2Q1MA

Crystal structure of human gitrl
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Tumor necrosis factor ligand superfamily member 18
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1mA00
2R30A 2WNVC 4G3YC 4DOUA 4QQHA 3URFA 1A8MA 1TNRA 3LKJA 2JG9C 4OUSA 4HT1T 1PK6C 1OQEA 2E7AA 1ALYA 1TNFA 2JG9B 2R32A 5L19A 1D4VB 1PK6B 1PK6A 1D0GA 2Z5WA 4GIQA 2ZJCA 3ME2A 1S55A 4MXWB 4MXWA 2Q1MA 3B9IA 4KGGA 1U5ZA 1WCKA 1C28A 1U5XA 2WNUB 2HEWF 2WNUA 3WD5A 5CIRA 4QQOA 2QE3A 5L36A 2TNFA 3MI8A 3K51A 1RJ7A 4TWTA 4QQPA 2ZPXA 3QBQA 1KD7A 4E4SA 1KXGA 2TUNA 1IQAA 3IT8A 3ALQA 2WNUC 1JTZX 4QQ2A 3QD6A 4QPYA 3B94A 1XU2A 1DG6A 5HBAA 3FC0A 2X29A 4NN0A 2RE9A 4QQLA 4OUMA 2HEVF 3V56A 2O0OA 2KA3A 1XU1A 4J6GA 3TWIA 1OSGA 2JG8B 5KC5A 2JG8A 3TYJA 2R6QA 1D2QA 5KC6A 4DB5A 5KWRA 2HEYF 2Q8OA 4D7YA 4E4DX 1U5YA 4EN0A 2WNVB 3K48A 2WNVA 1RJ8A 1JH5A 2AZ5A 1I9RA 1GR3A 4KGQA 4N90A 4TSVA 2QDNA 4MXVA 5BNQA 4KG8A 1C3HA 4OULA 2JG9A 4RSUA 2JG8C 2RJLA 3L9JT 2RJKA 5TSWA 4F3JA 1OQDA 1DU3D 4MSVA 1O91A 3B93A 4G4FA 2OIIA 3AB0A
chains in the Genus database with same CATH superfamily
1GQPA 4IQPA 1NCRB 1AR73 1OFSA 3D82A 4XILA 5FLHA 5C7GA 1NKGA 3GBGA 2WS91 1OPOA 1YEWA 1FV3A 2I45A 2YBPA 4XJ9A 5F5CA 1YFXA 4JHTA 3ZSJA 2VO5A 5JVVA 2XH6A 2XQRA 3I2KA 5IAVA 1A8MA 2SBAA 3DCQA 4AQ2A 4OUEA 1GFF2 5FQ0B 1AJOA 1AVBA 1IQDC 1VBB3 2ZS6B 4GD4A 4YFWA 4K6BA 4ZPIA 4AL9A 5FV3A 2XBO2 3LQCA 5FMOL 4M0NA 4P9XA 3S5QA 4JV4A 5CG8A 2XONA 2FMDA 5LBFA 5J48A 3WDVA 4OFGA 4MG2A 3FL7A 3RZGA 1UOJA 1UY4A 5LZ6A 3VUOA 4EROA 1NX9A 3BIEA 4QPGA 4N7IA 4M01A 3WSOA 2BP6A 1H4GA 1VLNA 4IV1B 4LKEA 3SITA 4ONUA 1BVVA 2WYFA 4P5YA 3MW2A 3X29B 3C7GA 1WKYA 5JOZA 1UNBA 2XVLA 4QHZA 2WS93 5HI0A 2A6XA 4JGZB 4LIUA 4AI8A 4AWDA 1SEFA 2QE3A 3I2GA 4QX2A 3K3OA 2WZR2 4GZ9A 2XHNA 1VE0A 1WD3A 4O9GA 3RZKA 3GZEA 4XXPA 4OCTA 4EN9B 3QBQA 1WLTA 3I59B 4HVOA 2XJUA 1RUI2 2Y6LA 3J9SA 1DYPA 1NZCA 1WCDJ 3OPZA 5EIYB 3GYDA 5AVPA 3SQOA 1JYVA 2YY1A 4Q0UA 4BJ0A 5HCHA 5DQ0A 3VZNA 3LIGA 3VDCA 2ZGTA 2XXZA 3FBMA 3P1IA 4H7LA 1JHJA 2DUOA 2OVUA 5FY9A 3ZDVA 2ZX4A 1AX1A 3VHOA 3LA3A 1SPPA 3PL0A 1QJZA 2JKBA 4LR4A 3VBUB 4IV3B 2RE9A 2AREA 2HJIA 2ZEYA 1LOGA 1XNKA 1REDA 4Y20B 3V56A 2W1QA 1XB9A 2OS2A 2GMMA 1FT9A 3H1YA 1VAVA 4YFZA 2RS11 1XU1A 4HPKA 4J6GA 3R4DB 3VKNA 4I0BA 4C8DA 4D6QA 4E2GA 2QBXA 1CAWB 5JZGA 1F5JA 2IXJA 3FFQA 1D2QA 1CX1A 1IPKA 5IUQA 1SCRA 2LRPA 5J36A 2D3PA 1PX3A 5FYIA 1ONAA 4AAXA 3POSA 4YYOA 4JZRA 1UU6A 3WQ7A 4PBPA 5FPZA 3DL3A 3Q8BA 4CP0A 1HV1A 2C9KA 5D2AA 4CDUC 4KG8A 1PM7A 3RJ2X 2BFUS 3WG4A 3RFRA 4LHNA 5FZ9A 3L2HA 4E4HA 4CTEA 1XYOA 1HRI2 1Z78A 2EICA 5JZGC 4BXSV 2YGLA 4FPCA 3A0NA 1CONA 3ZYJB 3GZTB 4S2HA 3TNQA 4CDWA 2VZ1A 4PIZA 1EPZA 4CUGA 2J1EA 3M3OA 3FJSA 5T52A 1MZFA 4W50A 1IG3A 4YVWC 2AEZA 3VBHB 4Y5SA 4DUWA 4Q27A 2RS13 1UO9A 2XB6C 3BODA 4QM9A 1VBA2 5A3TA 2ID4A 5IK5A 5A3WA 3VB9A 1C8NA 1OLQA 1SFYA 4A4AA 1IPSA 4P14A 3KS7A 3ZXEA 1CIWA 2O1QA 2CL2A 4AEJA 3POGA 4XEZA 3LDRA 2W91A 5CFDC 2MEV2 3GGLA 1W6OA 2ZXQA 2A3XA 3GBWA 5CYYA 3HD8B 5FY1A 3OBTA 1LULA 2QQMA 3AKTA 2K2SA 1N1TA 2QQNA 4IEXA 2YDEA 1EYBA 1KQRA 2CGOA 3WDTA 1OURA 2R0HA 3NVCA 2ARBA 4JTNA 3WQ1A 1NLQA 5JWPA 3ZYFA 1D4M1 1WCKA 1OVSA 2ZAHA 3AKSA 1UY3A 2F6BA 3PU8A 1C28A 4XF0A 4B4QA 2J1AA 3MBWA 1VIWB 3USSA 1ZA7A 1L3JA 2NP0A 1VRH2 2WNUA 1XRUA 3P3NA 3M3CA 3LB9A 2O8QA 5A3UA 1H30A 4IE6A 2QQVA 1PIV2 3NMBA 1EV12 1HXS1 4TWTA 4BQ2A 1JZ7A 4XBLA 1QMJA 4C0BA 2FDKA 2OUJA 1OF3A 3FWEA 3ZFEA 4CDXC 2VNGA 3CDZB 1QXRA 3O14A 3O1RA 3A22A 4FXKB 1UZWA 4B29A 3BOPA 4Y22A 1FPN1 1O3TA 5EPAA 4OI0A 1REEA 1YWKA 4X8NA 3ACLA 3VHNA 2WNUC 4LO8A 3ZM8A 2RDRA 3M4FA 5FYCA 3WOGA 1NLSA 2BVBA 3NKGA 3ZVXA 5HBAA 2QJVA 3FC0A 4CCDA 1NY72 4XFAA 4ASKA 3TEZA 4JDNA 1COV1 3QLQA 1D4M3 5FYVA 3CIHA 2ZGSA 1K5MC 4IGQA 4O65A 2O0OA 2XWBB 3UV9A 1X7NA 3MPPG 1LHNA 1AXYA 5A33B 3MUZ1 4BQ5A 3VBSC 3UJOA 5DG2A 4E27A 1JYXA 3FLPA 1UPIA 3WUDA 3I2HA 5F32A 3ZKYA 3AP5A 4FCAA 4CDQC 5K7PA 1JZ5A 1HXS3 3NL1A 5K0UB 1V6IA 1ND2C 1RUF1 2W39A 4XOGA 4B3NA 1Y43B 2OW4A 3O1UA 4ZXKA 4EN0A 1WZXA 4W65A 1CPMA 1FPN3 1V9U1 2DV9A 5M0TA 2QQWA 4N53B 4NRMA 5A32A 1XSRA 1LESA 4L97A 4YNIA 2AR6A 4DY5A 4IEUA 1RUD2 1W9FA 4KWLA 4WVZA 5AFBA 4D69A 5FP4A 3AMMA 1KFUL 4AF9A 5CNAA 3WDYA 1HKDA 1W03A 2PAEA 1LGBA 1WA6X 5LEKA 3WNOA 2ERFA 1COV3 1QU0A 4INDA 4PQ9A 3I3BA 5C6CA 1B35C 3IKWA 3IPVB 2LALA 4QPIB 5A7PA 2D7FA 3OG2A 3UGHA 5DUUA 3BCWA 4CVUA 2JWPA 4OHVA 3VBRB 4UFLA 2XOMA 4XJZA 3URFA 2D98A 5FP8A 2Y64A 1DGRN 3CF6E 4AFCA 1RUF3 1VJ2A 2VTXJ 4YG3A 5BXXA 2XPJA 1GNYA 2V09A 2RR12 2VW2A 3AYDA 4UF0A 2L9LA 2X09A 2DCZA 4MOAA 1ALYA 1V9U3 1W0OA 1QOOA 4LLFA 5FYSA 2ZA9A 3UT0A 4CE8A 2Q5TA 3KV6A 3PUQA 2Z5WA 5CFCA 1VBD1 1V6NA 3FFZA 2W9XA 4QMAA 4BH9A 1LENA 1RHI1 1O3QA 1H8TC 3AP6A 2XWJB 2B9VA 3SKVA 3MO4A 1I3HA 4MXWA 1HJGA 3AYEA 4A3ZA 2UY8A 4KGGA 4CUAA 2YPJA 2P3YA 1ULCA 4QD2A 1YNAA 4M4PA 4XYXA 2B8MA 2PXJA 5C5UA 2C5DA 4NUBA 1AX2A 2FCTA 1YQ2A 1LOBA 2DVDA 3HEIA 3U4SA 2CYFA 5LK5A 3IIIA 5CFCC 2GC1A 2XJPA 1YJKA 4EN8B 3LOIA 1BCXA 4MV2A 4QHOA 1J59A 1MR5A 1ASJ1 3IDEA 2Q8EA 1CAUB 2FHRA 3B5LB 3ZFFC 3MFAA 4QB6A 2JDMA 1YQCA 5JOXA 1BK1A 1TME1 3J8F1 1X8MA 1OOPB 1VBD3 2IXKA 4YG6A 1RHI3 1O8PA 5D8AA 5F37A 1OFNA 2DVBA 3CKHA 4BIFA 2VQAA 5IT6A 2RJ2A 3C8XA 5IK7A 2VMIA 4WZFA 4YM1A 1RUC1 2Y33A 1J1TA 1T6BX 3PMSA 2W68A 1NA1A 1RVF2 3HBZA 4N43B 1Z7S1 3IB3A 3ON7A 2DFBA 3POYA 2VOXA 4MVTA 4XUNA 5BNPA 4ASLA 3CZJA 2ZCWA 3KQ4B 2GH2A 4RGKA 1Y7BA 1NXD1 2A70A 2DU1A 1UCXA 1W39A 3GF6A 4WM8B 4YVSA 5FXVA 1XBFA 1MS0A 5KC5A 5LY1A 3TYJA 1PVC2 4GH4B 2VQUA 1ZRIA 5D8AC 5GALA 1NCQC 4QU2A 3O1OA 5FZ0A 2PFWA 1DGWA 4CSWA 1ASJ3 1FV2A 2VZSA 3K3NA 5FMDA 3RZJA 5DN2A 3UKTA 4P9LA 3KGLA 4MGIE 2PHDA 4IETA 4NRPA 4YGDA 1TME3 3J8F3 5EZWA 2DWRA 3VZOA 5FO8B 3UJQA 3ZXJA 1N3QA 3ZYPA 1RB8G 2Y8KA 2WLPA 1JZ8A 4L8QA 3BTYA 1UMZA 5L73A 1RUC3 4X6QB 4CYDA 1BEV1 3Q9OA 2GP3A 1UU5A 1V6KA 1DU3D 2D6LX 1Z7S3 4R9BA 4MSVA 3E5XA 1O91A 4AQTA 1R1A2 3E97A 3LF7A 2E7QA 4NJ4A 5FMCA 4BYYA 4HONA 3WF1A 2ZHMA 3HWJA 2IVJA 3AKPA 3VKOA 1REFA 4G3YC 3PUSA 4LBMA 3HBKA 4RQPB 5D1IA 3HT1A 3H8OA 1APNA 3GM8A 3AMQA 4CPBD 4CU7A 4O7XA 4RR3B 4YG0A 3UYJA 1AR72 3INAA 3WLUA 1W2NA 3I2IA 1P8JA 2QQLA 4FFIA 5LW9A 1CZSA 1K3IA 1TNFA 3CL1A 5A80A 4Q4X2 3VBFB 1PK6B 1VBB2 3WG2A 1ULOA 5F3EA 4XXAA 4CEWC 2YHJA 1ZVFA 3TN91 1UD1A 3SCFA 3ME2A 2XUMA 1LRHA 4AFDA 4AVTA 4D6SA 4BOWA 1GICA 5C70A 1BEV3 1G6NA 1HLCA 2J1RA 2Q1MA 2VUCA 5LBEA 3AL6A 1PGL2 1AL0G 1SQ4A 2YB7A 3U07A 2XLFA 4QX1A 1VMJA 2HBTA 1GU3A 1WW5A 4AG4A 1UY2A 5IVYA 4Y33A 4KL1A 1EUUA 4P02B 1LHVA 5GLUA 4LEJA 1JUHA 5H9RA 1WLDA 2XUEA 4Q0PA 3MV01 2XJSA 2JDUA 4GWMA 2WS92 4CPBA 4QQPA 3NV1A 5ABJA 2PQSA 5IK4A 2X5IB 2YC0A 2VTXA 3LEMA 3ZOIA 4B7KA 3RPQA 3LWCA 4BU2A 1JU4A 3H7JA 2VOWA 4K1ZA 3CLPA 3KF3A 4XHXA 5AC91 1CWPA 3TN93 2OZ6A 5KXBA 3N35A 3WW4A 3NWKA 3ZIXA 1AL21 1KJLA 2VBBA 2CHHA 3LA2A 3WNMA 4ATFA 2NMNA 4QQLA 4MZUA 2FDHA 2J22A 3NKTA 4WM7B 1AYM1 3QACA 3FN9A 5EYXA 1C8M1 5AVAA 1LCLA 5E88A 2V72A 3BTXA 1DCSA 3ZFGC 2JG8B 4A7YA 3H8UA 3CJIA 1UMHA 3C3VA 1BZWA 1F4AA 5DZFA 1O7FA 4DB5A 3EB7A 2HEYF 3LDBA 4XAAA 1XSQA 3U4XA 1TQ5A 3N7KA 3SC7X 5IFPA 3E6CC 3DXTA 3BB6A 4NRQA 2VOVA 2YC2A 4IEPA 5JUVA 4DEVA 3ZYHA 4BK5A 2ZBJA 4D94A 1K12A 4NAOA 3T0DA 3RWNA 4XBQA 1Y4WA 3NNLA 4BISA 5AC93 2DVGA 4Y26A 4EWDA 5BNOC 3ZN6A 3P5BA 3ZSLA 2PQQA 2HLEA 2JD9A 2JG9A 2VC9A 1AL23 4GKXA 1YYNA 1DLCA 4S2GA 5CZKA 1MEC2 1LKNA 1O4TA 3K4DA 2VBDA 1GSLA 5F2SA 3P3PA 1XNTA 2BRTA 2ZX1A 4HN1A 4FPLA 4BPZA 4NPRA 1SCSA 1AYM3 2QQKA 5DUVA 3HNBM 2DCTA 2VZQA 1WW4A 1C8M3 1N1SA 5FYTA 1GP6A 3TNPB 3FHQA 3BTZA 2UWBA 4R8HA 1BBT1 4WVVA 3ABZA 1WMEA 4JRLA 4COVA 3DPRC 2P5BA 3MW4A 3UL2A 2ZHNA 2WZPP 2ZMKA 3W21A 1QXPA 2RS12 2JG9C 2ZACA 1PNGA 4OHYA 1QNWA 1ND3C 1H9WA 1QJU1 4H3WA 4MYEA 4NROA 4PF1A 2FD8A 4A7ZA 1HRV1 3JU9A 4C0HA 4NIDA 4CEYA 2WO1A 1RMU1 5DPNA 5BPXA 2D6NA 5J37A 3RQ0A 3QH6A 5F7UA 3POFA 2B9UA 4Q8LA 4FQZA 2VZVA 5FY0A 5F3CA 3AYCA 2F4PA 3IDAA 2GNBA 3J7LA 4QPGB 4AGVA 2WBKA 3RMXA 1W0NA 3VZKA 4AHYA 3WNPA 1IG0A 2G9ZA 1MZ6A 2V73A 1LGCA 1Q5OA 3MLLA 4BXFA 2WN3A 1BBT3 1UZ0A 4CEYC 1M4WA 1O59A 3JQWA 4K3UA 5F5QA 4AEKA 5JMCA 1FAYA 5FYZA 5KHKA 1NYWA 5D21A 3VKLA 3OUJA 1ZA4A 1W04A 3M7AA 4GULA 3UK9A 5BUVA 1ZRDA 2PHWA 2XJTA 2WQZC 1JZ2A 4XQWA 5HCBA 1N3OA 1QJU3 1RUH1 2ZEZA 4Q1PA 4XC9A 5F6KA 5LB6A 4EZ4A 2YBKA 1KS5A 1LHOA 1HRV3 2VVFA 4FPFA 5C3PA 5FP7A 3BN6A 1RMU3 4GJYA 4IEVA 3WVJA 3ZR5A 1W8FA 4LKDA 5I0SA 1H0BA 2A5ZA 2HBUA 4ARYA 2VY0A 3CZUA 3ZPYA 1SLIA 3BU0A 5FZ4A 3VDBA 1SPPB 3RZLA 1KFXL 2XMLA 4O61A 3B02A 1LOEA 4NN0A 3OD0A 2J1SA 2WLQA 4ZZ8A 3OGGA 3VDDA 4XQ4A 1VALA 2HEVF 2BFUL 3LAGA 1LOFA 1Z0HA 2WABA 4QX7A 2ZMNA 4FTEA 4RHV1 1H2KA 1GYKA 1JN2P 2H6CA 4HPKB 1PO11 5DXDA 5DABA 1ULGA 3M3IA 4AEDB 4J1XA 1YO8A 3ATGA 4HOOA 2CDOA 1LR5A 2KR2A 2VMFA 1G7YA 3F95A 4E2SA 3BYWA 5JZGB 2VCMA 2WO3A 1SFPA 1X8EA 3KCCA 1IS6A 1RUH3 3V0AB 1U5YA 4XIKA 2P4EA 2FZ2A 4XQDA 4N9IA 1BQPA 1UW8A 4HL0A 2XKPA 4KU8A 1C4RA 5KHJA 1EY2A 1HXS2 4XZUG 4YW5A 1LOFC 4FI9A 1AZDA 4XACA 1D7PM 1W6MA 5BNNC 3VD4A 2E7TA 5FZ7A 1UN1A 4K40A 1DGRA 4QDQA 4DXZA 2QDNA 3JUUA 3T4VA 4QB1A 3MF6A 1FPN2 4YZ4A 4OMCA 3F2ZA 5T3NA 2RJLA 1FXZA 2Z4FA 3E6BA 4KG0A 4DXRA 5TSWA 1CZVA 4LUMA 5C9AA 2YYOA 4B1MA 4F7ZA 4CDWB 4K21A 4QXHA 2EA7A 5CBLA 4DUVA 1SBEA 2AACA 2VMEA 2NN8A 4RHV3 4CUBA 4FTSA 2ZGRA 3FMGA 2WR9A 2JX9A 4L92A 1PO13 2GNMA 2GAUA 1COV2 3AMHA 3ZXAC 1DIWA 1YJLA 2JIGA 4CP1A 1S0GA 3GHMA 1Y9MA 3B7MA 5JSRA 2H0VA 3DV8A 4GWJA 4Y1XA 1MVQA 3MFCA 3SLIA 2LTNA 1KJRA 5CVRA 5JI7A 4I3PA 1ZM1A 4XHBA 3TOJA 4YGEA 4P9JA 1W6OB 3TEYA 4YZ1A 2RG4A 3B00A 2J1UA 4WV8A 4IL7A 5CISA 3HIFA 2PTMA 5F6LB 5L19A 3W5NA 1ZBE1 2YU1A 4E2QA 1RUF2 2GH8A 3LFMA 1TMF1 1QDOA 3HR9A 4PBOA 1VR3A 2EXHA 1SFNA 5FZAA 2VPVA 1V9U2 2UY9A 5HCFA 5SV5A 4A42A 4UAPA 4TLGA 5HXMA 3CU7A 1NOVA 4D8MA 1MS5A 1J84A 2KD7A 2HWC1 4GMP1 3ZKUA 5A3OA 4AGRA 1FX5A 2WNUB 2ZGPA 1XNCA 1Q56A 2GU9A 4DRRA 3PU3A 1AR62 2O14A 3RDIA 3MI8A 1RUNA 2RM21 2C6SA 4Y5Z0 3FHAA 5KBFA 1ULDA 1FATA 3ZFEB 1ENQA 2J1TA 4L11A 4AI9A 1W6NA 4OZXA 1FMD2 2CAUA 3KM5A 4L0PA 2ZGUA 4K8FA 4XF3A 4Y22B 1WLCA 1ZBE3 3VHRA 4FFGA 3WDUA 1TMF3 2XGXA 2D97A 4BB3A 1DFQA 2BOJA 4QQ2A 3J4UH 2GC2A 2PMWB 4HMZA 5FPAA 3VZMA 2ZGKA 4YW7A 4ZY9A 1XU2A 4IEYA 4BE3A 4FPEA 5EJ3A 5A3LA 1PZ8A 4HN0A 1VBC2 4IEOA 1N3PA 1VBD2 5T5JA 1PX4A 2WZ8A 1RHI2 4BLJA 1RITA 4LBNA 2HWC3 4GMP3 1D2SA 1NZIA 1BLZA 2VZPA 3KB5A 3LDKA 2D3SA 4L9BA 3THTA 5LBCA 4BQ1A 3ZXDA 1QOTA 3BPZA 4OVEA 4C90A 1NAEA 4F8AA 3WV6A 2C9AA 2R6QA 3NJZA 2RM23 5FY8A 2ORXA 4AYUA 4NAMA 4E4DX 5GZCA 1U12A 1N47A 1J3PA 2WINB 4B1LA 3O5SA 3PVBB 2IZWA 4YSFA 4QXCA 2YG0A 2QDRA 2JE9A 4XF1A 4KGQA 5A32B 4A41A 5LA2A 4L99A 4XDOA 2D5FA 1ODMA 5JIUA 4JDMA 1C3HA 4R52A 4NIGA 3OJBA 1DQ0A 2XVKA 1GLHA 3WUCA 2QCSB 2WFF2 5FZCA 1TME2 2QVSB 1VB4A 3J8F2 4LE3A 2X8KA 3KGZA 1MZEA 2YZ4A 1SMVA 2A71A 2WL1A 4CDUA 1JODA 1R64A 4L2NA 3BI3A 2Z69A 2OIIA 4LIVA 2VQ0A 2R30A 3HJRA 4JGYC 3RVHA 4MX3A 1Z7S2 4AVAA 2J7MA 3TBDA 1F5FA 1QJY1 1VAKA 4KMQA 2WQ8A 5FZBA 3S7EA 2YUEA 4YVWA 3NSTA 1MPXA 3B01A 1G9AA 2G19A 4MUVA 3WINE 2C24A 2EXIA 4QKFA 1GP4A 4Z2AA 2HKXA 4OHWA 4UF0B 1NE4A 1X50A 2PAMA 1DF0A 1F31A 3VBOA 2X10A 1IS3A 3NRUA 1CN1A 3RRDA 2VZRA 5CFDA 1S2EA 4PI0A 1EAH1 1A78A 5I8TA 5CFCB 2KXLA 3UKVA 4GIQA 4AEMA 5C4WC 4QX8A 1GWKA 4FPGA 4NMIA 1OLRA 1CJDA 1POV1 4MXWB 4Q8KA 1NQJA 2VW0A 3H9AA 4Y4YA 4Y3OA 3WF3A 1DZRA 4K7JA 1S1AA 2OKXA 2W0XA 2C4XA 2IXLA 1OUXA 3C7HA 2D6PA 3JBG1 1UXZA 4JCKA 4NHXA 4PT6A 4NIAA 4KI5M 1BEV2 4UWDA 5FYUA 3VBOC 3EJKA 1SLAA 1UZZA 1WA4A 2K46A 3ILFA 5CIRA 2BNMA 4QQOA 2GDFA 1QJY3 2ZGOA 5DAPA 2VH9A 2X05A 3SMHA 1UX7A 2HWE1 3RYRA 2GMEA 2W52A 1H1IA 3LEIA 5FUNA 3FE5A 5A6QA 4HLTA 4RA0A 3WF4A 3E5UA 5FXXA 2Y0OA 1MS4A 1KD7A 3L2YA 1MS9A 4UFIA 4W6XA 4E8CA 1A3KA 5LA9A 1GWLA 3OGJA 1OUSA 3UGGA 4CDXA 5HV0A 1EAH3 1UYXA 1BJQA 4LHSA 2RMU2 2VL4A 5D8AB 3VD9A 2QTWB 3H8RA 3MZHA 2CY6A 1JUIA 1POV3 3Q8EA 4DIQA 4MGSA 2EXJA 5FUIA 3VL9A 5C3SA 1VPHA 1W9TA 1K42A 1NA1B 4OUMA 4Z92B 4RS5A 1UYYA 1OLMA 2A6WA 1AHSA 3VZJA 2D43A 3JBG3 2QZ3A 1KDMA 4PDWC 5FZHA 2GNDA 4OHZA 4Y1ZA 3BGAA 5BNPB 1R081 2E32A 4RFT0 4OQ8A 1L7LA 2OXBA 1POQA 4I02A 5A70A 4YVSB 3JCIA 2QKDA 2N7GA 4AW7A 4IEWA 1AR91 1GKBA 1SLLA 1K5MA 1UOBA 5LRRA 3CO2A 1XE8A 2HWE3 1LGNA 2PHLA 3VBSA 3WW3A 2LM3A 1GZTA 2R072 4CDQA 2VW1A 2IUWA 1BYHA 3HT2A 5LRSA 1YC61 3ETPA 2A6YA 1NE6A 4RS5C 3A7QA 1PMJX 4AAPA 4MHUA 5FOBB 5FQ0A 1G9FA 1ND2A 1XNDA 5JI9A 2WA3A 2CV6A 4QT6A 2VUAA 3KD4A 4COZA 3I7DA 1N1YA 1LEDA 2JKXA 2RDNA 3T2QA 4NWWA 3MEPA 4KH9A 1DDLA 1XE7A 2D5HA 2OZJA 3MIEA 1MZ5A 1DZQA 2RJKA 1ENXA 3L9JT 4F83A 1F4HA 1LHUA 2VZ3A 2DYCA 1NCRC 1AR81 5AC92 3LIHA 3O1PA 3PMEA 2WT0A 5FZFA 1H2NA 3GCWA 1AL22 4JKMA 5IHRA 1R083 1PMHX 4ZU7A 3AZVA 4ZKTB 4XFGA 4Z2WA 5EFUA 2LW8A 1AR93 5FK8A 2ATFA 4NVPA 1BMV1 1B35A 3IMNA 3KV9A 5H9PA 4CP2A 1C8M2 1GNHA 1YRZA 5C8WA 2YROA 1LOCA 4A45A 1T2XA 1SACA 4HXCA 1QJEA 5ISLA 4LQRA 4OLLA 1XNBA 3W59A 2E26A 1C57A 4JRAA 3ZXGA 4EWEA 4CU6A 1X33A 3A23A 1W06A 1WGPA 2GC0A 1RUE1 4TTGA 1HV0A 1CQ9A 1DHKB 3APBA 1XNAA 5DAXA 5EHDA 3N3HA 3WP6A 4QXBA 1GOGA 4IUGA 1S0BA 1AR83 5IFTA 1HQNA 1MS8A 4ZU5A 3ES4A 1E5HA 4WVMA 5SV8A 4JGZC 5FZMA 1H8TA 2A6VA 3ACGA 4IE0A 2DTWA 2QQOA 4J25A 3LPGA 3ORJA 2OX0A 1CIYA 1LU2A 4FXGB 2HYXA 3SNMA 1W8OA 1Y9QA 1R1ZA 2W1WA 3N9MA 1BBT2 1S0JA 4LLOA 2W87A 1H6YA 5KHHA 5ABJB 3MYXA 5I8SA 1W2UA 2YPDA 4M3CA 4CCNA 5K8SA 3PVEA 2VTFA 3WEZA 4I0AA 5IYYA 4E9KA 2W5FA 1W0PA 1MS1A 2R061 3IT8A 1RUE3 2DTYA 3IDBB 3VBUC 3ZSEA 1QJU2 1LODA 1Q8VA 2W94A 5E6HA 4FOWA 4J1WA 3DYPA 2AH2A 3B94A 5EQUA 1W8UA 5JCTA 4IGPA 1RMU2 1SZBA 2B4KA 3D0SA 2Y0IA 3GCXA 2JXAA 4HSJA 4KWJA 4NHKA 3ZFFA 5C33A 4TZDA 2X29A 1W8ZA 2NLRA 4XURA 1OD3A 3QOPA 4BQ3A 3AZWA 3WR0A 3OGSA 1HW5A 2IFRA 1JOBA 1AJKA 5CKMA 2VJXA 3NO8A 5LATA 1YLLA 3CJIB 2CWSA 3NW4A 4I09A 3VD3A 3R05A 4IERA 5A7NA 5A1FA 3AP9A 3KV5A 3BALA 1GP5A 3ZLIA 4KWKA 3LEGA 1LJ7A 5CKNA 1KDKA 3M1HA 1WW6A 4ITCA 1PO21 1RUI1 1AYN2 2R063 3FLRA 1NCQA 4UW4A 3VHPA 4MLOA 1RINA 3GXUA 2WO7A 4LBKA 3U10A 5JAXA 3ZN6B 2W47A 3RZMA 4XTPA 3N7MA 5I93A 3LSDA 5FYMA 2P1BA 2SLIA 5IVFA 1A6CA 3AP7A 4XABA 3OY8A 1OH4A 1UF2C 3DYMA 2XLGA 4FQ4A 3PJQA 3N7LA 3GNEA 4HKOA 4G4FA 4BWOA 2PLV1 2B46X 2PHRA 4XCAA 5I8YA 1B09A 3H3ZA 4A6OA 3ITQA 4RGAA 1W8HA 4DPNA 2E6VA 3M3EA 3I2OA 1AXZA 4RHV2 2FCVA 1EP0A 2BBAA 2GALA 2UURA 3NJVA 5JXIA 1PO12 3KF5A 2PA7A 3KT4A 3ZSKA 1LECA 3I2DA 4SBVA 5GJ6A 3W9AA 2W1UA 3DKWA 1PO23 1RUI3 1YHFA 4K8RB 4LO5B 1QEXA 3ASIA 1GWMA 1SBDA 2DFCA 2FQPA 4LNVA 5FPLA 4CEYB 1GMMA 1W05A 3HPNA 3GZAA 5FZGA 5KHGA 4V1PA 1JOPA 4QKDA 3KCYA 5FXZA 1PGW1 2ET1A 3PTYA 3BPSA 4XUTA 1S2KA 1UXXX 4Q29A 2RS31 1RIRA 4EN7B 1DQ5A 3THCA 2WZEA 2ZGMA 5A3MA 4BCUA 4CEWA 3B9IA 5ANQA 3LGRA 3IDCB 3G7DA 3WP3A 5F2WA 2HWF1 4LO6B 5EP9A 3ZR6A 1ZRFA 1JYTA 4QB2A 2PLV3 5FDBA 3WQBA 1UYZA 3NNMA 1H1AA 2JE8A 4YW2A 2ARCA 1DBNA 2VUDA 1XPWA 5GLTA 4QGLA 1YFWA 1H6XA 1UOGA 2XL9A 3CQOA 3ZPOA 5FO7B 3U11A 1W9WA 3WNNA 1CR7A 2G1MA 2ZPXA 2E31A 2RHPA 4DNYA 1JZ6A 3RI8A 4H7MA 1ST8A 5C3QA 1YXWA 3T08A 3WDWA 1IQAA 4P5HA 3S57A 4U36A 5BV6A 3V65A 5A3NA 1UU4A 3K2OA 3OPWA 3ZYBA 3EXUA 3WG3A 2IC1A 2RS33 1ZBE2 4QHBA 2X53S 2ORZA 2QQJA 5FY4A 3WP4A 1L7QA 1TMF2 3MPBA 4GB31 4NE9A 4Y5TA 1CGPA 1WUVA 2EIEA 2QUOA 2VCBA 3FZ3A 3MUY1 4XFCA 1Y3TA 4IXLA 5EJ1B 3VGIA 3CNAA 3IM0A 3VDDB 3I3QA 5FBJA 2HWF3 4RL7A 4FOQA 3OCPA 1S4CA 1WMFA 3SISA 1YI9A 4LA2A 4LKFA 5IAXA 3AP4A 5K0UC 1H9PA 1TE1B 3I49A 2W1SA 3KVAA 5GLZA 4BM8A 1HDKA 2HWC2 2PHXA 3POJA 3IPVA 3HMYA 2GC3A 2Y6HA 4JQRA 1RL3A 3KZ4C 2VXJA 1MQTB 3IBMA 2P37A 3ZFGA 4K1YA 4P9YA 1UQXA 1ZZCA 2VCAA 2RM22 2OA2A 4LMFA 1YUDA 3WXPA 4V2VA 1W6MB 2LS6A 4EE2A 5ACA1 4N90A 1ZNPA 2VUJA 2RVAA 2Q1ZB 5CAZA 1XXNA 1GUIA 3ENRA 4MXVA 4I2OA 3LZZA 2VR4A 4QX5A 5FPXA 3RWKX 4GALA 5I0TA 4GB33 4XFHA 3GALA 1NY71 4HZFA 2AEYA 3GDBA 3OYWA 4QPWA 4DO0A 1YCIA 4QPIC 5C9AB 1RXFA 5BNOA 1MACA 3E5QA 2VECA 2Y6JA 3ZMOA 2PN5A 2BGOA 4QWNA 2DVAA 3SH4A 1ZZ8A 3H3LA 1WCSA 3PVNA 3VD5A 1C5HA 1KEXA 4AXOA 4DINB 4HK9A 4XFBA 2BDRA 2VXRA 3EQEA 5H9QA 4FAGA 4HT1T 4GA9A 3SHRA 3S0MA 3AJYA 1TZOA 3DPRA 5JR2A 4MGYE 4CCMA 1OQEA 1WMDA 1YIFA 2HH9A 4AVVA 2WAAA 2R32A 3H1MA 3K46A 5ACA3 2PYTA 3USUA 5FPUA 2JDKA 4TXWA 2MHFA 4ZS3A 1ND3A 5F5IA 5A6XA 1T6GC 5FIXA 1V6LA 5FJHA 2VZTA 3AJZA 1GQHA 2A7AA 3KVBA 4AI2A 3EO6A 4BQ4A 5F3GA 4JVAA 5KHIA 2NZ9A 4KWUA 3ZYGA 3KV4A 3I3MA 3THDA 4DFSA 1DP0A 1YI7A 5J7MA 4FP2A 4IE4A 5J1XA 5FZOA 3MHZA 1J3QA 4Q26A 2ZZJA 3OGVA 1VAMA 4XUOA 5A7WA 1GZ9A 3K51A 4FVVA 3SXWA 1V00A 3DF0A 4QXKA 4OI1A 4YZ2A 1QH7A 4Q1RA 5LWBA 1QJY2 2ZHLA 1W6NB 3O12A 3U78A 3R6SA 3SEEA 1PZ7A 1ZX5A 3ACIA 3OB8A 4NHYA 3RG0A 1OOPC 4E4SA 5FWJA 3Q8AA 4EN6B 1O5LA 3SH3A 3R4UA 3OD4A 4XZPA 3OTFA 3J7NA 4AFAA 3ALQA 4PJYA 4LO7A 2C26A 3S7IA 4ASMB 2XJRA 3MIDA 4FOYA 4QDSA 4Q4Y1 2XR4A 5HPOA 4A3XA 2YXSA 4B8EA 2C0ZA 1GNZA 3CHXA 5F39A 3IN9A 2B45X 1EAH2 1K45A 2H0BA 4XJWA 3J7MA 2Z2SB 3I54A 3LFIA 3HNYM 1LU1A 4WM8C 1OA2A 2Q30A 1CPNA 3AZYA 1YFUA 2BPA2 4HK8A 2EF6A 3H42B 2HYKA 2VZOA 1F15A 1UPSA 1F2NA 3DEMA 2YFZA 1OSGA 3JBG2 4BQXA 5JXJA 4QX0A 1YFYA 3ZYIB 1ZZ6A 4JX0A 4URAA 2ZGQA 5KWRA 4UXAA 3PHMA 1H1MA 2E51A 1QKQA 5FYHA 4YW4A 2D6MA 4C1XA 5BY5A 2I07B 4HVQA 4CZSA 5K9YA 2DUPA 2DUQA 2VD7A 3S6PA 2WDBA 3O7OA 4LXLA 1PGSA 3WNXA 2BQPA 1QDCA 1F9KA 5IVCA 3POIA 5FAXA 4Q4Y3 2Q8DA 5GLWA 3C7FA 5GKAC 3WW2A 1XE0A 1URXA 3BU7A 1ZBA1 3ES1A 1JYCA 4DXTA 1QHDA 2P3IA 3MF9A 5BNNA 2GMPA 5I91A 2W92A 1HB4A 1HN0A 1H4HA 3MIGA 3VV1A 5H9SA 4CDUB 4F3JA 5GM0A 4RQPC 5FY7A 1RVF1 3ZDSA 1D4M2 2AUYA 4Y24A 2Z42A 1OC1A 3NNFA 4OHXA 1DQ6A 2A73B 4RR3C 1BHGA 3ZYRA 1UY1A 3UKNA 1X36A 2FDGA 2ZEXA 1R082 4IW3A 1C1LA 4YVWB 1W9YA 4YW1A 5T50A 3GBFA 1G8WA 2XJVA 3LKJA 3VBFC 1AR92 1PK6C 3ZMNA 5IVJA 2ZGLA 1W6QA 4YM3A 3FUOA 4SLIA 5JSOA 3AFKA 3VBOB 2EIGA 4CP9A 4OZOA 2JDZA 1DYOA 1JHNA 5JLVA 4AE2A 5CFDB 4JC1A 2RV9A 1ZRRA 3T0BA 5FFOC 4XDPA 4HVRA 2ZJCA 4OYUA 2W3JA 3FX3A 1NLRA 1ZBA3 3I3DA 3LSEA 5JXHA 2PHUA 1DYKA 4LBQD 1ULPA 4IESA 4ZHNA 2P17A 4ARXA 2IXCA 3BKZA 2VULA 5DZEA 3H7YA 1RTVA 5L9BA 3WQ0A 1RVF3 5K4LA 4FO9A 1QJX1 4Y4RA 1TVGA 2EAKA 2WWJA 4QKNA 4FSJA 2DCKA 2YC4A 2HEWF 1WWYA 3DXUA 4Z82A 4ZZ5A 1OBNA 3PNAA 5CA6A 4Q4V1 5L36A 1LB2A 3I3EA 5FZ8A 2G4IA 2X5IC 4YZ5A 2NYYA 4ATEA 5B4NA 1ODNA 3TEWA 1JOJA 1BMV2 1YQ8A 1W99A 1RUG1 2JDNA 2Y6FA 2ZMLA 4Y1YA 4LOTA 2BBVA 1E5IA 2ZTNA 4Q4X1 4CXYA 4CDXB 3OEAA 1LHWA 2J42A 3SH5A 1A8DA 4MGTA 2V4AA 1W2AX 1VRBA 3O0VA 4MHRA 4RFRB 1W3XA 5CU1A 3RGBA 4RS5B 5B2GB 1BKZA 1OKQA 1QJX3 4LBQA 1IPJA 2RDSA 5JXGA 3DYOA 3D5OA 4KBZA 4BLIA 1JS9A 1XQNA 3LEKA 2WN2A 4PLMA 3WCSA 4PHZA 2OT7A 4BA6A 4XJ8A 4YPJA 2AENA 1K5MB 4ZU4A 2OPKA 4Q4V3 4FTBA 2CDPA 1W28A 5A1LA 5GZGA 3VBSB 1FOD1 4ISQA 4MO3M 1AXKA 4NWVA 2Q8OA 5E1RA 1GZWA 1Q43A 1XC6A 4GJZA 4TN7A 4YZ3A 5T5LA 4CDQB 1RUG3 1YQ5A 3FUQA 2FBEA 1VB2A 4AQ6A 1QNYA 2WNVA 2AZ5A 5A1AA 1ENSA 5C8CA 4Q4X3 1ND2B 4M3CF 1I9RA 1Q8OA 2QZ2A 2XJQA 4JAAA 4XAEA 1JMUB 4QU1A 4AI3A 5FR3A 5JMOA 3NAPA 3J7HA 1K5JA 1NG0A 2R062 2VE1A 1OXCA 2B7YA 3OUHA 2FZ1A 5F8PA 3EBRA 4CU8A 4N7UA 2HWD1 5A7SA 5B4XA 3MICA 1J58A 1ULFA 3PIGA 4IEQA 1OQDA 4NOTA 4LHLA 4XUQA 4DUXA 3ILNA 1W8WA 3AXDA 3IMMA 1HIXA 5T54A 4MH0E 2YFUA 4XDQA 1XYPA 1CAXA 1POV0 2WNVC 5C8CC 1W6PA 2WSUA 5DDJ1 1GOHA 5FPVA 4DXSA 4PCRA 4CA9A 3T1LA 2WNOA 1B35B 4JKLA 4QQHA 4ES8A 2CNAA 3NAPC 1FOD3 4Q5OA 3PLQA 4HETA 2HWB1 5C71A 1OH3A 4JGYA 4MGQA 2XQXA 4XFFA 1ASJ2 4AFBA 2EIBA 2CAVA 4D7SA 3LA7A 3E1F1 2V5DA 1WW7A 2JICA 4GXLA 1OLME 4QPGC 3UETA 2Y6GA 1PO22 2QQIA 1RYYA 3ELNA 3NV4A 3PDQA 4GWNA 2R0FA 4RYDA 1ZZBA 5FYYA 5J09A 1S55A 2HWD3 4UBHA 4LBJA 1MEC1 2WO2A 2YU2A 1RUC2 1GQGA 1WLWA 3I2JA 4MGKE 4FAHA 1CAVA 1LEMA 2K9ZA 3CBNA 4WVMB 1HX6A 3N9NA 1BXHA 5C4WA 3EMRA 5KXDA 1H8TB 5L7OA 4ISRA 1CVNA 3O1MA 4Q0QA 3IAPA 1OKOA 3WHTA 5A6ZA 5DDJ3 5FZDA 3ZN5A 1G86A 2LROA 3MIHA 4NPMA 4YLZA 1BK0A 1WCQA 5F5AA 3IAQA 3N9QA 4QGMA 5KXCA 1W8TA 3O1VA 2TNFA 2VBPA 2W95A 4UW3A 4XPVA 2PLV2 5FRAA 4W4ZA 2QQPA 2HWB3 2FDFA 1RJ7A 4YWAA 4UFKA 5FO9B 3LE0A 3AKQA 3JD71 4PIYA 1GBGA 4Q0SA 5ANNA 4M3CB 2RS51 4AEDA 4LKSA 5JIAA 2XKOA 3AK0A 2D3RA 2JDPA 4QAWA 3ECQA 4CUCA 1W8NA 1D0HA 3N36A 4EQVA 5L7OC 2ZX3A 1E5RA 4Q4W1 1FNYA 1HB3A 2AC1A 4XVHA 1L7RA 5HV4A 3V0AA 2H6BA 1V6MA 3ZIWA 2DBIA 3QD6A 4E4ZA 1F35A 5FXWA 3ZFFB 3AMPA 1DG6A 4XBNA 2P6CA 4I0WB 5FZIA 3VKFC 1MEC3 3O1SA 1PGW2 2BOIA 3POBA 3MIBA 1O4ZA 1CJPA 3VKMA 3IWZA 4AEDC 2RS32 5FZ1A 1J1LA 2R49A 3S5AA 1V6JA 1ZRCA 2EIDA 5EWSA 5J3UA 4RGGA 3A21A 4BDVB 2R1BA 3QH7A 3TWIA 2QFEA 2D44A 4H14A 5C3OA 2HWF2 4PDWA 2ZZQA 3I97A 3QCWA 1OA3A 4IGOA 4ZONA 2BUKA 5LBBA 2GSYA 4XE9A 1O3RA 1KS4A 2ADDA 3JD73 2UU8A 2Z79A 4LT5A 2RS53 2BWAA 4YGBA 5E8AA 1R091 2OQ6A 3K48A 3TRSB 5ERLA 4LE4A 1NCQB 5J98B 3C7EA 4G9SB 3A0KA 4Q4W3 4D7TA 1GR3A 5FK7A 5APAA 3NJYA 4UW6A 3TN92 5FJKA 3DN7A 4CDWC 5CB7A 4Z8BA 2XDVA 1M06G 3H0OA 3I2FA 3RS6A 2WNEA 1VBE1 3KWVA 4AI1A 1DLLA 3ROUA 3V0BA 3OY8B 5A6YA 2BEOA 4K9SA 1O3SA 1MS3A 2CGPA 4PIXA 4GB32 1IHMA 1A34A 1H8VA 5G04L 1NCRA 4M3CE 2IXIA 3D6EA 4DOUA 4LTAA 2JIJA 2R1DA 3BUCA 4GAZA 5IJRA 4XIOA 1HB1A 4ZS2A 2VAUA 4H2AA 1QQP1 5JSPA 1R093 3EHKA 5T55A 2E7AA 4COYA 4AGGA 1WMXA 1U5IA 3N7JA 2ENRA 4M00A 2WA4A 1D4VB 4R4XA 2P2KA 3JB4C 2A6ZA 4GWIA 4LOSA 5CG9A 5FLIA 2K0GA 1G9BA 4XETA 3DKQA 1VBE3 5ACA2 3AX4A 5KR7A 2VZUA 3NV2A 4CEWB 3J26N 3HOBA 3OBAA 1AYM2 4HFSA 4KU7A 2VVDA 3DECA 4IV1A 3AYAA 3FLTA 2VNRA 3KT1A 3AXEA 2VG9A 2R041 2ZKLA 1O5UA 3ZFEC 4DZGA 3E6DA 5FZKA 3I4IA 3O1TA 4JGZA 4N9HA 3SCGA 1ACCA 1UMIA 5FMOS 1XOYA 3T0AA 2B39A 4LPLA 1JYIA 1HJFA 1Q8PA 4XFIA 1QH6A 1RUJ1 3AZXA 1QQP3 2E63A 2QNKA 3GJBA 4RN5A 2YGMA 5GLVA 3R4SA 2V4VA 1UIKA 2ZHKA 3UGFA 3I59A 1KXGA 4P00B 4EZHA 5IK8A 4W6WA 2DCYA 4IV1C 2BU9A 4P9GA 4NIIA 1HN1A 1S0DA 5F1RA 1QGLA 5IWFA 3O0XA 5KXEA 1NXMA 1H2LA 3AKRA 4AR2A 3KQRA 5DAVA 3VBUA 4OMDA 3CMGA 5FLJA 4E8DA 4IV3A 3T1MA 1UYPA 1LOAA 3RNSA 4Y20A 3NNJA 1JU3A 1UIJA 2R043 4XTMA 1ZREA 1W9SA 4PI2A 4CXXA 2FMYA 5I0UA 2ZX2A 1AR61 1Q8QA 1I5PA 5HXVA 2MPFA 3KHBA 4O9EA 1CAWA 2BNNA 3B3QE 2XBO1 3OPTA 1RUJ3 2JEMA 4MADA 2ARAA 5DG1A 2OYZA 3H3UA 2JECA 2JDAA 1W2OA 2WYSA 4UFJA 3ZFGB 4D7YA 4C91A 1NT0A 4LJHA 4IV3C 4DRVA 1FMD1 1PVXA 2BWCA 1HRV2 4IEZA 3EYPA 4YARA 4YGCA 3RMYA 4YW6A 1WBLA 1IZ3A 1N1VA 1J83A 2NQYA 2RDQA 4NHMA 4TSVA 5CKQA 3ZX7A 3ZSMA 3AFGA 2BZDA 2EAAA 4Q0VA 3T09A 4DMIA 2NM1A 1S0FA 3HN1A 3IZOA 3OYWB 2NMOA 4H55A 2VMCA 1UKRA 4I01A 2UWAA 4S2DA 1VBC1 4WBBA 3D4KA 1OA4A 5BNOB 4Q4Y2 1JYNA 1RUOA 1Q3EA 4BQYA 2WT2A 5EYYA 4FT8A 3KT7A 3B93A 3AB0A 2WZR1 1DQ2A 1QY4A 3VBHA 4AVCA 3LOBA 5FZEA 3PUIA 3DUIA 5FUPA 4AK3A 3JZVA 2EXKA 1CZTA 1AR63 2I2SA 2A75A 2XBO3 3C7OA 4FPJA 1OI6A 1TNRA 2OUHA 1O6UA 3TAYA 1UZYA 3ZO0B 4OUSA 4U2AA 4JDOA 3D0JA 3DPRB 1I1EA 1RUH2 4HG6B 5LA0A 1FMD3 1WBFA 2ES3A 3M8LA 3VZLA 1G9DA 1VMFA 1OT5A 1X82A 2UYBA 4FFHA 2JG9B 3MLKA 5BYNA 1BVP1 3USUB 4W8JA 4FBFA 1TEIA 3THPA 3VBHC 2GZWA 1ND3B 1UWWA 4D6RA 2JD4A 2FDJA 3WY6A 5LA1A 4GQ7A 3ACFA 2Y34A 4FOVA 2WC2A 1OF4A 1S0EA 4KQ7A 4TYSA 3U75A 3PUHA 4WVWA 2XG3A 5F3IA 4NIHA 2WFF1 3NV3A 1DQ1A 3I8TA 3OGRA 4DEQA 1VBC3 1SLBA 2VNOA 3C2UA 3KSCA 2Q8CA 5FKBA 4D3WA 4XCBA 5FKCA 3NJXA 3TB0A 1CX4A 1ZBA2 3ZXFA 1S0IA 3T2PA 4XMIA 4AI0A 2WRAA 1OQ1A 1VMHA 1S2BA 2WZR3 4Z1VA 5FZOB 2W08A 4EJRA 3WT3A 3WF0A 4FPOB 3K4ZA 1UKGA 5A7WB 3CEWA 2GP5A 1NQDA 2P3JA 3ILRA 2JB4A 2CTVA 4K20A 3OBRA 4R9DA 2JJ6A 3RZZA 2DU0A 4LORA 3ZXKA 5FZ6A 1OPMA 4FPHA 2ZABA 4S2FA 4URTA 2BERA 3UNPA 4R9CA 2BW8A 2GN7A 3T2TA 1FYUA 2GNTA 5L9RA 3W20A 4B4RA 2VMGA 1X9TA 3O0WA 2TUNA 3NNGA 1RGSA 5FTTC 4EYUA 3W5MA 1KRIA 1WD4A 2CU5A 3U0ZA 1HRI1 3PURA 3POWA 5A7QA 5A3PA 5I0RA 1IKQA 2EALA 3RYKA 3SKJE 1JTZX 1JZ3A 3AC0A 1NA1C 3WHUA 2JENA 2IFWA 1NUKA 2WFF3 3U1XA 5BNPC 4CRQA 2ZAAA 5FMBA 2OPWA 4CCEA 2I74A 5IVVA 4CU9A 4YVSC 1VBA1 2WWUA 1PHMA 2VOTA 2XHKA 3PIJA 3T30A 4UBGA 1DZTA 1KITA 4PLOA 5A33A 3AVSA 2CWMA 2FCUA 3JXSA 1SDWA 1QJX2 1E57A 4NPLA 3PUAA 3OF1A 3VN4A 5GZDA 1STMA 2KM2A 2MEV1 5EJZB 1F8VA 4DY3A 1JW6A 5KC6A 1EPWA 5F9TA 2VOKA 5K0UA 4UFHA 1XYNA 4QKBA 5E89A 5JR7B 3M70A 4Q4V2 3RZHA 2Q0AA 3HN3A 1CD3G 3H1WA 1PNFA 3BIWE 5JPNB 1HRI3 1W3VA 5G05L 1RUG2 3N9LA 4N53A 4R9AA 3ZXLA 3WW1A 2RMU1 3LPFA 4XJAA 1HB2A 2VQTA 3RJRA 2ZKNA 4RSUA 4JQTA 1JXNA 4FFFA 5BNNB 1JYWA 2WFPA 4BQWA 4CXWA 1VRH1 3D3AA 3IIAA 4PQQA 1IGOA 1VBA3 2WJSA 4QX3A 1UX6A 4LBOA 4UOJA 4ES9A 3GZUC 2YBSA 2D93A 4OQ9A 3JQXA 3K77A 1DQ4A 1V0AA 4QPIA 4BHPA 1PIV1 1EV11 1C5IA 2BTVC 2VNVA 2WQ4A 2ZX0A 4XF9A 2R16A 3A4UA 4C1WA 4N53C 2MEV3 2GN3A 4P9WA 4LK6A 1U0AA 2AGSA 1WCUA 4IE5A 3N9PA 4YM0A 3VBRA 4HKWA 3GHNA 2AYHA 4TLFA 2R071 1SDDB 1W6QB 2WIIB 1FOD2 5T5PA 3NQHA 3ZN4A 4CP9B 2F17A 5T5OA 3VDAA 1X9PA 1Y9GA 4LHKA 3AMNA 1SBFA 3FHIB 4NO4A 2RMU3 3WDXA 1IS5A 4NR1A 3VBRC 5FREA 2IXHA 2D40A 1AF9A 5JOYA 2BYVE 2E9QA 3MW3A 1SG3A 1J3RA 4BIOA 4CCKA 1GOFA 1VRH3 3HNMA 3Q8CA 2PAKA 3RSJA 4AVSA 1QWRA 4KNCA 4KBBA 1DGWX 3W58A 2HWD2 1U5XA 1V6OA 3WNLA 4AHWA 2C1FA 1FNZA 5I0DA 5FWEA 2VMHA 5AFEA 1PIV3 1EV13 3WD5A 5LK7B 5DAWA 1OHFA 3HAGA 3WF2A 2E33A 5ABJC 1IS4A 2ET7A 3N9OA 1LAJA 5HCAA 2JDYA 4AFMA 5DDJ2 2R073 4FPKA 3UESA 2B5HA 2ARXA 4HKLA 4ZXEA 4AHXA 4AOCA 1ZZ9A 1RUD1 1SLCA 3K4AA 1CAUA 2HWB2 1G9CA 2DBNA 3ACHA 2WT1A 2A3WA 1HQWA 1QOSA 1OD5A 2P6HA 4COWA 4IE7A 2NPIA 3CJXA 2Q4SA 4QPYA 5FPBA 1OOPA 5FZLA 3T3YA 2ILMA 5E16A 1MVEA 1RXGA 3KCXA 5DUXA 3MDPA 2DCJA 1AUYA 5DAQA 4QGNA 2G9GA 4LBQB 5IW0A 1UL9A 4N43A 4CCOA 3CJIC 1ZYBA 4AHZA 4LO4B 5A7OA 4XJUA 1PZ9A 5FCCA 3RI9A 4QM8A 1LTEA 2Y60A 4WM8A 4D0QA 4LITA 1DGLA 2RR11 4OI2A 2YV8A 2LUWA 4UI9L 3VLBB 4W6YA 1IKPA 2O8OA 4GH4A 4LUKA 2A3YA 1GZWB 4V2WA 5EV7A 2IVIB 3OSDA 4LA3A 3U37A 3WCRA 3WX5A 3BTAA 1RUD3 2EVXA 3OBZA 3P6BA 2WNVB 1TG7A 5C8CB 5LCWL 2Q1FA 4LULA 4N43C 1JH5A 3M3QA 3JD72 1US3A 2RS52 4AVBA 1QIQA 4P08A 1I5ZA 1O4YA 3NAPB 4A6SA 4BMEA 2WAOA 2VCCA 2A1XA 2WWSA 2J1VA 3LD8A 4OULA 2XL7A 4AQSA 4AZZA 2VGDA 3WNKA 4BZ4A 1LNSA 3Q8FA 3N4MA 4Q2FA 4Q4W2 1RC6A 4M4RA 5LASA 4EWAA 1QJFA 3PTRB 4GH4C 3ETQA 2WKKA 2D6OX 1UAIA 5FBZA 4HSLA 4MGZE 4WZCA 1GZCA 4R4ZA 4BK4A 4JTOA 4DS0A 1CAXB 1ZZ7A 2V5YA 3WZ1A 3OUIA 1W6PB 2JE7A 4M0HA 4HBNA 5EXOA 1US2A 2JB8A 1ENRA 4RD7A 2YMZA 2JDHA 3JB8A 4RQPA 5DUWA 4A44A 5LEJA 2RR13 1W2TA 3OEBA 1PGL1 4JHZA 2HWE2 4META 2PHTA 4RR3A 4UYBA 4JGYB 2ZEWA 3MIFA 4I30A 1KGYA 2P3KA 4BMBA 3HQRA 5JDBA 1S0CA 5CEHA 1UY0A 4B4PA 5JPMB 2DDUA 4QDRA 1AYN1 1XJAA 4HANA 4A2UA 4PF5A 2XVGA 2Y6KA 4B7EA 2PHFA 3VBFA 1PK6A 1YQ6A 1D0GA 1R092 3WG1A 5FYBA 2BNOA 3D8CA 1V70A 2BGPA 1YIPA 5IATA 4EV0A 2ZGNA 4DQAA 3HQXA 3KLSA 3DGTA 1CAVB 2B42B 3KMHA 4XF4A 5FZ3A 5C4WB 3M2MA 1U5ZA 3PVOA 3AZZA 3B9CA 3SEPA 5IVEA 5L7OB 3MGUA 1C1FA 1VBE2 1PVC1 2VVEA 3BOWA 4CCLA 3HVDA 5FP3A 5C5TA 4GMP0 2ETEA 4Z07A 2F4LA 3GJAA 1GV9A 2D6KA 1O8SA 3RYPA 2G9FA 2FDIA 4I3GA 3V64A 4CCJA 4LK7A 1OVPA 3FBYA 4ET7A 1UOFA 2VU9A 3LCPA 3MV11 4FPYA 1QF3A 4X8PA 3TEXA 1JZ4A 1E5SA 1Q8SA 4XMAA 2CGNA 4Y1VA 2BVVA 1AYN3 3AM2A 2ADEA 2X5IA 3H50A 4GKYA 4LBLA 4NHLA 4UW5A 4X6RB 2UWCA 1QQP2 3WP5A 3BVCA 1SHWB 5FY5A 3KHCA 5C3RA 2TBVA 1MQTA 2DF7A 1UZVA 3AVRA 5GZFA 2Y38A 4XW3A 3VDDC 5J96B 1OMIA 4COUA 3S30A 5CADA 3G6JB 1R1A1 2VMDA 1ULEA 3U14A 1GANA 1QXJA 1EUTA 3PJYA 1PMIA 1AR82 2Y26A 5IVBA 5FOJB 4P9IA 1VP6A 5DZGA 4ORFA 4IDZA 4WM7A 1PVC3 3VD7A 3B69A 4FP3A 5DMYA 2E53A 2KA3A 1AR71 1JI6A 2WUHA 2BJSA 4PDWB 2BV4A 5GZEA 1MQTC 2CSGA 4A7KA 1IOAA 2JG8A 2MNGA 3OOXA 4CCCA 5L9VA 1AX0A 2DURA 2R042 3HQUA 2TEPA 4UT5A 1H2MA 3T4HB 2PELA 1VBB1 4YW3A 1W90A 3MLJA 3K75B 4Y1UA 1RUJ2 4YRDA 1RJ8A 3ST7A 2UYAA 4WM7C 1RUE2 4PLNA 5C9AC 2OQ7A 1I6XA 3SCHA 2IWGB 3POEA 3VL8A 1SLTA 5BNQA 3AL5A 1FI2A 4JKKA 1CESA 1R1A3 2VM9A 4N8MA 5LY2A 2JG8C 3T2OA 4OI4A 2ZOEB 3V0BB 2WSVA 2DVFA 2BGCA 3R0RA 3H8XA 2XLAA 1HQLA 1JBCA 2QQUA 4UFMA 5JOWA 2R7EB 4YM2A 2W2IA 4XUPA 2W46A 1PM4A 5FP9A 2P34A
chains in the Genus database with same CATH topology
4IQPA 1NCRB 1AR73 1OFSA 3D82A 4XILA 5FLHA 3GBGA 2WS91 1OPOA 1FV3A 2I45A 4XJ9A 1YFXA 3ZSJA 5JVVA 2XH6A 1A8MA 2SBAA 4AQ2A 1GFF2 5FQ0B 1AJOA 1AVBA 1VBB3 2ZS6B 4YFWA 4K6BA 2XBO2 5FMOL 4M0NA 4P9XA 4JV4A 2FMDA 5J48A 3WDVA 4OFGA 3VUOA 4EROA 4QPGA 4N7IA 4M01A 1H4GA 1VLNA 4IV1B 3SITA 4ONUA 1BVVA 3MW2A 3X29B 2XVLA 5HI0A 2WS93 2A6XA 4JGZB 4AI8A 1SEFA 2QE3A 2WZR2 1WD3A 4O9GA 4XXPA 4EN9B 3QBQA 1WLTA 3I59B 4HVOA 2XJUA 1RUI2 3OPZA 3J9SA 1DYPA 1NZCA 1WCDJ 3GYDA 5AVPA 2YY1A 4Q0UA 3VZNA 2ZGTA 3FBMA 4H7LA 2OVUA 2DUOA 2ZX4A 1AX1A 3VHOA 3LA3A 3VBUB 1QJZA 2JKBA 4LR4A 4IV3B 2RE9A 2AREA 2HJIA 1LOGA 1XNKA 1REDA 4Y20B 3V56A 2GMMA 1FT9A 3H1YA 1VAVA 4YFZA 2RS11 1XU1A 4HPKA 4J6GA 3R4DB 3VKNA 4I0BA 4E2GA 1CAWB 5JZGA 1F5JA 2IXJA 3FFQA 1D2QA 1IPKA 5IUQA 1SCRA 5J36A 2D3PA 1ONAA 3POSA 4YYOA 1UU6A 3WQ7A 4PBPA 5FPZA 3DL3A 4CP0A 1HV1A 4CDUC 4KG8A 1PM7A 3RJ2X 2BFUS 3WG4A 4LHNA 5JZGC 3L2HA 4CTEA 1XYOA 1HRI2 1Z78A 2YGLA 4FPCA 3A0NA 1CONA 3ZYJB 3GZTB 4S2HA 3TNQA 4CDWA 4PIZA 1EPZA 3M3OA 3FJSA 5T52A 1MZFA 4YVWC 3VBHB 4Q27A 2RS13 2XB6C 3BODA 4QM9A 1VBA2 1C8NA 1OLQA 1SFYA 4P14A 3KS7A 3ZXEA 1CIWA 2O1QA 2CL2A 4AEJA 4XEZA 5CFDC 2MEV2 1W6OA 2A3XA 3GBWA 3HD8B 3OBTA 1LULA 3AKTA 2K2SA 1N1TA 4IEXA 2YDEA 1EYBA 1KQRA 2CGOA 3WDTA 2R0HA 3NVCA 2ARBA 4JTNA 3WQ1A 5JWPA 1D4M1 1WCKA 3AKSA 2ZAHA 4XF0A 2F6BA 1C28A 4B4QA 3USSA 1VIWB 1L3JA 2NP0A 1VRH2 2WNUA 1XRUA 3P3NA 3M3CA 3LB9A 2O8QA 1H30A 1PIV2 1EV12 1HXS1 4TWTA 4XBLA 1QMJA 4C0BA 2OUJA 3ZFEA 3FWEA 4CDXC 2VNGA 1QXRA 3O14A 4FXKB 4B29A 3BOPA 4Y22A 1FPN1 1O3TA 1REEA 1YWKA 4X8NA 3ACLA 3VHNA 2WNUC 4LO8A 3M4FA 3WOGA 1NLSA 2BVBA 3NKGA 3ZVXA 5HBAA 2QJVA 3FC0A 1NY72 4XFAA 4JDNA 1COV1 3QLQA 1D4M3 2ZGSA 1K5MC 2O0OA 2XWBB 3UV9A 1X7NA 3MPPG 1LHNA 1AXYA 5A33B 3VBSC 3UJOA 5DG2A 4E27A 3FLPA 1UPIA 3WUDA 4CDQC 5K7PA 3AP5A 4FCAA 1HXS3 3NL1A 5K0UB 1V6IA 1ND2C 1RUF1 2W39A 4XOGA 4B3NA 1Y43B 2OW4A 4ZXKA 4EN0A 4W65A 1CPMA 1FPN3 1V9U1 2DV9A 4N53B 5A32A 1LESA 4L97A 4YNIA 2AR6A 4IEUA 1RUD2 4KWLA 4WVZA 5AFBA 4D69A 3AMMA 1KFUL 4AF9A 5CNAA 3WDYA 1HKDA 2PAEA 1LGBA 5LEKA 2ERFA 1COV3 1QU0A 4INDA 4PQ9A 5C6CA 1B35C 3IKWA 3IPVB 2LALA 4QPIB 2D7FA 5DUUA 3BCWA 4OHVA 3VBRB 4XJZA 3URFA 2D98A 1DGRN 3CF6E 4AFCA 1RUF3 1VJ2A 4YG3A 5BXXA 2XPJA 2V09A 2VW2A 2RR12 3AYDA 2DCZA 1ALYA 1V9U3 1W0OA 1QOOA 4LLFA 2ZA9A 2Q5TA 2Z5WA 5CFCA 1VBD1 1V6NA 3FFZA 4QMAA 4BH9A 1LENA 1RHI1 1O3QA 1H8TC 3AP6A 2XWJB 1I3HA 4MXWA 3AYEA 2UY8A 4KGGA 2YPJA 1ULCA 4QD2A 1YNAA 4XYXA 2B8MA 2C5DA 1AX2A 2DVDA 1LOBA 2CYFA 5LK5A 5CFCC 2GC1A 2XJPA 1YJKA 4EN8B 3LOIA 1BCXA 4MV2A 1J59A 1MR5A 1ASJ1 3IDEA 1CAUB 2FHRA 3B5LB 3ZFFC 3MFAA 5JOXA 1BK1A 1TME1 3J8F1 1X8MA 1OOPB 1VBD3 2IXKA 4YG6A 1RHI3 5D8AA 1OFNA 2DVBA 4BIFA 5IT6A 2VQAA 5IK7A 2VMIA 4WZFA 4YM1A 1RUC1 1J1TA 3PMSA 2W68A 1NA1A 1RVF2 3HBZA 4N43B 1Z7S1 2DFBA 3POYA 2VOXA 4MVTA 5BNPA 4ASLA 2ZCWA 2GH2A 1Y7BA 1NXD1 2A70A 2DU1A 1UCXA 1W39A 3GF6A 4WM8B 4YVSA 4TZDA 1MS0A 5KC5A 3TYJA 1PVC2 4GH4B 5D8AC 5GALA 1NCQC 4QU2A 2PFWA 1DGWA 1ASJ3 1FV2A 3UKTA 4P9LA 3KGLA 4MGIE 2PHDA 4IETA 4YGDA 1TME3 3J8F3 5EZWA 2DWRA 3VZOA 5FO8B 3UJQA 3ZXJA 1N3QA 3ZYPA 1RB8G 2WLPA 4L8QA 1UMZA 5L73A 1RUC3 4X6QB 4CYDA 1BEV1 3Q9OA 1UU5A 1V6KA 1DU3D 2D6LX 1Z7S3 4R9BA 4MSVA 3E5XA 1O91A 4AQTA 1R1A2 3E97A 2E7QA 4BYYA 2ZHMA 3HWJA 3AKPA 3VKOA 1REFA 4G3YC 4LBMA 4RQPB 5D1IA 3HT1A 1APNA 3AMQA 4RR3B 4YG0A 1AR72 3INAA 3WLUA 1TNFA 3CL1A 4Q4X2 3VBFB 1PK6B 1VBB2 3WG2A 4XXAA 4CEWC 2YHJA 1ZVFA 3TN91 1UD1A 3SCFA 3ME2A 2XUMA 1LRHA 4AFDA 4AVTA 4BOWA 1GICA 1BEV3 1G6NA 1HLCA 2Q1MA 1AL0G 1SQ4A 3U07A 2XLFA 1WW5A 4AG4A 4KL1A 1LHVA 5GLUA 4LEJA 1JUHA 5H9RA 1WLDA 4Q0PA 2XJSA 4GWMA 2WS92 4QQPA 3NV1A 5ABJA 5IK4A 2X5IB 2YC0A 4B7KA 3RPQA 3LWCA 3H7JA 2VOWA 4K1ZA 3CLPA 4XHXA 5AC91 3TN93 2OZ6A 5KXBA 3N35A 3WW4A 3NWKA 3ZIXA 1AL21 1KJLA 3LA2A 4ATFA 2NMNA 4QQLA 4MZUA 3NKTA 4WM7B 1AYM1 3QACA 5EYXA 1C8M1 5AVAA 1LCLA 5E88A 3ZFGC 2JG8B 4A7YA 3H8UA 3CJIA 3C3VA 1BZWA 5DZFA 1O7FA 4DB5A 2HEYF 3U4XA 1TQ5A 3N7KA 3E6CC 3BB6A 2VOVA 4IEPA 2ZBJA 4D94A 3RWNA 4XBQA 5AC93 5BNOC 2DVGA 4Y26A 4EWDA 3ZN6A 3ZSLA 2PQQA 4GKXA 2JG9A 1AL23 1YYNA 4S2GA 1MEC2 1LKNA 1O4TA 1GSLA 3P3PA 2ZX1A 4HN1A 4FPLA 4BPZA 4NPRA 1SCSA 1AYM3 5DUVA 2DCTA 1WW4A 1C8M3 1N1SA 3TNPB 2UWBA 4R8HA 1BBT1 4WVVA 1WMEA 4JRLA 4COVA 3DPRC 3MW4A 3UL2A 2ZHNA 2WZPP 2ZMKA 1QXPA 2RS12 2JG9C 2ZACA 1PNGA 4OHYA 1QNWA 1ND3C 1H9WA 1QJU1 4H3WA 4MYEA 4A7ZA 1HRV1 3JU9A 4C0HA 4CEYA 1RMU1 5BPXA 2D6NA 5J37A 3RQ0A 3QH6A 4Q8LA 2B9UA 4FQZA 3AYCA 2F4PA 2GNBA 4AGVA 4QPGB 3RMXA 4AHYA 1MZ6A 2V73A 1LGCA 1Q5OA 3MLLA 1BBT3 4CEYC 1M4WA 3JQWA 4K3UA 5JMCA 5F5QA 4AEKA 1FAYA 5KHKA 1NYWA 3VKLA 1ZA4A 3M7AA 4GULA 3UK9A 5BUVA 1ZRDA 2PHWA 2XJTA 2WQZC 4XQWA 5HCBA 1N3OA 1QJU3 1RUH1 4Q1PA 5F6KA 1KS5A 1LHOA 1HRV3 2VVFA 4FPFA 1RMU3 4IEVA 3WVJA 5I0SA 1H0BA 2A5ZA 2VY0A 3ZPYA 1SLIA 1KFXL 3B02A 1LOEA 4NN0A 3OD0A 2WLQA 3OGGA 3VDDA 4XQ4A 1VALA 2HEVF 2BFUL 3LAGA 1LOFA 1Z0HA 2ZMNA 4FTEA 4RHV1 1H2KA 1GYKA 1JN2P 2H6CA 4HPKB 1PO11 5DXDA 1ULGA 3M3IA 4AEDB 4J1XA 1YO8A 3ATGA 5JZGB 1LR5A 1G7YA 4E2SA 1X8EA 3KCCA 1IS6A 1RUH3 3V0AB 1U5YA 4XIKA 2FZ2A 4XQDA 4N9IA 1BQPA 1UW8A 4HL0A 2XKPA 4KU8A 1C4RA 5KHJA 1EY2A 1HXS2 4YW5A 1LOFC 1AZDA 1W6MA 5BNNC 2E7TA 4DXZA 1UN1A 4K40A 1DGRA 2QDNA 3JUUA 3MF6A 1FPN2 4YZ4A 5T3NA 2RJLA 1FXZA 3E6BA 4KG0A 5TSWA 4LUMA 5C9AA 2YYOA 4F7ZA 4CDWB 4K21A 2EA7A 5CBLA 1SBEA 2NN8A 4RHV3 4FTSA 2ZGRA 3FMGA 2JX9A 4L92A 1PO13 2GNMA 2GAUA 1COV2 3AMHA 3ZXAC 1DIWA 1YJLA 4CP1A 5JSRA 1S0GA 3GHMA 3B7MA 2H0VA 3DV8A 4Y1XA 1MVQA 3MFCA 3SLIA 2LTNA 1KJRA 5CVRA 5JI7A 4I3PA 1ZM1A 4XHBA 3TOJA 4YGEA 4P9JA 1W6OB 4YZ1A 3B00A 4WV8A 4IL7A 3HIFA 2PTMA 5F6LB 5L19A 1ZBE1 4E2QA 1RUF2 2GH8A 1TMF1 1QDOA 3HR9A 4PBOA 1VR3A 2EXHA 1SFNA 2VPVA 1V9U2 2UY9A 5HCFA 5SV5A 3CU7A 1NOVA 1MS5A 2HWC1 4GMP1 4AGRA 1FX5A 2WNUB 2ZGPA 1XNCA 1Q56A 2GU9A 4DRRA 1AR62 3RDIA 3MI8A 1RUNA 2RM21 4Y5Z0 5KBFA 1ULDA 1FATA 3ZFEB 1ENQA 4L11A 1W6NA 4OZXA 1FMD2 2CAUA 3KM5A 5IK5A 2ZGUA 4K8FA 4XF3A 4Y22B 1WLCA 1ZBE3 3VHRA 3WDUA 1TMF3 2XGXA 2D97A 1DFQA 4QQ2A 3J4UH 2GC2A 4HMZA 3VZMA 2ZGKA 1XU2A 4IEYA 4BE3A 4FPEA 5EJ3A 5A3LA 1PZ8A 4HN0A 1VBC2 4IEOA 1N3PA 1VBD2 5T5JA 4BLJA 1RHI2 1RITA 4LBNA 2HWC3 4GMP3 1D2SA 3KB5A 2D3SA 4L9BA 3THTA 4BQ1A 3ZXDA 1QOTA 3BPZA 4OVEA 4C90A 4F8AA 3WV6A 2C9AA 2R6QA 3NJZA 2RM23 4AYUA 4E4DX 5GZCA 1U12A 1N47A 1J3PA 2WINB 3O5SA 3PVBB 2IZWA 4YSFA 2QDRA 2JE9A 4XF1A 4KGQA 5A32B 4L99A 5JIUA 2D5FA 4JDMA 1C3HA 4R52A 3OJBA 1DQ0A 2XVKA 1GLHA 3WUCA 2QCSB 2WFF2 1TME2 2QVSB 1VB4A 3J8F2 4LE3A 2X8KA 3KGZA 1MZEA 2YZ4A 1SMVA 2A71A 2WL1A 4CDUA 4L2NA 2Z69A 2OIIA 2VQ0A 2R30A 4JGYC 4MX3A 1Z7S2 4AVAA 3TBDA 1F5FA 1QJY1 1VAKA 3S7EA 2YUEA 4YVWA 3NSTA 3B01A 1G9AA 4MUVA 3WINE 2EXIA 2HKXA 4OHWA 1NE4A 1X50A 2PAMA 1DF0A 1F31A 3VBOA 1IS3A 1CN1A 3RRDA 5CFDA 1EAH1 1A78A 5I8TA 5CFCB 2KXLA 3UKVA 4GIQA 4AEMA 5C4WC 4FPGA 1OLRA 1CJDA 1POV1 4MXWB 4Q8KA 1NQJA 2VW0A 3H9AA 4Y4YA 1DZRA 4K7JA 1S1AA 2W0XA 2IXLA 2D6PA 3JBG1 4JCKA 1BEV2 3VBOC 3EJKA 1SLAA 1UZZA 1WA4A 3ILFA 5CIRA 2BNMA 4QQOA 2GDFA 1QJY3 2ZGOA 2VH9A 3SMHA 2HWE1 3RYRA 2GMEA 2W52A 1H1IA 3FE5A 4HLTA 4RA0A 3E5UA 2Y0OA 1MS4A 1KD7A 3L2YA 1MS9A 4W6XA 1A3KA 3OGJA 4CDXA 1EAH3 1BJQA 2RMU2 5D8AB 3MZHA 2CY6A 1JUIA 1POV3 2EXJA 3VL9A 1NA1B 4OUMA 4Z92B 4RS5A 2A6WA 5JOZA 1AHSA 3VZJA 2D43A 3JBG3 2QZ3A 1KDMA 4PDWC 4OHZA 2GNDA 4Y1ZA 5BNPB 1R081 4RFT0 4I02A 4YVSB 3JCIA 2QKDA 2N7GA 4AW7A 4IEWA 1AR91 1GKBA 1SLLA 1K5MA 5LRRA 3CO2A 1XE8A 2HWE3 1LGNA 2PHLA 3VBSA 3WW3A 2LM3A 2R072 4CDQA 2VW1A 1BYHA 3HT2A 5LRSA 2A6YA 1NE6A 4RS5C 5FOBB 5FQ0A 1G9FA 1ND2A 1XNDA 5JI9A 2WA3A 2CV6A 4QT6A 2VUAA 3KD4A 4COZA 3I7DA 1N1YA 1LEDA 4NWWA 3MEPA 4KH9A 1DDLA 1XE7A 2D5HA 2OZJA 3MIEA 1MZ5A 1DZQA 2RJKA 1ENXA 3L9JT 4F83A 1LHUA 2DYCA 1NCRC 1AR81 5AC92 3PMEA 2WT0A 1H2NA 1AL22 1R083 4ZU7A 3AZVA 4ZKTB 4XFGA 4Z2WA 5EFUA 1AR93 2ATFA 4NVPA 1BMV1 1B35A 3IMNA 5H9PA 4CP2A 1C8M2 1GNHA 1YRZA 5C8WA 2YROA 1LOCA 1SACA 4OLLA 1XNBA 3W59A 1C57A 4JRAA 3ZXGA 4EWEA 1X33A 2GC0A 1WGPA 1RUE1 1HV0A 1CQ9A 1DHKB 3APBA 3WP6A 3N3HA 1S0BA 1AR83 1HQNA 1MS8A 4ZU5A 3ES4A 4WVMA 5SV8A 4JGZC 1H8TA 2A6VA 2DTWA 1LU2A 3SNMA 4FXGB 1Y9QA 1R1ZA 1BBT2 1S0JA 4LLOA 5KHHA 5ABJB 3MYXA 5I8SA 1W2UA 5K8SA 4M3CA 3PVEA 4I0AA 4E9KA 1W0PA 1MS1A 2R061 3IT8A 1RUE3 2DTYA 3IDBB 3VBUC 3ZSEA 1QJU2 1LODA 1Q8VA 4FOWA 4J1WA 2AH2A 3B94A 5JCTA 1RMU2 4NHKA 3D0SA 4HSJA 2Y0IA 3ZFFA 2JXAA 4KWJA 5C33A 2X29A 2NLRA 3QOPA 3AZWA 3WR0A 1HW5A 2IFRA 1AJKA 3NO8A 1YLLA 3CJIB 2CWSA 3NW4A 4I09A 1PGL2 3R05A 4IERA 3AP9A 3BALA 4KWKA 1LJ7A 1KDKA 3M1HA 1WW6A 4ITCA 1PO21 1RUI1 1AYN2 2R063 3FLRA 1NCQA 4UW4A 3VHPA 4MLOA 1RINA 4LBKA 3U10A 5JAXA 3ZN6B 4XTPA 3N7MA 5I93A 3LSDA 2SLIA 1A6CA 3AP7A 3OY8A 1UF2C 2XLGA 4FQ4A 3PJQA 3N7LA 3GNEA 4HKOA 4G4FA 4BWOA 2PLV1 2B46X 2PHRA 5I8YA 1B09A 3H3ZA 4RGAA 4DPNA 2E6VA 3M3EA 1AXZA 4RHV2 2GALA 1EP0A 2UURA 1PO12 2PA7A 3KT4A 3ZSKA 1LECA 3I2DA 4SBVA 5GJ6A 3W9AA 3DKWA 4AWDA 1PO23 1RUI3 1YHFA 4LO5B 4DY5A 4LNVA 3ASIA 1SBDA 2DFCA 2FQPA 4CEYB 5KHGA 3GZAA 4V1PA 3KCYA 1PGW1 2ET1A 3PTYA 1S2KA 4Q29A 2RS31 1RIRA 4EN7B 1DQ5A 2ZGMA 4BCUA 4CEWA 3B9IA 3LGRA 3IDCB 3G7DA 3WP3A 2HWF1 4LO6B 1ZRFA 2PLV3 5FDBA 1H1AA 4YW2A 1DBNA 5GLTA 4QGLA 1YFWA 2XL9A 5FO7B 3U11A 1CR7A 2ZPXA 2RHPA 4DNYA 3RI8A 4H7MA 1YXWA 3WDWA 1IQAA 4P5HA 4U36A 5BV6A 3V65A 1UU4A 3EXUA 3WG3A 2IC1A 2RS33 1ZBE2 4QHBA 2X53S 3WP4A 1TMF2 4GB31 3MPBA 1CGPA 1WUVA 2QUOA 3FZ3A 4XFCA 3VZKA 3VGIA 1Y3TA 4IXLA 3CNAA 3IM0A 3VDDB 2HWF3 4RL7A 4FOQA 3OCPA 1WMFA 3SISA 1YI9A 4LA2A 3AP4A 5K0UC 1H9PA 1TE1B 5GLZA 4BM8A 1HDKA 2HWC2 2PHXA 3IPVA 3HMYA 2GC3A 4JQRA 1RL3A 3KZ4C 1MQTB 3IBMA 2P37A 3ZFGA 4K1YA 4P9YA 1ZZCA 2RM22 2OA2A 1YUDA 3WXPA 1W6MB 5ACA1 4N90A 1ZNPA 2VUJA 2Q1ZB 5CAZA 1XXNA 3ENRA 4MXVA 4I2OA 3LZZA 4QX5A 5FPXA 4GALA 5I0TA 4GB33 4XFHA 3GALA 1NY71 4HZFA 3OYWA 5C9AB 1YCIA 4QPIC 5BNOA 1MACA 3E5QA 2VECA 3ZMOA 2PN5A 2DVAA 3SH4A 1ZZ8A 1WCSA 3PVNA 1C5HA 4AXOA 4DINB 4HK9A 4XFBA 2VXRA 3EQEA 5H9QA 4FAGA 4HT1T 4GA9A 3SHRA 3S0MA 3AJYA 3DPRA 4MGYE 1OQEA 1WMDA 1YIFA 4AVVA 2R32A 3H1MA 5ACA3 2PYTA 3USUA 2MHFA 1ND3A 1T6GC 1V6LA 3AJZA 1GQHA 2A7AA 4AI2A 3EO6A 4JVAA 5KHIA 2NZ9A 3ZYGA 4DFSA 1YI7A 5J7MA 4FP2A 4Q26A 1J3QA 2ZZJA 1VAMA 1GZ9A 3K51A 4FVVA 3SXWA 1V00A 3DF0A 4QXKA 4OI1A 4YZ2A 1QH7A 4Q1RA 1QJY2 2ZHLA 1W6NB 3O12A 3R6SA 4E4SA 1PZ7A 1ZX5A 3RG0A 1OOPC 4EN6B 1O5LA 3SH3A 3R4UA 3OD4A 4XZPA 3OTFA 4AFAA 3ALQA 4PJYA 4LO7A 3S7IA 4ASMB 2XJRA 3MIDA 4FOYA 4Q4Y1 4A3XA 2YXSA 4B8EA 2C0ZA 1GNZA 3IN9A 2B45X 1EAH2 2H0BA 4XJWA 2Z2SB 3I54A 1LU1A 4WM8C 1OA2A 2Q30A 1CPNA 3AZYA 1YFUA 2BPA2 4HK8A 2EF6A 2HYKA 1UPSA 1F2NA 1OSGA 3JBG2 1YFYA 3ZYIB 1ZZ6A 5KWRA 2ZGQA 4UXAA 3PHMA 1H1MA 2E51A 1QKQA 4YW4A 2D6MA 4C1XA 5BY5A 2I07B 4HVQA 4CZSA 5K9YA 2DUPA 2DUQA 3S6PA 3O7OA 3WNXA 1PGSA 2BQPA 1QDCA 1F9KA 5FAXA 4Q4Y3 5GLWA 5GKAC 3WW2A 1URXA 3BU7A 1ZBA1 3ES1A 1JYCA 1QHDA 2P3IA 3MF9A 5BNNA 2GMPA 5I91A 3MIGA 1H4HA 3VV1A 4CDUB 5H9SA 4F3JA 5GM0A 4RQPC 3ZDSA 1RVF1 1D4M2 2AUYA 4Y24A 2Z42A 4OHXA 1DQ6A 2A73B 4RR3C 3ZYRA 3UKNA 1X36A 1R082 4YVWB 1C1LA 4YW1A 5T50A 3GBFA 1G8WA 2XJVA 3LKJA 3VBFC 1AR92 1PK6C 3ZMNA 2ZGLA 1W6QA 4YM3A 3FUOA 4SLIA 5JSOA 3AFKA 3VBOB 2EIGA 2JDZA 1JHNA 5JLVA 4AE2A 5CFDB 4JC1A 1ZRRA 5FFOC 4HVRA 2ZJCA 3FX3A 1NLRA 1ZBA3 3LSEA 2PHUA 1DYKA 4LBQD 4IESA 2P17A 2IXCA 2VULA 5DZEA 3H7YA 1RTVA 3WQ0A 1RVF3 4FO9A 1QJX1 2EAKA 4FSJA 2DCKA 2HEWF 4Z82A 5CA6A 3PNAA 4Q4V1 5L36A 1LB2A 2G4IA 2X5IC 4YZ5A 2NYYA 4ATEA 1JOJA 1BMV2 1RUG1 2ZMLA 4Y1YA 2BBVA 2ZTNA 4Q4X1 4CDXB 1LHWA 3SH5A 1A8DA 3O0VA 5CU1A 5B2GB 4RS5B 1BKZA 1OKQA 1QJX3 4LBQA 1IPJA 3D5OA 4BLIA 1XQNA 4PLMA 3WCSA 4BA6A 4XJ8A 1K5MB 2AENA 4ZU4A 2OPKA 4Q4V3 4FTBA 5GZGA 3VBSB 1FOD1 4ISQA 1AXKA 4NWVA 2Q8OA 5E1RA 1GZWA 1Q43A 4YZ3A 4CDQB 5T5LA 1RUG3 3FUQA 2FBEA 1VB2A 4AQ6A 1QNYA 2WNVA 2AZ5A 5C8CA 1ENSA 4Q4X3 1ND2B 4M3CF 1I9RA 1Q8OA 2XJQA 2QZ2A 4JAAA 4AI3A 3NAPA 1NG0A 2R062 2B7YA 2FZ1A 3EBRA 4N7UA 2HWD1 3MICA 1J58A 1ULFA 4IEQA 4NOTA 1OQDA 4LHLA 3ILNA 3AXDA 1HIXA 5T54A 4MH0E 4XDQA 1XYPA 1CAXA 1POV0 2WNVC 5C8CC 1W6PA 2WSUA 5DDJ1 4PCRA 3T1LA 1B35B 4QQHA 4ES8A 2CNAA 3NAPC 1FOD3 3PLQA 4HETA 2HWB1 4JGYA 4XFFA 1ASJ2 4AFBA 2CAVA 4D7SA 3LA7A 1WW7A 2JICA 4GXLA 4QPGC 1PO22 3NV4A 3ELNA 4GWNA 2R0FA 1ZZBA 5J09A 1S55A 2HWD3 4UBHA 4LBJA 1MEC1 1RUC2 1GQGA 1WLWA 4MGKE 4FAHA 1CAVA 1LEMA 2K9ZA 4WVMB 5C4WA 1HX6A 1BXHA 5KXDA 1H8TB 5L7OA 4ISRA 1CVNA 4Q0QA 3WHTA 5DDJ3 3ZN5A 1G86A 3MIHA 4YLZA 4QGMA 5KXCA 2TNFA 4UW3A 4XPVA 2QQPA 2PLV2 5FRAA 2HWB3 1RJ7A 5FO9B 3AKQA 3JD71 4PIYA 1GBGA 4Q0SA 4AEDA 4M3CB 2RS51 5JIAA 2XKOA 3AK0A 2D3RA 3ECQA 1D0HA 3N36A 5L7OC 2ZX3A 4Q4W1 1FNYA 3V0AA 2H6BA 1V6MA 3ZIWA 3QD6A 4E4ZA 3ZFFB 3AMPA 1DG6A 4XBNA 4I0WB 3VKFC 1MEC3 1PGW2 3MIBA 1O4ZA 1CJPA 3VKMA 3IWZA 4AEDC 2RS32 1J1LA 2R49A 1V6JA 1ZRCA 5EWSA 5J3UA 4RGGA 2R1BA 3QH7A 3TWIA 2QFEA 2D44A 4H14A 2HWF2 4PDWA 2ZZQA 3QCWA 1OA3A 2BUKA 2GSYA 4XE9A 1O3RA 1KS4A 3JD73 4LT5A 2UU8A 2Z79A 2RS53 2BWAA 4YGBA 5E8AA 1R091 3K48A 3TRSB 4LE4A 1NCQB 5J98B 4G9SB 3A0KA 4Q4W3 4D7TA 1GR3A 4UW6A 3TN92 3DN7A 4CDWC 5CB7A 4Z8BA 1M06G 3H0OA 3RS6A 2WNEA 1VBE1 4AI1A 1DLLA 3ROUA 3V0BA 3OY8B 2BEOA 4K9SA 1O3SA 1MS3A 2CGPA 4PIXA 4GB32 1IHMA 1H8VA 1NCRA 4M3CE 2IXIA 3D6EA