2LALA

Crystal structure determination and refinement at 2.3 angstroms resolution of the lentil lectin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LENTIL LECTIN (ALPHA CHAIN)
publication title Structural analysis of two crystal forms of lentil lectin at 1.8 A resolution.
pubmed doi rcsb
source organism Lens culinaris
total genus 24
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2lalA00
1IKPA 1HQLA 3RSJA 3N7KA 4Z8BA 3FUQA 1F9KA 5JOZA 4XJ9A 5H9QA 2EALA 1ZA4A 3WDTA 1SLAA 2VW1A 1UZZA 3N3HA 3N35A 2TEPA 2GMEA 4BQ1A 3PVEA 1GZWA 1KITA 5GLVA 4WVVA 4YZ4A 1CONA 4DS0A 5GLTA 1YYNA 2CWSA 1HLCA 4F83A 1Q8SA 4XDQA 4Y1YA 2R0HA 3VKLA 1DLLA 5T50A 2BQPA 4UW5A 2GNMA 2NN8A 1G7YA 1O4YA 2W08A 1JUIA 2ZGLA 3WCSA 2A7AA 4Y1VA 5CNAA 1ULCA 4R9CA 3LSEA 4AVVA 5SV8A 4I30A 1JBCA 2ZGPA 1SBDA 3AYAA 1FNYA 4FOYA 4YFZA 1N3OA 2C9AA 2ENRA 2D6NA 3V0BA 3ILFA 3V64A 3WDUA 1SCSA 1O4ZA 1VALA 4YM0A 3N7LA 1S0CA 5JOXA 1GNZA 1GBGA 2H0BA 4YGDA 1QOTA 2EAKA 1LU2A 1J1TA 4FPKA 3HR9A 4YG6A 3TAYA 3ZXFA 2SLIA 2D6LX 2EXJA 5GM0A 2EXHA 2ZHLA 4U36A 3MEPA 4YZ3A 1DQ0A 3APBA 2DUPA 3MW4A 4XBQA 1JN2P 3D5OA 4OZXA 1CJPA 1IKQA 3AP5A 2D3RA 4GWMA 2EIGA 4LBQD 5CB7A 2R0FA 4XIKA 5FRAA 5EYXA 1Q8QA 1W6OA 3AYEA 1B09A 2WQZC 4R9BA 5DZEA 3VKMA 5EWSA 2OW4A 1Z0HA 4LBLA 3IPVB 1KJLA 1BXHA 1W6QB 1DQ2A 2E6VA 4PBOA 2A70A 3WDVA 4ASMB 3WHUA 1G9CA 2P34A 1GYKA 4YW5A 3BTAA 1FNZA 1LGBA 3QCWA 3IN9A 1N1YA 3N36A 1SLBA 2HYKA 1IS4A 2A3XA 1YIFA 2WT0A 3FBYA 3R4UA 1G9BA 2WJSA 3VV1A 1QGLA 2ZGOA 2AYHA 4ATEA 3NV3A 4WZFA 3AJZA 4R9AA 4M3CA 3ZXEA 4Y1UA 3AP4A 3POWA 1RIRA 1S0DA 1MVEA 1V00A 4K1ZA 2JE9A 1V6KA 4LBOA 4CZSA 2CNAA 1KRIA 2ZAAA 2ZGKA 2CYFA 1PZ8A 4Y24A 2GMPA 2G4IA 2VXRA 1OKQA 1VIWB 4PQ9A 4LBJA 2R1BA 2DV9A 2OUJA 4K21A 1LCLA 4IQPA 4AWDA 2VUAA 3M3EA 4AYUA 1R1ZA 2JKBA 4ZKTB 2GMMA 4RL7A 1PZ9A 1CESA 5DXDA 5GZGA 1DIWA 1ULFA 3AZXA 1IS5A 2A6XA 1MS5A 2DVGA 1D2SA 1A8DA 1JOJA 1MR5A 1WUVA 1BKZA 4YFWA 3WV6A 4ZXKA 2ZGTA 2CY6A 1YO8A 1CVNA 1W6NA 2GALA 3FLPA 3VKNA 4XHXA 1GZWB 1A78A 3ILRA 5DZFA 4FPHA 3N7JA 1G86A 1CQ9A 1JHNA 1ULEA 2WNEA 3OPZA 1DQ6A 4YZ1A 1QOSA 3DGTA 5KXCA 3AP9A 1V6OA 3UL2A 1SCRA 1UZYA 1W6MA 3AX4A 4FQ4A 5E8AA 2JJ6A 4JC1A 3WOGA 1TEIA 1VLNA 1LODA 5H9RA 1LESA 1I1EA 4WVWA 2PELA 3O0XA 1A3KA 1AZDA 2WSUA 3B69A 3UJOA 3UK9A 1RINA 1YRZA 3WCRA 4C1WA 4AVSA 4R9DA 3V0BB 3PMEA 3O12A 1N1SA 2JDZA 3ZXLA 2B7YA 4FPEA 3AZWA 3AXDA 1U0AA 1MACA 3MW2A 3VUOA 1GICA 5EXOA 2C5DA 3WVJA 4YG3A 3WDYA 5GZDA 3A0KA 3NWKA 2PHWA 1LEDA 1HKDA 3B00A 3MPPG 1S0GA 3R4SA 3AYCA 4ISRA 2LTNA 2ZZJA 3HN1A 2D3SA 2ZHMA 1BZWA 4Q26A 2ZGQA 1YXWA 1LJ7A 1LGCA 2E53A 3B3QE 3O0VA 2CL2A 4YW2A 3WDWA 1G8WA 1Q8VA 2UWAA 3LCPA 2DU0A 3DUIA 4FOVA 4BPZA 5JDBA 1W6OB 1DYPA 1XQNA 2GNTA 4HL0A 4XTMA 5CAZA 1VAMA 2A75A 2I2SA 5T54A 4JCKA 1D0HA 3O5SA 5JOWA 4D69A 1AJKA 4FVVA 2PHXA 2ZACA 3FFZA 4Y20A 5T55A 5L73A 1WD3A 2V5YA 1QOOA 1KJRA 4XMAA 2JECA 4Q2FA 5AVAA 4JRAA 5KXDA 4FQZA 4P9YA 3ZSJA 1FX5A 4HANA 1CPMA 1LOAA 4GKXA 1WW5A 5T5PA 5IK5A 3ZXKA 4RA0A 2YY1A 2XB6C 3I8TA 5GZCA 4GWNA 1GZ9A 4DQAA 3L2YA 3ENRA 2Z42A 4FPCA 5GJ6A 4FPYA 4M3CB 4M01A 3VKOA 2A6WA 1AXYA 3KQRA 4GXLA 1QDCA 4Y1XA 4DPNA 4WV8A 2YV8A 5T5JA 2ZHKA 1QMJA 3M3QA 5GZFA 2VY0A 4Q8KA 3ZSKA 3TB0A 2ZMLA 1RITA 3WLUA 4BMBA 4BOWA 1WLCA 2WLQA 3POSA 1JYIA 1UN1A 1N1VA 1MZ6A 3ZSLA 1DYKA 2NMNA 3RMXA 4P9XA 4YLZA 2OVUA 1QU0A 2ZGNA 4FPOB 2KM2A 1SACA 4XMIA 1AXZA 4Y22A 3M3OA 2ZA9A 4YGBA 1LHWA 1FATA 5T52A 4AVTA 2EXIA 1HQWA 2ZKNA 5DUWA 3WUDA 2A6VA 3IM0A 5DG1A 1W6PA 3AJYA 2A3WA 1G9AA 1LOBA 1BJQA 4PF5A 2OUHA 5GLUA 2DU1A 3AYDA 2XG3A 1N47A 1URXA 1W6NB 4U2AA 5H9PA 1IOAA 3ZSMA 3V0AA 1S1AA 2P3IA 2R49A 4XZPA 1BQPA 2VW0A 3ILNA 4XBLA 1OQ1A 1MS0A 2DTWA 5F9TA 3U4XA 4DRVA 1LU1A 4C1XA 1W6MB 1ENRA 1G9FA 2UU8A 4YW1A 1CN1A 1LECA 3OJBA 4FPLA 3OGGA 1ULGA 1GKBA 1QNWA 1UX6A 1W0PA 4K20A 4L8QA 2UWBA 5T5LA 2DWRA 3M1HA 4BLJA 1G9DA 3OYWA 2W52A 3PVNA 1PZ7A 1C4RA 1KDMA 3SISA 1QKQA 5H9SA 3B01A 4PCRA 2YROA 3ZYPA 4M3CF 1V6LA 1GANA 1QF3A 4FPJA 5DG2A 3SH4A 2D7FA 1SBFA 2V73A 3AFKA 4TYSA 5DUUA 1AX0A 1SFYA 3OY8A 5GZEA 4YGEA 1AX1A 5HCBA 2CTVA 1LTEA 1NXD1 5JOYA 3OBTA 3WG1A 4GALA 2A6YA 2VW2A 3C2UA 2DVFA 1HDKA 2AH2A 2YMZA 3AP6A 4ISQA 5DUXA 1LEMA 1SLCA 2PHUA 2A71A 2ZGSA 4FPGA 4XXPA 4FOQA 4KBBA 4BLIA 2GNDA 1MS9A 4XBNA 4YG0A 1I3HA 2P3JA 3INAA 3WNXA 4M00A 2ARBA 3RG0A 2ZGRA 4LBQA 1WCSA 4UW3A 1WW6A 2FMDA 4YM2A 1ZM1A 2WT1A 3R05A 1ULDA 4Y20B 1APNA 4XILA 4XJZA 1X50A 1N3PA 5E88A 2D6OX 2R16A 3POYA 1F31A 3AK0A 5JVVA 5F5QA 4Y1ZA 5BYNA 5IK7A 1C1LA 2W68A 3T1MA 2CWMA 5HCAA 5FREA 2DYCA 2GN3A 5KXEA 3PJQA 4DRRA 1ONAA 4AGRA 2UURA 3CNAA 2EF6A 3FLRA 3USUA 1JYCA 1OFSA 3QLQA 3SNMA 2ZMKA 2SBAA 1BYHA 2E7QA 1V6NA 2JE7A 1WD4A 2VU9A 3AZYA 4XYXA 1VAVA 3BIWE 5GLWA 1UL9A 5JLVA 1AXKA 1S0IA 2NZ9A 2ZMNA 4P14A 1MZ5A 5JMCA 4YGCA 5IK8A 1GZCA 1NLSA 3GALA 4AGGA 5CBLA 1DQ5A 2ES3A 1FYUA 2D44A 1LOGA 3UJQA 2GDFA 3T2TA 1GLHA 1Q56A 1IS6A 1H9WA 4ITCA 2PHRA 3AZVA 1ENSA 1MVQA 2YXSA 4Y22B 5GLZA 4P9WA 3Q9OA 3WG3A 1F5FA 4LBKA 2R1DA 1MS3A 5EYYA 1W6PB 1N1TA 1DHKB 1WW4A 2ERFA 2NYYA 2LALA 3IMNA 4LBNA 5CA6A 4MYEA 2ZBJA 1AF9A 1LGNA 5T5OA 3ATGA 1FAYA 4UW6A 2P37A 4FP3A 2Q5TA 4GA9A 1DBNA 3V0AB 1Q8OA 1LOFA 4XE9A 3ASIA 3JUUA 4NOTA 1YI7A 3M3CA 2NMOA 1GSLA 1LHOA 1W0OA 1LULA 4PBPA 4Q1RA 1FV2A 3WZ1A 1UMZA 1Z78A 4DFSA 5GALA 4FPFA 1V6MA 3IKWA 3O0WA 1CR7A 3RQ0A 3WG2A 4YM3A 3NV4A 1JW6A 4CTEA 1IS3A 4XOGA 2D43A 4K1YA 2WT2A 1KQRA 4XJ8A 5IUQA 3PVOA 1V6JA 2D6PA 2AENA 1H9PA 2ZGMA 1LENA 2ARXA 3T1LA 1V6IA 4FP2A 5DUVA 3W58A 4YZ5A 1C57A 3V65A 3D4KA 2DVBA 3OYWB 2DUQA 2EXKA 3N7MA 4NO4A 2W39A 3SH5A 2YZ4A 1ENQA 3FLTA 1SLIA 4GKYA 4CRQA 3SLIA 1SLLA 1GV9A 3AP7A 4XJUA 3WUCA 1CIWA 3JU9A 2DURA 1SBEA 2AR6A 3H0OA 4AGVA 3WG4A 1DQ4A 3OY8B 5HCFA 2P2KA 1WBLA 2RHPA 1N3QA 3W59A 3B9CA 1WLDA 4YW3A 3WHTA 4H55A 2JD4A 1WW7A 1DGLA 3VKFC 1MS1A 4YM1A 4SLIA 2DTYA 1KDKA 2VH9A 2WSVA 3HMYA 4XTPA 1DFQA 1MS8A 1UPSA 2NP0A 2DUOA 3RRDA 1Q8PA 2A3YA 3ZPYA 2E51A 3IPVA 4LBQB 1MS4A 2FHRA 1S0EA 1W6QA 3ZYRA 1AVBA 2E7TA 1GNHA 1S0BA 1S0JA 5E89A 1UAIA 1LHUA 2D6KA 4Q27A 2GN7A 3I4IA 2GNBA 3NV1A 1H30A 4XJAA 3OBRA 1C1FA 2AGSA 5KXBA 3SITA 3A4UA 1UKGA 1WBFA 2WKKA 4YZ2A 3WDXA 1AX2A 3ZXJA 3A0NA 2A6ZA 4XJWA 3AZZA 4BMEA 4Y26A 1CPNA 2ZHNA 1DZQA 4ATFA 1LHVA 1JXNA 4Q8LA 3GNEA 4XHBA 3AXEA 3USUB 3RS6A 1LOEA 3KM5A 1SLTA 5DZGA 3M2MA 5IK4A 5IT6A 1EPWA 3MW3A 2AREA 2A5ZA 2DVDA 2NM1A 4FOWA 1QDOA 2ZGUA 2DVAA 3BODA 4M3CE 4W65A 4BM8A 1LOCA 1S0FA 1QNYA 2D6MA 4LBMA 1LHNA 1Y7BA 3SH3A 1WLWA 2PHTA 3NV2A 2AUYA 2P3KA 3FUOA 5LK5A 4XXAA 4XIOA 4TZDA 3LSDA 2ZABA 1DQ1A 2PHFA 3ZVXA 1AJOA 2D3PA 3RMYA 4YW4A 4UW4A 1FV3A 2UWCA 1LOFC 3BOPA 3D6EA 4Q1PA
chains in the Genus database with same CATH superfamily
3VD7A 4WVMA 2BGOA 3CEWA 3J9SA 1RUG3 3N7KA 3FUQA 2R063 4Z8BA 1ZZBA 2HJIA 2VECA 5KC5A 1OMIA 5H9QA 4OUEA 3QACA 1L3JA 4V2WA 5KHKA 3N35A 2QQPA 3HNBM 5C5UA 3CKHA 4IGQA 5GLVA 4D6RA 1OPOA 1VBD3 3KHBA 4IEXA 1XBFA 4DS0A 5A6ZA 5LA1A 3MIGA 1YYNA 2QZ3A 2CWSA 1HLCA 2PXJA 5JIUA 2R0HA 2A1XA 3VDAA 5J3UA 2BQPA 5AFEA 1AR91 4Q4V2 4A2UA 2NN8A 3WCSA 2FZ1A 3BN6A 2A7AA 1POV1 5FZEA 4R9CA 4BK5A 3LSEA 4AVVA 5SV8A 4GH4C 3IIAA 4COZA 1SBDA 2QTWB 1FNYA 1JMUB 2AACA 4LQRA 4P5YA 4D7YA 1N3OA 2C9AA 4RQPC 3LAGA 3DKWA 4LJHA 1Q5OA 4QX0A 4YM0A 2OIIA 2J42A 1NY71 4G4FA 1S0CA 4B4PA 5FY5A 1R1A3 1JZ7A 1RHI3 4H7MA 1GBGA 3TEYA 4M4PA 1MQTA 1MZFA 1QY4A 2QQLA 3GHNA 5FYIA 3TAYA 3ZXFA 1ZRRA 2D6LX 5EQUA 1VRH3 5BNPC 2VCCA 1YFYA 2HKXA 1QJX1 1GUIA 1O3SA 4OZXA 1CJPA 5CG8A 3FE5A 3MLKA 2QQMA 1F2NA 2EIGA 2VG9A 5CB7A 2R0FA 2ADEA 1SG3A 1W6OA 1YI9A 3GZAA 4R9BA 4IXLA 2F17A 5A80A 3GZUC 2J1RA 3DYPA 1KXGA 1W6QB 4YNIA 1DQ2A 1R083 3KQ4B 3H9AA 3WHUA 1NYWA 3CJIA 1WGPA 4JKKA 4YW5A 5C5TA 1U12A 1REFA 2QQJA 2BNOA 3N36A 1YJKA 2A3XA 1QEXA 3ZFFC 1YHFA 3R4UA 4QB6A 4FSJA 1UY2A 3NKTA 4G9SB 1ZZ7A 5FPVA 3VV1A 5C71A 2W5FA 3J8F1 4P5HA 1J59A 3URFA 4OYUA 3NV3A 5FXWA 4M3CA 4FTEA 2HBUA 4MXWA 4BE3A 2QQNA 1GZTA 3MI8A 5FR3A 4DXSA 3LB9A 4YVSC 1V00A 1PO13 1PVC1 4LK7A 5A7WA 5FO8B 1PGL2 3O7OA 1NA1A 4QKDA 3WP5A 4DUXA 1OC1A 2CNAA 2ZAAA 2GAUA 4QPIC 1D4M1 1AR62 4HZFA 4Q4W2 2HWD3 4PQ9A 4AK3A 1GP5A 4HBNA 5FP4A 4AVCA 1W8WA 5F3GA 4RR3C 1LCLA 3WNLA 1FXZA 3C3VA 4EZ4A 3TWIA 2JKBA 4B7EA 4ZKTB 2VOWA 1RUD1 3HD8B 2RS51 3CL1A 4EE2A 5K8SA 1DIWA 1ULFA 2G1MA 2LUWA 4PF1A 3MZHA 1H2MA 2DVGA 2WYFA 1D2SA 1JOJA 5LRRA 4FXKB 5K0UB 3BU0A 4YFWA 4NIAA 3HAGA 1W3VA 3BALA 3VBOC 1JZ4A 3FLPA 2B9VA 1UWWA 2L9LA 1UYXA 2ZZQA 2WUHA 1AYN3 1D0GA 2TBVA 1A78A 3LEIA 3MV11 4LO5B 4UFHA 4AHYA 3IWZA 1G86A 5J36A 4AHWA 4E2QA 3LA7A 3MO4A 5L9VA 3LA3A 1YCIA 4Q4Y3 2R072 5KXCA 5DAVA 1C5IA 5FPBA 3R6SA 4BQXA 1S2BA 1UOJA 1ND2C 2K46A 5FZMA 1GQGA 3OSDA 1POV0 1O5UA 4IE0A 3O0XA 3QBQA 5DAPA 5FY1A 2W1SA 2Q8CA 3B69A 2O8OA 3WW2A 4BU2A 1CJDA 3I2DA 1JTZX 1RINA 5FYTA 3WCRA 5C3RA 4IEUA 2YG0A 2WA3A 5BXXA 4AVSA 4CDXB 3V0BB 2H6BA 3O12A 5HV0A 4RHV1 4YRDA 2YBKA 4Q4X3 4FPEA 2ZEZA 3VB9A 1PK6B 3FHAA 1GP6A 1U0AA 2WQ8A 4QDSA 5IW0A 1COV2 1W8OA 1GNYA 1Q43A 2BGPA 5GZDA 3A0KA 3RYPA 3NWKA 4MUVA 1ALYA 3MPPG 1ULPA 2WO2A 1UZWA 1A6CA 3R4SA 4AEJA 3DXTA 5I91A 2VR4A 4ISRA 1XSQA 3HN1A 4L0PA 3HPNA 1BZWA 2TUNA 1LB2A 1LJ7A 2E53A 3GZEA 4JGYC 1W2TA 1QJY1 2EIEA 4QX5A 2EIBA 2BDRA 4P08A 3OTFA 1DYPA 1C8NA 3AMQA 3HNMA 4XF4A 4D8MA 5I0RA 1UU6A 4IEWA 3I2FA 1YLLA 5T54A 1X9PA 4M4RA 4D69A 1NLRA 4FVVA 2PHXA 4M0NA 3WINE 5T55A 1YJLA 2FQPA 5FP9A 3IBMA 2JECA 2VOTA 1NXMA 4RQPB 2I45A 3ZFGA 1CAUB 4HANA 5JR2A 2R041 4GKXA 2XOMA 4LR4A 2XB6C 2BBAA 4GWNA 1GZ9A 1H2KA 3ENRA 5GJ6A 4GWIA 2VMIA 5C8CC 2WO3A 3VKOA 4EN9B 1AXYA 1PIV3 3POFA 4H7LA 4QX8A 2XJQA 5FZOA 3JBG3 5D1IA 3ZMNA 4QT6A 5A32A 5LA0A 4LITA 1QMJA 4QQHA 4RYDA 3HBZA 3KWVA 3OOXA 1W04A 4CE8A 3ZSKA 3TB0A 5C3OA 1WLCA 2R32A 3POSA 2WNOA 3VZOA 5J7MA 3WR0A 1DYKA 4FTSA 1DGRA 4P9XA 4YLZA 3WQBA 2LM3A 2OVUA 1ND3A 4XAEA 5LASA 2RJKA 1AXZA 3RVHA 5IFTA 1FATA 1GFF2 1NX9A 2ZKNA 5DUWA 5FKCA 1GWMA 3BOWA 2A6VA 3WUDA 4AAPA 4BWOA 4NIIA 1H6XA 1FOD2 4NR1A 4GB31 2XONA 2PTMA 1AR72 1HQNA 2OUHA 2Y6LA 3MUZ1 1GU3A 2DU1A 3POEA 4KL1A 2JDKA 3ZFFB 5EP9A 5H9PA 3AMMA 3WNMA 3RYRA 3V0AA 3ITQA 4PIZA 5IJRA 1C28A 4RD7A 4PIXA 4C0HA 4CP9B 2YBSA 4UWDA 4CEYA 4AL9A 2RG4A 1FI2A 1A34A 5JSOA 1VR3A 2DTWA 1BMV1 1XNCA 3U4XA 1REEA 4OHWA 1EY2A 3VZNA 4YVSB 3E5QA 3UGFA 4AQ6A 5BNQA 1CN1A 1OUSA 1RUE3 1XXNA 4FPLA 3OGGA 1KEXA 2RMU2 1NCRA 1W8NA 2JB4A 2Z79A 4QPIB 5A3OA 2VO5A 1BEV3 1G9DA 5J37A 5JWPA 1C4RA 1KDMA 1U5XA 1QKQA 1B35C 3B01A 3AVSA 4NUBA 4RR3B 2WNVA 2X8KA 5H9SA 3I2IA 1OT5A 1HN1A 1TVGA 1HXS3 4KH9A 3A21A 4JZRA 4CDWA 2K2SA 1QJZA 2JIJA 5LA2A 5DUUA 1SPPB 5GZEA 3N9QA 1OA2A 4WZCA 3UETA 1C8M3 1LTEA 3SCHA 4CCEA 3C7OA 5JOYA 3VBOB 3WG1A 5JAXA 5F6KA 2A6YA 1OBNA 2VW2A 4W4ZA 3USSA 1ULOA 4QX2A 1HN0A 5DUXA 4E2SA 2XR4A 5G04L 1RVF1 1J83A 4FOQA 4L92A 2GNDA 2JXAA 1QJU1 5FYHA 5D8AC 3K48A 4LOTA 1ND2B 2FMDA 4IV1A 3WT3A 1AR92 3R05A 4KWUA 2IUWA 3QH6A 4XILA 1N3PA 2R16A 3POYA 1A8MA 5IK7A 3J26N 4AW7A 5BYNA 3M8LA 4XFBA 4N53A 4CXYA 3U1XA 1XYOA 4KBZA 5A3WA 5HCAA 1XU2A 3I3QA 3VZMA 3AB0A 2QJVA 1RJ8A 2KR2A 4EWDA 4IDZA 2BOJA 4BZ4A 1YFWA 4AGRA 5DAQA 2UURA 1NY72 3RDIA 3U0ZA 4PJYA 4COYA 1JYCA 3SNMA 5FZDA 5ABJA 2YPJA 4K6BA 2MNGA 3DECA 4EYUA 4KMQA 2RS33 2PLV3 2Y0OA 4Q0SA 2VU9A 4LPLA 5JLVA 1S55A 3JB4C 1AXKA 4PDWA 1MZ5A 1V70A 1X8EA 1ZRDA 5BNNA 4JGYB 1QJX2 2VUCA 1DQ5A 2JG8C 2BEOA 2VZRA 3C7EA 4L9BA 5CISA 1FYUA 3MGUA 4NHMA 1IG3A 2ARAA 1CGPA 3ETPA 4Y4RA 4BA6A 2CHHA 2JDMA 5HXVA 3AMPA 3FWEA 4URTA 4IGOA 4CEWA 3AZVA 1W9FA 1MVQA 3SC7X 3WG3A 4AE2A 4GJZA 5FYYA 3Q9OA 3AL5A 1F5FA 5FOJB 2RS13 5CEHA 2KA3A 3KHCA 1O3TA 1MS3A 1J84A 2ERFA 4LBNA 3IMNA 3O1VA 4QXCA 2OX0A 3RI8A 2ZBJA 3T4VA 4F8AA 4AI0A 1UZ0A 2XUEA 1FAYA 2GC0A 3ATGA 4A6OA 2P37A 4O61A 4AEDA 2Q5TA 5IVFA 1DG6A 3WEZA 3K4ZA 2VZOA 1CWPA 3OG2A 4NOTA 3M3CA 4MGYE 3VD9A 1LHOA 4HETA 2FDKA 1FPN1 2KXLA 2BYVE 2VM9A 5CFCA 3BIEA 5C8CB 1YQ2A 4A6SA 2WZPP 4QQPA 5GALA 1V6MA 3O0WA 2YFUA 3J8F2 4YM3A 1NQDA 3THPA 3NV4A 1TE1B 5FP8A 5A33B 4XOGA 4HK9A 1JYTA 2XJTA 2HWC1 1H0BA 1I9RA 3RWNA 1WZXA 4XJ8A 4ARXA 4GMP0 1H1AA 1RUF1 2D6PA 3CF6E 5LEJA 1T2XA 4K8RB 5DUVA 1PVC2 2XBO1 3PTRB 3D4KA 2WYSA 3HNYM 3OYWB 1TNFA 3UKVA 2VBPA 1D4M2 3BYWA 4LIVA 5C8WA 2JEMA 4GH4A 1ENQA 2IXKA 4CRQA 1IPJA 1SLLA 1RUH3 2BZDA 3NVCA 3ZSEA 3OB8A 5F8PA 3JU9A 1HRV3 2DURA 2HWC3 1DQ4A 3OY8B 4O65A 2XHNA 4CCKA 4COUA 5I8YA 1RUD2 2RS52 3W59A 3DXUA 5F32A 3EXUA 3PURA 4DOUA 1MS1A 4NHYA 2R6QA 5FP3A 1UW8A 2DTYA 4QWNA 1KDKA 2VH9A 4X6QB 4DXRA 5BNPA 1UPSA 2DUOA 1Q8PA 2VBBA 5FLHA 3GCXA 1ZVFA 3IPVA 2WS91 3TEWA 5CKMA 2P3YA 4UYBA 3ZYRA 1AVBA 2E7TA 2VC9A 1LRHA 5E89A 2O14A 2D6KA 3FC0A 2GN7A 1VMJA 5FK8A 3OBAA 3VD3A 1KGYA 3RI9A 4AFMA 2IFRA 2RJLA 3SITA 1B35B 1GQHA 2W46A 1UKGA 2XJVA 3T30A 4YZ2A 2WN3A 3A0NA 2A6ZA 5C4WA 2YPDA 4BMEA 2WRAA 1WCDJ 3WW3A 3ZN6A 4AI8A 2UYBA 1LHVA 1JXNA 1US3A 2W95A 4RHV2 5K4LA 3IDCB 4BDVB 4AQSA 3AXEA 1JOBA 3USUB 1VBB1 3RS6A 4I3GA 1SLTA 1UX7A 3JD73 3M2MA 4ZU5A 1EPWA 1V9U1 1X33A 2A5ZA 2AREA 3SQOA 3TNQA 4W65A 3N9NA 4ASKA 1LOCA 1S0FA 1ZYBA 1QNYA 5I0UA 4DNYA 3WNOA 5HV4A 1Y7BA 2D93A 2RR11 3IDEA 3P6BA 4FXGB 3SH3A 1PM7A 3NV2A 4LA3A 1MEC3 2VZPA 5D8AB 4TZDA 3LSDA 2J7MA 3NNLA 1DQ1A 2VQ0A 1QJY2 3BU7A 4XCAA 4BXFA 4BH9A 4I0AA 1PO21 1LOFC 3BOPA 4XDOA 2ZS6B 1W2NA 3D6EA 4LO6B 5FPAA 3RSJA 2D5HA 5BNOA 1F9KA 3SCFA 4J1XA 4X8PA 2XVLA 3H8RA 1FMD1 3C7HA 1SLAA 2LROA 1UZZA 4ARYA 4RSUA 5FZ4A 4AI3A 3LPGA 4BQ1A 3PVEA 1GZWA 2AC1A 1WMXA 3I7DA 4FO9A 1J58A 2OPWA 3NNGA 4YZ4A 5LATA 2R042 1AYM3 1H2NA 3ZYJB 1L7RA 1Q8SA 4F83A 3VKLA 1DLLA 3ECQA 1CX1A 2VQUA 2WAAA 2WA4A 1G7YA 1O4YA 2IC1A 2W08A 1MZEA 4AR2A 3VHNA 5CNAA 5C9AA 1UIKA 2VTXA 3LIGA 3PUAA 5C3QA 1H8TA 2QCSB 2ZGPA 3W5NA 3VL8A 2BPA2 3RPQA 2O1QA 4AEMA 2J1TA 5FO7B 2ENRA 1XNAA 2JG8B 1DCSA 3KVAA 4FI9A 3MFCA 4MGTA 3MIFA 2BGCA 4ZS3A 3WSOA 4AFBA 4BQWA 5KWRA 3WDUA 1VALA 1O4ZA 1VBA3 2VVEA 4BCUA 5A70A 5C7GA 3N7LA 3BCWA 3FZ3A 2YC4A 1QXPA 4XETA 1DP0A 4XQDA 5AVPA 5J96B 2ZXQA 2YB7A 4UF0B 4EN0A 4Z92B 4LO8A 4I0WB 4YGDA 5FPUA 2DCTA 2SLIA 3LDRA 2EXJA 3PUQA 1UNBA 2EXHA 4N8MA 2ZHLA 4U36A 4YZ3A 2K0GA 1H4GA 3MW4A 3SKJE 2ETEA 5FXVA 2VZ1A 3AKPA 4NHXA 3OGRA 4GB32 1W3XA 5HBAA 3B9IA 1YQ5A 2HWB1 1ODNA 1I5ZA 3CJXA 3I2GA 2VVDA 4WM8C 1J1LA 1SZBA 1Y43B 5FRAA 5EYXA 5KHIA 1Q8QA 1S2KA 3AYEA 5LY1A 1YIPA 3DV8A 1ZBE3 5EWSA 4FCAA 1ZBA3 2OW4A 4N43C 4QB2A 4P00B 3AL6A 2OQ7A 3VBSB 2E6VA 1BMV2 1JOPA 3WDVA 4DY5A 4QXBA 2VZ3A 2BNNA 3VBUC 4EN8B 2PQQA 4HSJA 3WP4A 1HB1A 1LGBA 3Q8EA 2WZR3 1EUTA 2WZEA 3IN9A 1XU1A 1QQP3 3K75B 4AOCA 2CU5A 1SQ4A 1QGLA 1KS5A 4S2HA 2AYHA 4QXKA 3W9AA 1YNAA 4ATEA 4WZFA 4RS5C 3G6JB 4YSFA 3AP4A 5FPXA 2V4VA 3POWA 2JG9A 1UOFA 1S0DA 2B8MA 2JE8A 3Q8AA 2JX9A 4YW7A 3EYPA 1HRI1 4K1ZA 2JE9A 1WCQA 1V6KA 3ZN5A 3ALQA 1RUJ3 3J7MA 2C26A 2VNOA 2CYFA 1PZ8A 4PT6A 3AKQA 3O14A 4GQ7A 4Y24A 2G4IA 1XSRA 1I6XA 4LIUA 2OYZA 5FYZA 4XCBA 4LBJA 2UYAA 2DV9A 1HJFA 1NE6A 1RVF2 4AWDA 4KWKA 4AYUA 1QJFA 4LULA 1YQ6A 4BQ5A 1QJU2 1CESA 1TMF1 1DGRN 1OQEA 1VB4A 3RGBA 2HWF3 2WBKA 3N9MA 1JUHA 3NRUA 1G6NA 4GJYA 2CY6A 1W6NA 4PI0A 3VKNA 4JKMA 3ILRA 1RUG1 2R061 3N7JA 5A3LA 2Y6HA 4XABA 3KCYA 4PHZA 4Q0PA 4MGKE 1QOSA 1UF2C 2D5FA 3AP9A 4CDXC 3UL2A 4MGIE 2Y34A 4AFAA 4HKOA 3AX4A 5HCHA 1VBD1 4BIFA 1RXFA 1HV0A 1VLNA 3TN93 3VDDA 3RZZA 4NROA 2QFEA 3JB8A 2PELA 2I07B 2VPVA 1PK6C 5ERLA 1A3KA 2QZ2A 1POQA 1XOYA 4FTBA 2W92A 5I8TA 5EIYB 3GBWA 3CLPA 2ZTNA 4NPLA 4IESA 2JDAA 4Z2AA 3KGZA 2VULA 1AUYA 4V2VA 2PA7A 4K3UA 5I0TA 5KC6A 4A45A 5L9BA 4CYDA 2R30A 3GXUA 5L9RA 3AZWA 3CZUA 4C8DA 3ACFA 3MW2A 5FZAA 1GICA 2DBIA 3MV01 4ZONA 2C5DA 4MGZE 3VN4A 3ZMOA 4B1LA 4YG3A 2QDRA 2QDNA 5FFOC 2PHWA 3VBRC 3B00A 1GR3A 1R1A1 4YARA 3VLBB 1RHI1 4Q0QA 4QHBA 1S0GA 2RE9A 3H7JA 2ZX4A 3AYCA 3HN3A 2ZOEB 2LTNA 2D3SA 2WQ4A 2Q1MA 2ZGQA 1OOPA 1YXWA 1VRH1 3SCGA 2VNRA 3AVRA 1Q8VA 4MH0E 2UWAA 3LCPA 2DU0A 2KD7A 1UYYA 2WLPA 2ZEXA 3DUIA 4FOVA 4YWAA 2FDIA 5CIRA 4JVAA 3MFAA 4NE9A 4LHSA 1FPN2 1VAMA 2A75A 5JOWA 3LEKA 2Q8DA 3VHOA 2ZACA 3FFZA 4HPKB 4Y20A 3UGHA 3WF3A 4EWAA 1YFUA 2ZX0A 1QOOA 1KJRA 4QDQA 1VBC3 4FQZA 1R081 1RUF2 1FX5A 4JGZA 5HXMA 3LPFA 2DCZA 1WW5A 1WA6X 2XBO2 4MGSA 5FYSA 1H8VA 3VDBA 2GSYA 4RA0A 4XVHA 2YY1A 3I8TA 2FCVA 4DQAA 2Z42A 4FPCA 4FPYA 1QDCA 5EHDA 4Y1XA 1IZ3A 1OKOA 1ST8A 2XWJB 2PYTA 5GZFA 4OHXA 3LEMA 4EJRA 2E7AA 2H6CA 1RITA 3QH7A 3IAQA 2WLQA 1YQCA 2HEYF 4WM8B 3VBHA 1PO11 2BUKA 3CZJA 5G05L 5ANNA 5F5IA 5F3IA 5FYVA 3DPRC 5LWBA 1JYXA 1QU0A 2ZGNA 4FPOB 4N43B 3ZYBA 3D0JA 2IXIA 2GC3A 3ZIWA 4Z82A 3B7MA 4Y22A 2HWD1 3BI3A 4AVTA 2EXIA 3VBUB 1HQWA 3T09A 2WS92 2FCUA 1W6PA 2W9XA 3AJYA 3DYOA 4INDA 4OI2A 3ZFEA 2CAUA 1LOBA 3KT1A 4IV3A 3AFGA 3J7NA 5FP7A 4WM7C 2F4LA 4QPGA 1F8VA 4CA9A 3K4AA 1N47A 1URXA 1Z7S3 2LW8A 1QXJA 2P3IA 3PTYA 2AEYA 3Q8BA 1SFNA 5FUPA 1X9TA 4RS5B 2Q8OA 5F9TA 1AYN1 2JDHA 2PQSA 3ACGA 5FUNA 4C1XA 1W6MB 4LUMA 4QKFA 2UU8A 1P8JA 2WNUA 3IDAA 4LKFA 1CAXA 1ZRFA 1JZ6A 4OUMA 4Q4Y1 1VBB2 4KGGA 4L8QA 5FY4A 4YW6A 1V9U2 4NRMA 4CDQA 3FN9A 3M1HA 2RM23 1UY0A 3OD4A 1O59A 4YPJA 3CU7A 3VZLA 4XFIA 4CCJA 4CDUA 2RR12 4PCRA 1OHFA 3TNPB 2YUEA 1GANA 4B8EA 5JSRA 2OPKA 5FQ0A 3SH4A 2FDGA 2D7FA 1SBFA 4TYSA 2TNFA 4TLGA 3WXPA 1AX0A 4Q4X1 4KQ7A 1TQ5A 4MZUA 5L19A 1PO22 1OLME 3FBMA 4YGEA 5F2SA 4BXSV 2BNMA 3WF1A 4GALA 5CG9A 3NNMA 4XACA 1E5RA 1EPZA 1GMMA 1YUDA 2DVFA 2MEV3 5IWFA 2AH2A 2YMZA 3S7EA 1FMD2 4ISQA 4N9IA 2IFWA 3ZYHA 2WFF3 4CP0A 3NAPC 2A71A 4PIYA 1K12A 4KBBA 5L7OA 3CMGA 4XBNA 3ZDVA 1I3HA 4NAOA 3ACIA 2HEWF 1VAKA 5DDJ3 3RJ2X 4LBQA 1WCSA 2DDUA 1WW6A 4XQWA 4CPBA 4YM2A 3I3MA 2W87A 2Y38A 2PAKA 2WT1A 4AVBA 4QU2A 3DEMA 5ACA3 4W6YA 4XDPA 1F15A 1NCQC 5JVVA 4Y1ZA 1JU3A 3MBWA 1XE8A 2WO1A 3NJVA 2W68A 3T1MA 5FREA 2ORZA 2DYCA 2VNGA 2XJUA 3MF6A 4IERA 1GOFA 4N9HA 4DRRA 1R093 1O91A 5JZGA 2WWJA 4IEVA 3NNFA 1OFSA 3QLQA 2BFUL 4QQLA 2CSGA 2ZMKA 1CZVA 1BYHA 1RMU3 3VBRB 1RUI3 1V6NA 2JE7A 1WD4A 4KU7A 1EV13 1VAVA 4Z2WA 3GYDA 4I09A 5F5CA 2NZ9A 1PIV1 4EN6B 5LBBA 4HK8A 4B7KA 3AMHA 4OI0A 3JBG1 4HVRA 4AAXA 4ZU4A 3RZGA 1X82A 3VHRA 2ES3A 5FZ7A 4E27A 1IPSA 5FYBA 3S5QA 3E1F1 4A3ZA 1LOGA 3UJQA 1M06G 2D97A 1GLHA 1H1IA 1Q56A 2HWB2 3P3NA 1IS6A 1EUUA 1H9WA 2D98A 3AKTA 4LA2A 3KT7A 1H2LA 2IXJA 2R7EB 2BBVA 3MUY1 2F6BA 2R1DA 4WBBA 1WW4A 2C0ZA 1DHKB 3IMMA 4L99A 2CGNA 3HT2A 4MYEA 2HWE3 1K3IA 2BV4A 5T5OA 1LGNA 4GULA 1UPIA 4UW6A 4RFRB 3K77A 2XQXA 4FP3A 1DBNA 1LOFA 4IEQA 5FMDA 1H6YA 1YI7A 4PBPA 1REDA 1GSLA 4DZGA 1LULA 4AQ2A 1FV2A 4Y3OA 1O6UA 3GJBA 5C33A 2VE1A 3HOBA 4OULA 3SMHA 4DFSA 2CGOA 3RQ0A 1CR7A 3ELNA 3RFRA 3TEXA 3WF2A 2BVBA 4K1YA 2WT2A 4URAA 5IUQA 3PVBB 3PVOA 2AENA 1H9PA 2ZGMA 4TXWA 4DINB 2F4PA 4YZ5A 3HQXA 5CADA 1HRI2 1RUE1 1OH3A 2DVBA 3C8XA 4F3JA 4DXTA 2DUQA 1NT0A 2X29A 3DPRB 1K5MC 4NO4A 3RZJA 1CX4A 1OF4A 1F5JA 3SH5A 2YZ4A 1BEV1 5FIXA 3U75A 2X5IB 3S57A 1SLIA 4MVTA 4XJUA 1O7FA 3UKTA 3HEIA 4QPYA 1SMVA 1ACCA 3ABZA 4XFHA 5LBFA 5A7OA 4AF9A 5JR7B 1BVVA 1GP4A 3WG4A 3ZOIA 4CVUA 5AC93 1GWKA 3NW4A 1HXS1 1OVPA 1TMF2 3POJA 4WM7B 4DUVA 4ZXEA 3PIJA 4A42A 2OQ6A 3WW1A 1T6GC 4D6QA 5BV6A 2JD4A 2YC0A 5LB6A 1WW7A 2GC1A 2WIIB 3VKFC 4DUWA 1EAH3 1C8M1 1OH4A 5FY0A 3RNSA 2WSVA 4AEKA 3N4MA 1RUG2 3LE0A 4NVPA 2R062 1AR83 2NP0A 1Y4WA 3RRDA 4I01A 3ZPYA 2WZ8A 2E51A 1MS4A 2JD9A 2VUDA 1S0EA 1W6QA 1K45A 3MHZA 3I59B 3UT0A 1HB2A 2VD7A 1S0JA 2P6HA 4YVWC 1UAIA 1VBD2 1YEWA 3H3UA 5FWEA 3TOJA 3NV1A 4JQRA 5DABA 5FZFA 3H50A 4J25A 1C1FA 1D4VB 2ARCA 2W94A 3IIIA 1HV1A 1AL23 5SV5A 4XAAA 3A4UA 4BK4A 2C24A 3U4SA 5A6YA 2ORXA 1BBT3 3IZOA 3AZZA 2Q0AA 4Y26A 3MIHA 1W9YA 1JH5A 5FBZA 1VBE3 4NWWA 1OD5A 3ZN4A 3NNJA 4UXAA 5DZGA 2OT7A 4LHNA 2DVDA 5KR7A 1CAWB 4FOWA 5A3PA 3ACLA 5J1XA 3F95A 4QKNA 2DVAA 5JI7A 1SFPA 4BM8A 4LBMA 1IPKA 4RS5A 1R1A2 1RHI2 3NAPB 2VMHA 2RS31 2PLV1 5FLIA 2ET7A 1OVSA 5EV7A 4IEOA 3AC0A 1VRH2 4XXAA 5FZ0A 3U10A 3ZVXA 2D3PA 3RMYA 4A3XA 5IVCA 2ZEWA 2UWCA 5CZKA 5KXDA 1OPMA 1HIXA 5IVYA 4Z07A 5A3UA 3LDBA 4DO0A 4IL7A 4L97A 4XJ9A 2G19A 5K0UA 5LBEA 1NCQB 2EALA 3LA2A 4UFIA 3O1RA 5CU1A 2RS11 2G9GA 3UGGA 4CP2A 4FFIA 4H14A 1E5HA 3KB5A 2P4EA 1R082 4QGMA 4XUTA 3CHXA 5GLTA 5FWJA 1KFXL 2GH2A 4XUNA 3WNKA 4Y1YA 2QQOA 3AM2A 4BQYA 4FAGA 5FTTC 1JUIA 5FZ9A 1O8PA 1RUC3 3ZXGA 1WMEA 1OD3A 2P5BA 2W2IA 1E5SA 2WFPA 5FJHA 3WY6A 3HT1A 4I30A 1JBCA 4BQ3A 3AYAA 1UCXA 4FOYA 4YFZA 4Q29A 2Y0IA 4CDXA 3IB3A 3V0BA 1OSGA 5FZ8A 3ILFA 5LBCA 3V64A 2VMEA 3CBNA 1PO12 1PK6A 5JOXA 4N7UA 5F6LB 4AI9A 1C3HA 3ZKYA 1R64A 2Y33A 1CAVB 1GNZA 2Q30A 4FFFA 2H0BA 2XLGA 1ASJ3 1SEFA 2EAKA 4HOOA 4O9GA 3HR9A 2VQAA 4LO4B 5GM0A 2J1AA 1TME3 4OI1A 2HWD2 4JHZA 4MADA 4OMDA 1RUH1 1KS4A 4V1PA 4XBQA 1NA1C 1HRV1 3VBSC 4E4SA 5D2AA 1F4AA 2VOVA 4GWMA 2J1UA 4XIKA 5BPXA 5KBFA 1KFUL 2I74A 3LKJA 3OGSA 2RV9A 5DZEA 3VKMA 5K7PA 2C6SA 3U11A 5CFDC 1TNRA 1TG7A 4JHTA 3ZM8A 5IFPA 4M0HA 2N7GA 3A23A 3T2PA 4PBOA 4EN7B 1AYN2 3BGAA 4CU6A 4RGAA 2A70A 5KXEA 1G9CA 5F39A 4A41A 4E9KA 2P34A 5J98B 1GYKA 2V5DA 1M4WA 3BTAA 1F35A 3QCWA 4RQPA 4LKSA 4Q4V3 4Q4Y2 1CAUA 1N1YA 2XH6A 5FK7A 1RXGA 4GWJA 4D7TA 3LFMA 4R4ZA 1G9BA 1K5MB 4LE3A 4R4XA 5E1RA 1W9WA 1RL3A 2Q4SA 2GC2A 2EA7A 2B46X 3AJZA 4R9AA 3ZXEA 4Y1UA 1ZZ6A 1GWLA 3J4UH 1RIRA 2WINB 1MVEA 3LWCA 2XGXA 3KSCA 3N9PA 2V72A 4ZS2A 4D3WA 4OZOA 4Q4X2 3PJYA 4LBOA 4CZSA 2FBEA 3UKNA 4BIOA 3JD71 3S0MA 4NAMA 2AEZA 2W0XA 2GMPA 5L36A 2XKOA 1VIWB 4PLOA 2VMGA 2ZX2A 2R1BA 2OUJA 4G3YC 4K21A 5EJZB 5A1AA 2VUAA 1D2QA 1R1ZA 5FY8A 3R0RA 4IETA 2GMMA 2XKPA 1PZ9A 5DXDA 3VD4A 1MEC1 1PNGA 4HKWA 3AZXA 4YVWB 1AL0G 2VXJA 4WVMB 5HPOA 2BFUS 1RUNA 3FX3A 4JDOA 1QJEA 1A8DA 2RDSA 3OGVA 4BJ0A 3ZFFA 2LRPA 5I0SA 4I3PA 5KHHA 3FMGA 4X8NA 4XHXA 3RZLA 3LOBA 2VAUA 4FPHA 1BK0A 2XL7A 1CQ9A 3J7LA 3THCA 4CP9A 2PFWA 2WNEA 3ON7A 2W47A 4LMFA 2CV6A 1W8UA 4QXHA 2ZCWA 1SCRA 1UZYA 3PMSA 4FQ4A 4YVSA 4P9IA 2JJ6A 2YHJA 4JC1A 5E8AA 1TEIA 3WOGA 3CDZB 2WDBA 1AYM1 1LESA 1I1EA 3GHMA 2MPFA 4COVA 5F2WA 4LK6A 4J6GA 2WSUA 3UJOA 2C4XA 5LY2A 4QPIA 3ZLIA 3ZFGC 5DQ0A 1PIV2 3JBG2 4RR3A 1OLRA 3IT8A 3PU3A 2B7YA 3T0DA 1OLQA 2X10A 3T2OA 4UFLA 5EJ3A 1K42A 1AR63 2DF7A 4JRLA 5EXOA 4HONA 1VBA1 4L11A 4Q4W3 5F3CA 1SPPA 5IVBA 5JXJA 3WDYA 2VCMA 4Q0UA 5FXZA 4KG0A 3UESA 5FYMA 1O4TA 1PHMA 3VBOA 5FMOL 3EQEA 5FZ1A 4LKDA 1OURA 2QE3A 2ZZJA 1UYPA 2BRTA 4GIQA 1LGCA 3M7AA 4YW2A 5A1LA 2CL2A 1RB8G 2WABA 5LZ6A 5JDBA 2BOIA 1W6OB 1NG0A 3I3DA 5LK7B 4H3WA 2VOKA 2GNTA 1ND2A 5CAZA 1ND3C 4KG8A 1OA3A 1OI6A 3RYKA 1BCXA 2HH9A 4JCKA 1D0HA 2IXLA 4HMZA 3FJSA 1ZBE1 5ANQA 2R073 1ZBA1 4QU1A 2V5YA 1U5YA 4XMAA 5AVAA 4KI5M 4FAHA 1W90A 4XFFA 3ZSJA 4CCCA 3SEEA 3ETQA 1CPMA 1LOAA 2ZX1A 5A7SA 3O1PA 2ZEYA 5IK5A 4CU8A 1RUE2 3GJAA 2E26A 2WZR1 4QQOA 3ZXKA 4HFSA 2B9UA 3BTXA 3C7FA 5FZBA 5JXGA 4CEYC 1UD1A 1QQP1 4ET7A 1MPXA 4M3CB 4Y33A 2A6WA 3I49A 1BEV2 3K3OA 3K2OA 4MXWB 3BTYA 3KQRA 4JDMA 4CUGA 1W2OA 4WV8A 1RC6A 5F5AA 4EQVA 1UXZA 2ZHKA 1QXRA 5A7WB 5ISLA 3MIDA 2XVGA 3LF7A 1NA1B 3I54A 2VY0A 4Q8KA 2VBDA 4E8DA 1HXS2 2ZMLA 1NCRC 1COV3 3H3ZA 5EJ1B 2K9ZA 2WWSA 4JGYA 3WLUA 4BOWA 4UFKA 3I2JA 2VZSA 1W2UA 1N1VA 1MZ6A 1ZZCA 1PGW1 3WX5A 3ZSLA 2X53S 3M70A 5KHJA 2B42B 5CFDB 1RUJ1 1C8M2 4MHRA 5FZKA 4PLMA 3I3EA 2WNVC 1UYZA 4SBVA 2KM2A 3EJKA 5D21A 4CCDA 5A7NA 4XMIA 5T52A 3M3OA 2JDUA 2GZWA 1LHWA 5FZ3A 3TYJA 4CDWC 5F7UA 5JPNB 4HVQA 3IM0A 3LIHA 4XUOA 2A3WA 3SKVA 4A7YA 1BJQA 4QDRA 1IQDC 3DKQA 3PNAA 3ST7A 1NLQA 2O0OA 2X09A 2XG3A 1SHWB 4U2AA 1CZSA 2GP3A 1I5PA 1IOAA 2HWF1 2HYXA 1S1AA 4HN1A 3S30A 3ZIXA 3ZSMA 5DMYA 1CD3G 1W8HA 2R49A 3B5LB 3H1WA 3QD6A 4XZPA 2VW0A 3ILNA 4XBLA 1DZRA 4DEVA 4LHKA 5C8CA 4XF0A 5T3NA 4DRVA 1LU1A 1Y9MA 1NKGA 2E9QA 1ENRA 1G9FA 2E33A 3KCXA 5A33A 5FO9B 4HXCA 4YW1A 3B93A 4TSVA 5KXBA 3OJBA 4IV1C 2BERA 1W0PA 3HJRA 1QH6A 4K20A 2YGMA 1JYWA 1UKRA 5T5LA 3ZO0B 2DWRA 3D3AA 5LRSA 4BLJA 5DN2A 3TN91 3NQHA 3OYWA 3KT4A 2W52A 4N53C 1PZ7A 4AI1A 2JICA 3KF5A 3U37A 2YROA 3ZYPA 4Y4YA 1NUKA 2PLV2 1V6LA 2Q1FA 1QF3A 2RS32 2BW8A 4LLFA 3Q8FA 4FFGA 4NJ4A 5DG2A 2J1VA 5FXXA 3GBGA 3I2KA 5M0TA 3O1OA 1SFYA 3OY8A 5JIAA 2JWPA 5ABJC 1AX1A 5HCBA 5A7PA 3D82A 3LGRA 1NXD1 4X6RB 5FKBA 2YU1A 3EB7A 1BK1A 2W3JA 3C2UA 1JI6A 1HDKA 3AP6A 4OHVA 1YWKA 4NPRA 2PHUA 2ZGSA 4XXPA 3ROUA 2RS12 5I0DA 1FOD3 1MS9A 4AZZA 1AR73 3INAA 3LEGA 3RG0A 2ZGRA 3ZYIB 1RJ7A 1IHMA 3ZR5A 1UY3A 4CEWC 1FT9A 5FLJA 3WQ1A 4QQ2A 3K46A 3UV9A 3T2QA 1APNA 1PMHX 4O7XA 4XJZA 1X50A 5E88A 4LT5A 1SDDB 1VB2A 1F31A 3AK0A 4JDNA 5F5QA 3H8OA 3ZFGB 2WWUA 2ZPXA 1C1LA 2AZ5A 1B35A 2CWMA 4AEDC 4BQ4A 2ADDA 2RMU3 2GN3A 4FT8A 1VBC1 3JQWA 3PJQA 1ONAA 4EZHA 5CFCC 2EF6A 1DGWA 1V0AA 3FLRA 3OPWA 4I02A 2VGDA 3J7HA 4LTAA 5FZOB 3USUA 2FD8A 3AKRA 2A73B 2CDOA 2E7QA 1YC61 3POBA 3DYMA 4UT5A 5FCCA 5A32B 2IZWA 4NIDA 3GF6A 1HJGA 1XNKA 3Q8CA 4UI9L 3BIWE 4XQ4A 3N9OA 1ZRIA 4XFCA 4UOJA 1BLZA 4P14A 5JMCA 4OLLA 4MOAA 4YGCA 2QKDA 1NLSA 5FY9A 1RUH2 1STMA 3LQCA 3TBDA 1HRV2 1PGSA 3HQRA 2HWC2 4XPVA 1TZOA 2D44A 4BQ2A 5D8AA 2P17A 3P5BA 3VDCA 3OCPA 1HB4A 2YU2A 1JZ8A 1ND3B 1PMJX 1GOHA 5C3SA 4IE6A 4ITCA 3EO6A 3HQUA 1ENSA 2J1SA 2YXSA 4KWLA 4P9WA 4LOSA 4LBKA 3HVDA 4QGLA 3GZTB 3WP6A 5F1RA 5EYYA 2NYYA 2JDYA 3S6PA 2LALA 2YDEA 4Y5TA 3VZJA 5CA6A 3E6DA 3LFIA 1AF9A 2VQTA 4E4HA 2UY8A 4GA9A 2RDRA 3F2ZA 3WD5A 3V0AB 1Q8OA 3ZR6A 1AR93 3A7QA 4XE9A 3RZKA 1XYPA 1O8SA 3ASIA 3E5UA 2W91A 3JUUA 4JKLA 1JZ5A 1POV3 3OEBA 4CEYB 2MHFA 5HI0A 1UOGA 5BUVA 3ES4A 1Z7S1 4K9SA 1WMDA 1UMZA 4RN5A 1Z78A 3MIEA 4FPFA 4MG2A 4QM8A 2QBXA 2IXHA 1VJ2A 1JW6A 3H8UA 2Q8EA 4I0BA 1IS3A 2D43A 1WCUA 4XF3A 3G7DA 1XNBA 2X5IC 3FHIB 2C9KA 5EPAA 1NCRB 2ARXA 1V6IA 3T1LA 4C91A 3V65A 2JG8A 1HW5A 5FOBB 4P9GA 4META 1NQJA 3JD72 3N7MA 2W39A 2WNVB 1U5IA 3QOPA 2RM21 4JX0A 5C4WC 1OLMA 4NN0A 4OI4A 4UF0A 4W6WA 3ZXDA 3AP7A 1QJX3 3WUCA 4CDWB 1CIWA 4B4QA 1ZA7A 5FZIA 2J1EA 1SBEA 3H0OA 4MHUA 2XWBB 3AMNA 5HCFA 2P2KA 2RDNA 1MEC2 1N3QA 3EBRA 3B9CA 2GH8A 2PAEA 3IAPA 5APAA 1DGLA 4IEYA 1XB9A 1O5LA 4YM1A 4DXZA 1S4CA 2Y64A 4SLIA 3PU8A 4XTPA 4XUQA 3KV6A 2MEV1 1DZTA 5AFBA 3NL1A 4JAAA 3WQ0A 2A3YA 4OQ8A 2WFF1 4KNCA 4HN0A 2FHRA 4LO7A 4IV1B 3VBSA 2D40A 3HWJA 1S0BA 3OGJA 3VHPA 2XUMA 4CUCA 5DDJ1 2IWGB 4F7ZA 3OF1A 1AYM2 1XC6A 3I4IA 3VL9A 5BNOC 2GP5A 1H30A 3J8F3 5CFDA 3HIFA 5FMOS 4LNVA 4C90A 5FZHA 4N53B 3VBFC 4A7KA 3BPZA 5ACA1 2V4AA 1WBFA 2WKKA 4QPWA 5FBJA 2P6CA 3GDBA 4XJWA 3OBZA 1CPNA 1PVC3 1DZQA 1UO9A 4Q8LA 4XHBA 3RWKX 4IE4A 1JHJA 2BP6A 2VZUA 1U5ZA 2YC2A 3B94A 2QUOA 3KM5A 5ABJB 1CIYA 4GD4A 2ZKLA 1D4M3 3MW3A 2E31A 4XF9A 4ES9A 4OCTA 5IK4A 5IT6A 1VBA2 3ORJA 4B29A 5C9AC 1R091 3MIBA 2ZGUA 4M3CE 4QX7A 1H8TC 2ZX3A 4UAPA 1F4HA 2GU9A 3ME2A 3KLSA 4FFHA 5E6HA 1LHNA 4PDWB 2YFZA 1OFNA 3ZX7A 4MLOA 1RMU1 4XFGA 5BNNB 1RUI1 4HLTA 2PHTA 2W1WA 1EV11 1RUD3 2RS53 2AUYA 2P3KA 4QKBA 4RGGA 3WNNA 2Z4FA 5LK5A 4XIOA 2XLFA 4UFMA 4LORA 4CEWB 3NKGA 1FV3A 3O1SA 4M3CF 5JCTA 1IKPA 3KV5A 1HQLA 1YFXA 2ATFA 4E4DX 3I3BA 5EZWA 5JOZA 1VRBA 3UYJA 5IAXA 2VL4A 1ZA4A 4KU8A 3WDTA 2VW1A 3N3HA 3MYXA 1EYBA 1XE7A 2DFBA 2GMEA 1ZBE2 2TEPA 3PUHA 1ZBA2 4Y5SA 4O9EA 1KITA 4AEDB 5KHGA 3KZ4C 2EICA 4Q5OA 4WVVA 1CONA 4QB1A 1DLCA 1DDLA 3M4FA 2HWE1 3OUIA 4GZ9A 4XDQA 5CFCB 3LOIA 5T50A 3WF0A 2WZR2 5C6CA 4UW5A 3HBKA 2GNMA 2ZAHA 2ZGLA 1QQP2 5FAXA 4IW3A 4Y1VA 5LCWL 2VCAA 1JODA 1ULCA 3DCQA 1Y9QA 2PN5A 3CQOA 4RHV3 1DYOA 3IDBB 3RZMA 3H1YA 4CXXA 5I8SA 2D6NA 2WAOA 3TRSB 1SCSA 4MGQA 3H3LA 1XRUA 3KMHA 3E6CC 3D8CA 4GH4B 3LZZA 3KV4A 1PGW2 2ILMA 4OUSA 5J48A 4N90A 1RUJ2 4YG6A 1QOTA 4FPKA 1LU2A 1J1TA 1GOGA 1VP6A 3POGA 5FDBA 2JG9C 2ID4A 4AFDA 2PHDA 3MEPA 3PUSA 4OHYA 1DQ0A 1QJY3 3APBA 2VNVA 3THTA 2DUPA 3H1MA 1JN2P 3D5OA 4UBHA 1IKQA 3AP5A 4RFT0 1XJAA 2D3RA 4XZUG 5C70A 5AC91 4XFAA 4LBQD 4CPBD 2VZQA 2HWF2 1D7PM 4AVAA 3KCCA 1B09A 2WQZC 3NJYA 5BNPB 5IVEA 4AFCA 1Z0HA 3JQXA 1EAH1 4LBLA 3P3PA 3IPVB 1W2AX 1KJLA 1BXHA 4ASMB 4MX3A 4QGNA 2PHLA 4HPKA 1AR81 1C5HA 2R043 4DMIA 4ZU7A 1FNZA 1ZZ9A 3GM8A 5FY7A 5A3NA 2HEVF 1SLBA 2JENA 2HYKA 1IS4A 1E57A 5GKAC 1YIFA 2WT0A 3FBYA 2XDVA 3T0AA 3E6BA 1W05A 4JV4A 2EAAA 4CCNA 3S5AA 3MPBA 3TN92 1T6BX 2WJSA 4Z1VA 1LKNA 2ZGOA 5C4WB 4ZZ5A 3ZN6B 4L2NA 4A44A 5J09A 2EIDA 1AL21 5A3TA 3D0SA 1BBT1 1J3PA 2OA2A 5JMOA 3PUIA 1JU4A 4S2GA 3K51A 3VDDC 1VBE1 1ODMA 4EROA 1O3QA 3R4DB 4HKLA 3THDA 2VZVA 1IGOA 1KRIA 3MF9A 4BISA 2ZGKA 4WM8A 1PX3A 2E32A 4E2GA 4ES8A 2VXRA 1OKQA 4S2FA 1H1MA 3VGIA 1HB3A 4MSVA 3I2HA 4IQPA 1XPWA 4LXLA 1W9SA 4N43A 4ZPIA 5I93A 3WQ7A 4GMP1 3M3EA 2DCJA 3CO2A 4GB33 2Y60A 4CSWA 1JYVA 4RL7A 5GZGA 1UQXA 3VBUA 1RUOA 1IS5A 3CIHA 2ET1A 2A6XA 1MS5A 2C1FA 2XHKA 1VMHA 2NQYA 3U78A 5BNOB 2BTVC 4W50A 1MR5A 1VPHA 1BKZA 1WUVA 4QHZA 3WV6A 2XJPA 2ZGTA 4ZXKA 3C7GA 4B1MA 2WO7A 1YO8A 1CVNA 3PLQA 2GALA 3VBFB 4Q0VA 2OZ6A 2J22A 4CUAA 4IGPA 1GZWB 5DZFA 4Y5Z0 1JHNA 1OOPC 1ULEA 1UOBA 4HT1T 3OUJA 5EFUA 3OPZA 2VMDA 1DQ6A 3A22A 4YZ1A 4GMP3 2E63A 3DGTA 3VD5A 1JYNA 1V6OA 1W6MA 2UY9A 3ES1A 1VBC2 1US2A 4CCLA 1RTVA 5DAWA 1LODA 5H9RA 1NAEA 5C9AB 1RGSA 2JB8A 4WVWA 1H8TB 4NWVA 4PQQA 1AZDA 3UK9A 1HX6A 1YRZA 4ONUA 5FJKA 4C1WA 1RUC1 1MQTC 4R9DA 4LEJA 3PMEA 2Z69A 3OUHA 3ZKUA 4JGZC 3PHMA 1N1SA 2VMCA 2CAVA 2JDZA 5A3MA 2WR9A 4JTNA 2G9FA 1UMIA 4QAWA 3AXDA 3PIGA 1MACA 3E97A 4XUPA 3WVJA 2YYOA 4YYOA 4S2DA 1XYNA 5JPMB 3AKSA 1W0NA 1OXCA 4KGQA 2DFCA 2XPJA 1LEDA 1HKDA 1RVF3 3NJXA 2VTXJ 1UY4A 1ASJ1 1QJU3 4Q26A 2G9ZA 5F3EA 4OHZA 2ZHMA 1TME1 3B3QE 3WDWA 3O0VA 1JS9A 2B45X 1ZNPA 2BVVA 1G8WA 3CJIC 3VBHC 1LAJA 4BPZA 3VUOA 4PI2A 2XXZA 1XNDA 2VUJA 1XQNA 4AQTA 2WC2A 4XC9A 4HL0A 3W20A 4XTMA 3I2OA 1W06A 1QWRA 4AXOA 4HVOA 2I2SA 1Z7S2 3O5SA 3ZDSA 1K5JA 2VVFA 1AJKA 3H42B 5CVRA 5L73A 1WD3A 4C0BA 3ZFEC 4K8FA 4Q2FA 4HSLA 5E16A 4IV3C 4JRAA 4OMCA 5JXHA 3BUCA 4P9YA 4QPGC 3K4DA 1SDWA 2RDQA 1E5IA 5CKQA 4MO3M 4QMAA 5T5PA 4D7SA 2ZJCA 1IQAA 4Q4V1 4DEQA 5GZCA 1WMFA 3L2YA 2QVSB 4MXVA 3KF3A 4M01A 1XNTA 2RM22 3NO8A 4OFGA 3DF0A 3T0BA 4GXLA 2JG9B 3VBRA 2WNUC 4MV2A 4DPNA 2YV8A 5TSWA 5T5JA 3JXSA 3M3QA 4CCOA 1WLTA 5IAVA 1UY1A 4QX3A 5FMCA 4DY3A 5K9YA 4BMBA 4CDQC 1JYIA 2OZJA 2QQUA 3WP3A 1OUXA 3B02A 3GGLA 1BHGA 1UN1A 4CU7A 4ZZ8A 5IYYA 5IHRA 2NMNA 3RMXA 1WWYA 4H2AA 4JQTA 3H7YA 1VE0A 3BPSA 5FZCA 4ZY9A 4CDUC 4E4ZA 1Y3TA 1SACA 4K40A 3L9JT 4P9LA 4YGBA 2ZA9A 2JKXA 2MEV2 2PMWB 2XVKA 2QQIA 3OEAA 4EWEA 3SEPA 4NHKA 2WFF2 5DG1A 5JSPA 4PF5A 1UXXX 4DB5A 5GLUA 4IE7A 3AYDA 1FPN3 1NE4A 4B4RA 1W6NB 5DDJ2 1JZ2A 3OD0A 1QHDA 3POIA 2JDPA 2CDPA 2VMFA 1BQPA 1OQ1A 1MS0A 5L7OC 5ACA2 4IE5A 1W9TA 2YBPA 3GBFA 1RUF3 3E5XA 2JIGA 2XBO3 4EV0A 3VDDB 1LECA 4XEZA 2DCKA 1ULGA 1GKBA 1QNWA 1UX6A 4KWJA 2HBTA 3TEZA 1WA4A 2UWBA 3KV9A 3FL7A 1OA4A 1R092 3ZXAC 3WNPA 4CCMA 3EHKA 3BVCA 5A1FA 4ZHNA 4AHXA 3PVNA 3DPRA 3SISA 1RMU2 4QD2A 1PVXA 1RUI2 2FZ2A 4BYYA 4FPJA 2X5IA 1EV12 1X8MA 2QQWA 2Y6JA 5FPLA 3I97A 1G9AA 2X05A 1ENXA 2FMYA 2V73A 3AFKA 1W28A 5JXIA 1PGL1 5JZGC 3KS7A 3JCIA 2CTVA 2Y6KA 4IEZA 4WM7A 1QH7A 3OBTA 3U14A 1AR61 5CKNA 4Q4W1 5FZ6A 1PX4A 2IVIB 1OOPB 1LEMA 2WS93 1SLCA 4FPGA 1H4HA 4UBGA 1W03A 4A7ZA 4BLIA 3KD4A 3ZYGA 1ZRCA 1O3RA 4YG0A 3MLLA 4NRQA 1XE0A 2P3JA 3WNXA 3X29B 4M00A 2ARBA 3KGLA 2FDHA 5FYCA 4AHZA 2HWE2 2B39A 4NRPA 3KVBA 4UW3A 4TTGA 1YQ8A 3I59A 1ZM1A 1UIJA 2BWCA 5JI9A 1ZREA 2CGPA 2VJXA 1ULDA 3NMBA 4Y20B 3O1TA 2Z2SB 1UMHA 1PM4A 3ACHA 4R8HA 2D6OX 1MQTB 5LEKA 1CZTA 5IVVA 2VZTA 4JGZB 4N7IA 1UU5A 3T08A 2Q1ZB 4QHOA 1QIQA 1JZ3A 2HLEA 1VBB3 2R071 4XURA 3ZYFA 5A6QA 4PLNA 1V9U3 3DL3A 2XL9A 1J3RA 1Y9GA 3M3IA 3ZPOA 5JUVA 3CNAA 5FZLA 3WF4A 4OVEA 5CYYA 3BTZA 2JDNA 2SBAA 4J1WA 5A7QA 3VBFA 2RR13 1CAWA 2XMLA 5BY5A 1W99A 2BJSA 3AZYA 4XYXA 5GLWA 5DAXA 4NIGA 1UL9A 1W8TA 3WW4A 5F37A 1S0IA 4P02B 2ZMNA 5IK8A 5FV3A 4W8JA 4BHPA 4TWTA 1GZCA 3GALA 3NAPA 3OPTA 4AGGA 1BVP1 5CBLA 3CJIB 3VBHB 4COWA 1PO23 4JTOA 3FFQA 5B4XA 2GDFA 5AC92 3T2TA 2Y26A 3SHRA 1COV1 3NJZA 2WL1A 2Y8KA 3MICA 3ZXLA 2PHRA 1FMD3 5A6XA 2XQRA 2EVXA 4Y22B 5GLZA 4NMIA 4XW3A 5B2GB 1EAH2 1W6PB 1N1TA 3ZFEB 3LD8A 1NCQA 4IV3B 5B4NA 1AR82 4QPGB 5IATA 1W8FA 2H0VA 2DBNA 3DN7A 4AG4A 4NIHA 4TLFA 1DU3D 3S7IA 1WCKA 5IVJA 2NMOA 1W0OA 2DCYA 4Q1RA 2O8QA 1W8ZA 4LKEA 3W5MA 4NHLA 3WZ1A 1LNSA 4LE4A 3IKWA 3WG2A 1NOVA 2FDJA 4P9JA 4WVZA 4CTEA 2WNUB 1X7NA 1CAXB 2VTFA 4CXWA 1AL22 1DGWX 2B5HA 4XF1A 1BBT2 1KQRA 3P1IA 3T4HB 1V6JA 3T3YA 3K3NA 2XJRA 1LENA 3W58A 4CDQB 4FP2A 3O1UA 1C57A 1VBE2 1J3QA 5LW9A 2XJSA 3VZKA 4CUBA 4D6SA 2NLRA 2EXKA 1IG0A 3U07A 4UFJA 3MDPA 3EMRA 2QNKA 2PAMA 2VOXA 4CDUB 3L2HA 2BWAA 3BKZA 1NZCA 4LLOA 3FLTA 2NPIA 4GKYA 1CAVA 4IEPA 5FQ0B 1GV9A 2P1BA 3SLIA 2VCBA 2BU9A 2RJ2A 5FPZA 5FZGA 3N9LA 2AR6A 4AGVA 3O1MA 4LHLA 2HWB3 3JZVA 1WBLA 2RHPA 3WHTA 1WLDA 4YW3A 5FUIA 1UZVA 4H55A 2Y6FA 2Z5WA 4CP1A 1X36A 2IXCA 2WN2A 2RVAA 4E8CA 1OQDA 3FHQA 3PL0A 5L7OB 2FCTA 1PNFA 3HMYA 2OS2A 5C3PA 1DFQA 3UNPA 1LR5A 1MS8A 1Q3EA 1EP0A 2FDFA 4ORFA 4LBQB 4AI2A 1S2EA 4D0QA 4QX1A 2IVJA 1AHSA 1KD7A 1GNHA 1FOD1 2W1UA 3BB6A 1AR71 4A4AA 4IUGA 1LHUA 4Q27A 4RGKA 2GNBA 5K0UC 4LUKA 3H8XA 4XJAA 3OBRA 2AGSA 2LS6A 4K7JA 1K5MA 5LA9A 1OF3A 1RUC2 3WDXA 1AX2A 3ZXJA 4DIQA 4W6XA 3LDKA 1L7LA 2ZHNA 4PDWC 2QQVA 1HRI3 4ATFA 4CU9A 5BNNC 3GNEA 5FMBA 4B3NA 5JZGB 1DF0A 5FYUA 3RZHA 2Y6GA 1L7QA 2YGLA 1LOEA 1UU4A 2RMU1 4I2OA 3RJRA 2NM1A 1WKYA 1ZX5A 1NZIA 4TN7A 4OQ9A 1QDOA 3BODA 1VMFA 2OXBA 5DPNA 3SXWA 4ASLA 2D6MA 2W1QA 1W39A 4BB3A 2OKXA 4R52A 3V56A 1WLWA 1ASJ2 2XLAA 2V09A 1TMF3 1GQPA 1RYYA 1TME2 3FUOA 1ZZ8A 2ZABA 4HG6B 4QM9A 2PHFA 3W21A 2QQKA 1AJOA 3NSTA 3PDQA 4GAZA 4NPMA 4FBFA 4YW4A 3GCWA 2B4KA 4UW4A 4D94A 3MLJA 1PMIA 4YVWA 4Q1PA
chains in the Genus database with same CATH topology
4WVMA 3CEWA 3J9SA 1RUG3 3N7KA 3FUQA 2R063 4Z8BA 1ZZBA 2HJIA 2VECA 5KC5A 1OMIA 5H9QA 3QACA 1L3JA 5KHKA 3N35A 2QQPA 5GLVA 1OPOA 1VBD3 4IEXA 4DS0A 3MIGA 1YYNA 2QZ3A 2CWSA 1HLCA 5JIUA 2R0HA 5J3UA 2BQPA 5AFEA 1AR91 4Q4V2 4A2UA 2NN8A 3WCSA 2FZ1A 2A7AA 1POV1 4R9CA 3LSEA 4AVVA 5SV8A 4GH4C 3IIAA 4COZA 1SBDA 1FNYA 4D7YA 1N3OA 2C9AA 4RQPC 3LAGA 3DKWA 1Q5OA 4YM0A 2OIIA 1NY71 4G4FA 1S0CA 4B4PA 1R1A3 1RHI3 4H7MA 1GBGA 1MQTA 1MZFA 1QY4A 3GHNA 3TAYA 3ZXFA 1ZRRA 2D6LX 1VRH3 5BNPC 1YFYA 2HKXA 1QJX1 1O3SA 4OZXA 1CJPA 5CG8A 3FE5A 3MLKA 2VG9A 1F2NA 2EIGA 5CB7A 2R0FA 1W6OA 1YI9A 3GZAA 4R9BA 4IXLA 3GZUC 1KXGA 1W6QB 4YNIA 1DQ2A 1R083 3H9AA 3WHUA 1NYWA 3CJIA 1WGPA 4YW5A 1U12A 1REFA 2BNOA 3N36A 1YJKA 2A3XA 3ZFFC 1YHFA 3R4UA 4FSJA 3NKTA 4G9SB 1ZZ7A 3VV1A 4P5HA 3J8F1 1J59A 3URFA 3NV3A 4M3CA 4FTEA 4MXWA 4BE3A 3MI8A 3LB9A 4YVSC 1V00A 1PO13 1PVC1 5FO8B 1PGL2 3O7OA 1NA1A 3WP5A 2CNAA 2ZAAA 2GAUA 4QPIC 1D4M1 1AR62 4HZFA 4Q4W2 2HWD3 4PQ9A 4AK3A 4HBNA 4AVCA 4RR3C 1LCLA 1FXZA 3C3VA 3TWIA 2JKBA 4B7EA 4ZKTB 2VOWA 1RUD1 3HD8B 2RS51 3CL1A 5K8SA 3MZHA 1DIWA 2LUWA 1ULFA 1H2MA 2DVGA 1D2SA 1JOJA 5LRRA 4FXKB 5K0UB 4YFWA 3HAGA 3BALA 3VBOC 3FLPA 2ZZQA 1AYN3 1D0GA 2TBVA 1A78A 4LO5B 4FBFA 4AHYA 5J36A 3IWZA 1G86A 4AHWA 4E2QA 3LA7A 3LA3A 1YCIA 4Q4Y3 2R072 5KXCA 1C5IA 3R6SA 1S2BA 1ND2C 1GQGA 1POV0 1O5UA 3O0XA 3QBQA 3B69A 2O8OA 3WW2A 1CJDA 3I2DA 1JTZX 1RINA 3WCRA 4IEUA 5BXXA 2WA3A 4AVSA 4CDXB 3V0BB 2H6BA 3O12A 4RHV1 4YRDA 4Q4X3 4FPEA 1PK6B 1U0AA 1COV2 1Q43A 5GZDA 3A0KA 3RYPA 3NWKA 4MUVA 1ALYA 3MPPG 1A6CA 3R4SA 4AEJA 5I91A 4ISRA 3HN1A 1BZWA 2TUNA 1LB2A 1LJ7A 2E53A 4JGYC 1QJY1 4QX5A 3OTFA 1DYPA 1C8NA 3AMQA 4XF4A 5I0RA 1UU6A 4IEWA 1YLLA 5T54A 4D69A 1NLRA 4FVVA 2PHXA 4M0NA 3WINE 5T55A 1YJLA 2FQPA 3IBMA 2JECA 1NXMA 4RQPB 2I45A 3ZFGA 1CAUB 4HANA 2R041 4GKXA 4LR4A 2XB6C 4GWNA 1GZ9A 1H2KA 3ENRA 5GJ6A 2VMIA 5C8CC 3VKOA 4EN9B 1AXYA 1PIV3 4H7LA 2XJQA 3JBG3 5D1IA 3ZMNA 4QT6A 5A32A 1QMJA 4QQHA 3HBZA 3ZSKA 3TB0A 1WLCA 2R32A 3POSA 3VZOA 5J7MA 3WR0A 1DYKA 4FTSA 1DGRA 4P9XA 4YLZA 2LM3A 2OVUA 1ND3A 2RJKA 1AXZA 1FATA 1GFF2 2ZKNA 5DUWA 3WUDA 3BOWA 4BWOA 2A6VA 1FOD2 4NR1A 4GB31 2PTMA 1AR72 1HQNA 2OUHA 4KL1A 2DU1A 3ZFFB 5H9PA 3AMMA 3RYRA 3V0AA 4PIZA 1C28A 4RD7A 4PIXA 4C0HA 4CEYA 1FI2A 5JSOA 1VR3A 2DTWA 1BMV1 1XNCA 3U4XA 1REEA 4OHWA 1EY2A 3VZNA 4YVSB 3E5QA 4AQ6A 5BNQA 1CN1A 1XXNA 1RUE3 4FPLA 3OGGA 2RMU2 1NCRA 2Z79A 4QPIB 1G9DA 1BEV3 5J37A 5JWPA 1C4RA 1KDMA 1U5XA 1QKQA 1B35C 3B01A 4RR3B 5H9SA 2WNVA 2X8KA 1HXS3 4KH9A 4CDWA 2K2SA 1QJZA 5DUUA 5GZEA 1OA2A 4WZCA 1C8M3 1LTEA 3SCHA 5JOYA 3VBOB 3WG1A 5JAXA 5F6KA 2A6YA 2VW2A 3USSA 5DUXA 4E2SA 1RVF1 4FOQA 4L92A 2GNDA 2JXAA 1QJU1 5D8AC 3K48A 1ND2B 2FMDA 4IV1A 3WT3A 1AR92 3R05A 3QH6A 4XILA 1N3PA 2R16A 3POYA 1A8MA 5IK7A 3J26N 4AW7A 5BYNA 3M8LA 4XFBA 4N53A 1XYOA 5HCAA 1XU2A 3VZMA 3AB0A 2QJVA 1RJ8A 4EWDA 4BZ4A 1YFWA 4AGRA 2UURA 1NY72 3RDIA 3U0ZA 4PJYA 4COYA 1JYCA 3SNMA 5ABJA 2YPJA 4K6BA 2MNGA 2RS33 2PLV3 2Y0OA 4Q0SA 2VU9A 5JLVA 1S55A 3JB4C 1AXKA 4PDWA 1MZ5A 1V70A 1X8EA 1ZRDA 5BNNA 4JGYB 1QJX2 1DQ5A 2JG8C 2BEOA 4L9BA 1FYUA 3MGUA 4NHMA 1CGPA 4BA6A 5HXVA 3AMPA 3FWEA 4URTA 4CEWA 3AZVA 1MVQA 3WG3A 4AE2A 3Q9OA 1F5FA 5FOJB 2RS13 2KA3A 1O3TA 1MS3A 2ERFA 4LBNA 3IMNA 3RI8A 2ZBJA 4F8AA 4AI0A 3ATGA 1FAYA 2GC0A 4AEDA 2P37A 2Q5TA 1DG6A 4NOTA 3M3CA 4MGYE 1LHOA 4HETA 1FPN1 2KXLA 2BYVE 5CFCA 5C8CB 2WZPP 4QQPA 5GALA 1V6MA 3O0WA 3J8F2 4YM3A 1NQDA 3THPA 3NV4A 1TE1B 5A33B 4XOGA 4HK9A 2XJTA 2HWC1 1H0BA 1I9RA 3RWNA 4XJ8A 4GMP0 1H1AA 1RUF1 2D6PA 3CF6E 5LEJA 5DUVA 1PVC2 2XBO1 3D4KA 3OYWB 1TNFA 3UKVA 1D4M2 5C8WA 2JEMA 4GH4A 1ENQA 2IXKA 4CRQA 1IPJA 1SLLA 1RUH3 3NVCA 3ZSEA 3JU9A 1HRV3 2DURA 2HWC3 1DQ4A 3OY8B 4COUA 5I8YA 1RUD2 2RS52 3W59A 3EXUA 4DOUA 1MS1A 2R6QA 1UW8A 2DTYA 4X6QB 1KDKA 2VH9A 5BNPA 1UPSA 2DUOA 1Q8PA 5FLHA 1ZVFA 3IPVA 2WS91 3ZYRA 1AVBA 2E7TA 5E89A 1LRHA 2D6KA 3FC0A 2GN7A 3RI9A 4AFMA 2IFRA 2RJLA 3SITA 1B35B 1GQHA 1UKGA 2XJVA 4YZ2A 3A0NA 5C4WA 2A6ZA 4BMEA 1WCDJ 3WW3A 3ZN6A 4AI8A 2UYBA 1LHVA 1JXNA 4RHV2 3IDCB 4AQSA 3AXEA 3USUB 1VBB1 3RS6A 4I3GA 1SLTA 3JD73 3M2MA 4ZU5A 1EPWA 1V9U1 1X33A 2A5ZA 2AREA 3TNQA 4W65A 1LOCA 1S0FA 1ZYBA 1QNYA 5I0UA 4DNYA 1Y7BA 2D93A 2RR11 3IDEA 3SH3A 4FXGB 1PM7A 3NV2A 4LA3A 1MEC3 5D8AB 4TZDA 3LSDA 1DQ1A 2VQ0A 1QJY2 3BU7A 4BH9A 4I0AA 1PO21 1LOFC 3BOPA 2ZS6B 3D6EA 4LO6B 3RSJA 2D5HA 5BNOA 1F9KA 3SCFA 4J1XA 4X8PA 2XVLA 1FMD1 1SLAA 1UZZA 4RSUA 4AI3A 4BQ1A 3PVEA 1GZWA 3I7DA 4FO9A 1J58A 4YZ4A 2R042 1AYM3 1H2NA 3ZYJB 4F83A 1Q8SA 3VKLA 1DLLA 3ECQA 2WA4A 1G7YA 1O4YA 2IC1A 2W08A 1MZEA 3VHNA 5CNAA 5C9AA 1UIKA 1H8TA 2QCSB 2ZGPA 3VL8A 2BPA2 3RPQA 2O1QA 4AEMA 5FO7B 2ENRA 2JG8B 3MFCA 3MIFA 2BGCA 4AFBA 5KWRA 3WDUA 1VALA 1O4ZA 1VBA3 2VVEA 4BCUA 3N7LA 3BCWA 3FZ3A 1QXPA 4XETA 4XQDA 5AVPA 5J96B 4Z92B 4EN0A 4LO8A 4I0WB 4YGDA 2DCTA 2SLIA 2EXJA 2EXHA 2ZHLA 4U36A 4YZ3A 2K0GA 1H4GA 3MW4A 2ETEA 3AKPA 4GB32 5HBAA 3B9IA 2HWB1 1I5ZA 3CJXA 4WM8C 2VVDA 1J1LA 1Y43B 5FRAA 5EYXA 5KHIA 1Q8QA 1S2KA 3AYEA 1YIPA 3DV8A 1ZBE3 5EWSA 4FCAA 1ZBA3 2OW4A 4N43C 3VBSB 2E6VA 1BMV2 3WDVA 4DY5A 2BNNA 3VBUC 4EN8B 2PQQA 4HSJA 3WP4A 1LGBA 2WZR3 3IN9A 1XU1A 1QQP3 1SQ4A 1QGLA 1KS5A 4S2HA 2AYHA 4QXKA 3W9AA 1YNAA 4ATEA 4WZFA 4RS5C 3G6JB 4YSFA 3AP4A 5FPXA 3POWA 2JG9A 1S0DA 2B8MA 2JX9A 1HRI1 4K1ZA 2JE9A 1V6KA 3ZN5A 3ALQA 1RUJ3 2VNOA 2CYFA 1PZ8A 3AKQA 3O14A 4GQ7A 4Y24A 2G4IA 1I6XA 2OYZA 4LBJA 2UYAA 2DV9A 1RVF2 1NE6A 4AWDA 4KWKA 4AYUA 4LULA 1QJU2 1CESA 1TMF1 1DGRN 1OQEA 1VB4A 2HWF3 1JUHA 1G6NA 2CY6A 1W6NA 3VKNA 3ILRA 1RUG1 2R061 3N7JA 5A3LA 3KCYA 4Q0PA 4MGKE 1QOSA 1UF2C 2D5FA 3AP9A 4CDXC 3UL2A 4MGIE 4AFAA 4HKOA 3AX4A 1VBD1 4BIFA 1HV0A 1VLNA 3TN93 3VDDA 3RZZA 2QFEA 3JB8A 2PELA 2I07B 2VPVA 1PK6C 1A3KA 2QZ2A 4FTBA 5I8TA 3GBWA 3CLPA 2ZTNA 4IESA 3KGZA 2VULA 1AUYA 2PA7A 4K3UA 5I0TA 5KC6A 4CYDA 2R30A 3AZWA 3MW2A 3VN4A 1GICA 3ZMOA 3VUOA 2C5DA 4MGZE 4YG3A 2QDRA 2QDNA 5FFOC 2PHWA 3VBRC 3B00A 1GR3A 1R1A1 4YARA 3VLBB 1RHI1 4Q0QA 4QHBA 1S0GA 2RE9A 3H7JA 2ZX4A 3AYCA 2ZOEB 2LTNA 2D3SA 2WQ4A 2Q1MA 2ZGQA 1OOPA 1YXWA 1VRH1 3SCGA 2VNRA 1Q8VA 4MH0E 2UWAA 3LCPA 2DU0A 2WLPA 3DUIA 4FOVA 5CIRA 4JVAA 3MFAA 1FPN2 1VAMA 2A75A 5JOWA 3VHOA 2ZACA 3FFZA 4HPKB 4Y20A 4EWAA 1YFUA 2ZX0A 1QOOA 1KJRA 1VBC3 4FQZA 1R081 1RUF2 1FX5A 4JGZA 2DCZA 1WW5A 2XBO2 1H8VA 2GSYA 4RA0A 2YY1A 3I8TA 4DQAA 2Z42A 4FPCA 4FPYA 1QDCA 4Y1XA 1IZ3A 2XWJB 2PYTA 5GZFA 4OHXA 4EJRA 2E7AA 2H6CA 1RITA 3QH7A 2WLQA 3VBHA 2HEYF 4WM8B 1PO11 2BUKA 3DPRC 1QU0A 2ZGNA 4FPOB 4N43B 3D0JA 2IXIA 2GC3A 3ZIWA 4Z82A 3B7MA 4Y22A 2HWD1 4AVTA 2EXIA 3VBUB 1HQWA 2WS92 4OI2A 1W6PA 3AJYA 3ZFEA 4INDA 2CAUA 1LOBA 3KT1A 4IV3A 3AFGA 1G9AA 4WM7C 4QPGA 1F8VA 1N47A 1URXA 1Z7S3 1QXJA 2P3IA 3PTYA 1SFNA 4RS5B 2Q8OA 5F9TA 1AYN1 4C1XA 1W6MB 4LUMA 2UU8A 2WNUA 1CAXA 1ZRFA 4OUMA 4Q4Y1 1VBB2 4KGGA 4L8QA 1V9U2 4CDQA 3M1HA 2RM23 3OD4A 3CU7A 3VZLA 4XFIA 4CDUA 2RR12 4PCRA 1OHFA 3TNPB 2YUEA 1GANA 4B8EA 5JSRA 2OPKA 5FQ0A 3SH4A 2D7FA 1SBFA 4TYSA 2TNFA 3WXPA 1AX0A 4Q4X1 4KQ7A 1TQ5A 4MZUA 5L19A 1PO22 3FBMA 4YGEA 2BNMA 4GALA 5CG9A 1EPZA 1YUDA 2DVFA 2MEV3 2AH2A 2YMZA 3S7EA 1FMD2 4ISQA 4N9IA 2IFWA 4CP0A 2WFF3 3NAPC 2A71A 4PIYA 4KBBA 5L7OA 4XBNA 1I3HA 2HEWF 1VAKA 5DDJ3 3RJ2X 4LBQA 1WCSA 1WW6A 4XQWA 4YM2A 2Y38A 2PAKA 2WT1A 4AVBA 4QU2A 5ACA3 4W6YA 5JVVA 1NCQC 4Y1ZA 1XE8A 2W68A 3T1MA 5FREA 2DYCA 2VNGA 2XJUA 3MF6A 4IERA 4N9HA 4DRRA 1R093 1O91A 5JZGA 4IEVA 1OFSA 3QLQA 2BFUL 4QQLA 2ZMKA 1BYHA 1RMU3 3VBRB 1RUI3 1V6NA 2JE7A 1WD4A 4KU7A 1EV13 1VAVA 4Z2WA 3GYDA 4I09A 2NZ9A 1PIV1 4EN6B 4B7KA 4HK8A 4OI0A 3AMHA 3JBG1 4HVRA 4ZU4A 1X82A 3VHRA 2ES3A 4E27A 1LOGA 3UJQA 1M06G 2D97A 1GLHA 1H1IA 1Q56A 2HWB2 3P3NA 1IS6A 1H9WA 2D98A 3AKTA 4LA2A 3KT7A 1H2LA 2IXJA 2BBVA 2F6BA 2R1DA 4WBBA 1WW4A 2C0ZA 1DHKB 4L99A 2CGNA 3HT2A 4MYEA