2Q1MA

Crystal structure of human gitrl
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 18
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1mA00
2WNUC 4E4SA 1A8MA 2HEWF 1GR3A 1C28A 1U5XA 4DB5A 2JG9B 2R6QA 1XU2A 4G4FA 1WCKA 2RE9A 4DOUA 1D2QA 1TNRA 4MXWB 1D0GA 2JG8A 5KC5A 1OQDA 2Q8OA 1S55A 2R32A 3B94A 5KWRA 2QDNA 3FC0A 1TNFA 4MXVA 2QE3A 4QQPA 4QQOA 2RJLA 3IT8A 3K48A 1IQAA 4KG8A 2WNUA 4MSVA 4OUMA 2WNVA 2RJKA 4G3YC 3AB0A 3TYJA 2WNVC 2TUNA 1U5YA 2OIIA 1RJ8A 1XU1A 3MI8A 1JTZX 5TSWA 3V56A 3B9IA 4QQ2A 5HBAA 3ME2A 1PK6C 2ZJCA 4EN0A 2KA3A 2X29A 1DG6A 2JG8B 4TWTA 1KD7A 2E7AA 1D4VB 2O0OA 2JG9C 1DU3D 4KGGA 2R30A 4E4DX 2WNUB 2Z5WA 3WD5A 4J6GA 3B93A 3LKJA 4GIQA 5BNQA 1PK6A 4NN0A 1ALYA 4KGQA 4OULA 4QQHA 2Q1MA 4F3JA 4OUSA 3QD6A 3K51A 3L9JT 5CIRA 1OSGA 3QBQA 4HT1T 2HEYF 2ZPXA 2JG9A 3TWIA 1C3HA 5L19A 1OQEA 4QQLA 2WNVB 1KXGA 1JH5A 1RJ7A 4MXWA 5L36A 1U5ZA 4TSVA 3URFA 5KC6A 4N90A 2AZ5A 4RSUA 2JG8C 1PK6B 4D7YA 2TNFA 1I9RA 3ALQA 1O91A 4QPYA 2HEVF
chains in the Genus database with same CATH superfamily
4AGVA 4ZHNA 3J9SA 1WLTA 3VBRB 4Q4X1 1UF2C 1OURA 3N7LA 2PAEA 5CFCC 3I4IA 1SLTA 3CKHA 3PUAA 4QX0A 1CAVB 3ETPA 3VB9A 1V6IA 3NW4A 5LA2A 1H8VA 4YVSA 3WHTA 2BJSA 4JCKA 2RR11 1F9KA 4XOGA 3SC7X 2QVSB 2YDEA 5M0TA 3D4KA 3K4DA 4OI2A 5C4WA 1XNTA 2JDKA 4I01A 4D6RA 3GGLA 4GB32 3AL6A 3WW1A 1TEIA 4RS5B 3WDYA 1F4AA 2ZGUA 1D4M1 3ZSJA 3AYAA 3WY6A 5FKCA 2WWUA 1HQWA 3MF6A 1PMHX 2GNMA 4P08A 2WNUA 5JDBA 4IEVA 4AI9A 2LTNA 3NAPC 5FPBA 2E7QA 3SXWA 3VBSA 2YU1A 1W2NA 4XJ9A 3NSTA 4WVVA 4Y4YA 1G9CA 1ZZCA 2C9KA 4PLMA 1UQXA 1KDKA 1CJPA 2UWBA 4UBGA 5C8CC 2BOJA 4IV3C 1QJU3 1X8MA 2ZHMA 3ME2A 4YGCA 2BGCA 1LGNA 4JHTA 2VR4A 1K5MC 5FZ9A 3PUHA 1WCQA 1RC6A 4L11A 1VBC3 1PIV1 5F2SA 1C1FA 4JV4A 4A6SA 1JYXA 4JGZC 3VBHC 3KGZA 2BFUS 1ZBE1 3RVHA 2ET7A 5IFPA 4QB1A 3HEIA 3CEWA 3O0VA 4P9LA 1WLWA 1W0PA 2BRTA 4YGBA 1N1VA 4JTNA 4UFLA 2XBO1 1NCRB 3S7EA 2X8KA 4ATEA 2ET1A 2ZGLA 1SBEA 1UMHA 2GH8A 5IK8A 5IVVA 5C7GA 1BBT3 1DQ4A 2F6BA 3K75B 1DQ1A 2C4XA 3J8F2 2LALA 2BGOA 2WO3A 1BK0A 4DRRA 4OZXA 5LK7B 3ZXDA 3WT3A 5T5OA 2VW0A 4IQPA 2OX0A 4JTOA 4C90A 1ND3B 1SFPA 1LGCA 5FYZA 2A6XA 1ZA4A 5IVEA 3LIGA 1F4HA 2D5FA 2W0XA 2VU9A 1O8PA 3KS7A 5JMCA 4KMQA 4QDQA 3MLLA 1PGW1 4XACA 1RUH3 3JBG2 2WQ8A 3ACFA 3OUHA 4RR3B 3ROUA 1K42A 1Z7S3 1YHFA 3LD8A 4V2WA 4NVPA 4XQWA 4ZU4A 5FYHA 5HV4A 1KGYA 4QKNA 1REDA 2CYFA 2JE9A 3AX4A 1H2LA 2DBIA 1W8ZA 1WWYA 2OZJA 3ECQA 3M3IA 4GH4C 4P02B 3E5UA 2Y8KA 4HKLA 4FI9A 1HRI2 4Y22B 1HRV3 4O7XA 4RFRB 5K0UC 1MS3A 4N90A 5KHHA 3WQBA 3ZYIB 4CA9A 5CB7A 3POEA 2C0ZA 1L7QA 1PK6B 3IIAA 4D7YA 2TNFA 2K9ZA 1K5JA 3LA7A 1N3PA 3ZXAC 3WP6A 5DAXA 1XJAA 5CG9A 3PJQA 3LSDA 4MHRA 3VBUC 4FCAA 1NLRA 1RUD3 1O3SA 5IAXA 3MFAA 3I3QA 1XQNA 5JOXA 3PNAA 3W5NA 4XAAA 5FUIA 1J3PA 3J7MA 5L73A 2V5YA 1U5XA 4X6QB 1DIWA 3W20A 2OVUA 5FY1A 4XUTA 5A80A 3HT2A 4FOWA 5FZFA 1SBDA 4A6OA 2W5FA 5CVRA 2RE9A 3TNQA 4YZ4A 2DU1A 2B45X 3H8UA 4LJHA 3N7MA 1BZWA 4YM3A 4FFHA 1YC61 4WZFA 1ZZ7A 3ZOIA 4K9SA 5GALA 1CQ9A 2VOVA 2W08A 3B94A 4OQ8A 1R081 2R1DA 4IGQA 2D6OX 1XYNA 4W6XA 2X5IA 2Q5TA 4N43A 4BDVB 2WYSA 1MZ6A 4IV1B 4LKDA 1O5UA 3EO6A 3HQXA 1FPN3 1QXRA 5JI7A 4HG6B 2WNVA 5FUNA 3RI8A 1VBB1 3ZKUA 4NIAA 2HWF2 4D6QA 1V9U2 1OPMA 2A6YA 2WN2A 4CSWA 1PNGA 1G86A 2TUNA 3MLKA 1I5ZA 5LRRA 3I3MA 2VOXA 1QXPA 1RJ8A 1S1AA 3N3HA 1KQRA 1XNBA 3NJYA 3WG4A 4PCRA 3FUQA 2WT1A 1H6XA 1JZ5A 1ZNPA 1YNAA 3QACA 5JWPA 1V6OA 1VAKA 5IK5A 5BXXA 4MGQA 3IIIA 5LA9A 1T6GC 4FPEA 4DIQA 5JAXA 4XTMA 4YG3A 1APNA 2PXJA 1ZRDA 1DDLA 4ZPIA 3HR9A 1LNSA 3HD8B 4KQ7A 5FIXA 4ZZ5A 2O0OA 1AR61 2JDNA 1MVEA 4YNIA 2VVEA 1DU3D 2YROA 3T2TA 5FK7A 4RQPA 1AR92 2VNVA 2AUYA 2YC0A 3LWCA 1JMUB 1NXMA 2F17A 1Y9MA 1C57A 2XPJA 4MLOA 5EYYA 1OHFA 1UZ0A 4XXPA 1S4CA 1WMFA 1VP6A 5FO7B 2PELA 3U0ZA 2ZMKA 1Q8PA 4TLGA 4OULA 5FYUA 1RINA 5H9SA 4QU1A 5B4XA 4YVSB 3KWVA 5DZEA 1NT0A 3BU7A 4YARA 3GDBA 1WD3A 1RYYA 4OUSA 3ZSMA 3POGA 2DBNA 1CZTA 3CLPA 5C4WB 1UO9A 4XHXA 3KQRA 1JUHA 4NWVA 3SH5A 4EWDA 3SMHA 3Q8FA 4TTGA 1UWWA 4WVZA 4YW3A 4GJZA 2P1BA 1EYBA 3FUOA 5EJ3A 3WX5A 3ZPYA 1AX1A 4Y33A 1ZX5A 4IEXA 4QQLA 3S5QA 1QY4A 3O1OA 1LU2A 1AYM1 4ZU5A 4BM8A 2GP3A 1CESA 4HK9A 4FTBA 1SFYA 1S0FA 2P17A 4WVMA 3KZ4C 3MIEA 1UPSA 3BYWA 5HCFA 4CCJA 5DMYA 3UESA 4Q8KA 1GOFA 2IXLA 2UY9A 1X9PA 5C4WC 3ALQA 4LOSA 4B7EA 4AI3A 3ZXJA 1ODNA 1RUJ1 4KI5M 3VGIA 1SEFA 4LBQD 5DUWA 5FZ0A 1A6CA 2PYTA 2VULA 3QLQA 1XXNA 2VUJA 3WR0A 2WNUC 5FMDA 3WQ1A 2Y34A 2J1AA 4FOQA 1NA1A 4QKBA 1ULFA 4TXWA 1W3VA 1BMV2 3VBSC 1FMD1 3PUSA 2B9UA 1DGRN 2D43A 1WCKA 2PHUA 2E33A 2PAMA 2LS6A 4QXKA 4R8HA 1W6PA 1D2QA 1TNRA 2QQNA 2BNNA 3E5QA 3I2HA 3I8TA 2VE1A 3IWZA 2OKXA 1QQP1 3TBDA 1FPN2 2NMNA 4OHYA 4K1ZA 1JOBA 1UX7A 2VMGA 4N7IA 2BUKA 2WIIB 2KM2A 1TVGA 3FL7A 3J7LA 4NIIA 5H9QA 3W59A 4FOYA 2MPFA 2W1SA 2KD7A 4G9SB 3E6CC 4HVOA 4XURA 5JVVA 4CEYA 3S57A 5LA1A 2G9ZA 3KVAA 5GZFA 1O4ZA 4EN8B 1U5YA 5FY4A 3HIFA 1W99A 4TYSA 5FXZA 2ZX4A 1RXFA 5F9TA 5JUVA 2W1QA 4S2GA 1YFWA 3C7OA 2QQKA 3PDQA 4P9XA 4XF9A 3B9IA 3WNXA 3H7YA 1OVSA 5HBAA 4AVCA 1D0HA 1QHDA 2EIDA 1QJY1 2VW2A 4RGKA 3EJKA 1JZ6A 2NP0A 1E5IA 1TZOA 3LEGA 1PX4A 3D5OA 5IWFA 3THPA 2VQ0A 5GLWA 5BNNB 3RI9A 4YZ1A 1V0AA 2AACA 3ILFA 1H9PA 5J1XA 1R082 2E31A 3H7JA 5BNOB 1LTEA 1OUSA 1IKPA 2DCJA 3ZFGB 4HETA 4S2FA 2QZ2A 1JZ7A 2PHWA 3KLSA 2BYVE 1GOGA 4KGGA 4Y26A 2XHNA 3M3CA 5EWSA 4EWEA 1VBB2 4P14A 3ZSLA 3RZHA 4NIDA 4AVTA 2KXLA 1VMJA 2AREA 2ZA9A 1VBD1 4FP3A 3EBRA 5C9AB 4DFSA 1MQTB 3POIA 2W95A 2RMU1 2OPKA 2NQYA 1BVVA 3LDRA 3T2PA 1US3A 3JXSA 5JMOA 2EIGA 5FJHA 2JDMA 4FPCA 3BB6A 1CAUA 2VVFA 3QBQA 1DYPA 4DPNA 3M70A 4HMZA 2ZAAA 1JHNA 1XNKA 5C71A 4EYUA 3HN1A 5ACA1 1W9TA 1Z78A 2JB8A 5DDJ1 5JZGA 3OY8B 1HJFA 4LBLA 5J7MA 2WNVB 2WSUA 3AVRA 4YLZA 1TG7A 3W9AA 1WA6X 1U5IA 3D0SA 4PLOA 2DYCA 3C3VA 1VALA 4PIZA 2EF6A 1PZ9A 2ZX3A 2AZ5A 5GZDA 4CCKA 5T3NA 1GSLA 3BUCA 2ZCWA 4XW3A 4LPLA 1I6XA 4K7JA 3VZLA 2D6NA 5JXGA 1W06A 4P9YA 4QPYA 2VZ3A 4XCBA 4AVSA 1K3IA 5FOJB 4D7TA 1ZRFA 2C6SA 4B1LA 2X5IC 3RZMA 4N43C 2R043 4LOTA 3VBFA 4KWLA 4QB2A 5G04L 3USUB 4I0WB 1AUYA 2YHJA 2GSYA 5I0DA 5DZGA 1OQ1A 3ZFEC 2DDUA 3WNNA 1SLIA 4LHLA 2E53A 1W6NA 3WG1A 3FE5A 2QTWB 3KHBA 5F5QA 3VZKA 2XH6A 4RQPB 5FZDA 3KT7A 1S0CA 1VAVA 1W9YA 1YJLA 4AFAA 5DQ0A 2PHFA 2HWC3 1O6UA 3HMYA 1JYNA 2DFBA 1T2XA 3BVCA 3RS6A 2I2SA 5FLJA 3OPTA 2WL1A 4LE3A 3WW2A 2VZVA 1S2KA 2JICA 2WS93 2W91A 3ZDVA 2WABA 1DF0A 1YO8A 3AZXA 4QDRA 4AVAA 1PO23 5CNAA 3UNPA 2IVIB 4MGZE 3ZLIA 1IS6A 3AB0A 4BU2A 4Y1ZA 2JIGA 1X36A 2ERFA 4ZS2A 1VBA3 1DQ6A 3ZFFB 3MI8A 4CDQA 4UBHA 1H4GA 5TSWA 1WLDA 1LAJA 3DF0A 1Y3TA 4PI2A 5FYSA 2EAAA 1B09A 1YIPA 4Q1PA 4YW6A 3U1XA 3T0AA 4AQSA 3V0BA 4LO7A 4LORA 1RGSA 4DXRA 3R4DB 5ABJA 2VO5A 4Z92B 2HWB3 5C3QA 4M3CA 4WVMB 4AG4A 4URAA 5FZ6A 2R071 1PZ8A 4AL9A 1PO11 1Y43B 2XKPA 1R64A 4GMP1 1RVF1 4BQXA 5IHRA 5K7PA 3OD4A 2RM21 1EP0A 4R4XA 4IW3A 4IEYA 2VUAA 3WF1A 4A7ZA 1VRH2 3K4ZA 1WW7A 3W21A 4GMP0 2VZPA 2IFRA 5EHDA 1EY2A 4OI4A 3EXUA 1KFXL 3MW2A 5BNPB 2P3KA 5KBFA 4JHZA 2WFF2 3DXUA 2VZ1A 1K45A 3HWJA 3WLUA 3UL2A 4BIFA 1WZXA 1FXZA 1NZCA 1QJY2 1DBNA 2WO1A 1HB3A 3VDDA 2BZDA 3O1PA 5GZCA 5CIRA 3ILRA 3WQ7A 2ZPXA 1XE8A 4LBNA 1GBGA 4Y20B 4W6YA 3OPZA 1TME3 2DVGA 1CAVA 4FTEA 3NJVA 2C24A 1NA1C 2CWSA 2VTXJ 3BIWE 4YW4A 5FUPA 1WA4A 4FOVA 2E6VA 2ZGTA 3OGVA 2QQJA 2AENA 4UYBA 3TN91 4F7ZA 4QX1A 2BTVC 2OQ6A 3A4UA 4Z2AA 4D7SA 5FTTC 4FPKA 4M4PA 2DTWA 5FBJA 2R042 5FZ7A 1SBFA 3PJYA 2CGOA 4AQ2A 4GAZA 5JOZA 1OOPB 3K3OA 3O1TA 4UFHA 4TZDA 1ENRA 4P9JA 1AYN1 3OPWA 1ZRIA 4QX7A 5FPVA 2UYAA 5T5JA 5A1AA 4AFCA 4ZKTB 2CTVA 1HB1A 3AJZA 4A4AA 1AR82 2QFEA 3JB8A 4NROA 1BQPA 2HWE2 4Q4Y1 2NYYA 3PL0A 3BODA 1C8M3 1GQGA 4CEYC 2BERA 3K46A 5F3GA 2HEWF 1ZZ9A 2GMPA 2GDFA 3S0MA 3I2DA 2VCBA 1DHKB 2IZWA 4GALA 1HW5A 4IDZA 2LM3A 4JQTA 2JDPA 1COV3 5DDJ2 4D6SA 2WS92 5L9VA 2X53S 3J4UH 4MXWB 2WNOA 3MO4A 4K6BA 1MEC3 3MYXA 2C5DA 3HVDA 4C1WA 4LR4A 4DXZA 1AX0A 2XJRA 3T1LA 2QDNA 5JOYA 4UAPA 3GJBA 4AFBA 2DTYA 1NCRA 3JQWA 4FXGB 3S30A 2XR4A 1VBE3 3AMPA 2WINB 4OUMA 1W2OA 1LOFA 3CU7A 5A6XA 1N1SA 1RHI3 4XBLA 5FJKA 2MNGA 5AC93 1QJX3 4XJUA 3O12A 1GWKA 4CCOA 1RUE1 1UW8A 4I30A 4LUKA 4F83A 5IAVA 2HWB2 2DCZA 2QDRA 2ZGRA 2OS2A 1ND3A 4W8JA 3ZPOA 3CL1A 5F7UA 1QJEA 1JYTA 4U2AA 1IGOA 5F1RA 4E2QA 4NAMA 2AC1A 5DPNA 1QOSA 2RS11 1CIWA 5FY7A 3WF3A 2A7AA 4LK7A 4XJZA 4BWOA 4D69A 2D6KA 1ZBA3 4EZHA 4RR3A 1EAH3 5LBCA 1WGPA 3C7HA 3ILNA 1XC6A 2D3RA 5FPZA 5F32A 3VBOB 2VJXA 5L9BA 5IVCA 4NIGA 2DCKA 1RIRA 3I7DA 2YBSA 2KR2A 3LEIA 5JZGC 3KD4A 1XNCA 2E63A 3ZMNA 1NQDA 4DO0A 1JU3A 1PK6A 2YBKA 4KBZA 3NV2A 4AR2A 4DMIA 4RGAA 1R091 3WV6A 4KGQA 3K4AA 3IMNA 2GP5A 4AGRA 1TME2 3ZXEA 4BPZA 3MUY1 5KHKA 5DZFA 2Y6LA 5EJ1B 4LO5B 4LA2A 2WZR1 2NZ9A 1HLCA 2XONA 4W6WA 4AAXA 3VBFC 3N9MA 3T2OA 1AL23 2CU5A 3MLJA 4HOOA 1UNBA 2R072 1MZEA 2ZEWA 3CQOA 2VZSA 3SNMA 1JYVA 1PO12 4CRQA 3GZUC 1I5PA 4FAHA 1LENA 1RUC1 4PI0A 4X8NA 1RMU3 2WJSA 2ZGNA 2FBEA 2IXJA 2GH2A 4C8DA 3S5AA 3BPSA 1MS9A 4CYDA 2C9AA 3O1RA 3IM0A 5FP3A 2Q8DA 5FPUA 5HV0A 1WW4A 2O1QA 2V5DA 3MEPA 5A1FA 3TEXA 2DUPA 4OFGA 4IV1A 1XYOA 2B5HA 4F8AA 2D3PA 4MGSA 5F39A 3EB7A 3TB0A 3L2YA 4HONA 1VE0A 4LTAA 4AOCA 1PVC1 1R1A2 1COV2 1JODA 1JW6A 4YM1A 1LHUA 1W8HA 3APBA 1US2A 4TN7A 2ZMNA 3R6SA 2JDUA 1DYKA 5A32A 4L0PA 1NE4A 4ISRA 2PTMA 2BOIA 4CDQC 1W0OA 4BQ3A 4RFT0 3UGHA 2F4LA 5IK4A 3HQRA 5JOWA 4JKLA 4DOUA 1YQ2A 4A3ZA 3B02A 2W46A 1YQ5A 4JC1A 5GKAC 3SCHA 4ZY9A 5JSPA 1VBE2 2Q8OA 1S55A 3AMMA 5CISA 5J3UA 4XDPA 1AXYA 4X8PA 5ABJC 1RHI2 1LEMA 4XUOA 5KR7A 2I74A 2ARBA 1HRI3 2DVAA 1QJFA 4BQ2A 2RG4A 5FO8B 3KB5A 3VDDB 3AMNA 3NNMA 3MZHA 5D1IA 1TMF2 3B01A 5A6YA 1H2NA 3HBZA 1AZDA 1F15A 1W8WA 2Z2SB 3JD71 4LA3A 4ES8A 2JX9A 3HJRA 2UU8A 4AHWA 1OF3A 3V65A 4AZZA 5JPMB 1ZBA2 2YC2A 5CADA 4IETA 1EAH2 3AM2A 3DPRB 3PU8A 4RL7A 5LW9A 2E7TA 3KGLA 4EN0A 3RZJA 1MPXA 1RUI3 2LW8A 4KL1A 3ACLA 3PIJA 4XBQA 3DKWA 5FAXA 3Q8CA 3VD9A 5BUVA 2JKXA 3F2ZA 4PIXA 1GKBA 2D97A 3H3ZA 5A33B 4HK8A 1DYOA 1OPOA 5CBLA 2XWBB 1W6QB 1MR5A 4C1XA 4UFJA 1MS1A 4YZ3A 1D4VB 5IJRA 3SLIA 1FOD2 3VBRC 2DCYA 3OGRA 3E1F1 1SLLA 5KHGA 3WDUA 1REEA 1DQ0A 1YQCA 5LEKA 4O9EA 1PM4A 4AEDB 2A5ZA 2J1RA 1HN0A 4NAOA 1EUUA 1L3JA 4QWNA 3LA2A 2ARXA 4Q29A 2EXKA 4FSJA 1KRIA 3MV01 4QD2A 3ST7A 1LB2A 2YZ4A 3IDEA 2R0HA 4FPHA 2BWAA 2HWF3 3CO2A 1V9U3 4ET7A 2GAUA 2B46X 1AL22 2VNOA 1H8TB 4M0HA 4RS5C 2GC0A 3RRDA 1X82A 3VZOA 5DAVA 5JSRA 2ZZQA 2GC3A 1OD5A 3SEEA 1NXD1 5JIUA 1RMU2 2W2IA 1XSRA 3HN3A 5GZGA 1W2TA 2WLQA 3LAGA 4BK4A 1YWKA 1ZZ6A 2JIJA 2A6WA 1C3HA 2RR13 1W39A 3ZDSA 1GNHA 1QEXA 1N1YA 4ASKA 1UOJA 2MHFA 2YPDA 4I2OA 1ULPA 4YSFA 2GC2A 4CEWA 2YG0A 3MGUA 4XILA 3M3QA 1YCIA 4UFIA 2XL9A 3ZXFA 3M3OA 5FYVA 1D4M3 3L2HA 4LQRA 4Q0PA 2YFZA 4MV2A 1VRBA 1X9TA 3IDAA 3UKTA 4P9WA 2PLV1 1AR93 3OEBA 3IB3A 5FMBA 2CAVA 1O4YA 2FHRA 3AYEA 4NWWA 5A7PA 4MGTA 1HRV1 1UN1A 2AR6A 1JU4A 2JENA 2WN3A 4K8FA 1RUF1 3N9NA 3NO8A 1SZBA 4DZGA 1QDCA 1NCRC 4YRDA 3SCFA 4LKFA 1MS4A 3JQXA 1HQNA 3AFGA 4OI1A 1XE0A 1IS3A 1AR71 2VCMA 1LOFC 2X09A 3FX3A 1RUD1 2QNKA 1E57A 2FDHA 3RGBA 4DB5A 3BKZA 4Q2FA 1PIV3 1XU2A 1UOGA 2R6QA 2R0FA 1OH4A 4AE2A 5GJ6A 4N9IA 5FPXA 2W39A 4M3CE 4XF4A 3T09A 3E97A 3MICA 4FFGA 2JD9A 1SCRA 1HB4A 3DV8A 3EQEA 1ND3C 4HFSA 5FZ8A 5KXEA 1D0GA 4LULA 2WFPA 1QJZA 2ADEA 3SKVA 1AF9A 4Y5TA 5BNNA 5JIAA 3PLQA 5FZOB 3ZXLA 1E5HA 5K9YA 4AF9A 4COWA 5BNOA 1J59A 4RR3C 1QOOA 3KV6A 5LASA 3ZFGA 3PVOA 5FV3A 3ACGA 5CFDA 5ANQA 1NE6A 1DGWX 4DUWA 4BH9A 4M0NA 2D44A 2B9VA 1I3HA 1RUI2 1POV1 3POBA 1PVC2 3QH7A 4AXOA 3CJIB 1H4HA 3PUIA 3RYRA 2R062 3OUJA 5CEHA 3MFCA 2VY0A 1U12A 1LCLA 5C9AA 3FWEA 1Q3EA 1MQTA 3WF0A 3OBTA 3U4SA 1PK6C 1BVP1 1POV0 2XJTA 4QDSA 3WDVA 1NCQB 3H50A 1G7YA 4BJ0A 2FCTA 2XJVA 5A7SA 5DAWA 2D5HA 2PAKA 1UPIA 1SHWB 1ASJ1 3LSEA 4XE9A 1UU4A 1S0BA 1F8VA 1CONA 2K2SA 3U75A 4R9CA 3VHPA 3AKQA 4E4HA 4RN5A 2LUWA 5A7QA 5I0RA 2XVLA 3OY8A 3CBNA 1AJKA 1RUG1 4Q1RA 4DUXA 2XG3A 1XPWA 1ENQA 3SCGA 4E4DX 3GM8A 1GZ9A 1UY0A 2FDIA 4MX3A 4MO3M 1U0AA 5J48A 4Q4X2 5BV6A 4IGOA 5EPAA 1OMIA 2VMIA 2VZQA 5A32B 1WBLA 3NQHA 5FCCA 4Z82A 1S0GA 5F8PA 5C6CA 1ZRRA 1W8FA 2BWCA 4IV1C 5FLHA 5G05L 3USUA 1OA2A 2HWD1 5A3OA 2ARAA 2JDZA 2RR12 2ZGPA 1SDDB 1ZM1A 3K51A 5BYNA 3FBYA 2XL7A 4UF0B 4N9HA 1BCXA 1ND2B 1QF3A 2PHRA 4R9BA 3VHNA 1D4M2 1W03A 3TAYA 1JYIA 1YQ8A 5A3WA 2W87A 3B3QE 5LB6A 1JH5A 4UWDA 3ZYGA 4L99A 2RHPA 1U5ZA 1CIYA 1R083 2VMDA 2YGMA 3BOPA 4K40A 4HN1A 1QH6A 1QKQA 3C2UA 3PUQA 2ZKNA 2GNDA 2FDGA 2VH9A 3NL1A 4GWNA 3D82A 2H0VA 3GBFA 1O3QA 1VBB3 2J1UA 3R05A 4O65A 3GZAA 4YPJA 5CAZA 3O1MA 1YEWA 1E5SA 1FI2A 2HKXA 4RD7A 1PIV2 4CPBA 1ACCA 1IZ3A 1IKQA 1KJLA 3NJXA 4FXKB 3AFKA 1ZBE2 5FZCA 1YIFA 2RS51 4XEZA 3ZFFA 5C5TA 4XFGA 4CXYA 1LODA 1WCUA 4KU7A 3VV1A 5D21A 3SEPA 4CDWB 1JZ4A 2WQ4A 3GF6A 3BCWA 1BXHA 2XBO2 3D3AA 4JKKA 4M01A 3T0BA 4JGYB 4GQ7A 4BA6A 4ARXA 3M4FA 2QQVA 3JU9A 5B2GB 4YVSC 5GLUA 1WMXA 1YRZA 2PHTA 1TQ5A 4YFWA 3FC0A 1OKQA 1TNFA 1G9FA 4XUNA 4QQOA 2B39A 4OLLA 3Q8AA 4COYA 4JRLA 4OHXA 5FP8A 2BFUL 3IT8A 3H3LA 2X10A 2EALA 5DG1A 3VZJA 4PBPA 2FD8A 1ULDA 3VDAA 3U10A 2R7EB 3P3NA 1PGW2 1UYZA 2A6ZA 3AJYA 3FZ3A 3M8LA 5KXBA 4B4PA 2W1WA 1N3QA 5BNPA 1JTZX 2RJ2A 3FMGA 1ZVFA 3I2FA 4JKMA 1AR72 3CNAA 5H9RA 4QGLA 1DQ2A 4FAGA 5FMOS 3UJQA 4M4RA 1EPZA 1UYXA 5F5IA 4XJWA 3LPGA 4CEWB 3VD7A 2OA2A 1Q8QA 2G9FA 3ATGA 4C0BA 4R9DA 1HV1A 2GN7A 4LK6A 1W6MB 4NHKA 4HVRA 4URTA 4OMCA 4Y20A 3SISA 4COZA 3RJRA 5JSOA 3AK0A 1UXZA 1SMVA 3G6JB 3IDBB 4JDNA 2JD4A 1FAYA 4OHWA 3WD5A 4LHKA 2CDPA 4XUQA 3ACHA 4N53B 3DYPA 3AZYA 4ORFA 1OOPA 1RUJ3 4NN0A 4Z1VA 1OFSA 2WNEA 5E1RA 1PMJX 2WBKA 2YV8A 2Y33A 2A75A 2RDQA 3O1VA 2B8MA 3R4SA 3MV11 2Q1MA 2VZUA 3WW4A 1S0JA 4XMAA 3H8OA 1FMD3 1VR3A 5F5CA 1GV9A 5A3MA 4A3XA 3DGTA 5IATA 1OSGA 4OVEA 3KV9A 4Y1YA 5IFTA 2EIEA 1RITA 1ASJ2 3WHUA 2GC1A 2XMLA 1STMA 1YI7A 5CFDB 4K8RB 1J3RA 2XDVA 4YVWB 5FZ1A 3O1SA 1X33A 1OLMA 4HSJA 4IERA 1QQP3 5F6LB 4MXWA 1RUG2 1ST8A 3URFA 3VDCA 4QU2A 4JZRA 2Q8EA 3UV9A 4XF1A 3LZZA 3NKGA 1NQJA 1QXJA 1VRH3 1FV2A 5BNNC 3S7IA 2Q0AA 3MUZ1 1AX2A 2BNMA 2W68A 1LU1A 5BNOC 2YXSA 2OUJA 4HANA 1OXCA 3ZFGC 3GNEA 2WFF3 2VZOA 2WC2A 4FPYA 1OLRA 2JKBA 4CUAA 5A70A 5CKNA 2HWD2 4R52A 1GNZA 1W2UA 4HKOA 1HXS1 1OBNA 1V00A 3LCPA 3SHRA 2JEMA 4B1MA 4CCEA 1QJY3 2RVAA 1B35B 1S0DA 2W3JA 1XRUA 4OHVA 4PF1A 4K21A 2A3WA 3PMEA 3DECA 3I2IA 4XCAA 1AR62 3NWKA 2Y6JA 4XZPA 1UOBA 1H6YA 1GZCA 2QZ3A 2Y0OA 3ON7A 4K20A 3AKTA 4L9BA 4Q4W1 1MQTC 4WM8B 4E9KA 5C9AC 3WNLA 1Y7BA 3GHNA 4U36A 3ZM8A 2AYHA 3FLTA 3O14A 2GALA 2CL2A 2NPIA 4GD4A 2LRPA 2Y26A 4QGNA 5FY5A 5FXXA 4CP0A 3VBOA 1N1TA 3R0RA 4NRPA 3O0WA 5DAPA 2HWC1 4PJYA 4YW7A 3T08A 2P3YA 2RJLA 3K48A 4MSVA 1S0IA 4A2UA 1UKRA 1YFYA 3WINE 2TEPA 1C8NA 2G4IA 2ENRA 2WNVC 2E32A 3HT1A 2WQZC 3MIBA 2RDSA 2VMHA 1Q8SA 2QQPA 1GLHA 1PO21 4RYDA 2VZTA 5FZHA 1Y4WA 4EQVA 1GU3A 2V4AA 1AR83 2DU0A 2HWE3 3D8CA 4GWJA 5FREA 1VBA1 4LE4A 4I02A 3HNMA 5KHIA 2Y60A 3PVEA 1KS4A 1D7PM 2CDOA 1IQDC 3KM5A 3OB8A 1AYM2 4Q5OA 2HH9A 3U11A 3RZGA 4NIHA 1NX9A 3C7FA 1LESA 1UU6A 4RHV1 4Y3OA 3W5MA 3HNYM 3AC0A 4XBNA 4P5HA 3ZIXA 4AHZA 4UOJA 5DDJ3 5JPNB 5FYMA 1P8JA 1LKNA 1EV11 3A21A 3NNJA 4I3PA 4BHPA 5C3OA 2VMCA 3IAQA 4CU8A 3OUIA 1JYCA 4JVAA 1IS4A 4YW1A 4CDUA 1RUJ2 3I2JA 4H3WA 2Z5WA 3AP4A 1JUIA 4RQPC 1VAMA 4AFDA 3BU0A 4J6GA 3CJXA 5EJZB 3ZR6A 4LKSA 1FATA 2PHLA 1DQ5A 2ZEZA 1UOFA 3LKJA 2WZPP 1FMD2 2QQOA 3PHMA 2VNRA 2XOMA 1IG3A 4LHNA 4LHSA 2G1MA 3N35A 4LLFA 1UY3A 3V0AB 2MEV1 1GZWB 2JDYA 3P1IA 1OD3A 1QQP2 5FZKA 3KF5A 3FHAA 5T54A 2VUCA 1AHSA 4XTPA 4COUA 1YUDA 3POSA 2VTXA 3POWA 3ZFFC 2WKKA 1CZVA 4XDOA 4ASLA 3EYPA 4DY5A 5LRSA 2WT0A 5L19A 2A3XA 5C5UA 3DEMA 5FP4A 1KXGA 3T1MA 2I45A 3H42B 3RZLA 1UZYA 1XNAA 2PN5A 4IEZA 3B69A 4QB6A 4EN7B 2R49A 4XYXA 4L8QA 1W0NA 1F5JA 1I9RA 4KWUA 5IVJA 4DINB 1GNYA 4D0QA 4IE7A 2YMZA 4OZOA 3IDCB 1W90A 2DUQA 2OXBA 5LK5A 3VD4A 1JXNA 5FO9B 1BEV1 1KJRA 2B42B 3OCPA 1I1EA 3LOIA 2IXKA 5A7WB 4DUVA 5A3TA 5CFCA 4FP2A 4WM7B 2Y64A 5IVYA 1AJOA 3WSOA 3D0JA 1OUXA 1GQPA 1RTVA 2HBTA 3WNPA 3DPRA 5JLVA 2RS31 2W92A 5BNPC 1CWPA 4G4FA 5HPOA 4YM2A 1C8M1 1LECA 4PDWB 2R073 4GA9A 4MGIE 1ONAA 2Y6FA 4PT6A 3N9LA 5KC5A 4FTSA 1PO13 3WEZA 2NMOA 4OQ9A 4MG2A 1RVF3 2E9QA 2YB7A 4PQ9A 5A33A 3THCA 1W6QA 3IZOA 4BK5A 4CU7A 1CVNA 2RM23 3THTA 3VKFC 3N7JA 2PQSA 1VBD2 1Q8VA 2XB6C 4MH0E 4E8CA 5FY8A 2A6VA 4IEOA 4AEDA 2RMU2 2HYKA 2GMEA 2JWPA 3OD0A 4ZONA 1Q56A 1NLSA 1RUOA 2XLFA 4NE9A 1JS9A 1AVBA 2OIIA 4NR1A 1W3XA 5FYCA 5C8CA 1C4RA 1HXS2 1N3OA 2RV9A 5ACA2 1YQ6A 1LR5A 1MZ5A 4I0BA 1CAXA 1R1A3 1H8TA 1GWLA 1OC1A 2ZGSA 1OOPC 4D94A 1V6JA 3VL9A 2P2KA 4QT6A 2WSVA 1ZA7A 5FYIA 2A1XA 2X29A 3IKWA 5D8AB 2JG8B 3OG2A 5IW0A 4AW7A 3T4VA 3WDXA 5GLTA 4FPGA 3MIGA 3PURA 2CY6A 4IXLA 1F35A 1QOTA 4UW4A 2V4VA 1FNZA 3SH4A 1J3QA 2HJIA 2D40A 2OYZA 3WUCA 3LOBA 4OI0A 1QWRA 1J1LA 4ZXKA 2VVDA 3AXEA 1UIKA 4KH9A 4KNCA 2D98A 3POJA 2XUMA 3O5SA 4O9GA 1UZZA 3ASIA 4Q0QA 3CF6E 5F3EA 3LEKA 2EXIA 2YYOA 4CUBA 3U07A 4GZ9A 1L7LA 2W1UA 2VOKA 3I3DA 4GIQA 5J09A 3ZYPA 1OA4A 4DXSA 4GB31 3NJZA 1SFNA 3M1HA 1DZTA 4I0AA 3FBMA 1TMF3 4NJ4A 5JCTA 5HXVA 4Q4Y3 5I0UA 2Q30A 3RNSA 3H0OA 3N9QA 3T3YA 1UZWA 2VMEA 2OT7A 4QQHA 1LHWA 5A3LA 4F3JA 2QUOA 1BYHA 3KCCA 4KWJA 2IXIA 2WO2A 3LE0A 1QH7A 2ZTNA 4QPIB 4HBNA 4LBMA 5HI0A 5I93A 2J1TA 4DEQA 4QAWA 4B8EA 1J83A 4GXLA 3BTYA 3M7AA 3T2QA 1EV12 2BU9A 2JDAA 3RPQA 3KV5A 1NZIA 3MW4A 4HKWA 4CDXB 5KXDA 2O8OA 1W9FA 5L36A 1FOD3 3LGRA 3IPVB 5K0UA 3MW3A 3LIHA 2H6CA 3BTZA 4AEKA 5LZ6A 5FZOA 2VBPA 2IC1A 2BEOA 2QKDA 3OGGA 5FZ3A 5IUQA 2VNGA 4Q0VA 4XJAA 5DUUA 3JCIA 4CP9A 3VBUA 1UYPA 1WW5A 4N8MA 4B7KA 3UT0A 4CU6A 3VBOC 3TRSB 4A7YA 4ISQA 4NHXA 2XJQA 4HLTA 4FPJA 1RUE3 4RGGA 4MADA 2FMDA 2IXCA 3MDPA 1LRHA 2MEV2 1ODMA 2P3IA 1TE1B 4AFMA 3J8F1 2PQQA 3CJIA 1NLQA 4YGDA 2Z79A 4YW5A 1BLZA 1QU0A 2JG9B 4Q4V1 1REFA 4AI8A 1RVF2 4IEUA 4LIUA 2RS13 4INDA 5FBZA 3JZVA 2FMYA 3Q9OA 5E89A 3WDWA 4CDUB 2RM22 1NCQA 1W6OB 3FFZA 3WF2A 4JX0A 3B00A 4BLJA 4W50A 1SPPB 1FNYA 3ZSKA 1UMZA 4IGPA 5FY0A 4ZZ8A 4NHMA 4Y5Z0 3QOPA 4M3CF 2V72A 3JBG1 3WOGA 2R32A 4XC9A 4IE0A 1KS5A 4HL0A 5E88A 3RJ2X 2DVFA 2VOTA 3VZMA 4V2VA 3X29B 1H9WA 5T5LA 2P6CA 5FP9A 4CPBD 4G3YC 3TYJA 5L7OB 1ZREA 1HRI1 4QX2A 4SBVA 4AVBA 3N9PA 4TLFA 5LEJA 1R093 4PQQA 2ARCA 4GJYA 1WD4A 4FBFA 2GN3A 2CV6A 3HPNA 2WO7A 1A78A 4H7MA 3GBGA 5FYBA 5J96B 2WZEA 3C7GA 5EQUA 1ZZBA 3ORJA 5FY9A 1H1IA 1Z0HA 2KA3A 5EFUA 3TN92 3VL8A 5LY1A 1PM7A 4L97A 4BQYA 1SQ4A 1G9DA 3MIFA 3H9AA 4QX5A 2XUEA 1KD7A 1OLME 2OW4A 1VMHA 2YY1A 4UF0A 3WVJA 4E8DA 2E7AA 1CZSA 1ND2A 4BLIA 1RUC3 5I91A 2O14A 3DKQA 5T50A 1XSQA 1YYNA 3B7MA 2RDRA 4QHZA 1AYN2 1WMEA 2G9GA 3HBKA 1RB8G 4E2GA 3AKPA 3R4UA 2XQXA 3ZYFA 4BB3A 4QHBA 5CYYA 2VQAA 4FQ4A 1Q43A 1W9SA 1UMIA 1WBFA 4JDMA 4Q4Y2 5CFCB 5FXWA 1O3TA 5EXOA 4BXSV 1F31A 4BYYA 4NPRA 1YFUA 2DURA 5IT6A 2JE8A 1OA3A 2VXJA 2V09A 2E26A 1OI6A 2L9LA 4DEVA 1O5LA 1PVC3 4CUCA 3MPPG 2R063 4PLNA 1QJU1 4BQ5A 2HWF1 4XDQA 1V9U1 3LB9A 3VDDC 1JYWA 3KHCA 1W8TA 4XAEA 4C91A 1CJDA 1VBC1 2DCTA 2ZXQA 1UYYA 3NMBA 5AFEA 1WCSA 5ISLA 4N7UA 5FZAA 4CDWA 5FLIA 5IVFA 1DCSA 3N7KA 4NOTA 3NAPB 4JGYA 4KG0A 5AVAA 4EN9B 2VD7A 2I07B 4QMAA 2FDKA 3DPRC 3KV4A 4TSVA 4LBKA 2EIBA 4FQZA 5ANNA 4BCUA 1IHMA 1V6KA 3P5BA 4FT8A 5C3RA 5I8YA 5C8CB 4IV3B 1RUE2 2K46A 3SITA 5A3NA 1K5MB 1LOAA 1BBT1 1CAXB 1A3KA 2JE7A 1LHVA 4Z2WA 4Q4X3 2UWAA 3FN9A 4HXCA 5CG8A 4JGZB 3VBHB 3JD73 3UKNA 1AR91 1H2MA 2IWGB 2RS12 3RWKX 3UK9A 4O61A 4LBQB 5F2WA 4AEDC 5I8SA 3OBZA 4IEPA 4UI9L 3HNBM 5BPXA 3VKMA 2XJUA 1PNFA 3H1YA 3O1UA 2E51A 2VGDA 3ACIA 3F95A 1CD3G 1GR3A 2QBXA 4S2HA 4XFAA 2OUHA 3KF3A 3PVBB 1CPNA 2FDJA 3BTAA 4H14A 1HV0A 1JZ3A 3DL3A 1RUH1 4CU9A 1RUNA 1XNDA 5FRAA 3FJSA 3TOJA 4E2SA 1Z7S1 3PTRB 5FQ0A 1H8TC 5C3PA 4QPWA 3AKSA 1PX3A 5FXVA 4CCCA 2PMWB 1W6MA 3B9CA 3O7OA 1GP5A 1KFUL 1VPHA 2DVDA 2HBUA 3LA3A 3ZMOA 4R9AA 3HOBA 3KQ4B 3LFMA 1R092 2J22A 1DGRA 2VXRA 1Q8OA 4GWMA 2XXZA 1DLLA 3NV1A 2WZR2 1Q5OA 1YI9A 2D6PA 3K2OA 4IL7A 4FPLA 3I54A 3OTFA 4N53A 3RDIA 1WUVA 2NM1A 3T30A 5T52A 4AHYA 1ENSA 3AP5A 1M4WA 4XJ8A 2BP6A 1AXKA 3GHMA 5FPLA 5FP7A 1W2AX 1ZBE3 2VBDA 4Q4V2 4GH4B 1BK1A 3BI3A 5SV5A 4B3NA 2AEZA 2J1EA 1RUC2 5J37A 1SACA 5K0UB 5C8WA 4K1YA 1JOJA 3RYKA 2OZ6A 2PHDA 2ORZA 2W47A 4W4ZA 2XLGA 4TWTA 5FK8A 3PU3A 4CXXA 4EE2A 4EWAA 2XBO3 1D2SA 2BNOA 5IVBA 3E5XA 1QDOA 1BMV1 4IEWA 1X50A 4MZUA 4DY3A 4CP9B 4YVWA 1MS8A 3VBUB 1G9AA 3ZN6B 3OF1A 3FFQA 3OBRA 4GKYA 5E8AA 4YW2A 4A42A 1UXXX 4EZ4A 2ID4A 2QQIA 2GNTA 1GP6A 3WNKA 2Q1ZB 2W94A 2R30A 1OH3A 5E16A 4PIYA 1C5IA 4XETA 1L7RA 4AI1A 2PLV3 2AGSA 4JQRA 4EV0A 4WV8A 4CTEA 1FPN1 4CZSA 4LBOA 3E6DA 5D2AA 1WCDJ 1LEDA 4XF3A 4NHYA 5FZBA 5BNQA 3H8XA 1AXZA 3KMHA 1LOBA 1RUF3 1W8OA 1XBFA 4NUBA 4UW6A 4XABA 5A6QA 3KCXA 1DP0A 5FDBA 2XJSA 3MIHA 4GWIA 3CDZB 2VL4A 3A22A 1O8SA 1X7NA 2XQRA 1YXWA 1AR73 3NV4A 4XFIA 4FFFA 1F5FA 2ATFA 4V1PA 3ITQA 3L9JT 3ZO0B 5J36A 3VD5A 1UIJA 3EHKA 1G8WA 1OFNA 2ZAHA 3WDTA 4AI0A 1B35A 1LOEA 4QKDA 5I0TA 3ES4A 5A6ZA 2EICA 1QNWA 2ZMLA 3TWIA 3CJIC 3ENRA 4AK3A 2VTFA 2EXJA 1NYWA 4WM8A 4NO4A 2DUOA 4SLIA 4BQ4A 5BY5A 4PBOA 2EA7A 1EUTA 5C3SA 3HQUA 3RMYA 3J26N 2WRAA 4NPLA 1NCQC 1WMDA 2J1VA 4FFIA 2FQPA 3GJAA 3JD72 4RSUA 4Q8LA 1IPKA 2ZGOA 3AP7A 2WZ8A 1H1MA 2WYFA 2D93A 3KVBA 1YJKA 4CVUA 4JAAA 4QGMA 4J1WA 4I3GA 4ZXEA 1POV3 4BQWA 5GLZA 4Q26A 3CZJA 2Z42A 2ZKLA 3THDA 3ZFEA 1EPWA 5DAQA 1QJU2 1O4TA 4HPKB 5JXJA 4E4SA 1KEXA 2WLPA 3OYWB 2PHXA 2SBAA 2XVGA 2XLAA 3GZTB 1ULCA 3H1WA 3UKVA 1VBC2 1NY71 4WBBA 4XFFA 4FPFA 4P9GA 2YFUA 1GQHA 2ZX0A 3MF9A 3MPBA 2WWSA 4LO4B 4S2DA 4ES9A 3RZKA 4X6RB 1ASJ3 3POFA 3M3EA 4YG0A 4LEJA 5DXDA 5EYXA 2VBBA 2QJVA 1NUKA 5FZIA 2XJPA 5K8SA 1T6BX 2ZZJA 4EROA 1RUG3 4Y1UA 5HXMA 1W9WA 4NPMA 1SG3A 3PIGA 4HSLA 2QE3A 4DNYA 3GCXA 3VUOA 3P3PA 1BBT2 4LBJA 1ND2C 5HCHA 1NOVA 2WA4A 1IQAA 1WLCA 4KG8A 3ZYBA 5T55A 1SDWA 3FLRA 3VN4A 3ZIWA 3DXTA 1DGLA 4P9IA 4AGGA 2ZX2A 2JDHA 1XU1A 4C0HA 3GBWA 1O7FA 1C5HA 4B4RA 3RFRA 2TBVA 2HWD3 3O0XA 5FWJA 2HLEA 2XHKA 1RUH2 1XE7A 2FCUA 3V0AA 5EIYB 5DABA 1H0BA 1GZWA 1MS5A 1Z7S2 2BQPA 4PHZA 5LBEA 3B5LB 5B4NA 1AR63 3LQCA 4YYOA 3G7DA 2WT2A 1J1TA 4AQ6A 4QXBA 5DUVA 3GXUA 2BVVA 2PLV2 1BJQA 4MUVA 2VC9A 1K12A 3OGJA 3VZNA 1HRV2 3AMHA 2G19A 1UAIA 1RUF2 4CDWC 4CUGA 2CNAA 1VIWB 2WNUB 2QQLA 3IN9A 4XUPA 4JGYC 2JJ6A 3GZEA 4QM9A 3VBSB 4UFKA 3INAA 3Q8EA 3Q8BA 3ZR5A 1RUD2 4XPVA 4MVTA 4H2AA 2EAKA 1IPJA 1GUIA 3AXDA 1VB4A 3DN7A 3LF7A 4META 2XVKA 3I2GA 1RXGA 5FQ0B 3PMSA 2RS53 4I09A 1PGL1 2B7YA 5FFOC 5L9RA 3WP3A 3QH6A 5A7WA 4IUGA 4WM7A 1ULOA 5H9PA 2Z4FA 1AYM3 4MGYE 2Y0IA 2YGLA 4BE3A 1JHJA 1QMJA 3DUIA 4QXHA 3WCSA 4M00A 3VKNA 2Z69A 1OQEA 1ZZ8A 4Y1VA 2Q8CA 4PDWA 1CX1A 4KWKA 1IS5A 4AYUA 4UW3A 4CP2A 4OMDA 4Z8BA 4CEWC 4LT5A 1UCXA 4L2NA 3CHXA 1F2NA 2P4EA 4P00B 1VMFA 1SCSA 4BIOA 1S2EA 2XGXA 3U37A 3WF4A 2C1FA 3ZYRA 4ONUA 1DLCA 2CGNA 2Y6HA 1O91A 1POQA 2SLIA 4QXCA 2FDFA 4XFBA 5JR7B 4OUEA 3TEWA 1VRH1 3WCRA 2PFWA 1S0EA 4FVVA 5A3PA 5JXIA 1PMIA 2VPVA 3I3EA 1UZVA 1FX5A 1ZYBA 4MOAA 2J7MA 3KT1A 4N53C 2YC4A 2CHHA 4Y1XA 4YZ5A 1V6MA 1IPSA 2WFF1 1CN1A 2ZEYA 2OPWA 4EJRA 2WA3A 3J7HA 3SH3A 3IBMA 1OF4A 1PVXA 2O8QA 5D8AA 5KHJA 4Q0UA 2JG8A 4NMIA 5IK7A 2ZACA 3RQ0A 5AFBA 1UKGA 3VD3A 4NRQA 3GALA 3EMRA 2XWJB 4UT5A 4GULA 1J84A 4XIOA 5SV8A 4CCMA 5I0SA 4NHLA 4QQPA 2JECA 3H1MA 3MIDA 2EXHA 1M06G 1H30A 1XYPA 2YBPA 4GKXA 2ZHNA 3K3NA 2YPJA 4YVWC 5CFDC 4DQAA 2PA7A 5FZMA 1BHGA 2RJKA 5T5PA 1MVQA 4AVVA 4Z07A 4A44A 4IE4A 3QCWA 2J42A 4IEQA 2YUEA 1JOPA 2R041 4H55A 4WZCA 3W58A 2VW1A 2WAAA 4UFMA 3D6EA 5K4LA 2ZGQA 3V56A 4BQ1A 1NY72 3WW3A 1UD1A 1JN2P 2ZJCA 1VB2A 5F37A 3KSCA 3RMXA 3N9OA 3AZZA 4LIVA 3NRUA 3VHRA 3ZSEA 1OKOA 1PGSA 1SLAA 4A41A 1AR81 4QPIA 1W05A 2HWE1 3K77A 2NN8A 3GCWA 3AZWA 3I2KA 5FZGA 2WWJA 2ZHLA 4AAPA 1W8UA 4HN0A 4QX8A 4CP1A 4P5YA 4EN6B 2X5IB 2FCVA 4N43B 1B35C 2ETEA 4CDXA 1Y9QA 3MHZA 3PTYA 2WS91 1MACA 3I59A 3IPVA 5FMCA 3ZFEB 2N7GA 1VBD3 5A3UA 4WM8C 4QPGA 4K3UA 3OBAA 2RS52 3WXPA 2RMU3 4XQDA 1UU5A 1CAWA 3E6BA 5A7OA 1ENXA 2AEYA 5DG2A 2F4PA 4BMEA 4CCNA 3WP4A 5FKBA 2ZBJA 1VJ2A 2R1BA 2BPA2 1HXS3 3AZVA 4LKEA 4CE8A 5ACA3 3NV3A 3WNMA 1MS0A 1W04A 1BKZA 4UXAA 3IMMA 3SKJE 1HJGA 4J25A 4E27A 1HB2A 4UW5A 4BMBA 4Q4W3 2JG9A 5CKQA 2HWB1 1YLLA 3LDBA 1W6OA 2GU9A 1W28A 1ULGA 2CGPA 1SPPA 2DF7A 2VECA 4OHZA 4LUMA 2FZ1A 4LITA 5GLVA 1SLBA 2LROA 3ZXGA 3I2OA 1UL9A 3P6BA 1GZTA 5A7NA 4B4QA 4CCLA 2Y38A 2Y6KA 5EZWA 1UY4A 5AVPA 2QQMA 4BOWA 3H8RA 2HYXA 1FYUA 2GZWA 2UY8A 1V70A 1SLCA 5GM0A 3BOWA 3ES1A 4AI2A 3ABZA 5CA6A 3AYCA 1E5RA 1JI6A 3KT4A 3LPFA 1G6NA 3I49A 1IOAA 4Y24A 2ZX1A 3V64A 4LMFA 4B29A 5L7OA 3BTXA 1PGL2 1GP4A 1UY1A 1HKDA 3UETA 5LY2A 3USSA 3FLPA 4XMIA 4Y5SA 1CPMA 1LOGA 5FPAA 1J58A 3AP9A 4QM8A 4RHV3 4QX3A 1TME1 2QQWA 3WNOA 4XXAA 5APAA 3VHOA 1EV13 5LCWL 2VCCA 1CX4A 4XFCA 1A8DA 1G9BA 5FMOL 5FZLA 5KWRA 5HCAA 2WR9A 3ZN5A 4NRMA 2OQ7A 1RL3A 3BN6A 3BGAA 5CZKA 3WG2A 1V6LA 2C26A 3ZYJB 5F3CA 1C1LA 1OT5A 4W65A 5EP9A 1CGPA 2A73B 4XHBA 3JB4C 3LDKA 2P3JA 1KDMA 3VDBA 1NA1B 1UX6A 2IVJA 2J1SA 1JZ8A 3T0DA 2MEV3 4QQ2A 1JZ2A 3RWNA 5I8TA 3U4XA 4XQ4A 5GZEA 3TNPB 1IG0A 3WQ0A 3AYDA 2UYBA 1LULA 1W6PB 3AMQA 4GMP3 5FYYA 1DG6A 1HN1A 2WAOA 3UJOA 3WUDA 2P6HA 1R1A1 1COV1 4DRVA 2Q1FA 1VLNA 4Q27A 3VBRA 3BIEA 3UYJA 2ZGMA 5IYYA 1MEC1 1NAEA 5JR2A 2FZ2A 2CSGA 4FPOB 4WM7C 2ZABA 1DFQA 1FT9A 1OVPA 1R1ZA 3NAPA 1X8EA 2ZHKA 3MBWA 3OJBA 4XFHA 4FO9A 3A7QA 4CEYB 2IUWA 2UURA 1V6NA 2D3SA 3I97A 3OSDA 1VBE1 4KU8A 2B4KA 3B93A 4PDWC 5FZEA 4IV3A 4KBBA 1K5MA 5AC91 2VQTA 1RHI1 3NNFA 2QCSB 1LOCA 4L92A 1QJX1 2JXAA 4RS5A 2VCAA 4QKFA 4OYUA 1ALYA 1BEV3 2CWMA 4COVA 4JGZA 4Q4W2 3VBHA 3OOXA 5F3IA 5FWEA 2BV4A 4LBQA 1DZRA 4MYEA 3UGGA 4D8MA 2H6BA 1TMF1 4PF5A 2BBAA 4YZ2A 3N4MA 2RS33 2D7FA 3NKTA 1Y9GA 4LO6B 4HT1T 3ZX7A 2HEYF 2ILMA 3LFIA 3TN93 1YFXA 1HIXA 2ZS6B 1ZBA1 3WZ1A 1MZFA 2HWC2 1EAH1 3N36A 4Y4RA 4HVQA 4AQTA 3NVCA 2R16A 2D6LX 2QQUA 2W9XA 1GWMA 5FR3A 2GMMA 5LATA 5LA0A 3KCYA 3AVSA 3JUUA 5KC6A 1AYN3 4LXLA 5D8AC 3J7NA 2JG8C 5ERLA 1PO22 4DS0A 3U78A 3HAGA 1FOD1 5FOBB 2H0BA 2JB4A 4IESA 5C33A 1VBA2 4D3WA 2X05A 3CZUA 1HQLA 2GNBA 2HEVF 1S2BA 1WW6A 2VUDA 4OCTA 4LNVA 4RHV2 5FZ4A 5EV7A 1GFF2 1CAUB 1FV3A 2P37A 2P34A 1A8MA 3BPZA 5A1LA 1C28A 2CAUA 5F5AA 1NKGA 2DV9A 1WKYA 2ZOEB 3BALA 4GH4A 1AL21 3A0KA 4CCDA 4XF0A 5JZGB 3I59B 1LHOA 2IFWA 2Q4SA 2WDBA 4XVHA 1KITA 4QPGB 1OQDA 3GYDA 1QGLA 3ZYHA 2ORXA 1ULEA 2VM9A 5JI9A 1RMU1 2BW8A 5KXCA 1CAWB 5LWBA 1QNYA 4YG6A 3WG3A 3M2MA 4QPIC 5HCBA 2A3YA 4MXVA 3ZN6A 1W8NA 1QIQA 3ZKYA 3ETQA 1HDKA 3ZXKA 4QHOA 1GMMA 1HX6A 2UWCA 3CMGA 4AWDA 4R4ZA 4ARYA 3VBFB 1AL0G 4GB33 2K0GA 5J98B 4CDXC 4HZFA 3IAPA 4Y22A 3FHIB 3TEYA 2BGPA 1N47A 4QPGC 3S6PA 2VAUA 4RA0A 1W6NB 4E4ZA 4BISA 5DN2A 4A45A 2ADDA 4YFZA 4MGKE 3A23A 4XZUG 3I3BA 1OLQA 1CR7A 3C7EA 3UGFA 4ZS3A 3DCQA 2D6MA 3SQOA 1GYKA 1XB9A 4ATFA 5DUXA 1LHNA 3OGSA 1LJ7A 3VLBB 3PVNA 2BDRA 4XIKA 2JG9C 3ELNA 1H1AA 2VMFA 4JDOA 2W52A 4CDUC 2WUHA 2A71A 1BEV2 2ZGKA 2P5BA 3WP5A 3FHQA 4BXFA 2BBVA 4Q0SA 3U14A 1JBCA 2DFCA 4IE6A 1PZ7A 2BVBA 2A70A 1ZRCA 1NG0A 3NNLA 5FYTA 4CDQB 4LO8A 3RSJA 4ZU7A 4DXTA 2WZR3 4AEJA 1DZQA 2RS32 3NNGA 2Y6GA 1O3RA 2VZRA 3ZN4A 5E6HA 2V73A 1C8M2 5F6KA 3J8F3 2ZEXA 3TEZA 1GANA 2DVBA 2XKOA 2VOWA 1UY2A 3QD6A 4YGEA 3V0BB 3VKOA 4YM0A 4HPKA 4Q4V3 5LBFA 1PHMA 1LGBA 1RUI1 2YU2A 3VKLA 4AEMA 3OYWA 4M3CB 5ABJB 5L7OC 3DYOA 3RZZA 2ES3A 4CXWA 5C70A 2R061 1A34A 3AP6A 1GICA 3POYA 3T4HB 4BZ4A 1MEC2 4H7LA 4ITCA 4J1XA 3DYMA 5LBBA 1URXA 3ZVXA 1H2KA 3C8XA 1RJ7A 1DGWA 3JBG3 4YWAA 4ASMB 1O59A 3A0NA 3AKRA 1XOYA 2DWRA 3CIHA 2VQUA 2NLRA 2VG9A 3OEAA 2IXHA 2RDNA 4IE5A 4A7KA 4LLOA 1GOHA 2EVXA 4JRAA 4AHXA 5AC92 5JXHA 3RYPA 3H3UA 1QJX2 3AL5A 5CKMA 4MHUA 5CU1A 3RG0A 2AH2A 3LEMA 4WVWA
chains in the Genus database with same CATH topology
4AGVA 3J9SA 1WLTA 3VBRB 4Q4X1 1UF2C 3N7LA 2PAEA 5CFCC 3I4IA 1SLTA 1CAVB 1V6IA 3NW4A 1H8VA 4YVSA 3WHTA 4JCKA 2RR11 1F9KA 4XOGA 2QVSB 2YDEA 3D4KA 5C4WA 4OI2A 4I01A 4GB32 3WW1A 1TEIA 4RS5B 3WDYA 2ZGUA 3ZSJA 1D4M1 3AYAA 3WY6A 1HQWA 3MF6A 2GNMA 2WNUA 5JDBA 4IEVA 2LTNA 3NAPC 3SXWA 2E7QA 3VBSA 4XJ9A 3NSTA 4WVVA 4Y4YA 1G9CA 1ZZCA 4PLMA 1KDKA 1CJPA 2UWBA 4UBGA 5C8CC 4IV3C 1QJU3 1X8MA 2ZHMA 3ME2A 4YGCA 2BGCA 1LGNA 1K5MC 1RC6A 4L11A 1VBC3 1PIV1 1C1FA 4JV4A 4JGZC 3VBHC 3KGZA 2BFUS 1ZBE1 2ET7A 3CEWA 3O0VA 4P9LA 1WLWA 1W0PA 4YGBA 1N1VA 4JTNA 2XBO1 1NCRB 3S7EA 2X8KA 4ATEA 2ET1A 2ZGLA 1SBEA 2GH8A 5IK8A 1BBT3 1DQ4A 2F6BA 1DQ1A 3J8F2 2LALA 4DRRA 4OZXA 5LK7B 3ZXDA 3WT3A 5T5OA 2VW0A 4IQPA 4JTOA 4C90A 1ND3B 1LGCA 2A6XA 1ZA4A 2D5FA 2W0XA 2VU9A 3KS7A 5JMCA 3MLLA 1PGW1 1RUH3 3JBG2 4RR3B 3ROUA 1Z7S3 1YHFA 4NVPA 4XQWA 4ZU4A 1REDA 2CYFA 2JE9A 3AX4A 1H2LA 2OZJA 3ECQA 4GH4C 3M3IA 3E5UA 4HKLA 1HRI2 4Y22B 1HRV3 5K0UC 1MS3A 4N90A 5KHHA 3ZYIB 5CB7A 2C0ZA 1PK6B 3IIAA 4D7YA 2TNFA 2K9ZA 3ZXAC 3LA7A 1N3PA 5CG9A 3WP6A 3PJQA 3LSDA 3VBUC 4FCAA 1NLRA 1RUD3 1O3SA 3MFAA 1XQNA 5JOXA 3PNAA 1J3PA 5L73A 2V5YA 1U5XA 4X6QB 1DIWA 2OVUA 3HT2A 4FOWA 1SBDA 5CVRA 2RE9A 3TNQA 4YZ4A 2DU1A 2B45X 3H8UA 3N7MA 1BZWA 4YM3A 4WZFA 1ZZ7A 4K9SA 5GALA 1CQ9A 2VOVA 2W08A 3B94A 1R081 2R1DA 2D6OX 1XYNA 4W6XA 2X5IA 2Q5TA 4N43A 1MZ6A 4IV1B 1O5UA 3EO6A 3HQXA 1FPN3 1QXRA 5JI7A 2WNVA 3RI8A 1VBB1 2HWF2 1V9U2 1OPMA 2A6YA 1PNGA 1G86A 2TUNA 3MLKA 1I5ZA 5LRRA 2VOXA 1QXPA 1RJ8A 1S1AA 3N3HA 1KQRA 1XNBA 3WG4A 4PCRA 3FUQA 2WT1A 1ZNPA 1YNAA 3QACA 5JWPA 1V6OA 1VAKA 5IK5A 5BXXA 1T6GC 4FPEA 5JAXA 4XTMA 4YG3A 1APNA 1ZRDA 1DDLA 3HR9A 4KQ7A 3HD8B 2O0OA 1AR61 1MVEA 4YNIA 2VVEA 1DU3D 2YROA 3T2TA 4RQPA 1AR92 2AUYA 2YC0A 3LWCA 1NXMA 2XPJA 1C57A 4MLOA 5EYYA 1OHFA 4XXPA 1WMFA 1VP6A 5FO7B 2PELA 3U0ZA 2ZMKA 1Q8PA 4OULA 5H9SA 1RINA 4YVSB 5DZEA 3BU7A 4YARA 4OUSA 1WD3A 3ZSMA 5C4WB 3CLPA 4XHXA 3KQRA 1JUHA 4NWVA 3SH5A 4EWDA 3SMHA 4WVZA 4YW3A 1EYBA 3FUOA 5EJ3A 3WX5A 3ZPYA 1AX1A 1ZX5A 4IEXA 4QQLA 1QY4A 1LU2A 1AYM1 4ZU5A 4BM8A 1CESA 4HK9A 4FTBA 1SFYA 1S0FA 2P17A 4WVMA 3KZ4C 3MIEA 1UPSA 5HCFA 4Q8KA 2IXLA 2UY9A 5C4WC 3ALQA 4B7EA 4AI3A 3ZXJA 1RUJ1 3VGIA 1SEFA 4LBQD 5DUWA 1A6CA 2VULA 2PYTA 3QLQA 1XXNA 2VUJA 3WR0A 2WNUC 3WQ1A 5KHJA 4FOQA 1NA1A 1ULFA 1BMV2 3VBSC 1FMD1 2B9UA 1DGRN 2D43A 1WCKA 2PHUA 2PAMA 4R8HA 4QXKA 1W6PA 1D2QA 1TNRA 2BNNA 3E5QA 3I8TA 3IWZA 1QQP1 3TBDA 1FPN2 2NMNA 4OHYA 4K1ZA 2VMGA 4N7IA 2BUKA 2WIIB 2KM2A 5H9QA 3W59A 4FOYA 2MPFA 4G9SB 3E6CC 4HVOA 5JVVA 4CEYA 5GZFA 1O4ZA 4EN8B 1U5YA 3HIFA 4TYSA 2ZX4A 5F9TA 4S2GA 1YFWA 4P9XA 4XF9A 3B9IA 3WNXA 3H7YA 5HBAA 4AVCA 1D0HA 1QHDA 1QJY1 2VW2A 3EJKA 2NP0A 3D5OA 3THPA 2VQ0A 5GLWA 5BNNB 3RI9A 4YZ1A 3ILFA 1H9PA 1R082 5BNOB 3H7JA 1LTEA 1IKPA 2DCJA 3ZFGB 4HETA 4S2FA 2QZ2A 2PHWA 3KLSA 2BYVE 4KGGA 4Y26A 3M3CA 5EWSA 4EWEA 1VBB2 4P14A 3ZSLA 4AVTA 2KXLA 2AREA 2ZA9A 1VBD1 4FP3A 3EBRA 5C9AB 4DFSA 1MQTB 2RMU1 2OPKA 2NQYA 1BVVA 2EIGA 4FPCA 3BB6A 1CAUA 2VVFA 3QBQA 1DYPA 4DPNA 3M70A 4HMZA 2ZAAA 1JHNA 1XNKA 5ACA1 3HN1A 1Z78A 5DDJ1 5JZGA 3OY8B 4LBLA 5J7MA 2WNVB 2WSUA 4YLZA 3W9AA 1U5IA 3D0SA 4PLOA 2DYCA 3C3VA 1VALA 4PIZA 2EF6A 1PZ9A 2ZX3A 2AZ5A 5GZDA 5T3NA 1GSLA 2ZCWA 4XW3A 3VZLA 1I6XA 4K7JA 2D6NA 4P9YA 4QPYA 4AVSA 5FOJB 4D7TA 1ZRFA 2X5IC 4N43C 2R043 3VBFA 4KWLA 3USUB 4I0WB 1AUYA 2YHJA 2GSYA 5DZGA 1OQ1A 3ZFEC 1SLIA 4LHLA 2E53A 1W6NA 3WG1A 3FE5A 5F5QA 3VZKA 2XH6A 4RQPB 3KT7A 1S0CA 1VAVA 1YJLA 4AFAA 2PHFA 2HWC3 3HMYA 2DFBA 3WW2A 3RS6A 2I2SA 5FLJA 4LE3A 2WL1A 1S2KA 2JICA 2WS93 1DF0A 1YO8A 3AZXA 1PO23 5CNAA 4MGZE 1IS6A 3AB0A 4Y1ZA 1X36A 2ERFA 1VBA3 1DQ6A 3ZFFB 3MI8A 4CDQA 4UBHA 1H4GA 5TSWA 1WLDA 3DF0A 1Y3TA 2EAAA 1B09A 1YIPA 4Q1PA 4AQSA 3V0BA 4LO7A 1RGSA 3R4DB 5ABJA 4Z92B 2HWB3 4M3CA 4WVMB 4AG4A 2R071 1PZ8A 1PO11 1Y43B 2XKPA 4GMP1 1RVF1 5K7PA 3OD4A 2RM21 1EP0A 4R4XA 4IEYA 2VUAA 4A7ZA 1VRH2 1WW7A 4GMP0 2IFRA 1EY2A 4OI4A 3EXUA 1KFXL 3MW2A 5BNPB 2P3KA 5KBFA 2WFF2 3WLUA 3HWJA 4BIFA 3UL2A 1FXZA 1NZCA 1QJY2 1DBNA 3VDDA 5GZCA 5CIRA 3ILRA 3WQ7A 2ZPXA 1XE8A 4LBNA 1GBGA 4Y20B 4W6YA 3OPZA 1TME3 2DVGA 1CAVA 4FTEA 1NA1C 2CWSA 3BIWE 4YW4A 1WA4A 4FOVA 2E6VA 2ZGTA 2AENA 3TN91 4F7ZA 2BTVC 3A4UA 4D7SA 5FTTC 4FPKA 2DTWA 2R042 1SBFA 3PJYA 2CGOA 4AQ2A 5JOZA 1OOPB 4TZDA 1ENRA 4P9JA 1AYN1 5T5JA 2UYAA 4AFCA 4ZKTB 2CTVA 3AJZA 1AR82 2QFEA 3JB8A 4Q4Y1 1BQPA 2HWE2 2NYYA 3BODA 1C8M3 1GQGA 4CEYC 2HEWF 1ZZ9A 2GMPA 2GDFA 3S0MA 3I2DA 1DHKB 2IZWA 4GALA 1HW5A 2LM3A 1COV3 5DDJ2 2WS92 2X53S 3J4UH 4MXWB 4K6BA 1MEC3 3MYXA 2C5DA 4C1WA 4LR4A 4DXZA 1AX0A 2XJRA 3T1LA 2QDNA 5JOYA 4AFBA 2DTYA 1NCRA 3JQWA 4FXGB 3S30A 1VBE3 3AMPA 2WINB 4OUMA 1LOFA 3CU7A 5AC93 1N1SA 1RHI3 4XBLA 2MNGA 1QJX3 4XJUA 3O12A 1RUE1 1UW8A 4I30A 4LUKA 4F83A 2HWB2 2DCZA 2QDRA 2ZGRA 1ND3A 3CL1A 4U2AA 1IGOA 5F1RA 4E2QA 1QOSA 2RS11 1CIWA 4BWOA 2A7AA 4D69A 4XJZA 2D6KA 1ZBA3 4RR3A 1EAH3 1WGPA 3ILNA 2D3RA 5FPZA 3VBOB 2DCKA 1RIRA 3I7DA 5JZGC 3KD4A 1XNCA 2E63A 3ZMNA 1NQDA 1PK6A 3NV2A 4DMIA 4RGAA 1R091 3WV6A 4KGQA 3IMNA 4AGRA 1TME2 3ZXEA 4BPZA 5KHKA 5DZFA 4LO5B 4LA2A 2WZR1 2NZ9A 1HLCA 4W6WA 3VBFC 1AL23 3MLJA 2R072 1MZEA 3SNMA 1PO12 4CRQA 3GZUC 4FAHA 1LENA 1RUC1 4X8NA 1RMU3 2WJSA 2ZGNA 2FBEA 2IXJA 2GH2A 1MS9A 4CYDA 2C9AA 3IM0A 1WW4A 2O1QA 3MEPA 2DUPA 4OFGA 4IV1A 1XYOA 2B5HA 4F8AA 2D3PA 3TB0A 3L2YA 4LTAA 1PVC1 1R1A2 1COV2 1JW6A 4YM1A 1LHUA 3APBA 2ZMNA 3R6SA 1DYKA 5A32A 1NE4A 4ISRA 2PTMA 4CDQC 1W0OA 4RFT0 5IK4A 5JOWA 4DOUA 3B02A 4JC1A 5GKAC 3SCHA 5JSPA 1VBE2 2Q8OA 1S55A 3AMMA 5J3UA 1AXYA 4X8PA 5ABJC 1RHI2 1LEMA 2I74A 2ARBA 1HRI3 2DVAA 5FO8B 3KB5A 3VDDB 3AMNA 3MZHA 5D1IA 1TMF2 3B01A 1H2NA 3HBZA 1AZDA 2Z2SB 4LA3A 3JD71 4ES8A 2JX9A 4AHWA 2UU8A 3V65A 5JPMB 1ZBA2 5CADA 4IETA 1EAH2 3AM2A 3DPRB 4RL7A 2E7TA 3KGLA 4EN0A 1RUI3 4KL1A 3ACLA 4XBQA 3DKWA 5FAXA 5BUVA 4PIXA 1GKBA 2D97A 3H3ZA 5A33B 4HK8A 5CBLA 1OPOA 2XWBB 1W6QB 1MR5A 4C1XA 1MS1A 4YZ3A 1D4VB 3SLIA 3VBRC 1FOD2 2DCYA 5KHGA 1SLLA 3WDUA 1REEA 1DQ0A 5LEKA 4O9EA 4AEDB 2A5ZA 1L3JA 1KRIA 4FSJA 3LA2A 2ARXA 4Q29A 2EXKA 4QD2A 3ST7A 1LB2A 2YZ4A 3IDEA 2R0HA 4FPHA 2BWAA 2HWF3 3CO2A 1V9U3 2GAUA 2B46X 1AL22 2VNOA 1H8TB 4M0HA 4RS5C 2GC0A 3RRDA 1X82A 3VZOA 5JSRA 2ZZQA 2GC3A 1OD5A 1NXD1 5JIUA 1RMU2 5GZGA 2WLQA 3LAGA 1YWKA 1ZZ6A 2A6WA 1C3HA 2RR13 1W39A 3ZDSA 1GNHA 1N1YA 2MHFA 4YSFA 2GC2A 4CEWA 4XILA 3MGUA 3M3QA 1YCIA 3ZXFA 2XL9A 3M3OA 1D4M3 3L2HA 4Q0PA 4MV2A 3UKTA 4P9WA 2PLV1 1AR93 2CAVA 1O4YA 2FHRA 3AYEA 4NWWA 1HRV1 1UN1A 2AR6A 2JENA 4K8FA 1RUF1 3NO8A 4DZGA 1QDCA 1NCRC 4YRDA 3SCFA 1MS4A 3JQXA 1HQNA 3AFGA 4OI1A 1IS3A 1AR71 3FX3A 1LOFC 1RUD1 2QNKA 1E57A 4DB5A 4Q2FA 1PIV3 1XU2A 2R6QA 2R0FA 4AE2A 5GJ6A 4N9IA 5FPXA 2W39A 4M3CE 4XF4A 3E97A 3MICA 4I2OA 1SCRA 3DV8A 3EQEA 1ND3C 4HFSA 5KXEA 1D0GA 4LULA 2WFPA 1QJZA 1AF9A 5BNNA 5JIAA 3PLQA 3ZXLA 5K9YA 4AF9A 4COWA 5BNOA 1J59A 4RR3C 1QOOA 3ZFGA 3PVOA 5CFDA 1NE6A 1DGWX 4BH9A 4M0NA 2D44A 1I3HA 1RUI2 1POV1 1PVC2 3QH7A 4AXOA 3CJIB 1H4HA 3RYRA 2R062 3MFCA 2VY0A 1U12A 1LCLA 5C9AA 3FWEA 1Q3EA 1MQTA 3OBTA 1PK6C 1BVP1 1POV0 2XJTA 3WDVA 1NCQB 3H50A 1G7YA 2XJVA 2D5HA 2PAKA 1UPIA 1ASJ1 3LSEA 4XE9A 1UU4A 1S0BA 1F8VA 1CONA 2K2SA 4R9CA 3VHPA 3AKQA 2LUWA 5I0RA 2XVLA 3OY8A 1AJKA 1RUG1 4Q1RA 2XG3A 3SCGA 1ENQA 4E4DX 1GZ9A 4MX3A 1U0AA 5J48A 4Q4X2 5BV6A 1OMIA 2VMIA 5A32B 1WBLA 5FCCA 4Z82A 1S0GA 5C6CA 1ZRRA 2BWCA 4IV1C 5FLHA 3USUA 1OA2A 2HWD1 2RR12 2JDZA 5BYNA 2ZGPA 1ZM1A 3K51A 3FBYA 2XL7A 4N9HA 1BCXA 1ND2B 1QF3A 2PHRA 4R9BA 3VHNA 1D4M2 3TAYA 1JYIA 3B3QE 1JH5A 3ZYGA 4L99A 2RHPA 1U5ZA 1R083 3BOPA 2YGMA 4K40A 4HN1A 1QH6A 1QKQA 3C2UA 2ZKNA 2GNDA 2VH9A 3NL1A 4GWNA 3D82A 2H0VA 3GBFA 1O3QA 1VBB3 3R05A 5CAZA 3GZAA 1FI2A 2HKXA 4RD7A 1PIV2 1IZ3A 1IKQA 1KJLA 4FXKB 3AFKA 1ZBE2 1YIFA 2RS51 4XEZA 3ZFFA 4XFGA 1LODA 4KU7A 3VV1A 4CDWB 2WQ4A 3GF6A 3BCWA 1BXHA 2XBO2 4M01A 4JGYB 4GQ7A 4BA6A 3M4FA 3JU9A 5B2GB 4YVSC 5GLUA 1YRZA 2PHTA 1TQ5A 4YFWA 3FC0A 1OKQA 1TNFA 1G9FA 4QQOA 2B39A 4OLLA 4COYA 4JRLA 4OHXA 2BFUL 3IT8A 3VZJA 2EALA 5DG1A 4PBPA 1ULDA 3U10A 3P3NA 1PGW2 2A6ZA 3FZ3A 3AJYA 3M8LA 5KXBA 4B4PA 1N3QA 5BNPA 1JTZX 3FMGA 5H9RA 1ZVFA 4FAGA 1AR72 3CNAA 4QGLA 1DQ2A 5FMOS 3UJQA 1EPZA 4XJWA 4CEWB 2OA2A 1Q8QA 2G9FA 3ATGA 4C0BA 4R9DA 1HV1A 2GN7A 1W6MB 4NHKA 4HVRA 4URTA 4Y20A 3SISA 4COZA 3RJRA 5JSOA 3AK0A 3G6JB 1SMVA 3IDBB 4JDNA 2JD4A 1FAYA 4OHWA 3WD5A 4LHKA 4N53B 3AZYA 4ORFA 1OOPA 1RUJ3 4NN0A 4Z1VA 1OFSA 2WNEA 5E1RA 2YV8A 2A75A 2B8MA 3R4SA 2Q1MA 3WW4A 1S0JA 4XMAA 1FMD3 1VR3A 5A3MA 1GV9A 4A3XA 3DGTA 1OSGA 4OVEA 4Y1YA 1RITA 1ASJ2 3WHUA 2GC1A 1YI7A 5CFDB 1J3RA 4YVWB 1X33A 4HSJA 4IERA 1QQP3 5F6LB 4MXWA 1RUG2 3URFA 4QU2A 3UV9A 4XF1A 3LZZA 3NKGA 1NQJA 1QXJA 1VRH3 1FV2A 5BNNC 3S7IA 2Q0AA 1AX2A 2BNMA 2W68A 1LU1A 5BNOC 2YXSA 2OUJA 4HANA 3ZFGC 3GNEA 2WFF3 2WC2A 4FPYA 1OLRA 2JKBA 2HWD2 4R52A 1GNZA 1W2UA 4HKOA 1HXS1 3SHRA 1V00A 3LCPA 2JEMA 1QJY3 1B35B 1S0DA 4OHVA 1XRUA 4K21A 2A3WA 3PMEA 1AR62 3NWKA 4XZPA 2Y0OA 2QZ3A 1GZCA 4Q4W1 4WM8B 4E9KA 4K20A 3AKTA 4L9BA 5C9AC 1MQTC 1Y7BA 3GHNA 4U36A 2AYHA 3FLTA 3O14A 2GALA 2CL2A 2NPIA 4CP0A 4QGNA 2Y26A 3VBOA 1N1TA 3R0RA 3O0WA 2HWC1 4PJYA 2RJLA 3K48A 4MSVA 1S0IA 4A2UA 1UKRA 1YFYA 3WINE 2TEPA 1C8NA 2G4IA 2ENRA 2WNVC 3HT1A 3MIBA 2WQZC 2VMHA 1Q8SA 2QQPA 1GLHA 1PO21 1AR83 2DU0A 2HWE3 3D8CA 5FREA 1VBA1 4LE4A 4I02A 5KHIA 3PVEA 1KS4A 3KM5A 3U11A 1AYM2 1LESA 1UU6A 4RHV1 4XBNA 4P5HA 3ZIXA 4AHZA 5DDJ3 5JPNB 1LKNA 1EV11 4I3PA 4BHPA 1JYCA 4JVAA 1IS4A 4YW1A 4CDUA 1RUJ2 4H3WA 2Z5WA 3AP4A 1JUIA 4RQPC 1VAMA 4AFDA 4J6GA 3CJXA 1FATA 2PHLA 1DQ5A 2WZPP 3LKJA 1FMD2 3PHMA 2VNRA 4LHNA 3N35A 4LLFA 3V0AB 2MEV1 1GZWB 1QQP2 5T54A 1AHSA 4XTPA 4COUA 1YUDA 3POSA 3POWA 3ZFFC 2WKKA 4ASLA 4DY5A 5LRSA 2WT0A 5L19A 2A3XA 1KXGA 3T1MA 2I45A 1UZYA 2PN5A 4IEZA 3B69A 4EN7B 2R49A 4XYXA 4L8QA 1F5JA 1I9RA 4DINB 2YMZA 3IDCB 2DUQA 5LK5A 1JXNA 5FO9B 1BEV1 1KJRA 2B42B 3OCPA 1I1EA 3LOIA 2IXKA 5CFCA 4FP2A 4WM7B 1AJOA 3D0JA 1RTVA 3DPRA 5JLVA 2RS31 5BNPC 4G4FA 4YM2A 1C8M1 1LECA 4PDWB 2R073 4GA9A 4MGIE 1ONAA 5KC5A 4FTSA 1PO13 2NMOA 1RVF3 2E9QA 5A33A 4PQ9A 1W6QA 1CVNA 2RM23 3THTA 3VKFC 3N7JA 1VBD2 1Q8VA 2XB6C 4MH0E 2A6VA 4IEOA 4AEDA 2RMU2 2HYKA 2GMEA 3OD0A 1Q56A 1NLSA 1RUOA 2XLFA 1AVBA 2OIIA 4NR1A 5C8CA 1C4RA 1HXS2 1N3OA 5ACA2 1LR5A 1MZ5A 4I0BA 1CAXA 1R1A3 1H8TA 2ZGSA 1OOPC 4D94A 1V6JA 3VL9A 2P2KA 4QT6A 2WSVA 2X29A 3IKWA 5D8AB 4AW7A 2JG8B 3WDXA 5GLTA 4FPGA 3MIGA 4IXLA 2CY6A 3SH4A 1QOTA 4AVAA 4UW4A 1FNZA 3WUCA 1J3QA 2HJIA 2D40A 2OYZA 3LOBA 4OI0A 1QWRA 1J1LA 4ZXKA 2VVDA 3AXEA 1UIKA 4KH9A 4KNCA 2D98A 4O9GA 2XUMA 3O5SA 4Q0QA 1UZZA 3ASIA 3CF6E 2EXIA 2YYOA 5J09A 3U07A 2VOKA 4GIQA 3ZYPA 1OA4A 4GB31 3NJZA 1SFNA 3M1HA 1DZTA 4I0AA 3FBMA 1TMF3 5JCTA 5HXVA 4Q4Y3 5I0UA 2Q30A 3RNSA 3H0OA 4QQHA 5A3LA 1LHWA 4F3JA 2QUOA 1BYHA 3KCCA 4KWJA 2IXIA 1QH7A 2ZTNA 4QPIB 4HBNA 4LBMA 5HI0A 5I93A 4B8EA 4GXLA 3M7AA 1EV12 3RPQA 4HKWA 3MW4A 5KXDA 4CDXB 2O8OA 5L36A 1FOD3 3LGRA 3IPVB 5K0UA 3MW3A 2H6CA 4AEKA 3OGGA 2IC1A 2BEOA 2QKDA 5IUQA 2VNGA 4Q0VA 4XJAA 5DUUA 3JCIA 3VBUA 1WW5A 4B7KA 3VBOC 3TRSB 4A7YA 4ISQA 2XJQA 4HLTA 4FPJA 1RUE3 4RGGA 2FMDA 2IXCA 3MDPA 1LRHA 2MEV2 2P3IA 4AFMA 1TE1B 3J8F1 2PQQA 3CJIA 4YGDA 2Z79A 4YW5A 1QU0A 2JG9B 4Q4V1 1REFA 4AI8A 1RVF2 4IEUA 2RS13 4INDA 5FBZA 3JZVA 2FMYA 3Q9OA 5E89A 3WDWA 4CDUB 2RM22 1NCQA 1W6OB 3FFZA 4BLJA 3B00A 1FNYA 3ZSKA 1UMZA 4NHMA 4Y5Z0 3QOPA 4M3CF 3WOGA 3JBG1 2R32A 5E88A 1KS5A 4HL0A 3RJ2X 2DVFA 3VZMA 3X29B 1H9WA 5T5LA 4G3YC 3TYJA 5L7OB 1ZREA 1HRI1 4AVBA 4SBVA 5LEJA 4TLFA 1R093 1WD4A 4FBFA 2GN3A 2CV6A 1A78A 4H7MA 3GBGA 5J96B 1ZZBA 1H1IA 1Z0HA 2KA3A 5EFUA 3TN92 3VL8A 1G9DA 1PM7A 4L97A 1SQ4A 3MIFA 3H9AA 4QX5A 1KD7A 2OW4A 2YY1A 3WVJA 2E7AA 1ND2A 4BLIA 1RUC3 5I91A 5T50A 1YYNA 3B7MA 1AYN2 1WMEA 2G9GA 1RB8G 4E2GA 3AKPA 3R4UA 4QHBA 2VQAA 4FQ4A 1Q43A 4JDMA 1WBFA 4Q4Y2 1O3TA 5CFCB 5EXOA 1F31A 4BYYA 4NPRA 1YFUA 2DURA 5IT6A 1OA3A 2V09A 1OI6A 1O5LA 1PVC3 3MPPG 2R063 4PLNA 1QJU1 2HWF1 4XDQA 1V9U1 3LB9A 3VDDC 4C91A 1CJDA 1VBC1 2DCTA 5AFEA 1WCSA 4N7UA 4CDWA 5FLIA 3N7KA 4NOTA 5AVAA 3NAPB 4JGYA 4KG0A 4EN9B 2I07B 4QMAA 3DPRC 4TSVA 4LBKA 4FQZA 4BCUA 1IHMA 1V6KA 4FT8A 5I8YA 5C8CB 4IV3B 1RUE2 3SITA 1K5MB 2JE7A 1LOAA 1BBT1 1CAXB 1A3KA 1LHVA 4Z2WA 4Q4X3 2UWAA 5CG8A 4JGZB 3VBHB 3JD73 3UKNA 1AR91 1H2MA 2IWGB 2RS12 4Z8BA 3UK9A 4AEDC 4LBQB 5I8SA 4IEPA 5BPXA 3VKMA 2XJUA 1PNFA 3H1YA 2E51A 2VGDA 1CD3G 1GR3A 4S2HA 4XFAA 2OUHA 3PVBB 1CPNA 4H14A 3BTAA 1HV0A 3DL3A 1RUH1 1RUNA 1XNDA 5FRAA 3FJSA 3TOJA 4E2SA 1Z7S1 5FQ0A 1H8TC 3AKSA 1W6MA 3B9CA 3O7OA 1KFUL 2DVDA 3LA3A 3ZMOA 4R9AA 1R092 1DGRA 2VXRA 1Q8OA 4GWMA 1DLLA 3NV1A 2WZR2 1Q5OA 1YI9A 2D6PA 4IL7A 4N53A 4FPLA 3I54A 3OTFA 3RDIA 1WUVA 2NM1A 5T52A 4AHYA 1ENSA 3AP5A 1M4WA 4XJ8A 3GHMA 1AXKA 1ZBE3 4Q4V2 4GH4B 1BK1A 5SV5A 4B3NA 5J37A 1RUC2 1SACA 5K0UB 5C8WA 4K1YA 1JOJA 3RYKA 2OZ6A 2PHDA 2XLGA 4TWTA 4EWAA 2XBO3 1D2SA 2BNOA 3E5XA 1QDOA 1BMV1 4IEWA 1X50A 4MZUA 4DY3A 4YVWA 1MS8A 3VBUB 1G9AA 3ZN6B 3OF1A 3FFQA 3OBRA 4GKYA 5E8AA 4YW2A 2GNTA 2Q1ZB 2R30A 5E16A 4PIYA 1C5IA 4XETA 4AI1A 2PLV3 2AGSA 4JQRA 4EV0A 4WV8A 4CTEA 1FPN1 4CZSA 4LBOA 3E6DA 1WCDJ 1LEDA 4XF3A 5BNQA 1AXZA 3KMHA 1LOBA 1RUF3 4UW6A 3KCXA 5FDBA 2XJSA