4FBFA

Crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
352
structure length
340
Chain Sequence
QPKDTPELRALYKSFEEESIIPLWTQGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRRALGLANPGLGGNAYISPTMYAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-dioxygenase
publication title The generation of a 1-hydroxy-2-naphthoate 1,2-dioxygenase by single point mutations of salicylate 1,2-dioxygenase - Rational design of mutants and the crystal structures of the A85H and W104Y variants.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
total genus 91
structure length 340
sequence length 352
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fbfA01
4MGZE 1UIKA 5LRSA 3ST7A 1I6XA 1O4TA 4XETA 3HT2A 3OD0A 4XFBA 5JAXA 2CGPA 1WA4A 2E9QA 1WLTA 5KHKA 4E2QA 3MYXA 4IEQA 2BGCA 4QXKA 1OI6A 1XE7A 1ZREA 3H7YA 1G6NA 1OMIA 4KU8A 1WGPA 5FQ0A 3UKNA 2GZWA 3RYPA 4IETA 1UIJA 5J3UA 1ZZBA 3LA7A 2C0ZA 4L11A 4MV2A 4HVQA 3EJKA 3NVCA 3U11A 5I0UA 5E1RA 3M3IA 5T3NA 1Q3EA 1ZZ6A 4X6RB 3LA3A 2UY8A 1Y3TA 2ET1A 1J3QA 5JSRA 1Q43A 1OFNA 4IEZA 1PM7A 2XLFA 1IPJA 4J1XA 3MPBA 3H1MA 4PIZA 5BUVA 3HQXA 4MX3A 5JSPA 2Q4SA 3G7DA 3PLQA 4K8FA 3EBRA 4WBBA 5LEJA 1HW5A 3QOPA 1GQGA 5I8TA 4AQ2A 2ET7A 4FT8A 2XLAA 5FCCA 1O3QA 3KGLA 4AQ6A 2WC2A 4QGLA 2FMYA 1RUOA 4TLFA 4LTAA 1DZTA 5I93A 3U10A 4Q0PA 1XE8A 3ROUA 3DV8A 1NE4A 3JZVA 1ZRFA 3SCFA 3D82A 1ZZCA 3E5QA 4QMAA 5E16A 1CX4A 4EROA 2HKXA 2Q30A 3H9AA 1QXJA 5I0SA 3E6BA 3ETQA 3LA2A 4IEPA 1O5LA 4N9IA 5EFUA 1ZZ9A 4CYDA 4LUKA 2Q0AA 1ZX5A 4H7LA 1O7FA 1GQHA 4HSLA 4J1WA 5LRRA 3EHKA 4I01A 5I8SA 2D5HA 3RNSA 2D93A 4LLOA 4YYOA 2ZCWA 3HT1A 3BU7A 2EA7A 4XF9A 4BH9A 2B9UA 1OD5A 1ZVFA 2BNMA 2VQAA 2QNKA 2PTMA 4Q0UA 4ZU5A 2PAMA 2KXLA 2B8MA 3IDCB 1V70A 2UYBA 2CAUA 3EQEA 4KWKA 4KL1A 3M70A 1H1MA 4BHPA 3LOIA 3L2HA 4IEXA 3ES1A 2IXKA 3BALA 2N7GA 4LA2A 4I0BA 1RTVA 2ZKLA 4MZUA 5BXXA 3BB6A 3MDPA 1QY4A 2ATFA 2PFWA 2PYTA 3D0JA 4BIFA 4IEWA 3FJSA 3E97A 4O9GA 5HI0A 2PAKA 2VPVA 3OTFA 4UXAA 4ORFA 1CAWB 2OZ6A 3I59B 3LZZA 4ONUA 2MHFA 4XFCA 3SMHA 4IEYA 5CADA 4LA3A 5D1IA 4XFGA 4XFHA 1L3JA 4I2OA 1TQ5A 1FI2A 5K8SA 5FPZA 4IERA 3USSA 1VP6A 4R8HA 1YHFA 4E2SA 2PAEA 1PMIA 4A2UA 4HN0A 1SFNA 4IEOA 2GAUA 5F1RA 1CAWA 3I59A 3WW2A 2B5HA 2OZJA 2HJIA 1Q5OA 3ES4A 3SXWA 1UCXA 3RYKA 4LULA 4JTNA 1LRHA 1ZZ7A 4Z07A 4HZFA 1FXZA 3RZZA 2XL7A 1EPZA 4YRDA 4HMZA 5C6CA 2PQQA 1UW8A 1O3TA 3GBFA 3CL1A 4P9GA 4OFGA 2IXIA 3SCGA 1LB2A 4HN1A 2XLGA 4F7ZA 5BY5A 1ZZ8A 3E5UA 2FQPA 2I45A 4Q0QA 5J7MA 4I0AA 2GC0A 3C3VA 3H3ZA 1YWKA 3R6SA 1VJ2A 2H6CA 4XFIA 3N4MA 2XKOA 1IPKA 1DGWA 1QXRA 2Y0OA 1CGPA 3SCHA 2OPKA 2IXCA 2XHKA 2UYAA 3SHRA 2WFPA 5I91A 4MGYE 2ETEA 3CLPA 5KHJA 3NL1A 4Q29A 4PJYA 2UY9A 2XKPA 5CVRA 2H0VA 4XF1A 2GU9A 1QWRA 2IXHA 3I54A 3DKWA 1CAXB 1J3RA 4O9EA 3S7IA 4META 1U12A 2P17A 1VR3A 5I8YA 3E6DA 1CAVB 2O1QA 1Y9QA 1X8MA 4D7TA 3WW4A 1YFXA 5KHHA 2BNNA 4LEJA 1H1IA 3KSCA 1I5ZA 4MH0E 3NW4A 1EY2A 2CV6A 3IWZA 1ZNPA 1CAXA 3DL3A 1CAUB 1X8EA 2GC1A 3ZDSA 1J58A 3IBMA 1SEFA 5BPXA 4UBHA 1CAVA 3PNAA 4R52A 2PHDA 3MZHA 3H8UA 4MGKE 4WZCA 2H6BA 3I7DA 4EWDA 4JV4A 3WW3A 3BCWA 4IEUA 3H50A 4Q0VA 3NJZA 5I0TA 3CO2A 5KBFA 3UKTA 4ZU7A 5JR7B 2XGXA 1EYBA 2Z69A 1YUDA 4IESA 4KWLA 3EO6A 1ZRDA 4OLLA 2QJVA 1JUHA 4IEVA 4RD7A 1NE6A 4YNIA 4N9HA 3ELNA 3IDBB 4AVAA 3PVBB 3KMHA 5J48A 2K9ZA 4LUMA 3VHRA 3FZ3A 5C8WA 2F4PA 4XFFA 3O14A 3OF1A 1J1LA 3CF6E 2OA2A 1ZRRA 3FX3A 4BYYA 2DCTA 4PIXA 2GC2A 5FPXA 5KHGA 3E6CC 3LWCA 2MNGA 1X82A 1XRUA 4FBFA 3S0MA 4AVCA 4FAGA 1UPIA 2BYVE 3TNPB 4EWAA 2O8QA 5JCTA 1DZRA 2Q1ZB 4QM8A 1NZCA 5FLIA 5AVPA 1UD1A 3E5XA 3OGJA 4AXOA 1RL3A 4EV0A 3BPZA 2GC3A 5FDBA 4HLTA 4MUVA 4X6QB 1ZRCA 4F8AA 2BEOA 1X7NA 1YFYA 2D5FA 2QVSB 4HVRA 3DN7A 4NVPA 4EWEA 3U0ZA 4XF0A 1EP0A 4JTOA 5BV6A 3IIAA 3KGZA 4XF3A 4Q0SA 3OCPA 2IXLA 3TNQA 1O3RA 2IC1A 4GULA 2CAVA 5JSOA 3RYRA 3H3UA 1YLLA 1LR5A 4KWJA 1NXMA 1O5UA 4PIYA 4YSFA 4KU7A 4UBGA 2EAAA 4ZU4A 2PA7A 3RPQA 2K0GA 4Z82A 3CJXA 4YARA 1RGSA 3H7JA 3LAGA 5FLJA 5KHIA 4WVZA 1FT9A 3B02A 2PHLA 3H1YA 2IXJA 4AVBA 4QGNA 1RC6A 4XEZA 4HSJA 2XL9A 3CEWA 4JVAA 4QM9A 4QX5A 5CU1A 1RUNA 4QGMA 4B29A 3S7EA 1YFWA 4DINB 3KCCA 1DGRA 3HIFA 2VECA 4D7SA 2QDRA 4I09A 4E2GA 2D40A 5FLHA 1O3SA 3UKVA 2MPFA 1NYWA 3H1WA 3D0SA 2Z2SB 3FHIB 4XF4A 3RDIA 3NKTA 2V09A 4HBNA 3ACLA 1J59A 2BNOA 3GYDA 5EZWA 1LKNA 4XFAA 3FFQA 4I3PA 4FAHA 1CAUA 4HVOA 1J3PA 2QCSB 3NSTA 2GH2A 5I0RA 2OYZA 1YFUA 3QACA 3FE5A 3WW1A 4L2NA 2EVXA 3FWEA 5FQ0B 1SQ4A 4MGIE 5LEKA 4I02A
chains in the Genus database with same CATH superfamily
2PXJA 2ZGLA 4C90A 3AYEA 4CP2A 5C5TA 3ST7A 2OUHA 5A70A 2DTWA 4XETA 3WF1A 1DYKA 2AYHA 1WWYA 1LENA 2ZEXA 4XFBA 4WVVA 4XMAA 4EZ4A 5LWBA 3H0OA 2CGPA 2E9QA 4IV1B 4OI0A 5GZCA 4AFCA 3LFMA 4UF0A 3VD3A 1Q8OA 1F4HA 3MYXA 5APAA 4CTEA 1ZBE2 1V6NA 2BZDA 2DTYA 2XPJA 1MVEA 1HKDA 4KU8A 4L92A 4LBKA 4QHBA 3O1SA 1N1VA 5T55A 1VBC2 1X9TA 1OLME 5F3IA 1MEC3 1ND2B 1KJRA 1W2TA 4Y1UA 5HPOA 4BQWA 2R49A 3B9CA 2C0ZA 4L11A 4MV2A 3NVCA 3OGVA 2VZQA 3I2GA 3U11A 1HB4A 1VIWB 4PCRA 5L9VA 4IV1A 2JICA 1W2NA 4G9SB 3CZJA 5F5CA 4ISQA 4CPBD 3MPPG 3QD6A 4URTA 3UETA 1Q3EA 1HRV3 1W06A 4LOTA 4X6RB 4E8DA 4OI2A 4TWTA 1Y3TA 3N7MA 3DPRB 5BNOC 3OPWA 4AEDB 3N3HA 1ENQA 1CX1A 4FXKB 4IEZA 1SCSA 3AMPA 2XLFA 5KXCA 4XJ9A 2Y60A 3OGSA 3VKOA 1S1AA 1ND2A 1H2MA 3POWA 1AF9A 5FBJA 1UZWA 2RR12 3HQXA 4FSJA 2YZ4A 2ZAAA 2CDOA 2VCBA 2Q4SA 3ZFGC 2F4LA 4Y24A 4MLOA 3AMMA 4P5YA 4WBBA 2WZEA 1N3PA 4XJAA 5D21A 1RINA 1GQGA 2QUOA 5FMBA 2XJSA 3WDVA 2ET7A 3DPRA 2HYXA 4UFHA 4AEDA 1CJPA 1ZBE1 5FYYA 3ACGA 3KGLA 1DQ2A 3KZ4C 4Q4X2 2J42A 1AR63 1XQNA 1BHGA 2VOKA 2Y6LA 3B93A 2VL4A 2X8KA 4LTAA 3VDCA 1PO23 4CEWC 1QJZA 1VBC1 3U10A 1QJY3 3PUAA 3KS7A 1OQ1A 1ZRFA 2OQ7A 1ZBA3 2WSUA 3D82A 2ZGSA 1ZZCA 3E5QA 4W8JA 4YZ3A 4COVA 3P6BA 5A3NA 1EPWA 1RXFA 3OBRA 5IFTA 4BE3A 2Q30A 5I0SA 2JB8A 2WNVC 4Y1XA 3BU0A 3IAPA 2BV4A 4IQPA 3ZMOA 1C5HA 2GMMA 3P3PA 2W1SA 3VBFC 1SPPB 2BVBA 4JRAA 4LK6A 2ORZA 4N9IA 3FHQA 3POIA 1UF2C 2CYFA 2EIDA 2J22A 4LBNA 4OQ8A 3I2FA 1OXCA 4CYDA 5J1XA 5DG1A 2W9XA 3ZSLA 1FMD3 5JOZA 1MS3A 1GQHA 3UGGA 1RHI3 4JDOA 3ZPOA 4CCKA 1Z7S2 3KCYA 3S30A 3AX4A 4BK4A 2XONA 4Q4W2 2WABA 5ACA1 2WO7A 5EJZB 2DVFA 4HOOA 4NAMA 4OI4A 5EHDA 3WNPA 4XF9A 2YUEA 2LM3A 2QQVA 2EXJA 1H6YA 2B9UA 1OD5A 1ZVFA 1PM4A 2BNMA 2VQAA 3D4KA 4DY3A 4JX0A 3NV2A 3VHPA 3JBG3 4ZU5A 4Q0UA 1J83A 2E31A 3RWNA 4F83A 5C3PA 5IK5A 3GDBA 4BK5A 3DYPA 3IDCB 4YG6A 1PNFA 3UK9A 1A8DA 1KQRA 1V70A 1GWKA 4LHKA 4L9BA 4KL1A 4JGYC 3U75A 5JXHA 1V00A 2VTFA 4Z2WA 3LOIA 4IEXA 1HRI1 4FPGA 5FZMA 1QGLA 5I0DA 2KA3A 3VZJA 1CZTA 5E8AA 3WSOA 5CAZA 2B45X 3AZVA 5D8AB 3T4VA 3W20A 1BBT2 4UYBA 3RGBA 1QJEA 3VB9A 4I0BA 4CDXC 1VBE1 1IKQA 2JG8B 3BB6A 3MDPA 2XB6C 1T6GC 1LGBA 4NR1A 1JOJA 1D4M2 4JRLA 3ZYPA 3O0VA 1NLSA 4Z8BA 3L2YA 1V0AA 3L9JT 3B01A 4V2VA 5EV7A 1ASJ1 5CFDC 1ULOA 2D6NA 4XHBA 3E97A 2YB7A 5FUPA 5HI0A 2WAAA 2WWJA 1PGL1 2VPVA 3ZKUA 3OGRA 2WS92 4UXAA 4IDZA 2VGDA 5D8AA 2Q5TA 1AYM2 4ORFA 4Q4W1 1Q8PA 1JOBA 4XACA 3WV6A 1SDWA 4AF9A 3FMGA 5F6LB 4IGPA 3SMHA 3VDAA 2JG8A 4IEYA 1IQAA 5HCHA 1FPN3 2VQUA 1UL9A 2WINB 1Z78A 4XFHA 5A7SA 1G86A 4P08A 2FDHA 1FNZA 3USSA 5K8SA 3VL8A 1MS8A 4COZA 1W6MB 3ZYJB 2VVFA 1YHFA 2R1DA 2BGPA 3MIEA 3HAGA 3M2MA 3ZFEC 3VBUC 3THTA 1YQ8A 2P3KA 1JHNA 3T4HB 4GB32 5G05L 1SFNA 2RS12 4IEOA 1S2KA 4KI5M 1PIV3 1RIRA 5F37A 5F1RA 4DFSA 1WBLA 2W52A 1XYNA 3FUOA 3RZJA 2CSGA 3VBHC 1Q5OA 1CPMA 1FATA 4N7IA 3RYKA 4QD2A 5F9TA 4SBVA 1HX6A 1ZZ7A 2RG4A 1MS9A 3G6JB 1HXS2 4CDQC 4N7UA 4CCCA 1W6QB 2QQKA 2VXRA 2XDVA 1C1FA 1D4M1 1W6MA 5AVAA 2XVGA 2VZUA 3O1PA 2WIIB 3IPVB 1W6OB 3H8XA 4K40A 2XR4A 2XMLA 1GZWA 3M3EA 3N7KA 3PTRB 2VQ0A 1RMU2 2KD7A 4XILA 3SCGA 2A6YA 2WYFA 3AXDA 4QX7A 1UYZA 4CCJA 2WS91 4NHLA 5JZGC 1ZRCA 1GKBA 1AYM1 1U5IA 3WEZA 4F7ZA 1GQPA 3GJAA 1ZZ8A 2ZEZA 2RVAA 3K77A 4QKBA 5C3QA 3VN4A 2ZACA 4BXFA 3N9NA 5E6HA 3B3QE 5J7MA 2W68A 5A80A 3H3ZA 1W6QA 3POFA 1KJLA 3MLLA 3R6SA 1OOPC 2R16A 3FBYA 1W2UA 5ERLA 2B4KA 3IPVA 1RJ8A 1RVF3 4CEYB 2XKOA 1G7YA 1UOBA 5J96B 2DFBA 2NPIA 3BUCA 4Y22B 4EN6B 4NUBA 5CFCC 4LPLA 3TEYA 1R093 4GB31 2RS11 2JD9A 2IXCA 2WZPP 2XHKA 1OQDA 5ANNA 2XOMA 1OPMA 3MF6A 2WFPA 3VHOA 4MGYE 3RMYA 3NL1A 4XTPA 5C9AC 1YJLA 3ZSMA 2JDHA 1GUIA 2EXHA 4PLOA 4XBLA 1HXS1 1NCRC 4UWDA 3S6PA 1NKGA 3I54A 2ARCA 4XCAA 4P9YA 1CAXB 5IAVA 4Y22A 2C9KA 2FDFA 2V4AA 1U12A 2VG9A 2A70A 2PQSA 1VBD2 1RMU1 1UMZA 2R0FA 5JIAA 5FZ6A 4AEDC 4KBBA 3H3LA 3VZLA 2ZHMA 4LMFA 2LROA 2J1RA 1CQ9A 2OXBA 3ZKYA 2BNNA 5FY4A 3VHNA 2FCUA 4DOUA 3VZNA 4MHRA 3KQRA 1CIWA 1QJU2 2K2SA 2WWUA 3IWZA 4RGAA 1ST8A 1CAXA 3W59A 3ILNA 4YFWA 1CAUB 2ZGKA 5ABJB 2UWCA 3ZDSA 1J58A 1MS0A 1FV2A 2GN3A 1BK1A 1EUTA 1SEFA 1S0BA 3IBMA 4YW3A 1SCRA 4J25A 4JCKA 2VTXJ 1S55A 3MZHA 2RDQA 4MGKE 3TN93 3VBOB 4EWDA 3DEMA 1LHOA 4MYEA 1DBNA 2J1SA 3WW3A 3BCWA 5FOJB 5C4WC 2YFUA 2WA3A 1HQNA 4Q0VA 1I5PA 4PF1A 5IUQA 1ZBA1 1S0DA 2D7FA 1DGLA 1UNBA 4FP2A 2L9LA 2VOVA 4CCLA 1GR3A 1OPOA 4DRRA 3UKTA 2TUNA 5GZDA 5FZ1A 5ABJA 4GJYA 1OT5A 3EO6A 5G04L 2XVLA 4DXZA 3B9IA 3WCSA 2WZR3 3T0BA 4LHSA 4QB2A 3OG2A 1AJOA 3CU7A 3VBOA 2VZ1A 1NE6A 5AFEA 5T52A 1AYN3 5FYBA 3GHMA 1VAKA 2HWC3 1AUYA 3ZXKA 4EN8B 2IVJA 2JIJA 1OUSA 4ES9A 1JYWA 1JTZX 1DLCA 3MW2A 2PLV2 3HBZA 4I30A 4O65A 2K9ZA 4LUMA 4CRQA 2ZMNA 1W8UA 4Y4RA 2NM1A 3FZ3A 1RUD2 5C8WA 1KD7A 4Y26A 1LNSA 5H9SA 4XFFA 1QJU1 3T0AA 1C1LA 4XQ4A 1P8JA 1GV9A 1H8VA 4MGQA 2BUKA 5CG9A 4D8MA 3GZUC 2HWB3 4M00A 3JBG1 4P9XA 2VOWA 2ES3A 2GC2A 5FPXA 2RM23 3RI9A 3E6CC 2VQTA 4FI9A 2E26A 3RZHA 3POBA 3THPA 3WP3A 4DQAA 4RS5B 5FKBA 3WF3A 5JMCA 1MQTB 3VV1A 5L19A 4FOWA 1UXXX 3N9QA 2VZTA 2WO1A 4YLZA 4RFRB 1E5HA 3SH3A 3O1OA 3TNPB 4OMCA 2O8QA 4CU6A 1DQ1A 3BN6A 4GWNA 4EWAA 3I2JA 1JYIA 4QPGC 4CCOA 1REEA 3TEXA 2RMU2 4QU1A 1LTEA 1E5RA 3RJRA 1KGYA 3OGJA 1ENRA 4JZRA 1RL3A 3JB4C 1UMHA 1E5IA 3BPZA 4A4AA 4EV0A 4HLTA 4D6SA 4E4SA 4RS5A 4M3CE 4QQHA 2VC9A 1YC61 1MQTA 4RA0A 1SFPA 3BTZA 1QMJA 3CZUA 2VVEA 4FPOB 1W9SA 4DNYA 4QXCA 4XUNA 1IHMA 1RUD1 1UZZA 1BK0A 4LKFA 4LO6B 4PT6A 3KGZA 1LCLA 1PVXA 4OHZA 4XF3A 1D2SA 2Q8CA 1HLCA 5EYYA 3POYA 4JKKA 1ULCA 3T2PA 4AAPA 1K5MB 3NJYA 1RUJ2 4GULA 4CDWB 4GWJA 3NRUA 1RITA 2YC4A 3C8XA 4RQPA 4KMQA 5FRAA 5FYMA 1YLLA 2W92A 1PVC3 4O61A 1BJQA 3NAPB 2YU2A 3VD9A 3FLRA 4OHWA 2Y34A 2VCAA 4UBGA 4H7MA 1OH4A 5KC5A 3UT0A 2CL2A 3N7JA 4INDA 5A6YA 5FYCA 2JXAA 5K9YA 4N90A 4A42A 4Z82A 1VAVA 4M01A 5J36A 3CJXA 1UY3A 3P5BA 1PO12 4UFKA 3ECQA 1FNYA 2V72A 5FPLA 4EN9B 1RGSA 2WFF3 2FZ1A 2BBVA 2PELA 3NQHA 2VTXA 3J7MA 4FOVA 2RMU1 1NZIA 4LO7A 1XC6A 3AL6A 2R073 3BVCA 4CDWA 1DQ5A 5GZFA 5HCBA 4QQLA 1H2KA 3VD4A 4YM1A 1JYTA 4XPVA 3NAPA 1RUI2 4HSJA 3WHTA 3JU9A 3MUY1 4WM7C 3WQBA 5IHRA 5JR2A 5F7UA 4QM9A 1F9KA 5CU1A 1YO8A 4NRQA 1JBCA 4XJUA 3WVJA 3W5MA 4DINB 2Y0IA 1DGRA 4LKSA 3X29B 1V6LA 5DABA 3IIIA 1N1SA 4D7SA 2FCTA 4CCDA 1UYYA 2AC1A 5FLHA 1VBA2 4YW7A 2WQZC 2VBDA 2MEV2 1EAH3 5B2GB 1RUJ1 2X10A 3FHIB 1RVF1 3A0NA 1DYPA 1DGRN 4HBNA 5FPVA 5A1LA 2BNOA 2XQXA 3ILRA 3V56A 5FV3A 1KDMA 1Z0HA 2EXIA 1UY4A 3JD72 5BNPB 3IB3A 3BPSA 4IXLA 3URFA 4FOYA 4CU8A 3P1IA 4XUOA 3CBNA 1LOFC 4AEKA 4YZ5A 4CDUC 5C8CB 3FWEA 4MGIE 5FZAA 4C91A 2ZZJA 3OPZA 1ZBE3 4XUPA 1UIKA 1AR92 1LOBA 2G9FA 1POQA 4WVMB 3J4UH 1RXGA 1UPSA 2GNMA 1I6XA 1O4TA 4MXWB 3HT2A 3H8OA 2JDYA 1VBC3 2WO2A 3VZOA 3FHAA 4LBQB 1WLTA 2XUEA 2ZZQA 5FZBA 5C3RA 4XBNA 2PHWA 4YWAA 3C7HA 5BNPA 4FTEA 4IEQA 2BGCA 4RR3B 1XE7A 1IGOA 5KXEA 1ZREA 1G6NA 4P02B 1OMIA 5C8CA 4TZDA 4AFAA 1OSGA 1VBA1 2O0OA 4IETA 4R9CA 4WVMA 1BKZA 2JG9C 2VM9A 5HXMA 2WT1A 1VRH2 5CYYA 2DBIA 4O7XA 3LA7A 2C24A 1KS4A 2VUJA 2BERA 4MXWA 2TNFA 2QZ2A 5HCFA 1BLZA 4LBQA 3WQ7A 4LT5A 2RR13 2GNTA 2RJKA 2JWPA 4RR3A 3LA3A 4AEJA 3TN91 4FTSA 5FZ3A 4XAEA 1J3QA 2HWD2 1V6MA 2W08A 4HK9A 5K7PA 1OFNA 1Q8QA 2ORXA 2XUMA 4J1XA 1WMXA 3KT1A 4PIZA 3FUQA 4FCAA 4DPNA 1YIPA 1EV12 1AR91 5BUVA 3E1F1 2JDUA 4X8NA 4Q4X3 1QH7A 3PLQA 3EBRA 2A7AA 2ZGUA 1GNHA 4Y3OA 3S57A 3KQ4B 5JOXA 1OVPA 4FTBA 4K1ZA 1NCQB 4BB3A 1RB8G 5FY9A 4CCNA 2C1FA 2HWC1 3I49A 4NPRA 5L9RA 2FMYA 2JDPA 2JEMA 2DFCA 4R4ZA 2BW8A 5FP8A 1DZTA 2YROA 2ZAHA 3POJA 4XZUG 3O1TA 5IYYA 1CESA 1VRH1 2WNEA 4QDQA 5FPAA 3BKZA 1NE4A 3JZVA 4I0WB 3SCFA 3UNPA 1VB2A 4TSVA 5E16A 3B5LB 1NCQA 1S2EA 5FZEA 5JDBA 1W8TA 1G9CA 2HKXA 4HPKB 2Y26A 5IATA 1Z7S3 2A75A 3FLTA 1VB4A 4QXHA 4XCBA 1JW6A 2ZEYA 2PHRA 4ZXEA 3CMGA 5EFUA 2A6XA 3RQ0A 4LUKA 3M3QA 1ZX5A 4H7LA 3BYWA 1EV11 2VMIA 3WCRA 1Q56A 2WFF2 2X5IC 1D4VB 1SHWB 3HWJA 4EE2A 2FCVA 5E89A 1TME2 4V1PA 2WQ8A 2VZOA 3M8LA 1PX3A 4LLOA 2VW2A 1AR82 4HPKA 1HN0A 2Z4FA 2JJ6A 2EA7A 1O6UA 4AVTA 4BH9A 5FAXA 1QJFA 2P6HA 5BNNB 1XNTA 2DCZA 1PHMA 2G19A 3PUQA 1IS5A 2PTMA 2A71A 3LDRA 2PAMA 3AKPA 4JQTA 1BBT3 2BFUS 1GNYA 1GP4A 2AH2A 4RQPC 5CEHA 3LB9A 1W8OA 1CD3G 2CWMA 2R062 3RRDA 2J1EA 3OUHA 1W39A 4HETA 1D4M3 1H1MA 1JXNA 2ZHLA 3POEA 4FFGA 2Y6FA 4JGZA 4QHZA 3LOBA 1SLBA 2P5BA 1DDLA 4PQ9A 1WW7A 2A1XA 2IXKA 2YY1A 3O1VA 5FO9B 3BALA 3FLPA 3ZN5A 1LHVA 1AL0G 3ZSKA 1XXNA 4LA2A 1PNGA 3I3EA 4QPWA 3ZXAC 5FXVA 5BNNA 2WS93 1PVC1 1W8NA 2B42B 2UU8A 4B4RA 2ZX2A 1AYM3 1L7QA 4XQDA 1LGCA 1UX6A 4W6YA 3U4XA 3ACIA 2PYTA 1OLQA 2EIBA 4BIFA 2VUAA 3FC0A 4XDOA 5F3EA 3FJSA 4V2WA 3SH5A 3C7OA 2PAKA 2G9ZA 1UY1A 4XJZA 4BLIA 2WFF1 3O0XA 4UFMA 2RE9A 5FREA 1OUXA 3AP6A 3WF0A 1TME1 2Q1FA 1YQ2A 4XVHA 2R071 4K1YA 1R082 3LZZA 1AR81 4M0HA 4ASLA 2MHFA 3ORJA 2D98A 4XFCA 1TMF2 4GB33 2RS13 1UY0A 1UU4A 1UZ0A 2AUYA 4AI9A 4W50A 4L97A 4XFGA 3ABZA 1CONA 4BDVB 1XNDA 2QQWA 1CPNA 2ZMLA 4P14A 5FPZA 5GLUA 3WG1A 3WUDA 1VP6A 5LBCA 4YM3A 2LALA 4XYXA 3J8F2 2WUHA 2Y6HA 4GJZA 4YW4A 2PAEA 4P9LA 4Q4Y2 1HXS3 4A2UA 2DVAA 4XBQA 1Y9GA 3LF7A 3VBRB 1MZEA 2ARAA 2GAUA 2BU9A 1RUF2 4QPIC 2A73B 3JQXA 2X09A 1EAH1 4GAZA 5FBZA 3ES4A 1RMU3 4LULA 5C71A 5JUVA 2ERFA 2JENA 4DIQA 1WMDA 2FMDA 2ZGOA 3N36A 2D6MA 1W03A 4UAPA 2ZTNA 1BQPA 1AX0A 1NLRA 2XL7A 2WWSA 4QX8A 4NIIA 5C6CA 4KWUA 3BOWA 5FZHA 1N1TA 2I07B 3DKQA 2VOTA 3LSEA 4YVWC 5FR3A 1OD3A 3ZFFC 1QNYA 5LA9A 3PUHA 4DS0A 3VBRA 5DUVA 4RHV2 1DZQA 1HJFA 3B69A 2ZXQA 4LJHA 3HPNA 5BNPC 4HN1A 1A78A 1AX2A 4AI2A 3QBQA 1R081 2OKXA 5LBEA 4C0HA 5IW0A 1STMA 1X50A 4KGQA 3VDBA 2RHPA 3WP4A 4DUWA 1ENXA 1WCUA 3J9SA 1YWKA 5IWFA 4GMP3 5FZ0A 1LOCA 2CDPA 1WW4A 5LASA 1HB3A 3KWVA 2W0XA 3UGHA 4NE9A 2AR6A 1F8VA 2UWAA 1NLQA 3TB0A 1H9PA 2OT7A 1PZ8A 1LHUA 5SV8A 2ZPXA 3ZSEA 4XZPA 1QXRA 2Y0OA 3AZWA 3LGRA 2OPKA 3NV3A 2LTNA 5LK5A 1H8TC 4HK8A 5F6KA 4AI1A 1RUF1 4UW6A 2JB4A 3VDDC 2EF6A 1IOAA 2EICA 4AE2A 1GP6A 3RJ2X 1VBD3 3CLPA 5FO8B 4BZ4A 5DZFA 1LOGA 2DUQA 1OVSA 1XE0A 2BWCA 2QQIA 4Q29A 4PDWC 4PJYA 4YPJA 5DQ0A 1G9AA 1DGWX 2RR11 4TTGA 4MG2A 3WZ1A 1QWRA 2OW4A 3LFIA 4CA9A 2ZKNA 4BQ1A 3AP9A 1JU3A 1PMHX 1J3RA 2JKBA 3AMQA 1KFUL 1SG3A 5DAXA 5F3CA 4MSVA 5I8YA 4PBPA 3E6DA 1QJU3 1VALA 4RHV1 2O1QA 1Y9QA 3MIFA 2QQNA 4DEQA 2NQYA 5FMOS 1SPPA 2A3WA 1E5SA 4OCTA 3VBSC 2WNUB 2AZ5A 1MPXA 4Q4X1 4QX3A 3C7FA 4Y5SA 4XOGA 4LEJA 3GCXA 2FDJA 3OGGA 4E27A 2VOXA 3AKSA 2WT2A 2R30A 3KCXA 4JDMA 4MH0E 3Q8AA 1WMEA 3O0WA 2CV6A 3M3CA 3ZYFA 5HCAA 1ZNPA 4YVSC 3PMSA 1X8EA 2GC1A 4P5HA 5FZDA 5T50A 2ZBJA 5BPXA 4HKLA 1JMUB 3ACFA 2PHDA 1KITA 2DVGA 3I97A 3ITQA 4G4FA 3KD4A 4AVVA 3BTXA 5DAPA 3I3MA 4A3ZA 3I7DA 2WNUA 3SEEA 1UOJA 2W87A 4IEUA 3IKWA 2WN2A 5IVVA 1UO9A 3OD4A 3NJZA 4B1LA 1Y7BA 5KBFA 1QJX2 4HKWA 1OH3A 2R042 4LQRA 4ZU7A 2PLV3 1MS1A 1Z7S1 4IESA 2ZJCA 1RUE2 1H0BA 1HDKA 4PI2A 3DUIA 2JE8A 2F6BA 4FXGB 2DYCA 1RUD3 2D43A 4IEVA 5L36A 3K4ZA 3D5OA 3KB5A 4N9HA 2GNBA 2RJLA 3IT8A 3ZO0B 4L99A 3GZEA 2ZX4A 4UFJA 3IDBB 3ZXLA 1ND3B 3U14A 5J48A 4YGEA 1I3HA 3VHRA 4N53C 2VBBA 2F4PA 5IVJA 3OBTA 1GBGA 1KRIA 4RFT0 4LE4A 1TNRA 1YQ5A 1B35B 1ZRRA 3FX3A 4JGZC 4AI0A 4BYYA 3M1HA 5FZIA 2KM2A 5BYNA 4HXCA 4D6QA 2DCTA 3H8RA 1RYYA 4BPZA 5A6XA 4A41A 5KHGA 3JB8A 4BQ4A 3RI8A 1BBT1 2VZRA 3TOJA 5FIXA 2LW8A 4QKDA 4B4PA 2RMU3 1ULPA 1X82A 4R9AA 5FZ7A 1W8FA 2W94A 1XRUA 3AYDA 5EIYB 1UU6A 2VZSA 4NPLA 1UPIA 3KVBA 1H30A 3GHNA 4M4PA 1L7RA 4ZS2A 4AAXA 2ZMKA 3WX5A 2Y38A 4B4QA 5A3OA 2CNAA 2GMPA 4QM8A 2VZVA 4HG6B 1NZCA 4ZXKA 4ZKTB 1B35A 5LBBA 3PURA 1K45A 1YEWA 2QQLA 2ADEA 4XABA 5JPNB 4QT6A 3R05A 4EJRA 3A21A 3HN1A 1S0FA 3NWKA 1DU3D 2XVKA 5AVPA 4AGRA 4BCUA 4CZSA 3I2KA 2ZGTA 1QIQA 4AXOA 1ENSA 1W2AX 2WBKA 2CHHA 5FMCA 4K8RB 5L7OB 4MUVA 4X6QB 2ZGQA 1LEMA 2BEOA 4M3CB 2QVSB 1OC1A 1RUJ3 1YQCA 1W6OA 3DN7A 1OURA 4TLGA 4YG0A 4AHWA 2W91A 4A7KA 3PU3A 4IV1C 3V64A 5LW9A 5IK4A 5CG8A 1VRBA 3U0ZA 3UJQA 4JTOA 4WM8B 3OEAA 4DRVA 2VJXA 4DXSA 1VE0A 4QX1A 5LY1A 2PHUA 4Z1VA 5EP9A 1Q8SA 2EIGA 1AL22 2QQPA 3LCPA 1PO13 4W6WA 5L7OA 3RYRA 3WHUA 3BIWE 1JYCA 4ZONA 1JZ5A 1C28A 1ND2C 3DCQA 4FFHA 4KWJA 3J26N 3LSDA 4M3CA 4PIYA 2PN5A 3ALQA 4LIUA 2QZ3A 4YSFA 1ZYBA 4UOJA 2EAAA 4CEYA 3WG3A 2ZX3A 4FPYA 2WR9A 1RUI3 3ON7A 5EWSA 4WM8A 4HONA 3MIDA 4JDNA 1NY72 2VNVA 1GWMA 1NA1B 3DPRC 5DUWA 4AGVA 1HQWA 4DUXA 3ZYGA 1POV3 1VMFA 2VH9A 2YDEA 1EUUA 4U36A 3CJIB 3B02A 1RUG2 4BQ5A 3N7LA 1QEXA 3MIBA 3C7EA 1WCQA 1R1A2 4XE9A 4QDSA 1VBA3 4Q27A 4UW3A 4QX5A 2MEV3 5JXGA 1H2LA 3QCWA 4RYDA 3ZYBA 4NAOA 2E63A 2BTVC 2C6SA 3KT4A 3IAQA 4HKOA 5L73A 1OLRA 4CUBA 2NMNA 3OEBA 2NZ9A 1W2OA 2HBTA 1HB1A 2VECA 1NA1A 3CQOA 2QDRA 3HQUA 3WNXA 3MEPA 2YV8A 3HEIA 4CCMA 3UL2A 3H1WA 1BXHA 1HIXA 2ZOEB 3CJIA 3D0SA 2VW0A 3JD73 4GMP1 1WLWA 3SLIA 2NMOA 4CPBA 4E8CA 3RDIA 1IPSA 2GALA 3NKTA 2V09A 1IS4A 1DQ0A 1MACA 2V4VA 3AM2A 3UJOA 4GMP0 4DMIA 3ACLA 2J1AA 4GH4B 4LIVA 5CKMA 2WAOA 1AR72 1GU3A 1AR93 1LKNA 3MW3A 1DCSA 4AWDA 4DZGA 4I3PA 1ULDA 4IV3B 1CAUA 1JZ6A 4AVSA 1JZ7A 4S2FA 5JXJA 4HVOA 4JKMA 1J3PA 2P4EA 3DXUA 3NSTA 3T3YA 2GH2A 4SLIA 5FP3A 1N3OA 5JOYA 2OYZA 3WW1A 1VBD1 1NY71 1C8NA 2VZ3A 4L2NA 4BQ2A 4DB5A 5LEKA 3AFKA 1CZSA 1OF4A 5GLVA 1W6NB 1W0PA 1XSQA 2BOJA 1QOSA 3I2DA 1RUG1 4R9DA 5LATA 4YZ2A 1V6IA 3IM0A 4FPFA 4FVVA 1ZM1A 5JWPA 4GH4A 1R1A1 1F15A 3S5QA 1LULA 4XUTA 5DG2A 5T5PA 2GMEA 3VUOA 4IV3A 3O7OA 1VRH3 4XXPA 5FY8A 4JHTA 3NNJA 3WOGA 2K46A 5C70A 3A23A 4QXKA 1O4YA 1XU1A 3AB0A 2QQMA 5F8PA 2Q8OA 2PHTA 1QOTA 3H7YA 3KV4A 1WGPA 2GZWA 4IGQA 3AJYA 2ZX0A 4CUAA 4ISRA 1LESA 3AL5A 3RYPA 5J3UA 2J1TA 1SFYA 1W6NA 4CVUA 2HWD3 4Y4YA 4K3UA 5FWEA 5A7WB 4JAAA 1GMMA 3ZLIA 3DXTA 4IGOA 4MADA 3NJXA 4A3XA 2ZEWA 1X9PA 3GZTB 2Y6JA 4NMIA 3PL0A 5E1RA 1IG3A 1AR71 1EV13 3IMMA 1M4WA 3ZVXA 3ZR6A 4KH9A 3LEKA 2UY8A 4URAA 4N43B 1PK6B 2XXZA 4FOQA 1F4AA 1Q43A 4HFSA 4PHZA 5D8AC 2CGNA 4OQ9A 2ARXA 1GZ9A 2JG8C 5KWRA 1PZ9A 1QKQA 4YW2A 5A7WA 4MX3A 2ADDA 3ZN4A 5JSPA 4ITCA 3VLBB 2P3IA 3G7DA 2PLV1 2YG0A 4K8FA 4K9SA 5JIUA 2AACA 2HEWF 5LEJA 5FPBA 1DYOA 1HW5A 3GXUA 3QOPA 1LODA 5LZ6A 5I8TA 4XUQA 5GLTA 1W28A 2E32A 2BP6A 3MBWA 5L9BA 4AQ2A 4IE5A 5LA1A 4FT8A 4NHKA 5FCCA 1U5YA 1O3QA 1PK6A 1C8M2 1OQEA 1TE1B 5LK7B 2W95A 1T6BX 4D6RA 2DDUA 4AQ6A 4A44A 3BIEA 3MLKA 2IVIB 1QQP2 4P00B 3DYMA 3JXSA 2FDKA 1W99A 3GJBA 4YW6A 5I93A 4Q0PA 1VPHA 3I4IA 4MO3M 5FMOL 5T5OA 4JQRA 1W9FA 4YW5A 3NV4A 3WNNA 4ASMB 1JZ3A 3ZIWA 3MV01 4GD4A 4YW1A 5DAQA 5IVCA 3V65A 5K0UB 1RUC2 2YU1A 3WP6A 5AC92 5EJ3A 2I2SA 3H9AA 5FP9A 4N8MA 1B35C 4ET7A 3E6BA 3B7MA 5D2AA 2XQRA 4FFFA 2A6ZA 1VBB2 3Q8FA 3PVEA 1TME3 3HBKA 3LA2A 5C3OA 1K5MA 4AYUA 3K48A 3C2UA 3MFAA 1AR83 2B46X 4FPKA 4XTMA 3ZN6B 4ZHNA 3MI8A 5IJRA 2Q0AA 2AREA 2YMZA 2XJPA 1O7FA 3M7AA 1S0EA 4HSLA 4J1WA 2BGOA 4GWIA 5JI9A 3M4FA 1F31A 3EHKA 4I01A 3AP5A 4EN0A 2R063 2D5HA 1A6CA 5IK8A 2SLIA 1S2BA 1JYXA 5FZKA 4D0QA 3W21A 4IE4A 1VMJA 2TEPA 2QNKA 2Z5WA 3I3DA 1M06G 3K4AA 3TYJA 1QQP1 3RZGA 2ZHNA 2VMGA 4DXRA 4BMBA 5L7OC 3TRSB 4EN7B 1K3IA 3EMRA 1QU0A 2UYBA 4W6XA 1V6OA 3EYPA 3PDQA 5A6ZA 3O1RA 4FQZA 3M70A 1MZ5A 2BJSA 2VZPA 1ZA7A 3N35A 3SQOA 4CEYC 4BHPA 3L2HA 1NG0A 3ES1A 1WBFA 4KGGA 4NROA 1MS5A 2A3XA 1SLLA 2W3JA 5DUUA 4BQYA 3PJQA 4ZZ5A 1AJKA 1CIYA 1PO11 3PVNA 5DN2A 2J7MA 2JKXA 1JOPA 4MZUA 1SBEA 1QY4A 5JI7A 4XMIA 2VULA 1HV1A 1O4ZA 1S0JA 4EZHA 1R083 3VKNA 4XIOA 2PFWA 2TBVA 3SC7X 3ZFGB 1RUH2 3D0JA 1SBDA 1TMF3 5DDJ2 3WNLA 1CWPA 1A3KA 1IQDC 1DQ4A 2FD8A 4RN5A 2ZABA 1RUI1 1UKGA 3IDEA 1REDA 1JS9A 5FPUA 1S0IA 1WKYA 4EYUA 1OHFA 2LRPA 1BVP1 5FZ8A 3BOPA 1POV1 3J8F3 2RS32 1CAWB 2OZ6A 4GQ7A 2QQJA 3I59B 4Q4Y3 5FK7A 4ONUA 2J1UA 2P6CA 3ENRA 4C0BA 1POV0 4CEWB 1RUF3 3THCA 5D1IA 4XJ8A 3T1MA 1WCDJ 3ZFGA 4I2OA 2MEV1 5A3TA 1TQ5A 1FI2A 3ZM8A 4S2HA 4C1WA 4GKXA 4OYUA 2Q8EA 1GSLA 4NHMA 3LIGA 4LNVA 3LEMA 1PMIA 3GALA 4AQTA 5IK7A 3WT3A 3ZXJA 4CP9B 4HN0A 2VCCA 5ABJC 3KF5A 3JQWA 2WNVB 4LLFA 4QPYA 1GFF2 2ZX1A 1CAWA 3A7QA 3MUZ1 3I59A 5IVYA 3JD71 5FOBB 2QDNA 3VBFB 2VNRA 2B5HA 2GN7A 2CWSA 3OBAA 4RHV3 3RG0A 3VBOC 3HVDA 4CEWA 4JTNA 4OULA 2W46A 4E4DX 2RS52 1YI7A 4Z07A 3TWIA 1FXZA 2CTVA 1OLMA 2OS2A 2RV9A 1QXPA 3ZXGA 3RZZA 4YRDA 1EPZA 4HMZA 1RUH1 3WNMA 1WCKA 5DDJ1 3R4DB 2PQQA 3PIGA 2EXKA 1IG0A 5IAXA 1GYKA 1UW8A 4FFIA 1VLNA 2HWF2 3D3AA 3GBFA 3CL1A 4CP9A 1W3XA 4OFGA 4AHXA 1TZOA 2WNVA 5CKQA 4YFZA 1JH5A 2A6WA 2E7QA 2HLEA 5GKAC 2ZHKA 3VBFA 4CXXA 2BBAA 2RS31 2XLGA 3GM8A 4Y1YA 2FQPA 1XOYA 2I45A 2VU9A 3F95A 3PJYA 5CZKA 5FXXA 4CU7A 4RGKA 2A3YA 4BLJA 4LBMA 1OA2A 1K5JA 2Y6KA 4AZZA 5C3SA 1VJ2A 3PIJA 4WV8A 3NO8A 4JGYB 2DUOA 3WXPA 1W0OA 4MVTA 5IVBA 4XFIA 3MW4A 3N4MA 2NN8A 3RFRA 5FO7B 1NAEA 1XYOA 4Q8KA 4ASKA 2VMCA 1K12A 4CDXB 3SHRA 1VMHA 2HWD1 5I91A 1WW5A 3ZXFA 2ETEA 3AP7A 2DWRA 3U78A 3J7LA 3UESA 5JMOA 2IFRA 4RS5C 2UY9A 1ONAA 3HR9A 2RS51 3PVOA 3ZYHA 3TEZA 1WW6A 5CFDB 1MQTC 2H0VA 4JGYA 2G1MA 1GP5A 4B1MA 3A0KA 3R0RA 1W3VA 1G9DA 1T2XA 4CXYA 3AK0A 3S7IA 1U5XA 2P17A 2HWE2 1XNCA 5H9PA 4AFMA 4XIKA 4CDXA 4RGGA 4D7TA 2IFWA 3N9MA 2V73A 3WW4A 1V6KA 1YFXA 3I2HA 2BQPA 4JKLA 4LORA 1G9FA 3PMEA 3IN9A 4PF5A 4AW7A 5E88A 4AGGA 1UYPA 1ODNA 1I5ZA 5CFDA 4AL9A 3NW4A 1UZYA 4QB1A 1KEXA 1WD3A 1EY2A 1SDDB 5DXDA 1MR5A 3ZFEB 4QQOA 3VKLA 5FYIA 3DL3A 1WA6X 4ES8A 4YM0A 4XURA 5DAWA 2WLQA 5DUXA 3ZR5A 1UOGA 1BCXA 2O8OA 5IT6A 1CZVA 3NNGA 2PHXA 4UBHA 5FZ9A 1QJX3 4XXAA 4KBZA 2R043 1W0NA 1H6XA 3VBHB 4HT1T 4A6SA 3MFCA 2H6BA 1RUE3 2DU0A 2XH6A 1BYHA 4JV4A 4ATEA 1K5MC 4CDQB 4CDWC 4H3WA 3H50A 3HJRA 1AX1A 3RVHA 3NAPC 4FO9A 5I0TA 4XDQA 3AC0A 3CO2A 3ZFEA 4AG4A 2DCKA 4AQSA 1WLCA 1OKOA 1UMIA 5FP4A 2HH9A 2JDZA 2Q1MA 2Z69A 4KWLA 2NYYA 4OLLA 5JZGB 1AHSA 1JUHA 3POSA 3SKVA 5CB7A 2EIEA 2HWE1 5KC6A 2UURA 3VBHA 3PTYA 4W65A 4RD7A 5F2WA 2Y33A 4YNIA 1YNAA 3CHXA 3TBDA 1LAJA 4CDQA 4QHOA 3GF6A 1DF0A 2VD7A 2V5YA 5EYXA 3ELNA 4XQWA 5FYZA 4AVAA 4BQXA 1OOPB 4BU2A 4ARYA 1SBFA 3BODA 1UU5A 3K4DA 3ZSJA 1D7PM 3W5NA 2R061 3ZMNA 5FY0A 3O14A 3PUIA 2V5DA 3OF1A 5J09A 3BI3A 3I3QA 3CNAA 5CFCB 2DUPA 4DY5A 2WSVA 3CF6E 5JZGA 4RL7A 1BEV2 3GBWA 1UWWA 4PIXA 2DVDA 3NMBA 4PI0A 1DQ6A 3LWCA 1PGSA 2MNGA 5BNQA 1ULEA 2YYOA 4QX0A 4I3GA 5C9AB 5DPNA 1OOPA 4BISA 5F3GA 2C26A 2BWAA 5M0TA 1NCRB 2W47A 4K20A 4OUMA 4FAGA 3LE0A 3HOBA 5FUIA 4Q4V2 1AVBA 4A7ZA 1DLLA 1DZRA 2Q1ZB 1ULFA 5HXVA 2Z79A 3USUB 3W58A 5CFCA 2LUWA 3I2IA 3LIHA 1JZ8A 3B94A 3APBA 5FXWA 3GGLA 3T0DA 3K2OA 3BTYA 4OUEA 2RDSA 1GOHA 3E5XA 3KVAA 4XAAA 5C8CC 1ALYA 1NOVA 2GC3A 1TMF1 5C9AA 5FDBA 5C33A 4GA9A 4LBLA 1NCRA 1Y4WA 2DCJA 1AL23 2JE9A 2WNOA 4NWWA 4F8AA 5F32A 2RJ2A 2P3JA 3UV9A 1X7NA 4KQ7A 5A3MA 4HVRA 1KS5A 2WL1A 4EWEA 3ZX7A 5T5JA 2WYSA 3C7GA 4M4RA 3J8F1 1WUVA 3USUA 5ACA2 2JIGA 4Q4Y1 4U2AA 4XF0A 5EPAA 1EP0A 4COUA 5BV6A 2DBNA 3D8CA 3IIAA 1S4CA 3U4SA 1GWLA 3OCPA 4RR3C 5F5AA 3AZXA 4XC9A 1BEV1 2R1BA 2P2KA 4LR4A 2D44A 2FZ2A 2P37A 2XBO3 1O3RA 5H9QA 3RWKX 1R1ZA 2IC1A 5JSOA 1V9U2 5C4WB 2C9AA 2HYKA 3H3UA 3T2QA 1V6JA 3WDYA 4HANA 2AENA 5FUNA 1LR5A 3WDWA 3KV6A 4Q5OA 1RUG3 3FN9A 4KU7A 1HRI2 2W39A 1R1A3 1IZ3A 1HQLA 3WG2A 3N9PA 4Q4V1 2YPDA 4YGCA 2K0GA 5JLVA 5FXZA 4NIGA 3N9OA 1XU2A 2RDNA 2R0HA 3AFGA 5A3LA 2YBKA 3H7JA 3LAGA 2VUCA 5FLJA 1NUKA 1VBE2 3AYAA 5KHIA 4WVZA 2E7AA 5H9RA 1FT9A 1COV2 5C4WA 3ILFA 2PHLA 3H1YA 2IXJA 5KR7A 4AVBA 4QGNA 2BPA2 5FYVA 1RC6A 1WCSA 1ASJ2 1D2QA 4XEZA 2XL9A 3CEWA 1YXWA 1UX7A 2DV9A 3WNOA 4YGDA 4D3WA 1PGL2 4QGMA 4B29A 3S7EA 1OKQA 1XSRA 1PMJX 4LBOA 4AK3A 1NCQC 5FFOC 3O5SA 1AR73 3ACHA 3HIFA 1PGW2 3VGIA 4I09A 4E2GA 1BMV2 2WRAA 2D40A 3WR0A 1O3SA 2YXSA 3U37A 1XNKA 3UKVA 1YQ6A 1NYWA 1JZ4A 3R4UA 2Z2SB 1ACCA 2VUDA 3MV11 4GIQA 4MGSA 1W8WA 5FYHA 3T1LA 1V9U1 2VNGA 4BOWA 4CP0A 2W1WA 4AI8A 3RSJA 4G3YC 5FWJA 3WG4A 3ZXDA 1CJDA 4B7KA 5EQUA 4C8DA 4CSWA 5EZWA 2D97A 4FPJA 4XFAA 3FFQA 4FAHA 1BVVA 4AFDA 1JYVA 2W2IA 1FV3A 5A33B 2QTWB 4QPGB 4D94A 2DU1A 4UT5A 2XHNA 5I0RA 1YFUA 3QACA 4K7JA 1JYNA 2EVXA 1PX4A 2VVDA 2GDFA 5FQ0B 1SQ4A 5F39A 4UFIA 3CKHA 4BWOA 3LQCA 4I02A 4MGZE 4NHYA 1COV1 5LRSA 5JPMB 4E4ZA 3WQ0A 2DVBA 1QNWA 1X36A 5JVVA 4K6BA 3OD0A 3EB7A 2YC0A 5JAXA 5LBFA 3O1UA 1WA4A 4YGBA 4LK7A 4NJ4A 5KHKA 3GNEA 1F2NA 4S2DA 4QPGA 5A33A 4H2AA 1J1TA 3NNMA 1H1AA 3ZPYA 4E2QA 3KV9A 4D7YA 3WDUA 1LJ7A 3ZYIB 1OI6A 5CIRA 2QQOA 1U0AA 1PGW1 2P1BA 5FQ0A 4CUGA 2KR2A 3UKNA 1BMV1 2ZGPA 1XNAA 4NIAA 2WO3A 1UIJA 5BNNC 1REFA 1ZZBA 5J37A 1H4HA 5FJKA 3RS6A 4GWMA 4AOCA 2NP0A 1ND3A 3ME2A 2OIIA 2E7TA 4HVQA 3EJKA 2A5ZA 1LOEA 4PLNA 3OY8B 5DZEA 5I0UA 5J98B 4Y1VA 3VKFC 4XW3A 4P9WA 3M3IA 2X29A 5T3NA 1QJX1 1JODA 1GZWB 2AEYA 2XJRA 2R041 2VNOA 1ZZ6A 1NQDA 1G9BA 5FMDA 1IS6A 1H4GA 1UXZA 4P9JA 2ET1A 3LPGA 1MEC2 1PZ7A 1RUE1 5FTTC 5JSRA 4XJWA 4QWNA 4ZPIA 1PM7A 3LDBA 5IVEA 4Q1PA 1IPJA 1TG7A 1LOAA 3MPBA 3H1MA 1C8M3 3K46A 3Q8BA 3W9AA 4S2GA 5K4LA 3I2OA 1E57A 3IMNA 4WM7B 1HRV2 2GSYA 3OY8A 1QQP3 5SV5A 3T2OA 3FBMA 5EXOA 5FYUA 2WT0A 1Y43B 5B4NA 4LE3A 3I8TA 3MIHA 1H9WA 3RZKA 1FOD3 2DURA 3AZYA 1YJKA 4UFLA 1WMFA 2XLAA 2PHFA 5FZLA 3O1MA 3MIGA 1YCIA 3O12A 2WC2A 3A4UA 4QGLA 4IUGA 1RUC3 3PHMA 1X33A 3OYWB 4DXTA 4TLFA 4UW5A 5AC93 1RUOA 2FDGA 5F2SA 5IVFA 5AFBA 1VBB3 5FKCA 3AZZA 4WM7A 1XE8A 2WJSA 1UY2A 2YBPA 1F35A 1XNBA 2H0BA 2WA4A 3DV8A 3EXUA 3ROUA 1JUIA 2JX9A 2OX0A 3A22A 3K3NA 3J7HA 2IZWA 4UI9L 3AJZA 3ZIXA 4QMAA 2YFZA 1Y9MA 2BFUL 3OOXA 2OUJA 2XBO2 3NKGA 1CX4A 1US3A 4JHZA 4GXLA 3IZOA 1O91A 3VBRC 4EROA 1AR62 4FPLA 2D6OX 5ISLA 1QXJA 2ZGMA 5CNAA 1PO22 1S0CA 2QKDA 4LBQD 4NHXA 3ETQA 1UKRA 3AKRA 1XB9A 1QJY2 4OMDA 2YGLA 1MEC1 4CDUB 5EJ1B 3OYWA 3HNBM 4IEPA 1O5LA 3UYJA 2EALA 1D0GA 1ZZ9A 1ZBA2 3INAA 2F17A 4Y1ZA 4JC1A 5FY7A 5ANQA 3SEPA 3SH4A 2A6VA 4CP1A 1HRV1 1US2A 3UGFA 4Q1RA 2P3YA 2GP5A 5LRRA 2DF7A 2SBAA 3VZMA 4F3JA 1ODMA 5I8SA 3NJVA 3RNSA 2D93A 4IE0A 2W1UA 2ZCWA 3HT1A 1LOFA 3BU7A 4YYOA 4CDUA 1YYNA 2D6PA 4Y5TA 3N9LA 2XG3A 3AVSA 1FMD2 1AL21 2JG9B 1RHI2 2JECA 4L8QA 5FZOB 2KXLA 4QXBA 2B8MA 4NIHA 5F5QA 3EQEA 2CAUA 4DO0A 4KWKA 1W9TA 3SKJE 1QOOA 2B39A 2ZGNA 4ZS3A 4COWA 1K42A 3OJBA 1RUH3 5DDJ3 1A8MA 2R7EB 4OZOA 2XBO1 3HNMA 3JBG2 3WP5A 2VE1A 1XPWA 1A34A 1AR61 2I74A 2N7GA 1JN2P 2ID4A 4QQPA 1PO21 4Y5Z0 5GZGA 3BGAA 1RTVA 4BIOA 1QJY1 2ARBA 2ZKLA 2PMWB 5BXXA 2JG9A 4QKFA 1W8ZA 2ATFA 3WD5A 4ZZ8A 2QFEA 2RS33 5FZOA 1W6PB 3WINE 3ZDVA 5T5LA 5GJ6A 3K3OA 2BOIA 4IEWA 2ILMA 2VY0A 1APNA 3RZMA 3KHCA 1W90A 4O9GA 3ETPA 3Q8CA 2IWGB 3V0BB 3KM5A 1C3HA 2OPWA 3AXEA 2YGMA 3NV1A 3OTFA 3VD7A 1TNFA 2E6VA 4Q8LA 2LS6A 1DFQA 1L7LA 3D6EA 2GP3A 5HBAA 1ULGA 3AP4A 4NO4A 4L0PA 2YBSA 4XHXA 5CADA 3OUJA 4LO5B 4LA3A 1W6PA 2XJVA 2WNUC 2XJUA 4R9BA 4Q2FA 5GM0A 1FMD1 1H2NA 5JOWA 1L3JA 1RHI1 1U5ZA 4BQ3A 4MXVA 4IERA 2VMEA 4X8PA 4R8HA 4KG8A 3WUCA 4E2SA 1GANA 2NLRA 4LHNA 4LOSA 5FJHA 5C5UA 1CR7A 2RS53 1CN1A 3V0BA 1KXGA 3DGTA 1LGNA 2VMHA 1KFXL 3OUIA 1NX9A 1FPN2 1QDOA 4MOAA 1F5FA 1LHWA 1OBNA 3WDTA 3WW2A 2AGSA 2HWF3 2OZJA 2HJIA 3SXWA 3POGA 3VZKA 1UCXA 4B8EA 5A1FA 2QE3A 5FY1A 1LRHA 4HL0A 4A6OA 2B7YA 4HZFA 4QDRA 3WF2A 3F2ZA 2E53A 4GZ9A 2CGOA 4R4XA 2WN3A 1PIV2 2HBUA 1HB2A 2X5IB 5FYTA 1SLIA 5KXDA 1O3TA 3T08A 4LO4B 5A7QA 1FYUA 2FDIA 4P9GA 4PQQA 1SMVA 2IXIA 3OPTA 1B09A 2FHRA 1SZBA 4N43A 1GOGA 1TVGA 5A7PA 3KHBA 1LB2A 1SLCA 2WZ8A 4NIDA 2AEZA 5BY5A 3E5UA 2WLPA 5GLWA 2CU5A 4Q0QA 3WDXA 4COYA 4I0AA 1JI6A 5T54A 1SACA 2GC0A 3C3VA 5DMYA 4RQPB 4DEVA 2G9GA 3QH6A 1FOD2 4RSUA 1FX5A 3V0AB 4TYSA 4CE8A 1ND3C 2D3SA 5DAVA 2X5IA 3MO4A 2H6CA 1XJAA 5FP7A 2JDKA 4M3CF 4A7YA 5LY2A 3T30A 3RZLA 4QB6A 3PUSA 2O14A 1IPKA 2VAUA 1QH6A 1DGWA 5HV4A 1CGPA 3SCHA 3GZAA 2VW1A 2OVUA 2R32A 2UYAA 1FPN1 4FPEA 1AXYA 4DUVA 4Z2AA 3Q9OA 2HWE3 1RVF2 5KHJA 3FL7A 5CA6A 1JZ2A 3V0AA 2CY6A 2XKPA 3ASIA 2VMFA 1OF3A 2W1QA 5CVRA 4CXWA 1O8SA 4XF1A 2X05A 2GU9A 1R092 3HMYA 3U1XA 5JXIA 2IXHA 3K51A 1I1EA 2Y6GA 1PIV1 2D6LX 2E51A 3DKWA 3T2TA 2BDRA 5A6QA 1YI9A 3CIHA 4B3NA 5K0UA 4O9EA 3WNKA 4META 2QQUA 1VR3A 4LKDA 1CAVB 1YIFA 3SNMA 3HN3A 1SLTA 4TN7A 5LB6A 1X8MA 1W04A 3DF0A 1GOFA 1ZA4A 3ZXEA 1C8M1 1UN1A 4NN0A 5GALA 4GKYA 1F5JA 4BJ0A 1AZDA 2R6QA 5FK8A 3ZN6A 5KHHA 2Y64A 2X53S 2ZGRA 2JD4A 2VO5A 1H1IA 3KSCA 3LDKA 5CBLA 1I9RA 4QAWA 1FOD1 1ZRIA 2C4XA 1W8HA 2JDAA 3VKMA 4ARXA 5HV0A 2BRTA 4FPHA 4LBJA 5A7NA 1DIWA 4IL7A 4Q26A 3H42B 4QPIB 1CAVA 1RUC1 3ATGA 3PNAA 4WM8C 4AI3A 5AC91 5BNOB 4LKEA 4R52A 1MVQA 2HEVF 3H8UA 3HD8B 3CDZB 2OQ6A 5FY5A 4WZCA 3LD8A 1VBB1 3QLQA 4LHLA 4WZFA 2Z42A 3SISA 4BA6A 5A3PA 3HQRA 4IW3A 2G4IA 4FQ4A 4IE6A 4P9IA 4OI1A 2DCYA 4YVWB 5FZCA 1RJ7A 3ZFFB 5LA2A 1MZFA 1R091 1N1YA 4NWVA 5JR7B 2XGXA 5A3WA 3TN92 5C7GA 1EYBA 2VMDA 1YUDA 3AKQA 4QX2A 1ZRDA 5BNOA 4OVEA 4QPIA 2QJVA 1UOFA 1QDCA 1MS4A 1QF3A 3AYCA 1NT0A 3FFZA 4XDPA 3T09A 4B7EA 1NA1C 1LECA 5IFPA 1YRZA 3IDAA 3VL9A 3OB8A 4UW4A 4OHYA 3OSDA 3WF4A 1BEV3 1N3QA 3CJIC 1AXKA 1GICA 3KV5A 2E33A 2XJQA 2D3PA 3Q8EA 3PVBB 4PLMA 3NNLA 3KMHA 4YM2A 1W05A 4CU9A 5A3UA 4YVWA 4WVWA 2YPJA 1GZCA 4MHUA 3ZFFA 4BXSV 2WZR2 2GH8A 1NQJA 2ZS6B 3TEWA 3HNYM 2WKKA 3PU8A 4NRPA 4NRMA 1J1LA 2VCMA 2JE7A 1C5IA 2P34A 4YZ1A 1AYN2 1R64A 1UZVA 2OA2A 3MF9A 5LCWL 2HWC2 3GBGA 1H8TB 4OHVA 5FZFA 4Q4V3 2HEYF 3MGUA 4Y20B 2IUWA 2D6KA 2YC2A 2ZA9A 4NOTA 3VDDB 1IS3A 4PBOA 4W4ZA 1GLHA 5F5IA 3J7NA 1LU1A 1O59A 3R4SA 1GNZA 3OBZA 3DYOA 2J1VA 4PDWB 1LEDA 2EAKA 3VD5A 4FBFA 3S0MA 5KXBA 4AVCA 1XYPA 4C1XA 1JU4A 1MZ6A 4GH4C 2BYVE 2D3RA 2HWB2 1JHJA 5FYSA 3JUUA 5A1AA 5JCTA 4Y33A 3LEIA 4IV3C 2RM22 1CVNA 1W9WA 2GNDA 4AFBA 2UWBA 5FLIA 1H8TA 4Y20A 3VDDA 2YHJA 4AHYA 1UD1A 1C57A 4LXLA 4YG3A 5ACA3 3VBSB 4H14A 4EQVA 3ZOIA 1SLAA 3K75B 4Z92B 1AXZA 3WQ1A 4CUCA 4PDWA 4CCEA 3JCIA 3QH7A 3B00A 4E9KA 5GZEA 3DECA 4KG0A 2WQ4A 2W5FA 2D5FA 1YFYA 1V9U3 4GALA 3U07A 4NVPA 3S5AA 2ENRA 4YVSB 3NNFA 3AMNA 4K21A 4OUSA 5LA0A 1IKPA 2WZR1 2VXJA 1WZXA 3MLJA 4Q0SA 1GZTA 1AYN1 3MHZA 1HRI3 3LEGA 4IE7A 2IXLA 3P3NA 1QHDA 4LITA 5FZ4A 2Q8DA 3TNQA 3VBSA 2XJTA 4AEMA 1XBFA 1NXD1 4AHZA 2CAVA 1UAIA 3M3OA 1DP0A 5A32B 1Q8VA 1LHNA 2Y8KA 1VBE3 3RMXA 2C5DA 3AMHA 3GCWA 3I3BA 4M0NA 5A7OA 3TAYA 1NXMA 1O5UA 1COV3 1BZWA 4FPCA 4QKNA 3ZYRA 4H55A 4YVSA 5TSWA 3LPFA 4ZU4A 3WLUA 1ASJ3 2HWB1 2PA7A 5DZGA 3RPQA 5GLZA 4MGTA 1D0HA 2HWF1 4OZXA 1HV0A 2RM21 4D69A 2QBXA 4YARA 4N43C 1N47A 1PK6C 1LU2A 1PVC2 1HJGA 1G8WA 4Q4W3 1OA3A 4BMEA 5A32A 1HN1A 3MICA 5CKNA 1URXA 1S0GA 1O8PA 3KF3A 4NPMA 4N53B 1UYXA 3AKTA 4LO8A 4JVAA 4A45A 3VBUB 2VR4A 2JDMA 1RUNA 1DHKB 1TEIA 3WY6A 1YFWA 2R072 3KCCA 4JGZB 2XWBB 1OFSA 2JDNA 4J6GA 2XWJB 4ATFA 1KDKA 5CISA 1W9YA 2BVVA 1OA4A 2MPFA 5FZGA 4BM8A 1WD4A 4QQ2A 4OHXA 1J84A 3KT7A 3BTAA 2RDRA 4QU2A 4XF4A 4N53A 2WDBA 1C4RA 1J59A 3VBUA 2FBEA 1UQXA 2VBPA 3GYDA 3SITA 4FP3A 2B9VA 3AVRA 3LKJA 4UF0B 3THDA 2QCSB 4KNCA 5K0UC 1DG6A 1EAH2 1WLDA 1FAYA 3FE5A 4AR2A 5B4XA 3KLSA 1VAMA 4TXWA 4E4HA 4YZ4A 4ZY9A
chains in the Genus database with same CATH topology
2ZGLA 4C90A 3AYEA 4CP2A 3ST7A 2OUHA 2DTWA 4XETA 1DYKA 2AYHA 1LENA 4XFBA 4XMAA 4WVVA 2CGPA 3H0OA 2E9QA 4IV1B 4OI0A 5GZCA 4AFCA 1Q8OA 4CTEA 3MYXA 1ZBE2 1V6NA 2DTYA 2XPJA 1MVEA 1HKDA 4KU8A 4L92A 4LBKA 4QHBA 1N1VA 5T55A 1VBC2 1MEC3 1ND2B 1KJRA 4Y1UA 2R49A 3B9CA 2C0ZA 4L11A 4MV2A 3NVCA 3U11A 1VIWB 4PCRA 4IV1A 2JICA 4G9SB 4ISQA 3MPPG 3QD6A 4URTA 1Q3EA 1HRV3 4X6RB 4OI2A 4TWTA 1Y3TA 3N7MA 3DPRB 5BNOC 4AEDB 3N3HA 1ENQA 4FXKB 4IEZA 1SCSA 3AMPA 2XLFA 5KXCA 4XJ9A 3VKOA 1S1AA 1ND2A 1H2MA 3POWA 1AF9A 4FSJA 2RR12 3HQXA 2YZ4A 2ZAAA 2Q4SA 3ZFGC 4Y24A 4MLOA 3AMMA 4WBBA 1N3PA 4XJAA 1RINA 1GQGA 2QUOA 2XJSA 3WDVA 2ET7A 3DPRA 4AEDA 1CJPA 1ZBE1 3KGLA 1DQ2A 3KZ4C 4Q4X2 1AR63 1XQNA 2VOKA 3B93A 2X8KA 4LTAA 4CEWC 1PO23 1QJZA 1VBC1 3U10A 1QJY3 3KS7A 1OQ1A 1ZRFA 1ZBA3 2WSUA 3D82A 2ZGSA 1ZZCA 3E5QA 4YZ3A 4COVA 1EPWA 3OBRA 4BE3A 2Q30A 5I0SA 2WNVC 4Y1XA 4IQPA 3ZMOA 1C5HA 2GMMA 3P3PA 3VBFC 2BVBA 4JRAA 4N9IA 1UF2C 2CYFA 4LBNA 4CYDA 5DG1A 3ZSLA 1FMD3 5JOZA 1MS3A 1GQHA 1RHI3 4JDOA 1Z7S2 3KCYA 3S30A 3AX4A 4Q4W2 5ACA1 2DVFA 4OI4A 4XF9A 2YUEA 2LM3A 2EXJA 2B9UA 1OD5A 1ZVFA 2BNMA 2VQAA 3D4KA 4DY3A 3NV2A 3VHPA 3JBG3 4ZU5A 4Q0UA 3RWNA 4F83A 5IK5A 4YG6A 3IDCB 1PNFA 3UK9A 1A8DA 1KQRA 1V70A 4LHKA 4L9BA 4KL1A 4JGYC 1V00A 4Z2WA 3LOIA 4IEXA 1HRI1 4FPGA 1QGLA 2KA3A 3VZJA 5E8AA 5CAZA 2B45X 3AZVA 5D8AB 1BBT2 4I0BA 4CDXC 1VBE1 1IKQA 2JG8B 3BB6A 3MDPA 2XB6C 1T6GC 1LGBA 4NR1A 1JOJA 1D4M2 4JRLA 3ZYPA 3O0VA 1NLSA 3L2YA 3L9JT 3B01A 5EV7A 1ASJ1 5CFDC 2D6NA 4XHBA 3E97A 5HI0A 1PGL1 2VPVA 2WS92 4UXAA 2VGDA 5D8AA 2Q5TA 1AYM2 4ORFA 4Q4W1 1Q8PA 4AF9A 3WV6A 1SDWA 3FMGA 5F6LB 3SMHA 2JG8A 4IEYA 1IQAA 1FPN3 1UL9A 2WINB 1Z78A 4XFHA 1G86A 1FNZA 3USSA 5K8SA 3VL8A 1MS8A 4COZA 1W6MB 3ZYJB 2VVFA 1YHFA 2R1DA 3MIEA 3HAGA 3M2MA 3ZFEC 3VBUC 3THTA 2P3KA 1JHNA 4GB32 1SFNA 2RS12 4IEOA 1S2KA 1PIV3 1RIRA 5F1RA 4DFSA 1WBLA 2W52A 1XYNA 3FUOA 3VBHC 1Q5OA 1CPMA 1FATA 4N7IA 3RYKA 4QD2A 5F9TA 4SBVA 1HX6A 1ZZ7A 3G6JB 1MS9A 4CDQC 1HXS2 4N7UA 1W6QB 2VXRA 1C1FA 1D4M1 1W6MA 5AVAA 2XVGA 2WIIB 3IPVB 1W6OB 4K40A 1GZWA 3M3EA 3N7KA 2VQ0A 1RMU2 3SCGA 4XILA 2A6YA 3AXDA 5JZGC 2WS91 4NHLA 1GKBA 1AYM1 1U5IA 4F7ZA 1ZZ8A 3VN4A 2ZACA 3B3QE 5J7MA 2W68A 3H3ZA 1W6QA 1KJLA 3MLLA 3R6SA 1OOPC 2R16A 3FBYA 1W2UA 3IPVA 1RJ8A 1RVF3 4CEYB 2XKOA 1G7YA 5J96B 2DFBA 2NPIA 4Y22B 4EN6B 5CFCC 1R093 4GB31 2RS11 2IXCA 2WZPP 2XHKA 1OQDA 1OPMA 3MF6A 2WFPA 3VHOA 4MGYE 3RMYA 3NL1A 4XTPA 5C9AC 1YJLA 3ZSMA 2EXHA 4PLOA 4XBLA 1HXS1 1NCRC 3S6PA 3I54A 4P9YA 1CAXB 4Y22A 1U12A 2VG9A 2A70A 1VBD2 1RMU1 1UMZA 2R0FA 5JIAA 4AEDC 4KBBA 3VZLA 2ZHMA 1CQ9A 2BNNA 3VHNA 4DOUA 3VZNA 3KQRA 1CIWA 1QJU2 2K2SA 3IWZA 4RGAA 1CAXA 3W59A 3ILNA 4YFWA 1CAUB 2ZGKA 5ABJB 2UWCA 3ZDSA 1J58A 1MS0A 1FV2A 2GN3A 1BK1A 1SEFA 1S0BA 3IBMA 4YW3A 1SCRA 4JCKA 1S55A 3MZHA 4MGKE 3TN93 3VBOB 4EWDA 1LHOA 4MYEA 1DBNA 3WW3A 5FOJB 3BCWA 5C4WC 2WA3A 1HQNA 4Q0VA 5IUQA 1ZBA1 1S0DA 2D7FA 1DGLA 4FP2A 2VOVA 1GR3A 1OPOA 4DRRA 3UKTA 2TUNA 5GZDA 5ABJA 4DXZA 3EO6A 2XVLA 3B9IA 3WCSA 2WZR3 1AJOA 3CU7A 3VBOA 1NE6A 5AFEA 5T52A 1AYN3 3GHMA 1VAKA 2HWC3 1AUYA 3ZXKA 4EN8B 4ES9A 1JTZX 3MW2A 2PLV2 3HBZA 4I30A 2K9ZA 4LUMA 4CRQA 2ZMNA 2NM1A 3FZ3A 1RUD2 5C8WA 1KD7A 4Y26A 5H9SA 4XFFA 1QJU1 1C1LA 4XQ4A 1GV9A 1H8VA 2BUKA 5CG9A 3GZUC 2HWB3 4M00A 3JBG1 4P9XA 2VOWA 2ES3A 2GC2A 5FPXA 2RM23 3RI9A 3E6CC 3THPA 3WP3A 4DQAA 4RS5B 5JMCA 1MQTB 3VV1A 5L19A 4FOWA 4YLZA 3SH3A 3TNPB 4EWAA 2O8QA 1DQ1A 1JYIA 4GWNA 4QPGC 1REEA 2RMU2 1LTEA 3RJRA 3OGJA 1ENRA 1RL3A 3JB4C 3BPZA 4EV0A 4HLTA 4E4SA 4RS5A 4M3CE 4QQHA 4RA0A 1MQTA 1QMJA 2VVEA 4FPOB 4DNYA 1IHMA 1RUD1 1UZZA 4LO6B 3KGZA 1LCLA 1PVXA 4OHZA 4XF3A 1D2SA 1HLCA 5EYYA 3POYA 1ULCA 1K5MB 4GULA 1RUJ2 4CDWB 1RITA 5FRAA 4RQPA 1YLLA 1PVC3 1BJQA 3NAPB 3FLRA 4OHWA 4UBGA 4H7MA 5KC5A 2CL2A 3N7JA 4INDA 5K9YA 2JXAA 4N90A 4Z82A 1VAVA 4M01A 5J36A 3CJXA 1PO12 3ECQA 1FNYA 4EN9B 1RGSA 2WFF3 2FZ1A 2BBVA 2PELA 4FOVA 2RMU1 4LO7A 2R073 4CDWA 1DQ5A 5GZFA 5HCBA 4QQLA 1H2KA 4YM1A 4XPVA 3NAPA 1RUI2 4HSJA 3WHTA 3JU9A 4WM7C 4QM9A 1F9KA 5CU1A 1YO8A 1JBCA 4XJUA 3WVJA 4DINB 2Y0IA 1DGRA 3X29B 1V6LA 1N1SA 4D7SA 5FLHA 1VBA2 2WQZC 2MEV2 1EAH3 5B2GB 1RUJ1 3FHIB 1RVF1 3A0NA 1DYPA 1DGRN 4HBNA 2BNOA 3V56A 3ILRA 1KDMA 1Z0HA 2EXIA 3JD72 5BNPB 4IXLA 3URFA 4FOYA 4AEKA 1LOFC 4YZ5A 5C8CB 4CDUC 3FWEA 4MGIE 4C91A 2ZZJA 3OPZA 1ZBE3 1UIKA 1AR92 1LOBA 2G9FA 4WVMB 3J4UH 1UPSA 2GNMA 1I6XA 1O4TA 4MXWB 3HT2A 1VBC3 3VZOA 4LBQB 1WLTA 2ZZQA 4XBNA 2PHWA 5BNPA 4FTEA 4IEQA 2BGCA 4RR3B 1XE7A 1IGOA 5KXEA 1ZREA 1G6NA 4TZDA 1OMIA 5C8CA 4AFAA 1OSGA 1VBA1 2O0OA 4IETA 4R9CA 4WVMA 1BKZA 2JG9C 2WT1A 1VRH2 3LA7A 1KS4A 2VUJA 4MXWA 2TNFA 2QZ2A 5HCFA 4LBQA 3WQ7A 4LT5A 2RR13 2GNTA 2RJKA 4RR3A 4AEJA 3LA3A 3TN91 4FTSA 1J3QA 2HWD2 1V6MA 2W08A 4HK9A 5K7PA 1OFNA 1Q8QA 2XUMA 4J1XA 3KT1A 4PIZA 3FUQA 4FCAA 4DPNA 1YIPA 1EV12 1AR91 5BUVA 4X8NA 4Q4X3 1QH7A 3PLQA 3EBRA 2A7AA 2ZGUA 1GNHA 5JOXA 4FTBA 4K1ZA 1NCQB 1RB8G 2C1FA 2HWC1 4NPRA 2FMYA 2JEMA 2DFCA 4R4ZA 2BW8A 1DZTA 2YROA 2ZAHA 1CESA 1VRH1 2WNEA 1NE4A 3JZVA 4I0WB 3SCFA 1VB2A 4TSVA 5E16A 3B5LB 1NCQA 5JDBA 1G9CA 2HKXA 4HPKB 2Y26A 1Z7S3 2A75A 3FLTA 1VB4A 1JW6A 2PHRA 5EFUA 2A6XA 3RQ0A 4LUKA 3M3QA 1ZX5A 4H7LA 1EV11 2VMIA 3WCRA 1Q56A 2WFF2 2X5IC 1D4VB 3HWJA 5E89A 1TME2 4V1PA 3M8LA 4LLOA 2VW2A 1AR82 4HPKA 2JJ6A 2EA7A 4AVTA 4BH9A 5FAXA 5BNNB 2DCZA 1PHMA 1IS5A 2PTMA 2A71A 2PAMA 3AKPA 1BBT3 2BFUS 2AH2A 4RQPC 3LB9A 1CD3G 2CWMA 2R062 3RRDA 1W39A 4HETA 1D4M3 1H1MA 1JXNA 2ZHLA 4JGZA 3LOBA 1SLBA 1DDLA 4PQ9A 1WW7A 2IXKA 2YY1A 5FO9B 3BALA 3FLPA 3ZN5A 1LHVA 1AL0G 3ZSKA 1XXNA 4LA2A 1PNGA 3ZXAC 5BNNA 2WS93 1PVC1 2B42B 2UU8A 4B4RA 2ZX2A 1AYM3 4XQDA 1LGCA 1UX6A 4W6YA 3U4XA 2PYTA 1OLQA 4BIFA 2VUAA 3FC0A 3FJSA 3SH5A 2PAKA 4BLIA 4XJZA 2WFF1 3O0XA 2RE9A 5FREA 3AP6A 1TME1 2R071 4K1YA 1R082 3LZZA 1AR81 4M0HA 4ASLA 2MHFA 4XFCA 2D98A 1TMF2 4GB33 2RS13 1UU4A 2AUYA 4L97A 4XFGA 1CONA 1XNDA 1CPNA 2ZMLA 4P14A 5FPZA 5GLUA 3WG1A 3WUDA 1VP6A 4YM3A 2LALA 4XYXA 3J8F2 4YW4A 2PAEA 4P9LA 4Q4Y2 1HXS3 4A2UA 2DVAA 4XBQA 3VBRB 1MZEA 2GAUA 1RUF2 4QPIC 2A73B 3JQXA 1EAH1 5FBZA 3ES4A 1RMU3 4LULA 2ERFA 2JENA 1WMDA 2FMDA 2ZGOA 3N36A 2D6MA 2ZTNA 1BQPA 1AX0A 1NLRA 2XL7A 2WWSA 5C6CA 3BOWA 1N1TA 2I07B 3LSEA 4YVWC 3ZFFC 1QNYA 4DS0A 3VBRA 5DUVA 4RHV2 1DZQA 3B69A 5BNPC 4HN1A 1A78A 1AX2A 4AI2A 3QBQA 1R081 4C0HA 1X50A 4KGQA 2RHPA 3WP4A 1ENXA 3J9SA 1YWKA 4GMP3 1LOCA 1WW4A 2W0XA 1F8VA 2AR6A 2UWAA 3TB0A 1H9PA 1PZ8A 1LHUA 5SV8A 2ZPXA 3ZSEA 4XZPA 1QXRA 2Y0OA 3AZWA 3LGRA 2OPKA 3NV3A 2LTNA 5LK5A 1H8TC 4HK8A 5F6KA 4AI1A 1RUF1 4UW6A 3VDDC 2EF6A 1IOAA 4AE2A 3RJ2X 1VBD3 3CLPA 5FO8B 4BZ4A 5DZFA 1LOGA 2DUQA 4Q29A 2BWCA 4PDWC 4PJYA 1G9AA 1DGWX 2RR11 3WZ1A 1QWRA 2OW4A 2ZKNA 4BQ1A 3AP9A 2JKBA 1J3RA 3AMQA 1KFUL 4MSVA 5I8YA 4PBPA 3E6DA 1QJU3 1VALA 4RHV1 2O1QA 1Y9QA 3MIFA 2NQYA 5FMOS 2A3WA 3VBSC 2WNUB 2AZ5A 4Q4X1 4XOGA 4LEJA 4E27A 3OGGA 2VOXA 3AKSA 2WT2A 2R30A 3KCXA 4JDMA 4MH0E 1WMEA 3O0WA 2CV6A 3M3CA 5HCAA 1ZNPA 4YVSC 3PMSA 1X8EA 2GC1A 4P5HA 5T50A 2ZBJA 5BPXA 4HKLA 2PHDA 1KITA 2DVGA 4G4FA 4AVVA 3KD4A 3I7DA 2WNUA 4IEUA 3IKWA 3OD4A 3NJZA 1Y7BA 5KBFA 1QJX2 4HKWA 4ZU7A 2R042 2PLV3 1MS1A 1Z7S1 4IESA 2ZJCA 1RUE2 1H0BA 1HDKA 3DUIA 2F6BA 4FXGB 2DYCA 1RUD3 2D43A 4IEVA 5L36A 3D5OA 3KB5A 4N9HA 2GNBA 2RJLA 3IT8A 3ZO0B 4L99A 2ZX4A 3IDBB 3ZXLA 1ND3B 5J48A 4YGEA 1I3HA 3VHRA 4N53C 2F4PA 3OBTA 1GBGA 1KRIA 4RFT0 4LE4A 1TNRA 4AI0A 1B35B 1ZRRA 3FX3A 4JGZC 4BYYA 5BYNA 3M1HA 2KM2A 2DCTA 4BPZA 5KHGA 3JB8A 3RI8A 1BBT1 3TOJA 4B4PA 2RMU3 1X82A 4R9AA 3AYDA 1XRUA 1UU6A 1UPIA 1H30A 3GHNA 2ZMKA 3WX5A 2Y38A 4B4QA 2CNAA 2GMPA 4QM8A 1NZCA 4ZXKA 4ZKTB 1B35A 5JPNB 4QT6A 3R05A 4EJRA 3HN1A 1S0FA 3NWKA 1DU3D 2XVKA 5AVPA 4AGRA 4BCUA 4CZSA 4Z8BA 2ZGTA 4AXOA 1ENSA 5L7OB 4MUVA 4X6QB 2ZGQA 1LEMA 2BEOA 4M3CB 2QVSB 1RUJ3 4YG0A 1W6OA 3DN7A 4AHWA 4A7KA 4IV1C 3V64A 5CG8A 5IK4A 3U0ZA 3UJQA 4JTOA 4WM8B 4DRVA 2PHUA 4Z1VA 1Q8SA 2EIGA 1AL22 2QQPA 3LCPA 1PO13 4W6WA 5L7OA 3RYRA 3WHUA 3BIWE 1JYCA 1C28A 1ND2C 4KWJA 3J26N 3LSDA 4M3CA 4PIYA 2PN5A 3ALQA 2QZ3A 4YSFA 1ZYBA 2EAAA 4CEYA 3WG3A 2ZX3A 4FPYA 1RUI3 5EWSA 4WM8A 3MIDA 4JDNA 1NY72 3DPRC 1NA1B 5DUWA 4AGVA 1HQWA 3ZYGA 1POV3 2VH9A 2YDEA 4U36A 3CJIB 3B02A 1RUG2 3N7LA 3MIBA 1R1A2 4XE9A 1VBA3 4Q27A 4UW3A 4QX5A 2MEV3 1H2LA 3QCWA 2E63A 2BTVC 3KT4A 5L73A 4HKOA 1OLRA 2NMNA 2NZ9A 2VECA 1NA1A 2QDRA 3WNXA 3MEPA 2YV8A 3UL2A 3H1WA 1BXHA 1HIXA 2ZOEB 3CJIA 3D0SA 2VW0A 3JD73 4GMP1 1WLWA 3SLIA 2NMOA 3RDIA 2GALA 3NKTA 2V09A 1IS4A 1DQ0A 1MACA 3AM2A 3UJOA 4DMIA 4GMP0 3ACLA 4GH4B 1AR72 3MW3A 1AR93 1LKNA 4AWDA 4DZGA 4I3PA 1ULDA 4IV3B 1CAUA 4AVSA 4S2FA 4HVOA 1J3PA 3NSTA 2GH2A 4SLIA 1N3OA 5JOYA 2OYZA 3WW1A 1VBD1 1NY71 1C8NA 4L2NA 4DB5A 5LEKA 3AFKA 5GLVA 1W6NB 1W0PA 3I2DA 4YZ2A 1QOSA 1RUG1 4R9DA 1V6IA 3IM0A 4FPFA 4FVVA 1ZM1A 5JWPA 4GH4A 1R1A1 1LULA 5DG2A 5T5PA 2GMEA 3VUOA 4IV3A 3O7OA 1VRH3 4XXPA 3WOGA 4QXKA 1O4YA 1XU1A 3AB0A 2Q8OA 2PHTA 1QOTA 3H7YA 1WGPA 2GZWA 3AJYA 2ZX0A 4ISRA 1LESA 3RYPA 5J3UA 1SFYA 1W6NA 2HWD3 4Y4YA 4K3UA 4JAAA 4A3XA 3GZTB 5E1RA 1AR71 1EV13 1M4WA 3ZVXA 4KH9A 2UY8A 4N43B 1PK6B 4FOQA 1Q43A 5D8AC 4HFSA 2CGNA 2ARXA 1GZ9A 2JG8C 5KWRA 1PZ9A 1QKQA 4YW2A 4MX3A 5JSPA 3ZN4A 4ITCA 3VLBB 2P3IA 3G7DA 2PLV1 4K8FA 4K9SA 5JIUA 2HEWF 5LEJA 1HW5A 3QOPA 1LODA 5I8TA 5GLTA 4AQ2A 4FT8A 4NHKA 5FCCA 1U5YA 1O3QA 1PK6A 1C8M2 1OQEA 1TE1B 5LK7B 4AQ6A 3MLKA 1QQP2 5I93A 4Q0PA 3I4IA 5FMOL 5T5OA 4JQRA 4YW5A 3NV4A 4ASMB 3ZIWA 4YW1A 3V65A 5K0UB 1RUC2 3WP6A 5AC92 5EJ3A 2I2SA 3H9AA 1B35C 3E6BA 3B7MA 2A6ZA 1VBB2 3PVEA 1TME3 3LA2A 1K5MA 4AYUA 3K48A 3C2UA 3MFAA 1AR83 2B46X 4FPKA 4XTMA 3ZN6B 3MI8A 2Q0AA 2AREA 2YMZA 2XJPA 1O7FA 3M7AA 1S0EA 4HSLA 4J1WA 5JI9A 3M4FA 1F31A 3EHKA 4I01A 3AP5A 4EN0A 2R063 2D5HA 1A6CA 5IK8A 2SLIA 1S2BA 2TEPA 2QNKA 2Z5WA 1M06G 3TYJA 1QQP1 2ZHNA 2VMGA 5L7OC 4BMBA 3TRSB 4EN7B 4W6XA 1QU0A 2UYBA 1V6OA 4FQZA 3M70A 1MZ5A 3N35A 4CEYC 4BHPA 3L2HA 1NG0A 3ES1A 1WBFA 4KGGA 1MS5A 2A3XA 1SLLA 5DUUA 3PJQA 1AJKA 1PO11 3PVNA 4MZUA 1SBEA 1QY4A 5JI7A 4XMIA 2VULA 1HV1A 1O4ZA 1S0JA 1R083 3VKNA 4XIOA 2PFWA 2TBVA 3ZFGB 1RUH2 3D0JA 1SBDA 1TMF3 5DDJ2 1A3KA 1DQ4A 2ZABA 1RUI1 1UKGA 3IDEA 1REDA 1S0IA 1OHFA 1BVP1 3BOPA 1POV1 3J8F3