1OPOA

The structure of carnation mottle virus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
267
structure length
267
Chain Sequence
SMTMSKTELLSTVKGTTGVIPSFEDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQPLQWVVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein
publication title The atomic structure of Carnation Mottle Virus capsid protein
pubmed doi rcsb
total genus 52
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
A PF08462 Carmo_coat_C Carmovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1opoA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opoA01
1RUD1 2RS12 2HWD1 2RMU1 2HWF1 1HXS2 1BMV2 1AYM2 3VBOB 5FMOL 1QQP3 1QJX3 4YVWA 1OOPB 1VRH2 3VBHB 5GKAC 1AR83 1VBB1 1Z7S1 1RVF1 5L7OC 1PIV3 1ND2C 1MQTC 1NY72 4CEWB 1MEC3 1PO22 1D4M3 2R061 3DPRC 1QJY1 1PGL1 3TN93 2WS93 1HRI2 4IV1B 1RUH3 4CDUB 1RUF2 5C9AB 1NA1C 3VBSC 1C8M3 4AEDB 3JD72 3VDDC 1ZBE2 5ABJA 2TBVA 1FOD2 1VAKA 1VBA1 5C4WC 5JZGA 1R1A3 4CDWB 2HWC2 4GH4C 1RUE2 1BBT3 4RHV2 2MEV2 4Y5Z0 2PLV2 1RMU1 5JZGB 5K0UB 1ND3A 4Q4X2 2WZR2 4RQPB 1VBD1 4WM8A 3ZFEC 1BEV1 3J8F3 1RHI3 2R071 5BNNA 4CDQB 1FPN3 3CJIC 5AC91 4QPGA 4WM7A 2RM22 4BCUA 5BNNB 1R083 4Q4V2 3VBOC 1EV11 1EAH2 3VBFC 1PO13 1AL23 1AUYA 4CEYC 4WM7B 5FMOS 4NWWA 1TMF2 5CFCB 2RS11 3S6PA 2HWE1 1HXS1 1OPOA 4LLFA 4N53A 5CFDA 1BMV1 1ZBA3 1WCDJ 5A32B 1QQP2 1COV3 1QJX2 1HRV3 4CDXB 4N53B 3ZFGB 1ASJ1 1PGW2 2HWB3 4Y4YA 4IV1C 1RUG3 1VBC1 1AR82 5C8CB 4FTBA 1PIV2 1PO21 3ZFFC 1MEC2 1D4M2 3JBG3 1VBE3 1RUJ3 3TN92 2WS92 1AR63 1GFF2 3LOBA 1RUH2 3JD71 1AR91 4NWVA 1C8M2 3VBRA 1ZBE1 1FOD1 1RUC3 5K0UC 1CD3G 4RQPC 2R043 3VBRB 2X5IA 2RS33 1RUD3 3FBMA 2HWC1 1B35A 1R1A2 1NCRA 4RHV1 1PVC3 4QPIA 5BNOC 1BBT2 4IV3B 2WZR1 2X5IB 1POV3 1V9U1 5D8AC 4CDQC 4YVSB 1RUI1 1B35B 1H8TB 4JGZB 4QPIB 1IHMA 4JGYC 3J8F2 1RHI2 5BNPA 5LK7B 5ACA1 4RS5A 5CFCC 4YVWB 1FPN2 2RM21 3VBUC 4Q4V1 1R082 1C8NA 1PO12 1AL22 4CDXC 1F8VA 1E57A 1QJZA 1X33A 1TME1 1VBA3 2BFUL 1ZBA2 4N43A 4PDWC 1QJX1 2WWSA 1COV2 1HRV2 2RS51 4RR3A 4Q4Y3 2HWB2 1AYN3 3ZFFA 5ABJB 1RUG2 2WFF1 1NCQC 2RR11 4GMP3 2R073 1AL0G 3JBG2 1VBE2 1K5MA 2XBO1 3TN91 1RUJ2 1AR62 1C8M1 1OHFA 4GB31 1ND3B 2XPJA 4WM8B 3NAPA 1EV13 1CJDA 1RUC2 1VB2A 1H8TC 2R042 2HWE3 2RS32 4JGZC 1R1A1 1RUD2 1SMVA 1OOPC 4QPGB 1FMD1 1W39A 1PVC2 4Z92B 3VBHC 5A33A 1R093 4JGYA 1AYM1 1QJU3 1AR73 4YVWC 1X36A 1ASJ3 4CEWC 3J8F1 1VBC3 2IZWA 5A33B 4Q4W3 1VRH1 5CFDB 5L7OA 1ND2A 1MQTA 2GH8A 4CDUC 5C9AC 1PGL2 4AEDC 1NY71 3DPRA 2ZAHA 1AR93 5L7OB 1ND2B 2BFUS 1NA1A 1PO11 1AL21 3VBSA 1HRI1 3VDDA 2FZ1A 1RUF1 4PDWA 4CDWC 1VBA2 5ABJC 1NA1B 1M06G 5C4WA 5JZGC 1RB8G 2WLPA 4GH4A 5DDJ3 2HWD3 2RMU3 1V9U3 1DDLA 2HWF3 4Q4Y2 1RUI3 1RUE1 1RUG1 1AYN2 2MEV1 2PLV1 1ND3C 3ZFEA 3HAGA 4Q4X1 1F2NA 2R072 1NCRB 1RUJ1 5ACA3 1VBB3 1AR61 1Z7S3 5BNNC 1NG0A 1RVF3 3CJIA 2R063 4WM7C 1QJY3 1EV12 3JB8A 3VBOA 1NOVA 3VBFA 4CEYA 2R041 5BNPB 1EAH1 1TME3 2HWE2 4RS5B 3VBHA 1POV0 1PVC1 1TMF1 4N53C 5CFDC 3VBFB 3ZFGC 1HX6A 4CEYB 1POV1 1VB4A 4CEWA 5J96B 2RS53 1R092 1QJU2 1AR72 5C8CC 1ASJ2 1QQP1 4IV1A 1VBC2 2WFF3 4CDUA 5C9AA 2RR13 1RMU3 1PGW1 4Q4W2 4AEDA 5FOJB 4N43B 1AR81 1VBD3 1PIV1 1BEV3 2XBO3 2BUKA 1MEC1 1D4M1 2VQ0A 1AR92 4GB33 4RR3B 3ZFFB 2WS91 4CDWA 1RUH1 3VBRC 5AC93 5K0UA 4RQPA 1K5MB 4IV3C 4FTEA 2X5IC 1FMD3 4YVSC 1B35C 2RS13 1NCRC 5BNOA 1HXS3 4Q4Y1 5DDJ2 4QPIC 2HWD2 2RMU2 1AYM3 1V9U2 1AYN1 2HWF2 3NAPB 4GMP0 5D8AA 4CDQA 1RUI2 1BBT1 4GMP1 2BBVA 5BNOB 1VRH3 5D8AB 5ACA2 1RHI1 5BNPC 4FTSA 1VBB2 1Z7S2 2FZ2A 1RVF2 1PO23 4RS5C 5CFCA 4JGYB 2DF7A 3VBUA 2R062 2Y26A 1FPN1 1QJY2 1HRI3 5A32A 1RUF3 4SBVA 3JD73 1R081 4CDXA 1MQTB 3VBUB 3M8LA 1TME2 3ZFGA 4EJRA 1ZBE3 1HQNA 2GSYA 2BPA2 1FOD3 3DPRB 5C8CA 4N43C 4FSJA 1R091 1ZBA1 1QJU1 1AR71 3VBSB 2RS52 2HWC3 3VDDB 1RUE3 1COV1 4RHV3 2MEV3 1HRV1 2PLV3 4RR3C 4Q4W1 4PDWB 2WFF2 2RR12 4Q4X3 2WZR3 1RMU2 1NCQA 2HWB1 5C4WB 1VBD2 2ZZQA 2ZTNA 2XBO2 1BEV2 5J98B 3JB4C 4GH4B 4WM8C 3ZXAC 1K5MC 3JBG1 1VBE1 1NCQB 4GB32 3IDEA 3ZFEB 5AC92 2RM23 3NAPC 4Q4V3 4IV3A 2QQPA 4QPGC 1EAH3 4YVSA 1A6CA 1RUC1 1H8TA 4RFT0 4JGZA 1TMF3 1FMD2 1OOPA 3CJIB 2RS31 5DDJ1
chains in the Genus database with same CATH superfamily
1XF2B 1CQYA 2HWD1 4LSSH 1UU5A 4PR5B 2UUDK 2O8OA 1LEKB 2GUYA 2QPFA 1SBBA 4JAMA 2Y36H 5DK3A 4NN5C 1GHFH 3IBMA 2E63A 3P4LA 1R17A 3WD5A 3BODA 1T0OA 3LPFA 3ECWA 4H8VA 5EO9B 3REWB 3V4UH 5GSVB 5IK8A 4XHQA 5C70A 1IAIH 1N19A 2WZPD 2K9UA 1XH1A 1WAPA 2B1HL 2H6PA 2OZNA 1UD2A 4NENB 4EJ1C 1JNNL 3BVTA 3WIHH 1CJYA 1QA9B 3KVDD 5D7IB 3WNJA 4XJZA 3CDCA 3SPGA 5LQBH 1UY1A 4X8NA 2YAOA 1HAUA 1PY9A 2V5YA 2GC4C 2P8MB 2AHIA 4KMTH 1FVEA 4FQJL 1QATA 4TNGA 4PF1A 1JPTH 4UNIA 1NA1C 3VBSC 5BV7H 5D7LD 3ZO9A 4FYQA 3VDDC 3QIBA 4FQLL 5E2UL 3SE4A 3BZEB 1T0MA 4YZ4A 3DX6B 1BOGA 3QB7C 1A3RL 4R90H 4PFEA 2OZ6A 1M9SA 1E5HA 4JFHE 2J1UA 4GSRA 3HS0C 1C8QA 5KN5B 4XDOA 4L1TA 1DUZB 4JZJB 4S0SD 1YJDH 2QVFB 3D12B 1YEHL 2EE3A 4D9RD 1G5GA 2CUAA 1OM9A 1MVUB 3HIFA 3B9KA 1J12A 5AAPA 2VUCA 1DEEA 3QNXA 3GS7A 2XFXB 4IEQA 4RHV2 5C0CB 4Z0XB 3HCVB 1AXYA 1FHNA 3N1GC 3AXLB 2CG9X 1RMU1 1KYFA 5E2JA 2CL2A 2FQFA 1EHLL 4HJ0C 4WM8A 1LMIA 2OV0A 4TSBH 4RMSA 4ORZC 2UVFA 3TNMB 2GK0B 4AEIH 1DUYB 4WHTA 4BHUA 2UYAA 4YO0A 1ZM1A 4P2RE 2DWXA 3VWJA 1CXHA 2J72A 1EZUA 1JWUB 4WO4B 2IV8A 2YEQA 4D0BB 5DXWA 2E9IA 5LGHH 2MHAA 4WK4B 4YGVB 1LO5A 5EFUA 1JWMA 3OHXA 1HL8A 3VFWA 2EIEA 3B7YA 2VQTA 4PJAF 1VGKA 4HV8A 4PWKA 1F41A 5FMOS 5LXGL 5SWSB 3B7RL 1PZDA 1VACA 5LAXA 3IKCB 2RS11 4BXFA 1YPZE 1OPOA 1KB3A 2ZQKA 2AC1A 3ALXA 4IU2A 2FX7L 3EFDL 1M56B 2Y6TE 5HHXH 4KJPC 1G43A 2R0ZL 2VKXA 2I74A 3ARWA 2XKNA 4K21A 4RZKA 3PLQA 5CU5A 3WFEL 1L7RA 4K3GA 4TVPL 3PJSB 4LHNA 5LWBA 2D9QB 2YXFA 1PGW2 3IGLA 1QD0A 4YW3A 4JMXA 2NQYA 3AKTA 2UV3A 5LNEA 3TEZA 5GGVH 4KY2A 4BGLA 3T4AC 1CFSB 1C5BL 2OCJA 3I02A 3PDGA 3BAWA 2BS9A 3UG4A 2WIIA 3LPOA 4ONHB 5E4OA 1WCSA 3GMLA 4H2CA 1G8WA 1EJ8A 1NX9A 2RVAA 4JZJC 4U1LA 4QY8B 2JCCA 3G04A 3MLTA 4L0ZA 1GGBL 2R2HA 3K80A 1WHOA 2DD8H 1BYOA 4Y16B 1E5RA 3J7MA 4LEOA 1IEBB 4ZUUB 1I85C 1J9CT 3HHRB 3DBSA 3ULUC 2MQGA 2P3KA 1HHIA 2W87A 1WBFA 1IGCH 5C3OA 3OUHA 3TPUA 4PTTB 4XMKH 3HBQA 1TTUA 3H0TB 3MLRH 1IGTB 1A7PL 1DVFC 3CLFL 4XMXA 1BD2A 4OLWL 5B1JC 1YUKB 1ZZCA 5I5IA 4H8QA 2CSPA 5CZXD 2NY1B 3QQDB 2PYED 3PGDA 4JFSA 2EDLA 2XN1A 5GGUB 2YZ4A 5A7SA 4WO4C 3VFOA 4XRCA 2DU1A 4PJCF 4KQ4L 4M3HA 5JOXA 3K74B 5FREA 3SYCA 4K1ZA 2ZXBA 2G4GA 4L9LB 1O3RA 4NDMB 3VFGH 3SBWC 1IGML 5BQ7A 3D2UB 1WT5A 4AQZA 1EGJA 1A65A 1UGNA 1DLHA 1OUXA 2AREA 2HVBA 2YGNA 3SYAA 4JFEA 5KG9B 3DXAD 1FPN2 1KQRA 2DKMA 3KAAA 3CL1A 3NCJH 3UG3A 3ACIA 3GRWL 3P3SA 5JXAH 1ZNPA 1BLIA 2UX6A 3HT1A 4M93B 4MKMA 3D3VB 4FNQA 1NAMH 1YFYA 3QULB 2X4OB 4FNSA 3O9WA 2WJSA 4A1RA 5EUKB 5D7KE 3BP4A 2EKSB 3EYUL 4I4WB 5KBDA 5DHEA 4HH8A 5KWYC 1M6UA 2DBJA 4HFSA 2YPVA 4D2NA 2VC2B 3FT3A 3INUL 5DYOA 3CSBA 4BFRA 3EH1A 2J1YA 5T3XD 2RTTA 5EF2A 1DN0A 3GI8H 4XBGB 1FYTE 5A7QA 3Q7JA 1J0JA 3POFA 1WWBX 2G3XA 4ZOAA 5H35A 4JQRA 1MW1A 1AYN3 1Z0MA 4NUGH 4OQTL 1NANH 3DX4A 3I74A 3FSZA 4Y16C 2VLRE 3HOGA 1IQWH 1NCQC 1VSCA 3WV0A 3LZOA 1NIEA 2C9XA 4NVPA 3K7UA 1Q9WB 2MSPA 2NY3D 3U0PA 1FGNH 3JWOC 5HTSA 4HKXA 2IVFC 1ZMYA 2OTWA 3TJEH 4DTGL 5L0QB 1GTFA 1YG9A 3HG1A 3D4KA 4QHMA 3U7YL 4LDOB 1G1CA 3VCLB 4YNYB 5JUEH 3TWYA 1DZ0A 1ZS2A 4LOFA 4QRUB 4BCZA 2Y38A 3CBNA 4C4BA 3J4UH 4BJ0A 4XOEA 1WD4A 5C07A 3VKNA 1SEBA 2VM4A 4C83A 1F4AA 4OZIF 3MBEA 1KOAA 2QR0B 5JPNC 3ARDC 4LK6A 3K5SA 5B7MA 3TF4A 1KT2A 4OD1L 5BXFA 2RS32 3C87A 1R1A1 4JR9H 1QSEE 1G7QB 3E1ZA 4ICXA 1OOPC 1FZMB 8CGTA 2KL6A 2VDLB 1NGYA 3CN4A 4EWEA 4X6FA 3WY2A 2X3BA 4HKLA 1GS6X 1TG8A 5IOPA 1NT0A 1WFJA 5DUPL 4Y5VC 1MCCA 5ETUA 2WYFA 3QJRB 1U8JA 4AQ6A 3LVEA 3ACGA 5LA0A 1WA2X 2D2OA 3OV6A 1GMIA 4FNPA 3OSKA 2HBUA 1Y6MR 1W04A 4Q4W3 4DGYH 3APMA 1YYMH 4YEEA 4M93C 1KBKA 3U2SA 3F58H 3I6KB 2GH8A 3UACA 3MX0A 3BEVB 3RLSA 1FH5L 1WAAF 3TO4D 3HC4L 3HWJA 4OIIL 1AACA 2PPAA 2AXFA 2B42B 1P5UC 1ZIBA 4JPWL 4OGXH 1F3JB 3C6LC 3QZOA 4PRIA 4E42A 1UPSA 3WX5A 2OIIA 2J8HA 2R0WL 4ZS3A 4PVLA 2LFGA 1PAMA 4LRNL 4OCLC 5IG7B 3BYWA 4NQDD 3BCWA 1FUNA 1A5FL 4HS8L 2H6CA 5C5UA 3MU3A 3GJEA 4G8FA 5F1SA 1WW6A 1C8PA 1W2AX 1WO2A 5B2GB 4HWEH 1NCUA 1CIYA 3M3IA 1FPTL 4BH8A 3H3KA 1UNBA 3DGGB 3ASIA 5I5MA 1IAKB 4IOIB 4MAUH 4EDXB 3NIFF 2HWD3 1ORSB 2IDUA 1A2YA 3D69B 4A7GA 5I76A 1EY2A 1PZ7A 1ROWA 3HAEA 4JDVA 3JWDC 1LHVA 2A38A 4MLIA 4MNQD 1M4WA 5KHIA 1WSST 5DMIH 1IBGL 4P9JA 3H9SB 3QI9D 3K8MA 2Y3AA 5FO9A 4TYSA 1T6WA 3W0WA 2G9ZA 3UIZA 3O45B 4YHLH 4ZXBC 3W82A 4XPTL 1N26A 2YBRB 2I45A 5TTRA 4PJ7E 3ZYIB 2OCFD 4AQ1B 4OZGA 1OD9A 4YG6A 4I18B 4QGMA 5E2VH 1XEDA 5SV3A 3T1MA 3VHPA 1XSOA 4UQ2B 1AHWA 1SNRA 5CADA 2P5ED 2QMJA 2YPLA 4WI5A 4LOSA 1MVFA 3I6SA 1UENA 5KUMA 4CE8A 4AM0A 3M1CA 3LQAL 4R97C 4LFHG 4U6HA 4UZUA 2VWEC 1Z9SB 3JV6B 4WW2A 3RL1B 2Y34A 5CIPB 4WEUD 4MFHA 1XQNA 4ENED 5F3GA 5FEBA 4C0HA 3N91A 3OKOB 2NTFA 1I9IH 1UJ3B 2OMWA 3WDXA 4JCKA 2FLMA 2X88A 2GITB 1XIWD 2R8SH 5SX5K 2WVVA 4GMTH 3CBJB 1POV1 4HZFA 5JIQA 1YNAA 2ATAA 1R3JB 1A3KA 2VQ1A 4EIZC 4KV5E 3WFDH 4DP9X 2BDRA 4TTDC 3ZYGA 2VZ3A 2EYRA 3L2NA 4R5VA 2WUBH 3HKFA 4XPAH 4RN5A 3D09A 2L4OA 3OPUA 2GY7B 3FB6A 4OF6A 5DMGD 2C5DA 4HOZA 2G9FA 2IVIB 3QHTC 1U8NB 1DQML 4D7YA 3BGAA 3VVVA 2NRDA 2VMGA 1RMU3 3LV3B 1IM3B 4JRWA 3VD2A 4QKFA 3L1GA 5A1FA 1AR81 4CCDA 3SGJA 1JTZX 1K72A 4U1NA 2ESVA 2RD0A 1ZT1B 4HAKA 3VFUB 1UVQB 1WA0X 4W68A 1ZA7A 3AT0A 5IIEA 3H9HA 2XJRA 1W0YT 1RMFH 4G6KH 4RSYA 3ZE0F 2R29H 4XMPH 1H3WM 1JF5A 4WHYG 4E2OA 1YEEH 4HJGB 4GLRH 4MQTB 1BVLA 3Q3GA 3F6JA 1OP9A 4N5EC 5F71A 2E7DA 3FH8A 1W2UA 1CDCA 4S1QL 1GZTA 3OD4A 5K0UA 1CBVH 2CGRL 3HR5A 5C0ND 5JMRA 1JGDB 2BVOB 2ZT9C 3RHWF 2KZWA 1WZ1H 3ZR6A 2WB1A 1UMIA 4LXLA 2RS13 4XAKE 3JZVA 4OCMC 1HQRA 4P48A 5DDJ2 5DHDA 1N8OE 1SLUA 3T65A 1V9U2 3RZMA 4XZUA 4WEEA 1ZA6B 1U2HA 4ZW5A 1YRZA 4GQRA 4I18C 4ZUVA 1MZ5A 4Y2DB 4MS6A 4IIQC 4U31A 1A4KA 3BVCA 2VDKL 2YD3A 3V0IA 4AJWA 2CLZB 1JUFB 5KW9L 4QT5B 1UM6L 2RE9A 3ZOAA 4A2GA 3C12A 4CCKA 4QTIH 5BNOB 4TNVK 3NJXA 4QGYA 1XGUA 2R0HA 1Y6NR 2FD6L 3LEMA 3KPSA 1FJ1B 4EIUA 4APQD 1AJ7L 1K85A 3B9DA 3I2OA 5T1MA 1AGCB 3Q2LA 2WYHA 5C9JA 2C1OA 2D93A 3O8XB 5E6HA 4EO5A 4NZ8A 5K1VA 5GPRA 1B4JH 3RGVB 4A38A 1HRI3 3BAKA 2WXQA 2ADJB 3QPXL 2VSDA 3BPNB 3L95B 4PJGE 4HS3B 3MA7B 3U9PL 3WG4A 1T0PB 4E9KA 5HYSA 3K6FA 4IK7A 1P1ZB 2CBOA 2JCCF 1FL6A 4FC3E 3D3AA 3BP5A 1P8JA 2WXFA 4TUOB 3LH2H 3O4LB 4UTAA 3OD3A 4PBDA 3VKMA 2KMWA 4GRWF 5FECA 5KXDA 1LXMA 1FFNA 4W70A 1UL9A 4KMQA 1RIHL 4U4IA 3ZIYA 2PHWA 3U6XS 1GCYA 1S7TB 1YEGH 4S11A 2BHZA 5B38B 2YYOA 3OMZA 5KS9B 1NBQA 4S0TD 4XFBA 3L81A 3QGVA 3Q43A 1AZVA 4H88L 5AW1B 5JIMA 1JBJA 3HN1A 3ITQA 2R56H 4R9DA 3KVPA 5EBGA 4GXLA 5FZKA 1Z6JT 4G8GD 1Q3EA 3X3FH 3C08H 4TUUA 4F9LC 1GWLA 4XAWL 3VI3A 4PLNC 2V5RA 4ODWB 3PWPE 1AANA 4X7SH 4KWJA 1FSKC 5F7UA 4S2FA 1SJHA 4EQVA 1GQHA 2CNAA 5FFOA 3JBG1 2Y6SD 4XMLL 1F58H 4KG8A 3WEAA 2R4RL 5I82A 1EZVX 3VXRD 3FRPB 5DVPA 3QACA 3PURA 1V6IA 3F04A 5HDBE 5TE7H 2JJVA 3IKKA 3EJYC 1UGKA 1PNDA 5CZKA 5F3HB 1KTKE 3T0EB 3UAFA 1HEJC 1FA4A 5FWEA 3F64A 2D7OA 3T0VA 4TRPL 2QQPA 1FDLH 2OTPA 1CD1A 2OULB 2DQUL 3SHSA 3NJZA 5CR1A 2NY0D 2WNUA 4MQXC 4IHBA 1RY7B 1A9EA 4LO8A 4OVVA 4EWAA 3NP3A 2BGOA 4PGDB 2NOYA 5AOKA 1POQA 4LB8A 1EA9C 3RWGA 3NEXA 5JPMB 4AFBA 2BW5A 2D3NA 1AYM2 1CAVA 3NV2A 1FNSL 1CE1H 3B8SA 5C3TA 4YVWA 5F6HJ 2WB7A 5I8CB 4S1RL 4NHCH 2ZCLH 5F7DA 3OUIA 1JHLL 2AABH 5FIEA 3BQUC 4MCYB 3UJIL 2WSPA 3FHQA 3RGVC 3U25A 4YQXH 3WDIA 5D9SB 3AFLA 3HFFA 5K39B 2HPTA 2DH3A 2X09A 1SGKA 4J3OH 4BUGA 5C86A 5D1IA 3ZX7A 2W0FA 3BPNC 3EH5B 5I1JL 4NZDA 2FO4A 3VTMA 5EMYA 4FXKB 3CC1A 1BLNB 1VIWB 5TQ0L 1RUAH 3NGBB 5DD3L 1YFWA 3CSYB 1XBDA 3UTTE 3M17A 2EDXA 3CJIB 1OXCA 4NZTH 2DWYA 4KFZC 2G3ZA 3H4HA 4LAJH 4TQHA 3RBGA 3BIBX 3GALA 3I9GL 1VA9A 5F3EA 4G42B 4Y4KD 4EIGB 1L7IH 3ARFD 1AR1B 1KITA 1JI2A 4P2AA 4N0UB 4KRPB 1RZKC 1W0WB 4UQEA 4XJWA 1PFOA 2XN9B 2DMGA 1FOD2 1H5BA 1MCOH 2XB6C 1EV2E 3BUCA 4OFYA 4LO5B 3NACH 3GBLA 2H26A 4TNFA 1ZLVK 2FQPA 4P5TD 1W99A 1R1A3 4JDEB 2BGCA 2E4FA 4OIFA 2AXGA 3WZ1A 3M1HA 1TCRA 3LA7A 1F5FA 4PQ9A 4PWGA 3TJPA 4MG2A 3K8LA 4LLDA 5FY8A 2ENRA 3JXSA 3P4NA 2G4EA 3BWAA 2EALA 1IKNC 1OAKH 1HJGA 1AG0A 2WNXA 3L9RB 1BX2A 4Y19B 3BESR 1KRIA 4O61A 4JRYE 1BEXA 1C12B 4CDQB 5AVTB 2DYPA 1OQXA 5JMOC 1HCZA 3Q0HA 1K6QH 2A6DA 5JPMC 2DVFA 3QEUA 1CGPA 4F8AA 3OX8B 3EH3B 2BV4A 1NUFA 3LZFH 2KQMA 1GV9A 3FHAA 4Z7OB 2CQVA 4L0PB 4COYA 1PLCA 5TQ2L 2WM0A 2RH0A 1MRDH 4F20A 2JKNA 1HXS1 1LMKA 3IFOA 1EAPB 4QDRA 1WKYA 1U8KA 5HI3D 5FYIA 3GHEH 2GNMA 4CN6A 5A32B 2FCVA 1UZZA 1LO4H 3QOPA 1QJX2 5A1AA 1F4WL 4CDXB 1INEL 1T03H 2VIRB 1FE8H 1HZHL 3CJXA 5A3OA 3QBQA 1HH6A 5EG6C 1ASJ1 3VYOA 1C5IA 3NIGF 5E8OA 5ICYA 1JNHB 3ES4A 2BCKB 1C57A 2D3VA 3IJ7A 3BJLA 4NRQA 1FNAA 1A3LH 4A7GF 1DQ6A 2FMDA 1XAKA 1OAQH 2TRYA 1W9FA 1A9BB 2NY4B 5BS0E 2WN3A 4GSQA 4HXAL 3GI9H 4KXAA 2VR9A 1MEC2 3P5BA 3KHCA 5A1LA 4CSSA 3EOAA 3JV5A 3QEHB 3RWHB 4N8CH 4GMSL 2ORZA 2JXAA 3LKNA 1NGPL 2HTKD 3FOMA 3LKPA 4GY4A 4DO6A 2DCKA 3J8F7 2XA8H 3JD71 3OB8A 2A3XA 4JRFA 3POHA 1NMBL 3SKJE 5ESQA 5A6QA 2ZPKL 4I02A 2QGEA 1OARL 3I75B 3IMWA 4LULA 3LY6A 1DQKA 3WIHA 2ZGTA 5JI9A 4LT7A 4JM2A 5IHLB 2AJ3A 2CZNA 4X5RA 4MDIB 1GP6A 1RVFH 3AKRA 2VAAB 3CIHA 4UQ9A 4PJBB 3BZ5A 4L4TD 1AO7A 3QJFB 4TUKH 1YECL 4WW2F 2VC9A 3OJDB 1SN2A 1FX5A 2GBAA 4OJDH 4P2OC 3MXWH 3S97C 3TA3C 4WK0B 1KFUL 2WBJC 3FOLA 1M9WA 4IV3B 2ORBH 1POV3 4CDQC 2W9XA 4XPFH 5IF0A 4Y4HB 1WD3A 2E3VA 4XVJH 4GO6B 5GGRA 2O30A 3FFCB 5FHAH 3GTTA 4KMLB 1UYWH 1CAXB 4OQ8A 1WGOA 5KJRH 4OI8A 1RHI2 3LQZB 2LE9A 3DF0A 5SX4H 2PELA 3VL9A 1JFQL 3O6KL 2EE9A 1KULA 3FTSA 1ZLWK 1M42A 2OXHA 3QIWB 3T0WA 4XPBL 2UY6A 2H0BA 4CCJA 1W9YA 3HBPA 3CXDL 5JHLH 2HKHH 4G4FA 1BZ7A 3LEKA 3WUWA 3AQXA 4HQQH 4K7PX 3D33A 2IFWA 4CPBD 1FORH 4FERA 5J3HC 5HD8D 3BPCA 4CDXC 1XZWA 2Z31B 2ZEZA 2XQBH 1DR9A 2VDNL 3EYQC 3RNQB 4ZFOA 2D4DA 3KPNA 4L3ED 1YI7A 3I50L 1DJXA 1KV3A 3EBIA 4F7PB 1XF4B 3QZWB 1QKZH 2YPKB 4XP4L 5IQOA 4LEJA 4DUWA 5H2BB 2AQ1A 3CIQA 2DQHL 2XXCB 3PUHA 5I1IH 3NNFA 3WSOA 1W28A 1QFOA 2RS51 1OP3K 4F24A 3HPNA 3PJLA 1CZVA 5INDA 3V0VA 1ZEAH 2O6FA 5I8KH 1IE5A 2HWB2 2JQMA 1L0YA 4LP5A 4YHZH 1L4IA 4QQHA 4NP4L 1NFDB 3T77B 3ULVF 3RVTC 2LU4A 1IKFL 2DQDL 3NIDF 3H9AA 1SJVA 4XXWA 4ZS6C 5EUOB 4ES8A 4BOWA 5IMMA 3HC0A 4D9QE 2YD6A 5J6HA 4LKXA 2JKLA 3MRDA 5HY9A 3SQOL 3DRQB 3FU7A 4EZLA 4XFIA 1VESA 1KB5H 4IKJA 4A7SA 5IMKB 3OKKB 4XP5L 5BYNA 5IEKB 4WWPA 4FXGB 4F27A 3QH3B 1OFSA 2FEEI 5KVMC 4MHHG 3UGHA 5T1LD 4DPAX 4IRJC 4P4KC 4LOVA 4L8DA 2JENA 1OMIA 2ADYA 4XJ9A 3NRFA 4N24A 4DXSA 1O6SB 2E86A 1LGNA 1UCXA 1SFYA 3LNEA 4QRFA 3CVHL 2JF1A 4JZNB 4PGCA 5DR5L 4JDMA 5FWJA 5IQ9A 1JXFA 4K8FA 1AH1A 5ITFA 1WBXA 3WF1A 3RZKA 2YD0A 3ARBD 3ORJA 4AUUA 2IOIA 1NE4A 4DCQA 1SZNA 3OMNB 1R3KA 4PV9A 5GS0C 5EZWA 3BKCL 4DGVH 1I9JL 2MKLC 3IT8A 3QIWC 3O14A 3RS6A 1QOOA 3P77B 1P7BA 1VEOA 3DOHA 5INCA 2E6VA 1Q9LB 5EJ1B 2H1LM 4MNHB 1AE6L 3OLDA 1THCA 3SKJH 2VM9A 1XGRA 3SITA 1JW6A 2IZWA 1W0VA 2QGCA 5MEQA 3BE1H 4FZEH 4H0LC 2FBJL 3NQKA 4MCNA 3B2UC 3FO9B 1VZIA 2XZZA 1GW6A 1MNUL 5ANME 4LBQA 3QISA 2CBPA 3IPVA 2Z31C 1AD9B 1DN2A 3WDHA 3ZXGA 5C9AC 3FQWB 3S35L 3GF8A 1NCAL 1QFUL 3PIQA 4JC1A 1YC8A 4YLQT 4AL8L 5C9KA 4QI3A 2BSTB 2CDGA 3WELA 4MGYE 1ICTA 1QLEH 4K3JH 4WI3A 3VQMA 1HAWA 1T21B 4DKTA 2J4WL 1RUF1 5C0EB 3TEXA 3DX7A 2UZXB 4NQTA 4AQ8C 1HZKA 5HGDA 4MWFA 1RP9A 3TVMA 3UJQA 2OP4H 1S0JA 2D40A 5CB7A 4MGIE 3KJ6L 3OZ9H 3BSZH 5T1KB 3MO4A 1M06G 1U12A 4FPGA 1ZA4A 4BIFA 1UD4A 4WJ5A 4Z7WB 2EA7A 4OLEA 1G9CA 1JDCA 4LORA 1UWFA 3G6JE 5C09E 3RA7L 1BEYH 1NAMA 3CZLA 3FF8A 4KU7A 5G05L 5T54A 1HNGA 2IALB 2GJ6B 2OCCB 1RUE1 2MEV1 4FMKA 1IM9D 3DBXA 1CXKA 4OSUH 3MRPA 4FXGC 3DURA 2CKNA 3BYTA 2VDRH 3NG5A 2YD2A 2HB0A 1KJMA 4AOCA 1D2OA 3BUPA 1KZYA 5TE6H 4P2RA 1AX1A 4TNWF 1ZT7A 3DXTA 3BWZA 3KVQA 1ESOA 2HJKB 1D7FA 3EDKA 2WZ6A 2KERA 2MCG1 3NSCA 1JPGB 5I18L 2A5ZA 3L6FB 5BUVA 3FH5A 2WNGA 2CJUL 1RK0B 2YFNA 4NPJA 5FO8B 3EYPA 1COBA 2NZIA 4E41D 2Z91A 3JB8A 1H30A 1QP1A 4ESKA 2GN7A 3CF6E 3WAJA 5CEYB 3UC0L 1VJSA 1YPZA 1EAH1 2ZACA 3PWUA 5DMKA 5BNPB 3PP3H 1Y18B 4OM1H 2JWPA 1GZPB 3RTQD 3ZPYA 3VBHA 4M3JA 1DQQA 5CJBA 3SE6A 2VCMA 1O7DC 4OZHA 1IEAA 3QJSB 3CFJB 3BTAA 3MIBA 5GJ6A 3VBFB 2IH3B 1OF3A 1XSKA 4Q97A 2F54E 3N35A 1G9BA 4Y7OC 4HCGA 2V9UA 4UOW1 3X12A 4WVVA 3WVJA 3NBNA 4Q5OA 3ZYBA 2YC1B 5EO1A 3WF4A 3WN5B 3FCSA 3FYIB 1U5XA 1Y1UA 1YEIH 2C4FT 4L18A 2WD0A 3ARZA 4A4AA 5K33A 1S5HA 3CK0L 2W52A 5TD4A 4AENA 4ZMTA 1I6XA 2K8QA 5CP3H 3ZSSA 4CMHC 4JEGB 4XO9A 4NQED 2YPVL 5GZND 2ZAGA 3BLBA 3S5ZA 2FSDA 2OBGA 4A42A 1K3IA 2V17H 2A9AA 2X4NB 3KCPB 4X6BB 3WY1A 1Q8QA 5CEXA 3TJHC 1XH3B 4CC1A 4Z7QB 5FR3A 4JV4A 5A7NA 3WDYA 2HT4C 4CILA 5L88L 1OGAD 4P9HC 4HUWA 3FJSA 2VW4A 3GZTB 3GSWA 1WUZA 1E6OH 2JK5B 2X38A 4L05A 5F7LB 3SKOA 4EBQL 4Z3IA 3DV4B 3FQXA 4G8EA 8PAZA 5IESH 4X4ZA 1T0NA 1UWXH 4XTRC 5BRPA 2DL2A 3RUGF 1KXTA 2WGNB 4PRPB 3WS6A 4BFIB 5EIIB 3VLBB 2A83B 3Q9OA 2VSKB 2AZUA 1I8IB 2ICWA 4JCLA 5DGRA 2EDWA 4N2FA 2Y1YA 2YXMA 1FNGB 1GR3A 1A6WH 4NNYB 1A8JH 4N0RA 3Q5OA 1Z5LB 2IPKB 3MRLB 4QXGL 4Y7MA 1HXS3 2DUPA 5CSZA 5DJCA 4QPIC 1PYWB 3MC0A 1IKQA 3KE0A 4QF1B 1KGJA 3TTSA 1CLVA 4LKCB 1ACCA 1NL0L 1PX3A 3VU2A 5A16A 1S9WA 3WG2A 1U93B 4AVJA 1SJEB 2DVGA 4P9MH 1FCGA 2DV9A 1AXIB 1IFGA 3FONA 2VNVA 2X4UB 5DD6B 5JXGA 5BNPC 4F7TB 4Z7UE 1VBB2 3WENA 2HJFA 4Z78B 3DVGA 5CFCA 2XYBA 3ZYFA 1QLFA 4O58H 4A6YB 2FHRA 4BFEA 2NT1A 2HMID 1LP9E 1CYWA 4XXDA 3OUJA 4YJZL 3AG3B 4APXB 1RK7A 4LL1A 3MRBB 5D6CB 1A14H 4WK2B 3TFKD 4CUAA 2HVKB 5DJZB 2WKLA 3JD73 1WMFA 3CD4A 4LKEA 3TB0A 1PD0A 3QNYA 3VD9A 1FVCB 3WN5C 3WKML 3EUDA 3QQ9D 1TTGA 1XSJA 3HLKA 2B4CH 3NZ8B 3LXUX 2W60B 3OKDB 4YSUA 1G7IB 1N3NA 4POUB 1DSWA 4B29A 2FBOJ 4NHXA 3MLZL 3D0JA 1X6LA 4YR6A 5C6WH 5F1RA 2DEYX 4P07A 2ZXEB 1XZ0B 1X7SA 4Z3EA 4QDGA 4DGWC 2VLRA 2J7MA 3B7MA 3IGAB 2ZP9A 2ZYIA 4OGYL 1J58A 3HPJA 4HVOA 4OGAD 1RUPH 5FY4A 2WUCH 1X5KA 1RU9H 1Q1JL 1MRCL 3CZGA 1U0AA 2P45B 3NNLA 4JTNA 1UD1A 4KY1L 3PWJB 1DJSA 3C09B 4LLOA 3AG1B 5LBEA 1UMHA 5DUML 3MROB 2JKJA 4IQHA 4P5KB 4P5RA 4Y1UA 3T2TA 2FCBA 3VXUA 3IPFA 1HXYA 1DCLA 4GB32 4MA7H 2GSGA 4R3SA 5HI0A 3KXFD 5TH2B 1PLBA 1UQSB 3CU1A 3WE1A 3QNZB 3IDIB 4FFZL 4XN4A 5F89A 3THMH 3L13A 3ZT7A 2B45X 2YKLH 2V2WB 3C3VA 2ZWZA 3NZHH 3IB3A 2D03H 4FLRA 4KI5F 4JK0D 3TEYA 4QT6A 1OCOB 3P9MA 1RUC1 2F74A 4XHBA 2N0KA 3N40P 4X9HA 1M3JA 3ABKB 1ZRIA 4JJ5B 2GP5A 3ZN4A 2YGVA 4GAJH 2DQGL 4X4KA 2R29A 4I48A 1KTDA 4YSDA 4GAAA 5IB5B 5IJBC 1XF3A 1WC7A 1UXSB 5SWZA 3KCWA 2OW4A 4FFWD 2Y5EA 1D6VL 4B9PA 1RJ7A 2A9BA 3FC8A 4L8SB 5CKAA 4QCIB 4TOYH 4ZMLA 4BFOA 2VQUA 4N2BA 1OCZB 1G0DA 1ZVSA 4G9FB 4NQVB 2QKIA 4Z3JA 4G7RB 4RFOH 4X98A 3GIVB 3QG7L 3UEQA 3R0NA 4HFUH 4F37K 5FGSA 3ARUA 2F61A 5B7FA 4C58B 4DFSA 2QEJA 2A9NL 4KHTH 3MTXA 2VLJE 2YWZA 3TYFA 3ZE1E 1LOFA 2BNRD 5G4NA 1PIV3 1FH2A 3FFDB 4LQFH 5D1ZA 4U6VH 3ZDYE 1NY72 2IAMD 4PYGA 4RFEA 1N2RA 2XJSA 2JDZA 1ULFA 1QJY1 2AZ5A 3ECBB 3F7VA 3ILQD 4FPJA 2Z8WC 5AB2A 1ZS8A 5FZOA 2ALWA 4XMWA 4ZX6A 3MRMA 1YEDB 3L3OA 5EZOH 3A0NA 2FDFA 4HIIB 4A04A 1WCKA 1FL3A 4B7LA 3IRCA 3II1A 3W9DB 3AAZA 3T4YB 3L3GA 2W95A 2DV6A 5ACLA 5IJRA 3DMMA 1OAYH 2IDTA 4LEXL 1PTZA 4XC1L 1BYPA 3O1OA 2GIYA 3LNIA 3C09C 4Z7NF 4XQ4A 4JO5A 2BNQB 3L4UA 4LVOC 1ADQH 1P4UA 3C9NA 4PJ8D 1VFMA 3GSNL 2XMLA 5FYYA 5L6YH 3SPHA 3VWKA 4YSFA 2CRYA 3BMVA 4EZMA 2PXJA 3AWGA 4UV4H 1ND3A 4YOKA 3W2DL 2X6AA 3IDNA 3SGEI 4H3WA 4KHXH 1REEA 2X4SB 5HPMB 4POZD 4PJ7A 3HE7D 3KL5A 1WZMA 2R071 1V55B 4MMYB 4IEOA 4WIQA 5BNNA 1VJ2A 4OYUA 1G9FA 4TWTA 3KBPA 3NSDA 1L6PA 4U2YA 3EJJX 5EU4B 3REVB 4TQIA 5E8NB 1T6GC 3CJIC 2YIHA 3Q01A 3JVGA 4LR4A 4MB3A 1N70A 3FRUA 3GB7B 3PPEA 2WFPA 1REIA 1B3IA 1DANT 2DKSA 5L8JB 2P80D 2XXGA 1W6MB 1TYEB 2Y6LA 1W2OA 1S0GA 3VD3A 2CRZA 1EV11 4IBLT 1N64H 1LD9A 2RB8A 3OC5A 4I85A 1OLLA 1W8NA 2J6WA 4A7VA 1GWMA 4P9YA 1GOGA 3AB0A 4UQAA 3I59B 3P0VH 1I7RA 4Y1AA 4JO2H 5C7XL 5GZCA 3BP6A 1EXUB 1TYJA 2IH8A 2APWA 1W9SA 5JIAA 4RETB 2NY3C 4KAQL 3G5XA 3UIYA 4DZGA 1XCXA 3K0YA 1HXKA 1WITA 2ICES 4N22A 5DRWA 3W1ZA 1X5YA 3BVVA 4MQ7A 5IFJA 3J27A 3HUJE 2F5BH 4MJ4A 4UW4A 1SHMA 1UATA 1G7HB 2L04A 3GBMH 5GS1B 4H25B 4J3SA 3T0AA 4E68A 1GL4B 4NQSA 4UTAL 1IT9L 2YN5A 4AYGA 4DW2L 4AQAB 5C8CB 3DPDA 1PO21 1FO0B 1IAIM 2AEQL 4XN8A 1WLHA 2BS71 3ATBA 4QYOB 5ITBH 2E0PA 1ENXA 3BN6A 1SOQA 3U9WA 1TU2B 3GMQA 1MS0A 1IMHC 2GUOB 4JNXA 5I8YA 3N36A 5JSOA 4BA8A 4OMDA 3TEUA 2H3NA 5FZ4A 2K4WA 3QWQB 1YQCA 3BH8A 1YY9D 5KVFE 1C8M2 1X5MA 1U8MB 3R06B 3QA3A 4X0NA 5J11B 5F3IA 1XD1A 2DLFH 2HX8A 3ZU8A 2NXYD 3RDTA 2YOAA 3T2LA 1J8HB 5KBKA 4GKLA 3TH4T 3B93A 4OZ4B 3GJAA 4M01A 4UM9A 1CD3G 5F0PB 1M05B 4NT6A 2EXYD 5FCUH 5FYZA 2ED9A 3FT4A 3LD8B 3ULUE 2UWAA 3MF6A 3FBMA 1J5DA 4YW5A 3HE6B 4HGMA 5DZPA 4S2SA 4V1DB 3U4BH 2J1WA 3HZKA 4I5BA 2WXGA 3QXDB 4H8WC 3Q6FA 1DQ5A 4CP2A 1PZAA 4AGLA 3APBA 3PTYA 3DPBA 3AS0A 2EECA 3AREA 1VHPA 4MMXB 4F1SA 5D8AC 4Z9KB 2OQJA 4OZHF 2E33A 3NW4A 3MLWL 3QUMB 5CD3A 2CJTA 3MREA 3MZTA 4EZJA 3K2UH 3PNWB 3HZMA 1KIUA 1BIIB 1LK2B 3GTNA 3NQIA 3DROB 4FQQA 4JB9H 4W9GC 5IB1B 4LCUB 1R5IB 3WDUA 1FLRL 3OKEB 3SN6N 3FNKA 5L19A 4JUSA 5D5MB 3TZVB 2BH0A 3LZNA 4I13B 4QRQB 4UIKL 5DZJA 1MS1A 4N4YB 3GMOB 3U48A 4R2GB 4U1KB 4PG2A 4RBPK 3PPSA 4PJGA 4Q4V1 1RUMH 2QV4A 2ZE0A 2OMTB 5IUSA 4CRPA 4J6RL 1HWGB 4LF3B 4ZYKA 3GXFA 3KPRB 4AEHL 3WNOA 3T0XA 2IQ9L 3AW5A 5HHOB 3C2AL 5GS1C 4MJIE 2Y5TB 1YNLH 1TVBB 1TFHA 3H3BC 1A1OB 2C9AA 1K8IB 3O1RA 4KTGA 1SEFA 5TGBA 2QSCH 4MDRA 5J36A 2OVUA 1N3QA 4HSCX 4LAQL 1YA5A 3PUCA 3ARPA 4JLRB 1COV2 3PTRB 1UWYA 3V0HA 1OT5A 4D3WA 2DTSA 2VD7A 1NCCL 3UFIA 2X70B 3MV9B 4ZZ8A 5DQJB 2OMNA 4M5YH 1MIEH 2QTWB 4ISVA 5DGQA 3QIUD 4XNMB 1E65A 2DCYA 1OSPL 5EU6D 4R8WH 5CS7A 1G7MA 1UACH 2QZQA 2VN7A 3HI5H 4ZKTB 5C0FB 2RHEA 4NGHH 1O6VA 1ZSDB 3TYJA 4GG6F 2FHCA 2FJGA 2JIXA 4PTUA 3WEOA 4ENEC 5L2JA 4JO3L 1K5MA 3MLSH 2XBO1 3TN91 1FV1B 1S7SB 3IMVA 3IDBB 3DX1A 3ZKND 4MSWB 3VMOA 5SWQB 4Q29A 3ZHKA 5I28A 4MMZC 4I30A 3FCTB 5DS1A 1U8OA 2PCPB 4WCYH 2PHFA 3CMOH 1DQLH 1A4BA 3WFCH 4K3DL 4MMXC 3MO1A 2X2YA 1VFAA 1PMIA 4NWTH 4X4YB 1MREL 3AXDA 3ZTNL 2JB6A 1UD8A 1AGEA 2ROYA 2WXPA 4IK6A 1UX7A 1Y7BA 4LSPH 3CCHB 4KRMB 4BSWA 2BW8A 4B96A 4KOBA 4PBVC 3RWCA 4RGOH 4DS0A 2NNFA 2ADFH 2R7EA 3N9PA 4IGBD 4Z92B 5D2LB 3LS5H 2XU9A 1MI5D 2IPTH 2W81C 2OX5A 3FJTA 3TZVC 4BFBD 1IE4A 2V7NA 5DWPA 5IT2L 3QLQA 5F9OL 4KVNL 2PUQT 4R2GC 4UV7L 3UGUA 1OLMA 1J9RA 4N85A 2F4LA 2X8KA 3VH8G 4HVQA 3M7AA 1RZFH 3OGRA 3WOGA 2XGXA 2VERN 4KVCL 3VFRB 2Y7NA 3S2CA 4IGOA 1BVZA 5F7KC 4W9ZA 2HFGL 4L1HA 3UTTA 5ISZD 4IBWA 4E5XA 5C0NC 3K51A 2E76C 3MLYL 1PGL2 4IOFC 1SZBA 4J23A 1JNJA 2NTSP 1T1XA 4M48H 2ZAHA 3ULUH 3SH4A 5IFAH 5HCAA 1UOWA 2X9YA 3V5HB 1U8HB 1AR93 1F6AA 2WXOA 2XN2A 3EOBA 5K59F 1AL21 2Y0IA 3WSQL 3HLAB 4XHJC 1LO3H 3LHPH 4LSSL 4M0NA 4WLCA 3R7QA 1W6OA 2Z7ZA 2Y36L 3H7JA 1VBA2 1GHFL 3KL3A 2OYPA 5IK4A 1E42A 3O6LH 5L4JA 1ETA1 1GSKA 2D4FA 3V4UL 2WXRA 1GIGH 2PCFB 3RG1C 4Y8DC 3QDJD 3TN0B 1WZAA 3VXMB 1IAIL 2DJ4A 2WYIA 4Y9GA 3A0KA 3SJVD 3SE3C 1K5NA 2IH9A 4W50A 4WNJA 1T80A 2Y22A 3IB4A 3M1BB 5AOMA 4CJ1A 5DUWA 3H7LA 5FF6B 2RIKA 4JMNA 5FO2A 3WIHL 4UFLA 1KG0A 3HZYB 4WGVB 4BIKA 4M3CF 2UUDH 1WZKA 4YW4A 5LQBL 4Q6KA 4C56D 3BPOB 3HAGA 2HUEA 1AQDA 7TAAA 2VO8A 4Q4X1 4NUQA 3FU9A 2P34A 4G43A 4YPJA 3WS3A 3B9VA 2A71A 3QRLA 4IGPA 4IJ3B 4FTVD 1NINA 3IMTA 1JPTL 2VLKE 4FKKA 4KTYA 3WO3B 5BV7L 3K71A 2VXVH 1X5FA 2OI9B 4P2QB 4RGMB 3FU0A 4UT6A 4MADA 1ZYBA 1P1VA 1S9YB 4WUUE 4R90L 3V0AB 4RRPM 2VCCA 4WSGA 1LEGA 2DWEB 4IE7A 4WM7C 1S9VB 1QJY3 1KIRA 1KPVA 1O91A 1HJFA 1MCHA 2R69H 1YJDL 5KYXA 3R05A 1LDSA 5GRVK 4PJDA 1LE9B 3WW1A 1N1TA 2R041 5DZFA 5F5CA 4WY7H 1X9PA 5I8EA 5TPWH 3SCFA 1ZRDA 5LGJB 2VWEE 4XO5A 3GKWH 1GCFA 4YZ1A 4DIXA 1L9PA 3U1XA 3VRJA 2CWRA 2PTUA 1N5AA 4V2BA 3EW3B 3UTSD 4CEWA 3Q2NA 1S7VB 3JWOH 2DURA 5J09A 4TSBL 3VE0B 4AEIL 1YY8A 1ZPUA 3K6DA 4ZMVA 1H8LA 5EPMA 1E7UA 1E5UI 4NI6A 4ZFOL 4XX1G 5CBAB 2B9BA 1Y0LA 1VBC2 1S0EA 5GSRA 4TLKA 2Z69A 1CVNA 2YQ3A 5BS0A 4M6NH 4HPKB 3O1VA 2VLLA 5LGHL 4QKDA 4O00A 2NY0C 2XXFA 4FQCH 2JJTA 1XWVA 4HK8A 2ATPA 4N6QA 1L9MA 5AFBA 1SYVB 5KAQG 1DVZA 4XABA 1HEHC 1JD7A 3N7MA 3RNKA 1MY5A 2WOYA 1DL7H 3TN0C 3ZR5A 3VBRC 5DFVD 3ZL2A 2XDHA 3IVKA 4J1WA 4R0LA 5HHXL 4XVUD 1T1WB 2ZUQC 3K2MC 3ZW3A 3MPBA 1I1EA 4IBVA 2BM3A 2EDQA 3OR7B 3SDDB 1UZ8A 3QDAA 5C0BD 4R4ND 5AVSB 5E94B 1X4YA 4B5EA 1NDMB 3UYPB 4IJ3C 5CJ8A 1JH5A 4YDNA 1CFNB 1P2CA 2VZSA 5GGVL 5AW4B 2OI9C 3FN0H 2PO6A 4RGMC 1C1EH 5FIXA 4HGKC 4PJHA 4EI5B 3L5JA 5F7YC 5GGSY 5IFPA 2XPZA 4QTHA 4NBZB 3PQYA 2QVKA 3WIFA 4X2UA 3H55A 4KROB 4PRHD 3BSZA 3WINE 1B6UA 4ZHNA 4I1NB 4Y4KC 2Q8AH 2EDRA 1KIQB 3ARFC 2QSVA 3WXWH 4PJ9B 1AMXA 4ONOA 2DD8L 3APDA 5ACA2 15C8H 2O6PA 5KSBE 4DZ8A 4HS6B 1CN4A 5BV6A 2V2TB 2VDOB 3V8CA 4BELD 3MJ9A 1M6OA 1E5IA 2R0KH 1PO23 4S2HA 4Y4FB 4YX2H 2BIOA 4JFYA 3SGDH 2QCSB 4BA6A 4P5TC 3ZZQA 1V8HA 5ACZB 2J8UB 2A5UA 1IGCL 2B1OA 1T22B 3GBNH 1FFQA 1CAUB 2E9JA 4KDTC 1HYRC 4XMKL 2NZ1A 3MLRL 3U9UB 2M8XA 4JPVH 1C1FA 2F7QA 4EJRA 2YUWA 3JWDH 5CLWA 4ODXA 3MFFB 1I3VA 3G5VA 1IARB 1KJVB 3PNRB 3F7KA 5C3SA 2AQSA 5DRXA 1A6VH 5LAPA 1JGUH 1UA3A 5HDRA 1MS4A 4M7LT 3S34L 4JQTA 2P46B 3MLUH 4WTWA 2XV2A 3MLPA 3VFGL 1TNMA 1BVKB 1V6MA 3P6BA 4G72B 1U33A 2QMKA 4J3VA 1QI4A 3VZKA 1UPIA 2Y0SA 3QJOA 5IP4A 2EYTA 5D93B 3NCJL 1W6PB 4QB2A 5FK9A 3S2AA 2BP8B 5EU3A 5CU1A 5JXAL 3KF3A 1D6EA 3CHRA 5G04L 5E0QA 1NAML 3SDDC 4EN2A 3PLYA 1XR9B 4HH9A 5EWIH 1A8MA 2QQQA 3E80A 1LEIB 2GMMA 3DTXA 4MNGB 3QXTA 1BXAA 3RPBA 3KYAA 5CP3A 1EP0A 4Q4V3 4XETA 4IW4C 2AK1H 1I82A 2XTLA 4RFNB 5CCKH 4XGZA 1A6CA 1KC5H 4KROC 1OSZA 4GO9A 3G5ZA 1ZTXE 3WSQH 3V79C 3IU3B 3R4DA 5H9QA 2EVGA 5ESVA 2DJUA 3V5DA 2NCMA 4RIRA 5LLIC 4NUGL 3BFWA 3C60A 3DHPA 2W0PA 4PJ9C 4PUBH 3SCMD 3SE8H 4H7LA 4ISQA 1IQWL 3UZEA 1VFOA 1UKTA 4JPQA 4UU9A 1BBJA 1FG2B 1FGNL 4UYQA 1TE1B 4R9HA 4D0CA 3TJEL 3L3JB 1GGYA 5BRZA 3KB5A 1QW9A 3MRIB 4LCCC 5DQDH 5LW9A 5JUEL 1QFWI 4FTDA 1BECA 2J22A 1Z7S1 3II3A 2PXYD 4DY5A 1OPGH 2H2PD 2QBWA 2D7NA 2GBTA 4FZ8H 2EE0A 1JRHH 5C08A 4ZXKA 2K3HA 3CH1A 2BRTA 2LW3A 4PJEE 4JX0A 3GXUB 2XOMA 3SDYH 3TN93 3O4LE 1OB1B 4JR9L 4GO8A 2VDNB 4L4VE 1KTLA 5DQ9A 5F70A 3RY5A 3M46A 4AVBA 3KEHA 4XWGH 4X5LA 1D9KD 5DI8A 5FDWB 3FFZA 1Q0XH 2YJLA 4OGQC 3W37A 1ZBE2 5TF1H 1U2YA 3T2PA 2B39A 1UZYA 3OPZA 4MGKE 5FWRA 2H7WA 1VAKA 3VFMA 1UOLA 2GC3A 4ZU5A 5FBJA 1URIA 12E8H 3P1VA 3H54A 3QIBB 1H8VA 4IJTA 5D6DC 1T0MB 3FQNA 3MI6A 1BOGB 4DGYL 5CIPH 2F17A 2Z1PA 1YYML 3BVDB 4CVZB 3F58L 5CMAA 5CO1A 2PLV2 4AYSA 3HQXA 1T6BX 2KLTA 4ZTOH 1MW3A 3LQMA 2C8NA 4OD2A 3SOBH 3KH3A 4NJAH 4X6DE 2CBMA 2R27A 4GINA 4OGXL 5HD8C 3E5QA 3WF0A 1K4DA 3GKZA 3HI1A 5F1IB 1TR7A 5AUMB 2Y6HA 3WDJA 5EJ3A 3U7AA 4N87A 1XE0A 4LIQE 3LX9A 1P7QA 2DCJA 1GZHC 5E8EA 1OXYA 4PJIF 3OBRA 4HWEL 2RM22 2IANA 2VNGA 4YO0B 1ZT4B 3CVHB 1KBGL 4MAUL 4R4FH 1AL23 1AUYA 2P1BA 1Q1PA 2Q1FA 3VXSE 5JO5B 3TEWA 4X8CA 2GC2A 3ZYPA 1AOZA 4OQ9A 1LO5B 3GSOA 1JWMB 1YYCA 3OHXB 2F54A 2Y4SA 5DMIL 5CFDA 3BB6A 1OP5K 1BVNP 1DVXA 4AL9A 2IXQB 1E9QA 4MO3M 1VACB 5LAXB 2R9HD 4YHLL 5E24E 1TT6A 1UOGA 3UAAA 1CLOH 5CAZA 4IU2B 2VGDA 2EDFA 5E2VL 3QQXA 4IOSA 1DQIA 5HHMB 5KANG 1YYLH 1RZJC 2IADB 3DCQA 2A6KA 2Q8EA 4IEZA 1ZTXH 2AGJH 3S4SA 4N0UE 2NN8A 3IDCB 2Y33A 2XWCA 4OLXH 4XVTH 1KFGA 3MRNB 4KXZI 5L73A 3MKGA 3UXFA 4AYFB 2X44D 3HTLX 4YDJA 3A6CL 4B41A 1RUH2 4KJQD 1MAMH 2OMVB 1I9IL 4Z18A 3GSQB 4YHKH 4NWVA 4I2XA 5AOZA 3K72B 3EJZC 2R8SL 5I26A 3TCLB 4GMTL 2XVBA 1KJLA 5DDHB 4G8AC 3ZMRA 4W1TA 4PREA 4U1LB 3VSQA 3WFDL 1UOJA 2VVDA 2PQSA 1UFGA 3MLTB 4BFFA 2QGDA 1L9QA 1G7PB 2R2HB 4XPAL 4DPRA 1J3QA 2R043 1MJ8H 1PX4A 2EIDA 2XTJD 3PL6D 5ERWA 4PJDF 1HSBB 2C9PA 2BSRA 5KYWA 3BPLB 2FUTA 5B3JF 5KBNC 4M03A 3H8RA 5EEXA 1RH8A 1U6AL 3UT0A 3T1WA 3RNSA 5L2KB 5SX5H 1ET7A 5DXDA 1F3DJ 1EFXB 4L5FH 3SKUD 2IXLA 4UF0A 3EBAA 4G6KL 1RMFL 1JTPA 4Z7UA 3MDPA 2R29L 1S78D 3PGDB 4XMPL 4YBLB 2Y8KA 4GP4B 1YEEL 4HLEA 4Y20A 1N9PA 1Z3GL 2BWCA 1ADQA 5EHFA 2XLAA 1RZKH 4C1XA 1EEYA 2DM3A 1LP9A 1NBYB 2PA7A 2VJ8A 4HANA 1BW8A 1VERA 3LRLA 1CBVL 4DEUA 3B9EA 1TJXA 4AXWB 4ZFQA 5FZDA 1F86A 5PCYA 3GRGA 1LHWA 4QRSA 3KV6A 5EF3A 1BAFL 1WZ1L 5J6GB 1GAFH 5DD1H 4XN7A 2WYSA 4D8MA 1H1AA 4UNTA 2FDIA 3F7QA 2E27H 4PJXE 5FZ7A 2A6ZA 3NJHA 2YHJA 2C7FA 4NLAA 2NMNA 5D2AA 1KPRB 3AGVA 2YFOA 5J8OA 3DO4A 3CQQA 2P9RA 2OQ6A 3AZWA 4PDWC 5JZ7D 1V3LA 4QTIL 3VRLF 2Q5TA 3P4OA 2ZSWA 4IMKA 2PR9A 2EXKA 3TBYB 3SDCD 3BP4B 4JTOA 2HVJA 4ASLA 4LIQH 3VFNB 5ISLA 5D1QD 1E2VA 3D50A 4N2GA 1CLCA 3QNFA 5FV1L 1IS4A 3UJOA 3UTPD 2RA1A 4WZFA 4PAZA 1AYRA 3FK3A 3MRCA 3FT3B 3NSYA 5DYOB 4P9GA 3ZFFA 4XUQA 2L7JA 3BW9B 5DK2A 3UH8A 2RR11 1DN0B 1B4JL 3FTZA 4PJHF 3GZUC 1OD5A 4NRMA 1IBBA 3KYOA 4UDTB 3RTQC 1GKBA 1JZ4A 4PVBA 4TSVA 5D96C 3QJVB 1KYAA 3UBXB 4XNDA 2HFFA 4IRZH 4Q58C 3LH2L 1PGL1 2AXWA 4BZ1H 4COZA 3VGIA 4GUPB 1NANI 2ADGB 3H7BB 1ZRFA 3HG1B 2QADB 2ZUTA 3C7HA 1JU3A 2H8PB 5K1JA 3BT2H 1INDH 1YEGL 4QD2E 4D7PA 4OAWA 1MF2L 5A6IA 3N43B 4Z07A 4PSRA 3QFJA 3ZDWA 1NDGB 3GGWA 4JPKH 4A41A 2R56L 5FV2A 1JYWA 2X9ZA 3EOYG 3R19A 5HI4D 2MQ3A 5ADOH 5GZNC 4KNQA 4YBLC 3X3FL 2I9TA 4Z2WA 3C08L 4AIXA 4LVHC 5A33A 1KT2B 3K5RA 3MRJB 4X7SL 1SACA 5DVOA 3HC3H 2FT7A 3C75A 1S0FA 2YSTA 3SE9H 1F58L 1NGYB 2JE7A 4NE9A 2VLJA 4H5SA 2FD8A 2YUZA 4PCSA 5IOPB 4PJFB 3S37L 1J3PA 5TE7L 2COQA 2QHLA 5L4IA 5CJOH 4H26A 3DJTA 3IGFA 1T7VA 4FFVD 4KKLD 5CSGA 1WFIA 4JRXD 1BQHG 1EH9A 1FDLL 1NGZA 2P5WD 5C8JA 1HB1A 4AGRA 4RVBA 2CNYA 3ZDXF 1EMTH 4GRLA 4BRVA 1S55A 2EXJA 3AXEA 3WL9B 3CFUA 3DO7B 1CAWB 5FYMA 3G5YA 3DX8B 1LENA 1NA1A 3MX0B 2W0LA 3F12A 3CQFA 5IBTH 1IQAA 1VLNA 1XPWA 3VDDA 2Q76A 3RYMA 5BZDA 4AH2A 1Y9MA 4LCWA 3OBTA 3L4ZA 4AYBA 5I6LA 2CRMA 4NHCL 3HS0A 4U1JA 5FS5A 3L5XH 3U1QA 4D94A 3BAYA 2AABL 1UZVA 5APAA 3HKZA 1NFDE 1MJJA 4N9GA 3GQFA 5DYFA 3GJEB 4LUKA 4G8FB 3HBGA 4FFIA 2J1KA 1RUAL 3EGSB 3RMYA 5DJXA 1CD0A 1RUI3 5ANQA 3LEXA 5FGBC 3TF7C 5DZ9A 3NYKA 4NZTL 4CCMA 1FGVH 5E1QA 3CBKB 1YZZA 1TZIA 3LGRA 4F7CA 4AQEB 4FAHA 3W39A 1DQJB 2AKRA 2ROXA 4DIQA 2QADC 1S7WA 3C8DA 5A3ID 5AW5B 1L7IL 1F31A 3R4UA 3ARTA 1IQDB 1Z7S3 2AEOA 4LCVA 1EZLA 4P14A 4O2FA 1QRND 3W0WB 4FQHB 3ETBJ 3R1GH 1XF2A 4FPFA 1MCOL 4WDIB 5B39B 4JBSA 4IS6B 3N3EA 3E8VA 4PR5A 1FT9A 1W8UA 3NACL 1ZLDA 3NPSC 1LEKA 4YYOA 5H4YA 3MBXH 4EUPG 1U8IB 4OZGB 2W65A 3HR9A 5J48A 1DF0A 5FUOH 1GKEA 5FFGA 2WNVB 4CGTA 3B6SB 5T33H 1G9DA 3JBG7 5EO9A 4OGAC 3CBRA 4OCWH 1QEXA 3I3QA 3L2MA 5CYYA 1PVC1 1KDJA 5JOFB 1A9VA 1UF2C 1QSZA 2B9UA 3EIFA 1UWGH 4NENA 1O7DE 5DF0A 3OPTA 3MBWB 1R092 2WT2A 5FX3A 1ZLVH 1SLVA 1E4HA 2OMWB 2OR9H 3GK8H 2GEQA 4YSSA 3KS0J 2P8MA 3TOPA 4NJ4A 4OUMA 4QRPD 1OF2B 3VYNA 5E08H 3ATAA 4PRAB 1U8PB 3GDBA 4FGMA 1PGW1 3QPKA 1F9KA 2VQ1B 3FB7A 1QNYA 1UKQA 2C9RA 1U95B 3GZEA 4LA2A 4AEFA 3N3HA 4ZOEA 1VR3A 1K6QL 2EYRB 3BAIA 3BZEA 3DGTA 2XL7A 4NUPA 4META 1JU4A 4D7BA 3LZFL 3F6LA 2ZZJA 3QWRD 5K1NA 4ICWA 5DZLA 3IDJA 1ZDSA 1DUZA 4JZJA 2B9VA 4KK8D 1MS9A 1MRDL 3D5OF 3ESPA 1HKLL 4YVNA 4U1NB 2YSSB 1MACA 4GT0A 5GS0H 3TO2A 3M3CA 2XFXA 4FRWA 2UWEE 4IE6A 5C0CA 3GHEL 4Z0XA 2CO4A 3HCVA 2WXJA 5B22A 1L7LA 3AXLA 5JXHA 3EJRA 1LO4L 4JY5H 1I85A 1E4XH 2CR6A 3TV3H 3PAYA 1QHQA 4X5WA 2OLDA 4TLUA 1T03L 3AS2A 2O93L 1BG1A 1FE8L 3KW8A 4Q74A 2VOKA 2ATFA 2HX9A 3STBA 4YDLC 4R83A 5B1JA 1DVFA 3QUYD 3GSNB 5IVXF 3TNMA 3KGZA 2GK0A 4ZDHB 1DUYA 1CURA 1A3LL 2DQEH 2IAMC 1IQDC 1OAQL 4Z23A 2RMU2 4GLRI 1I1RA 2EIJB 5JORB 3ILQC 3JZ7A 4NO2B 2F8OA 3Q9PA 5LNDA 2ZX1A 4WO4A 3I84A 4ZAKD 1GS7A 4D0BA 4M7KH 5A2FA 4YGEA 1SRDA 4N8CL 2ZOOA 4YGVA 4GIOA 3WKNA 2OT7A 2Q87A 4EKJA 5DC0A 2XA8L 4XZUB 4LHUB 1ROCA 3SBWA 1H1MA 5CVRA 5D7LE 3MOAH 5D7JD 4NN6B 2WP3O 2XETA 2I27N 5SWSA 1RVF2 1EUUA 4P57B 2O8QA 3FTWA 1YEWA 2WBWB 5GJTH 2WKOA 5TDPB 1CR9H 3KPSB 1FPN1 2ZBJA 3LF7A 3I9PA 5CKNA 3PJQA 3C5JB 4GKYA 4TUKL 3MRGB 5T1MB 4UAHA 3ARYA 3IDYC 4M00A 4MJIA 5EOTB 2C1OB 3VZMA 3MXWL 5FGCB 3PJSA 2GPZA 3RZCD 1TME2 2ENJA 5AVUB 3AMLA 2ORBL 3EO1B 1ENQA 4A67A 2NY5C 3PYCA 4XPFL 2A0LC 1DCEA 2EP6A 2AEWA 3CE1A 2PPDA 3MODH 3MV8D 3JTSB 4J8QA 4XVJL 4E9LA 1HB2A 2R69A 1CFSA 1UYWL 4ES9A 5LCWL 5KJRL 3CDFA 3O41B 4DEQA 1FL6B 1CFVH 2PWHA 3LZPA 3WTYA 1KLFA 4FLQA 2IGLA 4N90A 5D7SH 2VCAA 4QY8A 1FFNB 3RWDA 3SZKC 4W4NA 5GJSH 1SJMA 2J7LA 3ZKSD 3PUUA 1NCQA 3MHZA 4Y16A 3JWNC 2QQLH 2VITA 4PSPA 1VAVA 5C4WB 4CSWA 1RJYB 1IEBA 2CLVA 3DNKA 4LPWA 5JHLL 2HKHL 2X28A 3DDGA 4QHKJ 5MEND 1OGSA 3CWGA 2D6OX 4HQQL 3NNGA 2LV4A 1FORL 4G3YC 4F33A 3ILRA 4HUXB 5CKQA 4WVMB 2XQBL 4PTTA 1W15A 2B0SH 3H0TA 2WLYA 4DKFH 4F1ZA 2X2IA 3NRUA 1ZLWH 3QZBA 1YHFA 2EUXA 1QKZL 3INAA 1N68A 3OKMA 1HS6A 2YEVB 4KUCF 4HG4K 5M95B 2YU1A 3LYRA 3KV5A 1EJ6A 3ARDA 1Y1DA 3WMPA 4DT2A 5GGUA 3POGA 1OTTD 2VR6A 4P5MB 2UXVA 3OGOE 4NEHB 4AI1A 5IHBA 2JWYA 3V4PB 1ZEAL 2IH1B 5I8KL 1L5GB 1FMD2 4YHZL 4L9LA 1OOPA 1S7RB 2RS31 4HDIA 1PZ5B 1UH4A 4XUTA 1CD1B 3VM7A 4PQQA 4XUPA 4ANVA 2YARA 2WNUB 4FO9A 1SM3H 4N9IA 3BD5A 4Y5VA 1F1DA 5DG1A 4M7LH 3DXUA 1PNCA 4MD5A 3F8UB 1YY9C 3O2DH 4P49A 1UOKA 1KB5L 4P9HH 1VRH2 1OP3H 3SLIA 4HJUA 4M3KB 3HMYA 5E16A 2QPSA 4G9DB 1TZHA 5EHDA 5IROC 3QYMA 5L7OC 2AMUA 3AVSA 4A2DA 3QULA 5F7DB 4ZO9A 5GGSB 4KX8A 1HWHB 5EUKA 4I4WA 4PW9A 1D4M3 1A6ZB 3B7SA 1HX0A 3M7OA 2LT9A 3OJMB 3TH3T 2W0FB 2CCWA 1P5UA 3DTDA 4CW1B 2GHWB 2FO4B 5FPAA 1LEMA 4E9TA 1RERA 1UB6B 4CDUB 2P26A 3C6LA 3O0RL 5JIKA 5L4FA 2BVBA 1MFDH 5IFHH 4XBGA 4DQOH 5GISH 1EQWA 3ZDXE 2VJ0A 1UT2A 4DGVL 1WBYB 2WWJA 2PYEE 2Q6WB 4GQZA 5A6YA 3O2VH 3WJJA 2Y6JA 4MV2A 4Y5SA 3GXMA 4JVPA 1B6DA 1RZQA 4BK4A 4Z76A 1RV6X 4OCYH 3SKJL 3LIGA 4FDWA 2ZUYA 5C4WC 1IU1A 2ZWLT 4EDWH 4IRSB 2XT1B 1Q9WA 5CXPA 1OA2A 2WO1A 3BE1L 4FZEL 4CDWB 1KN4L 1CPMA 5IVOA 4Y33A 2JG9C 1AD0A 2W2IA 1O3SA 4GKNB 3EDDA 1B2YA 3FU6A 2N7AA 4YNYA 3VCLA 5J6SA 1UYPA 5IVCA 5I73C 1HQWA 5LRRA 4FQXD 3RRQA 2VLKA 2J5LB 4OZFG 1BEV1 1R19A 4E4DX 3RURA 3FF7A 4ZXBA 3GYDA 1TCRB 1QLEL 4K3JL 2PFWA 1NOLA 3NT0A 4WUUA 5CA6A 3MAWA 5KTEH 3O6FD 5E9DD 1I1AB 1G7QA 2OP4L 2ZKHH 4DOHB 5AC91 1PK6B 5AAWC 4OZXA 3P02A 3B9KD 3OZ9L 2H3XC 3BSZL 3T3PB 1BX2B 4ZPIA 2I9LA 4CP9A 1WP6A 2YC4A 4TLGA 1UKSA 4PWEA 1RUOA 5LGYA 5T3XE 1ZRUA 5JSPA 5C6TL 4RDQG 3WTVA 4AJVA 4WJKB 4ZBJA 1BEYL 1E6JH 3DHJA 4PCYA 3QIUC 3KH4A 4M02A 5GLWA 1W8TA 4AIZB 3NJVA 3S6PA 2J44A 1EUTA 5LY1A 4OSUL 3TIDB 3QHZH 1DBMH 2VDRL 2YAFA 4LGPB 1SBEA 3VWJD 5TE6L 3WO4B 4PN6A 1FIGH 4LBLA 5MHSD 3ZKNC 3ZFGB 1RC6A 5FJKA 1N59A 5C2BH 1U8KB 2DZEA 2XG4A 3FBKA 1AHSA 4AQ2A 1F3JA 1HOCA 3RZHA 4GP8B 5I23A 1HB4A 1NAKH 2H1XA 3FULA 2NY7H 4XZ4A 3WN6A 5JHDD 1Z78A 1EHNA 3EJCA 2PYFA 4DK6A 5IBLD 4LKFA 1QWHA 5C0DA 2BP3A 3VD4A 2A6JA 4XF1A 4OM1L 4DKAA 4J27A 3A5VA 3DGGA 3X3GH 4IRSC 3C7EA 1MEXH 5KHGA 5FKCA 1N0LB 4EDXA 4U49A 1ORSA 3D69A 2BNQE 3H9ZA 4PI0A 5HGBB 3LKNB 4HMDA 1YUDA 2OUJA 2VYRE 4A6YH 2WNOA 4G6AC 3LDRA 3MJGX 5CCJA 2BHUA 3ARGB 3V4LA 3VDBA 4EXPX 1MZ6A 1RUD3 1YEIL 2WWNA 3O45A 4YC2B 2JICA 1T89C 2IBZX 2H0JA 4IEWA 2YBRA 5FCSH 1PVC3 4FG6C 4JM2B 4GAZA 4AQ1A 4BDVA 3AWFA 4KTEH 1I1AC 4I18A 1V9U1 2Z7YA 2OQ7A 4IIQA 1XNTA 5DZGA 1R33A 4H0GA 1PK6C 1XGYH 2EUVA 2BWIA 2CR3A 5D7IF 1IX2A 4JGYC 2ZOKB 5KSBA 3J8F2 2DH2A 1E6OL 1Z9SA 3VXQB 3BZDA 5IESL 1ZKAA 5CIPA 1RIRA 4PCRA 5IF0B 4GQ9H 1FWXA 3QRFM 2E9BA 4NQDE 1RJLB 2LW8A 4K3UA 2FCTA 4KK6D 1UJ3A 2NXZD 1C5BH 4OI0A 2CKBB 1BD2D 2GITA 4M56A 4AGVA 4YWAA 2GTZA 4QRRB 2X0VA 4NOTA 1A6WL 4XFHA 2ZOUA 1C8NA 2HKFL 3WO4C 4WGKA 1MCWM 1I3UA 4I9WD 4FULA 4BWWA 1BFTA 1F18A 4MHHI 4BK5A 5KBMA 1U8NA 2QHRH 3EGDB 4MNQE 2XZQH 1IS5A 3U4KA 3LV3A 3WUWB 2UX7A 1YCSA 3OOXA 4KKNA 3UABA 1J84A 4O9EA 3BPCB 4P9ML 4JQXC 1B0IA 3P3TA 3PREA 3VFUA 5JW4M 1ZT1A 3MRKB 4GALA 3ZKUA 4JFED 1T2JA 1F35A 1CYGA 4PW4A 4UANA 5FZCA 5FXWA 1XMWA 3BU0A 1NEZB 3Q05A 4X6CF 4O58L 2R49A 2HRPH 4F9LA 1ZJAA 4FADA 3CDGB 5FLHA 5T3XH 2P5EE 2PWDA 4PLNA 3KPOB 3WHTA 5FYKE 3O9WD 3L3KB 1QHOA 3A4UA 1A14L 3F6IA 1JGDA 2M83A 2ARBA 1UXLA 3ARGC 2BVOA 1H3VA 4L9DA 1BZOA 4TQ8A 4JGZA 2HN7A 1CGUA 2B4CL 4LOUD 4YC2C 3HC0B 2BOBB 2ZKXA 4RLDA 1MUJB 1OT4A 4NP9A 4V1DE 4C91A 1CN1A 1ZA6A 2BVQB 1UEYA 5E89A 1GQGA 1LOBA 1CYXA 4K1YA 5FUIA 4C0BA 1N8ZB 2AJXH 3ZHLA 2DIAA 3TH2T 4QT5A 3FFOA 4GWJA 3QJUB 4L8DB 2XHKA 3CN2A 1FJ1A 1RUPL 1BQLL 4QPGB 4HUVB 3PIJA 2WUCL 1RU9L 2CDEB 1EEZB 4P4RB 4YM3A 2X89A 1L7TH 1AGCA 1JYTA 1G7LB 5GLZA 1CT8A 3RILA 1BJ1J 3QDMB 3O8XA 3RVUD 5IQ9B 1AYM1 2JTYA 4YUEL 2J1VA 3L08A 1UZ6E 3BQUA 3FCUB 2JG8A 2VRQA 2JI3A 2WANA 4FCHA 1O9WA 4M1GH 5C07D 3RGVA 3U4AA 4MA7L 4DCQB 1H2KA 1X5ZA 1R3KB 5DFVC 3L95A 3MBED 2JIGA 4HS3A 3MA7A 1V7NH 4LBAA 2EVIA 2H45A 4XVUC 1OPMA 1W9TA 1A0QH 5INCB 2YKLL 3W58A 1P1ZA 3N0AA 3NZHL 2DWDB 1TFPA 2D03L 4PV1C 5E6IB 1R5WA 4DNYA 5A2CA 1W0VB 3O4LA 5MEQB 4LESA 1C28A 1B0RA 4NS0A 4DTGH 2Q8OA 4L4VA 5H94B 1KIPB 2WQWA 2R59A 3QS3A 5FA3B 1EPZA 1N6VA 3ETQA 4QX3A 3WQ1A 3IPVB 3POCA 4GAJL 3ML8A 1S7TA 5B38A 1P7HL 4H8WH 4Y22A 5KS9A 1LM8V 4U6XB 5FJHA 4FX5A 1W9WA 4OVEA 4TOYL 2E6QA 4HZ1A 4ORFA 2YUVA 2BY1A 1MLCB 2CDGB 3F95A 4OZOA 1KTCA 1UZ0A 1ML0A 1OKOA 4HFUL 1Y4WA 4ODWA 5HGDB 4ONUA 3TVMB 3MGUA 4IUGA 4KHTL 3SO5A 5LGKA 1XEUA 5GRZA 3RI8A 3T6XA 2E56A 3B43A 3AL5A 4XMUA 1SFNA 4LQFL 3DYPA 4U6VL 3FRPA 1X5IA 4PY8J 4RGND 2LTNA 3K77A 4X6DA 2Q7YB 4PRID 3D06A 4FOMA 3SYOA 1BVP1 3T0EA 5KSUB 1IKNA 1NAMB 4HUCA 2AJVH 1JK8B 3LEIA 1YMHB 4N1CA 5EZOL 2EEDA 5DVNA 3DBXB 3P1IA 3MOBL 3MRPB 5DJAB 3ZY7A 3DURB 2ZX9A 5F2WA 4LBEB 4IBQA 2O61B 3FWEA 3PHMA 1NBZA 4L2LA 5JPMA 1FO0H 1ZGLM 4KKCD 4Z8FH 4OIIH 1OAYL 2WT0A 1R4XA 4JG1H 3CMGA 1T3FB 2EINB 2Q7NA 4DFIA 3WW4A 5J1AA 3VXSA 4JPWH 2VZTA 3ZBMA 1RJZB 5MEOA 3B2MA 1MCJA 2V8LA 1IJ9A 1RIVL 5K39A 5IBUG 5L6YL 2BGPA 4JM0A 4FLSA 1XNBA 2Z91B 4IRZA 4G8GE 4UV4L 5FYKH 4MJ6B 1O6TA 3GHBH 1BQKA 4FXKA 4BZ1A 4F92B 1BLNA 1VIWA 5K9OA 1JI6A 3MICA 3QPQD 3NO8A 2JKWA 4FFHA 4DXTA 1YPZB 3CSYA 3RAJH 1P84K 1B90A 5FOJA 5E6IC 5DAQA 1QJU2 1DQQB 3QCWA 2YPLD 4OVUA 5FTTC 3PHSA 2JE9A 3TFBA 3UL2A 5B1BB 3HJEA 5JR7B 2APVA 1MCWW 1FFPA 1UY3A 2WLNA 2FJHB 3AXIA 2W47A 2ZXAA 4Z3GA 4N0UA 2AQRA 4ZMYA 5C0JB 4X6RB 4K71C 3SDAD 3T2NH 1BEV3 2XA3A 2BDNH 3FCSB 4MXVA 1CFTB 4POYA 5HXMA 3QUMH 1N64L 1MEC1 3DN7A 2VQ0A 2NW3A 3T6VA 3RIFF 3SCMC 3WP4A 2EIBA 1OAUH 3S98A 1O5UA 4JDEA 4L97A 4JO2L 1YAIA 4GBXD 4OFPA 3VXME 5AC93 4OLLA 3U78A 2A4EA 1KCRH 3RVXD 4FJ6A 2TAAA 1TOXA 4ZQKA 4QXUH 1KY7A 3IMMA 1NJ9B 3MN8A 5HJ3B 5IGXH 3EO9H 2BSDA 3FQXB 4G8EB 2XACC 4HONA 1T0NB 3GBML 4FP3A 1GY1A 1KGCE 3LPWA 2PXYC 2H2PC 4NNXB 1KUMA 2ESVD 4Y19A 4N5UA 3S5LB 3TA3A 1EX0A 4UM8B 4KZEH 3P9WB 2ICWB 5AKRA 1PZ9A 1C12A 3I2DA 4CDQA 2LM3A 5ITBL 4ETQA 4GMP1 4J1XA 2CU5A 4PW3A 4DF9A 2NY2D 4DHLA 1QFWM 5DS8A 4MVBD 4NO0A 3ISRA 1T1ZB 3BD4A 3OX8A 1H8SA 4IHOA 3CVDA 3L5HA 2ZJSL 3LIZH 5J5EA 4F8LA 4HKJB 1RHI1 1KLUA 5IB4B 4FTSA 2DLFL 4L0PA 2YHGA 4CSPA 3ZZLA 1AKJB 5DJ6B 4E9WA 1V10A 2PTTA 1KGIA 2AJSH 2QPDB 2DF7A 1G6RH 3DI2B 1MFBH 3FONB 1EAPA 3OEBA 3ULVD 5AVPA 5FCUL 2OMXB 3EJPA 1GZ9A 5A32A 3QZLA 1LJ7A 2HJFB 1AZNA 3BEWB 3TURA 3U4BL 4AITA 2PCXA 2Q5BA 1QLFB 3T8MA 3VX1A 3NV3A 2VIRA 1KN2H 4MGZE 4CDXA 1UKRA 2IXCA 1PCSA 2GSMB 3EFOA 3JZYA 4BCXA 3MIEA 3V9CA 2BCKA 2OXGB 4FPOB 3Q8BA 4JGMA 1Q0YH 1JYXA 1TQBC 4L99A 3K2UL 1A9BA 4JB9L 4ZODA 3W9EA 1CIDA 2NYYC 1ONAA 2E6JA 4QIRA 3TCTA 3TXAA 4J7RA 6TAAA 3H0OA 4EN3B 4XTMA 1KXVC 3QEHA 3RWHA 1AGFA 2XWBB 4B4QA 4YLZA 4X5QA 1SXSA 3F5WB 1DG6A 2XCMC 4N20A 4NAJA 2VL5B 1D5BA 1FYTB 3DA0A 2HWB1 2HFTA 3L9YA 5C8WA 4XP6H 2RACA 1MCNA 1RUML 1B9ZA 1UASA 1UM6H 3MRQB 1W6QB 1IKOP 1K9TA 3JB4C 2VLRB 1ERNA 2EO1A 4LLUB 4MDIA 5CSBA 4ZX4A 3HPJB 3VBSA 2VAAA 5I74C 1KJ2H 4C54A 1BAWA 5IW0A 1YNLL 3BOVA 1MHEB 4WJG3 7FABH 1RQ5A 1WA1X 2QSCL 4IRJA 4P4KA 4QD2A 1HSAB 2R9HC 5I93A 1NC2A 4IV3A 1HXYB 2FUQA 4RAUB 4HAFA 1ZZ7A 3FTVA 3GS0A 4RBPH 4R3SB 4WFFE 2ERJC 3QPXH 1MCIA 4GYBA 4UBDD 4Y4HA 4RFT0 2D3LA 5MEPB 4GI8A 4DRVA 3PFQA 4YDVA 4M5YL 1PX8A 1MIEL 5FAAA 2JSFA 3GRBA 1ZZBA 5IK7A 3LQZA 2C4XA 2D5HA 5E0FA 1DBAH 1OQOA 4R8WL 1I5ZA 5IVVA 1QSEB 2VN6A 2F74B 2DIBA 2F9BT 3QIWA 1XU1A 3WF3A 3HI5L 1BIHA 1WFMA 4FS0A 4NGHL 3N9OA 3QDGD 3TNNB 4KNCA 2VDMB 3MLSL 1KTDB 3N1PC 5DU7A 3R8QA 1KYDA 1HHHB 1LILA 4AI3A 3KS0H 4PEEA 1H9VA 2Y07H 4OH2A 2Z4FA 1ZVSB 3BVNB 4GAGH 2QKIB 4WCYL 3KBHE 2Z31A 3CMOL 1OOAA 1DQLL 1ZVNA 3RNQA 1QQDA 3WFCL 4B97A 3R7RA 1SF5A 3T04D 4F7PA 1XF4A 2QTVA 2XTJC 3QC5X 3QZWA 2BVEA 4NWTL 2YPKA 4PD4K 3K6SA 3BRDA 5FPZA 4AZ8A 4G1MA 4L4TE 5HVHC 3WFBH 4ZMWA 5JIPA 1QDCA 4LSPL 3DUHA 3RDIA 1V3MA 5D1ZB 4N9OB 3PWLB 3AYEA 2PABA 4AEDB 4RGOL 2ADFL 4AQ8A 4H7VA 1WW5A 3L2YA 5LRSA 3LS5L 2IPTL 2LHAA 3TT1H 5FZOB 1NFDA 3NDYE 3T77A 2D6MA 3MRMB 2D7QA 3L3OB 1XH2A 2DBLH 1S78C 1RZFL 5EUOA 5HGAB 4NCC2 1LHOA 3FB8B 1AIFB 4XMTA 1FL5A 1CF8H 1I7UB 1VENA 3DRQA 2XVKA 3ZSKA 3NWKA 4MAYB 3HBZA 3DJ9A 3WU1A 5IMKA 1J0ZA 1A3QA 1CFQA 1MHHB 3OKKA 2ENSA 5T50A 4JJHA 2Z4TA 3NUKA 4M48L 4FXGA 3ULUL 3QH3A 5IFAL 3ZGIA 3QYNA 3O4OC 5B1AB 3CAFA 4FYSA 4I0KA 2Y1ZA 4MNGE 3C9NB 3UJIH 5ID1B 4LGRB 1GH7A 4Y3OA 4HWZA 1O6SA 1ZZ6A 4UYPA 1X8EA 1LO3L 3LHPL 5KOMC 4ZX3A 4GKOA 4NC0B 1RK1A 4JZNA 4XE0A 3QORB 4ZFFB 3AC0A 2JFCA 4BQXA 4PJ7B 4HW6A 5ES4B 3O6LL 5FM5O 3SDCC 5BNNB 2GJRA 1GIGL 4C4UA 1DIWA 5D1QC 2GHZA 4M5TA 1Q9LA 2J43A 1QUPA 3KLLA 5BMFH 4MNHA 1XB9A 3ATEA 2VNOA 3WCYA 2K6WA 4NWWA 5D71H 3FRUB 1TMF2 4ZW7A 4ARXA 5EC1A 4BSJA 4URTA 2ZF8A 5KS9F 2CY6A 1ZBA3 3FO9A 2GFBB 4OFDA 1EJFA 2QQMA 1TZ8A 1AD9A 5B3SB 1QJFA 4RMTA 3KV4A 3FQWA 3AB0B 1NA8A 2EDEA 3NCYP 2DYPD 2VXVL 4HJEA 1EDYA 1EO7A 3PWVA 3BP6B 2DLEA 4U36A 2BSTA 1B09A 5LBVA 3FH7A 3VL8A