1HRI3

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 40
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hri300
4QPIC 1FMD1 1E57A 1NCQA 3CJIA 4CDUA 4Q4W1 4RHV3 2WZR2 1C8M3 1VBD2 5C9AA 4QPIA 2ZAHA 1HXS1 4CEYC 1AL0G 1PO12 1BBT3 4RR3C 1ZBE3 4CEYA 4GMP3 1AR83 2HWC2 4CDXC 1R093 4RR3A 1BEV1 2X5IC 1D4M2 4CDXA 1RUG3 5CFDB 4Y4YA 2X5IA 4NWWA 5J96B 2RS53 3ZFEB 1M06G 1AR93 2RM21 1QJY3 2WFF3 2HWF2 1ND3C 4CDQC 1TMF2 4RQPB 3VBRC 4WM8B 1FPN3 1VB4A 1RUH2 1VRH1 1ND3A 5DDJ2 4CDQA 1AR63 3VBRA 3VBOC 1COV1 4FTEA 3ZFFB 1PIV1 5K0UB 4CDWC 5CFDC 3VBOA 1RB8G 4CDWA 5CFDA 2BUKA 1FMD3 4RS5B 3VDDB 4AEDC 4Q4W3 1AYN2 3VBFC 4WM7B 5C8CB 5C4WB 4AEDA 1HXS3 1SMVA 3VBFA 1RUF1 1QJX2 1RUI2 3TN91 1QQP2 1OOPC 1RVF1 3ZFFC 1VBC2 1W39A 1EAH1 1OOPA 1ASJ1 5K0UC 1C8M2 3ZFFA 1MQTB 4SBVA 4GMP0 1BBT2 2MEV2 2GSYA 5K0UA 3VDDC 3HAGA 2HWB1 1AYM2 1ZBE1 1RUD2 2R042 4WM7C 1R092 5C8CC 2BPA2 2FZ1A 3VDDA 2VQ0A 2RM23 2XBO3 2ZTNA 2RMU2 3M8LA 1NG0A 4Q4V2 4WM7A 5C8CA 1RUG2 4LLFA 2PLV2 1POV1 2HWE1 1VRH3 1F8VA 1HX6A 1VBA2 1COV3 1PIV3 4PDWC 5D8AB 1AR92 1PGL2 1QJY2 2WFF2 1PO23 1MEC2 4PDWA 1NA1B 1FPN2 5JZGB 1BMV2 1EV11 2WWSA 2FZ2A 1AR62 5J98B 1RMU2 4BCUA 5ACA3 1TME1 2Y26A 5A32A 1RUF3 1V9U1 4Q4X1 1HRI3 3DPRB 1R1A2 3TN93 2R063 4Q4W2 1EAH3 3JD73 1ASJ3 1RUE1 3JBG1 1HXS2 5JZGC 1WCDJ 2XPJA 4IV3B 1VBE1 1X36A 4IV1B 2HWB3 3IDEA 1C8NA 4Q4Y3 1BEV2 2BFUS 3DPRC 1AR71 5LK7B 5L7OB 4JGYB 1POV3 2HWE3 3DPRA 2WZR1 1VBD1 3VBHB 1FOD3 4QPGB 4GH4B 2RM22 1NY72 2XBO1 4IV3C 2DF7A 1PVC1 4N53B 1VBB3 1VRH2 1EV13 4RFT0 4IV3A 1HRV2 1COV2 1D4M1 1NCRB 2IZWA 1ZBA2 1TME3 3J8F2 1V9U3 2BFUL 4Q4X3 1RUC1 4JGYC 1PO21 2RS33 2R073 1QJZA 4JGYA 5FMOS 3ZFEC 4GH4C 1PGW2 1RUE3 1R083 3JBG3 5AC93 3ZFEA 5ACA1 1RUF2 4GH4A 2HWD3 4RQPC 1Z7S2 1VBE3 4WM8C 1HRI1 2WS91 4GB33 4YVWB 5ABJB 1RVF2 4RQPA 2R061 1AL22 4WM8A 1GFF2 1EAH2 5CFCB 3JD71 4RHV2 1AR73 1AYN1 2HWB2 1ZBE2 4RS5C 2WZR3 1VBD3 4N43B 5FMOL 1AR82 2ZZQA 4FTSA 1PO13 5C4WC 4Q4Y1 4RS5A 1POV0 1PVC3 2HWC3 5C4WA 2HWE2 2RS11 5CFCC 1D4M3 2RS52 1FOD1 2MEV1 4YVSB 3VBSB 1H8TB 1MQTC 5CFCA 1RUJ1 1RUC3 1HQNA 1VAKA 3ZFGB 5BNNB 1MQTA 2R041 3JB8A 1VBB1 1K5MB 5BNPB 2RMU1 4Q4V1 2HWF3 1V9U2 1RUH3 5DDJ3 2WS93 4Y5Z0 5C9AB 1VBA1 2R071 2RS31 4QPIB 3S6PA 5FOJB 3JB4C 1QJU1 3NAPB 1FMD2 4YVSC 5D8AC 1H8TC 1R081 5AC91 4Z92B 4YVSA 5D8AA 1H8TA 1A6CA 1VBE2 1NA1C 2HWD1 1AYN3 4GB31 5BNPC 1RMU1 4CDXB 1NA1A 5JZGA 3VBUB 5BNPA 1QJX3 1QQP3 1RHI1 1AR72 2RR11 1VBC3 2RS13 3NAPC 1CJDA 1OPOA 3NAPA 2MEV3 1PO11 1ND3B 1RUJ3 2XBO2 4CDQB 3VBRB 1CD3G 1PVC2 1AYM3 4IV1C 1RUD3 2HWC1 2R043 3VBOB 4IV1A 2RMU3 3VBUC 4Q4V3 4CDWB 1PIV2 2PLV3 3VBUA 1RUC2 1PO22 5L7OC 4JGZB 1VBA3 4AEDB 3VBFB 1QJU3 3VBHC 5L7OA 1NY71 2TBVA 3LOBA 4QPGC 1DDLA 1MEC3 5ACA2 2HWF1 3VBHA 1TMF1 4QPGA 1B35B 1OOPB 3FBMA 4N53C 1HRI2 2WS92 1RUH1 1HRV1 3TN92 5DDJ1 1RMU3 2R062 1ZBA1 4N53A 1NCRC 4FSJA 3J8F1 3JD72 1ASJ2 1R1A3 1RHI3 1NCRA 2RR13 4JGZC 1PGW1 4JGZA 1IHMA 2QQPA 4Q4Y2 1Z7S1 1QJX1 1B35C 1AUYA 1RUI1 1QQP1 5ABJC 4YVWC 5BNOB 4FTBA 1ND2B 1AL21 2RS12 1B35A 1VBC1 1X33A 4NWVA 1BEV3 4RHV1 5ABJA 4PDWB 4YVWA 1C8M1 1FOD2 4CEWB 1NOVA 1BBT1 1RUJ2 2GH8A 4GMP1 1AR81 5A33B 1AYM1 1VBB2 1RUD1 5A32B 4N43C 1EV12 1R091 5GKAC 2BBVA 1VB2A 4N43A 1RUG1 1TMF3 1OHFA 1TME2 5BNOC 1ND2C 2PLV1 4Q4X2 1NCQB 3CJIB 4CDUB 1HRV3 2RS32 2R072 3ZXAC 2RS51 5BNOA 1QJU2 1ND2A 1ZBA3 1AR91 3J8F3 4CEWC 1PGL1 1QJY1 2WFF1 3VBSC 1RUE2 1R082 3JBG2 5AC92 4CEYB 1MEC1 4CEWA 3ZFGC 1FPN1 1BMV1 2HWD2 3VBSA 5BNNC 4RR3B 1F2NA 4EJRA 4GB32 1AR61 1K5MC 3ZFGA 5A33A 5BNNA 2X5IB 1K5MA 1Z7S3 1RHI2 1RUI3 1NCQC 3CJIC 2WLPA 1R1A1 2RR12 4CDUC 1RVF3 5C9AC 1AL23
chains in the Genus database with same CATH superfamily
1FMD1 5IHRA 5BV6A 1NCQA 3HN3A 1QOOA 4ZKTB 4D6QA 2GNMA 1OF4A 1W6QA 3VZJA 4XJ8A 5C9AA 4LULA 4AYUA 3KGLA 4HMZA 3M3OA 4Z82A 1HKDA 2QZ3A 2A6XA 2DV9A 3ROUA 5BUVA 1JZ4A 3DL3A 3CL1A 3AM2A 1ZBE3 1BLZA 3FHIB 5A3UA 1QF3A 3LEMA 1OSGA 4D0QA 1WKYA 4R4ZA 1S0EA 2RJKA 1R093 1WW5A 2X10A 4RR3A 3D5OA 2P6CA 3U0ZA 1BEV1 4A3ZA 4O9GA 1BKZA 3AC0A 3CDZB 1DZQA 4L99A 5JR7B 4Y4YA 4E4SA 1W6PB 2CAVA 2WWUA 3OGVA 1XE0A 3LPFA 2H0VA 1XU2A 4MGTA 2XKOA 1SBFA 2HEYF 3AL5A 4RFRB 3W59A 5J96B 4YG6A 4X6RB 5DUVA 1OD5A 2YG0A 1WLDA 3PVNA 4LBOA 4N90A 1M06G 1PK6A 5A7OA 1C5IA 3F95A 1TNFA 5FV3A 2Y0OA 4LT5A 2HWF2 1UZ0A 1W8HA 4CDQC 1ULCA 4RQPB 4XXPA 5LY2A 4QXHA 1SFYA 1SPPB 5FQ0A 1NLQA 1VRH1 2EXKA 4PQQA 2AEYA 5GJ6A 3LWCA 5DZEA 2DCYA 2RJ2A 1OLME 2WJSA 3WXPA 1Y7BA 1WA4A 3SH4A 4CDWC 5IK8A 1JUIA 2ZPXA 3N7JA 1UMZA 4NRMA 1LGCA 3OG2A 4YWAA 1UY3A 1ST8A 3MIFA 2C9AA 5CFDA 5JOZA 4JKLA 1DZTA 2LM3A 3H8RA 2BUKA 2ZXQA 3ZR6A 4AEDC 4NPLA 3CJXA 4QHBA 4KI5M 4B29A 4YFWA 3CNAA 2OIIA 3H7JA 3H7YA 1JH5A 5C4WB 1YNAA 2WT0A 3ACLA 1SMVA 1VJ2A 2FQPA 1SDWA 4AWDA 1FX5A 3RYPA 3VKNA 2WYSA 1IZ3A 5FK7A 1ULFA 1CGPA 1OOPC 3KD4A 4K6BA 3H8XA 3LDBA 1DIWA 1US2A 4LITA 3ZKYA 2BWCA 2GZWA 1MPXA 1VBC2 2VU9A 3Q8AA 2XR4A 4TSVA 2HEVF 4AQSA 4XMAA 3WDTA 5FTTC 1MS5A 1FXZA 1GQGA 5EFUA 4YZ4A 3ZFFA 4SBVA 1NUKA 1DBNA 4GMP0 3BGAA 3WQBA 5FUIA 3BALA 3H3LA 2VQAA 4CPBA 3SH3A 2EVXA 1S0JA 4A45A 1ZBE1 4YM0A 2C4XA 2R042 3D0JA 4Y20A 1R092 5EHDA 2FZ1A 5H9SA 1XB9A 5FKCA 1UMIA 3VDDA 3G6JB 2XBO3 4CCMA 3EHKA 2RMU2 2JD9A 1GKBA 3GZEA 1LR5A 1XNAA 4AI3A 2EIEA 3BN6A 2WLQA 5FY9A 1QNYA 3NWKA 4LKFA 4LLFA 1W2TA 4BQYA 4UI9L 5FREA 4YM3A 3JCIA 2PLV2 4E2GA 1F8VA 1K12A 4XABA 4IEZA 5LK5A 3FN9A 1COV3 1I6XA 4P9YA 1DGWA 1HB1A 2VNGA 2VTXJ 1UN1A 3NNJA 2E33A 3WW2A 3ZYFA 3KLSA 4SLIA 1SLLA 4XJAA 4NIIA 3IIAA 4PI0A 1KFUL 2OVUA 2YB7A 4HG6B 2W91A 5JZGB 3ZSJA 5F3CA 1EV11 1W05A 3SC7X 5J98B 4ZHNA 3DF0A 1O4YA 1YFUA 3GJBA 3RWNA 1A8MA 4ASKA 5CEHA 5DAVA 4GKYA 2XKPA 1K45A 4Q4X1 1H6XA 5G04L 1VMJA 1ZRRA 3T09A 3TN93 1ZRDA 1W6NA 1UAIA 1VR3A 2OX0A 2OW4A 4DINB 2ZMKA 2VH9A 3P3NA 4IERA 3JD73 3SCFA 4AHZA 2JKBA 3E6CC 3TEYA 1GQHA 1KRIA 1O7FA 4MYEA 3KCYA 2PHTA 2P37A 1QWRA 1S0BA 1X7NA 1ZM1A 3N9QA 5JZGC 1WCDJ 3WUDA 1VBE1 3UKVA 1V6JA 2R16A 3IIIA 4AFMA 5JOWA 3PVBB 2P6HA 4NJ4A 2HWB3 2VW1A 3LSDA 3IDEA 3S7EA 2ZA9A 4XUPA 1NT0A 4J6GA 3V65A 4QDRA 3ZXLA 1MS9A 2PQQA 2NPIA 2VZ1A 1Q3EA 1RGSA 1XU1A 3T1MA 2BFUS 1TEIA 2EXHA 3PVEA 1JZ5A 5FXZA 4JGYB 1SEFA 2UY8A 3WY6A 5JVVA 4QX0A 4E8CA 3GCXA 1S1AA 2RHPA 3K4AA 1MACA 1UY4A 3OB8A 1S2EA 5EV7A 5IT6A 5FZ9A 4XF9A 4PBPA 4QPGB 4UFMA 5F3EA 5B4NA 2YDEA 1IGOA 2O1QA 4LORA 2XBO1 4Y1UA 5FOBB 5EYYA 4NAMA 1GANA 2W46A 4CXWA 4LE4A 4IEQA 4I02A 3MGUA 1SZBA 1WLWA 3UV9A 5KXDA 4RFT0 4UFHA 1A34A 4IV3A 2RDQA 3WP4A 1HIXA 1COV2 5FMDA 3S0MA 3NJXA 4AHXA 3ZIWA 1ZYBA 2RDRA 5GALA 3M7AA 5LRRA 4XHXA 5DZGA 2PELA 3RJ2X 4JGYC 1OC1A 2GMMA 4LHSA 5FZAA 2Y6KA 2R073 1OXCA 4KWJA 3RZGA 2D6KA 3AXEA 3HWJA 4XC9A 2VVFA 3WZ1A 2ZX3A 4XILA 2NMOA 3TYJA 5FMOS 2VOKA 4OI0A 2XDVA 5JR2A 4FOQA 2PHUA 3DKQA 3POSA 1H1AA 2VTXA 2WA3A 3JZVA 4KU7A 3WP3A 4QB1A 2JG9B 4IL7A 3JQXA 4HN0A 4ITCA 2PFWA 2HWD3 5A7NA 1UQXA 5FZHA 3DXTA 4GB33 1TNRA 4I0WB 4K20A 2BZDA 4AOCA 1CWPA 1GFF2 4AI2A 4CU8A 3JD71 3RS6A 2QQWA 2CGNA 5D2AA 2VMIA 4A7ZA 4CPBD 4DXTA 4GA9A 4E8DA 4XPVA 3O1PA 2FDGA 5FMBA 1LHWA 1N1TA 1OH3A 2TNFA 3T4HB 1KFXL 1DF0A 4A7YA 4CP0A 2ZX0A 5J1XA 1AYN1 5IVYA 5A80A 2HWB2 2V72A 5EQUA 2WZR3 1WMEA 3HJRA 4QPWA 1W3XA 2J42A 3WNKA 3K3NA 1XBFA 2KXLA 3NMBA 5A6ZA 4CTEA 2GN3A 1PM7A 3ZVXA 4QQOA 4BA6A 4QGNA 1PVC3 2HWC3 1W90A 3L9JT 1DGWX 2XJPA 3W5MA 1GP6A 3ACFA 2RG4A 1CPMA 2VOWA 1D4M3 4O9EA 4OQ9A 1BJQA 3AYDA 3VBSB 2WNOA 1MQTC 5IW0A 4XMIA 5B2GB 4QQHA 2DUQA 2W1SA 1RUC3 2XJSA 2W1UA 3NNFA 3NV2A 4Q0PA 3RRDA 5C33A 3GCWA 3W58A 3GDBA 1CVNA 4LHKA 4QD2A 4DRRA 4LBQB 3JB8A 3ACHA 4NOTA 3H8UA 2VMCA 4MGZE 3VKLA 2SLIA 5C3OA 5C3QA 2W95A 3PIGA 2PHWA 4KU8A 1N1VA 3KV6A 3U14A 3IDCB 1URXA 2BGOA 1RUH3 2YFUA 1X50A 1AJKA 4K3UA 2WS93 5DDJ3 5C9AB 5FYYA 2R071 2GNDA 1YHFA 3VZNA 2WZPP 3WNOA 2C0ZA 2XJRA 5D8AC 4A42A 3Q9OA 1WCQA 3T3YA 4U2AA 3A0NA 4H2AA 3CMGA 5HCAA 4NN0A 3JXSA 3GHMA 1H8TA 4C91A 2HWD1 4COWA 3K4DA 3R4DB 4GJYA 4AK3A 1GMMA 4GB31 1BHGA 1RMU1 2JDYA 3RI8A 5JSOA 3PUAA 1GNZA 5FR3A 1NA1A 4FO9A 4OQ8A 2EAAA 5LBFA 5BNPA 1EYBA 2CV6A 2KM2A 4A44A 4COYA 1WLCA 1ODNA 1QQP3 2P3KA 4XEZA 3ST7A 4QX1A 1DLCA 4NRPA 1OT5A 4OI2A 2XL7A 3WF3A 1PK6B 1V6MA 3RI9A 2BNNA 1OI6A 3PURA 1YEWA 1CAXA 1PGSA 3I2HA 4AQ2A 2XHKA 2B42B 4EN7B 3ASIA 3FLTA 3MW4A 4W6XA 4A41A 4LBKA 2VZVA 4DUXA 2E9QA 1FYUA 1OMIA 1RUJ3 4ATEA 3SITA 2K9ZA 1W2UA 2AC1A 4NIAA 4ATFA 3FX3A 1CD3G 1PVC2 2A1XA 2XJVA 3OBRA 1AYM3 3PJQA 2HBUA 2Z42A 4IV1C 1RUD3 2HWC1 2I45A 3HOBA 4CCDA 3OGJA 1W9TA 4BQ5A 3A0KA 3ALQA 4YZ1A 5A3LA 5JOYA 2GNBA 1UIKA 4Q4V3 1IPJA 1LODA 1PZ9A 4AVAA 2BV4A 4NVPA 3KVAA 4NIDA 3VBUA 1RUC2 4NHXA 3I3BA 2Q1FA 2ZGRA 4JGZB 4Y1YA 1VBA3 4YPJA 2VZQA 3WNMA 3U4SA 1CAUB 4LOSA 5L7OA 1NY71 2ORXA 2Z69A 4QM9A 4Y1ZA 4MG2A 1KDMA 2G19A 1UKGA 3WG2A 3VBHA 1TQ5A 4AI9A 2Z4FA 5SV8A 1TMF1 1W0PA 1G86A 5IK5A 2LW8A 1SLBA 2OQ7A 3DKWA 1HRI2 2WS92 4N53C 5C3PA 1RUH1 4OUMA 2J1EA 1FNYA 4M4PA 3POGA 4JDOA 4ZPIA 5DDJ1 2QQVA 2CL2A 3THCA 4R9CA 4MHRA 2Q0AA 3RG0A 1V70A 4NAOA 4MGKE 2R6QA 5JXHA 5CG8A 3J8F1 1HQWA 2JKXA 3K51A 3MF6A 5EWSA 2IXKA 1ASJ2 1UY2A 1S4CA 2GH2A 2QDRA 2R32A 4OMCA 2VUAA 1LOEA 3N7MA 1R1A3 5DMYA 1KS4A 2BTVC 2VW2A 2ZEZA 2ZAAA 5CB7A 4JGZC 4UFIA 4AE2A 3B02A 2ZX1A 5JXGA 1JZ7A 3C3VA 2FCVA 1LTEA 3FBYA 2EF6A 3O7OA 1WBLA 2DYCA 4XDQA 1WA6X 2FDIA 2VO5A 3ZPYA 2ZGKA 3ZXKA 4Q4Y2 3HVDA 2Z5WA 1YQ8A 2GC1A 4KL1A 3IB3A 4QX5A 4YGEA 2B5HA 4QKFA 5CA6A 1QQP1 4X8NA 2C5DA 5K9YA 1YFYA 2EXJA 2ZGQA 3POJA 4OUSA 5FYCA 2E7AA 1AL21 1NZIA 5L9RA 2XJQA 1WLTA 1GOFA 1X33A 2QZ2A 4NWVA 5FLHA 1H6YA 1JYCA 1SACA 2F4PA 2QUOA 4RHV1 3UK9A 2XUMA 4FPHA 2JDZA 4XUOA 5A7QA 1NOVA 3T4VA 3AZVA 1RUJ2 1UZYA 2XONA 2B7YA 4FXGB 5E8AA 3ZXFA 3H3UA 2GH8A 2Y6HA 4KBZA 1AYM1 4V2VA 1LGNA 1RUD1 2CSGA 4N43C 1LOFC 5FZKA 1MS3A 5FYVA 4NR1A 4CCJA 4AF9A 2TEPA 1W6NB 2D6MA 4C8DA 4DFSA 3NJYA 1IS3A 2VZ3A 3V56A 1OHFA 2WNVA 3RMXA 2DUPA 1HB4A 4AZZA 3CJIB 5FPLA 1UF2C 4UW3A 2RS32 3ZXAC 2DCZA 4N7IA 1H2LA 2RS51 4YG3A 2Y8KA 2J22A 4MX3A 4XETA 3KGZA 1AR91 3I49A 3MYXA 1ENQA 2ZHNA 1QJY1 2WFF1 5GZFA 5AC92 4XDOA 2XQRA 4LA3A 1XSRA 4MOAA 5JI7A 3VD5A 4CEWA 1BMV1 1YUDA 1ZZ9A 5DUXA 1XNBA 2BNOA 1ULOA 2HLEA 4RN5A 5BPXA 4AW7A 4NPRA 3ZFGA 5A3PA 4GWNA 1KD7A 4YGDA 5BNNA 1LRHA 2QKDA 1SBEA 2NN8A 2QTWB 1K5MA 5CZKA 1WBFA 1Z7S3 2ZHMA 3RZHA 1X8MA 1GZWB 3CJIC 2WLPA 1R1A1 2J1RA 4I30A 2WN3A 3W9AA 1RVF3 1JW6A 1JBCA 2ID4A 1ENSA 2QQUA 3ACIA 4UBGA 5H9PA 4EROA 4QPIC 1E57A 1N3PA 4INDA 3RYKA 4Q4W1 1DQ2A 4C1XA 1C8M3 1VBD2 5LK7B 4F7ZA 2ZAHA 3U11A 3NV4A 4M4RA 1AL0G 2R7EB 1X82A 1PO12 1BBT3 1S2BA 2KR2A 3ILFA 3KCXA 3NW4A 4IEOA 5KXCA 1VALA 2X29A 5JMOA 1VIWB 4CEYA 4GMP3 3VKFC 1AR83 1E5HA 3PU3A 4Y26A 3OPZA 4C0BA 2R0HA 3NNGA 4Y22A 1UXXX 2WZEA 4H7MA 3H42B 4CDXC 3KHCA 5FXVA 1CAVB 4ZXEA 2E6VA 3E6DA 3M3QA 3MICA 3O1RA 2GP5A 3B5LB 4K8RB 1HV0A 4XF1A 5I0SA 2NP0A 3WW3A 2X5IA 5T3NA 2ORZA 2FDFA 4XFIA 4CSWA 4BQ1A 4Y1VA 3VD4A 3ELNA 1OURA 4L0PA 4LA2A 4QU1A 4XUTA 4DMIA 1I3HA 4HANA 4ARYA 3OUHA 3K4ZA 4GWJA 3WP6A 4CUCA 4RGGA 5L19A 3GZUC 4JC1A 1XQNA 2OS2A 2JE8A 3N7KA 3VBRC 3HEIA 3RZMA 4PF5A 4YW3A 3NRUA 1UPIA 2W3JA 4FI9A 1LEMA 2RDNA 1ND3A 1OA4A 2XWBB 4IGQA 2D43A 3VBOC 2ARXA 1PIV1 2AH2A 2G9ZA 4HPKA 4P9GA 3ZYIB 5K0UB 5C6CA 4IW3A 4CCOA 3AVSA 2QQOA 2ZX2A 1RB8G 3PMEA 4O7XA 1LU1A 1UIJA 2CGOA 2FCTA 4LO4B 3OPTA 3WSOA 5FXXA 1S0IA 1FMD3 1D2QA 1QGLA 2Y34A 4JVAA 3AP5A 5EPAA 4DNYA 1QJEA 1UD1A 3VBFC 4URTA 4QX3A 5C8CB 3HMYA 2B45X 4DXZA 1ALYA 5CNAA 5CADA 2HH9A 3OTFA 1STMA 4URAA 1LAJA 4XF3A 3W21A 3ZYHA 4RYDA 4HSLA 1RVF1 3WF2A 5F6KA 5JWPA 4PBOA 3WW1A 4L8QA 2Q4SA 3MLLA 1EAH1 3M70A 5K0UC 1OVSA 2XUEA 1C8M2 2B9UA 3I2GA 1CZVA 3AK0A 5EXOA 3KV5A 4AHYA 2LUWA 3TOJA 1Z78A 4ZS2A 3WX5A 5FPXA 3RZKA 3QLQA 1BBT2 2MEV2 2D6OX 3DGTA 2AACA 3GALA 2VL4A 5T5LA 1KJLA 4S2DA 2VXRA 2ATFA 4FAGA 1UU6A 2ZBJA 4DRVA 4WVVA 3ZN6A 1IKPA 1VRBA 4NIGA 4OI4A 5C8CC 1SLTA 5IVEA 2VQ0A 5BY5A 2ZTNA 3M8LA 4WM7A 3PLQA 2W2IA 3O5SA 4FQZA 4N9IA 4UF0B 3OUJA 4XQ4A 4EWEA 4MGSA 5FYZA 1XC6A 4Q5OA 4E4HA 5KWRA 4CU7A 4QKBA 2EICA 4XYXA 1Y3TA 1LGBA 1POV1 2QBXA 1VRH3 1SFNA 3LD8A 4FOWA 5FP9A 3P5BA 4PIXA 1UXZA 1LOBA 2A3XA 1AF9A 3DECA 1W9FA 1BVP1 3HNYM 2UWBA 5EZWA 4DUWA 2LALA 2ZGSA 5JUVA 2ERFA 5EJ3A 1PO23 2A6VA 2HYKA 2VBDA 2KD7A 1ZX5A 4ARXA 2H6CA 4PDWA 4PIZA 3VKOA 4MO3M 1NA1B 3NNLA 2CGPA 3VV1A 3U4XA 5LBBA 2YPJA 1I9RA 1JU4A 4M0NA 3U78A 2YFZA 2BNMA 1YLLA 3DUIA 4Q8LA 3HT2A 4BCUA 3VLBB 3EYPA 4LKSA 1APNA 5D1IA 4XF0A 1TME1 1WW4A 1VLNA 4H55A 1D2SA 1HQLA 1V9U1 5A32A 3LKJA 4W6YA 2D6LX 2MNGA 2VNOA 1J1TA 3DPRB 4LO5B 5F3IA 5FBZA 4IUGA 2WNUA 4CCLA 2P3YA 1AXZA 3A23A 4BMBA 1ZZ8A 5I0RA 1W6MA 4NHKA 2YC0A 3OGSA 3LCPA 3AMMA 4DZGA 1H4GA 1RUE1 3EBRA 3JBG1 4XFFA 2WO3A 3CIHA 2ZS6B 4S2FA 1XOYA 2R1BA 4Q0UA 2XPJA 2D7FA 1DP0A 1X36A 3VZOA 5T50A 3TWIA 1CAWA 3N35A 3ZYGA 2GDFA 3AFKA 4CP2A 2H6BA 4GALA 3LSEA 4L2NA 1G7YA 4QDQA 1BEV2 4YLZA 3K3OA 5DAWA 4D6RA 1YJKA 2J1SA 1WCSA 1CX1A 3DPRC 4Q1RA 1AR71 4GKXA 3MF9A 1O4TA 4BZ4A 4OCTA 4YARA 5IVCA 5L7OB 3H1WA 5JPMB 1Q8QA 2DCKA 4EN0A 1H30A 4XVHA 4TTGA 2VUDA 2JENA 3VN4A 5BNQA 2Y33A 3VBHB 2DVFA 1RXGA 4BXFA 2IXCA 5KR7A 3THPA 1SCRA 4XJZA 1REDA 5T5JA 3ME2A 1KGYA 2DFBA 4QX7A 1OPMA 2VAUA 2W52A 4IGOA 2DF7A 2VPVA 4Q0SA 5E89A 3K2OA 5FYMA 2GMPA 4AL9A 1VBB3 3CQOA 1YI7A 5AFEA 4LE3A 1VRH2 1EV13 3EB7A 4HL0A 3FJSA 1HRV2 1REFA 2RDSA 1XNKA 3LDRA 3GBGA 1QH7A 2IZWA 1K42A 1ZBA2 2LS6A 3WDYA 1MZFA 3VHPA 4MH0E 5F6LB 3DYMA 2BFUL 1QXRA 1XRUA 4Q4X3 4UW5A 2K2SA 1PO21 3U37A 2VD7A 4IEXA 1UWWA 2IFRA 1QJZA 2B4KA 2VULA 1UU5A 3N9OA 5ERLA 2Q1MA 3ZN4A 2IFWA 1JUHA 2P1BA 3IWZA 3LOIA 4JZRA 1R083 2VOXA 4XFGA 1LULA 2BU9A 4EN9B 5JSPA 3DV8A 3ZFEA 3I4IA 1L7LA 2DVDA 4GH4A 5FLJA 3OYWB 2VVEA 4IEPA 4P9JA 4RQPC 4EV0A 1VBE3 5FDBA 5L36A 3O1SA 2A6ZA 2GN7A 3BU7A 3IAQA 3I3DA 5CU1A 1YRZA 5F2WA 5FIXA 4WM8A 4DO0A 4YSFA 5I0UA 1K5JA 5EJ1B 3OEBA 4QHOA 4HK8A 3SKVA 3SXWA 3O1MA 1MR5A 1VAMA 3DYOA 3LEGA 4PQ9A 1W06A 3ZN5A 3GHNA 1QDOA 4MXWA 1W9WA 2KA3A 2ZGLA 3POIA 2E7QA 4JDMA 3CO2A 1ZBE2 4LBLA 5FMOL 2VUCA 2D3PA 3O1TA 4QMAA 3CEWA 1O3SA 4NRQA 2VE1A 5FKBA 3WCRA 3ZLIA 3R6SA 3GBFA 4RS5A 5C4WC 1JYXA 1POV0 3OBTA 3SHRA 4BLIA 5F5AA 3S57A 4GULA 2YBSA 3O0XA 5B4XA 2WAAA 2RS11 4FPOB 1ZZ7A 2JDAA 4K9SA 4XFBA 1J1LA 5FYSA 2IVJA 4HFSA 1V6OA 4MV2A 2NLRA 1UOFA 3WT3A 1QH6A 4EN6B 4IE6A 1V0AA 5IATA 2W68A 5BXXA 5CFCA 2D6PA 3R05A 4OYUA 5F8PA 1SG3A 3AZXA 3Q8BA 3ZFGB 2BOJA 2D98A 2O8OA 3AP7A 5BNNB 1BK1A 5DUWA 2R041 5T54A 4EZHA 1VBB1 4I01A 1K5MB 1NXD1 1IQDC 1W2NA 2QE3A 2W5FA 5CAZA 3H9AA 3N9NA 2RMU1 1NQDA 2A70A 5E16A 3GJAA 3C8XA 3M3CA 2HJIA 4HETA 3NNMA 3MPBA 4S2HA 2ZGTA 3WNPA 5HXMA 1L3JA 1XPWA 4WVMA 1LHUA 4Y5Z0 5C5UA 1J3PA 1RXFA 3KZ4C 4HVRA 4XZUG 3MW2A 2I74A 1G9BA 2ETEA 3EO6A 4UW6A 1GWKA 3M2MA 1CZTA 4HN1A 1GICA 2VZSA 1B09A 1Q5OA 1R081 3FWEA 1MZEA 2XLGA 3A7QA 3WQ0A 4AVTA 5IVVA 2BP6A 4YVSA 1O8PA 1GWMA 1Y4WA 2YU2A 5FFOC 3J26N 1A6CA 1UZWA 1VBE2 1ZZCA 2QQLA 4FP3A 4GQ7A 2V5DA 4BWOA 1AYN3 2Z79A 1V6KA 2NYYA 3RYRA 3ZOIA 4ONUA 4I0BA 2D5HA 5KHHA 2FMDA 4LHNA 1FI2A 1QJX3 1NLRA 2UYBA 5DUUA 5IK4A 3PJYA 3PTYA 3U10A 1ULPA 1F35A 5FPAA 2CDOA 2JE7A 2WKKA 4JV4A 4LK7A 3AL6A 1ULGA 3CLPA 3IPVB 4NO4A 5FCCA 4HKOA 5KXBA 5KHKA 3NAPA 1VMHA 2WO1A 2ZOEB 1S0GA 4K1YA 1ND3B 4KMQA 2XBO2 3E97A 5FZ0A 2C9KA 3ZXJA 5LBEA 1LOGA 4PIYA 2ZHLA 5CBLA 3K46A 4GD4A 3VHNA 1H1IA 4B7EA 1TZOA 2VNVA 1K3IA 3C7EA 4AI0A 4C0HA 1ZVFA 2UURA 5GZEA 1F5FA 1OUSA 5FYIA 3QCWA 5JPNB 5GLZA 5K8SA 1FT9A 5A6YA 2A5ZA 1GU3A 1HJFA 4P9XA 4EWAA 3HR9A 3J7LA 3VL9A 3PNAA 1AZDA 4HXCA 3BKZA 1JYVA 2D93A 4D94A 3V0AA 3LEIA 4AHWA 2PN5A 5FUPA 3KWVA 1OKOA 4FT8A 4L9BA 3ZIXA 5CKNA 5LY1A 1JXNA 3LOBA 1NLSA 4QPGC 1W6OA 4BQ4A 1KEXA 1MEC3 3BIWE 3PUSA 3E6BA 2D40A 5FY4A 5FY1A 4DY3A 2FDKA 2R30A 2UYAA 2VZRA 3MEPA 2AENA 4W4ZA 3A21A 3SLIA 2WC2A 5AVPA 2Z2SB 1B35B 2VMDA 3FBMA 5FPZA 2TUNA 3TN92 1XJAA 3O14A 2JICA 1RMU3 2DURA 1QDCA 1V6LA 2CY6A 3ZO0B 3O1OA 2OA2A 2FDJA 4FSJA 2LTNA 3JD72 5DG1A 4YG0A 4RD7A 2VJXA 5E1RA 1NCRA 3GF6A 3PHMA 3WNLA 3I2JA 1LECA 5JDBA 5FYBA 1X8EA 2UU8A 1KXGA 3FZ3A 5J36A 1DYOA 1IHMA 3POEA 1GZCA 2JG9C 4JDNA 3LAGA 3MLKA 2YZ4A 2JWPA 5CIRA 3FMGA 1QJX1 1B35C 3OEAA 1RUI1 4YGBA 4MGYE 4FTBA 1ND2B 1CZSA 1WMXA 4IEWA 2ZZJA 2JDPA 3AKRA 5ABJA 4PDWB 4YVWA 3S7IA 2JDMA 1KJRA 1A3KA 2DBNA 2GC2A 4FPYA 4LLOA 4BJ0A 4I09A 3OGRA 4EE2A 2PAEA 3D4KA 3WP5A 1PMHX 3SEEA 3AMPA 3N9PA 1W8OA 2VQUA 1YXWA 1U5XA 5A33B 2L9LA 5GM0A 2WBKA 5DAXA 1NX9A 4YW4A 5A32B 3VD3A 1O59A 3USUA 4OHYA 4META 4FFGA 2BQPA 2F6BA 2BBVA 2JG8B 5C3RA 2VZOA 4LIUA 1EPWA 3FHAA 4IE0A 4N7UA 1N3QA 2DTYA 2CAUA 1CONA 1OQDA 1RUG1 1TMF3 1W6MB 2X53S 2ZKLA 5JCTA 3OUIA 5JIUA 5LB6A 1ND2C 5FZ3A 4ES9A 1NCQB 5JOXA 2AEZA 4XZPA 3VB9A 3UGFA 2R072 1OKQA 4FPGA 4XJ9A 4YW2A 1W6QB 5BNOA 5FYHA 2D97A 5F2SA 2O14A 3WF4A 4PF1A 3J8F3 1PGL1 4OHXA 2J1TA 5KC6A 5FBJA 3VBSC 3HBZA 4LBNA 4QU2A 1MEC1 4V2WA 1DG6A 3KSCA 1LENA 3MIDA 5HCBA 2JD4A 1FPN1 2HWD2 2ZEXA 2PQSA 4XACA 2CYFA 3P3PA 4RR3B 1F2NA 1Q8PA 5FZCA 2YMZA 3KF3A 1AR61 2P3JA 4GB32 4A3XA 5FRAA 1WZXA 1R64A 2WSUA 2JG8C 1W0OA 3HPNA 5I8TA 1CX4A 4TWTA 1HV1A 4XIOA 5FZOA 3BTZA 3UL2A 3E1F1 2BOIA 1OFNA 1US3A 2JDKA 3H50A 3L2YA 4MUVA 4UFLA 1NCQC 5K4LA 3ZSLA 5I8YA 3AP4A 4IEUA 5L9BA 3ZXDA 2VVDA 5C9AC 1AL23 1AJOA 1VPHA 5T5PA 3IBMA 4CDUA 1VAVA 5SV5A 3SH5A 4RHV3 2WZR2 2YU1A 2GALA 4UBHA 3UJOA 1HXS1 4AEMA 2DVGA 4L92A 5FQ0B 1MS1A 5IVFA 3AZYA 4C90A 4XW3A 3WV6A 5I91A 3JUUA 5FZBA 3TRSB 2IWGB 2W9XA 4RR3C 2Q30A 2HWC2 3SKJE 4DXSA 1GQPA 1IS5A 3APBA 5FYTA 1ZNPA 5FZDA 3T2QA 2QNKA 1D4M2 5J7MA 2JE9A 5CFDB 3IKWA 4GIQA 4YM1A 4I3GA 3JQWA 3QH7A 2YXSA 4NWWA 1PK6C 4IETA 5IVJA 2XVLA 1J3RA 1W3VA 3BOWA 3C7GA 2RS53 5FZ7A 2WWJA 1GP4A 4K40A 3ZFEB 1NE6A 4IXLA 3T2OA 1H8VA 3I2OA 3PVOA 1AR93 3Q8FA 5IVBA 2RM21 5KHGA 1QJY3 2VOTA 2WFF3 5I0TA 5F9TA 1ENRA 1TMF2 1JHNA 1YO8A 2I07B 4QHZA 4BDVB 4WM8B 1ZZ6A 2YBKA 1VB4A 4HSJA 1RUH2 1NZCA 2WT1A 5D21A 5DDJ2 1N47A 3B69A 4CDQA 4BQ3A 3ZFFB 4AGRA 1W03A 2XXZA 2DU1A 4CCEA 4P9LA 2AREA 5CFDC 4R8HA 4LO6B 5IUQA 5FP7A 4QQLA 1QIQA 4CDWA 2BBAA 4Y20B 1RIRA 4COZA 4R9BA 4RS5B 3VDDB 2PMWB 4OMDA 1UZZA 3E5XA 4Q4W3 1IG3A 4KG0A 3HN1A 2NMNA 1DLLA 4JRLA 3WOGA 2XJUA 3MHZA 3OPWA 4AEDA 3R4UA 3RDIA 4B8EA 4H7LA 1RUF1 2VGDA 1HJGA 2CTVA 3HD8B 3EMRA 3NL1A 1PX3A 3WHTA 1QQP2 4HONA 5FP8A 4LR4A 1F4HA 1GP5A 4Q0VA 1W8FA 4NROA 5IJRA 4BXSV 2OYZA 5A3NA 1SPPA 4YGCA 3ZFFC 5L9VA 1LESA 3A22A 1OOPA 5FYUA 1ASJ1 1LHOA 4RA0A 4D69A 4HKLA 3VKMA 3T0AA 1UYXA 1F5JA 2A3YA 2GMEA 3CU7A 1O91A 5JMCA 3C7HA 3AKTA 3D8CA 3T0DA 5LZ6A 5FPVA 2BGCA 4YNIA 4Q1PA 5LASA 2OKXA 1GOHA 3ZX7A 3VDDC 2ILMA 3HAGA 3WHUA 1AYM2 3MW3A 4XJWA 1RUD2 4H14A 4ZZ8A 3RZLA 4KGQA 3BVCA 3WLUA 4WVMB 1YFXA 2B9VA 4I0AA 4PI2A 5LW9A 4Q4V2 1DQ6A 1NG0A 5JLVA 5C7GA 5A6XA 2E32A 2X8KA 4OUEA 2D3SA 4K7JA 3CZJA 2HWE1 3BB6A 4Y3OA 2XB6C 1HX6A 2FCUA 4WZCA 4OVEA 5IK7A 1WWYA 1VBA2 4MSVA 4YRDA 1PIV3 1U12A 4QGMA 3DN7A 1AR92 4KG8A 2G1MA 4B1MA 1QJY2 4L11A 2WFF2 3H8OA 1F31A 2BRTA 2V09A 1S55A 3D82A 4UWDA 4AVVA 3J4UH 1UKRA 3L2HA 3M1HA 1BMV2 3LFMA 5T55A 4LBJA 3KCCA 1S0DA 5LATA 2WWSA 2FZ2A 4D3WA 5LRSA 3USSA 2YBPA 1DFQA 3UNPA 2ZGPA 4QB6A 3MIGA 4COVA 5ACA3 1YQ6A 4A2UA 4DEQA 2HBTA 2ADDA 1W9SA 3BTAA 4WVZA 1W99A 4BQWA 1GSLA 1RJ7A 2ARBA 1OA2A 1R1A2 2DDUA 5C5TA 1CPNA 3WDVA 5DAQA 2R063 3LIHA 3MFCA 3POYA 2A71A 4XFAA 4XXAA 3SMHA 2QJVA 2VZPA 3DXUA 4OHWA 4Q4W2 5FZGA 1EAH3 2OZ6A 3PMSA 2YC2A 4QQ2A 4HVQA 5GZGA 4D7TA 2IXLA 1RUNA 1JOJA 3ES1A 3FL7A 1POQA 4W8JA 3VZLA 4PJYA 1C5HA 4ZXKA 4IV3B 5GLUA 1C4RA 4LKDA 2Q8CA 5LA1A 3INAA 1NAEA 1OBNA 4G9SB 4XAEA 1GR3A 1C8NA 1CIYA 3ZSKA 2JECA 3WF1A 3V0AB 2XVGA 1M4WA 3SNMA 4CP9A 4FPJA 3KB5A 1J3QA 2MHFA 2PAKA 1ONAA 3EJKA 2BWAA 5CG9A 3WF0A 4JKMA 4NHMA 1IS6A 3T30A 4LBMA 3UKTA 4YZ3A 1POV3 1EY2A 1W6OB 1QJFA 1JYWA 3ORJA 1VBD1 2PHRA 5HCHA 1ZRFA 1FOD3 1AVBA 3NO8A 3B93A 2X05A 1YCIA 4JQTA 2G9GA 4UFJA 4LK6A 3UGHA 4BB3A 3TEZA 3ILNA 3IAPA 2D6NA 4LXLA 3WDXA 1AX0A 2MPFA 4IV3C 4S2GA 2WAOA 4YFZA 5J09A 1G9FA 2GC3A 2VQTA 3KF5A 3U75A 3K48A 1MZ5A 3CKHA 4WZFA 1T6BX 4BK5A 5LEJA 2Q1ZB 4IE4A 4QDSA 1J58A 1NCRB 2BW8A 3SQOA 4QQPA 2WO2A 3WCSA 2BERA 4C1WA 5JI9A 3N36A 3ZMOA 1TME3 3NJVA 3AXDA 1V9U3 3D6EA 3MO4A 4O65A 5I0DA 3GBWA 3T2PA 3WINE 2X09A 5HPOA 3AFGA 1OUXA 2JB4A 3PUIA 3ZKUA 1IPKA 2ARCA 4JGYA 4HZFA 5GLTA 1UCXA 1ODMA 4BK4A 1PGW2 1RUE3 5JSRA 2AGSA 3AKSA 3JBG3 1XYPA 4Q2FA 5ACA1 2C6SA 4UT5A 2AZ5A 4MGIE 3TAYA 1H2NA 2Y6FA 3LF7A 2PHDA 3RMYA 1XNCA 1QEXA 1Z7S2 2GNTA 3S5AA 1J84A 4YVWB 5ABJB 3VL8A 3OY8A 3H1YA 4RGAA 1RVF2 4Z2WA 1HN1A 2E51A 2R061 3ZDVA 4FPFA 2A7AA 4JCKA 1EAH2 3WNXA 5A1FA 4FPKA 1FNZA 1MVQA 1OVPA 2CHHA 4LOTA 1LCLA 1AR73 4LUKA 3USUB 4ES8A 1OFSA 4FOVA 4XFCA 4TYSA 4XURA 2HKXA 3LA2A 1MS0A 1AR82 2ZZQA 1XE7A 1WMFA 2BDRA 2JEMA 3I7DA 4FXKB 5A7PA 1S0FA 4FTSA 3D3AA 2V5YA 3MFAA 2B46X 2WZ8A 1LU2A 3VDCA 4Z8BA 3T08A 1NYWA 2PHFA 2P34A 2C24A 2Q8DA 2VBBA 1WD4A 2DU0A 1CJPA 1HW5A 4Q26A 5FWEA 4BE3A 2ENRA 4LEJA 5A7WA 2WL1A 4JQRA 4JRAA 3KQRA 4TZDA 4PLOA 3LA7A 4LTAA 5A3WA 1FOD1 2MEV1 3FHQA 4HBNA 4XDPA 1H8TB 4IQPA 5KXEA 4QXKA 4LNVA 3IM0A 2XHNA 2Q8EA 2C26A 2VZTA 4QWNA 2VC9A 4CUAA 5C71A 1PZ7A 4HOOA 1MQTA 2FD8A 1C1FA 4RSUA 1JMUB 4CZSA 2BVBA 2W08A 5BNPB 3OGGA 1UY1A 1QHDA 2IXIA 3K75B 4HLTA 4P9IA 4QGLA 1Y9QA 2J7MA 2HWF3 3N3HA 2A75A 1E5IA 2G4IA 2Q8OA 1V9U2 1LKNA 4XF4A 1UO9A 1FATA 4AVCA 1Z0HA 4ASMB 3FUQA 1CAXB 4XUNA 2WDBA 2RV9A 1KDKA 3M3EA 4W6WA 5DQ0A 3S6PA 1PX4A 3JB4C 4K21A 4YW6A 1C28A 1QJU1 1OH4A 1Q56A 1SLCA 2GP3A 1FMD2 1UYPA 1ULEA 3FLRA 3KT4A 4A6OA 1W8WA 3HQXA 4BPZA 2W87A 1H8TC 1WW6A 1WCUA 1L7RA 2ZHKA 4J25A 4AVBA 1W8UA 2DBIA 5D8AA 1HB2A 2QFEA 3MUZ1 1N1SA 4W65A 3WQ1A 1NA1C 2RJLA 3AYAA 2VW0A 2O8QA 5BNPC 4R4XA 1W8NA 4XQDA 2XWJB 4F3JA 4BQXA 5J37A 1DU3D 4JTNA 4WV8A 3DYPA 4QM8A 3VBUB 4JTOA 3KV9A 4V1PA 3FE5A 2WT2A 5C70A 4DIQA 2FDHA 1RHI1 1AR72 2VMGA 4GAZA 2RR11 3MIBA 2J1UA 2ZMNA 3Q8CA 4OLLA 1VBC3 4BHPA 1H9WA 1LEDA 4H3WA 5FP3A 2QQNA 2RS13 5FZFA 2JIJA 4AGGA 1H9PA 1CJDA 3KHBA 1OPOA 3U07A 4TLFA 2Y60A 2UY9A 4DB5A 5IWFA 4U36A 2VCCA 4CDQB 2AYHA 4FPCA 2XOMA 2IUWA 5FPBA 5LEKA 2FBEA 4DPNA 2R043 3NKGA 4JX0A 2OUJA 1W2OA 4OZOA 4Z2AA 4P02B 2XMLA 1JZ3A 2ZABA 1JU3A 2WA4A 4IV1A 2RMU3 3VBUC 3VD9A 4CDWB 1XE8A 3T2TA 3B9CA 4ISQA 3UETA 2PLV3 4ZU5A 1JS9A 2VXJA 5LA2A 1PO22 5DAPA 4CCKA 3WW4A 5L7OC 5I8SA 5ISLA 1WCKA 3ACGA 4AQ6A 4D7YA 1DZRA 1O5LA 5FY5A 4AEDB 2Y38A 2ZGUA 4E27A 1UY0A 4EWDA 3LB9A 3VBHC 5FMCA 2ES3A 3CHXA 1YIFA 4RL7A 3HQRA 1DQ4A 1AX1A 1QXPA 4OFGA 1BYHA 1X9PA 3MPPG 2XL9A 2HWF1 3AX4A 3AZZA 3BCWA 5F1RA 4B4QA 1Y9MA 2YYOA 2GU9A 1L7QA 2BYVE 1OOPB 1NE4A 3BU0A 4FBFA 1HRV1 5DABA 4R9DA 3ZXGA 5FZLA 2B39A 1EUUA 1G8WA 1ZBA1 4N53A 3BUCA 3LQCA 5GLWA 5GLVA 2ZGNA 3E5QA 3ZYPA 5FP4A 3I8TA 3AYCA 3T1LA 1YQ2A 2VCMA 3E5UA 3OOXA 3HNBM 4YZ5A 1CN1A 2JJ6A 5TSWA 4PLMA 1F15A 1D0GA 3B7MA 1I1EA 1H2KA 1D0HA 1YC61 5FZ8A 4XE9A 2VY0A 3GZTB 4CCNA 3TEXA 4XBLA 4JGZA 4AI1A 4GWIA 3ZR5A 5FPUA 2QQPA 1ZRIA 1CAUA 2WNVB 1PM4A 3ZXEA 3O1VA 4UOJA 4R52A 2YHJA 4KWUA 4A7KA 4MADA 1O4ZA 4MHUA 2UWAA 4BMEA 2XGXA 4E4DX 3BODA 5CVRA 3S5QA 4RGKA 1C3HA 1S0CA 2RS12 2F4LA 1VBC1 1QXJA 1HB3A 2DWRA 3B01A 3C7FA 3KM5A 3KT7A 3THTA 1V00A 2VECA 2HEWF 4JKKA 2VMHA 2W94A 3AKQA 5IFTA 4CEWB 2JB8A 3RQ0A 2VBPA 3VZMA 3FFQA 4AQTA 2EXIA 4IE5A 2VMEA 1GWLA 4XCBA 3WG3A 4Y33A 1UNBA 5HBAA 4IEVA 1ZREA 1VBB2 2C1FA 2JX9A 2DCTA 4CUGA 1EV12 1R091 1BXHA 2WRAA 5GKAC 2WNVC 5GZDA 4DEVA 3J7NA 4XCAA 2ZEWA 1RYYA 1LOFA 3QD6A 4N43A 4AAXA 5IYYA 1EPZA 5FLIA 1LB2A 5HCFA 3PUHA 5DN2A 4DS0A 4Q4X2 2PLV1 3RZJA 1NQJA 1JTZX 1NXMA 1GOGA 1QOTA 2I2SA 3SEPA 1GV9A 4QKNA 2ZKNA 4YZ2A 2XQXA 2LRPA 4GXLA 2P4EA 1IKQA 4QKDA 5LA9A 4BLJA 4G3YC 4DXRA 2WQ4A 1SQ4A 5EJZB 4CEWC 1ZZBA 1SLAA 2PA7A 3D0SA 4P08A 3LZZA 1R082 1KQRA 4CEYB 2Y0IA 5LA0A 4AAPA 4FFHA 4Y22B 3ZFGC 1UOGA 4CUBA 4LBQD 3VDBA 3DCQA 3OCPA 5BNNC 5GZCA 4CP9B 2VMFA 3IMNA 3I2IA 4EJRA 5A6QA 1IOAA 5T52A 2BJSA 1K5MC 2GAUA 4E9KA 2K0GA 5HV0A 4UXAA 5E88A 5JAXA 3WNNA 4QB2A 1U0AA 3VD7A 2X5IB 4NMIA 3ENRA 1RJ8A 3M4FA 3AJZA 1RUI3 4QXBA 3GNEA 4K8FA 1LHNA 3AMQA 4DQAA 5J48A 2P5BA 3ITQA 4E2QA 3B94A 3CJIA 2DVBA 3KS7A 1SCSA 2WINB 2VCBA 3TBDA 1HLCA 3R0RA 3I59A 5HV4A 4QPIA 1Y43B 5A1LA 5EIYB 3WDUA 4CEYC 3F2ZA 5LBCA 1D7PM 1XXNA 2WSVA 4G4FA 3RVHA 4J1XA 5JIAA 2V73A 4UW4A 2XG3A 1A8DA 2WYFA 2XLFA 1UU4A 4HPKB 4BIOA 5FZMA 4NIHA 3WDWA 1CR7A 1ZA7A 4F8AA 5ANNA 3IMMA 4XIKA 3MI8A 2X5IC 2ET7A 3UKNA 3TB0A 4CDXA 1TG7A 1RUG3 4Q8KA 4R9AA 2A6YA 1UW8A 4GWMA 2IC1A 3PU8A 1RL3A 2OZJA 1CIWA 4FP2A 1FV2A 2R1DA 2WUHA 1GBGA 1BK0A 4LIVA 4TLGA 1O5UA 1GZWA 4MVTA 4IGPA 4QAWA 5FZ6A 1AXYA 2DVAA 5J3UA 2ET1A 1UX7A 2VUJA 2W0XA 2ZGOA 3AMNA 1UYYA 1QY4A 4XFHA 2OPKA 3J7HA 2CDPA 1SHWB 2J1AA 3OY8B 3QOPA 1ND3C 1JHJA 3OD4A 1Q8VA 5T5OA 1FPN3 4HT1T 5AVAA 1EUTA 1FAYA 4HKWA 1PNGA 2EIBA 1AR63 4I3PA 4AEJA 5C8WA 3VBRA 1COV1 1PVXA 4FTEA 1UOBA 4WBBA 5KC5A 1MVEA 1Y9GA 5G05L 1YIPA 2UWCA 2VG9A 1JZ2A 1VMFA 2AR6A 1WGPA 2EA7A 3MLJA 4KNCA 3VBOA 1CAVA 3MDPA 5F7UA 1YQ5A 3NVCA 3VHRA 4XOGA 1KS5A 1LHVA 1OQ1A 4NE9A 4B1LA 3ZN6B 5CKQA 2W39A 3OF1A 4QPYA 1E5RA 1QMJA 3AZWA 3BYWA 4KWLA 5DXDA 4XAAA 3N7LA 5F3GA 4P00B 1AYN2 4WM7B 5FY7A 1HXS3 3GXUA 3PL0A 4XQWA 5FK8A 5A7WB 3VBFA 1PNFA 1W9YA 2SBAA 2QDNA 1QJX2 2WN2A 1ZA4A 1RUI2 4KWKA 4QT6A 3TN91 4XBQA 1DYKA 1CESA 2VCAA 4L97A 3MIEA 3LDKA 5DZFA 1Q8SA 4XBNA 1XYNA 3BI3A 1GNHA 1W39A 3MZHA 1QNWA 3BPSA 1YJLA 2AUYA 5L73A 5LCWL 3QACA 1T6GC 2A6WA 1MQTB 2EIGA 4N9HA 5FXWA 4E4ZA 2QQIA 4UAPA 2GSYA 5K0UA 3ZSEA 3LPGA 2D44A 1MS8A 3RJRA 2HWB1 2XLAA 2DCJA 3I2KA 5FZIA 4WM7C 4JAAA 2BPA2 1PMJX 1C1LA 2JDNA 2Y6GA 5LWBA 3MV11 2RM23 2WQZC 3VHOA 1I5ZA 5K7PA 1UPSA 1GLHA 3B3QE 1SDDB 4LO8A 4FVVA 2WNUB 5C8CA 1RUG2 3EQEA 4I2OA 5ANQA 1SFPA 2ZEYA 5M0TA 2OT7A 1PMIA 3BOPA 3JU9A 3MV01 3A4UA 2IXJA 4Q0QA 2IVIB 2GC0A 4O61A 3B9IA 4M3CA 4Y5TA 4ZY9A 4PDWC 2NZ9A 5D8AB 1G9CA 1WW7A 1Q43A 2E63A 2YV8A 1PGL2 1W8ZA 2PYTA 3IN9A 5H9RA 2V4AA 2OPWA 1OLRA 3AVRA 1MEC2 1CAWB 2EIDA 4YW7A 1OF3A 1FPN2 5FY8A 2XJTA 2ZMLA 2Y6LA 5IFPA 3O0WA 1ZRCA 1AR62 1C57A 3S30A 4IDZA 1RMU2 3POFA 3URFA 3C2UA 3U1XA 2R0FA 1XYOA 4ZU4A 2WNUC 2RVAA 2Y26A 3KT1A 3R4SA 5HI0A 1RUF3 3PDQA 4GJZA 3V0BA 2DFCA 1HRI3 4KQ7A 4ISRA 2OUHA 4UF0A 2VOVA 3GGLA 3Q8EA 1H4HA 4LPLA 5A7SA 4B7KA 4YW5A 5FZ4A 3I3EA 4CVUA 5F37A 5CYYA 1ASJ3 3I3QA 2J1VA 1A78A 1HXS2 4ET7A 1DHKB 4FPLA 4Y5SA 3ZM8A 4D6SA 3H3ZA 4NUBA 4IV1B 1PZ8A 4BU2A 5FWJA 4CE8A 4JHZA 3RSJA 3LEKA 3UYJA 4Q4Y3 1V6NA 4PHZA 1X9TA 3ILRA 4LMFA 3QH6A 5FO8B 3LGRA 4ZZ5A 3AP9A 3VDAA 4UYBA 4WVWA 3PUQA 2HWE3 5FJHA 3POBA 2YROA 1RC6A 3DPRA 2WZR1 1YI9A 1YWKA 5EYXA 5EP9A 2E53A 4F83A 4GH4B 2RM22 1NY72 1AX2A 3NQHA 5IAXA 3RZZA 1HDKA 1JYIA 1U5ZA 1WMDA 1PVC1 3ZMNA 2BVVA 1UMHA 4N53B 3AMHA 4XJUA 4Z1VA 4DY5A 3J9SA 2QQJA 1YQCA 1BCXA 5BYNA 1IPSA 1OLQA 1OD3A 1D4M1 4NPMA 1O6UA 4BM8A 3LIGA 3HQUA 3J8F2 4MXWB 1RTVA 4CCCA 1RUC1 4LJHA 2H0BA 2RS33 4XTPA 3EXUA 1GZ9A 2A3WA 5F32A 2P2KA 3H0OA 4AFDA 3WUCA 1W6PA 3ZFEC 4FFFA 4EYUA 4GH4C 1H0BA 1GNYA 4LKEA 5AC93 4PLNA 2CNAA 5A3MA 4BYYA 1RUOA 1RUF2 2WNEA 4ORFA 4FAHA 4ZS3A 3DEMA 2YGMA 4E2SA 4LO7A 2Y64A 3WQ7A 2B8MA 2CWSA 1HRI1 2WS91 4WM8C 4CYDA 2ZJCA 1LJ7A 4QXCA 1H1MA 3LE0A 4X8PA 5FO9B 4RQPA 1P8JA 5F5QA 1AL22 2VM9A 1AXKA 1QOSA 5CFCB 2W92A 4AFCA 4RHV2 2OXBA 3LA3A 4YM2A 1F4AA 5IAVA 3UGGA 2PHXA 5C3SA 3RGBA 1DQ5A 2N7GA 3N9LA 1MZ6A 5A1AA 1OA3A 3RFRA 4K1ZA 4AEKA 3TEWA 3ES4A 3KQ4B 4RS5C 1VBD3 1DYPA 2E31A 3CBNA 4KBBA 4N43B 1QU0A 5CISA 5JXJA 3HIFA 1YYNA 2A73B 2HYXA 1W28A 1PO13 2QQKA 5FAXA 4M3CE 4Q4Y1 3ZPOA 3OBZA 1G6NA 1HN0A 4OZXA 3UJQA 4EN8B 3VZKA 5C4WA 1BVVA 5FO7B 4MZUA 5FY0A 2P3IA 2HWE2 3OYWA 4IEYA 4Z07A 2Q5TA 1IQAA 5DG2A 4AR2A 2W47A 4J1WA 5CFCC 2RE9A 2RS52 1G9DA 2E26A 4YVSB 2VTFA 4IESA 3ABZA 1RUJ1 3GZAA 3BPZA 1HQNA 1VAKA 5DPNA 3WR0A 1N1YA 1S2KA 4QX8A 1W0NA 3SCGA 4BOWA 4LUMA 1DCSA 4D7SA 1R1ZA 2WO7A 3J7MA 1PHMA 3P6BA 2WIIB 4M00A 4Q4V1 2PXJA 1F9KA 1D4VB 1DGRN 1UOJA 4MLOA 1BQPA 1U5IA 2P17A 3V64A 3ZYJB 3WEZA 4XHBA 3AB0A 5F5CA 3TNPB 4ASLA 4AI8A 1TE1B 1JODA 3I59B 4NHYA 2K46A 1VBA1 2RS31 2WR9A 4QPIB 4QX2A 4B3NA 4FQ4A 3TNQA 4OHZA 3RPQA 3ECQA 2IXHA 5FOJB 3B00A 3NAPB 4A4AA 3K77A 1J83A 3OSDA 4YVSC 4AXOA 2JDHA 2JDUA 1JOPA 2QQMA 4UFKA 5AC91 4Z92B 2DTWA 1V6IA 1VP6A 4KH9A 3GYDA 3T0BA 1LNSA 1ENXA 4A6SA 4IE7A 4Q29A 2D5FA 4CDXB 2QVSB 1AHSA 5FJKA 5JZGA 1JZ8A 2YUEA 1SBDA 3RWKX 3NKTA 4AFBA 2NM1A 2ADEA 2V4VA 3I97A 2BGPA 5I93A 3UESA 3BTXA 3ZYBA 3QBQA 1REEA 2VR4A 2VNRA 3NAPC 3WVJA 3AP6A 1N3OA 1QKQA 3W5NA 4ZU7A 1JN2P 3ZSMA 1IS4A 4P9WA 5KBFA 4X6QB 2MEV3 3FUOA 5FZEA 1PO11 2DUOA 3NJZA 4CU9A 1EP0A 2EAKA 4FCAA 4P5HA 5F39A 3VBRB 1CQ9A 4Y4RA 1UZVA 4PCRA 3AKPA 1SLIA 2G9FA 3SCHA 4D8MA 4M0HA 3VBOB 1LOCA 5CKMA 4HK9A 4DUVA 1I5PA 1UYZA 1FV3A 3I54A 1U5YA 1PIV2 3OJBA 1JOBA 4PT6A 3O12A 4CXYA 1XSQA 4M3CF 4XUQA 2CWMA 1JI6A 4COUA 1OQEA 5A3OA 4BQ2A 4HVOA 3W20A 1J59A 2ZACA 3OBAA 5HXVA 2LROA 3SISA 3HT1A 3VBFB 1QJU3 1O3QA 3ETQA 2WABA 4OHVA 4Y1XA 3IDBB 3MBWA 2TBVA 4W50A 2ZCWA 2ZX4A 3NV1A 4ZONA 3IPVA 3ZDSA 5A3TA 2E7TA 3AYEA 5ACA2 4EQVA 1DDLA 4B4RA 2PAMA 3VUOA 4TN7A 2R49A 3ZYRA 4KGGA 3G7DA 4QPGA 5FUNA 3WD5A 4P14A 4CU6A 1UX6A 4OULA 3N4MA 4BISA 5KHJA 2YGLA 4YW1A 4OI1A 4Y24A 1H2MA 2R062 4P5YA 1W04A 1LOAA 1NCRC 3X29B 1XNTA 1RINA 1RHI3 1O8SA 2ARAA 1DGRA 1RITA 2ZGMA 5JXIA 1G9AA 2RR13 3UT0A 3KMHA 1JYTA 1W2AX 3FFZA 4FPEA 3FC0A 5F5IA 1MS4A 4Q27A 4CA9A 4M01A 1O3TA 1IG0A 1OLMA 3MIHA 3FLPA 3ON7A 5A70A 1PGW1 2EALA 2FMYA 1VE0A 1XNDA 1UL9A 2OQ6A 4GZ9A 2YC4A 3AJYA 2PTMA 1Z7S1 5APAA 1BZWA 1AUYA 2WQ8A 3NSTA 2O0OA 3NV3A 4M3CB 3IZOA 2JG9A 5ABJC 4YVWC 5BNOB 3I3MA 1ACCA 2FHRA 3POWA 1B35A 3IDAA 4XTMA 3KV4A 3VGIA 1BEV3 5H9QA 2Y6JA 1C8M1 2XH6A 3BTYA 1O3RA 1YFWA 3GM8A 1FOD2 3KVBA 1GYKA 1BBT1 3MUY1 3CZUA 1WUVA 3CF6E 1T2XA 4LHLA 1Q8OA 4GMP1 1AR81 1DGLA 3PIJA 3V0BB 5FZOB 4FFIA 3THDA 3WG1A 4AFAA 4DOUA 1E5SA 3N9MA 4NHLA 2WFPA 1NKGA 1VB2A 1KITA 3I2DA 4B4PA 1JZ6A 3H1MA 2NQYA 5KHIA 1TME2 3HBKA 5E6HA 5BNOC 4CDUB 1HRV3 3WG4A 3M3IA 2JIGA 2F17A 1QJU2 1ND2A 1ZBA3 1GUIA 2YY1A 1WD3A 4AGVA 4FOYA 3RNSA 4BH9A 5AFBA 1RUE2 1ULDA 3JBG2 2PHLA 4CRQA 3C7OA 3P1IA 1DQ0A 3BIEA 1W8TA 3PTRB 3OD0A 2CU5A 4MXVA 3VBSA 1TVGA 3ETPA 4AG4A 3O1UA 2D3RA 1GZTA 2W1WA 4AVSA 1DQ1A 5FZ1A 2W1QA 2JXAA 2XVKA 2YPDA 5A33A 3HNMA 1JYNA 4MGQA 3O0VA 4LBQA 4EZ4A 3IT8A 4N8MA 4CXXA 4JHTA 4TXWA 3LFIA 2BEOA 2JG8A 3ATGA 1RHI2 4CDUC 2RR12 2QCSB 4BIFA 4YYOA 3I2FA 4LQRA 2VZUA 4CP1A
chains in the Genus database with same CATH topology
1FMD1 5BV6A 1NCQA 4ZKTB 1QOOA 2GNMA 1W6QA 3VZJA 5C9AA 4XJ8A 4LULA 4AYUA 3KGLA 4HMZA 3M3OA 4Z82A 1HKDA 2QZ3A 2A6XA 2DV9A 3ROUA 5BUVA 3DL3A 3CL1A 3AM2A 1ZBE3 3FHIB 1QF3A 1OSGA 4R4ZA 1S0EA 2RJKA 1R093 1WW5A 4RR3A 3D5OA 3U0ZA 1BEV1 4O9GA 1BKZA 1DZQA 4L99A 5JR7B 4Y4YA 4E4SA 1W6PB 2CAVA 2H0VA 1XU2A 2XKOA 1SBFA 2HEYF 3W59A 5J96B 4YG6A 4X6RB 5DUVA 1OD5A 3PVNA 1WLDA 4LBOA 4N90A 1M06G 1PK6A 1C5IA 1TNFA 4LT5A 2Y0OA 2HWF2 4CDQC 1ULCA 4RQPB 4XXPA 1SFYA 5FQ0A 1VRH1 2EXKA 5GJ6A 3LWCA 5DZEA 2DCYA 2WJSA 3WXPA 1Y7BA 1WA4A 3SH4A 4CDWC 5IK8A 1JUIA 2ZPXA 3N7JA 1UMZA 1LGCA 3MIFA 5JOZA 2C9AA 5CFDA 1DZTA 2LM3A 2BUKA 4AEDC 3CJXA 4QHBA 4B29A 4YFWA 3CNAA 2OIIA 3H7JA 3H7YA 1JH5A 5C4WB 1YNAA 2WT0A 3ACLA 1SMVA 1VJ2A 2FQPA 1SDWA 4AWDA 1FX5A 3RYPA 3VKNA 1IZ3A 1CGPA 1ULFA 1OOPC 3KD4A 4K6BA 1DIWA 2BWCA 2GZWA 1VBC2 2VU9A 4TSVA 4AQSA 2HEVF 4XMAA 3WDTA 5FTTC 1MS5A 1FXZA 1GQGA 5EFUA 4YZ4A 3ZFFA 4SBVA 1DBNA 4GMP0 3BALA 2VQAA 3SH3A 2EVXA 1S0JA 1ZBE1 4YM0A 2R042 3D0JA 4Y20A 1R092 2FZ1A 5H9SA 3VDDA 3G6JB 2XBO3 3EHKA 2RMU2 1GKBA 1LR5A 4AI3A 2WLQA 1QNYA 3NWKA 4LLFA 5FREA 4YM3A 3JCIA 2PLV2 4E2GA 1F8VA 4IEZA 5LK5A 1I6XA 1COV3 4P9YA 1DGWA 2VNGA 1UN1A 3WW2A 3KLSA 4SLIA 1SLLA 4XJAA 3IIAA 5JZGB 1KFUL 2OVUA 3ZSJA 1EV11 5J98B 3DF0A 1O4YA 1YFUA 3RWNA 1A8MA 4GKYA 2XKPA 4Q4X1 1ZRRA 3TN93 1ZRDA 1W6NA 1UAIA 1VR3A 2OW4A 4DINB 2ZMKA 2VH9A 3P3NA 4IERA 3JD73 3SCFA 4AHZA 2JKBA 3E6CC 1GQHA 1KRIA 1O7FA 4MYEA 3KCYA 2PHTA 2P37A 1QWRA 1S0BA 1X7NA 1ZM1A 5JZGC 1WCDJ 3WUDA 1VBE1 3UKVA 1V6JA 2R16A 4AFMA 5JOWA 3PVBB 2HWB3 2VW1A 3LSDA 3IDEA 3S7EA 2ZA9A 4J6GA 3V65A 3ZXLA 1MS9A 2PQQA 2NPIA 1Q3EA 1RGSA 1XU1A 3T1MA 2BFUS 1TEIA 2EXHA 3PVEA 4JGYB 1SEFA 2UY8A 3WY6A 5JVVA 1S1AA 2RHPA 5IT6A 1MACA 5EV7A 4XF9A 4PBPA 4QPGB 2YDEA 1IGOA 2O1QA 2XBO1 4Y1UA 5FOBB 5EYYA 1GANA 4LE4A 4IEQA 4I02A 3MGUA 1WLWA 3UV9A 5KXDA 4RFT0 4IV3A 3WP4A 1HIXA 1COV2 3S0MA 4AHXA 3ZIWA 1ZYBA 5GALA 3M7AA 5LRRA 4XHXA 5DZGA 2PELA 3RJ2X 4JGYC 2GMMA 2R073 4KWJA 2D6KA 3AXEA 3HWJA 2VVFA 3WZ1A 2ZX3A 4XILA 2NMOA 3TYJA 5FMOS 2VOKA 4OI0A 4FOQA 2PHUA 3POSA 1H1AA 2WA3A 3JZVA 4KU7A 3WP3A 2JG9B 4IL7A 3JQXA 4HN0A 4ITCA 2PFWA 2HWD3 4GB33 1TNRA 4I0WB 4K20A 1GFF2 4AI2A 3JD71 3RS6A 2CGNA 4A7ZA 2VMIA 4GA9A 4XPVA 1LHWA 1N1TA 2TNFA 1KFXL 1DF0A 4A7YA 4CP0A 2ZX0A 1AYN1 2HWB2 2WZR3 1WMEA 2KXLA 4CTEA 2GN3A 1PM7A 3ZVXA 4QQOA 4BA6A 4QGNA 1PVC3 2HWC3 3L9JT 1DGWX 2XJPA 1CPMA 2VOWA 1D4M3 4O9EA 1BJQA 3AYDA 3VBSB 1MQTC 4XMIA 5B2GB 4QQHA 2DUQA 2XJSA 1RUC3 3NV2A 3RRDA 5C33A 4Q0PA 3W58A 1CVNA 4LHKA 4QD2A 4DRRA 4LBQB 3JB8A 4NOTA 3H8UA 4MGZE 3VKLA 2SLIA 2PHWA 4KU8A 1N1VA 3IDCB 1URXA 1RUH3 1X50A 1AJKA 4K3UA 2WS93 5DDJ3 5C9AB 2R071 2GNDA 1YHFA 3VZNA 2WZPP 2C0ZA 2XJRA 5D8AC 3Q9OA 4U2AA 3A0NA 5HCAA 4NN0A 3GHMA 1H8TA 4C91A 2HWD1 4COWA 3R4DB 4AK3A 4GB31 5JSOA 3RI8A 1RMU1 1GNZA 1NA1A 4FO9A 2EAAA 5BNPA 1EYBA 2CV6A 2KM2A 4COYA 1WLCA 1QQP3 2P3KA 4XEZA 3ST7A 4OI2A 2XL7A 1PK6B 1V6MA 3RI9A 2BNNA 1OI6A 4AQ2A 1CAXA 1PGSA 2XHKA 2B42B 3ASIA 3FLTA 3MW4A 4W6XA 4LBKA 2E9QA 1FYUA 1OMIA 1RUJ3 4ATEA 3SITA 2K9ZA 1W2UA 4ATFA 3FX3A 1CD3G 1PVC2 2XJVA 3OBRA 1AYM3 3PJQA 2Z42A 4IV1C 1RUD3 2HWC1 2I45A 3OGJA 3A0KA 3ALQA 4YZ1A 5A3LA 5JOYA 2GNBA 1UIKA 4Q4V3 1IPJA 1LODA 1PZ9A 4AVAA 4NVPA 3VBUA 1RUC2 2ZGRA 4JGZB 4Y1YA 1VBA3 1CAUB 5L7OA 1NY71 2Z69A 4QM9A 4Y1ZA 1KDMA 1UKGA 3WG2A 3VBHA 1TQ5A 5SV8A 1TMF1 1W0PA 1G86A 5IK5A 1SLBA 3DKWA 1HRI2 2WS92 4N53C 1RUH1 4OUMA 5DDJ1 1FNYA 3VGIA 4JDOA 2CL2A 4R9CA 2Q0AA 3RG0A 1V70A 4MGKE 2R6QA 5CG8A 3J8F1 1HQWA 3K51A 4Q8KA 3MF6A 5EWSA 2IXKA 1ASJ2 2GH2A 2QDRA 2R32A 5FCCA 2VUAA 1LOEA 3N7MA 1R1A3 1KS4A 2BTVC 2VW2A 2ZAAA 5CB7A 4JGZC 4AE2A 3B02A 2ZX1A 3C3VA 1LTEA 3FBYA 2EF6A 3O7OA 1WBLA 2DYCA 4XDQA 2ZGKA 3ZXKA 4Q4Y2 2Z5WA 2GC1A 4KL1A 4YGEA 4QX5A 2B5HA 5CA6A 1QQP1 4X8NA 2C5DA 5K9YA 1YFYA 2EXJA 2ZGQA 4OUSA 2E7AA 1AL21 2XJQA 1WLTA 1X33A 2QZ2A 4NWVA 5FLHA 3UK9A 1JYCA 1SACA 2F4PA 2QUOA 4RHV1 2XUMA 4FPHA 2JDZA 1NOVA 3AZVA 1RUJ2 1UZYA 2B7YA 4FXGB 5E8AA 3ZXFA 3H3UA 2GH8A 1AYM1 1LGNA 1RUD1 4N43C 1LOFC 1MS3A 4NR1A 4AF9A 2TEPA 1W6NB 2D6MA 4DFSA 1IS3A 3V56A 1OHFA 2WNVA 3RMXA 2DUPA 3CJIB 1UF2C 4UW3A 2RS32 3ZXAC 2DCZA 4N7IA 1H2LA 2RS51 4YG3A 4MX3A 4XETA 3KGZA 1AR91 3MYXA 1ENQA 2ZHNA 1QJY1 2WFF1 5GZFA 5AC92 4LA3A 5JI7A 4CEWA 1BMV1 1YUDA 1ZZ9A 5DUXA 1XNBA 2BNOA 5BPXA 4AW7A 4NPRA 3ZFGA 4GWNA 1KD7A 4YGDA 5BNNA 1LRHA 2QKDA 1SBEA 2NN8A 1K5MA 1WBFA 1Z7S3 2ZHMA 1X8MA 1GZWB 3CJIC 2WLPA 1R1A1 4I30A 3W9AA 1RVF3 1JW6A 1JBCA 5H9PA 1ENSA 4EROA 4UBGA 4QPIC 1E57A 1N3PA 4INDA 3RYKA 4Q4W1 1DQ2A 4C1XA 1C8M3 1VBD2 4F7ZA 2ZAHA 3U11A 3NV4A 1AL0G 3ILFA 1X82A 1PO12 1BBT3 1S2BA 3KCXA 3NW4A 4IEOA 5KXCA 1VALA 2X29A 1VIWB 4CEYA 4GMP3 3VKFC 1AR83 4C0BA 4Y26A 3OPZA 2R0HA 4Y22A 4H7MA 4CDXC 1CAVB 2E6VA 3E6DA 3M3QA 3MICA 3B5LB 1HV0A 4XF1A 5I0SA 2NP0A 3WW3A 2X5IA 5T3NA 4XFIA 4BQ1A 4Y1VA 3ELNA 4LA2A 4DMIA 1I3HA 4HANA 3WP6A 4RGGA 5L19A 3GZUC 4JC1A 1XQNA 3N7KA 3VBRC 4PF5A 4YW3A 1UPIA 1LEMA 1ND3A 1OA4A 2XWBB 2D43A 3VBOC 2ARXA 1PIV1 2AH2A 4P9GA 4HPKA 3ZYIB 5K0UB 5C6CA 1RB8G 2ZX2A 3PMEA 1LU1A 1UIJA 2CGOA 4LO4B 1S0IA 1FMD3 1D2QA 1QGLA 4JVAA 5JPNB 3AP5A 4DNYA 1UD1A 3VBFC 4URTA 5C8CB 3HMYA 2B45X 4DXZA 1ALYA 5CNAA 5CADA 3OTFA 4XF3A 4HSLA 1RVF1 5F6KA 5JWPA 4PBOA 3WW1A 4L8QA 2Q4SA 3MLLA 1EAH1 3M70A 5K0UC 5EXOA 1C8M2 2B9UA 3AK0A 4AHYA 2LUWA 3TOJA 1Z78A 3WX5A 5FPXA 3QLQA 1BBT2 2MEV2 2D6OX 3DGTA 3GALA 5T5LA 1KJLA 4S2DA 2VXRA 2ATFA 4FAGA 1UU6A 2ZBJA 4DRVA 4WVVA 3ZN6A 1IKPA 4OI4A 5C8CC 1SLTA 2VQ0A 5BY5A 2ZTNA 3M8LA 4WM7A 3PLQA 3O5SA 4FQZA 4N9IA 4XQ4A 4EWEA 5KWRA 4XYXA 1Y3TA 1LGBA 1POV1 4FOWA 1VRH3 1SFNA 4PIXA 1LOBA 2A3XA 1AF9A 1BVP1 2UWBA 5EZWA 2LALA 2ZGSA 2ERFA 5EJ3A 1PO23 2A6VA 2HYKA 1ZX5A 2H6CA 4PDWA 4PIZA 3VKOA 1NA1B 2CGPA 3VV1A 3U4XA 2YPJA 1I9RA 4M0NA 4Q8LA 2BNMA 1YLLA 3DUIA 3HT2A 4BCUA 3VLBB 1APNA 5D1IA 4XF0A 1TME1 1WW4A 1VLNA 4H55A 1D2SA 1HQLA 1V9U1 5A32A 3LKJA 4W6YA 2D6LX 2MNGA 2VNOA 1J1TA 3DPRB 4LO5B 5FBZA 2WNUA 1AXZA 4BMBA 1ZZ8A 5I0RA 1W6MA 4NHKA 2YC0A 3LCPA 3AMMA 4DZGA 1H4GA 1RUE1 3EBRA 3JBG1 4XFFA 2ZS6B 4S2FA 2R1BA 4Q0UA 2XPJA 2D7FA 1X36A 3VZOA 5T50A 3TWIA 1CAWA 3N35A 3ZYGA 2GDFA 3AFKA 4CP2A 2H6BA 4GALA 3LSEA 4L2NA 1G7YA 1BEV2 4YLZA 1YJKA 1WCSA 3DPRC 4Q1RA 1AR71 4GKXA 3MF9A 1O4TA 4BZ4A 4YARA 5L7OB 5LK7B 3H1WA 5JPMB 1Q8QA 2DCKA 4EN0A 1H30A 5BNQA 2JENA 3VN4A 3VBHB 2DVFA 2IXCA 3THPA 1SCRA 4XJZA 1REDA 5T5JA 3ME2A 2DFBA 1OPMA 2W52A 4Q0SA 2DF7A 2VPVA 5E89A 2GMPA 1VBB3 5AFEA 1YI7A 4LE3A 1VRH2 1EV13 4HL0A 3FJSA 1HRV2 1REFA 1XNKA 3GBGA 1QH7A 2IZWA 1ZBA2 3WDYA 1MZFA 3VHPA 4MH0E 5F6LB 2BFUL 1QXRA 1XRUA 4Q4X3 4UW5A 2K2SA 1PO21 4IEXA 2IFRA 1QJZA 2VULA 1UU5A 2Q1MA 3ZN4A 2IFWA 1JUHA 3IWZA 3LOIA 1R083 2VOXA 4XFGA 1LULA 4EN9B 5JSPA 3DV8A 3ZFEA 3I4IA 2DVDA 4GH4A 5FLJA 3OYWB 2VVEA 4IEPA 4P9JA 4RQPC 4EV0A 1VBE3 5FDBA 5L36A 2A6ZA 2GN7A 3BU7A 5CU1A 1YRZA 4WM8A 4YSFA 5I0UA 4HK8A 3SXWA 1MR5A 1VAMA 4PQ9A 3ZN5A 3GHNA 1QDOA 4MXWA 2ZGLA 2KA3A 2E7QA 4JDMA 3CO2A 1ZBE2 4LBLA 5FMOL 2D3PA 4QMAA 3CEWA 1O3SA 3WCRA 3R6SA 3GBFA 4RS5A 5C4WC 1POV0 3OBTA 3SHRA 4BLIA 4GULA 3O0XA 4XFBA 2RS11 4FPOB 1ZZ7A 4K9SA 1J1LA 4HFSA 1V6OA 4MV2A 2NLRA 3WT3A 1QH6A 4EN6B 2W68A 5BXXA 5CFCA 2D6PA 3R05A 3AZXA 3ZFGB 2D98A 2O8OA 3AP7A 5BNNB 1BK1A 5DUWA 2R041 5T54A 1VBB1 4I01A 1K5MB 1NXD1 2QE3A 5CAZA 3H9AA 2RMU1 1NQDA 2A70A 5E16A 3M3CA 2HJIA 4HETA 3MPBA 4S2HA 2ZGTA 1L3JA 4WVMA 4Y5Z0 1LHUA 1J3PA 3KZ4C 4HVRA 3MW2A 2I74A 1G9BA 2ETEA 3EO6A 4UW6A 3M2MA 4HN1A 1GICA 1B09A 1Q5OA 1R081 3FWEA 1MZEA 2XLGA 3WQ0A 4AVTA 4YVSA 5FFOC 3J26N 1A6CA 4FP3A 1VBE2 1ZZCA 4GQ7A 4BWOA 1AYN3 2Z79A 1V6KA 2NYYA 3RYRA 4ONUA 4I0BA 2D5HA 5KHHA 2FMDA 4LHNA 1FI2A 1QJX3 1NLRA 2UYBA 5DUUA 5IK4A 3PJYA 3PTYA 3U10A 2JE7A 2WKKA 4JV4A 4NO4A 1ULGA 3CLPA 3IPVB 4HKOA 5KXBA 5KHKA 3NAPA 2ZOEB 1S0GA 4K1YA 1ND3B 2XBO2 3E97A 3ZXJA 1LOGA 4PIYA 2ZHLA 5CBLA 3VHNA 1H1IA 4B7EA 4AI0A 4C0HA 1ZVFA 2UURA 5GZEA 1F5FA 3QCWA 5K8SA 5GLZA 1FT9A 2A5ZA 4P9XA 4EWAA 3HR9A 3VL9A 3PNAA 1AZDA 2D93A 4D94A 3V0AA 4AHWA 2PN5A 4FT8A 4L9BA 3ZIXA 1JXNA 3LOBA 1NLSA 4QPGC 1W6OA 1MEC3 3BIWE 3E6BA 2D40A 4DY3A 2R30A 2UYAA 3MEPA 2AENA 3SLIA 2WC2A 5AVPA 2Z2SB 1B35B 3FBMA 5FPZA 2TUNA 3TN92 3O14A 2JICA 1RMU3 2DURA 1QDCA 1V6LA 2CY6A 3ZO0B 2OA2A 4FSJA 2LTNA 3JD72 5DG1A 4YG0A 4RD7A 5E1RA 1NCRA 3GF6A 3PHMA 1LECA 5JDBA 1X8EA 2UU8A 1KXGA 3FZ3A 5J36A 1IHMA 1GZCA 2JG9C 4JDNA 3LAGA 3MLKA 2YZ4A 5CIRA 3FMGA 1QJX1 1B35C 1RUI1 4YGBA 4MGYE 4FTBA 1ND2B 4IEWA 2ZZJA 3AKRA 5ABJA 4PDWB 4YVWA 3S7IA 1KJRA 1A3KA 4FPYA 2GC2A 4LLOA 4I09A 2PAEA 3D4KA 3WP5A 3AMPA 1YXWA 1U5XA 5A33B 5GM0A 4YW4A 5A32B 4OHYA 3USUA 4META 2BQPA 2F6BA 2BBVA 2JG8B 1EPWA 4N7UA 1N3QA 2DTYA 2X53S 2CAUA 1CONA 1OQDA 1RUG1 1TMF3 1W6MB 2ZKLA 5JCTA 5JIUA 1ND2C 4ES9A 1NCQB 5JOXA 4XZPA 2R072 1OKQA 4FPGA 4XJ9A 4YW2A 1W6QB 5BNOA 2D97A 3J8F3 1PGL1 4OHXA 5KC6A 3VBSC 3HBZA 4LBNA 4QU2A 1MEC1 1DG6A 3KSCA 1LENA 3MIDA 5HCBA 2JD4A 1FPN1 2HWD2 2CYFA 3P3PA 4RR3B 1F2NA 1Q8PA 4A3XA 2YMZA 4GB32 1AR61 2P3JA 5FRAA 2WSUA 2JG8C 1W0OA 5I8TA 1CX4A 4TWTA 1HV1A 4XIOA 3UL2A 3H50A 1OFNA 3L2YA 4MUVA 3ZSLA 1NCQC 5I8YA 3AP4A 4IEUA 3ZXDA 2VVDA 5C9AC 1AL23 1AJOA 5T5PA 3IBMA 4CDUA 1VAVA 5SV5A 3SH5A 4RHV3 2WZR2 4UBHA 2GALA 3UJOA 1HXS1 4AEMA 2DVGA 4L92A 5FQ0B 1MS1A 3AZYA 4C90A 4XW3A 3WV6A 5I91A 3JUUA 3TRSB 2IWGB 4RR3C 2Q30A 2HWC2 1IS5A 3APBA 1ZNPA 2QNKA 1D4M2 5J7MA 2JE9A 5CFDB 3IKWA 4GIQA 4YM1A 4I3GA 3JQWA 3QH7A 2YXSA 4NWWA 1PK6C 4IETA 2XVLA 1J3RA 3BOWA 2RS53 3ZFEB 4K40A 1NE6A 4IXLA 1H8VA 3PVOA 1AR93 2RM21 5KHGA 1QJY3 2WFF3 5I0TA 5F9TA 1ENRA 1TMF2 1JHNA 1YO8A 2I07B 4WM8B 1ZZ6A 1VB4A 4HSJA 1RUH2 1NZCA 2WT1A 5DDJ2 1N47A 3B69A 4CDQA 3ZFFB 4AGRA 2DU1A 4P9LA 2AREA 5CFDC 4R8HA 4LO6B 5IUQA 4QQLA 4CDWA 4Y20B 1RIRA 4COZA 4R9BA 4RS5B 3VDDB 1UZZA 3E5XA 4Q4W3 4KG0A 3HN1A 2NMNA 1DLLA 4JRLA 3WOGA 2XJUA 4AEDA 3R4UA 3RDIA 4B8EA 4H7LA 1RUF1 2VGDA 2CTVA 3HD8B 3NL1A 3WHTA 1QQP2 4LR4A 4Q0VA 2OYZA 4YGCA 3ZFFC 1LESA 1OOPA 1ASJ1 1LHOA 4RA0A 4D69A 4HKLA 3VKMA 1F5JA 2A3YA 2GMEA 3CU7A 1O91A 5JMCA 3AKTA 3D8CA 2BGCA 4YNIA 4Q1PA 3ZX7A 3VDDC 2ILMA 3HAGA 3WHUA 1AYM2 3MW3A 4XJWA 1RUD2 4H14A 4KGQA 3WLUA 4WVMB 1YFXA 4I0AA 4Q4V2 1DQ6A 1NG0A 5JLVA 2X8KA 2D3SA 4K7JA 2HWE1 3BB6A 2XB6C 1HX6A 4WZCA 4OVEA 5IK7A 1VBA2 4MSVA 4YRDA 1PIV3 1U12A 4QGMA 3DN7A 1AR92 4KG8A 1QJY2 4L11A 2WFF2 1F31A 2V09A 3D82A 1S55A 4AVVA 3J4UH 1UKRA 3L2HA 3M1HA 1BMV2 5T55A 4LBJA 3KCCA 1S0DA 2WWSA 2FZ2A 4D3WA 5LRSA 3USSA 1DFQA 2ZGPA 3MIGA 4COVA 5ACA3 4A2UA 3BTAA 4WVZA 1GSLA</