5J3UA

Co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
261
structure length
261
Chain Sequence
VYEKDEGQKEQLERILRQSFLFNSLDEKDLNTVILAMQEKKIEASTCLIREGDDGECLYIVQSGELNCSKLIDGEERVVKVVGPGDAFGELALLYNAPRAATVTSVSACDLWELGRDTFNAIVKDAATKRRSMYDSFLKSVHILDGMDAYERGKVADALRTEMFTDGAYIVRQGELGDVFYIVEEGSAVATKSFGPGQPPIEVKKYQAGDYFGELALINEEPRAANVIAHGICKVACLERKSFKRLMGSVQDLLSKKASEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Kinase A
publication title Co-crystal structure of the regulatory domain of Toxoplasma gondii PKA with cAMP
rcsb
source organism Toxoplasma gondii
molecule tags Transferase
total genus 75
structure length 261
sequence length 261
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j3uA01
1O3QA 1Q5OA 1WLTA 2P17A 3BALA 2ET1A 3IDCB 1UIJA 4IEYA 3USSA 1JUHA 2GU9A 4QX5A 4XFFA 5JSPA 1CAWA 4HZFA 1ZZ6A 3WW2A 4WZCA 4MX3A 3PLQA 5KHJA 1J1LA 3H3ZA 4MZUA 4I0BA 3WW3A 3CEWA 4IERA 1RL3A 2PHDA 5BPXA 5BY5A 3E5UA 1X8MA 2OZJA 3E6DA 4LLOA 3CL1A 3FX3A 3C3VA 1IPJA 4XF3A 2MHFA 4YRDA 4HBNA 1O5UA 1UPIA 2O1QA 1QY4A 3DL3A 4HLTA 2KXLA 4LUKA 4N9HA 4PIYA 3BB6A 3ROUA 2QCSB 4L2NA 3OCPA 1CGPA 2OYZA 5J7MA 4I09A 1ZRRA 2UYBA 5JCTA 3DKWA 4N9IA 4LA3A 2B5HA 3H7JA 1ZZ9A 3ZDSA 2GZWA 3HT1A 2CAVA 2PYTA 3IDBB 5FCCA 3D0SA 2QNKA 2IXJA 3H1YA 1O3TA 4FBFA 1VP6A 3S7IA 5C8WA 4I0AA 4I3PA 4AVAA 2EAAA 1YFXA 5J3UA 1CAXB 4D7TA 1LKNA 1ZREA 4IEXA 4Q0QA 2K0GA 3M70A 5F1RA 5FQ0B 3EJKA 3OD0A 1GQGA 1XRUA 2E9QA 3IIAA 1WGPA 4MGIE 1YWKA 5KHIA 4I2OA 2H6CA 3LA3A 4Q0PA 3ACLA 1LRHA 3EO6A 3I7DA 4LTAA 4Z82A 4HVOA 5FLIA 3U10A 3NVCA 1XE7A 5LRSA 4BYYA 3U11A 1SFNA 2ETEA 5FLJA 1RUOA 3LWCA 4KWLA 1ZZ8A 4P9GA 4XFBA 4XF4A 1FXZA 3I54A 1VJ2A 5J48A 4ORFA 2GC0A 3E97A 3NSTA 1H1MA 4R8HA 5KBFA 2PA7A 4IEWA 1HW5A 4IEZA 2H0VA 2DCTA 3EQEA 1LR5A 1EP0A 3EHKA 3I59B 2B9UA 4BH9A 2IXLA 4HN0A 1O3SA 4AQ6A 3WW1A 2GAUA 4B29A 4XEZA 4BHPA 1UW8A 5KHKA 1NXMA 3UKTA 4QM9A 2PHLA 2OZ6A 2EVXA 4MH0E 5CVRA 5HI0A 3SHRA 1ZZ7A 1LB2A 4UBGA 2K9ZA 1CAVA 2CV6A 3KMHA 4YNIA 4QGLA 4WBBA 1FI2A 3BCWA 4E2SA 1OI6A 3H1WA 3MZHA 1NZCA 2PFWA 3H8UA 4YSFA 2N7GA 1SQ4A 1IPKA 4IEQA 4JV4A 4E2GA 3G7DA 1EYBA 4J1WA 3QACA 3SXWA 2GC1A 3LZZA 4IEUA 3NW4A 2HJIA 5JSRA 4I02A 1UCXA 1O5LA 2BNOA 2Q30A 2B8MA 4WVZA 1RUNA 2CAUA 1L3JA 2D93A 2PAMA 1UIKA 4PIXA 5KHHA 3FZ3A 3H9AA 1QXJA 1X7NA 3MDPA 1J58A 3LAGA 1ZX5A 3D82A 4CYDA 4LUMA 5FPZA 4IEPA 5I8TA 4Q0UA 2QDRA 3OF1A 3WW4A 4HN1A 1EPZA 3FWEA 2Y0OA 3KGZA 4XFGA 2BNNA 3CO2A 2D5FA 3FE5A 3LOIA 3GYDA 4FAGA 1O7FA 4TLFA 4Q29A 4X6QB 4EROA 4ONUA 2Q4SA 3NKTA 4PIZA 5I0SA 4GULA 4HVQA 4ZU7A 4MV2A 2ATFA 2UY9A 3FJSA 1FT9A 2HKXA 3HIFA 3IBMA 2PAKA 3LA7A 2PAEA 1UD1A 5LRRA 2XKOA 4R52A 4YYOA 5K8SA 1O3RA 2IXCA 2GH2A 1CAUB 2XKPA 1NE6A 2PQQA 2FQPA 1Y9QA 2UY8A 3U0ZA 1EY2A 4XETA 1V70A 5EFUA 2CGPA 2F4PA 4QXKA 2GC3A 1YUDA 2XGXA 4EWDA 4JTOA 3RZZA 3BPZA 5CU1A 3NL1A 4AXOA 2Q1ZB 4QMAA 3ETQA 4XFAA 3ST7A 3E5XA 4X6RB 1J3RA 2GC2A 1CAXA 3N4MA 4AVBA 1Q3EA 4HMZA 4QM8A 2OA2A 4ZU5A 4LA2A 4HVRA 3SMHA 2XLFA 5FQ0A 2OPKA 4OFGA 1GQHA 3H1MA 3SCGA 3OGJA 4PJYA 3RYPA 1VR3A 1ZRFA 2EA7A 3RYRA 5FPXA 4UXAA 4RD7A 2IC1A 1TQ5A 3HT2A 4XFIA 1DZTA 4A2UA 3M3IA 3SCHA 2UYAA 5E1RA 4K8FA 4KU7A 1YFUA 3NJZA 1J59A 3ES4A 5JSOA 4F8AA 1DGRA 4O9EA 2D40A 1J3QA 5D1IA 1YHFA 3H50A 4ZU4A 5EZWA 2ZCWA 3RPQA 5JR7B 1DGWA 4MGYE 2MPFA 5FLHA 5C6CA 4I01A 5CADA 4QGMA 3CLPA 3CF6E 5LEJA 1RC6A 4HSJA 5LEKA 1QXRA 3I59A 3KCCA 5BV6A 1O4TA 2QJVA 2IXIA 4Z07A 4JVAA 4H7LA 3TNQA 4EWAA 5FDBA 3RDIA 4DINB 2O8QA 4FAHA 4MUVA 3RNSA 3R6SA 3ELNA 4KL1A 3DV8A 2XL7A 1U12A 1PM7A 5JAXA 4XF1A 2BNMA 1NE4A 4Q0SA 5KHGA 3UKNA 3GBFA 4LEJA 3KSCA 1ZNPA 1OD5A 2ET7A 1H1IA 3L2HA 4E2QA 3TNPB 5AVPA 3E6CC 4EWEA 2ZKLA 5T3NA 2C0ZA 1RGSA 2Q0AA 3E6BA 2QVSB 1ZVFA 2XLAA 1Q43A 3KGLA 3MYXA 4L11A 1XE8A 3BU7A 4XFHA 2Z69A 3SCFA 5BUVA 4O9GA 1SEFA 5I93A 4Q0VA 4MGKE 4XF0A 4FT8A 1I6XA 2Z2SB 3H3UA 1ZZBA 5I8YA 4AVCA 1Y3TA 2BYVE 4IETA 4NVPA 2VECA 3B02A 1WA4A 4IESA 3VHRA 4YARA 2XHKA 3LA2A 5I0UA 1J3PA 1ZZCA 3IWZA 4F7ZA 3CJXA 3PVBB 3E5QA 2BEOA 4EV0A 4XF9A 1RTVA 2PTMA 2VPVA 4KWJA 4LULA 4HSLA 1QWRA 1X8EA 2WFPA 3FHIB 4J1XA 1YFWA 2IXKA 4OLLA 1DZRA 3DN7A 4UBHA 5I91A 2MNGA 4META 3O14A 2I45A 4KWKA 2WC2A 4IEOA 4QGNA 1ZRDA 3FFQA 2BGCA 1CAUA 3MPBA 1X82A 3ES1A 4IEVA 3EBRA 3PNAA 2XL9A 4KU8A 3HQXA 3QOPA 2VQAA 3S7EA 5I0RA 2IXHA 1CX4A 1CAVB 1NYWA 1OFNA 4AQ2A 1CAWB 3OTFA 1ZRCA 2XLGA 3S0MA 2H6BA 2D5HA 4XFCA 1PMIA 2V09A 3JZVA 3UKVA 4JTNA 4BIFA 1YLLA 1I5ZA 2FMYA 5I0TA 5I8SA 1YFYA 3H7YA 1G6NA 1OMIA 4D7SA 3D0JA 5E16A 4MGZE 5BXXA 3RYKA
chains in the Genus database with same CATH superfamily
4LHLA 3VBOC 5JIUA 1WLTA 2P17A 4ARYA 4BOWA 5F5IA 2ET1A 3IDCB 3WF3A 1OVSA 4Z2AA 3PJQA 3V0AB 2GU9A 3MFAA 4PLNA 5HCAA 1CAWA 4HZFA 1FAYA 5C3PA 1RJ7A 2RR11 4URTA 2YDEA 1V6KA 2WZR2 1DU3D 5F7UA 3W5MA 2XQXA 4I0BA 4HOOA 4ET7A 4MO3M 3WW3A 1E5IA 4JRLA 1W9SA 1ENQA 3MEPA 5IW0A 3IDAA 4GAZA 3CU7A 5CFCB 2OUHA 1W2AX 1TNRA 5BY5A 3E5UA 1W8UA 2VJXA 3FX3A 4XABA 1W2NA 1RB8G 3USUB 2KA3A 3C3VA 4FTEA 5D8AB 3JD71 5C8CA 4S2GA 4XF3A 4XDOA 1PZ8A 1BVP1 4YRDA 4NIAA 1A8DA 2VBBA 2RR13 4QT6A 4HBNA 4AQTA 1AF9A 1O5UA 2O1QA 1H1AA 3NV1A 3NMBA 2BGPA 3KT7A 1VMJA 1PO11 2EXHA 1VE0A 3AVRA 3ZM8A 3I49A 3ZSJA 4BQYA 2PELA 4A4AA 4PIYA 1H0BA 1PVC2 3ROUA 3ETPA 3VD9A 3U4XA 3ZSLA 4V1PA 3OCPA 2RS33 2OYZA 1REFA 2ZX3A 1JXNA 3AP4A 3M8LA 4P5HA 5FY4A 1MZFA 2WQ4A 4CCDA 1W8WA 5JCTA 4D7YA 5T50A 3O1PA 3K48A 1K5MB 4QHBA 1KFXL 1OPMA 1GZWA 5IVEA 3C7GA 2NPIA 1UX7A 2GZWA 1VBD1 4E9KA 3HT1A 2AEYA 3MIHA 2ZEXA 1R1A2 2QNKA 2NQYA 2WFF3 3H1YA 3ZYIB 5LZ6A 4H7MA 3B7MA 4FBFA 1A6CA 5BNOC 2P3KA 4AVAA 4P9IA 2VNOA 1LHUA 2IUWA 4LMFA 2VGDA 3ZYFA 4OCTA 5J3UA 5FO8B 1LKNA 4K20A 5HCHA 3BOWA 1AYM1 4UF0B 2HEYF 1LULA 4TSVA 3ZSMA 1LENA 4BA6A 2K0GA 1VLNA 5F1RA 1BKZA 5FQ0B 4WM8B 3OD0A 4LO7A 3WP5A 3HNBM 1V0AA 2CYFA 4CEYB 1WGPA 4MGIE 4Y1VA 5IAXA 4DXTA 5CA6A 2JDKA 1NCRC 1VRH1 2Y6JA 4AGGA 2WQZC 3ZFGC 4I2OA 1OKOA 1QJX3 2FZ2A 3N35A 2WT0A 1H8TB 2ZJCA 4F3JA 2R32A 4C90A 4AVSA 1AYM3 2HWC3 4P9YA 4N53A 4MSVA 5CB7A 2NYYA 5DAVA 1W8OA 5FFOC 3O7OA 5FLIA 1UAIA 1RXFA 1ODMA 5EHDA 3RMYA 4AHZA 4BYYA 3J9SA 4KMQA 1EAH2 1SFNA 1GWLA 2ETEA 1O4YA 3OPWA 2BBVA 5JOXA 4D3WA 4LK7A 2MEV3 2XWJB 1FOD1 3I54A 3JU9A 1YJLA 1VJ2A 2DVBA 5J48A 5JXJA 1UN1A 4ORFA 1F4HA 2EXIA 4W50A 3OPZA 1ASJ1 4FFIA 3WVJA 5FY7A 3M4FA 4Y20A 2DCTA 2P34A 5ABJB 2B7YA 1SMVA 1QU0A 2FDJA 2JECA 1SBFA 2WLQA 4CU8A 4RGGA 4XAEA 3H8OA 2WABA 4BH9A 1FOD3 1KFUL 3H42B 1OURA 4XMIA 2Y6GA 4HN0A 5IVYA 1O3SA 4TTGA 5C9AA 1ASJ3 4CUAA 2HWD1 3FL7A 1UW8A 1RUD2 1XYPA 3KLSA 4UW6A 4LKEA 3UJOA 3ZVXA 4AQSA 4CSWA 5KHKA 4E8CA 5G04L 2GN7A 2O8OA 5CBLA 5EPAA 4B4QA 1OLRA 4DNYA 1HQWA 3K4AA 1HXS1 3B93A 1DBNA 2E7TA 4N8MA 3PTYA 4UW3A 5KXBA 3S5AA 2LROA 2AH2A 2DCKA 1LB2A 3VZNA 3R4UA 3VD3A 1NLRA 1R081 3KMHA 2C26A 1VB2A 3TN93 1RUH2 4ISQA 1JZ3A 1FI2A 2HWE2 1OHFA 4D8MA 4E2SA 5C70A 1OT5A 4XBLA 3W21A 1F8VA 1AX2A 2PFWA 3WINE 3H8UA 3R0RA 2GP3A 3VBFC 4HK8A 4K1ZA 3G7DA 1EYBA 3ZYBA 3QACA 4RA0A 5HPOA 2WA4A 3LZZA 2XJVA 2ZHKA 3NAPA 3NW4A 3JBG3 3I3DA 2WLPA 1IHMA 2R7EB 2HJIA 2WNVA 1OC1A 1WLDA 2BDRA 1O5LA 2A6WA 1YEWA 5DUXA 4FPLA 3VL9A 3ZYPA 4XJAA 4CVUA 4AVVA 5GLVA 4XE9A 3VBUB 2D93A 2VNVA 2WUHA 2VTFA 1GZTA 1UIKA 3BOPA 5KHHA 1S0DA 3VKFC 1RUG2 3FZ3A 4QU2A 2ZGMA 3VHPA 3MDPA 3PIJA 5FY0A 1MS1A 1PNFA 1LOCA 2D6KA 1EV12 1NT0A 1ZX5A 5HV0A 3V0AA 1UXXX 1AXYA 4GWNA 5A7PA 4LUMA 4CYDA 5A3NA 1J1TA 1TMF1 1QQP1 1QIQA 1BEV1 1HRI3 2DVDA 2A3WA 5LK5A 2VMIA 1W06A 2LM3A 2QDRA 2YUEA 1QXPA 2W87A 5LBEA 5CNAA 1D4M3 3IB3A 1XU1A 4ZXKA 1H2LA 3C7HA 1W6NB 2D5FA 1W6MB 2XUEA 3BVCA 4YZ1A 5CFCA 4LIVA 2JJ6A 1LCLA 5LCWL 2SBAA 3POFA 4TLFA 3N9PA 1N1SA 3USUA 1JS9A 5FZ7A 4EROA 3M1HA 1PGSA 4CUBA 1PO22 4ONUA 1C8M3 1PX4A 2WAOA 4PIZA 4YW2A 4MLOA 4HVQA 4Y3OA 4RHV2 5FZ9A 4ZU7A 5K0UA 2UY9A 4CUCA 1FT9A 4IGOA 3HIFA 1JHJA 5JLVA 5H9PA 3ZKUA 1ZBA3 3LPFA 4PDWB 1UD1A 1AR81 1DQ4A 1GKBA 1LHWA 1Q8VA 2Q5TA 2H0BA 3J8F1 3OYWB 3KVAA 4FOYA 1HRV2 2IXCA 1CESA 2DV9A 1RVF1 4PQQA 3O1VA 1QNWA 1E5RA 3KQ4B 4LORA 2UY8A 2ZTNA 3B9CA 2LS6A 4OUSA 5FZHA 2FMDA 1JU4A 4QPWA 1D7PM 1V70A 3DYPA 1UYPA 1X9PA 3RRDA 2CGPA 2F4PA 4QXKA 5J1XA 1OSGA 1UY3A 3HNMA 1IOAA 4C91A 1XYNA 3PL0A 3R4DB 3J8F3 5D21A 3BPZA 1UZWA 2VCMA 3THCA 4CDQC 4QB2A 5FYZA 5JI9A 4COYA 2VQ0A 2Q1ZB 4QMAA 1HQLA 1NA1B 2VTXJ 2X29A 4X8NA 1RUC1 4LO4B 3VZLA 2F4LA 4YFWA 1J3RA 2Y0IA 2VH9A 1HN0A 1L7QA 5DDJ3 4DPNA 1XB9A 2UWBA 3MLLA 1KS4A 1YJKA 3FLRA 4JDOA 2OA2A 4C8DA 4AI9A 1XNDA 4XACA 1BMV1 4HVRA 4YZ3A 3ACIA 4UFIA 3BUCA 1KEXA 4UI9L 3T3YA 5FQ0A 1LJ7A 1LGBA 4LBQB 4LOTA 1H8VA 1UU4A 5ANNA 3ZFEA 5KR7A 1IS5A 1GQHA 3LFIA 4CEYA 2WNUB 4CEWB 3UYJA 5JZGB 1H4GA 1AUYA 4GMP3 2WS91 1JYIA 4UXAA 1H8TA 4MXWB 2IC1A 1TQ5A 1PNGA 4LHKA 3LDRA 1AR72 4RD7A 2UYAA 5GLWA 2HWF3 2W2IA 5LWBA 1SDWA 3N7KA 1YFUA 4XZUG 1J59A 1VBC2 5ACA3 4OMDA 5JSOA 5T5PA 1WLWA 3O0XA 3MIGA 4QPIB 5CEHA 3KHBA 1IS3A 2D40A 1GV9A 3GBWA 3NV3A 4PLMA 2DCZA 3H50A 2ZCWA 2MPFA 4CP1A 4JGYC 4INDA 1JYNA 3FLPA 3AFGA 3WNPA 4W65A 5ABJA 3GBGA 1ACCA 1WUVA 5BNNB 1MR5A 5FK8A 4CU7A 4RN5A 1QXRA 1OKQA 1MQTC 2QQMA 1S0CA 2A6XA 2Y6FA 1R1ZA 5C3QA 2DVGA 2IXIA 4M3CE 5A33B 5GM0A 3ZFFC 3I2FA 1WMXA 4H7LA 1V6LA 4RR3C 2VCBA 1AR91 5FYYA 4IV1B 4D69A 3W5NA 4ATFA 1S0IA 4M3CF 2IZWA 2O8QA 4FAHA 1CZTA 2YPDA 3WHTA 1G9BA 1V00A 3ELNA 3TYJA 2ZGTA 4KL1A 4AEDB 3DV8A 3C8XA 4M01A 3NWKA 3O5SA 4SLIA 4CCLA 2VW0A 3CDZB 2RMU2 4M4PA 4R9AA 2PQSA 1Z7S2 3PTRB 1NE4A 1NQDA 5KHGA 2ZGLA 2K46A 1LU2A 2RM23 2VOWA 3FUQA 1BCXA 1QH6A 4XDPA 4UFLA 4YPJA 2VTXA 4FPCA 2WAAA 1ZNPA 4K1YA 1OD5A 3NNFA 1D4VB 1FNYA 1H1IA 2YC2A 1QOOA 1ULDA 4DRVA 2ZX1A 1AZDA 1QJEA 2RJKA 4AFAA 2A7AA 5IWFA 5C4WB 5T3NA 4GH4B 1FPN1 1AX1A 3VZMA 4CRQA 3V65A 3DXTA 5FPLA 2Q0AA 2QVSB 3THTA 2QDNA 1ZVFA 2XLAA 3I2DA 1US2A 2DCYA 4PI0A 1NY72 4L11A 1G9AA 1NLSA 3WQBA 5T5LA 2VVEA 1BLZA 1E5HA 3VBRB 1OLMA 2JIGA 2Y6HA 1SEFA 4FFGA 1UQXA 2G9ZA 3ACFA 4MGKE 4OYUA 4FT8A 4ZPIA 2Q8OA 3VBUA 3BTYA 2J1EA 2VZ3A 2KR2A 3PDQA 2FDHA 2P6HA 5FZ0A 3D5OA 2WRAA 3WD5A 1W0OA 4ARXA 2Q8CA 4AVCA 1GR3A 1WBLA 5IYYA 2BU9A 4QPGA 4CP2A 2W95A 2RDRA 2RR12 1OA3A 5L7OB 1IG0A 3OD4A 1QJY3 2A5ZA 1C5HA 4TZDA 2NMOA 4NE9A 1SDDB 4QX8A 4XIKA 5GLZA 2XHKA 2JDHA 3LA2A 1OBNA 1Q8OA 1UOFA 2BWAA 5JXIA 2RS51 1W6NA 3N7MA 3DUIA 1W6MA 3B01A 1A3KA 5DAPA 3J7MA 5A7SA 4ZS2A 3OPTA 3VBHA 1ST8A 2RS32 1GLHA 2VXRA 3CJXA 3MIBA 2GMEA 2V4VA 1A8MA 4FPGA 4EV0A 4GZ9A 3F95A 4NR1A 4RSUA 3ZMOA 2Y33A 5FP4A 1POV1 1CIWA 2ID4A 4KG8A 2VPVA 4LULA 1ZA4A 4YVWB 3LOBA 3LE0A 5C33A 2QQOA 4XHXA 1TME3 1X8EA 4QX0A 2VW1A 4DEQA 3FHIB 2RJLA 2I74A 3DN7A 3THDA 2VR4A 5I91A 2MNGA 4META 2WFF2 2I45A 3AX4A 4C1WA 4D6RA 1MVEA 2BUKA 2JKXA 4XJWA 1X82A 4IEVA 4OZOA 4YVSB 1POV3 3AB0A 2QBXA 1SG3A 4KU8A 3J7LA 4N7IA 4IE5A 3GF6A 1HIXA 1ENSA 1QNYA 1OFNA 3OSDA 4LK6A 3W9AA 1CAWB 1S0FA 3OTFA 3SNMA 4JC1A 1W8HA 3WNMA 2FZ1A 3PJYA 3CMGA 2W1UA 3C7OA 5A6XA 1VMFA 2XUMA 4Y24A 5FZLA 1QJX2 2WR9A 2V09A 4AW7A 4FQ4A 1AYM2 2HWC2 2TUNA 3PVEA 1Q56A 3CKHA 3POYA 3K4ZA 4QQLA 1RUF3 1U5YA 1X33A 4QDQA 5I0TA 1YFYA 5FUIA 2YFZA 4COWA 1ND3B 3ATGA 2VBDA 5C8CB 3OEAA 1GFF2 3DEMA 5FZ4A 2MEV2 4LBQA 2W92A 2ZGOA 4CP9B 3D0JA 4OI4A 4D7SA 1IGOA 2PLV3 3UGHA 3WP3A 4AEJA 1GZ9A 3ZX7A 2WNUA 1XQNA 4E27A 5BXXA 3LPGA 4CEWA 1IPSA 5A1AA 5JZGA 2OVUA 1DP0A 1Q5OA 3KZ4C 3POSA 3U37A 4HKOA 5IT6A 2ORXA 1UMHA 1LODA 4MXWA 1QDOA 1E57A 3N7JA 4UFHA 5A3OA 4QX5A 4XFFA 5JSPA 1ALYA 1ZZ6A 1HJFA 2VZVA 4FCAA 4IL7A 4MX3A 4GKXA 4XJ9A 5CIRA 3PLQA 2BTVC 1LOBA 5KHJA 2QQPA 1MPXA 1PMHX 1FOD2 2XVKA 2ARCA 4FFHA 3CEWA 3LKJA 3S57A 2JDZA 5C3SA 4RGKA 3B69A 4GJYA 1CQ9A 1RL3A 4WM7C 1WCKA 4XOGA 1GZWB 3UGGA 5BPXA 2C24A 4FXKB 5BNPC 1X8MA 3I3BA 4K3UA 5FY1A 4BPZA 3CL1A 2BPA2 1UU6A 2PHRA 1UZ0A 3GJBA 2XPJA 1IKPA 1F35A 1H2KA 3ORJA 2XBO3 5JIAA 2X8KA 4B4RA 4YZ5A 1OOPB 2MHFA 5FY8A 4D0QA 1TVGA 1V6NA 5L9BA 5BNNA 4DY3A 2WWSA 2HEWF 1UPIA 4XIOA 1HB2A 1QY4A 3KV9A 4FSJA 1S2KA 2WINB 2K2SA 3TN92 3IMMA 1VBE1 3LEGA 5FR3A 2KXLA 4RYDA 5A33A 3P3PA 1N1YA 4XUNA 4N9HA 1WMEA 4N53C 3KWVA 4FPEA 2ZHLA 1LOFC 2DU0A 3DGTA 5K4LA 1WCSA 4IGPA 5FOBB 2X05A 1GNZA 1W3XA 2OIIA 5DG2A 3ZXLA 4YZ4A 1F5JA 1G86A 2ZA9A 4UFJA 5FZGA 2CWMA 4AEDA 4G3YC 1GP5A 5JI7A 4CCKA 1D2QA 1JU3A 3JBG2 1T6GC 4YW1A 2V4AA 1CX1A 1AR61 1AJKA 4LA3A 2B5HA 1O4ZA 3GM8A 1VBE3 5CKNA 5IATA 1W9TA 5GKAC 3HEIA 2Q8EA 1B35C 2WT2A 1B09A 3GHNA 4QDRA 5FCCA 5SV5A 2IXJA 3O0VA 3R05A 3VDDA 3F2ZA 1ULEA 2C6SA 1RJ8A 1W0PA 1NCQB 1VP6A 5C8WA 4I0AA 4ITCA 4ZKTB 2EAAA 2VE1A 5LA2A 5C4WA 3T2TA 1BBT2 4FPYA 1JYVA 3LDBA 4XZPA 1G9CA 2CSGA 3EXUA 1U5XA 2J1RA 3KCXA 4OHZA 5AC91 3BIEA 1HRI2 4P9XA 3KV6A 4Q4W1 1Y9MA 4XHBA 3M70A 2YBPA 1FMD1 3GCXA 3ILNA 1D4M2 3N9QA 1H6XA 4X8PA 3VBRA 1XRUA 1DGWX 1GMMA 2JB4A 1JUIA 2R073 4Z1VA 1STMA 3AKTA 1W6QB 1H2MA 3CIHA 4DO0A 5FO9B 4PI2A 4WVMB 5AVAA 2CGOA 4D6QA 4RQPC 2FD8A 3FLTA 5FXXA 5FZ6A 3MPPG 4GWJA 1H6YA 4B7EA 5AC93 3EO6A 1C8M2 3MLJA 4Z82A 1S1AA 4Q4X3 5SV8A 5L7OA 1S0JA 3NVCA 3WP6A 1FMD3 4BISA 2ZAHA 3E1F1 1RUOA 2G19A 3LWCA 1ZBA2 3OEBA 3AMPA 4AYUA 1ZZ8A 3LEIA 5FYCA 4XFBA 3IZOA 5B2GB 4AHWA 1FXZA 3T0BA 4HKWA 2JB8A 4CCCA 2WNVC 1DCSA 1V9U1 5KBFA 3ZSKA 1V6IA 1OF3A 4LXLA 3AMHA 3MW3A 3UGFA 3FMGA 2H0VA 1OXCA 1GU3A 3P3NA 4Q1RA 3ILRA 2FHRA 3P6BA 4E4ZA 1LR5A 4W4ZA 3ZYJB 1ZM1A 1IKQA 1ZBE1 2IWGB 3I59B 4YVWA 3PVOA 1MS5A 1P8JA 3KV5A 2AGSA 5EYYA 4CDXB 3O1TA 3NAPB 1Q8QA 1PK6B 1JHNA 2BZDA 2IXLA 3J8F2 3KB5A 4OHYA 1OD3A 1QMJA 2WN2A 2WO3A 4CA9A 3A0KA 1LHOA 4B29A 2QQLA 3UV9A 4ZS3A 4BHPA 1NXMA 2RDNA 2WQ8A 3I97A 4JZRA 4WV8A 5T5OA 3QD6A 2R041 2VMFA 4QKFA 3HMYA 1OQ1A 2DUOA 1AVBA 2GSYA 5DDJ2 2R6QA 5FZ1A 3S6PA 2DURA 5FZBA 4LO8A 5IUQA 1ZZ7A 5CFCC 3UT0A 4BQ5A 1UOBA 3MI8A 4AHYA 1JH5A 2OPWA 1CD3G 3GDBA 4YNIA 2C4XA 2R16A 5D8AC 1UZZA 2W91A 4Y1XA 5FJKA 5L9VA 1YQ2A 5F2WA 2ARXA 1ZYBA 4OI2A 5KC5A 2DTWA 2E31A 4YSFA 1SQ4A 5LBCA 4YM0A 1I3HA 1CN1A 4JV4A 1W6PA 2OT7A 2WJSA 4R9BA 3WDWA 3M2MA 3SXWA 2GC1A 1ULOA 2J42A 1HJGA 4O61A 5JSRA 1ND3A 1UCXA 2HWF2 4LHNA 1RUJ1 2Z4FA 1REEA 3N3HA 5A7OA 2Q30A 1ND2C 1ULPA 2B8MA 3NNMA 2VU9A 3P1IA 3AMNA 2A73B 3CQOA 4GB32 5FZMA 3MIEA 4CP9A 5ACA2 4NWVA 1LU1A 5FYBA 5K0UB 3MF6A 3AK0A 2BERA 4MHRA 2DYCA 2VL4A 3WZ1A 1JYXA 1MS3A 3H9AA 1K5MC 1X7NA 4G4FA 4P00B 3VBOB 4XXAA 5HV4A 5DPNA 3VKLA 2RS11 3JD73 1YQCA 2OQ6A 1BHGA 1RIRA 3R4SA 1WLCA 2EICA 1SLLA 3I3QA 3WT3A 2JENA 1EPZA 4DEVA 3KGZA 4XFGA 1PO13 1QJU1 2BNNA 2DUPA 3CO2A 2BW8A 1UKRA 4QKDA 5F2SA 4XC9A 2FCTA 1N47A 4DY5A 1YXWA 4LHSA 4FAGA 4Y33A 3NRUA 4FPJA 2ZGKA 4Q29A 3AL6A 2BBAA 1TG7A 1KJRA 5DAXA 1UZYA 3TEXA 4Z8BA 1OOPA 1VAVA 2JEMA 3NKTA 4WM8C 4YW6A 4GULA 3LCPA 4MV2A 1AXKA 2Y34A 1UYYA 2P1BA 2Y8KA 4OMCA 3T2PA 3ZN4A 4IEUA 1BXHA 4DQAA 3IBMA 3U4SA 3WQ0A 4QB1A 1JYCA 3Q9OA 4P14A 3UL2A 2RM22 1NX9A 1WD4A 5DZFA 2Y26A 1UXZA 1VBD3 2VUAA 2X53S 1XJAA 4N90A 1W04A 1FYUA 4R52A 3ZXAC 4XMAA 1O3RA 5FYIA 5GLTA 3TWIA 1GICA 4R9DA 1AL21 4QQHA 3ZFEB 3VKNA 1WCUA 4AAXA 5DG1A 1NKGA 1Y9QA 4AAPA 3IT8A 1JZ8A 4XETA 2D43A 2QQKA 3VZKA 1I5PA 4BMBA 2VMGA 3HNYM 1XPWA 3U14A 3SISA 2GC3A 1OUSA 1YUDA 1YQ8A 4GD4A 3W59A 2WBKA 3K3NA 4JTOA 3RZZA 1W8FA 5CU1A 3VDCA 4UOJA 4AFBA 2VZUA 1XNAA 2GH8A 4OHVA 5K9YA 3ZN5A 5EJ1B 1NCQA 2BFUS 4UAPA 1VRH3 1H30A 2E51A 2GC2A 2ZEYA 4O7XA 4AVBA 5ISLA 4CDUC 1QHDA 1SLBA 1QJY2 4HMZA 3V64A 3W58A 4DOUA 3WXPA 5IK8A 1SLIA 2PMWB 4RS5C 4V2VA 1NZIA 3RZGA 5EJZB 3LIGA 3PURA 4Z92B 3SQOA 5KC6A 4UT5A 3KD4A 4OVEA 1BQPA 1POV0 1W6QA 2GMPA 1KXGA 4GWMA 3RYPA 2BGOA 4WVMA 1VR3A 2OXBA 4MOAA 2ZX0A 4XPVA 4G9SB 2EF6A 5HXVA 2EA7A 1NCRB 4YGCA 5CZKA 1PGW2 5FUNA 2RDQA 3ZFGB 1K5JA 5FO7B 1RUI1 2R0HA 3OJBA 1EPWA 4XFIA 2ZGUA 4I3GA 2WYFA 5GALA 5JXHA 5EV7A 4KG0A 4BQXA 1VBB1 4KU7A 1IQAA 5DQ0A 4CCOA 1VBA1 3WHUA 1DGLA 1TME2 1GWKA 4FOWA 3ES4A 4F8AA 4PQ9A 3RJRA 1CPMA 1QEXA 2JDMA 2FDKA 4E4SA 4BU2A 2BWCA 5D1IA 4BK5A 1YHFA 2AR6A 3N9LA 1JZ7A 4ZU4A 3RPQA 5JR7B 1DGWA 4MGYE 2ILMA 4N7UA 5KWRA 2DVAA 4QAWA 3WQ1A 2HWD3 5C6CA 4OQ8A 2NP0A 2UU8A 1OLQA 2W3JA 1JODA 5CADA 2W08A 1W8TA 3SC7X 5LEJA 2VOVA 2LALA 4Q4Y1 2B4KA 1S4CA 3GCWA 4J6GA 1HXS3 5H9QA 5A32B 3I59A 3KCCA 1IZ3A 3H0OA 2QQUA 4NN0A 1O4TA 1COV1 4N43C 1HB4A 3T0AA 4CDXA 4CTEA 4Q8LA 4CZSA 5F9TA 1PK6A 2VZ1A 3MHZA 1R083 2QJVA 3BIWE 3ILFA 2I2SA 4Z07A 5FZ3A 3A21A 1QDCA 2GN3A 3WF0A 2HWB1 1LOGA 3WG1A 2ORZA 3PU3A 4XTPA 2DFCA 3AP6A 3R6SA 3EB7A 3KQRA 2O0OA 4JGZC 3WDVA 5FZKA 1H2NA 2WZEA 2XL7A 3B94A 3I4IA 1RUF2 3RSJA 1PM7A 2EALA 3AZVA 2A3YA 2OQ7A 2X5IC 3A22A 3MLKA 4UFMA 5LBBA 4XF1A 1UU5A 2BNMA 2LRPA 1WBFA 1U5IA 4QPGB 2VZTA 4GKYA 3UKNA 1R091 2C1FA 4Q26A 1LGCA 1O8PA 1XSRA 4NMIA 2PLV2 3IAPA 5A7WB 2E63A 1TE1B 2GP5A 3N9OA 4KH9A 5A3PA 4HPKA 3VGIA 4PT6A 5EJ3A 3OBTA 3E6CC 2ZBJA 4DIQA 3OGSA 1YCIA 2ZKLA 2XG3A 2XOMA 5DZGA 3VBFB 4PDWC 1W2OA 3UETA 1YQ6A 5EXOA 3E6BA 2YGMA 3VBHB 2XJRA 5IJRA 4JHTA 1JZ4A 1RUE1 3AKQA 3HQRA 1TMF3 1QQP3 3GGLA 1BEV3 1PIV1 1XE8A 3WCRA 3FC0A 1JN2P 2D7FA 1CZVA 5A70A 3SCFA 5I93A 4FFFA 3KCYA 2G1MA 1I6XA 1DF0A 4Y1UA 2DU1A 2JXAA 5ERLA 2V5YA 4JRAA 4HONA 5I8YA 2XVLA 1QJZA 3VBOA 1ENXA 1E5SA 2XBO2 4LJHA 4NJ4A 3NJXA 5FXZA 1GP6A 1RUE3 2VQTA 4LBJA 2IVJA 2YU1A 3L2YA 3MO4A 5EWSA 2JG9C 3NO8A 4QXBA 1UL9A 1GWMA 4YARA 1NA1C 3HBKA 2GNTA 2IVIB 4AR2A 1AR83 1JOPA 2OUJA 3LD8A 3OBAA 4FOVA 1DQ6A 2VNGA 1ZZCA 3IWZA 3D6EA 4P9LA 2A6VA 4BXSV 3MFCA 4QHOA 1RVF3 4CDWC 1W9FA 3KM5A 3SH5A 4A7YA 1DLCA 2ZOEB 3WNKA 1C5IA 3ZYHA 5FPUA 1RTVA 1XC6A 1ONAA 5IVFA 2GNDA 3GZEA 1SBEA 4KWJA 2PHFA 4XTMA 1H4HA 4OUEA 1QWRA 3SEEA 4JCKA 5E8AA 2JX9A 3CBNA 2Y6LA 1YFWA 1URXA 1S0BA 3NNLA 4B8EA 2XDVA 3O14A 1ZRDA 4QGNA 1V6OA 2DUQA 2XB6C 2WL1A 3T09A 2E33A 2GDFA 3AFKA 2XJQA 2XVGA 4AI2A 4K7JA 3MICA 4P9JA 1RUC3 3M7AA 2Z79A 3TRSB 4IW3A 5J09A 1XSQA 2WZR1 3HQXA 4QPIC 1L7RA 4FVVA 5I0RA 1CX4A 3CJIC 1BVVA 5J98B 3POWA 1UY1A 4BB3A 2R072 2W5FA 3APBA 4K6BA 5J36A 3ZKYA 1OPOA 4XUQA 2H6BA 3ACGA 1Z0HA 2J1VA 3N9NA 3S30A 1G7YA 5B4XA 5BNOA 1PZ7A 1LTEA 5JUVA 5AC92 2WS93 4JTNA 5F39A 2VQUA 4RGAA 1YLLA 3I2GA 4Q4X2 1XNBA 5LBFA 5T55A 4ZHNA 3O1SA 3MF9A 5A6ZA 1OLME 4JQRA 1FMD2 4H2AA 4IV1C 4EN6B 5IVJA 3TEWA 2GMMA 1HV0A 2Y64A 1PVC1 1JOBA 1XNCA 1FNZA 4PLOA 2C9AA 3AZZA 5F5QA 3ZYRA 4EJRA 4Y5TA 1H9WA 5E16A 1O6UA 4E4HA 1O91A 3VB9A 2UURA 4XBNA 3RYKA 2P3IA 3AJYA 1AX0A 4XUOA 1GUIA 1NCRA 4YM3A 2WN3A 4MXVA 5LASA 1UYXA 1UIJA 1W8ZA 4XW3A 5FMOL 3ZFGA 1H9PA 3NNJA 5FP9A 2ADEA 4EZ4A 1X50A 4WZCA 2G9GA 2Z5WA 5L73A 3EYPA 1J1LA 3H3ZA 1VAMA 4MZUA 2W1QA 3BN6A 3DPRC 3OUHA 5FP8A 4ES9A 3J7HA 1LAJA 4LNVA 3VBSC 4GH4C 1IS6A 3VHOA 4AI0A 1PGL1 3N36A 2OZJA 1ENRA 1JYTA 1DQ2A 1N3PA 2YROA 3AMMA 5JMCA 5A6YA 1AR93 4BDVB 2J1TA 1AYN1 1VRBA 2DBIA 3J4UH 5CYYA 3WSOA 5FWJA 4DXZA 3VDDB 3WNXA 2XONA 2FDFA 1N3QA 3LF7A 1UO9A 5A32A 1W6OB 3UNPA 4IE7A 2CDOA 3POBA 4HLTA 1CIYA 1MQTB 4LE3A 3UJQA 3BU0A 4JHZA 4LUKA 5LY2A 2GALA 3U75A 3GNEA 3U78A 1AYN3 2NZ9A 3ZFFB 4RR3B 2QCSB 4IV3C 4NHLA 1OQDA 4AI8A 1A78A 2J1SA 4MHUA 1OH3A 5FYTA 2BV4A 3RQ0A 5J7MA 3VD4A 4I09A 1BYHA 1ZRRA 1FPN3 1EAH1 2UYBA 4QU1A 5A3WA 3RGBA 4HT1T 1UF2C 3DKWA 1K12A 5A3MA 3H7JA 4UWDA 4COZA 2B46X 1ZZ9A 4GALA 4HL0A 1EUTA 1PMJX 4YW3A 2CAVA 2PYTA 3IDBB 5GZEA 3D0SA 4AGRA 5JPMB 1O3TA 2ZZQA 5A7WA 2HYKA 3IN9A 1ODNA 3S7IA 4M0NA 5CFDC 2P3JA 4YVWC 5DUWA 4I3PA 5IVBA 1MZ6A 1V6JA 4LO6B 3VBFA 2KM2A 1CAXB 1BK1A 3PUSA 3D3AA 2EIBA 2E7AA 5JWPA 4D7TA 5L36A 2V72A 2AEZA 3JD72 4FQZA 1Y4WA 4IEXA 3I3MA 4Q0QA 2JIJA 2JG8C 2YC4A 2ZPXA 4CPBA 4NIIA 2W94A 1GQGA 5DUUA 1PO12 2E9QA 2HBUA 2QFEA 3ZPYA 4YVSC 1RUD1 2RS53 5KHIA 4ASMB 1US3A 3T2OA 3LA3A 2BOIA 2NMNA 5A1FA 4L9BA 3I7DA 4LTAA 1LECA 1KDKA 2D6PA 4EN9B 3U10A 2W1SA 1XE7A 3PMSA 5LRSA 3DECA 1RUH1 3PHMA 4F83A 1G9FA 1W0NA 2CDPA 2DBNA 5FZDA 2HWE1 5GZCA 3ENRA 5JMOA 3TEYA 3ZYGA 3Q8EA 3NJYA 3RZMA 3TB0A 3WG2A 2CTVA 4YG3A 1VBD2 2Y6KA 1MS9A 3DKQA 1Y43B 3OUIA 1C4RA 3HVDA 3WF1A 3E97A 1H1MA 2JDAA 4R8HA 2PA7A 5C8CC 4IEZA 3ABZA 2ZGRA 1XNKA 3EQEA 3QH7A 3BI3A 1DQ5A 1RMU1 2QQWA 2VY0A 1UYZA 3FBMA 2HWE3 3VZJA 1W6PB 1EP0A 2VZOA 3ZR5A 4NROA 2B9UA 1PZ9A 4NRMA 4XURA 3MW2A 1KQRA 4LBMA 3K75B 5FYVA 1RUG1 3MUY1 4YWAA 1DG6A 3JB8A 2XH6A 4AQ6A 1C1FA 4H14A 2GAUA 3WW1A 3H8XA 3WF4A 2VNRA 4XEZA 1UZVA 2RJ2A 1EV11 4IXLA 4M0HA 4IDZA 3KVBA 3UKTA 3GHMA 4QM9A 4W6WA 2YBSA 1VRH2 3IDEA 2AC1A 1RMU3 4Q8KA 2OZ6A 1W2UA 2EVXA 5CVRA 4RFRB 3BTXA 3SHRA 5LK7B 5FY9A 5CG8A 4BK4A 5APAA 2UWAA 1EUUA 4I0WB 2ZABA 2DWRA 4UBGA 4A42A 5JOZA 4BM8A 2CV6A 3IAQA 1LHNA 4QGLA 3M3EA 2D44A 2VUDA 3S5QA 3KT1A 1OI6A 4K21A 4QX7A 5CISA 1NZCA 1YQ5A 4QX3A 2N7GA 1PO21 3AP5A 3WR0A 5C3RA 1IPKA 2AENA 4IEQA 5TSWA 1ASJ2 4A6OA 4RHV1 4HKLA 5T54A 1CJDA 2JE8A 3SH3A 1GBGA 3NV2A 3KHCA 1ULGA 3ITQA 1MS0A 3RWNA 2VZQA 1UWWA 3J26N 4I02A 1WW4A 4WVZA 1RUNA 2D3SA 1HRV1 1L3JA 3TEZA 2ZACA 1OF4A 2XWBB 3AVSA 3JCIA 2YGLA 3MW4A 4LOSA 2P6CA 5FYSA 1CR7A 3AC0A 1CWPA 4YGBA 1KRIA 2NN8A 2JWPA 3HD8B 4D6SA 1Q8SA 2R0FA 2D97A 2WZPP 3M3QA 2HWD2 3LAGA 4E8DA 4DUVA 2R30A 3LFMA 4FO9A 2JDUA 5JOYA 1TNFA 1KDMA 3LGRA 4FPHA 5F8PA 2A75A 5FPZA 1LNSA 5FZOB 3JB4C 1HXS2 2AZ5A 3VD7A 3W20A 5DAQA 3OF1A 2ERFA 2X10A 1R082 4JKLA 3KT4A 2FBEA 3FE5A 4GQ7A 4XXPA 3DCQA 1W90A 3GZTB 3GYDA 1O7FA 5BNPB 4Q1PA 1GNHA 1W03A 3FUOA 5A1LA 5IVCA 4X6QB 5FV3A 4BZ4A 3X29B 1N3OA 4KBZA 2ARBA 1XOYA 4YLZA 1SACA 4PBPA 3IIIA 1Y9GA 2A70A 3N9MA 4YG0A 5F3EA 1D0GA 1F2NA 1W6OA 3FJSA 3HAGA 3OY8B 2HKXA 4QWNA 2OKXA 3GJAA 4A41A 3K51A 1MQTA 1AR63 5FZ8A 5FZIA 4MVTA 3ZDVA 5C9AC 5C5UA 2XKOA 1GYKA 1TZOA 1C1LA 1MEC1 1W9YA 1ULFA 2V73A 2XJUA 4OULA 4GA9A 4AI3A 4QKBA 5K8SA 3OB8A 4FXGB 1CONA 4RR3A 3ZFFA 4NIHA 2YMZA 3ME2A 4Q4V1 1CAUB 2XKPA 2JE7A 1AR71 4FTBA 5FPAA 2FQPA 3K2OA 2WIIB 3LQCA 4IUGA 2W39A 1Q8PA 5EIYB 1T2XA 5EFUA 4AVTA 1VBC1 2QQVA 3NQHA 4Y1YA 1TMF2 4EWDA 1QQP2 1FV2A 1BEV2 5DMYA 4DUWA 1MEC3 1RYYA 4XDQA 1DIWA 4OI1A 4Q4W3 1Z78A 2XQRA 5C5TA 4LKFA 3Q8FA 5BYNA 4S2HA 1B35B 5FYHA 4AXOA 4Q4V3 3THPA 4OHWA 1QF3A 2E6VA 3ETQA 4NOTA 4XFAA 4KI5M 4X6RB 5FY5A 3NAPC 3BTZA 5FP7A 1FV3A 1CAXA 3N4MA 1RUE2 5FZAA 3LEKA 3WNLA 4LBOA 2YFUA 4QM8A 5FUPA 4CCMA 5T52A 3KF5A 1SCSA 1NAEA 3ZXKA 4GJZA 4ZU5A 3GALA 1SBDA 2XJSA 4NHMA 4OQ9A 3SLIA 1AR82 1WD3A 3Q8BA 4HANA 4IE6A 4PJYA 4FPOB 4BWOA 2VAUA 1UX6A 4QQOA 1VALA 2VCCA 3TOJA 4QQPA 4CCEA 5FPXA 3K46A 2VD7A 4JDNA 1XXNA 4RQPB 5DUVA 1V9U3 1RVF2 2PHUA 2YC0A 1DZTA 2RMU1 4A2UA 1Z7S1 3B00A 5E1RA 5E6HA 3AYEA 5KXEA 2NLRA 5FKBA 1ZBE3 2BP6A 1XNTA 3WDXA 5FTTC 4AI1A 1O59A 4MGTA 1DGRA 4L99A 3VZOA 4O9EA 4DMIA 4KNCA 4FI9A 1DHKB 4GIQA 4LBQD 4AWDA 2R49A 3AXEA 5FLHA 2YG0A 2BRTA 2QTWB 1HN1A 2WKKA 4H3WA 3FBYA 4I01A 5A80A 1S55A 4LE4A 1RUC2 5A7QA 3ZIXA 5CG9A 5K0UC 2R043 1NY71 4QGMA 1LEMA 2YPJA 3CF6E 1RC6A 3I3EA 4HPKB 2AUYA 4B4PA 4ZZ5A 5BNQA 5IHRA 1K42A 4AEKA 4AL9A 3IPVB 1IQDC 1DDLA 4K8RB 5A6QA 1WW7A 4ISRA 2F6BA 4OZXA 4LBNA 1BMV2 3BPSA 4TYSA 5F3GA 4JVAA 1GOFA 2ENRA 1SLTA 4EWAA 4XUTA 1RHI1 4YFZA 5FDBA 3VD5A 4RL7A 5JOWA 1SPPB 4Y22B 3PUIA 2O14A 2OS2A 1HKDA 2WS92 3LB9A 4Y5SA 3WDUA 3POGA 4V2WA 1U12A 5F6LB 2ARAA 2D3PA 2QQJA 4J25A 5E89A 4A3ZA 2FDIA 4NIDA 5E88A 1MS8A 2A71A 4Q0SA 3JUUA 3AZWA 2Q8DA 5AFEA 3GBFA 1RUJ3 3ASIA 1GNYA 2R1BA 1JZ5A 3KSCA 1RHI3 1UOJA 1Y7BA 2ZGNA 4CUGA 1GOGA 2RS31 3JQWA 2ET7A 5FOJB 2ZKNA 4AE2A 3VHNA 4CE8A 2ZGSA 5GZFA 4E2QA 1LGNA 4EWEA 1RGSA 1FATA 2ZS6B 4EN8B 1AXZA 3H8RA 4BIOA 4YM2A 2X09A 4NAMA 4Z2WA 1Q43A 1WCDJ 3OBRA 3KGLA 2RS13 4A44A 3OBZA 3ZFEC 3VLBB 4XFHA 5JXGA 4XQ4A 4CEYC 2WFF1 1ND2B 2WO1A 5DAWA 3HWJA 1D0HA 2ZGPA 2B9VA 3WDYA 1QJU3 1AL0G 1WWYA 1H8TC 1ZZBA 5FZFA 1AR92 5CKQA 2WDBA 4ZXEA 4NPRA 5EP9A 4MYEA 2BYVE 2D3RA 4DXRA 2RVAA 4PF5A 3B02A 2HEVF 5FZOA 5FZCA 1WA4A 4YW7A 2QUOA 2PXJA 4IESA 3C2UA 3VHRA 2BVBA 4XUPA 3AMQA 4WZFA 2QKDA 1W8NA 5I0UA 2JKBA 1PGL2 2ZHNA 4CCNA 1QJX1 4WM7A 1AYN2 4HFSA 2W46A 4NRQA 3LDKA 5BNPA 1UY2A 2HWC1 2C5DA 4NHKA 4E4DX 2VUJA 1A34A 2VXJA 1AL23 3AKPA 5ABJC 2WZ8A 3WX5A 3ZXJA 3RZHA 4K40A 4TN7A 2BEOA 1WCQA 4XF9A 3SKJE 3QH6A 2PTMA 1FPN2 4DB5A 2J7MA 1WMFA 3OY8A 5BNOB 3WOGA 4NIGA 1NXD1 2MEV1 3SKVA 4Y5Z0 2W0XA 4XVHA 2R061 5FXVA 3C7FA 4UBHA 4UFKA 2VMEA 5A3LA 2WC2A 4IEOA 3FFQA 1CAUA 1HB1A 1HV1A 1LOFA 1MZEA 3B9IA 4JAAA 4JKMA 3VN4A 3MPBA 3O1MA 2YBKA 2BOJA 4BMEA 4YGDA 3RWKX 3EBRA 3AZYA 2XL9A 3PIGA 3T30A 3MIDA 5JR2A 3QOPA 5FXWA 2FDGA 4HK9A 5EYXA 1M4WA 3CNAA 3B3QE 2IXHA 2DVFA 3KS7A 2R063 2VUCA 4AEMA 3O1OA 3VDBA 1CAVB 1OA4A 2GNBA 4QDSA 3RJ2X 1B35A 2VMDA 2RS52 2XLGA 2CY6A 3POEA 1JYWA 4A3XA 4GXLA 4AOCA 1BZWA 2ZMKA 2PHTA 2WO2A 3U1XA 5A7NA 4BQWA 2TEPA 2FMYA 1I5ZA 1RUI3 3MV11 5I8SA 3AP7A 5T5JA 4CDUB 3TN91 2XHNA 3AM2A 1PM4A 2OW4A 3VBUC 1VBB3 4RS5B 5LB6A 1G6NA 2RG4A 1VBA3 3NJVA 1JI6A 4NAOA 2LW8A 5FMOS 3VDAA 4FTSA 1WA6X 3AYDA 4YM1A 1WMDA 1F5FA 5F5CA 3RFRA 1O3QA 1K45A 3LSEA 3ZLIA 1YC61 2VCAA 3BALA 4GWIA 2E32A 4IEYA 2LUWA 4RQPA 2D6LX 4QPGC 5DN2A 3USSA 3JBG1 5HCBA 3WUDA 3ALQA 1JUHA 1DFQA 1YNAA 3WW2A 5LY1A 4QKNA 3HR9A 2WNOA 2CWSA 1ULCA 4KBBA 4Q4Y3 3TBDA 3ON7A 1HDKA 4B1MA 4W8JA 2E7QA 4IERA 1COV3 3HQUA 2VM9A 1YI7A 2PHDA 2A3XA 2WSUA 2W1WA 5A3UA 2VZRA 2ZGQA 3VBHC 1C3HA 1DQ1A 1AJOA 5IFTA 3E6DA 4LLOA 3V56A 1NOVA 1BBT1 2WSVA 3AP9A 2HWB3 2VC9A 1IPJA 2Z42A 1RMU2 2D6MA 2A6YA 5LATA 4FP2A 2XJPA 1HRI1 2D6OX 1QH7A 1WW5A 1MS4A 1LOAA 3BKZA 4BQ4A 1D4M1 1X36A 1JOJA 3IPVA 3DL3A 5FAXA 5FJHA 1NQJA 2JDNA 1R64A 4N43B 2QE3A 3PVNA 4YW5A 4ZONA 1BK0A 5FYUA 4U2AA 1BBT3 1R093 3I2KA 3BB6A 4M3CB 1G9DA 4L2NA 4XCAA 1UMZA 3HN3A 4OUMA 3ZSEA 1C8M1 3OG2A 1CGPA 1YRZA 1SPPA 4Y22A 4DFSA 4P9WA 2VULA 3A0NA 4JGZB 2QZ2A 3T1MA 1ZBA1 2DDUA 4N9IA 1O8SA 2YYOA 2VZPA 3ZXGA 2X5IB 2Y38A 4WVWA 3QLQA 2HH9A 2Y60A 3ZDSA 2FCVA 1PIV3 4BE3A 5FPBA 3M3OA 1SZBA 4QPYA 2WYSA 3ECQA 5FMDA 5D8AA 4DRRA 5IVVA 1PVXA 4ES8A 4DUXA 4MGQA 1YFXA 2CNAA 4EZHA 4AGVA 3PUHA 4O65A 4ASKA 4H55A 1APNA 4XJ8A 1ZREA 4FPKA 4LT5A 5FZEA 2P3YA 2RDSA 3OGRA 2YXSA 5F3IA 1GQPA 1JBCA 3EJKA 3JQXA 1DYKA 1ND2A 3RMXA 5IFPA 2WNUC 2EXKA 3IIAA 4CEWC 1YWKA 1VBE2 5JZGC 3MIFA 1IS4A 3O1UA 1REDA 2H6CA 4SBVA 5DDJ1 1K5MA 4Q0PA 3ACLA 2W9XA 1LRHA 1WW6A 3RI8A 3M3CA 3DXUA 1CZSA 3TAYA 3C7EA 1YIPA 4HVOA 3T0DA 2ZMLA 1W39A 4M00A 3BTAA 4Y4RA 1U0AA 2OX0A 2JG9B 4R4XA 5FLJA 3U11A 1DQ0A 4KWLA 1AR62 1S0GA 4P9GA 2CL2A 1C57A 4XF4A 1XE0A 5F3CA 1N1TA 5C71A 1LESA 2TBVA 4GMP1 2P2KA 5KXCA 2GC0A 3ZPOA 3NSTA 1QJFA 4B1LA 2BFUL 4KGGA 4LLFA 4UF0A 5FRAA 4IEWA 1HW5A 5J37A 1U5ZA 4LBLA 5L19A 1UY0A 2DTYA 4OI0A 3ZOIA 5BNNC 4CDQB 3WV6A 3RZKA 4DZGA 4CDWB 2HWF1 4R4ZA 4WM8A 4FOQA 1I1EA 3EHKA 1POQA 1NG0A 4GB31 5ACA1 2QZ3A 2WZR3 2ZEZA 4BLIA 4S2DA 5DABA 2BJSA 4BQ3A 4ATEA 3WG4A 1MEC2 4P5YA 4Q2FA 1AHSA 1XBFA 4Q4W2 3BYWA 4UYBA 3OGGA 3IKWA 3SEPA 3D8CA 3WY6A 4Q4V2 3AYAA 3VKMA 5FK7A 3G6JB 1HLCA 1SCRA 2YV8A 3T4VA 4L8QA 2CU5A 2PHLA 2QQNA 1VPHA 4W6YA 1OA2A 2CGNA 4AEDC 2YU2A 4MH0E 3URFA 5HI0A 4PF1A 4GB33 4Y1ZA 5FBZA 3AKRA 2ZZJA 2RE9A 2K9ZA 1CAVA 5FREA 4S2FA 4MG2A 5H9RA 3CJIB 4WBBA 2VVFA 4B7KA 3VDDC 3BCWA 1SLAA 1ZRIA 1PVC3 3H1WA 4TXWA 5FBJA 2EXJA 5FKCA 1MZ5A 3WEZA 4A6SA 5JPNB 4P08A 3MZHA 1R1A1 3O12A 4R9CA 5D2AA 3WNNA 4BCUA 5C4WC 3FN9A 4XQDA 4E2GA 1LHVA 1F31A 1V9U2 4J1WA 2XMLA 4I30A 2W47A 4NUBA 5F32A 2EIEA 3MBWA 4DXSA 4Q5OA 4NO4A 3OOXA 4K9SA 4CDUA 4U36A 4JGYB 2BNOA 3VBRC 2RM21 2G4IA 1J83A 3CZUA 3LIHA 4CXXA 1ZBE2 4RS5A 2CAUA 4FP3A 3O0WA 1R1A3 2ADDA 3K4DA 2PAMA 4URAA 4PIXA 3ZIWA 1RINA 5LA9A 4BXFA 1QXJA 4MADA 1J58A 4TWTA 5FPVA 4ZY9A 5B4NA 3D82A 3IMNA 2C9KA 5L7OC 2PN5A 4UW5A 2R042 4AFDA 1UPSA 1VIWB 1KD7A 1DYOA 4LBKA 3GZUC 4DS0A 4IEPA 1W9WA 2TNFA 1W99A 2JDPA 4Q0UA 4CU9A 5I8TA 3T2QA 1W2TA 3WW4A 4HN1A 3FWEA 2Y0OA 1SHWB 1XU2A 3RG0A 5G05L 4A7ZA 3DPRB 1FX5A 1X9TA 3LOIA 1RITA 5GZDA 3VBSB 5J96B 2CHHA 2HBTA 3NNGA 5DXDA 3RI9A 4YW4A 1UKGA 2JDYA 1S2BA 1QJY1 1YO8A 2Q4SA 4XILA 2ZMNA 5I0SA 3B5LB 5A3TA 2R1DA 4Y26A 5GLUA 3NKGA 2ATFA 3INAA 3HPNA 5HBAA 1EAH3 2YZ4A 4LR4A 4XQWA 2PAKA 3LA7A 2Q1FA 5JVVA 2PAEA 4PHZA 4QXHA 5LRRA 4N43A 1RUJ2 3CZJA 1RHI2 5F37A 4YYOA 1L7LA 2ES3A 3I2IA 2L9LA 1PGW1 2AYHA 1OUXA 3HOBA 2XXZA 2YY1A 4M3CA 3U07A 2GH2A 3T4HB 1W28A 1NE6A 2PQQA 4IV3B 3AL5A 2G9FA 4BIFA 4EE2A 3ZXEA 3U0ZA 1EY2A 3DYOA 4JGZA 1IG3A 5LA1A 4L0PA 1TME1 3QBQA 3WLUA 3ZN6B 2RS12 2X5IA 1C28A 2AREA 2XGXA 4COVA 5I0DA 2IFRA 4JX0A 2VG9A 3I2OA 1QOSA 3FHAA 5IK4A 3NL1A 3GXUA 4NHYA 1QJU2 1V6MA 1JW6A 4QD2A 1RUD3 4M4RA 3ST7A 3E5XA 5M0TA 2W68A 4IE4A 4QXCA 1XYOA 3KV4A 5CFDB 2V5DA 1SFPA 4NHXA 1GSLA 4IQPA 4PDWA 1ND3C 1GANA 3CHXA 2SLIA 2BQPA 3IM0A 4A45A 1Q3EA 5C3OA 2DF7A 5AFBA 4COUA 1RXGA 3OYWA 4LA2A 1BJQA 3AYCA 3SMHA 2XLFA 4HETA 2JG8B 3I2JA 4PCRA 1RUH3 3V0BB 1F4AA 2OPKA 2XJTA 5JDBA 1DGRN 3HBZA 4OFGA 3H1MA 4C0HA 3SCGA 5KXDA 1TEIA 3OGJA 4LQRA 2E53A 3AKSA 3Q8AA 1KITA 1WKYA 4AG4A 4EYUA 4LPLA 1ZRFA 1HB3A 3RYRA 1JZ6A 3ACHA 1AL22 1S2EA 1RUF1 3HT2A 3T1LA 3MUZ1 2JD9A 3M3IA 3SCHA 2ZAAA 4K8FA 4LITA 1UOGA 3PU8A 2JG9A 1YIFA 1LOEA 2VMHA 3NJZA 3WP4A 2PLV1 1NA1A 3WCSA 4IGQA 3Q8CA 4UW4A 3RVHA 5FIXA 2HYXA 1KJLA 5IK5A 2AACA 2GNMA 4W6XA 1RUG3 1J3QA 4AHXA 2VOKA 2B39A 5EZWA 4JDMA 1OOPC 4CCJA 1EV13 1JTZX 1WZXA 4QB6A 3ZMNA 3WF2A 4CDQA 5GJ6A 4CDWA 2PHXA 2JICA 2YB7A 3CLPA 2VO5A 4HSJA 4EN7B 2JD4A 5LEKA 3EMRA 1N1VA 4MGSA 1W3VA 2J1UA 2Q1MA 2R062 5BV6A 2A6ZA 3K77A 3FHQA 5F6KA 3AXDA 3I2HA 2XR4A 1VAKA 5L9RA 1C8NA 3TNQA 1SFYA 3LEMA 3WUCA 3RDIA 2VOTA 2ZXQA 3HN1A 4DINB 2P5BA 2A1XA 2XBO1 3N7LA 5IAVA 4MUVA 3RNSA 4XAAA 2P37A 1PO23 4NPLA 1PX3A 4YZ2A 3D4KA 3L9JT 4YG6A 5F5AA 1RUI2 4RHV3 2VZSA 4BJ0A 1CJPA 1QGLA 1VMHA 5JAXA 3PMEA 4QPIA 5H9SA 1G8WA 1PHMA 1ZA7A 1I9RA 4YGEA 1K3IA 1VBB2 3CJIA 5IK7A 1VBA2 4LEJA 4QQ2A 4QX2A 4XYXA 3SH4A 4AF9A 1KGYA 1J84A 4HG6B 3UK9A 4ZZ8A 1HRV3 1NCQC 1HQNA 3PUQA 3L2HA 1KS5A 3RZJA 3TNPB 5AVPA 5C7GA 1DLLA 1GZCA 2C0ZA 5HCFA 4WM7B 1GP4A 3A23A 5DZEA 2B45X 2ZEWA 4LIUA 3DF0A 1DYPA 1OQEA 3UESA 3VUOA 3MYXA 3DYMA 1T6BX 3GZAA 4JGYA 2DFBA 4Q4Y2 4IV1A 3BU7A 1DZQA 1NLQA 4PBOA 4XJUA 2ZX4A 2Z69A 4EQVA 4BLJA 3NV4A 4O9GA 5BUVA 4NWWA 4L97A 4L92A 1COV2 3A4UA 4P02B 4Q0VA 4XF0A 4B3NA 2Z2SB 4KQ7A 2WA3A 3LSDA 3H3UA 4OHXA 3I8TA 3WQ7A 3RS6A 2VOXA 2HWB2 2RHPA 3K3OA 5CAZA 5LA0A 3AZXA 1Y3TA 4IETA 4NVPA 3JXSA 4N53B 4Q27A 2VECA 4JKKA 1S0EA 3MGUA 3QCWA 4AFCA 1VB4A 2WT1A 3J7NA 5K7PA 1GOHA 2WNEA 5FYMA 2J1AA 5CKMA 1HX6A 5FMBA 2R071 3WG3A 1M06G 2F17A 3KF3A 3DPRA 1UY4A 2LTNA 3A7QA 3P5BA 4CPBD 2WWUA 4CU6A 1R092 3VBSA 3OUJA 4GH4A 2EIGA 1J3PA 4A7KA 1OH4A 4RFT0 4CXYA 1SLCA 3POJA 4XCBA 2VW2A 3HJRA 1UNBA 3AJZA 4F7ZA 1D2SA 3PVBB 4Q4X1 4Y20B 4HXCA 1AR73 2FCUA 2WO7A 3E5QA 4NRPA 1W05A 3H3LA 1QOTA 3PUAA 4NPMA 2D98A 4CDXC 2E26A 2I07B 1F15A 2VMCA 3POIA 1PK6C 4HSLA 4Y4YA 2WFPA 1YYNA 1VBC3 3WNOA 3SITA 2EIDA 3OGVA 4C0BA 4J1XA 1PIV2 2IXKA 2UWCA 4OLLA 3MV01 1DZRA 5C9AB 4QX1A 4C1XA 4JQTA 4AFMA 2JE9A 4KWKA 2P4EA 2IFWA 1YI9A 2VVDA 1CPNA 4XJZA 2BGCA 4ASLA 2B42B 4IV3A 2J22A 4AK3A 4CP0A 1CVNA 2NM1A 5FMCA 3ZXDA 2PHWA 3ES1A 3T08A 2HLEA 4AZZA 4XBQA 3ZXFA 5LW9A 3PNAA 4KWUA 5GZGA 4EN0A 2EAKA 3ZO0B 3ZN6A 2DCJA 2VQAA 3S7EA 1JZ2A 3BODA 4KGQA 1F9KA 5ANQA 2ZX2A 4CXWA 2W52A 1NYWA 2VBPA 3ZR6A 1MVQA 5FWEA 4AQ2A 1ZRCA 4TLGA 1OVPA 4BQ1A 3VL8A 5HXMA 4LKSA 2QQIA 4LKDA 1NUKA 3S0MA 1UMIA 1LEDA 1OFSA 1QKQA 2D5HA 4XFCA 5FP3A 1PMIA 5CFDA 3VKOA 3WDTA 3JZVA 4FPFA 3UKVA 2ZHMA 4D94A 2BVVA 1JMUB 4GMP0 4WVVA 3RZLA 4IE0A 2WNVB 2WWJA 2RMU3 3H7YA 1Z7S3 2YHJA 2KD7A 2JG8A 2RV9A 3V0BA 4LO5B 1MACA 1OMIA 4BQ2A 5EQUA 2D6NA 3FFZA 3VV1A 3O1RA 4MGZE 4YVSA 4QHZA 3BGAA
chains in the Genus database with same CATH topology
4LHLA 3VBOC 5JIUA 1WLTA 2P17A 4BOWA 2ET1A 3IDCB 3PJQA 3V0AB 2GU9A 3MFAA 4PLNA 5HCAA 1CAWA 4HZFA 1FAYA 1RJ7A 2RR11 4URTA 2YDEA 1V6KA 2WZR2 1DU3D 4I0BA 3WW3A 4JRLA 1ENQA 3MEPA 3CU7A 5CFCB 2OUHA 1TNRA 5BY5A 3E5UA 3FX3A 1RB8G 3USUB 2KA3A 3C3VA 4FTEA 5D8AB 3JD71 5C8CA 4S2GA 4XF3A 1PZ8A 1BVP1 4YRDA 1A8DA 2RR13 4QT6A 4HBNA 4AQTA 1AF9A 1O5UA 2O1QA 1H1AA 3NV1A 3KT7A 1PO11 2EXHA 3ZSJA 2PELA 4PIYA 1H0BA 1PVC2 3ROUA 3U4XA 3ZSLA 4V1PA 3OCPA 2RS33 2OYZA 1REFA 2ZX3A 1JXNA 3AP4A 3M8LA 4P5HA 1MZFA 2WQ4A 5JCTA 4D7YA 5T50A 3K48A 1K5MB 4QHBA 1KFXL 1OPMA 1GZWA 2NPIA 2GZWA 1VBD1 4E9KA 3HT1A 3MIHA 1R1A2 2QNKA 2NQYA 2WFF3 3H1YA 3ZYIB 4H7MA 3B7MA 4FBFA 1A6CA 5BNOC 2P3KA 4AVAA 4P9IA 2VNOA 1LHUA 2VGDA 5J3UA 5FO8B 1LKNA 4K20A 3BOWA 1AYM1 2HEYF 1LULA 4TSVA 3ZSMA 1LENA 4BA6A 2K0GA 1VLNA 5F1RA 1BKZA 5FQ0B 4WM8B 3OD0A 4LO7A 3WP5A 2CYFA 4CEYB 1WGPA 4MGIE 4Y1VA 5CA6A 1NCRC 1VRH1 4AGGA 2WQZC 3ZFGC 4I2OA 1QJX3 2FZ2A 3N35A 2WT0A 1H8TB 2ZJCA 4F3JA 2R32A 4C90A 4AVSA 1AYM3 2HWC3 4P9YA 4N53A 4MSVA 5CB7A 2NYYA 5FLIA 5FFOC 3O7OA 1UAIA 3RMYA 4AHZA 4BYYA 3J9SA 1EAH2 1SFNA 2ETEA 2BBVA 1O4YA 5JOXA 4D3WA 2MEV3 2XWJB 1FOD1 3I54A 3JU9A 1YJLA 1VJ2A 2DVBA 5J48A 1UN1A 4ORFA 2EXIA 3OPZA 1ASJ1 3WVJA 3M4FA 4Y20A 2DCTA 2P34A 5ABJB 2B7YA 1SMVA 1QU0A 2JECA 1SBFA 2WLQA 4RGGA 4BH9A 1FOD3 1KFUL 4XMIA 4HN0A 1O3SA 5C9AA 1ASJ3 2HWD1 1UW8A 1RUD2 1XYPA 3KLSA 4UW6A 3UJOA 3ZVXA 4AQSA 5KHKA 2GN7A 2O8OA 5CBLA 4B4QA 1OLRA 4DNYA 1HQWA 4UW3A 1HXS1 3B93A 1DBNA 2E7TA 5KXBA 3PTYA 2AH2A 2DCKA 1LB2A 3VZNA 3R4UA 1NLRA 1R081 3KMHA 1VB2A 3TN93 1RUH2 4ISQA 1FI2A 2HWE2 1OHFA 4E2SA 4XBLA 1F8VA 1AX2A 2PFWA 3WINE 3H8UA 3R0RA 3VBFC 4HK8A 4K1ZA 3G7DA 1EYBA 3QACA 4RA0A 2WA4A 3LZZA 2XJVA 2ZHKA 3NAPA 3NW4A 3JBG3 4IEUA 2WLPA 1IHMA 2WNVA 2HJIA 1WLDA 1O5LA 2A6WA 3VL9A 5DUXA 4FPLA 3ZYPA 4XJAA 4AVVA 5GLVA 4XE9A 3VBUB 2D93A 3BOPA 1UIKA 3VKFC 5KHHA 1S0DA 1RUG2 3FZ3A 4QU2A 2ZGMA 3VHPA 3MDPA 1MS1A 1PNFA 1LOCA 2D6KA 1EV12 1ZX5A 3V0AA 1AXYA 4GWNA 4CYDA 4LUMA 1J1TA 1TMF1 1QQP1 1BEV1 1HRI3 2DVDA 2A3WA 5LK5A 2VMIA 2LM3A 2QDRA 2YUEA 1QXPA 5CNAA 1D4M3 1XU1A 4ZXKA 1H2LA 1W6NB 2D5FA 1W6MB 4YZ1A 5CFCA 2JJ6A 1LCLA 2SBAA 4TLFA 1N1SA 3USUA 4EROA 3M1HA 1PGSA 1PO22 4ONUA 1C8M3 4PIZA 4YW2A 4MLOA 4HVQA 4ZU7A 4RHV2 5K0UA 2UY9A 1FT9A 3HIFA 5JLVA 5H9PA 1ZBA3 4PDWB 1UD1A 1AR81 1DQ4A 1GKBA 1LHWA 1Q8VA 2Q5TA 2H0BA 3J8F1 3OYWB 4FOYA 1HRV2 2IXCA 1CESA 2DV9A 1RVF1 1QNWA 2UY8A 2ZTNA 3B9CA 4OUSA 2FMDA 1V70A 3RRDA 2CGPA 2F4PA 4QXKA 1OSGA 4C91A 1IOAA 1XYNA 3R4DB 3J8F3 3BPZA 4CDQC 5JI9A 4COYA 2VQ0A 2Q1ZB 4QMAA 1HQLA 1NA1B 2X29A 4X8NA 1RUC1 4LO4B 3VZLA 4YFWA 1J3RA 2Y0IA 2VH9A 5DDJ3 4DPNA 2UWBA 3MLLA 1KS4A 1YJKA 3FLRA 4JDOA 2OA2A 1XNDA 1BMV1 4HVRA 4YZ3A 5FQ0A 1LJ7A 1LGBA 4LBQB 3ZFEA 1H8VA 1UU4A 1IS5A 1GQHA 4CEYA 2WNUB 4CEWB 5JZGB 1H4GA 1AUYA 4GMP3 2WS91 1JYIA 4UXAA 1H8TA 4MXWB 2IC1A 1TQ5A 1PNGA 4LHKA 4RD7A 1AR72 2UYAA 5GLWA 2HWF3 1SDWA 3N7KA 1YFUA 1J59A 1VBC2 5ACA3 5JSOA 5T5PA 1WLWA 3O0XA 3MIGA 4QPIB 1IS3A 2D40A 1GV9A 3GBWA 3NV3A 4PLMA 2DCZA 3H50A 2ZCWA 2MPFA 4CP1A 4JGYC 4INDA 3FLPA 3AFGA 4W65A 5ABJA 3GBGA 1WUVA 5BNNB 1MR5A 1QXRA 1OKQA 1MQTC 1S0CA 2A6XA 1R1ZA 2DVGA 2IXIA 4M3CE 5A33B 5GM0A 3ZFFC 4RR3C 4H7LA 1V6LA 4D69A 1AR91 4IV1B 4ATFA 1S0IA 4M3CF 2IZWA 2O8QA 4FAHA 3WHTA 1G9BA 1V00A 3ELNA 3TYJA 2ZGTA 4KL1A 4AEDB 3DV8A 4M01A 3NWKA 3O5SA 4SLIA 2VW0A 2RMU2 4R9AA 1Z7S2 1NE4A 1NQDA 5KHGA 2ZGLA 1LU2A 2RM23 2VOWA 3FUQA 1BCXA 1QH6A 4FPCA 1ZNPA 4K1YA 1OD5A 1D4VB 1FNYA 1H1IA 1QOOA 1ULDA 4DRVA 2ZX1A 1AZDA 4AFAA 2RJKA 2A7AA 5C4WB 5T3NA 4GH4B 1FPN1 1AX1A 3VZMA 4CRQA 3V65A 2Q0AA 2QVSB 3THTA 2QDNA 1ZVFA 2XLAA 3I2DA 2DCYA 1NY72 4L11A 1G9AA 1NLSA 5T5LA 2VVEA 3VBRB 1SEFA 4MGKE 2Q8OA 3VBUA 4FT8A 3D5OA 3WD5A 1W0OA 4AVCA 1GR3A 1WBLA 4QPGA 4CP2A 2RR12 1OA3A 5L7OB 3OD4A 1QJY3 2A5ZA 1C5HA 4TZDA 2NMOA 4XIKA 5GLZA 2XHKA 3LA2A 1Q8OA 2BWAA 2RS51 1W6NA 3N7MA 3DUIA 1W6MA 3B01A 1A3KA 3VBHA 2RS32 1GLHA 2VXRA 3CJXA 3MIBA 2GMEA 1A8MA 4FPGA 4EV0A 4NR1A 4RSUA 3ZMOA 1POV1 1CIWA 4KG8A 2VPVA 4LULA 1ZA4A 4YVWB 3LOBA 5C33A 4XHXA 1TME3 1X8EA 2VW1A 3FHIB 2RJLA 2I74A 3DN7A 5I91A 2MNGA 4META 2WFF2 2I45A 3AX4A 4C1WA 1MVEA 2BUKA 4XJWA 1X82A 4IEVA 4YVSB 1POV3 3AB0A 4KU8A 4N7IA 3GF6A 1HIXA 1ENSA 1QNYA 1OFNA 3W9AA 1CAWB 1S0FA 3OTFA 3SNMA 4JC1A 2FZ1A 3PJYA 2XUMA 4Y24A 1QJX2 4AW7A 2V09A 4FQ4A 1AYM2 2HWC2 2TUNA 3PVEA 1Q56A 5JI7A 3POYA 4QQLA 5I0TA 1RUF3 1U5YA 1X33A 4BIFA 1YFYA 4COWA 1ND3B 3ATGA 5C8CB 1GFF2 2MEV2 4LBQA 2ZGOA 4D7SA 3D0JA 4OI4A 1IGOA 2PLV3 3WP3A 4AEJA 1GZ9A 3ZX7A 2WNUA 1XQNA 4E27A 5BXXA 4CEWA 5JZGA 2OVUA 1Q5OA 3KZ4C 3POSA 4HKOA 5IT6A 1LODA 4MXWA 1QDOA 1E57A 3N7JA 4QX5A 4XFFA 5JSPA 1ALYA 1ZZ6A 4IL7A 4FCAA 4MX3A 4GKXA 4XJ9A 5CIRA 3PLQA 2BTVC 1LOBA 5KHJA 2QQPA 1FOD2 2XVKA 3CEWA 3LKJA 2JDZA 3B69A 1CQ9A 1RL3A 4WM7C 1WCKA 4XOGA 1GZWB 5BPXA 4FXKB 5BNPC 1X8MA 4BPZA 4K3UA 3CL1A 2BPA2 1UU6A 2PHRA 2XPJA 1IKPA 1H2KA 2XBO3 5JIAA 2X8KA 4B4RA 4YZ5A 1OOPB 2MHFA 1V6NA 5BNNA 4DY3A 2WWSA 2HEWF 1UPIA 4XIOA 1QY4A 4FSJA 1S2KA 2WINB 2K2SA 3TN92 1VBE1 2KXLA 5A33A 3P3PA 1N1YA 4N9HA 1WMEA 4N53C 4FPEA 2ZHLA 1LOFC 2DU0A 3DGTA 1WCSA 5FOBB 1GNZA 2OIIA 5DG2A 3ZXLA 4YZ4A 1F5JA 1G86A 2ZA9A 2CWMA 4AEDA 4G3YC 1D2QA 3JBG2 1T6GC 4YW1A 1AR61 1AJKA 4LA3A 2B5HA 1O4ZA 1VBE3 5GKAC 1B35C 2WT2A 1B09A 3GHNA 5FCCA 5SV5A 2IXJA 3O0VA 3R05A 3VDDA 1ULEA 1RJ8A 1W0PA 1NCQB 1VP6A 5C8WA 4I0AA 4ITCA 4ZKTB 2EAAA 5C4WA 3T2TA 1BBT2 4FPYA 4XZPA 1G9CA 3KCXA 3EXUA 1U5XA 4OHZA 5AC91 1HRI2 4P9XA 4Q4W1 4XHBA 3M70A 1FMD1 3ILNA 4X8PA 1D4M2 3VBRA 1XRUA 1DGWX 1JUIA 2R073 4Z1VA 3AKTA 1W6QB 1H2MA 5FO9B 4WVMB 5AVAA 2CGOA 4RQPC 3FLTA 3MPPG 4B7EA 5AC93 3EO6A 1C8M2 3MLJA 4Z82A 1S1AA 4Q4X3 5SV8A 5L7OA 1S0JA 3NVCA 3WP6A 1FMD3 2ZAHA 1RUOA 3LWCA 1ZBA2 3AMPA 4AYUA 1ZZ8A 4XFBA 5B2GB 4AHWA 1FXZA 4HKWA 2WNVC 1V9U1 5KBFA 3ZSKA 1V6IA 3AMHA 3MW3A 3FMGA 2H0VA 3P3NA 4Q1RA 3ILRA 2FHRA 4E4ZA 1LR5A 3ZYJB 1ZM1A 1IKQA 1ZBE1 2IWGB 3I59B 4YVWA 3PVOA 1MS5A 5EYYA 2AGSA 4CDXB 3NAPB 1Q8QA 1PK6B 1JHNA 2IXLA 3J8F2 3KB5A 4OHYA 1QMJA 3A0KA 1LHOA 4B29A 3UV9A 4BHPA 1NXMA 4WV8A 5T5OA 3QD6A 2R041 3HMYA 1OQ1A 2DUOA 1AVBA 2GSYA 5DDJ2 2R6QA 3S6PA 2DURA 5IUQA 4LO8A 5CFCC 1ZZ7A 3MI8A 4AHYA 1JH5A 1CD3G 4YNIA 2R16A 5D8AC 1UZZA 4Y1XA 2ARXA 1ZYBA 4OI2A 5KC5A 2DTWA 4YSFA 1SQ4A 4YM0A 1I3HA 1CN1A 4JV4A 1W6PA 2WJSA 4R9BA 3WDWA 3M2MA 3SXWA 2GC1A 5JSRA 1ND3A 1UCXA 2HWF2 4LHNA 1RUJ1 3N3HA 1REEA 2Q30A 1ND2C 2B8MA 2VU9A 3AMNA 2A73B 4GB32 5ACA2 3MIEA 5K0UB 4NWVA 1LU1A 3MF6A 3AK0A 2DYCA 3WZ1A 1MS3A 3H9AA 1K5MC 1X7NA 4G4FA 3VBOB 4XXAA 3VKLA 2RS11 3JD73 1RIRA 3R4SA 1WLCA 1SLLA 3WT3A 2JENA 1EPZA 3KGZA 4XFGA 1PO13 1QJU1 2BNNA 2DUPA 3CO2A 2BW8A 1UKRA 1N47A 4DY5A 1YXWA 4FAGA 4FPJA 2ZGKA 4Q29A 1KJRA 1UZYA 4Z8BA 1OOPA 1VAVA 2JEMA 3NKTA 4WM8C 4GULA 3LCPA 4MV2A 1AXKA 3ZN4A 1BXHA 4DQAA 3IBMA 3WQ0A 1JYCA 3Q9OA 4P14A 3UL2A 2RM22 1WD4A 5DZFA 2Y26A 2X53S 1VBD3 2VUAA 4N90A 4R52A 3ZXAC 1FYUA 4XMAA 1O3RA 5GLTA 3TWIA 1GICA 4R9DA 1AL21 4QQHA 3ZFEB 3VKNA 5DG1A 1Y9QA 3IT8A 4XETA 2D43A 3VZKA 4BMBA 2VMGA 3SISA 2GC3A 1YUDA 3W59A 4JTOA 3RZZA 5CU1A 4AFBA 2GH8A 4OHVA 5K9YA 3ZN5A 1NCQA 2BFUS 1VRH3 1H30A 2E51A 2GC2A 4AVBA 4CDUC 1QHDA 1SLBA 1QJY2 4HMZA 3V64A 3W58A 4DOUA 3WXPA 5IK8A 1SLIA 4RS5C 4Z92B 5KC6A 3KD4A 4OVEA 1BQPA 1POV0 1W6QA 2GMPA 1KXGA 4GWMA 3RYPA 4WVMA 1VR3A 2ZX0A 4XPVA 4G9SB 2EF6A 5HXVA 2EA7A 1NCRB 4YGCA 1PGW2 3ZFGB 5FO7B 1RUI1 2R0HA 3OJBA 1EPWA 4XFIA 2ZGUA 4I3GA 5GALA 5EV7A 4KG0A 1VBB1 4KU7A 1IQAA 1VBA1 3WHUA 1DGLA 1TME2 4FOWA 3ES4A 4F8AA 4PQ9A 3RJRA 1CPMA 4E4SA 2BWCA 5D1IA 1YHFA 2AR6A 4ZU4A 3RPQA 5JR7B 1DGWA 4MGYE 2ILMA 4N7UA 5KWRA 2DVAA 5C6CA 3WQ1A 2HWD3 2NP0A 2UU8A 1OLQA 5CADA 2W08A 5LEJA 2VOVA 2LALA 4Q4Y1 4J6GA 5H9QA 1HXS3 5A32B 3I59A 3KCCA 1IZ3A 3H0OA 4NN0A 1O4TA 1COV1 4N43C 4CDXA 4CTEA 4CZSA 5F9TA 4Q8LA 1PK6A 1R083 2QJVA 3BIWE 3ILFA 2I2SA 4Z07A 1QDCA 2GN3A 2HWB1 1LOGA 3WG1A 4XTPA 2DFCA 3AP6A 3R6SA 3KQRA 2O0OA 4JGZC 3WDVA 1H2NA 2XL7A 3B94A 3I4IA 1RUF2 3RSJA 1PM7A 2EALA 3AZVA 2A3YA 2X5IC 3MLKA 4XF1A 1UU5A 2BNMA 1WBFA 1U5IA 4QPGB 3UKNA 4GKYA 1R091 2C1FA 4Q26A 1LGCA 2PLV2 2E63A 1TE1B 4KH9A 4HPKA 3VGIA 5EJ3A 3OBTA 3E6CC 2ZBJA 1YCIA 2ZKLA 2XG3A 5DZGA 3VBFB 4PDWC 5EXOA 3E6BA 2YGMA 3VBHB 2XJRA 1RUE1 3AKQA 1TMF3 1QQP3 1BEV3 1PIV1 1XE8A 3WCRA 3FC0A 1JN2P 2D7FA 3SCFA 5I93A 3KCYA 1I6XA 1DF0A 4Y1UA 2DU1A 2JXAA 2V5YA 4JRAA 5I8YA 2XVLA 1QJZA 3VBOA 1ENXA 2XBO2 1RUE3 4LBJA 3L2YA 5EWSA 2JG9C 3NO8A 1UL9A 4YARA 1NA1C 2GNTA 1AR83 2OUJA 4FOVA 1DQ6A 2VNGA 1ZZCA 3IWZA 3D6EA 4P9LA 2A6VA 3MFCA 1RVF3 4CDWC 3KM5A 3SH5A 4A7YA 2ZOEB 1C5IA 1RTVA 1ONAA 2GNDA 1SBEA 4KWJA 2PHFA 4XTMA 1H4HA 1QWRA 4JCKA 5E8AA 2JX9A 1YFWA 1URXA 1S0BA 4B8EA 3O14A 1ZRDA 4QGNA 1V6OA 2DUQA 2XB6C 2WL1A 2GDFA 3AFKA 4AI2A 2XJQA 2XVGA 4K7JA 3MICA 4P9JA 1RUC3 3M7AA 2Z79A 3TRSB 5J09A 2WZR1 4QPIC 3HQXA 4FVVA 5I0RA 1CX4A 3CJIC 1BVVA 5J98B 3POWA 2R072 3APBA 5J36A 4K6BA 1OPOA 2H6BA 3S30A 1Z0HA 1G7YA 5BNOA 1PZ7A 1LTEA 5AC92 2WS93 4JTNA 4RGAA 1YLLA 5T55A 4Q4X2 1XNBA 3MF9A 4JQRA 1FMD2 4IV1C 4EN6B 2GMMA 1HV0A 4PLOA 1PVC1 5F5QA 1XNCA 1FNZA 5AFEA 2C9AA 3AZZA 3ZYRA 4EJRA 1H9WA 5E16A 1O91A 2UURA 4XBNA 3RYKA 2P3IA 3AJYA 1AX0A 1NCRA 4YM3A 4MXVA 3ZFGA 1UIJA 4XW3A 5FMOL 1H9PA 1X50A 4WZCA 2G9GA 2Z5WA 5L73A 1J1LA 3H3ZA 1VAMA 4MZUA 3DPRC 4ES9A 4LNVA 3VBSC 4GH4C 1IS6A 3VHOA 4AI0A 1PGL1 3N36A 2OZJA 1ENRA 1DQ2A 1N3PA 2YROA 3AMMA 5JMCA 1AR93 1AYN1 3J4UH 4DXZA 3VDDB 3WNXA 1N3QA 5A32A 1W6OB 4HLTA 1MQTB 4LE3A 3UJQA 4LUKA 2GALA 3GNEA 1AYN3 2NZ9A 3ZFFB 4RR3B 2QCSB 4IV3C 4NHLA 1OQDA 4AI8A 1A78A 3RQ0A 5J7MA 4I09A 1BYHA 1ZRRA 1FPN3 1EAH1 2UYBA 4HT1T 1UF2C 3DKWA 5A3MA 3H7JA 4COZA 2B46X 1ZZ9A 4GALA 4HL0A 5GZEA 4YW3A 2CAVA 2PYTA 3IDBB 3D0SA 4AGRA 5JPMB 1O3TA 2ZZQA 2HYKA 3IN9A 5CFDC 3S7IA 4M0NA 2P3JA 4YVWC 5DUWA 4I3PA 1MZ6A 1V6JA 4LO6B 3VBFA 2KM2A 1CAXB 1BK1A 5JWPA 2E7AA 4D7TA 5L36A 3JD72 4FQZA 4IEXA 4Q0QA 2ZPXA 2JG8C 1GQGA 5DUUA 1PO12 2E9QA 3ZPYA 2QFEA 4YVSC 1RUD1 2RS53 5KHIA 4ASMB 3LA3A 2NMNA 4L9BA 3I7DA 4LTAA 1LECA 1KDKA 2D6PA 4EN9B 3U10A 1XE7A 3PMSA 5LRSA 1RUH1 3PHMA 4F83A 1G9FA 5GZCA 2HWE1 3ENRA 3ZYGA 3TB0A 3WG2A 2CTVA 4YG3A 1VBD2 1MS9A 1Y43B 1C4RA 3E97A 1H1MA 4R8HA 2PA7A 5C8CC 4IEZA 2ZGRA 1XNKA