2Q1MA

Crystal structure of human gitrl
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 18
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1mA00
4QQOA 1C3HA 4QQLA 2TUNA 3ALQA 1RJ7A 2QDNA 2KA3A 1PK6C 4HT1T 3V56A 4MXWB 3TWIA 1WCKA 2Z5WA 1O91A 3B94A 4D7YA 5TSWA 2Q1MA 2JG8B 1D0GA 2WNUC 3L9JT 3URFA 4DB5A 4KGGA 2WNVB 1D2QA 4GIQA 4TWTA 2RJLA 5CIRA 2ZJCA 4OULA 4KG8A 2WNUA 1OSGA 2RE9A 4QQ2A 3MI8A 3LKJA 2JG9A 4MXVA 4OUMA 2AZ5A 3QBQA 1S55A 1KXGA 4NN0A 1GR3A 1U5ZA 2ZPXA 3TYJA 1U5XA 2X29A 4G3YC 1U5YA 3K51A 1JTZX 1PK6A 5KC6A 3ME2A 1RJ8A 1I9RA 3FC0A 4F3JA 3B9IA 1A8MA 1DU3D 4E4DX 2TNFA 1OQDA 2JG8C 5KWRA 4OUSA 2R30A 2JG9B 1IQAA 5BNQA 2JG8A 5L36A 2Q8OA 5L19A 1C28A 3IT8A 4MSVA 1JH5A 1PK6B 1DG6A 4EN0A 2R32A 4QQPA 2O0OA 2HEVF 1ALYA 5KC5A 3QD6A 4DOUA 3WD5A 1D4VB 4QPYA 2R6QA 2QE3A 2RJKA 4G4FA 2WNUB 3AB0A 4MXWA 2OIIA 2WNVC 1OQEA 4J6GA 4N90A 1KD7A 2E7AA 1XU1A 2HEWF 4RSUA 4KGQA 4TSVA 1TNFA 2WNVA 1XU2A 3B93A 1TNRA 4QQHA 4E4SA 3K48A 2HEYF 5HBAA 2JG9C
chains in the Genus database with same CATH superfamily
1BMV1 4L92A 1W3XA 1WLTA 4QQOA 1AR91 1RUJ3 2P6CA 1OPMA 3BTAA 1NLSA 1QJY3 3TNQA 4DFSA 3LA3A 2AC1A 3ZFGB 4LBQB 4CCEA 4I09A 1H30A 1RUD2 1TG7A 2AR6A 4AF9A 4CDUA 3VKLA 4J1WA 4LTAA 4NPMA 2VE1A 4COYA 4MXWB 5DAVA 1V6KA 5EFUA 4OVEA 4YFWA 4XCBA 4CCDA 4GWIA 4E27A 5D8AB 4XF3A 3M1HA 3C7GA 2GMPA 3O1PA 3M70A 1NCRC 1ULCA 4ARXA 5FZKA 2DCJA 3URFA 5CYYA 2LW8A 2ZHMA 4P9LA 4YG6A 5F6LB 5IAVA 3T09A 4HPKA 3ZSEA 1KRIA 1GWMA 4Q4V3 2Q0AA 1PO23 5FZOB 1UOGA 1S0BA 3LA7A 2PHDA 2WQ8A 1OBNA 3OGRA 4LBOA 1KQRA 4ISRA 1DQ4A 2UYAA 5IVFA 1LOEA 4Q4X1 5FWJA 2JDUA 5CFDB 1A8DA 4B4RA 2FDHA 3VUOA 3R05A 1UY4A 4LR4A 4XQWA 5EJZB 1GP4A 3APBA 2FQPA 3HQXA 5FRAA 1LJ7A 5JUVA 2WAOA 3VHRA 2JE7A 2RS11 4LBLA 5JR2A 3OF1A 3VN4A 3M3OA 5LB6A 3LQCA 4LNVA 4CDQA 1XRUA 4D94A 1CAXA 1ULFA 4IW3A 2VZTA 2D6PA 2GP3A 5J36A 1NT0A 5FAXA 5A7QA 4AW7A 1FV3A 3O12A 4FXGB 3S57A 1EAH3 1RUD1 4WBBA 4FPEA 4AQSA 2WRAA 5K0UB 4E4DX 1NLQA 3BU0A 1NAEA 2PMWB 3VDDA 4FPOB 2BV4A 2ZGQA 1BBT2 3GHNA 3NW4A 1UZZA 1W2UA 4WM7C 3ZXLA 2V4VA 1YUDA 2ZTNA 3AKRA 3OCPA 5A6ZA 1WUVA 2UU8A 2ZX3A 3Q8AA 4MO3M 4Q4W2 4MGIE 1CONA 2ZKNA 2Y6HA 4P9GA 4YVSC 3U07A 5A3NA 4DNYA 5J96B 4LE3A 2QQUA 3OY8B 3ZSLA 1W6MA 1UMHA 4GH4B 4LHLA 3WXPA 1BQPA 1RUG2 1SLCA 3AZYA 1V70A 1DLLA 1Q56A 4NRMA 5ERLA 2XG3A 1XYPA 2GH8A 2JX9A 4HKWA 3AL6A 1CIYA 5IVBA 1HN0A 4JVAA 3W5NA 1WMXA 3HT1A 5FUNA 1MACA 5FPBA 5KR7A 3TOJA 3E1F1 3ES1A 5BNPA 3T1LA 1F15A 4AAPA 4MZUA 2PXJA 5JMOA 3GGLA 4QB6A 2WNUB 1NX9A 4BIOA 4ORFA 5LA9A 1TME1 4RS5C 3ZN5A 3I54A 2IUWA 3UV9A 2VW2A 3KV4A 5B4NA 4XCAA 4EZHA 4M3CF 2BVVA 4IE7A 2R062 1S0DA 1WBFA 4L2NA 1DQ0A 2BU9A 2EIGA 3SMHA 1WA6X 3AXEA 2D6KA 1FMD3 4NWWA 4XE9A 1MS4A 1RHI2 3P6BA 4XF1A 1U12A 1WLDA 4N53B 1NZCA 3DKWA 3NMBA 4ZONA 5FY8A 5IK5A 2R16A 3BGAA 2DCZA 1RUI2 2Y6FA 2ZGSA 3NNGA 1BBT1 3OJBA 1HLCA 4HFSA 3JB8A 1WMDA 1CAUB 1WLWA 2QQKA 5E6HA 4CDWC 4EQVA 4GZ9A 4XABA 5F7UA 2JKXA 3LIHA 4LHKA 3KF5A 3D8CA 1RJ7A 2HYKA 2Z42A 4LK6A 4Q4W1 4XBNA 3ZVXA 1PK6C 1BEV3 2VNOA 3VD3A 1VR3A 2Z69A 1JUHA 2HWD2 2MEV3 1VMHA 1LNSA 1RUG1 3GBWA 3ZXKA 3ITQA 4EYUA 1SLBA 4O61A 2ILMA 4RGAA 5FP3A 3WHUA 1OFSA 5SV5A 5FMOL 3AXDA 2H0VA 3EHKA 2E53A 2E26A 2OUHA 3IMMA 4M01A 4BPZA 4EE2A 5JDBA 4LIUA 2XLAA 1QJFA 4G9SB 2GC2A 2D5HA 1IS5A 1NCRA 1OLQA 2V72A 3NV4A 4YW6A 3UL2A 4DEQA 5IAXA 1DYOA 1OSGA 3HJRA 1A3KA 5T5JA 3MI8A 4HK9A 4XUNA 2XJUA 1WW6A 3PTRB 4BHPA 4BQWA 2WQ4A 2R061 1RUC3 3ZXAC 1JOJA 5GZDA 5F32A 3VKNA 2W2IA 3WT3A 2ARXA 2ZA9A 3MO4A 4JV4A 4TYSA 3MFAA 2CGNA 3ZN6B 1GNYA 4JCKA 4BB3A 3RZJA 1RHI1 1U5XA 4FQ4A 1PX3A 3JCIA 1U5YA 3HNMA 3PVBB 3R4DB 5DDJ1 3OBTA 4AGVA 1RUI1 4Q0QA 2VCAA 4C1WA 2VZ3A 3BCWA 4JC1A 3ACIA 3OB8A 5C8CC 2YZ4A 4AI9A 3WF0A 4CVUA 1ZBE3 2A6VA 1O5LA 4EN7B 4HL0A 4AYUA 2ZGKA 3ATGA 3M8LA 4NE9A 5FYTA 5GM0A 4QXBA 2HWD1 4HSJA 2YC4A 1W6QB 1W06A 3CHXA 2RM23 3SXWA 5FPUA 3ZXDA 4CXYA 1OA4A 2VXJA 4CEWC 3SH4A 1VJ2A 2D44A 3POYA 4QM9A 3IKWA 3AX4A 1B35C 1JHNA 5LY2A 3NQHA 2IZWA 5JI7A 5KHGA 4EV0A 1LAJA 2BFUS 1QMJA 4WM7A 5IK7A 3C7OA 3POEA 2VNGA 3OGGA 4HK8A 4YVSA 3RWKX 3K3NA 4TZDA 3LOBA 5EP9A 3BU7A 4OI0A 4HVRA 3OBRA 4AHZA 1JHJA 5E89A 2D3PA 4B4PA 3FBMA 1EYBA 2DV9A 3ZR5A 4AVCA 1LECA 3HD8B 3A0KA 4BMEA 1HQNA 4QXKA 4ET7A 2HWE3 2BERA 4OHXA 1LHUA 3WUCA 1XE0A 5JR7B 3AJYA 4LUKA 4M3CA 1OMIA 1QU0A 1ODNA 2D93A 4IEWA 1XE7A 4LBQD 3TN93 3SCFA 3WHTA 3FLPA 2WR9A 4N90A 5L73A 4XF0A 2ZABA 5IK4A 2LRPA 5BNNB 3BIEA 4GB33 2XR4A 4XQ4A 4BWOA 1NUKA 2CY6A 3ZX7A 1NQDA 4RS5A 1OOPB 3PURA 4PLOA 4Y1XA 1C8NA 3H1MA 4I0WB 4E4SA 3MW3A 1UZWA 3WNPA 4NO4A 5KXDA 5HBAA 1DQ6A 2EVXA 3Q8FA 2YFZA 4C0BA 2RMU2 4R4ZA 5L7OA 3DN7A 4HKLA 4OZOA 3U0ZA 2SLIA 1Q8PA 5C3RA 5C5UA 4BH9A 2WDBA 3LOIA 3ZIWA 5FR3A 1YCIA 1RUJ2 3VZMA 4BQ1A 2HYXA 1JZ3A 2Y6JA 5IT6A 1CAVA 1C8M3 2A6YA 2BQPA 4QB2A 4WZFA 4COZA 4ES8A 2GDFA 3M2MA 3W5MA 3A23A 3LA2A 1CQ9A 2A6WA 2XVLA 1HRI3 1XNAA 4Y5TA 1EPZA 3CKHA 2WO1A 3T0BA 5I0RA 5JAXA 4AHWA 1GP5A 3O0XA 1SLLA 2PLV3 3CZJA 3POFA 1PVC3 4Y1VA 5C7GA 3WP3A 4C0HA 4GMP1 1C57A 3USSA 4Q4V2 1N3PA 1PO22 2OPWA 3N9PA 4YZ1A 5FMOS 5F2WA 5DUWA 1GOHA 3V0AB 5K9YA 1WCQA 2D3SA 1AX0A 1H1MA 1FPN3 2WABA 1UOJA 2P1BA 2HWC3 1JI6A 2JG9A 3FL7A 2VMHA 1KS4A 1X8MA 5BNPB 5JPNB 4QXHA 2CL2A 4M4PA 3V64A 3ZMOA 4A7YA 4XJ9A 1OKOA 1QJX3 4QDSA 3RSJA 5I8SA 1JW6A 4P5YA 4AFMA 2RMU1 5EPAA 4YVWC 2QQMA 2RR13 3FHQA 4PQ9A 3WOGA 4GWJA 3AKTA 2ZGUA 2VOWA 3DUIA 1RUJ1 2OVUA 4DIQA 2UWAA 4UW3A 1S0FA 2VNVA 1UO9A 3MIGA 4HZFA 1EAH2 3KMHA 1F9KA 1RUF3 1HQLA 1W05A 1Y9MA 1J3RA 5C8CA 3HNYM 4P5HA 4NRQA 5FBJA 5GZCA 1HRV2 5FYIA 1MQTB 3NNMA 1VB2A 1CX1A 2E33A 2JD9A 4CUGA 2D3RA 4BLJA 4CU7A 2GC0A 5C3OA 2J1SA 4HLTA 3GJAA 2Q8OA 3TEXA 3BUCA 1AUYA 1ENSA 2V5YA 2NYYA 5HXMA 3H42B 1C28A 4QHOA 4Q4V1 1GU3A 1PO21 2VOTA 4CEWA 4YW1A 1TZOA 4LIVA 1AYM3 1Y43B 4OHVA 1F5JA 1B35A 3WQ0A 3WW3A 2K2SA 1OXCA 4HMZA 1X9TA 1DGWA 2K0GA 1NE6A 3N7KA 1E57A 2IC1A 4NOTA 3OOXA 1H1IA 1S2EA 5DAQA 2JDZA 3KV9A 3U14A 3AB0A 3ZPOA 3OGJA 1L7QA 1H8TC 2ZEYA 4IE6A 4M00A 4FTSA 4CA9A 1AR93 1QH7A 2XWJB 5GZGA 1GLHA 1UX7A 4Q5OA 4BIFA 5BYNA 2RDRA 3MPBA 1UCXA 4AXOA 3HNBM 3MIBA 4N43B 5BV6A 1D2SA 4YW2A 2BNMA 1DBNA 1KFXL 1F4AA 1W3VA 2EAAA 2P17A 3O14A 1JYVA 4P9YA 5JI9A 2W68A 1EAH1 2XWBB 4WV8A 1FMD2 3G6JB 3IDBB 4AWDA 3UKVA 4MUVA 5LBEA 3KS7A 1HRV1 2PAMA 3GBGA 4LK7A 5ANNA 1ACCA 2QQLA 4DXTA 3GCWA 1POV1 1W9SA 2W1QA 1QOSA 1ZZCA 3H7JA 2VOKA 3ZM8A 1JZ4A 2EIDA 4PIXA 4D8MA 3TEWA 1Q8VA 1VBD3 2XBO3 2PA7A 2YY1A 1DIWA 3TWIA 1WMFA 3CJIC 2UY8A 4QAWA 4BQ4A 3NV3A 4I3PA 5FYZA 2PHRA 4LA2A 5AVPA 5IATA 3U78A 4YGDA 3MLLA 1KDKA 2YGLA 1DDLA 1OH3A 4QHBA 3LAGA 3PUHA 4KGGA 4K21A 2VZSA 4B7KA 4KWJA 1GICA 3AMNA 2JICA 3GXUA 3ZYBA 1CESA 4YVSB 3EYPA 2IFWA 1HKDA 1NE4A 2XH6A 1M4WA 1TVGA 5FWEA 2JWPA 1YFUA 3RVHA 1QF3A 1ZRRA 1JXNA 2ZX2A 2W39A 4QX7A 2VQTA 3TAYA 1RB8G 1W6OA 2KD7A 1O3SA 2R073 4YM2A 2W1SA 3V65A 3VB9A 1YIPA 5FPZA 1FMD1 4M3CB 3TYJA 5J48A 2FDKA 1RGSA 3PUSA 3VKFC 1NCQC 4IGOA 2TBVA 5E1RA 1IHMA 5EHDA 2CWSA 2R49A 4OZXA 4JGYB 2QQIA 5HXVA 3ZIXA 4RS5B 4AR2A 5LEKA 3LF7A 4I30A 4NPRA 2XLFA 1ZBE2 4YVWA 4AVVA 4D7TA 1AZDA 2X5IC 4KWUA 4K20A 2YMZA 4Y4RA 1HN1A 2D43A 4QX8A 3O0WA 3ZSKA 1O59A 5KWRA 3DEMA 4W6XA 5FY4A 4BQYA 5EYXA 4KNCA 1ST8A 3OG2A 3GZUC 4XOGA 4CU8A 5JSRA 2CV6A 3A21A 5D2AA 2FDFA 2QQOA 1CAVB 2YFUA 4DZGA 2J1UA 5IYYA 4CDWB 1GBGA 1I5ZA 1TME3 2AEZA 4FOQA 1PMJX 4Y20A 5EIYB 2IXLA 1W6NA 3EB7A 3IT8A 1QDCA 4PLNA 5DQ0A 1PK6B 3T2PA 3IPVB 4OMDA 5JIUA 4BE3A 2O0OA 3SH5A 1UYYA 3BODA 3FHIB 1ULOA 5CISA 3ZFGA 4LBQA 2WL1A 4XFIA 3J8F3 1AVBA 2VD7A 3PHMA 5E8AA 1W39A 2P3IA 4LPLA 2FZ2A 5AFBA 5GALA 2HWE2 3O0VA 4MXWA 2ET1A 5A7SA 3WNXA 1OQEA 1BK0A 4KQ7A 1O3RA 4BQ2A 2E7AA 4S2FA 1AR62 3BVCA 4DMIA 1UMZA 5FYMA 3PIJA 5FZ7A 1ND3C 3AKPA 1TQ5A 1HJFA 1ZBE1 4XIKA 1AJKA 2WT0A 4JHTA 4RA0A 3UGFA 3WINE 1F5FA 4R9BA 4AQ2A 5FTTC 4CEYB 2B7YA 5DAPA 3CF6E 4B4QA 2YBPA 4UOJA 4BYYA 5A7WB 4UW4A 1C3HA 4TLGA 5GLWA 5BXXA 1X8EA 4QDQA 5CFDA 2TUNA 1DGRN 4EWEA 1YFWA 2QDNA 2YBKA 3TEZA 2ZX0A 2KA3A 5BNOC 3O1OA 1Y9GA 2VUCA 1C8M2 2VVDA 3E5QA 3R4UA 4NUBA 5IFTA 3EQEA 4FPCA 3POGA 2P2KA 3JUUA 1PMHX 5LA0A 3ROUA 2AGSA 2R063 1HRI2 1VE0A 1O3QA 2J1RA 2WN2A 4FP3A 2OS2A 5A3WA 3I3EA 3HT2A 3THTA 3CJIA 4A3ZA 2VZVA 2PLV2 3B7MA 3JB4C 5LA2A 1PVC2 4MGTA 1QKQA 5CVRA 2W1WA 4FPKA 3HPNA 2XPJA 3GZEA 3B00A 4CE8A 5IVCA 2HWE1 1RUI3 4OULA 1DLCA 3NSTA 4ZXKA 3WX5A 4GD4A 1FPN2 1RITA 4Y5SA 2HWC2 3FBYA 1AR61 2AZ5A 4NIIA 3QH6A 4XC9A 1IS4A 2XVGA 4CCOA 4FP2A 2HWD3 3OY8A 3KWVA 2ZPXA 1QJX2 2YPJA 3HVDA 5FUPA 3U4SA 5F37A 1J84A 1O4YA 3H8XA 4FFIA 3ZYIB 5KXCA 4LKEA 4MVTA 1W9WA 2RR12 3OUHA 3NNFA 1ZNPA 3Q8EA 4FOWA 5FXZA 1RJ8A 5C71A 5LW9A 2ZEZA 4KWLA 2AUYA 4LEJA 3IB3A 2OKXA 4CZSA 3U37A 3C8XA 1ENXA 4N9IA 1GZWA 1C8M1 5BNNC 1RUF2 1B09A 2TNFA 1F4HA 4P9WA 4K8RB 1HDKA 3ZO0B 2D7FA 2GNDA 5LCWL 4PI2A 1HRI1 3WDYA 4K8FA 1IQAA 2C9AA 4XQDA 3NV2A 2FDGA 1GZ9A 1V6MA 5K4LA 4RN5A 1W9FA 1V6NA 5L19A 2PLV1 2E7TA 5A7NA 1PVC1 4FPLA 4OHWA 2IWGB 4W4ZA 1RXGA 5FDBA 1W8TA 4OMCA 1CZTA 3ILNA 4XILA 3MDPA 3KHBA 4YW5A 1AYM2 2G19A 4PIZA 1OKQA 1T6GC 1UPSA 1FPN1 4A3XA 4F8AA 4E8CA 4NHKA 2JDHA 2HWC1 3WF2A 4BCUA 2VR4A 2Y34A 3K75B 3WQ1A 3AM2A 4XJZA 5IVJA 1LOBA 1TEIA 2V5DA 2WZPP 2J1TA 2D5FA 2YB7A 1T6BX 4G4FA 5CKNA 5FMCA 1QJX1 3KCCA 1ULDA 1FNYA 4BZ4A 1SLIA 4OHYA 3H3LA 1OFNA 1DZQA 1JUIA 2RR11 2KR2A 2O1QA 5JXGA 3B5LB 4EZ4A 1W6OB 1XU1A 4XJAA 2GSYA 5F6KA 3U11A 3C2UA 2F17A 3A4UA 2QBXA 1LENA 5FCCA 1TNRA 1QJEA 4PLMA 4S2HA 4FPFA 5KXEA 3CO2A 2HEYF 1QNWA 4NR1A 1RUF1 2C6SA 2QUOA 2JDPA 4QGLA 4QB1A 2JDKA 4WVZA 2CGPA 3KGZA 1MEC3 2HBTA 2Y0OA 4XZPA 4Q0VA 4IEOA 3WG4A 4LULA 1I6XA 4QU2A 3N9NA 1ZRCA 1LGCA 3RS6A 4UF0A 1HB1A 2XONA 3ZN6A 4V2VA 4ZPIA 1VBD2 1N47A 1PVXA 3KV5A 2J1EA 2XBO2 1LHWA 3I4IA 4LBMA 3J4UH 5EJ3A 3LEMA 2VZPA 1AYM1 2ARCA 4A44A 5FZ4A 4KH9A 5K7PA 2FHRA 3T0DA 4NHMA 1YI7A 4DB5A 1D2QA 2YU1A 4KI5M 3ON7A 5FZBA 3PVNA 3N7MA 3B02A 5IK8A 4H14A 5JXIA 1DYKA 1W6QA 5EXOA 3C7EA 3BB6A 4JTNA 4AEDC 3POBA 2ZX4A 4MYEA 3AYEA 4NHYA 3VZOA 5L9RA 2YHJA 2OPKA 4FXKB 4BJ0A 2R072 1ZVFA 4LKSA 3ACFA 4NN0A 1HIXA 5F3IA 1J59A 1U5ZA 4CUBA 3WW4A 2J1VA 2RHPA 4FTBA 3ZXFA 3SC7X 1OD5A 1RMU3 1GQPA 2FDJA 2JB4A 4LLOA 1D4M3 4QXCA 4ZKTB 2VZ1A 2W3JA 1JYIA 1H8TB 2XUMA 1LRHA 4DS0A 3FC0A 1XSRA 1A8MA 4AL9A 4BLIA 1GV9A 4N43C 4HETA 3I2OA 2DYCA 1VBD1 5FYVA 2UURA 4BA6A 2XBO1 3M3CA 5J98B 4LKFA 1AF9A 3WNMA 2LS6A 3CMGA 3HOBA 4Z07A 5BNNA 5JLVA 3O7OA 4BK4A 2B39A 3I97A 1ZA7A 4LUMA 5ISLA 3MPPG 1OOPA 1Z7S2 1S2KA 1CGPA 3DKQA 3O1TA 1TME2 1LOCA 2BDRA 3AKQA 1ZZ8A 4XFAA 5I0SA 5FOJB 3LE0A 4AQ6A 3BI3A 3RGBA 5FY7A 4W8JA 4XJWA 2Y6GA 1LGBA 2DCYA 3RNSA 3VZLA 4Q8KA 5ABJC 3CJIB 1X36A 1ZBA3 2EXHA 4KBZA 4UFLA 1V6OA 5G04L 3J7NA 4YYOA 1OPOA 3RWNA 2E31A 1UW8A 4FQZA 2R071 4YARA 3J8F2 4E8DA 2QTWB 1D7PM 4IERA 4LXLA 2R6QA 4QHZA 4QPYA 1JZ6A 2PYTA 1YQ8A 2AH2A 2ZBJA 5F3CA 1HRV3 3WP5A 3LCPA 4MOAA 5CB7A 3JXSA 1YI9A 3GBFA 2GN3A 4XHXA 1POV3 2GNMA 3KD4A 1MZ6A 1OI6A 2XKOA 1UD1A 2HWB3 1UKRA 3PUAA 5CAZA 2CGOA 3I59B 1MVQA 2WNOA 2WINB 1L7LA 1WW7A 5IFPA 3VL9A 1J58A 4XUTA 1UY1A 4XACA 1OLMA 1LGNA 5KHHA 1MVEA 1ZZ9A 3V0AA 2UY9A 3NKGA 4DUVA 1XOYA 2DWRA 2Q8EA 3WUDA 2DVGA 2CHHA 2ZGLA 3WNKA 1NCQB 1GZWB 2ZS6B 2GC3A 1Z7S1 5BPXA 2JE8A 4JGYC 1OT5A 3MUY1 2E63A 2D6MA 2VCMA 3AFGA 3CBNA 4RQPC 4CP1A 5LZ6A 3SH3A 4ZU7A 1G9BA 4NWVA 3EJKA 2Z5WA 3VLBB 3T08A 2X5IB 5KXBA 4Y1UA 3PLQA 1ZX5A 1VBE3 2ZAAA 1UU4A 3OD4A 5F3GA 2BW8A 1OC1A 1YC61 4FI9A 2BNNA 3J8F1 4IEZA 2ZHLA 4LJHA 4OLLA 5T52A 3H8RA 2K46A 2ZHNA 4OQ8A 5DG1A 1LHOA 3ZYGA 4D3WA 1MQTA 1MS3A 1REFA 4URTA 4XAAA 1N1TA 2WZEA 4CCNA 2A7AA 3O1MA 4AAXA 4ZU4A 3U10A 4OFGA 3UT0A 2VMIA 3ELNA 5LK5A 4AEDA 2JDMA 2VTXJ 1HJGA 1X7NA 4LMFA 4WZCA 1WA4A 1K5JA 2IXIA 2D98A 2ZZQA 1EY2A 3NL1A 4GMP0 1NOVA 4IGPA 2RJ2A 3K3OA 2R1DA 1NY72 4PI0A 4UFMA 1I3HA 2W47A 3HQUA 4ARYA 5C3SA 1YJLA 3AKSA 5C3QA 5FO9B 1AJOA 4GWMA 1SG3A 3ZXEA 1OUXA 2X09A 1GP6A 1H6YA 5A1LA 2W91A 3AK0A 4WVWA 1G86A 5LK7B 1N3QA 2XJRA 1BK1A 4LO8A 5FKBA 4NIDA 1ND3B 4NIGA 3E6BA 4L9BA 1FT9A 4LOSA 4WVMB 5F5IA 4IXLA 2PTMA 4OUSA 2Z79A 5GLUA 3UGGA 4HVQA 3VBSC 3WF3A 1Y4WA 3BTXA 1F2NA 5GZEA 4N43A 4CEYC 1NLRA 1ZYBA 3VZJA 4UF0B 2A3XA 3RRDA 3ZN4A 1PMIA 2XHKA 4CP0A 4AFAA 2IXHA 3DYOA 2GALA 3VZNA 3OBAA 2LROA 1GNZA 3CDZB 1JOPA 5BNOB 3E97A 4UWDA 1DG6A 2VQUA 3KGLA 2ZMNA 5FYYA 2R32A 1FOD3 2PAKA 4PDWC 1S0EA 3ZXGA 3KCXA 4K9SA 5A1AA 1C1LA 1ZA4A 4JKKA 1ODMA 3WDWA 2AENA 4KWKA 3I8TA 2QE3A 5A33B 3ZPYA 4OUEA 3VBRC 4H55A 5ABJA 4A4AA 3AMMA 3POIA 4J6GA 1NY71 4QPIC 4QKNA 3B9CA 1CAWB 1ND2B 2RG4A 2VBBA 3NKTA 4K3UA 3B69A 5A7OA 2MPFA 2W95A 1I1EA 4QPGC 1O4TA 1VBB3 2JD4A 2UWCA 5HCAA 3AMHA 1XJAA 4YGBA 4CRQA 5I93A 3J26N 3IDEA 3FX3A 3HWJA 1GMMA 3BIWE 3MF6A 1UAIA 4V2WA 3NAPC 3CNAA 1MEC2 1UIKA 3J7LA 1AX2A 3PU8A 3LGRA 4BXFA 1U0AA 5J3UA 1JU4A 3QLQA 3IBMA 1LU2A 3VZKA 1CX4A 2Y6KA 3SISA 4CU9A 1AR63 1VBC2 2LALA 3FMGA 5CBLA 3CIHA 2Y26A 4AEMA 4Y24A 1WKYA 1KEXA 4JGYA 5DXDA 2B5HA 1POV0 3HIFA 1AXZA 2VZQA 1W8HA 1O7FA 2RJLA 2PFWA 4QX5A 3RJRA 2PAEA 2OQ6A 1CZVA 1UN1A 4IEYA 4XIOA 3AYDA 1FNZA 3LEKA 3PJQA 4KG8A 3BTYA 4XBLA 2RE9A 1DP0A 4BU2A 5FZ0A 2CYFA 1KJLA 3RZZA 4R9DA 1NA1C 3DF0A 4GWNA 2VXRA 3FWEA 3WDTA 5FZLA 4XXAA 2BEOA 4CDWA 2I07B 1ULGA 4IV3C 1RMU2 1GKBA 2FCUA 5FZEA 3TRSB 1J1TA 3K51A 4BXSV 4IQPA 1D4M2 1PK6A 3IPVA 3UGHA 3FZ3A 2OYZA 1LOFC 2QJVA 3WG3A 3S7EA 2HBUA 2NPIA 2BPA2 1US3A 1MEC1 4AOCA 4YGCA 4F3JA 1CR7A 5C4WC 1BVP1 3B9IA 4QMAA 4CCJA 2XJVA 1AYN3 2XQXA 1XNTA 5IVYA 2WKKA 4X8NA 5AFEA 3I3DA 2VMDA 2C9KA 4XFHA 5GLVA 1LB2A 5F8PA 1BVVA 2R0HA 5FP7A 4QX0A 4YGEA 5I8TA 1VBC1 4AFDA 5C6CA 3ZDSA 1HB3A 4YZ3A 1R1A3 4FOYA 2RDNA 1COV2 2ZEXA 5A32A 3RDIA 3RZLA 1EV12 5AVAA 2B46X 3WZ1A 1QY4A 4GJYA 5EZWA 3VBSA 1IPKA 4RYDA 4RGGA 4YW7A 2DBIA 4ATFA 5FIXA 4CEYA 3V0BA 2G9GA 4MGKE 1UOFA 3D0SA 2GNBA 1CWPA 3HMYA 4NHXA 4QQPA 5A7WA 2SBAA 1ZBA2 4IETA 4E2SA 4AHXA 5FZ1A 4XBQA 1VMFA 3PUIA 1ULPA 4PJYA 4QPWA 1W90A 1J3QA 1UZVA 2ZGMA 4GKYA 4PDWA 1RMU1 3MV01 2XL9A 4A7ZA 3UYJA 3KZ4C 4KU7A 2VQAA 1D4M1 3THCA 3MZHA 5ACA3 1RUH2 1LTEA 3LD8A 4LQRA 1W0OA 3BOPA 3E5UA 1W99A 2AYHA 2HWB2 4GQ7A 4AEDB 3RYRA 5LBBA 1JOBA 2YG0A 3WW1A 3NNJA 4QPIA 4JDNA 3RG0A 3VKMA 5FV3A 4XDPA 1S1AA 2YXSA 5DG2A 1OVPA 4YWAA 3EO6A 2ERFA 1QXPA 2VTXA 1PM7A 4LO7A 4Q1RA 3CL1A 4N7IA 4QPGA 3F2ZA 4A42A 2ZGPA 1PNFA 1SFYA 2EF6A 2WNEA 2YUEA 5JVVA 4DXSA 2BNOA 3E6DA 3I2IA 4AGRA 3FE5A 5FKCA 4PIYA 5CFCC 1COV1 3GZAA 4BQ5A 2DUQA 1DGRA 1EV11 5F1RA 1FX5A 2WYSA 3NAPA 3WW2A 1YQCA 5FZ6A 4QWNA 2V09A 1POQA 3MV11 1WCKA 2X05A 1UY3A 1X9PA 3QCWA 5ANQA 1STMA 2HKXA 2WBKA 2WZR2 3PJYA 1VBE2 1ZBA1 3P1IA 4R52A 3T2QA 1JS9A 3E6CC 4Q4Y2 1GNHA 4WM8C 3LSDA 3ACHA 4N7UA 1YFYA 1OF3A 3OSDA 3RI9A 4ZZ8A 4W50A 3H3ZA 1QQP3 2V4AA 3N35A 1XNCA 2QVSB 5HPOA 3N9OA 1RUH1 4ASMB 3U75A 5T5LA 4JRAA 2ZAHA 1C4RA 2HWB1 1SBFA 5A70A 1BHGA 4YPJA 2ID4A 2VW0A 5ABJB 1WBLA 2D6NA 4K40A 2A1XA 1WCDJ 2BOJA 3ZLIA 5JXJA 4MHRA 4G3YC 3ZYJB 1NA1A 2P3KA 3NJXA 1W03A 4CP2A 2OUJA 1I5PA 2FMYA 1DFQA 2JXAA 4BM8A 1KS5A 2BWCA 1Z78A 4M0NA 4XJ8A 1A6CA 3SEPA 5FK7A 4FFGA 3ZSMA 4O7XA 4YSFA 4TXWA 3ES4A 2XMLA 3GCXA 1LOFA 1DU3D 5G05L 1PGL2 2AACA 1JYXA 3RPQA 4YZ2A 1UYZA 4W6YA 2JIJA 5A3LA 5C4WA 4A41A 3D82A 4GAZA 3BPZA 3ORJA 4N8MA 1R64A 4BISA 1ZRFA 3ZFFC 2YDEA 1ZZBA 4FPYA 4JQTA 1YQ2A 1N3OA 2WZR1 4XMIA 3LSEA 1VBE1 1G7YA 1Q8SA 1UMIA 4LO4B 5L9VA 4Q4Y1 3AZXA 4XJUA 4AI0A 5FREA 4MGQA 3SKJE 1HB4A 4CP9A 4UFKA 4EN0A 3LIGA 3I2GA 1H9WA 3FLTA 1FOD2 2ZGTA 2DVBA 1W8NA 3LB9A 4RQPB 4PT6A 5FO8B 3WP4A 4AVTA 5JOZA 4IDZA 3ZYPA 1RUOA 1SFNA 1QDOA 3T2OA 1QNYA 3GDBA 2ZMKA 4BMBA 5BY5A 3H1YA 4X6RB 3VBHC 2OZ6A 3B3QE 1BJQA 2VMEA 3MIDA 4ZY9A 1R1ZA 1AL23 1Z7S3 3BYWA 5JOWA 2NP0A 4PHZA 3Q8BA 1WMEA 1WD3A 3S6PA 1VBB2 3K48A 1X50A 2EIBA 1U5IA 2DTWA 3ZSJA 1GQGA 4A6OA 1PGL1 4L99A 4L8QA 3DYPA 5DDJ2 1SZBA 4I0AA 4LO5B 1DQ2A 2YYOA 3DL3A 4PBPA 1YQ6A 2Y33A 1Q5OA 3D3AA 3JD72 2F6BA 2XGXA 4FCAA 4HBNA 4IESA 1MZEA 4PF1A 3IAPA 4Y22B 5LRSA 3ACGA 1DHKB 1VB4A 1YYNA 3SHRA 1DYPA 3WF4A 5HV4A 1OQ1A 4K6BA 1E5HA 1XBFA 2NMNA 3SNMA 3S7IA 3V56A 2Y38A 4YFZA 2A71A 1PZ8A 2AEYA 3LFIA 5CFCA 1UX6A 2Y60A 3B94A 4CUCA 4LHNA 1YLLA 5A3OA 3WEZA 1IKQA 5A32B 1FOD1 1H8TA 1WZXA 5FP9A 1G9FA 1D0GA 4MX3A 3QOPA 3WDUA 5C9AC 3NJYA 4Y1ZA 3VBSB 2VAUA 4ASLA 4H7MA 1QOOA 2Y0IA 4XMAA 5JPMB 2X8KA 3V0BB 2HWF2 1J1LA 1K45A 5FLHA 3UJQA 3VD7A 4X6QB 2NQYA 4Q26A 1TE1B 4D69A 2YU2A 3N9QA 2VW1A 5CEHA 3H50A 1MS0A 2A3WA 2YGMA 3JQXA 4WM8A 5FZAA 4TN7A 3VHNA 4CXXA 3MICA 1KXGA 3CU7A 4YM0A 4JDOA 5SV8A 4PDWB 3ZDVA 1VBB1 2Q1FA 2XHNA 1Q3EA 2ET7A 2WQZC 1BXHA 2UYBA 2W94A 4IEQA 2A75A 3D6EA 1LEMA 1IG3A 4MLOA 3VBRB 4AI2A 5CU1A 2JB8A 3JD71 4AVBA 5KHJA 1OHFA 3M3QA 4KG0A 4E2GA 4QPIB 3HN3A 2ZACA 3OYWA 1AYN2 2W92A 4ZU5A 3VV1A 1ND2C 2W08A 1YHFA 4RGKA 3VBOB 4RFRB 5FYBA 1SACA 3J7HA 4QPGB 5BUVA 4S2DA 1SPPB 2V73A 5DZFA 1UU6A 3O5SA 1R1A2 5DPNA 2Z2SB 3I59A 3PL0A 3NAPB 2DBNA 4DINB 1JYWA 3L2YA 5FPXA 2B9UA 5KHIA 4QKBA 5CZKA 1IOAA 1DF0A 2HWF1 4PBOA 3ZFFA 3KVBA 1MS8A 2O14A 1JBCA 4HXCA 4I3GA 5IVVA 4NVPA 1ALYA 1SDDB 2X10A 1K5MB 1VIWB 1Y7BA 2BUKA 5I91A 5IVEA 1NCQA 3DPRC 4C90A 3WD5A 5F9TA 2VCBA 3VDBA 2RJKA 2A73B 2VM9A 3F95A 1GYKA 4NJ4A 4AFCA 4DQAA 3AP4A 4DRVA 4Y5Z0 1MPXA 1PIV2 3T3YA 4Q0SA 1AX1A 2I74A 2W87A 1KGYA 2CDOA 4NRPA 2X5IA 5ACA2 3D0JA 4XDOA 5KBFA 2J42A 4UBHA 4CTEA 4CPBA 3WNLA 4FSJA 2DDUA 1XU2A 3WR0A 4RHV3 1AYN1 5FPVA 3P3PA 3UJOA 3VBHA 1K42A 2RV9A 3KQRA 1NA1B 3AP5A 4YZ5A 4DY3A 4XF9A 2VQ0A 4KBBA 2WS93 4QD2A 3SQOA 3WDXA 3RZGA 1VMJA 3N9LA 3GHMA 4GJZA 4IV3B 5FYUA 1PX4A 4FTEA 2EXIA 3P5BA 1QEXA 3NRUA 5M0TA 1R1A1 3ZMNA 1XE8A 2H6BA 3ACLA 1UZ0A 1RINA 3CLPA 3INAA 5IJRA 3K4AA 3OEBA 1CD3G 2OZJA 3LDBA 3K2OA 4MGYE 2B42B 5FXWA 4AVSA 5C4WB 4R9CA 4CDUB 5LBCA 2C4XA 4H2AA 4O9GA 3OGSA 3RYPA 4URAA 1UKGA 2JKBA 2IXCA 3RZKA 1DQ1A 4AQTA 2IXJA 1S0CA 1LU1A 1W2TA 5FP4A 2E6VA 5FZ8A 5GLZA 3RMYA 5DUXA 3VDDC 4TWTA 1UYPA 1CJPA 2A70A 5FYCA 2W46A 2CWMA 3GNEA 4GXLA 4CP9B 1VAKA 3WG2A 4FBFA 1CPMA 1ND3A 2DF7A 2EAKA 4LA3A 4WVMA 3OGVA 1PIV1 4DUXA 4DEVA 4F7ZA 1PO12 2VUDA 1CVNA 3LEIA 4DUWA 1QQP2 1FV2A 4FVVA 3ZYHA 5FZDA 1ZM1A 5JCTA 3GALA 5ACA1 2XJTA 4EROA 3GYDA 4RR3C 3BKZA 4TTGA 5A7PA 4I01A 1GR3A 2P5BA 4MH0E 2KXLA 2Q8DA 1VBC3 2X29A 4GALA 5HCFA 3SKVA 1EUTA 2PELA 1SDWA 3N3HA 2WFF3 2GZWA 5BNOA 3RZMA 1DZTA 1V0AA 2W9XA 1S4CA 2DU1A 3IDCB 4MV2A 5A3PA 4IEPA 2I2SA 2JEMA 5LASA 1QXRA 3UK9A 3ETQA 1OUSA 2JDNA 3MGUA 4K1ZA 1IZ3A 4B29A 5A33A 2Y6LA 1DGWX 4P14A 4CCCA 1SLAA 5FPAA 2YBSA 2RDQA 2RDSA 2WZ8A 3ZYFA 4AK3A 5A6XA 1LOGA 3ZXJA 5K8SA 3S5AA 1YO8A 2XJSA 1CAWA 1ND2A 3B01A 5LA1A 2P3YA 1QJU3 5D1IA 1Y9QA 4Y4YA 2WWUA 5LRRA 5L36A 5CNAA 1NYWA 5DZEA 4UBGA 4FO9A 5CFCB 2VUAA 3FFQA 3I7DA 1GWKA 1H2NA 2EALA 3AZWA 3ZFEC 2C1FA 1PO11 4JDMA 1V00A 4CDXB 1QQP1 2L9LA 3QD6A 2ORZA 2C26A 2R7EB 4ONUA 3WNOA 2WA3A 2XOMA 3POSA 3JU9A 1LODA 1WWYA 3WG1A 3KF3A 2WO7A 4QKFA 4M4RA 5T54A 2PHXA 2FCTA 2BGCA 3KVAA 4E4HA 4Y3OA 2C0ZA 4R4XA 2H0BA 4HANA 4UXAA 3DPRA 4WM8B 4XFFA 4YM1A 3VDAA 5CA6A 1JZ2A 5HCHA 1COV3 1FAYA 1JYCA 1KD7A 2JE9A 3SITA 4AEJA 3RZHA 1EV13 4XYXA 3WY6A 1QHDA 2N7GA 5GZFA 3VDCA 3A7QA 5FK8A 4DRRA 1AL22 3BOWA 3ZKUA 4QQHA 4YW3A 5FZCA 3VBFC 2GN7A 3ZYRA 3FHAA 2VUJA 1AXKA 3MIHA 3NWKA 3PNAA 4O9EA 3EBRA 4XW3A 2CSGA 2PN5A 5AC91 2WUHA 1D0HA 2C5DA 3LPFA 4Y1YA 2OT7A 4HN1A 2JENA 2VU9A 4EN6B 3UNPA 3ZR6A 3OYWB 1WCUA 2BTVC 1C5IA 3WV6A 2HH9A 5C33A 3U4XA 4HT1T 1VBA3 1EUUA 4KU8A 4XVHA 2I45A 1GOFA 1UF2C 1W8WA 3R6SA 3G7DA 4JGZB 1RUH3 2P3JA 4OI1A 4JX0A 1S0IA 3KQ4B 1KITA 1W8ZA 1E5IA 2Q1MA 2XXZA 4IGQA 1J83A 1OVSA 2PHLA 2WO2A 1AR73 3L9JT 3PMEA 5FZGA 4XXPA 3RMXA 4AHYA 2WSVA 2WNVB 2Q5TA 5HI0A 3A0NA 3JQWA 4W65A 3ZFFB 5CIRA 4FFHA 1W9YA 1VRH3 2DVAA 3EMRA 1ZZ7A 2X53S 4JKMA 1H8VA 1SBDA 1WGPA 3C7HA 1M06G 5B2GB 2BFUL 4FPHA 2VVFA 4NAMA 3IIIA 4HG6B 1LOAA 2JECA 3WQBA 1AL21 2P34A 1L3JA 4EWAA 4I02A 3JBG2 4YRDA 1REEA 1MZ5A 4FFFA 4RR3A 1JTZX 2E51A 3T4VA 1UIJA 3WF1A 3DECA 4E9KA 1Q43A 2WZR3 4YLZA 1OA2A 4MADA 3BALA 2ENRA 5KHKA 2MHFA 2NN8A 4XF4A 4Q4Y3 5C3PA 2QQNA 3T2TA 1MR5A 3VBHB 4C91A 3JZVA 5T3NA 2F4LA 5FFOC 3POJA 4BOWA 2DCTA 5F5AA 4COVA 5IUQA 1OQDA 3I2KA 4P9JA 2ORXA 2RS33 4D0QA 5A6YA 1S2BA 1JZ8A 1Q8QA 4Y33A 3I2FA 3T4HB 5FLIA 1GWLA 2B9VA 2DFBA 3IAQA 4XUQA 3AMPA 4HN0A 2VGDA 1W8OA 2GH2A 1O8SA 3NO8A 3UKNA 4S2GA 5L7OC 4MGSA 5AC93 5FQ0A 3RQ0A 4YM3A 1WW5A 2ZKLA 1S0JA 4UT5A 1XNKA 1V6IA 5J37A 4I2OA 2HEVF 2WLPA 2ZZJA 5F3EA 2ATFA 2WT1A 4HONA 1LKNA 1VAMA 4NMIA 2PHTA 4XAEA 3IZOA 2RVAA 3ZFEA 1FXZA 5DUUA 4HVOA 1R092 2CAVA 3AC0A 3PUQA 4Z92B 1LR5A 2QFEA 5DABA 5C9AB 4OHZA 2ZHKA 1O5UA 2R1BA 3JBG1 4QX2A 5FO7B 3MBWA 2ARAA 4E2QA 4BDVB 4XFCA 2HEWF 2VBDA 1XNBA 3DXTA 3R0RA 4RSUA 2XLGA 4XHBA 3AVSA 4LOTA 1HW5A 3B93A 2VC9A 3GZTB 4RHV2 5FYHA 2XUEA 2E32A 1S0GA 2JG9C 4ZS2A 4R8HA 1HV1A 2BBAA 3P3NA 4Y26A 1UYXA 2WS92 1QXJA 4JQRA 4YW4A 3VBFA 3AZZA 5FXXA 4BQXA 5HV0A 3PVOA 3GJBA 3ECQA 1Z0HA 5A3UA 3E5XA 1IPSA 3MLJA 4COUA 3ZKYA 4XZUG 1AHSA 2D97A 2PHWA 4D6QA 1V6LA 3PTYA 5I0DA 1V9U3 2B8MA 4P08A 4UFJA 4D7SA 4PF5A 3LEGA 4QKDA 4IE4A 2RS53 1WW4A 2ZMLA 5CKQA 2R042 3PMSA 5A6QA 1R083 1YQ5A 3VBOC 2QQJA 2TEPA 2Q4SA 2VULA 4C1XA 5JOYA 2BJSA 1JYTA 5A1FA 1O6UA 3PVEA 4IV1C 1UQXA 2BGPA 1R091 2W1UA 2ES3A 1AXYA 2VECA 1H2LA 4AE2A 2ZX1A 3JD73 4QQ2A 2A5ZA 3CZUA 2PHFA 4DXZA 3RJ2X 3MIEA 4ES9A 1XPWA 5FZIA 3QBQA 4CCKA 1S55A 4QGNA 2OW4A 5FY0A 3VKOA 5E88A 2QQVA 2GMEA 4QM8A 4RHV1 3M7AA 3AP7A 4HSLA 1WD4A 1K5MC 5FY5A 3DPRB 4LBNA 4DXRA 3BTZA 1EPWA 3H8OA 1HXS3 2BRTA 2WFF2 3LPGA 1CJDA 4OI4A 2ETEA 2WS91 2WSUA 3MYXA 4LBJA 1REDA 3KT7A 3MF9A 5DAWA 3ME2A 1QJZA 1LCLA 4RQPA 3THDA 4QX3A 1I9RA 3GM8A 3I3MA 2LUWA 1NZIA 2OQ7A 2WN3A 1H6XA 1H4HA 2HWF3 3FJSA 3LZZA 4SLIA 4HPKB 4SBVA 2VMFA 5J1XA 1W2AX 1W6PA 2QCSB 5H9PA 2Q1ZB 3FFZA 2JG8C 5JMCA 1V6JA 1GFF2 1C5HA 3RI8A 3HQRA 3W58A 1LEDA 2Y64A 3UKTA 2VPVA 2W52A 1QJU2 4B1LA 4TLFA 2BWAA 2R041 3J7MA 2ZOEB 5LBFA 4LKDA 4BQ3A 4Z8BA 1F8VA 4D6SA 2XVKA 1YJKA 4PQQA 4RFT0 2ZGRA 4XFGA 5JZGC 5HCBA 4OQ9A 2J7MA 1PHMA 3CQOA 3MHZA 3K4ZA 5H9RA 4ZHNA 3ENRA 3H1WA 5GJ6A 3PIGA 1JH5A 4CCLA 1VLNA 3VBUC 4NIHA 4CDQB 1CAXB 5JXHA 2DVDA 4UFIA 2G4IA 4MGZE 3KB5A 4YG3A 2GAUA 1YWKA 4CDUC 5FJHA 2PQSA 4DOUA 4Y22A 2XB6C 1QJY2 3Q9OA 2WWJA 3TBDA 3DCQA 4AI8A 1RTVA 3WNNA 3O1RA 4Q8LA 2BZDA 1BZWA 3VDDB 1OA3A 4Q27A 3WCRA 1GZCA 1OH4A 2WFF1 3VL8A 2DTYA 2WWSA 2A6ZA 3R4SA 4BK5A 4LITA 3N4MA 4KGQA 3WQ7A 4XEZA 3MEPA 4CXWA 2JDAA 1YIFA 1VPHA 4META 1GANA 1O8PA 1W6MB 1XNDA 5F5QA 1SHWB 3OD0A 4UYBA 1H1AA 4RR3B 4XUOA 5C70A 2JIGA 2MNGA 3ST7A 1N1SA 2ZEWA 4O65A 3UETA 1XSQA 2NM1A 1H2MA 1W8FA 4CYDA 3MW2A 3DXUA 1RUE3 5JWPA 4QQLA 5L9BA 1W04A 1YFXA 1PZ7A 2DURA 1QJU1 2QNKA 3N7JA 4J25A 4J1XA 4Q0PA 4CU6A 1OURA 2A6XA 5JSPA 1BYHA 1VBA2 1P8JA 1PIV3 1RVF3 1OLRA 1ASJ3 1WLCA 1TMF3 4AVAA 1WCSA 2ZXQA 4LORA 4DO0A 3NV1A 3FN9A 3VBRA 2VJXA 2H6CA 2LTNA 5TSWA 2YV8A 5C5TA 1DCSA 1QWRA 1AR72 2VZRA 3IMNA 5F2SA 1QJY1 5FQ0B 1NG0A 4Z1VA 1L7RA 1QH6A 2ZJCA 3DGTA 3LDKA 1HV0A 4RD7A 1K12A 5DAXA 1VRH2 5DUVA 1RC6A 4ASKA 4LO6B 4CPBD 3VBOA 1AR83 5LWBA 1PGSA 4A6SA 1GSLA 4AZZA 2Y8KA 3LKJA 1SPPA 1ZRIA 4IV1A 4EWDA 4OUMA 5T5PA 3OEAA 3MW4A 3ZFEB 2WLQA 3DYMA 3MUZ1 2DUPA 2G9ZA 1SBEA 2PHUA 4CDXC 4D6RA 3SLIA 3AJZA 3AYAA 4COWA 1KJRA 1UXZA 1PNGA 2FMDA 3H3UA 3TB0A 4YZ4A 3ZFGC 2CAUA 4LBKA 5GKAC 1GZTA 3W59A 3C3VA 1MS9A 1UWWA 1K5MA 4IEUA 5T50A 4JKLA 1ZREA 3BN6A 3LDRA 1IQDC 1ENQA 1Q8OA 2B45X 5D8AC 3L2HA 3KT1A 5A80A 1VBA1 4XTPA 1NCRB 2UWBA 1PO13 1SCSA 2RS32 2EIEA 3VBFB 2ADEA 4AI1A 4ZZ5A 1SLTA 2CDPA 2R30A 2IVJA 5I0TA 5FY1A 3VD9A 3O1SA 4A45A 4CSWA 1UNBA 4L11A 5BNQA 2VO5A 2ZGNA 1VAVA 3KSCA 5FMDA 3IN9A 3KLSA 1AR71 2JG8A 4YG0A 1YRZA 3ETPA 1XYNA 3N36A 4GA9A 2BYVE 1AL0G 1BLZA 1KFUL 3D4KA 5AC92 1CPNA 1XYOA 4FPJA 1VRH1 4U2AA 1CZSA 1LESA 5CFDC 3KV6A 2IXKA 5FPLA 3ASIA 3LFMA 4EJRA 4IV3A 4B8EA 2YC0A 3QH7A 3AZVA 3I2JA 5C8WA 4V1PA 5JZGA 5KC5A 3TEYA 2W0XA 3OUIA 1YXWA 4JGZC 4XFBA 5FP8A 1UY2A 3NNLA 3WSOA 4Z82A 3VBUA 2DVFA 2VMGA 3RFRA 2GMMA 1UL9A 1BEV2 4UI9L 1DZRA 1G6NA 2OIIA 2MEV2 4H7LA 4Q1PA 5GLTA 5IW0A 2WNVC 4B1MA 4C8DA 1G9DA 2GU9A 2AREA 1YNAA 4Q4X3 2QQPA 1IS3A 3ILFA 3OBZA 3M3EA 3T1MA 4E4ZA 4QU1A 3U1XA 5K0UC 1JZ5A 1RIRA 1CN1A 2P4EA 3Q8CA 2VL4A 3IM0A 3CJXA 4P9XA 4XUPA 4EN8B 1W9TA 2P6HA 1RYYA 1W8UA 2EA7A 1HB2A 1GQHA 3IDAA 2CTVA 1YEWA 5FUIA 2RS13 3RYKA 5H9SA 5CADA 5FOBB 4WM7B 3HN1A 1O3TA 2VH9A 2ARBA 4XPVA 3S0MA 3ILRA 2RS31 1QOTA 1QIQA 1H9PA 2DFCA 3OTFA 2VOVA 3AFKA 3OPZA 3VD5A 3O1VA 4K1YA 3HBKA 1OF4A 5CKMA 1UOBA 4GH4C 3N9MA 3THPA 4XURA 3ALQA 5E16A 1RUD3 1RUC2 3DV8A 3H0OA 4XDQA 1W6PB 3S30A 1FI2A 2VMCA 4IE0A 1SCRA 1FYUA 3D5OA 3MLKA 3QACA 1F35A 5FY9A 5FZ9A 1IG0A 1V9U2 4AG4A 5FLJA 4FAGA 4AI3A 1O4ZA 3PU3A 4FT8A 3M3IA 1O91A 4OI2A 4D7YA 4B7EA 5EJ1B 2RS52 4JZRA 1LULA 1VP6A 2WNUC 3PDQA 1R082 3WCSA 4AFBA 4IL7A 2BOIA 4JTOA 3FLRA 3K77A 3J9SA 4Z2AA 2W5FA 1JODA 1NXMA 4IEXA 1BEV1 5J7MA 2MEV1 3OUJA 5L7OB 3H8UA 4L0PA 2RM22 4XETA 4NROA 2WFPA 1HX6A 2DUOA 4N53C 4L97A 5B4XA 5JIAA 2VG9A 2XL7A 1VALA 3WVJA 3K46A 1OLME 1XXNA 4FPGA 4YNIA 2GNTA 3USUA 4H3WA 1N1VA 5D21A 1HXS2 2QQWA 5FYSA 3HBZA 3TNPB 4QT6A 4CDXA 5KC6A 3O1UA 5CG9A 1H4GA 1X82A 2WIIB 5EWSA 2XJPA 4PCRA 2VY0A 2Z4FA 4JHZA 2NLRA 1ULEA 5EYYA 1RUC1 3I3BA 4KMQA 3T30A 5JSOA 4IEVA 2FZ1A 5FZFA 2HLEA 4KL1A 4CUAA 1IPJA 1V9U1 4Q2FA 3AYCA 2O8OA 2WC2A 1BBT3 1NQJA 3KM5A 5D8AA 3OPWA 2JG9B 2RS51 3KT4A 3TN92 3UESA 1APNA 4B3NA 3W9AA 4Q4W3 2VTFA 5IHRA 2C24A 1R081 1GUIA 1URXA 2BP6A 1UU5A 2VBPA 3M4FA 4GB32 5H9QA 3W21A 1SMVA 4Q29A 5T5OA 3JBG3 1RUG3 2XQRA 4OYUA 1UXXX 5FZMA 5DN2A 5FZHA 4MSVA 1G9AA 1JMUB 4INDA 4MG2A 5FZOA 1H2KA 1IKPA 4I0BA 3CEWA 2O8QA 4W6WA 4LLFA 3K4DA 3POWA 1SQ4A 2RM21 1W0PA 1SFPA 1RXFA 4HOOA 1JN2P 1W0NA 3FUOA 1US2A 1D4VB 3A22A 2WYFA 4OCTA 4GULA 1X33A 4QX1A 3S5QA 3SCGA 3WDVA 5C8CB 5EV7A 4JGZA 1G9CA 1HXS1 4IV1B 4K7JA 5JOXA 1LHNA 2E9QA 2BVBA 3SEEA 1UZYA 3VHOA 1W2OA 5EQUA 1QGLA 1XQNA 2WNVA 1JU3A 1RHI3 5FXVA 4CEWB 5K0UA 4DY5A 4NAOA 4P9IA 5DDJ3 3VGIA 2GC1A 2R0FA 1A78A 4A2UA 1B35B 3VD4A 5IWFA 1RUE2 2K9ZA 4Q0UA 3TN91 3NVCA 2D6OX 2YPDA 5LATA 2B4KA 2ADDA 2FBEA 3N7LA 3X29B 3IWZA 1R093 4GB31 5T55A 3W20A 3MIFA 3IIAA 2QKDA 5FMBA 2VZOA 1RVF2 4JRLA 4RL7A 2G9FA 4GH4A 1ASJ2 1IGOA 1TMF2 1MS1A 1PGW2 2OA2A 2XDVA 1DQ5A 4IE5A 2P37A 1Y3TA 3I2DA 1BCXA 2J1AA 3I3QA 2JG8B 2WO3A 3HEIA 4UW6A 2Q8CA 3KHCA 4NHLA 1EP0A 3EXUA 3GF6A 4NPLA 3T0AA 1MZFA 1N1YA 1PM4A 2WAAA 4GIQA 1UY0A 5DZGA 4UW5A 4LHSA 4F83A 1A34A 5LY1A 5DMYA 3SCHA 2WNUA 1DGLA 2D6LX 1AR82 4M0HA 4HKOA 1ENRA 2E7QA 5JZGB 4FOVA 2Q30A 1OOPC 3AP6A 4NIAA 4MXVA 2PQQA 1F31A 1FATA 3AMQA 3VBUB 1ZZ6A 1XB9A 2D40A 4CDQC 2YROA 3ABZA 2KM2A 2XKPA 4A7KA 1IS6A 2BGOA 5APAA 5I0UA 1MS5A 3ZOIA 1HQWA 3KCYA 2WA4A 1RUNA 1JYNA 4WVVA 4N53A 2R043 4JAAA 4N9HA 1LHVA 1BKZA 1J3PA 1RUE1 2IFRA 3HR9A 2FCVA 4XTMA 2VCCA 2XJQA 4ISQA 4X8PA 1CAUA 3H7YA 2FDIA 2JJ6A 3NJVA 4GKXA 5A3MA 1H0BA 3H9AA 3OPTA 4M3CE 1SEFA 4ATEA 3NJZA 4LE4A 1RVF1 2EXJA 5C9AA 2G1MA 1ASJ1 1TMF1 2JDYA 5FJKA 1RL3A 1PGW1 1BMV2 4P02B 1XC6A 3WLUA 1AR92 2J22A 4ZS3A 1C1FA 2WJSA 4ITCA 5FBZA 1PZ9A 2OX0A 1ONAA 2VVEA 4P00B 2YC2A 4LT5A 3MFCA 3FUQA 2EXKA 1VRBA 3BPSA 2ZCWA 1W2NA 2HJIA 4FAHA 3I49A 2OXBA 1GOGA 5J09A 2QZ2A 2CU5A 5F39A 2VOXA 2DU0A 2ZGOA 3AP9A 5F5CA 5BNPC 4DPNA 5A3TA 1AR81 5I8YA 2BBVA 2IVIB 1K3IA 2VNRA 2WT2A 1JZ7A 1G8WA 2VZUA 4UAPA 4MHUA 4R9AA 1W28A 1CIWA 2EICA 4QGMA 1UPIA 4YVWB 3AL5A 5FZ3A 4GMP3 4AEKA 2QZ3A 3LWCA 5LEJA 4CCMA 1NXD1 4QDRA 2FD8A 3I2HA 4U36A 3AVRA 4Z2WA 1KDMA 4Q4X2 1ZRDA 1NKGA 2CNAA 3C7FA 4EN9B 2LM3A 1E5SA 3VHPA 1T2XA 4IUGA 1TNFA 4TSVA 1E5RA 3HAGA 4ZXEA 4AGGA 5CG8A 2NZ9A 1MQTC 4Y20B 2NMOA 2F4PA 1W6NB 2A3YA 2RS12 2GP5A 3USUB 3WP6A 2DCKA 2RMU3 4UFHA 2QDRA 1OD3A
chains in the Genus database with same CATH topology
1BMV1 4L92A 1WLTA 4QQOA 1AR91 1RUJ3 1OPMA 3BTAA 1NLSA 1QJY3 3TNQA 4DFSA 3LA3A 3ZFGB 4LBQB 4I09A 1H30A 1RUD2 2AR6A 4AF9A 3VKLA 4J1WA 4LTAA 4COYA 4MXWB 1V6KA 5EFUA 4OVEA 4YFWA 4E27A 5D8AB 4XF3A 3M1HA 2GMPA 3M70A 1NCRC 1ULCA 2DCJA 3URFA 4P9LA 2ZHMA 4YG6A 5F6LB 4HPKA 3ZSEA 1KRIA 4Q4V3 2Q0AA 1PO23 1S0BA 3LA7A 2PHDA 4LBOA 1KQRA 4ISRA 1DQ4A 2UYAA 1LOEA 4Q4X1 5CFDB 1A8DA 4B4RA 3VUOA 3R05A 4LR4A 4XQWA 3APBA 2FQPA 3HQXA 5FRAA 1LJ7A 3VHRA 2JE7A 2RS11 4LBLA 3OF1A 3VN4A 3M3OA 4LNVA 4CDQA 1XRUA 4D94A 1CAXA 1ULFA 2D6PA 5J36A 5FAXA 4AW7A 1FV3A 3O12A 4FXGB 1EAH3 1RUD1 4WBBA 4FPEA 4AQSA 5K0UB 4E4DX 3VDDA 4FPOB 2ZGQA 1BBT2 3GHNA 3NW4A 1UZZA 1W2UA 4WM7C 3ZXLA 2ZTNA 1YUDA 3OCPA 3AKRA 1WUVA 2UU8A 2ZX3A 4Q4W2 4MGIE 1CONA 2ZKNA 4YVSC 4P9GA 3U07A 4DNYA 5J96B 4LE3A 3OY8B 3ZSLA 1W6MA 3WXPA 4GH4B 4LHLA 1M06G 1BQPA 1RUG2 1SLCA 3AZYA 1V70A 1DLLA 1Q56A 4FTSA 2XG3A 1XYPA 2GH8A 2JX9A 4HKWA 4JVAA 3HT1A 1MACA 3TOJA 3ES1A 5BNPA 3T1LA 4MZUA 2WNUB 4BIOA 4ORFA 3ZN5A 1TME1 4RS5C 3I54A 3UV9A 2VW2A 4M3CF 2BVVA 2R062 1S0DA 1WBFA 4L2NA 1DQ0A 2EIGA 3SMHA 3AXEA 2D6KA 1FMD3 4NWWA 4XE9A 1MS4A 1RHI2 4XF1A 1U12A 1WLDA 4N53B 1NZCA 3DKWA 5IK5A 2R16A 5DDJ2 2DCZA 1RUI2 2ZGSA 3OJBA 1BBT1 1HLCA 4HFSA 3JB8A 1WMDA 1CAUB 1WLWA 4CDWC 4LHKA 3D8CA 1RJ7A 2HYKA 2Z42A 4Q4W1 3ZVXA 4XBNA 1PK6C 1BEV3 2VNOA 1VR3A 2Z69A 1JUHA 2HWD2 2MEV3 3GBWA 1RUG1 3ZXKA 1SLBA 2ILMA 4RGAA 3WHUA 1OFSA 5SV5A 5FMOL 3AXDA 2H0VA 3EHKA 2E53A 2OUHA 4BPZA 4M01A 5JDBA 2XLAA 4G9SB 2GC2A 2D5HA 1IS5A 1NCRA 1OLQA 3NV4A 3UL2A 1OSGA 1A3KA 5T5JA 3MI8A 4HK9A 2XJUA 1WW6A 4BHPA 2WQ4A 2R061 1RUC3 3ZXAC 1JOJA 5GZDA 3VKNA 3WT3A 2ARXA 2ZA9A 4JV4A 4TYSA 3MFAA 2CGNA 3ZN6B 4JCKA 1RHI1 1U5XA 4FQ4A 3JCIA 1U5YA 3PVBB 3R4DB 5DDJ1 3OBTA 4AGVA 1RUI1 4Q0QA 4C1WA 3BCWA 4JC1A 5C8CC 2YZ4A 1ZBE3 2A6VA 1O5LA 4EN7B 4HL0A 4AYUA 2ZGKA 3ATGA 3M8LA 5GM0A 2HWD1 4HSJA 1W6QB 2RM23 3SXWA 3ZXDA 1OA4A 4CEWC 3SH4A 1VJ2A 2D44A 3POYA 4QM9A 3IKWA 3AX4A 1B35C 1JHNA 5KHGA 5JI7A 2IZWA 4EV0A 2BFUS 1QMJA 4WM7A 5IK7A 2VNGA 3OGGA 4HK8A 4YVSA 4TZDA 3LOBA 3BU7A 4OI0A 4HVRA 3OBRA 4AHZA 5E89A 2D3PA 4B4PA 3FBMA 1EYBA 2DV9A 4AVCA 1LECA 3HD8B 3A0KA 4BMEA 1HQNA 4QXKA 2HWE3 4OHXA 1LHUA 3WUCA 5JR7B 3AJYA 4LUKA 4M3CA 1OMIA 1QU0A 2D93A 4IEWA 4LBQD 1XE7A 3TN93 3SCFA 3WHTA 3FLPA 4N90A 5L73A 4XF0A 2ZABA 5IK4A 5BNNB 4GB33 4XQ4A 4BWOA 2CY6A 3ZX7A 1NQDA 4RS5A 1OOPB 4PLOA 4Y1XA 1C8NA 3H1MA 4I0WB 4E4SA 3MW3A 5KXDA 4NO4A 5HBAA 1DQ6A 2EVXA 4C0BA 2RMU2 4R4ZA 5L7OA 3DN7A 4HKLA 3U0ZA 2SLIA 1Q8PA 4BH9A 3LOIA 3ZIWA 1YCIA 1RUJ2 3VZMA 4BQ1A 5IT6A 1CAVA 1C8M3 2A6YA 2BQPA 4WZFA 4COZA 4ES8A 2GDFA 3M2MA 3LA2A 1CQ9A 2A6WA 2XVLA 1HRI3 1EPZA 5I0RA 5JAXA 4AHWA 3O0XA 1SLLA 2PLV3 4Y1VA 1PVC3 3WP3A 4C0HA 4GMP1 1C57A 3USSA 4Q4V2 1N3PA 1PO22 4YZ1A 5FMOS 5DUWA 3V0AB 5K9YA 2D3SA 1AX0A 1H1MA 1FPN3 2HWC3 2JG9A 2VMHA 1KS4A 1X8MA 5BNPB 5JPNB 2CL2A 3V64A 3ZMOA 4A7YA 4XJ9A 1QJX3 3RSJA 5I8SA 1JW6A 4AFMA 2RMU1 4YVWC 2RR13 4PQ9A 3WOGA 3AKTA 2ZGUA 2VOWA 3DUIA 1RUJ1 2OVUA 2UWAA 4UW3A 1S0FA 3MIGA 4HZFA 1EAH2 3KMHA 1F9KA 1RUF3 1HQLA 1J3RA 5C8CA 4P5HA 5GZCA 1HRV2 1MQTB 1VB2A 2D3RA 4BLJA 2GC0A 4HLTA 2Q8OA 1AUYA 1ENSA 2V5YA 2NYYA 1C28A 4Q4V1 1PO21 4CEWA 4YW1A 1AYM3 1Y43B 4OHVA 1F5JA 1B35A 3WQ0A 3WW3A 2K2SA 4HMZA 1DGWA 2K0GA 1NE6A 3N7KA 1E57A 2IC1A 4NOTA 1H1IA 2JDZA 3AB0A 3OGJA 1H8TC 4M00A 1AR93 1QH7A 2XWJB 5GZGA 1GLHA 4BIFA 5BYNA 3MPBA 1UCXA 4AXOA 4N43B 3MIBA 5BV6A 1D2SA 4YW2A 2BNMA 1DBNA 1KFXL 2EAAA 3O14A 2P17A 4P9YA 5JI9A 2W68A 1EAH1 2XWBB 4WV8A 1FMD2 3G6JB 3IDBB 4AWDA 3UKVA 4MUVA 3KS7A 1HRV1 2PAMA 3GBGA 1POV1 1QOSA 1ZZCA 3H7JA 2VOKA 4PIXA 1Q8VA 1VBD3 2XBO3 2PA7A 2YY1A 1DIWA 3TWIA 1WMFA 3CJIC 2UY8A 3NV3A 4I3PA 2PHRA 4LA2A 5AVPA 4YGDA 3MLLA 1KDKA 2YGLA 1DDLA 4QHBA 3LAGA 4KGGA 4K21A 4B7KA 4KWJA 1GICA 3AMNA 2JICA 1CESA 4YVSB 2XH6A 1HKDA 1NE4A 2IFWA 1M4WA 1YFUA 1QF3A 1ZRRA 1JXNA 2ZX2A 2W39A 3TAYA 1RB8G 1W6OA 1O3SA 2R073 4YM2A 3V65A 1YIPA 5FPZA 1FMD1 4M3CB 3TYJA 5J48A 1RGSA 3VKFC 1NCQC 2TBVA 5E1RA 1IHMA 2CWSA 2R49A 4OZXA 4JGYB 5HXVA 3ZIXA 4RS5B 5LEKA 4I30A 4NPRA 2XLFA 1ZBE2 4YVWA 4AVVA 4D7TA 1AZDA 2X5IC 4K20A 2YMZA 3ZSKA 2D43A 5KWRA 3O0WA 4W6XA 5EYXA 4KNCA 5JSRA 3GZUC 4XOGA 2CV6A 1CAVB 4DZGA 4CDWB 1GBGA 1I5ZA 1TME3 4FOQA 4Y20A 2IXLA 1W6NA 3IT8A 1QDCA 4PLNA 1PK6B 3IPVB 5JIUA 4BE3A 2O0OA 3SH5A 3BODA 3FHIB 3ZFGA 4LBQA 2WL1A 4XFIA 3J8F3 1AVBA 3PHMA 5E8AA 1W39A 2P3IA 2FZ2A 5AFBA 5GALA 2HWE2 3O0VA 4MXWA 2ET1A 3WNXA 1OQEA 4KQ7A 1O3RA 2E7AA 4S2FA 1AR62 4DMIA 1UMZA 1ND3C 3AKPA 1TQ5A 1ZBE1 4XIKA 1AJKA 2WT0A 4RA0A 3WINE 1F5FA 4R9BA 4AQ2A 5FTTC 4CEYB 2B7YA 3CF6E 4B4QA 4BYYA 4UW4A 1C3HA 5GLWA 5BXXA 1X8EA 5CFDA 2TUNA 1DGRN 4EWEA 1YFWA 2QDNA 2ZX0A 2KA3A 5BNOC 3R4UA 1C8M2 2VVDA 3E5QA 3EQEA 4FPCA 2P2KA 3JUUA 3ROUA 2AGSA 2R063 1HRI2 1O3QA 4FP3A 3HT2A 3THTA 3CJIA 3JB4C 2PLV2 3B7MA 1PVC2 1QKQA 5CVRA 4FPKA 2XPJA 3B00A 2HWE1 1RUI3 4OULA 3NSTA 4ZXKA 3WX5A 1FPN2 1RITA 2HWC2 3FBYA 1AR61 2AZ5A 3QH6A 1IS4A 2XVGA 4FP2A 2HWD3 3OY8A 2ZPXA 1QJX2 2YPJA 1O4YA 3ZYIB 5KXCA 4MVTA 2RR12 1ZNPA 4FOWA 1RJ8A 4KWLA 4LEJA 2AUYA 4CZSA 1ENXA 4N9IA 1GZWA 1C8M1 5BNNC 1RUF2 1B09A 2TNFA 4P9WA 3ZO0B 1HDKA 2D7FA 2GNDA 1HRI1 3WDYA 4K8FA 1IQAA 2C9AA 4XQDA 3NV2A 1GZ9A 1V6MA 1V6NA 5L19A 2PLV1 2E7TA 1PVC1 4FPLA 4OHWA 2IWGB 5FDBA 3ILNA 4XILA 3MDPA 1AYM2 4PIZA 1OKQA 1T6GC 1UPSA 1FPN1 4A3XA 4F8AA 4NHKA 2HWC1 4BCUA 3WQ1A 3AM2A 4XJZA 1LOBA 1TEIA 2WZPP 2D5FA 4G4FA 1QJX1 3KCCA 1ULDA 1FNYA 4BZ4A 1SLIA 4OHYA 1OFNA 1DZQA 1JUIA 2RR11 2O1QA 3B5LB 1W6OB 1XU1A 4XJAA 2GSYA 5F6KA 3U11A 3C2UA 3A4UA 1LENA 5FCCA 1TNRA 4PLMA 4S2HA 4FPFA 5KXEA 3CO2A 2HEYF 1QNWA 4NR1A 1RUF1 2QUOA 4QGLA 4WVZA 2CGPA 3KGZA 1MEC3 2Y0OA 4XZPA 4Q0VA 4IEOA 3WG4A 4LULA 1I6XA 4QU2A 1ZRCA 1LGCA 3RS6A 3ZN6A 1VBD2 1N47A 1PVXA 2XBO2 1LHWA 3I4IA 4LBMA 3J4UH 5EJ3A 1AYM1 5K7PA 4KH9A 2FHRA 4NHMA 1YI7A 4DB5A 1D2QA 3PVNA 3N7MA 3B02A 5IK8A 4H14A 1DYKA 1W6QA 5EXOA 4JTNA 3BB6A 4AEDC 2ZX4A 4MYEA 3AYEA 3VZOA 2YHJA 2OPKA 4FXKB 2R072 1ZVFA 4NN0A 1HIXA 1J59A 1U5ZA 3WW4A 2RHPA 4FTBA 3ZXFA 1OD5A 1RMU3 4LLOA 1D4M3 4ZKTB 1H8TB 2XUMA 1LRHA 4DS0A 3FC0A 1A8MA 4BLIA 1GV9A 4N43C 4HETA 2DYCA 1VBD1 2UURA 4BA6A 2XBO1 3M3CA 5J98B 1AF9A 4Z07A 5BNNA 5JLVA 3O7OA 2B39A 4LUMA 3MPPG 1OOPA 1Z7S2 1S2KA 1CGPA 1TME2 1LOCA 3AKQA 1ZZ8A 4XFAA 5I0SA 5FOJB 4AQ6A 4XJWA 1LGBA 2DCYA 3RNSA 3VZLA 4Q8KA 5ABJC 3CJIB 1X36A 1ZBA3 2EXHA 3RWNA 1V6OA 4YYOA 1OPOA 4YARA 4FQZA 1UW8A 2R071 3J8F2 4IERA 4QPYA 2R6QA 2PYTA 2AH2A 2ZBJA 1HRV3 3WP5A 3LCPA 5CB7A 1YI9A 3GBFA 2GN3A 4XHXA 1POV3 2GNMA 3KD4A 1MZ6A 1OI6A 2XKOA 1UD1A 2HWB3 1UKRA 5CAZA 2CGOA 3I59B 1MVQA 2WINB 1WW7A 3VL9A 1J58A 1LGNA 5KHHA 1MVEA 1ZZ9A 3V0AA 2UY9A 3NKGA 2DWRA 3WUDA 2DVGA 2ZGLA 1NCQB 1GZWB 2ZS6B 2GC3A 1Z7S1 5BPXA 4JGYC 2E63A 2D6MA 3AFGA 1G9BA 4RQPC 4CP1A 3SH3A 4ZU7A 4NWVA 3EJKA 2Z5WA 3VLBB 2X5IB 5KXBA 4Y1UA 3PLQA 1ZX5A 1VBE3 2ZAAA 1UU4A 3OD4A 2BW8A 2BNNA 3J8F1 4IEZA 2ZHLA 4OLLA 5T52A 2ZHNA 5DG1A 1LHOA 3ZYGA 4D3WA 1MQTA 1MS3A 1REFA 4URTA 1N1TA 2A7AA 4ZU4A 3U10A 4OFGA 2VMIA 3ELNA 5LK5A 4AEDA 1X7NA 4WZCA 1WA4A 2IXIA 2ZZQA 2D98A 3NL1A 1EY2A 4GMP0 1NOVA 2R1DA 1NY72 1I3HA 1YJLA 3AKSA 5FO9B 1AJOA 4GWMA 3ZXEA 3AK0A 4WVWA 1G86A 5LK7B 1N3QA 2XJRA 1BK1A 4LO8A 1ND3B 3E6BA 4L9BA 1FT9A 4WVMB 4IXLA 2PTMA 4OUSA 2Z79A 5GLUA 4HVQA 3VBSC 1F2NA 5GZEA 4N43A 4CEYC 1NLRA 1ZYBA 3VZJA 2A3XA 3RRDA 3ZN4A 1PMIA 2XHKA 4CP0A 4AFAA 2IXHA 2GALA 3VZNA 1GNZA 5BNOB 3E97A 1DG6A 3KGLA 2ZMNA 2R32A 1FOD3 2PAKA 4PDWC 1S0EA 3ZXGA 3KCXA 4K9SA 1C1LA 1ZA4A 3WDWA 2AENA 4KWKA 3I8TA 2QE3A 5A33B 3ZPYA 3VBRC 4H55A 5ABJA 3AMMA 4J6GA 1NY71 4QPIC 3B9CA 1CAWB 1ND2B 3NKTA 4K3UA 3B69A 2MPFA 1I1EA 4QPGC 1O4TA 1VBB3 2JD4A 2UWCA 5HCAA 3AMHA 4YGBA 5I93A 4CRQA 3J26N 3IDEA 3FX3A 3HWJA 3BIWE 3MF6A 1UAIA 3NAPC 3CNAA 1MEC2 1UIKA 1AX2A 3LGRA 1U0AA 5J3UA 3QLQA 3IBMA 1LU2A 3VZKA 1CX4A 3SISA 1AR63 1VBC2 2LALA 3FMGA 5CBLA 2Y26A 4AEMA 4Y24A 4JGYA 5DXDA 2B5HA 1POV0 3HIFA 1AXZA 1O7FA 2RJLA 2PFWA 4QX5A 3RJRA 2PAEA 4IEYA 1UN1A 4XIOA 3AYDA 1FNZA 4KG8A 3PJQA 4XBLA 2RE9A 2CYFA 1KJLA 3RZZA 4R9DA 1NA1C 3DF0A 4GWNA 2VXRA 3FWEA 3WDTA 4XXAA 2BEOA 4CDWA 2I07B 1ULGA 4IV3C 1RMU2 1GKBA 3TRSB 1J1TA 3K51A 4IQPA 1D4M2 1PK6A 3IPVA 3FZ3A 2OYZA 1LOFC 2QJVA 3WG3A 3S7EA 2NPIA 2BPA2 1MEC1 4YGCA 4F3JA 1CR7A 5C4WC 1BVP1 3B9IA 4QMAA 2XJVA 1AYN3 2WKKA 4X8NA 5AFEA 5GLVA 4XFHA 1LB2A 1BVVA 2R0HA 4YGEA 5I8TA 1VBC1 4AFDA 5C6CA 3ZDSA 4YZ3A 1R1A3 4FOYA 1COV2 5A32A 3RDIA 1EV12 5AVAA 2B46X 3WZ1A 1QY4A 5EZWA 3VBSA 1IPKA 4RGGA 4ATFA 4CEYA 3V0BA 2G9GA 4MGKE 3D0SA 2GNBA 3HMYA 4QQPA 2SBAA 1ZBA2 4IETA 4E2SA 4AHXA 4XBQA 4PJYA 1J3QA 2ZGMA 4GKYA 4PDWA 1RMU1 2XL9A 4A7ZA 3KZ4C 4KU7A 2VQAA 1D4M1 3MZHA 5ACA3 1RUH2 1LTEA 1W0OA 3BOPA 3E5UA 2AYHA 2HWB2 4GQ7A 4AEDB 3RYRA 3WW1A 4QPIA 4JDNA 3RG0A 3VKMA 1S1AA 2YXSA 5DG2A 3EO6A 2ERFA 1QXPA 4LO7A 1PM7A 4Q1RA 3CL1A 4N7IA 4QPGA 2ZGPA 1PNFA 1SFYA 2EF6A 2WNEA 2YUEA 5JVVA 2BNOA 3E6DA 4AGRA 3FE5A 5CFCC 4PIYA 1COV1 3GZAA 2DUQA 1DGRA 1EV11 5F1RA 1FX5A 3NAPA 3WW2A 2V09A 1WCKA 3QCWA 2HKXA 2WZR2 3PJYA 1VBE2 1ZBA1 4R52A 3E6CC 4Q4Y2 1GNHA 4WM8C 3LSDA 4N7UA 1YFYA 3RI9A 3H3ZA 1QQP3 3N35A 1XNCA 2QVSB 1RUH1 4ASMB 5T5LA 4JRAA 2ZAHA 1C4RA 2HWB1 1SBFA 2VW0A 5ABJB 1WBLA 2D6NA 4K40A 1WCDJ 4G3YC 3ZYJB 1NA1A 2P3KA 4CP2A 2OUJA 2FMYA 1DFQA 2JXAA 4BM8A 1KS5A 2BWCA 1Z78A 4M0NA 4XJ8A 1A6CA 3ZSMA 4YSFA 3ES4A 1LOFA 1DU3D 1PGL2 3RPQA 4YZ2A 4W6YA 5A3LA 5C4WA 3D82A 3BPZA 1ZRFA 3ZFFC 2YDEA 1ZZBA 4FPYA 2WZR1 1N3OA 4XMIA 3LSEA 1VBE1 1G7YA 1Q8SA 4LO4B 4Q4Y1 3AZXA 4XJUA 4AI0A 5FREA 4EN0A 1H9WA 3FLTA 1FOD2 2ZGTA 2DVBA 3LB9A 4RQPB 5FO8B 3WP4A 4AVTA 5JOZA 3ZYPA 1RUOA 1SFNA 1QDOA 1QNYA 2ZMKA 4BMBA 5BY5A 3H1YA 4X6RB 3VBHC 2OZ6A 3B3QE 1BJQA 3MIDA 1R1ZA 1AL23 1Z7S3 5JOWA 2NP0A 1WMEA 1WD3A 3S6PA 1VBB2 3K48A 1X50A 1U5IA 2DTWA 3ZSJA 1GQGA 1PGL1 4L99A 4L8QA 4I0AA 4LO5B 1DQ2A 2YYOA 3DL3A 4PBPA 4IESA 1Q5OA 3JD72 4FCAA 2F6BA 2XGXA 4HBNA 1MZEA 4Y22B 5LRSA 1DHKB 1VB4A 1YYNA 3SHRA 1DYPA 1OQ1A 4K6BA 3V56A 2NMNA 3SNMA 3S7IA 4YFZA 2Y38A 2A71A 1PZ8A 5CFCA 1UX6A 3B94A 4LHNA 1YLLA 1IKQA 5A32B 1FOD1 1H8TA 1G9FA 1D0GA 4MX3A 3QOPA 3WDUA 5C9AC 4Y1ZA 3VBSB 4ASLA 4H7MA 1QOOA 2Y0IA 4XMAA 5JPMB 2X8KA 3V0BB 2HWF2 1J1LA 5FLHA 3UJQA 1JYIA 4X6QB 2NQYA 4Q26A 1TE1B 4D69A 2VW1A 3H50A 1MS0A 2A3WA 2YGMA 3JQXA 4WM8A 3VHNA 3MICA 1KXGA 3CU7A 4YM0A 4JDOA 5SV8A 4PDWB 1VBB1 1Q3EA 2ET7A 2WQZC 1BXHA 2UYBA 4IEQA 2A75A 3D6EA 1LEMA 4MLOA 3VBRB 4AI2A 5CU1A 3JD71 4AVBA 5KHJA 1OHFA 3M3QA 4KG0A 4E2GA 4QPIB 2ZACA 3OYWA 1AYN2 4ZU5A 3VV1A 1ND2C 2W08A 1YHFA 3VBOB 1SACA 4QPGB 5BUVA 4S2DA 2V73A 5DZFA 1UU6A 3O5SA 1R1A2 2Z2SB 3I59A 3NAPB 4DINB 3L2YA 5FPXA 2B9UA 5KHIA 1IOAA 1DF0A 2HWF1 4PBOA 3ZFFA 1MS8A 1JBCA 4I3GA 4NVPA 1ALYA 1K5MB 1VIWB 1Y7BA 2BUKA 5I91A 1NCQA 3DPRC 4C90A 3WD5A 5F9TA 2RJKA 2A73B 1GYKA 4AFCA 4DQAA 3AP4A 4DRVA 4Y5Z0 1PIV2 4Q0SA 1AX1A 2I74A 2X5IA 5ACA2 3D0JA 5KBFA 4UBHA 4CTEA 4FSJA 1XU2A 3WR0A 4RHV3 1AYN1 3UJOA 3P3PA 3VBHA 3KQRA 1NA1B 3AP5A 4YZ5A 4DY3A 4XF9A 2VQ0A 4KBBA 2WS93 4QD2A 3WDXA 3GHMA 4IV3B 4FTEA 2EXIA 1R1A1 3ZMNA 1XE8A 2H6BA 3ACLA 1RINA 3CLPA 3INAA 1CD3G 2OZJA 4MGYE 2B42B 4AVSA 5C4WB 4R9CA 4CDUB 3RYPA 4O9GA 1UKGA 2JKBA 2IXCA 1DQ1A 4AQTA 2IXJA 1S0CA 1LU1A 2E6VA 5GLZA 3RMYA 5DUXA 3VDDC 4TWTA 1CJPA 2A70A 3GNEA 2CWMA 4GXLA 1VAKA 3WG2A 4FBFA 1CPMA 1ND3A 2DF7A 2EAKA 4LA3A 4WVMA 1PIV1 4F7ZA 1PO12 1CVNA 5JCTA 1QQP2 1FV2A 4FVVA 1ZM1A 3GALA 5ACA1 2XJTA 4EROA 3GYDA 4RR3C 4I01A 1GR3A 4MH0E 2KXLA 1VBC3 2X29A 4GALA 5HCFA 2PELA 1SDWA 3N3HA 2WFF3 2GZWA 5BNOA 1DZTA 2DU1A 3IDCB 4MV2A 4IEPA 2I2SA 2JEMA 1QXRA 3UK9A 3ETQA 3MGUA 4K1ZA 1IZ3A 4B29A 5A33A 1DGWX 4P14A 1SLAA 4AK3A 1LOGA 3ZXJA 5K8SA 1YO8A 2XJSA 1CAWA 1ND2A 3B01A 1QJU3 5D1IA 1Y9QA 4Y4YA 5LRRA 5L36A 5CNAA 1NYWA 5DZEA 4UBGA 4FO9A 5CFCB 2VUAA 3FFQA 3I7DA 1H2NA 2EALA 3AZWA 3ZFEC 2C1FA 1PO11 4JDMA 1V00A 4CDXB 1QQP1 3QD6A 4ONUA 2WA3A 3POSA 3JU9A 1LODA 3WG1A 5T54A 2PHXA 2BGCA 2C0ZA 4R4XA 2H0BA 4HANA 4UXAA 3DPRA 4WM8B 4XFFA 4YM1A 5CA6A 1COV3 1FAYA 1JYCA 1KD7A 2JE9A 3SITA 4AEJA 1EV13 4XYXA 3WY6A 1QHDA 2N7GA 5GZFA 4DRRA 1AL22 3BOWA 4QQHA 4YW3A 3VBFC 2GN7A 3ZYRA 2VUJA 1AXKA 3MIHA 3NWKA 3PNAA 4O9EA 3EBRA 4XW3A 2PN5A 1D0HA 2C5DA 4Y1YA 4HN1A 2JENA 2VU9A 4EN6B 3OYWB 2BTVC 1C5IA 3WV6A 5C33A 3U4XA 4HT1T 1VBA3 4KU8A 2I45A 1UF2C 3R6SA 3G7DA 4JGZB 1RUH3 2P3JA 4OI1A 1S0IA 1KITA 2Q1MA 4YW5A 3PMEA 2PHLA 4AHYA 1AR73 3L9JT 3RMXA 4XXPA 2WSVA 2WNVB 2Q5TA 5HI0A 3A0NA 3JQWA 4W65A 3ZFFB 5CIRA 1VRH3 2DVAA 1ZZ7A 2X53S 1H8VA 1SBDA 1WGPA 5B2GB 2BFUL 4FPHA 2VVFA 1LOAA 2JECA 1AL21 2P34A 1L3JA 4EWAA 4I02A 3JBG2 4YRDA 1REEA 1MZ5A 4RR3A 1JTZX 2E51A 1UIJA 4E9KA 1Q43A 2WZR3 4YLZA 1OA2A 3BALA 2ENRA 5KHKA 2MHFA 2NN8A 4XF4A 4Q4Y3 3T2TA 1MR5A 3VBHB 4C91A 3JZVA 5T3NA 5FFOC 4BOWA 2DCTA 4COVA 5IUQA 1OQDA 4P9JA 2RS33 1S2BA 1Q8QA 5FLIA 2DFBA 3AMPA 4HN0A 2VGDA 2GH2A 3NO8A 3UKNA 4S2GA 5L7OC 5AC93 5FQ0A 3RQ0A 4YM3A 1WW5A 2ZKLA 1S0JA 1XNKA 1V6IA 5J37A 4I2OA 2HEVF 2WLPA 2ZZJA 2ATFA 2WT1A 1LKNA 1VAMA 2PHTA 3ZFEA 1FXZA 5DUUA 4HVOA 1R092 2CAVA 4Z92B 1LR5A 2QFEA 5C9AB 4OHZA 2ZHKA 1O5UA 2R1BA 3JBG1 5FO7B 4E2QA 4XFCA 2HEWF 1XNBA 3R0RA 4RSUA 4XHBA 2XLGA 1HW5A 3B93A 3GZTB 4RHV2 1S0GA 2JG9C 4R8HA 1HV1A 3P3NA 4Y26A 2WS92 1QXJA