5J3UA

Co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
261
structure length
261
Chain Sequence
VYEKDEGQKEQLERILRQSFLFNSLDEKDLNTVILAMQEKKIEASTCLIREGDDGECLYIVQSGELNCSKLIDGEERVVKVVGPGDAFGELALLYNAPRAATVTSVSACDLWELGRDTFNAIVKDAATKRRSMYDSFLKSVHILDGMDAYERGKVADALRTEMFTDGAYIVRQGELGDVFYIVEEGSAVATKSFGPGQPPIEVKKYQAGDYFGELALINEEPRAANVIAHGICKVACLERKSFKRLMGSVQDLLSKKASEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein Kinase A
publication title Co-crystal structure of the regulatory domain of Toxoplasma gondii PKA with cAMP
rcsb
source organism Toxoplasma gondii
total genus 75
structure length 261
sequence length 261
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j3uA01
1NXMA 3UKNA 1NE4A 3MDPA 1CAVB 3DKWA 3IWZA 3SCHA 3MYXA 1H1MA 2PYTA 4QX5A 2D93A 4H7LA 4IEQA 1J59A 2GC2A 3U10A 3FE5A 5C8WA 3R6SA 4Q29A 5EZWA 1YFUA 5JSOA 4LULA 3C3VA 2OZ6A 3E6DA 3VHRA 1ZVFA 5JSPA 4R8HA 2PAEA 2GC0A 5BPXA 1J3PA 4KU8A 5JSRA 2FMYA 5KHGA 2O8QA 3D0JA 3ETQA 4XFFA 2BNOA 2E9QA 1ZRCA 5EFUA 5FLIA 4XFHA 1CX4A 4QGLA 3H1WA 2XKPA 2B9UA 5AVPA 2XL7A 3KGZA 4HZFA 2H6CA 4MGIE 2UY9A 4IESA 3IIAA 2XLGA 4MUVA 2GH2A 4FAHA 1YWKA 2I45A 2P17A 5KHKA 4IEPA 2IXIA 1VP6A 3IDCB 2D5FA 1ZZ9A 5FQ0B 3S7IA 3HQXA 4XF0A 2KXLA 3SMHA 4XF9A 4JVAA 5F1RA 3IDBB 4JV4A 4Q0SA 3SCGA 3E6CC 3N4MA 3H9AA 4EROA 3WW2A 1YFWA 4YNIA 3USSA 4BHPA 5I91A 1O7FA 4OLLA 3M70A 5CADA 4MGZE 3BALA 4HN1A 3IBMA 5JR7B 3I59A 1O3TA 4MH0E 1EY2A 1JUHA 2QNKA 4Q0PA 3CO2A 3GYDA 1X8EA 4WZCA 5FPZA 4F7ZA 3LA7A 4QMAA 3HT1A 3UKVA 3SCFA 3BU7A 1CAWB 1OI6A 2OPKA 1VJ2A 3ACLA 4UBGA 1O3SA 4IEYA 2Z2SB 3FX3A 1OFNA 4PJYA 2Y0OA 3FFQA 1PM7A 2MNGA 4JTOA 2HJIA 3UKTA 1HW5A 3WW1A 3KSCA 2Q1ZB 2PTMA 2OYZA 3G7DA 2ZCWA 1X82A 4XFIA 3BCWA 4KL1A 5HI0A 5LRSA 2Q30A 1GQGA 1ZZCA 3LA2A 3H3UA 4I0BA 1YFYA 5I0UA 1J3QA 4LA3A 2GC1A 1LB2A 4X6QB 3I54A 5T3NA 1H1IA 2PAMA 2Q0AA 1CAXB 3FZ3A 2BGCA 5CU1A 5J3UA 1SFNA 2WFPA 4F8AA 3U0ZA 5C6CA 4D7TA 2H0VA 3SHRA 3CL1A 2MPFA 2GC3A 2QVSB 2XLFA 2BNNA 4META 4EWAA 1UIJA 1YHFA 3E97A 4BIFA 1Y9QA 4QGMA 3ST7A 4O9GA 5I8YA 5I93A 4XF4A 4L11A 1CAUA 4UBHA 4O9EA 3RPQA 4LTAA 3ZDSA 4LUMA 3LZZA 1LR5A 3ROUA 3H8UA 4XF3A 3NSTA 2H6BA 4HLTA 4KU7A 1I6XA 3KMHA 4QM8A 1SQ4A 1XE7A 3ES4A 4XF1A 3EO6A 4IERA 4I0AA 3OTFA 3E6BA 3EJKA 4BH9A 4TLFA 2CGPA 1OD5A 1ZZ8A 2ZKLA 3E5UA 1CAVA 3H7JA 4HMZA 3H1YA 2B5HA 1WGPA 1OMIA 1O5LA 3H50A 3PNAA 1WA4A 5FPXA 3FHIB 3LA3A 1ZREA 4YYOA 1ZZ7A 5I0TA 3DN7A 1UIKA 3PLQA 2GZWA 4JTNA 2ETEA 1RC6A 4MZUA 2CAUA 1ZNPA 1RUNA 1DGWA 1LKNA 4J1WA 1GQHA 2IXKA 1L3JA 4HBNA 3U11A 5FLJA 3OGJA 1SEFA 3OCPA 4ORFA 3MZHA 3OF1A 5J7MA 4X6RB 1XE8A 2VPVA 1NYWA 4FAGA 5KHIA 3D0SA 1QXRA 2EVXA 3NW4A 5I0SA 1EYBA 2XKOA 1YUDA 3BB6A 4J1XA 3GBFA 4EWDA 2XHKA 2D5HA 2IXLA 1QXJA 5FQ0A 2V09A 4PIXA 2XLAA 4AVBA 2GU9A 4WVZA 2EAAA 2FQPA 2ATFA 3FJSA 2CAVA 4AXOA 5I0RA 2PA7A 1ZZ6A 5CVRA 4MGKE 1DZTA 4DINB 4D7SA 1O3QA 3PVBB 3HIFA 2IXCA 3H7YA 1TQ5A 5J48A 4QXKA 4WBBA 4N9IA 5LEKA 4XFCA 3NJZA 2CV6A 2EA7A 2HKXA 3D82A 4IETA 1O3RA 4LUKA 4BYYA 5FDBA 1CAWA 1YLLA 2C0ZA 1J3RA 4Q0UA 1ZX5A 4IEZA 2ET1A 3H1MA 3SXWA 2QDRA 1Q3EA 2O1QA 1DZRA 2XL9A 3FWEA 3MPBA 2IC1A 4E2QA 4I09A 5LRRA 2BEOA 5D1IA 1UPIA 1QY4A 2PAKA 1FT9A 4N9HA 5KBFA 1Q5OA 3LAGA 4L2NA 4AVCA 3TNQA 1U12A 4HN0A 2B8MA 5LEJA 5KHJA 5FCCA 3WW4A 1X7NA 1CAXA 4IEXA 2IXHA 1G6NA 4XEZA 4HVQA 3EQEA 5K8SA 3CF6E 1NZCA 4K8FA 3TNPB 1NE6A 4YSFA 2IXJA 3B02A 3NVCA 1EP0A 4I3PA 2QJVA 3H3ZA 4YRDA 5KHHA 3EBRA 5E16A 1ZRRA 5BUVA 2OA2A 4A2UA 2ET7A 4OFGA 4Z82A 3RZZA 5E1RA 5I8TA 2WC2A 3QACA 4E2GA 1ZRDA 3DL3A 4KWLA 3RDIA 1RTVA 3RYKA 3HT2A 4IEUA 1V70A 4MGYE 4E2SA 2GAUA 2MHFA 2XGXA 3CJXA 4IEVA 2N7GA 3RYPA 1J1LA 1ZRFA 3DV8A 1I5ZA 1IPJA 2D40A 3O14A 3WW3A 4MX3A 4IEWA 4KWJA 4GULA 4P9GA 3BPZA 1RL3A 3OD0A 3QOPA 4UXAA 4XETA 2UYBA 4Q0QA 3I59B 1O4TA 2VQAA 3LOIA 1WLTA 2BYVE 4MV2A 2F4PA 4HVOA 4XFGA 1RGSA 3ES1A 3EHKA 4ZU7A 1YFXA 4HSJA 4LEJA 2PFWA 2VECA 3I7DA 4QGNA 2UYAA 1CGPA 2QCSB 3M3IA 3CEWA 4CYDA 2BNMA 1DGRA 4LLOA 3E5QA 1Y3TA 2Q4SA 4Z07A 2Z69A 4AVAA 2OZJA 1LRHA 4YARA 5JCTA 1IPKA 3JZVA 4XFAA 3RNSA 3KCCA 4RD7A 4KWKA 4R52A 4B29A 3L2HA 4FT8A 4I2OA 3CLPA 3RYRA 4IEOA 4HVRA 5BY5A 5BXXA 1UD1A 3S0MA 1VR3A 1J58A 3NL1A 1Q43A 5FLHA 4AQ6A 3NKTA 4QM9A 4NVPA 4I02A 1ZZBA 2K0GA 4FBFA 4I01A 3KGLA 1EPZA 1CAUB 1X8MA 2PQQA 2PHDA 5I8SA 3ELNA 4PIYA 4Q0VA 1FXZA 5JAXA 5BV6A 1QWRA 2PHLA 1UW8A 1XRUA 2DCTA 1PMIA 3E5XA 4PIZA 4HSLA 4LA2A 4AQ2A 4EWEA 4EV0A 1UCXA 4ZU4A 4XFBA 2UY8A 1FI2A 3LWCA 4ONUA 3S7EA 1O5UA 2K9ZA 1RUOA 4ZU5A
chains in the Genus database with same CATH superfamily
3FUQA 5FK8A 1DYKA 3MFCA 4FO9A 4WM8A 1Y7BA 4UW6A 5BYNA 1HRV3 3IWZA 2DCZA 3TB0A 2YZ4A 2W47A 4QX5A 5EJZB 1PK6A 1H2KA 4H7LA 4IGPA 5FY7A 4PLMA 3RZKA 1MEC3 4FQZA 1LEMA 1UF2C 1UZYA 5D8AC 4NR1A 5C8WA 5F7UA 5EZWA 2ZJCA 5FPUA 2D97A 1S0IA 2C24A 3E6DA 2OXBA 3VBSC 5FOJB 1ZVFA 1ZRIA 4LO7A 5JR2A 3LF7A 2DYCA 2XHNA 2ZHKA 3ILRA 4MGQA 4XVHA 5JOYA 5BPXA 4NPMA 3LSDA 2WZR1 3NAPB 2UURA 2WUHA 1JYIA 1NLRA 2FMYA 5KHGA 1GP4A 3RS6A 2VBDA 4AE2A 2VBPA 3ZDVA 2GP3A 1VBA3 3MEPA 5FP4A 4JQRA 3OY8B 5A6YA 1KQRA 4P9IA 4XFHA 4LBQD 4QGLA 2XKPA 3WCSA 3POGA 2RS32 4CP1A 1J1TA 4LHNA 4HZFA 1WA6X 4MGIE 4HPKA 3ACHA 3IB3A 3Q8CA 5FZ8A 2E7TA 2WN3A 1GV9A 1STMA 2GH8A 4K9SA 4MVTA 2JG8B 4JAAA 3UESA 1EAH2 5LK5A 2P17A 1Q8QA 3KCYA 3NKGA 1QQP3 2RS31 1KDMA 3ZYRA 2PHRA 3POWA 1W6MA 1YC61 1ZZ9A 1XJAA 1MS0A 1YI7A 1AR62 3MIBA 5F3EA 2D43A 2ZX4A 3ATGA 5E88A 3GJBA 3SMHA 2VNRA 5IK5A 2HWD3 2CDPA 3AP7A 4YLZA 1EAH1 5LY2A 4A4AA 3ZFFB 4B1MA 2ZGSA 1UYXA 1H2MA 4G4FA 3W21A 4EROA 4LJHA 2WNVA 3PU3A 4BHPA 4MHRA 1HV1A 2VZVA 1AR61 3THCA 1AR82 2VCCA 1SFPA 3JXSA 2TUNA 5K9YA 4MGZE 2LTNA 3IBMA 4IE0A 3VBRB 3O1VA 1N3PA 1SG3A 3WUCA 4DUVA 1R1A3 4K8RB 4R9DA 1Z7S1 4Q0PA 2XH6A 4GWIA 1V6IA 4H55A 1AR81 3N9MA 1S2EA 4RHV3 4RR3B 4WZCA 5FPZA 4JGYB 3T09A 1QJU3 4AI3A 1F15A 4AEKA 4WV8A 5C9AB 2ZZJA 5DDJ1 1MQTC 5IAVA 1ZM1A 4AVSA 2RDQA 4EE2A 2VO5A 2OS2A 3M8LA 3WHUA 4LBKA 3ZFEB 3WP3A 1PNGA 2BFUS 5FZFA 3VKNA 4IDZA 2HWE1 3LEMA 3ZYPA 1ULGA 5F2WA 4EZHA 3K2OA 2RS13 4ARYA 1HW5A 3WW1A 5F6LB 1LTEA 1JU3A 2NLRA 2QQWA 2B9VA 3KSCA 3ALQA 4TN7A 3G7DA 2ZCWA 3PMSA 5FYCA 1VBB2 2W08A 1AYM3 4KL1A 4NHXA 2RMU3 1O91A 3OGSA 5F3GA 5HCBA 4BLJA 1G9AA 1AUYA 3U75A 1IPSA 2KR2A 2VY0A 4CDUB 4BOWA 4P5HA 4CDWA 2Y34A 5SV5A 4I0BA 3VHPA 1VBB1 1OFSA 2R043 2YDEA 4PI2A 5CISA 3MICA 4IW3A 1RUC2 4LITA 4LKEA 2QQMA 5T3NA 1H1IA 1ZYBA 2Q0AA 2UWAA 3FZ3A 4XXAA 5FZ7A 1XQNA 3M3CA 3NJVA 4COWA 1C28A 3M4FA 3WT3A 2WFPA 1W6OB 4A7KA 2HEVF 4NIAA 4S2FA 3CL1A 1QEXA 4DQAA 2MPFA 2GC3A 2QVSB 4P00B 4R4XA 4YZ4A 4YGCA 1DFQA 1XYNA 1RUC1 1S4CA 2Y33A 4W65A 1NQDA 1URXA 4A7ZA 1UWWA 1UIJA 3E97A 4Q4Y1 3LGRA 1SCSA 1Y9QA 4YW7A 3BYWA 3W20A 2LROA 4ZXKA 5L7OB 3W5NA 3KB5A 2WZPP 5A7PA 1POQA 5T54A 1POV1 5JPMB 4O9EA 5AC91 5A1AA 3WUDA 2DBNA 5FZBA 3LOBA 1W03A 3ZDSA 3IM0A 3LZZA 1DBNA 5F39A 3H8UA 3ZSKA 5FPLA 3NSTA 4ITCA 4UW5A 3UETA 5BNQA 5C4WB 2WT2A 1PIV2 2DU0A 4HL0A 4XDPA 5FO7B 4KU7A 4BXFA 5IYYA 1QNWA 2VZ1A 1I5PA 1IGOA 3BIWE 1HXS2 1HRI3 1EUTA 3GZUC 3V0BB 4N90A 2VOXA 2VGDA 3JD73 3OTFA 4QKDA 4LHKA 4BH9A 1VB4A 5IUQA 3KV9A 2ZTNA 3OYWA 3H7JA 4LMFA 4UFLA 2P3KA 2GN7A 2V72A 2B5HA 1D0HA 3I2KA 4XJAA 5D8AA 3M3OA 4TZDA 2XONA 3QCWA 4Y1VA 1X33A 3PUSA 3VBSA 1IQAA 5A70A 3L2YA 4CP9B 4UT5A 2DVBA 3PMEA 3KHCA 3AZVA 2R1BA 3R4UA 3SITA 2GNMA 3WG4A 4AR2A 2AGSA 4K21A 3ZVXA 2D6OX 2F6BA 3C7HA 2K46A 4GALA 4Y5TA 3WF4A 1Q8SA 1IOAA 5EYXA 5DAXA 4MZUA 5TSWA 4OYUA 1E5HA 1JYXA 4H3WA 4EQVA 3OOXA 4BU2A 4L8QA 2ZKNA 5E89A 3Q8AA 3USUB 5CFDC 3Q9OA 1CPNA 4BM8A 4AFAA 5FJHA 2YPDA 2C6SA 1MS3A 2WNEA 2KM2A 1I9RA 3KV4A 1JYNA 2JDPA 2IVJA 4DZGA 1KITA 3LCPA 4QPYA 1JBCA 3AFGA 2ADEA 4X6RB 4XC9A 1N47A 3NQHA 5FZ4A 3VZLA 1WMFA 3PTYA 1HQWA 1XE8A 2VPVA 3VDDB 4FQ4A 1LODA 1QXRA 3ZIWA 4H7MA 1EV12 2IFWA 4XMIA 4YZ3A 2NPIA 3GBFA 4N43B 5FMDA 2D5HA 2IXLA 1QH6A 3I2IA 1SPPB 2V09A 2X10A 1C1FA 3PVOA 4PIXA 4QQHA 3GHNA 2WQ8A 4MGTA 2DF7A 4AVBA 4UYBA 1PVC2 4CUGA 1DGWX 5C3QA 1EV11 4QXHA 2PHUA 4GD4A 4FPFA 1KEXA 5I0RA 1GU3A 1SDDB 2IFRA 1ZZ6A 4AFMA 1DZTA 1B09A 1O4ZA 3OPZA 2W1QA 5IFPA 4LBQB 1PVC1 1S1AA 2JIGA 2RJKA 2P6CA 1SLIA 3DCQA 4A41A 4A7YA 4FOYA 4UWDA 4B7EA 1KGYA 3WV6A 5FZKA 3R4SA 3HJRA 4H14A 5BNPC 1AXYA 1W8ZA 5J09A 1YQ6A 1UY1A 2EIEA 5DAPA 4C0BA 4V1PA 3O1SA 1AL0G 3V65A 1OQ1A 1MQTA 2XBO3 2JDHA 5DAVA 4GWNA 4RFT0 1C57A 3D82A 1CIWA 5FZAA 4CU8A 1BCXA 3FLPA 5FDBA 5IK4A 4NROA 1FNZA 1HB2A 3A4UA 5DUXA 2VBBA 1OLRA 4R9AA 4H2AA 5J96B 4TWTA 3B93A 5D2AA 2ADDA 2FZ2A 1CQ9A 3JBG2 3SXWA 5J37A 2QDRA 1Q3EA 1W6PA 3ETPA 3WF1A 1XNTA 4OZOA 1H30A 2VW2A 1PO12 4P02B 1KDKA 1MS1A 2Y6HA 4LBMA 2VMCA 1Q8VA 1W6QA 2VMHA 4A44A 2VZRA 3GGLA 2XJPA 5DQ0A 5FO8B 2QDNA 1FT9A 3PUQA 2AH2A 3WQ0A 3HBZA 1D2QA 4ASLA 3HAGA 1HIXA 3B01A 4C90A 2SBAA 2YROA 3OEAA 1U12A 1A78A 1JODA 1YQCA 2B8MA 5T5JA 1JYVA 5LEJA 1R081 1BYHA 3WD5A 3JU9A 5JLVA 3O0VA 3WW4A 4S2HA 1WLCA 3A7QA 3AYCA 3POSA 1RUD2 1H1AA 4XEZA 1HB4A 1CZSA 1PGW2 2A70A 4AHZA 1N1SA 2LM3A 2J1EA 2G4IA 4Y3OA 2J7MA 5JXIA 1OURA 3O1TA 3UJQA 4CDQC 4QWNA 5A3MA 3NVCA 1RVF2 1WCKA 2JDAA 1C1LA 1GYKA 3J7MA 4I3PA 5KHHA 3T0BA 1K12A 3U78A 1PGW1 5FZIA 1HDKA 4Z2AA 1YCIA 5IJRA 2OA2A 1H8TC 1W90A 3GZAA 3MF9A 2BFUL 4RQPC 1H6XA 2D6PA 4G3YC 4Z82A 5T55A 3LFMA 1AR71 5FZCA 5E1RA 4D7YA 5FOBB 2GSYA 2ID4A 3TN91 1RVF1 1ZRDA 1VBD3 4XACA 4CP2A 3AP6A 1H8VA 2CSGA 1W6NA 1X36A 3ZN5A 1PIV3 5FRAA 4M3CF 1ND2C 2AC1A 1HXS3 4OI2A 2A6ZA 2XGXA 3CJXA 4AI0A 1H9WA 2Z4FA 2YUEA 3K4ZA 2R071 3NV1A 1ZRFA 4ZZ5A 3DV8A 4FPYA 1KJRA 1I5ZA 1KS4A 1VRBA 4FCAA 4QDRA 3RQ0A 3WHTA 3ZXKA 3V0AB 1CX1A 2JG9C 5FXVA 3URFA 5LA0A 1CJPA 3BOWA 1SMVA 3VD9A 5DG1A 1BJQA 4XABA 3HQUA 4GULA 4IE4A 1HN0A 4A6SA 3WNNA 3LIHA 1AYN2 3BPZA 4JC1A 1IS6A 3A0NA 2VOTA 4BQYA 1GZTA 1S0DA 4YWAA 3BTXA 4MOAA 2W87A 1ASJ2 4C1WA 4DEVA 2W52A 5A6XA 4XJUA 1O4TA 2VQTA 4LO4B 1QHDA 1CD3G 2OUJA 5A7QA 5CFDA 4KMQA 1Q56A 1UZ0A 2ZGNA 2F4PA 2WQZC 3RG0A 4HVOA 1DP0A 4Z1VA 1HB3A 2RDRA 1RGSA 4M3CB 1DGRN 1ASJ1 1NQJA 4OI4A 4XUTA 5DG2A 4QPIC 4OHYA 3TAYA 1RMU2 1SLLA 4GB32 3BGAA 4ZU7A 4CUAA 5ACA1 2QQVA 1RUH2 4A45A 2W3JA 4HSJA 4FFIA 4LEJA 4SBVA 3BUCA 1CGPA 3AVRA 2QCSB 4XXPA 1UMIA 2XXZA 2E33A 1NCQB 4K20A 2JEMA 1G9BA 5FIXA 1DGRA 3UGFA 1CZVA 1GZWA 2VOWA 3POFA 3VKOA 1W39A 4AEDC 5LA1A 3I2FA 2H0BA 1RUH1 4Z07A 1ZBA3 2OZJA 4LOTA 3UGGA 1IPKA 3JZVA 5FYTA 3VZMA 3ZYHA 1QOSA 1KJLA 2R0FA 2ARBA 3VHNA 2EICA 3KCCA 4FVVA 4HK8A 2VTFA 4RD7A 4XUOA 2O8OA 4DNYA 4XQWA 3QBQA 2BVBA 3AP4A 2CWMA 3ME2A 5EV7A 3ZYFA 1KD7A 1B35A 2ZEZA 3UK9A 4DMIA 4OI0A 5BNPA 4URTA 2PLV2 3DPRC 1UD1A 3I2DA 5EQUA 1VR3A 4P9LA 3S0MA 3KM5A 1SLTA 1LGNA 5HCHA 3ILNA 3P3NA 1Q43A 1GNYA 3A23A 3NV3A 1U0AA 4LLFA 5IVJA 1BHGA 3CZUA 4AQ6A 4YZ1A 3A21A 2ZAAA 1YNAA 2ZGOA 4QQPA 4AEJA 1ZZBA 5F5CA 3VBFC 1V6OA 3WNOA 1EPZA 2JDMA 2OPWA 1X8MA 5A3PA 2P3IA 4AEMA 1OXCA 4U36A 1LCLA 3AMQA 3JBG3 4IV3C 2FZ1A 2PHFA 1NOVA 3SISA 4AW7A 4D6RA 1F4HA 3H8RA 1UW8A 4I0WB 1OD3A 4MHUA 3E5XA 3MIGA 1PO13 2WAAA 4XJZA 4Y1UA 4CUCA 4HSLA 1S0BA 4AQ2A 5LA9A 4YVSC 4GJZA 1RUJ3 2VOVA 1UCXA 2JICA 5A3WA 1FI2A 4DPNA 2EIGA 1O5UA 4AAXA 4RQPB 2BZDA 3PJQA 1S0EA 5FZOA 4P9JA 4DB5A 5A33B 1RITA 2QQPA 3UKNA 4X8PA 1FNYA 1H6YA 1CAVB 3IMNA 4W50A 1KRIA 1H1MA 1I3HA 4NE9A 5DZEA 2ERFA 5KC5A 3U10A 4AAPA 4GQ7A 2WNUC 2Z42A 5GZFA 1RUD3 2P37A 2QQIA 4YVWB 3WLUA 1O59A 2C9KA 3R6SA 4CDQA 1NKGA 2CY6A 1YFUA 3RWNA 5JSOA 1OLMA 3AJYA 3KD4A 3WF3A 2OZ6A 3WNLA 3KT1A 2VCBA 1D4VB 3AKQA 3KF3A 1DHKB 2GC0A 3ACFA 4LKDA 1J3PA 2UWCA 4KU8A 4L92A 1REEA 4QT6A 1H8TA 1TNFA 4JGZA 2W1WA 3M1HA 3AMPA 2JG9B 2O8QA 5IFTA 3ZFGA 4DO0A 1RB8G 4XJWA 1KS5A 2BNOA 2CGOA 4QXBA 5FZGA 2YV8A 3CU7A 2W5FA 3NAPC 4YW3A 5FLIA 3ZMOA 2P1BA 1Y9GA 2XJVA 2FCVA 5FYSA 1DLLA 2H6CA 1ND2A 3IKWA 4JDMA 3AZYA 4P08A 5CBLA 4OUEA 2VNVA 5FZ6A 2UY9A 4DIQA 1QXPA 1VBE1 3NWKA 4IESA 4NUBA 4PCRA 2VULA 4YW4A 2ARCA 4PQQA 4COYA 2WSUA 5FO9B 4FAHA 4CXYA 3CDZB 5KHKA 1JYTA 4O65A 5KC6A 4XQDA 1P8JA 3C8XA 2RM21 2JG8C 4KGQA 1QJZA 3QLQA 4SLIA 1MACA 1GMMA 4YFWA 1PO21 3AKSA 3HQXA 1H4HA 4XF0A 3RGBA 4FP3A 2KXLA 1YJLA 1RHI3 2NYYA 1POV0 5FKCA 5A7WA 1VBC3 3OUJA 4JV4A 1GNHA 1LHOA 2R0HA 4Q0SA 2KA3A 2Q8CA 3WW2A 1YFWA 1AYN3 4FP2A 1RINA 3ZFFC 4AYUA 3GDBA 3RZLA 4XW3A 4EN7B 3M70A 3VBHC 5KXCA 2R062 1OPOA 3FMGA 4D0QA 2GP5A 3O1RA 4DOUA 1OQDA 1S0GA 1DQ1A 2BV4A 1JHNA 4FTSA 4MH0E 3J4UH 2QNKA 5FUIA 5BNNB 5HPOA 3VBRC 3LDKA 3LFIA 3MGUA 2BGPA 1BBT2 4F7ZA 3AFKA 4QPIA 3S5AA 2RV9A 3DYMA 3RVHA 4QMAA 3WXPA 3CNAA 3HT1A 4ISQA 4QB1A 1MZFA 2W1SA 3SCFA 1TMF3 4RR3C 3HQRA 4JGYC 1RMU3 5H9SA 3TRSB 4GB33 1RUE2 1VJ2A 1LGCA 2R16A 4UBGA 4GJYA 1MS9A 4IL7A 2Z2SB 4NMIA 3WR0A 2D3PA 2VXJA 3AKPA 2HEWF 5C9AC 4CCJA 4FI9A 4QX1A 4XHXA 2W91A 2E7QA 3K48A 4LR4A 5DUWA 5KWRA 4AEDA 1SLCA 3AL5A 4ZPIA 5FBZA 1GOGA 5T5LA 3ZFEC 3IMMA 1WMEA 2LS6A 4QDQA 3KVAA 1MS4A 3NMBA 1RUE1 4Q4X2 2Q8EA 2XG3A 2DUQA 4D6SA 1X82A 3R4DB 2WFF3 4R9BA 2D7FA 4ZKTB 3AVSA 2HWF2 5DZFA 1MVEA 4GH4A 1WD3A 4XIOA 1OA4A 4BLIA 1FPN2 1OA3A 4IV3B 4XYXA 1V0AA 2DCYA 2WO7A 2ZEYA 1QMJA 1UOGA 1W3XA 2GC1A 3AMMA 3DPRA 4LA3A 3ZYGA 2D6LX 1BVVA 2OIIA 2BGCA 3I3BA 2XJRA 1LJ7A 2PLV3 4NRMA 1Z78A 3PUAA 4XCBA 4F8AA 4AVVA 5C6CA 2H0VA 3VV1A 3ZN4A 1QJEA 3VBFA 4QX8A 1UL9A 4AZZA 4DS0A 2BNNA 3NNJA 1UYPA 4HT1T 4XAEA 4XTPA 1YIPA 1QJY1 2XQRA 1U5XA 4BMBA 4QGMA 3GZEA 1K42A 1XC6A 5I8YA 5I93A 4XF4A 4L11A 2WNUB 4CTEA 1F9KA 1ZA7A 1PK6B 1WBLA 3S57A 2CHHA 2UU8A 1ND3B 4LTAA 5L7OC 2QQJA 5IVEA 4NIHA 5IWFA 3ROUA 4N7IA 2WZR2 1JZ7A 1LHWA 4NO4A 4MADA 4YVSA 2H6BA 4HLTA 1O6UA 4IV1C 1DLCA 3I2JA 2JD9A 2ZAHA 2D44A 2P5BA 4XOGA 1QDCA 2XVLA 4KI5M 3KMHA 4QM8A 1SQ4A 1JN2P 2X5IC 1U5YA 2XJTA 2WN2A 3ZSLA 4BISA 5C4WC 5FR3A 2GNTA 4COVA 3CBNA 4UW4A 2Y0IA 3EJKA 1W8NA 1FV3A 4QKBA 4CDUC 4OHZA 3S5QA 3FHAA 3ZR5A 4FPJA 2A3XA 4A3XA 3ZOIA 4CP0A 3JD71 4BXSV 2C1FA 3HBKA 5LCWL 1WGPA 1OMIA 2Q1FA 4XCAA 1MZ6A 1PVXA 1Y4WA 3H50A 2MEV1 3KWVA 1LAJA 3PNAA 4Y22B 3T0AA 5K0UB 1WA4A 2WT1A 5FPXA 3WNKA 4W6WA 1UMZA 3LA3A 2W68A 4YZ5A 4L97A 1MS8A 4YYOA 5FP9A 3DN7A 1GBGA 2GZWA 2VQUA 1UY4A 1FMD1 1YYNA 2ETEA 1WW4A 3HN1A 2AYHA 3B3QE 3N9OA 3NAPA 5CNAA 2ZBJA 1BEV2 1DGWA 4Y1YA 3T3YA 5JOXA 1RUNA 1LKNA 1GOHA 1WBFA 4J1WA 3NV2A 1GNZA 2FDKA 1BQPA 3PVNA 4FOQA 2IXKA 3OY8A 4AQTA 1RUG1 1VMHA 4EZ4A 4ORFA 3RZMA 3HNMA 1CZTA 1QJX1 3GCWA 3VBHB 5FYHA 3OF1A 1JU4A 1BEV1 1Z7S2 4IUGA 4QAWA 2FCUA 2I74A 3N7JA 4AQSA 2WJSA 1TME3 3C7EA 3RMXA 1V6JA 4FAGA 3H8XA 2JG8A 5EXOA 3NW4A 2Z79A 4GMP3 1HN1A 1RUI2 4DRRA 4FTEA 2WR9A 4ATFA 1BK0A 4XILA 2JDZA 1UY0A 4E8DA 1PGL1 2XKOA 1YUDA 4J1XA 5DDJ2 1ZBE1 3VDDC 4YM0A 4EWDA 2YGMA 3N9NA 1D0GA 4DY5A 1QXJA 4XMAA 1JZ4A 1W9YA 5F5IA 1VB2A 5IAXA 2AENA 2Y38A 1GFF2 3IPVA 2XVGA 4IGQA 4N43C 5DAWA 3O0WA 4B4PA 1ODMA 1RUI1 2HWE2 5A1FA 3ZFFA 1LULA 4JQTA 2ATFA 4Z8BA 2AEZA 5GJ6A 3AP5A 3L9JT 4XZPA 4QQOA 3ZR6A 4Y4RA 3EB7A 2ZGPA 1UU4A 5A32A 4ARXA 3D3AA 1NXD1 4IE6A 4UW3A 1O3QA 4QX7A 1NX9A 2GN3A 2R063 3PVBB 4Q4W2 4HG6B 3IZOA 4NWWA 2BRTA 1TQ5A 5FPAA 3K3OA 2IZWA 3RWKX 5LEKA 1PX3A 4Q4V2 1RUF1 4PLNA 1BBT3 4RR3A 3POYA 4FOVA 4JGYA 3NJZA 2EA7A 4JX0A 4MLOA 4NJ4A 1DQ4A 3D6EA 4L99A 4Q4W1 3U07A 4LBJA 3AMHA 5C71A 1O3RA 3BKZA 4CDWB 5C9AA 1YLLA 3MW3A 5FYZA 3ZFEA 3N7MA 4Q4V1 2VTXJ 3GNEA 5H9PA 1V9U3 1HB1A 4OMCA 5APAA 4Q4Y2 2O1QA 1Y43B 2RVAA 2W2IA 4PDWC 5GZGA 5FP8A 3O1MA 4CUBA 1NLSA 2RR13 3A0KA 4Q4X3 3MPBA 4KBZA 5KR7A 4E2QA 4I09A 4NOTA 5AC92 3POBA 1LHUA 1UPIA 3NNGA 1R1ZA 2HWF3 3OSDA 2XWBB 4CU6A 5A3UA 4CDUA 4L2NA 2ZOEB 3ZPYA 1OC1A 3MUY1 2VU9A 5C3SA 4DXTA 3PUIA 4NRQA 1FPN3 3FUOA 4HN0A 3SC7X 3VBUA 1DYPA 1Q8PA 3T4VA 4I3GA 3WP4A 5C5TA 5KHJA 1QOTA 4GWMA 4IV1B 5FXXA 1X7NA 3BVCA 1MPXA 2IXHA 2WWSA 3S30A 1YQ2A 4CCEA 3ZKYA 2YFZA 2PN5A 4AGRA 5HV4A 4Y4YA 1GZCA 1UQXA 2X5IB 1K5MB 3EQEA 3HWJA 1NZCA 1KFXL 1W6OA 5C8CA 4YSFA 4JKMA 5A7OA 2IXJA 1W8WA 3IT8A 2PHWA 4P9WA 3AK0A 5AFBA 2Q8OA 1SLBA 4HANA 1NAEA 5JUVA 1XE0A 1VAMA 3EBRA 5FYUA 4CEYC 1LHVA 1KFUL 1ZRRA 1JZ6A 1RJ7A 4QPGB 2HBUA 5L7OA 1J83A 1TZOA 2KD7A 3RZZA 2WC2A 2V5DA 2A6WA 3WF0A 3MV01 1CR7A 3ENRA 3RDIA 2EIDA 2WZR3 4LKSA 3DXUA 1MS5A 5C4WA 1V70A 4AFBA 2VMDA 3AMNA 5DN2A 4DXRA 3M3EA 2V4AA 4E2SA 4J6GA 2Y64A 3V0BA 5FY9A 1NCRB 3EMRA 4E27A 5C3RA 5LATA 2Y8KA 2JE9A 2EF6A 2N7GA 1BXHA 1J1LA 4QX3A 5LY1A 1ODNA 2DCJA 4LXLA 1C5IA 3WW3A 1OQEA 4M00A 3WSOA 5FWEA 1OOPC 4IEWA 2ARAA 4B8EA 2RS33 2ZGKA 4P9GA 3MI8A 3KQRA 5FTTC 4CP9A 3N35A 4FPHA 4M0HA 4BDVB 5BNOB 4CPBA 4XZUG 4K7JA 4Q0QA 1ULOA 1EAH3 2D6KA 3I59B 1UXZA 4CCNA 1QH7A 2VQAA 3OUIA 4Y26A 1PNFA 3KT4A 1OUXA 2VL4A 4AOCA 1N3QA 2WA3A 2BYVE 4Q5OA 1AR63 1JMUB 2XQXA 2YBPA 5FZMA 3MIDA 3USUA 4LE3A 1WMXA 1BK1A 1RYYA 3ES1A 3WDVA 4E4HA 1BMV2 4QQ2A 3WEZA 4NPRA 1XNBA 3P1IA 3D4KA 4AI9A 5AVAA 1LOFC 1Z7S3 1G9CA 4RS5B 1WZXA 2RDNA 4BWOA 4LT5A 1F8VA 2JENA 2JKXA 4L0PA 1W04A 1AR83 2GNDA 1ZA4A 2VJXA 3M3IA 5T5OA 3CEWA 3U4SA 3VDDA 2BNMA 4ISRA 3KV6A 4UOJA 4ASMB 1V6NA 1XSRA 3TWIA 1BMV1 3NJYA 3VBOC 1JZ8A 1AJKA 5DDJ3 1NCQC 1UY3A 2FHRA 4N43A 1SPPA 4OHXA 2J1SA 3AX4A 4WVWA 3LPGA 3PURA 1QOOA 1L7RA 4XFAA 4XUNA 3ILFA 1W2TA 3WNXA 2HWE3 2YB7A 5EP9A 4AI2A 3FHQA 2VVFA 5LASA 4MO3M 4B4RA 3OUHA 2D3SA 4EN0A 1O8PA 3L2HA 4PDWB 3EYPA 1K5JA 3MIFA 1PGSA 4IEOA 4LBQA 3KHBA 5BY5A 1JZ3A 2DVAA 5GALA 3Q8BA 3WG3A 4ASKA 4RN5A 1UZZA 1S0CA 4E8CA 2A5ZA 4LOSA 4NHYA 4CEWB 1VBB3 1W2OA 4RYDA 2ZMNA 1G86A 1AR91 2J42A 1R082 3ZXEA 3DF0A 3G6JB 3D8CA 4QM9A 1DG6A 2Y6KA 1OSGA 4Y1XA 2C9AA 5C3OA 2HH9A 2TNFA 2VUAA 2K0GA 4E9KA 5CA6A 4I01A 2VZSA 1CAUB 3PHMA 4LPLA 3FC0A 2JIJA 4Q0VA 5H9RA 3C7FA 1RUC3 2WA4A 2R7EB 5BV6A 2EIBA 1AJOA 1N1TA 1E5SA 1DQ2A 1XNDA 2PHLA 2WS92 3MW2A 4Q4Y3 2XPJA 1OKQA 3QH6A 4PIZA 1JOBA 3WP6A 3BTYA 4DXSA 2WABA 2ZMLA 1QNYA 1POV3 4I30A 4D94A 5AC93 1Z0HA 4HOOA 1AR72 4EV0A 2D3RA 4CEYB 2UY8A 4HETA 5FZEA 3I2HA 3TN92 4K40A 1UOFA 2K9ZA 3N9QA 3DGTA 2WS91 1W0PA 4ZU5A 1NXMA 2D6NA 4EJRA 1PHMA 5K7PA 5J1XA 1GWLA 1V00A 3DKWA 3MYXA 1W3VA 4HKWA 2W94A 1AXKA 2PYTA 1NA1B 3BODA 1J59A 2TEPA 4J25A 2GC2A 2RS51 1UOJA 4XJ9A 1D4M2 4TSVA 2R072 4CCDA 4Q29A 1UMHA 2YU1A 3OGRA 3ZLIA 3C3VA 3UV9A 1SCRA 1YQ8A 2E31A 3LIGA 3AKTA 4YVWC 3VHRA 5JSPA 2QQLA 2R30A 2PAEA 2NM1A 4R9CA 1GP5A 5JSRA 3CJIB 5FY0A 3VZKA 2DBIA 1D4M1 2VXRA 1FYUA 2HEYF 4ZHNA 4Z92B 1C8M1 3GBGA 3ZX7A 3ZXJA 1OOPB 5JPNB 2E9QA 1ZRCA 5IK7A 5EFUA 4EN6B 1CX4A 4E4SA 4C8DA 3H1WA 5E8AA 4BK5A 3I97A 4KWUA 4ET7A 1OLME 2YYOA 1OF3A 3I3EA 3VD7A 3R05A 3N9PA 2WBKA 2XLGA 4HKOA 4MUVA 3K3NA 2GH2A 5KXDA 1JOJA 4XUPA 1YWKA 2ZXQA 2I45A 4IEPA 4D69A 1GKBA 2HWC1 1W2NA 1W9FA 5HV0A 4TLGA 1WCQA 1BLZA 2VZUA 3H42B 5FQ0B 3THPA 5ACA2 4NIDA 3T08A 3S7IA 4M4RA 3MPPG 3J7LA 4CXXA 5CKNA 4DY3A 3V0AA 1A8MA 1NG0A 1O8SA 4JKKA 5F1RA 2VAUA 3NV4A 4AK3A 4OUSA 5JWPA 3IDBB 1FAYA 4ZXEA 3SCGA 3M3QA 3E6CC 1XYOA 2B46X 4LIUA 4NN0A 1GUIA 3H9AA 4A6OA 3CIHA 2CNAA 4XQ4A 4YNIA 4BPZA 4BK4A 4OLLA 1IZ3A 3VGIA 3C2UA 3VBOB 5CADA 2VE1A 5FZLA 1JOPA 1QF3A 2Y6JA 3BALA 5FKBA 1AL21 5CEHA 2PXJA 1EV13 1O3TA 4K3UA 3J8F2 1JUHA 1F35A 4UI9L 3MIEA 2VMGA 4OVEA 3GYDA 1W8HA 2YBKA 3B69A 3WVJA 1ONAA 3LA7A 5F3IA 2X09A 5FXWA 5BNNC 1FOD1 4M3CA 3FLRA 3KCXA 2A7AA 1PVC3 1LOFA 3GXUA 4K1YA 3UKVA 2XOMA 3TBDA 1SACA 4AI1A 1CAWB 3J8F1 4OQ9A 2OPKA 3M2MA 1OVSA 3ACLA 4YG3A 3VDCA 1NZIA 1UKRA 2DFCA 4A3ZA 4NRPA 2A71A 2P3JA 3FX3A 3JB8A 2F4LA 3LSEA 3PUHA 4PJYA 4X8NA 4CDXC 2BERA 5C70A 2VUJA 1PM7A 2ORZA 1NCQA 2MNGA 3V56A 4Z2WA 1WLWA 3WNPA 4ZS3A 3VD4A 1GZ9A 4NWVA 2Q1ZB 2QTWB 2PTMA 3J26N 4S2DA 1MZ5A 2YY1A 2RG4A 3LB9A 1GLHA 1PX4A 3AZWA 3GJAA 2XWJB 4P9YA 2HWB1 2BP6A 2GMPA 2LALA 2P6HA 5K4LA 1GQGA 4UFHA 2X8KA 2Q8DA 5JXGA 3PJYA 4FPGA 3ZXDA 4L9BA 4BQ5A 3LA2A 5FY4A 2BBVA 1DCSA 2ZACA 3O1UA 2ES3A 1IG0A 4X6QB 3I54A 5GZEA 2J22A 5DMYA 1CAXB 1XNKA 5CU1A 4V2VA 1W9TA 2CWSA 2G9ZA 1SFNA 2OT7A 5JI9A 2E26A 3VHOA 3U0ZA 4D7TA 1H0BA 4XAAA 4C1XA 1GWMA 4ZY9A 5F3CA 1COV2 3MBWA 2AZ5A 2ILMA 1HJGA 2VD7A 2WNOA 1R083 1W8FA 3BOPA 3AZXA 5CZKA 4YW6A 1VRH1 1R091 1YHFA 4GIQA 2DU1A 5IATA 1APNA 4MXVA 1UO9A 5HCFA 3Q8EA 4WM7B 3KZ4C 2VCAA 1LEDA 3ZN6B 3UNPA 2W39A 1HRV2 5FP3A 1CVNA 3IAPA 4IQPA 4UBHA 4G9SB 1COV1 4XTMA 1M06G 3RI8A 5C5UA 5JXJA 3ZO0B 5DUVA 4RL7A 5FZHA 4LUMA 1DYOA 5A7SA 5JMCA 1MEC2 1JZ2A 2C5DA 4YW1A 1SHWB 4LBOA 1PK6C 2UWBA 3AYEA 4YM2A 1ND3C 3WCRA 3FBYA 4R4ZA 4BQXA 1HRV1 1JI6A 1I6XA 4FPLA 2WZEA 1XE7A 4LK7A 4XF1A 3SH4A 3U1XA 1AR73 4I0AA 4RGKA 2VUCA 3TN93 1RVF3 4DFSA 1MEC1 4RQPA 5H9QA 3VDBA 5L9VA 2HLEA 1LU1A 1XYPA 3ZFGB 5A33A 3TEXA 5EJ3A 4WZFA 1VBE2 1CAVA 4LHSA 4QKFA 3LEKA 2VZPA 5CG9A 3H1YA 1CESA 2LUWA 2DVGA 5GZCA 4KNCA 2WQ4A 4OMDA 1UYZA 3INAA 3RI9A 1O5LA 1N3OA 2RM22 4UFMA 4CCCA 4YVWA 3N9LA 2R073 4C0HA 2FD8A 1PO22 1X9PA 2W92A 5FYYA 1VBA1 1ZREA 2EXIA 5FZ3A 1WKYA 1ZZ7A 2PHTA 4IXLA 1UZWA 5K0UC 5D21A 1IG3A 1QQP2 1RC6A 1W2UA 4QKNA 4W8JA 5GLZA 1ZNPA 4N53B 4NIGA 5CFCB 2E51A 2OVUA 1NUKA 3CMGA 2PQSA 3SLIA 2JG9A 4BQ4A 2BUKA 3F2ZA 2HWD2 1UKGA 2B7YA 3WQ7A 1T2XA 1GQHA 2J1TA 3MUZ1 1C8NA 4HBNA 3OGJA 5LWBA 3OCPA 1QQP1 4E4DX 2NMNA 2SLIA 3JUUA 4MXWB 3VKFC 2BW8A 2YGLA 5J7MA 2JD4A 1RJ8A 3ZYJB 2HWD1 1NYWA 2WNVC 2ZGMA 2QUOA 4RSUA 5I0SA 1EYBA 4EN8B 1ASJ3 2YU2A 1ULFA 2WO3A 3AL6A 1R1A2 3O0XA 3CHXA 3OJBA 1IQDC 4WVMB 3BB6A 1RUOA 2XHKA 4U2AA 3PL0A 5ACA3 5J36A 4LKFA 1QJU2 3MIHA 5FMBA 5ABJB 2GU9A 3POEA 3DECA 4WVVA 1EUUA 5FUNA 2FQPA 3TYJA 3VN4A 2A6XA 1ENSA 1R1A1 5IW0A 3OBTA 2CAVA 4NHKA 3UJOA 3PU8A 3V64A 4CDXB 1Q8OA 1JW6A 5IVFA 3WDWA 1OT5A 2PA7A 1RUH3 4RHV1 5CVRA 2EXKA 2GDFA 4JHTA 4DINB 4D7SA 1QJU1 2FBEA 4UF0B 4COUA 2DV9A 3HR9A 1LOAA 4JHZA 4LIVA 3HIFA 2RS12 4Y20B 1BVP1 2IXCA 3W59A 2XUEA 4Q2FA 2OW4A 3HD8B 2CTVA 2ZHMA 4QXKA 5EJ1B 1JUIA 5BNNA 3U14A 4YG0A 4N9IA 1ALYA 2X05A 1AYM2 4XFCA 3WX5A 5IVBA 2RMU2 4O61A 2R1DA 4FXGB 2CV6A 2HKXA 2QQUA 4MSVA 5FV3A 4EWAA 3MLJA 3T2QA 2ORXA 2RS11 4IETA 4Q8KA 1UAIA 5LK7B 4BYYA 3GBWA 1IS3A 2C0ZA 1OKOA 1ENRA 1J3RA 4Q0UA 2R042 1ZX5A 1IKPA 1AYM1 4QX2A 2RMU1 5IVCA 4AGGA 4CDWC 1I1EA 4URAA 4LBNA 1UU5A 3DYOA 1QJY2 3O7OA 2BJSA 1DZRA 2RE9A 2XL9A 2NMOA 2ZGRA 5HCAA 5FYMA 1NY72 2R041 2IC1A 2CYFA 2WLQA 5LRRA 2BEOA 4BQ1A 1TEIA 5D1IA 4INDA 3FL7A 2PAKA 1JYCA 4JCKA 4CCMA 4P14A 5C7GA 1REFA 5LBCA 2FDIA 1Q5OA 3LAGA 4QXCA 5FY1A 3KLSA 3A22A 3T2PA 4LE4A 3T1LA 4OHVA 2WRAA 3TNQA 4AVCA 4WM8B 1VMJA 3OB8A 3N7LA 2B45X 3ABZA 4E4ZA 1NY71 4IV3A 3VZJA 2OX0A 2WL1A 4XUQA 3O12A 2VW1A 4MYEA 3VUOA 5FCCA 4GXLA 4IEXA 1W0NA 3ZSEA 4QX0A 3I8TA 2QE3A 3T1MA 5FP7A 1JH5A 3K75B 1W9WA 3KV5A 5A6ZA 1E5IA 3AJZA 3CF6E 4GAZA 1SLAA 4K8FA 4UAPA 4HKLA 3TNPB 1NE6A 2J1VA 2VG9A 4W4ZA 1AHSA 1HRI2 2B42B 5LB6A 2EXJA 1K5MC 1VPHA 3JD72 2C4XA 2J1RA 3JQXA 1DZQA 2QJVA 1GQPA 1T6GC 4ZZ8A 1V6MA 5DXDA 5E16A 2I07B 2MEV2 4JRLA 3ORJA 3BTZA 1LOBA 2ET7A 2WNUA 1HRI1 3TEZA 1FATA 1WD4A 1H2LA 4QPGC 1ND3A 1FMD2 2A6VA 4KWLA 2CL2A 3AXEA 4HPKB 3RYKA 4DXZA 4CU9A 3DYPA 2VH9A 1UZVA 3MV11 4AG4A 4LORA 4MGYE 3BPSA 3OG2A 1AVBA 3F95A 3KVBA 1AZDA 1SFYA 2GAUA 4YM1A 5F6KA 2FDJA 1ULEA 1RUG2 1F2NA 2EALA 3OBAA 5FYBA 4YPJA 3ZMNA 2X29A 5EWSA 3WINE 5A80A 1QJX2 1W6MB 2VC9A 3THTA 3RYPA 4FFGA 2WT0A 5FMOS 4NHMA 2LRPA 1QKQA 3MLLA 1NCRC 3LQCA 5E6HA 3HN3A 1IPJA 2CGNA 1VBE3 2D40A 3EXUA 4MX3A 3GZTB 4D8MA 5FAXA 4KWJA 4OUMA 1PMJX 1PGL2 3VDAA 1GANA 2RM23 2WNVB 1ZBE2 3ACGA 3FN9A 4Y22A 5FZ9A 4K6BA 1RL3A 5K0UA 3OD0A 3AB0A 1PO23 4UXAA 1US2A 1W9SA 4AF9A 5JDBA 4COZA 1IKQA 3PVEA 5AFEA 2UYBA 3WF2A 2WWUA 3OGVA 2ZGQA 5L9RA 1CIYA 4TXWA 4TTGA 1GWKA 2ZGTA 3LOIA 4Q1RA 4Y1ZA 5BNOC 1YI9A 2NZ9A 4GWJA 3IPVB 4XFGA 3RZHA 2OQ6A 2XJSA 2D6MA 3K4AA 1DIWA 1US3A 5IVYA 1PZ8A 1OBNA 1L7QA 5FYIA 2ZABA 1OUSA 5T5PA 4PBOA 1OPMA 3VBHA 1M4WA 3O5SA 2VZOA 2VMFA 5A32B 2WINB 4BA6A 5FY5A 3PTRB 1E5RA 2PFWA 5JVVA 1RUF2 1VLNA 2UYAA 3B9CA 2J1UA 4PF1A 3ZXGA 4CYDA 1W99A 4CU7A 5B2GB 3IIIA 4RS5C 3VBRA 4QB2A 4BCUA 4DUWA 1ST8A 2DUOA 2JE7A 3E5QA 4LLOA 1Y3TA 4NAOA 1D2SA 3MF6A 2Z69A 5FFOC 5JCTA 2XBO2 5LBEA 3P3PA 4PBPA 1CPMA 2C26A 1VALA 5FPBA 2P4EA 5GLTA 3RNSA 1BZWA 3WP5A 2V73A 2WO1A 4QQLA 1AX2A 2BTVC 5LBFA 1X9TA 3T2TA 3O1OA 1RUE3 3SKVA 4R52A 4B29A 4LK6A 1DQ0A 4XHBA 2XBO1 4FT8A 3CLPA 4I2OA 4HVRA 3JQWA 3AKRA 2BU9A 1QJFA 3NL1A 4RA0A 4YW2A 2A1XA 5FLHA 1OHFA 2XJUA 3NKTA 2OKXA 2P2KA 4NVPA 4CEWC 3WQBA 5DUUA 3OBRA 1XU2A 2JJ6A 4OZXA 3VBUB 3MLKA 5FZDA 1W8OA 4DRVA 2PQQA 3S6PA 5I0DA 2PHDA 2BWCA 2VM9A 5I8SA 4JDNA 4PIYA 4AI8A 2GNBA 1S2BA 2B4KA 1FX5A 2QFEA 5JAXA 2ZHNA 5ANNA 4FPCA 4BB3A 1ULCA 1QWRA 1QJY3 2DCTA 5JIAA 1PMIA 3OD4A 3ZSMA 1TNRA 3K4DA 4XJ8A 5C8CB 1XOYA 2WKKA 4EWEA 5IK8A 3I3MA 4MGSA 1GR3A 3B94A 1XNCA 2VNOA 2BQPA 4XURA 4XFBA 3AXDA 3MHZA 3RJRA 4DEQA 3LWCA 2WO2A 1C3HA 2WWJA 3OEBA 4LO6B 1DQ5A 5L9BA 5GLUA 2A6YA 2WSVA 5JZGB 5HXVA 3HNBM 1NE4A 1HLCA 2J1AA 2BOJA 2QZ2A 1A3KA 2NN8A 3MDPA 3NNFA 3OYWB 5FPVA 3SCHA 5A6QA 1H2NA 5D8AB 2VOKA 5CKMA 2D93A 3HMYA 1VAKA 4IEQA 1VBD2 4IV1A 3LDBA 4FPOB 5JMOA 4TYSA 4AVTA 3VBSB 2VW0A 3FE5A 1NA1C 2X5IA 1K5MA 4CRQA 2CU5A 4KBBA 4LULA 1F5FA 4JKLA 1NLQA 4R8HA 3WG1A 1VBD1 2VZ3A 3BU0A 4MG2A 2MEV3 2JDNA 1LU2A 1PIV1 4KH9A 3SH3A 1JHJA 1K3IA 1JXNA 1N1YA 2JDKA 3D0JA 3CJIC 3APBA 3ETQA 4QPGA 3N3HA 4XFFA 4AHWA 1HXS1 4FOWA 2HBTA 4KQ7A 1W0OA 4F83A 1FMD3 2B9UA 1WCSA 3BIEA 2JB8A 5AVPA 2XL7A 3KGZA 3QD6A 3UT0A 4CCOA 2DWRA 1CJDA 2AACA 1HV0A 2K2SA 2ZX3A 3IIAA 2G19A 1GOFA 2W0XA 2BPA2 2E7AA 4Y33A 4XBQA 4YGEA 5KXBA 1RUG3 1ENQA 1NCRA 2A75A 4B4QA 1RXFA 2IXIA 4RGGA 1VP6A 3IDCB 3RZGA 1QJX3 2D5FA 5G04L 1JYWA 4FPEA 2NP0A 1BEV3 3UGHA 4QU1A 3T30A 2FDGA 1W06A 4AL9A 4CCKA 5G05L 4XF9A 5IVVA 4JVAA 3U37A 3BN6A 3ZYIB 4BZ4A 1DDLA 2LW8A 3KT7A 4D3WA 3OGGA 3N4MA 2FDFA 3GCXA 3HEIA 1SBFA 2XMLA 1ZBE3 4XBLA 3USSA 5I91A 3TOJA 5DZGA 1O7FA 1PZ9A 2R32A 1UY2A 3J7NA 4FPKA 1CONA 5GLWA 3WQ1A 4EYUA 2W1UA 1MZEA 2WYSA 4QHZA 5FK7A 2YC0A 5BNOA 5FWJA 4HN1A 5JR7B 1RUI3 3I59A 5CKQA 1TG7A 1EY2A 5GKAC 2F17A 4XIKA 3CO2A 1ZBA2 1X8EA 1XNAA 3U4XA 3ZXAC 4PI0A 3BI3A 1CN1A 1LGBA 1MQTB 2E6VA 5F5QA 2JX9A 5L19A 1H9PA 1T6BX 3BU7A 3VL9A 1OI6A 1JZ5A 3AYDA 4LHLA 1IS4A 3AZZA 4BQ2A 4IEYA 5JXHA 4XPVA 1O3SA 1ZBA1 3NNMA 1OFNA 3KS7A 4RS5A 1C4RA 1AR92 1RUF3 2Y0OA 3CQOA 3FFQA 1W05A 3VKMA 5JOWA 4FTBA 1DU3D 3NJXA 1W6PB 4JTOA 2DVFA 4Q4W3 2DCKA 2HJIA 1B35C 2RJLA 5CIRA 5LBBA 3UKTA 2DTWA 3ITQA 2YHJA 3O1PA 1O4YA 2I2SA 5FMOL 2OYZA 2DURA 2DFBA 2QQKA 3K51A 4BMEA 1W6QB 4M3CE 3BCWA 4XFIA 4Q4V3 3HNYM 5HI0A 5LRSA 2Q30A 1SBDA 3H3LA 2YMZA 1JTZX 5A3NA 2QZ3A 2AREA 1ZZCA 2PMWB 5JZGC 2JECA 4P9XA 4XBNA 4CZSA 4AGVA 1UX6A 2VNGA 3WDTA 3K77A 2JB4A 3WDUA 1A34A 1NT0A 3H3UA 1R64A 4NPLA 1YFYA 5I0UA 2FCTA 4AWDA 4HONA 1J3QA 4PDWA 1LB2A 2PAMA 5A3LA 2X53S 4IE7A 3LE0A 4C91A 1KXGA 3LDRA 5J3UA 1X50A 3LKJA 2G9FA 2VZTA 3RMYA 1OVPA 2WLPA 2YXSA 3SHRA 1OH3A 1LNSA 1PMHX 4D6QA 1RUJ2 4CEWA 2XLFA 3ZYBA 1WMDA 2OQ7A 4QHBA 3SNMA 3JBG1 4GMP0 4META 2RS52 3C7OA 3W5MA 4BIFA 2IWGB 4JRAA 1WCUA 1PO11 4CE8A 3ST7A 2XDVA 5CB7A 4O9GA 5EIYB 5HBAA 5LW9A 1VE0A 1CAUA 2Y6GA 1RUJ1 2ZHLA 4WM7C 5F5AA 1YEWA 3ACIA 5EYYA 3RPQA 1WLDA 3MO4A 1LR5A 3QH7A 4XF3A 1W6NB 2TBVA 3DUIA 1OF4A 4IE5A 1C8M2 2ZEXA 2VCMA 2FMDA 2XR4A 2VVEA 2Y6LA 3ZSJA 5A1LA 3ES4A 1S0JA 2WIIB 3EO6A 2G1MA 4IERA 3PIGA 2QBXA 4CEYA 5GLVA 1RUD1 3E6BA 3GHMA 5FYVA 4BE3A 1PZ7A 3J9SA 1J84A 2HYXA 3RSJA 1W28A 2VTXA 3DEMA 3TEWA 3VD3A 3RJ2X 1D7PM 4TLFA 4NIIA 1WW7A 2VR4A 4AHYA 4BQWA 2CGPA 4JGZC 1OD5A 1YRZA 1ZZ8A 2XJQA 2BDRA 1N1VA 2ZKLA 3E5UA 3I3QA 4HMZA 4CSWA 5CG8A 1WCDJ 3ZFGC 1NA1A 4OHWA 2BBAA 2HWC2 3POIA 1WW5A 2WYFA 1G7YA 1LOGA 2VMIA 1UYYA 3FHIB 5FUPA 2V5YA 5I0TA 3PLQA 1UIKA 3OPWA 4YGBA 5JIUA 4JTNA 4PLOA 5T52A 3GM8A 1V6LA 3W9AA 1A6CA 2CAUA 3CJIA 5CFDB 5LZ6A 3IDAA 4LBLA 3SKJE 1QGLA 3FLTA 4B1LA 4EN9B 1VAVA 4KG8A 4YG6A 3N36A 1RHI2 4QDSA 1OOPA 4CVUA 4N53C 3LEIA 1L3JA 5CFCC 3U11A 1VBC2 5FLJA 1LENA 1SEFA 3J7HA 1AL22 3P5BA 4S2GA 3MZHA 2VUDA 4GKYA 2YPJA 1MVQA 3PDQA 4Q8LA 1XPWA 4Q27A 1RHI1 5KHIA 3D0SA 2EVXA 3I49A 1FOD2 5L36A 3IN9A 2ZMKA 1VBC1 4FFHA 2GALA 1GZWB 2A73B 2Z5WA 4N7UA 4V2WA 1AYN1 5FQ0A 1XSQA 1Y9MA 2V4VA 2XLAA 2ZS6B 4JZRA 4W6XA 5FREA 4AFDA 1HQLA 4M4PA 1DQ6A 1AF9A 4RFRB 4PT6A 5GZDA 3ZKUA 1XBFA 3X29B 4WVZA 2EAAA 1TMF2 3FJSA 2W9XA 5L73A 4AXOA 1SZBA 5ABJC 3GF6A 3T0DA 3B00A 4MGKE 1B35B 3I3DA 2HWB2 3ON7A 5IHRA 3VBOA 2ZX0A 5BNPB 3N7KA 2ZX1A 4CCLA 5C3PA 1TMF1 3I2OA 1GICA 3H7YA 2ZA9A 1RMU1 2YBSA 4ZS2A 4GB31 1W2AX 3VL8A 3DKQA 5J48A 5EPAA 1UOBA 4B7KA 4B3NA 4WBBA 5FZ0A 4BQ3A 4FXKB 2WFF2 3H8OA 2E32A 1F31A 5FMCA 4DUXA 1AX0A 1V6KA 1A8DA 1UX7A 1YJKA 4HK9A 4LUKA 1SDWA 1CAWA 4AFCA 1AX1A 3WG2A 3SEPA 4GH4C 4K1ZA 2W46A 5T50A 5CYYA 3NNLA 4RGAA 2AUYA 2NQYA 4IEZA 2WFF1 2XB6C 4HXCA 4P5YA 3ZM8A 3RZJA 1AR93 2ET1A 3K46A 5FZ1A 3H1MA 2RDSA 2AR6A 4M01A 1VRH2 1R092 2R6QA 2ZGUA 1ENXA 2WDBA 1REDA 1FV2A 2JXAA 3FWEA 3MW4A 3ASIA 3LEGA 1DGLA 5JZGA 4QD2A 4GA9A 1QY4A 1U5ZA 4Q26A 3AP9A 1ACCA 2VMEA 2DVDA 3W58A 4N9HA 3OBZA 4AHXA 1IS5A 2PLV1 3M7AA 2ZPXA 3VZNA 5KBFA 5FZOB 1TVGA 3B5LB 3GALA 4LNVA 4Y5Z0 4JDOA 1LOEA 3AYAA 1QDOA 3HPNA 4OQ8A 2YC4A 1W8UA 1RXGA 5A3OA 1DF0A 2DUPA 4XDOA 3LPFA 3KF5A 4WM8C 1CAXA 1WUVA 2A3WA 2AEYA 2B39A 4YGDA 1G6NA 4QPWA 2JDYA 5DPNA 4HVQA 2WS93 4CDQB 5K8SA 1L7LA 1YO8A 2BOIA 1OH4A 2WZ8A 1G9DA 3SEEA 2P3YA 3OPTA 2QQNA 1G8WA 3IAQA 5CAZA 1LHNA 4PHZA 2L9LA 3R0RA 4FFFA 1CWPA 3B02A 2DDUA 1EP0A 2RS53 1H8TB 3H3ZA 4YRDA 4ES8A 1XU1A 4JGZB 1LOCA 1LECA 4WM7A 3ZN6A 5BUVA 1PM4A 4QB6A 4ATEA 1YQ5A 2A3YA 4A2UA 2ZX2A 1VBA2 2E53A 2XVKA 4OFGA 4UFIA 5I8TA 2JDUA 4BIOA 3QACA 4E2GA 3KQ4B 3C7GA 3DL3A 5FXZA 1RTVA 1ND2B 3VZOA 3HT2A 3WZ1A 1D4M3 1G9FA 1UPSA 4IEUA 2ZGLA 5F9TA 2BVVA 2IUWA 1C8M3 3RFRA 1UNBA 1UN1A 1TE1B 5F32A 3WDXA 1ULDA 2P34A 2MHFA 2QQOA 2YC2A 1GSLA 4IEVA 2FDHA 1JS9A 3VB9A 2JWPA 1W8TA 1H4GA 3PIJA 3POJA 1ULPA 1S55A 4QHOA 2E63A 2ARXA 5J98B 5KXEA 3O14A 2YFUA 5ERLA 1WWYA 5F37A 4QU2A 3E1F1 5A7WB 1SBEA 3UYJA 2Q1MA 4LO5B 3T2OA 2HWC3 4Y24A 1AXZA 4GZ9A 2EAKA 5M0TA 1TME2 1HJFA 1VMFA 3NO8A 3JCIA 3QOPA 2ENRA 3UL2A 2VVDA 2EXHA 3AM2A 4LQRA 4XETA 1IHMA 2O14A 2R49A 1LESA 3ECQA 4NHLA 5FBJA 4YW5A 5F2SA 5EHDA 2XUMA 2Y60A 4N53A 2Q5TA 1U5IA 1WLTA 5CFCA 1TME1 4MV2A 3VKLA 3D5OA 5HXMA 2Y6FA 4RHV2 3THDA 3ZXLA 4QPIB 4OULA 2O0OA 4OCTA 3IDEA 4GMP1 1QIQA 2WAOA 4LO8A 1OA2A 3DXTA 5JOZA 5C33A 3VD5A 1AL23 4O7XA 1F5JA 3EHKA 1E57A 4A42A 1QU0A 4MXWA 3AC0A 1XB9A 1YFXA 4OI1A 1HX6A 4XDQA 4QGNA 2VECA 3I7DA 5DAQA 3P6BA 4ZONA 3H0OA 5FY8A 1YIFA 1FOD3 4HFSA 4AEDB 5SV8A 1MR5A 4WVMA 3RRDA 2BGOA 2PHXA 1UU6A 3FFZA 3VLBB 4Y5SA 3J8F3 4KGGA 2DTYA 4GKXA 3TEYA 2JKBA 2Q4SA 2YG0A 3T4HB 4AVAA 3I4IA 1C5HA 2D98A 1LRHA 5LA2A 4YARA 5ISLA 2R061 4FSJA 4N8MA 4Q1PA 5ABJA 4W6YA 5A7NA 4GH4B 4ES9A 4KG0A 1HQNA 1VIWB 3WOGA 4BJ0A 2JE8A 1HKDA 1XXNA 4NAMA 4CDXA 5IT6A 4KWKA 1BKZA 2VQ0A 2BWAA 2W95A 4YFZA 1BBT1 1YXWA 3DPRB 3HVDA 4M0NA 3WDYA 2HWB3 1V9U2 3NRUA 4UF0A 5F8PA 2HYKA 3RYRA 3MFAA 2GMEA 2CDOA 2G9GA 4Y20A 5DABA 3LD8A 3FBMA 5BXXA 1GP6A 4YZ2A 1J58A 2RR12 4UFKA 3JB4C 5GM0A 2Y26A 4IGOA 3SH5A 3HOBA 3CZJA 2RHPA 5B4XA 3VBFB 1V9U1 1OLQA 4UFJA 3CKHA 3SQOA 1K45A 1RIRA 4I02A 3Q8FA 2RR11 2ZZQA 4Q4X1 4FBFA 3KGLA 4CXWA 2PELA 2QKDA 3ZIXA 3ELNA 1EPWA 5FJKA 4CPBD 4F3JA 1FXZA 1F4AA 2HWF1 3ZXFA 3VBUC 1S2KA 5B4NA 5ANQA 3WY6A 3ZPOA 1VRH3 1R093 3B9IA 4CA9A 4YVSB 1XRUA 2GMMA 3WNMA 1UXXX 3I2GA 1FPN1 4LA2A 4PF5A 4XE9A 2VZQA 5JI7A 1WW6A 2ZEWA 4PQ9A 2OUHA 1COV3 4ZU4A 3BTAA 4YM3A 4ONUA 5C8CC 3S7EA 5A3TA 1S0FA 3B7MA 2RJ2A 2IVIB
chains in the Genus database with same CATH topology
3FUQA 1DYKA 3MFCA 4FO9A 4WM8A 1Y7BA 4UW6A 5BYNA 1HRV3 3IWZA 2DCZA 3TB0A 2YZ4A 4QX5A 1PK6A 1H2KA 4H7LA 4PLMA 1MEC3 4FQZA 1LEMA 1UF2C 1UZYA 5D8AC 4NR1A 5C8WA 5EZWA 2ZJCA 2D97A 1S0IA 3E6DA 3VBSC 5FOJB 1ZVFA 4LO7A 2DYCA 3ILRA 2ZHKA 5JOYA 5BPXA 3LSDA 2WZR1 3NAPB 2UURA 1JYIA 1NLRA 2FMYA 5KHGA 3RS6A 4AE2A 1VBA3 3MEPA 4JQRA 3OY8B 1KQRA 4P9IA 4XFHA 4LBQD 4QGLA 2XKPA 3WCSA 2RS32 4CP1A 1J1TA 4LHNA 4HZFA 4MGIE 4HPKA 2E7TA 1GV9A 2GH8A 4K9SA 4MVTA 2JG8B 4JAAA 1EAH2 5LK5A 2P17A 1Q8QA 3KCYA 3NKGA 1QQP3 2RS31 1KDMA 3ZYRA 2PHRA 3POWA 1W6MA 1ZZ9A 1MS0A 1YI7A 1AR62 3MIBA 2D43A 2ZX4A 3ATGA 5E88A 3SMHA 2VNRA 5IK5A 2HWD3 3AP7A 4YLZA 1EAH1 3ZFFB 2ZGSA 1H2MA 4G4FA 4EROA 2WNVA 4BHPA 1HV1A 1AR61 1AR82 2TUNA 5K9YA 4MGZE 2LTNA 3IBMA 3VBRB 1N3PA 3WUCA 1R1A3 4R9DA 1Z7S1 4Q0PA 2XH6A 1V6IA 4H55A 1AR81 4RR3B 4RHV3 4WZCA 5FPZA 4JGYB 1QJU3 4AI3A 4AEKA 4WV8A 5C9AB 2ZZJA 5DDJ1 1MQTC 1ZM1A 4AVSA 3M8LA 3WHUA 4LBKA 3ZFEB 3WP3A 1PNGA 2BFUS 3VKNA 3ZYPA 2HWE1 1ULGA 2RS13 1HW5A 3WW1A 5F6LB 1LTEA 3KSCA 2NLRA 3ALQA 3G7DA 2ZCWA 3PMSA 1VBB2 2W08A 1AYM3 4KL1A 2RMU3 1O91A 5HCBA 4BLJA 1G9AA 1AUYA 2VY0A 4CDUB 4BOWA 4P5HA 4CDWA 5SV5A 4I0BA 3VHPA 1VBB1 1OFSA 2R043 2YDEA 3MICA 1RUC2 5T3NA 1H1IA 1ZYBA 2Q0AA 2UWAA 3FZ3A 4XXAA 1XQNA 3M3CA 4COWA 1C28A 3M4FA 3WT3A 2WFPA 1W6OB 4A7KA 2HEVF 4DQAA 4S2FA 3CL1A 2MPFA 2GC3A 2QVSB 4R4XA 4YZ4A 4YGCA 1DFQA 1XYNA 1RUC1 4W65A 1NQDA 1URXA 4A7ZA 1UIJA 3E97A 4Q4Y1 3LGRA 1SCSA 1Y9QA 4ZXKA 5L7OB 3KB5A 2WZPP 5JPMB 5T54A 1POV1 4O9EA 5AC91 3WUDA 3LOBA 3ZDSA 3IM0A 3LZZA 1DBNA 3ZSKA 3H8UA 3NSTA 4ITCA 4UW5A 5BNQA 5C4WB 2WT2A 1PIV2 2DU0A 4HL0A 5FO7B 4KU7A 1QNWA 3BIWE 1IGOA 1HXS2 1HRI3 3GZUC 3V0BB 4N90A 2VOXA 2VGDA 3JD73 3OTFA 4LHKA 4BH9A 1VB4A 5IUQA 2ZTNA 3OYWA 3H7JA 2P3KA 2GN7A 4XJAA 2B5HA 1D0HA 5D8AA 3M3OA 4TZDA 3QCWA 4Y1VA 1X33A 3VBSA 1IQAA 3L2YA 2DVBA 3PMEA 3AZVA 2R1BA 3R4UA 3SITA 2GNMA 3WG4A 2AGSA 4K21A 3ZVXA 2D6OX 2F6BA 4GALA 1Q8SA 1IOAA 5EYXA 4MZUA 5TSWA 4H3WA 4L8QA 2ZKNA 5E89A 3USUB 5CFDC 3Q9OA 1CPNA 4BM8A 4AFAA 1MS3A 2WNEA 2KM2A 1I9RA 4DZGA 1KITA 3LCPA 4QPYA 1JBCA 3AFGA 4X6RB 1N47A 3VZLA 1WMFA 3PTYA 1HQWA 1XE8A 2VPVA 3VDDB 4FQ4A 1LODA 1QXRA 3ZIWA 4H7MA 1EV12 2IFWA 4XMIA 4YZ3A 2NPIA 3GBFA 4N43B 2D5HA 2IXLA 1QH6A 2V09A 4PIXA 4QQHA 1C1FA 3PVOA 3GHNA 2DF7A 4AVBA 1PVC2 1DGWX 1EV11 2PHUA 4FPFA 5I0RA 2IFRA 1ZZ6A 4AFMA 1DZTA 1B09A 1O4ZA 3OPZA 4LBQB 1PVC1 1S1AA 2RJKA 4B7EA 1SLIA 4A7YA 4FOYA 3WV6A 5BNPC 3R4SA 4H14A 1AXYA 5J09A 4C0BA 4V1PA 1AL0G 3V65A 1OQ1A 1MQTA 2XBO3 4GWNA 4RFT0 1C57A 3D82A 1CIWA 1BCXA 3FLPA 5FDBA 5IK4A 5DUXA 1FNZA 3A4UA 1OLRA 4R9AA 5J96B 4TWTA 3B93A 2FZ2A 1CQ9A 3JBG2 3SXWA 5J37A 2QDRA 1Q3EA 1W6PA 1H30A 2VW2A 1PO12 1KDKA 1MS1A 4LBMA 1Q8VA 1W6QA 2VMHA 2XJPA 5FO8B 2QDNA 1FT9A 2AH2A 3WQ0A 3HBZA 1D2QA 4ASLA 3HAGA 1HIXA 3B01A 4C90A 2SBAA 2YROA 5T5JA 1U12A 1A78A 1RB8G 2B8MA 5LEJA 1R081 1BYHA 3WD5A 3JU9A 5JLVA 3O0VA 3WW4A 4S2HA 1WLCA 3AYCA 3POSA 1RUD2 1H1AA 4XEZA 4AHZA 1PGW2 2A70A 1N1SA 2LM3A 2G4IA 3UJQA 4CDQC 5A3MA 3NVCA 1RVF2 1WCKA 4I3PA 1C1LA 1GYKA 5KHHA 1PGW1 1HDKA 1YCIA 2OA2A 1H8TC 3GZAA 3MF9A 4RQPC 2BFUL 4G3YC 2D6PA 4Z82A 5T55A 1AR71 5E1RA 4D7YA 5FOBB 2GSYA 3TN91 1RVF1 1ZRDA 1VBD3 4CP2A 3AP6A 1H8VA 1W6NA 1X36A 3ZN5A 1PIV3 5FRAA 4M3CF 1ND2C 1HXS3 4OI2A 2A6ZA 2XGXA 3CJXA 4AI0A 1H9WA 2YUEA 2R071 3NV1A 1ZRFA 3DV8A 4FPYA 1KJRA 1I5ZA 1KS4A 3ZXKA 4FCAA 3RQ0A 3V0AB 3WHTA 2JG9C 3URFA 1CJPA 3BOWA 1SMVA 5DG1A 1BJQA 4GULA 1AYN2 3BPZA 4JC1A 1IS6A 3A0NA 1S0DA 1ASJ2 4C1WA 2W52A 4XJUA 1O4TA 4LO4B 1QHDA 1CD3G 2OUJA 5CFDA 1Q56A 2ZGNA 2F4PA 2WQZC 3RG0A 4HVOA 4Z1VA 1RGSA 4M3CB 1DGRN 1ASJ1 1NQJA 4OI4A 5DG2A 4QPIC 4OHYA 3TAYA 1RMU2 1SLLA 4GB32 4ZU7A 5ACA1 1RUH2 4HSJA 4LEJA 4SBVA 1CGPA 2QCSB 4XXPA 1NCQB 4K20A 2JEMA 1G9BA 1DGRA 1GZWA 2VOWA 3VKOA 1W39A 4AEDC 2H0BA 1RUH1 4Z07A 1ZBA3 2OZJA 1IPKA 3JZVA 3VZMA 1QOSA 1KJLA 2R0FA 2ARBA 3VHNA 3KCCA 4FVVA 4HK8A 4RD7A 2O8OA 4DNYA 4XQWA 3QBQA 2BVBA 3AP4A 2CWMA 3ME2A 5EV7A 1KD7A 1B35A 3UK9A 4DMIA 4OI0A 5BNPA 4URTA 2PLV2 3DPRC 1UD1A 3I2DA 3S0MA 1VR3A 4P9LA 3KM5A 1SLTA 1LGNA 3ILNA 3P3NA 1Q43A 3NV3A 1U0AA 4LLFA 4AQ6A 4YZ1A 2ZAAA 1YNAA 2ZGOA 4QQPA 4AEJA 1ZZBA 3VBFC 1V6OA 1EPZA 1X8MA 2P3IA 4AEMA 4U36A 1LCLA 3AMQA 3JBG3 4IV3C 2FZ1A 2PHFA 1NOVA 3SISA 4AW7A 1UW8A 4I0WB 3E5XA 3MIGA 1PO13 4XJZA 4Y1UA 4HSLA 1S0BA 4AQ2A 4YVSC 1RUJ3 2VOVA 1UCXA 2JICA 1FI2A 4DPNA 2EIGA 1O5UA 4RQPB 3PJQA 1S0EA 4DB5A 4P9JA 5A33B 1RITA 2QQPA 3UKNA 4X8PA 1FNYA 1CAVB 3IMNA 1KRIA 1H1MA 1I3HA 5DZEA 2ERFA 5KC5A 3U10A 4GQ7A 2WNUC 2Z42A 5GZFA 1RUD3 2P37A 4YVWB 3WLUA 3R6SA 4CDQA 2CY6A 1YFUA 3RWNA 5JSOA 3KD4A 3AJYA 2OZ6A 3KT1A 1D4VB 3AKQA 1DHKB 2GC0A 1J3PA 2UWCA 4KU8A 4L92A 1REEA 4QT6A 1H8TA 1TNFA 4JGZA 3M1HA 3AMPA 2JG9B 2O8QA 3ZFGA 4XJWA 1KS5A 2BNOA 2CGOA 2YV8A 3CU7A 3NAPC 4YW3A 5FLIA 3ZMOA 2XJVA 1DLLA 2H6CA 1ND2A 3IKWA 4JDMA 3AZYA 5CBLA 2UY9A 1QXPA 1VBE1 3NWKA 4IESA 4PCRA 3T2TA 2VULA 4YW4A 4COYA 5FO9B 2WSUA 4FAHA 5KHKA 5KC6A 4XQDA 2RM21 2JG8C 4KGQA 1QJZA 3QLQA 4SLIA 1MACA 4YFWA 1PO21 3AKSA 3HQXA 1H4HA 4XF0A 4FP3A 2KXLA 1YJLA 1RHI3 2NYYA 1POV0 1VBC3 4JV4A 4Q0SA 1GNHA 1LHOA 2R0HA 2KA3A 3WW2A 1YFWA 1AYN3 4FP2A 1RINA 3ZFFC 4AYUA 4XW3A 4EN7B 3M70A 3VBHC 5KXCA 2R062 1OPOA 3FMGA 4DOUA 1OQDA 1S0GA 1DQ1A 1JHNA 4FTSA 4MH0E 3J4UH 2QNKA 5BNNB 3VBRC 3MGUA 1BBT2 4F7ZA 3AFKA 4QPIA 4QMAA 3WXPA 3CNAA 3HT1A 4ISQA 1MZFA 3SCFA 1TMF3 4RR3C 4JGYC 1RMU3 5H9SA 3TRSB 4GB33 1RUE2 1VJ2A 1LGCA 2R16A 4UBGA 1MS9A 4IL7A 2Z2SB 3WR0A 2D3PA 3AKPA 2HEWF 5C9AC 4XHXA 5KWRA 5DUWA 2E7QA 3K48A 4LR4A 4AEDA 1SLCA 5FBZA 5T5LA 3ZFEC 1WMEA 1MS4A 1RUE1 4Q4X2 2XG3A 2DUQA 1X82A 3R4DB 2WFF3 4R9BA 2D7FA 4ZKTB 2HWF2 5DZFA 1MVEA 4GH4A 1WD3A 4XIOA 1OA4A 4BLIA 1FPN2 1OA3A 4IV3B 4XYXA 2DCYA 3AMMA 3DPRA 1QMJA 4LA3A 3ZYGA 2GC1A 4CDUC 2D6LX 1BVVA 2OIIA 2BGCA 2XJRA 1LJ7A 2PLV3 1Z78A 4F8AA 4AVVA 5C6CA 2H0VA 3VV1A 3ZN4A 3VBFA 4DS0A 1UL9A 2BNNA 4HT1T 4XTPA 4BMBA 4EWAA 1YIPA 1QJY1 1U5XA 4QGMA 5I8YA 5I93A 4XF4A 4L11A 2WNUB 4CTEA 1F9KA 1PK6B 1WBLA 2UU8A 1ND3B 4LTAA 5L7OC 3ROUA 4N7IA 2WZR2 1LHWA 4NO4A 4YVSA 2H6BA 4HLTA 4IV1C 2ZAHA 2D44A 4XOGA 1QDCA 2XVLA 3KMHA 4QM8A 1SQ4A 1JN2P 2X5IC 1U5YA 2XJTA 5C4WC 3ZSLA 2GNTA 4COVA 4UW4A 2Y0IA 3EJKA 1FV3A 4OHZA 4FPJA 2A3XA 4A3XA 4CP0A 3JD71 2C1FA 1WGPA 1OMIA 1MZ6A 1PVXA 3H50A 2MEV1 3PNAA 4Y22B 5K0UB 1WA4A 2WT1A 5FPXA 4W6WA 1UMZA 3LA3A 2W68A 4YZ5A 4L97A 1MS8A 4YYOA 3DN7A 1GBGA 2GZWA 1FMD1 1YYNA 2ETEA 1WW4A 3HN1A 2AYHA 3B3QE 5CNAA 3NAPA 5JOXA 2ZBJA 1BEV2 1DGWA 4Y1YA 1RUNA 1LKNA 1WBFA 4J1WA 3NV2A 1GNZA 1BQPA 3PVNA 4FOQA 2IXKA 3OY8A 4AQTA 1RUG1 4ORFA 1QJX1 3VBHB 3OF1A 1BEV1 1Z7S2 2I74A 3N7JA 4AQSA 2WJSA 1TME3 3RMXA 1V6JA 4FAGA 2JG8A 5EXOA 3NW4A 2Z79A 4GMP3 4DRRA 1RUI2 4FTEA 4ATFA 4XILA 2JDZA 1PGL1 2XKOA 1YUDA 4J1XA 5DDJ2 1ZBE1 3VDDC 4YM0A 4EWDA 2YGMA 1D0GA 4DY5A 1QXJA 4XMAA 1VB2A 2AENA 2Y38A 1GFF2 3IPVA 2XVGA 4N43C 4B4PA 3O0WA 1RUI1 2HWE2 3ZFFA 1LULA 2ATFA 4Z8BA 5GJ6A 3AP5A 3L9JT 4XZPA 4QQOA 2ZGPA 1UU4A 5A32A 1NXD1 4UW3A 1O3QA 2GN3A 2R063 3PVBB 4Q4W2 4NWWA 1TQ5A 2IZWA 5LEKA 4Q4V2 1RUF1 4PLNA 1BBT3 4RR3A 3POYA 4FOVA 4JGYA 3NJZA 2EA7A 4MLOA 1DQ4A 3D6EA 4L99A 4Q4W1 3U07A 4LBJA 3AMHA 1O3RA 4CDWB 5C9AA 1YLLA 3MW3A 3ZFEA 3N7MA 4Q4V1 3GNEA 5H9PA 1V9U3 4Q4Y2 2O1QA 1Y43B 4PDWC 5GZGA 1NLSA 2RR13 3A0KA 4Q4X3 3MPBA 4E2QA 4I09A 4NOTA 5AC92 1LHUA 1UPIA 1R1ZA 2HWF3 2XWBB 4CDUA 4L2NA 2ZOEB 3ZPYA 2VU9A 1FPN3 3FUOA 4HN0A 3VBUA 1DYPA 1Q8PA 4I3GA 3WP4A 5KHJA 1QOTA 4GWMA 4IV1B 1X7NA 2IXHA 2WWSA 3S30A 2PN5A 4AGRA 4Y4YA 1GZCA 2X5IB 3EQEA 1K5MB 3HWJA 1NZCA 1KFXL 1W6OA 5C8CA 4YSFA 2IXJA 3IT8A 2PHWA 4P9WA 3AK0A 5AFBA 2Q8OA 1SLBA 4HANA 1VAMA 3EBRA 4CEYC 1LHVA 1KFUL 1ZRRA 1RJ7A 4QPGB 5L7OA 3RZZA 2WC2A 2A6WA 1CR7A 3ENRA 3RDIA 2WZR3 1MS5A 5C4WA 1V70A 4AFBA 3AMNA 3M3EA 4E2SA 4J6GA 3V0BA 1NCRB 4E27A 2JE9A 2EF6A 2N7GA 1BXHA 1J1LA 2DCJA 1C5IA 3WW3A 1OQEA 4M00A 1OOPC 4IEWA 4B8EA 2RS33 2ZGKA 4P9GA 3MI8A 3KQRA 5FTTC 3N35A 4FPHA 4M0HA 5BNOB 4K7JA 4Q0QA 1EAH3 2D6KA 3I59B 1QH7A 2VQAA 4Y26A 1PNFA 3KT4A 1N3QA 2WA3A 2BYVE 1AR63 3MIDA 3USUA 4LE3A 3ES1A 1BK1A 3WDVA 1BMV2 4QQ2A 4NPRA 1XNBA 3D4KA 5AVAA 1LOFC 1Z7S3 1G9CA 4RS5B 4LT5A 1F8VA 4BWOA 2JENA 3RSJA 1AR83 2GNDA 1ZA4A 3M3IA 5T5OA 3CEWA 3VDDA 2BNMA 4ISRA 4ASMB 1V6NA 3TWIA 1BMV1 3VBOC 1AJKA 5DDJ3 1NCQC 2FHRA 4N43A 4OHXA 3AX4A 4WVWA 1QOOA 4XFAA 3ILFA 3WNXA 2HWE3 4AI2A 2VVFA 4B4RA 2D3SA 4EN0A 3L2HA 4PDWB 3MIFA 1PGSA 4IEOA 4LBQA 5BY5A 2DVAA 5GALA 3WG3A 1UZZA 1S0CA 2A5ZA 4CEWB 1VBB3 2ZMNA 1G86A 1AR91 1R082 3ZXEA 3DF0A 3G6JB 3D8CA 4QM9A 1DG6A 1OSGA 4Y1XA 2C9AA 2TNFA 2VUAA 4E9KA 2K0GA 5CA6A 4I01A 1CAUB 3PHMA 3FC0A 4Q0VA 5H9RA 1RUC3 2WA4A 5BV6A 1AJOA 1N1TA 2PHLA 1XNDA 1DQ2A 3MW2A 2WS92 4Q4Y3 2XPJA 1OKQA 3QH6A 4PIZA 3WP6A 2ZMLA 4D94A 1QNYA 1POV3 4I30A 5AC93 1Z0HA 4EV0A 1AR72 2D3RA 4CEYB 2UY8A 4HETA 3TN92 4K40A 2K9ZA 3DGTA 2WS91 1W0PA 4ZU5A 1NXMA 2D6NA 4EJRA 1PHMA 5K7PA 1V00A 3DKWA 3MYXA 4HKWA 1AXKA 2PYTA 1NA1B 3BODA 1J59A 2TEPA 2GC2A 2RS51 4XJ9A 1D4M2 4TSVA 2R072 4Q29A 3C3VA 3UV9A 1SCRA 3VHRA 3AKTA 4YVWC 5JSPA 2R30A 2PAEA 2NM1A 4R9CA 5JSRA 3CJIB 3VZKA 1D4M1 2VXRA 1FYUA 2HEYF 4Z92B 1C8M1 3GBGA 3ZX7A 3ZXJA 1OOPB 5JPNB 2E9QA 1ZRCA 5IK7A 5EFUA 4EN6B 1CX4A 4E4SA 3H1WA 5E8AA 2YYOA 3R05A 2XLGA 4HKOA 4MUVA 5KXDA 2GH2A 1JOJA 1YWKA 2I45A 4IEPA 4D69A 1GKBA 2HWC1 5FQ0B 3THPA 5ACA2 3S7IA 3MPPG 4DY3A 3V0AA 1A8MA 1NG0A 5F1RA 3NV4A 4AK3A 4OUSA 5JWPA 3IDBB 1FAYA 3SCGA 3E6CC 3M3QA 1XYOA 2B46X 4NN0A 3H9AA 2CNAA 4XQ4A 4YNIA 4BPZA 4OLLA 1IZ3A 3VGIA 3C2UA 3VBOB 5CADA 1QF3A 3BALA 1AL21 1EV13 1O3TA 4K3UA 3J8F2 1JUHA 3MIEA 2VMGA 4OVEA 3GYDA 3B69A 3WVJA 1ONAA 3LA7A 5BNNC 1FOD1 4M3CA 3FLRA 3KCXA 2A7AA 1PVC3 1LOFA 4K1YA 3UKVA 3TBDA 1SACA 4AI1A 1CAWB 3J8F1 2OPKA 3M2MA 4YG3A 3ACLA 1UKRA 2DFCA 2A71A 2P3JA 3FX3A 3JB8A 3LSEA 4PJYA 4X8NA 4CDXC 2VUJA 1PM7A 1NCQA 2MNGA 3V56A 4Z2WA 1WLWA 1GZ9A 4NWVA 2Q1ZB 3J26N 2PTMA 4S2DA 1MZ5A 2YY1A 3LB9A 1GLHA 5JZGB 3AZWA 2XWJB 4P9YA 2HWB1 2GMPA 2LALA 1GQGA 2X8KA 3PJYA 4FPGA 3ZXDA 4L9BA 3LA2A 2BBVA 2ZACA 2ES3A 4X6QB 3I54A 5GZEA 1CAXB 1XNKA 5CU1A 2CWSA 1SFNA 5JI9A 3VHOA 3U0ZA 4D7TA 1H0BA 4C1XA 1COV2 2AZ5A 2ILMA 3BOPA 1R083 3AZXA 1VRH1 1R091 1YHFA 4GIQA 2DU1A 1APNA 4MXVA 5HCFA