1HRI3

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 40
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hri300
2R043 4RQPB 3ZFEB 2XPJA 4GB33 1X33A 2X5IB 4WM8B 5JZGB 1NA1A 1R093 4IV1A 2ZZQA 1HQNA 1VBC3 1H8TA 1RUF3 3ZFFA 1HXS3 4RFT0 2XBO1 2HWD3 1PIV1 1NOVA 1VBA1 1AL0G 5C4WC 2HWF3 1RUD3 1TME1 4PDWA 4YVWB 3CJIA 4CDXA 2XBO2 1AL21 5J98B 5C9AC 1BBT3 2HWF2 1ND3B 4WM7B 4CDQB 1TME2 4QPIA 1FPN1 3LOBA 2HWC3 4YVSC 1BMV1 1EV11 4RS5C 1A6CA 2WS91 4GH4B 4Q4X1 1EAH1 1ZBA3 1FPN2 5K0UB 1RMU3 4RR3C 1RUE2 5AC93 3VBOB 3NAPA 1MQTB 2RM21 5LK7B 1ZBE3 1EAH2 1HX6A 4AEDC 2RS51 2BFUS 4CDWC 4CDUA 4N43C 1OPOA 2RM22 5FMOL 1AR63 4IV3A 5J96B 2RS52 1C8M3 5C4WA 2ZTNA 4Q4Y1 4Q4W2 2MEV1 1AYM3 1RUG3 4GMP0 1Z7S1 4Q4Y2 3VBHA 2MEV2 4GMP1 4N53B 1E57A 5BNNA 1OOPC 4WM8C 4YVSA 5JZGC 4CEWB 4RS5A 4RHV3 5C9AB 1QQP1 1Z7S2 3VBSB 1VBD3 1F8VA 3S6PA 1HRI1 4FSJA 1QJY3 1AR81 1QQP2 4YVSB 2WLPA 1VBE2 2TBVA 4YVWC 2RR13 1HRI2 4AEDA 4CDWA 2FZ2A 1QJY2 1TMF1 1AR82 4N43A 1ND3C 4RR3B 4WM7C 2R061 1AYN1 4Y4YA 3J8F1 1AR73 1TMF2 1QJU1 1RVF1 2R073 2R062 2GSYA 3VBUB 1FMD1 1BEV2 4RQPA 1RVF2 2R072 3ZFEA 5CFCC 1QJX3 1RUH2 1V9U1 1M06G 1MQTC 1RHI3 2X5IA 4WM8A 1R1A2 5ACA3 4CEYC 3TN93 5JZGA 1R083 1FMD2 1QJX2 1V9U2 2PLV3 1PGW1 4GB31 3TN92 4NWVA 1OOPB 1PVC2 4Y5Z0 5CFDB 2R042 1R091 4YVWA 1PGW2 4GB32 1VBC1 2FZ1A 1ND3A 4WM7A 5A32B 4LLFA 4CDQA 1R092 2BPA2 2HWF1 4N53C 1VB4A 3VBFB 1RUD1 1VBC2 1RUF2 5BNPC 1HXS2 4CEWC 4BCUA 2HWD2 5L7OC 1BBT1 4Z92B 4GH4A 3VBSC 1RUD2 1FOD3 5K0UA 1RUJ3 4EJRA 1K5MB 5ABJC 3DPRB 1BBT2 2HWC1 3VBOA 1VRH3 1MQTA 1RUE1 1PIV3 1RUJ2 1VBA3 1HRV3 1NCRC 5A33B 2HWC2 1RMU1 1VRH2 5CFCB 5AC91 1AL23 1RUI3 1ZBE1 2DF7A 1NG0A 1HRV2 1ZBA2 1CD3G 4CEYB 1RMU2 4Q4V3 1GFF2 1COV3 1POV0 5AC92 3VBUC 1RUI2 1ZBE2 1POV3 4Q4W1 1AR61 3VBRB 1PO13 2WS93 1B35B 1C8M1 4N53A 2HWB3 3VDDB 1AYM1 1NY71 3ZFGC 4CEWA 1AR62 5L7OA 5C9AA 5D8AC 1C8M2 1RUG1 2IZWA 3VBSA 5GKAC 2ZAHA 2WWSA 1AYM2 1NY72 2BFUL 4FTEA 5BNPB 1ASJ3 2RS33 1RUG2 5CFDC 4RHV1 5L7OB 3JBG3 3IDEA 1NCQC 3JD73 3JB8A 1VBE1 1VBD1 1RUC3 3FBMA 3JB4C 4RR3A 5DDJ3 3ZXAC 5ABJB 4RHV2 1QJY1 3VBFC 3HAGA 1VBD2 2WZR3 2HWE3 5DDJ2 1AUYA 1NCRB 3VBUA 4FTBA 5C8CC 1PGL1 2RR12 1K5MC 2HWE2 1D4M3 3DPRC 1AR71 1BEV1 2R071 1PGL2 1PO23 1RUH1 4QPGB 1VBB3 1R1A1 1AR72 1MEC3 4IV1C 2BBVA 1QJX1 2WFF3 1H8TC 3ZFFC 1DDLA 1RHI1 1OOPA 4FTSA 3TN91 5CFDA 3ZFGB 1AYN3 3J8F3 5D8AB 1PVC1 2R041 4CDXC 1RHI2 2PLV1 5ACA2 4JGZB 5A32A 2RMU3 3VBRC 1R082 1B35C 2RS13 3VBFA 1ND2B 3VDDC 4NWWA 1AR93 1NCQB 2PLV2 4QPIC 1RUF1 2BUKA 1HXS1 2HWD1 1K5MA 5BNOB 1IHMA 3DPRA 4JGYB 3NAPC 4SBVA 5C8CB 1FOD1 5A33A 5FOJB 1RUJ1 4CDUC 5CFCA 1WCDJ 1VRH1 4IV3C 2XBO3 1FOD2 4CEYA 2Y26A 1HRV1 1ZBA1 1NA1B 2VQ0A 1TME3 4IV1B 3M8LA 1PIV2 1OHFA 1VBA2 1H8TB 3VBRA 3ZFFB 1RUI1 1B35A 4Q4V1 1COV1 3VDDA 3VBHC 5BNNC 1AL22 1F2NA 1FPN3 1SMVA 4PDWB 4QPGC 3CJIB 1POV1 2GH8A 4CDXB 5FMOS 1EV13 1RUE3 1PO11 4Q4V2 1COV2 4Q4X3 1CJDA 2HWB1 1EAH3 1BMV2 5BNPA 1EV12 1RB8G 4QPIB 1PO12 2WS92 2RM23 4Q4X2 2HWB2 2QQPA 4JGZC 5ABJA 2RS53 1ASJ1 2RS31 4Q4W3 1ND2C 3JBG1 3NAPB 3JD71 1RUC1 1NCRA 1ASJ2 4Q4Y3 5DDJ1 2RS32 2MEV3 4CDUB 3JBG2 5BNOC 3JD72 4IV3B 1RUC2 4RQPC 2RR11 2WZR1 3ZFEC 2HWE1 1Z7S3 5C4WB 4GMP3 4JGYC 2X5IC 4QPGA 1W39A 2WZR2 1QQP3 1D4M1 1VBE3 3VBHB 1HRI3 1PO21 5BNNB 3ZFGA 1AR83 1D4M2 1VBB1 5D8AA 1NA1C 4RS5B 1MEC1 1PO22 2WFF1 4JGZA 1TMF3 1C8NA 1VBB2 1VB2A 5ACA1 4CDQC 2R063 1MEC2 1ND2A 1R081 1NCQA 1X36A 2WFF2 4PDWC 3CJIC 1BEV3 1QJU3 1RVF3 4AEDB 2RMU1 4CDWB 4GH4C 1AYN2 1RUH3 3J8F2 4N43B 2RS11 5BNOA 1R1A3 5K0UC 1AR91 1FMD3 1QJU2 2RMU2 4JGYA 3VBOC 1V9U3 1VAKA 2RS12 1QJZA 5C8CA 1AR92 1PVC3
chains in the Genus database with same CATH superfamily
4Y5TA 2ETEA 2JE9A 2Q5TA 4QX7A 5IVFA 2R043 2BZDA 5HPOA 4OMCA 4K1YA 3Q8FA 5L73A 1CPMA 5KBFA 4GB33 1GZTA 3M7AA 2WQ8A 1X33A 1MZEA 4QPWA 1CR7A 3W21A 5IATA 4LO5B 4UOJA 1R093 4IV1A 5A7SA 1OF4A 2E31A 3D5OA 2DURA 2JDZA 4K20A 3VL9A 2ZS6B 1HXS3 4RFT0 2XBO1 2HWD3 3BPSA 4XDQA 5J09A 1HDKA 4MGZE 1WKYA 5C4WC 1P8JA 4LBKA 2HWF3 3N9NA 1ZRFA 1AXYA 5FZOA 2XJPA 1GWKA 3FLRA 3PLQA 4FPYA 1A3KA 3ME2A 1LB2A 3D8CA 4CDXA 4IGOA 1JS9A 4XJWA 5A1FA 1AL21 4EZHA 1N3PA 5C9AC 4EQVA 4D94A 1QGLA 3DKWA 3LA2A 4PJYA 2YROA 4WM7B 4D6RA 5T55A 3H8RA 2IXIA 1UPSA 3UKNA 4XTMA 4QHBA 3VHPA 4HZFA 1ULFA 2WKKA 4D7YA 5F2SA 2HWC3 2QQUA 3POSA 1GNHA 5G05L 5JXHA 2Z79A 4W4ZA 2XHKA 2P17A 3PNAA 1OA4A 3TRSB 4GH4B 3CZUA 1BK1A 5E1RA 5IFPA 1EAH1 2PHDA 2JKXA 2WYFA 3AM2A 1V6MA 2CTVA 3I2JA 4FPFA 1RMU3 4XETA 4QDQA 1E5SA 1LGBA 2SLIA 2Y6KA 3JQXA 4XUOA 5FZCA 5E6HA 3CHXA 3TWIA 5JSPA 1GNYA 3DXTA 2WNUC 4B1MA 2YY1A 4N9HA 1HX6A 2Y6GA 2YBPA 1W6NB 3ZSLA 3VDCA 5KWRA 3NJXA 1UXZA 1YRZA 4V2VA 3B00A 4BYYA 4Y33A 3T4HB 1PZ8A 4Q5OA 3S5QA 4CDUA 4COYA 2XXZA 2W95A 1OPOA 5FMOL 1AR63 1XYPA 3WQBA 3ZKUA 4WZCA 2RS52 2D3RA 2PAEA 4C90A 4DB5A 5A3UA 2ET7A 1IKPA 3FHQA 1AYM3 3ACLA 4LMFA 2P37A 4ITCA 4KG8A 4XBNA 4EROA 5IK7A 2JIGA 2WN3A 3AKPA 2WAOA 4LR4A 3QH7A 3UKTA 1HN1A 2VCBA 5CKQA 1IG0A 1YFXA 1Z7S1 2WLQA 3N36A 4WVVA 2MEV2 4TZDA 4LNVA 1E57A 3ZDVA 5BNNA 4OI0A 1WMDA 1W2AX 2ATFA 3BYWA 3U4SA 4E2GA 4CEWB 1DYOA 3LE0A 1CONA 5C9AB 2NZ9A 2ZHKA 4QWNA 4LK7A 3O14A 1SZBA 2BVVA 2W1SA 2GNMA 4CP1A 4AVCA 5FZLA 2AZ5A 1ODNA 3S6PA 3ZSMA 1MS5A 2DCZA 2VE1A 1W06A 3T30A 3WQ7A 1HRI1 2VMGA 2DFBA 3USUA 2FDGA 1I1EA 5KXEA 1OSGA 4B7KA 1QJY3 3WF2A 1QQP2 4AE2A 3VZNA 1PX4A 5JXIA 1WMXA 4FQZA 1LCLA 4LKDA 5EIYB 4YVWC 3S30A 4AEDA 2CY6A 1C1LA 1WW4A 1SG3A 2F17A 2XLGA 4Y3OA 1ZZ9A 2FZ2A 4YW2A 5FREA 4ZS3A 2IXJA 1ND3C 2PYTA 2BWCA 1XYNA 2R061 3J8F1 4DZGA 1H30A 1NX9A 2WNUB 1VALA 3KLSA 2A6WA 5IHRA 1EPZA 3I3MA 1YI9A 4BA6A 5JI9A 4ZS2A 3O1RA 2GSYA 4HPKB 4R8HA 3RYPA 2YHJA 3MYXA 3VBUB 3AXDA 3O1UA 2Y60A 1CAWA 4YW7A 4CUGA 1FMD1 2ZX1A 4G4FA 1GV9A 3H9AA 1O6UA 3ON7A 1GQPA 4BWOA 2YUEA 4W6YA 4IEXA 3WF1A 5LBEA 1CAUB 1H6YA 3PDQA 1O5UA 2YV8A 3P6BA 4FPCA 3ZVXA 4EN0A 4NJ4A 5F1RA 2VMIA 2CDOA 1ULEA 2ZPXA 3HVDA 5FYHA 5L9BA 4UT5A 4E4ZA 2PLV3 1PGW1 2LUWA 4OUEA 3TN92 2FMDA 2VUJA 5KHKA 4NWVA 4XJ9A 4NIHA 1H1AA 1UZZA 2Q1MA 1PVC2 1RTVA 2D5HA 2R042 3M3QA 3CIHA 3BIEA 4GB32 3M4FA 4H7LA 5FZHA 3RZZA 1W05A 5FIXA 5A32B 1DBNA 2A70A 4LLFA 4NVPA 4CTEA 4BK4A 3HPNA 1R092 4ZXEA 1XNBA 4N53C 4QXHA 3H42B 4HMZA 4NHKA 1HQWA 1RUD1 3I3DA 5AVPA 4R9BA 1HXS2 2YGLA 5FUNA 3WVJA 4AL9A 2HWD2 1J84A 5L7OC 3U0ZA 3M3EA 5D21A 3KHBA 4P08A 4XJZA 3VDBA 1DGWA 5B2GB 3OGGA 3WUCA 2QQIA 3POBA 1RUJ3 4CE8A 1QWRA 4HXCA 2GMEA 4OI1A 4MHRA 1JU4A 3DPRB 2FHRA 2J1RA 4AF9A 4BQXA 4QX3A 5FLJA 5JCTA 3LIHA 2F6BA 3U4XA 2Q4SA 1GYKA 3MHZA 3OBAA 1XNTA 1AX1A 1LGNA 3ZR5A 1DQ1A 2PQQA 4KI5M 2DCJA 1NCRC 2ZHLA 5E8AA 5A33B 2GMPA 2HWC2 3CO2A 4AQSA 4A4AA 4P5HA 4NR1A 4DEVA 4RGGA 4NAMA 3H8XA 1IS5A 1PMIA 2A75A 2VZQA 1ZBE1 3BPZA 4HN0A 4N7IA 5DAVA 1QIQA 1RMU2 1GFF2 2IUWA 1COV3 2LRPA 4NPLA 2BRTA 4F7ZA 1W9FA 4JDOA 4W6WA 4BMBA 1QOOA 1RC6A 3VBRB 5C8WA 1B35B 4LULA 4HSLA 4IE7A 2HYKA 3VGIA 2X8KA 1W9TA 3VDDB 4Y22B 1I9RA 2EXIA 3RNSA 1NY71 3LDBA 1AR62 2BDRA 4LIUA 3MO4A 3WCSA 2GZWA 3I2IA 2LS6A 3WSOA 4DFSA 2OA2A 5C3OA 1S2BA 3POWA 2BOJA 2ARCA 2ZAHA 1AYM2 4PQQA 2VZPA 3KM5A 1QOSA 4WVMB 3I3EA 3U1XA 5IJRA 1ASJ3 2JWPA 4K7JA 4B4QA 5LCWL 5CFDC 2JX9A 1IPKA 4RHV1 1C5IA 3JBG3 3H1MA 3IDEA 4PLMA 1NCQC 3ZXLA 5L7OB 3ACGA 4AVSA 4ZPIA 4B8EA 1RUC3 4Q27A 3GBWA 5A3TA 4K40A 5GLTA 5DXDA 3ZXAC 5F7UA 3T1MA 2CAVA 2XR4A 4M3CE 4JQRA 5FZKA 4A6SA 1OVPA 4AWDA 2R16A 3HAGA 1OD5A 2RDRA 1TQ5A 2WZR3 4ATEA 3H1YA 3PHMA 2A6XA 1JOJA 2VXJA 2ZGQA 5KHHA 5KHGA 3BU0A 1NZIA 1NCRB 3E5UA 2A7AA 2GP3A 3QBQA 4XQWA 2LTNA 4CA9A 2XVGA 2EXJA 2JG9C 4QDRA 4YFZA 1XOYA 2VAUA 1G9CA 1K5MC 5HCHA 1C28A 1AR71 1WW5A 3OGVA 5ERLA 3KVBA 3MICA 2V5DA 3KT4A 1JYIA 1DGRA 1JXNA 1PX3A 3P5BA 5JIAA 5F3CA 1LHUA 3ZR6A 2VC9A 5JOWA 3VD7A 4AI8A 3IMMA 4LHNA 5DUXA 2BBVA 2EIGA 2JDHA 3NJYA 1DDLA 4WZFA 2DUOA 1RHI1 5A6XA 3WOGA 1UW8A 5I0DA 2UY8A 5CAZA 3TN91 1JHJA 5ANNA 2YFZA 1AYN3 4NAOA 3TNQA 3ROUA 4CUCA 1PVC1 4AEKA 2R041 1QMJA 3G7DA 1HW5A 1WGPA 2PHUA 5DG2A 3K4DA 4JGZB 4CP9B 3MUY1 1MS9A 3DCQA 4Q8KA 1CAVA 1VMJA 2QCSB 3AKQA 1NCQB 2CWMA 3GF6A 2PLV2 4QPIC 1TZOA 3U14A 5C3QA 4ATFA 2WA3A 3ACHA 2ERFA 2WNEA 3LB9A 1HXS1 2AYHA 1MS3A 3MW2A 3OYWA 5FO9B 2HWD1 4IEWA 4XHXA 2WNVA 3NNMA 2OXBA 3ATGA 4KH9A 4XCAA 4LORA 5BNOB 4XAEA 2G4IA 2QQVA 4MLOA 2BJSA 2FCVA 2B8MA 3PVOA 3HNMA 2Y6LA 3WLUA 3NAPC 3I2FA 1LOCA 1W6PB 3BB6A 5HCBA 1UNBA 1U12A 2JICA 3PIJA 3RJRA 4I2OA 1XB9A 2AUYA 4QKBA 4QPYA 1IPJA 3ZDSA 1D2SA 3E6CC 1O7FA 2DCKA 3MV01 3AZVA 2XBO3 2HEYF 2WJSA 1S0EA 1DGRN 3A0KA 1LECA 3H0OA 2W92A 1UOGA 3TEXA 5IK5A 4H14A 3EO6A 4J25A 2FDJA 1YJLA 2IC1A 2J1UA 4QDSA 3WDXA 1X8EA 1NLSA 2D40A 4HKLA 1ZRIA 3J9SA 3LFMA 3POEA 1G86A 3M3OA 4R4ZA 4Q4V1 5EHDA 1A8DA 1FI2A 1ULOA 4QXKA 4EV0A 1SLTA 2VTFA 3AZZA 2ZGNA 3C7OA 5FDBA 2IFRA 4FT8A 1F2NA 4PDWB 3ZXGA 3D82A 2GH8A 3ZYHA 2J1SA 4IXLA 1RUE3 2XQRA 4BXSV 3AKRA 2CL2A 1COV2 5FYMA 1CJDA 2HWB1 1EAH3 3WX5A 5LY1A 3LCPA 1L7QA 5DUVA 5BNPA 4ES9A 5FPXA 2YXSA 1ZYBA 4O7XA 4C91A 4QPIB 5FQ0A 1F9KA 4FXGB 3I3BA 1IS3A 4UFKA 4IE0A 4FPKA 4JHTA 2NMNA 4I0WB 3P1IA 4Z2AA 3WCRA 4ISQA 4BIOA 5ABJA 1KQRA 2CU5A 4XOGA 3VHOA 2LM3A 3WW3A 2WSUA 4MGYE 4YW6A 4IE6A 4I3PA 1LU2A 5GM0A 3FL7A 1QDOA 3NAPB 5GZFA 4NHMA 1VJ2A 3CF6E 4H7MA 1W8NA 4S2HA 1ASJ2 4AVAA 5FPBA 4BLJA 4A7KA 3JBG2 1YHFA 3JZVA 5HI0A 4UFIA 3MPBA 5FY9A 1SLAA 1H1MA 2Q8EA 3NKGA 3KCXA 5EV7A 4CPBD 5FO8B 1UY2A 3LSEA 1K12A 1RUC2 1DZRA 3K4ZA 4MADA 4DY3A 5FYUA 4LO7A 4FOQA 1Z7S3 4PLNA 1O4TA 3AYEA 2W87A 3F2ZA 4H3WA 4LLOA 5J1XA 2GDFA 2X5IC 1OLQA 4P9IA 3MFCA 4P9GA 4QPGA 2CAUA 3ZIWA 4XIOA 3T2QA 2WZR2 4UFHA 2BGOA 2H6CA 4JDMA 2ORZA 2BOIA 1DF0A 4JQTA 3H7YA 2YFUA 4PIXA 3ZO0B 3V65A 3C8XA 4FFFA 1H9WA 4ZZ5A 1HRI3 4XZUG 4AFCA 1E5HA 2ARBA 5FFOC 4XFBA 3AP5A 1F5JA 2QJVA 1NA1C 2Y8KA 2CV6A 4LK6A 2X09A 4QU1A 2WFF1 3SISA 5IVVA 4EN7B 2DVDA 1SPPA 1FXZA 5FZDA 4QAWA 1C8NA 4B1LA 2WUHA 4BQ2A 2XKPA 2R063 1ND2A 4GWJA 1LGCA 1Y9GA 1EYBA 2Q8OA 3VKLA 4P14A 3URFA 4QKNA 2MNGA 3MIHA 1XSRA 2RMU1 3V64A 4CDWB 1AYN2 1RUH3 2GALA 1ALYA 3GZEA 4N43B 3ZSKA 1RXGA 2ZA9A 5DAXA 4AHXA 2RDQA 1R1A3 5FXWA 5K0UC 4R4XA 1NAEA 1FMD3 1H6XA 1OT5A 2XLAA 3KCCA 5L9RA 2G9ZA 4MV2A 1ZRDA 1JHNA 3VBOC 2VOKA 2VZTA 3OGRA 5C8CA 1ZM1A 3MLKA 3MZHA 4OCTA 3WG1A 3B01A 4BMEA 3IDAA 3ENRA 3K3OA 4QU2A 3WG3A 2G19A 5T5PA 2J1VA 5FZ6A 1SHWB 3A23A 5JMCA 1LJ7A 4Q0PA 2RJ2A 1UX6A 3U78A 3R6SA 4LT5A 2X5IB 3PUIA 4WM8B 3SMHA 5JZGB 4M4PA 2RVAA 4RYDA 4XJUA 5KC6A 4BQ3A 5GLWA 4XTPA 3BUCA 4FBFA 1H8TA 4QX1A 1BVVA 3OD0A 5I0SA 1Q8PA 3CU7A 4E8CA 1ZZBA 3ZYJB 3RS6A 1H4GA 1UOFA 1H2KA 4P9JA 4M3CB 4BB3A 2VMCA 4N90A 3ZXKA 3EHKA 1NT0A 5A7QA 1RUD3 1OVSA 5JPNB 1UU4A 4AI1A 3CJIA 2XBO2 4DRVA 1SFYA 4XFGA 1FATA 4QKFA 3GALA 3I2HA 1UAIA 3S7EA 3TAYA 2UY9A 2WZ8A 4QQLA 3U75A 1CVNA 2DUPA 3HIFA 4YZ4A 2VMFA 4YFWA 2JENA 5FWEA 2QQOA 4ASKA 3LOBA 4YVSC 1W28A 2P3JA 4QX8A 3RI9A 3THTA 3W58A 4RS5C 1SCSA 4OHVA 1IOAA 1JZ3A 1ZBA3 3VKMA 4E8DA 5K0UB 1JI6A 1XNAA 1RUE2 1SFNA 4OVEA 5FMBA 3VBOB 1MQTB 2RM21 4S2DA 1MR5A 1ZBE3 3N7JA 1EP0A 5F5QA 1EAH2 1UPIA 1UY3A 5FYVA 1IPSA 3OBRA 2QZ3A 4M01A 5BXXA 3NJVA 2BFUS 5A3NA 3ZX7A 3BCWA 4UFJA 5I91A 4YG6A 1H2NA 1O8SA 2K46A 3GHMA 3WDYA 4DPNA 3V0BB 1UYXA 3OY8B 1DFQA 4XYXA 4H2AA 5C4WA 3QD6A 2C1FA 1LTEA 3BALA 1O8PA 2VOWA 1CWPA 1GUIA 2Q30A 4TXWA 1WCKA 4Q4Y1 1W8HA 5EQUA 5FJHA 4ASLA 4GQ7A 3KB5A 5FPLA 2E7TA 5FPAA 5IAXA 2VM9A 5FY1A 1Y3TA 1D7PM 3RZMA 1CAXA 5A7PA 2ZJCA 1JZ2A 2PN5A 3NQHA 4FP3A 1SLIA 3E5XA 3T08A 1WLWA 3VBHA 2BW8A 4GMP1 1BXHA 2VZUA 5DAPA 4HVQA 4NPRA 4EWEA 1ULDA 2VUDA 3PUSA 3LEMA 1K3IA 1GKBA 2P34A 5LBCA 1WCQA 1LOEA 4RHV3 3WP6A 1Z7S2 4BQ4A 4IE5A 2VO5A 4XZPA 3VBSB 2V4AA 4K1ZA 2BEOA 4L2NA 1LOGA 3ZYFA 4URAA 2ZGMA 2B5HA 5A7WA 1GBGA 2NM1A 3LKJA 2YYOA 1OMIA 4FSJA 1W3XA 1YIPA 1AR81 3K4AA 1X8MA 4YVSB 1BCXA 2WLPA 3LA7A 2DVFA 4QXCA 3IB3A 4AHYA 5KHIA 5F5AA 2RR13 4FFHA 4HBNA 1HRI2 1GOFA 3DKQA 1AF9A 4DMIA 3CLPA 1TMF1 4LBJA 1B09A 4WM7C 5HV4A 3AYAA 2WQZC 2EICA 3VZKA 1AYN1 3R4DB 4CUBA 4KWUA 5LK5A 1R64A 2Z2SB 3CKHA 3N7LA 4XHBA 5EPAA 3DV8A 3IPVA 5A3WA 4BXFA 2ET1A 3CQOA 3RWNA 1AR73 4ES8A 3GCXA 1KS5A 1RVF1 3ZM8A 2R062 2VW1A 3HWJA 1Q56A 3LSDA 4GKXA 2UWCA 4A3XA 4XJ8A 3LQCA 4Y20A 4YWAA 4RQPA 3ACFA 3ZFEA 3GYDA 3LAGA 1LR5A 4XQDA 1RUH2 1V9U1 1YC61 1YFYA 4LQRA 4XMIA 5DAQA 5CB7A 1RHI3 2XOMA 4LBQB 5FZ9A 1R1A2 5GJ6A 1LNSA 1OQ1A 3TN93 2W5FA 1GZWA 3MLJA 1R083 1W6OA 3M3IA 4IERA 1FMD2 4MZUA 5BYNA 4KG0A 1DU3D 1QJX2 2ZCWA 4HL0A 1W6MA 4LJHA 2XQXA 2VCAA 3O1TA 3OUHA 3K46A 3NO8A 5F3GA 2J1TA 4ZY9A 3ZN6A 2QKDA 1O91A 5FLIA 4A7ZA 5GLZA 5JLVA 2IWGB 4PBPA 3HJRA 1NXMA 5H9RA 3RDIA 3AJZA 3QLQA 4FPOB 4YVWA 5JMOA 1PGW2 3AZXA 1MVEA 2WQ4A 1SBDA 2MHFA 3KT1A 2GU9A 1DG6A 1ND3A 5CBLA 1PK6C 3NW4A 4CDQA 3AL6A 1XNKA 3KCYA 3INAA 3K3NA 4IEVA 3VBFB 2WAAA 4LHSA 4A45A 2W1UA 2VUCA 2VW2A 1S0FA 4G3YC 5DMYA 4CEWC 3G6JB 1WA6X 3RGBA 5F5IA 1QJEA 2EALA 1AX0A 4AFMA 4Z92B 4XF1A 1RITA 1BLZA 4X6QB 3N9PA 4C0HA 1RUD2 1IGOA 4QHZA 4AFDA 1F15A 4O61A 3FC0A 3SCHA 4EJRA 1YFWA 1W2TA 2Q0AA 3IZOA 3ST7A 2W46A 2JJ6A 3I59A 1QEXA 1UY4A 2O8QA 3E97A 3WW1A 1L7RA 4QQHA 5DN2A 1RUE1 1PIV3 4DRRA 1SQ4A 2FBEA 4JHZA 1VBA3 4PI0A 5CG8A 3N7MA 3PU3A 4FFIA 4PF5A 2VVEA 1VRH2 3QH6A 1C3HA 5E88A 5DUWA 3FMGA 3BOWA 3O5SA 1KD7A 1OLMA 3WV6A 2WRAA 2SBAA 2QVSB 1NG0A 4L9BA 3BTXA 1ZBA2 2JG8B 1CD3G 1GU3A 1RJ7A 4Q4V3 5IWFA 4OHYA 2IVIB 2ZOEB 4FOYA 4KBZA 4JCKA 3QCWA 3KF3A 4HVOA 2VMDA 2XKOA 2VBPA 4XURA 3VBUC 3WY6A 1ZBE2 1UY0A 3GM8A 3SH5A 1W8TA 1UO9A 2E51A 3EJKA 2WS93 4N53A 2HWB3 1WZXA 4KGGA 2W0XA 4LO8A 1JN2P 1JYNA 1OURA 4K3UA 3DL3A 3ZFGC 5L7OA 3FJSA 5IVBA 4LPLA 4AQ2A 4DQAA 3TEWA 2FDIA 5D8AC 4YM1A 4YG3A 1OKQA 1UCXA 1PK6B 1JOBA 5GKAC 4KNCA 2WWSA 1NY72 2GP5A 3SHRA 3J26N 3PMEA 2ADEA 5F5CA 4LOTA 3WNOA 2E6VA 1OUXA 2NN8A 2R7EB 2WNOA 3MW4A 3V56A 1CQ9A 1EPWA 2B39A 3AP7A 3DECA 2Y6HA 1C5HA 1VBD1 4I0AA 1UKRA 3RG0A 3L9JT 4RR3A 1MACA 5FZEA 1G9BA 4RHV2 3AYCA 1YQCA 2G9FA 2W2IA 4W50A 2EXHA 3HT1A 1IQDC 4ORFA 3VUOA 2RHPA 2ZEYA 5DDJ2 5FY8A 4MSVA 4YGEA 4LO4B 3GJBA 1V00A 2XWJB 3C7GA 1PGL1 3NNFA 3M70A 1LRHA 2RR12 1ZZ8A 3KF5A 1W9WA 1C4RA 4DUVA 1O3TA 3B69A 3W20A 2YG0A 3DPRC 2J7MA 3KQ4B 3THCA 1OH4A 1T2XA 2OQ7A 1W9SA 4ZU7A 4IEPA 4BM8A 1TVGA 3Q8AA 4B7EA 1RUH1 4P5YA 3U37A 2GMMA 2ENRA 1XPWA 2QDNA 4L99A 5L9VA 3I49A 1R1A1 1JZ5A 1AR72 4HANA 2ZMNA 4IV1C 3SEEA 1KFXL 4QHOA 1QJX1 2WFF3 1DGLA 4XVHA 1JMUB 1ZREA 2CGNA 4HN1A 3GZAA 4AZZA 1LHNA 2YDEA 1OOPA 2EA7A 5CFDA 3ZFGB 4CCJA 4COZA 2W08A 5D8AB 2VW0A 5DQ0A 3POFA 3WW2A 4QB2A 5SV5A 3R4UA 4RFRB 2C9AA 1RHI2 3SKVA 4CDXC 5LRSA 1XNDA 2RMU3 4LTAA 3VBRC 1R082 2Y0OA 4A2UA 1B35C 4ARYA 3AVRA 4IEOA 2GH2A 3T0BA 4ISRA 3B9IA 2B42B 2XJVA 2QQNA 3VDDC 5FV3A 3LEIA 4JAAA 5FLHA 3O1MA 3ILNA 2JG9A 4BQ5A 4AFAA 5M0TA 1QH7A 4UW5A 3VHNA 5FPZA 2R49A 3NKTA 3K51A 1K5MA 2AENA 5K7PA 4NIIA 1IHMA 1UQXA 4TYSA 4X8PA 2YU1A 4D7TA 2ARAA 1QNYA 2I74A 3OBZA 5C3SA 2WO7A 3B93A 3OEAA 3ZYGA 2ZABA 4JGYB 2XJTA 3NNLA 4XAAA 4U36A 2V72A 4D69A 1HV1A 1H2LA 3PUAA 3MGUA 4LBLA 1FOD1 1CESA 2HBTA 4O9GA 2Y0IA 1PGSA 3WDWA 4XF4A 5FOJB 1GOGA 2D6OX 2JIJA 3PUQA 4CDUC 1ENQA 4DXRA 5CFCA 1ULGA 2OUJA 1DHKB 1VRH1 2OPWA 2XL9A 5A3MA 5FZFA 5C3RA 3AP9A 4CEYA 4KWLA 4URTA 5LA1A 3KV6A 4NHXA 1ZBA1 2C9KA 3WP5A 2XUMA 2A3WA 3HD8B 4IV1B 5JSOA 3M8LA 4JTNA 3HR9A 1PIV2 5GLVA 1VBA2 4QGNA 2QQKA 5HXMA 4F8AA 2YPDA 3GJAA 3HNBM 4AXOA 3T2TA 4QX0A 1K5JA 1XSQA 3GXUA 3Q9OA 1M4WA 1OPMA 3VD5A 3WR0A 5BNNC 2DBIA 5FZOB 3TEYA 2UYBA 3BTAA 3H8OA 4S2FA 4MYEA 4CSWA 1POV1 4PCRA 4CDXB 5FMOS 1BYHA 5F6LB 2O1QA 1KJRA 3ES1A 4Q4V2 5FZ1A 4C0BA 2W1QA 4AQTA 3BU7A 3HQUA 2VD7A 4QQ2A 3VZMA 4BPZA 1BMV2 1EV12 3GZUC 1RUOA 1ZZ6A 5I8SA 4DXTA 2WS92 4Q0UA 2F4PA 2RM23 2C4XA 3EBRA 4Q4X2 4QB1A 2HWB2 3BN6A 2DWRA 2QQPA 5FRAA 4GULA 3ZYBA 3S57A 1F35A 2BNNA 3ZYIB 2DDUA 3HOBA 1JW6A 3PMSA 4JGZC 2BP6A 4MXWA 5H9QA 4LUMA 4L0PA 2ZMLA 1H2MA 4AI3A 3LD8A 1V70A 4LKSA 3KHCA 3IKWA 4MUVA 4BH9A 3D4KA 1L7LA 1ZA4A 3MFAA 5EJZB 1JTZX 2OX0A 1W6QA 2VVFA 3FN9A 3RQ0A 2B7YA 2E32A 1QHDA 3C2UA 4Q4Y3 5DDJ1 3AC0A 2OPKA 2VQUA 4CDUB 4N7UA 2VZ3A 2KA3A 5BPXA 5BNOC 4Q0SA 2ZGUA 5T52A 2CDPA 4YW3A 4EE2A 2RR11 3RSJA 3VHRA 4GMP3 1J83A 4QT6A 2GNDA 3UETA 4BLIA 4UAPA 1ST8A 4AI9A 3OD4A 3NNJA 1YYNA 1W39A 1D0GA 1U5YA 3LEGA 4ZXKA 2LALA 3WINE 3WNXA 4E4DX 2B9VA 4Q8LA 1VBE3 2E7QA 1EUTA 5CU1A 2JB4A 3UGGA 1LEDA 5GLUA 5BNNB 2FMYA 4LIVA 2E63A 1AR83 1GWLA 2D6PA 2VQAA 4F83A 2OW4A 1JZ6A 1UOJA 1LKNA 1YQ5A 1BVP1 4DINB 2W1WA 3TBDA 1JZ8A 3S5AA 4XPVA 2D6MA 2D6KA 1O5LA 4FOWA 3K2OA 1CJPA 4JV4A 5DG1A 4OZXA 1TMF3 5IFTA 3UT0A 5E16A 3USUB 1VB2A 1XNCA 2NYYA 4XMAA 2D7FA 4AHWA 1UZVA 5KR7A 1R081 2VZOA 1SLBA 2P2KA 3R05A 2YBSA 1OKOA 3ORJA 2WFF2 1V6OA 1R1ZA 4YM3A 4PDWC 5BUVA 5IVJA 3CNAA 4AEDB 1RVF3 5JI7A 1HJFA 4JX0A 4MGTA 2VBDA 2QQJA 4OHZA 2VU9A 4QM8A 1Y4WA 1G7YA 4PF1A 1O59A 3GBFA 1KDMA 1QJU2 2GNBA 3DYMA 4TWTA 5EYYA 2RMU2 3I7DA 1W9YA 2UU8A 1V9U3 3ZN5A 1WA4A 4KMQA 4CUAA 4PT6A 2KD7A 4I02A 5GALA 1SBEA 3KSCA 5IVYA 1GZ9A 3N7KA 1GICA 3FUQA 4K9SA 5FMCA 1N3OA 5TSWA 4AEJA 2P6CA 1CAWB 4KBBA 4DOUA 4XBQA 2PHWA 3FFZA 2XWBB 4Q1PA 3BOPA 4X6RB 2WO3A 5DZEA 4IL7A 4XW3A 1CZTA 2X10A 3KGLA 1GSLA 2FCUA 3JQWA 1HN0A 1NA1A 2EVXA 2J22A 4FP2A 2AC1A 3DF0A 4PBOA 3V0AA 2FDFA 1A78A 1HQNA 2WR9A 1RUF3 3PVEA 3PVNA 3ZFFA 3ZYPA 2GC2A 1PIV1 5FK8A 1H8VA 1I5ZA 1TG7A 3SCGA 3M1HA 1VBA1 5IVEA 3K75B 4PI2A 2PAMA 1HKDA 4RSUA 2QZ2A 5FXXA 1TME1 4BOWA 1HV0A 4P00B 4Z2WA 3ZXDA 1YI7A 1XU2A 4C1WA 5J98B 2V09A 3LPGA 3UGFA 5I0RA 5FZGA 4BQYA 4FFGA 3SQOA 1O3SA 3KV5A 1WUVA 3RMYA 1WD3A 3T09A 5LY2A 3HN3A 3ZLIA 1FPN1 1N1SA 2D5FA 3WDTA 4AVBA 2W3JA 5AVAA 4ONUA 3OGJA 5EYXA 1BMV1 1EV11 2E9QA 5FBZA 5LATA 5A80A 3B9CA 4QX5A 1NUKA 2WS91 5EZWA 3T2OA 5EXOA 2YPJA 4ZU5A 5FOBB 4NRPA 4Q4X1 4JC1A 4OQ9A 1TNFA 4ZHNA 1NLRA 1JH5A 2VVDA 2EF6A 5A3PA 1N1YA 1GP4A 3SEPA 4MVTA 2WN2A 1RGSA 1Z0HA 2RJLA 2HEWF 5LK7B 5FYBA 3UYJA 1LHOA 3K48A 1ZNPA 1DIWA 5E89A 2XJUA 2Z5WA 3FHIB 3HMYA 3IAPA 3KWVA 1W8OA 1WLTA 2ADDA 1ZVFA 2XG3A 4FI9A 1WMEA 4CDWC 3A0NA 1W0PA 4N43C 3N9MA 4QKDA 2RM22 1FT9A 3OUIA 5FYYA 3S7IA 2FDKA 1CZSA 2BVBA 1XE0A 4IV3A 3WEZA 4GKYA 1CIYA 1LULA 2ZTNA 1IG3A 4MGKE 3ZN4A 3R0RA 4MG2A 2LW8A 4GZ9A 3AK0A 3MF9A 2W39A 4TTGA 4CCLA 1DQ6A 2DUQA 3HQXA 2JEMA 1WLCA 2GNTA 1UMIA 3PJYA 4LA3A 3UJOA 4Q4Y2 5LB6A 2W47A 2PQSA 4TLFA 3IWZA 2VG9A 4XFFA 1H1IA 4GWNA 4WM8C 1GP5A 3E6DA 4MO3M 4YVSA 1Y9QA 5JZGC 3X29B 5GZGA 3AMHA 4MGIE 1YLLA 4RS5A 4UF0A 4Z8BA 5JXJA 4GWMA 3N4MA 3WP4A 3KT7A 4UW4A 3ABZA 4UW3A 2F4LA 1VBD3 4DS0A 4YM0A 5LBBA 2PXJA 4MXVA 1UL9A 1HB4A 1LU1A 3CL1A 3NV2A 1MZ5A 1NE4A 3P3NA 4UFMA 1AXKA 1VBE2 1QDCA 2IVJA 2R1DA 2E53A 4ZZ8A 2ZZJA 2WL1A 4DO0A 2HBUA 4YGBA 3NSTA 4NN0A 1AR82 5C6CA 1DQ5A 3J7NA 3MBWA 4Y4YA 4AI2A 3VZJA 3ZSJA 4M3CF 2ZGLA 3ASIA 1W2UA 3L2HA 5B4XA 1TMF2 4CP0A 1O4YA 1QJU1 3VN4A 4HLTA 1Q8VA 4YM2A 2D43A 3HEIA 5HV0A 1GNZA 1O3QA 5EWSA 1OI6A 1NE6A 1X50A 1BK0A 3LPFA 3NV1A 1RVF2 2R072 1TNRA 2QUOA 1PNGA 1KJLA 1QJX3 2JE7A 1AZDA 2UWAA 5LASA 2VCCA 2VZRA 4XF9A 1MQTC 3BTYA 2GN7A 4UXAA 2QQLA 2R1BA 3WXPA 1IS4A 5ACA3 1J1LA 1WLDA 2YC2A 3UK9A 3UNPA 2JD9A 3VZOA 3VLBB 2CGPA 2O14A 1V9U2 2P3IA 1H0BA 3FHAA 2HEVF 2DVBA 2Q1FA 3B02A 5DPNA 3O7OA 2WIIB 1HB2A 2Z42A 2ZEWA 3FFQA 3NJZA 4Y5Z0 4FAGA 4Q2FA 4HONA 4P9YA 3AMQA 1REEA 1VBC1 1H9PA 2AR6A 3SLIA 2PFWA 2RV9A 5C33A 1OA3A 4WM7A 4RGKA 2JDNA 4CCOA 2JDPA 4NIGA 1MZ6A 3HBZA 4AAPA 2BPA2 2ZX4A 4P9XA 1GMMA 2OQ6A 1CAVB 1VB4A 4XFHA 3FX3A 1RUF2 5BNPC 3LFIA 4L92A 5C71A 2YU2A 1GOHA 2ARXA 3RVHA 1BBT1 1OFNA 4FOVA 4GH4A 2PHFA 3OYWB 4HVRA 3VBSC 2WNVB 2BYVE 2QDRA 1FOD3 2OS2A 2VPVA 2V73A 3ILFA 5ABJC 1NXD1 1KEXA 1T6BX 3H8UA 4FCAA 1YUDA 2Y6JA 4GXLA 4LITA 3ELNA 4IGPA 3THPA 1VRH3 2A6YA 2VNVA 5CVRA 2OYZA 5K8SA 1MPXA 2D3PA 1W6NA 1XU1A 2XL7A 4CXYA 2VNGA 2DU1A 3MLLA 4FPLA 4LHKA 4HETA 1FV3A 1PNFA 1TE1B 1US3A 1RYYA 5FCCA 1FX5A 2ZACA 3UKVA 4ZKTB 1X82A 2VOXA 2X29A 5FP8A 3RWKX 5AC91 1OF3A 4A42A 1JZ7A 2G1MA 4PLOA 4CXXA 2ZGKA 2JDAA 5DABA 2HYXA 2VNOA 4FXKB 5BY5A 1HRV2 4FO9A 2VZVA 4AVTA 3C7HA 1S0IA 5F39A 3NNGA 2PTMA 4YW4A 1POV0 3D0JA 2RJKA 2IXKA 3OOXA 1H4HA 4Y1UA 3H3UA 4NIAA 1RUI2 5DUUA 1POV3 1YNAA 3FLTA 5LZ6A 1NYWA 3GZTB 4B3NA 1JUIA 4CCNA 2D97A 4E27A 2BERA 3POYA 4NOTA 1C8M1 5JR7B 1S0DA 1STMA 3LDRA 3Q8BA 1SLLA 4CRQA 5J36A 1JOPA 4CEWA 2DV9A 3KVAA 1YWKA 2EXKA 3O0XA 1WBLA 3OBTA 3D3AA 2ZGRA 1WW6A 3RPQA 4BISA 4ET7A 1VMHA 1RUG1 1DZTA 2IZWA 1SEFA 2VNRA 3C7EA 1UIKA 2ZXQA 5T5LA 1AX2A 3M2MA 4FTEA 2N7GA 5IUQA 5BNPB 2P4EA 4B4PA 5FQ0B 2Q8DA 3RMXA 1PM7A 2ZMKA 4EWDA 1UYZA 2EAAA 2UURA 4JKLA 4IW3A 3JB8A 3C3VA 1VBE1 2I07B 2ZEXA 2P3KA 3IIIA 4AEMA 2JECA 4Y26A 4D6SA 4JTOA 4QQOA 5DDJ3 4KQ7A 5ABJB 5ISLA 4OYUA 5F9TA 1IKQA 3O1OA 3AKTA 2ID4A 2WNUA 3VBFC 4E9KA 5IK4A 1D2QA 1VBD2 4FPEA 1DP0A 4XFIA 5JOYA 4FPGA 4K21A 1G9DA 3AMPA 3LWCA 1AUYA 3A21A 3IT8A 1VP6A 1OA2A 2B4KA 3IN9A 4HPKA 4P02B 3VBUA 5C8CC 5CG9A 4RL7A 1OUSA 5IYYA 4XUPA 5FZ8A 2HWE2 1UN1A 3EB7A 1PM4A 4HT1T 2OIIA 4UI9L 3NVCA 3EQEA 4XUTA 5FMDA 2VOVA 2VQTA 1US2A 2R071 4OUMA 4PQ9A 4YRDA 1CAUA 1PGL2 1VE0A 1J59A 3BKZA 1ZZCA 1S1AA 1W99A 4Q0VA 1WCSA 4QPGB 3T3YA 5GZDA 5FYZA 1V6IA 1NLQA 4EWAA 4COVA 2WA4A 3IAQA 1W90A 2ZAAA 1H8TC 2XDVA 4YW5A 1JBCA 2JG8C 4AVVA 3ETPA 2OZJA 4ZU4A 4EZ4A 5FTTC 1JZ4A 3D6EA 2VCMA 5A6YA 3AX4A 4YG0A 2P3YA 2QE3A 4D6QA 3GHNA 2GAUA 3MIDA 3WF0A 2VJXA 3LDKA 1QNWA 4GWIA 5ACA2 5T3NA 3RRDA 5A32A 1OLME 1SPPB 3HN1A 3A7QA 4AYUA 3BGAA 1CX1A 4XDPA 1YCIA 2D6LX 1ND2B 1Q43A 1ZX5A 2YBKA 3WQ1A 3U07A 3CZJA 4AW7A 5T54A 2EIDA 2H0BA 3I2KA 4J6GA 5C7GA 5I8TA 5LEKA 4LOSA 2NQYA 4I09A 1RUF1 4XCBA 2JD4A 3A22A 4JKKA 1MS1A 3WD5A 5KXCA 3ZSEA 1W8FA 2JDUA 5LEJA 3MUZ1 1CGPA 5LA9A 1BKZA 1REFA 3DPRA 2JDYA 5H9PA 5T5OA 4UWDA 2J1EA 2XVLA 3T2PA 4YYOA 2O8OA 3ZIXA 1O4ZA 4KGQA 1DGWX 3RFRA 1W2NA 5C8CB 1HQLA 1UU5A 3IDCB 3KMHA 2DCTA 4I30A 4JRLA 1S55A 3O12A 5A33A 1KXGA 2P6HA 2Y33A 3OTFA 3MIBA 3SITA 5BV6A 1W2OA 1WCDJ 2DCYA 4XILA 1G9FA 1NQDA 1APNA 2ZX2A 3JXSA 3T1LA 4DEQA 5CISA 2VY0A 2EIBA 1YXWA 4WVWA 1JYVA 4NPMA 1FOD2 1T6GC 1LOFC 4BIFA 3LGRA 2J42A 1N3QA 4DY5A 3TEZA 2X53S 2Y26A 1A8MA 1HLCA 1HRV1 1VAVA 2C0ZA 4LEJA 5LA2A 3O1SA 4CU6A 4XFAA 1TME3 3GCWA 1UZ0A 1X9PA 4M0NA 4KU7A 1OHFA 4BHPA 1H8TB 3VBRA 1RUI1 1PHMA 2DFCA 1B35A 4PIYA 5HBAA 4BE3A 2HJIA 5FAXA 4HG6B 2ZX3A 4D8MA 4CCEA 3VDDA 3VBHC 4Y22A 3ZMOA 4B29A 2OT7A 2WZEA 1FPN3 2ZEZA 3E5QA 3CJIB 1OQEA 2Z69A 3PU8A 2ZBJA 1EV13 1GANA 2QQMA 3OB8A 4Y4RA 5SV8A 3SC7X 1PO11 3DN7A 4CCMA 5I8YA 4Q4X3 4R9DA 3DUIA 5DZFA 3ZXEA 3AB0A 4DUWA 4WVMA 1OD3A 2GC0A 4NO4A 5GZEA 4RGAA 3UJQA 2W52A 1QY4A 1UXXX 2ZGPA 4P9LA 4E2SA 2MPFA 2IXCA 1KGYA 1SDWA 3OJBA 1DYKA 1UIJA 1S4CA 1UOBA 2NPIA 1BQPA 3AZWA 2DVGA 4Z82A 3VD4A 5IVCA 3WDVA 1V0AA 2PHLA 4MGQA 2RS31 2XLFA 4NRMA 4Q4W3 3VD9A 2ZHMA 3PTYA 4FPJA 1VLNA 1ZRRA 3JD71 3DYOA 2QNKA 3CJXA 4CU7A 3MV11 5LBFA 4CZSA 1NCRA 3OCPA 4NIDA 2RG4A 5CNAA 1WCUA 5H9SA 1QH6A 4L11A 3GBGA 2KM2A 1W03A 3FWEA 5CEHA 3NL1A 4XEZA 3B5LB 4RQPC 3ZFEC 5C70A 2VZ1A 2HWE1 5C4WB 5J7MA 4OHXA 1XJAA 4JGYC 4TSVA 1Q5OA 3N9LA 3BI3A 4QD2A 2R30A 2XH6A 2E26A 4V2WA 1AXZA 3WZ1A 3OSDA 5K9YA 3VV1A 1DLLA 1BJQA 3N35A 1EUUA 3PIGA 1D4M1 4KL1A 4YZ3A 5IK8A 1CAXB 3BVCA 3SNMA 2H0VA 1G9AA 2D93A 4HOOA 3VBHB 1PO21 4IEQA 3VKOA 4XABA 3T4VA 4AAXA 3CMGA 4QGMA 5FYTA 1VBB1 3RI8A 2VZSA 3TOJA 3KD4A 1MEC1 2PMWB 1CN1A 2ZGTA 3J7LA 3I2DA 3WQ0A 5A1AA 4YGDA 4JGZA 2Y38A 5FR3A 4QB6A 4CP9A 5CKMA 4DXSA 3F95A 1W0OA 5F3EA 2HLEA 1Q8OA 3DYPA 5A7WB 4CDQC 5ACA1 4DXZA 5A7OA 2RDNA 3FZ3A 5FYIA 1NCQA 5FPUA 2JDMA 3AZYA 4J1WA 2NMOA 1MVQA 1OBNA 3APBA 3KS7A 2NP0A 1BEV3 1QJU3 2D6NA 3ETQA 4K8FA 3ZMNA 2VMHA 2BBAA 2XJSA 4H55A 2BNMA 3RYRA 4FVVA 4Z07A 2RS11 5DZGA 5BNOA 5IW0A 3DGTA 5JIUA 1N1TA 1QKQA 2JKBA 4GALA 1WMFA 1AR91 2QFEA 1AJOA 4HKWA 3IPVB 4GAZA 4IEYA 1VAKA 1JODA 4A3ZA 1OH3A 3POJA 1V6LA 1QJZA 4BQWA 1W6PA 4HK8A 3TB0A 2FD8A 2J1AA 1L3JA 3AXEA 4MOAA 2A3YA 2Y6FA 4QMAA 4Y20B 5FK7A 4RQPB 1LESA 1LOAA 5FUIA 4YVWB 3ZFEB 2XPJA 5A7NA 2XONA 4CVUA 4RD7A 4OI4A 4F3JA 3OG2A 3WW4A 4COWA 3OF1A 3W5MA 2A3XA 2P1BA 2I2SA 2B46X 3T0AA 1GZWB 5IT6A 1W6OB 1GWMA 2D3SA 1KRIA 1GLHA 5F32A 3ZPOA 1W6MB 3QOPA 4G9SB 1Q3EA 2WT1A 2ZZQA 1VBC3 4OZOA 3ZN6B 1DQ0A 1HJGA 2TEPA 1C1FA 4DUXA 1WD4A 1NOVA 1I6XA 1UU6A 4NRQA 1AL0G 3ZYRA 2QBXA 2EIEA 4BDVB 1W04A 5F2WA 2X05A 1VR3A 4LO6B 3MF6A 4MHUA 2BV4A 4PDWA 4RN5A 4Y1YA 2WABA 1UMHA 2WINB 3J7MA 3PJQA 5D1IA 3KV4A 4OULA 3AVSA 2WBKA 1BBT3 4C1XA 3E1F1 4YSFA 3AJYA 3K77A 2HWF2 4R52A 1ND3B 3RZGA 2XUEA 4A41A 1RUNA 4CDQB 3FBYA 1TME2 4D0QA 1S2EA 3RJ2X 5APAA 4CCCA 3AFGA 5AFEA 4QPIA 3Q8EA 1X9TA 5F8PA 1SACA 1A6CA 2V5YA 3AYDA 1UF2C 3W9AA 4IEZA 4AFBA 3KQRA 1FPN2 4RR3C 3UL2A 5I93A 2BNOA 2WO2A 2XB6C 1QXPA 3I59B 1Q8SA 5AC93 4CU8A 3NAPA 1QXRA 5A6QA 4UBGA 2L9LA 2K2SA 3OPWA 2DBNA 1YQ6A 2RDSA 4AEDC 4M4RA 2VL4A 4IETA 2RS51 5FP3A 4W8JA 3PVBB 3MPPG 4AR2A 1FYUA 3WHTA 3ZPYA 1I3HA 4NE9A 4OHWA 1FAYA 2BWAA 5J96B 3CDZB 3JCIA 2BGCA 5FZBA 2W94A 1U5IA 3ES4A 4R9AA 1ENRA 1C8M3 4B4RA 3S0MA 1V6JA 5FP7A 2FCTA 1JU3A 2CSGA 4Q4W2 5GZCA 2MEV1 3I2OA 1S2KA 5JDBA 4OMDA 4KWKA 5FYCA 3TYJA 2CWSA 1RINA 1DQ4A 1RUG3 4GMP0 4IDZA 1Y7BA 4XJAA 1REDA 2CNAA 2VUAA 2A73B 4N53B 4ARXA 5KC5A 3O0VA 5FBJA 4N8MA 1OOPC 4N9IA 5DAWA 2A71A 3BTZA 5FO7B 2Y64A 2B45X 4UYBA 1QQP1 2TUNA 3H50A 3P3PA 2YC4A 1V6NA 3PL0A 4K8RB 5CA6A 1PVXA 1SLCA 4L97A 1F8VA 2WFPA 2ILMA 2XJQA 1DLCA 2C24A 3DXUA 4SLIA 3ZXFA 4AG4A 5HCFA 1E5IA 2UWBA 3IBMA 3N3HA 2W91A 5EFUA 4X8NA 1UX7A 1F4HA 2TBVA 2FQPA 4WVZA 1QU0A 1I5PA 1WWYA 4E4HA 4CDWA 1QJY2 3A4UA 3I97A 2WSVA 4N43A 4QQPA 4RR3B 2WZPP 2PHXA 1UY1A 3H3ZA 3PTRB 5FKBA 1E5RA 1A34A 2DYCA 3Q8CA 1XC6A 4JDNA 4LKFA 5FP4A 4AOCA 1SCRA 2HKXA 1VPHA 2VTXA 3PURA 4META 5JSRA 1QF3A 4YZ1A 2DTYA 2R073 3JUUA 5I0TA 1O3RA 2D44A 4RA0A 2Y34A 5C3PA 3J4UH 1EY2A 3NWKA 4LBNA 3WNNA 3MIGA 2AREA 3L2YA 3WUDA 3O0WA 4DNYA 1BEV2 1XYOA 3IDBB 5CFCC 5FZ7A 1DYPA 1M06G 1XXNA 2ES3A 4QM9A 2X5IA 4WM8A 4BU2A 4YZ5A 4MGSA 1DZQA 5FZ3A 3SH3A 4CEYC 5JZGA 1K42A 5FZ4A 5KHJA 1SFPA 3UGHA 1XBFA 4JVAA 4XFCA 4R9CA 5FZ0A 1ONAA 1U0AA 3ECQA 5CKNA 1W8UA 1YIFA 2VBBA 4GB31 3DEMA 5BNQA 2VR4A 1OOPB 4IESA 4M3CA 3ZOIA 5ANQA 2ZHNA 1HB1A 4IGQA 1RXFA 1IS6A 1GZCA 5CFDB 5A6ZA 1NQJA 1R091 4XIKA 1HB3A 5FY0A 1RL3A 2A6VA 2YB7A 2OVUA 3LIGA 4LHLA 4KU8A 3THDA 2DTWA 3OGSA 2FZ1A 2AACA 2ZKLA 4FPHA 4LBQD 5KXDA 2ORXA 2CHHA 1X7NA 1UYYA 5T50A 2HWF1 3CEWA 4I01A 4IE4A 5FP9A 4EN8B 2Q1ZB 3HBKA 4YPJA 1VBC2 3RZLA 4NROA 1YO8A 4BCUA 1TEIA 4XXAA 4D7SA 1MS8A 4BJ0A 3I2GA 1UKGA 3ZKYA 4LBOA 2JG9B 5FZAA 5FY4A 5K0UA 4BQ1A 1F31A 2QQWA 1K5MB 1LENA 5CZKA 5FPVA 2H6BA 4DIQA 2PAKA 1VMFA 1BBT2 2HWC1 3VBOA 3WNKA 1MQTA 1W3VA 2GC3A 2B9UA 1J58A 1RUJ2 3MIEA 5JPMB 3LA3A 1RJ8A 1SBFA 2YMZA 3E6BA 3I4IA 5JOZA 1HRV3 5AFBA 1RMU1 1WBFA 4NHYA 5C5TA 3IIAA 4FAHA 2BTVC 3SH4A 5CFCB 5K4LA 1AL23 3V0BA 3ITQA 3ALQA 4O65A 3OY8A 1GQGA 1RUI3 1XRUA 2DF7A 4LA2A 1S0CA 4CEYB 1KFUL 4P9WA 1UZWA 5AC92 4TLGA 4Q4W1 2R0FA 4ZONA 1AR61 1QJFA 3MI8A 2AEZA 3SCFA 3B3QE 1PO13 1SDDB 4PIZA 2TNFA 1W8ZA 1IQAA 1PZ7A 4JKMA 3O1VA 1VAMA 1YFUA 1XE7A 1HIXA 4AGGA 4AGRA 4ASMB 2CGOA 1UWWA 2WO1A 1S0BA 1GR3A 2WT2A 1J3PA 1AYM1 5JXGA 4YLZA 2IXLA 4Y1XA 4WBBA 1QOTA 3POGA 5IAVA 2C5DA 1C8M2 4HKOA 3JU9A 1ACCA 3VBSA 4XF0A 4W6XA 1NKGA 5B4NA 4QXBA 5JWPA 2BFUL 3FUOA 1ULCA 5I0UA 2E33A 4UW6A 3WHUA 3LZZA 4MX3A 5FYSA 4CCKA 2DU0A 1JUHA 2RS33 1RUG2 5F3IA 3TNPB 1CPNA 5F6KA 2WT0A 1J1TA 3JD73 1D0HA 2VMEA 4AHZA 2ZGOA 1CX4A 3HNYM 4Q1RA 4COUA 1GQHA 2P5BA 1G8WA 3FBMA 1Y43B 3JB4C 4MXWB 3VD3A 3M3CA 2O0OA 4GJYA 5L19A 1QJY1 3B7MA 1WW7A 2GN3A 4TN7A 1N1VA 2R6QA 2JDKA 2K0GA 1AHSA 3U11A 4Q26A 1URXA 2HWE3 3GGLA 1W6QB 5JOXA 4XUNA 4JRAA 5LA0A 3CBNA 3AFKA 2YZ4A 4FTBA 2WNVC 4LKEA 4OI2A 2YC0A 3WNLA 3BODA 1U5ZA 4LBMA 1ZA7A 1D4M3 4EYUA 1MZFA 4WV8A 1Y9MA 1JYCA 5FJKA 4IUGA 1BEV1 3AL5A 4LBQA 4OQ8A 1PO23 2XVKA 3AMNA 1S0GA 1YJKA 3LEKA 1VIWB 5LW9A 3AKSA 1VBB3 2WYSA 3HT2A 5A1LA 4D3WA 1MEC3 1N47A 4O9EA 2GC1A 4OLLA 3ACIA 3D0SA 4YW1A 3ZFFC 2AH2A 1DCSA 2W9XA 4FTSA 2D98A 4C8DA 4QGLA 5FKCA 3VL8A 4A6OA 3J8F3 4CYDA 1JYWA 1NZCA 2WWUA 4XE9A 3RYKA 4GIQA 1FV2A 5C9AA 3PUHA 4CP2A 5J48A 1LEMA 2PLV1 2VGDA 1DQ2A 5JAXA 2RS13 1J3QA 3VKFC 5FXZA 3VBFA 1Z78A 5FY5A 5FZIA 4NWWA 4E4SA 1AR93 3N9OA 3LOIA 3VDAA 1MS4A 3R4SA 5HCAA 2BUKA 2IFWA 3WG2A 4CXWA 3NRUA 1K45A 1S0JA 5CYYA 3RZHA 4GA9A 3AP4A 3GDBA 3UV9A 1BHGA 3UESA 4AK3A 4JZRA 5JVVA 5FY7A 1UD1A 2XHNA 3C7FA 1G6NA 4INDA 5CIRA 4OUSA 2LROA 2WWJA 4SBVA 1D4VB 3I8TA 4XACA 1RUJ1 4XQ4A 4YGCA 5A3OA 2PHRA 2VOTA 4Y1ZA 5JR2A 2VXRA 2VH9A 2WDBA 5D2AA 1V6KA 2EAKA 3ZXJA 3W5NA 1YQ8A 2R0HA 4IV3C 3BIWE 2JG8A 4LXLA 4NUBA 3WF4A 5FXVA 1OC1A 5LWBA 1NA1B 1LOBA 2VQ0A 3I3QA 4Y24A 1VRBA 3EXUA 3V0AB 5EP9A 1YEWA 2I45A 1KDKA 3SKJE 3WNPA 2VTXJ 3ZFFB 1AJKA 2Z4FA 1POQA 4EN6B 4XC9A 2OUHA 2C6SA 3J7HA 3H7JA 3RZJA 1COV1 2OZ6A 1JYXA 4U2AA 3VKNA 3KV9A 1AL22 2Q8CA 4CU9A 4E2QA 2RE9A 4J1XA 1SMVA 1JYTA 2PELA 4QPGC 3O1PA 2KXLA 1PK6A 4HFSA 4CPBA 2K9ZA 1FNYA 3NMBA 4I0BA 2WC2A 1W8WA 4Z1VA 3WNMA 5L36A 1LHVA 5EJ1B 3OUJA 4Y1VA 4LUKA 1IZ3A 1RB8G 3VZLA 4AQ6A 1PO12 2VECA 1GP6A 3T0DA 2A5ZA 1ULPA 4W65A 2JXAA 4XXPA 1XE8A 2G9GA 2JE8A 3IMNA 5KXBA 2NLRA 4A44A 3WF3A 4A7YA 3AP6A 2RS53 5F37A 1RIRA 2ZKNA 3H3LA 4QX2A 3VB9A 3WDUA 1BZWA 1ASJ1 5EJ3A 3ILRA 1ND2C 3NV4A 3MW3A 2JB8A 1U5XA 3JBG1 5A3LA 1ODMA 4Q29A 1FNZA 1LOFA 5J37A 4XBLA 1LHWA 1ENSA 2V4VA 2YGMA 1C57A 1Q8QA 2XJRA 1RUC1 4XF3A 3N9QA 1PZ9A 2W68A 2BGPA 2RS32 2MEV3 2OKXA 3WT3A 5JUVA 4CCDA 3HQRA 4M00A 3EMRA 3JD72 4PHZA 4V1PA 5J3UA 3H1WA 3B94A 4IV3B 1KS4A 4EN9B 2WZR1 5FWJA 2IXHA 1UYPA 2ZX0A 3FLPA 4L8QA 1OXCA 2FDHA 4LE3A 4UBHA 5HXVA 3KGZA 1OQDA 4KWJA 1CIWA 5G04L 1QQP3 3QACA 4GJZA 1ENXA 1XQNA 3IM0A 3MEPA 4BK5A 1UMZA 1UZYA 1ZZ7A 2CYFA 2XGXA 3I54A 4HSJA 1LODA 1PMHX 1W0NA 2A1XA 5CADA 3FE5A 4IEUA 5A70A 5FZMA 3ZFGA 4K6BA 1D4M2 2E7AA 5LRRA 5D8AA 4MH0E 4RS5B 2VULA 3U10A 4UF0B 4NMIA 4Y5SA 5C5UA 2BQPA 1MS0A 3NV3A 2A6ZA 1YQ2A 2R32A 2BU9A 1PO22 2XMLA 3OEBA 1OLRA 4FQ4A 5T5JA 1QXJA 4AI0A 4GD4A 1F5FA 4M0HA 1KITA 1VBB2 4XDOA 4AGVA 3KZ4C 2C26A 2PA7A 3MDPA 1AVBA 1MEC2 3MIFA 3W59A 2AEYA 3GNEA 4HK9A 1J3RA 1X36A 4I3GA 4S2GA 4IQPA 3CJIC 4BZ4A 3WG4A 3LF7A 2ZGSA 3USSA 4GH4C 3EYPA 2DVAA 2PHTA 3J8F2 3OPZA 2HH9A 4YNIA 1ZRCA 4Q0QA 3AMMA 5FUPA 3RZKA 3SXWA 4JGYA 2KR2A 2QTWB 4NHLA 3WP3A 1OFSA 4YARA 2RS12 2UYAA 1F4AA 3OPTA 4LE4A 4XUQA 1PMJX 1LAJA 1CZVA 3POIA 4UFLA 4YZ2A 1AR92 2AGSA 4OFGA 1PVC3
chains in the Genus database with same CATH topology
2ETEA 2JE9A 2Q5TA 2R043 4K1YA 5L73A 1CPMA 5KBFA 4GB33 3M7AA 1X33A 1MZEA 1CR7A 4LO5B 1R093 4IV1A 3D5OA 2DURA 2JDZA 4K20A 3VL9A 2ZS6B 1HXS3 4RFT0 2XBO1 2HWD3 4XDQA 5J09A 1HDKA 4MGZE 5C4WC 4LBKA 2HWF3 1ZRFA 1AXYA 2XJPA 3PLQA 3FLRA 4FPYA 1LB2A 1A3KA 3ME2A 3D8CA 4CDXA 4XJWA 1AL21 1N3PA 5C9AC 4D94A 1QGLA 3DKWA 3LA2A 4PJYA 2YROA 4WM7B 5T55A 2IXIA 1UPSA 3UKNA 4XTMA 4QHBA 3VHPA 4HZFA 1ULFA 2WKKA 4D7YA 2HWC3 3POSA 1GNHA 2Z79A 2XHKA 2P17A 3PNAA 1OA4A 3TRSB 4GH4B 1BK1A 5E1RA 1EAH1 2PHDA 3AM2A 1V6MA 2CTVA 4FPFA 4XETA 1RMU3 1LGBA 2SLIA 3JQXA 3TWIA 5JSPA 2WNUC 2YY1A 4N9HA 1HX6A 1W6NB 3ZSLA 5KWRA 1YRZA 3B00A 4BYYA 4COYA 1PZ8A 4CDUA 1OPOA 5FMOL 1AR63 1XYPA 4WZCA 2RS52 2D3RA 2PAEA 4C90A 4DB5A 2ET7A 1IKPA 1AYM3 3ACLA 4XBNA 2P37A 4ITCA 4KG8A 4EROA 5IK7A 3AKPA 4LR4A 3UKTA 3QH7A 1YFXA 1Z7S1 2WLQA 3N36A 4WVVA 4TZDA 2MEV2 4LNVA 1E57A 5BNNA 4OI0A 1WMDA 2ATFA 4E2GA 4CEWB 1CONA 5C9AB 2NZ9A 2ZHKA 3O14A 2BVVA 2GNMA 4CP1A 4AVCA 2AZ5A 3S6PA 3ZSMA 1MS5A 2DCZA 3WQ7A 1HRI1 2VMGA 2DFBA 3USUA 1I1EA 5KXEA 1OSGA 4B7KA 1QJY3 4AE2A 1QQP2 3VZNA 4FQZA 1LCLA 4YVWC 3S30A 4AEDA 2CY6A 1C1LA 1WW4A 2XLGA 1ZZ9A 2FZ2A 4YW2A 5FREA 2IXJA 1ND3C 2PYTA 2BWCA 1XYNA 2R061 3J8F1 4DZGA 1H30A 2WNUB 1VALA 3KLSA 2A6WA 1EPZA 1YI9A 4BA6A 5JI9A 2GSYA 4HPKB 4R8HA 3RYPA 2YHJA 3MYXA 3VBUB 3AXDA 1CAWA 1FMD1 2ZX1A 4G4FA 1GV9A 3H9AA 4BWOA 2YUEA 4W6YA 4IEXA 1CAUB 1O5UA 2YV8A 4FPCA 3ZVXA 4EN0A 5F1RA 2VMIA 2ZPXA 1ULEA 4E4ZA 2PLV3 1PGW1 2LUWA 3TN92 2FMDA 2VUJA 5KHKA 4NWVA 4XJ9A 1H1AA 1UZZA 2Q1MA 1PVC2 1RTVA 2D5HA 2R042 3M3QA 4GB32 3M4FA 4H7LA 3RZZA 5A32B 1DBNA 2A70A 4LLFA 4NVPA 4CTEA 1R092 1XNBA 4N53C 4HMZA 4NHKA 1HQWA 1RUD1 5AVPA 4R9BA 1HXS2 2YGLA 3WVJA 2HWD2 5L7OC 3U0ZA 3M3EA 4XJZA 1DGWA 5B2GB 3OGGA 3WUCA 1RUJ3 1QWRA 2GMEA 4OI1A 3DPRB 2FHRA 4AF9A 5FLJA 5JCTA 2F6BA 3U4XA 2Q4SA 1GYKA 1AX1A 1LGNA 1DQ1A 2PQQA 2DCJA 1NCRC 2ZHLA 5E8AA 5A33B 2GMPA 2HWC2 3CO2A 4AQSA 4P5HA 4NR1A 4RGGA 1IS5A 1PMIA 2A75A 3BPZA 1ZBE1 4HN0A 4N7IA 1RMU2 1GFF2 1COV3 4F7ZA 4JDOA 4W6WA 4BMBA 1QOOA 1RC6A 3VBRB 5C8WA 1B35B 4LULA 4HSLA 2HYKA 3VGIA 2X8KA 3VDDB 4Y22B 1I9RA 2EXIA 3RNSA 1NY71 1AR62 3WCSA 2GZWA 4DFSA 2OA2A 1S2BA 3POWA 2ZAHA 1AYM2 3KM5A 1QOSA 4WVMB 1ASJ3 4K7JA 4B4QA 5CFDC 2JX9A 1IPKA 4RHV1 1C5IA 3JBG3 3H1MA 3IDEA 4PLMA 1NCQC 3ZXLA 5L7OB 4AVSA 4B8EA 1RUC3 4Q27A 3GBWA 4K40A 5GLTA 5DXDA 3ZXAC 3T1MA 2CAVA 4M3CE 4JQRA 4AWDA 2R16A 3HAGA 1OD5A 1TQ5A 2WZR3 4ATEA 3H1YA 3PHMA 2A6XA 1JOJA 5KHGA 2ZGQA 5KHHA 1NCRB 3E5UA 2A7AA 3QBQA 4XQWA 2LTNA 2XVGA 2EXJA 2JG9C 4YFZA 1G9CA 1K5MC 1C28A 1AR71 1WW5A 3MICA 3KT4A 1DGRA 1JXNA 5JIAA 1LHUA 5JOWA 4AI8A 4LHNA 5DUXA 2BBVA 2EIGA 1DDLA 4WZFA 2DUOA 1RHI1 3WOGA 1UW8A 2UY8A 5CAZA 3TN91 1AYN3 3TNQA 3ROUA 1PVC1 4AEKA 2R041 1QMJA 3G7DA 1HW5A 1WGPA 2PHUA 5DG2A 4JGZB 1MS9A 4Q8KA 1CAVA 2QCSB 3AKQA 1NCQB 2CWMA 3GF6A 2PLV2 4QPIC 4ATFA 2WA3A 3LB9A 2ERFA 2WNEA 1HXS1 2AYHA 1MS3A 3MW2A 3OYWA 5FO9B 2HWD1 4IEWA 4XHXA 2WNVA 3ATGA 4KH9A 5BNOB 2G4IA 4MLOA 2B8MA 3PVOA 3WLUA 3NAPC 1LOCA 1W6PB 3BB6A 5HCBA 1U12A 2JICA 3RJRA 4I2OA 2AUYA 4QPYA 1IPJA 1D2SA 3E6CC 1O7FA 2DCKA 3AZVA 2XBO3 2HEYF 2WJSA 1S0EA 1DGRN 3A0KA 1LECA 3H0OA 5IK5A 4H14A 3EO6A 1YJLA 2IC1A 3WDXA 1X8EA 1NLSA 2D40A 4HKLA 3J9SA 1G86A 3M3OA 4R4ZA 4Q4V1 1A8DA 1FI2A 4EV0A 4QXKA 1SLTA 3AZZA 5FDBA 2ZGNA 2IFRA 4FT8A 1F2NA 4PDWB 3ZXGA 3D82A 2GH8A 4IXLA 1RUE3 3AKRA 2CL2A 1COV2 1CJDA 2HWB1 1EAH3 3WX5A 3LCPA 5DUVA 5BNPA 4ES9A 5FPXA 2YXSA 1ZYBA 4C91A 5FQ0A 4QPIB 1F9KA 4FXGB 1IS3A 4FPKA 2NMNA 4I0WB 3WCRA 4ISQA 4BIOA 5ABJA 1KQRA 4XOGA 3VHOA 2LM3A 3WW3A 2WSUA 4MGYE 4I3PA 1LU2A 5GM0A 3NAPB 1QDOA 5GZFA 4NHMA 1VJ2A 3CF6E 4H7MA 4S2HA 1ASJ2 4AVAA 4BLJA 4A7KA 3JBG2 1YHFA 3JZVA 5HI0A 3MPBA 1SLAA 1H1MA 3NKGA 3KCXA 5EV7A 5FO8B 4DY3A 3LSEA 1RUC2 1DZRA 4LO7A 4FOQA 1Z7S3 4PLNA 1O4TA 3AYEA 4LLOA 4H3WA 2GDFA 2X5IC 1OLQA 4P9IA 3MFCA 4P9GA 4QPGA 2CAUA 3ZIWA 4XIOA 2WZR2 2H6CA 4JDMA 1DF0A 3H7YA 4PIXA 3ZO0B 3V65A 1H9WA 1HRI3 4AFCA 5FFOC 2ARBA 4XFBA 3AP5A 1F5JA 2QJVA 1NA1C 2CV6A 2WFF1 3SISA 4EN7B 2DVDA 1FXZA 1C8NA 2XKPA 2R063 1ND2A 1LGCA 1EYBA 2Q8OA 3VKLA 4P14A 3URFA 2MNGA 3MIHA 2RMU1 3V64A 4CDWB 1AYN2 1RUH3 2GALA 1ALYA 4N43B 3ZSKA 2ZA9A 4AHXA 1R1A3 5K0UC 4R4XA 1FMD3 2XLAA 3KCCA 4MV2A 1ZRDA 1JHNA 3VBOC 2VOKA 5C8CA 1ZM1A 3MLKA 3MZHA 3WG1A 3B01A 4BMEA 3ENRA 4QU2A 3WG3A 5T5PA 5JMCA 1LJ7A 4Q0PA 1UX6A 3R6SA 4LT5A 2X5IB 4WM8B 3SMHA 5JZGB 4XJUA 5KC6A 5GLWA 4XTPA 4FBFA 1H8TA 1BVVA 3OD0A 5I0SA 1Q8PA 3CU7A 1ZZBA 3ZYJB 3RS6A 1H4GA 1H2KA 4P9JA 4M3CB 4N90A 3ZXKA 3EHKA 1RUD3 5JPNB 1UU4A 4AI1A 3CJIA 2XBO2 4DRVA 1SFYA 4XFGA 1FATA 3GALA 3S7EA 1UAIA 3TAYA 2UY9A 4QQLA 4AGVA 1CVNA 2DUPA 3HIFA 4YZ4A 4YFWA 2JENA 3LOBA 4YVSC 2P3JA 3RI9A 3THTA 3W58A 4RS5C 1SCSA 4OHVA 1IOAA 1ZBA3 3VKMA 5K0UB 1RUE2 1SFNA 4OVEA 3VBOB 1MQTB 2RM21 4S2DA 1MR5A 1ZBE3 3N7JA 1EP0A 5F5QA 1EAH2 1UPIA 3OBRA 2QZ3A 4M01A 5BXXA 2BFUS 3ZX7A 3BCWA 5I91A 4YG6A 1H2NA 3WDYA 3GHMA 4DPNA 3V0BB 3OY8B 1DFQA 4XYXA 5C4WA 3QD6A 2C1FA 1LTEA 3BALA 2VOWA 2Q30A 1WCKA 4Q4Y1 4ASLA 4GQ7A 3KB5A 2E7TA 1Y3TA 1CAXA 2ZJCA 2PN5A 4FP3A 1SLIA 3E5XA 1WLWA 3VBHA 2BW8A 4GMP1 1BXHA 4HVQA 4NPRA 4EWEA 1ULDA 1GKBA 2P34A 1LOEA 4RHV3 3WP6A 1Z7S2 4XZPA 3VBSB 4K1ZA 2BEOA 4L2NA 1LOGA 2ZGMA 2B5HA 1GBGA 2NM1A 3LKJA 2YYOA 1OMIA 4FSJA 1YIPA 1AR81 1X8MA 4YVSB 1BCXA 2WLPA 3LA7A 2DVFA 4AHYA 5KHIA 2RR13 4HBNA 1HRI2 1AF9A 4DMIA 3CLPA 1TMF1 4LBJA 1B09A 4WM7C 3AYAA 2WQZC 3VZKA 1AYN1 3R4DB 5LK5A 2Z2SB 3N7LA 4XHBA 3DV8A 3IPVA 2ET1A 3RWNA 4ES8A 1AR73 1KS5A 1RVF1 2R062 2VW1A 3HWJA 1Q56A 3LSDA 4GKXA 2UWCA 4A3XA 4XJ8A 4Y20A 4RQPA 3ZFEA 3GYDA 3LAGA 1LR5A 4XQDA 1RUH2 1V9U1 1YFYA 5CB7A 4XMIA 1RHI3 4LBQB 1R1A2 5GJ6A 1OQ1A 3TN93 3MLJA 1GZWA 5BYNA 1R083 1W6OA 3M3IA 4IERA 1FMD2 4MZUA 4KG0A 1DU3D 1QJX2 2ZCWA 4HL0A 1W6MA 3NO8A 3ZN6A 2QKDA 1O91A 5FLIA 4A7ZA 5GLZA 5JLVA 2IWGB 4PBPA 1NXMA 5H9RA 3RDIA 3AJZA 3QLQA 4FPOB 4YVWA 1PGW2 3AZXA 1MVEA 2WQ4A 1SBDA 2MHFA 3KT1A 1DG6A 1ND3A 2GU9A 5CBLA 1PK6C 3NW4A 4CDQA 1XNKA 3KCYA 3INAA 4IEVA 3VBFB 2VW2A 1S0FA 4G3YC 4CEWC 3G6JB 2EALA 4AFMA 1AX0A 4Z92B 4XF1A 1RITA 4X6QB 4C0HA 1RUD2 1IGOA 4AFDA 3SCHA 3FC0A 4EJRA 1YFWA 2Q0AA 3ST7A 2JJ6A 3I59A 3WW1A 2O8QA 3E97A 4QQHA 1RUE1 1PIV3 4DRRA 1SQ4A 2FBEA 1VBA3 5CG8A 3N7MA 4PF5A 2VVEA 1VRH2 3QH6A 1C3HA 5E88A 5DUWA 3FMGA 3BOWA 3O5SA 1KD7A 3WV6A 2SBAA 2QVSB 1NG0A 4L9BA 1ZBA2 2JG8B 1CD3G 1RJ7A 4Q4V3 4OHYA 2ZOEB 4FOYA 4JCKA 3QCWA 4HVOA 2XKOA 3VBUC 3WY6A 1ZBE2 3SH5A 2E51A 3EJKA 2WS93 4N53A 2HWB3 4KGGA 2W0XA 4LO8A 1JN2P 4K3UA 3DL3A 3ZFGC 5L7OA 3FJSA 4AQ2A 4DQAA 5D8AC 4YM1A 4YG3A 1OKQA 1UCXA 1PK6B 5GKAC 4KNCA 2WWSA 1NY72 3SHRA 3J26N 3PMEA 2E6VA 2NN8A 3MW4A 3V56A 1CQ9A 1EPWA 2B39A 3AP7A 3RG0A 4I0AA 1C5HA 1VBD1 1UKRA 3L9JT 4RR3A 1MACA 1G9BA 4RHV2 3AYCA 2G9FA 2EXHA 3HT1A 4ORFA 3VUOA 2RHPA 5DDJ2 4MSVA 4YGEA 4LO4B 1V00A 2XWJB 1PGL1 3M70A 1LRHA 2RR12 1ZZ8A 1C4RA 1O3TA 3B69A 3DPRC 4ZU7A 4IEPA 4BM8A 4B7EA 1RUH1 2GMMA 2ENRA 2QDNA 4L99A 1R1A1 1AR72 4HANA 2ZMNA 4IV1C 1KFXL 1ZREA 1QJX1 2WFF3 1DGLA 2CGNA 4HN1A 3GZAA 1LHNA 2YDEA 1OOPA 2EA7A 5CFDA 3ZFGB 4COZA 2W08A 5D8AB 2VW0A 3WW2A 5SV5A 3R4UA 2C9AA 1RHI2 4CDXC 5LRSA 1XNDA 2RMU3 4LTAA 3VBRC 1R082 2Y0OA 4A2UA 1B35C 4IEOA 2GH2A 4ISRA 3B9IA 2B42B 2XJVA 3VDDC 4JAAA 5FLHA 3ILNA 2JG9A 4AFAA 1QH7A 4UW5A 3VHNA 5FPZA 2R49A 3NKTA 3K51A 1K5MA 2AENA 5K7PA 1IHMA 4TYSA 4X8PA 4D7TA 1QNYA 2I74A 3ZYGA 3B93A 2ZABA 4JGYB 2XJTA 4U36A 4D69A 1HV1A 1H2LA 3MGUA 4LBLA 1FOD1 1CESA 4O9GA 3WDWA 2Y0IA 1PGSA 5FOJB 4XF4A 2D6OX 4CDUC 1ENQA 5CFCA 1ULGA 2OUJA 1DHKB 1VRH1 2XL9A 5A3MA 3AP9A 4CEYA 4KWLA 4URTA 3WP5A 1ZBA1 2XUMA 2A3WA 3HD8B 4IV1B 5JSOA 3M8LA 4JTNA 3HR9A 1PIV2 5GLVA 1VBA2 4QGNA 4F8AA 4AXOA 3T2TA 3Q9OA 3WR0A 1M4WA 1OPMA 5BNNC 2UYBA 3BTAA 4S2FA 4MYEA 1POV1 4PCRA 4CDXB 5FMOS 1BYHA 5F6LB 2O1QA 1KJRA 3ES1A 4Q4V2 4C0BA 4AQTA 3BU7A 4QQ2A 3VZMA 4BPZA 1BMV2 1EV12 3GZUC 1RUOA 1ZZ6A 5I8SA 2WS92 4Q0UA 2F4PA 2RM23 3EBRA 4Q4X2 2HWB2 2DWRA 2QQPA 5FRAA 4GULA 2BNNA 3ZYIB 4JGZC 1JW6A 3PMSA 4MXWA 5H9QA 4LUMA 2ZMLA 1H2MA 4AI3A 1V70A 3IKWA 4MUVA 4BH9A 3D4KA 1ZA4A 3MFAA 1JTZX 1W6QA 2VVFA 3RQ0A 2B7YA 3C2UA 1QHDA 4Q4Y3 5DDJ1 2OPKA 4CDUB 4N7UA 2KA3A 5BPXA 5BNOC 4Q0SA 2ZGUA 5T52A 4YW3A 2RR11 3RSJA 3VHRA 4GMP3 4QT6A 2GNDA 4BLIA 3OD4A 1YYNA 1W39A 1D0GA 1U5YA 4ZXKA 2LALA 3WINE 3WNXA 4E4DX 4Q8LA 1VBE3 2E7QA 5CU1A 1LEDA 5GLUA 5BNNB 2FMYA 2E63A 1AR83 2D6PA 4F83A 2VQAA 2OW4A 1LKNA 4DINB 1BVP1 3TBDA 4XPVA 2D6MA 2D6KA 1O5LA 4FOWA 1CJPA 4JV4A 5DG1A 4OZXA 1TMF3 5E16A 3USUB 1VB2A 1XNCA 2NYYA 4XMAA 2D7FA 4AHWA 1R081 1SLBA 2P2KA 3R05A 2WFF2 1V6OA 1R1ZA 4YM3A 4PDWC 5BUVA 3CNAA 4AEDB 1RVF3 5JI7A 4OHZA 2VU9A 4QM8A 1G7YA 3GBFA 1KDMA 1QJU2 2GNBA 4TWTA 5EYYA 2RMU2 3I7DA 2UU8A 1V9U3 3ZN5A 1WA4A 4I02A 5GALA 1SBEA 3KSCA 1GZ9A 3N7KA 1GICA 3FUQA 4K9SA 1N3OA 5TSWA 4AEJA 1CAWB 4KBBA 4DOUA 4XBQA 2PHWA 3FFZA 2XWBB 4Q1PA 3BOPA 4X6RB 5DZEA 4IL7A 4XW3A 3KGLA 1GSLA 3JQWA 1NA1A 2EVXA 4FP2A 3DF0A 4PBOA 3V0AA 1A78A 1HQNA 3PVNA 1RUF3 3PVEA 3ZFFA 3ZYPA 2GC2A 1PIV1 1H8VA 1I5ZA 3SCGA 3M1HA 1VBA1 2PAMA 1HKDA 4RSUA 2QZ2A 1TME1 4BOWA 1HV0A 4Z2WA 3ZXDA 1YI7A 1XU2A 4C1WA 5J98B 2V09A 5I0RA 1O3SA 3RMYA 1WUVA 1WD3A 4AVBA 1FPN1 1N1SA 2D5FA 3WDTA 1BMV1 5AVAA 4ONUA 3OGJA 5EYXA 1EV11 2E9QA 5FBZA 3B9CA 4QX5A 2WS91 5EZWA 5EXOA 2YPJA 4ZU5A 5FOBB 4Q4X1 4JC1A 1TNFA 1NLRA 1JH5A 2VVDA 2EF6A 1N1YA 4MVTA 1RGSA 1Z0HA 2RJLA 2HEWF 5LK7B 1LHOA 3K48A 1ZNPA 1DIWA 5E89A 2XJUA 2Z5WA 3FHIB 3HMYA 2XG3A 1WLTA 4CDWC 1ZVFA 1WMEA 3A0NA 1W0PA 4N43C 3S7IA 2RM22 1FT9A 2BVBA 4IV3A 4GKYA 1LULA 2ZTNA 3ZN4A 4MGKE 3R0RA 3AK0A 3MF9A 2W39A 1DQ6A 2DUQA 3HQXA 2JEMA 1WLCA 2GNTA 3PJYA 4LA3A 3UJOA 4Q4Y2 4TLFA 3IWZA 2VG9A 4XFFA 1H1IA 4GWNA 4WM8C 3E6DA 4YVSA 5JZGC 1Y9QA 3X29B 5GZGA 3AMHA 4MGIE 1YLLA 4RS5A 4Z8BA 3N4MA 4GWMA 3WP4A 3KT7A 4UW4A 4UW3A 1VBD3 4DS0A 4YM0A 4MXVA 1UL9A 3CL1A 1LU1A 3NV2A 3P3NA 1MZ5A 1NE4A 1AXKA 1VBE2 1QDCA 2R1DA 2E53A 2ZZJA 2WL1A 4YGBA 3NSTA 4NN0A 1AR82 5C6CA 1DQ5A 4Y4YA 4AI2A 3VZJA 3ZSJA 4M3CF 2ZGLA 3ASIA 1W2UA 3L2HA 1TMF2 4CP0A 1O4YA 1QJU1 3VN4A 4HLTA 1Q8VA 4YM2A 2D43A 1GNZA 1O3QA 5EWSA 1OI6A 1NE6A 1X50A 3NV1A 1RVF2 2R072 1TNRA 2QUOA 2JE7A 1KJLA 1PNGA 1QJX3 1AZDA 2UWAA 4XF9A 1MQTC 2GN7A 4UXAA 2R1BA 3WXPA 1IS4A 5ACA3 1J1LA 1WLDA 3UK9A 3VZOA 3VLBB 2CGPA 1V9U2 2P3IA 1H0BA 2HEVF 2DVBA 3B02A 3O7OA 2WIIB 2Z42A 3FFQA 3NJZA 4Y5Z0 4FAGA 4Q2FA 4P9YA 3AMQA 1REEA 1VBC1 1H9PA 2AR6A 3SLIA 2PFWA 5C33A 1OA3A 4WM7A 1MZ6A 3HBZA 2BPA2 2ZX4A 4P9XA 1CAVB 1VB4A 4XFHA 3FX3A 1RUF2</