1OPOA

The structure of carnation mottle virus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
267
structure length
267
Chain Sequence
SMTMSKTELLSTVKGTTGVIPSFEDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQPLQWVVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title The atomic structure of Carnation Mottle Virus capsid protein
pubmed doi rcsb
molecule tags Virus
total genus 52
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
A PF08462 Carmo_coat_C Carmovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1opoA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opoA01
4NWVA 5C9AB 5C9AC 2BBVA 1AL0G 2MEV3 1VBB2 1RUD1 3ZFFA 1RUJ2 5A32A 3VBHA 1BMV2 4CEWA 4CDXB 1QJY3 4CDXC 2R043 1POV3 1A6CA 1COV1 1RUH2 1E57A 1VBD3 5D8AC 5D8AB 4BCUA 2R072 4RQPA 1PO13 2IZWA 4N43A 2RS33 4Q4V1 3TN92 2RMU3 1DDLA 2ZZQA 1HRV2 1RVF3 1VRH1 1R082 1FOD3 1HRI1 3ZFFC 3ZFFB 1QJX2 5A32B 3VBHB 3VBHC 4CEWB 4CEWC 1BBT1 1CJDA 2Y26A 5J96B 1TME1 1OOPA 4RQPC 4RQPB 4Q4W2 1ASJ3 2ZAHA 4N43B 4N43C 4Q4X2 1RUE3 2R063 1AYM1 3IDEA 1PGL2 4JGYA 3J8F3 3VDDA 1AR71 2WS91 1R092 4YVWA 1VBA3 2ZTNA 5C8CA 1ZBE3 2RR12 1FPN1 1QJU3 2WFF1 4AEDA 1RHI1 1OOPB 1OOPC 1Z7S2 1VBE1 5J98B 1RUD2 5JZGA 1QJZA 4GH4A 2RS11 1AYN1 1AR61 4JGYB 4JGYC 1FMD3 1COV2 4Y4YA 4CEYA 3VDDB 3VDDC 1PO21 1RUJ3 4YVWB 4YVWC 1M06G 1AL21 1NCRA 3JB8A 5C8CB 2HWE3 1VBC1 1MEC1 3JB4C 3JBG2 4AEDB 4AEDC 2RS51 5ABJA 5A33A 1RUC3 1HXS2 5JZGB 5JZGC 1PGW2 4SBVA 4Y5Z0 4GH4B 4GH4C 1VAKA 3TN93 1BBT2 1C8M2 1HQNA 1ZBA1 4GB31 3FBMA 1ZBA3 4CEYB 4CEYC 1R1A1 1TME2 4RR3A 5DDJ3 2HWB3 1RUI1 1EV12 2WZR3 1NCRB 3NAPB 1AR81 1PIV2 1CD3G 3NAPC 4LLFA 3VBOA 1AUYA 1AYM2 1AR92 2RM22 5ABJB 5ABJC 2MEV1 5A33B 1ND2A 2HWF2 1PVC3 5AC92 5L7OA 1QJY1 2WS92 4FTEA 2R041 3VBFA 1POV1 4WM7A 1FPN2 1VBD1 2WFF2 1RUF3 1PO11 4RR3B 4RR3C 1VBE2 2RS31 1RUG3 1POV0 4RHV3 1MQTA 1NY72 1AYN2 2RMU1 3VBOB 2RR13 3VBOC 1RVF1 3VBRA 1VB4A 2WWSA 1AR62 2TBVA 1FOD1 1ND2B 1ND2C 1Z7S3 5L7OB 5L7OC 1QQP3 1AL22 3VBSA 5ACA3 1GFF2 3VBFB 3VBFC 4WM7B 4WM7C 1NCQA 1MEC2 1RMU3 1ASJ1 2XBO3 1D4M2 1NG0A 1MQTB 1MQTC 4FTSA 1RUE1 2R061 4Q4Y3 3VBRB 3VBRC 3JBG3 3J8F1 2VQ0A 1HXS3 1R1A2 4CDWA 4JGZA 2HWC3 1TMF3 1RUI2 1VBA1 3VBSB 3JD73 1V9U3 3VBSC 1ZBE1 3CJIA 1C8M3 1AR82 2HWD1 2BFUS 1NCQB 1NCQC 1QJU1 1BEV3 4IV3A 2HWD3 1EAH3 1OPOA 1EV13 1QJY2 2R042 1PIV3 5BNNA 2PLV3 1AR93 1FMD1 1VBD2 2HWF3 5AC93 1RUJ1 4CDWB 4CDWC 1BMV1 4JGZB 4JGZC 2RS32 1VBB3 1NOVA 1ND3A 2HWE1 3CJIB 3CJIC 2RMU2 4Q4V2 1RVF2 3NAPA 4IV3B 4IV3C 1FOD2 1RUC1 1VRH2 1RUH3 1VB2A 2R073 3TN91 1HRI2 5C4WB 5BNOA 5BNNB 5BNNC 1HRV3 5DDJ1 1R083 2GH8A 4QPGA 4PDWA 1ASJ2 2HWB1 4YVSA 2WZR1 1QJX3 1ND3B 1ND3C 4GMP3 4FTBA 1RUE2 1H8TA 2R062 3ZXAC 1PVC1 1D4M3 4Q4W3 1WCDJ 1AR72 4N53A 5BNOB 1ZBE2 5BNOC 4IV1A 4Q4X3 2BPA2 4WM8A 1QJU2 1IHMA 1RUF1 1K5MA 1NA1A 4QPIA 4QPGB 4QPGC 4PDWB 4PDWC 4YVSB 4YVSC 1RUG1 1RHI2 4RHV1 3VBUA 3DPRA 1F2NA 1R093 2RR11 1H8TB 1H8TC 2RS12 1FMD2 1Z7S1 1SMVA 5FOJB 1QQP1 2XPJA 2FZ1A 1RUD3 4CDQC 1PO22 4CDQB 4RS5A 5ACA1 3S6PA 2HWE2 4N53B 4N53C 4IV1B 4IV1C 2X5IA 4WM8B 4WM8C 1VBC2 3HAGA 1RMU1 1RUC2 1K5MB 1K5MC 2XBO1 1NA1B 1NA1C 4QPIB 4QPIC 1COV3 2RS52 3VBUB 3VBUC 3DPRB 3DPRC 4EJRA 4Q4Y1 1HX6A 4Q4V3 3JBG1 4GB32 1ZBA2 2BFUL 1HXS1 1VRH3 1PGW1 5DDJ2 2HWC1 1TMF1 2HWB2 5BNPA 3JD71 1V9U1 1HRI3 2WZR2 4RS5B 4RS5C 1C8M1 4CDUA 1BBT3 1BEV1 2X5IB 2X5IC 5K0UA 4Z92B 2QQPA 1EAH1 1RB8G 1PVC2 2MEV2 1EV11 1TME3 4FSJA 1X33A 1PIV1 5CFDA 3ZFGA 2PLV1 1AR91 2RM21 2HWF1 5AC91 1AYM3 1RUF2 2RM23 1VBB1 5BNPB 5BNPC 1PO12 1RUG2 3ZFEA 4RHV2 2WLPA 1AR73 5CFCA 2WS93 2FZ2A 4CDUB 4CDUC 1B35A 3LOBA 5K0UB 5K0UC 1FPN3 4NWWA 1RUH1 2WFF3 1QQP2 2R071 1RHI3 1VBE3 1NY71 5ACA2 4RFT0 5FMOL 5CFDB 3ZFGB 3ZFGC 2RS13 5CFDC 1AYN3 1C8NA 1HRV1 1RMU2 1R081 1AR63 2XBO2 1QJX1 3ZFEB 3ZFEC 4GMP1 1PO23 1OHFA 5C8CC 5CFCB 5CFCC 5FMOS 1AL23 1B35B 1B35C 4Q4Y2 5C4WA 1VBC3 5LK7B 5C9AA 1MEC3 1D4M1 4GMP0 2HWC2 1TMF2 2RS53 3J8F2 4Q4W1 3JD72 1V9U2 1X36A 4Q4X1 1VBA2 4CDXA 4CDQA 1BEV2 5GKAC 4GB33 2HWD2 1EAH2 3M8LA 1PGL1 2BUKA 5D8AA 2GSYA 1R1A3 1W39A 1NCRC 1R091 2DF7A 1RUI3 2PLV2 5C4WC 1AR83 1F8VA
chains in the Genus database with same CATH superfamily
3ARUA 2EIGA 2XTJD 5EZOH 4DXSA 3MR9A 1BLNA 1EEYB 3ZUNC 2MKLC 3FCSA 2ZEXA 5E23A 5EOCJ 3WF4A 2CLZB 1SQ4A 1SXNA 4XN2A 5KVFH 4WHYG 3NCBB 1MCBA 2PO6A 4Z78A 4HUWA 1SDYA 5C3IA 1AD9A 3FFQA 2CU9A 2YWYA 4GKZB 4CC0A 4J3OF 1PNCA 2BMKB 3APMA 2VW2A 3US9A 1W2NA 4AQEA 2RDSA 1U3YA 5ITBH 1X8MA 1ZZ8A 1PG7L 2R4RH 2AV7A 3L5JA 3BZEB 1N67A 4C58B 1E57A 4FQXA 4X6EB 1XIWC 1H6TA 32C2B 3UJQA 2QVMA 2Y4SA 5KC6A 3DLQR 1S0IA 5ICYB 4ZO6A 1DYPA 3CAFA 1AG0A 1E67A 5DPNA 2X42A 1YPZE 1TZIA 4R5VA 3V6OC 5K59E 2OXHA 1A7PH 2BINA 4FEIA 4XETA 3H42B 1NDGA 3MR9B 3VSTA 3J7LA 1CDHA 1TQTA 4ZTOH 1V55B 3FCSB 5EBGA 3FONA 2Q7AA 3F7RA 3U4AA 3R19A 3FL7A 1C5HA 2TSBA 1KN4L 1G6NA 1SQ2N 1JUFA 2PO6B 4GI8A 4S1DD 2TAAA 4HUWB 1JFQH 1AD9B 3RPIB 4Z78B 4B9GA 4CE8A 1J1TA 1CJDA 5MP6H 4AQEB 2Z7UA 4NQCD 4HJIA 5FP7A 2L3BA 5DJDA 3FUDA 1X9PA 4MWFA 3DCQA 3B9IA 2JKLA 1WA1X 4FQXB 3WKQA 4HHAA 1O7SA 4PMFA 3G5VA 2OXBA 5HHOE 5LNDA 1NXMA 3MFGB 4CMHC 2AHIA 5KVFE 4K8FA 5FGSA 4FP2A 1HEZA 1I8IA 1WCUA 3ECUA 2CO4A 1Q8PA 4WSGA 1TZIB 3MXWL 1CWVA 5EC2A 1RUE3 2OXHB 5EF1A 1WBFA 2IPUK 1NDGB 5MI0C 4J7RA 1QD0A 4POZC 4OZGF 3FONB 5FMBA 1ZX5A 4JPVL 1CDIA 5FZ8A 5JQHC 3IWVA 1JUFB 1UT1A 2CA4A 3LY6A 2E63A 2WS91 4N0UA 2V5DA 4JHWH 5IW0A 4OD1L 3BD3A 3U48A 4TNFA 1ZT4A 2WBJD 4S1SH 5DJDB 5J89A 1T20A 2ADIA 4MWFB 4EDXA 4E36A 2YB7A 1ZXKA 1SJEA 4HHAB 3EJJX 3G5VB 4HIIA 4UW4A 1QEXA 2YRLA 2KI6A 4FNUA 4M62H 3NSYA 3C7GA 1UXSA 2Z8RA 3DDFA 1HEZB 1I8IB 2VDLB 5EC2B 3QUYC 1BECA 1PQZA 4CC1A 5EH1A 4PJBA 4HEME 2XQYA 4F8AA 4K20A 5C0DA 4N0UB 3S3BB 1BD2E 1FYHB 4JFSA 1OAYL 2WLHA 3JB8A 3TAYA 1EY2A 3RX7A 2YA1A 3VLBB 1ZT4B 4AAXA 4HWNA 1T20B 2ADIB 4EDXB 5BUGA 2DV9A 4K3UA 2ILMA 3CBRA 3JZYA 1LOEA 4AFAA 1SJEB 3JBG2 4HIIB 1RUC3 5TD4A 3NRUA 3BKCH 2Q3AA 3F83A 4MS8D 5CN3A 2VBDA 4SBVA 5IAXA 1QKZL 3VB9A 1UXSB 1A7OH 2DMGA 1BX2A 2DYSB 3RFZC 4B3NA 4G7YH 3EYUH 4OFYD 1NMCC 1U3JA 2EXYD 2DBLL 2FUTA 5DQ9A 5JUEL 3FUFA 1FAYA 1G5GA 4D9RE 4JR9H 1A0QH 1DGWX 2QDVA 1PQZB 1GJIA 4HUUA 2QQVA 4LHQB 3T6ZA 1RIHL 2ZCZA 3BIBX 3MUZ1 4PJBB 3T8XA 4CJ1A 5FV3A 1S7QA 3OPUA 2NY1B 2WO1A 4NAOA 4TUOA 3WDYA 1NFIA 3AM8C 1OQEA 2UUDK 3TPUA 3VX0A 1BPVA 1F6LL 1S7XA 4LPCA 3HC4L 2NYYA 3PLQA 5AEAA 3SPIA 1ULGA 4YE4H 4JFFA 3VB8A 1AR92 5C0AA 2ZF9A 4UT9A 3W56A 4H26B 4R97B 1B3IA 1PVC3 3ES6A 1LTXA 3BP5A 3WY1A 4K3EL 2H45A 3WDXA 3QXWA 4LZKA 4D0BA 1BX2B 4M8RA 3QNYA 4KKBC 1GJWA 3REVA 1CI5A 5DQ9B 3AB0B 2WS92 2Z8SA 4ZUUA 1MCFA 2AXFA 3F8UB 3ISYA 1KCUL 5IK4A 3ZYJA 3UCQA 1EDQA 4H5SA 1AXSA 4ZW7A 3NZSA 5J6GA 2B9VA 1VBD1 3QUXC 9PCYA 1A64A 5E94A 4XNUL 3T8XB 2D0FA 2P5WA 5T5FA 1S7QB 5I17A 4LQ1A 4CCMA 2A4ZA 1KDMA 3UKNA 4AXOA 5KWRA 4TUOB 4PGBB 1NFIB 3AQYA 4KKAC 3C60D 3KBHE 4G59C 3TPUB 3GI8H 3EXJA 4HMZA 1S7XB 3VXNA 4MH0E 3BN6A 5CADA 5I5RA 4MUVA 1KCLA 1T83C 4ZZKA 4JFFB 2JLPA 4RMTA 3MA9L 5C0AB 1AF9A 2A1WH 3HG5A 4JFTA 3MLVH 3ES6B 4NLHA 3BP5B 5H37H 2AEIT 1GYVA 2PW1A 4D0BB 3Q9OA 2VDKH 3REVB 1UM6H 2VLME 3QNYB 1MJ7L 5LA9A 5K7PA 2BRRL 3O6ML 4ZUUB 2VDQL 2EVJA 4QOKE 2L04A 1X7QA 3ZYJB 4MJ5A 4H5SB 2EILB 1AXSB 5J6GB 4U3CA 2ZX3A 2ZP9A 5E94B 2Z8WC 2RVAA 2P5WB 2MCMA 5I17B 1DQ0A 1KZQA 1LO4L 5E5LA 4B4QA 4Z8BA 3PJSA 3ULVD 1ASJ1 4L23A 2O1QA 2QZ3A 4MO3M 4HMCA 3DTXA 3NN8A 3C5SB 5D4HA 1KLUA 1WZ1H 3QIWA 4HJTA 4OIAA 2VDRH 3THTA 1XH2A 3VXNB 5D7JD 1CMOA 3IDUA 4ZJ9A 2BM3A 1PMJX 2G5UA 2X9ZA 2GNDA 4YHZL 2BHZA 1JZ5A 4PQ9A 4GMSL 4HK0A 3RTLA 3V7MA 2Q8AL 1YO4A 2DM2A 2PW1B 1XV8A 3C5ZA 2HPOA 4TUKL 5F7FA 1FH2A 1ZCRA 4DEUA 1QKQA 4XFIA 5FWEA 4PJHF 4C56E 5TF0A 4KXCA 1SOQA 2DD8H 3I9GL 4L9LC 4OCYL 4MJ5B 3HT1A 2VW1A 5KHKA 5T1LD 1CGSH 3UTPD 5IFJA 1BEV3 3IJ8A 3TJHC 4D9QE 5C0RH 5JI9A 5EEWA 4ZUTA 1RXLA 4P59H 1JD7A 3L17A 4NYLA 1ODNA 3PJSB 2D6NA 3TCXA 2AEPL 4BUGA 2FECI 2WUHA 1RU9H 3NN8B 2XG5A 5IK3B 1JZ6A 1KLUB 2DQCH 3QIWB 5ALCH 1FNLA 1WT5C 1PIV3 3LS4H 4QYOA 1PBYA 3NNJA 1Q4NX 4A7GF 5FYKU 2W47A 4GIQA 1AXTL 3JZ7A 1SY6A 3RL1A 2YN5A 2A9AA 5I30L 1IGOA 1VBD2 1MCCA 4HK0B 3LEXA 5FOBA 2HCZX 2UZIL 1DYKA 2RACA 1UUNA 3C5ZB 5SX5K 1BMV1 3C3VA 1QDCA 5IB5A 2XDHA 5CLWA 3NJIA 1VFBA 3AP9A 2NY2B 3IFLH 1NMAH 4HJEA 2UURA 2A9BA 3EJZC 3THCA 3BFQG 4FQPA 3MJ7A 3NAPA 5IFJB 4IV3C 4LSVL 4QHZA 3D52A 3WNKA 1AMXA 4ZUTB 3KPRE 2NSMA 2CBMA 3AUWB 3H9SD 4NYLB 2WYZA 5LNEA 4ACTA 4JAAA 4LORA 3QR2A 1VDGA 2FJSA 3FU8A 3M07A 3ARDD 2XG5B 2OBGA 4M1DL 4GWNA 1UY2A 2HTKD 5CHNA 4D3WA 5I91A 1WDAA 3KJ6L 4QYOB 3RQ3A 3J7MA 4Y16C 1MREH 4G71B 5GZNC 4TL5A 3HRZA 3RL1B 3QYMA 4MADA 4OI1A 1RUQH 4BQ5A 3LEXB 3TOPA 1DVQA 4QPGA 1H6FA 2EIBA 1ASJ2 2VOTA 3O0VA 2NY3B 5IB5B 3W0WA 3FPXA 1IU1A 5CR1A 3H55A 1UCTA 1VFBB 4LSPL 5IVEA 2ZPKL 1LD9A 4BWTA 3MJ7B 3CU7A 1BQLL 1DE4A 3MLXL 2P26A 2BNMA 3MZGB 5FLHA 2CGPA 3V0AC 1GCYA 1W8UA 2W94A 2IH9A 4JVPA 3HAEG 3Q2CA 1TJHH 3CLWA 3KR3H 3PDOA 4H8QA 2JVUA 2NYKA 4KXBA 5CEHA 2R83A 5JLZA 1GOFA 1G1YA 1J1PL 1ODAA 4JCMA 5C0CA 2BY0A 3OXRA 5CHNB 1U8IA 2UXTA 1AR72 1DGRA 1VERA 1YYLL 5BNOC 4M1CC 2ZOLA 2YFNA 1KNOB 1B6DA 2X1OA 2AFNA 3HRZB 4FYSA 3U7WL 1Y7BA 5CZVL 3D6EA 2O5XH 2DYPA 2WBKA 4QPGB 1LEDA 3SBWC 4XP5L 1YC61 2ZGMA 1DANU 4M48L 2VMDA 3W0WB 4JB9H 4YG0A 1MDTA 3O2WH 3TZVC 4AYEC 3GFUA 3MGUA 3WXWH 3A3YB 4NP9A 3QJRB 5BCAA 1LD9B 5BNQA 2RDQA 1NC4A 2X6MA 1KYOK 3SYOA 1AJOA 4NZTH 5LASA 3FF8A 3LQAL 1HESA 4APQD 2RGSA 3G3LA 3GBDA 3VHPA 3PDOB 4A4AA 2AXGA 2VZVA 4LU5H 3BLKA 5C0CB 4TVUA 5JLZB 3EYSL 2XPJA 3OXRB 1R3IL 1U8IB 3MX0A 3ZN4A 2BIOA 2BXYA 2ZOLB 4QXUL 3BAIA 2EE6A 3V4UL 4BUQA 1QO3A 2DH2A 4XCAA 1SM3H 3MV7D 1BMWA 3DX0A 4XPHH 2DYPB 1LAJA 4KQ4H 1UCXA 1GRWA 2JJTC 4WO0A 5DLMH 5FM5M 3DJTA 1XBDA 1J0KA 2BIPA 2F18A 3BKJH 3LNDA 5IJRA 3VKLA 3MNVA 3IBEA 2XSKA 2JCCF 2FRGP 4OW6A 4NZUH 4WJ5A 5EU6A 1YFXA 3NNMA 1E5AA 4Y1AE 1NC4B 5L4JA 1PVXA 4GINA 3O3UN 1ZBA2 3CFTA 3MLUL 1A78A 1JZIA 1P1VA 5LGHL 4EZLA 3N44B 4XVSH 2G75B 4UV4L 2AXGB 1FGNL 4FA8A 4Q9RH 4OQTA 4YZ4A 1FNHA 1QO3B 1T80A 1TZGL 1XF5A 4PJAE 5B8CC 1RUAH 2XZQH 7CGTA 1P7QD 5I1JH 4WO4D 1BA9A 5T52A 4K5OA 3SJVA 3WT3A 1BZOA 1D5IH 1O7DE 1JRHL 3II3A 4XMTA 2XZZA 4CU9A 3I6GA 4PJ5E 3MNVB 1E90A 1E6JH 4FZ8H 4HAKA 1AI1H 4WJ5B 5EU6B 5D7SL 4M93B 4RETB 4LCIL 4WFHD 1S7RA 4KJQC 4RA0C 2BERA 1AXYA 2GFBA 4YBHA 2RM21 4HH8A 2YBRA 4KROD 1UD2A 5AC91 1PZCA 2PR9A 3QJOA 2F54E 4JO2L 1MNNA 3VI4E 1YEHL 1SFNA 5I73B 4B7IA 2K9ZA 4JQIL 4FGMA 1H30A 1BK0A 5T3XH 4FTVD 2X1WL 2ATAA 2W68A 2Z31A 1MIEH 4YGAB 4XQ4A 3WIHA 2K78A 2QR0A 2A6JA 3L3JA 1XF5B 2DEXX 1G1KA 4HCRL 4UIKH 2ZNWA 3CKHA 3CVIH 3SJVB 4UOZA 4OT1L 3JCIA 3ZE0B 3A0OA 1TZAA 2DIJA 5I76A 2WJ5A 1S9YA 3I6GB 3NZUA 3PGFL 4R0LC 4TUJA 4Y1VA 3BFOA 5EN2A 4LO9A 2CHZA 3UJTH 5AAWC 4XILA 4PIBA 3VXRB 1S7RB 3B93A 3ZFGC 1UZYA 1NOFA 2GFBB 1T1XA 1NIAA 4J8QA 3ZTNL 2YBRB 3R1GH 3E5UA 4IEXA 1HRV1 2XDVA 5B21A 2FWSA 4MNQA 1MR5A 5FZOB 1Z2KA 1CZVA 3RIFF 1TYJA 2ET1A 4YO0A 1KXVA 2GDFA 2Y7QA 2WRAA 3QWOA 3BZFA 1CIUA 2DWXA 3MJ9L 3NA9L 4LBEA 3SGJC 4EKJA 3W5NA 1QYGL 2JDKA 2Z31B 3IMNA 5C9KA 4OLXH 4IOFC 3OLDA 2QR0B 2A6JB 3L3JB 4QMAA 2H32H 1SLXA 3O6KH 3CQQA 5AOJA 2P37A 3F01A 4XC1H 4AWJC 3VXTA 1DZRA 4KNCA 5KXDA 1JGUH 2G5RA 3JUZA 1UYYA 3BWUC 4JL2A 4NUMA 5I76B 1MHPL 1S9YB 4FG4A 5J1TC 4TUJB 5BW7C 5B1CA 4Q4W1 4GS7C 5EN2B 5F32A 5L9BA 4NQXA 4PJDF 4AQ1C 1P0SE 4AYBA 2X4SA 4ODTH 6CGTA 2BIMA 5T3XE 4CDXA 2GTZA 3K3QA 1T1XB 1V6LA 4KOCA 5EZWA 2CL2A 2COQA 3T0AA 4AFBA 2WZ5A 3WE6A 4MNQB 3K6DA 2J1SA 4I0AA 1QFUH 4UFHA 3OBTA 4YO0B 1T04A 2Y7QB 2ZGRA 3ZHKA 2IH3A 3ATFA 3BZFB 3QWOB 1R1A3 4LBEB 4JPKL 4NRZA 3VDAA 5IVXA 1W06A 2GI0A 3MW4A 2X10A 3QBTB 1QHQA 1UYPA 1JZHA 5GHWL 3KGTA 4XNZB 5EPMA 2OX0A 4JO1L 5G4MA 5FS5A 5KN5A 2Y8KA 4NT6A 1YJKA 4R96A 4NWVA 3F2ZA 1S7TA 3DV6A 4BFRA 3VXTB 4E4ZA 1E5UI 3VM7A 4H7MA 2IWGA 4TNVK 2AQ2A 4LJHA 3UNPA 2Y6JA 4P9HL 4TN9A 3LDBA 2YKLH 3CLPA 4NQXB 4CDXB 2VXQA 2X4SB 2GTZB 4CN6A 2QPFA 2WY3B 4MGSA 1FT9A 3U37A 4LLDA 4TVPD 1X3DA 5AOMA 2P5BA 2N0MA 3WE6B 1ZVFA 4BXFA 1OLMA 1NGWA 4QRRD 1HB3A 2WWMC 4YMPA 3MIEA 1T04B 1MHEA 4BFGA 3RILA 2IH3B 4H8PA 4D7YA 4NRZB 5IVXB 4XHJC 2C7FA 5EPMB 4HZLA 1E28A 2FLRT 4N2AA 5KN5B 4EZ4A 4NT6B 4R96B 2EEAA 3ZQ9A 4C4BA 1S7TB 1ACYL 3DV6B 1HRV2 1RVF3 1NJ9A 1BOGA 3BPLB 5EIIA 2IWGB 4FTDA 4X4KA 4LA2A 2PYEA 4JZJC 2F7OA 4PV1C 4C1WA 3INUL 3LDBB 3SDCA 1PGSA 5FIEA 3A47A 4PJEA 4Z8FL 5GRUH 2W52A 3H4FA 1YECL 3B8YA 4DCQA 4JHTA 3FQWA 1PZAA 4LLDB 4I3GA 2PF6A 3UX9B 4HUKB 1E6OL 2Y26A 1NGWB 4YZFE 3NACH 2ISDA 4YG3A 1MHEB 1O7DC 2XBDA 4Q4W2 2CJSA 3BVDB 4Y26A 2XACC 4OZXA 1DP0A 3RWJA 4HZLB 1E28B 2PO6D 3M3EA 3L1OH 1C5CL 1G6RL 2VCAA 3KG5A 2R063 2FLMA 2ZCHH 2KHAA 2C1FA 5EU3A 1NJ9B 1BOGB 5EIIB 3S88L 3KVQA 2YC0A 2PYEB 1T4WA 3VDDA 1FV1A 1JPSH 4J3VA 2HVKA 2MKWA 3SDCB 4YVWA 4E42A 4PJEB 3UTSE 4H4NA 4FQXD 4NNPL 3MAWA 4Z77A 3WMSA 3GMNA 4WK4B 4EUPG 4DCQB 5L2KA 2EACA 2IAMC 3FQWB 4AVBA 5JYLA 3ZX7A 4K94H 1YQVH 3CMOH 4WI3A 3N42F 5FECB 4NO3A 5I5MA 2QZ2A 3KM1A 1KV7A 4HWEL 1Z7S2 4ZTPH 3IFNH 2HH0H 3LNFA 4WUKL 2MPFA 3CZUA 5A6QA 5JZGA 3LNEA 2WXIA 4YSSA 1LILA 3S96A 4GH4A 3RWJB 5JW5A 1V6OA 2BP6A 3NW4A 1OP5H 2JELH 2VYRE 5B4NA 1Z3GH 4HLZH 5EU3B 3L3GA 2H8PA 4BFNA 5IIEA 4QAMB 4HKJA 2QQLL 4R83A 3V0WH 1QSVA 4LF3A 3B9VA 1RVFL 3VDDB 4P3CL 2Q8OA 1FV1B 1A21A 1TQCC 2HVKB 4NQEA 2GAUA 4WGWB 3WUDA 3RG1C 1BIHA 4E42B 5E00A 4YVWB 4B9CA 1U41A 4Z77B 4N7IA 1ZV9A 4ODVH 1M06G 3GMNB 5L2KB 4GT7A 2GMEA 5C8WA 4FABL 1DVUA 5KS9E 3ZE1F 4PG9A 2ZGUA 4OLZL 1TTUA 3GHBL 3QH7A 3POCA 4PWGA 4AEJA 25C8H 3FT0A 4NO3B 3RWHA 3QACA 1EVTC 5DDHA 4IE6A 1F2XK 5A33A 3EDDA 2PWDA 3CZUB 2FB4L 5JZGB 5HVFB 2DS4A 3GLAA 4YH6A 5IBLD 1O4TA 3GPEA 3F64A 5T8IA 3S96B 4GH4B 5JW5B 2XKPA 2OUHA 3A67L 5HD8D 1V8HA 1BYPA 1OTSD 3VKFC 5GZCA 3ARGA 1KFGA 4DIQA 5E1AA 3L3GB 5IIEB 4HKJB 1F6AA 3D05A 4LF3B 3SGEI 4XP6L 1P5VA 3OPZA 4K1YA 4NQEB 1PG7H 2B1HL 1CTNA 5H37G 3S35X 2W5FA 4HIXL 5DZAA 4Z7IA 3V65A 2VW6A 5LBCA 1O5PA 1IGCH 1DBJL 2OTWA 3HLAB 5L4MA 1CD3G 4PG9B 2J43A 4JL1A 4CP2A 3WR0A 3RWHB 3LHPL 1USQA 5DDHB 5A33B 4P2RA 3TLRA 1IQAA 1HK6A 1ED3A 4XOEA 2ICWJ 2EUZA 2ZCWA 2NY4C 4HK8A 2K7PA 2EEBA 4R8WL 2NY1D 5FP9A 2UWEA 3ARGB 4YNYA 5E1AB 1PD6A 2AVFA 1KB9J 4XXWA 5JIMA 3C09B 1F6AB 3DBSA 3F7VA 3MLRL 4EI6A 3B1TA 1P5VB 1JCKA 2QFRA 2W9EL 1FL5A 1W0PA 4U3SA 2B4CL 3IXTA 5CJQL 4FL4C 5DFVD 3TL5A 2JJVA 2OL3L 4EI5C 6FABL 1QY4A 2OTWB 1OQOA 3PIQA 4NKMA 1OGSA 3MQIA 5AAMC 1ODMA 3P73A 1NSNL 1ZHKB 4HFSA 4LBQA 1OAQL 3BLBA 4P2RB 5IHUH 5FXXA 2BIHA 3ABMB 1ED3B 1M3JA 4HZFA 2UVFA 3GB7A 3L4ZA 4JPVH 3VSQA 2VXUL 2WKOF 4W65A 3OX8A 2UWEB 1JZ3A 4YNYB 2BLFA 3GRWH 2CDFA 1DEDA 2IANB 2VDOL 3BUYA 4N5ED 1XMWA 2RBLA 3F7VB 4YBQD 5BV7B 4OD1H 4MOAA 4Q6IC 4EI6B 3OPWA 2HLFC 2W92A 4JFFD 5C07A 3V5HA 4LSUL 1FL5B 5JNYA 3N9OA 4P5RA 4U3SB 3PXLA 1IC0A 3IXTB 1WMFA 3I02A 4A2DA 4UFMA 3DVNA 2GAZA 4FX5A 3PIQB 5EFUA 3CFDA 4NKMB 5SV3A 2J4WH 1KF9B 3IB4A 4W4OA 4META 5KXEA 3DETD 3TBSA 1KJRA 4LBQB 4QQHA 4ONOA 2YRBA 3JBG3 1O7VA 1VADA 1ICTA 1CAWA 2VQ0A 3PWUA 2YK1L 4Q2ZA 2NQCA 4QRPE 1JP5A 2F7QA 1QWUA 2ITFA 3OL2A 3GB7B 4XDQA 4W68A 4UQAA 3OGOE 2P5WD 5F6HI 3V55A 1JTZX 4TNWK 2KM2A 1NAMA 4HUNB 2V5YA 3POBA 5DUML 1JHNA 3OX8B 4NUBA 5CZKA 1RK0B 3BSHA 4KKZA 4CJ0A 3BUYB 4Y33A 5IHZA 2W88A 2XOTA 4KRPC 3MV9A 3POHA 2Q8CA 3C6SA 5C07B 3D30A 3MRFA 5JNYB 4E68A 2OVUA 1UFGA 3CNKA 2WP3O 5FK7A 5E6ZA 3L9BA 1MFVA 4K3JL 5F3FA 1CFBA 3I02B 4RGNC 4GKOA 4ACPA 4Z7OE 3DVNB 4BIFA 2GAZB 5B1BB 1OPMA 3CFDB 1QKZH 4Y20A 1CFMA 2I25N 4LP4A 4DN4L 4P23A 3TEZA 3VQ1C 3TBSB 1AR93 3SKVA 1EHNA 2FBOJ 2NDFA 3S37X 1VADB 1CAWB 2NPLX 4PW9A 1J18A 3PWUB 4TQEL 2QMKA 3JVGA 2WSPA 4Q2ZB 3N50A 2CKBH 5D71L 3T3PE 4DKTA 1RIHH 4EIBA 1TEGA 4AYDC 3RYMA 1DBNA 1NAMB 4TQIA 3N4MA 3VQMA 1KGYA 2ETEA 2XKUA 3FH7A 5AZUA 2R69A 4LOTA 1C8QA 3QIWD 4CCDA 4BQ8A 3EFOA 4FLSA 3TO4C 1IIIA 5IHZB 4FFHA 1EANA 3S5YA 3HC4H 3MV9B 4GBXA 5DVMA 4UTAL 4P05A 2QPUA 3C6SB 4RAVA 5IMKA 1MFDL 3MRFB 3ZW3A 1UY4A 1ERNA 2XLGA 4HS8H 1CVRA 3MCLH 3T6VA 2MNJB 5L8KB 2Q87A 1YY8A 3IJSB 4ZUVA 3ZYFA 3C5ZD 4WV8A 2J1YA 4LBKA 4Y20B 1BJ1J 2VLRE 4P23B 4NPMA 2NYZA 4E41A 3DXAE 1KCUH 1ZHBA 1FZJA 2NY2D 1WD4A 2WA4A 2W07A 2OMTA 3AP7A 4K94C 4XNUH 3CL1A 4ORGA 2J22A 3ZYGA 1U36A 3MREA 4G9DA 3FU9A 1PHMA 1QJX3 2F8IA 5I6XB 3ZN5A 4W4NA 3WW3A 1UOFA 3ABLB 2WXPA 1J3PA 4B9IA 3AL5A 3KD4A 1PS3A 3ZXAC 3EFOB 1GGIL 2CPUA 4Y89A 2E27L 4GBXB 1IILE 3OGVA 1DJZA 5IMKB 3ZOIA 3MA9H 4YLBA 4JQXA 2BNQA 3HI1A 4A7TA 3BVWA 3W9EA 3RI5K 2P5EE 1YY8B 4ZUVB 4AGNA 3VG0L 4IV1A 5D1QD 4U1SA 3D18A 4URAA 1MJ7H 1W6LA 2BRRH 1IBBA 3NSXA 3O6MH 4E41B 2CBOA 2VDQH 1ZHBB 1FZJB 4BFIA 1WE5A 2D7PA 5BOJA 2W07B 2OMTB 3DJZA 3JTSA 3KGUA 1MCOL 3MGTA 4JHBA 4CC4A 2CCVA 3N0AA 2OSYA 3TVMA 2EDMA 4ORGB 1A6UL 1LO4H 3MREB 4G9DB 4LCWA 1NIFA 3TH2T 2ZKNA 2ZP8A 3AXDA 4NB7A 2RR11 3OB0H 1AX2A 2O5NA 1WLTA 3DROA 3ULVL 4Q1RA 2XUWA 4LHLA 4M3HA 1T7XA 4KJPD 1WAAA 2WNVC 2BNQB 3HI1B 3OAWA 3W9EB 2FZ1A 4GMSH 1SF3A 3V0HA 2Q8AH 4HLJA 3SCMC 3B5HA 4TUKH 3KGLA 4G6KL 4IV1B 4U1SB 3D18B 5I0ZA 3W0WD 4OKDA 2XBZA 5F7YC 5FUCC 4ANKA 1EPZA 3OSKA 4H8UA 3WUZA 3CZSA 2CU5A 2V4VA 3GZKA 3KCWA 3I9GH 3IJYA 2OV0A 4OCYH 3PL6A 2MJWA 3JTSB 3MGTB 3Q3GA 5FMCA 1XB6A 3TVMB 4F15C 5J12B 4LCWB 2YPLA 1O7FA 2F6AA 1MCWW 2O4EA 2CXGA 3QDMA 3WF1A 2AEPH 2VTXA 5C0CD 1KIRA 3MRRA 3HFFA 2XQ0A 5CWSA 4XCEA 5J13C 3E0GA 1S46A 1SHMA 3DROB 1EHLL 2Z1KA 1B4LA 4PRBA 5HI3D 1AXTH 1NCHA 1KFUL 5I30H 3IGLA 4IRJB 3ZDYB 1EXHA 1I1RA 2DYPD 1XDTT 2GQHA 1JYTA 2UZIH 1J1OL 4ZO9A 2Z91A 5E9NA 3UG4A 5GLUA 1G7MA 4FHBD 3FQYA 2XXFA 3GJFA 4AGOA 1G94A 2BEOA 1A4BA 1U3HC 3LZLA 4TLFA 3IJYB 4G8GA 3PL6B 3BAEL 3Q3GB 2HT2C 1AAJA 3D08A 4NFCA 1NC4D 5D1XA 1K5WA 4XJZA 4NN6B 4LSVH 3O1TA 2XL9A 2YPLB 1TR7A 4MXQD 3QDMB 4AYSA 1MPXA 1IBZA 4KFZC 4NWUL 1KIRB 3SXWA 1WGOA 2WLYA 3MRRB 3IDIA 4XCEB 5CWSB 2PLV1 4XOGA 5KUMA 5FXZA 1AYOA 3EBRA 3KJ6H 3UJIL 4HW6A 1XSJA 2R2BA 4JQVC 4PRBB 2HZHA 3EBAA 3HW7A 1M7IA 5E70A 5GS1C 3NRPA 4LK6A 2I85A 1XCTA 3RLSA 3TCLA 3GSNL 2WQ4A 4LSQL 1YIFA 2PYTA 1AR73 1KJ2H 3POWA 2Z91B 1BMGA 1G7MB 1G7LA 2RJKA 3GJFB 3KXFE 4LSPH 1UT9A 3E3QE 4NJAL 4ZMPA 4G8GB 4IGBC 4QT5A 5EU6D 1UGKA 4KO6A 1S55A 3E8UL 4JPIA 1BQLH 3DIVA 5D1XB 4PB9L 4R4BA 5DZVA 5E9DE 3MLXH 1RJLA 4Y5XC 4HIHB 2VCMA 4GUQA 2Y3NA 3RY5A 3JU9A 5KJ4A 4F7KA 4UNIA 1J1PH 3IDIB 1ET5A 3NABL 5C09D 2XXZA 2ZPXA 2ZJCA 2YSTA 3S5QA 4JG0L 1YYLH 4EVNA 2R2BB 3VI3E 4HU2A 3K71A 4G8IB 3KLKA 3N1FC 4K5NA 1M7IB 4K73A 4OGXL 2GJ6E 1I3RA 3QCVL 2BWIA 1XCTB 5D6DC 3TCLB 3U7WH 4G43A 3NIFE 5CZVH 3SJVD 4UOW0 2A74C 5C8CC 4IE0A 3SPCA 1EZSA 4XP5H 2PPAA 4H0IA 3RVUD 4DFHA 1L0PA 1VFOA 3EYVA 3KS0J 3BQUC 1CJYA 5HDBF 1G7LB 5GS0H 1H9VA 2BPBA 1JNNL 5DK0A 3FBYA 1C8PA 3VXRD 4QT5B 3N43B 1XYOA 4JPIB 2D3RA 4PS8A 5FM8A 4GMP0 4GMTL 4FOMA 4R4BB 1RJLB 4D8OA 3B2DC 3LQAH 1L7LA 2H0JA 3NA4A 5EJZB 3S7IA 3PNRB 3DN7A 5LKNA 1WGPA 1X4XA 3TYGL 3EYSH 1R3IH 4ODWA 2NSQA 1S9VA 3U2JA 4EVNB 2EEXA 3H8NA 1JVOA 4QXUH 1S4IA 3K71B 2YLKA 1K2DA 3H3KA 1OB0A 3V4UH 3OD0A 1I3RB 3QE5A 4XVUC 5J1XA 4AUYA 4LIQL 3KQRA 4G43B 5BXXA 1NCRC 1KTRL 1IKOP 1RQ5A 3D0VA 2WVTA 4U33A 3EYVB 5D4IA 1DZQA 2PLV2 2ZKWA 1WCBA 1F8VA 3AFLA 5DK0B 5TQ2L 4XVTL 4HK3N 3V0VA 3BMVA 5A2KH 3ABGA 3WG7B 4IIQA 1WTGT 3N04A 3MLUH 2DJMA 2VSDA 1RUD1 4MNQD 1RUJ2 1SBFA 1KBBA 3VXUE 4U2AA 2WUBL 5FZ9A 2ZX6A 3MRLA 5E2TL 1Z32X 2AJVH 1WWBX 3TXAA 4HGWB 3K6FA 1RIVH 4MX7A 1IL1A 1FGNH 4NC2B 4DWHA 3DSNA 3FYIB 2JSFA 4ODWB 1S9VB 5E88A 2HJLA 1K2DB 2W38A 2A9MH 1TZGH 2VERA 4BQ9A 2J6EA 4AEKA 2CIIA 2FQFA 3AY2A 4I0WB 5I74B 4AEMA 3D0VB 2IZWA 1WCKA 1ILUA 1JRHH 2LQRA 2YPVL 4OMCA 1G4MA 1PNDA 2O93L 4E9LA 1ZPUA 2Q8BL 2DUQA 1WCBB 1ZPLA 4OLLA 4QXWA 3ASOB 4COZA 3V0VB 5D7SH 2UWBA 1TVBA 1JGEA 1DVFC 5CFHA 4IIQB 1NWPA 2F2HA 2GNBA 4B9KC 4Y4FC 5BRPA 4QXVA 4LCUA 3KGSA 3DDGA 5HGAA 3KPPA 3MRLB 4JO2H 5C0BE 4S2DA 4ZG1A 2EXTA 1YEHH 2GJZB 1OF2A 3PLYA 4JQIH 4MX7B 1IL1B 3UTTA 5JHAA 1J86A 1AKPA 3I3QA 3DSNB 1FVCA 1Q0XL 4QKXB 4MHRA 1EDHA 5DVOA 5FXWA 2HJLB 1HZHL 1GCFA 1PZSA 1YMHA 4HCRH 4HLZG 2CIIB 1BMZA 1RK7A 5IQOA 4PJIA 2YGPA 4Q14A 4XP4H 3D4GA 4OT1H 4WI0A 2APFA 4HFUL 1WRFA 3KLHC 1QSEE 3PGFH 2MHFA 5GRXG 4XZUA 1NICA 3BYWA 2XJPA 4HKXA 1KCBA 2OZNA 3O0WA 1TVBB 1KS4A 1JGEB 1DLFL 2IMNA 4YHPA 4P2OA 5DC0A 2E74C 1JS9A 1LULA 1NOLA 2YD7A 4LCUB 5HGAB 1KEML 3KPPB 2Z5WA 1GJUA 2CGNA 1OF2B 2VM9A 3G6JF 5DFAA 5FV2A 3UTTB 1ZVNA 2R30A 5FGBC 3OB0K 3MJ9H 3NA9H 1FVCB 4PIZA 1QYGH 1GIGL 2BWCA 3I9AA 4BA8A 2VNCA 3BT2L 3FUKA 2A6XA 3C87A 1YMHB 3E3QC 2E7AA 1N3OA 1T89C 3OC5A 4TLTA 4PJIB 4U3HA 4LDCA 4XRCA 5F1NA 3A24A 5EUOF 1RUD2 4W6WA 5J98B 5KSAC 4MGZE 3TBDA 4WI0B 2PYED 5D1ZC 1MHPH 3KBFA 3LXUX 3HR6A 3LKSA 3SDCD 4XZUB 2X12A 4HKXB 3S2CA 4GP5B 1MZ5A 5FZGA 1A6PA 4P2OB 4YHPB 4KITB 1YEFL 2DBNA 2ORBL 1J5OL 1PO21 1THCA 2JJ6A 4LXLA 1BVKA 1OWRM 2FYVA 3HBKA 3RKDC 1BFTA 1E3XA 3NCEB 1MCDA 1H3PL 3NJNA 1FYTE 2KS0A 4KKLC 2VL5A 3BPNB 4JO1H 1JD9A 5F1NB 4XRCB 1PZ2A 4W6WB 2VMEA 2YGVA 4W9ZA 2D6PA 2ARXA 3CXHK 2ITCA 4R4FL 1VMJA 4P9HH 4YLZA 3LKSB 1XGTA 1H6YA 1LOGA 2CXKA 5MEOA 2XOMA 5IROA 1HVXA 3KCYA 5L2KD 2V5MA 3OR7A 1V7NL 1ZGLA 3VGBA 3WKPA 1CB4A 3MCYA 5HY9A 2CR6A 2DQUL 4MLSA 3LKOA 5FUOL 2XXMB 1BVKB 3L48A 1CXIA 1CGXA 2EUVA 2VZRA 4LLFA 4TVPL 4KY1L 3VE0A 4O61A 5A3TA 4Y19A 1QDOA 2VL5B 3VWKA 4AE2A 1WUVA 2DTYA 2GCYA 3O4LD 3UXFA 1W0YT 1KCSL 1UKQA 1CFQA 2H3NA 1ACYH 4QO1A 2D7MA 4KJWC 2SODB 5DHVH 3IDCB 3GMOA 3L2LA 2ITCB 3PPEA 4NIYE 4YQXL 2ZP0T 5G4NA 3DO3A 3SE6A 3I2HA 3KF5A 3INUH 1XGTB 2DMBA 3RWKX 1USZA 1YSOA 2NXZB 5MEOB 2X6BA 4YGBA 1HKDA 5FYSA 2G2RA 3NIGF 1YECH 3OR7B 1OL0A 1ZGLB 3MV11 1WBLA 3VN4A 4JVUA 4N2CA 5HY9B 3O6FC 5GS0C 1H2NA 3WMQA 1E6OH 2EDWA 1WICA 3LKOB 3UYRH 4F8OA 5JPMC 4LKDA 4PLOA 4PCTA 1EFXD 1POV0 5AKSA 2OTUA 4N28A 1HJGA 4FG6C 2RMU1 4YNIA 3LF7A 3QOPA 3IBOA 3VE0B 2HLEB 4LPYA 3LQAC 4Y19B 3B2VH 3P3UA 3VWKB 3U2IA 2QDWA 2WQUA 2GCYB 1ND2C 1G6RH 5FR3A 3H42L 3ARGD 2H3NB 1CFQB 4QO1B 1Z7S3 2RE9A 1PZ3A 5FYYA 3HBPA 3C75A 3GMOB 2A38A 3WJJC 3S88H 5LG1A 4X4YB 4C4KO 3VBSA 4XHQA 2K4WA 2DDUA 2FQEA 5FAXA 3ARTA 5ACA3 2VZOA 3ORJA 3CFJA 2EAKA 1BZ7A 4NNPH 5CBEA 1ULPA 1L7IH 2G2RB 4LP8A 5TGBA 3Q8BA 2CM5A 4XURA 1O5DT 4XAKE 1GNYA 2NNRA 3UBXA 4PLOB 1T2XA 1S9XA 4I3PA 5I19L 4JM2C 1IC7L 4P2RD 1JIBA 1WW4A 4HWEH 2OTUB 2Q76A 1GKEA 4WUKH 2P49B 5GISL 5DZPA 1LDPL 1JODA 2GTWA 3DARA 3ZYIA 2W9XA 1Q72L 5HI4C 3VBRC 4FQJL 4CCJA 3QSKB 4EN3D 2NP0A 3CK0L 4LEBA 1PIFA 2BSSB 5FF6A 1TMF3 2IGFL 5BNXD 2QQLH 1WBXA 2VITA 2Q7YB 4OZIB 3CX5K 5ELIA 1RVFH 2DWDA 4J8RB 3VBSB 1ZBE1 1YG9A 3OJMB 4PCSA 1DYOA 5E8OA 3CFJB 2BFUS 5FHAL 1BZ7B 5CBEB 2ENPA 3DHJA 2NY6D 3IPBA 2R16A 5TGBB 3QT2A 1O6VA 3RGVC 4FABH 1LO3H 1C3HA 3QAZB 2IDTA 5AAWA 3FBQA 1KMGA 1ZRUA 3GHBH 3UBXB 3CHQA 4JBSA 4LBQD 3T4VA 1S9XB 2IXJA 3L45A 4XR8C 5I1CH 1C4RA 2C3HA 2FB4H 2Q76B 4E5XG 3EJTA 1I8AA 4B50A 2H9GA 3M6DA 2GTWB 2VDLL 4SLIA 3A67H 3FJSA 2YGOA 3KPSA 4I77L 4AQOA 1UJ3C 2A3TA 4BFKA 3O8XC 1LOBA 1IBGL 4XP9L 1KT2A 2IJ0C 4JGZC 5FF6B 2ZHNA 1WBXB 2VITB 4UMSA 2DWDB 4XP6H 1ND3A 2WD0A 5C07D 1UEMA 2B1HH 1KDIA 4ZW8A 2RMU2 1PKQE 3JVFC 4HIXH 4JFZL 4PJXE 5E8OB 4F24A 3DJ9A 1DBJH 3P0VL 1ZLWH 1YO8A 2NNFA 3V0JA 5BRQA 3MBED 1L9OA 2H6PA 1DANT 3ZIMA 3LHPH 5A6YA 3DO7B 1KXHA 4CDGC 3UTZA 1VMFA 1HWHB 4B9ZA 5EBLA 1R17A 4ZMTA 1URXA 2H9GB 3V5DA 5FZEA 4PT6A 2DV6A 4R8WH 2WLIA 5SWZD 3KPSB 3GF8A 4F27A 4U31A 2XGXA 2GH8A 1YMMA 3Q6GL 5FK8A 1KT2B 4IS6A 4KNUA 3ZLIA 2G3NA 3MLRH 4WI8A 1M53A 3MV9D 3WLBA 4L8BA 4LBAA 2AJUL 4AGLA 1URLA 4E9VA 1ND3B 1WFUA 2W9EH 2WKKA 2B4CH 5CJQH 6FABH 4ZX5A 1VSCA 1YVLA 1BBJB 1Y7VA 2JWYA 3AJYA 4EWAA 2C9UA 1U0QA 3VMNA 4XP1L 4P23D 1NSNH 2H6PB 5F3IA 3MC0A 2XLFA 2XTJE 2XT1B 1OAQH 1TG8A 3UJOA 4TUUA 3UTZB 1R24A 2AJZA 3IDAA 3PQYA 5EBLB 1O5UA 3PMSA 4GQZA 2AS5M 4H0GA 1ZBE2 2ZMLA 4CRQA 5FY9A 2BPA2 3H9HA 3V5DB 1TETL 2VXUH 2WLIB 3OGSA 4I5BA 2Y7OA 1VJ2A 1YCSA 4UF7C 1YMMB 2HG0A 4I1RA 3SYPA 1T21B 2VDOH 3W2DL 4IS6B 1S0GA 3SISA 4EQVA 5CKQA 2QT6A 2VO8A 3SBQA 4GBXD 3WLBB 4L8BB 2YAOA 2YFUA 2OCCB 2QHLA 4R9HA 5K93A 2UY8A 4FOYA 2VDMH 1BVNT 1GKBA 3M7AA 3GK8L 2E8YA 4XX5A 1JJUA 5K9OA 4CKQA 1AR1B 1XB3A 5HGGS 1N6QL 3SE9H 2DTML 5DEJA 1YQ6A 4P46A 1ZZBA 4P9HC 2AZ5A 4E2OA 3FAWA 4UT9L 1MCEA 4CP1A 1R24B 2AJZB 4KWKA 3PQYB 2YK1H 4AQ2A 1W28A 2IEPA 2YAFA 2W65A 4Z7AA 3H9HB 2EDFA 2ARWA 3P40A 6TAAA 5DUMH 3LEGA 4KXAA 4MYWB 1PEWA 4Y24A 1FWXA 3S3SA 3SDDD 4QHOA 4NQCE 1WP6A 1OD5A 5HHVH 1UX7A 1FC1A 3VBUC 5AYQA 1AQMA 3KV5A 4CSTA 4CTEA 5F6LB 3M3OA 1P4IL 2J8OA 3QZMA 4K3JH 4UF0A 2DTSA 5K9OB 2NZ9C 4E9WA 3HVNA 3ZSMA 3HRPA 4P46B 2QDRA 5JXAL 5JIQA 4DN4H 4E9YA 1UD1A 4R8HA 4UQIM 3WXPA 1YDPA 3HI5L 3EO9L 4MYPA 4TQEH 5D71H 5AFBA 4HKBA 2FMYA 2OKXA 2W65B 2LTQB 5DC9B 5AVPA 4LEXH 2B1AL 4LCWD 2X5IC 5HJBA 3WFBL 3KPTA 1XCXA 2TRYA 1W05A 4LULA 5KSBA 5DAPA 2IWKA 5DXWA 4RMQA 1XEDA 4PN6A 4OQ9A 3M88A 4NSKB 4JKNA 2WXJA 1Z9OA 4HS6A 4XMKL 1AQHA 4UTAH 5HXMA 1X33A 1H3XA 3T71A 1MFDH 3EGDA 5F5QA 3LB6C 3QEGL 3N7KA 1LWRA 2ARCA 4UF0B 4GG6F 3BUQA 3GMPA 4QB1A 1CFSA 2K8QA 3LNIA 1ND0A 1U2YA 2WCSA 1OSPH 3NAAL 1Q5OA 1E8ZA 3SKMA 3WCRA 4IRZL 2FT6A 1QOOA 1T7YA 3FKUS 2A3XA 5C3RA 3IZOA 4GNKB 1YDPB 3NP3A 1LVEA 2VN7A 4HL0A 3L3IA 3WTXA 3PL6D 4Y4KA 1JW6A 2Y24A 4FQQA 4PCKA 5FUIA 4HKBB 2EDYA 3CFNA 1MI5B 4WW1A 5FZLA 2YPLD 4L29B 2B16A 3QDMD 3GPSA 3KL0A 5ANME 5KSBB 1J8RA 2Y0OA 4K55A 3DX1A 5IATA 4LBJA 2LOEA 4KPHL 4AZUA 5CGYC 4BHUA 2R071 2WFF3 4HS6B 2E27H 3Q5YA 3R0MA 1Q9OA 1OXCA 4CPBA 3EJSA 1Z66A 3EGDB 2QGBA 4LOVA 3WP4A 3PAYA 2WZPP 3RZZA 5CFDC 3GMPB 1CFSB 2BWDA 3CQPA 5JXEA 2IXKA 1ND0B 4PJ9C 3T2NL 3VG0H 2MQCA 3SKMB 3WKNA 4GAAA 4X9HA 4JRYA 2HKFL 1SY6L 4NNXA 3VXOA 2X4PA 3WNIA 3FUQA 3X1GA 1XH0A 2G4EA 4DW2L 3HQUA 1OSGA 2N1KA 3L3IB 4OHWA 2CBTA 4Y4KB 4FQQB 2YO3A 5FYCA 2DKUA 2WVUA 4GFTB 5D1XD 1CVNA 4FN0A 4WW1B 2IG2L 1AL23 4XFHA 3WY6A 2WCPA 3GSWA 3HCVA 1A6UH 5DU7A 3DKQA 4Z3FA 5EO1A 3V0EA 5C4WA 4K71C 2R9HC 1RJCA 1W15A 3CVDA 2GJJA 3H54A 1OP3H 4H7VA 4ORZC 3OLIA 3IGKA 1VZHA 1Q9OB 3M1HA 4BOWA 3ULVH 3QJHA 1RERA 1LOFA 1ZANH 5DA4A 1VBA2 3BWUF 3QFGA 1MH5A 4X42A 5E1HB 3BPOB 3M8OL 3WS6A 2WVSA 1F02I 4FE9A 4M0HA 2DWSA 3JWOL 3KWXA 3LV3A 4G6KH 5EIQA 5DT1L 3R0RA 4JRYB 4NNXB 3VXOB 1IM9A 2X3BA 2X4PB 1R5WA 7FABL 1DQLL 4FRWA 4R4ZA 2WWJA 1I82A 3ESVF 1E4HA 3FWEA 4D7BA 3HBGA 4TSAL 3RWFB 4A6SA 3FDWA 3GSWB 3HCVB 3OMNB 5CP7A 5C4WB 1Y4WA 5EO1B 3TRSB 2H5UA 1BDYA 3LMJL 2CLRA 5C9AC 4X6DE 2EE2A 5AVVB 4C90A 1I8KA 5E4EB 2JCWA 2Z65C 5BVPL 2YEZA 1MJ8L 4Z23A 5DHXB 1EHLH 1F2QA 1BVP1 3QJHB 4L4VA 3S3DB 4CEWA 5KC5A 4P3WA 3BRFA 1JOPA 5LBEA 2ZX1A 2LT9A 4OZHA 4QQPA 1MH5B 2YXMA 1DJIA 5I18L 1J1OH 3LV3B 5EZPA 2OZJA 4HJJL 4S1DC 1NCIA 4KVNL 1IM9B 1R5WB 1ZLWK 2CBPA 5D8AC 4E4SA 2B4CC 4EN2A 2R072 2EYSA 1BQUA 2VZTA 3CSPA 4PAZA 3L4YA 5EG6C 2WOYA 4AF9A 3BAEH 3OKLA 5FYTA 3L7EA 5EA0L 2FIKA 1I5PA 1XGPB 3RX5A 4ZMNA 2EA7A 5CP7B 2HX9A 3ULVE 2KDYA 3PP4L 4L11A 5C08A 1BEYL 2NT1A 2CLRB 2QQQA 1I8KB 2DDQL 2GBAA 1YQ8A 1FOD3 3JWNG 3EJCA 2YEZB 4KK8C 1HKLL 2HKXA 4UNTA 4L4VB 3VBHC 4CEWB 4LT5A 5E08L 2EE0A 4OZHB 3CDFA 1NGYA 3EKCA 3GSNH 1G9EA 4LSQH 1PZ7A 1ZZ7A 3L2HA 4EZHA 2K7QA 1MEXL 3SQOA 1BZQK 3GDBA 4LCYA 3FT9A 2J7LA 3P77A 1L7QA 2A6KA 4NJAH 1NFDE 2NX5E 3UDWC 1U4EA 4NZRL 2JIGA 2YZ4A 3UTPE 1IB5A 2WBJC 2XXGA 3AQDA 3L7EB 3OKLB 3H1MA 4PB9H 4GO9A 3PJYA 3KPLA 4QHKI 1ASPA 3C8HA 2FO1A 5C08B 5I71B 3QUMA 4HKLA 3MYZA 1NFAA 3NABH 2Y5EA 3SH3A 4HF5H 4WVMA 5B3JF 4HEMA 1R9FA 4JG0H 3FFCA 5SX4I 3TNQA 3CLFH 2CSPA 1XR9A 4OGXH 1BD2A 2X2UA 3K1KC 2P3KA 4JDOA 4XF4A 3QCVH 5F0JB 1NGYB 1OB1A 2VIRA 4LBNA 4URTA 3NQKA 3FO9A 1EQWA 5ID1A 1FPN1 4OUMA 4OQTL 1YJDL 4P9GA 4Y3OA 4LCYB 1WVZA 3P77B 4P99A 1I3VA 1DVSA 4QGTA 3OLEA 2A6KB 2ZX2A 1JNNH 2H2SD 3FT3A 2G4GA 5J06A 1VBE1 4QRQA 5CCHE 4DO6A 3RJOA 2ICES 3H9SE 4GMTH 1CXLA 3KPLB 4BQ2A 4TYSA 4RGOH 2X4QA 2VOWA 3QUMB 4MS8C 1QBAA 4LHNA 3UTTD 3BKML 3TYGH 1WA4A 1F45A 4WRLA 4JGYC 4WVMB 4ODHL 1K85A 1RJ7A 3OUJA 2EXYC 4XCBA 5IMLB 3FFCB 1RUJ3 2BQPA 4X7DC 1GXEA 3L4VA 5FZKA 1XR9B 5E0QA 1BD2B 5HJDA 5FKAA 4ILDA 2J88L 1FORL 5CSZA 2MIZA 2VIRB 1OB1B 4JDVA 4LIQH 4URTB 5DJAA 2R32A 1DHKA 3FO9B 5ID1B 1GZHC 3EQEA 1A9EA 3WIHL 2VUDA 3BGFC 4K07A 3FT3B 5TQ2H 4XVTH 4CW1A 2ZG2A 4QRQB 4Y5Z0 2ETWA 3FLRA 5D7LA 4JM0A 5JOPD 2EDDA 1VAKA 1HEHC 2MPVA 4P2OD 1S78D 5F1SA 4HYTB 4IQPA 4EN6B 4HG4J 3DEMA 4B1LA 2WUBH 5C5UA 1IAOA 2X4QB 5E2TH 4LR4A 5LJYH 3FQRB 1W8ZA 4IERA 3I84A 3LPOA 3MRQA 3RDTC 5ABDE 5FZIA 2B14A 1XB8A 4RFEA 1CF1A 5HTSA 4FQZA 1IQDC 3GYDA 2GC0A 4J1XA 1IFGA 5EF0A 5FKAB 5LXVA 2WZR3 5CSZB 4JDVB 5DJAB 4KZ0A 1DHKB 4LCCA 3POGA 1ZSDA 4AE0A 1A9EB 4W70A 1SLIA 3I3MA 4YM3A 2YPVH 1X5IA 3VD7A 4JCWA 3OHXC 4RVBA 4PU2A 5FCSH 4JFUA 3C60C 3T0VA 3UC2A 3E5QA 4GAJL 5CF3A 4CW1B 2F6BA 5T1KA 2QPEB 5C9JA 5D7LB 4E2SA 1YXWA 15C8L 1JTOA 2R041 4KHXL 3TA3D 4D94A 1ZRIA 2PTTA 3B9EA 4PBPA 1IAOB 3OKOA 1FPN2 1FL6A 3SBPA 5LLIC 1TOXA 4LIQE 5DRWB 1PD0A 3MRQB 4FFYA 4FKHA 4RFEB 3SC7X 3L13A 2JK5A 4FQ2H 1C12A 3P69A 3CXFA 1HZHH 3MV7E 1VBE2 3QO1A 5F7KC 5LQBL 5C2BL 1H3GA 5ITFA 5JPNC 1MQTA 2VNGA 2HMIC 1NY72 4LCCB 4OZGA 1ENXA 1ZSDB 2AK4A 4CUBA 2YAQA 4M61A 3AZWA 3ULVC 3NSJA 1I9IL 4HFUH 1MPAL 2WXLA 3N9GL 2D7FA 5FY5A 5T1KB 2E7LA 5IROD 5FPIA 3DRQA 5IMMA 2D9QB 2F19L 4LDLB 4AL8L 3MRMA 4WKXA 5FZFA 1PIGA 4DOUA 2PTTB 3HNSL 4QOKB 5KYYA 3CDCA 1KEMH 2H1PL 3OKOB 1FL6B 2VXQL 1JOIA 1JN2P 7PCYA 3APFA 1DUZA 1YEEL 4AFCA 2YQ3A 4PJCF 1JV5A 4C4UA 1SEFA 2NQYA 1GIGH 1OP3K 2JK5B 1C12B 4GW4A 3L4TA 3BT2H 3HVDA 1QACA 4F2MB 3QO1B 4Q0PA 5IJKC 4GXUN 1RYYA 2LV4A 3HJEA 5ITFB 5CCJA 4BA0A 1MQTB 1REIA 1U93A 2GVYA 2AK4B 3F7QA 1RUOA 5CNAA 4M61B 4F93B 5B4MD 2DWTA 3WNJA 4WFHE 4RLDA 5F7HA 1RPKA 1W2KT 4CP9A 5HI0A 3BDBA 5I1DB 5IMMB 1JPGA 4OF6A 3MRMB 3V6ZA 4QKDA 1J5OH 5KYYB 3LSOA 1YLLA 4G9SB 5DC2A 2CMRL 2DLTA 3E9TA 1CZTA 2NM1A 2DY2A 1CGVA 3UAJA 1DUZB 3LEVL 4FTVE 5J1SC 1JV5B 1N4XL 3KPRA 1EAH3 1H3PH 2YYOA 1X50A 1OSYA 2AKRA 4GW4B 1U8JA 4OR1A 1KDJA 4QX7A 3TBYA 3PL0A 2F0CA 4ANXA 2R042 3FRUA 4UT6A 5B1KA 1U93B 1ILSA 4OV5A 5EEZA 3MRNA 3RWIA 2XJRA 4Q74A 1PSKL 3D7PA 3HBZA 5DAWA 2HTKC 3BZ5A 1ANUA 4OJAA 4CP9B 4J1WA 2VN4A 2R0WL 1JPGB 3TN0D 1EP0A 4YFWA 1V7NH 3V6ZB 3VU1A 4I1PA 3ZX1A 1Z3RA 1G9ML 1RURL 2DQUH 4LNVA 3LSOB 5FUOH 4Q4V2 1A66A 3M3IA 1OA2A 4G70B 4PR5A 3A21A 3IT8A 3WSOA 4OD2A 3KPRB 4TVPH 4MG2A 4KY1H 2WXFA 2AKRB 1U8JB 3OAZH 5EU5A 5EPAA 3CD4A 3BVUA 4FMKA 4Y1SA 3TBYB 4GWMA 1HRI2 3ZSJA 2VN3A 3WJMB 1KCSH 2CLVA 3FRUB 2BFGA 3QP3A 3GMRA 3N3HA 4MMZA 4LPUA 4OV5B 3L54A 5IWLC 1QGLA 3MRNB 3RWIB 1T7VA 5E1GA 4L1SA 1VRBA 1XH1A 4YQXH 3UH8A 1B88A 4EXPX 4MBOA 2IVIB 3EH5B 1GHFL 1KS5A 1AZDA 4XCFH 4XE0A 5GSVA 4U1NA 3BEVA 2P52A 2WANA 4KBBA 3FAXA 4GW1A 1CL7L 4KTEL 3I9IA 3HZVA 4PR5B 2BFVL 3O14A 3MOAL 1V10A 3T2QA 1E9QA 1L4IA 4HVOA 4HH9A 1FSKC 4LKSA 2XV2A 5JXHA 3AWGA 5EU5B 4HD9A 5DQ0A 1UC6A 3KPSD 3H42H 2CLVB 1CC3A 3GMRB 4MMZB 4KFMA 1EERB 3UK9A 2Q5BA 5L8LB 4YW6A 4HXBL 2NW2A 5JA8B 2EECA 3QNFA 1TE1B 4C0BA 2NR6A 2JKWA 2WZ0A 5FW7A 3D4ZA 4B9FA 4AIOA 4LL9A 1K5MA 3RVHA 4PDWC 1A8JH 2MTAA 5GSVB 4U1NB 5AVZB 2YXWA 3BEVB 4TVPE 4WWKA 4X9GA 2F7IA 1W8OA 2JKXA 3OPZL 3TTYA 1BM7A 4QRRE 1RUKL 4GW1B 5E2UL 4EAEA 3BVTA 2QQWA 3HN5A 2RV9A 4KY2A 2EUXA 4L8QA 5FW6A 1WMDA 2W59A 2ERJC 3DHMA 3HZVB 3WUWA 5AG9A 2JE9A 5I19H 1IC7H 2ZWSA 4TSBL 4K9SA 1E9QB 1RJYA 4HH9B 3KYOA 1RAMA 4J28A 4MX3A 1LDPH 4Y9GA 4PJHA 5FYLH 1Q72H 2WB1A 3KL5A 4FQJH 4BQWA 5I1HL 5FZ4A 4PVMA 1GGCL 1F3RB 3CK0H 3MO1A 3U07A 1YMMD 2NXYB 1MCLA 2IGFH 4JJHA 5F7UA 5ES4B 3FO2A 4ONUA 2CR0A 3U10A 2VXTL 2NW2B 3BZDA 1K5MB 4ALAL 1NIEA 1UZ0A 3CZNA 5FHAH 1BQHG 5BV7L 1AR1D 4KBZA 4WWKB 1HQRA 1MCNA 4MAZA 3QIBA 3HS0C 4FXKC 5FC9A 2C9VA 1D5ZA 3AAZA 4WO4C 2FO8A 4O2EA 3RA7L 4N0CD 1TVDA 5C6PB 5CD5D 3I2IA 1HX6A 4A2EA 4LHUA 2WSKA 3S30A 2ED9A 5F7MC 3PQYD 5FZHA 1RJYB 3KYOB 2A9DA 4WV1C 2RMNA 1XFPA 4PJHB 2VDLH 1OT1A 1M57B 3MO1B 3W59A 4I77H 4GXLA 1C8M1 2ZJSH 5GLWA 5CG8A 1IBGH 1Z0NA 2YSSA 4HBCH 4KROC 4XP9H 4EIZC 1CDJA 1OKOA 2YMTA 3FO2B 4OQ8A 2FK9A 5AYUL 4L37A 2CCLA 5CO1A 3TNNA 4KNTA 3KT7A 4JFZH 3IDNA 4QWWC 5IT6A 4XNXL 1EV11 1HQRB 1HFUA 3P0VH 4P46D 1D5ZB 2EXSA 3AAZB 5DK2A 4O2EB 3ZRCC 3SDAA 5HDQL 3TURA 4OHZA 3GBEA 1WFIA 4G7QB 2FBJL 4LHUB 2P5PA 5FUZL 2ZAGA 1HV0A 2HWF1 1X5GA 1A3QA 3F6LA 4CUGA 3K1DA 2QKSA 2B39A 3S3PA 1YFUA 5B3SB 2GIMA 1QH6A 3KMDA 3FULA 2X38A 1JAEA 4NN5C 4X9FA 1PO12 4BFJA 3Q6GH 3F85A 2QV4A 2YSSB 2LAAA 3SZ6A 3TBTA 2AMGA 1H15A 2LABA 1NAML 4PBVC 1DL7L 5E6IA 2AJUH 3TNNB 4L37B 4UV7L 1PMIA 2MQ3A 4FNLL 1UMIA 5CU1A 5I75B 3EGSA 1HWGB 3CFCL 4AVJA 4RGAA 4BH8A 3J9SA 3U82B 2HTLC 4AEHH 5DK2B 4XP1H 2PHXA 4GLRH 2MWCA 1X9TA 3LKQA 3SDAB 3AXEA 2EC9T 4DFSA 1QWRA 1J9CT 1UH4A 2XX1A 5LBGA 3T4YA 3ZSLA 4HUMB 1R081 1ESOA 3S3JA 2D4FA 4JK0D 3GO1L 2GITA 1TETH 4N0UE 3AXLA 3SGDI 1JWUA 5DGQA 4NUPA 4LIVA 5HYSA 3W2DH 2GB2A 5FMOS 4MQSB 4DGVL 4G8EA 1U8NA 2J1KA 3TBTB 1H15B 4F7PA 5EF3A 1B35C 1PK6A 1BQ5A 5E6IB 2C5DC 1WISA 3NZHL 4U6VL 1N12A 3KPQA 3LKRA 4XNYL 3SEPA 2R69L 4GSUA 1EPWA 4F7ZA 2C4FU 3EGSB 4LOUD 3GK8H 4HJ0D 1D4M1 4NZFA 4BH8B 1N6QH 4BM7A 4I48A 2DTMH 1F1DA 2UV3A 4OH2A 3DX6A 4UBDC 3J8F2 3W37A 1U8LB 2G0KA 3LKQB 1OQXA 2XQBH 4AC2A 4UT9H 5BS0D 2Y06H 2J1UA 1EFQA 4HVRA 4CDQA 4Y4KD 4XXAA 5L9DL 1N3NA 5I2IA 5IV2A 1I1FA 1QHDA 4PBOA 2GITB 3HNTL 2JCCA 2DQJL 2FZ3A 3AXLB 4M7LT 1JWUB 4UNUA 5DFTA 5B38G 5BOPA 1W39A 5I8EA 5GLTA 4EN8B 5HYSB 3EO6A 1OT2A 5J11B 4G8EB 1U8NB 5T5FH 1MCPL 1PK6B 4F7PB 1INQA 4M7ZB 1KXGA 4CPBD 1WS7A 1C57A 2J12B 4OY9A 3KPQB 3LKRB 3KZ8A 1HW5A 5FYIA 4XXCA 3VZLA 1SN5A 2F5AL 3PNAA 4B5ZA 1CFVL 1JXDA 1P4IH 4Y5SA 3TFKD 3KM2A 3QNZA 4AK2A 5JXED 5EU7E 2CZNA 3DX6B 2CYFA 5JXAH 3QZOA 4JRYD 4CVXA 4PGEA 4Z7WF 5LBSA 3VRLF 4KJYA 4AKQA 4AJVA 2GEQA 3HI5H 3ZPDA 3EO9H 1A22B 2ZOUA 1T22A 4LVOB 3TS8A 2WXNA 1N3NB 5I2IB 3L5XL 5IV2B 1GTFA 4E0RA 2B1AH 3K81A 3E80A 2JCCB 4BCUA 3G08A 3OAZK 2BRQA 5SV4A 5A2JH 3N40F 2BNNA 2DPKA 5I8EB 4YW4A 3K51A 1CR7A 3T08A 4IDJH 1INQB 4PJ8D 4JFFE 4XMKH 2AR6A 4ATFA 3VGEA 4BWUA 1RJZA 4OCMC 3QEGH 4BE6A 4B9PA 2XUMA 1R082 4TULL 4Y4HD 4H3WA 5J09A 1TLKA 1CX4A 3QNZB 2Y5QA 3ON7A 1YNTF 1HSBA 1RZPA 2M8XA 5HJ3A 3NAAH 3VZOA 2PO6C 5FPBA 4CVXB 5A16A 4PGEB 5ERLA 3TA4D 4KJYB 3UTSA 1RIRA 4L99A 2Q86A 3PU7A 4L4JA 3WIIH 2YBGA 1T22B 1LESA 4W9LC 4ODSL 2J57A 2P5WE 4NP4L 3O12A 1IPSA 4E0RB 2FE0A 5EZIL 2YBKA 2BRTA 1D0HA 2X29A 4FQXC 2CO3A 2LGNA 1AQDA 2XN9A 3G08B 1U0AA 1F31A 4YYOA 2ZX5A 4ARYA 2Y1AA 1MZ6A 1MF2L 3S0PA 4N25A 4KPHH 4RWYL 2ICCA 4NO2A 5ACMA 4L4VD 4P5SA 1LKNA 4KKCC 2W8CA 1RJZB 4FFZA 4JKWA 1BEXA 2MNWA 2EIMB 3IDEA 4N9GA 3AACA 4NDMA 4RGKA 2HP4A 5HJ3B 4U6XA 5DUVA 3AP5A 5A16B 2WQSA 4GY4A 4ELMF 1SY6H 1TG7A 5FLIA 3UTSB 5C71A 4Z7NF 2KR2A 2P4EA 1VBA3 4EV0A 2Q86B 4CN1A 3UZEA 3R05A 1TDQA 4QRSA 4MJ6B 4QRTA 5B39A 1F3JA 1G9FA 2IG2H 3B7SA 2ERFA 2DQIL 3H3UA 2G9ZA 1G84A 1TEFA 3L3OC 1RK1A 5C08D 2ZZJA 4PJDA 1AQDB 2XN9B 1V00A 5GGQL 1X44A 4W9JC 3SBRA 4DEVA 2B0SL 2HG5A 3U6XS 2VUAA 2O5ZL 4ZU5A 4D6RA 3RUGF 4K21A 1A4CA 1WPCA 4IMLA 4IHOA 4KAQL 4QXTA 8CGTA 1BQKA 3WW2A 1HU8A 1YLBB 4N9GB 5IBLC 3VFWA 5I8OL 4NDMB 4NJ4A 2CO6A 1ZA4A 3M8OH 4JLRA 1I8MA 4QKFA 4N2DA 4U6XB 3JWOH 4AVTA 5DT1H 3F7KA 3JSSA 4QXGL 7FABH 1W6NA 1CDGA 1DQLH 1PM7A 1P69B 5I93A 3KW8A 4PY8J 2VB5A 4QRSB 3QZBA 2UYBA 4Z0BL 5B39B 4QRTB 1CLZL 1LO0L 1F3JB 2VXVL 4UTCA 4YVNA 3T6QC 4P5YA 3D6GA 2K0GA 1NIDA 4PRPA 3QXUA 1RK1B 4ZPIA 5ABJA 4PJDB 1HXS2 5J8OA 3LMJH 1OH4A 4JTNA 3FF7A 1KACB 3WO4B 3D1MC 4H8VA 2V4LA 5DJ2A 4NRMA 5E95B 5BVPH 3LDKA 1MJ8H 1J05A 3OG2A 3FFCD 4IMLB 4IHOB 4QXTB 3EFFA 5DGRA 1HQNA 2JFCA 3V9FA 1JGDA 3D8CA 3I8TA 5KAQG 4X80L 5T5NF 3ETQA 4G3YL 3VFWB 2FH8A 4PSRA 5JZ7C 2ENRA 2CO6B 4YSCA 1I8MB 4JLRB 5I18H 4MGXA 2NY1C 4HJJH 4KVNH 4PG2A 2P80A 2DCZA 3IEAA 1TENA 2ICWA 3VBOA 3NJHA 5EA0H 1UA3A 2D6OX 4M56A 2C9XA 3CHXA 4PRPB 4BPZA 3PP4H 5ABJB 2HJKA 1WWCA 5FZ1A 1BEYH 4R97C 5A2LH 4N7UA 5DMGD 1X5ZA 2D6MA 4TWTA 3HOGA 2OZ6A 4DNYA 3JT2A 3LD8A 5DZ9A 5JMOA 1V54B 2DDQH 5DJ2B 4ZY9A 3BT0A 4R4ND 5JW4N 3AB0C 5E1IA 1J05B 3PABA 3FCUB 4QYAA 5ECGA 3VBFA 2MOVA 3EFFB 1W3XA 2XQYK 1JGDB 3PUAA 1VFUA 3MCG1 4KC3B 3VHRA 2G60L 1KENL 1J1XL 1W6MA 3LHAA 1W90A 3R6SA 1MEXH 4IBLT 2Y6TE 3W0WE 4F2FA 2MCPL 2G2PA 3QRLA 1RUG3 1B4JL 2IDSA 4YBQC 2A6VA 1OGAA 4J3OD 2ENSA 4KO5A 4N5EC 3SGDH 3QUKA 4NZRH 1UOLA 4MZ2A 1TFHA 2ICWB 4YSUA 3VBOB 1U6AL 2NYYC 5D7LD 1YJLA 1N59A 2R7EA 1U5XA 1SUJA 2KD7A 4GZ9A 2HT4D 5CNHA 4PVNA 2HJKB 2CNYA 3FUEA 3JV4A 5C0CE 3TT1H 3D69A 3LD8B 3FCTA 2QELA 4K5MA 4LRNH 1OPGL 4ZX4A 3PABB 5J1AA 5EB9A 3VBFB 3MI6A 2AQNA 1RLWA 3I2CH 1ZZ6A 4TQHA 1MLCA 1NCBL 3O0RL 5J37A 2RR3A 4Y2OA 4BHPA 4OU3A 3IGAA 1XAKA 2Z4TA 4UILL 1AJKA 1AYRA 5BOZG 5KBDA 2WMPA 2O5YH 3LIUA 4BD4A 1W6MB 3NSTA 2E7CA 4M5YL 4OQTH 1YJDH 3QFDA 1R64A 2J6EL 1RKRA 1MWAA 2VMIA 1OGAB 1PKOA 5L4IA 4Y5VA 3QUKB 5T1KD 2V3DA 4Q4Y3 1F4YL 1N59B 2R7EB 2YUWA 4PV8A 5E8PA 5IW1A 3DPDA 5F2WA 1S2KA 2Y2YA 2OQ7A 4G11A 4OHYA 3QRBA 4JM2F 3WDJA 4HP5A 4A37A 4P2YA 3JV4B 4W8JA 3D87B 1HCVA 1MCSA 3D69B 2E47A 2Z7YA 3BKMH 1A5FL 3FCTB 4HOWA 2BGOA 2O14A 4ODHH 2PWHA 4AY0A 3K6IA 5J1AB 3OZKA 3N42B 1UU4A 2IXCA 2EJ1A 4EIGB 1CJPA 3NFPA 1MLCB 1KYAA 5DS8A 1EO8L 2J88H 1FORH 4GSQA 2MQGA 4WTWA 4Y2OB 4KTYA 3IGAB 3VQLA 4XNQA 3B2UC 3WKYA 1ZM1A 2AK4D 1I3GL 2WMPB 1P2CB 3WIHH 1P7KA 2ZABA 2FDIA 3QFDB 1XE8A 2Z69A 2Z0BA 1MWAB 2R0FA 5E03A 3QIWC 5EU6E 4Y5VB 3VXPA 4Z7OB 3VZKA 1Z9SA 2OR8A 1AS6A 5IW1B 3VQ2C 2BX5A 4E9SA 1HYSC 3FHIB 1TSRA 1U8CA 3DXAA 4XBMA 5KOMC 1DZTA 3U9UA 2TRHA 2Q3XA 3PDDA 5C09E 3C5ZC 5E99H 3T2LA 3ZE1B 1RITA 2XH6A 3VXSA 3A0NA 1AQ8A 1ONAA 2NY2C 1JI2A 3ML9A 3NFPB 5A7BA 5DS8B 3SJVE 3EH4B 4XNQB 3BO8A 1W2TA 3OY8A 3ZE0E 1P7KB 1TPXB 2NTSP 1TNNA 5FYKD 2ODHA 3VXRE 2P5EA 4GAJH 3AG2B 3VXPB 3U78A 5DRNA 3ZHFA 1OTTD 3L9RA 5IK7A 1Z9SB 3U36A 3PHAA 3ALWA 15C8H 4NN7B 2G9HA 1U8CB 1UKSA 3DXAB 4KHXH 4KKPA 4WHTA 4WFGD 1BVOA 2W91A 3R8QA 3TH3T 1A65A 1FUNA 4U0RB 3VXQA 2NY3C 4GWIA 3VXSB 2P1YA 4YAQA 3DUIA 4LSRL 1H4GA 4LK4A 4KK6C 1H8TA 1H4HA 4Q97A 2GK2A 3U7YL 4FPYA 3H85A 5C2BH 1HS6A 1DJHA 4JHAL 4P5KA 1VLNA 5F6HJ 2O6DA 2WYTA 3BO8B 3OY8B 4NC1C 4QXBA 5EHDA 4OB5L 5AVUB 1F42A 2WKOA 1I9IH 3AXHA 1MPAH 1PDKA 4MQ7B 2D7OA 3N9GH 5F9OL 3LZRA 3U1QA 5T5OA 3H8XA 2P5EB 5DRNB 3L9RB 4PSPA 4N53A 5I0TA 3U36B 4XO3A 3FXIC 2F19H 3JWOC 4AL8H 5GXBB 1P7HL 2VUJA 4MNQE 4G7RB 3HRZC 4WM8A 2G9HB 2IBZY 4BA6A 3HNSH 4WHTB 2DVAA 3P3YA 2H1PH 4L05A 3IWZA 1QNZL 2VXQH 4QPGC 2G5BA 3ARXA 4ATWA 1JZDC 5FUNA 5LY2A 3T1LA 1YEEH 3VXQB 4IKIA 2VSKB 2I45A 4YAQB 2PNDA 2LALA 3CFKA 3ZXGA 4Y0GA 4A55A 2WQVA 1CO1A 5AVXB 2YV8A 4G6JL 1H8TB 1YCIA 4YPGA 2OQJA 1UASA 4O5LH 2B7DT 4P5KB 2Y69B 3MNZA 4YHLL 4HKZA 2IXLA 4PTTA 1W03A 1QLRA 1WW5A 3OTTA 1PDKB 5GZGA 4LQFL 2EIJB 4R90L 4YJZL 2Y6KA 3ALQA 4BE5A 4N53B 4RS5A 2WP3T 4P5TA 1LGNA 1KYDA 1HEJC 3F84A 2R56L 4KO9A 1QX1A 4NQQA 5HI3C 3G5YA 3BCWA 3MUGA 1LLAA 3JQWA 4WM8B 1U8MA 1X7SA 1S6NA 2VABA 5ESVA 3TH4T 2ZXCA 2CMRH 4IOIA 2G5BB 3EG9A 1JZ7A 1ORQA 3LEVH 5IVXE 3QIUA 1KSRA 1POQA 1CLYL 1Q3EA 2A3WA 1HL5A 5A7OA 1D2SA 2VW4A 5K9QG 3CFKB 2BVBA 4Q4V3 1AS8A 2JB5L 2OQJB 4L4TD 4YPGB 3MNZB 4OIIL 5TE6L 1M71A 4ELKA 4HKZB 4PTTB 2NXYD 3DOIA 4MA7L 1YY9C 1QLRB 2VMFA 4MXQC 3ZL2A 1PGW1 4XVHA 4IBYA 3RY4A 1J5IA 4AMKL 2AXWA 4FJ6A 4K3HA 4G6AD 4LSSH 5E2WL 3HR9A 2NR6D 3SYQA 4N22A 1HRI3 2A6WA 3EH2A 3JD71 4RS5B 3VHOA 3BOVA 5LEJA 1JZGA 3POJA 4P5TB 4FVVA 2R0WH 1J3RA 2WOBA 3AP4A 4CDUA 4WWKD 3GNMH 5EWSA 3V6BR 5IW6A 1OLME 3G5YB 4XQDA 3MUGB 1G9MH 2FO4A 1RURH 1U8MB 3KXFA 3QHFL 2VABB 5ESVB 3SPJA 5T5LA 4IOIB 4BKLA 3EG9B 1WKYA 1ORQB 5E9DA 3QIUB 2DMHA 1WO2A 2B4KA 5TK4A 3HC2A 2LU7A 2R23B 3VRJA 4Z2AA 5IEKA 4HD5A 3WX5A 1IAMA 4AZ8A 4Z7VE 4M93C 2AQQA 3FU3A 4BKSC 2JDHA 1DDHA 5GGSA 1M71B 4ELKB 1ZXQA 2K8MA 1R0AL 2PAMA 1Z0MA 2PYEE 3VI3A 3L08A 1ZRCA 2RM23 1CD9B 2P8PA 4PJEE 4QD2A 4EWEA 3ZFEA 1UZ6E 4ZDHA 5T50A 5CFAA 1GHFH 2WJ7A 4MB3A 1OK0A 5J6HA 4N3TA 3WI9A 3ZMNA 2DU1A 4CDUB 3RZJA 1YJDC 3QIBD 5FYJD 2BOBA 2WN2A 2FO4B 1TQSA 3KXFB 1CL7H 3A6BL 4QRFA 4XWOD 4OI4A 3SH4A 3O1MA 2XIIA 4EI0A 1T1YA 3NT0A 4KTEH 2DQGL 4BKLB 4BGDA 5E9DB 2BFVH 4LHUD 3CNAA 3MOAH 4KTGA 1ZOXA 1RZFL 3QRGL 3RVUC 4MHUA 3WCSA 3Q6FA 5A3MA 1R34A 3MRBA 3VRJB 5AW9B 4ZPTA 5IEKB 4AZ8B 1QSFA 3KV6A 2X4RA 3HB3B 5LGYA 4WFED 2KZKA 1XGQA 1GMEA 5D7IF 1O4ZA 1GW6A 1DDHB 1ORSA 4XX1G 5GGSB 4CILA 2Y6HA 2VXSL 4F8QA 3VI3B 4DEPB 3WNNA 1S0CA 2DM3A 4HPKA 4R9BA 3U11A 4HXBH 1BV8A 3ETTA 3U4KA 2P8PB 5AB2A 3AFKA 3ZFEB 1TCMA 2NNXA 4ZDHB 3TWCL 1MACA 5FRAA 5L2KE 3SE3A 4P9YA 2J2ZA 2Z31C 5J6HB 2QJDA 3OPZH 3TEYA 2BOBB 1WCSA 1RUKH 2WLNA 5E2UH 1OIOA 4P14A 5EJ3A 1EAOA 5EV7A 3SDAD 2CO7A 1T1YB 2VDNL 1F18A 5HGDA 5FHBL 5CYYA 4TSBH 4MFHA 4EF3A 2DF3A 5TK2A 3MRBB 3JD72 3LGRA 5F7BA 4ZPTB 3BVCA 1ZJBA 1QSFB 2X4RB 3O4LE 5I1HH 3LCYA 3U0PA 1GGCH 1XGQB 4D8MA 3KT4A 1UXMA 1PFCA 1R4XA 2LVCA 2EEFA 2V3FA 3BSGA 2JQMA 3ARFA 4PRHD 43C9A 1KWKA 4HPKB 3ZGIA 3FH5A 1TF4A 2A77L 2VXTH 2E59A 1KXVC 3HJ0A 1NBZA 1CU4L 1N10A 4ALAH 3CE1A 3M70A 2J2ZB 3NZ8A 5BV7H 1KDKA 1P4BL 3EYPA 3E8VA 4XNZC 2AENA 3O4OB 5IJBC 1MELA 2XTLA 1HQ4A 3QYCA 1NEZA 4K5LA 3RA7H 3ROOA 4F57H 2CO7B 2K3HA 4IXLA 3VAEA 5HGDB 2F53A 4FJZA 3TONA 1OTUC 4QX1A 1ECYA 3DX9A 4A7VA 3QEUA 3ZFFA 4U1HA 3ISRA 3ERXA 3SOBL 3QXDA 2VW0A 5JIAA 5F7EH 4CDXC 3AKSA 4P2CG 1KBWA 3FUHA 2BVOA 3SDXF 4M6AA 3ZMRA 2BNOA 3MRCA 3NFSL 2O30A 4AW7A 3ARFB 5I82A 2OJZH 1D6VL 1UQSA 3ZIYA 2F4PA 2Q4SA 3D2UA 1EXUA 1NBZB 3NMEA 3GMLA 1B2WL 5AYUH 1J5CA 2BHUA 1XCQA 1JHJA 1A8MA 1PO13 4LPTA 3HE7D 2JG9A 2Q8DA 2J8UF 3NZ8B 4XNXH 4IIZA 1ZEAL 2WSDA