2Q1MA

Crystal structure of human gitrl
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tumor necrosis factor ligand superfamily member 18
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1mA00
2ZJCA 1RJ8A 1D4VB 4DB5A 1U5ZA 1WCKA 5L19A 1C3HA 2JG9B 2WNUB 2WNVC 1DU3D 2JG8C 4QQOA 2R32A 3ME2A 2JG8B 1XU2A 3ALQA 4MXVA 3URFA 4OUMA 2TUNA 3B9IA 3LKJA 2X29A 2O0OA 2WNUC 4G4FA 3QBQA 1JH5A 5KC6A 1U5XA 2Q1MA 4TSVA 2ZPXA 4EN0A 1A8MA 1ALYA 4DOUA 4MSVA 5HBAA 4KG8A 2QDNA 1OQEA 2AZ5A 3K48A 4N90A 4KGQA 4GIQA 3L9JT 3MI8A 1U5YA 4HT1T 1GR3A 3TYJA 4E4SA 1TNFA 2WNUA 4RSUA 2RJLA 2KA3A 2RE9A 4QQHA 1OSGA 4D7YA 1S55A 4OUSA 2WNVA 3AB0A 4TWTA 1D2QA 4G3YC 2WNVB 1TNRA 2HEYF 2QE3A 4QQLA 4F3JA 2JG8A 1IQAA 4KGGA 4J6GA 1XU1A 4QQ2A 3WD5A 3TWIA 2Z5WA 5L36A 1KD7A 1O91A 4MXWA 3B93A 5KWRA 1PK6C 3K51A 4QQPA 1OQDA 4E4DX 2OIIA 2TNFA 4OULA 1I9RA 1RJ7A 1PK6A 1PK6B 2HEWF 3FC0A 4MXWB 1JTZX 1DG6A 2JG9C 2E7AA 2R6QA 3IT8A 3QD6A 2R30A 2RJKA 2Q8OA 2HEVF 3V56A 4QPYA 2JG9A 5TSWA 4NN0A 1C28A 5CIRA 1KXGA 1D0GA 5BNQA 5KC5A 3B94A
chains in the Genus database with same CATH superfamily
2FCTA 2ZGMA 3BPZA 3LQCA 3POIA 5FPLA 2P17A 1N1SA 1R1A1 2XVKA 3BOWA 5FQ0A 4RGKA 5B4NA 2PHWA 1GZWA 1DLLA 4ZU7A 4YGEA 3KV6A 1W8FA 4Q4Y2 4UYBA 4WM7B 4XQ4A 3MIDA 3KLSA 4MHUA 4QPGA 1PX3A 4BH9A 2VAUA 2B4KA 4IV1B 1LCLA 4RYDA 1WWYA 4DS0A 1APNA 3B00A 2Q0AA 4CU8A 5CBLA 5JOYA 2VBPA 1H9WA 4E2QA 3VDDC 4LT5A 3WHUA 4CDUB 1U12A 4HLTA 2AGSA 3JB8A 1DQ4A 4TSVA 4X8PA 4I3PA 3KWVA 2R1BA 4O7XA 3OGGA 4X6RB 5FXZA 3UK9A 1QGLA 3I2JA 4KG8A 4FPCA 3AP6A 2V5DA 3NV1A 4PCRA 1XXNA 1FPN1 1PO23 2ZHNA 4GD4A 1KDKA 4S2HA 4Y5TA 4IEQA 2ZHLA 4EV0A 5APAA 2VQUA 3RMXA 4ZHNA 1R091 3KMHA 1H1AA 2H6CA 3D6EA 2W46A 1SDWA 2Q5TA 1YQ5A 3H1YA 2VXJA 1AR81 2H0VA 2XBO1 2CY6A 4JGYA 5H9SA 5L73A 5A7PA 3WQBA 2VNGA 4WM8C 3PJQA 5FOJB 5K4LA 3DPRC 5BYNA 1AYN1 1US2A 3ENRA 2IC1A 3VLBB 3C7FA 4KBZA 3I3MA 2VMFA 2ZXQA 5FY5A 3BTZA 2EVXA 4DFSA 4GA9A 5A1LA 3MF9A 5G04L 3AB0A 2RS53 4IE4A 4W6YA 1WA4A 4XHXA 3ZKUA 2Q8DA 5IW0A 1BHGA 3DYPA 4NHMA 3WHTA 4MGSA 2D6LX 2YXSA 3RYPA 3U14A 2P3YA 4SLIA 1SPPA 4J6GA 1TQ5A 4AFAA 2E7TA 1RMU2 3FJSA 1QOSA 1O8SA 1DZQA 1AYM1 3BYWA 2WZR2 5F3IA 5LZ6A 4Y20A 3B93A 1NZCA 4RN5A 4CVUA 3K51A 1VBD3 3KGLA 3ZKYA 4KL1A 4CCDA 1W6QA 1WLTA 2YU1A 2QNKA 2ZGTA 1W6NB 1H2KA 1PK6A 4AGVA 2G9FA 3WLUA 2KXLA 2OQ6A 4YM1A 1JUHA 5AC93 3TEYA 3JZVA 1UKGA 3CHXA 5FPZA 1UOGA 4V1PA 3JBG2 3U07A 3BPSA 3Q8FA 1ZBA1 1CIWA 2XR4A 1QJZA 3ZYFA 1PVC1 2NM1A 5JIAA 4IESA 3LEKA 4JDNA 3OD0A 5C8CA 1OOPA 5DQ0A 5EFUA 4FI9A 2NMOA 4GB31 3VBUB 1J59A 2FDIA 4OI0A 3ZXAC 2TBVA 2K2SA 2OUJA 2WDBA 5CB7A 5TSWA 3T08A 1RHI1 3HN1A 4NHXA 3SEPA 1V6JA 1UL9A 2W08A 1CZSA 1OKOA 3LE0A 5GLUA 5L7OA 1YHFA 1RJ8A 3LA2A 1LU1A 3NRUA 3PVBB 1QJX1 2ZGKA 2HWF2 4OHWA 3MV01 3ZFEC 3HVDA 2DUOA 3CJIC 3RZJA 1RUJ1 1QQP1 3ROUA 4JCKA 2A3WA 3M8LA 5FO9B 2RVAA 1UMZA 1UIKA 3DYMA 1V6OA 2LALA 4JKMA 2WO1A 4UW3A 4ES8A 2Y26A 4LO5B 4A7KA 1HDKA 2LRPA 3POFA 4QXKA 2JDAA 3JD71 5FZEA 4Y5Z0 2YYOA 3KV4A 4N53A 1N3OA 5FUPA 2RS31 1JZ6A 5IVVA 1Q43A 3EQEA 4CDXB 3DUIA 5KHKA 2ZACA 4XZPA 3LD8A 4I0WB 4K8RB 2YC2A 1FMD1 4CDWB 1UIJA 2DCKA 3QOPA 1U5XA 3DPRB 3D8CA 1W9YA 1Y4WA 1RUC1 2DUPA 4ZONA 1W6MB 2BTVC 4JAAA 3GF6A 1JU3A 1NLRA 4GKXA 4PQ9A 2R16A 2AYHA 4ASKA 1UU6A 2PHDA 4N53B 1QY4A 4AFMA 4DXTA 1YRZA 1IKQA 4P08A 4RFT0 4IQPA 3MLKA 2G19A 3KCCA 3E5XA 4K9SA 3ZOIA 1VMFA 1POV0 2W91A 4YW7A 3USSA 4ATEA 2D3RA 4ES9A 2XH6A 3KCYA 3WNPA 2VMDA 3AKQA 2NYYA 2AEYA 4Y4RA 2ZCWA 1BKZA 1VBC2 3DECA 2R49A 5C3PA 2BJSA 1W6MA 1YIPA 1B35A 1OSGA 3AK0A 3RZMA 3ZFGB 4YPJA 4PBOA 1PIV2 5C9AA 4YZ1A 1QIQA 2WKKA 1E5RA 3ST7A 4OMCA 4LBLA 4OYUA 1SLTA 2HWB2 3BUCA 2Y6LA 2X5IC 1X82A 1Y43B 5FLIA 5DAWA 4NHLA 2A1XA 5LRSA 5DZGA 3FLPA 4Q0VA 5ACA3 1K12A 1EPZA 5LK7B 3RG0A 3BALA 1CZVA 4XIKA 3LB9A 2B9UA 5KR7A 3PVNA 3O0WA 1NAEA 4MUVA 5I0UA 3VDAA 2ZKLA 2JDPA 3VKMA 5GLVA 4BE3A 4CDXC 4FPJA 1NLSA 5KXBA 4DUXA 2BYVE 4IV3B 5LA2A 4CE8A 2P2KA 4JRAA 3BTAA 1PO11 1W04A 2ETEA 2Y64A 4QQPA 4AHXA 1W6QB 4YVWC 4Q4W3 4UWDA 3VBOB 1RUF1 1ST8A 2TNFA 4HPKB 2GP3A 1PO21 4D8MA 5LA0A 1VP6A 1UZVA 4JKLA 1KFXL 5C8WA 5A3UA 4Q29A 2WO3A 4XJUA 4GJYA 4BZ4A 4CU6A 5C3QA 1JZ8A 1IG3A 1MPXA 5EV7A 3V0AB 4HZFA 4RHV2 4F83A 5KHGA 2XBO3 1IOAA 2RR13 2YHJA 4M0NA 4W65A 2ZEZA 4YZ2A 1ND3A 4JVAA 1DF0A 3N9NA 3X29B 4Q8KA 1S0JA 4UF0A 3VBSC 4FQ4A 1JYTA 3B94A 2IFWA 2D6KA 2QQJA 3VHNA 4Z07A 2I2SA 2JIGA 2ZGNA 5ERLA 1REDA 4BYYA 2J7MA 3C2UA 1ZYBA 1MS8A 5L19A 3AYEA 1RXFA 1YI7A 5F2WA 5A33B 1FAYA 2GAUA 4M4RA 4C8DA 1LOAA 4C0HA 1LHUA 4S2FA 1CJPA 2VW1A 1D2SA 5CFCB 3WDTA 2C1FA 4QKFA 3ZR5A 4EN8B 1HQLA 1W8WA 1YQCA 3T0DA 1W3XA 2XJTA 2DYCA 2BP6A 3AJZA 3P5BA 1A8DA 1US3A 1QQP2 1CAXB 3VDDB 4HONA 3HR9A 2X29A 3LKJA 1LJ7A 3MLJA 1HB4A 3NAPC 5CYYA 4BLIA 4H7LA 3QCWA 2ORZA 4QU1A 4CEWC 1BJQA 2XJPA 3N36A 2GP5A 3T09A 2GDFA 3FHIB 4S2GA 4XUQA 1ENQA 2JDHA 2RHPA 2VE1A 2ZZQA 4R8HA 2J42A 4FOVA 1DGWX 4YVSA 3WG3A 1T6GC 4YZ5A 1RMU3 4HK9A 2F4LA 2QQPA 4FPEA 3GBFA 1O59A 1ACCA 4CDQA 5DN2A 4D6QA 5GJ6A 5A7WB 1NT0A 3WP6A 3CZJA 5FLJA 4NIIA 4N90A 1O3RA 4GKYA 1CAVB 1JOBA 4GAZA 3T0AA 1K42A 1FATA 5FYVA 1RUG3 1W8NA 3AZXA 4NHKA 1V70A 2A73B 1EV12 5A7QA 2JDKA 2DU1A 3BTYA 2Y33A 1EV11 1RTVA 1AR63 1HRV3 3I3QA 2VU9A 4HFSA 4KI5M 4XXAA 3SEEA 5JSRA 4RA0A 1VBB2 5KXEA 3AX4A 1ND2C 3OUIA 1RUH3 5EYXA 1CAWA 1NCRB 5KXCA 1F31A 2IVJA 4RQPB 1QDOA 1XYOA 2PELA 4FFGA 2GSYA 3HNBM 3UETA 2RMU3 5C6CA 4CXWA 3N7JA 5DMYA 2BBVA 5FJKA 3PUIA 2RS33 4MH0E 1UY3A 4LQRA 2VULA 3KQ4B 3AMNA 3R05A 1AR83 1WA6X 2WT2A 4E4HA 1YJKA 4P02B 5FK7A 2QVSB 4XUNA 3SCGA 1KITA 1J1LA 1SCRA 1RUC3 4NIAA 5JMOA 3ZN5A 1V6LA 3GDBA 1VJ2A 1PMJX 1J3RA 2WO2A 1RUD2 1JYXA 5IFPA 4IGOA 1H2NA 2YBKA 1AYN2 3ETQA 1LULA 5FY8A 1MZEA 3J9SA 2FCVA 4BK4A 4AAXA 4FSJA 1KS4A 3FX3A 2R061 2C24A 3FC0A 1UU5A 4JGZA 1CJDA 1DP0A 3OPWA 4LKSA 1QJY3 4K3UA 1RHI2 1OI6A 4Y3OA 2AREA 1FNZA 1MVQA 5CZKA 5GM0A 4QPWA 5FKBA 5KXDA 3VBUC 1UYXA 4YM0A 1WW7A 1GUIA 1YQ6A 3WQ1A 3WY6A 4NOTA 4XMIA 1STMA 2E31A 1HRV2 1AR62 4FOQA 3L2YA 1OURA 3ZSMA 1ZZ8A 3JUUA 1CR7A 1QJEA 3NKGA 4LUMA 5K0UA 1RIRA 4DNYA 4DB5A 1UYPA 1VIWB 2LS6A 1SLCA 5FZBA 5FFOC 4FTEA 3UGGA 1QJU2 3EB7A 2OZ6A 3RNSA 4W50A 4NRQA 5L9VA 1LRHA 3APBA 2R043 4RGGA 4QB6A 1PZ8A 4ZU5A 4D6RA 3WDUA 1HRI3 2VH9A 4S2DA 2YGMA 3IAPA 5EP9A 4K20A 2O0OA 1COV3 4EZHA 4XFFA 4EWAA 4L0PA 5BUVA 1J3QA 1Y9GA 4AHYA 1QQP3 4M3CE 2ZAHA 2PLV2 1CZTA 2HYXA 4QXCA 2JB8A 4IE0A 1GU3A 4Q0PA 4DZGA 5KHIA 3IDCB 3MGUA 4M0HA 4HKOA 4YWAA 1ZBE2 3LZZA 4YGBA 2Q8CA 3THCA 3VZMA 5CG8A 1R092 1DZTA 4I02A 5DAPA 4H3WA 1SZBA 3ZFFA 2VCBA 1X9TA 4UI9L 4Y1YA 1WCUA 2B42B 2VZUA 3OEBA 1W06A 3SLIA 1WD4A 3UKTA 4NIDA 3HEIA 5LK5A 2ZEXA 3K75B 3TEXA 3WG1A 1S0IA 2FDKA 1NZIA 2C26A 3POBA 5EHDA 4NE9A 3RPQA 4BM8A 1HN1A 4OUEA 5JUVA 1JYIA 4R4ZA 4B4RA 4TN7A 2WNVB 3RMYA 1UD1A 5FLHA 1AR73 2ZGRA 1F8VA 3VDCA 1IQAA 1U5IA 5FAXA 2X05A 4A7ZA 4N43C 4EN6B 4EWEA 5J37A 5IWFA 3T30A 3KM5A 3WG2A 3FUOA 3BU0A 1KD7A 4BA6A 3WF0A 4D3WA 2WS93 1D7PM 2DV9A 5E16A 2A6VA 1KJRA 3M3CA 1K45A 2VZVA 1IPSA 1W8UA 5BNOC 1W8TA 3UJOA 1I1EA 2DF7A 2ZGSA 2IXHA 2ZAAA 1WMDA 5GZFA 4JTOA 4IE5A 1GFF2 1AZDA 1VE0A 4XFAA 4BWOA 1QEXA 1V6IA 4YLZA 2E32A 3AP9A 4PHZA 1W39A 2A71A 3I2GA 5FREA 4H55A 2PAEA 1O3SA 4OFGA 3FLTA 5FZ7A 1P8JA 5FZ3A 2JENA 3NQHA 4MG2A 1F15A 1H4HA 2W2IA 3R4UA 2EXHA 3H8UA 1PIV3 3V56A 2W87A 2C9KA 4RS5B 5HI0A 1DYPA 1NA1B 2HWF3 3VBFA 3OCPA 1B09A 1BK1A 5C4WB 3H0OA 1OF3A 2HYKA 3PMEA 5FYUA 3ZXDA 5KC5A 3I7DA 2F17A 1DBNA 3LIHA 4DINB 2RM23 5DG1A 4ONUA 5FZLA 4YVWA 3SCHA 1UY2A 3AFKA 4CCNA 5ACA1 4W4ZA 4H2AA 5JZGB 1HXS1 1K5MB 3M3EA 1Q56A 3LFIA 4CUGA 3VD9A 1BEV2 5A33A 4IEOA 5FZGA 1OPMA 5JR7B 1GOGA 2WSVA 5FMOL 2VBBA 5FYYA 3HN3A 5IVYA 5J7MA 3E5QA 2MEV3 5FYCA 4XDOA 1GMMA 4AEDA 4YYOA 2ZABA 4OUMA 1MZ5A 2TUNA 4XYXA 4HVOA 1PNFA 2X5IA 4XBLA 2NMNA 4A4AA 1G9BA 3LA3A 3O0XA 1CX4A 2WNUC 4XVHA 4Q4V1 4AVTA 1FV2A 1BK0A 5J09A 3M3QA 2I07B 2K46A 4UW6A 2FZ1A 3SH5A 4XC9A 4GULA 1G86A 2ERFA 2P3JA 1ALYA 3ZIXA 4L2NA 5K7PA 1T6BX 1PGW2 4CA9A 4AW7A 1GNYA 3PUQA 2Z2SB 4D0QA 3AMPA 1W6OA 4P9YA 5FYZA 4CSWA 5IT6A 1UU4A 3H9AA 3N9PA 1XNCA 1YCIA 3EYPA 2QDNA 5A3MA 1ND3C 3K48A 1C8M2 3ZMOA 3CKHA 1NCQA 4UFHA 2RS52 1ZVFA 1D4M2 5K8SA 1PO12 3C7OA 4PI2A 5T5LA 5C4WC 1AL22 2BGOA 2RR12 3MF6A 4QGMA 3RWNA 4RD7A 1XB9A 2JDMA 5FRAA 2WSUA 2RS12 4FP2A 3LDKA 4O9EA 4HVQA 1XNDA 4JGYB 3LWCA 2GC0A 1ENRA 1CQ9A 2J1SA 3FWEA 1FOD2 4AQSA 3NO8A 4LIUA 3ZSKA 4A6OA 1RC6A 4OZXA 2Y6FA 2R041 2ZGPA 1UXXX 2GH2A 2QQUA 4YW1A 5EIYB 4UFJA 3WNOA 2JB4A 5JAXA 2WYFA 1TZOA 4N53C 4TLFA 3MFCA 2D5HA 3WT3A 1TNRA 2GMMA 2W0XA 4IXLA 4LE4A 4JZRA 3UNPA 5IVBA 3HT1A 3H50A 5T3NA 1G9FA 2PTMA 2Z79A 4DRVA 3V0AA 1WBFA 1RVF3 3ASIA 3AMMA 2W39A 3J7LA 4JDOA 1WGPA 4CDQC 4XJAA 2WLQA 4LBKA 2GC2A 2BV4A 4P5YA 1ODNA 3B02A 1ODMA 3PTYA 4P14A 3DF0A 4A42A 4UFMA 2WAOA 2P5BA 2BBAA 1ZA4A 4E9KA 3T2OA 3MW4A 4JRLA 2OYZA 4E4DX 4CEWA 1DYOA 4CRQA 1ULGA 4RS5A 1YXWA 2WN3A 4YM2A 3BI3A 1L7LA 2RDRA 3PU8A 2HWC1 3CQOA 4MLOA 4AVBA 4IV1A 1RUD3 4MVTA 1RB8G 3T2QA 1PZ9A 4QPGB 1C8M1 1HB2A 1LOFC 3R4SA 3MV11 1UW8A 4C1XA 2HH9A 4N7IA 2VOWA 2UY8A 4FO9A 1K5MA 1DGWA 5JCTA 4CP9B 5F3CA 4WZCA 1QJU1 1ZZCA 1UXZA 1VBC1 1D0GA 1NUKA 1YIFA 2YPDA 3E6DA 2D6NA 3MIHA 1BVVA 4LNVA 4R9DA 4BCUA 3W5MA 2D93A 3AC0A 3IIAA 2WFPA 3AZVA 2I45A 2UYAA 4BQWA 4DQAA 2ENRA 4IGQA 3VBFB 5I8YA 2YROA 4OI2A 1UX7A 4MGIE 4QPIA 2XOMA 2OUHA 4QB1A 2WZ8A 2QQWA 5JR2A 2E51A 4XW3A 2R32A 3G7DA 3NNGA 4YW3A 2J22A 3GM8A 3T2PA 4HMZA 5A1FA 4NMIA 3UESA 1L3JA 1SLIA 1TVGA 2QQIA 4IEVA 3AYCA 2JKXA 4XAEA 3VHPA 5CISA 3MEPA 5FOBB 3USUB 4PIYA 3TEWA 3S5AA 2YZ4A 1CPMA 1LEMA 4PDWB 3ZMNA 1NX9A 4BIOA 4N9IA 5C3SA 3B9IA 1E5SA 3ZDVA 4CP9A 1AR61 1HRV1 2YV8A 4Q4X2 5F5QA 3ZYBA 4CXXA 1AR72 3LPFA 3CJIA 3DPRA 2ZTNA 2ARAA 4HK8A 2VCMA 1ULOA 5CFCC 4CDXA 4XCAA 2PHXA 4M01A 1VBE2 4Y1UA 4ASMB 4F7ZA 1MS3A 2VMCA 3O0VA 2A3YA 4EQVA 2E6VA 4UOJA 1RUJ2 4KU7A 3ZFGC 1GANA 3MIFA 3P3PA 1SEFA 2W5FA 1CONA 3D82A 3GBWA 4AVVA 2LTNA 3RYKA 4CDWC 3ZYHA 4MGTA 1OH4A 3B5LB 2W1UA 4XJWA 3TNQA 5CKQA 1OMIA 4FFIA 1R082 1UAIA 4NWWA 1R093 2QZ2A 4AGRA 1AJOA 5ISLA 4XF3A 4XTPA 4AF9A 4BQ4A 1LENA 2RE9A 1Q3EA 3ILNA 1SG3A 2DVGA 4Z92B 4OCTA 4O65A 1GNZA 1WCSA 3S57A 3I4IA 4AFCA 4FBFA 4FCAA 1L7QA 4E2GA 3WW1A 1UZWA 4G3YC 5A3PA 4XBNA 1UOFA 2ATFA 3N9QA 2VC9A 2CDPA 3G6JB 4RFRB 4XABA 4EROA 4B7EA 2JKBA 2V73A 4GMP1 4XETA 1SLBA 1XQNA 5JDBA 1UQXA 3I59A 2VTXA 3K4AA 1RUI3 4I2OA 2VZRA 4NUBA 5E88A 3J7HA 3EJKA 1QHDA 2EXJA 1RGSA 5C7GA 5D2AA 1GWKA 3KHBA 4LO7A 5FIXA 3W58A 4YZ3A 1LOFA 1S2BA 3NV3A 1IS5A 4P5HA 4AI0A 4IEYA 1DQ1A 3ZPYA 1PGL1 3RDIA 2GNDA 3JCIA 3M1HA 3OTFA 4JTNA 1W28A 2BQPA 3CEWA 5DAQA 2E9QA 1G8WA 4NAMA 3DN7A 4LHSA 1QXRA 1E5IA 1UYZA 2A6WA 5F5CA 2J1EA 3HNYM 3VUOA 4HBNA 2EAAA 2K0GA 1JZ3A 4TYSA 3D4KA 3WR0A 1JOJA 1S0BA 2ZOEB 2B46X 3GJAA 4XZUG 2HEVF 4YW5A 1NG0A 4R52A 3POGA 5CADA 2NLRA 2WFF2 3LEMA 1RUG2 1H0BA 1QXJA 4Q0SA 5F8PA 5GLTA 1J83A 5DDJ3 2A70A 2GALA 5J1XA 1LGCA 4MXVA 3P6BA 3U0ZA 3ES1A 4GXLA 1E5HA 4CUCA 1ZBA2 2J1RA 2HWB3 4GB32 2EA7A 1VBB1 3N7LA 1JMUB 3MUZ1 4MGYE 3MIGA 1JU4A 2JG9B 2CU5A 2VZSA 2ZMNA 3S0MA 2WRAA 5FBZA 3O12A 1M06G 4AVCA 4A41A 3KHCA 3J4UH 4HVRA 4MHRA 4Z1VA 2P37A 3GZUC 3BIEA 1BBT1 1UKRA 2IXIA 2SBAA 3KVBA 3OBTA 5A32B 4Y33A 5F32A 1VRH1 1F4AA 4IW3A 1WMXA 4YSFA 3RVHA 5C4WA 4K1ZA 1ENSA 4AEJA 5JXJA 4MV2A 1C57A 1HV1A 1NA1C 2GNMA 3QBQA 4NWVA 2W95A 2VECA 1KRIA 5CFDB 1ZBE3 3WDYA 5FY7A 4QD2A 1T2XA 1QH6A 3O1TA 1EAH2 2ZPXA 5FWJA 3RWKX 1BYHA 4X8NA 4KU8A 4OI4A 3H7YA 1F4HA 5L9BA 1W9TA 5CKNA 3NNJA 3WP3A 2VY0A 4CCJA 5ANNA 1VMJA 4Q4V2 5H9PA 4L92A 4COWA 5LRRA 3ZYJB 4GMP0 3AZWA 3VV1A 4D69A 2AZ5A 2VD7A 3T4HB 2B5HA 2G9GA 3EO6A 1ULPA 2VQ0A 2WLPA 4GIQA 2GH8A 5CFDC 1UZ0A 2WS91 3MI8A 3ZIWA 2ZZJA 3HQRA 2RS32 4XUTA 3I2FA 4O9GA 3RS6A 2WNUA 4XJ9A 1YC61 5LY1A 1QOOA 3O1OA 2P3IA 4OHXA 2WN2A 1Y3TA 4UW5A 3J8F2 2KR2A 4YFWA 3N4MA 4NO4A 4UT5A 4ZXEA 5F9TA 5IFTA 2WNVA 3SXWA 3O7OA 3KD4A 5I8SA 4CCCA 4OHYA 2BZDA 4CPBD 2VUCA 5CFCA 4DUWA 1GNHA 5JSOA 4BB3A 2JJ6A 2WJSA 4XF1A 1RUOA 4GH4C 1J84A 4ZXKA 4LKDA 1AUYA 4WVVA 2P1BA 4AI2A 2A5ZA 3E97A 1ND3B 1NQDA 2BU9A 3MHZA 3VHOA 2BDRA 3SISA 1XJAA 5ACA2 3VBFC 2WZPP 4YGDA 1NCQB 2PLV1 4M00A 3KCXA 1I9RA 3KSCA 3KS7A 4OULA 5IVEA 3AZZA 4MXWB 4KWLA 4RR3C 4Q4Y1 3D0JA 2QJVA 3NNFA 2X10A 2V4AA 4Y1XA 3C7EA 1VBD2 4LA2A 4BXSV 1DDLA 1AX2A 2JG9C 3B3QE 1H8VA 2ADDA 4OHVA 1QNYA 3W9AA 1R1A2 4NIHA 4M3CB 1Y9MA 2XQRA 2R30A 3AKRA 4MGZE 4LK7A 4Q5OA 4QPGC 1LOGA 2Q8OA 5GZDA 1SMVA 4AQTA 4DY3A 3I54A 3VBRC 4L9BA 4PLMA 1O3QA 5EPAA 5D21A 5K9YA 3VDBA 4A6SA 2HWC2 3EHKA 1F35A 5A6ZA 5F1RA 4XILA 4N7UA 5LATA 2RDNA 1C5HA 2VW0A 1XYNA 4QX2A 1ZRCA 1F2NA 2C5DA 3AKTA 2W94A 4NRMA 1OQ1A 3T3YA 1W8HA 5F6KA 4IEUA 5FZ0A 3FHQA 4FPGA 4FTBA 4QXHA 4CP1A 2WUHA 1JXNA 3ORJA 3CJIB 3AJYA 2C9AA 2H6BA 5E89A 2J1VA 4GWNA 4KH9A 1Z78A 4LXLA 4DEQA 4PDWC 4DXSA 3IB3A 1QJU3 3A21A 4MO3M 2UWCA 4N43B 1S0EA 4AQ6A 1XPWA 2CWMA 1LEDA 4LTAA 1MS5A 1SDDB 1LKNA 4M4PA 4PDWA 5E1RA 5FTTC 5T50A 1N3PA 5GKAC 5C3RA 4G4FA 4NPMA 3W59A 4NAOA 1CIYA 4QKDA 4HG6B 5KC6A 4B3NA 2JICA 5HCFA 4CYDA 4QXBA 4QPIB 3R6SA 1AX0A 1L7RA 3OUJA 3I8TA 4HKLA 3BCWA 1CAUA 3OYWA 3FHAA 4XE9A 3POYA 4QX3A 1DCSA 1R1A3 2WQ8A 2OW4A 4XXPA 1RMU1 2YBPA 2XHKA 1D4M1 3KF3A 5KBFA 1VBA3 1K5JA 5F7UA 3W5NA 4V2VA 3T4VA 3WSOA 3ZLIA 1GP6A 2P3KA 5FP8A 3AKSA 1PZ7A 3ZVXA 2BNOA 2ILMA 1DQ0A 2UWAA 3LEGA 2WZR1 1PMIA 4W8JA 4KG0A 2XKPA 4UXAA 1CAUB 3OYWB 1AF9A 1A34A 4QU2A 5T52A 2VMIA 5FZ1A 3ZXFA 1GZCA 3OBZA 5GALA 3KV9A 5H9RA 4AZZA 2ZHKA 5HXMA 3JBG1 2DURA 2VUDA 2KD7A 4CEYC 3I3BA 1GQPA 2WNOA 5T5JA 2ES3A 5LBBA 4LHLA 3IBMA 5IVJA 1SHWB 2RG4A 3FUQA 3R4DB 2E26A 4FFHA 1JYVA 1Z7S2 4FPOB 4KGGA 2DCTA 1DQ2A 2PHRA 2VVDA 2W52A 1XU1A 1MR5A 3LSEA 4LHNA 5K0UC 3TWIA 4YG6A 1JODA 1YQ8A 2ORXA 2QKDA 2V5YA 2WR9A 5FMOS 1SFPA 4GWIA 2AH2A 5BY5A 2VPVA 2XWBB 3GNEA 4Q4X3 5EQUA 1ONAA 4OI1A 1AR92 1COV2 1SFYA 3H42B 5T5PA 3K46A 3PTRB 3K4DA 3WW4A 1PK6B 1YFUA 2XUMA 3ELNA 1Q8VA 4ITCA 4JX0A 1LOEA 2QQKA 4O61A 5DUVA 2VXRA 5C8CB 4HOOA 2Y0OA 1I3HA 3U11A 1AR93 2JWPA 2HBUA 4DIQA 1DG6A 1FXZA 5C9AC 1AXKA 3ON7A 4YVSB 1J3PA 4JGZC 3LA7A 4B4QA 1B35C 3NKTA 4XIOA 3KB5A 2WA3A 4CZSA 3THDA 1POV1 4CEWB 3ECQA 1BLZA 3THPA 5C3OA 2W47A 5FZCA 2XUEA 2XVLA 1LB2A 2CL2A 3HAGA 1IPJA 4A3ZA 1QJFA 3O1VA 1XE7A 1ZNPA 2KM2A 3N7MA 4GWMA 2XPJA 3N35A 1SFNA 4IEXA 4LK6A 5C71A 3WV6A 3ABZA 4LBNA 3VB9A 2J1TA 4FVVA 3GGLA 4TZDA 1DU3D 3VKNA 1UY1A 3AYAA 3AZYA 3B69A 2CAUA 2PQSA 5C33A 1BQPA 2VL4A 2GN3A 3H3ZA 4RL7A 1OVPA 5FV3A 1RUF3 5T55A 4AVAA 1QXPA 1YNAA 5F39A 2VGDA 2VM9A 3PL0A 3A0NA 2OZJA 2D43A 3I2KA 3MW2A 2VOKA 4I09A 2FQPA 4KMQA 4IEPA 3ZN4A 4PT6A 1MZ6A 2O8QA 3C8XA 4B1LA 4P9LA 2GC3A 5DG2A 3PLQA 1JZ5A 4BLJA 2NZ9A 1EY2A 1X50A 1O5UA 1I6XA 1NXMA 3SMHA 4E2SA 5GZGA 3A4UA 2JE7A 3A0KA 1COV1 4COUA 3O1MA 1UX6A 3ACGA 2WQ4A 2X53S 3Q9OA 2D40A 1N1TA 2VMGA 2ARXA 2VR4A 5A1AA 1RXGA 3KF5A 1H6XA 2VCAA 5LW9A 3HQUA 4INDA 4TLGA 3WX5A 1NKGA 1GQHA 1LHNA 4GH4A 3I3DA 2BVVA 5EJ1B 5FZOB 1OLME 2CYFA 5J96B 2AC1A 4HT1T 4META 4CXYA 2XLFA 4RHV3 1YUDA 3CBNA 1ZBE1 2C0ZA 4BPZA 4COVA 1UZYA 3LPGA 3RFRA 4OQ9A 1VBA2 4IL7A 4CDUA 1WMEA 3ILFA 2DU0A 2LROA 4QX1A 3MPPG 4HETA 2VNVA 4HANA 1GKBA 1AXYA 1LECA 3PURA 5DDJ2 3WNNA 2WS92 1QDCA 1UF2C 3WINE 3M70A 3C7HA 4XFIA 4DRRA 2VZ1A 3FBYA 4LUKA 4YM3A 5IAVA 4ORFA 5A6QA 1S1AA 4XFCA 1ZRIA 2YY1A 1G6NA 4QT6A 3FLRA 1NCRC 1RUH1 1W2UA 1XSRA 2PMWB 4QQLA 2BOJA 1IG0A 3SITA 5A32A 4QQ2A 3MLLA 2QCSB 4IETA 2VMEA 5LY2A 2DCJA 3BVCA 2O14A 5L36A 4IE7A 5JI9A 1LHWA 1H8TA 3LGRA 4R9AA 3UKNA 3OJBA 4D7TA 2VQAA 4EN7B 5IVCA 5KHJA 1TME2 2CNAA 3DCQA 4ISRA 5DAXA 5I0TA 4LPLA 1Z7S1 4AL9A 5CKMA 3KT7A 4COYA 2W9XA 1OA2A 1AR82 1NA1A 2DUQA 3KZ4C 3INAA 3L2HA 5CNAA 4AEKA 3F95A 1HN0A 2HEWF 2VJXA 1H1MA 3ES4A 2WBKA 1FMD2 2FD8A 3O1RA 4LBOA 4Z2WA 3C7GA 2IXJA 4BK5A 4Q8LA 2PHFA 1POQA 2YC0A 2ZX0A 3O1UA 2E7AA 2BPA2 2R6QA 3IT8A 1QJY1 1LR5A 3JD72 2PHUA 1IS3A 1BEV3 2WZR3 3DYOA 4LMFA 3ZO0B 4I01A 5A6YA 3CDZB 4CDWA 3ZFFB 4D6SA 1W05A 2QDRA 1QKQA 4NN0A 4QHZA 2D98A 3ILRA 4XFHA 3EBRA 1OD5A 2JXAA 5AFEA 2ZGOA 4QDRA 4RS5C 5D8AA 1I5PA 1I5ZA 3WUDA 1JZ7A 4AWDA 2JE8A 5FP7A 2BOIA 1SBEA 3M3OA 1VAMA 1C5IA 1HKDA 3TB0A 5BNNB 4BU2A 5J98B 2DVBA 3LEIA 4RR3B 2R042 4BISA 2GNTA 4GZ9A 1O6UA 2R063 2Q1FA 5JLVA 3LSDA 1S4CA 1N1VA 1O3TA 4XHBA 3VBSB 1PVC2 2IZWA 2XBO2 4LO8A 4RQPC 3DKWA 1W6PA 2FMDA 3AYDA 3WUCA 3VL8A 4XJZA 3VHRA 1OXCA 1KQRA 2YDEA 1UYYA 1OOPB 1Q8PA 4QPIC 4AEDC 3PJYA 4G9SB 5BXXA 5JOZA 3C3VA 4XFGA 4C1WA 4D94A 5M0TA 1LU2A 4P9XA 5F3GA 2PAKA 3RJRA 1HJFA 3WG4A 4JC1A 1UMHA 5LBFA 2WO7A 5HBAA 1TMF3 2XDVA 4Q4W2 4CCOA 2WT0A 3ZYGA 4YW2A 3MBWA 4XQWA 4DXZA 5ABJB 1VR3A 3ZN6A 4LBJA 3LIGA 5E8AA 4EYUA 1OFNA 1PM4A 4Z2AA 1NCQC 1VAKA 3NW4A 3TEZA 3S5QA 4QWNA 3L9JT 4QGLA 2ARBA 1V0AA 3AP4A 3HD8B 3NL1A 5E6HA 3AFGA 3I2IA 1RUF2 3LAGA 4Q0UA 5FXXA 4YRDA 2KA3A 3S7IA 3EMRA 1AVBA 1OA4A 1W03A 1TE1B 2YBSA 3FFQA 1SBFA 3IMMA 4Q4Y3 1ZX5A 4DXRA 4FPKA 5ANQA 1MQTC 3GJBA 2CGOA 2OX0A 3JQWA 4URTA 3T1MA 4OUSA 4PLOA 3QH7A 1FYUA 4R4XA 1VBA1 3RZKA 1F5JA 1TG7A 4UW4A 1W2TA 1LTEA 5DUXA 1VBE1 1GWLA 2Y8KA 4I3GA 5JXHA 1GP4A 2EXKA 2W1WA 1UOBA 2YU2A 1FOD1 3PU3A 4LLFA 3VBHB 1Q8OA 3USUA 2UU8A 1YFYA 1FPN2 4QB2A 2C4XA 5SV8A 3TAYA 1REEA 1O91A 1W9FA 2LM3A 2XKOA 4UFIA 5BNPB 2ZX4A 2NPIA 1ZM1A 4XEZA 2ZGUA 3TN91 3VZJA 2ID4A 2JDYA 3JQXA 5A6XA 4UBHA 3UYJA 1AHSA 1WLDA 2OIIA 1D4M3 2D6OX 5JXGA 3NWKA 1O7FA 2QTWB 4JV4A 2X09A 5FYMA 4DMIA 1OHFA 5BNPC 1SLAA 2DFCA 3WVJA 5I93A 1MEC3 3IPVA 1HJGA 2HWC3 1O4TA 1GBGA 5G05L 2QQLA 1WD3A 5FUNA 4JGZB 2OKXA 3VD5A 1XNBA 3GZTB 1OVSA 4IEZA 3MW3A 3U37A 3SC7X 1XNTA 4W6XA 4B4PA 4BQ3A 1YFXA 5I8TA 3ZSLA 3KQRA 1LESA 1S2EA 3TRSB 1X7NA 4N9HA 4K6BA 3ZR6A 3LDRA 5FXVA 1Q8QA 1VB4A 3ZM8A 2AR6A 1VB2A 4QX5A 3WP4A 1NCRA 4BJ0A 3WF1A 2WWUA 2G9ZA 1C3HA 2YGLA 4XOGA 2NQYA 2HWD1 2Z42A 1PX4A 2AUYA 1AL0G 4YG0A 3VKOA 2W3JA 4ZPIA 1M4WA 1H30A 4LOTA 3N9MA 2W1QA 3AP5A 1TMF2 1XE0A 2ZX1A 5FQ0B 1CAWB 1HQNA 4IV1C 1QU0A 1C4RA 4AHWA 3URFA 2BVBA 4LBQB 1EP0A 3LOBA 4NJ4A 2ZEWA 3VZOA 3RJ2X 5FYIA 4HSLA 3UV9A 1U0AA 2MEV2 1JH5A 1OPOA 3FBMA 1PIV1 3HNMA 4I0AA 4IEWA 4LO6B 1BMV1 1GOFA 2Z4FA 4P9WA 1AR91 2HWF1 1DZRA 1ZRRA 2TEPA 3GZEA 1QOTA 5LB6A 5T5OA 4EN0A 1GV9A 4QX8A 4PJYA 1BEV1 5J48A 1RUE3 3K3NA 5GZCA 2YG0A 2ZKNA 2VZPA 2RM21 3GCXA 5D1IA 2XONA 2FBEA 1HIXA 2Y34A 3UGHA 2FDJA 3WW2A 4A44A 1S0CA 1HXS3 2WFF3 5FZOA 3PNAA 3U4SA 1VBD1 1PO13 2BEOA 3VDDA 4B8EA 3K77A 4PLNA 3IZOA 2ZX3A 4QKBA 4Q4X1 5H9QA 5BNNC 5A3TA 1GICA 2RS13 1JHNA 3VBRA 1HRI1 1VRBA 3WDWA 3DL3A 5A3WA 2V4VA 3POJA 4AI1A 2WABA 1QJX2 5FO7B 5FYHA 1JYNA 1CAXA 4QHBA 3RI9A 4FXKB 1CWPA 2RS51 2B39A 1W9SA 1WLCA 1PVC3 1MVEA 1CD3G 2Q30A 3PVEA 4XDPA 3H1MA 2XB6C 4CCEA 2VW2A 3K4ZA 2B9VA 3FFZA 3IDAA 5FBJA 3VKFC 4F8AA 2AACA 3WDXA 2QE3A 4R9CA 3OGSA 4Z8BA 4KWJA 4MZUA 4J1WA 1WBLA 1OC1A 4LEJA 1NYWA 3IN9A 1AYM3 3OGJA 1SCSA 2BWAA 4IUGA 4AXOA 2BRTA 4CP0A 4BIFA 1PMHX 4L11A 2XGXA 2CTVA 5JWPA 3GALA 4GMP3 2BNNA 1IS4A 3GYDA 1V9U1 4V2WA 4BQXA 1TME3 1OFSA 1W99A 2XLGA 3D3AA 2L9LA 2ZEYA 1MACA 3AL6A 3FE5A 2B45X 2ZGLA 3P3NA 1RITA 2UWBA 5FP3A 3LDBA 1H4GA 3N3HA 4LBQA 1ZREA 2SLIA 5F6LB 3SH4A 5DZEA 1WLWA 3UGFA 1EAH3 1JTZX 1ZBA3 2HBTA 3GHMA 4FOYA 3ZXJA 4LLOA 5LA1A 4GALA 2WYSA 4Y5SA 1IPKA 5B4XA 1JHJA 5AFBA 2HWE1 2PN5A 5FPBA 4FPYA 1MZFA 2VOXA 3HT2A 3WZ1A 2CSGA 2VUAA 1ZA7A 1DIWA 3IDEA 4GQ7A 4JKKA 4CP2A 4QM8A 4JQRA 2QQOA 4UFKA 3OD4A 1FMD3 3HBZA 3S6PA 2C6SA 1UPSA 1WUVA 2VO5A 3BN6A 1G9DA 4P9JA 3NAPB 4FPLA 2JX9A 1W0PA 5KHHA 3T0BA 2PA7A 1WCDJ 2VZOA 5A7SA 3NNMA 4LE3A 4IV3A 1MS0A 4E4ZA 1RVF1 3ZFEB 4EWDA 5FPXA 2NN8A 5CEHA 1JBCA 1D4VB 5A3LA 1RL3A 4AEDB 4LKFA 1VBE3 2O1QA 3N7KA 3NV2A 1F9KA 3ITQA 4ZS3A 5EZWA 2HJIA 1FOD3 4XPVA 2A6YA 2WQZC 3PUSA 2XG3A 3WP5A 1VBB3 3ME2A 5HCHA 1HV0A 1SQ4A 4Y26A 3JB4C 4A7YA 4QM9A 5A7NA 2F4PA 3TOJA 3WNXA 5FCCA 2W1SA 2VBDA 5FZHA 1J58A 2EICA 1EV13 4FP3A 1OUXA 1V6NA 2ZX2A 3I2DA 4NROA 5JSPA 1H8TC 3MDPA 5JVVA 1DGRA 4BDVB 2IUWA 1UN1A 2IVIB 2E63A 2DVAA 1EPWA 5JZGC 2R1DA 2UYBA 1ULFA 3ACHA 3AP7A 4L97A 1V6MA 5GLWA 4CUAA 1MEC1 4B29A 1FPN3 1JYWA 5A3NA 4AVSA 5IYYA 1A3KA 1LGBA 4OQ8A 1UZZA 3WOGA 3MYXA 2YB7A 2VVEA 4ZS2A 5FPUA 5HCBA 2QQNA 3PDQA 4ARYA 5I91A 1G7YA 4HL0A 3CZUA 1BBT2 1WKYA 1YQ2A 2DTYA 2HLEA 1DLCA 2JE9A 3MICA 3OB8A 3IAQA 2DVFA 1YWKA 3VBUA 4Q4W1 4I0BA 1VAVA 1NE6A 3OBAA 1Z7S3 5HCAA 4L8QA 4MADA 4YARA 3AXEA 5FMCA 4H7MA 1YJLA 1LHOA 3D5OA 3WF2A 2JD4A 2OQ7A 2WAAA 2IXKA 3ZYPA 5I0RA 2B7YA 2EIBA 3ZSEA 2J1UA 3BU7A 3POEA 3ACFA 3H7JA 4QAWA 3S30A 4QKNA 1W6NA 5FK8A 5IJRA 3NAPA 4OVEA 4AAPA 4XF0A 4WM7C 3H1WA 4KBBA 2PHLA 5FXWA 1MS1A 1ND2B 3MZHA 1GZTA 5FZDA 4B7KA 1V6KA 1IZ3A 1H1IA 4PBPA 1NXD1 1DQ6A 2FMYA 2JD9A 3W20A 3FL7A 4XQDA 2DTWA 3THTA 3K3OA 2JIJA 5FZIA 5FO8B 2XJQA 1JZ4A 1FT9A 2Y60A 1S2KA 2H0BA 4CPBA 4AYUA 4CEYB 1IKPA 3FZ3A 4Q2FA 2D6PA 5FYSA 1XNKA 2VZQA 3U1XA 4C0BA 4EN9B 3LCPA 1ASJ2 2OPKA 3ZYIB 3JXSA 3ZPOA 5BNOA 2WZEA 3ZXKA 5HV4A 3H3LA 2BGPA 2XJSA 3I97A 4QHOA 2PLV3 2WIIB 4XCBA 2YPJA 5JOWA 4N8MA 1MEC2 2YFUA 4RGAA 4RR3A 1AL23 3QACA 3SHRA 4LULA 2ET1A 4M3CA 4C91A 1LGNA 4K1YA 5DABA 5EJ3A 3TN93 4AI8A 4C90A 2EIEA 5IAXA 4XUPA 4YNIA 3CJXA 5DZFA 3M3IA 2DCZA 2R071 2ZMLA 2OS2A 4Y20B 2V09A 4LR4A 3ATGA 3OPTA 1TMF1 3Q8CA 1AXZA 4YVSC 3E6CC 1UWWA 1U5ZA 1UO9A 4BQ1A 5IHRA 1A6CA 2MHFA 2WNUB 1C1LA 1QH7A 2WNVC 1S0DA 2JG8C 2GN7A 2VUJA 5DUUA 1GOHA 2VTFA 3ETPA 5JOXA 1FV3A 3BB6A 3WF3A 1GP5A 5JI7A 4A2UA 3DXUA 4CTEA 3K2OA 4LBQD 5FJHA 1XBFA 2Q4SA 1V9U3 2F6BA 3DGTA 2I74A 4XF9A 2P6CA 4OHZA 1CGPA 5FR3A 5A70A 2W68A 1CN1A 1ZRDA 4JQTA 4OZOA 3S7EA 4PF1A 1XC6A 1R081 2G4IA 3FN9A 3OGVA 3PVOA 4AI9A 2FZ2A 3CNAA 5FY4A 3AMHA 2YMZA 3WCRA 1YEWA 1MQTA 1X9PA 3I49A 4ASLA 2Q1MA 2WT1A 3AVRA 3IPVB 4P00B 1RUH2 1X33A 1YYNA 3RZGA 2GMPA 5JZGA 1GZWB 1PGL2 2GZWA 2HWD2 1W8ZA 4DO0A 3FMGA 5FWEA 2Y38A 2FDGA 2CDOA 3OOXA 2CGNA 1X8MA 4BXFA 3NV4A 1WW5A 4U2AA 1OQEA 5AVPA 1OLMA 1WZXA 1OA3A 2A7AA 3WDVA 1JYCA 2RJ2A 1VLNA 4K21A 4NIGA 4BMBA 4EE2A 5J36A 1ULDA 2OA2A 1RINA 5A7WA 4AI3A 3HQXA 3OEAA 4RSUA 3OY8B 5BNPA 1BBT3 1LOCA 1H6YA 1MQTB 3KGZA 4QDSA 2JEMA 3LF7A 4AGGA 2RMU2 1H2MA 2D7FA 5F3EA 1RUE1 3T1LA 5IVFA 1O8PA 3VKLA 3O1SA 4AFBA 5ABJC 3HWJA 1UY4A 1XE8A 2BFUL 4RQPA 2FDFA 4A3XA 1XNAA 4FQZA 4M3CF 2A6ZA 2HEYF 2AEZA 3CO2A 2Y0IA 3IM0A 2WL1A 4CCMA 5CVRA 3RZLA 2Q8EA 3A23A 5LASA 2IXLA 3QLQA 1Q5OA 5EWSA 5SV5A 2XL9A 1REFA 4DY5A 2ADEA 4K7JA 4OMDA 1KEXA 1HQWA 2XLAA 3Q8AA 2BUKA 1RUI2 2Z5WA 3MUY1 4HSJA 2BGCA 3KVAA 1FNYA 2QZ3A 2Y6HA 2GU9A 1O4ZA 2BW8A 1GQGA 2D3PA 2EF6A 2VQTA 1ZZ7A 5FPAA 4JHZA 5A80A 3UT0A 1PHMA 4AK3A 4AE2A 1W3VA 1FI2A 3J8F1 1OQDA 4XJ8A 5L9RA 1CAVA 2HWD3 3V65A 4FPHA 5BNOB 2WFF1 1HLCA 1DGLA 5I0DA 1TEIA 5FMBA 4CDQB 2JDNA 4PIZA 3A22A 2PAMA 3IDBB 5FY9A 5EXOA 5HXVA 3VZKA 3QD6A 4P9GA 4XBQA 2QQVA 3TNPB 3ACIA 2QBXA 2ZGQA 5IK4A 3RGBA 3VBHA 1YFWA 4HXCA 3E1F1 2BERA 1QF3A 1OF4A 2K9ZA 3ACLA 1W6PB 3JU9A 3OPZA 1V9U2 4LJHA 2VOTA 5CIRA 1Y7BA 4DPNA 5CG9A 4LIVA 2R0HA 1PVXA 2N7GA 1RUI1 2EAKA 2CWSA 1ND2A 2ZJCA 5AVAA 2ZHMA 5LBEA 5LA9A 5HPOA 5F2SA 2ZBJA 5FZMA 5T54A 1EAH1 3DEMA 1YI9A 5C70A 5BV6A 5FZ4A 2JDZA 5LBCA 4ZKTB 1W8OA 3MIEA 2HWE3 1JN2P 5BNNA 3HBKA 1PO22 1DQ5A 1XU2A 3KT1A 3U10A 4Q27A 3SNMA 3QH6A 4ATFA 1A78A 3ALQA 3KV5A 3I59B 4Q26A 1IS6A 3ZXGA 3IIIA 1Q8SA 3PMSA 3RZHA 1HRI2 4H14A 3J7NA 2RS11 1X8EA 4XF4A 1AJKA 2AENA 2Y6GA 2FHRA 2CHHA 4IE6A 4KWKA 2RDSA 3ZFGA 2IXCA 2A3XA 1B35B 4U36A 4BQYA 2B8MA 1A8MA 1ULCA 4FFFA 4PF5A 3CU7A 1EUUA 4MSVA 1R1ZA 2QFEA 3DV8A 3PUAA 4W6WA 4AEMA 1OUSA 1BZWA 2DWRA 5L7OC 3VL9A 2EIDA 5FZAA 4NRPA 4YFZA 1NY71 2VVFA 4KQ7A 4TTGA 1JW6A 1HX6A 4ZZ5A 4FXGB 4WBBA 5DPNA 3VD7A 4BQ5A 4JDMA 2VNOA 5CA6A 2VZ3A 2FDHA 2PXJA 2X8KA 3VBOA 1W9WA 1OOPC 2UURA 2OPWA 1FX5A 1D0HA 1EUTA 2XMLA 1AX1A 1GSLA 5CU1A 4AOCA 5F37A 1TME1 1GR3A 1LOBA 1TNFA 2HKXA 2PHTA 1LODA 1RUNA 3OUHA 2WC2A 2RJLA 3E6BA 3POSA 4QMAA 1VRH3 3VD4A 4D7YA 5FPVA 5JPNB 4PIXA 3HPNA 5AC92 1UMIA 4QX7A 2RMU1 2ARCA 2E7QA 5FYBA 4XAAA 2OVUA 3GXUA 4WVWA 2BWCA 4XDQA 4Y4YA 3VZLA 1O4YA 2WNEA 2DBNA 3PHMA 4TXWA 1ZZBA 5CAZA 1JZ2A 4EJRA 3WW3A 4P9IA 4J1XA 3U4XA 3RI8A 1W0OA 1MS4A 1R083 1ZRFA 1GLHA 1VBC3 3POWA 4MGKE 5LEKA 4FAGA 3ZX7A 3H8RA 4B1MA 4D7SA 3F2ZA 2DBIA 4FOWA 4NHYA 4AG4A 4GWJA 2O8OA 4QDQA 5DAVA 3BIWE 2Q1ZB 3H8XA 1GZ9A 3V0BB 3P1IA 2MPFA 3J7MA 3SKJE 2WINB 1J1TA 1SACA 1WMFA 3VBHC 3PIGA 2XXZA 1RJ7A 2MEV1 4Y22B 3OSDA 1CESA 4WM8A 2P6HA 2RV9A 1H8TB 1ENXA 4AR2A 4ZZ8A 3AM2A 2QQMA 1QNWA 3IWZA 2LW8A 4R9BA 4DEVA 1ASJ1 1GWMA 1DYKA 4Q4V3 1BXHA 3NJZA 4QGNA 4LITA 1N3QA 3RRDA 3EXUA 5A3OA 3H3UA 1SBDA 5FUIA 1IGOA 1JOPA 1OKQA 1OLQA 2ZMKA 1ZZ6A 1H2LA 3ZFEA 3WQ7A 3ZFFC 4LORA 3BKZA 5F5IA 3CMGA 1QJY2 3WQ0A 2GMEA 1F5FA 1XYPA 1WCKA 2QUOA 4OLLA 3M2MA 1WW6A 4XTMA 3VN4A 4PI0A 2JG8B 1EYBA 1S0FA 5C8CC 3VGIA 3WXPA 5AC91 3VBRB 1JS9A 4CU7A 4CCKA 1DFQA 3RQ0A 4GH4B 1SPPB 3CIHA 4EZ4A 2XJVA 2R073 2PQQA 2WWSA 2GNBA 3B7MA 1AYM2 4IDZA 4WVMB 4GB33 1PGSA 5EJZB 4XURA 2XHNA 5C5UA 1CVNA 3LFMA 2FCUA 4YGCA 1POV3 1SLLA 1HB3A 3TN92 1QWRA 1BMV2 1AL21 4PQQA 5GLZA 3RYRA 5JPMB 5IK5A 1W2NA 1AYN3 2X5IB 3CF6E 4LBMA 3T2TA 5I0SA 4AQ2A 1RUJ3 4UF0B 3Q8BA 4BOWA 1O5LA 4Q1PA 4Y1VA 1OT5A 2ZA9A 1MS9A 1U5YA 3CLPA 1JUIA 3O5SA 3WNLA 5IUQA 3TYJA 4HN1A 5FZ8A 3B9CA 4NR1A 3O1PA 3D0SA 1W2OA 3PIJA 1W6OB 1X36A 1LHVA 3I3EA 4YW6A 3DXTA 1G9CA 5J3UA 3IMNA 4HKWA 1PM7A 2XJUA 2VG9A 2BFUS 4YVWB 4QQHA 3VBOC 4UAPA 4YG3A 3GBGA 3NNLA 4JGYC 4K8FA 4WVMA 4CDUC 4K40A 4UFLA 4MYEA 5D8AC 2GC1A 1AR71 1URXA 4HPKA 4TWTA 1D2QA 1KJLA 2V72A 1KDMA 2LUWA 1QJX3 2RDQA 3ZSJA 2ZS6B 2P34A 1IQDC 2VOVA 3MIBA 4F3JA 2JG8A 4MX3A 3SCFA 3PUHA 2E53A 1K3IA 2JDUA 5DDJ1 3VZNA 1NOVA 1NQJA 1R64A 4WVZA 1IHMA 2IWGB 2XL7A 3BOPA 4DUVA 4A45A 5B2GB 3E5UA 4LO4B 3WNKA 1KS5A 1UNBA 5GZEA 2XVGA 3OY8A 3WCSA 1W2AX 4CCLA 1UCXA 4Z82A 4NVPA 3SKVA 2A75A 5KWRA 1HW5A 1PK6C 4MOAA 3HJRA 1HB1A 3M4FA 4YW4A 3WF4A 1RHI3 2VTXJ 4LHKA 2NP0A 3OF1A 4KWUA 1RUE2 5LEJA 4ZU4A 1KFUL 1UPIA 1WW4A 4WM8B 5C9AB 2EIGA 1BVP1 4Y22A 2R7EB 2CGPA 5JXIA 2OXBA 2YC4A 3V0BA 3VD3A 3JBG3 3U78A 1XOYA 2P4EA 3ZYRA 4FTSA 1UOJA 4HN0A 4E27A 2D97A 3AVSA 2VMHA 1RYYA 4YZ4A 2D6MA 4QPYA 2JG9A 4I30A 3TBDA 4XMAA 3J8F3 1C28A 3HOBA 4LKEA 3Q8EA 5BNQA 1K5MC 3JD73 3BODA 4MGQA 4NPRA 5FZ6A 1G9AA 2VNRA 4N43A 1LAJA 2ET7A 3J26N 1NE4A 3RZZA 5FKCA 1ULEA 2Z69A 3DKQA 1JI6A 3ZXEA 2XWJB 3ZDSA 4BMEA 3OG2A 4Y24A 4Q0QA 4COZA 4WV8A 4QQOA 1NLQA 4ARXA 2E33A 3AXDA 2JECA 4WM7A 1C8NA 5FP4A 5FYTA 5A7OA 5LCWL 2XQXA 5FDBA 4FAHA 3NJYA 5C5TA 2CV6A 4ZY9A 1RUC2 2HWE2 3W21A 3BGAA 2VCCA 4UBGA 3AMQA 1KGYA 5IK7A 3UL2A 2RR11 2YUEA 2UY9A 5FZKA 2CAVA 2R062 1WCQA 2DFBA 1XRUA 3GCWA 1OLRA 4ET7A 3NMBA 2D3SA 1PNGA 2VZTA 2Y6KA 4J25A 4WZFA 5F5AA 4ISQA 1UY0A 2BNMA 1H9PA 1VPHA 3I2HA 4DOUA 1CPNA 5DXDA 1ASJ3 2EALA 4Y1ZA 3I2OA 2DDUA 2PFWA 1Y9QA 3IKWA 5L7OB 4NPLA 1C1FA 2WA4A 1GYKA 4L99A 4LA3A 5ABJA 3LOIA 1N47A 3MFAA 4KGQA 1OBNA 3NJVA 1ZZ9A 3NJXA 4BHPA 3A7QA 5FMDA 5IATA 3B01A 3GZAA 4IGPA 3VBSA 4SBVA 4E4SA 3HIFA 4CEYA 2RM22 2D44A 3ZXLA 4FT8A 4X6QB 1LNSA 1HXS2 1VRH2 1S0GA 2DCYA 2R0FA 3NVCA 2YFZA 3U75A 5K0UB 2Y6JA 3KT4A 4GJZA 5FY1A 3GHNA 4AFDA 1S55A 5LWBA 2XJRA 2R072 1E57A 4XACA 5JIUA 3OGRA 1RVF2 2MNGA 1V00A 5EYYA 3OBRA 1NY72 1YLLA 3H8OA 5FZ9A 5D8AB 1OD3A 3ZN6B 2WWJA 3NSTA 1DHKB 4FPFA 2D5FA 4E8CA 3RSJA 1W0NA 4JHTA 1CX1A 3SH3A 3WNMA 2W92A 3WD5A 4QX0A 2J1AA 3MPBA 2HWB1 5FZFA 4XFBA 1BCXA 3MO4A 3R0RA 1Z0HA 4IV3C 1W90A 1RUG1 3WEZA 4KNCA 3HMYA 4BQ2A 1DGRN 2A6XA 4MXWA 4URAA 2IFRA 4Q1RA 1PGW1 4XUOA 4RHV1 2DVDA 4IERA 3V64A 1VALA 5HV0A 1N1YA 5FP9A 2OT7A 1RUD1 2G1MA 3N9OA 1YO8A 1C8M3 5IK8A 2EXIA 1XSQA 5DUWA 3N9LA 5BPXA 3CL1A 3BTXA 3AKPA 2RJKA 5CFDA 3SQOA 4CU9A 1VMHA 4LOSA 3UKVA 3AL5A 4CUBA 2PYTA 3UJQA 4E8DA 5JMCA 1QMJA 1KXGA 3M7AA 5FY0A 3O14A 4AHZA 1OH3A
chains in the Genus database with same CATH topology
2ZGMA 3BPZA 2P17A 1N1SA 1R1A1 2XVKA 3BOWA 5FQ0A 2PHWA 1GZWA 1DLLA 4ZU7A 4YGEA 4Q4Y2 4WM7B 4XQ4A 3MIDA 3KLSA 4QPGA 4BH9A 4IV1B 1LCLA 4DS0A 1APNA 3B00A 2Q0AA 5CBLA 5JOYA 1H9WA 4E2QA 3VDDC 4LT5A 3WHUA 4CDUB 1U12A 4HLTA 2AGSA 3JB8A 1DQ4A 4TSVA 4X8PA 4I3PA 2R1BA 3OGGA 4X6RB 3UK9A 1QGLA 4KG8A 4FPCA 3AP6A 3NV1A 4PCRA 1XXNA 1FPN1 1PO23 2ZHNA 4S2HA 1KDKA 4IEQA 2ZHLA 4EV0A 3RMXA 1R091 3KMHA 1H1AA 2H6CA 3D6EA 1SDWA 2Q5TA 3H1YA 1AR81 2H0VA 2XBO1 2CY6A 4JGYA 5H9SA 5L73A 5FOJB 2VNGA 4WM8C 3PJQA 3DPRC 5BYNA 1AYN1 3ENRA 2IC1A 3VLBB 2EVXA 4DFSA 4GA9A 3MF9A 3AB0A 2RS53 4W6YA 1WA4A 4XHXA 4NHMA 3WHTA 2D6LX 2YXSA 3RYPA 4SLIA 4J6GA 1TQ5A 2E7TA 1RMU2 3FJSA 1QOSA 1DZQA 1AYM1 2WZR2 4Y20A 3B93A 1NZCA 3K51A 1VBD3 3KGLA 4KL1A 1W6QA 1WLTA 2QNKA 2ZGTA 1W6NB 1H2KA 1PK6A 4AGVA 2G9FA 3WLUA 2KXLA 4YM1A 1JUHA 5AC93 3JZVA 1UKGA 5FPZA 4V1PA 3JBG2 3U07A 1ZBA1 1CIWA 1QJZA 1PVC1 2NM1A 5JIAA 4IESA 4JDNA 3OD0A 5C8CA 1OOPA 5EFUA 3VBUB 2NMOA 4GB31 1J59A 4OI0A 3ZXAC 2TBVA 2K2SA 2OUJA 5CB7A 5TSWA 1RHI1 3HN1A 1V6JA 1UL9A 2W08A 5GLUA 5L7OA 1YHFA 1RJ8A 3LA2A 1LU1A 3PVBB 1QJX1 2ZGKA 2HWF2 4OHWA 3ZFEC 2DUOA 3CJIC 1RUJ1 1QQP1 3ROUA 4JCKA 2A3WA 3M8LA 5FO9B 1UMZA 1UIKA 1V6OA 2LALA 4UW3A 4ES8A 2Y26A 4LO5B 4A7KA 1HDKA 4QXKA 3JD71 4Y5Z0 2YYOA 4N53A 1N3OA 2RS31 1Q43A 3EQEA 4CDXB 3DUIA 5KHKA 2ZACA 4XZPA 4I0WB 4CDWB 1FMD1 1UIJA 2DCKA 3QOPA 1U5XA 3DPRB 3D8CA 1RUC1 2DUPA 1W6MB 2BTVC 4JAAA 3GF6A 1NLRA 4GKXA 4PQ9A 2R16A 2AYHA 1UU6A 2PHDA 4N53B 1QY4A 4AFMA 1YRZA 1IKQA 4RFT0 4IQPA 3MLKA 3KCCA 3E5XA 4K9SA 3USSA 1POV0 4ATEA 4ES9A 2D3RA 2XH6A 3KCYA 3AKQA 2NYYA 2ZCWA 1BKZA 1VBC2 2R49A 1W6MA 1YIPA 1B35A 1OSGA 3AK0A 3ZFGB 4PBOA 1PIV2 5C9AA 4YZ1A 2WKKA 3ST7A 4LBLA 1SLTA 2HWB2 2X5IC 1X82A 1Y43B 5FLIA 4NHLA 5LRSA 5DZGA 3FLPA 4Q0VA 5ACA3 1EPZA 5LK7B 3RG0A 3BALA 4XIKA 3LB9A 2B9UA 3PVNA 3O0WA 4MUVA 5I0UA 2ZKLA 3VKMA 5GLVA 4BE3A 4CDXC 4FPJA 1NLSA 5KXBA 2BYVE 4IV3B 2P2KA 4JRAA 3BTAA 1PO11 2ETEA 4QQPA 4AHXA 1W6QB 4YVWC 4Q4W3 3VBOB 1RUF1 2TNFA 4HPKB 1PO21 1VP6A 1KFXL 5C8WA 4Q29A 4BZ4A 4XJUA 3V0AB 5EV7A 4HZFA 4RHV2 4F83A 5KHGA 2XBO3 1IOAA 2RR13 2YHJA 4M0NA 4W65A 4YZ2A 1ND3A 4JVAA 1DF0A 3X29B 4Q8KA 1S0JA 3VBSC 4FQ4A 3B94A 2IFWA 2D6KA 3VHNA 4Z07A 2I2SA 2ZGNA 1REDA 4BYYA 3C2UA 1ZYBA 1MS8A 5L19A 3AYEA 1YI7A 5A33B 1FAYA 2GAUA 1LOAA 4C0HA 1LHUA 4S2FA 1CJPA 2VW1A 1D2SA 5CFCB 3WDTA 2C1FA 4EN8B 1HQLA 2XJTA 2DYCA 3AJZA 1A8DA 1QQP2 1CAXB 3VDDB 3HR9A 2X29A 3LKJA 1LJ7A 3MLJA 3NAPC 4BLIA 4H7LA 3QCWA 4CEWC 1BJQA 2XJPA 3N36A 2GDFA 3FHIB 4S2GA 2ZZQA 1ENQA 2RHPA 4R8HA 4YVSA 3WG3A 4FOVA 1DGWX 1T6GC 4YZ5A 1RMU3 4HK9A 2QQPA 4FPEA 3GBFA 4CDQA 5GJ6A 3WP6A 5FLJA 4N90A 1O3RA 4GKYA 1CAVB 1FATA 1RUG3 3AZXA 4NHKA 1V70A 2A73B 1EV12 2DU1A 1EV11 1RTVA 1AR63 1HRV3 4XXAA 2VU9A 4HFSA 5JSRA 4RA0A 1VBB2 5KXEA 3AX4A 1ND2C 5EYXA 1RUH3 1CAWA 1NCRB 5KXCA 1F31A 4RQPB 1QDOA 1XYOA 2PELA 2GSYA 2RMU3 5C6CA 3N7JA 2BBVA 2RS33 4MH0E 2VULA 3AMNA 3R05A 1AR83 2WT2A 1YJKA 3SCGA 2QVSB 1KITA 1J1LA 1SCRA 1RUC3 3ZN5A 1V6LA 1VJ2A 1J3RA 1RUD2 1H2NA 1AYN2 3ETQA 1LULA 1MZEA 3J9SA 1KS4A 3FX3A 2R061 3FC0A 1UU5A 4JGZA 1CJDA 1QJY3 4K3UA 1RHI2 1OI6A 1FNZA 1MVQA 2AREA 5KXDA 5GM0A 3VBUC 4YM0A 1WW7A 3WQ1A 3WY6A 4NOTA 4XMIA 1HRV2 1AR62 4FOQA 3L2YA 3ZSMA 1ZZ8A 3JUUA 1CR7A 3NKGA 5K0UA 4LUMA 4DNYA 1RIRA 4DB5A 1VIWB 1SLCA 5FFOC 4FTEA 1QJU2 2OZ6A 3RNSA 1LRHA 3APBA 2R043 4RGGA 1PZ8A 4ZU5A 3WDUA 1HRI3 2VH9A 4S2DA 2YGMA 4K20A 2O0OA 1COV3 4XFFA 4EWAA 5BUVA 1J3QA 4AHYA 1QQP3 4M3CE 2ZAHA 2PLV2 4Q0PA 5KHIA 4DZGA 3IDCB 3MGUA 4M0HA 4HKOA 1ZBE2 3LZZA 4YGBA 5CG8A 3VZMA 1R092 1DZTA 4I02A 4H3WA 3ZFFA 4Y1YA 2B42B 3SLIA 1WD4A 3UKTA 5LK5A 3WG1A 1S0IA 3RPQA 4BM8A 1JYIA 4R4ZA 4B4RA 2WNVB 3RMYA 1UD1A 5FLHA 1AR73 2ZGRA 1F8VA 1IQAA 1U5IA 5FAXA 4A7ZA 4N43C 4EN6B 4EWEA 5J37A 3KM5A 3WG2A 3FUOA 1KD7A 4BA6A 4D3WA 2WS93 2DV9A 5E16A 2A6VA 1KJRA 3M3CA 5BNOC 3UJOA 1I1EA 2DF7A 2ZGSA 2IXHA 2ZAAA 1WMDA 5GZFA 4JTOA 1GFF2 1AZDA 4XFAA 4BWOA 1V6IA 4YLZA 3AP9A 1W39A 2A71A 5FREA 4H55A 2PAEA 1O3SA 4OFGA 3FLTA 2JENA 1H4HA 3R4UA 2EXHA 3H8UA 1PIV3 3V56A 4RS5B 5HI0A 1DYPA 1NA1B 2HWF3 3VBFA 3OCPA 1B09A 1BK1A 5C4WB 3H0OA 2HYKA 3PMEA 3ZXDA 5KC5A 3I7DA 1DBNA 4DINB 2RM23 5DG1A 4ONUA 3SCHA 4YVWA 3AFKA 5ACA1 5JZGB 1HXS1 1K5MB 3M3EA 1Q56A 1BEV2 5A33A 4IEOA 1OPMA 5JR7B 2WSVA 5FMOL 5J7MA 3E5QA 2MEV3 4AEDA 4YYOA 2ZABA 4OUMA 1MZ5A 2TUNA 4XYXA 4HVOA 1PNFA 2X5IA 4XBLA 2NMNA 1G9BA 3LA3A 3O0XA 1CX4A 2WNUC 4Q4V1 4AVTA 1FV2A 5J09A 3M3QA 2I07B 4UW6A 2FZ1A 3SH5A 4GULA 1G86A 2ERFA 2P3JA 1ALYA 3ZIXA 4L2NA 5K7PA 1PGW2 2NP0A 4AW7A 2Z2SB 3AMPA 1W6OA 4P9YA 5IT6A 1UU4A 3H9AA 1XNCA 1YCIA 2QDNA 5A3MA 1ND3C 3K48A 1C8M2 3ZMOA 1NCQA 2RS52 1ZVFA 1D4M2 5K8SA 1PO12 5T5LA 5C4WC 1AL22 4QGMA 2RR12 3MF6A 3RWNA 4RD7A 5FRAA 2WSUA 2RS12 4FP2A 4O9EA 4HVQA 1XNDA 4JGYB 3LWCA 2GC0A 1ENRA 1CQ9A 3FWEA 1FOD2 4AQSA 3NO8A 3ZSKA 1RC6A 4OZXA 2R041 2ZGPA 2GH2A 4YW1A 5JAXA 4N53C 4TLFA 3MFCA 2D5HA 3WT3A 1TNRA 2GMMA 2W0XA 4IXLA 4LE4A 3HT1A 3H50A 5T3NA 1G9FA 2PTMA 2Z79A 4DRVA 3V0AA 1WBFA 1RVF3 3ASIA 3AMMA 2W39A 4JDOA 1WGPA 4CDQC 4XJAA 2WLQA 4LBKA 2GC2A 3B02A 3PTYA 4P14A 3DF0A 4E9KA 1ZA4A 3MW4A 4JRLA 2OYZA 4E4DX 4CEWA 4CRQA 1ULGA 4RS5A 1YXWA 4YM2A 2HWC1 4MLOA 4AVBA 4IV1A 1RUD3 4MVTA 1RB8G 1PZ9A 4QPGB 1C8M1 1LOFC 3R4SA 1UW8A 4C1XA 4N7IA 2VOWA 2UY8A 4FO9A 1K5MA 1DGWA 5JCTA 4WZCA 1QJU1 1ZZCA 1VBC1 1YIFA 1D0GA 3E6DA 4LNVA 2D6NA 3MIHA 1BVVA 4R9DA 4BCUA 2D93A 3IIAA 2WFPA 3AZVA 2I45A 2UYAA 4DQAA 2ENRA 3VBFB 5I8YA 2YROA 4OI2A 4MGIE 4QPIA 2OUHA 2E51A 4XW3A 2R32A 3G7DA 4YW3A 4HMZA 1L3JA 1SLIA 4IEVA 3AYCA 3VHPA 5FOBB 3MEPA 3USUB 4PIYA 2YZ4A 1CPMA 1LEMA 4PDWB 3ZMNA 4BIOA 4N9IA 3B9IA 1AR61 1HRV1 2YV8A 4Q4X2 5F5QA 1AR72 3CJIA 3DPRA 2ZTNA 4HK8A 5CFCC 4CDXA 4Y1UA 2PHXA 4M01A 1VBE2 4ASMB 4F7ZA 1MS3A 3O0VA 2A3YA 2E6VA 1RUJ2 4KU7A 3ZFGC 1GANA 3MIFA 3P3PA 1SEFA 1CONA 3D82A 3GBWA 4AVVA 2LTNA 3RYKA 4CDWC 3B5LB 4XJWA 3TNQA 1OMIA 1R082 1UAIA 4NWWA 1R093 2QZ2A 4AGRA 1AJOA 4XF3A 4XTPA 4AF9A 1LENA 2RE9A 1Q3EA 3ILNA 2DVGA 4Z92B 1GNZA 1WCSA 3I4IA 4AFCA 4FBFA 4FCAA 4E2GA 3WW1A 4G3YC 4XBNA 2ATFA 3G6JB 4EROA 4B7EA 2JKBA 2V73A 4GMP1 4XETA 1SLBA 1XQNA 5JDBA 3I59A 1RUI3 4I2OA 5E88A 3EJKA 1QHDA 2EXJA 1RGSA 4LO7A 3W58A 4YZ3A 1LOFA 1S2BA 3NV3A 1IS5A 4P5HA 4AI0A 4IEYA 1DQ1A 3ZPYA 1PGL1 3RDIA 2GNDA 3JCIA 3M1HA 3OTFA 4JTNA 2BQPA 3CEWA 2E9QA 1G8WA 3DN7A 1QXRA 2A6WA 3VUOA 4HBNA 2EAAA 2K0GA 4TYSA 3D4KA 3WR0A 1JOJA 1S0BA 2ZOEB 2B46X 2HEVF 4YW5A 1NG0A 5CADA 2NLRA 2WFF2 5GLTA 1RUG2 1H0BA 1QXJA 4Q0SA 5DDJ3 2A70A 2GALA 1LGCA 4MXVA 3U0ZA 3ES1A 4GXLA 1ZBA2 2HWB3 4GB32 2EA7A 1VBB1 3N7LA 4MGYE 3MIGA 2JG9B 3S0MA 2ZMNA 5FBZA 3O12A 1M06G 4AVCA 3J4UH 4HVRA 4Z1VA 2P37A 3GZUC 1BBT1 1UKRA 2IXIA 2SBAA 3OBTA 5A32B 1VRH1 4YSFA 5C4WA 4K1ZA 1ENSA 4AEJA 4MV2A 1C57A 1HV1A 1NA1C 2GNMA 3QBQA 4NWVA 2VECA 1KRIA 5CFDB 1ZBE3 3WDYA 4QD2A 1QH6A 1EAH2 2ZPXA 1BYHA 4X8NA 4KU8A 4OI4A 3H7YA 2VY0A 5H9PA 4Q4V2 4COWA 4L92A 5LRRA 3ZYJB 4GMP0 3AZWA 3VV1A 4D69A 2AZ5A 2B5HA 2G9GA 3EO6A 2VQ0A 2WLPA 4GIQA 2GH8A 5CFDC 2WS91 3MI8A 3ZIWA 2ZZJA 2RS32 4O9GA 3RS6A 2WNUA 4XJ9A 1QOOA 2P3IA 4OHXA 1Y3TA 4UW5A 3J8F2 4YFWA 3N4MA 4NO4A 5F9TA 2WNVA 3SXWA 3O7OA 3KD4A 5I8SA 4OHYA 5CFCA 5JSOA 1GNHA 2JJ6A 2WJSA 4XF1A 1RUOA 4GH4C 4ZXKA 4AI2A 1AUYA 4WVVA 2A5ZA 3E97A 1ND3B 1NQDA 3VHOA 3SISA 5ACA2 3VBFC 2WZPP 4YGDA 1NCQB 2PLV1 4M00A 3KCXA 1I9RA 3KSCA 3KS7A 4OULA 3AZZA 4MXWB 4KWLA 4RR3C 4Q4Y1 3D0JA 2QJVA 4Y1XA 1VBD2 4LA2A 1DDLA 1AX2A 2JG9C 3B3QE 1H8VA 3W9AA 4OHVA 1QNYA 1R1A2 4M3CB 3AKRA 2R30A 4MGZE 4AQTA 4QPGC 2Q8OA 1LOGA 4DY3A 5GZDA 1SMVA 4EN9B 3I54A 3VBRC 4L9BA 4PLMA 1O3QA 5K9YA 2HWC2 3EHKA 5F1RA 4XILA 4N7UA 1C5HA 2VW0A 1XYNA 1ZRCA 1F2NA 2C5DA 3AKTA 1OQ1A 5F6KA 4IEUA 4FPGA 4FTBA 4CP1A 1JXNA 3CJIB 3AJYA 2C9AA 2H6BA 5E89A 4GWNA 4KH9A 1Z78A 4PDWC 4N43B 1QJU3 2UWCA 1S0EA 4AQ6A 2CWMA 1LEDA 4LTAA 1MS5A 4PDWA 1LKNA 5E1RA 5FTTC 5T50A 1N3PA 5GKAC 4G4FA 3W59A 5KC6A 4B3NA 2JICA 5HCFA 4CYDA 4QPIB 3R6SA 1AX0A 5DXDA 3I8TA 4HKLA 3BCWA 1CAUA 3OYWA 4XE9A 3POYA 1R1A3 4XXPA 2OW4A 1RMU1 2XHKA 1D4M1 5KBFA 1VBA3 2P3KA 3AKSA 1PZ7A 3ZVXA 2BNOA 2ILMA 1DQ0A 2UWAA 2WZR1 1PMIA 4KG0A 2XKPA 4UXAA 1CAUB 3OYWB 1AF9A 4QU2A 5T52A 2VMIA 3ZXFA 1GZCA 5GALA 5H9RA 2ZHKA 3JBG1 2DURA 4CEYC 5T5JA 2ES3A 4LHLA 3IBMA 3FUQA 3R4DB 1Z7S2 4FPOB 4KGGA 2DCTA 1DQ2A 2PHRA 2VVDA 2W52A 1XU1A 1MR5A 3LSEA 4LHNA 5K0UC 3TWIA 4YG6A 2QKDA 2V5YA 5FMOS 2AH2A 5BY5A 2VPVA 2XWBB 3GNEA 4Q4X3 1ONAA 4OI1A 1AR92 1COV2 1SFYA 5T5PA 3WW4A 1PK6B 1YFUA 2XUMA 3ELNA 1Q8VA 4ITCA 5DUVA 1LOEA 5C8CB 2VXRA 2Y0OA 1I3HA 3U11A 1AR93 1DG6A 1FXZA 5C9AC 1AXKA 4YVSB 1J3PA 4JGZC 3LA7A 4B4QA 1B35C 3NKTA 4XIOA 3KB5A 2WA3A 4CZSA 1POV1 4CEWB 3ECQA 3THPA 2XVLA 1LB2A 2CL2A 3HAGA 1IPJA 1XE7A 1ZNPA 2KM2A 3N7MA 4GWMA 2XPJA 3N35A 1SFNA 4IEXA 3WV6A 4LBNA 4TZDA 4FVVA 1DU3D 3VKNA 3AYAA 3AZYA 3B69A 2CAUA 5C33A 1BQPA 2GN3A 3H3ZA 4RL7A 5T55A 4AVAA 1RUF3 1QXPA 1YNAA 2VGDA 3A0NA 2OZJA 2D43A 3MW2A 2VOKA 4I09A 2FQPA 4IEPA 3ZN4A 1MZ6A 2O8QA 4P9LA 2GC3A 5DG2A 3PLQA 4BLJA 2NZ9A 1EY2A 1X50A 1O5UA 1I6XA 1NXMA 3SMHA 4E2SA 5GZGA 3A4UA 2JE7A 3A0KA 1COV1 4COUA 1UX6A 2WQ4A 2X53S 3Q9OA 2D40A 1N1TA 2VMGA 2ARXA 4INDA 3WX5A 1GQHA 1LHNA 4GH4A 2BVVA 2CYFA 5J96B 4HT1T 4META 2XLFA 4RHV3 1YUDA 1ZBE1 2C0ZA 4BPZA 4COVA 1UZYA 4CDUA 1VBA2 4IL7A 1WMEA 3ILFA 2DU0A 3MPPG 4HETA 5DDJ2 4HANA 1GKBA 1AXYA 1LECA 2WS92 1QDCA 1UF2C 3WINE 3M70A 4XFIA 4DRRA 3FBYA 4LUKA 4YM3A 4ORFA 1S1AA 4XFCA 2YY1A 1G6NA 4QT6A 3FLRA 1NCRC 1RUH1 1W2UA 4QQLA 3SITA 5A32A 4QQ2A 3MLLA 2QCSB 4IETA 2DCJA 5L36A 5JI9A 1LHWA 1H8TA 3LGRA 4R9AA 3UKNA 3OJBA 4D7TA 2VQAA 4EN7B 5KHJA 1TME2 2CNAA 4ISRA 5I0TA 1Z7S1 3KT7A 4COYA 1OA2A 1AR82 1NA1A 2DUQA 3KZ4C 3INAA 3L2HA 5CNAA 4AEKA 2HEWF 3ES4A 1H1MA 1FMD2 4LBOA 4Z2WA 2IXJA 4Q8LA 2PHFA 2YC0A 2BPA2 2ZX0A 2E7AA 2R6QA 3IT8A 1QJY1 1LR5A 3JD72 2PHUA 1IS3A 1BEV3 2WZR3 3ZO0B 4I01A 4CDWA 3ZFFB 2QDRA 1QKQA 4NN0A 2D98A 3ILRA 4XFHA 3EBRA 1OD5A 2JXAA 5AFEA 2ZGOA 4RS5C 5D8AA 1I5ZA 3WUDA 4AWDA 1SBEA 3M3OA 1VAMA 1C5IA 1HKDA 3TB0A 5BNNB 5J98B 2DVBA 4RR3B 2R042 2GNTA 2R063 5JLVA 3LSDA 1N1VA 1O3TA 4XHBA 3VBSB 1PVC2 2IZWA 2XBO2 4LO8A 4RQPC 3DKWA 1W6PA 2FMDA 3AYDA 3WUCA 3VL8A 4XJZA 3VHRA 1KQRA 2YDEA 1OOPB 1Q8PA 4QPIC 3PJYA 4G9SB 5BXXA 5JOZA 3C3VA 4XFGA 4C1WA 4D94A 1LU2A 4P9XA 3RJRA 2PAKA 3WG4A 4JC1A 5HBAA 1TMF3 4Q4W2 2WT0A 3ZYGA 4YW2A 4XQWA 4DXZA 5ABJB 1VR3A 3ZN6A 4LBJA 5E8AA 1OFNA 1NCQC 1VAKA 3NW4A 3L9JT 4QGLA 2ARBA 3AP4A 3HD8B 3NL1A 3AFGA 1RUF2 3LAGA 4Q0UA 4YRDA 2KA3A 3S7IA 1AVBA 1OA4A 1TE1B 3FFQA 1SBFA 4Q4Y3 1ZX5A 4FPKA 1MQTC 3JQWA 2CGOA 4URTA 3T1MA 4OUSA 4PLOA 3QH7A 1FYUA 4R4XA 1VBA1 1F5JA 4UW4A 1LTEA 5DUXA 1VBE1 4I3GA 2EXKA 3VBHB 1FOD1 4LLFA 1Q8OA 3USUA 2UU8A 1YFYA 1FPN2 5SV8A 3TAYA 1REEA 1O91A 2LM3A 2XKOA 5BNPB 2ZX4A 2NPIA 1ZM1A 4XEZA 2ZGUA 3TN91 3VZJA 3JQXA 4UBHA 1AHSA 1WLDA 2OIIA 1D4M3 2D6OX 3NWKA 1O7FA 4JV4A 4DMIA 1OHFA 5BNPC 1SLAA 2DFCA 3WVJA 5I93A 1MEC3 3IPVA 2HWC3 1O4TA 1GBGA 1WD3A 4JGZB 1XNBA 3GZTB 4IEZA 3MW3A 4W6XA 4B4PA 1YFXA 5I8TA 3ZSLA 3KQRA 1LESA 3TRSB 1X7NA 4N9HA 4K6BA 1Q8QA 1VB4A 2AR6A 1VB2A 4QX5A 3WP4A 1NCRA 1C3HA 2YGLA 4XOGA 2NQYA 2HWD1 2Z42A 2AUYA 1AL0G 4YG0A 3VKOA 1M4WA 1H30A 3AP5A 1TMF2 2ZX1A 5FQ0B 1CAWB 1HQNA 4IV1C 1QU0A 1C4RA 4AHWA 3URFA 2BVBA 4LBQB 1EP0A 3LOBA 3VZOA 3RJ2X 4HSLA 3UV9A 1U0AA 2MEV2 1JH5A 1OPOA 3FBMA 1PIV1 4I0AA 4IEWA 4LO6B 1BMV1 3ZXGA 4AFAA 4P9WA 1AR91 1ZRRA 1DZRA 2HWF1 2TEPA 5T5OA 1QOTA 4EN0A 1GV9A 4PJYA 1BEV1 5J48A 1RUE3 5GZCA 2ZKNA 5D1IA 2RM21 2FBEA 1HIXA 3WW2A 1S0CA 1HXS3 2WFF3 3PNAA 1VBD1 1PO13 2BEOA 3VDDA 4B8EA 4PLNA 2ZX3A 4Q4X1 5H9QA 5BNNC 1GICA 2RS13 1JHNA 3VBRA 1HRI1 3WDWA 3DL3A 4AI1A 5FO7B 1QJX2 1CAXA 4QHBA 3RI9A 4FXKB 2RS51 2B39A 1WLCA 1PVC3 1MVEA 1CD3G 2Q30A 3PVEA 3H1MA 2XB6C 2VW2A 3FFZA 3VKFC 4F8AA 3WDXA 2QE3A 4R9CA 4Z8BA 4KWJA 4MZUA 4J1WA 1WBLA 4LEJA 1NYWA 3IN9A 1AYM3 3OGJA 1SCSA 2BWAA 4AXOA 4CP0A 4BIFA 4L11A 2XGXA 2CTVA 5JWPA 3GALA 4GMP3 2BNNA 1IS4A 3GYDA 1V9U1 1TME3 1OFSA 2XLGA 3FE5A 1MACA 2B45X 2ZGLA 3P3NA 2UWBA 1RITA 1H4GA 3N3HA 4LBQA 1ZREA 2SLIA 5F6LB 3SH4A 5DZEA 1WLWA 1EAH3 1JTZX 1ZBA3 3GHMA 4FOYA 3ZXJA 4LLOA 4GALA 1IPKA 5AFBA 2HWE1 2PN5A 4FPYA 1MZFA 2VOXA 3HT2A 3WZ1A 2VUAA 3IDEA 4GQ7A 1DIWA 4AEDC 4CP2A 4FSJA 4QM8A 4JQRA 3OD4A 1FMD3 3HBZA 3S6PA 1UPSA 1WUVA 1G9DA 4P9JA 3NAPB 4FPLA 2JX9A 1W0PA 5KHHA 2PA7A 1WCDJ 4LE3A 4E4ZA 4IV3A 1MS0A 5FPXA 1RVF1 3ZFEB 4EWDA 2NN8A 1JBCA 1D4VB 5A3LA 1RL3A 4AEDB 1VBE3 2O1QA 3N7KA 3NV2A 1F9KA 5EZWA 2HJIA 1FOD3 4XPVA 2A6YA 2WQZC 3WP5A 2XG3A 1VBB3 3ME2A 1HV0A 1SQ4A 4Y26A 3JB4C 4A7YA 4QM9A 2F4PA 3TOJA 3WNXA 5FCCA 1J58A 1EV13 4FP3A 1V6NA 2ZX2A 3I2DA 5JSPA 1H8TC 3MDPA 5JVVA 1DGRA 1UN1A 2E63A 2DVAA 1EPWA 5JZGC 2R1DA 2UYBA 1ULFA 3AP7A 4L97A 1V6MA 5GLWA 1MEC1 4B29A 1FPN3 4AVSA 1A3KA 1LGBA 1UZZA 3WOGA 3MYXA 2VVEA 5HCBA 5I91A 1G7YA 4HL0A 1BBT2 2DTYA 3MICA 2JE9A 2DVFA 1YWKA 3VBUA 4Q4W1 4I0BA 1VAVA 1NE6A 1Z7S3 5HCAA 4L8QA 4YARA 3AXEA 4H7MA 1YJLA 1LHOA 3D5OA 2JD4A 5I0RA 2IXKA 3ZYPA 2B7YA 3ZSEA 3BU7A 3H7JA 3S30A 1W6NA 3NAPA 4OVEA 4XF0A 4WM7C 3H1WA 4KBBA 2PHLA 1MS1A 1ND2B 3MZHA 4B7KA 1V6KA 1IZ3A 1H1IA 4PBPA 1NXD1 1DQ6A 2FMYA 3THTA 4XQDA 2DTWA 5FO8B 2XJQA 1FT9A 1S2KA 2H0BA 4AYUA 4CEYB 1IKPA