2LALA

Crystal structure determination and refinement at 2.3 angstroms resolution of the lentil lectin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
181
structure length
181
Chain Sequence
b'TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LENTIL LECTIN (ALPHA CHAIN)
publication title Structural analysis of two crystal forms of lentil lectin at 1.8 A resolution.
pubmed doi rcsb
source organism Lens culinaris
molecule tags Lectin
total genus 24
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2lalA00
4XHBA 2NP0A 2V5YA 4YW5A 1V6KA 2A71A 4U2AA 1MVEA 2DTYA 4XXAA 3U4XA 4YFZA 2P3KA 2CNAA 1LULA 2ZGPA 4PBOA 4FP3A 3FLPA 4BM8A 2PHUA 3VKOA 3V0AB 3AFKA 2ZACA 4M3CA 4XMIA 1DBNA 2ZHLA 3ZVXA 1DQ4A 4YZ1A 4Y1VA 2W08A 2D44A 1GZWB 1SLAA 4WV8A 2ZHNA 3ZSMA 3POSA 4Y1UA 2PHFA 4FPHA 4TZDA 1Y7BA 1O4YA 4FPEA 1LEMA 1H9WA 3WDWA 1ENSA 2WLQA 3W58A 4C1WA 4NOTA 2R0HA 1SBDA 3KM5A 1ULFA 1SFYA 2AH2A 1DZQA 3V0AA 4P9XA 1FATA 2YROA 3OYWB 5H9RA 1MACA 1WW5A 4ASMB 4K1YA 3RG0A 3ZSJA 2UWBA 4R9BA 1LOCA 1JUIA 1AX1A 1UZZA 2DUQA 3R4SA 1S0CA 2ZGLA 4ITCA 2C5DA 3WLUA 1GZWA 4K20A 1GBGA 2DUOA 3APBA 1FNYA 3OJBA 2DWRA 1A78A 4YZ3A 3N7JA 1N1YA 5DUUA 1X50A 3M1HA 3FFZA 2D6NA 4FVVA 2GN7A 1G9CA 1WCSA 2EF6A 5CAZA 3LCPA 4PBPA 1OKQA 3BTAA 1LOEA 1SLLA 2JE7A 3T1MA 2DVDA 1IS6A 3VV1A 4M3CE 1Z78A 1MS0A 3HN1A 4FPCA 4HL0A 3OYWA 1I3HA 3JUUA 2KM2A 3MEPA 1IOAA 2WSVA 2EXJA 1SLTA 4BLJA 3AJYA 3OY8B 1NLSA 2Q5TA 3DUIA 3SH5A 1W0PA 5GM0A 1CPMA 1Q8VA 4Y1ZA 4BLIA 2EALA 3AP4A 1S1AA 1KJRA 1WLWA 2VW0A 3SISA 3GNEA 1UZYA 2OUHA 2DU0A 3ZSKA 1KDKA 3O5SA 4FOWA 2ZBJA 2A6VA 4Q8LA 5IK5A 4FOQA 2NMOA 4ZXKA 1N47A 1QDCA 3T1LA 2UWCA 2JJ6A 1ULDA 3WUCA 1W6NA 2GN3A 3OY8A 1S0IA 3NV2A 5JMCA 1VAVA 2SBAA 2EXHA 2JDZA 2ZGUA 4U36A 4YM1A 2I2SA 3HR9A 1BQPA 1G7YA 3WG2A 2ARBA 1YI7A 4XJ8A 4BPZA 1UAIA 2WT0A 3ASIA 3OBRA 4UW5A 4Y20B 2C9AA 2VW2A 3BOPA 5GZEA 1DGLA 1GYKA 5GLTA 2EXKA 2WQZC 3POWA 4LBKA 1AXZA 1BYHA 3ZXJA 2ZGKA 1QNWA 2CTVA 1LHWA 4H55A 3IPVB 3RRDA 1G9AA 4FOYA 5CB7A 2OVUA 1DQ2A 1VAMA 2PHWA 5SV8A 4KBBA 1V6NA 4RA0A 2DYCA 1HDKA 1URXA 3RSJA 4BOWA 2P37A 1LOGA 1QDOA 2W52A 1G9FA 4Y24A 2D43A 4R9CA 1CIWA 4XILA 5DG1A 4Y20A 5BYNA 4Y1XA 4FPLA 2HYKA 2ZAAA 1MZ6A 5GLWA 1LESA 1D0HA 4AYUA 2ZGSA 2ENRA 3WCSA 1MS3A 3IPVA 1S0GA 4WVVA 3UK9A 3FUQA 1A8DA 2UURA 3WG1A 4F83A 2ZMKA 1DIWA 1YIFA 1AJKA 1DQ5A 2AREA 2ZHKA 4GWNA 3ATGA 3AP6A 4M3CF 4YW1A 3ZXLA 2YY1A 1LHOA 2ZGTA 1LOFA 2OW4A 1N3PA 3AXEA 3M2MA 3SH3A 1WUVA 1JYIA 2NYYA 4Q2FA 4JRAA 2A75A 2NN8A 3AK0A 4XMAA 5GJ6A 3WG4A 4L8QA 4GA9A 3LSEA 4M01A 1JXNA 2D7FA 1ZM1A 1S0DA 3AXDA 4NO4A 4Q26A 1S0FA 1AXKA 4Y1YA 5L73A 1F9KA 4FPYA 3AZVA 4FP2A 3PVNA 3WNXA 3NV4A 1MR5A 2DUPA 1F5FA 1JHNA 1LGBA 3RS6A 5DZEA 2P3IA 2PHTA 1W6MB 2E7TA 1ENQA 1QOTA 1KDMA 4XBLA 4XTPA 1MS5A 2FMDA 5LK5A 4PCRA 2ZABA 1DQ0A 1W6OB 1YRZA 4LBOA 3VUOA 1QGLA 2D6MA 3PVOA 5GZFA 1KRIA 3AYCA 3AP5A 1Q8SA 4LBLA 4XXPA 2PHXA 2P2KA 2UU8A 4Y22B 1IS5A 4IQPA 1Z0HA 5GZDA 4YW4A 3RMXA 1MVQA 3HMYA 4CRQA 3NWKA 1SLCA 1DHKB 3ILRA 3AP9A 4YM0A 4OZXA 1UKGA 3WDTA 1KQRA 4ZKTB 1LU1A 2A3YA 4XBQA 3PJQA 1W6OA 3SNMA 1GANA 5E89A 5JDBA 2A70A 4XYXA 1LECA 3VKLA 5EWSA 1LGNA 4LBNA 2GDFA 2YV8A 2ZGMA 3ZYPA 1V00A 1LHNA 4Y22A 1G9DA 1G8WA 4YGDA 2ZMLA 4AGRA 1N1TA 1QNYA 2ZZJA 4AGGA 1N1VA 2Z42A 2ZGNA 4LBQB 3B9CA 4UW3A 1IS3A 2DU1A 2CL2A 2G4IA 3NV3A 2A7AA 3OBTA 3D6EA 1GNZA 4JC1A 3RQ0A 3V65A 1Q8OA 1UL9A 4C1XA 2GMEA 2D3PA 3AYAA 5T5OA 3B00A 5KXEA 4HANA 2ZGQA 3WZ1A 5F9TA 1AJOA 3N35A 1IKQA 3WHTA 2WT2A 3MW2A 3WUDA 4CTEA 1CJPA 3MW4A 3M3EA 3WDUA 1KJLA 1LOAA 2ZA9A 2NM1A 2ZKNA 1S0JA 1O4ZA 1J1TA 1LJ7A 1RINA 1SLIA 2V73A 4DRRA 1GLHA 1Q8QA 3M3QA 2PHRA 5CNAA 2LALA 3WV6A 1G9BA 1SBFA 2R1BA 1GZ9A 5T52A 1HLCA 4XDQA 1W6PB 4YM3A 5DUWA 3QLQA 3ZYRA 2SLIA 5EXOA 4R9AA 3FLRA 1G86A 4Q1PA 1ULEA 3W59A 3TAYA 1LEDA 5GLZA 4P9WA 4FPJA 1S0EA 1S0BA 3AYDA 3R05A 5E8AA 5H9QA 1BKZA 4GKYA 1YYNA 4YZ4A 4AVVA 2GNTA 2E51A 1UX6A 1LHVA 2JD4A 5HCAA 5IK7A 4K1ZA 3D5OA 2OUJA 1MS9A 4SLIA 4WVWA 2NMNA 1W6PA 1ZA4A 2WNEA 4FPKA 4BMEA 2B7YA 3WVJA 3AYEA 3PVEA 4YGEA 1V6OA 4PQ9A 3A0NA 2CY6A 4YW3A 3I8TA 1B09A 1LENA 2D6LX 1YXWA 1LCLA 4YW2A 4YZ5A 3A4UA 1LHUA 1GSLA 3O0XA 4K21A 2P34A 2YXSA 1JOJA 1JYCA 3AJZA 5GLVA 4BMBA 3QCWA 2CWSA 2RHPA 3GALA 3ZPYA 2P3JA 1JN2P 2DVFA 1H9PA 1HKDA 3RMYA 1FNZA 2XG3A 1BJQA 1CQ9A 1PZ9A 2D3RA 3ILFA 5T54A 2XB6C 2YMZA 1LODA 1N3QA 3BODA 4XJ9A 3POYA 2ES3A 1FV3A 3T2TA 3IN9A 1DQ1A 1FX5A 1VIWB 3MPPG 1Q56A 1RIRA 1N3OA 4DQAA 1ENRA 3L2YA 2ZHMA 4YM2A 2GNBA 2D3SA 5T5LA 1QF3A 1W6QB 2D6KA 4UW6A 3USUB 3JU9A 1IKPA 1C4RA 1SLBA 2GNMA 2ZGRA 1WW7A 4M00A 3VKNA 1BZWA 1OQ1A 4DS0A 2E6VA 1ULGA 1DYKA 5JOYA 5DZFA 4LBQD 4M3CB 5IK4A 1Q8PA 5KXBA 1KITA 1ULCA 3TB0A 4GWMA 1WD3A 1WLCA 4YGBA 4FQZA 3M3CA 3FUOA 1LTEA 1GKBA 2CWMA 3NV1A 5CBLA 4FPOB 4CZSA 1LOBA 4YFWA 4ATFA 5JVVA 1TEIA 4YLZA 2VU9A 1UMZA 1FAYA 1LOFC 3N7KA 1VALA 1W6MA 3BIWE 4ISRA 4XIKA 3MW3A 5T5JA 4FQ4A 1SCSA 4XJUA 4XHXA 4UW4A 3VKFC 1QMJA 3SH4A 1R1ZA 1W0OA 1H30A 2R49A 4ISQA 4AVTA 1V6JA 1QOSA 1I1EA 2PELA 2AGSA 1U0AA 3IKWA 2AR6A 1RITA 1D2SA 2DV9A 2YZ4A 3A0KA 4XJZA 5HCBA 4YG3A 4XOGA 2EXIA 2H0BA 5KXCA 2GALA 1CESA 4Z8BA 1DQ6A 1C1FA 3O0WA 3VKMA 1PZ8A 3ZXKA 1WD4A 3UJQA 3WDYA 4MYEA 3AZXA 1GNHA 1CN1A 3WDVA 4LBJA 1N1SA 1AZDA 1QKQA 1JBCA 2VW1A 3O0VA 1EPWA 5IK8A 2DTWA 2VH9A 5IT6A 1GZCA 1PZ7A 3PMEA 5GZGA 3B01A 3WHUA 2AYHA 1VLNA 1MS1A 4YGCA 5EYXA 4AVSA 3R4UA 2ERFA 1V6IA 4GKXA 2A3WA 2DURA 2W39A 3M3OA 4TYSA 4LBQA 4XTMA 5HCFA 3V0BB 5AVAA 4W65A 1FYUA 2GMMA 5DUVA 5FREA 3UJOA 4DFSA 2AUYA 1QU0A 4Q27A 1W6NB 4JCKA 4R9DA 1AX2A 1SBEA 1UN1A 4XBNA 5H9SA 2EAKA 2DVAA 3AP7A 3OGGA 5GALA 1SACA 1GICA 3N3HA 5T50A 1LGCA 3C2UA 5H9PA 2WKKA 1DFQA 4YZ2A 3KQRA 2JKBA 1CONA 3LSDA 1MS4A 4YG0A 1BXHA 1DYPA 3SLIA 3O12A 5IUQA 3V0BA 2CYFA 3OPZA 3Q9OA 5DXDA 2WSUA 1UPSA 2R0FA 3WOGA 5CA6A 2VUAA 4I30A 1SCRA 3UL2A 2D6OX 2JECA 3N36A 1FV2A 2A6XA 3B69A 4YG6A 5E88A 4Q8KA 3CNAA 5T5PA 3AX4A 5DZGA 1MS8A 3V64A 1CVNA 2GMPA 4DPNA 2UWAA 1CR7A 4PF5A 3ILNA 3FBYA 5DUXA 2EIGA 1A3KA 3D4KA 2FHRA 2JE9A 3AZWA 3WG3A 2TEPA 3INAA 4XE9A 2BQPA 2E53A 2LTNA 5FRAA 5JOWA 1WW4A 1AF9A 4FPGA 4P9YA 1HQLA 1WW6A 1CPNA 3ZSLA 5EYYA 4FPFA 4FOVA 4RL7A 2WT1A 3ENRA 4XZPA 3N7MA 5JLVA 1OFSA 3IMNA 3FLTA 1HQWA 4BQ1A 2ZGOA 1C57A 4Q1RA 4XJAA 5JOXA 1MZ5A 4WZFA 3ZXEA 1YO8A 2WJSA 3I4IA 5T55A 3DGTA 1AVBA 1WBLA 1JW6A 3SITA 1F31A 4AWDA 2VXRA 3ZXFA 1WLDA 2ARXA 3N7LA 2DVBA 5GZCA 3AZZA 1AXYA 4ATEA 1QOOA 1AX0A 1GV9A 2VY0A 4D69A 2W68A 1C1LA 2DVGA 2D6PA 1LU2A 3H0OA 2E7QA 2ZMNA 2A6ZA 2A5ZA 4Y26A 3WCRA 2A6YA 5DG2A 5F5QA 4XJWA 1XQNA 4DRVA 1IS4A 1V6MA 1WBFA 3B3QE 3IM0A 4GALA 4GXLA 2R1DA 1V6LA 2AENA 2R16A 1ONAA 1NXD1 2A3XA 2NZ9A 4LBMA 3AZYA 2GNDA 4XIOA 4AGVA 1DLLA 4P14A 5KXDA 5GLUA 3WDXA 5JOZA 1APNA 1W6QA 3USUA 2A6WA
chains in the Genus database with same CATH superfamily
4XHBA 4CDUA 2R063 3IDCB 5FYTA 4J1WA 1RUE1 2QQPA 4DO0A 2RV9A 1UY3A 2ZGPA 2ZKLA 4FP3A 4BM8A 2PHUA 2OQ7A 2ORXA 2XKPA 2ZACA 4XMIA 3ZVXA 5FOJB 3ZXGA 4JX0A 3POEA 3V56A 4X6RB 4CP1A 4Y1VA 2W08A 2RJ2A 4YZ1A 3H8RA 5FTTC 1HB4A 1GZWB 1NOVA 1SLAA 2WS92 1ZBE2 4LE4A 4UFHA 4WV8A 2XH6A 4XCBA 3VBSB 4EN8B 5C8CC 3POSA 3VD7A 1DDLA 1VBE3 3RZGA 4HK8A 3S7IA 1DGWA 1I6XA 4MH0E 1SZBA 1Y7BA 4B29A 4B4QA 3S6PA 5FP9A 5IYYA 5IFPA 2WLQA 5LBCA 4GQ7A 2J42A 1WLTA 4NN0A 2AH2A 1ND2C 3OGJA 1U5IA 1NAEA 1QJX2 4LKFA 1UIJA 4OMCA 3RG0A 5FP3A 1JUIA 1AX1A 1QXPA 1RUD2 5CA6A 1UZWA 1S0CA 2ZGLA 2C5DA 4ITCA 1GZWA 3Q8AA 1GBGA 1CZSA 2DUOA 1HN0A 2XL9A 4X8PA 1FNYA 1A78A 2KA3A 5FO8B 2VZPA 2WYFA 4KQ7A 3M1HA 3NJVA 3FFZA 2D6NA 4QM8A 4XUPA 4QDRA 2PLV1 4C90A 1WCSA 5IATA 3N9LA 2BGPA 2R071 4W6XA 2DF7A 1C8M2 4IE4A 1LOEA 3B93A 5JR2A 1WCKA 2RMU3 2ET7A 2RJKA 2K46A 3UETA 4M3CE 4FPCA 5EJZB 1RMU2 4QAWA 5CKMA 3R6SA 2KM2A 5FFOC 3M8LA 1U5YA 4PDWC 1WMEA 4DIQA 2Q5TA 3B5LB 2Y26A 2BU9A 3P3PA 4XFIA 1O3RA 3JQWA 3OG2A 1CPMA 1Y9QA 3AVSA 1Q8VA 2VMEA 2R7EB 2EALA 4AE2A 3JBG2 3MIFA 5FXZA 2OUHA 1BHGA 1DU3D 5CEHA 5IK5A 4Q8LA 4JHZA 3RZHA 1VBC2 4ZXKA 4FTBA 3THDA 3AVRA 5HBAA 3BU7A 4YPJA 1PMHX 1W90A 3TEZA 1LAJA 2GN3A 3GJAA 1S0IA 4IEWA 4MG2A 2SBAA 2ZGUA 5DAVA 2CDPA 3PVBB 1FPN1 3HR9A 3VBOA 1G7YA 3ZN4A 5D8AB 1UOGA 2HEVF 2WT0A 3OBRA 1DZRA 2O14A 2VW2A 3LIHA 3ZDVA 5KR7A 2EXKA 2E32A 4LXLA 4QKBA 3POWA 1YCIA 2JWPA 4NIAA 5I0DA 1XE7A 2ZGKA 4HMZA 1CJDA 4JGZC 2BZDA 1GFF2 2V4VA 3IPVB 1G9AA 3S5AA 3OGRA 3A22A 1VAMA 2N7GA 4LHKA 3BPSA 2AACA 2HWC2 5SV8A 4CCNA 3RSJA 2HEYF 4UOJA 4Y5SA 2KD7A 1OA2A 5HCHA 3T2PA 1ND3C 5C4WA 5FYYA 1OF3A 2J1EA 4XF9A 5BYNA 4FPLA 3KT1A 2HYKA 2FQPA 4AGVA 4HG6B 4GZ9A 4WM7C 5FWJA 2Q4SA 4X8NA 3UGHA 4F7ZA 4AYUA 2GP3A 2ZGSA 3O1MA 3IPVA 1S0GA 4WVVA 2EIEA 1AYN1 2VJXA 1OVPA 2WWJA 1AJKA 2AREA 5A6YA 2VMHA 2WS93 1T6GC 1ZBE3 4BHPA 2VQUA 1LOFA 1RC6A 2OW4A 1WUVA 4WVMB 3VN4A 4Q2FA 3LPFA 4OFGA 3LFIA 1GR3A 3JCIA 5FCCA 3AK0A 4UFKA 4H3WA 3MICA 5E16A 2LRPA 4M01A 2XVKA 1JXNA 4D7SA 3I54A 3AXDA 2BP6A 1QJX3 1S0FA 1AXKA 4A45A 4Y1YA 4W8JA 3AZVA 3AKQA 4ZS3A 5BXXA 2D93A 2PAKA 3IDBB 3OBAA 3NV4A 2DUPA 1F5FA 1JHNA 2GC2A 3KWVA 4RFT0 4WVMA 1US3A 2C4XA 5F3GA 4XFBA 1W6MB 1ENQA 2R30A 3MGUA 1QOTA 4TWTA 1C8M3 3M4FA 5ACA2 1MS5A 4RQPC 5KHIA 5LWBA 4PCRA 4BU2A 1REFA 1W03A 1RMU3 4H7LA 3K46A 5GZFA 2J1UA 4HVRA 5BNNC 3RZJA 3AP5A 1Q8SA 5BV6A 1TMF2 2PHXA 2VZ1A 4LHLA 2UU8A 4URTA 4FAGA 4UAPA 1IPKA 3ZYGA 1UXZA 2Y6KA 1REEA 3RMXA 4CRQA 1ZVFA 3JBG3 1SLCA 3SC7X 1UW8A 1XE8A 4B1LA 3T0AA 2CGPA 3AP9A 1X33A 5FBJA 1UKGA 2OT7A 5DAQA 3VBUB 1KQRA 3WDTA 2A3YA 4LUMA 1UXXX 2VOWA 3SNMA 4QKDA 1WCDJ 4N43C 4QB1A 5JDBA 1VBC3 2A70A 3VKLA 4UBGA 4MHRA 2GDFA 3ZYPA 5F5CA 4RR3A 4LO8A 1V70A 2HBTA 2C26A 2JICA 3MIEA 3CJIB 3EHKA 2HWB1 4YYOA 4MVTA 2WNUA 4Q4X2 4AHZA 3KHCA 1DGRN 1G8WA 2PHLA 2WA3A 1EPZA 1N1TA 2ZZJA 4AGGA 4BJ0A 4LBQB 3B9CA 1UOBA 2DU1A 1YEWA 2G4IA 3VBHA 2FBEA 4JGYC 4P5YA 4DY5A 4HSLA 1FMD2 5FQ0B 3VBUA 4YVWC 3NV3A 5EZWA 4AEDC 4FAHA 1TQ5A 1UU5A 4IUGA 5A3MA 5FAXA 4A3ZA 3MF6A 4QPWA 4MXWB 3ZYBA 1UL9A 2QVSB 2UY9A 2ZCWA 1PHMA 4IEUA 3W5NA 1GOFA 1NQDA 3ZN5A 3CJIA 2GP5A 3B00A 4AW7A 5KXEA 2WA4A 5E6HA 2HWC3 1PO22 3ZLIA 2P3YA 3M3EA 4ZS2A 4B8EA 2ZA9A 3PUQA 4CCJA 4GH4B 4QXBA 1O5LA 1W9SA 4DXSA 1LJ7A 4DRRA 1ZX5A 2F4LA 1W8ZA 3VZKA 1NY71 2R1BA 3K3NA 5EHDA 4LKEA 1HLCA 4HFSA 3QLQA 4BCUA 1ULEA 4GJYA 4UFJA 1S0EA 1S0BA 3GGLA 3NQHA 3THPA 1SDWA 3ACHA 1W99A 4GKYA 4M0NA 4PJYA 4JDMA 1F8VA 2E51A 3DECA 4UI9L 4M0HA 4BQ2A 4L97A 2QDRA 1TME2 3RPQA 3I2HA 4K1ZA 3D5OA 1MS9A 1V9U1 1VP6A 5FP8A 1OPOA 5C3PA 3I2FA 3AMMA 1F35A 2PFWA 3AYEA 4YGEA 1V6OA 2J1VA 1MQTA 2O0OA 3HJRA 1DZTA 4Z82A 3HNYM 4NUBA 3UGFA 5A1LA 3BU0A 1YXWA 4O9EA 2BERA 1ZZBA 1LCLA 4YW2A 4YZ5A 2YXSA 1BEV2 2FDIA 2YPJA 5HV0A 3OTFA 4XABA 4BMBA 4EV0A 5ACA3 3WX5A 2JDYA 4JZRA 3ZPYA 2P3JA 2DVFA 3ZFEC 1HKDA 5J1XA 4HVQA 1W28A 1ND2B 1BJQA 1PZ9A 2D3RA 2JD9A 3ILFA 5T54A 2ARCA 5IFTA 5FYCA 4KU8A 3T2OA 1EP0A 2ZZQA 4P9GA 1N3QA 1TMF3 3BODA 4XJ9A 5JZGC 2Y33A 2ES3A 2RS32 2X5IC 2ZX2A 3UGGA 4JQRA 1RVF3 4QHBA 1FX5A 2BGOA 4WVZA 3FZ3A 4CXWA 1XJAA 3O1PA 1W9TA 1RXFA 5C8CA 3OF1A 1ENRA 4IGQA 2GNBA 1OUSA 1RUC1 4XETA 5KC6A 4Z2WA 5JI9A 2VNGA 1VBD2 1IKPA 1OKOA 1JYWA 1OFNA 5FZOB 1PNFA 1ND2A 1O3SA 1AR92 2QBXA 1BZWA 5LBFA 4DS0A 3HOBA 3SXWA 2WO7A 1ZA7A 1KEXA 1ULGA 2WBKA 3AMPA 3B9IA 5JOYA 3MYXA 1O4TA 1UYPA 1F4AA 4LBQD 1PIV1 1UYXA 2LROA 3AKRA 4M3CB 4Q4X3 2XJPA 5FMBA 2W47A 3O7OA 4HKLA 4XFGA 4MV2A 3TB0A 4GWMA 1RUJ3 1WD3A 1WLCA 4BA6A 4COUA 1D2QA 5L9RA 4OHZA 2XVGA 1ZZ9A 3H8UA 3M3CA 3T09A 1RUF2 3NV1A 2W91A 4Q4Y1 4BK4A 1LOBA 1PK6C 1FMD3 2XQXA 2C6SA 5JVVA 5I0TA 5A32B 3T3YA 5JPNB 3RFRA 3NAPB 2LUWA 3FWEA 3B7MA 1YHFA 3BIWE 5FXXA 2BGCA 4YVSB 4HK9A 4FQ4A 5A3OA 1SCSA 4XHXA 3F95A 3LE0A 4XQWA 1KD7A 2BV4A 1PO23 1JODA 2JB4A 2B9UA 2JG8B 2RDSA 5HPOA 4RHV2 3SH4A 1W0OA 2NPIA 3IT8A 5CFDC 1I1EA 3U0ZA 1V6JA 1PO11 2PELA 4EROA 1CWPA 5A3PA 4JQTA 3I3QA 5L9BA 1HX6A 3HNMA 2MEV1 4XJZA 2B9VA 4YG3A 4XOGA 1HRI2 5DDJ2 1XNKA 4EN0A 2H0BA 1LRHA 1UY1A 2MPFA 3BN6A 4Z8BA 2YDEA 1DQ6A 4MGSA 3O0WA 4ASKA 3VKMA 3ZXKA 2E9QA 3D3AA 1RUG1 4NPMA 3IBMA 2DDUA 2P1BA 4MYEA 5FYVA 1PX4A 3O1TA 3N4MA 2OX0A 1CN1A 2WZR2 3WDVA 1C5IA 1QKQA 4JAAA 4S2HA 4QPIC 1PVC2 3RVHA 2DTWA 1LKNA 3P3NA 3PMEA 3B01A 1ND3B 1TME3 3WHUA 1NXMA 2AYHA 2VE1A 3BUCA 5K8SA 4QD2A 4D6SA 4CDXC 4HSJA 1KFUL 4XEZA 4XTMA 1H0BA 4LO4B 2RS52 5DUVA 3GBWA 1VMHA 1XNBA 5FLHA 2AUYA 1QU0A 4YARA 1COV1 5AC92 3OSDA 1W6NB 4JCKA 4R9DA 3VBSC 1AX2A 2BEOA 1UN1A 4XBNA 2EAKA 2YBKA 3ZMNA 3AP7A 1W3VA 1YQ6A 5GALA 3ZPOA 3F2ZA 1BEV3 1ND3A 1UOFA 1CONA 3CBNA 3KQRA 4XUQA 4HOOA 3ZYIB 3WP6A 4YG0A 3CQOA 2HWF1 1R082 2Q30A 2W1UA 2XWBB 4WM7A 3J4UH 3SLIA 1G9CA 5DXDA 2JDNA 3WOGA 2J1AA 2R0FA 4C0BA 4GB31 2RDRA 1UYYA 3B69A 2TBVA 5E88A 3VDAA 5T5PA 2B5HA 2RS33 4P9JA 3N9NA 5FLIA 4LOTA 5FZIA 4EQVA 3ILNA 3FBYA 5DUXA 5LRSA 3B94A 4BQ5A 1A3KA 4COVA 3PLQA 2TEPA 3INAA 4XE9A 3ZKUA 5LZ6A 5CG8A 1UO9A 4TTGA 3HAGA 4JTOA 4XVHA 3VZNA 1R1A1 2H0VA 3NO8A 5IVFA 1CPNA 1VBD3 3NJXA 4FPFA 4DUXA 5I0SA 1AR93 3T0DA 3ZFFB 2WT1A 3FLTA 4Q1RA 4LIVA 3JD71 1Y4WA 4I0AA 5A7SA 4PLMA 1RUI1 3DKWA 2R32A 4MHUA 1H4GA 1WMXA 4AR2A 4TXWA 2Y6FA 1AVBA 2C0ZA 1JW6A 2Y6HA 4AWDA 1JS9A 3PU3A 1D4VB 3ZXFA 4RQPA 1K5MB 1NZIA 3W9AA 3GHNA 2ARXA 4I09A 4N43B 3N7LA 2RR12 2ZS6B 5GZCA 4QGLA 4ATEA 1QOOA 4ES8A 3OGVA 5FZMA 3WW3A 5F32A 2W68A 4AFDA 4I0WB 5D8AC 1W8OA 4RHV3 1CAVB 2ZMNA 1OOPC 5FO7B 4Y26A 3WCRA 3USSA 1JU4A 1VBB1 1QWRA 2WNOA 3WQBA 2XQRA 3B3QE 1VMJA 3PNAA 2XDVA 4RS5B 4QU2A 5DDJ3 1HRI3 1NXD1 2W94A 4OHXA 5G04L 3DYMA 4ATFA 1POV0 4N43A 1SPPB 3H50A 3EBRA 2YYOA 5FY1A 5GLUA 2XHKA 1D4M1 5JOZA 1CGPA 3FL7A 4FFIA 1W6QA 2HKXA 2A6WA 3MF9A 3MIHA 3THCA 4CCKA 2NP0A 1JOBA 2V5YA 2WZR3 4YW5A 5KHHA 4XXAA 3T2QA 2A1XA 4LKDA 1CAVA 4QX0A 2P3KA 1IQAA 2XBO2 2VM9A 1PVC3 2XWJB 3FLPA 1JZ2A 5A80A 4DEQA 3V0AB 2FDKA 3ZYJB 4JGYA 3D8CA 1DGWX 4RS5A 4YVWA 2C24A 5FZAA 4AEDA 2D44A 2VVEA 1CZTA 3MLKA 1SPPA 3EQEA 2ZPXA 5LY2A 2B4KA 2ZHNA 1ZZ8A 4PHZA 3WNKA 3PUHA 1KFXL 2RS53 2PHFA 1JZ6A 4FPHA 3VHNA 4CCDA 3GYDA 4TZDA 5AC93 1LEMA 1H9WA 1JU3A 2ETEA 4C1WA 3W58A 3POGA 2R0HA 1SBDA 3BALA 4NOTA 5F3EA 3VZMA 1JHJA 5D21A 3VL9A 1Z7S1 4MSVA 3WW1A 1QJEA 3V0AA 1L3JA 2FD8A 2YROA 3K51A 3KS7A 4WZCA 3K48A 4R9BA 1UZZA 3CLPA 5K0UC 3CZUA 3EYPA 2WWSA 3RJRA 4LNVA 2PYTA 3WQ1A 2Y38A 1R083 3WINE 1OQEA 4KG0A 2K0GA 4YZ3A 3UESA 1N1YA 3ABZA 5DUUA 5AVPA 4XUTA 4ZONA 2GN7A 3KSCA 4FFFA 3JB4C 2R061 4HZFA 4XURA 5CAZA 4Z92B 5CZKA 2GU9A 4A4AA 2RJLA 1OPMA 4PIXA 1IGOA 1UY4A 2FDGA 1Z78A 3OPTA 1I3HA 4AI0A 1OA3A 4YW6A 5JIAA 3UKVA 2FDFA 2WSVA 3MLLA 4J1XA 5CADA 1NLSA 3SH5A 3AB0A 1VBE1 4JDOA 1X82A 3DXUA 3PTRB 4BLIA 3AP4A 1S1AA 1WLWA 2VW0A 3LGRA 1S2BA 4A41A 1POV1 2W9XA 2G9ZA 5F3IA 2DU0A 3ZSKA 1KDKA 3O5SA 3DL3A 4BQYA 5JZGB 2A6VA 5FPBA 1AL23 2NMOA 4LIUA 2X5IB 4TSVA 4DXTA 1N47A 1XC6A 2UWCA 2QTWB 4FXGB 4LQRA 4PIZA 3R4DB 4Q0PA 1U5XA 3KT7A 1PGSA 3IIAA 4CUBA 1DLCA 2JDZA 4O9GA 3ZM8A 4NIDA 5FY8A 1HIXA 2G19A 3TN92 1JYXA 2WFF2 2VZSA 2HBUA 2PAMA 1YJLA 2RS13 2YGLA 3ZFEA 4ES9A 2DFBA 1YI7A 2RR13 1ODMA 4AAPA 1UAIA 4UW5A 1O3QA 4YSFA 5JZGA 4ZXEA 4KWUA 1K12A 2OPWA 1CAWB 1GYKA 1HJGA 4Q4W2 5GLTA 2X5IA 4LBKA 4IEZA 1BYHA 2R042 5F7UA 1Y3TA 1D0GA 4CCLA 4DXZA 2CTVA 5FYZA 3ZIWA 3BTYA 3RRDA 2G1MA 1TZOA 1BK0A 1DQ2A 2D5HA 2OVUA 1PK6B 2TUNA 4IEPA 1V6NA 3W5MA 4CSWA 1MEC2 4LT5A 4CXXA 1URXA 3WNMA 1JI6A 1LOGA 2P37A 1HRV1 4H2AA 4IE6A 4QKNA 4R9CA 3TBDA 1CIWA 1X7NA 5FP7A 4XILA 3TEWA 1AR72 5F6KA 2OKXA 1ZRIA 3WY6A 4GWJA 1PVXA 1H2LA 2WO1A 4CP2A 3I3MA 1LESA 1M4WA 4NRMA 2XBO3 5IW0A 4GH4C 5CFDB 1STMA 2HWE3 3J26N 5DQ0A 4BQXA 2Q8EA 3MV11 1PK6A 1O91A 5FZ3A 1QEXA 1JUHA 4XCAA 2ZHKA 3R0RA 2H6CA 2YY1A 1LHOA 3TNQA 4BYYA 1N3PA 3KHBA 3SH3A 2BPA2 1UY0A 3C7OA 3WNNA 1J59A 4GMP3 5IWFA 2WO2A 3LA3A 2NN8A 3LEIA 1GNYA 1FI2A 4L8QA 3WG4A 4AFAA 1WGPA 2X05A 5CFDA 4F3JA 2DBNA 2W95A 4QPIB 1YC61 4XF1A 3VDBA 3J9SA 1BBT2 4NO4A 4Q26A 5KHKA 3ORJA 2VGDA 4E27A 2K9ZA 1XOYA 3K4ZA 1T6BX 3ACFA 3PVNA 3WNXA 1REDA 1MR5A 3PJYA 5L7OB 4CDXB 1H8VA 4LO7A 4COWA 2QUOA 5DZEA 1AR82 3D82A 2E7TA 1LR5A 2VQ0A 4NR1A 1KDMA 3CJXA 4XBLA 3UYJA 1R092 1X9TA 2A73B 2LM3A 3JXSA 1QQP2 3KCCA 5A7OA 2EIDA 5AFBA 4AI9A 4QPIA 1RUE2 4IGOA 3K4DA 2CGNA 3OB8A 1DGRA 5LRRA 1KS5A 4XXPA 2ZEZA 4B1MA 2P2KA 1ZBE1 1IS5A 3T08A 2ZAHA 1H6XA 4IQPA 4JV4A 2E31A 1EUUA 4CDXA 3DPRC 3OD0A 4UT5A 3HMYA 5LBEA 4CCCA 5IVBA 3G7DA 4QXCA 3AKPA 3E5XA 4OZXA 2XUEA 1QXRA 3HBKA 4FXKB 3VBSA 4FSJA 3NKTA 4UWDA 2QE3A 3K4AA 1UNBA 1LGNA 5FJKA 4QXKA 3H42B 4BH9A 2DCZA 2VVFA 3FFQA 1LHNA 4KL1A 4YGDA 5LW9A 3TN93 1SFPA 1NE4A 1YI9A 2Z42A 4UW3A 2BBAA 1ZRFA 1IS3A 3LA2A 3VDCA 3ECQA 4Q4W3 4ARXA 2VXJA 3RQ0A 3D6EA 1Q3EA 1RMU1 2R043 3UT0A 1W8FA 4C1XA 2D3PA 2XJTA 2QNKA 5T5OA 3NAPC 4HANA 1AJOA 3WHTA 2W1WA 1AYM3 4ONUA 1MEC3 4QQ2A 3JBG1 3MW4A 4LK7A 1ZREA 3WDUA 3O1VA 1LOAA 2C1FA 2D98A 4YVSC 1OLMA 3SHRA 4AEJA 2ZKNA 1AR73 1Q43A 2O8QA 3I97A 1O4ZA 2JG8C 5C3SA 3ETPA 1RINA 2V73A 1SLIA 1UD1A 3M3QA 4NROA 2PHRA 1TE1B 5CNAA 1GZ9A 3WP5A 2J1TA 4GULA 4HETA 4LR4A 5DUWA 4YM3A 3ZYRA 1OOPB 5LA9A 1Y9GA 3NVCA 3FLRA 4LMFA 5CVRA 4Q1PA 2FZ1A 4FTEA 3MUZ1 2JE8A 1OI6A 2B39A 5A7NA 5E8AA 1BMV1 1YYNA 2VG9A 2O1QA 4YZ4A 3POJA 1UX6A 1FPN2 1OD5A 1LHVA 2JD4A 2VZOA 1VB4A 3GM8A 1JMUB 4I02A 3GZEA 3RI9A 3HIFA 3AL6A 4WVWA 5FMOS 3ES4A 4HPKB 5D8AA 5I8TA 3JZVA 4BMEA 2VUDA 1OOPA 2B7YA 4A2UA 4AXOA 1HXS2 1BBT3 3DYPA 3A0NA 2HWC1 4XFFA 2CY6A 4YW3A 3WW4A 3VBRC 4QHZA 3WEZA 5C33A 3CIHA 2W5FA 4QDSA 4ZHNA 2X09A 1W2NA 1W06A 3FE5A 3A4UA 2PA7A 4AHWA 4D7YA 3GF6A 3ACGA 3O0XA 2GH8A 5CU1A 3P5BA 1AR83 4I01A 4E2SA 2B46X 2FZ2A 3QCWA 1R093 1QXJA 3WW2A 1QQP3 4RSUA 4D3WA 1H9PA 1XU2A 3PU8A 1RUE3 2X10A 3S5QA 5FZLA 3AL5A 5EJ1B 1LODA 1ZZ6A 2R6QA 1QJY2 1O6UA 1ZZ7A 3POYA 4Y5Z0 1FV3A 1AYN2 5K0UB 3IN9A 3CEWA 4P00B 1YUDA 3MPPG 2QFEA 5FV3A 1RIRA 5FPLA 2Y6JA 3UV9A 4L2NA 3L2YA 1RUD3 3DN7A 3IWZA 5FOBB 5B2GB 4UW6A 1DG6A 3HQRA 4LOSA 4XACA 3JU9A 3D0JA 3BTXA 1YQ8A 1PNGA 1RJ8A 3K2OA 3P1IA 2ZGRA 3VKNA 4AI8A 1W9FA 1OQ1A 4QX1A 1UCXA 1XNAA 3P6BA 2BWCA 2E6VA 5HXVA 4QX2A 5BNQA 4E2QA 1XYOA 2X29A 5DZFA 5K0UA 5JAXA 4G3YC 5FZFA 1ULPA 2HLEA 2WRAA 3ZFFC 2JEMA 4FQZA 3ACIA 3E1F1 2PMWB 1GKBA 4J6GA 4OQ8A 4JKMA 4AHXA 1G6NA 3MI8A 2JDPA 4Y5TA 1O7FA 3N7KA 2E7AA 1RUOA 2ZEYA 3DYOA 1PMIA 1W6MA 3MFCA 1TMF1 4MX3A 4WM8C 3W21A 3WR0A 3BI3A 4S2GA 3HN3A 4J25A 4Z07A 4ZY9A 5T5JA 1RVF1 4XJUA 1K5MC 1Y43B 3T4VA 4IW3A 1PGW1 4GAZA 4LPLA 1NYWA 1R1ZA 4ISQA 2R49A 2XJVA 5F8PA 3RZZA 4AQSA 2BVVA 1GP5A 5KBFA 4QDQA 1GU3A 3ZN6B 2AR6A 1RITA 3A0KA 4IEXA 2Q1ZB 3H1MA 4OUEA 4XQ4A 4AAXA 2V09A 4A42A 5KC5A 5KWRA 1UPIA 4RS5C 1ACCA 3RYKA 4HVOA 5CG9A 1OVSA 1GNHA 1RUJ1 1H4HA 5FZ8A 3H3LA 4LBJA 3VB9A 2HWB2 2PN5A 2OA2A 2VTXA 4B4RA 4IEVA 1EPWA 4TLFA 3I3EA 4OHWA 1PZ7A 3U07A 3ZN6A 2UYBA 3E97A 3J7NA 2QQOA 4P02B 4Q4V1 3HQXA 4YGCA 5EYXA 4AVSA 4GKXA 2ERFA 1V6IA 4BQ3A 1NA1C 2W39A 1OC1A 2CU5A 4LBQA 1ZRCA 4W65A 4BIOA 1J58A 2GMMA 3KGZA 5FQ0A 1HXS3 4O61A 4G4FA 4IGPA 2VZ3A 4RD7A 1ASJ2 5JI7A 3KV9A 2XMLA 5C9AC 2JG9B 2QDNA 1D7PM 2DVAA 4MXWA 5JPMB 2VO5A 3OGGA 1GICA 3N3HA 4JVAA 1LGCA 3C2UA 2DCJA 5T50A 3BTZA 2JKBA 3JQXA 2MHFA 5FZ9A 3FHQA 1NT0A 1NQJA 2CYFA 3OPZA 2YG0A 2BWAA 3OD4A 1UPSA 3Q9OA 5LB6A 3VHRA 5FZ1A 1SFNA 1NY72 2D6OX 4GH4A 5FZ7A 2OZJA 1IZ3A 1QJY3 1AYN3 3V64A 2MNGA 4LO6B 1H1IA 2XR4A 1JYNA 4DPNA 2ZX3A 1CR7A 2YC0A 2Y0IA 4D6QA 3O1OA 2FHRA 1VBA2 2ADDA 3AZWA 3CMGA 3VD9A 3SKVA 2BQPA 2LTNA 3BYWA 5FRAA 4GJZA 1AF9A 1IG0A 1BCXA 2O8OA 3LZZA 1PGL1 1RGSA 5JCTA 3A21A 1AUYA 3ZXAC 4FOVA 1EV11 1F5JA 2XJRA 2XHNA 3ENRA 4LJHA 3N7MA 1SG3A 1OFSA 3KCYA 3IMNA 4CP0A 1HQWA 5A7WB 4YWAA 2ZGOA 5C8CB 5J96B 1H2NA 1OLQA 1MZ5A 4XF4A 1FOD1 2CSGA 2K2SA 2WO3A 3LDRA 1OURA 3POIA 3ZXEA 1UU4A 5DN2A 1XB9A 1YO8A 3FHAA 3DPRB 2I74A 3I4IA 1J84A 1AR61 2XLAA 5A33B 1RUNA 1W0NA 1YNAA 5DPNA 2J22A 3SITA 4KBZA 2DCKA 2VXRA 3GCWA 2YC2A 5F2SA 3WNLA 5BUVA 5FPXA 4BDVB 3KV6A 1L7LA 2PQSA 3ZMOA 3H7YA 1AXYA 3NRUA 3ON7A 4W50A 1HB1A 3ZKYA 4D69A 4DINB 1C1LA 2DVGA 5F2WA 1LU2A 4CEYC 3H0OA 2E7QA 3KV5A 1QJZA 1U12A 3LPGA 3DPRA 2A6ZA 4QWNA 4B7KA 5DG2A 5A33A 2EICA 4RYDA 3CKHA 4OUSA 5FPZA 4DRVA 1RHI2 1IS4A 1V6MA 1WBFA 1VBD1 2RM22 1NZCA 1VRH2 2TNFA 4S2DA 2A3XA 1AR91 2NZ9A 3E5QA 4HONA 3AZYA 4XIOA 2IXLA 3PUSA 2P17A 4P14A 2DFCA 2XXZA 3VDDC 4HT1T 4WBBA 4NHLA 2NQYA 3CF6E 3U1XA 3WDXA 4MXVA 4N90A 5FZOA 1MVEA 3U4XA 2HWB3 4YFZA 2OPKA 4IE5A 1ZRRA 1TNRA 2F17A 4PBOA 5A1FA 3VKOA 4LA2A 3N9MA 3AFKA 1OSGA 1H1MA 2JDHA 2ZHLA 4M3CA 1ZBA2 3S0MA 4AQ2A 4KU7A 1V0AA 1E5SA 1OF4A 4N9IA 5FZBA 1JZ3A 1W2OA 5JMOA 1HB2A 5K7PA 1HV0A 1WKYA 4Y1UA 3VBFC 1O4YA 4FPEA 5A32A 4I3GA 2VNRA 1ENSA 1ASJ3 3NAPA 1ZNPA 5FY5A 4D0QA 1ULFA 1SFYA 2WFPA 1DZQA 2VMGA 1JZ4A 5C70A 4P9XA 3KV4A 1SQ4A 1FATA 4V1PA 5FYBA 5JXJA 1MACA 1WW5A 4JRLA 1K3IA 4YVSA 1LOCA 4NHXA 3R4SA 1HRI1 2ET1A 4NPLA 2JG8A 5DDJ1 2QZ3A 5FK8A 3WLUA 4K20A 4N8MA 2IXHA 2MEV2 1UQXA 3APBA 2VCAA 3N7JA 4XF0A 4LLOA 5FZ0A 4CCMA 4KH9A 1X50A 2IVIB 4OMDA 3LCPA 1OKQA 2W92A 4KG8A 5LA2A 1SLLA 1RUG2 2JE7A 3T1MA 3VBRB 3VZLA 1PVC1 2DVDA 4IXLA 5L7OC 1VRBA 2VPVA 1VPHA 1MS0A 1ULOA 3JUUA 4KGGA 3G6JB 1VBA3 3MEPA 1IOAA 2OS2A 2BRTA 2EXJA 1SLTA 4BLJA 2D5FA 3AJYA 3OY8B 2ZX1A 1ENXA 1UWWA 1W0PA 3Q8CA 5SV5A 1DCSA 2VUCA 4QM9A 2RS51 1VR3A 1M06G 1MZFA 1KJRA 2ATFA 3MBWA 2JIJA 3SISA 3NMBA 1UZYA 2OZ6A 3DKQA 2FCUA 4FOWA 3VBRA 1COV2 2Z5WA 1LB2A 5GKAC 3T1LA 3KGLA 2IVJA 1PM4A 2JJ6A 3WUCA 4A7KA 4ARYA 1W6NA 5LEJA 3OY8A 3TWIA 2VTFA 4NWWA 5C7GA 4NJ4A 2EXHA 1DP0A 4U36A 4DB5A 1JZ7A 1RYYA 4FI9A 2VBDA 4YM1A 4TLGA 3WG2A 2ARBA 4XJ8A 3ZX7A 3ASIA 4Y20B 2C9AA 3L9JT 1OBNA 4KWKA 4ZU5A 3BOPA 1DGLA 1W8HA 2QQWA 4UYBA 4H7MA 4N9HA 2VZUA 2WQZC 4KI5M 4CCEA 1CX1A 4LKSA 3GXUA 4XW3A 1QNWA 3UNPA 2AEZA 2VCMA 3IDAA 1OA4A 5A7PA 4AEKA 1LHWA 3POBA 3HNBM 3IAPA 3K3OA 1H2MA 1CAXB 1RHI3 2IXJA 2RM23 4PT6A 4LE3A 4AL9A 1VRH3 4FT8A 4EN9B 5C6CA 4RA0A 5CFCC 2DYCA 3BCWA 3C7HA 3T30A 1FXZA 1QDOA 1R1A2 2W52A 4Y24A 3LEMA 1RUF3 4UF0B 5DG1A 4UFIA 4Y20A 4WM8B 4RFRB 5F5IA 1AL21 4Y1XA 5IVEA 2VOXA 2VCCA 5J37A 2VD7A 4CVUA 2ZAAA 4XDPA 4NRPA 5GLWA 1NCRB 2QQNA 3ZFFA 3JD72 3VHOA 4HXCA 3UK9A 1RUI2 1A8DA 3WG1A 2YPDA 4A6SA 1YIFA 1ZBA3 3MIGA 2Z4FA 2IXIA 4JDNA 5A3TA 1QJU2 4YW1A 2RS11 2VZTA 4OI0A 1K45A 1B35B 2RR11 2IC1A 3ZXLA 5FZCA 2ZGTA 3M2MA 1C8NA 3Q8BA 4AI2A 2GC0A 4WM8A 3K75B 2NYYA 5I0UA 2KR2A 3LEGA 2A75A 1K5MA 4OHVA 5GJ6A 4GA9A 2P6HA 3RNSA 3O1UA 3U11A 1ZM1A 2YFZA 4QMAA 2RVAA 3X29B 5FYIA 1X8EA 5DAPA 3ZIXA 1VBB2 1F9KA 4LHSA 5ANNA 1B35A 1NLRA 3HVDA 4QT6A 3HD8B 1NA1B 3FBMA 4IE7A 1WMDA 2XOMA 2WR9A 4ASLA 3A23A 3U78A 2P3IA 1J83A 5ABJB 5C5TA 1CZVA 4K40A 3J8F1 3EJKA 4IV1C 1XRUA 2Y64A 2CGOA 4XUOA 2FMDA 4AFMA 2OYZA 1RUG3 5LK5A 2XBO1 1OH3A 2ZABA 1DQ0A 1GZTA 1W6OB 1YRZA 2HWE1 4LBOA 5C9AB 3VUOA 4NHMA 3PVOA 2D6MA 3LKJA 5F37A 3AYCA 3ZXDA 3USUA 4XFAA 1GQHA 1WMFA 1OHFA 2IFRA 5GZDA 1NA1A 5LATA 1RUH2 3M70A 4YW4A 4QU1A 4DXRA 2ILMA 3ILRA 3RYPA 3H8XA 4PQQA 5FPAA 1O3TA 1YFUA 4BXFA 1Q5OA 1MPXA 1COV3 1W6OA 5C9AA 3E5UA 5E89A 1FT9A 2HWD1 4OUMA 5FZHA 5EWSA 1F4HA 1UMIA 3PIGA 3NL1A 4IV3B 5E1RA 3J7HA 1V00A 2VUJA 4K8FA 4AZZA 3WP4A 3Q8FA 2Z79A 2ZMLA 4AGRA 2QJVA 3BGAA 1N1VA 2ZTNA 4MLOA 4OHYA 1SHWB 1GQGA 2CL2A 1CD3G 3CL1A 1XU1A 4XDOA 1BVVA 5JIUA 4HKOA 2A7AA 3OBTA 3V65A 4NAOA 1YWKA 2DCTA 3LAGA 4AEMA 5F5AA 1XSQA 4ORFA 4META 3AMQA 4IV3A 3I59B 2GMEA 3AYAA 4R8HA 2Y6GA 4XUNA 3WZ1A 2ARAA 2YUEA 1IKQA 1W3XA 2UY8A 3MW2A 1AL0G 3WUDA 2BNNA 2RDNA 4JKLA 4EE2A 1IG3A 4IETA 4QPGC 1R1A3 2ORZA 1KJLA 2LS6A 3RWNA 4HKWA 2J1RA 2NM1A 1S0JA 2W87A 2EIBA 3C7FA 4CP9B 1GLHA 4Y4RA 1Q8QA 1BLZA 2WIIB 2LALA 4AVBA 2BJSA 2E26A 1G9BA 4CEYB 3I59A 4NWVA 5T52A 1S4CA 3ZYFA 5JSPA 1H8TC 4EN7B 2FCVA 1RUI3 5EXOA 2RMU1 1MZEA 3S57A 2PHDA 1H2KA 4BE3A 3AKSA 3TAYA 4LEJA 4FPJA 4P9WA 1QJU3 3OUJA 3VD4A 4COYA 3AYDA 3R05A 5H9QA 3HWJA 2GAUA 3U4SA 4AVVA 2GNTA 1GWLA 3GJBA 3FHIB 1XE0A 4Q4W1 3VDDB 5HCAA 2JXAA 3VHPA 5JR7B 1RTVA 2R041 2VOKA 4NMIA 2OUJA 1JYVA 4SLIA 4LORA 5IJRA 3VZOA 4CEYA 2NMNA 5FKCA 3IB3A 1F2NA 1HJFA 1ZA4A 2WNEA 4FPKA 3WVJA 1I9RA 1W9YA 4PQ9A 4NIGA 3AC0A 1AYM1 4UBHA 1CAWA 1UZVA 1WCUA 3GZUC 3U37A 2IFWA 1QH6A 4Y33A 4CU8A 1F15A 4Z2AA 2PQQA 1UY2A 4INDA 2XJSA 4EJRA 4AI1A 1AR71 1CAUB 2P34A 4FFGA 3VDDA 1HRV2 3VBFB 3WT3A 3NNGA 2JG9C 3AJZA 1VAKA 4YNIA 3KCXA 4IEOA 3ZFGB 1TNFA 5A70A 2EVXA 1OQDA 4IERA 1FNZA 2XG3A 4Y3OA 3H9AA 2JX9A 2WAAA 3ST7A 1SEFA 4CEWB 1EAH2 1GWKA 1NE6A 2AC1A 2YU1A 3WP3A 3T2TA 3K77A 4DY3A 4A6OA 1XNDA 1SMVA 5CISA 1VIWB 3I2JA 1RUH3 4K6BA 1CAUA 3UKNA 5LA0A 4EYUA 5I8SA 1N3OA 1VE0A 2QCSB 3VBFA 4I0BA 4YM2A 4L0PA 4AQ6A 3USUB 4R52A 1QHDA 1SLBA 4FO9A 3WF2A 2GNMA 3E6BA 5G05L 1W9WA 1WW7A 1BBT1 4MGYE 5FP4A 2VQTA 4X6QB 2BFUS 2D97A 1DYKA 2X53S 1YFYA 5IK4A 4QHOA 1Q8PA 1YLLA 4FBFA 2WNVC 5KXBA 2ZJCA 3PL0A 2HEWF 4HBNA 1X36A 1AR81 1UU6A 2YB7A 1LTEA 4FPOB 4CZSA 4YFWA 3ITQA 4CPBD 5IVVA 2WS91 1O8PA 2BYVE 3D0SA 1HW5A 5FZGA 2FDJA 2VU9A 5L7OA 1FAYA 4BQWA 2XKOA 4XIKA 3WF1A 3VGIA 4CUAA 3ELNA 5K9YA 5FZ6A 1XNTA 1UZ0A 5FMOL 5BNPC 3WD5A 1QJX1 4NVPA 4XC9A 4AVTA 1QOSA 1RUD1 4NHKA 3WSOA 5EFUA 2QZ2A 3MV01 1D2SA 2Q1MA 3H7JA 4E4SA 1POV3 2KXLA 4BWOA 2XL7A 3NNJA 2ZEXA 2WFF3 5KXCA 2GALA 2VMCA 1CESA 3IMMA 3TEYA 1W2UA 1C1FA 2OQ6A 1C8M1 1PZ8A 4PIYA 4IEYA 3UJQA 3WDYA 2XPJA 3LOBA 4ET7A 3AZXA 2PLV2 3GHMA 3IZOA 5HXMA 2R072 1N1SA 5FMCA 1JBCA 5CFCB 5FR3A 1TVGA 2QQMA 1RL3A 2B8MA 2F6BA 5IK8A 5IT6A 4FFHA 1GZCA 4OYUA 5JWPA 2IUWA 5JXGA 2IXKA 1A34A 5GZGA 2BDRA 3LWCA 1P8JA 3O14A 4P08A 1VLNA 1JOPA 5FXVA 3R4UA 3TNPB 4MGTA 2A3WA 3M3OA 3ZR6A 5HCFA 3V0BB 5AVAA 1WZXA 4KWJA 3UJOA 1UOJA 4DFSA 2BNMA 1S2KA 1W8UA 2VQAA 4Q27A 4D8MA 1SBEA 1VBC1 1GP4A 5H9SA 5CFCA 2BNOA 3AM2A 2Q0AA 5FZEA 3B02A 3VBOB 2VAUA 3GZTB 1TG7A 1HRV3 4LITA 4Q0SA 4UXAA 3LSDA 4YZ2A 2Q1FA 1DF0A 3NJZA 5EPAA 4C0HA 2Y8KA 1BXHA 1DYPA 2W1QA 3V0BA 4Z1VA 5EV7A 4BXSV 5J98B 2XGXA 5L19A 2JECA 1UX7A 1FV2A 4BB3A 1EAH3 3BOWA 2XVLA 5DZGA 5FXWA 2YHJA 2Z69A 1CVNA 2UWAA 4PF5A 4NHYA 2EIGA 2JE9A 2BUKA 5FBZA 2CDOA 1BMV2 3VD3A 5I8YA 2E53A 2IZWA 4PF1A 3SCHA 4C8DA 4QPYA 5C4WB 4DMIA 5IVJA 2UYAA 2XJUA 1WW6A 4IV1B 2J1SA 5F1RA 3H3ZA 2B45X 1HXS1 4RL7A 2EA7A 5JLVA 2WN3A 1A8MA 3WQ7A 4BQ1A 1C57A 3NW4A 3T0BA 5HI0A 4HPKA 4AFBA 4ZZ8A 1S2EA 2P4EA 2WUHA 5T55A 2CAUA 4B4PA 3DGTA 2WYSA 1WBLA 3KMHA 3OEAA 5F39A 1F31A 3ACLA 2BOIA 3DCQA 4IV1A 4SBVA 5JUVA 4DUVA 3DXTA 1WLDA 4HN1A 1GQPA 5A6ZA 1QJY1 3LQCA 3AZZA 3IAQA 3KVBA 1GV9A 2VY0A 3NNLA 3CO2A 5IVCA 3QH6A 4EWAA 2G9FA 2D6PA 3N9QA 4B7EA 2CAVA 5FUPA 2A5ZA 4D7TA 2Y60A 5C5UA 2A6YA 4L99A 5F5QA 2QQLA 3QD6A 4XJWA 4FTSA 3IM0A 3GCXA 4M4RA 4GALA 1W8NA 1V6LA 2AENA 1NX9A 2R16A 1W8WA 1DYOA 1NCQC 4LBMA 1A6CA 2GNDA 5LASA 2QQKA 1DLLA 3CZJA 4I2OA 1I5PA 3FJSA 2XLFA 4BIFA 1APNA 5ACA1 2PLV3 1V6KA 2A71A 2R073 3MIDA 2DTYA 4U2AA 1L7RA 3LD8A 2CNAA 1LULA 3ALQA 2GC3A 4HN0A 4LO5B 1E5IA 2ADEA 4QPGB 2C9KA 4NIHA 5HV4A 5BY5A 4DZGA 4KNCA 1DBNA 2B42B 5JSOA 1DQ4A 3N9PA 4ZU7A 4M4PA 1NCRC 3MIBA 4E8CA 1C28A 1ST8A 3ZSMA 1UF2C 1H8TB 4RR3B 3OGSA 5FO9B 3WDWA 4QB6A 4GD4A 1B35C 2WNUB 3KM5A 1RVF2 4CU7A 1RB8G 2VVDA 4K3UA 4KGQA 4QPGA 1PGW2 3OYWB 5H9RA 4ASMB 3LF7A 4K1YA 4Q4X1 3Q8EA 2UWBA 3ZSJA 3VBHB 4AVCA 2DUQA 1O8SA 4EZHA 4RGKA 1U5ZA 1K5JA 4XZUG 3OJBA 2DWRA 4QQOA 5EQUA 4OQ9A 2Y6LA 1J3PA 1FMD1 2JDMA 2V72A 1H8TA 1FPN3 4FVVA 2ZOEB 5I93A 3I2GA 2EF6A 3NJYA 5CKQA 4LLFA 4PBPA 3BTAA 3H1YA 4K9SA 5A3UA 1UMHA 3IIIA 4CXYA 2HH9A 4LUKA 4E4HA 1IS6A 1RUJ2 4JHTA 2BOJA 3HN1A 4HL0A 1JH5A 3VV1A 3OYWA 4BQ4A 5ABJC 2VZQA 1XYNA 3QH7A 5A3WA 2WL1A 4O65A 4N53C 5JSRA 1PO21 5FY0A 1XSRA 3GBGA 3DUIA 1I5ZA 5FWEA 5GM0A 4Q4V2 5J09A 4Y1ZA 5DAWA 4AG4A 3ZOIA 1ASJ1 3GNEA 4Q0UA 5FMDA 4AF9A 3H8OA 5BPXA 3AMNA 2QQVA 2PXJA 2ZBJA 4E4ZA 1OD3A 4FOQA 4GWIA 1QDCA 1RJ7A 1ULDA 4KMQA 3KF3A 4YRDA 3NV2A 5JMCA 2AZ5A 5CYYA 4B3NA 1VAVA 2JG9A 2XONA 3FN9A 3TYJA 3LA7A 1QH7A 3BB6A 2GC1A 2I2SA 2RDQA 4IV3C 4NPRA 1O59A 1BQPA 2E63A 3J7MA 1TME1 2DBIA 1OUXA 3GBFA 4BPZA 2WINB 4QQHA 4CE8A 2OXBA 2VZRA 4QQLA 3WQ0A 3O1RA 5GZEA 5B4XA 1KS4A 1MQTB 2IXCA 3LEKA 3QBQA 1AXZA 1WA6X 3ZXJA 1ZYBA 1V9U2 1VBA1 2WNVB 5FYMA 3HT1A 3LDKA 1RXGA 1YIPA 5T3NA 4H55A 3RGBA 5LK7B 4FOYA 5CB7A 3URFA 2PHWA 2JKXA 4QB2A 2QQJA 4KBBA 2DCYA 5FYSA 4DUWA 1XXNA 1HDKA 4CDQC 1BEV1 3RJ2X 4BOWA 5C8WA 1G9FA 1PGL2 2D43A 1YFXA 2NLRA 3OEBA 1XNCA 5FZDA 2CV6A 4P9LA 4OI2A 2H6BA 2FMYA 1EV12 1YFWA 4MGIE 4CU9A 5FY9A 1Y9MA 3BIEA 4H14A 2WNVA 4LULA 1MZ6A 4NAMA 1EUTA 4MGQA 5BNOC 1FOD2 5A3LA 1D0HA 2GH2A 2ENRA 1LNSA 1W2TA 1MS3A 3WCSA 4CA9A 5BNPB 3HBZA 1T2XA 1HN1A 3KLSA 2RS31 5A7WA 3FUQA 5LBBA 2UURA 4DNYA 4EN6B 2ZMKA 1DIWA 4G9SB 5IAXA 1AR62 1DQ5A 4IESA 5FPVA 3M3IA 3ATGA 3AP6A 2F4PA 3L2HA 4GWNA 4M3CF 4Q0VA 4PI2A 3JB8A 1XPWA 3AXEA 1ODNA 2ZX4A 2ID4A 1JYIA 4KWLA 5KHJA 1QIQA 2WQ4A 4JRAA 5FIXA 3ETQA 1RUC2 1JTZX 4XMAA 3WNOA 2D40A 2JDAA 3ZR5A 4NRQA 3LSEA 4AQTA 4E8DA 5CKNA 5BNPA 2D7FA 3RZMA 2XUMA 1S0DA 1RHI1 4QGMA 2RM21 3PUAA 4CDWC 1VRH1 1YJKA 3FC0A 5C3OA 1OMIA 3MLJA 5L73A 4FPYA 5A1AA 4FP2A 4PI0A 1PIV2 3I2KA 4IDZA 1RUF1 1IHMA 4RGAA 1GOGA 1QY4A 1LGBA 1IPJA 3RS6A 4CU6A 4OVEA 3GDBA 2PHTA 1W04A 2RE9A 4K8RB 4Q4Y2 4E4DX 4PDWB 4XTPA 2VECA 5B4NA 3SCGA 4DOUA 1YQ5A 2WZ8A 5I0RA 2WAOA 4A44A 5J3UA 1QGLA 4PLNA 1ZBA1 1KRIA 3DEMA 4D94A 3OOXA 5KHGA 3RZLA 4LBLA 2PTMA 3ZFGC 4XFHA 1J3RA 3M7AA 1W8TA 4Y22B 4RHV1 3QACA 2GZWA 1Z0HA 4EWDA 4Q4V3 2W2IA 2ZEWA 4CEWC 3U14A 1MVQA 3MFAA 3WF4A 5FY4A 3NWKA 3ROUA 1DHKB 5C71A 3MDPA 1PO12 4FCAA 4QXHA 4YM0A 3TOJA 3HQUA 1W2AX 4PDWA 3VL8A 4CYDA 5JXIA 3I2DA 4ZKTB 5LEKA 1LU1A 2P5BA 4XBQA 3PJQA 1GANA 1KGYA 1WWYA 1X9PA 4XYXA 1LECA 3VD5A 3WXPA 4LBNA 3PHMA 2W46A 2YV8A 2ZGMA 3UKTA 1H6YA 2WZR1 1H1AA 1UIKA 4Y22A 4F83A 1G9DA 2BTVC 3RYRA 4CDUC 2JDKA 4AFCA 1O5UA 4A3XA 1JZ5A 4Q29A 2BVBA 1QNYA 2ZGNA 3TEXA 3VZJA 1X8MA 2YU2A 4JGZB 2W0XA 1CIYA 4RN5A 4JC1A 1GNZA 5IVYA 4EWEA 3N9OA 2P6CA 2WWUA 5DABA 1V9U3 1Q8OA 2QKDA 3POFA 5AC91 4AI3A 2WQ8A 1NLQA 2YFUA 4Q5OA 5A7QA 2Q8DA 4JKKA 2ZGQA 5F9TA 2YBSA 3N35A 2WT2A 4CTEA 1CJPA 5DMYA 3O1SA 1GOHA 3CU7A 4R4ZA 1S55A 4Q0QA 2W1SA 4WM7B 4DEVA 4JGZA 1J3QA 1US2A 3I2OA 3LOIA 1EV13 2VBBA 1R081 3ZDSA 1J1TA 5EJ3A 4OCTA 3HPNA 3KF5A 5A6XA 3WV6A 1SBFA 1FOD3 2HWF2 3PIJA 2RG4A 4XDQA 1W6PB 2G9GA 2SLIA 3KZ4C 3NNFA 3MPBA 4R9AA 4GB32 1G86A 3W59A 3KD4A 1AR63 3KVAA 1LEDA 5D1IA 5GLZA 1J1LA 4Y4YA 2HJIA 5LCWL 3C3VA 3U10A 1NCQB 1BKZA 3S7EA 2I45A 3VLBB 4CUGA 5IK7A 4CCOA 3PUIA 5J48A 1NG0A 4GMP0 2WLPA 1RUC3 3E6DA 4TN7A 4XAEA 2YBPA 1OLRA 4P9IA 1W6PA 2VC9A 3H1WA 1XYPA 4ZU4A 1E57A 5J7MA 1C3HA 2JIGA 3PVEA 5FZKA 1K42A 3OUHA 1R64A 3CDZB 4LTAA 3I8TA 1ALYA 2VCBA 1B09A 1LENA 2D6LX 4QX3A 5LY1A 3GZAA 5D2AA 1PIV3 1OLME 1NCQA 2J7MA 3PMSA 4RGGA 4CUCA 4RQPB 5A6QA 1LHUA 3BPZA 1GSLA 3E6CC 4K21A 2Y0OA 1JOJA 2ZXQA 1CAXA 4E2GA 4OZOA 5FLJA 5FK7A 1JYCA 4Q4Y3 5GLVA 3ME2A 5BNNB 2CWSA 2RHPA 3GALA 2OIIA 1AL22 2Q8OA 1CX4A 1JN2P 4R4XA 3RMYA 3VBOC 4UF0A 2WZPP 3RDIA 1CQ9A 1E5RA 1ZZCA 3W20A 4XF3A 2XB6C 2YMZA 4QX7A 3WF0A 4A7ZA 1IQDC 1QJU1 5APAA 4K7JA 4C91A 1NUKA 4BK5A 1KXGA 4L11A 1DQ1A 1NCRA 2Y34A 3RWKX 3EXUA 5JXHA 3SKJE 1Q56A 2RS12 2WN2A 4LA3A 2EAAA 4XAAA 2QQUA 4DQAA 3C7GA 1PO13 2ZHMA 4BISA 2D3SA 5T5LA 3T4HB 5K4LA 4A7YA 1QF3A 1W6QB 2D6KA 3KT4A 4MADA 5EIYB 2MEV3 4BZ4A 1AHSA 1C4RA 3KQ4B 2VOTA 4P5HA 4M00A 3ZSEA 5C3QA 2JDUA 5C4WC 2VMIA 5LA1A 1D4M2 4JGYB 4N53B 1GWMA 4YVWB 1KITA 1ULCA 4AEDB 3I2IA 3I7DA 2V5DA 4YGBA 1W05A 1L7QA 3FUOA 5CBLA 2CWMA 5EP9A 2YGMA 4MUVA 3CHXA 4OULA 5A3NA 1UKRA 1TEIA 3J8F2 1XBFA 4YLZA 4ZPIA 3A7QA 1UMZA 5DAXA 1LOFC 4YW7A 1VALA 3MO4A 1WCQA 2L9LA 2Z2SB 4GMP1 2HWE2 4ISRA 3U75A 5ABJA 5F3CA 3MW3A 4I3PA 4N53A 3ES1A 4V2VA 4UW4A 1RUH1 3MHZA 3OUIA 3VKFC 1QMJA 3LIGA 2VNVA 3H3UA 1YQ2A 2X8KA 1H30A 4GIQA 3QOPA 1C5HA 3WNPA 1Z7S2 3I49A 4MOAA 2AGSA 1U0AA 3IKWA 4AHYA 2DV9A 2VTXJ 2YZ4A 4XPVA 5HCBA 2VZVA 2PAEA 3SQOA 2EXIA 3NKGA 5I91A 2VBPA 5TSWA 2JB8A 5FUNA 2HWF3 3RI8A 2HWD2 1POQA 5FKBA 5J36A 3AMHA 1VJ2A 1WD4A 4GB33 5F6LB 5L9VA 2FCTA 4MGZE 3LFMA 2R062 4AOCA 1AZDA 2WZEA 2HYXA 3OBZA 3EMRA 1GMMA 2VW1A 3O0VA 4QX8A 3FX3A 4CDQB 3NNMA 3WF3A 1EY2A 2VH9A 2VMFA 4OLLA 4COZA 2E33A 4IEQA 4QGNA 4QQPA 3DF0A 2GSYA 1GP6A 2LW8A 3SEPA 4F8AA 3C7EA 5C3RA 1MS1A 4L92A 4W6YA 4OI4A 1HB3A 4QKFA 2QQIA 2DURA 3OPWA 4TYSA 1VMFA 4EZ4A 4JTNA 1YQCA 3BKZA 1OXCA 1UYZA 1FYUA 3OCPA 1VBE2 4E9KA 3PURA 3SEEA 5BNOB 5FREA 3EB7A 4UFMA 3HEIA 5AFEA 3FMGA 1PX3A 2I07B 3AKTA 4OI1A 1JYTA 3THTA 3BVCA 3J7LA 3LB9A 4CPBA 1WA4A 3JD73 4IL7A 4CDQA 1SACA 5H9PA 4L9BA 2WKKA 4RR3C 3PDQA 1DFQA 5FYUA 5FZ4A 3ZFEB 1OH4A 2BFUL 3I3BA 4MO3M 1MS4A 2WNUC 3TN91 1VB2A 2WFF1 1JZ8A 2VOVA 3O12A 5IUQA 4V2WA 1NKGA 1PMJX 2YC4A 3PTYA 2WSUA 5BNOA 4N7IA 5FDBA 2VUAA 3HT2A 1SCRA 4I30A 4IE0A 2WC2A 3N36A 2A6XA 3UL2A 3VBHC 4YG6A 3VBUC 4CP9A 4Q8KA 3CNAA 4CDWB 3AX4A 4MZUA 5FPUA 1MS8A 2RMU2 4O7XA 2GMPA 3AFGA 5ISLA 3MUY1 4D6RA 1PM7A 3D4KA 4QX5A 3WG3A 5FUIA 3C8XA 3CJIC 4MGKE 1HQNA 1MEC1 1VBB3 1WW4A 2VR4A 4FPGA 4PLOA 5JOWA 4P9YA 1HQLA 1OT5A 2V4AA 5ERLA 4XFCA 3ZSLA 4LK6A 3NSTA 5EYYA 2CHHA 4ZZ5A 2BBVA 3I3DA 2JENA 2AEYA 4XZPA 4N7UA 5IHRA 4CDWA 3SCFA 4HLTA 2FDHA 3SMHA 3ZO0B 5BNNA 5M0TA 1D4M3 4XJAA 5JOXA 4W4ZA 1AYM2 3MZHA 3DV8A 5L36A 4WZFA 2VMDA 1EYBA 2WJSA 2W3JA 2WABA 3ZYHA 2VULA 2XJQA 4W6WA 1HV1A 3RZKA 4LHNA 4AVAA 3J8F3 3KB5A 2ZX0A 4NE9A 3S30A 5FY7A 1EAH1 1GUIA 1SDDB 3TRSB 1W39A 2DVBA 1IPSA 4UFLA 1AX0A 3ZFGA 2IWGB 4CDUB 2Q8CA 1E5HA 4S2FA 3EO6A 5ANQA 4CEWA 4URAA 3LDBA 1Z7S3 2XLGA 1XQNA 1MQTC 3IDEA 5FYHA 5IAVA 1BK1A 1BVP1 4GXLA 4NIIA 2R1DA 1ONAA 2WDBA 2VNOA 4XQDA 1ZRDA 2VL4A 5CIRA 5KXDA 2HWD3 4AK3A 1QJFA 1R091 5FJHA 2BW8A 1QQP1
chains in the Genus database with same CATH topology
4XHBA 4CDUA 2R063 3IDCB 4J1WA 1RUE1 2QQPA 2ZGPA 2ZKLA 4FP3A 4BM8A 2PHUA 2ZACA 2XKPA 4XMIA 3ZVXA 5FOJB 3ZXGA 3V56A 4X6RB 4CP1A 4Y1VA 2W08A 4YZ1A 4FTEA 5FTTC 1GZWB 1NOVA 1SLAA 2WS92 1ZBE2 4LE4A 4WV8A 3VBSB 2XH6A 4EN8B 5C8CC 3POSA 1DDLA 1VBE3 4HK8A 3S7IA 1DGWA 1I6XA 4MH0E 4B4QA 1Y7BA 4B29A 4COWA 3S6PA 2WLQA 4GQ7A 1WLTA 4NN0A 2AH2A 1ND2C 3OGJA 1U5IA 1QJX2 3RG0A 1UIJA 3ZIWA 5CA6A 1JUIA 1AX1A 1QXPA 1RUD2 1S0CA 2ZGLA 4ITCA 2C5DA 1GZWA 1GBGA 2DUOA 2XL9A 4X8PA 1FNYA 1A78A 2KA3A 5FO8B 4KQ7A 3M1HA 3FFZA 2D6NA 4QM8A 1G9CA 2PLV1 4C90A 1WCSA 4W6XA 2R071 2DF7A 1C8M2 1LOEA 3B93A 1WCKA 2RMU3 2ET7A 2RJKA 4M3CE 4FPCA 1RMU2 3R6SA 2KM2A 5FFOC 3M8LA 1U5YA 4PDWC 1WMEA 2Q5TA 3B5LB 2Y26A 3P3PA 4XFIA 1O3RA 3JQWA 1CPMA 1Y9QA 1Q8VA 2EALA 4AE2A 3JBG2 3MIFA 2OUHA 1DU3D 5IK5A 4Q8LA 1VBC2 4ZXKA 4FTBA 5HBAA 3BU7A 2GN3A 1S0IA 4IEWA 2SBAA 2ZGUA 3PVBB 1FPN1 3HR9A 3VBOA 1G7YA 3ZN4A 5D8AB 2HEVF 2WT0A 3OBRA 1DZRA 2VW2A 2EXKA 3POWA 1YCIA 1XE7A 2ZGKA 4HMZA 1CJDA 4JGZC 1GFF2 3IPVB 1G9AA 4LHKA 1VAMA 2N7GA 5SV8A 2HWC2 3RSJA 2HEYF 1OA2A 1ND3C 5C4WA 4XF9A 5BYNA 4FPLA 3KT1A 2HYKA 2FQPA 4WM7C 2Q4SA 4X8NA 4F7ZA 4AYUA 2ZGSA 3IPVA 1S0GA 4WVVA 1AYN1 1AJKA 2AREA 2VMHA 2WS93 1T6GC 1ZBE3 4BHPA 1LOFA 1RC6A 2OW4A 1WUVA 4WVMB 3VN4A 4Q2FA 4OFGA 1GR3A 3JCIA 5FCCA 3AK0A 4H3WA 3MICA 5E16A 4M01A 2XVKA 1JXNA 4D7SA 3I54A 3AXDA 1QJX3 1S0FA 1AXKA 4Y1YA 3AZVA 3AKQA 5BXXA 2D93A 2PAKA 3IDBB 3NV4A 2DUPA 1F5FA 1JHNA 2GC2A 4RFT0 4WVMA 4XFBA 1W6MB 1ENQA 2R30A 3MGUA 1QOTA 4TWTA 1C8M3 3M4FA 5ACA2 1MS5A 4RQPC 5KHIA 4PCRA 1REFA 1RMU3 4H7LA 5GZFA 4HVRA 5BNNC 3AP5A 1Q8SA 5BV6A 1TMF2 2PHXA 4LHLA 2UU8A 4URTA 4FAGA 1IPKA 3ZYGA 1REEA 3RMXA 4CRQA 1ZVFA 3JBG3 1SLCA 1UW8A 1XE8A 2CGPA 3AP9A 1X33A 1UKGA 3VBUB 3WDTA 1KQRA 2A3YA 4LUMA 2VOWA 3SNMA 1WCDJ 4N43C 5JDBA 1VBC3 2A70A 3VKLA 4UBGA 2GDFA 3ZYPA 4RR3A 4LO8A 1V70A 2JICA 3MIEA 3CJIB 3EHKA 2HWB1 4YYOA 4MVTA 2WNUA 4Q4X2 4AHZA 1DGRN 1G8WA 2PHLA 2WA3A 1EPZA 1N1TA 2ZZJA 4AGGA 4LBQB 3B9CA 2DU1A 3VBHA 2G4IA 2FBEA 4JGYC 4DY5A 4HSLA 1FMD2 5FQ0B 3VBUA 4YVWC 3NV3A 5EZWA 4AEDC 4FAHA 1TQ5A 1UU5A 5A3MA 5FAXA 3MF6A 4MXWB 1UL9A 2QVSB 2UY9A 2ZCWA 1PHMA 4IEUA 1NQDA 3ZN5A 3CJIA 5KXEA 3B00A 4AW7A 2WA4A 2HWC3 1PO22 3M3EA 4B8EA 2ZA9A 4GH4B 1O5LA 1LJ7A 4DRRA 1ZX5A 3VZKA 1NY71 2R1BA 1HLCA 4HFSA 3QLQA 4BCUA 1ULEA 1S0EA 1S0BA 3THPA 1SDWA 4M0NA 1F8VA 4GKYA 4PJYA 4JDMA 2E51A 4M0HA 4L97A 2QDRA 1TME2 3RPQA 4K1ZA 3D5OA 1MS9A 1V9U1 1VP6A 1OPOA 3AMMA 2PFWA 3AYEA 4YGEA 1V6OA 1MQTA 2O0OA 1DZTA 4Z82A 1YXWA 4O9EA 1ZZBA 1LCLA 4YW2A 4YZ5A 2YXSA 1BEV2 2YPJA 3OTFA 4BMBA 4EV0A 5ACA3 3WX5A 3ZPYA 2P3JA 2DVFA 3ZFEC 1HKDA 4HVQA 1ND2B 1BJQA 1PZ9A 2D3RA 3ILFA 5T54A 4KU8A 1EP0A 2ZZQA 4P9GA 1N3QA 1TMF3 3BODA 4XJ9A 5JZGC 2ES3A 2RS32 2X5IC 2ZX2A 4JQRA 1RVF3 4QHBA 1FX5A 4WVZA 3FZ3A 5C8CA 3OF1A 1ENRA 2GNBA 1RUC1 5KC6A 4XETA 4Z2WA 5JI9A 2VNGA 1IKPA 1VBD2 1O3SA 1OFNA 1PNFA 1ND2A 1AR92 1BZWA 4DS0A 3SXWA 3B9IA 1ULGA 3AMPA 5JOYA 3MYXA 1O4TA 4LBQD 4M3CB 1PIV1 4Q4X3 3AKRA 2XJPA 3O7OA 4HKLA 4XFGA 4MV2A 3TB0A 4GWMA 1RUJ3 1WD3A 1WLCA 4BA6A 4COUA 1D2QA 4OHZA 2XVGA 1ZZ9A 3H8UA 3M3CA 1RUF2 3NV1A 4Q4Y1 1LOBA 1PK6C 1FMD3 5JVVA 5I0TA 5A32B 5JPNB 3NAPB 2LUWA 3FWEA 3B7MA 1YHFA 3BIWE 2BGCA 4YVSB 4HK9A 4FQ4A 1SCSA 4XHXA 4XQWA 1KD7A 2JG8B 1PO23 2B9UA 4RHV2 3SH4A 1W0OA 2NPIA 3IT8A 5CFDC 1I1EA 3U0ZA 1V6JA 1PO11 2PELA 4EROA 1HX6A 2MEV1 4XJZA 4YG3A 4XOGA 1HRI2 5DDJ2 1XNKA 4EN0A 2H0BA 1LRHA 2MPFA 4Z8BA 2YDEA 1DQ6A 3O0WA 3VKMA 3ZXKA 2E9QA 1RUG1 3IBMA 4MYEA 3N4MA 2WZR2 1CN1A 3WDVA 1C5IA 1QKQA 4JAAA 4S2HA 4QPIC 1PVC2 2DTWA 1LKNA 3P3NA 3PMEA 3B01A 1ND3B 1TME3 3WHUA 1NXMA 2AYHA 5K8SA 4QD2A 4CDXC 4HSJA 1KFUL 4XEZA 4XTMA 1H0BA 4LO4B 2RS52 5DUVA 3GBWA 4YARA 1XNBA 5FLHA 2AUYA 1QU0A 5AC92 1COV1 1W6NB 4JCKA 4R9DA 3VBSC 1AX2A 2BEOA 1UN1A 4XBNA 2EAKA 3ZMNA 3AP7A 5GALA 1BEV3 1ND3A 3KQRA 1CONA 3ZYIB 3WP6A 4YG0A 2HWF1 1R082 2Q30A 4WM7A 2XWBB 3SLIA 3J4UH 5DXDA 3WOGA 2R0FA 4C0BA 4GB31 3B69A 2TBVA 5E88A 5T5PA 2B5HA 2RS33 4P9JA 5FLIA 3ILNA 3FBYA 5DUXA 5LRSA 3B94A 1A3KA 4COVA 3PLQA 2TEPA 3INAA 4XE9A 5CG8A 3HAGA 4JTOA 3VZNA 1R1A1 2H0VA 3NO8A 1CPNA 1VBD3 4FPFA 5I0SA 1AR93 3ZFFB 2WT1A 3FLTA 4Q1RA 3JD71 4I0AA 4PLMA 1RUI1 3DKWA 2R32A 1H4GA 1AVBA 2C0ZA 1JW6A 4AWDA 1D4VB 3ZXFA 4RQPA 1K5MB 3W9AA 3GHNA 2ARXA 4I09A 4N43B 3N7LA 2RR12 2ZS6B 5GZCA 4QGLA 4ATEA 1QOOA 4ES8A 3WW3A 2W68A 4AFDA 4I0WB 5D8AC 4RHV3 1CAVB 2ZMNA 1OOPC 5FO7B 4Y26A 3WCRA 3USSA 1VBB1 1QWRA 3B3QE 3PNAA 4RS5B 4QU2A 5DDJ3 1HRI3 1NXD1 4OHXA 4ATFA 1POV0 4N43A 3H50A 3EBRA 2YYOA 5GLUA 2XHKA 1D4M1 5JOZA 1CGPA 1W6QA 2HKXA 2A6WA 3MF9A 3MIHA 2NP0A 2V5YA 4YW5A 2WZR3 5KHHA 4XXAA 1CAVA 2P3KA 1IQAA 2XBO2 2XWJB 1PVC3 3FLPA 3V0AB 3ZYJB 4JGYA 3D8CA 1DGWX 4RS5A 4YVWA 4AEDA 2D44A 2VVEA 3MLKA 3EQEA 2ZPXA 2ZHNA 1ZZ8A 1KFXL 2RS53 2PHFA 4FPHA 3VHNA 4TZDA 3GYDA 5AC93 1LEMA 1H9WA 2ETEA 4C1WA 3W58A 4NOTA 2R0HA 1SBDA 3BALA 3VZMA 3VL9A 1Z7S1 4MSVA 3WW1A 3V0AA 1L3JA 2YROA 3K51A 3KS7A 4WZCA 3K48A 4R9BA 1UZZA 3CLPA 5K0UC 2WWSA 3RJRA 4LNVA 2PYTA 3WQ1A 2Y38A 1R083 3WINE 1OQEA 4KG0A 2K0GA 4YZ3A 1N1YA 5DUUA 5AVPA 2GN7A 3KSCA 3JB4C 2R061 4HZFA 5CAZA 4Z92B 2GU9A 2RJLA 1OPMA 4PIXA 1IGOA 1Z78A 1I3HA 4AI0A 1OA3A 5JIAA 2WSVA 3MLLA 4J1XA 5CADA 1NLSA 3SH5A 3AB0A 1VBE1 4JDOA 1X82A 4BLIA 3AP4A 1S1AA 1WLWA 2VW0A 3LGRA 1S2BA 1POV1 2DU0A 3ZSKA 1KDKA 3O5SA 3DL3A 5JZGB 2A6VA 1AL23 2NMOA 2X5IB 4TSVA 1N47A 2UWCA 4FXGB 4PIZA 3R4DB 4Q0PA 1U5XA 3KT7A 1PGSA 3IIAA 2JDZA 4O9GA 1HIXA 3TN92 2WFF2 3ZFEA 2PAMA 1YJLA 2RS13 2YGLA 4ES9A 2DFBA 1YI7A 2RR13 1UAIA 4UW5A 1O3QA 4YSFA 5JZGA 4Q4W2 1CAWB 1GYKA 5GLTA 2X5IA 4LBKA 4IEZA 1BYHA 2R042 1Y3TA 1D0GA 4DXZA 2CTVA 3RRDA 2OVUA 2TUNA 1DQ2A 2D5HA 4IEPA 1PK6B 1V6NA 1MEC2 4LT5A 1URXA 2P37A 1LOGA 1HRV1 4R9CA 3TBDA 1CIWA 1X7NA 4XILA 1AR72 5F6KA 3WY6A 1PVXA 1H2LA 4CP2A 1LESA 1M4WA 2XBO3 4GH4C 5CFDB 2HWE3 3J26N 1PK6A 1O91A 1JUHA 2ZHKA 3R0RA 2H6CA 2YY1A 1LHOA 3TNQA 4BYYA 1N3PA 3SH3A 2BPA2 1J59A 4GMP3 3LA3A 2NN8A 1FI2A 4L8QA 3WG4A 4AFAA 1WGPA 5CFDA 4F3JA 4QPIB 4XF1A 3J9SA 1BBT2 4NO4A 4Q26A 5KHKA 2VGDA 4E27A 2K9ZA 3PVNA 3WNXA 1REDA 1MR5A 3PJYA 5L7OB 4CDXB 1H8VA 4LO7A 2QUOA 5DZEA 1AR82 3D82A 2E7TA 1LR5A 2VQ0A 4NR1A 1KDMA 3CJXA 4XBLA 1R092 2A73B 2LM3A 3KCCA 5AFBA 1QQP2 4QPIA 1RUE2 2CGNA 1DGRA 5LRRA 1KS5A 4XXPA 2P2KA 1ZBE1 1IS5A 2ZAHA 4IQPA 4JV4A 4CDXA 3DPRC 3OD0A 3HMYA 3G7DA 3AKPA 3E5XA 4OZXA 1QXRA 4FXKB 3VBSA 4FSJA 3NKTA 2QE3A 1LGNA 4QXKA 4BH9A 2DCZA 2VVFA 3FFQA 1LHNA 4KL1A 4YGDA 3TN93 1NE4A 1YI9A 2Z42A 4UW3A 1ZRFA 1IS3A 3LA2A 3ECQA 4Q4W3 3RQ0A 3D6EA 1Q3EA 1RMU1 2R043 4C1XA 2D3PA 2XJTA 2QNKA 5T5OA 3NAPC 4HANA 1AJOA 3WHTA 1AYM3 4ONUA 1MEC3 4QQ2A 3JBG1 3MW4A 1ZREA 3WDUA 1LOAA 2C1FA 2D98A 4YVSC 3SHRA 4AEJA 2ZKNA 1AR73 1Q43A 2O8QA 1O4ZA 2JG8C 1RINA 2V73A 1SLIA 1UD1A 3M3QA 2PHRA 1TE1B 5CNAA 1GZ9A 3WP5A 4GULA 4HETA 4LR4A 4YM3A 5DUWA 3ZYRA 1OOPB 3NVCA 3FLRA 5CVRA 4Q1PA 2FZ1A 1OI6A 2B39A 5E8AA 1BMV1 1YYNA 2VG9A 2O1QA 4YZ4A 1UX6A 1FPN2 1OD5A 1LHVA 2JD4A 4I02A 1VB4A 3RI9A 3HIFA 4WVWA 5FMOS 3ES4A 4HPKB 5D8AA 5I8TA 3JZVA 4BMEA 1OOPA 2B7YA 4A2UA 4AXOA 1HXS2 1BBT3 3A0NA 2HWC1 4XFFA 2CY6A 4YW3A 3WW4A 3VBRC 5C33A 3FE5A 3A4UA 2PA7A 4AHWA 4D7YA 3GF6A 3O0XA 5CU1A 2GH8A 1AR83 4I01A 4E2SA 2B46X 2FZ2A 3QCWA 1R093 1QXJA 3WW2A 1QQP3 4RSUA 4D3WA 1H9PA 1XU2A 1RUE3 1LODA 1ZZ6A 2R6QA 1QJY2 1ZZ7A 3POYA 4Y5Z0 1FV3A 1AYN2 5K0UB 3IN9A 3CEWA 1YUDA 3MPPG 2QFEA 1RIRA 3UV9A 4L2NA 3L2YA 1RUD3 3DN7A 3IWZA 5FOBB 5B2GB 4UW6A 1DG6A 3JU9A 3D0JA 1PNGA 1RJ8A 2ZGRA 3VKNA 4AI8A 1OQ1A 1UCXA 5HXVA 2BWCA 2E6VA 5BNQA 4E2QA 1XYOA 2X29A 5DZFA 5K0UA 5JAXA 4G3YC 3ZFFC 2JEMA 4FQZA 1GKBA 4J6GA 4AHXA 1G6NA 3MI8A 1O7FA 3N7KA 2E7AA 1RUOA 4WM8C 1PMIA 1W6MA 3MFCA 1TMF1 4MX3A 3WR0A 4S2GA 4Z07A 5T5JA 1RVF1 4XJUA 1K5MC 1Y43B 1PGW1 1NYWA 1R1ZA 4ISQA 2R49A 2XJVA 3RZZA <