1OPOA

The structure of carnation mottle virus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
267
structure length
267
Chain Sequence
SMTMSKTELLSTVKGTTGVIPSFEDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQPLQWVVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The atomic structure of Carnation Mottle Virus capsid protein
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein
total genus 52
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
A PF08462 Carmo_coat_C Carmovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1opoA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opoA01
1NG0A 2HWB1 3VDDA 1ND2B 2PLV3 1BBT1 4PDWB 4SBVA 1OOPB 1X36A 2HWC1 5C4WA 1V9U1 2MEV1 4Y5Z0 1VBB2 3ZXAC 1QJU3 3VBUB 5CFDB 1RUC3 2QQPA 4Q4Y3 5DDJ2 1AR92 3DPRA 1PO11 1RUH2 4IV1B 2RS53 2ZAHA 4CDUA 1QJY1 3JD71 4QPGC 1WCDJ 3VBFA 3TN93 5L7OB 1TME3 2RS13 4GH4C 3ZFFC 1R081 2WZR2 1ND2C 1IHMA 2RS51 1EV11 1F2NA 1NOVA 4YVWA 4N53B 4Q4V1 1VB2A 2HWD3 1Z7S3 1BMV1 1NCQB 3DPRC 4RR3B 1QJZA 2RR12 2MEV3 1V9U3 4CDUC 1TME1 1RMU3 5A33A 3TN91 3LOBA 4Y4YA 5C8CC 2R063 1QQP3 1NY72 1AR63 1HRV1 3VBSB 1AYN3 1FOD2 4JGYB 2RM22 4IV3B 1AR82 1VBA2 1PIV1 1PO13 2VQ0A 3ZFFB 1RUG3 5AC91 2BPA2 1VBB1 1RB8G 5C4WC 1ND3B 1HRV3 4RHV3 1C8M2 5JZGA 1TMF2 3VBHC 1BBT3 2HWB3 5C8CB 1H8TA 5C8CA 4Q4W2 1VBC1 2R073 1PVC2 1ND3C 1VBD2 1BEV2 4RQPC 5JZGB 1SMVA 4N43A 1RUJ2 1EAH3 1RHI2 1RUE1 4QPGA 1ZBE2 1EV12 1PO23 1NCRA 3ZFFA 4FTBA 2WZR1 4JGZB 2BFUL 1R082 5K0UC 3ZFGB 1MEC2 2HWF2 1QJX2 4JGYA 4CDXB 4LLFA 4FSJA 2RMU3 3VBSA 3VBRC 4QPIB 5ACA1 1NA1B 4CDWB 1QJY3 5CFCA 1RUF2 1PO21 1POV0 4EJRA 4RQPB 1AL22 3VBHB 1HXS2 4N43C 1D4M1 1RUC1 2HWE2 3NAPA 3VBUC 5ABJA 3VBOC 5FOJB 2WWSA 1E57A 2WFF2 2BBVA 5K0UA 1RUI3 1HRI2 1FMD2 4IV3C 4AEDC 4GMP0 2FZ1A 1VRH2 2XBO1 4Q4X3 1COV1 1R092 2RS31 5BNPC 1RUD2 1RUG1 5BNNA 4CDUB 2RS32 1AR73 2X5IC 1PIV2 1NA1A 4CDWA 2DF7A 1RUF1 2RM21 4WM8C 1H8TC 4N53C 1HX6A 4CDXA 5A32B 5CFDA 3VBUA 2RMU1 5ACA3 3ZFGA 1RUI1 1FPN3 5FMOS 1AYM1 4JGZA 4WM7C 1OOPA 4RFT0 1R1A2 4PDWA 4QPGB 3J8F2 1D4M3 1CD3G 3NAPB 1RUE3 4Q4V2 1RVF2 2R042 1ASJ2 1K5MA 4CEYA 4GB32 1PGL2 4YVSB 1VBC2 2GH8A 1ZBA2 3ZFEC 1AYM2 3M8LA 5CFDC 1NCQC 4RR3C 3S6PA 1B35C 3JD72 3JBG3 4CEWB 4GMP3 3CJIC 2TBVA 1ZBE1 1VBE2 1NCRB 4NWVA 1AR71 1M06G 3VBOA 5AC92 5DDJ1 2WS92 4CEWA 2BUKA 4WM8B 1COV2 2XBO2 4GH4B 2Y26A 2HWC2 1K5MC 4CEYC 1OHFA 1NY71 2PLV2 1QQP1 1POV1 4YVSA 3ZFEB 2PLV1 5BNPB 1NCQA 4RR3A 4BCUA 5GKAC 1VBB3 1QJU2 1RUC2 3VBFC 1Z7S1 2HWD1 4N53A 4Q4Y2 5DDJ3 4RS5B 5J96B 1AR93 5FMOL 1RUH3 2BFUS 3VDDC 2RS52 1W39A 4GMP1 1AYN1 2RS11 3JB4C 1AR61 5A32A 1MEC1 2HWF1 3TN92 1RMU1 1TME2 2RS12 5A33B 2WZR3 5BNNB 4GB31 1ASJ1 3DPRB 1PGW2 4QPIC 2HWD2 1Z7S2 1VAKA 5C4WB 2RR13 4YVWB 5K0UB 1VBD1 2MEV2 1R1A1 1V9U2 3CJIA 1RMU2 1ND2A 2ZZQA 1TMF1 5ABJB 2R062 1QQP2 1C8M1 5L7OA 4YVWC 4RHV1 1AR62 1CJDA 1AYN2 5BNOB 1FOD3 2RM23 1AR83 1VBA3 3VBHA 4RQPA 1PO12 5CFCB 1RUG2 5LK7B 2WLPA 1VBE1 2IZWA 4QPIA 1QJU1 3VBRB 1HRV2 5D8AA 4RHV2 1C8M3 2R061 5J98B 1TMF3 2WFF1 1POV3 1BBT2 1NCRC 2HWB2 4RS5C 4Q4W3 2R072 1PVC3 3VDDB 1VBD3 1BEV3 1PGL1 2RR11 5C9AA 2R041 4JGYC 1BMV2 2WS91 1RUJ3 1EAH2 4N43B 1B35B 1RHI3 2X5IB 3VBRA 1HXS1 4FTSA 5JZGC 3J8F1 1AL21 1ZBE3 1EV13 1H8TB 1PO22 1C8NA 2GSYA 3NAPC 1R083 3JBG1 1ND3A 1DDLA 1MEC3 2HWF3 1QJX3 1X33A 5D8AC 2RMU2 5ABJC 1VB4A 4WM7B 1QJY2 2FZ2A 1RUF3 4AEDA 3CJIB 1AL23 3IDEA 1RVF1 5C9AC 1HXS3 1RUD1 1AR91 4IV3A 1EAH1 1R091 2HWE3 4NWWA 5L7OC 1VRH1 3VBSC 1PVC1 1MQTA 4Q4W1 1AUYA 4CDQA 2WFF3 4Z92B 1FPN1 5BNOC 1RUI2 1HRI3 1FMD3 5CFCC 4FTEA 1VRH3 3ZFGC 4Q4X2 2HWE1 1R093 1OOPC 1RUD3 4AEDB 1F8VA 2RS33 1AR72 1AL0G 1PIV3 3VBFB 2XPJA 4RS5A 1OPOA 1HQNA 2ZTNA 1HRI1 5ACA2 3JB8A 1FPN2 5BNPA 4IV1A 1ZBA1 1R1A3 4CDQB 3ZFEA 1NA1C 4CDWC 1MQTB 5BNNC 3J8F3 2X5IA 1D4M2 1B35A 4GH4A 1RUE2 1PGW1 5C9AB 4Q4V3 1RVF3 4WM8A 1RUJ1 2R043 4CDXC 1ASJ3 4JGZC 4GB33 3VBOB 4CEWC 1VBC3 2R071 1ZBA3 4PDWC 1GFF2 4WM7A 5D8AB 1AYM3 1QJX1 3JD73 3JBG2 4YVSC 4IV1C 1VBE3 1RUH1 1MQTC 3FBMA 5AC93 1K5MB 4CEYB 4Q4Y1 1RHI1 4CDQC 2WS93 1VBA1 1AR81 1COV3 5BNOA 3HAGA 4Q4X1 2XBO3 1BEV1 1FOD1 1A6CA 2HWC3 1FMD1
chains in the Genus database with same CATH superfamily
5HBBA 3U1PA 3LDBC 1BBT1 4H40A 4I18C 4FA6A 3CN1A 3ETQA 3BRFA 2E7AA 3WAJA 1HSBB 4SBVA 3HNVL 4P59L 3Q5TA 1QNYA 4CCCA 3SBWA 3UG3A 5KTEL 4PJCE 2FMDA 2BSRA 2JDUA 2IAMD 3OPZA 5ABDE 4YNIA 4J1XA 2JTYA 3TO4C 1RUC3 5IROC 2A38A 5IFJA 4GA9A 1B88A 3BDYL 4F9PA 2QE3A 1M6OA 4B9JA 4R97B 5CHNA 2JB6B 3IJ8A 1MFEH 3I2IA 1YEDA 2EECA 4N0FA 4ADJA 4E5XG 2ARBA 5KS9A 3GHBH 3AS3A 4LCYA 4X99A 3U0WH 4P4KC 4XF3A 1IQDA 1FO0L 5CZVH 4PP1C 4AX3A 4XIOA 1JYIA 1BBDH 1JMUB 1UGNA 5GSRA 3ZE1B 3GGWB 3PIQB 4RGNB 3FT3B 5LZ6A 2V72A 3QO0B 4XO5A 5IMLA 1HCVA 3IJ9A 5DK0A 3BZEB 2RS13 3LDBA 3ELQA 4Y4FA 5FZ8A 5EU6D 1PG7W 3BKJH 4OM1H 4FZ8L 1APNA 2V9TA 5AVYB 5DJZB 3O1RA 2WNGA 4N53B 1FPTL 3KZ4C 1W8EA 2VVFA 4M0NA 2JWPA 3S3SA 1HDMA 1AP2B 4HCGA 4HHAA 3CBNA 4XABA 1BMV1 4I02A 1B4JL 4LSPL 4TQEL 1XPWA 2WNUB 1SPDA 2NX5E 5FW6A 4GP8B 2RH0A 2DQFA 4LQFL 3TCLB 1IGFH 3ZDYE 4N90A 4Y4YA 1SZNA 4XZ4A 1OARH 2J4WL 3CZNA 4AVIA 1P9MC 1HRV1 1DU3D 1BAWA 2ZHNA 1KV7A 1XF3B 2DBLL 5DZGA 1UA3A 1KZQA 1QI3A 1FYHB 5LBCA 1CCZA 5HHME 4PBVC 4U05A 3WFHA 1TSRA 3H1WA 3UAJD 1WSST 5G2NA 1MQKL 1X5MA 4N6RB 4HZFA 4MOAA 3UGHA 1PLGH 3VG9C 4CXYA 1L3WA 3WMSA 1CC3A 1QRNE 1ROCA 4MGXA 5DJAB 3V0DA 3KD4A 1UM4H 1G7YA 1X82A 2O5YL 2X7LA 1W9YA 3MZHA 4WW2A 1OT1A 2NY5C 3CFBB 5I1IH 1JUHA 3UDWA 4U1JB 4QO1B 3MUGB 4N8UA 3KPSD 3QPKA 1AD9A 5JOFA 3RE0A 4B9YA 1OD5A 3AYAA 2DQEL 3K8KA 2P37A 1QW8A 3LKOA 3UTSA 1QZ1A 4NO3A 3MVSA 2WSKA 1O9WA 2EE3A 1P1ZA 1ETA1 2F54B 4M02A 4XGZB 2R7EA 3O4LE 5IB5A 1F6AB 4IE6A 5HV0A 1BWWA 1EAH3 5MEQB 2VDNH 2VSCA 1GS8A 4GIOA 1HC1A 1XGYL 2G5UA 3IGFA 4X6RB 5AUMA 1NAKH 3R4SA 4J12A 2J6WA 3LQZB 1ORQA 1E9PB 4FTVD 4W6WB 2IFFL 3HA0A 1F8TL 2FO4A 3ARPA 1Z6JT 4IMLB 4P5KA 5E6ID 3B00A 4UQEA 4BB3A 4AEIH 1WWAX 2BVYA 1K2DA 5FB8B 1ULCA 1BJ1H 2WBJA 2ZX2A 2JJTC 3ZFGB 1JSYA 4Y5YA 1M7DA 2YD9A 5DYFA 3CUPB 4WHTB 1GKBA 5LNGA 2Q1MA 1F18A 4FFWC 3QDMA 2WOYA 3CFEB 4L23A 1C5DA 4FJZA 1WYJA 5JOXA 5LY1A 1JNNL 1J7VR 1RURL 2Q8BH 3VXQA 1FFPA 5L8LB 1OSPH 3PL6B 3EO0B 4JCKA 3GPEA 5F6HI 3JXAA 5IB1B 2BP0B 4D3CL 1HXS2 3EXUA 4N43C 3MIBA 5HYFA 1KT2B 1MKFA 1OAKH 3IWVA 3O14A 4EVNA 4P5TA 1PDKB 4N90E 2X09A 4HAGA 3X3GH 4EZJA 1OQOA 5IK5A 1T1WA 1RMFL 1AMYA 4E36A 5IUCA 5E5MA 3BP4A 1H9WA 5A6IA 3A24A 4RDQF 1JOJA 1FZOA 2VNOA 3BSZL 1OGAB 4AVSA 1XYPA 3MLXH 2DRUA 3D69A 3H42H 1ODMA 2ZX6A 4XZUA 3KYNB 5EWSA 1NGXA 4YM0A 3H2PA 4ZXBA 4DGIL 5E08L 2E26A 3MOBH 3EO9H 3NZ8B 5DD0L 2YDEA 4I2OA 3RWFB 1CYXA 1EZSA 4ZS7H 4AQ1A 4P2RD 1ACYL 4NHXA 4G8IB 5EQUA 3V0BA 5BPPA 4LB8A 4HT1L 3VACA 1SBSL 3T0DA 3J26N 3QUMH 3RSJA 1CZ8H 1HL4A 1FPN3 4CU9A 1VGKB 3LD8A 2CA3A 3QR0A 2ZGTA 3VD4A 2EEFA 1I8AA 3KW8A 1BMWA 1JWUA 1UY1A 3UK9A 4LXLA 3QFJE 4ZUSB 4E9VA 4CE8A 2JH2A 1QY4A 5MEQA 3TVMA 3VFOB 2ZOEB 1YEKH 3TC9A 4A42A 5F70A 4L92A 5L0QC 4KPHL 3ULUH 5A3NA 1UCBL 4NNPL 2YARA 1X9LA 1K5MA 4LLUB 2WP3O 4KO6A 1A3LL 5EO9B 3VFWB 1FZJA 2CO7A 2GH8A 1ZBA2 1FZMB 4MNQA 3O9WD 4W70A 2Z5WA 3ZFFA 2DQJL 2A0LC 1TR7A 3KWTA 4CXWA 4SLIA 2KDYA 2QDRA 4QX8A 5JMOA 3SKVA 3HZKB 2X7LB 2X4NA 3I6LD 3FT9A 1BECA 1NAKL 1XF4A 5LAXB 1WA0X 3U30B 4F2FA 4QHLA 4OQTL 1VKXA 5J37A 3EYVA 1JZGA 5CEZD 2VC2L 1Z5LB 5L88L 3IPFA 5C0BA 4NYLA 2IXIA 2R1BA 1SPPA 4AGGA 4QDQA 3IDIA 1DN0B 3VQ1C 1S5IL 1CGWA 2AJYL 4KU8A 3FCUB 1RAMA 1UYWL 3FSWA 1COV2 3GDCA 4LIVA 1A4BA 3P4NA 4ZOCA 5DO8A 5C08E 5MERB 1N67A 4B3EA 5I0WA 4KH2A 5EFIA 2A71A 1C16B 4YE4L 1ITBB 3NEOA 2DQGL 4CEYC 1E5YA 2JJVA 1WBYA 3MROB 4D0DA 4JCMA 1POV1 1MEXL 4FLQA 4UV7L 1F02I 2TSAA 3PABA 3FB8A 4U33A 4P06A 4V11A 2YUZA 2PLV1 5CG8A 5B3JE 3SNMA 5FQ0A 1G1OA 2D9QB 2HFGL 1T0MB 3MRKB 3HNBM 4G6AC 5IK7A 2CLRA 5GLUA 1SLTA 4XUTA 1HHJB 3Q01A 5CS7A 4LLYB 5FK9A 2A9BA 5IATA 4FD0A 3INUL 5DDJ3 4N9OB 4MASA 2FIKA 1EXGA 2UYLA 3IDXL 2ZBJA 1HQRA 1QBLH 1CLVA 2HVKB 4EI0A 5DJZA 3AXDA 4HUXB 5BUAA 4I0PC 1ZT4A 2PAEA 1X7TA 3UYPA 4CP1A 3UBXB 4UW4A 2NR6C 2QFRA 4FQPA 2QGCA 1CX1A 1EFXA 4C4UA 1TVHA 2F8IA 3D0JA 3EZ8A 4UTBA 3TPKA 3V0HA 1OSGA 4EDXA 4Q6IC 4QRAA 4L0PA 2WZR3 3UGFA 2W60B 2KDGA 1J10A 1NUKA 1ILUA 2UXFA 3HPJA 3QUYA 5IHUL 1J5IA 2HEYF 1MFCH 2D44A 3KPRB 2XJPA 3E1ZA 3OZ9L 1NCAH 3SKOA 1E2VA 4AGOA 4DQOH 5A6LA 2VLKE 4LBKA 3AS0A 5CU5A 3BZFA 1HSAA 4XP4L 3T77B 1V6JA 1Q56A 4U7MA 3LCPA 4ZS2A 5F3CA 3ZTCC 2JX9A 1JYVA 4AUJA 1N3OA 1E5ZA 4EUPG 2AMGA 5FXZA 4KRPD 4KK6D 2XKNA 5M0TA 3QQ9C 3RL2B 1EHNA 1FNEB 2P8PA 4DP9X 1E6OL 2ADYA 1JHTA 1KJ3H 3LPGA 1GWKA 1DQKA 2BH0A 5IW1A 3LB6C 4QKTA 5GS0H 2AS5M 2QFPA 3IE9A 4M5ZL 1E90A 2V3DA 2VLJE 1KCKA 2YBRB 3D39D 4OLYH 2H1XA 5E8OA 4EZ4A 3VH8A 3A6CL 2G3XA 4QAWA 2RM23 2WO3A 3CXHJ 4IEVA 3RZHA 5F7DB 4N3UA 4NI6A 1Y7BA 4IOFD 2D97A 3FBYA 4O9GA 5DZEA 3QR2A 1AGDA 4LAQL 4V1DE 1RUG2 2ZKHL 3GBGA 3BZ4A 4MLSA 1E0OB 3G5VA 1J8HD 2OR7A 3KPMA 1UYXA 4AXWA 4XODA 2WY3B 2BBAA 2F4LA 3B3BA 1FJ1A 1NLDH 5I18L 4KWKA 1CL7H 5EULV 3VKNA 2X4PB 2V09A 3T65B 3A6BH 5FGCE 3MF6A 1MLCA 1TZAA 2IALA 2YN3A 4N22A 2WJSA 2WQUA 2FBRA 1MXGA 5KANG 3U48A 2XL9A 4Y22B 2QSTA 4XPTL 1W72L 1VBD3 5HYQB 2GCYB 4MCYB 3V65A 4UAOB 3H0TA 1RUJ3 2VERA 4OLZL 3NIFB 5GRUL 2BNUA 2DW5A 2F5BL 3SDXA 4KI5C 9PCYA 2ICWA 5CIPH 2OJZL 3QZWG 3U30C 3WHXB 2YUVA 1T0NA 4QLRA 1SLCA 1AYOA 1ACYH 1DVFC 5GSVA 1PO22 2YV8A 3NACH 2WVUA 4KVPA 4CCJA 1QX1A 5FFOA 2QQUA 4UQIM 3QXWA 2NZ1A 3U0ZA 2W07A 3NTCH 2EC8A 5C0GA 2H3NB 4M93B 3VRLE 1FA4A 4XCAA 4X5RA 3F5WA 2EDBA 1EZLA 1ZSHA 2K8MA 4DGWC 5GS2D 2HKHH 1Y9MA 1DYZA 3LZLA 4FQQA 3M4FA 3UKTA 3BWSA 2HKHL 4NJ9H 4WSKA 2EVFA 3EJUA 3X11B 5J8OA 3FBKA 4PV8A 2H2PC 2X28A 3BEVA 4EI5A 5LNDA 5HGAA 3MNZA 3X2QB 3CJIB 1BZ7B 1AL23 1G6RA 1R1CA 1ZIBA 3ETSA 5AAWC 4FQ4A 5GALA 2D7TL 5TE6L 5IR1A 6FABL 4WU7A 3FJTA 5H2BB 1MLBA 1F5WA 4J5VA 2WVSA 2RTTA 2RDSA 2NUTB 2CH8A 4ASKA 4CL7A 2PTTA 3GSWB 5LXGL 4O9EA 3MJ9H 2Z69A 2TEPA 5HCFA 1AS6A 1OEZW 5JDSA 5FZBA 3RQ3A 1G94A 4QRTB 3W0WB 3E6CC 1GW6A 1CGSL 4XDQA 1GYWA 4G42A 4FTEA 4YNYA 3LD8C 1FV3A 1WTLA 3HUJF 3WF4A 4JPWL 4HS6A 3ZXKA 1FRGH 5KYNA 1VBC1 1UX6A 1WLCA 3IE4A 4JRYB 3II3A 4TS6A 3GBEA 4F9LA 4DKDC 2EIZB 3RMYA 1DR9A 4F8AA 5JQHC 1KPUA 4BQ3A 1JYWA 5B8CC 2VRAA 2QPUA 2XXCB 3SE3C 3VBFB 2GITB 4I01A 5JXJA 4AQAA 4CP0A 4JKPH 3VGHA 3DKQA 4KNSA 2DS4A 5AFEA 1AGFA 5HI5D 4BQ9A 5J1XA 3U6RA 2H6PA 3JB8A 1OKEA 4G6JH 5TDOB 2XPGB 5F3HB 3BCWA 5IY5B 3MLSL 1QSED 1I75A 1TYEB 1FL5A 5AZ2H 1EO5A 1A7QH 1ZBA1 3RZKA 3G6DL 3ARUA 2JDMA 3H7JA 4O65A 4EAEA 1U30A 2BNNA 2ENPA 5EH1A 3N4MA 2XKUA 2IGTA 2GSIB 2VDKB 4YPGB 1A7NL 2X5IA 1B35A 1OURA 3GSOB 4R7VA 2VMEA 2P5PA 4KKPA 2JMRA 3QYNA 3WLBA 4L99A 1JERA 2XWZA 4X4YA 3RVVD 4YZ2A 3PLQA 2FD6H 2HLAA 4GMSH 1DFXA 4OD1H 4AR2A 4HUWA 4X80L 4RISH 2RALA 3RY5A 1E5CA 3GCWA 4IMKC 2X1PA 1M7IA 4MB1A 3R8BB 1BJ1J 5DQJA 1WFUA 4C56A 4WEMB 2AQQA 4K3UA 2WLYA 4NDMB 1K4DB 3OZKA 1HV0A 4FXGB 4X9GA 3TNNB 3P30H 1TLMA 4FQXB 4YHOL 4L8SC 3PWPA 1EVUA 3D2UD 1XZWA 4PJHE 1IM9A 2Q8AH 3DUSA 2YRZA 3SKJL 1ECZA 4FQJH 5D2NA 3TFKD 1F6FB 3L9BA 4OZHE 5I66B 1IL1B 1BFVL 2IWKA 2DLFL 1GZPA 2P5WD 4ODVL 3QZPA 1KB3A 1KIUA 1ZT1B 4P3CL 3WS6A 1CAVB 2B59A 3JV0A 4GAYA 4QIRA 2WLMA 1ANUA 5CSGA 3FSZA 2OYKA 1AZVA 1U8NB 1KXTB 3QJOA 5MP6H 4I0PA 1XE0A 4LPLA 3NH7H 3KLKA 3H3LA 4OFDA 2VUKA 3LKPA 2YHJA 1O5DT 5C6TH 4FPFA 2NYYC 1JZJA 3DPDA 4OJYA 5CKAA 1GV9A 3BQUA 4ELDA 2H41A 3QEQA 1OOPB 5CNHA 4HQQH 4GBXC 1AIZA 4BZ2H 2LVCA 1V9U1 3QNYB 2MNJB 2MEV1 3QUZD 1XIWC 4RZCB 5IHRA 1Q72H 1YQ2A 4F7KA 3QG6B 3SKUD 4ELKB 3CDZB 2VXSL 3FN9A 3IRZA 3RFZB 1QBAA 4K3JH 3UEZA 5JLZB 3MJ8A 5MHSE 1LNSA 1DSFL 1NOLA 1K72A 3BYTA 1IILE 1F4YH 4ICXA 5TK2A 5IB4B 1WA2X 4IV1B 4JPKL 1VDGA 5EUOF 5FYMA 4YE0A 4XWGH 3MW4A 5MENB 4EWDA 1EDHA 3DVNB 2YPLB 3BT2H 2DBJA 4C47A 3J9SA 4DO6A 1CXFA 4U7SA 1BJMA 4I4WB 1B6UA 4OGYH 5K1JA 4IRSB 1EEYB 4DF9A 2WGXA 1TME3 5FMCA 3LXCA 4BRJA 2XXMB 1DG6A 1ENSA 4KGQA 5JR2A 1AX1A 2Z91B 4LDEB 4WW1B 2XZZA 2OSLB 2AEQL 3IDUA 4OUEA 1GOGA 2Y3AA 2FO1A 4IEXA 4IU2A 1HHGA 4KZCA 4QRUA 3KM2A 5ICYA 1W8ZA 1NEZG 1NANI 5I6MA 3GBFA 2VAAB 3FC8A 2E4TA 4G5ZL 1FFNB 1GYCA 2D03H 4GP4B 2FT7A 3MRDB 3DYOA 3LMJL 1IEAA 1QEWA 2CK2A 1OB1B 3RAJL 5KYYB 1HN0A 2Z3FA 5IQ7H 4FFYA 1V9U3 3DVGA 4GKZB 4U1IB 5FUCE 1J8KA 2YWZA 4Q9RH 3KPPA 2FJFB 2R063 4FXGC 2JSFA 2X2IA 1NY72 2NQCA 1A3RH 3KPNA 1BVKB 4UTBH 4AZUA 4N20A 2E7QA 5F3IA 1WC7A 3T30A 1FNZA 2NQ3A 1S9YA 1QOOA 3ZSLA 4QY8A 4PI2A 1PIV1 4HK9A 1ITCA 3NQKA 1CURA 3Q1SH 3DF0A 2J5WA 1BX2B 1SZBA 1OHZA 2NN8A 3O3EB 5KBDA 1DQMH 4U31A 4BWUA 1UWXK 3EH4B 1G4RA 2CJUL 1YUKB 4QF1B 5AZEH 2RDQA 3VD1A 5FECA 4BQXA 3DX6B 1N8OE 3MLRH 4ZSOA 1P7BA 2WXOA 5I5RA 1TJMA 3MXVH 2BWIA 4DESA 2F6AA 1XV8A 4YIQB 2BJMH 3HI6H 1BBT3 3I2CL 3T3MB 2BQPA 3JWOC 1F3JB 2UZYA 2VRQA 5J6HA 4G8EA 1QVOB 2NPIA 5E6IB 4XP1H 2JIGA 1NMCB 5ETUB 1VPHA 2D40A 3GMRA 4NZUL 2GMPA 4L8DA 4IEYA 3MV7D 1I3RA 4DXSA 2FX9L 4L3EE 4PJ8A 3D82A 2DD8L 5KBLA 4MWFA 4FQCL 1TETL 2H8PB 4C4KT 1P7QA 2E7TA 1XT5A 3R4DB 5FYKL 4GKXA 4FEIA 4PRDB 3E2HB 4DHLA 2ZCLH 3IJ7A 2DTML 5SX5H 3T0VA 1WAAE 3L2NA 2E7BA 3IB3A 2AMUA 3M3QA 4ZXEA 3A22A 4OGAC 2A77H 3TA3C 1Z1WA 3FFCA 4AGRA 3WLUA 1OB0A 2Z4QA 4Z7WA 1U8CB 5E4AA 4NQDB 4ZZFA 4G9SB 4CDXB 1NOAA 1J5HA 2QQKL 2RMU3 5C0CA 2F53B 1FL6B 3L3IA 3DN7A 3BH9B 1J3RA 3DI3B 3ABMB 1LO2L 5JIHA 2VNVA 5CFCA 4ZU5A 1KEML 1E4XI 3L3HA 2BFVL 4KVNH 1DO5A 3L6FB 3PGCA 2ZX4A 3PUIA 5A3IC 2VWEC 4UAHA 2VUCA 1MCKA 1C08A 1Q9OB 3N9MA 3S3DB 4AEEA 4BZ1H 3Q9QA 2XWJB 3DK0A 5KXCA 3DRTB 3EIFA 4IU3B 4JFPA 1ET8A 4JFEB 3C5XA 2PN5A 3FO1B 3BPOC 4LP5A 3RVTD 4PV9B 4TOYL 3RPBA 2DCJA 2DQUH 4F7TB 3I6KA 4G82A 4XILA 1A65A 4MYPA 3TU6A 1ONQA 4H25A 1KLUB 4WJKB 2V3EA 3K2IA 1TU2B 3ZYJB 3ARFC 1NA8A 1NMAH 2OTPA 1J1OH 5J12B 3SDDB 1ED3A 1JNLL 1MACA 1S9WA 4U6XB 1IFGA 3ILQC 1QIQA 5BOZG 5CP3H 5FDWA 1J0YA 3V5KA 2G2PA 1RUD2 3OGVA 4N2EA 3B7YA 2OK0L 5A7OA 5FKAB 1NLQA 1BEXA 1GBGA 2VQ1A 3WS3A 4ISVA 4BKSC 3GPSA 2B5HA 2RM21 2V5TA 3CZJA 2HJKB 5EU6B 3SD2A 5BV7L 2GALA 4AZ8A 2XSKA 3AUWB 4ZW6A 3RJQB 4QLWA 4L3AA 4JFWA 4PJAA 2AABL 3ARGC 2VUDA 1CDIA 4CCDA 1AYM1 1NCJA 4X6EB 5IHZB 1M7UA 3H3PH 4TNGA 4B95C 4LSPH 4TQEH 1JN6B 3AM8C 5BNXD 2VLJA 1CFVL 1JUFB 1WCQA 3HIZA 4WEBH 1IAOB 4O00A 2H32H 5T5NF 3ROLB 4HC1H 1Y6NR 4LE8A 3B5LB 4DO0A 3P11L 4J23A 4MH0E 2YZ8A 4Q2ZB 5JOPE 4AHYA 1QZNA 4J4PC 3RPIA 4NKOB 4D0BA 4L8QA 3GI8L 3HTLX 3QAQA 1JNHB 3GMOA 1V7NH 1AGCB 1BZ8A 1F2QA 2AP2A 1M05A 3HRZA 4L5FL 4DW2H 4KQ0A 3PWPE 4BWOA 1VZIA 1RJLA 2H32B 4V1PA 4TYSA 2XTSA 2QDWA 1N10A 2BTVC 3M3CA 1RUQL 4YWGL 2GW5A 4W9HC 5FYLL 6CGTA 2FX9H 3IXAB 3HNYM 2FJGB 3OGCB 3SOTA 1Q1JH 5LQBH 5FAXA 3MRCA 2QV4A 4K4KA 3SPVA 2GAUA 3VFPA 1IGIL 2FL5B 5DHVB 4CEWB 4S1QH 3NCYS 4GMP3 1THCA 2E46A 3KPQB 3L5IA 5FA4B 3U0TB 2VBBA 4IJTA 4OZIF 3S57A 4C0HA 4WUUE 2FQEA 2LLLA 4D9RE 1DQIA 1UEYA 3RRQA 4F7CA 2WXIA 5F89A 2XJRA 3ACHA 3GBNH 3HOGA 2L4OA 3MLZL 2PAKA 4LKXA 3T6ZA 2QHLA 2LFEA 2JENA 3IPEA 3GZEA 5DD3H 3V0EA 1PLCA 1O59A 4QWWC 2J1UA 5DZLA 3DX8B 3HI1A 3Q6FB 4WM8B 1E8ZA 2XB6C 4HKWA 4JFQB 5ESQB 4IGBC 4IOIA 5DRZB 1F58L 3T2QA 1DVYA 3BE1H 2JEMA 5EZWA 1DQVA 4NIAA 2K2SA 3BH4A 3JWNG 4L8SA 2W94A 25C8H 4E9XA 2ENJA 1BD2A 5B38G 3WP6A 1GYVA 1VFBA 4JM0A 3GSRB 1GTFA 2VSKB 2BIPA 5CYYA 4BFFA 4O02H 2AHIA 4UV4L 2KT6A 4HZAA 4NN5C 4DVRL 1J5OL 4NQXA 1QH7A 5GS1A 1QR1A 3QW9A 5ESAB 3E0GA 1KCWA 4X6DE 3WJJA 1B4RA 3BDXA 5HHOD 1BXAA 1N6VA 3KT1A 5INCA 2Y25A 1E5BA 2LTNA 1BQLL 1NDTA 1R5WA 1GYKA 2XJSA 2XZQH 4C8DA 4XO8A 3TH4T 5LWYH 3O8XD 3LWCA 4PJXA 2CV6A 2PKDA 4PR5A 1ZJBA 1EBAA 1GZWA 2OMXB 4HJTA 2XN1A 1X9PA 5CMAA 4GMP1 2VW2A 3R4RA 1TZHB 1V6IA 4PJ5A 2B4CC 2BLFA 1GGCH 1E5AA 3RX7A 1ULPA 4F3FB 5EF2A 3S7EA 1GCYA 3ES4A 4D6QA 3PV7A 3LH2L 1KBKA 4ISVB 1WD3A 1MUJA 3WFDL 3WD5H 1TQBB 1DDHB 2BVEA 3HMWL 4UW6A 3NQIA 3W3BA 4J3XA 4YDMA 4N26A 2QHRL 3CLEL 3VWKA 1WT5C 4MMXA 1UCBH 4GG6A 2WA3A 5I6KA 1M1SA 1RHHB 3QFJD 4DAGL 5I16B 2B1OA 1MS3A 5BJTA 4ZFOL 1SDAB 1ZS2A 1E4WL 3ZMEA 5F3BB 3CNKA 3S8FB 3FHAA 3ULVL 2G5BB 3MRIB 3C6SA 3GMMB 3VD5A 2BZDA 2FATL 3VGGA 3Q9PA 5DEZA 4PV9A 2ISDA 3RWCA 4ZAKA 4LAJH 4KNTA 3FO1A 1USZA 4HLZG 4J3OH 1M4WA 2IPTH 2JB8A 3BW9B 4RHV1 3JUZA 4M62L 2WOBA 3RL1B 1JV5B 2VLRE 2O1QA 5DQ0A 2H6OA 3H1ZA 3VKMA 4NO0A 4P9HH 2P1BA 5FCCA 3K71A 4XUNA 2OMTB 5I1CH 5DA4A 4RQPA 2WJ5A 1PO12 4U1SB 5D1QA 2WN2A 5A7WA 2R9HD 1R75A 4DZ8B 1SBDA 4DEPB 3E3QE 1AE6L 3PWJA 4GULA 1BQ5A 5F72S 5F71A 4XCYB 5T1KB 1P9MA 3T0BA 1DJGA 4EKJA 3KHQA 4OI2A 2ADIB 4LHJB 2AKRB 3HI5H 4HV8B 5D7SL 4K7PL 3HNTH 1NUNB 1RZJC 3C7GA 1W0VA 3GHPA 4IL7A 5J98B 5T5NG 2B2XL 4Y5XA 1GTNA 1B0WA 5D4HA 3REVB 4KDTA 1GUIA 1BW8A 3APCA 4N1HB 5FP7A 3KPLA 2VO5A 3T1FB 3KV4A 3VDDB 4P46C 4FOQA 3H2QA 2AK4D 1MWAB 3FUOA 2RR11 5FOBA 3QQDB 5C9AA 5E8PB 4Z7NB 3VGEA 4PJ8B 3IJHB 4TUUA 3L1FA 2BCMA 5F0JB 4WK2B 3V0WH 1X9TA 3AY4C 1IBHA 3VMOA 1ZV5A 3TV8A 3AL5A 5H37H 1SEQH 3A4FA 3C6LD 3K72A 4G1EB 4P4KB 3EHBC 1ZLSH 3UBFA 4B4RA 3QQ9D 3EGDA 1TZIB 3ULUL 5I19L 2CIIB 4LVOB 3V6FA 4NPMA 3L5WB 4YSSA 4JC1A 3CC5B 4AIOA 1U8LB 4N9HA 1E3XA 1FO0A 5TDNB 1S5IH 1ZLWH 1J84A 1A1MA 1FNHA 2IG2L 5D7IA 1DBKH 3TT1L 4BBWA 1QO3A 3PMEA 1KLFB 2VR6A 5FZOB 4S2DA 1OP9A 2WC7A 3D87B 4KAQL 4OQTH 4U7KA 4QNPF 5I0XA 1EHLH 3KWWB 1EK3A 1RZ7H 4P0DA 4R90L 3O4LD 3N9PA 3AMPA 1YEIL 3NFNA 4KKLC 2I27N 2HWE3 2OVUA 4PRIE 3T09A 1NCWH 1KZYA 3GYDA 3NIDF 3IVKB 4LUMA 2F74A 1UZWA 1K8DA 3TN0B 2BWQA 2DJ4A 4M01A 3GMQB 1AQDA 1H15A 4XNUH 1BREA 4LF3A 2C24A 2IWGA 4BISA 3JV6B 2YGNA 4GAAA 1O7DC 3L2LA 4WSGA 4DZBB 3F6LA 4MCZB 1WLTA 2BNQA 3N85L 2DMBA 5EXOA 2HWE1 4HEPA 4G3YL 3D6GA 1ADQL 2FHRA 4EMZA 4JDNA 2WZPA 4C91A 4NIIA 4XXCC 1MFVA 4IRJB 3W1ZA 4O2FA 3MA7B 3HC4L 2CG9X 3SGEI 4M3CE 1FNSL 2ZCLL 5HV4A 2KERA 4OCYH 3WY4A 1U12A 4P2OA 2O6FA 5D6CB 3FCTB 3M7OA 4AG4H 4G72B 3CC5A 3MV8B 4M48L 4S2SB 4FFVC 1VRBA 3IF1B 2PYFA 3LEVH 3ZKND 2XJVA 2VDPB 1UWEL 3EJRA 3I3EA 4I77H 4QRRA 2ADGB 4IRZH 3IU4L 4CC0A 5CISA 3OHXB 3AS1A 3FOLA 3MJ8B 1FORH 3RZCD 1JPSH 4HPYH 4BGLA 3AT8A 3I9PA 4MJJA 4MG2A 2RGSA 2L3BA 4RX4D 4ZTPL 1JGEB 4I2XA 4AGNA 1CI3M 3RNKB 1JK8A 3PS6A 5B1JA 3R8QA 1GU3A 5AVPA 3DXAD 3JV4B 1D2PA 1ENQA 5CBAB 2WBWB 4Y5XB 4UDTA 1D5MA 5BRQA 4KBZA 1HL9A 1YYCA 2Q0ZX 3KSCA 3WINE 4COWA 2WWJA 5E1AA 3D0LB 4EDWL 5I73B 3TZVA 5DSCB 4NQCB 3O3DB 2SLIA 1AJ7H 1XGZA 3FCSB 2FJSA 2K45A 1SBBA 2VZ1A 3HRZC 1UT1A 2P4EA 3O4OB 4QYAA 2MCPH 4IBLT 4B29A 3KPRE 3S36X 5E89A 1Y18A 1T21B 1I8MA 1UFGA 1JD7A 4IKNA 4P23A 1YYLH 5LB1A 2B4CH 4NN0A 1GL4B 2WXKA 1FFOA 5DYOB 1AFVL 3RTQC 1VBA1 4OJDH 3VM7A 5CF3A 1J8HB 2X9WA 4HIXH 2H9GA 1QDOA 2WNVA 3HAGA 4IGQA 4P04A 3NP3A 4LVNC 4YHKL 2X3BA 1L0YA 3F84A 2HWC3 4L4VE 1T89C 4X7DC 1H0DA 4DFSA 4LRNL 1W0YT 2MRYA 2XETA 3VG9B 1Z66A 4WV1C 5EU4B 1V05A 2UX6A 3E6FA 1W04A 3AQYA 3QIWC 3QJRB 5TPWL 1TQVA 1RJYA 1GR3A 2VKXA 3S3JA 3OKNA 1IC0A 2VMDA 1D5ZA 4DERA 1HTYA 4GKSB 4H0HB 4J1UA 1RHHA 1NDMB 1GC1H 3PHQB 2ZOUA 3BN9D 4MMXB 1BVLB 1AR92 3VXRE 2WNKA 1WFIA 3I3DA 4J3OC 4ZMZA 1PO11 3F3HA 1DQ6A 5E0QA 4J3VA 3AREC 4JKPL 5DQ9B 2A6VA 4D0QA 3OF6D 2OI9C 4WHCA 1IX2A 2ORBL 5CIPA 1NCBH 5JSRA 1V55B 4JRXE 5EPMA 5TQ0L 4M8QA 4X80H 1XOYA 4CN6A 4UNUA 1HXYA 3IDCB 1O0VA 4P5MA 2I7SA 2HJLA 2B5IB 3UMTA 2ATFA 1GZHC 5JHMA 4Z7OB 4JJ5B 5IIEA 3DRQA 4GH4C 2H6BA 4UTAL 4JQTA 4Y4HA 1LECA 3ZY7A 2P5BA 4OBRA 5C09A 5FLHA 3DVIA 1XZ0A 4AVKA 3THDA 4C83A 5IHUH 3MIFA 2VR4A 1WJ3A 3IMVA 3L08A 4Q4V1 2LV4A 1A66A 4YVWA 1ET5A 4GI6A 4ODXB 3HMXA 4FNTA 2UWBA 3BIKA 2UWEB 3OY8A 3HNSH 4D2NA 2YMTA 3L4VA 3HQRA 3L2HA 4E4ZA 4OIFA 2X5PA 2B8OT 1TG7A 3OPTA 1U42A 3DARA 4OFYD 4S1RL 1TME1 4TL5A 3DV6B 3G3LA 2L04A 3WN5A 5FZLA 2Z31A 3LV3A 1DN2A 3HFMH 3DKWA 1W6PA 1OE1A 1CFNA 3GC3A 4JFOB 1GSMA 5KBNC 3UJTH 1MCNA 1P1VA 4W9LC 3N40P 2WXGA 3IN2A 1RURH 2Q8BL 2J20A 3K91A 4OQTA 4V2BA 4ZX5A 5IQMA 1CDHA 1BYNA 2R2HB 1BZ7A 5AG9A 5IG7B 1H9PA 3AU0A 4EI5B 5AFBA 3KGSA 1E5UI 1T2QL 2WLLB 1FYTE 2K9FB 3K6SA 4W9FC 1E5HA 4XVOA 3KPQA 3NRUA 5F5CA 4NRMA 3KG5A 1Y07A 3PUUA 4OLLA 5FYKH 3Q1EA 5CJQL 4Q89A 3CDGB 1W3XA 5DZAA 2X41A 4WWPA 3BMVA 4IM8A 3SO3C 2XVLA 1V10A 5FK8A 5AVZB 5CZRA 1I1AA 5ITBL 4UU9B 2OL3H 3HLKA 4D9LL 4YBLC 1T0NB 5IW0A 1J1XH 4ILDA 3RQ0A 5KVEH 1JXDA 3VZNA 1VAVA 4HKZA 5A40E 1BEV2 3CXDH 3FRPA 4NM8L 5AZ2L 2CO6A 2XR4A 3POWA 1JNHA 3GMOB 5AFAA 4P5YA 3S9DB 4D0BB 3AYEA 1CJYA 3CSGA 3MBXL 1S9VA 1PLBA 4XVUD 4W68A 4BWTA 5HYQA 5LEJA 1EPFA 4LULA 4BSJA 1ENXA 4BFJA 4LESA 3S88L 3O6LL 1NCHA 2J22A 1NCRA 5C0AD 3V0GA 3UPRB 2ZUQB 3HNVH 3GUTB 2PCPA 4IIQA 4PJHB 3B02A 2OTUA 3CMOH 4YDVA 3ON7A 4QDSA 4IGOA 5DR5H 5ENWA 3F7VB 5DJ2A 5FY8A 3AKSA 1UM5H 3E2HC 5DJCB 2XG5B 3ZFFC 2HP4A 1SOQA 4QPEA 4AXWB 3ZMOA 2AGJH 5CO1A 4ISRA 5FZ9A 3VBRC 1AIFA 1HILB 2AERT 3G5VB 3RX9A 4A3ZA 1IKNA 4UTBL 3N44B 1YN6B 4TSAL 2Y7NA 2K6ZA 4RBPH 4R4NC 3V4VL 4YQXH 1MY5A 1RUF2 3KYOB 2OMNA 5T1JA 4ZY9A 3HG1E 1G1KA 2H0BA 4HK3N 4HXBL 4DEPC 1ZYBA 1JMZA 2WO3B 3VH8B 4A2DA 3RAJH 5BZDA 1D4M1 3K4ZA 2DKSA 2YBRA 4U0QB 1RUC1 4A7GA 2DYCA 4XMWA 1RYYA 4X7TB 5EIQA 1GAFH 3D4CA 2FEDD 3V6OA 4AMWA 1A4CA 3LB9A 5ADOH 4N2OA 1FUNA 4LBAA 5F7LB 4ZNEA 4HBCL 3RL2A 4FNPA 2E32A 5L6YH 35C8L 4YZ4A 3CZUA 3V0AA 5KHHA 4FMVA 1RUI3 1A6TB 3HW7A 4LHSA 1RK7A 2BWDA 1YCSA 2ATPA 4MA1B 4BKTC 1DJZA 2WLIA 1DQ5A 1E4KA 2ADFH 2XBO1 3GXUB 3KV6A 3JWDH 3ETBJ 4RSVA 5E9NA 5T5JA 2W47A 3CVIL 2H0FA 4AEHH 4U0RC 4S1RH 1RXFA 2BDNH 3HPJB 4Q56A 5JW4Q 2UY7B 5DS8A 3RUGA 3BKZA 1W15A 2ZABA 3NZHL 5C08B 2ZOOA 5LCVH 3CE1A 3UPAA 4EDXB 1NA1A 3G04B 3QJFB 1FL6A 3L3IB 1KCSL 4W81A 1LP9E 3IWUA 2R2BA 4N53C 2D2OA 3EFDH 4RIRA 2Y69B 4Z7WB 4CDXA 1MZYA 3PHQA 4K3GA 5GS3A 2RMU1 2RMNA 3KYKL 3NPSC 4PJIA 3QUMB 5FMOS 1WBZB 1AO7E 5K9OA 2QQWA 5ALBH 2AV7B 4TNWK 2NY1B 1T2QH 3AACA 4TVSa 1ONAA 2LABA 3NFSL 1XSJA 3JTBA 4RMRA 3BLBA 3R4DA 4ZFZA 3Q7JA 4W9CC 3RWHB 4MLIA 5MENE 1UFUA 1BP3B 4JLRB 4Y26A 1CD3G 3E8UH 2WNVB 5KOMC 3QCVH 4A6SA 4N0YH 4E9SA 1LP9B 1C1FA 1N3QA 2ORBH 1C7TA 2WWMD 4PRPA 2EE9A 1I7ZA 4G8EB 3NIFF 4GB32 1HN1A 1J59A 4PGEB 3IJSB 1N0XH 5GHWL 5K9QI 2QVSB 4I5BA 3VSUA 1W6OA 3LRGA 3ROUA 1BZEA 5DPNA 2QSCL 3HCVB 2H4EA 4NBYB 1P69B 3IKCA 5GZOA 1YFUA 4I18A 4CADB 4QF1A 3JBG3 1EV2E 4AQ8A 3SPJA 3ZR5A 3KGRA 4M5ZH 2TBVA 4NYLB 4QUOA 1UTDA 2NZIA 2FNBA 3OSDA 4Y1TA 1G6RL 4IRJC 3R06B 4X9YA 2DBNA 4PRNB 1HZKA 4Q0SA 4A2UA 4L4JA 2F5AL 4KY1H 5D55A 1CFQA 4PJXE 3VDCA 3TBDA 2IXQB 1SLUA 2F53D 2XTJE 3OJMB 4XRCA 1AX2A 5F1RA 4FQ2L 1WMDA 4OF0A 3VFMA 3LTVA 4K3HA 4D7PA 4MQXD 4ZONA 4M6MH 4YDKH 4YHLL 5KJ7E 3NOIA 5F6HJ 2DVAA 4FX5A 3SDCA 3ELAT 5I6LA 2Z1KA 1IQDC 1EXUA 1MELA 3PQYA 3T0AA 1A25A 4UFLA 1J3QA 1KJ2A 1U2YA 3L45A 1NCQA 3FU9A 4RR3A 2QGEA 4XMXA 2V8MA 4WVMB 3FUKA 2BP8A 2UZPA 4MS8D 5E1IA 5HYJE 3ZXGA 1UACH 5TFSH 1AGBA 2DM2A 3CFTA 1UMZA 5HDBE 4HU2A 1X4XA 3E9TA 3VXNA 3WDJA 2PP7A 1AXYA 1SN0A 2DEWX 4G8GA 4IRJA 4KHXL 2CR3A 3QQ3B 5SX4I 1UKSA 1RZFL 4F8PA 2X05A 1LVEA 3T2OA 2HEVF 4M3JA 2PYED 4HWUA 1XFPA 4RMUA 4Z7AA 3VXOA 5L19A 4AEHL 1IC5H 4IK6A 4PHZA 1RK0A 2OSWA 2GUOB 2IH3A 1BIIB 3BEWB 3NUKA 4RISL 4WUUA 5FUZH 1MVEA 5FFOC 1CR9L 1I85A 4OUMA 1T5WB 4R96A 2VUJA 5FV3A 3MLYH 2WXLA 4XW3A 1ST8A 3PU7A 1F97A 5LBSH 5KR7A 3LN4B 4QCIB 5ERWB 1PGW2 2FDKA 1JVOA 5G05L 3UAAA 5CZKA 3KWXA 1CZ8L 3ZO9A 4MGQA 3FC0A 3QEUB 4IKLA 4Z95L 3LGRA 1NFDE 1AJOA 1VBD1 4LSDA 2AEOA 1ETB1 2ZMLA 3L95B 3FN3A 3BP5A 1WMXA 2Q3ZA 3VXMD 1ZA7A 5JSPA 1XSQA 3M1OA 1UZ6E 1OTUC 2WUBL 2HLFC 3MJWA 4JDZB 1OOAA 1TMF1 3M86A 1T6GC 5I1GL 1QQP2 2HRHA 5L7OA 3L5XL 3V4UL 1MJ8L 2C4FT 3SE6A 3UC0L 5JNYA 3JYBA 5T5LA 1X9RA 4UV4H 4DVRH 5GGSB 1HNFA 1DL7H 1KIUB 4XP5H 5DURD 3VSVA 4HKBB 2BSTB 2NYKA 5BQDA 1FFPB 3BQVA 4P08A 5BO1H 3WTXA 2Y6HA 5C5UA 5CGMA 4AKQA 1AKJA 1KPVB 3ZDYF 1UB6B 5ID1B 3BE1L 4HJGB 4RGNE 2LRPA 4XNMB 4WEBL 3IBMA 5IFAH 1MCWW 5F7BA 3AP9A 2VM9A 1UG9A 3CFKB 5DK2A 2FDHA 4JG1H 4J28A 3EO1A 3O7OA 1RUPH 1W6WA 3V5DB 4XXCA 2WVVB 1UH4A 3BSHA 5I71B 1I3HA 1BQHA 3WDVA 4ARXA 2WFF1 2YPLD 1NBCA 2HMIC 1YRZA 2DMGA 1I9IL 3APMA 3H4FA 4JFDA 8PAZA 4DZGA 4IRSC 5IFPA 3KYMA 2E4FA 3P0GB 3TT1H 1C1EL 1PGL1 1BZWA 2ERJC 4FOYA 4N0RA 4BFOA 2AKRA 2YEZB 4HV8A 3OEAA 2R7EB 5IB5B 1Q1JL 4ZMYA 1KGYA 1RHI3 4YPGA 1C9SA 2AJSL 4L3CB 1Q3EA 5T1KA 3AREB 2X5IB 5FYZA 5CILL 2WJ7A 4NO3B 2BNMA 3GBMH 1BVP1 2JCCB 4N0UA 2XN9B 1SBEA 4DW2L 2A5UA 5HDQH 1PX4A 2EH8L 1IC4L 2OMTA 3PAUA 5IAXA 4IJ3C 3DBXA 1GPOL 1CGPA 2BVOA 2YMXL 4WFHD 1DUYA 5ECJE 3RL1A 5BUVA 4JANB 4YHIA 2AACA 5DEGB 2WT2A 3VI3A 1XSKA 3WFHB 1SXBA 3LIHA 5E8AA 3VXSB 3GS0A 3SJVA 3W39B 3HN5A 1HXS3 4JZRA 4UB0L 3ARFA 4MADA 1OV8A 3NCJL 4RDQG 1HYSD 2CLZA 2DWYA 2PPFA 3ZKQD 1U8QA 3VBSC 1P6AB 3QIBC 2EO1A 4JHWL 4KK8D 4YGDA 2XFGB 5CJQH 4HG4K 4TUKH 3I3QA 4F8NA 1FX5A 4HJJL 5LBSL 2APBA 3NCMA 2ADJA 2HX9A 4FQ2H 4HK3J 32C2B 4LFHG 4M7KH 1ZDSA 3EYOB 5E7BA 3VD3A 5C9JB 1FMD3 2DVFA 2DI9A 3BUCA 2YSSA 3VVWA 1N1YA 4NZDA 3CH1A 1TEFA 2J42A 5EUOA 3C8XA 1HQ4A 5CGBA 4DOHE 3T0XA 3EOYG 1KN4H 1T7WA 2B0SL 2XZCL 2VLRD 1XQ4A 3UMNA 1MS1A 5I8SA 5IVZA 3S6CA 3GWJA 1MI5A 2ICEA 3VCLA 1A6WH 2EABA 4YRDA 1XGQA 4QHUB 1T5XB 3MLWL 4FYRA 3TIDA 3CLPA 3NL1A 1CF8H 4L9LA 2D7FA 1HJBC 3CDCA 1WW5A 4FI8A 1UIKA 1IQWL 4EKXA 4Z07A 3PIQA 3GGWA 4NOFA 5DK3A 5I8CA 4GXLA 4MGTA 1QSEB 3DV4A 3W37A 1HKDA 4KNUA 4F57L 3QRBA 4L4TD 3BD5A 2AQ2A 2H3NA 3WI9A 4F93B 1RJ8A 1MJUH 1OSYA 2W07B 1MW0A 5JUVA 3GXDA 3D0AA 3FZUC 3FULA 3VDAA 4JL2A 1R1A3 1Q9WA 4EQVA 1VFBB 3GJAA 1H9VA 1ZWIB 2DJMA 4P2CG 4ALAL 1UA7A 1NA1C 1SY6H 3SYQA 3UBGA 3H50A 3TLRA 2CNYA 3A4UA 1YEKL 2BNUB 3J8F3 3VXSE 5DQDH 3ZYFA 3DGGA 4JFQA 5ESQA 3TEWA 4G6ML 2A74C 4TLGA 2OXHA 2X4TA 4RESB 1RUJ1 5I74B 1IV8A 5DD6B 3K75B 4Y22A 2NNFA 4RCAA 1ASJ3 1I9RA 2PHDA 3KWUA 4JGZC 2C5DC 3RWDB 4AJ0A 4LHKA 2DYPD 1RLWA 3SKNB 5I1KL 3T65A 4Z9KB 2YKLH 3MUY1 1W6QA 5D8AB 1DQ4A 4HG6B 4PP1D 1QJX1 3U0TA 4CKQA 4RGMC 2VYRE 4LCCA 4JKWA 2XQYG 1CF1A 3MRHA 4GAGH 1VAMA 2BGCA 1IGML 2WNUC 4XFCA 2QQKA 4BMEA 3GSUA 4HGWA 5LGHL 5BMFL 4GKNB 4BFIA 2BXZA 3WQ0A 4EN3C 2DFCA 3RURA 1DL7L 4XP5L 5AC93 2DQEH 5INDA 3MO4A 4CDQC 4LPYA 4M4RA 2CZNA 4RFOH 3O4OC 4Y4KC 1AR81 4V1DB 3DXAE 5DUPL 5ADPL 4G8FB 1QKQA 1G9AA 1CBVH 2ATKB 3LQAC 4K0OA 5GZNC 3WXPA 2CXGA 4ZBJA 4TLKA 5A2BA 2FO8A 1NAMH 2EDTA 3QYMA 3SE8H 3RWDA 4Q1RA 4JHAH 2V2XB 3QEGL 3A0KA 4JQIL 3AITA 4RQQA 2XONA 3QDHA 4OB5L 3RZCC 2E6PA 4EROA 4RMQA 5AG8A 5FLVA 4DKAA 1DJSA 1GS6X 3T77A 1FHNA 4KITB 4XX1E 2VTXJ 3B56A 5DHMC 5KOVC 3C5ZA 1H5BB 3GEWB 2E9WA 4K8RL 5DDJ2 1SEBA 4Q9CA 4CJ0A 4O5LL 1QR4A 3DPRA 2BGPA 3W21A 4QMAA 1NZCA 3QUYB 3WLWD 4OCYL 4PWIA 3FLPA 1W03A 1V3KA 3F2ZA 3GHBL 2VXVL 1R0AL 2XMLA 4PJ8C 1AQ8A 2X4QA 2DQIH 5CEZH 4XMIA 1WZMA 4WO4D 4MD0B 1VA9A 2H47C 3APDA 1I3UA 1P5UC 1QPXA 2DV6A 1WCDJ 2VOKA 5FZHA 5IVEA 4L2YA 3BI3A 3DYPA 3O12A 1FL3B 3HMWH 1NGPL 3ZL2A 1ZT4B 1UU6A 4RFEA 4LOTA 2GC2A 4Z77A 5GJTH 4L3EB 3VRJA 2D6NA 1LM8V 1U3HD 2RS51 1ZZ7A 2ROYA 3IDYB 3T3PF 3AS2A 4EPSA 3I2KA 2V5SA 3D48R 1XF1A 4BZ2A 1HHJA 2B08A 4HLEA 2VABA 1G9MC 3V5HA 4M3KB 3ARXA 1U8PB 5DUBA 2PCXA 3GO1L 4NOTA 1CGUA 4PD4K 1ADQH 5I1JH 3L6FA 4ABUA 3KMHA 2ZXEB 2CDEB 4MA7H 4MRCA 4PRID 3T6WA 4R83A 4XXDB 1AXSB 1YNLH 5TD4A 3V95A 2BDRA 2VTXA 5C8CC 2X29A 3VXME 4NO2A 5EFIB 3NG5A 3ST7A 5C0CB 3BOPA 3QI9B 1WCBA 4XF0A 2FLBT 4PRAB 3AXEA 5D7JD 3S5ZA 3IPVB 1AZCA 4LL1A 5ISZB 5LB6A 1LNUB 1CIYA 2WZ8A 3GRWA 2PCYA 5DUMH 4PTUB 5ICXA 1R4XA 3KPRD 4UF7C 4QPYA 1HKFA 4Y16C 3BX7C 3DX0A 4GQZA 5BVJA 1KCRL 5DMIH 1LOCA 1ZRFA 1UEMA 5DVMA 2VN6A 1I7RB 4FDWA 4RHV3 1HZHH 5IBUB 5BV7H 4MXQC 1TMF2 3ZYRA 2CDGA 1CD1A 5BS0B 2OCCB 3VFWA 4Q8LA 5F96H 4MQSB 2UWEE 1H8TA 2I9TB 4S1SH 3TOPA 5D1ZA 4OHWA 2YK1H 3OGOE 4LOVA 3F7YB 1VBD2 3NESA 1BMGA 2EVXA 2IANB 1DE4A 3LY6A 4NFBA 4RLDA 4ALAH 4UQBA 2K7QA 3FB7B 1WV7T 4P5TC 4XBMA 5HYSB 1H3TA 1SXZA 1JI1A 1LU1A 4AHXA 4QPGA 5GLWA 3DX4A 2JKNA 1N4XL 2ZNXA 2QQNL 4Z7OF 3GINA 5I19H 5IVBA 4BH8B 2ETEA 2QKDA 1ML0A 4ISQA 1RJZA 4FOMA 1R082 1MJJA 2OV0A 1QABA 2P26A 2VC2B 5A2JH 3O3BB 2CGRH 4JG0H 4J3BA 3QDJD 1CIDA 1CUOA 5F1NA 3DEMA 1J11A 1I8LC 4L1SA 4ZW8A 3UL4A 3VXTA 3ESPA 3R7QA 4I3PA 4FG6C 3O2DH 3HBQA 1XSRA 4GLRI 4H1LA 4DP0X 5FYSA 4MX7B 2H2PD 2NNRA 3I85A 3UYJA 3QIBB 3FPYA 5CM1A 4OFGA 4YARA 4OQ8A 4KC3B 2YRPA 4QOKB 3WKPA 4BUHA 4KFZC 1NEZB 1IAIH 3HB3C 1UQSA 1TZGL 3N55A 4QRQB 3S2CA 4MKTA 3S37L 3FQYA 5LO7A 1IE5A 2C6SA 1A0QH 4U6YB 4KZ0A 5DHXB 2M83A 2PHUA 1Z9PA 2WTRB 1LYQA 2ZG2A 2LAAA 2NY3D 3DX9A 5C0FB 2Q76A 2A99A 2HFFB 2K4AA 1RZQA 1T1WB 1JHLL 3WTYA 3BB6A 3T08A 4QRQA 1I1FB 2BRRL 2I5YH 1UOWA 5FM5M 1PZ2A 5ERWA 1S7VB 5DLLA 3ZE0F 4YGAB 1IM3B 4BQ6A 2JKBA 5KXEA 3BAEH 4RMSA 3EO0A 1TF4A 3DVNA 1IGYB 2AQ3A 3GS4A 3WJMB 5BNNA 4MQTB 4AL9A 4ELMF 1JL8A 1YPZB 4K5OA 4IUGA 2C9QA 5TSWA 1KXQE 1FYTA 3LSOA 4B1LA 2YD8A 5F1NB 3OGRA 4K8RB 3GD1C 5DZNA 4Q0VA 3VBUA 1RTVA 3ZFGA 1G0XA 4CMHB 4QQHA 1FF5A 1Q0XH 1IS3A 3MLVL 4XC3L 2CMRH 3I6LE 3BESR 3M88A 4IMLA 4FP8L 5B7EA 5IM7A 1Q38A 1OOPA 5KTEH 4Z2WA 1P0SE 3TTSA 2BMKA 4YZ3A 3DX9B 1BOYA 5DI8B 4P2RB 5C0FA 2ICWJ 1LO5A 4FFZA 3KAAA 4QPGB 4R0LC 4GAJH 5CGTA 3SGJC 1A1NA 1YMME 3TWCL 4ZG1A 4D3WA 2YC2A 3DO7A 3VHRA 5KSBF 4XMVA 2ED7A 3T0EA 3PTRB 5FPVA 2F54A 5FY1A 5GGVL 5LWYL 1RVF2 3VJ6A 2VXVH 4NO5B 4Y33A 1EBPA 1GANA 5A2CA 3X12A 5FW8A 2CDGB 5BS0A 1C4RA 1FYUA 3NN8A 4GAZA 3UV9A 1XH1A 2FHBA 4MJID 4JDTH 4IXLA 2BW5A 3DIDA 4L2LA 2FDBP 3FFOA 3WEOA 5DLMH 2JE7A 3IDGB 1ZZ6A 4ZS3A 2UXVA 2QJVA 2ZP8A 4XJUA 3D50A 1H6YA 2SBAA 1PD6A 3R06A 3EH2A 5EFUA 1YLBB 5ACZA 1CONA 1ZBE1 3ECUA 3H9HA 3U83A 2G2NA 5AAMC 1IAKA 4HFSA 4PRAA 3VG0H 5JOZA 1IZKA 3VGFA 4FF9A 1YEEH 1PFCA 3BTAA 1OLLA 4I18B 4F9PC 5DJ8A 1LGVA 3ILRA 4YFWA 1C12B 1SQMA 5JHAA 4CTEA 3Q5YA 4HFUL 5EMYA 4MSWA 1JXKA 1Z9MA 2PXJA 1HL8A 1AXSA 4I5BB 1OHFA 4X98A 3FH5A 3UCQA 1XXFC 3HE6D 3VX0A 2F7RA 3WDUA 4BDVA 1D5BA 1LOAA 4EZLA 3PRZA 1NC2A 5FYKU 1N9PA 2VW7A 3HRPA 3EXLA 3LEYH 3O0XA 4GSRA 5TDOA 2ODIA 2HX8A 4Y4KA 1HDMB 4LEOB 1ZTXE 5IROD 3THPA 3W5MA 4KJPC 3I9GL 2BERA 4N53A 4JFTA 3AB0A 4NHMA 1ADQA 3EUDA 5SWZA 3ZL4L 1KB5H 2WYIA 2GK0A 3N35A 1U6AH 1JYNA 1AE6H 3VNZA 3ILPA 4PGCB 4PAZA 3D34A 5D70H 3N1MC 4R6UA 2PP8A 4P9HC 5L9DL 1AYN1 4FVVA 1G9DA 1T20A 2DWSA 3K51A 4KX7A 1KB5B 3BIEA 5I75B 2F58H 5BZWA 5KEZA 4PJIE 2ZJSL 1KYUA 4XXDA 4JQRA 4F5CA 4HF5L 5FYKD 4GB31 4EOWL 4X7EC 5F3GA 2O30A 5EUOE 3NGBB 1J05A 5DUBB 4FQHB 3H8NA 5IFJB 5KXDA 1K4CB 1KLGB 1FC2D 5HP5A 2ZZUT 2A73B 4Y2DC 5E70A 1Z7S2 3LAFA 4L4TE 4NRZB 3OBRA 2ZICA 2MIZA 2R69L 1KTCA 1AANA 1USQA 3TO2B 1US3A 3IRCA 4JO1H 1OTTD 4DY5A 2E8YA 3L4ZA 4Y4HC 3W11C 1R1A1 4B7KA 5IMMB 1KJ3L 1RMU2 2VN7A 4BHPA 2ZZQA 2A9ML 5KYWB 1P5VB 2ATKA 2R062 1MVUB 5FLUA 5EJZB 1GYUA 1UQXA 2EAAA 1PZSA 1QOKA 5BNOB 1U3ZA 5CEYB 4AKPA 1PVXA 2XQRA 4MD0A 4ELMB 3B3QE 3RVWC 5B3NA 3B7UX 4QTIH 4LSRH 4ONFH 3WJLA 3MRNB 1N64H 5LEKA 4A1RA 1PKQE 3DCQA 1IFHH 1NM9A 4KKBC 2MFNA 1IPSA 1X7QB 1AIFB 3K77A 2ZKNA 3GSNL 1UA6L 4TL4A 1E5RA 3ETTA 5AENA 1NX9A 4K1YA 3HHMA 2E8ZA 4JZNA 4IW4C 4E9KA 5D8AA 2OTUB 3CCHA 1PNCA 1SYSB 2R061 1HIXA 5GRWA 2NY0D 2JCWA 3LPPA 4URTA 4KMLB 1TTBA 4LGSB 3TA3A 1BBT2 1RIVH 3MCKB 1NCRC 5EJ3A 3SZ6A 2VVEA 3DC0A 4PWEA 3LXBA 1U8HB 3EJYC 1S3KH 2J55A 2P6HA 4Z7QF 3EG9B 3D2UB 3H85A 2P7TA 2YQ3A 4WSJA 5B1KA 3VXRD 1FJ1B 3UZEA 1JWMA 5L36A 5JYMA 1E3ZA 3GSXA 4J3OG 1QRKA 4Z3HA 4Z7IA 1NANH 4FZEL 2DTSA 2OA9A 4CSWA 3MLTA 4D8PB 1T6WA 2XVKA 2E3VA 2EXJA 3VKLA 2Y64A 4YPJA 4PJGA 5HI3D 4ZW7A 4FNSA 2UY8A 3OBZA 5CJ5A 3VWJA 4BFIB 2D5HA 1ZGLM 2DCTA 3JBG1 2JKIS 1IB5A 1XYOA 1CVSC 5AW4B 1X50A 3L9EA 4ELMA 1AXIB 3N42F 4JHWH 5LA1A 4LCWB 1ZHKA 4HUUB 4MA1C 3HMYA 4H8VA 2QADB 5JXEC 5MEPA 2WLLA 4K5PA 4AF9A 4YHMH 1BQKA 2YAMA 2BY2A 3IRPX 2J1SA 4U1KA 5E1HB 1N3PA 3V4PH 4MZIA 1FNEA 4NWUL 4PY8J 4RSYA 1V6NA 1TYJA 4CGTA 4QX7A 5I0TA 3WNMA 3FW6A 5JORB 5DMJB 1KDMA 4IIZA 2YB7A 2KH2B 1AR91 5BQ7B 4F15B 5C3LD 3UZEC 1O7FA 1X6LA 3FWEA 5JDBA 4AK2A 2YSSB 1IBZA 1WWBX 1REFA 4KI5F 1TO5A 4FHJA 4YAQA 3OWEA 1A6PA 4YC2B 2ZKHH 1RIUL 3SKOB 5ADOL 1AUYA 1TNRA 4JM2A 3IFOA 4JFHE 4J8RA 4YHKH 4D69A 4Z7WF 2P42B 3IT8D 3N1QC 5DLML 5D96B 4ZQTA 1QBBA 4FLHA 4NM4H 1YO4A 3LF7A 2CLZB 2NX5A 4JY6B 3Q05A 1EGJA 2ENRA 4MGYE 4YHYC 3QUKA 4FLSA 2X10A 3ESOA 4PW9A 3VXSA 4DWHA 3O0RH 3ARBA 4TVUA 1LEIA 4XPTH 2DIBA 2YO3A 1JZEA 4LLQA 5C7GA 1PIV3 2GK0B 2NOYA 4ADGA 5LCWL 1IC7H 4IESA 5SWZB 3VI4E 4AIZA 5E99H 1ZANL 2Z2SB 1NEUA 4QR7A 5KSVA 2ET1A 2YPDA 1HQ4B 2BVOB 2L7QA 4M1CC 4MD4A 1BXXA 3WF0A 1QSFA 3L4YA 1D9KA 2Y6TE 3LHPH 2NRDA 3U4KA 3ULVD 4YYOA 1OF2A 4PRHD 2VGDA 1MVYA 2EP6A 3E80A 4K73A 2YXWA 1QKZL 3DDFA 1LMKA 3FQ1A 1EQWA 2XRAL 3I02B 4OLVH 4PVLA 2AXGA 1CFSA 2AV1B 5JW3H 1EPZA 3T1WA 1J0IA 3GNML 4B3VA 2YR3A 2Z8RA 3S34L 5BNNC 2EDJA 2WIIB 1C16A 3MN8A 4K94C 5GZOC 5LGHH 1MFDL 5C07D 2VERN 1D5ZB 2DDUA 1QFUL 5GRXG 1BYPA 1DEDA 4MXVE 4Z7UF 2DBLH 2JECA 2XBTA 3EFOB 3NDZE 1IAKB 4NHKA 1CLOL 3KYAA 4PPTA 1WGPA 1KBBA 1H0DB 5ACZB 2YUWA 2WVVA 3FRPG 3S5YA 1AYM3 3LEMA 4YLCA 1XGPA 4WU5A 5GGRA 3ZTNH 43CAA 4PIXA 1WAPA 4XF9A 4M7KL 1FFOB 3H7BB 4QDGA 1KFUL 1Z9OA 4D6SA 4TXWA 4PYHA 3RI9A 4YR6B 1BVNP 4U36A 4Q8KA 2MQGA 1T21A 2JCCA 2V4AA 4L37A 5GS1C 4OI7A 3FBMA 5HCBA 4LLUA 5J36A 3HKZA 3CL1A 1OVZA 1RHI1 4AM0B 3FCSA 3VJ6B 3WY1A 4C0BA 2YAPA 4KY1L 4ODHL 4R7DB 3D85A 4G1MA 1PEZA 3T0EB 3UABA 3I75A 3QDJE 3GXMA 5FF6A 3DO7B 3KVAA 5C08D 4FQCH 2CBMA 4JM4H 4BCXA 1BM3H 3SEPA 3QSKB 4WBBA 1JWUB 4LHQB 3WSQH 3JQXA 4XPAL 4KKQA 3WSQL 4HJ1A 4OLYL 1JZ7A 5C4WA 4A7QA 4Z78A 4HCIA 5M94B 1YNAA 3I2CH 1JGEA 3LEXB 5FYVA 5I30H 4M7JH 3UKVA 5DO2C 3QIUD 3RY4A 2K9UA 3LSOB 2VC9A 4XJ9A 4OHYA 1HXMA 2WMPB 3BPCB 2MHFA 1AKJB 1T3FA 2ADGA 1IQAA 2R49A 4TVPL 1NBYA 1X5AA 3R19A 4ZXBB 4X6BB 3SY6A 3RPKA 3TEUA 2Y1ZA 5SV4A 4J1WA 1IM3A 1RZKH 1JFQH 2VDKH 3GM0A 2NW3A 2BSEA 2B1HL 4NAQA 4PI0A 4NIDA 2PO6D 1RZIB 3SMHA 4GRLA 4D7SA 2NLRA 2RVAA 3LS4H 5B4NA 1D7BA 4O2FB 3RWJB 3I3MA 2R23A 3C12A 3S5QA 3ECWA 1RSFA 5C0RL 5IESL 2I32A 3QORB 8FABA 1UYPA 1LEGB 2GIYA 1MH5A 3V4VH 4F7MB 2BNQB 3KL5A 1Z9NA 1AXTL 4CYDA 1E2ZA 3MUJA 4FKEA 2J6EH 4W9GC 4FXKA 1U5XA 3QWRA 4WWKD 3UBXI 2RR12 4LF3B 1GGUA 2E53A 1ZVNA 4AYEC 5I2IA 2XZCH 2R0LH 3TBTA 1I3VA 3VFNA 4E41E 3VKFC 4Y9BA 5CADA 3V4VB 1A5FH 3LB6D 4H1LB 3OAYH 1KYOK 5FKPB 2AEWA 2RHPA 3CVDA 5PAZA 2OBGA 4FS0A 2IXQA 1AYN3 4Z0XA 2JDZA 1MNUL 1UM6H 3WG4A 1KDJA 4JFZH 4A2HA 4HAKA 2Y1YA 5F6IC 1CXKA 2ESVD 3T4YA 2EXIA 3BIWE 1PO13 1JPFA 3BN3B 2OMYA 1CE1H 2FO4B 4POZD 4UQDA 1A4AA 3OJ2C 5ANHA 2IJ0C 2EEDA 2EXWC 3T8VA 2YGMA 3U78A 3ZTNL 5L2JB 4EN9B 1UC6A 1JDCA 3M1BB 3AY4A 1VBB1 4N90D 1D6EB 4W9ZA 2FX7H 1S78D 1AG6A 1L9QA 3IKCB 3SBWC 1G9NH 2ARJB 2XX1A 3LKNA 1S8DA 2WXRA 3RGVA 4WI0B 5T1MB 2VXQA 3B2UD 1CFBA 3B2MA 3NABL 4JFHD 5G55A 2IV9A 4WVMA 1EJ8A 3EFDL 2VB5A 4E8DA 2CWMA 4YW5A 4O58H 1XNAA 4GO6B 3PQYB 2V9RA 1CIWA 4GRMA 1NBZA 4JQVA 3MSPA 3T4AB 2UWEF 4JHZA 1V0AA 2OZ6A 1KJ2L 2DQTH 1KGJA 1SMVA 2APVA 1X5LA 2VXRA 1H3VA 1ASPA 4FTVE 5C09E 5JOPD 4DKTA 3KZ8A 3SOBL 4A55A 4IOSA 3IDJB 3NZSA 1EV12 3WCSA 4PS4H 4HIPA 1IT9L 1O6SB 5ICXB 1OQXA 4YG3A 1DQQB 3O1UA 1QSZA 4JO4L 3L4TA 3UTSD 3ASOB 3IPVA 5JOEA 1JDDA 4YDIL 2RD0A 4XC1L 2GTWB 2AJVL 1N0LA 3QI9A 5E56A 3KXFD 3B5GA 4E9TA 5EDSA 4BE6A 3BVNB 2W52A 3NSYA 4QPIB 4G80A 2BHZA 5CFAA 3D39E 1OMIA 4PGBB 1QJY3 3JBG7 4DP8X 1V6MA 3U7YL 4AM0Q 4YG6A 3V0JA 2E9JA 4F7EB 4Q9RL 4RQPB 1OQEA 1EMTH 1RZ7L 1LK3L 4EN3B 5I1DA 1TJXA 4DN4L 4NO0B 4Y16D 1U8PA 3P69A 2WWKT 4J4PD 4DETA 3L8QA 4KUCF 3WIHA 1UW8A 2IWFA 5DDHB 4HHAB 1AP2A 1MHPH 3KPSE 4ACPA 3HR9A 3PUAA 3LS4L 3BWAA 3NAPA 4L3FA 1JZ8A 5EIYB 1MWAH 4ZI8A 5B3JF 1A6TA 2WHVA 4DK3A 1OPGL 3G5XA 1YNTB 4L3EA 3VRJB 1AHSA 2OX5B 2FDJA 4ZRGA 2ZF9A 3OZ9H 2WLNA 1L5GB 4YSUA 1WE5A 5AB0A 3QRLA 3WQ1A 4N2NA 1VRH2 1ZA4A 2XZAL 5BZDB 1MAJA 1UAIA 4RIRB 1G9ML 4P5TD 5HDOA 1BM7A 4Q1PA 2PCFB 4YFDB 5DRNA 5DMIL 3VFTA 4R2GD 2X5IC 2VM3A 4G7VH 5D1IA 4KXCA 3RG1C 1SMAA 1SOSA 2X42A 2AAVA 3CSFA 3U0PB 1MCBA 4F3FA 1H8TC 1IOAA 4N85A 4DQOL 2J7LA 2XV2A 2A6ZA 3D25A 4XIKA 5ACA3 3JTSA 1LB2A 3RLSA 3PNWB 5ENWB 1RUI1 4EO5A 4ODTH 2BW4A 4IIQB 3KBFA 4JGZA 1CT8B 2IUWA 4FFVD 4TNEA 1DGRN 2AREA 4I2XE 2YPVL 3GEFA 2ZP9A 3CSPA 4KUCD 3PUQA 3K80A 3TZVC 4LQRA 1I1YB 4ZDHB 4K6BA 4CC4A 3HZMB 4MA7L 3HE7B 2EKJA 5F7FA 3TESA 1LCLA 4RGNC 4KGJA 1Y6KR 1EO8H 4XVJH 1SACA 1RP9A 1RUAL 3QDGE 3N7MA 1DBJH 4WVZA 1P7KA 3DIFB 4X4XA 4KHXH 1PKQA 3CX2A 3HS0C 4M4RB 5EEYA 2R042 1YECL 5DC0A 2JIXA 2Y3NA 3ALPA 5GRVL 2V7NB 4C90A 4G6FD 2BVPB 1J87A 2ALWA 3OD3A 4JRLA 3I8TA 4BFBD 3KYOA 4N0CC 3FS9A 2HTKD 4ANWA 4K5NA 4HFUH 3LKRA 1KG0A 5IK3B 3RWIB 4F58L 4IOIB 2G0LA 5DRZA 2XGXA 3N1GC 3ZHDA 4ZNEE 5KWYC 2NY2C 3MRHB 3QJSB 2DF3A 3A67H 4OTXH 4PY7A 1NXMA 1KENH 4ZD3L 3TJEH 1OE3A 1OTSD 3CJIC 3V2AR 2IH9A 1VFAB 3OXRB 3CVCA 3V9FA 4OV5A 4LKXB 3WX5A 5FWEA 2YC0A 4BFNA 3F83A 3NJMA 4DIXA 3LRKA 4PJ9B 2NLJB 3POFA 3QBQA 5EO1B 1R3IL 5FUNA 3FTGB 3HUJB 1OAXL 4Y1UA 3GIZL 1UYWH 2QTWB 2Z4FA 3LQCA 4MNQD 4PY7B 1FZKB 1W0OA 1XF2A 2IOMA 1NLSA 3MRCB 3DGGB 3JYCA 3WELA 2LW3A 4R9BA 3QB7C 4L8CA 5IEHA 3H8OA 3CLWA 5EBMB 5FS5A 1JBCA 1NT0A 4HKZB 2LU3A 3DV6A 3WN5B 5FC9A 3BKCH 3VRLF 5I23A 2E7DA 2BVPA 2FRGP 2QSQA 3RIFK 4YVSA 5LVEA 4HOXA 1MRFL 4JQIH 1WA6X 5DVKA 4GRLC 5AOJA 1P7KB 4RRPA 1XAUA 3OY8B 1QJU2 5T33H 2SEBB 4W4OC 1G7MA 2MMXA 3UOAB 4QWNA 3KQRA 1DCSA 3LEGA 1I1YA 1JCKA 4ZDHA 1JUFA 3ROLA 4E4DX 2IQAA 5GGTA 3TIDB 5IFAL 2CBOA 2AJSH 4PM1A 3VA6A 4KROD 4Y3OA 1NKRA 4PTTB 1AH1A 1DGWA 1MCFA 2GT9A 2OMZB 5K93A 3D25B 3VDBA 3OJBA 2GY5A 2PETA 3CKHA 1PEWA 3CH1B 2HWF1 1FORL 1T04B 4NCDA 5FZDA 4BJ0A 3T0EC 2HLEB 5KSAA 2XJLA 1WHOA 3L7FA 1YUDA 4XBEH 2ADJB 2ZP0T 3IPBA 2DAVA 2BM3A 2YKLL 1WPCA 5DRNB 4JPIB 5IMOA 5MHSD 2EZ0C 1BQHG 1K45A 2DD8H 3MIGA 2Y7LA 1M4KA 2IFGA 4O61A 3B37A 5GGRY 1BV8A 2E0PA 4DVBB 4F2EA 2A83A 3SCGA 4KQ3L 3ZYJA 2TNFA 5ANNA 4ODXA 3SE4C 5M95B 1AVAA 3MC0A 1ULGA 1FAIH 2JI3A 3S8GB 2OX5A 3ATEA 3C6LC 4C83B 4A3XA 4KWLA 5FYUA 2R0ZH 4PS7A 2W2IA 2XBDA 4Z23A 2H3KA 1J0KA 4M93C 2WKGA 1HU8A 1NLDL 2WB1A 5DUPH 3LQAH 4ZFOB 4E2OA 5ADPH 4JANA 2BVBA 1AR62 3L3OC 5E03A 1JVKA 3ZE0E 4JG5A 2HJLB 1O9VA 2Q20A 1FOD3 2C4FU 5TDPB 2FMYA 1YEGH 1C08B 1Q9OA 4JM2C 4Y1AE 3TURA 1SDWA 1FSKC 3SYPA 4ELME 3AQDA 2OJ1A 2FWOB 4P23B 4ZUTB 3SPCA 2A6IB 1J8HE 4XPGL 3BU7A 3HT1A 1VEOA 3K0YA 2OKXA 5DJ6A 1TJGH 3T3PB 1BIHA 2DLIA 3U9PH 2X1QA 4MB4A 5IT2L 2KZ1B 1L7TL 1DSFH 1H6TA 2ZNWA 2OQJA 3BVNA 3FU5A 3HR5A 5T5FA 1GVIA 5C9KA 4NUGL 2YD4A 4M61A 3RY6A 2ROXA 2YKKA 3HNTL 4GKSA 4XVSH 3SQBB 4LEXH 3FLTA 3OB0K 2YAHA 4QRRE 4Y1YA 4GG8B 5CXPA 1R3IH 1ORSB 2K78A 4GMTH 4X8XA 1JGDB 4JQIA 4HCRH 2ZGOA 4HH9B 3SQOH 1BEV3 2B14A 4MGIE 1B0GB 1O7SA 2UX7A 4S10A 5I24A 3L2YA 3F7KA 3L1EA 1MCIA 4RAVB 4GRWF 4UBDC 4KTEL 4XAKE 1W2UA 1I8LA 2BVVA 4XVHA 3OAUH 4G7VL 1C7SA 4HSCX 3FTZA 3S88H 4HJGA 3OTFA 1AY1L 3NFPB 4KG8A 4GRMB 2YXFA 4WI4A 3VD7A 5CLWA 1IKFH 2APFA 1U4EA 4AIEA 1X5IA 4PJ7A 1MY7A 2ZYIA 1N1TA 1N1VA 3MV11 1P4IH 3ZUNC 3AFGA 1O75A 1EHKB 4NPYB 4WI0A 5T1MA 3F62A 2EUXA 1TQCB 1PMHX 2RG4A 4GUPA 2FB4H 1D6EA 5TK4A 3RWGB 2LM3A 5F5AA 1QWNA 3SEEA 2P46B 2HJIA 1KNOB 1VHPA 4FJYA 5EOQL 2VNCA 3J7MA 1G7IB 4G7RB 2CLVB 2D8KA 3BP5B 2EDYA 4R4ND 1EHLL 2EUVA 1QNWA 1HOCB 1IC1A 1JOIA 1TTCA 1VCAA 1RVFL 2C3HA 2PR4L 3CSYA 3G08B 3JV4A 5DWPA 4TRPL 5FCUH 3WFCL 4JB9H 1A3KA 5AW6B 1AXKA 2DVBA 4ANUA 4BZ2L 2HPOA 4YK4B 4XB3A 4LK6A 5F9JB 4GUQA 1YUHA 1IBDA 2B4CL 1ULOA 5L7OC 3NEEA 2YA2A 1ZS8B 4JS7A 1U91B 2X6VA 1BLIA 3E3QC 4LLMB 3QI9C 5J9PA 2YD2A 4I1PA 2XOTA 1ZANH 2XTJB 4WVVA 1DSYA 1OB1A 5A1LA 4EI5D 4Z92B 3IVKA 1QAWA 3WJLC 5C6PB 1SHWA 5EBLA 5CFCC 2X1OA 3VFUA 4BQCA 1J86A 4Y89A 5E6HA 5JO5B 2NW2A 3NFNB 1MH5B 3GK8L 1CDBA 1QXJA 1HB4A 2WXNA 2VAJA 3KWWA 3T6QC 2JTDA 1MS5A 2CALA 2X9YA 4UT9L 3O2VL 4G8GB 3RWJA 1OP5H 4H20L 1EEYA 2IOIA 4W9DC 2GYSA 2OMVA 4CA4A 1OD7A 5I26A 4RMBA 4M00A 3ARGD 1SN2A 2NW3B 5I1LA 2Y7MA 2GG1A 3PXLA 4MCZA 5EOTB 5HDQL 1D5RA 3H3ZA 2BP8B 2P43B 4ZQKB 3VFUB 4QB2A 4CCLA 5ALBL 2IWGB 3EGDB 4IRZL 1RULH 3BUIA 4P49A 4G1EA 4P4KA 5JW4M 1NEPA 3LDKA 5JPMA 3B9EA 1DQML 4KKAD 2F74B 2Y4SA 4DGYL 4OZIA 3CVHH 1ZS8A 3PIJA 1QUNB 5JMOC 1R3LA 4NQVB 4Z7UA 2NZ9C 1A4JB 3Q2VA 9CGTA 2VUAA 2HTLD 2VTFA 1DLHB 5L8KB 4K5LA 1PSKH 3L13A 4CPBD 3SDDC 5H37A 4XN1A 5HJBA 1T89A 1URIA 4GB33 1N3NA 4EXPX 1IAIM 1YA5A 3QULA 2R071 1G7IA 2CO4A 3MKKA 4JDTL 4XHBA 4AV0A 1NCNA 1NGYB 1SFHA 1U58A 4Y1SA 3MDJA 1KXTA 3LE0A 5H4YA 3D85B 4G1MB 4I1NB 5FCSH 1O91A 1JMXA 4CSZA 5DJ0A 3NVQA 2VDPH 4JY5L 3JUYA 4JO2L 2N7AA 3RIAK 3O6KH 1D6VH 5JMCA 2M8XA 5I8KL 3JWOL 4M43L 4XMZA 1W6OB 2DU0A 2XIDA 3F12A 3NIFE 2VJ0A 1NQDA 2DWEB 5C0ND 5DXWA 2WANA 3WJJC 1I7ZB 4IHBA 3QH3A 4LBQD 1CK0H 4A41A 4Q74A 4M3HA 4XOAA 3WD5L 2NZ9A 1K4DA 1EAJA 4GI9A 1JGVH 4RAVA 1J83A 1HKLL 1YNTF 4CKVX 2G1MA 4YW1A 3EUUA 3LKSA 1KBGH 4OY9A 5E8PA 1GZTA 2JELL 4FULA 3RWHA 3MBXH 2EYRA 4M8VA 4AYGA 4HIJA 2MH4A 1PG7X 1TKWB 4P3DA 1F15A 3HWJA 4PDWB 1QPPA 4HUWB 4EN7B 4OM0H 3V8CA 1GGYA 3TBYB 3ZPOA 2PWHA 3I3BA 5HPOA 3MICA 3ARBC 2J1ZA 3O6ML 4PJIB 5AB1A 2P5WA 1HHIA 2WSUA 5J0BA 4TQHA 3UROR 1K5JA 3QH7A 1A3QA 1YFWA 3AU1A 4I3SH 2R2BB 2ZPKH 3PXJA 1JPTL 2AXFB 4Y20B 2NUPA 2DWRA 4QX1A 3ES6A 5I1HH 2OJEA 1XB8A 3X29B 3RNQA 1FL5B 1XEUA 1S4IA 2A6IA 1O5PA 5IT6A 1J5CA 5F3HA 4JFED 1KN2H 5H4ZA 3VD2A 2DH2A 2EKSA 1BBJB 2VDOH 1DZ0A 4IEFB 2QTEA 2GMMA 3NVCA 5DHEA 4OSUL 4UBGA 4GSQA 4E0RB 3TYGL 3VBFA 5FHAL 3BW9A 5GLTA 2VE6B 4JRXB 1KPUB 1PBYA 4M8RA 3SKMA 3EKCA 1WFJA 1OARL 2J4WH 1W2KT 4R4BB 3RZCB 2BIHA 3C6SB 2XA3A 3UACA 3UO1L 3GJBA 3WW3A 3K5SA 4FFZL 5JPNA 3KJ6L 1OCCB 1OFSA 2QADC 1Q90A 3D3VA 4X7TA 4WHYG 4DKFL 2PPDA 4Q9QH 2XQYA 3W9AA 3ZLIA 2V0AA 3KCYA 1U36A 4OT1H 1Y6MR 5C0IB 3CFNA 1XEDA 1LAJA 1YJDH 3F7QA 3M8OH 2EDWA 3ZO0B 2P47B 2VQ4A 4JPIA 4DGYH 4XJ8A<