2LALA

Crystal structure determination and refinement at 2.3 angstroms resolution of the lentil lectin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LENTIL LECTIN (ALPHA CHAIN)
publication title Structural analysis of two crystal forms of lentil lectin at 1.8 A resolution.
pubmed doi rcsb
source organism Lens culinaris
molecule tags Lectin
total genus 24
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2lalA00
4FP2A 4R9AA 1YI7A 1CVNA 1SACA 2DWRA 4PCRA 5T54A 1N1YA 2AGSA 3BODA 1JHNA 4M3CE 1V6OA 1MS3A 4ATEA 1Q8PA 3U4XA 3WVJA 1LU2A 4DRVA 3LCPA 5GM0A 5CB7A 1KDKA 4OZXA 3KQRA 2E7QA 2UWCA 4Q26A 1IS5A 1F31A 1W6OB 2W52A 2P3KA 1TEIA 1MS9A 1Q8QA 2GMPA 2XB6C 3B69A 4XTMA 2FHRA 4YGEA 2ZGKA 1XQNA 1LOGA 1N3PA 1LHNA 1SCRA 3INAA 5DG1A 5KXDA 1C57A 1G8WA 1QKQA 2D6NA 2PHXA 1G9DA 3V0BA 4TYSA 4WV8A 2H0BA 3I8TA 2YZ4A 2JE7A 4M00A 4CTEA 4YW5A 3UL2A 4YGBA 2ZGLA 2D6MA 2D6LX 2NZ9A 1JYIA 1J1TA 4FPOB 2VY0A 4ITCA 1LCLA 2AYHA 1UKGA 5GZFA 1WLWA 4C1XA 1MS5A 1ULFA 1QNWA 2WSVA 1WLCA 4YGDA 4I30A 1SLBA 2GALA 5JMCA 1W0PA 1LHVA 1DQ0A 3AZXA 1WD4A 1MS1A 2V5YA 1MZ5A 4LBKA 2PHFA 1URXA 1UL9A 4LBLA 3ZXKA 4AVSA 5CAZA 1ULCA 1WLDA 1LGCA 3T1LA 1QOSA 4FPHA 3WDUA 1IS3A 4Y26A 3V0BB 1C4RA 1QGLA 3GALA 3N3HA 5GZCA 2ZGUA 1CPNA 1UZYA 2DURA 4TZDA 1UAIA 1GLHA 3FLPA 2ZGQA 3AJYA 1BQPA 4MYEA 2EIGA 5GZDA 3R05A 1RIRA 2CL2A 2UWBA 4GWMA 3R4UA 1GSLA 3UK9A 3AZZA 1Q8VA 1N1TA 3C2UA 3RSJA 3RG0A 3APBA 4ZKTB 4Y1ZA 1APNA 5HCFA 4XTPA 2D6PA 2D3RA 3RRDA 1IKQA 1SCSA 2I2SA 2BQPA 1LOAA 4Y20A 3Q9OA 4GKXA 2ZA9A 1UMZA 5JVVA 3AXDA 1WW7A 1I3HA 2VXRA 4XILA 2W08A 5T5JA 1GICA 4H55A 2R16A 1QMJA 1ULDA 1DHKB 2VW0A 4K20A 5DZFA 1QDOA 4ISRA 2AUYA 2WLQA 1MVEA 1S0GA 4XJ9A 1R1ZA 1LU1A 1JYCA 2DU1A 2WQZC 3PMEA 3ILNA 4BQ1A 1Q8OA 3N36A 5IK7A 1IS4A 1W0OA 3PVOA 5EYXA 1LEDA 2DTWA 4BOWA 1YO8A 2E51A 1GYKA 5IT6A 2EXJA 3UJQA 4Y1YA 4RA0A 3FUQA 3AYEA 2VUAA 4D69A 1KJLA 3OY8A 4AGGA 3BTAA 4Y20B 4AGVA 3CNAA 1ZA4A 5GLWA 1G7YA 1KRIA 3PJQA 5H9PA 4Y1VA 3M3EA 2ZKNA 1FAYA 4YG3A 1G9FA 5HCBA 5L73A 5SV8A 2JJ6A 3WDTA 4UW6A 4FVVA 1BZWA 2WSUA 2ENRA 4Q27A 4WZFA 4AYUA 2EF6A 5JOXA 5IK8A 2DVBA 4AGRA 1KDMA 1V6IA 3D6EA 4HANA 1GZWA 1V6LA 2CYFA 2V73A 1AX1A 3AP7A 4P14A 2D3PA 4UW4A 3LSDA 2D7FA 2HYKA 1ULGA 2GN7A 2A6XA 2LTNA 2A6ZA 4YM2A 3VV1A 1DLLA 1G9CA 4AVVA 2R49A 4HL0A 1LOEA 4XJAA 3T1MA 5GZGA 4LBOA 4BPZA 2R1DA 3OY8B 1JOJA 1WBLA 4R9DA 4UW5A 2A3YA 2JE9A 2VW1A 4KBBA 5DZEA 4YM0A 1GKBA 1S0JA 2EXKA 5T5LA 5T5OA 2AH2A 2A7AA 3VUOA 4XJWA 3IMNA 1A78A 3ZSKA 2SLIA 2D43A 2E6VA 2UURA 4LBQD 5CA6A 1ULEA 3OBRA 2GN3A 3WG3A 1LTEA 2ZGOA 2ZGNA 1DZQA 2ZZJA 2DVDA 3M2MA 5GALA 2P2KA 1GZWB 1VLNA 1WD3A 2TEPA 4FPFA 1LHOA 1W6MB 2DVGA 4XMIA 2ZMKA 5GLVA 4JRAA 1GZ9A 3DGTA 2YXSA 4XHBA 1PZ8A 3W59A 2ZHMA 3LSEA 4FOVA 3RMYA 5DUWA 4DQAA 4DRRA 2DUPA 2NYYA 4XYXA 4Y1XA 1O4YA 2P37A 4YZ3A 5JLVA 3VKNA 1I1EA 3AJZA 3FBYA 3ILRA 1CJPA 3R4SA 3B01A 3WCSA 3OYWA 5DXDA 1Y7BA 2DV9A 5DUVA 1Z0HA 4M01A 2AR6A 1AJKA 3PVEA 3AP6A 1AZDA 1LULA 4FPYA 1JBCA 4K1YA 4SLIA 1LODA 3WG2A 3USUA 3B3QE 4PBOA 1AVBA 1JXNA 1LHWA 2PHRA 1MS8A 2P34A 3WNXA 4R9CA 3N7KA 1ENRA 4JC1A 2EXHA 4BLJA 4CZSA 3AYCA 1YXWA 5DUUA 5JOWA 1HDKA 4FPGA 2B7YA 4P9WA 4NOTA 2ZACA 2GNTA 5HCAA 2A5ZA 2OW4A 3QLQA 4XBQA 1WBFA 1QDCA 1DQ4A 2UWAA 2GNBA 4LBMA 1U0AA 3ZSJA 3A0KA 1ZM1A 1S0FA 1GNHA 1ONAA 2JECA 1DIWA 2NM1A 4FPCA 1G86A 2VW2A 4BM8A 1QOOA 3O0XA 3FLRA 1LENA 5E88A 1IS6A 2GMMA 2P3IA 3OYWB 1HQWA 3A0NA 2DUQA 5LK5A 1V6JA 3V0AA 4Q1PA 1S0EA 3B9CA 3O0VA 5DG2A 1LOFA 3ZSMA 2NMNA 4AVTA 3N35A 3USUB 3N7LA 2DVAA 2A71A 3HN1A 1MVQA 3POYA 2DU0A 5T55A 4FP3A 3SLIA 3L2YA 3O5SA 5DUXA 3TB0A 1LGBA 4XZPA 4FPLA 1MACA 3ZXFA 4ISQA 5JDBA 1AX0A 3ZXEA 2EALA 3FFZA 1N3OA 1DFQA 1LESA 5IUQA 1DGLA 1LHUA 3AX4A 4FOYA 2OVUA 5GJ6A 3WDXA 4PQ9A 1SLLA 3ZXJA 3ZYRA 2YMZA 2GNDA 4K1ZA 4PF5A 3AP9A 4ASMB 2A75A 4YM1A 2W39A 4Z8BA 1H30A 2A6YA 3V0AB 4XDQA 1KJRA 2ZMLA 1HQLA 4P9XA 3WG1A 1GBGA 3SH3A 3JUUA 3DUIA 4UW3A 4F83A 2ZGTA 1FNYA 1SBFA 3WCRA 4YFWA 4YGCA 1N3QA 3ATGA 4XJ8A 4FOQA 5H9QA 2A3XA 4FOWA 4DFSA 3TAYA 1VAVA 2ARBA 5T5PA 3AZYA 4LBJA 1ENSA 3A4UA 2OUHA 5FRAA 3JU9A 3WV6A 4P9YA 1W6MA 1MR5A 2DTYA 4YZ5A 1AXZA 2ERFA 3BOPA 4YW1A 2C9AA 3IN9A 2EAKA 1S0CA 2A6VA 2ARXA 1CPMA 3AZVA 2ZABA 3M1HA 3IKWA 3SH4A 1SBEA 4XHXA 2D44A 2DYCA 1OQ1A 1RITA 1KITA 2DUOA 1Z78A 4PBPA 2E53A 3NV4A 4YW2A 5BYNA 2YROA 1LOFC 1LOBA 3POSA 3NV1A 2AREA 2PHUA 1LGNA 1CONA 4R9BA 4YZ4A 5AVAA 3AZWA 5JOZA 1G9AA 1NXD1 1LECA 3VKMA 4WVWA 1AJOA 3GNEA 3SNMA 4W65A 5T50A 3ZVXA 4BLIA 3WZ1A 4LBQA 1AF9A 1DQ2A 2WT1A 4XE9A 5GLTA 2R0HA 4IQPA 2P3JA 2G4IA 1A3KA 4AWDA 2NP0A 2D6OX 3WLUA 4U36A 1IOAA 1S1AA 1Q8SA 3AYAA 1AX2A 1FX5A 3AYDA 1YRZA 3WG4A 2ZGMA 2LALA 3ENRA 4YW4A 4LBNA 2KM2A 3NV2A 4K21A 1VAMA 2D3SA 1H9PA 4YG0A 4U2AA 3D4KA 2YV8A 4GALA 4YZ1A 1YIFA 5GZEA 3MW3A 3N7JA 1BXHA 3M3QA 1SFYA 4XJZA 3MEPA 2VH9A 4YG6A 1W6PA 1S0DA 1V6NA 2EXIA 2E7TA 1CIWA 1GV9A 2VU9A 1W6QA 5F9TA 1S0BA 1BKZA 4NO4A 4Y1UA 4M3CF 4Q2FA 3IM0A 4XMAA 1V00A 5EXOA 4LBQB 1OFSA 1CR7A 2ZAAA 2A3WA 3SH5A 3KM5A 1D2SA 5EYYA 1A8DA 3HR9A 3M3OA 4YW3A 3ASIA 4Y24A 4XBNA 5EWSA 4YLZA 1LOCA 1F9KA 4ZXKA 5H9SA 4BMBA 1H9WA 2ZHLA 1RINA 2CWMA 2Q5TA 3MPPG 3VKOA 1UPSA 2ZBJA 3ILFA 2WT2A 1FYUA 3AFKA 1PZ7A 2R0FA 2JKBA 3ZPYA 2GDFA 4C1WA 1B09A 4FPJA 1QOTA 1PZ9A 2ZHNA 1W6PB 5KXEA 3WDVA 4GA9A 1FNZA 1O4ZA 1W6NA 1CESA 1UN1A 1W6QB 3FUOA 4RL7A 1FV2A 3RS6A 3WDYA 2CNAA 3RMXA 4FQ4A 1BYHA 1OKQA 5DZGA 3T2TA 3WHUA 3QCWA 4FPKA 5CBLA 1C1LA 1IKPA 1C1FA 2ES3A 2Z42A 3VKFC 2AENA 1QF3A 4DS0A 3OBTA 1V6KA 1QNYA 3OPZA 1SLCA 2CY6A 3M3CA 2FMDA 1WW4A 3I4IA 4DPNA 1SLTA 4M3CA 2PHWA 3D5OA 1UX6A 3MW4A 1X50A 2W68A 3FLTA 1V6MA 1VIWB 3ZYPA 2YY1A 1N47A 1GNZA 1YYNA 4Q1RA 2JDZA 2D6KA 1N1SA 1Q56A 1DQ5A 3AK0A 4XXAA 3AP5A 1F5FA 1MS0A 1CQ9A 2ZGSA 3MW2A 1LJ7A 1CN1A 1W6NB 2ZHKA 3WOGA 1SLIA 4XIOA 5E8AA 3BIWE 4BMEA 1AXKA 4YM3A 3ZSLA 2GNMA 3SISA 1JUIA 1SLAA 1GZCA 3PVNA 4CRQA 1BJQA 4Y22A 1WCSA 5GLUA 3V64A 5FREA 4GXLA 4JCKA 3IPVA 5H9RA 4XBLA 4XXPA 1SBDA 4GWNA 4XOGA 1N1VA 1DQ6A 2PHTA 3B00A 1DBNA 1MZ6A 2A6WA 2GMEA 5E89A 2CTVA 1D0HA 4YFZA 3OGGA 2NMOA 3W58A 3HMYA 4M3CB 3H0OA 3RQ0A 2OUJA 4GKYA 1EPWA 3OJBA 1LEMA 2SBAA 4ATFA 2RHPA 5F5QA 2CWSA 3O0WA 1HLCA 4FQZA 1QU0A 3POWA 2ZMNA 2DVFA 5KXBA 1G9BA 3NWKA 4WVVA 1FATA 3AP4A 1VALA 2ZGRA 4XJUA 1JW6A 2PELA 5IK5A 5JOYA 1MS4A 3NV3A 2ZGPA 3VKLA 3WHTA 1WUVA 2JD4A 1DQ1A 4Q8KA 4L8QA 3V65A 2C5DA 1W6OA 4Y22B 1GANA 3N7MA 3O12A 1KQRA 4FPEA 4YZ2A 3IPVB 1UZZA 1NLSA 3SITA 3WDWA 2WKKA 1FV3A 1S0IA 1WW5A 5GLZA 2UU8A 5IK4A 2XG3A 2R1BA 2A70A 2WJSA 5T52A 3UJOA 3AXEA 3WUCA 1DYPA 2WT0A 1JN2P 2NN8A 4XIKA 1AXYA 1ENQA 5KXCA 1HKDA 1WW6A 4Q8LA 2WNEA 1DYKA 3ZXLA 3WUDA 5CNAA
chains in the Genus database with same CATH superfamily
1QEXA 3WF1A 1SHWB 5ABJA 1QJX1 1YI7A 2VG9A 3KV6A 3LB9A 5LA2A 1L7RA 2FCTA 3FX3A 1YQ5A 3BODA 3OEBA 1JHNA 4KQ7A 2VO5A 4M3CE 5JPMB 1UYYA 4Q29A 2DCKA 1SDDB 2HWD2 3AMHA 3P3PA 2C26A 4WM7B 3WVJA 1LU2A 4A41A 4DIQA 2B46X 3U4XA 3RZJA 5GM0A 4BQ5A 3CEWA 4QX2A 3WXPA 3VB9A 3HWJA 1GZTA 5FUIA 4A45A 2WN2A 5FZGA 5BV6A 5CFDC 4IEUA 1F31A 4A7KA 1MS9A 3B69A 3WEZA 2RDRA 2ZGKA 4YGEA 5A33B 3DEMA 4BQ3A 2HWF3 2QUOA 1VBE2 1SFNA 1C57A 5IW0A 4XFCA 2WFF1 2H0BA 3I8TA 1UXXX 2XLAA 3LA2A 2JE7A 4LHKA 4M00A 5FIXA 3RNSA 3H8OA 1J59A 2ZGLA 5FY0A 5JZGC 5DQ0A 3LEGA 3LDRA 2R073 4ITCA 5A1LA 2Y6HA 2YGMA 4B7EA 1H6YA 1PK6C 5J48A 1UZWA 4DXRA 1MS5A 2WSVA 1QNWA 4XUNA 3BPZA 4LOTA 3ZMNA 4YGDA 5JMCA 3BB6A 4RS5C 3LA7A 5EJ1B 3KQ4B 3JBG1 1WD4A 2V5YA 4PIXA 1MZ5A 4ZPIA 5I0TA 1CAXB 1VBD3 1PMJX 2RE9A 4LMFA 5CAZA 3DYOA 4N7UA 2VCCA 3FHIB 3OGVA 3WDUA 3VBFA 4JKKA 3PJYA 2RJ2A 4RSUA 1PO22 1NLQA 4ES9A 3V0BB 4MXWB 3A23A 2ZGUA 5GZCA 2WYSA 1CPNA 4QDSA 4AZZA 4UFMA 5FAXA 3PIGA 1GLHA 3FLPA 3HNBM 4MGIE 1SG3A 4OMDA 5FY9A 3ZPOA 2J1UA 3Q8EA 5ABJC 3VBSA 2VULA 4GWMA 4IEPA 4UFLA 3ZM8A 1JS9A 5K8SA 1C8NA 2HWC1 3AZZA 3C2UA 2QQNA 3TN92 2ZAHA 3RG0A 3APBA 3RGBA 3VD3A 1APNA 2WZR3 1V9U2 4XTPA 5FMOL 1Y9QA 2EVXA 2XLFA 3I54A 5A70A 2MEV3 4Y33A 3NAPA 1UMZA 5JVVA 1U12A 2JG8A 3CDZB 5C3SA 2VXRA 5FZBA 4PDWB 1WMEA 2L9LA 2BRTA 3T08A 1ULDA 3T4HB 4F3JA 1DHKB 2AEYA 1ZBA3 2VW0A 4QGMA 2BPA2 5J96B 2Q4SA 3I3DA 3WT3A 5AFEA 1S0GA 5L9BA 1R1ZA 1UZVA 3A21A 3PMEA 2WQZC 4HVRA 2GSYA 3AKSA 4TLFA 4BQ1A 4D8MA 5IJRA 1WZXA 5IK7A 3NNLA 2OKXA 4KU8A 4NPRA 1LEDA 1LNSA 1NQDA 3LOIA 2X05A 1GYKA 1HV1A 5LA1A 3NSTA 4Y1YA 3MGUA 2UY9A 5FZ7A 4RA0A 5FY7A 1OPOA 1WCKA 2J7MA 3CBNA 4D69A 1RUG1 3U14A 3CNAA 4LA2A 2RM22 4IGOA 5A3LA 3O1VA 1I5ZA 3WINE 2DFBA 1KRIA 3PJQA 4B29A 2B9VA 1KXGA 1STMA 5SV8A 2XJTA 3FFQA 3SKJE 1BZWA 4HN1A 1J3QA 4LOSA 4META 4Q27A 3I3BA 4YNIA 4AYUA 3H1WA 2HWE1 4JGZA 2O14A 2AACA 1QJEA 4KI5M 5I0RA 2K9ZA 5FYHA 4KG0A 2LW8A 1V6LA 3DECA 3UNPA 4YSFA 4IETA 2W94A 4HMZA 1NY71 4NHKA 3ZIXA 3VBSC 1ZBE1 2RDQA 2A6ZA 4LO6B 4YM2A 2DCJA 3ETQA 5A7SA 2WA3A 1OD3A 4QX0A 4GH4B 3F95A 1LOEA 4IE5A 5JSOA 4PF1A 3PMSA 4H2AA 2VBBA 4CU8A 4R9DA 2WYFA 3CF6E 3C7HA 1PVXA 3NAPC 4KBBA 1YNAA 2JG8C 5APAA 2UY8A 4MGQA 4XJWA 1VRH2 2KD7A 4H3WA 2QQOA 3ZSKA 1ZRRA 4AG4A 3UV9A 5C8CC 3OBRA 3S5QA 3WG3A 1DZQA 1W2AX 2YC4A 4IV1A 4CUBA 1CAXA 5IWFA 4ZU7A 5GALA 4QX7A 3LPFA 3MBWA 5A1AA 1OF4A 2BJSA 1YEWA 1W6MB 2DVGA 2XDVA 1G6NA 4Y5Z0 2QQIA 2YXSA 3UESA 3CZUA 4DINB 1D2QA 4Y4YA 5DUWA 4DRRA 1K45A 4LT5A 1YFXA 1W9WA 4K3UA 4YZ3A 5FUPA 1UY3A 2PAMA 1Z7S2 2PQSA 2UYBA 3J9SA 1I1EA 3MI8A 1OFNA 2D5FA 5SV5A 1CJPA 3SXWA 2HWB1 1H8TB 4NPMA 5T3NA 3H3LA 3WCSA 4ARYA 4WM7C 3PL0A 5IVBA 1R093 2OIIA 5LBEA 4BIOA 3AP6A 5FPXA 4LR4A 2FDKA 1AZDA 5CKNA 2EIBA 2VNVA 2ID4A 4M0NA 4JGZC 1NLRA 1LHWA 2LROA 2P34A 4P5YA 3WNXA 1RUE3 2VNOA 2VUCA 2GAUA 2VMDA 4RQPB 4D6RA 2EXHA 3GF6A 1BEV2 5EJ3A 3U11A 4FPGA 4P9WA 2GNTA 2A5ZA 2J1SA 1TMF1 2OW4A 2RVAA 5DN2A 4LQRA 1QXJA 2PHDA 3J8F2 4LBMA 2X10A 4IGPA 1IPKA 1S55A 2TUNA 5J3UA 1DIWA 1EYBA 2C9KA 2IXLA 1ND3B 4QGNA 1DGRN 3O0XA 5FO7B 2RDNA 3MLKA 3ZDSA 3MPBA 1AHSA 1RUC3 1FPN3 3PIJA 4MO3M 1MQTA 3EXUA 3OYWB 4NN0A 1HQWA 2CDPA 3A0NA 5A32B 2DUQA 2ET1A 3AKPA 4LJHA 5LK5A 3C7FA 4DY5A 4G3YC 3ZSMA 5DG2A 3BOWA 4EZHA 5CFCB 1F5JA 4MGZE 4COWA 3N35A 2QQMA 3RFRA 4D6QA 4JKMA 4BISA 4D6SA 5FZ4A 2WINB 2XJUA 2DU0A 1WMDA 2CSGA 1TE1B 4QHBA 5DUXA 1NX9A 2WRAA 4FPLA 4ISQA 5IVCA 5FZ6A 3ZXEA 5LASA 2GC3A 5M0TA 5FK7A 3FFZA 1DFQA 4UOJA 1TNRA 1COV3 1JUHA 4Q4V3 5IUQA 4CP0A 4BQ4A 4QXBA 3GYDA 5F6LB 4AHXA 4OI2A 4PQ9A 5FZHA 3ZYRA 5J36A 4HXCA 5FZEA 4PF5A 3AP9A 4OHZA 4ASMB 4NAMA 4YM1A 5FCCA 3VD5A 2W5FA 2IXCA 2BBAA 1H30A 3LEMA 3V0AB 2W47A 1DF0A 5EJZB 2ZMLA 1UPIA 2Y33A 2IXJA 3WG1A 2W92A 3JUUA 4PDWC 4BXSV 4F83A 2ZGTA 1SBFA 4TSVA 2R6QA 5BNQA 2OA2A 3VDDA 4FOWA 4IL7A 5BNNA 1VAVA 4YRDA 3T3YA 3H1MA 2LUWA 3AB0A 1PX4A 2RR11 1AL23 4MUVA 1NCQB 4HKLA 1X8EA 2VD7A 4P9YA 3WV6A 3I59B 4N53A 4A42A 1W6MA 2VZPA 1AR63 2WZR2 3C7OA 4EWDA 4HSLA 4YZ5A 3HQXA 1CX4A 1GOGA 1AXZA 1W04A 2DBIA 2ERFA 2Y6KA 3MLLA 4RGKA 2MEV2 5LBCA 4I0BA 4Q4W3 4GMP0 2CDOA 3OG2A 4H7MA 5FDBA 1ZRDA 3VD7A 2XQRA 3DPRA 4GMP1 1MQTC 5FZ8A 3VBRB 5BXXA 2Y60A 4NMIA 3T09A 2WO3A 2DUOA 1RUI2 4PBPA 4Q4Y1 2B9UA 4YW2A 3J7LA 5BYNA 5E6HA 5KC6A 1O7FA 2Q1FA 4X6QB 4YWAA 4GULA 2PYTA 1ZBA2 1L3JA 4AFCA 3POSA 3NV1A 1HB1A 1LGNA 1VMFA 3AZWA 2V72A 4QKDA 3VKMA 5JXGA 4KG8A 4AL9A 2XKPA 4J6GA 5F2SA 5F1RA 4QX8A 3ZVXA 3I7DA 3ST7A 1SDWA 3WZ1A 4BLIA 3KMHA 5JI9A 4XAAA 2W95A 1DQ2A 2RV9A 4NIDA 4XURA 2R0HA 2ORXA 4E8CA 1K3IA 3LKJA 1IOAA 2XBO2 2WS92 3LQCA 3AYAA 4UF0B 5IVEA 4NHLA 2GC0A 4QXCA 4FXGB 1FMD3 2LALA 3ENRA 2KM2A 3NV2A 4K21A 3B93A 2W2IA 3QH7A 2W91A 2Y64A 2WZEA 3D4KA 4GH4C 4YG0A 3RWKX 2X09A 1QH7A 4YZ1A 1GWMA 5GZEA 4EN8B 4LO5B 4B1MA 1ND3A 2WABA 2WR9A 4MLOA 1RUJ2 2WA4A 1FOD2 4WVMB 4XJZA 4CCJA 1W99A 2EXIA 3ETPA 3R6SA 1CIWA 2K2SA 5FKCA 4AEDA 5F9TA 2ZX4A 1POV0 1PM7A 4NO4A 1XNCA 3VDDC 4COUA 2PLV2 4C91A 5EXOA 5I8SA 3ZN4A 4BA6A 1POV1 5DAWA 1H4GA 4P9IA 1OPMA 1RUNA 2A3WA 5HV0A 4UAPA 2W1QA 4I3GA 3BPSA 4N53C 3S7EA 4XBNA 1YQ8A 1W39A 1AR91 5KR7A 1UF2C 4ZXKA 5H9SA 5EQUA 4Z1VA 4LKSA 1PVC2 1H9WA 3MZHA 2B45X 3S57A 3DPRC 3MPPG 3VKOA 1Y43B 4LNVA 2WT2A 3KS7A 3GCXA 1S4CA 5D2AA 2G9FA 4DY3A 1UOJA 5FYYA 4C1WA 1AR72 5JCTA 4CXXA 1W8NA 4JDOA 2BZDA 3WDVA 4GA9A 4R4ZA 4P9JA 1UN1A 3FHQA 3FUOA 2DCZA 4YW7A 3DN7A 4LA3A 3DKWA 1OKQA 5DZGA 4FPKA 1Q43A 4IDZA 3L2HA 2JEMA 2HWD1 4P5HA 2XJRA 1PO12 2C1FA 3EHKA 4W6WA 4XPVA 1UOBA 3BTYA 4GIQA 1CAVA 3ZR5A 4QB2A 4Y3OA 3VZOA 1IQAA 5A3NA 2O8QA 3KCCA 5FLHA 3ZKYA 2HYXA 3ZYPA 3FLTA 3CJIA 4AEKA 4EQVA 1JYWA 4UFKA 1O6UA 1N47A 2D98A 4PQQA 1R092 4QAWA 5C4WB 4AVCA 2EIDA 3C7EA 4Q1RA 4AFDA 3M4FA 1W2NA 1ND3C 3VD9A 3AP5A 1MEC3 4XF1A 3H1YA 3PNAA 2ZGSA 3JZVA 4FT8A 1DG6A 3M7AA 1WA6X 1K5MB 5A3OA 3KWVA 1W6NB 3WOGA 1SLIA 5E8AA 1R1A3 3ZSLA 2RMU1 4ZXEA 1SLAA 5C9AB 5CFCC 3T2PA 3UYJA 4Y22A 5FREA 4GXLA 5ACA1 1JI6A 2IWGB 3C3VA 3IPVA 5H9RA 4XBLA 3URFA 4XXPA 3GDBA 4IEYA 2JB4A 1BBT3 1DQ6A 3LFIA 3ZX7A 3WP5A 2TBVA 3PURA 3WQ7A 2A6WA 1E5RA 4BJ0A 4YFZA 4LO4B 3OGGA 2VZRA 3DYPA 3JD72 1X33A 4R8HA 4PI2A 4HPKB 3LZZA 1ZZ9A 4OHWA 4GKYA 3SCHA 4J25A 5LA0A 1RUC2 1FPN2 2XVGA 1C5HA 4IGQA 2RHPA 5F5QA 5I8YA 3O0WA 1QU0A 5FY8A 5J37A 2DVFA 1C3HA 5HCHA 1VAKA 4OMCA 1FATA 2JIJA 2VC9A 3AP4A 5A6ZA 1NZCA 1GR3A 4GB31 4XJUA 5AC91 3F2ZA 1ZZ6A 3NV3A 5C71A 3WP3A 2JD4A 4L8QA 3VDAA 4QPIA 1GP4A 2C5DA 1W6OA 2WQ4A 3AKTA 3TN91 3I97A 4HVQA 2WUHA 1UZZA 3WDWA 1NQJA 4HG6B 1DCSA 1FV3A 1S0IA 3L9JT 4A3ZA 1IG0A 2UU8A 1F35A 5IK4A 4Q4V2 4B4QA 5FYCA 1DYPA 3T0AA 3JB4C 2NN8A 3JCIA 5I8TA 4Q8LA 1W28A 1JZ8A 1DYKA 1DZTA 4FP2A 1VBC2 1SACA 2RS13 4ZS2A 2BBVA 2YU1A 1GWKA 5T54A 3HT1A 1H1AA 1W03A 4PJYA 1V6OA 2XUEA 1ENXA 2VTXJ 3K2OA 4NRMA 1MS3A 1JYTA 4ATEA 3RZZA 4A7ZA 4D0QA 3VBRC 4DRVA 3PUQA 2X5IA 3LCPA 1CAUB 5DAVA 1WMFA 1TME3 1XU1A 2VUJA 3I2IA 2WNUB 4XDPA 2UWCA 1IS5A 2WBKA 5BNOA 3VN4A 2P3KA 1TEIA 2GMPA 4XTMA 4A4AA 2V4VA 4P00B 5L19A 1AL22 2VCAA 1N3PA 5DAPA 1DU3D 4ET7A 1EAH1 2RM21 1G8WA 3B7MA 1AR62 5FY4A 2JXAA 1AL0G 5JXIA 3CIHA 2ZTNA 1CZVA 4MZUA 4WV8A 5DDJ1 3IT8A 3UL2A 4HSJA 5G04L 1C8M1 4YGBA 4ZZ5A 2D6MA 4COYA 5ABJB 4R52A 1J3PA 4AAPA 1JODA 4NIHA 1QQP3 1LCLA 4Q4X3 1YI9A 5C6CA 4XFGA 3NJYA 5EPAA 3VDCA 4ONUA 5IVVA 1WLWA 1RUD3 1O3RA 1ULFA 2R7EB 2VQ0A 2VCBA 5AFBA 4BK4A 1SLBA 4QDQA 3I3QA 1RHI1 5JR7B 1W0PA 4LIVA 1LHVA 1W3XA 1GP5A 2RDSA 3VBUA 3GJBA 1MS1A 4QM8A 4LBKA 1UL9A 4WM8B 2ZX3A 1K5MA 3KV4A 3NNGA 4LBLA 2E9QA 1EUTA 3T1LA 2HBTA 3T30A 5LW9A 4AOCA 3KVBA 3HQUA 3PU8A 3WP6A 4BQYA 1QGLA 1J83A 3GALA 3AVRA 3N3HA 2FCVA 5A80A 3WQ0A 1HXS3 2IXIA 5IFTA 3S0MA 3DF0A 1UMHA 3HAGA 1JZ5A 2JG9A 4OVEA 2ZGQA 3AJYA 1EV12 2EIGA 2CL2A 1YQCA 2UWBA 3USSA 3WSOA 5C8WA 5JSRA 2ADDA 1GSLA 5FPZA 1J1LA 1N1TA 1Q8VA 4QWNA 3RSJA 3RZGA 2Q1ZB 2VMIA 2D40A 2BQPA 2X5IC 1LOAA 1UIKA 3KSCA 4Y20A 1EUUA 1EY2A 1HB4A 3AXDA 3WNNA 3MFAA 1I3HA 1O8PA 1RXGA 3IZOA 3KF3A 3ON7A 1J58A 2E31A 5K4LA 1OUSA 1OHFA 1RUF3 4H7LA 4PLOA 2R16A 1D0GA 2R32A 4ZHNA 2P3YA 2XMLA 3OPTA 1ZRIA 1QH6A 3VBFB 2PFWA 5A7PA 4LO7A 1QDOA 2JDUA 2WLQA 2Z5WA 4PLNA 2JICA 1HRV1 1Q8OA 3N36A 1D4M2 3MV11 4XFIA 1X9PA 4XW3A 4XF4A 1W0OA 4COZA 3GHNA 3GJAA 3VBSB 4BOWA 4XAEA 1XU2A 2R063 1YO8A 5LB6A 5IT6A 4S2DA 3D0JA 3ME2A 2XXZA 3AYEA 1BEV1 1KJLA 3OY8A 4AGVA 4Y5TA 1ZA4A 3NAPB 5GLWA 3WF2A 4EN0A 4JTNA 3HNYM 2JG8B 2XHNA 3CHXA 3PTYA 5H9PA 4M4PA 1OQEA 4AQSA 1IQDC 2WL1A 2ZKNA 3J8F1 3KT7A 1K5MC 2E33A 1G9FA 2B5HA 3BGAA 3M3IA 3E5XA 3A22A 3NKGA 3WDTA 1AR83 4FVVA 4UW6A 4A7YA 5A1FA 5C9AC 1X7NA 1XNBA 2EF6A 5JOXA 4LE3A 4AGRA 3D6EA 1UWWA 1R64A 5F3GA 4HANA 4O7XA 3MF6A 2CYFA 2V73A 2P6CA 2JG9C 1PGW2 3LSDA 1Q3EA 4D94A 3H8XA 2HYKA 4J1WA 1XE7A 2GN7A 4BHPA 1JOPA 1G9CA 4CCKA 4AVVA 1MEC2 3HT2A 4OI4A 2VCMA 2BGCA 4HL0A 2FDFA 1H2NA 3LDKA 4BPZA 2RS33 2B4KA 1RVF1 1WBLA 1R1A2 2JE9A 1ASJ3 4YM0A 1GKBA 5T5LA 3ALQA 3ZXGA 1US3A 2AH2A 4XFFA 1YC61 2RS51 3WNKA 5FQ0A 1JYVA 3VUOA 1QJY2 3LGRA 1PIV3 1GQPA 1A78A 1C28A 1CZTA 3KV9A 4HOOA 3W20A 2E6VA 3KHBA 2UURA 4S2GA 5FP7A 3V56A 1E57A 1BBT2 1LTEA 1RUH2 2JE8A 2ZGOA 5A3WA 5LRSA 4CCEA 4PIZA 1QJU1 1T2XA 2AC1A 2DVDA 2PMWB 2QZ2A 4JGZB 1OUXA 4WM8A 3NNMA 2JIGA 1VLNA 1WD3A 4X8NA 3KVAA 4F7ZA 5A6QA 3ZYBA 1XNTA 2JWPA 4XMIA 2ZMKA 5GLVA 1YCIA 4XETA 3FBMA 2DBNA 4XZUG 1GZ9A 1AUYA 4PLMA 3DGTA 4XHBA 1V0AA 2ZHMA 3AMPA 4FOVA 4DQAA 2DUPA 4HLTA 2BTVC 3FN9A 1PX3A 4Y1XA 3B9IA 5A7WA 1VBB1 3AJZA 2IFRA 2WIIB 2QNKA 2VTFA 4IERA 2OPKA 4AHWA 1Q5OA 4XUPA 4FXKB 5DXDA 1ACCA 1OSGA 5FJHA 5JSPA 2AR6A 1AJKA 5JXHA 4GWIA 2Y6LA 1LULA 4K1YA 1JBCA 2WNUC 2Z79A 1H0BA 4QKBA 3QOPA 3WG2A 4H14A 4V2VA 4IV1B 1QXPA 4RHV3 3USUA 1MS8A 2XKOA 4R9CA 1DZRA 3N7KA 3E6CC 1QJX3 3HJRA 1RUI1 3MFCA 1UD1A 1YXWA 4Z2WA 2QQJA 4W50A 3K48A 2F17A 2P4EA 1AYN1 5IVFA 4I02A 4AQ2A 1WBFA 3DKQA 5C33A 2UWAA 2GNBA 1HX6A 1ZM1A 4EYUA 3OGSA 1GNHA 1UYPA 2JECA 2NM1A 3KT4A 4FPCA 4WVZA 1G86A 3EBRA 3U07A 1QOOA 4DEVA 1R082 1I6XA 3FLRA 5ANQA 1LENA 2H0VA 5E88A 1VJ2A 5C3OA 4W6YA 4YYOA 2XBO1 2WS91 4NRQA 1NXMA 3MV01 4TXWA 3RVHA 3BU7A 3P6BA 5F3EA 4CPBA 2YDEA 3OB8A 3B9CA 3O0VA 3OTFA 4IUGA 4EN6B 2WFF3 1H6XA 2G9ZA 4WM8C 4BU2A 2QJVA 2A71A 3HN1A 4LE4A 1FXZA 2C4XA 1RUJ1 3SLIA 1FOD1 3U0ZA 1XXNA 4ASLA 5FOBB 3AL6A 3CQOA 1ZX5A 1LGBA 2JDPA 2NPIA 4XZPA 5KBFA 1QQP2 2ADEA 2EALA 4Q4X2 2QQVA 4QKNA 2YPJA 2YU2A 2GZWA 1NE6A 1LESA 1E5HA 1RUD2 3ELNA 1DGLA 1JTZX 3AX4A 4YW6A 4GQ7A 3KGLA 5FYMA 5GJ6A 3VBOA 4FFIA 4I2OA 3JBG3 4NVPA 2KA3A 2ATFA 3FC0A 4AQTA 3BTZA 1GNYA 1MQTB 2MNGA 1WA4A 2XQXA 3H50A 3WP4A 2A6YA 4QHOA 3ZFFA 4XDQA 2MHFA 4AK3A 1KJRA 2PAEA 3MDPA 2DFCA 4KWJA 1DLCA 1PVC1 3HBZA 2QCSB 2ZX0A 3DUIA 4UW3A 3WF0A 3W5NA 4AHZA 4YFWA 4Y4RA 2ILMA 4YGCA 4FOQA 3UT0A 3KGZA 2A3XA 4IEVA 1MZEA 3VBFC 3TWIA 4LBJA 4ZY9A 3DL3A 4Z2AA 2HWC3 4HN0A 4YARA 2PXJA 5CU1A 5D21A 3MLJA 5FRAA 1PGSA 1S2EA 3ZKUA 4L97A 2WO1A 3KB5A 4Z82A 1YFUA 3U37A 2DTYA 5ACA2 1LAJA 4DEQA 3HPNA 3VD4A 1W9YA 4CXWA 2W87A 3WR0A 3IN9A 4FSJA 5C3QA 2A6VA 1PO11 4OCTA 1CPMA 1C5IA 3AZVA 3LDBA 5F32A 3IKWA 3SH4A 2IXHA 3S6PA 1KEXA 3K4DA 3IWZA 3NQHA 4HK8A 4XHXA 3U75A 4BQWA 5I0DA 3NV4A 4E4SA 1OQDA 1O5LA 2BFUS 3RJRA 3DCQA 2PHUA 2R042 1CONA 2E63A 3S5AA 1G9AA 1NXD1 1XB9A 3RDIA 3TOJA 4WVWA 3TEYA 3GNEA 3SNMA 3VDDB 5BNNB 4W65A 4AVAA 2VOTA 2BWAA 4LBQA 1B35B 2E7AA 5F3CA 4FFHA 2J42A 3VHRA 3MICA 2R062 4AWDA 1A3KA 4E4DX 1CJDA 4N53B 4HZFA 3TNPB 5LEKA 1RUG3 3GZTB 2B42B 1U5ZA 3VBOC 3WW4A 4W4ZA 4K40A 3ZXDA 4Q0PA 4K8RB 5F5AA 2QBXA 1VAMA 1PM4A 1H9PA 2D3SA 3DPRB 4FO9A 1LB2A 2YV8A 5FZLA 3MW3A 4OQ9A 1BXHA 4OYUA 3M3QA 3JD71 1SFYA 2HWE3 1AR82 2VH9A 4LULA 3NRUA 4YG6A 1W6PA 1S0DA 3FMGA 5FZMA 3WW3A 2E7TA 4QD2A 2VU9A 4FAHA 1J84A 1KGYA 4AI9A 3PVBB 2BYVE 3POJA 1E5IA 1ZBE3 2RG4A 5HBAA 2XJQA 1HN1A 1RYYA 1HB3A 1SZBA 1CR7A 4LITA 3EO6A 1YJLA 3KM5A 4B3NA 2XPJA 1A8DA 2ARAA 4IEZA 4BWOA 4IESA 4Y24A 5B2GB 1U5YA 4CDWA 4MG2A 3FE5A 4UT5A 3QD6A 4YLZA 2RS32 1LOCA 4MH0E 3RYRA 3T2OA 2ZHLA 1L7LA 1RMU1 3SQOA 2CWMA 1UPSA 1PNFA 2XVKA 3ILFA 3G6JB 3AFKA 2R0FA 2GDFA 2OZJA 4QB1A 4CDXA 2VQUA 2ZEZA 2ZHNA 2OQ7A 3FJSA 1UO9A 4P08A 2BU9A 4AEDB 3VDBA 2XOMA 1FV2A 1VBC1 1VBA1 1YFWA 2PHLA 1Y9MA 2CNAA 2ZS6B 3B5LB 4N7IA 2HWF2 2QQLA 3WHUA 3OSDA 2BV4A 1WLTA 4IV1C 1Y3TA 1IKPA 2PAKA 3IMMA 3RYPA 4PIYA 5BNPA 3VBHA 3OPZA 1HQNA 4JAAA 5EV7A 1GMMA 3RS6A 2YUEA 2FMDA 3M3CA 1WW4A 3I4IA 1KFUL 4EZ4A 5FWJA 2HWB3 2R072 3LF7A 5FP3A 1UX6A 3LE0A 3MW4A 4XDOA 2JDMA 2Q30A 2YY1A 3PLQA 4NIAA 5EZWA 5IATA 4QPWA 1QWRA 1XOYA 1YYNA 2WAAA 4LLFA 4QB6A 2D6KA 1JZ2A 1DQ5A 4XXAA 1QJFA 1O91A 3H7JA 3MW2A 1KFXL 4RHV2 3PUHA 4E2QA 1VBD2 4CEWB 4FCAA 4YM3A 3TYJA 1JYXA 2WLPA 4DZGA 2GNMA 1MPXA 2ETEA 3HN3A 1QJX2 3RI9A 2J1VA 3SISA 4PI0A 3VZJA 1KD7A 1BJQA 3ABZA 3HVDA 1TMF3 2BW8A 5E16A 3H3UA 1NG0A 3ZSEA 1ZZBA 3VZLA 4KH9A 4AFMA 3K75B 2IFWA 1N1VA 3FL7A 4DMIA 4JZRA 4L99A 1DBNA 1B35A 3EQEA 1CAVB 2CTVA 3OGRA 3HMYA 3LWCA 3UETA 3BU0A 3H0OA 4LHNA 2OUJA 4NHMA 4E9KA 3TBDA 3CJIB 4KBZA 3B02A 3IAQA 1HRI1 2CWSA 1HLCA 4FQZA 3ZOIA 3K4ZA 1A8MA 1GP6A 4UFHA 3ACFA 3UGFA 1HIXA 3GCWA 5A3TA 4O65A 5JOYA 4RR3A 1EV11 1GQGA 1XE8A 3VKLA 2CAUA 1WUVA 3WHTA 4XC9A 5CISA 4JDNA 4R4XA 5FLIA 5JI7A 4Y22B 3N7MA 3O12A 2JENA 2ZOEB 4JV4A 4YZ2A 3IPVB 5EFUA 3SITA 1ZRFA 4KGQA 1OLMA 2WWJA 5FMOS 1QIQA 1W90A 1QJZA 5A6YA 3AVSA 5T52A 3AXEA 2X29A 1UY1A 4XCBA 4XIKA 1AXYA 5KXCA 1HKDA 5HV4A 2FDIA 1DP0A 3ZXLA 5KXEA 5CNAA 4QGLA 1CVNA 4N8MA 2AEZA 2DWRA 1CX1A 2DCYA 2KR2A 1AYM1 1N1YA 2GP3A 1IG3A 2AGSA 5FZ9A 3H7YA 3D0SA 2BVBA 1JHJA 3EJKA 4LXLA 4QX5A 2VOKA 1D4M1 1F4HA 4CCNA 2C6SA 5J7MA 1OLRA 5CB7A 1FT9A 4A3XA 2PQQA 4M4RA 4OZXA 1SEFA 3VZNA 2RR13 1UU4A 3KQRA 4QPIB 1W6OB 2OS2A 4NIGA 1Q8QA 5FJKA 2B39A 2HWC2 4LHSA 4HKOA 3RJ2X 3WF3A 5AVPA 1XQNA 2VXJA 3WW1A 1LOGA 4FAGA 1LHNA 2MPFA 1SCRA 3INAA 5DG1A 1UZ0A 5BNNC 1G9DA 4XEZA 4OHXA 1B35C 1YFYA 2Y0IA 3ECQA 4QPGB 4TYSA 4XF0A 5C7GA 5LWBA 1O3TA 4AI0A 2VE1A 5EHDA 4GMP3 4YW5A 5CVRA 3KCXA 4E4HA 1ZZCA 2I74A 5FPUA 3A7QA 1CIYA 3E1F1 4GAZA 3SMHA 4Q4Y3 4CU9A 1JYIA 1OVPA 2VY0A 3T2QA 2JB8A 3G7DA 4N43A 3LEKA 2XGXA 2AYHA 3KCYA 2VBPA 1P8JA 3NNJA 1S2KA 5FZ1A 5GZFA 3THPA 1QY4A 2GALA 2X5IB 2J1TA 1VB4A 1KS5A 1XRUA 4QQ2A 4PHZA 1DQ0A 3NO8A 1TQ5A 1D7PM 5BNOB 2WC2A 3ZXKA 4AVSA 4CEWA 5A7NA 1JH5A 2FQPA 4URTA 4FPHA 4LLOA 4BCUA 4C90A 4MOAA 5CYYA 5FMCA 5L36A 3BIEA 1AYM3 1IS3A 1RUG2 1YIPA 4BH9A 1QJY1 2ZCWA 3RI8A 3WF4A 2DURA 4TZDA 4UYBA 1UAIA 3UKVA 2FBEA 4N90A 1BQPA 4XUTA 1RUH1 3IIIA 5FPVA 3R05A 3THDA 5CEHA 1BK1A 1ZNPA 3OUJA 5C5UA 2VZSA 2HWE2 1SPPB 2QFEA 2CV6A 1TNFA 2VZOA 2VZUA 4MADA 1VBE1 2D6PA 4Y1ZA 5HCFA 1SCSA 3RRDA 3ZIWA 4AI8A 5K9YA 1ND2A 5FP4A 2B8MA 4AR2A 1POV3 5FZOA 3S30A 3VBUB 3VL8A 2JKXA 4NUBA 3GXUA 4K8FA 5F6KA 4AEDC 4EWEA 4FTBA 5K0UA 1RUE2 4XF3A 1AR93 2G1MA 4KNCA 3BYWA 4K20A 5DZFA 3VZMA 5F37A 1MVEA 4EE2A 4XJ9A 1LU1A 1JYCA 4RFRB 3SCFA 1O8SA 2JG9B 1M06G 3K4AA 4QX3A 4ASKA 1VB2A 3PVOA 3WNPA 1U5XA 3RZKA 4CCDA 5D8AA 4N43C 3GBWA 3M70A 4IEOA 2E51A 4BQXA 4SBVA 3UJQA 1H1MA 3DV8A 2F4PA 4O61A 4XABA 2W1WA 3FUQA 2VUAA 4YVWA 2WN3A 5FZFA 3Q8AA 4JVAA 4RGAA 4DXTA 1PO21 3BTAA 4Y20B 3E5QA 3O1TA 3LPGA 2HWD3 1W06A 1BVVA 1S2BA 1DYOA 3M3EA 3CKHA 1OA4A 4CEWC 3LFMA 4P9LA 5FZIA 3R0RA 5L73A 2JJ6A 4FFFA 4YVSB 3LAGA 3O1UA 2WSUA 2J1EA 2ENRA 2JX9A 4WZFA 1IZ3A 5JWPA 2DVBA 5HPOA 1KDMA 5LA9A 4K6BA 4NHXA 5FTTC 1GZWA 1V9U1 4L0PA 4UFJA 1AX1A 3AP7A 4UW4A 4E2SA 1COV2 2D7FA 2QDNA 2QQUA 1JU4A 4QPGA 1ULGA 2X53S 2IVIB 2A6XA 1CD3G 2C0ZA 2LTNA 2ZPXA 3VV1A 2XUMA 3ZFGA 5LY1A 2VBDA 2VZQA 1GFF2 3CJIC 4CYDA 1UX7A 2VOVA 5E1RA 5J1XA 1RTVA 1LKNA 2R1DA 2RMU3 3OY8B 3RPQA 2GH2A 4NPLA 4NROA 3ZFEA 3ZYJB 5DZEA 5F39A 2VW1A 4MVTA 4CP9A 2R30A 2EXKA 1S0JA 5FXXA 3U10A 2OXBA 4KWLA 3PUSA 4KMQA 4CDUA 5CA6A 3SC7X 5K0UC 1ULEA 1PMIA 4MV2A 5FZ3A 2ZGNA 3JQWA 1WMXA 2ZZJA 5FR3A 4XFAA 3M2MA 3O7OA 4EJRA 4TLGA 3LA3A 1OC1A 2TEPA 4KU7A 5FPLA 1HB2A 5IVYA 5FYSA 3W5MA 4UWDA 1OF3A 4JRAA 2K46A 3W59A 4AEMA 1OT5A 4GB33 5D8AC 3LSEA 3D3AA 4Q4W2 2J22A 5AC93 2GH8A 2W9XA 4XYXA 5JIAA 2CHHA 4YVWC 5JLVA 3OPWA 4HBNA 2DDUA 1E5SA 2JD9A 3FBYA 4GZ9A 4W6XA 3ILRA 1OH3A 3IDEA 3TN93 1FI2A 2HEVF 1UY4A 1SPPA 3B01A 5FQ0B 5IHRA 4Z92B 1F8VA 5L7OA 1T6GC 1Y7BA 1W9SA 2DV9A 4JGYA 1Z0HA 2OT7A 3PVEA 3IDCB 4HKWA 3AMNA 4I09A 4MGKE 5DUVA 5FV3A 1O3SA 4AW7A 3NVCA 3W21A 4FPYA 2ET7A 4QPIC 4CCMA 2FCUA 4SLIA 1LODA 2VGDA 4PBOA 1H2LA 2VZVA 1AVBA 1JXNA 3POGA 4OI1A 1UY0A 4XF9A 4CUCA 2GP5A 3DXUA 4JC1A 1IGOA 2VVFA 1BMV2 4A44A 4NHYA 5DUUA 5JOWA 4QPGC 1NZIA 4M0HA 4G9SB 4NOTA 4B7KA 5HCAA 1FMD2 1Y9GA 2R041 1VRH1 1W8WA 3QLQA 4XBQA 5FYUA 4E4ZA 5FXVA 1QDCA 2JDAA 1DQ4A 4IEWA 1ZZ7A 1U0AA 2WNVB 3A0KA 5FXWA 1ONAA 5A7WB 1O5UA 2WO7A 2ZEXA 4JHZA 2NLRA 4QHZA 5KHKA 4GD4A 4CUGA 2YGLA 1NKGA 3KLSA 5ISLA 1OI6A 2PN5A 1X36A 3SKVA 2N7GA 1EAH3 2RM23 1XNAA 4ZS3A 1S0EA 1LOFA 1JOBA 2XJSA 3POEA 2NMNA 1W05A 4S2FA 5DDJ3 1BLZA 3USUB 5BNOC 3N7LA 2DVAA 3T0DA 5F3IA 1C8M3 1MVQA 3ZN6A 1Z7S1 4NR1A 4YVSA 1OH4A 3BN6A 3P5BA 5FZKA 3L2YA 2XH6A 2NQYA 3O5SA 4Q4Y2 4QKFA 2BFUL 5KC5A 1MACA 1AX0A 1LR5A 1W9TA 5EP9A 1NT0A 1SFPA 1VMHA 1PNGA 2O1QA 4OUSA 4LORA 4RGGA 2W0XA 4DO0A 2EIEA 3POIA 4OLLA 4FOYA 1LHUA 1RHI3 2OVUA 3WDXA 3R4DB 1SLLA 2K0GA 3ZXJA 5A3PA 2GNDA 3OBZA 3NMBA 2HH9A 2XL7A 4KWUA 5L9RA 2LS6A 3P3NA 5F8PA 3ORJA 5L7OC 5FWEA 2W39A 2BNOA 3DYMA 3IBMA 5KHHA 4IV3A 4LTAA 1JZ7A 3ZYFA 3VBUC 1GBGA 4A6OA 1FNYA 2BP6A 1N3QA 4XJ8A 2V09A 4MSVA 1JZ6A 3VHOA 2BGOA 4OHVA 4JKLA 1UNBA 3TAYA 1QXRA 5T5PA 4AF9A 2YFZA 1ZVFA 4ZZ8A 1ENSA 3FHAA 4CCCA 2Z69A 2BDRA 2OUHA 3K3NA 3VHPA 4QXHA 5JZGA 4OHYA 2HWF1 3GZAA 2BOIA 2OPWA 2PTMA 3VBOB 4YW1A 3BOPA 4CA9A 4GWJA 2W3JA 1RGSA 1W2TA 1S0CA 1PK6A 2ARXA 3JXSA 3SEPA 2QVSB 2J1RA 5FY1A 2ZABA 3M1HA 4IXLA 1SBEA 2DYCA 4JHTA 1UXZA 1V70A 4RS5A 2BVVA 2E53A 3ZFFB 2F4LA 2R071 2YROA 2XVLA 1LOFC 1NCRB 3I2GA 4NJ4A 1CAWA 2WQ8A 3I2KA 1HRV3 4YZ4A 3U1XA 1RL3A 4B4RA 2WNOA 1LRHA 2H6BA 2HJIA 4YPJA 2G9GA 4YVSC 1AJOA 3SHRA 2BWCA 5T50A 4C8DA 3VLBB 4XACA 2BUKA 2WT1A 5GLTA 4IQPA 2NP0A 2G4IA 1PMHX 1VBD1 2D6OX 1BEV3 1S1AA 1OLQA 1AX2A 1F4AA 3AYDA 2OYZA 3VZKA 2ZGMA 1TG7A 4YW4A 1DGRA 5F5IA 5C3PA 3J8F3 4RFT0 1X8MA 5KWRA 3RZHA 2WNVA 1YIFA 2ZKLA 3ZYIB 4IV3C 4ES8A 3MEPA 4JRLA 3WNLA 1SMVA 1V6NA 3N9NA 4V2WA 2Q1MA 3FWEA 3K77A 4UI9L 3UGGA 1W6QA 4X8PA 2WZR1 5FBJA 1PGL2 5FPAA 3E6DA 1BKZA 4XQWA 2BNNA 1ZREA 1J3RA 3IM0A 2MEV1 4QQHA 3OBAA 4XMAA 2Y6JA 3POFA 3THTA 2Q8OA 4LBQB 4DUXA 2Y6FA 1UKRA 3SH5A 4YW3A 4XFHA 5FP8A 4AHYA 1RVF3 2CGOA 3KD4A 5EWSA 3THCA 2LM3A 2VECA 1JYNA 1ZBA1 2RMU2 2RS12 1EP0A 2P17A 5FXZA 3WQ1A 1YUDA 2VAUA 1I9RA 2RS53 5DMYA 4DXZA 1D4VB 3BTXA 1RINA 4XUOA 3I3MA 1OBNA 4OZOA 3WY6A 3J7HA 4AFBA 1PZ7A 5CKMA 2JKBA 2YHJA 3C7GA 2AZ5A 3NJXA 4AI1A 1B09A 3MIGA 1TME2 1QJU3 1PZ9A 1NA1A 1W6PB 1RC6A 4ZU5A 1O4ZA 1CESA 4DB5A 4LPLA 4CDQA 5F7UA 3K46A 3N9MA 3RMXA 4FQ4A 1BYHA 2PA7A 3QBQA 4OUMA 1SQ4A 2F6BA 1C1LA 2FDJA 1C1FA 2ZEYA 2CAVA 4GB32 3VKFC 4CP1A 2AENA 4NE9A 4FI9A 4DS0A 3OBTA 5AC92 1QNYA 1W8UA 1NE4A 1VBB3 3NW4A 4WBBA 4CDWB 1SLTA 4DUWA 1I5PA 4M3CA 2XJVA 2PHWA 5FZCA 5BY5A 4CXYA 3OD0A 5FPBA 2W68A 1V6MA 2VM9A 3GBGA 5J09A 3NNFA 2PLV1 1XBFA 2YFUA 2WNVC 2Y26A 4HONA 3WW2A 4QDRA 3NJVA 4CDXB 5FY5A 5FMDA 3MIDA 1K5JA 1F5FA 4J1XA 1MS0A 3DXTA 3EB7A 5TSWA 1O59A 1WWYA 1W9FA 1W8ZA 2ZEWA 4F8AA 2IZWA 2ZHKA 1YJKA 1RUI3 4XIOA 3BIWE 4BMEA 4CEYA 5C8CA 3T4VA 4L2NA 1GZCA 1NCRA 3PVNA 3V64A 5GLUA 4V1PA 1AYN3 1BK0A 1W3VA 2VPVA 4OI0A 1MZFA 5JAXA 5LY2A 1HXS2 4D7YA 1POQA 5BNPB 3GHMA 1AR71 1UOGA 2PHTA 3VBHB 3B00A 2YPDA 2P5BA 2GMEA 1UU5A 1D0HA 3ZYGA 3W58A 1OOPA 2XBO3 2WS93 3OJBA 1NYWA 1LEMA 5FYVA 2VL4A 2VR4A 5KXBA 3POWA 2ZMNA 5JR2A 1CWPA 3BUCA 1EAH2 5FZAA 4I0AA 3E6BA 2QQKA 1VALA 2VOWA 4JQRA 1NA1C 4WM7A 2PELA 5IK5A 5DDJ2 3CU7A 1MS4A 1RUF2 4LKEA 4CU7A 1GU3A 4CDQC 1C8M2 1RUJ3 1FOD3 1VPHA 1XYNA 4TTGA 4I0WB 5FYZA 1GANA 4FPEA 4E2GA 4B4PA 5A33A 5IVJA 1R091 5GLZA 4TWTA 5KHIA 2PLV3 3MYXA 5IYYA 2E26A 4BZ4A 2A70A 1RHI2 3WUCA 3TRSB 3J26N 1JN2P 5KHGA 1WCQA 1WW6A 1W2OA 1YWKA 4MGSA 1XE0A 1RUE1 2I07B 5A7QA 3WUDA 2OQ6A 4R9AA 5I0SA 3OUIA 3ZYHA 4NWVA 4PCRA 4BDVB 5JUVA 2ZZQA 3VL9A 1PVC3 1YLLA 4K7JA 3H42B 1Q8PA 2QZ3A 4HETA 5C5TA 1IPJA 3AL5A 4ORFA 1AR73 4RR3B 5I0UA 4CEYC 2VMEA 1KDKA 5FO8B 2YC2A 3ZFFC 1K42A 1K12A 3U4SA 4Q26A 2E7QA 1NCRC 1DGWX 2W52A 3D8CA 4ZU4A 5JDBA 1XYPA 1UMIA 3GBFA 2XB6C 3JQXA 4JQTA 1RUC1 1FPN1 4OULA 1XJAA 2FHRA 5LBBA 4AI2A 4NRPA 4CU6A 3TNQA 4Q0VA 5KXDA 2D6NA 1QKQA 2XJPA 2EICA 2PHXA 3V0BA 4MXWA 1YQ2A 1PO13 2YZ4A 4AXOA 4CTEA 1OOPC 2A73B 4EROA 3KT1A 2D6LX 2NZ9A 1J1TA 1GUIA 4FPOB 3AMQA 4N9IA 3M8LA 3N9OA 1WCDJ 1ASJ2 1BCXA 1UKGA 3ITQA 4Y5SA 1W8TA 4C1XA 3LIGA 1WLCA 1HRV2 1JMUB 1COV1 1PIV2 3IDAA 4I30A 4Q4V1 4P9GA 3K51A 4QT6A 4I01A 2CGNA 3AZXA 1HN0A 4PDWA 5JMOA 2PHFA 1URXA 2XR4A 2BERA 1ULCA 1WLDA 1VE0A 1LGCA 2XHKA 1QOSA 3O1RA 1JZ3A 4IE0A 4Y26A 1C4RA 1ULOA 2DCTA 5CG8A 1UZYA 2QKDA 1HJGA 1T6BX 3HNMA 1OLME 1NUKA 2HEWF 1ST8A 3CO2A 4MYEA 5GZDA 1RIRA 4QM9A 3KZ4C 3JD73 4AI3A 5L9VA 4N43B 3C8XA 3R4UA 3UK9A 5F2WA 2WZPP 4CUAA 1AL21 1DGWA 4N9HA 4ZKTB 3QH6A 4CPBD 5FLJA 4JDMA 4X6RB 2D3RA 1IKQA 2I2SA 1AR61 3Q9OA 3E97A 4GKXA 2ZA9A 1WW7A 3MHZA 2W1SA 4Q4W1 4ARXA 4XILA 2W08A 5T5JA 1GICA 4H55A 3MF9A 4K9SA 4EWAA 1UCXA 3BVCA 3GZEA 4LIUA 4LEJA 1REFA 1UIJA 3EYPA 3MIEA 4HK9A 3LOBA 4FTSA 1QMJA 2FZ1A 5G05L 4JX0A 2IC1A 3ROUA 1RVF2 3HEIA 4ISRA 2AUYA 2BEOA 4LHLA 1JZ4A 2ZXQA 1RMU3 1WCUA 3OEAA 2Y34A 1US2A 1X9TA 2DU1A 2RS52 5FK8A 3ILNA 5B4XA 5A7OA 3BI3A 3W9AA 3Q8CA 1TZOA 1IS4A 4CDWC 5EYXA 4BIFA 2DTWA 2ORZA 4Q0SA 5GKAC 1W8FA 2I45A 2QTWB 1QJU2 2EXJA 1M4WA 2RJKA 4GH4A 5FBZA 2XONA 1VRBA 1VBC3 1VBA3 1BMV1 3OF1A 3ZR6A 3WX5A 4AGGA 1ND2B 4CDXC 1U5IA 3D82A 3ZMOA 1FMD1 4S2HA 1G7YA 2P6HA 2WFF2 5FZOB 4Y1VA 5LBFA 4LO8A 1FAYA 2D97A 5FO9B 4YG3A 5HCBA 4XFBA 3O1OA 3LIHA 5CKQA 5K0UB 1XNDA 2X8KA 1VBB2 5DABA 1UOFA 5IK8A 1V6IA 4CCLA 3I3EA 4UBGA 2ZX1A 1UW8A 3N9PA 1H1IA 2EAAA 1IHMA 4XVHA 4AFAA 5BNPC 5JIUA 4P14A 3HBKA 2RJLA 2D3PA 3VBHC 4A2UA 3H8UA 3K3OA 2C24A 5D8AB 4FFGA 3JBG2 1DLLA 2Q8CA 2KXLA 5HXMA 2R49A 3PDQA 4NAOA 2A1XA 4XJAA 1L7QA 2XWJB 3MIFA 4LBOA 3PU3A 4YVWB 3T1MA 3O14A 5GZGA 1JOJA 2WAOA 3BALA 4UW5A 2UYAA 2A3YA 4HVOA 4MGTA 5T5OA 1H8TA 2A7AA 3I2JA 1AYN2 5FZDA 1XYOA 3I2HA 3IMNA 3TEXA 1XSQA 1OD5A 4I3PA 2FDHA 2JDNA 2D43A 2SLIA 4IEQA 4LBQD 3GGLA 5FMBA 2GN3A 2WWSA 4MGYE 5FFOC 1BHGA 4UBHA 2WFPA 2P2KA 1GZWB 1VP6A 2VNRA 2YYOA 3AKRA 2JDYA 4RQPA 4BK5A 1HRI3 2EA7A 2H6CA 1LHOA 4FPFA 3ACHA 4HFSA 4XCAA 1W2UA 4B1LA 1ULPA 4UFIA 2YBPA 4P02B 4CE8A 1W8OA 1PZ8A 2VVDA 4GJZA 3IAPA 4QMAA 3RMYA 1OKOA 3S7IA 3ZFGB 3MO4A 3FZ3A 2NYYA 1EV13 1O4YA 2P37A 5KHJA 3VKNA 3Q8BA 4E8DA 4D3WA 2W46A 4LUKA 3ZFEB 1UYXA 2VMFA 4CP9B 3ACGA 3R4SA 4HT1T 3UKTA 3TEZA 3OYWA 2D5HA 2ARCA 3ACLA 3SCGA 5A32A 5LEJA 2D93A 1ODNA 1PGW1 3NJZA 4RR3C 4M01A 2W1UA 5CZKA 3WNOA 4CDUB 5CADA 5CFCA 3PHMA 5LATA 1MEC1 3B3QE 4OFGA 2PHRA 3NL1A 1ENRA 2LRPA 3N9LA 1R1A1 4BLJA 4AVBA 4CZSA 3AYCA 3VGIA 2YBSA 1HDKA 4KWKA 5IAXA 2B7YA 2ZACA 1F2NA 2YC0A 3I2DA 4IEXA 4E27A 3T0BA 2GC1A 1D4M3 5C3RA 3EMRA 2VOXA 2OZ6A 4D7TA 1BBT1 3ZSJA 4LK7A 1S0FA 3HD8B 4IW3A 4TN7A 4XQ4A 4Q5OA 2VW2A 4BM8A 2XWBB 4IE7A 4AE2A 3AKQA 3HOBA 4QU1A 5EIYB 1H8TC 1HJFA 1QHDA 1IS6A 2GMMA 1XNKA 2P3IA 5L7OB 1UU6A 4CCOA 5K7PA 1V6JA 4JGYB 3V0AA 1O3QA 2QDRA 4Q1PA 4C0HA 4EN9B 1NY72 2XL9A 3ACIA 1ZBE2 1F15A 2Z4FA 4AVTA 3N4MA 4BE3A 2Y38A 3Q8FA 5A3MA 3AMMA 4DOUA 3H8RA 5DAQA 4RQPC 3POYA 4BXFA 5T55A 4L11A 1RXFA 4FP3A 4RYDA 5I93A 3UGHA 3TB0A 4G4FA 2E32A 2VZ1A 3ZXFA 1NCQA 5JXJA 3I59A 1PGL1 1REEA 5J98B 1N3OA 3NKTA 3AFGA 1OA3A 3RWNA 1XC6A 2YMZA 2IVJA 2Y6GA 1UY2A 3KF5A 4K1ZA 3ES1A 3ZN5A 2A75A 3PTRB 3VBRA 4EN7B 4Z8BA 4W8JA 1NOVA 2DF7A 5FOJB 2RS11 3HIFA 2Q8EA 1HQLA 3MIBA 4P9XA 4OUEA 3SH3A 1QJY3 2JDKA 5FYTA 3RZLA 3WCRA 1Y4WA 4QQPA 3ATGA 2YG0A 5H9QA 3ZDVA 3ZN6B 2BGPA 3OOXA 1RUH3 4DFSA 4QU2A 2ARBA 3J4UH 1R081 1TME1 1XSRA 2CU5A 3AZYA 3PUIA 3H9AA 2VMCA 5A3UA 3A4UA 2HWB2 3JU9A 1VBE3 1MR5A 5HI0A 1RJ7A 3OCPA 4UF0A 4D7SA 5BUVA 4L92A 1A34A 2C9AA 3HQRA 3I49A 2EAKA 1ZZ8A 3E5UA 3CMGA 2BNMA 1H4HA 3KV5A 4A6SA 1RUOA 2VMHA 4COVA 2FZ2A 3GM8A 5IAVA 2WO2A 2D44A 4O9GA 1OQ1A 1RITA 1KITA 1ND2C 1Z78A 3IIAA 5I91A 4WVMA 5DPNA 3TEWA 4IV3B 4LK6A 5CFDB 1QQP1 4WZCA 1LOBA 2VVEA 4LKDA 4Q4X1 5FZ0A 4CP2A 2CGPA 2AREA 1TMF2 4R9BA 5AVAA 5JOZA 1RUD1 1RMU2 4MX3A 4Q0QA 1W8HA 1LECA 3LEIA 1GOFA 3CZJA 5LRRA 1W0NA 1AF9A 2HBUA 1EPZA 4XE9A 3UKNA 1NCQC 5FKBA 2P3JA 4EV0A 3KHCA 3WLUA 4U36A 2Q0AA 1Q8SA 1VR3A 5JZGB 1FX5A 3GZUC 1PO23 1VBA2 1YRZA 3WG4A 4O9EA 3ZXAC 1WGPA 4LBNA 4BYYA 1GWLA 4IE6A 1HXS1 1PK6B 4AEJA 4QPYA 4U2AA 2FD8A 1ZA7A 2JDHA 4MHRA 4GALA 3J7MA 2QQWA 3N7JA 4RS5B 2FMYA 1R083 4JTOA 5BPXA 3O1MA 1V9U3 1CAWB 4DXSA 1GV9A 5B4NA 1H2KA 1H8VA 2FDGA 1S0BA 4NWWA 2OX0A 3U78A 2VZTA 2V4AA 4Y1UA 4BQ2A 4M3CF 4Q2FA 1V00A 1O4TA 2Y0OA 3OUHA 3MUY1 2P1BA 3O1PA 4DUVA 4FTEA 1OFSA 1TVGA 2ZAAA 3JB8A 5HXVA 5LCWL 5ERLA 5CG9A 3I2OA 1RJ8A 1D2SA 5EYYA 1RUF1 4CVUA 5LZ6A 3HR9A 3M3OA 2O0OA 3ASIA 4AAXA 1BVP1 1UQXA 3N9QA 3X29B 5D1IA 1F9KA 5FUNA 4BMBA 3AC0A 2Y8KA 3ZFGC 1OXCA 2G19A 1REDA 3WQBA 2Q5TA 4RN5A 1X82A 2ZBJA 2IUWA 4C0BA 5C4WA 2V5DA 1FYUA 3ZPYA 3O1SA 2VJXA 3ZFEC 4FPJA 1ZYBA 1QOTA 1YQ6A 2BOJA 2R061 2VTXA 3CL1A 2RR12 3P1IA 4NIIA 4URAA 3BKZA 4B8EA 5JPNB 1FNZA 3I2FA 1W6NA 1W6QB 4RL7A 3OGJA 3WDYA 3ZLIA 4CDUC 4IE4A 1JU3A 3MIHA 4LUMA 1HRI2 5C9AA 5CIRA 1PHMA 3T2TA 3POBA 3QCWA 4QQLA 3IDBB 5CBLA 2ES3A 2Z42A 4BB3A 4LKFA 5C70A 1QF3A 4PT6A 1V6KA 3B94A 3IB3A 3LD8A 3ES4A 3PUAA 1SLCA 2GC2A 2CY6A 4Z07A 1AR81 4DPNA 3BCWA 2HKXA 4GJYA 2WWUA 5IFPA 1OURA 3D5OA 3SEEA 2Z2SB 4HPKA 4ZONA 4L9BA 4OQ8A 1X50A 1CZSA 1VIWB 5ACA3 2J1AA 4RD7A 1VMJA 1GNZA 3QACA 5DAXA 2WDBA 4FBFA 5A6XA 2JDZA 1H2MA 1N1SA 1GQHA 1HW5A 1Q56A 3AK0A 4KGGA 2XLGA 1RB8G 4XUQA 1NA1B 1CQ9A 2YB7A 4Q0UA 1OMIA 1LJ7A 1CN1A 4JGYC 1DDLA 4CDQB 2VQAA 1AXKA 1UYZA 2RS31 1JUIA 5CFDA 4CRQA 1WCSA 1ASJ1 1AYM2 4JCKA 2R043 2QQPA 1VRH3 4INDA 1WKYA 1SBDA 1ZRCA 1PIV1 4GWNA 4QX1A 4XOGA 1KS4A 3RYKA 1MZ6A 5F5CA 5E89A 2ZX2A 4MXVA 1GOHA 2NMOA 3RZMA 4M3CB 3WD5A 1YHFA 3RQ0A 1ALYA 1EPWA 3CJXA 2Q8DA 2SBAA 1ODMA 5FP9A 4ATFA 5C4WC 2QE3A 4MHUA 1G9BA 2O8OA 2VZ3A 3NWKA 4WVVA 3OD4A 2ZGRA 1HV0A 1JW6A 2VNGA 5FYBA 4XQDA 2HEYF 1Z7S3 2ZGPA 5LK7B 1CAUA 5FYIA 4CEYB 1OVSA 5C8CB 1DQ1A 4Q8KA 1A6CA 3MUZ1 3V65A 2WNUA 1AR92 2WZ8A 2VUDA 2ZJCA 4DNYA 1CGPA 1KQRA 5ANNA 4AQ6A 2HLEA 4QXKA 1NLSA 1OA2A 3ZO0B 2WKKA 1WW5A 2IXKA 3CLPA 2VMGA 2GU9A 3H3ZA 1XPWA 2XG3A 2YBKA 2R1BA 2WJSA 3J7NA 1NAEA 3UJOA 2WT0A 3AM2A 4KL1A 4RHV1 4UXAA 1ENQA 4QQOA 3VHNA 2VQTA 1OOPB 3WNMA 2WNEA 1IPSA 2TNFA 4CSWA
chains in the Genus database with same CATH topology
5ABJA 1QJX1 1YI7A 2VG9A 3LB9A 3FX3A 3BODA 4KQ7A 1JHNA 4M3CE 5JPMB 4Q29A 2DCKA 2HWD2 3AMHA 3P3PA 4WM7B 3U4XA 3WVJA 1LU2A 2B46X 5GM0A 3CEWA 3WXPA 3HWJA 5CFDC 5BV6A 4IEUA 1F31A 4A7KA 1MS9A 3B69A 4YGEA 2ZGKA 5A33B 2HWF3 2QUOA 1VBE2 1SFNA 1C57A 4XFCA 2WFF1 2H0BA 3I8TA 2XLAA 3RNSA 3LA2A 2JE7A 4LHKA 4M00A 1J59A 2ZGLA 5JZGC 2R073 4ITCA 2YGMA 4B7EA 1PK6C 5J48A 1MS5A 2WSVA 1QNWA 3BPZA 3ZMNA 4YGDA 5JMCA 3BB6A 4RS5C 3LA7A 3JBG1 1WD4A 2V5YA 4PIXA 1MZ5A 5I0TA 1CAXB 1VBD3 2RE9A 5CAZA 4N7UA 3FHIB 3WDUA 3VBFA 3PJYA 4RSUA 1PO22 4ES9A 3V0BB 4MXWB 5GZCA 2ZGUA 1CPNA 5FAXA 1GLHA 3FLPA 4MGIE 5ABJC 3VBSA 2VULA 4GWMA 4IEPA 5K8SA 1C8NA 2HWC1 3AZZA 3C2UA 3TN92 2ZAHA 3RG0A 3APBA 1APNA 2WZR3 1V9U2 4XTPA 5FMOL 1Y9QA 2EVXA 2XLFA 3I54A 2MEV3 3NAPA 1UMZA 5JVVA 1U12A 2JG8A 2VXRA 4PDWB 1WMEA 1ULDA 4F3JA 1DHKB 1ZBA3 2VW0A 4QGMA 2BPA2 5J96B 2Q4SA 3WT3A 5AFEA 1S0GA 1R1ZA 3PMEA 4HVRA 4BQ1A 2WQZC 2GSYA 3AKSA 4TLFA 5IK7A 4KU8A 4NPRA 1LEDA 1NQDA 3LOIA 1GYKA 1HV1A 3NSTA 4Y1YA 3MGUA 2UY9A 4RA0A 1OPOA 1WCKA 4D69A 1RUG1 3CNAA 4LA2A 2RM22 5A3LA 1I5ZA 3WINE 2DFBA 1KRIA 3PJQA 4B29A 1KXGA 5SV8A 2XJTA 3FFQA 1BZWA 4HN1A 1J3QA 4META 4Q27A 4AYUA 4YNIA 3H1WA 2HWE1 4JGZA 5I0RA 2K9ZA 4KG0A 1V6LA 4YSFA 4IETA 4HMZA 1NY71 4NHKA 3ZIXA 3VBSC 1ZBE1 4YM2A 2A6ZA 4LO6B 2DCJA 3ETQA 2WA3A 4GH4B 1LOEA 5JSOA 3PMSA 4R9DA 3CF6E 3NAPC 4KBBA 1PVXA 1YNAA 2JG8C 2UY8A 4XJWA 1VRH2 4H3WA 3ZSKA 1ZRRA 4AG4A 3UV9A 5C8CC 3OBRA 3WG3A 1DZQA 4IV1A 4ZU7A 1CAXA 5GALA 1W6MB 2DVGA 1G6NA 4Y5Z0 2YXSA 4DINB 1D2QA 4Y4YA 5DUWA 4DRRA 4LT5A 1YFXA 4K3UA 4YZ3A 2PAMA 1Z7S2 2UYBA 1I1EA 3J9SA 3MI8A 1OFNA 2D5FA 5SV5A 1CJPA 3SXWA 2HWB1 1H8TB 5T3NA 3WCSA 4WM7C 1R093 2OIIA 4BIOA 3AP6A 5FPXA 4LR4A 1AZDA 4M0NA 4JGZC 1NLRA 1LHWA 2P34A 3WNXA 1RUE3 2VNOA 2GAUA 4RQPB 2EXHA 3GF6A 1BEV2 5EJ3A 3U11A 4FPGA 4P9WA 2GNTA 2A5ZA 1TMF1 2OW4A 1QXJA 2PHDA 3J8F2 4LBMA 1IPKA 1S55A 2TUNA 5J3UA 1DIWA 1EYBA 5FO7B 2IXLA 1ND3B 4QGNA 1DGRN 3O0XA 3ZDSA 3MLKA 3MPBA 1AHSA 1RUC3 1FPN3 1MQTA 3EXUA 3OYWB 4NN0A 1HQWA 3A0NA 5A32B 2DUQA 2ET1A 3AKPA 5LK5A 4DY5A 4G3YC 3ZSMA 5DG2A 3BOWA 5CFCB 1F5JA 4MGZE 4COWA 3N35A 2WINB 2XJUA 2DU0A 1WMDA 1TE1B 4QHBA 5DUXA 4FPLA 4ISQA 3ZXEA 2GC3A 3FFZA 1DFQA 1TNRA 1COV3 1JUHA 4Q4V3 5IUQA 4CP0A 4AHXA 3GYDA 5F6LB 4OI2A 4PQ9A 3ZYRA 5J36A 4PF5A 3AP9A 4OHZA 4ASMB 4YM1A 5FCCA 2IXCA 1H30A 3V0AB 1DF0A 2ZMLA 1UPIA 2IXJA 3WG1A 4F83A 3JUUA 4PDWC 2ZGTA 1SBFA 4TSVA 2R6QA 5BNQA 2OA2A 3VDDA 4FOWA 4IL7A 5BNNA 1VAVA 4YRDA 3H1MA 2LUWA 3AB0A 2RR11 1AL23 4MUVA 1NCQB 4HKLA 1X8EA 3WV6A 4P9YA 3I59B 4N53A 1W6MA 1AR63 2WZR2 4EWDA 4YZ5A 4HSLA 3HQXA 1CX4A 1AXZA 2ERFA 3MLLA 2MEV2 4I0BA 4Q4W3 4GMP0 4H7MA 5FDBA 1ZRDA 3DPRA 4GMP1 1MQTC 3VBRB 5BXXA 2DUOA 1RUI2 4PBPA 4Q4Y1 2B9UA 4YW2A 5BYNA 5KC6A 1O7FA 4X6QB 4GULA 2PYTA 1ZBA2 1L3JA 4AFCA 3POSA 3NV1A 1LGNA 3AZWA 3VKMA 4KG8A 2XKPA 4J6GA 5F1RA 3ZVXA 4BLIA 3I7DA 3ST7A 1SDWA 3WZ1A 5JI9A 3KMHA 1DQ2A 2R0HA 3LKJA 1IOAA 2XBO2 2WS92 3AYAA 4NHLA 2GC0A 4FXGB 1FMD3 2LALA 3ENRA 2KM2A 3NV2A 4K21A 3B93A 3QH7A 4YG0A 3D4KA 4GH4C 1QH7A 4YZ1A 5GZEA 4EN8B 4LO5B 1ND3A 4MLOA 1RUJ2 2WA4A 1FOD2 4WVMB 4XJZA 2EXIA 3R6SA 1CIWA 2K2SA 4AEDA 5F9TA 2ZX4A 1POV0 1PM7A 4NO4A 1XNCA 3VDDC 4COUA 2PLV2 4C91A 5EXOA 5I8SA 3ZN4A 4BA6A 1POV1 1H4GA 4P9IA 1OPMA 1RUNA 2A3WA 4I3GA 4N53C 3S7EA 4XBNA 1W39A 1AR91 1UF2C 4ZXKA 5H9SA 4Z1VA 1PVC2 1H9WA 3MZHA 2B45X 3DPRC 3MPPG 3VKOA 1Y43B 4LNVA 2WT2A 3KS7A 5JCTA 2G9FA 4DY3A 4C1WA 1AR72 4JDOA 3WDVA 4GA9A 4R4ZA 4P9JA 1UN1A 3FUOA 2DCZA 3DN7A 4LA3A 3DKWA 1OKQA 5DZGA 4FPKA 1Q43A 3L2HA 2JEMA 2HWD1 4P5HA 2XJRA 1PO12 2C1FA 3EHKA 4W6WA 4XPVA 4GIQA 1CAVA 3VZOA 1IQAA 2O8QA 3KCCA 5FLHA 3ZYPA 3FLTA 3CJIA 4AEKA 1N47A 2D98A 1R092 5C4WB 4AVCA 4Q1RA 4AFDA 3M4FA 1ND3C 3AP5A 1MEC3 4XF1A 3H1YA 3PNAA 2ZGSA 3JZVA 4FT8A 1DG6A 3M7AA 1K5MB 1W6NB 3WOGA 1SLIA 5E8AA 1R1A3 3ZSLA 2RMU1 1SLAA 5C9AB 5CFCC 4Y22A 5FREA 4GXLA 5ACA1 2IWGB 3IPVA 3C3VA 5H9RA 3URFA 4XBLA 4XXPA 4IEYA 1BBT3 1DQ6A 3ZX7A 3WP5A 2TBVA 3WQ7A 2A6WA 4YFZA 4LO4B 3OGGA 3JD72 1X33A 4R8HA 4HPKB 3LZZA 1ZZ9A 4OHWA 4GKYA 3SCHA 1RUC2 1FPN2 2XVGA 1C5HA 2RHPA 5F5QA 5I8YA 3O0WA 1QU0A 5J37A 2DVFA 1C3HA 1VAKA 1FATA 3AP4A 1NZCA 1GR3A 4GB31 4XJUA 5AC91 1ZZ6A 3NV3A 3WP3A 2JD4A 4L8QA 4QPIA 2C5DA 1W6OA 2WQ4A 3AKTA 3TN91 4HVQA 1UZZA 3WDWA 1NQJA 3L9JT 1FV3A 1S0IA 2UU8A 5IK4A 4Q4V2 4B4QA 1DYPA 3JB4C 2NN8A 3JCIA 5I8TA 4Q8LA 1DYKA 1DZTA 4FP2A 1VBC2 1SACA 2RS13 2BBVA 5T54A 3HT1A 1H1AA 4PJYA 1V6OA 1ENXA 1MS3A 4ATEA 3RZZA 4A7ZA 3VBRC 4DRVA 2X5IA 3LCPA 1CAUB 1WMFA 1TME3 1XU1A 2VUJA 2WNUB 2UWCA 1IS5A 5BNOA 3VN4A 2P3KA 1TEIA 2GMPA 4XTMA 5L19A 1AL22 1N3PA 1DU3D 1EAH1 2RM21 1G8WA 3B7MA 1AR62 2JXAA 1AL0G 2ZTNA 4MZUA 4WV8A 5DDJ1 3IT8A 3UL2A 4HSJA 1C8M1 4YGBA 2D6MA 4COYA 5ABJB 4R52A 1J3PA 1QQP3 1LCLA 4Q4X3 1YI9A 5C6CA 4XFGA 4ONUA 1O3RA 1WLWA 1RUD3 1ULFA 2VQ0A 5AFBA 1SLBA 5JR7B 1RHI1 1W0PA 1LHVA 3VBUA 1MS1A 4QM8A 4LBKA 1UL9A 4WM8B 2ZX3A 1K5MA 4LBLA 2E9QA 3T1LA 3WP6A 1QGLA 3GALA 3N3HA 3WQ0A 1HXS3 2IXIA 3S0MA 3DF0A 3HAGA 2JG9A 4OVEA 2ZGQA 3AJYA 1EV12 2EIGA 2CL2A 3USSA 2UWBA 5C8WA 5JSRA 5FPZA 1GSLA 1J1LA 1N1TA 1Q8VA 3RSJA 2Q1ZB 2VMIA 2D40A 2BQPA 2X5IC 1LOAA 1UIKA 3KSCA 4Y20A 1EY2A 3AXDA 3MFAA 1I3HA 1J58A 1OHFA 1RUF3 4H7LA 4PLOA 2R16A 1D0GA 2R32A 1QH6A 3VBFB 2PFWA 4LO7A 1QDOA 2WLQA 2Z5WA 4PLNA 2JICA 1HRV1 1Q8OA 3N36A 1D4M2 4XFIA 4XW3A 4XF4A 1W0OA 4COZA 3GHNA 3VBSB 4BOWA 1XU2A 2R063 1YO8A 5IT6A 4S2DA 3D0JA 3ME2A 3AYEA 1BEV1 1KJLA 3OY8A 4AGVA 1ZA4A 3NAPB 5GLWA 4EN0A 4JTNA 2JG8B 4AQSA 3PTYA 5H9PA 1OQEA 2ZKNA 2WL1A 3J8F1 3KT7A 1K5MC 1G9FA 2B5HA 3M3IA 3E5XA 3NKGA 3WDTA 1AR83 4FVVA 4UW6A 4A7YA 5C9AC 1X7NA 1XNBA 2EF6A 5JOXA 4LE3A 4AGRA 3D6EA 4HANA 3MF6A 2CYFA 2V73A 2JG9C 1PGW2 3LSDA 1Q3EA 4D94A 2HYKA 4J1WA 1XE7A 2GN7A 4BHPA 1G9CA 4AVVA 1MEC2 3HT2A 4OI4A 2BGCA 4HL0A 1H2NA 4BPZA 2RS33 1RVF1 1WBLA 1R1A2 2JE9A 1ASJ3 4YM0A 1GKBA 5T5LA 3ALQA 3ZXGA 2AH2A 4XFFA 5FQ0A 2RS51 3VUOA 1QJY2 3LGRA 1PIV3 1A78A 1C28A 2E6VA 4S2GA 2UURA 3V56A 1E57A 1BBT2 1LTEA 1RUH2 2ZGOA 5LRSA 4PIZA 1QJU1 2DVDA 2QZ2A 4JGZB 4WM8A 1VLNA 1WD3A 4X8NA 4F7ZA 4XMIA 2ZMKA 5GLVA 1YCIA 4XETA 3FBMA 1GZ9A 1AUYA 4PLMA 3DGTA 4XHBA 2ZHMA 3AMPA 4FOVA 4DQAA 2DUPA 4HLTA 2BTVC 4Y1XA 3B9IA 1VBB1 3AJZA 2IFRA 2WIIB 2QNKA 4IERA 2OPKA 4AHWA 1Q5OA 4FXKB 5DXDA 1OSGA 5JSPA 2AR6A 1AJKA 1LULA 4K1YA 1JBCA 2WNUC 2Z79A 1H0BA 3QOPA 3WG2A 4H14A 3USUA 4IV1B 1QXPA 4RHV3 1MS8A 2XKOA 4R9CA 1DZRA 3N7KA 3E6CC 1QJX3 1RUI1 3MFCA 1UD1A 1YXWA 4Z2WA 3K48A 1AYN1 4I02A 4AQ2A 1WBFA 5C33A 2UWAA 2GNBA 1HX6A 1ZM1A 1GNHA 2JECA 2NM1A 3KT4A 4FPCA 4WVZA 3U07A 1G86A 3EBRA 1QOOA 1R082 1I6XA 3FLRA 1LENA 2H0VA 5E88A 1VJ2A 4W6YA 4YYOA 2XBO1 2WS91 1NXMA 3BU7A 2YDEA 3B9CA 3O0VA 3OTFA 4EN6B 2WFF3 4WM8C 2QJVA 2A71A 3HN1A 4LE4A 1FXZA 3U0ZA 1RUJ1 3SLIA 1FOD1 1XXNA 5FOBB 1ZX5A 1LGBA 2NPIA 4XZPA 5KBFA 1QQP2 2EALA 4Q4X2 2YPJA 2GZWA 1NE6A 1LESA 1RUD2 3ELNA 1DGLA 1JTZX 3AX4A 4GQ7A 3KGLA 3VBOA 5GJ6A 4I2OA 3JBG3 4NVPA 2KA3A 2ATFA 3FC0A 4AQTA 1MQTB 2MNGA 1WA4A 3H50A 3WP4A 2A6YA 3ZFFA 4XDQA 2MHFA 4AK3A 1KJRA 2PAEA 3MDPA 2DFCA 4KWJA 1PVC1 3HBZA 2QCSB 2ZX0A 3DUIA 4UW3A 4AHZA 4YFWA 4YGCA 2ILMA 4FOQA 3KGZA 2A3XA 4IEVA 1MZEA 3VBFC 3TWIA 4LBJA 3DL3A 2HWC3 4HN0A 4YARA 5CU1A 5FRAA 3MLJA 1PGSA 4L97A 3KB5A 4Z82A 1YFUA 5ACA2 2DTYA 3WR0A 3IN9A 2A6VA 1PO11 1CPMA 1C5IA 3AZVA 3IKWA 3SH4A 2IXHA 3S6PA 4HK8A 3IWZA 4XHXA 3NV4A 4E4SA 1OQDA 1O5LA 2BFUS 3RJRA 2PHUA 2R042 1CONA 2E63A 1G9AA 1NXD1 3RDIA 3TOJA 4WVWA 3GNEA 3SNMA 3VDDB 5BNNB 4W65A 4AVAA 4LBQA 2BWAA 1B35B 2E7AA 3VHRA 3MICA 2R062 4AWDA 1A3KA 4E4DX 1CJDA 4N53B 4HZFA 3TNPB 5LEKA 1RUG3 3GZTB 2B42B 1U5ZA 3VBOC 3WW4A 4K40A 3ZXDA 4Q0PA 1VAMA 2D3SA 1H9PA 3DPRB 4FO9A 1LB2A 2YV8A 3MW3A 1BXHA 3M3QA 3JD71 1SFYA 2HWE3 1AR82 2VH9A 4LULA 4YG6A 4ASLA 1W6PA 1S0DA 3FMGA 3WW3A 2E7TA