1FNZA

A bark lectin from robinia pseudoacacia in complex with n-acetylgalactosamine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
237
structure length
234
Chain Sequence
b'TGSLSFSFPKFAPNQPYLINQGDALVTSTGVLQLTNVVNGVPSSKSLGRALYAAPFQIWDSTTGNVASFVTSFTFIIQAPNPATTADGLAFFLAPVDTQPLDLGGMLGIFKFNKSNQIVAVEFDTFSNGDWDPKGRHLGINVNSIESIKTVPWNWTNGEVANVFISYEASTKSLTASLVYPSLETSFIIDAIVDVKIVLPEWVRFGFSATTGIDKGYVQTNDVLSWSFESNLPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARK AGGLUTININ I, POLYPEPTIDE A
molecule tags Sugar binding protein
publication title Structure of a legume lectin from the bark of Robinia pseudoacacia and its complex with N-acetylgalactosamine
pubmed doi rcsb
total genus 49
structure length 234
sequence length 237
ec nomenclature
pdb deposition date 2000-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fnzA00
2R0HA 1IS6A 1ULGA 1BKZA 2EXIA 1GZWA 1QGLA 1Z0HA 1MVEA 2PHTA 5GJ6A 2A3WA 3WCSA 3WDWA 4SLIA 1H9WA 1TEIA 1S0EA 1UPSA 5CAZA 1KRIA 1VAVA 2WLQA 4DPNA 3ASIA 2NYYA 3APBA 1GICA 4XJZA 3RSJA 3ZPYA 1OQ1A 2A7AA 2ZHKA 4LBJA 1LEMA 5JDBA 3TAYA 1WW4A 4Y22A 5DUVA 1QOTA 2ZGLA 2D44A 4LBQD 1GZWB 1DHKB 1W0OA 1WLWA 5JMCA 4CTEA 5IT6A 2GNDA 1KDKA 3MPPG 2V5YA 4YGEA 2DVDA 3VKMA 3RQ0A 1J1TA 1JBCA 2E51A 1CR7A 3AZZA 5AVAA 1LOAA 4AYUA 1VAMA 2DV9A 1LGNA 1LCLA 2DVGA 3IPVB 1W0PA 3WUDA 1W6MA 4YW2A 1RITA 2DVFA 1AXZA 4M3CF 2A3XA 2UWAA 1DIWA 2CTVA 3D4KA 3A4UA 5GZDA 1JOJA 4Y1UA 1QOOA 4YW3A 1V6KA 3O0VA 4ZXKA 1URXA 3RS6A 3UL2A 2ZGQA 4ISQA 2A71A 1MS1A 3M3OA 3INAA 3OY8B 4Y20A 2JJ6A 2ZABA 3GNEA 3IN9A 1UKGA 3PVOA 4FQZA 2A75A 3FBYA 1CVNA 4WVVA 3N3HA 4DFSA 2WT0A 1ENSA 2VW1A 4LBQA 1G8WA 1SLCA 3PVNA 2R16A 5EXOA 5KXBA 2PELA 1IKPA 1BZWA 3OY8A 2ZGPA 3WG3A 3QCWA 3POYA 3WHUA 4FOYA 1CPNA 1SACA 2W39A 5H9QA 2ZHMA 1WCSA 4PBPA 1N3PA 2ARBA 4L8QA 4ZKTB 1DQ4A 2JD4A 2VW0A 2AH2A 5JOXA 1QDOA 1DQ2A 4FPHA 3AP4A 4R9BA 1W6NB 3VV1A 4YFZA 2P37A 3IMNA 5GLTA 5IK4A 1CN1A 1ONAA 2E6VA 1SBDA 2ZMKA 3AJZA 4K1YA 4Q26A 1ZA4A 3UJQA 4FPOB 5BYNA 1YRZA 1LHNA 1HKDA 5T54A 4YZ3A 1DYKA 1H30A 2YY1A 2DU0A 3ZSJA 1AF9A 5JOZA 3VKNA 2TEPA 1LHUA 2VW2A 1V6IA 3AX4A 2YZ4A 2A6WA 1LEDA 3AFKA 4YM3A 3M3EA 1LOCA 2D43A 3B01A 4Q8KA 1G9FA 3ZXLA 1ENRA 4ISRA 5DXDA 1MZ5A 1N47A 3ENRA 3WDUA 2ERFA 1DBNA 1UX6A 1A78A 2GMMA 1LOFA 2EAKA 2ZMNA 3OBRA 3RMXA 1V6NA 1YYNA 1CESA 3BOPA 4AVVA 2AGSA 2EALA 2W68A 2AYHA 4LBKA 3ZXFA 2ZAAA 1N1VA 2AENA 2PHFA 2GALA 3LSEA 1FV2A 1SLLA 3LSDA 5GLUA 3D5OA 4FPCA 2DU1A 3AZWA 2P3KA 3WDTA 1Q8OA 4UW3A 1SCRA 1KJLA 3VUOA 4XBQA 2D6MA 1X50A 3ATGA 2D6KA 4Q8LA 4FPYA 1FATA 1V6JA 3ZYPA 3V0AA 3B3QE 3AZVA 4D69A 1SLBA 2GMEA 1S0GA 1LTEA 1UZZA 1B09A 4M00A 1JN2P 4BPZA 1SBFA 3V65A 1AVBA 4XDQA 1N1TA 2LALA 2WQZC 4XMIA 1HQLA 3JUUA 4XTMA 5EWSA 4DQAA 4YM2A 1GBGA 1QMJA 1ULCA 1AXYA 3T1LA 3WHTA 1Q8VA 2CY6A 3WDXA 2YXSA 2A6ZA 3OGGA 1CIWA 1LHWA 2E7QA 1LODA 1PZ8A 2WSUA 3IKWA 2PHWA 1N1SA 4YW1A 1F9KA 4NOTA 2YV8A 1V6LA 4CRQA 4M01A 4Y1VA 2E7TA 3N7LA 4LBLA 3VKLA 4FPJA 1DQ1A 2AUYA 1LECA 2DYCA 3OPZA 2UWBA 4XBLA 3H0OA 5GZGA 2NMOA 1FAYA 2EXJA 3MW4A 3AP9A 1KQRA 3FUQA 1FNYA 1G9BA 2PHUA 2KM2A 4HL0A 2ZMLA 3C2UA 1NXD1 3OBTA 1LULA 5HCAA 1S1AA 5F9TA 1DYPA 4FQ4A 1N3OA 2DUOA 4M3CA 2RHPA 3OYWA 2R0FA 1DZQA 1MS4A 2VXRA 2ZACA 4XE9A 2UURA 1SBEA 1BQPA 1JUIA 1F31A 1HQWA 2CYFA 1DFQA 1ENQA 2NM1A 4AVTA 3N7JA 5GM0A 1AJKA 3HMYA 2C5DA 3AZXA 2ZGTA 4XZPA 2EXKA 3OJBA 1HDKA 4U2AA 1CJPA 4GXLA 2ZGOA 5EYYA 5GZFA 2D3PA 5FREA 1DQ5A 2HYKA 3WCRA 1PZ9A 4XJAA 3V0BA 3L2YA 5GLWA 3WV6A 2EIGA 1A3KA 3AYAA 4YG6A 3WZ1A 3PVEA 2WJSA 4LBMA 1G7YA 4YGBA 2WSVA 4WV8A 2Z42A 1D2SA 1WUVA 5DUXA 3WNXA 4P9YA 3POSA 1WBFA 2CWSA 1MS9A 3R4UA 1SLAA 4I30A 4R9CA 1UN1A 5DUUA 1DQ6A 3ZXKA 4DRVA 4UW5A 3AXEA 2A3YA 3DUIA 4FOWA 3W58A 1QF3A 3NV3A 3FLTA 4GWNA 4YW5A 3FUOA 4Y20B 1G9DA 5DZGA 1RINA 1QNYA 5KXDA 4C1WA 5EYXA 1GZCA 4XHBA 4XJUA 2NZ9A 3W59A 1GSLA 3WOGA 2XB6C 3ZSMA 1KITA 3ZXEA 5DZFA 3SISA 3AK0A 5KXEA 2EF6A 3WG2A 4FP3A 4XBNA 4XIOA 4BQ1A 4KBBA 1W6MB 1WLDA 3KM5A 5CNAA 1SFYA 3HR9A 4BM8A 2DUPA 1YI7A 3PMEA 1JW6A 1MS0A 1BJQA 2XG3A 4YZ1A 5GLZA 2SLIA 2D3SA 4NO4A 4RA0A 5E88A 4K21A 4U36A 1S0BA 1IS4A 1WD4A 1FNZA 3V64A 4P14A 4Y1ZA 4XOGA 1GV9A 1N1YA 2D6PA 2VY0A 4FVVA 3SITA 3ZYRA 3AYEA 4Y22B 4XMAA 1BYHA 4ASMB 3WDYA 2VUAA 4HANA 3USUB 2WT2A 5L73A 1C57A 2H0BA 1YIFA 5HCFA 1Q8SA 2JECA 4MYEA 5T5OA 3WDVA 4YLZA 5T5JA 3UJOA 2R49A 5SV8A 4Y26A 2ARXA 1JXNA 2A6XA 2OUHA 3R05A 4AGVA 1XQNA 3IPVA 4Q2FA 1KJRA 2WKKA 4YGCA 4GALA 5CBLA 5FRAA 4XJ8A 4XIKA 3AYCA 2B7YA 4Y24A 1SLTA 2W52A 2NN8A 4WVWA 1Q56A 4XXAA 1CONA 1LU1A 3SH4A 2PHRA 1VALA 1WLCA 1IOAA 2D3RA 2GMPA 1LGBA 3FLRA 3CNAA 3R4SA 3WLUA 2ZGSA 1DGLA 4AVSA 4PCRA 1UZYA 5H9PA 1AXKA 2Q5TA 3WVJA 2GNMA 4DS0A 1LESA 1MS8A 4Q1RA 1APNA 1C1FA 1QKQA 3POWA 3AZYA 4UW6A 1DLLA 3ZVXA 1GNZA 1LENA 3U4XA 3QLQA 4F83A 1S0JA 1UL9A 3WG4A 2R1BA 3I8TA 3IM0A 1Q8PA 1YXWA 2VH9A 4YG3A 1LGCA 1W6PA 1O4ZA 1U0AA 2CWMA 1Z78A 3SH5A 4M3CB 2DTWA 3T1MA 5T5PA 4GWMA 1NLSA 4BMBA 3NV2A 2EXHA 2D7FA 1G86A 1LHVA 2ZGRA 5HCBA 3ZSLA 5T50A 1GNHA 1DQ0A 1LOEA 3AP5A 3SLIA 3N35A 1G9AA 1LJ7A 3ZXJA 2OVUA 2ZA9A 3NV4A 3A0NA 2DVAA 1S0IA 2ZGUA 5GZEA 5JVVA 5T52A 1IS3A 2FHRA 1C1LA 5LK5A 4Y1XA 2CL2A 4BLJA 1W6QA 3O0WA 3JU9A 3RMYA 1LHOA 1LOFC 1W6NA 3B00A 1MS3A 3RG0A 3VKOA 2P3JA 3AJYA 1CPMA 3WUCA 5IK8A 3FFZA 3M3QA 1QOSA 4TYSA 1CQ9A 2ZGKA 5CB7A 2A6VA 2OUJA 2GNBA 5JLVA 1D0HA 2ZGNA 3NWKA 4XILA 4YGDA 4YZ2A 1S0FA 1W6OB 2YMZA 4C1XA 2A5ZA 4JC1A 1WBLA 4ITCA 3T2TA 4LBNA 2DURA 3FLPA 4PBOA 5H9RA 4FP2A 2VU9A 4R9AA 1A8DA 3I4IA 1UAIA 1SLIA 3HN1A 4YG0A 1JHNA 1AZDA 3M3CA 2E53A 2OW4A 2ZZJA 2C9AA 2P3IA 5DZEA 2ES3A 2GNTA 1MACA 1FX5A 2GDFA 2YROA 3B9CA 5E89A 3VKFC 3MW2A 1LOBA 2GN7A 2P2KA 3KQRA 3PJQA 4XJ9A 5GZCA 4GKXA 1KDMA 2D6OX 3AXDA 1AX1A 4ATEA 1AX2A 1SCSA 1WW5A 4DRRA 4JCKA 4H55A 4XXPA 4AGRA 1LOGA 1O4YA 4BLIA 3USUA 2GN3A 4FOQA 2G4IA 1ULDA 1FV3A 3AP7A 4Q1PA 3N7MA 4FPGA 4TZDA 4PQ9A 1VIWB 4RL7A 4XHXA 1AX0A 1V6OA 3AYDA 3B69A 4YW4A 1ZM1A 2ZHLA 4FPKA 5GALA 3DGTA 3LCPA 3N36A 5IK5A 4AGGA 1MS5A 1BXHA 4FPEA 1AJOA 2JE7A 2JE9A 2SBAA 4ATFA 1G9CA 3BIWE 1R1ZA 1WW7A 4CZSA 5DUWA 3MW3A 3M1HA 1Q8QA 4YZ4A 2ZKNA 1JYIA 4Y1YA 1W6OA 1OKQA 5CA6A 1ULEA 1I3HA 3V0AB 2P34A 5IK7A 1VLNA 2A6YA 5F5QA 1GANA 3BODA 1MVQA 2LTNA 4WZFA 5DG2A 5E8AA 4AWDA 1GLHA 3N7KA 2UU8A 2D6NA 4FOVA 3SNMA 4FPLA 4YZ5A 2AR6A 3D6EA 4K20A 4JRAA 1ULFA 1W6QB 3GALA 4BOWA 2BQPA 5DG1A 3TB0A 1MZ6A 3O5SA 1IKQA 1Y7BA 2I2SA 1QU0A 4XTPA 5T55A 2DVBA 1GKBA 2ZBJA 3WG1A 2ENRA 3Q9OA 4OZXA 1FYUA 3O0XA 2DWRA 3SH3A 3A0KA 4YFWA 3V0BB 1V00A 1GZ9A 4P9XA 4Q27A 4LBOA 1I1EA 1GYKA 4YM1A 5JOYA 3ILRA 2A70A 1LU2A 3M2MA 3UK9A 1OFSA 4P9WA 3ZSKA 2ZHNA 3NV1A 1S0CA 5IUQA 1W6PB 1F5FA 1N3QA 1EPWA 2CNAA 3RRDA 4UW4A 1V6MA 2AREA 3AP6A 4LBQB 4BMEA 3ILFA 2WNEA 4XJWA 1JYCA 2DUQA 2W08A 2ZGMA 4FPFA 4IQPA 1QDCA 5T5LA 1YO8A 1IS5A 2PHXA 1S0DA 5GLVA 5JOWA 3OYWB 1RIRA 4GKYA 5H9SA 2NMNA 2FMDA 4Z8BA 3BTAA 4GA9A 3ILNA 1UMZA 2NP0A 5KXCA 4M3CE 4R9DA 1WW6A 4XYXA 1PZ7A 1MR5A 3MEPA 1WD3A 2WT1A 2V73A 3O12A 2DTYA 4PF5A 1C4RA 2JKBA 1QNWA 4K1ZA 2D6LX 1HLCA 4YM0A 1H9PA 2JDZA 2UWCA 2R1DA 4W65A
chains in the Genus database with same CATH superfamily
2CDPA 2VULA 2BTVC 2R0HA 4PDWC 1ULGA 1D7PM 1DP0A 2PHTA 4RQPC 1H2NA 1Z0HA 2R32A 3KLSA 5C7GA 2VECA 3P5BA 1W2NA 3ALQA 5CG9A 1YNAA 1UPSA 5JSPA 4QX1A 3ZYFA 3S57A 4XJZA 5K0UB 5JDBA 5FWJA 5C8CA 2NLRA 1QOTA 2ZGLA 2FZ2A 3VL8A 5JMCA 4CTEA 5IT6A 1EP0A 1EY2A 2E32A 5DAVA 3PUQA 5EJZB 4PDWB 1UY2A 1ZVFA 4M0HA 4CCLA 1U5ZA 3NO8A 4RFT0 1CR7A 5JR2A 1OLQA 1ACCA 1AR81 1LCLA 3WUDA 5IFPA 1W6MA 1W99A 2VNGA 3WP3A 4AI2A 5FOBB 2DVFA 1AXZA 4CXXA 4M3CF 2VBDA 2A3XA 2JB4A 4NAOA 4YARA 4NIIA 5IJRA 2YBKA 3DYPA 2BVBA 1KS4A 2A71A 4Y20A 2VNVA 3INAA 4ZS2A 5FZEA 2JJ6A 3GNEA 1CAUB 1O6UA 3VZNA 4NR1A 2J1EA 4AHWA 3FBYA 3SHRA 4C0HA 2YU2A 3N3HA 5FUPA 1GP5A 2XKPA 4DFSA 4GAZA 1GP6A 3NQHA 2VW1A 3JD71 3H8RA 2R16A 2FDJA 3ZMOA 2CGOA 1UZVA 3TBDA 1E5HA 5A1AA 2RS32 4QU2A 4A3XA 3VBSB 2HWB3 1J58A 1ZBE3 4FOYA 4YRDA 1SHWB 1H0BA 3I2JA 4HOOA 3NNMA 5BNPB 2Y8KA 2LRPA 5C6CA 4BXSV 1K45A 2W46A 4PBPA 4RR3B 3KMHA 3VDCA 1X33A 4ZKTB 1M06G 5CKQA 2B45X 1GQPA 2WINB 1PO11 2WWSA 5JOXA 4YFZA 3VV1A 3IMNA 4WM7B 5IK4A 5K9YA 4Q26A 5FTTC 2BEOA 1H2LA 2WNVA 3UJQA 4C90A 3M3IA 5BYNA 1LHNA 1PO21 1HKDA 1XNAA 3PLQA 1JZ2A 2E63A 2Y6KA 2QQLA 1AF9A 3QH6A 1OOPB 2XL7A 2YZ4A 2A6WA 1OF3A 3AFKA 1PO23 3JBG2 1DF0A 3TN91 4YM3A 4I0AA 4KL1A 4JQTA 3DPRC 1MZ5A 4WM8C 3WDUA 4CUCA 4IETA 3ZFGB 4N43C 1A78A 3R4DB 5FYVA 1BLZA 4AVVA 3EJKA 4OZOA 2VBBA 2X10A 2WLPA 4A6SA 2AYHA 2WA3A 3ZN4A 2BGPA 4X6RB 3VBFC 5FO7B 3NSTA 3DL3A 2FDKA 5LY1A 1K5JA 4A41A 5EJ3A 3U10A 3I2GA 3NNLA 2QUOA 4GMP0 3PL0A 4F3JA 5C33A 1SCRA 5FZCA 4NIGA 4FTSA 3VUOA 4KGGA 1SMVA 4CDWB 1W90A 3A23A 3I3DA 3CBNA 2Q8DA 3EB7A 1GQGA 4Q8LA 1RMU2 4FPYA 3AM2A 1W2TA 3GZAA 5HXVA 1S0GA 3OBAA 3NAPA 1HJFA 1JN2P 4OI4A 3TN92 4BPZA 1YCIA 2KA3A 3LAGA 1SPPB 1G6NA 1HQLA 3JUUA 4XTMA 2K0GA 5ABJC 4XW3A 4YM2A 1HX6A 2R062 2HWC3 3P3PA 3FHIB 5B4NA 2WO7A 3WDXA 4AWDA 3OGGA 1CIWA 1MEC1 2XJPA 2E7QA 5AC92 5JZGC 1COV3 4Z2WA 2XL9A 4P9IA 2IXJA 2YV8A 1DCSA 2XBO2 4Z1VA 5C3SA 4LQRA 4EN9B 3RWKX 3VBHA 5JXJA 4S2GA 3H8XA 2E7TA 4LBLA 5EIYB 5HI0A 3EMRA 4Q4W1 3VDBA 1HRI1 2AUYA 2DYCA 5BV6A 1UF2C 1FAYA 4QHZA 2JDMA 2OPWA 1C8M1 1FNYA 2RS51 3LWCA 3VBUC 3ZN6A 1G9BA 2QQOA 2Y6JA 2WFF2 3BTZA 1YUDA 4DXZA 5ACA3 4IEZA 4GMP3 5FPZA 1FOD2 1JODA 2XGXA 4J25A 5F3EA 1S1AA 3NJYA 5EZWA 2R6QA 4YPJA 1O7FA 1DYPA 2XQXA 1TQ5A 3VBRC 4M3CA 4AF9A 2BWCA 3VZMA 2R0FA 3OGSA 4TLGA 1OD5A 4DEQA 1MS4A 5FZIA 1TG7A 4CDUC 4GWIA 4AAPA 3E6CC 1DDLA 1BQPA 1UY1A 2CYFA 1W9SA 1XOYA 1DFQA 1QJZA 5FXVA 4AVTA 2RV9A 4LK6A 3VBUB 1UW8A 2PMWB 5DDJ2 1W9YA 3POEA 2HJIA 4PIZA 2OQ6A 4XZPA 5IVJA 5K0UC 2WYSA 1OKOA 2WNUC 4XQDA 3NW4A 1IPKA 4RFRB 5FO9B 5EYYA 3SCHA 4JGYA 2ORZA 5CFCA 3TEZA 5LA1A 5J36A 3V0BA 3L2YA 1XE0A 2EIGA 3AYAA 3O14A 3PVEA 1ZZBA 3ECQA 1O3SA 5DUXA 2Z4FA 3GF6A 3DPRB 3BYWA 1WBFA 2F6BA 4UT5A 3VD5A 2HWE3 5ABJA 1D4M3 1SLAA 2HWB1 2WUHA 4MV2A 5DUUA 1DQ6A 3BPSA 4A7ZA 4UW5A 4DRVA 3AXEA 1YQCA 4FOWA 3VBOC 3NV3A 4TXWA 3T4HB 5HV0A 5EV7A 2VMFA 4KWLA 3WW3A 2K46A 4LOTA 3GZEA 2C9KA 3THPA 1UXZA 2X09A 5FPXA 4IXLA 2QVSB 4TWTA 1SG3A 3M8LA 4J6GA 3W59A 3EQEA 2VCMA 5KBFA 4LKDA 3SISA 2B4KA 3N9LA 5FYUA 4FP3A 3UKVA 2XVGA 4XIOA 5J48A 4YYOA 3VBOB 4NRQA 3KWVA 1RHI3 4ZONA 3I54A 2XMLA 3HR9A 4BIFA 4MADA 1JW6A 2PA7A 1BJQA 3NVCA 4LIVA 1YQ8A 4P9GA 2MPFA 4XF1A 2SLIA 4HBNA 3J7HA 4GB33 4NO4A 4WM7C 4FAHA 4HN0A 4PQQA 4QPYA 4A6OA 1GV9A 1N1YA 1VAKA 4FVVA 4MGKE 3AYEA 5FYTA 5FZ7A 3KHCA 3THTA 2RM21 4RD7A 5L73A 1C57A 2WR9A 2H0BA 3C8XA 5BPXA 1HRV2 5FV3A 2EICA 3DYMA 3O1OA 5SV8A 4Y26A 2ARXA 2GC3A 4GJZA 4CDUA 3R05A 2FBEA 1X9PA 1XQNA 3IPVA 4Q2FA 4YGCA 4AGVA 2V72A 4XJ8A 5FRAA 2RJKA 5IFTA 5HXMA 1OD3A 5JPMB 2B7YA 1NA1A 1H1AA 3HWJA 2O0OA 1L7RA 3I59A 4FCAA 3RPQA 1SLTA 2W52A 3LEGA 4NHMA 1RUE2 1Q56A 3F2ZA 1YLLA 5FPUA 4NIDA 1ZRDA 3D82A 2Y6HA 3ZPOA 2O14A 2D3RA 2P17A 2WABA 5TSWA 2C1FA 4A7YA 3R4SA 2E9QA 4RYDA 5A7SA 4EN8B 5IHRA 2Z5WA 4QX8A 1AXKA 2BDRA 2Q5TA 1I6XA 1VBC2 3TRSB 1W8HA 2GNMA 4IEUA 3DEMA 1MS8A 1VB2A 5D1IA 4KG0A 3POWA 3AZYA 2JDUA 2GC1A 1X8EA 5FPLA 1GNZA 3W5NA 1LENA 3PDQA 2VR4A 4MGTA 1BBT3 3QLQA 1UL9A 2B8MA 1BBT2 4LXLA 3VBOA 1XNBA 1QQP2 2PTMA 3CF6E 3H7JA 1U0AA 3SH5A 2GZWA 5FP3A 1VMJA 2VM9A 4M3CB 3T1MA 2ZEYA 4JZRA 4EZHA 3E6BA 2RR12 1NLSA 4D94A 2D7FA 5JAXA 3ZSLA 5HCBA 2G1MA 5T50A 2VPVA 1C8M2 2E26A 2RS52 3SCGA 3N35A 4Q4X3 3A0NA 2ZGUA 1S0IA 3ZXDA 2C26A 3PMSA 1XNCA 3OGRA 1B35B 4A4AA 5LK5A 2R071 4RGKA 4OHZA 4BB3A 2DCYA 4B1LA 1W6QA 5FUNA 1CWPA 4LLFA 3RMYA 1W6NA 3RG0A 5LA2A 2IVJA 2P3JA 5LA9A 2XJQA 4JGYC 2D5FA 3FFZA 5KC5A 5LK7B 3ZKUA 2R072 4TYSA 1PO12 1CQ9A 2DFBA 2GNBA 5JLVA 2ZGNA 3MIFA 4PHZA 4YGDA 5FZKA 4YZ2A 1ND2A 5F7UA 4QXHA 4AI0A 1RUC2 3MIHA 4JC1A 5L36A 2W3JA 4ITCA 4NHXA 1VBE3 3T2TA 4PBOA 1RMU1 2DURA 2ZJCA 2BUKA 5FPAA 5H9RA 4C8DA 4D6QA 1CX4A 3HNMA 4KMQA 3E5UA 4R9AA 4XFCA 5CADA 3N4MA 3HQUA 2FDFA 2IFRA 2X05A 3LE0A 1V9U1 1JU3A 3HN1A 1YIPA 3I7DA 5FLIA 5J09A 1JHNA 4NWWA 2OW4A 1K5MA 2ZZJA 2ARAA 2C6SA 4DO0A 1NA1B 5LRRA 3ZFFC 5KC6A 1NCQB 4AAXA 2VNRA 2GN7A 3PJQA 1QJX1 3KQRA 2OZJA 4FTEA 4N53B 2D6OX 2XJTA 3AXDA 4V2VA 4CP1A 1AX2A 1RUC1 2W2IA 4DRRA 5IVEA 2XPJA 4YVWC 1QWRA 3JXSA 4BA6A 1O3QA 3MI8A 3SEPA 3OGJA 3AL5A 4BLIA 4UI9L 1H2MA 1R093 4WZCA 2XWBB 4JDMA 2K9ZA 5FUIA 5FP4A 1OOPC 4KG8A 1CZSA 1ULDA 1P8JA 1HQNA 4HZFA 4B8EA 1QEXA 2DCJA 3LQCA 1DGWA 3IAPA 1AR73 4PQ9A 4NRMA 4DY3A 1GFF2 4OMDA 1VIWB 4N9IA 4OVEA 4RL7A 4AW7A 3POJA 2BOJA 3ZIXA 1ZM1A 3SKVA 2IXIA 4NN0A 1R081 5FZMA 5IK5A 5I91A 1UPIA 3U4SA 1NAEA 1AL21 1UU6A 1R1ZA 4NHLA 4RS5B 4CZSA 3HQXA 1JYWA 4Q4V1 4RR3C 4AEMA 4ES8A 5A6ZA 2ZKNA 2YB7A 1W6OA 2QTWB 2WA4A 2ZS6B 5CA6A 2FDHA 5ISLA 4OULA 3HNYM 1VLNA 5FLJA 2EIDA 2VZ3A 3ACHA 3IT8A 1H1MA 1UZ0A 1XU1A 4QQOA 1H8TA 1HB2A 2VTXJ 3GDBA 3ZSEA 2JENA 3SNMA 5D8AC 2DFCA 4IEPA 5J98B 4YZ5A 1R082 2UYBA 1JHJA 3OEBA 4Y5Z0 4BOWA 1PVC2 4YVSA 2BQPA 2VUCA 5KWRA 4LO7A 4FO9A 1UO9A 4W6YA 5FFOC 4BISA 3U0ZA 1PIV2 2FCTA 1GKBA 2ZBJA 3DCQA 1I5ZA 1K5MC 3CZJA 3Q9OA 1E5IA 4JX0A 4LUKA 2BVVA 2JIGA 4OZXA 5IVVA 3O0XA 4N9HA 3E5XA 4IV3C 4AEDB 1VBE1 4FFGA 4YFWA 3V0BB 5LWBA 3HIFA 1I1EA 3DKWA 4JGYB 1NCRA 5FOJB 5JOYA 2VO5A 3WF3A 1H2KA 3M2MA 4OUMA 4P9WA 4P00B 1V9U3 2HWF2 2XH6A 1W3XA 3BPZA 4NPRA 5FYMA 1K12A 1MQTC 1HRI3 2FCVA 4RS5A 4BYYA 1N3QA 4CCOA 4IE6A 1V6MA 2AREA 1POV3 2WNVB 4LBQB 3ILFA 4FFHA 5HBAA 3UGGA 4HPKA 4IQPA 5T5LA 1YO8A 2V4VA 4XUOA 1S0DA 1J3RA 3KB5A 4K6BA 2PXJA 4WVZA 5JOWA 1JOBA 1AL23 5JWPA 2XJVA 2VQAA 4COWA 2VQ0A 3AL6A 2RM23 1UMZA 2NP0A 3J7MA 4QDSA 4EROA 3ES1A 1CGPA 1OF4A 2R7EB 4OCTA 3S5QA 4MGZE 3W21A 1AL22 1JS9A 1AYN2 3EYPA 3O12A 3LIHA 4AL9A 1ZX5A 3VHOA 1O3RA 3MFAA 2D98A 2JDZA 4BHPA 4K7JA 4LO4B 2XJUA 1IGOA 2RS13 2QZ3A 1QGLA 1R1A3 1MVEA 1SZBA 1UX7A 2V09A 3KT1A 4E2GA 2QFEA 1ST8A 1TEIA 3B9IA 1S0EA 2WS91 3LDRA 5CAZA 1KRIA 1ZZ6A 3T2OA 1VAVA 2WLQA 3JD73 4DUXA 2NYYA 3MUZ1 4AVCA 2ZHKA 1LEMA 4JTOA 4Y22A 4EE2A 3NJXA 4RHV1 4BXFA 5HCHA 1AYM3 1GZWB 1DHKB 1WLWA 1Z7S2 3H42B 2BYVE 4FAGA 4URAA 5C4WC 2TUNA 1OUSA 3K2OA 2JG8A 2W5FA 3MZHA 1S4CA 3LKJA 3RQ0A 3VKMA 1JBCA 4AYUA 4XUPA 4I2OA 4V2WA 5FMOL 3NNJA 5FY7A 2DVGA 2GSYA 4YW2A 5A7QA 4KH9A 5JPNB 4PIXA 2W1QA 1MEC2 1OT5A 4ET7A 1DIWA 3RGBA 3RZJA 4ORFA 2BWAA 4QD2A 2CTVA 3D4KA 3A4UA 5SV5A 5C8WA 2GP5A 2VVEA 4Y1UA 1QOOA 4ZXKA 1IQAA 2QQKA 5ACA2 3UL2A 5AFBA 2R042 3M3OA 3VHRA 1K3IA 2ZABA 3PVOA 1QH7A 4CEYA 1U5YA 3MIGA 4MHRA 5D21A 5L19A 3S5AA 3IAQA 1PM7A 2VGDA 4WVVA 1SDDB 2YBSA 1OH4A 1ENSA 2XBO3 2QZ2A 2VOTA 1G8WA 1HRV3 1PX4A 2WO3A 3GZTB 2C0ZA 3PVNA 4MH0E 1PGL1 4D8MA 1WA6X 2UY9A 5EXOA 1PGSA 4GB31 3DKQA 3T0AA 3WR0A 3OY8A 1UNBA 3QCWA 5C3RA 1Y9MA 4TN7A 4HT1T 4OI1A 1DU3D 1L7LA 5H9QA 2HLEA 1JI6A 1RUG3 1UYZA 4QX3A 2QE3A 1N3PA 2JG9B 2ARBA 1NT0A 2JXAA 2G9GA 4EWAA 1NA1C 2Y0OA 3H50A 4D6RA 2IWGB 2JD4A 1JYXA 1A6CA 3ZDVA 1RUF3 4FPHA 5JXHA 4R9BA 3VBFA 1W6NB 2R063 2P37A 1ONAA 2E6VA 4N53C 1SBDA 4K1YA 4IGOA 1VBD1 4JKLA 5EHDA 1POQA 2VZPA 2PN5A 3RYPA 4AI3A 5I93A 4CCDA 4EV0A 1YRZA 5EJ1B 1PVC1 3KSCA 4YZ3A 1DYKA 4K8RB 5CYYA 2OKXA 1H8TB 2DU0A 3BN6A 4G4FA 4IEYA 4K8FA 4F8AA 1QJY2 5FP7A 1CAUA 2VW2A 4NVPA 2BPA2 1RMU3 2P1BA 2XLGA 4EN0A 3NL1A 1W8ZA 1ZBA1 3M3EA 1G9FA 3ZXLA 4XF0A 1ENRA 5IVBA 3K4ZA 1N47A 4AI8A 4W6WA 1ASJ3 1SFNA 3OBRA 1LOFA 4XUNA 3JBG3 2EALA 3CO2A 1HN0A 3ZFEC 1QJY3 1OVPA 2W68A 3ZXFA 2ZAAA 5J7MA 2PHFA 3LSEA 2GALA 4IEVA 1FV2A 3W9AA 1YQ5A 4FPCA 1PMHX 3RYKA 1R083 1UU4A 3OD0A 5CVRA 3VGIA 2P3KA 1HB4A 4ONUA 4UW3A 3WDTA 5FZDA 2ZX4A 4CDUB 3M7AA 2Q8EA 2D6MA 3HEIA 4CU8A 2WNVC 4I0WB 2D6KA 4QMAA 4GWJA 3GHMA 3ZYPA 3V0AA 5IVCA 4RQPB 1OLRA 5C3PA 2XJRA 1QIQA 1X9TA 3E5QA 3ROUA 2VVDA 1RHI1 3V65A 1NUKA 4CXWA 2LALA 5ERLA 1GOGA 4QU1A 1QMJA 4HKLA 3PURA 1EV13 1AXYA 2ZX2A 5FZAA 3TNQA 1IPSA 3WHTA 3CL1A 3I59B 2A6ZA 4IEQA 1LHWA 5FZ0A 2OPKA 4ZU5A 1BCXA 2J1TA 2PHWA 4AZZA 1F9KA 5IAVA 3H1MA 1AR82 4LT5A 5A7NA 1ZNPA 2P6HA 3A22A 1LECA 3HBZA 4G9SB 4HVRA 3H0OA 1VPHA 2WNUA 3MW4A 3OF1A 4LJHA 5F5CA 1KQRA 2W1UA 1DZTA 1Y9QA 2LS6A 4P08A 2DCKA 3BTXA 2Z69A 4OHWA 2QCSB 2NQYA 1NXD1 2HEYF 4KU7A 4LKEA 4QPIB 2JE8A 1RUF1 1XPWA 5F9TA 1UIJA 4BQ2A 4FQ4A 4OHYA 5DN2A 1U12A 3OD4A 4I02A 3Q8CA 3C7EA 3ACFA 1OQDA 4BK5A 2HBUA 5BNOC 1GUIA 2VXRA 1JYVA 2Y6GA 4O7XA 4Y33A 4Q0UA 3ZX7A 1C5HA 3A21A 2VC9A 2GU9A 2VMGA 1EAH3 5BNNC 1RUI3 3LOBA 4CEWC 2EXKA 5FMCA 3MGUA 3PTYA 3NRUA 5FYBA 1CJPA 1F35A 1RVF1 4MXWB 1UOGA 3N9QA 2VMEA 3O1VA 1DQ5A 1YHFA 2CGPA 1ZBE1 1CAXB 4A44A 4IW3A 5FKCA 3ZN5A 5GLWA 4AFBA 3WZ1A 3DYOA 4O65A 3S7EA 4YGBA 4LPLA 1G7YA 2WSVA 3PUHA 3ZYBA 3VBUA 1D2SA 2OA2A 4R4XA 2XONA 4NHKA 1WCDJ 1UXXX 5L9BA 2WO1A 3MV01 5FWEA 4AR2A 3K4AA 4CEWB 3K3NA 4AG4A 1A8MA 3R4UA 1ASJ2 4Q5OA 4HFSA 1OA3A 2FMYA 5FJKA 2X5IC 5I0DA 1HIXA 3FWEA 2VZSA 4YW5A 1UY3A 3CIHA 1RUJ3 2WWUA 2PYTA 2WZR3 5JI7A 4E9KA 1RINA 4QPIA 2ZEWA 1FT9A 1GZCA 4XJUA 2NZ9A 3ZMNA 3VD4A 3KQ4B 4I3PA 3I2DA 5FZLA 2KR2A 1KITA 4CP9A 5CKMA 4OQ9A 5DZFA 4DXRA 1VR3A 5A3UA 2GAUA 1RVF2 2QBXA 3VD9A 1KGYA 3AK0A 4K3UA 2X8KA 5KXEA 1RUH3 1KS5A 3WG2A 1US3A 4JGZB 1WLDA 3LDKA 3ZYIB 2LM3A 3M70A 1RUE1 1SFYA 2HWE1 2HYXA 3FMGA 1FMD1 2QKDA 1AR92 2VAUA 3AMMA 2R061 1MS0A 3DN7A 3PMEA 3PIJA 2ZAHA 1HW5A 2JDNA 3AC0A 3KV4A 4RA0A 5BNQA 1J83A 5FDBA 1S0BA 2ATFA 4LOSA 3WW4A 3V64A 1GQHA 3HPNA 2D6PA 3SITA 5CFCB 2VD7A 2BOIA 4ASMB 4MOAA 2VUAA 4Q4Y1 2WT2A 4E27A 1S2EA 3CZUA 3ZYJB 2G9FA 1VRH3 4QQPA 1Q8SA 2JECA 3WDVA 3WP5A 4YLZA 3UJOA 1OLME 1KXGA 2W94A 1T2XA 5C9AC 2A73B 4OI2A 1JXNA 1LR5A 2A6XA 3K46A 5FYYA 2OS2A 3GBGA 4LIUA 4XIKA 1F4AA 1QQP1 4XFHA 1YWKA 4WVMB 3WNKA 2XBO1 5IYYA 5M0TA 3WT3A 3VBRB 1YQ2A 4XXAA 1CONA 1W2UA 3SH4A 4AFCA 5I8TA 4EJRA 2PHRA 1WLCA 3UYJA 3ZFGA 1BVP1 4RR3A 2D97A 1JZ5A 1ZBA2 1LGBA 4LUMA 3RYRA 1IG0A 4GD4A 1C8M3 2RS53 2ZGSA 1DGLA 4AVSA 4CDQC 1WCQA 3Q8AA 5E16A 5FR3A 1UYPA 5C3OA 2PAEA 2VTFA 4UF0B 5FMDA 3GBFA 5JSRA 3W5MA 1TNRA 4MUVA 4MG2A 4OLLA 5ABJB 4Z07A 5FK7A 4E4ZA 4XQ4A 3IDAA 3BU0A 4RGAA 5D2AA 3W20A 1RXFA 2VMCA 4AEDC 2Y38A 1QJFA 1E5SA 1Z78A 2CWMA 5FY9A 1AYM1 5JZGB 2OQ7A 2JDHA 1BK1A 4BMBA 4IE7A 4QX7A 2JG9A 3KZ4C 3NV2A 2BBAA 2Y60A 1G86A 5C5UA 3GJBA 3ZM8A 5J37A 1GR3A 1DQ0A 1LOEA 3AP5A 4Q4V2 1G9AA 1LJ7A 1AYM2 1Z7S3 3K4DA 4META 2ZA9A 5GZEA 2EA7A 3HN3A 5JVVA 1NE4A 1ZRCA 1NX9A 2HWD2 4LMFA 3JD72 1JTZX 2FHRA 2WDBA 5JCTA 1AR72 1XYOA 1OFNA 1FPN2 1YEWA 2GP3A 2CL2A 3R6SA 3O0WA 2QDRA 3HOBA 4QM8A 1AL0G 4DY5A 1LOFC 2IXLA 3B00A 4LE4A 5F3GA 3SQOA 2J7MA 4PI0A 2ILMA 3AKRA 4L0PA 3WUCA 5IK8A 3PHMA 1NCRC 3E1F1 3M3QA 1J3QA 4CYDA 1QOSA 1OC1A 2WL1A 2A6VA 4QQHA 1ZZ8A 4LEJA 2AC1A 4KI5M 3T0BA 5B2GB 1W8OA 5I8SA 3J7LA 4XILA 3ZXGA 5A6QA 4HETA 2CAVA 5BNNA 4RS5C 1W6OB 4C1XA 3FZ3A 3EHKA 3VBSA 4FT8A 1ZRFA 4LBNA 4ZHNA 4FP2A 3KV6A 2Y6LA 1UY4A 1TMF3 1C5IA 1SLIA 4EWEA 1TNFA 2P5BA 3PUSA 3ZIWA 5A3OA 2XKOA 2BBVA 4FFFA 3GYDA 3NKTA 4AEKA 2ZEZA 3QH7A 4KU8A 4L11A 2VOVA 3J26N 2RMU2 5ANNA 1US2A 3B9CA 5LBEA 1LOBA 1GZTA 4JKMA 4XJ9A 3E97A 5GZCA 1J59A 2BNNA 1XJAA 4BQYA 4BE3A 3BTYA 1REEA 3N9OA 4DOUA 1BMV1 4AGRA 4XXPA 4BH9A 3NAPB 1TME3 3K48A 2D40A 2Y64A 3USUA 3VDDC 5AFEA 1H4HA 3N9NA 3VZOA 5C4WB 2VJXA 4YWAA 5K7PA 2I07B 3CKHA 1FV3A 4Q1PA 3FN9A 5BNPC 4MGQA 2VCAA 3N7MA 3V56A 3KT7A 4B29A 2BFUS 4FPGA 1I9RA 1FMD2 4IESA 5FY0A 3TOJA 4XHXA 1V6OA 3B69A 2BGOA 4P9JA 4YW4A 3UESA 5IVFA 1RB8G 2RMU1 3LCPA 5FZ9A 2ZEXA 4Y5SA 1DZRA 1XU2A 1BXHA 4UFMA 3ZYGA 3ZXAC 4AGGA 4ATFA 4B7EA 1XNDA 5L9RA 1EAH1 1WW7A 5FYSA 3POBA 5DUWA 4UXAA 3DXUA 3PNAA 3MW3A 1W8FA 1RYYA 3M1HA 2WQ4A 1Z7S1 4Y1YA 2BU9A 5A3WA 1JZ3A 1OKQA 4KQ7A 1PNFA 5JXIA 5LBCA 3KGLA 4OI0A 4KNCA 1HB1A 3HBKA 2P34A 2RS31 3T2QA 5IK7A 2A6YA 3T09A 3WP6A 2YYOA 4EWDA 3BODA 4Q0QA 2YC4A 4QT6A 4B3NA 4D7SA 4E4SA 4IGQA 1WCUA 4FI9A 1CJDA 1YFYA 2Q1FA 2UU8A 4KWJA 4UAPA 4E4HA 4X6QB 3CQOA 1W6QB 1GOHA 2D93A 3WQ0A 1Y9GA 3TB0A 1B35A 1MZ6A 1IKQA 1POV1 2A1XA 3KT4A 1WGPA 2JWPA 1VBC1 4XETA 1B35C 5A7OA 4QAWA 2JB8A 2ENRA 1SFPA 1FYUA 1V0AA 4BQWA 2XVLA 2PQQA 3VHNA 2DWRA 4OUEA 4CPBD 3FBMA 1RUG1 1GZ9A 1RGSA 4LKSA 5JIAA 5C9AB 1GYKA 2A70A 3D8CA 1Q5OA 3MF9A 2FCUA 4XUQA 5A6XA 1JH5A 4XUTA 1E57A 4WM8A 4CCCA 3MLLA 3VD3A 3O1SA 4X8NA 1EPWA 1W2AX 2CNAA 3LB9A 5C70A 5I0UA 2B9UA 3FJSA 3WY6A 4XJWA 2DUQA 5FBZA 4LA2A 4ARXA 2XHNA 3JB8A 4X8PA 2XDVA 5I8YA 2VNOA 2ZX0A 4N90A 5KHGA 3KVBA 5GLVA 2W0XA 4CUBA 1RIRA 2X29A 3AKQA 4GKYA 5H9SA 4QB1A 5IATA 2ETEA 1LB2A 4Z8BA 2RS11 1PVXA 2O8QA 3BU7A 4Q4Y2 1OA2A 4QKBA 4DXTA 5BUVA 5IAXA 2K2SA 5JXGA 4Q4Y3 4OYUA 4XYXA 2AZ5A 2B42B 4Z82A 5L7OB 2B5HA 3I2HA 3DV8A 1QJY1 1ODNA 1IZ3A 1OQEA 3KD4A 4PF5A 1C4RA 4AOCA 4NAMA 4Q29A 1HJGA 1QJU3 1MQTA 4HVOA 1D4M2 3MIDA 1PNGA 2R1DA 2C24A 1R64A 4P9LA 1X82A 2EXIA 4L2NA 1ODMA 5GJ6A 3WCSA 3OBZA 1BK0A 1H9WA 1W8TA 5I0SA 5LRSA 4DPNA 3ASIA 2RDSA 3APBA 3RSJA 3SMHA 3U78A 3ZPYA 5J3UA 2QQIA 1VBA3 3LZZA 3MBWA 1W0OA 1Y4WA 1ALYA 4YGEA 2DVDA 3EBRA 4EYUA 1J1TA 2E51A 2XWJB 4HKOA 3P3NA 2PFWA 5AVAA 4CCEA 1LGNA 1KFXL 4JGZA 4KGQA 1SQ4A 4XFIA 2I74A 1JOPA 5FY1A 4LHLA 1QXJA 3QACA 1S55A 3I97A 5GZDA 2KD7A 1JOJA 5GKAC 2Q8CA 3UKTA 2DBNA 3O1RA 1BVVA 1URXA 1XYPA 1RUE3 2ZGQA 4D7YA 1IPJA 4Q0SA 3TNPB 3FX3A 4ISQA 4URTA 4OHXA 3IN9A 1UKGA 3IIAA 4FQZA 1X7NA 4QGNA 2L9LA 4I01A 2A75A 1OHFA 1UOJA 2CHHA 2WT0A 1ND3B 3F95A 1SLCA 4CXYA 4CDXC 3LPGA 5A1LA 4PLNA 4MX3A 2R30A 5J1XA 1C3HA 1ULPA 4KWKA 3RFRA 1IKPA 1BZWA 3VD7A 1UZWA 1Y3TA 2ZGPA 1VE0A 1ZRRA 2ZXQA 1R092 2QNKA 4IEWA 4UYBA 5E1RA 1R091 2RM22 3WG3A 3WHUA 1NXMA 2P3YA 5FZ1A 4CA9A 3RVHA 4CP2A 2W39A 5DMYA 5KHIA 2IZWA 4IUGA 3UGFA 5L9VA 4L8QA 2I45A 4XFGA 4W6XA 1DQ4A 1YFUA 3IDEA 1OH3A 4CUAA 1DQ2A 2BJSA 4AHZA 1EV12 1I5PA 1JZ6A 1CN1A 1UY0A 2HBTA 2ZMKA 3A7QA 4CEWA 4FBFA 3GGLA 3WEZA 5CISA 3AMQA 2GC2A 4FPOB 3TN93 5FZ6A 2IC1A 4DMIA 2YY1A 1H30A 2VE1A 3PTRB 1Y43B 1EV11 4B7KA 2TEPA 1LHUA 4XEZA 2ZX3A 3BIEA 1LOCA 2D43A 3B01A 4Q8KA 3H9AA 1OUXA 3ENRA 1EPZA 3WF0A 2W87A 3BUCA 3POFA 1UX6A 1O4TA 2ZMNA 3RMXA 4F7ZA 4MSVA 1V6NA 1YYNA 1CESA 2WYFA 3N9PA 3MO4A 2Q1ZB 4IV3B 3I3QA 4QKFA 3RZMA 4LBKA 4YW6A 2F4LA 2N7GA 1H8TC 1SLLA 3Q8FA 1REDA 1ND3A 1NLQA 4Q4W2 5GLUA 3D5OA 4AE2A 4CDXB 2VUDA 5A70A 5F37A 2VOXA 1VBD3 2WRAA 5G04L 2DU1A 2XR4A 4AQTA 1MQTB 1Q8OA 2JG8B 2VL4A 1KJLA 2J1RA 1STMA 1YI9A 1UWWA 2HWD3 3JZVA 4XBQA 2Q8OA 4QDRA 1SPPA 1NQJA 1NYWA 3G7DA 4R8HA 3NMBA 5D8AA 4E2QA 3DF0A 2HKXA 1SLBA 1CAVA 1RUG2 4L92A 1B09A 3KCYA 4M00A 1U5IA 3PUIA 3WF2A 4XDQA 4XMIA 4BQ3A 4QHOA 4DQAA 2C4XA 5KHJA 1LAJA 1GBGA 4CDWA 5F2WA 4NHYA 1PMIA 1JZ8A 5LEKA 2QQNA 4L97A 5DDJ1 4QKDA 4COYA 3C7GA 4EQVA 1LODA 3FFQA 2WSUA 1N1SA 4NOTA 1S2BA 5F6KA 1JMUB 1V6LA 1WA4A 4CRQA 5A80A 3URFA 4Y1VA 5DDJ3 3OB8A 2BRTA 4HK9A 3N7LA 4P5YA 4XDOA 3DXTA 2VMHA 5DQ0A 1T6BX 3VKLA 3WINE 3WXPA 1VB4A 3EXUA 2UWBA 3OPZA 2NMOA 2EXJA 2VBPA 1E5RA 3ZFGC 3P1IA 4ZU4A 1TE1B 2W1SA 5HV4A 4IERA 2WFF1 3I2IA 5FIXA 2VXJA 1Q3EA 2ZMLA 3C2UA 3BOWA 3OBTA 4IV1B 5HCAA 4DXSA 4CDQA 3ZOIA 4YVWB 3MF6A 1D0GA 1N3OA 3FL7A 4DZGA 3OYWA 1PGL2 1DZQA 3HVDA 1JZ4A 3CU7A 4XC9A 4XE9A 3H7YA 2UURA 1U5XA 2VMIA 4OHVA 1YJKA 3J4UH 2ZCWA 1AR62 1ENQA 2NM1A 5B4XA 5AC91 1XSRA 3IDBB 3N7JA 2PAMA 1AJKA 3DPRA 5GM0A 1RUD3 3HMYA 4ZXEA 4EN6B 1GOFA 3AZXA 2W92A 2VCCA 2ZGTA 1YJLA 4CEYB 2AEZA 5JIUA 3OJBA 1HDKA 5L7OA 1XYNA 5AC93 4GXLA 3ST7A 4MLOA 2ZGOA 3AB0A 3KCXA 2D3PA 4NPMA 5FREA 2HYKA 5GZFA 1OA4A 4A3ZA 3ES4A 3WCRA 4RSUA 1PZ9A 2LROA 4XJAA 2YBPA 1RUOA 1PIV1 1AUYA 3WV6A 1HN1A 4H2AA 5A32B 4LO8A 1XXNA 2WJSA 4LBMA 2RDQA 1W04A 4PT6A 2DCTA 2J22A 1WUVA 2MEV2 4HLTA 1O8SA 4JVAA 3RZZA 4P9YA 3POSA 4B4RA 4MZUA 2CWSA 2W1WA 4IE4A 1LKNA 5LEJA 3O1TA 1MS9A 4QB6A 4I30A 4QM9A 4R9CA 2P6CA 5LBBA 3ZXKA 3P6BA 4JHZA 2A3YA 3VBHC 3OPTA 1QF3A 5LW9A 2AACA 3D0JA 3FUOA 4XFFA 4Y20B 2HWF1 5DZGA 2Y34A 4C1WA 4D7TA 3RDIA 4XHBA 1VRBA 3WOGA 3ZSMA 2VZTA 1ZYBA 1RUJ2 4GJYA 1MZEA 3ZXEA 3MPBA 3LA3A 4BQ4A 4DIQA 4J1XA 4HN1A 1UQXA 4XBNA 1PO22 2J42A 4LORA 4FTBA 4DS0A 3RZGA 4QXCA 1IHMA 5FYHA 4AXOA 5FYCA 4PLMA 1W03A 1YI7A 3MFCA 3WNLA 3LPFA 2WZR1 5GLZA 4NMIA 5FZ4A 2VUJA 2D3SA 5E88A 4OUSA 2UY8A 4K21A 1IS4A 4CU6A 4BQXA 1TMF2 4XOGA 3HT2A 4XCAA 4Y22B 5K0UA 3AKTA 1MZFA 1RUF2 3FHQA 1F8VA 2HEWF 4JV4A 5FZGA 4QPGA 2DBIA 1W39A 5HCFA 5T5OA 4MYEA 2V5DA 1RUI2 5T3NA 5T5JA 2OX0A 5F3IA 5ANQA 1F5JA 2OUHA 4ZS3A 2WIIB 3BI3A 2WKKA 3CEWA 1T6GC 1OBNA 2WZEA 1GMMA 1K5MB 5A33A 1VMFA 3RI9A 5LY2A 3PU8A 2NN8A 4MGSA 4E2SA 3VDDB 3H8OA 4GH4A 5FZOA 4H14A 1VALA 3IZOA 1FOD3 4HMZA 3T08A 1IOAA 4N7IA 1ZREA 1COV2 2ET1A 3ZLIA 2ZZQA 2MNGA 2GMPA 1NLRA 3MLJA 3FLRA 5K4LA 5FQ0B 4JHTA 4K40A 5G05L 2JDAA 3C7OA 3HAGA 1NY71 2YPDA 3B7MA 2FDIA 4PF1A 2P4EA 3WVJA 1TZOA 3RZKA 1H4GA 2RR13 5FYIA 5JZGA 4JTNA 4XF3A 1C1FA 2VZRA 2RJ2A 4ZY9A 4HXCA 1DLLA 4UW6A 2DCZA 4BU2A 4CDWC 3U4XA 1ZZCA 2Q30A 3WSOA 1S0JA 1MEC3 1W9FA 4HG6B 1Q8PA 4YG3A 1LGCA 1W6PA 2YG0A 1NKGA 1DYOA 1O4ZA 4NRPA 1F4HA 2XUMA 4XVHA 4GWMA 4YVWA 4LHKA 4RHV2 1RC6A 4PLOA 2XVKA 4JAAA 1LHVA 4Z92B 2YHJA 4CEYC 2Y33A 4D0QA 1NCRB 4UFJA 4MXWA 5EP9A 3SLIA 4TTGA 3ZDSA 1VJ2A 3ZXJA 1NZCA 1WWYA 2O1QA 3NV4A 2DVAA 3NJZA 2EAAA 3ETQA 1TMF1 1W2OA 3X29B 4S2HA 3U07A 5LA0A 2RDRA 3RNSA 3KHBA 1C1LA 1HB3A 1O5LA 3EO6A 3K77A 4Q4X1 1BEV3 3B02A 2HEVF 4Y1XA 4BLJA 4COVA 3JU9A 3H3ZA 5JR7B 3VKOA 1MS3A 2IXHA 3AJYA 1CPMA 1RL3A 4EN7B 2QQVA 1MPXA 4Z2AA 2YPJA 3ZO0B 5CB7A 2EVXA 2G19A 2OUJA 5CKNA 1A34A 3NWKA 4QHBA 2OIIA 5FK8A 1VRH2 2VOKA 5FZ3A 3PVBB 4LE3A 4GH4C 5FY4A 5FQ0A 1L3JA 3GHNA 4XURA 2H6BA 5FYZA 1AYN3 3AVRA 3JQWA 1YFXA 2ADEA 5E6HA 5C5TA 2CDOA 2BNMA 5FPBA 1OSGA 2VU9A 1A8DA 3OSDA 3OOXA 1KD7A 4N53A 2OYZA 3LDBA 3TWIA 4DUWA 4GB32 2JG8C 1ASJ1 4YG0A 4N7UA 3CJIB 1AZDA 1XE8A 4G3YC 2E53A 4TLFA 4UBGA 2Q4SA 2DF7A 4AFDA 4DNYA 2C9AA 4INDA 2P3IA 5DZEA 4AQSA 1XNTA 2ES3A 1FX5A 1MACA 2GDFA 2YROA 4MGYE 5E89A 3VKFC 3MW2A 2P2KA 3HQRA 1F2NA 1KDMA 3H1YA 4GKXA 3S0MA 1AX1A 4ATEA 1SCSA 1NG0A 1W0NA 1WW5A 1VBB1 3JQXA 4H55A 4JCKA 5F6LB 3OUHA 4AI9A 1LOGA 4DUVA 1NQDA 5FY5A 4RQPA 5FP9A 1UYXA 4DINB 2GN3A 4FOQA 2O8OA 1CIYA 2G4IA 2R043 3SCFA 3WD5A 3OG2A 5A1FA 1RTVA 4QGLA 2QQWA 3Q8BA 5FZFA 4TZDA 1OPOA 3J8F3 5CFDA 1IQDC 1EYBA 4DEVA 5CFDC 3AYDA 2QDNA 3ABZA 5GALA 4SBVA 2ZHLA 1AR61 4WVMA 4CCNA 2FD8A 1WKYA 3DGTA 1V70A 3GCWA 3N36A 5EQUA 2X5IA 3OUIA 2JE9A 2PLV1 2YFZA 1S2KA 4UFKA 1XNKA 1G9CA 4ES9A 2MEV3 4PJYA 4AK3A 1VBC3 2XXZA 1D2QA 4GQ7A 1HRV1 3WQ7A 2PHLA 1JYIA 4AVBA 4MO3M 3O1UA 1ULEA 1I3HA 2UYAA 1OURA 4LTAA 3LA2A 3GCXA 1MVQA 1X8MA 2RE9A 5JSOA 2LUWA 1RUH1 5DG2A 1ND3C 1J1LA 3ACLA 4FOVA 4FPLA 2AR6A 2OZ6A 3C7FA 3D6EA 4JRAA 4K20A 1ULFA 1AHSA 3GALA 1WMEA 3Q8EA 3T30A 5I0RA 3CLPA 3ZFEB 2QQUA 5FXZA 2CU5A 1BHGA 3O5SA 3H3LA 1Y7BA 4LK7A 1QU0A 3AKPA 4XTPA 1TME2 5T55A 4DB5A 3S6PA 2DVBA 4YNIA 2B9VA 3WG1A 2YFUA 2JKXA 4H7LA 4YVSC 2DDUA 1DG6A 3G6JB 4CP9B 3I3BA 2J1VA 1PGW2 4KWUA 1AYN1 3RJRA 3TYJA 1V00A 3E6DA 4P9XA 4Q27A 1FMD3 4LBOA 1ND2B 1COV1 5FAXA 1F15A 5LATA 4YM1A 2FQPA 3I2OA 2B46X 3GJAA 3J7NA 3NV1A 4O61A 4QX2A 3RI8A 4B4QA 1JU4A 2VZVA 4UW4A 1EUTA 3RRDA 4NIHA 4BMEA 2WQ8A 4HONA 2X5IB 1JYCA 1QJU2 3ITQA 2ZGMA 2ZOEB 3LGRA 3U11A 4FPFA 1ULOA 1XSQA 4ASKA 4S2FA 1RUC3 2PHXA 3S7IA 4ZZ8A 3OYWB 4GIQA 1DGRN 3CHXA 4YW7A 2MEV1 2NMNA 2FMDA 4W50A 3ZFFB 3BTAA 2WC2A 4RGGA 2W95A 2WS92 4L9BA 4LR4A 1UOBA 2EIBA 4M3CE 5CIRA 1WW6A 1BEV1 1PZ7A 4FSJA 2BNOA 3MEPA 3J8F1 2WT1A 4XPVA 1VBE2 2WZR2 5EFUA 2DTYA 1W06A 1VBA1 3J9SA 2JKBA 5F32A 3SEEA 1QHDA 1GWMA 2D6LX 4K1ZA 1HV1A 4YM0A 2FDGA 4Y5TA 2VOWA 3FC0A 4AI1A 4Q4X2 3MUY1 2R073 4N43A 5EYXA 4D3WA 4W65A 5BY5A 1JYTA 1W8NA 4Q4V3 1UMIA 1IS6A 1HXS3 1WZXA 1XB9A 1BKZA 3M4FA 1GZWA 5FXWA 3QBQA 3WDWA 1ND2C 1RUD1 2A3WA 4TSVA 1PVC3 4SLIA 2BV4A 5A6YA 4XAAA 1BEV2 3AMHA 3U37A 1K42A 1NZIA 4A42A 2VZOA 2AEYA 1GICA 4QKNA 1OQ1A 2A7AA 4JDNA 4GULA 4LBJA 4QQ2A 3TAYA 1WW4A 3MICA 1UKRA 4UBHA 4UFIA 5DUVA 4B1MA 2D44A 4LBQD 2RR11 2RVAA 4CVUA 2BERA 2GNDA 1KDKA 2BFUL 3MPPG 1EAH2 1H1IA 2V5YA 4QPWA 3RWNA 4O9EA 2XUEA 3H3UA 1BBT1 2JDYA 1LOAA 3AZZA 1W28A 2RDNA 4IGPA 1VAMA 2DV9A 2TBVA 1JUHA 2YUEA 3IPVB 1W0PA 5CFDB 1PHMA 2Y6FA 2W9XA 1RITA 2VZUA 3K75B 3S30A 3UNPA 2H0VA 1RJ8A 1UCXA 2UWAA 2R041 1REFA 5F2SA 4C91A 2F17A 1VRH1 4YW3A 5ACA1 1V6KA 3O0VA 3RS6A 3IDCB 5C9AA 2BZDA 3VZLA 5C8CC 1XE7A 2IXKA 1MS1A 3OY8B 5DAPA 2RS12 2YDEA 2OXBA 4OFGA 1CVNA 2WZ8A 4HPKB 4AHYA 4M4RA 4LBQA 1M4WA 4I3GA 3USSA 1OXCA 2W47A 5KXBA 5C3QA 2PELA 2HWC2 4Q0PA 2VMDA 3ACGA 2W91A 2BP6A 5DAQA 1C8NA 3ZR6A 3POYA 4LLOA 1CPNA 2G9ZA 5FKBA 1SACA 3BVCA 4JGZC 5EPAA 5A7WB 1DGWX 2ZHMA 1WCSA 3POGA 5A3PA 4CP0A 3CJXA 4OMCA 5K8SA 3ETPA 4Y4RA 5DAXA 2VW0A 3I3EA 2AH2A 1O3TA 1QDOA 2VTXA 2XJSA 3AP4A 3IB3A 5A3MA 5GLTA 3VBHB 1TME1 3AJZA 4FXKB 1ZA4A 3ELNA 4QDQA 4CCKA 1VBD2 3LEMA 4LO5B 5FLHA 4NUBA 4E4DX 5T54A 5CU1A 4NWVA 3ZSJA 4COZA 5JOZA 3VKNA 1IG3A 1V6IA 2ADDA 3AX4A 1RHI2 1LEDA 5KR7A 1TVGA 2VQTA 4ISRA 5DXDA 4AHXA 1VBB2 2ERFA 1RVF3 2OT7A 3ZN6B 1DBNA 2GMMA 5FP8A 2EAKA 1YC61 2ZKLA 3BOPA 4GH4B 5FZOB 2AGSA 2QQPA 4K9SA 3OTFA 3FHAA 1N1VA 2AENA 2WFPA 1PK6C 4LULA 5BNOA 1RUNA 3LSDA 1CX1A 3SXWA 3BALA 4KBZA 2PLV2 1OPMA 3AZWA 1QJU1 3N9MA 4PDWA 1VBB3 4QB2A 3RZHA 1XBFA 1C28A 4QGMA 1RUI1 1J3PA 1X50A 3ATGA 1DLCA 1UU5A 1W8WA 3WP4A 3KV5A 3LFMA 1FATA 1V6JA 1WLTA 1FI2A 3AZVA 3B3QE 4QPGB 1CD3G 5FY8A 4D69A 5KHKA 3I3MA 2GMEA 2KXLA 2WNOA 3AVSA 1LTEA 1UZZA 1WMDA 3R0RA 4Y3OA 5F8PA 1SBFA 4UWDA 1AVBA 4ZZ5A 5FO8B 1N1TA 2WQZC 2Y0IA 5EWSA 5F3CA 1UMHA 3OEAA 3VDDA 3RJ2X 1ULCA 3T1LA 5BXXA 1Q8VA 2CY6A 2PHDA 1VMHA 2YXSA 1FPN1 2JD9A 2JIJA 1PZ8A 3IKWA 4YW1A 2CSGA 5A33B 3DECA 1OI6A 3CJIA 5FZ8A 5JUVA 4M01A 4QXBA 3K51A 1RUJ1 4FPJA 1DQ1A 4XBLA 3MHZA 3WNNA 3B93A 5GZGA 3MIEA 1NE6A 3H1WA 3QOPA 4QX5A 3AP9A 4CE8A 5L7OC 3GBWA 3FUQA 2YGMA 4IEOA 2PHUA 2CV6A 2KM2A 4HL0A 3KF3A 5BNPA 1LULA 3KS7A 4XACA 3LF7A 3SC7X 3VHPA 1PM4A 2VZQA 2DUOA 2BGCA 3I2FA 2RHPA 1OMIA 3JBG1 4XFBA 1PIV3 4XDPA 4NPLA 3SKJE 3VZKA 1SEFA 2D5HA 2ZACA 3WF4A 1SBEA 1F31A 1JUIA 1POV0 4PI2A 5LASA 1HQWA 1ZRIA 2JEMA 4HSLA 1W9WA 4YVSB 3MV11 3T2PA 1DGRA 1O59A 5FZHA 5KHHA 2C5DA 3LEKA 2GH8A 3AKSA 3VB9A 5A32A 2CAUA 1NY72 3ORJA 4U2AA 2YC0A 5DABA 2BW8A 4JDOA 3PUAA 4NIAA 1KEXA 3NNFA 4L99A 3FE5A 1X36A 4W8JA 2ET7A 5LB6A 1H8VA 3MDPA 1A3KA 1PO13 1XRUA 4YG6A 4Q4W3 4WV8A 2Z42A 4CCJA 3KV9A 4WBBA 3IMMA 3WNXA 1LRHA 1AR93 4A7KA 4Q0VA 3VBRA 4A45A 5A3LA 3POIA 3PIGA 2YC2A 4WM7A 5FZBA 1UN1A 4CU7A 3MIBA 4LNVA 2WAAA 3C3VA 3DUIA 4FFIA 1PX3A 1KFUL 2ZTNA 4RN5A 3W58A 4HSJA 3FLTA 4GWNA 1QY4A 5FBJA 3LFIA 1G9DA 2IFWA 5C8CB 1HV0A 1QNYA 5KXDA 1O8PA 1GSLA 2XB6C 1CAVB 4AEDA 5CEHA 2WS93 2YGLA 1JYNA 2E33A 2VCBA 4AEJA 4COUA 5IWFA 2EF6A 4BQ1A 3BB6A 4KBBA 1W6MB 3KM5A 5CNAA 1NCQA 2HWE2 3WF1A 2VZ1A 2QQMA 4BM8A 2DUPA 3O1MA 1CAWB 5A3NA 5F5AA 2XG3A 3UKNA 5IVYA 4YZ1A 3HNBM 5CFCC 3ZKYA 4U36A 4YSFA 1WD4A 1CZVA 1FNZA 2HWD1 4P14A 4Y1ZA 2ARCA 2X53S 4IV3A 3ZYRA 2VY0A 2J1UA 1QJEA 5DAWA 4XF4A 1BYHA 4XMAA 3VL9A 3WDYA 2H6CA 3JCIA 4HANA 2F4PA 5FPVA 5C4WA 3USUB 1Q43A 4MGIE 5D8AB 1YIFA 4HKWA 4P02B 5I0TA 2HWC1 2R49A 4JQRA 3WW1A 3GZUC 3WX5A 4HVQA 1H6XA 1W9TA 3PJYA 1KJRA 5AVPA 2IUWA 2HH9A 3OGVA 1HRI2 4GALA 3UETA 5CBLA 2RS33 3AYCA 4IL7A 4CU9A 4BIOA 1L7QA 2XLFA 3LEIA 1V9U2 4Y24A 4BK4A 4M0NA 1XC6A 4WVWA 3LOIA 5HPOA 3TEYA 2VG9A 1LU1A 5BNOB 1UOFA 2J1SA 4LA3A 4BZ4A 2ID4A 5F1RA 1CZTA 3TEXA 2WFF3 4QQLA 3VLBB 1PGW1 3CNAA 4MVTA 3WLUA 2E31A 3BGAA 4PCRA 5BNNB 1UZYA 3U75A 5H9PA 2ZX1A 4E8CA 3ACIA 4QPGC 4R4ZA 3D0SA 1LESA 5F5IA 1R1A1 3C7HA 3UGHA 3ZYHA 1QJX2 4Q1RA 1APNA 1EUUA 1QKQA 4D6SA 3B94A 4QPIC 1AR83 4V1PA 3ZVXA 3KF5A 2QQJA 3LD8A 2XQRA 3WNPA 4F83A 1UYYA 3WG4A 2R1BA 3I8TA 3IM0A 1YXWA 2VH9A 1RUH2 3VN4A 3OUJA 2QJVA 3ON7A 4XFAA 2DTWA 3WW2A 1YQ6A 5T5PA 1ZA7A 4LHNA 1NCQC 2EXHA 1FXZA 2ZGRA 1RXGA 4FXGB 5A7WA 1GNHA 4BWOA 3UV9A 3RZLA 1ZBA3 5DPNA 2OVUA 4LITA 4N8MA 4BJ0A 3WNOA 2E7AA 5T52A 3K3OA 5JI9A 1IS3A 2VVFA 3WQBA 3NJVA 4IEXA 4E8DA 3BKZA 1JZ7A 1GP4A 5F39A 1D4M1 2RMU3 4LO6B 1OLMA 2GH2A 2JX9A 2WBKA 3ZFEA 1LNSA 5IW0A 1LHOA 1R1A2 3CMGA 4J1WA 5FXXA 4NJ4A 2MHFA 3I2KA 5J96B 1NOVA 2JICA 1AR71 2ZGKA 3BCWA 4UF0A 3KVAA 1D0HA 4CDQB 1H6YA 2PQSA 4UFLA 1PK6A 4IV1A 5LZ6A 4CSWA 1S0FA 2WAOA 2YMZA 1BMV2 2A5ZA 5LCWL 1WBLA 1O91A 5FCCA 3U1XA 3WNMA 1WMFA 1VP6A 3AFGA 3FLPA 1QXPA 4A2UA 3LA7A 2EIEA 1YFWA 3I4IA 1UAIA 1D4VB 4Y4YA 1GNYA 2V4AA 4ZPIA 4XAEA 3CDZB 1GWLA 3KGZA 2IXCA 2JDPA 2HWB2 3MYXA 4R52A 4QX0A 3M3CA 5A7PA 3L2HA 3ME2A 4CUGA 4M4PA 1W05A 1FPN3 2GNTA 4H3WA 1PMJX 3T4VA 3WQ1A 1HXS1 1UIKA 1O5UA 2FZ1A 4P5HA 3T3YA 4W4ZA 3I49A 3GM8A 2TNFA 2WWJA 4OQ8A 3TEWA 2XOMA 1O4YA 1WCKA 1ZBE2 3VZJA 4O9GA 4ASLA 3THDA 3QD6A 4PIYA 3CJIC 4BQ5A 3AP7A 2WZPP 3H8UA 4EZ4A 2JG9C 1AX0A 3ZR5A 3AMNA 3NKGA 2WO2A 4N43B 2ORXA 4FPKA 4H7MA 2RG4A 4UFHA 2YU1A 3KCCA 4MHUA 3LIGA 4BCUA 5FMOS 1MS5A 1UD1A 2Z79A 4FPEA 1AJOA 2JE7A 2SBAA 5APAA 1SDWA 4AVAA 4CDXA 3NAPC 3BIWE 3VBFB 1QXRA 3T0DA 5LBFA 1QJX3 4IE0A 4NROA 5CG8A 5FMBA 1W8UA 4RHV3 1Q8QA 4XZUG 4NE9A 4YZ4A 1J84A 1OVSA 1ENXA 2JDKA 4ZU7A 3V0AB 3OCPA 1QQP3 4C0BA 4CPBA 1ZZ9A 1GWKA 1OOPA 4IDZA 5F5QA 1GANA 3ZFFA 5C71A 3VDAA 4AQ2A 1GU3A 2B39A 2LTNA 4IE5A 3GXUA 4WZFA 5E8AA 1GLHA 2VQUA 3N7KA 3O1PA 4IV1C 1RUD2 2D6NA 3L9JT 4GMP1 4JRLA 5A3TA 2PLV3 3U14A 4MXVA 4CCMA 4I09A 3IBMA 1AR63 5DG1A 2XLAA 4B4PA 1AR91 3O7OA 2I2SA 4UOJA 4XQWA 3VBSC 3PU3A 4WM8B 3JB4C 4GZ9A 2XHKA 3NNGA 1VBA2 4QXKA 2Y26A 1QH6A 3SH3A 3A0KA 3AMPA 1CAXA 3J8F2 2Z2SB 2J1AA 1PK6B 2PAKA 3ILRA 3MLKA 1LU2A 3HT1A 3B5LB 1OFSA 3UK9A 5FJHA 3ZSKA 2ZHNA 2NPIA 1S0CA 1HXS2 5IUQA 1W6PB 1W3VA 1F5FA 2CGNA 3D3AA 3IWZA 4AFMA 3UT0A 3AP6A 2WNEA 4I0BA 3OPWA 2W08A 4JKKA 5CZKA 4QWNA 2LW8A 4LKFA 4XABA 1QDCA 5JMOA 1WMXA 3THCA 1IS5A 1FOD1 4XCBA 4AQ6A 4LHSA 4GA9A 3ILNA 1RJ7A 4XF9A 5KXCA 4R9DA 2WN3A 4S2DA 1MR5A 3HD8B 4BDVB 2HWF3 1WD3A 2GC0A 3HJRA 2WNUB 2V73A 1ZZ7A 2IVIB 4AFAA 2ZPXA 3IIIA 2Q1MA 1QNWA 2Q0AA 1HLCA 1H9PA 1CAWA 2RJLA 2UWCA 2WN2A 4ARYA 4HK8A
chains in the Genus database with same CATH topology
2VULA 2BTVC 2R0HA 4PDWC 1ULGA 4RQPC 2PHTA 1H2NA 1Z0HA 2R32A 3KLSA 2VECA 3ALQA 5CG9A 1YNAA 1UPSA 5JSPA 4XJZA 5K0UB 5JDBA 5C8CA 2NLRA 1QOTA 2ZGLA 2FZ2A 3VL8A 5JMCA 4CTEA 5IT6A 1EP0A 1EY2A 4PDWB 1ZVFA 4M0HA 1U5ZA 3NO8A 4RFT0 1CR7A 1OLQA 1AR81 1LCLA 3WUDA 1W6MA 3WP3A 2VNGA 4AI2A 5FOBB 2DVFA 1AXZA 4M3CF 2A3XA 2BVBA 1KS4A 2A71A 4Y20A 3INAA 2JJ6A 3GNEA 1CAUB 3VZNA 4NR1A 4AHWA 3FBYA 3SHRA 4C0HA 3N3HA 4DFSA 2XKPA 2VW1A 3JD71 2R16A 3ZMOA 2CGOA 3TBDA 2RS32 4QU2A 3VBSB 2HWB3 1J58A 1ZBE3 4FOYA 4YRDA 1H0BA 5BNPB 5C6CA 4PBPA 4RR3B 3KMHA 1X33A 4ZKTB 1M06G 2B45X 2WINB 1PO11 2WWSA 5JOXA 4YFZA 3VV1A 3IMNA 4WM7B 5IK4A 5K9YA 4Q26A 5FTTC 2BEOA 1H2LA 2WNVA 3UJQA 4C90A 3M3IA 5BYNA 1LHNA 1PO21 1HKDA 3PLQA 2E63A 1AF9A 3QH6A 1OOPB 2XL7A 2YZ4A 2A6WA 3AFKA 3JBG2 1PO23 3TN91 1DF0A 4YM3A 4I0AA 4KL1A 3DPRC 1MZ5A 4WM8C 3WDUA 4IETA 3ZFGB 4N43C 1A78A 3R4DB 4AVVA 3EJKA 2WLPA 2AYHA 2WA3A 3ZN4A 4X6RB 3VBFC 5FO7B 3NSTA 3DL3A 5EJ3A 3U10A 4GMP0 2QUOA 4F3JA 5C33A 1SCRA 4FTSA 3VUOA 4KGGA 1SMVA 4CDWB 1GQGA 4Q8LA 1RMU2 4FPYA 3AM2A 3GZAA 5HXVA 1S0GA 3NAPA 1JN2P 4OI4A 3TN92 4BPZA 1YCIA 2KA3A 3LAGA 1G6NA 1HQLA 3JUUA 4XTMA 2K0GA 5ABJC 4XW3A 4YM2A 1HX6A 2R062 2HWC3 3P3PA 3FHIB 3WDXA 3OGGA 1CIWA 1MEC1 2XJPA 2E7QA 5AC92 5JZGC 1COV3 4Z2WA 2XL9A 2IXJA 2YV8A 2XBO2 4Z1VA 4EN9B 3VBHA 4S2GA 2E7TA 4LBLA 5HI0A 4Q4W1 1HRI1 2AUYA 2DYCA 5BV6A 1UF2C 1FAYA 1C8M1 1FNYA 2RS51 3LWCA 3VBUC 3ZN6A 1G9BA 2WFF2 1YUDA 4DXZA 5ACA3 4IEZA 4GMP3 5FPZA 1FOD2 2XGXA 1S1AA 5EZWA 2R6QA 1O7FA 1DYPA 1TQ5A 3VBRC 4M3CA 4AF9A 2BWCA 3VZMA 2R0FA 1OD5A 3E6CC 1MS4A 1DDLA 4CDUC 1BQPA 2CYFA 1DFQA 1QJZA 4AVTA 3VBUB 1UW8A 5DDJ2 2HJIA 4PIZA 4XZPA 5K0UC 2WNUC 4XQDA 3NW4A 1IPKA 5FO9B 5EYYA 3SCHA 4JGYA 5CFCA 5J36A 3V0BA 3L2YA 2EIGA 3AYAA 3O14A 3PVEA 1ZZBA 3ECQA 1O3SA 5DUXA 3GF6A 3DPRB 1WBFA 2F6BA 2HWE3 5ABJA 1D4M3 1SLAA 2HWB1 4MV2A 5DUUA 4A7ZA 1DQ6A 4DRVA 4UW5A 3AXEA 4FOWA 3VBOC 3NV3A 5EV7A 4KWLA 3WW3A 3THPA 5FPXA 4IXLA 2QVSB 4TWTA 3M8LA 4J6GA 3W59A 3EQEA 5KBFA 3SISA 4FP3A 3UKVA 2XVGA 4XIOA 5J48A 4YYOA 3VBOB 1RHI3 3I54A 3HR9A 4BIFA 1JW6A 2PA7A 1BJQA 3NVCA 4XF1A 4P9GA 2MPFA 2SLIA 4HBNA 4GB33 4NO4A 4WM7C 4FAHA 4HN0A 4QPYA 1GV9A 1N1YA 1VAKA 4FVVA 4MGKE 3AYEA 3THTA 2RM21 4RD7A 5L73A 1C57A 2H0BA 5BPXA 1HRV2 5SV8A 4Y26A 2ARXA 2GC3A 4CDUA 3R05A 2FBEA 4AGVA 1XQNA 3IPVA 4Q2FA 4YGCA 5FRAA 4XJ8A 2RJKA 5JPMB 2B7YA 1NA1A 1H1AA 3HWJA 2O0OA 3I59A 4FCAA 3RPQA 1SLTA 2W52A 4NHMA 1RUE2 1Q56A 1YLLA 1ZRDA 3D82A 2D3RA 2P17A 5TSWA 2C1FA 4A7YA 3R4SA 2E9QA 4EN8B 2Z5WA 1AXKA 2Q5TA 1I6XA 1VBC2 3TRSB 2GNMA 4IEUA 1MS8A 1VB2A 5D1IA 4KG0A 3POWA 3AZYA 2GC1A 1X8EA 1GNZA 1LENA 1BBT3 3QLQA 1UL9A 2B8MA 1BBT2 3VBOA 1XNBA 1QQP2 2PTMA 3CF6E 3H7JA 1U0AA 3SH5A 2GZWA 4M3CB 3T1MA 3E6BA 2RR12 1NLSA 4D94A 2D7FA 5JAXA 3ZSLA 5HCBA 5T50A 2VPVA 1C8M2 2RS52 3SCGA 3N35A 4Q4X3 3A0NA 2ZGUA 1S0IA 3ZXDA 3PMSA 1XNCA 1B35B 5LK5A 2R071 4OHZA 2DCYA 1W6QA 4LLFA 3RMYA 1W6NA 3RG0A 2P3JA 2XJQA 4JGYC 2D5FA 3FFZA 5KC5A 5LK7B 2R072 4TYSA 1PO12 1CQ9A 2DFBA 2GNBA 5JLVA 2ZGNA 3MIFA 4YGDA 4YZ2A 1ND2A 4AI0A 1RUC2 3MIHA 4JC1A 5L36A 4ITCA 3VHRA 1VBE3 3T2TA 4PBOA 1RMU1 2DURA 2ZJCA 2BUKA 5H9RA 1CX4A 4R9AA 5CADA 3E5UA 4XFCA 3N4MA 2IFRA 1V9U1 3HN1A 1YIPA 3I7DA 5FLIA 1JHNA 4NWWA 2OW4A 1K5MA 2ZZJA 1NA1B 5LRRA 3ZFFC 5KC6A 1NCQB 2VNRA 2GN7A 3PJQA 1QJX1 3KQRA 2OZJA 4FTEA 4N53B 2D6OX 2XJTA 3AXDA 1AX2A 1RUC1 4DRRA 2XPJA 4YVWC 1QWRA 4BA6A 1O3QA 3MI8A 3OGJA 4BLIA 1H2MA 1R093 4WZCA 2XWBB 4JDMA 2K9ZA 1OOPC 4KG8A 1ULDA 1HQNA 4HZFA 4B8EA 2DCJA 1DGWA 1AR73 4PQ9A 4DY3A 1GFF2 4OVEA 1VIWB 4N9IA 4RL7A 4AW7A 3ZIXA 1ZM1A 2IXIA 4NN0A 1R081 5IK5A 5I91A 1UPIA 1UU6A 1AL21 1R1ZA 4NHLA 4RS5B 4CZSA 3HQXA 4Q4V1 4RR3C 4AEMA 4ES8A 2ZKNA 1W6OA 2WA4A 2ZS6B 5CA6A 4OULA 1VLNA 5FLJA 3IT8A 1H1MA 1XU1A 4QQOA 4AWDA 1H8TA 3ZSEA 4YZ5A 2JENA 3SNMA 5D8AC 2DFCA 4IEPA 5J98B 1R082 2UYBA 4Y5Z0 4BOWA 1PVC2 4YVSA 2BQPA 5KWRA 4LO7A 4FO9A 4W6YA 5FFOC 3U0ZA 1PIV2 2ZBJA 1GKBA 4P9IA 1I5ZA 1K5MC 3Q9OA 4LUKA 4OZXA 2BVVA 3O0XA 4N9HA 3E5XA 4IV3C 4AEDB 1VBE1 4YFWA 3V0BB 3HIFA 1I1EA 3DKWA 4JGYB 1NCRA 5FOJB 5JOYA 1H2KA 3M2MA 4OUMA 4P9WA 1V9U3 2HWF2 2XH6A 3BPZA 4NPRA 1MQTC 1HRI3 4RS5A 4BYYA 1N3QA 1V6MA 2AREA 1POV3 2WNVB 4LBQB 3ILFA 5HBAA 4HPKA 4IQPA 5T5LA 1YO8A 1S0DA 1J3RA 3KB5A 4K6BA 4WVZA 5JOWA 5JWPA 1AL23 2XJVA 2VQAA 4COWA 2VQ0A 2RM23 1UMZA 2NP0A 4EROA 3ES1A 1CGPA 4MGZE 1AL22 1AYN2 3O12A 1ZX5A 3VHOA 1O3RA 3MFAA 2D98A 2JDZA 4BHPA 4K7JA 4LO4B 2XJUA 1IGOA 2RS13 2QZ3A 1QGLA 1R1A3 1MVEA 2V09A 3KT1A 4E2GA 2QFEA 1TEIA 3B9IA 1S0EA 2WS91 5CAZA 1KRIA 1ZZ6A 1VAVA 2WLQA 3JD73 2NYYA 4AVCA 2ZHKA 1LEMA 4JTOA 4Y22A 4RHV1 1AYM3 1GZWB 1DHKB 1WLWA 1Z7S2 4FAGA 2BYVE 5C4WC 2TUNA 2JG8A 3MZHA 3LKJA 3RQ0A 3VKMA 1JBCA 4AYUA 4I2OA 5FMOL 2DVGA 2GSYA 4YW2A 4KH9A 5JPNB 4PIXA 1MEC2 1DIWA 4ORFA 2BWAA 4QD2A 2CTVA 3D4KA 3A4UA 5SV5A 5C8WA 4Y1UA 2VVEA 1QOOA 4ZXKA 1IQAA 5ACA2 3UL2A 5AFBA 2R042 3M3OA 2ZABA 3PVOA 1QH7A 4CEYA 1U5YA 3MIGA 5L19A 1PM7A 2VGDA 4WVVA 1ENSA 2XBO3 2QZ2A 3GZTB 1G8WA 1HRV3 3PVNA 2C0ZA 4MH0E 1PGL1 2UY9A 5EXOA 1PGSA 4GB31 3WR0A 3OY8A 3QCWA 4HT1T 4OI1A 1DU3D 5H9QA 1RUG3 2QE3A 1N3PA 2JG9B 2ARBA 4EWAA 2JXAA 2G9GA 1NA1C 2Y0OA 3H50A 2IWGB 2JD4A 1A6CA 1RUF3 4FPHA 4R9BA 3VBFA 1W6NB 2R063 2P37A 1ONAA 2E6VA 4N53C 1SBDA 4K1YA 1VBD1 3RYPA 2PN5A 4AI3A 5I93A 4EV0A 1YRZA 1PVC1 3KSCA 4YZ3A 1DYKA 1H8TB 2DU0A 4G4FA 4K8FA 4IEYA 4F8AA 1QJY2 1CAUA 2VW2A 4NVPA 2BPA2 1RMU3 2XLGA 4EN0A 3NL1A 1ZBA1 3M3EA 1G9FA 3ZXLA 4XF0A 1ENRA 1N47A 4AI8A 4W6WA 1ASJ3 1SFNA 3OBRA 1LOFA 3JBG3 2EALA 3CO2A 3ZFEC 1QJY3 2W68A 3ZXFA 5J7MA 2ZAAA 2PHFA 3LSEA 2GALA 4IEVA 1FV2A 3W9AA 4FPCA 3RYKA 1R083 1UU4A 3OD0A 5CVRA 3VGIA 2P3KA 4ONUA 4UW3A 3WDTA 2ZX4A 4CDUB 3M7AA 2D6MA 2WNVC 4I0WB 2D6KA 4QMAA 3GHMA 3ZYPA 3V0AA 4RQPB 1OLRA 2XJRA 3E5QA 3ROUA 2VVDA 1RHI1 3V65A 2LALA 1QMJA 4HKLA 3TNQA 1EV13 1AXYA 2ZX2A 3WHTA 3CL1A 3I59B 2A6ZA 4IEQA 1LHWA 2OPKA 4ZU5A 1BCXA 2PHWA 1F9KA 3H1MA 1AR82 4LT5A 1ZNPA 1LECA 3HBZA 4G9SB 4HVRA 3H0OA 3OF1A 2WNUA 3MW4A 1KQRA 1DZTA 1Y9QA 2DCKA 2Z69A 4OHWA 2QCSB 2NQYA 1NXD1 2HEYF 4KU7A 4QPIB 1RUF1 5F9TA 1UIJA 4FQ4A 4OHYA 1U12A 3OD4A 4I02A 1OQDA 5BNOC 2VXRA 4Q0UA 3ZX7A 1C5HA 2GU9A 2VMGA 1EAH3 5BNNC 1RUI3 3LOBA 4CEWC 2EXKA 3MGUA 3PTYA 1CJPA 4MXWB 1RVF1 1DQ5A 1YHFA 2CGPA 1ZBE1 1CAXB 3ZN5A 5GLWA 4AFBA 3WZ1A 3S7EA 4YGBA 1G7YA 2WSVA 3VBUA 1D2SA 2OA2A 4R4XA 4NHKA 1WCDJ 4CEWB 4AG4A 1A8MA 3R4UA 1ASJ2 4HFSA 1OA3A 2FMYA 2X5IC 1HIXA 3FWEA 4YW5A 1RUJ3 2PYTA 2WZR3 5JI7A 4E9KA 1RINA 4QPIA 1FT9A 1GZCA 4XJUA 2NZ9A 3ZMNA 4I3PA 3I2DA 1KITA 5DZFA 1VR3A 2GAUA 1RVF2 4K3UA 3AK0A 2X8KA 5KXEA 1RUH3 1KS5A 3WG2A 4JGZB 1WLDA 3ZYIB 2LM3A 3M70A 1RUE1 1SFYA 2HWE1 3FMGA 1FMD1 2QKDA 3AMMA 1AR92 3PMEA 2R061 1MS0A 3DN7A 2ZAHA 1HW5A 5BNQA 4RA0A 5FDBA 1S0BA 2ATFA 3WW4A 3V64A 1GQHA 2D6PA 3SITA 4ASMB 2VUAA 4Q4Y1 2WT2A 4E27A 3ZYJB 2G9FA 1VRH3 4QQPA 1Q8SA 2JECA 3WDVA 3WP5A 4YLZA 3UJOA 1KXGA 5C9AC 2A73B 4OI2A 1JXNA 1LR5A 2A6XA 3GBGA 4XIKA 1QQP1 4XFHA 1YWKA 4WVMB 2XBO1 3WT3A 3VBRB 4XXAA 1CONA 1W2UA 3SH4A 4AFCA 5I8TA 4EJRA 2PHRA 1WLCA 3ZFGA 1BVP1 4RR3A 2D97A 1ZBA2 1LGBA 4LUMA 3RYRA 1C8M3 2RS53 2ZGSA 1DGLA 4AVSA 4CDQC 5E16A 2PAEA 3GBFA 5JSRA 1TNRA 4MUVA 4OLLA 5ABJB 4Z07A 4E4ZA 4XQ4A 4RGAA 4AEDC 2Y38A 2CWMA 1Z78A 1AYM1 5JZGB 1BK1A 4BMBA 2JG9A 3KZ4C 3NV2A 1G86A 5J37A 1GR3A 1DQ0A 1LOEA 3AP5A 4Q4V2 1G9AA 1LJ7A 1AYM2 1Z7S3 4META 2ZA9A 5GZEA 2EA7A 5JVVA 1NE4A 1ZRCA 2HWD2 3JD72 1JTZX 2FHRA 5JCTA 1AR72 1XYOA 1OFNA 1FPN2 2CL2A 3R6SA 3O0WA 2QDRA 4QM8A 1AL0G 4DY5A 1LOFC 2IXLA 3B00A 4LE4A 2ILMA 3AKRA 3WUCA 5IK8A 3PHMA 1NCRC 3M3QA 1J3QA 4CYDA 1QOSA 2WL1A 2A6VA 4QQHA 1ZZ8A 4LEJA 5B2GB 5I8SA 3ZXGA 4XILA 4HETA 2CAVA 5BNNA 4RS5C 1W6OB 4C1XA 3FZ3A 3EHKA 3VBSA 4FT8A 1ZRFA 4LBNA 4FP2A 1TMF3 1C5IA 1SLIA 4EWEA 1TNFA 3ZIWA 2XKOA 2BBVA 3GYDA 3NKTA 4AEKA 3QH7A 4KU8A 4L11A