2Q1MA

Crystal structure of human gitrl
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tumor necrosis factor ligand superfamily member 18
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1mA00
5KC6A 4QQOA 2JG8C 4KGGA 3LKJA 3URFA 3IT8A 4RSUA 1RJ8A 4E4DX 3K48A 1TNRA 3B9IA 1OQDA 1RJ7A 4G4FA 3QD6A 3ME2A 2WNUA 4QPYA 2R30A 1TNFA 2RE9A 3QBQA 4J6GA 1OQEA 2JG9C 2WNUC 2OIIA 5HBAA 4NN0A 2R6QA 2JG9A 4E4SA 4KG8A 2HEVF 1KD7A 1KXGA 5L19A 5KWRA 1O91A 1A8MA 1GR3A 4OUMA 4QQPA 2Q1MA 1U5ZA 4DOUA 1S55A 3ALQA 2KA3A 1D4VB 1PK6C 1JTZX 2WNVC 1OSGA 2JG8A 1IQAA 3WD5A 4F3JA 3TWIA 2X29A 1U5XA 3B94A 1D2QA 5L36A 2AZ5A 2O0OA 4MSVA 4G3YC 1C28A 1WCKA 4GIQA 2ZJCA 1DU3D 2R32A 1PK6B 4TWTA 4QQHA 2RJKA 3AB0A 1U5YA 3FC0A 1D0GA 3B93A 4MXVA 2TNFA 2TUNA 2QE3A 2WNUB 4OULA 2Z5WA 1C3HA 3L9JT 2WNVB 2JG9B 2HEWF 2E7AA 1ALYA 5TSWA 1I9RA 1XU2A 4OUSA 3MI8A 4HT1T 2Q8OA 2ZPXA 4N90A 1PK6A 1XU1A 3K51A 5KC5A 2HEYF 4TSVA 4QQLA 4DB5A 1DG6A 2QDNA 3V56A 1JH5A 5CIRA 2RJLA 4MXWB 4QQ2A 4EN0A 4MXWA 4KGQA 2JG8B 2WNVA 3TYJA 4D7YA 5BNQA
chains in the Genus database with same CATH superfamily
3ZXLA 2Y38A 4QQOA 5FZAA 2ZA9A 3TB0A 5IVVA 3WNOA 4E2GA 5L9VA 4JX0A 1VMJA 3NNGA 2YPDA 5C9AA 2HWB1 4W6YA 5A3UA 3W5NA 2NZ9A 4WM7B 1OXCA 3H8RA 5FZBA 3KZ4C 4B1LA 4ES9A 3USSA 2WLQA 4HVQA 3RNSA 5CFDC 1AR92 3BOWA 1RVF3 4FCAA 2BWCA 1NUKA 4G4FA 2E31A 4W8JA 3VBOB 3ZYPA 4ZKTB 4LBLA 2ADDA 2FHRA 2GP5A 5HXMA 2FDKA 2FZ1A 4X6QB 3VBSA 1GU3A 2GH8A 1GQHA 3HQRA 4JKKA 5I0UA 1X33A 3O1OA 3I2IA 3AJYA 3T1LA 4CDWA 3LA2A 3SQOA 3KCYA 3OGGA 1IS4A 3JXSA 1DYPA 1M06G 2C9KA 4M0NA 1WD3A 3IDEA 1DGRN 1RUOA 2YU2A 1LESA 3M4FA 3VBUC 3ZYRA 1OBNA 4CSWA 2GNDA 4OUMA 2NQYA 3VBFC 4UWDA 5SV5A 3EB7A 4FQZA 4BZ4A 2C9AA 1S0CA 4HZFA 5J48A 3ZMNA 2ZGKA 5FYMA 5KXCA 1O59A 1H30A 4FPYA 5LA9A 5LRRA 3RI9A 3T09A 1W03A 5BNNB 1N1TA 1HX6A 1ULCA 1UKGA 2NLRA 4DO0A 4IEWA 4XJAA 3BPSA 1UY4A 3LGRA 5F5IA 3SCGA 3VBFB 4B8EA 4UFKA 1KDMA 2O0OA 3DKWA 5D21A 4CCLA 1KRIA 1T2XA 4LIUA 2BV4A 5CADA 1NCRC 1EP0A 5DAVA 1LR5A 1SACA 5IUQA 3DXTA 4OVEA 3DCQA 4AVSA 1JODA 1AXKA 1V70A 2RS52 4Q0SA 1XRUA 4XUNA 1RUJ1 1LOEA 1ST8A 2WN2A 4L11A 3RRDA 4Y33A 2TUNA 3NMBA 4J25A 1HRV3 1IS5A 1SG3A 3IN9A 4ONUA 4GD4A 1O4TA 1FPN2 4UOJA 5EHDA 5JXHA 4YPJA 2J1RA 4Z82A 3VDBA 1UW8A 3L9JT 4DMIA 2DVAA 2WUHA 1OURA 2YPJA 4DPNA 4EV0A 1V0AA 2YBKA 5A3LA 1V6LA 4LBJA 1LEDA 2A6ZA 2ZGUA 3BODA 2XGXA 3M3IA 4Y26A 2X05A 1GZTA 1R092 4JHTA 4QKBA 5A7PA 1W6OB 4LOSA 1OFNA 2BTVC 4OHXA 3CJIA 5J96B 3UGHA 1AYN2 2W0XA 2JDZA 4PDWC 4E4ZA 2X10A 2HKXA 4FFFA 4TTGA 1QDCA 1PGSA 2QDNA 4CP1A 3GYDA 1ZVFA 4BCUA 1AX2A 3WDVA 1XSRA 4P5HA 1X50A 3BI3A 5F1RA 3ACHA 1GV9A 4GXLA 1DQ6A 2YG0A 4XDPA 3DYOA 3IMNA 2WNVA 1W6MB 4IERA 3S5AA 4PQQA 1WW4A 1RTVA 1GANA 2OS2A 2WAOA 4OMCA 5F3CA 1JS9A 3QH6A 4A6SA 4DZGA 2OPKA 4Q26A 5EQUA 2AENA 4I09A 1ENXA 2ZKNA 2YYOA 2ETEA 1JOJA 4XJWA 3WG1A 4CUBA 1UZVA 2RR13 2F6BA 3I54A 2FQPA 1MACA 3M2MA 2PHDA 3KVBA 3LB9A 3N7KA 4DEQA 4HKWA 3M3OA 4EWAA 1RJ7A 3VDDB 1AXYA 2BERA 1NG0A 3QD6A 1UOBA 2XHNA 3NRUA 4RR3B 2OX0A 1LTEA 5LASA 2BJSA 4PF1A 5FZLA 2ERFA 2R49A 3S7EA 5IVEA 2K0GA 4D69A 1CJDA 1GOFA 1CZTA 2HWB2 5DMYA 1GWLA 1I3HA 2BW8A 5ANQA 5BNNC 2XL9A 3KF3A 2VQTA 2HWF1 3AXDA 4XJ9A 1CAVB 2WO7A 5E88A 1IPKA 4C8DA 1GKBA 1WW7A 4N53B 4Y1XA 4GKYA 4YG6A 4CDUB 5ABJC 4MX3A 2ZKLA 4DY3A 3LZZA 4JDOA 3LEIA 4NHYA 1PHMA 5I8SA 4COYA 1ND3A 4CU8A 3JD73 3KGZA 4PLNA 1G8WA 2XWBB 2P17A 2JG8A 4UXAA 4BB3A 4L9BA 5F39A 3PHMA 4OI1A 2XHKA 2QQKA 4ZPIA 1EV13 5L9BA 1SLIA 2FMDA 4AVAA 1UN1A 4K40A 4N43C 3KS7A 3N9PA 1EUTA 4AEDC 1ENRA 5J98B 3EJKA 4SLIA 1X9TA 1ODNA 2P3KA 5FK8A 2D43A 2HBUA 1S4CA 5FYCA 1ENSA 2WR9A 4M4RA 1J1LA 1RMU3 4AG4A 2C4XA 4OI2A 1LODA 2JDPA 1Z78A 4OCTA 3HT2A 1J3QA 1HRI2 2P3YA 4IE5A 1LHUA 1ZM1A 4Y20B 3THDA 4Y3OA 2VOWA 1W2OA 4OHZA 1WGPA 3GF6A 2WNUB 4LA2A 3I3DA 4HLTA 2PLV3 4ZZ8A 1CPMA 4MHRA 4OULA 4QKFA 4QM9A 1Z7S3 1C3HA 3FHAA 1YHFA 1NXMA 2O8QA 2C26A 2UU8A 4XJ8A 4NVPA 4YZ5A 1F9KA 1C5IA 1RUC1 2DFCA 1HN0A 3NV2A 4CCMA 4DNYA 4Q0QA 5E8AA 2Y6JA 1JYTA 1W8TA 4XF4A 1Q3EA 2WQZC 2ZGOA 4IGOA 3U11A 2DVBA 5C70A 3H3UA 4A3ZA 4DUWA 4QPGA 3OD4A 3RMXA 4CXWA 2ZX4A 2XONA 2ENRA 2WSUA 3MI8A 1RUH3 4M3CE 1UPIA 4GH4A 2BOIA 5LK7B 2J1SA 5KC5A 1DIWA 4KBZA 1EPWA 3AVRA 4P9LA 2VCBA 3RJRA 5FXWA 1VIWB 2VH9A 4UI9L 4QXBA 5JSOA 4W6WA 4GAZA 5FP8A 3CL1A 1QOTA 4NJ4A 4RFRB 5B4XA 1MQTB 5JI7A 1RUH2 2ARBA 5FLIA 1AR72 4JGYA 3A23A 2RMU1 3J8F2 5KR7A 3POJA 2BVBA 2RS32 2RS13 5EJ3A 3GJBA 3EMRA 3GZEA 3ZFEA 2BNNA 4Z07A 4AGRA 1F5FA 1PO21 4M3CB 2HBTA 2JB4A 4LTAA 5KBFA 5FZHA 4L99A 4XFAA 3PUSA 4C0BA 3H42B 1BZWA 3H3LA 3IWZA 4R9AA 4YGDA 5L9RA 1W0PA 5F3GA 5FFOC 1QH7A 3IT8A 1R091 4RSUA 4BM8A 4XMIA 2DCZA 3RZZA 1GP4A 4QX1A 4LT5A 5C5TA 4C1XA 1H2KA 3LF7A 4AI9A 2YY1A 2JD9A 3C7HA 3O0XA 5FY9A 2VOXA 4IE7A 4NHKA 4KH9A 4NMIA 4OZXA 3J8F1 5FZOB 3ZFFA 4GWMA 3I97A 1Q56A 3GM8A 2QJVA 3WDTA 4LKSA 3ZXJA 5HBAA 1EAH1 4COUA 3VDCA 2CDOA 3KGLA 1DQ0A 3KT7A 5FJHA 1V6OA 5FYVA 4A42A 1SDDB 2LM3A 1ZZCA 4DQAA 5A3MA 1BEV3 3JBG3 5IT6A 2B45X 3VBOC 5JIAA 2J1TA 3AKTA 4R4XA 4BWOA 4URAA 1NCQC 1GZWA 3KV4A 3NL1A 1GR3A 3WY6A 1FXZA 4K8FA 2PHUA 4OZOA 2GDFA 5K4LA 4QPWA 1G6NA 1RUJ3 3CU7A 1AZDA 2WZR1 4ZXEA 2BBAA 3LDBA 3JUUA 2O14A 1IQAA 4X8NA 3OBTA 1ULPA 3H7JA 4BU2A 5I0DA 4Q0VA 2VZSA 4LPLA 1H4GA 1WCSA 1YI7A 4JQTA 2W95A 1D2QA 3CLPA 3OYWA 3SEEA 1K5MB 4R8HA 1LKNA 4QDRA 4LJHA 3RYPA 3WHTA 1UO9A 3D8CA 4Y24A 4XW3A 1JZ5A 1DU3D 1O4ZA 2DWRA 3ETPA 5FY8A 2P5BA 1V6IA 5I91A 1G86A 3M3EA 3G7DA 1LU1A 1XNCA 1FATA 1RUE3 3AYDA 4N8MA 4MXVA 2ZXQA 2VNRA 1MEC1 5ABJA 1OLMA 1JU4A 2QKDA 3Q8EA 1LEMA 1S0FA 3OBAA 4YVSB 1UY0A 4MGQA 3WNLA 4W4ZA 1AR63 1NAEA 2DCYA 1UD1A 2J1VA 4QXCA 1DQ1A 3ZIWA 2NM1A 2W2IA 2QZ3A 1H8TA 2HWD1 1AUYA 4Q1RA 1CESA 1IPJA 1UCXA 4P9YA 3I7DA 2RVAA 1CVNA 2VPVA 4PIYA 3ACLA 2J7MA 5EJ1B 5FK7A 3OD0A 3WDUA 3O1UA 1AF9A 2ZGTA 1ZZ6A 4JDMA 5CNAA 2VQAA 1Y43B 1KGYA 2LS6A 4N90A 5JOYA 3ZDSA 4D6RA 4PI2A 3U4XA 5FXXA 1HV1A 2XQXA 3G6JB 1SFYA 3OEBA 2DUOA 3S30A 1CJPA 1LGNA 4LO8A 2XVLA 2UYAA 3TEXA 3J7LA 4JAAA 3SHRA 4CA9A 2FDGA 3PUIA 3WZ1A 2X5IB 1AYM2 2D6KA 3AMHA 1CZSA 2FBEA 4P00B 4YW6A 4D6SA 4YW3A 1UOGA 3E6BA 5H9RA 2JG8B 3RVHA 3TYJA 1UAIA 1K5MC 1QOOA 4DXSA 3GZUC 4HG6B 2VW2A 1D0HA 4ZU7A 4K20A 3ZX7A 3UGGA 2RDNA 1MS5A 2X09A 2ZHMA 2DTWA 3R4SA 3P3PA 4CCOA 4IV1A 1QOSA 5F6KA 2W08A 1N1SA 4CEYB 4JKMA 2BFUS 2AEZA 1DYKA 2D6MA 3B9IA 3DEMA 3Q9OA 4RQPA 4YW7A 5J1XA 2GH2A 3AL6A 1N47A 1CAWB 3PIJA 4YG3A 4WVWA 5A32A 4HVOA 2AREA 4N9HA 3ME2A 1H6YA 5E6HA 5JVVA 4M01A 4PLMA 2JG9C 1IKPA 1GNHA 3VD3A 2EA7A 4HETA 1OD5A 2UWCA 5T52A 4I2OA 4N43A 2IC1A 1LCLA 3MO4A 5CEHA 3WG3A 1PO11 4K7JA 1VBD3 1QXPA 3N35A 1UX6A 1W8FA 1K3IA 4XXAA 2VOVA 4IEOA 5KHKA 3R4DB 1MZ6A 3ECQA 2WWSA 1ZZ8A 4COVA 4ET7A 3AL5A 4P9WA 1VAVA 3AYCA 4Q0UA 3IDBB 2JD4A 3JU9A 3VKLA 2D98A 2BFUL 2XBO2 4PF5A 5A6ZA 1JOBA 3QACA 3OG2A 2HWE1 2FD8A 1S55A 2CAUA 3OBZA 5FY4A 4QX0A 4AGGA 1P8JA 5F5QA 4CDQB 3R0RA 4FTSA 1QKQA 3BU7A 1SFNA 3FUQA 4LBNA 1JYWA 1GFF2 4GJYA 4I0WB 4LQRA 4NOTA 1XPWA 2RDQA 3LA7A 4QHZA 4N53C 4PHZA 2IFRA 3EO6A 3VDAA 5A3NA 2PA7A 4AWDA 5J36A 5T5LA 1H2NA 1ONAA 3BTZA 3I2JA 5F6LB 4FAGA 4CU7A 2FDFA 2FCTA 4RA0A 2BUKA 4XF3A 3D0JA 4BPZA 4EWEA 3WNPA 3D82A 5BPXA 1HJFA 2ZACA 1OF4A 1R1ZA 3FJSA 3UKVA 5HV4A 1S0DA 2Q4SA 2QNKA 3I2FA 5D8AA 2YB7A 3E6CC 4JV4A 5CBLA 2IVJA 2RM21 1PX4A 2VVFA 2X5IA 5FY0A 1LULA 2KM2A 3EYPA 4ZZ5A 4AR2A 1HB1A 1ASJ3 4FOVA 4ARYA 4B4PA 1JN2P 1NQDA 2Y0OA 1VAKA 2VXJA 1SDWA 4LE3A 1UYYA 2D6NA 2JEMA 5FYTA 3MF9A 3ZIXA 2D97A 4NRMA 4LBQB 5LW9A 2JE9A 2WBKA 5ERLA 2JXAA 2BQPA 2ET1A 2W39A 5FZKA 4XHBA 1R64A 4P08A 1SLTA 4TSVA 3ZSKA 4CEYA 2JDNA 4AFDA 1A34A 1SLLA 4H2AA 1HQNA 3ZFEC 1G9CA 3PUAA 2ZGNA 1RB8G 3J7HA 4HSJA 4CCJA 2AUYA 2PHTA 4D94A 4FTEA 4KG0A 4NWVA 3AJZA 5BNNA 3K4DA 3ZFEB 1TME2 2E32A 1KJLA 3WQBA 3ZYGA 3AC0A 3SMHA 1JZ6A 4B7KA 2YV8A 1POV0 3ZYHA 3BIWE 3NKGA 4QPIA 2R042 1QJU1 2OPWA 3RS6A 1SZBA 1LOAA 2EALA 1N3QA 5A7NA 3U1XA 1PVC2 2VMEA 2VXRA 2BOJA 5A3TA 5GZGA 3DV8A 4FXGB 5IJRA 3KT1A 1UL9A 3N7MA 1UY2A 5IFTA 3HVDA 2XXZA 5JR7B 2CGOA 5FMOL 3TRSB 2OQ6A 3K77A 5JOZA 4CEWB 4MADA 4XOGA 5LBEA 5DAWA 4BIFA 3I2HA 3VBSB 4FFGA 3WXPA 5CYYA 5FRAA 3UKNA 5A33B 3B3QE 4E2SA 1BEV1 5LA1A 1W2NA 1VMFA 4TXWA 2K46A 4QPGC 3WF3A 1TME1 2W1WA 4FPEA 4KWKA 1L7QA 4O7XA 2RS53 1Q8OA 1ACCA 4QX8A 1WLCA 1XNTA 2JE7A 4YRDA 5EFUA 3NNFA 3TNPB 3NJVA 3KB5A 4BQ2A 4EN6B 2JDHA 4JTOA 1RUH1 1QJY2 2K2SA 2YFZA 4RR3C 3WQ0A 4AVTA 4B7EA 3OPTA 4CZSA 1AR82 2CWSA 4XAAA 2E9QA 4XTPA 2WABA 4MV2A 2EXHA 3BYWA 4OYUA 5BYNA 2SLIA 1U5ZA 2I2SA 4QGLA 1AL0G 1NCRA 3KF5A 1TMF3 2QVSB 3HAGA 5J09A 2VY0A 4IV3A 4L8QA 4RD7A 2D5HA 4CCDA 1DQ2A 1V9U3 4JVAA 5DDJ1 4I0AA 4F3JA 1E5IA 4ATFA 2JX9A 2VZRA 4UFIA 5C8WA 4R52A 1DYOA 2ZX3A 2D3RA 4UW5A 3QH7A 4BQ5A 1TMF2 4XFHA 3VZNA 1PO23 2EIBA 1HB2A 3LIHA 4AQSA 1HB3A 2RG4A 1RMU1 2ZJCA 4QX3A 1S0IA 1MS3A 3UGFA 3WW4A 5JR2A 1NA1C 3OEAA 1U5YA 2EVXA 2XBO1 3DYPA 4W65A 4WZCA 1XBFA 2JIJA 3GBGA 4AEDA 4Y5TA 2VBBA 4RHV1 3THCA 3O14A 5KHHA 5JI9A 1SBFA 5LCWL 1Y4WA 5C7GA 1Y3TA 1L7RA 4CE8A 2QE3A 5HV0A 2R071 2VZPA 2BYVE 1G9FA 4MGIE 5FXVA 2ZMKA 1VBB2 2WSVA 3NV1A 1K12A 3Q8FA 2Y0IA 4FTBA 1R1A2 1MQTC 1QGLA 2IXLA 2XLFA 4MGZE 3CO2A 1K42A 4LK7A 1ALYA 2TBVA 3QCWA 3SNMA 2RJ2A 1XQNA 5H9QA 4A4AA 2QCSB 2RR12 1NZIA 4Q4X3 1VBB3 4P02B 4MGKE 5FPAA 3UETA 1WZXA 4CPBA 1ZRFA 3U37A 4CDWC 3M8LA 4FP2A 4A7KA 1X8MA 5F9TA 1OQ1A 3ACGA 3S6PA 4FBFA 2BP6A 1BYHA 2VOTA 3NJYA 5E16A 2PELA 2GC1A 5JAXA 4OI0A 2FDJA 3LSDA 5G05L 1J84A 4TLFA 2Q8EA 2IFWA 4MXWB 2XBO3 3MYXA 5FZOA 3WG4A 1JBCA 3T1MA 1HRI3 4IE6A 1D4M3 4KQ7A 1W8ZA 5EZWA 1W6MA 5FREA 2OUHA 4JCKA 1YRZA 4B4RA 4ASKA 3MBWA 2J1AA 4D7YA 3MDPA 3J7NA 4PDWA 3A22A 2VG9A 3OGRA 1US2A 4FPHA 3SH4A 1RXFA 3MW2A 2DTYA 4QMAA 1H4HA 2CV6A 4YZ2A 3TEWA 3I2OA 5IK8A 4XQDA 5FJKA 2VBDA 3NNJA 2KXLA 1V9U1 1ASJ2 1H1MA 4LUKA 4V1PA 2BNOA 5DDJ3 1HIXA 3K48A 3LPFA 2W1QA 1MR5A 1CN1A 4A44A 1OQDA 2YC0A 2VTXA 1MS9A 2R16A 2NP0A 4FI9A 1W2AX 4IGPA 3O1PA 4P9IA 1TVGA 1WBLA 2VMFA 2I74A 2VZVA 4JGYB 3QBQA 2JDKA 1R093 3HMYA 2A3YA 3VZOA 3JBG2 2V4AA 1DQ4A 2AEYA 2R6QA 3MLKA 3IPVA 4EN7B 1J83A 3CMGA 3F2ZA 1HQLA 4FQ4A 3HIFA 4UW6A 2XOMA 1QJZA 3HR9A 4K6BA 1OH3A 2V4VA 4QB2A 4CCEA 1BJQA 2VJXA 4C91A 3I59B 4AE2A 5KHGA 1JYXA 1OUSA 4FSJA 1YQ2A 3WV6A 4XUQA 1PZ9A 3IM0A 2LROA 3N9NA 4BMBA 1W28A 2A70A 3HQUA 3DF0A 4ZXKA 4WZFA 1LHOA 1WUVA 1XE8A 4RFT0 2EXKA 4MO3M 4OUEA 1W05A 4F83A 4WM7C 1DQ5A 2PAMA 3MHZA 2G9ZA 5EYYA 3RPQA 3PIGA 4MG2A 1ENQA 2AC1A 4JGZB 4MGTA 3O1SA 3WHUA 4Q8LA 4YNIA 3ZM8A 3PU8A 2VULA 3VKFC 3KSCA 3CBNA 1SPPA 5BV6A 4H7MA 3V0BA 4NPLA 2B46X 5LBBA 2VNGA 3H8XA 4I3PA 4FPLA 3CEWA 1RUE2 4RGGA 4XF0A 5HCBA 3LEKA 1SLBA 5LBFA 3EXUA 5EYXA 1RUD1 2BU9A 5C3SA 3C8XA 4PQ9A 1X82A 5FTTC 1H6XA 5FZIA 3N9QA 1OLME 1H1IA 3LE0A 5FO7B 4Z2WA 2DUPA 1AYN3 1V6KA 2IXKA 2HYXA 4RHV3 3MIGA 5GZFA 1QWRA 1S0GA 1ZA4A 4XIOA 5FP4A 1VBE1 4B3NA 5EXOA 5FMDA 2BNMA 4XUOA 4K3UA 1JU3A 3KQ4B 4QU2A 5APAA 1F4HA 3BTAA 4P5YA 4M0HA 3D3AA 5FYUA 5FZ3A 2ES3A 4XJZA 3RZMA 2WDBA 1CIYA 3ATGA 4OUSA 3FN9A 1HXS3 4YGCA 4B1MA 5SV8A 2XQRA 4D6QA 4R4ZA 4S2FA 2PMWB 4FPCA 3WUCA 4XTMA 4MVTA 5BNOB 4NHMA 1UOFA 3POFA 2WL1A 3J26N 5IYYA 2A3WA 1XNBA 4EE2A 3GHMA 3I3EA 3Q8BA 5LEKA 1PO22 4GWJA 2V09A 4BQ3A 4AZZA 4ISRA 5D8AC 2VBPA 4S2DA 1PZ7A 1LOFA 1GQPA 1NE6A 1Q8SA 4FFHA 1UZZA 4BQ1A 3BOPA 4MHUA 1GWKA 3DECA 2OUJA 2O8OA 1MVQA 1AYM3 2GSYA 2XDVA 3NO8A 1IQDC 4ASMB 3AZXA 4LKFA 4ORFA 3DXUA 3WW1A 3GCWA 4HVRA 4DY5A 2Y6GA 3CJIB 2VZTA 4BXFA 2HWB3 4UT5A 3SISA 3KCXA 4A45A 2F17A 5DN2A 1W90A 1W2TA 3M3QA 3MW3A 2MNGA 3LA3A 1NZCA 1SBDA 4QWNA 4CEWA 2BWAA 1W0OA 5EIYB 2WA4A 2VMCA 3ZSJA 4FPFA 1D4M1 1POQA 2R30A 4I02A 1C8M1 1H8VA 1TG7A 2ZOEB 3P3NA 3ZXAC 5HPOA 1H1AA 2GAUA 3SKJE 4Q4X1 5C4WB 1QIQA 2IUWA 2Y8KA 1UY3A 2XB6C 5JXJA 2CL2A 4B4QA 3RSJA 3EBRA 4P9JA 3H9AA 3ST7A 3H1MA 4E4HA 5FQ0A 2EICA 3T2TA 3AFGA 3ES4A 2PLV1 5DZEA 3VHPA 5KWRA 2QDRA 3RJ2X 3TAYA 1D4M2 4WM8B 3C7FA 5F7UA 3HBKA 2DCTA 5KXDA 3RMYA 4JC1A 2HH9A 2JE8A 5CZKA 3I3QA 1GP6A 1JTZX 3PVOA 2Q5TA 1W06A 1J58A 2A73B 3FLPA 2RM22 4WM8C 1UIJA 5FDBA 4XDOA 3ELNA 4QM8A 1RUF1 2Y34A 1YI9A 2HJIA 5ACA2 1CONA 5CISA 5FIXA 3OYWB 2C5DA 5FYHA 4KL1A 5FP7A 2WFF3 2F4LA 3NJXA 2XR4A 4W6XA 5L36A 2AZ5A 2B39A 2RR11 2XUEA 5CFCC 4HBNA 3SXWA 5JMCA 1ZZ7A 4HMZA 3T2QA 1FOD3 2NPIA 4JHZA 4M4PA 5BNOA 4E8DA 2BRTA 2RV9A 2YU1A 3DPRA 2XJQA 2NN8A 3GDBA 4Q4V3 5DUXA 3KHBA 5FOJB 5FOBB 3RWNA 3Q8CA 4FP3A 3ZYJB 3LOBA 2R063 3K75B 4KNCA 3ZN5A 3VUOA 3RYRA 2R1BA 1STMA 1YQ8A 3R05A 4JQRA 2YROA 4LO5B 1ZZ9A 4NIAA 3WUDA 5FP9A 2ARXA 4PJYA 1VRBA 3J4UH 4BLIA 1J3PA 2CAVA 3MF6A 2CYFA 4YW4A 1SMVA 1MS4A 3MUY1 2E7AA 1W8NA 3OJBA 3OF1A 3JCIA 2PHLA 2VW1A 4YM2A 2GC2A 2QQMA 3L2HA 2MHFA 2HWD3 4CYDA 3ACIA 2GC3A 3POWA 2W3JA 5F37A 1CAVA 5B4NA 2R041 2ZHKA 5I0SA 5JXIA 1L7LA 1UX7A 1COV1 4IE4A 2ZGPA 2G9GA 4DB5A 1IS6A 3ZN6A 2Z4FA 2LRPA 5DABA 4XHXA 1QQP1 1VMHA 1OD3A 3WEZA 2PN5A 4QHOA 3WP3A 3B69A 1D7PM 5LY2A 2VO5A 3AZYA 4MXWA 2HWC1 4XYXA 1E57A 5FLHA 2DBNA 4D7SA 1TEIA 3RG0A 5C8CA 3RZLA 2C6SA 5AC92 4HK9A 5C8CB 3UNPA 1O3RA 2PAEA 4BIOA 1BMV1 2LALA 1YJLA 3WSOA 4CU9A 4GKXA 1QJU3 4PDWB 4GZ9A 3MPBA 1UU5A 1BQPA 4P9XA 1NY72 1ULDA 1CGPA 3HN3A 4RS5C 1QQP2 2WAAA 1CAXB 4XMAA 2XG3A 4Q4W2 5A1LA 3W20A 2C0ZA 5FZDA 4CP0A 3WOGA 3NV3A 5FBJA 5A32B 2LW8A 5JSRA 4K9SA 5F32A 1TNFA 2RE9A 1RL3A 4E8CA 2IWGB 3I8TA 3FZ3A 2WNUC 3MEPA 2GNMA 4IDZA 2DUQA 3N3HA 2WQ8A 3QOPA 4QHBA 1GNZA 4UF0B 5BNPB 5CAZA 3FLRA 1LOCA 1ND2A 1R082 5AC91 4Z2AA 4IW3A 4QGMA 3VHNA 3WDYA 1KXGA 5DUVA 2NMNA 3B00A 3VHRA 1W6QB 5T3NA 3ZSMA 1OA3A 3ACFA 4QDQA 3HN1A 4LEJA 4GJZA 4BE3A 3ZDVA 1U0AA 1XYPA 3MICA 2XLAA 4QT6A 4META 4ZU4A 4BDVB 2RDSA 3KMHA 2PAKA 1UMHA 2KA3A 1MQTA 2YBSA 3KV6A 2MEV2 3WDWA 2G19A 2V72A 2VL4A 1UIKA 3BCWA 3O12A 3WD5A 1QNYA 1OLQA 3TWIA 3FBYA 3O1TA 3WG2A 1A6CA 4F7ZA 3RGBA 2A6YA 1AJOA 2RHPA 5T54A 3I49A 1ULEA 4L2NA 1MS1A 3WR0A 5BNPC 2QQLA 4ATEA 3ILRA 2VR4A 4O9EA 1RVF2 2R32A 3VBHB 2Y26A 4JTNA 2G1MA 2W1SA 3MLLA 3K46A 2RJKA 1WMEA 1GZWB 2PLV2 5LB6A 2VOKA 1DGRA 1GZ9A 3AYAA 2DDUA 3H8UA 4GMP3 2BGCA 5JLVA 1HB4A 2QQUA 4C1WA 5FZ1A 3O0VA 4UFJA 5DG2A 2P3IA 1DFQA 1YFWA 2VZQA 1AL23 3AP7A 2Q30A 5HI0A 2WNVB 3NAPB 3PVEA 4BQXA 3NAPA 1UZ0A 4TYSA 2E7QA 1QJY1 2HWE3 1VLNA 5F8PA 5LATA 1JZ2A 2ZGMA 1K5MA 2DURA 3ZPYA 4EYUA 2ZCWA 4EZHA 1NQJA 4QDSA 4AK3A 1YFYA 1W9WA 4Q8KA 2BGPA 5I93A 1PK6A 2I45A 3SLIA 4LBQD 4A2UA 3C7GA 4PIZA 4S2GA 2ARCA 4IE0A 4CEWC 5FY5A 1OOPC 5HCHA 1WLWA 2IXJA 2PHWA 5DZFA 4AVBA 4QX2A 1V6JA 3HT1A 3LAGA 4Q4Y2 4U36A 2VCCA 3ASIA 4Y22B 4YG0A 2FDHA 1WCDJ 1NX9A 1J1TA 2VU9A 4NIGA 4YVSA 3FHIB 4INDA 5DPNA 5FZ8A 4D3WA 5JDBA 1YCIA 3WT3A 4A7YA 4Y1VA 3UESA 2AYHA 3PJYA 3JBG1 1WW6A 1PMJX 3O1VA 1VAMA 3LWCA 5KC6A 5DAQA 5FBZA 2Q8CA 4BXSV 2V5YA 5EV7A 1T6BX 2ZX0A 4N53A 2C24A 1NT0A 5FY1A 4AXOA 4CUAA 5FY7A 1G7YA 3SCHA 4ARXA 2VQ0A 3LD8A 4HK8A 4LBMA 4KWUA 3ZYFA 3C7EA 2CGPA 4NHLA 1W2UA 2CSGA 1YJKA 1KFUL 3OB8A 2WT0A 2QUOA 2P6CA 1FOD2 1K5JA 2CNAA 4CDQA 2WNUA 4XF9A 4ZS2A 4GB31 5KXEA 3QLQA 4XACA 1AX0A 1UYXA 4LIVA 4CCKA 4AI2A 3W5MA 5IVFA 2QZ2A 2HWC2 4NRQA 4Q27A 3RQ0A 1BK1A 2BZDA 3CIHA 5FZ0A 5FPVA 5BXXA 4RL7A 4KWJA 2D5FA 1H2MA 4ZHNA 2XL7A 1NCQA 1S0BA 3ZKUA 3WDXA 2OA2A 5A3PA 2DCKA 4YZ3A 5L73A 4MOAA 4RQPB 3WW3A 1D2SA 1ODMA 1ULOA 3OUHA 3POSA 4Q4W1 2X8KA 2K9ZA 3U78A 5AC93 1YQ5A 2AACA 4WVMB 4DOUA 5J3UA 4WVMA 4KU8A 3UT0A 4AOCA 2WNVC 1GBGA 5C71A 5IK4A 1WWYA 5FCCA 4LUMA 3MLJA 5H9SA 4NROA 3ZFFC 2SBAA 1IZ3A 2GMPA 4Q4X2 2YFUA 3IIAA 5FYSA 1U5XA 5BNPA 1N1VA 4GALA 5IAXA 2JICA 1W3XA 1X7NA 2GN3A 3FUOA 4QB6A 5L7OC 5DG1A 2WT1A 5CKQA 3FX3A 3INAA 1WLTA 1WCKA 3AMMA 3NW4A 5E1RA 4XCAA 5A80A 3IZOA 2H0VA 4YLZA 1QU0A 2B7YA 2ZEWA 3CJXA 5JMOA 2B8MA 1PX3A 5FMCA 4JRAA 2PYTA 4BOWA 4CCCA 4LBKA 4CDUA 1CZVA 3OY8B 2VVEA 3PVNA 4QKNA 3BTXA 3LFIA 4QAWA 3GHNA 3KT4A 1EAH2 4YWAA 2WKKA 2VW0A 5IAVA 2D3SA 2XKOA 2EXJA 3BALA 3PVBB 1JZ4A 2CU5A 2Y33A 4U2AA 2ADEA 4YVWB 1IS3A 3HNBM 1W6NB 3AXEA 1JHJA 2WIIB 2VC9A 5GZDA 1OHFA 1QF3A 2YMZA 4NO4A 5GM0A 3E5XA 1BBT3 4JZRA 2Z2SB 4QD2A 2IXIA 3AKQA 2E6VA 3KCCA 1WBFA 3M7AA 1PM4A 3WF4A 1GP5A 4QB1A 4CDUC 2WQ4A 2BPA2 1SCRA 2OZ6A 1QNWA 1DG6A 1V9U2 2VE1A 4QX5A 4JKLA 2D44A 2VCMA 1A78A 2XVKA 3ZFGC 1AX1A 5FLJA 3VZJA 4L92A 1WCQA 4YSFA 3ZXFA 5A6XA 2OVUA 2H6CA 1O8SA 1XYNA 1QJX2 4HL0A 1KEXA 2OW4A 3ZFFB 1HV0A 1PGW1 1W0NA 3AMPA 1VB4A 3U10A 3PTYA 1O4YA 1UZYA 1I6XA 1HLCA 3MFAA 3ABZA 1SHWB 4IV3C 3VB9A 3ZXGA 3AFKA 1DZQA 2KR2A 2JG8C 1ZYBA 2VZOA 5IATA 1H9PA 1REFA 1SQ4A 5GLZA 4CTEA 3URFA 4BK5A 1COV2 4AQTA 2E33A 1W3VA 4V2VA 4WM8A 1RUC2 4AI3A 4CCNA 3MFCA 4FOWA 2EF6A 1VALA 4XE9A 4Y22A 1OA4A 3VDDA 1W8UA 2WWUA 5C4WC 2MEV1 4IV3B 3AM2A 2CY6A 4LO4B 1QJX1 4NIIA 1RUF3 2PQQA 4J6GA 1Q8QA 3USUB 1S2EA 3W59A 2P34A 2RMU3 1LHNA 3IPVB 2JWPA 4RGKA 4UF0A 1PVC3 4LK6A 1GWMA 1FMD1 3H1YA 3Q8AA 3DPRC 3KQRA 4QPIB 3KLSA 4OLLA 4QX7A 4XFBA 1W9SA 2A71A 5CFDB 1JOPA 2VMHA 5L19A 4UW3A 2XMLA 2Y6KA 4XFIA 3VZMA 2XJTA 3I3MA 3CJIC 1CR7A 1O5UA 1RUD3 2WC2A 3MIEA 3MIBA 4X8PA 1FYUA 1O91A 1YC61 2WYFA 2ZGRA 3K2OA 5A1FA 2WO3A 3ALQA 3IB3A 4YW1A 3SC7X 1ZBA3 1ZNPA 2H6BA 2VQUA 1OVPA 1CAUA 5LEJA 3HEIA 1APNA 4LO7A 2DBIA 4FOQA 1FOD1 3ZOIA 3CDZB 5DAXA 5H9PA 2JDYA 2X29A 3IIIA 3DGTA 3LEMA 2VMIA 2ZGLA 3B94A 4N7IA 3AKRA 5DUUA 3POBA 4V2WA 1OUXA 3ON7A 2WZR2 3ROUA 3B01A 5EP9A 2OYZA 2YGMA 2LTNA 3BB6A 3K4AA 3RWKX 1F31A 3B9CA 3BVCA 4LHNA 1LOBA 3FC0A 4MGYE 5CFCB 4AF9A 2UY9A 5CFCA 3TEYA 1NCRB 2EAAA 3DUIA 3KV5A 2DF7A 1ZA7A 4LHKA 4RR3A 4Q2FA 2IXHA 4TZDA 1BVP1 5K0UA 2BGOA 1AXZA 5K9YA 1PM7A 1RHI3 1SBEA 1FT9A 2VTXJ 1G9DA 1RUG1 1ZBA1 5FZCA 2FCVA 2ZMLA 4Y5Z0 5F3IA 3ZO0B 1ND2B 4AHWA 2RS12 1LECA 5FZMA 4X6RB 4QPGB 3I2KA 1WMFA 3APBA 2XJVA 4HT1T 1F35A 1PVXA 1CAXA 1AR93 2EIEA 2QQVA 3MUZ1 2HWC3 4AFMA 4EN9B 2R1DA 1VJ2A 3OGSA 3VL8A 2GC0A 3BU0A 2E7TA 3VBHC 4GA9A 4H14A 2A3XA 4CDQC 2VZUA 1WA4A 1PIV3 4LR4A 1CAWA 1E5SA 1REEA 3AZZA 1QJU2 1JH5A 1FAYA 4EN0A 4Q0PA 1YIFA 2BBVA 1PGL2 2EIDA 1FX5A 5GLTA 4QPIC 2P6HA 5FYBA 4Y1YA 3LFMA 4XBNA 1O3QA 2YGLA 4QU1A 1JYVA 3N7LA 5F5CA 2VTFA 2OKXA 5CKNA 3GALA 1RJ8A 5JPMB 4E4DX 1HN1A 2HWD2 1OI6A 4LKDA 3AK0A 4ZONA 4FFIA 1IKQA 3UK9A 1LNSA 3GBWA 1JUIA 3RFRA 1RUI3 1KS5A 1W99A 5A7SA 2GALA 1VRH2 4GH4C 1RUJ2 4K8RB 1N3PA 2JG9A 2XJRA 1FV3A 5FO8B 1DHKB 2E63A 2VNOA 3JQWA 2ZABA 5JUVA 3LOIA 5A6QA 2AGSA 2V73A 1VBA1 3WNNA 1NKGA 2WINB 2IVIB 4GH4B 5CA6A 5FUIA 2ZGQA 3CQOA 1DCSA 1OKQA 1Q5OA 1VB2A 1O8PA 1VBA3 3OSDA 2W92A 4XIKA 1CX4A 4MYEA 1EV11 3T3YA 1HW5A 1S1AA 1XYOA 5D1IA 3H8OA 5CKMA 5DQ0A 5FZ4A 4XZPA 5A7WB 4DUVA 3MIHA 3FFQA 3PDQA 3CHXA 4LBOA 1US3A 3ZYBA 3PMSA 4XC9A 4Y4RA 2WO1A 2P37A 4EROA 2F4PA 4Z8BA 2XH6A 4AI1A 4E2QA 2W9XA 2CWMA 3ZN6B 1S2BA 1XE0A 2IXCA 3NWKA 5C3PA 1ZRDA 5C5UA 1Y9QA 3AMQA 4AHZA 2W91A 1OPMA 5FXZA 3VLBB 2HLEA 2OT7A 2EAKA 1QDOA 2OZJA 4AEJA 1C28A 3KWVA 4IEVA 5L7OA 3U75A 1CQ9A 3OUJA 1B35B 2YZ4A 4C0HA 4K21A 3H0OA 2UWBA 2TNFA 3E5UA 4XUTA 5LA2A 3KV9A 5ABJB 4XZUG 4GQ7A 4MH0E 4AL9A 3K4ZA 2VUAA 4PCRA 4HPKA 4BJ0A 4N7UA 1AR61 2R043 3S0MA 5C9AC 4QGNA 1RYYA 3P1IA 1ZBE2 5M0TA 1NOVA 1CD3G 3I4IA 1TE1B 3PUHA 5FO9B 4YW2A 3TEZA 5I8TA 1MEC3 1OF3A 3WF2A 4DRRA 1A8DA 4MZUA 4XBQA 1NY71 4LO6B 3JZVA 5C9AB 1XU2A 1RGSA 3AVSA 1GZCA 1KS4A 5AVPA 5CFDA 2PFWA 1OFSA 3NV4A 5JXGA 1B09A 3VV1A 4WBBA 1XU1A 3K51A 1URXA 3H1WA 3VD7A 3ZSEA 3M1HA 2P3JA 3LQCA 3NJZA 1ULGA 3PMEA 2CGNA 4UBGA 2NMOA 3SCFA 2ZEYA 2GP3A 3NQHA 3PJQA 1W8HA 1OH4A 1RINA 5C3OA 5IHRA 3S7IA 2W1UA 4L0PA 3VBRB 5A1AA 3O1RA 2XUMA 3E5QA 4CRQA 3MV01 2YUEA 4IESA 1MVEA 1IG0A 2DU1A 5K0UC 3S57A 1YIPA 2ZHLA 1RUG2 1RVF1 1X8EA 2ID4A 4Z92B 1AHSA 1KITA 4IQPA 1VBC1 4OHYA 4YFZA 4UAPA 1B35A 3I2GA 3HPNA 3U14A 4FO9A 4IEPA 1CIWA 4AI0A 3O1MA 5B2GB 1VBC3 3WINE 1AR81 2BEOA 3N36A 2PQSA 2VCAA 1C8M2 3A21A 4HFSA 3ENRA 2Y6LA 2W47A 1RUD2 1HQWA 3PL0A 1ZRRA 4QPYA 3U4SA 1VR3A 1CWPA 3HJRA 3VKOA 3USUA 5CG9A 3BN6A 4IUGA 2VUCA 4XILA 5C33A 4N43B 1DDLA 1RIRA 1HRV1 1EPZA 4H3WA 4KBBA 4P9GA 4GULA 4LHSA 5GLWA 2ZMNA 4KG8A 4BK4A 1VBD1 1UXXX 3C2UA 4LORA 1KD7A 1XXNA 1JYNA 5HXVA 1IHMA 2NYYA 2A6WA 2Q1ZB 5LZ6A 1ZZBA 4WM7A 1A8MA 4AQ6A 2A5ZA 5KXBA 1TME3 4M00A 1GMMA 2ARAA 3IDCB 3T08A 1BVVA 2GMEA 1BHGA 3GXUA 2GNBA 3N9LA 1D4VB 2HWF2 4PBPA 1FPN1 1R1A3 3NVCA 1Y9MA 2X5IC 3MIDA 2P1BA 4YM1A 4Y1UA 5JWPA 1HRV2 5HCAA 2W94A 5DAPA 4Q29A 4LHLA 4AAXA 5FPUA 1G9BA 4XFFA 2P2KA 2OXBA 1XJAA 3WNKA 4CPBD 1UMZA 2Q0AA 4TN7A 3GJAA 3T30A 1WMXA 4GIQA 4PBOA 3FLTA 4AW7A 5IFPA 1R081 4YGBA 2XLGA 3AB0A 3KM5A 3RZJA 5J7MA 2O1QA 3EQEA 1V00A 2J42A 2JECA 3JB8A 4NHXA 2ZHNA 4GB32 1QHDA 3POEA 2JENA 1N1YA 4RYDA 5FUNA 3VDDC 3V65A 1DLCA 2QBXA 2RM23 1PO13 1YO8A 2Q8DA 4A41A 4RQPC 3C3VA 1XE7A 2BDRA 4AVVA 4NIDA 1RMU2 1KDKA 3HD8B 4UFLA 3MZHA 4HN1A 1QEXA 1Z7S1 1GYKA 1UZWA 4I30A 5GKAC 1IOAA 1JW6A 1WKYA 2ZZJA 2VVDA 3HNMA 2HEWF 3T0AA 4DEVA 4DXZA 1YEWA 2WJSA 1PGW2 4CDWB 1X36A 4OI4A 4AAPA 4IEXA 1LENA 3VBFA 2W5FA 1I9RA 4IL7A 3SH5A 3UV9A 4IETA 2VAUA 4I3GA 1YUDA 1H9WA 1OA2A 2DU0A 4AYUA 2DFBA 5IWFA 4D7TA 4UW4A 4LA3A 1FPN3 1HKDA 2WA3A 1BBT2 2G4IA 3OY8A 3TBDA 1ND3B 1AYN1 1Q8VA 1YLLA 3I3BA 3THPA 1BMV2 2A6VA 4XPVA 3LDRA 5CIRA 2A75A 2RJLA 5I0TA 3TN93 3DL3A 3JB4C 3VKNA 2G9FA 4OFGA 3PTRB 4EN8B 1AR91 3CKHA 2XVGA 4XQ4A 1RUI1 4AFCA 3AP4A 4DS0A 1YFUA 3WP4A 3ZVXA 1AR62 1QY4A 1YQCA 1AR71 1FV2A 3O7OA 3WP5A 1CX1A 3E97A 1ZREA 4ITCA 3MW4A 2XWJB 4BMEA 4Q4Y1 1JMUB 1RUF2 2Q1FA 5ACA1 1J3RA 2R073 3B02A 1GOHA 1KJRA 2R0FA 2Z69A 2UY8A 4KI5M 3ZXKA 3VD5A 1HDKA 5JIUA 5LRSA 1F4AA 2JKBA 3EHKA 1I5PA 4IEZA 1SFPA 1NA1A 1COV3 1GICA 4DIQA 5JOXA 4KMQA 2X53S 3A7QA 1LHWA 1XNKA 3IDAA 5FAXA 5BUVA 5D2AA 4FVVA 5F5AA 3T4HB 4PIXA 4JGYC 4YM3A 1E5RA 1GSLA 3H50A 2VM9A 4XJUA 5ISLA 1RUE1 1DZTA 2N7GA 2JDAA 1XSQA 3PUQA 4JGZC 3WX5A 3O0WA 2QQPA 1J59A 3E1F1 2RMU2 2GZWA 4XF1A 4CP2A 4B29A 5LA0A 4OHVA 3VD4A 1C57A 4O9GA 1IPSA 4AHYA 5LWBA 4QQPA 2Q1MA 3T2OA 2HYKA 4YFWA 5LBCA 1UU4A 3VBUB 5JZGA 5A7WA 1DGWA 3H7YA 3HQXA 5A6YA 3OTFA 1XB9A 2J22A 4HKLA 3WW2A 4CDXA 1GNYA 1ZBE1 4XCBA 5IK7A 3B5LB 1YXWA 1ZBA2 1MZFA 2ORZA 1Q43A 3IKWA 1BXHA 5A7OA 5FZEA 1AR83 1FMD3 3D0SA 1LOGA 1W8WA 4MSVA 4AFAA 1VE0A 4LOTA 3C7OA 3D6EA 4Y5SA 3WQ1A 4EJRA 1PK6B 2W52A 4EZ4A 4QQHA 1KFXL 1TZOA 3E6DA 1D0GA 3LIGA 2PHFA 1JXNA 2PTMA 1RHI2 2YXSA 1BKZA 1PNGA 2WO2A 4TLGA 3R4UA 3W58A 1W9FA 1FI2A 4BQ4A 1UKRA 3N9OA 3LDKA 2LUWA 1VBE3 3UJQA 2TEPA 3ES1A 2JG9B 2P4EA 1A3KA 2ORXA 5T5OA 3WCRA 1JZ3A 4WV8A 4BH9A 4YYOA 1DLLA 3ZMOA 2GNTA 3ZXDA 5JPNB 3ILNA 4AHXA 4YZ4A 4ES8A 1PIV2 3K3NA 3IAQA 1W6PA 3ZSLA 3S5QA 3A0KA 1XC6A 5AFBA 4JDNA 3KHCA 2HEYF 4BHPA 5JCTA 5DZGA 1UF2C 2FMYA 3MPPG 4CXXA 1Z7S2 3V56A 5LY1A 2E26A 3A0NA 3X29B 3GBFA 4Q4V2 1W8OA 4IEYA 2D7FA 1UXZA 3V64A 3SH3A 1DZRA 4CVUA 4CDXB 3U07A 4FPOB 4OHWA 5FV3A 3PLQA 1QMJA 4FXKB 3SEPA 3PURA 4N9IA 2DVGA 1PIV1 2DV9A 5C4WA 2DVFA 5FZGA 4BQWA 1UY1A 3OOXA 4HN0A 1W9TA 1AYM1 1Y7BA 5C8CC 3HWJA 3TNQA 3B7MA 4KGGA 1YYNA 1EAH3 3LKJA 3GZTB 1AJKA 3VBHA 1EV12 2R0HA 2DYCA 3ETQA 4D8MA 4IV1C 1NXD1 2ZAAA 4EQVA 1TMF1 1SLAA 2ET7A 4UFHA 2RS33 1SEFA 4J1WA 2D93A 4O65A 2CDPA 4WVVA 5T5JA 1O6UA 3AZVA 2CHHA 4IGQA 5FPBA 1RHI1 3UL2A 3PU3A 2WFF2 3ZKYA 3ZXEA 2OIIA 5AVAA 5FPLA 3VBRC 4XXPA 1W04A 1HXS1 2WNEA 1JUHA 2HWF3 1UWWA 4H7LA 3K3OA 4OMDA 1OC1A 3VL9A 1H2LA 3L2YA 4J1XA 1S2KA 4Y1ZA 1PMIA 1EUUA 2W68A 3BPZA 1JYIA 4MLOA 5FYYA 3TN92 4LNVA 1BLZA 4LKEA 5IVBA 2WWJA 1R1A1 3P6BA 4XFCA 1F2NA 3OPZA 3AKSA 4UBHA 4P14A 3DN7A 5CG8A 4BLJA 5FZ9A 4CP9A 3FE5A 5CU1A 4IEQA 2QQNA 1CAUB 1JYCA 4HPKB 4AEMA 5G04L 2JJ6A 4M3CF 1SPPB 1HJGA 3V0BB 3BTYA 3M3CA 4FPGA 1OVSA 1W6NA 4XUPA 3JQXA 5T50A 4PT6A 1GLHA 1OOPA 2OQ7A 1W6OA 3WCSA 2YC4A 1IGOA 1XNDA 2WN3A 3MV11 4G3YC 3ILFA 2VD7A 2ZGSA 4CEYC 5ANNA 1JZ8A 2ZTNA 2WFPA 3ZN4A 2ZEZA 3GZAA 3B93A 3OGVA 2QTWB 3W21A 4C90A 1PZ8A 2D40A 4IEUA 4D0QA 4COZA 4Q1PA 1RUNA 4A3XA 3TOJA 1C4RA 1W9YA 1JI6A 2RS11 4XDQA 5FMOS 3NNMA 3NSTA 1UYPA 5A33A 2MEV3 3BUCA 3POGA 3DYMA 1BBT1 2FDIA 3VHOA 3BGAA 2AR6A 4RS5B 5AFEA 4ZS3A 2WS93 4Q4W3 4R9DA 3ZFGA 5GJ6A 4H55A 3ITQA 3IAPA 5GLVA 2Q8OA 1LGCA 1ZBE3 2WZEA 1MS8A 2EXIA 5L7OB 4AVCA 5HCFA 4F8AA 4QQLA 4HXCA 3JD71 2ZZQA 1PMHX 4OQ9A 2Y6HA 3F95A 3ORJA 5A7QA 1GUIA 3HBZA 4QXHA 3OPWA 4A7ZA 3N9MA 5IW0A 3IBMA 2PHXA 1SCSA 4CXYA 3J7MA 1CPNA 2WNOA 4GWNA 4UFMA 1UU6A 1QJY3 1S0EA 4HKOA 2J1EA 1UPSA 2DCJA 4G9SB 5K8SA 1W6QA 2JDMA 5T5PA 3T0DA 1BCXA 4O61A 2AH2A 3THTA 4RGAA 2GN7A 4LULA 1ZRIA 3UYJA 3JD72 4QKDA 1TNRA 1XOYA 2WS91 5FZ6A 2L9LA 2WFF1 4JRLA 3LSEA 2XJSA 2UWAA 4MGSA 3VBOA 3MIFA 3OGJA 1UYZA 3FFZA 3U0ZA 1VPHA 3CNAA 4NPMA 4GMP0 4Q4Y3 3LCPA 4S2HA 4FAHA 4Q5OA 2QQOA 3NKTA 4EWDA 5FWJA 2BVVA 1UOJA 4RHV2 4XBLA 4PI0A 1PGL1 1Y9GA 1RXGA 3LPGA 3VBSC 1NYWA 2HEVF 4XAEA 2Z79A 1B35C 1DBNA 1ZRCA 1RUG3 2E51A 4K1ZA 1W6PB 1S0JA 2A6XA 1MPXA 3O5SA 5I0RA 5IVJA 4FOYA 2Z42A 2WZR3 4NE9A 1UNBA 1X9PA 3T2PA 3D4KA 1G9AA 4LE4A 4AEKA 4Y20A 5FYIA 5IVYA 3T0BA 2VZ1A 1MZEA 5BY5A 2QQWA 1VBC2 1OSGA 3KD4A 3VBUA 4NAOA 4BA6A 3T4VA 4DXTA 5KHIA 4YZ1A 5K0UB 1DGWX 3GNEA 3ZYIB 3VD9A 2VMDA 2W46A 2ZEXA 5CVRA 2ZX1A 2I07B 2WZ8A 4HOOA 2CTVA 3SITA 2J1UA 2YBPA 2ZX2A 2B4KA 3WNXA 4QXKA 1FNZA 5F3EA 1POV3 1OT5A 4TWTA 1GOGA 1K45A 3VN4A 1YNAA 4IV1B 3WNMA 3NAPC 5FWEA 3RDIA 5FPXA 4Y4YA 3RZHA 2WRAA 3R6SA 4AEDB 3J8F3 2JKXA 1BEV2 3WQ7A 4DRVA 3RZKA 4AGVA 3A4UA 4OQ8A 1WLDA 1WCUA 3M70A 1NA1B 4R9BA 2VGDA 5IK5A 2XJUA 3HOBA 5IVCA 1I5ZA 1Q8PA 4YW5A 3VZKA 1NE4A 4GB33 1ASJ1 4WVZA 2VUJA 3UKTA 3OCPA 4HSLA 3RYKA 4YVSC 3DKQA 3CZUA 4M3CA 2R061 4LLFA 1RITA 4DXRA 1OOPB 1M4WA 3BKZA 4FPKA 2JIGA 1DP0A 1PVC1 1O3TA 5K7PA 3I59A 1KQRA 1QXJA 1AL21 3J9SA 1POV1 1ULFA 4IXLA 1QJEA 4FT8A 4RN5A 4LMFA 4CU6A 4KU7A 2RS51 4DUXA 3V0AA 3WLUA 2MPFA 4K1YA 4UYBA 4XEZA 1E5HA 5D8AB 1O3SA 1LAJA 4NPRA 2D6LX 1QQP3 3ZR5A 1V6NA 2WLPA 5EPAA 5FKCA 4CP9B 1Z0HA 2VECA 5FYZA 1EY2A 3GCXA 2Y6FA 5I8YA 5KHJA 4QQ2A 3VBRA 3LEGA 5FZFA 1HRI1 1MS0A 2B9VA 4KGQA 3WF1A 5JOWA 3POIA 1YWKA 4JGZA 4DINB 1WA6X 2ILMA 4XURA 5A70A 5GZCA 4BQYA 5EWSA 3AP5A 4XQWA 5EJZB 5BNOC 2FZ2A 5FKBA 1AR73 2QQIA 3ZLIA 2YDEA 3H3ZA 4BISA 2V5DA 4PLOA 1PNFA 3UJOA 4ASLA 5A3WA 1RUC3 1VRH3 5GZEA 2QFEA 5ACA3 2A7AA 5FQ0B 4I01A 1O7FA 2UYBA 4LITA 2ZBJA 1VRH1 2H0BA 3AYEA 1UQXA 4MUVA 3PNAA 1AL22 4W50A 2VUDA 4FPJA 4LLOA 4LXLA 2QQJA 5GALA 3P5BA 2VZ3A 1QXRA 5C6CA 5JZGB 2KD7A 3OUIA 2XKPA 1N3OA 1QH6A 1VBA2 2UURA 1RC6A 4Q4V1 3VGIA 1OKOA 5DDJ2 1W39A 3ZR6A 1BK0A 2D6OX 1OQEA 2YHJA 4NAMA 1FNYA 3TN91 4NN0A 3SKVA 4XVHA 2E53A 3VKMA 4E4SA 1LU2A 4E27A 1AVBA 2DVDA 1NLSA 4NR1A 4RS5A 4I0BA 4XETA 1LB2A 3W9AA 5FUPA 1YFXA 1H8TC 4A6OA 5J37A 1PO12 1JHNA 3DPRB 1OLRA 3WVJA 1RUI2 5E89A 1ND3C 1ZX5A 2WS92 1LRHA 2Y60A 3NNLA 5DXDA 1C8NA 4CUGA 1WW5A 1NLRA 1L3JA 1PK6C 2R072 4YVWC 3VZLA 2GMMA 1V6MA 2IZWA 3CZJA 3AKPA 4COWA 5F2SA 3ZPOA 3GGLA 1R083 2PXJA 5DUWA 2PHRA 1IG3A 1H8TB 1UMIA 4URTA 1WMDA 4HANA 1F5JA 1HXS2 2WT2A 4E9KA 5C3RA 1H0BA 4GWIA 2FCUA 4KWLA 2RDRA 3OBRA 5FP3A 1LHVA 1C5HA 2RS31 3CF6E 3WP6A 4AQ2A 4L97A 3N7JA 4NWWA 4ZY9A 5LK5A 2JB8A 1VP6A 2A1XA 2D6PA 2EIGA 4YM0A 1NLQA 5F2WA 4R9CA 3AX4A 3FHQA 1VBD2 5GLUA 2WZPP 2XPJA 3V0AB 1QJX3 1YQ6A 2GU9A 1EYBA 3I2DA 4YGEA 3WF0A 2WYSA 1FMD2 1QJFA 4XABA 5JZGC 1OMIA 2ZS6B 4ZU5A 4GMP1 5FMBA 5FR3A 1C1LA 3AZWA 2YC2A 3FMGA 2B42B 1ND2C 1SLCA 3FL7A 2B9UA 2Z5WA 3FBMA 4HONA 1DGLA 4DFSA 1MZ5A 4AI8A 3KVAA 4NIHA 3AP6A 4LBQA 2R7EB 4BYYA 5FZ7A 3BIEA 2W87A 5T55A 5CB7A 1DF0A 1O5LA 5A3OA 5TSWA 3HNYM 4NRPA 3D5OA 3ZFGB 1U12A 1VBE2 1LGBA 4AFBA 1REDA 2ZAHA 1GQGA 2ZPXA 1NCQB 2XJPA 3IMMA 2ATFA 1XNAA 2C1FA 1VBB1 2B5HA 1OPOA 2VMGA 2D3PA 2Y64A 3RI8A 1U5IA 1I1EA 1JZ7A 4CDXC 1TQ5A 1F15A 1LOFC 4CUCA 2VNVA 3AP9A 1LJ7A 4SBVA 3POYA 4Z1VA 2JDUA 1WD4A 1MEC2 1C8M3 2HWE2 3MGUA 2R062 1C1FA 4YARA 4YVWA 5JSPA 5C3QA 3RZGA 4XFGA 3AMNA 3FWEA 1F8VA 4ISQA 4NUBA 5FPZA 5BNQA 1T6GC 3N4MA
chains in the Genus database with same CATH topology
3ZXLA 2Y38A 4QQOA 2ZA9A 3TB0A 4E2GA 5C9AA 2HWB1 4W6YA 2NZ9A 4WM7B 3KZ4C 4ES9A 4HVQA 3USSA 2WLQA 3RNSA 5CFDC 1AR92 3BOWA 1RVF3 4FCAA 2BWCA 4G4FA 3VBOB 3ZYPA 4ZKTB 4LBLA 2FHRA 2FZ1A 4X6QB 3VBSA 2GH8A 1GQHA 5I0UA 1X33A 3AJYA 3T1LA 4CDWA 3LA2A 3KCYA 3OGGA 1IS4A 1DYPA 1M06G 4M0NA 1WD3A 3IDEA 1DGRN 1RUOA 1LESA 3M4FA 3VBUC 3ZYRA 2GNDA 4OUMA 2NQYA 3VBFC 4BZ4A 5SV5A 5J48A 4FQZA 2C9AA 1S0CA 4HZFA 3ZMNA 2ZGKA 5KXCA 1H30A 4FPYA 5LRRA 3RI9A 5BNNB 1N1TA 1HX6A 1ULCA 1UKGA 2NLRA 4IEWA 4XJAA 3LGRA 3SCGA 3VBFB 4B8EA 1KDMA 2O0OA 3DKWA 1KRIA 5CADA 1NCRC 1EP0A 1LR5A 1SACA 5IUQA 4OVEA 4AVSA 1AXKA 1V70A 2RS52 4Q0SA 1XRUA 1RUJ1 1LOEA 4L11A 3RRDA 2TUNA 1HRV3 1IS5A 3IN9A 4ONUA 1O4TA 1FPN2 4Z82A 1UW8A 3L9JT 4DMIA 2DVAA 2YPJA 4DPNA 4EV0A 5A3LA 1V6LA 4LBJA 1LEDA 3BODA 2A6ZA 2ZGUA 2XGXA 3M3IA 4Y26A 1R092 1W6OB 4OHXA 1OFNA 2BTVC 3CJIA 5J96B 1AYN2 2W0XA 2JDZA 4PDWC 4E4ZA 2HKXA 1QDCA 1PGSA 2QDNA 4CP1A 3GYDA 1ZVFA 4BCUA 1AX2A 3WDVA 4P5HA 1X50A 5F1RA 1GV9A 4GXLA 1DQ6A 3IMNA 2WNVA 1W6MB 4IERA 1WW4A 1RTVA 1GANA 3QH6A 4DZGA 2OPKA 4Q26A 2AENA 4I09A 1ENXA 2ZKNA 2YYOA 2ETEA 1JOJA 4XJWA 3WG1A 3I54A 2RR13 2F6BA 2FQPA 1MACA 3M2MA 2PHDA 3LB9A 3N7KA 4HKWA 3M3OA 4EWAA 1RJ7A 3VDDB 1AXYA 1NG0A 3QD6A 4RR3B 1LTEA 2ERFA 2R49A 3S7EA 2K0GA 4D69A 1CJDA 2HWB2 1I3HA 2BW8A 5BNNC 2XL9A 2HWF1 3AXDA 4XJ9A 1CAVB 5E88A 1IPKA 1GKBA 1WW7A 4N53B 4Y1XA 4GKYA 4YG6A 4CDUB 5ABJC 4MX3A 2ZKLA 4DY3A 3LZZA 4JDOA 1PHMA 5I8SA 4COYA 1ND3A 3JD73 3KGZA 4PLNA 1G8WA 2XWBB 2P17A 2JG8A 4UXAA 4L9BA 4OI1A 3PHMA 2XHKA 1EV13 1SLIA 2FMDA 4AVAA 1UN1A 4K40A 4N43C 3KS7A 4AEDC 1ENRA 5J98B 3EJKA 4SLIA 2P3KA 2D43A 1ENSA 1J1LA 1RMU3 4AG4A 4OI2A 1LODA 1Z78A 3HT2A 1J3QA 1HRI2 1LHUA 1ZM1A 4Y20B 2VOWA 4OHZA 1WGPA 3GF6A 2WNUB 4LA2A 4HLTA 2PLV3 1CPMA 4OULA 4QM9A 1Z7S3 1C3HA 1YHFA 1NXMA 2O8QA 2UU8A 4XJ8A 4NVPA 4YZ5A 1F9KA 1C5IA 1RUC1 2DFCA 3NV2A 4DNYA 4Q0QA 5E8AA 4XF4A 1Q3EA 2WQZC 2ZGOA 3U11A 2DVBA 3H3UA 4QPGA 3OD4A 3RMXA 2ZX4A 2ENRA 2WSUA 3MI8A 1RUH3 4M3CE 1UPIA 4GH4A 5LK7B 5KC5A 1DIWA 1EPWA 4P9LA 3RJRA 1VIWB 2VH9A 5JSOA 4W6WA 3CL1A 1QOTA 1MQTB 5JI7A 1RUH2 2ARBA 5FLIA 1AR72 4JGYA 2RMU1 3J8F2 2BVBA 2RS32 2RS13 5EJ3A 3ZFEA 2BNNA 4Z07A 4AGRA 1F5FA 1PO21 4M3CB 4LTAA 5KBFA 4L99A 4XFAA 4C0BA 1BZWA 4YGDA 3IWZA 4R9AA 1W0PA 5FFOC 1QH7A 3IT8A 1R091 4RSUA 4BM8A 4XMIA 2DCZA 3RZZA 4LT5A 4C1XA 1H2KA 2YY1A 3O0XA 2VOXA 4OZXA 4NHKA 4KH9A 3J8F1 3ZFFA 4GWMA 1Q56A 2QJVA 3WDTA 3ZXJA 5HBAA 1EAH1 4COUA 3KGLA 1DQ0A 3KT7A 1V6OA 2LM3A 4DQAA 1ZZCA 5A3MA 1BEV3 3JBG3 5IT6A 2B45X 3VBOC 5JIAA 3AKTA 4BWOA 4R4XA 1NCQC 1GZWA 3NL1A 3WY6A 1GR3A 1FXZA 4K8FA 2PHUA 2GDFA 1G6NA 1RUJ3 3CU7A 1AZDA 2WZR1 3JUUA 4X8NA 1IQAA 3OBTA 3H7JA 4Q0VA 1H4GA 1WCSA 1YI7A 1D2QA 3CLPA 3OYWA 1K5MB 4R8HA 1LKNA 3RYPA 3WHTA 3D8CA 4Y24A 4XW3A 1DU3D 1O4ZA 2DWRA 5I91A 1V6IA 1G86A 3M3EA 3G7DA 1LU1A 1XNCA 1FATA 1RUE3 3AYDA 4MXVA 2VNRA 1MEC1 5ABJA 2QKDA 1LEMA 1S0FA 4YVSB 1AR63 2DCYA 1UD1A 1DQ1A 3ZIWA 2NM1A 2QZ3A 1H8TA 2HWD1 1AUYA 4Q1RA 1CESA 1IPJA 1UCXA 4P9YA 3I7DA 1CVNA 2VPVA 4PIYA 3ACLA 3WDUA 3OD0A 1AF9A 2ZGTA 1ZZ6A 4JDMA 5CNAA 2VQAA 1Y43B 4N90A 5JOYA 3ZDSA 3U4XA 1HV1A 3G6JB 1SFYA 2DUOA 3S30A 1CJPA 1LGNA 4LO8A 2XVLA 2UYAA 4JAAA 3SHRA 3WZ1A 2X5IB 1AYM2 2D6KA 3AMHA 2FBEA 4YW3A 3E6BA 5H9RA 2JG8B 3TYJA 1UAIA 1K5MC 1QOOA 3GZUC 2VW2A 1D0HA 4ZU7A 4K20A 3ZX7A 1MS5A 2ZHMA 2DTWA 3R4SA 3P3PA 4IV1A 1QOSA 5F6KA 2W08A 1N1SA 4CEYB 2BFUS 3Q9OA 1DYKA 2D6MA 3B9IA 4RQPA 2GH2A 1N47A 1CAWB 4YG3A 4WVWA 5A32A 4HVOA 2AREA 4N9HA 3ME2A 5JVVA 4M01A 4PLMA 2JG9C 1IKPA 1GNHA 2EA7A 4HETA 1OD5A 2UWCA 5T52A 4I2OA 4N43A 2IC1A 1LCLA 3WG3A 1PO11 4K7JA 1VBD3 1QXPA 3N35A 1UX6A 4XXAA 2VOVA 4IEOA 5KHKA 3R4DB 1MZ6A 3ECQA 2WWSA 1ZZ8A 4COVA 4P9WA 1VAVA 3AYCA 4Q0UA 3IDBB 2JD4A 3JU9A 3VKLA 2D98A 2BFUL 2XBO2 4PF5A 3QACA 2HWE1 1S55A 2CAUA 4AGGA 4FTSA 4CDQB 5F5QA 3R0RA 3BU7A 1QKQA 1SFNA 3FUQA 4LBNA 1GFF2 4I0WB 4NOTA 3LA7A 4N53C 2IFRA 3EO6A 2PA7A 4AWDA 5J36A 5T5LA 1H2NA 1ONAA 5F6LB 4FAGA 4RA0A 2BUKA 4XF3A 3D0JA 4BPZA 4EWEA 3D82A 5BPXA 2ZACA 1R1ZA 3FJSA 3UKVA 1S0DA 2Q4SA 2QNKA 5D8AA 3E6CC 4JV4A 5CBLA 2RM21 2VVFA 2X5IA 1LULA 2KM2A 1ASJ3 4FOVA 4B4PA 1JN2P 2Y0OA 1NQDA 1VAKA 4LE3A 1SDWA 2D6NA 2JEMA 3MF9A 3ZIXA 2D97A 4LBQB 2JE9A 2JXAA 2BQPA 2ET1A 2W39A 4XHBA 1SLTA 4TSVA 3ZSKA 4CEYA 4AFDA 1SLLA 1G9CA 1HQNA 3ZFEC 1RB8G 2ZGNA 4HSJA 2AUYA 2PHTA 4D94A 4FTEA 4KG0A 4NWVA 3AJZA 5BNNA 3ZFEB 1TME2 1KJLA 3ZYGA 3SMHA 4B7KA 2YV8A 1POV0 3BIWE 3NKGA 4QPIA 2R042 1QJU1 3RS6A 1LOAA 2EALA 1N3QA 1PVC2 2VXRA 5GZGA 3DV8A 4FXGB 3KT1A 1UL9A 3N7MA 5JR7B 2CGOA 5FMOL 3TRSB 5JOZA 4CEWB 4XOGA 4BIFA 3VBSB 3WXPA 5FRAA 3UKNA 5A33B 3B3QE 4E2SA 1BEV1 4QPGC 1TME1 4FPEA 4KWKA 2RS53 1Q8OA 1WLCA 2JE7A 4YRDA 5EFUA 3TNPB 4EN6B 3KB5A 4RR3C 4JTOA 1RUH1 1QJY2 2K2SA 4B7EA 4AVTA 3WQ0A 4CZSA 1AR82 2CWSA 4XTPA 2E9QA 4MV2A 5BYNA 2EXHA 2SLIA 1U5ZA 2I2SA 4QGLA 1AL0G 1NCRA 1TMF3 2QVSB 3HAGA 5J09A 2VY0A 4IV3A 4L8QA 4RD7A 2D5HA 1DQ2A 1V9U3 4JVAA 5DDJ1 4I0AA 4F3JA 4ATFA 2JX9A 5C8WA 4R52A 2ZX3A 2D3RA 4UW5A 3QH7A 1TMF2 4XFHA 3VZNA 1PO23 4AQSA 1RMU1 2ZJCA 1S0IA 1MS3A 3WW4A 1NA1C 1U5YA 2EVXA 2XBO1 4W65A 4WZCA 3GBGA 4AEDA 4RHV1 3O14A 5KHHA 5JI9A 1SBFA 1Y3TA 2QE3A 2R071 2BYVE 1G9FA 4MGIE 2ZMKA 1VBB2 2WSVA 3NV1A 4FTBA 2Y0IA 1R1A2 1MQTC 1QGLA 2IXLA 2XLFA 4MGZE 3CO2A 1ALYA 2TBVA 3QCWA 3SNMA 5H9QA 1XQNA 2QCSB 2RR12 4Q4X3 1VBB3 4MGKE 1ZRFA 4CDWC 3M8LA 4FP2A 4A7KA 1X8MA 5F9TA 1OQ1A 4FBFA 3S6PA 1BYHA 5E16A 2PELA 2GC1A 5JAXA 4OI0A 3LSDA 4TLFA 2IFWA 4MXWB 2XBO3 3MYXA 3WG4A 1JBCA 3T1MA 1HRI3 1D4M3 4KQ7A 5EZWA 5FREA 1W6MA 2OUHA 4JCKA 1YRZA 4B4RA 4D7YA 3MDPA 4PDWA 4FPHA 2VG9A 3SH4A 3MW2A 2DTYA 4QMAA 1H4HA 2CV6A 4YZ2A 5IK8A 4XQDA 2KXLA 1V9U1 1ASJ2 1H1MA 4LUKA 4V1PA 2BNOA 5DDJ3 1HIXA 3K48A 1MR5A 1CN1A 1OQDA 2YC0A 1MS9A 2R16A 2NP0A 4P9IA 1WBLA 2I74A 4JGYB 3QBQA 3HMYA 1R093 2A3YA 3VZOA 3JBG2 1DQ4A 3MLKA 2R6QA 3IPVA 4EN7B 4UW6A 1HQLA 4FQ4A 3HIFA 3ZN6A 1QJZA 3HR9A 4K6BA 1BJQA 4C91A 3I59B 4AE2A 5KHGA 4FSJA 3WV6A 1PZ9A 3IM0A 4BMBA 2A70A 4ZXKA 3DF0A 4WZFA 1LHOA 1WUVA 1XE8A 4RFT0 2EXKA 4F83A 4WM7C 1DQ5A 2PAMA 5EYYA 3RPQA 1ENQA 4JGZB 3WHUA 4Q8LA 4YNIA 2VULA 3VKFC 3KSCA 5BV6A 3V0BA 4H7MA 2B46X 2VNGA 4I3PA 4FPLA 3CEWA 1RUE2 4RGGA 4XF0A 5HCBA 1SLBA 3EXUA 5EYXA 1RUD1 4PQ9A 1X82A 5FTTC 1H1IA 5FO7B 4Z2WA 2DUPA 1AYN3 1V6KA 2IXKA 4RHV3 3MIGA 5GZFA 1QWRA 1S0GA 1ZA4A 4XIOA 1VBE1 4B3NA 5EXOA 2BNMA 4K3UA 4QU2A 3BTAA 4M0HA 2ES3A 4XJZA 3ATGA 4OUSA 1HXS3 4YGCA 5SV8A 4R4ZA 4S2FA 4FPCA 3WUCA 5BNOB 4XTMA 4MVTA 4NHMA 2WL1A 3J26N 2A3WA 1XNBA 3GHMA 5LEKA 1PO22 2V09A 4ISRA 5D8AC 4S2DA 1PZ7A 1LOFA 1NE6A 1Q8SA 1UZZA 4BQ1A 3BOPA 2OUJA 2O8OA 1MVQA 1AYM3 2GSYA 3NO8A 4ASMB 3AZXA 4ORFA 3WW1A 4DY5A 4HVRA 3CJIB 2HWB3 3SISA 3KCXA 3M3QA 3MW3A 2MNGA 3LA3A 1NZCA 1SBDA 4CEWA 2BWAA 1W0OA 2WA4A 3ZSJA 4FPFA 1D4M1 2R30A 4I02A 1C8M1 1H8VA 3ZXAC 2ZOEB 3P3NA 1H1AA 2GAUA 4Q4X1 5C4WB 2XB6C 2CL2A 4B4QA 3RSJA 3EBRA 4P9JA 3H9AA 3ST7A 3H1MA 5FQ0A 3T2TA 3AFGA 3ES4A 2PLV1 5DZEA 3VHPA 5KWRA 2QDRA 3RJ2X 3TAYA 1D4M2 4WM8B 5KXDA 2DCTA 3RMYA 4JC1A 1JTZX 3PVOA 2Q5TA 1J58A 2A73B 3FLPA 2RM22 4WM8C 1UIJA 5FDBA 3ELNA 4QM8A 1RUF1 5ACA2 1YI9A 2HJIA 1CONA 3OYWB 2C5DA 4KL1A 2WFF3 4W6XA 5L36A 2AZ5A 2B39A 2RR11 5CFCC 5JMCA 4HBNA 3SXWA 1ZZ7A 4HMZA 1FOD3 2NPIA 5BNOA 5DUXA 3DPRA 2XJQA 2NN8A 4Q4V3 5FOJB 5FOBB 3RWNA 4FP3A 3ZYJB 3LOBA 2R063 4KNCA 3ZN5A 3VUOA 3RYRA 2R1BA 3R05A 4JQRA 4LO5B 2YROA 1ZZ9A 3WUDA 2ARXA 4PJYA 4BLIA 3J4UH 1J3PA 2CAVA 3MF6A 2CYFA 4YW4A 1SMVA 1MS4A 2E7AA 3OJBA 3OF1A 3JCIA 2PHLA 2VW1A 4YM2A 2GC2A 3L2HA 2MHFA 2HWD3 4CYDA 5I0SA 2GC3A 3POWA 1CAVA 2R041 2ZHKA 1COV1 4DB5A 2ZGPA 2G9GA 1IS6A 4XHXA 1QQP1 2PN5A 3WP3A 3B69A 3AZYA 4MXWA 4XYXA 2HWC1 1E57A 5FLHA 1O3SA 4D7SA 1TEIA 3RG0A 5C8CA 1O3RA 5AC92 4HK9A 5C8CB 1BMV1 2PAEA 4BIOA 2LALA 1YJLA 4GKXA 1QJU3 4PDWB 3MPBA 1UU5A 1BQPA 4P9XA 1NY72 1ULDA 1CGPA 4RS5C 1QQP2 1CAXB 4XMAA 2XG3A 4Q4W2 2C0ZA 4CP0A 3WOGA 3NV3A 5A32B 5JSRA 4K9SA 1TNFA 2RE9A 1RL3A 2IWGB 3I8TA 3FZ3A 2WNUC 3MEPA 2GNMA 2DUQA 3N3HA 3QOPA 4QHBA 1GNZA 5BNPB 5CAZA 3FLRA 1LOCA 1ND2A 1R082 5AC91 4QGMA 3VHNA 3WDYA 1KXGA 5DUVA 2NMNA 3B00A 3VHRA 1W6QB 5T3NA 3ZSMA 1OA3A 3HN1A 4LEJA 4BE3A 1U0AA 1XYPA 3MICA 2XLAA 4QT6A 4META 4ZU4A 3KMHA 2PAKA 2KA3A 1MQTA 2MEV2 3WDWA 1UIKA 3BCWA 3O12A 3WD5A 1QNYA 1OLQA 3TWIA 3FBYA 3WG2A 1A6CA 4F7ZA 2A6YA 1AJOA 2RHPA 5T54A 1ULEA 4L2NA 1MS1A 3WR0A 5BNPC 4ATEA 3ILRA 4O9EA 1RVF2 2R32A 3VBHB 2Y26A 4JTNA 3MLLA 2RJKA 1WMEA 1GZWB 2PLV2 2VOKA 1DGRA 1GZ9A 3AYAA 3H8UA 4GMP3 5JLVA 2BGCA 4C1WA 3O0VA 5DG2A 2P3IA 1DFQA 1YFWA 1AL23 3AP7A 2Q30A 5HI0A 2WNVB 3NAPB 3PVEA 3NAPA 4TYSA 2E7QA 1QJY1 2HWE3 1VLNA 2ZGMA 1K5MA 2DURA 3ZPYA 2ZCWA 1NQJA 4AK3A 1YFYA 4Q8KA 5I93A 1PK6A 2I45A 3SLIA 4LBQD 4A2UA 4PIZA 4S2GA 4CEWC 1OOPC 1WLWA 2IXJA 2PHWA 5DZFA 4AVBA 1V6JA 3HT1A 3LAGA 4Q4Y2 4U36A 3ASIA 4Y22B 4YG0A 1WCDJ 1J1TA 2VU9A 4YVSA 3FHIB 4INDA 4D3WA 5JDBA 1YCIA 3WT3A 4A7YA 4Y1VA 2AYHA 3PJYA 3JBG1 1WW6A 1VAMA 3LWCA 5KC6A 5FBZA 2V5YA 5EV7A 2ZX0A 4N53A 4AXOA 1G7YA 3SCHA 2VQ0A 4LBMA 4HK8A 2CGPA 4NHLA 1W2UA 1YJKA 1KFUL 2WT0A 2QUOA 1FOD2 2CNAA 4CDQA 2WNUA 4XF9A 4GB31 5KXEA 3QLQA 1AX0A 4AI2A 2QZ2A 2HWC2 4Q27A 3RQ0A 1BK1A 5BXXA 4RL7A 4KWJA 2D5FA 1H2MA 2XL7A 1NCQA 1S0BA 3WDXA 2OA2A 2DCKA 4YZ3A 5L73A 4RQPB 3WW3A 1D2SA 4Q4W1 3POSA 2X8KA 2K9ZA 5AC93 4WVMB 4DOUA 5J3UA 4WVMA 4KU8A 2WNVC 1GBGA 5IK4A 5FCCA 4LUMA 3MLJA 5H9SA 3ZFFC 2SBAA 1IZ3A 2GMPA 4Q4X2 3IIAA 1U5XA 5BNPA 1N1VA 4GALA 2JICA 2GN3A 1X7NA 3FUOA 5L7OC 5DG1A 2WT1A 3FX3A 3INAA 1WLTA 1WCKA 3AMMA 3NW4A 5E1RA 2H0VA 4YLZA 1QU0A 2B7YA 3CJXA 2B8MA 4JRAA 2PYTA 4BOWA 4LBKA 4CDUA 3OY8B 2VVEA 3PVNA 3GHNA 3KT4A 1EAH2 2WKKA 2VW0A 2D3SA 2XKOA 2EXJA 3BALA 3PVBB 4U2AA 4YVWB 1IS3A 1W6NB 3AXEA 2WIIB 5GZDA 1OHFA 1QF3A 2YMZA 4NO4A 5GM0A 3E5XA 1BBT3 2Z2SB 4QD2A 2IXIA 3AKQA 2E6VA 3KCCA 1WBFA 3M7AA 2BPA2 4CDUC 2WQ4A 1SCRA 2OZ6A 1QNWA 1DG6A 1V9U2 4QX5A 2D44A 3ZFGC 1A78A 2XVKA 1AX1A 5FLJA 3VZJA 4L92A 4YSFA 3ZXFA 2OVUA 2H6CA 1XYNA 1QJX2 4HL0A 3ZFFB 2OW4A 1HV0A 1PGW1 3AMPA 1VB4A 3U10A 3PTYA 1O4YA 1UZYA 1I6XA 1HLCA 3MFAA 4IV3C 3ZXGA 3AFKA 1DZQA 2JG8C 1ZYBA 1H9PA 1REFA 1SQ4A 5GLZA 4CTEA 3URFA 1COV2 4AQTA 4WM8A 1RUC2 4AI3A 3MFCA 4FOWA 2EF6A 1VALA 4XE9A 4Y22A 1OA4A 3VDDA 5C4WC 2MEV1 4IV3B 3AM2A 2CY6A 4LO4B 1QJX1 1RUF3 2PQQA 4J6GA 1Q8QA 3USUB 3W59A 2P34A 2RMU3 1LHNA 3IPVB 1PVC3 1FMD1 3H1YA 3DPRC 3KQRA 4QPIB 3KLSA 4OLLA 4XFBA 2A71A 5CFDB 2VMHA 5L19A 4UW3A 4XFIA 3VZMA 2XJTA 3CJIC 1CR7A 1O5UA 1RUD3 2WC2A 3MIEA 3MIBA 4X8PA 1FYUA 1O91A 2ZGRA 3ALQA 4YW1A 1ZBA3 1ZNPA 2H6BA 1CAUA 5LEJA 1APNA 4LO7A 4FOQA 1FOD1 5H9PA 2X29A 3DGTA 2VMIA 2ZGLA 3B94A 4N7IA 3AKRA 5DUUA 2WZR2 3ROUA 3B01A 2OYZA 2YGMA 2LTNA 3BB6A 1F31A 3B9CA 4LHNA 1LOBA 3FC0A 4MGYE 5CFCB 4AF9A 2UY9A 5CFCA 1NCRB 2EAAA 3DUIA 2DF7A 4LHKA 4RR3A 4Q2FA 2IXHA 4TZDA 1BVP1 5K0UA 5K9YA 1AXZA 1PM7A 1RHI3 1SBEA 1FT9A 1G9DA 1RUG1 1ZBA1 2ZMLA 4Y5Z0 3ZO0B 1ND2B 4AHWA 2RS12 1LECA 4X6RB 4QPGB 1WMFA 3APBA 2XJVA 4HT1T 1PVXA 1CAXA 1AR93 4AFMA 4EN9B 2HWC3 2R1DA 1VJ2A 3VL8A 2GC0A 2E7TA 3VBHC 4GA9A 4H14A 2A3XA 4CDQC 1WA4A 1PIV3 4LR4A 1CAWA 3AZZA 1REEA 1QJU2 1JH5A 1FAYA 4EN0A 4Q0PA 1YIFA 2BBVA 1PGL2 1FX5A 5GLTA 4QPIC 4Y1YA 4XBNA 1O3QA 2YGLA 3N7LA 3GALA 1RJ8A 5JPMB 4E4DX 2HWD2 1OI6A 3AK0A 1IKQA 3UK9A 3GBWA 1JUIA 1RUI3 1KS5A 2GALA 1VRH2 4GH4C 1RUJ2 1N3PA 2JG9A 2XJRA 1FV3A 5FO8B 1DHKB 2E63A 2VNOA 3JQWA 2ZABA 3LOIA 2AGSA 2V73A 1VBA1 4GH4B 2WINB 5CA6A 2ZGQA 1OKQA 1Q5OA 1VB2A 1VBA3 4XIKA 1CX4A 4MYEA 1EV11 1HW5A 1S1AA 1XYOA 5D1IA 4XZPA 3MIHA 3FFQA 4LBOA 3PMSA 2P37A 4EROA 2F4PA 4Z8BA 2XH6A 4AI1A 4E2QA 2CWMA 3ZN6B 1S2BA 2IXCA 3NWKA 1ZRDA 1Y9QA 3AMQA 4AHZA 1OPMA 3VLBB 2EAKA 1QDOA 2OZJA 4AEJA 1C28A 4IEVA 5L7OA 1CQ9A 1B35B 2YZ4A 4C0HA 4K21A 3H0OA 2UWBA 2TNFA 3E5UA 5ABJB 4GQ7A 4MH0E 2VUAA 4PCRA 4HPKA 3S0MA 4N7UA 1AR61 2R043 5C9AC 4QGNA 1ZBE2 1NOVA 1CD3G 3I4IA 1TE1B 5FO9B 4YW2A 5I8TA 1MEC3 4DRRA 1A8DA 4MZUA 4XBQA 1NY71 4LO6B 3JZVA 5C9AB 1XU2A 1RGSA 1GZCA 1KS4A 5AVPA 5CFDA 2PFWA 1OFSA 3NV4A 1B09A 3VV1A 4WBBA 1XU1A 3K51A 1URXA 3H1WA 3ZSEA 3M1HA 2P3JA 3NJZA 3PMEA 1ULGA 4UBGA 2CGNA 2NMOA 3SCFA 3PJQA 1RINA 3S7IA 3VBRB 2XUMA 3E5QA 4CRQA 2YUEA 4IESA 1MVEA 2DU1A 5K0UC 1YIPA 2ZHLA 1RUG2 1RVF1 1X8EA 4Z92B 1AHSA 1KITA 4IQPA 1VBC1 4OHYA 4YFZA 1B35A 4FO9A 4IEPA 1CIWA 4AI0A 5B2GB 1VBC3 3WINE 1AR81 2BEOA 3N36A 1C8M2 4HFSA 3ENRA 1RUD2 1HQWA 1ZRRA 4QPYA 1VR3A 3VKOA 3USUA 5CG9A 4XILA 5C33A 4N43B 1DDLA 1RIRA 1HRV1 1EPZA 4H3WA 4KBBA 4P9GA 4GULA 5GLWA 2ZMNA 4KG8A 1VBD1 3C2UA 1KD7A 1XXNA 5HXVA 1IHMA 2NYYA 2A6WA 2Q1ZB 1ZZBA 4WM7A 1A8MA 4AQ6A 2A5ZA 5KXBA 1TME3 4M00A 3IDCB 1BVVA 2GMEA 2GNBA 4PBPA 1D4VB 2HWF2 1FPN1 1R1A3 3NVCA 2X5IC 3MIDA 4YM1A 4Y1UA 5JWPA 1HRV2 5HCAA 4Q29A 4LHLA 1G9BA 4XFFA 2P2KA 1UMZA 2Q0AA 4GIQA 4PBOA 3FLTA 4AW7A 1R081 4YGBA 2XLGA 3AB0A 3KM5A 5J7MA 2O1QA 3EQEA 1V00A 2JECA 3JB8A 4XF1A 3VDDC 2ZHNA 4GB32 1QHDA 2JENA 1N1YA 3V65A 2RM23 1PO13 1YO8A 4RQPC 3C3VA 1XE7A 4AVVA 1RMU2 1KDKA 3HD8B 3MZHA 4HN1A 1Z7S1 4I30A 1GYKA 5GKAC 2ZZJA 1IOAA 1JW6A 2VVDA 2HEWF 4DXZA 2WJSA 1PGW2 4CDWB 1X36A 4OI4A 4IEXA 1LENA 3VBFA 1I9RA 4IL7A 3SH5A 3UV9A 4IETA 4I3GA 1YUDA 1H9WA 1OA2A 2DU0A 4AYUA 2DFBA 4D7TA 4UW4A 4LA3A 1FPN3