4KBZA

Crystal structure of hypoxia-inducible factor prolyl hydroxylase (phd2) with (s)-{2-[2-(5-cyano-3-hydroxy-pyridin-2-yl)-thiazol-4-yl]-acetylamino}-phenyl-acetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
234
structure length
231
Chain Sequence
b'TKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYEKGLRVELNKPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 68
structure length 231
sequence length 234
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4kbzA00
2HBTA 2V4AA 5L9BA 4KBZA 3OUHA 5ERLA 3PL0A 4XACA 3ITQA 5DAVA 3DKQA 4IW3A 4NHMA 5A3UA 4NHXA 4Q5OA 4XCAA 5EPAA 3W21A 2JIJA 3W20A 4J25A 2FCTA 5HV4A 2FCUA 4MHUA 2Y33A 4JZRA 2JIGA 4XABA 2G19A 4BQXA 3NNFA 4UWDA 5HV0A 4Y5SA 4XC9A 4NMIA 5LBCA 3OUJA 4XCBA 3NNMA 4BQYA 3HQUA 2FCVA 2G1MA 5LASA 2RDQA 2RG4A 5C5UA 3MGUA 2RDRA 3KT4A 2RDSA 3GJBA 4ZONA 3OBZA 3KT7A 4NAOA 5DAXA 5DAQA 5LBFA 5IAVA 3NNLA 3GJAA 4NHYA 3BVCA 5C5TA 4NHKA 5LB6A 4XAAA 2Y34A 3HQRA 4Y5TA 4ZPIA 5EP9A 5L9RA 3OUIA 3EMRA 4MHRA 5EQUA 5IATA 2OPWA 5LBBA 3GZEA 5LBEA 2HBUA 4NHLA 2A1XA 5M0TA 5L9VA 5DAWA 3KT1A 5LA9A 5IAXA 4BQWA 5LATA 5DAPA 3NNJA 2RDNA
chains in the Genus database with same CATH superfamily
3ILNA 3O0WA 3B9IA 2VW1A 3ES1A 3RGBA 3DN7A 4HMZA 4RGKA 5JSPA 1PO21 2BJSA 4GULA 3MZHA 2WS91 3P6BA 3H8OA 4RQPB 4FVVA 2WSVA 1HJGA 3VBUC 2QQLA 4CU7A 2XUEA 1LAJA 3T4HB 3RZLA 3J8F1 3LFIA 1SCRA 1TNFA 2R062 2XJUA 4LA3A 3P3NA 5I0RA 5K8SA 3VD9A 2VW2A 4XPVA 2DCTA 1OQDA 2DU0A 4LPLA 4Z82A 3UJQA 2WYFA 3I3BA 4BMBA 3I3EA 4CEWA 3OGGA 1YXWA 2RS11 1IKQA 1VAVA 5C4WA 1XOYA 3LDRA 1G9BA 2UURA 2Y33A 3JBG1 4RFRB 3ZFGB 4A4AA 1WMFA 2AR6A 4EROA 2R073 2WKKA 3HT1A 5JWPA 2ZHLA 1J3QA 3WUDA 5KXCA 4B7EA 4XFHA 4A6OA 1ZA4A 1MS3A 1CONA 3CMGA 5T5OA 4A41A 2ZCWA 2FD8A 1Q43A 4CU9A 1VRH2 5F1RA 4EQVA 1PO11 1Q56A 4YFZA 5A3MA 2K0GA 4R9DA 1WBLA 1RUJ1 1UD1A 2ERFA 4E27A 1LHUA 3APBA 1IQAA 2VNOA 3NNMA 3HWJA 3OUJA 4HSJA 2EXJA 1SLIA 4MGKE 4QMAA 5FYMA 1AL22 5FPZA 4AEMA 3BI3A 3U37A 5LWBA 1WCQA 4UBHA 5F2WA 2D5HA 1D4M3 4XYXA 3ZIWA 5FO9B 4D7TA 3I97A 3OBAA 1YJKA 4PBPA 5T50A 1LCLA 2CL2A 3OBZA 5EHDA 1Y7BA 2WC2A 4LO8A 1BJQA 2J42A 3B00A 2TUNA 4OI4A 1PO23 1ZA7A 2VCCA 2WS93 1SHWB 2QZ2A 4P5HA 2GALA 2ZPXA 5EJ3A 1E5RA 2OXBA 4OVEA 4IEVA 3W5NA 1OLME 3T1MA 3O1UA 4IESA 4KU7A 4YM3A 3AKTA 4LTAA 5LBFA 4BQ1A 2MEV2 1YQCA 3J8F3 4HKWA 5JIAA 3WQ7A 1UZYA 3KV5A 4D7SA 1HRV3 4IGPA 4Y5Z0 4MXWA 2VMFA 4FO9A 5A6ZA 2FBEA 3NAPC 2VO5A 3Q8CA 5CYYA 5EV7A 2VE1A 2ZX4A 3KCXA 1CX4A 1IQDC 4UF0B 3AKPA 2GNMA 2E6VA 4GWNA 4NRMA 5G05L 3RYPA 1AR62 2RS13 3C7OA 3CDZB 2YFZA 2VCAA 2VMCA 4OI0A 1RJ7A 4JRLA 4FOVA 4HZFA 2Q1ZB 2PHDA 1E5SA 3POFA 5IFTA 4AVSA 5LRSA 3GHNA 2AGSA 1JHNA 4Q4Y2 1OF3A 3QOPA 5C8CC 2RS52 1SLLA 5CISA 2TNFA 2OZJA 2GH2A 3CO2A 5FR3A 2NN8A 3I59B 1ZRRA 4Z92B 4FOWA 1ZZCA 1RUJ3 4M0NA 2ILMA 1NCQB 3N4MA 4O61A 3BTYA 5JIUA 2DYCA 4LA2A 3WF1A 1CESA 4YPJA 1ULEA 2VUDA 1V9U2 3NO8A 1NY71 5T5JA 5JOXA 1PM4A 1WW5A 4QKFA 5AFEA 4IE4A 3IPVA 3MIEA 3O14A 1HJFA 3POIA 5HCBA 1RVF2 3ZFFB 1UIKA 3H7JA 2GNDA 1H8TA 1VBE1 1ZBE1 1UMHA 3C2UA 3JB8A 5CKMA 3MICA 2JDZA 2RR13 4AFBA 3EBRA 3ITQA 2H0BA 1YO8A 4DRVA 3O1VA 1O4ZA 5FIXA 5EZWA 1UW8A 3OY8A 1OH4A 3QH7A 1NLRA 2XJTA 3GZAA 3LIGA 4XCAA 4EWAA 2OX0A 1JOPA 2NPIA 2WA4A 3ENRA 2CAVA 4GQ7A 1HLCA 1YI9A 3MFAA 2P2KA 4V2WA 1JMUB 2P3YA 1QNYA 2VZQA 2DTWA 3AM2A 2ZX2A 4EN8B 2ZACA 2BVBA 2WNUA 1UY0A 1JOJA 2XHNA 3FLTA 2LUWA 2JDKA 3LIHA 4RSUA 3NL1A 3SNMA 1BVVA 3J7LA 2ZGPA 2XB6C 4AE2A 5FUPA 1KEXA 4IE0A 4YNIA 4ES8A 4N9HA 3RYRA 5H9SA 5L7OC 1YQ5A 3U4XA 1VLNA 3VZLA 2VTXJ 2E53A 1UX6A 2BV4A 2JXAA 4Y5SA 1UY4A 4CDXC 3T2OA 4Q0QA 4PT6A 4CDQA 4P9XA 3VBSA 2PLV1 4W4ZA 1BKZA 3OBRA 4X8NA 3MW3A 2ZGQA 2XLAA 1S0FA 4EYUA 2VTXA 1YRZA 4IV3A 4Z1VA 1OD3A 1H1IA 3VBRA 5BNNB 4P9JA 2ARBA 5C5UA 1NAEA 4NE9A 2VZTA 4QX8A 4AXOA 4Z2WA 2P4EA 2E33A 3K77A 4UFMA 1TEIA 1PNGA 3IZOA 1F5FA 2A3YA 2HWD2 1J59A 3Q9OA 1WZXA 1YI7A 1APNA 2Q8OA 4XF1A 4DMIA 2F4PA 4AVCA 3MF9A 3I2DA 2RJKA 1HB4A 3LB9A 1OC1A 3G7DA 5KBFA 1GP6A 3O5SA 3IIIA 5C3PA 1XNCA 1CGPA 5FMBA 2FMDA 3U11A 2D6NA 2DURA 5GKAC 3TN92 3FN9A 1O5UA 3BYWA 1BQPA 2Q8EA 5F9TA 3V0AB 5E1RA 2R16A 4RHV2 2BBVA 2YC4A 3AJZA 5A3PA 5GM0A 3R4UA 4YVWA 1GBGA 4MYEA 1LU1A 4AFCA 1FATA 1LB2A 1QJX2 1RITA 4IEYA 1PNFA 4JKKA 4YZ1A 2P3JA 4GWJA 4KG8A 3SMHA 1A78A 5DUXA 1OLMA 2IXHA 4E8CA 5H9PA 3I8TA 1BCXA 4YWAA 4EJRA 2WO3A 5FJKA 3WDYA 3AP9A 2A75A 5FYHA 3ZR6A 4Y1XA 1MS8A 3HEIA 4NRPA 2XL9A 4S2HA 3EO6A 2IUWA 5FP9A 2QTWB 1AR91 1HN1A 1UOFA 3WQ1A 3HQXA 3GM8A 1FMD2 3J26N 3ZXJA 3VBOA 3DYMA 3VHOA 3VZMA 1GZWB 2ETEA 4KBBA 2WAAA 4XJAA 2PHUA 4RQPC 4PDWB 3WNLA 2VGDA 1XYPA 1AXZA 1MZ5A 1REEA 3U1XA 3VL8A 4I01A 2MNGA 1OFSA 2C1FA 2W3JA 5J98B 4Q4V1 2JIJA 1Y3TA 1M4WA 2ZZJA 3IM0A 3NV2A 3AK0A 4JRAA 2W1SA 1KS5A 1VB4A 1J84A 4GKXA 2WNVC 3AVRA 2DF7A 3QLQA 2FCTA 3B93A 4ES9A 2W1WA 2PN5A 4LBLA 5HPOA 1EAH2 2B42B 2Z5WA 3ZFGC 1D0GA 5IK4A 1BBT1 1R093 3SKVA 1EPZA 1TME3 3B94A 3MO4A 2RS31 1MQTB 1E5IA 1B35C 2ZMKA 3IT8A 2AZ5A 2QDNA 2VQTA 5FZ3A 1VAMA 5GJ6A 3VBHA 3WCSA 2G4IA 4P14A 1IPSA 3IAQA 1JXNA 3N36A 3WW4A 5IVJA 3MW2A 3H42B 4L2NA 3VD5A 4AFAA 4MGQA 1HDKA 1ND2B 1LU2A 1QOSA 4XAEA 1WLWA 3LEKA 4XQWA 3I3QA 1W9SA 2UYBA 1RB8G 3AMPA 3WX5A 2YC0A 2EIGA 3J9SA 4AHWA 5FP8A 3RG0A 4ONUA 4ZONA 2IXJA 1F31A 3LEGA 2VW0A 3VDDA 5FO8B 1R64A 1GNHA 1VBC3 2IXLA 2JKXA 3M3EA 5JI9A 1F8VA 1WCSA 2FDJA 4LBJA 5K0UA 1LNSA 1UZVA 1MS5A 3NSTA 3ETPA 3FC0A 1FOD3 1TE1B 1ZBA2 4PLNA 4XF0A 3RQ0A 3ZX7A 5GALA 4A44A 2J22A 3RZGA 3ELNA 1RGSA 1OH3A 2PHTA 1AXKA 1YQ8A 3DUIA 5C3RA 4YYOA 4F83A 3JUUA 3MHZA 1AHSA 3CJIB 4CXXA 1UYZA 1MS4A 2BNMA 2D97A 2OZ6A 1ENXA 1IOAA 5DZFA 3BPZA 4G4FA 1QJEA 1REDA 1ND3C 4XAAA 2XWJB 2C26A 1BBT3 4UFHA 2QQMA 4TSVA 2RS33 2V5YA 3RZZA 4DY3A 4F8AA 3UT0A 2ET1A 3M3OA 3EMRA 1US3A 2ADDA 5FP3A 2BGOA 3E97A 1RMU3 1KITA 2Q1FA 3AP4A 5FXZA 2GP5A 3AFGA 2HWB1 1RUD2 1VPHA 1GKBA 5A6YA 2YPDA 5A7WA 1EP0A 1NCQC 4GIQA 3DYPA 3SITA 4J6GA 2Z79A 3C7FA 4XJ8A 1NA1B 4MGYE 1Q8SA 4LO4B 4MOAA 5FY4A 1W3XA 1VBA1 2BYVE 2BGCA 2WZ8A 1OUSA 2WYSA 3BGAA 5ANQA 2C4XA 5FBJA 3MPPG 1SZBA 1LOEA 2DUPA 2ZGKA 2IWGB 4FQ4A 4B4RA 4OMCA 3O1TA 1SACA 4LT5A 1TMF2 3ME2A 2AUYA 1V6LA 1LOAA 5FK7A 4IW3A 1YYNA 2EA7A 1RXFA 2VD7A 4QDSA 1STMA 1XPWA 2ZS6B 4QPIC 5FXXA 3W58A 4QU2A 2B4KA 1O3QA 2WBKA 1PVXA 2YC2A 4L0PA 4LOSA 3WW1A 1NQJA 1YIFA 3CU7A 4QHBA 3I4IA 4FPYA 2WFPA 5FZOA 4YW6A 1FV3A 3LPGA 2XHKA 3RNSA 4L9BA 4HG6B 4QGMA 4RN5A 1N3PA 3UYJA 2GN7A 3RJ2X 4FTBA 1S0DA 1U5IA 4QKBA 1SLAA 2XKOA 3K2OA 1QQP2 2DBNA 3AJYA 4P02B 3MV11 5DDJ3 4CU8A 1R1A2 4GWMA 4KQ7A 4Q1RA 3PHMA 1L3JA 2ARXA 3OPTA 2DDUA 2BQPA 4BQ2A 2PELA 3ZO0B 5DUUA 4BLJA 5B4XA 2E26A 4E8DA 3WLUA 3DV8A 3ZSLA 1JYTA 3MDPA 3S7EA 3SH4A 1O4TA 5FLJA 3UKNA 1AYN1 3UESA 1VBB2 4JTOA 4LNVA 1J1LA 2ORZA 4I0WB 4KNCA 4CDWB 1JUHA 3KB5A 4FFFA 2X5IB 3MIDA 4FPGA 1VBA3 4OHVA 1O59A 4BQ3A 1BXHA 4YGBA 2HH9A 5A33B 3GJBA 3UGGA 5L36A 4MG2A 4QD2A 4NO4A 3N3HA 2Q1MA 2Q5TA 4GH4B 1A3KA 5FYUA 1S0BA 5FZKA 1QDCA 2K2SA 5CEHA 5I8TA 5E89A 3GDBA 5BNQA 1PZ8A 1ULOA 3POBA 1CVNA 1LECA 3PVNA 1FPN1 4RL7A 1K5MA 1PVC1 4XZPA 2WN3A 4CDUB 2IXKA 2W87A 4PQ9A 3H3LA 4AFDA 1FI2A 3KMHA 1N3QA 1X9TA 1W6QA 4OI1A 1KJRA 3BIEA 2K46A 5BPXA 4KWKA 4WV8A 2EAKA 5KC5A 3LSDA 5FPUA 3NNLA 4WM7A 4YM1A 1FAYA 5LEKA 4FXKB 1C57A 4GA9A 4QPWA 4Y1ZA 5FZHA 3OF1A 4S2DA 4LO6B 2BBAA 2WO2A 4IERA 1O91A 2CDOA 1AR83 1SQ4A 2JE9A 2ZGTA 4BXSV 1COV1 1CAWA 4Y5TA 4ZKTB 2R072 4YZ5A 1WKYA 5L9RA 3POGA 1X8EA 4C90A 3T2PA 1DYKA 1H4HA 4HN1A 5FZ6A 3VBFB 4LKFA 4QAWA 2ZEYA 5JMOA 4EN6B 3H9AA 3O0VA 2JG8A 3J7MA 1UY2A 2QQOA 2VPVA 1LEMA 2HBUA 4ZZ5A 1MEC1 4BIFA 5FZ9A 5LK5A 4V2VA 3S30A 1Y43B 5F32A 1AYN3 2WL1A 3LOBA 1JZ7A 4KGQA 2P37A 2W47A 1AJKA 3S5QA 2QFEA 4XFIA 2OPKA 2X29A 1TQ5A 1PHMA 1C8M1 1W2AX 1QNWA 4PLMA 1OSGA 1WCKA 3AZZA 1OFNA 2RDNA 1DZTA 3MF6A 4HBNA 4HXCA 1D4M2 3O0XA 2HBTA 3OYWA 4Q0SA 2Z2SB 2EF6A 2QQPA 2WLPA 2I45A 3B3QE 1OPMA 1NCRC 2I07B 4MGIE 2ZEZA 3OOXA 2PHFA 2DVBA 5IVBA 1LHVA 1KGYA 2RHPA 4N53B 3FUQA 2X09A 5DAVA 3ZSKA 4CEYB 1YLLA 4Z07A 5FY8A 5FY9A 3WF2A 3U78A 5KXDA 1PVC3 5TSWA 2V09A 1HB1A 2R041 2X05A 5FYTA 1Q8OA 4CU6A 3ZDSA 5CFCB 5DG2A 4OLLA 4IL7A 4LMFA 4YVSB 2UWAA 1HRV2 5C70A 3MIBA 2JECA 5FZ4A 3AXDA 4A45A 4LHLA 4QGLA 3M7AA 1U5XA 2EALA 4NIIA 2OVUA 4X8PA 3ZR5A 3BU0A 2OQ7A 3O1OA 5IVFA 3TEWA 3MEPA 5FCCA 1VALA 3GCWA 1COV3 1O6UA 4XE9A 5AC93 1AYM1 1QY4A 3AMQA 5EIYB 1GWKA 5FAXA 4AHXA 2E63A 4DQAA 3TNPB 3JZVA 5FZFA 2GU9A 4YW4A 1O8PA 4W6WA 3WP4A 4YGCA 2NZ9A 5LY1A 1UKRA 1RIRA 2BP6A 4FPKA 4YW5A 2XLGA 3NV3A 3ZLIA 1MEC3 2A6WA 1ND2C 4FP2A 3WG3A 1GNZA 3JQWA 1GLHA 2VM9A 4XBNA 5GZDA 2Y6KA 5JZGA 1NLQA 2OUJA 3ACHA 3WDUA 2YZ4A 5D8AA 4KU8A 4CEWB 4COZA 1Z7S1 1IGOA 2YU2A 3B69A 5C4WB 4IEOA 2VR4A 3QCWA 3FE5A 4ZHNA 3PIGA 4FQZA 2WWSA 2RR12 4DUWA 5ACA1 5JOWA 5C7GA 4PF5A 3ZFEC 1WMEA 2EAAA 2ZHNA 3VBUA 2UYAA 4MUVA 3L2YA 2W68A 3E6BA 4GB31 4XURA 4A7KA 4BDVB 1DF0A 2FDIA 1QU0A 1RUF1 2GP3A 4LE4A 3A0KA 5FZIA 4AYUA 4ARXA 1WGPA 3KD4A 5IAVA 1UOGA 3N7JA 4WVWA 3L2HA 3WNKA 5E6HA 4B8EA 3KCYA 3IIAA 3I2JA 2Y0IA 2WNOA 3HNBM 1W8FA 1HRI1 3FLRA 3P1IA 3R4SA 5A1LA 2IZWA 1DQ0A 4YW1A 5LB6A 1YC61 3VZKA 1K12A 4XXPA 1OT5A 2DVFA 3AYAA 1IS6A 4XXAA 4PI0A 2HYXA 4M0HA 1AYM3 4SLIA 2GC3A 4WM8B 4QX1A 4TLGA 4M00A 3QH6A 4GJYA 1NUKA 5FOJB 1WD3A 4P9YA 2A71A 3BOPA 1SLBA 3LZZA 5IATA 1KQRA 1HV1A 4K1ZA 4UT5A 5LBBA 4XTPA 4OUMA 5F8PA 3WHTA 4LK6A 5C33A 3WF0A 4UFIA 5CIRA 2VBPA 2VVEA 1XNBA 3AZVA 1NA1C 5DAWA 2L9LA 4UW3A 1EV11 4N7IA 4RR3C 3WW2A 2JE7A 3B9CA 5JOZA 5C9AC 1ACCA 4I02A 3IWZA 1D2SA 3I49A 2WUHA 5FRAA 4MXWB 1RTVA 2GC2A 5CG9A 3CL1A 1F9KA 1H9WA 2JG9A 2V4AA 2A3WA 1ASJ2 1YIPA 4QX7A 3C3VA 1CIWA 1W9YA 3PL0A 1V0AA 1UYXA 3R0RA 3M3CA 2BWAA 3KGZA 4O9GA 3D0SA 4WZCA 2CAUA 1DLCA 2KD7A 3K4ZA 3ZYJB 1JYIA 5FUIA 3ZN4A 1XJAA 1OLRA 2CSGA 1ZNPA 2JDPA 2DU1A 3FFZA 4GB33 3U4SA 2P6CA 4M4RA 3GBFA 5J7MA 5JCTA 4AI8A 1AR71 4D3WA 4LKEA 4FPHA 1OI6A 2WZR1 4H7MA 4LQRA 4ASKA 2VXJA 5HXMA 2ZGOA 5FZAA 2WQ8A 4QPGC 4R9BA 4FCAA 3NAPA 4UW5A 3LCPA 3WDWA 1ENQA 2FMYA 2W08A 2XJPA 3ZXGA 1HRI3 5HCHA 2AREA 2JWPA 4MHUA 5F39A 4QGNA 2VMDA 5C3SA 4XABA 4AVAA 3FBMA 4RGAA 3LGRA 5ABJA 4CUAA 5JXGA 3MW4A 2W5FA 1MZ6A 3VHNA 3GCXA 5IHRA 2HWE2 3KQ4B 2Y60A 2QQKA 1GOFA 2CYFA 1Y4WA 1PK6A 1YFWA 3KVBA 1OF4A 3M8LA 4IGOA 5C8CA 4ASMB 2E32A 3OY8B 1BEV1 1G86A 3GF6A 3LEMA 4XDQA 5CKNA 4EN7B 5JI7A 1WCUA 5BNPC 5HBAA 3CEWA 3ILFA 4CYDA 4WBBA 2AACA 4AAXA 1LGBA 4XHBA 2WLQA 5LASA 3MBWA 4XUTA 4N9IA 3E1F1 4FPJA 3VKLA 4MGSA 2RDRA 3MGUA 1HXS1 2WNUB 3OBTA 3OGSA 3UKVA 1W9TA 1HW5A 4C91A 5CU1A 1ST8A 3PVBB 1SBFA 1SBEA 1RHI3 5IVYA 3ZXAC 4R9AA 2YMZA 4CDUC 1IPKA 5JXJA 1QJY1 2BVVA 4CCDA 2NM1A 1RUC1 3U07A 4I30A 5IK8A 1EUTA 3LA2A 1CAVA 4N43B 4BPZA 1OOPC 1GFF2 4K21A 4NWVA 5T55A 4CDQB 3VBSB 1RC6A 4FT8A 2WZR3 1BMV1 2OT7A 4UFKA 4JDNA 3VUOA 2XONA 4FI9A 4CCOA 3OD0A 1P8JA 4IV3B 4LBQA 1XBFA 4NHKA 4CP9A 3VBRB 3AYDA 3G6JB 5J1XA 5JAXA 4IE7A 1J83A 2KXLA 1QH6A 1R092 2WFF2 1TME2 4TTGA 1RUH2 3UGHA 2XJVA 3FHAA 1PIV1 3VBFC 1GUIA 3OUIA 3J7NA 4D94A 5EQUA 5LRRA 4H55A 2VZUA 2FDFA 2YUEA 3GZEA 5EYXA 3VHPA 4D6RA 5CAZA 1BEV3 1RUI1 4BK5A 2G9GA 5F5IA 2W9XA 1G9CA 5L9VA 4Q4W2 3KT1A 1AX0A 4XILA 5E8AA 2QQIA 1T2XA 3T1LA 3ILRA 1QJU1 1UYPA 3UNPA 1VAKA 1W6MA 3S5AA 4XUOA 5FPXA 3M4FA 3I3DA 3OGJA 4FTSA 4GKYA 4TZDA 1DYPA 3AYEA 3BIWE 3ZIXA 4I2OA 4JQTA 4BOWA 1NZCA 5FJHA 1DQ2A 2W46A 1SMVA 1ODMA 2VQUA 4ZXKA 4A7YA 5EFUA 4Y24A 2VNRA 3JBG3 3WUCA 4TN7A 4YVWB 1VBC2 3KZ4C 5C8WA 3F95A 4HPKA 4AW7A 1W03A 3SLIA 4IEXA 2QQVA 2XGXA 1UPSA 2ZJCA 1LR5A 5JLVA 1FOD2 3QACA 3ST7A 2VVDA 2FDHA 2P3KA 1W39A 2Q4SA 3IDCB 5CFCC 1X36A 4LHSA 4YVSC 4QDQA 1PO13 3N7MA 4J25A 4GWIA 2DWRA 4TWTA 4JGZC 4ZY9A 4FOQA 2WAOA 4Q29A 3WXPA 1PX4A 3ON7A 5FDBA 1XE8A 3KV4A 3USUA 3THCA 1GWLA 2YROA 3IDEA 1V6IA 4D6QA 4JKMA 4KL1A 4U36A 2Y8KA 3KWVA 1S0EA 3VBOB 4NVPA 4BU2A 1HKDA 4QQOA 1PIV3 3PUHA 1O3TA 1K5JA 2OW4A 1PGL1 1XRUA 2YFUA 1W90A 4ZZ8A 4Y4RA 3GNEA 5CNAA 3CIHA 2QQUA 4B4PA 1RMU2 1PM7A 4G9SB 4QB1A 2OIIA 1H9PA 4IETA 4IUGA 1RUI3 4Y1UA 3UV9A 5FKCA 1C1LA 2XBO1 4Q4X1 3SH3A 5JPNB 3Q8AA 3JD72 3RFRA 1QJU3 1I9RA 4YG3A 3I2KA 3KV9A 5HCAA 1FNYA 2RG4A 4XW3A 4DS0A 3KT4A 1B09A 5KC6A 3BODA 3ZYFA 1RUG1 1S0CA 1V6OA 5KHGA 5JPMB 3R05A 4FAGA 1ZX5A 1A8MA 1DBNA 1WW4A 1PGW2 1GOGA 1OD5A 3OGVA 4RQPA 1ZYBA 2EXIA 2P3IA 4C8DA 2RM22 5CFDC 2JDHA 5I8SA 2Z42A 3HIFA 4Z8BA 4GD4A 3VBHB 3RZMA 1RXGA 1VR3A 3RRDA 2V4VA 3U75A 2QJVA 2VXRA 4QX3A 5E16A 4AI3A 5ISLA 2HWF1 4JGYC 4M01A 5FZ1A 3N9QA 2WNVA 4JC1A 2YYOA 5LEJA 1ODNA 3BALA 4AGRA 1Q3EA 2ZEWA 5J3UA 1XE7A 4J1XA 2VBDA 4M4PA 3LAGA 1ZZ7A 1S55A 3I2IA 3IKWA 4XF4A 5AFBA 2FQPA 3I54A 1YJLA 5C6CA 1A8DA 3U0ZA 5A1AA 3D5OA 2RJLA 3HQRA 2PQQA 2WDBA 5DDJ2 2OKXA 4AQ2A 3M3QA 5EP9A 5A3LA 2D5FA 4WM8C 1B35A 3DF0A 4B3NA 1VBE3 1ZBE3 3ECQA 4MHRA 3U10A 2QCSB 5HXVA 2GMPA 5K0UB 4D6SA 4XJ9A 3RJRA 3ZN6A 4NAMA 2BFUL 2HEYF 4Q26A 5I0TA 4DEQA 2MPFA 3M3IA 1TVGA 1IS3A 2R061 5I0UA 3VGIA 3H3UA 2A1XA 3KHBA 1L7LA 3LD8A 5M0TA 3BN6A 4OFGA 4WZFA 3GXUA 2XBO3 4Q4X3 1PMIA 3E5XA 4K3UA 5FZDA 1UY3A 3NNJA 5FBZA 1L7QA 4R8HA 2ARAA 5FZLA 2UWCA 3BKZA 3QBQA 4HONA 4O65A 2E7AA 2WA3A 1RUG3 3O1PA 2R1BA 3BUCA 5BNOC 4AI2A 1MPXA 1W8OA 1UX7A 4UOJA 4DUVA 5A1FA 3GZTB 1GWMA 3NV4A 4K20A 1VRH1 4BM8A 1MZEA 1WD4A 3BU7A 4OYUA 3TYJA 5B4NA 2YDEA 3DXUA 1VRBA 3PMSA 4CA9A 5D2AA 2FDKA 1GP4A 4PCRA 2UY9A 1WMXA 2NLRA 1QHDA 4LEJA 5A32B 5A7WB 4OI2A 4CSWA 2WQZC 3Q8BA 1VBD2 3MFCA 1AL21 2ZBJA 2PLV3 3PVOA 3RI8A 5JDBA 3ZMNA 5KHJA 5KXEA 2QUOA 2X8KA 3X29B 3F2ZA 1GQGA 1GSLA 1TNRA 2PHLA 2QVSB 5DUVA 1ULPA 3T0BA 1YUDA 2AENA 1W8HA 1F4HA 2PTMA 4DO0A 1DFQA 1C4RA 5A7PA 1ND3A 2PHXA 1AR82 1R082 1U5ZA 5IW0A 3VZJA 2EIBA 4JCKA 4XJWA 1UCXA 4R9CA 1ZRDA 3ACLA 2BFUS 3CLPA 3J4UH 3WP6A 1U5YA 2W52A 1NYWA 1OBNA 4XEZA 3GBGA 3ZXEA 3C7EA 3OEAA 2BNNA 4QPYA 3I2HA 2MEV1 4W8JA 3M2MA 1L7RA 4Q1PA 2V5DA 1SDDB 4YZ3A 4XFBA 3RPQA 4XCBA 1QXPA 4B1LA 5I93A 4R4XA 5FZOB 1UAIA 3IDBB 2XXZA 1X82A 5J48A 2WNUC 2VZ1A 1AR61 2YGMA 5LW9A 2JB8A 3VKMA 3FJSA 4LK7A 2A5ZA 4META 1NLSA 2D3SA 3H7YA 4NOTA 4M3CF 4UI9L 3URFA 2B7YA 1JU4A 2Y6FA 1GZCA 3TBDA 3MUY1 4K6BA 3I2GA 4Q4Y1 4NAOA 4Y22A 5FV3A 1PX3A 1Z78A 2RS51 1ULFA 2B45X 2YBPA 4YG6A 2LTNA 4QPIA 1VRH3 1NT0A 5DAQA 2XQXA 1ZRCA 1K42A 2BOJA 4N43C 2ENRA 4F7ZA 2E7QA 3VBSC 2BZDA 1F5JA 4BIOA 3OPZA 1MS1A 1OQ1A 3UL2A 4QT6A 5IUQA 1V9U1 4DRRA 1AL23 3HN1A 2W92A 3PUQA 5FFOC 2ZGLA 4XQ4A 3WR0A 4WVMB 2F6BA 1OVSA 3BVCA 4NHYA 4NPRA 5C5TA 2ZKLA 2GAUA 1AR93 1RVF1 1DU3D 3RS6A 4BH9A 1FNZA 3ATGA 5EYYA 4EV0A 2PMWB 1YQ6A 1V70A 5AC92 3D4KA 3HAGA 4XQDA 2H6BA 2OQ6A 4NJ4A 3GALA 4GXLA 4COYA 1QEXA 3PUIA 2C0ZA 1V00A 5F7UA 3ZXFA 5H9RA 2WZPP 2WT0A 3ZPYA 4AEJA 1K5MB 2IXCA 3CZJA 3GYDA 4UW4A 4QB6A 1QGLA 4FP3A 1W6QB 2KM2A 2MEV3 2QQNA 1C1FA 2PXJA 1Y9MA 1MS0A 4YSFA 4Q4V3 2D40A 2PQSA 3HD8B 2WZEA 3K3OA 5LA9A 4WM7B 2Y64A 5A7SA 5DUWA 3EJKA 1VMJA 4XIOA 1NKGA 1SFYA 1AR63 2W94A 2D44A 2VY0A 2RVAA 4N8MA 5FYYA 4XBLA 3UGFA 5FPVA 3C7HA 3HNMA 1W6OA 1CAWB 1HB3A 2O0OA 3WOGA 4LLOA 2HWC2 4DZGA 2YG0A 4QKDA 2D7FA 5F5AA 1W06A 2JG8B 2ZHMA 1AF9A 3CHXA 2Q30A 5CBLA 2ZMNA 4K40A 1WBFA 4K8RB 4MGTA 4C0HA 2JDUA 3CBNA 2BRTA 4PF1A 2Y38A 5F3CA 1LHNA 1V9U3 3H1MA 2GSYA 1N3OA 1OA2A 1VE0A 2A70A 3KSCA 4IXLA 4KH9A 4QM9A 3RWKX 5EJ1B 4L99A 1KD7A 3OYWB 3WNXA 2ZX0A 3ZFFC 2HWD1 4AL9A 2X53S 4QB2A 2LM3A 1LOBA 3AC0A 1QOOA 1ALYA 2DVGA 1J3RA 2V72A 1SDWA 5T5LA 1UOBA 3MV01 2XWBB 3FFQA 5LY2A 5HV0A 5D1IA 5FTTC 3ZDVA 3TEZA 3TNQA 1RUE2 3T0AA 2JENA 2VU9A 4KI5M 3CKHA 3U14A 3T08A 4ZU7A 1ZZ6A 3DPRB 4XC9A 4EE2A 4XJZA 1SFPA 1ZZ8A 5LBCA 5JOYA 3TN91 1I5PA 1LGNA 3W59A 3MLKA 4CE8A 3AFKA 4CXWA 5FMCA 4R52A 2ZXQA 2RMU2 4RHV1 1O4YA 3WVJA 5K9YA 5FOBB 2LS6A 1NCRA 1RYYA 2D6MA 5F6LB 4WVVA 1W05A 2E51A 1HB2A 4PIYA 4Y3OA 1QJX1 1XQNA 2GMMA 2VG9A 1E5HA 4LKSA 4IQPA 4MZUA 1I5ZA 4MV2A 2IXIA 3TOJA 4B1MA 4HT1T 4COUA 1JYCA 2AEZA 4A3XA 2VCBA 2UWBA 5FLIA 1Z0HA 2HWB3 2I2SA 2Q8CA 3WF4A 2D6PA 1UF2C 3WQBA 5IFPA 4D0QA 4LITA 5JZGB 3WDVA 1QDOA 1YFUA 1W04A 3AXEA 4LORA 4DXSA 5BNNC 5K4LA 3GJAA 3PDQA 1FMD1 2QBXA 4IGQA 2A7AA 1OHFA 4IV1B 4XFCA 3T3YA 5D8AB 1AUYA 5FK8A 5IJRA 4A42A 2K9ZA 1UL9A 4DIQA 5IVCA 2HJIA 4DB5A 1HQWA 2GNBA 2Y34A 2HWD3 2W1UA 1PZ9A 2A6XA 1UMZA 3ABZA 2XVKA 3DGTA 3PUAA 2VVFA 5FZGA 3ZSJA 1KS4A 4E4ZA 2JKBA 3VBUB 2EVXA 3AMNA 4LO7A 5F3GA 3I2OA 1XE0A 3S7IA 2BDRA 4PIXA 3VZNA 1YNAA 2IFRA 4XVHA 2P5BA 2JDNA 3WDTA 3V0BA 2YXSA 3AVSA 4AGGA 4OMDA 4RGGA 4BQWA 3TEYA 4NIDA 1C5HA 1EAH1 4CUCA 5C3OA 3I7DA 1DLLA 2VOWA 2XG3A 4JDOA 4XMIA 3IMNA 4RHV3 3DYOA 4YM0A 3SKJE 2ZGSA 1OVPA 1M06G 1F2NA 4GAZA 4BA6A 4Q8KA 1LOFA 3HJRA 5IVEA 3KGLA 5F3EA 1RHI2 3PU3A 4RS5A 4DFSA 4R4ZA 1ZZBA 2HEVF 3ZFEA 1OA3A 5KWRA 4RFT0 1BVP1 3FBYA 1AVBA 4NPLA 4OQ9A 2XVGA 1IZ3A 1IKPA 5FWJA 1ULDA 3W21A 2R1DA 1HQNA 4ZS3A 1J58A 2OYZA 2Z4FA 1GV9A 3O1SA 3W20A 1OMIA 1DGWA 4X6QB 2Y0OA 3KV6A 1KDMA 4LULA 3PURA 4N90A 5IVVA 4Y20A 5HV4A 4GZ9A 2G9FA 5JXHA 5FZEA 3ACFA 5FLHA 3O1MA 2AYHA 2JG9B 4JZRA 5AVPA 5IYYA 3ZYBA 4Q8LA 3E6DA 1H2NA 2JD4A 3WD5A 1HN0A 2BGPA 5E88A 1NQDA 4PDWC 3WHUA 1PO22 1ZBA1 5D21A 2WS92 3LDKA 4P9IA 4C1XA 3K46A 3HBKA 4CPBA 4CUGA 2ZX3A 5A6XA 1FPN3 2QDRA 3POYA 2GDFA 4QQLA 1N47A 3TEXA 1O8SA 1OPOA 4AFMA 5JMCA 3WW3A 3MYXA 4AEKA 3JCIA 5A3NA 4XFFA 3J8F2 4L8QA 5CVRA 4RR3A 3SEEA 3W9AA 3RZHA 5C9AA 3AZWA 3MIHA 4INDA 5J09A 3WDXA 3WNOA 1Y9QA 5BY5A 2ORXA 3NAPB 4YFWA 2RDQA 5FZ7A 1DQ6A 1NZIA 2XMLA 2DTYA 1W0PA 2DFCA 1C28A 3BCWA 3BTAA 3N7KA 2WQ4A 1VB2A 3VN4A 1GMMA 2RS12 2D6OX 1MQTC 2VULA 3KT7A 3OD4A 3T30A 4DUXA 3JBG2 5A80A 3AL5A 5ABJB 1UY1A 4LE3A 1O3RA 4QU1A 4QHOA 4YW2A 2B46X 1OKOA 1MS9A 1RUD1 3AP7A 2ZAAA 1PK6B 5C8CB 3H3ZA 1JOBA 1JZ4A 3IB3A 3BTXA 2R32A 2VUCA 1PO12 4LBKA 1XSRA 1RUJ2 1VMHA 4UXAA 4QPGA 5G04L 2O1QA 1MR5A 1C8M3 1JBCA 2NMNA 1H1AA 1DGWX 1OXCA 3NV1A 4JV4A 5EWSA 5JVVA 1TMF1 1X33A 3AB0A 1H1MA 4CCMA 1D4VB 2LW8A 1QOTA 5CADA 4I3PA 4L92A 5GLVA 4NIGA 2NYYA 4BISA 1K5MC 2WIIB 1ZBA3 3AZYA 4CP0A 1GANA 1LHOA 5LBEA 2D6LX 3AMHA 1X9PA 2A6ZA 2R043 4E9KA 1S0GA 1CAVB 3FLPA 3KQRA 1HX6A 3OG2A 5BNPA 3T09A 4DNYA 5BYNA 5A3TA 4OQ8A 5EXOA 4I0BA 3RVHA 3CJIC 3WNPA 3LOIA 2WINB 1QQP1 4AVTA 5T3NA 4LBQB 4CP9B 2O8OA 5CKQA 1YFXA 1R1A1 4KBZA 3OUHA 4LXLA 2JD9A 1OLQA 2NQYA 2W1QA 4GALA 5F3IA 1JTZX 3ZOIA 4FPCA 2IFWA 4XACA 4UBGA 2E31A 1REFA 2J7MA 2VQ0A 4XOGA 1SPPA 4U2AA 5CB7A 4UFJA 3NJVA 4NHMA 4E2SA 2JG8C 5FYVA 1O3SA 5EPAA 1RUD3 3LSEA 1ULCA 4A3ZA 5T5PA 1JYXA 4IEZA 4LIVA 1VBB1 4EN9B 1OOPA 3UETA 1ZVFA 5LA2A 3SCHA 1SEFA 3ZM8A 1UO9A 4AEDA 4HOOA 1W6MB 4XBQA 3KCCA 4MO3M 5FZBA 5CG8A 2FCUA 1CAXA 2Y6JA 3WSOA 3ZN5A 1UPIA 1W8UA 1NY72 1V6NA 1RJ8A 2XLFA 2YY1A 4QWNA 1Z7S3 2BUKA 4AK3A 4HKOA 4HETA 2WO1A 5T52A 2DCZA 1W6PA 3HT2A 1VBE2 1ZBE2 1V6KA 2CV6A 5ACA3 1W2OA 1R1ZA 1XNKA 4HPKB 1MVEA 3ALQA 3CQOA 3DPRC 3ZSEA 5LK7B 1CR7A 2Q8DA 3TB0A 2XJQA 2C24A 3L9JT 3EXUA 1RUF3 5KHKA 1AJOA 4BYYA 4IE6A 4URAA 4JHTA 4M3CE 2VMEA 2DBIA 3HMYA 2A6VA 3N35A 5FKBA 2XVLA 1X50A 2ZKNA 1DG6A 5J36A 2CWMA 3USUB 1QQP3 4RD7A 4FFIA 2R071 4CCJA 4SBVA 3IPVB 4EZ4A 1IS5A 2DCKA 3EYPA 4AI9A 5JSOA 1JUIA 4QQPA 1T6BX 4QHZA 4AHYA 1H8TB 2OS2A 3RI9A 4ATEA 4CCEA 4A6SA 2B5HA 3HBZA 2R0FA 3A0NA 5DZEA 4HVRA 1NOVA 3NQHA 3NVCA 1H6YA 1VIWB 2BNOA 4AQTA 1I3HA 2DCYA 3DXTA 4NIAA 4CDWC 4P9WA 3DEMA 2PAEA 2PLV2 4PIZA 1XU2A 4JGZA 2X5IC 3ROUA 1T6GC 1RL3A 1EV13 1DDLA 1D4M1 4IV1C 1JZ3A 5D8AC 2HKXA 1JW6A 2XQRA 2WO7A 4DINB 5IT6A 3NKTA 1JU3A 1QJFA 5J96B 1PZ7A 1CIYA 3O12A 4GH4C 2SLIA 4ZPIA 2QNKA 1UU4A 4OCTA 4COWA 3N9MA 1F4AA 4AR2A 3FHIB 3T4VA 1IHMA 4J1WA 1GOHA 4N7UA 2HEWF 4AGVA 3JXSA 3H1YA 1QH7A 2XL7A 4NWWA 3VDBA 1HRV1 3WG2A 2LRPA 1JODA 5DPNA 1AR73 2JB4A 1QIQA 4OHWA 2PHRA 4V1PA 1W0OA 2J1RA 2WNVB 5LATA 1H6XA 1NXMA 3I2FA 3OSDA 4KWJA 1CN1A 4IE5A 4OUEA 3RDIA 4S2FA 4IEPA 4BLIA 3VKOA 1D2QA 3WQ0A 3ASIA 4KG0A 5KHHA 5FUNA 3EHKA 3KLSA 4BQ4A 5FQ0A 1KDKA 1IS4A 1LTEA 3K4DA 4BWOA 1G9AA 1B35B 5L7OA 2J1TA 5CFDA 4FPLA 2P17A 3ES4A 4NHXA 4MSVA 4QX0A 3ZN6B 4CDXA 2XR4A 3BPSA 2WABA 5SV5A 2SBAA 1CAUA 3AL6A 3KM5A 3NJXA 4JGYA 1UYYA 3MLJA 3RYKA 5T54A 1JI6A 2BEOA 4Q0VA 2IVJA 4GJZA 3T2QA 5FY0A 4OHZA 3CF6E 2A6YA 4OUSA 2D98A 1URXA 1AR92 2JG9C 1H2KA 4OZXA 4P5YA 2BW8A 5EJZB 1Y9GA 4FPEA 3K51A 4YGEA 3RWNA 1HXS3 3WT3A 4FPOB 2RR11 5F6KA 4N53C 2G19A 3AKSA 3USSA 2J1SA 4WM8A 1GQHA 2CGNA 4UFLA 4UWDA 4CEYC 4YZ2A 1LODA 2ZOEB 3IDAA 3SCFA 1CD3G 3NRUA 3S57A 1CQ9A 1J1TA 1NE6A 5FXVA 2EIEA 1BK1A 2YBKA 1QJY3 3IN9A 4EWEA 2ZGUA 1RUC3 3HNYM 2FZ2A 3NW4A 3POSA 3K3NA 3B5LB 3ZXLA 1BZWA 1VJ2A 2VOVA 1CZVA 1N1TA 2W39A 3E5UA 4MGZE 4Q4V2 3CZUA 3HQUA 2PAMA 4BCUA 2VTFA 3FHQA 1W3VA 5FMDA 4UYBA 5FWEA 3B7MA 4L11A 4BK4A 2R0HA 5JSRA 3GHMA 1OURA 3OJBA 1ND3B 3WG1A 5ABJC 2CWSA 1BBT2 5BNOA 2BWCA 1QKQA 2RS32 5FYCA 1UOJA 1GZ9A 4NIHA 1U12A 1PK6C 4Q0PA 5DZGA 1VMFA 5F5CA 4IEWA 1NX9A 2P34A 3OGRA 4JKLA 3ZSMA 4FFHA 3LFMA 3PU8A 4PHZA 3OPWA 4QX2A 4HFSA 4HL0A 1GR3A 1W6NA 4TXWA 3LKJA 5FMOL 4PI2A 1FYUA 1LOGA 3J7HA 3VHRA 4EN0A 1DQ5A 2PFWA 2QKDA 4ISQA 5AVAA 2PHWA 4M3CA 1Q8VA 1N1VA 3SXWA 1AXYA 3PTYA 3R6SA 4CEWC 1W8ZA 3N9PA 1ASJ1 1DCSA 1F35A 1TZOA 3N9OA 4XF9A 5C4WC 1DGLA 1W2TA 1AX2A 1WUVA 2JICA 4BJ0A 1LEDA 5GLWA 1LOCA 4ISRA 3NJZA 4XDPA 2EIDA 1FV2A 1BLZA 1G7YA 2WJSA 4Y22B 2AEYA 5F5QA 1Q5OA 4YARA 3VKFC 4ORFA 4QPIB 3VD3A 4JTNA 2FHRA 4OHXA 1JYVA 2DCJA 2VOKA 1CPMA 3PTRB 2VZVA 2C9KA 4QXKA 1JZ2A 2N7GA 1POV0 5DAPA 3C7GA 3PMEA 4COVA 4Q2FA 5LCWL 3ZKYA 1EY2A 5FPBA 1QXJA 4D7YA 3ZFGA 5FP4A 5L9BA 3M70A 1DZRA 2RJ2A 1O7FA 3K4AA 4KWUA 2HWE1 3WY6A 3TWIA 3VDDB 1US2A 3VV1A 1DYOA 3FWEA 1QXRA 4N43A 4NN0A 4Q5OA 2PA7A 1F15A 3N9LA 5FMOS 2YB7A 5FYZA 4NR1A 1WLCA 3M1HA 4QQHA 3NNGA 2HWB2 3OCPA 5B2GB 1NXD1 2WSUA 1HQLA 3I3MA 1UNBA 1EPWA 1MZFA 1BHGA 2GZWA 1YHFA 1GNYA 5IK7A 1CPNA 1VBA2 1G9FA 1W9FA 1ASJ3 2GC0A 2CTVA 3JB4C 4XUQA 5GZCA 1SCSA 2VJXA 1UZWA 1W6OB 3QD6A 4ZU5A 2ZMLA 1QWRA 2ZGNA 1XYNA 1FX5A 1G8WA 3O7OA 4LOTA 4ZXEA 4LUKA 3D82A 3D3AA 5FYBA 1LENA 4MH0E 1UKGA 4AVBA 4FPFA 4CTEA 2QQWA 3K48A 3RMXA 1C3HA 2BTVC 1D7PM 4C1WA 4CPBD 4HK9A 5IWFA 3W5MA 2Z69A 2HWF3 2KR2A 4ZU4A 4O9EA 4K9SA 2G1MA 4DXTA 4JDMA 2EICA 4I3GA 3LEIA 4UF0A 5FYSA 3FUOA 4LLFA 3S6PA 3HR9A 1R091 2WFF1 1PMJX 1TME1 1RUH1 3LA3A 2RE9A 5LZ6A 5L19A 4JAAA 1J3PA 4D69A 1H8TC 3THTA 1U0AA 4A2UA 4YLZA 2HWE3 3KS7A 3H1WA 4QKNA 3O1RA 4LBNA 3AMMA 2VBBA 3DKWA 2VCMA 1DQ1A 2BERA 4KGGA 3H8XA 3SISA 3CJXA 3I59A 3N9NA 5I8YA 1ZRIA 5FZ0A 4QX5A 4Q4W1 4B29A 3KF3A 2YBSA 1IPJA 1GZTA 2DV9A 3PJYA 5IK5A 1NCQA 2B39A 2R063 2XDVA 1V6MA 3LA7A 1AYN2 5KXBA 2XKPA 3GGLA 1I6XA 1POV1 2XPJA 1WLDA 4E4HA 2QZ3A 4OULA 2TBVA 1BYHA 3MLLA 2ZEXA 4AZZA 5KR7A 4ATFA 3R4DB 2CU5A 2TEPA 2VAUA 4FOYA 3ZFFA 1FXZA 2WR9A 1ENRA 1NCRB 5BUVA 1VBC1 3ZYIB 4CXYA 2J1EA 3ZMOA 2UY8A 2NMOA 4BHPA 3ZKUA 1JS9A 1FOD1 3DECA 2DVAA 1N1YA 1FPN2 2ATFA 5C3QA 1PVC2 4OHYA 4W6YA 2GC1A 4CDQC 4DEVA 1LHWA 4BXFA 1LRHA 1WA4A 1ZZ9A 2VZ3A 4H7LA 2ZHKA 4XUNA 1KFUL 2FDGA 4IV3C 2G9ZA 4W50A 4MLOA 3VBRC 3SC7X 2WFF3 5FY7A 1RUH3 1SLCA 3HPNA 4CP1A 3V64A 2WWJA 2C9AA 1COV2 2WT2A 3Q8FA 1RINA 1XNAA 1RMU1 4W65A 4CCKA 3IMMA 3ZYGA 5A7OA 5JUVA 1K45A 2DUQA 4HN0A 1MACA 3ACGA 4XFAA 2DVDA 1GQPA 5FY1A 1JZ8A 5I0SA 4Q4W3 1MEC2 4XETA 3V56A 2DUOA 2Q0AA 3JD71 2LROA 4QDRA 4QQ2A 5APAA 1JZ5A 3TRSB 1POV3 3V0BB 1C8NA 2D3RA 4RYDA 2WWUA 1WMDA 5BNNA 3S0MA 3VB9A 1C8M2 1KJLA 2WT1A 2ZTNA 2GMEA 3WV6A 4LBMA 1YEWA 1CJDA 3H50A 1QJZA 2VOTA 3PVEA 1PGW1 1NE4A 1EUUA 4XMAA 1IG3A 4O7XA 2OA2A 4YVWC 4LHNA 2RM21 1HV0A 4CCLA 4E2GA 2BPA2 4RS5B 3AP5A 2ID4A 3ZXDA 4P9LA 4Q4Y3 3ZFEB 5HI0A 2CHHA 2RS53 3UKTA 1BK0A 3SHRA 1QF3A 4YW7A 4C0BA 2R042 4HANA 3UJOA 4ASLA 5FREA 4K7JA 5C71A 1W2UA 4ET7A 1KFXL 4AI0A 4NUBA 2CY6A 4EZHA 4BQ5A 2VZRA 1W2NA 5CA6A 2R7EB 2VZPA 1DP0A 1X8MA 3V0AA 4FTEA 4Y20B 2X10A 1EYBA 1OA4A 2KA3A 5I0DA 5DDJ1 3SH5A 1V6JA 3VBOC 3B02A 1RVF3 1XC6A 4QXCA 4FAHA 4HK8A 1S2BA 2CGOA 4PBOA 4IEUA 4QXBA 2AC1A 5DMYA 1GU3A 1AYM2 3AYCA 1YFYA 3NMBA 4CCNA 4D8MA 5BV6A 3T0DA 3INAA 1Q8QA 4AQSA 2CDPA 2CGPA 5A32A 3JU9A 3PJQA 1CJPA 3OB8A 4XJUA 4AEDC 4JVAA 3VLBB 3A7QA 4E4SA 5DABA 3JD73 3A4UA 1YCIA 1UU5A 4GMP0 3GBWA 4RR3B 4XF3A 4AG4A 5C9AB 1LGCA 2VZSA 3V65A 3H0OA 3TAYA 4JX0A 5CZKA 3LE0A 3PNAA 3SQOA 2DFBA 3VD4A 2ARCA 1JYNA 2D6KA 5GZEA 1GZWA 1ULGA 1UZ0A 1Z7S2 1G9DA 1XNTA 4MVTA 4PDWA 3ACIA 2RM23 1DHKB 3H8RA 2JE8A 5ACA2 4H3WA 3ORJA 1XSQA 4Y26A 3VBHC 2C6SA 2PYTA 1S2KA 3PLQA 5H9QA 4P08A 1JHJA 5HCFA 4CVUA 4NHLA 4GB32 2PAKA 4NRQA 5KHIA 1VBD1 1RUF2 1S4CA 5J37A 1ZRFA 1Q8PA 2E7TA 3P5BA 4LUMA 1OKQA 1UXZA 3ZYPA 2BOIA 4AHZA 1KXGA 4Q0UA 4QPGB 5JR7B 1NG0A 4AVVA 4BB3A 4HVQA 1CWPA 1C5IA 1AR81 1R081 1HRI2 2Y6HA 2YPJA 4I0AA 2B9UA 2HLEA 4P9GA 5BXXA 3ZPOA 1GICA 1MQTA 3VDDC 2YHJA 2V73A 1MVQA 2B8MA 4LBQD 3RZJA 2ZA9A 5GLTA 1W0NA 4L97A 3LQCA 1LKNA 5K0UC 5DQ0A 5A3UA 1I1EA 5A7NA 1WCDJ 3BOWA 5FP7A 4CP2A 2ES3A 3RZKA 2XJRA 4XUPA 2R30A 4HLTA 3WNMA 4EWDA 1W8WA 1ND2A 1DGRN 1GP5A 3GZUC 5BNPB 1GYKA 3FZ3A 4WVMA 1OUXA 3TN93 1EV12 4YGDA 4LO5B 3VKNA 1JYWA 2JX9A 2FZ1A 2HYKA 4YW3A 3DCQA 1S2EA 2AH2A 1CZSA 3WF3A 4PJYA 2Y6LA 2W2IA 5FO7B 1WA6X 2WNEA 2RV9A 2JIGA 2QE3A 3A21A 3AKQA 3MUZ1 4UAPA 3B01A 2VECA 3WG4A 2VUJA 4YZ4A 5FZMA 4BQXA 3NNFA 2QQJA 3HVDA 2ZAHA 4AI1A 5GZGA 1KRIA 1QJX3 3LF7A 2E9QA 4AWDA 1SPPB 3IAPA 3VL9A 1JZ6A 1UMIA 3WNNA 3AX4A 4FBFA 2VMGA 2ZGMA 3MIFA 4NMIA 4E2QA 3BB6A 3DL3A 1OOPB 1UU6A 1VBD3 2JJ6A 1AR72 2VQAA 2R6QA 2ZZQA 4GMP1 1JN2P 1H2MA 3CJIA 2WZR2 4LBOA 4WVZA 4AEDB 4CRQA 4DPNA 4K8FA 3RSJA 4BZ4A 1XYOA 4FXGB 4W6XA 2D3PA 1PMHX 1SBDA 4AAPA 2EXKA 1FMD3 1CAXB 1R083 2IVIB 5FY5A 1A6CA 5DG1A 5AC91 3ZVXA 2WRAA 1H4GA 1SFNA 5SV8A 1QMJA 3FL7A 4G3YC 2LALA 1W6PB 5DAXA 5DN2A 5JXIA 1DIWA 5GLUA 3LWCA 1YQ2A 4YM2A 3H8UA 3VZOA 3THDA 4OZOA 3MI8A 5JR2A 5I91A 1BEV2 3C8XA 2W95A 5A70A 3EQEA 1XB9A 3WCRA 4JQRA 1X7NA 2P6HA 1OQEA 1NA1A 5FXWA 5F37A 2ZABA 1S0JA 1POQA 4IDZA 2ET7A 1A34A 4Y4YA 3HN3A 3D8CA 3OEBA 1EAH3 1E57A 3SEPA 3P3PA 2D93A 2JDAA 2VNVA 3SCGA 5K7PA 1SLTA 3Q8EA 1HXS2 1S0IA 2C5DA 2F4LA 2HWC1 2I74A 2ZGRA 2VC9A 3MPBA 1O5LA 2VUAA 4CUBA 1DQ4A 1W8TA 3DPRA 5ANNA 1QJY2 2OPWA 3WZ1A 3KHCA 1W99A 2A3XA 1RUC2 1ENSA 1UWWA 3KVAA 1DGRA 4QXHA 2MHFA 1RUOA 4CCCA 2ADEA 4XZUG 3WP5A 3N7LA 3FMGA 4AF9A 1LJ7A 3NKGA 4GMP3 1AX1A 5IAXA 1XXNA 1WW7A 4JGZB 1ZREA 4FSJA 3E5QA 4QM8A 4Y1VA 1BMV2 1WLTA 1H30A 3VDAA 2J1UA 3JQXA 5ERLA 2W0XA 4LJHA 5A6QA 3BTZA 4DXRA 1W9WA 1RUE1 1PIV2 1CZTA 2JDYA 3DKQA 3POEA 4HSLA 4BMEA 3UK9A 3IBMA 4UW6A 3ETQA 1H2LA 1PGSA 4E4DX 2H0VA 4CZSA 2XH6A 3THPA 1RUI2 4CDWA 3NJYA 4WM7C 3ZYRA 4Q27A 2RMU1 2X5IA 3AKRA 1UN1A 4IV1A 4BE3A 1QJU2 4PQQA 2VZOA 1H8VA 1H0BA 3LDBA 3NWKA 4F3JA 5A33A 4LR4A 1D0HA 4IEQA 4MX3A 1LOFC 4TYSA 4HVOA 4GH4A 4B7KA 5A3WA 1S1AA 4KMQA 4RS5C 2JEMA 3CNAA 2VL4A 2D43A 4URTA 2ZX1A 4Y1YA 1IG0A 5FPAA 5FQ0B 5FPLA 2HWC3 3WINE 4DXZA 1CX1A 1AZDA 1FT9A 1UXXX 2OUHA 3A22A 3T2TA 4CDUA 5L7OB 5CFDB 4B4QA 2P1BA 1WWYA 3KF5A 3WP3A 3AZXA 1W28A 5FYIA 1XNDA 5GLZA 5L73A 4XIKA 4AQ6A 4HKLA 2XJSA 4CDXB 1CAUB 3D6EA 3HOBA 5DXDA 3FX3A 2GH8A 4JGYB 4BQYA 3OTFA 4P00B 2VOXA 4RA0A 3POJA 5LA1A 2FCVA 1UZZA 2UU8A 4H2AA 3PUSA 3EB7A 5LA0A 1ONAA 2GN3A 1DZQA 3D0JA 2RDSA 2GNTA 4PLOA 4TLFA 5A7QA 3AP6A 2BU9A 4JHZA 1TMF3 4ARYA 2XOMA 1SG3A 2JDMA 4LIUA 1TG7A 4MXVA 3VBFA 3LPFA 1RUE3 1LESA 4YG0A 5A3OA 4NPMA 2YU1A 2F17A 3A23A 1PGL2 2R49A 1G6NA 1XU1A 4ITCA 1WW6A 3MIGA 4LHKA 1AL0G 4DOUA 2A73B 2Y26A 4NROA 2XUMA 2Y6GA 3POWA 4FFGA 1HIXA 2XBO2 2YGLA 4Q4X2 4KWLA 4XFGA 2RMU3 3PIJA 4AOCA 4XDOA 3VDCA 1UQXA 5GZFA 4ZS2A 4MADA 2J1VA 2J1AA 2O8QA 1YWKA 4K1YA 2YV8A 1RHI1 5FZ8A 1RUG2 4N53A 1R1A3 3VD7A 1W8NA 2H6CA 2IC1A 2VMIA 5F2SA 3WEZA 2VH9A 1N1SA 2W91A 2CNAA 3K75B 4CEYA 5BNOB 2VMHA 2O14A 4XHXA 2WN2A 5FZCA 1LULA 4Z2AA 4H14A 1RUNA 1UIJA 5CFCA 2B9VA 1JH5A 4Y33A 4YVSA 4DY5A 4LKDA 1VP6A 4S2GA 1W6NB 2VNGA 4A7ZA 1VBB3 3ZXKA 5JZGC 4X6RB 2NP0A 2HWF2 3ZYHA 3E6CC 1ZM1A 3RMYA 1K3IA 4I09A 4XTMA 2EXHA 4M3CB 4YRDA
chains in the Genus database with same CATH topology
2HBTA 2V4AA 5L9BA 4KBZA 3OUHA 5ERLA 3PL0A 4XACA 3ITQA 5DAVA 3DKQA 4IW3A 4NHMA 5A3UA 4NHXA 4Q5OA 4XCAA 5EPAA 3W21A 2JIJA 3W20A 4J25A 2FCTA 5HV4A 2FCUA 4MHUA 2Y33A 4JZRA 2JIGA 4XABA 2G19A 4BQXA 3NNFA 4UWDA 5HV0A 4Y5SA 4XC9A 4NMIA 5LBCA 3OUJA 4XCBA 3NNMA 4BQYA 3HQUA 2FCVA 2G1MA 5LASA 2RDQA 2RG4A 5C5UA 3MGUA 2RDRA 3KT4A 2RDSA 3GJBA 4ZONA 3OBZA 3KT7A 4NAOA 5DAXA 5DAQA 5LBFA 5IAVA 3NNLA 3GJAA 4NHYA 3BVCA 5C5TA 4NHKA 5LB6A 4XAAA 2Y34A 3HQRA 4Y5TA 4ZPIA 5EP9A 5L9RA 3OUIA 3EMRA 4MHRA 5EQUA 5IATA 2OPWA 5LBBA 3GZEA 5LBEA 2HBUA 4NHLA 2A1XA 5M0TA 5L9VA 5DAWA 3KT1A 5LA9A 5IAXA 4BQWA 5LATA 5DAPA 3NNJA 2RDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBT A;  2V4A A;  5L9B A;  4KBZ A;  3OUH A;  5ERL A;  3PL0 A;  4XAC A;  3ITQ A;  5DAV A;  3DKQ A;  4IW3 A;  4NHM A;  5A3U A;  4NHX A;  4Q5O A;  4XCA A;  5EPA A;  3W21 A;  2JIJ A;  3W20 A;  4J25 A;  2FCT A;  5HV4 A;  2FCU A;  4MHU A;  2Y33 A;  4JZR A;  2JIG A;  4XAB A;  2G19 A;  4BQX A;  3NNF A;  4UWD A;  5HV0 A;  4Y5S A;  4XC9 A;  4NMI A;  5LBC A;  3OUJ A;  4XCB A;  3NNM A;  4BQY A;  3HQU A;  2FCV A;  2G1M A;  5LAS A;  2RDQ A;  2RG4 A;  5C5U A;  3MGU A;  2RDR A;  3KT4 A;  2RDS A;  3GJB A;  4ZON A;  3OBZ A;  3KT7 A;  4NAO A;  5DAX A;  5DAQ A;  5LBF A;  5IAV A;  3NNL A;  3GJA A;  4NHY A;  3BVC A;  5C5T A;  4NHK A;  5LB6 A;  4XAA A;  2Y34 A;  3HQR A;  4Y5T A;  4ZPI A;  5EP9 A;  5L9R A;  3OUI A;  3EMR A;  4MHR A;  5EQU A;  5IAT A;  2OPW A;  5LBB A;  3GZE A;  5LBE A;  2HBU A;  4NHL A;  2A1X A;  5M0T A;  5L9V A;  5DAW A;  3KT1 A;  5LA9 A;  5IAX A;  4BQW A;  5LAT A;  5DAP A;  3NNJ A;  2RDN A; 
#chains in the Genus database with same CATH topology
 3ILN A;  3O0W A;  3B9I A;  2VW1 A;  3ES1 A;  3RGB A;  3DN7 A;  4HMZ A;  4RGK A;  5JSP A;  1PO2 1;  2BJS A;  4GUL A;  3MZH A;  2WS9 1;  3P6B A;  3H8O A;  4RQP B;  4FVV A;  2WSV A;  1HJG A;  3VBU C;  2QQL A;  4CU7 A;  2XUE A;  1LAJ A;  3T4H B;  3RZL A;  3J8F 1;  3LFI A;  1SCR A;  1TNF A;  2R06 2;  2XJU A;  4LA3 A;  3P3N A;  5I0R A;  5K8S A;  3VD9 A;  2VW2 A;  4XPV A;  2DCT A;  1OQD A;  2DU0 A;  4LPL A;  4Z82 A;  3UJQ A;  2WYF A;  3I3B A;  4BMB A;  3I3E A;  4CEW A;  3OGG A;  1YXW A;  2RS1 1;  1IKQ A;  1VAV A;  5C4W A;  1XOY A;  3LDR A;  1G9B A;  2UUR A;  2Y33 A;  3JBG 1;  4RFR B;  3ZFG B;  4A4A A;  1WMF A;  2AR6 A;  4ERO A;  2R07 3;  2WKK A;  3HT1 A;  5JWP A;  2ZHL A;  1J3Q A;  3WUD A;  5KXC A;  4B7E A;  4XFH A;  4A6O A;  1ZA4 A;  1MS3 A;  1CON A;  3CMG A;  5T5O A;  4A41 A;  2ZCW A;  2FD8 A;  1Q43 A;  4CU9 A;  1VRH 2;  5F1R A;  4EQV A;  1PO1 1;  1Q56 A;  4YFZ A;  5A3M A;  2K0G A;  4R9D A;  1WBL A;  1RUJ 1;  1UD1 A;  2ERF A;  4E27 A;  1LHU A;  3APB A;  1IQA A;  2VNO A;  3NNM A;  3HWJ A;  3OUJ A;  4HSJ A;  2EXJ A;  1SLI A;  4MGK E;  4QMA A;  5FYM A;  1AL2 2;  5FPZ A;  4AEM A;  3BI3 A;  3U37 A;  5LWB A;  1WCQ A;  4UBH A;  5F2W A;  2D5H A;  1D4M 3;  4XYX A;  3ZIW A;  5FO9 B;  4D7T A;  3I97 A;  3OBA A;  1YJK A;  4PBP A;  5T50 A;  1LCL A;  2CL2 A;  3OBZ A;  5EHD A;  1Y7B A;  2WC2 A;  4LO8 A;  1BJQ A;  2J42 A;  3B00 A;  2TUN A;  4OI4 A;  1PO2 3;  1ZA7 A;  2VCC A;  2WS9 3;  1SHW B;  2QZ2 A;  4P5H A;  2GAL A;  2ZPX A;  5EJ3 A;  1E5R A;  2OXB A;  4OVE A;  4IEV A;  3W5N A;  1OLM E;  3T1M A;  3O1U A;  4IES A;  4KU7 A;  4YM3 A;  3AKT A;  4LTA A;  5LBF A;  4BQ1 A;  2MEV 2;  1YQC A;  3J8F 3;  4HKW A;  5JIA A;  3WQ7 A;  1UZY A;  3KV5 A;  4D7S A;  1HRV 3;  4IGP A;  4Y5Z 0;  4MXW A;  2VMF A;  4FO9 A;  5A6Z A;  2FBE A;  3NAP C;  2VO5 A;  3Q8C A;  5CYY A;  5EV7 A;  2VE1 A;  2ZX4 A;  3KCX A;  1CX4 A;  1IQD C;  4UF0 B;  3AKP A;  2GNM A;  2E6V A;  4GWN A;  4NRM A;  5G05 L;  3RYP A;  1AR6 2;  2RS1 3;  3C7O A;  3CDZ B;  2YFZ A;  2VCA A;  2VMC A;  4OI0 A;  1RJ7 A;  4JRL A;  4FOV A;  4HZF A;  2Q1Z B;  2PHD A;  1E5S A;  3POF A;  5IFT A;  4AVS A;  5LRS A;  3GHN A;  2AGS A;  1JHN A;  4Q4Y 2;  1OF3 A;  3QOP A;  5C8C C;  2RS5 2;  1SLL A;  5CIS A;  2TNF A;  2OZJ A;  2GH2 A;  3CO2 A;  5FR3 A;  2NN8 A;  3I59 B;  1ZRR A;  4Z92 B;  4FOW A;  1ZZC A;  1RUJ 3;  4M0N A;  2ILM A;  1NCQ B;  3N4M A;  4O61 A;  3BTY A;  5JIU A;  2DYC A;  4LA2 A;  3WF1 A;  1CES A;  4YPJ A;  1ULE A;  2VUD A;  1V9U 2;  3NO8 A;  1NY7 1;  5T5J A;  5JOX A;  1PM4 A;  1WW5 A;  4QKF A;  5AFE A;  4IE4 A;  3IPV A;  3MIE A;  3O14 A;  1HJF A;  3POI A;  5HCB A;  1RVF 2;  3ZFF B;  1UIK A;  3H7J A;  2GND A;  1H8T A;  1VBE 1;  1ZBE 1;  1UMH A;  3C2U A;  3JB8 A;  5CKM A;  3MIC A;  2JDZ A;  2RR1 3;  4AFB A;  3EBR A;  3ITQ A;  2H0B A;  1YO8 A;  4DRV A;  3O1V A;  1O4Z A;  5FIX A;  5EZW A;  1UW8 A;  3OY8 A;  1OH4 A;  3QH7 A;  1NLR A;  2XJT A;  3GZA A;  3LIG A;  4XCA A;  4EWA A;  2OX0 A;  1JOP A;  2NPI A;  2WA4 A;  3ENR A;  2CAV A;  4GQ7 A;  1HLC A;  1YI9 A;  3MFA A;  2P2K A;  4V2W A;  1JMU B;  2P3Y A;  1QNY A;  2VZQ A;  2DTW A;  3AM2 A;  2ZX2 A;  4EN8 B;  2ZAC A;  2BVB A;  2WNU A;  1UY0 A;  1JOJ A;  2XHN A;  3FLT A;  2LUW A;  2JDK A;  3LIH A;  4RSU A;  3NL1 A;  3SNM A;  1BVV A;  3J7L A;  2ZGP A;  2XB6 C;  4AE2 A;  5FUP A;  1KEX A;  4IE0 A;  4YNI A;  4ES8 A;  4N9H A;  3RYR A;  5H9S A;  5L7O C;  1YQ5 A;  3U4X A;  1VLN A;  3VZL A;  2VTX J;  2E53 A;  1UX6 A;  2BV4 A;  2JXA A;  4Y5S A;  1UY4 A;  4CDX C;  3T2O A;  4Q0Q A;  4PT6 A;  4CDQ A;  4P9X A;  3VBS A;  2PLV 1;  4W4Z A;  1BKZ A;  3OBR A;  4X8N A;  3MW3 A;  2ZGQ A;  2XLA A;  1S0F A;  4EYU A;  2VTX A;  1YRZ A;  4IV3 A;  4Z1V A;  1OD3 A;  1H1I A;  3VBR A;  5BNN B;  4P9J A;  2ARB A;  5C5U A;  1NAE A;  4NE9 A;  2VZT A;  4QX8 A;  4AXO A;  4Z2W A;  2P4E A;  2E33 A;  3K77 A;  4UFM A;  1TEI A;  1PNG A;  3IZO A;  1F5F A;  2A3Y A;  2HWD 2;  1J59 A;  3Q9O A;  1WZX A;  1YI7 A;  1APN A;  2Q8O A;  4XF1 A;  4DMI A;  2F4P A;  4AVC A;  3MF9 A;  3I2D A;  2RJK A;  1HB4 A;  3LB9 A;  1OC1 A;  3G7D A;  5KBF A;  1GP6 A;  3O5S A;  3III A;  5C3P A;  1XNC A;  1CGP A;  5FMB A;  2FMD A;  3U11 A;  2D6N A;  2DUR A;  5GKA C;  3TN9 2;  3FN9 A;  1O5U A;  3BYW A;  1BQP A;  2Q8E A;  5F9T A;  3V0A B;  5E1R A;  2R16 A;  4RHV 2;  2BBV A;  2YC4 A;  3AJZ A;  5A3P A;  5GM0 A;  3R4U A;  4YVW A;  1GBG A;  4MYE A;  1LU1 A;  4AFC A;  1FAT A;  1LB2 A;  1QJX 2;  1RIT A;  4IEY A;  1PNF A;  4JKK A;  4YZ1 A;  2P3J A;  4GWJ A;  4KG8 A;  3SMH A;  1A78 A;  5DUX A;  1OLM A;  2IXH A;  4E8C A;  5H9P A;  3I8T A;  1BCX A;  4YWA A;  4EJR A;  2WO3 A;  5FJK A;  3WDY A;  3AP9 A;  2A75 A;  5FYH A;  3ZR6 A;  4Y1X A;  1MS8 A;  3HEI A;  4NRP A;  2XL9 A;  4S2H A;  3EO6 A;  2IUW A;  5FP9 A;  2QTW B;  1AR9 1;  1HN1 A;  1UOF A;  3WQ1 A;  3HQX A;  3GM8 A;  1FMD 2;  3J26 N;  3ZXJ A;  3VBO A;  3DYM A;  3VHO A;  3VZM A;  1GZW B;  2ETE A;  4KBB A;  2WAA A;  4XJA A;  2PHU A;  4RQP C;  4PDW B;  3WNL A;  2VGD A;  1XYP A;  1AXZ A;  1MZ5 A;  1REE A;  3U1X A;  3VL8 A;  4I01 A;  2MNG A;  1OFS A;  2C1F A;  2W3J A;  5J98 B;  4Q4V 1;  2JIJ A;  1Y3T A;  1M4W A;  2ZZJ A;  3IM0 A;  3NV2 A;  3AK0 A;  4JRA A;  2W1S A;  1KS5 A;  1VB4 A;  1J84 A;  4GKX A;  2WNV C;  3AVR A;  2DF7 A;  3QLQ A;  2FCT A;  3B93 A;  4ES9 A;  2W1W A;  2PN5 A;  4LBL A;  5HPO A;  1EAH 2;  2B42 B;  2Z5W A;  3ZFG C;  1D0G A;  5IK4 A;  1BBT 1;  1R09 3;  3SKV A;  1EPZ A;  1TME 3;  3B94 A;  3MO4 A;  2RS3 1;  1MQT B;  1E5I A;  1B35 C;  2ZMK A;  3IT8 A;  2AZ5 A;  2QDN A;  2VQT A;  5FZ3 A;  1VAM A;  5GJ6 A;  3VBH A;  3WCS A;  2G4I A;  4P14 A;  1IPS A;  3IAQ A;  1JXN A;  3N36 A;  3WW4 A;  5IVJ A;  3MW2 A;  3H42 B;  4L2N A;  3VD5 A;  4AFA A;  4MGQ A;  1HDK A;  1ND2 B;  1LU2 A;  1QOS A;  4XAE A;  1WLW A;  3LEK A;  4XQW A;  3I3Q A;  1W9S A;  2UYB A;  1RB8 G;  3AMP A;  3WX5 A;  2YC0 A;  2EIG A;  3J9S A;  4AHW A;  5FP8 A;  3RG0 A;  4ONU A;  4ZON A;  2IXJ A;  1F31 A;  3LEG A;  2VW0 A;  3VDD A;  5FO8 B;  1R64 A;  1GNH A;  1VBC 3;  2IXL A;  2JKX A;  3M3E A;  5JI9 A;  1F8V A;  1WCS A;  2FDJ A;  4LBJ A;  5K0U A;  1LNS A;  1UZV A;  1MS5 A;  3NST A;  3ETP A;  3FC0 A;  1FOD 3;  1TE1 B;  1ZBA 2;  4PLN A;  4XF0 A;  3RQ0 A;  3ZX7 A;  5GAL A;  4A44 A;  2J22 A;  3RZG A;  3ELN A;  1RGS A;  1OH3 A;  2PHT A;  1AXK A;  1YQ8 A;  3DUI A;  5C3R A;  4YYO A;  4F83 A;  3JUU A;  3MHZ A;  1AHS A;  3CJI B;  4CXX A;  1UYZ A;  1MS4 A;  2BNM A;  2D97 A;  2OZ6 A;  1ENX A;  1IOA A;  5DZF A;  3BPZ A;  4G4F A;  1QJE A;  1RED A;  1ND3 C;  4XAA A;  2XWJ B;  2C26 A;  1BBT 3;  4UFH A;  2QQM A;  4TSV A;  2RS3 3;  2V5Y A;  3RZZ A;  4DY3 A;  4F8A A;  3UT0 A;  2ET1 A;  3M3O A;  3EMR A;  1US3 A;  2ADD A;  5FP3 A;  2BGO A;  3E97 A;  1RMU 3;  1KIT A;  2Q1F A;  3AP4 A;  5FXZ A;  2GP5 A;  3AFG A;  2HWB 1;  1RUD 2;  1VPH A;  1GKB A;  5A6Y A;  2YPD A;  5A7W A;  1EP0 A;  1NCQ C;  4GIQ A;  3DYP A;  3SIT A;  4J6G A;  2Z79 A;  3C7F A;  4XJ8 A;  1NA1 B;  4MGY E;  1Q8S A;  4LO4 B;  4MOA A;  5FY4 A;  1W3X A;  1VBA 1;  2BYV E;  2BGC A;  2WZ8 A;  1OUS A;  2WYS A;  3BGA A;  5ANQ A;  2C4X A;  5FBJ A;  3MPP G;  1SZB A;  1LOE A;  2DUP A;  2ZGK A;  2IWG B;  4FQ4 A;  4B4R A;  4OMC A;  3O1T A;  1SAC A;  4LT5 A;  1TMF 2;  3ME2 A;  2AUY A;  1V6L A;  1LOA A;  5FK7 A;  4IW3 A;  1YYN A;  2EA7 A;  1RXF A;  2VD7 A;  4QDS A;  1STM A;  1XPW A;  2ZS6 B;  4QPI C;  5FXX A;  3W58 A;  4QU2 A;  2B4K A;  1O3Q A;  2WBK A;  1PVX A;  2YC2 A;  4L0P A;  4LOS A;  3WW1 A;  1NQJ A;  1YIF A;  3CU7 A;  4QHB A;  3I4I A;  4FPY A;  2WFP A;  5FZO A;  4YW6 A;  1FV3 A;  3LPG A;  2XHK A;  3RNS A;  4L9B A;  4HG6 B;  4QGM A;  4RN5 A;  1N3P A;  3UYJ A;  2GN7 A;  3RJ2 X;  4FTB A;  1S0D A;  1U5I A;  4QKB A;  1SLA A;  2XKO A;  3K2O A;  1QQP 2;  2DBN A;  3AJY A;  4P02 B;  3MV1 1;  5DDJ 3;  4CU8 A;  1R1A 2;  4GWM A;  4KQ7 A;  4Q1R A;  3PHM A;  1L3J A;  2ARX A;  3OPT A;  2DDU A;  2BQP A;  4BQ2 A;  2PEL A;  3ZO0 B;  5DUU A;  4BLJ A;  5B4X A;  2E26 A;  4E8D A;  3WLU A;  3DV8 A;  3ZSL A;  1JYT A;  3MDP A;  3S7E A;  3SH4 A;  1O4T A;  5FLJ A;  3UKN A;  1AYN 1;  3UES A;  1VBB 2;  4JTO A;  4LNV A;  1J1L A;  2ORZ A;  4I0W B;  4KNC A;  4CDW B;  1JUH A;  3KB5 A;  4FFF A;  2X5I B;  3MID A;  4FPG A;  1VBA 3;  4OHV A;  1O59 A;  4BQ3 A;  1BXH A;  4YGB A;  2HH9 A;  5A33 B;  3GJB A;  3UGG A;  5L36 A;  4MG2 A;  4QD2 A;  4NO4 A;  3N3H A;  2Q1M A;  2Q5T A;  4GH4 B;  1A3K A;  5FYU A;  1S0B A;  5FZK A;  1QDC A;  2K2S A;  5CEH A;  5I8T A;  5E89 A;  3GDB A;  5BNQ A;  1PZ8 A;  1ULO A;  3POB A;  1CVN A;  1LEC A;  3PVN A;  1FPN 1;  4RL7 A;  1K5M A;  1PVC 1;  4XZP A;  2WN3 A;  4CDU B;  2IXK A;  2W87 A;  4PQ9 A;  3H3L A;  4AFD A;  1FI2 A;  3KMH A;  1N3Q A;  1X9T A;  1W6Q A;  4OI1 A;  1KJR A;  3BIE A;  2K46 A;  5BPX A;  4KWK A;  4WV8 A;  2EAK A;  5KC5 A;  3LSD A;  5FPU A;  3NNL A;  4WM7 A;  4YM1 A;  1FAY A;  5LEK A;  4FXK B;  1C57 A;  4GA9 A;  4QPW A;  4Y1Z A;  5FZH A;  3OF1 A;  4S2D A;  4LO6 B;  2BBA A;  2WO2 A;  4IER A;  1O91 A;  2CDO A;  1AR8 3;  1SQ4 A;  2JE9 A;  2ZGT A;  4BXS V;  1COV 1;  1CAW A;  4Y5T A;  4ZKT B;  2R07 2;  4YZ5 A;  1WKY A;  5L9R A;  3POG A;  1X8E A;  4C90 A;  3T2P A;  1DYK A;  1H4H A;  4HN1 A;  5FZ6 A;  3VBF B;  4LKF A;  4QAW A;  2ZEY A;  5JMO A;  4EN6 B;  3H9A A;  3O0V A;  2JG8 A;  3J7M A;  1UY2 A;  2QQO A;  2VPV A;  1LEM A;  2HBU A;  4ZZ5 A;  1MEC 1;  4BIF A;  5FZ9 A;  5LK5 A;  4V2V A;  3S30 A;  1Y43 B;  5F32 A;  1AYN 3;  2WL1 A;  3LOB A;  1JZ7 A;  4KGQ A;  2P37 A;  2W47 A;  1AJK A;  3S5Q A;  2QFE A;  4XFI A;  2OPK A;  2X29 A;  1TQ5 A;  1PHM A;  1C8M 1;  1W2A X;  1QNW A;  4PLM A;  1OSG A;  1WCK A;  3AZZ A;  1OFN A;  2RDN A;  1DZT A;  3MF6 A;  4HBN A;  4HXC A;  1D4M 2;  3O0X A;  2HBT A;  3OYW A;  4Q0S A;  2Z2S B;  2EF6 A;  2QQP A;  2WLP A;  2I45 A;  3B3Q E;  1OPM A;  1NCR C;  2I07 B;  4MGI E;  2ZEZ A;  3OOX A;  2PHF A;  2DVB A;  5IVB A;  1LHV A;  1KGY A;  2RHP A;  4N53 B;  3FUQ A;  2X09 A;  5DAV A;  3ZSK A;  4CEY B;  1YLL A;  4Z07 A;  5FY8 A;  5FY9 A;  3WF2 A;  3U78 A;  5KXD A;  1PVC 3;  5TSW A;  2V09 A;  1HB1 A;  2R04 1;  2X05 A;  5FYT A;  1Q8O A;  4CU6 A;  3ZDS A;  5CFC B;  5DG2 A;  4OLL A;  4IL7 A;  4LMF A;  4YVS B;  2UWA A;  1HRV 2;  5C70 A;  3MIB A;  2JEC A;  5FZ4 A;  3AXD A;  4A45 A;  4LHL A;  4QGL A;  3M7A A;  1U5X A;  2EAL A;  4NII A;  2OVU A;  4X8P A;  3ZR5 A;  3BU0 A;  2OQ7 A;  3O1O A;  5IVF A;  3TEW A;  3MEP A;  5FCC A;  1VAL A;  3GCW A;  1COV 3;  1O6U A;  4XE9 A;  5AC9 3;  1AYM 1;  1QY4 A;  3AMQ A;  5EIY B;  1GWK A;  5FAX A;  4AHX A;  2E63 A;  4DQA A;  3TNP B;  3JZV A;  5FZF A;  2GU9 A;  4YW4 A;  1O8P A;  4W6W A;  3WP4 A;  4YGC A;  2NZ9 A;  5LY1 A;  1UKR A;  1RIR A;  2BP6 A;  4FPK A;  4YW5 A;  2XLG A;  3NV3 A;  3ZLI A;  1MEC 3;  2A6W A;  1ND2 C;  4FP2 A;  3WG3 A;  1GNZ A;  3JQW A;  1GLH A;  2VM9 A;  4XBN A;  5GZD A;  2Y6K A;  5JZG A;  1NLQ A;  2OUJ A;  3ACH A;  3WDU A;  2YZ4 A;  5D8A A;  4KU8 A;  4CEW B;  4COZ A;  1Z7S 1;  1IGO A;  2YU2 A;  3B69 A;  5C4W B;  4IEO A;  2VR4 A;  3QCW A;  3FE5 A;  4ZHN A;  3PIG A;  4FQZ A;  2WWS A;  2RR1 2;  4DUW A;  5ACA 1;  5JOW A;  5C7G A;  4PF5 A;  3ZFE C;  1WME A;  2EAA A;  2ZHN A;  3VBU A;  2UYA A;  4MUV A;  3L2Y A;  2W68 A;  3E6B A;  4GB3 1;  4XUR A;  4A7K A;  4BDV B;  1DF0 A;  2FDI A;  1QU0 A;  1RUF 1;  2GP3 A;  4LE4 A;  3A0K A;  5FZI A;  4AYU A;  4ARX A;  1WGP A;  3KD4 A;  5IAV A;  1UOG A;  3N7J A;  4WVW A;  3L2H A;  3WNK A;  5E6H A;  4B8E A;  3KCY A;  3IIA A;  3I2J A;  2Y0I A;  2WNO A;  3HNB M;  1W8F A;  1HRI 1;  3FLR A;  3P1I A;  3R4S A;  5A1L A;  2IZW A;  1DQ0 A;  4YW1 A;  5LB6 A;  1YC6 1;  3VZK A;  1K12 A;  4XXP A;  1OT5 A;  2DVF A;  3AYA A;  1IS6 A;  4XXA A;  4PI0 A;  2HYX A;  4M0H A;  1AYM 3;  4SLI A;  2GC3 A;  4WM8 B;  4QX1 A;  4TLG A;  4M00 A;  3QH6 A;  4GJY A;  1NUK A;  5FOJ B;  1WD3 A;  4P9Y A;  2A71 A;  3BOP A;  1SLB A;  3LZZ A;  5IAT A;  1KQR A;  1HV1 A;  4K1Z A;  4UT5 A;  5LBB A;  4XTP A;  4OUM A;  5F8P A;  3WHT A;  4LK6 A;  5C33 A;  3WF0 A;  4UFI A;  5CIR A;  2VBP A;  2VVE A;  1XNB A;  3AZV A;  1NA1 C;  5DAW A;  2L9L A;  4UW3 A;  1EV1 1;  4N7I A;  4RR3 C;  3WW2 A;  2JE7 A;  3B9C A;  5JOZ A;  5C9A C;  1ACC A;  4I02 A;  3IWZ A;  1D2S A;  3I49 A;  2WUH A;  5FRA A;  4MXW B;  1RTV A;  2GC2 A;  5CG9 A;  3CL1 A;  1F9K A;  1H9W A;  2JG9 A;  2V4A A;  2A3W A;  1ASJ 2;  1YIP A;  4QX7 A;  3C3V A;  1CIW A;  1W9Y A;  3PL0 A;  1V0A A;  1UYX A;  3R0R A;  3M3C A;  2BWA A;  3KGZ A;  4O9G A;  3D0S A;  4WZC A;  2CAU A;  1DLC A;  2KD7 A;  3K4Z A;  3ZYJ B;  1JYI A;  5FUI A;  3ZN4 A;  1XJA A;  1OLR A;  2CSG A;  1ZNP A;  2JDP A;  2DU1 A;  3FFZ A;  4GB3 3;  3U4S A;  2P6C A;  4M4R A;  3GBF A;  5J7M A;  5JCT A;  4AI8 A;  1AR7 1;  4D3W A;  4LKE A;  4FPH A;  1OI6 A;  2WZR 1;  4H7M A;  4LQR A;  4ASK A;  2VXJ A;  5HXM A;  2ZGO A;  5FZA A;  2WQ8 A;  4QPG C;  4R9B A;  4FCA A;  3NAP A;  4UW5 A;  3LCP A;  3WDW A;  1ENQ A;  2FMY A;  2W08 A;  2XJP A;  3ZXG A;  1HRI 3;  5HCH A;  2ARE A;  2JWP A;  4MHU A;  5F39 A;  4QGN A;  2VMD A;  5C3S A;  4XAB A;  4AVA A;  3FBM A;  4RGA A;  3LGR A;  5ABJ A;  4CUA A;  5JXG A;  3MW4 A;  2W5F A;  1MZ6 A;  3VHN A;  3GCX A;  5IHR A;  2HWE 2;  3KQ4 B;  2Y60 A;  2QQK A;  1GOF A;  2CYF A;  1Y4W A;  1PK6 A;  1YFW A;  3KVB A;  1OF4 A;  3M8L A;  4IGO A;  5C8C A;  4ASM B;  2E32 A;  3OY8 B;  1BEV 1;  1G86 A;  3GF6 A;  3LEM A;  4XDQ A;  5CKN A;  4EN7 B;  5JI7 A;  1WCU A;  5BNP C;  5HBA A;  3CEW A;  3ILF A;  4CYD A;  4WBB A;  2AAC A;  4AAX A;  1LGB A;  4XHB A;  2WLQ A;  5LAS A;  3MBW A;  4XUT A;  4N9I A;  3E1F 1;  4FPJ A;  3VKL A;  4MGS A;  2RDR A;  3MGU A;  1HXS 1;  2WNU B;  3OBT A;  3OGS A;  3UKV A;  1W9T A;  1HW5 A;  4C91 A;  5CU1 A;  1ST8 A;  3PVB B;  1SBF A;  1SBE A;  1RHI 3;  5IVY A;  3ZXA C;  4R9A A;  2YMZ A;  4CDU C;  1IPK A;  5JXJ A;  1QJY 1;  2BVV A;  4CCD A;  2NM1 A;  1RUC 1;  3U07 A;  4I30 A;  5IK8 A;  1EUT A;  3LA2 A;  1CAV A;  4N43 B;  4BPZ A;  1OOP C;  1GFF 2;  4K21 A;  4NWV A;  5T55 A;  4CDQ B;  3VBS B;  1RC6 A;  4FT8 A;  2WZR 3;  1BMV 1;  2OT7 A;  4UFK A;  4JDN A;  3VUO A;  2XON A;  4FI9 A;  4CCO A;  3OD0 A;  1P8J A;  4IV3 B;  4LBQ A;  1XBF A;  4NHK A;  4CP9 A;  3VBR B;  3AYD A;  3G6J B;  5J1X A;  5JAX A;  4IE7 A;  1J83 A;  2KXL A;  1QH6 A;  1R09 2;  2WFF 2;  1TME 2;  4TTG A;  1RUH 2;  3UGH A;  2XJV A;  3FHA A;  1PIV 1;  3VBF C;  1GUI A;  3OUI A;  3J7N A;  4D94 A;  5EQU A;  5LRR A;  4H55 A;  2VZU A;  2FDF A;  2YUE A;  3GZE A;  5EYX A;  3VHP A;  4D6R A;  5CAZ A;  1BEV 3;  1RUI 1;  4BK5 A;  2G9G A;  5F5I A;  2W9X A;  1G9C A;  5L9V A;  4Q4W 2;  3KT1 A;  1AX0 A;  4XIL A;  5E8A A;  2QQI A;  1T2X A;  3T1L A;  3ILR A;  1QJU 1;  1UYP A;  3UNP A;  1VAK A;  1W6M A;  3S5A A;  4XUO A;  5FPX A;  3M4F A;  3I3D A;  3OGJ A;  4FTS A;  4GKY A;  4TZD A;  1DYP A;  3AYE A;  3BIW E;  3ZIX A;  4I2O A;  4JQT A;  4BOW A;  1NZC A;  5FJH A;  1DQ2 A;  2W46 A;  1SMV A;  1ODM A;  2VQU A;  4ZXK A;  4A7Y A;  5EFU A;  4Y24 A;  2VNR A;  3JBG 3;  3WUC A;  4TN7 A;  4YVW B;  1VBC 2;  3KZ4 C;  5C8W A;  3F95 A;  4HPK A;  4AW7 A;  1W03 A;  3SLI A;  4IEX A;  2QQV A;  2XGX A;  1UPS A;  2ZJC A;  1LR5 A;  5JLV A;  1FOD 2;  3QAC A;  3ST7 A;  2VVD A;  2FDH A;  2P3K A;  1W39 A;  2Q4S A;  3IDC B;  5CFC C;  1X36 A;  4LHS A;  4YVS C;  4QDQ A;  1PO1 3;  3N7M A;  4J25 A;  4GWI A;  2DWR A;  4TWT A;  4JGZ C;  4ZY9 A;  4FOQ A;  2WAO A;  4Q29 A;  3WXP A;  1PX4 A;  3ON7 A;  5FDB A;  1XE8 A;  3KV4 A;  3USU A;  3THC A;  1GWL A;  2YRO A;  3IDE A;  1V6I A;  4D6Q A;  4JKM A;  4KL1 A;  4U36 A;  2Y8K A;  3KWV A;  1S0E A;  3VBO B;  4NVP A;  4BU2 A;  1HKD A;  4QQO A;  1PIV 3;  3PUH A;  1O3T A;  1K5J A;  2OW4 A;  1PGL 1;  1XRU A;  2YFU A;  1W90 A;  4ZZ8 A;  4Y4R A;  3GNE A;  5CNA A;  3CIH A;  2QQU A;  4B4P A;  1RMU 2;  1PM7 A;  4G9S B;  4QB1 A;  2OII A;  1H9P A;  4IET A;  4IUG A;  1RUI 3;  4Y1U A;  3UV9 A;  5FKC A;  1C1L A;  2XBO 1;  4Q4X 1;  3SH3 A;  5JPN B;  3Q8A A;  3JD7 2;  3RFR A;  1QJU 3;  1I9R A;  4YG3 A;  3I2K A;  3KV9 A;  5HCA A;  1FNY A;  2RG4 A;  4XW3 A;  4DS0 A;  3KT4 A;  1B09 A;  5KC6 A;  3BOD A;  3ZYF A;  1RUG 1;  1S0C A;  1V6O A;  5KHG A;  5JPM B;  3R05 A;  4FAG A;  1ZX5 A;  1A8M A;  1DBN A;  1WW4 A;  1PGW 2;  1GOG A;  1OD5 A;  3OGV A;  4RQP A;  1ZYB A;  2EXI A;  2P3I A;  4C8D A;  2RM2 2;  5CFD C;  2JDH A;  5I8S A;  2Z42 A;  3HIF A;  4Z8B A;  4GD4 A;  3VBH B;  3RZM A;  1RXG A;  1VR3 A;  3RRD A;  2V4V A;  3U75 A;  2QJV A;  2VXR A;  4QX3 A;  5E16 A;  4AI3 A;  5ISL A;  2HWF 1;  4JGY C;  4M01 A;  5FZ1 A;  3N9Q A;  2WNV A;  4JC1 A;  2YYO A;  5LEJ A;  1ODN A;  3BAL A;  4AGR A;  1Q3E A;  2ZEW A;  5J3U A;  1XE7 A;  4J1X A;  2VBD A;  4M4P A;  3LAG A;  1ZZ7 A;  1S55 A;  3I2I A;  3IKW A;  4XF4 A;  5AFB A;  2FQP A;  3I54 A;  1YJL A;  5C6C A;  1A8D A;  3U0Z A;  5A1A A;  3D5O A;  2RJL A;  3HQR A;  2PQQ A;  2WDB A;  5DDJ 2;  2OKX A;  4AQ2 A;  3M3Q A;  5EP9 A;  5A3L A;  2D5F A;  4WM8 C;  1B35 A;  3DF0 A;  4B3N A;  1VBE 3;  1ZBE 3;  3ECQ A;  4MHR A;  3U10 A;  2QCS B;  5HXV A;  2GMP A;  5K0U B;  4D6S A;  4XJ9 A;  3RJR A;  3ZN6 A;  4NAM A;  2BFU L;  2HEY F;  4Q26 A;  5I0T A;  4DEQ A;  2MPF A;  3M3I A;  1TVG A;  1IS3 A;  2R06 1;  5I0U A;  3VGI A;  3H3U A;  2A1X A;  3KHB A;  1L7L A;  3LD8 A;  5M0T A;  3BN6 A;  4OFG A;  4WZF A;  3GXU A;  2XBO 3;  4Q4X 3;  1PMI A;  3E5X A;  4K3U A;  5FZD A;  1UY3 A;  3NNJ A;  5FBZ A;  1L7Q A;  4R8H A;  2ARA A;  5FZL A;  2UWC A;  3BKZ A;  3QBQ A;  4HON A;  4O65 A;  2E7A A;  2WA3 A;  1RUG 3;  3O1P A;  2R1B A;  3BUC A;  5BNO C;  4AI2 A;  1MPX A;  1W8O A;  1UX7 A;  4UOJ A;  4DUV A;  5A1F A;  3GZT B;  1GWM A;  3NV4 A;  4K20 A;  1VRH 1;  4BM8 A;  1MZE A;  1WD4 A;  3BU7 A;  4OYU A;  3TYJ A;  5B4N A;  2YDE A;  3DXU A;  1VRB A;  3PMS A;  4CA9 A;  5D2A A;  2FDK A;  1GP4 A;  4PCR A;  2UY9 A;  1WMX A;  2NLR A;  1QHD A;  4LEJ A;  5A32 B;  5A7W B;  4OI2 A;  4CSW A;  2WQZ C;  3Q8B A;  1VBD 2;  3MFC A;  1AL2 1;  2ZBJ A;  2PLV 3;  3PVO A;  3RI8 A;  5JDB A;  3ZMN A;  5KHJ A;  5KXE A;  2QUO A;  2X8K A;  3X29 B;  3F2Z A;  1GQG A;  1GSL A;  1TNR A;  2PHL A;  2QVS B;  5DUV A;  1ULP A;  3T0B A;  1YUD A;  2AEN A;  1W8H A;  1F4H A;  2PTM A;  4DO0 A;  1DFQ A;  1C4R A;  5A7P A;  1ND3 A;  2PHX A;  1AR8 2;  1R08 2;  1U5Z A;  5IW0 A;  3VZJ A;  2EIB A;  4JCK A;  4XJW A;  1UCX A;  4R9C A;  1ZRD A;  3ACL A;  2BFU S;  3CLP A;  3J4U H;  3WP6 A;  1U5Y A;  2W52 A;  1NYW A;  1OBN A;  4XEZ A;  3GBG A;  3ZXE A;  3C7E A;  3OEA A;  2BNN A;  4QPY A;  3I2H A;  2MEV 1;  4W8J A;  3M2M A;  1L7R A;  4Q1P A;  2V5D A;  1SDD B;  4YZ3 A;  4XFB A;  3RPQ A;  4XCB A;  1QXP A;  4B1L A;  5I93 A;  4R4X A;  5FZO B;  1UAI A;  3IDB B;  2XXZ A;  1X82 A;  5J48 A;  2WNU C;  2VZ1 A;  1AR6 1;  2YGM A;  5LW9 A;  2JB8 A;  3VKM A;  3FJS A;  4LK7 A;  2A5Z A;  4MET A;  1NLS A;  2D3S A;  3H7Y A;  4NOT A;  4M3C F;  4UI9 L;  3URF A;  2B7Y A;  1JU4 A;  2Y6F A;  1GZC A;  3TBD A;  3MUY 1;  4K6B A;  3I2G A;  4Q4Y 1;  4NAO A;  4Y22 A;  5FV3 A;  1PX3 A;  1Z78 A;  2RS5 1;  1ULF A;  2B45 X;  2YBP A;  4YG6 A;  2LTN A;  4QPI A;  1VRH 3;  1NT0 A;  5DAQ A;  2XQX A;  1ZRC A;  1K42 A;  2BOJ A;  4N43 C;  2ENR A;  4F7Z A;  2E7Q A;  3VBS C;  2BZD A;  1F5J A;  4BIO A;  3OPZ A;  1MS1 A;  1OQ1 A;  3UL2 A;  4QT6 A;  5IUQ A;  1V9U 1;  4DRR A;  1AL2 3;  3HN1 A;  2W92 A;  3PUQ A;  5FFO C;  2ZGL A;  4XQ4 A;  3WR0 A;  4WVM B;  2F6B A;  1OVS A;  3BVC A;  4NHY A;  4NPR A;  5C5T A;  2ZKL A;  2GAU A;  1AR9 3;  1RVF 1;  1DU3 D;  3RS6 A;  4BH9 A;  1FNZ A;  3ATG A;  5EYY A;  4EV0 A;  2PMW B;  1YQ6 A;  1V70 A;  5AC9 2;  3D4K A;  3HAG A;  4XQD A;  2H6B A;  2OQ6 A;  4NJ4 A;  3GAL A;  4GXL A;  4COY A;  1QEX A;  3PUI A;  2C0Z A;  1V00 A;  5F7U A;  3ZXF A;  5H9R A;  2WZP P;  2WT0 A;  3ZPY A;  4AEJ A;  1K5M B;  2IXC A;  3CZJ A;  3GYD A;  4UW4 A;  4QB6 A;  1QGL A;  4FP3 A;  1W6Q B;  2KM2 A;  2MEV 3;  2QQN A;  1C1F A;  2PXJ A;  1Y9M A;  1MS0 A;  4YSF A;  4Q4V 3;  2D40 A;  2PQS A;  3HD8 B;  2WZE A;  3K3O A;  5LA9 A;  4WM7 B;  2Y64 A;  5A7S A;  5DUW A;  3EJK A;  1VMJ A;  4XIO A;  1NKG A;  1SFY A;  1AR6 3;  2W94 A;  2D44 A;  2VY0 A;  2RVA A;  4N8M A;  5FYY A;  4XBL A;  3UGF A;  5FPV A;  3C7H A;  3HNM A;  1W6O A;  1CAW B;  1HB3 A;  2O0O A;  3WOG A;  4LLO A;  2HWC 2;  4DZG A;  2YG0 A;  4QKD A;  2D7F A;  5F5A A;  1W06 A;  2JG8 B;  2ZHM A;  1AF9 A;  3CHX A;  2Q30 A;  5CBL A;  2ZMN A;  4K40 A;  1WBF A;  4K8R B;  4MGT A;  4C0H A;  2JDU A;  3CBN A;  2BRT A;  4PF1 A;  2Y38 A;  5F3C A;  1LHN A;  1V9U 3;  3H1M A;  2GSY A;  1N3O A;  1OA2 A;  1VE0 A;  2A70 A;  3KSC A;  4IXL A;  4KH9 A;  4QM9 A;  3RWK X;  5EJ1 B;  4L99 A;  1KD7 A;  3OYW B;  3WNX A;  2ZX0 A;  3ZFF C;  2HWD 1;  4AL9 A;  2X53 S;  4QB2 A;  2LM3 A;  1LOB A;  3AC0 A;  1QOO A;  1ALY A;  2DVG A;  1J3R A;  2V72 A;  1SDW A;  5T5L A;  1UOB A;  3MV0 1;  2XWB B;  3FFQ A;  5LY2 A;  5HV0 A;  5D1I A;  5FTT C;  3ZDV A;  3TEZ A;  3TNQ A;  1RUE 2;  3T0A A;  2JEN A;  2VU9 A;  4KI5 M;  3CKH A;  3U14 A;  3T08 A;  4ZU7 A;  1ZZ6 A;  3DPR B;  4XC9 A;  4EE2 A;  4XJZ A;  1SFP A;  1ZZ8 A;  5LBC A;  5JOY A;  3TN9 1;  1I5P A;  1LGN A;  3W59 A;  3MLK A;  4CE8 A;  3AFK A;  4CXW A;  5FMC A;  4R52 A;  2ZXQ A;  2RMU 2;  4RHV 1;  1O4Y A;  3WVJ A;  5K9Y A;  5FOB B;  2LS6 A;  1NCR A;  1RYY A;  2D6M A;  5F6L B;  4WVV A;  1W05 A;  2E51 A;  1HB2 A;  4PIY A;  4Y3O A;  1QJX 1;  1XQN A;  2GMM A;  2VG9 A;  1E5H A;  4LKS A;  4IQP A;  4MZU A;  1I5Z A;  4MV2 A;  2IXI A;  3TOJ A;  4B1M A;  4HT1 T;  4COU A;  1JYC A;  2AEZ A;  4A3X A;  2VCB A;  2UWB A;  5FLI A;  1Z0H A;  2HWB 3;  2I2S A;  2Q8C A;  3WF4 A;  2D6P A;  1UF2 C;  3WQB A;  5IFP A;  4D0Q A;  4LIT A;  5JZG B;  3WDV A;  1QDO A;  1YFU A;  1W04 A;  3AXE A;  4LOR A;  4DXS A;  5BNN C;  5K4L A;  3GJA A;  3PDQ A;  1FMD 1;  2QBX A;  4IGQ A;  2A7A A;  1OHF A;  4IV1 B;  4XFC A;  3T3Y A;  5D8A B;  1AUY A;  5FK8 A;  5IJR A;  4A42 A;  2K9Z A;  1UL9 A;  4DIQ A;  5IVC A;  2HJI A;  4DB5 A;  1HQW A;  2GNB A;  2Y34 A;  2HWD 3;  2W1U A;  1PZ9 A;  2A6X A;  1UMZ A;  3ABZ A;  2XVK A;  3DGT A;  3PUA A;  2VVF A;  5FZG A;  3ZSJ A;  1KS4 A;  4E4Z A;  2JKB A;  3VBU B;  2EVX A;  3AMN A;  4LO7 A;  5F3G A;  3I2O A;  1XE0 A;  3S7I A;  2BDR A;  4PIX A;  3VZN A;  1YNA A;  2IFR A;  4XVH A;  2P5B A;  2JDN A;  3WDT A;  3V0B A;  2YXS A;  3AVS A;  4AGG A;  4OMD A;  4RGG A;  4BQW A;  3TEY A;  4NID A;  1C5H A;  1EAH 1;  4CUC A;  5C3O A;  3I7D A;  1DLL A;  2VOW A;  2XG3 A;  4JDO A;  4XMI A;  3IMN A;  4RHV 3;  3DYO A;  4YM0 A;  3SKJ E;  2ZGS A;  1OVP A;  1M06 G;  1F2N A;  4GAZ A;  4BA6 A;  4Q8K A;  1LOF A;  3HJR A;  5IVE A;  3KGL A;  5F3E A;  1RHI 2;  3PU3 A;  4RS5 A;  4DFS A;  4R4Z A;  1ZZB A;  2HEV F;  3ZFE A;  1OA3 A;  5KWR A;  4RFT 0;  1BVP 1;  3FBY A;  1AVB A;  4NPL A;  4OQ9 A;  2XVG A;  1IZ3 A;  1IKP A;  5FWJ A;  1ULD A;  3W21 A;  2R1D A;  1HQN A;  4ZS3 A;  1J58 A;  2OYZ A;  2Z4F A;  1GV9 A;  3O1S A;  3W20 A;  1OMI A;  1DGW A;  4X6Q B;  2Y0O A;  3KV6 A;  1KDM A;  4LUL A;  3PUR A;  4N90 A;  5IVV A;  4Y20 A;  5HV4 A;  4GZ9 A;  2G9F A;  5JXH A;  5FZE A;  3ACF A;  5FLH A;  3O1M A;  2AYH A;  2JG9 B;  4JZR A;  5AVP A;  5IYY A;  3ZYB A;  4Q8L A;  3E6D A;  1H2N A;  2JD4 A;  3WD5 A;  1HN0 A;  2BGP A;  5E88 A;  1NQD A;  4PDW C;  3WHU A;  1PO2 2;  1ZBA 1;  5D21 A;  2WS9 2;  3LDK A;  4P9I A;  4C1X A;  3K46 A;  3HBK A;  4CPB A;  4CUG A;  2ZX3 A;  5A6X A;  1FPN 3;  2QDR A;  3POY A;  2GDF A;  4QQL A;  1N47 A;  3TEX A;  1O8S A;  1OPO A;  4AFM A;  5JMC A;  3WW3 A;  3MYX A;  4AEK A;  3JCI A;  5A3N A;  4XFF A;  3J8F 2;  4L8Q A;  5CVR A;  4RR3 A;  3SEE A;  3W9A A;  3RZH A;  5C9A A;  3AZW A;  3MIH A;  4IND A;  5J09 A;  3WDX A;  3WNO A;  1Y9Q A;  5BY5 A;  2ORX A;  3NAP B;  4YFW A;  2RDQ A;  5FZ7 A;  1DQ6 A;  1NZI A;  2XML A;  2DTY A;  1W0P A;  2DFC A;  1C28 A;  3BCW A;  3BTA A;  3N7K A;  2WQ4 A;  1VB2 A;  3VN4 A;  1GMM A;  2RS1 2;  2D6O X;  1MQT C;  2VUL A;  3KT7 A;  3OD4 A;  3T30 A;  4DUX A;  3JBG 2;  5A80 A;  3AL5 A;  5ABJ B;  1UY1 A;  4LE3 A;  1O3R A;  4QU1 A;  4QHO A;  4YW2 A;  2B46 X;  1OKO A;  1MS9 A;  1RUD 1;  3AP7 A;  2ZAA A;  1PK6 B;  5C8C B;  3H3Z A;  1JOB A;  1JZ4 A;  3IB3 A;  3BTX A;  2R32 A;  2VUC A;  1PO1 2;  4LBK A;  1XSR A;  1RUJ 2;  1VMH A;  4UXA A;  4QPG A;  5G04 L;  2O1Q A;  1MR5 A;  1C8M 3;  1JBC A;  2NMN A;  1H1A A;  1DGW X;  1OXC A;  3NV1 A;  4JV4 A;  5EWS A;  5JVV A;  1TMF 1;  1X33 A;  3AB0 A;  1H1M A;  4CCM A;  1D4V B;  2LW8 A;  1QOT A;  5CAD A;  4I3P A;  4L92 A;  5GLV A;  4NIG A;  2NYY A;  4BIS A;  1K5M C;  2WII B;  1ZBA 3;  3AZY A;  4CP0 A;  1GAN A;  1LHO A;  5LBE A;  2D6L X;  3AMH A;  1X9P A;  2A6Z A;  2R04 3;  4E9K A;  1S0G A;  1CAV B;  3FLP A;  3KQR A;  1HX6 A;  3OG2 A;  5BNP A;  3T09 A;  4DNY A;  5BYN A;  5A3T A;  4OQ8 A;  5EXO A;  4I0B A;  3RVH A;  3CJI C;  3WNP A;  3LOI A;  2WIN B;  1QQP 1;  4AVT A;  5T3N A;  4LBQ B;  4CP9 B;  2O8O A;  5CKQ A;  1YFX A;  1R1A 1;  4KBZ A;  3OUH A;  4LXL A;  2JD9 A;  1OLQ A;  2NQY A;  2W1Q A;  4GAL A;  5F3I A;  1JTZ X;  3ZOI A;  4FPC A;  2IFW A;  4XAC A;  4UBG A;  2E31 A;  1REF A;  2J7M A;  2VQ0 A;  4XOG A;  1SPP A;  4U2A A;  5CB7 A;  4UFJ A;  3NJV A;  4NHM A;  4E2S A;  2JG8 C;  5FYV A;  1O3S A;  5EPA A;  1RUD 3;  3LSE A;  1ULC A;  4A3Z A;  5T5P A;  1JYX A;  4IEZ A;  4LIV A;  1VBB 1;  4EN9 B;  1OOP A;  3UET A;  1ZVF A;  5LA2 A;  3SCH A;  1SEF A;  3ZM8 A;  1UO9 A;  4AED A;  4HOO A;  1W6M B;  4XBQ A;  3KCC A;  4MO3 M;  5FZB A;  5CG8 A;  2FCU A;  1CAX A;  2Y6J A;  3WSO A;  3ZN5 A;  1UPI A;  1W8U A;  1NY7 2;  1V6N A;  1RJ8 A;  2XLF A;  2YY1 A;  4QWN A;  1Z7S 3;  2BUK A;  4AK3 A;  4HKO A;  4HET A;  2WO1 A;  5T52 A;  2DCZ A;  1W6P A;  3HT2 A;  1VBE 2;  1ZBE 2;  1V6K A;  2CV6 A;  5ACA 3;  1W2O A;  1R1Z A;  1XNK A;  4HPK B;  1MVE A;  3ALQ A;  3CQO A;  3DPR C;  3ZSE A;  5LK7 B;  1CR7 A;  2Q8D A;  3TB0 A;  2XJQ A;  2C24 A;  3L9J T;  3EXU A;  1RUF 3;  5KHK A;  1AJO A;  4BYY A;  4IE6 A;  4URA A;  4JHT A;  4M3C E;  2VME A;  2DBI A;  3HMY A;  2A6V A;  3N35 A;  5FKB A;  2XVL A;  1X50 A;  2ZKN A;  1DG6 A;  5J36 A;  2CWM A;  3USU B;  1QQP 3;  4RD7 A;  4FFI A;  2R07 1;  4CCJ A;  4SBV A;  3IPV B;  4EZ4 A;  1IS5 A;  2DCK A;  3EYP A;  4AI9 A;  5JSO A;  1JUI A;  4QQP A;  1T6B X;  4QHZ A;  4AHY A;  1H8T B;  2OS2 A;  3RI9 A;  4ATE A;  4CCE A;  4A6S A;  2B5H A;  3HBZ A;  2R0F A;  3A0N A;  5DZE A;  4HVR A;  1NOV A;  3NQH A;  3NVC A;  1H6Y A;  1VIW B;  2BNO A;  4AQT A;  1I3H A;  2DCY A;  3DXT A;  4NIA A;  4CDW C;  4P9W A;  3DEM A;  2PAE A;  2PLV 2;  4PIZ A;  1XU2 A;  4JGZ A;  2X5I C;  3ROU A;  1T6G C;  1RL3 A;  1EV1 3;  1DDL A;  1D4M 1;  4IV1 C;  1JZ3 A;  5D8A C;  2HKX A;  1JW6 A;  2XQR A;  2WO7 A;  4DIN B;  5IT6 A;  3NKT A;  1JU3 A;  1QJF A;  5J96 B;  1PZ7 A;  1CIY A;  3O12 A;  4GH4 C;  2SLI A;  4ZPI A;  2QNK A;  1UU4 A;  4OCT A;  4COW A;  3N9M A;  1F4A A;  4AR2 A;  3FHI B;  3T4V A;  1IHM A;  4J1W A;  1GOH A;  4N7U A;  2HEW F;  4AGV A;  3JXS A;  3H1Y A;  1QH7 A;  2XL7 A;  4NWW A;  3VDB A;  1HRV 1;  3WG2 A;  2LRP A;  1JOD A;  5DPN A;  1AR7 3;  2JB4 A;  1QIQ A;  4OHW A;  2PHR A;  4V1P A;  1W0O A;  2J1R A;  2WNV B;  5LAT A;  1H6X A;  1NXM A;  3I2F A;  3OSD A;  4KWJ A;  1CN1 A;  4IE5 A;  4OUE A;  3RDI A;  4S2F A;  4IEP A;  4BLI A;  3VKO A;  1D2Q A;  3WQ0 A;  3ASI A;  4KG0 A;  5KHH A;  5FUN A;  3EHK A;  3KLS A;  4BQ4 A;  5FQ0 A;  1KDK A;  1IS4 A;  1LTE A;  3K4D A;  4BWO A;  1G9A A;  1B35 B;  5L7O A;  2J1T A;  5CFD A;  4FPL A;  2P17 A;  3ES4 A;  4NHX A;  4MSV A;  4QX0 A;  3ZN6 B;  4CDX A;  2XR4 A;  3BPS A;  2WAB A;  5SV5 A;  2SBA A;  1CAU A;  3AL6 A;  3KM5 A;  3NJX A;  4JGY A;  1UYY A;  3MLJ A;  3RYK A;  5T54 A;  1JI6 A;  2BEO A;  4Q0V A;  2IVJ A;  4GJZ A;  3T2Q A;  5FY0 A;  4OHZ A;  3CF6 E;  2A6Y A;  4OUS A;  2D98 A;  1URX A;  1AR9 2;  2JG9 C;  1H2K A;  4OZX A;  4P5Y A;  2BW8 A;  5EJZ B;  1Y9G A;  4FPE A;  3K51 A;  4YGE A;  3RWN A;  1HXS 3;  3WT3 A;  4FPO B;  2RR1 1;  5F6K A;  4N53 C;  2G19 A;  3AKS A;  3USS A;  2J1S A;  4WM8 A;  1GQH A;  2CGN A;  4UFL A;  4UWD A;  4CEY C;  4YZ2 A;  1LOD A;  2ZOE B;  3IDA A;  3SCF A;  1CD3 G;  3NRU A;  3S57 A;  1CQ9 A;  1J1T A;  1NE6 A;  5FXV A;  2EIE A;  1BK1 A;  2YBK A;  1QJY 3;  3IN9 A;  4EWE A;  2ZGU A;  1RUC 3;  3HNY M;  2FZ2 A;  3NW4 A;  3POS A;  3K3N A;  3B5L B;  3ZXL A;  1BZW A;  1VJ2 A;  2VOV A;  1CZV A;  1N1T A;  2W39 A;  3E5U A;  4MGZ E;  4Q4V 2;  3CZU A;  3HQU A;  2PAM A;  4BCU A;  2VTF A;  3FHQ A;  1W3V A;  5FMD A;  4UYB A;  5FWE A;  3B7M A;  4L11 A;  4BK4 A;  2R0H A;  5JSR A;  3GHM A;  1OUR A;  3OJB A;  1ND3 B;  3WG1 A;  5ABJ C;  2CWS A;  1BBT 2;  5BNO A;  2BWC A;  1QKQ A;  2RS3 2;  5FYC A;  1UOJ A;  1GZ9 A;  4NIH A;  1U12 A;  1PK6 C;  4Q0P A;  5DZG A;  1VMF A;  5F5C A;  4IEW A;  1NX9 A;  2P34 A;  3OGR A;  4JKL A;  3ZSM A;  4FFH A;  3LFM A;  3PU8 A;  4PHZ A;  3OPW A;  4QX2 A;  4HFS A;  4HL0 A;  1GR3 A;  1W6N A;  4TXW A;  3LKJ A;  5FMO L;  4PI2 A;  1FYU A;  1LOG A;  3J7H A;  3VHR A;  4EN0 A;  1DQ5 A;  2PFW A;  2QKD A;  4ISQ A;  5AVA A;  2PHW A;  4M3C A;  1Q8V A;  1N1V A;  3SXW A;  1AXY A;  3PTY A;  3R6S A;  4CEW C;  1W8Z A;  3N9P A;  1ASJ 1;  1DCS A;  1F35 A;  1TZO A;  3N9O A;  4XF9 A;  5C4W C;  1DGL A;  1W2T A;  1AX2 A;  1WUV A;  2JIC A;  4BJ0 A;  1LED A;  5GLW A;  1LOC A;  4ISR A;  3NJZ A;  4XDP A;  2EID A;  1FV2 A;  1BLZ A;  1G7Y A;  2WJS A;  4Y22 B;  2AEY A;  5F5Q A;  1Q5O A;  4YAR A;  3VKF C;  4ORF A;  4QPI B;  3VD3 A;  4JTN A;  2FHR A;  4OHX A;  1JYV A;  2DCJ A;  2VOK A;  1CPM A;  3PTR B;  2VZV A;  2C9K A;  4QXK A;  1JZ2 A;  2N7G A;  1POV 0;  5DAP A;  3C7G A;  3PME A;  4COV A;  4Q2F A;  5LCW L;  3ZKY A;  1EY2 A;  5FPB A;  1QXJ A;  4D7Y A;  3ZFG A;  5FP4 A;  5L9B A;  3M70 A;  1DZR A;  2RJ2 A;  1O7F A;  3K4A A;  4KWU A;  2HWE 1;  3WY6 A;  3TWI A;  3VDD B;  1US2 A;  3VV1 A;  1DYO A;  3FWE A;  1QXR A;  4N43 A;  4NN0 A;  4Q5O A;  2PA7 A;  1F15 A;  3N9L A;  5FMO S;  2YB7 A;  5FYZ A;  4NR1 A;  1WLC A;  3M1H A;  4QQH A;  3NNG A;  2HWB 2;  3OCP A;  5B2G B;  1NXD 1;  2WSU A;  1HQL A;  3I3M A;  1UNB A;  1EPW A;  1MZF A;  1BHG A;  2GZW A;  1YHF A;  1GNY A;  5IK7 A;  1CPN A;  1VBA 2;  1G9F A;  1W9F A;  1ASJ 3;  2GC0 A;  2CTV A;  3JB4 C;  4XUQ A;  5GZC A;  1SCS A;  2VJX A;  1UZW A;  1W6O B;  3QD6 A;  4ZU5 A;  2ZML A;  1QWR A;  2ZGN A;  1XYN A;  1FX5 A;  1G8W A;  3O7O A;  4LOT A;  4ZXE A;  4LUK A;  3D82 A;  3D3A A;  5FYB A;  1LEN A;  4MH0 E;  1UKG A;  4AVB A;  4FPF A;  4CTE A;  2QQW A;  3K48 A;  3RMX A;  1C3H A;  2BTV C;  1D7P M;  4C1W A;  4CPB D;  4HK9 A;  5IWF A;  3W5M A;  2Z69 A;  2HWF 3;  2KR2 A;  4ZU4 A;  4O9E A;  4K9S A;  2G1M A;  4DXT A;  4JDM A;  2EIC A;  4I3G A;  3LEI A;  4UF0 A;  5FYS A;  3FUO A;  4LLF A;  3S6P A;  3HR9 A;  1R09 1;  2WFF 1;  1PMJ X;  1TME 1;  1RUH 1;  3LA3 A;  2RE9 A;  5LZ6 A;  5L19 A;  4JAA A;  1J3P A;  4D69 A;  1H8T C;  3THT A;  1U0A A;  4A2U A;  4YLZ A;  2HWE 3;  3KS7 A;  3H1W A;  4QKN A;  3O1R A;  4LBN A;  3AMM A;  2VBB A;  3DKW A;  2VCM A;  1DQ1 A;  2BER A;  4KGG A;  3H8X A;  3SIS A;  3CJX A;  3I59 A;  3N9N A;  5I8Y A;  1ZRI A;  5FZ0 A;  4QX5 A;  4Q4W 1;  4B29 A;  3KF3 A;  2YBS A;  1IPJ A;  1GZT A;  2DV9 A;  3PJY A;  5IK5 A;  1NCQ A;  2B39 A;  2R06 3;  2XDV A;  1V6M A;  3LA7 A;  1AYN 2;  5KXB A;  2XKP A;  3GGL A;  1I6X A;  1POV 1;  2XPJ A;  1WLD A;  4E4H A;  2QZ3 A;  4OUL A;  2TBV A;  1BYH A;  3MLL A;  2ZEX A;  4AZZ A;  5KR7 A;  4ATF A;  3R4D B;  2CU5 A;  2TEP A;  2VAU A;  4FOY A;  3ZFF A;  1FXZ A;  2WR9 A;  1ENR A;  1NCR B;  5BUV A;  1VBC 1;  3ZYI B;  4CXY A;  2J1E A;  3ZMO A;  2UY8 A;  2NMO A;  4BHP A;  3ZKU A;  1JS9 A;  1FOD 1;  3DEC A;  2DVA A;  1N1Y A;  1FPN 2;  2ATF A;  5C3Q A;  1PVC 2;  4OHY A;  4W6Y A;  2GC1 A;  4CDQ C;  4DEV A;  1LHW A;  4BXF A;  1LRH A;  1WA4 A;  1ZZ9 A;  2VZ3 A;  4H7L A;  2ZHK A;  4XUN A;  1KFU L;  2FDG A;  4IV3 C;  2G9Z A;  4W50 A;  4MLO A;  3VBR C;  3SC7 X;  2WFF 3;  5FY7 A;  1RUH 3;  1SLC A;  3HPN A;  4CP1 A;  3V64 A;  2WWJ A;  2C9A A;  1COV 2;  2WT2 A;  3Q8F A;  1RIN A;  1XNA A;  1RMU 1;  4W65 A;  4CCK A;  3IMM A;  3ZYG A;  5A7O A;  5JUV A;  1K45 A;  2DUQ A;  4HN0 A;  1MAC A;  3ACG A;  4XFA A;  2DVD A;  1GQP A;  5FY1 A;  1JZ8 A;  5I0S A;  4Q4W 3;  1MEC 2;  4XET A;  3V56 A;  2DUO A;  2Q0A A;  3JD7 1;  2LRO A;  4QDR A;  4QQ2 A;  5APA A;  1JZ5 A;  3TRS B;  1POV 3;  3V0B B;  1C8N A;  2D3R A;  4RYD A;  2WWU A;  1WMD A;  5BNN A;  3S0M A;  3VB9 A;  1C8M 2;  1KJL A;  2WT1 A;  2ZTN A;  2GME A;  3WV6 A;  4LBM A;  1YEW A;  1CJD A;  3H50 A;  1QJZ A;  2VOT A;  3PVE A;  1PGW 1;  1NE4 A;  1EUU A;  4XMA A;  1IG3 A;  4O7X A;  2OA2 A;  4YVW C;  4LHN A;  2RM2 1;  1HV0 A;  4CCL A;  4E2G A;  2BPA 2;  4RS5 B;  3AP5 A;  2ID4 A;  3ZXD A;  4P9L A;  4Q4Y 3;  3ZFE B;  5HI0 A;  2CHH A;  2RS5 3;  3UKT A;  1BK0 A;  3SHR A;  1QF3 A;  4YW7 A;  4C0B A;  2R04 2;  4HAN A;  3UJO A;  4ASL A;  5FRE A;  4K7J A;  5C71 A;  1W2U A;  4ET7 A;  1KFX L;  4AI0 A;  4NUB A;  2CY6 A;  4EZH A;  4BQ5 A;  2VZR A;  1W2N A;  5CA6 A;  2R7E B;  2VZP A;  1DP0 A;  1X8M A;  3V0A A;  4FTE A;  4Y20 B;  2X10 A;  1EYB A;  1OA4 A;  2KA3 A;  5I0D A;  5DDJ 1;  3SH5 A;  1V6J A;  3VBO C;  3B02 A;  1RVF 3;  1XC6 A;  4QXC A;  4FAH A;  4HK8 A;  1S2B A;  2CGO A;  4PBO A;  4IEU A;  4QXB A;  2AC1 A;  5DMY A;  1GU3 A;  1AYM 2;  3AYC A;  1YFY A;  3NMB A;  4CCN A;  4D8M A;  5BV6 A;  3T0D A;  3INA A;  1Q8Q A;  4AQS A;  2CDP A;  2CGP A;  5A32 A;  3JU9 A;  3PJQ A;  1CJP A;  3OB8 A;  4XJU A;  4AED C;  4JVA A;  3VLB B;  3A7Q A;  4E4S A;  5DAB A;  3JD7 3;  3A4U A;  1YCI A;  1UU5 A;  4GMP 0;  3GBW A;  4RR3 B;  4XF3 A;  4AG4 A;  5C9A B;  1LGC A;  2VZS A;  3V65 A;  3H0O A;  3TAY A;  4JX0 A;  5CZK A;  3LE0 A;  3PNA A;  3SQO A;  2DFB A;  3VD4 A;  2ARC A;  1JYN A;  2D6K A;  5GZE A;  1GZW A;  1ULG A;  1UZ0 A;  1Z7S 2;  1G9D A;  1XNT A;  4MVT A;  4PDW A;  3ACI A;  2RM2 3;  1DHK B;  3H8R A;  2JE8 A;  5ACA 2;  4H3W A;  3ORJ A;  1XSQ A;  4Y26 A;  3VBH C;  2C6S A;  2PYT A;  1S2K A;  3PLQ A;  5H9Q A;  4P08 A;  1JHJ A;  5HCF A;  4CVU A;  4NHL A;  4GB3 2;  2PAK A;  4NRQ A;  5KHI A;  1VBD 1;  1RUF 2;  1S4C A;  5J37 A;  1ZRF A;  1Q8P A;  2E7T A;  3P5B A;  4LUM A;  1OKQ A;  1UXZ A;  3ZYP A;  2BOI A;  4AHZ A;  1KXG A;  4Q0U A;  4QPG B;  5JR7 B;  1NG0 A;  4AVV A;  4BB3 A;  4HVQ A;  1CWP A;  1C5I A;  1AR8 1;  1R08 1;  1HRI 2;  2Y6H A;  2YPJ A;  4I0A A;  2B9U A;  2HLE A;  4P9G A;  5BXX A;  3ZPO A;  1GIC A;  1MQT A;  3VDD C;  2YHJ A;  2V73 A;  1MVQ A;  2B8M A;  4LBQ D;  3RZJ A;  2ZA9 A;  5GLT A;  1W0N A;  4L97 A;  3LQC A;  1LKN A;  5K0U C;  5DQ0 A;  5A3U A;  1I1E A;  5A7N A;  1WCD J;  3BOW A;  5FP7 A;  4CP2 A;  2ES3 A;  3RZK A;  2XJR A;  4XUP A;  2R30 A;  4HLT A;  3WNM A;  4EWD A;  1W8W A;  1ND2 A;  1DGR N;  1GP5 A;  3GZU C;  5BNP B;  1GYK A;  3FZ3 A;  4WVM A;  1OUX A;  3TN9 3;  1EV1 2;  4YGD A;  4LO5 B;  3VKN A;  1JYW A;  2JX9 A;  2FZ1 A;  2HYK A;  4YW3 A;  3DCQ A;  1S2E A;  2AH2 A;  1CZS A;  3WF3 A;  4PJY A;  2Y6L A;  2W2I A;  5FO7 B;  1WA6 X;  2WNE A;  2RV9 A;  2JIG A;  2QE3 A;  3A21 A;  3AKQ A;  3MUZ 1;  4UAP A;  3B01 A;  2VEC A;  3WG4 A;  2VUJ A;  4YZ4 A;  5FZM A;  4BQX A;  3NNF A;  2QQJ A;  3HVD A;  2ZAH A;  4AI1 A;  5GZG A;  1KRI A;  1QJX 3;  3LF7 A;  2E9Q A;  4AWD A;  1SPP B;  3IAP A;  3VL9 A;  1JZ6 A;  1UMI A;  3WNN A;  3AX4 A;  4FBF A;  2VMG A;  2ZGM A;  3MIF A;  4NMI A;  4E2Q A;  3BB6 A;  3DL3 A;  1OOP B;  1UU6 A;  1VBD 3;  2JJ6 A;  1AR7 2;  2VQA A;  2R6Q A;  2ZZQ A;  4GMP 1;  1JN2 P;  1H2M A;  3CJI A;  2WZR 2;  4LBO A;  4WVZ A;  4AED B;  4CRQ A;  4DPN A;  4K8F A;  3RSJ A;  4BZ4 A;  1XYO A;  4FXG B;  4W6X A;  2D3P A;  1PMH X;  1SBD A;  4AAP A;  2EXK A;  1FMD 3;  1CAX B;  1R08 3;  2IVI B;  5FY5 A;  1A6C A;  5DG1 A;  5AC9 1;  3ZVX A;  2WRA A;  1H4G A;  1SFN A;  5SV8 A;  1QMJ A;  3FL7 A;  4G3Y C;  2LAL A;  1W6P B;  5DAX A;  5DN2 A;  5JXI A;  1DIW A;  5GLU A;  3LWC A;  1YQ2 A;  4YM2 A;  3H8U A;  3VZO A;  3THD A;  4OZO A;  3MI8 A;  5JR2 A;  5I91 A;  1BEV 2;  3C8X A;  2W95 A;  5A70 A;  3EQE A;  1XB9 A;  3WCR A;  4JQR A;  1X7N A;  2P6H A;  1OQE A;  1NA1 A;  5FXW A;  5F37 A;  2ZAB A;  1S0J A;  1POQ A;  4IDZ A;  2ET7 A;  1A34 A;  4Y4Y A;  3HN3 A;  3D8C A;  3OEB A;  1EAH 3;  1E57 A;  3SEP A;  3P3P A;  2D93 A;  2JDA A;  2VNV A;  3SCG A;  5K7P A;  1SLT A;  3Q8E A;  1HXS 2;  1S0I A;  2C5D A;  2F4L A;  2HWC 1;  2I74 A;  2ZGR A;  2VC9 A;  3MPB A;  1O5L A;  2VUA A;  4CUB A;  1DQ4 A;  1W8T A;  3DPR A;  5ANN A;  1QJY 2;  2OPW A;  3WZ1 A;  3KHC A;  1W99 A;  2A3X A;  1RUC 2;  1ENS A;  1UWW A;  3KVA A;  1DGR A;  4QXH A;  2MHF A;  1RUO A;  4CCC A;  2ADE A;  4XZU G;  3WP5 A;  3N7L A;  3FMG A;  4AF9 A;  1LJ7 A;  3NKG A;  4GMP 3;  1AX1 A;  5IAX A;  1XXN A;  1WW7 A;  4JGZ B;  1ZRE A;  4FSJ A;  3E5Q A;  4QM8 A;  4Y1V A;  1BMV 2;  1WLT A;  1H30 A;  3VDA A;  2J1U A;  3JQX A;  5ERL A;  2W0X A;  4LJH A;  5A6Q A;  3BTZ A;  4DXR A;  1W9W A;  1RUE 1;  1PIV 2;  1CZT A;  2JDY A;  3DKQ A;  3POE A;  4HSL A;  4BME A;  3UK9 A;  3IBM A;  4UW6 A;  3ETQ A;  1H2L A;  1PGS A;  4E4D X;  2H0V A;  4CZS A;  2XH6 A;  3THP A;  1RUI 2;  4CDW A;  3NJY A;  4WM7 C;  3ZYR A;  4Q27 A;  2RMU 1;  2X5I A;  3AKR A;  1UN1 A;  4IV1 A;  4BE3 A;  1QJU 2;  4PQQ A;  2VZO A;  1H8V A;  1H0B A;  3LDB A;  3NWK A;  4F3J A;  5A33 A;  4LR4 A;  1D0H A;  4IEQ A;  4MX3 A;  1LOF C;  4TYS A;  4HVO A;  4GH4 A;  4B7K A;  5A3W A;  1S1A A;  4KMQ A;  4RS5 C;  2JEM A;  3CNA A;  2VL4 A;  2D43 A;  4URT A;  2ZX1 A;  4Y1Y A;  1IG0 A;  5FPA A;  5FQ0 B;  5FPL A;  2HWC 3;  3WIN E;  4DXZ A;  1CX1 A;  1AZD A;  1FT9 A;  1UXX X;  2OUH A;  3A22 A;  3T2T A;  4CDU A;  5L7O B;  5CFD B;  4B4Q A;  2P1B A;  1WWY A;  3KF5 A;  3WP3 A;  3AZX A;  1W28 A;  5FYI A;  1XND A;  5GLZ A;  5L73 A;  4XIK A;  4AQ6 A;  4HKL A;  2XJS A;  4CDX B;  1CAU B;  3D6E A;  3HOB A;  5DXD A;  3FX3 A;  2GH8 A;  4JGY B;  4BQY A;  3OTF A;  4P00 B;  2VOX A;  4RA0 A;  3POJ A;  5LA1 A;  2FCV A;  1UZZ A;  2UU8 A;  4H2A A;  3PUS A;  3EB7 A;  5LA0 A;  1ONA A;  2GN3 A;  1DZQ A;  3D0J A;  2RDS A;  2GNT A;  4PLO A;  4TLF A;  5A7Q A;  3AP6 A;  2BU9 A;  4JHZ A;  1TMF 3;  4ARY A;  2XOM A;  1SG3 A;  2JDM A;  4LIU A;  1TG7 A;  4MXV A;  3VBF A;  3LPF A;  1RUE 3;  1LES A;  4YG0 A;  5A3O A;  4NPM A;  2YU1 A;  2F17 A;  3A23 A;  1PGL 2;  2R49 A;  1G6N A;  1XU1 A;  4ITC A;  1WW6 A;  3MIG A;  4LHK A;  1AL0 G;  4DOU A;  2A73 B;  2Y26 A;  4NRO A;  2XUM A;  2Y6G A;  3POW A;  4FFG A;  1HIX A;  2XBO 2;  2YGL A;  4Q4X 2;  4KWL A;  4XFG A;  2RMU 3;  3PIJ A;  4AOC A;  4XDO A;  3VDC A;  1UQX A;  5GZF A;  4ZS2 A;  4MAD A;  2J1V A;  2J1A A;  2O8Q A;  1YWK A;  4K1Y A;  2YV8 A;  1RHI 1;  5FZ8 A;  1RUG 2;  4N53 A;  1R1A 3;  3VD7 A;  1W8N A;  2H6C A;  2IC1 A;  2VMI A;  5F2S A;  3WEZ A;  2VH9 A;  1N1S A;  2W91 A;  2CNA A;  3K75 B;  4CEY A;  5BNO B;  2VMH A;  2O14 A;  4XHX A;  2WN2 A;  5FZC A;  1LUL A;  4Z2A A;  4H14 A;  1RUN A;  1UIJ A;  5CFC A;  2B9V A;  1JH5 A;  4Y33 A;  4YVS A;  4DY5 A;  4LKD A;  1VP6 A;  4S2G A;  1W6N B;  2VNG A;  4A7Z A;  1VBB 3;  3ZXK A;  5JZG C;  4X6R B;  2NP0 A;  2HWF 2;  3ZYH A;  3E6C C;  1ZM1 A;  3RMY A;  1K3I A;  4I09 A;  4XTM A;  2EXH A;  4M3C B;  4YRD A; 
#chains in the Genus database with same CATH homology
 2HBT A;  2V4A A;  5L9B A;  4KBZ A;  3OUH A;  5ERL A;  3PL0 A;  4XAC A;  3ITQ A;  5DAV A;  3DKQ A;  4IW3 A;  4NHM A;  5A3U A;  4NHX A;  4Q5O A;  4XCA A;  5EPA A;  3W21 A;  2JIJ A;  3W20 A;  4J25 A;  2FCT A;  5HV4 A;  2FCU A;  4MHU A;  2Y33 A;  4JZR A;  2JIG A;  4XAB A;  2G19 A;  4BQX A;  3NNF A;  4UWD A;  5HV0 A;  4Y5S A;  4XC9 A;  4NMI A;  5LBC A;  3OUJ A;  4XCB A;  3NNM A;  4BQY A;  3HQU A;  2FCV A;  2G1M A;  5LAS A;  2RDQ A;  2RG4 A;  5C5U A;  3MGU A;  2RDR A;  3KT4 A;  2RDS A;  3GJB A;  4ZON A;  3OBZ A;  3KT7 A;  4NAO A;  5DAX A;  5DAQ A;  5LBF A;  5IAV A;  3NNL A;  3GJA A;  4NHY A;  3BVC A;  5C5T A;  4NHK A;  5LB6 A;  4XAA A;  2Y34 A;  3HQR A;  4Y5T A;  4ZPI A;  5EP9 A;  5L9R A;  3OUI A;  3EMR A;  4MHR A;  5EQU A;  5IAT A;  2OPW A;  5LBB A;  3GZE A;  5LBE A;  2HBU A;  4NHL A;  2A1X A;  5M0T A;  5L9V A;  5DAW A;  3KT1 A;  5LA9 A;  5IAX A;  4BQW A;  5LAT A;  5DAP A;  3NNJ A;  2RDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...