2W94A

Native structure of the discoidin i from dictyostelium discoideum at 1.8 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 62
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w94A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w94A01
3HOBA 4CUCA 3C7OA 4UAPA 1US2A 2YB7A 2YC4A 3FHAA 1GMMA 3P6BA 3HNMA 3VDAA 1WKYA 2VZ1A 1BHGA 1W8OA 1UY0A 3C7GA 2VZTA 3K4DA 4RN5A 3I2JA 4A6OA 1JHJA 2ORXA 3IAQA 1O59A 3OB8A 2CGZA 2Y6KA 2R7EB 1K42A 5HXMA 4DUXA 2J1SA 4XUTA 5JR2A 2VC9A 3P1IA 1JI6A 2VZVA 2JKXA 1XNTA 3WMPA 1UXZA 3C7FA 1K3IA 3LEIA 4W50A 3MO4A 1CZTA 3T2PA 3I3DA 3I2KA 3WF1A 3T0DA 3VD5A 3K4ZA 3WQBA 3E1F1 4QDRA 2VM9A 4JKLA 5IJRA 2W3JA 3UETA 1JZ8A 2QQNA 4QX2A 3SEPA 2W87A 2VJXA 4E8CA 4JKMA 2J1TA 2VZSA 4D8MA 2VL4A 2WZ8A 4UOJA 2VMDA 4GWIA 3T2QA 2VZ3A 4OUEA 2CGYA 1UMHA 2E26A 1OF3A 1PMJX 3LQCA 5JMOA 2VZPA 2YC2A 2ZEXA 3WF3A 3T0AA 3WSOA 2W95A 1TG7A 3VD7A 4W8JA 3HJRA 1J84A 1R64A 4QAWA 2OKXA 2QQLA 2WYSA 3CKHA 2LW8A 1J83A 2J1AA 4YPJA 2J22A 1W8NA 2VR4A 1IQDC 3WNLA 2EIEA 4BK4A 2WO3A 2Z4FA 2WN3A 3SKJE 4E8DA 1H6XA 1UY4A 2CCVA 4A44A 2XQXA 5C7GA 3ACGA 3WF2A 1UYXA 3WNMA 3GGLA 2Y6GA 4TXWA 5JUVA 4LPLA 1K45A 1GOHA 2VCCA 5JXIA 2E31A 2J1EA 4M4PA 3GM8A 3I3EA 5EJZB 4ARYA 2YFUA 1OH4A 3WMQA 1UY3A 2VMFA 3I3BA 1UX7A 5CYYA 2WO2A 4ZXEA 1XPWA 3K46A 3T0BA 3WNPA 4QDSA 1DLCA 1GOGA 2WBKA 2Y64A 5HPOA 3GDBA 4P08A 3W5MA 3BGAA 2CDPA 3I2IA 2VOTA 2DCJA 5DPNA 1OD3A 3IB3A 1L7QA 4CVUA 4JX0A 2W1SA 4A4AA 4DXSA 1L7RA 4CU6A 2W5FA 3DYMA 1GU3A 4PQQA 3BN6A 3VD4A 4OMCA 4QB2A 2J1UA 1UZ0A 2E32A 1NUKA 4OZOA 2B4KA 2W94A 4A45A 1JYWA 2VCBA 3HNBM 5I0DA 2VQTA 3NRUA 4MGQA 1P8JA 3HPNA 2V72A 3EYPA 2CE6A 4ZZ5A 1OF4A 3LE0A 4QX0A 3WNKA 1PX4A 3AC0A 3W5NA 1UYYA 3T08A 1W99A 3ECQA 1JU3A 4OYUA 4QX1A 4JHZA 5DN2A 3NQHA 2WQ8A 1K12A 1RYYA 3HEIA 3K77A 2ZXQA 2ZEYA 1GNYA 2YG0A 4LHSA 4MADA 4AAXA 1JU4A 2C26A 5DQ0A 4BDVB 1JYNA 2Y8KA 1YQ2A 3C8XA 2W92A 4DEQA 4L0PA 2QQKA 2W1UA 2PQSA 3DYPA 3MUZ1 4DXRA 3LPFA 3NJXA 2BGOA 3CZUA 5A1AA 2L9LA 2VMCA 5LA2A 5IYYA 4JKKA 4LKSA 1SDDB 2QQMA 3UNPA 2XONA 2Y6JA 4DXTA 3WEZA 3WF0A 2ORZA 2YFZA 4CUAA 3OBAA 1UY1A 2J7MA 2KD7A 4XUQA 2EIDA 4HG6B 1XNAA 3THDA 1T2XA 3PUIA 4MO3M 3D3AA 3PUHA 2QQIA 1JZ4A 3MV01 1W9SA 1ULPA 1W9WA 2C9KA 4GWJA 3OGVA 4QX3A 1JZ6A 4XUOA 1O8SA 2Y6LA 2X09A 2HLEA 3DYOA 4RYDA 5J1XA 2LS6A 4XVHA 2VZUA 4DUVA 4P00B 1JZ7A 2XOMA 1US3A 3VDCA 4ARXA 3MBWA 3U37A 1SHWB 4XURA 1CX1A 2VZOA 2BGPA 5JXGA 3C7EA 4PT6A 2BERA 4XUPA 4TTGA 3I2FA 2W1QA 2WAOA 4CU8A 3IIIA 1KGYA 3A7QA 3C7HA 3K4AA 3ETPA 2W91A 3CQOA 1DP0A 2WABA 1CZVA 4BK5A 3LEGA 3ACFA 1O8PA 4ET7A 3LPGA 5IFPA 4CU7A 4QB1A 3MV11 4P5YA 3I97A 3WNNA 2VZRA 5B4NA 3I2HA 4Q56A 1UWWA 2RV9A 4LQRA 3CMGA 1UY2A 2W46A 1JZ3A 4P02B 4UI9L 2HYXA 3JXSA 3WF4A 4A41A 1F4HA 5G04L 4Z2AA 2BBAA 3HNYM 1ULOA 3OGRA 1XC6A 2RJ2A 3A23A 1JYXA 3CDZB 3SKVA 4QPWA 3LEKA 4DUWA 2W9XA 2JDAA 4GZ9A 4QDQA 1JYVA 5B4XA 4OMDA 3OGSA 4XUNA 4DEVA 4XZUG 1JZ5A 3ZM8A 5LCWL 4PF1A 1PX3A 4KI5M 4BJ0A 2VZQA 3NJVA 4M4RA 5FUIA 3ACHA 5EJ1B 1MPXA 3ABZA 1EUTA 2RVAA 4KMQA 3J7HA 4ZZ8A 3THCA 1TVGA 2JD9A 1JZ2A 5JXHA 3NNGA 2E33A 3A22A 2ID4A 2WN2A 1GUIA 1CZSA 4KWUA 5DMYA 3I2GA 1KEXA 2DCKA 3HN3A 1PMHX 4CU9A 2J1VA 2X05A 1W0NA 1GOFA 2EICA 4A42A 2X10A 3GXUA 4ZY9A 3IDAA 2Y6HA 2QQOA 2W47A 1WCQA 5C71A 3T09A 1UYZA 3CIHA 3UESA 5CZKA 1HN1A 1LNSA 5IHRA 2WZEA 3OEBA 2BZDA 1F4AA 5F7UA 5LA0A 4QB6A 2VCAA 4D0QA 3DECA 3MUY1 4MOAA 2ZEWA 3ACIA 2WO1A 2B9VA 2VMEA 2WUHA 1GQPA 4W4ZA 5JXJA 2J1RA 4IUGA 5EIYB 3T2OA 4BXSV 2CDOA 3A21A 1NX9A 4CUBA 2JE8A 3VDBA 1CIYA 2V5DA 2W1WA 2VTFA 1UXXX 2QQJA 3FL7A 2DDUA 2VQUA 4AG4A 3VD9A 1W9TA 2WAAA 3OEAA 4MGSA 3VD3A 2V4VA 1D7PM 1NAEA 3FHQA 3IAPA 5G05L 4A3ZA 1OT5A 2QBXA 3OG2A 3WNOA 3F2ZA 1DYOA 1SG3A 1EUUA 3CZJA 2XHNA 1NKGA 2WDBA 1UMIA 2ZEZA 5IFTA 3K75B 2C4XA 3FN9A 3EB7A 5LA1A 1I5PA 2EIBA 4FI9A 2VO5A 1H6YA 5C70A 3SEEA
chains in the Genus database with same CATH superfamily
1HXMA 2VAAA 1RLWA 2G2RA 43C9B 1DZRA 1MG3C 4KXAA 4CSSA 4PCKA 3I9IA 1GR3A 2RM22 4MAUL 3IE9A 4PBPA 1NC2A 3VDDB 1XGYL 4I1NB 2OMUB 1VB9A 3AWGA 4HIIB 5DRZB 2JQAA 4NQTA 4OD2A 5EV7A 3ULVH 3KPQB 5MENB 4ZKTB 2VCMA 3BH9A 1HHHA 4ZOEA 2PAMA 3OMNB 1OQXA 4HMDA 1F6AB 1GL4B 3N9GH 2EXIA 3V8OA 1HZLA 3J2PA 2CBQA 4QRRE 4BFBD 5JORA 2OJEB 2GNMA 4QGTA 4EKJA 3S5AA 4MQXC 2VC9A 3HG0A 3VXQB 2VNGA 1J86A 5KG9A 1DFQA 2ADEA 2RS33 2MEV3 1P69B 1UXZA 3BSHA 1QLRA 1TQUA 4JPIB 1ST8A 3MQIA 3HUJF 2Q76B 3MOBH 1YQ5A 1VFMA 2AUYA 1M71A 2A3WA 5IMKA 5E2JA 3VYOA 4RAUA 3U07A 3LX9A 1KXTB 4X6FA 4I87A 3RYKA 1ZT1A 4N22A 3E1F1 4X98B 2D3LA 1DVYA 3HNSL 5IVOA 1XU1A 3BVXA 3NBNA 4PRIA 3UP1A 2G60H 4KI5C 1D9KD 3UPRB 4XMWA 4LXLA 5FZGA 3TA3B 1ZWIB 4DZ8B 3S9DB 4E8CA 4BQ9A 1WBZB 1X5YA 4XMKL 2JK5B 3MV8B 3PVOA 1EHLH 1U3HB 4UCFA 1ET7A 5E2UH 1DVFA 1U2CA 3FKUS 1G7LA 4U1KA 5LHDA 3II1A 1PNGA 1JF5A 1RUML 1AR91 3OZ9L 4IDJH 4KJYA 3MYZA 3L3DB 2VOWA 1KV3A 3KJ4C 1NMBH 4JFFD 3HBGA 4LARH 4WM7B 1LMIA 3B7YA 4F15B 2JI2A 4RIRB 4HW6A 4PTUB 4HT1H 1GP4A 4IGOA 1A9BA 2PHFA 4PJEE 1UZZA 5FHBL 4CW1B 3GO1L 2R042 1CI3M 4N5ED 1D5ZA 1H2KA 4XMUA 1R64A 1TDQA 4EWAA 5CF3A 2KL6A 3P4OA 3Q2LA 3JWDL 1YEDB 3IKKA 4UIMB 3W11D 2IANB 5DJ8A 3M3CA 2HG5B 1W8NA 4JFDE 3SKNB 4LITA 3KVAA 3ATFA 2GHZA 3DDFA 4X4KA 2AXGB 1H4HA 3DCQA 1YO4A 4JRAA 1V9U2 4AYSA 2WLKA 4YWGH 2P49B 1VACB 4LVHB 5C6PB 4AQTA 2NXZB 1HHIA 2AEPH 3FRUB 4J6IA 1QYGH 3KXFE 4LCCB 2P8PA 3VBOB 5AVRB 4C4KT 1HOCA 2ROXA 2A6VA 5F3BA 3B4NA 2VLMD 5F7WC 4AXWB 2FD8A 2TRHA 3RRDA 2VCCA 4TUKH 4MXWH 1QASA 5KYNA 2E31A 4LUMA 5C5UA 4E41A 5EO0B 4HANA 4FCAA 3ML9A 3LEYL 1DLFL 2FNBA 4HBCH 2SBAA 1UY3A 2Y06L 4BFOA 1ULCA 1P5UA 4EIGB 1SQ4A 2XLLA 4HP5A 5DLML 1EV11 1QKZH 4PLNC 4JFTA 4MGTA 5T1JA 4NPRA 4FG4A 1UD3A 5IQ7L 1QH6A 3DX0A 4UTCA 1VBE2 3FZUD 5C0ND 4YNYA 2VC2B 2HH0L 1WFMA 3J8F7 4R4BA 1TEYA 3OX8B 1MCDA 4KHTH 4KRPB 1AY1H 3WNPA 3OF1A 1IQAA 5F8PA 4Q8BA 2Y7LA 4NRYB 1QSFE 2WUBL 1NXD1 4M03A 3GDBA 5FZOA 5FWJA 3IJHB 3VRLF 1AGFA 3KYOB 1WZKA 4I3PA 1JN6A 2OS7A 2E4FA 3FH7A 1I8IA 3E3QE 4MA8L 3ZE0F 2PXJA 2YD7A 5C0BD 2ZE0A 3TBSB 3TYFB 2ORBL 5JIAA 3WU1A 3DRQB 1G9AA 1RUNA 1QSED 1K6QL 1L9TA 4JLRB 1ZGLP 1LULA 4NUGL 2D97A 3WP6A 3G5WA 1CQKA 3D25A 3UTTE 3JZYA 5F1RA 1IC5L 3PUQA 3T6WA 2X6VA 4NROA 4FXKA 1HWGB 3CVHA 1LE9B 2Y26A 4Z7UB 2VXTL 2FQPA 2EDBA 3FUNA 3F7VA 3VXRA 1LOEA 1MEC2 4KROC 3JTTB 1OGPA 1RLBA 2VDML 3QEUB 5I9QB 4TLSA 3QQ9C 1WTLA 4JO8A 3BIWE 5FZFA 4ASMB 1KEGL 5BVPH 3CLFL 3HS0A 2Y0IA 4W6WA 1U30A 2J72A 3E80A 4OFVA 3D69A 3QUXA 5E9DB 5HYEA 3K71B 3F12A 3QJHA 2AR6A 3TEYA 4XPVA 5HDOA 2OX5A 1RZIB 1INQA 2H3NA 1R5WB 2XTJB 4OZOA 5FZCA 1PHMA 4JFFA 1C8QA 3G5VB 4AYBA 1YXWA 1P6FA 4JAAA 2QZQA 4AEIL 4TUJA 5FOBA 1UN1A 1UD2A 4HS3B 2H0FA 4AI9A 2QQPA 5FYJU 1ZVSA 2A99A 2NZIA 2MHFA 3SO3C 5D71H 4QX0A 5I30H 5DTFA 1AUYA 5DJCB 3GZEA 1PX4A 1BGXH 5HBBA 3T08A 4EO5A 2EIKB 2BJMH 1VBB1 2NY4C 4MXQC 1JGDB 2QGEA 3WUWG 2IOMA 5E16A 3AS3A 3QBTB 5DN2A 3HRZC 5A2AA 5GRXG 4HZLA 1ND3B 1UZ8B 3AM2A 3QFJD 4YBQC 4NZUH 3S3JA 4BYHA 4M7ZC 4QU1A 5DEFA 3OBRA 4RGOH 4CCLA 4P5TB 1RXLA 2QVTA 1PGL2 5AVQB 3JU9A 5IEHA 4XIKA 2LTQC 1S3KH 2WNUA 5HHVL 3H1MA 4CJ1A 4AAXA 3KNBB 3PABB 3RURA 1JZDC 5CFCC 3P9MB 1I3RB 2F54D 2DU0A 2ZTBA 5FLUA 1PNFA 5AOIA 3OUHA 4WW2A 5HVHC 5FGSA 1GIGH 3UBXB 4YHNB 4XPHL 2YBRB 5DS1A 4BSWA 2UWAA 4APXA 3BPZA 1JWUA 4RHV3 1VFBA 5EORH 5DXWA 1XIWC 5KVGE 3FUDA 3HPJB 3TBVA 1P4BH 1IV8A 4AEHH 1MIEH 1L5GB 3RVVC 1U8JB 4QUOA 3U0WH 2L9LA 2XV3A 4ISVB 1XXDC 3CFNA 4LLVB 4JM2C 2FYYB 4RAVA 1X5GA 2GI7A 3GBNL 5MERA 3MW3A 3QOPA 4MHRA 1JERA 4NUJB 4OF3A 2XONA 2B59B 3VXOB 5LBVA 1ASJ2 4LQFL 4UZGA 4RQQA 3UTSA 1USZA 3WY3A 2O5ZL 4BQ1A 1FYTE 1SXCA 4PGCA 4UB0H 4TPRL 2QHLA 4A6YH 3GGWB 2CPCA 3WD5H 3QR0A 3TH3T 1CDBA 1CN1A 4HL0A 2EXHA 1IAIH 3U0PA 4HBNA 3O8XA 4X8CA 1RPQA 4KNCA 4F3JA 5DF0A 5C0BA 1F58L 3RIFK 2XIDA 1JZ4A 1TMF1 1J1LA 5EC2B 4KK5D 1SF5A 4KKBC 5IW3A 1ULPA 1CXIA 4QNPE 1FH5L 5CILL 3HUJA 1I3GH 1AC6A 5HXVA 4WI9A 5B3JE 4AM0B 2XWRA 5KANG 3ZY7A 5D21A 5AL0A 3O3BB 1BQ5A 1OP9A 3DYOA 1VP6A 5H9SA 1YMHA 5GGQL 3NZ8B 5A70A 3HBPA 3VCLA 2XOMA 1WC7B 4PRNA 4N2NA 3KAAA 5I16B 3MA9H 4A2DA 3VHOA 3M88A 1CVRA 3G5ZA 1A0QH 3Q2NA 1NAKH 3QC6X 5DVPA 2W0FA 2NY1D 3PVNA 1OT1A 2E7LC 4PT6A 3HC0A 4OIFA 4LIQH 1QJU2 2HLAA 4ZPVB 2NY2C 2YBGA 1IGOA 2JE9A 3OUJA 1NCAL 4LCWA 2X9XA 5ITFA 4G8EA 4YW4A 1UYPA 4OF0A 1C1LA 3PL6A 3T6ZA 4Y4FB 5B3NA 1IAII 2F7QA 1H3PH 2VLLA 1ACYH 1QHOA 3K4AA 4ZT1A 1NIBA 4C56E 4PCRA 3U83A 1OCWH 5DG1A 3RVWD 1XCXA 3ARWA 2A6DB 3NFNB 3FN0H 3SKMA 2P7TA 5L2KD 1HNFA 2KXLA 2JXMA 1NSNL 2NR6A 3LPGA 4IJ3B 4Y89A 5B7FA 1BEV1 1BLNB 3VE0A 2C5DC 5D8AA 3GINA 4RMUA 4YGEA 1N2RB 1KBBA 1XMEB 2Y3NA 2E9JA 2ED9A 2I27N 3U36A 2D4FA 3B9KB 3WW4A 4ANXA 1S7VA 4BXVA 2QFRA 4MX3A 3CMGA 4WUUB 4FLOA 5EYYA 4A41A 4KY1L 3RZCC 3HZYA 5CMAA 1J0IA 3T30A 2JDPA 1IB5A 5FBJA 3FX3A 4Y19E 5EBLA 2OP4L 2DLIA 3D87B 1RUI1 3F85A 3I6GA 1ZA6B 2WKGA 2DQIH 1VALA 3LZPA 4GZ9A 3VLBB 1INDL 4GXUM 4E9QA 3MGOA 5KSUB 4FLQA 2QLVB 2LU7A 4X42A 4LBEB 1PKQA 1VZGA 1F3DH 1NCCH 1E6JH 3MREA 5KYWB 3O81A 2MHAB 3T6QC 3WE6A 4WSGA 3MRFB 4PEEA 3SKOB 5FYTA 3SQRA 4AZ8B 1FNSH 2R9HD 1RJYB 4FHJA 4QF1B 1RU9H 3VJ6B 1KS5A 4YZ3A 3J7HA 2GC2A 5FXZA 5KHKA 4MZIA 4XETA 1BOYA 1GGTA 3PU7A 4NPLA 3LSEA 3U6RA 2HA1A 4U6VL 1NCQA 5I0UA 4UOQA 1BVLB 3VI3F 3NJYA 2HWF2 1C16A 4KWUA 5HI0A 1KEXA 2DQTH 5I8CA 2A83B 3F7PC 5H8DA 5FXVA 1N3OA 3AYDA 2YAHA 5CD5D 1AR71 3QUZC 5ADPH 5CFDC 2GAUA 1A78A 5DDHA 2MTPA 3QUYB 4I2XB 3T0WA 1GMIA 1DBKL 3TBWA 5I24A 2X1PA 2N0KA 5TF1H 3IFOA 3A4FA 3LYRA 2C4FT 4IRSD 5C0RL 1N5YH 4QT6A 4R3SB 2FX7H 3NN8A 5C3PA 3SYQA 2DAVA 1HE8A 4Q4Y1 3FO9B 1DANT 2F74A 1G7PB 3QWRA 1YEEL 2D73A 5CGYD 3PIGA 2PPEA 1HYSD 1CZ8H 1XH3A 2H6PB 3GZOA 5C0FB 1IFRA 4LSPH 4F83A 1NGYA 2EDWA 5EZIL 4OVEA 3F58H 4HIXL 5LGHL 5MHSE 3AXLB 2ZJCA 3EQEA 1MCWW 4MTMA 4PLJD 1GC1L 4Z3TA 5FZ0A 3MRHA 4XQWA 1V3KA 5GS2H 1HL4A 3C6SA 1U5YA 1LLAA 3ACIA 4EN3A 4AK3A 3ARGC 1I1AA 3MLXL 4LSRL 4QMAA 2VMEA 1QJZA 1H6UA 1UD4A 3MBEC 5FYLD 5D7HA 3IDJA 4OJYA 3SE9L 3ZHFA 2HWZH 4M6OH 4LO6B 1CL7L 1SN0A 3VWJB 3QZNA 1BF8A 1CI5A 4OVVA 3HWJA 4HLTA 4YZ1A 1Q94B 4NRXA 1BIIB 2I60H 2AK4D 2BX5A 4WI0A 2XQYG 1G9ML 1YQVH 4G8GB 5D1XC 4A6SA 1E6OL 4AL9A 1CPNA 4AVHA 3GYRA 4FQPA 2W52A 4OJCA 3D51A 3P3YA 4M8VA 4AYID 3O14A 2B7YA 2XFXB 3L9JT 2BVQA 1NL0L 2ED8A 1M53A 3TIDB 1KPRA 2VVEA 3FQUB 4YHKH 1SLXA 5IOPB 2HVKB 5IATA 2QQVA 4YFLF 4XE9A 1AZVA 1QQDA 3KCWA 1TNFA 2I85A 4I3GA 3D0SA 1EV2E 2YC1A 3W2DL 1ED3A 3CCHA 5AG8A 4OLLA 5FP3A 5CAZA 4I13B 3B5HA 3U7YH 5D2LE 4QLRA 5JPMC 5G05L 5K59F 3E2HC 1Q0XH 4GSUA 5LDSA 3WNOA 5A33A 5J8OA 5I6NA 1SJHA 4FNUA 4B9CA 3W9EA 4Q52A 1NKOA 5JXEC 5GGTA 5F9JA 4V2BA 5HYQA 1T3FA 1MQ8A 2OJ1A 2JJSC 2XHNA 1ZEAH 3HNVL 4IKJA 3RTQA 5I19L 1WCDJ 4XCEB 3FB7A 2R69H 3ABLB 1X8MA 1SLTA 4PS4H 2JG8A 5K0UA 1F9KA 2O6EA 4PRAB 2CBMA 3D2TA 4IEVA 4R7NB 3VM5A 1OSZA 4FFWD 1N3PA 5LBSH 4PJ9D 2Z64C 2BNUA 3P9LA 8PAZA 3KJ4B 1H6YA 4Y4YA 4XNAA 3VXTB 1S7TB 2D40A 3QB7C 3BVNB 4MNQE 1I9JH 1BZEA 1WD8A 3IBMA 5BNQA 4PIRF 2CRYA 3FFOA 1J9QA 1B09A 1TXKA 5FP4A 3B2VH 1O7FA 3J8F2 3ZFGB 1HXYB 2VZ1A 2RMNA 1W8OA 4AQEB 4V1DE 1V55B 4K3JL 5C0JB 2HRLA 1U8CA 1Q90A 5JVVA 1GMEA 4D6RA 1ZLWK 2GTWA 2JTYA 2FATH 2P45B 4QRPA 3VD2A 5A3NA 5CEHA 2XZQL 3W37A 2D03H 5J11B 1VA9A 2HKFH 5C8JA 4B29A 2EABA 1PZ3A 3MJ7B 4ZTOH 5CGMA 1JI6A 4HOZA 3GMMB 1LOBA 3ISYA 1G9FA 1E4XH 2PHTA 1BJ1H 1JHTA 4HGKC 1I6XA 5CG9A 1KXHA 1T5XA 4QTIH 1WS7A 3FQ1A 4YSSA 1CZTA 1K5JA 2GP5A 5D7JD 3UTQA 3MA7A 1YEJL 4WSJA 3TV3H 1SMOA 5CKMA 5DABA 3TONA 5BVJB 3GSXB 1L7IL 4N0RA 3ZLIA 1AE6L 3EO9H 4MMYA 3QORD 5E6UB 2JB5L 5IVFA 4ESKA 5FAAA 4FPHA 3SXWA 4YVUA 3VV1A 4BDVA 4WFEE 3L4YA 4GKSA 3NGBC 4KVCH 5CUSL 2EZ0C 3UC2A 1S7QB 1HIXA 1DN0B 1FDLL 2EDYA 2Y7NA 3EJCA 3FUFA 1VERA 1XO8A 1V27A 3DBXB 3HAEA 2XBO3 4UQ2B 4BQ2A 4JJ5A 1G7IB 1G9CA 1L6ZA 2WCGA 5CJ8A 1JRHL 2GBAA 4HCFA 5TDOA 2RIKA 1DDHB 1F2QA 4D0CB 4PI2A 1TYEB 4LBQD 1KBKA 3VFPA 4L8SC 5FP7A 5C0AA 2NQ3A 4F92B 3ZLQC 3D4GA 2RS11 1NCWH 2DWEB 2PABA 5J7CC 2IALB 4TYUA 2VGLM 1Y9GA 1JZIA 1IFHL 2XB6C 2WP3T 3RZHA 5LN8A 1R46A 5FUZL 5IFJB 1KBWA 1R3LA 2AQ2A 2X3BA 3BZFB 5FYHA 2Z6FA 1OHQA 2H0BA 4RGGA 3L3HB 2HBUA 1JUHA 3GRWH 3QARA 4FP2A 1H4GA 3RYPA 3RZJA 1FFPB 4GBXA 4NQCE 4RVBA 1K4CA 4KTEL 3V0AC 4P5MA 5EEXA 1UX6A 1J5HA 1FUNA 5EEUA 2FJFB 4Y4KC 2BHZA 1UCBH 3C5SA 4RSYA 4ZQKB 5EOTA 3CNKA 2WQZC 2XQXA 1AXTL 5G5DA 1MRCH 4JBSA 1LGBA 1UYXA 2WLPA 5BZZA 4TXWA 4UW5A 1K45A 5E8EB 2WQAA 1KIQA 4J6RH 3GC3A 4UQ3A 3HFML 2YGLA 1M9WA 5GJ6A 1YC8A 2K78A 3SO3B 4E4HA 1QFWL 2DLTA 3O1PA 5FYJD 2NY0D 4UQIM 2XN2A 2FB4L 4RS5A 3ULVE 1EO7A 2EIMB 2KLSA 3MV9B 4H8QA 4UDTA 4CP0A 2JELH 2NY4B 2B8MA 2A6KB 1C5DB 3O3AB 3V6ZB 2XH6A 3NCBB 3PIQB 3WEBA 5ITBL 2W65A 1QJX2 3HI1A 1RUPL 2UWBA 4JGZC 3N41B 4M7ZB 3WJJC 1AHWC 3TYJA 1ADWA 4KH9A 1GZCA 4JHWH 5F7YC 4K40A 4WI6A 2DMGA 3HQRA 5EPAA 3ES4A 3ILNA 1TVDA 5FIEA 1JBJA 3DHMA 1J8HA 2WA4A 2RM21 3FZ3A 3LRGA 3ZKNC 3GIZH 1R0AH 2H2SC 2OMVB 2EDXA 2X6MA 2ESVB 3BAIA 4OT1L 2VD7A 3BB6A 3WZ1A 1VRSA 2VDNB 1KFAL 3JVGC 2IFRA 3QIBC 5DDJ3 4MA3A 3LGRA 2VDPL 1RHHB 1XIWB 2D8KA 4XHJC 4GG6F 2NOYA 2IBZY 3FQRA 4UDUB 3X29B 4KX8A 2XY2A 1KFUL 3FTGA 3V95A 2PLTA 3MLYL 2CO1A 4TM9A 4OJAA 3HZKA 4TUUA 1CIDA 3QS3A 2KZBA 4JM2B 5F6IC 1IZJA 3ZDZE 43C9A 5GZFA 1IGYA 1Y7VA 1PVC3 1U36A 1UZ6E 3T65B 1J9TA 1IGIH 4UT6A 1BD2B 1AFVL 1AZBA 4JRYE 3RX9A 4NFBA 1E5ZA 1JVKA 4X4MA 3OAYH 5DRZA 4E36A 1QMJA 3BSZA 2PNDA 5H9PA 4LBQA 5BXFA 3KPQA 5MENA 3HPNA 5LA9A 2CE6A 4D7TA 4LPYA 3MI8A 2Q8EA 2WYIA 1HFUA 4G8GE 1VPOH 4XAWL 2ZG1A 1UJTA 1F6AA 5I6XB 4JEGB 1ASPA 1LNUA 2C7UB 1POV0 1GGYA 1RFDH 5JI7A 1ADQL 3TN92 2OJEA 3KLQA 4Y7MA 4X4YA 4Z7OB 4TTDC 3Q06A 3N44B 1G1CA 3BP6B 1YJDC 5BNNC 1N0LB 4OGAD 3ZN4A 4AHYA 2V4LA 3NIGE 3VXQA 1WWWX 2M8XA 1DU3D 4Z7WE 5JR1H 3CFQA 2NMOA 3AGWA 4JPIA 3T0EC 5IJBC 1XV8A 3AKTA 2Q76A 5IBLC 1Z3GL 1LD9B 5GGTL 4XE0A 2HWE2 2ZEYA 4TN7A 3KYKL 5KBPA 2V5YA 1XNKA 4MADA 5HGDA 1YN7B 1KXTA 3SO5A 5A2LH 1MDAA 1TJGL 1AX0A 1SVBA 1Y07A 2W9DL 4X98A 5DD5L 3WINE 4WW1B 2WWMD 4JVPA 1QABA 2OXHA 4PJGE 2NZ9C 4P2QB 5DQ9B 3VXSD 3VZMA 5L19A 2R041 3ROOB 4QHKI 5A1LA 1DBMH 3C12A 2HX8A 5ACA2 1F6LL 5F7FA 4ABWA 1JTOA 2XZAL 1Q1JL 2BVPB 2OM5A 4R7XA 2EXJA 1QX1A 4LKDA 1WBZA 1W90A 4ODSL 3N9PA 2JK5A 4A63A 3MV8A 5CKGA 5I0WA 4LBLA 2C9VA 3A5VA 5FA3A 1NH6A 4XBPB 1C7TA 5FZDA 3CZUA 4DGIH 3QD6A 2AACA 1AHMA 3KL3A 5FYUA 3MTRA 3RB7A 1V9U1 4LKEA 1MRFH 3IXAB 2V3EA 2YPVH 3L3DA 2R49A 4Y88A 4WM7A 1JPST 5IK4A 3D52A 1Y18B 2K3TA 4Q9QH 1ZRCA 4PTUA 3JBG2 4NO4A 3LJ3A 1J7VR 3FU8A 3X1GA 3NH7H 1TPXB 3H53A 4IEPA 3X14B 3LOBA 3K74B 4LL4A 4CGUB 4HJJL 4F8NA 1IIIA 1EZVY 1XH0A 3WFZA 5KSAC 5I1AB 4G6KL 3R1GH 4KNQA 1QQP2 5IROD 1VBC2 3HE7C 2HEWF 1ZGLM 5B7MA 3PMSA 5F97E 5SWZD 3S34L 5DJDA 4HPHA 4MO3M 3NPSC 3V0EA 2HG5A 4R9HA 2Y36L 4NQEB 3SKNA 3D3AA 4JCKA 2AXGA 4NNPL 4PUBL 5INCB 2V17L 4JO3L 1U2YA 3RZCB 1RINA 4I3SL 2D7PA 1MWAB 1KJ2A 4FXTA 3TEXA 4MDIB 5I6MA 5AVTB 5HHXH 3EHKA 5FWRA 3LNGA 1VBE1 4EJ1C 4X9HA 2HT3D 3A4DA 3FRUA 5FYLL 1UM6L 1ZIBA 3Q01A 1M6OB 4XAAA 5K1NA 1MR5A 3VBOA 4WWOA 4AGVA 2VDOB 2EYSB 3GMNA 3NA4A 5A6LA 2LS6A 3ECUA 4DUVA 3NEOA 1DQ1A 5DSCB 5DVOA 5K4LA 3HNSH 3TRSB 3T8VA 1S7XB 5DD0L 3LQZB 5EO0A 4XMLL 4A2GA 3B7UX 2ZACA 1U93B 4Z7VE 1XNCA 4KK8C 1NDMB 3D39D 3RWFB 4XMKH 2ZNWA 3EKCA 3LKRB 5B8CC 1UZVA 1VBD3 3AK0A 1HRI2 2NSXA 3ZHKA 4TNWK 3VGIA 4ZS6C 4K20A 4QOKB 2GAZB 1MEC1 3OZ9H 1KGJA 2PO6D 2Y6FA 1ZA3B 2V33A 3KPNA 3X11B 4QXHA 3UIZA 3ZSTA 4CA4A 2A4EA 3QUZB 4JQXC 1N3NB 2ZMKA 3KYOA 5FFGA 5CFDB 3FCBA 4ET7A 5FHBH 3MVSA 4FQXD 1AL22 3GO1H 5AVYB 1CDJA 5IK7A 3ET9F 3TBSA 1Y43B 4QB1A 3TYFA 1GYCA 3DRQA 2EIJB 2JG9C 1FHGA 1MAJA 4HSAC 1FRGL 1QAWA 1RPKA 2X2JA 3KL0A 2ITDB 4FULA 2HN7B 5T5FL 3TESA 1LEMA 5KHHA 3JWDH 3K2MC 1N6VA 2EXYD 2O5XL 5DRXB 1JHKL 1J5OH 1LE9A 1XF5A 4TQ8A 2Y7MA 4MMZB 4P2YA 1TYJA 4GMTL 2EEBA 3JTTA 4PJXE 2WBXA 1R3HA 1YY8B 2C3XA 1KZQA 1YMME 4HIPA 4R96B 1YAZA 4L37B 5CN2A 1XXNA 4NXSA 2G75B 3HI6L 4DEUA 3OKLA 3UTPE 5BPXA 2F7OA 2DRUA 1C3HA 4N90E 2J1WA 1QDCA 2HKHL 4I7ZC 1NWPA 2RD0A 2XV0A 1ENQA 1PGL1 2I2SA 3VG9B 4YDKL 4HH8A 2RCSH 3OB0K 1CXKA 3MC0A 2X41A 3MRJB 3NFSL 3NCCB 2H6CA 3IFNL 5TGBA 5D7LD 1DLFH 1DYZA 4OGQC 2CU9A 3LTVA 2Y06H 4MD0B 1OMIA 3TT3L 5DJCA 4N9IA 2OBGA 3AL5A 1F4YH 2A9DA 5DLMH 3SCMC 1UZGA 5GSRB 3MV9E 5IQ7H 4KK9D 5SWZA 2D3VA 2DOCA 3MCLH 4ZTPL 2HH0H 1CB4A 4GQPH 5IW1B 1W6NA 2YZ8A 4B1MA 1E50A 4A2FA 4M6ML 2P2KA 4N3UA 3LRHA 4P5TA 1OAXH 3HHRB 2KH2B 1XT5A 3E5QA 2WUBH 4JY6B 3V9EA 2CR6A 3KNBA 3PABA 5C3IA 4GT7A 3P9MA 5BV7B 1ASJ1 4YW5A 1YWKA 3E2HB 1T03H 4ELKA 4LSTH 2ORBH 1G6NA 1AXYA 5KANI 2DQHH 1R3JA 4YHNA 3UBXA 3PS6A 3ZR6A 3KMDA 2YBRA 3K0WA 3D7PA 4NUGH 4GG6A 1B0RB 4J3SA 3QEHB 4KQ3H 4KY2A 5DMIL 4CEWC 1BG1A 3GIVB 1EEQA 4GSRA 1IC5H 4PVMA 2J1ZA 3ZK0A 3QQ3B 5GRZA 3IDNB 4QJ3B 1C1EL 1GYVA 2VXTH 2WBJD 2H6UA 8CGTA 4TXVB 4DVBA 4V2VA 2R56H 2VDMH 2VT0A 1IPJA 4LLVA 4LIQE 5GLWA 2WO3B 3WE1A 4GB9A 2VQ0A 1ZRIA 1KEGH 3CLFH 5FY0A 4U05A 1KXGA 3TCXA 2JIJA 4XOGA 5C3QA 1UYWL 2B59A 4WHDA 1G9HA 3VXOA 1JGVH 1X5MA 3NZSA 1URXA 3AU0A 3V5DB 5CIPB 2PO6A 3RVUC 1OTUC 2YQ3A 2A6IB 4HIEA 2X0VA 1IBGL 3TT1L 4AEIH 4DFIA 3GGWA 1RK0B 1YQCA 4JGYC 2D3RA 3ZFFB 1YA5A 2WZR3 4Y22B 2B42B 3LDBB 2IDSA 2WVSA 5F3HA 2G5UA 2NMSA 2K3HA 4KJWD 5D1ZB 4JR9L 2ZZJA 4YDVA 4QTFA 4ABQA 3MXWL 2APVA 3BOWA 4NO5B 3T3PE 5EC2A 3IKWA 3CMOL 2E7TA 3VBRA 1QJU1 2BP5M 3EJYC 2CYFA 2DUPA 4E9XA 4MBOA 4HZ1A 4AM0A 4POYA 3HPLB 3TZVC 3CN1A 2YAPA 1MSPA 3O3BA 3PNWA 3NA9L 5J6GB 5ETUB 2KA3A 3OGGA 2ZKWA 3NZ8A 1W15A 1ZE3C 1AR2A 5FWEA 5HHVH 1RJLB 5JOPE 2CGRL 3BUYB 1WC7A 4P5HA 3KJ6L 5I16A 2CK0L 4PP1D 4TQHA 2WA3A 5F3IA 5K8SA 1M2VB 5FYJL 5A3IC 3C09B 4R5XA 4COYA 5KSBB 2ZHMA 3FRPB 2BVEA 1T7YA 2PR4H 4XPHH 3PP3K 2O6PA 3L8QA 1JCKA 3GBWA 1GPOL 3U1QA 3LH9A 4ZPVA 4BQ5A 4PDWA 1I8AA 1EAOA 3IM1A 3NGBB 4D9RE 4ODUB 1A3LL 2C4XA 2YRBA 3EB7A 4WEMB 4Y4FA 4HX1A 1AXSB 1JXDA 3AM8A 3JUYA 3TS8A 4D2NA 4HK0A 2UUDK 2H26A 1OCCB 4PVNA 1Z5LA 3GBNH 4UNVA 5CLZA 2KBGA 1YJKA 3L5XL 3C2UA 4XTRD 3NFNA 1GH7A 3VXMD 4CCEA 3C5XA 3HOBA 4LQFH 3OAWA 2WIMA 3PNAA 2O5ZH 2WWKO 1LWHA 3RIFF 4LOEA 2YD8A 3FHAA 5A6XA 1BLNA 1RUF2 5A6YA 1KPUB 3R7QA 4PRDA 1KJ2L 4NVPA 1N2RA 1PD6A 1SXSA 2D7NA 3SPVB 5JA8B 2GBTA 1IIKA 3B9KA 2KDYA 4CSZA 1REEA 3DUSB 4Y1XA 4OZFA 4ZI8A 2N1KA 3Q9OA 4Q4W3 3HB3C 5I15L 5D96C 2FCUA 3MICA 5LXVA 4LASL 3NJKA 4BE5A 2OZ4H 4IMKA 3H42B 1NCRB 2ICWB 2X2UA 2ZHNA 1FH5H 1ZE3H 4MCNA 4KWKA 2ZXCA 1N64L 2A77H 1CT8B 4D3CH 2N56A 3V0AB 2HWF1 3MRMA 1DDLA 1J0KA 1ZA6A 3EH2A 2VXUH 5GGQH 3S5QA 3T2PA 1A66A 4Y4KB 2F1EA 1PQZB 2VN4A 1KG0B 4NGHL 4RR3C 3CVIH 3TVMD 4ACPA 4IV3C 5JW4Q 1TETL 3A4UA 4LBEA 5DZLA 5KYWA 4AAPA 2QVFB 3C6LC 4N8VA 3K80A 1UO9A 3MRFA 2G3MA 4LVNC 3SKOA 3CL1A 3I50L 4AZ8A 1RJYA 2QQNA 3VJ6A 1Q8MA 5HD8D 5J9PB 1MHCB 5DQJB 4ZFFA 3LQAL 3N0AA 2VJ8A 1NCAH 4FQCH 5IKCB 2VMIA 4Z07A 3T1LA 4IRZA 4OHVA 2DS4A 1YYCA 3ARFD 4LBNA 3BPOC 4UOJA 4FERA 1BVLA 4J3XA 4XP9H 3T2QA 5DI8B 2GITB 1TZOA 2E7MA 4J7RA 4JGZB 4N2KA 3U4EB 1UMHA 2XWZA 2DWTA 3DF0A 3CJIC 3NMEA 4IGPA 3C8KB 3N41F 1SGKA 5FB8A 2XNAB 4PYGA 4ZDHB 2PYFA 4WTZA 1F6FB 4UINL 4LLYB 1UPSA 4NN0A 2R8SL 5FYIA 2HBTA 5AVXB 2H47C 3HC3L 4NAQA 1E0OB 2JI1A 4HT1T 2G3NA 3DGGA 3SPIA 3PJNA 2VUAA 4R3SA 4OGZA 1CIWA 2KI6A 2VSMB 3FBQA 3SDDD 2AKRA 5IB2A 1X4YA 2IQ9H 3QIUD 3QIBB 1G7PA 3EGDB 4PU2A 3SYAA 1G86A 2B5HA 2LM3A 2H6PA 1XH1A 4NHMA 4KY1H 2PFWA 4IEUA 4ZXBC 1IQDC 5DJAB 4MCZA 2ZX0A 4QLWA 1UKRA 3FTUA 4N43B 2OP4H 3Q13A 4I30A 1O3TA 3NIDB 4GQQA 3D85D 3T9WA 2CCVA 3DKWA 4GH4C 3VMOA 1IBDA 3WDHA 4B96A 4QX8A 2FEJA 5EWIL 3WF2A 1MI5E 2DKUA 1DSFH 3BLBA 3UEZA 2F53E 3KMHA 1UOVA 1Q8VA 4XOEA 3HZ3A 3SCFA 3VWJA 2WXPA 1UATA 4GAGL 2BO0A 3BP7B 2QHRL 1BIIA 1AR1C 3D4ZA 4M4PA 3I3EA 4PY8I 4XGZB 1UOGA 2GN3A 1NJ9B 3FLPA 5AOZA 5I5IA 3ML8A 1XB9A 3ZXKA 2VMFA 1UUNA 3D48R 5D1XE 1HIML 3GZKA 4YHYB 3GSVB 4JDTL 3P02A 4G80A 5CEXB 2FECL 4NEHB 3TIDA 4ZU4A 1YFWA 3FQUA 4CCKA 4B53A 2E7AA 2C8NA 4U6VH 1POV3 1WUNT 3RGVD 1HCYA 2APFA 3VXUE 2Q87A 4Z7OF 3TBDA 3MCKB 1FAKT 4KH2A 4HJEA 3BAYA 1MHEB 1OPOA 1RMFL 2PLV3 4KG8A 2UZYA 3QQNA 4G9DB 3ZE1B 1TJHL 2W08A 2DD8H 4QRAA 4J8RB 2RACA 5EZOL 2WFF3 3TCLA 4FNLL 4J3OD 1JS4A 4Y9CA 3BMVA 3VHRA 1U58A 4C55A 4S1SH 4ENED 4Q58C 1HJBC 1OD3A 4K7PX 2GI0A 1AO7B 2LU4A 4R8WL 3RDTC 1SVCP 1RJ8A 2CG9X 2NNFA 3O4LB 5T3ZE 1D3CA 3TVMA 4CVUA 3J8F1 1NWOA 2IPUG 1ENXA 1JI1A 5E2VL 1SOKA 1EPZA 3H85A 3U9UB 4E5XA 5EN2A 4XCEA 1CJDA 3KHOA 2KZWA 3MU3A 1OGAD 4PRAA 4L3CA 4MMXC 4WGKA 2VDRL 5LEJA 3LOIA 2IAMD 1A65A 3O2DL 4YDLB 4NWUL 3JV4A 1GC1H 5IWFA 2OLDA 1FJ1A 4MVBD 5HVWA 1U8OB 1S0FA 3MLXH 4TSBL 3NTCL 4LSRH 1RUC3 3X1FA 1OIOA 4FABL 4KKAD 3QZPA 3PNRB 1U91A 3SE9H 2B4KA 43CAA 2VVDA 3K1DA 2ZSVB 4M5TA 3ZFGA 4GUQA 1HXYA 3ATEA 4KKZA 5HHOB 1DVUA 3Q6GL 3A6OA 1AYN2 2JDMA 2VR5A 1G9MH 4R4FL 1E6OH 4TS6A 5I6LA 1OTSC 1DVTA 3WNKA 3DX6A 2YEVB 3VXPB 2UXTA 2B20A 4N8MA 2NPLX 3REWB 1W99A 1NL0H 4AENA 3ETQA 4BQWA 5F3GA 3QO0B 3QRGL 2Z7ZA 4TLGA 4UBDC 1ZGLA 4WNQB 4PWHA 4PS7A 1RYYA 4HQQH 3WOVA 1MS0A 1BMWA 1IMHC 4XNUL 3L13A 4N6QA 3ILPB 3W2DH 1MS9A 2FWSA 1DANU 1JGIA 1KF9B 4AH2B 3K6SB 5IV2B 4LULA 3DN7A 4EKXA 4NYLB 1I4FB 2D6MA 4BFGA 3D85A 3GSXA 1NANH 2CHDA 4ZAKC 1YQ2A 5DK2B 4UV7L 5GQBA 3WHE1 5KSBE 2FDHA 1VJ2A 3HR6A 3APBA 5FLHA 2QQKA 1CPUA 4DXZA 2CBOA 1ORQB 2P24B 2XXMB 4M9PA 3HNVH 1FG9C 2A5ZA 3GZAA 1S7QA 1KJVB 1DN0A 5DFVC 2MQGA 3DBXA 4UQ2A 1AX1A 1CL7I 4QRUB 1G0XA 3RNQB 4JZJB 4Z1PA 3CFIC 4I3RL 4R7LA 2B2XH 3W9DB 2KHAA 1BX2B 3MJ9A 4NOBA 4P5RA 5LCVA 2R0LH 5AFEA 1DDHA 5C1MB 4GEJA 3TJHD 4JKKA 2ZGUA 3AXDA 3IDMB 3G9VA 1O7DE 3RGVA 5TTRA 4EN9B 2Q10A 1E5AA 3QXDA 3EJJX 4JN2B 2V2WB 3QCWA 5TPWH 1PO13 2ORZA 2KD7A 5A3LA 1AS6A 1G7HB 2I07B 2ZCKL 5DC2A 3WGUB 2JG9B 1NLRA 1BCIA 4K3JH 4OLWL 1ZREA 3DIFB 5IFJA 3MX0B 4H8PA 4TLUA 4PJCB 1JN2P 4IEYA 3FMGA 1SPDA 1CFQB 3HG3A 3NJFA 1KTLB 4S1QL 5CZXD 2GSGB 3W0WD 3VSUA 2XZQH 3L08A 5T3XD 2Y4SA 3DNKA 5GGSY 1U2HA 1XRUA 4G3YL 1FFPA 2QQWA 2DQGL 2H4EA 3DWTA 4XXWC 4HK8A 1OALA 1JZ6A 1M3IA 3P73A 3DX1A 1JK8B 1QJX1 3WKYA 1OGAA 4XUOA 4BIFA 3D0VB 4OZ4B 4U6YB 3L45A 2G5BB 4M6AA 2YWZA 4PTTB 4X7EC 5FM5O 4K9JA 3LPOA 3MGUA 1JE6A 5T1MB 1TLMA 3QG7H 2EDFA 2GJ6B 2OUJA 2GU9A 2WK2A 1N9PA 3T3MB 2VH5L 1OB1B 3TIEB 2RS53 4E9WA 4LP8A 3BRFA 1F0LA 1L7IH 4F8TA 3K5SA 2W9EL 1AE6H 5AKRA 5F8QC 4G1MB 1GS8A 3O9WD 3VHPA 3KCPB 2NY5L 2JB5H 2ZQKA 4ZW8A 2WR9A 5AVSB 1HHGB 3H3KA 4LF3B 4IE5A 4XUPA 3BRDA 2XCMC 4X8XA 3EGXA 4YLQT 5CUSH 4MQTB 2FDFA 3Q7JA 3CJJA 3SCMB 5DMJB 3FS9A 4YVNA 2MNWA 3N55A 5EUOE 1DQLL 1FDLH 4OZIE 2A6KA 1C5DA 3PLYA 3U30B 3KLLA 5EO1B 1F11A 3UDWA 1AZNA 4K9EL 3WXPA 1JRHH 3L4VA 4OJEH 1V6JA 5I8YA 3MFCA 2N1TE 3Q43A 2YA2A 5C0EB 3WS6A 4S2SB 2VUJA 3MXVH 4I01A 1I1YB 5E56A 1RMU3 2WABA 4PJIF 4JG5A 5JHLA 4Y24A 4QO1B 1ZBA2 1EDHA 2WXMA 3QSKB 1WAAF 4YDNA 2RJKA 5JSRA 4P49A 2ESVA 4PV8B 4Y9GA 4Q4EA 1DLLA 1GVIA 1IFHH 1SZNA 3N2JA 2JIXB 1XF3A 1R33A 4ZPIA 3FT1A 4XVTL 5FUZH 3RL1B 4FYRA 4CEWB 4HALA 1RHHA 4OI1A 3ZDXE 2XDVA 3V0FA 1QSZA 3WF4A 4UDUA 3VAEA 3ZMRA 2C1FA 5G04L 1MQKL 1AYRA 3QJFB 2R32A 1UKSA 3TN91 4NAOA 3F5WB 2CWMA 3B8SA 4M8UA 4OKDA 4TNEA 2AANA 4L48A 1CAXB 1CFVH 1SFNA 5LBCA 4Z3JA 1VAVA 1XDTT 4JZNB 1SACA 3S5LB 2A6ZA 1LGCA 3KPSB 3T65A 2XLGA 1BD2A 3OKDB 2PA7A 2ICWJ 2HWE1 4LBKA 3S98A 1CYWA 2A3TA 2HT4D 2OULB 3AG2B 4BZ2L 2BY3A 3PHMA 4I9WD 4B60A 1X7SA 4HWBL 2R6QA 2VECA 3QG6A 4CN1A 1JRHI 5FZKA 4K23L 3IFLL 2ZX7A 4WVWA 5IF0B 2XTSA 1I1RA 1QFWH 1TCRB 3OWRA 1T7WA 2AZAA 4U1NA 5IHHA 3ACHA 3K3OA 2C7UA 3KH4A 5ACA1 3H9AA 2XWTA 3VD1A 2FB4H 1Q1PA 3FFQA 1MCKA 2EE0A 3QIWB 5A6IA 3BP6A 1IOAA 1N0LA 2W07B 3P4LA 2FZ1A 3QUMH 3W0WA 5ITBH 4NQQA 4BFKA 3HCVA 1RUPH 3U4BH 1ID2A 2H0EA 4YVWC 3C60C 3B93A 1LD9A 3T0EE 2HTLC 1VGEL 1E7VA 4ZK8A 1II4E 5F3CA 3J9SA 3HN3A 1WZMA 1BFSA 2WNWA 4Z76A 3RWIB 3VD0A 3JBG1 3OC5A 4WW1A 3B2PA 1GOFA 2NNRA 3H4FA 5EDXA 5DQ9A 3FQTA 4P2QA 1W6PB 3GBLA 5EHDA 4OT1H 4JPVH 1LR5A 1OQDA 5CZVH 3FFZA 1Z5YD 2NY6C 3MNMA 4L29B 2CNZA 1KFAH 1MZ5A 4J12A 2BVPA 2YQGA 4GMSL 1QQP1 2MPFA 1VBC1 3W39B 1ULEA 5BMFH 1ODNA 4H8WL 4FA6A 2A4CA 2HRGA 1Z1WA 3OGOE 3LVTA 5E5LA 2P5EE 4K1YA 5JW5A 3FCGA 2XPGB 4QEGA 1AVBA 4LOSA 5FA4B 4XBPA 1F4AA 2EKSA 3LD8C 5BPPA 5DHVB 2MMXA 3QQXA 3MLYH 4GRLC 3SGKA 4EOWH 1KD7A 2P8MB 2MH4A 2KKQA 1SXZA 3P9WB 3CF6E 1N1SA 4A2UA 2VNOA 3IDXL 1A7RL 3X14A 2YOAA 5IEKB 3M17A 3BW9A 1EFXB 1SXNA 3OZLA 1OUSA 1UIJA 2GTZB 3L4XA 4G9FB 3WLWD 1WMEA 4BM7A 1KYFA 3IRZA 4G43A 2R2BB 2PTUA 2VRQA 4M29A 4GJYA 5J09A 4N0CD 4QM8A 4WI7A 2K9ZA 3ITQA 4NQEA 1ZTMA 1ADQH 1KBVA 1MUJB 1U95B 5BRPA 1H9VA 3SJVB 4D0DB 4BFNA 1UA3A 4JANB 1J59A 2PTTB 3F7YB 5SWQB 1MWAA 4MDIA 2HKAA 3HG4A 5LVEA 5DK3A 1HRI1 4KJPC 25C8L 3VD9A 1PSKL 5A3MA 1M6OA 3ULUF 1TQ5A 1Z3GH 1IM9D 5E6IC 3WFCL 4Z5RB 2W39A 2RFXB 4UQ9A 5C0CE 1VENA 3KYKH 3EOYG 3ZDYB 1F2NA 1B88A 4F8AA 4GKLA 3URFA 1G7JB 4N9OB 5E7FA 2BU9A 5DD5H 4E2SA 3BDBA 4UYQA 1OT5A 4TL4A 2QBXA 4IV3B 4DNYA 4AIZA 5KC5A 1E4KC 1AL21 2Z4QA 1TZGH 5DZNA 3PWPD 4R4ND 5ABDE 2KLTA 4GQ9L 3QYCA 5LCVL 2B7DT 5INDB 1U93A 4G8IB 4LVNB 3KLSA 1Q1JH 3WO3B 3IGKA 1NDMA 2X3CA 4P2RB 2GUOB 3DL3A 3P2BA 4ODSH 5ACLA 2Z93B 2CDGB 2ZEZA 2LABA 2DVGA 4NQSA 3CQFA 4PR5B 1RITA 3LIHA 4K3DL 5HHMD 5EF0A 1BKZA 4FLSA 4QOKA 5EOQH 3BZDA 1I5PA 2GAZA 4NHCL 1SJEA 4CJ0A 1D5BA 5LA1A 1M56B 5KVEL 1ZA3A 4KNTA 4M48H 3G7DA 4HMZA 2VDKB 3U48A 1WF5A 4FQ2L 4ANUA 1F56A 1IKNA 2ZGRA 3SEEA 1M7IB 3P54A 3CJIB 2ZOUA 3NAPC 5H4YA 3UJIL 1PIV3 1I9RL 3AG3B 3OHXA 3RPQA 3CN0A 1YCIA 2OVUA 1OARL 3LSOA 3MRLB 4HJJH 2OPKA 1B35A 2BBVA 3LKQB 4M3JA 3UTZB 4G6KH 1UIKA 1MFDH 3ELAT 4K2UL 2HN7A 1N8ZB 1NKRA 2Y69B 3HLAB 3L95B 1HT6A 4RGND 4D7SA 2WYFA 3S34H 2QTVA 4LOFA 4A6OA 5DRXA 4TLTA 2XYBA 2BVUA 3WL9A 2Y36H 3S37X 3KCCA 1GCFA 1K42A 1U12A 4PUBH 4YGVB 4JO3H 1PK6B 2IH3B 3C08L 4MMZA 3RDJA 4I3SH 1VMFA 4ASLA 4ZXBB 1CQ9A 2EDKA 1YY8A 3R0RA 3LXBA 4L37A 4LT5A 1B4JL 2BOBA 2G75A 3AG1B 1RIVH 3GI9L 4QGYA 5FYLH 1LECA 2EA7A 2IUWA 3WLUA 1UM6H 4KZCA 4IESA 3KLHC 5IG7B 1LGNA 4UOZA 3GXFA 4OQTA 1FH2A 5IREA 3NIDF 5HDQL 3E6CC 3FPYA 2RR13 1L3NA 3N85L 1NPUA 2FL5B 4JCWA 2MJWA 5DHMC 2PXYC 3BCDA 3MRJA 1ZLUH 3SQOL 1SYSB 2D7QA 3CUPB 3F05A 5DD0H 5LB1A 4Q8LA 4AOCA 4O7XA 3CXHJ 1H3UA 4MD0A 1L9PA 7PCYA 5JHDE 1W3XA 2W87A 2QKDA 5GSRA 3VI4E 1VAMA 1S0IA 4C8DA 2FBJL 1JWSB 2G9HB 5CR8A 2HWD2 4IS6B 4BK5C 3AQXA 2X29A 2ZGSA 4XFCA 4WAFA 4JFEB 2W0LA 2VMDA 1NCUA 3DRTB 4B0MB 3N35A 4GWIA 4X6CE 4U1MB 4A55A 1BYHA 2BV4A 4PJIA 2O8OA 3CSPA 4AQ2A 4R7DB 1XR8B 4JRXD 3PYCA 3L3IA 1BQLL 1WAAA 3C2AL 3L5HA 4JY6A 5JUEL 1PM4A 2XYCA 3G5XB 2DYSB 4MASA 1F90L 2WSDA 2ZYIA 3IGAB 5K33A 4PJEF 3DXTA 4X6BA 2QQQA 1L0YA 1JHLL 2B5IC 3V6OC 3PWUA 1KGUA 3VD7A 2R1XA 1FRGH 2IC2A 2K6WA 3IJ8A 4QAWA 5T5FH 1J84A 4W9DC 1B0RA 1MIML 3QEHA 2EUZA 2GEQA 3GIVA 3ULUD 3TFBA 3SDAD 1JHKH 3EADA 3KLAB 3PWPA 5A3UA 2I5YL 3GSNH 4WEEA 1K2DB 2ENRA 1KRIA 2A9CA 2X7LB 3VRJA 3VA6A 4NUQA 1M3JA 4QXGL 3V5KB 2BNRD 3IDYC 5F6HI 2N01B 1UU6A 2WO3A 5F89B 4W9IC 1V6KA 1X9UA 3CK0L 1U8LB 3VNYA 3HI6H 2F4LA 2RMU3 4PB9L 2BFUL 4MAYB 4O61A 2DF7A 4L5FL 1FG2A 2HKHH 1SLVA 2W1NA 4AIXA 5FK9A 3PWLB 3NIFB 4JTNA 3B34A 5CKAA 4Z0XB 3GSOB 4CDUC 1MQTB 4YDKH 4LCUB 3AMLA 2Y23A 3ZFFA 2V5MA 5FRAA 3A6BL 4NPJA 3NFSH 4JCMA 5TE7L 5LNGA 3IFNH 2X89D 4Y22A 1DJZA 2XSKA 3L4TA 3LDBA 3GNML 3SGDI 4L99A 1H3VA 5E5UB 4DAGL 5T3XL 1YY9D 5AL8A 3KWUA 5D1ZA 1R1A2 4AHXA 1HN0A 4W6YA 2H41A 2ODHA 4NO5A 4KO6A 1CICD 1RCYA 3DV4A 2CUMA 4W4OA 3EDDA 1H8TC 4NO0B 3H9YA 3QDGE 1S5IL 2YLKA 5GHWH 1GY2A 2OS2A 1BJ8A 4FMVA 5CU9A 1WH0A 2ZT9C 1MCJA 3K46A 5J6GA 1REDA 5ETUA 1L4IA 4X99B 1AG0A 5CD3B 4Y2DC 3Q5OA 2JNZA 4ZD3L 3NV4A 2UY9A 5B1JC 1RJLA 1GOGA 4DP9X 2ITFA 3BUYA 3S3DB 3E1ZA 3DPBA 1NMAH 1CE1H 5CN1A 4QRRD 4ELMB 4F37K 3I2IA 1M2VA 4ZAKB 1G6RL 3ZKMC 1RUF1 4UU9B 3VU1A 4ZMXA 5DMIH 3T2LA 5LKNA 4NMIA 4JPWL 5EIQA 1L9MA 5A7BA 2DH2A 3I6SA 5DZOA 3ES1A 1NQDA 4PQQA 1UWFA 1XGQA 5FDYA 1WGPA 1FZKB 5IQMA 1KJLA 4XP6L 3RWHB 1JYCA 3MNWA 4S1DD 1IAKB 4YHOL 2JICA 4J3OG 1HXS3 3KBEA 2H32B 1SMVA 1UYWH 3ETSA 3U0TB 1UB5A 1HEHC 1ZHKB 3O0LA 4JKNA 3WY4A 5CLTA 1NDTA 1Z7S2 1BAWA 4L8CB 2ZKNA 5E1AB 4FA7B 1EY2A 1J0HA 1IBGH 4JRXA 1IE5A 1YC61 4AFAA 3ZGHA 1KPUA 5K9KB 1IBZA 4H1LB 2XVLA 4RAHA 4G5ZH 4YHIB 5DWUL 2OK0L 2CMRL 3DUSA 1S5HA 5AOKA 4JRFA 3CFJB 1FFNA 3ESPA 3MXWH 2FEDC 5HHPB 4CAGA 3WNIA 2XLAA 4LBOA 4AFDA 2C1PB 1M1XA 2BCMA 3G04B 35C8H 3CMOH 2W0KA 4L9LB 4U3XA 2L7UA 1NCRA 3OJMB 3ILFA 4P9IA 4RGAA 3T4HB 3SDAA 3WUDA 4FYTA 1HEJC 3SCGA 1VEMA 1CT8A 3L5WA 1ROWA 3S97C 5GZNC 3BEWB 4GXVH 4JQRA 3NA9H 1DL7L 1ZCRA 1N47A 2QADB 5D7IB 3QWOB 1EJFA 4IJTA 5DK0B 1FNEB 1XGRB 2CGRH 1PQZA 5BRQA 1KG0A 2DBLL 4XNBA 4AGQA 1WMXA 3CBNA 5IK8A 4EAEA 3KJ6H 2CK0H 4JFDD 4AV5A 2V0AA 2XIBA 1OM3L 5T5JA 4LEBA 1RUKL 3G7TA 5CEYB 5HY9A 4G8FB 3GXUB 1ZXKA 2ZKHH 4FI8A 4HFSA 3U79A 2F8VA 3ALWA 3T3MF 1HK6A 4Z92B 2ZGPA 2X89A 5DQJA 3JQWA 1T20B 4HWNA 4RRPM 3KXFD 4YFLI 5BW7A 1H3TA 4KXCA 3WW1A 1Z0MA 2CK2A 1IFGA 3EYQC 1A3LH 2AS5M 3X3FH 1DHKA 5DI8A 2GITA 4B1LA 1CICA 1ZT7B 1WT5C 1C57A 1M57B 4NI3A 1IO4C 4JGZA 3U4EA 5LA2A 2OL3H 3S8WA 2G9GA 3HZMB 1LB2A 5D9SA 3C8KA 4C83A 1JWMB 4Z7NE 3UZQB 5CJXA 2DEYX 1AJ7L 4DK5A 2AEQL 4AYGA 4LLYA 4UIKL 3EG9A 4OGYL 4W9GC 2YRLA 5IUCA 4CXXA 1WIPA 1VZHA 1AR93 4XP1H 5FFOA 5J89A 2DJUA 4P2OC 4YG6A 3ZIMA 4BBWA 2J3SA 3JVGA 2R29A 2NY3D 3ARBD 3CIQA 4P8QA 5I15H 2C3HA 3AITA 4Y5VB 3SYPA 4LASH 2ZMNA 4IEOA 1BSIA 4J25A 4YW7A 5DJAA 4WWPA 3CU7A 4AV0A 4OZHE 2J6EH 4FPOB 4PW3A 5IHUL 4U2AA 1N64H 3TYGL 4N43A 4XACA 4OV6F 4CXWA 5B3JF 4HJ0D 4BFIB 1KV7A 3D4KA 1FZJB 1BVKB 3BVUA 4Y9EA 4RZKA 4BHUA 2ICCA 1RIHH 2PP8A 2BVVA 1BREA 4NGHH 3UTTD 1DGWX 1LP9E 1SJXA 4LUKA 1JZ7A 1LEGB 4H40A 4QPGC 1NZIA 3BP7A 2F6BA 3MRKA 4XURA 1Q0EA 4PSPA 1SFHA 2VZOA 4P2AA 3U1SL 5SX4I 1KTRL 3ZSSA 3EHBC 3I50H 5K5YA 5FXCH 1KGXA 4POUB 3GSVA 3BODA 2G1MA 5AW2B 5CEXA 4TTGA 2CWSA 5IESL 3VYNA 3R4UA 1QO3A 4PJDB 4DN4H 5JMOC 4F9LA 4DW2L 2EXWD 5KBMA 1RULL 4JKPL 4CU8A 4LSVL 1HW5A 4OUSA 1MHEA 2YMXH 4G9DA 1D6EB 2EDDA 1BVNT 3C5ZC 1O9VA 1Z6JT 1CLYH 3C60B 4PJEA 1EV13 4XDPA 2WCSA 4YVWB 4I88A 3ZQXA 4DKAA 2ARBA 3F7KA 3M3IA 2UXFA 1X5LA 3GJFH 2VLRE 4KL1A 4UINH 3V4VL 2R8SH 1IGFL 3R4DB 2P5WB 4L8BB 3K6DA 1NE6A 4P5YA 5DT1L 2PQQA 3ZN5A 3CFMA 2NY6B 4N1EA 4GI9A 4QHMB 5DC4B 4E68A 1AYN1 2E6PA 3MIHA 5C0GA 3KVPA 3B9AA 3RPBA 3ZTJG 4ES9A 1UWWA 4UF0B 5DUBA 2YUXA 4M3CE 4MJIE 1T0OA 3ZYGA 1COV2 3ASNB 3MO1B 5FM8A 3SDYL 3N1FC 4EIUA 2R51A 4MD4B 2GJZA 3CX2A 3M3OA 4OFPA 3KXFA 1CDGA 3ZX7A 2Y5TA 4F7EB 4GRLB 4GKZB 4B9IA 1U8OA 2BGCA 2R0KL 1HWWA 4X83A 2WM0A 1R082 4KJQC 2XX1A 5B4XA 3GF8A 5D2NE 4PLMA 3OLGA 4GAGH 4P05A 2QHRH 3GXDA 3IN0A 2BIPA 4HJGB 5IW6B 4CSWA 5BS0B 5LCWL 1T0NB 3ZOAA 1Q9KA 2OTUB 2DKSA 4V33A 5IJKA 4PF1A 3KYNB 4M5ZL 1AS8A 3FU7A 4HXAH 3VXPA 1CC3A 3EJRA 4IKNA 1LTEA 4XXDB 4QYAA 4ZSOB 3REWA 3UAJD 3LIGA 3SMHA 3WDTA 4FA8A 1KIUB 4ZMAT 3QO0A 4QU2A 4W4NA 4KU7A 4LLQA 1FYTD 3VBSC 1RMFH 5C08E 1CDYA 1LO2H 1CWVA 4UNTA 2OSYA 3ILPA 4LDEB 2Z2SB 4AH2A 2ZAAA 3NYKA 1VBB3 5A80A 4FNLH 1E4HA 4WV1C 5HYIA 5KYXB 1WZ1L 4NYLA 5FP8A 1I4FA 2NYYD 1F3JA 5L88L 2A5UA 4WO4C 3VFRB 1MJ8L 3EJZC 3ZDYF 5DK2A 4QJ5B 5DURB 1VBA2 3SDXE 4BA0A 2ZXAA 3MLWH 3L3GB 2W80C 2YZ1A 2P24A 1ORQA 1WCQA 2ZD0A 3T09A 3R4SA 5E2VH 1KWGA 1R6VA 1RZGA 2F8IA 3B3IB 3EFOB 3QO1A 3X13B 4WHCA 1KJVA 3L1FA 2M2DA 1KSRA 1P7QB 5JMRA 2G19A 5LWBA 4FNPA 4I0PC 5GM0A 3ZDWA 4QRUA 2OKMA 5C86A 2VDRH 2YGNA 4JZJA 1PGSA 4NWUH 3DX8A 1SLLA 2PMZA 4U7SA 4QY8B 3UOAB 1GNZA 3BAWA 3IDMA 3BWSA 4OCRL 4AJ0A 4GJZA 3UO8B 4TSBH 2XBDA 2BY0A 3NTCH 3VFNA 3F2LA 5EZPA 3TAYA 2FECI 4E4SA 2F1BA 4ZNEA 4S2HA 2HTKD 4WFGE 5JOFA 2WYHA 4LCIH 3SE3A 5EIYB 2I07A 3OOXA 3ESOA 2A6YA 4K8RD 1PTZA 4Q97A 5D2AA 5IT2L 3DIFA 3OR6B 1SY6H 4R4FH 4XC1L 2VKXA 3MX0A 4RWYH 1XQNA 4FAHA 3DUIA 3WEAA 3AQDA 4WWKD 4TNFA 5KWYC 3IMVA 2GSGA 4C56D 3CFDA 4HZFA 1N26A 2P47B 1CS6A 3PQYE 3KGZA 3GTTA 1VR3A 3QRGH 5FY4A 1ZT4B 4JDVB 1A3RL 4L4VB 1JV5B 5E6SB 4SLIA 3RTLA 4AVJA 1UXMA 4X0NA 4EI5D 4RQPC 2VTXA 1NCHA 4LMQI 3T4YB 4X0KB 3D0VA 2BFGA 4OZ4A 1LDSA 3O2VL 4U6YA 4XNUH 4PTTA 4O51B 5EU6B 4ZJ9A 2D5HA 3AREC 4ONHB 1TMF3 5T1MA 1FFOA 4S2GA 1S9YB 2GJ6A 3FB5B 5H35A 3WN5C 2ZHLA 3FHQA 3WG4A 3HHSB 1OB1A 3VBFC 3ES6A 4DQOL 5HVGB 1ZBA1 4LBMA 3L7EB 4UV7H 4YOKA 3KCPA 3N40P 1HB4A 2DUOA 1KPVB 1HHGA 1PYWB 4LF3A 4XMPL 3G6JE 1U0AA 4Y19D 1MVYA 3LIZA 1EUUA 4HC1L 2Z3FA 3N9OA 1N12A 2IV8A 3WP5A 4LE4A 5DJZB 3SY6A 3CBKB 2QSTA 4B50A 4LA2A 3KGSA 4JFPB 5EO1A 3CDGB 2DI7A 2EAEA 5HGBA 5EIIB 3R05A 4I3RH 4AI3A 1E9QB 1QOKA 2NNCA 1RY7B 5L2JA 4FHKA 3KH3A 1XXFC 3OHMB 4BRVA 3DXAE 1I1YA 4MCYB 3OV6A 5DJ2B 4FT8A 3GT6A 3PWNB 2ZXWB 3HR5B 4WM8C 3ZXJA 2WQSA 3KGUA 2ZCKH 4X4XB 2ERJC 3NZHL 5G4OA 3K3NA 2FE0A 1O4TA 2JIXA 1BHGA 4OLWH 5J3HC 2XN9E 1CURA 2PHWA 3RL1A 1EEYB 3EGSB 4X80L 1OP3K 1DR9A 3OB8A 3MNVB 4S1QH 2DQUL 1FYHB 4Y5YC 4ZQTA 3RFZA 4UW4A 3VL9A 4WKZB 5ISZE 2R0ZL 4F2ME 4OF7A 4DUXA 1BEV3 2W9LA 5DUXA 3GALA 4G3YH 3F5WA 2DQGH 2IWEA 2QEJA 3IDYB 1ND2C 3O6MH 2YGVA 1WCKA 5FMBA 3QXAB 2XN0A 1E57A 2NCMA 1H6TA 3KPSA 4K73A 5JDJA 3LEVH 3MJWA 4HUNB 1WZLA 4JG1L 1ZJAA 4AKOA 4OFDA 4BEIA 4AMXA 3DO7B 1OWRM 4F7KA 5HJ3B 3PHQB 3UAFA 1OGSA 4BKLA 1IPKA 2VH5H 3NIFF 4G6FB 2W9EH 5MHSD 4Y1AE 5HTSA 2P9RA 3I54A 3JTBA 3O6FD 1RUI3 2NY5H 3UETA 5F1IA 1RUG2 5L7OC 5E1IA 3D34A 3FUJA 5B4MD 5C09E 3PWVB 3QIWA 4Z0BH 1LWRA 3ZMOA 3MIEA 3S3SA 2W07A 4XBEL 1ML0A 1H8TB 3LKJA 1HKLL 4LGPB 4Y9FA 4JMNA 4WWKA 4K9EH 4B6ZA 4C56A 3W57A 5A40E 1J1XL 2QPEB 4PIXA 5FLIA 1QLFB 1W0OA 5IM7B 4ZS2A 2C0ZA 4MJ5A 5HJGA 4DZBB 1ZD6A 1QVOB 2ADFL 5HI4D 3RWIA 5KVFE 3T4AB 3GJEA 3FU5A 3RILA 4UFIA 3BPNC 3T0AA 5IY5B 5MEQB 1NFDB 2X5IA 5JLZB 2W95A 4PI0A 3MRQB 4L29A 2PW1B 3BI9X 3CBJB 3MGTB 3ZFEC 4ELMF 1ES0B 3BN9C 1AR73 4XVTH 3D0LB 3W39A 4HKLA 1SQ2N 2OKXA 4LHUB 2JKBA 5HI3D 1WLHA 4PIYA 3RGBA 3ZHDA 2OAAA 2XPGA 1P9MA 4LRIC 1MQKH 1EPFA 2Y2TA 3EBGA 3PFUA 5FA4A 4Y19A 5DVLA 4BZ1A 5FC9A 4Y33A 3AABA 5DHVA 5B39A 5TE6L 2P52A 4HPOH 1VRBA 1MCHA 4XF4A 4Q4Y3 1H6XA 4MZUA 5T50A 1AHKA 2J8HA 2ZX8A 3BO8B 4JPQA 1NGWB 2CRIA 2C9RA 2P44B 5ENWB 1T2JA 1INEL 5IEKA 1WITA 1EFXA 3JWNG 4OLXH 4UNUA 3WNMA 3N3HA 1MFMA 2GTZA 3ZL1A 4H0LC 2DYPD 4HWBH 2DL2A 4G9FA 4XVOA 4K23H 4CDXC 2FBRA 4JREB 5E95B 2R2BA 4ZFGL 4S0HA 2YFUA 1OF2A 4A1RA 1BVNP 3MSPA 1KMGA 3BX7C 2EDLA 1MUJA 1U95A 2N7AA 4LOUD 4EBQL 3CSTA 3U2SB 1RUAL 1G9EA 4D0DA 2QDRA 3LNIA 4I0AA 4NS0A 3VVWA 1EERB 2PTTA 3F7YA 4O2FB 2Z0BA 4MNQD 5F7AA 4XYXA 4WVRA 4PS3A 2JJTC 3KM2A 4POZD 2Y33A 4JM0A 5JHBA 3IAGC 4YSQA 5FGCB 1ND0B 1P4UA 3QEGL 2OMXB 4DO4A 1PO22 4Z5RA 5JHMA 4ENZA 2RFXA 4V1DD 1NCOA 2XETA 1QXPA 5F71A 5HGAB 4YMPA 5ID0B 3KW8A 4QR7A 1TIUA 1G7JA 3RZWA 3GMQA 5D7IF 4DFHA 3TTSA 1BOGB 4KHXL 2LFEA 1CGWA 4JVWA 3UYOD 4FKKA 3CVDA 4HCRA 5INDA 4G8IA 5A7QA 4GMSH 4F5CE 5DWPA 3EYVB 3M7FB 4YE4H 2OIIA 1G7QB 4L1HA 2RHPA 1V6LA 2GUOA 3HIFA 1MVEA 4H8WH 4KZEH 1MJJB 5I0ZA 2Z93A 2DWXA 2CDGA 3CJXA 5F1NA 3O6FA 4PR5A 2VAUA 1GCYA 3ZRCC 3HQUA 4FTSA 1UFUA 2J8UE 4Q9RL 5ID1B 1BVZA 2BNQB 4G59C 4M62L 2ZBJA 2Y6SC 3ARPA 4I77L 3WNXA 2NX5E 1A7QL 4NFDA 2XKOA 4UBGA 4YSFA 4RRPA 2R4RL 3NSJA 2HPOA 1M7IA 4CA9A 3ZDZF 3IDXH 1UZ6F 1A7RH 2ZX9A 3POIA 2FHBA 4NQDE 3BCWA 4A7ZA 1L9QA 4WFED 4IBZA 2AZ5A 3MRLA 1KB5L 5C3RA 3NRUA 1PMIA 3LKQA 3RPIB 3TFKC 1N8ZA 3JWOL 3L95A 3RWJB 4UM9B 2AEOA 1OSGA 2WKKA 1ZHBA 3E8UH 5E99L 4BUGA 3OF6D 3ULSA 5KJ7E 4F57H 4AGNA 2ICEB 4P4RA 1OT2A 2H8PB 1DJGA 4RGMC 3RPKA 3VH8A 2WQUA 1PK6A 1U5XA 3DROB 2WC2A 1BQHB 3WCSA 4F80A 4JFHD 3P3RA 3UC0L 5DGQA 2HWD1 5JW3L 3DGDA 2L0DA 3ME0B 2XC8A 4TLKA 2R16A 2KUTA 25C8H 1DQ5A 3W1ZA 1PSKH 2CJTA 3ZXAC 5IG7A 4P23C 1W72L 3WFCH 3K77A 5GLUA 4AGLA 3UROR 1CVSC 3P30L 1UOJA 1NAML 1KCLA 2W8CA 4PRPB 3FSWA 1S2EA 1SYSA 3BVVA 3CUPA 2A0LD 1XGTB 4ODVL 1JFHA 3RB5A 1C8M2 1RB8G 1UM5H 3LZLA 1QPPA 4GQ9H 4YXKL 2DFCA 1ZV9A 1JOIA 3IJEA 3FT2B 4NQCD 2DYPA 4N9GB 5GGVH 5DJ0B 1AQ8A 4MS8C 5AOJA 2G9HA 4CP9B 1QRNB 4IS6A 1C12A 1GYWA 3V0GA 1D6VL 4K3DH 1Y0LB 2YMTA 3FU0A 4AC2A 2FIRT 4KX7A 4IBWA 1E27B 2J8OA 4NHCH 4U1MA 2AITA 4J3OH 3V6BR 4U6TA 2XFGB 5AALA 4D94A 5KVEH 2HFGL 2Y1VA 1LO4L 3QR1A 3S3PA 2Z1KA 3KWWA 3C5ZB 4PBDA 3FFCB 4WVZA 3AKRA 2Q2EB 2Q8CA 3UNPA 4PV9A 3UJIH 5FMOL 1I9RH 1SN2A 5E8AA 1FVCB 2OYPA 1OARH 4V1DA 3SY0B 5CEZE 3ULVD 1IKQA 2UY7B 1UY1A 1IVLA 3QJQB 3O3EB 2EVXA 1T22A 3V6OE 4FO9A 1F8TL 3IT8A 4K2UH 3HN5A 3T6XA 3CLWA 5F5IA 5FYZA 2IPTL 5FZBA 1T1XB 1T2XA 3QQDA 1R1A1 3GBMH 1IILE 2IOOA 1WBXA 1K2DA 1UG9A 3MPCA 5KS9B 5E2WH 3QH6A 1A7PL 1OGTA 3C08H 4GLRH 3V5KA 1OUXA 4ZW7A 2MIZA 3AZVA 3AFLA 4H20L 4AC4A 2FDGA 2R072 2X4TB 3ZUNC 2VXVL 2QCSB 1U8LA 4HAFA 3GI9H 4NX0A 4M0NA 4MAYA 2JXAA 2CWRA 3B01A 5AWNL 2NW2B 3ILQC 4AMKH 1OA4A 3K3QA 4RYDA 1TMQA 2OA9A 3PWLA 1XX9C 4K8RL 2BUKA 3GSOA 2DJSA 1UXLA 5HDQH 1XZ0B 1MQTA 1L6PA 2DUQA 3N85H 4LCUA 3VTAA 1DBNA 4MDJB 3SQOH 3UCRA 2APWA 3Q2WA 1L0QA 2Y38A 2P3KA 5IQ9A 1V7NH 3VA2C 2J25A 3MPBA 3S35X 1DVFC 3P2TA 2EDTA 3ZE2B 4DKTA 2ZKXA 2GC1A 3C7EA 5C4WA 4Z7VF 5TDPA 4R2GC 4HEPA 2QGCA 2FBJH 1ZTXE 4NO0A 4HLZG 4S10A 4EUPB 5JZ7D 1L9RA 4FE9A 1DQ6A 4JGMA 4LEJA 4JRYD 1AP2A 1EXGA 2Q86A 1ZV2A 2HPTA 1XSOA 3VBSB 4PWIA 2B77A 3QAZC 5I17A 2BOCB 2DTYA 2XIIA 3AFKA 4YS4A 3GWJA 4Z7QB 5JUEH 1JI2A 3APMA 3O2WL 4X7DC 4L4TE 1G5AA 3TNMB 1F90H 3H9SB 4WV1B 3UFIA 3QWQB 4ELMA 3DHJA 1RMU2 4WO4B 1LRHA 1Z7S1 2I9TB 1CGTA 1YO8A 1CX4A 1DBJL 4LPUA 5L4IA 3UCQA 4XF0A 1G8WA 1YI9A 5F6KA 4HLEA 1IGCL 5KTEL 4U31A 4PV1C 4WEUD 3NCMA 3OMZA 1XSJA 4WO0A 3I97A 4XABA 5JLVA 3IPBA 2VZRA 4RESB 1FVDB 2NTFB 5IHRA 1TQVA 5EO9B 2I5YH 4BUQA 2YXMA 4G42A 4JHBA 5ISLA 5JQHC 3VUAA 5C92A 4P02B 1K3ZA 4JQIL 2RM23 1AC0A 1NBZA 4QXGH 4DP2X 4Q4V2 4LSSL 3T1FB 1FZKA 4HLJA 3ZX1A 4AG4L 4EZKA 3CK0H 4YLZA 1KJ3L 1IAKA 1JPGB 1N19A 2F2HA 4J23A 3FWEA 4HKZA 2H32A 4L5FH 4XOBA 3U0TA 1UM4L 2HXAA 1EJ6A 4ALAL 4QHUB 1BWWA 1TMCB 3SBPA 1P5UC 3Q48A 3QPXH 4C59B 5AAMA 5HYFA 1N6QH 4FPFA 4YBLB 5DD3L 1LGVA 4FP8L 1SYVB 1IEHA 1CONA 5TE7H 2AV1B 5EG6C 3OGJA 2OMNA 3C2SA 4YL4A 1CXEA 4GP4B 3GNMH 2R0WL 4YHIA 5ESAB 3V8CA 4DAGH 1OLME 2VUOA 1XJAA 2E7QA 1PX3A 1IAOA 5A3PA 2R27A 5HHPA 1ONAA 3THPA 1QBBA 5EU5A 1EUTA 4LSUL 5HHQB 2Z69A 4L9LA 1OZTG 1HB2A 3MIDA 1S5IH 3DPRA 3Q1SL 4AVTA 2IFFH 2BFVH 4DEWA 2WLHA 4LHNA 2XKSA 3RYMA 4F37F 1KXQA 3BEWA 2KMWA 5I8KL 4DT2A 3TO4D 1VPHA 1BMV2 2VUDA 5D7IA 3QWOA 3BPLC 5DK0A 4ZD3H 4XTMA 1PNCA 1FNEA 4NLHA 2LQRA 2PYEB 3AREB 1PMHX 1IARB 3COOA 3NZUA 4PG9B 2IXIA 2FT7A 3QULB 1D9KC 4YSRA 4HSJA 5IQLA 4BH7A 4NWTL 4FXKC 3STLB 5LGJB 3VBFB 3GXUA 1G6RH 5M0TA 4ZUUB 5GSVB 3GSQB 4FTVE 5KAQF 4OHXA 1LTXA 1MJUL 2FRGP 1WFJA 1DQML 3QPQC 3ZTJH 5J12B 1DQ0A 2WXLA 5C71A 2NP0A 5K39A 4JPWH 2A3YA 3HS0C 2XBZA 3UYRL 3QUXC 3J7MA 4Q6KA 2VR3A 4N0YL 4OF6A 3VWKD 1ACXA 2X9YA 1G0DA 3PTYA 2R043 3N3EA 2GN7A 4XP6H 2Q3ZA 3K2IA 5GGRY 5JIIA 2JJUA 3IDIA 3AP5A 1QBML 1AJKA 4JG9A 4AUJA 4RMQA 4RDQF 1JWMA 4JRYA 4OKVB 5JOEA 4BELD 5I1DB 1OCZB 3OMIB 4X4YB 5FXXA 2B4CL 4DJMA 4Z3FA 2J1RA 1NMCB 3E9UA 4IUGA 1V9U3 3DURB 1NLBL 1W2UA 2ERJB 5DWUH 3W11C 2VULA 2JKNA 3I6KA 2VYRE 2VLKE 3LPPA 2CL2A 3SCHA 2AJ3A 2D7OA 2IMNA 4BWUA 4NQVA 2PMWB 2Y9RT 4Y5VA 4IDZA 4Y5YB 2BSRA 2HB0A 4IE7A 5F0PB 3I75A 2WNUC 3WUWB 4IIQB 4ZO8A 3CWGA 3BU0A 4NHUB 4DY5A 4FD0A 2QLYA 3MJ8B 1T7VA 3TJEL 4FJYA 4JFSA 2BVOB 1DL7H 4A7UA 4BFIA 5FECB 5HHNB 3E97A 1E3ZA 1IZ3A 3WCYA 4WW2C 3ILEA 1FZJA 1BVKA 5IJVA 2WWSA 5EBWA 4ZFOA 4CPBA 3FT3B 3VD3A 3AZXA 4F7MA 3W82A 1LEGA 2R1YB 3GUTB 4ZYKB 4HZAA 4A3ZA 1OM3H 1YRZA 5DC9B 5SX5K 1GLHA 1VBE3 2ZX3A 3BT0A 2ZAGA 2X4PB 2ADIB 2ODIA 4QKFA 2YQ2A 4MXWA 1YMMD 3M1CA 4KROD 5I18H 3KDPB 4O02B 3FB6B 3RBSA 1BQKA 2LU3A 3D4CA 5L7OB 1UB6A 3NJLA 3UTPD 4UM8A 3WHE0 3GM0A 4N90D 3FZUC 4LGRB 1LYQA 2WDBA 1JPEA 1WWYA 1EZLA 2CU5A 4UAOB 1BQUA 3HJ0A 5I1EH 5GLZA 2J20A 1C1FA 2XVBA 1COV1 3KGTA 3K72A 4LDCA 4X6DB 3QVAA 1MCCA 4X50A 1D6EA 3RA7H 1M05A 3VRIA 4BINA 4WU7A 2VO5A 5I71C 2GB2A 2I7OA 1DGRA 3O8XC 3LQMA 2UYBA 2AEQH 1EGJH 4AHZA 3IDGA 4UIKH 3C7OA 1MCFA 3R4DA 4BH8B 3FU9A 1R081 5HYJE 2P5WA 1MEC3 1RL1A 1X5XA 2IQAA 2ZPKH 2ZX2A 3M8LA 3EFDL 1Z9PA 3ZFEB 2QPSA 4EN2A 4QHMA 5PAZA 3OPZL 3A0OA 2G9ZA 1NFDF 2EH8L 3FCSB 4YBQD 1CTNA 4WNJA 2ORXA 2VW6A 4UF0A 2AXFA 2G5RA 2PUQT 2OMWB 2VKWA 4XP5L 3ABMB 3BFOA 3LNDA 1E40A 2ZP0T 5I1CL 3V0BB 1WFTA 3MO1A 4NZJA 5ANQA 4TWTA 4YFEA 2H3KA 3I2CH 1M4KA 5IHUH 4MD4A 2XXFA 1S55A 2AXJA 2VZVA 4AL8C 1NUDA 3T5WA 1WIOA 4K94L 1QA9B 3VWKA 1BVVA 1VMJA 1XNTA 4GKZA 1X44A 4B9GA 1A4AA 4G70B 4OI2A 2VXQL 1I7RB 2PPCA 5E6YA 4BKTC 4ZW6A 4AQSA 3E6FA 3WAKA 2LTNA 5C2UB 1ZXQA 4OFYD 4ETYA 3C87A 5GISH 5F7KC 3RNKA 3VD5A 5HSFA 1UKGA 3ARDB 4AFMA 5IW6A 2VM9A 4HJGA 4Z7VA 3IJYA 3IJSB 3UG5A 2OTUA 3QZWA 3U1SH 3WG7B 3RVVD 3JYCA 1QHPA 5IJRA 1G4RA 1VBA1 3BQUD 3PL6C 1J8RA 3UKTA 1YEGL 4Z8FL 2ZZUT 5HCHA 4XXDA 1GSKA 4ZSOA 5J06A 5IESH 4CN4A 1KIUA 4MZ3A 1NEZG 2DIAA 4W65A 2FSDA 4DW2H 2DQDL 4XBGA 1RULH 2BMKB 3PRZA 4JKPH 4Y2LA 2UWEE 2KDGA 4JZOB 2NR6C 3Q8CA 1RURL 4FQHB 4HKBB 1S7WB 3CSGA 1G1OA 3G08B 1AKJB 5D8AC 2YRPA 6FABL 4QKNA 1STMA 1I7ZB 3D2UD 3GXIA 4DWHA 5KYXA 1BXHA 1LEKA 1HCFX 3PJQA 2BZCA 4IGBD 1S9WB 3OR7B 4QTHA 4DRVA 4HV8B 4MFHA 1TKWA 3IDBB 2R30A 4R7VA 5DT1H 3VVVA 4OULA 5DO2C 2E86A 2JV6A