1FNZA

A bark lectin from robinia pseudoacacia in complex with n-acetylgalactosamine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
237
structure length
234
Chain Sequence
TGSLSFSFPKFAPNQPYLINQGDALVTSTGVLQLTNVVNGVPSSKSLGRALYAAPFQIWDSTTGNVASFVTSFTFIIQAPNPATTADGLAFFLAPVDTQPLDLGGMLGIFKFNKSNQIVAVEFDTFSNGDWDPKGRHLGINVNSIESIKTVPWNWTNGEVANVFISYEASTKSLTASLVYPSLETSFIIDAIVDVKIVLPEWVRFGFSATTGIDKGYVQTNDVLSWSFESNLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a legume lectin from the bark of Robinia pseudoacacia and its complex with N-acetylgalactosamine
pubmed doi rcsb
molecule keywords BARK AGGLUTININ I, POLYPEPTIDE A
molecule tags Sugar binding protein
total genus 49
structure length 234
sequence length 237
ec nomenclature
pdb deposition date 2000-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fnzA00
1LCLA 3AYDA 1D2SA 4Q27A 1O4ZA 2A70A 4LBQB 4AGGA 1AF9A 2VH9A 4FPYA 3W58A 1CONA 4YZ1A 1Y7BA 5GLUA 1SLLA 4AGVA 5AVAA 1OFSA 2A6VA 5KXCA 4M00A 5T5JA 1IKPA 1FV2A 1C57A 1SLCA 2ZA9A 5DUXA 5F5QA 3V0BB 1GLHA 1EPWA 3M1HA 5DUWA 2A3XA 3MW3A 1JUIA 1V6LA 4NOTA 3SH3A 1N3PA 4FOYA 2D6MA 2ZZJA 1MS5A 2I2SA 3GALA 4LBKA 4P9WA 3SISA 1IOAA 1CPNA 1HQLA 3OGGA 2D6KA 1CN1A 2C9AA 3AZWA 5F9TA 4BLIA 1JBCA 4XBNA 1CJPA 2B7YA 3IN9A 1S0DA 1YIFA 1SACA 3ZXLA 2CNAA 2A6XA 4DPNA 2GDFA 4XILA 1YI7A 1MS3A 3QLQA 5IK5A 1BKZA 4AVSA 2P2KA 1ENQA 3FLRA 4FPCA 4W65A 2H0BA 2PHXA 3I8TA 5EXOA 1AVBA 1Q8VA 4GKXA 5JOWA 2R0HA 2GALA 4YW2A 1ZM1A 3OJBA 1DQ2A 1W6OB 1G9AA 1I3HA 1MS4A 1LHNA 4YZ2A 4K1ZA 1LHOA 2WNEA 3UL2A 3B01A 1AX1A 3PVNA 4U2AA 4Z8BA 1UL9A 5KXEA 3AFKA 3AP5A 1LECA 3RS6A 3LSDA 3D6EA 4WVWA 1LHVA 4YW3A 5KXBA 5SV8A 4YLZA 1ULDA 1UPSA 1GNZA 4XHXA 3ZPYA 3DUIA 2DWRA 3N7KA 4R9DA 1TEIA 1LU1A 4K21A 1UKGA 1W6QA 3R05A 4Y24A 5DUUA 3R4UA 1SBEA 4XTMA 3UK9A 4Q2FA 5H9SA 3N7JA 3ILFA 1MS1A 2G4IA 1UZZA 4UW6A 4FVVA 2PELA 4P9XA 5CAZA 3WOGA 4LBOA 3A0NA 1MS9A 1NLSA 1QKQA 1C1FA 2A75A 1LGBA 4DRVA 2DU1A 3PJQA 3ZXEA 4JC1A 1DYKA 2ZGRA 1FAYA 1GZWA 1N47A 1W6MA 3FUOA 3NV3A 3T1MA 3VKMA 2P34A 1MVQA 2JE9A 1S0CA 5IT6A 1SCRA 2P3KA 4K20A 5FREA 1V6MA 2UU8A 3RSJA 5GJ6A 1MR5A 4FOWA 4FPHA 2YXSA 4Y1XA 4YG6A 1C1LA 1Q8PA 1VLNA 3SH5A 1C4RA 3WDVA 2Z42A 1RINA 1SLTA 1LTEA 1JHNA 3DGTA 3L2YA 4YGBA 3R4SA 2W68A 3WUDA 1WLCA 2JD4A 1BYHA 3VKNA 3OYWB 1S1AA 3QCWA 4Y26A 4AVTA 2D3PA 4UW3A 5DZEA 2A3WA 2BQPA 3M2MA 4P14A 4ASMB 3ZSJA 4DRRA 1F9KA 2CL2A 3WDWA 1GV9A 2W08A 3HR9A 1GANA 1WBLA 2TEPA 1N1YA 1KDKA 1KQRA 3WLUA 1SLAA 2YY1A 2R49A 1V6IA 2ZMLA 2AH2A 1VAVA 3AYEA 2ARBA 2NMNA 1VALA 2EXIA 4C1WA 5E8AA 5DG2A 3WDTA 2CWSA 2ZMNA 2CY6A 3JU9A 2VU9A 2FMDA 4DS0A 3AK0A 1AXYA 4PBPA 2YV8A 1S0FA 1QDCA 2R1DA 3WHTA 1CQ9A 3WDUA 3N7MA 1DIWA 3N36A 4PCRA 3WCSA 4ISRA 4YZ4A 1LULA 1R1ZA 1H30A 1DLLA 4BPZA 2CTVA 4D69A 2NYYA 3WG1A 4YM2A 2WT1A 1WCSA 2GMMA 1BQPA 2EIGA 3BIWE 1QMJA 4YGCA 1QNYA 2EXJA 5CNAA 1QOOA 1JN2P 1DQ0A 4DQAA 2EXHA 2YZ4A 3TAYA 5EYXA 4Q8KA 2V5YA 5DZGA 2DUOA 4BQ1A 4ZKTB 2ZGLA 4ITCA 1CESA 4Y20A 5T52A 3WHUA 5T50A 3OBRA 1MVEA 3MW4A 3M3EA 2E7TA 2P37A 1B09A 1HDKA 1DQ1A 1AX0A 1IS5A 4AGRA 2EXKA 3NV1A 4LBQA 4PF5A 1UZYA 1YYNA 2DVAA 2P3JA 1SLBA 3ZSLA 2AREA 1WD3A 1W0OA 3M3CA 3FLTA 2VY0A 1GICA 2D3SA 1F31A 5IUQA 5T5PA 3ZSKA 1LGCA 1J1TA 3WDYA 1V6NA 1CPMA 2DVGA 4ZXKA 1ULCA 1V00A 3ASIA 4FP2A 4IQPA 5JOXA 5T55A 3M3OA 1Q8SA 3O0WA 5HCBA 5CA6A 1PZ7A 3KM5A 5T5LA 2D43A 4MYEA 4Y1YA 4YFZA 2ZGMA 4TZDA 3NV4A 1YXWA 1GZCA 2YROA 3POSA 3NV2A 2DVDA 5JOZA 3M3QA 2DURA 1ULEA 3ZXJA 1HQWA 1W6PB 1W6NA 2SBAA 3VKLA 4R9CA 3OY8B 3WUCA 1WW5A 1WLWA 4M3CA 2ZHKA 1ENRA 4PBOA 2GNTA 3A4UA 2DVBA 4U36A 3SH4A 2GNDA 1G7YA 1W0PA 3LCPA 4UW4A 2WJSA 1LOFA 3U4XA 3POWA 1G9BA 2PHTA 3NWKA 1LOEA 2D44A 4BMEA 2NZ9A 1G8WA 2YMZA 5E89A 1FATA 2AYHA 4FOVA 4LBQD 1LHWA 1S0JA 5GZFA 1JYIA 1JW6A 3IPVB 4XMAA 1QGLA 1DGLA 1X50A 2ZGQA 3MW2A 4C1XA 5JOYA 2D6PA 3D5OA 2W52A 4PQ9A 1A78A 4YM1A 1QNWA 4TYSA 4YGDA 5EYYA 3RQ0A 4Y22A 3ZXKA 4YZ5A 2JECA 1URXA 4GKYA 2DTWA 4SLIA 4FQ4A 4FPKA 5DZFA 5KXDA 3ZSMA 3MPPG 5GZEA 1V6KA 2P3IA 4LBJA 2JJ6A 1LENA 2ZGTA 4XIKA 2AGSA 1W6QB 4XJZA 1N3OA 4YW4A 3AP4A 2PHUA 3T1LA 3OPZA 1NXD1 1IS3A 3RMXA 3V65A 1N1VA 3A0KA 3AJZA 4FOQA 4Q1RA 1MACA 2EF6A 3SLIA 5H9QA 3VUOA 4YM3A 2SLIA 3WDXA 2ZHNA 1GZWB 2WLQA 5GLWA 5L73A 1AXZA 4R9BA 1GZ9A 2WKKA 2VUAA 4H55A 3V0AA 2EAKA 3USUA 1Z0HA 1MZ5A 2WSUA 3FBYA 2ZGNA 1IS4A 2UWBA 3IKWA 2D3RA 3I4IA 3RG0A 2UURA 4LBNA 1AZDA 1A8DA 5E88A 1LOAA 1OKQA 1ONAA 2ENRA 3WZ1A 1DYPA 3OYWA 3W59A 1IKQA 1LODA 2PHWA 1QU0A 1VAMA 2ZBJA 4JCKA 2XB6C 4XJ9A 1Z78A 5DXDA 3N3HA 3N7LA 4CZSA 3TB0A 5GZCA 5EWSA 2NMOA 4M3CE 1UN1A 2ZGSA 3ZXFA 2OUHA 2OUJA 4YW1A 1LEMA 3BOPA 3VV1A 3UJOA 1DFQA 1H9WA 1QDOA 2ZKNA 1SFYA 1AX2A 4Y1ZA 2UWAA 1JYCA 4FP3A 1V6JA 4OZXA 5JLVA 2NM1A 2W39A 3AXDA 1LOFC 1FNYA 2WSVA 4XJ8A 1ULGA 5GM0A 1V6OA 3WG4A 1SLIA 1WW7A 1DHKB 1QOSA 2GMPA 4XZPA 2ZMKA 1A3KA 2GNBA 3C2UA 3H0OA 4LBMA 1I1EA 2D6NA 4M01A 2JE7A 4BLJA 2WT0A 4YG0A 1LU2A 5BYNA 2GNMA 1YRZA 2E53A 2A3YA 4XXPA 5T5OA 4YW5A 3RMYA 3O0XA 3GNEA 3WCRA 2GMEA 1FYUA 1SBDA 2NN8A 1CIWA 5T54A 3BODA 5DUVA 1CR7A 4P9YA 5GLTA 1DQ5A 2DV9A 1DQ4A 2R16A 4BM8A 3IMNA 4LBLA 3FLPA 4Q8LA 1GBGA 1BZWA 4XBQA 4WZFA 1YO8A 3O5SA 5HCFA 3V0BA 5CBLA 1HLCA 2JKBA 4XJUA 2AENA 1Q8QA 4DFSA 3AP7A 1VIWB 1XQNA 2A6YA 4XJAA 5IK8A 2A5ZA 2HYKA 4XMIA 4ATEA 5JMCA 3AYAA 4XHBA 1MZ6A 4GWMA 1WD4A 1AXKA 1WW4A 3HMYA 1KITA 4FPFA 2ERFA 3LSEA 3VKFC 3PVEA 1KRIA 1FV3A 5IK7A 1UX6A 2ES3A 3O0VA 1AJKA 1DQ6A 2OVUA 5CB7A 1U0AA 1S0IA 2ZGUA 3N35A 3OBTA 4XE9A 4Y1VA 1W6PA 1FX5A 2WQZC 2LTNA 4FPJA 1W6NB 1DBNA 1JOJA 2D6OX 4ISQA 4YFWA 3OY8A 2ZHMA 4KBBA 1GYKA 3B69A 1QOTA 1WUVA 1S0EA 2CYFA 3BTAA 5JVVA 3WG2A 4M3CB 3AZYA 4Y1UA 4YM0A 3JUUA 5GLVA 3SITA 4AYUA 1W6OA 3POYA 4HANA 1D0HA 2EALA 5GALA 1LJ7A 4AWDA 4XDQA 2DUPA 1OQ1A 1HKDA 3AZXA 1N1SA 1Q8OA 1LESA 3AZVA 5GZDA 4GWNA 5IK4A 2RHPA 1G9CA 3INAA 3UJQA 3PMEA 5HCAA 2VW0A 1ULFA 1BJQA 1RIRA 1RITA 2DU0A 2GN7A 3V64A 3ZYPA 3ENRA 3O12A 1KJLA 1LOBA 2ARXA 2ZGOA 3AX4A 4FPLA 2OW4A 4BOWA 3HN1A 3IPVA 4GA9A 2V73A 4RA0A 5LK5A 4XOGA 4XIOA 1G9FA 4BMBA 1AJOA 3AJYA 1N3QA 1LHUA 2D6LX 2R0FA 5GZGA 1N1TA 4Q26A 1KDMA 2E7QA 4Y22B 2D7FA 4WV8A 4RL7A 1Q56A 3B9CA 1FNZA 3AYCA 5FRAA 3WG3A 3Q9OA 1SCSA 2DYCA 1W6MB 4YGEA 2E6VA 1KJRA 1S0BA 3ATGA 4FPEA 2AR6A 1LEDA 4FQZA 2ZACA 3WV6A 5JDBA 1WW6A 2KM2A 4HL0A 2JDZA 1BXHA 2A71A 3CNAA 3FUQA 3ILNA 4FPGA 4F83A 5GLZA 3WNXA 2A6WA 4GALA 1LGNA 3FFZA 2DUQA 1O4YA 4AVVA 3V0AB 1APNA 3T2TA 3USUB 4I30A 1MS0A 4YZ3A 2C5DA 4ATFA 3SNMA 4XXAA 3D4KA 2CWMA 2ZHLA 4K1YA 1IS6A 3RRDA 2VW1A 1PZ8A 2A6ZA 3VKOA 3MEPA 4JRAA 1LOCA 1LOGA 1S0GA 3ILRA 1GNHA 2ZGPA 2XG3A 1GKBA 4XBLA 3IM0A 1GSLA 4XYXA 1MS8A 2A7AA 3AXEA 4M3CF 2LALA 2VW2A 2ZGKA 5H9PA 3ZYRA 1G86A 2DVFA 1F5FA 4CTEA 1QF3A 3B00A 1CVNA 1H9PA 2NP0A 3AP6A 2VXRA 5H9RA 3WVJA 4GXLA 4FPOB 5DG1A 1WLDA 2AUYA 1SBFA 4L8QA 3APBA 1WBFA 1PZ9A 1UMZA 3KQRA 2PHRA 4YG3A 2PHFA 4UW5A 2ZABA 3PVOA 1UAIA 4R9AA 1G9DA 2E51A 2GN3A 1DZQA 2Q5TA 2UWCA 2FHRA 3B3QE 1JXNA 2ZAAA 3AZZA 1ZA4A 1ENSA 3AP9A 4Y20B 4Q1PA 4XTPA 4NO4A 2R1BA 4XJWA 3ZVXA 4WVVA 2DTYA 4CRQA 2WT2A
chains in the Genus database with same CATH superfamily
3AYDA 5FZ8A 1RUC2 1D2SA 4Q0UA 4OHYA 3JQXA 4LBQB 1AF9A 2B9UA 2JIGA 3OBAA 5FMDA 3W58A 3POEA 5FMOS 3KF5A 3WP5A 3QH7A 5JUVA 2WAAA 1TNRA 4D7YA 4XAEA 3OOXA 3TRSB 1RGSA 4UT5A 2WZ8A 5AVAA 1POV0 3EBRA 5A33B 3VBOB 3GBGA 1XE0A 4RSUA 1IKPA 1ULOA 4FFIA 1GOHA 3V0BB 2J1RA 1EPWA 3M1HA 2RS31 5J36A 4IEYA 4S2GA 4NOTA 3VZLA 4H2AA 4FT8A 1MS5A 2I2SA 3GALA 2WC2A 1GWMA 3FX3A 3KHBA 4JTNA 4IUGA 4CUCA 1VBC3 1PGL2 1CPNA 1AR72 4BWOA 3L9JT 2C9AA 3AZWA 4BLIA 3OUJA 4E4DX 4XBNA 1RUD3 4E4ZA 1YIFA 1SACA 3ZXLA 3M8LA 2CNAA 3VDDB 1OOPA 1PO13 4EROA 3GXUA 4FTBA 4MXWB 4XILA 4BJ0A 1UU6A 1XNTA 1BKZA 2ORXA 1W2OA 4QU2A 5FPBA 5CG8A 1ZNPA 1H8TA 2HWC3 2PHXA 3VD7A 1AVBA 2DCTA 3VN4A 5JXIA 4I3GA 2GALA 1YI9A 4PI0A 4M0HA 2R7EB 1JYNA 3FFQA 1DQ2A 2WNUB 4S2FA 2F17A 1I3HA 5F3IA 4J1WA 1TNFA 4K1ZA 2D5HA 1VRBA 2PAMA 3PLQA 2B39A 2ZZQA 1SFPA 3B01A 3WW1A 2CGNA 4LHNA 4ASLA 3PVNA 4U2AA 1EAH2 1C5IA 4OCTA 5KXEA 1TMF1 3AFKA 5FLHA 5LK7B 5A6QA 1W8UA 4XUOA 1QXRA 2WINB 3NKTA 5KXBA 3I3MA 1MEC1 4UYBA 4QD2A 4AW7A 1PVC1 4P02B 3ZPYA 3O1MA 4R9DA 5I93A 1ZBA2 3RZZA 1R083 1H8VA 2GC1A 2PA7A 5DAQA 1U12A 3R4UA 2VPVA 4IETA 3HEIA 2OS2A 1LNSA 2YPJA 3FL7A 4KQ7A 5C8CB 3WOGA 2QKDA 5LA1A 3POFA 1MS9A 1NLRA 1C1FA 3KT1A 4CU8A 4L2NA 3PJQA 3GZUC 4MVTA 1PK6A 2AACA 3FUOA 4N90A 2HWF1 4NROA 4TWTA 4BISA 4OQ9A 1IG3A 1JZ6A 1JYTA 3AMMA 1SCRA 3OD4A 4BZ4A 5GJ6A 1SMVA 2YC2A 4W50A 4HLTA 4XCAA 4Y1XA 3WDVA 2CGOA 1D4M2 4GWJA 5JIAA 2Z42A 4CUBA 3C7OA 4YGBA 1T6GC 3MIDA 1E5HA 1ND3C 4N8MA 1BYHA 4AQ2A 1VRH2 2DBNA 4Y26A 3NNMA 1UYXA 2W92A 2WZR2 2YBKA 4UW3A 5DZEA 4JHTA 3V56A 4H7MA 1F9KA 4XUPA 2CL2A 3WDWA 4DEQA 4QB2A 1W9TA 1XXNA 1GV9A 2W08A 1UOFA 2TEPA 3HR9A 1WWYA 1N1YA 3WLUA 3WQ0A 1PGW2 3JZVA 4CDQB 3ZO0B 4BXSV 4WM8C 2OZ6A 5LA2A 1IQDC 2ZMLA 3VD5A 3AVSA 1OA4A 2ARBA 2NMNA 2VMEA 4C1WA 5JAXA 2CWSA 3ZX7A 2CY6A 2YGMA 1QEXA 1U5XA 3Q8BA 4LMFA 4AI1A 1JMUB 2QQMA 3NW4A 2AC1A 1S0FA 2YV8A 3OGVA 4AFCA 3WHTA 3WDUA 1TVGA 2HWD2 4EWEA 3O1SA 4JZRA 1DIWA 3VBSB 3PUIA 2RS11 3NAPB 4ISRA 4YZ4A 3T0BA 1LULA 3ZYJB 4DXRA 5BNPA 3BB6A 4AFAA 4BPZA 4D69A 4IE7A 2YBSA 2BBVA 3LDBA 3WG1A 4LOSA 1VJ2A 1J84A 2GMMA 2JDNA 1CZTA 2EIGA 2B9VA 3AL5A 3E5QA 4IE0A 5CNAA 4AEDB 3UGGA 1JN2P 3CO2A 4LE3A 2YZ4A 3TYJA 3RZJA 3WQ7A 3AKSA 4LKEA 2XWBB 5DDJ3 4G3YC 4BQ1A 2R043 1UWWA 3EQEA 5LY1A 4ITCA 3WR0A 4Y20A 1PHMA 1PO21 5T50A 2JG8C 4OUSA 1MVEA 2E7TA 4XCBA 4IESA 2VGDA 1HDKA 5K4LA 2VQ0A 5HXVA 4AGRA 4LBQA 1UZYA 2JDKA 1BEV2 2AREA 1WD3A 4XURA 3HQXA 5FYMA 2BWAA 1F5JA 3ZSKA 3F2ZA 3OGJA 2O8OA 1LGCA 4LA3A 2OA2A 1UOJA 5IJRA 2X05A 1UY1A 5A33A 3S6PA 3VBOA 5FWEA 3WDYA 5J1XA 4A45A 3ZYBA 1Q8SA 4SBVA 5CA6A 4RS5C 3B93A 1US3A 5T5LA 4L99A 4MYEA 4JGYB 1YXWA 3E6BA 3NV2A 2DVDA 5JOZA 1T2XA 3VGIA 4XFFA 3LE0A 3NNLA 4HPKB 1W6NA 4NWVA 4QX3A 4BXFA 3OY8B 3WUCA 5C9AA 3VDDA 2QZ2A 4M3CA 4FBFA 2ZHKA 3QBQA 3ZPOA 5L7OC 3A21A 3TEZA 1ENRA 2QUOA 3BTYA 3A4UA 2VBPA 4GIQA 2WWJA 3BU0A 4UW4A 2CV6A 5IFTA 2G9ZA 1QH6A 1RUI2 1G9BA 2VG9A 3VBHA 5KR7A 3H8OA 2WNUA 4OHZA 1HXS2 2D44A 4HONA 4JGZC 4DINB 1G8WA 2YMZA 1FI2A 2NQYA 1S0JA 5CEHA 5GZFA 3ZN5A 1JYIA 1HB4A 3Q8AA 4DXZA 1O5LA 5FTTC 3JD73 4HN1A 5AFBA 4CP2A 1OMIA 4HKLA 1AYM1 1X7NA 3MW2A 5I0SA 5JOYA 1XYPA 5A32A 4I0WB 2D6PA 2W52A 3I3DA 4PQ9A 1QNWA 5EIYB 3TWIA 1W2UA 1ACCA 3FHQA 3OF1A 4WM7A 1YQ2A 1C8M2 5LA0A 1DYOA 5GZEA 3E5XA 1V6KA 4AFMA 5FZ4A 4XIKA 4YW4A 3I97A 3DV8A 4FI9A 2AGSA 1W6QB 1YFUA 1N3OA 2WS92 2P3YA 1WA6X 4O7XA 5FV3A 4I0BA 2V4AA 1UOGA 4UI9L 5C6CA 2QNKA 5BNNC 3RZKA 5A7PA 1NXD1 3H8UA 3PIGA 5C8CA 1XE7A 4QKNA 1N1VA 2Q1FA 3ITQA 3IZOA 1RUH1 4PIZA 1MACA 2EF6A 3RVHA 1W8NA 3CJIC 5F1RA 5KHJA 3NJYA 5H9QA 3U37A 2XJPA 4UAPA 5J96B 4Y5Z0 2WLQA 5FP9A 5KBFA 1QJY3 4XETA 4XF4A 3H3LA 3DPRC 4ASKA 2VUAA 4IDZA 2EAKA 3H3ZA 5ANQA 1ZYBA 5FBJA 3UT0A 2D3RA 3S5QA 2FDHA 4LJHA 1YFXA 2J1UA 5D2AA 1HQNA 3URFA 3WX5A 1BBT1 3W59A 2XKPA 1OSGA 3B9IA 1LODA 2LS6A 1JS9A 5CKMA 5DXDA 4G4FA 4CDXB 1NT0A 4JDOA 3MYXA 2OUJA 3MLKA 4YW1A 3BOPA 5A7QA 3VBRA 1DFQA 1H9WA 1QDOA 5A1AA 2DCKA 1SFYA 1AX2A 2RR11 4MLOA 4RHV3 2UWAA 3AMPA 4OZXA 4NE9A 5HCHA 4QX8A 2EIEA 5JLVA 1UY0A 4QHZA 2JENA 1Y9QA 1LOFC 3IIIA 1ULGA 1AR61 4UFMA 4ZONA 5F37A 3D82A 1QOSA 1FOD1 2RMU2 2ZPXA 3MI8A 3AMQA 1C3HA 4TTGA 4V1PA 5FY0A 1TME1 3NAPA 2FCTA 3K2OA 5F39A 1Y43B 3C2UA 1QQP2 2UYBA 4HKWA 2QDNA 4ZZ8A 4BLJA 2HWE3 4YG0A 3GZEA 3I2OA 2QQWA 2XJRA 2A3YA 1UXXX 5T5OA 4N53A 3GGLA 3RMYA 2H6CA 3NJZA 2P17A 2GMEA 1J83A 1HN1A 3BODA 1DQ5A 1S4CA 4COZA 1DQ4A 2R16A 4B1MA 5FMCA 3IMNA 3THDA 1GBGA 1YO8A 3VZNA 1UO9A 2JKBA 1BMV2 2VUJA 4XF9A 5IK8A 3VHPA 3AP7A 2BBAA 2A5ZA 2HYKA 2HLEA 1ENXA 3UKTA 2J7MA 1JTZX 4ATEA 2VZVA 3PIJA 2CAVA 3IMMA 2V72A 4B7KA 1WD4A 2VVFA 2ZX0A 1WW4A 1ZBE2 2Q1MA 1RUC1 3HMYA 2R6QA 3K4ZA 3LDRA 4D8MA 1XBFA 3MHZA 4FO9A 1KRIA 4JGYA 4JKKA 2Y8KA 4UBGA 5IK7A 1QJZA 1AJKA 1DQ6A 1LR5A 3AKTA 4J6GA 3KQ4B 5CB7A 2XLGA 3ETPA 1I9RA 2QZ3A 2WNVC 4QQHA 1CX1A 1FX5A 4HPKA 1FXZA 4IE6A 4JDNA 5F6LB 4FPJA 1RUE2 2RDNA 3OY8A 4KG0A 3B69A 2PMWB 3BTAA 4AR2A 1F8VA 1YIPA 4Y1UA 1PGL1 3JUUA 3Q8FA 2LM3A 4CP0A 1W6OA 5GALA 3WP4A 4AWDA 4XDQA 3NRUA 1UZVA 3EO6A 2VCCA 1N1SA 1P8JA 1LESA 1Q8OA 2B8MA 3AZVA 4LQRA 5DQ0A 5FYZA 3SCFA 4CA9A 5JIUA 5A80A 1XNAA 3ZIWA 2RHPA 4XF1A 2JKXA 1BVP1 1OT5A 1RIRA 2DU0A 1RITA 2GN7A 2X5IA 5FXVA 4GD4A 3O12A 2ARXA 3SXWA 3TN93 5FR3A 1PIV3 4NPMA 3ZSEA 4W6WA 3WW4A 1VBE2 4XOGA 5JR2A 2JG8B 5JPNB 1BHGA 5ANNA 3D0JA 3K77A 1ZVFA 3VLBB 4LKFA 2E7QA 3PU8A 5JMOA 2AZ5A 2RJKA 1VBB1 1YQCA 4FCAA 1FNZA 4CCJA 2BOIA 1MZFA 1NCRB 1MQTB 1SCSA 2RM23 2VNOA 2VOTA 4BQXA 2LRPA 3S0MA 2RE9A 1OPOA 2E6VA 1KJRA 1S0BA 4NRQA 2Y60A 4AOCA 3DYOA 4Q4X3 2ZACA 3T3YA 4QXCA 1NY72 1DF0A 1QJU3 1TQ5A 1TG7A 1WW6A 2OXBA 2Y26A 4QXKA 5FO7B 3T09A 4X6RB 1BXHA 2PAKA 5KC5A 1E5RA 2A71A 4FPGA 2JWPA 3ILNA 4DUXA 2JDUA 5GLZA 5J3UA 4LT5A 4GALA 1A8MA 1W8ZA 2DUQA 2I07B 4QMAA 4EN0A 4O9GA 2HWB3 4Q4W1 5L7OB 1MS0A 3ZYGA 3BCWA 4CXXA 3SNMA 3I2KA 4XXAA 1JYWA 1DZRA 2CWMA 2ZHLA 4K9SA 2IFRA 1S0GA 1YFWA 2FDKA 1GSLA 3DYMA 1MS8A 2QQVA 3AXEA 5BY5A 5H9PA 2Q30A 4CEYC 1RB8G 4B4PA 4JGZB 4F3JA 4CTEA 5FZ0A 5HV4A 1CVNA 4MGYE 4LPLA 1W9YA 1UU5A 3WVJA 2EICA 4FPOB 1A6CA 1FMD2 5JWPA 1K3IA 4L8QA 1H4HA 4X8NA 4HSLA 1WBFA 4CU9A 4B4QA 4YG3A 3LDKA 4LHSA 2ZABA 3PVOA 1UAIA 3HQUA 5CKNA 2GN3A 3CBNA 1PGW1 2ARAA 2UWCA 3BN6A 2C24A 4MV2A 4S2HA 2RS33 4AHWA 1CAVB 3AZZA 5FZKA 3T2QA 5CU1A 4AI0A 3JB4C 5FZ7A 5I0UA 4AZZA 5FOJB 1ENSA 2ETEA 4XTPA 4COVA 1QHDA 2R1BA 2RV9A 3DECA 3PUHA 4KGGA 4QX1A 5FYSA 3ZVXA 4CRQA 4EJRA 5BNNB 1ASJ2 3NSTA 2MEV2 2WT2A 4QDRA 4ES9A 3W5MA 5CG9A 4YVSB 5F8PA 1WCQA 3VDBA 2HWD1 3CJIB 4Q27A 1O4ZA 2A70A 1WMXA 3RYKA 4ZS2A 2XVGA 2ZX1A 3D0SA 3S7IA 2C1FA 3J7MA 1JZ5A 3BTZA 2DF7A 1SLLA 3QD6A 3DPRB 1UY4A 3OCPA 4LNVA 1NOVA 5K7PA 4IEOA 4M00A 4NHXA 5T5JA 2BV4A 2OKXA 1HV1A 1C57A 2ZXQA 2ZA9A 4DMIA 3ZM8A 2PAEA 1JUIA 3GM8A 3K3NA 4GB33 5IVVA 1ND3A 4D6SA 4LBKA 4ZHNA 2WFPA 2D98A 4P9WA 1OUXA 3KB5A 3OGGA 1V9U1 4OMCA 4QQOA 4UBHA 1CN1A 1NA1B 2B7YA 1BEV1 1S0DA 2WQ8A 1TMF3 1BK0A 2A6XA 3TNQA 4P9JA 4WM8A 1COV1 1UX7A 2B5HA 3WP3A 3ZYFA 1HRV1 1VBC2 1MEC3 1ZRIA 5IK5A 3BKZA 5FP8A 1O59A 2WWSA 4MHRA 2P2KA 1ENQA 1PVC3 2PQSA 3FLRA 4MGZE 4OMDA 3I8TA 3LWCA 4CDQC 1RUD2 1W39A 5JOWA 2VQAA 2VR4A 1GQHA 5F32A 4YW2A 4Z2AA 2VOWA 1WGPA 1OF3A 1CAXB 1JI6A 5BNPC 1CAUB 4OQ8A 4P9IA 2BPA2 5FUIA 2ZOEB 1RC6A 3I7DA 1UL9A 2P4EA 1HN0A 2QE3A 3I54A 4QX7A 4WVMB 2G1MA 3VBSC 4XQ4A 5B4NA 5FLJA 3MZHA 2HWF3 3PL0A 3PTYA 5DAXA 3D6EA 4WVWA 5FYCA 4AHYA 1OD3A 2XHNA 5SV8A 2VM9A 4AEDC 3VDAA 1HV0A 2VOVA 3HBZA 4CPBD 3ZXGA 4TZDA 2JG8A 4Q5OA 2XJSA 1ND2A 1UIJA 3C7HA 4K21A 4CXYA 1ULPA 2A1XA 2XDVA 1HXS1 4RFRB 2FQPA 2E63A 5DUUA 2OPKA 3POGA 3B94A 2DFCA 4UW6A 1IQAA 5FZLA 3B5LB 5FK7A 2XBO2 1QKQA 3LPFA 3SMHA 2DU1A 4PLOA 1FAYA 2Q8EA 4DUVA 3OGSA 2BVBA 3VKMA 2OZJA 1QY4A 4FXGB 1MVQA 3J8F3 4IEPA 2PTMA 1KGYA 1RTVA 2BRTA 2XONA 4RS5A 5G05L 1ZRCA 1C8M1 2Y0OA 2BOJA 4NAOA 1DU3D 4FOWA 4FPHA 1JOPA 1UZ0A 2JB8A 4J1XA 4CCLA 3UKNA 1ZRDA 1LTEA 1JHNA 1PGSA 2WNVB 3L2YA 4RQPC 5EJ3A 3SC7X 3ZR5A 2XVKA 2WAOA 4MGTA 2D5FA 3KV6A 1S1AA 1R093 3AKQA 2D3PA 3MICA 5ABJC 3IDEA 5L7OA 1BK1A 2I45A 1FT9A 3MUZ1 4LO4B 2WL1A 4XFIA 4YYOA 4AFDA 4BIOA 2CGPA 5K0UA 5A1FA 4BQ2A 1KXGA 2YPDA 2FD8A 4KI5M 1XB9A 2BNNA 3BOWA 3AM2A 3AYEA 4QB6A 5A3WA 2EXIA 5IAXA 1POV1 2WA4A 1YJKA 2IXCA 1UF2C 3RI8A 1PO23 3JU9A 2VU9A 3POBA 4MADA 5BNOC 3AK0A 4NAMA 1AXYA 1Z7S1 4NIAA 3ROUA 3I59A 3VB9A 2BW8A 2XL7A 4HETA 1X9TA 2CDPA 4XABA 1GOGA 3KVBA 3ZYHA 3WW2A 3HT1A 1YQ5A 2DBIA 5EHDA 5LBBA 2CTVA 2QFEA 3MDPA 2NYYA 4NUBA 4W8JA 4XF3A 4LOTA 1WCSA 4YW7A 1BQPA 3BIWE 5L19A 4YGCA 1OLME 3FWEA 1X82A 2V5YA 2VZUA 3N9PA 1JZ2A 1CAVA 4CEWC 2DUOA 3DXTA 4ZXEA 1GP4A 4OI4A 4IGOA 2ZGLA 1C5HA 3WZ1A 3HT2A 1CESA 2GH2A 5HPOA 4CUAA 1ZX5A 5BNNA 3OBRA 3FC0A 2VNGA 5JI7A 3MW4A 3M3EA 3TNPB 4CCCA 2RMU1 5C7GA 5JCTA 5DN2A 4DNYA 3H1MA 1DQ1A 3NV1A 4PF5A 3LD8A 2P3JA 3BTXA 3ZN6B 2IXKA 1EUUA 1QQP1 2R042 3RPQA 2W2IA 1PNFA 3FLTA 4KH9A 4UF0B 5LBFA 2ZKLA 3DPRA 3LOIA 5T5PA 3O1RA 3ECQA 1RVF2 1VAKA 5LZ6A 1CPMA 1WZXA 2DVGA 1VBD3 3ASIA 4FP2A 1Y9GA 5FP7A 2P1BA 4CE8A 2VCAA 1IPJA 4Y1YA 4P08A 4YFZA 2OX0A 2ZGMA 3NV4A 4MGQA 3NMBA 3A22A 2YROA 3POSA 4V2VA 4CDUC 1HRI2 1DGWA 3O14A 3K75B 3AB0A 4RD7A 1ULEA 4HK9A 4N43C 4CEYB 3CHXA 5HV0A 1IGOA 2BTVC 2DDUA 2Y34A 1E5IA 1WCKA 3VBUB 2VNRA 1I5PA 4META 4OI2A 4COYA 5C70A 3DEMA 3JBG1 4BQWA 4P5YA 5BPXA 1VPHA 3T4VA 2LUWA 4U36A 4H3WA 3LA2A 4CDXC 1G6NA 1ZBE1 2GNDA 4LXLA 4Q0SA 4MG2A 1W0PA 1YEWA 5F2WA 1WCUA 1LOFA 1GZTA 2WJSA 2XQRA 1C28A 3FHIB 4Y4RA 3MFCA 2PHTA 4KWUA 3VBFC 2C6SA 4ZU7A 3EMRA 3E6DA 4BHPA 4DXTA 4B3NA 3TBDA 4BMEA 4MGKE 2NZ9A 5C3RA 2VQUA 5DMYA 1S2EA 1CAXA 4FOVA 1CAUA 2JXAA 3CLPA 1RUE1 1QGLA 1DGLA 1KS5A 1UZWA 2K9ZA 4WVMA 2J1VA 4HSJA 3RNSA 1W90A 2VZSA 4PIXA 4YM1A 3RJRA 3ZXKA 4TYSA 3CL1A 4E9KA 2WN3A 1NX9A 3CF6E 3WNPA 2QQPA 4Q0PA 3MPPG 5L9RA 3BPSA 4LK7A 4LBJA 4ONUA 1O5UA 4XJZA 4FFGA 2XXZA 5LBCA 2HJIA 5IVFA 3T1LA 2ZX2A 1BBT3 1OFNA 3GBFA 4IV3C 3OPZA 1VBE1 1J3RA 1OA3A 1STMA 1IS3A 1H0BA 3CMGA 1S55A 2X8KA 3MIBA 4IV1B 5FKBA 3HQRA 5IW0A 1NUKA 5D8AC 3TEYA 2B42B 2SLIA 3PNAA 3WDXA 4YM3A 3SKJE 1GZWB 3LA3A 1PVXA 2VMDA 4HBNA 3IDAA 3VL9A 3WNMA 3MV01 3NQHA 2JG9C 4OVEA 4R9BA 1GZ9A 4X6QB 5L73A 2RR13 4H55A 4O9EA 2Q8DA 1FPN2 1JUHA 3P3NA 2W1UA 1W8TA 4P00B 4COWA 2WNVA 1IS4A 1AR63 1REFA 2UWBA 2QJVA 3IKWA 3MV11 2XR4A 1RYYA 5FZ9A 1A8DA 1FOD3 3OPWA 2XJVA 3LQCA 1OKQA 4RR3B 2VNVA 1QJY2 3NL1A 1TME3 1IKQA 2ARCA 3U10A 4JCKA 5AC91 3ON7A 3ZFGB 5LY2A 1Z78A 3OG2A 3ZMNA 3ZFFC 5FPUA 4AHZA 2MHFA 5CVRA 2O0OA 2KD7A 1UN1A 2ZGSA 2BNMA 3M70A 5AC92 5HBAA 3UJOA 2BU9A 2UY8A 3MFAA 1ZRRA 4K3UA 1JZ7A 2C4XA 1IG0A 4A2UA 4Y1ZA 1JYCA 4FP3A 4UFLA 4AEJA 3NO8A 3AXDA 5J98B 4XJ8A 2WSVA 1V6OA 1O3SA 1SLIA 3ZLIA 4CCEA 2QQLA 2ZMKA 2C26A 2DCYA 1EV11 4PDWB 4QPGB 1A3KA 5ERLA 2KR2A 1UYPA 2GNBA 3IWZA 4GH4C 4Y4YA 1GWLA 4HZFA 4QPIA 5FPXA 4FXKB 3C7FA 2GNMA 2VUCA 1RUC3 3U07A 2XVLA 1FMD1 4E8DA 4EZHA 1RHI1 1RUF2 3B7MA 3QH6A 1R64A 2NN8A 3FBMA 1CIWA 5T54A 3THPA 2RDQA 4QPYA 5CZKA 2RS52 1CR7A 1TE1B 4E4HA 2PN5A 1IPSA 2HWE2 4B1LA 5LRSA 2JDPA 2OQ7A 2GAUA 1NCRC 1MQTC 2VCMA 2VMIA 3FLPA 4ORFA 4Q8LA 4QU1A 4NJ4A 3V0BA 4X8PA 1RMU3 1AL21 1REDA 1SEFA 4IE5A 1CJDA 2AENA 4RQPB 1XQNA 4UF0A 2HEWF 1NCQC 4XMIA 3T0AA 1PM7A 3OD0A 1B35C 4XHBA 4ET7A 4GWMA 1ASJ1 2IXJA 2MEV1 1UQXA 1AR82 1R1A2 5ABJB 3THCA 3H7YA 4NPLA 4ARYA 1KITA 4FPFA 3J9SA 1GP6A 5DAVA 4BK4A 1K5JA 3ZOIA 5JDBA 4EN7B 4Z07A 4E2SA 3OUHA 3WF4A 2ES3A 3O0VA 2OVUA 3UGHA 4MXWA 4KWKA 1DP0A 3HWJA 4XE9A 4TSVA 2E9QA 4XC9A 4Y1VA 4CEYA 2WQZC 2LTNA 4LKDA 2RJLA 4ISQA 1JOJA 2D6OX 4IL7A 1AHSA 4EN6B 5BNOB 3J7HA 5A7NA 5M0TA 3KV5A 2XH6A 4QQLA 3WSOA 4ARXA 2OQ6A 2JICA 1SZBA 4AYUA 3POYA 2EALA 2X53S 4GZ9A 1VBB3 2XHKA 3ZFEC 3AZXA 2GH8A 3GJBA 1H6YA 2WO1A 3IAQA 1OPMA 4EN8B 2JDMA 3INAA 3UJQA 2VVEA 3PMEA 4GQ7A 4JKLA 1JH5A 4LHKA 1LOBA 2RJ2A 2QQKA 4CEWB 3J4UH 2OW4A 4MO3M 4QX0A 2V73A 4XFCA 2VOKA 2I74A 2Z79A 3K4DA 1DZTA 1RUD1 2IXIA 2VVDA 3KHCA 1AJOA 3AJYA 3RFRA 2XGXA 3N9MA 3TOJA 2R0FA 1N1TA 4HT1T 1X8MA 1RUJ3 1AYN2 2VZPA 4KU8A 4Y22B 3TN92 2D7FA 4WV8A 1PIV2 4Q4W3 5LBEA 5KHKA 4XDOA 3RDIA 2UY9A 4Z82A 3AYCA 1K5MC 3AKPA 4YVSC 4I02A 5FK8A 5FYBA 3WG3A 2WO2A 2J1SA 4IEUA 2BFUL 2WQ4A 1DDLA 4YGEA 3ATGA 3GZTB 4FPEA 4Z2WA 2AR6A 2GC3A 5FUPA 1LEDA 4I09A 4QQPA 1QJX3 1EYBA 2NLRA 3ELNA 5B4XA 3P5BA 4CDUB 2KM2A 4V2WA 5L9VA 2CHHA 5FZEA 3VZJA 5JZGB 1F2NA 1YFYA 4KG8A 4N43B 1XNKA 5IATA 4F83A 5IHRA 1CAWB 4KU7A 5FYHA 1VBA2 2A6WA 1LGNA 4CDWB 5C4WC 1O4YA 1W9FA 3V0AB 4O65A 3T2TA 3USUB 4I30A 2XBO1 1W3XA 3ACHA 1NA1C 4Y33A 2WO3A 1YQ8A 1H1MA 1AL0G 2GP5A 3D4KA 4HG6B 5EQUA 4K1YA 3MEPA 4JRAA 4CDQA 5E6HA 1XPWA 2ZGPA 2R072 4B8EA 1GKBA 2E32A 2IXLA 4XBLA 3VBFB 2HWB2 2GSYA 3D3AA 5FUNA 3ZDSA 3VDCA 2RDRA 2CU5A 2ZGKA 5LWBA 3LEMA 1O91A 3G6JB 1F5FA 3LEKA 3B00A 1GP5A 1I5ZA 1H9PA 2NP0A 3AP6A 2VXRA 4GXLA 2HWD3 2IUWA 1WLDA 2XL9A 2XLFA 4HVOA 1SBFA 3VBSA 4CCKA 5ACA2 1RUG1 3E6CC 2R32A 1PZ9A 2QCSB 1UMZA 5L9BA 3HIFA 3KQRA 2PHRA 1QWRA 2PHFA 1XNDA 4R9AA 4AG4A 2FZ2A 5FP3A 3NVCA 4AEDA 4COUA 5FPVA 4EE2A 3RZGA 1W3VA 1DZQA 2Q5TA 4BQ4A 2FHRA 1UY3A 2OT7A 3WT3A 4DXSA 3C7EA 4CVUA 2VD7A 5IVYA 5C3QA 3KWVA 1XJAA 4IV3B 1V9U3 4WVVA 5IAVA 2FCVA 1J3PA 3DYPA 1LCLA 1VB4A 1SPPB 2VC9A 4TLFA 5D8AB 4JQRA 2RS32 4AGGA 3IDCB 2MPFA 4YZ1A 5GLUA 1COV3 2WFF2 4AGVA 2FDFA 1HRV3 2JG9B 1OFSA 3LIGA 4AAPA 2JDAA 1FV2A 1H2NA 2F4PA 4NRMA 3K48A 5DUXA 3CZUA 4QGNA 3VZKA 1VP6A 5DUWA 3AL6A 3MW3A 1V6LA 4XEZA 4W6YA 3SH3A 1K12A 1N3PA 4FOYA 2W46A 2D6MA 2O8QA 2ZZJA 2VAUA 1DCSA 3WINE 1DLCA 2D6KA 4B7EA 1J1LA 4CCDA 4YWAA 5F9TA 1NYWA 3GHNA 1JBCA 5FZHA 3WF3A 1CJPA 3ZFFB 4GB32 2VMFA 1NE4A 2YFUA 3UYJA 4NPRA 4TXWA 4DPNA 1RVF1 4XFBA 2P6HA 1AR71 4NHYA 5EJZB 2CDOA 4AVSA 1DGRA 5A3NA 1RXFA 5I0RA 4RYDA 4W65A 1CD3G 2Q1ZB 1RL3A 4UFHA 4GKXA 3KLSA 1WCDJ 4A42A 1ZM1A 3LEIA 4DY5A 4YSFA 1HRI1 1G9AA 2YU2A 2JE8A 1MS4A 1LHNA 2TBVA 4YZ2A 4IEZA 1MEC2 1YLLA 2PLV2 1F35A 1LHOA 2WNEA 3UL2A 4GH4B 1PVC2 1UU4A 3PHMA 4AI3A 1AX1A 1NQJA 2W0XA 1UW8A 4EN9B 1SG3A 1OLMA 3MF9A 3N9NA 3S5AA 4NHLA 3LSDA 1CX4A 1LHVA 4YW3A 4CEWA 3T08A 1C8M3 4YLZA 3ABZA 1UPSA 4LO6B 1JZ4A 3I2JA 2KXLA 3MF6A 5EFUA 3DUIA 3N7KA 4AVAA 1AR92 1EAH1 1TEIA 2B46X 1UKGA 5FP4A 1H2LA 1W6QA 3AC0A 2Y6JA 3R05A 4Y24A 1ZZ9A 5D1IA 5FXWA 1SBEA 2HWF2 4XTMA 1OQEA 3H50A 3ILFA 4NR1A 5FZFA 2W95A 1UZZA 2PFWA 1XOYA 4FVVA 4P9XA 1NCQB 4CYDA 4NHMA 1NLSA 2H0VA 5FLIA 1ZBA1 2A75A 1UOBA 1B35B 2W3JA 3KGLA 4JC1A 1DYKA 3ZXEA 4DRVA 5J48A 4A6OA 1N47A 1UNBA 3NV3A 5LRRA 4N9HA 2P34A 4M4PA 5IVCA 4YRDA 5CFDC 3BYWA 5IT6A 5FREA 3RSJA 1V6MA 2UU8A 3U14A 3HNMA 3KGZA 3SHRA 1MR5A 1Q5OA 5A7WB 2NPIA 4Q4Y3 2BYVE 1C1LA 1Q8PA 4YVWC 3SH5A 1C4RA 2WA3A 4ES8A 1RINA 2QQOA 3UGFA 3DGTA 5LEJA 1Z7S3 4MGSA 4N43A 3R4SA 2Z2SB 3WUDA 1CAWA 1E5SA 3J8F2 4QXHA 4W4ZA 3I3BA 4GMP1 3OYWB 4IEWA 2R062 2ZTNA 3QCWA 2L9LA 1RUOA 4AVTA 1S2KA 3M2MA 4DRRA 1D4M1 5KHHA 3KVAA 4R4ZA 3ZKUA 4CDXA 4R4XA 3VBUC 1GANA 1WBLA 2P6CA 2VCBA 3ZFEB 1SLAA 2YY1A 2R49A 2X29A 1AUYA 1V6IA 4H14A 2AEZA 3U78A 2AH2A 1VAVA 1VRH1 1C8NA 4BB3A 3VBFA 1R092 1VALA 2VL4A 2WZR1 1ZZ8A 2WYSA 1L3JA 2XOMA 1FPN1 3CDZB 5DG2A 5E8AA 1PX4A 5FY9A 3WDTA 4E4SA 1H2MA 1OVSA 4DS0A 5C9AC 4Q4V2 2RMU3 4PBPA 2VECA 1HJGA 1QDCA 3AMHA 4W6XA 2JDYA 1QIQA 3N7MA 2WLPA 3MIEA 3N36A 4PCRA 1KD7A 4LITA 1R1ZA 1H30A 1SQ4A 1DLLA 5CFCC 4YM2A 2WT1A 2XUMA 3N9LA 5FQ0B 1QNYA 2EXJA 4G9SB 4LLOA 3VBHC 4BQ3A 4D6RA 4PLMA 5EYXA 1K5MB 5DZGA 4BCUA 5L36A 1YWKA 4QDSA 1PM4A 2VMHA 2WABA 3QACA 2RG4A 2XWJB 3WHUA 2OIIA 4Q29A 5T52A 4IERA 2Y6GA 4IV3A 1XRUA 2CAUA 3T30A 4OI0A 3WQBA 2P37A 5IVBA 1ODMA 1XSRA 1B09A 5FCCA 5JI9A 1PX3A 1AX0A 2WWUA 2YFZA 4A3XA 5FYUA 1YYNA 1SLBA 3ZSLA 1W0OA 1RJ8A 1OUSA 3JBG3 3M3CA 4IV1C 3R6SA 2BNOA 3T4HB 2D3SA 1F31A 5IUQA 3LB9A 2B4KA 3K46A 1J1TA 5C4WB 1V6NA 1W04A 3O7OA 4JVAA 5D21A 4OLLA 5FY8A 4IEQA 4ZXKA 5DPNA 1ULCA 3VHOA 1RUF1 2ET1A 3M3OA 5HCBA 3O0WA 3VZMA 4FTEA 2BFUS 1PZ7A 2RS51 1V70A 4JKMA 2HWE1 3KCCA 1OLRA 3M3QA 1GQGA 2DURA 3NJVA 2E7AA 3CIHA 3ZXJA 1HQWA 1VBD2 1W6PB 5FPAA 4RR3C 2ZEYA 2VJXA 2JD9A 2SBAA 3T2OA 3VD9A 5B2GB 2ZS6B 2G9FA 4XQWA 3ZFGC 3A23A 4PT6A 1PO12 3WF0A 3DKQA 5F7UA 2Z4FA 1AR81 1R1A1 1NG0A 3LCPA 4KGQA 3KV4A 4N7UA 4BDVB 4JHZA 5FZCA 3PTRB 3U4XA 2HWC2 2VOXA 3NWKA 1CWPA 4ZY9A 4LORA 1V0AA 2BP6A 2YU1A 5E89A 1FATA 4LBQD 4QQ2A 1LHWA 4GH4A 1JW6A 2ZX3A 5FKCA 3ALQA 2VZ3A 1BCXA 3PVBB 3VBRC 1X50A 4Y3OA 1RUI1 2DCJA 3VZOA 3J7LA 2ZGQA 4PDWC 4QPGC 4XUQA 4C1XA 4S2DA 3LPGA 1A78A 4YZ5A 2XUEA 3R0RA 4KWLA 4YGDA 3IIAA 3I3EA 3N9QA 2JECA 3PU3A 5EYYA 5FZAA 1URXA 3RWNA 4GKYA 2DTWA 4CXWA 4QHBA 4NHKA 3GF6A 4A3ZA 5DZFA 5KXDA 3DCQA 1UYYA 2KA3A 3ZSMA 2YB7A 3QOPA 1NCRA 1MQTA 1OQDA 1LENA 2JJ6A 2ZGTA 4HVQA 5FDBA 1R082 5EJ1B 3AP4A 4LE4A 4AVBA 2GC2A 2VO5A 3KMHA 4A6SA 4HKOA 4GJZA 4B4RA 3N9OA 3TEWA 2QVSB 3ZN4A 3V65A 1NCQA 3A0KA 3AJZA 4MX3A 4EWDA 3POJA 3AVRA 3RYPA 1B35A 4Q0QA 3SLIA 4EZ4A 3WEZA 5FIXA 2QTWB 4A44A 2WS91 2BGOA 5A6ZA 1SDDB 1H1AA 5GLWA 1AYN1 5F6KA 4MGIE 3UKVA 1AXZA 4R52A 2WKKA 2VZ1A 2W91A 4QT6A 2RS13 2ZX4A 2WZPP 5KHIA 1Z0HA 1MZ5A 2WSUA 3VL8A 3FBYA 3K4AA 3TEXA 2ZGNA 2Z5WA 4RFT0 1CGPA 3RG0A 4LO7A 3CZJA 4LBNA 1AZDA 4BK5A 1LOAA 3E97A 2ENRA 3OYWA 1OI6A 5A3MA 1EV13 1OLQA 1GMMA 3C3VA 5FOBB 2PHWA 1QU0A 1VAMA 3CEWA 4XJ9A 2IWGB 2BGPA 3N7LA 4JGZA 4M4RA 1NZIA 3TB0A 4OI1A 5GZCA 5EWSA 1AR62 3ZFEA 2D93A 3ZXFA 1FOD2 2OUHA 1CZVA 3VV1A 1VBA1 4C0HA 1KEXA 4ZU5A 4GULA 4JDMA 1RHI3 1GU3A 1X9PA 4K6BA 5IVEA 3AKRA 2P5BA 1V6JA 3HBKA 3LFMA 3W21A 5FZBA 2NM1A 2XMLA 1FNYA 3WNLA 1KS4A 1WW7A 2IXHA 2R071 3BALA 1AL23 3OUIA 4XUTA 4I0AA 4QGLA 5BNPB 2IC1A 3X29B 1HJFA 3H0OA 1F4HA 4M01A 1OF4A 2Q0AA 2WN2A 3C8XA 2JE7A 2WT0A 2XQXA 3OB8A 3RI9A 4AAXA 1ASJ3 3W5NA 4A41A 5BYNA 2VTXA 1YRZA 2E53A 1K5MA 3HPNA 2X5IC 4YVSA 4YW5A 1O4TA 3RZMA 2XPJA 3CJIA 3WCRA 1O7FA 5ACA1 4RGGA 1KFXL 5DDJ2 5E16A 2HH9A 5DUVA 4P9YA 3SEPA 2BJSA 5KWRA 4B29A 5CFDB 1ZZCA 4LBLA 3ZYIB 1XSQA 1CIYA 4XBQA 4FAHA 3O5SA 3Q8CA 1JU4A 4UFIA 5HCFA 4Y5TA 4XFGA 1HLCA 4YVWB 1VIWB 1XU1A 3D8CA 4XJAA 5F2SA 1QXJA 5EZWA 1VB2A 2BZDA 3IBMA 3AYAA 5C4WA 1DG6A 1MZ6A 1OD5A 4LULA 4C8DA 1ZREA 5JZGC 1NA1A 5AVPA 4MUVA 4XDPA 1BMV1 1RMU2 2YYOA 4CDWC 3VKFC 1AYM3 2E33A 3WD5A 2WFF1 5KHGA 1F4AA 3AMNA 4F8AA 3I2HA 2DFBA 1MPXA 2LROA 4LO5B 1U0AA 3O1VA 2EAAA 1D7PM 5AFEA 4GAZA 1W6PA 1DGRN 3BPZA 4D6QA 1DBNA 1W6NB 2V09A 3KV9A 4KMQA 4YFWA 1ST8A 1HX6A 3ACIA 5F5AA 4F7ZA 2ZHMA 4KBBA 1GYKA 1IZ3A 1QOTA 1ZZ7A 3UETA 2CYFA 3WG2A 3ZR6A 5C9AB 4M3CB 2FDIA 3AZYA 4RGKA 3SITA 4URAA 5IYYA 4AVCA 4HANA 2VULA 1OXCA 4LIUA 3KF3A 4QM9A 2DUPA 5CFCB 5DAPA 5GZDA 1RUH3 2CSGA 3BVCA 4GB31 2X09A 4GWNA 3I2GA 1G9CA 3G7DA 3P6BA 3VBHB 5LATA 2VW0A 5HCAA 2VZRA 3V64A 5BXXA 3ENRA 3PUQA 4FPLA 1KJLA 2BDRA 3AX4A 2Y6HA 4QGMA 4BOWA 4RA0A 5LK5A 1L7RA 1VBB2 2E26A 2HBTA 2Y38A 3GJAA 3O1UA 4XIOA 4RGAA 1G9FA 4BMBA 3JD72 4I3PA 4MSVA 5C3OA 4C0BA 5A32B 1W2AX 2WO7A 2PLV1 4INDA 4RL7A 4WM7B 4H7LA 5HXMA 3B9CA 2QQNA 2XBO3 4HN0A 3FHAA 4M0NA 1REEA 2QQJA 4TLGA 1W8OA 1F15A 4XAAA 2DYCA 1H2KA 1W6MB 3F95A 2BVVA 1RUJ2 1Q43A 2Y6FA 4CP9B 4QWNA 4NMIA 4Q4W2 3WV6A 1S2BA 5K9YA 3K3OA 4I01A 4KWJA 4XQDA 1AR91 4HL0A 2JDZA 4XFAA 4J25A 3EHKA 4AK3A 3OGRA 3KCXA 3U1XA 3CNAA 4OULA 3WF1A 3MUY1 4ZS3A 5A3UA 2IZWA 1RUG3 1NY71 1QJX2 5FJHA 2WNOA 4BQ5A 2YHJA 2C5DA 4ATFA 2WIIB 1LKNA 2RDSA 4LUKA 5LEKA 3RRDA 1IS6A 1PZ8A 5JR7B 1XC6A 1UCXA 3VKOA 3ILRA 3OEBA 3N4MA 1GNHA 2W9XA 3PMSA 4BE3A 1HB1A 3EYPA 3HD8B 3IM0A 1YUDA 4M3CF 3GCXA 4URTA 1GFF2 2LALA 2VW2A 3ZYRA 1EUTA 3J7NA 4JV4A 1SDWA 3J8F1 5JPMB 3VBRB 1ZRFA 2GU9A 2R061 1JHJA 5DG1A 1UMIA 4NIDA 2AUYA 4RHV2 4L11A 1W2NA 5IFPA 2GP3A 3WW3A 5JSRA 1EPZA 3HOBA 3HVDA 3GZAA 3AFGA 1HIXA 3B3QE 3GHMA 1R091 4D7SA 2QQIA 1W2TA 1ZA7A 3AP9A 4Q1PA 1GOFA 1US2A 2F4LA 3EB7A 4Q4V1 4XACA 1NKGA 4XJWA 5I8TA 1L7QA 1UYZA 4YW6A 3EXUA 1WA4A 1GQPA 3KCYA 4N53B 4AQ6A 3IT8A 2EIBA 3GDBA 1M4WA 4OHWA 2VH9A 2FMYA 4FPYA 5FY4A 3ZN6A 1J59A 1CONA 5FPZA 1Y7BA 1RVF3 5CFDA 2O14A 3ACGA 1AR73 2W47A 1ND2C 4CP1A 1V9U2 2A6VA 2QDRA 4QKFA 5KXCA 4HVRA 4O61A 4BH9A 3O1OA 1SLCA 1WKYA 2WR9A 4YVWA 4EYUA 3SQOA 5F5QA 1GLHA 3O1TA 2A3XA 3UESA 4CPBA 3O1PA 2N7GA 2BGCA 2ZAHA 1COV2 4IXLA 1HRI3 3SISA 1IOAA 1HQLA 1HRV2 2E31A 4JQTA 4LK6A 2ZCWA 2ET7A 4A7ZA 3PDQA 1SFNA 3CU7A 5C3PA 5GKAC 3IN9A 3NNFA 3VBUA 1VMJA 1W03A 4L9BA 5FPLA 4BU2A 2J42A 1H6XA 5T3NA 2GDFA 3ZIXA 2K2SA 1O3RA 1YI7A 1MS3A 3QLQA 5HI0A 1D0GA 5FYVA 4FPCA 4NN0A 2H0BA 2GC0A 5EXOA 1WMEA 5FZ6A 4N9IA 3OTFA 1POQA 2VQTA 5FZGA 1EAH3 3SCHA 1Q8VA 2R0HA 5FXZA 3FJSA 5BV6A 2W87A 4AEMA 3OJBA 1W6OB 5FY1A 1VBC1 1JYXA 5K0UC 3NKGA 3KT7A 1VBD1 5FY5A 5CFCA 5F3CA 2HEVF 3I2FA 4KL1A 3HNYM 2ORZA 1ZBA3 1JOBA 1HB2A 1RJ7A 2HYXA 4Z8BA 4HXCA 3ES1A 5FZOB 2C9KA 3ACLA 1LECA 1PO11 3AP5A 3RZLA 2X5IB 3RS6A 5APAA 1DGWX 2OPWA 3B02A 4YNIA 4ZZ5A 5CIRA 4LUMA 4ZPIA 2EIDA 1ULDA 3J26N 1GNZA 3NJXA 4XHXA 4I2OA 2DWRA 2HWC1 5A3TA 1LU1A 1RXGA 1OURA 3WF2A 1JZ3A 4K7JA 3UK9A 4Q2FA 5H9SA 3N7JA 4GMP3 3LOBA 1MS1A 3U11A 1NQDA 4IV1A 2G4IA 5CAZA 2ZEWA 2PELA 2XKOA 2YG0A 4XFHA 4LBOA 4A7KA 1VR3A 4C91A 1YC61 3A0NA 1Y9MA 2XJUA 3LGRA 1D4M3 1LGBA 2PHDA 3IB3A 4DOUA 2ZGRA 1GZWA 1OVPA 2RM22 1W6MA 3T1MA 2TUNA 2A73B 4HFSA 2JE9A 2YGLA 1S0CA 4CP9A 1VRH3 5FJKA 2P3KA 4K20A 4Q4X2 2WZR3 2FDGA 5FZMA 4FAGA 1FPN3 2UYAA 2YXSA 4YG6A 2Y0IA 1QJU2 1VLNA 2VBBA 2ZEZA 1SLTA 2Z69A 3KD4A 4QM8A 1R081 3T0DA 5C5UA 1PMIA 4RR3A 2W68A 1WMFA 5E1RA 1WLCA 1YCIA 2JD4A 3JXSA 3VKNA 3VD3A 3IDBB 4K8FA 4UWDA 2FBEA 4CCOA 4IGPA 3ZFGA 2A3WA 2BQPA 4P14A 3WY6A 4AQTA 4Q4Y2 3MBWA 1ALYA 3PUAA 3ZSJA 4ASMB 4DO0A 1VMHA 3DXUA 4FTSA 5I8YA 4L92A 1KDKA 1Z7S2 1KQRA 5TSWA 5LA9A 1OOPC 1VE0A 2WRAA 4OUMA 4TN7A 2DCZA 2ATFA 3W20A 4NIHA 1XYNA 4HMZA 2ZJCA 3U75A 2BUKA 4IEVA 2ZMNA 4CU6A 1QH7A 1H8TC 2J1TA 4DZGA 2QQUA 2FMDA 3VHNA 5F3EA 5FO8B 2PQQA 5FMBA 5FXXA 5FZIA 2R1DA 3DN7A 1CQ9A 3LZZA 4QKBA 3LA7A 4PDWA 4QPGA 3WCSA 5C3SA 3HAGA 2PYTA 4XPVA 1JU3A 5LW9A 2PXJA 4NRPA 3NNJA 5IWFA 4JTOA 1OKOA 1QMJA 5FYYA 4PI2A 3GCWA 2Q8CA 1QOOA 4K8RB 4QPWA 1DQ0A 4DQAA 2EXHA 3TAYA 3JB8A 4Q8KA 4QDQA 1RUF3 4YARA 2W1SA 3MGUA 4QXBA 5F5IA 1BEV3 4Y5SA 4KNCA 4ZKTB 2RS53 3OPTA 3KT4A 2ILMA 5I0TA 3H8RA 4BIFA 3S57A 3IAPA 4LTAA 5FZ1A 4LR4A 3S7EA 5C71A 1IS5A 2EXKA 2VMCA 2V5DA 4AHXA 1PNGA 2DVAA 4DEVA 4RQPA 5J09A 5JXJA 3LEGA 4PJYA 3OSDA 2V4VA 3JQWA 1O3QA 2VY0A 1GICA 2WZEA 3RYRA 2QBXA 3EJKA 4P9LA 4DY3A 4LKSA 1AR83 1R1A3 3PURA 3ZMOA 1PK6C 4P9GA 3USSA 5ABJA 1XNBA 2GZWA 5A6XA 1V00A 2YBPA 5I91A 4IQPA 5JOXA 5T55A 1OH4A 4MHUA 5DDJ1 1JZ8A 1OHFA 4XW3A 3I2IA 2R041 3LIHA 3KM5A 3JBG2 1OA2A 2D43A 1ND3B 2AEYA 3WP6A 3CQOA 3H3UA 2HEYF 1GZCA 4NWWA 3Q8EA 4LHLA 4CU7A 4E27A 3MLJA 1NE6A 1K45A 5BNOA 5LB6A 1ODNA 2W94A 2IFWA 3VKLA 4R9CA 5CISA 1RUI3 3POIA 1WW5A 4LLFA 1WLWA 1TMF2 4OZOA 1Q3EA 4WM8B 4N7IA 5C5TA 1HXS3 4FFFA 4PBOA 2VXJA 4JX0A 1WMDA 2GNTA 3H42B 5A6YA 3SH4A 2DVBA 4NIGA 2Y6KA 1G7YA 4XZUG 2EVXA 4OFGA 4D3WA 2O1QA 1RMU1 3ZXDA 1UMHA 3POWA 5ISLA 3ETQA 4WVZA 1MZEA 1LOEA 4JRLA 1LAJA 4CUGA 2BERA 1U5IA 1W9SA 1W99A 3BGAA 2AYHA 4PHZA 5J7MA 2VUDA 2VZQA 3IPVB 4XMAA 3HN3A 3ZDVA 2VZOA 4NVPA 1EY2A 1VMFA 4XVHA 4E2GA 5FZOA 2WS93 4R8HA 5FMOL 3D5OA 2VTXJ 5A3LA 3MPBA 3I3QA 3SEEA 4UFJA 1AYN3 3RQ0A 4D7TA 4Y22A 5A1LA 3WNNA 1HB3A 1OH3A 4XF0A 4SLIA 3BUCA 4FQ4A 4FPKA 1QXPA 3MLLA 1I6XA 1ND2B 5A3PA 2P3IA 2VMGA 4PIYA 4AE2A 2EA7A 1K42A 2PHUA 3VHRA 1UD1A 3CKHA 4QPIC 2C0ZA 2F6BA 3WXPA 1NAEA 3RMXA 5DAWA 1W9WA 3H8XA 3BI3A 4Q1RA 2YDEA 1POV3 4FOQA 4CDUA 3JD71 3U0ZA 2XJQA 3KSCA 3VUOA 5IVJA 4FSJA 2ZHNA 4PLNA 5JZGA 2VZTA 1O8PA 2Y33A 3FZ3A 4OHVA 2OYZA 1VBA3 2YC4A 2HKXA 4LEJA 4CDWA 4RS5B 3ES4A 3V0AA 1UXZA 3RJ2X 5F5CA 3VBOC 2IVJA 3USUA 4PQQA 2YUEA 5FAXA 3R4DB 3JCIA 4HOOA 5BUVA 5FYTA 1NLQA 3I4IA 4PF1A 1U5YA 2UURA 4IE4A 3MIHA 5E88A 1RUJ1 1ONAA 1D4VB 1DYPA 1IPKA 1X33A 1TZOA 2R073 2W1QA 3DL3A 4QB1A 5CADA 1GNYA 2ZBJA 5FBZA 2XB6C 2RS12 5CKQA 1PMHX 4WBBA 3N3HA 4CZSA 3RGBA 4WZCA 5K0UB 4FFHA 2WDBA 1SHWB 2NMOA 4M3CE 3KZ4C 3VDDC 1XYOA 1UPIA 1LEMA 1W8WA 5A70A 1QJY1 2RVAA 1EV12 4QAWA 4ZU4A 2ZKNA 5ACA3 2D97A 1QJX1 4DB5A 2VE1A 3LAGA 1QQP3 4MOAA 3OEAA 3P1IA 4QHOA 3ME2A 2W39A 3A7QA 4OYUA 3H9AA 5GM0A 3WG4A 1OBNA 1PO22 2XLAA 3M3IA 1DHKB 3VD4A 2GMPA 3I59B 4GWIA 3E5UA 4XZPA 3ZKYA 1U5ZA 3BIEA 3C7GA 1X36A 2WNUC 4IGQA 3HNBM 1RHI2 1YNAA 4CCMA 2VTFA 3PJYA 2ZEXA 3LFIA 4EQVA 3DKWA 4LBMA 1I1EA 2D6NA 3ST7A 2FDJA 4HK8A 4JAAA 2K0GA 1LU2A 3THTA 3BU7A 3CJXA 4XXPA 1UIKA 2G19A 5C8WA 2JX9A 5D8AA 1SPPA 3O0XA 5FO9B 5KC6A 3GNEA 1M06G 1AL22 3OBZA 4RHV1 1NXMA 1FYUA 1SBDA 2ID4A 2VBDA 1D2QA 1BVVA 1H4GA 2MNGA 1W0NA 2Q4SA 2R30A 2WFF3 2WYFA 4GMP0 1UKRA 4WM7C 5GLTA 2DV9A 2JG9A 4LIVA 4BM8A 4C90A 4CCNA 3H1YA 1BZWA 1ZBE3 1W8FA 4WZFA 5I0DA 3I2DA 3MIFA 5FYIA 2H6BA 5CBLA 4XJUA 3UNPA 4AI9A 1Q8QA 4DFSA 2A6YA 5C8CC 4QX2A 2K46A 1YQ6A 1IHMA 5FZ3A 2D40A 5JMCA 3HJRA 1YJLA 4OHXA 4AQSA 2JEMA 2J1AA 1AXKA 1GUIA 4DUWA 2ERFA 1RUE3 3DF0A 3LSEA 3ZFFA 1OC1A 2J1EA 3PVEA 3WQ1A 5JXGA 1FV3A 5FFOC 1UX6A 3MO4A 1J58A 1OOPB 2HBUA 4AEKA 5J37A 1S0IA 2JIJA 4D94A 2ZGUA 5DABA 1Y3TA 3N35A 3OBTA 2FZ1A 2YC0A 5EP9A 1H8TB 1ZZ6A 5JVVA 4E2QA 1WUVA 1AYM2 1S0EA 1PMJX 4YM0A 5GLVA 1D0HA 1O8SA 1LJ7A 1JYVA 2PLV3 1BLZA 1T6BX 3I49A 1XU2A 1VBE3 1OQ1A 3FE5A 3RZHA 1HKDA 3L2HA 4QKDA 1XE8A 2Q8OA 3GYDA 5JSOA 5JXHA 5IK4A 5FZDA 1JODA 1H1IA 4IW3A 4LO8A 1ULFA 1BJQA 4MH0E 2IVIB 4P5HA 3ZYPA 4AL9A 3ACFA 2ZGOA 1Y4WA 5F3GA 1LRHA 3HN1A 3IPVA 4GA9A 1QJEA 4MXVA 1XNCA 1AR93 1RUH2 4AI2A 2LW8A 4AXOA 2WBKA 4BYYA 4EV0A 1N3QA 1LHUA 2BWCA 2D6LX 3NAPC 5LASA 2BEOA 5GZGA 1EP0A 4Q26A 3WNOA 1KDMA 3ORJA 4AFBA 1W06A 2G9GA 5K8SA 3GBWA 4GJYA 1Q56A 2Y64A 5AC93 1O3TA 1A34A 4N53C 5FRAA 5A7OA 3SKVA 3Q9OA 4L0PA 5JSPA 4Z1VA 4BA6A 1PK6B 4A4AA 4LA2A 5BNQA 1LB2A 3M7AA 3S30A 1BBT2 3K51A 3TN91 4FQZA 1PIV1 5EPAA 4AI8A 2JDHA 4RN5A 3MIGA 5A7WA 3T2PA 4E8CA 5FWJA 3FMGA 4Z92B 1QJFA 2XJTA 3FUQA 3WNXA 1GWKA 2R063 3FFZA 3RWKX 4AVVA 3U4SA 4D0QA 1APNA 2JB4A 2RR12 5EV7A 4Q0VA 4YZ3A 4UOJA 2W1WA 2FCUA 1W8HA 2RM21 3WNKA 1NZCA 1RUNA 2ADDA 2A6ZA 2VW1A 4L97A 4CSWA 1LOCA 4JGYC 1LOGA 5SV5A 2J22A 1FMD3 5FY7A 2XG3A 4Q4X1 3H1WA 4XYXA 1X8EA 1TME2 2A7AA 2ADEA 1RUG2 1GR3A 3LF7A 3UV9A 3P3PA 1QJU1 4IEXA 1G86A 2DVFA 1UY2A 1O6UA 2PHLA 5CYYA 4Q4V3 1QF3A 1L7LA 3H7JA 4DIQA 4UXAA 3KS7A 2TNFA 5H9RA 1YHFA 4YPJA 4QX5A 1WLTA 3FN9A 3NNGA 3SCGA 4AF9A 3PUSA 3E1F1 4A7YA 2HWB1 1W28A 3APBA 2WUHA 2Y6LA 4Q4Y1 5I8SA 4UFKA 4UW5A 2B45X 1CZSA 4XUNA 1G9DA 1HW5A 2E51A 5FQ0A 4NIIA 2MEV3 3ZXAC 2X10A 1ZZBA 4KBZA 4OUEA 1JXNA 3LKJA 2ZAAA 1KFUL 3W9AA 4BQYA 1ZA4A 2W5FA 5LCWL 1J3QA 4Y20B 4NO4A 4QPIB 1W05A 4EWAA 2DTYA 3M4FA 5G04L 5A7SA 5C33A 4K40A 5A3OA 4MZUA 1E57A
chains in the Genus database with same CATH topology
3AYDA 1RUC2 1D2SA 4Q0UA 4OHYA 3JQXA 4LBQB 1AF9A 2B9UA 3W58A 5FMOS 3WP5A 3QH7A 1TNRA 4D7YA 3TRSB 1RGSA 5AVAA 1POV0 3EBRA 5A33B 3VBOB 3GBGA 4RSUA 1IKPA 3V0BB 5J36A 1EPWA 3M1HA 2RS31 4IEYA 4S2GA 4NOTA 3VZLA 4FT8A 1MS5A 2I2SA 3GALA 2WC2A 4JTNA 3FX3A 1PGL2 1VBC3 1CPNA 1AR72 4BWOA 3L9JT 2C9AA 3AZWA 4BLIA 4E4DX 4XBNA 1RUD3 4E4ZA 1YIFA 1SACA 3ZXLA 3M8LA 2CNAA 3VDDB 1OOPA 1PO13 4EROA 4FTBA 4MXWB 4XILA 1UU6A 1BKZA 4QU2A 5CG8A 1ZNPA 1H8TA 2HWC3 2PHXA 1AVBA 2DCTA 3VN4A 4I3GA 2GALA 1YI9A 4M0HA 3FFQA 1DQ2A 2WNUB 4S2FA 1I3HA 4J1WA 1TNFA 4K1ZA 2D5HA 3PLQA 2PAMA 2B39A 2ZZQA 3B01A 3WW1A 2CGNA 4LHNA 4ASLA 3PVNA 4U2AA 1EAH2 1C5IA 5KXEA 1TMF1 3AFKA 5FLHA 5LK7B 1QXRA 2WINB 3NKTA 5KXBA 1MEC1 4QD2A 4AW7A 1PVC1 3ZPYA 4R9DA 5I93A 1ZBA2 3RZZA 1R083 1H8VA 2GC1A 2PA7A 1U12A 3R4UA 2VPVA 4IETA 2YPJA 4KQ7A 5C8CB 3WOGA 2QKDA 1MS9A 1NLRA 1C1FA 3KT1A 4L2NA 3PJQA 3GZUC 4MVTA 1PK6A 3FUOA 4N90A 2HWF1 4TWTA 3AMMA 1SCRA 3OD4A 4BZ4A 5GJ6A 1SMVA 4HLTA 4Y1XA 3WDVA 2CGOA 1D4M2 5JIAA 2Z42A 4YGBA 1T6GC 3MIDA 1ND3C 1BYHA 4AQ2A 1VRH2 4Y26A 2WZR2 4UW3A 5DZEA 3V56A 4H7MA 1F9KA 2CL2A 3WDWA 1XXNA 1GV9A 2W08A 3HR9A 2TEPA 3WLUA 1N1YA 3WQ0A 1PGW2 3JZVA 4CDQB 3ZO0B 4WM8C 2OZ6A 2ZMLA 1OA4A 2ARBA 2NMNA 4C1WA 5JAXA 2CWSA 3ZX7A 2CY6A 2YGMA 4AI1A 1U5XA 3NW4A 2YV8A 1S0FA 4AFCA 3WHTA 3WDUA 2HWD2 4EWEA 1DIWA 3VBSB 2RS11 3NAPB 4ISRA 4YZ4A 3ZYJB 1LULA 5BNPA 3BB6A 4AFAA 4BPZA 4D69A 2BBVA 3WG1A 1VJ2A 2GMMA 3E5QA 2EIGA 5CNAA 4AEDB 1JN2P 3CO2A 4LE3A 2YZ4A 3TYJA 3WQ7A 3AKSA 2XWBB 5DDJ3 4G3YC 4BQ1A 2R043 3EQEA 4ITCA 3WR0A 4Y20A 1PHMA 1PO21 5T50A 2JG8C 4OUSA 1MVEA 2E7TA 4IESA 2VGDA 1HDKA 2VQ0A 5HXVA 4AGRA 4LBQA 1UZYA 1BEV2 2AREA 1WD3A 3HQXA 2BWAA 1F5JA 3ZSKA 3OGJA 2O8OA 1LGCA 4LA3A 2OA2A 3WDYA 5A33A 3S6PA 3VBOA 1Q8SA 4SBVA 5CA6A 4RS5C 3B93A 5T5LA 4L99A 4MYEA 4JGYB 1YXWA 3E6BA 3NV2A 2DVDA 5JOZA 3VGIA 4XFFA 4HPKB 1W6NA 4NWVA 3OY8B 3WUCA 5C9AA 3VDDA 2QZ2A 4M3CA 4FBFA 2ZHKA 3QBQA 5L7OC 1ENRA 2QUOA 3A4UA 4GIQA 4UW4A 2CV6A 1QH6A 1RUI2 1G9BA 2VG9A 3VBHA 2WNUA 4OHZA 1HXS2 2D44A 4DINB 4JGZC 1G8WA 2YMZA 1FI2A 2NQYA 1S0JA 5GZFA 3ZN5A 1JYIA 4DXZA 1O5LA 5FTTC 3JD73 4HN1A 5AFBA 4CP2A 1OMIA 4HKLA 1AYM1 1X7NA 3MW2A 5I0SA 5JOYA 1XYPA 5A32A 4I0WB 2D6PA 2W52A 4PQ9A 1QNWA 3TWIA 1W2UA 3OF1A 4WM7A 1C8M2 5GZEA 3E5XA 1V6KA 4AFMA 4XIKA 4YW4A 3DV8A 2AGSA 1W6QB 1YFUA 1N3OA 2WS92 4I0BA 5C6CA 2QNKA 5BNNC 5C8CA 1NXD1 3H8UA 1XE7A 1N1VA 5J96B 4PIZA 4Z92B 1RUH1 5F1RA 1MACA 2EF6A 5KHJA 3CJIC 5H9QA 2XJPA 4Y5Z0 2WLQA 5KBFA 1QJY3 4XETA 4XF4A 3DPRC 2VUAA 2EAKA 3H3ZA 1ZYBA 2D3RA 1YFXA 3URFA 1HQNA 3WX5A 1BBT1 3W59A 2XKPA 1OSGA 3B9IA 1LODA 5DXDA 4G4FA 4CDXB 4JDOA 3MYXA 2OUJA 3MLKA 4YW1A 3BOPA 3VBRA 1DFQA 1H9WA 1QDOA 1SFYA 2DCKA 1AX2A 2RR11 4MLOA 4RHV3 2UWAA 3AMPA 4OZXA 5JLVA 2JENA 1Y9QA 1LOFC 1ULGA 1AR61 3D82A 1QOSA 1FOD1 2RMU2 2ZPXA 3MI8A 3AMQA 1C3HA 4V1PA 1TME1 3NAPA 1Y43B 3C2UA 1QQP2 2UYBA 4HKWA 2QDNA 4BLJA 2HWE3 4YG0A 2XJRA 2A3YA 5T5OA 4N53A 3RMYA 2H6CA 3NJZA 2P17A 2GMEA 3BODA 1DQ5A 4COZA 1DQ4A 2R16A 3IMNA 1GBGA 1YO8A 3VZNA 2JKBA 1BMV2 2VUJA 4XF9A 5IK8A 3VHPA 3AP7A 2A5ZA 2HYKA 3UKTA 1ENXA 1JTZX 4ATEA 2CAVA 4B7KA 2VVFA 1WD4A 2ZX0A 1WW4A 1ZBE2 2Q1MA 1RUC1 3HMYA 2R6QA 4FO9A 1KRIA 4JGYA 4UBGA 5IK7A 1QJZA 1AJKA 1DQ6A 1LR5A 3AKTA 4J6GA 5CB7A 2XLGA 1I9RA 2QZ3A 2WNVC 4QQHA 1FX5A 4HPKA 1FXZA 4JDNA 5F6LB 4FPJA 1RUE2 3OY8A 4KG0A 3B69A 3BTAA 1F8VA 1YIPA 4Y1UA 1PGL1 3JUUA 2LM3A 4CP0A 1W6OA 5GALA 3WP4A 4AWDA 4XDQA 3EO6A 1N1SA 1Q8OA 1LESA 2B8MA 3AZVA 3SCFA 5C8WA 5JIUA 3ZIWA 2RHPA 4XF1A 1BVP1 1RIRA 2DU0A 1RITA 2GN7A 2X5IA 3O12A 2ARXA 3SXWA 3TN93 1PIV3 3ZSEA 4W6WA 3WW4A 1VBE2 4XOGA 2JG8B 5JPNB 3D0JA 1ZVFA 3VLBB 2E7QA 2AZ5A 2RJKA 1VBB1 4FCAA 1FNZA 2RM23 1MZFA 1NCRB 1MQTB 1SCSA 2VNOA 3S0MA 2RE9A 1OPOA 2E6VA 1KJRA 1S0BA 4Q4X3 2ZACA 1NY72 1DF0A 1QJU3 1TQ5A 2Y26A 1WW6A 4QXKA 5AC92 5FO7B 5JDBA 4X6RB 1BXHA 2PAKA 5KC5A 2A71A 4FPGA 3ILNA 5GLZA 5J3UA 4LT5A 4GALA 1A8MA 2DUQA 2I07B 4QMAA 4EN0A 4O9GA 2HWB3 4Q4W1 5L7OB 1MS0A 3ZYGA 3BCWA 3SNMA 4XXAA 1DZRA 2CWMA 2ZHLA 4K9SA 2IFRA 1S0GA 1YFWA 1GSLA 1MS8A 3AXEA 5BY5A 5H9PA 2Q30A 4CEYC 1RB8G 4B4PA 4JGZB 4F3JA 4CTEA 1CVNA 4MGYE 1UU5A 3WVJA 4FPOB 1A6CA 1FMD2 5JWPA 4L8QA 4X8NA 1H4HA 4HSLA 1WBFA 4B4QA 4YG3A 2ZABA 3PVOA 1UAIA 2GN3A 1PGW1 2UWCA 4MV2A 4S2HA 2RS33 4AHWA 1CAVB 3AZZA 5CU1A 4AI0A 3JB4C 5I0UA 5FOJB 1ENSA 2ETEA 4XTPA 4COVA 1QHDA 2R1BA 3ZVXA 5BNNB 4KGGA 4CRQA 4EJRA 1ASJ2 3NSTA 2WT2A 2MEV2 4ES9A 5CG9A 4YVSB 2HWD1 3CJIB 4Q27A 1O4ZA 2A70A 3RYKA 2XVGA 2ZX1A 3D0SA 3S7IA 2C1FA 2DF7A 1SLLA 3QD6A 3DPRB 3OCPA 4LNVA 1NOVA 5K7PA 4IEOA 4M00A 5T5JA 1HV1A 1C57A 2ZA9A 4DMIA 2PAEA 1JUIA 4GB33 1ND3A 4LBKA 2WFPA 2D98A 4P9WA 3KB5A 3OGGA 1V9U1 4QQOA 4UBHA 1CN1A 1NA1B 2B7YA 1BEV1 1S0DA 1TMF3 2A6XA 3TNQA 4WM8A 1COV1 2B5HA 3WP3A 1HRV1 1VBC2 1MEC3 5IK5A 2WWSA 2P2KA 1ENQA 1PVC3 3FLRA 4MGZE 3I8TA 3LWCA 4CDQC 1RUD2 1W39A 5JOWA 2VQAA 4YW2A 1GQHA 2VOWA 1WGPA 1CAXB 1CAUB 2BPA2 4P9IA 2ZOEB 1RC6A 3I7DA 1UL9A 2QE3A 3I54A 4WVMB 3VBSC 4XQ4A 5FLJA 3MZHA 2HWF3 3PTYA 3D6EA 4WVWA 4AHYA 5SV8A 4AEDC 1HV0A 2VOVA 3HBZA 3ZXGA 2JG8A 2XJSA 1ND2A 1UIJA 4K21A 1HXS1 2FQPA 2E63A 5DUUA 2OPKA 3B94A 2DFCA 4UW6A 1IQAA 3B5LB 3SMHA 2XBO2 1QKQA 2DU1A 4PLOA 1FAYA 3VKMA 2BVBA 2OZJA 1QY4A 4FXGB 1MVQA 3J8F3 4IEPA 2PTMA 1RTVA 4RS5A 1ZRCA 1C8M1 1DU3D 4FOWA 4FPHA 4J1XA 3UKNA 1ZRDA 1LTEA 1JHNA 1PGSA 2WNVB 3L2YA 4RQPC 5EJ3A 2XVKA 2D5FA 1S1AA 1R093 3AKQA 2D3PA 3MICA 5ABJC 3IDEA 5L7OA 1BK1A 2I45A 1FT9A 4LO4B 4XFIA 2WL1A 4YYOA 4AFDA 4BIOA 2CGPA 5K0UA 1KXGA 3BOWA 2BNNA 3AM2A 3AYEA 2EXIA 1POV1 2WA4A 1YJKA 2IXCA 1UF2C 3RI8A 1PO23 3JU9A 2VU9A 5BNOC 3AK0A 1AXYA 1Z7S1 3ROUA 3I59A 2BW8A 2XL7A 4HETA 3WW2A 3HT1A 2CTVA 2QFEA 3MDPA 2NYYA 4XF3A 1WCSA 1BQPA 3BIWE 5L19A 4YGCA 3FWEA 1X82A 2V5YA 1CAVA 4CEWC 2DUOA 4OI4A 2ZGLA 1C5HA 3HT2A 1CESA 2GH2A 1ZX5A 5BNNA 3OBRA 3FC0A 2VNGA 5JI7A 3MW4A 3M3EA 3TNPB 2RMU1 5JCTA 4DNYA 3H1MA 1DQ1A 3NV1A 4PF5A 2P3JA 3ZN6B 2IXKA 1QQP1 2R042 3RPQA 1PNFA 3FLTA 4KH9A 2ZKLA 3DPRA 3LOIA 5T5PA 3ECQA 1RVF2 1VAKA 1CPMA 2DVGA 1VBD3 3ASIA 4FP2A 1IPJA 4Y1YA 4YFZA 2ZGMA 3NV4A 4CDUC 2YROA 3POSA 1HRI2 1DGWA 3O14A 3AB0A 4RD7A 1ULEA 4HK9A 4N43C 4CEYB 1IGOA 2BTVC 1WCKA 3VBUB 2VNRA 4META 4OI2A 4COYA 3JBG1 5BPXA 2LUWA 4U36A 4H3WA 3LA2A 4CDXC 1G6NA 1ZBE1 2GNDA 4Q0SA 1W0PA 2WJSA 1LOFA 1C28A 3FHIB 3MFCA 2PHTA 3VBFC 4ZU7A 3E6DA 4BHPA 4B3NA 3TBDA 4BMEA 4MGKE 2NZ9A 1CAXA 4FOVA 1CAUA 2JXAA 3CLPA 1RUE1 1QGLA 1DGLA 1KS5A 2K9ZA 4WVMA 4HSJA 3RNSA 4PIXA 4YM1A 3RJRA 3ZXKA 4TYSA 3CL1A 4E9KA 3CF6E 2QQPA 4Q0PA 3MPPG 4LBJA 4ONUA 1O5UA 4XJZA 2HJIA 3T1LA 2ZX2A 1BBT3 1OFNA 3GBFA 4IV3C 3OPZA 1J3RA 1OA3A 1VBE1 4IV1B 1IS3A 1H0BA 4JQRA 1S55A 2X8KA 3MIBA 5D8AC 2B42B 2SLIA 3PNAA 3WDXA 4YM3A 1GZWB 3LA3A 1PVXA 4HBNA 3VL9A 5L73A 2JG9C 4OVEA 4R9BA 1GZ9A 4X6QB 2RR13 4H55A 4O9EA 1FPN2 1JUHA 3P3NA 4COWA 2WNVA 1IS4A 1AR63 1REFA 2UWBA 2QJVA 3IKWA 1A8DA 1FOD3 4RR3B 2XJVA 1OKQA 1QJY2 3NL1A 1TME3 1IKQA 3U10A 4JCKA 5AC91 3ZFGB 1Z78A 3ZMNA 3ZFFC 4AHZA 2MHFA 5CVRA 2O0OA 1UN1A 2ZGSA 2BNMA 3M70A 5HBAA 3UJOA 2UY8A 3MFAA 1ZRRA 4K3UA 4A2UA 4Y1ZA 1JYCA 4FP3A 4AEJA 3NO8A 3AXDA 5J98B 4XJ8A 2WSVA 1V6OA 1O3SA 1SLIA 2ZMKA 2DCYA 1EV11 4PDWB 4QPGB 1A3KA 2GNBA 3IWZA 4GH4C 4Y4YA 4HZFA 4QPIA 5FPXA 4FXKB 2GNMA 1RUC3 3U07A 2XVLA 1FMD1 1RHI1 1RUF2 3B7MA 3QH6A 2NN8A 3FBMA 1CIWA 5T54A 3THPA 4QPYA 2RS52 1CR7A 1TE1B 5LRSA 2PN5A 2HWE2 3FLPA 2GAUA 1NCRC 1MQTC 2VMIA 4Q8LA 4ORFA 3V0BA 4X8PA 1RMU3 1AL21 1REDA 1SEFA 1CJDA 2AENA 4RQPB 1XQNA 2HEWF 1NCQC 4XMIA 1PM7A 3OD0A 1B35C 4XHBA 4GWMA 1ASJ1 2IXJA 2MEV1 1AR82 1R1A2 5ABJB 3H7YA 1KITA 4FPFA 3J9SA 4EN7B 4Z07A 4E2SA 2ES3A 3O0VA 2OVUA 4MXWA 4KWKA 4XE9A 3HWJA 4Y1VA 4TSVA 2E9QA 4CEYA 2WQZC 2LTNA 2RJLA 4ISQA 1JOJA 2D6OX 4IL7A 1AHSA 4EN6B 5BNOB 2XH6A 4QQLA 2JICA 4AYUA 3POYA 2EALA 2X53S 1VBB3 2XHKA 3ZFEC 3AZXA