4KBZA

Crystal structure of hypoxia-inducible factor prolyl hydroxylase (phd2) with (s)-{2-[2-(5-cyano-3-hydroxy-pyridin-2-yl)-thiazol-4-yl]-acetylamino}-phenyl-acetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
234
structure length
231
Chain Sequence
TKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYEKGLRVELNKPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 68
structure length 231
sequence length 234
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4kbzA00
5L9BA 2FCUA 3KT7A 3ITQA 4Y5TA 2HBUA 3PL0A 5HV4A 4NHYA 2Y34A 4JZRA 5IATA 3W21A 2RDQA 5LA9A 4J25A 4XCAA 5A3UA 3HQRA 2RG4A 3OBZA 3OUIA 4NHKA 4ZONA 3KT4A 4Q5OA 5LASA 4NMIA 5EP9A 3NNLA 5DAWA 4BQXA 4BQYA 5DAQA 5LBFA 3OUJA 2RDNA 5C5TA 5HV0A 2OPWA 2JIGA 2G1MA 5LB6A 4XCBA 5ERLA 5EPAA 3DKQA 3MGUA 5LATA 4XC9A 3KT1A 2RDRA 4NHMA 2A1XA 2FCTA 5LBBA 3GJAA 5M0TA 5LBEA 4Y5SA 3NNMA 3HQUA 5EQUA 5L9RA 4MHUA 4UWDA 2FCVA 4ZPIA 4NAOA 3NNJA 3W20A 4XAAA 5LBCA 4IW3A 3NNFA 4KBZA 4BQWA 2HBTA 2G19A 4NHLA 4XABA 5DAPA 5L9VA 5DAXA 4NHXA 3GZEA 2Y33A 5DAVA 3EMRA 5IAVA 5C5UA 2RDSA 2V4AA 4XACA 3OUHA 2JIJA 4MHRA 3GJBA 3BVCA 5IAXA
chains in the Genus database with same CATH superfamily
1Y4WA 2X5IC 5T5OA 2YV8A 5JLVA 4AFMA 4N9HA 3AVSA 3VBHC 2VUJA 3BODA 3H42B 4Y5TA 1GZCA 3AX4A 3ES4A 5F2WA 1PO13 1RJ8A 1QOTA 2ZACA 2Q1ZB 1AR73 3ZXGA 1VAMA 5A3WA 5FP4A 1JODA 3SNMA 5T50A 1UY3A 4LBNA 4LLOA 4XUNA 3N9LA 1K5MA 4LMFA 4YGEA 5T5LA 3H8UA 2TBVA 1RMU3 2WBKA 1YQ2A 2QDRA 4FOQA 4ARXA 2HWD3 1G7YA 1US2A 1B09A 1S0CA 2Y6JA 3V0BA 2OYZA 2ZGUA 4EV0A 4LA2A 4OI4A 4UYBA 3VBSC 4AFDA 2WFF3 2XUMA 2YBPA 1AUYA 1C3HA 1JN2P 1J3QA 1U5IA 2O0OA 4UFIA 5E16A 5CBLA 3TN92 1UKGA 2Q1MA 4Q29A 2W1WA 4XE9A 2WZR2 4PQQA 4BQXA 4CDWA 4DUVA 1LOFC 2RJ2A 1DQ4A 4QAWA 2P6CA 2DVFA 3AP4A 3QACA 4XZPA 5A32B 3D4KA 1MZFA 1OF3A 1V9U2 3CMGA 4W8JA 4CDUB 5HV0A 3OD0A 2Q8DA 3FMGA 1EV12 5GZDA 4ZU7A 5FZFA 1DFQA 4NIHA 2CAUA 2RR13 4PIZA 4PIXA 1ENRA 4D6SA 2A3XA 3KT1A 5FYCA 1U0AA 3ZLIA 5I8YA 2PHUA 4LO5B 4LHKA 4LUKA 4XTPA 2QBXA 5HCBA 2WQZC 3O7OA 2JDNA 1RUF3 3C7EA 3N35A 1ZM1A 2BOJA 2VW0A 5IVFA 3I2HA 2Y6HA 5BXXA 2KM2A 4QPWA 5FZ7A 1WCSA 4B8EA 4I09A 4MGYE 1HJFA 1ODNA 5A6YA 1VRH1 5A33A 2CTVA 2IXKA 5HXVA 3LDRA 2QQIA 4GH4C 4EWEA 4AVCA 1M4WA 4HPKA 4AR2A 1RUG3 2RJLA 2X10A 3NW4A 4HONA 4EYUA 3NVCA 4JKLA 2WKKA 1NCQA 4FPLA 4XPVA 4BQWA 3SISA 2NLRA 4QU1A 4IGQA 3BCWA 1QQP2 2GC2A 2PYTA 3DPRA 1O7FA 3PTYA 4H2AA 4IERA 4JGYA 4AG4A 4D7TA 5FMBA 3D82A 4F8AA 3B7MA 5F5CA 1BVP1 2BTVC 2QKDA 3BPSA 1BEV3 2GZWA 1PZ7A 3EMRA 4CCMA 4CU9A 1O5UA 2J42A 5IAVA 2YBSA 5KC6A 1BBT3 3NV1A 1OA3A 4FOVA 4R4XA 1IOAA 3DECA 4FPYA 3WQ1A 2W3JA 2R073 1W99A 4MSVA 3POSA 2JG9B 3DEMA 3MUY1 4NRPA 1Q56A 4XACA 2CYFA 2Z79A 4YW1A 2R063 2MEV1 5CZKA 2WZPP 3DUIA 3MF6A 2Q8CA 3AKRA 1P8JA 4AQSA 2XLAA 3O5SA 1OD5A 1PO22 1QJZA 2E26A 5I91A 2PQSA 1WMEA 1HXS3 5FY4A 1H2MA 1HB4A 3VDDC 3ZFEC 4GAZA 4D6QA 4QKBA 3KV4A 2JDAA 4RN5A 3FHAA 1LHVA 4S2FA 4LHSA 5DN2A 1BCXA 4ARYA 4N53C 2BW8A 4UFLA 4YYOA 3ZYIB 1SLAA 4XXPA 1GQHA 2ZGSA 2IC1A 2VZPA 4DQAA 3USSA 1R092 4AEJA 4CP2A 4JVAA 1NY71 2W68A 2XJQA 5FYBA 1CGPA 4CUAA 4ZU5A 1RHI2 2GC3A 2ID4A 3NAPC 5FR3A 5IWFA 4CEYC 1HW5A 4N9IA 4CUGA 3PDQA 4YVWA 2J22A 3D0SA 3ZYBA 1EY2A 1ZZBA 3E5UA 5L19A 5AVAA 5CG8A 1PK6C 4L8QA 4TN7A 1LU2A 2RM23 4P08A 4E4SA 5FO9B 2XPJA 1G9DA 3ZN6A 1L7RA 4UT5A 5GJ6A 1XXNA 4RS5C 1YXWA 2RV9A 4COYA 1U5XA 2XHNA 1C8M2 1CAUA 2D5FA 4Q5OA 3A23A 4XTMA 3VBOB 2IVJA 4FP3A 1TMF2 1CAXA 2XJSA 2C26A 4PDWA 3VKLA 3O1TA 1NUKA 1OLMA 2UY9A 4OYUA 1H9WA 3POJA 1DZRA 4BQYA 5JOZA 1X9TA 1S0FA 2JD9A 3LB9A 3NKTA 5CKQA 5FO7B 2Q8OA 3CJIC 1Y9GA 1GSLA 1W90A 4TLFA 3N9NA 3ZN5A 4BYYA 3C7FA 1AR92 1AVBA 1I5PA 1SLTA 2D40A 1EAH3 3CU7A 3ON7A 3BU0A 4BU2A 3PUIA 2B7YA 2GSYA 2AREA 4IL7A 4LBMA 4XFBA 2F17A 3HBZA 4K3UA 3T2PA 3U10A 4B7EA 5KHIA 3IBMA 4WVWA 2BPA2 4OQ8A 4NHMA 1AR63 2FCTA 4KMQA 5CKNA 5FZMA 3GJAA 3IDAA 4XJAA 1K42A 2EAAA 4RGAA 2PELA 1LHNA 5DZFA 1KFUL 1QJU2 2D3SA 1MEC2 3TN91 3I3BA 3T2OA 5LEKA 1X8MA 4AK3A 2WZR1 3LCPA 1FAYA 2AGSA 4QPGA 3N7MA 1IGOA 2FCVA 1HRV2 3U78A 1CJDA 1QIQA 3KQRA 1Q8PA 4OI0A 1XYNA 1PGW2 2A73B 2DUPA 2DV9A 2RS12 3R0RA 4RQPA 1AL0G 1V9U1 1ZBE1 5C3OA 1EV11 3CKHA 4BCUA 2PFWA 3DGTA 3PVOA 2QDNA 1Q43A 5GLZA 4FSJA 4GJYA 2FHRA 3D5OA 4XBLA 4DZGA 3DL3A 5ACA2 4A41A 4XAEA 3VKNA 5J37A 4I3GA 5I8TA 4BPZA 3WG2A 3BTXA 4XQWA 3GZEA 1IHMA 1QKQA 3DV8A 1UU6A 4MGKE 1MR5A 3ENRA 3WHTA 2GN7A 3MW4A 3K4ZA 1POQA 4Y22A 1WLWA 3N7KA 1W2TA 4UI9L 1QHDA 1JOPA 1NX9A 2XQRA 4ORFA 4RGGA 2YFUA 1F9KA 4IEOA 5CVRA 3T1MA 4JQRA 4Y1UA 2AEYA 4MZUA 3WNPA 4G4FA 1AR82 1J58A 3AYAA 4MV2A 1OA4A 1PMIA 4MX3A 5CYYA 5FYYA 3KHCA 1DDLA 3I4IA 3RWKX 1V6IA 1HV0A 5FZ6A 4DFSA 4BWOA 4G9SB 1HX6A 1JZ3A 1DYPA 1VBC2 2O8OA 2GNDA 3AFKA 3ZFGA 3S5AA 4QDQA 3O1UA 1JYCA 5FZCA 3KM5A 1CPNA 1S0DA 1LOBA 2VMIA 2W08A 3LA3A 1QQP1 3AYDA 3KVAA 1LESA 4IDZA 1Y9QA 1C28A 2ET7A 1VRH3 1W6QB 3JCIA 4Q26A 2ERFA 2N7GA 4HLTA 3RZMA 1CJPA 1Z7S2 3DXUA 4LKEA 5J7MA 2CGNA 1EUTA 1YC61 2MHFA 5FQ0A 1CAVB 4JHTA 3ASIA 5FZ4A 4B4PA 2WNOA 4WZFA 4EN8B 3AMMA 3VDCA 1PMJX 1UU4A 5FY5A 4S2DA 4PF1A 5F5AA 5FLHA 2UYAA 4JDOA 1L3JA 3OPWA 2OQ7A 2Y8KA 4NIAA 2XKOA 2ZHLA 3C3VA 4QXCA 2DU1A 3WG4A 4AQ6A 2OUHA 2ZMLA 5LASA 3U07A 5AC93 3WDXA 1OQEA 2UWAA 3O12A 1UX7A 1W05A 5FZGA 3BIEA 5BNOA 2DU0A 5FZOA 1QXPA 3O1PA 2LM3A 2PHTA 5GLTA 2EAKA 5C9AA 2IXIA 4GD4A 2BNNA 4Q4Y2 1W8TA 1AJOA 2YG0A 4KGQA 1DLLA 4W50A 1A34A 1LOGA 4K8RB 2I45A 5A7PA 4CEWC 5JR2A 2A3WA 3SEPA 5FXVA 1OFNA 1RHI1 4QGLA 5LATA 1O8PA 3KV5A 1JYNA 5C4WB 4HN0A 4XIOA 2PAMA 2XWJB 3FHIB 4RR3B 3PNAA 3HEIA 3OSDA 3WINE 5I0TA 5FPZA 3GBWA 1U12A 1C8M1 4LORA 3HQUA 3ACHA 4IV1A 5JSOA 1S1AA 1OF4A 1UIJA 4XUPA 2HEVF 3SMHA 2VMDA 4RGKA 5EJ3A 3ORJA 4DEQA 5JWPA 4QXKA 3WEZA 5C8CB 1XNAA 3IKWA 3OGGA 1Q3EA 3VBUA 4HKOA 1XU2A 5C7GA 3RI9A 5FBJA 3A0KA 1AR91 1OLME 2CAVA 4KH9A 4IW3A 4QHZA 3NNFA 1W39A 2B5HA 4ISRA 5DABA 3MPPG 1LGCA 1D4M2 4P5YA 3LDKA 3KQ4B 1IG3A 3SCFA 4P9JA 3SKJE 2WLQA 1K5MC 2X09A 1MS3A 4GMP1 4TLGA 2DUQA 2OS2A 5JOYA 4O61A 2LW8A 2X5IB 5H9PA 2CDOA 4LULA 2D7FA 3X29B 4HFSA 5K7PA 3DYPA 3VBHB 2BERA 4KL1A 2DBNA 4YVSA 1JUHA 1QJU1 2VM9A 1ULOA 3C7GA 2LROA 1REFA 5A3TA 4YPJA 3L2HA 4KU7A 3K75B 2YFZA 1H6XA 4YZ2A 1IS5A 1HQNA 3K3OA 1KS4A 5FYHA 5CKMA 2C4XA 2VG9A 4MHRA 4CDWC 1HRV1 5I0RA 1G9BA 5A1AA 1AHSA 1MS0A 3U11A 3VDAA 2RS11 1K5JA 2PLV2 4NPRA 1PVXA 3UL2A 1ENQA 5L9BA 2FCUA 3FN9A 1O4YA 2FMDA 2VBBA 3KT7A 3MV11 5CNAA 1FI2A 1DZQA 2C1FA 2A3YA 4NRQA 1QNWA 3CJXA 1COV1 3ZSMA 1B35A 1V0AA 3TN93 3OGVA 1WMDA 1YFUA 3VBSB 2VZQA 3AKQA 3ATGA 2WZR3 2VU9A 4A2UA 4QKNA 1WA6X 3H50A 1EUUA 2R30A 3M3EA 2ZJCA 3IPVA 5LRSA 1MS5A 3ETQA 4PBOA 5LA9A 5IVBA 1AZDA 2AH2A 1WW5A 1VBD2 3EHKA 2VVFA 1V9U3 3ELNA 2MNGA 3VBFA 2JE8A 1XJAA 4FFHA 1EV13 3ECQA 4QPIA 3EO6A 1QJEA 3ZSKA 3NSTA 4Q4W2 1OC1A 1TME2 4IV3C 4K21A 1AR81 2Z2SB 3U75A 2XXZA 5FZLA 3FFZA 2TUNA 1ULEA 1XNCA 5LK5A 4FTSA 3SCHA 4AHWA 5CB7A 2AYHA 1VBC1 4Y1ZA 3FUOA 2V72A 5D8AC 3TEWA 5CFCA 1NCQC 3ZDVA 5BNPA 4FOWA 1ZZ7A 4WM8A 1H8VA 3WQBA 1NYWA 3OEAA 4LITA 2OA2A 2WNVA 3KF3A 4YARA 1UOGA 3DPRC 4JGYC 3ZYJB 2OXBA 3KS7A 2WT1A 3N3HA 1Z7S1 4UW6A 4OI2A 3FWEA 2I74A 4Y5Z0 3VZOA 1H8TA 3LOIA 4M4PA 3OJBA 2RDRA 4Q8KA 2DDUA 1R1ZA 2ZZJA 4GH4B 4SBVA 5GZEA 1CN1A 5F37A 4K8FA 1XPWA 4YW4A 4FAHA 1QQP3 3WDYA 3G6JB 4Y5SA 1HB3A 4TZDA 1NOVA 2P4EA 1XNKA 5FKBA 3BTAA 4A3ZA 4XF1A 2D6PA 1RUC2 3HD8B 4PQ9A 1UY2A 1FPN1 4W6XA 5HPOA 4UW3A 4EN6B 1VJ2A 5F2SA 1YEWA 4O9EA 3TBDA 4Q4Y1 5FYSA 2XGXA 2VE1A 4HSLA 2DVGA 4XJZA 1W06A 3F2ZA 4UAPA 1UN1A 3CEWA 3RNSA 4JQTA 2E33A 4ZS3A 2VNOA 1FNYA 2WZ8A 2CGPA 1PO23 3AZYA 3ILRA 5FUPA 1ONAA 3GCXA 1APNA 1QH7A 1WMXA 3T0BA 2DURA 3WX5A 5FP3A 4TYSA 5A7NA 2JECA 1VBA2 2JKXA 3J7LA 3VDDB 2ENRA 4CYDA 1ENXA 3ZFEB 5JAXA 3GBFA 4LIVA 1MQTA 4FOYA 3S5QA 5A3LA 1R093 4N53B 4JX0A 1OVPA 3LEIA 4IE7A 5GZCA 1OOPA 4YW3A 5FPXA 2VZTA 1RHI3 5A7WB 3GJBA 3FFQA 3JXSA 3AFGA 3A21A 4DXSA 3RMYA 2HWD1 3B01A 1SG3A 2BGPA 4CRQA 3H8RA 3VHRA 1NA1A 3NAPB 2O8QA 2P34A 3GYDA 2VNRA 5F32A 3TAYA 3WW2A 4AI3A 1D4M1 4CEYB 2WFF1 1GP6A 5FREA 4EJRA 2VUCA 4RSUA 4H55A 3N9OA 4EZ4A 3OGSA 3ZYRA 1H0BA 1C8M3 1PK6B 2NP0A 4A7ZA 4C1WA 4Y1YA 3VKFC 2EIDA 4KNCA 5BV6A 4RS5B 1ZNPA 1SPPB 3MDPA 2ORXA 4K6BA 3OCPA 1CZVA 3OY8A 2W1UA 1GWKA 3LAGA 1GFF2 2YC0A 3WP4A 1AR93 3GALA 3MIEA 3I2IA 1T6GC 4YZ5A 3HQRA 4HOOA 3CJIB 1CWPA 4C0BA 1YQ6A 1UXZA 2RS32 2VY0A 4QPGC 3GZTB 4GMP3 4ZONA 1S4CA 2JJ6A 1BJQA 2PLV1 2WT2A 4D6RA 3POWA 1K45A 2VTXJ 4LE3A 3AK0A 1V6NA 1AJKA 2D6MA 3BYWA 2CGOA 1YI7A 4RQPC 1G86A 1OLRA 3PMEA 4UW4A 1BVVA 2YC2A 5C6CA 1N47A 1RGSA 5FP7A 3LD8A 1JYTA 1QJU3 1WA4A 1MEC3 1WCKA 1XE0A 3HT2A 4JRLA 3QCWA 2VO5A 1ZZ9A 2W0XA 3KSCA 2VECA 3RYPA 1NG0A 1HRV3 2C9KA 3PUAA 3LOBA 1XSQA 1OA2A 1UX6A 1A6CA 1QU0A 1XE8A 1V6KA 2RS13 4LO4B 4P9IA 5F9TA 2ATFA 4FPKA 4XDPA 2ETEA 4BQ5A 3N9MA 3VB9A 4K1ZA 5DMYA 1RUE2 3Q8EA 4Q4W1 4LO6B 1TME1 3ZXAC 3T08A 2P3KA 2R7EB 5FY0A 2YC4A 1K12A 1BZWA 1IQDC 1W28A 3J7MA 1RXGA 3MIGA 2GU9A 4NE9A 4FTBA 2HYKA 2VCCA 3KD4A 1XYOA 3BALA 4COWA 5A3PA 2YPDA 4NIDA 1S0IA 5A3OA 4QXHA 2JE7A 1KXGA 4GB32 4WVVA 1W2UA 3NWKA 4XJ8A 4B7KA 3RZKA 3CL1A 4QM8A 1BBT1 2XR4A 1ZRDA 1SEFA 2VW2A 2JXAA 5E6HA 1GANA 3T30A 1DQ1A 4YZ3A 1BK1A 3LE0A 4KBZA 3OB8A 5F5QA 1GQPA 1AR83 2LS6A 3ABZA 1E5HA 3NL1A 2HBTA 1SFNA 4XFAA 4YLZA 5JI9A 2X8KA 1QGLA 1XNBA 1VBC3 2K9ZA 4YGDA 2ZEXA 1DYOA 2P3YA 3OTFA 2A70A 2BDRA 4XFHA 5KXBA 2ZPXA 3URFA 5EWSA 3FX3A 4L0PA 5CIRA 2ZGTA 1SBDA 4V2WA 4A3XA 2HJIA 4DOUA 3VGIA 2J1TA 4Q2FA 2PHRA 1Z7S3 4XILA 3LSDA 5EFUA 2WINB 1I1EA 4EROA 3T2TA 2W46A 3H7YA 4EQVA 1DZTA 4HVQA 4P9XA 5AFEA 3VBRA 1YO8A 1X9PA 4AI1A 2EXJA 2IFWA 5LK7B 2YBKA 5C9AC 2WSVA 5JI7A 1QOSA 1GR3A 3I2JA 4AVSA 2ZX2A 3ZXJA 1PGL2 3WP3A 5A6ZA 4LK6A 1ZX5A 3WNMA 4FXGB 2XG3A 4ONUA 1OUXA 4FI9A 1DHKB 5HV4A 4Y20A 2YYOA 2WL1A 3HR9A 3ILNA 5FZKA 2TEPA 4QMAA 4LNVA 3DYOA 1HJGA 1U5YA 4LR4A 4QDRA 1RUD2 3LWCA 4KWLA 1VBA1 2BFUL 4HETA 3NV4A 2B39A 5C8WA 3DXTA 3POGA 4Q4Y3 4LXLA 3O1RA 3TWIA 3F95A 1SBEA 2D98A 3J9SA 1O91A 3USUB 3WG1A 3JQXA 2OVUA 1W0NA 3GZUC 4IV1C 4IEPA 4Q4V2 5I0UA 3WT3A 1A8DA 2Q5TA 2H0BA 4QWNA 2ZCWA 3FUQA 1W2OA 5FUIA 1G8WA 1VRBA 4NRMA 2H0VA 3VBUC 3OF1A 4CEWB 2ZS6B 2O14A 3FC0A 4GKXA 1AR61 3IWZA 3UGFA 1GZWA 5EP9A 1OH3A 1UZZA 1KEXA 1JS9A 4LO7A 1T6BX 5FMCA 3PMSA 3CF6E 4M3CF 5I0DA 3BIWE 4HANA 1W0OA 2JX9A 1DG6A 4GJZA 4U36A 4DPNA 2Q30A 1UWWA 2VBPA 4I02A 2W5FA 4MOAA 4PLMA 3RJ2X 3SXWA 1MVEA 4AGRA 4Z8BA 2TNFA 4IQPA 5FJHA 5LB6A 4CCKA 2J1VA 3I59A 4MGSA 2JDZA 4OUSA 1N1YA 1E5IA 5IVYA 2W52A 2ZBJA 2YGLA 4FXKB 2W47A 3PUQA 4YVSC 4BHPA 4BQ1A 4AFCA 4DUWA 3EBRA 4JTOA 4AOCA 1D4M3 3EQEA 5FP9A 2LALA 2RS31 4Q0PA 2IUWA 4JKMA 2YUEA 3N4MA 2ZGMA 3B02A 2EXIA 3MHZA 5FMOS 3ZPYA 1PIV2 4LPLA 1K5MB 2ZGQA 1ODMA 2J1UA 3H1MA 3SHRA 5FCCA 3POBA 4BXSV 1IPSA 2AZ5A 4K40A 4XXAA 1DIWA 1LENA 1Q8OA 1CX1A 4DXTA 2VULA 3V0BB 1KDMA 3BI3A 1B35C 1RUI2 2WWUA 3ACFA 3PHMA 4IEXA 5A32A 1LTEA 2X53S 5IVJA 2GNMA 3A0NA 4LBQD 2ZAAA 4ASKA 4Y33A 1Y9MA 4QM9A 2PLV3 1HKDA 4LK7A 3AZVA 4CPBD 4B4QA 1UMIA 1KJLA 4XMAA 3TB0A 4CDWB 4XABA 2OQ6A 4KGGA 3T2QA 1JZ8A 3VBFC 1GU3A 2X29A 1RUE1 1WMFA 3GGLA 2GMPA 5A3MA 2Y33A 2VOTA 5FY8A 4COZA 1J3PA 1WLTA 4LQRA 1DQ2A 1W8HA 4GWJA 3N9QA 2VR4A 2GMEA 3WF1A 2NYYA 1RJ7A 2Z69A 4GB31 1KITA 4Q4X2 4A4AA 2DFCA 1VBD3 1LCLA 1XB9A 3KV6A 1ND3A 3IIAA 2WNVC 4Q4W3 1TME3 3K3NA 4O65A 3U4XA 3HNBM 1V00A 4Y26A 3GCWA 3LEKA 5GLWA 5T52A 1OKQA 3TYJA 4GMP0 2VVEA 1AL22 3PLQA 1UPIA 3AYCA 3BB6A 1QF3A 1H8TC 1WD4A 4IV3B 5AC91 3L2YA 4AEDC 3HPNA 1RL3A 4YFZA 5A33B 1JYWA 1W0PA 3FE5A 2KA3A 4GZ9A 3DN7A 2FZ2A 3WUDA 5IATA 4AI9A 1RUOA 3VD4A 1GNYA 2G9FA 2VCBA 3C2UA 4UF0A 4W65A 4XYXA 3UGGA 4BZ4A 5IFPA 5D8AB 2AUYA 2Y64A 4GIQA 4NIGA 3FBMA 1QDOA 4AAPA 1AXKA 1NCQB 3WCRA 5LA0A 3AMPA 1EPWA 3JU9A 1TVGA 4LBOA 4XQ4A 3UJOA 2JG9A 4MH0E 4WM7A 5FZAA 3ZXEA 4JGYB 3DPRB 4Y3OA 5JVVA 1BHGA 5FLIA 4YM1A 1AX1A 4Z2AA 4JCKA 3J8F1 5IUQA 1ZVFA 1ZZ6A 2CDPA 1ZRCA 2J1EA 4FPJA 5DAWA 3O0XA 4CDXC 1PGL1 1OBNA 5IJRA 2A5ZA 1RINA 1JHNA 2R042 3LPGA 4LKDA 2VL4A 4BOWA 2R1BA 1YFYA 2OW4A 4A6OA 5CA6A 5JZGA 1SBFA 2E53A 5DG1A 5C5TA 2Y26A 1Y3TA 3V0AB 5ANQA 2G1MA 2XBO2 2CV6A 2XJTA 2XWBB 4X8NA 5FK7A 1ZYBA 1NLSA 3HOBA 4LBQB 1GMMA 3CZUA 1ZRFA 3RQ0A 1UAIA 3M4FA 5CFDC 2ZX3A 4DS0A 2A1XA 5C3RA 1F35A 1OOPC 2P5BA 4ZZ5A 1GZ9A 4B29A 5KC5A 1FOD2 2ZX1A 3WCSA 1H2KA 2P2KA 3POFA 3VBOA 4FO9A 1LECA 1NA1C 1VBA3 1PVC2 2BNOA 2VQ0A 4WVZA 3NJYA 4AFBA 4YW5A 4DRVA 2PHWA 1YQ8A 2DCTA 1UYXA 5T5JA 3B94A 1LU1A 1WKYA 1HB2A 3HJRA 1VE0A 4NPLA 3ZN6B 1JI6A 2DFBA 1QXJA 2CHHA 1AYN2 5GLUA 1CAUB 3AJYA 4RFT0 4S2GA 5JXJA 3IN9A 3KF5A 3VN4A 2VOVA 3LFMA 4HZFA 1LODA 5L9VA 3AL6A 1MACA 2DVDA 5FPVA 2W1SA 3FBYA 2HWF2 2YROA 3MEPA 2YHJA 3ILFA 3ACIA 3AKTA 2ZGOA 5CADA 2BOIA 1VIWB 2PAEA 3VZKA 1N3PA 1PIV1 1C1LA 2ZGKA 4K9SA 3RSJA 1UYYA 3NKGA 3WZ1A 3O1MA 1QOOA 4QPYA 4NWVA 2VD7A 5J3UA 4K7JA 4IUGA 4FQ4A 4BMBA 2ZTNA 1GWMA 4PCRA 5EJZB 4XETA 5A7SA 4DUXA 3O1OA 4LUMA 1F31A 3SEEA 4OHWA 1RUH2 3NRUA 4AE2A 3KCYA 3OEBA 2A6XA 1VB2A 3GNEA 3KCCA 4NWWA 5FYTA 4RFRB 1AXZA 2RS33 1QWRA 1TQ5A 3JB4C 2J1SA 2R6QA 4BA6A 2B42B 4HK8A 2G9ZA 2JEMA 2Q4SA 1PX4A 4LJHA 1FYUA 1UYPA 4QPGB 3PUHA 5FK8A 2WO1A 3A7QA 4AVAA 2E31A 2HWC2 4I0AA 5A7QA 5IK8A 1SHWB 1UOFA 1OI6A 4RQPB 2SLIA 5J09A 1Y7BA 3POEA 2RDQA 3Q8FA 3W59A 2WO7A 1UF2C 1RYYA 4DB5A 1US3A 4XF0A 4CTEA 5FZ9A 5FYIA 5SV5A 1W6OA 1S0BA 4J1XA 4AEKA 1LAJA 1KJRA 2HEYF 3ZFFC 2FDKA 4QX0A 4NIIA 3WW4A 1F2NA 3OBZA 2V4VA 5KHKA 4YGCA 5FXZA 1LHUA 1JUIA 4ET7A 3AZXA 2E6VA 1RUE3 2VC9A 4J1WA 4MYEA 2D3RA 2BWCA 4Y22B 3NNLA 1FATA 2P37A 1AL21 1GOFA 5FZ1A 5DXDA 1OQ1A 2P6HA 1IS4A 1R64A 4AI0A 1J1TA 4KWUA 3T0AA 3ES1A 5IVVA 1FXZA 4GB33 1W6QA 2WR9A 2HEWF 3HWJA 4LLFA 4RL7A 5L7OA 5H9RA 1VAVA 1ZZCA 4IE5A 1LGNA 2VGDA 3CIHA 4AQTA 1W6PB 1CAVA 1WW6A 2NN8A 5FXXA 4Q0QA 3THTA 2E51A 2VMFA 4OULA 1BMV2 5JPMB 1L7LA 5FZDA 3WNNA 1UIKA 1DYKA 1W6MA 5HCHA 1OURA 5APAA 5BNNA 3FHQA 1PO21 5IT6A 3KVBA 4PLNA 2DUOA 4XFIA 3FLTA 3NO8A 4XURA 3BPZA 3NJVA 2WRAA 4QX3A 3ZVXA 5C3QA 3WQ7A 2W2IA 2R041 1RB8G 3INAA 4ZPIA 3BU7A 4XF3A 3CLPA 4B1MA 1R091 1XU1A 3AXEA 1JZ7A 3W20A 1FMD2 2JG8C 4Q1PA 4XJWA 4EN0A 3N9PA 4AXOA 1SLIA 2JENA 2VXJA 1N1SA 2XBO1 2B46X 3P6BA 4XF4A 3M3QA 1VBB2 3J8F3 3TNPB 2RJKA 5FZOB 2WAAA 2VQTA 3I8TA 2EALA 3HMYA 3ST7A 2ZGNA 1UW8A 2IXHA 1CIWA 4JC1A 3H0OA 3UT0A 5C9AB 5J48A 1FOD1 4Z92B 5FWEA 3KV9A 4L2NA 5FBZA 3VD7A 1TMF1 3ZIXA 5C3PA 1IPKA 3FZ3A 3MBWA 1RUD3 5T5PA 3VZLA 3PJYA 2HWB2 2AEZA 1PVC1 3M70A 5I8SA 4EWDA 3S0MA 3W58A 2QQOA 1S2BA 1V6OA 2WDBA 4M00A 4XZUG 5C8CA 2VZ3A 1JBCA 2ZZQA 1D7PM 1WW7A 5F6LB 2JDYA 4IGPA 1ULPA 4Q4V3 5K0UA 1LGBA 5KBFA 3UNPA 1F4HA 1RITA 1UNBA 4GWNA 4IV1B 3ZO0B 4XUTA 5LEJA 1GQGA 1RVF2 4K20A 5FYZA 4AHXA 3D6EA 3JD72 4YM2A 2NMOA 4NPMA 4Q27A 3R4SA 3M3OA 3VBUB 4ASLA 2I2SA 2X5IA 2ZHKA 1QJX2 2R0FA 3AMQA 1MZEA 1MEC1 5JCTA 1LEDA 4HVOA 1LOCA 5GLVA 1ZA4A 4CU8A 2E7AA 2FDIA 2VCMA 3JZVA 1DBNA 1I6XA 1NQJA 2WNUA 3UV9A 4LOTA 3AB0A 5FJKA 4A44A 3OD4A 1W6NA 5ABJA 2MPFA 1PGW1 3OUIA 5HBAA 4J6GA 4COUA 4L97A 1UY1A 4M3CA 4NUBA 1RUH1 2VZ1A 1IS6A 3N36A 1H1AA 5FWJA 4QXBA 1O3TA 4YVSB 3VD9A 4BIFA 5ACA1 4AW7A 4B3NA 1NKGA 1Z0HA 4YZ1A 1NCRA 1E5RA 3D0JA 1PIV3 4U2AA 2LTNA 4QGNA 5DUUA 1CESA 3SITA 2F4LA 3WDWA 3P3NA 3VBSA 1J3RA 4LBLA 2HWC1 3NQHA 3VV1A 3AP5A 3IMMA 2WQ4A 2HYXA 5GM0A 3GXUA 2BVVA 5FUNA 5EYXA 3R4UA 5J36A 3B9IA 3MV01 1OLQA 5EPAA 3S6PA 1T2XA 4BB3A 5KHHA 4ZXKA 2O1QA 1NXMA 2BBAA 2ZOEB 4HT1T 5EXOA 3U37A 5FY1A 4NOTA 5BNQA 4N43A 3H8XA 1B35B 1JOJA 3M2MA 4P02B 3RPQA 2W95A 1H2NA 2VBDA 4MGQA 1NQDA 5DUXA 2Q8EA 5M0TA 1W9FA 3KGLA 2A6VA 4OZOA 1XBFA 4KI5M 5FV3A 1ND3C 5JMOA 3LIHA 1JYIA 2XVLA 2ZHMA 3ZSJA 1UKRA 2GNTA 3MIDA 5A6XA 4R8HA 2GNBA 2XHKA 5L9RA 1GNZA 4RHV2 4UW5A 4IETA 3VBFB 2ARBA 4C90A 3SH4A 4CXYA 3NNJA 5H9QA 4AHZA 1OMIA 4V1PA 4YG0A 4R9AA 2ZAHA 4Q4X3 4BJ0A 2GMMA 4CDQA 2QZ2A 3GDBA 2C5DA 4D8MA 3B93A 3OGJA 4JDMA 1JHJA 4CCLA 2KD7A 3CQOA 4PBPA 2VZVA 4P14A 5AVPA 4DMIA 3HQXA 4FTEA 1SLCA 3UGHA 2PMWB 3MLJA 2W9XA 4GH4A 5DAXA 4ZHNA 4NHXA 1LB2A 1YUDA 1JMUB 3DKWA 4PIYA 1AL23 1O4ZA 4WM7C 2WNVB 1LRHA 3WF0A 2BYVE 2QQNA 4YG3A 3LKJA 4N7UA 4W6WA 2QQWA 3MICA 4AZZA 4LO8A 3RRDA 1H8TB 4XMIA 4WVMA 4AEDB 4KG0A 3OUHA 3VUOA 4E2GA 1R1A2 4N90A 4FBFA 2DYCA 2ZA9A 4MXVA 5GKAC 1GP5A 4JGZA 1I5ZA 2AENA 2QVSB 4FFGA 4A42A 4NJ4A 1DQ0A 2C6SA 4FPCA 3ALQA 5JZGC 3RG0A 2YPJA 4QU2A 3M7AA 1OKOA 1DGRA 2HBUA 3PL0A 1WZXA 4YVWC 2BQPA 4QD2A 1PX3A 3VZNA 2Y34A 2ZEZA 3O14A 1WLCA 3LQCA 1HN0A 5FYUA 2R043 4QB2A 3I3DA 3RS6A 3O1VA 1MZ5A 3DF0A 1YHFA 4CDXB 4JTNA 2VMEA 4IXLA 1SACA 3QOPA 1HB1A 4PDWC 4P9LA 3VBOC 3I49A 4N53A 2XBO3 2HWB1 2QJVA 5FPLA 4OQ9A 2QQPA 1DGLA 2VXRA 1PZ9A 2BJSA 2D6LX 4OHXA 5A7WA 1C5IA 4NHKA 5FYVA 3THDA 5LY1A 5H9SA 2EXKA 2GP3A 3PVNA 3HNMA 5DPNA 1JXNA 2WS92 1H9PA 2XH6A 4EZHA 4CEYA 5GALA 1YIFA 2DVAA 2OZJA 4XW3A 3RI8A 1FOD3 5CFDB 1W9YA 3UYJA 2JWPA 2OPKA 1TMF3 1PK6A 1RVF1 3NJZA 1O59A 1OOPB 3JD71 1YWKA 1OD3A 3OYWA 1PVC3 4ZZ8A 4XHXA 3R05A 4EE2A 2WJSA 3V0AA 1ASJ2 1AX0A 4Q0SA 3VHPA 1UZWA 3LFIA 4EWAA 1TE1B 1NA1B 3DKQA 3MGUA 5DZEA 2DCZA 4RA0A 2DVBA 1UY4A 3L9JT 3AYEA 3O0VA 3VZMA 5F39A 1AYN3 1JU3A 1OVSA 1MZ6A 1V70A 3ETPA 3RZHA 3K46A 1DF0A 2L9LA 3ZKUA 3VKMA 2QQVA 3MZHA 3W9AA 5FPAA 3OBRA 2CNAA 3HT1A 4FPFA 4IESA 5JOXA 1GKBA 4DRRA 1WD3A 2UU8A 3B00A 2VUAA 5BYNA 5EYYA 2HWF3 3MFAA 4QQLA 1JTZX 5JDBA 4M3CE 2WT0A 4MO3M 2D5HA 1F4AA 1VR3A 2CY6A 2D93A 1H4HA 2WYSA 3ZYGA 2XLFA 2CU5A 3Q8CA 2GH8A 3IDBB 1UOJA 1BKZA 2A71A 3BKZA 1VBD1 3ZXDA 1FV3A 1ZBA2 2A6YA 4OZXA 1RUH3 2WABA 3K51A 4RD7A 4XDOA 3ZYPA 3ZX7A 4R52A 5F6KA 4R9CA 3R6SA 2FD8A 1KGYA 3ZXFA 1H6YA 1QJY2 5ACA3 2XOMA 4YW7A 3J26N 3RFRA 5IVCA 4AL9A 1S0JA 1I9RA 4URTA 2HWC3 4LBJA 3ZR6A 5IK4A 2W92A 2DF7A 3ZFGC 3FLPA 1BQPA 4GWMA 4JKKA 1H1IA 2E9QA 1YFXA 1QNYA 2ZGLA 2DBIA 2GAUA 2IWGB 3NJXA 4RHV1 3I2DA 3SH3A 1A8MA 1J84A 1JW6A 4H3WA 4BDVB 3VD5A 3BVCA 5IFTA 4KQ7A 1BYHA 3H3LA 3N7LA 4XEZA 5CISA 4HG6B 3ZPOA 2NPIA 2OUJA 1X36A 4ZXEA 1SFYA 3PVEA 1CPMA 1FNZA 1XC6A 5L7OC 1JOBA 2W87A 2JDKA 3ZFFB 1ALYA 1VRH2 2XUEA 2V5YA 4AF9A 3MIHA 4FQZA 3AL5A 2A6ZA 4MXWB 1JU4A 1WUVA 2E7QA 4JZRA 2PXJA 3C7OA 3JUUA 3H7JA 3S7IA 5K4LA 5BNNC 4O7XA 2I07B 1ND2A 5LY2A 1UYZA 2PAKA 4XCAA 1JYVA 1Q8QA 4LOSA 3TEZA 1RUC1 1CX4A 2A7AA 3HVDA 1STMA 2BZDA 1FX5A 5BNOC 4QQHA 4AWDA 2EIBA 5BY5A 2DTWA 2DWRA 3Q9OA 2KR2A 3KWVA 4FAGA 2W91A 3IM0A 3WNOA 1LHWA 4YFWA 1H30A 3LEGA 3ZOIA 4BQ4A 1W8OA 2XB6C 3IDCB 5JXHA 1KDKA 3TRSB 1JZ4A 1LEMA 2YB7A 2Y0OA 3H1YA 3PIJA 1GUIA 4Y24A 5DAQA 3NMBA 5LCWL 2JB4A 1TEIA 1VMFA 2MEV2 2Q0AA 3M3CA 2ZXQA 4LIUA 3ROUA 1VMJA 1YLLA 2FZ1A 2BUKA 2OPWA 2HKXA 1CAWB 3SC7X 4XCBA 1YYNA 1N3QA 3C7HA 2EVXA 2JDHA 3JBG2 1IKQA 1URXA 4I0BA 5FIXA 3P3PA 1QEXA 4CP9B 1O4TA 1C57A 3K48A 2YXSA 4OHZA 3PUSA 3ZMOA 1JH5A 2JG8B 2OZ6A 2Z5WA 4IEVA 4Y20B 5JIUA 2E63A 3T09A 4UBGA 4Q0VA 2QUOA 3LA7A 4X6RB 4YZ4A 4BM8A 4CEWA 4OHYA 2WS91 1NY72 1ULCA 3NNGA 4OUEA 4Z07A 2BU9A 3H1WA 5K0UC 4UBHA 3MFCA 5FOBB 4IEQA 2ARCA 1W8WA 3ACGA 2XMLA 5FZ3A 5CG9A 4HBNA 4UFJA 3VZJA 4MGZE 4CCNA 4X8PA 2B9VA 5D2AA 2ZHNA 2FDJA 2HWB3 4YW6A 1NZIA 3I2FA 1ASJ1 4KU8A 1QJFA 2R0HA 2XONA 5F3CA 4AEMA 3SKVA 4AVBA 2Y38A 1GZWB 1XSRA 1C1FA 1W2NA 2G9GA 1W8UA 2ZMKA 3RYRA 3HAGA 4DXRA 4XOGA 1Q8VA 2ADDA 2VTXA 3VL8A 3FL7A 2WNUC 1OH4A 3AP7A 3CDZB 1E57A 3MUZ1 3U14A 3WDVA 2BBVA 2WLPA 1PZ8A 3E97A 3MLLA 4XHBA 4XFGA 5ABJC 1RVF3 4MUVA 1UQXA 5E1RA 3WSOA 4CP1A 3JD73 4QX5A 4KWKA 3I59B 2P1BA 1AX2A 1RUNA 2ORZA 4P9YA 5ISLA 1QJX3 2K2SA 2QQUA 5K9YA 2E7TA 3WR0A 1NCRC 4OUMA 4CDUA 4HL0A 4CCEA 4CVUA 1W04A 1RIRA 5HI0A 3AM2A 4OLLA 1SDWA 4PJYA 2B4KA 3AC0A 2FQPA 2XLGA 4YG6A 5J1XA 1PNGA 1ZBA1 1WWYA 4E4ZA 4G3YC 1UZYA 1G9AA 3VHOA 5GZFA 4X6QB 4QPIC 1AXYA 2E32A 1S2EA 4QX1A 1OXCA 2GC0A 3GZAA 3J7HA 4QKDA 1QJY1 4Y4RA 4BQ2A 2ZGRA 3PIGA 2AR6A 4N43C 1REEA 4QB1A 1X7NA 4OCTA 1H1MA 1MPXA 4TXWA 1ZBE2 5E8AA 4AYUA 1OT5A 1VB4A 4J25A 4KWJA 5A3UA 4C1XA 5EV7A 5CFCC 4URAA 2IZWA 4Q1RA 4HXCA 4W6YA 1W9SA 3WVJA 2NMNA 1BLZA 3EYPA 2WYFA 2RG4A 4GQ7A 3UKVA 5BNPC 4LA3A 1SZBA 4WM8C 4Y1XA 4I3PA 2WO2A 2ZABA 5F3GA 4NROA 3KT4A 4GA9A 1ULDA 5DZGA 1ENSA 1LR5A 4C0HA 5HCAA 5DDJ2 5DQ0A 1BXHA 4CDQC 3GF6A 1TNRA 1LNSA 4UXAA 1NXD1 2V5DA 3RWNA 4IV3A 3ZN4A 3GHMA 3I2KA 2XJRA 4N7IA 4UFMA 2XJPA 2VOKA 5HCFA 1S55A 2FMYA 4HPKB 5C71A 1KS5A 4RHV3 1ND3B 1U5ZA 4L11A 3WDTA 1UZVA 2ARAA 5ERLA 3ZKYA 2VW1A 4UFKA 5D8AA 3ZDSA 3A22A 4QHOA 3CHXA 3POIA 2VUDA 3S57A 2Y0IA 3W5MA 2ADEA 2PHLA 2XVGA 1KFXL 1VMHA 2VH9A 3RVHA 2EIEA 2NZ9A 3EJKA 3SLIA 5EIYB 4JGZC 1OSGA 1OPMA 2WQ8A 2Y6GA 4UF0B 2VZUA 4H7LA 1V6JA 5EQUA 5A70A 1HN1A 2RVAA 4HK9A 4XIKA 1DGWA 4MHUA 4QHBA 4KG8A 5D1IA 3WG3A 1HQWA 4MGTA 5FDBA 4WM7B 4H7MA 1NE4A 1RUC3 1RUD1 5E89A 4FP2A 2WIIB 3EB7A 4XAAA 4CCCA 2G4IA 1HRI2 1D2QA 1DQ5A 1HQLA 1R1A3 3C8XA 2NQYA 2QQKA 2VOXA 3A4UA 3P1IA 5FY7A 4OI1A 3OBAA 2R16A 1DP0A 4LBQA 3VD3A 1MQTC 5LA2A 3OOXA 3JBG1 4Q4V1 3AP6A 2BGCA 4CPBA 2J7MA 3POYA 2AC1A 4SLIA 3D8CA 2WSUA 3ZYHA 1UY0A 3WY6A 4NO4A 1I3HA 4E8CA 2YY1A 1O8SA 3SQOA 2VVDA 4CSWA 3OPTA 2XJVA 5JZGB 1C5HA 1SQ4A 1J59A 2WAOA 4C8DA 5K8SA 1POV1 1WGPA 3PU3A 1QMJA 2IVIB 2PHXA 3H9AA 4GULA 4BLIA 5CEHA 1SDDB 2RMU2 1NLRA 3BOPA 4YVWB 5F5IA 1C4RA 4QX2A 4AGGA 1YQCA 2WA4A 3CO2A 2JIJA 2XQXA 2YDEA 2Z4FA 5DUWA 1OQDA 3H3UA 3WXPA 1W9WA 4XJ9A 4Z82A 1DLCA 1SFPA 5JOWA 4YSFA 4B4RA 2ZKNA 2YMZA 1AF9A 1CAXB 2JD4A 4PDWB 5L73A 1X50A 2ZX0A 2JE9A 2RHPA 2WFPA 2C24A 4INDA 2WS93 2VPVA 4O9GA 3H3ZA 3QH7A 4BQ3A 2UYBA 1NT0A 3UJQA 2YU2A 1OFSA 3BOWA 1AYM2 1OHFA 1W9TA 1UCXA 4R9BA 4I01A 4IEYA 3APBA 2EICA 4BK5A 2PHFA 2K46A 2YU1A 2FDHA 4XFFA 3WQ0A 4CA9A 4QGMA 1IG0A 2UWCA 2YGMA 3EXUA 1ASJ3 3I3EA 4CCDA 3QLQA 4AI2A 4FFFA 1RUI1 5DG2A 3RZZA 3VDBA 3H8OA 3RZLA 3UESA 4V2VA 2ZMNA 4R9DA 3MI8A 2F6BA 5JR7B 4M0NA 3ZM8A 4YM3A 3PTRB 2BWAA 4HKWA 1PM4A 2J1RA 4HMZA 1LKNA 5EZWA 3B5LB 4ITCA 4MADA 2RS52 1HV1A 2CL2A 4I2OA 2VZRA 1YJLA 5KHJA 1D2SA 3PURA 2HWE2 1QH6A 2WN2A 1UMZA 3RDIA 2RDNA 4WZCA 3KGZA 4FT8A 4QKFA 2QTWB 4Y4YA 4ASMB 4JHZA 5LZ6A 1LHOA 1GICA 1ZRIA 3K77A 4JDNA 4XBQA 4H14A 5EJ1B 2GC1A 3MO4A 2UY8A 2WUHA 2BGOA 3MYXA 2WZEA 4MLOA 4Q4X1 4XC9A 5BUVA 1COV2 3MPBA 1GYKA 1FT9A 1G6NA 1ZBA3 5C3SA 1CVNA 2OX0A 3AJZA 2ARXA 5D21A 1CR7A 4E4HA 3VKOA 3O1SA 1X8EA 5LBEA 1QJY3 2WNEA 3SH5A 4TWTA 4DINB 4ZU4A 5DDJ1 4CCOA 4LEJA 4AGVA 2D97A 1SCSA 1N1VA 4IE6A 2BP6A 1L7QA 1GNHA 1W6OB 2OT7A 3OPZA 5ANNA 4DXZA 4ATEA 1SLBA 3IDEA 2JDPA 4R4ZA 1MVQA 2WN3A 4LKSA 5F8PA 1RUJ2 1XE7A 1D0HA 3ZR5A 2UWBA 1IS3A 2CSGA 2IXJA 4FFIA 4IE4A 5LBCA 4P9WA 5A1LA 4FPEA 5FZHA 1YI9A 3ZFGB 4DY3A 1JZ5A 1ND2C 1TG7A 1UPSA 1W6PA 5FPBA 5T55A 1ULGA 3WUCA 5F1RA 5L36A 1R082 1OPOA 2IXCA 1N1TA 1XQNA 5DAPA 3MLKA 4XUQA 1PGSA 3VBRC 2ZEYA 4MGIE 5FZBA 1G9CA 3BTZA 3CZJA 4DEVA 4NVPA 4TTGA 3I3QA 3V65A 1JZ2A 2BEOA 3K2OA 4M4RA 3NV3A 5FQ0B 5L7OB 2VMGA 3RZGA 3BTYA 3GBGA 3WOGA 2V4AA 5FZEA 3HN1A 3E5QA 5J96B 1W6MB 1Y43B 2OIIA 2Y6FA 4ZY9A 1VBE2 4XF9A 5BNNB 1F8VA 1RTVA 1K3IA 5C70A 1HRI1 3FJSA 1CZSA 5JPNB 4XUOA 5BNOB 4FPHA 5C4WA 3W5NA 1F5JA 4RR3A 5A80A 1FPN2 4CP0A 1JYXA 1W8NA 2WC2A 1HLCA 2IXLA 3B3QE 2R32A 1GBGA 4NHYA 4YNIA 3S7EA 1PNFA 2XKPA 2D6NA 3W21A 3IAQA 2PQQA 5IVEA 1GP4A 1SLLA 3GHNA 3KLSA 5JXIA 2MEV3 2GDFA 1X33A 1WBFA 2GALA 2SBAA 2RMU1 2PA7A 4XBNA 4D94A 2DTYA 3PU8A 4IEWA 3VLBB 5B4XA 5A1FA 4XVHA 1G9FA 4E2QA 3KMHA 3JBG3 5JMCA 3Q8AA 2VQUA 4PF5A 1IKPA 5SV8A 2FDFA 1XNTA 4QQPA 2A6WA 2W39A 1PO12 1AYN1 1MS8A 2P3JA 1AR72 2B45X 1UD1A 5FMOL 4YM0A 1VP6A 3V56A 3I7DA 4P9GA 4JRAA 1S0EA 5KHGA 5I0SA 1POV3 1XYPA 3HNYM 3HIFA 4CXXA 3OUJA 2HWF1 1ST8A 1RMU2 5A3NA 2BFUS 5TSWA 5I93A 1AYM1 4FVVA 5DUVA 4M01A 2HWD2 3VBHA 2JKBA 5T3NA 2PN5A 3T0DA 1NE6A 5K0UB 4N8MA 1REDA 2QE3A 3R4DB 1CD3G 2WFF2 5LA1A 5CAZA 4D0QA 1O5LA 3P5BA 1UZ0A 2ET1A 5E88A 1NAEA 1O6UA 4ZS2A 5LBBA 5KXEA 4CE8A 4DNYA 5FZ8A 1CONA 1XRUA 5HXMA 1YRZA 2VNVA 5G05L 4CDUC 1QY4A 3IMNA 1W3XA 1ZRRA 2FDGA 2XDVA 4XJUA 5FAXA 2JDUA 2QQJA 5F3IA 2RS51 3FLRA 5T54A 1WCUA 4OMDA 5B2GB 3I2OA 4QX8A 3UKTA 3E5XA 2WNUB 2DCYA 2HWE1 2GN3A 2V73A 5FY9A 3WNXA 2F4PA 1LULA 1W6NB 5ABJB 2RR12 1UL9A 5JXGA 1TNFA 3UK9A 3ME2A 4MG2A 2A75A 1RUI3 2GP5A 4M3CB 4BIOA 5BPXA 3WW1A 1Z78A 1LOFA 5FMDA 5JIAA 1GOGA 3UKNA 3N7JA 1YIPA 5AFBA 1RUF2 2QNKA 3V64A 3QD6A 5FP8A 2WO3A 1NCRB 1OUSA 4LT5A 3ZXLA 5FFOC 2QZ3A 3CBNA 4JV4A 3IPVB 3S30A 5DAVA 4Q8LA 4ES9A 4ATFA 5KXDA 2XL7A 3HBKA 1V6LA 3LZZA 3AKPA 4E9KA 3J4UH 1YQ5A 2P3IA 3WP5A 3BGAA 3LDBA 3AZWA 2D43A 2RDSA 4CUBA 4E4DX 4QPIB 1ZBE3 2HLEA 4QT6A 1W8FA 4DO0A 1RUG2 3DCQA 2YZ4A 4N43B 1GV9A 1WLDA 3TEXA 1RUJ1 4FPOB 4M0HA 3M1HA 4WBBA 3ZXKA 5IAXA 3MIFA 2ILMA 3LIGA 1A78A 1BMV1 3KCXA 3WNKA 5IYYA 5CFCB 1S2KA 3I97A 1VAKA 2FBEA 3WF4A 1Q8SA 5BNPB 1WCQA 1BEV2 1R081 4WM8B 1WCDJ 2JG9C 4YGBA 5DDJ3 3WF2A 3GM8A 3M3IA 4BK4A 1BBT2 2LRPA 2C0ZA 4CXWA 1CQ9A 1MS9A 2CWMA 4IEUA 2R072 4LTAA 2VJXA 4OVEA 4AVVA 3T4VA 3B69A 5CU1A 2R062 5A7OA 4CDQB 1ZREA 2H6BA 1WW4A 1W8ZA 5F3EA 4D69A 4PLOA 4PHZA 3J7NA 3ACLA 1CZTA 4AEDA 2Z42A 4AI8A 1HXS2 4A45A 1FMD1 3Q8BA 2QCSB 1H2LA 3RGBA 3IIIA 4K1YA 3WNLA 1VBE1 3I2GA 3THPA 4D7SA 4PI2A 5C33A 3RZJA 4MVTA 1D0GA 4E2SA 4NMIA 4FCAA 4BISA 3LF7A 1VPHA 2Y6LA 3QBQA 1PHMA 2JDMA 1VBB1 2ZKLA 2D6KA 4A7KA 1GWLA 1XNDA 3THCA 4WVMB 5GZGA 1PM7A 3UETA 4BH9A 4ES8A 2OKXA 1YJKA 4JGZB 1DGWX 3VDDA 1VALA 4XFCA 4Y1VA 3ZFEA 2IFRA 4CDXA 4AVTA 1QXRA 2RM22 2K0GA 2XJUA 3IB3A 1HRI3 5FYMA 4F83A 4HKLA 4CUCA 3LEMA 2LUWA 3IAPA 4GKYA 3TOJA 4OHVA 3IT8A 3NV2A 1O3RA 1IQAA 3E6BA 3O0WA 4KBBA 4COVA 2BNMA 5FZIA 1EP0A 3AP9A 3NAPA 1PO11 3LPFA 3NNMA 2WWSA 1MQTB 1V6MA 4S2HA 5IW0A 3RMXA 1AR71 3AKSA 1FV2A 1IZ3A 1LJ7A 2BRTA 1UXXX 1YFWA 1C8NA 1UU5A 1DU3D 4IGOA 4OFGA 3OGRA 4XDQA 5CFDA 2D3PA 2XVKA 4GALA 4Z2WA 1M06G 2R1DA 1EAH2 1UMHA 2EIGA 4RS5A 3VL9A 1SPPA 2VQAA 2RMU3 3LA2A 1RMU1 4EN9B 4DY5A 4D7YA 1GOHA 1QJX1 2ZGPA 2C9AA 3LGRA 2WWJA 3DYMA 5KR7A 3I3MA 1SCRA 2ZEWA 4Q0UA 1ZA7A 2VMHA 1AR62 3E6CC 4OMCA 1D4VB 2G19A 3VHNA 4NHLA 2J1AA 5LWBA 3CJIA 3T4HB 1PMHX 4UFHA 1DGRN 2R49A 2VNGA 5FZ0A 5G04L 4YWAA 2Y60A 1ZZ8A 3OYWB 2X05A 3ZSLA 4E27A 3MW3A 3PJQA 2VZSA 2W94A 5IHRA 3TEYA 3OY8B 4P00B 4I0WB 4YW2A 5FLJA 3MW2A 4P5HA 5FRAA 5C5UA 1AYM3 2VTFA 3AMHA 1NLQA 1DQ6A 2NM1A 3JQWA 3RJRA 3M8LA 1W2AX 2JB8A 4HVRA 4EN7B 2P17A 4E8DA 1KRIA 4PT6A 4D3WA 4QX7A 3WHUA 2RR11 3ZSEA 4B1LA 1Q5OA 3LSEA 3G7DA 4A6SA 4DIQA 2ES3A 5JSRA 4I30A 3WF3A 4Z1VA 4QQOA 2EA7A 1TZOA 3ITQA 3BUCA 3K4AA 5JUVA 1RC6A 2Q1FA 5J98B 1RUF1 3MF9A 1CIYA 1MS4A 1EYBA 2GH2A 5KWRA 2RS53 4F3JA 5EHDA 5FOJB 5LW9A 5FXWA 1H4GA 2HWE3 3U4SA 1POV0 3PVBB 1IPJA 4UOJA 4LE4A 4W4ZA 2EF6A 4ZKTB 1E5SA 3SCGA 3T1LA 3U0ZA 4BMEA 2RE9A 3T3YA 2CWSA 2HH9A 1RUG1 3HN3A 3WDUA 4GWIA 1O3SA 1W3VA 1QDCA 4PI0A 3BN6A 1O3QA 4L9BA 3KB5A 4BLJA 1COV3 1UO9A 1UOBA 3IZOA 4CU7A 2DCJA 1LOEA 3D3AA 4AAXA 3ZMNA 1F15A 1VLNA 3ZFFA 4AQ2A 1BEV1 1YNAA 3RYKA 5LBFA 2QQLA 1HDKA 5A6QA 4YRDA 4MXWA 1HIXA 3JB8A 1BK0A 4CZSA 4XQDA 2D6OX 3OG2A 1XOYA 2JIGA 2R071 4LHNA 4QDSA 5B4NA 5FPUA 1WBLA 1MS1A 1RXFA 2R061 1RUJ3 1J83A 3WD5A 4FPGA 4HN1A 2WA3A 1R1A1 2BV4A 2VOWA 3AZZA 4AFAA 5AC92 1HXS1 4CCJA 2VCAA 4ISQA 4L99A 4C91A 1R083 4IEZA 4CU6A 5FO8B 5KXCA 4HSJA 3QH6A 5FTTC 3KHBA 1ND2B 3WW3A 1F5FA 1GZTA 3AMNA 3TNQA 2H6CA 4META 2B9UA 2PHDA 3WP6A 3ZIWA 2BVBA 5IK7A 1GLHA 2KXLA 4A7YA 3K4DA 4UWDA 3AVRA 5C4WC 2V09A 2VAUA 1KQRA 2JICA 4NAOA 2AACA 5JSPA 3VBRB 4IE0A 4RR3C 1NZCA 2DCKA 2VZOA 4L92A 2UURA 1S0GA 2QFEA 3I54A 1CAWA 4RYDA 3KZ4C 3WV6A 1FMD3 1ACCA 3J8F2 3USUA 1VBE3 4LBKA 2RM21 3WLUA 1KD7A 4AHYA 1N3OA 4BXFA 3ZYFA 5FKCA 4CP9A 3MIBA 3OBTA 5LRRA 2EXHA 4F7ZA 5C8CC 3E1F1 1VBB3 2ZX4A 4NN0A 2JG8A 3U1XA 4TSVA 1JZ6A 1SMVA 4NAMA 1J1LA 4LKFA 5F7UA 4JAAA 1A3KA 1ULFA 5IK5A 3B9CA 1FPN3 3CNAA 1EPZA 1LOAA 4GXLA 2PTMA 2QQMA 2D44A 2B8MA 3E6DA 3AXDA 4BE3A 1DCSA 2XL9A 4LHLA 2W1QA 1EAH1 4WV8A 1W03A 4QB6A 4QQ2A 2VMCA 4NR1A 2Y6KA 1X82A 1YCIA
chains in the Genus database with same CATH topology
5L9BA 2FCUA 3KT7A 3ITQA 4Y5TA 2HBUA 3PL0A 5HV4A 4NHYA 2Y34A 4JZRA 5IATA 3W21A 2RDQA 5LA9A 4J25A 4XCAA 5A3UA 3HQRA 2RG4A 3OBZA 3OUIA 4NHKA 4ZONA 3KT4A 4Q5OA 5LASA 4NMIA 5EP9A 3NNLA 5DAWA 4BQXA 4BQYA 5DAQA 5LBFA 3OUJA 2RDNA 5C5TA 5HV0A 2OPWA 2JIGA 2G1MA 5LB6A 4XCBA 5ERLA 5EPAA 3DKQA 3MGUA 5LATA 4XC9A 3KT1A 2RDRA 4NHMA 2A1XA 2FCTA 5LBBA 3GJAA 5M0TA 5LBEA 4Y5SA 3NNMA 3HQUA 5EQUA 5L9RA 4MHUA 4UWDA 2FCVA 4ZPIA 4NAOA 3NNJA 3W20A 4XAAA 5LBCA 4IW3A 3NNFA 4KBZA 4BQWA 2HBTA 2G19A 4NHLA 4XABA 5DAPA 5L9VA 5DAXA 4NHXA 3GZEA 2Y33A 5DAVA 3EMRA 5IAVA 5C5UA 2RDSA 2V4AA 4XACA 3OUHA 2JIJA 4MHRA 3GJBA 3BVCA 5IAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L9B A;  2FCU A;  3KT7 A;  3ITQ A;  4Y5T A;  2HBU A;  3PL0 A;  5HV4 A;  4NHY A;  2Y34 A;  4JZR A;  5IAT A;  3W21 A;  2RDQ A;  5LA9 A;  4J25 A;  4XCA A;  5A3U A;  3HQR A;  2RG4 A;  3OBZ A;  3OUI A;  4NHK A;  4ZON A;  3KT4 A;  4Q5O A;  5LAS A;  4NMI A;  5EP9 A;  3NNL A;  5DAW A;  4BQX A;  4BQY A;  5DAQ A;  5LBF A;  3OUJ A;  2RDN A;  5C5T A;  5HV0 A;  2OPW A;  2JIG A;  2G1M A;  5LB6 A;  4XCB A;  5ERL A;  5EPA A;  3DKQ A;  3MGU A;  5LAT A;  4XC9 A;  3KT1 A;  2RDR A;  4NHM A;  2A1X A;  2FCT A;  5LBB A;  3GJA A;  5M0T A;  5LBE A;  4Y5S A;  3NNM A;  3HQU A;  5EQU A;  5L9R A;  4MHU A;  4UWD A;  2FCV A;  4ZPI A;  4NAO A;  3NNJ A;  3W20 A;  4XAA A;  5LBC A;  4IW3 A;  3NNF A;  4KBZ A;  4BQW A;  2HBT A;  2G19 A;  4NHL A;  4XAB A;  5DAP A;  5L9V A;  5DAX A;  4NHX A;  3GZE A;  2Y33 A;  5DAV A;  3EMR A;  5IAV A;  5C5U A;  2RDS A;  2V4A A;  4XAC A;  3OUH A;  2JIJ A;  4MHR A;  3GJB A;  3BVC A;  5IAX A; 
#chains in the Genus database with same CATH topology
 1Y4W A;  2X5I C;  5T5O A;  2YV8 A;  5JLV A;  4AFM A;  4N9H A;  3AVS A;  3VBH C;  2VUJ A;  3BOD A;  3H42 B;  4Y5T A;  1GZC A;  3AX4 A;  3ES4 A;  5F2W A;  1PO1 3;  1RJ8 A;  1QOT A;  2ZAC A;  2Q1Z B;  1AR7 3;  3ZXG A;  1VAM A;  5A3W A;  5FP4 A;  1JOD A;  3SNM A;  5T50 A;  1UY3 A;  4LBN A;  4LLO A;  4XUN A;  3N9L A;  1K5M A;  4LMF A;  4YGE A;  5T5L A;  3H8U A;  2TBV A;  1RMU 3;  2WBK A;  1YQ2 A;  2QDR A;  4FOQ A;  4ARX A;  2HWD 3;  1G7Y A;  1US2 A;  1B09 A;  1S0C A;  2Y6J A;  3V0B A;  2OYZ A;  2ZGU A;  4EV0 A;  4LA2 A;  4OI4 A;  4UYB A;  3VBS C;  4AFD A;  2WFF 3;  2XUM A;  2YBP A;  1AUY A;  1C3H A;  1JN2 P;  1J3Q A;  1U5I A;  2O0O A;  4UFI A;  5E16 A;  5CBL A;  3TN9 2;  1UKG A;  2Q1M A;  4Q29 A;  2W1W A;  4XE9 A;  2WZR 2;  4PQQ A;  4BQX A;  4CDW A;  4DUV A;  1LOF C;  2RJ2 A;  1DQ4 A;  4QAW A;  2P6C A;  2DVF A;  3AP4 A;  3QAC A;  4XZP A;  5A32 B;  3D4K A;  1MZF A;  1OF3 A;  1V9U 2;  3CMG A;  4W8J A;  4CDU B;  5HV0 A;  3OD0 A;  2Q8D A;  3FMG A;  1EV1 2;  5GZD A;  4ZU7 A;  5FZF A;  1DFQ A;  4NIH A;  2CAU A;  2RR1 3;  4PIZ A;  4PIX A;  1ENR A;  4D6S A;  2A3X A;  3KT1 A;  5FYC A;  1U0A A;  3ZLI A;  5I8Y A;  2PHU A;  4LO5 B;  4LHK A;  4LUK A;  4XTP A;  2QBX A;  5HCB A;  2WQZ C;  3O7O A;  2JDN A;  1RUF 3;  3C7E A;  3N35 A;  1ZM1 A;  2BOJ A;  2VW0 A;  5IVF A;  3I2H A;  2Y6H A;  5BXX A;  2KM2 A;  4QPW A;  5FZ7 A;  1WCS A;  4B8E A;  4I09 A;  4MGY E;  1HJF A;  1ODN A;  5A6Y A;  1VRH 1;  5A33 A;  2CTV A;  2IXK A;  5HXV A;  3LDR A;  2QQI A;  4GH4 C;  4EWE A;  4AVC A;  1M4W A;  4HPK A;  4AR2 A;  1RUG 3;  2RJL A;  2X10 A;  3NW4 A;  4HON A;  4EYU A;  3NVC A;  4JKL A;  2WKK A;  1NCQ A;  4FPL A;  4XPV A;  4BQW A;  3SIS A;  2NLR A;  4QU1 A;  4IGQ A;  3BCW A;  1QQP 2;  2GC2 A;  2PYT A;  3DPR A;  1O7F A;  3PTY A;  4H2A A;  4IER A;  4JGY A;  4AG4 A;  4D7T A;  5FMB A;  3D82 A;  4F8A A;  3B7M A;  5F5C A;  1BVP 1;  2BTV C;  2QKD A;  3BPS A;  1BEV 3;  2GZW A;  1PZ7 A;  3EMR A;  4CCM A;  4CU9 A;  1O5U A;  2J42 A;  5IAV A;  2YBS A;  5KC6 A;  1BBT 3;  3NV1 A;  1OA3 A;  4FOV A;  4R4X A;  1IOA A;  3DEC A;  4FPY A;  3WQ1 A;  2W3J A;  2R07 3;  1W99 A;  4MSV A;  3POS A;  2JG9 B;  3DEM A;  3MUY 1;  4NRP A;  1Q56 A;  4XAC A;  2CYF A;  2Z79 A;  4YW1 A;  2R06 3;  2MEV 1;  5CZK A;  2WZP P;  3DUI A;  3MF6 A;  2Q8C A;  3AKR A;  1P8J A;  4AQS A;  2XLA A;  3O5S A;  1OD5 A;  1PO2 2;  1QJZ A;  2E26 A;  5I91 A;  2PQS A;  1WME A;  1HXS 3;  5FY4 A;  1H2M A;  1HB4 A;  3VDD C;  3ZFE C;  4GAZ A;  4D6Q A;  4QKB A;  3KV4 A;  2JDA A;  4RN5 A;  3FHA A;  1LHV A;  4S2F A;  4LHS A;  5DN2 A;  1BCX A;  4ARY A;  4N53 C;  2BW8 A;  4UFL A;  4YYO A;  3ZYI B;  1SLA A;  4XXP A;  1GQH A;  2ZGS A;  2IC1 A;  2VZP A;  4DQA A;  3USS A;  1R09 2;  4AEJ A;  4CP2 A;  4JVA A;  1NY7 1;  2W68 A;  2XJQ A;  5FYB A;  1CGP A;  4CUA A;  4ZU5 A;  1RHI 2;  2GC3 A;  2ID4 A;  3NAP C;  5FR3 A;  5IWF A;  4CEY C;  1HW5 A;  4N9I A;  4CUG A;  3PDQ A;  4YVW A;  2J22 A;  3D0S A;  3ZYB A;  1EY2 A;  1ZZB A;  3E5U A;  5L19 A;  5AVA A;  5CG8 A;  1PK6 C;  4L8Q A;  4TN7 A;  1LU2 A;  2RM2 3;  4P08 A;  4E4S A;  5FO9 B;  2XPJ A;  1G9D A;  3ZN6 A;  1L7R A;  4UT5 A;  5GJ6 A;  1XXN A;  4RS5 C;  1YXW A;  2RV9 A;  4COY A;  1U5X A;  2XHN A;  1C8M 2;  1CAU A;  2D5F A;  4Q5O A;  3A23 A;  4XTM A;  3VBO B;  2IVJ A;  4FP3 A;  1TMF 2;  1CAX A;  2XJS A;  2C26 A;  4PDW A;  3VKL A;  3O1T A;  1NUK A;  1OLM A;  2UY9 A;  4OYU A;  1H9W A;  3POJ A;  1DZR A;  4BQY A;  5JOZ A;  1X9T A;  1S0F A;  2JD9 A;  3LB9 A;  3NKT A;  5CKQ A;  5FO7 B;  2Q8O A;  3CJI C;  1Y9G A;  1GSL A;  1W90 A;  4TLF A;  3N9N A;  3ZN5 A;  4BYY A;  3C7F A;  1AR9 2;  1AVB A;  1I5P A;  1SLT A;  2D40 A;  1EAH 3;  3CU7 A;  3ON7 A;  3BU0 A;  4BU2 A;  3PUI A;  2B7Y A;  2GSY A;  2ARE A;  4IL7 A;  4LBM A;  4XFB A;  2F17 A;  3HBZ A;  4K3U A;  3T2P A;  3U10 A;  4B7E A;  5KHI A;  3IBM A;  4WVW A;  2BPA 2;  4OQ8 A;  4NHM A;  1AR6 3;  2FCT A;  4KMQ A;  5CKN A;  5FZM A;  3GJA A;  3IDA A;  4XJA A;  1K42 A;  2EAA A;  4RGA A;  2PEL A;  1LHN A;  5DZF A;  1KFU L;  1QJU 2;  2D3S A;  1MEC 2;  3TN9 1;  3I3B A;  3T2O A;  5LEK A;  1X8M A;  4AK3 A;  2WZR 1;  3LCP A;  1FAY A;  2AGS A;  4QPG A;  3N7M A;  1IGO A;  2FCV A;  1HRV 2;  3U78 A;  1CJD A;  1QIQ A;  3KQR A;  1Q8P A;  4OI0 A;  1XYN A;  1PGW 2;  2A73 B;  2DUP A;  2DV9 A;  2RS1 2;  3R0R A;  4RQP A;  1AL0 G;  1V9U 1;  1ZBE 1;  5C3O A;  1EV1 1;  3CKH A;  4BCU A;  2PFW A;  3DGT A;  3PVO A;  2QDN A;  1Q43 A;  5GLZ A;  4FSJ A;  4GJY A;  2FHR A;  3D5O A;  4XBL A;  4DZG A;  3DL3 A;  5ACA 2;  4A41 A;  4XAE A;  3VKN A;  5J37 A;  4I3G A;  5I8T A;  4BPZ A;  3WG2 A;  3BTX A;  4XQW A;  3GZE A;  1IHM A;  1QKQ A;  3DV8 A;  1UU6 A;  4MGK E;  1MR5 A;  3ENR A;  3WHT A;  2GN7 A;  3MW4 A;  3K4Z A;  1POQ A;  4Y22 A;  1WLW A;  3N7K A;  1W2T A;  4UI9 L;  1QHD A;  1JOP A;  1NX9 A;  2XQR A;  4ORF A;  4RGG A;  2YFU A;  1F9K A;  4IEO A;  5CVR A;  3T1M A;  4JQR A;  4Y1U A;  2AEY A;  4MZU A;  3WNP A;  4G4F A;  1AR8 2;  1J58 A;  3AYA A;  4MV2 A;  1OA4 A;  1PMI A;  4MX3 A;  5CYY A;  5FYY A;  3KHC A;  1DDL A;  3I4I A;  3RWK X;  1V6I A;  1HV0 A;  5FZ6 A;  4DFS A;  4BWO A;  4G9S B;  1HX6 A;  1JZ3 A;  1DYP A;  1VBC 2;  2O8O A;  2GND A;  3AFK A;  3ZFG A;  3S5A A;  4QDQ A;  3O1U A;  1JYC A;  5FZC A;  3KM5 A;  1CPN A;  1S0D A;  1LOB A;  2VMI A;  2W08 A;  3LA3 A;  1QQP 1;  3AYD A;  3KVA A;  1LES A;  4IDZ A;  1Y9Q A;  1C28 A;  2ET7 A;  1VRH 3;  1W6Q B;  3JCI A;  4Q26 A;  2ERF A;  2N7G A;  4HLT A;  3RZM A;  1CJP A;  1Z7S 2;  3DXU A;  4LKE A;  5J7M A;  2CGN A;  1EUT A;  1YC6 1;  2MHF A;  5FQ0 A;  1CAV B;  4JHT A;  3ASI A;  5FZ4 A;  4B4P A;  2WNO A;  4WZF A;  4EN8 B;  3AMM A;  3VDC A;  1PMJ X;  1UU4 A;  5FY5 A;  4S2D A;  4PF1 A;  5F5A A;  5FLH A;  2UYA A;  4JDO A;  1L3J A;  3OPW A;  2OQ7 A;  2Y8K A;  4NIA A;  2XKO A;  2ZHL A;  3C3V A;  4QXC A;  2DU1 A;  3WG4 A;  4AQ6 A;  2OUH A;  2ZML A;  5LAS A;  3U07 A;  5AC9 3;  3WDX A;  1OQE A;  2UWA A;  3O12 A;  1UX7 A;  1W05 A;  5FZG A;  3BIE A;  5BNO A;  2DU0 A;  5FZO A;  1QXP A;  3O1P A;  2LM3 A;  2PHT A;  5GLT A;  2EAK A;  5C9A A;  2IXI A;  4GD4 A;  2BNN A;  4Q4Y 2;  1W8T A;  1AJO A;  2YG0 A;  4KGQ A;  1DLL A;  4W50 A;  1A34 A;  1LOG A;  4K8R B;  2I45 A;  5A7P A;  4CEW C;  5JR2 A;  2A3W A;  3SEP A;  5FXV A;  1OFN A;  1RHI 1;  4QGL A;  5LAT A;  1O8P A;  3KV5 A;  1JYN A;  5C4W B;  4HN0 A;  4XIO A;  2PAM A;  2XWJ B;  3FHI B;  4RR3 B;  3PNA A;  3HEI A;  3OSD A;  3WIN E;  5I0T A;  5FPZ A;  3GBW A;  1U12 A;  1C8M 1;  4LOR A;  3HQU A;  3ACH A;  4IV1 A;  5JSO A;  1S1A A;  1OF4 A;  1UIJ A;  4XUP A;  2HEV F;  3SMH A;  2VMD A;  4RGK A;  5EJ3 A;  3ORJ A;  4DEQ A;  5JWP A;  4QXK A;  3WEZ A;  5C8C B;  1XNA A;  3IKW A;  3OGG A;  1Q3E A;  3VBU A;  4HKO A;  1XU2 A;  5C7G A;  3RI9 A;  5FBJ A;  3A0K A;  1AR9 1;  1OLM E;  2CAV A;  4KH9 A;  4IW3 A;  4QHZ A;  3NNF A;  1W39 A;  2B5H A;  4ISR A;  5DAB A;  3MPP G;  1LGC A;  1D4M 2;  4P5Y A;  3LDK A;  3KQ4 B;  1IG3 A;  3SCF A;  4P9J A;  3SKJ E;  2WLQ A;  1K5M C;  2X09 A;  1MS3 A;  4GMP 1;  4TLG A;  2DUQ A;  2OS2 A;  5JOY A;  4O61 A;  2LW8 A;  2X5I B;  5H9P A;  2CDO A;  4LUL A;  2D7F A;  3X29 B;  4HFS A;  5K7P A;  3DYP A;  3VBH B;  2BER A;  4KL1 A;  2DBN A;  4YVS A;  1JUH A;  1QJU 1;  2VM9 A;  1ULO A;  3C7G A;  2LRO A;  1REF A;  5A3T A;  4YPJ A;  3L2H A;  4KU7 A;  3K75 B;  2YFZ A;  1H6X A;  4YZ2 A;  1IS5 A;  1HQN A;  3K3O A;  1KS4 A;  5FYH A;  5CKM A;  2C4X A;  2VG9 A;  4MHR A;  4CDW C;  1HRV 1;  5I0R A;  1G9B A;  5A1A A;  1AHS A;  1MS0 A;  3U11 A;  3VDA A;  2RS1 1;  1K5J A;  2PLV 2;  4NPR A;  1PVX A;  3UL2 A;  1ENQ A;  5L9B A;  2FCU A;  3FN9 A;  1O4Y A;  2FMD A;  2VBB A;  3KT7 A;  3MV1 1;  5CNA A;  1FI2 A;  1DZQ A;  2C1F A;  2A3Y A;  4NRQ A;  1QNW A;  3CJX A;  1COV 1;  3ZSM A;  1B35 A;  1V0A A;  3TN9 3;  3OGV A;  1WMD A;  1YFU A;  3VBS B;  2VZQ A;  3AKQ A;  3ATG A;  2WZR 3;  2VU9 A;  4A2U A;  4QKN A;  1WA6 X;  3H50 A;  1EUU A;  2R30 A;  3M3E A;  2ZJC A;  3IPV A;  5LRS A;  1MS5 A;  3ETQ A;  4PBO A;  5LA9 A;  5IVB A;  1AZD A;  2AH2 A;  1WW5 A;  1VBD 2;  3EHK A;  2VVF A;  1V9U 3;  3ELN A;  2MNG A;  3VBF A;  2JE8 A;  1XJA A;  4FFH A;  1EV1 3;  3ECQ A;  4QPI A;  3EO6 A;  1QJE A;  3ZSK A;  3NST A;  4Q4W 2;  1OC1 A;  1TME 2;  4IV3 C;  4K21 A;  1AR8 1;  2Z2S B;  3U75 A;  2XXZ A;  5FZL A;  3FFZ A;  2TUN A;  1ULE A;  1XNC A;  5LK5 A;  4FTS A;  3SCH A;  4AHW A;  5CB7 A;  2AYH A;  1VBC 1;  4Y1Z A;  3FUO A;  2V72 A;  5D8A C;  3TEW A;  5CFC A;  1NCQ C;  3ZDV A;  5BNP A;  4FOW A;  1ZZ7 A;  4WM8 A;  1H8V A;  3WQB A;  1NYW A;  3OEA A;  4LIT A;  2OA2 A;  2WNV A;  3KF3 A;  4YAR A;  1UOG A;  3DPR C;  4JGY C;  3ZYJ B;  2OXB A;  3KS7 A;  2WT1 A;  3N3H A;  1Z7S 1;  4UW6 A;  4OI2 A;  3FWE A;  2I74 A;  4Y5Z 0;  3VZO A;  1H8T A;  3LOI A;  4M4P A;  3OJB A;  2RDR A;  4Q8K A;  2DDU A;  1R1Z A;  2ZZJ A;  4GH4 B;  4SBV A;  5GZE A;  1CN1 A;  5F37 A;  4K8F A;  1XPW A;  4YW4 A;  4FAH A;  1QQP 3;  3WDY A;  3G6J B;  4Y5S A;  1HB3 A;  4TZD A;  1NOV A;  2P4E A;  1XNK A;  5FKB A;  3BTA A;  4A3Z A;  4XF1 A;  2D6P A;  1RUC 2;  3HD8 B;  4PQ9 A;  1UY2 A;  1FPN 1;  4W6X A;  5HPO A;  4UW3 A;  4EN6 B;  1VJ2 A;  5F2S A;  1YEW A;  4O9E A;  3TBD A;  4Q4Y 1;  5FYS A;  2XGX A;  2VE1 A;  4HSL A;  2DVG A;  4XJZ A;  1W06 A;  3F2Z A;  4UAP A;  1UN1 A;  3CEW A;  3RNS A;  4JQT A;  2E33 A;  4ZS3 A;  2VNO A;  1FNY A;  2WZ8 A;  2CGP A;  1PO2 3;  3AZY A;  3ILR A;  5FUP A;  1ONA A;  3GCX A;  1APN A;  1QH7 A;  1WMX A;  3T0B A;  2DUR A;  3WX5 A;  5FP3 A;  4TYS A;  5A7N A;  2JEC A;  1VBA 2;  2JKX A;  3J7L A;  3VDD B;  2ENR A;  4CYD A;  1ENX A;  3ZFE B;  5JAX A;  3GBF A;  4LIV A;  1MQT A;  4FOY A;  3S5Q A;  5A3L A;  1R09 3;  4N53 B;  4JX0 A;  1OVP A;  3LEI A;  4IE7 A;  5GZC A;  1OOP A;  4YW3 A;  5FPX A;  2VZT A;  1RHI 3;  5A7W B;  3GJB A;  3FFQ A;  3JXS A;  3AFG A;  3A21 A;  4DXS A;  3RMY A;  2HWD 1;  3B01 A;  1SG3 A;  2BGP A;  4CRQ A;  3H8R A;  3VHR A;  1NA1 A;  3NAP B;  2O8Q A;  2P34 A;  3GYD A;  2VNR A;  5F32 A;  3TAY A;  3WW2 A;  4AI3 A;  1D4M 1;  4CEY B;  2WFF 1;  1GP6 A;  5FRE A;  4EJR A;  2VUC A;  4RSU A;  4H55 A;  3N9O A;  4EZ4 A;  3OGS A;  3ZYR A;  1H0B A;  1C8M 3;  1PK6 B;  2NP0 A;  4A7Z A;  4C1W A;  4Y1Y A;  3VKF C;  2EID A;  4KNC A;  5BV6 A;  4RS5 B;  1ZNP A;  1SPP B;  3MDP A;  2ORX A;  4K6B A;  3OCP A;  1CZV A;  3OY8 A;  2W1U A;  1GWK A;  3LAG A;  1GFF 2;  2YC0 A;  3WP4 A;  1AR9 3;  3GAL A;  3MIE A;  3I2I A;  1T6G C;  4YZ5 A;  3HQR A;  4HOO A;  3CJI B;  1CWP A;  4C0B A;  1YQ6 A;  1UXZ A;  2RS3 2;  2VY0 A;  4QPG C;  3GZT B;  4GMP 3;  4ZON A;  1S4C A;  2JJ6 A;  1BJQ A;  2PLV 1;  2WT2 A;  4D6R A;  3POW A;  1K45 A;  2VTX J;  4LE3 A;  3AK0 A;  1V6N A;  1AJK A;  2D6M A;  3BYW A;  2CGO A;  1YI7 A;  4RQP C;  1G86 A;  1OLR A;  3PME A;  4UW4 A;  1BVV A;  2YC2 A;  5C6C A;  1N47 A;  1RGS A;  5FP7 A;  3LD8 A;  1JYT A;  1QJU 3;  1WA4 A;  1MEC 3;  1WCK A;  1XE0 A;  3HT2 A;  4JRL A;  3QCW A;  2VO5 A;  1ZZ9 A;  2W0X A;  3KSC A;  2VEC A;  3RYP A;  1NG0 A;  1HRV 3;  2C9K A;  3PUA A;  3LOB A;  1XSQ A;  1OA2 A;  1UX6 A;  1A6C A;  1QU0 A;  1XE8 A;  1V6K A;  2RS1 3;  4LO4 B;  4P9I A;  5F9T A;  2ATF A;  4FPK A;  4XDP A;  2ETE A;  4BQ5 A;  3N9M A;  3VB9 A;  4K1Z A;  5DMY A;  1RUE 2;  3Q8E A;  4Q4W 1;  4LO6 B;  1TME 1;  3ZXA C;  3T08 A;  2P3K A;  2R7E B;  5FY0 A;  2YC4 A;  1K12 A;  1BZW A;  1IQD C;  1W28 A;  3J7M A;  1RXG A;  3MIG A;  2GU9 A;  4NE9 A;  4FTB A;  2HYK A;  2VCC A;  3KD4 A;  1XYO A;  3BAL A;  4COW A;  5A3P A;  2YPD A;  4NID A;  1S0I A;  5A3O A;  4QXH A;  2JE7 A;  1KXG A;  4GB3 2;  4WVV A;  1W2U A;  3NWK A;  4XJ8 A;  4B7K A;  3RZK A;  3CL1 A;  4QM8 A;  1BBT 1;  2XR4 A;  1ZRD A;  1SEF A;  2VW2 A;  2JXA A;  5E6H A;  1GAN A;  3T30 A;  1DQ1 A;  4YZ3 A;  1BK1 A;  3LE0 A;  4KBZ A;  3OB8 A;  5F5Q A;  1GQP A;  1AR8 3;  2LS6 A;  3ABZ A;  1E5H A;  3NL1 A;  2HBT A;  1SFN A;  4XFA A;  4YLZ A;  5JI9 A;  2X8K A;  1QGL A;  1XNB A;  1VBC 3;  2K9Z A;  4YGD A;  2ZEX A;  1DYO A;  2P3Y A;  3OTF A;  2A70 A;  2BDR A;  4XFH A;  5KXB A;  2ZPX A;  3URF A;  5EWS A;  3FX3 A;  4L0P A;  5CIR A;  2ZGT A;  1SBD A;  4V2W A;  4A3X A;  2HJI A;  4DOU A;  3VGI A;  2J1T A;  4Q2F A;  2PHR A;  1Z7S 3;  4XIL A;  3LSD A;  5EFU A;  2WIN B;  1I1E A;  4ERO A;  3T2T A;  2W46 A;  3H7Y A;  4EQV A;  1DZT A;  4HVQ A;  4P9X A;  5AFE A;  3VBR A;  1YO8 A;  1X9P A;  4AI1 A;  2EXJ A;  2IFW A;  5LK7 B;  2YBK A;  5C9A C;  2WSV A;  5JI7 A;  1QOS A;  1GR3 A;  3I2J A;  4AVS A;  2ZX2 A;  3ZXJ A;  1PGL 2;  3WP3 A;  5A6Z A;  4LK6 A;  1ZX5 A;  3WNM A;  4FXG B;  2XG3 A;  4ONU A;  1OUX A;  4FI9 A;  1DHK B;  5HV4 A;  4Y20 A;  2YYO A;  2WL1 A;  3HR9 A;  3ILN A;  5FZK A;  2TEP A;  4QMA A;  4LNV A;  3DYO A;  1HJG A;  1U5Y A;  4LR4 A;  4QDR A;  1RUD 2;  3LWC A;  4KWL A;  1VBA 1;  2BFU L;  4HET A;  3NV4 A;  2B39 A;  5C8W A;  3DXT A;  3POG A;  4Q4Y 3;  4LXL A;  3O1R A;  3TWI A;  3F95 A;  1SBE A;  2D98 A;  3J9S A;  1O91 A;  3USU B;  3WG1 A;  3JQX A;  2OVU A;  1W0N A;  3GZU C;  4IV1 C;  4IEP A;  4Q4V 2;  5I0U A;  3WT3 A;  1A8D A;  2Q5T A;  2H0B A;  4QWN A;  2ZCW A;  3FUQ A;  1W2O A;  5FUI A;  1G8W A;  1VRB A;  4NRM A;  2H0V A;  3VBU C;  3OF1 A;  4CEW B;  2ZS6 B;  2O14 A;  3FC0 A;  4GKX A;  1AR6 1;  3IWZ A;  3UGF A;  1GZW A;  5EP9 A;  1OH3 A;  1UZZ A;  1KEX A;  1JS9 A;  4LO7 A;  1T6B X;  5FMC A;  3PMS A;  3CF6 E;  4M3C F;  5I0D A;  3BIW E;  4HAN A;  1W0O A;  2JX9 A;  1DG6 A;  4GJZ A;  4U36 A;  4DPN A;  2Q30 A;  1UWW A;  2VBP A;  4I02 A;  2W5F A;  4MOA A;  4PLM A;  3RJ2 X;  3SXW A;  1MVE A;  4AGR A;  4Z8B A;  2TNF A;  4IQP A;  5FJH A;  5LB6 A;  4CCK A;  2J1V A;  3I59 A;  4MGS A;  2JDZ A;  4OUS A;  1N1Y A;  1E5I A;  5IVY A;  2W52 A;  2ZBJ A;  2YGL A;  4FXK B;  2W47 A;  3PUQ A;  4YVS C;  4BHP A;  4BQ1 A;  4AFC A;  4DUW A;  3EBR A;  4JTO A;  4AOC A;  1D4M 3;  3EQE A;  5FP9 A;  2LAL A;  2RS3 1;  4Q0P A;  2IUW A;  4JKM A;  2YUE A;  3N4M A;  2ZGM A;  3B02 A;  2EXI A;  3MHZ A;  5FMO S;  3ZPY A;  1PIV 2;  4LPL A;  1K5M B;  2ZGQ A;  1ODM A;  2J1U A;  3H1M A;  3SHR A;  5FCC A;  3POB A;  4BXS V;  1IPS A;  2AZ5 A;  4K40 A;  4XXA A;  1DIW A;  1LEN A;  1Q8O A;  1CX1 A;  4DXT A;  2VUL A;  3V0B B;  1KDM A;  3BI3 A;  1B35 C;  1RUI 2;  2WWU A;  3ACF A;  3PHM A;  4IEX A;  5A32 A;  1LTE A;  2X53 S;  5IVJ A;  2GNM A;  3A0N A;  4LBQ D;  2ZAA A;  4ASK A;  4Y33 A;  1Y9M A;  4QM9 A;  2PLV 3;  1HKD A;  4LK7 A;  3AZV A;  4CPB D;  4B4Q A;  1UMI A;  1KJL A;  4XMA A;  3TB0 A;  4CDW B;  4XAB A;  2OQ6 A;  4KGG A;  3T2Q A;  1JZ8 A;  3VBF C;  1GU3 A;  2X29 A;  1RUE 1;  1WMF A;  3GGL A;  2GMP A;  5A3M A;  2Y33 A;  2VOT A;  5FY8 A;  4COZ A;  1J3P A;  1WLT A;  4LQR A;  1DQ2 A;  1W8H A;  4GWJ A;  3N9Q A;  2VR4 A;  2GME A;  3WF1 A;  2NYY A;  1RJ7 A;  2Z69 A;  4GB3 1;  1KIT A;  4Q4X 2;  4A4A A;  2DFC A;  1VBD 3;  1LCL A;  1XB9 A;  3KV6 A;  1ND3 A;  3IIA A;  2WNV C;  4Q4W 3;  1TME 3;  3K3N A;  4O65 A;  3U4X A;  3HNB M;  1V00 A;  4Y26 A;  3GCW A;  3LEK A;  5GLW A;  5T52 A;  1OKQ A;  3TYJ A;  4GMP 0;  2VVE A;  1AL2 2;  3PLQ A;  1UPI A;  3AYC A;  3BB6 A;  1QF3 A;  1H8T C;  1WD4 A;  4IV3 B;  5AC9 1;  3L2Y A;  4AED C;  3HPN A;  1RL3 A;  4YFZ A;  5A33 B;  1JYW A;  1W0P A;  3FE5 A;  2KA3 A;  4GZ9 A;  3DN7 A;  2FZ2 A;  3WUD A;  5IAT A;  4AI9 A;  1RUO A;  3VD4 A;  1GNY A;  2G9F A;  2VCB A;  3C2U A;  4UF0 A;  4W65 A;  4XYX A;  3UGG A;  4BZ4 A;  5IFP A;  5D8A B;  2AUY A;  2Y64 A;  4GIQ A;  4NIG A;  3FBM A;  1QDO A;  4AAP A;  1AXK A;  1NCQ B;  3WCR A;  5LA0 A;  3AMP A;  1EPW A;  3JU9 A;  1TVG A;  4LBO A;  4XQ4 A;  3UJO A;  2JG9 A;  4MH0 E;  4WM7 A;  5FZA A;  3ZXE A;  4JGY B;  3DPR B;  4Y3O A;  5JVV A;  1BHG A;  5FLI A;  4YM1 A;  1AX1 A;  4Z2A A;  4JCK A;  3J8F 1;  5IUQ A;  1ZVF A;  1ZZ6 A;  2CDP A;  1ZRC A;  2J1E A;  4FPJ A;  5DAW A;  3O0X A;  4CDX C;  1PGL 1;  1OBN A;  5IJR A;  2A5Z A;  1RIN A;  1JHN A;  2R04 2;  3LPG A;  4LKD A;  2VL4 A;  4BOW A;  2R1B A;  1YFY A;  2OW4 A;  4A6O A;  5CA6 A;  5JZG A;  1SBF A;  2E53 A;  5DG1 A;  5C5T A;  2Y26 A;  1Y3T A;  3V0A B;  5ANQ A;  2G1M A;  2XBO 2;  2CV6 A;  2XJT A;  2XWB B;  4X8N A;  5FK7 A;  1ZYB A;  1NLS A;  3HOB A;  4LBQ B;  1GMM A;  3CZU A;  1ZRF A;  3RQ0 A;  1UAI A;  3M4F A;  5CFD C;  2ZX3 A;  4DS0 A;  2A1X A;  5C3R A;  1F35 A;  1OOP C;  2P5B A;  4ZZ5 A;  1GZ9 A;  4B29 A;  5KC5 A;  1FOD 2;  2ZX1 A;  3WCS A;  1H2K A;  2P2K A;  3POF A;  3VBO A;  4FO9 A;  1LEC A;  1NA1 C;  1VBA 3;  1PVC 2;  2BNO A;  2VQ0 A;  4WVZ A;  3NJY A;  4AFB A;  4YW5 A;  4DRV A;  2PHW A;  1YQ8 A;  2DCT A;  1UYX A;  5T5J A;  3B94 A;  1LU1 A;  1WKY A;  1HB2 A;  3HJR A;  1VE0 A;  4NPL A;  3ZN6 B;  1JI6 A;  2DFB A;  1QXJ A;  2CHH A;  1AYN 2;  5GLU A;  1CAU B;  3AJY A;  4RFT 0;  4S2G A;  5JXJ A;  3IN9 A;  3KF5 A;  3VN4 A;  2VOV A;  3LFM A;  4HZF A;  1LOD A;  5L9V A;  3AL6 A;  1MAC A;  2DVD A;  5FPV A;  2W1S A;  3FBY A;  2HWF 2;  2YRO A;  3MEP A;  2YHJ A;  3ILF A;  3ACI A;  3AKT A;  2ZGO A;  5CAD A;  2BOI A;  1VIW B;  2PAE A;  3VZK A;  1N3P A;  1PIV 1;  1C1L A;  2ZGK A;  4K9S A;  3RSJ A;  1UYY A;  3NKG A;  3WZ1 A;  3O1M A;  1QOO A;  4QPY A;  4NWV A;  2VD7 A;  5J3U A;  4K7J A;  4IUG A;  4FQ4 A;  4BMB A;  2ZTN A;  1GWM A;  4PCR A;  5EJZ B;  4XET A;  5A7S A;  4DUX A;  3O1O A;  4LUM A;  1F31 A;  3SEE A;  4OHW A;  1RUH 2;  3NRU A;  4AE2 A;  3KCY A;  3OEB A;  2A6X A;  1VB2 A;  3GNE A;  3KCC A;  4NWW A;  5FYT A;  4RFR B;  1AXZ A;  2RS3 3;  1QWR A;  1TQ5 A;  3JB4 C;  2J1S A;  2R6Q A;  4BA6 A;  2B42 B;  4HK8 A;  2G9Z A;  2JEM A;  2Q4S A;  1PX4 A;  4LJH A;  1FYU A;  1UYP A;  4QPG B;  3PUH A;  5FK8 A;  2WO1 A;  3A7Q A;  4AVA A;  2E31 A;  2HWC 2;  4I0A A;  5A7Q A;  5IK8 A;  1SHW B;  1UOF A;  1OI6 A;  4RQP B;  2SLI A;  5J09 A;  1Y7B A;  3POE A;  2RDQ A;  3Q8F A;  3W59 A;  2WO7 A;  1UF2 C;  1RYY A;  4DB5 A;  1US3 A;  4XF0 A;  4CTE A;  5FZ9 A;  5FYI A;  5SV5 A;  1W6O A;  1S0B A;  4J1X A;  4AEK A;  1LAJ A;  1KJR A;  2HEY F;  3ZFF C;  2FDK A;  4QX0 A;  4NII A;  3WW4 A;  1F2N A;  3OBZ A;  2V4V A;  5KHK A;  4YGC A;  5FXZ A;  1LHU A;  1JUI A;  4ET7 A;  3AZX A;  2E6V A;  1RUE 3;  2VC9 A;  4J1W A;  4MYE A;  2D3R A;  2BWC A;  4Y22 B;  3NNL A;  1FAT A;  2P37 A;  1AL2 1;  1GOF A;  5FZ1 A;  5DXD A;  1OQ1 A;  2P6H A;  1IS4 A;  1R64 A;  4AI0 A;  1J1T A;  4KWU A;  3T0A A;  3ES1 A;  5IVV A;  1FXZ A;  4GB3 3;  1W6Q A;  2WR9 A;  2HEW F;  3HWJ A;  4LLF A;  4RL7 A;  5L7O A;  5H9R A;  1VAV A;  1ZZC A;  4IE5 A;  1LGN A;  2VGD A;  3CIH A;  4AQT A;  1W6P B;  1CAV A;  1WW6 A;  2NN8 A;  5FXX A;  4Q0Q A;  3THT A;  2E51 A;  2VMF A;  4OUL A;  1BMV 2;  5JPM B;  1L7L A;  5FZD A;  3WNN A;  1UIK A;  1DYK A;  1W6M A;  5HCH A;  1OUR A;  5APA A;  5BNN A;  3FHQ A;  1PO2 1;  5IT6 A;  3KVB A;  4PLN A;  2DUO A;  4XFI A;  3FLT A;  3NO8 A;  4XUR A;  3BPZ A;  3NJV A;  2WRA A;  4QX3 A;  3ZVX A;  5C3Q A;  3WQ7 A;  2W2I A;  2R04 1;  1RB8 G;  3INA A;  4ZPI A;  3BU7 A;  4XF3 A;  3CLP A;  4B1M A;  1R09 1;  1XU1 A;  3AXE A;  1JZ7 A;  3W20 A;  1FMD 2;  2JG8 C;  4Q1P A;  4XJW A;  4EN0 A;  3N9P A;  4AXO A;  1SLI A;  2JEN A;  2VXJ A;  1N1S A;  2XBO 1;  2B46 X;  3P6B A;  4XF4 A;  3M3Q A;  1VBB 2;  3J8F 3;  3TNP B;  2RJK A;  5FZO B;  2WAA A;  2VQT A;  3I8T A;  2EAL A;  3HMY A;  3ST7 A;  2ZGN A;  1UW8 A;  2IXH A;  1CIW A;  4JC1 A;  3H0O A;  3UT0 A;  5C9A B;  5J48 A;  1FOD 1;  4Z92 B;  5FWE A;  3KV9 A;  4L2N A;  5FBZ A;  3VD7 A;  1TMF 1;  3ZIX A;  5C3P A;  1IPK A;  3FZ3 A;  3MBW A;  1RUD 3;  5T5P A;  3VZL A;  3PJY A;  2HWB 2;  2AEZ A;  1PVC 1;  3M70 A;  5I8S A;  4EWD A;  3S0M A;  3W58 A;  2QQO A;  1S2B A;  1V6O A;  2WDB A;  4M00 A;  4XZU G;  5C8C A;  2VZ3 A;  1JBC A;  2ZZQ A;  1D7P M;  1WW7 A;  5F6L B;  2JDY A;  4IGP A;  1ULP A;  4Q4V 3;  5K0U A;  1LGB A;  5KBF A;  3UNP A;  1F4H A;  1RIT A;  1UNB A;  4GWN A;  4IV1 B;  3ZO0 B;  4XUT A;  5LEJ A;  1GQG A;  1RVF 2;  4K20 A;  5FYZ A;  4AHX A;  3D6E A;  3JD7 2;  4YM2 A;  2NMO A;  4NPM A;  4Q27 A;  3R4S A;  3M3O A;  3VBU B;  4ASL A;  2I2S A;  2X5I A;  2ZHK A;  1QJX 2;  2R0F A;  3AMQ A;  1MZE A;  1MEC 1;  5JCT A;  1LED A;  4HVO A;  1LOC A;  5GLV A;  1ZA4 A;  4CU8 A;  2E7A A;  2FDI A;  2VCM A;  3JZV A;  1DBN A;  1I6X A;  1NQJ A;  2WNU A;  3UV9 A;  4LOT A;  3AB0 A;  5FJK A;  4A44 A;  3OD4 A;  1W6N A;  5ABJ A;  2MPF A;  1PGW 1;  3OUI A;  5HBA A;  4J6G A;  4COU A;  4L97 A;  1UY1 A;  4M3C A;  4NUB A;  1RUH 1;  2VZ1 A;  1IS6 A;  3N36 A;  1H1A A;  5FWJ A;  4QXB A;  1O3T A;  4YVS B;  3VD9 A;  4BIF A;  5ACA 1;  4AW7 A;  4B3N A;  1NKG A;  1Z0H A;  4YZ1 A;  1NCR A;  1E5R A;  3D0J A;  1PIV 3;  4U2A A;  2LTN A;  4QGN A;  5DUU A;  1CES A;  3SIT A;  2F4L A;  3WDW A;  3P3N A;  3VBS A;  1J3R A;  4LBL A;  2HWC 1;  3NQH A;  3VV1 A;  3AP5 A;  3IMM A;  2WQ4 A;  2HYX A;  5GM0 A;  3GXU A;  2BVV A;  5FUN A;  5EYX A;  3R4U A;  5J36 A;  3B9I A;  3MV0 1;  1OLQ A;  5EPA A;  3S6P A;  1T2X A;  4BB3 A;  5KHH A;  4ZXK A;  2O1Q A;  1NXM A;  2BBA A;  2ZOE B;  4HT1 T;  5EXO A;  3U37 A;  5FY1 A;  4NOT A;  5BNQ A;  4N43 A;  3H8X A;  1B35 B;  1JOJ A;  3M2M A;  4P02 B;  3RPQ A;  2W95 A;  1H2N A;  2VBD A;  4MGQ A;  1NQD A;  5DUX A;  2Q8E A;  5M0T A;  1W9F A;  3KGL A;  2A6V A;  4OZO A;  1XBF A;  4KI5 M;  5FV3 A;  1ND3 C;  5JMO A;  3LIH A;  1JYI A;  2XVL A;  2ZHM A;  3ZSJ A;  1UKR A;  2GNT A;  3MID A;  5A6X A;  4R8H A;  2GNB A;  2XHK A;  5L9R A;  1GNZ A;  4RHV 2;  4UW5 A;  4IET A;  3VBF B;  2ARB A;  4C90 A;  3SH4 A;  4CXY A;  3NNJ A;  5H9Q A;  4AHZ A;  1OMI A;  4V1P A;  4YG0 A;  4R9A A;  2ZAH A;  4Q4X 3;  4BJ0 A;  2GMM A;  4CDQ A;  2QZ2 A;  3GDB A;  2C5D A;  4D8M A;  3B93 A;  3OGJ A;  4JDM A;  1JHJ A;  4CCL A;  2KD7 A;  3CQO A;  4PBP A;  2VZV A;  4P14 A;  5AVP A;  4DMI A;  3HQX A;  4FTE A;  1SLC A;  3UGH A;  2PMW B;  3MLJ A;  2W9X A;  4GH4 A;  5DAX A;  4ZHN A;  4NHX A;  1LB2 A;  1YUD A;  1JMU B;  3DKW A;  4PIY A;  1AL2 3;  1O4Z A;  4WM7 C;  2WNV B;  1LRH A;  3WF0 A;  2BYV E;  2QQN A;  4YG3 A;  3LKJ A;  4N7U A;  4W6W A;  2QQW A;  3MIC A;  4AZZ A;  4LO8 A;  3RRD A;  1H8T B;  4XMI A;  4WVM A;  4AED B;  4KG0 A;  3OUH A;  3VUO A;  4E2G A;  1R1A 2;  4N90 A;  4FBF A;  2DYC A;  2ZA9 A;  4MXV A;  5GKA C;  1GP5 A;  4JGZ A;  1I5Z A;  2AEN A;  2QVS B;  4FFG A;  4A42 A;  4NJ4 A;  1DQ0 A;  2C6S A;  4FPC A;  3ALQ A;  5JZG C;  3RG0 A;  2YPJ A;  4QU2 A;  3M7A A;  1OKO A;  1DGR A;  2HBU A;  3PL0 A;  1WZX A;  4YVW C;  2BQP A;  4QD2 A;  1PX3 A;  3VZN A;  2Y34 A;  2ZEZ A;  3O14 A;  1WLC A;  3LQC A;  1HN0 A;  5FYU A;  2R04 3;  4QB2 A;  3I3D A;  3RS6 A;  3O1V A;  1MZ5 A;  3DF0 A;  1YHF A;  4CDX B;  4JTN A;  2VME A;  4IXL A;  1SAC A;  3QOP A;  1HB1 A;  4PDW C;  4P9L A;  3VBO C;  3I49 A;  4N53 A;  2XBO 3;  2HWB 1;  2QJV A;  5FPL A;  4OQ9 A;  2QQP A;  1DGL A;  2VXR A;  1PZ9 A;  2BJS A;  2D6L X;  4OHX A;  5A7W A;  1C5I A;  4NHK A;  5FYV A;  3THD A;  5LY1 A;  5H9S A;  2EXK A;  2GP3 A;  3PVN A;  3HNM A;  5DPN A;  1JXN A;  2WS9 2;  1H9P A;  2XH6 A;  4EZH A;  4CEY A;  5GAL A;  1YIF A;  2DVA A;  2OZJ A;  4XW3 A;  3RI8 A;  1FOD 3;  5CFD B;  1W9Y A;  3UYJ A;  2JWP A;  2OPK A;  1TMF 3;  1PK6 A;  1RVF 1;  3NJZ A;  1O59 A;  1OOP B;  3JD7 1;  1YWK A;  1OD3 A;  3OYW A;  1PVC 3;  4ZZ8 A;  4XHX A;  3R05 A;  4EE2 A;  2WJS A;  3V0A A;  1ASJ 2;  1AX0 A;  4Q0S A;  3VHP A;  1UZW A;  3LFI A;  4EWA A;  1TE1 B;  1NA1 B;  3DKQ A;  3MGU A;  5DZE A;  2DCZ A;  4RA0 A;  2DVB A;  1UY4 A;  3L9J T;  3AYE A;  3O0V A;  3VZM A;  5F39 A;  1AYN 3;  1JU3 A;  1OVS A;  1MZ6 A;  1V70 A;  3ETP A;  3RZH A;  3K46 A;  1DF0 A;  2L9L A;  3ZKU A;  3VKM A;  2QQV A;  3MZH A;  3W9A A;  5FPA A;  3OBR A;  2CNA A;  3HT1 A;  4FPF A;  4IES A;  5JOX A;  1GKB A;  4DRR A;  1WD3 A;  2UU8 A;  3B00 A;  2VUA A;  5BYN A;  5EYY A;  2HWF 3;  3MFA A;  4QQL A;  1JTZ X;  5JDB A;  4M3C E;  2WT0 A;  4MO3 M;  2D5H A;  1F4A A;  1VR3 A;  2CY6 A;  2D93 A;  1H4H A;  2WYS A;  3ZYG A;  2XLF A;  2CU5 A;  3Q8C A;  2GH8 A;  3IDB B;  1UOJ A;  1BKZ A;  2A71 A;  3BKZ A;  1VBD 1;  3ZXD A;  1FV3 A;  1ZBA 2;  2A6Y A;  4OZX A;  1RUH 3;  2WAB A;  3K51 A;  4RD7 A;  4XDO A;  3ZYP A;  3ZX7 A;  4R52 A;  5F6K A;  4R9C A;  3R6S A;  2FD8 A;  1KGY A;  3ZXF A;  1H6Y A;  1QJY 2;  5ACA 3;  2XOM A;  4YW7 A;  3J26 N;  3RFR A;  5IVC A;  4AL9 A;  1S0J A;  1I9R A;  4URT A;  2HWC 3;  4LBJ A;  3ZR6 A;  5IK4 A;  2W92 A;  2DF7 A;  3ZFG C;  3FLP A;  1BQP A;  4GWM A;  4JKK A;  1H1I A;  2E9Q A;  1YFX A;  1QNY A;  2ZGL A;  2DBI A;  2GAU A;  2IWG B;  3NJX A;  4RHV 1;  3I2D A;  3SH3 A;  1A8M A;  1J84 A;  1JW6 A;  4H3W A;  4BDV B;  3VD5 A;  3BVC A;  5IFT A;  4KQ7 A;  1BYH A;  3H3L A;  3N7L A;  4XEZ A;  5CIS A;  4HG6 B;  3ZPO A;  2NPI A;  2OUJ A;  1X36 A;  4ZXE A;  1SFY A;  3PVE A;  1CPM A;  1FNZ A;  1XC6 A;  5L7O C;  1JOB A;  2W87 A;  2JDK A;  3ZFF B;  1ALY A;  1VRH 2;  2XUE A;  2V5Y A;  4AF9 A;  3MIH A;  4FQZ A;  3AL5 A;  2A6Z A;  4MXW B;  1JU4 A;  1WUV A;  2E7Q A;  4JZR A;  2PXJ A;  3C7O A;  3JUU A;  3H7J A;  3S7I A;  5K4L A;  5BNN C;  4O7X A;  2I07 B;  1ND2 A;  5LY2 A;  1UYZ A;  2PAK A;  4XCA A;  1JYV A;  1Q8Q A;  4LOS A;  3TEZ A;  1RUC 1;  1CX4 A;  2A7A A;  3HVD A;  1STM A;  2BZD A;  1FX5 A;  5BNO C;  4QQH A;  4AWD A;  2EIB A;  5BY5 A;  2DTW A;  2DWR A;  3Q9O A;  2KR2 A;  3KWV A;  4FAG A;  2W91 A;  3IM0 A;  3WNO A;  1LHW A;  4YFW A;  1H30 A;  3LEG A;  3ZOI A;  4BQ4 A;  1W8O A;  2XB6 C;  3IDC B;  5JXH A;  1KDK A;  3TRS B;  1JZ4 A;  1LEM A;  2YB7 A;  2Y0O A;  3H1Y A;  3PIJ A;  1GUI A;  4Y24 A;  5DAQ A;  3NMB A;  5LCW L;  2JB4 A;  1TEI A;  1VMF A;  2MEV 2;  2Q0A A;  3M3C A;  2ZXQ A;  4LIU A;  3ROU A;  1VMJ A;  1YLL A;  2FZ1 A;  2BUK A;  2OPW A;  2HKX A;  1CAW B;  3SC7 X;  4XCB A;  1YYN A;  1N3Q A;  3C7H A;  2EVX A;  2JDH A;  3JBG 2;  1IKQ A;  1URX A;  4I0B A;  5FIX A;  3P3P A;  1QEX A;  4CP9 B;  1O4T A;  1C57 A;  3K48 A;  2YXS A;  4OHZ A;  3PUS A;  3ZMO A;  1JH5 A;  2JG8 B;  2OZ6 A;  2Z5W A;  4IEV A;  4Y20 B;  5JIU A;  2E63 A;  3T09 A;  4UBG A;  4Q0V A;  2QUO A;  3LA7 A;  4X6R B;  4YZ4 A;  4BM8 A;  4CEW A;  4OHY A;  2WS9 1;  1NY7 2;  1ULC A;  3NNG A;  4OUE A;  4Z07 A;  2BU9 A;  3H1W A;  5K0U C;  4UBH A;  3MFC A;  5FOB B;  4IEQ A;  2ARC A;  1W8W A;  3ACG A;  2XML A;  5FZ3 A;  5CG9 A;  4HBN A;  4UFJ A;  3VZJ A;  4MGZ E;  4CCN A;  4X8P A;  2B9V A;  5D2A A;  2ZHN A;  2FDJ A;  2HWB 3;  4YW6 A;  1NZI A;  3I2F A;  1ASJ 1;  4KU8 A;  1QJF A;  2R0H A;  2XON A;  5F3C A;  4AEM A;  3SKV A;  4AVB A;  2Y38 A;  1GZW B;  1XSR A;  1C1F A;  1W2N A;  2G9G A;  1W8U A;  2ZMK A;  3RYR A;  3HAG A;  4DXR A;  4XOG A;  1Q8V A;  2ADD A;  2VTX A;  3VL8 A;  3FL7 A;  2WNU C;  1OH4 A;  3AP7 A;  3CDZ B;  1E57 A;  3MUZ 1;  3U14 A;  3WDV A;  2BBV A;  2WLP A;  1PZ8 A;  3E97 A;  3MLL A;  4XHB A;  4XFG A;  5ABJ C;  1RVF 3;  4MUV A;  1UQX A;  5E1R A;  3WSO A;  4CP1 A;  3JD7 3;  4QX5 A;  4KWK A;  3I59 B;  2P1B A;  1AX2 A;  1RUN A;  2ORZ A;  4P9Y A;  5ISL A;  1QJX 3;  2K2S A;  2QQU A;  5K9Y A;  2E7T A;  3WR0 A;  1NCR C;  4OUM A;  4CDU A;  4HL0 A;  4CCE A;  4CVU A;  1W04 A;  1RIR A;  5HI0 A;  3AM2 A;  4OLL A;  1SDW A;  4PJY A;  2B4K A;  3AC0 A;  2FQP A;  2XLG A;  4YG6 A;  5J1X A;  1PNG A;  1ZBA 1;  1WWY A;  4E4Z A;  4G3Y C;  1UZY A;  1G9A A;  3VHO A;  5GZF A;  4X6Q B;  4QPI C;  1AXY A;  2E32 A;  1S2E A;  4QX1 A;  1OXC A;  2GC0 A;  3GZA A;  3J7H A;  4QKD A;  1QJY 1;  4Y4R A;  4BQ2 A;  2ZGR A;  3PIG A;  2AR6 A;  4N43 C;  1REE A;  4QB1 A;  1X7N A;  4OCT A;  1H1M A;  1MPX A;  4TXW A;  1ZBE 2;  5E8A A;  4AYU A;  1OT5 A;  1VB4 A;  4J25 A;  4KWJ A;  5A3U A;  4C1X A;  5EV7 A;  5CFC C;  4URA A;  2IZW A;  4Q1R A;  4HXC A;  4W6Y A;  1W9S A;  3WVJ A;  2NMN A;  1BLZ A;  3EYP A;  2WYF A;  2RG4 A;  4GQ7 A;  3UKV A;  5BNP C;  4LA3 A;  1SZB A;  4WM8 C;  4Y1X A;  4I3P A;  2WO2 A;  2ZAB A;  5F3G A;  4NRO A;  3KT4 A;  4GA9 A;  1ULD A;  5DZG A;  1ENS A;  1LR5 A;  4C0H A;  5HCA A;  5DDJ 2;  5DQ0 A;  1BXH A;  4CDQ C;  3GF6 A;  1TNR A;  1LNS A;  4UXA A;  1NXD 1;  2V5D A;  3RWN A;  4IV3 A;  3ZN4 A;  3GHM A;  3I2K A;  2XJR A;  4N7I A;  4UFM A;  2XJP A;  2VOK A;  5HCF A;  1S55 A;  2FMY A;  4HPK B;  5C71 A;  1KS5 A;  4RHV 3;  1ND3 B;  1U5Z A;  4L11 A;  3WDT A;  1UZV A;  2ARA A;  5ERL A;  3ZKY A;  2VW1 A;  4UFK A;  5D8A A;  3ZDS A;  3A22 A;  4QHO A;  3CHX A;  3POI A;  2VUD A;  3S57 A;  2Y0I A;  3W5M A;  2ADE A;  2PHL A;  2XVG A;  1KFX L;  1VMH A;  2VH9 A;  3RVH A;  2EIE A;  2NZ9 A;  3EJK A;  3SLI A;  5EIY B;  4JGZ C;  1OSG A;  1OPM A;  2WQ8 A;  2Y6G A;  4UF0 B;  2VZU A;  4H7L A;  1V6J A;  5EQU A;  5A70 A;  1HN1 A;  2RVA A;  4HK9 A;  4XIK A;  1DGW A;  4MHU A;  4QHB A;  4KG8 A;  5D1I A;  3WG3 A;  1HQW A;  4MGT A;  5FDB A;  4WM7 B;  4H7M A;  1NE4 A;  1RUC 3;  1RUD 1;  5E89 A;  4FP2 A;  2WII B;  3EB7 A;  4XAA A;  4CCC A;  2G4I A;  1HRI 2;  1D2Q A;  1DQ5 A;  1HQL A;  1R1A 3;  3C8X A;  2NQY A;  2QQK A;  2VOX A;  3A4U A;  3P1I A;  5FY7 A;  4OI1 A;  3OBA A;  2R16 A;  1DP0 A;  4LBQ A;  3VD3 A;  1MQT C;  5LA2 A;  3OOX A;  3JBG 1;  4Q4V 1;  3AP6 A;  2BGC A;  4CPB A;  2J7M A;  3POY A;  2AC1 A;  4SLI A;  3D8C A;  2WSU A;  3ZYH A;  1UY0 A;  3WY6 A;  4NO4 A;  1I3H A;  4E8C A;  2YY1 A;  1O8S A;  3SQO A;  2VVD A;  4CSW A;  3OPT A;  2XJV A;  5JZG B;  1C5H A;  1SQ4 A;  1J59 A;  2WAO A;  4C8D A;  5K8S A;  1POV 1;  1WGP A;  3PU3 A;  1QMJ A;  2IVI B;  2PHX A;  3H9A A;  4GUL A;  4BLI A;  5CEH A;  1SDD B;  2RMU 2;  1NLR A;  3BOP A;  4YVW B;  5F5I A;  1C4R A;  4QX2 A;  4AGG A;  1YQC A;  2WA4 A;  3CO2 A;  2JIJ A;  2XQX A;  2YDE A;  2Z4F A;  5DUW A;  1OQD A;  3H3U A;  3WXP A;  1W9W A;  4XJ9 A;  4Z82 A;  1DLC A;  1SFP A;  5JOW A;  4YSF A;  4B4R A;  2ZKN A;  2YMZ A;  1AF9 A;  1CAX B;  2JD4 A;  4PDW B;  5L73 A;  1X50 A;  2ZX0 A;  2JE9 A;  2RHP A;  2WFP A;  2C24 A;  4IND A;  2WS9 3;  2VPV A;  4O9G A;  3H3Z A;  3QH7 A;  4BQ3 A;  2UYB A;  1NT0 A;  3UJQ A;  2YU2 A;  1OFS A;  3BOW A;  1AYM 2;  1OHF A;  1W9T A;  1UCX A;  4R9B A;  4I01 A;  4IEY A;  3APB A;  2EIC A;  4BK5 A;  2PHF A;  2K46 A;  2YU1 A;  2FDH A;  4XFF A;  3WQ0 A;  4CA9 A;  4QGM A;  1IG0 A;  2UWC A;  2YGM A;  3EXU A;  1ASJ 3;  3I3E A;  4CCD A;  3QLQ A;  4AI2 A;  4FFF A;  1RUI 1;  5DG2 A;  3RZZ A;  3VDB A;  3H8O A;  3RZL A;  3UES A;  4V2V A;  2ZMN A;  4R9D A;  3MI8 A;  2F6B A;  5JR7 B;  4M0N A;  3ZM8 A;  4YM3 A;  3PTR B;  2BWA A;  4HKW A;  1PM4 A;  2J1R A;  4HMZ A;  1LKN A;  5EZW A;  3B5L B;  4ITC A;  4MAD A;  2RS5 2;  1HV1 A;  2CL2 A;  4I2O A;  2VZR A;  1YJL A;  5KHJ A;  1D2S A;  3PUR A;  2HWE 2;  1QH6 A;  2WN2 A;  1UMZ A;  3RDI A;  2RDN A;  4WZC A;  3KGZ A;  4FT8 A;  4QKF A;  2QTW B;  4Y4Y A;  4ASM B;  4JHZ A;  5LZ6 A;  1LHO A;  1GIC A;  1ZRI A;  3K77 A;  4JDN A;  4XBQ A;  4H14 A;  5EJ1 B;  2GC1 A;  3MO4 A;  2UY8 A;  2WUH A;  2BGO A;  3MYX A;  2WZE A;  4MLO A;  4Q4X 1;  4XC9 A;  5BUV A;  1COV 2;  3MPB A;  1GYK A;  1FT9 A;  1G6N A;  1ZBA 3;  5C3S A;  1CVN A;  2OX0 A;  3AJZ A;  2ARX A;  5D21 A;  1CR7 A;  4E4H A;  3VKO A;  3O1S A;  1X8E A;  5LBE A;  1QJY 3;  2WNE A;  3SH5 A;  4TWT A;  4DIN B;  4ZU4 A;  5DDJ 1;  4CCO A;  4LEJ A;  4AGV A;  2D97 A;  1SCS A;  1N1V A;  4IE6 A;  2BP6 A;  1L7Q A;  1GNH A;  1W6O B;  2OT7 A;  3OPZ A;  5ANN A;  4DXZ A;  4ATE A;  1SLB A;  3IDE A;  2JDP A;  4R4Z A;  1MVQ A;  2WN3 A;  4LKS A;  5F8P A;  1RUJ 2;  1XE7 A;  1D0H A;  3ZR5 A;  2UWB A;  1IS3 A;  2CSG A;  2IXJ A;  4FFI A;  4IE4 A;  5LBC A;  4P9W A;  5A1L A;  4FPE A;  5FZH A;  1YI9 A;  3ZFG B;  4DY3 A;  1JZ5 A;  1ND2 C;  1TG7 A;  1UPS A;  1W6P A;  5FPB A;  5T55 A;  1ULG A;  3WUC A;  5F1R A;  5L36 A;  1R08 2;  1OPO A;  2IXC A;  1N1T A;  1XQN A;  5DAP A;  3MLK A;  4XUQ A;  1PGS A;  3VBR C;  2ZEY A;  4MGI E;  5FZB A;  1G9C A;  3BTZ A;  3CZJ A;  4DEV A;  4NVP A;  4TTG A;  3I3Q A;  3V65 A;  1JZ2 A;  2BEO A;  3K2O A;  4M4R A;  3NV3 A;  5FQ0 B;  5L7O B;  2VMG A;  3RZG A;  3BTY A;  3GBG A;  3WOG A;  2V4A A;  5FZE A;  3HN1 A;  3E5Q A;  5J96 B;  1W6M B;  1Y43 B;  2OII A;  2Y6F A;  4ZY9 A;  1VBE 2;  4XF9 A;  5BNN B;  1F8V A;  1RTV A;  1K3I A;  5C70 A;  1HRI 1;  3FJS A;  1CZS A;  5JPN B;  4XUO A;  5BNO B;  4FPH A;  5C4W A;  3W5N A;  1F5J A;  4RR3 A;  5A80 A;  1FPN 2;  4CP0 A;  1JYX A;  1W8N A;  2WC2 A;  1HLC A;  2IXL A;  3B3Q E;  2R32 A;  1GBG A;  4NHY A;  4YNI A;  3S7E A;  1PNF A;  2XKP A;  2D6N A;  3W21 A;  3IAQ A;  2PQQ A;  5IVE A;  1GP4 A;  1SLL A;  3GHN A;  3KLS A;  5JXI A;  2MEV 3;  2GDF A;  1X33 A;  1WBF A;  2GAL A;  2SBA A;  2RMU 1;  2PA7 A;  4XBN A;  4D94 A;  2DTY A;  3PU8 A;  4IEW A;  3VLB B;  5B4X A;  5A1F A;  4XVH A;  1G9F A;  4E2Q A;  3KMH A;  3JBG 3;  5JMC A;  3Q8A A;  2VQU A;  4PF5 A;  1IKP A;  5SV8 A;  2FDF A;  1XNT A;  4QQP A;  2A6W A;  2W39 A;  1PO1 2;  1AYN 1;  1MS8 A;  2P3J A;  1AR7 2;  2B45 X;  1UD1 A;  5FMO L;  4YM0 A;  1VP6 A;  3V56 A;  3I7D A;  4P9G A;  4JRA A;  1S0E A;  5KHG A;  5I0S A;  1POV 3;  1XYP A;  3HNY M;  3HIF A;  4CXX A;  3OUJ A;  2HWF 1;  1ST8 A;  1RMU 2;  5A3N A;  2BFU S;  5TSW A;  5I93 A;  1AYM 1;  4FVV A;  5DUV A;  4M01 A;  2HWD 2;  3VBH A;  2JKB A;  5T3N A;  2PN5 A;  3T0D A;  1NE6 A;  5K0U B;  4N8M A;  1RED A;  2QE3 A;  3R4D B;  1CD3 G;  2WFF 2;  5LA1 A;  5CAZ A;  4D0Q A;  1O5L A;  3P5B A;  1UZ0 A;  2ET1 A;  5E88 A;  1NAE A;  1O6U A;  4ZS2 A;  5LBB A;  5KXE A;  4CE8 A;  4DNY A;  5FZ8 A;  1CON A;  1XRU A;  5HXM A;  1YRZ A;  2VNV A;  5G05 L;  4CDU C;  1QY4 A;  3IMN A;  1W3X A;  1ZRR A;  2FDG A;  2XDV A;  4XJU A;  5FAX A;  2JDU A;  2QQJ A;  5F3I A;  2RS5 1;  3FLR A;  5T54 A;  1WCU A;  4OMD A;  5B2G B;  3I2O A;  4QX8 A;  3UKT A;  3E5X A;  2WNU B;  2DCY A;  2HWE 1;  2GN3 A;  2V73 A;  5FY9 A;  3WNX A;  2F4P A;  1LUL A;  1W6N B;  5ABJ B;  2RR1 2;  1UL9 A;  5JXG A;  1TNF A;  3UK9 A;  3ME2 A;  4MG2 A;  2A75 A;  1RUI 3;  2GP5 A;  4M3C B;  4BIO A;  5BPX A;  3WW1 A;  1Z78 A;  1LOF A;  5FMD A;  5JIA A;  1GOG A;  3UKN A;  3N7J A;  1YIP A;  5AFB A;  1RUF 2;  2QNK A;  3V64 A;  3QD6 A;  5FP8 A;  2WO3 A;  1NCR B;  1OUS A;  4LT5 A;  3ZXL A;  5FFO C;  2QZ3 A;  3CBN A;  4JV4 A;  3IPV B;  3S30 A;  5DAV A;  4Q8L A;  4ES9 A;  4ATF A;  5KXD A;  2XL7 A;  3HBK A;  1V6L A;  3LZZ A;  3AKP A;  4E9K A;  3J4U H;  1YQ5 A;  2P3I A;  3WP5 A;  3BGA A;  3LDB A;  3AZW A;  2D43 A;  2RDS A;  4CUB A;  4E4D X;  4QPI B;  1ZBE 3;  2HLE A;  4QT6 A;  1W8F A;  4DO0 A;  1RUG 2;  3DCQ A;  2YZ4 A;  4N43 B;  1GV9 A;  1WLD A;  3TEX A;  1RUJ 1;  4FPO B;  4M0H A;  3M1H A;  4WBB A;  3ZXK A;  5IAX A;  3MIF A;  2ILM A;  3LIG A;  1A78 A;  1BMV 1;  3KCX A;  3WNK A;  5IYY A;  5CFC B;  1S2K A;  3I97 A;  1VAK A;  2FBE A;  3WF4 A;  1Q8S A;  5BNP B;  1WCQ A;  1BEV 2;  1R08 1;  4WM8 B;  1WCD J;  2JG9 C;  4YGB A;  5DDJ 3;  3WF2 A;  3GM8 A;  3M3I A;  4BK4 A;  1BBT 2;  2LRP A;  2C0Z A;  4CXW A;  1CQ9 A;  1MS9 A;  2CWM A;  4IEU A;  2R07 2;  4LTA A;  2VJX A;  4OVE A;  4AVV A;  3T4V A;  3B69 A;  5CU1 A;  2R06 2;  5A7O A;  4CDQ B;  1ZRE A;  2H6B A;  1WW4 A;  1W8Z A;  5F3E A;  4D69 A;  4PLO A;  4PHZ A;  3J7N A;  3ACL A;  1CZT A;  4AED A;  2Z42 A;  4AI8 A;  1HXS 2;  4A45 A;  1FMD 1;  3Q8B A;  2QCS B;  1H2L A;  3RGB A;  3III A;  4K1Y A;  3WNL A;  1VBE 1;  3I2G A;  3THP A;  4D7S A;  4PI2 A;  5C33 A;  3RZJ A;  4MVT A;  1D0G A;  4E2S A;  4NMI A;  4FCA A;  4BIS A;  3LF7 A;  1VPH A;  2Y6L A;  3QBQ A;  1PHM A;  2JDM A;  1VBB 1;  2ZKL A;  2D6K A;  4A7K A;  1GWL A;  1XND A;  3THC A;  4WVM B;  5GZG A;  1PM7 A;  3UET A;  4BH9 A;  4ES8 A;  2OKX A;  1YJK A;  4JGZ B;  1DGW X;  3VDD A;  1VAL A;  4XFC A;  4Y1V A;  3ZFE A;  2IFR A;  4CDX A;  4AVT A;  1QXR A;  2RM2 2;  2K0G A;  2XJU A;  3IB3 A;  1HRI 3;  5FYM A;  4F83 A;  4HKL A;  4CUC A;  3LEM A;  2LUW A;  3IAP A;  4GKY A;  3TOJ A;  4OHV A;  3IT8 A;  3NV2 A;  1O3R A;  1IQA A;  3E6B A;  3O0W A;  4KBB A;  4COV A;  2BNM A;  5FZI A;  1EP0 A;  3AP9 A;  3NAP A;  1PO1 1;  3LPF A;  3NNM A;  2WWS A;  1MQT B;  1V6M A;  4S2H A;  5IW0 A;  3RMX A;  1AR7 1;  3AKS A;  1FV2 A;  1IZ3 A;  1LJ7 A;  2BRT A;  1UXX X;  1YFW A;  1C8N A;  1UU5 A;  1DU3 D;  4IGO A;  4OFG A;  3OGR A;  4XDQ A;  5CFD A;  2D3P A;  2XVK A;  4GAL A;  4Z2W A;  1M06 G;  2R1D A;  1EAH 2;  1UMH A;  2EIG A;  4RS5 A;  3VL9 A;  1SPP A;  2VQA A;  2RMU 3;  3LA2 A;  1RMU 1;  4EN9 B;  4DY5 A;  4D7Y A;  1GOH A;  1QJX 1;  2ZGP A;  2C9A A;  3LGR A;  2WWJ A;  3DYM A;  5KR7 A;  3I3M A;  1SCR A;  2ZEW A;  4Q0U A;  1ZA7 A;  2VMH A;  1AR6 2;  3E6C C;  4OMC A;  1D4V B;  2G19 A;  3VHN A;  4NHL A;  2J1A A;  5LWB A;  3CJI A;  3T4H B;  1PMH X;  4UFH A;  1DGR N;  2R49 A;  2VNG A;  5FZ0 A;  5G04 L;  4YWA A;  2Y60 A;  1ZZ8 A;  3OYW B;  2X05 A;  3ZSL A;  4E27 A;  3MW3 A;  3PJQ A;  2VZS A;  2W94 A;  5IHR A;  3TEY A;  3OY8 B;  4P00 B;  4I0W B;  4YW2 A;  5FLJ A;  3MW2 A;  4P5H A;  5FRA A;  5C5U A;  1AYM 3;  2VTF A;  3AMH A;  1NLQ A;  1DQ6 A;  2NM1 A;  3JQW A;  3RJR A;  3M8L A;  1W2A X;  2JB8 A;  4HVR A;  4EN7 B;  2P17 A;  4E8D A;  1KRI A;  4PT6 A;  4D3W A;  4QX7 A;  3WHU A;  2RR1 1;  3ZSE A;  4B1L A;  1Q5O A;  3LSE A;  3G7D A;  4A6S A;  4DIQ A;  2ES3 A;  5JSR A;  4I30 A;  3WF3 A;  4Z1V A;  4QQO A;  2EA7 A;  1TZO A;  3ITQ A;  3BUC A;  3K4A A;  5JUV A;  1RC6 A;  2Q1F A;  5J98 B;  1RUF 1;  3MF9 A;  1CIY A;  1MS4 A;  1EYB A;  2GH2 A;  5KWR A;  2RS5 3;  4F3J A;  5EHD A;  5FOJ B;  5LW9 A;  5FXW A;  1H4G A;  2HWE 3;  3U4S A;  1POV 0;  3PVB B;  1IPJ A;  4UOJ A;  4LE4 A;  4W4Z A;  2EF6 A;  4ZKT B;  1E5S A;  3SCG A;  3T1L A;  3U0Z A;  4BME A;  2RE9 A;  3T3Y A;  2CWS A;  2HH9 A;  1RUG 1;  3HN3 A;  3WDU A;  4GWI A;  1O3S A;  1W3V A;  1QDC A;  4PI0 A;  3BN6 A;  1O3Q A;  4L9B A;  3KB5 A;  4BLJ A;  1COV 3;  1UO9 A;  1UOB A;  3IZO A;  4CU7 A;  2DCJ A;  1LOE A;  3D3A A;  4AAX A;  3ZMN A;  1F15 A;  1VLN A;  3ZFF A;  4AQ2 A;  1BEV 1;  1YNA A;  3RYK A;  5LBF A;  2QQL A;  1HDK A;  5A6Q A;  4YRD A;  4MXW A;  1HIX A;  3JB8 A;  1BK0 A;  4CZS A;  4XQD A;  2D6O X;  3OG2 A;  1XOY A;  2JIG A;  2R07 1;  4LHN A;  4QDS A;  5B4N A;  5FPU A;  1WBL A;  1MS1 A;  1RXF A;  2R06 1;  1RUJ 3;  1J83 A;  3WD5 A;  4FPG A;  4HN1 A;  2WA3 A;  1R1A 1;  2BV4 A;  2VOW A;  3AZZ A;  4AFA A;  5AC9 2;  1HXS 1;  4CCJ A;  2VCA A;  4ISQ A;  4L99 A;  4C91 A;  1R08 3;  4IEZ A;  4CU6 A;  5FO8 B;  5KXC A;  4HSJ A;  3QH6 A;  5FTT C;  3KHB A;  1ND2 B;  3WW3 A;  1F5F A;  1GZT A;  3AMN A;  3TNQ A;  2H6C A;  4MET A;  2B9U A;  2PHD A;  3WP6 A;  3ZIW A;  2BVB A;  5IK7 A;  1GLH A;  2KXL A;  4A7Y A;  3K4D A;  4UWD A;  3AVR A;  5C4W C;  2V09 A;  2VAU A;  1KQR A;  2JIC A;  4NAO A;  2AAC A;  5JSP A;  3VBR B;  4IE0 A;  4RR3 C;  1NZC A;  2DCK A;  2VZO A;  4L92 A;  2UUR A;  1S0G A;  2QFE A;  3I54 A;  1CAW A;  4RYD A;  3KZ4 C;  3WV6 A;  1FMD 3;  1ACC A;  3J8F 2;  3USU A;  1VBE 3;  4LBK A;  2RM2 1;  3WLU A;  1KD7 A;  4AHY A;  1N3O A;  4BXF A;  3ZYF A;  5FKC A;  4CP9 A;  3MIB A;  3OBT A;  5LRR A;  2EXH A;  4F7Z A;  5C8C C;  3E1F 1;  1VBB 3;  2ZX4 A;  4NN0 A;  2JG8 A;  3U1X A;  4TSV A;  1JZ6 A;  1SMV A;  4NAM A;  1J1L A;  4LKF A;  5F7U A;  4JAA A;  1A3K A;  1ULF A;  5IK5 A;  3B9C A;  1FPN 3;  3CNA A;  1EPZ A;  1LOA A;  4GXL A;  2PTM A;  2QQM A;  2D44 A;  2B8M A;  3E6D A;  3AXD A;  4BE3 A;  1DCS A;  2XL9 A;  4LHL A;  2W1Q A;  1EAH 1;  4WV8 A;  1W03 A;  4QB6 A;  4QQ2 A;  2VMC A;  4NR1 A;  2Y6K A;  1X82 A;  1YCI A; 
#chains in the Genus database with same CATH homology
 5L9B A;  2FCU A;  3KT7 A;  3ITQ A;  4Y5T A;  2HBU A;  3PL0 A;  5HV4 A;  4NHY A;  2Y34 A;  4JZR A;  5IAT A;  3W21 A;  2RDQ A;  5LA9 A;  4J25 A;  4XCA A;  5A3U A;  3HQR A;  2RG4 A;  3OBZ A;  3OUI A;  4NHK A;  4ZON A;  3KT4 A;  4Q5O A;  5LAS A;  4NMI A;  5EP9 A;  3NNL A;  5DAW A;  4BQX A;  4BQY A;  5DAQ A;  5LBF A;  3OUJ A;  2RDN A;  5C5T A;  5HV0 A;  2OPW A;  2JIG A;  2G1M A;  5LB6 A;  4XCB A;  5ERL A;  5EPA A;  3DKQ A;  3MGU A;  5LAT A;  4XC9 A;  3KT1 A;  2RDR A;  4NHM A;  2A1X A;  2FCT A;  5LBB A;  3GJA A;  5M0T A;  5LBE A;  4Y5S A;  3NNM A;  3HQU A;  5EQU A;  5L9R A;  4MHU A;  4UWD A;  2FCV A;  4ZPI A;  4NAO A;  3NNJ A;  3W20 A;  4XAA A;  5LBC A;  4IW3 A;  3NNF A;  4KBZ A;  4BQW A;  2HBT A;  2G19 A;  4NHL A;  4XAB A;  5DAP A;  5L9V A;  5DAX A;  4NHX A;  3GZE A;  2Y33 A;  5DAV A;  3EMR A;  5IAV A;  5C5U A;  2RDS A;  2V4A A;  4XAC A;  3OUH A;  2JIJ A;  4MHR A;  3GJB A;  3BVC A;  5IAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...