1OPOA

The structure of carnation mottle virus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
267
structure length
267
Chain Sequence
SMTMSKTELLSTVKGTTGVIPSFEDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQPLQWVVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The atomic structure of Carnation Mottle Virus capsid protein
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein
total genus 52
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
A PF08462 Carmo_coat_C Carmovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1opoA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opoA01
2R062 3ZFFB 2WZR2 4GMP0 1RUE2 1MEC3 1VBD3 1RVF1 1VB4A 4FTSA 1MEC1 2R063 1TME1 1ND3A 5JZGA 3FBMA 5LK7B 1TME3 4RR3B 5ABJC 1B35A 1VBA3 1R082 2HWB3 4N43A 5BNNB 1VBA2 4QPGB 4Q4Y3 5D8AC 1POV1 3CJIC 4YVSC 5BNOA 1VRH3 2R072 2WZR1 3J8F1 4GB33 1R1A2 1VRH1 3VDDC 1NY72 2RR11 1QJY1 5C9AC 1NY71 4GB32 1BEV1 2R061 5CFCB 4RS5C 4N53B 4GH4A 4Q4W2 3NAPC 4CDWB 3VBHB 1RUG2 1AYM2 4IV1B 4Q4W3 4AEDC 1RUG1 4FTEA 1ZBA2 1QJU2 4QPIA 1BEV3 1AYM3 5K0UB 2QQPA 4Q4X2 2WWSA 1PIV2 2VQ0A 3VBOB 1RMU1 1R092 4Q4X1 1PGL1 1C8NA 1BEV2 5ACA2 1BBT1 1R1A1 1PIV3 3VBRC 2DF7A 1R093 3JD71 2RM23 3TN91 1GFF2 1OOPA 1MEC2 1NCRC 1VBD2 5CFCA 1RUJ1 4CDXC 1RHI1 5C8CA 4GH4B 1ZBA1 4QPGC 2ZTNA 4QPIB 1EAH3 5D8AB 1NOVA 2Y26A 4CEWB 1AR92 1RUC3 5FOJB 1FMD1 2HWB2 4FTBA 2PLV1 3S6PA 1D4M2 5BNNA 1AR91 1VBA1 1RUC1 4RQPC 4JGZC 1BBT2 1RUE1 1OHFA 5DDJ1 1ND3C 1AR93 5L7OC 1RUC2 1COV2 1NCRA 4Q4Y2 1VRH2 1RMU2 2R073 1WCDJ 1OOPB 1PO21 1ND2C 3ZFEA 4GB31 1AR71 1EV12 5C8CB 1F8VA 4N53A 1H8TC 5A33B 1RUH1 1HRI1 5D8AA 1RUF1 1EV13 5FMOL 1RUF2 4WM7A 1PGW2 1Z7S3 3VBOC 4FSJA 2HWC3 4LLFA 1QJU1 5DDJ3 3VBFC 1ASJ3 2ZAHA 3VBSA 5CFDB 1NCQB 1Z7S2 1QJU3 5BNPA 1ASJ1 2HWC2 4Y5Z0 1AUYA 4CDUC 2RMU3 4WM8A 2BPA2 5ACA1 2RS52 2RMU1 5C9AA 4Q4V1 4PDWC 1K5MC 1RUH2 5ACA3 2RS51 3TN92 1V9U3 1HRV2 1SMVA 2RS53 2RM22 5JZGB 4QPIC 1MQTA 1EV11 2RM21 2HWD1 1V9U2 3TN93 1W39A 3VBFA 5AC91 1F2NA 3VBUA 5CFDA 4AEDA 2WFF2 5C4WA 1NCQA 4CEWA 1HXS1 4GMP3 5BNPB 1EAH2 2RS11 2X5IC 4WM8B 2WFF3 1RUD2 1D4M3 4Q4V2 4JGYA 1COV1 1BBT3 2RR12 2MEV3 1COV3 2HWE3 1RMU3 1MQTB 1C8M2 2MEV2 2RS31 2HWE2 5CFCC 2RS13 3VBUB 4NWWA 2PLV2 4IV3C 1AYM1 4IV1A 1EAH1 3DPRC 3VDDB 4CDWC 4Y4YA 1CJDA 2RS12 2PLV3 5A32B 1RUF3 5K0UA 1VBE2 1PIV1 4NWVA 3JB8A 1AR63 4PDWB 1PGL2 5DDJ2 1ASJ2 1VBE3 5J96B 3LOBA 5JZGC 1RUJ3 3JD72 1QJX3 1ND2A 2RMU2 2RS33 3ZFEC 4IV1C 1RHI3 4YVWC 1RUH3 1QJX2 3ZFGB 1VBB1 1PGW1 1HRV3 1OPOA 1RHI2 1V9U1 3CJIB 4YVSB 5A32A 2X5IB 1QQP1 3VBRA 1Z7S1 2WS91 2HWC1 1RVF3 1VBC1 2HWB1 3VDDA 5C4WB 4PDWA 2R071 2FZ1A 4CEYB 1VBE1 4RS5B 2GH8A 1NCRB 1RUD1 4Q4Y1 5ABJA 1B35C 1VBB3 1QJZA 3HAGA 2GSYA 4JGYB 4CDUA 1RUD3 3ZFFC 3NAPB 4Q4V3 3VBHC 2RR13 1OOPC 1VBB2 1C8M1 1X33A 1ND2B 2WS93 1R081 3CJIA 4YVSA 5A33A 3DPRB 1C8M3 3J8F3 4EJRA 1AYN1 2WS92 1VBC2 3JB4C 4N43C 4WM7B 4RS5A 3VBRB 5BNNC 4SBVA 3VBSB 2FZ2A 4YVWB 4Z92B 1BMV2 1AR62 1ZBE1 4CDXB 2XBO1 4RFT0 5C9AB 1NG0A 2BFUS 1NA1A 1RUJ2 3JD73 2MEV1 2RS32 2HWD2 3VBFB 4RR3C 4RQPB 5C4WC 5AC92 5L7OB 5GKAC 1AYN2 1HX6A 3IDEA 4AEDB 2R041 3JBG3 1RUI2 2XBO3 1HXS2 5J98B 2BBVA 4JGYC 4YVWA 1DDLA 1AL22 1RVF2 2TBVA 5BNPC 2XBO2 4WM8C 1E57A 5ABJB 1AL0G 1NA1B 3NAPA 1AR61 1AR72 5FMOS 1TMF3 2ZZQA 4JGZA 1FPN2 1AR73 1PVC1 4WM7C 1RB8G 1QJX1 2HWF1 4CDQC 1TMF2 3J8F2 3VBUC 1FPN3 1POV0 4IV3B 1VBC3 4BCUA 2WLPA 4RHV2 1K5MB 1FOD1 1CD3G 2HWF3 1ZBE2 1X36A 4CDWA 3VBHA 1HRV1 1FPN1 1PVC2 3ZXAC 5K0UC 1ZBE3 1AR81 3ZFGA 1QQP3 1AR82 1PO11 1M06G 3VBOA 2HWD3 2WZR3 2X5IA 1QQP2 5AC93 3M8LA 1RUI1 1AYN3 1QJY3 3JBG2 1RUI3 5CFDC 2BUKA 1MQTC 1NA1C 1HXS3 4GMP1 4CEYA 1A6CA 5BNOC 1TME2 1ND3B 4GH4C 1QJY2 4CDUB 3ZFGC 1AL23 1H8TA 4RR3A 1PO13 1R083 1BMV1 1HQNA 1B35B 4CEWC 1PO12 2HWE1 4Q4W1 4CDQB 5C8CC 3DPRA 4JGZB 2WFF1 1R1A3 1D4M1 1R091 4CEYC 1VB2A 2IZWA 3ZFFA 2R042 4IV3A 1PO22 3ZFEB 1H8TB 1K5MA 1VAKA 1VBD1 1FOD2 2R043 1AL21 3JBG1 4RHV3 3VBSC 2XPJA 1PO23 1RUG3 4CDXA 1HRI2 1FMD3 4CDQA 1FOD3 4N53C 1ZBA3 4N43B 2HWF2 1HRI3 4Q4X3 1FMD2 1PVC3 1NCQC 1IHMA 4RQPA 5L7OA 1RUE3 4RHV1 2BFUL 1POV3 1TMF1 1AR83 4QPGA 5BNOB
chains in the Genus database with same CATH superfamily
3AP7A 3IMUA 3ISYA 5E7BA 2RQEA 1J5DA 1ZTMA 4ZFZB 2Y8KA 4WV1A 1VBD3 5CCJA 4JO4H 3MCLL 4G8IB 3MIFA 3DMMC 4M0NA 4X80H 2FNBA 4DK3A 4QYAA 1BJ1J 1TQUA 5AW6B 3D2TA 3O6LL 3EJKA 3NJMA 4M8QB 1DSWA 4IBVA 4NENB 4TLSA 2ADJB 3WKYA 5IB1B 1P5UB 1RXLA 4RR3B 1U30A 4D8PB 1MIMH 4QRRB 4PGEB 4ANXA 1J58A 2WGNB 4XAKD 4YZ1A 1W8FA 1GIGL 3EHBC 4OHVA 1I1YA 4AVBA 3AFGA 2YWZA 3WN5A 1W2NA 1GP6A 4QPGB 2E7TA 1TTRA 4EN3B 3D4ZA 5ID1A 5E8EA 3RHWF 2P3IA 5GGRB 4WV1B 4XMZA 4Z78A 5BUPA 3OKNB 4XC1H 2R30A 1ZAGA 5EEZA 2PWDA 4LEEA 2WTOA 3WKNA 4Y2DD 3ZKMD 4XMAA 3LS4H 3P4OA 4LZKA 2GIXA 5TDOA 2ZGNA 4YM1A 1SY6A 4BIOA 5CFCB 2HYXA 4AQSA 1U8IB 3L3GA 1DLFH 1KTLA 2BFVH 4NIHA 1AGBB 1IKQA 3MIHA 1QDCA 5TH2B 3WXPA 1SG3A 2X4QA 1BBJB 4NNPL 4G9FE 3MRPB 2HFGL 3IKCA 4HD5A 3LPPA 1OVPA 3GSWA 3FB7A 4PWGA 5IEKA 1W8NA 3EFFA 1QFUH 2YK1L 4I0BA 3N43B 3QPXL 4OUEA 4OF5A 4GQRA 3QZMA 4OLYL 4KO7A 1SUJA 3H1ZA 4M5TA 4TSCH 4FNSA 4K8RB 1BYPA 4GBXB 4PP1C 3ZUNC 1MKFA 1DQML 1CE6B 5I82A 5JHDA 1AYM3 1U5IA 5K0UB 2WWSA 2KLRA 3NPZB 2OMWB 4D0BB 3UP1A 3QWNA 1RMU1 3SMHA 3VX1A 1LJMA 4EWAA 4XXWA 2R2EA 2DMGA 1XF4B 2NY2D 3QEQB 1C8NA 1ST8A 5AVYB 2MFNA 3RP1A 4BSWA 3T2QA 4U2ZA 2Y6KA 2ORBL 3K3OA 5E0QA 5SWSB 1ULVA 1AGBA 3LB6C 2Y7OA 2UZIL 3HFML 2ZCZA 5ECGA 5FYKE 4GXVH 3EFOB 1JG9A 2QQIA 4OJFH 4QQPA 4QM8A 1II4E 3GSWB 5EB9A 1FYTD 2Y2YA 3PU8A 4R8WH 2BDNL 4COUA 2D93A 5C3RA 3GSNH 5IHRA 4WWKB 3T3YA 1JCVA 2YRBA 1TZOA 4GAJL 1BREA 1EPZA 1HXMA 4XBGB 4TLKA 4P5RA 2F54E 2ZOTA 3K75B 3K2IA 5T1DL 3ZE0B 4ZUSB 3PAYA 2JDPA 1A4JB 3SCMA 5FYKH 2PLV1 3G7DA 4LO4B 3S6PA 1HKLH 1IBYA 3J9SA 5I30L 4X98A 4I02A 4DKFH 4OMCA 2PXYD 1NCRA 1UWYA 3MRFB 4LDEB 1XE7A 5CJOH 1QLEL 4XMKH 4OB5L 4JANA 5EMYA 2J72A 1BJMA 5BNOB 3H2QA 1A4CA 3WUDA 3AREC 4YXHH 1BPVA 3ECWA 4IRSA 4OZFA 1KPRB 3O3BB 4OD3L 2NY1C 2Y72A 3VXOB 1W2UA 4M7LH 1WLTA 3KT7A 1OKOA 1ACYH 3U7WL 5JHMA 1YEJL 4YGBA 1Y1UA 4N6RA 5I18L 4D0DB 2UZXA 1EEQA 1JK9A 1KEML 3EGXA 3MAWA 1Z6JT 5KWYC 2MQ3A 1EV13 1GANA 3D39A 2VCOA 4N85A 1RUF2 1DBAH 2YMTA 4MZIA 2B46X 5A6ZA 4FQQB 5HYFA 1KIUA 1ZS8A 1L7IL 1MOEA 2EIDA 3UP6A 4AL9A 1FL3B 3DGTA 1T7ZA 3CO2A 3MTRA 5D4HA 3PHQB 3MJ9L 4MD4B 3C7EA 5FW8A 5E6IA 5IMLB 4R2GD 2ALWA 3QCVH 4URAA 2ZKMX 1AQKH 2XNAB 3PURA 1A6ZA 2RMU3 2JIGA 2BIHA 1PZSA 4OJEH 2R4RH 3DJSA 3VFVA 1TETL 4Q2ZB 2GEEA 3FFCA 1VJ2A 2X09A 1UZYA 2P3YA 3BXNA 4JQXC 5C0DA 2TRHA 1W72H 4RGMB 3QJTB 1CO1A 2OW7A 2VD7A 3LKQA 3Q8FA 4ZODA 4K21A 1DQDH 2NQYA 3TXAA 4AV4A 2GSGA 1EV11 4BPZA 1XF2B 1QR1A 4Y5VB 5DK2B 5HDQL 1G6RL 3I4IA 1IGCL 4FQQA 4UQ9A 5BZWB 1J5HA 5AC91 5F3CA 1F2NA 1PM7A 1ZSDB 2NY5C 5BZXA 1MCBA 4G43B 3E5UA 4IE4A 5A3TA 1ICTA 5JSOA 1INEL 5C4WA 1UOVA 2HWZL 3NAAL 3OG6B 1UXSB 5MERB 1F00I 2EICA 4U7MA 2ZCWA 1MIEH 2RS11 3TH3T 1DE4B 4H8PA 3ZBMA 3BE1H 2VN7A 2DWDB 3D25B 1D4M3 4CPBA 2J56A 5D7LD 3LQMA 5KC5A 5T5OA 3JT0A 3GMNB 5D7JA 3H3PH 1SJXA 5I74B 1UUNA 1QVOA 4EXPX 2CKBL 3SN6N 3QLQA 4Z3EA 3QDMA 5ADOH 3IB4A 1DUYB 3GGLA 4UYPA 3PWLA 1X7TA 1J1XH 1BAFH 1TITA 4RFOH 3B69A 5H9QA 1AS6A 1HH6B 3KBEA 3ROLB 4F37F 3RDTD 5AVZB 1RH8A 4NWWA 2NPIA 4N1EA 5HYSA 1J1LA 1SY6H 1H5BC 5DHYB 1WCUA 2FL5B 1OTSC 3S0PA 4RH4A 2BH0A 3N7KA 4Z7NE 1AXTL 2QQKL 5FAXA 3ESUF 3OOXA 1WJ3A 2WWNA 3AT8A 5F0PB 3UTTB 5LKNA 4YNYA 5A32B 1NM4A 1WAAE 4F15B 5IIEB 2ETEA 2PN5A 3VCLB 1OT4A 1RK7A 5HGDA 4NWVA 1YY9C 2OR9L 3ML9A 3QDMD 5TDNB 4PJ6A 4AMXA 1CG9B 3QNZA 1DBNA 2QGBA 4G6MH 1ASJ2 1FNLA 1LVEA 4BQ2A 5FB8A 3BIKA 2EO1A 2OS2A 3ZT6A 1DQLL 4TNEA 4I09A 1UJ3A 3N1MC 1KENH 1RUJ3 4GG6E 1KCVH 1FORL 5LASA 2X9YA 3GBNH 4M3CA 1CTNA 4HLZH 5F7EL 3FUKA 4RGOL 1MFDL 3EDEA 3O3EA 5LY1A 1RUH3 4JHBA 1C8PA 1NWPA 4NPRA 3HIZA 3MCG1 4H1LH 1JZJA 5EBLB 1RHI2 2LR4A 1OSZB 1CUOA 1KWGA 2J1VA 2F7IA 4U3CA 4XVTH 4RFRB 2NY0C 1HHHB 3VVWA 5DHVA 2NW2A 2CHZA 2WOYA 3AMLA 1MW0A 1Z7S1 4OHYA 2EUZA 1OXCA 4MQTB 3FQRB 4JM0A 4BFGA 2ICWI 4KO5A 5EU3B 1G4RA 3VXUA 1F6AA 2UXFA 1R5WA 4NM4L 1S7SB 2HVKB 1QW9A 2K0GA 1D7CA 3TYFB 3RNQB 4KVNL 4R84A 2MTPA 1JTPA 2DBLL 1G86A 4UOJA 3QAZC 3GJFA 4G7VH 1J9TA 4BQ8A 3HAGA 3AAZB 1RUD3 4O61A 1WIOA 3BJ91 4HG6B 3ZXLA 1P7BA 4XNBA 3HUJF 4G9FA 1MH5A 2FX9L 2NUTB 2XT1B 4XPAH 3SY0A 3IJEB 1R46A 1J3PA 4S1DC 1OOPC 5B1JC 1V6MA 5J09A 5FM5O 3VZKA 4XBMA 4PWHA 5MP6H 3MUHL 4R4ZA 2BWDA 3LJ3A 5FJHA 1C5CH 4HMEA 4RMRA 3VXPB 4EZLA 4AJWA 5SX5K 4OLVL 3MQIA 4TV3A 5EU3A 3VXUB 3N5AA 3VLBB 4D3CH 1JN6B 1BD2D 2XLAA 4IEYA 2Y6LA 5FHAH 2DDUA 2F53E 2GBVA 4QOKD 1QAWA 3TYFA 1OAQH 1VKXA 4YZ2A 4LGSB 4GXUM 3UT0A 2JCCE 3VBSB 1MS1A 3GFUA 3DJ9A 4IOSD 1WKYA 3OPTA 2UWCA 4F91B 3MV01 1SBDA 4DIQA 2BIOA 1F8TH 1RU9L 2BY0A 4WI2A 1OVSA 2ZUYA 2C4FT 3GBML 5ITFB 3KBHE 4FPFA 3B5GA 2YU2A 3JWOC 4JRAA 3SYAA 2B1OA 3BPOB 4O7XA 2OMXA 1NGXA 4ISVA 3SBWC 5JQHC 3U9PL 2HLFC 1E4JA 2Y0SA 4XMVA 2JEMA 3MV9A 4WTWA 4Y9EA 3UG4A 2CGRL 1OF2B 2JDZA 1IAIM 3EAKA 3QRLA 2VLKE 4TM9A 2QE3A 4FGMA 2JKXA 3BYTA 4XN4A 1WMDA 1S7RB 2UX7A 1V7ML 1VESA 3FBQA 3CZFA 4ODTL 4BUGA 1NBZA 5GGQH 2V2WA 3FZUC 2Z91B 1AGFA 4OLZL 3X1NA 5I18H 1UA6H 2QQLH 4G80B 2ZGSA 2KMWA 3CHRA 3VFGL 4MD5B 3AMPA 5E9DD 3S7GA 1HLCA 2ZQKA 2ESVA 2FR4A 1GSLA 1GNYA 3U25A 5DRXB 3AZXA 4J3VA 2ZNWA 4F7EA 5IVEA 3VX0A 3LKPA 4GWIA 4PLJD 5AVAA 4EBQH 1U91A 1TJIH 4ETQB 5I5RA 4N90A 4W9ZA 3MYXA 4HWZB 1RURH 2QZ2A 4JGZA 4ZFFA 2AKRA 2FHCA 3P11L 3E6FA 1RB8G 4ZO9A 2EP6A 4M1DH 1PHMA 4V1DA 4FQXD 1V3LA 1NCNA 1XO8A 2V2WB 1DJYA 1MREH 1UEYA 2D7TH 2XWJA 4OY9A 2P43B 4G7YL 3LKSA 3F7VA 4YSOA 3KPMA 2PCXA 2BS71 3NSXA 4DEPB 1DLLA 4XUTA 4NBZB 2XY2A 3BKYL 4L4TA 4BK5C 5DMYA 4Q0XH 3CEWA 3FPYA 1DJXA 1KPUA 1D9KD 2RACA 3C7FA 2O6PA 4DGIH 1RSYA 1VE0A 1A3QA 4JFFE 4PI0A 2WWJA 4EPSA 5IVBA 5HVWA 4KZDL 5ANMB 2F18A 4MNGB 5LQBL 2XKNA 1E3XA 1ZBE2 2XPYA 3ABKB 4NIGA 4M62L 3IFOA 4HD9A 4FQXA 5FXZA 4ELDA 4LEOB 3RBSA 3NEOA 3HC3H 4BKLB 3RU8H 3ILPB 4OGYL 5BS0E 5DFAA 3PNRB 1W0VA 1IJ9A 1GGBH 2LW8A 5F97E 1RJLA 1S78D 2Q7AA 3NCFB 4K5PA 1X5MA 1XGTB 2DLIA 4J3UA 3JWOH 4C83A 4A3ZA 3OHXC 3RGVB 4WCYH 1RUI1 3II1A 3IFNH 1KPUB 4CADA 4L3EE 1BQ5A 2DURA 2QKDA 3RNSA 1YYML 3JBG2 3K5RA 5I0DA 2LAAA 5EN3A 5CIPH 1TME2 1RJYB 2VMFA 4GJTB 3LDBB 4GWNA 1NXD1 3KXFE 2VITB 4NUPA 5KJ7E 3OR6A 1LHNA 5A3WA 1TEFA 3NW4A 5AZEH 5KZCB 4HIQA 2NP0A 4J6GA 4MAYA 4CEWC 2QJDA 4JPWH 1EHLL 4MXQD 2GJRA 1AZNA 3PWJA 5KS9A 1NCBH 2VMDA 1T2JA 3H6JA 4Q6KA 1OP9A 2QQNA 1MZZA 2JDYA 1LLAA 5E8NB 5IMOB 3PJSA 4OUUA 4F2MA 1FORH 1F97A 1HSBB 4NJAL 2WP3T 4LLMB 3PABA 5DWPA 5F7EH 2IANA 1JU4A 4U31A 4WHYH 1LE9B 2IDQA 4Y1YA 2HVBA 2EDNA 2OJ1A 2CLVB 1FVCA 1BECA 1F4WH 4URKA 4AQ1A 5I1JH 4XETA 5I0YA 4WWKD 4MDJB 4KI5E 1T04B 3U0WL 1DTUA 3VYNA 1E6JH 1RUG3 5TQ2H 2G0KA 3NIFB 4JVWA 4NHCH 3U4BL 1BD2A 4PQ9A 3DV8A 1UH3A 4KY1L 5JZ7D 2Q8AH 4Y24A 3ZPOA 4PSPA 1JZ7A 2Y24A 2Y6FA 5D1QB 1WQVT 3NACH 1E7UA 5C9KA 3MJ7B 2VH5L 1TOXA 4Q6IA 3A7QA 2ZYSA 4FFYH 3DETD 1A02N 4QHZA 4FOVA 4JFEA 1XGZA 3GF8A 5GGTH 1KDKA 3ACLA 5A7BA 5L7OA 1SPPB 1Q5OA 2E63A 4YPGA 4M7LL 1R9FA 3VQ1C 3P73A 4P9IA 4A2MA 2AK1H 1M7IA 2FEDC 3FLPA 2HBUA 4AE1A 4I0WB 1CWPA 4I87A 5GRUL 3H53A 1UY1A 2NY4B 5GRWA 2JQZA 1RI8A 4LARH 5BO1L 3HD8B 5B1AB 3HZVB 5I8OH 4BWTA 1MCQA 5IVFA 1B2YA 2EXWC 3IMTA 4QDSA 1GZWB 5FZKA 4UTAL 3HBZA 2N4IA 2CHHA 4RGGA 2YIHA 4LCIH 3KPLA 3KYAA 4L3CA 5DVLA 3N85H 4DEUA 4EIBA 4AGPA 2Q7YA 3PWPB 1ZANL 4OM1L 5I71C 1BLZA 1TPXC 4LKXA 4RA3A 1FL6B 1HHJB 3C08H 4ZW6A 5HYQB 2YPDA 2FB4H 4NRZB 3AXDA 2XTJE 2R072 1CYXA 3KF3A 1PYWA 3H7BB 4P46D 2XHNA 5HI5C 1MAMH 3V6OA 3V0GA 2OAAA 4R8HA 3O3UN 5HHXH 2C1OB 2GFBA 1KJRA 2AC1A 5FQ0A 7TAAA 4H88H 3S5LB 4JO4L 1BVVA 4TSBH 5ALCH 4AYEC 5HHMB 1D0HA 3DOSA 4FRWA 4EN7B 3PDDA 4MV2A 1AO7D 5FY7A 5D7EA 1WC7A 1CLYL 2W0XA 3B9IA 4YDMA 4Q9QH 4HSLA 2R0ZH 3QD6A 3VBHB 1XAUA 1KPVA 1JGVH 3H9ZA 5IB1A 3AJYA 5FY1A 1T7XA 3MJ8B 5I9QC 3B9KA 4DFSA 2WNXA 4G5ZH 2R16A 3PL6C 4XP6H 1TR7A 2OI9B 2DWYA 1H5BA 1ZVHA 5FREA 1P6FA 3DKHA 4XHQA 4Y8DC 3A24A 2VDKB 3EG9A 4JHWH 3UEZA 4BH8B 4F80A 1REDA 4ZX6A 1YQ8A 4ZUUA 3VMPA 1UKSA 3CVCA 4RFOL 2XWDA 4OF6A 4Z3GA 5FQ0B 1IEAB 5EN2A 5IEHA 3NMBA 1Q9LA 1BK1A 4H14A 3VXTB 3GGWA 3KPRA 2X2HA 4K0OA 3O0WA 2PAEA 4JG0H 1DQ5A 2CGYA 2RM23 2NY6D 3PV7A 4OGAC 2X4NB 3T1FA 4XUOA 3I2GA 4Z7WE 3D1MC 1L7RA 2NZ9D 3K4DA 1UWFA 5T55A 2LS6A 5DI8A 1KPVB 1U8QB 1N59B 2UVEA 2A3XA 1EBAA 1KJVB 5ALBL 5CVRA 5CD3B 5C8CA 4QD2E 2VPVA 2XPZA 4PV1C 5EORL 1AY1L 2EDWA 2IWEA 3US1A 3F05A 1QDOA 5LHDA 3AY4C 1BP3B 5LBBA 3KYMB 3NA9L 1MS9A 4RNRA 2QPFA 4YSEA 1TCRA 2E7AA 3ZL4L 4B9GA 2PTVA 3L3JA 3VRIB 1A1OB 4TULL 1RUE1 4RGOH 1CE6A 1OHFA 1ZTXE 2R0WL 2JB5H 1ND3C 4G82A 1CB4A 2WZ5A 4HONA 4FTDA 4X7EC 4BRVA 3NFPB 1VPOL 1YC8A 1B88A 2ORBH 1VDGA 3GSQB 3JT2A 4J39A 3RVVC 4BSWB 1S7WA 1Q1JH 3F6IA 5DI8B 4ETYA 2H0FA 3RIAF 1LP9A 4JZJB 2TSBA 4JJOA 3KCYA 1DIWA 4UQIM 2G75A 3Q6GH 5I1EH 3JWOL 4QDRA 5C8CB 1DZTA 4U36A 4PJ8B 2A6VA 3GNML 4N8CH 2IXLA 3EJZC 4GY4A 3AZVA 2E9IA 4GH7B 4NHYA 3UZVA 4H8WC 3T0EC 4TQEL 5DLML 1WCBA 3Q1SL 4FOWA 2P5EE 1MDTA 3FJTA 2F8IA 3CV5A 4S0HA 2B1HL 3CBKB 2VGLM 4WO4C 3BRDA 2ORXA 1RZ7H 3N42B 3KYKL 3ZR6A 2WRAA 3IETA 4ZUSA 3SE9H 5I6LA 2E7LA 1V7NL 2Y36L 3VQMA 5IB2A 1NXMA 2ARCA 2DVGA 4GW5B 3VFRB 5HVFB 1XB9A 1NMCC 4RESB 5DJ6A 3B2PA 1R0AL 1TKWB 3TVMD 2BIMA 3W11D 1N4XH 4DEQA 2G75B 2A99A 5DT1L 1WD9A 2YSTA 3QO0B 4Q9BA 5AKRA 5A2AA 5L9VA 4QTHA 1JFQL 1SMVA 5JWPA 3V9CA 3ML8A 3LZZA 5C3QA 1J87A 4BDVA 4EI6B 4QLWA 4N2DA 4WI3A 3CG8A 4A6YB 2HT4D 4WUUD 2WXLA 1X5GA 1OH3A 2PAKA 1NZRA 3L5WA 1PNCA 2LGNA 4WKXA 1EP0A 2QQLA 3ZXKA 3I3DA 1K5JA 2YBRB 1SLCA 4N6RB 1UW8A 4TTDD 1X8MA 1WA2X 3K46A 2IQ9H 4O2CB 4YZFE 4D0DA 1AX2A 4UT5A 2D7QA 3FN0H 2J4WH 2VDPH 3QDJB 4NQQA 1XQNA 2ERFA 3TN0B 1QFWL 4GMP3 2X5PA 2C7UA 1EDHA 3ME2A 1VGEH 2WXPA 4GW5A 1KIUB 3SBPA 3ULVD 3QUXB 3BCDA 4WGWB 1MZYA 3CIQA 1WD3A 4AVCA 2C9QA 1YEKH 1YCSA 3CE1A 2RB8A 4R5XA 3DX7B 3A67L 2ITDB 4X9FA 2D8KA 3L5XH 2MEV2 3KL0A 2B20A 4C0BA 4QHPA 4L0YA 4AW7A 1G7HB 2VXVH 3O4LA 4ORZC 1V70A 1EEYA 4MB1A 5I6XC 4QKDA 1L0YA 3QWOA 1DQJA 1FHNA 3WIHA 4WSGA 3IMBA 5I1KL 3ZE1E 3BO8B 5C2UB 5FK8A 1YY8B 1LNUB 4X4XA 4ZOEA 3L3OC 5AZ2L 3N36A 2VCMA 3QUXA 2XCMC 3KS7A 3BPLC 3LD8C 4YE0A 3ZO0A 4HOWA 4NROA 2FAUA 3LIZL 5F9OH 4XCEA 2YN3A 5LBSH 4YSUA 2LFEA 1PIV1 3VWJC 3LEXA 4YHOH 2E27L 7CGTA 1IE5A 1MCRA 1ODUA 1W8WA 3QEQE 1BM7A 2AGJH 3LRKA 2IXQB 3OKMB 1D5MB 4NRYA 4YSDA 1DZBA 4JN1H 5JIDA 1NIEA 3GMOB 5DAWA 4WW2F 5DZVA 1EEYB 4JMXA 2NXYC 4L8BB 1QI5A 4OI7A 4GD4A 2VLRB 5IFAH 3ATAA 1XXDC 3T3PB 2D5HA 3N35A 4CA4A 2VE1A 4LPVA 3EDFA 1OPOA 1NDGA 2F7RA 3OGRA 2WWKO 3ZYHA 2AAAA 2WSUA 1URIA 4Q89A 3OHXB 5FZMA 2YN5A 2ZX2A 1W6QA 3C8DA 4XRCA 5CIPA 1DZQA 3DRTA 1G9CA 4XNXL 1G7JA 4H0LC 1C5IA 2WSKA 2P45B 2MMXA 1UQSB 4Z7AA 3AS1A 2DWTA 4KXCA 1GU3A 1URXA 5IQMA 2VC2L 1F13A 1UX6A 1KCBA 3DCQA 5I8CB 5LRRA 1NC2B 3LDBC 4DJMA 1OK0A 4H0HB 1TTUA 4NZJA 4JKMA 2J1ZA 5T33L 4F8OA 2UXVA 3E3QC 1BEXA 2E7MA 4X9YA 3ISWA 1SYSB 1ZZCA 1EUUA 1FPTL 3D05A 3L4UA 1ML0A 5DEZA 1FH5H 4RBPK 4BCZA 4JPKH 5FB8B 2UWEB 4KK9D 5ABDE 1D5ZB 2FDFA 1TMQA 1ORSB 4JO8A 4Z23A 3R6SA 3O0RH 4XTMA 2H32H 3CJIA 4LKCB 4R9DA 1E5UI 2JJSA 3DPRB 3BWUC 5I8KL 1SPDA 2FX7H 1JV5B 3O3EB 4J3OG 3DRTB 2CNAA 4B9PA 4DB5A 1H3GA 2Y5EA 1ULOA 3DX9A 3ZYZA 1EY2A 2BP0B 3ES6B 3MLUH 3OGOE 4N43C 1EAQA 3WDJA 5E1GA 4WHDA 2JX9A 2ZBJA 2P37A 3MFCA 2IH3A 1FE8L 4TVUA 1UYZA 1JOIA 3T2TA 4GXFA 2DDQH 1U3YA 1ZA3A 5I30H 4NKIH 1OAUL 5IGXH 5JR7B 1KFXL 1O5LA 1JGEA 4P4KD 4G8GD 3DBSA 5KVGH 2MSPA 4GAYA 5IVXA 5EPAA 1HH9A 1J84A 3WHTA 2WLIB 2EYTA 3UBHA 4OM0H 4X8PA 1AR1B 1P4BL 2C26A 2PYFB 4HPKB 1FRGH 3PHAA 4IU2B 1QRNB 3U7YL 5D1XE 4N2LA 3WFHA 4HG4J 1SBEA 3BU7A 1NA1A 2CA3A 1WLCA 3MRMB 2PETA 1SJMA 4R4FL 3NIFE 1N6UA 3MOBL 1RJ8A 4PBWD 4XURA 1NGZA 3QUZA 5KVGE 1W8ZA 2CLRA 3L5IA 3BQUD 2WVTA 1X5AA 5C09B 3EH3B 3MUY1 1DBBL 2DN7A 3WO3B 3SHSA 2ZWLT 2DWSA 2ZCKL 3NSJA 3V5DA 2E33A 3U83A 3ZRCC 2VIRB 2WQAA 3H9HA 4EWEA 1PSKH 3QCTH 3SJVD 5E56A 2IPUG 2BBVA 1YYCA 4GAYB 2APVA 4PJ9D 3P1IA 2TAAA 4P08A 5IWLA 5MENA 4P23C 3HEIB 4MOAA 1U93B 1YC7A 2OMYB 2UYLB 2VLLA 5JORB 4OVVA 3HNYM 3ZVXA 1ITCA 1SDDB 2BO0A 2GSIB 2H7WA 2RHEA 2VW7A 5IF0A 1NA1B 4MTMA 1F1DA 4A38A 4YFLF 1N5YL 1I8LC 2CUHA 5IG7A 4HV8A 4YZ3A 1HS6A 4FNQA 3FX3A 4OUSA 2CHXA 2F58H 4PJ7B 2PPAA 4GSDL 3K74B 1WDAA 3WE6B 4M7LT 1UGKA 4UBDD 1WUVA 3QOPA 3FTVA 1OARL 2YSSA 2VUJA 4Z2WA 5TQ0L 4DOHB 1NE4A 1TMF2 1WWCA 1LDPL 2K9UA 2L7QA 3KH4A 4K3HA 3P77A 4UBDC 3VNYA 4MH0E 3VBUC 5BY5A 2RBLA 5A6MA 1OA4A 1S4CA 1FVEA 1Z9SB 1GAFH 2XVGA 3N40P 3TZVA 2HUEA 5MENB 1OLRA 1T3FA 4FQ4A 4GBXC 3WDHA 2XC8A 4NIKB 3PHMA 2H47C 2VLLB 4Z0BH 2VNOA 2WNEA 2K6WA 3BAEL 2Z91A 1CAXA 1G43A 4G5AA 3FN0L 1JMUB 1XZ0A 3WEBA 5FYKU 3DBXA 1IRAY 1LK2B 2D7NA 4QXUL 4LRIA 3PQYE 3IDMA 1QHOA 3B2VL 2Q6WB 1OI6A 4PJ9C 2CG9X 2G5RA 4HJUA 1FPN1 1MCSA 4RMWA 2B59B 3RWJB 1IQAA 1QSEE 4G6KH 3MEPA 1AGCB 1O0VA 2GUOB 2IH8A 1QQP3 3P11H 3ARWA 4LSQL 1K12A 1PO11 2N56A 5IVXF 3WXVL 3SH4A 3W11C 5DN2A 4PJDA 4YS4A 2DWRA 5LWBA 4XF1A 3AG1B 3P2BA 3DX6B 4O5LL 1DGRN 1U9KA 2VECA 2HRHA 2R29L 5CU9A 3HNSL 2E6QA 3R7RA 5JDJA 1JK8B 3PV6B 1DGWX 3LDRA 1S2BA 1CR9L 3UACA 5AW1B 3PTRB 2X2IA 4H8HA 1S0EA 4PTTB 3H9SD 2YLHA 2XWCA 5B8CC 2R49A 4L4TB 3MLRL 2J1YA 5CB7A 1ET8A 1ZCRA 1E27B 4Z7WF 2AACA 4CDUB 3CPLB 3NNGA 3FU9A 3MGOA 4ELMB 5BVJB 2EVFA 2WNUC 5D1ZA 1EO5A 2P7TA 5LBSL 5T3XE 4TUKL 3MCKB 3I3QA 5FGBC 3SKOB 3E80A 3EJUA 1LO2H 2K3TA 3NFSL 4HALA 4Z3FA 1N64H 4OFPA 4AE0A 4JUTA 3RMYA 2YZ4A 1PL3A 2XJQA 4NNYA 5CM1A 4M6AA 3V4PL 4F3JA 5F5AA 2HKHH 2QR0A 3DK0A 4IHBA 4HSQA 1P4LB 4K2UH 4M9OA 4S2SB 4F2FA 4HJ0D 3MV7E 5BXFB 3NV3A 3VGEA 3E6DA 2FGZA 1G6VK 1U6AL 2BOCA 2BGOA 2DVDA 3WG1A 1IPSA 2DF3A 1QHPA 2PO6C 2A6WA 4NFDA 3BWUF 4LMQE 4X9BA 1DVSA 1W80A 2D3NA 3HI5H 4JHZA 3P0VL 5E1IA 3S34L 1VAKA 3AJZA 1RUOA 3QQ4B 5E2UH 4L3AA 2C4XA 3FN9A 4M5SA 2OUHA 4YDJB 3MUJA 4FNUA 2VITA 4KKQA 4RMQA 1ODNA 2XUMA 4N53C 5TFSL 5IFPA 4DP7X 2C8NA 5LN4A 5SV4A 3SIKA 1HRI3 1S55A 3LZFH 4Q9QL 2G3XA 4PG2C 1R3JA 4Y1SA 3T0EA 2D44A 5I8TA 3WHUA 3BUPA 4J4PC 1AANA 5LJYH 5EZIH 1L0QA 1MAJA 4PJ5A 4KXZI 4R90L 5MEPB 5FZOA 4X6BB 3KVAA 1AIFA 1TMCB 3TJHD 2HLEB 1POV3 2WY3B 4PJGB 1AR83 4DPRA 4GAZA 2A73B 3SKMB 5FUZL 4BFOA 2YOAA 1L9MA 3TESA 1F4WL 1FV1A 2ZOEB 4ALAL 4MNQA 5LB6A 4HWNA 4MMXA 5DLMH 2X4OA 3J7HA 1QPPA 1SXSA 5EF3A 3B9DA 3ARFD 3KYKH 1W05A 2OT7A 2BXYA 3PQYA 3KVQA 4CGUB 4TTDC 4YHPA 2F15A 2Z2SB 3F5WA 5IJKA 4D7YA 2QDWA 2VUKA 1XMEB 1L9RA 2GUYA 2DZEA 2W65B 4TUOA 1DSFH 4DZBB 4K3DL 1SM3L 4Y2DB 1UO9A 2V5TA 2Z8RA 2DBIA 1RPKA 5DUWA 2OMWA 3C2AH 4D0BA 3SPVA 2QEJA 2NY5H 3QQDB 3ALPA 4L37A 4MQXC 2NR6D 4QKTA 4CU6A 1GZTA 1POV1 2QBXA 5ERLA 4HHAB 3RZKA 3RUGB 3ENEA 5GHWL 1PGRB 1R1A2 3J8F1 1Q0YH 4MNQB 3ZU8A 5MEQB 3FMGL 4KK5C 4XO5A 5IAVA 1NY72 2D6OX 1OKQA 3IMWA 2ITFA 5HHME 4MGQA 4BYYA 5I1CH 3ZE1F 3VFUA 4JFQA 4WUUB 3MODH 1OA3A 3FT0A 3O45B 3SE4A 3WKPA 1BGXH 1UXLA 5FYUA 4R7DB 1FAKT 1BM3L 3ZE2B 4X9HA 4I2XB 2WAQA 5JUEH 1HINH 3LA2A 2DI8A 1NFAA 3V4VA 3D06A 2QQJA 1Y1DA 3MLSH 1DCLA 3AADB 4ES9A 3WVJA 3NCWA 1HXMB 2D3LA 4JEGB 1A8MA 35C8H 1UYXA 3GXDA 3O6ML 5DHXB 2XR4A 1ZWIB 4N5ED 3SPVB 3UCQA 1UWGL 3TA3A 3HHRB 1K8IA 3KLSA 3AP4A 4LO8A 5FFOC 4IKNA 1X8EA 4NCC1 5K33A 3T6ZA 5C6TL 1T7WA 4PRPA 2DTWA 3KDMA 3MLVL 4B9CA 2HFFB 4NX0A 4EO5A 4M6OH 3F01A 4DO0A 5IHZA 1TUPA 4R4XA 3L5XL 3B2DC 1GZQB 1LHOA 2FWLB 5HYJD 4Q4X1 4O2EA 4YBQD 4H3WA 2SEBA 3BUTA 5I5IA 3KPRE 4G1EB 4L8QA 5G04L 1QRNE 3SKVA 3MV8B 1R3HB 4P3DA 4E8DA 1UACH 1UKGA 1IVTA 4JFDA 2XZQL 4LASL 3X13A 2C1OA 3H1MA 2YY1A 1OOPA 2EDJA 2ZIDA 3PREA 1MRCL 2P24A 4HUXA 4QB6A 3L6FB 3KYOB 3QAZB 3VQLA 3OXSB 2JJSC 3VGIA 3I84A 4D9QE 4NUGH 3JTSB 4XUQA 3GB7A 5FWRA 3QRGH 4TMPA 1W9FA 5KXDA 4KROC 5T52A 2R23B 4AOCA 1GCFA 2KKQA 1KIPA 1NOVA 2B7YA 5IHZB 4DN3H 2H3NA 2Y26A 1NMBH 3LH2H 4MD4A 3JV6B 3QQ3A 2C1PB 2V5YA 2OV0A 5FYJE 2BVQA 1FBIL 4Z07A 4PIZA 5HHMD 2VZRA 4JGZC 1NBCA 1L9SA 4PHXA 4HIJA 1PZAA 2VDRB 4TSVA 4A2LA 4ATFA 1YPZA 1KGCD 2H32A 4NC1E 3INAA 4Q2ZA 1V6OA 3APNA 1VRH2 5T5JA 1AG0A 5INDB 4R7LA 2Y6SD 1TNNA 2KHAA 3S5YA 4F8PA 1VF5C 3WXVH 3SKUD 3PNWB 5LGJA 1SLBA 1SLTA 2BTVC 2COQA 1T1ZA 1G5AA 3KPRB 3BH4A 4UILL 3V9FA 4XNXH 4QGMA 4NUJB 2IH1A 3GB7B 4Y4HC 3CC1A 4E0RB 3CFCH 4LULA 2R23A 3ZT7A 1I85C 2WXKA 4IRJB 3G6JB 4MZ2A 4P5MA 2X6AA 5DUPL 5AZEL 1KTCA 3RZCB 1H15B 3S2CA 3ZIMA 4G43A 4HMZA 3SXWA 5C8WA 3N41B 3X3GL 4XDQA 3CBRA 3EJZD 4PJFA 2A74C 1LU2A 5I1GH 3MLRH 1PGW2 3BSZH 4HC1H 1D9KC 3UBXB 1O4TA 5FZ8A 5IFJA 3ZSLA 1X7QB 1DQKA 1G9ML 3WFEL 2DUPA 3WENA 4LT5A 2X2YA 3KPNA 4X8JB 2VSKB 1SF5A 2MWCA 2VDNB 4K5MA 1ZHNA 2X3AA 3A23A 4ODSL 2DJMA 4RNRB 4UT9L 5EWIL 5HHOA 2Z92A 4NYLA 3ZOAA 4YSSA 5LCWL 2HWC2 4XC1L 5EU5B 4BJLA 3HAEB 5DQDL 1OK8A 1WRFA 2QMKA 1RJZA 4RAVA 5EU7C 5HI4D 4FABL 5TTRA 1T22B 1GGIL 5F89B 1JMXA 3ZZ1A 2X89D 2LALA 1NBYA 1GY1A 2PFWA 2Q0AA 1KXHA 4LLWB 4J3WA 3FB8B 3QZBA 4YHYC 4XWGL 5FA4B 5A7SA 5JXED 1CL7L 4L0PB 2QLVB 2BZCA 4ZXBA 1K5WA 4JCLA 5IVCA 5JI9A 4KPHH 4JN2A 3WKMH 3D69B 3EHBD 4KV5F 1LEGB 5H4YA 5KVDL 3U4BH 4M56A 4APXA 1MCPH 4ARXA 5CADA 5HJ3B 3QG7L 3KW7A 1W39A 2HLAB 3JBG7 1XNTA 3MIDA 3MO4A 2EDKA 5TK4A 4FNRA 1CPUA 4I3RH 5TD4A 2VH5H 4P5TC 3DNKA 4TSCL 3B9KC 4PJYA 3VCLA 1NCQA 3DX8B 3QC6X 4K5LA 4HZLB 1KNOB 4MAYC 4LHNA 4CEWA 1J8HA 1X5IA 2JK5A 5TDNA 3S7IA 1MCOL 2XQYA 3TCTA 5FY9A 4P99A 5EO1A 3F2LA 2HJIA 2A1WL 4RAVB 3DMMB 2WFF3 3B5LB 3O1UA 4BZ1A 1A9VA 1VFAA 1KJMA 4PV9A 25C8H 3DYOA 2EXHA 2CGNA 1URLA 2VDPB 2B4CL 1MW3A 5A2FA 4M01A 5SV8A 2G9HA 1NEUA 3POIA 2GMEA 2OYLA 3WIIH 3ILEA 4Z0XA 1OGAD 2KD7A 1PAZA 1C8M2 4MZ3A 1GGUA 5JMCA 1IC1A 1MFBL 4BQWA 3EBIA 2PNDA 3NCJH 3WI9A 2ZWNA 4AVAA 5KYUB 4NN6C 3V6FA 3QCTL 1SYVB 3VG9B 1D5BB 3IIIA 4HK3J 4MB3A 1HHHA 2RS13 4HUKB 3RA7H 2NW2B 3Q5OA 1R4XA 4MUVA 5J3UA 3DX8A 3RPKA 4JM2B 1IS5A 2Y3AA 1XDTT 3FC0A 4YC2B 2BNQE 2BWIA 3ARBB 3DGDA 3HG1A 3QFDA 4OLXL 4XTRD 5DGQA 5EO1B 5I75C 1TJGH 4PGBA 3WN5C 4NZUL 3TTSA 1ONAA 1I1AA 4PV9B 1YNKL 3JWDC 3MRCA 1GR3A 4UQEA 2BSED 5JZ7C 4NKDA 4N86A 2NYZA 1G7MA 2J1UA 1IGMH 3L9RA 4JZOA 1FATA 1FYTA 4JRXE 4LLQA 4OHWA 1UURA 3C2AL 2DVAA 2ZP9A 4P2RA 3P6BA 3V6FB 2YEVB 2PR9A 4IV1C 1YI9A 1TXKA 1UD1A 5C71A 3K4ZA 3RX7A 4PJ9A 3VACA 5DRZB 4LAQH 2QDRA 3QFDB 4PJEA 3ARTA 3LN9A 5D7IE 3OXRB 4L8SB 2BSEA 2DMKA 3Q6FB 3L4YA 1VZHA 1B6DA 2X4SB 1J8SA 5F39A 4N5EC 2J8UF 4NQDB 2WS91 3L3DB 2CDPA 2EJ1A 1LYQA 1XH2A 5TJWK 3AY2A 1VRSA 2R2BB 5LBEA 1FYTB 1BOGA 4TS6A 4C8DA 2EO9A 5FKPA 4P9LA 3CN1A 2P5EA 4XCEB 1W8HA 1QSFD 2WWKT 4YBHA 3P9LA 4XNYL 3DX3A 2WNGA 3PGDA 3ULVL 1RVFL 4KWKA 3WQ0A 3MCLH 5LA1A 1Z0MA 2IG2H 4GG6F 2R69A 1F5FA 5ANNA 4PJAA 2A6DB 5DZNA 3NFNB 4ZNEE 3CHPA 4V33A 3ACGA 1TNRA 4AC2A 1TJHL 5JA9A 1JUIA 3UL2A 3BKJL 1RINA 4X5QA 4QY8B 2XWTB 4KTDH 4MJIA 1G6RH 4PB9H 5BPXA 4PF1A 4AWJC 1AYN1 3DYPA 4X5XA 4IKIA 1I7UA 3TBVA 2W9EL 4R4NC 3DHMA 1Q1PA 5EBWA 2CAKA 1ENSA 4OZHA 5F2SA 2EIEA 3J07A 1WCQA 1UZVA 2YD8A 4YL4A 1OM3H 2P5EB 3COOA 2CYFA 1O6VA 4NUGL 4W9KC 4BA8A 1LO5B 3AKTA 1QUPA 2MCG1 2A6JA 2FHRA 3BP7B 4NQDE 5B38B 5AKTA 3O8XD 2WKOA 3ON7A 4JRYE 5C0RH 5IK4A 3GMQA 3O6FB 4LCWA 1NAMA 3WFDH 4LP8A 4K3EL 4KDTC 4EIGB 3BSZA 2NUPB 4HC1A 3VHRA 3ARFC 2X70A 1ZBE1 1FYTE 3FO9A 1U91B 2EDHA 1AD0B 4BQ6A 2JG8A 1QBAA 1H3VA 1ZIBA 2CM5A 1A3LL 3CZGA 1V6JA 2BSTA 1C28A 2D0FA 3ARYA 1B4JH 1BMWA 2WQXA 1D7FA 4FS0A 4X6QB 1JXNA 1Q9KA 5F7FA 1QFUL 1QKZH 1RIVH 1E2VA 5C4WC 5I1AA 3B56A 1ZLWK 2QHLA 3Q1SH 4KTEH 4L9DA 1BXHA 2FEJA 2GNDA 4FA6A 3DX9B 4W4NA 1W2KT 2BP0A 5C9JA 5J12B 1G9HA 2P44B 2M26A 1FE8H 1YMHA 4UF7C 5F93C 3VWKC 1RZ7L 5C8JA 4LCWB 5IFHL 5TFSH 5D6CA 1EK3A 1ROWA 2IH3B 3T3MF 4N2IA 2YXWA 4YSTA 1LNSA 5IJRA 2XBO2 2VDOL 3KL3A 4RMUA 2UZYA 3DVNA 3WNXA 2JXAA 5IROD 1OE2A 1ILUA 3IFOB 4QUOA 5AYTA 3GKWL 1UASA 2QVMA 1JPFA 4DKAA 4U49A 3KEDA 3VTMA 1TSRA 5ICUA 1AE6H 2YUWA 3ESOA 3CGTA 3QUMB 5EA0L 5F9WB 4CGTA 3BDXA 1YG9A 3RTQB 5LBGA 1E9OB 3FQ4A 4JKKA 3CX2A 4LSUL 4R5VA 1F5JA 4GKNB 1L3WA 4A7QA 3GSNL 3L17A 2QKIA 3CFBA 1T7YA 2QBWA 1DLHA 4ABUA 1WYJA 1T5XB 1XGTA 4C83B 1P69B 12E8H 1E8WA 4JO3L 4RCAA 2O5YL 1FA4A 1S7TB 4YEFA 4KPHL 3D0LA 2CLRB 1SFDA 3EH1A 2VKXA 3LVTA 4ONHB 3ZK0A 4ZTOL 3DXUA 1CGXA 3HRPA 4H0GA 2DICA 4U1LB 3OY8B 4FQ1L 3V5DB 1OH4A 1PGSA 1AF9A 3HMXA 5ISZA 4QT5A 1UU4A 2ZJCA 5I8EA 3ZRFC 1G1CA 1QEWB 5I1HL 1CD1A 3G6AA 3MRQA 4RDQG 1CXEA 3VH8B 4M5YH 3IAPA 2YZ1A 1YEKL 2UXGA 4ZRGA 1MS8A 3KPSE 5KEZA 3HEIA 2BNUB 4GJYA 3NPSC 3RL2B 1MCOH 5ENWB 1M9SA 4XNUH 3A22A 3ECBB 5KHGA 3BQUB 4G6AD 4N0FA 1BQHG 4YHMH 3P4NB 3PVOA 4BV1A 3OUHA 4NQUA 4QEGA 1DLHB 1Q8VA 4RDQF 4MNQD 4BZ2H 2FH8A 3M46A 4NCC2 3HUJA 3MYZA 4HZFA 4K9SA 5GLUA 2ALAA 5BQ7B 4J28A 2Z65C 4E9SA 1MFBH 1JPSH 4NUQA 3BVVA 3GSVB 3L1EA 4N2KA 3VXMB 1BVP1 3EGDB 1JERA 4QQLA 3FUEA 4XPVA 3NGBC 4LU5H 4PJGF 3VD5A 2ITCB 2GT9A 4MWFA 5F9WC 4KKAC 3GHEL 2K70A 4D0CB 3OWRA 2DYRB 3EIFA 1HXS3 3ETSA 4XGZA 2HFEB 3LMJL 5BNOC 1HOEA 4CVZB 1ND3B 3ECBA 3HE6A 2OL3A 2Y06H 1WAAA 2R4RL 4FXLA 3P4NA 4OFIA 1CAXB 2CE6A 2P52A 3M8OL 4M6OL 1T1XA 3SQBA 3APDA 5D21A 1AI1L 1QH7A 4LCUB 2A2QT 3OGGA 1WFTA 4M93B 4NBYB 2ZUWA 2I07A 4JZJC 4ZNEA 4B4QA 4M48H 3RWEA 3CCHA 3G5ZB 4P9MH 3WEXB 5A80A 1OY3B 2WFF1 3RQ0A 3CUPA 4QXGL 3ZY7A 3CXHK 5ABZA 1TF4A 4B95C 3D4YA 2ITCA 5CEZD 1JNHB 4DN4H 2H1PH 2Z4FA 3GHNA 3MRLB 1MRCH 1FVDA 1SBSL 1MFAH 3QRFM 2VTXA 3HNSH 1JU3A 1FLRL 3P2DA 1UEMA 4L9LA 4MJID 3SDAC 1SHWB 2AC0A 2J8HA 4Y4RA 5BPPA 3BP4B 4UB0L 4LUMA 4LHUB 2HPTA 4U1KB 3GEWB 5HV4A 1DVFC 3HC0B 4PIBA 1PMHX 5FBZA 1YY9D 3GBEA 4QRPD 1E5AA 1IS6A 5AENA 5A1FA 5T3ZH 1AHWB 2JVUA 4MJ5B 3DO7B 2UYBA 3RPQA 1CLOL 3KGLA 5D1ZB 3PWPA 3R0RA 2BMKB 3H56A 2P3JA 5C0JA 2R8SL 1QRKA 1I7RA 4WI0A 1TE1B 1I9EA 1FX5A 4DMIA 2BX5A 1RVFH 1BEYL 4DP6X 2VWEE 3CTTA 5EZWA 1BLNB 3HG3A 3PHSA 3IPEA 3VD7A 2R9HC 1OCWH 5E9DA 3N7JA 2BFUL 3WKQA 3X1FA 4PH8A 4XI5C 5EO0B 3LF7A 4GZ9A 4AFMA 4S2SA 4L0ZA 4PLOB 4LBQA 5F7DB 3BMVA 2A6IA 4JFVA 2NNXA 2VLJD 5E5MB 5EULV 2KC0A 5IQ7H 1H6EA 1OTTD 3QIUD 2EE2A 2WO4A 3HC0A 3QJVB 4EDWH 5GZGA 1P1ZA 2K8MA 1L9OA 4OLYH 5E1AA 2ZX0A 3N9OA 1G9MH 3QEGL 4XNZB 3EBAA 4Z8FH 1VAVA 1YFWA 5K9KA 1HU8A 1NGQL 1I7TB 4I1RA 5HD8D 3B9KB 2W91A 4L4VD 3IEAA 5D7LB 3WY4A 1S8DB 4BUHA 2FATL 2JE9A 5I6NA 4EYUA 2WQ4A 2K2SA 3RU8L 2BEOA 1H1MA 4U1GB 1BMGA 2PA7A 1A6WL 4TXVB 4WV8A 2LVCA 4LBQD 1NPNA 4QOKE 3PVEA 1ZXKA 4XW3A 2OFQA 3I2OA 3T1MA 1WAAF 5E6IC 1LEDA 1MZ6A 5KN5A 1LHUA 2ED8A 1Q9LB 2HN7A 4IGBA 1LRHA 2ZEZA 2J1XA 1YFUA 2NR6C 3G6JF 1K9TA 1QI4A 4D9RE 2YLKA 1W2AX 1MHHA 3FNKA 4FQJL 1B3JA 3U0ZA 4RQQA 1MFEH 1BEV1 1JODA 1RV6X 4M3HA 1ECYA 4OCRH 3VG9C 3W5NA 4GRMA 3TURA 4CC4C 4D3WA 3MLTA 4EE2A 4HT1L 4BFEA 5CINL 4NE9A 4XP1L 5T5NG 4WVVA 5JUVA 3UTSE 3EFDL 1WLHA 4LSVH 4F57L 4Q4W2 3R1GL 4K7JA 1S5HA 1YXWA 2KERA 1TYRA 2ESVE 1YEGH 3WN5B 4F9PC 4MFHA 1DFQA 5EOQH 4GQZA 5AW9B 3L48A 1HZLA 4OMDA 3GLAA 1A7RH 4XMKL 1OARH 4DEPC 1X3DA 2TRYA 3BUYA 4R97B 4ZFQA 5JXEA 2R4SH 5BV7H 2EXYD 3TX4A 4XPTH 4L5FL 2VQ0A 2AJVH 4G7SB 1LGBA 4JCWA 5K9OB 1BQKA 5F7WC 1BCXA 5FCCA 4M6MH 1DJGA 4P2QD 1MLBA 3QUZC 5C2BL 5L4IA 2YD3A 1BQHB 2AJUH 3HZMB 4M61A 4U6HA 4O9EA 3QDGD 4LCCA 3EYQC 4W81A 4MAYD 4FYSA 5TH2A 1BIIA 4YX2L 1HJFA 3VI3F 4OBSA 2LW3A 3HLAA 2KQMA 2ZX9A 4AIZB 4GKZB 4N26A 4FNLL 5I26A 3UTZB 5DFVD 1YEHL 1JZIA 2VDLB 4ELME 1KGIA 2Q3AA 2XA8L 2A4ZA 4MXWL 1YMME 4UT7H 4OQ9A 2DEWX 1PW3A 2J7LA 1G94A 4IIQA 3WG2A 3ZN4A 4Z18A 3U4XA 1BCIA 5GS1B 1M05B 1NPUA 3ZJAA 1BVOA 5TGBA 4GXLA 3WF4A 2ZXBA 1H19A 1GTNA 4UANA 4V2BA 4YXKH 1SJVA 1UKTA 4AI1A 4X0NA 2QPSA 3MO1A 4JDTL 1D4M2 2BDRA 3VFRA 1MS0A 4P9WA 4A6OA 4QPYA 4TLGA 1BQRA 3DVIA 1N2RB 1FDLH 1QPXA 2KLTA 3MV7B 3WF2A 3C09B 3MXWH 1SQ2N 3BH8B 3GXUB 3WJLC 3EFOA 4Q0SA 1PO21 3SO3B 4JM2F 3QQXA 1ZGLP 2RJMA 1TZGH 2ADYA 3UJTL 4L3EB 5JLVA 2ENQA 3VSUA 1NDTA 5JXIA 4P5TD 2Z34A 3O11B 3V4VH 4NQED 3L3KA 2UY6B 5DJYA 3UC2A 4WJKB 3L4VA 3WG3A 4PS4L 2X4RA 4IIQB 5D2NE 4IW4C 4RD7A 1L9NA 4ODUA 4WY7L 4ZUTB 4XBGA 5F3HA 1VP6A 1CFVL 3QW9A 3N85L 3V0HA 4HIIB 3N40F 5ICZB 1NLBL 3TN0A 3GXFA 3O3DA 2R27A 2C7UB 2F53B 2A7BA 5FZAA 2CO6A 1J1PL 2CO3A 4I7ZC 5J6HA 4X98B 3LEKA 4AAPA 3AZUA 1QTPA 1UATA 1Z5YD 1C1EL 4S1QH 5DRWB 5JHLL 4JQRA 2XI9A 2ZAHA 3JV6A 3QQ3B 2YPLD 3BH8A 3HE7D 3D12B 4IKKA 4YLBA 5DZJA 3AFKA 4FG6D 5DUVA 4FPCA 3VD3A 1BIHA 4WO0A 2I9TB 2ZA9A 1RZGA 1F31A 4Y5Z0 1RSFA 1NC4A 2DQUH 1AUYA 2BNMA 4JBSA 4NO2B 5E00B 3WD5L 1UD4A 3MN8A 3E6HA 1QG3A 1RUQH 1MI5A 1IBGL 2EABA 2PMZA 3LN4B 4QHLB 1OHQA 3JUYA 4TUJA 3FSZA 4OT1L 1RUH2 1V9U3 2FLMA 1G7HA 2E7BA 4ZNCD 5HBBA 4JO2H 1LHZA 1UA7A 1SOXA 3WTXA 1T1ZB 3CDGB 2D31B 5F71A 5JQIB 1NGPL 4PD4K 2BJML 3Q0HA 4JDZA 5BV7C 2NYYA 4D6RA 4M62H 4HVRA 4KXZH 1ETJA 1GYCA 2YGVA 4IRJA 3OLIA 1BVLA 2WLLB 4P5MB 4PBXA 5EC2B 5J12C 1U4FA 4M1GH 2Y5TB 1GPOL 3VBUA 3O6FD 1E5RA 2EACA 3GTVA 1CT8A 4HETA 4PS8A 1J05A 4PBDA 3LEXB 5DYFA 3UBXA 4FXGC 2E7DA 2W8CA 2BNRD 2VT0A 3F7QA 4HLEA 4XCNB 1WLDA 4E41D 1CIYA 3UKTA 4NHXA 1MFDH 4E42A 1GKOA 1ACCA 1I5ZA 4BMBA 1NM9A 2PPDA 3OKMA 2OW6A 4F2EA 2ZACA 1ZY9A 2VZOA 2W5PA 5EF1A 2OZ6A 5KSUB 4QRQB 5HCHA 2Q8EA 2V33A 2AQQA 2Y1ZA 5AAPA 5FA4A 3GWJA 1F6FB 2GB2A 4R7XA 3H7YA 4LP5A 4XRCB 1I9IL 1KTJA 3GXTA 2RALA 4JVPA 3EUDA 4MB5A 1OD9A 4MGSA 2VBBA 3V7MA 1BZ7B 1UQSA 1FF5A 4UTBA 5C0BD 5A2KH 4IERA 4AQAB 1O7VA 4JY6B 1E8XA 3CMOH 4XCNA 5DS8A 1BAGA 1NC2A 2ZCLH 5IK5A 3KV4A 4CP9B 4MNHB 1IC0A 1AXIB 1VBE2 2EDBA 1KN2L 2YMXH 3DUHA 4H1LG 4ODXA 1AO7B 2DD8L 3NIDB 4FLOA 2WZ8A 3IS0X 2QVFB 3VFMB 1DZRA 3KMDA 4ASKA 3EHKA 3P30L 2D4FA 2BSSA 4M5ZH 4K71B 3KLAA 4MQXD 4ANUA 4ELMF 5IB3A 4J3TA 5KUKA 5CKGA 4QX3A 2WNUA 4XHBA 5DO2D 2VZ3A 3D2UA 4PT6A 5DSCA 4X6DF 3II2A 4D3CL 3EYFA 3TRSB 3GNMH 4N8CL 2BW8A 5FHAL 1YIFA 2FDJA 4D7TA 2FT8A 1VBB1 4MBRA 2F2HA 4YHLL 3NNJA 4M1CD 3SNMA 3GBDA 4NZRH 5C0AD 4F2ME 4FQCH 2O61B 1UOBA 1QLFA 3T4YB 5A32A 5D5MA 2X5IB 4M5YL 1OGPA 2BIPA 2XWRA 5CINH 2XXMB 5A1AA 1A22B 3ZW3A 5KZCD 4OCWH 3PUUA 2CDFB 2YBPA 1V7NH 1AGEB 3BIKB 2W39A 2WLIA 1I1AB 3U9UA 3VGAB 1L7TH 2WJ7A 1I3HA 4YDIH 3RPBA 3I54A 5ABJA 1COBA 5IK8A 5EIYB 3BRFA 1IGTB 4N0CD 3NL1A 4GUOA 2P5WB 1J9RA 2FBRA 3LIZA 1CLCA 3NJKA 3OJDB 4N0CC 4AITA 3H0TA 3W0WD 5JPNA 1G7YA 3NZHL 1VACB 4P2AA 5L36A 1R24A 3V0BB 1V7MH 4BA6A 4YDLC 1YDPB 2EKJA 4JFHE 3SKJL 3QO1A 3OAUH 4F3FB 4LL4A 1URZA 2ZKNA 1NGZB 4LR4A 1J1OH 4I3SH 3OCPA 1D6EB 1QBLL 5HHQA 4RGNC 1DQ2A 2EVXA 4LBAA 5KJRH 3DXAE 3C6LB 4N8MA 2BLFA 4H20L 4JJHA 1QPKA 1HE8A 3UAJC 2CU9A 3GXIA 3SSGA 1FNZA 4LOTA 3W9AA 5DZPA 2RGSA 5ANME 2C3VA 4ACTA 1OURA 2P5WA 1DVFB 4EUPB 4QHKJ 1OVZA 4CCLA 2N3JA 5A6XA 4F8TA 4Z92B 2YUZA 1IAMA 4W9GC 4XNYH 1DGWA 4CDXB 5HCAA 3X1GA 5LCVH 4HV8B 1UAIA 3UERA 5I0VA 3WW4A 2F19H 2VQ1B 4CYDA 2YD0A 1WT5C 3O9WD 3U2SA 2E86A 3UYJA 1CLYH 3LNEA 4C0HA 1AYOA 1TQWA 2ENSA 3LXCA 4RA0A 6FABH 1M71A 4QX7A 1TG7A 2DUOA 4G5ZL 3V55A 2DKSA 2JDMA 1FI2A 5TE6L 3JBG3 3PAUA 1R1ZA 1S9XB 2R56H 1ZLSL 4HEME 5C6PB 5JMOC 2E7CA 2VDML 4C58B 2GI0A 3HPJB 4WY7H 5AVUB 4JGYC 4KJQC 1YQ6A 4P59L 3ME0B 2J5LC 4YHOL 1AL22 1P7HL 4XNZC 4E2OA 1RVF2 2GNMA 4UV4H 4QNPF 4KU1A 3U10A 1UIKA 4HJ0C 4NWTL 1SZNA 5IK3B 5PCYA 4ZQTA 4IE7A 4GRLC 3AMNA 4KBBA 3OF6D 2NUPA 2D73A 1KIRB 2ZF9A 1Z1WA 5FYLL 1M2OA 3SEEA 5IUSA 1A3LH 1KITA 1AD0A 1M71B 4ZS7L 2ENPA 3U0TB 3L5JA 3NJLA 4P8QA 5KVDH 3MRGB 1HQRB 3QZOA 4PTUA 4UINL 2UYAA 1RUMH 3IWZA 2AXFB 4L8CA 5LG1A 2C3XA 3FU6A 1RUKH 2OCJA 3G9AB 5LGYA 4S1SL 2IAMC 4IBQA 3FJSA 1Q9KB 1A8JH 1T0PB 3HPJA 1RZJH 1EZLA 1O6SB 3IS1X 3QEGH 4Z8FL 3LRHA 3O4LE 1NGPH 3WDUA 1VBC3 1CAUB 4O9GA 1DUZB 3MGUA 4LQFH 4IEWA 2OLDA 3WOVA 1QO3B 4UTCA 5IK3A 4X6CA 1OL0A 1K5MB 2MPAL 5C8JB 3LDKA 1T20B 3EQEA 4FI9A 2HH0L 2DM7A 4PB0L 2P7TB 3GUFA 3LKPB 2D3VA 3TEZA 1FPTH 4XB7A 2ORZA 4XDOA 4Y4FD 1CQ9A 2BOIA 2HKFH 4ZUWA 3OJ2C 1D5IL 4J2QA 4F7TA 5JOFB 3AITA 2J3SA 4CDHA 1UU5A 1X36A 1HQRA 4PTUB 4NPYA 1OD3A 2JI1A 4N0RA 2C6SA 4V1DB 4KG8A 4XQDA 3CNAA 3TF4A 5LA0A 5CO1A 4B4PA 3KHCA 2B9BA 2VRKA 1A6VL 3TGXA 1J48A 4NN5B 5GGVH 3F7YA 1JPGA 4KROB 4YK4B 3OUJA 5CS7A 1DUZA 2WB7A 1LWHA 3UG5A 2Z5WA 3UAAA 3KWTA 1YQVH 4Y2NA 2XQBL 5APAA 3PAZA 4MD0A 4M43H 1D7DA 1JHKH 4ONHA 3FSVA 4HKXB 2C1FA 2DLFL 2XN0A 1D3CA 4XTRC 4LBJA 5JPMB 2CJSA 3IM0A 2NXYB 2HX7A 3ZX1A 5AW4B 1JTOA 5EOQL 5KYXB 5GGSB 1R0AH 1FZJB 4UMGA 1W72B 2QELA 2AEYA 1BQSA 1M1SA 2ZCLL 2FYYA 3BWSA 1I9RL 4N90E 4BKLA 3U4EB 1KN2H 2VR4A 2JG9A 3WDXA 4EIZC 4M6NL 1S7QB 4YO0A 1CTMA 3ZT5A 4Q9RH 1NAEA 4XF3A 5FZ0A 4IMKA 3QJFA 3V65A 3W20A 3NJJA 1FHGA 4J1UB 4Q6YA 2VXQL 1M6OB 4WU5B 2EDLA 1ZZ9A 5FY8A 5FXXA 2VUYA 4BZ2L 4YAQB 1ZRDA 4P2QB 3ZN6B 1AIFB 1MJJB 3F7LA 3MLZH 4DP0X 4XNQB 5IBLD 4MD0B 1S0IA 1BXVA 5ACZB 2A75A 1AZUA 2BVOB 4AENB 3T65B 2X42A 3KT1A 3ARVA 1RIHH 5CZVL 5FR3A 1G6RB 2O6FA 4PJBB 2JDHA 1EO8L 1FZJA 2IJ0C 2QQQA 1MHCB 3K4AA 4S2HA 3L2LA 32C2B 4I0PA 3MFAA 1QXRA 4WF7A 1FOD2 4XPFL 2B0SH 5J1TC 4XGZB 3RVTD 2AEOA 4L99A 1WBZB 3KDPB 4OCWL 2IAND 3FWEA 4R52A 5CWSA 3I2KA 5AW8B 1E42A 3BIEA 3CL1A 3QUZD 4DOHE 4OUMA 4YAQA 5JDBA 1G1YA 1B9ZA 5IMOA 3SE8H 4E4SA 4P5SA 4UAHA 3N6YA 2QCSB 2YPKA 3AQZA 4L37B 4XFFA 3RI5F 1NCQC 2BVOA 3O6LH 2LAGB 3RWEB 4A42A 3T65A 3EJRA 1WBXA 2B1AL 3RFZA 1TZAA 3VFSB 4LF3B 1W6OB 2DCKA 2XYCA 1EMTH 1FFNB 3AU1B 3V8OA 3EYUL 4L3ED 4NPMA 5AFBA 2EAKA 4Z7QB 1HHIB 5E2VL 1BG9A 4LHQB 3WLBB 4P5TB 4HDIB 5HI4C 4FPEA 3VUAA 4HBCL 4IHOB 32C2A 3MLKA 1RIUL 1T04A 3JUUA 2H0PA 1FLRH 4HCRA 1FNGA 4Y4KB 2BS8A 1CFSA 3DECA 1OT5A 2X6UA 2VAUA 3V5KA 3RI5K 5IVYA 2Y7MA 2WNKA 2F74B 2Y7SA 1C4RA 5JZGA 1ZJAA 3B1UA 4S1QL 4N25A 4ZFOB 1T4WA 6PCYA 4JHWL 1E4WH 1PLCA 2E4FA 4CMMB 5F7HA 5F6IC 2JSFA 2YPLB 3HE7B 4IRZH 1GNHA 4KKRA 1R082 1RTVA 3RZZA 3AREA 3KDMB 3GPEA 4NO0D 4W9JC 4LF3A 3MLYH 3VXNB 2Y38A 3O1OA 3ELQA 4LLVB 1FYHB 5CLYA 5LCVL 4P5TA 1LULA 1JGLL 1YUHB 3N04A 3GLZA 2LU7A 5HI5D 2WXHA 2XVKA 3FN3A 3OF6A 3OPZH 4QXTA 3SODB 4OFYD 3WIFB 4XC9A 1QSEA 1EQWA 1FNGB 3F58L 2HH9A 2V5DA 2IFGA 3VD9A 3H1WA 2VSCA 1S0JA 2IPTL 5IUQA 1FFPA 5GS0L 3L3OA 3QIBD 5IQLA 5IFHH 2C24A 5EHDA 2VJ0A 3QPQD 4LBQB 4Z7QE 4PLOA 2OSYA 2P24B 2IMMA 4HUXB 2DYSB 2DV6A 3L6FA 4JW3A 4ZW8A 4EROA 4RS5C 3A5VA 1I8AA 1H6XA 4GWMA 2AENA 2JDUA 5JLZB 1W6WA 4GH4A 2AQ1A 3KPLB 5F9JA 4HN1A 5E1AB 1B0RB 5FLJA 5GSVA 3V0EA 2P34A 4S1RL 3SOTA 4E41B 1AYM2 4IV1B 4I48A 1U8NA 2APBA 2UZIH 2W38A 3HFMH 2XY1A 4ENED 2FX7L 3NVQA 2GC1A 3KJ6L 4TQIA 1MJ8H 5DMGC 3P3SA 5CEXB 4LITA 2YPVA 4JC1A 1RPQA 2D3RA 2HKHL 3ZHFA 1GZPA 1YPZB 3HQXA 2BDNH 4JQIL 2GNBA 4YOKA 5INDA 1O7SA 2J71A 3WCSA 5FZIA 2DQHH 3FT4A 2JELH 5JHBA 4NP4H 3KCCA 2FBJH 3FB5A 3KCXA 2NY2C 3CN4A 3C5SA 1LQBC 4L1DA 4Z7UE 2UWBA 1ZEAL 1XZWA 3CWGA 1HKLL 1CFTB 3MBEA 5FP8A 3TPUB 3G6JA 3NBNA 3DI2B 4U1MA 3DF0A 3WLUA 2W94A 1SFPA 2ZXAA 3G5VB 3EFDH 4LSVL 2H9GB 1L4IA 3SBWA 3V8CA 4PJFB 4XNUL 5JIKA 2UUDK 1MWAA 4PGCB 1QKQA 2WJSA 4R9AA 3F64A 1KF9B 1RKRA 2D7MA 1HIML 4CPBD 1YEGL 1Z3GL 1I31A 1EAH3 4PB0H 4KMTL 4R4FH 3PLYA 3WMQA 1A14H 3C75A 3LRSB 1L6PA 1LO4L 3QQNA 5FUNA 4AFDA 1RUC1 4QQ2A 4S2DA 1RMFH 4MRCA 3VRJB 5L6YH 4E4ZA 2GIMA 3SDDC 3NKGA 1YRZA 5DJ8B 3TJEH 1XCQA 1YPZE 3TNMB 4EVNB 4KJPC 3MBEB 5EZJA 4L0PA 3RURA 2XN9B 4J3OF 3STLA 4YDLB 1UZGA 3D4GA 1KJVA 2CNZA 4KKLC 4N9GB 5CD3A 1UH2A 2QADD 1I5PA 1MWAB 3K2MC 4PGCA 5F7AA 5T1DH 1DN2A 3BEVB 1EV12 1R5IB 1A6TA 4PR5B 5BRZA 2EXKA 3QCVL 3T0ED 5A33B 2R32A 1AI1H 1M1XA 1SJHB 5IQOA 1JPTL 4LT7A 4NLHA 1JZFA 2XA8H 1BA9A 3ZKNC 4NKMA 5D7KE 1GQHA 1JW6A 3AB0A 3KVBA 4GSDH 5CU1A 5DUUA 1JHLL 2YC1B 1W72L 5JSRA 3D2UD 3VGBA 4AHWA 4GMSL 2GK0B 4D9LH 1NCDH 4YDVA 5IB5B 4YXHL 3DKQA 4ZS2A 4KK6C 1A78A 1CDBA 5DJ8A 4DGWC 3T3MB 2IWGA 3TVMC 1RZJC 5FPAA 1GR7A 1AMYA 1I7ZB 1HYRC 2HJLA 3GM8A 1S7WB 1B2WH 2XSKA 4CSPA 5C0AA 1PNDA 5E6RB 4TYSA 2QVKA 4OD1L 3AGWA 5BOZG 3UTTD 3WAKA 3H50A 3MV11 1JF1A 4GRWF 1F6LL 2HEVF 3TT1L 5FO8B 4QTFA 4Q4V1 4OLLA 5F8QC 3SDCB 4DQOL 1P84J 2Z6FA 1YNLL 4Q4EA 2M1KA 3QWQB 5F6HI 3WTYA 2CIKB 3QJHA 4HF5L 4L3EA 3DSNB 4NXSA 4OZ4A 3IXTB 1PJ9A 3TN93 1WCBB 3L7EA 1ZV2A 5T1MB 3L08A 4BHUA 1CFNA 3DROB 3C7GA 1ADWA 2W80C 1T0MB 1BK0A 1O59A 1XH3B 3WNLA 1OAJA 1KB3A 3TO4B 2FLRT 2GK0A 3WDIA 5I1DB 3D0AA 1FAIH 5FP7A 8FABB 2NY6C 2QSCH 2HJLB 1N3NA 1G7MB 2F1BA 2F19L 4QHMB 5CBAB 1O5UA 3B3QE 2D3JA 4HEPG 1OP5H 5IQ9B 3BN9C 4P2RB 4ONOA 1E9QB 3UG3A 4JGYA 2LTQB 4NNXA 1UACL 1RZGB 2EC9U 4OQ1A 1T03H 3IDJB 3WL9B 4HOOA 1IU1A 1K4DB 4BDVB 4EI6A 4W6WA 2C3HA 3AUVA 3ESPA 3C5ZB 4CW1A 1THCA 2QQMA 3BHBB 1OSGA 5DRZA 3IRZA 2L8AA 3US0A 2N7GA 4L5FE 2OZ4L 4H25A 4I0CC 2HWE2 4BM7A 3MU3A 1C16B 2DIJA 5DVPA 1ZZ7A 1E9PA 1KCRH 2X10A 5I28A 3UTSB 2QT6A 1N6VA 8FABA 2FEEL 4IV3C 4DF9A 3MBXH 4Z77B 4GSQA 3SEPA 5CCHE 3ZQ9A 3JQWA 4KWLA 3QYCA 5KS9F 4EAEA 3T77B 2O26U 4MDIA 4ZFOL 5H35A 1J1XL 2O93L 5CSBA 3A0KA 5EU7E 1K4DA 4NZFA 3KEHA 2WD0A 1WCSA 4XJZA 1A1NB 4JR9H 5E4OA 3R4DB 2WM0A 3C5ZA 4CW1B 3WTUA 4XZUG 2ZWKA 5JZGC 4JRFA 4ZI8A 4H25B 2O1QA 3KG5A 1RHI3 1RITA 4F20A 3TF7C 3NRFA 4IMKC 3ZDXE 5EEWA 2W1SA 3S57A 4ATEA 3DIDA 3BO8A 3CFKB 5D2AA 4QCIA 2X0VA 1EZVY 4DT2A 2AK4A 3V4UL 2WA4A 4FO9A 4FP2A 3ARGC 3RB7A 1JUHA 3SITA 4Z7WA 3T8VA 4QYOA 3TBDA 1JWUB 2GNTA 2XV6B 1KCVL 5T1JA 5C07B 3I6SA 3BP7A 5B38A 2PQQA 5IBUB 2N0KA 3QBTB 3RX8A 4FBFA 2OCFD 4ZDHA 3CZNA 1H9WA 4XR8C 4N9HA 4GJZA 3HZYA 3O9WC 2EDRA 4KVPA 4MQSB 4XXDB 4HKWA 2QTEA 4OHZA 4A7VA 3GMOA 4LRIC 3ZTJG 4OAWA 3OZ9L 4Q97A 5HHOE 2BSSB 3CFKA 3KL5A 3DV4B 3OC8A 1SLLA 2QZ3A 1NDGB 4B9IA 4QU2A 4XF4A 2Q2EB 1IC4L 4Z7QF 2WS93 1OHZA 5L2JB 4BFIB 2OMUA 3DK2A 5I73C 3H3ZA 4QYOB 4YHLH 1DJHA 1D9KA 3USSA 4BQ4A 4FI6A 2D0GA 3CVDA 5C9JB 4X6DA 5ANQA 3OAYH 2P42B 3KGTA 3MA7B 5DG2A 5F2WA 3EHBB 4RGND 3Q1EA 5DFVC 4N8PA 1JYXA 3RDJA 3DRQA 3MPCA 5D5MB 5FP3A 2FJHA 5I1LB 5FYVA 4M6NH 1JYVA 5KVEL 5HY9B 3C9NA 3HMXH 4NSKB 4PLJC 4RRPA 4DS0A 1F9KA 2MHFA 5DG1A 5B1JA 4WI6A 4YDIL 4ZS6D 4MGTA 1TLMA 4XJ9A 1GC1H 3BEWB 1D5ZA 2ZKXA 3RWFA 1ZIAA 3MLZL 5KSBB 1AR62 2ZTBA 5DMGD 2FCTA 3QUMA 1AXYA 3HCVA 1ZA6B 2ZKWA 4OLVH 1JBJA 1KZQA 4OD2A 4LXLA 1AZDA 5JOWA 4FL4C 5B39B 1JV5A 4O65A 5DJZB 4X4ME 1PD1A 5JAXA 3HS9A 1P84K 2DKMA 3CBNA 1R24B 3BAKA 4X6DB 3WXWL 1NEZB 3N9GH 1YJDL 2AERT 4N1CA 2BIIA 4PJHB 4JB9H 2EC8A 5DC9B 3UL4A 4RQPB 1GQGA 3DRQB 2Z3FA 1NJ9B 4NFCA 4N2MA 4U1LA 2KZBA 3OY8A 1CZTA 4U1GC 5F6LB 1IC5L 3C9NB 1SLAA 3GMLB 3WDYA 4MO3M 1JN2P 4K8RC 2AABL 4QAMB 5GJSH 3I6GA 4HQQL 5I8EB 5TK2A 3VTTA 3POWA 3OAYK 1HH9B 1QEWA 4JM2D 4KHTL 4XVOA 2MHAB 3PMEA 5EUKB 3NEEA 1DJIA 2Y0OA 1JGDB 2DQUL 1U4EA 1QRNA 3TEXA 3VJ6A 2VL5B 3BQUA 2XZQH 4N0FB 3GM0A 5E99L 1KYOK 4J12A 3MRMA 5HI3D 3GO1L 2OX5A 4D9LL 4IEQA 1EMTL 5FCSH 4INDA 1ROCA 5FXWA 1E4KC 2EXIA 4IEFB 2WXIA 5D8JH 5A7WB 1B90A 2VQ1A 1Z0HA 1SGKA 2E9WA 1PVC1 2TSAA 4UIMB 4KZDH 5I0TA 3VXMA 2VIRA 2DQGH 3H9HB 4DQOH 2VJXA 4ZYKB 3I6GB 3TCLA 4EZJA 3O5SA 3WF1A 4G9FD 4MWFB 2QFPA 4KUZL 1H8NA 3AABA 4MGZE 1IV8A 3BDBA 5B4NA 1SOKA 4N4YB 5AWNH 3O1SA 2VDMH 4PJ7F 2ARJB 2X87A 1O9VA 4DY3A 4KJYA 3PJYA 4LOUD 3UZQA 3VJ6B 3DHJA 2A0LD 2J8UA 5IF0B 2BCMA 1R64A 4K55A 3LV3B 1XC6A 5LAXB 3TV3L 1INQA 3NTCH 3ARBD 5HYJB 4AXWB 1ANUA 2J1AA 5C7XH 3U0PB 3E2HC 4JTOA 2P80A 4E9RA 4B5ZA 1CDJA 3ZHKA 3HAEH 3NZ8A 4HT1T 1XF3B 3CUPB 5K0UC 2JTYA 4IOSA 3BVTA 4NI6A 1R6VA 1AR81 4PB9L 3AXLA 2D98A 3VXRA 3QDHA 4PJXB 2EVIA 5J13C 4QU1A 4FFZL 1AR82 2MQGA 1ONQA 4XXPA 1FVDB 3GDBA 3QFJB 3EOAA 2Q86A 4AYFB 3SJVE 5J4MA 3VBOA 1AZVA 4XPGH 2ARJA 5E2UL 2ISDA 1USZA 5LEJA 4PCRA 3U6XS 4N2BA 1GYWA 1JNLL 5AEAA 1SEBB 1XZ0B 3HN3A 2FT6A 5DYOA 1XJAA 1MQTC 1Q0EA 4OBRA 5DUBA 1NICA 4KH2A 5DTFA 3T2LA 2Y1AA 4U1NA 3FOMB 1QBBA 5DQDH 2I2SA 3NIGB 4KX8A 1OIOA 3BVUA 5G4OA 2XBDA 4I4WB 4A6YH 5DZGA 1W0YT 3C7HA 3VXRD 4RZCB 1LO0L 1WFNA 1VADA 3ZYOA 3EF7A 5TE7H 1WFIA 3QIBC 3GQFA 4PJXA 2IIJA 3FQUA 4ZUWB 3KLHD 3SDYH 3ACHA 4KI5D 1CDCA 4CXXA 1P8JA 3AYEA 3EJJX 1MRDL 4Q1RA 2H3KA 4PJDB 2PW2A 4M7ZC 3RIAK 1MELA 4FZEH 3G5XA 4IIQC 4KI5C 4RN5A 2VLMD 5EO0A 1XE8A 3SDDB 1NOAA 5GZNA 1FXZA 1TU2B 2Q8AL 4UBGA 1PX4A 2ZSWB 3Q9QA 4OTXL 5BMFL 3ZFFA 3D5OF 4X8CA 1GY2A 1MVUB 5BS0B 4A04A 2DFBA 1CYGA 2XQBH 1L0PA 3MICA 2A6ZA 4Y89A 4XE9A 5HGHA 1UJTA 2P26A 4PRBB 3UTPD 2CBPA 3CPLA 4YIQB 4ADGA 1ZPLA 3VGDA 3MUGB 4RHV3 5LK5A 1I7TA 1A7QH 2B3IA 5EYXA 5A6YA 5KTEH 4OI9A 3KD4A 4N8UA 4WRLA 3WJJC 2GMPA 3FUDA 2XUWA 2JB4A 1AX0A 1Q0YL 3BWAB 4GSXA 5DVMA 5JDSB 1XAKA 3DUUB 3CZJA 4PRHA 1P1VA 1RZIA 5I6OA 2XJRA 3JZ7A 4Q4X3 3NSCA 1HN0A 2G2RB 4J1UA 4NS0A 4WUKL 4U1SA 1A2YA 1FGNH 1M6OA 3W56A 2FMDA 5CBLA 2HN7B 4IGBB 5DEFA 1YIPA 4X7FC 3ALQA 5J9PA 3BIWE 4PJHF 1JGUL 1S5IH 2WQVA 3KV5A 2CO7B 3QIWB 1ID5I 4GIQA 1MHHB 5CGYD 2QADB 4WAFA 4YIQA 1N8ZB 4FULA 5EBMA 4E8CA 3LPWA 1EDYA 4JQVC 4QHUA 5A2JH 5IOPA 1RUE2 1EO8H 3GYDA 3SKNA 3NCYP 4FXGB 1MNUL 5JW5A 2BRQA 3LRGA 5DJ2A 5A6IA 1JHNA 4RIRA 2PYTA 1FLTX 3DJZA 1MHCA 3SGEH 4KDTA 5KBDA 5FPUA 1TME1 4JJ5A 1N18A 1P2CA 2YAEA 1G1OA 4I0PB 4XP4H 5D55A 2WSVA 3BI3A 3DMMD 5GGTL 2QL1A 4GO9A 5LK7B 3WEZA 2J2ZB 2IDTA 4N2AA 4H26A 1WBZA 2BHUA 2EXTA 2VR3A 2X9WA 3N42F 3ZKSD 1U3HC 4LOEA 3BZ5A 4LVOC 5T5FA 3E6BA 4WU7B 3SE8L 5AG8A 3I9PA 2APXA 1FAYA 5FZOB 5JHDE 3ZSEA 2IDFA 3TFKC 1FO0H 3TOPA 4HWBA 1VBA2 1G7IA 1WHOA 1OAKH 3LPGA 3VXSD 3CH1A 1VRH3 2P47B 4NZDA 4N2GA 2WZR1 4AEKA 1NIAA 3VFSA 1CWVA 3PIGA 1YCIA 1MVQA 2HRPH 4XJAA 1AIZA 1O9WA 2X0UA 1Z5LB 1FFRA 2CRYA 4LIVA 4Y1AE 1NY71 4QD2A 2BWCA 4G42B 4IHOA 4MB4A 3X3FH 3ACIA 3D50A 4NO5B 4WJ5A 5CJQL 1IGYB 4UV4L 4Y4KA 3WY2A 3EXUA 2WO3B 4DTGL 5CCGE 1KYDA 3WG7B 2VMGA 2XTJC 4Y5XC 3C8XA 4LPLA 3NSFA 2N59A 4F8QA 3NAPC 5GS2D 4XPBH 1E4WL 2EINB 1E5IA 2DYPD 3AC0A 4BGLA 1O6UA 2I24N 2FVNA 3AQDA 4IRZL 3UJJL 1NMAH 1OSPH 4HSAC 4DP4X 4KNUA 4ZMZA 4U1JB 4AEDC 1Z2KA<