2DCTA

Crystal structure of the tt1209 from thermus thermophilus hb8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
MEIKDLKRLARYNPEKMAKIPVFQSERMLYDLYALLPGQAQKVHVHEGSDKVYYALEGEVVVRVGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVVTAPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TT1209 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA0104
total genus 19
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dctA00
1J58A 4YNIA 5HI0A 5I93A 4LULA 2IXIA 4CYDA 2QNKA 3H7YA 2XL9A 1UD1A 4FAGA 3D0SA 4O9EA 4TLFA 5EFUA 1DZTA 3B02A 1WA4A 1X82A 2P17A 4AQ6A 3ST7A 3E6DA 5JAXA 4JV4A 1YHFA 3D0JA 3G7DA 2IC1A 3MYXA 3PVBB 3OTFA 4HLTA 1J3QA 4XF1A 5J48A 3S0MA 2EVXA 3LOIA 3SMHA 2XHKA 1XE7A 1CAVB 2VECA 4O9GA 2CV6A 1CAXA 1X7NA 2WFPA 1UCXA 1WLTA 1Q43A 2MHFA 3CL1A 3RYPA 5J7MA 1NE6A 4IESA 4IEYA 2GU9A 3GYDA 2Q4SA 2N7GA 3I7DA 2PQQA 2D40A 2O1QA 4FAHA 1YFYA 1YFXA 2ATFA 2B9UA 1O5LA 3H3ZA 4HMZA 4BIFA 1VR3A 1ZNPA 1YFUA 4MX3A 3E97A 3FWEA 4XFHA 4FBFA 2D5HA 2DCTA 2GZWA 4PJYA 2Y0OA 1NXMA 4JTNA 5LEJA 4I3PA 4KU8A 2BNOA 4DINB 4I0AA 1QY4A 5BUVA 4LA3A 1OMIA 5I0TA 1ZZ8A 1UIJA 1I6XA 5KHHA 5LRSA 3BU7A 3SCHA 3OCPA 2BNNA 4BHPA 5KHJA 4X6QB 4UBGA 2XLGA 3H7JA 1FT9A 1JUHA 4IEZA 4XETA 3OF1A 5BXXA 4Q29A 5FPZA 4GULA 5I8YA 1YFWA 3VHRA 3ES1A 3CLPA 4AVBA 2ET7A 4H7LA 4IEQA 3EHKA 4I09A 2PHLA 1PMIA 3R6SA 4F8AA 1OFNA 2PYTA 2H0VA 3M70A 5BPXA 1RC6A 4Q0VA 1Q5OA 4IETA 4ZU7A 4MV2A 3UKNA 5I0SA 1RL3A 3EO6A 4BH9A 2MNGA 4XEZA 1LR5A 2PAMA 4I02A 1LRHA 4AXOA 2GC0A 2XLFA 1ZRRA 1CX4A 4E2SA 4YYOA 4LTAA 3DV8A 3MZHA 3KSCA 5J3UA 3QACA 2D5FA 4I0BA 1ZZ6A 3FE5A 3H1WA 3ETQA 3LA3A 4QGNA 5CADA 3KCCA 1O3TA 1PM7A 4Z82A 1VJ2A 4KWKA 1UIKA 1ZZ9A 4OLLA 2QJVA 3SCFA 2IXHA 4IEXA 3WW3A 3FHIB 4YSFA 1QXRA 1OI6A 4QX5A 1GQGA 4WVZA 4R52A 5FPXA 4IEWA 4AVCA 2MPFA 3USSA 1ZRDA 3E5XA 3S7IA 4EWEA 3IIAA 1X8MA 3RZZA 2XLAA 2PHDA 2C0ZA 3NSTA 4FT8A 3NL1A 5I0UA 5FQ0B 2GAUA 1J59A 1ZREA 5F1RA 3SXWA 3U11A 1RUOA 4F7ZA 4I2OA 3CF6E 2XKPA 4LUMA 4YRDA 2IXLA 3ES4A 5C6CA 4IEPA 1XE8A 3EQEA 4R8HA 3RDIA 1YUDA 3ELNA 1VP6A 4L2NA 4YARA 3HIFA 3HT2A 4EWAA 1ZRCA 2FMYA 1Y3TA 5JSRA 4XFFA 1O3SA 2QVSB 3NJZA 2OYZA 3JZVA 3WW2A 3E6BA 4JTOA 3GBFA 2Q1ZB 3SCGA 2B5HA 3E5QA 1J1LA 2WC2A 3NVCA 5FLJA 3M3IA 5E16A 3EJKA 2B8MA 1LKNA 2V09A 1YWKA 3CEWA 2OPKA 1GQHA 1CAXB 3LWCA 2QDRA 2D93A 4RD7A 2PFWA 4L11A 5KHIA 1UPIA 2BYVE 5KHKA 4EV0A 2HKXA 4MGKE 2ETEA 4PIZA 4QM8A 4XFCA 4P9GA 5FLIA 2XL7A 4HZFA 2Z69A 3ROUA 3OD0A 4WZCA 3ZDSA 1ZVFA 3NKTA 3RPQA 4E2QA 2K9ZA 4UBHA 4IEVA 4D7TA 2EAAA 2CAUA 2PA7A 1DGRA 4XF0A 4MH0E 5KHGA 5CU1A 4LUKA 5I8TA 3BPZA 1U12A 2XGXA 2F4PA 4Q0QA 4J1XA 1NZCA 4N9IA 2GC1A 4Q0PA 4EWDA 5FLHA 3IDBB 1QXJA 1FXZA 2Q30A 4Q0SA 2HJIA 5T3NA 2XKOA 3WW4A 3RNSA 2ZCWA 5KBFA 3H50A 1WGPA 1X8EA 4OFGA 4X6RB 1CAUB 2OZ6A 2Q0AA 2I45A 2PAEA 3UKTA 3OGJA 4KWJA 5E1RA 3DKWA 3PLQA 1H1IA 2CGPA 3E5UA 3HQXA 1O3QA 3LZZA 1ZRFA 4BYYA 2UY9A 3FZ3A 2BGCA 3BCWA 4HVOA 1CAWA 4PIYA 4IERA 3H3UA 3IDCB 1RUNA 3MPBA 1H1MA 5FCCA 3U0ZA 4JVAA 2BEOA 3D82A 4ORFA 2GC2A 2VPVA 1SFNA 2UY8A 3LA7A 2UYAA 4HN0A 1DGWA 3DL3A 4NVPA 4QM9A 5K8SA 3TNPB 1CGPA 5JR7B 4LLOA 2BNMA 5LRRA 4QGLA 2PTMA 5I91A 4UXAA 5CVRA 2FQPA 4QMAA 2IXJA 4LEJA 3SHRA 3TNQA 3H8UA 4XF4A 5BV6A 1Q3EA 3I59B 1CAWB 1UW8A 1EYBA 3NW4A 4META 5I0RA 1EPZA 1O4TA 1J3RA 2IXKA 1TQ5A 1NYWA 1ZZCA 3FFQA 5EZWA 1O7FA 3KMHA 5I8SA 2VQAA 3S7EA 3IBMA 5JSOA 3HT1A 5FDBA 3PNAA 4K8FA 4KWLA 2GC3A 3LA2A 1SEFA 2UYBA 4MUVA 3H1MA 4Z07A 3N4MA 4A2UA 4MGYE 4XF9A 2PAKA 4KU7A 4MGZE 3H9AA 4LA2A 3I59A 2GH2A 5C8WA 5FQ0A 1Y9QA 3UKVA 2KXLA 1J3PA 3BALA 4PIXA 4QGMA 4HSLA 3C3VA 1IPKA 5D1IA 1FI2A 1SQ4A 5AVPA 1CAUA 3BB6A 4HVRA 1RTVA 2H6CA 2K0GA 1EY2A 3DN7A 4ONUA 3QOPA 4QXKA 4I01A 4KL1A 1HW5A 1LB2A 3O14A 2EA7A 1YLLA 4MZUA 1NE4A 1V70A 4XFIA 3ACLA 5LEKA 3LAGA 1DZRA 4D7SA 3EBRA 1ZX5A 3E6CC 3FX3A 4N9HA 1RGSA 2QCSB 1O3RA 2ZKLA 1I5ZA 2E9QA 3RYRA 4XFAA 2OA2A 4WBBA 4XFGA 5JCTA 3KGLA 4XFBA 1G6NA 4ZU5A 3IWZA 2CAVA 4ZU4A 3U10A 3CJXA 5JSPA 4IEUA 3H1YA 4Q0UA 4MGIE 3WW1A 1EP0A 2ET1A 4J1WA 4AQ2A 3CO2A 4HBNA 1ZZBA 1L3JA 1XRUA 3I54A 3MDPA 4HSJA 4AVAA 4IEOA 1ZZ7A 4E2GA 2IXCA 2OZJA 2O8QA 3KGZA 4EROA 5BY5A 4HN1A 2Z2SB 4HVQA 1O5UA 4B29A 1IPJA 2H6BA 1CAVA 1QWRA 4XF3A 3L2HA 3RYKA 3FJSA 1OD5A
chains in the Genus database with same CATH superfamily
1J58A 4K20A 1OBNA 3ZDVA 2V73A 4UT5A 1YQ5A 3ON7A 4JCKA 2QZ2A 3PHMA 1BEV2 1ULFA 3POWA 1GICA 5L73A 2BPA2 1S0JA 2WNOA 3ATGA 2QFEA 2Q1FA 3SKVA 5IK5A 4A41A 3KCXA 5FOBB 2XJUA 4NJ4A 1W3VA 3VBSC 3DXUA 4AQ6A 1RHI2 2ES3A 1GZTA 3B00A 4UFMA 3ITQA 3WCRA 2YBKA 4LMFA 2I07B 3PVBB 4AAXA 4LORA 4FOQA 5KC5A 1C8M2 1QH7A 1Y4WA 2WDBA 4IQPA 4CCNA 4PLOA 3SMHA 1XE7A 1RUE2 4E8CA 1WW5A 2VECA 4XJAA 4EN8B 4Z8BA 5EXOA 4WM8A 2IFRA 1BJQA 4RN5A 3VKFC 3ZFEA 1UWWA 3CKHA 1IS6A 1CAXA 1COV1 2K2SA 1X36A 2RE9A 4I0WB 4Q4W2 5EJ1B 2R16A 5FY5A 2P2KA 1E5SA 2WWUA 3PUHA 2FDGA 5A7WA 1O6UA 1UZWA 3OYWA 4YW3A 1MS8A 2P3IA 2RR12 3EB7A 3ORJA 1RJ7A 2F17A 5FJKA 5FV3A 1KS4A 1HRV1 4BQ4A 4IESA 4IEYA 5FYVA 3GYDA 1RUC1 2BWCA 5FREA 1FMD1 3M3OA 5E89A 3G6JB 4UFLA 4E4ZA 4FAHA 2HWC3 1OQDA 3AVSA 3PVEA 4LO5B 3WNLA 1AJKA 4ATEA 2RS32 4QU1A 2OS2A 1VR3A 2YC4A 5DUWA 4M3CF 2Y0IA 2ZEWA 2VUCA 4MX3A 3WF0A 4DRVA 2GMPA 2VZ3A 1AR71 4KWUA 4UW3A 4UI9L 2R6QA 3WR0A 4BWOA 3TN91 3OG2A 2LTNA 2RV9A 3CJIC 3ECQA 2G9GA 4X8PA 3WY6A 4I3PA 4TWTA 5C5TA 1QEXA 1GNZA 1O4ZA 4I0AA 4RQPB 1V0AA 5DZGA 3VBUA 4AEMA 5F5AA 2OUJA 4HK8A 2XH6A 3RZHA 3FN9A 1BYHA 1I6XA 2VMFA 3NRUA 3HN1A 5KHHA 5BNPC 3SCHA 3OCPA 2B46X 4GWNA 5EYXA 5A7WB 1K5MA 4DFSA 1Q8PA 1GOGA 3DPRA 3ZXDA 3P1IA 4PCRA 1FX5A 4IE4A 1XU2A 4UBGA 5EJZB 5A7SA 3WDVA 1I3HA 5AVAA 1PK6A 4FPKA 3IIIA 1VBE3 4IEZA 1GMMA 4XETA 3OF1A 3A0KA 2ZKNA 4AF9A 5C8CC 4XDOA 3KVBA 1OSGA 5FYZA 5IK7A 3U75A 3UGHA 3VHRA 1RYYA 3CLPA 4AVBA 5IFPA 3SISA 2VUJA 3EHKA 4RR3C 4I09A 3NNGA 1A8DA 4LE4A 4YGBA 2WNVB 4Q4W3 3ALQA 3O1RA 1JUIA 1VRH1 2GDFA 1OFNA 2H0VA 1WW4A 4HONA 4MHUA 3ME2A 3BU0A 1UF2C 1W04A 3OY8B 3VZKA 1DLLA 1CR7A 2Y33A 3K75B 3KZ4C 3TBDA 3USUA 2E7AA 2AEYA 3QD6A 4OQ9A 3VLBB 4Y1XA 3U14A 4DXZA 1RUC2 3UKNA 1HV1A 1HRV2 4Y1ZA 4RHV2 4BH9A 2MEV3 5FJHA 4FPCA 1GZCA 2MNGA 5LY2A 1LR5A 2I2SA 1EPWA 1WW7A 4AXOA 2GC0A 3V56A 1RHI3 1RUF3 4BE3A 1CX4A 4E2SA 3FHAA 4LLFA 3RZGA 5KXEA 3KV9A 4UFHA 2HBTA 1UYYA 3KSCA 5J3UA 2YBSA 2VOTA 1AYM2 2GP3A 3GCWA 5CFDC 3PUAA 3FE5A 5A1FA 3JBG2 3MPPG 1W8NA 3FFZA 4MVTA 2EICA 5F2WA 1GKBA 1UY1A 1HQLA 3MFCA 4FTBA 4HOOA 4Z82A 1WMEA 2HYKA 5FRAA 1ZM1A 4C91A 5JI7A 3AMHA 3OY8A 1KD7A 2LALA 4KWKA 4DO0A 5HCBA 1LGBA 3SCFA 1WW6A 2IXHA 4CEWC 2RMU1 3VB9A 1LEMA 1XC6A 4XOGA 5J1XA 3ZXKA 3VUOA 3CU7A 1WMFA 3PUQA 1EAH2 4JDOA 1OI6A 2DFCA 1ZA7A 4QX5A 1GQGA 1LGCA 4MG2A 5FPBA 4OZOA 5A7QA 4XBNA 5CNAA 3C7HA 1LU2A 5FZOA 2RS13 3B7MA 2HWD1 4G4FA 1WBLA 1GYKA 2JG8A 2VXRA 1K3IA 3D5OA 4WVWA 5DG2A 2VOKA 3S7IA 2RS53 2VAUA 4YM0A 2XLAA 3WNPA 1H8TC 1H2MA 3M7AA 1JYCA 4NRMA 5GZEA 2W9XA 1LOAA 1YQ8A 4CUGA 4YZ1A 5L7OA 5FZLA 3BKZA 2Y6HA 3ZIXA 5LBCA 1QKQA 4A7YA 2B4KA 2R073 1S1AA 3T09A 1XOYA 3P5BA 5IFTA 5ABJB 2P1BA 2ZACA 5A6ZA 5D8AB 1MS4A 3T30A 2J1RA 2IXLA 2WZR1 1VE0A 4AVTA 5JIUA 4B7KA 1AR91 5AC92 1J83A 2RM23 1TME1 2JEMA 3I2FA 1R081 1YNAA 3OBTA 4M0NA 3RDIA 3RZMA 3ELNA 4L2NA 4YARA 4HETA 4KG0A 3PTRB 1Y3TA 3ASIA 1SCSA 4XFFA 3VBSB 2J42A 2PHRA 1FATA 3WW2A 5IVCA 3PMEA 1H9WA 5FMOS 1HRI3 2JG8B 2OIIA 4M3CE 3OUHA 3VKOA 5F9TA 4DEQA 5AFEA 4NHXA 5EJ3A 3NAPB 5FZMA 1W28A 4XHXA 5K4LA 1R1A3 5CAZA 2Q8CA 4DUXA 3AFKA 1RMU1 2B8MA 2DTWA 3AKSA 1R083 4XIOA 1G7YA 2GN3A 4W8JA 2BFUS 1QDOA 4YWAA 1GQHA 1QQP1 3AP5A 4CDUC 5F5QA 2ZGUA 2WZR3 4JQTA 1WCSA 1QMJA 1T6GC 4D94A 4K9SA 3S5AA 4QXCA 2BW8A 4QKFA 5KHIA 2ZMKA 1UKRA 5B2GB 1K12A 1HDKA 2R071 4QPIA 2I74A 1XSRA 3RZLA 4W4ZA 2AYHA 3N9PA 2W91A 1FYUA 2PLV1 3MW2A 3MO4A 2DWRA 5J98B 2DVDA 2VCAA 2WFF1 3VKNA 3RI8A 1OKQA 1F35A 2BDRA 2VE1A 4QM8A 3I2DA 3FL7A 3ZSJA 3MUZ1 3J26N 5C33A 2WKKA 2DCZA 2XL7A 1L7LA 3IDEA 4HZFA 3S5QA 3HR9A 4Q4V2 3BOPA 2Z5WA 1ZVFA 3NKTA 3ZYRA 3RPQA 2KR2A 4BU2A 2K9ZA 2Z79A 3KS7A 3PTYA 4UBHA 4IEVA 4D7TA 5BNOC 3LEMA 2VCCA 4U36A 4BJ0A 2W52A 2CAUA 2ZX4A 4DUWA 2BGPA 4DEVA 4CDQB 1DGRA 3OGVA 1LNSA 3OYWB 5I8TA 3BPZA 2C6SA 2QZ3A 4A7KA 3ZYBA 4XJUA 1H4GA 4AI1A 2VNGA 4XIKA 2ORZA 4BQ1A 1YCIA 4CUBA 5JZGC 2GC1A 1PO21 2CGNA 4LO7A 1O59A 1W90A 3VHOA 4EN9B 4Q0PA 4EWDA 4A7ZA 4Z92B 2VW0A 1DHKB 1AR92 1G9CA 1MS0A 3RQ0A 1BZWA 3KCYA 1H1AA 2JE8A 1FAYA 2Q30A 3WOGA 4OI4A 1VMFA 4Q0SA 5GLVA 5T3NA 3WW4A 5CFDB 2WNEA 1LOFC 4INDA 3GHNA 2ZCWA 3POYA 2IVJA 3GJAA 1V9U1 4JX0A 4QX0A 1X8EA 3H50A 2W1QA 4X6RB 3BTYA 1H0BA 2OZ6A 4JGYB 4AHXA 5IK4A 2Q0AA 2RR13 1QJX3 2EXIA 2I45A 5KR7A 2GNDA 1OXCA 4XTPA 2A6VA 2HEWF 3LDRA 3HD8B 3K46A 4XXAA 4ZS3A 5A33A 3DKWA 3FC0A 3I2GA 3I97A 1FNZA 5F3IA 1K5MB 4FQZA 3ZFGA 3H8RA 3E5UA 1ZRFA 5FAXA 4MYEA 4ES9A 2A6WA 2XOMA 2WIIB 3CIHA 1MEC1 3HAGA 2Q8OA 1GANA 2PHXA 4CCJA 1EAH1 1ENRA 1OLME 4B1MA 1L7RA 1XB9A 3T0BA 1LHWA 1WA6X 5FBJA 2SLIA 4IERA 3J8F3 3RFRA 1RUNA 1P8JA 4Z2WA 2W0XA 3U0ZA 1MS1A 2D43A 2E7QA 2ZOEB 3WQ1A 5D2AA 1W6NA 2JDNA 3N7KA 4FFIA 3GXUA 5H9QA 1SFNA 2UY8A 3LSDA 1YEWA 2RM22 2UYAA 3HPNA 3HWJA 4HN0A 4CE8A 1DGWA 2DUPA 2VO5A 3B94A 3HQUA 4NHMA 4A4AA 4DQAA 2X5IA 5JWPA 1F4HA 2CDPA 3I8TA 5K8SA 3KF3A 2RDNA 4RSUA 1Q8OA 4BQXA 3AJZA 3VBHC 3T0DA 4C8DA 1PZ9A 5LRRA 3ILFA 5BNOA 4LR4A 1G9FA 4PBPA 5I91A 5CVRA 4OI1A 3WXPA 2IXJA 4MSVA 4RL7A 2EIEA 3L9JT 1AUYA 1Q3EA 1W6PB 4KI5M 4YW7A 4A3ZA 3I59B 3U4XA 2ZGLA 4AK3A 3KV4A 4D6QA 2WNUC 4RHV1 1PNGA 1LJ7A 1LAJA 3NW4A 3ZPYA 1GR3A 4JDNA 2ARBA 1DZQA 4AI2A 1TQ5A 1NYWA 1KXGA 3NO8A 4LXLA 1PZ7A 4CPBA 4GA9A 4GKYA 5I8SA 3VZOA 1R1A1 4NRQA 4Q1PA 3IBMA 1QOTA 3LF7A 3S7EA 3HBKA 1NY71 3HT1A 1W8TA 4AHZA 2DFBA 2HWE1 4QPGC 3JQWA 2OUHA 5LW9A 1WD4A 3HNMA 1F31A 1SEFA 3AB0A 3GJBA 1D4M1 1PGW1 2X5IB 4FPGA 4IE0A 5FY1A 4OCTA 2PHFA 1JZ3A 3POSA 5DZEA 4K1YA 4DIQA 5FZOB 5T5LA 2VUAA 1UOJA 3ZVXA 5IYYA 1VBD3 3GBWA 1YI9A 4MGTA 4NRPA 2Y6FA 1W6PA 4LBMA 1ZBE1 3I59A 2EALA 1LECA 5K0UB 2GH2A 2G19A 1D4VB 4FQ4A 3J4UH 4NPLA 4R4XA 4YVSB 3UKVA 2BUKA 3I4IA 2WABA 3GZEA 1OLRA 1OOPB 3VD7A 3LCPA 1SQ4A 4XCAA 2FDFA 4O61A 3OB8A 2RDSA 2Y6LA 3ZSLA 1SLLA 2K0GA 4Q27A 3AM2A 2X09A 4CPBD 1W2OA 4DNYA 1XU1A 4GMP1 4I01A 3O14A 2JB8A 2XDVA 2ZA9A 2EA7A 1N1YA 5FMDA 1NE4A 5HCFA 5GLWA 1C57A 1SDDB 1S0FA 2YC0A 3D4KA 2ZX1A 5JXJA 1DZRA 1H2LA 1ASJ1 3A4UA 4QWNA 1WLCA 1JU3A 2HWB3 3EBRA 1RUJ3 4JKLA 1D2QA 2AR6A 4A45A 3WQ0A 4ZKTB 3E6CC 3FUOA 1N3OA 5FPLA 2BERA 2CL2A 2Q5TA 3WHUA 4XVHA 4BPZA 4AGRA 2OW4A 4AFDA 1YIFA 2WUHA 2HWB2 4ZPIA 1L7QA 1VAKA 2Y6GA 5FZ3A 5CKNA 1RUC3 4IV3A 2XB6C 3PUSA 3WINE 2VQ0A 4IV1B 4XFAA 3WQBA 3JBG3 4XFGA 2XR4A 3BOWA 1U5ZA 2ZMNA 3VDDA 3CJIA 3LOBA 1C8M1 3IWZA 2CAVA 4ZU4A 3U10A 1AX0A 1LOCA 4Y3OA 1DGRN 1CWPA 1KGYA 4Y5TA 3VBUC 3WNOA 1E5IA 2W94A 3WW1A 4AGGA 1W2AX 3CO2A 3N7LA 5FMCA 1ZZBA 1W0PA 1CIYA 2YGLA 2PXJA 1MEC2 2OQ7A 1OHFA 1NQDA 1WZXA 1CONA 1RITA 4TSVA 2OZJA 3MIFA 1MS5A 5FYSA 3OUJA 4QHBA 5T5JA 1GBGA 1WCKA 4E4DX 4EN6B 5IK8A 1O5UA 2NN8A 2O8OA 1QU0A 4UFIA 2X8KA 2CTVA 5FKCA 2HWF3 1CAVA 1QWRA 5EQUA 5HXVA 1WLDA 2AGSA 4QPIC 4FTEA 1HIXA 2WQ4A 3FJSA 5A3PA 1NKGA 1OD5A 2B9VA 5F5IA 3VBOC 1ND2C 3TWIA 1KFUL 2IXIA 4GKXA 4CYDA 4HKLA 2YPJA 2QNKA 5C5UA 2VVEA 2XL9A 1W8WA 2XJVA 3KHBA 4B1LA 1VBE2 3POFA 4C1XA 3WEZA 2ZHLA 4BLJA 5CIRA 3D0SA 3KM5A 3IPVA 4LIVA 4O9EA 4QQLA 1GWKA 3DCQA 1UYZA 4LBQA 4XUOA 2J1SA 5FBZA 4ZHNA 3K3NA 1D4M3 1WA4A 1HB4A 1OA4A 1GP5A 2GNBA 4LKDA 4YGEA 4YVSC 2D6MA 3VDCA 2X10A 1UL9A 3E6DA 3BTXA 3I2HA 5GM0A 4Y1VA 1YHFA 1MQTA 5FUPA 4B4PA 3PUIA 5IT6A 1N3QA 1XNBA 2XXZA 5CFDA 1BBT3 1ST8A 1IS3A 1MZEA 1J3QA 4KQ7A 4XF1A 5FFOC 5J48A 3KV6A 3S0MA 4E27A 4P5HA 4FP3A 2JKBA 1CAVB 4O9GA 5C4WA 4RYDA 1JOJA 4HKWA 2YUEA 1DYPA 3KT7A 1BLZA 1RUI1 2WFPA 3AP4A 4COYA 2JDAA 2XONA 4COVA 5A33B 3ZFGB 1W03A 1GOFA 1Q43A 1C28A 1KS5A 4IV3C 3FLTA 4Q1RA 4CEWA 4OMCA 1H8TB 1KJRA 1VBB2 5FUNA 1FMD3 1JYIA 5CG9A 4GMP3 5FP9A 4LBQB 2RS51 4OULA 4OMDA 2JECA 4A3XA 5FWJA 4A44A 1BCXA 4N43A 4GH4C 2PQQA 2W39A 4PBOA 1LEDA 2P3JA 3ZX7A 1H6YA 3HQRA 4TLGA 3HNYM 2NYYA 3U07A 2AH2A 2B9UA 4FFHA 1HRI1 1O5LA 1QQP2 3ACHA 1R091 2FCUA 5C9AC 4FBFA 2D5HA 2DCTA 2GZWA 1W6NB 4PJYA 2Y0OA 2JG9B 5FZCA 1GQPA 5LEJA 3JD72 3KB5A 2QDNA 4DINB 3M3CA 5A80A 1QY4A 4KNCA 3RSJA 3MIHA 1NA1C 1AYN2 3INAA 1JZ8A 4XE9A 1OQEA 4YW1A 3VBHB 1FPN1 1ZZ8A 1YQ6A 2D6NA 3ZYFA 4CP9B 1JW6A 3BU7A 3MBWA 4N90A 3KHCA 5H9PA 2JE7A 3NKGA 1W39A 2QQVA 2ARAA 5B4XA 2RJKA 1REDA 2ARXA 3NAPC 5BNOB 4X6QB 2XLGA 2YC2A 4RFRB 1R64A 1QNWA 1FT9A 3ZKYA 4P9JA 1AYN1 1BQPA 5FPZA 2G1MA 5JOZA 5L9RA 4FPLA 2QQUA 4LHKA 4IEQA 2E53A 1NLQA 4Y1UA 1E5RA 2D3RA 4OVEA 5DUVA 3DUIA 2VJXA 1QJY3 4CRQA 3VDBA 2ORXA 3R6SA 3CZUA 4CDWB 2JDUA 4F8AA 2BBAA 1ALYA 4FXGB 4LK6A 3J7LA 1POV0 5J09A 2ZX3A 2WFF2 3M70A 1RC6A 2D6LX 4QPGB 3WP3A 4IETA 3ZN5A 4AOCA 2WYSA 1DCSA 1RL3A 2E51A 3ZYPA 5I0SA 3EO6A 1C5IA 1ZBA1 4RGAA 4CDUA 5LA0A 2PAMA 1BXHA 2QE3A 4I02A 4CP9A 4QQPA 4NIIA 4URAA 2R30A 4IGOA 4YYOA 4LTAA 1S0CA 1SACA 3DV8A 2XPJA 1N1TA 4QHZA 3AKPA 4DXSA 1QJFA 1YO8A 4I0BA 2PHUA 3MF6A 2BRTA 3H1WA 3O7OA 3PL0A 1G86A 4MO3M 2QQOA 4ZXEA 2GH8A 1RXFA 2KM2A 3DYPA 4FPOB 4PQ9A 4EN0A 3KCCA 1O3TA 4PDWA 4CCDA 1UY3A 1PM7A 4IUGA 4WM7B 5FOJB 1OOPA 1S0GA 3CBNA 1VJ2A 4C0BA 2BP6A 3ACGA 3E1F1 3JXSA 2J22A 2UU8A 2VVDA 5A3MA 3WNMA 1SLBA 1ZZ9A 1Q8QA 4OLLA 2QJVA 4COZA 3WG3A 4GB32 5GLUA 4QXBA 1REEA 3OD4A 4AE2A 4BXFA 2JICA 3LDKA 1R082 4NIAA 3LQCA 4QDQA 2GMMA 3SITA 3H0OA 4P08A 1NXD1 3IZOA 4EZHA 2VMEA 1UZ0A 2CWSA 5DN2A 2VMIA 3IKWA 3WX5A 3ZOIA 4AG4A 1YJLA 4LKEA 3KVAA 4RGGA 1PGSA 5IVEA 1PO13 1XJAA 2JDZA 3IIAA 5CISA 1HB3A 3RZZA 1VBA1 2Y34A 4Y20B 5JOWA 5IAVA 2AEZA 4IV3B 3KT4A 5JLVA 1Q56A 2XWJB 2EIBA 4FT8A 2BWAA 3NL1A 4E9KA 4CVUA 1UO9A 1OLMA 2D6KA 2P37A 1J59A 3C8XA 4UF0A 3UESA 5F1RA 5FR3A 1COV3 4AYUA 1SCRA 3MLJA 3U11A 3ZSKA 4ZS2A 3VD5A 4I2OA 2IWGB 2VY0A 4LKFA 3VBUB 4YRDA 1SLIA 4C0HA 4O65A 5FO7B 3W5MA 3AMQA 2ZGKA 4IEPA 4S2FA 1XNAA 1YUDA 4M01A 5FP3A 3FUQA 3MI8A 1AR93 1VP6A 2RMU2 3HIFA 3HT2A 4EWAA 3WD5A 3S30A 3OSDA 4UAPA 5JR2A 1F15A 3JZVA 4JTOA 4FOVA 2DVGA 3J7MA 3NV3A 1TEIA 3OPZA 4CU9A 4XCBA 3JD73 5GKAC 1SLAA 3ZKUA 3OBZA 3SCGA 5A3LA 3KLSA 3E5QA 5A3UA 5FZ1A 3GZAA 5FP7A 3NVCA 2WNVA 3JBG1 4QT6A 2ZHNA 1B35C 3M3IA 3EJKA 1FPN3 3ZXJA 2JE9A 2VZ1A 3T1LA 1AR72 5A6QA 4Z2AA 4UF0B 4AFCA 2HWD3 2ADEA 1US2A 4ZZ8A 3T08A 1SFYA 2QDRA 4FCAA 4XC9A 1JZ6A 1QF3A 2PFWA 2PN5A 4L11A 2JIJA 4QQ2A 5DUXA 2WS91 4PI0A 4P02B 4JRAA 1S2BA 2YBPA 3POBA 4YPJA 3WUCA 3ZYGA 4EV0A 2XUMA 5KHKA 2DDUA 2YU1A 1W2NA 1CJPA 1GZWA 4QQOA 4CDXC 2WS92 1QOOA 4AGVA 1BEV3 4JKMA 1XPWA 5DAVA 1MQTB 3VKLA 4XZUG 1WUVA 5A1LA 4XPVA 3LIHA 3AKQA 5JXGA 2VCBA 2ID4A 2WFF3 4K21A 1COV2 5GLTA 5JI9A 1UAIA 2NMNA 4JZRA 1GZ9A 4COUA 1X9TA 3WDYA 2A6XA 1NZIA 5GZGA 5C3PA 5BNNA 3ZXGA 2XJPA 2EAAA 3O0XA 1QGLA 4E4SA 3L2YA 1C1LA 1W6OB 3Q9OA 1OPOA 1FOD2 4BMEA 2ZGRA 3IMNA 4PLNA 1POV1 3P3PA 4CEWB 2QUOA 3WSOA 4YW6A 1U12A 1QDCA 2VZSA 4GMP0 2CGOA 4AEDB 2X53S 5IJRA 5T54A 2F4LA 1DYKA 5JMCA 1I1EA 1SLTA 4Y4YA 4QU2A 1NZCA 2JWPA 2Z42A 3WNKA 4N9IA 1GP6A 5HXMA 4LOSA 3PDQA 4MGSA 4Y4RA 1DQ1A 3GM8A 4W6WA 3WP5A 3ZSMA 1CIWA 4XAEA 3IDBB 4MHRA 5FLHA 1NCQC 1WKYA 3O1OA 5FYBA 4AR2A 3KWVA 2HJIA 5CKQA 1KITA 2D6PA 4YZ4A 4C90A 5A3OA 3LFMA 4OUEA 1NCRC 5FZGA 3PU3A 4BDVB 2RS31 1A6CA 4CU7A 3O1TA 2YFZA 2WT0A 1CAUB 4EJRA 2VOXA 5FMBA 1AX1A 4IGPA 1OT5A 5ABJA 3OGJA 3V0AB 2W68A 4HFSA 3TEWA 5C7GA 1O3QA 2JDPA 3LPGA 1JYNA 1T2XA 1R093 1NLSA 3AXDA 3ILNA 4AI8A 2BGCA 3BCWA 1SFPA 4DUVA 3N7JA 4I3GA 1AL22 1O8PA 4HVOA 1S4CA 3K4DA 1JH5A 5FPUA 4CEYC 4PLMA 1T6BX 4K7JA 3WUDA 1XSQA 3H3UA 3LEKA 4R9BA 2VUDA 3IDCB 4AI3A 5JZGA 3Q8CA 1N47A 1LENA 2AREA 1S0DA 2YZ4A 3D82A 4ORFA 4PHZA 3NAPA 4M3CB 4XUPA 1VB2A 4FFGA 3WNXA 2VPVA 4WM8B 5FZDA 5FXWA 3DGTA 5JPMB 3WQ7A 2VMHA 3THPA 4P5YA 3LD8A 5BYNA 2KD7A 4B4RA 1ENSA 5EPAA 3ACIA 1KDKA 5LBBA 4BXSV 3NJXA 1Y9GA 4E4HA 4W65A 1CGPA 4FP2A 1MPXA 3AFGA 5DDJ1 1EV11 2BNMA 2YYOA 1NX9A 4DY3A 3TAYA 4D7YA 3W21A 3AZYA 4AZZA 4QGLA 3AKTA 3VKMA 4CCOA 2FQPA 2YMZA 4QMAA 4FO9A 3VL8A 4LJHA 2HYXA 4LEJA 3SHRA 4XF4A 4XAAA 4Y1YA 3A22A 1ASJ3 5CB7A 1RUD2 1UMHA 2JX9A 3UJOA 4WVMB 2DURA 5LA1A 3UNPA 5JZGB 1QJY1 4META 2DBNA 3SQOA 2IXKA 3FLPA 4TZDA 4PDWB 1ZRIA 3WZ1A 4GQ7A 3FFQA 2PHTA 1DQ6A 4YVWB 5EZWA 4YFZA 1O7FA 5GLZA 1HJGA 4RQPA 2VQAA 4NHKA 2W1UA 2BVVA 3PNAA 5ANQA 1S2EA 1ND3C 1NLRA 2FMDA 2XBO3 5FXZA 2XJTA 2GC3A 2P3KA 4CDQA 3LA2A 1GUIA 2UYBA 2LUWA 2R32A 4Z07A 3WVJA 1BMV2 1RUG1 4HK9A 4XBQA 1PK6B 3N3HA 3EYPA 2BQPA 1AX2A 1VAVA 3AYEA 5CZKA 1MZ6A 1NG0A 1HX6A 2WAAA 1JOPA 4A2UA 4HPKA 2G9ZA 1BKZA 5ANNA 4GAZA 4QB6A 4LT5A 1POV3 4LA2A 5F2SA 2A5ZA 3LDBA 1FPN2 3PIJA 1Z7S2 4UW4A 1CZTA 3MV01 3S6PA 2HLEA 1MVQA 1PZ8A 3WF2A 4D6SA 2YFUA 1JYTA 4P14A 1XBFA 2DCKA 2KXLA 2W5FA 3MW3A 4WZFA 3VBFA 1G9DA 2NMOA 3APBA 4HSLA 4NUBA 2TNFA 1FI2A 3ETPA 1K42A 3NNFA 4Q4V3 5AVPA 3BB6A 1NA1B 1R092 1WCUA 1RTVA 1IOAA 2VD7A 2V4AA 3DN7A 4ONUA 2LW8A 1W2UA 3DECA 3QOPA 4LO8A 4QXKA 2H0BA 4HL0A 4KL1A 4Y26A 3V0BB 4GD4A 4LQRA 3B3QE 3B01A 4R9AA 3I3EA 2A7AA 2ZAAA 1PO12 1V70A 4XFIA 3ACLA 1MS9A 3NMBA 4Y24A 5CFCC 5JXHA 4D7SA 4TN7A 3AMPA 2VG9A 1UU5A 1ZX5A 4HPKB 3AX4A 2A3YA 4GH4A 4Z1VA 1YQ2A 4QB1A 1VMJA 1RUI2 2QCSB 3DYMA 4AL9A 2W08A 3SNMA 1AR63 4WVVA 1I5ZA 2CHHA 4CXWA 1ODNA 2TBVA 2YXSA 4FSJA 5FO8B 3MGUA 4URTA 1PGL2 4WBBA 1RUH3 4YZ3A 2XHNA 3I49A 4QKNA 1ULOA 4Y5Z0 4HXCA 3CQOA 2A73B 4V2WA 3X29B 3CJXA 4GWIA 1W8HA 1NA1A 3DF0A 2YB7A 1KDMA 5FK7A 1U5YA 2JENA 1GNYA 1SZBA 1O91A 2ET1A 4MGIE 1FV2A 5FZKA 3VZJA 4AQ2A 5B4NA 2WBKA 1LOBA 1QOSA 1L3JA 1JN2P 3VZMA 1VBA3 2DBIA 3MDPA 2ZXQA 4HSJA 4XILA 2HH9A 2A3WA 1ZZ7A 2EIGA 2WZR2 2ZEZA 4Q4X1 5E8AA 4L0PA 1AR61 2O8QA 1X33A 3NWKA 3NNLA 1IZ3A 4P9IA 2WNUB 5LA9A 1J1TA 4HN1A 1UQXA 3D8CA 3WG2A 3AYAA 3B9IA 3DEMA 2WT2A 3D3AA 3M8LA 3LSEA 5EP9A 3RWNA 5JOXA 4KBZA 1XYPA 2TEPA 5CEHA 4HG6B 2H6BA 3MIGA 2HWC2 1D0GA 4XF3A 5GZDA 1RUD1 4LE3A 2GNMA 3AMMA 2VZRA 1RIRA 3A0NA 4X8NA 4XJ8A 2P4EA 5FZEA 3N35A 4NO4A 5LY1A 4LULA 2NQYA 1GV9A 1TNRA 1UD1A 2ZGOA 3VBRC 1EV12 1DZTA 1KJLA 3I3MA 5IW0A 1CZSA 1PIV2 2OXBA 3ILRA 3NV2A 1W8OA 2E33A 1G9AA 3MEPA 1NCQB 2R062 3QH7A 3VBSA 1OQ1A 3OGGA 4AEJA 4JKKA 1DG6A 1G8WA 1NUKA 4CCKA 4K6BA 1X50A 5JAXA 4JV4A 5KC6A 4OI2A 2Q1MA 1PIV3 2PQSA 3O1VA 3G7DA 3O1UA 1FOD1 2IC1A 3MYXA 4HLTA 3OTFA 1VB4A 4W6XA 1KRIA 1SG3A 2C9AA 3VBRB 5DABA 2YG0A 3WDUA 1OUXA 2VGDA 4NR1A 5FY9A 2KA3A 3QCWA 3CMGA 2JDHA 2MEV2 2Y8KA 2R0FA 2A6ZA 3LFIA 3IN9A 3POJA 4XBLA 3ZFEC 1X7NA 3V0AA 5IWFA 4QHOA 1WLTA 2ZX2A 3T1MA 1OH4A 5EYYA 2VNVA 3MHZA 2MHFA 3VN4A 4YG6A 1VBD2 1AYM3 3I2JA 5EV7A 3J8F1 2J1TA 3VGIA 5FXVA 4IL7A 3BODA 1WCDJ 1JYWA 4O7XA 2Q4SA 4XMAA 5CBLA 4P00B 2E26A 4LBQD 4QPYA 4ZY9A 1JYVA 5T50A 1V6MA 3H3ZA 4HMZA 5KXBA 5LCWL 2HWF1 3QLQA 3SC7X 3E97A 3FWEA 4CP0A 4PT6A 2QQLA 4M3CA 1PVC3 3LIGA 1XYOA 3WV6A 5IATA 1NXMA 4JTNA 4L99A 4EZ4A 3MLLA 1QQP3 4KU8A 2NZ9A 4BQ5A 2ZGMA 4K3UA 1RVF1 1N1VA 5BNPB 5FZAA 1OMIA 5C4WC 1RMU3 1UY0A 4ARYA 2EXJA 4YW4A 2HBUA 4H2AA 2E7TA 2WINB 3A23A 3DYOA 1CZVA 2WO2A 2XJRA 2VW1A 2BNNA 5FZBA 4KMQA 1B35A 1E57A 1AYN3 4BHPA 1TE1B 2C26A 3H7JA 3ZFFB 2FD8A 4YM2A 1JUHA 4BK5A 1LOEA 2NM1A 2EXHA 1YQCA 2VH9A 4GULA 1D4M2 2UURA 1O8SA 1YFWA 4MOAA 5I8YA 1F5JA 5EIYB 3EXUA 5FMOL 4H7LA 4RR3A 4N43C 5DZFA 1ULGA 4XW3A 2PHLA 4QQHA 4LBKA 1CX1A 3P6BA 2WSUA 3LKJA 5KXDA 1DBNA 2PYTA 4FI9A 4JAAA 3CZJA 1OD3A 1HKDA 2VZPA 4JHZA 4JGYA 4LBNA 5KWRA 5BPXA 4Q0VA 4NAMA 1FMD2 4R9DA 2O0OA 2WN2A 1VBA2 1DU3D 1QJU1 4NE9A 5A1AA 4D3WA 2RG4A 2WL1A 1V6JA 3PJQA 2ZGQA 1YXWA 4NWWA 3NJYA 1YIPA 5CKMA 2YV8A 2BBVA 5D21A 1UYPA 5IVYA 5H9SA 2VOVA 1ZRRA 3WF1A 1BBT1 4P9LA 4TXWA 2D98A 1B35B 2XQXA 4OHXA 1V6OA 5A3NA 5A6XA 2ARCA 2ZS6B 3MZHA 5F3GA 4XJWA 1D0HA 1MVEA 1NOVA 4NMIA 4CDXA 4IGQA 3QACA 5IHRA 1VIWB 3M3EA 2WAOA 1OLQA 4FOYA 3WP6A 3ZM8A 2GMEA 3M1HA 4DRRA 1NT0A 3HBZA 4QGNA 2CU5A 4NIGA 4B8EA 2A6YA 4Q4Y3 1OA2A 1Z7S3 3HVDA 4L92A 1RHI1 5E6HA 5IVBA 5HPOA 1EAH3 4LBOA 3SKJE 5HV4A 1UIKA 2R061 4A6SA 1OH3A 4AVSA 4IEXA 3WW3A 4CCCA 3V0BA 1AL23 1NCRA 3J7NA 2C9KA 3DKQA 1QXRA 5L19A 4CCMA 1X9PA 2B42B 3K3OA 3BVCA 5EHDA 3N9LA 4TTGA 1W0OA 2XWBB 1Q8SA 1LHOA 4WVZA 2IVIB 5JVVA 1SPPB 2CWMA 3AC0A 4IEWA 2RDQA 1PNFA 1H6XA 1QJEA 3KQRA 4QX8A 3ZPOA 2MPFA 4FFFA 3USSA 2CSGA 1ZRDA 4EWEA 5FPVA 4UW5A 1H30A 4Q2FA 2VL4A 4Q4X3 4QKBA 5J37A 5JMOA 3NJVA 1H9PA 2PHDA 3UGFA 3VZNA 3B93A 4YG0A 3NSTA 4ATFA 5I0UA 2EAKA 4LKSA 5FQ0B 3JQXA 3AL6A 3AZZA 2GAUA 3VD4A 4OQ8A 1ZREA 2JG9A 3LB9A 5CFCA 3RVHA 3SXWA 1AR62 1C8NA 1W6MA 1JHJA 2UWCA 3K4AA 4WM8C 4F7ZA 5ERLA 4CTEA 1ODMA 2XKPA 3CF6E 2C1FA 4QDRA 2FBEA 3C7EA 5F6LB 3VBHA 1I5PA 4BIOA 4BMBA 5FK8A 1TMF2 4R8HA 2QQKA 1NCRB 2A75A 3T2OA 3VBOA 3KD4A 3NV4A 4BK4A 1PM4A 2FDHA 3ZXFA 3WF3A 5FZ9A 1O3SA 1NQJA 4N8MA 2WNUA 3F95A 5C8CB 3E6BA 2J1AA 2JDMA 5T5PA 2ZZJA 3ZMOA 3GBFA 4CEYA 5A32B 5K0UC 2Q1ZB 2GALA 4GZ9A 5FYUA 1UOFA 2Z4FA 2CY6A 4EE2A 1J1LA 4YVSA 3UYJA 2WC2A 3IT8A 2F6BA 4G3YC 5FLJA 3IAQA 1TZOA 2AC1A 5E16A 1LKNA 1YWKA 3VHNA 3CEWA 1W8UA 2OPKA 4XACA 5SV5A 3TB0A 3TEXA 2Y6KA 1CAXB 5DQ0A 3U4SA 4D8MA 3IAPA 2P34A 5FZ4A 5DMYA 2D93A 1PVXA 4RD7A 1R1ZA 1OF3A 2YY1A 3OEBA 4R4ZA 4A6OA 5K7PA 1VBC2 1JMUB 1UPIA 1V6NA 3EMRA 3WDWA 2EXKA 1IHMA 2VQUA 4XURA 4GJYA 4QX3A 2RS52 4GJZA 2DV9A 3RMYA 5J36A 1VBC1 4MGKE 1JZ5A 2WA4A 4IW3A 2VW2A 3AK0A 4AWDA 5C8CA 4P9GA 4ISRA 4OHYA 5FLIA 2VZVA 3WCSA 4LO6B 3VBRA 1Y9MA 1XQNA 2VXJA 2Z69A 1UNBA 3K51A 3MLKA 4SBVA 3ROUA 5LA2A 3Q8EA 3ZDSA 3PIGA 5C3RA 3B69A 3O12A 3VDDB 1UOBA 3WLUA 4B3NA 4JGZB 2NLRA 1AR81 3LGRA 1LESA 5H9RA 4XF0A 5DAPA 1ZBE3 4MH0E 5KHGA 2JIGA 1NAEA 3ENRA 4LUKA 2FDJA 3TOJA 1WWYA 1YRZA 3O5SA 3R4UA 5A7PA 2E63A 3W5NA 1S55A 4AI0A 2F4PA 4Q0QA 4YG3A 3ZSEA 2JG9C 3R0RA 4P9YA 4AI9A 4J1XA 3TN93 2ZTNA 1BK1A 4P9WA 1F5FA 3AP9A 2PHWA 3HEIA 1HB1A 2BJSA 1TMF1 1VPHA 3MFAA 4HKOA 1FXZA 3HJRA 3PVOA 2V5YA 2XKOA 2XVLA 3VV1A 4K1ZA 5IAXA 2ADDA 5L9VA 1U0AA 1J84A 1OVSA 1UOGA 4YZ5A 4XJ9A 2V72A 3RJ2X 4OFGA 5AC93 2DCYA 2VTFA 3MUY1 4DY5A 1WD3A 3BIWE 4LO4B 3USUB 2OX0A 2PAEA 4F3JA 1LHUA 3ZFGC 4KWJA 4AAPA 3GCXA 2WS93 4B4QA 5J96B 5DDJ2 4UWDA 3JUUA 1UZVA 5A7NA 3C7GA 1VBB1 4BYYA 4CUAA 3ZFFA 1US3A 3FZ3A 3H8OA 4FPHA 2OQ6A 1IQDC 1W99A 2RJLA 2WSVA 3PMSA 3RJRA 2BGOA 1UXXX 2D3SA 1AL0G 3H3LA 1DDLA 5DUUA 2C24A 4PIYA 1KFXL 1QXPA 1U5IA 4LHSA 4RR3B 4AEKA 2R49A 5ACA3 3O1PA 2WLPA 1C1FA 3MPBA 5HCHA 4JHTA 4NOTA 1H1MA 1HN1A 1AR83 5FCCA 3BTZA 4JVAA 1IGOA 1UKGA 3B5LB 5JIAA 4BQ2A 4L8QA 2GC2A 3F2ZA 3LA7A 1TMF3 3URFA 2BV4A 1ACCA 2D44A 2VCMA 4QKDA 1LGNA 5I0DA 1AL21 2OVUA 1AVBA 1HJFA 3TRSB 1S0IA 3ZYHA 4MXWA 4XXPA 1ZYBA 3DL3A 4QM9A 4PDWC 4FXKB 3ZLIA 4ET7A 4Q8LA 1STMA 3AZVA 1RUJ2 5JR7B 1ASJ2 4AVVA 4DMIA 1A3KA 4YZ2A 4NWVA 4KGQA 1LULA 3UL2A 2ZHMA 4UXAA 3AZWA 1PVC1 1W06A 3HMYA 4AHYA 3H8UA 4U2AA 1GZWB 5LB6A 5BV6A 3FHQA 3WF4A 2FHRA 3C7FA 5C9AB 5IVJA 3BGAA 2P5BA 5FPAA 5FY4A 1UW8A 1Z78A 4QDSA 1IPSA 1EYBA 4YW2A 5FYTA 3FBMA 4ARXA 2WJSA 5I0RA 1EPZA 2AACA 5LBFA 1ZZCA 1TVGA 5DAQA 3BPSA 4LHNA 1VRH2 5JSOA 3DPRC 1S0BA 5FDBA 5FYIA 2RS11 5KXCA 3W9AA 4K8FA 5FYHA 3UV9A 3RMXA 4J6GA 2RDRA 2W1SA 1UY4A 3AYDA 3CHXA 4MUVA 4QB2A 5T52A 4OHVA 1WLWA 4FPYA 3W59A 4OHZA 1VAMA 4JC1A 2D6OX 3BTAA 5ACA2 1XNCA 4IE5A 2WQ8A 4Y5SA 1EV13 2VTXA 2DF7A 3OPTA 1XYNA 1OF4A 2JDYA 4MGZE 3H9AA 5A6YA 4AFAA 1PGW2 1V6KA 1JYXA 2C5DA 4ASMB 5C9AA 1KEXA 4LK7A 1Y43B 2HWE2 3ZFFC 2RS12 5EWSA 1RVF2 3WNNA 2HWB1 3O1SA 5FQ0A 1Y9QA 2A70A 3GZTB 1MZFA 3R05A 4V2VA 1J3PA 1UYXA 1F2NA 4QGMA 4W50A 1S0EA 3C3VA 1C8M3 3GBGA 1CAUA 3BYWA 1OKOA 1CESA 4RQPC 4CDUB 4QX7A 1EY2A 1UMZA 2WNVC 1SDWA 3O1MA 1UY2A 1LB2A 4YVWC 1TG7A 3PU8A 4QXHA 5DXDA 3U37A 3VBOB 1A8MA 2PLV3 2WT1A 3D6EA 3WG1A 4MZUA 1JODA 1RUD3 4CUCA 5FZHA 5LEKA 3VL9A 4C1WA 4QPIB 3J8F2 5FYMA 4RS5C 2RHPA 4ES8A 2E6VA 4NROA 3WDTA 5A32A 3FX3A 1CJDA 4N9HA 4LBLA 3BI3A 4CXXA 1YI7A 1RGSA 2VMGA 1ENQA 2WR9A 4NHLA 2R063 4M00A 2QBXA 1O3RA 2RM21 4WM7A 1IS5A 4WV8A 1ZBE2 5APAA 1PMHX 3C2UA 1G6NA 4ZU5A 1UZZA 5FIXA 4MADA 3VDDC 1DQ2A 2W2IA 3MIDA 3WHTA 2J7MA 1REFA 4IEUA 3H1YA 4PQQA 1WMXA 2ZGNA 4Q0UA 4FPJA 4Q26A 4XQDA 3SH3A 5HV0A 1FV3A 1GSLA 3DPRB 4YGCA 2OT7A 5SV8A 3NNMA 4ZXKA 2GNTA 2RVAA 1XRUA 2IUWA 4IEOA 2EIDA 3OBRA 1HV0A 5FZ7A 2IXCA 4IV1C 5L7OC 4L9BA 4B7EA 4DXTA 2QTWB 3PJYA 2AENA 4XQWA 4Q8KA 1JU4A 3RS6A 5G04L 4NAOA 3OGSA 2WLQA 1LODA 1UU6A 4B29A 5FUIA 3BUCA 2WN3A 3HOBA 1JTZX 1XE0A 2ZJCA 1XXNA 3VD3A 1MR5A 1IPJA 1Q8VA 3GZUC 2WZ8A 3GHMA 1V9U2 4W6YA 5A70A 1ZA4A 3ZR5A 4JGZA 4UW6A 1RJ8A 1ND2A 1O4YA 1LU1A 4YNIA 5HI0A 5I93A 1ENXA 4D6RA 4JGYC 1PVC2 3V64A 2WA3A 1N3PA 3H7YA 4FAGA 3K77A 1W8ZA 4S2DA 3JCIA 1GU3A 1PO22 4TLFA 3AJYA 5EFUA 3B02A 2VZQA 1W2TA 1HXS1 2ZGPA 5FYCA 2UWBA 1X82A 1RINA 5K9YA 4M0HA 1H2KA 2FDIA 1M06G 2P17A 4LHLA 5LATA 3ST7A 1H4HA 4ASKA 3D0JA 1GWLA 1GLHA 2XMLA 2W92A 4XUNA 2ZGSA 5G05L 5BNQA 1RUF1 2B39A 4KGGA 5FY0A 1OFSA 5CYYA 4DS0A 2EVXA 1RB8G 3O0WA 3AVRA 1POQA 3LOIA 2LROA 2XHKA 2ZEYA 4CCEA 2JJ6A 2R041 1CQ9A 2CV6A 1RUG3 3VBFB 1MS3A 2XQRA 2D3PA 3NV1A 4AFBA 3B9CA 3RWKX 1UCXA 2Y6JA 3J9SA 2X05A 1AXZA 1JZ7A 1SBEA 3CL1A 3RRDA 4XUTA 5JPNB 3RYPA 2G4IA 5J7MA 1NE6A 2XBO2 4EQVA 2W87A 3QBQA 3JU9A 1IG0A 4LPLA 2GU9A 5F39A 1DFQA 1PO11 2N7GA 1RVF3 3I7DA 2D40A 4JDMA 2O1QA 1IKPA 1YFYA 1MEC3 1YFXA 2ATFA 3V65A 3UT0A 4BIFA 1C5HA 4CP2A 5HBAA 1ZNPA 3P3NA 5FYYA 1YFUA 4XFHA 2Y60A 1CVNA 3M4FA 5F7UA 2VU9A 1RMU2 2O14A 3BIEA 4LITA 4QD2A 1W6OA 2BNOA 1QJX1 3POEA 4LA3A 5BUVA 5D8AA 1UMIA 1Z7S1 1ONAA 2Y38A 5I0TA 4DOUA 1RXGA 1UIJA 4XDQA 1JZ2A 2DUOA 3M2MA 3SEPA 5LRSA 1SMVA 2VC9A 1VRBA 1DGLA 4P9XA 3GF6A 3HN3A 5FP4A 4BM8A 4NN0A 2PELA 1AHSA 1OUSA 4LOTA 4LNVA 1LTEA 4OUMA 4AHWA 3T2TA 1GNHA 1LOFA 1RUI3 2QQMA 3QH6A 1MACA 5BXXA 3SEEA 2HEYF 4Q29A 4S2HA 4UOJA 4BLIA 5T55A 2VZTA 3UK9A 1HN0A 4M4PA 4JRLA 2RMU3 3WT3A 3ES1A 1UU4A 1W9SA 2ET7A 1HQNA 2JXAA 2YU2A 4L97A 3GNEA 4IE7A 5FY7A 4S2GA 4Q4V1 1HLCA 2DVBA 2XVKA 3A7QA 4Q5OA 4FVVA 5K0UA 4XJZA 5HCAA 1PMIA 5L9BA 1W9YA 1ZBA3 1HRI2 4N7IA 2DUQA 4XTMA 2VOWA 3T2QA 1QJU3 1IS4A 3K2OA 2EF6A 1V00A 5GZCA 2WYFA 3VHPA 1Q5OA 1GP4A 1QJY2 4ZU7A 1DF0A 2PLV2 4MV2A 4V1PA 5JDBA 4NIDA 4TYSA 1AXYA 2B45X 2XBO1 3ABZA 5DPNA 4CZSA 4BZ4A 4XEZA 4GWMA 3VBFC 2HWD2 1LRHA 5DAXA 4H14A 2XLFA 2XJSA 1BK0A 3Q8AA 1OVPA 1DGWX 4CSWA 2RS33 3C7OA 1W3XA 2FCTA 5FZFA 3I2IA 5FZ0A 4EYUA 1QHDA 4OZXA 3CNAA 4N7UA 1NCQA 1TNFA 5ISLA 4PF1A 1UPSA 1B09A 2D5FA 1BHGA 2VBBA 2D97A 5F6KA 1C4RA 1ZZ6A 2WZEA 4IE6A 2JD4A 4YM1A 3W58A 1EUTA 3ETQA 3MICA 1A34A 3FLRA 3U78A 2A1XA 2J1VA 2TUNA 3LA3A 4FPFA 4YM3A 5CADA 2VR4A 5FKBA 3I3BA 1W9TA 3OOXA 3PVNA 2DVFA 4K40A 2ZMLA 4N53C 2YHJA 4UYBA 1YYNA 3N7MA 3CJIB 2OPWA 3T4HB 5CG8A 3Q8FA 4AQTA 3ZXLA 1ULEA 1Z0HA 1H2NA 4YW5A 3R4DB 1K45A 3FHIB 4Q4Y2 1HXS2 1W0NA 4YSFA 5GJ6A 3ZR6A 2V4VA 2YGMA 1VBE1 4R52A 4DZGA 2FDKA 5FPXA 5IVFA 1BBT2 4AVCA 1QH6A 1VMHA 3AL5A 4BOWA 4D69A 2ZZQA 2QKDA 2D7FA 4YFWA 5JUVA 3E5XA 5FTTC 3N36A 1WBFA 4OI0A 1JBCA 2W95A 4WVMA 1DYOA 1QJU2 1X8MA 5C70A 3AMNA 4YVWA 5F32A 2C0ZA 2BVBA 3ZO0B 4CA9A 5E88A 4H55A 1PX4A 3DXTA 3KF5A 4RFT0 4QPWA 1RUOA 4FOWA 5BNPA 5JXIA 4LUMA 1AXKA 3RGBA 4BQYA 3ES4A 4QX1A 5C6CA 1XE8A 3EQEA 1QJZA 1LCLA 1W6QA 4N53B 4UFKA 3SH4A 1IG3A 2CNAA 3VD9A 2P6CA 4WM7C 1HRV3 1XNDA 4K8RB 4PI2A 2QQJA 1ZRCA 2FMYA 5CA6A 5IUQA 5JSRA 2W47A 5FWEA 2QVSB 1UN1A 2ZAHA 3NJZA 3LE0A 2OYZA 2DVAA 4FTSA 1S2KA 3MIBA 1UX7A 3S57A 1K5JA 4BQWA 5C3QA 4CU6A 2B5HA 1APNA 4UFJA 4GALA 4EN7B 2AZ5A 3I3QA 4AQSA 5LASA 2BOJA 1ULCA 3KQ4B 4GB33 4YLZA 2V09A 1ND2B 4XUQA 4HT1T 2VM9A 2CDOA 5C4WB 1AYM1 1VBC3 1PK6C 4XMIA 2HWF2 4Y33A 1FNYA 3LWCA 5L36A 1C3HA 2E31A 1MZ5A 3LEIA 4KH9A 1GFF2 1ULPA 5GZFA 2VZUA 3SH5A 1EUUA 2BYVE 3GDBA 2BZDA 1W6QB 4N53A 4NIHA 2VZOA 2A71A 2B7YA 2GP5A 2HEVF 2HWE3 3FBYA 4Y22A 2HKXA 2RR11 4BISA 1VBD1 4GH4B 1F4AA 1SBDA 2ETEA 4J25A 4N43B 2ERFA 4PIZA 3ZYIB 4CDXB 1JOBA 4XFCA 2AUYA 1YC61 2WWJA 3UETA 1PX3A 2JD9A 4RA0A 5IVVA 4QX2A 3OD0A 1CN1A 4WZCA 2MEV1 2BU9A 4HANA 1OPMA 1A78A 1UZYA 2VVFA 3I2KA 4E2QA 5LZ6A 5DAWA 4BA6A 4NPRA 2YDEA 5BNNC 2WO7A 3AP6A 4XYXA 4DB5A 2PA7A 4DPNA 4BQ3A 5ACA1 1V6IA 1VRH3 4KG8A 5CU1A 2G9FA 3ZN4A 1SBFA 3POIA 4JQRA 4ASLA 1CPNA 2XGXA 2BTVC 4OYUA 2GN7A 3JB4C 4XQ4A 4RHV3 1PIV1 2GSYA 2VMDA 2JG8C 2Q8DA 1SPPA 1DQ4A 1GWMA 1AF9A 1NY72 2ENRA 4RS5B 4M4RA 1JI6A 4IDZA 4Y22B 1R1A2 2OKXA 2DYCA 1QXJA 3FMGA 4OUSA 3TN92 2UWAA 4G9SB 3SLIA 2VNRA 4NPMA 3RNSA 4AFMA 1PHMA 2QQIA 3ZXEA 4AW7A 4CDWA 1AZDA 2SBAA 5KBFA 1WGPA 3HNBM 4IXLA 2ILMA 1OOPC 4BCUA 1WCQA 2WO3A 5ABJC 4LIUA 1V6LA 2VBDA 1W6MB 3UKTA 4COWA 3RZKA 5E1RA 3POGA 1AJOA 1H1IA 3PLQA 2CGPA 1AR73 3HQXA 1RUJ1 3LZZA 3W20A 1DLCA 1F9KA 1HQWA 2UY9A 3UGGA 3IMMA 3PURA 4Q4X2 2K46A 1QIQA 5T5OA 4Q4W1 1CAWA 3H42B 1JHNA 2C4XA 4YGDA 1TME3 1G9BA 2YPDA 2W3JA 4H7MA 4RS5A 1WMDA 1UX6A 3TYJA 3T2PA 4Q4Y1 3ZXAC 5F37A 2WRAA 4GB31 1RUE1 1W9FA 3AYCA 3MIEA 4CEYB 3K48A 5F5CA 5FY8A 4I30A 2BEOA 2VBPA 3TEZA 4IV1A 1DQ5A 5GALA 1IQAA 3ZIWA 1ND3B 5LK7B 2R1DA 1HXS3 4PF5A 3RG0A 3WP4A 2LM3A 2IZWA 2DU0A 3GALA 1LHNA 4CP1A 4XHBA 2DTYA 3THTA 2ZX0A 3U1XA 1BVVA 3AKRA 5FO9B 5JOYA 2J1EA 3JB8A 2NP0A 1RUH2 3AZXA 4NVPA 2Y26A 3TNPB 4RGKA 2XUEA 1BEV1 4LLOA 1LHVA 1OA3A 1H8VA 3NQHA 4JGZC 4ITCA 5AFBA 2PTMA 2Y64A 2ZHKA 3MV11 5LWBA 1VBB3 3TNQA 3OEAA 3T4VA 1CAWB 1D2SA 1ZBA2 3I2OA 3N9NA 4A42A 5C3SA 1XNTA 2VTXJ 2QQPA 2HWC1 3IDAA 1VLNA 1O4TA 1J3RA 1JXNA 1LOGA 4Y20A 2VNOA 1HB2A 5FP8A 1FOD3 3ZYJB 1DP0A 4DXRA 1D7PM 2R1BA 3KMHA 4ISQA 1UXZA 4AEDC 2E32A 1CD3G 1ND3A 1YJKA 2ZEXA 5A3WA 3OGRA 1XNKA 2DCJA 4KWLA 5DG1A 4CDQC 5KHJA 2J1UA 4NHYA 3IPVB 4H3WA 4CXYA 1URXA 5TSWA 3H1MA 2QQWA 2ZBJA 3UJQA 1IKQA 1W9WA 2NPIA 4CDWC 2V5DA 3OPWA 3A21A 4BB3A 3N4MA 2LRPA 4MGYE 3MW4A 4XF9A 1Y7BA 3M3QA 2BOIA 1AR82 2PAKA 2YROA 4GXLA 4KU7A 3NNJA 3T0AA 4QAWA 1N1SA 4E8DA 2RJ2A 3CDZB 2R7EB 5FXXA 3T3YA 4XABA 1BVP1 3WG4A 1PGL1 3THCA 2JKXA 3THDA 1CPMA 5C8WA 3GGLA 1SHWB 4D0QA 1W8FA 1QJX2 2XJQA 3JD71 4GIQA 3KT1A 1I9RA 3BALA 4OHWA 4PIXA 5F3EA 4CU8A 2LS6A 1IPKA 3LPFA 5D1IA 5DDJ3 2IFWA 1GOHA 4HVRA 1RUE3 4FPEA 2H6CA 2JB4A 1V9U3 2X29A 5FZIA 2R072 1H8TA 2P3YA 3OJBA 3J7HA 3KV5A 1HW5A 2WQZC 3IM0A 4ZONA 2DU1A 2W46A 1YLLA 4MLOA 3ZN6B 1E5HA 2WO1A 3LAGA 3N9OA 3ACFA 4XDPA 5C71A 2P6HA 1U5XA 3AP7A 1JZ4A 1PO23 4KBBA 4F83A 4ZZ5A 1DIWA 3O0VA 1RUH1 2R0HA 5A3TA 1W05A 2R043 2VMCA 1OURA 3RZJA 4GWJA 4MXVA 5FZ8A 2ZGTA 4SLIA 2FCVA 2ZPXA 2ZKLA 3OUIA 3OBAA 3K4ZA 3TEYA 2E9QA 5L7OB 3RYRA 1F8VA 3BN6A 3R4SA 2R042 5LBEA 2OA2A 4MGQA 2FZ2A 2BFUL 5JCTA 3KGLA 4XFBA 5BNNB 1M4WA 4LBJA 2X5IC 4CCLA 5F8PA 1RUF2 3H8XA 2QQNA 2VULA 2VQTA 3I3DA 3LEGA 4R9CA 5D8AC 5JSPA 3AXEA 4MXWB 2WWSA 1EP0A 1DQ0A 1RUG2 4J1WA 1BMV1 3WDXA 1TME2 3VDAA 2CYFA 4HBNA 3RI9A 1VALA 2PMWB 5AC91 5LK5A 4AEDA 3I54A 2XG3A 5F3CA 4AVAA 2L9LA 3ZN6A 4E2GA 1MQTC 2JDKA 5M0TA 3KGZA 3VZLA 4EROA 5BY5A 5FZ6A 1KQRA 4XZPA 2Z2SB 4HVQA 2A3XA 3N9QA 1ULDA 1PMJX 2ZABA 2Q8EA 1QNYA 3Q8BA 3ZMNA 1JS9A 5C3OA 5A7OA 1SLCA 1OC1A 1K5MC 2W1WA 3IB3A 2XVGA 3L2HA 3MF9A 2WZPP 3RYKA 2FZ1A 3ZFEB 5CFCB 3N9MA 4QPGA
chains in the Genus database with same CATH topology
1J58A 4K20A 2V73A 4JCKA 2QZ2A 3PHMA 1BEV2 1ULFA 3POWA 1GICA 5L73A 2BPA2 1S0JA 3ATGA 2QFEA 5IK5A 3KCXA 5FOBB 2XJUA 3VBSC 4AQ6A 1RHI2 2ES3A 3B00A 3WCRA 2I07B 3PVBB 4FOQA 5KC5A 1C8M2 1QH7A 4IQPA 4PLOA 3SMHA 1XE7A 1RUE2 1WW5A 2VECA 4XJAA 4EN8B 4Z8BA 5EXOA 4WM8A 2IFRA 1BJQA 3VKFC 3ZFEA 1IS6A 1CAXA 1COV1 2K2SA 1X36A 2RE9A 4I0WB 4Q4W2 2R16A 2P2KA 3OYWA 4YW3A 1MS8A 2P3IA 2RR12 1RJ7A 1KS4A 1HRV1 4IESA 4IEYA 3GYDA 1RUC1 2BWCA 5FREA 1FMD1 3M3OA 5E89A 3G6JB 4E4ZA 4FAHA 2HWC3 1OQDA 3PVEA 4LO5B 1AJKA 4ATEA 2RS32 1VR3A 5DUWA 4M3CF 2Y0IA 4DRVA 4MX3A 2GMPA 1AR71 4UW3A 3WR0A 2R6QA 4BWOA 3TN91 2LTNA 3CJIC 3ECQA 2G9GA 4X8PA 3WY6A 4I3PA 4TWTA 1GNZA 1O4ZA 4I0AA 4RQPB 5DZGA 3VBUA 4AEMA 2OUJA 4HK8A 2XH6A 1BYHA 1I6XA 5KHHA 3HN1A 5BNPC 3SCHA 3OCPA 2B46X 4GWNA 5EYXA 1K5MA 4DFSA 1Q8PA 3ZXDA 3DPRA 5KHJA 4PCRA 1FX5A 4UBGA 1XU2A 3WDVA 1I3HA 5AVAA 1PK6A 4FPKA 1VBE3 4IEZA 4XETA 3OF1A 3A0KA 2ZKNA 4AF9A 5C8CC 1OSGA 5IK7A 3VHRA 3CLPA 4AVBA 3SISA 2VUJA 3EHKA 4RR3C 4I09A 1A8DA 4LE4A 4YGBA 2WNVB 4Q4W3 3ALQA 1JUIA 1VRH1 2GDFA 1OFNA 2H0VA 1WW4A 3ME2A 1UF2C 3OY8B 3VZKA 1DLLA 1CR7A 3USUA 3KZ4C 3TBDA 2E7AA 3QD6A 3VLBB 4DXZA 4Y1XA 1RUC2 3UKNA 1HV1A 1HRV2 4Y1ZA 4RHV2 4BH9A 2MEV3 4FPCA 1GZCA 2MNGA 1LR5A 2I2SA 1EPWA 1WW7A 4AXOA 2GC0A 3V56A 1RHI3 1RUF3 4BE3A 1CX4A 4E2SA 4LLFA 5KXEA 3KSCA 5J3UA 1AYM2 5CFDC 3FE5A 3JBG2 3MPPG 3FFZA 4MVTA 1GKBA 1HQLA 3MFCA 4FTBA 4Z82A 1WMEA 2HYKA 5FRAA 1ZM1A 4C91A 5JI7A 3AMHA 3OY8A 1KD7A 2LALA 4KWKA 5HCBA 1LGBA 3SCFA 1WW6A 2IXHA 4CEWC 2RMU1 1LEMA 4XOGA 3VUOA 3ZXKA 3CU7A 1WMFA 1EAH2 4JDOA 1OI6A 2DFCA 4QX5A 1GQGA 1LGCA 4XBNA 5CNAA 1LU2A 2RS13 3B7MA 2HWD1 4G4FA 1WBLA 1GYKA 2JG8A 2VXRA 4WVWA 3D5OA 5DG2A 3S7IA 2VOKA 2RS53 4YM0A 2XLAA 1H8TC 1H2MA 3M7AA 1JYCA 5GZEA 4YZ1A 5L7OA 1LOAA 3ZIXA 1QKQA 4A7YA 2R073 1S1AA 5ABJB 2ZACA 5D8AB 1MS4A 5JIUA 2WZR1 2IXLA 4AVTA 4B7KA 1AR91 5AC92 2RM23 1TME1 2JEMA 3RDIA 1R081 1YNAA 3OBTA 4M0NA 3ELNA 4L2NA 4YARA 4HETA 4KG0A 1Y3TA 3ASIA 1SCSA 4XFFA 3VBSB 2PHRA 1FATA 3WW2A 3PMEA 1H9WA 5FMOS 1HRI3 2JG8B 2OIIA 4M3CE 5F9TA 3VKOA 5AFEA 5EJ3A 3NAPB 4XHXA 1R1A3 5CAZA 3AFKA 1RMU1 2B8MA 2DTWA 3AKSA 1R083 4XIOA 1G7YA 2GN3A 2BFUS 1QDOA 1GQHA 1QQP1 3AP5A 4CDUC 5F5QA 2ZGUA 2WZR3 1WCSA 1QMJA 1T6GC 4D94A 4K9SA 2BW8A 5KHIA 2ZMKA 1UKRA 5B2GB 1HDKA 2R071 4QPIA 2I74A 2AYHA 1FYUA 2PLV1 3MW2A 2DWRA 5J98B 2DVDA 2WFF1 3VKNA 3RI8A 1OKQA 3ZSJA 4QM8A 3I2DA 5C33A 3J26N 2WKKA 2DCZA 2XL7A 3IDEA 4HZFA 3HR9A 4Q4V2 3BOPA 2Z5WA 1ZVFA 3NKTA 3ZYRA 3RPQA 2K9ZA 2Z79A 3KS7A 3PTYA 4UBHA 4IEVA 4D7TA 5BNOC 4U36A 2W52A 2CAUA 2ZX4A 4CDQB 1DGRA 3OYWB 5I8TA 3BPZA 2QZ3A 4A7KA 4XJUA 1H4GA 4AI1A 2VNGA 4XIKA 4BQ1A 1YCIA 5JZGC 2GC1A 1PO21 2CGNA 4LO7A 3VHOA 4EN9B 4Q0PA 4EWDA 4A7ZA 4Z92B 2VW0A 1DHKB 1AR92 1G9CA 1MS0A 3RQ0A 1BZWA 3KCYA 1H1AA 1FAYA 2Q30A 3WOGA 4OI4A 4Q0SA 5GLVA 5T3NA 3WW4A 5CFDB 2WNEA 1LOFC 4INDA 3GHNA 2ZCWA 3POYA 1V9U1 1X8EA 3H50A 4X6RB 1H0BA 2OZ6A 4JGYB 4AHXA 5IK4A 2Q0AA 2RR13 1QJX3 2EXIA 2I45A 2GNDA 4XTPA 2A6VA 2HEWF 3HD8B 4XXAA 5A33A 3DKWA 3FC0A 3ZFGA 1FNZA 1K5MB 4FQZA 3E5UA 1ZRFA 5FAXA 4MYEA 4ES9A 2A6WA 2WIIB 1MEC1 3HAGA 2Q8OA 1GANA 2PHXA 1EAH1 1ENRA 1LHWA 2SLIA 4IERA 3J8F3 1RUNA 4Z2WA 2W0XA 3U0ZA 1MS1A 2D43A 2E7QA 2ZOEB 3WQ1A 1W6NA 3N7KA 5H9QA 1SFNA 2UY8A 3LSDA 2RM22 2UYAA 3HWJA 4HN0A 1DGWA 3B94A 2DUPA 4NHMA 4DQAA 2X5IA 5JWPA 3I8TA 5K8SA 4RSUA 1Q8OA 3AJZA 3VBHC 1PZ9A 5LRRA 3ILFA 5BNOA 4LR4A 1G9FA 4PBPA 5I91A 5CVRA 4OI1A 3WXPA 2IXJA 4MSVA 4RL7A 3L9JT 1AUYA 1Q3EA 1W6PB 3U4XA 3I59B 2ZGLA 4AK3A 2WNUC 4RHV1 1PNGA 1LJ7A 3NW4A 3ZPYA 1GR3A 4JDNA 2ARBA 1DZQA 4AI2A 1TQ5A 1NYWA 1KXGA 3NO8A 1PZ7A 4GA9A 4GKYA 5I8SA 3VZOA 1R1A1 4Q1PA 3S7EA 3IBMA 1QOTA 4AHZA 3HT1A 1NY71 2DFBA 2HWE1 4QPGC 3JQWA 2OUHA 1WD4A 3RG0A 1F31A 1SEFA 3AB0A 4FPGA 1D4M1 1PGW1 2X5IB 2PHFA 3POSA 5DZEA 4K1YA 5T5LA 2VUAA 3ZVXA 1VBD3 3GBWA 1YI9A 1W6PA 4LBMA 1ZBE1 3I59A 2EALA 1LECA 5K0UB 2GH2A 1D4VB 4FQ4A 3J4UH 4R4XA 4YVSB 3UKVA 2BUKA 3I4IA 1OLRA 1OOPB 3LCPA 1SQ4A 3ZSLA 1SLLA 2K0GA 4Q27A 3AM2A 4DNYA 1XU1A 4GMP1 4I01A 3O14A 2ZA9A 2EA7A 1N1YA 1NE4A 5HCFA 5GLWA 1C57A 3D4KA 1S0FA 2YC0A 2ZX1A 1DZRA 1H2LA 1ASJ1 3A4UA 1WLCA 2HWB3 3EBRA 1RUJ3 1D2QA 2AR6A 3E6CC 3WQ0A 4ZKTB 3FUOA 1N3OA 2CL2A 2Q5TA 3WHUA 4BPZA 4AGRA 2OW4A 4AFDA 1YIFA 2HWB2 1VAKA 1RUC3 4IV3A 2XB6C 3WINE 2VQ0A 4IV1B 4XFAA 3JBG3 4XFGA 3BOWA 1U5ZA 2ZMNA 3VDDA 3CJIA 3LOBA 1C8M1 3IWZA 2CAVA 4ZU4A 3U10A 1AX0A 1LOCA 1DGRN 3VBUC 3WW1A 4AGGA 3CO2A 3N7LA 1ZZBA 1W0PA 2YGLA 1MEC2 1OHFA 1NQDA 1CONA 1RITA 4TSVA 2OZJA 3MIFA 1MS5A 4QHBA 5T5JA 1GBGA 1WCKA 4E4DX 4EN6B 5IK8A 1O5UA 2NN8A 2O8OA 1QU0A 2X8KA 2CTVA 2HWF3 1CAVA 1QWRA 5HXVA 1WLDA 2AGSA 4QPIC 4FTEA 1HIXA 2WQ4A 3FJSA 1OD5A 3VBOC 1ND2C 3TWIA 1KFUL 2IXIA 4GKXA 4CYDA 4HKLA 2YPJA 2QNKA 2VVEA 2XL9A 2XJVA 1VBE2 4C1XA 2ZHLA 4BLJA 5CIRA 3D0SA 3KM5A 3IPVA 4O9EA 4QQLA 4LBQA 5FBZA 1D4M3 1WA4A 1OA4A 2GNBA 4YGEA 4YVSC 2D6MA 1UL9A 3E6DA 5GM0A 4Y1VA 1YHFA 1MQTA 4B4PA 5IT6A 1N3QA 1XNBA 5CFDA 1BBT3 4KQ7A 1IS3A 1MZEA 1J3QA 4XF1A 5FFOC 5J48A 3S0MA 4E27A 4P5HA 4FP3A 2JKBA 1CAVB 4O9GA 5C4WA 1JOJA 4HKWA 2YUEA 1DYPA 3KT7A 1RUI1 2WFPA 3AP4A 4COYA 4COVA 5A33B 3ZFGB 1Q43A 1C28A 1KS5A 4IV3C 3FLTA 4Q1RA 4CEWA 1H8TB 1KJRA 1VBB2 1FMD3 1JYIA 5CG9A 4GMP3 4LBQB 2RS51 4OULA 4A3XA 2JECA 1BCXA 4N43A 4GH4C 2PQQA 2W39A 4PBOA 1LEDA 2P3JA 3ZX7A 2NYYA 3U07A 2AH2A 2B9UA 1HRI1 1O5LA 1QQP2 1R091 5C9AC 4FBFA 2D5HA 2DCTA 2GZWA 1W6NB 4PJYA 2Y0OA 2JG9B 5LEJA 3JD72 3KB5A 2QDNA 4DINB 3M3CA 1QY4A 4KNCA 3RSJA 3MIHA 1NA1C 1AYN2 3INAA 4XE9A 1OQEA 4YW1A 3VBHB 1FPN1 1ZZ8A 2D6NA 1JW6A 3BU7A 4N90A 5H9PA 2JE7A 3NKGA 1W39A 2RJKA 1REDA 2ARXA 3NAPC 5BNOB 4X6QB 2XLGA 1QNWA 1FT9A 4P9JA 1AYN1 1BQPA 5FPZA 5JOZA 4FPLA 4LHKA 4IEQA 2E53A 4Y1UA 2D3RA 4OVEA 5DUVA 3DUIA 1QJY3 4CRQA 4CDWB 3R6SA 4F8AA 1ALYA 4FXGB 1POV0 5J09A 2ZX3A 2WFF2 3M70A 1RC6A 2D6LX 4QPGB 3WP3A 4IETA 3ZN5A 5I0SA 1RL3A 2E51A 3ZYPA 3EO6A 1C5IA 1ZBA1 4RGAA 4CDUA 2PAMA 1BXHA 2QE3A 4I02A 4QQPA 2R30A 4YYOA 4LTAA 1S0CA 1SACA 3DV8A 2XPJA 1N1TA 3AKPA 1YO8A 4I0BA 2PHUA 3MF6A 3H1WA 3O7OA 1G86A 2GH8A 4FPOB 2KM2A 4EN0A 4PQ9A 3KCCA 1O3TA 4PDWA 4WM7B 1PM7A 5FOJB 1OOPA 1S0GA 1VJ2A 4C0BA 2UU8A 2VVDA 5A3MA 1SLBA 1ZZ9A 1Q8QA 4OLLA 2QJVA 4COZA 3WG3A 4GB32 5GLUA 1REEA 3OD4A 4AE2A 2JICA 1R082 2GMMA 3SITA 3H0OA 1NXD1 2CWSA 2VMIA 3IKWA 3WX5A 4AG4A 1YJLA 4RGGA 1PGSA 1PO13 2JDZA 3IIAA 3RZZA 1VBA1 4Y20B 5JOWA 4IV3B 5JLVA 3KT4A 1Q56A 2XWJB 4FT8A 2BWAA 3NL1A 4E9KA 2D6KA 2P37A 1J59A 5F1RA 1COV3 4AYUA 1SCRA 3MLJA 3U11A 3ZSKA 4I2OA 2IWGB 2VY0A 3VBUB 4YRDA 1SLIA 4C0HA 5FO7B 3AMQA 2ZGKA 4IEPA 4S2FA 1YUDA 4M01A 3FUQA 3MI8A 1AR93 1VP6A 2RMU2 3HIFA 3HT2A 4EWAA 3WD5A 3S30A 3JZVA 4JTOA 4FOVA 2DVGA 3NV3A 1TEIA 3OPZA 3JD73 5GKAC 1SLAA 3SCGA 5A3LA 3KLSA 3E5QA 3GZAA 3NVCA 2WNVA 3JBG1 4QT6A 2ZHNA 1B35C 3M3IA 3EJKA 1FPN3 3ZXJA 2JE9A 3T1LA 1AR72 4AFCA 2HWD3 1SFYA 2QDRA 4FCAA 1QF3A 2PFWA 2PN5A 4L11A 4QQ2A 5DUXA 2WS91 4JRAA 1S2BA 3ZYGA 5KHKA 3WUCA 4EV0A 2XUMA 1CJPA 1GZWA 4QQOA 4CDXC 2WS92 1QOOA 4AGVA 1BEV3 1MQTB 3VKLA 1WUVA 4XPVA 3AKQA 2WFF3 5JI9A 4K21A 1COV2 5GLTA 1UAIA 2NMNA 1GZ9A 4COUA 3WDYA 2A6XA 5GZGA 5BNNA 3ZXGA 2XJPA 2EAAA 3O0XA 1QGLA 4E4SA 3L2YA 1C1LA 1W6OB 3Q9OA 1OPOA 1FOD2 4BMEA 2ZGRA 3IMNA 4PLNA 1POV1 3P3PA 4CEWB 2QUOA 1U12A 1QDCA 4GMP0 2CGOA 4AEDB 2X53S 5T54A 1DYKA 5JMCA 1I1EA 1SLTA 4Y4YA 4QU2A 1NZCA 2Z42A 4N9IA 1DQ1A 4W6WA 3WP5A 3ZSMA 1CIWA 5FLHA 3IDBB 1NCQC 2HJIA 1KITA 2D6PA 4YZ4A 4C90A 1NCRC 2RS31 1A6CA 2WT0A 1CAUB 4EJRA 2VOXA 1AX1A 5ABJA 3V0AB 3OGJA 2W68A 4HFSA 1O3QA 1R093 1NLSA 3AXDA 3ILNA 4AI8A 2BGCA 3BCWA 3N7JA 4I3GA 1AL22 4HVOA 1JH5A 4CEYC 4PLMA 4K7JA 3WUDA 3H3UA 4R9BA 4AI3A 5JZGA 3IDCB 1N47A 1LENA 2AREA 1S0DA 2YZ4A 3D82A 4ORFA 3NAPA 4M3CB 1VB2A 3WNXA 2VPVA 4WM8B 3DGTA 5JPMB 3WQ7A 2VMHA 3THPA 5BYNA 4B4RA 1ENSA 1KDKA 4W65A 1CGPA 4FP2A 3AFGA 5DDJ1 1EV11 2BNMA 2YYOA 4DY3A 3TAYA 4D7YA 3AZYA 4QGLA 3AKTA 3VKMA 2FQPA 2YMZA 4QMAA 4FO9A 3VL8A 4LEJA 3SHRA 4XF4A 4Y1YA 1ASJ3 5CB7A 1RUD2 2JX9A 3UJOA 4WVMB 2DURA 5JZGB 1QJY1 4META 4TZDA 2IXKA 3FLPA 4PDWB 3WZ1A 4GQ7A 3FFQA 2PHTA 1DQ6A 4YVWB 5EZWA 4YFZA 1O7FA 5GLZA 4RQPA 2VQAA 4NHKA 2BVVA 3PNAA 1ND3C 1NLRA 2FMDA 2XBO3 2XJTA 2GC3A 2P3KA 4CDQA 3LA2A 2UYBA 2LUWA 2R32A 4Z07A 3WVJA 1BMV2 1RUG1 4HK9A 4XBQA 1PK6B 3N3HA 2BQPA 1AX2A 1VAVA 3AYEA 1MZ6A 1NG0A 1HX6A 4A2UA 4HPKA 1BKZA 4LT5A 1POV3 4LA2A 2A5ZA 1FPN2 1Z7S2 4UW4A 3S6PA 1MVQA 1PZ8A 4P14A 2KXLA 2DCKA 4WZFA 3MW3A 3VBFA 1G9DA 2NMOA 3APBA 4HSLA 2TNFA 1FI2A 5AVPA 4Q4V3 3BB6A 1NA1B 1R092 1RTVA 1IOAA 3DN7A 4ONUA 4QXKA 1W2UA 3QOPA 4LO8A 4Y26A 2H0BA 4HL0A 4KL1A 3V0BB 3B3QE 3B01A 4R9AA 2A7AA 2ZAAA 1PO12 1V70A 4XFIA 3ACLA 1MS9A 4Y24A 5CFCC 4D7SA 3AMPA 2VG9A 1UU5A 1ZX5A 4HPKB 3AX4A 2A3YA 4GH4A 4Z1VA 1RUI2 2QCSB 2W08A 3SNMA 1AR63 4WVVA 1I5ZA 2YXSA 2TBVA 4FSJA 5FO8B 3MGUA 4URTA 1PGL2 4WBBA 1RUH3 4YZ3A 4Y5Z0 2A73B 3X29B 3CJXA 1NA1A 3DF0A 1KDMA 1U5YA 2JENA 4MGIE 2ET1A 1O91A 3VZJA 4AQ2A 1FV2A 1LOBA 1QOSA 1L3JA 1JN2P 3VZMA 1VBA3 3MDPA 4HSJA 4XILA 5E8AA 2A3WA 1ZZ7A 2EIGA 2WZR2 4Q4X1 1AR61 2O8QA 1X33A 3NWKA 4P9IA 1IZ3A 2WNUB 1J1TA 4HN1A 3D8CA 3WG2A 3AYAA 3B9IA 3M8LA 2WT2A 5JOXA 3LSEA 3RWNA 2TEPA 1XYPA 2H6BA 3MIGA 2HWC2 1D0GA 4XF3A 5GZDA 1RUD1 4LE3A 2GNMA 3AMMA 1RIRA 3A0NA 4X8NA 4XJ8A 3N35A 4NO4A 4LULA 2NQYA 1GV9A 1TNRA 1UD1A 2ZGOA 3VBRC 1EV12 1DZTA 1KJLA 3ILRA 1PIV2 3NV2A 1G9AA 3MEPA 1NCQB 2R062 3QH7A 3VBSA 1OQ1A 3OGGA 4AEJA 1DG6A 1G8WA 4K6BA 1X50A 5JAXA 4JV4A 5KC6A 4OI2A 2Q1MA 1PIV3 3G7DA 1FOD1 2IC1A 3MYXA 4HLTA 3OTFA 1VB4A 4W6XA 1KRIA 2C9AA 3VBRB 3WDUA 2VGDA 4NR1A 2KA3A 3QCWA 2MEV2 2R0FA 2A6ZA 3IN9A 4XBLA 3ZFEC 1X7NA 3V0AA 1WLTA 2ZX2A 3T1MA 5EYYA 2MHFA 3VN4A 4YG6A 1VBD2 1AYM3 5EV7A 3J8F1 3VGIA 4IL7A 3BODA 1WCDJ 4XMAA 2Q4SA 5CBLA 4LBQD 4QPYA 5T50A 1V6MA 3H3ZA 4HMZA 5KXBA 2HWF1 3QLQA 3E97A 3FWEA 4CP0A 4M3CA 1PVC3 1XYOA 3WV6A 1NXMA 4JTNA 4L99A 3MLLA 1QQP3 4KU8A 2NZ9A 2ZGMA 4K3UA 1RVF1 1N1VA 5BNPB 1OMIA 5C4WC 1RMU3 2EXJA 4YW4A 2E7TA 2WINB 2XJRA 2VW1A 2BNNA 1B35A 1E57A 1AYN3 4BHPA 1TE1B 3H7JA 3ZFFB 4YM2A 1JUHA 1LOEA 2NM1A 2EXHA 2VH9A 4GULA 1D4M2 2UURA 5I8YA 1YFWA 1F5JA 3EXUA 5FMOL 4H7LA 4RR3A 4N43C 5DZFA 1ULGA 4XW3A 2PHLA 4QQHA 4LBKA 2WSUA 3LKJA 5KXDA 1DBNA 2PYTA 4JAAA 1HKDA