2DCTA

Crystal structure of the tt1209 from thermus thermophilus hb8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
b'MEIKDLKRLARYNPEKMAKIPVFQSERMLYDLYALLPGQAQKVHVHEGSDKVYYALEGEVVVRVGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVVTAPRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA0104
publication title Crystal structure of the TT1209 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 19
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dctA00
4J1WA 5BY5A 2B8MA 4IEQA 3BPZA 1CAVA 2EAAA 3FE5A 3KGZA 4BHPA 1QWRA 4HSLA 2UYAA 4JTNA 4MH0E 4E2GA 4AVBA 3E5XA 3E6DA 3WW1A 1O5LA 1SEFA 4IERA 1PM7A 4BIFA 5D1IA 4LUMA 3KCCA 3RDIA 3HT2A 1RUOA 2N7GA 4BYYA 2CGPA 4LULA 3D82A 5K8SA 3WW3A 5FPXA 3GBFA 4WZCA 1DGRA 3WW2A 1Q43A 3H1YA 5FLIA 2MHFA 4XEZA 2EVXA 1ZZ9A 2QJVA 2CV6A 5JSOA 3NKTA 2B9UA 2KXLA 3FZ3A 1ZRFA 4ZU5A 3PLQA 4E2SA 1ZRRA 4HVQA 1OFNA 2PHLA 3E5UA 3SCFA 5KBFA 1UIKA 4XF4A 2UY8A 1ZREA 3LZZA 1ZZCA 3UKVA 4IEVA 5I8YA 2O1QA 4ORFA 3U11A 2XKPA 2XHKA 1PMIA 1YFUA 1ZVFA 3C3VA 3RNSA 2P17A 4O9GA 2FQPA 5I8SA 5CVRA 4OFGA 5FDBA 2QNKA 2BNOA 5BV6A 4R52A 4J1XA 3SCHA 2O8QA 4HSJA 2ET1A 2EA7A 4XETA 4D7SA 2XLAA 4IEOA 1U12A 3HT1A 4NVPA 4R8HA 3ELNA 4D7TA 4FAGA 2ET7A 2GC2A 4XF0A 3IDCB 3ZDSA 3LOIA 4N9HA 3UKTA 1LKNA 5FQ0B 4XFFA 2XGXA 3VHRA 2QVSB 3OGJA 3MDPA 3BB6A 3H8UA 1O3QA 4LEJA 4Z07A 4PIYA 2PA7A 3UKNA 4MZUA 2D5HA 3E6BA 4I02A 1Y9QA 1J1LA 3H3ZA 4XFIA 1O5UA 3MYXA 1NE4A 1CAVB 2D5FA 5LRRA 3USSA 1QY4A 2V09A 5BUVA 3H50A 1H1IA 1WA4A 4FBFA 5I93A 2B5HA 2HKXA 1RTVA 4LLOA 1RGSA 3RYPA 4QGNA 3H1MA 4XF3A 5FQ0A 3KGLA 4Q0SA 3RYKA 1H1MA 3IIAA 3ROUA 3PVBB 4WBBA 2GAUA 5C8WA 2MNGA 4AQ2A 2XLFA 3CL1A 4Q0QA 1ZZ7A 4L11A 4I2OA 1SQ4A 5LRSA 4TLFA 4QGLA 1IPJA 2IXLA 1O4TA 4BH9A 1ZZ8A 2H6CA 2XL9A 2GZWA 2H0VA 4LA2A 4CYDA 3LAGA 3PNAA 4FAHA 3BALA 1HW5A 4KU8A 4META 1FI2A 1VJ2A 4I0AA 3FHIB 2Z2SB 3LA3A 3ST7A 1ZZ6A 4QX5A 3M70A 3BCWA 3MPBA 4N9IA 3OCPA 4UBHA 4XFHA 5J3UA 1X8MA 3H7YA 1LR5A 4I01A 3B02A 5J48A 4IEUA 5E16A 1IPKA 3CLPA 1WGPA 2HJIA 1X7NA 1O3RA 4KWJA 4P9GA 4IEWA 3IBMA 4FT8A 1YUDA 2ETEA 4MUVA 5I0TA 4HN0A 3QOPA 2BEOA 1O3TA 4XF9A 1NXMA 4RD7A 3WW4A 2BNMA 4QXKA 4AQ6A 3M3IA 5JAXA 4HZFA 2IXJA 5CU1A 1YFYA 2UYBA 3HQXA 4QGMA 2IXKA 3R6SA 4Q29A 2GC1A 2VECA 1DGWA 1OD5A 3H9AA 1I6XA 3TNPB 2ATFA 3DN7A 3H1WA 4GULA 1J3RA 4HBNA 3RZZA 4E2QA 2QDRA 3E6CC 3U0ZA 4KWLA 3L2HA 1J3QA 2Q0AA 3D0SA 3IWZA 3CJXA 4DINB 5FLHA 4LUKA 1JUHA 2PYTA 1TQ5A 4JVAA 3ES4A 1EY2A 2QCSB 5T3NA 2ZCWA 4PJYA 4EWEA 1ZRCA 2IXCA 1QXRA 2Z69A 1ZX5A 4UBGA 4XFCA 4XFBA 5EZWA 4XFGA 3DV8A 2GU9A 4IEYA 1J3PA 2OPKA 4MGIE 4ONUA 1DZRA 2F4PA 3CEWA 4JV4A 4MV2A 5JSRA 1VP6A 1LB2A 3ES1A 2OA2A 3NJZA 4LTAA 2GC0A 5KHJA 3JZVA 4YRDA 4HN1A 4AXOA 4PIZA 2BNNA 2VQAA 2PQQA 2XLGA 3D0JA 3H3UA 4Q0PA 3FWEA 3OD0A 4I09A 2GH2A 3EHKA 1NZCA 4QM9A 5I0SA 2GC3A 4MGKE 1V70A 3FFQA 1OI6A 4IEZA 2VPVA 5FCCA 1EYBA 1CAXA 3BU7A 4B29A 2H6BA 3LWCA 3NW4A 3E97A 2CAVA 5KHHA 3SHRA 1RL3A 3O14A 3I59A 3U10A 2K0GA 5C6CA 4EWDA 4EV0A 1DZTA 1CAUB 1G6NA 2IC1A 3SCGA 3ACLA 4H7LA 5CADA 1GQHA 4QM8A 3H7JA 1I5ZA 3DKWA 3KMHA 1XRUA 3NSTA 4PIXA 2CAUA 4MGYE 5FLJA 5BXXA 3RPQA 1UW8A 2BGCA 4O9EA 3FJSA 3I7DA 1ZRDA 4EWAA 5LEKA 3EO6A 4XF1A 2PFWA 3ETQA 4X6QB 5J7MA 1ZNPA 3DL3A 1NYWA 5LEJA 3N4MA 4I3PA 5HI0A 1X8EA 4HVOA 3SMHA 1YFWA 5KHIA 4I0BA 1CAUA 5AVPA 1UD1A 3KSCA 3TNQA 5JCTA 1CAWA 2IXHA 3IDBB 4K8FA 2Q1ZB 4IEXA 3G7DA 3FX3A 2DCTA 4YYOA 2PAMA 3S7EA 3OTFA 3EQEA 1UPIA 4KU7A 5E1RA 4UXAA 3OF1A 2OZ6A 5KHGA 4KWKA 1FT9A 2OYZA 1QXJA 4EROA 1UCXA 5I0UA 4IESA 2D93A 1XE8A 3EJKA 4IEPA 3RYRA 4HVRA 4WVZA 5KHKA 1O7FA 2MPFA 3HIFA 3MZHA 2Q4SA 2E9QA 4Q0UA 3S7IA 1RUNA 3LA7A 4F8AA 1J59A 5FPZA 1Q5OA 3GYDA 2WFPA 2IXIA 5I8TA 4OLLA 5I0RA 3SXWA 4LA3A 2WC2A 1EPZA 1X82A 1CAXB 4XFAA 5I91A 1CGPA 3CF6E 2XKOA 1O3SA 2Y0OA 2D40A 1OMIA 4HMZA 2Q30A 2PAKA 2FMYA 1EP0A 3I59B 4IETA 4ZU4A 1UIJA 1LRHA 1XE7A 4L2NA 4Z82A 4YSFA 3I54A 2OZJA 1FXZA 1Y3TA 3EBRA 4JTOA 5JSPA 2PTMA 2C0ZA 3NVCA 1SFNA 2PAEA 4KL1A 4MGZE 4YARA 1VR3A 1J58A 1YFXA 4A2UA 1YHFA 1CX4A 2BYVE 4YNIA 4ZU7A 2K9ZA 4Q0VA 4F7ZA 2UY9A 4AVCA 1RC6A 3CO2A 3NL1A 4AVAA 5F1RA 2PHDA 3LA2A 2I45A 5JR7B 4MX3A 2ZKLA 3QACA 1YLLA 2XL7A 1NE6A 4QMAA 1GQGA 1ZZBA 3S0MA 3E5QA 4HLTA 5BPXA 1YWKA 1L3JA 1CAWB 1Q3EA 5EFUA 4X6RB 1WLTA
chains in the Genus database with same CATH superfamily
3WX5A 2W2IA 1NOVA 5LBEA 4XJWA 1UZZA 1L7LA 3FFZA 1NLSA 2B8MA 4ISRA 4WV8A 5IW0A 3RFRA 4MG2A 1XOYA 1QWRA 4H2AA 5EJZB 4NIHA 2TUNA 1LOFA 1J1TA 2FHRA 4HPKB 2QE3A 3FN9A 4NO4A 1K12A 3E5XA 3E6DA 4NPLA 2WNVB 4ZPIA 5FZDA 2OX0A 4IERA 3SKJE 1NX9A 4OHVA 5JMOA 5D1IA 5H9SA 2GP5A 3WDUA 5FZBA 4AAPA 3WOGA 5ACA1 3HT2A 3B69A 2R042 2XUEA 3VBOC 1GQPA 1HRI1 5DUXA 1GSLA 3I2OA 4A41A 4YW3A 2ID4A 5D2AA 4DO0A 5FPXA 4OI4A 3GBFA 2W94A 3VZNA 3EXUA 3WW2A 4M4PA 2EAKA 1PNGA 2EXJA 3H1YA 1YEWA 4YVWA 2A6VA 5FLIA 2MHFA 1ENSA 2JG9A 1HXS3 1ZZ9A 4FPEA 4JZRA 1DQ5A 3AMQA 3M3EA 2JE7A 4NHYA 1ZRFA 3N36A 5GZCA 4M00A 4E2SA 2Y8KA 1H8TA 4LBKA 1UYYA 1WLDA 4Q4X3 3AB0A 4CDQC 3ASIA 5C3PA 1OFNA 1B35C 1BHGA 1EAH1 4XF4A 3LEIA 3ILRA 2UY8A 4AQTA 5FY7A 1ZREA 1H4GA 3BGAA 3LZZA 4LHKA 5CISA 4JKKA 4L92A 2D44A 2QUOA 3IAPA 5FZGA 3UKVA 2O1QA 4INDA 3V56A 4BXSV 3T4VA 3POFA 1CR7A 1MS5A 2XQXA 2GN3A 5A32B 2OT7A 1HV1A 1NA1C 5A80A 1WMFA 1ZVFA 3C3VA 4IQPA 1UZ0A 3N9OA 4FPHA 3ME2A 2IFRA 1E5IA 3T2OA 2BWAA 5BNOC 1W39A 5T5PA 4CP9A 3M1HA 2UWCA 5I8SA 4NAMA 4E9KA 4MVTA 3SNMA 4AF9A 1FAYA 3GXUA 3BUCA 5FYHA 5BV6A 4N43C 1PO21 1PZ9A 1Q8SA 4J1XA 1VBB1 5IVEA 1QGLA 3JBG2 3WG3A 2NZ9A 2VOVA 3AP6A 3LSDA 2XR4A 2DFBA 2D6MA 1ND3A 2NLRA 4NVPA 4R8HA 2R043 1AR81 5A33A 4GB31 4CUAA 4FAGA 5L73A 4NAOA 1T2XA 1V6KA 1OBNA 2ZTNA 1XSQA 4JHZA 4Q4W1 3TBDA 2EIBA 3N7KA 1GKBA 4GIQA 1AL21 2W91A 3O1OA 3WV6A 2FDHA 3AVRA 4MGTA 3WNLA 3M3OA 2GN7A 4LBLA 1VBE1 4XUQA 2SBAA 1LKNA 1CZVA 2DUOA 2XB6C 3AMNA 3ETPA 3OBZA 2R062 2XGXA 1WCUA 1W6QB 3ATGA 3WINE 4Y4YA 1OLME 3Q8CA 4GA9A 4P9IA 3N9PA 4JCKA 4YVSC 1QH6A 2E7AA 5L7OC 1D4M1 1WMXA 3FLPA 5D8AB 4H55A 3TRSB 5GZFA 1J1LA 1JS9A 4AFCA 4PDWA 1XXNA 5K0UC 4HK9A 5EP9A 1OA2A 5C8CB 5C7GA 1LGCA 1QJX2 1LOAA 4N90A 3V65A 3OY8B 3VKFC 3TEXA 2V09A 5EHDA 1F4HA 1MS3A 2IZWA 5J36A 2RMU2 5KXEA 2Y6HA 1H1IA 4YZ5A 1R091 2ERFA 4HKOA 5DQ0A 3O1TA 2DVBA 1LEMA 3B3QE 2RS32 3I2DA 2B5HA 1F9KA 1RGSA 1W2NA 3H1MA 1JZ2A 3QD6A 3JBG3 4XDOA 2VQ0A 4JC1A 5FQ0A 1W6OA 3DECA 4Q0SA 2C5DA 3RZKA 3IIAA 4GWNA 1E57A 1QJY3 2FCVA 4PCRA 4AEDA 2HBUA 3S57A 2J1VA 3FBYA 4AQ2A 4BDVB 2XLFA 3CL1A 4I2OA 2X5IB 5GLTA 5C33A 4XE9A 2JDNA 4BISA 3ZFEA 4TLFA 5CFDB 4IE4A 1MVEA 3WSOA 2CNAA 2VBBA 3POWA 3VDDA 1VMFA 2IFWA 1QF3A 3BYWA 3PTRB 4YG0A 3K4AA 2F4LA 1W9TA 2J1RA 5A7SA 4WM8B 2H0VA 4ZHNA 1JI6A 3LAGA 5BNNB 3BALA 3NAPA 4B4QA 1R083 3WVJA 1V6NA 4META 2QQKA 4ISQA 4PBPA 1FI2A 3WHUA 4DNYA 2I07B 5FO9B 2Z2SB 4XAEA 3LDRA 1ZZ6A 5B2GB 3MPBA 2Y0IA 2AEZA 4PLMA 1OH3A 2ZHMA 3NRUA 4XFHA 3UV9A 2DCYA 2A6ZA 1SMVA 3VD4A 1RUC2 1C8M1 3OBAA 4YGCA 5FMCA 1VBA1 1X8MA 1NCRA 2DVAA 1CIYA 1POV3 2B42B 1IHMA 5E16A 2FZ2A 3BTYA 2RMU3 2HJIA 2ADEA 2R7EB 4PQ9A 1BK1A 4YW5A 1PNFA 4BIOA 2VMGA 1S0JA 3ZVXA 5HCHA 5H9PA 1CD3G 5L19A 2W1UA 4IEWA 2H0BA 3FMGA 3IBMA 4CXWA 1JU4A 1SFYA 2VW1A 1QDOA 2GH8A 1XQNA 4COZA 2PHUA 3POYA 2MEV1 3QOPA 5IVBA 1ND2A 4OI0A 5E88A 1WW7A 2HWE2 5FXZA 4XMIA 3CQOA 3JXSA 1O3TA 2BOIA 2NM1A 4CU6A 3VHOA 3WG2A 1NXMA 4A7YA 3AJZA 3WW4A 4W6WA 2AH2A 4CDXC 4NIGA 2YBPA 1CONA 3IDAA 3PURA 4PLNA 5A7QA 2ILMA 3LE0A 4QGMA 1K5JA 1O4ZA 4ATFA 4Q29A 4QQLA 5EWSA 3U14A 3OJBA 2YC0A 3HNYM 4LBQA 2Q1FA 2RM22 4P9XA 3K46A 3MBWA 2B9VA 1KD7A 1SBFA 2ZMKA 4AHWA 1AF9A 2HLEA 3VBOA 1I3HA 2VOKA 1WUVA 3QLQA 4GULA 4XDPA 2J22A 3SH5A 1UY4A 3UJQA 3ON7A 1D4VB 3RZZA 3E6CC 4CDUC 4XUOA 1W0OA 5FZOB 3CJXA 5FO7B 4P9WA 4CEYC 1QOSA 4R4XA 4RGAA 5FLHA 1SCRA 1DBNA 1RUC3 2WWSA 2Y26A 2WO7A 5EYYA 1D0HA 1OF4A 4L97A 4JVAA 4IV1C 4N8MA 3AVSA 4WM7B 4CDQA 2DUPA 2WZR2 3MV01 1B35A 2JB4A 2VNVA 4CUCA 3DV8A 2FBEA 5HCFA 2J1AA 2W08A 4S2HA 2BRTA 3AZXA 2OKXA 2XVKA 3NV4A 4MGIE 3KCYA 3S5QA 2UURA 3HBKA 1NA1A 4ZY9A 1DZRA 1DGWX 1LEDA 3J7MA 2XG3A 4YW2A 5FPLA 5BNOA 1LB2A 2VY0A 1FPN1 2OA2A 4K20A 1AR92 2ZGNA 2X29A 1MZ6A 1X50A 2A6WA 3GZEA 3IAQA 4XTPA 4YRDA 4CCCA 5C4WC 3V0BB 4AXOA 1WW5A 3NV3A 4N43A 3ZYBA 2R072 4RFT0 3IMMA 2G9ZA 3U07A 2RM23 1S0EA 2AENA 1DP0A 2E63A 2WZEA 4TLGA 2XLGA 3RZHA 4O7XA 3H3UA 4AYUA 5F8PA 4LIUA 1VBC1 3ZFFC 3MI8A 4XHXA 3ZN5A 3I3MA 1AUYA 5DAWA 4QM9A 4JDMA 4ATEA 4P9YA 1AVBA 5JVVA 2GC3A 1QQP3 1V70A 1MVQA 4EN0A 4QQOA 5DUVA 4DUXA 3THPA 2JDUA 1VRH1 3SH4A 4MXWB 2VPVA 4CXYA 4YZ1A 3NNGA 2WL1A 4QPYA 4UFKA 1MZFA 4LO4B 4JDOA 4CVUA 4A44A 1EUTA 2YU1A 1W8HA 2Z5WA 3LWCA 1HN1A 3E97A 4Y1YA 2ARXA 1RUE1 4YVSA 2CAVA 3U78A 4YFZA 1G9CA 3WQ1A 2WZ8A 2WN2A 5L7OA 2Q1MA 1JYNA 5F9TA 3K75B 5JWPA 1JYIA 3I59A 4JX0A 5DAXA 1SBDA 5A3PA 1YI7A 1CIWA 5K0UA 2QDNA 4O65A 1WD4A 1COV1 1DZTA 4DXSA 4EV0A 2WQ4A 5GZDA 2IC1A 4HOOA 1RVF2 1MZEA 1W8ZA 2A7AA 4LNVA 1UMZA 3LQCA 2Y6JA 4XXPA 1E5SA 4AL9A 3UYJA 3MIEA 4AAXA 3KHCA 1AYN2 1YC61 1JYXA 1DYOA 2RS52 2BTVC 3H7JA 3WP6A 1IZ3A 1CQ9A 3DKWA 1HB3A 1RITA 1XRUA 3ZSMA 5HXMA 5LASA 4RHV1 4PIXA 4W65A 5A6XA 1N47A 3WQ0A 5KXBA 1GANA 1S2EA 2R073 2HWB2 1YQ2A 5FLJA 2JD4A 5EPAA 4O9EA 5JMCA 5ERLA 3ZDVA 1Z78A 4LKDA 4XF1A 2QFEA 4DRVA 5JZGB 2P1BA 2NMNA 2UU8A 3DL3A 4FI9A 4XJZA 4IV3C 2YB7A 1I9RA 2VNOA 1KDMA 1KJRA 2ZAAA 3CBNA 3FUOA 3AFKA 4Q27A 4YFWA 5DDJ3 2ZMNA 4AFBA 3LD8A 5FZIA 4I0BA 2PMWB 5HPOA 5JR2A 4LO8A 4AHYA 3KSCA 1ZBE2 1V6IA 2YXSA 4LXLA 4XXAA 3TB0A 1CAWA 2WFF1 4CCJA 5LBCA 5C3OA 4K8FA 4FOWA 5ABJB 3DYPA 4IEXA 3G7DA 1JOJA 4LBQD 3ZR5A 2ZACA 1HQLA 3VDBA 3AYEA 4C0HA 2CL2A 2JXAA 3OTFA 3EQEA 3PIGA 4ES8A 3V0AA 1BBT2 2D6KA 3OGSA 1Q8OA 4KWKA 5IUQA 1Q8QA 2VL4A 4ET7A 1RVF3 2DTYA 3MIHA 2VW2A 1RB8G 2BP6A 3P1IA 4KI5M 1QEXA 1N3OA 4WZFA 1GWMA 3OPWA 2JKXA 4XACA 4CUGA 3UT0A 2OUHA 3LEKA 3EJKA 4IEPA 2E7TA 4K21A 4HVRA 3I4IA 1L7RA 5KHKA 5FZKA 2MPFA 2HWB3 4PI0A 1X9PA 2Q4SA 1PM4A 4MSVA 5FJKA 1RUNA 4F8AA 1ENXA 4N53C 3BPSA 4C90A 3W21A 5CYYA 3W59A 1OPMA 1DQ0A 2DCJA 2XJUA 3WDTA 1LESA 2NMOA 1RUI1 1S0IA 4OLLA 1PHMA 3U75A 4LA3A 1TME1 4CDXA 1FOD1 1O8PA 5BNPC 1F35A 1OOPC 1UX7A 1X82A 2C9KA 4XFAA 4BOWA 3CF6E 2DCKA 4CEWC 1MEC3 4OHYA 2WA3A 4UI9L 2JD9A 1O3SA 1UY3A 5CFCC 1A8DA 2YUEA 2Y0OA 2YBKA 4XJ9A 2DCZA 2Q8EA 3WNMA 4Z8BA 2RDRA 4Y24A 3W5MA 1FMD2 2XMLA 3DGTA 4RYDA 5DZEA 2VVFA 4FPLA 4Q4Y2 1YQ5A 3PUSA 4P08A 1ZBA1 2PLV2 4ZU4A 4DIQA 2XBO2 1WD3A 1D7PM 1AHSA 1KGYA 4TYSA 1ALYA 1VBD2 1NAEA 4XURA 4DRRA 4AGVA 3NJXA 4CDUA 5FV3A 3GHMA 1BBT3 1UXXX 3WUCA 4CEYA 2WN3A 4AI2A 1FXZA 1PGW1 4AVTA 4TTGA 3H8OA 2PTMA 2JX9A 2C0ZA 4XVHA 1PZ8A 4NHKA 2D6OX 4G9SB 1SFNA 4XOGA 2R1DA 4IV1A 5FYUA 3PJYA 1V6MA 2AZ5A 3GZUC 5GLZA 1YFXA 4E4HA 4ZU7A 4Q0VA 2C26A 1YCIA 1STMA 4YW1A 3LEMA 3HVDA 1W3XA 4KNCA 1W28A 1PIV1 2UY9A 4P02B 3FBMA 3VV1A 3MF6A 1OF3A 2DU1A 5DXDA 3NL1A 5L9BA 1SPPA 4AVAA 3RJ2X 5F1RA 2PHDA 2ZKLA 2JWPA 2RS11 5JXIA 1NE6A 3VBFC 1DU3D 3ACHA 1ZZBA 1RUH3 4HLTA 2WA4A 5C4WA 2G19A 1YWKA 3O7OA 2JG9B 4WVMA 1U5IA 2DFCA 1HJGA 1W04A 3K51A 2PHTA 1Q3EA 4UT5A 3TN93 2NYYA 4FCAA 5LW9A 4QB1A 2ES3A 1ULGA 5FR3A 1RMU2 3RZGA 1XPWA 2VXRA 4J1WA 1FMD3 2BZDA 1H8TB 5BY5A 3BPZA 3ZFFA 2PLV3 2UYAA 1AR62 2XBO3 4MH0E 2Q8CA 1VBD3 2LALA 2LW8A 2OS2A 2D7FA 2QQLA 1O5LA 1F4AA 1LJ7A 1PM7A 4YG3A 2JG8B 4LUMA 2OW4A 3MICA 1HN0A 2N7GA 1QJU1 1RHI3 5EJ1B 4NHXA 5APAA 2CGPA 4LULA 2JIGA 3KVBA 5K8SA 1ULEA 1S0FA 4CP9B 4I0WB 5E6HA 5HCBA 4OMCA 1DGRA 4Y5SA 3WEZA 1Q43A 3HD8B 5F2WA 1JMUB 2CV6A 3WR0A 3ZYJB 5ACA2 1V9U3 2KXLA 2HEWF 1HRI2 2CU5A 4LOSA 3I3QA 1BJQA 1F2NA 1YQCA 4HVQA 5A6QA 2R30A 1TVGA 1UIKA 2XPJA 1SDDB 2RVAA 4QD2A 4NWVA 1F5JA 1C5IA 1ODNA 4QKNA 3POGA 5FP3A 1IS5A 4MXVA 1HX6A 3OYWA 4W50A 3AKRA 3DPRB 2XHKA 1GICA 1US3A 3PHMA 5GJ6A 1QJFA 5FYBA 3KZ4C 4QXBA 5JIAA 4NRPA 5JPMB 5ISLA 1W2UA 2A5ZA 4O9GA 2HWD1 2ZPXA 1NUKA 1AR63 4Q1PA 4UOJA 3DXTA 2VNRA 5A1AA 1KEXA 1FX5A 1H1AA 2QNKA 3F95A 3UGFA 4D6SA 2ZGMA 1CVNA 4IV3A 5LBFA 1KJLA 5A3TA 1JZ5A 1K5MB 4PDWB 4D7SA 4LBJA 5LCWL 2XDVA 1UOBA 4IEOA 4GWMA 1J83A 1H4HA 1U12A 2ZEYA 4PHZA 3WXPA 3ELNA 2VM9A 4QHOA 5FRAA 4RR3B 1D0GA 4NUBA 4Z2WA 2ET7A 4U2AA 4QX0A 1RUG2 4XF0A 2V4AA 4XIKA 2ZX0A 1OT5A 3AL6A 4DXRA 1C57A 3LGRA 2GMEA 2RR11 4MOAA 2BWCA 4QXHA 4R9DA 1PO22 3ZDSA 1VBB2 2FDIA 5FJHA 3VB9A 5IK4A 1Z7S3 4OI1A 5FQ0B 4PQQA 4XFFA 5FZ0A 1W6OB 1NY71 5FZ1A 2HYKA 3KT1A 4GH4B 4Q26A 5FK7A 2W5FA 5G05L 1AR82 5ACA3 3OGJA 3MDPA 5IATA 4GB32 1HRI3 2A3XA 3C7GA 3BB6A 4AEDB 1X36A 2D98A 4Q4V1 4Z07A 3WF2A 3JQWA 4Q4W2 1AR72 2P2KA 4QAWA 3TWIA 1AL22 3CKHA 3VGIA 1W8UA 4B4PA 4FO9A 4L99A 4MZUA 3ZFEB 1AL0G 1JYCA 1ZA4A 3R4SA 1VBE2 4W6YA 2E6VA 3OD4A 1PGL1 2AREA 3BOWA 3C7FA 4XAAA 3VDDB 2XJVA 3VKLA 3WF0A 2WS91 4B1LA 3MYXA 1NE4A 1CAVB 2D5FA 4YM1A 3J8F3 4UF0A 3NAPB 4N53A 2XJQA 3OUJA 3ILNA 5I93A 5IAVA 1KXGA 1D4M2 1OUSA 4CSWA 1CZSA 1GZCA 1DZQA 3S5AA 5CNAA 4BU2A 1OUXA 1CESA 5BNPA 1OOPA 3LFIA 4MLOA 4PI2A 3VZOA 1I1EA 4L0PA 2BVBA 3KGLA 1UYZA 1H1MA 4CEWA 5F32A 3FHAA 4BQ5A 1NCRB 3ROUA 5A3LA 3ZYHA 5CFCA 4YZ4A 4K8RB 4RS5B 1GUIA 1PK6C 1RUG3 1XC6A 1LENA 1R092 1ULOA 2DBNA 2WRAA 2ZX4A 3DYOA 2IWGB 1SQ4A 4AFMA 5LRSA 1AYM1 5CKMA 5B4NA 1IPJA 3ZKYA 2IXLA 1PO23 2VXJA 2YY1A 5FYMA 5F39A 1NKGA 1RUD3 1TMF1 3KV6A 3NJYA 3UGGA 2L9LA 4LA2A 3HN1A 5FYTA 1JOBA 2D6LX 1TZOA 1JW6A 1ND2B 1QKQA 3OPTA 3RZMA 2W3JA 1AJOA 3I3DA 1JU3A 4GB33 3M4FA 4KU8A 5CG8A 4Y1VA 3WCSA 1OLRA 3FHIB 2V5YA 5LY1A 1AR73 5HXVA 1YJLA 1UYXA 3VBHA 2YC2A 3BCWA 4N9IA 1REDA 2R6QA 3OCPA 4OYUA 1SLCA 1R1ZA 3AL5A 3AZZA 4UBHA 4JGZB 2ZGKA 5TSWA 3VD7A 2ZBJA 4D3WA 5IYYA 5JXJA 3CHXA 4HT1T 5FZFA 4YWAA 1WBLA 4BWOA 4LBQB 3RZJA 1W9FA 2WNVC 4YGDA 3CZJA 2V72A 2K46A 4I01A 4QPGC 4QX1A 4W6XA 4HANA 2ZGQA 1JZ6A 4IEUA 1PO13 2XOMA 5FUNA 2VZVA 3LSEA 4A42A 1HRV1 3VBRC 4AR2A 2ARBA 3H8RA 1BEV1 2D97A 2XQRA 1DLLA 3N9NA 2VC9A 3MIFA 1GLHA 4AVVA 1D4M3 4GWIA 1X7NA 1APNA 4KWJA 3NKGA 5LA1A 3ABZA 1Y9MA 1WCQA 3GALA 4P9GA 2HWC1 4R9CA 1S4CA 3VBFA 4YZ3A 1C8M2 4OVEA 1VBA2 5CG9A 3D3AA 2QTWB 5FOBB 4CE8A 2R16A 4FTEA 1LHVA 2WQ8A 3LPGA 4TZDA 4UWDA 2WSUA 3AP4A 1R093 4QXKA 1H30A 1NT0A 2E26A 2WAAA 2TNFA 1B35B 3JD71 2IXJA 3O5SA 3I2GA 3RS6A 4RQPB 1ODMA 3V64A 4JGYC 2MEV2 4UW6A 1WWYA 1AX2A 2BPA2 3JUUA 1YNAA 4COVA 4FQ4A 1VALA 3TNPB 3NNLA 1LGNA 3AK0A 2GSYA 1G8WA 5IVCA 2VZ1A 1J3RA 1NG0A 3PU8A 3P6BA 2VCMA 3SEPA 3WDWA 4HBNA 5BNOB 2WNUC 4D8MA 2WLQA 1UY0A 5HCAA 3U0ZA 3T1MA 1V6OA 3VL8A 3WCRA 3IWZA 4DQAA 1XBFA 4YW6A 3WP3A 3BIEA 4LUKA 2RG4A 4QT6A 1YI9A 3LKJA 1EY2A 1W0PA 1LHOA 1ULPA 4D94A 3POJA 3D4KA 1REEA 4LKSA 1W6PA 2IXCA 3A21A 4M3CA 1ENQA 4DUWA 2AUYA 1PVC1 5T55A 2Z69A 1OKQA 4DPNA 4XUNA 5A3UA 1LHUA 2VG9A 4XFBA 5EZWA 1OQDA 4XFGA 2GU9A 4IEYA 3WQ7A 4QPIB 4UFHA 3P3PA 5C71A 1R1A1 2ZGUA 5GLWA 2FDGA 3I2JA 1BYHA 2HYXA 3IMNA 3HBZA 4BM8A 5KR7A 4MV2A 1BMV2 1VP6A 3WP5A 2XXZA 4FPJA 4GMP0 3VHNA 2NQYA 3ES1A 1K45A 1CX1A 4YVSB 1S0GA 2XVGA 1SLAA 2QQIA 5L7OB 2WBKA 5F3IA 3KQ4B 2D3SA 2EXKA 5T5OA 4QX7A 1A3KA 1UZYA 1MS8A 2MEV3 4OZOA 5D8AC 5K0UB 3AKQA 3DEMA 2BDRA 3WNPA 3N35A 4YZ2A 5C8CC 3OD0A 2BVVA 1JZ4A 1HXS1 4I09A 4LE3A 2GH2A 2YGLA 5FK8A 2A70A 1FPN2 3EHKA 3I49A 1NZCA 5IWFA 5LY2A 5FUPA 2Z4FA 3CJIC 2QQVA 3J7LA 4N7IA 4Q4X1 2BBAA 1OI6A 2YV8A 3O1VA 3D6EA 1EYBA 1H9WA 3O1SA 1CAXA 4ASMB 4B29A 1F31A 3HWJA 1VBC2 4XJ8A 2IVJA 2RDSA 2YFUA 2YFZA 2VZUA 2B45X 3NW4A 4Q2FA 2R063 4CTEA 4EN8B 5KHHA 4I3GA 3HNMA 2ENRA 5CZKA 3SHRA 1GOHA 1RL3A 2VU9A 3O14A 4Y20B 4FPFA 4YPJA 1UU4A 4M0HA 5FZ3A 5CFDC 3RSJA 2K0GA 1VRH2 4IE7A 1GV9A 3CIHA 3MO4A 4FPCA 3O1RA 2ZX2A 1G9AA 4URAA 1G6NA 2P3JA 4WM8C 4J25A 4XZUG 5BNNC 4H7LA 3BN6A 2DYCA 4DOUA 3W5NA 5CADA 1GP4A 1RUE2 4AI3A 1LTEA 1SBEA 1FV3A 2JB8A 3ZYFA 1QJX3 4GD4A 1BVP1 3HJRA 1GYKA 1N1TA 4EZ4A 2PHRA 5FWEA 1COV2 4K6BA 2KM2A 5BXXA 1S0BA 2B7YA 2BGCA 4Y22B 2SLIA 3UNPA 5L9VA 4CU8A 2CSGA 2RS33 3FHQA 5AVAA 4AZZA 1H6XA 4CCNA 5LEKA 3IDEA 2C24A 2DVGA 1W3VA 4M4RA 4X6QB 3ETQA 2NP0A 1PK6A 4CZSA 1ZNPA 3MLLA 3N3HA 5J7MA 1NYWA 2PELA 5LB6A 1XJAA 2DVFA 2JIJA 4I3PA 5FP8A 2ZGPA 1SHWB 4RHV2 1UU5A 4GAZA 3ZMNA 4HVOA 4A6OA 4B1MA 1BQPA 1AJKA 3LB9A 2E7QA 4AI0A 3TEYA 3SC7X 1UU6A 2VZTA 5HBAA 1OQ1A 4DMIA 5FZCA 5FZEA 1UD1A 5BYNA 2FMDA 3EMRA 3VUOA 1BZWA 4AI1A 3TNQA 1VBC3 4LO5B 5J1XA 2IXHA 2FDKA 1XB9A 2EIGA 3IDBB 1W0NA 1YIFA 2Q1ZB 5IK8A 1Y4WA 4CDXB 3WLUA 2DCTA 4PLOA 1ULFA 1V0AA 1QOTA 2Y64A 4KU7A 1WCSA 1BCXA 2A3YA 4AVSA 3IN9A 1VRH3 2EICA 5A3NA 5KHGA 2P6HA 4ZKTB 1FT9A 2WNVA 1VAKA 3JQXA 4QPGA 4GZ9A 5K7PA 1QXJA 1G9BA 2WFF2 1UQXA 1IKQA 4PBOA 4CU7A 1VMHA 2QZ3A 3VBRA 3B00A 3RVHA 1RXFA 4IESA 3TOJA 1S1AA 1QJY1 4OHXA 3RZLA 2R32A 2VOXA 4CXXA 1PGSA 1KFUL 4WVZA 4LT5A 2ARAA 3RGBA 4Y4RA 1D2SA 1O7FA 1IG3A 5DPNA 1AXZA 3HIFA 4CEYB 1UY2A 4AE2A 2E9QA 4Q0UA 1W8FA 1PMJX 4S2FA 5C9AB 1Q5OA 2WFPA 5DAQA 4CP2A 2RDQA 1M4WA 1J84A 5JOXA 4QQPA 2R1BA 1IGOA 5I0RA 2DDUA 3QH7A 5LWBA 1R081 1S55A 4WM7C 4QU1A 2HWE3 3DYMA 2JEMA 1Y7BA 5E89A 4OHZA 1XE0A 4O61A 2P4EA 4NIAA 3VD9A 1TEIA 4JGYA 1IG0A 1QXPA 4Y1ZA 3S6PA 1OMIA 4UFJA 1F15A 4FP2A 4ZXEA 1A8MA 1SPPB 2Q30A 3GCWA 4E4DX 2FMYA 1RUI2 1LAJA 4IETA 2RJLA 4NRMA 4NPMA 3ZFGC 4DEVA 1FOD2 1UN1A 3C7HA 3ACIA 3BIWE 1W6NB 1AX1A 3ZXDA 1LRHA 1POV1 5IK7A 2YYOA 2WNUA 4F3JA 2GALA 5EXOA 5A7NA 1IS6A 1GOGA 1OA3A 1HKDA 3B9CA 3L2YA 1P8JA 4WVMB 4OMDA 3WF1A 3I54A 4LBMA 1Y3TA 3KT7A 4JTOA 1JN2P 2C6SA 4F83A 3ZYIB 1ASJ1 2VTXJ 4LHSA 4D6QA 2VUAA 2PXJA 3LDBA 3KLSA 1ZBA2 4LORA 2PAEA 3ZSEA 1JUIA 3ZFFB 3WD5A 1C5HA 5A6ZA 4XCBA 2QKDA 3BOPA 4ZONA 1DQ1A 2GMPA 1YHFA 1BKZA 1CX4A 1OXCA 1XNKA 1OH4A 2BYVE 2KR2A 3MEPA 3D8CA 1PGW2 4XC9A 2GMMA 3ZSJA 2WZR3 1RC6A 1OFSA 2G9GA 3M3QA 3UK9A 1KS4A 4HXCA 1PVXA 1WMDA 3LA2A 5JR7B 3WF4A 4MX3A 2BERA 2JJ6A 1YLLA 4NHMA 1MPXA 2Z42A 1W6QA 4QHZA 1V6LA 3ZSLA 1GQGA 5E8AA 2WZPP 4AQSA 5EQUA 3E5QA 2XJPA 1RUF1 1G7YA 1DGRN 4G4FA 4M01A 3ZXGA 1PIV2 5KC5A 5F5IA 5FY5A 3AP9A 4X6RB 5D8AA 1SLTA 2LS6A 3O12A 4BK4A 1JHNA 1AR93 3NMBA 4BE3A 2DU0A 5IK5A 2WKKA 2IUWA 3IB3A 4IEQA 2VBDA 1RUI3 2RS12 3MIBA 3PJQA 5C8CA 3KGZA 3FE5A 3P3NA 1A34A 4X8NA 2WJSA 4E2GA 4AVBA 2OPWA 3SH3A 3H8XA 1SEFA 4HETA 1H2NA 2E33A 2JDZA 3CJIA 4OQ8A 3AKPA 4MHRA 3KCCA 2HEYF 3OYWB 3B01A 5FY4A 4L8QA 5F5QA 5L9RA 4G3YC 4BYYA 1JOPA 4XABA 4HFSA 5JI9A 3PL0A 3WW3A 5B4XA 2WIIB 3VKMA 4P5HA 4WZCA 5FXXA 3RI8A 3I8TA 5FPAA 1EV11 2HH9A 3O0XA 4XEZA 2EVXA 3PUIA 5CFDA 2GP3A 1UXZA 2E51A 2P3KA 2B9UA 5FZ7A 5DG2A 1QJU2 3FZ3A 5EV7A 4ZU5A 4BMEA 2VZ3A 3T30A 4BQXA 4DXZA 3PLQA 3KQRA 3GM8A 1ZRRA 2I74A 4WM8A 2LTNA 3B93A 5BNNA 3SCFA 2ZAHA 3AP7A 5DAPA 4OQ9A 2YPDA 3T1LA 2ZABA 5F3GA 3N9MA 4ZS3A 1GBGA 4A3XA 3W9AA 1SLLA 3SLIA 1ZZCA 3AZVA 3OUHA 2ZEXA 2W92A 3VDAA 3PVEA 1YXWA 3PVOA 1WKYA 1YQ6A 1CJPA 2XKPA 1PMIA 1AYN3 2PHXA 1OVPA 4UW4A 2RS53 1Y9GA 4OUSA 1QQP1 4LBOA 3OUIA 3RNSA 3EB7A 4NJ4A 3LEGA 3UGHA 1UMHA 3WG1A 1V00A 1W9SA 2JDHA 4K3UA 1YQ8A 3ZO0B 2YMZA 1HB2A 3KB5A 4OFGA 5C70A 3AYDA 4GKXA 4PT6A 5FDBA 2D6PA 3AXEA 1GU3A 4R52A 3WNXA 4ASKA 3SCHA 3WQBA 4JHTA 4HKLA 2XLAA 3HT1A 4K1ZA 4OHWA 4Z2AA 2ZHLA 2TBVA 3IPVA 4D7TA 2GC2A 4QDRA 1DFQA 4K40A 2HWD2 1UL9A 2VTXA 2VMFA 2P3YA 3LOIA 3ZIXA 5BNPB 1ZBE3 3ACGA 4LLFA 3ZN6B 3RMYA 3ALQA 2QQJA 5FWJA 1QJU3 1W6MA 3NV1A 3WNKA 2VZQA 3EYPA 3H8UA 4QPWA 4Y26A 4LEJA 4B8EA 5FYVA 4YM2A 4COYA 4PIYA 2PA7A 4UAPA 3VBUB 3BU0A 4MHUA 5FYYA 2X8KA 3E6BA 5H9RA 4CDWB 4EJRA 3TEWA 2V4VA 3RI9A 2CWSA 2Y6KA 4E27A 5A6YA 5IVFA 1NY72 4FFFA 3UETA 3KF3A 4FXGB 3VBHC 3D5OA 4GMP3 3KS7A 3PIJA 3O1UA 1TG7A 5FZOA 2WSVA 2WYFA 1QY4A 4CA9A 5DDJ1 4Q4V2 3AZWA 4ZXKA 3ZPOA 3RWNA 3MIGA 4DY3A 3ITQA 4LO6B 3ZMOA 4FBFA 3KVAA 3AC0A 4QWNA 5FZLA 3K3NA 3I3BA 4V2WA 3WY6A 4C0BA 1QMJA 1RTVA 2HKXA 3A23A 1PGL2 3JB8A 4QGNA 3RYPA 3ZLIA 1OA4A 2WS92 2OIIA 2ZX1A 4WM7A 3AX4A 2GNTA 4XILA 3RYKA 5CIRA 1MS4A 2YC4A 4BA6A 2UWBA 2R49A 3PVBB 4M0NA 2XJSA 5C8WA 4GQ7A 3PUHA 4IE6A 4YVWB 1NQDA 1ZZ7A 2HWD3 2XWJB 2V5DA 3VL9A 3GZTB 1XNDA 4QGLA 3ZFGA 1WA6X 4YGBA 5IJRA 3K77A 1O4TA 2ZMLA 4BH9A 5CBLA 2H6CA 1HIXA 2CTVA 2XL9A 4XJUA 5SV8A 3VBFB 4AGRA 1CPMA 2EXHA 1RUJ2 2GZWA 1FNYA 1C28A 2XJRA 4Q4Y3 2VMIA 4QHBA 4CCMA 5FPBA 1W05A 2OUJA 4CYDA 1HW5A 4RFRB 3FLRA 4DB5A 5C5UA 3V0BA 4Y33A 3ACFA 3OBRA 1VJ2A 2JDAA 4JAAA 5JOWA 3AKTA 2B39A 2JKBA 5JIUA 2HWB1 3SEEA 1DIWA 1AYM2 1GZTA 1QNWA 5LK5A 3ZIWA 3M70A 5JLVA 1OSGA 2D43A 2VOWA 1TMF2 3OEBA 4KBBA 5JOZA 1NCQC 2RE9A 4A4AA 5L36A 3ZYGA 2RDNA 4LE4A 1M06G 3HN3A 5I0DA 1LR5A 5A1LA 4C91A 5DN2A 2W1SA 1IPKA 3QBQA 4K9SA 2I2SA 3KV4A 4QKBA 1SACA 2F17A 2YGMA 5F5CA 1MEC1 4MXWA 1LHNA 1F8VA 1C4RA 4NRQA 4RA0A 1ZA7A 4B3NA 1ND3B 1NXD1 4W8JA 5FY9A 3ZXKA 4FT8A 2XUMA 1YUDA 3I2IA 3JCIA 4IE0A 2XONA 2ZZQA 5A33B 4HN0A 5F37A 2VOTA 3N9LA 2BBVA 2DUQA 3DF0A 1H0BA 4K1YA 3ZM8A 3J7NA 1IS3A 1HRV2 4XF9A 5GZEA 1TNRA 4AFDA 4FTBA 5J96B 1BEV2 3BTAA 3TAYA 4RD7A 2BNMA 1W6PB 2EALA 2WYSA 3F2ZA 3Q8BA 3ZYPA 4EE2A 1BVVA 5JAXA 5CU1A 3ZSKA 2HWC2 1YFYA 2VCAA 1HQWA 1RMU3 2FCTA 3HQXA 4EYUA 2IXKA 1W03A 2XVLA 2GC1A 3DUIA 1RUJ3 5JXGA 1EAH2 2J1TA 4XW3A 2ZJCA 2XWBB 4CCOA 2ATFA 3DPRC 3DN7A 3X29B 2QQOA 3H1WA 4A3ZA 2W0XA 1S0DA 3R0RA 4AHZA 3THCA 1AYM3 2WT2A 5AC91 3JD72 3C7EA 1XU2A 4MGSA 3ZOIA 4CCLA 4DEQA 4KWLA 3L2HA 1J3QA 4SBVA 4U36A 2CYFA 4CPBA 4QDQA 1MR5A 2YZ4A 4LO7A 3KV9A 1DCSA 2VQUA 1K5MC 5FYZA 1AX0A 1XU1A 1RUH1 4AGGA 4UFLA 3C2UA 1H8VA 4RR3C 3USUA 4EWEA 3TN91 1QXRA 3IT8A 1ZX5A 4UBGA 1MS9A 3A0NA 4JQTA 1FMD1 2JENA 4XFCA 1XNTA 2VMDA 5IVVA 2D6NA 2R0HA 1IS4A 3PTYA 5CAZA 2ZOEB 2EIDA 1J3PA 2YROA 3K4DA 2XBO1 2BW8A 2W87A 4WVVA 1VBD1 1LOCA 2ZHNA 3VDCA 4ONUA 5C3QA 2F4PA 2V73A 1BEV3 4JV4A 5LA9A 4COWA 5JSRA 1PVC2 4LTAA 4OULA 1RHI1 5KHJA 4B7KA 3JZVA 1VIWB 1IQDC 2Y34A 4KGGA 4V1PA 3JU9A 5J09A 4FSJA 4WVWA 1UYPA 3HOBA 4JQRA 4OI2A 4PIZA 4ASLA 1VB2A 4BCUA 2A6YA 4BJ0A 1EAH3 3RJRA 2BNNA 1R1A2 2PQQA 2VQAA 1GZWA 4FXKB 3GGLA 2W9XA 1AXYA 4C1WA 3POSA 1XNCA 3PU3A 4D69A 3A7QA 1EPWA 3GF6A 1V9U1 1NQJA 1W8OA 3Q8FA 4FFIA 1FNZA 3JD73 4M3CE 4YG6A 5FFOC 1XNBA 5FYIA 1DGLA 2Y38A 1AXKA 1WBFA 4P00B 3FFQA 1OVSA 4MGQA 5FAXA 3VD3A 1DLCA 1V6JA 3T2QA 1UKRA 1DQ6A 2X10A 3ORJA 2AEYA 3VBSC 4C1XA 5FCCA 4QQHA 4HONA 3BU7A 1OC1A 3WUDA 5GZGA 5FMOS 2W52A 1VBB3 2F6BA 2JE8A 1DQ2A 4Y5TA 3HPNA 2CDPA 1PK6B 4A6SA 1VAMA 1WCDJ 4XJAA 1H2MA 2DF7A 1B09A 1Y43B 2XHNA 5CKQA 4CCKA 4IW3A 1AR83 1MQTC 4KGQA 5C3SA 1DHKB 2P6CA 2BUKA 2YPJA 3MW2A 3U10A 1G9DA 5C6CA 4Q4W3 3WZ1A 1AL23 5JXHA 1SFPA 1JBCA 3MW4A 1W90A 3IM0A 3TYJA 2Y6GA 5JI7A 1VBE3 5FO8B 1UNBA 5A7PA 4QX8A 4AEJA 1GQHA 1UO9A 4QM8A 3S30A 1HDKA 1I5ZA 1W99A 1LU2A 4X8PA 3KMHA 2O8OA 3QCWA 4UYBA 3WT3A 5FZ9A 1HJFA 4HK8A 4L9BA 1K3IA 1TNFA 2Y6FA 4IL7A 2CAUA 4MGYE 3VBOB 4P14A 3RPQA 4JGZC 2W39A 3PVNA 3FJSA 1R1A3 1KS5A 1JYWA 2HWF1 5LATA 1R64A 5A3MA 1XYOA 4H7MA 3I7DA 4QPGB 1Z7S1 4JKMA 3EO6A 5FP7A 2PFWA 2ZGRA 5J37A 3VBRB 1LGBA 2D3PA 1VPHA 3KF5A 5T52A 2EF6A 1WLWA 4FQZA 1RINA 4C8DA 1NLRA 2YDEA 3OGGA 1RJ7A 4LBNA 3N7LA 4TN7A 1W9WA 1CAUA 2LROA 2GNDA 5FPVA 5LBBA 4CDQB 5IVYA 3POBA 2IVIB 1DDLA 3PDQA 5FP4A 5IAXA 4Y1UA 1N1SA 2WUHA 4H14A 1CWPA 3AP5A 2A3WA 1WCKA 1CPNA 4JRAA 2O14A 5EJ3A 3J8F1 4FOQA 4EQVA 2D3RA 2QQMA 2CGNA 3E1F1 3FX3A 2PAMA 4YYOA 4NIDA 3U37A 5FXVA 2VCBA 2ZX3A 3S7EA 5FMOL 1NA1B 1UPIA 3HQRA 5E1RA 3J26N 1SZBA 3QH6A 4UXAA 1FYUA 3OF1A 2OZ6A 1NCQA 2WINB 5A1FA 1RYYA 3K2OA 1GP5A 4JGYB 4RQPC 2O0OA 2OYZA 4FFGA 2OVUA 2JE9A 2JG8A 4FPYA 1QJZA 3IIIA 4R9AA 4ZZ8A 3LDKA 3WDVA 4CPBD 2WDBA 4N43B 5I0UA 4JKLA 2R0FA 2G9FA 1T6BX 5A3WA 5A3OA 2WNUB 5FY0A 3ZR6A 1RUG1 2XJTA 3RQ0A 2P34A 4DXTA 4HL0A 3AMMA 3MZHA 4GALA 3S7IA 4Z1VA 3LA7A 1J59A 4KG0A 1SLBA 3B7MA 5J98B 1RUD1 4AG4A 4DY5A 4QU2A 3VKOA 2JDKA 1LODA 1W2AX 3H42B 1QJY2 1C8M3 3SXWA 1VBA3 4FPOB 1EPZA 1N3PA 4GXLA 2DURA 3LCPA 1KDKA 2ZGSA 1CGPA 3N7JA 4R9BA 1AR71 4QQ2A 1U5YA 2Y6LA 3RRDA 1QOOA 2D40A 2DBIA 4D0QA 4HMZA 4QPIC 3FUQA 4XIOA 4LOTA 3UESA 1EP0A 3DPRA 1Q8PA 3I59B 4S2DA 5KWRA 4TWTA 1VMJA 1W8TA 1PX4A 1R082 4LITA 4BMBA 1PO11 2HBTA 1XE7A 2J42A 3A4UA 4Z82A 4TSVA 3KWVA 2VUJA 4DS0A 3GBGA 3GZAA 2X09A 1D2QA 2OZJA 2RJ2A 1ZYBA 3RWKX 4BQ4A 1UKGA 2WWUA 3O1PA 1K5MA 4XBNA 4XYXA 2X53S 1YYNA 2J1UA 1UWWA 4KL1A 4KH9A 4RR3A 3PMSA 1C3HA 3CNAA 4YGEA 1F5FA 2JDPA 1J58A 1IOAA 1POQA 3BODA 3FLTA 1LECA 3CJIB 2K9ZA 2VR4A 3OPZA 3KM5A 5A7WA 1O6UA 5FY1A 5DAVA 1ASJ2 2YBSA 3OGRA 4AVCA 3CO2A 2Q5TA 2WWJA 3ENRA 2X5IC 4KQ7A 4QKDA 1LU1A 4URTA 5FREA 2W1WA 3SITA 3MFAA 3I3EA 4GH4A 3QACA 3ZXAC 2XL7A 4QMAA 3AKSA 3S0MA 5IFTA 2WO1A 1JXNA 1OPOA 2G4IA 4NWWA 1Q56A 2W46A 1L3JA 1CAWB 1SDWA 4NR1A 2R041 1HQNA 3LPFA 3KCXA 1CAVA 4UFIA 2EAAA 4BHPA 1UOFA 3V0AB 4HSLA 4JTNA 3I2FA 4DZGA 3AMPA 2FCUA 5F6KA 3WW1A 1RUF2 1MS1A 3WG4A 3A22A 4BIFA 1LOEA 5JPNB 2AYHA 4D7YA 4YM3A 1E5HA 3RDIA 2BFUS 4IGPA 4ARYA 3ZYRA 1JYTA 1FPN3 1DG6A 3VBSA 4E8DA 1RUOA 5T50A 1JODA 1GWLA 5F7UA 4KMQA 3D82A 3NV2A 4BQ1A 2Y33A 1TE1B 4MADA 4AK3A 2ZEZA 3U1XA 3B9IA 3PUQA 4BZ4A 4RS5A 3URFA 3VHPA 2AC1A 1MQTA 2QJVA 2KD7A 5JSOA 2BV4A 1DYKA 3C8XA 5JOYA 3NKTA 2J1EA 3O1MA 4A7KA 5T5JA 4FPGA 1ASJ3 1QIQA 3GHNA 3IPVB 4YM0A 3J9SA 3MV11 1MS0A 2C9AA 2PHLA 3E5UA 5KBFA 4HPKA 1JTZX 4AWDA 2EIEA 1EV12 3KV5A 3ECQA 3RG0A 3ZKUA 1LCLA 4IEVA 5I8YA 2E31A 3JBG1 5GALA 3RMXA 5EIYB 4ORFA 3U11A 2LRPA 1YFUA 3J7HA 3ZN6A 1RUE3 1OLMA 1W6MB 4JGZA 3I2HA 2VZPA 3HNBM 4NPRA 3NQHA 3VN4A 4EN6B 4FPKA 5G04L 2P17A 2FQPA 4CDUB 4LKFA 4CRQA 3MHZA 5CVRA 5DUUA 1COV3 2WO3A 1O59A 1W2TA 2BNOA 4XQ4A 1RUF3 1W06A 3R05A 2O8QA 1CN1A 4HSJA 1UMIA 2EA7A 2ET1A 3WHTA 4XETA 5GLUA 3VZLA 1DF0A 2DVDA 3ZX7A 2R061 4OUMA 5T5LA 2PHWA 4IV1B 3U4XA 1QQP2 4CU9A 2NN8A 4BQ2A 1BK0A 4RHV3 2A73B 1UY1A 3IDCB 5KXCA 1LULA 4QDSA 5C9AC 3WF3A 4RN5A 2BFUL 5FIXA 5GLVA 3FL7A 4EZHA 1VAVA 2YU2A 1UPSA 4N9HA 2JDYA 3Q8EA 3UKTA 4CP1A 1BMV1 2A6XA 3VHRA 2TEPA 2QVSB 5A32A 2VMCA 4PF1A 5C5TA 1TME2 1REFA 1Q8VA 1QJX1 1O3QA 4RQPA 5ANQA 1W8NA 3FC0A 2RMU1 2G1MA 1YO8A 5C4WB 3AYAA 2ZZJA 2JDMA 3UKNA 3M7AA 4PF5A 2D5HA 5FZ6A 3ZFGB 2RS31 4I02A 5CKNA 1EV13 1Y9QA 2WLPA 1QNYA 3H3ZA 1GZ9A 1OQEA 1GNYA 1O5UA 2WFF3 4XFIA 2P37A 1LOGA 1UOJA 4XQDA 5LRRA 4Q8KA 4W4ZA 3USSA 3T2PA 1OD3A 5BUVA 4BB3A 3H50A 3NO8A 1WA4A 3GJBA 1W8WA 2DTWA 2VMHA 5IHRA 1U5XA 1ZRIA 3T3YA 4BXFA 1O4YA 5HV0A 4P5YA 2UWAA 4LLOA 4XMAA 5GM0A 3SQOA 4XF3A 4CUBA 2RV9A 4LHNA 4XUPA 2VQTA 1YJKA 1A78A 4AHXA 3C7OA 1KRIA 1ULCA 4AEKA 1S0CA 3ZXLA 2EXIA 3W20A 4WBBA 3GBWA 5DDJ2 2GAUA 1W9YA 5FY8A 4FFHA 4HG6B 3ILFA 3ZXJA 2MNGA 5DUWA 4Q0QA 4L11A 1JH5A 3GCXA 3MFCA 3K48A 4QPIA 2YHJA 1HB1A 5KC6A 5LA0A 2P5BA 3HQUA 4N7UA 1ZZ8A 3AYCA 2VZRA 1VLNA 1YIPA 2LUWA 3IKWA 3O0WA 4A7ZA 5HV4A 2FD8A 1WZXA 3AMHA 2A71A 2PQSA 3A0KA 3CDZB 3H0OA 1RUC1 3PNAA 4FAHA 1TME3 3OY8A 3W58A 1FOD3 5D21A 2ORZA 1C1FA 3OG2A 3N9QA 4DUVA 4ZZ5A 1WMEA 2AGSA 2VO5A 3H3LA 4I0AA 3BVCA 5FXWA 4D6RA 4LPLA 5A70A 5IVJA 3LA3A 2OXBA 4IE5A 3ST7A 1HLCA 4QX5A 2BU9A 1UZVA 3LIGA 5IFPA 3BI3A 5CB7A 1NLQA 2VZSA 5F3CA 5J3UA 2OQ7A 3OGVA 4BLIA 1U0AA 4IGOA 1VRBA 1ZBA3 3H7YA 2HEVF 5FBJA 2J7MA 4XBLA 3B02A 5J48A 1QDCA 2HWE1 3CLPA 1E5RA 2WAOA 3WP4A 5AFEA 5JZGC 3AM2A 2VBPA 1WGPA 2VH9A 3VZMA 3AJYA 2X5IA 1HV0A 2LM3A 1IPSA 3CZUA 4IV3B 5K4LA 2WNOA 1O3RA 1U5ZA 2JECA 1UZWA 2W47A 3INAA 5A7OA 3T0AA 4Y5Z0 2ETEA 4MUVA 5FMBA 4UW3A 5FZHA 5I0TA 3T09A 4S2GA 2RM21 2BEOA 4NROA 1X9TA 3GJAA 4Y20A 5IT6A 3OEAA 4SLIA 5FMDA 3T2TA 3DCQA 1MEC2 4BK5A 5ABJC 2WT1A 1X33A 3USUB 4LMFA 4AQ6A 3M3IA 1KITA 1PIV3 4HZFA 2VW0A 3AFGA 3WNNA 2CHHA 2UYBA 3VD5A 5FBZA 3R6SA 5FZ4A 3LOBA 5CEHA 2VECA 2Q8OA 1DGWA 3ZPYA 2RS13 4RGGA 1OD5A 3T0BA 5M0TA 2XH6A 3THTA 1VB4A 1EUUA 1KFXL 1I6XA 1H9PA 1S2BA 3H9AA 3MW3A 1MACA 4YLZA 4KBZA 2VGDA 4RGKA 4XTMA 5JUVA 1N1YA 4Y22A 3MPPG 3NWKA 1ZM1A 5GKAC 1PZ7A 4E2QA 2QDRA 2WZR1 5EFUA 3SISA 4UF0B 2Q0AA 3D0SA 4DINB 5F5AA 4N53B 2BOJA 2ZXQA 4QB6A 1JZ8A 1PX3A 1C8NA 4AI9A 1JUHA 3L9JT 1GR3A 2PYTA 1TQ5A 1GZWB 3CMGA 1CJDA 3ES4A 4K7JA 4XZPA 4NIIA 3WDYA 4AW7A 2QCSB 5T3NA 2VNGA 1SCSA 1L7QA 2ZCWA 4PJYA 1OOPB 1KQRA 3KHBA 3APBA 3LIHA 3B5LB 4ES9A 5AC92 5LA2A 1ZRCA 2VCCA 4JRLA 4CEWB 2C1FA 5DG1A 1AR91 5CFCB 1T6GC 4LIVA 4FP3A 5DABA 5LK7B 1NZIA 2Z79A 1XNAA 3NJVA 2R071 4XPVA 4EN7B 3GNEA 4UFMA 4CCEA 2RR12 1RUH2 2AR6A 2OPKA 3HMYA 1UAIA 5LZ6A 4RL7A 4HKWA 3K3OA 4XBQA 5FYCA 2VULA 1VE0A 2ZHKA 4P9LA 3TN92 5BNQA 1IQAA 3CEWA 3AXDA 2W1QA 3OB8A 1QHDA 3NJZA 5FZAA 1US2A 2GC0A 3LFMA 1QJEA 2J1SA 3VKNA 1XSRA 4HN1A 2VUCA 3VBUC 2QQNA 3J4UH 5FYSA 1FATA 4M3CF 2GNBA 4XDQA 4CDWC 4Q1RA 3P5BA 3POIA 3D0JA 3K4ZA 4QKFA 3TEZA 3IZOA 3VBHB 4COUA 4Q0PA 5FOJB 1WW4A 3FWEA 1H6YA 2VZOA 4CP0A 1WLCA 3B94A 1O8SA 4UW5A 1LOFC 2VJXA 1RHI2 5C9AA 3U4SA 1H2KA 4J6GA 5I0SA 4Z92B 3R4UA 3Q9OA 4MGKE 3JB4C 2DV9A 3VZJA 4GKYA 2B4KA 3ZN4A 1N1VA 4IEZA 1JZ3A 1RIRA 4MYEA 5ANNA 1ACCA 3M2MA 1SLIA 5JDBA 2H6BA 2AACA 1RVF1 1SG3A 4NMIA 2K2SA 2PHFA 3T4HB 2VAUA 5AC93 1V9U2 5FZ8A 1O91A 2QQUA 3MUZ1 2QQPA 4YVWC 1AYN1 3CU7A 4FOVA 4OUEA 2RS51 1BXHA 1N3QA 2JG9C 4XHBA 2OQ6A 3R4DB 2A1XA 4OZXA 2Q8DA 4AFAA 1W2OA 1UF2C 5SV5A 4EWDA 1W6NA 4EN9B 1CAUB 2RR13 1GMMA 1H8TC 3SCGA 4GWJA 2WQZC 3ACLA 5AFBA 3OOXA 1G86A 2GNMA 2VTFA 4YW4A 3UJOA 1WW6A 1XYPA 2CGOA 3BTXA 4IDZA 2ARCA 4LK6A 5FUIA 3SKVA 5DMYA 2E32A 5F2SA 1POV0 1LOBA 2JG8C 4KG8A 5DZFA 1JZ7A 3NSTA 5FP9A 2A75A 4Q4V3 4LKEA 4Q8LA 1JYVA 4ZS2A 4B7EA 2VE1A 1NCQB 1A6CA 1UW8A 2QZ2A 2Y60A 2VVDA 3OBTA 5FKCA 2ZGOA 1ZRDA 1ZBE1 1GNZA 3HAGA 2RJKA 4FVVA 4EWAA 5F6LB 2WS93 4AOCA 4BQ3A 2BGOA 5LEJA 3AZYA 1GNHA 3N4MA 5HI0A 2P3IA 4TXWA 1X8EA 3PMEA 3SMHA 3KT4A 1ND3C 1BBT1 3MLJA 1YFWA 3MIDA 5KHIA 2WABA 4M3CB 2ZA9A 1OLQA 2DWRA 2HWF2 2NPIA 3LF7A 5AVPA 2W68A 4NOTA 4P9JA 5T54A 3BKZA 1Z7S2 3NNFA 1URXA 4NHLA 4KWUA 4E8CA 4LR4A 5JCTA 2YG0A 3MUY1 1XYNA 4GMP1 1BLZA 1CZTA 1MZ5A 4FOYA 2FZ1A 4A45A 1RJ8A 4BQYA 2CWMA 1C1LA 3HR9A 4XCAA 4QX3A 4LJHA 4BPZA 1RXGA 4Q5OA 4I30A 4NE9A 4LK7A 3UL2A 2FDJA 5F3EA 3T0DA 1IKPA 4EROA 3GDBA 1TMF3 1JHJA 4YW7A 2QQWA 1UCXA 5JZGA 3J8F2 1GP6A 3VLBB 2RHPA 2D93A 1XE8A 4RSUA 4XUTA 5FZMA 4GJZA 3VZKA 4PDWC 3RYRA 2GDFA 3G6JB 1YRZA 2BQPA 2X05A 5FTTC 2ZEWA 1QU0A 2VMEA 1GFF2 1ONAA 4Y3OA 5FPZA 2C4XA 1LHWA 3GYDA 2IXIA 5FKBA 5I8TA 3M3CA 2WO2A 3Q8AA 4Q4Y1 5ABJA 2PLV1 4Y1XA 4V2VA 2WC2A 2W95A 5FPUA 1CAXB 3POEA 5I91A 1OKOA 1HRV3 1H2LA 2BJSA 2XKOA 4GH4C 2ZKNA 2ORXA 2CY6A 3ZXFA 5A7WB 4AEDC 2HWF3 2VUDA 3KD4A 4LHLA 1Z0HA 1OURA 2BGPA 1RUD2 4JDNA 2CDOA 2VVEA 1I5PA 4BQWA 2HWC3 2PAKA 4QB2A 4AEMA 1DQ4A 5K9YA 1FV2A 1ENRA 4IXLA 3ZFEC 1HB4A 4GJYA 1UIJA 4NN0A 1ST8A 2ADDA 3VDDC 3THDA 3I97A 1OHFA 4L2NA 4LQRA 1UX6A 4H3WA 4BLJA 3MLKA 5CA6A 4YSFA 3NAPC 1GWKA 2E53A 3EBRA 5JSPA 2FDFA 3WDXA 3HEIA 3O0VA 3OSDA 3NNMA 2B46X 3MGUA 3NVCA 1LNSA 2WR9A 5H9QA 3DXUA 1AZDA 1DYPA 4YARA 4MGZE 2PN5A 5KXDA 4CCDA 1VR3A 3T08A 1PO12 4AI8A 4ITCA 2ZGTA 1G9FA 2KA3A 3WNOA 3PUAA 3MF9A 4MO3M 5EYXA 4A2UA 4FTSA 4IUGA 1HXS2 4XQWA 1ULDA 4YNIA 3I2KA 1NCRC 4E4ZA 4E4SA 4RS5C 3VBSB 4F7ZA 1RMU1 3ZXEA 5C3RA 3M8LA 3NNJA 1PMHX 3DKQA 4Q4X2 1K42A 2I45A 1RUJ1 4OCTA 2ZS6B 1S2KA 4R4ZA 3N7MA 1UOGA 2VD7A 1AR61 4IGQA 2QBXA 4B4RA 4DFSA 2ZGLA 4QXCA 2WNEA 2JICA 4QX2A 5DZGA 5BPXA 4ARXA 3BTZA 1MQTB 2WT0A 1QH7A 1ND2C 3VBUA 1GOFA 1PVC3 4CDWA 1WLTA
chains in the Genus database with same CATH topology
3WX5A 1NOVA 4XJWA 1UZZA 3FFZA 1NLSA 2B8MA 4ISRA 4WV8A 1QWRA 2TUNA 1LOFA 1J1TA 2FHRA 4HPKB 2QE3A 4NO4A 3E5XA 3E6DA 2WNVB 4IERA 4OHVA 5D1IA 5H9SA 3WDUA 5ACA1 3WOGA 3HT2A 3B69A 2R042 3VBOC 1HRI1 5DUXA 1GSLA 4YW3A 5FPXA 4OI4A 3GBFA 3VZNA 3EXUA 3WW2A 2EAKA 1PNGA 2EXJA 3H1YA 4YVWA 2A6VA 5FLIA 2MHFA 1ENSA 2JG9A 1HXS3 1ZZ9A 4FPEA 1DQ5A 3AMQA 3M3EA 2JE7A 1ZRFA 3N36A 5GZCA 4M00A 4E2SA 1H8TA 4LBKA 1WLDA 4Q4X3 4CDQC 3AB0A 3ASIA 1OFNA 1B35C 1EAH1 4XF4A 3ILRA 2UY8A 4AQTA 1ZREA 1H4GA 4LHKA 3LZZA 4L92A 2D44A 2QUOA 3UKVA 2O1QA 4INDA 3V56A 1CR7A 1MS5A 2GN3A 5A32B 1HV1A 1NA1C 1WMFA 1ZVFA 3C3VA 4IQPA 4FPHA 3ME2A 2IFRA 5BNOC 2BWAA 1W39A 5T5PA 3M1HA 2UWCA 5I8SA 4E9KA 4MVTA 3SNMA 4AF9A 1FAYA 5BV6A 4N43C 1PO21 1PZ9A 1Q8SA 4J1XA 1VBB1 1QGLA 3JBG2 3WG3A 2NZ9A 2VOVA 3AP6A 3LSDA 2DFBA 2D6MA 1ND3A 2NLRA 4NVPA 4R8HA 2R043 1AR81 5A33A 4GB31 4FAGA 5L73A 1V6KA 2ZTNA 3TBDA 4Q4W1 3N7KA 1GKBA 4GIQA 1AL21 3WV6A 3M3OA 2GN7A 4LBLA 1VBE1 2SBAA 1LKNA 2DUOA 2XB6C 3AMNA 2R062 2XGXA 1W6QB 3ATGA 3WINE 4Y4YA 4GA9A 4P9IA 4JCKA 4YVSC 1QH6A 2E7AA 5L7OC 1D4M1 3FLPA 5D8AB 4H55A 3TRSB 5GZFA 1J1LA 4AFCA 4PDWA 1XXNA 5K0UC 4HK9A 1OA2A 5C8CB 1LGCA 1QJX2 1LOAA 4N90A 3V65A 3OY8B 3VKFC 2V09A 5KXEA 1MS3A 2IZWA 5J36A 2RMU2 1H1IA 4YZ5A 1R091 2ERFA 4HKOA 2DVBA 1LEMA 3B3QE 2RS32 3I2DA 2B5HA 1F9KA 1RGSA 3H1MA 3QD6A 3JBG3 2VQ0A 4JC1A 5FQ0A 1W6OA 4Q0SA 2C5DA 3IIAA 4GWNA 1E57A 1QJY3 4PCRA 4AEDA 3FBYA 4AQ2A 2XLFA 3CL1A 4I2OA 2X5IB 5GLTA 4XE9A 3ZFEA 4TLFA 5CFDB 1MVEA 2CNAA 3POWA 3VDDA 2IFWA 1QF3A 4YG0A 4WM8B 2H0VA 3LAGA 5BNNB 3BALA 3NAPA 4B4QA 1R083 3WVJA 1V6NA 4META 4PBPA 4ISQA 3WHUA 1FI2A 4DNYA 2I07B 5FO9B 2Z2SB 1ZZ6A 5B2GB 3MPBA 2Y0IA 4PLMA 3UV9A 2ZHMA 4XFHA 2DCYA 2A6ZA 1SMVA 1RUC2 1C8M1 4YGCA 1VBA1 1X8MA 1NCRA 2DVAA 1POV3 2B42B 1IHMA 5E16A 2FZ2A 2RMU3 2HJIA 4PQ9A 1BK1A 4YW5A 1PNFA 4BIOA 2VMGA 1S0JA 3ZVXA 5H9PA 1CD3G 5L19A 4IEWA 2H0BA 3FMGA 3IBMA 1SFYA 2VW1A 1QDOA 2GH8A 1XQNA 4COZA 2PHUA 3POYA 2MEV1 3QOPA 1ND2A 4OI0A 5E88A 1WW7A 2HWE2 4XMIA 1O3TA 2NM1A 3VHOA 3WG2A 1NXMA 4A7YA 3AJZA 3WW4A 4W6WA 2AH2A 4CDXC 1CONA 4PLNA 2ILMA 4QGMA 1O4ZA 4ATFA 4Q29A 4QQLA 5EWSA 3OJBA 2YC0A 4LBQA 2RM22 4P9XA 1KD7A 1SBFA 2ZMKA 4AHWA 1AF9A 3VBOA 1I3HA 2VOKA 1WUVA 3QLQA 4GULA 3SH5A 3UJQA 1D4VB 3RZZA 3E6CC 4CDUC 1W0OA 3CJXA 5FO7B 4P9WA 4CEYC 1QOSA 4R4XA 4RGAA 5FLHA 1SCRA 1DBNA 1RUC3 2WWSA 2Y26A 5EYYA 1D0HA 4L97A 4JVAA 4IV1C 4WM7B 4CDQA 2DUPA 2WZR2 1B35A 3DV8A 2FBEA 5HCFA 2W08A 4S2HA 3AZXA 2XVKA 3NV4A 4MGIE 3KCYA 2UURA 1NA1A 1DZRA 1DGWX 1LEDA 2XG3A 4YW2A 5BNOA 1LB2A 2VY0A 1FPN1 2OA2A 4K20A 1AR92 2ZGNA 2X29A 1MZ6A 1X50A 2A6WA 4XTPA 5C4WC 4YRDA 3V0BB 4AXOA 1WW5A 3NV3A 4N43A 2R072 4RFT0 3U07A 2RM23 1S0EA 2AENA 2E63A 2XLGA 3H3UA 4AYUA 1VBC1 3ZFFC 3MI8A 4XHXA 3ZN5A 1AUYA 4QM9A 4JDMA 4ATEA 4P9YA 1AVBA 5JVVA 2GC3A 1QQP3 1V70A 1MVQA 4EN0A 4QQOA 5DUVA 3THPA 1VRH1 3SH4A 4MXWB 2VPVA 4YZ1A 2WL1A 4QPYA 1MZFA 4LO4B 4JDOA 2Z5WA 3LWCA 4Y1YA 3E97A 4YFZA 2ARXA 1RUE1 4YVSA 2CAVA 1G9CA 3WQ1A 5L7OA 2Q1MA 5F9TA 5JWPA 1JYIA 3I59A 1SBDA 1YI7A 1CIWA 5K0UA 2QDNA 1WD4A 1COV1 1DZTA 4EV0A 2WQ4A 5GZDA 2IC1A 1RVF2 1MZEA 2A7AA 4LNVA 1UMZA 4XXPA 3MIEA 1AYN2 2RS52 2BTVC 3H7JA 3WP6A 1IZ3A 1CQ9A 3DKWA 1RITA 1XRUA 3ZSMA 4RHV1 4PIXA 4W65A 1N47A 3WQ0A 5KXBA 1GANA 2R073 2HWB2 5FLJA 2JD4A 4O9EA 5JMCA 1Z78A 4XF1A 2QFEA 4DRVA 5JZGB 2UU8A 2NMNA 3DL3A 4XJZA 4IV3C 1I9RA 2VNOA 1KDMA 1KJRA 2ZAAA 3FUOA 4Q27A 3AFKA 5DDJ3 4YFWA 4AFBA 2ZMNA 4I0BA 4LO8A 4AHYA 3KSCA 1ZBE2 1V6IA 2YXSA 4XXAA 3TB0A 1CAWA 2WFF1 4K8FA 4FOWA 5ABJB 4IEXA 3G7DA 1JOJA 4LBQD 2ZACA 1HQLA 3AYEA 4C0HA 2CL2A 2JXAA 3OTFA 3EQEA 3V0AA 1BBT2 2D6KA 4KWKA 1Q8OA 5IUQA 1Q8QA 1RVF3 2DTYA 3MIHA 2VW2A 1RB8G 1N3OA 4WZFA 2OUHA 3EJKA 4IEPA 2E7TA 4K21A 4HVRA 3I4IA 5KHKA 2MPFA 2HWB3 2Q4SA 4MSVA 1RUNA 4F8AA 1ENXA 4N53C 4C90A 3W59A 1OPMA 1DQ0A 2DCJA 2XJUA 3WDTA 1LESA 2NMOA 1RUI1 1S0IA 4OLLA 1PHMA 4LA3A 1TME1 4CDXA 1FOD1 5BNPC 1OOPC 1X82A 4XFAA 4BOWA 3CF6E 2DCKA 4CEWC 1MEC3 4OHYA 2WA3A 1O3SA 5CFCC 1A8DA 2YUEA 2Y0OA 4XJ9A 2DCZA 4Z8BA 4Y24A 1FMD2 3DGTA 5DZEA 2VVFA 4FPLA 4Q4Y2 4ZU4A 1ZBA1 2PLV2 2XBO2 1WD3A 4TYSA 1AHSA 1ALYA 1VBD2 4DRRA 4AGVA 4CDUA 3GHMA 1BBT3 3WUCA 4CEYA 4AI2A 1FXZA 1PGW1 4AVTA 2PTMA 2JX9A 2C0ZA 1PZ8A 4NHKA 2D6OX 4G9SB 1SFNA 4XOGA 2R1DA 4IV1A 3PJYA 1V6MA 2AZ5A 3GZUC 5GLZA 1YFXA 4ZU7A 4Q0VA 1YCIA 4YW1A 4KNCA 1PIV1 2UY9A 3FBMA 3VV1A 3MF6A 2DU1A 5DXDA 3NL1A 4AVAA 5F1RA 3RJ2X 2PHDA 2ZKLA 2RS11 1NE6A 3VBFC 1DU3D 1ZZBA 1RUH3 4HLTA 2WA4A 5C4WA 1YWKA 3O7OA 2JG9B 4WVMA 1U5IA 2DFCA 3K51A 2PHTA 1Q3EA 3TN93 2NYYA 4FCAA 2ES3A 1ULGA 1RMU2 2VXRA 4J1WA 1FMD3 5BY5A 1H8TB 3BPZA 3ZFFA 2PLV3 2UYAA 1AR62 2XBO3 4MH0E 1VBD3 2LALA 2D7FA 1O5LA 1LJ7A 1PM7A 4YG3A 2JG8B 4LUMA 2OW4A 3MICA 2N7GA 1QJU1 1RHI3 2CGPA 4LULA 5K8SA 1ULEA 1S0FA 4I0WB 5HCBA 1DGRA 1Q43A 3HD8B 2CV6A 3WR0A 3ZYJB 5ACA2 1V9U3 2KXLA 2HEWF 1HRI2 1BJQA 1F2NA 4HVQA 2R30A 2XPJA 1UIKA 4QD2A 4NWVA 1F5JA 1C5IA 1IS5A 4MXVA 1HX6A 3OYWA 3AKRA 3DPRB 2XHKA 1GICA 3PHMA 5GJ6A 5JIAA 5JPMB 3KZ4C 1W2UA 2A5ZA 4O9GA 2HWD1 2ZPXA 1AR63 4Q1PA 2VNRA 1FX5A 1H1AA 2QNKA 2ZGMA 1CVNA 4IV3A 1KJLA 1K5MB 4PDWB 4D7SA 4LBJA 4IEOA 4GWMA 1H4HA 1U12A 3WXPA 3ELNA 5FRAA 4RR3B 1D0GA 4Z2WA 2ET7A 4U2AA 1RUG2 4XF0A 4XIKA 2ZX0A 1C57A 3LGRA 2GMEA 2RR11 2BWCA 4R9DA 1PO22 3ZDSA 1VBB2 5IK4A 1Z7S3 4OI1A 5FQ0B 4XFFA 1W6OB 1NY71 2HYKA 3KT1A 4GH4B 4Q26A 5ACA3 1AR82 3OGJA 3MDPA 4GB32 1HRI3 2A3XA 3BB6A 4AEDB 1X36A 2D98A 4Q4V1 4Z07A 3JQWA 4Q4W2 1AR72 2P2KA 3TWIA 1AL22 3VGIA 4B4PA 4FO9A 4L99A 4MZUA 3ZFEB 1AL0G 1JYCA 1ZA4A 3R4SA 1VBE2 4W6YA 2E6VA 3OD4A 1PGL1 2AREA 3BOWA 3VDDB 2XJVA 3VKLA 2WS91 3MYXA 1NE4A 1CAVB 2D5FA 4YM1A 3J8F3 3NAPB 4N53A 2XJQA 3ILNA 5I93A 1KXGA 1D4M2 1GZCA 1DZQA 5CNAA 5BNPA 1CESA 1OOPA 3VZOA 4MLOA 1I1EA 2BVBA 3KGLA 1H1MA 4CEWA 1NCRB 3ROUA 5A3LA 5CFCA 4YZ4A 4RS5B 1PK6C 1RUG3 1LENA 1R092 2ZX4A 2IWGB 1SQ4A 4AFMA 5LRSA 1AYM1 1IPJA 2IXLA 1PO23 2YY1A 1RUD3 1TMF1 4LA2A 3HN1A 2D6LX 1JW6A 1ND2B 1QKQA 4GB33 1AJOA 3M4FA 4KU8A 5CG8A 4Y1VA 3WCSA 1OLRA 3FHIB 2V5YA 1AR73 5HXVA 1YJLA 3VBHA 3BCWA 4N9IA 1REDA 2R6QA 3OCPA 3ZN6B 1SLCA 1R1ZA 4UBHA 3AZZA 5TSWA 4JGZB 2ZGKA 2ZBJA 4D3WA 4HT1T 1WBLA 4BWOA 4LBQB 2WNVC 4YGDA 4I01A 4QPGC 4W6XA 4HANA 2ZGQA 4IEUA 1PO13 3LSEA 1HRV1 3VBRC 2ARBA 1BEV1 2D97A 1DLLA 3MIFA 1GLHA 4AVVA 1D4M3 1X7NA 1APNA 4KWJA 3NKGA 3GALA 4P9GA 3VBFA 4R9CA 2HWC1 4YZ3A 1C8M2 4OVEA 1VBA2 5CG9A 5FOBB 2R16A 4FTEA 1LHVA 4TZDA 2WSUA 3AP4A 1R093 4QXKA 1H30A 2TNFA 1B35B 3JD71 2IXJA 3O5SA 3RS6A 4RQPB 3V64A 4JGYC 2MEV2 4UW6A 1AX2A 2BPA2 3JUUA 1YNAA 4COVA 4FQ4A 1VALA 3TNPB 1LGNA 3AK0A 2GSYA 1G8WA 1J3RA 1NG0A 3WDWA 5BNOB 4HBNA 2WNUC 2WLQA 5HCAA 3U0ZA 3T1MA 1V6OA 3VL8A 3WCRA 3IWZA 4DQAA 3WP3A 4LUKA 4QT6A 1YI9A 3LKJA 1EY2A 1W0PA 1LHOA 4D94A 3D4KA 1REEA 4M3CA 1W6PA 2IXCA 1ENQA 2AUYA 1PVC1 5T55A 2Z69A 1OKQA 4DPNA 1LHUA 2VG9A 4XFBA 5EZWA 1OQDA 4XFGA 2GU9A 4IEYA 3WQ7A 4QPIB 3P3PA 1R1A1 2ZGUA 5GLWA 1BYHA 3IMNA 4BM8A 3HBZA 4MV2A 1BMV2 1VP6A 3WP5A 4FPJA 4GMP0 3VHNA 2NQYA 3ES1A 4YVSB 1S0GA 2XVGA 1SLAA 5L7OB 2D3SA 2EXKA 5T5OA 1A3KA 1UZYA 1MS8A 2MEV3 5D8AC 5K0UB 3AKQA 3N35A 4YZ2A 5C8CC 3OD0A 2BVVA 1HXS1 4I09A 4LE3A 2GH2A 2YGLA 2A70A 1FPN2 3EHKA 1NZCA 3CJIC 4N7IA 4Q4X1 1OI6A 2YV8A 3D6EA 1EYBA 1H9WA 1CAXA 4ASMB 4B29A 1F31A 3HWJA 1VBC2 4XJ8A 4Q2FA 3NW4A 2B45X 4EN8B 2R063 4CTEA 5KHHA 4I3GA 2ENRA 3SHRA 2VU9A 1RL3A 4Y20B 3O14A 3ZSEA 4FPFA 5C33A 1UU4A 4M0HA 5CFDC 3RSJA 2K0GA 1VRH2 1GV9A 4FPCA 2ZX2A 1G9AA 1G6NA 2P3JA 4WM8C 5BNNC 4H7LA 2DYCA 4DOUA 5CADA 1RUE2 4AI3A 1LTEA 1SBEA 1FV3A 1QJX3 1BVP1 1GYKA 1N1TA 2PHRA 1COV2 4K6BA 2KM2A 5BXXA 1S0BA 2B7YA 2BGCA 4Y22B 2SLIA 2RS33 5AVAA 5LEKA 3IDEA 2DVGA 4X6QB 3ETQA 2NP0A 1PK6A 4CZSA 1ZNPA 3MLLA 3N3HA 5J7MA 1NYWA 2PELA 2DVFA 4I3PA 2ZGPA 4RHV2 1UU5A 3ZMNA 4HVOA 1BQPA 1AJKA 3LB9A 2E7QA 4AI0A 1UU6A 5HBAA 1OQ1A 4DMIA 5BYNA 1UD1A 2FMDA 3VUOA 1BZWA 4AI1A 3TNQA 1VBC3 4LO5B 2IXHA 2EIGA 3IDBB 1YIFA 2Q1ZB 5IK8A 4CDXB 3WLUA 2DCTA 4PLOA 1ULFA 1QOTA 4KU7A 1WCSA 1BCXA 2A3YA 4AVSA 3IN9A 1VRH3 5KHGA 4ZKTB 1FT9A 2WNVA 1VAKA 3JQXA 4QPGA 5K7PA 1QXJA 1G9BA 2WFF2 4PBOA 1IKQA 2QZ3A 3VBRA 3B00A 4IESA 3TOJA 1S1AA 1QJY1 4OHXA 2R32A 2VOXA 1PGSA 1KFUL 4WVZA 4LT5A 1D2SA 1O7FA 1AXZA 3HIFA 4CEYB 4AE2A 2E9QA 4Q0UA 4S2FA 5C9AB 1Q5OA 2WFPA 4CP2A 1M4WA 5JOXA 4QQPA 2R1BA 1IGOA 5I0RA 3QH7A 1R081 1S55A 4WM7C 2HWE3 2JEMA 1Y7BA 5E89A 4OHZA 1TEIA 4JGYA 1QXPA 4Y1ZA 3S6PA 1OMIA 4FP2A 4E4DX 1A8MA 2Q30A 2FMYA 1RUI2 4IETA 2RJLA 3ZFGC 1FOD2 1UN1A 3BIWE 1AX1A 1W6NB 3ZXDA 1LRHA 1POV1 5IK7A 2YYOA 2WNUA 4F3JA 2GALA 5EXOA 1IS6A 1OA3A 1HKDA 3B9CA 3L2YA 4WVMB 3I54A 4LBMA 1Y3TA 3KT7A 4JTOA 1JN2P 4F83A 3ZYIB 1ASJ1 2VUAA 3KLSA 1ZBA2 2PAEA 1JUIA 3ZFFB 3WD5A 1C5HA 2QKDA 3BOPA 1DQ1A 1YHFA 1BKZA 1CX4A 1XNKA 2BYVE 2GMPA 3MEPA 3D8CA 1PGW2 2GMMA 3ZSJA 2WZR3 1RC6A 1OFSA 2G9GA 3M3QA 3UK9A 1KS4A 1PVXA 1WMDA 3LA2A 5JR7B 4MX3A 2JJ6A 1YLLA 4NHMA 2Z42A 1W6QA 3ZSLA 1V6LA 1GQGA 5E8AA 2WZPP 4AQSA 3E5QA 2XJPA 1RUF1 1G7YA 1DGRN 4G4FA 4M01A 3ZXGA 1PIV2 5KC5A 3AP9A 4X6RB 5D8AA 1SLTA 3O12A 1JHNA 1AR93 4BE3A 2DU0A 5IK5A 2WKKA 4IEQA 1RUI3 2RS12 3MIBA 3PJQA 5C8CA 3KGZA 3FE5A 3P3NA 4X8NA 2WJSA 4E2GA 4AVBA 3SH3A 1SEFA 4HETA 1H2NA 2JDZA 3CJIA 3AKPA 3KCCA 2HEYF 3OYWB 3B01A 4L8QA 5F5QA 4G3YC 4BYYA 4HFSA 5JI9A 3WW3A 2WIIB 3VKMA 4P5HA 4WZCA 3RI8A 3I8TA 1EV11 3O0XA 4XEZA 2EVXA 5CFDA 2E51A 2P3KA 2B9UA 5DG2A 1QJU2 3FZ3A 5EV7A 4ZU5A 4BMEA 4DXZA 3PLQA 3KQRA 1ZRRA 2I74A 4WM8A 2LTNA 3B93A 5BNNA 3SCFA 2ZAHA 3AP7A 3T1LA 2ZABA 1GBGA 4A3XA 3W9AA 1SLLA 3SLIA 1ZZCA 3AZVA 3PVEA 1YXWA 3PVOA 1CJPA 2XKPA 1PMIA 1AYN3 2PHXA 4UW4A 2RS53 4OUSA 1QQP1 4LBOA 3RNSA 3WG1A 1V00A 4K3UA 3ZO0B 2YMZA 3KB5A 4OFGA 3AYDA 4GKXA 5FDBA 2D6PA 3AXEA 4R52A 3WNXA 3SCHA 4HKLA 2XLAA 3HT1A 4K1ZA 4OHWA 2ZHLA 2TBVA 3IPVA 4D7TA 2GC2A 1DFQA 4K40A 2HWD2 1UL9A 3LOIA 3ZIXA 5BNPB 1ZBE3 4LLFA 3RMYA 3ALQA 1QJU3 1W6MA 3NV1A 3H8UA 4Y26A 4LEJA 4B8EA 4YM2A 4COYA 4PIYA 2PA7A 3VBUB 2X8KA 3E6BA 5H9RA 4CDWB 4EJRA 3RI9A 2CWSA 4E27A 1NY72 4FXGB 3VBHC 3D5OA 4GMP3 3KS7A 2WSVA 1QY4A 5DDJ1 4Q4V2 3AZWA 4ZXKA 3RWNA 3MIGA 4DY3A 4LO6B 3ZMOA 4FBFA 3WY6A 4C0BA 1QMJA 1RTVA 2HKXA 1PGL2 3JB8A 4QGNA 3RYPA 1OA4A 2WS92 2OIIA 2ZX1A 4WM7A 3AX4A 2GNTA 4XILA