1OB0A 2IQAB 3EUUA 4ZKTB 4H55A 3O7OA 2GY5A 2DQCH 3KPLB 5EU5B 4LSQL 3OF1A 2F53D 3SCMB 3VKOA 1Y18B 1P2CA 1HSAB 2HFFA 5HHXH 5FYLD 1ND2A 2WSVA 5AG8A 2XDHA 1WG3A 2MNUA 3CX5K 5INDB 1LU2A 1PMHX 1RZ8B 5HYEA 3SBRA 4DEQA 5HYSA 4PR5A 2CO1A 3RWDA 4F24A 2FJUB 4POUB 1H5BC 4Y5XC 2VU9A 4HBCH 1CJPA 4K5MA 1ZT7B 2OZ4L 4OF5A 5GHWH 1SFDA 1P1VA 2WZPA 1PS3A 1HH9A 1COV1 3EZ8A 4FXGA 1TTAA 4XMKH 1RCYA 4NROA 3HZVB 3NGBC 1FA4A 2HKXA 1X4ZA 3D85A 4S10A 2VW6A 1NPNA 3E5QA 4FI6A 1OCZB 1WICA 1M7IB 1UACH 3OKEA 1Q4NX 4ZK8A 1NX9A 5FPAA 5IW6B 3MR9A 2VQ1B 3EO1A 5H9RA 4G59C 1WFMA 1U8KB 1L7TH 2Y1ZA 1D7DA 3DX1A 3JBG1 1BD2B 3E6DA 1TME3 1HWGB 2JQZA 3M1HA 1A1NA 1YN6B 1T7YA 1YJKA 4IIQA 2H0VA 3PFQA 3I59A 4ZSOA 1KCUL 3WIHL 3FQYA 3I9IA 4L8CA 3X17A 1BZWA 2IXCA 2V5DA 3J4UH 3GZTB 4L2LA 1W2TA 5IATA 4KVNH 1L9NA 3VFNB 4HWBH 3L5XH 2FCTA 2AUYA 3MLLA 4ZDHB 3V0BA 1MFBL 3QHTC 3AMMA 3QORB 4IV1C 1QUNA 1WZAA 3GIZH 1FO0H 1XO8A 2OXHA 1FGNL 2VMHA 3P9MB 3X14A 4J3OH 4KGGA 1DBMH 2YAFA 2A77L 1DE4A 2XTJC 4U3XA 5CHNA 3WLWC 5JOFA 2XLFA 4MASA 3A0NA 2CJUL 1HOCA 5KWRA 3EF4A 3H50A 5A1FA 2IXKA 3FUNA 4Y19E 2PTMA 1UJTA 3SDCA 3L3DA 4AOCA 3X2QB 1YI7A 2PQSA 3DJSA 1XQ4A 4PJBE 1O75A 1AR71 2PKDA 2XU9A 1JNLL 1BMGA 1TVBA 5JPMC 2OKXA 2VDNL 4NPYB 1A6WL 3ARBB 1W2OA 4L8SA 3QEHB 4CPBA 1YN7A 5CD3B 3U6RB 3TA4D 2DV9A 1FLRH 1SOKA 2ERJC 2YMXH 5A7EA 2Y7NA 1ASJ2 3N3EA 4PBPA 2JK5B 4P9XA 2G2PA 4HV8B 3ZDSA 1IGCL 3PLQA 2VWEE 1CTOA 5FUOH 2A0LD 2K6WA 5D1XE 2NY3D 1FOD2 3F7VA 3FRUA 2QQNL 4LLDA 3V55A 4ISVA 5CSZB 1YJDL 4Y4RA 1D5XB 4L8SC 1MOEA 4N25A 4YXLH 4I3RH 1KIRA 1OGAA 2RBLA 1XCTB 1XF4A 4M1DH 4R90L 3IEAA 2F8OA 1PNGA 4JFYA 3VXSD 4DO0A 5IQLA 4CMHC 4XVSH 4Y4HD 1GJWA 4ZXEA 2DLGA 3NA9H 2KL6A 2B42B 4UF0B 4QHUB 2EH8L 1F5WA 1OAUH 4P3DB 4DTGL 1X50A 1JGLL 3O0RH 2J7MA 4H8WL 4HPOL 5CZXD 2ZUQB 5GGVY 4LBLA 1MAJA 3GF6A 2E8ZA 3T4YA 3GUFA 4J27A 1GR7A 1ACCA 4GMSH 4X5LA 4F7PB 2DQJH 1MZEA 3R05A 3VD7A 1KBKA 2X05A 1O5DT 4N20A 1HZHH 1RERA 3MIHA 4RAVA 1FPN3 1G7MB 1DVYA 4OB5L 2ATPB 5CINH 1HB1A 4NX0A 6FABH 2DWRA 4MQ7A 1JL8A 2MIZA 4F9PA 1ZIAA 3V6ZA 4L4VA 3L16A 4HK3J 1VHPA 3EOYG 4W6YB 5F96L 3WIIH 3OL2A 4YG3A 1PZUB 5JHDD 5DWUL 5DDJ1 1URXA 1XR8A 1ASPA 4P59L 5G4NA 4XYXA 1F1GA 3QJRB 4Q4EA 2WLMA 3BUIA 1H19A 2V7NA 3SSGA 3AROA 2AABH 1DN2A 5BNNB 1M1XA 5IROD 1LE5A 1T1XA 4LBEA 3ACIA 3F12B 1W72L 1CZSA 2ZGPA 5HI0A 4F9PC 1S7QB 1OMIA 5I8YA 1BDYA 3TN0C 4YO0B 3ZE2F 4NQCD 3FT1A 1RVFL 4IMLB 1OVSA 3QVAA 2Z1PA 2Y7OA 3W2DL 1H0DB 3GRWH 1DIWA 1NGQL 3WEOA 2PMZA 5TPWL 4PJAA 1EUUA 1OAZL 2XQBH 2BQPA 4A6SA 3LNGA 4Y1AE 2VTFA 4MBOA 4MS8D 3IAQA 1S8DB 3BAWA 2OS7A 3W58A 2X2IA 3PWUB 3CN2A 3H1WA 3AXDA 5H2BA 2FWSA 4DN4L 4M7JL 3IMNA 4NQQA 4AKPA 3SB3A 5B8CA 4GY4A 2PHTA 4XABA 3LCPA 4KQ3H 2JLLA 3PNWA 4FA6A 1MLCB 4OBSA 1RUD1 1OO2A 2OMTB 1HKLH 1JHKH 1KDMA 5J57B 4IERA 4WHTA 5HJDA 1N19A 2OQJA 2JI2A 4KTGA 2CLVA 4PJXB 5H4YA 4PB9H 5I1JL 1ZT1A 3QCVH 43C9A 1XR9B 3WTSA 1GQGA 4FNLL 1LMKA 2YXWA 4ODSL 3WV0A 1CONA 4BA6A 4H1LG 3O1RA 3O81A 4HIJB 5C7XH 4PJYA 4XZUA 4CDWC 1MNNA 1RIRA 2VDNB 1MCWM 1TJGL 2DMKA 5LAXB 3FNKA 2YFOA 2B20A 3ILQC 2RGSA 4UQAA 1YMMD 1MFEH 1ET7A 3N40P 1I3VA 4MXWH 4QD2E 1CLZH 4YWGL 4A7TA 4XURA 3LKNA 1BBT1 1Z78A 5BVPL 5A7WB 3LAGA 1N2RA 5I8OH 5IJVB 3N42F 1N10A 2W0FB 4K0OA 4K23H 2C9KA 1ADQA 2I45A 3CSYB 4G8FA 2H2SD 4JRXA 3SE3C 3CN4A 2IZWA 1F42A 2X1XR 3CFEB 2Q0ZX 4XNXL 2EIJB 4N2FA 1OHZA 4RS5A 4GAYA 1YNLH 2DTML 1E2WA 4EF3A 4R7XA 1VBA2 2YK1L 4WI2A 3BVNA 3QIUA 3B34A 4F7CB 4YFEA 3IXTA 4F8LA 1BZ9B 2GSGA 1NTDA 4YDZA 3SDDA 4ZNEA 3DUSA 2A6YA 4OI1A 1MIML 4WVRA 3BT2H 4CRQA 3NACH 3ZYGA 2V9RA 3L4ZA 4NUJB 1OQXA 2EIDA 3D33A 4QRUB 1I9IH 1ZLVK 1Q0YL 2FL5B 4RS5C 1RULL 1MPAH 1PDKB 3SKOB 1GKBA 3C2SA 4NIAA 4J3VA 3WZ1A 1DDLA 2H6PB 5F7UA 3ZXFA 3SDDC 4PPTA 1FIEA 1QRNE 2X0UA 3X29B 2R1YB 3W11C 1ZJBA 2IG2H 2VW4A 5KXCA 7PCYA 3VXNB 1I8IB 3MYZA 4QXGL 1P8JA 2UWEE 2WINA 4PV9A 2APTA 4WJ5A 2X10A 4GEIA 1QFUL 4LCVA 5E6ID 3U30C 4ALAL 4ANUA 2R23B 3APFA 1MI5A 5D4JA 1ZZ6A 3WJJA 4TYUA 1DF0A 5FK8A 2ZOLB 1J18A 1LQBC 1GAFH 3AU1B 4Y2OB 2NOYA 3NGBB 2JG8C 3QG6B 1C1FA 1ROCA 5F72S 3MV7A 5A6LA 1GY2A 2X1PA 1HH6B 1NKRA 2DYPD 4Y9CA 5EFIB 4H7VA 1HXMA 2NY5H 4HPYL 4U6VH 5C0IA 4IEVA 1LEGB 4NYLA 5K9QI 1VADA 3E3QE 1W6MB 1PGW2 4NBXB 4MD0A 2X4PB 3DECA 4L23A 3WJJC 4K9JA 4EZJA 4IEUA 2CLZA 2BRRH 3CLFH 1W0OA 1NLBL 4JG1L 4JX0A 5I1IL 1XGTA 3R0MA 3USUA 1QQDB 4MJ4A 1KEGL 3K4AA 4EVNA 4Z0XA 4RDBA 4UTBL 2OYZA 3SDAD 1ES0B 4E4DX 3V9EA 3VSVA 3SISA 4OQ8A 3O1PA 3TO4C 4IV1B 2XN9A 3MUY1 1M53A 1CGUA 2FJGB 4HUCA 4PJEA 5D8AC 3G6AB 2A83A 1PZ5B 1PFCA 1U8MA 2XTJB 3EJSA 3RNQB 5KBDA 3V5DA 2P24B 3Q6FA 4IKLA 3WJMB 3WP4A 4A7KA 3WFCL 3HPJB 3IJEB 4E9LA 4PN6A 3AZWA 1UZ6E 2A6IA 2QSTA 4PJ5A 1A3RL 3MROA 3PWPA 4V2CB 4KTEL 1SACA 4HXAH 1SMVA 3U75A 4XP5L 2H8PA 4PFEA 3A3YB 1R3IL 1U92B 2DRUA 3CSBA 3LRLA 3O8XD 4X83A 2R2BB 3KLLA 5EG6C 4ZI8A 1LOFA 4M3CA 3CDGA 1V6JA 5FYYA 3ZSLA 2VQ4A 2X4TB 5FCUH 5JPMB 3VI4B 3KCPA 1D0GA 4JFXB 4BK5C 1IPJA 5LA9A 4GQRA 1ZPLA 1X5JA 4UM8A 5T1LD 5MP6L 2X09A 1A7NH 2GK0B 4MVTA 4YXKL 4E2QA 5AVWB 3IN2A 1DGWA 1LOFC 1MF2L 4JFPA 1LOGA 1CFNB 2COVD 3QRBA 5HYIA 4XP9L 4Z92B 1K8IB 2VCCA 2Q9OA 4Z7OE 4BINA 4R9DA 4PBXA 2Z31D 3X12B 1RZGB 4DP0X 3SYOA 4TNVF 3G08A 2XKPA 3JV4A 3DURA 2I60L 1YECH 4X5WB 1B4LA 1SF3A 4RGND 3SCFA 4GQ7A 4TLFA 1RFDL 3PIJA 1ZBA2 4ONFH 4Y4FB 5A32A 2QVFB 1GGIH 2NRDA 3II1A 3VXRE 2J8UB 4CMHB 1MLBB 5EU6B 3RI5F 5ANQA 3O1MA 3STBA 2RM22 4NHUA 4LSVL 3NIDE 1YEFL 1P0SE 4TQEL 1XF2B 1RVF3 4G6JL 1PJ9A 3PHOA 4HUXA 3S37L 2ZZUT 2HWZL 3UTSE 3UEZA 1KBPA 3O3DB 4WU7B 3FH5A 3GBMH 2AGSA 5KJ4A 3VD9A 4EI0A 1UZYA 3UZQA 1QXPA 1COBA 3RL2B 5SV5A 4N9GA 3HR9A 5J89A 1B2WH 4G9DA 1OAXH 1QX1A 1RJ7A 1TZIB 1EXGA 1TENA 4JFEE 1WO2A 1PGL2 4DK6A 5ESQA 4GUOA 1MHPH 4WFFE 5GGVL 1OPMA 2MQCA 1I82A 5D9SB 4ORFA 4E2GA 4CADB 4JQVC 5J96B 1MG2C 1JK8B 5G04L 4NRZA 3AQDA 2W68A 1B88A 2B14A 3G9AB 3FUMA 2N56A 3KG5A 1JN2P 3H7YA 2AEPL 4YK4B 3HBKA 1U8IA 4PJGA 4Y5YC 5A6QA 3IRZA 4ODWB 1TUPA 4GRWH 4OUUB 1WCDJ 4S0SD 2D7MA 1HCYA 2VLKB 3NP3A 4MZUA 4XH2A 5AW5B 4XTPA 3DGGA 4ODUA 8FABB 4NQXB 3PF2A 2VZPA 3SITA 5FTTC 2E7MA 3BVTA 4MWFB 3RUGE 1M2OA 1E27B 4I85A 3V5KB 3ZDYF 1Q9WB 1U5ZA 2VBBA 1KDIA 3SKNB 4C0BA 3FMGH 5EBLA 2CKBL 2XIBA 5EOCJ 2GFBB 1OLLA 4JRFA 1QHQA 3VNYA 1KJVB 4ZYKB 5F9WB 4PW9A 4S1DD 1NCCH 4G72B 3RAJH 1IPSA 4KK9C 4A44A 5J3UA 3L1OL 3TT3L 2YXMA 2X9WA 3NCEB 4P08A 1WMDA 4G9FD 3IIIA 2UZIL 2ZCHL 2GW5A 1WAAE 4K3DL 1S46A 5C9JA 1NCOA 1GC1C 3GT6A 3RTQB 4N6QA 2ZEZA 3W9AA 4JKMA 4NZTL 3ZFFA 2ZKYA 3BE1H 5C0JB 5I17A 4MXVE 4JKKA 4FFZL 1NLQA 1BX2A 1KJRA 4OFVA 3WOVA 2J22A 2OQ7A 2XWTB 4UT6H 1EFXB 1BFVH 4FPLA 4WU5A 3KV4A 4UIKL 2DWYA 3RDTC 3FHQA 2YAEA 3AL6A 4EWAA 4TUKH 2DOCA 3U6XA 3BWUF 4YSAA 1OLQA 5DURB 3EJCA 4BQWA 3FOMB 4GB32 3ZFFC 4BQ3A 5K7PA 2VD7A 1EVUA 4QLWA 5FBJA 5FY0A 3W9DB 5CNHA 2YC4A 1GZPB 3FZUC 3K80A 3IGKA 3BUCA 5LHDA 1IEBA 1APNA 1IL1A 2JE7A 1FC2D 2K6ZA 3T0EA 1XXDC 4Q0UA 3BZFA 1WBXA 3H1ZA 3SBPA 4E9XA 1VRBA 5A2JH 3QQXA 1T6BX 5INCB 4XQ4A 1XCXA 1NUNB 3EOBA 3NSDA 3K6SB 4M3JA 1BGXH 1A6TB 1E7UA 1KCKA 2VLMD 4IRZH 4JKPH 4XNUL 3H6AA 4PGJA 3MLUL 5IWLA 4ZUWA 1RPQA 5F6KA 4QJ4B 1FZOA 4GSRA 1OF4A 3UGGA 5DEFA 1BAWA 5IFHL 1ZRIA 5LEJA 2RIKA 1I3RB 1NDTA 2E0PA 1E4WH 4P9HL 4Z78B 5I1KH 3SGKA 3HN8A 1RPKA 3VFGH 5DGRA 1B4JL 3GSNA 5E8PA 3ZKMD 1T1ZB 1EAJA 2XGXA 4I0CC 4Z23A 2P9RA 2FZ1A 2VN4A 5HI5D 5JPNC 3APNA 2RS33 2E59A 2XG4A 5F7AA 4GQZA 4M3HA 4M8QB 4Q1PA 4KNSA 3RZCD 1KGWA 2JG9A 4LEOB 3TNQA 4TVUA 1M71A 3MLSL 3OXRB 1N4XL 5FKCA 3SGKC 1AO7B 5C70A 2F53B 4Y16D 1ZZ7A 3WD5A 5D70L 5E9DA 2H45A 1AQ8A 5GQBA 4R5VA 1G1OA 5FUZL 4P2QA 2R1DA 4GRWE 1PKQB 1WA2X 4WRLA 3WTWA 4JM4L 3MF9A 4LOVA 5EUKA 1DQLL 4OJFH 2EAAA 1DUYA 5C07B 4RGGA 1C8M3 4YHYC 2VBDA 5HYJD 4PRAB 4MV2A 5JZ7D 4U33A 4WFEE 5I5IA 4F3FB 4DN3H 5BJTA 4M48H 3PMEA 3WNXA 3B4NA 4NO0D 2XWCA 3DIVA 2RTTA 1Y0LA 2G60L 3TWCL 5A70A 4PDWC 3ZXLA 2UWEF 5TFSH 1LOBA 2VUKA 1XJAA 4XE0A 4WAFA 1NGXB 3U30B 5GJTH 4B4QA 4NO3B 2BDRA 2W1SA 3DPBB 3MCLL 3VFMB 5JIQA 2DCTA 2DM4A 1QOKA 4Z77A 2GJ6E 3T1FA 2FQPA 1R3KA 4PIYA 3FUJA 4RMQA 5B1BB 2JG8B 3WXWL 1S7WB 3BKMH 5LDSA 4IEPA 4NBYB 3QJUB 2WGNB 4D94A 3VN4A 3JV5A 1YLLA 1HN1A 3HAGA 3EAKA 2NNRA 2QLYA 3EYOB 5I6OA 2V73A 3IFOA 1KFAH 1IQWL 4MRCA 3OGVA 2CKBB 3VFRA 1M05A 1JFHA 2QZ5A 4AMXA 3D87B 4NNPL 2BW8A 2VT0A 4KROD 2O5YH 1GH7A 3DOSA 3TYFA 4NHLA 3RYKA 3HT2A 2CR6A 2J1KA 3SQBA 2HYXA 1O7DE 3OKDA 1INQB 4FG4A 4LOUC 4XMXA 5LRRA 3GI9L 5FIEA 3TV3H 4O02H 1UYPA 5BRZE 1ACYL 3MV9E 3NCYP 1V6KA 3HN5A 1TJMA 3R4DA 3WL9B 3QUZD 5KBFA 2WBJA 2VNCA 3QUKA 4GKOA 4OQ9A 2QKIB 1TVHB 3VXPB 2NY2D 2B15A 3BIWE 3CMOL 4K5NA 4PLJD 1L3WA 4RL7A 3L2YA 1AVBA 2HJKA 5E5MB 4QKXB 1UH3A 1ID2A 4GKZA 4LLUA 1L5GB 4KWLA 2QGBA 1CAVA 2F17A 1UZ6F 2W2IA 5E99L 4ODHL 1R75A 3IDGA 3OWRA 3SQRA 3IVKA 2DU0A 4GWIA 2ITCA 3WMPA 3T4AC 1G6RH 1XGYL 4L29A 4OAWB 2H0FA 4KDTA 3SPHA 3DL3A 3I3MA 4M8VA 1V00A 3U1PA 4ZS7L 1H9VA 1H6UA 3V4VH 3U4SA 2OMNA 1ZT4B 2WA3A 1Q72L 5KJRH 2YB7A 1OY3B 2NY3B 4JNXA 4M7LL 1CYXA 1MDTA 4RMRA 3V0JA 3X13A 4HK8A 1GSKA 3VVWA 1DGLA 5AVXB 1QZNA 2GSIA 5G55A 2PHDA 4TM9A 4FCAA 2HVKB 4QKFA 1BVLA 3LOWA 5IHUH 3FO2A 3IETB 1GJUA 2AJUL 2ZWNA 3C2AH 3H7LA 4HW6A 4XCCL 5KVEH 1GHFH 1XVSA 4Y20A 3WDIA 3VXSB 3NCBB 43CAB 4Z7OF 3T4VA 4BEIA 3F7YB 1DFBL 4OR1A 4Y4HB 4LEXL 1UAIA 4AQSA 5MERA 1DANU 4XCAA 2EIZB 2K70A 4FKHA 4A2GA 2V2TB 3C6SA 1Q8VA 5A2CA 2CAUA 2FMDA 4M9OA 2L7QA 3H56A 3ETTA 2GAZB 2X6UA 3RBSA 1BHGA 5IHBA 1CGYA 3TURA 1DQVA 3GJAA 5LCVL 3NYKA 3ST7A 1ZE3C 4EN3C 1VJ2A 3ZMEA 1FNGA 2WABA 4RFEA 2CA3A 5EU7C 5EOTB 5A2FA 4HX1B 3VUOA 3O6FD 4UDUA 5D6CB 4G3YL 4C1XA 1UIJA 3FTZA 2JKWA 5CLXA 1M6OA 3DGTA 1QSFD 1LGBA 3ULVF 1W9YA 5FYCA 1AGDA 4OIIH 5T8IA 5JHDB 3P9LA 4BZ1L 4OZHB 4FP8L 3H0TA 2A73B 4JFVA 4ABVA 1W8ZA 3ME2A 2FCBA 4PTTA 3A6CL 3R18A 1OGTA 3QCTH 2P47B 4LE8A 1DCLA 1DQJA 5DJ6B 1ND3C 2JH2A 4F58H 3HHRB 1PLGL 3POWA 3P0YH 3QULB 1V7ML 4Y5YB 3PV7A 4N0YL 2E51A 3EJUA 5J6HB 2G0KA 4NQCB 3CFMA 3D0VA 4ZTPL 1GZWB 4ZPTA 1KS4A 2WB7A 2D31B 5EEWA 4Q6IC 2GTWA 1MCDA 1C5DA 5TE4H 2APFA 1K4CB 5D72H 2WAAA 5C0GB 1LJMA 4QHLB 4X6FA 3EH1A 1BXVA 1MCEA 2WBXA 3OLGA 3TBYA 2PHLA 5FZ0A 5A3UA 5FKBA 1G87A 3HG1A 5C9AC 2XZQH 1EJOL 2JJWA 3HC4H 4PUBL 1JE6A 5EHDA 4PRPD 4O9GA 1IOAA 1OSPH 5I1CL 4J3XA 1NBZA 5F5QA 2GIXA 4XPBH 3VWKD 3HE6A 2BZDA 4GH7B 4XUQA 3ACGA 5IK5A 1MQKH 3SQOL 5F7EH 2ZP0T 3CVDA 2CO3A 3RVVD 4YQXH 1QR1B 3UYRH 2FYVA 4H40A 2WP3T 2CG9X 4MVBD 3PUIA 5DZLA 4PQQA 5BY5A 4OQ1A 4YZ2A 5K9OA 2LW8A 1IBHA 4XMWA 4OHVA 2ZPKL 4TQHA 4V1DA 4WFGD 4FG6C 4YHML 3CXDH 1K6QH 4O2FB 3U7YH 5MEQB 3HE6C 3ZR5A 2HWF1 1Q8PA 4NLHA 5AW4B 3R19A 1HHKB 2EVXA 2Z4QA 3QIBD 2A9DA 15C8L 3KW8A 4OGYL 3RDTB 1ZXQA 5DJ8B 4D6RA 5J9PB 3IPVA 2IV8A 2Z91A 4FEMA 4FTVD 4AQ1A 1NMAH 3I3QA 4G6FB 4N28A 1K5MA 5DGQA 3VX0A 4OLXH 3ZHFA 2WYZA 4AM0B 3RZWA 5KVEE 3DO7A 1UCXA 5HDRA 5JIMA 1KSRA 5T5OA 3GMLA 1YMMB 5DC4B 3HR5B 1NGYA 2FEEI 4BH7B 4I7ZC 4QHKJ 4A2MA 3IK2A 4YGVB 3MUUA 4HT1T 3L5WB 4S1RL 3BGMB 2TEPA 5EQUA 1CDHA 1RK1B 1DLFH 1K5MC 3D06A 1AGCB 2OMVB 2X12A 2YIHA 1EXUA 3FFCD 4R7DA 4ARYA 4JJHA 4AEDC 5IHZB 1VCAA 5GJ6A 1XU1A 3ZGHA 2DWDB 1FL6B 4ZFZB 2Y3AA 2BFUS 3IS0X 1ND0A 3ZSSA 2ZAIA 5I0DA 2VMIA 1SEQH 4Z3HA 1PCXA 1LGNA 1PF3A 4UAOC 1KCRL 2NXZD 1IS6A 5DD0L 2X9YA 3DV4A 1BF5A 2VDML 5JPNB 3C8DA 5J56B 1SLTA 2KA3A 5D55A 2D73A 1JF1B 1SJMA 1PZ2A 4JM2F 5FGCE 1QBML 3CSFA 5EORH 4DY5A 2R2CA 2DQFA 1OTUD 2RD0A 3MRHB 3I2HA 2JKIS 1W8OA 1MCRA 3QFDA 4LDCA 3PUAA 4JZNA 3DTDA 1JYWA 1EH9A 3T3YA 4WQOA 4LASL 1KB9J 3RKDC 2AEWA 1S9XB 1SUHA 3N50A 5DD1L 4D8PB 3RE0A 5J6GA 4JRAA 1SHMA 2VR7A 3I3BA 1C28A 3LRHA 4GRWF 4NQEE 2YBSA 2OMXB 1P4BH 1R17A 3SE4A 1VBD2 3HAEB 4PGEB 4YHYB 2EP6A 2D7OA 2R4SH 3CFNA 4PAZA 2XJSA 4TLGA 5IW1B 1DO5A 1H1MA 2QQKH 1ZHNA 3MA9H 1URZA 1RUI3 3LFMA 3DMMC 1QW9A 3IDJB 4QRQA 5IVOA 3N4MA 1FP5A 4XN1A 3ASWA 4PDWB 1D2PA 4QHMB 5E2VH 1NCBL 1E50A 1AAJA 2J71A 2I9TB 3ES6A 2VLRA 1R3LA 5JDSA 4GUCA 3RB7A 5IW3A 1M42A 4JDZB 1A1MA 1YEHL 1U8HB 1AR82 1KGYA 1LR5A 4PLMA 4U7MA 3D69A 4XJUA 2QQLH 4R6UA 5TQ2L 2R1XB 3Q13A 2HWE2 1G1YA 3BSGA 1MVUA 2FH6A 4PF1A 4Z95H 1QDOA 1MQTC 5CUSL 2HLAB 2MNGA 3DA0A 3RY6A 4LCCA 1M9SA 1IT9H 3TBVA 5KAQF 4EZ4A 1ZANH 3AUWB 3SDAB 4S2GA 1W9FA 3I9AA 1DO6A 1XIWA 3K6DA 1KXHA 1EEUA 1HNFA 4FJYA 2YUXA 5C0BB 3KCCA 4RESB 4YSQA 3RYRA 1AHKA 5E2UH 5DHVH 5HHOA 2E46A 1YQ2A 2VXQL 3LS5L 4HKBB 2VDRL 4Z7IA 3MKKA 3TBWA 4FJZA 1BD2E 1FF5A 1ONQA 2GQHA 1JHTB 3HI1A 3HNTH 3L6FA 4UBDC 5AVSB 1N5YL 1ZZ9A 2RS12 1GWMA 4L48A 4AQ8C 1OM9A 4FFFA 4E4HA 5E8OA 5HHNA 5JNYB 2UXTA 3O8XB 2O5ZL 4U6XA 4JL2A 5EO0A 5F97E 3MACH 2XT1B 3H8NA 4XX1E 5JHMA 1YQCA 4CE8A 1UM6L 2NZ9A 2ZJSL 2AQTA 2C9PA 2VMDA 4UINL 2L7UA 2OXGA 3EJPA 5T3ZH 2WVTA 3UFIA 3M3OA 2PAKA 2X2JA 3H3UA 2VUJA 4YVWB 3T4AB 4Y4KA 1FCCA 5B38B 5I8EA 5T1LB 5L2JA 1HV1A 1GRWA 3PJLA 2VTXJ 3KCWA 1POV3 4G8GD 3VI3A 4JHTA 3U7WL 2ZGMA 4GB9A 3ATGA 3SDYH 4XMIA 1S0BA 3LZNA 1YHFA 3EHBC 3MLRL 3EGSA 5E70A 4HOXA 1AXYA 2Z31B 4HP5A 3U0TB 4Q9RH 4M43H 1JZDC 1UX7A 4Z7VB 1IBDA 1PTZA 3OD4A 2WCGA 2WO2B 4PREA 4RGNB 1ZRRA 1AR62 4FZ8H 2WCSA 5DAWA 3ZQWA 2RDQA 4JKNA 5IBTL 4F8QA 1QLEH 4XC1L 2RMU1 4A2FA 2WMPB 3LRGA 2YMOA 4P2OD 1UWXK 3ZSJA 5GZCA 5AZUA 4A1RA 3HTLX 2GJZA 2E3VA 3R06B 5IJCC 4OD2A 1E5IA 1YY8A 4MYEA 1P6AB 1Q0XH 3QJFA 4OY9A 3W81A 3QEQD 2VQAA 1IEAA 4YPJA 3QDME 2HTKC 1U3NA 1BXUA 3SDXB 3KNBA 4K3UA 3W9EA 1U8CA 3O6MH 3DX7B 1N3PA 4DPBX 1HHGA 4IS6A 5C1MB 1QJY2 3TYGH 1SQMA 3M7FB 5F1OB 4ISQA 1GNHA 1JBCA 3NCWA 3MJ9H 5TGBB 1HINH 5CGYC 1UWEH 2NY0C 4P23C 3VBRA 1FJ1B 3O3AA 4XP4H 2OA2A 5CEZL 5CFCA 4JFFD 3V0AA 1GGBL 2ZOTA 5FHBH 5I0VA 1SM3H 1PVC2 2UY9A 1RMU2 4A2UA 2W81C 5EOCL 2B9AA 5CD5C 3VD4A 5L9BA 4HANA 1HXS2 4F8AA 4JB9H 3JWOL 4ZUSB 3DIFB 1HS6A 5AB1A 1ND3B 2VDLL 4CGTA 3O0WA 1V10A 4NFCA 2P5WD 5AENA 4RFT0 5CFCC 2MEV2 4R4BB 3TJPA 2CGZA