2DCTA

Crystal structure of the tt1209 from thermus thermophilus hb8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
MEIKDLKRLARYNPEKMAKIPVFQSERMLYDLYALLPGQAQKVHVHEGSDKVYYALEGEVVVRVGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVVTAPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA0104
publication title Crystal structure of the TT1209 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 19
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dctA00
1UW8A 1G6NA 2Q0AA 2WC2A 1YFXA 2VECA 2XLFA 3E97A 2QCSB 4HLTA 1GQHA 3E6DA 2XKOA 1LB2A 2EVXA 2PHLA 4GULA 4QGLA 3KMHA 5FLIA 1CAXB 4HN0A 1RL3A 4QXKA 4HVRA 3ES1A 5KHGA 5E1RA 3HT1A 1EYBA 4IEWA 3EJKA 2BNOA 1QXJA 2IXCA 3SCHA 3RYRA 2D93A 1I6XA 4Q0QA 1ZRFA 1RTVA 2Z69A 4H7LA 2C0ZA 2B8MA 5J7MA 5EZWA 3OD0A 4I09A 2OZ6A 5CADA 3LA7A 3SCFA 1CAWA 4QM8A 4ZU7A 4N9HA 4WBBA 2VPVA 5BPXA 4EWAA 1YLLA 4MZUA 3RYPA 2PA7A 3KCCA 3H3ZA 1DGWA 2Z2SB 5T3NA 2MHFA 1O7FA 4XFAA 2IXKA 5BY5A 4FAHA 2DCTA 3EQEA 3BPZA 4LA3A 2CGPA 4PIXA 1XE7A 4QGMA 4PJYA 3I59A 2GC2A 5JAXA 4XETA 1VP6A 1XE8A 4YRDA 4ONUA 5J3UA 4LULA 4QX5A 2OA2A 3DV8A 1OD5A 4EWEA 1CAUA 4MGYE 3HQXA 4AQ2A 1UD1A 2QJVA 3LA3A 4Q0VA 3UKNA 3EBRA 4F7ZA 3JZVA 3RYKA 3KGZA 5I0TA 2QDRA 3DL3A 3I59B 5JR7B 3PLQA 3H7JA 2FQPA 4LLOA 3RDIA 4OLLA 1YHFA 2PAKA 2PHDA 4XFGA 4O9GA 1O4TA 3SHRA 3R6SA 4D7SA 1CAUB 1SFNA 3VHRA 3FWEA 4LA2A 4YNIA 5JSOA 3OCPA 4F8AA 2GC0A 3NSTA 4X6RB 4E2QA 2QVSB 1EY2A 5FQ0B 1IPKA 2H6BA 2OYZA 3IWZA 3M70A 4IETA 1ZZ9A 2IXHA 5CU1A 4WZCA 3B02A 1O3SA 4I2OA 4JV4A 2EA7A 5E16A 3EO6A 4UXAA 2Q30A 4HN1A 5JCTA 3E6CC 4ZU4A 1J58A 1O3QA 3GBFA 3ROUA 3IDCB 4ZU5A 1FT9A 4LTAA 1PM7A 1Q43A 4UBGA 2HJIA 5D1IA 2ATFA 2CAUA 5FDBA 1RGSA 2MPFA 3BB6A 2XL7A 2BNNA 1X82A 2H6CA 2XLGA 2XGXA 3H1WA 2HKXA 4XF4A 1WLTA 4META 4FBFA 5KHIA 5C6CA 3ZDSA 4Q0PA 1Q5OA 1YUDA 3H7YA 5KHKA 5BUVA 5HI0A 2OZJA 2UY8A 1OFNA 1IPJA 3CEWA 4RD7A 4XF1A 2ETEA 2UYBA 1VJ2A 3KSCA 3SMHA 3FHIB 5I0UA 2XKPA 2B5HA 1DZTA 4MUVA 1LR5A 2VQAA 1O5LA 2QNKA 4P9GA 2K0GA 5FPZA 3UKTA 3MYXA 4KU7A 3USSA 5BV6A 4LUKA 2H0VA 4QMAA 5I0SA 1FI2A 4XFHA 5J48A 4HMZA 3NW4A 2KXLA 3LWCA 1WA4A 4R8HA 2Q1ZB 4Q29A 4IEPA 4IEYA 3U0ZA 4KWKA 5K8SA 2PYTA 4HSLA 5KHHA 2GAUA 4IEZA 1GQGA 4YYOA 3E5QA 5KHJA 1CAWB 1UPIA 3PNAA 3H3UA 2BNMA 3NVCA 2D5HA 2XHKA 3ACLA 3LA2A 1NXMA 4E2GA 4XF0A 3QOPA 2PAEA 4FT8A 3FX3A 1DGRA 2FMYA 3CJXA 4IEXA 2MNGA 4BYYA 1J59A 4KL1A 3O14A 1I5ZA 1SQ4A 4BH9A 4X6QB 1ZVFA 3FE5A 2UY9A 2UYAA 4HVOA 4AQ6A 2O8QA 2Q4SA 1SEFA 3D0SA 1NZCA 1DZRA 3IIAA 3OGJA 4ORFA 3IBMA 3H1MA 3E6BA 4O9EA 3S7EA 3ELNA 3C3VA 4KWLA 3E5UA 1FXZA 5FCCA 1LKNA 1CX4A 1H1MA 1YFYA 1ZRCA 2WFPA 4IERA 3H1YA 2PFWA 4QM9A 4JVAA 5JSPA 4XFCA 1ZNPA 4KU8A 4PIZA 1O3TA 3FFQA 2BYVE 4XFBA 3HIFA 3RNSA 4E2SA 3FJSA 5FPXA 3U11A 2BGCA 3S7IA 3GYDA 3WW4A 4L2NA 2GC1A 4LEJA 5F1RA 1UCXA 4EROA 3WW2A 3EHKA 1NYWA 1O3RA 4TLFA 2XLAA 3RPQA 4AXOA 3D0JA 2B9UA 4A2UA 5I8TA 1J1LA 2D5FA 1RUOA 2Y0OA 3UKVA 3D82A 1X7NA 5CVRA 2P17A 4AVBA 2ET7A 4HZFA 4K8FA 3FZ3A 4L11A 4R52A 4NVPA 3RZZA 2GH2A 1ZX5A 1J3PA 4IEOA 2F4PA 3MDPA 3E5XA 2IC1A 2ZKLA 1QY4A 4YARA 3MZHA 4MX3A 4LUMA 3KGLA 1YFWA 3BCWA 3SCGA 3ST7A 4BIFA 3I54A 1ZZCA 2EAAA 4XF9A 4IEQA 4BHPA 1J3QA 3CLPA 1TQ5A 3QACA 4Q0UA 1NE6A 3S0MA 4IESA 4XFIA 2GZWA 5LRSA 3N4MA 4XF3A 5LEKA 5EFUA 1J3RA 1ZREA 1NE4A 5I8SA 4XFFA 5FLJA 4CYDA 2K9ZA 3ETQA 2OPKA 4MH0E 5I93A 1H1IA 2ET1A 2CAVA 4YSFA 4Z82A 4B29A 4MGIE 4DINB 4J1XA 4Z07A 5FLHA 3OF1A 5LEJA 5KBFA 4I0AA 4PIYA 3ES4A 1EP0A 1X8MA 1YWKA 3OTFA 3WW1A 1OI6A 4KWJA 1WGPA 3U10A 3H9AA 3WW3A 4MGZE 1Q3EA 1CAVA 3G7DA 4QGNA 2PQQA 3DKWA 4I3PA 4D7TA 4IEUA 1O5UA 1XRUA 2N7GA 5JSRA 2XL9A 1V70A 2CV6A 5I0RA 2GC3A 2I45A 2PTMA 4XEZA 5AVPA 2ZCWA 4EWDA 3I7DA 3LZZA 1ZZBA 3HT2A 3LOIA 4MGKE 1EPZA 1ZZ8A 3NKTA 5FQ0A 3CF6E 1CAVB 3CL1A 3TNPB 1LRHA 2PAMA 4EV0A 1Y3TA 3CO2A 4I0BA 1UIJA 4AVAA 1JUHA 3BALA 4HBNA 2IXJA 1OMIA 2D40A 3L2HA 2IXIA 4Q0SA 4WVZA 4IEVA 1PMIA 3DN7A 1QXRA 5BXXA 5C8WA 1ZZ6A 3NL1A 1CGPA 2E9QA 2BEOA 1U12A 4N9IA 1YFUA 1VR3A 1L3JA 4I01A 5I91A 1X8EA 1CAXA 3IDBB 3NJZA 4HSJA 4JTOA 1ZRDA 2O1QA 2IXLA 4J1WA 4UBHA 1RC6A 1HW5A 3SXWA 3PVBB 3BU7A 1ZRRA 4FAGA 3MPBA 1Y9QA 1ZZ7A 4OFGA 1UIKA 3H50A 4I02A 3H8UA 4MV2A 4JTNA 3M3IA 4AVCA 4HVQA 5I8YA 1QWRA 5LRRA 3TNQA 2V09A 2GU9A 1RUNA 3LAGA
chains in the Genus database with same CATH superfamily
4R9DA 4LBQB 1UW8A 3WVJA 1YFXA 3TAYA 2XLFA 1QJU3 1UZWA 3IT8A 3WDYA 1G9DA 2D44A 2RS52 4FFGA 4YFWA 3E6DA 1DIWA 5DAWA 1PIV2 1LESA 1XOYA 3Q8CA 4QGLA 5FLIA 4AEDB 1HDKA 3D8CA 1NCRA 4OI2A 1VBA1 4QPGA 1T2XA 2X8KA 3OBAA 3HOBA 3IDAA 3OY8A 4GALA 5KHGA 1OURA 2WNVB 2EIBA 3GZEA 5I0DA 2LS6A 2BP6A 3ABZA 3EJKA 4IEWA 4CDXC 3ENRA 3OUJA 1Y7BA 3U1XA 3O1VA 4A6OA 4AFMA 2G1MA 3ACHA 5IATA 1JYIA 3FHAA 1JOJA 3KD4A 3ZFEC 2I2SA 5A7SA 5EIYB 5IVJA 1COV1 1JH5A 1K12A 4C8DA 5DAPA 1N3QA 2X5IC 2R30A 3OD0A 1AJOA 3QLQA 5FYIA 5C8CB 4BMEA 3AL5A 2YZ4A 3T2QA 2W1SA 1RJ8A 3RI9A 4N9HA 1LOBA 4YG0A 3O1PA 4EWAA 2J22A 1VB2A 2C1FA 1GBGA 2HWE2 2QTWB 3HQUA 4FQZA 1TNFA 3DYMA 2Q8EA 2PA7A 5F5CA 1U5YA 1PGW2 2VMCA 3KCCA 4H3WA 4YVSA 1BHGA 2Z2SB 3ME2A 4AWDA 1IG0A 5L9RA 3VDAA 3SH5A 5JPMB 1O7FA 4JDNA 4XFAA 2VOKA 1W6OB 2A3WA 2OUHA 4YW4A 2ZMNA 1SG3A 4FOVA 2DCTA 3EQEA 3BPZA 1OOPA 2HLEA 5GLWA 2CGPA 4KBZA 2VGDA 4DXSA 4Q27A 3IKWA 5FPVA 1S0BA 1GOFA 2BRTA 3POFA 4UT5A 5JAXA 1ASJ3 4IXLA 4XETA 1VP6A 4OI4A 2J1TA 3GZUC 5CIRA 4ONUA 5FP4A 3M2MA 3POJA 2OA2A 1MS1A 4QPIC 4CDUC 3VZNA 3PL0A 3HQXA 4LO8A 2IFRA 2J1SA 4WM8A 2VY0A 3VZKA 2VCBA 4GB33 5JZGA 2PXJA 2RJLA 1HN0A 2YFUA 1HRI1 3B9CA 1NXD1 4IGQA 1GOHA 2DFBA 4QB2A 2IZWA 4BK5A 4HOOA 1MZEA 3EBRA 2DCYA 4DUVA 2VR4A 1IKPA 4BB3A 4RQPB 3C7EA 1GZWA 1X9PA 4XJAA 2QQVA 4XDOA 3AVRA 5AFBA 3HWJA 3GHNA 4AW7A 1S2EA 2HYXA 5EWSA 1WBLA 3DL3A 4N53C 3PLQA 2ZZQA 3H7JA 1RVF3 2NMOA 4XUOA 3LD8A 5A7PA 1OQEA 4XQ4A 3MIEA 1YHFA 4AEKA 1XNCA 4XFGA 4Z2WA 4O9GA 1O4TA 3SHRA 3WG4A 5C4WC 2Q1FA 3ACIA 4OHYA 1SFNA 5FMOL 2D43A 1WLDA 1TG7A 2CDPA 4YNIA 2ZX3A 3GCWA 2DTYA 1F5JA 5HCBA 5JXJA 2WWUA 1BKZA 1SBDA 5FMCA 3S30A 3ZN5A 4ATEA 4Q4V3 4NPMA 2VZUA 1Q56A 3NSTA 3I2GA 2CWSA 2A5ZA 2P6HA 1YQ5A 1O59A 2VMGA 3MFAA 1R092 1DQ2A 2QVSB 1EY2A 5FBJA 5CFDC 5IVBA 3RVHA 2WO7A 2OYZA 1RUE2 4OUEA 4A7KA 4IETA 3FN9A 4HPKA 1NKGA 5GZFA 1OKQA 4Q1PA 3B02A 5FXXA 2KM2A 1SHWB 3PJQA 4NPRA 5DUUA 2BTVC 4JV4A 1VAMA 5HPOA 5J1XA 2RDRA 3JBG2 1HJFA 3I49A 4HN1A 3ZN6B 1QQP2 2RS33 5JCTA 1W6QB 5EYXA 1ULGA 4ZU4A 3ROUA 1CIYA 2Y64A 3AK0A 3IDCB 1QNWA 1SDDB 3WNOA 2R0HA 2VZQA 1PM7A 3T09A 1W03A 4UBGA 4AGGA 1GP5A 1CD3G 2HJIA 3VBSA 4AVSA 4M00A 4YW5A 2Y38A 1ND2A 3IIIA 2MPFA 3OGRA 2VOTA 1GZCA 2W9XA 4Q4Y3 5LA1A 1COV2 1XSRA 2A6WA 4RSUA 1V9U2 2BNNA 5EV7A 1W2AX 1NLRA 1JS9A 4Z92B 2VULA 3CJIA 1ODNA 4QKDA 4I0WB 4Y22A 5CISA 2XGXA 3OOXA 1KRIA 1WLTA 2W52A 4META 4FBFA 5KHIA 2OVUA 4RYDA 5C6CA 1QOTA 5FZAA 4YM0A 4AFBA 4QXBA 1YI7A 1VRH1 2JX9A 4WM7C 2YB7A 2RJKA 5CFCB 1SFPA 2WQ8A 4BQ4A 5HI0A 5CG9A 1KXGA 2OZJA 2UY8A 5GZDA 2UURA 1SBEA 4KNCA 4NOTA 4ZHNA 4JGYA 4RD7A 3VZJA 2AR6A 4LKSA 4GMP1 1QDOA 1D4VB 3FHIB 2VC9A 1EV11 3VV1A 4MUVA 1OA3A 4KBBA 2G19A 1JYCA 2XBO2 4V1PA 2WO1A 1O5LA 1O4ZA 2ARCA 1MVQA 5APAA 2YBKA 3NV1A 4LO6B 5FPZA 5H9SA 1IQDC 4MADA 4Y1VA 4N7UA 4RS5C 4QPGB 3USSA 4KU7A 1ULPA 2BWCA 4XIKA 1RUC2 4LBJA 2WNOA 2ZGTA 4P02B 5FPBA 3L9JT 1VBB1 4M0HA 4QQOA 3SEEA 5CKNA 4RN5A 1WA4A 1LGCA 2Q1ZB 3ITQA 1NX9A 1N47A 2ZX0A 3J26N 2ZGRA 2AH2A 4LKFA 5CAZA 4IEYA 2TEPA 3PDQA 1PZ8A 3LGRA 5LY1A 1GLHA 3DKQA 1GP4A 1LULA 2ZX2A 4BM8A 1HRI2 1DBNA 2PYTA 4AEDC 5KHHA 3B01A 1MPXA 4IEZA 5GZEA 5IVFA 1FYUA 5FKBA 3NWKA 5KHJA 1S0CA 3JB8A 2AUYA 1WD4A 3LPGA 2XJRA 3NVCA 2WA4A 2D5HA 2WR9A 2ZEZA 4AFCA 3ACLA 1ENRA 1NXMA 1BVVA 2VUDA 1HRV3 3S5AA 4XF0A 4YVSB 1J84A 5LA9A 3ZOIA 2D3RA 2WNEA 4FT8A 1OSGA 4PBPA 2VW1A 1DGRA 3OEBA 5F5AA 3ALQA 1JYWA 3CJXA 2QZ3A 1SCSA 1RUG1 1H4GA 4JAAA 4ZXEA 4NIAA 2VZPA 2SBAA 4Q4X1 5F6LB 2QQWA 2JDYA 3OGSA 5FXVA 3AYEA 3B5LB 4M3CF 5IT6A 1TME3 2CWMA 3H42B 2XJVA 2XPJA 3WF2A 4CU7A 3NNLA 4H2AA 4N7IA 4CDQB 4XACA 1SEFA 3D0SA 2HEVF 1K5JA 4CDXA 2HWD2 4NIGA 2Y6KA 3HNYM 2BQPA 1JZ4A 3ZFEA 2BBVA 3K2OA 1PO12 2DVDA 3E6BA 3S7EA 1PO23 3GALA 1WZXA 3WUCA 1C28A 2X5IA 3E5UA 4ZS2A 1CWPA 1FXZA 3IN9A 2ZBJA 3HVDA 1QJY2 4FFHA 4XUTA 1WUVA 1DLLA 5DDJ2 1ZRCA 1ZA4A 2WFPA 4G9SB 2RR12 4IERA 3WV6A 2UWCA 5T55A 3SQOA 4JVAA 1NLQA 4YG3A 2I74A 5FYSA 2ZTNA 1EAH3 2XJQA 2XJPA 4NWWA 4Y5TA 1ST8A 1DCSA 1XYOA 4YVWB 1V0AA 1V00A 3HIFA 2E32A 4XFBA 3RNSA 4W6WA 3FJSA 1S4CA 3ZXDA 4E2SA 5FRAA 1GOGA 4COWA 5FOJB 4RQPC 4YW7A 2BGCA 2ZPXA 3U11A 5JMCA 5HV4A 2R041 3S7IA 2RM23 1XU1A 5F1RA 4A45A 2VNGA 1U0AA 4FPEA 3VZMA 2VVDA 3HAGA 2WAOA 1B09A 1RHI1 1O3RA 3H8XA 2WFF1 4YG6A 1ND3B 3X29B 2BPA2 1FV2A 4K3UA 1LCLA 2DDUA 2ZEWA 4QQ2A 3LF7A 2Z4FA 4A7YA 4W4ZA 1W06A 2R073 3WP4A 4QPIA 4CDUA 1RUOA 1EV12 1ZRIA 3LDKA 2YYOA 3VDBA 1VBE3 2VXRA 1JHNA 1AR91 1VBC2 5FYTA 2ET7A 4LHNA 1LHOA 3E1F1 5FV3A 4K8FA 3ZKYA 3VD3A 5E8AA 4PLOA 3VDDA 1S2KA 5AC93 1JOPA 1ZBE3 4R52A 3BI3A 1XE0A 3HNMA 1MS3A 4AAXA 1NUKA 1MVEA 3RZZA 2GH2A 3PIGA 3ZFFB 2FHRA 1DZQA 1SLCA 4TWTA 2ZKLA 4BE3A 1V6IA 3RWKX 2RMU2 2R0FA 4HETA 5JXHA 4MX3A 2IVJA 3VBSB 5A33A 3NNGA 4N53A 1ND2B 3KGLA 1W0PA 5F2SA 4YZ4A 2AENA 4GAZA 4NHLA 1WCQA 3N7MA 3IAPA 1PVXA 3MI8A 3ZN4A 3OYWA 5B4NA 5C4WA 1PVC1 4BHPA 3O1OA 5LBCA 5JOWA 1WMEA 3I2OA 4E4SA 1LHNA 2A3YA 1YCIA 3CLPA 3OGVA 3VL8A 1VBA3 3DGTA 4FPJA 4Q0UA 3JB4C 2W1WA 4LBKA 1R082 4HK9A 3N9LA 1LJ7A 1XXNA 4DFSA 1AYM1 1AX0A 2YBSA 1TZOA 5DQ0A 3POBA 2VMIA 4XF3A 3ZLIA 4CUBA 5LEKA 2BZDA 2YROA 1PZ7A 3I3EA 1J3RA 5C9AC 5BNPB 1UO9A 1JUIA 2F4LA 5E89A 3AP6A 3ETQA 3LEIA 5CFDA 3RG0A 2ZGNA 5BNNB 3NAPB 4MH0E 5CZKA 2YV8A 5IYYA 3VD4A 3BODA 3O12A 1Z78A 5FR3A 4Z82A 1NQDA 4D0QA 2VNVA 5SV5A 2A6XA 5FZCA 1QEXA 4FP3A 1W04A 5LEJA 4I0AA 3LEMA 3M3EA 3VB9A 1JXNA 2CL2A 2DWRA 3ES4A 4Y20A 4AHWA 2CY6A 3OTFA 1OI6A 4KWJA 3KB5A 4JZRA 3D5OA 2QFEA 3ACFA 2WWSA 4HKWA 4TTGA 2NM1A 3THPA 1N1TA 1N1YA 4KGGA 4LOTA 4L8QA 4QGNA 2PQQA 2PELA 4R9AA 1FPN2 2O14A 3T2OA 2VZOA 4I3GA 1MZ6A 4UFKA 3MO4A 4CE8A 1JU4A 1DQ5A 1YIPA 1SLIA 2WSVA 2ZAHA 4AVVA 1XRUA 5K0UB 5FZHA 5J98B 1EUTA 3THCA 3VHNA 5J09A 4YM3A 3SISA 4EQVA 4ZY9A 4DNYA 4AEJA 4H14A 3ACGA 4K20A 1HXS2 2PTMA 3AJZA 5AVPA 1BMV2 4EWDA 3V65A 2CU5A 1LU2A 2ARXA 4WM7A 3W9AA 2YGMA 3LZZA 4BMBA 3HT2A 1EPZA 3NKTA 1MZ5A 1HRI3 1F8VA 1R64A 3OB8A 4EV0A 3B9IA 3BTXA 3N9NA 2JDKA 1NY72 4D7YA 4RR3C 5IAXA 4QB6A 4CCKA 1H0BA 4E4HA 4XQDA 2R1DA 3BTAA 5F9TA 3BIEA 5IJRA 1CQ9A 5C3SA 1CIWA 4RS5A 3AJYA 2JWPA 2WZPP 4XCBA 4BXSV 2B45X 4BIOA 2JB8A 5L7OB 1QXRA 3P6BA 4CDXB 1CZVA 3MW3A 3Q9OA 1UOJA 2ZGOA 1ZZ6A 2VCAA 2XQXA 1CGPA 2PLV1 2NZ9A 1F2NA 2VCCA 5EPAA 3T4VA 5F3CA 3UYJA 1S0IA 3CBNA 4N9IA 4XTMA 1DQ1A 1XBFA 3FBYA 3IMNA 4NWVA 4I01A 5JPNB 3F95A 1X8EA 4AEDA 3NJZA 5C3OA 2YU1A 1AVBA 3JU9A 5A6XA 3GNEA 1AL22 2IXLA 2UU8A 4J1WA 4KH9A 1RC6A 1HW5A 1ZBA1 3U37A 3VBHC 4CDQC 3MPBA 2BDRA 3FL7A 1UOBA 1GWKA 2VXJA 1UIKA 3H50A 4I02A 5ANQA 3TBDA 4HVQA 1S1AA 5DABA 3TNQA 3NO8A 3ORJA 5J3UA 2K46A 2BBAA 2OIIA 3LIHA 3LQCA 2OW4A 1C8M1 1XB9A 4W6YA 2VECA 1JW6A 1SPPB 3ZXJA 3B69A 3PTYA 4MHUA 4RGAA 1AHSA 1RUH2 3LOBA 2A7AA 4LJHA 2DF7A 1LECA 1BEV1 2QQIA 2XKOA 2HH9A 2W95A 1OQ1A 1QMJA 2OQ6A 2VTXJ 2PHLA 3MLJA 1R1A1 5T5LA 3KMHA 3WF3A 4D94A 1CAXB 5D8AC 5DG1A 3SEPA 1RL3A 2HBTA 3ZMOA 5A1FA 3ES1A 4IE4A 2OS2A 3WQBA 1KEXA 1N1VA 4K1ZA 5FZIA 1EYBA 2XOMA 5JI7A 4YVWC 3J7LA 1QOSA 4P9JA 4A44A 1UY2A 4IUGA 2GMMA 2IXCA 3J7MA 4HL0A 1I6XA 1DFQA 2RS51 4LE3A 2WAAA 1H8VA 4R9BA 3VBOB 2Z69A 2V5YA 1PIV1 3RJRA 1CJPA 4H7LA 5L73A 2B8MA 3WF0A 3ZYPA 5J7MA 3BGAA 1ND3C 2B39A 3USUA 2E33A 3VN4A 4BQ3A 2OZ6A 4BQXA 5KWRA 1D2QA 1VRH3 3IMMA 3QCWA 4J25A 1JODA 1FNYA 2GN3A 4B7KA 3B3QE 5C70A 4WBBA 3ZPYA 5BPXA 4JQRA 5K7PA 1HIXA 2GP3A 1GNYA 1YLLA 4GMP3 1LENA 4QDRA 4Q8LA 4MZUA 1PGL2 3N3HA 4C90A 1EUUA 2JDZA 2DVAA 5FY5A 4XOGA 1DGWA 3WP5A 3LE0A 1ULFA 2BFUL 5T3NA 2MHFA 4IV3B 4LBNA 3A21A 1E57A 1AX2A 3ZFFC 4P5HA 4CZSA 2YHJA 4RQPA 1RUD1 4LA3A 3AKRA 4PIXA 3POIA 4UI9L 1V6OA 3AMMA 3AYAA 2DU1A 2HWE1 1HV0A 1VBB3 4B4RA 2WRAA 3ZPOA 5JVVA 2P2KA 1HQWA 4D8MA 1XE8A 2VE1A 1PGW1 3OJBA 2GNMA 4U2AA 2JG9C 2E6VA 5H9RA 3T2PA 4AQSA 3TEXA 4QX5A 1AR62 1BYHA 1OD5A 4MGYE 1ENSA 4UW4A 3ZYFA 4C1XA 3O1RA 4M3CB 5A3TA 3LA3A 4AHZA 4JRAA 4LBMA 5DAQA 3AC0A 5HCFA 1RXGA 4GJYA 4Y20B 5BNPC 1FNZA 1EPWA 1YEWA 1OBNA 1G9AA 3JZVA 2XUMA 5BNNC 3KGZA 3NAPC 2GNTA 2QQMA 1WWYA 1ULCA 2QDRA 2ZHKA 5LY2A 3UK9A 2F6BA 2W1QA 4DXRA 4FVVA 2D3PA 1SMVA 2WUHA 1UF2C 3MF9A 4QWNA 1PNGA 1RUG3 2MEV1 4OLLA 2PAKA 4NR1A 4UF0B 2QQLA 4DEQA 2P4EA 3KM5A 3R6SA 4K9SA 1CR7A 4Q4X3 4CVUA 1SZBA 3ZN6A 5JSOA 3WHUA 1W6QA 5DN2A 1ZBA2 2ENRA 2G9FA 2WS91 2HWF2 3OCPA 3H3LA 1HKDA 1F15A 4F8AA 5LZ6A 2VUCA 2D98A 3LKJA 3KT7A 4FQ4A 2WZEA 4WM7B 3C7OA 4X6RB 4E2QA 3THTA 2HWB2 5T5PA 2OKXA 2LM3A 3DECA 5C9AA 5AVAA 2WBKA 5FP8A 1IPKA 5ACA3 5K0UC 2ZA9A 1S0EA 5LASA 1UQXA 1KDMA 3M70A 5CBLA 1MS5A 2C9KA 3T2TA 4BISA 1K42A 1GMMA 3VGIA 1PK6B 2VTXA 4FTBA 4WZCA 4BXFA 1BEV2 2VOXA 1AXZA 3MBWA 3K77A 2VBDA 5FZMA 5E16A 5FFOC 4OMDA 4UW6A 5T5JA 5GZGA 4ZPIA 5F5QA 2Q30A 3I2DA 3VHOA 1CZSA 3VDCA 1GNHA 2VAUA 2OPWA 5LCWL 3C7FA 3GBFA 1R091 5CNAA 5F2WA 5FXZA 1WMFA 2NMNA 1G86A 2FD8A 1RUE1 2PHUA 1Q43A 4PQ9A 5FJHA 5A70A 1ULOA 1W2NA 4QHOA 5GKAC 3P5BA 4QQPA 2ZABA 5FDBA 1RGSA 1CPMA 2CDOA 2WNUC 4P9LA 3BB6A 4DY5A 1FATA 1QNYA 2XL7A 3N9QA 2R043 4XJWA 1IHMA 5IUQA 4C91A 4ASKA 1XSQA 1X82A 2W46A 3JBG1 3EB7A 1QQP1 2E7TA 2XLGA 4EZ4A 1RHI3 3DPRB 2HKXA 2WFF3 1Q8SA 3GCXA 4CXWA 5L7OC 4DPNA 2AZ5A 4R9CA 4RFRB 3WDVA 1POV1 1DHKB 1YQCA 1Q5OA 4UFMA 3AVSA 3H7YA 3FUOA 4Q2FA 5BUVA 5KHKA 5FREA 1W05A 5ANNA 1AR93 3WLUA 4XF1A 4JHTA 2ETEA 1V9U1 1VJ2A 2UYBA 3KSCA 1OQDA 2PHXA 4CU6A 4AI3A 2XKPA 1UYZA 4H55A 1DZTA 1UMZA 4NHKA 4P9IA 2UWAA 4A3ZA 1RUD2 1S55A 2CNAA 3C8XA 4DUWA 2QNKA 2AC1A 4R4ZA 2K0GA 4AVTA 5CYYA 4RR3A 5FMBA 1HB3A 4FI9A 2Q8DA 4LPLA 4LLFA 5EJ3A 3ZXFA 5JIUA 1MEC2 2VU9A 4FFFA 4BQYA 4LUKA 3WDUA 5I0SA 1HJGA 4QMAA 3K3NA 4HMZA 4MG2A 3LWCA 4R8HA 5LK5A 3AMQA 3ZO0B 4Q29A 2QQJA 2C26A 3I2IA 3JQXA 4IEPA 4L99A 3S6PA 1PVC3 2XBO1 1H6YA 3MGUA 4LITA 3WQ0A 1JZ7A 4RGKA 5A1AA 2ZOEB 4HSLA 2IVIB 3USUB 4XUNA 4X8PA 3VBUB 4Q4W2 4CP2A 3I97A 4YYOA 1RUC1 2DUPA 1AYM3 4A41A 1VAKA 3CKHA 3N9MA 1UPIA 2ZGLA 2VMDA 3APBA 3PNAA 4OULA 4QKNA 3VBHA 4CDQA 3H3UA 3ZSJA 4JQTA 2PHWA 2XHKA 4MOAA 1LTEA 5A3PA 3VBOC 2A6YA 1OUXA 5KXBA 2MEV2 4QPYA 4XUPA 1DG6A 2GP5A 1AYN2 3ECQA 3FX3A 4ATFA 3LB9A 3T08A 1UZYA 1UU6A 3PUAA 4A42A 4IE6A 5E88A 5FMOS 4IEXA 2P34A 4CEYB 5FBZA 1D0GA 4FFIA 4BYYA 4NIHA 2WS92 2E51A 1NG0A 1J59A 3ZMNA 1H6XA 4HKOA 3JD72 3AZWA 2Z42A 3ATGA 2ILMA 1AF9A 3MEPA 4Q26A 4X6QB 2XJSA 5D8AA 3FE5A 4AQ6A 2O8QA 4JGZC 4IV3C 5EJZB 4A3XA 2GALA 1WW4A 4YVWA 1NZCA 2R1BA 3MIFA 3NJXA 1REDA 3HQRA 4AI9A 4I30A 1F4AA 5G05L 1PGSA 1Y4WA 2ZEXA 2B46X 4LO5B 1JTZX 1C4RA 3IIAA 5LB6A 2JG8B 3NJVA 1RUJ2 4CEWC 3H1MA 3PUSA 2JKBA 4O9EA 4C1WA 2VQUA 3C3VA 3FFZA 3BU0A 1YIFA 4FPHA 2Y6HA 3TEZA 1WW6A 1ND3A 4GA9A 1REEA 3WDXA 2FDGA 1Z7S3 1CX4A 3T3YA 1W3XA 1LOFC 3HJRA 1KFUL 4MGTA 5LW9A 4FPOB 3RZLA 3FLTA 4QHZA 2HWD1 3WZ1A 2RVAA 2PFWA 1UU5A 3WCRA 1OD3A 5FY1A 2E26A 4EZHA 2Q8OA 1NCQB 4XFCA 5IVYA 4PIZA 4CXYA 1PO11 3J8F2 2W47A 2TUNA 2BYVE 4LHSA 2EXKA 3V56A 4FOQA 3MLLA 1RUI2 1OPMA 1QJY1 1LGNA 5F6KA 4W8JA 3ZFFA 1CX1A 1K5MB 1MZFA 2ORZA 4KMQA 4QKFA 1I9RA 2NN8A 1I5PA 3PTRB 2JD4A 4L2NA 2DV9A 3TYJA 1JZ2A 5DDJ1 3U07A 2NPIA 2RR11 1W6NA 2BOJA 4GIQA 4TLFA 2WKKA 3KCYA 3RPQA 1NZIA 2XJTA 1OF3A 4AXOA 2B9UA 2PLV3 5C9AB 3LEKA 5IAVA 4KI5M 2JG9A 4Y1ZA 5FY4A 3GJBA 4LIUA 4XQWA 1HN1A 1UYXA 4GH4B 3INAA 3UKVA 1I3HA 1X7NA 5CVRA 5IFTA 1G7YA 4YFZA 1J83A 4FXKB 1GSLA 3B94A 2ES3A 2WA3A 4XTPA 1FMD3 3WR0A 4EN8B 4F83A 1BLZA 2QE3A 5JUVA 4TZDA 4FPKA 4PBOA 3RMYA 1JBCA 3W20A 1IS5A 2JECA 3KF3A 4CP0A 3WT3A 2C5DA 1RMU2 2LROA 3Q8EA 4NRQA 4W6XA 3THDA 3WEZA 4BDVB 5BNPA 4IEOA 2F4PA 3WX5A 3MZHA 3B93A 1WD3A 2FDJA 2PHFA 5BNNA 4XXAA 3NAPA 4LUMA 3WNLA 4S2HA 1H8TB 1VBC1 1PK6C 1C8M3 4RL7A 5FPLA 1XNTA 3ST7A 2YXSA 1LOEA 3EXUA 3P3NA 3ZYIB 1IGOA 2EAAA 3LFIA 4IEQA 1UY3A 4IGOA 1R1A3 1AR82 1PHMA 5FY0A 1ODMA 3KF5A 1JZ5A 4UW5A 4DQAA 1UY0A 2LUWA 5D2AA 2RMU1 4M3CE 2ADDA 4ZZ5A 2G4IA 3AFGA 5CG8A 1YQ2A 3A22A 3I2JA 3N4MA 4EN6B 1URXA 2RHPA 4P5YA 4XUQA 1SACA 2FCTA 2XQRA 1QOOA 4XFFA 5I8SA 4A7ZA 2RS53 4IE7A 1DQ0A 1KD7A 1D7PM 2OPKA 2RDSA 3N9PA 2YPDA 1PIV3 3I2HA 1RJ7A 5K0UA 5I93A 3DPRC 4B7EA 1RYYA 2CAVA 1UXZA 2BGOA 4QXHA 4PI0A 4MGIE 1R081 2QUOA 2XVLA 4RR3B 1S0GA 4CSWA 1QJX2 1CESA 1GICA 4J1XA 4XBLA 4Z07A 3OF1A 4DRRA 1IKQA 3K46A 1GR3A 4PIYA 3R05A 1QJZA 1PX3A 4XJUA 3BYWA 4BWOA 1L7LA 2AGSA 2ZGKA 4DY3A 4XZUG 1WW7A 3WF1A 5GLUA 3WW3A 3NQHA 3G7DA 3CU7A 1FOD2 4I3PA 3BIWE 1TEIA 1IS3A 3SKJE 4FSJA 1W8OA 1RUD3 2PHTA 4IEUA 4UAPA 2Q5TA 4XVHA 2VCMA 5JSRA 5FO8B 2HWE3 1ACCA 4SLIA 1DDLA 1V70A 3ZM8A 1CN1A 3OSDA 3VBHB 3K75B 1GZTA 3OUIA 3K48A 2ZJCA 5L7OA 1O91A 3WUDA 4Z8BA 2QKDA 3HBZA 2A1XA 5FIXA 3IM0A 2R16A 4QQLA 3DCQA 2PMWB 5FAXA 1FPN1 4COVA 5IW0A 3DXTA 1STMA 3LOIA 4N90A 5KXEA 2EIGA 2V72A 2C9AA 2CHHA 1ZZ8A 4LT5A 3CDZB 3CF6E 3VBUC 3CL1A 4Y5Z0 4L0PA 4B3NA 5JDBA 1BK1A 4P9WA 4EN0A 2X05A 4I0BA 1UIJA 1V6MA 2J1EA 4AVAA 2QZ2A 4NAMA 1HXS1 1BMV1 2D40A 3HEIA 3G6JB 1QF3A 5D8AB 1YXWA 2VNOA 3WDTA 4LBOA 4WVZA 3AKQA 1PMIA 3IPVB 4CUGA 3DN7A 1H9WA 5FK8A 1JZ3A 4JRLA 2VNRA 5C8WA 4CCJA 1SPPA 1YQ6A 4CEYC 4URTA 2W68A 2BEOA 1NY71 5LATA 1SBFA 2PN5A 1APNA 1PNFA 4MHRA 5FZ7A 4EN9B 1YFUA 1VBD2 1VR3A 2AREA 1L3JA 4LBQD 3WY6A 3AXDA 2JDUA 5L9VA 5GLVA 5C5UA 1CAXA 1LNSA 3IDBB 3VD5A 2BOIA 1UX7A 3D3AA 2BJSA 2EAKA 3VBRB 3ZSLA 4CPBD 4N43B 3URFA 3KWVA 5HBAA 3BU7A 2WINB 4DMIA 1Y9QA 5J36A 1MQTC 1VPHA 1ZZ7A 4FPLA 4WVVA 3H8UA 3WOGA 5EYYA 2JKXA 4AVCA 5I8YA 3RRDA 2JG8C 2Y6GA 1QWRA 2V09A 3CHXA 5FZLA 1UWWA 4LK6A 3VBOA 5FWEA 2HEYF 2VBBA 3VUOA 1RUNA 1DYPA 1G6NA 3OEAA 3MIBA 2IUWA 2Q0AA 2WC2A 3A0KA 3NV4A 2QCSB 4HLTA 3CMGA 1AL21 1KITA 1PMJX 2RG4A 1MS8A 3ZYJB 1E5HA 3DYOA 4Y5SA 2B7YA 2EXHA 1GQHA 3VDDC 1LB2A 3F2ZA 2GMPA 1W6NB 1R093 2EVXA 2DVFA 4GULA 4LQRA 3BVCA 1WKYA 4ZKTB 1RUE3 4QXKA 4K8RB 4Y1XA 1NCQC 4HVRA 4QPWA 2YMZA 2JG9B 1H9PA 1RUF2 2GSYA 5E1RA 4JGZA 3BN6A 3IZOA 4IV3A 2ID4A 3WNNA 4DO0A 4AE2A 5IVVA 4O61A 1E5IA 1K5MC 1RUH1 3JBG3 1CZTA 4Q0QA 3ZYHA 1QQP3 1W8FA 5A32B 4CEWA 1LEDA 5EZWA 1IPSA 1TMF2 3MIHA 4NRPA 4CP1A 1POV3 1UN1A 4I09A 5DZGA 3ZXKA 5CADA 1UZZA 4QM8A 2VM9A 3L2YA 5A7WB 1WW5A 1LOFA 2A3XA 4LK7A 4XJZA 2VPVA 1COV3 4GH4C 3U78A 4LOSA 3T4HB 1V9U3 1W8UA 4Y4YA 2OUJA 4M3CA 1C1LA 5FO7B 4BOWA 4GD4A 1Y43B 4QX2A 3TN91 3M3QA 1UL9A 5FPUA 1C5HA 2CYFA 3O1SA 2IXKA 3K4DA 1AR72 4LE4A 4FAHA 2FDFA 4Q1RA 3BUCA 2JE8A 1Y9MA 2WN3A 2GNDA 3LPFA 1YQ8A 5EHDA 1XE7A 5FUPA 4QGMA 5HXVA 4PJYA 1H8TC 2GC2A 3WNPA 4YZ3A 1PGL1 3SC7X 5FYBA 2JENA 3ZVXA 4GB31 3FLPA 1W6MB 4YRDA 1J1TA 3ZDVA 3KQ4B 4LULA 1AZDA 1BK0A 2R7EB 2VUAA 2XBO3 4FP2A 4DS0A 2C4XA 1CONA 3JXSA 4UF0A 5LBEA 5TSWA 4DZGA 2W1UA 1JOBA 3FHQA 5F32A 5GZCA 5KXCA 2Y60A 4KG0A 4PDWB 4Y1UA 2Y0IA 3ZFGC 2QJVA 1OF4A 3I3QA 2HWC2 2FCVA 3R4DB 4MSVA 1VMJA 1RUC3 2R6QA 4JKLA 5K9YA 4Q0VA 5A80A 3ZSMA 3UKNA 4RHV2 3FLRA 1A78A 1AR61 2CSGA 2R062 4F7ZA 1K45A 3TB0A 2G9ZA 4K1YA 4YM2A 3WNMA 4P9YA 2JIGA 4Z1VA 3I59B 2RS12 3WSOA 4GZ9A 2FQPA 2XHNA 2Q1MA 3HPNA 2BV4A 1PK6A 3POYA 3Q8BA 4IV1C 4Y1YA 2O8OA 2WNUB 2VQ0A 2PHDA 1SLLA 5IK7A 1IQAA 3N7JA 1CAUB 2QQUA 3ZKUA 3VHRA 2W0XA 5A3OA 2W2IA 2ZMLA 2ZS6B 1O6UA 3RZGA 3FBMA 4CCEA 2WZR2 1ALYA 1QJFA 3W5MA 4XDPA 3M3CA 1QJU2 2ZGPA 1LHVA 2GC0A 4CU8A 5KC6A 1OFSA 4QU1A 3PUQA 5A7NA 1T6GC 5DZEA 2JEMA 2BGPA 1A8MA 4YWAA 3PVOA 3KS7A 1S0FA 3IWZA 4LORA 3U4SA 4ARYA 4YGDA 2RS31 5A7OA 4JHZA 2YC2A 2VZ1A 4EE2A 3UV9A 1ZZ9A 2IXHA 4WV8A 3DPRA 2HWF1 2DCJA 5LWBA 3A7QA 2VVEA 4CP9B 4DB5A 1V6LA 2WZ8A 4IQPA 2EA7A 1H4HA 1CJDA 1OVPA 3EO6A 5CKQA 1P8JA 2HWB1 1GWLA 4ISRA 3E6CC 2HWD3 5J37A 1J58A 1IS6A 3GDBA 4HFSA 1O8SA 1OUSA 1UYPA 1V6KA 1XYNA 4BU2A 4LTAA 3V0BB 2VBPA 1PO13 4QAWA 1QH7A 3WF4A 1Q8VA 5D1IA 4HXCA 2CAUA 1C1FA 4GWJA 5BNOC 1LOGA 1KJRA 4G3YC 2GH8A 2WQ4A 1QJY3 2LRPA 4JC1A 3GZAA 1JHJA 5DDJ3 4GWNA 3PUHA 2RR13 4LHKA 4LMFA 1HLCA 3C7HA 5KXDA 4LKDA 4XF4A 2J7MA 3MHZA 5A6ZA 2ZAAA 3ZDSA 4Q0PA 2J1UA 3NNJA 2O0OA 3OBRA 1YUDA 4BLJA 3D6EA 1N3PA 3UNPA 3P3PA 4ES9A 5F8PA 2FBEA 3WHTA 2KR2A 2ZHLA 5GJ6A 1ASJ2 3M1HA 3TN92 3I2FA 2IFWA 4ZS3A 2BFUS 5I0UA 3VBUA 2B5HA 1OA4A 1XPWA 2VZVA 3VBRC 3WDWA 4N43C 3UL2A 1KQRA 1G9FA 4P9GA 2WT0A 2VVFA 2J1AA 5FYYA 1JYTA 3Q8FA 3UKTA 1OPOA 2ZGUA 2VZRA 5FZKA 5T54A 3UGHA 1EV13 4FOWA 4GB32 4OMCA 4LR4A 5K4LA 1VBC3 2H0VA 4WVMB 1FI2A 1GZ9A 4JGZB 5DPNA 4OI0A 2KXLA 3OPWA 3VBFB 2E7AA 3OG2A 2VZTA 3BTZA 3MICA 1W0OA 1IZ3A 1KDKA 2Y26A 4KWKA 4CEYA 4KQ7A 5GLTA 1Z0HA 5HCHA 4UFIA 3MF6A 4LHLA 3UGGA 4CEWB 1S0DA 5FZ8A 3SNMA 3R0RA 1RVF2 2RMU3 3HBKA 1MEC1 2UWBA 4AEMA 5AFEA 1LODA 1GQGA 1BVP1 3E5QA 2ORXA 3ZXEA 1A6CA 5FZ1A 2H0BA 5FZGA 4XJ8A 2VZ3A 2ZHMA 4B8EA 3VD9A 1MQTA 3I3MA 3NMBA 4Y3OA 1D2SA 1POQA 4K40A 5FZEA 1QHDA 2JG8A 2VO5A 2JDHA 1PZ9A 2PAEA 3QOPA 3RFRA 5JMOA 2WO2A 4Q4V2 2ZGQA 1R083 2VL4A 3LSDA 4Q4W1 4JDOA 2P1BA 4COUA 4D7SA 5JOZA 3H8RA 1T6BX 1VAVA 2WQZC 2YUEA 4QQHA 3RWNA 2D3SA 1DU3D 1DP0A 1UY1A 1W2UA 2B9VA 4KL1A 3O14A 3EMRA 2DFCA 4OUSA 1I5ZA 3AMHA 2NP0A 5FPAA 3ZXLA 1U5IA 2ZKNA 2V4AA 2RDQA 2P5BA 2UY9A 1NCQA 1LGBA 1AYN1 2C6SA 1WMDA 3KVAA 2RS32 3QBQA 3UJQA 1DZRA 3RZKA 3T30A 1K5MA 3FUQA 4ORFA 2CGNA 5GLZA 3IBMA 2WLQA 3M3OA 3OPTA 5L9BA 2CTVA 1C3HA 3JD71 3J4UH 4AI8A 4G4FA 2J1VA 4KWLA 1UKRA 2WJSA 4NIDA 2XWJB 5FCCA 3JUUA 4AI2A 1LKNA 1JI6A 2OQ7A 1H1MA 3C2UA 4Q4Y2 2D6LX 3VKOA 1FPN3 3Q8AA 5DAVA 2VZSA 5LA2A 4KG8A 3AP4A 2EIEA 4FO9A 3MPPG 4D6RA 1KS5A 3H1YA 4GH4A 4ITCA 4M01A 1N3OA 4PDWC 4UOJA 4PLMA 5DUXA 5JSPA 4XILA 1RUJ1 1ZNPA 1KGYA 4KU8A 1N1SA 3UJOA 5ERLA 3FFQA 3W21A 1YJKA 1AJKA 2EXJA 3DUIA 3AZVA 1HXS3 4LKEA 2DBNA 2VUJA 4NPLA 2FDHA 2RJ2A 3GYDA 1TNRA 3MUZ1 5T50A 2GC1A 4ISQA 4MVTA 4M4RA 3WW4A 4AFAA 1W0NA 1BCXA 1W6PA 3WW2A 1LOCA 4IE0A 2SLIA 1H8TA 4CXXA 4UFLA 1F5FA 2XXZA 1D0HA 4GWMA 3D0JA 3DYPA 2W87A 2XDVA 4CCOA 3J8F1 3N9OA 2P3YA 5JXGA 5AC91 1W9TA 2D5FA 1XNAA 1ZBE1 1OLME 1RUI1 2Y0OA 5IK4A 4S2FA 3MW2A 3ZIXA 4QD2A 4AVBA 1W28A 3O7OA 3TWIA 3W58A 3AMPA 3ZFGA 3NNFA 2IWGB 1B35C 2AACA 2XJUA 1HB4A 1JYNA 1OLRA 4NVPA 1H30A 2XVKA 1O8PA 4CCMA 4CUAA 4QX3A 1ZX5A 4YPJA 3RJ2X 3AKSA 4COYA 3E5XA 4AL9A 1QY4A 4YARA 5JXIA 3JQWA 4OQ8A 1NOVA 4PCRA 4TSVA 4ARXA 2G9GA 3BOWA 2K2SA 2P6CA 5FZ6A 3RMXA 3SCGA 3HR9A 5ABJB 3GGLA 4IV1A 1AL23 2A6ZA 1RITA 3GZTB 3WD5A 1ZZCA 1QU0A 1UZVA 4ASMB 4MXWB 4XF9A 1OH3A 3OPZA 4XIOA 1HRV2 2X10A 1MS0A 3KVBA 1RMU1 1J3QA 1VALA 3KQRA 3T0DA 1W8ZA 4OZOA 5DUWA 1TQ5A 4CDWB 1NE6A 5DMYA 1XU2A 2P37A 4NMIA 3VHPA 5L36A 4GMP0 4IESA 2GZWA 3PMSA 4XFIA 3A0NA 5B4XA 5LRSA 4FCAA 4K6BA 1PMHX 1UX6A 3LFMA 1D4M1 1W3VA 5CB7A 4DEVA 1VE0A 4E4DX 1DGLA 1NE4A 1RUH3 5FLJA 4CYDA 4E9KA 1L7RA 3TEWA 1TME2 5FP7A 2TBVA 1C57A 3ON7A 4QDSA 3WCSA 2AEZA 1UOFA 2FZ1A 3O0VA 1AR81 5A3NA 4RFT0 3VKFC 1QDCA 2XR4A 4XZPA 4YSFA 4XURA 3MIGA 4W50A 2YY1A 3GJAA 4XMIA 4AAPA 4NHYA 4XYXA 2Y34A 1X50A 4EN7B 1WCDJ 4UYBA 2JE9A 2TNFA 3A4UA 4AI0A 2J1RA 1YWKA 5FP3A 3ZYBA 1WGPA 1ZYBA 1RB8G 4BK4A 1PO22 3H9AA 4AGRA 4O7XA 2WN2A 3AP7A 5LBBA 2P3IA 1PX4A 3TN93 4CCNA 5IK5A 5JIAA 1WLCA 5FWJA 5BNOA 1JN2P 4D7TA 4JX0A 1M4WA 1QJX1 2RE9A 5F39A 4AOCA 5FZ9A 2VMHA 5FOBB 5FZFA 5A7QA 4LIVA 3AX4A 4U36A 2WT1A 3N7LA 1EAH2 3NV2A 4P08A 2CV6A 3IPVA 3O1MA 3VBFC 3PVNA 4CCDA 2V5DA 2GC3A 4B4QA 2QQPA 1MS9A 1MQTB 5JWPA 2ARBA 3M4FA 4B1MA 4OQ9A 1FOD1 2RM22 3O0WA 4BPZA 2YDEA 4FPYA 3PURA 1SDWA 2A71A 2Y8KA 2JDNA 4MGKE 3OBTA 2GNBA 5FQ0A 2ZX4A 5C3QA 2XG3A 2B4KA 1CAVB 1W39A 3TNPB 5KR7A 3O0XA 1LRHA 4CRQA 1X33A 1AXYA 1JU3A 2ZGMA 3VBRA 3LCPA 4N43A 4CTEA 1AR63 1JUHA 2R072 3BALA 3GBGA 4HBNA 2IXJA 4LXLA 4FTSA 3RI8A 1VBE2 2DVBA 4J6GA 5FZ3A 1BZWA 3I3BA 3HNBM 3S5QA 4IEVA 4UWDA 2AEYA 3PMEA 1YNAA 1VRBA 5AC92 3D4KA 1ZBE2 5BXXA 1SLBA 2A75A 4AI1A 1DYOA 1ULDA 3NL1A 3H0OA 5IHRA 1DLCA 2E9QA 1PM4A 5D21A 4LO4B 3W5NA 1YYNA 3POEA 2HYKA 4YGEA 4QKBA 5JOXA 1HV1A 3I8TA 2DU0A 2XWBB 4HSJA 4HK8A 4YW6A 4JTOA 4PLNA 3I2KA 3SXWA 3PVBB 5C3RA 3V0AB 4QX1A 4OFGA 4XBQA 4EYUA 1WLWA 3KV9A 3B7MA 4BCUA 1NA1B 4JTNA 3M3IA 3WXPA 4ZXKA 4ZONA 1VBA2 5LRRA 3I4IA 1VBD1 4D6QA 4QX8A 5A32A 4OHXA 1ZBA3 1GYKA 2HWF3 4HG6B 4N8MA 1SCRA 1BXHA 1WMXA 2F17A 2E63A 2ADEA 3DEMA 3E97A 4OHZA 3JCIA 3B00A 1W9YA 2JDMA 2HWB3 1OLMA 1UPSA 1W6PB 5A7WA 3DXUA 1H2MA 4KWUA 2ARAA 1JZ6A 4UW3A 2YBPA 2JDPA 4HN0A 4YGBA 4C0HA 1D4M2 4OVEA 3T1MA 2VW0A 1HQNA 3AKTA 1UYYA 3ETPA 2ZMKA 3HT1A 2WDBA 3KT4A 2NQYA 1BEV3 3ZSKA 2BNOA 3AZYA 3BOPA 3N35A 1GP6A 5CA6A 1FAYA 1QXJA 5IVCA 2C24A 3SCHA 4AGVA 3ZFGB 4LBLA 2D93A 3RYRA 5B2GB 1ZRFA 1SLTA 3CZUA 3ZXAC 1JYVA 1RTVA 2FDIA 3LDRA 3K51A 4JDMA 2C0ZA 2VJXA 1ENXA 3AL6A 2QDNA 2WL1A 2YG0A 5G04L 2QQNA 3RZJA 4LO7A 3H8OA 2ZXQA 1W6MA 3LA7A 3VD7A 1RUF1 3SCFA 1CAWA 4ZU7A 3AM2A 4X8NA 4Q8KA 2GDFA 3T1LA 4TYSA 1NCRB 2Z79A 3AP9A 4PDWA 3RYPA 3DF0A 2E31A 4IV1B 3OY8B 3H3ZA 1JYXA 1QGLA 2R32A 3LSEA 1S2BA 2I07B 1GKBA 1W8NA 2EICA 2RV9A 2DURA 4S2GA 1TMF1 4OI1A 3LAGA 1ENQA 2WIIB 2FMDA 5FK7A 4D3WA 5BY5A 5F7UA 1F31A 5F5IA 1LHUA 3ZSEA 1UMIA 1YJLA 5A1LA 1UU4A 3BTYA 3GHMA 1QJEA 3I59A 2DVGA 3GBWA 3EYPA 1MACA 3ILFA 5ABJC 2D6MA 5BNQA 1E5RA 2WNVC 1WA6X 5E6HA 2WNUA 4OHWA 3UESA 4E8DA 1BBT1 2BERA 2EF6A 1W9FA 3DV8A 2QQKA 4MLOA 4EWEA 1CAUA 4SBVA 5FZ4A 4D6SA 4AQ2A 1AR71 1UD1A 4CDWC 3IAQA 1MEC3 4AFDA 3SITA 1I1EA 3AP5A 4A6SA 2BU9A 3MIDA 2HEWF 1B35A 1RIRA 4Y33A 5C8CC 1W90A 4K7JA 4MGSA 2VTFA 2ZACA 1OA2A 3MW4A 1QH6A 3WNXA 1AX1A 1MS4A 1OOPB 3U4XA 3TOJA 3RYKA 4XXPA 5I0TA 2CGOA 1H2NA 2YFZA 4YGCA 1WCKA 1KS4A 5JR7B 4MO3M 3IDEA 4XABA 4AYUA 2WYSA 4LLOA 4A4AA 2FDKA 2HWC1 3RDIA 4Q4W3 5FKCA 5BNOB 5C3PA 4QX0A 1DYKA 4NIIA 4NJ4A 1GU3A 3SH3A 4CP9A 1F35A 5A3WA 4RHV1 4XDQA 1US3A 2FCUA 3IB3A 3NRUA 3PJYA 4NROA 4B4PA 1IS4A 2W3JA 4BA6A 3AZZA 3FWEA 4LA2A 4DXZA 1UKGA 2R061 3CZJA 1US2A 4WM8B 1E5SA 2JJ6A 3KCXA 5JZGB 5DXDA 5ACA1 3BPSA 1AL0G 4AQTA 3K4AA 2EALA 2MEV3 3MV11 3VKNA 1AYN3 2RS11 4AK3A 1Q8OA 1VIWB 5FZDA 3V0BA 1OC1A 4K21A 1UXXX 3KHBA 4MGQA 4BQ2A 1OLQA 1Y9GA 4BQWA 4QXCA 4P00B 1GZWB 5FY7A 4AF9A 4P9XA 5L19A 4BZ4A 3PVEA 1F4HA 3RSJA 5FQ0B 2J42A 2WS93 2BW8A 2H6BA 4M0NA 2ZHNA 3RQ0A 5CEHA 1UNBA 3KV4A 4OHVA 2ZX1A 3JD73 5A6YA 4QDQA 5CU1A 2WZR1 2DBIA 2DUOA 5EP9A 2Z5WA 2A73B 1O3SA 4YZ5A 4I2OA 1QJU1 2DUQA 2HBUA 2P3JA 4NE9A 3ZX7A 4JKMA 4GKXA 4UXAA 5JI9A 1GUIA 3TRSB 3OGGA 4PHZA 1O3QA 1A34A 3NKGA 4ZU5A 4DXTA 3KHCA 3OUHA 1FT9A 1RUJ3 4HT1T 5FP9A 1OHFA 2Q8CA 3OD4A 1VRH2 2ATFA 4PQQA 5IK8A 1WCSA 4XAAA 1DGWX 1BQPA 4WZFA 1NT0A 4XC9A 1NQJA 1W9WA 3AB0A 2H6CA 2XONA 3WP3A 2L9LA 3W59A 4HPKB 3HN3A 3ZXGA 3H1WA 1LU1A 1YI9A 2D6NA 4WVMA 5A6QA 1GV9A 1K3IA 2W08A 4NRMA 1GNZA 3RS6A 3VBFA 3PHMA 3J8F3 4PF1A 2WABA 1HB1A 2VMFA 3LIGA 4PI2A 1RUI3 2BVVA 3PIJA 5A3LA 1OFNA 3MLKA 3VZOA 1W8HA 1IPJA 3CEWA 1QIQA 4Y4RA 3KT1A 4KGQA 2BUKA 5J96B 1VBB2 3SMHA 1FV3A 2Y6FA 4XHXA 4NAOA 1LR5A 1V6NA 4URAA 2VQAA 2X53S 5EJ1B 1HQLA 2D7FA 5FY9A 4FPFA 4WVWA 5IWFA 3AMNA 5FYUA 4IE5A 1NA1C 2A6VA 3CJIB 1QXPA 3MYXA 1XJAA 4Y22B 2XH6A 3LDBA 5FY8A 5SV8A 5BV6A 3T0AA 2RDNA 4XFHA 5J48A 3NW4A 1BBT2 1WBFA 1ASJ1 5H9QA 3WNKA 4FPCA 5A3MA 4OUMA 2D6OX 4QU2A 2WYFA 3U0ZA 1H2LA 1S0JA 5M0TA 1RMU3 4JGYB 5FYZA 1U5XA 1OVSA 1W8WA 5K8SA 5FZ0A 4O65A 3M8LA 4JKKA 1AXKA 2BVBA 3AYDA 2GAUA 1G8WA 4YW1A 3WQ1A 5CKMA 1RUG2 3V64A 1CAWB 4NUBA 1D4M3 2W94A 2FZ2A 2BWAA 4QX7A 3N36A 1W2TA 2VW2A 2LW8A 3PUIA 2BNMA 3NNMA 4Q4X2 3SKVA 1XNKA 2XMLA 3LA2A 5CFCC 1XYPA 2W39A 4E2GA 4Y26A 4MYEA 2JXAA 5BYNA 1AR83 4OZXA 3VLBB 1DGRN 5T52A 5FTTC 1Q8PA 3ZR6A 4ES8A 1RVF1 2JE7A 3GF6A 1Q8QA 3POGA 2FMYA 4DIQA 4TLGA 5HCAA 5FYHA 4XAEA 1C5IA 1R1ZA 2B42B 3SLIA 5KC5A 2MNGA 1KFXL 1UMHA 5ACA2 2VMEA 2PHRA 3CNAA 5FYVA 2X09A 1NCRC 3PU8A 2WLPA 1SQ4A 5DG2A 4NHXA 4QPGC 3UGFA 4BH9A 4QB1A 3K3OA 2QQOA 1ZVFA 1UOGA 2UYAA 4XCAA 4HVOA 4ZZ8A 4HONA 2Q4SA 2W92A 4Q4V1 5JOYA 4P14A 3VZLA 5FUIA 4M4PA 1MR5A 1QJX3 1Z7S1 1XC6A 4H7MA 5FZOA 3OGJA 4FPGA 4Q5OA 1UZ0A 3RZHA 1B35B 2YPJA 1WCUA 3P1IA 2XB6C 4FXGB 3ELNA 2AYHA 3O1UA 5T5OA 4IW3A 1IOAA 2EIDA 4XBNA 3FC0A 1RINA 2V4VA 4E8CA 2R042 1FOD3 4XPVA 2VD7A 3VKLA 4C0BA 1G9CA 1YFYA 3QD6A 1NAEA 4IGPA 3AYCA 4AR2A 4EJRA 2XUEA 4AZZA 2W91A 1RHI2 4NO4A 4QM9A 4BQ1A 2WFF2 3ASIA 4XW3A 4YVSC 4R4XA 3UT0A 2VOVA 1O3TA 1DF0A 1GWMA 3MV01 1UY4A 4LBQA 4YZ2A 4UFHA 4AG4A 3QH6A 4YZ1A 5FPXA 4Q4Y1 1AR92 1OOPC 2GMEA 1M06G 2WSUA 3ZFEB 3GXUA 1ULEA 4CPBA 3PU3A 4GXLA 1VB4A 1UCXA 1W8TA 4LEJA 4EROA 3WQ7A 4XMAA 3ZYGA 3EHKA 5LK7B 4D69A 1NYWA 2X5IB 3FMGA 4Y24A 2XLAA 4DRVA 5ABJA 3C7GA 4A2UA 4DUXA 5C33A 5I8TA 1J1LA 2WNVA 1FMD1 2VH9A 4QHBA 5FZBA 3S57A 5DZFA 4MXWA 3D82A 2LALA 4WM8C 2P17A 5F3GA 2WO3A 1X36A 3J9SA 3HMYA 3POWA 4PT6A 3N7KA 2D6KA 4CDWA 5JZGC 1DQ6A 4HZFA 4E27A 1OH4A 1LOAA 2VOWA 3FZ3A 2OT7A 4L11A 1GFF2 1G9BA 3KZ4C 4GKYA 5C8CA 1PVC2 2DTWA 2JDAA 5FYMA 3MFCA 4HKLA 4F3JA 2KA3A 4YM1A 3U14A 5DAXA 1CPNA 1J3PA 1TVGA 2NYYA 3MDPA 4TXWA 2IC1A 5IVEA 5LBFA 1VBD3 4GWIA 5FMDA 2P3KA 4NHMA 1AYM2 1YFWA 4XJ9A 1YO8A 3I3DA 3BCWA 2Y6JA 2JB4A 4IL7A 4BIFA 4GJZA 3I54A 2V73A 4B1LA 1W9SA 1POV0 4QPIB 4CDUB 3NV3A 2E7QA 4XHBA 1W6OA 3T0BA 2JIJA 5HXMA 3TEYA 1U5ZA 3QACA 3WINE 1OKOA 3S0MA 3VDDB 5F3IA 1YRZA 1AUYA 2ERFA 3O5SA 3ZIWA 3KLSA 1SLAA 2JICA 4YW2A 3WG2A 2Y6LA 2D97A 2YGLA 1VMHA 1H1AA 3KV6A 5C71A 5EFUA 1ZREA 1HB2A 3HN1A 5FXWA 2K9ZA 4S2DA 2WT2A 1KJLA 3AXEA 3AZXA 3J7HA 3VKMA 1HRV1 4HANA 5A33B 3R4UA 4N53B 1H1IA 2D6PA 4L92A 3ZR5A 3GM8A 2ET1A 1YC61 3U75A 2YU2A 4B29A 1RUF3 3RZMA 1ZA7A 3OYWB 4DINB 5C4WB 5FLHA 5KBFA 5C7GA 3J7NA 3R4SA 4COZA 1EP0A 1X8MA 4ASLA 1V6JA 3VL9A 3WW1A 1XQNA 3U10A 1UAIA 3ILNA 1QKQA 1TME1 1GQPA 1Q3EA 4MGZE 1SFYA 1JZ8A 3VBSC 1CAVA 2X29A 2ZGSA 1GANA 3QH7A 5FUNA 1ND2C 1Z7S2 2VQTA 1RXFA 1A3KA 1OT5A 1O4YA 1TMF3 2ZEYA 2R49A 3DKWA 4AHXA 4CCCA 1OXCA 2VG9A 2DCZA 4FOYA 1JMUB 4CU9A 5JR2A 5CFDB 3CJIC 1O5UA 2N7GA 3ZYRA 2XL9A 4JCKA 4TN7A 5GM0A 2E53A 5IFPA 2Y33A 4YW3A 4CA9A 1PO21 1W99A 5I0RA 1IG3A 2KD7A 2JD9A 5FYCA 2I45A 4XEZA 2ZCWA 3RGBA 1BBT3 5F3EA 2PQSA 4V2VA 1L7QA 4NN0A 3I7DA 5HV0A 4AHYA 3UETA 2DYCA 1X9TA 4JGYC 3BKZA 4RA0A 1AR73 1ZZBA 1F9KA 1VLNA 4W65A 2OXBA 3AKPA 3LEGA 1LEMA 1NLSA 3KV5A 5EQUA 2PAMA 5A3UA 2PLV2 1Y3TA 1EAH1 3CO2A 4E4ZA 4V2WA 4GQ7A 4YLZA 2YC0A 3MUY1 3HD8B 3V0AA 3ILRA 1OMIA 1ZM1A 3CIHA 4DOUA 1TE1B 4L9BA 1NA1A 2RM21 2GN7A 3K4ZA 1H2KA 3L2HA 2IXIA 4Q0SA 5GALA 3M7AA 1C8NA 3AFKA 1LAJA 4MXVA 3WG3A 1W2OA 2HWC3 1FMD2 1ONAA 4FTEA 2W5FA 1VMFA 2ZZJA 4XE9A 2OX0A 4ET7A 4L97A 4RHV3 3OBZA 5FZOB 4CCLA 4BQ5A 5JLVA 5FJKA 1BJQA 1U12A 2R063 2R071 2A70A 4IDZA 2LTNA 1REFA 5F37A 1XNBA 3WP6A 1VBE1 4QT6A 3A23A 1DQ4A 1C8M2 3NJYA 4CUCA 5I91A 4OYUA 2RS13 5H9PA 5C5TA 5FO9B 1ZRDA 2O1QA 3WG1A 2XVGA 4UBHA 2NLRA 2WWJA 3SH4A 4UFJA 1FX5A 1ZRRA 4BJ0A 1HX6A 4FAGA 4PF5A 1A8DA 5EXOA 1R1A2 2YC4A 2EXIA 4MV2A 2DCKA 1XNDA 3CQOA 5LA0A 5CFCA 4LNVA 4RS5B 5DUVA 4Z2AA 2QBXA 4RGGA 5ISLA 1CVNA 4BLIA 4INDA 2GU9A 3POSA 4OCTA 2WZR3 3O1TA 1LHWA
chains in the Genus database with same CATH topology
4R9DA 4LBQB 1UW8A 3WVJA 1YFXA 3TAYA 2XLFA 1QJU3 3IT8A 3WDYA 1G9DA 2D44A 2RS52 4YFWA 3E6DA 1DIWA 1PIV2 1LESA 4QGLA 5FLIA 4AEDB 1HDKA 3D8CA 1NCRA 4OI2A 1VBA1 4QPGA 2X8KA 4GALA 3OY8A 5KHGA 2WNVB 4IEWA 3EJKA 4CDXC 3ENRA 1Y7BA 4AFMA 1JYIA 1JOJA 3KD4A 3ZFEC 2I2SA 1COV1 1JH5A 1N3QA 2X5IC 2R30A 3OD0A 1AJOA 3QLQA 5C8CB 4BMEA 2YZ4A 1RJ8A 3RI9A 4N9HA 1LOBA 4YG0A 4EWAA 1VB2A 2C1FA 1GBGA 2HWE2 4FQZA 1TNFA 2PA7A 1U5YA 1PGW2 3KCCA 4H3WA 4YVSA 2Z2SB 3ME2A 4AWDA 5JPMB 3SH5A 1O7FA 4JDNA 4XFAA 2VOKA 1W6OB 2A3WA 2OUHA 4YW4A 2ZMNA 4FOVA 2DCTA 3EQEA 3BPZA 1OOPA 5GLWA 2CGPA 2VGDA 4Q27A 3IKWA 1S0BA 5JAXA 1ASJ3 4IXLA 4XETA 1VP6A 4OI4A 3GZUC 5CIRA 4ONUA 3M2MA 2OA2A 1MS1A 4QPIC 4CDUC 3VZNA 3HQXA 4LO8A 2IFRA 4WM8A 2VY0A 3VZKA 4GB33 5JZGA 2RJLA 3VDDC 3B9CA 1HRI1 1NXD1 2DFBA 2IZWA 1MZEA 3EBRA 2DCYA 1IKPA 4RQPB 1GZWA 4XJAA 5AFBA 3HWJA 3GHNA 4AW7A 5EWSA 1WBLA 3DL3A 4N53C 3PLQA 2ZZQA 3H7JA 1RVF3 2NMOA 1OQEA 4XQ4A 3MIEA 1YHFA 4AEKA 1XNCA 4XFGA 4Z2WA 4O9GA 1O4TA 3SHRA 3WG4A 5C4WC 4OHYA 1SFNA 5FMOL 2D43A 1WLDA 4YNIA 2ZX3A 2DTYA 1F5JA 5HCBA 3S30A 1BKZA 1SBDA 3ZN5A 4ATEA 4Q4V3 1Q56A 3NSTA 2CWSA 2A5ZA 2VMGA 3MFAA 1R092 1DQ2A 2QVSB 1EY2A 5CFDC 2OYZA 1RUE2 4A7KA 4IETA 4HPKA 5GZFA 1OKQA 4Q1PA 3B02A 2KM2A 3PJQA 4NPRA 5DUUA 2BTVC 4JV4A 1VAMA 3JBG2 4HN1A 3ZN6B 1QQP2 2RS33 5JCTA 1W6QB 5EYXA 1ULGA 4ZU4A 3ROUA 3IDCB 3AK0A 1QNWA 2R0HA 1PM7A 4UBGA 4AGGA 1CD3G 2HJIA 3VBSA 4AVSA 4M00A 4YW5A 2Y38A 1ND2A 2MPFA 1GZCA 4Q4Y3 1COV2 2A6WA 4RSUA 1V9U2 2BNNA 5EV7A 1NLRA 4Z92B 2VULA 3CJIA 4Y22A 4I0WB 2XGXA 1KRIA 1WLTA 2W52A 4META 4FBFA 5KHIA 2OVUA 5C6CA 1QOTA 4YM0A 4AFBA 1YI7A 1VRH1 2JX9A 4WM7C 5CFCB 2RJKA 5HI0A 5CG9A 1KXGA 2OZJA 2UY8A 5GZDA 2UURA 1SBEA 4KNCA 4NOTA 4JGYA 4RD7A 3VZJA 2AR6A 4GMP1 1QDOA 1D4VB 3FHIB 1EV11 3VV1A 4MUVA 1OA3A 4KBBA 1JYCA 2XBO2 4V1PA 1O5LA 1O4ZA 1MVQA 3NV1A 4LO6B 5FPZA 5H9SA 4Y1VA 4N7UA 4RS5C 4QPGB 3USSA 4KU7A 2BWCA 4XIKA 1RUC2 4LBJA 2ZGTA 3L9JT 1VBB1 4M0HA 4QQOA 1WA4A 1LGCA 2Q1ZB 3J26N 1N47A 2ZX0A 5CAZA 2ZGRA 2AH2A 4IEYA 2TEPA 1PZ8A 3LGRA 1GLHA 1LULA 2ZX2A 4BM8A 1HRI2 1DBNA 2PYTA 4AEDC 5KHHA 3B01A 4IEZA 5GZEA 1FYUA 3NWKA 5KHJA 1S0CA 3JB8A 2AUYA 1WD4A 3NVCA 2XJRA 4AFCA 2WA4A 2D5HA 3ACLA 1ENRA 1NXMA 1BVVA 1HRV3 4XF0A 4YVSB 2D3RA 2WNEA 4FT8A 1OSGA 4PBPA 2VW1A 1DGRA 3ALQA 3CJXA 2QZ3A 1SCSA 1RUG1 1H4GA 4JAAA 2SBAA 4Q4X1 5F6LB 3AYEA 3B5LB 4M3CF 5IT6A 1TME3 2CWMA 2XJVA 2XPJA 4N7IA 4CDQB 1SEFA 3D0SA 2HEVF 4CDXA 2HWD2 2BQPA 3ZFEA 2BBVA 1PO12 2DVDA 3E6BA 3S7EA 1PO23 3GALA 3WUCA 1C28A 2X5IA 3E5UA 1FXZA 3IN9A 2ZBJA 1QJY2 1WUVA 1DLLA 5DDJ2 1ZRCA 1ZA4A 2WFPA 4G9SB 2RR12 4IERA 3WV6A 2UWCA 5T55A 4JVAA 4YG3A 2I74A 2ZTNA 1EAH3 2XJQA 2XJPA 4NWWA 1XYOA 4YVWB 4XFBA 1V00A 3HIFA 3RNSA 4E2SA 4W6WA 3FJSA 3ZXDA 5FRAA 4COWA 5FOJB 4RQPC 3U11A 2BGCA 2ZPXA 5JMCA 2R041 3S7IA 2RM23 1XU1A 5F1RA 2VNGA 1U0AA 4FPEA 3VZMA 2VVDA 3HAGA 1B09A 1RHI1 1O3RA 2WFF1 4YG6A 1ND3B 3X29B 2BPA2 1FV2A 4K3UA 1LCLA 4QQ2A 4A7YA 2R073 3WP4A 4QPIA 4CDUA 1RUOA 1EV12 2YYOA 1VBE3 2VXRA 1JHNA 1AR91 1VBC2 2ET7A 4LHNA 1LHOA 4K8FA 5E8AA 4PLOA 3VDDA 1S2KA 5AC93 1ZBE3 4R52A 1MS3A 1MVEA 3RZZA 2GH2A 3ZFFB 2FHRA 1DZQA 1SLCA 4TWTA 2ZKLA 4BE3A 1V6IA 2RMU2 2R0FA 4HETA 4MX3A 3VBSB 5A33A 4N53A 1ND2B 3KGLA 1W0PA 4YZ4A 2AENA 4NHLA 3N7MA 1PVXA 3MI8A 3ZN4A 3OYWA 5C4WA 1PVC1 4BHPA 5JOWA 1WMEA 4E4SA 1LHNA 2A3YA 1YCIA 3CLPA 3VL8A 1VBA3 3DGTA 4FPJA 4Q0UA 3JB4C 4LBKA 1R082 4HK9A 1LJ7A 1XXNA 4DFSA 1AYM1 1AX0A 2VMIA 4XF3A 5LEKA 2YROA 1PZ7A 5C9AC 1J3RA 5BNPB 1JUIA 5E89A 3AP6A 3ETQA 5CFDA 3RG0A 2ZGNA 5BNNB 3NAPB 4MH0E 2YV8A 3BODA 3O12A 1Z78A 4Z82A 1NQDA 5SV5A 2A6XA 4FP3A 5LEJA 4I0AA 3M3EA 4AHWA 1JXNA 2CL2A 2DWRA 3ES4A 4Y20A 2CY6A 3OTFA 1OI6A 4KWJA 3KB5A 3D5OA 2QFEA 2WWSA 4HKWA 2NM1A 3THPA 1N1TA 1N1YA 4KGGA 4QGNA 4L8QA 4R9AA 2PQQA 2PELA 1FPN2 4I3GA 1MZ6A 1DQ5A 1YIPA 1SLIA 2WSVA 2ZAHA 4AVVA 1XRUA 5K0UB 5J98B 3VHNA 5J09A 4YM3A 3SISA 4DNYA 4AEJA 4H14A 4K20A 1HXS2 2PTMA 3AJZA 5AVPA 1BMV2 4EWDA 3V65A 1LU2A 2ARXA 4WM7A 3W9AA 2YGMA 3LZZA 4BMBA 3HT2A 1EPZA 3NKTA 1MZ5A 1HRI3 1F8VA 4EV0A 3B9IA 1NY72 4D7YA 4RR3C 1H0BA 4XQDA 2R1DA 3BTAA 5F9TA 1CQ9A 1CIWA 4RS5A 3AJYA 2WZPP 2B45X 4BIOA 5L7OB 1QXRA 4CDXB 3MW3A 3Q9OA 2ZGOA 1ZZ6A 1CGPA 2PLV1 2NZ9A 1F2NA 1S0IA 4N9IA 4XTMA 1DQ1A 3FBYA 3IMNA 4NWVA 4I01A 5JPNB 4AEDA 1X8EA 3NJZA 1AVBA 3JU9A 3GNEA 1AL22 2IXLA 2UU8A 4J1WA 4KH9A 1RC6A 1HW5A 1ZBA1 3VBHC 4CDQC 3MPBA 1UIKA 3H50A 4I02A 3TBDA 4HVQA 1S1AA 3TNQA 3NO8A 5J3UA 2OIIA 2OW4A 1C8M1 4W6YA 2VECA 1JW6A 3ZXJA 3B69A 3PTYA 4RGAA 1AHSA 1RUH2 3LOBA 2A7AA 2DF7A 1LECA 1BEV1 2XKOA 3MLJA 5T5LA 1OQ1A 1QMJA 2PHLA 1R1A1 4D94A 3KMHA 1CAXB 5D8AC 5DG1A 1RL3A 3ZMOA 3ES1A 1N1VA 4K1ZA 1EYBA 5JI7A 4YVWC 1QOSA 4P9JA 2GMMA 2IXCA 4HL0A 1I6XA 1DFQA 2RS51 4LE3A 1H8VA 4R9BA 3VBOB 2Z69A 2V5YA 1PIV1 3RJRA 1CJPA 4H7LA 5L73A 2B8MA 3ZYPA 5J7MA 1ND3C 2B39A 3USUA 3VN4A 2OZ6A 5KWRA 1D2QA 1VRH3 3QCWA 1FNYA 2GN3A 4B7KA 3B3QE 4WBBA 3ZPYA 5BPXA 4JQRA 5K7PA 1HIXA 1PGL2 1YLLA 4GMP3 1LENA 4Q8LA 4MZUA 3N3HA 4C90A 2JDZA 2DVAA 4XOGA 1DGWA 3WP5A 1ULFA 2BFUL 5T3NA 2MHFA 4IV3B 4LBNA 1E57A 1AX2A 3ZFFC 4P5HA 4CZSA 2YHJA 4RQPA 1RUD1 4LA3A 3AKRA 4PIXA 1V6OA 3AMMA 3AYAA 2DU1A 2HWE1 1HV0A 1VBB3 4B4RA 5JVVA 2P2KA 1HQWA 1XE8A 3OJBA 1PGW1 2GNMA 4U2AA 2JG9C 2E6VA 5H9RA 4AQSA 1AR62 4QX5A 1BYHA 1OD5A 4MGYE 1ENSA 4UW4A 4C1XA 4M3CB 3LA3A 4AHZA 4JRAA 4LBMA 5HCFA 4Y20B 5BNPC 1FNZA 1EPWA 1G9AA 3JZVA 2XUMA 5BNNC 3KGZA 3NAPC 2GNTA 2ZHKA 1ULCA 2QDRA 3UK9A 2F6BA 4FVVA 2D3PA 1SMVA 1UF2C 3MF9A 1PNGA 1RUG3 2MEV1 4OLLA 2PAKA 4NR1A 3R6SA 3KM5A 4K9SA 1CR7A 4Q4X3 3ZN6A 5JSOA 3WHUA 1W6QA 1ZBA2 2ENRA 2G9FA 2WS91 2HWF2 3OCPA 1HKDA 4F8AA 2D98A 3LKJA 3KT7A 4FQ4A 4WM7B 4X6RB 4E2QA 3THTA 2HWB2 5T5PA 2LM3A 5C9AA 5AVAA 5ACA3 1IPKA 5K0UC 2ZA9A 1S0EA 1KDMA 3M70A 5CBLA 1MS5A 3T2TA 3VGIA 1PK6B 4FTBA 4WZCA 1BEV2 2VOXA 1AXZA 5E16A 5FFOC 4UW6A 5T5JA 5GZGA 5F5QA 2Q30A 3I2DA 3VHOA 1GNHA 3GBFA 1R091 5CNAA 1WMFA 2NMNA 1G86A 1RUE1 2PHUA 1Q43A 4PQ9A 5GKAC 4QQPA 2ZABA 5FDBA 1RGSA 1CPMA 4DY5A 2WNUC 4P9LA 3BB6A 1FATA 1QNYA 2XL7A 2R043 4XJWA 1IHMA 5IUQA 4C91A 1X82A 3JBG1 1QQP1 2E7TA 2XLGA 1RHI3 3DPRB 2HKXA 2WFF3 1Q8SA 5L7OC 4DPNA 2AZ5A 4R9CA 3WDVA 1POV1 1DHKB 1Q5OA 3H7YA 3FUOA 4Q2FA 5BUVA 5KHKA 5FREA 1AR93 3WLUA 4XF1A 2ETEA 1V9U1 1VJ2A 2UYBA 3KSCA 1OQDA 2PHXA 4AI3A 2XKPA 4H55A 1DZTA 1UMZA 4NHKA 4P9IA 2UWAA 1RUD2 1S55A 2CNAA 2QNKA 4AVTA 4R4ZA 2K0GA 4RR3A 5JIUA 3ZXFA 4LLFA 5EJ3A 1MEC2 2VU9A 4LUKA 3WDUA 5I0SA 4QMAA 4HMZA 3LWCA 4R8HA 5LK5A 3AMQA 3ZO0B 4Q29A 4IEPA 3JQXA 4L99A 3S6PA 1PVC3 2XBO1 3MGUA 3WQ0A 2ZOEB 4HSLA 3USUB 4X8PA 3VBUB 4Q4W2 4CP2A 4YYOA 1RUC1 2DUPA 1AYM3 1VAKA 1UPIA 2ZGLA 4OULA 3APBA 3PNAA 3VBHA 4CDQA 3H3UA 3ZSJA 2PHWA 2XHKA 1LTEA 3VBOC 2A6YA 5KXBA 2MEV2 4QPYA 1DG6A 1AYN2 3ECQA 3FX3A 4ATFA 3LB9A 1UZYA 1UU6A 5E88A 5FMOS 4IEXA 2P34A 4CEYB 5FBZA 1D0GA 4BYYA 2WS92 2E51A 1NG0A 1J59A 3ZMNA 4HKOA 3JD72 3AZWA 2Z42A 3ATGA 2ILMA 1AF9A 3MEPA 4Q26A 4X6QB 2XJSA 5D8AA 3FE5A 4AQ6A 2O8QA 4JGZC 4IV3C 4A3XA 2GALA 1WW4A 4YVWA 1NZCA 2R1BA 3MIFA 1REDA 4I30A 1PGSA 4LO5B 2B46X 1JTZX 1C4RA 3IIAA 2JG8B 4CEWC 1RUJ2 3H1MA 2JKBA 4O9EA 4C1WA 3C3VA 3FFZA 1YIFA 4FPHA 1WW6A 1ND3A 4GA9A 1REEA 3WDXA 1Z7S3 1CX4A 1LOFC 1KFUL 4FPOB 3FLTA 3WZ1A 2HWD1 2PFWA 1UU5A 3WCRA 2Q8OA 1NCQB 4XFCA 4PIZA 1PO11 3J8F2 2TUNA 2BYVE 2EXKA 3V56A 4FOQA 3MLLA 1RUI2 1OPMA 1QJY1 1LGNA 5F6KA 3ZFFA 1K5MB 1MZFA 3TYJA 1I9RA 2NN8A 4L2NA 2JD4A 2DV9A 5DDJ1 3U07A 2NPIA 2RR11 1W6NA 4GIQA 4TLFA 2WKKA 3KCYA 3RPQA 2XJTA 4AXOA 2B9UA 2PLV3 5C9AB 2JG9A 4Y1ZA 4XQWA 4GH4B 3INAA 3UKVA 1I3HA 1X7NA 5CVRA 1G7YA 4YFZA 4FXKB 1GSLA 3B94A 2ES3A 2WA3A 4XTPA 1FMD3 3WR0A 4EN8B 4F83A 2QE3A 4TZDA 4FPKA 4PBOA 3RMYA 1JBCA 1IS5A 2JECA 4CP0A 3WT3A 2C5DA 1RMU2 4W6XA 5BNPA 4IEOA 2F4PA 3WX5A 3MZHA 3B93A 1WD3A 2PHFA 5BNNA 4XXAA 3NAPA 4LUMA 4S2HA 1H8TB 1VBC1 1PK6C 1C8M3 4RL7A 3ST7A 2YXSA 1LOEA 3EXUA 3P3NA 3ZYIB 1IGOA 2EAAA 4IEQA 1R1A3 1AR82 1PHMA 4UW5A 4DQAA 2LUWA 2RMU1 4M3CE 2G4IA 3AFGA 5CG8A 3N4MA 4EN6B 1URXA 2RHPA 1SACA 4A7ZA 1QOOA 4XFFA 5I8SA 2RS53 1DQ0A 1KD7A 2OPKA 1PIV3 1RJ7A 5K0UA 5I93A 3DPRC 4B7EA 2CAVA 4MGIE 1R081 2QUOA 2XVLA 4RR3B 1S0GA 1QJX2 1CESA 1GICA 4J1XA 4XBLA 4Z07A 3OF1A 4DRRA 1IKQA 1GR3A 4PIYA 3R05A 1QJZA 4XJUA 4BWOA 2AGSA 2ZGKA 4DY3A 1WW7A 5GLUA 3WW3A 3G7DA 3CU7A 1FOD2 4I3PA 3BIWE 1TEIA 1IS3A 4FSJA 2PHTA 1RUD3 4IEUA 2Q5TA 5JSRA 5FO8B 2HWE3 4SLIA 1DDLA 1V70A 1CN1A 3VBHB 5L7OA 3K48A 2ZJCA 1O91A 3WUDA 4Z8BA 2QKDA 3HBZA 3IM0A 2R16A 4QQLA 5FAXA 1FPN1 4COVA 3LOIA 4N90A 5KXEA 2EIGA 2C9AA 1ZZ8A 4LT5A 3CF6E 3VBUC 4B3NA 3CL1A 4Y5Z0 5JDBA 1BK1A 4P9WA 4EN0A 4I0BA 1UIJA 1V6MA 4AVAA 2QZ2A 1HXS1 1BMV1 2D40A 3G6JB 1QF3A 5D8AB 1YXWA 2VNOA 3WDTA 4LBOA 4WVZA 3AKQA 1PMIA 3IPVB 3DN7A 1H9WA 4JRLA 2VNRA 5C8WA 4CEYC 4URTA 2W68A 2BEOA 1NY71 1SBFA 2PN5A 1APNA 1PNFA 4EN9B 1YFUA 1VBD2 1VR3A 2AREA 1L3JA 4LBQD 3WY6A 3AXDA 5GLVA 1CAXA 3IDBB 3ZSLA 2EAKA 3VBRB 5HBAA 4N43B 3URFA 3BU7A 2WINB 4DMIA 1Y9QA 5J36A 1MQTC 1ZZ7A 4FPLA 4WVVA 3H8UA 3WOGA 5EYYA 4AVCA 5I8YA 3RRDA 2JG8C 1QWRA 2V09A 3VBOA 2HEYF 1RUNA 3VUOA 1DYPA 1G6NA 3MIBA 2Q0AA 2WC2A 3A0KA 3NV4A 2QCSB 4HLTA 1AL21 1KITA 1MS8A 3ZYJB 2B7YA 2EXHA 1GQHA 1LB2A 2GMPA 1W6NB 1R093 2EVXA 2DVFA 4GULA 4ZKTB 1RUE3 4QXKA 4Y1XA 1NCQC 4HVRA 2YMZA 2JG9B 1H9PA 1RUF2 2GSYA 5E1RA 4JGZA 4IV3A 4AE2A 3JBG3 1K5MC 1RUH1 4Q0QA 1QQP3 5A32B 4CEWA 1LEDA 5EZWA 1TMF2 3MIHA 4CP1A 1POV3 1UN1A 4I09A 5DZGA 3ZXKA 5CADA 1UZZA 4QM8A 3L2YA 1WW5A 1LOFA 2A3XA 4XJZA 2VPVA 1COV3 4GH4C 1V9U3 4Y4YA 2OUJA 4M3CA 1C1LA 5FO7B 4BOWA 1Y43B 3TN91 3M3QA 1UL9A 1C5HA 2CYFA 2IXKA 1AR72 4LE4A 4FAHA 4Q1RA 2GNDA 1XE7A 4QGMA 5HXVA 4PJYA 1H8TC 2GC2A 1PGL1 4YZ3A 2JENA 3ZVXA 4GB31 3FLPA 1W6MB 4YRDA 1J1TA 4LULA 1AZDA 2VUAA 2XBO3 4FP2A 4DS0A 5TSWA 1CONA 4DZGA 5GZCA 5KXCA 4KG0A 4PDWB 4Y1UA 2Y0IA 3ZFGC 2QJVA 2HWC2 3R4DB 4MSVA 1RUC3 2R6QA 5K9YA 4Q0VA 3ZSMA 3UKNA 4RHV2 3FLRA 1A78A 1AR61 2R062 4F7ZA 3TB0A 4YM2A 4K1YA 4P9YA 4Z1VA 3I59B 2RS12 2FQPA 4Y1YA 2Q1MA 1PK6A 3POYA 4IV1C 2O8OA 2WNUB 2VQ0A 2PHDA 1SLLA 5IK7A 1IQAA 3N7JA 1CAUB 3VHRA 2W0XA 2ZMLA 2ZS6B 3FBMA 2WZR2 1ALYA 3M3CA 1QJU2 2ZGPA 1LHVA 2GC0A 5KC6A 1OFSA 1T6GC 5DZEA 2JEMA 1A8MA 3PVOA 3KS7A 1S0FA 3IWZA 4YGDA 2RS31 3UV9A