1FNZA

A bark lectin from robinia pseudoacacia in complex with n-acetylgalactosamine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
237
structure length
234
Chain Sequence
TGSLSFSFPKFAPNQPYLINQGDALVTSTGVLQLTNVVNGVPSSKSLGRALYAAPFQIWDSTTGNVASFVTSFTFIIQAPNPATTADGLAFFLAPVDTQPLDLGGMLGIFKFNKSNQIVAVEFDTFSNGDWDPKGRHLGINVNSIESIKTVPWNWTNGEVANVFISYEASTKSLTASLVYPSLETSFIIDAIVDVKIVLPEWVRFGFSATTGIDKGYVQTNDVLSWSFESNLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARK AGGLUTININ I, POLYPEPTIDE A
publication title Structure of a legume lectin from the bark of Robinia pseudoacacia and its complex with N-acetylgalactosamine
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 49
structure length 234
sequence length 237
ec nomenclature
pdb deposition date 2000-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fnzA00
4MYEA 4Y1UA 1WBLA 3OJBA 1BYHA 4YZ3A 2P3JA 5DZFA 3FLRA 3ZYRA 3L2YA 1QDCA 3WDWA 2GN7A 4GWMA 3B9CA 1OKQA 2LALA 2W08A 2YY1A 1OFSA 5IK4A 1V6JA 2R0FA 1HLCA 3FFZA 3KM5A 2ZGOA 1MS9A 1G9AA 2ARBA 2DU1A 4YW4A 5EXOA 1LOEA 1WLWA 1ULFA 3A0NA 1AXZA 3VKMA 3IPVA 1SLBA 1LU1A 3KQRA 3VKNA 1WD3A 5GLTA 4XMIA 2EIGA 1DFQA 4YGDA 1LGCA 4AVSA 1BXHA 4K20A 3ILFA 3AYCA 1AX2A 2AYHA 1AX1A 2ZZJA 2ZGSA 1CONA 3I8TA 4HANA 5GZCA 4BM8A 3GNEA 5L73A 4GXLA 5DUUA 3MW4A 3W58A 1QDOA 3AK0A 2JE9A 2V5YA 2UWCA 1GICA 5EWSA 2ZKNA 3ZVXA 1UZYA 1IKQA 4ZXKA 1LHNA 1URXA 1S0GA 2D6OX 3WDXA 1KRIA 1LEMA 4UW4A 5T54A 1ENQA 3MW2A 4ATFA 4UW5A 1X50A 3WDYA 1QF3A 4AGGA 3MPPG 2A3XA 2GNBA 1CIWA 3OBRA 4DFSA 3RMXA 1MZ6A 3RRDA 3QCWA 3ZPYA 1S0DA 4PCRA 5BYNA 1R1ZA 2A7AA 1UX6A 5GLWA 1GKBA 3RQ0A 3QLQA 4RA0A 4XE9A 1YXWA 1N3OA 3N35A 5GM0A 2W52A 5CB7A 4XYXA 4DS0A 1F5FA 4IQPA 2YZ4A 3V64A 3B69A 1KJRA 4PBPA 2D6MA 4Q1RA 1CVNA 3UJOA 2A6WA 4LBOA 2DUPA 4TZDA 2D43A 2EALA 1S1AA 4YM0A 3TB0A 4L8QA 1YRZA 3OGGA 5E8AA 4AGRA 4FOWA 3ZXKA 1WUVA 1CPNA 5LK5A 3OY8A 1S0BA 1PZ7A 2VXRA 3AZZA 3H0OA 4R9AA 2P3IA 3FLTA 5GZFA 3LCPA 5GLUA 5CAZA 1RIRA 3PMEA 5T5OA 1W6NB 1U0AA 3RS6A 2DTWA 3UK9A 2WLQA 1IKPA 3NV3A 3V0AA 1LOBA 4GKXA 2CY6A 3ENRA 1Y7BA 2DVFA 4KBBA 4YZ4A 1GZ9A 1UKGA 5JOWA 2DVAA 3PJQA 5JMCA 1C1FA 1LENA 3D6EA 3OPZA 1VAMA 2UWBA 5KXBA 4FVVA 2CTVA 1S0FA 4Y1VA 3U4XA 1W6QB 4YM2A 3WDVA 2NYYA 4P14A 3USUA 1GV9A 1CN1A 1GZWA 1YO8A 3ZSJA 2R0HA 2OW4A 3GALA 1ONAA 1V6LA 5F5QA 5T5LA 2D3PA 4JCKA 3APBA 2ERFA 4GALA 3LSEA 5GLVA 2P37A 1BZWA 2A3WA 2A71A 3R4SA 4LBQD 1IS3A 4M3CA 4XBQA 4Y22A 3NV2A 3PVOA 3SNMA 2DUOA 2PELA 1KDMA 5H9RA 4XBLA 2DVGA 2R1DA 2ZGPA 1H9WA 3NV1A 5EYYA 4WVWA 4Z8BA 1CR7A 1ENSA 2OUJA 4XHXA 4Y1XA 5DZEA 4BQ1A 1G9DA 2NZ9A 3AYDA 3SISA 4CTEA 1ULGA 3M3CA 1GZWB 3MW3A 2WT1A 4YG6A 1UZZA 1C1LA 1IOAA 3A0KA 1VALA 4SLIA 1GNZA 2VY0A 1W6OB 4W65A 4D69A 4Y24A 4LBKA 4BMEA 1DYKA 3PVEA 3N7LA 2WQZC 1UN1A 3WNXA 1AJOA 1JBCA 3HMYA 4BOWA 1QMJA 4XBNA 1FV2A 1N1YA 1QOSA 1LULA 4DQAA 2V73A 1QU0A 2A6VA 2ZGUA 4BLJA 1JYCA 3M3EA 1EPWA 4FPYA 3AJZA 2GNDA 1ULDA 1Z0HA 1JN2P 3M2MA 4Y1YA 2D6KA 2KM2A 3VUOA 3AX4A 2FMDA 2CNAA 3O12A 1LJ7A 1W6MA 2E7QA 1G9CA 1IS4A 1SCSA 4ATEA 2DYCA 2DVBA 5T52A 1A8DA 3AXEA 4Y20A 5GALA 3RG0A 4AVTA 3N7KA 4LBMA 4JRAA 1C57A 1YI7A 2R16A 3OYWA 4RL7A 3WVJA 1G9BA 4XIOA 3N7JA 3SITA 4LBJA 2B7YA 3AP5A 5CA6A 1V6IA 1JW6A 1ULCA 2ZMLA 1N47A 4F83A 1LTEA 1N1VA 2VUAA 3WLUA 4XTMA 5HCAA 2JJ6A 3HN1A 5DG2A 5IK7A 3FLPA 4C1XA 1VIWB 4AWDA 2H0BA 3VKFC 1V6MA 1XQNA 4YW1A 1Z78A 3AZXA 1MS4A 1SLAA 5KXDA 3IPVB 1UPSA 1DGLA 2D44A 3D4KA 1SBFA 2E6VA 2A6YA 4M00A 3I4IA 2DWRA 4YW2A 5GJ6A 3ZSMA 1V6OA 4Q26A 1NLSA 3D5OA 3WG4A 4YFZA 1LCLA 4XTPA 2OUHA 2WSVA 3DUIA 1F31A 4NOTA 1B09A 3ATGA 2NM1A 5H9SA 1DLLA 5JOXA 1JXNA 2WJSA 3ASIA 4R9CA 1WW4A 2ARXA 3WUCA 2JKBA 1QOTA 2GALA 2PHXA 2ZGKA 2PHTA 1D0HA 3ZSLA 4PF5A 4ASMB 1LEDA 2WNEA 4YZ1A 2ZGTA 2GN3A 2PHFA 1CESA 3AZVA 1C4RA 3HR9A 1BKZA 1W0OA 4OZXA 1BJQA 2A6XA 1QOOA 4FPHA 4XIKA 2R1BA 5IUQA 3T2TA 5JOZA 2UU8A 3ILNA 4BPZA 3N7MA 5CNAA 4FQ4A 4Q8LA 2DVDA 4PQ9A 4R9BA 4XZPA 4M01A 3AP6A 2Q5TA 1LHVA 1I1EA 2AUYA 3WUDA 4XDQA 1MVEA 1LODA 1D2SA 5KXCA 3BODA 1V00A 3V0BA 3O0VA 2D7FA 1Q8OA 3JUUA 2DUQA 1DQ1A 2A5ZA 1S0EA 1G7YA 4FPFA 4NO4A 2EXJA 3T1LA 5T50A 4P9XA 2D6LX 2WT0A 2G4IA 2JE7A 2TEPA 3A4UA 3DGTA 4FPJA 1DYPA 2Z42A 4FPCA 5AVAA 1S0CA 5FREA 2YMZA 4ZKTB 4LBNA 5CBLA 2AREA 2A3YA 4FPEA 3OY8B 1LHWA 3FBYA 4XILA 2D6PA 2ZACA 3BIWE 5GZEA 1A78A 3PVNA 1WLCA 4K1YA 2P34A 5IT6A 2R49A 1W6PA 2CWSA 1JHNA 4YM3A 1SLIA 1N1SA 1O4ZA 1O4YA 4Q1PA 3V0AB 2NMOA 2ZHNA 1LESA 4XOGA 1DQ5A 4AGVA 4DRRA 2GMMA 1MS0A 1BQPA 4XJWA 1WBFA 3WDUA 1IS5A 4LBLA 5DUVA 1PZ9A 2PHWA 1CJPA 1VAVA 1UMZA 2CWMA 2XB6C 3USUB 4CZSA 3Q9OA 2JDZA 2ZGQA 3O5SA 2E7TA 3ZXEA 2D3SA 1FNYA 3UL2A 3VKLA 1SFYA 4FOYA 4XJAA 3ILRA 4YFWA 4AYUA 3WHUA 2ZGNA 4WV8A 1DQ4A 3W59A 4WVVA 4FPGA 4U36A 4Y22B 4M3CB 4M3CF 1DBNA 4WZFA 2OVUA 1SACA 4I30A 2ZGLA 3O0WA 2HYKA 2E53A 3R05A 1GBGA 2JD4A 4BMBA 3SH4A 4XMAA 2VH9A 2ZMKA 3N36A 3O0XA 1GSLA 2EXIA 2D3RA 4YG0A 3B3QE 4FPLA 3NWKA 5FRAA 2I2SA 2JECA 1FYUA 4FP2A 1QKQA 3WDTA 3AP7A 1G8WA 1MACA 2ZHMA 1WW6A 1YIFA 2A70A 3LSDA 2D6NA 2ZAAA 3CNAA 5E89A 4ISQA 1FNZA 1APNA 5DXDA 1MZ5A 1LECA 4FOVA 5GZDA 4YM1A 5EYXA 5H9PA 5E88A 1UAIA 5F9TA 1AXYA 1ENRA 5DUXA 1AX0A 1FV3A 2SLIA 2GMEA 3MEPA 1NXD1 5IK8A 3INAA 1S0IA 3B01A 1SBDA 3SH5A 1MR5A 1GLHA 4UW6A 2W39A 4HL0A 1KQRA 3SH3A 1FX5A 1JYIA 4YZ5A 2WT2A 2AENA 2ZHKA 5DG1A 2NN8A 1A3KA 1CQ9A 2DTYA 4K1ZA 1SCRA 2C5DA 2BQPA 2P2KA 3AXDA 4XJ8A 5HCBA 1J1TA 2EXHA 1VLNA 4XJ9A 5T5JA 2GMPA 2XG3A 4GWNA 1GANA 2AH2A 1W6MB 2GDFA 1F9KA 4H55A 1CPMA 4YG3A 5T55A 2C9AA 4Y20B 3POSA 3VKOA 2NMNA 3OYWB 4Q8KA 1DQ2A 4XJUA 1SBEA 3VV1A 3AFKA 2AR6A 1HKDA 1LOCA 1SLTA 3AYEA 1Q8SA 3AZWA 2CL2A 2A75A 4JC1A 4YLZA 3M3QA 1MS1A 3V65A 2GNTA 3POYA 1TEIA 1FATA 3JU9A 4GA9A 5T5PA 3WCRA 3WG1A 4XXPA 1Q8QA 1ZM1A 4YGBA 3RMYA 5KXEA 1RINA 3ZXJA 1ULEA 1S0JA 3WCSA 3RSJA 1KDKA 1LOAA 3BTAA 3WZ1A 1W0PA 2PHRA 4U2AA 3TAYA 1JOJA 1MS8A 1WW5A 1WCSA 5DUWA 5IK5A 2DV9A 3M1HA 4P9WA 1N3PA 4YW3A 1Q56A 2CYFA 1Q8VA 1W6NA 3FUOA 3ZXLA 4PBOA 5GLZA 1I3HA 1FAYA 1WD4A 1GYKA 1LU2A 1QNWA 1YYNA 1LOFA 2ZHLA 1V6NA 3M3OA 3R4UA 2FHRA 4M3CE 4C1WA 4DRVA 3FUQA 1V6KA 2ES3A 3OBTA 1AF9A 1DQ6A 1W6QA 2ZGMA 4DPNA 1HQLA 4CRQA 2VW1A 1IS6A 3C2UA 2YXSA 1DQ0A 2LTNA 2P3KA 3ZXFA 2AGSA 4LBQA 1HQWA 4P9YA 3AP9A 2ENRA 1H9PA 3AYAA 3POWA 1QNYA 4TYSA 5SV8A 1KJLA 1LGBA 1MS3A 3V0BB 2VW2A 1LOFC 1AZDA 2UWAA 2ZBJA 3SLIA 1DHKB 2ZGRA 3AZYA 1DIWA 3WV6A 4Y26A 1GNHA 4AVVA 3IN9A 3ZYPA 1OQ1A 4YW5A 5HCFA 3T1MA 2VU9A 4FOQA 4YGCA 1H30A 2YROA 2PHUA 2WKKA 1AXKA 1LHOA 2DU0A 3AJYA 1MVQA 2WSUA 1PZ8A 3UJQA 2NP0A 3WG3A 2A6ZA 3WHTA 1G9FA 2W68A 3IM0A 4FPOB 1QGLA 4YGEA 4FPKA 3IKWA 2ZMNA 4LBQB 3N3HA 5JDBA 1W6OA 4Q2FA 4ITCA 1WLDA 1ZA4A 3B00A 4XHBA 1RITA 1W6PB 2ZA9A 1JUIA 4Q27A 3IMNA 1DZQA 5DZGA 5JOYA 1SLLA 2ZABA 1KITA 1AJKA 3NV4A 2YV8A 4BLIA 4Y1ZA 3BOPA 1AVBA 1GZCA 1WW7A 2GNMA 2EF6A 4GKYA 4R9DA 1LGNA 4UW3A 1Q8PA 5JVVA 1N3QA 2VW0A 2UURA 4FQZA 4YZ2A 1HDKA 5GZGA 2DURA 2E51A 2EXKA 2RHPA 4XXAA 3ZSKA 2EAKA 2SBAA 4ISRA 5H9QA 1LOGA 4FP3A 1G86A 4K21A 5JLVA 3AP4A 1LHUA 4XJZA 1N1TA 1UL9A 3WG2A 1MS5A 3WOGA 1SLCA
chains in the Genus database with same CATH superfamily
1HV1A 5FDBA 3NNGA 4NAOA 5FKCA 4DINB 5LASA 2Q8CA 1P8JA 3VHRA 3EXUA 2WS91 4KGGA 5IVEA 3L2YA 1HJFA 4YW7A 2GP3A 4GWMA 2WA4A 1OKQA 1XU2A 2HWC3 1OFSA 4Q4V3 4O7XA 5AVPA 3HQUA 3LIGA 2TBVA 4F7ZA 4Q4Y3 5A6YA 1BCXA 3KM5A 2G9ZA 2ZPXA 5BY5A 2ARBA 1MZFA 2LM3A 2WAOA 3J8F2 1UNBA 1FOD3 3J8F1 5FK7A 3UT0A 5K0UB 2WNOA 1CIYA 1JZ4A 4OULA 1T6BX 2OKXA 5GLTA 4EYUA 5FUNA 4E4DX 4K20A 3WNLA 2ZZJA 4FFHA 2FDGA 1CAVB 3K2OA 4XDPA 3AKTA 1CONA 4MXWB 1GFF2 1XNKA 1NA1C 4BM8A 1X7NA 1Z7S3 4Y5Z0 4JQTA 1O3SA 4E8CA 3AK0A 3MO4A 5BNOB 4BDVB 3ZYFA 4BQWA 4LT5A 1DZTA 3VDAA 3HNMA 3GBFA 3E6DA 4XUQA 4IV1A 4ZXKA 4AOCA 3WDXA 5FZ3A 4LITA 4QGMA 3DXTA 2Y6KA 1PK6C 1KFUL 1SEFA 4ATFA 5C5TA 4AHYA 1ZZ7A 3MPPG 1CIWA 1NXMA 2HEYF 1EV13 4I02A 1HIXA 3QCWA 3ZPYA 2E9QA 1S0DA 3WX5A 5IFPA 3VBFC 4PQQA 4YWAA 2VO5A 1MZEA 2MHFA 4ONUA 2QKDA 5IW0A 5I0UA 3VBHA 3WF1A 1O4TA 1BBT3 2A7AA 2YHJA 5A70A 2BBAA 3QLQA 4ZU4A 5CB7A 5GM0A 5I8YA 4IQPA 4RHV2 1E5HA 4RHV1 1RGSA 4P00B 1TME3 4OHVA 1IQAA 4Q1RA 2E33A 3UJOA 2WZEA 5DAWA 1EPZA 1K5JA 5FZLA 1OOPC 2XVGA 3TB0A 1YRZA 1QJY3 3FFQA 4AGRA 4IDZA 3ZXKA 1QWRA 3JBG3 1KXGA 5D8AB 3ZFEA 1BEV2 2RM22 3OY8A 1S0BA 4C91A 2RM21 4QM9A 1JTZX 1IQDC 1CJDA 3H0OA 4D8MA 2Q0AA 2WYSA 1RUF3 3FLTA 3S5QA 4BU2A 5C6CA 3HT2A 4G9SB 5GLUA 5CAZA 1RIRA 5T5OA 1W6NB 1U0AA 1QXPA 2O1QA 4Q0VA 3RS6A 4Z1VA 4UFIA 2WLQA 3WF4A 5FZ8A 3V0AA 2BOJA 4PLNA 2F4LA 2JG8A 4RR3B 2Y6JA 3ENRA 4HFSA 3SKVA 1XPWA 1GZ9A 4YZ4A 2DVAA 4DXSA 4QX3A 5JMCA 2VBDA 3OPZA 2HWE2 3D6EA 1VAMA 1W8OA 2JB8A 3VHNA 2UWBA 3ZFGC 4FVVA 3U10A 5HBAA 4Y1VA 1OVSA 3H3LA 1W6QB 3H1YA 3I54A 2P17A 1MEC1 1UOGA 4I3PA 5HPOA 2NYYA 4P14A 3P3PA 3USUA 2VUCA 2ZAHA 3FWEA 3WQ7A 1VBE3 4QDSA 5I8SA 1UU4A 5LRSA 1AYN2 2YC4A 2QVSB 4KL1A 5F5QA 4BQYA 1OT5A 2FMYA 2CU5A 4JCKA 5FZCA 4XVHA 3AFGA 4GALA 5FZ6A 4XFIA 3KVAA 2A71A 2A3WA 3KMHA 3LOIA 2K2SA 4LBQD 4M3CA 4S2HA 5FQ0A 2PELA 2VBPA 4GH4A 4QX0A 3KWVA 3VD9A 2Q8DA 4UAPA 4XBLA 2DVGA 1D4VB 4PT6A 1H9WA 1RUG3 4UBGA 4WVWA 3OUHA 4EROA 2XH6A 5CU1A 3I2GA 4DXRA 2XJQA 1L7RA 1ND3C 4CDWB 1D4M3 2JDUA 5JXJA 5FV3A 2FDJA 5FZBA 3A0KA 1C1LA 3EO6A 2HLEA 2XUEA 1PNFA 2XQXA 5FYSA 4CCOA 4FSJA 4NWWA 5A3WA 2J22A 4LBKA 3BUCA 4DB5A 4BMEA 3N7LA 2OS2A 2X5IA 3SC7X 3G7DA 1NCRA 3MPBA 1WCDJ 1NAEA 2VQ0A 3CLPA 1LULA 1H8TA 2R042 1KEXA 1Q43A 2YFZA 2R041 4DQAA 3RZLA 2A6VA 4XFHA 4BLJA 2MEV1 3M3EA 2RJ2A 2ZJCA 4QU1A 3I49A 1EPWA 3GGLA 2QQIA 1Z0HA 4Q29A 1RUC2 2Z69A 3M2MA 3GHMA 4Y1YA 1RUC1 2PHDA 5FIXA 1JYVA 1K12A 1ST8A 4NE9A 4QX8A 3VUOA 3I2IA 2ARAA 2FMDA 4MGTA 3RVHA 4CCKA 2HEWF 4WM8C 3P1IA 1SCSA 1M4WA 5FXZA 4A41A 1RUJ2 3QOPA 4Y20A 1RUJ1 3AXEA 5LATA 5T52A 4NIAA 3ZLIA 1DGRA 1IPSA 4QPIC 1LB2A 4RL7A 3M70A 3TN92 2Q8EA 3BIEA 3ETQA 3ZR5A 4LBJA 4YVSB 1CZSA 1XE0A 1W8NA 1N47A 2AEZA 1LTEA 1XNDA 1WMDA 2G9FA 3JXSA 3NJXA 4S2DA 4LKDA 4XAEA 2WZPP 3FLPA 4A3XA 4C1XA 2XJPA 1DZRA 1XNAA 2H0BA 4AWDA 3VKFC 1WCUA 3VBOC 1OF4A 1Z78A 1UU5A 1RJ7A 5LEKA 4L9BA 3N9NA 1SBFA 2MNGA 4H2AA 5C3QA 2A6YA 2WC2A 1ZRCA 2V4AA 3ZSMA 5C9AA 2HBUA 2W2IA 2W91A 1PMJX 3T2OA 2XKPA 2BU9A 3LEMA 5IATA 1PGW1 3KVBA 2WSVA 1UPIA 3KT4A 1PO11 2B5HA 3CJIB 2VMHA 5BNNB 4EN7B 3WP6A 3WEZA 2VZTA 2ZX4A 2QDNA 4JKLA 4MHRA 4ASKA 4JV4A 4HT1T 2C1FA 3U78A 5FZOA 4CPBD 3LOBA 1UQXA 3WUCA 2JKBA 2BDRA 1I5ZA 2WFF2 1D0HA 1IPJA 4URTA 5TSWA 4CUBA 1X9TA 4YZ1A 3HNBM 5F32A 1C4RA 4JTOA 4C8DA 3B9IA 3T2TA 1QOOA 5F7UA 1W0NA 3ILNA 1VRBA 4BPZA 3N7MA 4AQTA 5C9AB 4MG2A 2KD7A 1IG0A 3C7OA 1ZRFA 2VNOA 3KV5A 1RB8G 4YYOA 3VD4A 3GZTB 2HWD3 2PYTA 1H1MA 1J3QA 1LHVA 2JG9C 2AUYA 2IXJA 4KGQA 4AZZA 3WUDA 4DUWA 3AKRA 5JZGA 2WQ8A 1D0GA 1W9YA 5KXCA 1AL23 4MLOA 4NIIA 1GZTA 1Q8OA 3U37A 2A5ZA 3WSOA 4NO4A 4FPFA 2XONA 1H2LA 5FCCA 5C71A 1SPPA 5C3PA 2WT0A 1QEXA 2G4IA 2TEPA 3IDBB 1VBA2 4E2GA 3EBRA 1VBA1 4FPJA 5CEHA 2Z42A 3BCWA 4XETA 4YVWB 3K75B 4KG0A 5FREA 4XAAA 3ZFFB 3CF6E 4LBNA 4FPEA 4DO0A 3U14A 3FBYA 1W2AX 2Y6HA 3Q8FA 5L7OC 3U11A 2ZACA 4B29A 1WMXA 4AFAA 1K5MB 3N9LA 1UZWA 1YNAA 2QTWB 5FYCA 2PAKA 1WLCA 3DXUA 2P34A 3HVDA 1OMIA 1Q3EA 5FYVA 3LDBA 4YM3A 5L19A 5J1XA 1QHDA 1ZBA2 5FY0A 1ZBA1 2ZHNA 2ET1A 4XOGA 1NX9A 1DQ5A 3CQOA 4GIQA 4AGVA 4EN0A 5A6XA 2VMFA 5HI0A 1O3TA 1VRH2 2XOMA 5FWEA 1VRH1 4XJWA 2QQUA 5DUVA 5FZ7A 5EZWA 1IZ3A 5FP4A 4D94A 1UY0A 2J42A 2ZGQA 1HW5A 2E7TA 4N43C 2VVDA 5A3MA 5EIYB 4CDXA 5G05L 1EAH3 4XJAA 4IV3A 4AYUA 2QDRA 2R32A 3DYMA 2ILMA 4WVVA 4U36A 3H42B 4I2OA 1DBNA 3FZ3A 5C33A 2HWC2 4LK6A 2HWC1 2E53A 5ANNA 5EQUA 4AE2A 4QDQA 2N7GA 4Q4V1 2H6BA 4Q4Y2 3VBUB 4Q4Y1 4QQHA 2GP5A 4QM8A 1X82A 2VH9A 1BMV2 2W1WA 2EXIA 5FRAA 2I2SA 3GF6A 1F8VA 1FOD1 4FP2A 2JDKA 1QKQA 1SZBA 3WDTA 1U5IA 3OG2A 3LSDA 1WW6A 1GQPA 5GLVA 3T2PA 1YQCA 1HN0A 1G6NA 2PHLA 1QXJA 1UMHA 2I74A 4KI5M 2IC1A 4ISQA 1DDLA 1APNA 4GJYA 1QJZA 1MZ5A 4QKBA 1LECA 4OUEA 4META 1UAIA 4YARA 1Z7S2 1C5HA 2JIJA 5FY7A 3WW4A 1ZZBA 4CDUC 4W50A 2DF7A 4BWOA 4YZ5A 1BVP1 2WT2A 3U1XA 1GU3A 2AENA 2ZHKA 3AB0A 2NN8A 2OYZA 4I0WB 4PIXA 3SQOA 4AEJA 1QH7A 2BQPA 3AXDA 4BISA 4XJ9A 5T5JA 4D7SA 4GWNA 2JB4A 2Y38A 1GANA 1XE8A 3OD4A 1EV12 2GDFA 1F9KA 1CAUA 2Y0OA 1EV11 4D0QA 5T55A 1W9SA 1Q5OA 2GC3A 4P9GA 1LR5A 3POSA 4CXXA 3MI8A 1HQNA 2YBKA 1LRHA 2NMNA 3OYWB 1BBT1 3LD8A 5ERLA 5IJRA 4BXSV 1UYXA 2WNUB 1W99A 1ZRDA 5F2SA 2ZX2A 3POYA 1TME2 2OQ6A 1R082 3JU9A 1TME1 4GA9A 3WCRA 3WG1A 4AFCA 4CDQA 4QX1A 3RMYA 5B4NA 3TNQA 3H8OA 3ZXJA 3ZN5A 1QJY2 3RSJA 1QJY1 3BTAA 3JBG2 4XCBA 3WW1A 2OX0A 4AVBA 1PM7A 3JBG1 4BQ2A 1WW5A 1WCSA 5DUWA 2JENA 5FXXA 5FXWA 1XNCA 1RUF2 4P9WA 2RS33 1RUF1 5KHHA 4QGNA 1Q56A 1KD7A 2D93A 1WKYA 3LPGA 4WBBA 4IV1C 1W8FA 3H3UA 2WL1A 4CCNA 4GWJA 5CIRA 1O3QA 1RUNA 1FAYA 2VZVA 3PUQA 2VZRA 1GYKA 1WGPA 3FHQA 4BA6A 4IE0A 2VZ1A 2WAAA 4FI9A 1V6NA 2FHRA 2VOWA 4C1WA 3K77A 5D8AC 3K51A 2IXCA 3QD6A 3AVRA 3T4HB 2ES3A 1A8MA 4ZXEA 4EZHA 5CFCA 1HQLA 4CRQA 1BEV3 1HXS3 2VW1A 3USSA 1VBE1 1UYYA 3C7EA 3NAPA 2HYXA 4JKKA 3ZXFA 1S4CA 4URAA 4P9YA 3OUIA 5SV8A 1X9PA 1H9PA 4RR3C 2VVFA 1KJLA 1OD3A 3J7HA 4UFLA 1MS3A 1UX7A 1XB9A 1LOFC 2UWAA 3SEEA 3ZKUA 3MLLA 2BPA2 1GNHA 1CAXA 4QX7A 1AR63 1QJU3 3E1F1 3POBA 4LR4A 2HWF3 2RJLA 5F3EA 2HWE3 1UMIA 4YGCA 2YROA 1RUG1 4DY3A 2DU0A 2WSUA 3GCXA 1VBC2 3D0SA 1YFXA 3SXWA 1ODMA 5IYYA 1D4M2 1W8ZA 2IUWA 2PMWB 1D4M1 1CAWA 2RS13 2XBO2 2DFCA 4L97A 4MGKE 2VMDA 2R6QA 2VMIA 3M4FA 3N3HA 3AL6A 3O7OA 3C8XA 5FMCA 1J3PA 1ZA4A 1W6PB 2VR4A 2PLV3 1TE1B 4CXWA 1ACCA 1JUIA 3IMNA 4Q27A 1GNYA 3LIHA 1SLLA 3OOXA 1KITA 4XC9A 5A3UA 3T0BA 4JDMA 1W8UA 3MV11 5FYUA 2YG0A 4IEVA 4BLIA 2WN2A 4WVMB 5F5IA 4LA2A 2GNMA 2EF6A 1SDDB 3T2QA 2TUNA 4CDWC 5LY2A 3GZAA 5JVVA 1N3QA 2VW0A 1HDKA 1RHI3 4K7JA 3W5NA 2JWPA 2RHPA 3KB5A 4XXAA 4A42A 5JLVA 3CHXA 1HRV3 1C8M3 4P08A 1UL9A 1I9RA 4MSVA 4EN6B 5LA1A 1SLCA 2JDYA 4MYEA 1DLCA 4QU2A 4QXBA 3OJBA 2XR4A 2TNFA 1BYHA 2P3JA 3BKZA 3VDDA 3FLRA 3ZYRA 4WVZA 3H3ZA 3VLBB 3WDWA 2RV9A 4OI0A 2Q30A 2LRPA 3B9CA 4ZU7A 3J7NA 1HV0A 1JZ8A 2MPFA 2YGMA 4QPIB 5FLJA 3H8UA 2R0FA 2Q4SA 1ND2A 1HLCA 3FFZA 4PDWA 4OI1A 2ZGOA 4GQ7A 1MS9A 2IVIB 5EP9A 1G9AA 3O1TA 2DU1A 2KR2A 1LOEA 1AXZA 1H1AA 2D5HA 3IPVA 4XUNA 1OLMA 3KQRA 3VKMA 3VKNA 1ODNA 1WD3A 1UZ0A 4XMIA 2CV6A 4ES9A 3TBDA 4AVSA 1LGCA 1BXHA 5E16A 4KQ7A 1AX2A 4AHZA 4RGAA 1VMHA 4UF0B 2VQTA 4A6SA 2ZCWA 2VXJA 3RDIA 3I8TA 4KH9A 4BK4A 4YVSC 2CGOA 3B5LB 4AI9A 3GNEA 1Y4WA 3LEIA 4GXLA 5L73A 3VZKA 4DMIA 1H8TC 2BWCA 3W58A 1YJKA 5LBFA 2V5YA 1GICA 1CGPA 1SDWA 1H6YA 3JD73 4PDWB 2XPJA 1ND2B 1POV3 2ZKNA 1GQGA 4K6BA 3I2OA 1IKQA 1ASJ3 2D6OX 5C70A 5FYMA 3VBSB 1KRIA 1ENQA 4BIFA 2R30A 1REFA 1QF3A 2OA2A 2YC0A 3HQRA 4JGYB 4LHSA 3RMXA 2ADDA 3ROUA 4MZUA 5IHRA 4W8JA 3CJIC 3H50A 4XDOA 4Q5OA 5DAPA 3RRDA 3BTYA 4QKNA 4B7KA 5L36A 2HWD1 3ME2A 4HK8A 4K8FA 3HNYM 4MUVA 4XURA 4D7YA 3P3NA 1AL22 2F6BA 1AL21 1YCIA 2JG9B 2C0ZA 4DS0A 1K3IA 4IGPA 4H14A 2D6MA 1YJLA 4GWIA 4CUCA 1ZZ6A 5JXHA 4IE6A 5F3CA 1UY1A 2A6WA 4X6RB 2EALA 5KHGA 4KNCA 4CCDA 4L8QA 5C9AC 5E8AA 1WUVA 1CPNA 5DAVA 5LK5A 1UF2C 2XVKA 2F17A 4IEXA 1S2KA 5FZFA 2JDHA 1QQP1 3PUIA 5FZMA 2IWGB 2JEMA 2IXKA 2PQQA 2X29A 3LCPA 3PMEA 4QHBA 5L7OB 4I0BA 2V5DA 5FYBA 1IKPA 3NL1A 3NV3A 1LOBA 5A7NA 1W2NA 1YLLA 4GKXA 1UOFA 2DVFA 4E27A 4E4HA 1VAKA 4JKMA 1ZRRA 4LKFA 5JOWA 3IAQA 1WA6X 2ORZA 1AUYA 3PJQA 1C1FA 3ZFFC 5EPAA 3WQ0A 5AFEA 3UESA 1YC61 5F5AA 2HH9A 1R091 1S0FA 1U5ZA 5CZKA 5FBJA 1HB4A 1K5MC 3E5XA 3C7HA 3OF1A 4P02B 1CN1A 1FMD3 1UZVA 3LB9A 3ZSJA 5JZGC 4P9IA 1HX6A 4QQOA 3GALA 1ONAA 3I2FA 4N8MA 5FY9A 4JRLA 5AC93 1EAH1 5JXIA 4HBNA 2GU9A 5T5LA 2DCTA 2Y8KA 5FLHA 3LSEA 3R4SA 1BZWA 1HB3A 3ZIWA 4V1PA 3KHCA 3A7QA 2YFUA 3NV2A 2BZDA 2DUOA 5FZ4A 5H9RA 2R063 2FCVA 5J48A 3WNNA 1JZ6A 2WNVA 3VD3A 3VBRA 5KHKA 2GH2A 3O1MA 3DL3A 3NV1A 5EYYA 4NVPA 1CR7A 5BPXA 4FT8A 1JOPA 2XWJB 4H3WA 5A3PA 3AYDA 3T4VA 1F4HA 1W8TA 4M4PA 5CFDA 2OT7A 2WT1A 5LW9A 4OHXA 4ZPIA 2BERA 4AI8A 1WCQA 4LO7A 4RQPA 3ETPA 5L9BA 4Y5SA 4SLIA 3RWKX 5JAXA 1W6OB 3I2HA 4A6OA 4D69A 2UY9A 1JZ7A 3NQHA 5D1IA 3VBUC 4QXCA 4PLOA 5LA0A 1D2QA 1SFPA 1UY2A 3VDCA 3LDKA 3OGRA 3BPZA 3ECQA 3DKQA 2ZGUA 4QGLA 5FMOS 4V2WA 4MHUA 1XNBA 4AQ6A 1KGYA 3H9AA 4XFCA 4HPKA 4IV3C 4CDUB 5EHDA 1TMF3 1KFXL 3MF9A 3AX4A 2QQPA 2CNAA 3POGA 1IS4A 2WO3A 4MH0E 3BU7A 1ZRIA 2DYCA 2W92A 5GALA 4AVTA 1JYNA 3VDBA 3N7KA 3EHKA 3WVJA 2R16A 2QFEA 3MIGA 1HB2A 2VZPA 4XIOA 3N7JA 3SITA 4COVA 3AP5A 5C4WA 1JW6A 2AACA 3R4DB 1N1VA 5A80A 1AYM3 1XQNA 3MF6A 3ZMOA 2B8MA 4BIOA 3OD0A 1RYYA 1DGLA 3CJXA 2ORXA 4KWKA 3L9JT 3I4IA 4YW2A 1W05A 2BFUS 1VPHA 2BV4A 2JKXA 5DABA 3D5OA 3POJA 1LCLA 2RS32 4XTPA 2OUHA 3DUIA 4J25A 1F31A 3FC0A 2WNUC 4XFGA 4HG6B 5J36A 3ATGA 5FLIA 4FTSA 2VTXJ 5BUVA 1IG3A 4TLFA 1WW4A 5C5UA 1JYTA 4XF3A 2ARXA 5LBBA 4IE5A 1QOTA 2GALA 1OQDA 2ZGKA 3BN6A 2PHTA 3ZSLA 2QE3A 2QJVA 4IV1B 4CU9A 1R083 2GN3A 2PHFA 4UFKA 5I0TA 1W0OA 5FMDA 2A6XA 5HXVA 1OH4A 3HJRA 5JOZA 2IXHA 1NCQA 2UU8A 2Z2SB 1JI6A 3HN3A 4HKLA 3OTFA 3C7FA 1BEV1 1HRI3 1HXS2 4UYBA 4XZPA 3AP6A 1H2KA 4W4ZA 4BE3A 4C0BA 3VHPA 1I1EA 1POV0 2VZ3A 2WA3A 3EB7A 4JTNA 3VBHB 1D2SA 1ZX5A 1XE7A 3BODA 3S7EA 2I07B 4CYDA 4LNVA 3N9PA 1RUE3 4CDQC 1S0EA 2CSGA 1G7YA 4I3GA 2EXJA 4P9XA 3TOJA 2P3YA 4LA3A 2D6LX 1QJU2 5CYYA 2ET7A 4XUOA 1AR61 1QJU1 1NZCA 1VMJA 5T3NA 2HWF2 1AR93 3WNOA 1U5XA 2HWF1 1DYPA 1YHFA 2HWE1 4EWEA 1E5RA 2IXLA 2FDHA 1S0CA 1NCQB 3GM8A 3EQEA 4LPLA 2XXZA 5CBLA 3ZFEB 5FYZA 3OY8B 1LHWA 1AHSA 4AEDA 4XILA 3AKPA 1C3HA 1UIKA 2RS12 2D6PA 3IB3A 3RJRA 4HN1A 2ADEA 2IVJA 4CCMA 3C3VA 5FP9A 5GZEA 4F8AA 1AYN1 5IAVA 5IT6A 2R49A 4XFBA 1JHNA 2PLV2 3ZXAC 4B4PA 2PLV1 3EMRA 4Q1PA 3V0AB 4TXWA 2VGDA 2NMOA 2BGOA 2JG8B 4LKSA 1S2EA 1HB1A 3LA3A 1NLRA 3NNMA 4DRRA 3WXPA 2FDFA 4UBHA 4XF0A 2A1XA 2GMMA 3MIBA 3Q8EA 4LUMA 1S2BA 3FMGA 2FDKA 2BBVA 4IW3A 4CEWA 1WBFA 1XYNA 3T0AA 3WDUA 5JUVA 4LBLA 3I3BA 1COV2 3NAPC 5FO8B 1LNSA 1RHI2 4NMIA 3BTZA 1RHI1 4WM7A 5EJ3A 3USUB 1VBC3 1OXCA 1HRV2 3DPRA 4HVRA 5FZIA 1OPOA 1HRV1 3E6CC 1C8M2 2O8OA 2XBO3 1FNYA 1C8M1 3VN4A 3UL2A 4CP9A 4G4FA 1UIJA 4CU7A 3ILRA 3WHUA 2G19A 1O91A 2ZGNA 1DQ4A 4PLMA 3H1MA 3V56A 2EA7A 1REEA 1J3RA 4B3NA 3S7IA 4M3CB 4M3CF 3IDAA 5FQ0B 4CCEA 4I30A 3U4SA 1O3RA 4QPWA 4GH4B 4IERA 4CCCA 4ORFA 3H7JA 2YBPA 2JD4A 1UO9A 3IZOA 3GCWA 3PU8A 5LRRA 4ZZ5A 1RUH2 3HWJA 4M0NA 1VBD3 3N36A 4CEWB 3LEKA 3I3DA 4YG0A 1UOBA 3B3QE 3H1WA 3ACFA 4OMDA 1FYUA 3ORJA 5FBZA 1G8WA 3BTXA 2VMCA 3NSTA 4COUA 5BNPA 2DCZA 1QJEA 2HKXA 2ZAAA 2VUDA 3BGAA 3POEA 3S6PA 4AXOA 4DNYA 2W94A 3CNAA 4ASLA 5DXDA 4L99A 4YM1A 3LEGA 3PIGA 5E88A 4RN5A 4TWTA 5F9TA 1AX0A 2QZ2A 2X5IB 4QT6A 3TN91 5FOBB 1NCRB 2BJSA 5FJKA 4CXYA 4TLGA 2XJRA 3INAA 3JD72 3B01A 1PX4A 3JD71 3SH5A 1GLHA 1H8TB 2XJVA 2VUJA 4LMFA 2W39A 1ASJ2 1W3VA 3LA2A 1ASJ1 1YQ6A 2ID4A 1RUI3 3OPTA 2EIBA 1W28A 2VNRA 1A3KA 3S57A 2DTYA 5HCHA 1SCRA 2C5DA 2Q1FA 3LAGA 4A7YA 2QCSB 5BNPB 5LK7B 4HETA 2ZEXA 2ZEWA 1PNGA 2QBXA 2AH2A 2XJTA 1BK1A 3NJYA 4H55A 4XPVA 3RZMA 4YG3A 4JDOA 5CVRA 4Y20B 1CZTA 4CPBA 4JHTA 4PDWC 1ND2C 2BRTA 2YPJA 4Q4X3 3S0MA 2AR6A 4AQSA 1OLRA 1SLTA 1Q8SA 1W06A 5DPNA 2VOXA 4OMCA 1W9TA 1ZREA 2B42B 1MS1A 3M3QA 3V65A 2EICA 3VBSC 5FOJB 1A6CA 1XSQA 4X6QB 2YDEA 2WFF1 4OLLA 1ZM1A 4CUAA 1GOFA 3GHNA 4JGYC 3UGHA 5KXEA 1RINA 3NO8A 5FZ9A 5SV5A 2PTMA 3H8RA 4H7LA 4RYDA 5ANQA 4CP1A 2ATFA 1KDKA 3JQWA 4U2AA 3TAYA 3U75A 1MS8A 1EUUA 3PUHA 4Y5TA 3M1HA 1O5LA 3KT1A 2YU1A 4LO4B 4PIZA 4QXHA 2K46A 4YW3A 2DBIA 2J7MA 5ABJA 1POQA 2BWAA 3TEZA 1O8PA 2X05A 4PBOA 1GOGA 5FZOB 3PNAA 4JHZA 4ZU5A 4A45A 4AI2A 1KS4A 1F2NA 4E4ZA 2CGPA 3ZYGA 5DDJ3 4N53A 3FUQA 3HT1A 2PA7A 1V6KA 4CSWA 2OPKA 2ZGMA 4M4RA 4O9EA 5J96B 2Q8OA 5FZEA 3LGRA 4LKEA 3B93A 3E6BA 3MYXA 4LIVA 4OI2A 2C9KA 1FMD2 1OUXA 2ZTNA 4EV0A 3TRSB 4HVOA 4IUGA 5A3OA 5AC92 2LTNA 1HQWA 3AYAA 5EJ1B 5JZGB 4TYSA 4NHMA 1NY72 2VW2A 1ULPA 2R062 5FP3A 1OBNA 1R1A2 2R061 4MGYE 4Y26A 1SPPB 3WV6A 3MBWA 3ZYPA 4CEYA 2DCJA 4OUSA 2CGNA 2VBBA 4BHPA 2AC1A 3CEWA 5DAXA 1FT9A 4QB1A 2CDPA 1QY4A 3AJYA 1MVQA 2C26A 3UJQA 2NP0A 4LEJA 3T1MA 2HWB3 3W9AA 1G9FA 3PVBB 1OPMA 1VBB3 2W68A 4YGEA 4FPKA 2C4XA 3IKWA 3VHOA 1RUOA 2XLAA 5JDBA 2WRAA 4ITCA 1E5SA 1WZXA 2GZWA 3B00A 3URFA 5LCWL 3KD4A 2Q1ZB 3K4ZA 5DZGA 3DYPA 4TTGA 4XF1A 4JX0A 4CEYB 2B46X 3J26N 4IEYA 2P6HA 4X8PA 4I09A 5CFDB 1WW7A 3CBNA 4IEPA 4YNIA 5JPNB 2VECA 2ETEA 4JZRA 2E51A 2EXKA 1I5PA 1PGL2 2EAKA 2SBAA 4ISRA 5DQ0A 4FP3A 5LBEA 1G86A 1TMF2 5CKNA 2KA3A 1LHUA 1TMF1 3A21A 3AP4A 2F4PA 2PHUA 2EIEA 4N90A 4NROA 4Y4YA 4BYYA 3RWNA 4CDXB 1BMV1 4Y1UA 2DCYA 4IV3B 4XUTA 3MUY1 4YZ3A 4Q4W3 1QDCA 4P9JA 3HQXA 4PF1A 2GN7A 1PO23 2VC9A 4BQ4A 1Z7S1 2DBNA 2EIDA 3AMQA 4MADA 1NA1A 2W08A 2XHNA 4P5HA 2YY1A 3VB9A 3H7YA 1D7PM 1V6JA 1GMMA 5F39A 1AYM2 4YW4A 1AYM1 1C8NA 5A6ZA 3I3MA 3A0NA 1WCKA 1SLBA 4AQ2A 4AW7A 1FPN3 1PK6A 2BOIA 2EIGA 4MGIE 1GP4A 3AYCA 5JIAA 3ZR6A 2AYHA 3LKJA 4I01A 4OCTA 4BCUA 2WS93 2W1UA 2B9UA 2ZGSA 4GMP0 3AMHA 4HANA 4KWJA 4K8RB 4LHLA 5GZCA 5K9YA 2BP6A 5DUUA 4LO5B 3MW4A 3LDRA 3VBFA 3GZUC 1QDOA 2JE9A 2PXJA 4JGZA 2UWCA 4ZONA 2VOVA 4XQWA 1W2UA 1RXGA 1TQ5A 3ZVXA 3BB6A 4AVCA 3WT3A 1WA4A 2W87A 3MIHA 3F2ZA 3AMMA 1S0GA 4QD2A 5D21A 1R081 3LWCA 3I59A 5T54A 3N9OA 3MW2A 3KF3A 4LQRA 4UW5A 3WDYA 5EFUA 3WD5A 2GNBA 1OOPA 5A7OA 5CG8A 4AI3A 1MZ6A 3HPNA 1HRI2 1HRI1 3S5AA 3PDQA 1CAUB 3T0DA 1GWKA 4XF4A 2VCBA 2WZR2 5FPBA 5C4WC 3KCXA 2V72A 3UGGA 1PMIA 4SBVA 2B39A 4FXGB 3T09A 5BYNA 1R1ZA 3ZDVA 4ZY9A 1UX6A 1GKBA 1F15A 3RQ0A 4RA0A 1RUE2 1YXWA 3BOWA 3CDZB 3GJAA 1RUE1 2W52A 3N35A 4XE9A 4UFMA 4XYXA 4Z2AA 2YZ4A 4M0HA 4PBPA 1KJRA 5IVBA 4OHYA 4XEZA 3NRUA 4LBOA 4CDQB 4Y4RA 1AR92 2XKOA 3LPFA 3MIFA 4OYUA 1AR91 1NKGA 1S1AA 1Y9MA 2VG9A 4RGKA 4YM0A 5IVJA 5FFOC 4RS5A 3SHRA 4FOWA 3U0ZA 1L3JA 3RNSA 3ZFGA 1DGRN 3PURA 2JE8A 5D2AA 1UD1A 4OHZA 4R9AA 3VBHC 3QACA 3OB8A 3DN7A 3MLKA 4NUBA 3VZOA 5BXXA 4EWDA 2Y33A 4IEZA 3UK9A 1ZYBA 1ULOA 4IE4A 1OVPA 5F6KA 3N9QA 1RUD3 1QH6A 4KBBA 1UKGA 5C3RA 5FO9B 5A7PA 1LENA 1NCQC 5JI9A 2VQUA 2ZEZA 4CCJA 3ZFEC 5KXBA 3ZYHA 4RS5B 2CTVA 1H4GA 4IEQA 2FZ1A 4LO6B 4NHKA 5FJHA 1W2TA 3TYJA 4JDNA 5CFCB 3RZJA 1VBC1 3OEAA 1DF0A 1GZWA 1YO8A 3GBWA 3FN9A 1X33A 3WINE 3NAPB 1ZVFA 2OW4A 2XBO1 4Q0UA 1ND3A 4B1LA 4BK5A 4CP0A 5KC6A 3JB4C 2D3PA 3SEPA 2JG8C 3APBA 2ERFA 2NPIA 4Y22A 5IWFA 4KG8A 3KZ4C 1PVXA 3PVOA 1KDMA 1XNTA 1XBFA 1W04A 3GBGA 1CAXB 2A73B 2R1DA 1OLQA 3AMNA 1VBD2 2LS6A 4QB6A 3MLJA 4HKOA 1VBD1 5JSRA 1GOHA 1MEC3 3SKJE 1ENSA 4UWDA 4XHXA 4Y1XA 1OA2A 1W39A 3LA7A 1COV3 3I2JA 4BQ1A 2NZ9A 1G9DA 4RFRB 3VD5A 3SISA 3MW3A 1GZWB 1CAWB 4ARYA 1U5YA 1KS5A 3O14A 5LA9A 2UYAA 1IOAA 4NN0A 1VALA 4W65A 2VY0A 5FPVA 4AHXA 1E57A 4BQXA 4Y24A 1PX3A 4WM8A 1SMVA 1DYKA 2UYBA 3PVEA 2WQZC 4GH4C 1EP0A 1UN1A 5FPLA 3D82A 4J1WA 3WNXA 1AJOA 1JBCA 3KQ4B 3KV9A 1H2MA 1QMJA 1OA3A 1FV2A 1N1YA 2RE9A 3A22A 3KCYA 4XBNA 4BOWA 1J84A 2QQNA 1UCXA 2V73A 3MV01 4WM7C 3IDEA 2E32A 3R6SA 1QU0A 2WWJA 2PQSA 5JMOA 1RUH3 2R073 3DPRC 3T30A 2WN3A 1RUI2 3UKNA 1YUDA 4FPYA 1RUI1 2ZXQA 2GNDA 1I6XA 1ULDA 5C7GA 1NQJA 1JN2P 3AC0A 4MOAA 2C6SA 3CU7A 3VBOA 4RGGA 3O12A 4TN7A 2E7QA 1W6MA 1G9CA 3S30A 2WQ4A 2DVBA 2X5IC 1A8DA 4MVTA 2VCCA 1NCRC 4NRQA 3VDDB 4LBMA 3ZO0B 3HBKA 4UXAA 1G9BA 5A32A 3FX3A 4E2QA 4EQVA 4Q4X2 3FHIB 3P6BA 4UI9L 2B7YA 2JIGA 2VULA 4Q4X1 5CA6A 2ZMLA 3OGSA 4F83A 3WLUA 3IBMA 5A7WA 5FMBA 4DOUA 2JJ6A 3HN1A 2WDBA 2BUKA 1V6MA 4HK9A 4N9IA 5BNPC 3AZXA 1MS4A 1SLAA 5KXDA 3RGBA 3ZSEA 3IPVB 1UPSA 2D44A 3D4KA 1WWYA 4QX2A 5FYIA 2E6VA 4M00A 3RI8A 4Q0PA 5ACA3 5CG9A 1V6OA 3AVSA 3GXUA 4YFZA 1NLSA 2BNNA 2XVLA 3SMHA 2WWSA 3OGJA 1IHMA 4B7EA 1B09A 4AEMA 2E26A 2NM1A 3K3OA 1DLLA 2RDNA 4QKFA 3THCA 3ASIA 2IFWA 3KT7A 3MUZ1 1H1IA 4R9CA 3T3YA 4GJZA 2PHXA 3BVCA 2W47A 4PF5A 4ASMB 4XUPA 5FR3A 1LEDA 2WNEA 4V2VA 5EJZB 1US2A 2QUOA 5A1LA 2ZGTA 3BALA 5DDJ2 4OZXA 5DDJ1 2XQRA 1BKZA 5FY5A 3N4MA 3NKTA 3KV6A 4XIKA 5IUQA 3W21A 3ZN6A 2VD7A 5CNAA 4FQ4A 3ZMNA 3ZXDA 4E9KA 5DMYA 5FMOL 5F2WA 4IGQA 4M01A 5JIUA 3PL0A 1PO13 4LLOA 4DXTA 4NPRA 2I45A 3ALQA 4XDQA 3D0JA 5I93A 4BZ4A 1V00A 1W03A 4XFAA 3V0BA 1M06G 1DQ1A 3ZYIB 4ZHNA 2Z4FA 2DDUA 4OI4A 1CWPA 1OSGA 2JE7A 1YIPA 3TNPB 3A4UA 3KGZA 2G9GA 4OHWA 3WP5A 4FPCA 4UFJA 1WLTA 5AVAA 3ZN6B 4ZKTB 2XJUA 5A33A 2A3YA 2WR9A 2HWB2 1UKRA 5IVYA 2HWB1 4D3WA 1TNRA 1VBB2 3TEXA 3I3EA 2VZQA 4W6XA 4FBFA 2AZ5A 1A78A 4N43A 2X53S 1MPXA 2HJIA 2VM9A 4JQRA 4EZ4A 2CWSA 3NKGA 1N1SA 1O4ZA 1O4YA 1WMFA 4TSVA 1JH5A 1LESA 4N53C 1XOYA 1R1A3 2JICA 5LBCA 5IFTA 3KS7A 2BGCA 2VZUA 1BQPA 4HOOA 4R8HA 4AL9A 3KV4A 2O0OA 1VAVA 5FKBA 4YW6A 1AR82 2GAUA 2CWMA 5JWPA 1JYWA 3WP3A 4CZSA 5JCTA 4K9SA 2QQLA 3P5BA 2D3SA 4A44A 3RZGA 5LA2A 4BQ3A 4D6SA 1SFYA 4FOYA 4YFWA 3UKTA 4A7KA 2CDOA 4MGZE 4Q4W2 2CAVA 3CKHA 4FPGA 1V0AA 4Q4W1 4CEYC 4PJYA 5EV7A 1PO22 4WZFA 2WZ8A 1PO21 1SACA 2ZGLA 3O0WA 1T6GC 2WO1A 3Q8BA 1W90A 3U07A 1OQEA 4BMBA 2WNVB 2Q1MA 3VBRB 4IGOA 3SH4A 4XMAA 3ZYBA 4QPYA 2ZMKA 4ZS2A 5F1RA 3O0XA 1GSLA 2BNOA 1RTVA 2JECA 3MFCA 5K0UA 3LF7A 3WF3A 4CDXC 4J1XA 2VMGA 2ZHMA 2B4KA 1FPN2 1YIFA 3QH7A 4NPLA 1FPN1 4LJHA 1PIV2 4Q0SA 4X8NA 2WBKA 4RQPB 1CAVA 2GSYA 2WS92 1FNZA 5E89A 4ET7A 1OFNA 4FOVA 4MXWA 5F8PA 5H9PA 5FUIA 1IPKA 1ENRA 1UXZA 4QDRA 3JCIA 3MEPA 5FYTA 3IDCB 3ZXGA 5BNOA 5IK8A 2WYFA 1SFNA 3QH6A 1SBDA 1NT0A 1MR5A 4MV2A 4S2GA 1JU4A 4HL0A 1FX5A 1JYIA 1JZ3A 4K1ZA 4E4SA 4XJ8A 4HPKB 5A6QA 1J1TA 2EXHA 1VLNA 2H6CA 3GJBA 2GMPA 1HJGA 4PIYA 3ST7A 1LKNA 3AMPA 1ZZ9A 1CX1A 3E5QA 4O61A 2E31A 2C9AA 1YI9A 3K48A 4LK7A 3VZNA 1ZBE3 2RS31 3VKOA 4HSLA 2JD9A 1DQ2A 4XJUA 2AEYA 5I91A 3AFKA 3OPWA 1LOCA 2JDMA 1CX4A 1NG0A 2YPDA 3AZWA 4CUGA 5C4WB 2CL2A 4JC1A 4MXVA 1F4AA 5K8SA 3NMBA 5LB6A 1RL3A 5F3GA 5T5PA 1VB2A 3BPSA 3D8CA 4XXPA 1Q8QA 4QKDA 3TEWA 2ZKLA 4C0HA 2B9VA 1H8VA 1V9U3 2BTVC 2XMLA 4LOSA 1PVC3 2R7EB 5D8AA 1W0PA 3RYRA 2PHRA 1BLZA 3DF0A 2ZS6B 2Y60A 3MFAA 3EYPA 4FCAA 4NIGA 1GR3A 2Y6GA 1HXS1 2OIIA 3HOBA 4P9LA 4JGZC 1N3PA 2IFRA 2DFBA 2WZR3 4Z82A 4DEQA 5HXMA 5IVCA 5FZKA 1W6NA 2XJSA 1CD3G 3JZVA 4UOJA 3WW3A 4QHZA 4RR3A 1RUD2 1HN1A 2HBTA 1RUD1 3M7AA 4FFIA 4K40A 3RFRA 1YYNA 1LOFA 1DGWX 2ZHLA 3BYWA 3R4UA 1FXZA 4BJ0A 1OA4A 1NQDA 3J4UH 4BQ5A 3A23A 4NAMA 4XFFA 4S2FA 2P6CA 2VTFA 2WIIB 3PUSA 4N9HA 4CP2A 1DQ6A 1W6QA 1C5IA 4DPNA 4A2UA 2X8KA 2IZWA 4P5YA 3C2UA 2YXSA 4ES8A 1O6UA 2RS11 5FXVA 1YWKA 2P3KA 1ZA7A 2XGXA 2AGSA 4LBQA 4CA9A 3K3NA 4PHZA 3AP9A 4QAWA 1QNYA 1XYPA 1LGBA 2ZBJA 1H4HA 1DHKB 2ZGRA 2FCUA 2BNMA 3HD8B 3SLIA 3AZYA 1BVVA 1TNFA 4AVVA 4RS5C 5HV4A 3IN9A 5CKMA 4LIUA 1O8SA 2VJXA 4YW5A 2Y26A 5CFCC 1H30A 1BK0A 1MEC2 5IVVA 1XC6A 1AXKA 1H6XA 4W6WA 1PZ8A 1COV1 4CDWA 1JYXA 2A6ZA 4QQLA 2RR13 3DECA 4AEDB 5M0TA 3B7MA 2VNVA 4O65A 3THDA 4B4RA 3IM0A 4FPOB 1QXRA 5KR7A 4AAXA 3NJVA 4LBQB 1AR62 1LAJA 4Q2FA 1WLDA 4XHBA 3O1RA 1RITA 2ZA9A 3RZKA 2XDVA 2WINB 1DZQA 2LROA 3FE5A 5JOYA 4E8DA 2ZABA 4COWA 2BW8A 1AJKA 2OZ6A 3K46A 4KWLA 2D97A 4GMP3 4GB33 3UYJA 3HEIA 4Y1ZA 1L7QA 4AFBA 4QXKA 1AVBA 1GZCA 5E6HA 1Y9GA 1LGNA 2VL4A 2R072 4MO3M 3VL8A 1RUH1 2R071 1ZZ8A 4FQZA 2UURA 5JPMB 4YPJA 5GZGA 2DURA 4WM7B 4AFMA 1J59A 2GC1A 1LOGA 3DPRB 4N7IA 4QX5A 2Y6FA 4OZOA 2E7AA 5H9QA 3THPA 4XJZA 1N1TA 1YEWA 4K3UA 4DEVA 4CEWC 4CP9B 3W5MA 4LXLA 5JSPA 1WBLA 4N7UA 3NNFA 5DZFA 5J09A 2EVXA 2ARCA 3IMMA 4CVUA 1OH3A 4G3YC 3HIFA 2ZX1A 2XWBB 1EUTA 1NZIA 4YVSA 2FZ2A 2LALA 1B35A 1QJX3 3O1VA 5FO7B 1YFWA 4J6GA 1UW8A 2MEV2 1POV1 1SQ4A 1VR3A 1XSRA 1UY3A 2GC2A 2WABA 4KU8A 5EXOA 2PAMA 1WLWA 1V70A 1ULFA 5HV0A 2XL7A 1LU1A 1OHFA 4HMZA 3ZKYA 3WQBA 1DFQA 3ACGA 4YGDA 5ACA2 5BV6A 5ACA1 3VDDC 3ILFA 5KHJA 4LTAA 1AX1A 3OCPA 5KBFA 4E2SA 5LY1A 5KHIA 3PHMA 4D6QA 4LULA 1JMUB 3CJIA 5BNNA 3MIDA 3DV8A 1OKOA 5KC5A 1DP0A 2BVVA 1B35B 3EJKA 3WW2A 5C3OA 5EWSA 4OQ9A 3ACIA 1UZYA 3DCQA 2FD8A 1LHNA 3KF5A 1MQTA 1URXA 3I2KA 3HAGA 1LEMA 4QPGA 4UW4A 5FPAA 5F3IA 4GAZA 1X50A 4RSUA 4AGGA 2A3XA 2GC0A 4DFSA 3OBRA 1U12A 3ON7A 1JS9A 3WF0A 5CADA 1PGW2 3W20A 3WF2A 5I8TA 1PO12 2Y34A 3PTYA 4PCRA 2W1QA 2VZOA 5A3TA 4Y33A 5GLWA 5FZAA 4INDA 3WNPA 3MDPA 5FZHA 5KWRA 5A1FA 4QMAA 1N3OA 4MX3A 5J3UA 1F5FA 3V64A 3B69A 4WZCA 1CVNA 4FO9A 1MQTB 4TZDA 5B2GB 2DUPA 3QBQA 4AHWA 4QPGB 2D43A 1JODA 4MGQA 4YVWA 4XF9A 1US3A 2BVBA 3PU3A 3OGGA 3ZFFA 1AR73 3IT8A 4EN9B 3AM2A 1PZ7A 2VXRA 1NLQA 2WFPA 3AZZA 1F5JA 1RXFA 2P3IA 5I0RA 1FMD1 4LHKA 3L2HA 5GZFA 1K5MA 2P1BA 1W8WA 4A3ZA 5AC91 5ABJB 5LWBA 1YQ5A 3VZMA 3OBAA 2DTWA 2VCMA 3LZZA 3VZLA 1NY71 2CY6A 4FFGA 1TG7A 1Y7BA 2VZSA 3GZEA 3KCCA 3X29B 1R1A1 5FZ1A 1TZOA 4HSJA 4A4AA 5BNQA 2QQVA 2Y0IA 2WWUA 3KSCA 4N53B 2RDQA 2X10A 1OI6A 3NNLA 3U4XA 1Y43B 4YM2A 3WDVA 2Z79A 5IVFA 1GV9A 2BYVE 1QQP3 4Z2WA 5DN2A 2R0HA 2O14A 2W0XA 2OZJA 3K4AA 4IXLA 1V6LA 2ZOEB 4LE4A 1JOBA 1JUHA 1RMU3 4A7ZA 5C8CA 4HONA 1CZVA 1YFUA 1YQ8A 2P37A 3WNMA 1IS3A 4XBQA 3PMSA 1A34A 2QQOA 3SNMA 1E5IA 1ALYA 5A1AA 5A7SA 1RVF3 3J9SA 5J37A 2YBSA 2RDRA 4Q0QA 3RJ2X 3VBUA 2ZGPA 5A7QA 2OPWA 1R093 4LORA 5G04L 3VGIA 2UY8A 2RMU3 4Z8BA 4L0PA 2VPVA 2OUJA 5DZEA 5K7PA 2QQKA 1YFYA 1AR83 4RD7A 4CTEA 1ULGA 3M3CA 3O1PA 2QQJA 4QQPA 2VCAA 4QHOA 3UKVA 4YG6A 2J1RA 5C8WA 4XZUG 4FAGA 1UZZA 5APAA 3AKQA 5DAQA 2RVAA 3NW4A 5I0SA 1OLME 2IXIA 1GNZA 5C8CB 5CKQA 4KU7A 4OVEA 2LW8A 2J1VA 4C90A 2VNGA 1ZZCA 2J1UA 2RJKA 2WNVC 2J1SA 2EAAA 4LHNA 4IEOA 3Q8CA 3HMYA 2ZZQA 4IE7A 4NRPA 4Q4V2 3VBRC 1JZ2A 3NJZA 1QOSA 4B4QA 1W9WA 1X36A 1VMFA 5ISLA 3MICA 5K4LA 1JYCA 2ZX0A 2O8QA 1FOD2 3RI9A 3AJZA 5CFDC 5FWJA 3WQ1A 2H0VA 3K4DA 2D6KA 2KM2A 3TEYA 4RQPC 2RS53 4BB3A 3H8XA 1VE0A 3ITQA 3G6JB 4UFHA 1LJ7A 1PIV3 3IWZA 2D40A 2X09A 3Q8AA 2WO7A 4FXKB 4KWUA 3RZZA 4ATEA 4COYA 4IL7A 3RG0A 1ZBE2 3ABZA 5FZDA 3KLSA 1PHMA 1ZBE1 5J7MA 1ZNPA 4JRAA 1C57A 1YI7A 2KXLA 3OYWA 2CAUA 3KHBA 3F95A 3ZN4A 1W9FA 2FQPA 2WNUA 1V6IA 1NA1B 1ULCA 2XHKA 3ZM8A 1WMEA 2VUAA 4D7TA 4XTMA 3DEMA 5HCAA 5K0UC 2QQWA 5DG2A 5IK7A 4COZA 5IK4A 1VIWB 4AI1A 1DGWA 4O9GA 3RPQA 4YW1A 1V9U2 1J1LA 3J8F3 3ZYJB 1V9U1 1YQ2A 2YC2A 2FCTA 4PI0A 4PI2A 4AF9A 1PVC2 5L9VA 2B45X 1PVC1 4DUVA 1PK6B 2DWRA 1UOJA 2VQAA 2JXAA 5GJ6A 2XLGA 1C28A 3POFA 1NOVA 4Q26A 3WG4A 3IIAA 1JU3A 4L2NA 2XL9A 4XQ4A 2VE1A 4NOTA 5BNOC 1OC1A 2PAEA 2WZR1 1OUSA 1BBT2 4NPMA 4FAHA 2FBEA 4YSFA 3CIHA 4F3JA 5H9SA 4R4XA 3VBFB 4OQ8A 5JOXA 4IETA 1JXNA 2WJSA 4JGZB 2J1TA 1REDA 2RDSA 1Y3TA 5FPXA 4IESA 5FY4A 3HBZA 2VMEA 5JR7B 3TWIA 2W95A 4DZGA 3POIA 2G1MA 1CESA 3AZVA 3HR9A 3I59B 1BJQA 1X8EA 2W5FA 4FPHA 4HN0A 2R1BA 2RG4A 1OURA 5JR2A 3CMGA 1GP6A 1OOPB 1JZ5A 2PFWA 3I3QA 1Y9QA 4D6RA 2VVEA 2DVDA 3NNJA 4Q8LA 4PQ9A 4R9BA 1UWWA 3ZOIA 1XJAA 2Q5TA 1UXXX 4MGSA 1XXNA 1STMA 4FTEA 1MVEA 1LODA 4HZFA 4JAAA 4IEWA 3O0VA 2D7FA 3UNPA 3JUUA 5GKAC 2DUQA 4ZZ8A 3T1LA 4RHV3 4JVAA 5T50A 5LZ6A 2LUWA 4BH9A 5FPUA 4OFGA 4NRMA 3DGTA 1OD5A 4EE2A 2HEVF 3IIIA 2YMZA 3J7LA 1L7LA 2AREA 3ZFGB 2RM23 4XACA 4YRDA 1VBE2 2RR12 4Z92B 2RR11 2GH8A 2YU2A 2C24A 3FHAA 3OGVA 3BIWE 3I2DA 3GYDA 3OBZA 3RYPA 3GDBA 3PVNA 2WO2A 4K1YA 1W6PA 1NE6A 4NHYA 5F5CA 1SLIA 3FL7A 3LE0A 4KBZA 2WLPA 1W8HA 3ELNA 4NWVA 4GB32 4GMP1 4GB31 4WVMA 1VJ2A 3WR0A 1RUG2 1MS0A 3FJSA 4UT5A 5F37A 3FBMA 2D5FA 3JQXA 5AFBA 4AEDC 1IS5A 3MIEA 1AL0G 3DYOA 1PZ9A 2PHWA 1CJPA 4XCAA 4FTBA 1UMZA 2XB6C 3ZX7A 3Q9OA 3LQCA 2JDZA 2K9ZA 3O5SA 4LLFA 3ZXEA 5LEJA 3UGFA 5JI7A 1ND3B 2W46A 1AYN3 1DU3D 3ACHA 3VKLA 1GQHA 3O1OA 1W3XA 4NIHA 1FI2A 4WV8A 2JDPA 2XLFA 3W59A 4Y22B 2W9XA 1JHJA 1PMHX 3VZJA 3OUJA 4Y3OA 1K45A 2OVUA 5JSOA 3AKSA 3PIJA 1H2NA 1QJX2 4IEUA 2HYKA 3SCGA 1J83A 1QJX1 3R05A 4QPIA 4W6YA 1GBGA 2YUEA 5E1RA 5FZ0A 4AI0A 3BU0A 1PGL1 5FY8A 1SG3A 4XQDA 2PN5A 2V4VA 4QB2A 5FYHA 4DIQA 2D3RA 4FPLA 3NWKA 5FYYA 2VAUA 3C7GA 3AP7A 1MACA 1W2OA 1IGOA 2W1SA 2A70A 5FTTC 2D6NA 3E97A 1PM4A 4QQ2A 2QNKA 4UF0A 3UETA 4DUXA 3R0RA 4NHLA 5GZDA 4GD4A 5EYXA 2W3JA 4WM8B 1SHWB 3THTA 1AXYA 3NVCA 5DUXA 1R64A 4FFFA 1FV3A 2SLIA 1XYOA 2GMEA 2QQMA 1NXD1 1NYWA 3I97A 1T2XA 3WNKA 1S0IA 2D98A 3LFIA 2R043 4UW6A 3VL9A 2MEV3 1KQRA 3SH3A 3ES4A 4NHXA 1UU6A 3VBSA 3JB8A 3CL1A 5DG1A 1CQ9A 1RUC3 2NLRA 5FPZA 2CHHA 2P2KA 5HCBA 3ACLA 4JGYA 3VBOB 4Z07A 1ENXA 5FP8A 2XG3A 4ZS3A 1PGSA 5FZGA 3WP4A 2Y6LA 1W6MB 5J98B 4AG4A 1CPMA 5A3NA 1NUKA 1RUJ3 1B35C 1UYZA 4LO8A 2L9LA 2ZEYA 1UY4A 5FAXA 5A32B 3TN93 4CU8A 4Q8KA 1SBEA 3VV1A 4QWNA 1HKDA 4XW3A 2JG9A 2VOKA 3AYEA 2A75A 4YLZA 3MGUA 5A7WB 1XRUA 4CCLA 4GZ9A 2GNTA 1TEIA 1FATA 3M3IA 4YGBA 4I0AA 1F35A 3KGLA 1EY2A 4LOTA 2YB7A 1ULEA 1S0JA 3WCSA 1H0BA 1LOAA 3WZ1A 1AR72 3SCFA 3WY6A 3J7MA 1AR71 1GWLA 1JOJA 5CISA 1GWMA 2E63A 4NR1A 5BNNC 5IK5A 1NE4A 2DV9A 2HWD2 2YYOA 3IAPA 3RYKA 3T08A 1VB4A 4B8EA 2CYFA 3I7DA 1Q8VA 2J1AA 3AL5A 3FUOA 2Y64A 3ZXLA 5L7OA 1O5UA 3ZIXA 1OF3A 2JDNA 4NJ4A 1MQTC 5GLZA 1I3HA 4KMQA 1WD4A 5L9RA 1LU2A 2VOTA 4QPGC 1QNWA 2XUMA 2WFF3 1X8MA 1O7FA 3M3OA 3CZUA 2VTXA 3ES1A 4AFDA 4M3CE 4BXFA 4H7MA 4EN8B 4DRVA 2JX9A 3M8LA 2P5BA 5FP7A 3OBTA 1AF9A 4L11A 1RJ8A 1UYPA 4AVAA 5F6LB 4HKWA 1EYBA 1QQP2 3ZPOA 1IS6A 5ABJC 4GULA 1DQ0A 3ZDSA 3B02A 3SCHA 1VBB1 1RMU2 1XU1A 2OQ7A 1K42A 1RMU1 2ENRA 3LFMA 3POWA 4RFT0 1QIQA 1DCSA 2NQYA 3V0BB 4R4ZA 4ARXA 2J1EA 1AZDA 2BFUL 4AAPA 1BHGA 3MHZA 4YVWC 4DXZA 1DIWA 1RVF2 4AEKA 1RVF1 3N9MA 1J58A 2V09A 3RZHA 4L92A 2WUHA 1OQ1A 1VBA3 2BGPA 1R092 3B94A 1QJFA 3PJYA 2VU9A 1RC6A 2RMU2 4FOQA 4HLTA 5FY1A 5HCFA 2RMU1 2WKKA 5JXGA 1LHOA 4OUMA 2Z5WA 3E5UA 3OEBA 4HXCA 1O59A 4LUKA 4B1MA 5FK8A 5A33B 3WG3A 3WHTA 1AR81 4AR2A 1VP6A 4HVQA 5I0DA 3PUAA 3MZHA 1QGLA 2P4EA 1EAH2 3DKWA 2ZMNA 4AK3A 4LE3A 1DYOA 4R52A 3VD7A 4EJRA 1DG6A 1W6OA 1GUIA 5IAXA 3PLQA 5FUPA 2YGLA 4N43B 5B4XA 2DCKA 4NIDA 1S55A 1ZBA3 3BI3A 1GP5A 3CO2A 1TVGA 3NV4A 4EWAA 2YV8A 4CU6A 3BOPA 2OXBA 5A3LA 4GKYA 1VRH3 3PTRB 4R9DA 4UW3A 3O1SA 1Q8PA 3UV9A 5C3SA 3CZJA 4XABA 3D3AA 4YZ2A 4DY5A 2ZX3A 3ZSKA 2QZ3A 3OSDA 2RS52 4CE8A 4CDUA 2K0GA 4K21A 2RS51 5C8CC 2JDAA 2FDIA 2BEOA 3WOGA 3O1UA 3WG2A 1MS5A 1PIV1
chains in the Genus database with same CATH topology
1HV1A 5FDBA 4DINB 3VHRA 3EXUA 2WS91 4KGGA 3L2YA 4GWMA 2WA4A 1OKQA 1XU2A 2HWC3 1OFSA 4Q4V3 5AVPA 2TBVA 4F7ZA 4Q4Y3 1BCXA 3KM5A 2ZPXA 5BY5A 2ARBA 1MZFA 2LM3A 3J8F2 1FOD3 3J8F1 5K0UB 4OULA 5GLTA 4E4DX 4K20A 2ZZJA 1CAVB 3AKTA 1CONA 4MXWB 1GFF2 1XNKA 1NA1C 4BM8A 1X7NA 1Z7S3 4Y5Z0 1O3SA 3AK0A 5BNOB 4LT5A 1DZTA 3GBFA 3E6DA 4IV1A 4ZXKA 3WDXA 4QGMA 1PK6C 1KFUL 1SEFA 4ATFA 4AHYA 1ZZ7A 3MPPG 1CIWA 1NXMA 2HEYF 1EV13 4I02A 1HIXA 3QCWA 3ZPYA 2E9QA 1S0DA 3WX5A 3VBFC 1MZEA 2MHFA 4ONUA 2QKDA 3VBHA 5I0UA 1O4TA 1BBT3 2A7AA 2YHJA 3QLQA 4ZU4A 5CB7A 5GM0A 5I8YA 4IQPA 4RHV2 4RHV1 1RGSA 4Q1RA 1TME3 4OHVA 1IQAA 3UJOA 1EPZA 1OOPC 2XVGA 3TB0A 1YRZA 1QJY3 3FFQA 4AGRA 3ZXKA 1QWRA 3JBG3 1KXGA 5D8AB 3ZFEA 1BEV2 2RM22 3OY8A 1S0BA 4C91A 2RM21 4QM9A 1JTZX 1CJDA 3H0OA 2Q0AA 1RUF3 3FLTA 5C6CA 3HT2A 4G9SB 5GLUA 5CAZA 1RIRA 5T5OA 1W6NB 1U0AA 1QXPA 2O1QA 4Q0VA 3RS6A 4Z1VA 2WLQA 3V0AA 4PLNA 2JG8A 4RR3B 3ENRA 4HFSA 4YZ4A 1GZ9A 2DVAA 5JMCA 3OPZA 2HWE2 3D6EA 1VAMA 3ZFGC 3VHNA 2UWBA 4FVVA 3U10A 5HBAA 4Y1VA 1W6QB 3H1YA 3I54A 2P17A 1MEC1 4I3PA 2NYYA 4P14A 3P3PA 3USUA 2ZAHA 3FWEA 3WQ7A 1VBE3 5I8SA 1UU4A 5LRSA 1AYN2 2QVSB 4KL1A 5F5QA 2FMYA 4JCKA 3AFGA 4GALA 5GLVA 4XFIA 2A71A 2A3WA 3KMHA 3LOIA 2K2SA 4LBQD 4M3CA 4S2HA 5FQ0A 2PELA 4GH4A 4XBLA 2DVGA 1D4VB 1H9WA 1RUG3 4UBGA 4WVWA 4EROA 2XH6A 5CU1A 2XJQA 1ND3C 4CDWB 1D4M3 3A0KA 1C1LA 3EO6A 1PNFA 4FSJA 4NWWA 4LBKA 4DB5A 4BMEA 3N7LA 2X5IA 3G7DA 1NCRA 3MPBA 1WCDJ 3CLPA 2VQ0A 1LULA 1H8TA 2R042 4DQAA 1Q43A 2R041 2A6VA 4XFHA 4BLJA 2MEV1 3M3EA 2ZJCA 1EPWA 1Z0HA 4Q29A 1RUC2 2Z69A 3M2MA 3GHMA 4Y1YA 1RUC1 2PHDA 3VUOA 2FMDA 2HEWF 4WM8C 1SCSA 1M4WA 1RUJ2 3QOPA 4Y20A 1RUJ1 3AXEA 5T52A 1DGRA 4QPIC 1LB2A 4RL7A 3M70A 3TN92 3ETQA 4LBJA 4YVSB 1N47A 1LTEA 1XNDA 1WMDA 2G9FA 4S2DA 2WZPP 3FLPA 4A3XA 4C1XA 2XJPA 1DZRA 2H0BA 4AWDA 3VKFC 3VBOC 1Z78A 1UU5A 1RJ7A 5LEKA 4L9BA 1SBFA 2MNGA 1ZRCA 2A6YA 2WC2A 3ZSMA 5C9AA 2XKPA 1PGW1 2WSVA 1UPIA 3KT4A 1PO11 2B5HA 3CJIB 2VMHA 5BNNB 4EN7B 3WP6A 2ZX4A 2QDNA 4JV4A 4HT1T 2C1FA 3LOBA 3WUCA 2JKBA 1I5ZA 2WFF2 1D0HA 1IPJA 4URTA 5TSWA 4YZ1A 1C4RA 4JTOA 3B9IA 3T2TA 1QOOA 3ILNA 4BPZA 3N7MA 4AQTA 5C9AB 1ZRFA 2VNOA 1RB8G 4YYOA 3GZTB 2HWD3 2PYTA 1H1MA 1J3QA 1LHVA 2JG9C 2AUYA 2IXJA 4KGQA 3WUDA 3AKRA 5JZGA 1D0GA 5KXCA 1AL23 4MLOA 1Q8OA 2A5ZA 4NO4A 4FPFA 1H2LA 2WT0A 2G4IA 2TEPA 3IDBB 1VBA2 4E2GA 3EBRA 1VBA1 4FPJA 2Z42A 3BCWA 4XETA 4YVWB 4KG0A 5FREA 3ZFFB 3CF6E 4LBNA 4FPEA 3FBYA 5L7OC 3U11A 2ZACA 4B29A 4AFAA 1K5MB 1YNAA 3N4MA 2PAKA 1WLCA 2P34A 1OMIA 1Q3EA 4YM3A 5L19A 1QHDA 1ZBA2 1ZBA1 2ZHNA 2ET1A 4XOGA 4AGVA 1DQ5A 4GIQA 4EN0A 5HI0A 1O3TA 1VRH2 1VRH1 4XJWA 5DUVA 5EZWA 1IZ3A 4D94A 2ZGQA 1HW5A 2E7TA 4N43C 2VVDA 5A3MA 4CDXA 1EAH3 4XJAA 4IV3A 4AYUA 2QDRA 2R32A 2ILMA 4WVVA 4U36A 4I2OA 1DBNA 3FZ3A 5C33A 2HWC2 2HWC1 2E53A 4AE2A 2N7GA 4Q4V1 2H6BA 4Q4Y2 3VBUB 4Q4Y1 4QQHA 4QM8A 1X82A 2VH9A 5FRAA 2EXIA 2I2SA 3GF6A 1F8VA 1FOD1 4FP2A 1QKQA 3WDTA 1U5IA 3LSDA 1WW6A 2PHLA 1G6NA 1QXJA 2I74A 2IC1A 4ISQA 1DDLA 1APNA 1QJZA 1MZ5A 1LECA 4META 1UAIA 4YARA 1Z7S2 1C5HA 3WW4A 1ZZBA 4CDUC 4BWOA 2DF7A 4YZ5A 1BVP1 2WT2A 3AB0A 2AENA 2ZHKA 2OYZA 2NN8A 4I0WB 4PIXA 4AEJA 1QH7A 2BQPA 3AXDA 4XJ9A 5T5JA 4D7SA 4GWNA 2Y38A 1GANA 1XE8A 3OD4A 1EV12 2GDFA 1F9KA 1CAUA 2Y0OA 1EV11 5T55A 1Q5OA 2GC3A 4P9GA 1LR5A 3POSA 3MI8A 1HQNA 1LRHA 2NMNA 3OYWB 1BBT1 2WNUB 1ZRDA 2ZX2A 3POYA 1TME2 1R082 3JU9A 1TME1 4GA9A 3WCRA 3WG1A 4AFCA 4CDQA 3RMYA 3TNQA 3ZXJA 3ZN5A 1QJY2 3RSJA 1QJY1 3BTAA 3JBG2 3WW1A 4AVBA 1PM7A 3JBG1 1WW5A 1WCSA 5DUWA 2JENA 1XNCA 1RUF2 4P9WA 2RS33 1RUF1 5KHHA 4QGNA 1Q56A 1KD7A 2D93A 4WBBA 4IV1C 3H3UA 2WL1A 1RUNA 5CIRA 1FAYA 1GYKA 1WGPA 4BA6A 1V6NA 2FHRA 2VOWA 4C1WA 5D8AC 3K51A 2IXCA 3QD6A 2ES3A 1A8MA 5CFCA 1HQLA 4CRQA 1BEV3 1HXS3 2VW1A 3USSA 1VBE1 3NAPA 3ZXFA 4P9YA 5SV8A 1H9PA 4RR3C 2VVFA 1KJLA 1MS3A 1LOFC 2UWAA 3MLLA 2BPA2 1GNHA 1CAXA 1AR63 1QJU3 4LR4A 2HWF3 2RJLA 2HWE3 4YGCA 2YROA 1RUG1 4DY3A 2DU0A 2WSUA 1VBC2 3D0SA 1YFXA 3SXWA 1D4M2 1D4M1 1CAWA 2RS13 2XBO2 2DFCA 4L97A 4MGKE 2R6QA 2VMIA 3M4FA 3N3HA 3O7OA 1J3PA 1ZA4A 1W6PB 2PLV3 1TE1B 1JUIA 4Q27A 3IMNA 1SLLA 1KITA 4JDMA 4IEVA 4BLIA 4WVMB 4LA2A 2GNMA 2EF6A 2TUNA 4CDWC 3GZAA 5JVVA 1N3QA 2VW0A 1HDKA 1RHI3 4K7JA 4XXAA 2RHPA 3KB5A 5JLVA 1HRV3 1C8M3 1UL9A 1I9RA 4MSVA 4EN6B 1SLCA 4MYEA 4QU2A 3OJBA 2TNFA 1BYHA 2P3JA 3VDDA 3FLRA 3ZYRA 4WVZA 3H3ZA 3VLBB 3WDWA 4OI0A 2Q30A 3B9CA 4ZU7A 1HV0A 2MPFA 2YGMA 4QPIB 5FLJA 3H8UA 2R0FA 2Q4SA 1ND2A 1HLCA 3FFZA 4PDWA 4OI1A 2ZGOA 4GQ7A 1MS9A 1G9AA 2DU1A 1LOEA 1AXZA 1H1AA 2D5HA 3IPVA 3VKMA 3KQRA 3VKNA 1WD3A 4XMIA 2CV6A 4ES9A 3TBDA 4AVSA 1LGCA 1BXHA 5E16A 4KQ7A 1AX2A 4AHZA 4RGAA 2ZCWA 3RDIA 3I8TA 4KH9A 4YVSC 2CGOA 3B5LB 3GNEA 3VZKA 5L73A 4GXLA 4DMIA 1H8TC 2BWCA 3W58A 1YJKA 2V5YA 1GICA 1CGPA 1SDWA 2XPJA 3JD73 4PDWB 1ND2B 1POV3 2ZKNA 1GQGA 4K6BA 1IKQA 1ASJ3 2D6OX 3VBSB 1KRIA 1ENQA 4BIFA 2R30A 1REFA 1QF3A 2OA2A 2YC0A 4JGYB 3RMXA 3ROUA 4MZUA 3CJIC 3H50A 3RRDA 4B7KA 5L36A 2HWD1 3ME2A 4HK8A 4K8FA 4MUVA 4D7YA 3P3NA 1AL22 2F6BA 1AL21 1YCIA 2JG9B 2C0ZA 4DS0A 4H14A 2D6MA 1YJLA 1ZZ6A 2A6WA 4X6RB 2EALA 5KHGA 4KNCA 5C9AC 4L8QA 5E8AA 1WUVA 1CPNA 5LK5A 1UF2C 2XVKA 4IEXA 1S2KA 1QQP1 2IWGB 2JEMA 2IXKA 2PQQA 2X29A 3LCPA 3PMEA 4QHBA 5L7OB 4I0BA 1IKPA 3NL1A 3NV3A 1LOBA 4GKXA 1YLLA 2DVFA 4E27A 1VAKA 1ZRRA 5JOWA 3PJQA 1AUYA 1C1FA 3ZFFC 5AFEA 3WQ0A 1R091 1S0FA 1U5ZA 1K5MC 3E5XA 3OF1A 5JZGC 1CN1A 1FMD3 3LB9A 3ZSJA 4P9IA 1HX6A 4QQOA 3GALA 1ONAA 5AC93 4JRLA 1EAH1 4HBNA 2GU9A 5T5LA 2DCTA 5FLHA 3LSEA 3R4SA 1BZWA 3ZIWA 4V1PA 3NV2A 2DUOA 5H9RA 2R063 5J48A 2WNVA 3VBRA 5KHKA 2GH2A 3DL3A 3NV1A 5EYYA 4NVPA 1CR7A 5BPXA 4FT8A 2XWJB 4H3WA 3AYDA 5CFDA 2WT1A 4OHXA 4AI8A 4LO7A 4RQPA 4SLIA 5JAXA 1W6OB 4D69A 2UY9A 5D1IA 3VBUC 4PLOA 1D2QA 3BPZA 3ECQA 2ZGUA 4QGLA 5FMOS 1XNBA 4AQ6A 3H9AA 4XFCA 4HPKA 4IV3C 4CDUB 1TMF3 1KFXL 3MF9A 3AX4A 2QQPA 2CNAA 1IS4A 4MH0E 3BU7A 2DYCA 5GALA 4AVTA 3N7KA 3EHKA 3WVJA 2R16A 2QFEA 3MIGA 4XIOA 3N7JA 3SITA 4COVA 3AP5A 5C4WA 1JW6A 3R4DB 1N1VA 1AYM3 1XQNA 3MF6A 3ZMOA 2B8MA 4BIOA 3OD0A 1DGLA 3CJXA 4KWKA 3L9JT 3I4IA 4YW2A 2BFUS 3D5OA 1LCLA 2RS32 4XTPA 2OUHA 3DUIA 1F31A 3FC0A 2WNUC 4XFGA 5J36A 3ATGA 5FLIA 4FTSA 5BUVA 4TLFA 1WW4A 4XF3A 2ARXA 1QOTA 2GALA 1OQDA 2ZGKA 2PHTA 3ZSLA 2QE3A 2QJVA 4IV1B 1R083 2GN3A 2PHFA 5I0TA 1W0OA 2A6XA 5HXVA 5JOZA 2IXHA 1NCQA 2UU8A 2Z2SB 4HKLA 3OTFA 1BEV1 1HRI3 1HXS2 4XZPA 3AP6A 1H2KA 4BE3A 4C0BA 3VHPA 1I1EA 1POV0 2WA3A 4JTNA 3VBHB 1D2SA 1ZX5A 1XE7A 3BODA 3S7EA 2I07B 4CYDA 4LNVA 1RUE3 4CDQC 1S0EA 1G7YA 4I3GA 2EXJA 4P9XA 3TOJA 4LA3A 2D6LX 1QJU2 1AR62 2ET7A 1AR61 1QJU1 1NZCA 5T3NA 2HWF2 1AR93 1U5XA 2HWF1 1DYPA 1YHFA 2HWE1 4EWEA 2IXLA 1S0CA 1NCQB 3EQEA 5CBLA 3ZFEB 3OY8B 1LHWA 1AHSA 4AEDA 4XILA 3AKPA 1C3HA 1UIKA 2RS12 2D6PA 3RJRA 4HN1A 3C3VA 5GZEA 4F8AA 1AYN1 5IT6A 2R49A 4XFBA 1JHNA 2PLV2 3ZXAC 4B4PA 2PLV1 4Q1PA 3V0AB 2VGDA 2NMOA 2JG8B 3LA3A 1NLRA 4DRRA 3WXPA 4UBHA 4XF0A 2GMMA 4LUMA 3MIBA 2BBVA 1S2BA 3FMGA 4CEWA 1WBFA 1XYNA 3WDUA 4LBLA 1COV2 3NAPC 5FO8B 1RHI2 1RHI1 4WM7A 5EJ3A 3USUB 1VBC3 3DPRA 1HRV2 4HVRA 3E6CC 1OPOA 1HRV1 1C8M2 2O8OA 2XBO3 1FNYA 1C8M1 3VN4A 3UL2A 4G4FA 1UIJA 3ILRA 3WHUA 1O91A 2ZGNA 1DQ4A 4PLMA 3H1MA 3V56A 2EA7A 1REEA 1J3RA 4B3NA 3S7IA 4M3CB 4M3CF 5FQ0B 4I30A 1O3RA 4GH4B 4IERA 4ORFA 3H7JA 2JD4A 5LRRA 1RUH2 3HWJA 4M0NA 1VBD3 3N36A 4CEWB 4YG0A 3B3QE 3H1WA 1FYUA 5FBZA 1G8WA 3NSTA 4COUA 5BNPA 2DCZA 2HKXA 2ZAAA 3S6PA 4AXOA 4DNYA 3CNAA 4ASLA 5DXDA 4L99A 4YM1A 5E88A 4TWTA 5F9TA 1AX0A 2QZ2A 2X5IB 4QT6A 3TN91 5FOBB 1NCRB 2XJRA 3INAA 3JD72 3B01A 3JD71 3SH5A 1GLHA 1H8TB 2XJVA 2VUJA 2W39A 1ASJ2 3LA2A 1ASJ1 1RUI3 2VNRA 1A3KA 2DTYA 1SCRA 2C5DA 3LAGA 4A7YA 2QCSB 5BNPB 5LK7B 4HETA 1PNGA 2AH2A 2XJTA 1BK1A 4H55A 4XPVA 4YG3A 4JDOA 5CVRA 4Y20B 4PDWC 1ND2C 2YPJA 4Q4X3 3S0MA 2AR6A 4AQSA 1OLRA