1OPOA

The structure of carnation mottle virus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
267
structure length
267
Chain Sequence
SMTMSKTELLSTVKGTTGVIPSFEDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQPLQWVVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title The atomic structure of Carnation Mottle Virus capsid protein
pubmed doi rcsb
molecule tags Virus
total genus 52
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
A PF08462 Carmo_coat_C Carmovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1opoA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opoA01
1AL23 2HWC3 1RUE2 2PLV1 1RUF1 1X36A 1PO11 1RUG1 2VQ0A 1VRH1 2XPJA 1RUJ3 2RR12 5A33B 5DDJ1 5J96B 4WM8B 1EV11 1GFF2 1R083 1FOD3 4WM8C 3VBUA 5FMOS 1ND3C 2R042 4N53B 5C9AB 2HWD3 4N53C 4CDWB 1VBB2 5C9AC 1R1A2 1MEC3 4Q4W3 5JZGC 1QQP1 2RMU1 4QPGC 2HWE2 3VBHA 3JBG1 1VBB3 1R1A3 4IV1B 1PO21 5BNNA 3ZFGB 3VBRA 4IV1C 2XBO3 3S6PA 3VBOA 4IV3A 5D8AA 5L7OA 1C8NA 1K5MB 4GB31 4JGYA 4NWWA 1K5MC 5C8CB 3NAPA 4QPIB 1V9U1 2WLPA 1AUYA 2RS31 4RR3B 5A32B 5C8CC 4RQPB 4GH4B 4QPIC 4Q4V1 1RUI2 1VBC3 4RR3C 1TME1 4RQPC 4GH4C 4RS5C 2BUKA 1RUF2 1AL21 3CJIB 2HWC1 1PO12 1RUG2 5ABJA 2BFUL 3CJIC 1E57A 5CFCC 5DDJ2 1RUJ1 4CEWA 4Y4YA 1R081 1FOD1 2RS13 2WZR2 3VBUB 2RMU2 2GH8A 2WZR3 3VBUC 1HXS2 1MEC1 4Q4W1 4FTBA 3JBG2 1PO22 1BBT3 1BMV2 3VBHB 1VBB1 1R1A1 2WWSA 5AC93 5ACA3 5BNNB 4FSJA 3VBRB 5K0UA 1RB8G 1RMU3 4IV3B 3VBOB 3VBRC 1OHFA 5D8AB 5L7OB 2IZWA 4CDXA 2RS32 3VBOC 4IV3C 4JGYB 4YVSC 5D8AC 5L7OC 5BNPA 2ZAHA 1QJY3 4Y5Z0 1CD3G 3NAPB 4WM7A 3VBFA 2RM23 1VBC1 5CFDA 1AL22 4BCUA 4PDWA 4NWVA 1TMF3 1AR73 1PGL2 5ABJB 4JGZA 1RUJ2 2DF7A 4RHV3 5ABJC 1BEV2 1R093 1WCDJ 3DPRA 1AR93 1R082 1FOD2 4CEWB 1VBD2 3VDDA 1BEV3 1IHMA 4AEDA 4CEWC 2WS93 2RS11 2RS53 1HX6A 2HWD2 2WFF2 3TN93 1NA1A 5FOJB 1VBD3 1MEC2 4Q4W2 1VBE3 2WZR1 3ZFFA 2WFF3 1Z7S2 1EAH2 4CDQA 1BBT1 4CDWC 3JB8A 5BNOA 1HXS1 3LOBA 5GKAC 1CJDA 2XBO2 4EJRA 1Z7S3 5FMOL 1EAH3 5AC91 2HWF3 5ACA1 1C8M3 1BMV1 1OOPA 2R072 1RMU1 3ZFGC 1PIV3 5K0UB 1AYN3 4CDXB 5K0UC 2R073 1QJY1 4Z92B 1VBC2 5BNPB 4CDXC 2RM21 4WM7B 1NCRB 3VBFB 5CFDB 4WM7C 5J98B 4PDWB 2R062 5CFDC 1ZBE3 2R063 4JGZB 1QJZA 1HRI3 4RHV1 1PGL1 1RHI3 4FTSA 1PVC3 1FMD3 1R091 1RUD3 3VBSA 1AR91 2RS12 1H8TA 1POV3 3DPRB 1ASJ2 1BEV1 4N43B 3VDDB 2WS91 2RS51 3DPRC 4AEDB 1COV3 3HAGA 1VBD1 4FTEA 1NA1B 1ASJ3 5C4WA 1D4M2 2HWD1 2WFF1 1NA1C 1BBT2 4GMP3 2X5IB 3ZFFB 1QJX3 5AC92 4CDQB 1D4M3 5ACA2 5BNOB 1Z7S1 1EAH1 4CDQC 2HWF1 1C8M1 1RMU2 2BPA2 3VBHC 5BNOC 1ND3A 1NCQA 1PGW2 2XBO1 1OOPB 1PIV1 5BNNC 4Q4Y2 1QJY2 1AYN1 5JZGA 1RVF2 2R071 4QPGA 2RM22 4Q4Y3 3J8F3 4YVWA 1RUC3 3FBMA 1ND2A 4JGYC 1FPN3 1RVF3 1NCRA 1TMF2 3NAPC 1AR72 4CDUA 3M8LA 4CEYA 1NG0A 1HRV2 2MEV3 4RHV2 2R061 1HRI1 1HRV3 1R092 1AR82 1RHI1 4GB33 2HWB2 1AR92 1VBA2 1FMD1 1NOVA 2WS92 1AR83 4RS5A 2RS52 1POV1 3TN92 2HWB3 3VBSB 1NY72 2QQPA 1VBA3 1H8TB 4N43A 3ZXAC 1VBE2 1COV1 1H8TC 1AYM3 4SBVA 1ASJ1 1RUH3 5C4WB 5CFCA 4GMP1 1QJU3 2X5IA 4Q4X2 5C4WC 1QJX1 1RUE3 2HWF2 1D4M1 1C8M2 2ZZQA 4Q4X3 1PIV2 1AYN2 1ND3B 1NCQB 2RR13 1VB2A 3JD72 1NCQC 3IDEA 1OPOA 1PGW1 2GSYA 1SMVA 5JZGB 3JD73 4QPGB 2Y26A 3J8F1 4Q4Y1 1RUC1 2R043 4YVWB 1FPN1 1RVF1 1ND2B 1B35A 5BNPC 4YVWC 1POV0 1ZBE2 2FZ2A 1ND2C 1NCRC 3VBFC 2HWE3 4CDUB 1TMF1 1AR71 2MEV1 4CEYB 1HRI2 1RHI2 4CDUC 4PDWC 3ZFEA 4YVSA 1PVC2 4CEYC 1FMD2 1ZBA2 1HRV1 1RUD2 4GMP0 4JGZC 1AR62 1ZBA3 2BFUS 1AR81 3JB4C 2HWB1 1MQTA 1COV2 1VBA1 1VAKA 4RS5B 1F8VA 1AR63 2PLV2 3TN91 1AYM1 1NY71 1RUI3 4N43C 1RUH1 3VDDC 4AEDC 1QJX2 1VBE1 2PLV3 1VB4A 1RUF3 1QJU1 5CFCB 1VRH2 1RUE1 1PO13 1RUG3 2X5IC 2FZ1A 3ZFFC 1VRH3 4Q4X1 5A33A 1EV12 1AL0G 5DDJ3 4WM8A 2RR11 1EV13 2ZTNA 3J8F2 4N53A 5C9AA 1RUC2 1OOPC 1QQP2 3JD71 1FPN2 4CDWA 2R041 5LK7B 1HQNA 1QQP3 2RMU3 1B35B 1HXS3 2TBVA 2MEV2 4IV1A 2BBVA 3JBG3 4LLFA 2HWE1 1B35C 1PO23 3ZFGA 1ZBE1 4GB32 1K5MA 4RFT0 3ZFEB 1A6CA 4YVSB 1F2NA 1V9U2 5C8CA 3ZFEC 1X33A 4Q4V2 1PVC1 4QPIA 1W39A 1ZBA1 5A32A 1RUD1 1V9U3 1TME2 4RR3A 4RQPA 4GH4A 2RS33 1M06G 1AYM2 1MQTB 4Q4V3 1AR61 1RUH2 2HWC2 1DDLA 1TME3 3VBSC 1MQTC 1RUI1 1QJU2 3CJIA
chains in the Genus database with same CATH superfamily
15C8L 3S7EA 3VKLA 3NCCB 1QWHA 3BAYA 3BIKA 5CWSB 5AG9A 4P9GA 1GJWA 4ZQKA 1CO1A 3MROB 3ML8A 3CBKB 4G7YH 1B0IA 2FWOB 4QKXB 5I1CH 3ULVE 1PHMA 3DA0A 5DJ6A 3BSZH 4WFED 5C7XL 5I1IH 4APXB 3TX4A 1N6QH 1C28A 2EYTB 2ZGPA 3SQBB 3WHE1 3P4OA 1NC2B 4TQEL 2VBDA 1BGXL 1U8QB 2VERA 2JCCA 3L3GA 3GSOB 3O3EB 4W9FC 3MUY1 4IQHA 3OKLB 4B29A 5J13B 5DGQA 3KB5A 3IU4L 3FFQA 1W2KT 2B8OT 5E8PB 2DTSA 2NYYC 1CE1H 4MA3B 3SYOA 3PFQA 3O2VL 3RA7L 3S35X 3WELA 2XB6C 5FY5A 3BKMH 3NMBA 2HT4D 5KVMC 1CPMA 2GMPA 5SX4H 1CIYA 3DVGB 4P57A 5CBAA 3LRLA 1PLAA 3ILEA 3V5DA 1O8SA 2GB2A 4BJ0A 4J3BA 4QPGC 3VBHA 1GYVA 1SXBA 2J1WA 4OJYA 4OUMA 3MREB 1PO21 2D7TL 2VR8A 4HF5L 5HHXH 1M4WA 4E5XG 1XF2A 3KT1A 4XOBA 1TNMA 1R24A 1K6QL 1A9BB 4NIKB 4YWGL 3S6PA 3EOYG 4NPLA 1UJ3C 3N1MC 3BH8A 4TLTA 3SY0A 4AG4H 3UNPA 3ITQA 2X1PA 3HRZB 3WJLA 2DQHL 3EH3B 5DD6B 3PV6A 4XP9L 5AVUB 3TNMA 3T8XB 2YGQA 1EGJA 2UV3A 3K3OA 4LEXH 2VQ1B 4I0AA 3G5XA 1SLBA 3ETBF 4QPIB 3ETQA 4EI6B 3ESPA 4JZOA 3A4UA 2WLQA 2BP0B 2WNKA 4OKVA 2RMNA 4M5ZH 3TM6A 2DUOA 4YNIA 4D8PA 3O8XB 1TME1 5F5CA 1O9ZA 3NJIA 1QLEB 4KDWA 4ZS3A 2BUKA 3J26N 4K9JA 3SY6A 5GXBB 1UQXA 3V4VB 1DQLL 3TBSA 4P0DA 1XXFC 2FZ3A 5IHZB 1JWUB 3G3LA 5E1GA 1W9TA 3LQAC 2XWJA 2NNXA 3QI9C 4BHPA 3UZVB 4PRIE 4ZMZA 1ZPUA 4PU2A 1W6MB 1E57A 3Q6GH 4KTYA 5DDJ2 1DVUA 1JMZA 2Y25A 2ZXQA 4U3SB 4WUUB 1OCRB 3VXPA 3ASIA 5CJ5A 4PTTB 3MRCA 2BFVL 5DJYA 3OKKB 2VTFA 3AUVA 3FO2A 1DZTA 3CN1A 5E6IC 3VA6A 3CFMA 4GKSB 1FOD1 5DUUA 2VZTA 1CAXA 1GSLA 3WG2A 1F11A 1M05B 1HOCA 2RJKA 2LV4A 1KYFA 2JKWA 1ULCA 1GS8A 2J5LC 2JKXA 4KKBD 1KPRA 4N1CA 1HXS2 4G9FE 4KGGA 4I2XB 4JRYA 5F7MC 3ARFB 2HN7A 1P1ZA 1RZFL 4Y33A 3KJ6H 1I7UB 1SJMA 3ELAT 3ARBA 3NVQA 4BE3A 4RA0A 12E8L 2NR6A 1BBT3 2LLNA 3NT0A 3ZE0E 3OGSA 1W9SA 1J12A 3K6NA 4W93A 5FO2A 4WU7A 1PZUB 3STZB 5EA0H 4PRPD 4H8PA 4H8VA 4D9LL 2UY6B 3NNFA 1JXNA 4P9IA 1UEYA 2GJ6A 2ITDA 1PVXA 1AACA 2YPVA 3HR5A 4ODWB 4OKDA 2KPNA 1EWHA 3B83A 1GZTA 1OHFA 3X1GA 2H32B 2NXZC 1SFDA 3A3YB 4P49A 4PBOA 4IE7A 2FO1A 1KIQB 4IV3C 1HJCA 1RUPH 4HK8A 4AI2A 4OT1H 1HH9A 3P30H 3TCXA 5D8AC 4AG4A 5JW4N 2AVFA 4MCMA 5FV2A 1XDTT 4ZXBB 1DQ4A 4UAOC 1KN4H 4LMQE 1P6AB 1G7IB 4N26A 3SEPA 4MNQE 2ODHA 1NBZA 5KSVA 3NNMA 4URAA 5JXJA 1TZ8A 1JPTL 1MS1A 4GFTB 1QDCA 5J1XA 1KGIA 2Z92A 3I9PA 2PTUA 4FFTA 2BZCA 5G5DB 4PDWA 3LMJL 2Y5TA 4U6YA 1KS4A 1LGNA 3KXFD 3OX8A 1BAFH 1NZRA 4QT5A 3I2FA 3CE1A 1X8EA 3FTGB 3BUIA 3EYOA 4KU8A 1TO5A 4HJGA 3EYFB 4PJ7A 1UA6H 4XC3H 4JGZA 3G6JB 3TRSB 2WV3A 3GKZA 1USQA 1N7MH 1PZ5A 3CMGA 3KLSA 3K8KA 2V72A 5IESH 1US3A 4PMEA 4RRPG 5D7IE 3FU0A 5JMRA 4OHWA 3TB0A 1NWPA 1UOLA 4NENB 1KGCE 2C5DA 2XN9A 3A67L 3F2ZA 4W9JC 2WA3A 1YMHA 2EZ0D 3STLB 5APAA 3QPXH 3IJ8A 1IHMA 3HE7B 4AQ1C 4Q6IB 3EYSL 4HIHB 4YHML 1HX6A 2HWD2 4P9YA 2ZPKH 4QUOA 5I1KL 4NAJA 4L5FH 2DQCH 4XABA 1WT5C 4TN7A 4YHKH 1HLCA 4TSAH 1MFEL 1MHEB 2WT2A 5TH2B 4KJQD 2WFF3 3VNYA 3LKSB 5CG9A 1XH2A 3MMEA 1EAPA 2Y7MA 1RPUA 5D7JD 3RTQC 3UC0H 3AROA 4K3DH 4DCQB 5HYJA 4XCAA 4KZEH 1Z3GL 3OJBA 3L2LA 4PJBA 5AC91 4RBPK 5AVPA 4XCEB 5FYVA 4C90A 4BM8A 3PWUA 4JO1L 2PTMA 3V6FA 1BMV1 1BP3B 1FG9C 3RL2B 4GINA 1OOPA 5KN5A 4YARA 2AJUL 2ZOEB 1J1OL 1JG9A 5L9DL 3BYWA 3UBFA 2BGOA 4IU2A 3TN0D 4JVPA 2YQBA 2YGPA 4MNGA 1GYAA 2HMID 2B4CC 1XH1A 4HPOH 5BO0D 3L08A 2K2SA 1LMIA 4UT6L 4YW3A 3L7FB 1N1TA 5CFHA 1E4XH 1YEHH 2W81C 4KXDA 1HWWA 2VC2L 5F8QC 1N18A 1CAUA 3F7YA 2BDNH 2C9QA 2CD0A 4C55A 1TT6A 4LDCA 2EP6A 4OSUH 4RLDA 2JD4A 3IDBB 3E6BA 2A5ZA 2D6PA 1PEZA 4WEBH 3RLSA 4TVPD 3KSCA 5SWZD 1TMCB 3P9WB 3AP4A 1J10A 1E43A 3F62A 4EN7B 3GHEH 2F54B 2X2JA 3BEWB 4ZFFA 2R2BB 3JCIA 4H3WA 5FK9A 4OUUA 3W37A 3SCMD 4OCXL 4YBLC 3Q0HA 4Y4KD 4Z0BL 2ET1A 4A63A 2OZJA 4LKXA 3AFKA 2VDRH 2R32A 3AWEA 5IOPA 4I0WB 1WWBX 4FXTA 1J5OH 4ATEA 4DGVL 1PVC3 3DYMA 1NMBL 2PCYA 2EYRB 3B01A 4X42A 3ZDXE 4FLQA 2YXMA 2NW2A 3UBGA 1N64L 3OC8A 3QDMA 4HBCH 1MIEL 1NIFA 1FO0A 2JDZA 2EAEA 4NQSB 4A6YL 4HOZA 5LXGL 1ASJ2 4PW9A 3VFSA 4W9HC 3WS3A 3QC6X 5DVOA 4LBMA 1GPOH 5D2NB 1OAYH 3UL4A 2QHRL 4NPYB 5C07B 4I0PB 2NXYC 5CEZH 2A0LD 3MGAA 1UACL 4MRCA 4PJIA 5CFAA 4Q0SA 3U48A 3SCHA 4FJ6A 3U78A 5HGGS 3L1OH 5M95B 4U0RC 1E5BA 1I7RB 4S1SH 3D0VB 1CLCA 3ATEA 1QSEA 3SGEH 5DTFA 2HWF1 2HAZA 1WBZA 5D1QD 4F33B 1C8M1 3KG5A 2VULA 3AMKA 5D6DC 4MXVE 3M88A 3VYOA 2XBO1 3IWZA 2CUHA 3KJ4B 4MZ2A 2OTPA 4HS3A 1Y7BA 2IXHA 2FWSA 5F3BA 5DG2A 5F37A 3LEYH 2NDFA 3DOSB 3RZLA 1JPFB 3IF1B 5EU6A 4I77L 5HHNA 3W0WB 1CFVH 2CUAA 2ORBH 3N9GH 2XOMA 5JZGA 1R5VA 5B39A 3AZZA 5FUZH 4ABVA 4GB9A 2XWTB 4UM8A 2WA4A 1GS7A 5E6ZA 4GUOA 1WD3A 3VI4B 3FBMA 1U6AH 2Z4QB 4QHMB 2JF1A 3FUFA 1F4WL 1T04B 4K3HA 1KTJA 1HQ4B 4BFKA 4CDUA 2HUEA 2CHXA 1WTGT 3LEXA 4MKMA 4L3FA 3U36B 2GSMB 1KJ2B 2W1QA 4HPYL 4DETA 3ILRA 5AVSB 3PY9A 2O6CA 5ILTL 1LRHA 1IGFH 2H7WA 5FGSA 4ONHB 1AR1D 2J88L 3QC5X 4GW1B 1CD8A 1UXMA 2VJ0A 5DFTA 2HUHA 4P5TC 3LQCA 1REIA 2A6DA 1ZGLP 3H8UA 2OUHA 4OULA 3BCFA 2EIEA 2PYEE 2YIHA 1JWSB 1UENA 3WP4A 4Q2ZA 2VE6B 1B90A 1MI5D 2WTRB 2XXFA 4NDMB 5L8KB 2C24A 1YQVL 2Q6WA 4PRHE 4B7IA 2C9XA 1BMZA 1Q0YL 3L54A 3R1GL 4Y4HA 5SV3A 4EN3A 3CSFA 2ED8A 4J7RA 3T0EC 2IFWA 3TCLB 2ATFA 4AITA 2AEZA 2X2UA 1L9NA 5CFCA 1XGPB 3I75A 4HWUA 5IJKC 5FY0A 4R9DA 1HX0A 2DQGH 3KLKA 1R64A 4J3OH 4TOYH 4R4BB 5KYYB 2F4LA 1PNFA 2GH2A 1XNAA 3NV4A 1GH7A 4UBHA 2VLKE 1T6BX 4PJDB 4PJEA 4U1NB 1D5ZA 3L6FB 5CP7A 1WLCA 4C91A 5C3PA 5IHLB 3GPEA 2B1OA 2YBKA 1JRHL 4OIAA 4Z7UA 3Q06A 1PK6A 4BQ9A 1O4ZA 1FL5A 3UTQA 1A7OH 1OC1A 1DDTA 5KOMC 1PNCA 4IE6A 3JWNG 3KLDA 1B4TA 2WW8A 3SGDI 2ZOTA 1JTZX 4H0LC 5AZEL 4AEEA 4F2MB 3MLTA 2JKNA 3JWNC 1KCSH 1MJ8L 2Q8DA 4CRPA 4L8DA 1HINL 4EUPA 5A7EA 2JNZA 5J9PA 3QS2A 4X8JA 3KH4A 3CIHA 4WIQA 1QSFD 3EF4A 4WV1B 4DO0A 2BERA 4KUZL 1HB1A 1T83C 2EXYD 5TE4L 1GTFA 2QR0B 4PF5A 1SF3A 3OZLA 2QVKA 4GFXA 2E86A 2DURA 3LDKA 4YGEA 4XP6L 3I9GH 4HAFA 1BZ7B 5KSAB 4FNRA 2DEXX 4CEYB 1E4KA 1CAWA 2VZRA 4YDMA 2MCG1 4C4KT 1JZHA 3OKEB 4JPIB 3I2JA 4C1XA 3FT9A 4NKIH 3IDUA 4R5TA 1JYCA 5IHUL 2FJUB 2GITA 3AAZA 4GMP0 2AKRB 4JE4B 4KK5C 3DEMA 1D6EA 2FUTA 3B2VL 2ATKA 3U7WH 1UXSB 4LLQA 1A6PA 3QGVA 3PLQA 2PCPB 4ZS6C 4WO4C 4MOAA 4RS5B 2ZOUA 1NUKA 2JFCA 4MDIA 3SKMA 2R1BA 1C12A 5DA0B 1BVNT 1W72A 4LSTH 3ZKMD 1GGCH 1YEGL 2CQVA 4CBZA 3GEFA 2ZJCA 4NRMA 5A7PA 4HUUB 2JD9A 3LF7A 5CWSA 4AVIA 1JZ5A 1N68A 3LPOA 3MROA 4DW2L 2BHFA 4EZLA 4BQYA 3PU8A 1W9WA 2FWOA 1L0XA 4RH4A 4CCNA 1JD9A 5AB1A 1UMHA 1WA0X 4FKEA 3IJEB 4APXA 2EYTA 1F3DH 3SQBA 1NC2A 1QJEA 4MCYB 2ZAAA 1U8QA 3GMMB 3VI3E 1AJ7H 5H9PA 1SXNA 1SFPA 2KI6A 3GSOA 1AD9B 3O3EA 1AKPA 5E1RA 3OKLA 3IPFA 2ZE0A 4UTAL 3ALQA 1XQ4A 1TITA 1X8MA 2D97A 2W9DH 3VG9B 1MFAL 1TEIA 5E8PA 4DWHA 2WNVB 2OYMA 2J71A 3ETTA 3ASWA 4MA3A 1QTYT 3ARPA 5K93A 1QFHA 4NZRH 2YRBA 2OJZL 3ME0B 3R4SA 2J44A 3DVGA 3ULVH 4PWJA 2B2XH 1S78D 4KVNH 4AE0A 5BQ7B 3D3VB 4MMZB 2R69H 4YN3A 2L9LA 2HVKB 4XQWA 3MREA 1RSFA 4WVRA 1O5PA 2X42A 3EXUA 3M1HA 1NPUA 4KZ0A 4AYFB 1A9BA 1ID2A 3MLVL 3QNZB 4GRWE 1CZTA 3U9UB 4LLWB 2ENYA 1L3NA 4MCZB 4TNWK 4EDWH 3HRZA 4ODVH 3MPBA 5DD6A 3IRZA 3WY2A 2AC0A 5DWUL 5B3JF 2ORZA 2KLRA 1L0QA 2VQ1A 4F7EB 4H13C 3ZN4A 1LILA 4QPIA 2ZIDA 4EI6A 4LCWD 3P3RA 3GBDA 1DZBA 2JMRA 4X8CA 3TZVC 3FJSA 4NHYA 1DYPA 1UFGA 2BP0A 4EF3A 2EDKA 3II2A 1E2ZA 1ZJAA 4NWTL 5GRVL 3GSWB 2YLHA 3O8XA 3PREA 3INAA 5D7SH 3O2DA 3TS8A 1DLCA 3RVHA 3NH7H 3I02B 3D3AA 3QUMB 4NUGH 3V4VA 5IVZB 2DF3A 4YE4L 5I73C 3T2NH 1QATA 3D50A 1SVZA 5E2WL 5IHZA 1JWUA 5I5RA 4WCYH 2QQJA 3WJMB 2F17A 4PCYA 4KK8D 3UZVA 1IM3D 1W6MA 3ABZA 3UDWC 1UMZA 4WUUA 4U3SA 4C57C 2VNVA 5IYYA 4F9PA 4M7LL 4PTTA 4ELMB 2ZXAA 1H6EA 4JG0L 5LG1A 3IRPX 5GRUH 2G3XA 3OKKA 4FFZH 5DDJ1 1NGPH 4N0YL 1DQVA 4GKSA 3FN9A 4JM2B 2ED7A 3BKJH 1M05A 3PP3H 4OY9A 5HYQB 5FMOS 2JE7A 1LO3H 2JQAA 4JFFE 1KFGA 5A2FA 3LX9A 1BJMA 4Y5YC 4HUCA 3MNVB 4I2XA 2HJIA 5C9AC 2BIMA 1I7UA 1SJXA 1VFMA 4YK4B 1E42A 1SHXA 4NNXB 4R4FL 3O7OA 1TTRA 3OOXA 5FPLA 3BX7C 1W2NA 3PTYA 1TZGL 1OWRM 4I18C 4GSDL 4ZX4A 2E7MA 2K6ZA 1AKJD 3FQYA 5EJ1B 3CVHL 3STZA 4XVTL 5B8CB 1IQAA 2UY6A 3RGVC 1RK1B 1A5FL 2FJFB 2BGCA 4E5XB 5FZ8A 2NY6D 4ODWA 4CNIB 2BGPA 2EIBA 2VDKL 3R4RA 2YARA 4KNSA 1VHPA 4KXZH 3MZTA 3ZKNC 3PVEA 1VACB 2MNJB 2JX9A 3ZDZF 2H32A 5LBGA 4DN3H 1PLBA 5FFGA 4CCDA 5ACMA 2QVTA 1KIQA 2C9UA 5DEGB 2N1TE 1JGDB 4A44A 2CR0A 1KCVH 4QPEA 3QK0A 5HDLA 3TIEB 3B2PA 4ZXBA 4OLWL 5IVOA 2WLPA 2WXQA 1G7IA 4FXLA 5IBUG 1J1PL 2NY5L 2C9VA 5DCCA 1KDJA 5HPMB 3MEPA 2VN6A 1VBC3 4JZRA 4F83A 4NO4A 3ECUA 5G5DA 3E5UA 5BV7L 1K4CB 2YUXA 3MLXL 4L4TD 3MO4A 1OALA 3ZTCC 4AWDA 1Q1JL 3TEZA 1WUNT 4NZFA 5T3ZL 3FTGA 3X17A 1S0GA 3QI9B 2ZGLA 5CLZA 5C6WH 3C12A 5BW7A 2E7TA 2FX9H 3V65A 3EYFA 5DMJB 5FK8A 1MAJA 3G6JA 5E08L 2VR6A 1X7QB 4Y9EA 2DEWX 3IFLH 1Z5YD 1RXFA 3PL0A 1HKFA 2CHDA 2VSDA 3HOBA 5FTTC 3UYRH 4OZHB 2ZGQA 3FQNB 3NIDB 2SLIA 2XJPA 4NENA 2R27A 1EAQA 4PCRA 3V64A 5EXOA 3AP6A 1NCTA 1JZ7A 3STLA 5E6IB 4FERA 4M1GH 5AALA 5GGTA 3HE7A 2Y6TE 3HG1D 4Q6IA 4HIHA 4FLHA 2E33A 1F18A 5FMDA 1O9WA 4M7JH 2WSUA 1CVSC 1Y43B 2RS13 5FV3A 5IVXF 2J5LB 3QIUC 1QNYA 2ARJB 1TJGL 1PY0A 1MHEA 5T5LA 4F8QA 2BY0A 2DQ6A 3KHQA 1KY6A 1N6VA 4ZZ8A 4IBVA 2NCEA 4W68A 4DCQA 1DQ0A 1ANUA 3BYYA 3CSGA 2A6XA 3FFCD 1CN4A 2VW7A 4O00A 2E7LC 5JO5B 2EVXA 4XNYH 4KKAC 4RRPM 4EKJA 2F53B 4QRPB 1R1A1 3UX9B 4XCEA 4UBDC 2CM6A 3PQYD 2DLIA 2W9EL 1MY5A 3EJPA 1HC1A 5C08D 1TFPA 5TQ2H 4DUXA 1X9TA 4JG1L 5IZ7A 3RL2A 2J22A 2NXZB 4EN6B 2I60H 3FH5A 1V7ML 3OPZL 3KPOB 4IV3B 2YXWA 4X7DC 5D8AB 4YHOH 1G1OA 3VGGA 5E2VH 1FSKC 5FA3B 1PF3A 3L7FA 4K73A 5SWQB 2R9HC 1KELL 4UAOB 5DD5H 4JPKH 3O6KL 3DTXB 4JFQB 4Y5Z0 2VR3A 3VGDA 3QIBC 1HHIB 3SE4A 2RA1A 4UQDA 5HDQH 3W39B 2EVFA 3CZFB 3QORD 4HH8A 5A3LA 1DSYA 1KEMH 2MQ3A 3ASOB 3GMQB 2PHXA 4LASH 1ZS8B 5LBBA 1F41A 4ZONA 2NYKA 5TE7L 4HEPG 1GIGL 5DUVA 4X6QB 4LKCB 1E4WL 2F54A 3BEWA 1WFJA 5IHWA 2R2BA 5LGHL 1S0EA 3KHCA 4Y22B 4N5UA 2NCMA 3FCTB 1SN2A 1KYUA 4Y1SA 3F58L 3I2IA 4XQDA 5EZIH 5A6LA 4NI3A 4E9WA 2PYTA 4AHZA 2HKFL 2QJDA 2EYRA 1JIBA 4M48H 4L4VD 1JHJA 1G7YA 1HL4A 4OF3A 4AQ1B 2PW1B 2VO8A 4NQSA 2D40A 2H8PB 2XHKA 2GC4C 3WS6A 3MV7E 3UYPB 3G08B 2IEPA 4D8OA 5AW2B 4DIXA 2ZWLT 3WY1A 5D2NA 2Q3XA 3NV3A 4NPYA 2VLJE 4R2GB 5C07A 1U36A 1O91A 3ZM8A 1QBBA 3HTLX 4XN2A 1FZJB 4ONGH 3VD0A 5C7XH 4ASLA 4PLOB 4TULH 1U2CA 1XD0A 3HE6C 2QCSB 1I7RA 1OAQH 2JDUA 1WH0A 2Q1FA 1FORH 3GMNB 1HE7A 2QPSA 3D0VA 5C0CD 3N9MA 3RZZA 2D03H 4QDGA 4UQ2B 3VQMA 3CIQA 1OANA 1ZA4A 4F33A 1C08B 2YAFA 1L7LA 3ZYHA 1VKXA 1GYCA 1OXCA 5TGBA 3LKPB 1INDL 1DQTA 4XPTL 3RA7H 3DOSA 1JPFA 1N10A 3IF1A 3GC3A 3W0WA 2K9FB 4IOIB 2V9TA 4K23L 4MAUH 4QTIH 4UT9H 5FW8A 3RX8A 3QULB 4OFYD 4TRPH 5L4IA 4E9XA 1ULFA 2VDLB 1I85A 1FCCA 3GQFA 2XWTA 2X28A 1CLYL 1I1FB 1Y18B 3VI4A 3AJYA 2Z4QA 4QHMA 4L1SA 5IVNA 1UU4A 3QHZL 3LRMA 4RISH 4LNVA 5DAQA 2CMRH 1ULOA 1T04A 3D34A 1NCRB 3FCGA 1D7CA 2CBTA 4KH2A 1HQ4A 2AI0L 4PJ8C 1K6QH 1RZPA 3U36A 1KJ2A 4YBLB 4DK5A 5EEXA 4OD3L 4Y19B 4A55A 1WUZA 3GWJA 3MDPA 1TVGA 2O30A 1KC5H 2ZUQB 1OGSA 2RTTA 3ZHLA 2OMYB 4J25A 4FNQA 1FE8L 2XKUA 4ONHA 1HZHH 1YFWA 4GW1A 3H9AA 4XFGA 3RX5A 3T3PF 4PJ5B 4FTSA 3CQOA 5SWSD 1HOEA 1JWSA 2R0WH 2VE6A 2X9WA 2WTRA 4NDMA 3CVBA 4PQXA 4YSAA 4IEFB 2ZOWA 3QWRA 4MB3A 1ORSB 4HEME 1KJMB 2ZHNA 3TCLA 3GZTB 2KZWA 1TTAA 1XBDA 1CIUA 3NW4A 4X8NA 2E31A 2ZGUA 3BJLA 2X6UA 1XGPA 2RJMA 4GP4B 3ULUE 2QQKA 5IUSA 5HV0A 1D4M2 3RNSA 3F6JA 1LQBC 5D2LE 3FYEB 1FYTE 3TH2T 3UCQA 4YEFA 4U0RB 5KYYA 3DXAD 4R4BA 2ERJC 3VD2A 3HI6L 1BJQA 2WZAA 4MJ2A 5MERB 3MXVH 4PJDA 4U1NA 3L6FA 1R46A 2BFVH 4ZZFA 5JDSB 4UT7L 1SBSL 4MWFB 4K2UH 4YFLI 4CDQC 4UW5A 3D69A 4P2QD 4JY4B 1QA9B 4XUOA 4C1WA 1OB1B 1LOFA 3NMEA 2LVEA 2G5RA 3NJMA 5A2CA 1NCAH 4F2MA 2FWLB 5FUIA 5JXEC 4MS8C 1O9VA 1QJY2 2A3WA 1B6DA 5AVVB 1UZVA 5GHWH 3TO4D 4PQQA 1BCIA 1N2RB 2NZIA 4W6XB 4WV1A 4AJ0A 3NJLA 2Z42A 1BQSA 2CK0L 3QDGE 1J5HA 4XXPA 4LPLA 1FPN3 2QR0A 3SD5A 1DQ1A 4N85A 2KS0A 4M3KB 4Q1PA 4PPTA 2YK1L 5JOFB 1BZ7A 3ARWA 3ETBJ 2DVGA 3ZL2A 5KSAA 4JS7A 1VMHA 3JZVA 1G9HA 2DQMA 4BK5C 1HRV2 4CEYA 1RULH 3LS5H 5IJRA 3QG7H 4PG2C 1XYNA 3OKEA 4JPIA 5IUQA 4P5TB 4I3PA 3D08A 1EPFA 4CMHB 1CLOH 2AKRA 3T4AC 4XB8A 5DRZB 5BV7C 1AR92 5DUPL 3MX0B 4F7KA 1KRIA 1UXSA 2QQMA 1OCWH 2PCPA 1AE6L 4I87A 4RS5A 1HL8A 4ZTPL 1KEXA 4MQXD 1VBA3 5B7MA 1DJWA 1AXTL 5ELIA 4D0DB 2J7MA 3ENRA 4KK6C 4UOZA 4L2NA 3NL1A 2DLFL 3R8BB 4HUUA 3BLPX 4KMQA 4Y5VC 3V9FA 4IBUA 3FN3A 4S0SD 1RUH3 3T5WA 3N40F 4ZD3L 2AGSA 2DVAA 3FT0A 5A7BA 5C7GA 1W6QB 1QJU3 2YJLA 2D73A 2FJSA 3GXFA 3IJEA 4KKNA 4PJFE 2DQTH 1R6VA 1WCBB 4MCYA 3GMMA 5BNQA 43C9B 1OUXA 2F58H 1QMUA 1AD9A 2BSBA 2D9QB 1HWHB 1GNYA 2Y60A 3POFA 3GSRB 5F1KC 2XQYA 1TYEB 2X10A 3WHXB 2WNVA 4LU5L 5CCJA 2XQXA 1L9RA 4FVVA 4N1EA 2W46A 4KO6A 4DN4L 2QGBA 1UXXX 5FS5A 4O5LL 2E9JA 3ME0A 4ESKA 4RGND 3JD73 2Y26A 1F2QA 5BQ7A 1YC7A 1I9EA 4J1UB 3AJZA 3D3VA 4X6CE 4MMZA 5D8JL 1RUAH 5BOPA 1RVF1 4GW5B 5HDRA 2HVKA 1WLTA 2KXLA 4CZSA 3VB9A 2VCBA 5CGMA 4CDXC 1S9XB 3APNA 3FSOA 1PZDA 4LXFA 4Z95L 4FPCA 3P0GB 4F7MB 4Q9BA 1P7BA 3T30A 5EN3A 1OGAB 1GR7A 4AYFA 4OHYA 3QNZA 1AR71 3U9UA 4LLWA 4MCZA 2QL1A 4TSBL 3BUYB 2CJUH 1NGYB 4KXCA 4P4KB 1CGXA 5HP5A 1ZBA2 1MVYA 1OD5A 1SFYA 2DVDA 4HCRL 2OW7A 4F7EA 5KVGL 3F95A 1AF9A 1BVP1 4WWOA 3LKQB 5EDXA 3INOA 3AW5A 4Q89A 4WO4B 3SJVB 2J1EA 2CA4A 4A41A 4H0HB 3EG9B 3GSWA 2JCCF 2W0PA 3AWFA 3OL2A 3QQ4B 3U79A 3UG3A 1COV2 5GZFA 5F8RC 3I02A 1DSFL 1P6FA 2AK4E 3QUMA 5MHSE 1UOFA 1WMFA 2PLV2 4WJG3 4LK7A 3BWSA 4IMLB 2Y2TA 4XVHA 5IG7B 1KCUL 4XCBA 4PN6A 1T7VA 5B7EA 3WJMA 4LHLA 4LIUA 2M1KA 4BQBA 4YHLL 1EDHA 1MW3A 1J9TA 4FNSA 3RU8L 2QTEA 4F8LA 3US1A 4FDWA 1IAIL 4LSVH 4FP2A 2VZVA 4ELMA 1DLLA 1VRBA 5JXHA 3CK0L 1OE1A 5IFAL 4JHTA 4I09A 3OEAA 4OM0L 1AL0G 3T2OA 4HWZB 4HIJB 1INQB 3RVUD 3WEMA 2WKLA 2NYYA 3W82A 3ZOIA 1KV7A 2VW4A 4JM2A 1A3LH 2XTJB 4HZ1A 4OZIE 4QPWA 4X4ME 4UOW1 3QUZB 2QHRH 4YBQC 5HYQA 1LP9E 2DBLL 2DH3A 1RUC2 1WAAA 2DRUA 3MNVA 3PP4H 2BNQD 3H3ZA 1F00I 4YR6B 1G9FA 3ZN5A 3D2UD 4NNXA 5EZOH 2DYRB 5DMGD 5I19L 5I30H 2EH7H 1KCRL 1MCRA 3D1MC 3HMWL 3L9BA 5E5MB 2MEV2 5JPMC 4N20A 4JN1L 5B8CA 5CYYA 4OCWH 3WTWA 1AGCA 1Z1WA 1RK1A 2FJFA 2MQ0A 2VC2B 4LIQE 4GMSH 4D9QE 4E5XA 4K5OA 1PO23 3OUHA 2BWCA 4YDVB 4CNIA 2KZBA 2VQTA 3VZMA 3COOA 3IFNH 2YRZA 2Q1MA 3LPWA 3HZVB 1VACA 1KXGA 3HHRB 4KX7A 1A34A 2JG8B 4LEOB 5CGYC 2F9BT 3LSDA 5DEGA 2W1SA 1JGDA 3U4BL 3LA7A 3TZVB 3TT3H 3BDYH 4OD1H 3TIEA 2BNRB 4L9DA 3GI9H 1NX9A 2JLLA 4IDJL 2J4WL 1XMEB 2W95A 3CSTA 3KCPB 4LHUG 3MLSL 3TTYA 1G9MH 2ARJQ 2BXZA 2WAHA 1K4CA 4FZ8H 5DURD 2JKIS 3VGAC 4BGLA 1TME3 1JZDC 4UM9D 4JDVA 1MRCL 3SBRA 2BWDA 2DMCA 3WIIL 2ET7A 2VIRB 4FZEL 2FX8L 3QI9A 1DGRN 2DCKA 4LLOA 3HA0A 5FV1L 3B94A 3OAWA 2X6BA 4F2FA 2IPTH 4A6YB 3Q8CA 1BVVA 1RUE2 1P5UB 3QRGH 1X7QA 2I74A 1X36A 3EOTL 2DQDH 1J86A 3X1EA 2DBIA 4XFCA 5T5JA 4PIZA 1YPZB 4OZHA 3FQNA 5CN1A 1B0GB 1AQMA 2Z7UA 4RIRB 2Z91B 3FN0L 4IKLA 4LOTA 1TJXA 1JK8B 5E9DE 1YYML 3L9YA 5E6IA 3P3PA 4KWJA 1QBLL 5FDYA 5AB9A 2EXTA 3CH1B 3SYAA 4YVUA 4D0CB 4FBFA 4H20L 1E50A 2VPVA 1AO7E 1RP9A 1FOD3 2ARJA 2IALB 2L04A 2UZIH 3IM1A 4S1RL 4Y5YB 2MHFA 3ZYGA 3A6CH 2R042 5C9AB 3M45A 1CLZL 1LO2L 5D1ZC 1FFNB 1TZHB 3AGWA 1WA4A 2IPUK 3MLZL 4IKIA 2VZQA 5A7SA 4NAQA 3UP6A 3IDAA 2DJMA 2BPBA 4ZNEE 3IS1X 5JO5A 4K5MA 4F57L 5BVJB 1VJ2A 2F53A 4QRPA 3RGVB 4P2RB 2FLMA 2D3NA 5AZ2L 4G8EB 5FZ9A 9CGTA 5F96L 4X4KA 1S0IA 3GJFK 2YGVA 3WFZA 5AZEH 3P1VA 3ES1A 1C1LA 3WKQA 4IV3A 3KPOA 3KPPB 1HJBC 1SBDA 5D8AA 1C8NA 5FA3A 4PJ7F 1MZ6A 5SWQA 5IFHL 3W56A 4TLFA 3ZN6B 3DTXA 4JFQA 3WV0A 3KVDD 3FHAA 1HHIA 3QXDB 2P52A 3W39A 5AW4B 2VZ3A 3CZFA 4DXRA 1MREL 1ZMYA 3FFDB 4HIXL 5IBUB 3GMQA 5H9RA 1ZS8A 4FCHA 4HXCA 3SDDD 3FFOA 2JDHA 3HQUA 5LEKA 4LKCA 2QDNA 2VABB 3V0WL 3A22A 4Y22A 2KZ1B 3FCTA 1CYGA 2FBJH 1V55B 3GXNA 5FP8A 3BD4A 4BCZA 3PJLA 4QX3A 1LNSA 4GXUM 4K7PY 3M6DA 2BVOB 3KDPB 3MYZA 5HYIA 2LROA 1GANA 3DBSA 4HSCX 4QRRD 5LAPA 5F7DB 3ERXA 4DF9A 2YBSA 4Z7QB 5FYKL 4RRPA 4AEHL 2OCCB 1O3TA 4YW4A 4HU8A 4AQ1A 1NLDH 2L3BA 2PW1A 1IO4C 3QO0B 2H8PA 3KYAA 4PJBF 3UYPA 3G08A 3QIUB 4Q56A 4CSPA 3TV8A 3L1EA 1IE5A 1GNHA 1N5YH 2GHZA 4RSYA 2VZ1A 1JXDA 1X5AA 4XGZA 1BECA 4Z23A 3U1SH 4QRBA 4DKFL 1FZJA 4YDKL 3WIHL 3GXDA 4HIEB 5CCHE 1P4BL 3MUZ1 2RMU2 3D0LB 4PLOA 1S7XB 4IRJD 3JBG2 3FU7B 4L1DA 5D55A 2CPCA 3GMNA 3RWDB 5CD3B 1WD4A 3TASA 5KS9E 4S2HA 1S6NA 3Q1SH 4UQ2A 1C08A 2IVFC 1H4HA 5BZWB 2YOCA 4XO4A 5AC93 5JOXA 3H1ZA 1MFAH 3LKPA 1RZKH 4GP8B 5I0YA 1HV0A 3OUIA 5T52A 1E30A 2E46A 4H8WH 4UTBA 3RZHA 1WG3A 3DIFA 5IB3B 1RB8G 5CF3A 4IOIA 2FK9A 1ZD6A 3QULA 2VDMH 4NUQA 5IB2B 4EO5A 2YD0A 3C2SA 4OI4A 3D85D 4XURA 3VBOC 3W9EB 1DQ2A 4JFEE 1I1FA 1Y18A 2M26A 4LB8A 4S1DD 2Y8KA 5KJ4A 3VSUA 1MNNA 2IC1A 4LA2A 1H9VA 2AK1H 3OZ9L 3SHRA 1A22B 3QEQB 5FCSH 4LE4A 1X5LA 1WISA 2EIZB 3JVGC 3GZKA 3D52A 5LQBL 1FFOB 3N42B 2WQAA 1OI6A 1G5GA 5MEND 1T2JA 2EC8A 4Y19A 4YZFF 3O6FC 4NWVA 1GNZA 2OMYA 3MOAL 4AL8H 2O5ZH 3RQ3A 3UJIL 2YWYA 4META 4ODSH 2R4RH 4PJ5A 1OA3A 2EDJA 4JO4L 4PJIF 1Z5LB 3FAXA 1JNLH 2OIIA 4NXSA 4LBQB 3CDCA 3E9UA 4IOSD 4IEFA 4LSSL 1WIOA 2LU7A 4NN0A 3OD0A 3RZCC 3GSNL 1FDLL 1ORSA 5DPNA 5K7PA 5IK3B 1ZLVH 3BP7B 1CDUA 2MCPL 4HC1H 1HIMH 2OSWA 4XTRC 2LVCA 1KJMA 2F6AA 4ENEC 3T6QC 4LBKA 4JPVL 2WBJD 3ELNA 3FLPA 4GKOA 3I2KA 4UI9L 4KI5D 2AXWA 2W87A 1AXYA 4ZQTA 3HE6B 1HKLH 1VBE3 3VTMA 2OTWB 1CR9L 1GWKA 2FEDC 4E42B 3APBA 5MERA 4ZDHB 3N55A 5JDSA 1YZZA 4A7VA 4BCYA 3JB8A 4MWFA 3BAKA 5D6DA 4JDTL 1BW8A 5DQJB 1CJDA 2WL1A 4JY4A 1H6YA 1QA9A 1TNFA 1CDCA 1OB1A 2HWF3 5JA9A 3EJKA 1C8M3 2X1WL 1X3DA 3UTSB 1BIIB 2W92A 3HG0A 1UXLA 5A6IA 1KULA 2RACA 3Q1EA 5I17B 4OCLC 5JDJA 3WD5H 2DJ4A 3F64A 3TEWA 1OARL 4Z7NB 4LA3A 1JYVA 2X88A 2XKOA 3PWPD 3RZWA 4YC2C 5L9BA 2OTUB 3NNGA 4ZNCD 4CDXB 1N2RA 4FFVC 2K70A 4W6XA 1X5YA 2DYSB 1QJY1 1A25A 5C0AE 3MI6A 4DP7X 1YEKL 4H14A 3NEEA 4XPAH 3CG8A 5CJ8A 4JFDD 4HUWB 3N06B 5C6CA 4PJ8B 2XONA 5JOFA 1HEHC 3D87B 3D51A 1A5FH 4J3OG 4N2DA 3X2QB 1BWMA 1QKQA 1MCEA 2OXBA 3HNBM 3WXVH 3SH4A 1LDSA 3DHJA 2F5BH 5FCUL 5CFDC 5L4FA 1TLMA 4J3OC 4TSCL 3VGHA 4HLEA 3D6EA 3TU6A 1OAKL 2NTFB 4P5TA 3W2DL 4JLRB 2QQLA 3ILNA 4X0KB 1T89C 2ZGMA 4MJIE 4MVTA 2VDOL 1MS9A 5ISZD 5IQLA 3RPIB 1LHNA 5DRZA 1IZKA 3V95A 4UV4H 5BJTB 4XTMA 5IROD 3MX0A 4XOAA 5FLJA 1I1EA 2WXRA 3LEGA 1CS6A 2A7BA 1E3FA 2XPYA 5CD5C 4PJEF 1Z3RA 5F2FA 2A9MH 1AR91 1OL0A 3KWWB 4D0DA 3BPOC 5FO8B 2VNRA 3AXLB 4O51B 4J6RH 4Z7UF 4DP6X 2RFXB 1DBMH 3WFBH 4DO6A 4YSPA 3J4UH 2IDUA 4KU1A 1PPIA 5IJKA 4CKQA 2LALA 3HAGA 2Z79A 3LVEA 2CAUA 4PFEA 2ERJB 5KYUB 5BMFL 1W6QA 2GUOB 1GCFA 1TU2A 2WLKA 5C6PB 3VUAA 4AEIH 4N2HA 1WCBA 1QH6A 2CDPA 3VW3H 1A65A 5JXAL 43C9A 4K94H 4F2EA 4CDQB 4JRWA 5KHKA 1R34A 4XE5B 5K33A 4E68A 1JTTA 2EKSB 2EAAA 3N9NA 4JTNA 3L4WA 3AXDA 3GSRA 2QVIA 4GAYB 3A4EA 3DX6B 4KKZA 1ZLSL 4OI7A 4QKBA 5CO1A 5LZ6A 2APFA 2HLFC 4K9EL 5KTEL 1THAA 3WHXA 5BNOC 4INDA 4COVA 4FOMA 2RDSA 2MNUA 4OBRA 5BNNC 4Q4Y2 3CVHB 4B3VA 3Q8AA 1GGBL 1UKTA 2W38A 2YA1A 2L7UA 5IWLA 2ZKHL 4NHCH 2BINA 5CJQL 1M7XA 1PFCA 1T83A 2VDKB 4K8RD 1HWGB 4JHBA 1SEBB 5C0GB 5F6HI 3H3LA 5FUPA 1TF4A 4GW5A 4LAJH 1MCFA 3HCVA 2GI0A 4FPFA 4JGYC 1JYTA 5K39B 1S9XA 1W0YT 3PIQB 4PJXB 1YNTB 3KYKH 4BHUI 2W9EH 1GSKA 4NAOA 4F7MA 1DCSA 1S0BA 5LLIC 4LLVB 1GXEA 4Q0XL 3BESR 3K4ZA 2MCAA 1OGAA 2FDIA 3ZOAA 2YD5A 2BY1A 1OK8A 3OPZH 5D70L 3N9OA 3PTRB 3BUYA 4OVEA 4WW2B 4EN9B 1DVXA 4P4KA 1EPZA 3VB8A 4WFEE 5BV7B 5IQ7L 1PZSA 2R061 3UGEA 5EEWA 5FM4A 1WAPA 2D7NA 5E1QA 5L6YL 1XJAA 1SLVA 5JQHC 4UBDD 4IEZA 2DWTA 4WO4A 3SJVA 2CR6A 4YMPA 3N1PC 1U5XA 5EUOE 3NSFA 3EG9A 3LEVL 3AS2A 3QQ4A 1ZTMA 3TVMC 4EI5D 4K8FA 4TS6A 3I9IA 3IGUA 1BBDH 4TNEA 5D5MA 3T1WA 2QQPA 4MVBC 1E4WH 4Y5VB 3OGJA 1J1XL 5LGHH 4IMLA 2FSEB 3ULVC 4Z7WE 2PPAA 1COV1 5JMOC 3B7MA 1NPJA 4NM8L 2AEQL 5IG7A 3B5LB 3F58H 1JZGA 3E9TA 4BU2A 4F8AA 5T5OA 3PAUA 2HKFH 2XN1A 2R23B 3NIGB 4X6FB 3ZYOA 2YC0A 3H9ZA 2LAAA 2W1WA 2VT0A 4AAXA 1UOVA 3SDYH 1U8LB 3FQUB 1FBIL 5JIIA 3SGDH 4HN0A 3QRLA 5E6YA 5F9WB 2DWEB 3HZMB 2YBRB 4HIJA 4HWZA 1INQA 5BO1L 1PIV2 1WDAA 4HK9A 5JWPA 2BX5A 4S0HA 5JPNC 3VFGH 2G4IA 4XQ4A 1SOXA 3CQQA 5MP6L 3QUZA 3SBPA 3VD1A 3IFPB 5EF0A 1OTTC 4YR6A 3W21A 3AS0A 1NBQA 2YSSB 1H0BA 4HVQA 1RUC1 4OMDA 1BM3H 3NK4A 4B3NA 1ENSA 3PMEA 3F04A 4UT6A 1CXIA 4UNVA 4G5ZL 5EF2A 1YYLH 1LEMA 1PEWA 3O3AB 2K1MA 1OZTG 4YDVA 2BYVE 2NY3C 5DSCA 3VXUB 2J12B 3T3YA 3QNXB 4XPTH 2MEV1 1BQLH 2QPEB 3MCKB 3HZVA 5F1RA 2QBWA 1RHI2 2I2SA 1R4XA 1X4ZA 1YYCA 2LU5A 2JG8A 3ZXGA 5J56B 2CXKA 3RZKA 4PEEA 4IW3A 5IVJA 3TZVA 5BZZA 2LW3A 4ZXKA 1KXHA 4PT6A 4AIXA 2BNRA 2VSCA 5E4EC 1KFUL 2IGFH 5DS2A 3RHWF 5FYJL 1T2XA 2N3JA 1XNTA 1MS5A 3KPRE 3KCPA 1TFHA 3GXMA 3BTXA 2AI0H 4HFSA 4M29A 2H1XA 2UY8A 3NUKA 5CINH 4V1DB 1P9MA 4E4DX 2Y1YA 4GSUA 5BRZD 1OP5K 2VIRA 4WNQB 5EFIB 2XSKA 5EEYA 4NPKA 2OSYA 3T3MB 4A6YA 2ZGOA 1VA9A 2VLRB 5FUCE 4OCRH 4HWBA 1LO0H 1XE7A 4E4HA 2LFEA 2OMVB 2FQPA 1UOJA 1YPZA 4K1ZA 1RUE1 1B0GA 1UZWA 5TE6H 1S9WB 2O6EA 2DUPA 5L73A 3I4IA 1RV6X 2Z91A 1JK8A 1O59A 4GMTH 4PRPE 2ZP0T 3QZMA 4Y4HD 4IE5A 5GGRB 1TTFA 3LS4H 1D5IH 3CH1A 4D0CA 5DDJ3 4AF9A 3R6SA 1E5ZA 3GI8L 3FO0L 5ES4B 3WCYA 3IMNA 1DJGA 4NN5C 1IARB 5AVTB 3V0IA 3ZGIA 2IALA 1RIRA 2ZF9A 3PHQB 4FP8H 4Y5YA 2Y72A 2PQQA 2YMTA 1UKSA 5C9AA 1I1AB 3MW4A 5CIPH 5FKAB 1FFNA 1TZHA 2Q20A 3SQOH 3GGLA 4X83A 5DC9B 1TUPA 2CGYA 5F8PA 4ZU7A 3VHPA 2ICWB 3FUIA 3MBXH 4XMPL 4YX2L 2R041 4PM1A 1P84J 1X5FA 1XYOA 5BVJA 3RGVA 4P2RA 3VO0A 1HXS3 3DYPA 3KXFE 4G8EA 4HU2A 5IGXH 2P3YA 1UATA 3LZRA 3M7FB 1C5CL 3MBEB 1HB2A 2VD7A 5CBLA 1UZGA 3QE5A 4HFUL 3B9KB 2VQAA 4YHYC 3UH8A 1O75A 1JV5B 3TAYA 3KPPA 2F7RA 4CGUB 5JUVA 1OT5A 4RFT0 3O11B 4LP5A 1FJ1B 4NLAA 2IANB 2F74B 1U4FA 2FYYB 3G6JF 3SODB 3ZN6A 1KD7A 4HS6B 3NVCA 3IN9A 4JO3L 5CP3A 4KROD 3QXDA 3VFUB 3BMWA 3HT2A 3SE8L 2WVVB 2L7JA 1RUD1 2K6WA 3FFDA 5KAQF 3VGAB 4J8QA 4M1DH 2QGCA 3MC0A 4BFGA 5JXED 2GC0A 3AZYA 4LHUB 4MS8D 2RR3A 1KY7A 3LJ3A 2K8QA 4NNPH 1ODAA 4Q8KA 2VABA 5HBAA 4OGAC 3UO1H 5CAZA 3OJ2C 3EMRA 2AEYA 3IAQA 4TNVK 1MS8A 2XXGA 3GXTA 3IM0A 4ZSOE 4UQBA 4WVZA 5C3QA 2WIIB 1RZJH 1SXZA 1YJKA 3L3HB 2B1AL 3NRPA 1RY7B 3HAEH 4Z7IA 1KCLA 3N7LA 2BVOA 2WZPA 3GB7B 2FH8A 3NJHA 3OXSB 1UU6A 2E0PA 2WXIA 5F7DA 3RL1B 4E41B 1IIIA 3M7OA 4E4SA 5LBSH 1TVDA 1AZNA 1IS3A 2YAPA 3U46B 5KWYC 4JKLA 4Z76B 3D8CA 3QO0A 3RDIA 4BELD 1HYSD 4QXUL 4WBBA 1BXVA 3CZEA 3QIUA 3QIWD 4QNPF 4OLXH 3AL6A 3IWUA 1INEH 3S5ZA 1QBMH 2IJ0C 1QR4A 3L5XH 1IKFL 2IV9A 5D1ZB 3HI5L 2WNOA 4HIEA 3J7MA 3D0LA 3LRHA 4POYA 2BVBA 4XPGL 2HWD3 2E7LA 1S7XA 1I3RB 3DSNB 3FU7A 4Q29A 3D18B 4R7NB 5CD3A 3RWDA 5FCCA 4RFEB 4HVOA 4TVPE 2RMU1 4QB2A 5SWZE 5A3TA 1T2QL 2EXWD 1ZLWH 1TLKA 4X5WB 2V3FA 3HNTL 3CHRA 4X9IA 5BZWA 2HVJB 1DG6A 4HCIA 2Q0AA 1R1A3 3JBG1 4YFEA 5AD0B 1YSOA 4G6ML 3PU3A 2VCCA 5A3PA 1QEWB 2QADC 5DFVD 5IB3A 2YGOA 5GLUA 1DBKH 4IKKA 3UMNA 2M2DA 2D0FA 1W8WA 5JSPA 4DQOL 5IB2A 1K42A 3E38A 4U7SA 1KGYE 2O8OA 3FTUA 3W9EA 1YN6B 3L5HA 3LH2H 4GYBA 5I6KA 4FQLH 2EIJB 2EICA 2D7OA 1S3RA 1BF5A 1A14L 3QEQA 4ECNA 4HH9B 2F19H 2EIZA 3FUMA 4R7DB 3MLWH 4Q4V1 3U4SA 1FFOA 5I0XA 2CGPA 1MXDA 3IVKB 3QBTB 5I16B 3B9VA 4HEPA 2PTVA 4GH4C 1B9KA 4N2BA 4ASKA 3L45A 2CGRH 3C5ZD 4IDZA 5EYXA 5LRSA 2BCMA 2Q8BL 1NGWB 2JIXD 1RUG2 2A9CA 1PJWA 1UVQB 2PO6B 1H1AA 1WCUA 5C92A 4UB0H 5KVGH 1ZZCA 3HPNA 3LDRA 2BDRA 1WLWA 4BUHA 4OV6F 1Z5LA 3EFDH 3AITA 4NJAL 4LBQA 5SX5K 3BAXA 2DWRA 1NCCL 1R1CA 5IK3A 1CZVA 3BP7A 3BXNB 5ANMB 2F8VA 3V7MA 3H1MA 5HI4D 1ZTXE 2ZG2A 1OAJA 2Y6SD 3I7DA 1OAXL 4FTVB 1C5HA 3VKNA 2Y24A 2YMOA 4XI5D 3IGLA 5J06A 3C6LB 3HE6A 5FZ0A 2X41A 2OTWA 2V7HB 2DI8A 4RX4D 4E42A 1HW5A 2CWSA 4HK0B 5DQDL 5FZEA 3O2WH 2X3BA 2YBGA 3E1F1 4ZDHA 3VI4F 1YXWA 2VR9A 5B21A 4OQ1A 4U1SB 5ANQA 5E2UL 1IJ9A 5DQJA 1IGCL 1JGVH 2ESVB 2OR8A 3KV9A 3WG4A 2D7QA 1YEJL 3UTPD 3UTSA 2L7QA 1BIIA 3OAYH 3IDXH 1IAIM 5I17A 4L0PB 4NMIA 2E27H 2E4TA 1SRDA 1X5GA 1YLBB 3VWJC 3VBOB 4XVOA 1A6WH 4BUQA 4X5PA 2OTUA 4WUKL 2A3YA 3ARFD 4CDXA 1IGTB 3AREC 3DV4B 1SDDB 4WENB 2VM4A 4XXWC 1ACCA 1MI5E 4UINL 2AERT 5E70A 3VMPA 4B50A 5I19H 1CDBA 4L3EE 3NAPB 4ELDA 4DKTA 3NFSH 4HUWA 1XSIA 5T3XL 4HHGA 2UUDH 3EUDA 4PJ8A 2ZWNA 3O6FB 2MWCA 4HMCA 1X4XA 3PAYA 1OF0A 4G9DB 2C6SA 2QUOA 1PGL2 3CFCH 2EADA 2NTFA 4Y88A 2BWQA 2J8UB 2XICA 4JLRA 4X0KA 3U4BH 3RIFK 2WINB 5JI9A 5DGRA 3RPIA 3BHBB 3QARA 5BJTA 1T21B 4FQ1L 3KBEA 4FNLH 3RZCB 25C8L 2V33A 4TLUA 1AS8A 4UV7H 1BEV2 4PJDF 5KANG 1SLIA 3VAEA 3KWWA 4NZUH 1DF0A 1TNRA 5FO8A 3AXLA 4O51A 1JYIA 2GBTA 2RFXA 5HPOA 4J5VA 3RYPA 3BSGA 3V56A 3WIIH 2WQZC 5J0BA 1J59A 2MJWA 1S0DA 5IHRA 1KBPA 4HJ1A 1P69B 3ECWA 1OLMA 5EP9A 5KYUA 3MPCA 4JNXA 3PDQA 1QSFE 2GUOA 1IBGL 4J6IA 5C09D 1AMYA 1K2DB 4GLRI 1PM4A 4L3AA 2BQPA 2XDVA 2W88A 3TV3H 4LHKA 5B4MD 3JTTB 3V5KB 2QFPA 4Q9QL 4CDQA 5K9YA 2K7QA 2WXNA 2EKSA 4OBSA 4OW6A 4BZ2L 4GAYA 3CFTA 3DX6A 1RMFL 1OLZA 3EQEA 1FAKT 5F7YC 4KK9D 3Q2CA 4KWUA 2ERFA 2FLRT 2WJSA 3CVHA 3WKNA 5JZ7D 1N3PA 3ZFGC 1CLZH 1MHPL 4JDMA 5FWJA 4HUVB 2ZGRA 5C0GA 3QISA 5KZCB 1SEBA 2HBTA 2ZP8A 2NUPB 2DMGA 1IC4H 4F57H 4CCKA 2J6EH 3KPSB 3AS3A 1ZZ6A 5K39A 2PABA 3PIQA 4PJXA 4PUBL 1YNTA 2NRDA 5AZ2H 4BK5A 1KYOK 4LLVA 1CL7L 1NLBL 2LTQC 5CFDB 1ZVNA 2WXOA 3JU9A 1LO4L 4NKDB 3CVIL 4PG2A 5J98B 1H15B 1OQXA 2XC8A 5E0QA 5DHXB 4P23C 4WW2A 4Y8DC 4RDBA 1ENQA 2COVD 2BMKB 4CXYA 1PS3A 2EEFA 1DDHB 2HYXA 3JWDL 1HT6A 4D0QA 4UQCA 3WFCH 2V2XB 4W4NA 3VWKD 5IP4A 4Y7MA 3BPOB 3EJZD 4P02B 1MWAL 1YQ2A 2GSGB 2A6KB 4OGQC 3VMNA 4Y5VA 1BZ9B 2F54D 3NFNB 5K9QI 1SACA 3N9QA 1JHKL 2FSEA 4Z9KB 4JB9L 4AGLA 4IEQA 3O4LB 4KJWC 4Y16B 1A8ZA 5AYUH 1JP5A 1AGFB 1XIWD 3KLLA 3GTVA 4B5EA 1C5IA 3V5HB 1AYOA 2WUBH 4X6FA 4QXGL 2R23A 3BUCA 4IHOB 5A3UA 3MV9D 4KMLB 4M43H 4DVRL 5JW3H 2X5IB 2H3KA 2HPTA 1U8LA 3FQUA 1S2BA 3KR3H 4XE0A 2DWEA 3L9EA 3HZMA 2JIJA 3CMOL 5BNOB 2YBRA 4FQIL 1EAH1 4X9HA 2Z7YA 1A1NB 4TUKH 3BZ5A 2DLGA 4RGAA 3FMGL 4LRNL 2X89D 4ONFL 4QGYA 2R29H 4KRPB 1IV8A 4I0PD 1A4AA 4ZFOL 1PIV1 4I3RH 1NFDB 2EDBA 3IFPA 2J2ZB 3GS0A 4IRZH 1CURA 4LCWE 3M4FA 2A4CA 1FLRL 1ASPA 5TK4A 2A6ZA 2YSSA 3NIFB 4GRLD 5FLVA 1RZIB 2EE6A 1XU1A 2UURA 4HPKB 1DFBH 1RVF3 4P9ML 3D0SA 1UWFA 5PCYA 3UAJD 3VZJA 2VRKA 3O3AA 1F1DA 2IOMA 2EECA 3VXUA 4EMZA 1FXZA 3QNXA 2OP4L 3P54A 4E9VA 2Y6HA 3H1WA 3MCKA 3ZYBA 2R1YB 4JHWH 3KPNB 2DMKA 3VXMD 3W0WD 4BINA 1G87A 4L8QA 4XUNA 5T1MB 2Y07L 2GK2A 4UIKL 3GBNL 4ADJA 4X4XB 4ZMNA 3E1ZA 4FQHB 4KMTL 5C2BH 1W90A 4P2AA 1WGPA 2E9QA 1RHI1 5J7CC 5LJYH 1RJ8A 2CAKA 3VXSB 4MJIB 3LKRB 1MW0A 3U0WH 4IESA 5I66B 3U25A 4ELMF 1MRFL 2G3ZA 2GTWB 1HXYB 5GJ6A 3DVIA 3KMHA 3PUAA 1QLRB 3PPEA 1GMMA 2VMHA 2EEAA 4V1DA 3MV01 2DCTA 4ODUB 2WLLA 4WNQA 4JM2F 5D4HA 5EFIA 3G7DA 5CCKL 4LT5A 3K75B 3QFJD 2VLRA 1P0SE 5DO2C 1QXRA 1LMKA 5DD0L 2OMVA 1CGYA 2NX5B 1WAAF 4GQ9H 4I0CC 2Q87A 2V0AA 1S9WA 1SYVB 4W9IC 3WENA 1X7SA 1E5IA 4AV0A 4MD5A 1FNYA 3P40A 1UKRA 4LO8A 3GSNH 1FDLH 3PUHA 4PB0H 3GS7A 5JPNB 3FQ4A 1LWRA 3LDBC 5GGRA 1TKWB 3MTRA 4Q8LA 3I59B 5IVFA 4CCCA 5HI0A 1A3RH 1XGUB 4DS0A 2A1WL 5EZPA 1ND3B 2XPGB 3D8MA 3PHQA 4GT0A 4GKLA 1NCBL 1DBJL 1W99A 2B9AA 3T1MA 1JE6A 1I1AA 1AGDB 3AWGA 1U2HA 5FKAA 1MWOA 3ZUCA 4AGPA 3LNFA 2UWCA 2ICWA 3S96B 4Z1PA 4KBBA 3HC3H 3JVFC 2H45A 1UD1A 4ATFA 4ENED 3ZDSA 1EFQA 2NW3B 4L4TE 2B7YA 3BAEH 2VH5L 1ZBE2 2KT6A 1UUSA 2X70B 3MBEA 5AKRA 1DJZA 3B9KA 5BY5A 1JV5A 2W0LA 4QX2A 5MEOA 4TVUA 1OARH 2FEDD 3WKML 5FZFA 1NOAA 1WCKA 3CNAA 4C4UA 5TDPB 3O11A 4ALAC 1DBBH 4DO5A 1NMAH 2IANA 2F74A 3VM5A 2FYYA 2E7HA 3AZWA 4HS6A 5E4EB 5C86A 1P5VB 4CCJA 2D2CC 5ALCL 1PMHX 3VFUA 4OZHF 2WVVA 5CLYA 3CXFA 3NIDF 2ID5A 3WQ0A 1NXMA 3A0KA 5E95B 2BFUS 3HG1E 2AJXL 2DIAA 3PYCA 2VUCA 2CG9X 4LHUA 2YUEA 1FAIL 5C0BE 1RVFL 2B46X 2BVEA 2WO4A 4IEWA 4FFVD 5DR5L 2WIIA 3ARYA 1RZ8B 3A6BL 3O0RL 1YFUA 1JNNH 1OAKH 3L3HA 4R26H 4DINB 2AHIA 3MRPB 2SBAA 4KGQA 1QJX2 2ZHMA 3GB7A 3U82B 1WS7A 1KB5L 3OXSA 4E41A 1U58B 3IE4A 3RL1A 3S5LG 4MHRA 2E6VA 4GKNB 4DNYA 3LA3A 4QEGA 3U46A 2AJ3B 3PQYE 4AVCA 5C08E 4PSPA 3MJGX 4Z76A 4Y1ZA 4JMNA 4AGMA 1HQWA 4XIKA 1KEGH 2C9KA 4G9FB 5AOJA 4FKHA 4NPMA 4U1IB 4BH8B 4BPZA 1ZZ9A 5D1ZA 2DDQL 1QPKA 3EYPA 5LNEA 5SV5A 3L9RB 3ZE0B 5BMFH 3TEXA 4WW1B 5HVHC 3GIZH 3BKYH 4G43B 2FDBP 2R0LH 1OT1A 4LCCC 4X4ZA 1I3RA 3WDJA 3KMDA 1QQP2 1MVUB 3DSNA 1RJ7A 3D18A 3C2AH 4R7NA 5J89A 4RFEA 2A4EA 2Y36L 3SMHA 1IKNC 2FD8A 5EEUA 5FYYA 2HT3C 3MNZB 3P3YA 4X5WA 3VMOA 5LCWL 2HVJA 1X5KA 2E47A 3I74A 4BV1A 4H8UA 1CIDA 3ZSJA 4YHYB 5AD0A 2PW2B 3H53A 1QOOA 3M3CA 2EO9A 5I5MA 2BBVA 4U2ZA 1QEWA 3DBXB 1B35C 1ZS2A 4PJHE 1NGXB 3IZOA 4AYEC 3KZ4C 4WZFA 2GABA 3S37L 1OEZW 1M1XB 1QFWM 3LYRA 4MNQB 5J1SC 1WV7T 1UYWL 2HH0L 3EJUA 1EDYA 1QW9A 1V9U2 1YN6A 2OUJA 2WABA 5CJQH 3MI8A 4OCYL 2VXSH 2X29A 1G0DA 4PJ9B 4I1NB 3LXAA 1U91B 1J84A 1LDPH 3WY6A 5JIPA 4HH9A 4TVPH 2N7GA 4R7DA 4OCSH 4BXFA 5KSBE 4AXWB 4LBLA 3IVKA 5I16A 4SLIA 3MCLL 3T0DA 3C9NB 4QHOA 1DDLA 2R1DA 2IFFL 1MZFA 4KDVA 5D7IB 5GGVH 4UYPA 4M4PA 3TJHD 4YL9A 4MZUA 1NGWA 1U3HC 1R3IL 3P0VL 4COZA 1UVQA 1SMDA 2PO6A 2C34A 2WOYA 1H3UA 3ZXKA 3BPLB 2YB7A 1YJDH 4U6VH 4B95C 5ESAB 2QDVA 4HS8H 5AKSA 5C0CE 1RUG1 2TSAA 1MG2C 3WLWC 3IMBA 1U95B 1RZKC 3CFIC 5D96B 4AL9A 5FPVA 3HKZA 3HN3A 3BXNA 5ANMA 1W03A 4F3JA 3WFEH 4BMEA 1ZVYA 2C8NA 2J5WA 2FBRA 4Y1AB 1CX4A 1KTLB 4TTDD 4EDXB 4FQXC 3TYGH 4HA1A 4KKCC 4FTVA 4OAWA 4AMWA 1FL3B 1HS6A 4BFFA 1DJXA 5IOKA 3NSXA 1JAEA 5GRYA 2QZ2A 3O1MA 3C6LA 2X2HA 5DMIH 1ECZA 2V7HA 1XOYA 4X7EC 1DVFB 1Z0NA 4N7IA 3TVMD 3AMPA 2J21A 1G9NH 1UZ6E 3SPGA 4HK0A 1J8KA 4U1SA 4JW3A 1E6OH 2B1HH 4K7FB 2PAKA 4AK2A 2ESVA 3BT0A 2ZUXA 3UYOD 1ND0B 3B1TA 2QADB 4AL8C 4URTB 3L4YA 3CH8A 4IGBD 5MP6H 1JL8A 3ZHKA 2OS7A 4IEVA 2XZCH 4L0PA 3F85A 2BP3A 1PZAA 1S9KC 4CBPA 3VBOA 2YQ3A 2XG3A 5SWSE 1Q8VA 3H55A 1IGTA 3DV4A 4F1ZA 1SDDA 5C9KA 3AT9A 4GB31 1BFVL 2VXVL 4CW1B 1LK3L 2FNWA 4NN7B 3NAPA 3AG2B 3JVGA 4AMKL 4HOWA 1A4BA 4HCRA 1O7FA 4GH4B 2XPZA 3KYOB 3O6FA 1RUI2 4IJ3C 2BP5M 3QDHA 4YDNA 5PAZA 5L2KB 2WUCL 4CC4A 2HTKC 4F5CE 4G9DA 5FZDA 5BV6A 3OGGA 3OMAB 1HNGA 5FPBA 5HXVA 3ZDXB 3OSVA 3MLYL 3WEBA 2J8UA 1A66A 2WINA 4BQ8A 2RGSA 3BHBA 3CJIC 1T21A 4J4PA 1T1WB 2XETA 3UPAA 3X3FL 2EDOA 2H1LM 4ORGB 1AZRA 1SDYA 4XZ4A 4FG6D 3RZCA 1N0XL 2B5HA 4XFIA 1JHTB 4M7KL 4EI0A 2CBQA 3WTXA 4P2QE 5FMCA 2NY3D 4D7BA 4XZPA 2DLTA 4B9GA 3IGKA 1SFHA 3DMMC 1CBVH 3BZDA 4HGWB 2H6CA 3UKNA 2YA2A 1OK0A 5CGBA 3ULUC 3MRMB 1R0AL 1VZGA 2CALA 2XLGA 2WGNB 5I6XB 4RD7A 2P44B 4ZBJA 3W20A 1K2DA 3GBGA 4GI9A 4R97C 5I75C 5JOZA 3JTTA 4G42B 4UUJB 3V5KA 2WNUC 1SPPB 4QHBA 4NIHA 2R56L 3F7KA 1K85A 1PZCA 4PRID 3RNQB 5B38G 2FGWH 4MA7L 4BD4A 1S5HB 3GI8H 5T5PA 1SN5A 3MDJA 3NRFA 4KTEH 4WY7H 3VWJB 2UXVA 5T5NG 3X14B 2JJ6A 3RRQA 3HZYB 3FT1A 3K6FA 4M3HA 1BPVA 1HXKA 1W15A 2XZAL 3WFDH 4Z8FH 2BIPA 4HUVA 4BZ1L 2LU3A 4XMPH 1L5GB 2OL3H 2NUPA 1JGLL 3MLUL 4Z3FA 3AP9A 1BEYH 4IIQC 5FGBA 3KPSA 1QJY3 2P4EA 1T80A 2NDGA 2CU9A 5E5RB 2B16A 1MQ8A 1VEOA 3Q8BA 2J42A 2ZX3A 5CFDA 3WDVA 1TYJA 4NKDA 3MN8A 1NANI 1H15A 3CBNA 3SD2A 4KOBA 1NOFA 2PYEB 2C9SA 1OM3L 1T89A 3O1OA 1ZNPA 4K0OA 4KNTA 4XHXA 4K94C 2P9RA 1DDHA 4PRHB 3U4EB 1NLRA 3OWEA 1UL9A 1TG8A 2EDXA 3G9AB 3PU7A 5DC4B 2V2XA 4U1MB 3V4UH 4FQPA 2PMWB 2GSGA 5LNDA 4J2XA 4KPHH 1AR93 1R082 2A6KA 3AKQA 4KTDL 1BZ9A 2Y6FA 2YFNA 3EJCA 3NFNA 5AENA 2YQ2A 5K59E 1K4DB 2IBZY 2XJQA 2NY1C 3O4LA 4NN6C 1MHHB 4Q4IA 4Y16A 1AGFA 3DN7A 5ABDE 2WFF2 2VLKB 3PXHA 3LIUA 4RGNE 3V5HA 4JV4A 1H8LA 4Q4W2 2B39A 4W9EC 4RFRB 2NLRA 4IHOA 5TDOB 3E80A 1V3KA 3SZKC 1BIHA 4HT1H 3RIKA 1C5BL 4OGAD 2XWCA 3T65B 2PR4L 2PWHA 1HJFA 2WQ4A 2ARAA 3WINE 3ZVXA 3VA2C 4WAFA 3OR6B 5BNOA 3SPCA 3RJQB 1A1NA 2W8CA 3MLLA 4TKWA 1Q8MA 3AB0B 2BK8A 5D4JA 1RTVA 4YXHH 1PTZA 3SYPA 3A4FA 2VERN 3CN2A 3I9AA 3E5QA 4WWNA 1ZEAH 2PPCA 4M6OH 5I0ZA 2LW8A 3ESOA 3DKHA 4XNXH 3SIKA 1NFDA 4ZOEA 2IXLA 4JY5L 5LXVA 2J2ZA 4M62H 4XB7A 2P3JA 3QQ9D 4UNTA 1WVZA 2H0PA 5K1NA 3ZMOA 4Z92B 1RZIA 2DQUH 5BNPB 4HPKA 1T2QH 2LTQB 1XL6A 2J43A 2ZWZA 5D5MF 2XJRA 4G6MH 3WNXA 2BVYA 3QB7C 4FHBD 4P23B 1EHLH 2JE9A 2PPFA 3GRWH 4AGOA 2DM3A 2R1YA 3KPNA 3ETPA 2H6BA 4B4RA 5T1MA 2IWGB 3S88H 3VXRB 3UC2A 2NY4B 3C6EA 4CE8A 4P2CG 1FNFA 1HI6B 2R063 3GZUC 1JERA 3VXSA 1G7JB 4MJIA 4UF7C 3LKRA 2DTWA 3RVVD 3FH7A 5CZXD 5I66A 1LHZA 1S7TB 3GBLA 2GTWA 5E8DH 1HXYA 5GS0L 4NQEB 3FHIB 4D6QA 1QLRA 3K1DA 3T8VA 3WUWG 2D6KA 4UW3A 5FYZA 1GW6A 3WDUA 5JMOA 1MG3C 2OK0L 5C2UB 1NCDL 5H37G 2RHPA 4ODUA 5T8IA 3RJ2X 4AJWA 1V5JA 4Y4FC 1IS5A 4JM4L 3VI3B 2VXUH 1COV3 5CCGE 2ZA9A 4K55A 3VDCA 4EN0A 5EG6C 2BNQE 4QGTA 4AE2A 5IV2B 5BOJA 1N6UA 2H0VA 4ERSL 3EOAB 2NX5A 3AM8C 2CIKB 4MNHB 4YE0A 4NOTA 4YM3A 1J8SA 1SYVA 2W0KA 1DLHB 4GXLA 1W2UA 3NABH 3THTA 3WIHA 1D9KB 4JY6B 2D3SA 4Z3HA 5JPNA 2HT2C 1TKWA 2H2SC 3I59A 5C3RA 4ANVA 1A4KB 1X9QA 2C1PB 2MSPA 1W9YA 3MUHL 3VKFC 3WCSA 1XGUA 1RMU2 3MXWL 4KY1H 3EYQC 3RB7A 2XPGA 5F7AA 5JOPD 1ND3A 1PGW2 3IJYB 4LOFA 4OTXH 2YPKB 3LNDA 1AGDA 4AWJC 1HSBB 5AB0A 3FB6B 2X40A 5TPWH 2YD7A 5FGRA 2A38A 3S96A 2P48B 3RDTC 2IG2L 4LE8A 4GRWB 4OU3A 1HAUA 4AGGA 1RUC3 5E2UH 2B3RA 3E6FB 2NW3A 1QFUL 3VU2A 1GP4A 4QTHB 4XVJL 1A6UH 2X70A 3QEUB 4XOCA 3DV8A 4MRBA 2WCSA 2K45A 5ICUA 4XNBA 1EMTH 3ZYIB 3ZE2E 4Y7OC 5JIHA 4YXLH 1EO8H 1VESA 1DUYB 2HZHA 4Y2DB 2MEV3 5E6HA 5A3ID 5TDPA 3ZKXC 5I1HH 4XOGA 4OLVH 4ZU4A 1IG0A 3I3QA 5I9QC 1IZ3A 4ZW3A 1LTEA 1P5VA 1XGYH 2FIRT 3NZHH 5AOIA 1E28B 4UINH 3C7OA 1ICTA 1IOAA 5I6OA 1YPZF 4X7FC 2VXQL 1LHUA 4OFGA 3QEGH 2WLJA 2Y0OA 2ZSVB 5T3XH 5FPUA 5C3OA 1NFKA 3B1UA 2A74C 2RS52 4YG3A 2Q3AA 5IQOA 1GP6A 2GALA 2A6WA 4JRAA 1SOKA 3QYCA 4LVHB 5A70A 5FPXA 1JW6A 1RZ8A 5CGTA 5I8OH 2JDPA 1WCQA 3LZFL 1FF5A 2J1AA 3MRPA 4Q0PA 3CQPA 3OQ3B 4OZGE 1U58A 5IBTH 4LFHD 4FLRA 1T7ZA 2OKMA 25C8H 1H3GA 4GKNA 1UPIA 1KJ3L 2QEJA 1QJX1 4OGYL 1RUE3 1WITA 2AJ3A 5A6YA 8FABB 5T55A 4HQQL 5LBVA 2MH4A 2V17L 2Q2EB 4KXAA 4Y4RA 3KDMB 4G9FA 2WKGA 4NQCE 4LARH 2OKXA 3KF3A 4U1IA 3HG5A 4QKNA 4BH8A 4RL7A 3UPRB 2OMNA 2WVSA 5IQ9B 4MXWH 1YAIA 2AGJL 2NY2D 3L9RA 4WW1A 1BD2D 2ADFL 1MVEA 2WYZA 3PAZA 4PYGA 4G43A 1PZ3A 1OPOA 3IDEA 4GUPB 3KL3A 4B1MA 1MVUA 3ATFA 2WK2A 3B2UC 2R0HA 3B8YA 4J27A 3H42L 4B9IA 4PS8A 2X12A 3V9EA 2R043 3ZXLA 5A2BA 1ZKAA 3MNZA 1E6JL 3QUXC 3HNSH 4QY8B 4DPRA 1KENH 2ADIB 1RZJC 2PW2A 3T1FB 3F5WB 3GNEA 1G1KA 3KPMB 3DBXA 4DFSA 3M3QA 1NGXA 4XHJC 1Q8SA 2DKSA 2Y7QB 3HWJA 2XIIA 4H2AA 3FUNA 2Q7YB 2IAAC 1M1XA 4M1CD 4MNQA 4AEFA 1WW5A 2ZXDA 3CHOA 4QRRE 1SHMA 1ZVSB 4YVSA 1VSCA 4PLKC 3K4AA 5CMAB 4N2OA 2G4EA 2PHRA 4Z8BA 1BV8A 4U1GC 1XCQB 2Q8AL 1OLLA 4FCAA 4PJ9A 4Q9CA 2RV9A 5JCTA 4CRQA 1U91A 4Z7QF 3RYKA 1AMXA 3HFML 4IE4A 4G8IB 4RGOL 1MZ5A 4JQTA 4QAWA 4IOFD 4KJYB 1BYPA 4AXWA 1CL7H 2G75B 4NKMB 3T0VA 3C9NA 1OGAD 2N0MA 4A7SA 3LNEA 2ZD0A 2YXFA 1X5IA 2F7IA 5LGKA 1OSEA 1JXKA 5D7IA 1E5CA 2XBTA 3VXQB 1DL7L 1ZIBA 4P4KD 1E27B 4NZTH 3AM2A 2HRPL 3I2OA 2YHGA 4KWKA 4D7PA 5ISLA 3M46A 5F9JB 4E8DA 5ESAA 3JWDH 3LXBA 1A47A 1XZWA 1RLWA 3L2NA 4QXHA 2JKSA 3S5LB 1W9XA 4TPRL 1FO0L 3OV6A 1U95A 4WI2A 3JWOH 2ADYA 5F2SA 5TTRA 1J88A 3MKGA 3PXLA 3V0EA 4Y1AA 2V9QA 3ZR6A 1KTLA 3VFTB 1GA2A 4EDXA 1AY1L 1JHKH 2CLVB 3CZLA 3UJQA 3ZLIA 1F8TH 1WIUA 1EAJA 1FL3A 4P3CL 2NT0A 1K45A 2IXJA 3M3IA 5HVHB 2AJSH 5JR1L 4YVSB 4LCCB 2P1BA 3UKTA 2ZTNA 3BKZA 3A4DA 4MZIA 1DVFA 1SHSA 4RFOL 5DEFB 3ZE1E 3A24A 4W9GC 5EWIH 4DVRH 3EJYC 4NO0D 3TBYB 1X5ZA 1GZ9A 1YC61 3ZIYA 4AGNA 4EZKA 3BUBA 4N8CL 5A3OA 2R1WB 4BH9A 3FE5A 2V37A 2VC9A 1J0KA 2EE0A 4K7FA 3GRBA 1AQ8A 2QQNH 4F91B 1HQNA 4LDOB 2RMU3 1VZHA 5MENE 4UYQA 3DI2B 1ND0A 4GO6B 1B35B 1IBZA 2EDWA 2OMBA 1ZK5A 4QHLB 3RWHB 3N42F 3JBG3 3MW3A 4URTA 3SDAC 1SJEB 1SPDA 1JYNA 3FRPG 3O6ML 35C8H 4HWNA 4JQIH 4D3CL 4FFHA 4R4XA 1KFAL 2A75A 4EZHA 1MCNA 2APXA 4LPVA 4NT6B 3UTTB 5AW7B 1A6CA 2QKDA 1FLRH 5F21B 1V27A 2ZXGA 4CW1A 5KVEE 4XJUA 4TXVB 3S8GB 4BFJA 3RWCB 3MF6A 1NUFA 2O5YH 1KT2B 2WO7A 1KBVA 3U0PB 4GH4A 4CP9B 3KYOA 1ODMA 2FDHA 3H1YA 2IXIA 4Q4V3 4LR4A 4N2AA 3MQIA 5L2KA 5DD3H 1G6RB 4KI5E 4APQC 2AH2A 1U3HB 1XZ0B 3LCPA 1MWAB 4Z0XB 4BQ6A 1RUI1 5IMKB 3ZYFA 5GS0C 2WQSA 4KMTH 2J20A 2K3HA 1T1WA 2Z4FA 5HDBE 2FHFA 4ORGA 3I84A 3BFQG 1JHTA 4I2OA 3JV5A 5CR8A 2AJVH 5GLVA 2VLJB 3S0MA 2HWZH 2A3TA 3H2WA 4UT9A 4DEWA 1H9WA 1ADQL 4NGHL 4HGWA 1FIGL 4PVMA 1OD3A 4AT6B 1MCKA 3FHEA 4FADA 3MRMA 4OHVA 1W3VA 2OT7A 3PWPE 4NEHB 1OGTB 2BSDA 2XIDA 4JKKA 3RKPA 4P3DB 4QLRA 1BVKB 2NNCA 5DDHB 5A2AA 4Z7NF 1CC3A 2VNOA 2GMEA 2YO3A 4U1LB 3WIAA 4MZ3A 2XKNB 1E5RA 1JDCA 4MXVA 2FRGP 4LZKA 1RZ7L 4ZFOB 4HKOA 4UUJA 2WWMC 4G42A 4L1BA 4TSVA 2CXGA 3WMPA 1SPPA 2PMZA 4UQAA 4XP4L 1F35A 3L9JT 3WEAA 3O4OB 1SJVA 4MSWB 3RNQA 1T3FB 5T1LB 2X53A 4ZMOA 4OI2A 4HJIA 2WSKA 2BSED 3CZNA 4WVMB 1RI8A 1WIPA 5DO2D 3VWJA 4FYRA 1EIBA 5GZOC 4ORFA 4PJYA 3X14A 3C5JB 1G7LB 3GTNA 3NFPB 3HZYA 4NFCA 5ISZE 3DWTA 4XXWA 1B4JH 5HDOA 2OI9C 3F01A 4XMKH 1M6UA 2P1YA 1D5MB 1W8UA 1DQIA 5F0MB 3DIVA 3DXUA 1L5GA 1OTUD 4F58H 1D2QA 1ZCRA 4AQ2A 4N2LA 4WKXA 1QX1A 2BOBB 5INDA 5K9OB 1RU9L 2Y0IA 3PGCB 4O2EB 4LOUC 4IJ3B 4HHAB 3K3NA 4Z2AA 1PG7W 2ZKMX 3B34A 2WWKT 4AQ6A 2ETWA 4WGKA 2PYEA 1MCOL 5JW4Q 4O9HH 1QO3B 3QCUH 4M93C 4RCAA 3CHSA 1QZ1A 1WGVA 3CJIB 4YBHA 1V7NH 1QYGH 3LHPL 4PRHA 3U4EA 2DDUA 3BAJA 4DAGH 3LIZL 4DO4A 2GNBA 3ZDZB 3P1IA 4IM8A 4WJKB 3SQRA 4EWEA 4WI7A 3MPPG 3HHSB 1GICA 3WP5A 5JHMA 4LHJB 3CFQA 2HFGL 2YR3A 3DMMB 1W0NA 3Q2VA 1RUMH 1DIWA 1RLBA 2AV7B 4CCEA 5KVFH 4TQPA 4XWGL 2OZ4A 1MAMH 3WIFA 4ANXA 1SEQH 1K4DA 4WWKB 1IC7L 1CFQB 3QJHB