1OPOA

The structure of carnation mottle virus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
267
structure length
267
Chain Sequence
b'SMTMSKTELLSTVKGTTGVIPSFEDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQPLQWVVYRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title The atomic structure of Carnation Mottle Virus capsid protein
pubmed doi rcsb
molecule tags Virus
total genus 52
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
A PF08462 Carmo_coat_C Carmovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1780 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1opoA02
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opoA01
1ND2B 5AC91 2HWE1 5J98B 1RUH2 2X5IC 5C4WA 1AYM3 2XBO3 2XBO1 1POV0 3DPRC 5JZGC 1D4M3 3VBUA 4FTBA 3VDDC 1AR61 3JB4C 1AR71 1PIV3 1AUYA 1W39A 1OOPC 2BFUS 1M06G 4Q4W3 4N43A 4Q4X1 4CEYC 1ND2A 1RUE2 1RUC3 2X5IB 1RUJ2 1R081 1RB8G 1EAH1 2XPJA 1TME1 3VBSC 1AYM2 2XBO2 3VBHC 1RHI3 4IV1B 1D4M2 2HWD3 4CDWB 1NA1C 1BBT1 4Q4V1 1COV3 1AR62 1AR72 2RS51 1PIV2 2X5IA 4Q4W2 1C8M3 1EV11 3IDEA 2RR13 4Q4X2 4PDWB 1F2NA 1R082 1Z7S1 1RUF1 3JD71 4IV1A 1V9U3 1TME2 4CDWA 1FPN1 2HWB3 1B35B 4YVSC 4GH4C 1NCQB 5CFCC 1RHI2 2HWD2 3FBMA 5DDJ1 4NWWA 1COV2 3JBG3 2GH8A 2ZTNA 4PDWA 4AEDB 1CD3G 4CEWC 1FMD1 1C8M2 2RMU1 4CDUC 2RR12 2RM23 1AL0G 1B35A 1PVC1 3JD72 5C8CB 1DDLA 4YVWB 5FMOS 1PGW2 1AR91 1POV1 1HRI3 4BCUA 1QJX1 1PGL2 1R1A3 1ASJ1 2GSYA 5DDJ2 4AEDA 5C4WC 4NWVA 1ZBE1 1QJU3 3JBG2 1HXS1 1VBB3 3VBUC 2BBVA 1QJY1 5CFCA 5C8CA 2RMU2 2RS13 4YVWA 2R061 1RUH1 2ZAHA 1HRV1 3VBFB 3CJIB 5BNPB 1ND2C 2FZ1A 1HRI2 1HX6A 1R1A2 4IV3B 4CDXC 2WFF3 1QJU2 1HXS2 1RUE1 1RUJ1 4RS5B 1OHFA 1VBB2 1QJY2 2WLPA 1RUI3 3CJIA 2MEV3 2RS12 5BNPA 1HRV2 5C9AC 1AYM1 1RUD3 1D4M1 1NY71 1CJDA 2TBVA 3ZFFB 4CDXB 4IV3A 1RUG3 1PIV1 4IV1C 1AL23 1MQTB 4CDWC 4RS5A 3ZXAC 4Q4W1 5GKAC 4QPGC 2QQPA 2HWF3 1RUC1 4JGZC 5C9AB 1NCRB 4WM8B 1RUI2 1PO23 1VB2A 2MEV2 4PDWC 3ZFFA 4CDXA 1RUD2 1RHI1 1VBC3 1VBE3 1NY72 1MQTA 2HWD1 1B35C 3TN93 4QPGB 1COV1 1RUG2 1NCQC 1TMF3 4JGZB 5C9AA 5BNNB 1AL22 4FTSA 1ND3B 1C8M1 1NCRA 4WM8A 4GMP0 1K5MB 2RR11 4SBVA 2HWF2 1RUC2 4GB33 5K0UC 4AEDC 1F8VA 1V9U1 1PGW1 1PO22 2VQ0A 3LOBA 2HWB1 4QPGA 1ZBA3 5C8CC 1SMVA 1X33A 4LLFA 1RVF3 4JGZA 1VBC2 1VBE2 4YVWC 5BNNA 1PGL1 1ND3A 1K5MA 3TN92 3JBG1 1C8NA 1VBA3 5ACA3 1TMF2 5K0UB 1VBD3 2BFUL 2RM21 1MEC3 5ABJB 2WWSA 4GB32 1NCQA 1V9U2 2HWB2 1NG0A 1HRI1 3VBFC 1BEV3 3CJIC 1RVF2 2WZR3 5K0UA 5BNPC 1AYN3 1AR83 1R1A1 1H8TB 1BMV1 1VRH3 1QJU1 1VBA2 3JB8A 5ACA2 4Y5Z0 5ABJA 1VBB1 4IV3C 4CDQB 1VBD2 2RS11 5BNOC 2RM22 2BPA2 1MEC2 2HWC3 4RS5C 4RFT0 1VAKA 1FOD3 3J8F3 3VBRB 1PO13 1IHMA 1RMU3 3NAPB 1H8TA 4Q4Y3 1BEV2 2R073 2WZR2 1R093 4JGYB 3ZFFC 4CDQA 1BMV2 2WFF1 5BNOB 4RR3B 1VRH2 3ZFEB 1QJZA 1MQTC 5L7OB 2R043 4GMP3 4EJRA 1RUI1 3VBFA 5LK7B 3VBRA 2MEV1 1QQP3 4WM7C 3NAPA 2HWC2 1RUD1 1FOD2 2RS33 4RQPB 1NCRC 4WM8C 1PO12 4JGYA 4N53B 1RMU2 1RUG1 5BNOA 4RR3A 5FMOL 4Q4Y2 3ZFEA 5CFDB 2Y26A 5L7OA 1AL21 2PLV3 4RHV3 5D8AB 2WS93 2WFF2 2HWF1 4WM7B 5AC93 2HWE3 5BNNC 1X36A 4RQPA 2R042 1ND3C 1K5MC 2DF7A 1PO21 1OPOA 1QQP2 4N53A 1AR63 1AR73 2RS32 3HAGA 5CFDA 3VBOB 1VBC1 1VBE1 5D8AA 3TN91 4Q4X3 1NOVA 5A32B 1TMF1 4WM7A 1R083 2PLV2 4RHV2 3DPRB 2WS92 5JZGB 1EAH3 1TME3 3ZFGC 5AC92 2HWE2 3VDDB 4GB31 1VB4A 3VBOA 1OOPB 1BBT3 5ABJC 4Q4V3 2IZWA 1ZBA1 2RS53 4CEYB 5A32A 5A33B 1RVF1 1EV13 2FZ2A 3DPRA 5JZGA 1VBA1 3VBSB 5ACA1 3ZFGB 3VDDA 3M8LA 1Z7S3 3VBHB 1H8TC 1RUF3 1VBD1 3JD73 1OOPA 1EAH2 1MEC1 1A6CA 1FPN3 1NA1B 5J96B 4CEYA 4CDQC 5A33A 4FSJA 5DDJ3 1BBT2 4Q4V2 1ZBA2 2RS52 3VBSA 3ZFGA 1BEV1 3VBRC 2WZR1 1AYN1 1AR81 3NAPC 3VBHA 1FMD3 1EV12 4QPIC 2RMU3 1VRH1 1NA1A 4JGYC 4YVSB 4GH4B 1Z7S2 1PVC3 1RUF2 5CFCB 4RR3C 3ZFEC 5L7OC 1FPN2 1AR93 2HWC1 1POV3 1FOD1 4FTEA 1QJX3 3J8F1 1WCDJ 1PO11 1ASJ3 2ZZQA 1RMU1 4CEWB 4QPIB 1ZBE3 4RQPC 4CDUB 4Q4Y1 1HXS3 1E57A 1AYN2 1QJY3 1R091 1AR82 2R071 4GH4A 4N53C 4YVSA 1FMD2 2R063 3S6PA 5CFDC 1RUH3 1HRV3 2R041 4GMP1 5D8AC 4Z92B 1PVC2 4N43C 1QQP1 5C4WB 4CEWA 1AR92 4QPIA 4CDUA 2RS31 2BUKA 1QJX2 3J8F2 3VBUB 1HQNA 1ASJ2 1GFF2 5FOJB 1ZBE2 3VBOC 1RUE3 1RUJ3 2R072 1R092 2PLV1 4RHV1 4Y4YA 2WS91 4N43B 2R062
chains in the Genus database with same CATH superfamily
4Y2NA 4Y4HB 1DUYA 1KGYA 1IAKB 3LQCA 5CWSB 5E4EC 1Q90A 1LHNA 1L7QA 1POV0 2Q8OA 3U6XS 1SXBA 1TJHL 3BDXA 4Y1TA 5F71A 5C97A 5A1FA 2W9DH 4LHUG 2DDQL 4WGKA 1CD0A 1X5MA 4D9RE 3K2OA 1BZ7A 4OZHB 3LKSB 3NA4A 4JRXD 1PIV3 5JMRA 4X8GA 4F7PA 1MQKL 4QHMB 1U12A 4HIHB 4U1GC 4XZUB 2SEBB 1VZIA 3KLAA 2X4SA 2ZSWB 4R5VA 3T04D 2YJQA 4JVWA 4LASH 1M9WA 3WIIH 1FFOA 2GFBB 2IBZX 3I9PA 3Q0HA 5DUBB 5LWYH 1UFUA 3D8CA 3APFA 3GJBA 1CFSB 1JUFB 2KUTA 3LH8A 2AJVH 4NZDA 4PTUA 1JWUB 5EIYB 3Q5OA 3BKYH 4JHAL 5L2KD 1N64L 4UAOC 1N6QL 1KELH 1E2VA 3SBQA 2JG9C 1QP1A 3AK0A 1HWWA 2P8PA 1UZ6E 3ZDWA 1AYM2 3RP1A 4PGBB 4BRJA 2WCSA 2BW5A 4EIZC 4AQ8A 4PM1A 4IV1B 3TV3H 2P1BA 4DRRA 3PXLA 2MOVA 4XNMA 1CDIA 1I8LA 5DJ6A 5F1IB 3VWJB 3VXPA 4ZNEA 1P6AB 1W91A 4MQ7A 1BZDA 3NCYP 4RVBA 4O2CB 4NO4A 3AYAA 3ZQWA 2ICEA 5DJAB 1DQML 5C09B 4L8DB 5AAMA 4PHZA 3KV4A 2YBSA 4NHMA 3FB6B 1UOLA 3GI8H 4I09A 3H9HA 3QLQA 4HOMA 3J9SA 4Y5SA 5H8DA 1HJCA 4KITB 2ZEYA 2YSSA 3FU8A 3NN8B 4F57L 4JK0D 2J22A 4H5SB 3L3OB 3PQYB 1ZK5A 3CTTA 3HI1A 1JUIA 5FLVA 1VAMA 4L8BA 1I4FA 2H32H 2XNAB 5ESAA 2R1WB 2OYPA 3RZCB 3CFMA 5F9OL 5BCAA 3MRNA 5BS0B 1YMME 4WK4B 1P4IH 43CAB 2AEPH 4MDJB 1RK0A 5LRRA 1HU8A 1BV8A 1KDJA 2XQBH 4QOKA 1QWUA 3CN2A 3MU3A 4HIIB 3UEZA 4GRWF 4DEUA 4F92B 3O1RA 1ZDQA 2R2EA 4GP8B 1BQHB 2F54B 2JK5B 4WEBH 2F7QA 4NI6A 3U79A 5GS2H 1SVBA 3DBXA 5MEOA 1MHPL 2QQLL 5ENWB 4QRPA 1A8MA 4K3UA 1HFUA 1E5RA 5T5LA 1IVLA 1BGXH 3AC0A 1BOGB 3I6KB 3MRGB 2F9BT 4PV1C 3IT8A 2WP3O 4P4KD 1X6LA 2Z7ZA 3MXVH 3WO3B 3FOMB 2DS4A 2IQAA 3Q5YA 4XQDA 4ZFGH 1IVTA 1V7MH 3L45A 1LHUA 1WCSA 4EQ2A 5EBMB 1ASOA 2O5ZH 4YHYB 1WS7A 4BQ8A 4GS7C 15C8L 1GZQA 4DGUA 1Y07A 2G60H 4Q14A 3FN3A 4INDA 4TUKL 5D9SB 3FJTA 3MX0A 4R7XA 5LEJA 3EO6A 3DIFB 4P59H 4QRAA 3VBUC 5IQ9B 2OZJA 1ES0A 2FQGA 1AGDB 5F9JA 1IGIL 1XB6A 3CFBB 4XB8A 1VAVA 3L3KB 2WZPP 4X83A 1RUH1 1AR1B 1UZYA 2WA3A 5JI7A 5LBCA 1UM6L 3T3MB 2KZKA 1DLFL 2J1EA 3HPLB 1TZOA 5HGGS 1FT9A 3FT4B 3O3BB 4KQ4L 1IKOP 4X4ZA 5D7LD 4A2FA 1I1AA 4V33A 1LB2A 2E7AA 2O5YL 4XVOA 4PRBB 3TA3C 2X28A 3WTYA 3U36A 1HB4A 3EO0A 1RUQH 3TRSB 1HX6A 4AFDA 3QIUC 3EH3B 1RZ8B 5IOPB 4HUUB 4WI0A 3VKFC 3QUHA 4N68A 5KJ7E 3O6KL 4MA1B 4H55A 1W2KT 3BQUD 2NR6C 3BPOC 4YHLL 4JHUA 4PN6A 1N7MH 4HP5A 1GA2A 4HL0A 4M01A 2YPJA 3HG2A 2K46A 3N9GH 4YBHA 2BDNH 5B1BB 5A2KH 5M7QA 2VLMD 1UM4H 1TJIH 1U41A 3HE6B 3MRPA 3LDRA 3O4LA 3RIAF 2JDUA 2NLRA 3OCPA 4ABVA 4QRSA 1WGPA 4H14A 5I1EH 1MW3A 2WKKA 4OLYH 4G5ZL 1IT9H 1F00I 3WV0A 3ZFFB 1G9NH 4B60A 3WXWH 1L7RA 3EBHA 1BFOA 3D12B 3QJFB 3DGDA 3UCQA 2ZBJA 3EH1A 5TDNB 2ZD0A 5ABZA 1TIUA 3UK9A 2XRAH 3KDMA 2R0LH 2X3CA 5EU5B 5FK9B 3VFTA 4JFOA 2OJ1A 3EG9B 1I7RB 1AKPA 2XKSA 1LK3L 1UGKA 3WLUA 4KKZA 3KR3H 4WW1B 2GK0A 1ZM1A 3L48A 3NAAH 1RUI2 2YZ4A 2FYYB 4WEMB 4NJ4A 1KYAA 2P3IA 4I01A 4DXRA 4GAYA 4X7EC 1D5IL 4OB5L 4Q1RA 5DUWA 1A7QH 1C57A 3BPNC 1ZHKA 2D0GA 1UD8A 3LXUX 2NUTB 4LSQH 2HPOA 1MI5E 1JF1A 5F1RA 1U95A 4R84A 1NFDE 3GFUA 1V3JA 2GJJA 5CKMA 1GUIA 3INOA 4FQ4A 4LHUD 1JF5A 3BCDA 5C0JA 5AB0A 1HB3A 1IQDB 4U2YA 3OBTA 1L3NA 3DX4A 5DD1H 4TOYL 5IVBA 1W6PB 5DJXA 4E2SA 4F9PA 1AQDB 1KG0A 2FB4L 4H26B 1DSWA 2FR4B 4NN6B 3S36L 5D1QD 3IMSA 2VMGA 1BW8A 4LOTA 3WAKA 2MQCA 3WMQA 4BQXA 2EYRA 4R4NC 4WCYH 3REWA 1ANUA 4O2FA 4TN7A 4LLUB 1ETJA 1FZKA 2P5EE 2UY6A 3HZKA 4MLIA 4PJGB 4GA9A 3BZ5A 3QEHA 2M8XA 3B01A 1TG8A 1XXNA 4QPGA 3RJQB 3DF0A 3OGCB 5E1RA 3FC0A 4P08A 5KZCB 4LO5B 3MFFA 4TSBL 5FZDA 4OD2B 1D6EB 1ND3A 2D40A 2XYBA 5DEJA 3RDTB 2AS5M 4IGBA 2AI0L 3C7HA 4S1DD 5TFSH 5EU6D 2DQFA 2QKDA 1HH9A 3W0WD 1B90A 4I1NB 3TYJA 4NO0A 3CZFB 5EOTA 2Z31B 1JH5A 4G6MH 4UYQA 3WD5L 4BD4A 3FFCA 4F7EA 1KBBA 3BP5A 3U4EA 3VD2A 4N90E 1QLFB 4XNUL 4BQ1A 3PUUA 5GM0A 5I71B 4URTB 1TENA 5IG7A 5GZDA 4KBBA 5GZEA 1S7WA 3LVTA 2VXJA 1I7TB 3WNKA 1S5HA 4NO3B 4E5XA 2R2HA 3GSNB 3OYWA 5BNPC 1AR83 3MICA 3MUJA 1QSEE 1MW2A 4MGXA 3QXDA 1PZ7A 5HDWA 2WNVA 4Y1ZA 3EAKA 3T6VA 3ZL4L 4XPFL 5IHUL 4XETA 3AROA 4GKOA 5IQ7H 5ACA2 1UY2A 1R3IH 4PJAF 4D6SA 4MZ3A 1F41A 1CFVH 4LNRB 1YAZA 1ITCA 5B1KA 2KYIA 3DPBB 3QCUL 2WXOA 5EORH 5ACMA 2GAUA 4MNQD 4DPAX 1P9MA 4DQAA 4BIFA 3QFJD 1X7QB 1HAWA 3OAUL 1UACL 2R1BA 1XR9B 1DVFA 2HTKC 3HEIA 4FULA 2EDKA 3J8F3 1Q8MA 3THML 3ZHDA 5A3WA 3RVWD 2AACA 2CNZA 4NM8H 4UFKA 2GH2A 2CAVA 3H9SB 4K9EC 1TEGA 3UT0A 4ALAH 3GBWA 5EH1A 5FECB 3KJ4C 4IU3B 2J72A 3WG2A 1BEV2 3G5YB 2TSAA 4LKXB 3PF2A 3C9NB 1VEMA 4Y2OB 1NICA 1GH7A 3MO1A 4NYLB 4UQAA 3CDFA 5GGSB 4Y1AD 1SBDA 5DFWH 4POZC 3BH9B 4XPHH 4Q0QA 3H8XA 4P5SA 4ZAKA 1J0KA 3PG2A 4AKOA 2VQ4A 1CICC 2PW1B 3GHBL 1JCVA 4LEXH 3CGTA 5E2WH 2MFNA 4NNXB 4Q56A 1RUPL 5DFVC 5HYQA 2X0WA 5LWBA 5HDOA 3QUKB 4O7XA 1CAVA 1RMU2 3RNSA 1KPVA 3LHAA 2BYVE 5FYBA 3HQXA 1XXFC 2VDKB 3QR0A 3KBFA 1N70A 4LOVA 3K74B 4P5TB 2XN9B 4Y19B 2HMID 2J44A 2YGNA 4JRXE 4NX0A 3QJHB 3F7YA 3B2UD 2A3YA 1GHFH 4LBJA 3WHTA 4BSWA 2RHPA 2VL5B 4F1SA 1HINL 4P2OA 4RDBA 1V6JA 1WFUA 3MLYH 4Y2DD 4EWEA 1KCRL 2IDCA 2ZOKA 1SVCP 1RV6X 5FS5A 3RFZC 2CO7B 1MS4A 1VMJA 1YY8A 5HYSA 1MCFA 1ZY9A 1XR8A 1JGEB 2VDOB 4QM8A 3GJFK 2OYZA 3KPMA 3WYRA 5JW4R 3OAWA 4GWMA 3S96A 2R32A 4XC1L 4N53A 2VM3A 5E6ID 4FLHA 1WMDA 5L2KE 4E27A 4UOW0 3N7JA 2O5XH 5B1JA 2ETEA 3OPUA 3AMLA 4P99A 2OTWA 2KC0A 4X4XA 3MPBA 3N36A 1SY6H 1MIEL 4JPVL 3JXSA 3RWJA 1WZAA 3DI3B 5HGAA 3U7WH 1SDWA 2J1UA 3P69A 3NCWA 3O0XA 3WOGA 4R3SB 1QASA 2F6AA 4ADIA 1X5YA 2Y72A 1XE8A 1OGSA 3PGFH 1M7XA 2LFGA 3AP6A 5DJ2B 3T0AA 3WELA 3W5NA 2LS6A 4ONHA 1Q3EA 1EXUB 2NY3D 4PD4J 4X7DC 1OARL 4Y8DC 2BU9A 4Q29A 4LLQB 4Z7UF 3N50A 5C6TL 1ZA6A 3SPJA 5JDBA 5C0BD 1N6UA 1UT2A 3X1BA 4D3WA 4FG2A 3TVMB 4KY1H 4FQJL 3OUIA 3CFDA 1WWBX 2QJDA 4IGPA 2HUEA 3B8YA 3ULUF 4A68A 4F2MA 2FZ2A 4WUUD 4B29A 2DQDH 2XG4A 3P3TA 2JDZA 1ILUA 2OVUA 1EXHA 5SWSA 2QR0B 4KGJA 5FA3B 4Q6IB 4BSVB 3L5XL 1VBD1 3S2AA 4GO8A 1KGXA 3LZOA 2K2SA 1S9VB 3U4SA 1E9PA 4ZDHB 3WTWA 3BHBA 3GM0A 1IBYA 3LEYL 3BZEB 2XX0A 1NQBA 1HXMA 5HGDB 5KYUA 3RIFF 1KUMA 3LIUA 4CDQC 2TNFA 3UG5A 1WD9A 5BJTA 4J1XA 1NM9A 1BX2A 1AFVL 2ZUWA 3VCLB 4XMZA 1KTLA 4XN7A 3TBDA 4Z8FL 3SGJC 1ZBA2 3NV2A 2DEWX 2Z0BA 3ATBA 3MA7B 1K5NA 5F7FA 1NUDA 2UX7A 4AFCA 2PTTB 4KNTA 5E8EA 4GQPH 1AYN1 5CJ8A 4N0CC 3G5WA 3MV8B 4DESA 4BELD 1QSFE 4C57C 4U7SA 4WO4C 3KGSA 4GUCA 3T8XA 1SACA 2VLJB 3D1MC 1X5JA 2EYSB 2KT6A 3QORA 4NSKB 5JPNA 1H3PL 2FX9H 2B2XL 3L5HA 3D3VD 1LYQA 3HNVH 3NNMA 5DQ9B 2JB6B 3EH2A 2BGCA 1P5UA 1TZIB 3PHSA 3S3SA 1FPN2 4A7UA 1OVPA 2F2HA 3IMRA 1RAMA 3FO0H 3MGOB 4QX5A 5B39G 3RZGA 2NNAA 1A14L 5FUCC 3N9QA 3LN9A 1A34A 5EEYA 4U3HA 2PETA 2F53D 2X1XR 5D7LE 5H2BB 4OHWA 4RH4A 5FHAH 5FGCB 5GRUL 3GBDA 1AD0B 3HCVB 4HSCX 3FC8A 5AALA 3QUXD 5EBLB 1GXEA 4LBOA 1PPIA 2Q3ZA 2WGXA 2HFFB 4U3CA 4IIZA 3MF9A 1TYRA 2NY1D 4FNLL 4ZUUB 3B8SA 3UTSD 4MAYB 2K0GA 3NZ8A 2WCGA 1I8MA 3L1FA 4U1HB 2CHNA 1MFNA 1T1XB 3CCHB 3UTOA 1RURL 1AOZA 1OE3A 3S7IA 1QRNA 1AR92 1HWHB 1TNMA 2VLME 3UL2A 1U8MA 1J1OH 3OZKA 1PJ9A 4FHJA 4U3XA 2FDBP 1JHTA 4WJ5A 1SQ2N 5E5RB 4H4NA 4OM1L 5F1KC 2WABA 4MQTB 4BE5A 2ARAA 1NCNA 3ETSA 4IESA 5FJKA 4NXKA 1K8IA 4MGTA 1T7XA 1RIUL 4N8VG 5EF3A 5F3IA 4CUBA 4L0PB 4NZFA 2NYKA 4XVSL 3N9NA 5GLTA 3EJTA 5F9DC 3FUOA 5AC91 2HWE1 1QXRA 3SGKC 2ZAIA 5FW6A 2R2BA 2J1TA 3BMVA 4WHTB 5J13B 1B0GB 1IG0A 1J9TA 1TITA 1U8OA 1OPGH 3O8XD 1ND0B 1OSPL 4PWHA 4QD2E 4TSAH 1A64A 4ZD3H 5K9YA 3EIFA 1Z9PA 1G7HB 1BQKA 3DJSA 2GNTA 2WT1A 4P2QA 4PRPD 2BFUS 1HQ4B 2Z7UA 3KYMB 1A2YA 3VI3A 4JM2C 3WSOA 2FIKA 1IAOB 4BJLA 4N43A 4BFJA 3ARDD 3PWUA 3S37H 3IZOA 1D5ZA 1W0PA 2LW8A 3MLRH 2YLHA 3DSNB 3PABB 5IREA 2W08A 2CL2A 3S35L 3MCLL 5BZDA 4P23D 4J3BA 1Z32X 2Z64C 4LU5H 4J6GA 4YO0A 4JY4A 3KM2A 3TBSB 3GXMA 5K9KA 4NQDD 5C3OA 5D7SL 1FGNH 3J7NA 3QHFH 5D1QE 4C4UA 1BPVA 1FVDB 3ELAT 2HJFA 4QRTB 4LK7A 1E6JL 3ES6A 5HYEA 2JDMA 3BKJL 3UG4A 2YRLA 3O6FB 3VU1A 2FHFA 4YMPA 2AK4D 1UOBA 3ZN5A 2IV9A 1PKQB 2WZ5A 5CVRA 2VXQL 1JXDA 1LM8V 2X70A 2ZPKL 2VLRD 4GKLA 2XA8H 4L3CA 2X5IA 3OBRA 4EZHA 2BVOB 4YZ2A 1PL3A 4XMVA 2IQ9L 1U58B 4Q4X2 1T20B 4K3DH 1KJVA 4AVIA 3SCHA 4U2AA 4ZMQA 1OE1A 4LRIC 4ERSL 5CU1A 3NKGA 1A4JA 4AEIH 2C5DC 1AGCA 4N2IA 4C1XA 3CSGA 3MJ7B 3UPRA 5EU6E 5CIPB 2C9QA 2IF7A 4L4JA 2KL6A 5FGSA 1XNKA 5I28A 5FREA 3VFMA 1NCAH 5B3JE 1SEFA 3H8UA 3HE7A 5T1KD 4R6UA 1SOQA 5KSBB 2CIIA 2JKTM 4HGKC 1IRAY 1DJYA 2I5YH 5FXCH 4NC2B 3IXAB 1D2PA 1PIFA 1ZYBA 2NT0A 2AJXH 2DF3A 4X4MA 4AC2A 1LDPH 3SGEH 2O72A 2LABA 4HISA 4PJ5B 4UQ3B 1H15B 2NY0C 4X80H 3GIVB 4JKKA 1ZBE1 2I85A 4RA3A 1DO5A 3LKQB 2AGSA 3NIDF 3FBQA 4YR6B 4EZMA 1MY5A 5GGRA 2R0KH 5DVPA 3PVEA 1T5WA 3D39D 3I2CL 3QO1B 3AS0A 4ATWA 4N0FB 2VTXJ 1DDLA 2RG4A 1R3JB 2ZKYA 3BE1H 2FT6A 3LPOA 2ZX0A 1ULPA 4X6BB 1H9VA 4MNQE 5TE4H 4TTDD 1SY6A 3TAYA 2JDNA 3QFJE 2QSTA 3VWKA 4LO6B 2QUOA 2BXYA 4OQTH 2ZYHA 1ASJ1 3HKZA 3QK0A 2PWDA 4I8DA 3GZOA 3U82B 4A7VA 3OG2A 1WQVT 3B7UX 3HBPA 4RESB 5DEFB 2VXSL 5GS0L 4XN1A 2DLEA 2XBTA 2BZCA 4DN4H 4GKNB 4QF1A 2XWZA 2YD9A 4XUQA 1I9RL 4J7RA 3UJJL 1PW3A 3MZHA 5I1HH 3R0RA 4KWKA 1SQ4A 1SNRA 1KB5B 2PPCA 4KO5A 4M7KH 5ETUB 4Y1AE 1H2KA 1HRV1 1A6ZA 3T5WA 1UZWA 4X6CA 1J8HD 4KROD 4DIQA 1JDDA 4F5CE 3EXUA 4F91B 1BHGA 5G04L 2QGCA 3AXHA 1JDCA 5DCCA 3SQOH 4WNSA 2DQJH 2FCBA 4HF5H 1IC7L 1MDTA 3DHMA 1HRI2 1EHNA 3OBAA 2IBZY 4A39A 1E4WL 4IK6A 5KSAB 3NRPA 3PFUA 2PQQA 1C5DB 3VO0A 1MFBL 3MGUA 4CDXC 4RIRB 4QTHB 2JXAA 1TZHA 2XXCB 2DOCA 5FK7A 4JO3L 5F7NC 4M48L 4RS5B 2GVYA 4ELKA 5LDUA 4GH7B 3MKGA 1WZ1L 2PWGA 4KGGA 4PBPA 3QXWA 3OGVA 2PR9A 4HT1H 4ARXA 2H4EA 1WSST 2RVAA 3CFTA 3IAPA 4G43B 5LBSL 1GZCA 3DV8A 4F7TA 2LU4A 4WENB 5DMKA 5I9QB 4D0QA 1L0QA 5D7IB 2DQMA 5HGBA 2F58L 1QACA 6FABH 1NCGA 2BMKA 1CE6B 2OJEB 3AQXA 3GMNB 1HKLH 4X8JA 4M43L 3SYCA 1XZ0B 3QAZC 5C9KA 5IW1A 1AL23 2UYLB 1O9VA 4XNYH 4XPGL 4PJEB 2IAND 2P8LB 2C4XA 3ZXAC 5F9WB 3CPLA 3FQRB 1KEGL 4ZMWA 1CF1A 3V52L 5IMMA 1FAIH 4RMQA 1DYZA 2K6WA 3WY3A 3O81A 3GNML 2FJUB 5SWZD 3BW9B 5DAQA 2NZIA 3O3AA 3RVVC 2VTXA 1S9XB 4PJ7A 1GS7A 5FYHA 1BBJA 4NAJA 4ZTPH 3C2AL 3FBKA 4IGQA 1ED3B 3WNNA 1RUD2 1NCIA 5INDA 2AEIT 3VG0H 1S7TB 2HWD1 2XV2A 1DN2A 4YDNA 2VZOA 1Q1PA 1U0QA 4M1CD 3UZEA 2CXGA 1DZTA 2ZGTA 4N22A 1AZZC 2E47A 3I85A 3WNPA 3IETB 2PAEA 1DQIA 3BSZH 3GSNH 3MBEA 4LLAA 4QJ3B 1FDLL 3B9KA 3INUL 4HD5A 5T1JA 3CHPA 1WLWA 2B45X 4JGZB 1VLXA 2AV1B 3W2DH 4FAHA 2GNMA 4Q26A 5A6YA 1I1YA 5HDBE 4LARL 4AENB 3EO9H 5KSUA 5I1JH 1VGEL 4WUUE 5D6DC 4GB33 5B4NA 1Y6MR 4WU7A 3ZDYB 2ZHMA 1KPUA 1XQ4A 1KENL 2ICWB 5C0FA 1W72L 3VWJA 1Y1DA 2D0HA 3HNTH 1ZGLA 1C4RA 3T2PA 3K5SA 4ZQTA 3ZKQD 2NQDA 2B14A 3O2WL 3QDJB 1AHWC 2IWEA 3EZJB 5T33L 1OCOB 2TAAA 3LNGA 3UYPA 2ZXGA 4WHYG 5D1XB 4HPHA 4OI2A 1HXYB 3BZ4A 1QTSA 3EBAA 4FFWC 3GSWA 4NKMB 3HC0B 1GNZA 2W94A 4JFVA 2F18A 3S98A 1ET7A 2ADFH 4HIXH 5FOBA 3VXSA 4XCAA 3WF0A 5EUKB 4GW1B 4AQAB 4Z3TA 2DQHL 3BQVA 3EYOB 1MFUA 4J3OC 1UY1A 2JCCF 4PJ9D 2GALA 1P53A 1UGNA 3CSTA 3MTRA 4P2AA 3RWGB 4YG6A 5FPZA 1OGAA 1JTZX 1F3DJ 2YK1H 3IKCB 4MXWL 3MRBA 5C0DA 3ZTJG 3WSQH 4F58L 1BZEA 1ZANH 5B8CA 3D3VE 1GKOA 2WN3A 3O6LH 3K81A 2VDRH 4I4WB 5BZWB 4BZ1H 2HWB2 3AUVA 1NGQL 4Z82A 1PKOA 2RA1A 4A6OA 5J56B 1GC1C 4MDJA 3HBZA 5CCKH 1BIIA 2I60L 3BXNB 3EJSA 4L3EA 3SDXA 1RVF2 1A6WL 4MKTA 4I30A 1EZVX 4YHZL 4LKSA 2VDKH 2ZS6B 5HDRA 3RWEA 2OXHB 4AYBA 1G7MA 3G9AB 2F53E 5ENWA 1J3RA 4HCRA 3OUJA 4XC3L 3VQ2C 1DQQA 5LG1A 2ITFA 2YDEA 3GBFA 4ICXA 4QCIB 2W07B 1PD0A 2G2RB 4Y5VC 4Z95H 1BIHA 3GDCA 2BJML 2ZKLA 1NDGB 2ZGMA 5C9JA 1U8LB 2O0OA 3UTSE 1GGYA 1Z7JA 1RULL 3LRSA 3GO1L 4Q0XL 3VFOA 2XXGA 3CDYA 4B4PA 1G94A 2Z6FA 4RAUB 2HVJA 2E56A 1HEZB 4N87A 1PHMA 1U93A 1ODMA 5CZVH 2WXRA 3TPUA 4N7UA 4CCEA 3ULVH 3QXTA 4NJ9H 3D25A 3RVTC 3LKJA 5A3LA 2ZX7A 1RZ7H 4OZGA 3WY2A 4NQEA 3VL9A 4J6RH 5C0CA 3CFBA 5IF0A 4U1KA 1N8ZB 1QJZA 3WW2A 2DI8A 1C5CL 2VJ8A 3JVFC 4RAHA 1F4YL 1UXSA 2C1OB 2BOBA 2CALA 2P24A 2ZUQC 2EH7L 3HPLA 3QNYB 3NCBB 4Y4KD 3VFSB 3VW3H 1W2NA 4JN1H 3BPZA 5C86A 4LPUA 1OLLA 2GHWB 5BZZA 4U1IA 5DSCA 3F2LA 4PPTA 1D2OA 5CMAB 2YA1A 3RI5F 3C75A 4MZIA 5GZND 5TE7H 2OUHA 4A37A 4AVTA 4RA0A 5CJOH 1P6FA 4PBVC 1KCUH 3BISA 2V7NA 1MFDL 3CQQA 3ILFA 1RUG1 3LD8B 2QQQA 1DSYA 5J6HA 1J5OH 3R6SA 2Q4SA 1BAGA 5CFDB 1TJGL 4UYPA 3P3YA 2JG8B 3AB0A 2J8UA 3THTA 5GISH 4WW2A 4A63A 1G9DA 4PRPE 4A66A 3NSTA 5D8AB 5F6KA 3GZKA 1CR7A 4ZNCD 2DWSA 4MDIB 2P7TA 4I0KA 5CD3A 2WFF2 4KMQA 2PCPB 5HTSA 4FI7A 3BH8A 5JPMC 2N0MA 5BNNC 3V6OA 4MVBD 4JDZB 4YHKL 4B7EA 1DHKA 1SFDA 1C8QA 4LE4A 5CHNA 4XZPA 3KEDA 4EEEA 3NK4A 4NENB 1ORQB 3V0VB 2ZKWA 3V4PL 2WS92 3WJLC 3ZIWA 4CU9A 3CLEH 3T3PB 4DGYH 3VXNA 5HHXL 3GZUC 4NQDE 2EEAA 5FAXA 1OY3B 1VLNA 1FE8L 3QOPA 1AX1A 1OP5H 5ANNA 2WO3A 3QG6A 5T1DH 5BUAA 2E0PA 3DGCR 2IXQB 1I7RA 4Y4FA 3F2ZA 5CJXA 1R47A 2AK4E 3AFLA 3K6IA 5E4EB 1CAXA 4JB9L 1R083 1FNYA 2NY6D 3QNZA 5E9AA 4YWGH 4AGLA 2VSCA 2VLRE 4EKXA 4ODXA 1YO8A 2JTDA 2OX5A 2YUEA 3VFGH 4ZX4A 1R33A 4WI7A 4IE0A 2QPUA 2MKLC 5CBEB 1LEGA 4OI7A 2Q10A 3SQOA 2R23B 3O1VA 2CE6A 4AUUA 3BLPX 4ZUWA 1MWOA 3EO1B 4LSTH 4OFKA 4JZRA 1LWJA 5EU3B 4U1GB 4MXVE 1FZJA 4KKBD 4PREB 5HI3C 5ISZA 3UTZB 2IZWA 4JFEA 3JTTB 4JG5A 5EHFA 1UQSB 4Z7VB 3ZIMA 3LN4A 4B9JA 3GSQB 3WDVA 2PFWA 4OKVA 5JUEL 2W91A 4NO2B 4WVMB 1N9PA 3HPJA 3W21A 2GABA 5I0VA 1IFGA 4UDUB 1M2OA 3KM1A 5DC0A 3TIDB 4UAOB 1WTLA 2WVVB 4GAGH 5DN2A 3W57A 3TWCH 2AQRA 1EAH2 4E0RB 3DPDA 1XAKA 4YDJA 1JOBA 2QPEB 4UWDA 1BFVL 3TBYA 4P14A 2BFVL 1AE6L 4ANXA 4ZW8A 1QW9A 3KCPA 3D39E 4FSJA 3FB5B 3B56A 5F44A 3ZKMD 4Q4V2 2B1OA 4H8WC 2ARXA 3HC3L 1BMWA 1V0AA 5FYKL 2XI9A 3VBRC 1FJ1A 1UXMA 1EMTH 2H3XC 5DO2C 4AZ8B 1MCNA 2B59A 3F5WA 2GQHA 5I93A 2EEDA 2XIDA 1UWXH 4LIQH 4LSPL 4Z7WB 2RMU3 2F1BA 1GGCH 2JWYA 3TV8A 5F1NA 1NA1A 2X0VA 4FD0A 4UTBH 4JHTA 1XSQA 4XVHA 3DKHA 3KGTA 3QFDB 4RGOL 1DYOA 3ZO9A 5HCBA 2CBOA 3WXVH 4IE5A 3G6DL 4BKSC 4CUAA 3LDBA 4YDMA 4FQXC 1RLBA 3V8CA 4K3HA 2HWC1 3CFJA 1DANU 1VHPA 3SLIA 2YQ3A 4OI1A 3BSZA 4ADGA 3HHSB 1J8HE 4LSUL 4BZ2A 4OJCA 1DBKL 1XSIA 2IOMA 2VDMB 3ML8A 4MS8D 4O02B 3IFNH 5E1IA 4AMKH 4ZXBA 9PCYA 4ZMYA 4JDVA 5DRWA 5I1CH 5C0GB 5IROD 1S5IL 4YFEA 4JG0L 1A9BB 1CG9B 3VHOA 4YSPA 1Y9GA 4MA3B 3TPKA 3U2JA 1FFQA 1I1EA 5ICYB 2NOYA 3DPBA 4EI6A 4K6BA 1VFAA 2LAAA 1H0DA 4X5PA 1BA9A 1DBBH 1WGVA 4XP1H 3AQYA 3LPGA 1SOSA 1FL6B 2H6CA 2F08A 5E9DE 3L2LA 2NYYD 4MMYB 1AQKL 3RA7L 3C7EA 2CLRB 1FNGA 5SX5H 1MCWW 3M8OL 5L7XL 3ZXKA 1SMOA 4FQCH 3V4UL 4GS7B 3RIAK 5KJRL 1NDTA 4Y0GA 2GI7A 3HZ3A 4XO5A 1PY4A 2NY5L 4I9WD 3U0TA 1EERB 3UAAA 2HTLD 1GGIL 1DCSA 4OF6A 3WDTA 3WUCA 2WKLA 3VZKA 3C5SB 3LEXA 5CN3A 3EOAA 3C9NA 5A7WB 4Y2OA 3WU1A 3VBUB 3BFQG 3OTTA 1Q9WB 1NMCB 3HOGA 5GGSA 5TQ2H 2CY6A 1KIRB 4IEFB 5FOJB 4Z7NE 3ETQA 2B39A 4WDIA 1YNLL 3OJDA 3MACH 4M3CB 3UC2A 4AYEC 2PLV1 5HYJD 4OMCA 5HVGB 4PS4H 3TBTA 1J1LA 2WS91 4CADB 4V1PA 2IANE 5EUOA 1QBML 4GG6A 4E42B 2FATH 5EO1A 1FORH 3FUFA 4BZ1A 3TA3B 3ZRFC 1EFQA 4KPHL 5JZGC 4YDLC 4QQOA 4TULH 5CIPH 5CZXD 2B9UA 4GFXA 2P52A 3QIUB 2XOMA 5SWZE 4JZJC 5JNYB 3VSVA 5J1SC 2XCMC 3FPYA 1IAMA 5DUUA 4CU6A 3TEZA 1IPJA 1EAPA 2ZG3A 3BPOB 3FU9A 3TBVB 2ISDA 3POWA 3PUAA 5C07B 5HP5A 4FOYA 1A3QA 5T52A 3T6QC 1JAEA 5C7GA 4J1UA 1NGYA 1YHFA 1UCTA 3K48A 4PSRA 3ETBJ 3SODB 5I19H 3OGGA 4XF1A 2ERJC 3B6SB 4ZW3A 3L3JB 3IFPA 3P4OB 4YNYB 2P1YA 4QKDA 3OKMA 1Q8OA 3DX8B 2UWEF 4W9KC 1GSKA 5C3TA 5JR1L 5IZ7A 5H4YA 1MAKA 4JFXB 3TZVC 4YUEH 1PNFA 1IBFA 3CN3A 4Z7OF 3OD3A 1Z5HA 1GY1A 3KG5A 1IE4A 2H6PB 4TLKA 1FVCA 4M7JL 5E1AB 1XCXA 3HZMB 3VE0B 3AJYA 3B69A 4A4AA 3MW2A 4HZLA 4XACA 4A41A 1V3KA 35C8H 3CVCA 3ARFA 3B83A 4YHPA 3ZE1F 2C1FA 1N26A 5HI5D 4AV5A 3HN5A 4UU9B 1S7QB 2IFFL 4AQ1C 1C8M3 2Z1KA 3H50A 5E1GA 1NCOA 2ZGPA 4KO9A 4UFLA 4HAGA 4NN7C 3U37A 3ME0A 1UOWA 4BLJA 3BPNB 4XP4H 1KB5H 2FCUA 1F11A 3DJTA 4XBGB 4NP4L 4U31A 2B16A 4LRNH 3IDNA 5AD0A 1TME2 1YQ8A 5CZRA 2VNOA 1E27A 3UBHA 1ZT1A 1J9RA 3EUDA 1MZFA 3ZYRA 1X3DA 1ZV5A 1CZVA 4XMAA 4P2YA 4CGUB 2Y7SA 4KK5C 2PYFA 1U5IA 3L1EA 1BVLA 5DD0H 3MGTA 4JBSA 1NPNA 3N85L 1HXKA 5F7WC 1FZMB 2YRZA 5IIEB 1S0EA 1OGTA 4ZX6A 4NPYB 1FFPA 3KHOA 4H7LA 4AHYA 3OPTA 4M6ML 5GLZA 4IMLB 2HBTA 1NGZB 2YUXA 2PYEB 5LY2A 1CD3G 5F89B 2CO4A 2EIJB 2P47B 2RR12 2RM23 1DN0A 2EXWD 3CC1A 4K94L 4IBWA 2YPLB 4Q89A 5LBGA 3UXFA 4BQ6A 3MCKB 1A6VH 2V33A 1MS1A 1V8HA 2W9EH 1U8KA 3ABMB 4OLZH 3QZLA 2ARCA 1I8AA 3WIFB 2ED6A 3SE3C 4HHWA 4PG9A 1AO7E 3MUUA 5C71A 1QNYA 5FO7B 3A0KA 1XNBA 3L95A 4HWZB 5I18H 3L2HA 4U1JB 5ADOL 4QRQB 4AWDA 1NGWB 5F32A 4LBQB 5I0UA 1QO3B 5FO9B 1J83A 1S7SB 2VM4A 4XHBA 5I1IL 3QIBD 4QO1B 3VZJA 1U8CB 4PS8A 5LKNA 4WVRA 4U6HB 3V10A 2V9QA 2V2WB 1ULFA 4HDIB 3Q2NA 3OHXA 3S4SA 1MZZA 1WO2A 2Q8AL 4DCQA 5I5MA 5JHLL 4WZFA 1Z3GL 3ETTA 5FZBA 4E2GA 2RS13 1R75A 1QMUA 1NGPL 1YZZA 4LCYB 3ZVXA 4MJID 1U30A 1W6QB 2DVFA 2ZOTA 5I1AB 3PUHA 5D2NA 1CL7H 5BQDA 2OW4A 5CSBA 1I1RA 3T2OA 3MLWH 1WZMA 3WDIA 2VIRB 5HHOD 4D9LL 1QY4A 3OJBA 1JPTL 1ZZ8A 5IHRA 3MRIA 5BNPB 5JMCA 3KW7A 3LRLA 5I6XC 2QADC 5H2BA 3HG5A 1CVNA 3NCCB 3GMLA 2ZPXA 4ETQB 4GKSB 1QFWH 4KZCA 4U6XA 4OGYH 4P46D 4XYXA 5DABA 2YPVH 3FCTA 1MHEA 1MCCA 2YLKA 3B7SA 5ICXB 5BRZD 3UPAA 3WFBH 3HUJB 3EXLA 1QJU2 1RIRA 2YBKA 1YLLA 1VBB2 3QCVH 3KSCA 1QJY2 1MJUH 4WWOA 1AX0A 1DSFH 1N1YA 3CJIA 4UF0B 2VZPA 3ATFA 4K5OA 4UB0L 1E6OH 4XCNB 3VXUA 1AYM1 5C9AC 1H8VA 1QKZH 3KLDA 4A55A 1QUNB 5JHAA 3KJ4B 3IJSA 3PREA 1C1FA 3RGVD 2HFGH 3MRCA 4IBZA 3L3DA 4GIQA 2P26A 1CYGA 2G2NA 1PZAA 3HB3D 2VXTL 2V7HB 4Y20A 2VC2B 2YMOA 5GQBA 4UTBA 2C6SA 3HG1A 3TB0A 4TLSA 1CICB 1T89A 2UUDK 1QOOA 2UZIL 1JN2P 3QRGL 3EYPA 5L4IA 1LAJA 3FONA 3JWDH 1TEIA 3MNVB 1QIQA 4JM4L 4LPYA 3R18A 3TJEH 3POFA 1XV8A 2VR9A 2PHXA 4QXBA 2QKSA 5LEKA 1LOAA 1K2DB 3SDCB 1OLRA 1DZ0A 4P5KB 2VERN 4AMXA 3WDXA 1A8ZA 4P0DA 3JSSA 4G7YH 2ATPB 1YEDB 1K5JA 5I2IB 2EIDA 1NZIA 2CSGA 3QUZC 4P5RA 4TNVF 4XAKD 3P11H 4XVTL 4F7CB 2D7MA 1YEGH 4BDVA 2GTWB 1A8DA 3NPZB 3TN93 3KGZA 3A67L 1HOEA 2R0WL 4ELME 3RUGF 1GYAA 4KH2A 3RFZB 3REVA 3MKKA 1D7FA 2J4WH 1W6OA 4OCRH 4GMP0 4P9WA 3BWZA 5LBEA 2W5PA 3V8OA 2Q0AA 2ZHNA 4W6XB 3QACA 2GC4C 3TOJA 1LOFA 1C08A 1PO22 2C9SA 3EJRA 1RITA 3CE1A 5HJ3A 1KLFA 3QAQA 5TDOA 3V7AG 3PGDB 3BGAA 4YSRA 3RIFK 2WNOA 5F5AA 1R3LA 4J4PA 4XO4A 2MHFA 1ITBB 5L9RA 3O1TA 2X9YA 2X1PA 2R7EB 5GRJL 1W2UA 1AI1H 2DL2A 1FL5B 3NDYE 3QDGD 4FFZH 5FKAA 4IBYA 1K5MA 2BNQA 2IXCA 1MQ8A 4ZUVB 1RXLA 2QDWA 4ZSOE 1S2KA 3EDDA 2HEYF 4OCTA 5GSVA 2A0LC 3FOLB 2HN7B 4Q6YA 4ZU4A 5I0WA 2ERFA 1MFAL 1Q1JL 1M6UA 3QJTB 4TL4A 1RZGA 2P45B 4HGMA 5CUSL 4CN6A 3AAZB 4JKPL 4TRPH 3S3CB 3RNKB 1K8DB 1U92A 2CO3A 1BZOA 3KW8A 2W0FA 4M8QB 5DJ8A 1JYCA 2ADIA 4NIIA 3VKLA 3M3CA 4LITA 4L1BA 1OQXA 3S5LB 1URXA 3WS3B 4HK0A 1VACA 2B0SH 3VBFC 5I26A 1UOJA 1QR4A 1GYUA 4HLZH 1NC2D 1SN5A 4I3RL 4ZU5A 2DWYA 3MV11 4YZ5A 1LO3H 1KULA 2IALB 1IARB 3FUIA 4CMMA 5I0YA 1HWGB 4IOSA 3A0NA 1S4CA 3D6EA 3SCGA 3BDYL 4G42A 3I3QA 4H1LA 3ZRCC 4PJ6A 3BPSA 2XPGA 1XL4A 4CDQB 2WUHA 4ANWA 3UAFA 4H2AA 3BP7B 4K2UH 2Q9OA 1PMHX 3WCYA 3BVDB 1RU9H 4EDXB 1IPKA 5EO9B 4LLVB 3E9TA 3EOYG 4LE8A 2NW3A 4DTGH 3GJAA 3UTPD 1FNSH 2N59A 4AYDC 2FDJA 2WQRA 2BNRA 3CZNA 4D8PB 2NY7H 4FQHB 3UJTH 1X4ZA 1ECYA 2HYKA 2EDYA 5DFAA 4CC1A 2CA3A 4Q4Y3 4K3JL 1YQ5A 4UNTA 3OSVA 4KJWD 4I9WE 4M7LT 2CJUL 4QNPF 1NAML 3M45A 1E90A 2XBZA 2CV6A 2P3KA 1UWEL 3SZKC 2Q6WB 4HLTA 3VRJA 3U0ZA 2XFGB 4GQRA 2QJVA 4MKMA 5KXCA 1XIWD 3TONA 3IEAA 3MV9B 1RUI1 2JJTA 4OI8A 3FN9A 3ZHLA 3UGHA 5L4MA 5FV2A 4NZTH 4PRID 5HYJE 5IEHB 4BGLA 4JFYB 4OZHF 2FWOB 2X4PB 3TFBA 4NUJB 4PGDB 4Q9CA 3NSFA 4LMFA 5LNDA 1XTMA 1E4JA 4TVPH 2K7QA 2VDLL 1DUZA 4JPKL 4AEMA 1NA8A 1D6VH 3A6CL 2CGRH 5IB3A 3RKDD 5I8EA 1KIPB 1JRHL 4LVHC 1LILA 4NAMA 3U4BH 1T1ZB 1BEXA 2EUXA 2WLIB 2BOCA 3OKKA 4F8OA 4ZHNA 1GS8A 3IJHA 4UAHA 2JQZA 4PB9L 2X9XA 1MVUB 5F7YC 3QWRA 4N8CL 5IVZB 2JB8A 4L3FA 1UXZA 2P34A 3EFDL 1CIDA 3VN4A 3FZUD 3DSFH 4ZYKB 3SGDI 2QQLA 1NMBH 3K7UA 3C60D 1EGJH 3KT1A 3FU6A 2I2SA 3SO5A 3LZNA 2DTWA 3MREA 1M7UA 2I74A 4MYWB 4YSCA 4Y8AA 4DW2H 4G8GB 4G8EB 5B22A 4LP8A 3I6GB 5I8OL 3CU1A 4W9GC 1CPMA 5DGQA 5DF0A 1AJ7H 2G9ZA 5ACZB 3L3HA 3L9YA 1F42A 3ZL2A 3QIWC 2CDFA 3IE9A 2ARJB 4J8RA 1LEIB 3P0VL 2H2SC 4H0GA 4JPIA 4AW7A 2WUBL 3PWLB 1OO2A 1JBJA 2ENRA 2WNVB 4HXBH 4HVOA 3FWEA 3IMBA 1H6YA 4COZA 2EC9U 2DUOA 4RHV2 2RQ8A 3DX9A 2HVBA 3BW9A 4D69A 2YQBA 2AC0A 2K9UA 3EJUA 3PDDA 4LVNC 4P2RD 5I1GH 4ZPIA 4ZTEA 2FT7A 5IFJA 1OD5A 3NWKA 3UNPA 2VN7A 4TN9A 2H6UA 3OF1A 5EWIH 2Y6LA 2VZVA 1S7TA 4J12A 4KRMB 3UYOD 1QPXA 2EINB 4JM2B 3TBBA 4V1DD 2Q76B 3SDYL 4GWNA 4I5BB 5IVXF 3ARGD 4WTXA 4IRJD 2I07B 4O02H 2WYTA 4EI5C 4TQIA 3WNIA 2F5BL 2JDPA 1UB6B 5HCFA 5GIRB 1QXJA 4XPAL 1LTXA 4CMHC 2BNUA 1N2RA 3PJNA 3II1A 4BXFA 5ACA1 2ZNXA 4YXLH 3RB7A 3SOBH 1FBIH 5EG6C 3LMJL 4W6YA 1GJIA 3EUUA 7FABL 4E2QA 3OF6D 1KYOJ 2GJ6D 1PZDA 4ZODA 1S55A 1LECA 4XFFA 1L9NA 3MMEA 3P9MB 5TPWL 2LROA 5FY7A 3TN0D 2BNNA 4RGND 2XWTB 4CCDA 3O3DA 5LXGH 4KRPD 3ACIA 3F7VB 3GB7A 2B4CL 4LPCA 4XRCA 1XO8A 1PGSA 4RD7A 4E36A 3BU0A 4FP8L 1XCTA 3DMMA 3IDXH 3LNFA 4A2LA 3QDMB 4GRWE 1BEV1 1FIGH 1TNFA 2OMUA 4XNXH 4GW1A 2AP2A 1WCBA 4LQ1A 4X7CC 1NOFA 4R7LA 5SWQA 1SJHA 5IB1A 4HPOH 3BDBA 4RQQB 3T3MF 4EV0A 1EWHA 2NM1A 4HUWB 2DVDA 1IE5A 2AQ3A 1T6VN 4EF3A 1Z7S2 3DDFA 1IFHH 1BQLL 3AWEA 4XI5C 3BVUA 1XSOA 5FA4B 2AMGA 3ZFEC 3V0AC 5I5IA 4M0NA 4AHZA 3FFDA 4F33B 2DBJA 4EQ3A 4PGEA 2QBWA 4JQXA 1KTDA 1EO5A 1O9WA 1IBGH 3CVHB 4MJIE 3F58L 1OT5A 5H9RA 5ADPH 3EOTH 5B4XA 5HHOE 2NY0B 4EUPG 4FQ1H 1RMU1 1SFYA 1WW4A 1KTBA 1PU0A 2NYZA 3TURA 3VDDA 2OR8A 2FDFA 2JXMB 3ZOIA 1UVQB 2QHRH 3OMAB 1YIFA 1YMMA 4GH4A 1AR82 2WMPA 3HLAA 4LORA 3F01A 1BXUA 1TYJA 2HX7A 3VXQB 3BRGC 5CFHA 3UC0H 3AMQA 5FXZA 5BRZE 3M1OA 1PCSA 3O11A 3PWVB 4G6KL 5FZ3A 1J05B 4Z92B 5E2TL 4YDVA 4PUBH 3I2OA 4HJSA 1ACYH 1UOFA 4NQVB 3HRZA 1HILA 4NRXA 4P05A 2WQUA 2AK1L 3FRUB 2QV2A 5DYOB 4AXWB 4ZTOL 3VFRA 4CU7A 1QJX2 4IRSD 3J8F2 2XQYA 5FM8A 4EMZA 1OWWA 4DP6X 2WKOF 4GNKB 3DRTA 4LSDA 3TH3T 1F15A 1GFF2 5JXJA 1RZIA 4FHBD 3UP6A 1YC8A 5DC2A 4Q1PA 3LGRA 1N4XL 2V6HA 3C8HA 4XDOA 3IXTB 4JHBA 4RSYA 1KN4L 2X4NB 4OD3H 2B9VA 2QSVA 3KV6A 4K21A 3H53A 2EA7A 4A7KA 5DRNA 4KRLB 3BOWA 1AYOA 2CBMA 4XWOD 3PDOA 4Y22A 3GTNA 1M7IB 4F80A 5IHLB 3BKMH 3I2IA 5EZIL 4XVJL 3T0EC 2F5AL 4XBPB 3QNXB 4BE3A 2GDFA 4XNDA 3Q2LA 2HLEB 3X14A 3VDDC 2RJMA 5IK3A 3A7QA 5I30H 4OF8A 1JV5B 4PJIF 4O51B 5HVFB 2AKRA 1N67A 5EEVA 2RTTA 5EFIB 2P49B 4KXCA 4L1SA 5E8NA 1UD1A 4M7LL 2YY1A 2F7PA 2A9NH 1FFNB 1NE4A 2NSXA 3KM5A 1QBLL 4XAKE 1IIIA 1OGPA 2P4AB 3ZKYA 3NJNA 1A6AA 4MA7L 1YEIL 4G6AD 4G1MA 1XF2A 5KTEL 1RUJ2 1PVHA 3T77A 5KS9B 3ARXA 2HG5A 3B4NA 4PJGF 1WWYA 4N0UE 2XZAL 1WIOA 4L4TD 4PY7A 1WFJA 1SDDA 4E4HA 4AQ2A 1GU3A 4LXFA 3LQZA 1ULOA 2ZG2A 2E6JA 4UV7L 3IM0A 3F05A 3QAZB 2Y24A 3VMNA 5IVVA 1XGRA 2HJIA 2ADJA 2BP6A 1UKTA 4P9HL 2J7LA 2W38A 4EN3A 4Y9GA 2R1DA 1T83C 4YBQD 1H3VA 1LEKA 1XOYA 4PJ8C 12E8H 2Y07L 1DQLL 2CXKA 2WZPA 4YL4A 3H3ZA 2YZ1A 4HQQH 4RWYL 4HOOA 5LNEA 4XT1C 4YHOH 1UJ3A 4AIOA 4LJHA 5FY8A 4E9QA 4ES8A 4XO9A 3ZMOA 3APCA 1UEYA 1F2QA 4L2YA 2R23A 4S10A 3ULUC 1IPSA 1V5JA 1IU1A 5FKBA 2P3YA 1YEHH 3DIVA 1FPN1 5D7JD 3PIQB 2BSDA 4YVSC 1W3VA 4MMZC 4UT7L 1NYWA 1MLBA 5C3QA 2H26B 1RHI2 1OF3A 4NRYB 2HKAA 2KZWA 1WG3A 2FBJH 5IJVA 4M6NL 5C7XL 2O6CA 1V55B 2VSMB 3QXUA 3JBG3 2VLKB 3KPSB 2GH8A 2AAAA 2JG9A 1SFNA 1MI5A 5EZPA 3Q2CA 1NXD1 3O7OA 4FMKA 5C33A 4C55A 5JI9A 3VG9C 5KSVA 1NFDA 2X4RA 3Q9OA 3DTUB 3HMWH 1IBDA 4IKKA 1EGJA 5HBBA 2HG0A 2Y6JA 3BP4B 5A7SA 3PAYA 4AI2A 3TEUA 3UESA 4DFSA 1L6ZA 3NVQA 5C3IA 3G5XB 4UMGA 4UQ2B 5CEXB 5IESL 4AI1A 5FZAA 3IGAB 4KFMA 2VMHA 3N44F 5FZGA 4K9EH 1D9KD 3V0FA 5IP4A 2DWDB 1SJEB 2EQDA 2QVMA 3O0LA 1AR91 1NFAA 1POV1 2YU1A 2B77A 3QEGH 2IC2A 4DQOL 3S8GB 2RV9A 4JY5H 4QXVA 4TS6A 5AYTA 3T09A 2H0JA 1LO0L 4NRMA 3QHTC 2NX5B 2C9RA 5F3HB 3UTPE 3D0VB 3LOIA 1REDA 3MV7D 3DYMA 4JGUA 2VC2H 1R0AH 2XSKA 4CAGA 3HQRA 3QS2A 4P3CL 1YEJL 5F3CA 1JPSH 4AJWA 2R8SL 5FQ0B 3KGUA 4F2FA 1W03A 4JL2A 5KXDA 3MJ8A 3QUYA 4G70B 4IQHA 1MF2L 5HYFA 1WWAX 2GN3A 3ZDZE 1JV2A 2AJYH 4G8AC 3R7RA 5AVWB 2A6DB 1YYNA 2JD9A 1GW6A 3B1TA 4ZO9A 3LXAA 5IT6A 4EBQL 2Z91A 5CGYD 2OQ6A 2D4DA 5FYLH 5BXFA 3R4RA 4C56A 1M05B 2SODB 4EZKA 3UOAB 1LGBA 3QCTL 4BFOA 4OAWB 1DR9A 2A7BA 2G0LA 2Y64A 5GS0C 1ODAA 3PU7A 4PRIE 4WWKD 4AVSA 5GHWH 2F68X 1V54B 3BIKA 1FYTD 3OLGA 4NT6A 1ZLUK 3SJVB 5L0QC 3FNKA 2NDFA 4NJAH 5DHYA 4LSSH 2JIXB 2CM6A 1MCWM 2GSMB 1XL6A 2L7UA 1JMZA 3PWJB 1AKJB 1R17A 1FL6A 2I26N 1QSEA 4Y5VB 5IV2B 5GJTL 4KWLA 1FLRH 2WD0A 1DQ4A 3VFVA 2ROYA 4UW6A 2JV6A 2VN6A 4ONFH 1DFQA 5IOKA 2CLRA 5BUVA 5FYJU 2KS0A 1X5LA 3MLPA 5FY0A 4F37F 1MELA 3M1BA 2VOKA 1X6NA 2RACA 1WW5A 1T66D 2Y4SA 3AXIA 4ODHH 3R06B 4PWJA 5FYJH 4LO4B 3LZFL 2OMWA 4Q27A 1TVBB 3BVNB 5DTFB 4K40A 1XGZA 4P57B 4FJZA 4FPOB 5JQIB 1C12A 4KJPC 3HZYB 2R0HA 3WEXA 4N8MA 2ZUQB 2YIHA 1ZPLA 4APXB 4CADA 3UL4A 5DLMH 5HHQB 1OALA 4PJFB 1KFXL 1A6UL 2YAFA 4KKCC 4Y16A 4DIXA 4NIGA 5I0RA 1OT1A 1IZ3A 3MIBA 4ONOA 5D1QC 5I16A 3GGWB 4HHAB 3AP9A 2APWA 4KX8A 2FHBA 4Z07A 4HKWA 3K3NA 3QZNA 4P2RE 3UIYA 3N06B 1OOAA 1C5BL 1S7RB 4I77L 5GZFA 1UWYA 3FQWB 4U1SB 4PJCE 4XXWC 3UYRH 1SVZA 5DXDA 3MJWA 4FFYA 3E2HC 1NEZB 4KO6A 4LLDA 2DD8H 4HKJA 4S2SA 1TMF3 1Q9LB 4V1DE 2EIGA 5ID1A 4HFWA 1AP2B 5DJ0B 5JPMB 4HHGA 3HIFA 4FFIA 3X3GL 5FJHA 5BNNB 3C8KA 2Z9TA 1INDH 3DX8A 1FO0L 4HJ1A 4KU1A 2A2QT 4WM8A 4FEMA 3NZSA 1WEJL 2HWF2 4JRXA 4RZKA 5CSZA 3ZE0B 4DGIL 1HX0A 4QKNA 1A1OA 5C2BH 3BZDA 3T4VA 1OSZA 3QYCA 3VA6A 1MS5A 5TDPB 2GC0A 3GIZH 2FCVA 1HW5A 3DARA 2APTA 4KVCH 4PJBB 5ILTH 1PS3A 3LOBA 2YD0A 4JZOA 3QE5A 1CFTA 1K12A 4W65A 2GJ6E 2J42A 1SMVA 3CK0L 2O93L 4ATFA 2Q1FA 4PFEA 3DKQA 4X6EA 5L2KA 3POBA 4JEGB 2ADYA 4LCIH 3LCPA 4RGNE 4YHML 3WZ1A 4FXTA 3SYOA 5J4MA 3QGVA 5K69A 1LK2B 2JLLA 4W68A 2ZOEB 5IWFA 2WW8A 4HV8A 3OR7B 3ILPB 2WUCH 1MCQA 3GZTB 3NL1A 3GUTA 3ILQD 4HCGA 2F19L 2G3XA 4NZRL 1R5IB 2R6QA 3GCWA 3WHUA 3P3UA 4UIKH 3V7AE 2OYKA 4OHXA 5ABJB 5FUZL 1OQDA 3V6ZB 5D5MF 1E2WA 2N0KA 3ILDA 3P9LB 2QE3A 2HKXA 5KVFE 3JUZA 3BTXA 4L8CA 3QXAB 2PXYB 4UILH 2BY1A 3GXPA 5M95B 4TUUA 4HN1A 1A4CA 4AHWA 1HRI1 1KJ3H 2Q7NA 1EANA 1PNDA 4NQXB 2M2DA 5FMBA 4U1LB 1AXYA 2ZCWA 1G9HA 1BYPA 1UKGA 4MMXC 2DWRA 3L08A 4G8FB 2FX7H 4XXCC 4QX8A 1APNA 1E8YA 4UT6H 1X4XA 2YEZA 1I1AD 3IJEA 3I2GA 4PY8I 5DC4B 3MRHA 2VQ1A 4JCWA 2O8QA 2RDQA 4MX7B 1ILSA 5H37H 3HN1A 4QT5B 1FRGL 3FFZA 3H1YA 4LPXA 1MEC2 2I25N 1X8EA 2K70A 2ZX1A 5FFLA 4IIQC 1NBVL 1D0HA 4QRQA 3VI4A 2WTRB 2B8MA 2CGZA 1PO13 3B2MA 2ZEXA 3VBRB 4F8LA 3QG7L 1OAZL 3JQXA 5B7FA 2WZ6A 3QULA 3TOPA 4ZMZA 5JW3L 4NHXA 4P02B 1PTZA 1PGRB 1MCJA 3LN5B 1MFCL 2CR3A 4U6HA 4QXTA 5KVEL 1FHGA 1R093 3Q1SL 3VD0A 3HS9A 3MDPA 3B2UC 5FO2A 3FCBA 5J9PB 4XN5A 2EVJA 2W0XA 1MSPA 1YPZB 1MACA 4RETB 4FQXB 4JS7A 4HU8A 1C5HA 1CXKA 3R4SA 4Y2DC 2XJTA 1BZ8A 4OLVL 3TTSA 4JFHD 4GXUN 4GMP3 4N86A 5ACLA 4ZS7L 1BYOA 3MLJA 1MJ8L 4R26H 2WVTA 3VFWB 4NM4H 2A38A 4XXAA 4YM0A 5T50A 4Y88A 1KN2H 4FOMA 2N1TE 4ETQA 3C6LD 3EJYC 1AS8A 1RUD1 1W0OA 3QWNA 4MHUA 2AZUA 2DBLH 2HJLA 4YSQA 1OH4A 4B9CA 4I0PC 4A04A 4ZUSA 2DQTH 1U3HB 3B43A 5F6HI 5JW5A 2WSUA 3AYDA 2EIZB 3MA9H 1HHIA 1LP9B 1HC1A 1ZHBB 4WK0B 3NH7L 1AG0A 1UG9A 2VZTA 1EZSA 5D7LA 4IEUA 3FRPB 3RVUC 1CLZL 1W15A 3L1OL 3OY8A 3I74A 2HEVF 1NDMB 4MZUA 3ZR6A 2C7UB 1SCSA 4WM7B 4QHNA 4GRLD 1PX3A 1KXQE 4PRNB 3N42F 5IR1A 3T9WA 1UH3A 4F3FB 5E08L 4G4FA 1LE5B 3NTCL 3LQAH 5GJ6A 4A6YB 4A2DA 1JNHB 3LS4L 1MRDH 5JXAH 1GQGA 4C4KO 4L4TE 5FMDA 3VRLE 2A3TA 2VAJA 3HR5A 1J1PL 3D52A 1YJDC 5LLIC 4A7YA 2XJPA 5E6ZA 1QI5A 1PSKL 4DXSA 3UO1H 3VXRB 5LCWL 2JDKA 3GMPA 3PUCA 3T2NH 1J87A 4RDQG 3V5DB 3IJ7A 3W20A 5D2LE 1QAWA 3CC5A 5JZGB 4XZ4A 5DD6A 4YDLB 4QJ5B 5FZMA 4B6ZA 2WCPA 3U9UA 5EQUA 4KG0A 2ATPA 3VBOA 4BZYA 4YSDA 3BT0A 1ZTMA 2FWLB 1YEFH 4QRRD 2FYVA 3S5ZA 5IHHA 3CVHH 5KVFL 4DEPC 1CIWA 4YSSA 1G7QB 3ZE2E 4YGCA 5BW7C 2H7WA 2ERJB 4AK1A 2OSLA 1RVF1 3G6JF 4JQRA 4FXKC 4Q8BA 3U2SB 1XGPA 2WZ8A 1Q94A 1SXAA 2IAAC 2IDSA 1T1WA 2DTSA 1FAKT 2E9QA 4I2XA 1G84A 4DEVA 3I3EA 3TZVB 3THPA 1M42A 5D1ZI 4XBNA 3TT3L 3M8LA 4WY7H 4WTZG 3S34L 2O14A 4XNZB 3JD73 2FGWL 1ASPA 1OF2B 1P1ZB 1OOPA 5KN5B 1B4JL 1M3IA 5FDYA 4LHUA 2B5IC 4KVPA 4ODWA 4COYA 5IWLC 4OF7A 3KF3A 2VRAA 1OTUD 4ILDA 2V8MA 2OZNA 2ZOWA 4AQ1B 5BMFH 1WF5A 4WUKL 2LR4A 4GKYA 4QM9A 3ZSKA 4NQCA 1KJ2B 3RYPA 1B2WL 4NN7B 3NQKA 3OX8A 4W9FC 1A5FH 3CXHK 2HN7A 3R0MA 5DURB 5DUMH 3ARVA 5DLLA 5MEND 4QPIC 3VXTA 2H1LM 1MPAL 5LGJB 4MCYA 4WWID 5AB9A 4H2CA 1SLAA 3MV7E 4IU2B 3SZ6A 1KZYA 4CUCA 1OA4A 3AW5A 3QARA 2WOYA 3KPRB 5CBLA 3OGOE 3I59A 4KNUA 4FQZA 1BBDL 5DGRA 1JMXA 5CG8A 2X88A 3M86A 1CBVH 1IQWH 4JFFB 1BP3B 1S7UA 5AAWA 4QHPA 3GBMH 5CINH 3W0WA 4UOW1 1RHHA 4N2LA 1HS6A 1HL8A 4UINH 4G7VH 2DIAA 2L7JA 4HCIA 1ZJAA 1FYTE 3ARWA 1XGUB 2R071 4PLJD 2IFWA 2GG1A 5D1ZC 1SF3A 2YA0A 4X9FA 3HLKA 2QCSB 4RGAA 5F7BA 2ZX3A 2XOTA 2R69H 4QXGL 1LU2A 3CN4A 3WMPA 1L5GB 2H9GB 3VFPB 3SGJA 5I1KH 1I7UA 4AG4L 1PVC2 2E7TA 5GS2D 2I9LA 1CR9L 4I48B 3IU4H 3P0GB 3SBWC 2YYOA 4LAQL 1TZAA 1MCLA 3ZMNA 2Y7QA 3BALA 3NGBC 1VESA 1A3LH 4WO4A 4CDUA 4PYHA 3AP7A 5SV4A 4PJEF 2BP8A 2WBXA 5EXOA 1OW0A 3UAJD 2KDGA 1MHHB 3QFGA 4NN5C 1EPFA 4MNQA 5AZ2H 3UAEA 5IT2H 3ZYBA 4ARYA 5C3SA 2IFGA 3QFJA 2P80D 4LL1A 1DEEA 4GMSH 5H35A 3LH2H 3RYKA 1UN1A 3GMRA 3H3BC 1USZA 4XO3A 3UTTD 3SH3A 3U14A 4OGQC 1US3A 3NJLA 1XYOA 3FUEA 5A7NA 4OZ4B 5E4IA 3GF6A 3PHOB 2BVQB 4E9TA 1RIVL 2YD8A 4FPJA 5IEHA 3X12A 1PG7H 1E4KA 1J9SA 1JWSA 4P23C 2W2IA 2VBDA 2NY5C 2QADB 1DVYA 3WTXA 1SUJA 32C2A 1XCQB 3DGGA 1DQTA 3TO4C 2BEOA 4CA9A 1ZEAH 2YPKB 5IVFA 1JFQL 4L4VB 3DNKA 2W1WA 5F0JB 4PLMA 2PCXA 4Y1AA 3Q8AA 1KIUB 1UCBL 2RFXB 1JYTA 3MLXH 5DMGC 4F5CA 5CNAA 1AUYA 4QHLB 1EZUA 3FU5A 3RJ2X 1UWGL 5JXGA 1M2VB 2CLVB 5JHDD 1YEKH 5CB7A 3U75A 1C1EH 3UJOA 1E4XL 5H37A 4DP9X 4G72B 5A7BA 5JXED 4CVZB 3RU8H 3ARED 3ZDYF 1QTPA 4ORGA 4KZEH 2EKSA 1L9OA 3MYJB 3GSRB 2Q8CA 2ALWA 1N0LB 2EXHA 2XZCL 2Q20A 2XWJB 1EAH1 1LO4L 3PJLA 5I5RA 4W8JA 1YY9D 3MNZA 1WVZA 5FC9A 1CGXA 1NLQA 2BTVC 1YSOA 3AS1A 4AY0A 5ITFB 4HJGB 3BD3A 4MJ5A 3I6GA 2Y5EA 1WC7B 3LS5L 5SWSD 5TE6L 3ZGHA 5EF2A 2V5DA 2YC4A 4HUVB 4UM9D 2NUPA 3PGCA 4OGAD 3IGUA 1T3FA 5ACZA 4Y5YB 3N9MA 1XGTB 3MLVH 1LENA 4NE9A 4Q4V1 3QUML 4MHRA 2YAHA 2H45A 1F86A 3OKEA 3I3DA 2Y6SC 3WKPA 3ZKND 2ZOOA 4PJDA 3MRFA 2QTEA 1UYZA 3ZU8A 3IDEA 5E6IA 4ISQA 1KIQB 1DQDH 4J3OH 3GSUB 2ESVD 1YI7A 4LKCA 4M8RA 4MDRA 2PCFB 1R082 2JTYA 4LGSB 1QDOA 1FVEB 2Q8BH 4PJXE 3QUZB 4CDWA 3LKPA 4DAGL 1G7IB 4Z76B 4JW3A 1GC1H 3MROB 2A77H 1O7FA 3UMNA 5FP3A 2HX9A 5E8OB 1VF5C 4QHUB 5DDJ1 1XF4A 5CNHA 3WNJA 2WINA 4KK9C 1YIPA 2CQVA 2PHWA 4J1WA 2QPDB 1TZGH 4L11A 1ALYA 4PDWA 4NR1A 5C0BA 1SN2A 2J88H 2R29L 1QNZL 3KJ6H 1GPOL 1SBSH 5ECJE 2JCCE 1KGIA 2QZ5A 3L3GA 5DI8B 3U7YL 1ODNA 2WT2A 5D2AA 4RBPK 1I9IH 4UDTB 4XCEB 5EOCH 4LHKA 2BSRA 1LJ7A 4XCFL 2EIEA 4H13C 4WUUA 2JMRA 1LTEA 2VUCA 1HOCB 1OAUL 1FZOA 1Z1WA 2EEFA 3MUGA 4Z78A 2MPFA 1K45A 2OJZL 1VA9A 3EHBD 1IEBA 1CU4H 4X6DA 3DO7A 2Z5WA 1CGUA 3V4PA 2OL3H 3OMNB 3FQTA 1WBXA 3FTGA 1CUOA 1P4BL 2CDOA 1P7QB 1CFQA 4XAWL 5F39A 3FSVA 4NHUA 1RZKH 3JWOL 1IKNC 2BSTA 5B3SB 3CZSA 4DP2X 3OUHA 5JIIA 1ZGLM 1GBGA 3POYA 5C2UB 4D8MA 2FDKA 1W8ZA 1XF1A 2ZP9A 3O4LE 4IRZH 2RMU2 1CDJA 3O3EB 3P2BA 3ZZLA 2VR7A 4IHOB 1WFOA 5GRVL 3Q05A 4LULA 4YE4L 2IO5A 2N01B 1GGTA 3VBFB 4ODUA 2MCMA 3T1FB 1HQLA 1Q9OB 1DJWA 5FZCA 3EJZC 1H8SA 3FT2B 4PJHB 2MHAA 1Q9KB 2JXMA 5LCVH 3LHPL 1UVQA 2IVJA 3LKNA 1KXTB 3D3VA 1I3UA 4FLQA 2APFA 5EA0L 2QFEA 1CGVA 2V4AA 3E97A 2XR4A 5L8KB 1BG1A 4AM0B 2ZX6A 5D72L 3UP1A 4DKDC 3IMTA 1S0BA 4KBZA 5FFOC 2DZEA 2EACA 3KWXA 3BAEL 1WUNT 3NNFA 5AFBA 3FTWA 3TCXA 4BA6A 5DVNA 3QI9D 2GITB 5TD4A 2EXTA 5C0EA 4R96A 2F53A 4LBLA 3HMXA 2D7OA 3STLB 2V72A 1F2XK 2AXWA 5LZ6A 4OM0H 3WQ0A 5E03A 4CU8A 3H42L 5C3LD 2ZMKA 1SHXA 5LAXA 4CCMA 4RAVB 1U8NA 5D71H 8PAZA 2VYRE 3SN6N 3WDWA 1G7JB 3N41F 2XQXA 3EYVA 5L9DH 3HG3A 4NAOA 4K23H 1BFSA 1MAML 3ILNA 3FTZA 1F90L 2WO2A 2D31B 1F4XH 3CXFA 4FYQA 3D0LA 1NLSA 5GLWA 4ZMPA 4XHXA 1BD2D 3VD9A 4MD4A 2LM3A 3FQNA 4JDTL 4Y9BA 4IXLA 2EJ1A 4CNIB 1CQ9A 1JZGA 1DVXA 2NPIA 4XWGH 2WBJC 3VFNB 4YPJA 4Z3IA 1RUC1 2WNGA 5FZ0A 5A2JH 2E74C 1RZFH 1II4E 4YSOA 2QSQA 4U3SB 3SKJH 2BC4A 3TT1L 5JYLA 4OMDA 5FMCA 3MN8A 2OMNA 5CEHA 4CDXA 4CVUA 2CZNA 4QXUL 4Z7VF 4WNJA 4LVHB 3S5YA 1K4CA 1Z9LA 1IFRA 2FJHB 3ZDXF 4C4BA 2CRYA 2D0FA 3EFFB 3ESMA 2XFXA 3P6BA 4JUTA 2PABA 3EYFB 3S88L 1QMJA 4QRRE 1HHJA 2NTSP 3NNLA 2WLKA 4DO0A 1IZKA 1AGFB 1WE5A 3Q3GB 2R69A 2DYPD 1E2ZA 1PDKB 4JGNA 1CK0L 4IBSA 4XMKL 1W8FA 2ZEWA 3MR9B 2PA7A 1ORSA 5J12C 2RR11 3V9CA 1OKQA 4PBXA 2FDGA 1O7DC 2ZJSH 5K9OB 4PRPA 1REFA 1HNFA 1PZSA 1V27A 1A25A 4WFFD 2APSA 3SEPA 2VUAA 3CMOL 2DWEA 3AZXA 4YGDA 1NPJA 2LQRA 1HIXA 2OR9L 5K33A 3PUQA 3R1GL 4H8WH 4YVNA 1MFVA 2J6WA 4ZFFA 3FCSB 3QIWB 4QTIH 3WTVA 1O4TA 2L9LA 4YW5A 1NUNB 3OKNA 4LLFA 2Z8RA 4H25B 5CKAA 1LOCA 1DBJH 3I9IA 5GGUB 1MXGA 3GXFA 2PKDA 4OZFB 1RIHL 4NQDA 3O0VA 2VCMA 4DOUA 2P5EB 3CH1A 1KBGH 4LVNB 3GBLA 3SDAC 1S1AA 3OJMB 4L9LA 4B50A 2GUOB 3ZXDA 4OFQA 1BVNP 5EOCJ 1RL1A 1WTGT 3RGBA 2TEPA 2GSIB 4AW4A 3FQXB 2BFUL 2AK4A 2YC1B 5MENE 2WWOA 3D9AL 1NTDA 1NL0H 1QHQA 1U91B 3GJFA 3MRDB 2IPKA 2PO6C 4HJJL 3Q8EA 4PP2A 2WYHA 2VLRA 2EVGA 2B7YA 2WWSA 4TNWF 4K7FA 3C7OA 4B9GA 1E42A 2Z42A 1YNAA 2B15A 4LCCC 3HI5L 2JSFA 3O6ML 5BVJB 1RC6A 2IAMD 2J7MA 2IPTL 1BLNA 3D7PA 3RVXC 4FF9A 5I8YA 4G1EA 2HT4D 2CMRL 4CMHB 1IC0A 4UQDA 5MI0C 5E2VL 2GC3A 2W46A 2E9IA 4HFSA 5D6DA 3BI3A 4MXVA 1BAWA 2X09A 4X9YA 4BFIB 1DQJB 4DH2A 1VCBC 4BKLB 1QJU1 5T1KA 1VBB1 4FMVA 4UQ2A 5BPPA 1ZS8A 3DETC 3QWOA 5CEXA 2J2ZA 4IV3C 3F3HA 5FUOL 1AHWA 2PPDA 4W6WB 2RM22 3P9WB 2BP5M 4GQ9L 3GUFA 3KV5A 2AJZA 4HWEH 1QSVA 4A6YH 1JRHI 3B7TA 2L7QA 3R4DB 3GK8L 4IJ3C 4R7DA 4XBLA 3MYZA 2CD0A 1IHMA 3JZVA 3IBMA 3NFPA 3DDGA 4R7VA 3EF7A 3RWIA 4R9HA 3GZAA 2ORBH 1ROWA 3CDCA 5EC1B 3D39A 4M3CF 4L1LA 1GZPA 2NXYD 2C9PA 3EGDB 1N0XH 4HIJA 5J3HC 4LOSA 2IXJA 2V3FA 4HKXA 3RZJA 3RTQD 1RQ5A 5BNOB 1VRH2 3ZFEB 5EOQL 3V0AB 5BV7L 1M3JA 1PZ2A 4PMEA 3PMSA 4CXXA 4AK3A 3P02A 3RZMA 3UTTE 3V7MA 3RWHB 1HSBA 4PJAB 4DXTA 3DOSA 4Z7QE 1QQP3 2PR4L 4N9GB 2W1SA 5F8PA 5F7LB 1JPFB 5GGRY 3P2TA 3W39B 3ZHKA 4IM8A 1FOD2 1OLME 5GALA 3HJ0A 1YECH 1AIZA 1Y0LB 4RISH 4Y4HD 3WG7B 2FHCA 1AD9A 3K6DA 1XH1A 3W9DB 1LDSA 3G6AA 3O45A 1E3FA 4QGTA 3WFHA 1M1SA 4DK5A 1F1DA 1I31A 1TE1B 4PWIA 5IFAL 2F4PA 3WDHA 2QKIA 4CILA 7CGTA 4UNUA 1AKJA 1J8HA 1NFIA 3G04B 3OZLA 3PP3K 4AMWA 1AXZA 2F7OA 1BK1A 4EN6B 2DDQH 1SFHA 4AX3A 3AVSA 2XC8A 2G4GA 2XQ0A 4QU2A 5DG2A 2W9DL 4MJ6A 5E6YA 5JHDE 2MOGA 2ZHKA 1Z2KA 3OJ2C 3ZLIA 3V6FA 2B3IA 5DRZB 3KLHD 3PDGA 4PWKA 1MS9A 2R042 4ZS6D 2R27A 3B9KD 5IB5B 1S0FA 2FWUA 4DGWC 1PZ5B 2OL3A 5C7ZA 4WF7A 1BM7A 4M5ZL 1PO21 4UFJA 1D5BB 3L9RA 4QHZA 5B39A 4UBDD 4FO9A 4S2HA 4FERA 1NH6A 1H1AA 4LASL 2VR3A 3WIIL 5LWYL 3U9PH 5E7BA 5SWSE 1KJ2H 1FNEA 4CL7A 2AJVL 3FO2B 3K6FA 2LTNA 1XGYL 3QZBA 4KDWA 3VWJD 5A32B 3GPEA 4XP5H 3UGUA 4EI0A 3ZHNA 1A1NB 4OZIE 4GZ9A 4QRUB 2F8IA 1AG6A 1SHSA 3AY4A 3TV3L 5C09D 3NSJA 3C5ZC 2ARJQ 3T0EB 2VR4A 4AOFA 5JHLA 2FMYA 3J7MA 4KTEL 1J8KA 5HJDA 2X4OB 1LKNA 2D6LX 3VDDB 3ZFGC 4N2GA 2ESVE 1E7UA 2LFEA 4YN3A 3C6SA 3QYNA 5A1LA 2R9HC 4U1SA 3KL5A 3WLBA 1SLIA 1EDHA 2HRPH 3JT2A 3P4MA 3GI8L 1O6SB 4HZ1A 5HSFA 3UERA 4WU5A 3TO2A 4GW4A 3ZKMC 5DJ0A 4QPYA 5SWZA 1O8SA 3F7LA 2X3AA 3JV0A 1T0PB 2R1XA 3GBEA 1CFNA 1OGAD 1XEDA 3QDHA 5F88A 1M7DA 3R19A 1TMQA 4NBXB 2CR0A 1FSKC 5FW7A 3IKKA 2LTQC 2OMYB 1NBYA 3KYNA 3RZCD 3OTFA 4N8VA 5BS0D 4Y5XC 4IOFC 2ZQKA 2HYXA 2WLNA 3CQOA 1H8TC 5KBKA 1Q8PA 3HS8A 4DZBB 2CSPA 4G9FB 3UO8B 1JPGB 3KGRA 2F54D 2BY2A 4HC1A 4TM9A 3TXAA 1P4IL 3SDDC 5DK3A 5IJDC 5K59F 5KEZA 2QDRA 4PJ8B 3T0DA 2JVUA 2W81C 1B0RB 2Y25A 4PIRF 4Z7UB 5T5FH 3WENA 1PZUB 4UTAH 1MHPH 4WEBL 3WUWB 1BBT2 1YQCA 1JI1A 4DINB 5DHVA 3QPKA 1KXGA 1CXHA 5B38B 5CAZA 3NESA 3N2JA 4NHLA 3POSA 5FYYA 2OMTA 1BGXL 3WT3A 4GIAA 3VUAA 2YHGA 3MXVL 1SPPA 4PLOA 5K39A 1UB5A 4JGYC 4YVSB 3P9LA 4P4KB 4ZFGL 4MMZB 4KTDH 1GV9A 3UZVB 3DHJA 1FLTX 1NCBH 4QKTA 2B4CC 4FA6A 2O5ZL 4JKWA 2PW2A 4TUKH 5E6HA 1ZMYA 4E9YA 5L7OC 1AAJA 2IDTA 1PD6A 2G60L 1JZ3A 1QSFB 1T22A 2R51A 3AZYA 2WWNA 1AR1D 1IGIH 4PGCA 4DVBB 1VALA 3GT6A 4EAEA 5MEPA 3VG9B 3PHMA 3BIAX 4PJ9A 3HUJF 2WIIB 3IU3A 1R1CA 3VI3F 2FJFB 4CP2A 5F2FA 1XHHA 4MX7A 5E99L 1MH5B 3MOBH 4FFVD 5D70H 1Z0HA 2C3WA 2XVBA 3WTSA 1RUH3 2R49A 3CBNA 1A9EB 1FF5A 43C9A 1MLCB 4MADA 1JD9A 5I75C 4D0BB 3IDBB 4UT9H 3OLEA 3H6JA 3TEYA 3RI8A 5FP9A 1GL4B 4CEWA 4N2KA 3RWFA 2Y2TA 3MFGB 4F37K 5CCGE 2BCKB 3QQ3A 1W2TA 1T80A 3HE6D 3EQEA 1DBMH 1N7ML 3GQFA 5DWUL 5GSRA 5AVRB 2LRPA 3BQUB 1HCVA 3LEMA 4ZZ5A 5F8RC 3N9GL 1UA6H 2BDNL 3Q1EA 4WKZA 4GXFA 1UM4L 1TJIL 5FX3A 3OVUB 5GRYA 4CCOA 3KQRA 1BZ9B 4JVPA 4AI8A 1CGTA 2UZPA 2UXFA 4HLEA 2A73A 4RHV1 5E88A 3BUDA 1NIEA 3FPXA 4HUXB 5I1EL 4QHKJ 1BD2E 4OLYL 2DYSB 4BUGA 2NQCA 4D0CA 1IT9L 1G9NL 1CDCA 1JK8B 4BFEA 4YDIH 4JREC 3ENEA 3GHEL 4WTWA 5L0QB 4CSTA 5TF0A 4DRVA 4X5WB 2DTMH 5E0FA 1HYSD 2VWEE 3DRQA 4XVUD 3TEWA 1RZPA 1J9CT 1DBAH 4HJ0C 4BCYA 2R0LL 3IN2A 4EZJA 2ZX2A 5E1HB 3JB4C 1R5VA 3LZZA 3BWAB 3RURA 5LXVA 2YR3A 4Y4KA 3RY6C 3H1WA 4W93A 3IIIA 1ZLDA 1OK8A 2CUHA 3B7YA 3D2UB 1OAQH 3KR3L 3A4FA 1CAUB 3FRPA 4QGNA 3NAAL 2CU9A 2OW7A 1ONQB 4OH2A 3HG0A 1CZ8H 2VBPA 1PY9A 1CI5A 1E28B 1ND2A 5GZNA 4EWAA 5ISZD 1HI6A 3I9GH 2G9HA 4JFED 1A7QL 2ZCKH 3KNBB 2VQAA 1WW7A 1W8EA 4ZBJA 5FM5M 3R8BB 2CLZA 4A6YA 1OD3A 4LSQL 1O5LA 5JLZB 1J18A 2UYAA 3HS0A 4C83A