2DCTA

Crystal structure of the tt1209 from thermus thermophilus hb8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
MEIKDLKRLARYNPEKMAKIPVFQSERMLYDLYALLPGQAQKVHVHEGSDKVYYALEGEVVVRVGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVVTAPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA0104
publication title Crystal structure of the TT1209 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 19
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dctA00
4E2QA 1X8MA 1J3RA 3D0SA 3IDCB 4ZU4A 3WW4A 4D7SA 4ZU5A 1PM7A 2Q1ZB 1YHFA 4CYDA 1G6NA 4E2GA 3RYRA 4I3PA 2IXKA 4J1WA 2PYTA 4IEUA 1GQHA 1I6XA 4AVCA 4O9GA 3WW2A 4X6QB 3S0MA 2QNKA 2GAUA 2BNNA 1EYBA 1SFNA 2PHLA 4GULA 1NZCA 3IIAA 4ORFA 4J1XA 4IEZA 2VQAA 2EVXA 4KL1A 5LRRA 3VHRA 4AVBA 3LZZA 2PTMA 4AQ2A 2GZWA 1YFYA 1J1LA 2CAUA 3UKNA 3E5UA 1O3TA 5J48A 3LA3A 4MGZE 1OFNA 4UXAA 4LA3A 4MV2A 1CGPA 1CAWA 1X82A 4F7ZA 1Y3TA 1QXJA 2H0VA 3CO2A 3WW3A 4NVPA 4XFFA 4FT8A 4MUVA 2B9UA 1WA4A 3NW4A 3LAGA 3BPZA 3UKVA 3E6CC 2EAAA 2ATFA 3OGJA 3H7YA 2QCSB 3CF6E 2OZJA 4I0BA 5FPZA 3RYKA 3GYDA 4MZUA 3ROUA 2FMYA 4WBBA 2K0GA 3RZZA 2FQPA 4F8AA 4L2NA 1SEFA 1WGPA 4IEOA 3H8UA 3CJXA 1XE8A 5FLJA 1SQ4A 1VR3A 4DINB 4JV4A 2PAEA 5JSPA 5I0TA 1GQGA 3UKTA 3H1YA 2BEOA 5I0RA 3H3UA 4PIZA 3H9AA 1DZTA 4L11A 1ZZ9A 3E5QA 4IETA 4QXKA 1O5UA 4KU7A 4Q29A 5FQ0A 1OMIA 3M70A 4EWDA 1UCXA 2DCTA 5JR7B 5CVRA 1H1MA 1XRUA 1O3SA 2HJIA 3O14A 3FZ3A 2CV6A 1EY2A 3E5XA 4LTAA 2H6BA 5FLHA 1X7NA 4KU8A 1YWKA 1LR5A 2UY9A 1O4TA 5LRSA 4LEJA 1J3QA 2XHKA 3HT2A 4PIXA 3U10A 2MNGA 1YFUA 3H50A 3MPBA 4HN1A 4I2OA 4Q0UA 5FQ0B 3SHRA 1IPJA 2IXLA 4X6RB 4QX5A 3E97A 3ETQA 2BYVE 5JAXA 3CLPA 5LEJA 4WVZA 5I91A 1FI2A 3NL1A 4I01A 4MH0E 5K8SA 2VECA 3PLQA 3D0JA 3PNAA 3SMHA 3RYPA 1CAXB 1OI6A 4IERA 3KGZA 3RNSA 3SCHA 2IXCA 1ZZBA 2IXJA 4MX3A 2C0ZA 3FWEA 3KMHA 2OYZA 3E6DA 4D7TA 1LKNA 4AVAA 2Y0OA 2QJVA 3FX3A 2PAKA 4AXOA 2XL9A 1UD1A 4MGKE 4YYOA 5KHKA 1DZRA 3LA2A 5BV6A 1LRHA 4LUMA 4N9HA 4IEYA 2PAMA 2IC1A 3RPQA 5HI0A 2N7GA 5D1IA 5FPXA 3LOIA 3S7EA 2Z69A 4EV0A 4KWJA 1RGSA 2IXIA 4O9EA 4XF0A 3E6BA 4QM9A 5I8TA 3N4MA 4HLTA 1UIKA 2PFWA 3HT1A 3I59B 5I8SA 4Q0PA 4XFGA 4E2SA 1NE4A 5JSOA 2Q4SA 3FJSA 4QGNA 5E1RA 2BGCA 4OFGA 1ZZ8A 1Q3EA 2H6CA 4HVOA 5EFUA 3MDPA 4XF9A 1EPZA 4AQ6A 3I7DA 1CAUA 3IWZA 4H7LA 4JTNA 2PHDA 4EWAA 4KWLA 5FCCA 5I0UA 3GBFA 4FAGA 3ZDSA 5BY5A 3R6SA 3H1WA 1CAVB 2F4PA 2B5HA 3BCWA 2OPKA 4QGLA 3ELNA 2EA7A 4Z07A 2GC3A 2E9QA 1YFWA 4QMAA 5LEKA 1ZREA 5E16A 1FXZA 4HVRA 4YSFA 2OZ6A 4XFCA 3G7DA 4N9IA 4Q0VA 2CGPA 1ZX5A 1L3JA 2UYAA 2GH2A 4WZCA 1CAUB 2D5FA 3DL3A 4Q0QA 1V70A 4QM8A 3OTFA 4IESA 3C3VA 4HZFA 2BNMA 2O1QA 1UIJA 4B29A 4R52A 2XKOA 2GC2A 3SXWA 2HKXA 1LB2A 2XGXA 5I0SA 3CL1A 4TLFA 5T3NA 1RL3A 1ZRFA 4BHPA 4ONUA 4META 1CAXA 4MGIE 3H7JA 2MPFA 1IPKA 3LA7A 5BXXA 5AVPA 4BIFA 5C8WA 1NE6A 3B02A 1NYWA 2ZKLA 5KHJA 2BNOA 1Q5OA 1OD5A 3CEWA 3NKTA 4XEZA 3IDBB 5KHHA 3EQEA 3RDIA 3NVCA 4IEPA 1ZZ7A 2ETEA 1JUHA 4YNIA 2V09A 4P9GA 1O5LA 1QY4A 1I5ZA 4XFBA 5EZWA 4YARA 4MGYE 4JTOA 2PA7A 2D5HA 3I59A 5JSRA 1EP0A 1RUNA 1ZRCA 3ES4A 4UBHA 1O7FA 4XFHA 3QACA 1ZZ6A 2B8MA 2MHFA 1H1IA 3EJKA 4BYYA 4QGMA 3KCCA 1O3QA 4LLOA 4LUKA 4Z82A 5FLIA 2XLFA 3OD0A 3OF1A 3S7IA 5J3UA 4LA2A 3SCFA 1HW5A 5KHIA 3MZHA 3U0ZA 1RUOA 2QVSB 3NSTA 4I09A 3SCGA 3KGLA 1CAVA 2QDRA 1VJ2A 3WW1A 2CAVA 1Y9QA 5FDBA 4IEVA 4I0AA 5JCTA 4K8FA 3M3IA 3USSA 3IBMA 2IXHA 3MYXA 4UBGA 2KXLA 2UYBA 2XLGA 3DN7A 2I45A 3FFQA 4HSLA 3BU7A 4R8HA 3TNQA 1FT9A 1XE7A 3BB6A 4OLLA 3DV8A 3D82A 2O8QA 3LWCA 4XETA 3L2HA 1ZRDA 2UY8A 2ET1A 1QWRA 1ZRRA 2ET7A 1ZNPA 1YFXA 1PMIA 5KHGA 4EROA 4PJYA 4I02A 5KBFA 2K9ZA 4XFIA 3EO6A 4HN0A 2Z2SB 4PIYA 2PQQA 1YUDA 3ST7A 2D93A 3PVBB 1Q43A 1ZVFA 1UW8A 1U12A 3EHKA 5CADA 2ZCWA 4XF4A 2WFPA 4XF1A 3EBRA 3TNPB 4IEXA 4LULA 4XF3A 3ES1A 4FBFA 5BPXA 2WC2A 3OCPA 1DGWA 3JZVA 3QOPA 4HMZA 1WLTA 4XFAA 5I8YA 2XLAA 4IEQA 1CAWB 3HIFA 1YLLA 1ZZCA 2XL7A 3BALA 1O3RA 3FHIB 3I54A 2XKPA 3H1MA 3H3ZA 3DKWA 2GU9A 3HQXA 5J7MA 4Q0SA 1QXRA 4FAHA 4EWEA 4IEWA 2D40A 4HBNA 2VPVA 3ACLA 3FE5A 4KWKA 3NJZA 5C6CA 4JVAA 4RD7A 1CX4A 5I93A 1J3PA 2Q0AA 1VP6A 3KSCA 5BUVA 2GC1A 1J59A 1NXMA 3U11A 4HSJA 4HVQA 1RTVA 5CU1A 1X8EA 2OA2A 2Q30A 5F1RA 1TQ5A 4BH9A 1RC6A 2P17A 1DGRA 2GC0A 1J58A 4A2UA 4ZU7A 4YRDA 1UPIA
chains in the Genus database with same CATH superfamily
3HQRA 3VKFC 4E2QA 3UJOA 4Q4X1 3VKOA 3EB7A 3IDCB 5HCBA 1H9PA 4D7SA 2FDIA 1PM7A 4HOOA 1OA4A 1V00A 1YHFA 2V5YA 2YXSA 4L0PA 4ZONA 4QAWA 1G6NA 4BDVB 1XU1A 3RYRA 4LNVA 1LU1A 3T08A 4W65A 1QJFA 3AX4A 1C8M2 1ND3A 2DVGA 1CJDA 4J1WA 2Q8EA 5BNNB 1OT5A 1JYIA 1GYKA 4A7ZA 2WO2A 1KJRA 4QT6A 5FYIA 4GAZA 1REDA 4M3CF 2G4IA 4C0HA 4YM1A 1UZVA 1WD4A 4O9GA 1F5FA 1QKQA 4C1WA 3ZMOA 4IXLA 1Y9MA 4HPKA 4X6QB 4NO4A 2QNKA 4LBQD 4XJZA 1CQ9A 5CA6A 1MACA 2GAUA 1YRZA 1ZYBA 5HXVA 3INAA 1TNFA 2QUOA 4DUVA 1TMF1 1EYBA 2BOIA 4RHV1 4Q4V3 5DN2A 1VB2A 4XAAA 1JYNA 2TEPA 1JH5A 3BTAA 1F5JA 3GZAA 2YB7A 4MYEA 4YW3A 3K77A 3LDKA 2VAUA 1SLTA 2VH9A 3ACFA 2VZVA 5T50A 3ZN5A 2PHUA 4IEZA 1AR81 3M8LA 1OKOA 2IFRA 4KL1A 4IUGA 2JWPA 4QPGC 1IS6A 1ND3B 2JG9A 3PIGA 2C5DA 1UX6A 5IATA 2YU2A 2VMDA 2CWSA 2E51A 2PTMA 2HEVF 2WNVA 2GZWA 2R061 1OOPB 5C4WC 4CU6A 1W8HA 3BU0A 3LQCA 4YVWA 3ZPOA 3IMNA 1JMUB 5J48A 2OVUA 3MFAA 3NV4A 1RUD2 1XOYA 4LBMA 4XMAA 3KF3A 1YEWA 2W39A 1DG6A 1OUSA 3R0RA 2SLIA 4F7ZA 3GBGA 3I2KA 1R083 2B46X 2H0VA 4UFLA 2BDRA 1GU3A 1CPNA 2HH9A 2P3KA 2W1SA 2VOTA 4NHXA 2W68A 3F2ZA 2WO7A 3K4AA 1RUI2 4XJ8A 4B3NA 4FPJA 1ALYA 3LFMA 5C5TA 5F5QA 2AZ5A 4SBVA 3D3AA 4U2AA 1LOBA 5IUQA 2WQZC 2YG0A 2EAAA 3M3CA 2WSVA 1RUG3 2WNVB 2X10A 3KZ4C 3OGJA 1UMIA 2I74A 3H7YA 5IWFA 3MFCA 1DQ1A 4B4RA 4CTEA 1W2OA 5FBZA 2HWD3 4I30A 1VMFA 4N90A 5A6XA 2FMYA 1LNSA 1MPXA 4NPLA 1AXKA 4WBBA 2FCTA 2NN8A 4XBNA 4GWIA 3T2TA 1XYPA 2VM9A 3RZZA 4KMQA 3ZSMA 5DDJ2 4AHXA 1YI7A 2C9AA 2OW4A 1DU3D 1JU3A 4KQ7A 4OUEA 4XDQA 1QJY2 2YFUA 2VOVA 2P3IA 4CSWA 2ILMA 3O1MA 2HBUA 1BXHA 1QJX1 1KFUL 2C1FA 3OOXA 3PVNA 3V64A 1ENSA 4DINB 2DUOA 3JQWA 1K5MC 5FPVA 1ZBA3 4P00B 1B35C 5I0TA 1LOFC 1ZA7A 1SDWA 1EV12 5JR2A 4RL7A 5D21A 5I0RA 2W1UA 1C57A 3GNEA 3MLKA 4PIZA 3H9AA 3NNMA 3T09A 5GALA 4JHTA 1W6NA 1UOBA 3E5QA 1XXNA 4GZ9A 2WUHA 4IETA 4XUOA 1NLSA 5FXVA 1O5UA 3RI9A 4MADA 3UNPA 5FQ0A 3M70A 1VRH3 3CKHA 1SG3A 1VBE1 3AMPA 1UCXA 4K1ZA 4DNYA 4Y5TA 3HQUA 1KD7A 4RQPA 3T1LA 4DUXA 1CN1A 2PQSA 4LO4B 1W03A 1H1MA 5FZ6A 3S5AA 1O3SA 2Y6KA 1L7QA 1S0EA 2AENA 1JYVA 3FLRA 5JI9A 3VGIA 4CEYB 1EY2A 1RIRA 3ATGA 5C8CC 3WDXA 4EZHA 1A8DA 3GCWA 3ZFFA 3LF7A 1SZBA 1FX5A 2XH6A 1J3QA 4XURA 2P2KA 2VU9A 2FZ1A 2XHKA 1A34A 4D7YA 3HT2A 1V9U3 1VBA1 3CIHA 3FBYA 3OEBA 4M00A 4DB5A 1VMJA 1J84A 1PO23 2R041 5CYYA 5FKBA 3AJYA 5FQ0B 4QX2A 3BOPA 5FYBA 4GKXA 3ZM8A 1JOBA 4RGAA 3TB0A 4RA0A 3ZPYA 3O1OA 2YBPA 1E5IA 4H7MA 3CLPA 4C1XA 4CP1A 5A7PA 5LEJA 4XQ4A 2VMEA 1HB3A 4UFIA 1H30A 1YI9A 1C5HA 1WCKA 4YLZA 1W04A 1KEXA 4OI2A 4Q27A 1G9BA 4FXGB 1GP4A 2ZGUA 2Y6GA 3GXUA 3PNAA 2LM3A 1CAXB 4GXLA 4IERA 2J1AA 1PIV2 3B00A 3T0DA 1C28A 2QQOA 4QB1A 4DEQA 1K5JA 1R1ZA 1HXS2 1QJEA 1W6PB 4FPFA 1S0CA 1QHDA 4ZXKA 5C71A 5GZGA 2D6LX 2HWC1 2QJVA 1N1VA 1W8TA 2PAKA 3WNOA 1D4M3 2XL9A 3NV3A 2DCYA 3PMEA 4L97A 4H14A 2EXIA 5EYXA 1OH4A 5DUVA 2RVAA 5DMYA 4AFDA 3BODA 3O1RA 1XSRA 3KCXA 4YG6A 5D1IA 5A7SA 5FPXA 4BK4A 2DVBA 3VBSC 1W8FA 2ZGMA 1R092 2JDNA 1RXFA 3ZX7A 1I5PA 1SBFA 4QM9A 5FIXA 3VL8A 5I8TA 4HLTA 3QD6A 5FPBA 5FZ9A 2WNOA 2ZEXA 1QOOA 5C3QA 4FOWA 4XUTA 5C3SA 5JWPA 2Q4SA 3A0KA 3FJSA 5E1RA 4AE2A 1ZZ8A 4Q4W3 4KGGA 4ARYA 5IYYA 4OI0A 1WKYA 5EFUA 5IK5A 1DGLA 4JAAA 4OHXA 2QDNA 3I7DA 3HBKA 2YDEA 3P5BA 4IE6A 2JB4A 4EWAA 3DECA 4KWLA 1J83A 1AYN3 2YUEA 4CEWC 3FL7A 2RMU2 4CUAA 2YYOA 3WDWA 2FHRA 2W2IA 3DYMA 1UKRA 3BCWA 2B5HA 4SLIA 1DYPA 2CGNA 2DTWA 4XE9A 3KT1A 5IW0A 3VBFA 1PO11 3QLQA 2E9QA 1MS9A 1A3KA 2R32A 5E16A 4XTMA 4AEDB 2ZABA 4DRRA 4CU8A 4EJRA 3P3NA 3ZFEC 1ZBA1 4CCNA 4G4FA 2JX9A 4PT6A 4KBZA 4Z2WA 2XBO3 3AFGA 1UZZA 3OBTA 4Q4Y3 2E26A 3KV6A 3PHMA 3WG3A 1RVF2 4XOGA 1LCLA 1UOGA 4NAMA 4MO3M 2D5FA 3CNAA 3B94A 3RMYA 1RUH3 3D6EA 4Y5SA 4IESA 5FO8B 1PZ9A 2VULA 4QXHA 4TN7A 1VBD2 4IV1C 4HZFA 3OD4A 2O1QA 2JB8A 1HV0A 3H3LA 4R52A 1EUTA 2WFF3 3WG2A 3O1UA 2GC2A 2D7FA 5H9PA 3BTYA 4LO8A 5LBBA 2ZX4A 2B9VA 1RUE3 2D3SA 1Y7BA 2OPWA 3OB8A 1OSGA 3PVOA 5BYNA 3JCIA 1DGWX 1GWLA 2P3YA 3FBMA 5JOZA 4DY3A 3AMHA 1RL3A 4LBLA 4XBLA 2DU1A 2VL4A 1SFYA 4HKLA 3WINE 3JBG3 1AYM3 3ZSLA 1LOGA 1AR71 3I3EA 1IPKA 2JDKA 5C9AB 1WCDJ 4L9BA 4MHUA 4ZS2A 4YM2A 5JPMB 5BNNC 1GZTA 1JN2P 1BEV2 3ZSJA 3BKZA 2BNOA 1WZXA 1I3HA 2ARCA 2XUMA 3AKPA 2ZGQA 3I2GA 5CKQA 1IS5A 1HIXA 3NKTA 1PVC3 1RJ8A 2NLRA 4XEZA 4OHZA 3IDBB 1UKGA 4QXCA 3VBUB 4CVUA 5A6YA 4WM7B 5IK8A 1POV3 4OQ9A 4IEPA 1DGRN 1ZZ7A 1R1A3 3SKJE 2Q8OA 4FQZA 1O8PA 4XXAA 4AW7A 2V09A 4P9GA 5L9BA 4G3YC 4XFBA 3AP6A 4B8EA 1JYXA 1VBB2 1JHJA 5CB7A 4CCMA 3AP9A 3ILRA 4UFHA 1OQ1A 3ZYRA 5GLWA 3TN91 3UJQA 3OPZA 1CZTA 1ND3C 3GZEA 2ZMLA 3O1SA 2BBAA 2B8MA 3ZSEA 4W6WA 4X8PA 4BM8A 2RDQA 3EJKA 3VD7A 4QGMA 1EPWA 4WZFA 5F3GA 1SPPA 4QPGA 1GUIA 4GJYA 2EXHA 3E1F1 2W1QA 1XYNA 1OC1A 2A3YA 1S0GA 3AYEA 5B2GB 4UW3A 4B4PA 1AJOA 1JYCA 1JHNA 3TEXA 1W8NA 3OD0A 3LGRA 3A0NA 3IDAA 1LGBA 1PVXA 2RS13 4B7EA 1JZ7A 4BPZA 3KB5A 5DG2A 5A7QA 2CSGA 2WT0A 3H0OA 3FHAA 3KGLA 4I09A 3SC7X 2VCMA 3QH6A 3SCGA 4DOUA 1VJ2A 3WW1A 4HK8A 2CGOA 4GA9A 1X36A 1GKBA 3MV01 4IEVA 5LW9A 1V0AA 2R072 4JDOA 1RUF1 2JJ6A 2YY1A 3M3IA 3IBMA 4R9CA 2IXHA 3USSA 3VHNA 2EIBA 2JDHA 4QDQA 4XDOA 2P34A 1ENQA 5FZ8A 1RMU3 3NNLA 2WNVC 1FT9A 1XE7A 3V65A 5IFTA 2A1XA 2YHJA 4L92A 3DV8A 4OLLA 4FOQA 5JLVA 4DXSA 1HLCA 4BOWA 1T6GC 1RXGA 2V4VA 2VNGA 2O8QA 2NMNA 2XWJB 4XPVA 3WF3A 3WR0A 3ZXAC 5ISLA 3L2HA 3JD73 1ZRDA 2UY8A 1AYN1 2C26A 3RZMA 5CFDB 2DCJA 2HEWF 1HB2A 3C8XA 1QWRA 1ZRRA 2A70A 5KHGA 2Y38A 5LY1A 5KBFA 1YCIA 1JZ2A 2AACA 1GMMA 2R1BA 3B01A 4S2HA 4AGVA 2WSUA 4Q4V2 1HRI1 4H55A 2E33A 5IJRA 3WCRA 1GOHA 1U5YA 1KRIA 1YUDA 1H6YA 5KC6A 2LUWA 3PVBB 4CDQB 5LY2A 3EHKA 3WT3A 1K5MA 3WDUA 3OGVA 4AVSA 1B35A 1ZM1A 1LOFA 4JX0A 1K3IA 5A3OA 5T5LA 5JZGB 1AVBA 1PM4A 2WNUA 4LO7A 1FPN3 1COV1 1VPHA 1Z0HA 3ES1A 4P9IA 4ASLA 4CCJA 5F37A 5FK8A 2WC2A 3POBA 3QOPA 1H6XA 3ILNA 4QPIB 1WLTA 1BYHA 1CX1A 3GDBA 1XNTA 2XJQA 4XFAA 3D5OA 1UY1A 3ZOIA 5I8YA 5FZFA 1CAWB 5A7WB 5AC93 2BFUS 2WFF1 3LE0A 1YLLA 4B1LA 5F5AA 5GZEA 1ZZCA 3VBHA 1CPMA 1RUE1 3FHIB 4BQ5A 2JDUA 2AC1A 1QJU3 3WG4A 4BQ2A 1R082 5J7MA 4Q0SA 1HRV3 4EWEA 1KDKA 4Y20A 1LESA 3IB3A 2D40A 3SH5A 4OUMA 2F4LA 3JBG1 1H2MA 2WNUB 3WUCA 2JDYA 3LEKA 4O61A 2DVFA 1TZOA 4BQYA 1RUG2 1J3PA 2Q0AA 4Q8KA 5I93A 1VP6A 1AR61 3N9NA 2W3JA 3IMMA 4PLNA 5EJ3A 5FZMA 4LO6B 4CXXA 4UYBA 3DGTA 4DUWA 2HWD2 1CJPA 1XSQA 5FO7B 1S4CA 5FP9A 1GZ9A 1NXMA 4HANA 4M3CA 2RM21 1US3A 1X8EA 5F1RA 3ITQA 3VBHB 4AEJA 3T0AA 4QQPA 1BK1A 1N47A 4BH9A 4TWTA 2BBVA 2P17A 4FQ4A 3WP4A 4XYXA 4XUPA 2F17A 3OSDA 5IVJA 3W5NA 2GN7A 1JBCA 4CXWA 3W21A 4NIIA 1ZBA2 1CONA 1J3RA 4YZ5A 4Q4X3 2P6CA 4ZU5A 5J36A 3IKWA 2HWE3 3AXEA 1LODA 4LR4A 2NMOA 4BCUA 3HOBA 2D98A 1W0PA 1UY2A 4E2GA 1NCRA 3B93A 4I3PA 1R64A 2IXKA 3WLUA 1PZ8A 2W52A 3NO8A 2FDKA 5C3OA 3F95A 1W99A 3PJQA 1W3XA 2Y6FA 4LLFA 4RR3A 3WHTA 3KV5A 1OH3A 2W47A 3NWKA 3VD4A 1GQHA 4M3CB 3CZJA 1I6XA 1UOJA 1VRH2 5FZIA 3AXDA 4FPCA 5A3UA 2A6YA 1ZRIA 4E8CA 2K2SA 1L7LA 1FOD3 3TBDA 3KVAA 3WW2A 2GMEA 3VKLA 3M7AA 2Y33A 5FV3A 4GMP1 3H8OA 4W6YA 5A1AA 3J7HA 5JUVA 2PHLA 2VVDA 4FPHA 3VBSA 4GULA 3KV4A 1NZCA 1G9DA 4IV3A 1M4WA 2WJSA 2EXKA 3UESA 3L9JT 4J1XA 4QHBA 1NQJA 3U37A 1E5RA 5BNOA 5ACA2 1V6KA 5T5PA 1NCRB 1AR83 5FMDA 2TBVA 2EVXA 2JE7A 1V9U2 4K8RB 5FMOL 3VZMA 4BQ4A 1HJGA 4HL0A 2B39A 4RR3B 3MIFA 1V6IA 3K48A 1QMJA 4P5HA 5J09A 1PO22 2P3JA 5FFOC 3U75A 2VZPA 2QKDA 1UY4A 3PDQA 1LTEA 1YFYA 4HK9A 4AGGA 3BGAA 3VDCA 3IPVA 1H0BA 2JEMA 2WWJA 5C5UA 1J1LA 3POWA 2BTVC 1GNZA 3QBQA 1Z7S1 3GCXA 5FTTC 5JOWA 3JD71 4L99A 5DAQA 1OFNA 3VD5A 2HWB2 2MEV1 5LZ6A 2WR9A 4CEWA 4CRQA 1DYOA 3M1HA 4YW5A 3I3BA 4ZHNA 2V72A 2PLV1 4NHLA 1Y3TA 1QXJA 1GZWB 4IV3B 4JGZB 4AEDC 4D6SA 3SEEA 3WW3A 4XFFA 1OLME 1U5XA 5BNOB 3AVRA 1GWMA 2AREA 5D8AB 2B9UA 1W6MB 2ZBJA 1UWWA 3CMGA 3JXSA 2OQ6A 2OX0A 3NW4A 3LAGA 4TLGA 3UL2A 3BPZA 3E6CC 4B7KA 3PL0A 3ZFEA 1YNAA 5C3PA 5A33B 4A7KA 1D4M2 2QCSB 2OZJA 1QH6A 2VMIA 5FPZA 1FPN1 1LULA 3RYKA 3ZKYA 1DQ4A 3GYDA 4GMP0 3KVBA 2YC2A 1H4HA 1RITA 2NYYA 2WL1A 3BYWA 4EYUA 1RINA 2PN5A 5IAXA 1VAVA 3GJBA 3K3NA 2GN3A 2QQKA 4RSUA 4UOJA 4Y5Z0 4F8AA 2ES3A 3ZDVA 1DHKB 1E57A 4P9XA 4QQHA 3RZHA 1CZSA 1WGPA 1X9PA 4IEOA 3H8UA 1GNHA 4QX7A 4UFMA 4YGCA 3SH4A 5FLJA 4XJWA 1QJX3 4XBQA 1SQ4A 2JENA 3J26N 4JV4A 2JDMA 1G7YA 2PAEA 3MV11 1GQGA 4NIAA 2LTNA 1W6OA 1MS1A 3VZNA 3VZKA 1OPMA 4Q4W2 3H1YA 2BEOA 4CPBA 4NIGA 5A1LA 5C9AC 5FXWA 5IFPA 1LECA 1RUC1 1W3VA 1ASJ1 4Y4YA 2IWGB 4QXKA 1G86A 2ZHKA 2WS91 2Y8KA 4Q29A 3WP5A 1QDOA 3LPGA 5FP8A 2XJSA 4KBBA 2DCTA 1VBE3 4EWDA 1AYN2 1XJAA 1LHOA 2VW1A 5FPUA 2QQWA 4EE2A 5SV5A 1O91A 2PHTA 2HJIA 2BWCA 3VBUC 2BVBA 2HWF1 3O14A 4IQPA 4WM7C 5C7GA 5FP7A 3VKNA 2NM1A 2VO5A 4LTAA 2VW0A 5JXHA 3DPRB 3ZVXA 2VNVA 2L9LA 2WN3A 4JKLA 2J1UA 3LIHA 1IG3A 3WNKA 4NHMA 5GZDA 1AL0G 2X09A 4NR1A 3A23A 1PMHX 1S0JA 1DCSA 2LS6A 1VBA3 2ZGLA 2HWE1 2XBO2 2VQUA 3H50A 3C7OA 3FLTA 3I3QA 4P9LA 4Q4Y2 2R043 2A7AA 1MVEA 3SHRA 1UPSA 2VZSA 3I2DA 1B09A 4NIHA 5F7UA 5F9TA 4HKWA 4UF0B 5T5OA 1RUH2 2D97A 3MIHA 5HCAA 1UN1A 2UU8A 5LRRA 3RSJA 2YZ4A 5LK7B 4WVZA 4CCCA 5I91A 5JIAA 3IM0A 1OOPA 2WFF2 2RDRA 5BNPB 3NL1A 1H9WA 3Q8FA 1OQEA 4P02B 3URFA 1G9AA 1FOD1 3I4IA 5J98B 1A6CA 3NNGA 4GWJA 5DZGA 3D0JA 4EN7B 1LEMA 5LBFA 2D6NA 1AXYA 3G6JB 3SMHA 1MZFA 2HYKA 4YGDA 3KGZA 3SCHA 3T30A 1ZZBA 2D43A 3MIEA 1BBT1 2IXJA 1WW6A 2W08A 4MHRA 3KT7A 5ANNA 1S2KA 4Y22B 1WLDA 3JBG2 4K40A 4TYSA 1AYM2 1KGYA 2CDOA 2JIGA 5CZKA 2ZPXA 4AVAA 5CBLA 2HWC3 4LOTA 4A3ZA 3SLIA 4BIOA 4JGYB 2A6VA 3LA2A 2BPA2 5BV6A 3CDZB 5C70A 3ZSKA 1S0BA 5EQUA 2XXZA 1DQ0A 3O0WA 3ZYGA 1P8JA 1MZ6A 2YBSA 2YGLA 1JOJA 2C6SA 4LXLA 3VD3A 5CFDC 1PVC2 3LOIA 5F6KA 4EV0A 1FMD3 1OUXA 2AEZA 3QCWA 3WNMA 1RGSA 4IE5A 4MGTA 5FYMA 3E6BA 3ORJA 1HJFA 4XW3A 3O1PA 3M4FA 2ERFA 2DVDA 4A44A 1XNBA 2R7EB 1R1A2 3APBA 4LOSA 1ULEA 3HT1A 3I59B 4QXBA 4S2GA 2XG3A 1BMV1 3KWVA 4M0HA 4EZ4A 1NE4A 2JDPA 2XQRA 3HAGA 3KQ4B 5JSOA 2G19A 1W39A 2BGCA 4OFGA 1LENA 1W90A 4CDQC 4ASMB 1QGLA 2PHXA 5DAPA 2ZGKA 2RS31 4OUSA 1SLAA 4AVTA 4C8DA 4XF9A 5JZGC 1EPZA 2XDVA 1X33A 1JW6A 1UYZA 2J7MA 4LT5A 5TSWA 1CAUA 1PGW2 3IWZA 4QPIC 1PHMA 2XVGA 5FCCA 2FDGA 5FY8A 5A3WA 1H2KA 3LD8A 1TVGA 5CEHA 3UK9A 5J96B 3HNYM 2VCCA 3B7MA 4OQ8A 4K20A 1CAVB 4I3GA 2F4PA 3MICA 4MLOA 4QGLA 5FZDA 3J4UH 2RS12 3ELNA 4NIDA 1S1AA 1PO13 3BI3A 2X5IA 1DDLA 1GP6A 3MIGA 1QH7A 4QMAA 1UU6A 1H8TA 4HVRA 5FUPA 2VZRA 4CEYA 5GZCA 5A3TA 3C2UA 4XFCA 5A6QA 1NQDA 2WO1A 1DYKA 3I97A 2WNUC 3CQOA 4XIKA 3DKQA 2WZR1 1JUIA 1ZX5A 2ZEWA 3ZXJA 1U5ZA 2GH2A 3N7JA 2BUKA 1RMU2 1CAUB 2PHFA 3BVCA 4OZXA 4WZCA 4BK5A 3RZJA 3DL3A 4Q0QA 5ABJA 2VZOA 4N7UA 5FAXA 4UFJA 4YGBA 1GBGA 2XKOA 3JD72 3O0XA 4FPEA 1WMXA 4XMIA 4LBKA 3U14A 4PBPA 2GNMA 3VBHC 2HYXA 1BVVA 3NNFA 2YBKA 3AP5A 4WM8A 4UI9L 2X5IB 2YGMA 3IAQA 1E5SA 1NAEA 2VMFA 4N53B 5I0SA 4RS5B 1H8TB 4S2FA 4XACA 5DZEA 2XJVA 2BZDA 2W9XA 2EALA 4RFRB 5L73A 1XYOA 2OIIA 5IHRA 5F3IA 5F3CA 5E8AA 1CAXA 1FNYA 2B42B 2G1MA 5KXEA 3MF9A 2MPFA 4K9SA 1AR73 3HBZA 1X50A 2ZS6B 3LA7A 1FYUA 1NCQB 2XOMA 3C7EA 3RWKX 4E27A 5IVEA 4MG2A 5C8WA 5ABJB 1W6PA 3B02A 1FPN2 3I3DA 2WAOA 3IAPA 3FUQA 3NJVA 4GH4B 1CR7A 2ZKLA 1JOPA 3VZJA 3ZN6A 4GB31 2SBAA 4A6OA 4Y26A 2BVVA 2QQMA 1ODMA 2XJRA 3A4UA 2WZ8A 4WM8B 2D6OX 5KHHA 5AC92 1XNAA 4CPBD 4XJAA 4AAPA 2VMHA 2VZTA 3NVCA 4QX0A 1NKGA 5JXIA 4UT5A 1JUHA 2ORZA 5A6ZA 4H3WA 4YNIA 4KI5M 4N8MA 1QY4A 2NZ9A 2WIIB 1I5ZA 3OBRA 1QJU2 5K7PA 5K8SA 1W0NA 1HRV2 4YARA 1KS5A 4L8QA 4JTOA 4COYA 4AOCA 2D5HA 1NCRC 4PQQA 1TME1 4FOVA 3ES4A 3TN93 1BHGA 3I8TA 2W91A 3AZWA 4RR3C 3MIDA 1NT0A 2VZQA 3ZXFA 1NA1A 3ZN6B 1J1TA 1MS8A 1KJLA 1MS0A 3ZKUA 3THDA 2RS52 1AL21 4BLJA 4GIQA 1W9TA 4QU1A 2JECA 4C0BA 1O3QA 3OBAA 4F3JA 1NY71 1EAH1 4LLOA 3LFIA 4BWOA 1OBNA 5G05L 1ULGA 2ZGPA 3ZMNA 2FMDA 3WQBA 1S0DA 5LA9A 3POSA 2Z4FA 4LA2A 3THCA 3SCFA 4URAA 1PGL2 4WVMB 1FMD1 4A7YA 1GZCA 4ARXA 3P3PA 1OA2A 2QVSB 1RUOA 2VD7A 4IV3C 3U1XA 4JGZC 2QDRA 3FMGA 2ZACA 2CAVA 3W20A 3WDVA 4FPGA 4PLMA 5DAVA 5BNOC 4I0AA 4Y3OA 5D8AC 4K8FA 1HN1A 1RUF3 1GP5A 2W46A 4UBGA 4Q4X2 2C24A 2UYBA 4AEDA 2FDFA 2HWE2 5G04L 1NA1B 2I45A 3BUCA 2ZEYA 1JYTA 4Z2AA 4HSLA 1G8WA 3DXUA 4PLOA 3V0AB 3BU7A 4DEVA 3K4ZA 1D0GA 1ZBE3 2QBXA 3BB6A 3HNBM 2CY6A 3IN9A 5FZ4A 3ZR6A 4AI2A 2P6HA 2TNFA 2Q1FA 2LROA 4Q1RA 1US2A 1QIQA 1W8ZA 2GNTA 2XQXA 4PDWB 5KR7A 2JD4A 5F2WA 5GLZA 4JKMA 3SITA 5DABA 1CIYA 1FOD2 4CUCA 4QHZA 3J8F1 1GV9A 3HWJA 3VBRB 1WA6X 1N1YA 4CDXA 2VZUA 2BWAA 1TMF2 4RHV2 1HRI3 2Z2SB 4W50A 2W94A 2PQQA 4LKDA 3ST7A 3LB9A 2AR6A 4CP9B 2D93A 5IT6A 1Q43A 1ZVFA 3I2IA 3P1IA 2ZA9A 1U12A 2R1DA 1I1EA 2BGPA 3TYJA 1DP0A 1KXGA 1MQTA 1AR82 2WFPA 3HN3A 3BTXA 4XF1A 1WW4A 3EBRA 5C3RA 4IEXA 4LULA 4XF3A 5JMOA 4BXSV 3AYAA 1COV3 1DQ5A 3N9PA 4EN8B 5GJ6A 3JZVA 5C9AA 1FNZA 2VBPA 5HXMA 2R062 1SBDA 1HX6A 4R9AA 4IEQA 3OPTA 3D4KA 4U36A 4RYDA 1C8NA 1AR91 1ENRA 1W8OA 2BOJA 2V4AA 3POFA 4CDXB 1S55A 3GHNA 5FY4A 2A6ZA 4OI1A 2CTVA 4CUBA 1FV3A 3W5MA 3H1MA 3H3ZA 3VBUA 3DPRC 4WM7A 5F6LB 4D3WA 1DLLA 3JU9A 3KHBA 2WBKA 2WT2A 4CCOA 4QPYA 1G9CA 4AFBA 3O1VA 3I2OA 5IVYA 4BMEA 5AFEA 1MQTB 2VXRA 4QQLA 5EJZB 2VPVA 5DAWA 1JZ8A 1X9TA 3FE5A 4GJZA 4MXVA 3NJZA 3VDDB 2P37A 4ZKTB 3NKGA 1PK6B 4MGSA 4RGGA 3WCSA 4Z1VA 1CX4A 5FRAA 4AI3A 2ZKNA 2ZGRA 1AR63 2VCBA 4QDRA 4AFAA 2CDPA 3KSCA 4PBOA 5K0UB 2VCAA 3CZUA 4YZ3A 2ZMNA 3N3HA 3HN1A 4LBNA 1IZ3A 2YC4A 5CU1A 4HVQA 1UQXA 2W87A 2OUHA 2RM23 4AWDA 5BNPC 2Q30A 2GNBA 2VMGA 5FZLA 1TQ5A 1XBFA 2FZ2A 5HCFA 4WVWA 3PVEA 4Y1XA 1W2UA 1J58A 4A2UA 1QJX2 4CU9A 3PUAA 4JCKA 4ZU7A 5HV0A 1UPIA 1UYPA 2ZZJA 2J1TA 5GLVA 3ENRA 2Y64A 4ZU4A 5DUUA 2QQNA 4XJ9A 4FCAA 4FFIA 2ZHNA 4CCLA 3N9MA 5B4XA 4CYDA 4D6QA 3UYJA 1OVSA 2ZHLA 3Q8BA 4UFKA 2A3WA 3ZXGA 1MEC1 4JGYC 5F39A 1WBFA 2IVJA 1IS3A 2O14A 1QOSA 4Q1PA 2NPIA 4W4ZA 3VN4A 1K42A 2C9KA 1OOPC 5FZ7A 3WQ0A 2O8OA 1VBE2 4QDSA 2Z79A 2FD8A 4M4PA 4LHSA 1RHI1 4JZRA 4JDNA 4NN0A 1AX2A 3S0MA 1LAJA 3AL5A 1JS9A 3W9AA 1H4GA 2BW8A 2BNNA 2AGSA 1OPOA 1MS3A 4GMP3 3L2YA 5CFDA 1YXWA 4ATFA 5B4NA 3TEWA 1ODNA 2JE9A 5F5IA 2DUQA 1D4VB 3V0BB 1APNA 4IGPA 4ORFA 3VLBB 3TAYA 3W59A 3POIA 2JD9A 4K1YA 1D2QA 3MW2A 2VQAA 1LHUA 1W2AX 2KR2A 3NJXA 3A22A 3PIJA 4Q26A 1VBA2 3AK0A 3ZIXA 2RV9A 4CDQA 1YQCA 1QJZA 3A21A 2R042 3LZZA 2AH2A 5DG1A 5DQ0A 4GALA 4AQ2A 2QQIA 1ZBE1 2WAAA 3GM8A 5JZGA 3EXUA 2RE9A 1HKDA 3J9SA 5F32A 2IUWA 3E5UA 1O3TA 3VL9A 1OKQA 1Z7S3 2WNEA 4BZ4A 4K6BA 2ZHMA 5A3MA 4QPIA 3LA3A 2I2SA 4MGZE 4UXAA 1ND2B 4LIUA 3USUA 1CGPA 1C3HA 2MEV3 3C7GA 1CAWA 1RUJ1 4LE4A 1F31A 5A7WA 2YPJA 1EV13 2PLV3 3CJIA 3HNMA 3ZLIA 2Y60A 1VMHA 2YV8A 3FLPA 3OJBA 1YYNA 5AVAA 4CA9A 3CU7A 3ON7A 3V56A 4AZZA 4FT8A 1BKZA 2VOWA 3IZOA 4RFT0 5FZOB 4INDA 4DFSA 3UKVA 1UNBA 4UW5A 2HWC2 2RJKA 5FMCA 1IG0A 2A5ZA 4LE3A 2WLPA 3AMQA 4MZUA 2J1SA 2QFEA 1QOTA 2WZPP 4P9YA 5JIUA 2P1BA 1AJKA 4K7JA 5KXDA 5LWBA 4FVVA 3USUB 4AG4A 1UZ0A 2NQYA 4L2NA 1XNKA 1WLWA 1OLRA 2HBTA 3RJ2X 2X5IC 2QQVA 3CJIB 1XE8A 4N53C 4CDUB 4RS5C 1H8TC 1T6BX 3MLLA 2Y34A 4CEYC 2VVFA 2G9ZA 2JG8A 1KITA 2R6QA 1G9FA 3UKTA 1YJLA 4N43B 3BTZA 2GALA 1K45A 1V6LA 4NROA 3ZIWA 4HG6B 2XJUA 1LOAA 4CE8A 3H3UA 1NCQC 1DZTA 4L11A 3B3QE 5ABJC 1RUC3 1UY3A 1WW5A 1GR3A 1ASJ3 1W9SA 1V6MA 3AYCA 3DYOA 3FC0A 3D8CA 1HB4A 2WS93 3JB4C 4GH4C 4KU7A 1CD3G 1OMIA 3MUZ1 2XR4A 2UWCA 5FUIA 5JR7B 4YW2A 1HQLA 1VRBA 3DCQA 4ZY9A 1Q8QA 5CVRA 4OI4A 2NP0A 1F2NA 4WM8C 1V6OA 2OS2A 2HWF3 2DYCA 3FZ3A 1C1LA 1F8VA 2DFCA 4AF9A 2GMPA 1PMJX 2RG4A 2ENRA 1A78A 3WUDA 4IDZA 5KXCA 2WA3A 2JG8B 2J1RA 4PQ9A 1X7NA 4LHLA 4AYUA 1PO12 2Q8CA 4PCRA 4R4XA 1YWKA 1LR5A 2WQ4A 5KWRA 1RYYA 3ZN4A 5LRSA 4LEJA 5CNAA 4BB3A 3NRUA 2JKBA 1CZVA 3ZXEA 5CG8A 2DURA 4UW4A 3NNJA 3U10A 3MPBA 1N3OA 2IFWA 4QPWA 1GANA 3RVHA 3MIBA 1UL9A 1OLMA 2ARBA 1O4YA 1IPJA 3TEZA 5LBCA 3B9CA 3WEZA 4JQTA 4QX5A 1PZ7A 2JDAA 5JAXA 2IVIB 1ULPA 3LSEA 2E7QA 1RUD1 4GWNA 4BXFA 4O65A 5LA0A 2VTXJ 4C91A 1SACA 1Q8VA 4MH0E 5C8CB 4XQDA 1DQ6A 4PF5A 2ZX2A 4KG0A 3RYPA 3FFZA 1OI6A 5J1XA 4DXRA 1RUI1 4E9KA 3KCYA 2A71A 1BBT3 4YVSB 4MX3A 3VUOA 2C0ZA 2BJSA 4ATEA 1GZWA 4JGZA 2OYZA 3E6DA 4D7TA 1LKNA 4S2DA 5F5CA 1NA1C 1D0HA 2Y0OA 1YIPA 1AR72 2E53A 3FX3A 4KNCA 4UW6A 5D8AA 4AXOA 1IKPA 1UD1A 1W6MA 3AYDA 4YYOA 4E4HA 5KHKA 1DZRA 4M01A 2RMU3 1LRHA 3AB0A 1ULDA 1XB9A 3MF6A 4IEYA 5A33A 5DDJ1 2IC1A 3THTA 3ILFA 2N7GA 4HT1T 2VR4A 1QJY1 1MZ5A 2D6KA 2Z69A 2DFBA 4JDMA 2A75A 4KGQA 4KWJA 2IXIA 4QHOA 4XF0A 3VBRC 4XUNA 3KT4A 3OBZA 4NJ4A 4Y33A 3N4MA 1BJQA 4FI9A 3RZKA 4LBJA 1F4AA 5I8SA 3KV9A 1EV11 4XFGA 4E2SA 3K75B 2WDBA 4QGNA 1JZ6A 2WQ8A 1Q3EA 1WMDA 3S30A 5D2AA 2R49A 2Q1MA 2V73A 3RGBA 4DY5A 2RS33 1F4HA 3TN92 3TOJA 1IOAA 3OGSA 5FK7A 1GSLA 3HJRA 5A7OA 4XQWA 5C33A 1CESA 1SLIA 2CL2A 3Q8EA 1GWKA 3AM2A 4JTNA 1U5IA 2PHDA 3LEIA 5I0UA 2ZTNA 2X29A 4NOTA 2WYSA 5FZHA 4FAGA 5BY5A 3R6SA 3RJRA 1UXZA 1Y4WA 2JE8A 4CDXC 2OPKA 4PI2A 2ZZQA 3HVDA 5FY1A 2GC3A 2OT7A 3KM5A 4TXWA 1H2LA 3B9IA 4V2VA 4YSFA 3MHZA 3PMSA 4IGOA 1O59A 2VNOA 4AI8A 2YC0A 1ZRFA 3WF0A 1MQTC 3GALA 2OXBA 1GOGA 4QKNA 3DPRA 3PUHA 4CXYA 1RUF2 2ZAAA 2A73B 4LITA 1LU2A 2A3XA 1W9WA 4N9IA 4Q0VA 5A7NA 3VDDC 3WQ1A 1L3JA 2UYAA 2WZR3 5ERLA 3WD5A 1PK6C 1GLHA 2AEYA 3MO4A 3UV9A 4AAXA 4NRMA 2G9FA 4LKFA 1Q8SA 1ZBE2 1SBEA 4NRPA 4DXZA 5K0UC 3LCPA 2WKKA 3OUJA 2OUJA 4B29A 1W06A 1UIJA 1DBNA 2Y0IA 4IGQA 4JKKA 1VE0A 1URXA 1W9YA 2VC9A 4QKBA 2VJXA 4UF0A 3GZUC 3MW3A 2HKXA 5E88A 1LB2A 3GHMA 4D69A 1HV1A 4TLFA 3T2PA 5BNPA 5LCWL 1PIV1 3OYWB 2LW8A 1IS4A 2ZX3A 2WWUA 1VB4A 1HRI2 5FYHA 1D2SA 4BHPA 1HXS1 2TUNA 4CDWB 4CP2A 4ES9A 4XVHA 4AFCA 5LATA 4XXPA 4EQVA 3LOBA 1IQAA 1HB1A 3H7JA 5BNQA 4ISQA 5JXJA 3Q8CA 1ENXA 2WABA 4XABA 4IL7A 4YPJA 5FJKA 2J22A 4Q5OA 1M06G 1C1FA 1QEXA 1BZWA 3ACGA 4Y22A 4BIFA 4ISRA 1NLQA 3ZFGA 4RN5A 1LGNA 1YQ2A 1COV2 2PHWA 5KHJA 4IV1B 1ULFA 3IIIA 1RJ7A 3PTRB 1ULOA 4GB33 1Q5OA 4LBOA 5FPAA 5SV8A 3WNNA 1OD5A 4JGYA 2GH8A 3WX5A 3I49A 2BP6A 2EICA 2ZOEB 2PMWB 2XPJA 3OY8B 1R091 5CFCB 4XAEA 3RDIA 4YW1A 5FZ1A 2R073 5L7OB 1MS4A 1RUE2 1S0FA 3GBWA 4MXWA 1BCXA 4WVVA 2VOKA 1LHVA 5EPAA 2VUAA 1T2XA 3H42B 5JDBA 4FOYA 5L36A 1LOCA 3I59A 4Y1YA 5JSRA 1EP0A 1RUNA 4NWWA 2DBNA 4UBHA 1TME3 4R9BA 3WF1A 1U0AA 4XFHA 3ZFGB 2Q5TA 1ZZ6A 3WP3A 2MHFA 1TE1B 3T4VA 4LKSA 1ONAA 1REFA 4CCEA 4FXKB 3KCCA 1AL23 3ZXDA 1AR62 2RMU1 2FDJA 1EAH3 1JODA 3NAPA 4LUKA 2RJ2A 4OHWA 1VIWB 1S2EA 4Z82A 3VBOA 1OA3A 1LJ7A 3N9OA 4Y1VA 1ND2C 2OKXA 2RM22 2CYFA 1HQWA 1LHWA 4AEMA 5J3UA 2FBEA 2WN2A 2HLEA 4LIVA 4MXWB 3KHCA 1H2NA 3U4SA 1CAVA 5A70A 4E4DX 4O7XA 1OURA 1NXD1 2R0HA 4P9JA 3WZ1A 5LA2A 3VZLA 3HPNA 1Y9GA 3MYXA 3UETA 1NUKA 2XLGA 3DN7A 1RVF1 3BPSA 5FZBA 3N9QA 1YC61 4R8HA 3TNQA 4XDPA 3ME2A 1PNFA 2J1EA 2LRPA 1SCSA 4MOAA 4XC9A 4XJUA 4C90A 3I2HA 5FMBA 3NJYA 1IHMA 1VBD1 3NAPB 3KLSA 2H0BA 3AKRA 3AP7A 3POYA 3N7KA 3I2JA 3LWCA 4HFSA 1FAYA 4HPKB 4OCTA 4BISA 3PUIA 4YWAA 3VBOB 3ZYJB 4DIQA 5EWSA 5FXXA 1PX4A 1ZNPA 1YFXA 3CJIC 3J8F3 1PMIA 2JXAA 4EROA 1YQ5A 4I02A 4CDUC 2P5BA 2K9ZA 4AQSA 2R0FA 3RFRA 4HN0A 1SLLA 1Q8PA 5DZFA 5H9SA 5H9QA 3AFKA 3RWNA 1Q56A 4N53A 2JG9B 4X8NA 4N43C 4RS5A 4ZZ8A 2A6XA 2DBIA 2G9GA 3POJA 1DZQA 3OUHA 4NE9A 1QQP3 2CNAA 1EUUA 2VTFA 5CADA 1WMEA 1V6NA 2VUJA 1WD3A 4V2WA 3TNPB 3SH3A 1BEV1 3J7MA 4YVWB 3WNPA 3DF0A 3RG0A 2RHPA 4XHXA 3BIWE 4COWA 4XUQA 5BPXA 3OCPA 1DGWA 4HMZA 1NCQA 5L9VA 2QQJA 2WA4A 1XC6A 5ANQA 4GH4A 3QH7A 2BFUL 3BN6A 1Z7S2 3HIFA 3AZVA 4IE0A 1AR93 1F9KA 5FR3A 3BALA 1O3RA 2ID4A 1DFQA 4LK6A 2MEV2 5FYYA 3PJYA 5A1FA 2JG8C 1LEDA 2XKPA 3I54A 2A6WA 1VBB1 2PLV2 1JYWA 1UXXX 3AZXA 1QXRA 3O0VA 5FY5A 2O0OA 4FAHA 4IEWA 5A32A 4QX3A 3UGGA 1UMZA 4HBNA 2OQ7A 3ACLA 2Z42A 4KWKA 2QQUA 3ZYPA 4JVAA 1SFPA 1UAIA 3SEPA 3ZYBA 1UZWA 2Y6JA 4PF1A 1ACCA 4NUBA 3LDBA 3T2OA 3S57A 5BUVA 4CUGA 1AF9A 4LMFA 4DXTA 3U11A 4DMIA 4ZPIA 2Y26A 3T2QA 2VOXA 5FUNA 4QKFA 1KFXL 5IAVA 5IVVA 5FOJB 2DU0A 1C5IA 2X53S 5FKCA 5GLTA 4ZZ5A 3M3QA 3ZXKA 1YQ8A 2C4XA 1RC6A 4E8DA 1VAKA 1DF0A 2WWSA 4NMIA 5FY9A 4AEKA 1MS5A 1AX0A 4YRDA 4PJYA 2R071 5ACA3 4WVMA 5A32B 2PXJA 3Q8AA 4YVSC 4AFMA 1X8MA 3D0SA 3WW4A 2DVAA 4B4QA 1W6NB 5APAA 3KD4A 2Q1ZB 2X05A 1BQPA 4ZS3A 2J42A 4BU2A 3DXTA 2VBDA 5HV4A 2ARAA 4LJHA 5T55A 4EN9B 2XONA 1LOEA 1MEC3 1RUC2 2PYTA 2EIEA 3PTYA 1ASJ2 1HDKA 4IEUA 4QKDA 4RQPB 4TSVA 2WS92 3V0AA 3AKQA 4OHYA 4XCAA 2X8KA 4FTEA 4KH9A 2WLQA 2HWB3 4AVCA 5K4LA 4JQRA 4RGKA 2WRAA 4A3XA 4BQ1A 3B5LB 1RHI3 4QD2A 5FWJA 3ZFFB 5F8PA 2RR13 4PDWA 2HWF2 5FZ3A 4H2AA 1JZ5A 3WDTA 4Q4V1 1SFNA 4NHYA 1SLCA 2VY0A 3BOWA 2E63A 4D94A 4LHNA 4R9DA 4NPMA 3IIAA 3VBRA 4FPYA 1H1AA 2VNRA 3VHRA 4OYUA 5FMOS 2E7TA 2XMLA 4CP9A 1FATA 1TG7A 2D44A 4AVBA 4ET7A 1O4ZA 1JXNA 2UWAA 3LEMA 3VZOA 2W0XA 3VB9A 3GZTB 4FO9A 3JUUA 4KG8A 3N36A 4QU2A 2CAUA 5KXBA 2AUYA 3UKNA 4QB2A 3WNLA 2Q8DA 1UMHA 3FN9A 5GKAC 4LA3A 3T4HB 1SMVA 2EIDA 4MV2A 4FTSA 1X82A 1IPSA 1RUJ3 3ABZA 1D7PM 1R081 3CO2A 3WQ7A 1GOFA 3NV2A 1VBC3 4FPLA 4NVPA 4Q2FA 4TTGA 3NV1A 3N9LA 5LBEA 1V6JA 4P14A 4QX1A 4MUVA 5FZCA 1BBT2 3GF6A 3AZYA 1UF2C 1WA4A 4WV8A 2XJTA 5DAXA 2E31A 3PU8A 3PUQA 3VDAA 1QQP1 3KQRA 3M2MA 2FDHA 1RUG1 2ORXA 2ATFA 4XZPA 4I0BA 3CF6E 2D3PA 2HWD1 5M0TA 1H8VA 5FYSA 3K2OA 2XVLA 1XNCA 4NRQA 3ROUA 5LASA 3RI8A 3VDDA 4TZDA 1ULCA 1PK6A 2K0GA 4MSVA 2FQPA 5JXGA 1N3PA 3HD8B 1N3QA 2UWBA 5K0UA 1SEFA 4ES8A 5FYUA 2XWBB 3BIEA 3MI8A 5FY0A 3CJXA 4NPRA 4COVA 2B7YA 4QX8A 1STMA 1WCQA 2DV9A 3K51A 4DQAA 5A3LA 3OPWA 5IVFA 3S6PA 4D0QA 4Y24A 1VR3A 3WOGA 3ETPA 4BQXA 1OVPA 5JSPA 3N7LA 1C4RA 2JICA 4CDWC 5L19A 1BMV2 3PU3A 5IVBA 2CGPA 5A3NA 3WF2A 2ZX0A 1NZIA 4JC1A 5T54A 1DIWA 1AHSA 5LB6A 3FUOA 4FFHA 5EHDA 5FYZA 1NLRA 4CU7A 1C8M3 4OHVA 2RS32 1ZZ9A 1UOFA 5T52A 4F83A 3NMBA 5EIYB 2R30A 1PGSA 1VRH1 4XTPA 1QDCA 2YMZA 4LKEA 4GKYA 2QZ2A 5CIRA 3POGA 4DZGA 1N1TA 1WLCA 4FTBA 3VBFB 1DLCA 1XRUA 1WCSA 5CFCC 3RMXA 4YW7A 3RRDA 3WSOA 1JZ3A 5IK7A 2YU1A 4YZ4A 4AL9A 2CV6A 3E5XA 3RS6A 1SLBA 5JMCA 2H6BA 5FLHA 5L9RA 5J37A 4LPLA 5L7OC 1CIWA 4KU8A 4UAPA 4D6RA 2RDSA 4GWMA 2UY9A 1O4TA 4YW6A 2DDUA 5ACA1 2ZEZA 4OMDA 1TNRA 2YFZA 3SQOA 4Y4RA 4YM0A 1V9U1 1YJKA 3OG2A 2DCKA 4PIXA 4QQ2A 3V0BA 1VAMA 2MNGA 1WBLA 1YFUA 1PO21 3ACHA 4HN1A 3ZFGC 4I2OA 1PX3A 2WZR2 4Q0UA 3UT0A 4LHKA 4JHZA 4P08A 4ASKA 5F2SA 4YZ2A 2IXLA 1S0IA 4X6RB 5CKNA 3PURA 3HEIA 3E97A 3ETQA 3X29B 2BYVE 2ARXA 2F6BA 3ZXLA 1SCRA 4W8JA 1AXZA 2HWB1 2Y6HA 1FI2A 1RUD3 3C7HA 1REEA 2VZ3A 5F3EA 1GQPA 4QWNA 4I01A 3TRSB 2QZ3A 1UU5A 2VW2A 2VECA 2W92A 3PLQA 4AHYA 4AHZA 2ZGSA 2RR11 4AI9A 3M3EA 1ND2A 2VTXA 2D6MA 2EAKA 1XPWA 5GM0A 3RNSA 3H8XA 2IXCA 1RUI3 1WUVA 4Z92B 1W8WA 2ADEA 4URTA 3FWEA 3KMHA 3WY6A 3C7FA 4IW3A 1L7RA 4YM3A 3LPFA 3VHOA 2ADDA 5EYYA 5FBJA 5AFBA 3THPA 1D4M1 4DS0A 1NX9A 3LIGA 3N35A 3U4XA 4MGKE 5FZOA 3TWIA 4BA6A 3DYPA 2RJLA 2ZGNA 3LEGA 3NAPC 4LUMA 4N9HA 4G9SB 4NAOA 4BQWA 4K21A 3VV1A 3VBOC 2PAMA 5C4WA 4GB32 3RPQA 5DDJ3 4D8MA 5HI0A 4XZUG 3WV6A 5FZKA 3ZYHA 1UYXA 5EJ1B 4E4SA 1LHNA 3S7EA 1QJY3 1QXPA 2GP5A 5DUWA 3JB8A 5FXZA 3WF4A 4O9EA 1CWPA 1O6UA 1VLNA 5E89A 3VD9A 4NHKA 1UIKA 2D3RA 2PFWA 4FPKA 1E5HA 3O12A 4QQOA 4Q0PA 5FYTA 3UGFA 4CP0A 5JOYA 2JG9C 2VVEA 3KS7A 1CVNA 4Q4W1 4CDUA 1VBC1 1FV2A 2VE1A 2DTYA 2KM2A 3R4SA 3RZLA 3ZO0B 4GQ7A 1BLZA 2H6CA 3JQXA 1SPPB 4HVOA 4QPGB 3WNXA 1TME2 3MDPA 5JVVA 4N43A 4Q8LA 4AR2A 1HN0A 4AQ6A 4YVWC 5FP4A 4OVEA 3ASIA 4HKOA 3EMRA 1GICA 4H7LA 4LK7A 3CHXA 4LO5B 5C4WB 1AL22 3GBFA 5FJHA 4YZ1A 1MR5A 1F15A 3ZDSA 3R4UA 3WVJA 4QB6A 4A4AA 1NY72 1EAH2 4DPNA 5FZ0A 1S2BA 2VGDA 3H1WA 5FZGA 3OEAA 3IT8A 3AVSA 2BQPA 5HBAA 3SNMA 3U78A 2BGOA 1W05A 4AGRA 2EA7A 4Y1ZA 4Z07A 4CCKA 2VBBA 3GGLA 1FMD2 1YFWA 5LEKA 1ZREA 1BVP1 1W2NA 1FXZA 4YG3A 1YQ6A 1F35A 4YGEA 4KWUA 1JI6A 3IDEA 2OZ6A 2QQLA 5EV7A 4BE3A 1KS4A 1OFSA 1W9FA 5DXDA 4YFZA 3G7DA 4A42A 2XBO1 4P9WA 4Q4Y1 2DWRA 2VZ1A 2DUPA 3AKTA 1DQ2A 1JU4A 2QE3A 1XU2A 5LA1A 2QQPA 2XUEA 1N1SA 1C8M1 4MGQA 1RUH1 1V70A 4QM8A 3OTFA 4PI0A 3C3VA 2BNMA 2QTWB 1AX1A 3LDRA 1QNYA 3I3MA 3OUIA 2J1VA 4E4ZA 4P5YA 2P4EA 4NWVA 3SXWA 5E6HA 4AQTA 1Z78A 2ZXQA 2XGXA 3T1MA 4I0WB 2E32A 1AZDA 3CL1A 4LQRA 3J8F2 5JPNB 2GSYA 3TEYA 4AK3A 5T3NA 1WMFA 1PIV3 2XHNA 5C8CA 1K5MB 2I07B 4BJ0A 1B35B 2WT1A 4ONUA 3O5SA 1HXS3 1OQDA 4META 1AYM1 4MGIE 3WHUA 3LKJA 4LBQA 1LGCA 1QQP2 4AHWA 2RS53 5BXXA 3AC0A 4A41A 4YVSA 5CAZA 4FP2A 5AVPA 1NE6A 5CISA 4RQPC 1NYWA 1BK0A 1XNDA 2VQ0A 3OGGA 4A6SA 1Q8OA 2KD7A 5FZEA 2JDZA 2W95A 2VUCA 4BQ3A 4IE7A 1PVC1 3CEWA 4COUA 1K12A 2BU9A 1UO9A 2BRTA 4XCBA 1Y43B 2AYHA 3EQEA 1R093 5GZFA 3ZFFC 1POV1 1OF4A 1AR92 3ALQA 4Z8BA 2ETEA 2VG9A 1R1A1 4EN0A 4Y20B 2D6PA 3M3OA 1O5LA 5IVCA 2XJPA 4R4ZA 5EZWA 5H9RA 4BMBA 5FO9B 4FSJA 4MGYE 4LBQB 2VXJA 4K3UA 5FP3A 3P6BA 1IGOA 3ZR5A 4CCDA 2PA7A 5IK4A 5FOBB 1QU0A 2HEYF 4OULA 1ZRCA 3AMMA 1GNYA 1O7FA 1ST8A 3K4DA 3QACA 2CWMA 5DUXA 3MW4A 3HR9A 1PGW1 2ZAHA 1H1IA 1POQA 4XIOA 4BYYA 1W28A 1YO8A 2R16A 1MVQA 2DF7A 2ZMKA 2CHHA 4PHZA 5DPNA 2K46A 1QF3A 2EIGA 3NQHA 3ECQA 5CG9A 2FCUA 2XB6C 4PDWC 3AZZA 5FLIA 2XLFA 3K3OA 3OF1A 1W8UA 3S7IA 2CU5A 2RDNA 2VQTA 2RS11 2ZGTA 4COZA 4J25A 2BV4A 1TMF3 1HW5A 5I0DA 2WYFA 4RHV3 4AVVA 5KHIA 3MZHA 3U0ZA 1TEIA 3NSTA 5A80A 3AMNA 4FPOB 5FYVA 3S5QA 4HETA 4N7IA 1Y9QA 2GP3A 4EN6B 5FDBA 5FY7A 5JCTA 4AI1A 3UGHA 3I2FA 4M0NA 2KXLA 1W0OA 2GNDA 3AKSA 4M4RA 1RVF3 5FPLA 1RMU1 1SDDB 1I9RA 2JIJA 2WINB 3FFQA 3KF5A 4M3CE 4XHBA 5FREA 5FYCA 1POV0 3B69A 2R063 4XILA 4AI0A 3VKMA 1PNGA 2VUDA 4IE4A 5EXOA 2LALA 3SISA 1MEC2 3D82A 2W1WA 1NOVA 1MZEA 1VBD3 2JKXA 4XETA 3RQ0A 1UYYA 1OD3A 4Y1UA 1ZA4A 1GFF2 3MEPA 4YW4A 2ET1A 4UWDA 3WG1A 2PELA 5JI7A 5K9YA 3VBSB 1RHI2 2ET7A 5GLUA 2Y6LA 2RR12 1WCUA 3AL6A 1JTZX 3U07A 4LORA 4XFIA 3EYPA 3MUY1 3EO6A 3VDBA 2YROA 5JOXA 1QNWA 4PIYA 2VMCA 1A8MA 4CZSA 2WO3A 4OZOA 1OHFA 2FCVA 5A3PA 3OYWA 1UW8A 1HQNA 4JRLA 3N7MA 2ZCWA 4XF4A 3RZGA 2EF6A 3K46A 3PUSA 3IPVB 3WXPA 2IZWA 3OGRA 4CDWA 2V5DA 1BEV3 4FBFA 2ZJCA 4B1MA 5HCHA 2B4KA 2GDFA 2WZEA 3J7NA 3LSDA 3MPPG 4V1PA 5FZAA 3SKVA 1JZ4A 2Z5WA 1OXCA 5CKMA 1O8SA 4YFWA 1AUYA 1SHWB 4CEWB 4JRAA 2XLAA 3VBFC 5T5JA 5AC91 4IV1A 3ZYIB 3AJZA 3AP4A 4HONA 2XL7A 2DCZA 4GD4A 3VHPA 1RB8G 1WW7A 2BERA 1NG0A 3O7OA 2UURA 2XVKA 3OY8A 3H8RA 1QJU1 1RUJ2 2ZX1A 5CFCA 3DKWA 2GU9A 3DEMA 1WWYA 3HQXA 1VBB3 1HRV1 3MGUA 4DRVA 2E7AA 5HPOA 1W6QA 1VBC2 5FWEA 2B45X 1UZYA 1UY0A 4YG0A 3ZFEB 4BLIA 5KC5A 5L7OA 3ACIA 3T3YA 2EXJA 2GMMA 3WP6A 4DO0A 1VALA 1YIFA 4J6GA 1KQRA 3POEA 2YPDA 5C6CA 3DUIA 3GJAA 4FFGA 4RD7A 4HXCA 2RS51 1OF3A 1UU4A 1XQNA 5EP9A 5LK5A 3R05A 3ZYFA 5BNNA 1W2TA 4ITCA 2GC1A 2KA3A 1J59A 3W58A 3HMYA 4HSJA 1RTVA 1IKQA 2E6VA 2ZGOA 3Q9OA 4A45A 3J7LA 1XE0A 2W5FA 4ZXEA 2PHRA 2OA2A 4MVTA 1PGL1 1OLQA 3FHQA 4FFFA 4OMCA 3WDYA 1W6OB 1IQDC 3R4DB 4FP3A 1DGRA 2GC0A 1KDMA 3CBNA 4W6XA 1UX7A 3T0BA 1W6QB 3MLJA 3O1TA 3MBWA 3A7QA
chains in the Genus database with same CATH topology
3VKFC 4E2QA 3UJOA 4Q4X1 3VKOA 3IDCB 4D7SA 5HCBA 1H9PA 1PM7A 1OA4A 1V00A 1YHFA 2V5YA 2YXSA 1G6NA 1XU1A 3RYRA 4LNVA 1LU1A 4W65A 3AX4A 1C8M2 1ND3A 2DVGA 1CJDA 4J1WA 5BNNB 1JYIA 1GYKA 4A7ZA 1KJRA 4QT6A 1REDA 4M3CF 2G4IA 4C0HA 4YM1A 1WD4A 4O9GA 1F5FA 1QKQA 4C1WA 3ZMOA 4IXLA 4X6QB 4HPKA 4NO4A 2QNKA 4LBQD 4XJZA 1CQ9A 5CA6A 1MACA 2GAUA 1YRZA 1ZYBA 5HXVA 3INAA 1TNFA 2QUOA 1TMF1 1EYBA 4RHV1 4Q4V3 1VB2A 2TEPA 1JH5A 3BTAA 1F5JA 3GZAA 4MYEA 4YW3A 2VH9A 1SLTA 5T50A 3ZN5A 2PHUA 4IEZA 1AR81 3M8LA 2IFRA 4KL1A 4QPGC 5LRRA 1IS6A 1ND3B 2JG9A 2C5DA 1UX6A 2CWSA 2E51A 2PTMA 2HEVF 2WNVA 2GZWA 2R061 1OOPB 5C4WC 4YVWA 3IMNA 5J48A 2OVUA 3MFAA 3NV4A 1RUD2 4XMAA 4LBMA 2W39A 1DG6A 3R0RA 2SLIA 4F7ZA 3GBGA 1R083 2B46X 2H0VA 2P3KA 1CPNA 2W68A 1RUI2 4XJ8A 4FPJA 1ALYA 5F5QA 2AZ5A 4SBVA 4U2AA 1LOBA 5IUQA 2WQZC 3M3CA 2EAAA 2WSVA 1RUG3 2WNVB 3KZ4C 3OGJA 3H7YA 2I74A 3MFCA 1DQ1A 4B4RA 4CTEA 5FBZA 2HWD3 4I30A 4N90A 2FMYA 4WBBA 1AXKA 2NN8A 4XBNA 3T2TA 1XYPA 3RZZA 3ZSMA 5DDJ2 4AHXA 1YI7A 2C9AA 2OW4A 1DU3D 4KQ7A 4XDQA 1QJY2 2VOVA 2P3IA 2ILMA 1BXHA 1QJX1 1KFUL 2C1FA 3PVNA 3V64A 1ENSA 4DINB 2DUOA 3JQWA 1K5MC 1ZBA3 1B35C 5I0TA 1LOFC 1SDWA 1EV12 4RL7A 5I0RA 1C57A 3GNEA 3MLKA 4PIZA 3H9AA 5GALA 1W6NA 3E5QA 4B3NA 1XXNA 4IETA 3RI9A 1NLSA 1O5UA 5FQ0A 3M70A 1VRH3 4K1ZA 1VBE1 3AMPA 1UCXA 4DNYA 1KD7A 4RQPA 3T1LA 1CN1A 4LO4B 1H1MA 1O3SA 1S0EA 2AENA 3FLRA 5JI9A 3VGIA 4CEYB 1EY2A 1RIRA 3ATGA 5C8CC 3WDXA 1A8DA 3ZFFA 1FX5A 2XH6A 1J3QA 2P2KA 2VU9A 2FZ1A 2XHKA 4D7YA 3HT2A 1V9U3 1VBA1 3FBYA 4M00A 4DB5A 1PO23 2R041 3AJYA 5FQ0B 3BOPA 4GKXA 4RGAA 3TB0A 4RA0A 3ZPYA 4H7MA 3CLPA 4C1XA 4CP1A 5LEJA 4XQ4A 1H30A 1YI9A 1C5HA 1WCKA 4YLZA 4OI2A 4Q27A 1G9BA 4FXGB 2ZGUA 3PNAA 2LM3A 1CAXB 4GXLA 4IERA 1PIV2 3B00A 1C28A 1R1ZA 1HXS2 1W6PB 4FPFA 1S0CA 1QHDA 4ZXKA 5GZGA 2D6LX 2HWC1 2QJVA 1N1VA 2PAKA 1D4M3 2XL9A 3NV3A 2DCYA 3PMEA 4L97A 4H14A 2EXIA 5EYXA 5DUVA 4AFDA 3BODA 3KCXA 4YG6A 5D1IA 5FPXA 2DVBA 3VBSC 2ZGMA 1R092 3ZX7A 1SBFA 4QM9A 3VL8A 5I8TA 4HLTA 3QD6A 1QOOA 4FOWA 5JWPA 2Q4SA 3A0KA 3FJSA 5E1RA 4AE2A 1ZZ8A 4Q4W3 4KGGA 4OI0A 5EFUA 5IK5A 1DGLA 4JAAA 4OHXA 2QDNA 3I7DA 2YDEA 4EWAA 4KWLA 1AYN3 2YUEA 4CEWC 2RMU2 2YYOA 3WDWA 2FHRA 1UKRA 3BCWA 2B5HA 4SLIA 1DYPA 2CGNA 2DTWA 4XE9A 3KT1A 3VBFA 1PO11 3QLQA 2E9QA 1MS9A 1A3KA 2R32A 5E16A 4XTMA 4AEDB 2ZABA 4DRRA 4EJRA 3P3NA 3ZFEC 1ZBA1 4G4FA 2JX9A 4Z2WA 2XBO3 3AFGA 1UZZA 3OBTA 4Q4Y3 3PHMA 3WG3A 1RVF2 4XOGA 1LCLA 2D5FA 3CNAA 3B94A 3RMYA 1RUH3 3D6EA 4IESA 5FO8B 1PZ9A 2VULA 1VBD2 4IV1C 4HZFA 3OD4A 2O1QA 4R52A 1HV0A 3WG2A 2WFF3 2GC2A 2D7FA 5H9PA 4LO8A 2ZX4A 1RUE3 2D3SA 1Y7BA 1OSGA 3PVOA 5BYNA 3JCIA 1DGWX 3FBMA 5JOZA 4DY3A 3AMHA 1RL3A 4LBLA 4XBLA 2DU1A 1SFYA 4HKLA 3WINE 3JBG3 1AYM3 3ZSLA 1LOGA 1AR71 1IPKA 5C9AB 1WCDJ 4L9BA 4YM2A 5JPMB 5BNNC 1JN2P 1BEV2 3ZSJA 2BNOA 1I3HA 2XUMA 3AKPA 2ZGQA 1IS5A 1HIXA 3NKTA 1PVC3 1RJ8A 2NLRA 4XEZA 4OHZA 3IDBB 1UKGA 3VBUB 4WM7B 5IK8A 1POV3 4IEPA 1DGRN 1ZZ7A 1R1A3 2Q8OA 4FQZA 4XXAA 4AW7A 2V09A 4P9GA 4G3YC 4XFBA 3AP6A 4B8EA 1VBB2 5CB7A 3AP9A 3ILRA 1OQ1A 3ZYRA 5GLWA 3TN91 3UJQA 3OPZA 1ND3C 2ZMLA 2B8MA 3ZSEA 4W6WA 4X8PA 4BM8A 3EJKA 4QGMA 1EPWA 4WZFA 4QPGA 2EXHA 1XYNA 2A3YA 3AYEA 1S0GA 5B2GB 4UW3A 4B4PA 1AJOA 1JYCA 1JHNA 3OD0A 3LGRA 3A0NA 1LGBA 1PVXA 2RS13 4B7EA 4BPZA 3KB5A 5DG2A 2WT0A 4I09A 3H0OA 3KGLA 3SCGA 4DOUA 3QH6A 1VJ2A 3WW1A 4HK8A 2CGOA 4GA9A 1X36A 1GKBA 4IEVA 2R072 4JDOA 1RUF1 2JJ6A 2YY1A 3M3IA 3IBMA 4R9CA 2IXHA 3USSA 3VHNA 2P34A 1ENQA 1RMU3 2WNVC 1FT9A 1XE7A 3V65A 4OLLA 2YHJA 4L92A 3DV8A 4FOQA 5JLVA 1HLCA 4BOWA 1T6GC 2XWJB 2VNGA 4XPVA 2O8QA 2NMNA 3WR0A 3ZXAC 3L2HA 3JD73 1ZRDA 2UY8A 1AYN1 5CFDB 2DCJA 2HEWF 1QWRA 1ZRRA 2A70A 5KHGA 2Y38A 5KBFA 1YCIA 2R1BA 3B01A 4S2HA 4AGVA 2WSUA 4Q4V2 1HRI1 4H55A 3WCRA 1U5YA 1KRIA 1YUDA 5KC6A 2LUWA 3PVBB 4CDQB 3EHKA 3WT3A 1K5MA 3WDUA 4AVSA 1B35A 1ZM1A 1LOFA 5T5LA 5JZGB 1AVBA 2WNUA 4ASLA 4LO7A 1FPN3 1COV1 4P9IA 1Z0HA 3ES1A 2WC2A 3QOPA 3ILNA 4QPIB 1WLTA 1BYHA 4XFAA 2XJQA 3D5OA 5I8YA 1CAWB 5AC93 2BFUS 2WFF1 1YLLA 5GZEA 1ZZCA 3VBHA 1CPMA 1RUE1 3FHIB 1QJU3 3WG4A 1R082 5J7MA 4Q0SA 1HRV3 4EWEA 1KDKA 4Y20A 1LESA 2D40A 3SH5A 4OUMA 3JBG1 1H2MA 2WNUB 3WUCA 2DVFA 4Q8KA 1RUG2 1J3PA 2Q0AA 5I93A 1VP6A 1AR61 4PLNA 5EJ3A 4LO6B 3DGTA 2HWD2 1CJPA 5FO7B 1GZ9A 1NXMA 4HANA 4M3CA 2RM21 1X8EA 5F1RA 3VBHB 4AEJA 4QQPA 1BK1A 1N47A 4BH9A 4TWTA 2BBVA 2P17A 4FQ4A 3WP4A 4XYXA 2GN7A 1JBCA 1ZBA2 1CONA 1J3RA 4YZ5A 4Q4X3 4ZU5A 5J36A 3IKWA 2HWE3 3AXEA 1LODA 4LR4A 2NMOA 4BCUA 2D98A 1W0PA 4E2GA 1NCRA 3B93A 4I3PA 2IXKA 3WLUA 1PZ8A 2W52A 3NO8A 3PJQA 4LLFA 4RR3A 3WHTA 3NWKA 1GQHA 4M3CB 1I6XA 1VRH2 3AXDA 4FPCA 2A6YA 2K2SA 3TBDA 1FOD3 3WW2A 2GMEA 3VKLA 3M7AA 4GMP1 4W6YA 2PHLA 2VVDA 4FPHA 3VBSA 4GULA 1NZCA 1G9DA 4IV3A 1M4WA 2WJSA 2EXKA 3L9JT 4J1XA 4QHBA 1NQJA 5BNOA 5ACA2 1V6KA 5T5PA 1NCRB 1AR83 2TBVA 2EVXA 2JE7A 1V9U2 5FMOL 3VZMA 4HL0A 2B39A 4RR3B 3MIFA 1V6IA 3K48A 1QMJA 4P5HA 5J09A 1PO22 2P3JA 5FFOC 2QKDA 4HK9A 1LTEA 1YFYA 4AGGA 3IPVA 1H0BA 2JEMA 1J1LA 3POWA 2BTVC 1GNZA 3QBQA 1Z7S1 5FTTC 5JOWA 3JD71 4L99A 1OFNA 2HWB2 2MEV1 4CEWA 4CRQA 3M1HA 4YW5A 2PLV1 4NHLA 1Y3TA 1QXJA 1GZWB 4IV3B 4JGZB 4AEDC 3WW3A 4XFFA 1U5XA 5BNOB 5D8AB 2AREA 2B9UA 1W6MB 2ZBJA 3NW4A 3LAGA 3UL2A 3BPZA 3E6CC 4B7KA 3ZFEA 1YNAA 5A33B 4A7KA 1D4M2 2VMIA 2OZJA 1QH6A 2QCSB 5FPZA 1FPN1 1LULA 3RYKA 1DQ4A 3GYDA 4GMP0 1H4HA 2WL1A 1RITA 2NYYA 1RINA 2PN5A 1VAVA 4RSUA 4Y5Z0 2GN3A 4F8AA 2ES3A 1DHKB 1E57A 4P9XA 4QQHA 1WGPA 4IEOA 3H8UA 1GNHA 4YGCA 3SH4A 5FLJA 4XJWA 1QJX3 4XBQA 1SQ4A 2JENA 3J26N 4JV4A 1G7YA 2PAEA 1GQGA 3VZNA 2LTNA 1W6OA 1MS1A 3VZKA 1OPMA 4Q4W2 3H1YA 2BEOA 5C9AC 1LECA 1RUC1 1ASJ1 4Y4YA 2IWGB 4QXKA 1G86A 2ZHKA 2WS91 4Q29A 3WP5A 1QDOA 2XJSA 4KBBA 2DCTA 1VBE3 4EWDA 1AYN2 1LHOA 2VW1A 5SV5A 1O91A 2PHTA 2HJIA 2BWCA 3VBUC 2BVBA 2HWF1 3O14A 4IQPA 4WM7C 3VKNA 2NM1A 4LTAA 2VW0A 3DPRB 3ZVXA 4NHMA 1AL0G 4NR1A 1S0JA 1VBA3 2ZGLA 2HWE1 2XBO2 3H50A 4Q4Y2 3FLTA 4P9LA 2R043 2A7AA 1MVEA 3SHRA 1UPSA 3I2DA 1B09A 5F9TA 4HKWA 5T5OA 1RUH2 2D97A 3MIHA 5HCAA 1UN1A 2UU8A 3RSJA 2YZ4A 5LK7B 4WVZA 5I91A 5JIAA 3IM0A 1OOPA 2WFF2 5BNPB 3NL1A 1H9WA 3URFA 1OQEA 1G9AA 1FOD1 3I4IA 5J98B 1A6CA 5DZGA 3D0JA 4EN7B 1LEMA 2D6NA 1AXYA 3G6JB 3SMHA 1MZFA 2HYKA 4YGDA 3KGZA 3SCHA 1ZZBA 2D43A 3MIEA 1BBT1 2IXJA 1WW6A 2W08A 3KT7A 1S2KA 4Y22B 1WLDA 3JBG2 4K40A 4TYSA 1AYM2 4AVAA 2ZPXA 5CBLA 2HWC3 3SLIA 4BIOA 4JGYB 2A6VA 3LA2A 2BPA2 5BV6A 3ZSKA 1S0BA 1DQ0A 3O0WA 3ZYGA 1MZ6A 2YGLA 1JOJA 5CFDC 1PVC2 3LOIA 5F6KA 4EV0A 1FMD3 3QCWA 1RGSA 3E6BA 4XW3A 3M4FA 2ERFA 2DVDA 1XNBA 3APBA 1R1A2 1ULEA 3HT1A 3I59B 4S2GA 2XG3A 1BMV1 4M0HA 1NE4A 3HAGA 5JSOA 1W39A 2BGCA 4OFGA 1LENA 4CDQC 4ASMB 1QGLA 2PHXA 2ZGKA 2RS31 4OUSA 1SLAA 4AVTA 5JZGC 4XF9A 1EPZA 1X33A 1JW6A 4LT5A 5TSWA 1CAUA 1PGW2 3IWZA 4QPIC 1PHMA 2XVGA 5FCCA 1H2KA 3UK9A 5J96B 3B7MA 4K20A 1CAVB 4I3GA 2F4PA 3MICA 4MLOA 4QGLA 3J4UH 2RS12 3ELNA 1S1AA 1PO13 2X5IA 1DDLA 3MIGA 1QH7A 4QMAA 1UU6A 1H8TA 4HVRA 4CEYA 5GZCA 3C2UA 4XFCA 1NQDA 1DYKA 4XIKA 2WNUC 2WZR1 1JUIA 1ZX5A 3ZXJA 1U5ZA 2GH2A 3N7JA 2BUKA 1RMU2 1CAUB 2PHFA 4OZXA 4WZCA 3DL3A 4Q0QA 5ABJA 4N7UA 5FAXA 4YGBA 1GBGA 2XKOA 3JD72 3O0XA 4FPEA 4XMIA 4LBKA 4PBPA 2GNMA 3VBHC 1BVVA 3AP5A 4WM8A 2X5IB 2YGMA 5I0SA 4N53B 4RS5B 1H8TB 4S2FA 5DZEA 2XJVA 2EALA 5L73A 1XYOA 2OIIA 5E8AA 1CAXA 1FNYA 2B42B 5KXEA 3MF9A 2MPFA 4K9SA 1AR73 3HBZA 1X50A 2ZS6B 3LA7A 1FYUA 1NCQB 4E27A 5C8WA 5ABJB 1W6PA 3B02A 1FPN2 3FUQA 4GH4B 1CR7A 2ZKLA 3VZJA 3ZN6A 4GB31 2SBAA 4Y26A 2BVVA 2XJRA 3A4UA 4WM8B 2D6OX 5KHHA 5AC92 4XJAA 2VMHA 3NVCA 1JUHA 4H3WA 4YNIA 1QY4A 2NZ9A 2WIIB 1I5ZA 3OBRA 1QJU2 5K7PA 1HRV2 4YARA 1KS5A 4L8QA 4JTOA 4COYA 2D5HA 1NCRC 1TME1 4FOVA 3ES4A 3TN93 3I8TA 3AZWA 4RR3C 3MIDA 3ZXFA 1NA1A 3ZN6B 1J1TA 1MS8A 1KJLA 1MS0A 2RS52 1AL21 4BLJA 4GIQA 2JECA 4C0BA 1O3QA 4F3JA 1NY71 1EAH1 4LLOA 4BWOA 1ULGA 2ZGPA 3ZMNA 2FMDA 1S0DA 3POSA 4LA2A 3SCFA 1PGL2 4WVMB 1FMD1 4A7YA 1GZCA 3P3PA 1OA2A 2QVSB 1RUOA 4IV3C 4JGZC 2QDRA 3FMGA 2ZACA 2CAVA 3WDVA 4FPGA 4PLMA 5BNOC 4I0AA 5D8AC 4K8FA 1RUF3 4UBGA 4Q4X2 2UYBA 4AEDA 2HWE2 1NA1B 2I45A 3V0AB 4HSLA 1G8WA 4PLOA 3BU7A 1D0GA 1ZBE3 3BB6A 4AI2A 2CY6A 3IN9A 2TNFA 4Q1RA 2GNTA 4PDWB 2JD4A 5GLZA 3SITA 1FOD2 3J8F1 1GV9A 3HWJA 3VBRB 1N1YA 4CDXA 2BWAA 1TMF2 4RHV2 1HRI3 2Z2SB 2PQQA 3ST7A 3LB9A 2AR6A 5IT6A 2D93A 1Q43A 1ZVFA 2ZA9A 1U12A 2R1DA 1I1EA 3TYJA 1KXGA 1MQTA 1AR82 2WFPA 4XF1A 1WW4A 3EBRA 4IEXA 4LULA 4XF3A 3AYAA 1COV3 1DQ5A 4EN8B 5GJ6A 3JZVA 5C9AA 1FNZA 2R062 1SBDA 1HX6A 4R9AA 4IEQA 3D4KA 4U36A 1C8NA 1AR91 1ENRA 4CDXB 1S55A 3GHNA 2A6ZA 4OI1A 2CTVA 1FV3A 3H1MA 3H3ZA 3VBUA 3DPRC 4WM7A 5F6LB 4D3WA 1DLLA 3JU9A 2WT2A 4QPYA 1G9CA 4AFBA 4BMEA 5AFEA 1MQTB 2VXRA 4QQLA 2VPVA 3FE5A 3VDDB 4MXVA 3NJZA 2P37A 4ZKTB 3NKGA 1PK6B 4RGGA 4Z1VA 3WCSA 1CX4A 5FRAA 4AI3A 2ZKNA 2ZGRA 1AR63 4AFAA 3KSCA 4PBOA 5K0UB 4YZ3A 2ZMNA 3N3HA 3HN1A 4LBNA 1IZ3A 4HVQA 5CU1A 2OUHA 2RM23 4AWDA 5BNPC 2Q30A 2GNBA 2VMGA 1TQ5A 2FZ2A 5HCFA 4WVWA 3PVEA 4Y1XA 1W2UA 1J58A 4A2UA 1QJX2 4ZU7A 4JCKA 1UPIA 2ZZJA 5GLVA 3ENRA 4ZU4A 5DUUA 4XJ9A 4FCAA 2ZHNA 4CYDA 2ZHLA 2A3WA 3ZXGA 1MEC1 4JGYC 1WBFA 1IS3A 1QOSA 4Q1PA 2NPIA 3VN4A 1OOPC 3WQ0A 2O8OA 1VBE2 2Z79A 1RHI1 4JDNA 4NN0A 1AX2A 3S0MA 3W9AA 1H4GA 2BW8A 2BNNA 2AGSA 1OPOA 1MS3A 4GMP3 3L2YA 5CFDA 1YXWA 4ATFA 2JE9A 2DUQA 1D4VB 3V0BB 1APNA 3VLBB 4ORFA 3TAYA 3W59A 4K1YA 1D2QA 3MW2A 2VQAA 1LHUA 4Q26A 1VBA2 3AK0A 3ZIXA 4CDQA 1QJZA 3LZZA 2R042 5DG1A 2AH2A 4GALA 4AQ2A 1ZBE1 5JZGA 3EXUA 2RE9A 1HKDA 3J9SA 3E5UA 1O3TA 3VL9A 1OKQA 1Z7S3 2WNEA 4BZ4A 4K6BA 2ZHMA 5A3MA 4QPIA 3LA3A 2I2SA 4MGZE 4UXAA 1ND2B 3USUA 1CGPA 1C3HA 2MEV3 1CAWA 1RUJ1 4LE4A 1F31A 2YPJA 1EV13 2PLV3 3CJIA 2YV8A 3FLPA 3OJBA 5AVAA 1YYNA 3CU7A 3V56A 4FT8A 1BKZA 2VOWA 4RFT0 4INDA 4DFSA 3UKVA 4UW5A 2HWC2 2RJKA 2A5ZA 4LE3A 2WLPA 3AMQA 4MZUA 2QFEA 1QOTA 2WZPP 4P9YA 5JIUA 1AJKA 4K7JA 5KXDA 4FVVA 3USUB 4AG4A 2NQYA 4L2NA 1WLWA 1XNKA 1OLRA 3RJ2X 2X5IC 3CJIB 1XE8A 4N53C 4CDUB 4RS5C 1H8TC 3MLLA 4CEYC 2VVFA 2JG8A 1KITA 2R6QA 1G9FA 3UKTA 1YJLA 4N43B 2GALA 1V6LA 3ZIWA 2XJUA 1LOAA 3H3UA 1NCQC 1DZTA 4L11A 3B3QE 5ABJC 1RUC3 1WW5A 1GR3A 1ASJ3 3AYCA 1V6MA 3FC0A 3D8CA 2WS93 3JB4C 4GH4C 4KU7A 1CD3G 1OMIA 2UWCA 5JR7B 4YW2A