5J3UA

Co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
261
structure length
261
Chain Sequence
VYEKDEGQKEQLERILRQSFLFNSLDEKDLNTVILAMQEKKIEASTCLIREGDDGECLYIVQSGELNCSKLIDGEERVVKVVGPGDAFGELALLYNAPRAATVTSVSACDLWELGRDTFNAIVKDAATKRRSMYDSFLKSVHILDGMDAYERGKVADALRTEMFTDGAYIVRQGELGDVFYIVEEGSAVATKSFGPGQPPIEVKKYQAGDYFGELALINEEPRAANVIAHGICKVACLERKSFKRLMGSVQDLLSKKASEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-crystal structure of the regulatory domain of Toxoplasma gondii PKA with cAMP
rcsb
source organism Toxoplasma gondii
molecule tags Transferase
molecule keywords Protein Kinase A
total genus 75
structure length 261
sequence length 261
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j3uA01
4XFAA 1O5LA 1QXRA 5BXXA 4H7LA 4YARA 4Q29A 4MZUA 4GULA 1EYBA 3H1YA 1FT9A 3WW2A 4F7ZA 4AVBA 4XF9A 3BALA 4P9GA 5F1RA 4KL1A 2GC2A 4PIZA 4X6QB 2PHLA 3KGZA 3LA3A 5FLIA 3D82A 4I0AA 3CO2A 4HBNA 4XFFA 4N9HA 2IXLA 2ZKLA 4MX3A 5E16A 3FFQA 4YYOA 3SHRA 1CGPA 4HN0A 3CL1A 4HVOA 3U0ZA 5KHKA 4KU8A 1NXMA 1WGPA 4IEVA 1Q3EA 2XHKA 1O7FA 1ZZ6A 3BU7A 4LLOA 3H7YA 5FLHA 1QY4A 1RC6A 4J1WA 5JSRA 1CAUB 2GU9A 4LUKA 2MNGA 5JSOA 5KHGA 2PHDA 4Q0QA 3DL3A 2EAAA 4LTAA 2IC1A 4A2UA 3CLPA 3OF1A 2XLGA 4QMAA 5KHIA 1DZRA 3RYRA 4PIXA 1LKNA 5JR7B 2D5HA 3E5XA 3D0JA 2CV6A 3GBFA 1O3TA 5J48A 3SXWA 3ROUA 3E6BA 1J58A 4UBHA 4LA3A 2F4PA 3NJZA 4CYDA 1X82A 4K8FA 5JSPA 1FI2A 4HZFA 4MH0E 2O1QA 4BHPA 1H1MA 2PA7A 3BCWA 2HJIA 1X8MA 2MPFA 4I3PA 4HN1A 4FAHA 4AVCA 1ZZ8A 1ZRCA 1NE4A 2FQPA 5FCCA 1PM7A 1XRUA 2XKOA 3KSCA 3NL1A 3TNPB 5FPXA 2QNKA 5EZWA 4E2QA 1L3JA 4B29A 2IXHA 1GQGA 1YFYA 4EWDA 4EROA 3H50A 3PNAA 3FE5A 1ZX5A 3SCHA 4EV0A 1CAWA 4R8HA 3IDBB 2I45A 4YRDA 3E6CC 1RGSA 5FDBA 1IPKA 1NZCA 2XL7A 2QVSB 4QGMA 5I0UA 3D0SA 1J3RA 1QWRA 3N4MA 1J3QA 1O5UA 2IXIA 1RUNA 3HQXA 3M3IA 3U10A 2VQAA 1I5ZA 1CX4A 4I02A 4XFHA 4ONUA 4FAGA 4AQ2A 3I59A 4QM8A 1SFNA 3NSTA 2ZCWA 2GC1A 2ETEA 3RZZA 3O14A 1CAUA 2Q0AA 3H3UA 3RDIA 5AVPA 2GC3A 4L2NA 4OFGA 5E1RA 4HSLA 3ACLA 3HT1A 1DGWA 3FZ3A 4I01A 2OZJA 4HVQA 2PQQA 1OFNA 3CJXA 3OCPA 3CF6E 3H3ZA 4XETA 4D7SA 1LRHA 1ZZ7A 1O3QA 1EY2A 3RNSA 2OPKA 2Z2SB 1EPZA 1OI6A 2H0VA 1RUOA 5CU1A 3E6DA 1LB2A 3U11A 5I91A 5I0TA 2Q30A 1ZZ9A 4LEJA 1DZTA 4XF3A 4HVRA 1UPIA 1X8EA 3OGJA 5FQ0B 2PYTA 4MGYE 4PIYA 2BNNA 2MHFA 3FJSA 4YSFA 4ORFA 4MGZE 4QXKA 4XFGA 3UKNA 3ZDSA 4ZU5A 2GAUA 4ZU7A 2E9QA 5HI0A 3I7DA 3KMHA 3KGLA 3S7IA 4IEWA 3EBRA 4KWJA 4UXAA 1ZZBA 4XEZA 3I59B 4HSJA 4IEOA 3RPQA 4I2OA 3H1MA 2IXCA 4Z82A 4MUVA 3H7JA 1ZVFA 2VPVA 4XFBA 3G7DA 2H6CA 2P17A 4Q0SA 3LZZA 1ZREA 3PLQA 4EWEA 4TLFA 3HT2A 2UY9A 4Q0UA 3SCGA 5J3UA 1VR3A 2O8QA 4KWKA 4QM9A 4AVAA 4DINB 3MDPA 3RYKA 2FMYA 2PFWA 4NVPA 4D7TA 2B9UA 4N9IA 3IBMA 5BUVA 2HKXA 1ZNPA 2PAMA 4BH9A 2D40A 1TQ5A 4F8AA 4IEYA 2BNOA 3H1WA 1CAWB 2CGPA 1G6NA 2C0ZA 3WW3A 3E97A 3EHKA 1CAVB 4WBBA 5I0SA 2UYBA 4E2SA 1U12A 5KHJA 1YFWA 3ST7A 2ATFA 2IXJA 2UY8A 1YWKA 1SEFA 4IERA 1RL3A 3SCFA 2GZWA 2BGCA 5BV6A 1HW5A 5I8TA 2D93A 4JTNA 4R52A 1YFXA 4META 1O4TA 1ZRFA 2GC0A 2OYZA 5I8YA 4FBFA 1J1LA 4IEQA 1IPJA 3H8UA 2D5FA 4IEUA 4FT8A 4HMZA 4PJYA 1J3PA 2BYVE 4QGNA 1JUHA 1J59A 4LUMA 1QXJA 4Q0VA 1UIKA 3OTFA 1Q5OA 4MGIE 3LWCA 3SMHA 3UKVA 3EO6A 1X7NA 4JVAA 2OZ6A 1UCXA 3JZVA 4BIFA 5T3NA 1YLLA 1SQ4A 4I09A 3PVBB 3RYPA 5JAXA 2PAKA 3M70A 2GH2A 2Z69A 1ZRDA 1O3SA 1NE6A 2XL9A 3WW1A 3HIFA 3B02A 2N7GA 4QGLA 1O3RA 4XF0A 3USSA 1VJ2A 1OD5A 4XF1A 3R6SA 1Y9QA 4MGKE 5D1IA 1XE8A 3IIAA 4LA2A 2ET1A 4IEZA 5LRSA 2CAUA 3IDCB 4Z07A 3MYXA 2XLFA 2Q1ZB 3FX3A 3TNQA 2KXLA 2V09A 3DV8A 4E2GA 5C6CA 4LULA 2BEOA 5LEJA 4L11A 3MZHA 1CAXA 4RD7A 1OMIA 2WFPA 1YUDA 2VECA 2Q4SA 2Y0OA 4KWLA 3LOIA 2QJVA 4AXOA 2UYAA 3KCCA 3QACA 1VP6A 1FXZA 2XKPA 3S7EA 3DN7A 5LEKA 3BB6A 5BY5A 3ELNA 3NVCA 2IXKA 2OA2A 5CVRA 1UIJA 3CEWA 3E5QA 1XE7A 1UD1A 3LA2A 4UBGA 3DKWA 4XF4A 3MPBA 1DGRA 3LA7A 4EWAA 1LR5A 3UKTA 2H6BA 3NKTA 4AQ6A 2QDRA 1WLTA 5FQ0A 1NYWA 4J1XA 3ES1A 3GYDA 2B8MA 3EJKA 5K8SA 4OLLA 4XFCA 4ZU4A 1H1IA 3FHIB 5CADA 3ETQA 2BNMA 4HLTA 1YFUA 1CAVA 4IEPA 2XLAA 5BPXA 1YHFA 4I0BA 5I8SA 1ZZCA 2EVXA 3OD0A 3E5UA 2PAEA 5I0RA 2ET7A 1UW8A 1CAXB 4WVZA 2WC2A 4WZCA 5J7MA 2DCTA 4O9EA 1I6XA 1ZRRA 2XGXA 4QX5A 3H9AA 2PTMA 3FWEA 2K9ZA 5FPZA 5FLJA 2EA7A 1WA4A 3EQEA 2CAVA 3LAGA 1Y3TA 1EP0A 1Q43A 3C3VA 3L2HA 5KHHA 2K0GA 3S0MA 3WW4A 5KBFA 4IETA 4JV4A 5JCTA 4MV2A 3IWZA 5LRRA 2QCSB 3QOPA 4XFIA 3BPZA 5I93A 4IEXA 5C8WA 3NW4A 4BYYA 4IESA 1RTVA 1V70A 2B5HA 3ES4A 4KU7A 1PMIA 3VHRA 4Q0PA 1GQHA 3I54A 4O9GA 4X6RB 5EFUA 4YNIA 4JTOA
chains in the Genus database with same CATH superfamily
2P6CA 4FPFA 1O5LA 4A42A 4XACA 5JMOA 4Q29A 4QB2A 4WM8C 4BQXA 1A6CA 1ND3A 1CR7A 4GULA 1K12A 3WW2A 3BYWA 1ND2B 2RS51 3ZFGB 1CX1A 1CPNA 4IV1B 2RDQA 4P9GA 5HXMA 5DZFA 5JOYA 2W1WA 1RMU1 1COV2 2ZJCA 1V9U3 4J6GA 3GGLA 5C71A 5B4XA 5F1RA 2B9VA 5F3EA 4HONA 2GC2A 4CZSA 3VDCA 1MZEA 2R042 4KI5M 2MEV2 3KGZA 1S4CA 4X6QB 2VTXA 1Y4WA 2DVBA 3VBSC 2QFEA 4BM8A 2JE7A 2QQNA 4NHXA 3ZYFA 1ND3C 2JDUA 1SZBA 2QQVA 4N9HA 2EIEA 3RZGA 1W8NA 2YU2A 4CE8A 1W9WA 2E53A 5GLVA 1COV3 1JOBA 4OHYA 3WP6A 2VBPA 1W6OB 5IVJA 3D8CA 3CKHA 1QJZA 1LU2A 1MZFA 1NAEA 2Y6FA 2VUCA 1C5IA 4QDSA 4N7IA 5A80A 2BVVA 2H0BA 2RM22 3LEMA 4AW7A 4IEVA 5H9SA 4LJHA 3RZLA 2WT1A 2XHKA 3K46A 4RHV2 1ONAA 2EAKA 1POV0 3PTRB 3V56A 4N53B 3OG2A 4XVHA 1UY2A 5D21A 1QY4A 2HWD2 4J1WA 3VKFC 4YVSA 2GU9A 2XH6A 4COZA 2OX0A 5JSOA 4ZZ8A 5KHGA 1G9CA 3LIGA 2OQ7A 1YI7A 4HXCA 2ILMA 4A2UA 2Q8CA 2HBTA 4HKOA 4FSJA 4LLFA 1HQWA 4OVEA 2BFUL 4UFJA 4XAEA 4XOGA 3VDDC 5IK4A 2XUEA 5KHIA 1W8OA 2ZX0A 4PIXA 4NWVA 1LCLA 2D5HA 3CDZB 3W59A 2CV6A 3GBFA 1PIV2 2XVLA 3MW3A 5FJKA 3WV6A 5J48A 1O3TA 5FJHA 3WG2A 2WNOA 3U07A 5FZ0A 1J58A 2VMGA 3AP6A 4CUAA 4N43A 3AMHA 2VCAA 4YG0A 4YZ1A 2EXIA 4GKYA 3ZSJA 4CYDA 3K3NA 4HZFA 3QCWA 4MH0E 5G05L 1H1MA 4BHPA 1B35A 2W52A 5A3WA 3LE0A 2C24A 2DBNA 4RSUA 4HN1A 1JMUB 3JCIA 4AVCA 1ZRCA 2KM2A 4K1ZA 2HH9A 1PMHX 2X5IA 1RHI2 3AXEA 3KSCA 1RUI2 5FZ1A 1CQ9A 2QTWB 2UURA 2YYOA 3UK9A 4BQYA 2VOXA 4BLIA 3AL6A 2WNEA 5EZWA 1LOEA 1FOD3 3WDWA 4CU8A 1GQPA 1JOJA 1WLCA 4P00B 1D2QA 1L3JA 1GQGA 1YFYA 2O8OA 4MOAA 4ET7A 2SBAA 3M1HA 4EWDA 1YIFA 1F8VA 1ZX5A 4V2VA 1MS4A 1CAWA 1TME3 3WNXA 1JTZX 1CPMA 3RJ2X 4CCNA 3UJOA 1RGSA 1IPKA 1FPN1 2GSYA 2QVSB 4YVWA 3ZVXA 4JC1A 4Q26A 4FPJA 3WUCA 4LBQA 4ATEA 3H3LA 1JYTA 1NLSA 2HWB2 2X5IB 4MYEA 3ACFA 2LROA 1RUNA 3HQXA 3M3IA 1QNWA 3U4XA 2VQAA 3OGVA 1OKOA 2VMHA 2RS13 1ZM1A 3GM8A 4WVVA 5F3GA 1REFA 3WF2A 4Q4V3 3GZUC 4H3WA 1GSLA 2EICA 3AKSA 4FPEA 4RGGA 2ZX2A 5FPVA 3TWIA 4CDXB 4P08A 2P3YA 3A22A 4DOUA 1PVC3 3FC0A 3Q8CA 2PLV2 2NPIA 4IE4A 3ZN5A 3ZDVA 3T2TA 2GP3A 3AMMA 2OVUA 2ETEA 1V6KA 3H3UA 3PHMA 5AVPA 1GYKA 4QWNA 4ASLA 1AL23 4L2NA 1ZBA2 2BP6A 5FUIA 4HSLA 5FPBA 2JIJA 2JDPA 5FZ8A 1YQ6A 1JYXA 5FK7A 2NM1A 1C1FA 2VQTA 1IKPA 2F17A 3FZ3A 5T50A 4HVQA 5HV4A 5FXZA 1JHNA 4XQWA 1JBCA 5IVBA 4UW3A 1DGRN 3THCA 1LEMA 2WZR1 2NN8A 4BMEA 2IFWA 2JG9B 5J1XA 4ZZ5A 5A7WB 3K4DA 5FZHA 1R093 3OEBA 1OQDA 2VNGA 4M4RA 1O3QA 1W0PA 3BVCA 4R9CA 1LODA 1EY2A 4Q1RA 1GICA 3ZFFB 1Y7BA 1PZ9A 3N7JA 1S0BA 3ASIA 4JKKA 3VN4A 3ZIXA 2VZOA 5DDJ1 4R9BA 1LB2A 1QJY2 1HRI3 1VBC2 3LSEA 4NIHA 4UF0B 4RHV3 2R063 4RS5C 3SH4A 3U11A 1V6NA 5C3PA 4Z92B 2DCKA 4S2FA 1AL0G 4LHSA 4Y1XA 1EV12 1W6QB 4URTA 2WZEA 4QPGB 4D69A 4LBLA 2ZACA 1TMF2 1RUE3 4PIYA 1AR62 3RI8A 1F4HA 1ULOA 2MHFA 2Y38A 4QQLA 4R4ZA 3WQ0A 3N3HA 3I2OA 3PU8A 3SH5A 3N9QA 3BOPA 4QXKA 4QX7A 2VXJA 3I2DA 4PLOA 4K6BA 2HWF3 3ZDSA 1UPSA 1ZA7A 1RIRA 3ZFFA 3ZYPA 1V6IA 5BNOC 1RUC3 3TEXA 5IJRA 1SFYA 1FNZA 1UMZA 2Q1FA 3ZFGA 4YFWA 3EBRA 4QPIB 2BBAA 1ZZBA 5J98B 3OGGA 2JG9A 3I59B 4HSJA 4ZY9A 3I2GA 3VZLA 1UXXX 3WSOA 4CEWC 3RZKA 1S2KA 4JDNA 1HQLA 2IXCA 3CZJA 3H7JA 2A3YA 2RR11 4IUGA 2C26A 4QDRA 3IPVA 4A3ZA 1IS6A 2WO7A 1ZREA 2XDVA 4YZ2A 3ZFFC 2EXJA 4TLFA 3IDEA 3ZN6B 3LEIA 4IE0A 2PHTA 4XHBA 4V2WA 4Q0UA 4NRMA 2JD4A 2VR4A 2VZUA 2QQWA 1W28A 4UWDA 2HWD1 4QKBA 1UYZA 5FY7A 4GWJA 3TAYA 5G04L 5DABA 2FCUA 2WKKA 4AAPA 4LKSA 4DB5A 3D4KA 4YGCA 1OUXA 1ULFA 3ZFEB 4FOWA 2CWMA 4HK9A 3KHCA 3KF5A 4AHZA 5DAWA 1BEV1 3POBA 4K3UA 3N35A 5IYYA 4JGYA 1Y9GA 3RWNA 1KQRA 4BH9A 1EAH1 3HMYA 4GIQA 1TQ5A 4KQ7A 4ES8A 4F8AA 2HWB3 1KS4A 2VCCA 3ILFA 4TTGA 4RR3C 1CAWB 3J4UH 3LQCA 3URFA 3WW3A 1SLLA 2WAOA 2JG8A 3DYOA 3I8TA 5CKMA 5LBCA 1LHUA 1GOGA 4MGQA 2YG0A 4WBBA 5GLUA 2WBKA 4FFFA 2C4XA 2UYBA 5FFOC 5D8AC 5FREA 3TYJA 1RUF2 2ZZQA 4NR1A 4ATFA 3ST7A 3DXUA 1UU6A 1H2LA 2YV8A 3FLRA 4YM0A 4BPZA 1OC1A 4N8MA 5HBAA 1YWKA 1JS9A 1SEFA 3VZNA 1YCIA 1C4RA 1V0AA 2W08A 5FAXA 1I9RA 1VRH3 2BGCA 1G8WA 4PF5A 5FMOL 3JBG3 1HKDA 3VDBA 4CEYB 4XCAA 2QQPA 5FP4A 3U14A 4R52A 1YFXA 4XTPA 4AVTA 3PVOA 4CU9A 1STMA 4R9DA 1HB4A 1RUJ2 3QBQA 1O4TA 4OUMA 1NT0A 2ZGSA 3IMMA 1C57A 1ZRFA 4GWNA 2XJSA 2JG8B 2VU9A 4N43B 3T2QA 4NHKA 1SPPA 1LOAA 1W99A 4L9BA 1WBFA 1D0GA 1CD3G 1ZBE2 2ES3A 1HJGA 4FT8A 4G4FA 4IEUA 1J3PA 3VD3A 3O7OA 1SLTA 2OKXA 5EJ1B 1J59A 1QGLA 4Q0VA 4S2DA 5FZOA 1LHVA 2A1XA 2PHUA 1HB3A 3KCYA 1AJOA 5T5OA 3ZYRA 1AR93 3NRUA 4MGIE 2ZXQA 4UAPA 1FYUA 5LWBA 3K4ZA 3K48A 1FMD2 3UKVA 2JEMA 3AVRA 2VZRA 1KFXL 3EO6A 1LHOA 4JVAA 1VBD2 4LK6A 2B42B 1DIWA 2JDYA 3DUIA 5T3NA 1YLLA 3RSJA 3ZSEA 2VE1A 2GNBA 4A44A 3PVBB 3RYPA 5JAXA 3AX4A 4PF1A 1DF0A 4OQ9A 2ZGNA 3UJQA 3OPZA 2HWF1 2ZEZA 5CG8A 3DYPA 2WO3A 3MW2A 4P9XA 2GH2A 2JX9A 5E89A 2Z69A 3A21A 4QB6A 1FNYA 2DBIA 3KT7A 2EIBA 4LOSA 2VAUA 3K3OA 5FMBA 2XL9A 3SC7X 3USUA 1JZ4A 4ZS3A 3WQ1A 2R0HA 4QGLA 2N7GA 4MGSA 4YVWB 1OF4A 3FN9A 2HEVF 4YW5A 1JZ7A 1OD5A 4W50A 5FKCA 2DVGA 4FOQA 4PDWB 1KJRA 2E63A 5D1IA 3BIWE 2W92A 4LA2A 3ZPYA 1RMU2 1XQNA 4XIOA 3OY8B 3IIIA 4FPYA 5DDJ3 2CAUA 5BNPC 2OT7A 2Q1ZB 3HN3A 1OPMA 4CEYC 1U5ZA 3ZN4A 2V09A 1OSGA 2VCBA 4LKFA 1UU4A 3B94A 5FP7A 3UYJA 4MG2A 2Y6GA 4EE2A 2VGDA 1CZVA 1VBB3 5A3PA 4BU2A 5LEJA 5KXBA 1CAXA 3NWKA 1W2TA 5IK7A 4CDUC 2XOMA 5CFDB 3M3QA 1OKQA 3MEPA 5FV3A 2ZPXA 3LIHA 2W94A 4DRRA 2VECA 1AYM3 3TN91 1QMJA 2Y0OA 5I0DA 4Y20A 5FZBA 4D94A 2BGPA 3WX5A 2KR2A 1R1A1 3PDQA 1FXZA 3RVHA 4AEMA 3DN7A 4Q4X2 1MVEA 2R061 1NXD1 2WNUB 4MXWB 1HRI1 4IGPA 1N1VA 3IAPA 4IV1C 3WG4A 2WJSA 4AI9A 4RFRB 5CVRA 3CEWA 3WF0A 2J1EA 4QPYA 1SPPB 1UD1A 4ZPIA 4WM8A 4FTBA 2Y6KA 4XDQA 5HPOA 3AP4A 1YRZA 2HWE2 3MPBA 4EWAA 4YZ5A 3TEYA 1UZZA 4CCDA 2H6BA 3X29B 3NKTA 4B8EA 1WCQA 1S2EA 1WLTA 3KT4A 2BPA2 2GMEA 5T54A 4YGEA 4YWAA 3GHNA 4YW7A 1WA6X 1Y9MA 4CUGA 2B8MA 5T5LA 4OLLA 1JZ5A 3KV4A 1H1IA 1AL21 2QZ2A 2ZGRA 3OGSA 1HXS2 2XR4A 4FPCA 4QX0A 4AYUA 1GWKA 4Y20B 4CEWA 2A70A 4TZDA 2W0XA 4I0BA 2BV4A 2FCVA 4AGGA 4P9WA 4GB33 3AB0A 2EVXA 5GM0A 1UWWA 2HWB1 3TEZA 3E5UA 1PVC1 2VQUA 2J22A 1FV2A 2C9AA 5GLTA 4Y1YA 5EJZB 3V64A 1PK6B 1XU1A 3R0RA 2X09A 1NA1A 4CDWC 2VW1A 4WZCA 3VV1A 2JB8A 4H55A 1OFSA 4LBJA 4C1WA 1I6XA 3SH3A 4EN9B 2JECA 1SACA 2ZX3A 1ZRRA 4QX5A 3JU9A 1OA2A 4MGTA 2ZGUA 5EIYB 3UETA 5FMOS 1AXKA 3AKTA 2ZKNA 5JOZA 1K5JA 5CNAA 1MR5A 2D43A 3ZKUA 4FP2A 1W8TA 1XNDA 2VO5A 2K0GA 4P9YA 5L7OB 4DUWA 1S0CA 1RXFA 4IETA 3CBNA 3POWA 4JV4A 4TYSA 1LOFA 5JCTA 4IDZA 2VTXJ 2FCTA 2DF7A 4LE3A 1BJQA 2AH2A 4XFIA 1U0AA 4AHYA 4N43C 5ACA3 2WFF2 4LITA 4CA9A 2PHRA 2PHWA 3MF6A 4IESA 4XUNA 1W8ZA 3UGFA 2D97A 2QQUA 4D6QA 4DUVA 4UFIA 3ILRA 4NIIA 1SDWA 3ENRA 3VHRA 4Q0PA 4CRQA 4O9GA 5GZEA 3DECA 5FZ7A 5F2SA 2EIDA 1ASJ2 3T4VA 1NOVA 2UU8A 4JTOA 3LDRA 5FYMA 1QXRA 1UOGA 4AQSA 4DMIA 4H7LA 5FYSA 4YARA 2ZX4A 2XONA 2FD8A 3H1YA 5A3LA 1WUVA 1JYCA 3POYA 1REDA 4RN5A 1TMF3 2ARAA 1XYOA 3BPSA 1BVP1 3VLBB 1DFQA 1QH7A 2A73B 3JUUA 3BALA 4XYXA 4RHV1 2WT0A 2E26A 1Q8SA 2A5ZA 3OPTA 5JLVA 4J25A 3P3PA 2OUHA 2WQZC 4KL1A 4MHRA 2KA3A 5L19A 2VCMA 1JN2P 3VZOA 3NO8A 2LM3A 3APBA 3D82A 3VBRC 3CO2A 4DXRA 1XB9A 3O1VA 1H0BA 3WG3A 2IXLA 2ZKLA 2Z42A 4MX3A 5LA9A 5E16A 1CIYA 3FFQA 3GF6A 4TLGA 1RJ7A 2WLPA 1K5MC 2RMU3 3CL1A 3O1UA 4XZUG 3B3QE 4KU8A 2X29A 1NXMA 1WGPA 2AEYA 3FLPA 4NE9A 4XJUA 1DYOA 1VAMA 3V0AA 1CIWA 1OA3A 4NRPA 3POEA 3BU7A 4LLOA 4AL9A 1LU1A 3H7YA 3MIEA 2J1AA 2WQ4A 3WDYA 1OLME 1PVXA 3FFZA 2GH8A 1TNFA 5JSRA 3MLKA 3MFCA 1UF2C 5C3RA 3J8F3 4Q0QA 3J7MA 3PUHA 1W05A 4ZONA 3O1TA 3WF1A 2IC1A 5J36A 1MPXA 3OF1A 1W9TA 4Q4V1 4BWOA 4DY5A 1HIXA 4Y4RA 2X10A 3VBFC 4DXSA 1A78A 4Q4Y3 3VD5A 5E8AA 3RYRA 1AR83 2ZMNA 4OUEA 3T2OA 2XWJB 2YY1A 4QAWA 3PVNA 5JR7B 4FPLA 5C33A 1WZXA 2P1BA 2F4PA 2WIIB 2VZPA 1BBT2 3MICA 1SBFA 5JSPA 3RFRA 4DUXA 4CDUA 4Q4Y1 3WCSA 4CTEA 1FI2A 1KRIA 2YDEA 2PA7A 3BCWA 5FZ6A 5C70A 4DEVA 4BMBA 3RS6A 1XNCA 2BFUS 4C8DA 4FAHA 1W8WA 1WD3A 3MI8A 5IAXA 4A7KA 4Z2WA 1N3PA 3ACGA 2RS32 1MACA 2FQPA 4WVMB 1G9FA 1JYIA 3J8F1 4HT1T 4MHUA 1XRUA 5FBJA 3WR0A 1XNKA 5A6ZA 5FPXA 5JUVA 4RS5B 2A3XA 2QNKA 3KLSA 1L7QA 3HEIA 4YPJA 2V73A 2OUJA 2VXRA 3AJYA 4N53C 4L97A 4E4DX 1M4WA 1R092 1RUJ1 2R7EB 3H50A 3GCXA 4FPKA 1VBA1 2QQKA 2ARXA 3SCHA 2JD9A 4MVTA 3MFAA 4FI9A 4EV0A 5T5JA 1MQTB 4R8HA 1DQ4A 2VNOA 2JG9C 2I45A 2RMU1 3E6CC 1HXS1 4YM3A 5FDBA 3I2JA 4IE5A 4AWDA 4QGMA 5I0UA 2JE9A 2QQLA 2UWBA 3D0SA 1KDKA 3JQWA 3A4UA 3F2ZA 4QU1A 3S30A 5FZGA 4M00A 2W1UA 5A6YA 4AOCA 3B9CA 1I5ZA 2RS12 4I02A 5BNNA 2Q1MA 3IKWA 4CCOA 1FMD3 3OUJA 4UW4A 3U37A 4GMP1 2UWCA 3FBMA 4XPVA 5EJ3A 3ZOIA 4XJ8A 4CP2A 5DN2A 3NSTA 5JWPA 3RMYA 1YI9A 5EWSA 1BEV2 2CGOA 4WV8A 4FQ4A 3TBDA 3N9LA 2JICA 5A7SA 4Q4W1 1TVGA 1D0HA 5A3TA 2YPJA 3RDIA 4RFT0 2RG4A 3LDBA 2WINB 3LEKA 3WY6A 3VDDA 3J7LA 1CZSA 3ACLA 3VBUC 3VBHA 4A7YA 1NA1C 2Y33A 4I01A 5DUXA 1US3A 2OZJA 2HBUA 3B01A 4QX8A 4BQ2A 3CJXA 1CWPA 2B4KA 3H3ZA 1V6OA 1LJ7A 2WRAA 1ZZ7A 4NUBA 1G9AA 5JZGB 4YGDA 5C7GA 2YBPA 1V9U2 2YUEA 1SMVA 2CDOA 2AC1A 1JXNA 1O59A 5D8AA 2VVEA 1N1YA 1BZWA 1EPZA 4UI9L 1GP5A 1RVF3 4BIOA 1S0DA 2MEV3 2BWCA 3B93A 1YQ5A 4W4ZA 5FZ4A 5H9PA 4B3NA 4NAOA 1RMU3 2W95A 5F39A 2RJKA 3NAPB 4P9IA 2CU5A 2XJQA 5I0TA 4QX3A 2Q30A 1ZZ9A 4LEJA 4S2GA 1QJEA 4NIDA 2V4VA 5C4WA 3ZIWA 4XTMA 4GH4C 1W6MB 2D6NA 2PYTA 1VAVA 2W87A 3ECQA 4RQPB 3P1IA 2DWRA 1E5RA 1NQJA 2JDHA 4DY3A 2Y6LA 4YSFA 1JZ3A 2ERFA 2JENA 4AQTA 2RJLA 2EALA 3AKRA 4K8RB 4XFGA 3WF4A 5A3NA 3SKJE 5FZEA 1CVNA 2A6ZA 5KR7A 2KD7A 2WAAA 5AVAA 5HI0A 2WS93 3ORJA 2WNUC 3S7IA 1RUD1 1VBD1 2J1TA 4UXAA 4XEZA 3V65A 2D6PA 2WFF1 4GZ9A 1WCDJ 2WSVA 4YW2A 1ENQA 1S55A 5FZDA 4GH4A 2HWE3 4XMAA 2VZ3A 1D4VB 4MUVA 4C0HA 1C3HA 3PJYA 4XFBA 2FHRA 4GJZA 5FZCA 2H6CA 4OI4A 4DNYA 2P17A 2AZ5A 2RV9A 3S5AA 2BJSA 1PO22 3WNKA 5K0UA 4IE6A 1SBEA 2HWC2 1H8TB 3PLQA 5F3IA 3K75B 2FMDA 4L8QA 4JGYB 2Z4FA 1MS9A 1FAYA 2WNUA 4EZ4A 4SLIA 4W6YA 1MEC2 4XAAA 3VL9A 1UMHA 2O8QA 3R4SA 1AJKA 5BNPB 1PO23 4E27A 4DIQA 5IATA 1IQAA 3PMSA 3MPPG 3RYKA 3GDBA 3HVDA 1H2KA 5LA2A 4DXZA 1ULDA 3ZM8A 2B9UA 4M01A 5F3CA 2WUHA 3POGA 1RUD2 2P5BA 1IZ3A 1RUI1 1YQ8A 5BUVA 5F2WA 2EXHA 1PMJX 2DCJA 2TBVA 5EPAA 3O1MA 1NG0A 3N9MA 2WZPP 4EJRA 4YG6A 5LBFA 4RR3B 5EV7A 2J1VA 2PELA 4CEYA 5FYIA 5IUQA 3VBHB 2PHXA 1E57A 4LBMA 4GA9A 4NIAA 1OOPC 3SLIA 2A6VA 3OUIA 3TB0A 3VGIA 1QQP3 3S57A 1R1A3 3POSA 2R30A 2W47A 1HRV3 3T0DA 2DFBA 4RS5A 1AR82 1V6JA 1O4YA 3H8XA 3CJIA 5FZIA 1MVQA 3K51A 1YFWA 1GANA 3VBFA 2XJTA 4ZKTB 3ZYIB 5IVCA 4EYUA 4ASMB 1IQDC 1X36A 4KH9A 2XPJA 4IERA 4LXLA 5IVEA 2WNVC 3SCFA 2OXBA 3IZOA 2RR12 5FUPA 5BNNB 4DS0A 1KD7A 1TZOA 3GJBA 2J1RA 2A71A 1UOFA 2HWE1 3QD6A 1DP0A 1HB2A 2Y0IA 4JTNA 3W20A 4EQVA 3KV9A 2WWJA 1VBD3 1F31A 2G9ZA 1AYN3 5FMDA 5CYYA 1H9WA 2OYZA 4BCUA 1D7PM 5GJ6A 4CCLA 5KWRA 3DKQA 4IEQA 4K7JA 1MS1A 5A1AA 4LBKA 5FPAA 4RQPC 5F7UA 4D7YA 1NQDA 4L0PA 4Q4X1 5LK5A 3ZO0B 5AFBA 3O1SA 5BYNA 4QGNA 1YC61 1UOBA 2WNVA 1RB8G 1GP6A 4LHLA 1AR61 3ZPOA 1AYN2 1AYM2 1QXJA 4LUMA 4E4HA 5DPNA 2ENRA 4RA0A 3KVAA 2FDJA 4NRQA 1UN1A 4QHBA 2ZMLA 3HWJA 3M2MA 2CHHA 3VBOA 2E33A 2K2SA 3UV9A 1EPWA 4QQ2A 1X7NA 4AR2A 2VTFA 3SEPA 3AVSA 4MO3M 1UCXA 3JZVA 3WHUA 4YG3A 1D4M3 2MEV1 1XC6A 3OY8A 2VD7A 3JD73 4WZFA 3ZYHA 1SQ4A 1W2AX 5IWFA 1R1ZA 1AR91 2PAKA 3M70A 1XPWA 2DCZA 4QPGC 1FX5A 1YJKA 2XXZA 4IL7A 2C1FA 3UGHA 3NNJA 1Q8OA 1X33A 2VH9A 1ZRDA 3B00A 4COUA 1UZVA 2GMPA 1PHMA 1PIV3 4CP9B 1NE6A 5C3SA 1W2UA 1BMV1 2VUDA 1BK0A 1W9FA 2D6MA 1PK6A 1XBFA 3GHMA 4NJ4A 3U75A 5BNNC 4XXPA 1PGW1 1EV11 4NHMA 4XF0A 1RITA 2WO1A 1QHDA 3EXUA 3MIHA 3R6SA 4F3JA 3KQRA 4RYDA 1UMIA 1U5XA 3O5SA 4NMIA 3OBAA 3OPWA 4Z07A 3BGAA 1U5IA 2XLFA 1BXHA 3IAQA 2JG8C 3QLQA 4TN7A 3TNQA 4CCKA 3AYCA 5F6LB 3RMXA 3ZXLA 3O1RA 5DAQA 4ISQA 1O6UA 5LY2A 3VBHC 1GV9A 1CONA 1VE0A 2Z5WA 5FP3A 3RWKX 1DQ0A 4JHZA 4XUPA 1O8PA 1OBNA 1VBE1 2HYXA 2JDAA 2Q4SA 2ZA9A 1MEC3 1S0EA 2VOWA 3LOIA 2G1MA 2R041 5EYXA 2P4EA 1F9KA 4CP0A 3KCCA 3M7AA 4AEDB 1BKZA 3QACA 5ABJC 3IT8A 1VP6A 3NV4A 3S7EA 1XYPA 4QT6A 1VAKA 4B1LA 2WSUA 4G3YC 2XQRA 2OA2A 1BEV3 5APAA 2RS52 1LOBA 3KZ4C 1UIJA 3KQ4B 1ODNA 4O61A 1DQ2A 1QDCA 3FMGA 4AHWA 2GNMA 4JDOA 4UBGA 3VBUB 3AP7A 1N3QA 3R4UA 4Y3OA 3LA7A 3Q8BA 3LKJA 1UO9A 2PLV3 1ENRA 2D6OX 4KBZA 4LO4B 5FZKA 1T6GC 3H42B 4BZ4A 3O0XA 1NYWA 1UL9A 3ES1A 2DU0A 1UZYA 5ACA2 1R081 2NZ9A 4I3GA 1CZTA 1OA4A 2D7FA 4ZU4A 3BTZA 3K77A 4CU7A 2FZ1A 1LULA 2YROA 4E9KA 2FDKA 1W8HA 1IG3A 1W8UA 4XCBA 1YFUA 4M3CB 5FK8A 4IEPA 5BPXA 2R0FA 1YHFA 4I0WB 2BOJA 2JB4A 1G9BA 1ASJ3 3K2OA 2A6WA 3AJZA 3M3OA 4WM7A 3RRDA 4Y1VA 1HV1A 4TSVA 2JIGA 2J42A 4XJ9A 2GMMA 2G9GA 2PAEA 3VD9A 2ET7A 3OOXA 4XDPA 1QJX1 1UW8A 4UFLA 4D3WA 5A1FA 1CAXB 4WVZA 2WC2A 1RUC1 3L9JT 4E4SA 3KM5A 3CNAA 4OMDA 2QKDA 2XGXA 1W9SA 3H9AA 1NKGA 1WMXA 3MIDA 5F37A 4JAAA 1LOGA 3KV5A 5A7QA 1F35A 5FPZA 2WABA 2ZGOA 5BNOB 3M4FA 3T2PA 5C9AB 4XZPA 1OT5A 1PGW2 2O0OA 3N7LA 1Q43A 2Y8KA 4AF9A 4AHXA 2JWPA 2IFRA 4N7UA 1WMEA 3RZHA 1DZQA 2JKXA 4D0QA 4RGKA 4FXGB 2XJUA 4QXCA 1G7YA 3POFA 3DYMA 2ZX1A 3BOWA 3CHXA 1GR3A 3IWZA 4Q5OA 2CGNA 3PIJA 3ZXGA 2XQXA 3FBYA 3QOPA 5GALA 4GQ7A 1UAIA 2W39A 1ALYA 1ENXA 2JJ6A 4IV1A 1PX4A 2I07B 3NAPA 3NW4A 5EQUA 1XE0A 2QUOA 1RHI3 5GLZA 5JVVA 2SLIA 2W46A 1UX7A 1S0IA 3CJIC 3ES4A 3GBWA 4OYUA 4HPKB 5LASA 4CCJA 1GQHA 5ABJB 3MBWA 4X6RB 3VKOA 1PGL1 1PNGA 2ORZA 1J1TA 1UZ0A 2YU1A 4EN6B 5CISA 2DTYA 1OVSA 2V5DA 1NUKA 2XVKA 1LOCA 3FL7A 3JB8A 4HK8A 2VW0A 4PLNA 3L2YA 4XFAA 5L9VA 1TMF1 4M0HA 1LESA 4CPBA 4MZUA 3MIFA 1AX0A 3HN1A 5FPLA 1NLRA 1SBDA 1YO8A 2HLEA 2RMU2 1OH3A 3NV3A 4AVBA 3ZR6A 1KFUL 1GOFA 1TG7A 3ZN6A 1DCSA 1OHFA 3TEWA 3I97A 3PJQA 3VD7A 4XURA 2YZ4A 4N90A 5LBBA 5FXWA 5IAVA 3EB7A 1DDLA 2RS11 3WEZA 1VB4A 4JGZA 4C1XA 1HLCA 3GZTB 1JI6A 1VALA 1OQ1A 2A7AA 2GN3A 2RS31 1ODMA 2YHJA 4I0AA 4HBNA 4XFFA 5F9TA 5ACA1 2P3IA 3AZVA 4JHTA 1ST8A 2OPWA 2W3JA 4YYOA 4COVA 5FOBB 2VY0A 5IW0A 3VBOC 1JHJA 1UXZA 3N9OA 1X9TA 4GAZA 1TME2 4HVOA 5KHKA 1BBT1 1GWMA 2WO2A 1VBA2 1Q3EA 1MS0A 1OQEA 3NV1A 1RUG2 1O7FA 2ZGMA 1XXNA 4LIVA 1ZZ6A 5F5AA 2PN5A 1BYHA 4QPGA 1DQ6A 4W65A 1FOD1 5FBZA 1DLLA 4PT6A 1LGCA 1T2XA 4OI0A 2TEPA 1H30A 2O14A 1CAUB 1C8M3 2ZGKA 2PLV1 4JQTA 4LPLA 4BK4A 1SCSA 1DLCA 1RUH3 2G19A 3J8F2 4NN0A 4NROA 4Q4V2 3VBUA 1QJFA 4CUBA 3VKMA 1PK6C 4LTAA 1LOFC 4Q8LA 3U1XA 1W6PB 4CDQB 2ZEWA 3VDAA 5FWEA 3GJAA 1DZRA 3OD4A 1C8M1 2Y26A 1LKNA 3I2KA 2WYSA 2DVAA 3E5XA 5A7WA 3D0JA 4KBBA 1IG0A 2RDSA 3OJBA 4GB31 1GP4A 4FPGA 3VBSB 4XIKA 1FPN2 2Q8DA 4UBHA 4LA3A 5GZDA 2V4AA 3AYDA 1BBT3 3PMEA 1X82A 5TSWA 5FZ9A 1ZRIA 2JDKA 2O1QA 3OYWB 5KC5A 2FZ2A 1X8MA 2MPFA 4A6SA 4Q27A 2WNVB 4OI1A 1H4HA 5KXDA 3CMGA 3PUAA 2YFUA 5C4WC 1ZZ8A 3SITA 5JOWA 2Q8EA 2DV9A 5L7OC 1QF3A 4P9LA 4FPOB 5JOXA 1N3OA 1NE4A 1YQCA 2X53S 2RS33 4TWTA 1K5MB 4HPKA 4XE9A 3WCRA 5ABJA 1NY72 2XKOA 3I3QA 1UKGA 3AMNA 4Q2FA 3I3MA 1KS5A 3I3BA 3R4DB 4FTEA 1GZ9A 3KF3A 3UESA 5CBLA 3ZXKA 3ZLIA 5JXGA 1KXGA 4INDA 4B29A 2IXHA 3RJRA 1MS3A 4BE3A 4EROA 5A6QA 1AR72 1UQXA 3PNAA 1RXGA 1PGL2 3FE5A 4B1MA 5HCHA 2FDIA 3M3EA 3EYPA 2R1DA 2BW8A 5ERLA 3ACIA 3MGUA 4YRDA 5FOJB 2XL7A 1JZ8A 4W6XA 4R9AA 2D3SA 2W1SA 1N47A 2ZS6B 1J3RA 1QWRA 5H9QA 3N4MA 1K5MA 1H8TA 1O8SA 1AF9A 2IXIA 3DF0A 4AEDC 3DGTA 5K0UC 4IXLA 2WT2A 5CA6A 3N9NA 3JD71 3ME2A 4UFHA 4XFHA 2GNDA 1V9U1 4TXWA 3T0AA 4JKMA 4QQPA 4D8MA 4QKFA 4FAGA 2NP0A 4AQ2A 5IT6A 5CIRA 3GCWA 3B7MA 4LKEA 4QM8A 5E6HA 1VBB1 1QJX3 3WINE 2GDFA 3WQBA 5A6XA 1PZ7A 2CY6A 2RS53 4QD2A 5FWJA 3PVEA 4XBNA 3CIHA 1L7LA 2VZVA 1YXWA 3O14A 1AR63 2Q0AA 1H8TC 2VZTA 3ABZA 3JXSA 2PMWB 4LO7A 4AEDA 3MV11 2GC3A 2VUAA 3HPNA 1W3XA 2ARBA 3PTYA 3SEEA 3HT1A 4AGRA 1W6PA 4AFAA 3WD5A 1W90A 2ZZJA 5C4WB 2VULA 2ZGQA 4DPNA 1OOPA 1XYNA 1QNYA 2UWAA 2HWC3 1JW6A 1QIQA 2VZ1A 3PUSA 3ZXDA 1DGWX 4XUQA 2BRTA 3D6EA 5H9RA 4EZHA 1V6LA 1S1AA 4YW1A 1DGLA 2D3RA 2ZGLA 1P8JA 5FUNA 1BQPA 3RNSA 5JR2A 1SG3A 2OPKA 4Y22B 1OD3A 2Z2SB 1QKQA 4URAA 1RUOA 1IS5A 2XG3A 2ZHNA 3U4SA 1KGYA 3E6DA 5FY8A 2EF6A 3J7HA 1R082 4GJYA 4PQ9A 3AXDA 3PUQA 1S0JA 3HAGA 5I91A 5CFDC 4F83A 4OQ8A 4XF3A 1Q56A 2BTVC 4UFKA 3VZKA 3UNPA 3BIEA 1X8EA 4N53A 3OGJA 4FXKB 3NJXA 2EIGA 1QQP1 2RDRA 4KGGA 2XB6C 2VQ0A 1Y43B 4B4PA 2WWUA 1WBLA 3SKVA 1OF3A 4AVVA 3BI3A 3MLJA 2NYYA 4ZU5A 2GAUA 2F4LA 2K46A 1MEC1 3A7QA 2VZQA 3SQOA 1GFF2 1VRH2 3I7DA 4IEWA 3RG0A 4KWJA 3THPA 1QOOA 5AC93 2DTWA 4IEOA 4XBQA 1JZ6A 1PVC2 5FZAA 3H1MA 4YZ3A 1PO21 4Z82A 2VPVA 2AGSA 2AACA 4HG6B 4FOYA 5JPNB 2P6HA 1V00A 3THDA 4FO9A 1PO12 3KV6A 5JIUA 1X50A 1O4ZA 4LBQB 5EXOA 3ZYJB 4JRAA 2XBO3 4EN8B 1I3HA 4K40A 3VHPA 1GUIA 2LRPA 3ON7A 1AL22 4EWEA 2R062 5FKBA 2BBVA 5DUWA 2ZAHA 2IZWA 2VBDA 5C9AA 3SCGA 1EV13 2VMCA 2VVFA 1VR3A 2R49A 4XJAA 2R043 4AVAA 3W5NA 5CKNA 4CVUA 3NNMA 1VBE3 2NQYA 1DBNA 2QZ3A 1WW7A 1EAH3 3NV2A 3ZYGA 1AR73 4NVPA 4X8NA 4D7TA 2B7YA 1LEDA 4HKWA 4YM1A 2VG9A 3LFMA 2E51A 5JI7A 3IBMA 4PDWA 2IWGB 2CTVA 5EP9A 4QX1A 2HKXA 4AI2A 1ZNPA 1JU4A 4B4QA 1LECA 1QEXA 4FQZA 1XJAA 3B9IA 4QXBA 2D40A 3RI9A 4P5YA 3KS7A 4IEYA 5FXXA 4XMIA 1NCQC 3H1WA 1H6YA 3KWVA 4CU6A 2CGPA 4PQQA 1R1A2 3HR9A 5K7PA 5FYCA 5T55A 5F8PA 1CAVB 3ALQA 5I0SA 5FYBA 3WT3A 2DUOA 1OVPA 4PHZA 4DXTA 3OSDA 4E2SA 1B09A 1U12A 1JU3A 3AKPA 3AYEA 3G6JB 2ADDA 4GKXA 3TOJA 4MLOA 5KHJA 2IXJA 4AG4A 1WMDA 4NHLA 4UOJA 5D8AB 1Z7S2 4Z2AA 2VM9A 3KT1A 5A70A 2AUYA 1B35B 5IHRA 4HL0A 1QJU2 3D5OA 1HW5A 5DAXA 3CQOA 1N1SA 5LK7B 2BDRA 3MHZA 4BXSV 2VL4A 4W8JA 3VKNA 3AFGA 4KNCA 2AYHA 3I2FA 4LO5B 4QU2A 3LFIA 3W5MA 4FBFA 4D6SA 4YW6A 3AC0A 5T5PA 3JQXA 1MZ5A 4A7ZA 3H8UA 3NJVA 4BLJA 4FCAA 3VBFB 2GP5A 4OHVA 1ULCA 5FYUA 3C7HA 5M0TA 1ZBA1 2XBO1 1JUHA 2ZABA 2BERA 1HRV1 2HEWF 5HXVA 1W06A 2BGOA 2P34A 4GH4B 4YW4A 3OTFA 4LBQD 1G86A 1Q5OA 3M3CA 4JQRA 4Y5SA 3LWCA 4BISA 4E4ZA 4YVSB 2VMFA 4LHKA 4H14A 3SMHA 3C7OA 3USUB 3ITQA 1K45A 3NQHA 5AC91 1EUUA 1RUG1 2OZ6A 2XVGA 3DPRC 5C3QA 5CKQA 2DDUA 2LTNA 4BIFA 1YNAA 3WVJA 1RUI3 5LBEA 4QQHA 1PO11 2A3WA 3I3EA 1Q8VA 2BWAA 4CDXA 2Y6HA 5K4LA 3S5QA 3BN6A 1R091 1VIWB 1URXA 3QH6A 1RJ8A 1O3SA 2OS2A 3NNGA 4W6WA 2XHNA 3IN9A 5FTTC 3WW1A 5C5TA 1H2MA 1YIPA 2WN3A 3HIFA 3B02A 3HQUA 4QPIC 1E5IA 2E7AA 1AUYA 1WW4A 3MUZ1 3USSA 4BB3A 1O3RA 4WVWA 3P3NA 1PX3A 3DPRA 4M4PA 4BQWA 5LA0A 1Y9QA 4MGKE 5FR3A 5AFEA 3IIAA 1W3VA 3OYWA 2ADEA 4UYBA 5DXDA 3WZ1A 4IEZA 3QH7A 2J7MA 3VZJA 1VMHA 1WWYA 3MYXA 3AP9A 3S6PA 1DQ1A 3FX3A 3GXUA 3O1OA 3FUOA 2CYFA 1POQA 3DV8A 4CDXC 4CUCA 4WVMA 3OBTA 4V1PA 4E2GA 5C6CA 4EN0A 3AKQA 4BA6A 2WS92 4LKDA 3C8XA 4L11A 3ZKYA 1RUH2 3MZHA 1JYWA 3VBOB 1FV3A 2DVFA 1MS8A 1RUG3 2AENA 2HWC1 2WFPA 1YUDA 1IHMA 2BUKA 2WZ8A 4CCEA 1KITA 4IGOA 4KWLA 4HANA 2DFCA 4QKNA 4AXOA 2UYAA 1W9YA 3ZFEC 2FBEA 4IE7A 3LB9A 1FATA 4LNVA 4XQ4A 1TNRA 1LENA 1ZBA3 5LEKA 3BB6A 4JZRA 4ZS2A 1FPN3 2PHFA 2Y6JA 3VHOA 5FO7B 2ZMKA 4PLMA 3LEGA 4RQPA 4CP1A 3BKZA 3FUQA 1XE7A 1D2SA 4FFHA 2XJRA 4Y4YA 4XJZA 3M8LA 2DURA 4GXLA 5CFCC 1BMV2 4XF4A 3B69A 2YMZA 1W0NA 4Y24A 4OULA 3PURA 1YJLA 3VUOA 3UKTA 3VBRB 2E31A 4Z8BA 1RUD3 4BQ1A 1ND2A 4AQ6A 1QXPA 2J1UA 2QDRA 3WP3A 4AI3A 4J1XA 3WNNA 3GYDA 4Q8KA 4NHYA 1HDKA 5DUUA 1GWLA 3EJKA 3T1LA 4AZZA 5K8SA 3V0BB 4NIGA 1A8MA 4XFCA 5F6KA 3FHIB 3WNLA 3AP5A 2BNMA 3AFKA 3ETQA 3KD4A 5KXEA 1DG6A 4HLTA 3ZSKA 1CAVA 5HCFA 5GZGA 2XLAA 1GZTA 4GMP0 1Q8QA 2CNAA 3Q9OA 1XSRA 3HNMA 5GKAC 1SFPA 1XU2A 3FHAA 5HCBA 3VDDB 3OD0A 4M0NA 1LHWA 2LW8A 4Q4W3 4CP9A 3T1MA 5DZGA 4FPHA 3I49A 2ZEXA 1Z0HA 1GBGA 5A7NA 5I0RA 1GKBA 4C90A 4AFDA 1ACCA 4Y33A 1HB1A 3T09A 5J7MA 4NO4A 1MZ6A 4RL7A 5C9AC 2BU9A 1G9DA 1VRBA 1WW5A 1AR71 3WG1A 1GLHA 3RZMA 4M3CA 5A7PA 1I1EA 3FWEA 2W91A 2YC2A 2K9ZA 2W68A 1UY0A 5FLJA 5L9RA 4BQ3A 3I2IA 1NCQB 2TUNA 3W58A 1W2OA 2C6SA 4K9SA 5L73A 3N7KA 5FYVA 3ZR5A 3LAGA 5J09A 3D3AA 1EP0A 3L2HA 2BOIA 4YVSC 3B5LB 4I30A 1YQ2A 3WNMA 4B7EA 3WW4A 5K9YA 4EN7B 3IMNA 4NWWA 1DU3D 3I4IA 3WDUA 4AE2A 3GZAA 5LRRA 2QCSB 1LGNA 1S0GA 2EXKA 2A6XA 3BPZA 1UZWA 1YEWA 4RGAA 4IEXA 1HV0A 4XQDA 1RUH1 2E7QA 1LAJA 3LDKA 3A23A 1RTVA 1FMD1 3DCQA 3PL0A 3AM2A 1C8M2 5IVFA 2JXAA 2ZOEB 4JGZB 5EFUA 1XNAA 5L7OA 1PZ8A 4P5HA 1EAH2 2DUQA 2OQ6A 2WL1A 1JYNA 4WM8B 5BXXA 2BVBA 4NPLA 2D3PA 1ZBE1 1IS4A 1EYBA 5A32B 3SISA 1FT9A 4LIUA 4LO8A 4F7ZA 2QDNA 2X5IC 2WR9A 2OIIA 1FOD2 4X8PA 3O1PA 1POV3 1T6BX 1OPOA 2DUPA 1XNBA 4XF9A 4CDQA 3T08A 1JOPA 1AHSA 3PIGA 2G4IA 1AR81 2VJXA 2R072 3N9PA 4ZXKA 1M06G 1F2NA 4LORA 4NAMA 2CDPA 5JZGA 4PIZA 2RDNA 1NCRC 4WM7C 2PHLA 2A6YA 3LA3A 5FLIA 3HNBM 4Y22A 4CXXA 4P9JA 2P37A 1REEA 4IW3A 4OZOA 1Q8PA 2B39A 4DZGA 4UW5A 1HN1A 2Q5TA 4S2HA 1WD4A 1F15A 3CU7A 4LT5A 1ND3B 3HBKA 3ZXAC 3SHRA 1Z7S3 2DYCA 1CGPA 4PI0A 4HN0A 3HNYM 4O65A 1AR92 2AR6A 5LB6A 3U78A 4QX2A 1ENSA 5F32A 3IB3A 3P5BA 3U0ZA 1QOSA 2RM23 3FLTA 4GWMA 3E1F1 5FMCA 2BQPA 1GU3A 1QH6A 4XUTA 2VNRA 2FDFA 1VMFA 4NPRA 2W1QA 5IFTA 4GALA 5FLHA 2AEZA 2ZTNA 5FY9A 5JPMB 1RC6A 4LUKA 2MNGA 2PHDA 3DL3A 5FP8A 4CXYA 4PI2A 2VOVA 4XABA 3LGRA 2WYFA 1RYYA 2EAAA 3A0KA 3WOGA 3CLPA 4QHOA 5DZEA 4UW6A 5F5CA 2XLGA 4CDUB 1GZWB 2R32A 4E8DA 2P2KA 3AZWA 4QMAA 4ZXEA 4AFBA 4CSWA 1GNHA 4Y5TA 2X8KA 1KDMA 4LQRA 3TN92 5A3UA 3VL8A 3NAPC 4AI0A 1UYXA 2CWSA 3VHNA 2JE8A 2XJVA 2ZGPA 2ZGTA 4LBOA 3SXWA 3ROUA 3E6BA 2D44A 1US2A 2JDZA 3O0VA 5FZFA 4WM7B 2WA4A 4FP3A 3NJZA 2X05A 4LK7A 3WP5A 1W04A 2QBXA 3C7FA 4K8FA 3UL2A 1SLCA 2Z79A 2ZHLA 3VKLA 2HJIA 5A1LA 1W6MA 2WQ8A 3LPFA 5IVVA 3MLLA 4I3PA 3T3YA 5JXJA 4HKLA 5JXHA 3WF3A 2VC9A 4HOOA 5FCCA 5JXIA 1PM7A 4CXWA 3TNPB 3NL1A 5FZ3A 1UY4A 1SLIA 2GALA 3Q8FA 2B45X 4BXFA 4E2QA 3IM0A 4OUSA 4XW3A 4AEKA 3CZUA 1ASJ1 3HJRA 1OLRA 1JZ2A 4PCRA 2E32A 2W5FA 5E88A 4JGZC 3RZJA 1XOYA 2RM21 3MIBA 2VOTA 4LE4A 4QHZA 1WLDA 2ZBJA 3IDBB 5SV8A 5CFCA 3VD4A 4G9SB 5ISLA 4XDOA 5DUVA 1NZCA 3C2UA 1WKYA 1Z7S1 3MO4A 1QDOA 4K1YA 5KXCA 1R083 5GZCA 4CPBD 4MSVA 1UYPA 3SNMA 4OMCA 3ZFGC 4HETA 1J3QA 1O5UA 1ND2C 5ANQA 3VBSA 1H6XA 3AMQA 3U10A 3RGBA 3ZYBA 3WXPA 3IPVB 3V0AB 4A3XA 2JKBA 1UY3A 1W6OA 1CX4A 1AZDA 4P14A 5FY1A 2JDMA 3ZMOA 2NMOA 2P3KA 4ISRA 4ONUA 4UT5A 4YW3A 3ZXEA 4L92A 4A6OA 1DQ5A 5FPUA 1NCRB 2ORXA 3I59A 4NPMA 4SBVA 5GZFA 2FDHA 1CN1A 4Q4W2 2Y64A 1SFNA 3AYAA 1POV1 1S2BA 3C7GA 2YXSA 1DYKA 2E6VA 2ZCWA 4JX0A 2GC1A 3LSDA 3RZZA 3ZXJA 3DXTA 4CCCA 4AFCA 1CAUA 4DO0A 1J83A 5FZLA 4BK5A 3OEAA 1ZBE3 3MUY1 1W6NA 1PGSA 5K0UB 2I2SA 1JH5A 1YYNA 4OFGA 5E1RA 4D6RA 1OXCA 4PDWC 5LATA 5HCAA 1QQP2 3THTA 1W39A 3I3DA 1DGWA 4CEWB 3LD8A 1BLZA 2LUWA 4B4RA 1IS3A 1OFNA 2PQQA 2P3JA 2A75A 3OCPA 3EMRA 3CF6E 5LW9A 1K3IA 1RUF1 5L9BA 4XETA 4D7SA 1LRHA 2GNTA 4IQPA 4JGYC 3F95A 2YGLA 4KGQA 3WP4A 3UGGA 1OI6A 2H0VA 1AXYA 2YC4A 5CU1A 2R071 1VLNA 2YFZA 3JB4C 4Y26A 5FP9A 5LZ6A 4IV3A 4FFIA 4KWUA 1XSQA 4KMQA 2ID4A 5J96B 3O0WA 4MADA 1DZTA 2QQIA 1CJPA 1J84A 4A4AA 1A34A 4HVRA 1UPIA 1W0OA 1VPHA 2XJPA 4Y1ZA 5FQ0B 1SLBA 2VNVA 3WHTA 1RUE2 4MGYE 2BNNA 4L99A 5FYHA 3VZMA 2XBO2 3FJSA 4ORFA 5FZMA 4MGZE 5F5QA 3OBRA 3UKNA 4AGVA 2RVAA 1IKQA 2ARCA 2GN7A 5DAPA 2E9QA 4ZU7A 2VUJA 4YM2A 3TN93 3HD8B 5EYYA 4IV3C 1VB2A 1VBB2 1MS5A 3KGLA 3KMHA 3WNPA 1RHI1 4LO6B 4I2OA 1HJFA 4BOWA 5AC92 1I5PA 2HYKA 2AREA 5FZOB 3Q8AA 4OCTA 4YZ4A 3RPQA 5A7OA 2DU1A 1QJU1 3JD72 3POIA 1E5SA 4MXVA 5IVYA 4Z1VA 1ZVFA 3MW4A 5ANNA 3G7DA 1HN0A 4QQOA 4Q0SA 2VBBA 4CDQC 3LZZA 1HRV2 1DHKB 1H2NA 4Q4X3 3NJYA 3HT2A 3P6BA 1PIV1 2UY9A 3AK0A 5JZGC 1N1TA 1NCRA 1A3KA 1SCRA 1SLAA 1GMMA 1QU0A 2RE9A 1R64A 4DRVA 1BVVA 2W9XA 1UYYA 5J3UA 3BTXA 4KWKA 1WCUA 4QM9A 4DINB 3MDPA 3LPGA 4ARYA 1UKRA 2XUMA 1AYM1 3W9AA 3T0BA 1F5FA 1UY1A 1QJY3 1VBC3 2ZEYA 5FYYA 3ZSLA 1U5YA 2D6LX 2FMYA 2JDNA 2PFWA 1BHGA 1LTEA 3LF7A 3BU0A 2QQOA 3C7EA 1NLQA 4N9IA 4R4XA 3GBGA 2BZDA 2YGMA 3PU3A 2XMLA 1ZA4A 3A0NA 5CB7A 2F6BA 3NNFA 4K21A 4BDVB 4LR4A 5CFCB 3WDVA 1NX9A 5FO9B 1APNA 2PAMA 1QJY1 1VBC1 2YC0A 4XC9A 4QPWA 3OUHA 5DDJ2 2Y60A 2BNOA 2HWF2 4H2AA 1MQTA 1W6QA 1G6NA 3H0OA 3VB9A 1F5JA 4BJ0A 2C0ZA 4KG0A 5BNPA 2WN2A 3E97A 3EHKA 3Q8EA 4DEQA 3OBZA 2NLRA 5C3OA 3DPRB 5CFDA 4JDMA 1K42A 4U2AA 2ATFA 3WQ7A 4BQ5A 2WZR2 1GNZA 4FTSA 4AI1A 1D4M2 1HQNA 2UY8A 1C28A 5A32A 3DEMA 5DAVA 3MIGA 2J1SA 4COWA 3H8OA 1RL3A 2CSGA 3HQRA 2GZWA 3GZEA 4Q4Y2 4ZHNA 5BV6A 1QJU3 4A45A 5I8TA 4IV3B 2D93A 4AK3A 3R05A 4U36A 1ULPA 1MQTC 4P02B 1H8VA 1V6MA 4UFMA 4META 2QQMA 4O7XA 3CJIB 4OI2A 4Q1PA 2WZR3 3TRSB 1VRH1 5DG1A 2GC0A 3W21A 5I8YA 1GOHA 4YLZA 2C5DA 3J26N 1J1LA 5FYTA 5BNOA 4XHXA 1IPJA 2D5FA 2L9LA 5LY1A 2D6KA 3ZXFA 4HMZA 4PJYA 4CDWB 2BYVE 4Y5Z0 1E5HA 3ATGA 3ETPA 1TE1B 2VMDA 3J9SA 4FOVA 4PBPA 4QKDA 1UIKA 1AVBA 5LA1A 3UT0A 1PO13 1JYVA 4GWIA 1OLQA 4CCMA 5CG9A 3JBG2 3NMBA 3V0BA 1AXZA 3HOBA 2WFF3 5L36A 2YBSA 2R16A 1OUSA 2NMNA 4COYA 2WS91 1OH4A 2R073 1A8DA 3T30A 5FO8B 4Y1UA 3JBG1 4I09A 1JODA 3AZYA 3AL5A 2RHPA 1IOAA 2QQJA 3RQ0A 2E7TA 1LNSA 3KB5A 2RJ2A 1H9PA 1VBE2 2IUWA 4A41A 3BTAA 1OLMA 1RUF3 4XXAA 2CL2A 3KHBA 2VOKA 5C5UA 5A3MA 1IPSA 4OHWA 3WUDA 1SHWB 2LALA 1UNBA 1WCKA 2HWD3 2XWBB 2YPDA 1WMFA 4JKLA 1X9PA 5CAZA 4AEJA 2VZSA 4QXHA 5D2AA 1VJ2A 4XF1A 1XE8A 1Z78A 1NCQA 4K20A 1KEXA 2ET1A 5DG2A 2B46X 4E8CA 2D98A 4CDWA 5LRSA 3IDCB 4DQAA 1RVF1 2HEYF 1O91A 3NKGA 4M3CF 2KXLA 2R6QA 4QB1A 5BNQA 2RR13 4ASKA 2G9FA 2PXJA 4RR3A 4LULA 2BEOA 1SDDB 1ZYBA 5GLWA 2C9KA 5A3OA 4RD7A 1D4M1 3AMPA 4ARXA 1B35C 4YFZA 1OMIA 2ZAAA 3T4HB 2FDGA 3BODA 3WDTA 2QJVA 1OURA 5JDBA 1W6NB 4IGQA 4AFMA 1L7RA 1W8FA 3ZMNA 5FY0A 3HBZA 2XKPA 4LOTA 3BUCA 1OOPB 3AZXA 3AZZA 5IK5A 2V5YA 1KJLA 3N7MA 1BK1A 3ELNA 1WW6A 3NVCA 4JCKA 5SV5A 5BY5A 2IXKA 4QDQA 1UU5A 1XNTA 3N36A 5JMCA 2VW2A 3E5QA 1TEIA 1WLWA 4LMFA 1RVF2 3LA2A 2DCYA 5HV0A 1ULEA 3MV01 1CJDA 1NZIA 1AYN1 1H4GA 4GMP3 3INAA 4NOTA 2TNFA 3DKWA 3PUIA 2QE3A 1AX1A 1DGRA 4YVWC 1RINA 4PBOA 1LR5A 1QJX2 4B7KA 5J37A 3LOBA 1H1AA 1GZWA 3POJA 1QOTA 4DFSA 3O12A 3OGRA 2IVJA 3GALA 1C1LA 1GNYA 1WCSA 5B2GB 5FQ0A 5DMYA 5A33B 4FVVA 1C5HA 5JI9A 2V72A 4AAXA 4ITCA 1HXS3 4OHZA 5CADA 4GD4A 4BQ4A 5DQ0A 1C8NA 1HX6A 5T52A 1RUE1 1DYPA 3GNEA 5EHDA 1COV1 4C0BA 5FY5A 5I8SA 2ZHMA 1ZZCA 4JRLA 4LHNA 3NNLA 5FXVA 3FHQA 4QPIA 2IVIB 4OZXA 2PQSA 2R1BA 4H7MA 5A33A 4AI8A 3VBRA 3ZSMA 2OW4A 2LS6A 3ACHA 3ILNA 1NY71 1EUTA 1GZCA 3J7NA 2VMEA 3I2HA 4HFSA 2Y34A 5IFPA 1UOJA 2DCTA 5FIXA 4O9EA 1IGOA 1S0FA 2YBKA 2ZHKA 5CEHA 3OB8A 2WWSA 1F4AA 5KC6A 2PTMA 5FY4A 5FRAA 1RUC2 2WDBA 2VMIA 5F5IA 2EA7A 3KVBA 1CESA 3MF9A 1WA4A 3EQEA 1ULGA 2CAVA 4OHXA 3ZX7A 4UF0A 4GB32 1Y3TA 2WLQA 5C8CC 3C3VA 5FYZA 3K4AA 5KHHA 1W03A 1VBA3 4XJWA 3S0MA 2DVDA 2VVDA 4LBNA 5KBFA 1RUJ3 5C8CB 3ZFEA 1TME1 2Q8OA 4C91A 5LCWL 4MV2A 4FFGA 1PNFA 1VMJA 4M3CE 2WA3A 3KCXA 1JUIA 3H8RA 1AX2A 1HRI2 1UX6A 4ES9A 5B4NA 5I93A 1LHNA 1W2NA 4YGBA 5C8WA 2YB7A 2W2IA 4KG8A 4BYYA 5CZKA 3IDAA 3LCPA 3WNOA 1V70A 5JIAA 5IK8A 3WDXA 2I74A 4MXWA 1LGBA 4XILA 2B5HA 4KU7A 5C8CA 1PMIA 3I54A 4XBLA 1PM4A 4AVSA 3BTYA 3WLUA 1BCXA 1NA1B 4YNIA 4XUOA
chains in the Genus database with same CATH topology
4FPFA 1O5LA 4Q29A 4WM8C 1A6CA 1ND3A 1CR7A 4GULA 3WW2A 1ND2B 2RS51 3ZFGB 1CPNA 4IV1B 4P9GA 5DZFA 5JOYA 1RMU1 1COV2 2ZJCA 1V9U3 4J6GA 5F1RA 2GC2A 4CZSA 1MZEA 2R042 4X6QB 2MEV2 3KGZA 2DVBA 3VBSC 2QFEA 4BM8A 2JE7A 1ND3C 4N9HA 2E53A 5GLVA 1COV3 4OHYA 3WP6A 1W6OB 3D8CA 1QJZA 1LU2A 1MZFA 1C5IA 4N7IA 2BVVA 2H0BA 2RM22 4AW7A 4IEVA 5H9SA 2WT1A 2XHKA 4RHV2 1ONAA 2EAKA 1POV0 3V56A 4N53B 1QY4A 2HWD2 4J1WA 3VKFC 4YVSA 2GU9A 2XH6A 4COZA 5JSOA 5KHGA 1G9CA 1YI7A 2ILMA 4A2UA 4HKOA 4FSJA 4LLFA 1HQWA 4OVEA 2BFUL 3VDDC 4XOGA 5IK4A 5KHIA 2ZX0A 4PIXA 4NWVA 1LCLA 2D5HA 3W59A 2CV6A 3GBFA 1PIV2 2XVLA 3MW3A 3WV6A 5J48A 1O3TA 3WG2A 3U07A 1J58A 2VMGA 3AP6A 4N43A 3AMHA 4YG0A 4YZ1A 2EXIA 4GKYA 3ZSJA 4CYDA 4HZFA 3QCWA 4MH0E 4BHPA 1H1MA 1B35A 2W52A 4RSUA 4HN1A 3JCIA 4AVCA 1ZRCA 2KM2A 4K1ZA 2X5IA 1RHI2 3AXEA 3KSCA 1RUI2 1CQ9A 2UURA 2YYOA 3UK9A 2VOXA 4BLIA 2WNEA 5EZWA 1LOEA 1FOD3 3WDWA 1WLCA 1JOJA 1D2QA 1L3JA 1GQGA 1YFYA 2O8OA 4EWDA 2SBAA 3M1HA 1YIFA 1F8VA 1ZX5A 1MS4A 1CAWA 1TME3 3WNXA 1JTZX 1CPMA 3RJ2X 3UJOA 1RGSA 1IPKA 1FPN1 2GSYA 2QVSB 4YVWA 3ZVXA 4JC1A 4Q26A 4FPJA 3WUCA 4LBQA 4ATEA 1NLSA 2HWB2 2X5IB 4MYEA 1RUNA 3HQXA 3M3IA 1QNWA 3U4XA 2VQAA 2VMHA 2RS13 1ZM1A 4WVVA 1REFA 4Q4V3 3GZUC 4H3WA 1GSLA 3AKSA 4FPEA 4RGGA 2ZX2A 3TWIA 4CDXB 4DOUA 1PVC3 3FC0A 2PLV2 2NPIA 3ZN5A 3T2TA 3AMMA 2OVUA 2ETEA 1V6KA 3H3UA 3PHMA 5AVPA 1GYKA 4ASLA 1AL23 4L2NA 1ZBA2 4HSLA 2NM1A 1C1FA 3FZ3A 1IKPA 5T50A 4HVQA 1JHNA 4XQWA 1JBCA 4UW3A 1DGRN 1LEMA 2WZR1 2NN8A 4BMEA 2IFWA 2JG9B 1R093 1OQDA 2VNGA 1O3QA 1W0PA 4R9CA 1LODA 1EY2A 4Q1RA 1GICA 3ZFFB 1Y7BA 1PZ9A 3N7JA 1S0BA 3ASIA 3VN4A 3ZIXA 5DDJ1 4R9BA 1LB2A 1QJY2 1HRI3 1VBC2 3LSEA 4RHV3 2R063 4RS5C 3SH4A 3U11A 1V6NA 4Z92B 2DCKA 4S2FA 1AL0G 4Y1XA 1EV12 1W6QB 4URTA 4D69A 4QPGB 4LBLA 2ZACA 1TMF2 1RUE3 4PIYA 1AR62 3RI8A 2Y38A 4QQLA 2MHFA 3WQ0A 4R4ZA 3N3HA 3SH5A 3BOPA 4QXKA 3I2DA 4PLOA 4K6BA 2HWF3 3ZDSA 1UPSA 3ZYPA 1RIRA 3ZFFA 5BNOC 1V6IA 1RUC3 1SFYA 1FNZA 1UMZA 3ZFGA 4YFWA 3EBRA 4QPIB 5J98B 1ZZBA 3OGGA 2JG9A 3I59B 4HSJA 4CEWC 3VZLA 1S2KA 4JDNA 1HQLA 2IXCA 3H7JA 2A3YA 2RR11 3IPVA 1IS6A 1ZREA 4YZ2A 3ZFFC 2EXJA 4TLFA 3IDEA 3ZN6B 2PHTA 4XHBA 4Q0UA 2JD4A 2HWD1 3TAYA 2WKKA 4DB5A 3D4KA 4YGCA 1ULFA 3ZFEB 4FOWA 2CWMA 4HK9A 4AHZA 1BEV1 4K3UA 3N35A 4JGYA 3RWNA 4BH9A 1KQRA 1EAH1 3HMYA 4GIQA 1TQ5A 4KQ7A 4ES8A 4F8AA 2HWB3 1KS4A 3ILFA 4RR3C 1CAWB 3J4UH 3URFA 3WW3A 1SLLA 2JG8A 3I8TA 1LHUA 4WBBA 5GLUA 5FFOC 2UYBA 5FREA 5D8AC 3TYJA 4ATFA 1RUF2 2ZZQA 4NR1A 3ST7A 1UU6A 1H2LA 2YV8A 3FLRA 4YM0A 4BPZA 5HBAA 1YWKA 1SEFA 3VZNA 1YCIA 1C4RA 2W08A 5FAXA 1I9RA 1VRH3 2BGCA 1G8WA 4PF5A 5FMOL 3JBG3 1HKDA 4CEYB 2QQPA 4R52A 1YFXA 4XTPA 4AVTA 3PVOA 4R9DA 4OUMA 1RUJ2 3QBQA 1O4TA 2ZGSA 1C57A 1ZRFA 4GWNA 2XJSA 2JG8B 2VU9A 4N43B 4NHKA 1LOAA 4L9BA 1WBFA 1D0GA 1CD3G 1ZBE2 2ES3A 4FT8A 4G4FA 4IEUA 4YM3A 1J3PA 3O7OA 1SLTA 1J59A 1QGLA 4Q0VA 4S2DA 1LHVA 2PHUA 3KCYA 5T5OA 1AJOA 3ZYRA 1AR93 4MGIE 1FYUA 3K48A 1FMD2 3UKVA 2JEMA 1KFXL 3EO6A 1LHOA 4JVAA 1VBD2 2B42B 1DIWA 3DUIA 5T3NA 3ZSEA 1YLLA 3RSJA 3V0AA 2GNBA 5JAXA 3PVBB 3RYPA 3AX4A 1DF0A 2ZGNA 3UJQA 3OPZA 2HWF1 5CG8A 3MW2A 4P9XA 2GH2A 2JX9A 5E89A 2Z69A 1FNYA 3KT7A 2XL9A 3USUA 3WQ1A 2R0HA 4QGLA 2N7GA 4YVWB 4YW5A 2HEVF 1OD5A 1BMV2 2DVGA 4FOQA 4PDWB 1KJRA 2E63A 5D1IA 3BIWE 4LA2A 3ZPYA 1RMU2 1XQNA 4XIOA 3OY8B 4FPYA 5DDJ3 2CAUA 5BNPC 2Q1ZB 1OPMA 4CEYC 1U5ZA 3ZN4A 2V09A 1OSGA 1UU4A 3B94A 2VGDA 1VBB3 5LEJA 5KXBA 1CAXA 3NWKA 5IK7A 4CDUC 5CFDB 3M3QA 1OKQA 3MEPA 2ZPXA 4DRRA 2VECA 1AYM3 3TN91 1QMJA 2Y0OA 4Y20A 4D94A 3WX5A 1R1A1 1FXZA 4AEMA 3DN7A 4Q4X2 1MVEA 2R061 1NXD1 2WNUB 4MXWB 1HRI1 1N1VA 4IV1C 3WG4A 2WJSA 5CVRA 3CEWA 4QPYA 1UD1A 4WM8A 4FTBA 4XDQA 3AP4A 1YRZA 2HWE2 3MPBA 4EWAA 4YZ5A 1UZZA 2H6BA 3X29B 3NKTA 4B8EA 2BPA2 1WLTA 3KT4A 2GMEA 5T54A 4YGEA 3GHNA 2B8MA 5T5LA 4OLLA 1H1IA 1AL21 2QZ2A 2ZGRA 4FPCA 1HXS2 4AYUA 4Y20B 4CEWA 2A70A 4TZDA 2W0XA 4I0BA 4AGGA 4P9WA 4GB33 3AB0A 2EVXA 5GM0A 2HWB1 3E5UA 1PVC1 1FV2A 2C9AA 5GLTA 4Y1YA 3V64A 1PK6B 1XU1A 3R0RA 1NA1A 4CDWC 2VW1A 4WZCA 3VV1A 4H55A 1OFSA 4LBJA 4C1WA 1I6XA 3SH3A 4EN9B 2JECA 1SACA 2ZX3A 1ZRRA 4QX5A 3JU9A 1OA2A 2ZGUA 5FMOS 1AXKA 3AKTA 2ZKNA 5JOZA 5CNAA 1MR5A 2D43A 4FP2A 1XNDA 2K0GA 4P9YA 5L7OB 1S0CA 4IETA 4JV4A 3POWA 4TYSA 1LOFA 5JCTA 2DF7A 4LE3A 1BJQA 2AH2A 4XFIA 1U0AA 4AHYA 4N43C 5ACA3 2WFF2 2PHRA 2PHWA 3MF6A 4IESA 2D97A 3ILRA 1SDWA 3ENRA 3VHRA 4Q0PA 4CRQA 4O9GA 5GZEA 1ASJ2 1NOVA 2UU8A 4JTOA 1QXRA 4AQSA 4DMIA 4H7LA 4YARA 2ZX4A 3H1YA 5A3LA 1WUVA 1JYCA 3POYA 1REDA 1TMF3 1XYOA 3VLBB 1BVP1 1DFQA 1QH7A 2A73B 3JUUA 3BALA 4XYXA 4RHV1 2WT0A 1Q8SA 2A5ZA 5JLVA 3P3PA 2OUHA 2WQZC 4KL1A 5L19A 2KA3A 1JN2P 3VZOA 3NO8A 2LM3A 3APBA 3D82A 3VBRC 3CO2A 1H0BA 3WG3A 2IXLA 2ZKLA 2Z42A 4MX3A 5E16A 3FFQA 3GF6A 1RJ7A 2WLPA 1K5MC 2RMU3 3CL1A 3B3QE 4KU8A 2X29A 1NXMA 1WGPA 3FLPA 4XJUA 1VAMA 1CIWA 1OA3A 3BU7A 4LLOA 1LU1A 3H7YA 3MIEA 2WQ4A 3WDYA 1PVXA 3FFZA 2GH8A 1TNFA 5JSRA 3MLKA 3MFCA 1UF2C 3J8F3 4Q0QA 2IC1A 5J36A 3OF1A 4Q4V1 4BWOA 4DY5A 1HIXA 3VBFC 1A78A 4Q4Y3 5E8AA 3RYRA 1AR83 2ZMNA 2XWJB 2YY1A 3PVNA 5JR7B 4FPLA 5C33A 2F4PA 2WIIB 1BBT2 3MICA 1SBFA 5JSPA 4CDUA 4Q4Y1 3WCSA 4CTEA 1FI2A 1KRIA 2YDEA 2PA7A 3BCWA 4BMBA 3RS6A 1XNCA 2BFUS 4FAHA 1WD3A 3MI8A 4A7KA 4Z2WA 1N3PA 2RS32 1MACA 2FQPA 4WVMB 1G9FA 1JYIA 3J8F1 4HT1T 3WR0A 1XRUA 1XNKA 5FPXA 4RS5B 2A3XA 2QNKA 3KLSA 2V73A 2OUJA 2VXRA 3AJYA 4N53C 4L97A 4E4DX 1M4WA 1R092 1RUJ1 3H50A 4FPKA 1VBA1 2ARXA 3SCHA 4MVTA 3MFAA 4EV0A 5T5JA 1MQTB 4R8HA 1DQ4A 2VNOA 2JG9C 2I45A 2RMU1 3E6CC 1HXS1 5FDBA 4AWDA 4QGMA 5I0UA 2JE9A 2UWBA 3D0SA 1KDKA 3JQWA 3A4UA 3S30A 4M00A 3B9CA 1I5ZA 2RS12 4I02A 5BNNA 2Q1MA 3IKWA 1FMD3 4UW4A 4GMP1 2UWCA 3FBMA 4XPVA 5EJ3A 4XJ8A 4CP2A 3NSTA 5JWPA 3RMYA 1YI9A 5EWSA 1BEV2 2CGOA 4WV8A 4FQ4A 3TBDA 2JICA 4Q4W1 1D0HA 2YPJA 3RDIA 4RFT0 2WINB 3WY6A 3VDDA 3ACLA 3VBUC 3VBHA 4A7YA 1NA1C 4I01A 5DUXA 2OZJA 3B01A 3CJXA 3H3ZA 1V6OA 1LJ7A 1ZZ7A 1G9AA 5JZGB 4YGDA 1V9U2 2YUEA 1SMVA 1JXNA 5D8AA 2VVEA 1N1YA 1BZWA 1EPZA 4BIOA 1RVF3 1S0DA 2MEV3 2BWCA 3B93A 5H9PA 4B3NA 1RMU3 2RJKA 3NAPB 4P9IA 2XJQA 5I0TA 2Q30A 1ZZ9A 4LEJA 4S2GA 5C4WA 3ZIWA 4XTMA 4GH4C 1W6MB 2D6NA 2PYTA 1VAVA 3ECQA 4RQPB 2DWRA 1NQJA 4DY3A 4YSFA 2ERFA 2JENA 4AQTA 2RJLA 2EALA 3AKRA 4XFGA 1CVNA 2A6ZA 5AVAA 5HI0A 2WS93 2WNUC 3S7IA 1RUD1 1VBD1 4UXAA 4XEZA 3V65A 2D6PA 2WFF1 4YW2A 1WCDJ 2WSVA 1ENQA 1S55A 4GH4A 2HWE3 4XMAA 4C0HA 1D4VB 4MUVA 1C3HA 3PJYA 4XFBA 2FHRA 2H6CA 4OI4A 4DNYA 2P17A 2AZ5A 1PO22 5K0UA 1SBEA 2HWC2 1H8TB 3PLQA 2FMDA 4L8QA 4JGYB 1MS9A 1FAYA 2WNUA 4SLIA 4W6YA 1MEC2 3VL9A 2O8QA 3R4SA 1AJKA 5BNPB 1PO23 4E27A 1IQAA 3PMSA 3MPPG 3RYKA 4DXZA 1H2KA 1ULDA 2B9UA 4M01A 1RUD2 1IZ3A 1RUI1 5BUVA 2EXHA 2DCJA 2TBVA 1NG0A 4EJRA 2WZPP 4YG6A 4RR3B 5EV7A 2PELA 4CEYA 5IUQA 3VBHB 2PHXA 1E57A 4LBMA 4GA9A 3SLIA 1OOPC 2A6VA 3TB0A 3VGIA 1QQP3 1R1A3 3POSA 2R30A 1HRV3 2DFBA 4RS5A 1AR82 1V6JA 1O4YA 3CJIA 1MVQA 3K51A 1YFWA 1GANA 3VBFA 2XJTA 4ZKTB 3ZYIB 4ASMB 1X36A 4KH9A 2XPJA 4IERA 2WNVC 3SCFA 5BNNB 2RR12 4DS0A 1KD7A 2A71A 2HWE1 3QD6A 2Y0IA 4JTNA 1VBD3 1F31A 1AYN3 1H9WA 2OYZA 4BCUA 5GJ6A 5KWRA 4IEQA 4K7JA 1MS1A 4LBKA 4RQPC 4D7YA 1NQDA 5AFBA 4Q4X1 5LK5A 3ZO0B 5BYNA 4QGNA 2WNVA 1RB8G 4LHLA 1AR61 1AYN2 1AYM2 1QXJA 4LUMA 2ENRA 4RA0A 1UN1A 4QHBA 2ZMLA 3HWJA 3M2MA 3VBOA 2K2SA 3UV9A 1EPWA 4QQ2A 1X7NA 1UCXA 3JZVA 3WHUA 4YG3A 1D4M3 2MEV1 3OY8A 3JD73 4WZFA 1SQ4A 1R1ZA 1AR91 2PAKA 3M70A 2DCZA 4QPGC 1FX5A 1YJKA 4IL7A 2C1FA 1Q8OA 1X33A 2VH9A 1ZRDA 3B00A 4COUA 2GMPA 1PHMA 1PIV3 1NE6A 1W2UA 1BMV1 2D6MA 1PK6A 3GHMA 5BNNC 4XXPA 1PGW1 1EV11 4NHMA 4XF0A 1RITA 1QHDA 3EXUA 3MIHA 3R6SA 4F3JA 3KQRA 3O5SA 1U5XA 4Z07A 1U5IA 2XLFA 1BXHA 2JG8C 3QLQA 3TNQA 3AYCA 5F6LB 3RMXA 3ZXLA 4ISQA 3VBHC 1GV9A 1CONA 2Z5WA 1DQ0A 1VBE1 2Q4SA 2ZA9A 1MEC3 1S0EA 2VOWA 3LOIA 2R041 5EYXA 4CP0A 1F9KA 3KCCA 3M7AA 4AEDB 1BKZA 3QACA 5ABJC 3IT8A 1VP6A 3NV4A 3S7EA 1XYPA 4QT6A 1VAKA 2WSUA 4G3YC 2OA2A 1BEV3 2RS52 1LOBA 3KZ4C 1UIJA 1DQ2A 1QDCA 3FMGA 4AHWA 2GNMA 4JDOA 4UBGA 3VBUB 3AP7A 1N3QA 3R4UA 3LA7A 3LKJA 2PLV3 1ENRA 2D6OX 4LO4B 1T6GC 4BZ4A 3O0XA 1NYWA 1UL9A 3ES1A 2DU0A 1UZYA 5ACA2 1R081 2NZ9A 4I3GA 1OA4A 2D7FA 4ZU4A 2FZ1A 1LULA 2YROA 4E9KA 1YFUA 4M3CB 4IEPA 5BPXA 2R0FA 1YHFA 4I0WB 1G9BA 1ASJ3 4WM7A 2A6WA 3AJZA 3M3OA 3RRDA 4Y1VA 1HV1A 4TSVA 4XJ9A 2GMMA 2G9GA 2PAEA 2ET7A 1QJX1 1UW8A 4D3WA 1CAXB 4WVZA 2WC2A 1RUC1 3L9JT 4E4SA 3KM5A 3CNAA 2QKDA 2XGXA 3H9AA 3MIDA 4JAAA 1LOGA 5BNOB 5FPZA 2ZGOA 5C9AB 3M4FA 4XZPA 1PGW2 2O0OA 3N7LA 1Q43A 4AF9A 4AHXA 2IFRA 4N7UA 1WMEA 1DZQA 4FXGB 2XJUA 1G7YA 2ZX1A 3BOWA 1GR3A 3IWZA 2CGNA 3ZXGA 3FBYA 3QOPA 5GALA 4GQ7A 2W39A 1UAIA 1ALYA 1ENXA 2JJ6A 4IV1A 2I07B 3NAPA 3NW4A 2QUOA 1RHI3 5GLZA 5JVVA 2SLIA 1S0IA 3CJIC 3ES4A 3GBWA 4HPKB 5ABJB 1GQHA 4X6RB 1PGL1 3VKOA 1PNGA 1J1TA 4EN6B 2DTYA 2XVKA 3JB8A 4XFAA 1LOCA 4HK8A 4PLNA 2VW0A 3L2YA 1TMF1 4M0HA 1LESA 4MZUA 3MIFA 1AX0A 3HN1A 1NLRA 1SBDA 1YO8A 3NV3A 2RMU2 4AVBA 1KFUL 3ZN6A 1OHFA 3PJQA 2YZ4A 4N90A 1DDLA 2RS11 1VB4A 4JGZA 4C1XA 1HLCA 3GZTB 1VALA 1OQ1A 2A7AA 2GN3A 2RS31 2YHJA 4I0AA 4HBNA 4XFFA 5F9TA 5ACA1 2P3IA 3AZVA 4YYOA 4COVA 5FOBB 2VY0A 3VBOC 1TME2 4HVOA 5KHKA 1BBT1 1VBA2 1Q3EA 1MS0A 1OQEA 3NV1A 1RUG2 1O7FA 2ZGMA 1XXNA 1ZZ6A 2PN5A 1BYHA 4QPGA 1DQ6A 4W65A 1FOD1 5FBZA 1DLLA 1LGCA 4OI0A 2TEPA 1H30A 1CAUB 1C8M3 2ZGKA 2PLV1 1SCSA 1RUH3 3J8F2 4NN0A 4Q4V2 3VBUA 3VKMA 1PK6C 4LTAA 1LOFC 4Q8LA 4CDQB 1W6PB 1DZRA 3OD4A 1C8M1 2Y26A 1LKNA 2DVAA 3E5XA 3D0JA 4KBBA 3OJBA 4GB31 4FPGA 3VBSB 4XIKA 1FPN2 4UBHA 4LA3A 5GZDA 3AYDA 1BBT3 3PMEA 1X82A 5TSWA 2O1QA 3OYWB 5KC5A 2FZ2A 1X8MA 2MPFA 4Q27A 2WNVB 4OI1A 1H4HA 5KXDA 5C4WC 1ZZ8A 3SITA 5JOWA 5L7OC 2DV9A 1QF3A 4P9LA 4FPOB 5JOXA 1N3OA 1NE4A 2X53S 4TWTA 2RS33 3WCRA 1K5MB 4HPKA 4XE9A 5ABJA 1NY72 2XKOA 4Q2FA 1UKGA 3AMNA 1KS5A 3R4DB 4FTEA 1GZ9A 5CBLA 3ZXKA 1KXGA 4INDA 4B29A 2IXHA 3RJRA 1MS3A 4BE3A 4EROA 1AR72 3PNAA 1PGL2 3FE5A 3M3EA 2R1DA 2BW8A 3MGUA 4YRDA 5FOJB 2XL7A 4W6XA 4R9AA 2D3SA 1N47A 2ZS6B 1J3RA 1QWRA 5H9QA 3N4MA 1K5MA 1H8TA 1AF9A 2IXIA 3DF0A 4AEDC 3DGTA 5K0UC 4IXLA 2WT2A 5CA6A 3JD71 3ME2A 4XFHA 2GNDA 1V9U1 2NP0A 4QQPA 4FAGA 4AQ2A 5IT6A 5CIRA 4QM8A 3B7MA 3WINE 1VBB1 1QJX3 2GDFA