1HRI3

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 40
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hri300
1RUI1 4YVWB 1VBD2 1COV2 3VBOC 5BNPA 1PVC2 2RS52 3JBG2 5BNPC 5A32B 5JZGB 1AR62 2R042 2WS92 1HQNA 4Q4V2 4Y5Z0 5J98B 2ZZQA 4EJRA 2RR12 1EV12 2WZR1 1PGL1 1R093 2R071 1RHI3 3JD73 4GMP0 1AR92 1W39A 2BFUS 4QPIA 1PO11 2HWC3 3VBHC 4Q4Y2 4QPIC 4RHV1 4CEYB 4FSJA 1VBD3 1COV3 2RM22 2MEV1 1PVC3 2RS53 1E57A 3JBG3 3NAPB 1AR63 2R043 2WS93 4Q4V3 1NA1A 2ZAHA 4WM8B 4WM7C 1B35B 1NA1C 3ZFFB 1C8M1 2WLPA 2BFUL 2RR13 1EV13 1NCRB 4RS5B 2XBO2 4FTSA 1POV1 1RUD2 4CDXB 1HRI2 1RVF1 1PGW1 1DDLA 1ASJ1 1QJZA 4CEWB 1MEC2 5L7OC 4Q4Y3 3ZFEA 1X33A 2BPA2 2HWB1 1HX6A 3ZFEC 1EAH2 4QPGA 4QPGC 4IV1A 1RB8G 1PO12 1R1A1 1CD3G 1OOPB 5BNNB 5ABJA 1V9U2 4Q4X1 1ND3A 3TN92 1ND3C 2XBO3 1ZBA1 5AC91 1RUD3 1HRI3 4IV3B 1RUJ1 1POV0 1D4M1 5FOJB 3VBFA 1HXS1 2HWE1 1Z7S3 1MEC3 1VAKA 1R082 1RUG1 4BCUA 1H8TB 1EAH3 1OPOA 1VBC2 1VRH1 1ASJ2 4CDWA 1QJU2 2RS31 1PO13 2X5IB 4CDUB 1V9U3 2QQPA 4WM8C 1B35C 1NOVA 1HRV2 1QQP1 3ZFFC 1BMV1 3TN93 2DF7A 4PDWB 5D8AB 5C8CA 4N43A 4CDXC 4YVSA 2PLV2 2WFF1 1TMF1 4N43C 3CJIC 4N53B 4Q4W1 4Z92B 4RR3A 1TME1 1QJY1 1RUE1 4CEWC 4RR3C 3VBUA 3VBSA 4GB31 1R083 5AC92 3VBUC 1X36A 5CFCC 4GH4C 1ND2B 1VBC3 5ACA2 1AL22 1AR82 1QJU3 3VBOA 1NG0A 3VDDB 5GKAC 1ZBE1 1HRV3 3FBMA 2Y26A 1VRH2 1PIV3 3JB4C 1NCQC 2PLV3 4JGZB 5DDJ3 1MQTB 3J8F2 1FPN2 1WCDJ 5AC93 4JGYC 1AYN1 1RMU2 5ACA3 3VBHA 1AL23 1AR83 2FZ1A 2R061 1TME2 1PO22 1QJY2 4AEDB 1QJX1 2X5IC 4GB32 4CDUC 1VBB1 2HWD2 2HWF1 3ZFGB 5ABJB 4FTEA 1VRH3 4PDWC 4RQPB 5C9AA 1AYM2 5D8AC 1FOD1 1A6CA 5C9AC 1RUH2 1RUI2 4LLFA 4WM7A 2RS11 1AL0G 1AR71 3J8F3 1FPN3 1VB4A 1K5MB 3S6PA 5CFDB 1VBE1 2RMU1 1RMU3 1AR93 5L7OA 4YVWA 2WZR2 1PO23 1QJY3 1PGL2 4YVWC 3VBRB 1BBT1 4CDQB 2R072 4GMP3 1BEV1 2RM23 5K0UB 2HWD3 5A32A 5JZGA 5J96B 2GSYA 5BNOB 5JZGC 1AYM3 2R062 1RUH3 1RUI3 2IZWA 4RHV2 1VBA1 4JGZC 2TBVA 1RUC1 5C4WB 1F8VA 3DPRB 1MQTC 2MEV2 5A33B 3HAGA 4NWVA 2ZTNA 1NY71 1C8M2 2WZR3 1RUF1 4CEYA 5FMOL 4AEDC 4CEYC 3LOBA 2R073 2XPJA 1RVF2 1PGW2 2RMU2 3NAPA 5BNPB 3NAPC 1R091 2R063 4WM8A 2GH8A 1RHI1 1B35A 2HWB2 4RHV3 3JD71 3ZFFA 1BEV2 1NCRA 4RS5A 2HWC1 1NCRC 4RS5C 2MEV3 4CDXA 1VBD1 3CJIA 1R1A2 1COV1 5CFDC 4CEWA 1PVC1 4Q4X2 2RS51 4NWWA 1AR61 1C8M3 2R041 5CFCA 4GH4A 1ZBA2 4QPIB 4Q4V1 1POV3 4CDQC 5K0UC 1RVF3 1RUJ2 1FMD1 1D4M2 1EV11 1OHFA 1ASJ3 5BNOC 1HXS2 2HWE2 1NY72 1OOPA 5BNNA 1RUF2 1OOPC 5BNNC 2HWB3 1RUG2 4WM7B 1NA1B 4FTBA 1NCQA 3M8LA 4Q4Y1 2RS32 4IV3A 1R092 4RFT0 1R1A3 4IV3C 4Q4X3 1BMV2 1QQP2 4JGYA 4Y4YA 1H8TA 1ZBA3 1H8TC 3ZFEB 2WFF2 1TMF2 4Q4W2 1RUJ3 1D4M3 2XBO1 4QPGB 1HXS3 2HWE3 2X5IA 1RUE2 1RUD1 1RUF3 4CDUA 4IV1B 1HRI1 1RUG3 4PDWA 1Z7S1 5D8AA 1ND3B 1FMD2 1MEC1 2RS33 4N53A 1EAH1 4N53C 1ZBE2 1QQP3 3VBFB 1ND2A 1V9U1 1ND2C 2WFF3 1TMF3 3TN91 4Q4W3 3JB8A 1TME3 1RUE3 1AUYA 3VDDA 4CDWB 1IHMA 4GB33 3VDDC 1AYN2 1FMD3 1R081 1SMVA 4JGZA 5FMOS 2FZ2A 1C8NA 1M06G 1QJX2 1VBC1 5C8CB 1MQTA 4N43B 3CJIB 4YVSB 1VBB2 4SBVA 2HWF2 1ZBE3 1QJU1 1Z7S2 4RR3B 1FOD2 3VBUB 3VBSB 5CFCB 4GH4B 2RS12 1HRV1 1PIV1 4AEDA 1AR72 1GFF2 2PLV1 4IV1C 3ZFGA 5DDJ1 3VBOB 1VBE2 3ZFGC 1AYN3 5ABJC 4RQPA 4RQPC 1NCQB 1QJX3 1BBT2 5ACA1 1AL21 1VBB3 1AR81 1K5MA 1F2NA 1CJDA 2HWF3 3VBFC 1K5MC 5CFDA 1FOD3 4JGYB 1VBA2 2RS13 1RUC2 3JBG1 1AR73 2WS91 3VBHB 3VBRA 4CDQA 4CDWC 3VBRC 5K0UA 5BNOA 1VBE3 2RR11 3ZXAC 3J8F1 2RMU3 1FPN1 1PIV2 2VQ0A 5C9AB 3IDEA 5LK7B 5C4WA 1BBT3 1RMU1 3DPRA 1VB2A 5C8CC 1AR91 1BEV3 4YVSC 5C4WC 3DPRC 5DDJ2 5A33A 2BUKA 1PO21 2WWSA 4GMP1 2RM21 3VBSC 1RHI2 1VBA3 2HWD1 3JD72 1RUC3 2BBVA 1AYM1 2HWC2 5L7OB 1RUH1
chains in the Genus database with same CATH superfamily
1RUI1 4IEZA 4LHNA 1EUTA 2X53S 4XHXA 4AVVA 3KQ4B 1VBD2 2CL2A 4Q0VA 1FX5A 1ZX5A 4R8HA 4JQTA 5FZ9A 2P5BA 3KV6A 4FPHA 4L97A 1XB9A 2DVBA 2JDYA 3BIWE 3THCA 3VBOC 1PVC2 5BNPC 1JYXA 1AR62 2R042 3HPNA 4QXBA 4PQ9A 3KWVA 4GWNA 4XAEA 4B1MA 2BVBA 4Y5Z0 1QKQA 3KCCA 5J98B 4FPLA 1SDWA 4EZ4A 2VUJA 3GZEA 2KXLA 1S2EA 5L36A 2RR12 1W6OA 2VMEA 2ZGQA 3MEPA 4MLOA 1PGSA 5JMOA 3L2HA 3LIGA 4IEXA 1W6PB 2DBNA 2Y33A 3R4UA 1QXJA 1SFNA 3E6DA 2D40A 1QH7A 2RJ2A 3ALQA 4DZGA 2JKXA 4XACA 1JTZX 3J7HA 1PMHX 1ZRDA 3ILRA 3KV9A 1W39A 2R7EB 4QPIA 4ITCA 2GNTA 3P6BA 1WWYA 3N9LA 4HK9A 4BZ4A 4J1XA 3I3QA 4CXWA 4NROA 4A42A 4CEYB 3JZVA 1CPMA 3PLQA 1COV3 2RM22 4EN9B 4ZKTB 2YC0A 3A23A 3MZHA 5FPUA 3A21A 4CCCA 1OMIA 4YG6A 5FP8A 2WS93 3VD3A 3S5QA 5F7UA 1QIQA 1WD4A 4H2AA 5LEKA 2Z79A 2BU9A 3VD5A 2ZHKA 1NA1C 3ZFFB 1OFNA 3T1LA 1DGRA 1EV13 1K45A 1GZWB 1LHOA 2ARBA 2XBO2 4NRMA 4YGDA 4AF9A 3O1UA 2P37A 5C70A 3K51A 4CDXB 1HDKA 4JDOA 5KC5A 2ZKLA 1VAVA 2DTWA 1OH4A 3LEGA 2GALA 4AI1A 1DDLA 4D6QA 4NOTA 1GBGA 4FP3A 1WGPA 4Q4Y3 4NJ4A 2WIIB 4X6QB 2HWB1 2VECA 3K48A 2BPA2 4K21A 3TWIA 1UY2A 1CWPA 2PHDA 4D3WA 1LGBA 1UPIA 2LUWA 1CZTA 1HKDA 2BQPA 2VOTA 3ROUA 3DV8A 1ULOA 1CR7A 1UY4A 4MGIE 2VQUA 1CD3G 4UW4A 4ASKA 3KLSA 2ZGTA 5FY5A 4NVPA 3UESA 1C5HA 1SDDB 4Y4RA 1UU4A 3TN92 1ND3C 2IVJA 3VKMA 2JXAA 3D82A 1FYUA 4GIQA 4A44A 4DQAA 1EY2A 2K46A 1KJLA 3VDAA 1J3PA 5CG9A 4EV0A 4Y22A 2WLQA 5FOJB 1HXS1 5J48A 3GF6A 4HKWA 1SLLA 2Y0IA 3DL3A 1D0HA 3POEA 3C2UA 1RXFA 4INDA 1J1TA 1R082 4PQQA 2C4XA 4BLJA 1QJEA 1OPOA 2CWSA 3R0RA 4RFRB 5HCBA 3RFRA 4A6OA 1ENRA 3RGBA 5E6HA 1ASJ2 4MZUA 1REEA 5AFEA 4YG3A 4AYUA 2X5IB 1HB2A 2W2IA 2K9ZA 4GKXA 1QXPA 1KGYA 2ZBJA 2JD9A 3P5BA 4GULA 1NYWA 1PNGA 3JCIA 1NOVA 5T55A 1KJRA 3ZFFC 4AGGA 1I5PA 2DF7A 3N7LA 1O8PA 4C0BA 4CDXC 1J3QA 1TQ5A 3GCXA 1OVPA 4N43C 3CDZB 3J7NA 4WVZA 4EN8B 4Z92B 1UZWA 2YC4A 1UZ0A 3ETQA 4RR3A 1TME1 2JDNA 3B7MA 2WFPA 4YGBA 3VZJA 1IG3A 2ET7A 4QGNA 5T5OA 3HD8B 4IW3A 3VBSA 3GNEA 5FKCA 4ES8A 3SCFA 1DZRA 5AC92 1V6KA 1W8OA 1X36A 1XYOA 2VY0A 4LE4A 4QX1A 2Q8DA 3UJOA 3Q8EA 1LOFC 3T08A 1D0GA 4JCKA 1JHJA 5LK5A 1VRBA 2IXLA 3ZVXA 4CU7A 1OURA 3KM5A 4HETA 1QJU3 4NHYA 4YFZA 1UYPA 2XR4A 3K2OA 5A6XA 3PVOA 3ELNA 4IE0A 3VDDB 2YU1A 3ZYRA 3RZLA 2VCCA 3NW4A 3WLUA 3AKQA 2B8MA 1CAWB 2VH9A 3PNAA 4YW4A 3UT0A 2V09A 5A80A 3WQ1A 3ZKUA 4JDNA 4ZPIA 3AP9A 5KXEA 3ACLA 2VOWA 3MLLA 4JDMA 2A7AA 3MIHA 4N90A 5DAQA 5FYIA 1GV9A 3SISA 4Y24A 4KWKA 5A6YA 3OD0A 5JCTA 3B5LB 5M0TA 3UNPA 5FZ1A 3ZXKA 3BI3A 3E5UA 3W9AA 1MQTB 2VCAA 3J8F2 2DVAA 5JI7A 4IGQA 2DUQA 1UQXA 1LRHA 1N1SA 2FBEA 4HT1T 5I0RA 1UNBA 4QU1A 4MGQA 4CP2A 2HEYF 1IS4A 4GXLA 1AYN1 4GZ9A 1HJGA 1E5SA 3H3LA 1AL23 5FQ0A 2X5IC 4OYUA 4GB32 3VZLA 3O1SA 4CXXA 1CIYA 4AEKA 3I2OA 5GZCA 3WNOA 3HMYA 1K42A 2UURA 3ATGA 4HOOA 4RQPB 2Y6LA 3DYOA 2CGPA 1IZ3A 2DVFA 3O5SA 4UFJA 3WUCA 1ALYA 4NHMA 5ISLA 5J37A 1DQ0A 1GSLA 2EXKA 4WM7A 2RS11 5FK7A 5HCFA 2E7QA 2VCMA 2OYZA 4BXSV 4EROA 1V6JA 2CGNA 3MDPA 4LO8A 3LIHA 2ZMLA 3O1RA 3VGIA 4Y22B 1VB4A 3WX5A 4OI4A 1K5MB 3S6PA 2GN3A 4YGEA 3OBZA 3H7YA 2DCZA 5GALA 3VZNA 4LOTA 5DUUA 2A75A 4ZY9A 1VBE1 2IXHA 2SLIA 4ARXA 1N47A 1RMU3 2ZGKA 4XXPA 3W21A 2EXIA 3OCPA 3GZTB 4Z8BA 5L7OA 4YVWA 1WA4A 3E6CC 4AGVA 1Y4WA 1PO23 3I8TA 4A41A 5A6ZA 1PGL2 5C3OA 4QXKA 1MS0A 1BEV1 1W8UA 4UF0B 4NAOA 2GMPA 4OI2A 5K0UB 4R9CA 1BQPA 5FY8A 3ACFA 2GNBA 1BKZA 1KEXA 3CU7A 3PJYA 4NHLA 2XKOA 5FMDA 2J1AA 2WR9A 4TXWA 5BNOB 2A6YA 4QPWA 3N7MA 1W03A 4HN1A 1F5FA 4YZ5A 2WDBA 3PUAA 4RHV2 3LB9A 4HN0A 3VZOA 2TBVA 4P14A 4XJ9A 1NT0A 5FY1A 4Z2WA 4QDSA 5C4WB 3Q8AA 1F8VA 3DPRB 1ZRCA 1MQTC 2MEV2 4QAWA 4OI1A 2W1SA 5A33B 2ZXQA 2XJRA 1X82A 1XBFA 2IXKA 2PAEA 3BTAA 1SFYA 3VV1A 4E2QA 3I97A 3PTYA 3S7EA 5DAPA 3GM8A 3KB5A 5EFUA 5JZGA 3POFA 4B4QA 2E7TA 5IK4A 2WZR3 2VD7A 5JPNB 1W8HA 2GC1A 2VGDA 4LBLA 2VNGA 2ORXA 3WD5A 2Z42A 3AMQA 1IPSA 4HPKA 1PM7A 4P9LA 4UFKA 3PUHA 5B4XA 1PGW2 1TVGA 3AJYA 3AP7A 2VMDA 3PHMA 3ILNA 3CEWA 3HVDA 3NAPC 2LROA 4YW1A 4XZPA 3WF2A 3SNMA 2EIGA 4YM3A 4ZU7A 1RHI1 5LRRA 1B35A 3WQBA 1N1YA 3UV9A 1IG0A 2HWC1 3PJQA 4RS5C 1ZA4A 1ZYBA 1JI6A 1TEIA 2WNEA 4PF5A 2JDAA 1DCSA 1VBD1 1W8TA 2EVXA 2DFCA 4FOYA 4XCAA 5JR7B 4WZCA 2PAMA 2RV9A 3VL9A 4CEWA 1PVC1 4XTMA 4Y1VA 2YBPA 4E27A 2D7FA 3GDBA 4CA9A 4LK7A 4D6RA 1AR61 3UKVA 2R041 4YZ2A 3W20A 3ZSLA 4GH4A 5HV0A 1ZBA2 3IAQA 2PN5A 5FQ0B 2NPIA 3VN4A 1W6QB 4URAA 5K0UC 1XNTA 1RVF3 4PLMA 1RUJ2 1YI7A 1FNZA 3I2HA 4UFHA 4EQVA 3OY8B 2VNVA 4HK8A 4MUVA 5BNOC 3ZN5A 3IDBB 1SBFA 1N3QA 1NY72 2WN2A 2QTWB 5BNNA 2G1MA 4UOJA 3NNGA 1R64A 5T52A 3K3OA 1OUXA 3ZR5A 4LO5B 1PMIA 5FZCA 5LY2A 4WM7B 3WT3A 3HQUA 1PNFA 3VKNA 1O5UA 1W04A 5FZOA 3HEIA 1EP0A 5LB6A 3UJQA 2OS2A 3D3AA 1JYWA 2IWGB 2JE9A 4LHLA 3ZM8A 5JUVA 4IV3C 4QPYA 1OI6A 4QGLA 1YQ2A 3EBRA 2GU9A 4Q4X3 1U5ZA 4L99A 4N7IA 4JGYA 4Y4YA 3MBWA 1H8TA 2AUYA 3OD4A 2AC1A 2J22A 2WT1A 4MGKE 4Y26A 3B9CA 5CVRA 1CAXA 3TEWA 1UU6A 2L9LA 2WO2A 3OB8A 5DUXA 1D4M3 1LOBA 4M0NA 2XBO1 2P6HA 2HWE3 1RUE2 3WDXA 3IT8A 1C1LA 1FNYA 5GLZA 4B7KA 4B1LA 4CCMA 2GP5A 4XJUA 4ZZ8A 1RUG3 2JDHA 1Q8QA 2Y8KA 4PDWA 1AX2A 1H2MA 5HI0A 3WG2A 2W52A 3VD4A 2YB7A 4UFIA 4AW7A 2RS33 4G9SB 3WHUA 2G9GA 4N53C 2VXJA 1N1VA 2CAVA 3SLIA 4YW2A 2VOVA 1GMMA 4NPLA 1QQP3 1WLDA 2B7YA 3B94A 4BQ2A 3VBFB 2BVVA 4I09A 1GZ9A 5HCHA 2R1BA 1CJPA 1H30A 4ASLA 4LBMA 1L3JA 1KD7A 4Q8KA 3LZZA 3K75B 3S5AA 2D98A 3TN91 1STMA 2VULA 2Z2SB 4ZU4A 1CAVA 3VDCA 3ORJA 3KF5A 4AI9A 5FZ7A 2W1UA 5B2GB 4CDWB 2X09A 3SH3A 2FCVA 4IDZA 5A70A 5I91A 4QX5A 5ERLA 2WNVA 4I2OA 1YNAA 3V56A 4CP0A 1MS1A 2OKXA 5I93A 3DECA 1H2NA 3WDVA 1R081 4K40A 5DABA 4L92A 1MVEA 4QX7A 1M06G 4DPNA 1DYPA 3LPFA 3U78A 4B29A 4BA6A 2TEPA 2E33A 1VBB2 2DURA 4SBVA 4Y1ZA 4AE2A 4DO0A 1ZBE3 5KHHA 2FDJA 1W0OA 4Q8LA 3FC0A 2WN3A 2UYAA 1E5HA 1FOD2 3NVCA 4PT6A 2FQPA 3CZJA 3OG2A 3VBUB 2VU9A 4CSWA 4GH4B 3O12A 4DRVA 2D93A 1Q8VA 5IATA 2DCYA 1PIV1 2AGSA 2CY6A 2ZKNA 1LU1A 5DAWA 2XUMA 4Z82A 2OVUA 4AEDA 3IMMA 5FKBA 4S2HA 2XDVA 1GNYA 3ZYJB 3ZFGA 1PK6A 1YIPA 2WNUB 3RSJA 3RYKA 4EE2A 1BHGA 5KXBA 4DFSA 2PHLA 5D1IA 2J1TA 2RJLA 4PF1A 1QJX3 3O0WA 4ZXEA 2WWJA 3ZYBA 1ZRFA 1FXZA 4DUWA 2VZ3A 5FUIA 5C5TA 4BQ3A 3RMXA 2WA3A 2VTXA 5FZ0A 4XIOA 3VBFC 4JTNA 4XF1A 4Y20B 3T09A 4LBQA 4OLLA 3WDYA 4HVQA 2YBKA 5FR3A 2BOIA 4Q0PA 2P17A 3LOIA 4JGYB 4JTOA 3AFGA 1JU3A 2WSUA 1J3RA 1VBA2 4XBLA 3BPZA 1UOBA 1UIKA 4FXGB 1RUC2 4WV8A 3URFA 3JBG1 4FAGA 4CCLA 2WZPP 1H4HA 4RD7A 4HG6B 3VBRA 4CDWC 3WNLA 5L9VA 3N9QA 4BIOA 1UXZA 4WVMB 2DU0A 5CB7A 3FZ3A 3J8F1 1KXGA 3GCWA 2C5DA 2PHUA 2VQ0A 4R9DA 4BPZA 1LTEA 5FYYA 1YC61 5C9AB 3F2ZA 4D7SA 1AR91 5FPAA 2PFWA 4NE9A 1T6GC 1GP6A 3LSDA 3T0BA 3WF3A 5FMBA 2AENA 1LEDA 1O5LA 4Q1RA 3U11A 3WCSA 5IYYA 2WWSA 2GN7A 5FPVA 1I5ZA 4AVTA 3BTZA 2V4AA 4BQ5A 4FOVA 4OULA 4XJAA 3JD72 4QDRA 4IESA 3I2FA 3KSCA 2FMYA 1UZZA 5FLIA 3OYWA 2GC3A 4LBKA 1ULGA 3MYXA 3T30A 3HIFA 4P08A 1CAVB 1M4WA 1IPJA 4TN7A 4Q26A 1JODA 1XNKA 3FLPA 1V6NA 5BNPA 2LRPA 1GWMA 2WNUC 2RS52 4MV2A 1APNA 1U5YA 2OA2A 1I6XA 2WNVB 2BGOA 3FBYA 5GJ6A 4CCOA 5A3UA 1HQNA 2V5DA 5A1LA 2EIEA 5L9RA 4Q4V2 2H0BA 3NJYA 1T6BX 1DLLA 4IEVA 3LDKA 4EJRA 1UAIA 4BK4A 2IUWA 3H8XA 4QKBA 3DEMA 2LW8A 3T2OA 3INAA 3TB0A 1PGL1 4K8FA 1MZ5A 2WA4A 2DV9A 2A5ZA 2ZGUA 3WDWA 1H1MA 4DXSA 5KR7A 2XVLA 3AZXA 3BUCA 1DLCA 3SHRA 4FBFA 2ZJCA 1PO11 1BK1A 4UFMA 4RHV1 1QF3A 5IK7A 4M01A 1IS6A 4RA0A 1CAUA 3WEZA 1N1TA 2B5HA 2Y0OA 4J25A 3MFAA 2MEV1 3CKHA 3M1HA 5IVYA 4NIHA 1UL9A 2CTVA 1H9PA 3BVCA 4LPLA 3JBG3 5FP3A 1GOHA 2VW1A 1LECA 1LGNA 1AVBA 4PIXA 4GJYA 1BLZA 2YBSA 1NA1A 2ZAHA 4WM8B 4BQYA 4COWA 4LKDA 4PIYA 4Q0UA 2WLPA 3KD4A 3IDCB 1NCRB 3AJZA 1Q5OA 1DZQA 1C3HA 1CX4A 1POV1 2A70A 2PXJA 4CCNA 5LEJA 5EPAA 1HRI2 5FFOC 4GJZA 5BUVA 1JYIA 2VMHA 1PGW1 4DOUA 1RIRA 2Q0AA 3VHOA 1MEC2 4K3UA 4P9WA 1X33A 2YROA 2VZVA 4LNVA 3FHAA 3DXUA 4PI0A 3ZFEC 3KVAA 1RGSA 1RUOA 2EAKA 4IGPA 4DXRA 4QB2A 3MIDA 4QPGC 3I3BA 2VBDA 2X8KA 2R30A 4R4XA 4QKNA 2A3WA 3KHBA 2PHXA 3AMHA 1OOPB 3SH4A 1NE6A 1BK0A 2J7MA 1ND3A 3DXTA 3AB0A 3AP4A 3T4VA 4L9BA 4JZRA 1SBDA 1HB3A 1A3KA 1H9WA 1UOFA 1ZBA1 2HBTA 3ZYIB 2BNOA 4ONUA 4XMIA 4AFAA 1RUD3 3AKRA 5EJ3A 3UGGA 2UWCA 1RUJ1 2BNMA 1W9TA 4CUGA 5IVCA 5FZMA 1EYBA 1Z7S3 2Y6HA 3FHIB 5IAXA 2JG9B 3PIJA 4CP1A 3BTXA 4G4FA 5J7MA 1GQPA 3AZVA 2DYCA 3NV3A 3V0AA 3BKZA 4I30A 1SFPA 1EAH3 1QDOA 5EWSA 4A3ZA 1PX3A 1VBC2 3OBRA 5TSWA 4OCTA 1VRH1 5G05L 2W95A 2WC2A 2ILMA 4C1XA 2I2SA 2W5FA 1XNBA 1Q8OA 4M0HA 1PO13 1Q8SA 3BPSA 3GJAA 4LBJA 1F4AA 1V9U3 1UWWA 2QQPA 4WM8C 4TYSA 2X05A 1SPPB 1VMHA 1HRV2 4LLOA 1WMEA 2O14A 5E16A 5IFTA 3CL1A 4E4DX 5D8AB 5L73A 3QOPA 1J59A 4N43A 2ADEA 2LM3A 3ME2A 2E7AA 2PLV2 2ETEA 4YVSA 3UKTA 1L7QA 2XL7A 4B7EA 4JC1A 1Q8PA 3CJIC 3W59A 3GBFA 4META 1CGPA 4P00B 1X8MA 4TLGA 4YSFA 4AFBA 5FBJA 1QJY1 1RUE1 2WZ8A 3HWJA 3I3DA 5IJRA 4WBBA 3FLRA 1S0CA 3ZXLA 1LOFA 2XHKA 3NKTA 1GUIA 4MO3M 1ND2B 2QQMA 1HLCA 4C91A 5KHIA 2C9AA 2HEVF 5A1FA 4RL7A 1AR82 4ORFA 3EXUA 2ZEZA 5FZBA 1XRUA 4LHKA 5GKAC 3IB3A 3TEYA 1UIJA 2IXCA 3CNAA 2WAAA 2WNOA 4LBQD 1XPWA 4LTAA 4N7UA 4MX3A 1WLCA 4KGQA 1S0BA 5K4LA 4GD4A 5A3WA 4S2DA 5F3CA 3HN3A 4NRPA 1G86A 4M3CA 1C5IA 4JGZB 4O7XA 1YEWA 1VAMA 5FY4A 5LCWL 2VVEA 3M3OA 5DDJ3 4LK6A 1G9CA 3ZYPA 2JDMA 2EIDA 2JG9C 1YHFA 4LJHA 1IS5A 3FUQA 1BYHA 3ITQA 3DKQA 2VBPA 5KWRA 2E51A 2GP3A 5ACA3 3VBHA 3R05A 4KL1A 3MV01 2FZ1A 1Q3EA 1GICA 1OQEA 3N9PA 1X8EA 4L2NA 3WVJA 3H0OA 3OOXA 2VOXA 3ZO0B 1VBB1 4OFGA 5A32A 4UT5A 1K12A 1DQ6A 2W1QA 1VRH3 2VAUA 3IBMA 1AYM2 3FLTA 5D8AC 1A8DA 1FOD1 2DUOA 2IXIA 2ZX2A 2BEOA 2XG3A 1S0GA 2JG8A 5JVVA 1AL0G 4H14A 2G4IA 5KBFA 4O61A 4XF4A 4OHYA 3VD9A 5FZLA 1FPN3 4C8DA 3R6SA 3V65A 4OHXA 4AGRA 2D5FA 2R49A 3AXDA 3LF7A 5I0TA 3UYJA 1SLAA 5CFDB 2B45X 1XNCA 2RMU1 1KDKA 3V0AB 4IEOA 5DPNA 4IEYA 1H2LA 2DBIA 3PU3A 3O7OA 1G6NA 2DUPA 4LMFA 3ZDVA 1QJY3 4AHYA 2NP0A 2B4KA 1W6NB 3WR0A 3WP5A 2R072 5EJ1B 4GMP3 1JZ2A 3FMGA 4D6SA 4CP9A 5C8WA 1GNHA 2HWD3 4LOSA 4AG4A 1CQ9A 1WBLA 3ZYHA 2NMOA 2WQ4A 4GALA 5E8AA 3RZKA 2R062 1G9DA 1GYKA 3VZKA 1RUH3 1RUI3 2IZWA 3ZYFA 1VBA1 4JGZC 3RPQA 3BU0A 3D5OA 3HR9A 4GAZA 2VR4A 1QMJA 1RUC1 4JHTA 3WG3A 4AI2A 1UKGA 4D69A 1A8MA 5JIUA 2JDKA 1XE7A 3HAGA 1XSQA 2CNAA 3B93A 2WWUA 5FMCA 3RZGA 4OUSA 4H7LA 5FYZA 5JMCA 3ZN4A 3UL2A 4Y33A 4PHZA 3I2JA 2ZEYA 4KMQA 2QQUA 5CIRA 4JKLA 3AYAA 1C8M2 4XJWA 1RUF1 4XC9A 2R6QA 2VNOA 4HXCA 5FMOL 2PAKA 4LR4A 4Z1VA 1VALA 4CEYC 1YLLA 3LOBA 3OGGA 2ZPXA 3OBTA 2XPJA 2OZ6A 1ZRIA 2D5HA 2Y64A 5KXCA 3NAPA 4A2UA 2ZGSA 4IE4A 1IOAA 1OUSA 2BV4A 3NJVA 4A7KA 3L2YA 1R091 3HNMA 4HSLA 4N9HA 4YPJA 5C3SA 4AXOA 3JUUA 1FV2A 3JD71 3S57A 4LUKA 4MGSA 4MOAA 2C24A 4RS5A 1WBFA 3N9NA 1YJLA 2VMGA 3VHNA 1GOFA 2OXBA 4RN5A 5JOZA 1W6OB 1W6MA 3AKSA 4D7TA 3TOJA 3K46A 1R1A2 3OUIA 1OLMA 5CFDC 4LIUA 4CU6A 3SCHA 3AP5A 4BQ1A 2YU2A 2X29A 2RS51 1UYZA 2H0VA 2W0XA 4Y1UA 3KGLA 5JSRA 5T54A 4IEPA 4AAXA 1XC6A 3ZKYA 5CFCA 4QPIB 3HJRA 4Q4V1 1BVP1 3RYPA 1GQHA 4QX0A 3MO4A 1NQJA 4JHZA 4AZZA 3QLQA 3NV1A 4BISA 5FWEA 5HBAA 1VLNA 4NHXA 1W0PA 3WNNA 3E5XA 1H4GA 1CN1A 2HWB3 1MS5A 1PHMA 3PIGA 1GANA 4OHZA 5FYMA 3CHXA 3J7MA 4FTBA 1NCQA 1SCSA 2IFWA 3M8LA 4XURA 5AVPA 5FLJA 2PMWB 4A45A 4QGMA 4IV3A 2DTYA 4RFT0 1U5XA 3IPVA 5CKMA 1HQWA 1JUHA 5EQUA 5F39A 3E97A 1Y9QA 4XF3A 3X29B 2IVIB 4P5YA 1XE8A 1AX1A 3POIA 3ZXFA 2CWMA 2ZHMA 3ZPYA 5LA0A 3FHQA 2WFF2 5DAXA 5T50A 1IKQA 1TMF2 4CTEA 2VW0A 1HJFA 4Q4W2 4XJZA 5FP7A 5JOYA 1JOBA 1KS5A 1I3HA 1HXS3 5A3OA 4CDUA 1RUF3 3KT7A 4J6GA 1HRI1 2J1SA 2O8OA 5I0DA 5FXVA 1C4RA 1OT5A 1VE0A 5CKQA 4JV4A 4HBNA 1FMD2 1MEC1 2QQVA 5EYXA 2Z5WA 3M3EA 2VBBA 4JVAA 4YW7A 5F3EA 1LHVA 4KG8A 1W28A 2UY9A 1D2QA 1DFQA 5C71A 4N53A 1Q56A 3CJXA 3A7QA 5A7OA 5FPXA 3G7DA 5K7PA 2XXZA 4KWJA 2FD8A 5GZEA 1X7NA 4QWNA 2HYXA 3LA7A 3WUDA 2Z4FA 4FOWA 5HXVA 5IUQA 5CYYA 3O1TA 3K4DA 4FPCA 1DHKB 1Z78A 3E6BA 3FFZA 5FYVA 5DMYA 2Y6JA 4XUTA 2ZEXA 2BNNA 3NNJA 5F6KA 3UK9A 1US2A 4XFIA 4DUXA 3H42B 1UKRA 3C7EA 4QQLA 3Q8FA 3JB8A 1TME3 1W9FA 2ZABA 3FWEA 5FZHA 3TEZA 2UYBA 1IHMA 4XZUG 3VDDC 4RGGA 5LATA 1D4VB 5CA6A 3NMBA 4GKYA 5FO9B 1TNRA 2C26A 2W94A 2VQAA 5HCAA 4FXKB 4HVOA 1TNFA 1F4HA 1W9YA 3KGZA 3ECQA 4LKEA 3I49A 1SMVA 1QOTA 2PQQA 3R4SA 4QXHA 2FZ2A 4Y5SA 2QZ3A 4N8MA 2QJVA 1VBC1 2D3SA 3WNPA 1LNSA 2E31A 4V2WA 1LHUA 2K2SA 3I59A 4OHVA 4UAPA 2HWF2 4P9JA 1Z7S2 2P3IA 3ES1A 4RR3B 2YFZA 1O3RA 2XGXA 1SACA 2H6BA 1H1IA 1QDCA 5DZFA 1XU1A 2DCKA 3VBSB 4K6BA 5CFCB 1HRV1 3K3NA 4ZU5A 3AYCA 3NJXA 3BYWA 5I8TA 4AVAA 2D6PA 3BCWA 3SMHA 1AR72 4I3GA 3ZSKA 1GFF2 1TE1B 4M3CE 1WCSA 3TRSB 4ARYA 4XABA 2PLV1 1H1AA 2OZJA 1LHNA 1RC6A 4LA3A 2FHRA 4Q29A 1AYN3 1YXWA 5FBZA 2JICA 3O0VA 1WKYA 4URTA 4RQPC 4PLOA 3ZXJA 1NCQB 5FYHA 4E9KA 2GAUA 2Q1ZB 1BBT2 5BYNA 1KITA 1AR81 1W8FA 1CJDA 4R4ZA 1K5MC 1X50A 3RJ2X 4IERA 2HH9A 5A3MA 2LALA 2YC2A 4HFSA 2O0OA 5DG2A 4E8CA 1XXNA 3GBGA 4LA2A 5AVAA 3ZSEA 3M4FA 2RS13 2VC9A 3O1MA 4P02B 1LGCA 4BMBA 1VP6A 4JRLA 1SHWB 4CDQA 5F5IA 5FO7B 1YFUA 3LDBA 4ISQA 5EHDA 2Y6KA 1G9AA 5CISA 1MZEA 1QWRA 1VBE3 2RR11 2BERA 3MW3A 3ZN6A 2H6CA 1W8ZA 3O1VA 1MACA 2E32A 4YLZA 4AQ6A 4CVUA 4MADA 4QDQA 3UETA 5JSPA 1BEV3 3MIEA 3POSA 1REFA 3DPRC 2Q1MA 4EWAA 5DDJ2 5C4WC 1DG6A 1YQCA 1ENSA 2CGOA 2WO7A 3OPZA 3HOBA 3PU8A 1YQ5A 3RS6A 1OA2A 1PZ7A 1ULEA 2RM21 4R9BA 4YG0A 4QD2A 3VBSC 4WZFA 4AAPA 1AYM1 2CDOA 4AI8A 2YMZA 2ZACA 3NJZA 4DXZA 1NZCA 1XOYA 5L7OB 4BHPA 4YVWB 3L9JT 3VZMA 2A6VA 5ANQA 3ABZA 1COV2 1LULA 1MPXA 3H3UA 1MR5A 5HXMA 3BTYA 2QZ2A 5A32B 2SBAA 5I0UA 5JZGB 4XF9A 1WZXA 2WS92 2ZX3A 1O8SA 3E1F1 2PHWA 2NLRA 4A7YA 4XE9A 1W2TA 2W39A 1EV12 1JBCA 2N7GA 4O65A 4H55A 5JPMB 1XYNA 4TTGA 2R071 3B02A 1HN1A 1G9FA 3BIEA 2VUDA 4SLIA 1RHI3 4UI9L 1ODNA 2W92A 2XJSA 1HN0A 4GMP0 4XW3A 2J1RA 3H1WA 5EV7A 3HBKA 2HWC3 3QH6A 1CZSA 3M7AA 4Q4Y2 4EN0A 1JZ5A 3B01A 4KG0A 3LD8A 4UWDA 1GNZA 1VBD3 3C7GA 3DKWA 5EZWA 5FCCA 3VL8A 4FSJA 3B00A 4OVEA 1PVC3 4HPKB 3WF1A 1E57A 3D4KA 2P4EA 2MHFA 1UO9A 1AR63 4XFBA 2R043 5DQ0A 3SC7X 1YO8A 3NV4A 2Q5TA 1OLME 4QHBA 3SEPA 4WM7C 5T5LA 4Y1XA 1B35B 3V64A 5FY0A 4G3YC 1C8M1 1W2UA 2BFUL 2I74A 2RR13 3C7OA 3U37A 3KF3A 2R32A 1W2AX 5FWJA 3PTRB 4KBZA 2G19A 1J84A 3GBWA 5A7PA 3USUA 5LW9A 2XJVA 4RGAA 3A0NA 5LY1A 4DXTA 1LKNA 1ASJ1 1QJZA 1V70A 2VUAA 4CEWB 2AYHA 3LAGA 3WF0A 2B39A 5L7OC 3ZFEA 5L19A 3MLKA 4E4ZA 4ZZ5A 1HX6A 1S0JA 4XTPA 3WNXA 4AVSA 2W47A 1G7YA 5E89A 5HV4A 1CZVA 3Q9OA 4QPGA 1V6IA 5A3PA 2OT7A 1XJAA 3B69A 4RGKA 1MZ6A 2YPJA 4IV1A 4BDVB 5A7WA 3WQ0A 1R1A1 1SLTA 4XQWA 4IXLA 5ABJA 5BNNB 1QOOA 4L8QA 5LA9A 3A4UA 2B46X 2OW4A 2ZHNA 3KV4A 3RQ0A 3V0BA 2D6OX 2XQRA 2WABA 2XBO3 3ZSMA 4EN6B 3C3VA 1GU3A 5AC91 4NN0A 1UY0A 2VZTA 5FZOB 2BTVC 5CADA 4E8DA 4BK5A 2VL4A 3W5MA 1S0IA 1TG7A 3APBA 1AX0A 3WG1A 1ZZCA 4AOCA 2CAUA 2VQTA 5H9SA 2QDRA 4O9EA 1UOGA 1DQ4A 4BCUA 1H8TB 2A1XA 4DMIA 1R1ZA 4XQ4A 1US3A 4UYBA 1CAXB 1V6OA 2BP6A 4HLTA 1XYPA 1QJU2 2ZGNA 2BGPA 1LOEA 1RJ7A 2F17A 4W4ZA 1SG3A 3HNYM 2RVAA 4BU2A 2XLFA 5DZEA 4OQ8A 1B35C 1PZ9A 1X9PA 3NNLA 3WP3A 2JECA 4HKLA 3TN93 4PDWB 2OQ6A 4FQZA 2P1BA 3ZOIA 4XUPA 5C8CA 4AFCA 4S2FA 1RJ8A 2WFF1 1TMF1 4Q4W1 5IK5A 3TNPB 3MV11 1YJKA 4CEWC 3LA3A 2YUEA 2VZQA 3BODA 4GB31 5F32A 1R083 4ATFA 1KRIA 4FPGA 3VBUC 4PI2A 4GH4C 4ASMB 3N9OA 2IC1A 1O4TA 3KHCA 1AL22 3NWKA 1ULFA 4KH9A 4ZHNA 1LU2A 4MG2A 1OQDA 3AL6A 3OGJA 4AHXA 3AK0A 3ZDSA 3OJBA 1GKBA 2YGMA 1NG0A 3VBOA 1FI2A 2E9QA 3QBQA 1UZVA 3B9IA 1UMHA 1NUKA 1PIV3 2A6XA 5SV8A 3MIFA 4LUMA 3MICA 2BDRA 2ARAA 1G8WA 2GDFA 3PVBB 5JOXA 3CF6E 3SKJE 4K9SA 3USUB 3D0SA 2QFEA 2QQNA 1DYKA 3AZWA 4QX8A 4XF0A 2NN8A 2P34A 3MIBA 2D97A 5A3TA 1I9RA 1OBNA 3H8OA 2P3KA 4B4RA 5AC93 4FCAA 4JGYC 1L7RA 5FRAA 2VTFA 1L7LA 3OF1A 4F3JA 1OH3A 1WCUA 5GZDA 1RMU2 2ARCA 3BB6A 4AFDA 1UPSA 2W1WA 4P9GA 3R4DB 1WCKA 3JQWA 1TME2 2ZGPA 4FFHA 1PO22 1WUVA 4DEQA 4AEDB 2XB6C 2J42A 3M3CA 1O3QA 2BJSA 4EYUA 4AVCA 1GOGA 3ACHA 1W9SA 1W3XA 2K0GA 3GXUA 2VZ1A 2HWF1 3ZFGB 4AVBA 1PK6B 5ABJB 3PDQA 1MS8A 1WMFA 4JX0A 1WW4A 3O14A 4PDWC 3RI9A 1HV1A 2RE9A 3VKFC 3B3QE 5C9AC 3W5NA 2BGCA 4I0WB 4LLFA 2YG0A 2EA7A 4FAHA 4QU2A 3PMEA 4NIDA 2WKKA 3WDTA 1AR71 1W06A 1KDMA 2XMLA 3J8F3 3PUIA 5A1AA 1WCQA 4LIVA 4D0QA 3IIAA 3PVEA 4LBQB 4NPRA 1OC1A 4NRQA 2IXJA 3OUHA 4CCDA 1AR93 4FPEA 4HSJA 1W2NA 1HIXA 4IEUA 1OSGA 4FFIA 4Y3OA 4AWDA 2WZR2 5ANNA 3LEMA 1VIWB 3POJA 4YW6A 1JH5A 4W50A 3VBRB 1BBT1 4DINB 4JKKA 3TAYA 2WT0A 5IVBA 4LQRA 4ISRA 4NPMA 1UYYA 4P9XA 2VZRA 3M2MA 5JIAA 2WNVC 2UY8A 5C33A 4NUBA 2W3JA 2P2KA 2VMIA 3I3MA 2DCJA 1ST8A 2VZUA 3QD6A 3TYJA 5JDBA 1MVQA 3H9AA 5F5CA 3T2QA 4COZA 2LS6A 4M4RA 1UY1A 3BALA 1W6PA 4MGZE 4IEWA 3GJBA 1DGWA 5A7QA 3DUIA 1SZBA 1POQA 1YCIA 2ORZA 1SLIA 3FN9A 1W8NA 2FMDA 3JU9A 4I0AA 1MZFA 5H9QA 4E4HA 4EWEA 5B4NA 5C5UA 4J1WA 4AEJA 5EXOA 3PMSA 5FIXA 1NY71 2UU8A 4GA9A 4QQOA 3KMHA 1UW8A 1YFWA 2JDPA 4CEYA 4Z2AA 3I3EA 4AEDC 2ZZJA 4FFFA 3OYWB 5IVJA 1VMFA 1CVNA 1V00A 3O0XA 3N35A 1W0NA 4LBNA 1I1EA 2X10A 1YYNA 4LEJA 2O8QA 2YV8A 1RVF2 2QDNA 2WINB 1V0AA 2VVDA 2WL1A 1LEMA 1V6LA 1BXHA 5BNPB 2D6KA 2O1QA 2JWPA 1YWKA 3MUZ1 2GH8A 5FXWA 2VMCA 1ACCA 2ES3A 3DGTA 4RHV3 2PHRA 3ZFFA 3VKLA 4F7ZA 1BEV2 2XVGA 4R52A 1RL3A 2ATFA 2HJIA 1NCRC 2MEV3 4LULA 5FZ3A 5LRSA 4CDXA 5DAVA 4KQ7A 5FDBA 2P3JA 3C8XA 3NNFA 1COV1 4XHBA 2FCTA 4KNCA 4CU8A 5HPOA 3M70A 2VJXA 2QKDA 4Q4X2 5EP9A 5FUPA 3DYPA 5GZGA 1DBNA 1JYTA 5KHGA 4W6YA 2ZX4A 3DF0A 5A7NA 5FZ8A 5FO8B 1POV3 5J09A 1FV3A 2EF6A 2OQ7A 4AQ2A 1HB4A 1OHFA 1D4M2 1CAUB 1EV11 3EB7A 5IW0A 5JXHA 3E5QA 2VG9A 4Q2FA 2HWE2 1C57A 3SITA 4MVTA 3POYA 4YGCA 2D3RA 3KZ4C 1OOPC 2EICA 4BQWA 4JKMA 1UXXX 5A3NA 2BWAA 4QQ2A 4EWDA 1RUG2 2UWBA 4FOQA 4UXAA 1WLWA 3RJRA 1NA1B 2XONA 4AFMA 2PHFA 4XFHA 3I2DA 5F8PA 1DGWX 2XH6A 5FXZA 1WW6A 3M3IA 5F6LB 5BNQA 4Q4Y1 5EYYA 3LEKA 1OLQA 4JQRA 4D7YA 2RS32 1SLCA 2GMMA 4CPBA 1O91A 3OGVA 1LB2A 3PL0A 4MXVA 1OFSA 2MNGA 3DCQA 1BMV2 5FP9A 1H0BA 1QQP2 3ZR6A 5JLVA 3QCWA 1S4CA 5BPXA 1KQRA 4Z07A 1ZBA3 5LBCA 3C7FA 1N3OA 4FO9A 2BZDA 2VW2A 4COVA 2ZCWA 2XWJB 2UWAA 1AJOA 5JOWA 2BYVE 2ZOEB 1RUJ3 4HANA 4XCBA 1JYCA 4Q0SA 1PM4A 2X5IA 4IE7A 2Q8CA 4BQXA 2BRTA 1ODMA 1GP5A 2Q30A 3LSEA 2FDHA 2VUCA 3WW2A 1SQ4A 2EIBA 3AZZA 5AFBA 4LORA 3KCYA 5LZ6A 3ZIWA 1DZTA 1ND3B 1RINA 2MPFA 2ZEWA 5JI9A 3AVRA 4DIQA 1N3PA 4CYDA 3LGRA 5IAVA 5JWPA 2QQJA 2NYYA 3DN7A 4XBQA 5FTTC 2JX9A 3P3NA 5CG8A 3RWKX 1ZBE2 4XXAA 2R0HA 2W08A 4FPYA 1SEFA 4UBGA 3K4ZA 5CAZA 2QQWA 5I0SA 1Y7BA 2QE3A 5DXDA 2GNDA 1ND2C 1ZNPA 2FDGA 5CKNA 1CIWA 1E5RA 1Y9MA 4ES9A 2EAAA 4NIAA 4MXWA 1RUE3 3VDDA 5FREA 1UCXA 1W8WA 4HVRA 4IL7A 4LKSA 3U75A 1CAWA 1OF3A 3RZHA 3IAPA 1EPWA 1O6UA 1OF4A 2ZGLA 1NXMA 1ENXA 5FPZA 3N4MA 2A6WA 1C8NA 2RG4A 1QJX2 5T5PA 1UN1A 2YPDA 4F8AA 5I8SA 1OKQA 1KFXL 1MQTA 2WSVA 4K1YA 4N43B 1PZ8A 4YVSB 4XOGA 5A3LA 1BJQA 1QJU1 1DQ5A 3BOPA 1RXGA 2IFRA 1H8VA 1J83A 2JEMA 3AMNA 1S1AA 5APAA 3RDIA 3ETPA 2AH2A 2TNFA 2AR6A 2ZMKA 3SH5A 5FJHA 3IKWA 1OVSA 5C3RA 2YY1A 3WCRA 1O3TA 3MF9A 3MUY1 4GWJA 4OZOA 1H2KA 1WMXA 4RQPA 2JIGA 1GQGA 2A71A 3IM0A 1YFXA 1GR3A 3NV2A 5FPLA 4MGTA 4ZS2A 1YFYA 3D8CA 2RDSA 4M3CB 3RZZA 1DYOA 2W87A 1AL21 1VBB3 1YIFA 5BXXA 1K5MA 4XYXA 3I54A 2OPWA 1W3VA 3GYDA 1AF9A 4BE3A 3CBNA 1FOD3 3I4IA 3MF6A 1U0AA 4DY5A 1NAEA 4K20A 5JXJA 4NHKA 1JUIA 1ULDA 5KHJA 4IQPA 4I02A 1A78A 5F3GA 2ENRA 2C9KA 1UX6A 2WJSA 3VBHB 3JXSA 3ES4A 5FAXA 4UF0A 4MHUA 5K0UA 4AI0A 1QNWA 2DU1A 3AP6A 3CO2A 5BV6A 5FYUA 5IVFA 2OPKA 3IMNA 5BNOA 5CBLA 4FPKA 2RMU3 2HLEA 1PIV2 2W9XA 1NKGA 3I2IA 1WD3A 3VLBB 3LQCA 2VTXJ 3MI8A 3IDEA 5LK7B 5C4WA 3DPRA 1RMU1 3U4SA 1VB2A 2GC2A 4LKFA 4BM8A 4YVSC 4YZ1A 2JG8B 5H9RA 5FY7A 5A33A 4CCKA 2BUKA 5CU1A 2Q8EA 1PO21 1IQDC 4XFCA 1YI9A 3ACIA 1AHSA 1GZTA 2AEYA 2V72A 4QXCA 1SCRA 3QACA 4FI9A 1VBA3 1XE0A 3WF4A 4C0HA 2D44A 5FZFA 1RUC3 2ET1A 2WQ8A 2ZX0A 2P6CA 2RDRA 2CYFA 3SEEA 1NZIA 4MYEA 4YYOA 3USSA 2RDNA 4MXWB 2FDIA 5E1RA 4A4AA 4DB5A 3TNQA 1JYNA 3KT4A 2YXSA 1PVXA 1OD5A 1QNYA 5DG1A 4CP9B 1WW5A 1ZZBA 3JBG2 4OUEA 4LO7A 1W90A 3T2TA 1QU0A 1MS4A 4KWUA 3GHNA 1ZVFA 5FK8A 5FZ4A 3WINE 1D7PM 2ZZQA 5FXXA 1AXKA 2WZR1 5GLTA 1HQLA 4OHWA 1MS3A 1WW7A 3VDBA 1R093 5FYBA 2RJKA 1REDA 4BOWA 2FDKA 3LA2A 1JS9A 1P8JA 4IEQA 2VXRA 4QHOA 4AHZA 3JD73 2VO5A 2Y6GA 3MIGA 4XMAA 3POWA 1AR92 3WQ7A 5C7GA 4U2AA 2BFUS 2BW8A 3IN9A 4RYDA 1XU2A 3C7HA 3VBHC 1CX1A 3WXPA 1URXA 1X9TA 3GALA 1W6QA 4QPIC 2B42B 4QM8A 3JQXA 1DP0A 1VR3A 2VNRA 3W58A 4QQPA 3OY8A 2GH2A 3MW4A 3LFIA 1S55A 4P9YA 1B09A 4CPBD 2DDUA 2RS53 3WW1A 1S0EA 3OBAA 3NAPB 3K4AA 1LOAA 4CUCA 4Q4V3 1VJ2A 2D6MA 4WVWA 4CU9A 1ULCA 1AXYA 1VPHA 2HBUA 2JG8C 4FPOB 4GWMA 2WT2A 3AC0A 3ZIXA 3I7DA 4P9IA 2F6BA 4FTSA 4RS5B 1DU3D 2XQXA 4XDPA 1GLHA 2WQZC 3FX3A 4PBPA 5J36A 2YDEA 1ENQA 1RUD2 1W6MB 2WZEA 1RVF1 3WHTA 4RSUA 2LTNA 4X8NA 3S7IA 2C6SA 5IK8A 3LE0A 5F5AA 3NO8A 4L11A 4BMEA 4GQ7A 2DVGA 1C1FA 4CRQA 5LA1A 1K5JA 3FUOA 2QQOA 1EAH2 1PX4A 1LESA 2ZX1A 3HT2A 3WZ1A 3AX4A 3RVHA 2JB4A 3I2KA 3AVSA 3WDUA 4DNYA 1RB8G 1PO12 2XL9A 2XLGA 5LASA 3FE5A 5FUNA 1V9U2 3SKVA 4Q4X1 3VHRA 1NLRA 3N3HA 3VKOA 3D6EA 3AXEA 3T3YA 2RDQA 2Y60A 4DEVA 3D0JA 4Q5OA 3IZOA 5DUWA 5JR2A 1BZWA 1IQAA 3ON7A 1QY4A 2W68A 3THPA 2CDPA 1HRI3 5CNAA 2JIJA 4IV3B 3ZXGA 4BQ4A 1POV0 1D4M1 4JRAA 1F31A 3VBFA 4Q1PA 2HWE1 3IPVB 4Q27A 2VZOA 2VVFA 1MEC3 1VAKA 4M4PA 2VE1A 4XFAA 4YZ3A 5GZFA 1JMUB 3RMYA 5KC6A 2GMEA 1IGOA 1RUG1 2ZS6B 4FT8A 3RWNA 4ATEA 3K77A 1ZM1A 1DQ2A 2A3YA 3AFKA 3HBZA 4PBOA 2V4VA 3ZMOA 4CDWA 4XDOA 4FPFA 2XUEA 4YZ4A 2WBKA 3NSTA 4WVVA 5FY9A 2RS31 1QEXA 4XFFA 1S0DA 4YW5A 4F83A 5J3UA 5DN2A 1FAYA 1SLBA 2ZMNA 1O4ZA 3N9MA 3WOGA 2G9FA 3GHMA 4CDUB 5K8SA 3RYRA 1OKOA 4XPVA 3T2PA 5F3IA 1BMV1 1QQP1 3UKNA 5FZ6A 4DY3A 1BCXA 2HEWF 1ONAA 1JOPA 2VZSA 4D8MA 3U4XA 3I2GA 1DF0A 1UD1A 1JHNA 3EJKA 1MS9A 4N53B 5DUVA 3ZYGA 1O3SA 3ST7A 2NZ9A 2Q1FA 2J1EA 3VUOA 1JZ6A 3FFQA 4RR3C 2R16A 1XQNA 3VBUA 3VB9A 1A34A 1E5IA 4COYA 2J1UA 5CFCC 4KGGA 4IUGA 3U07A 1VBC3 5ACA2 5C6CA 3MHZA 4AQTA 3MLJA 2VMFA 1QHDA 3BOWA 4K8RB 4ZS3A 4CE8A 2I45A 1QJFA 4LO4B 5JXIA 5GLVA 3OEAA 3PUQA 2WNUA 3CZUA 5GLWA 4UW3A 4HZFA 2E53A 1ZBE1 4UBHA 1HRV3 1W05A 2KA3A 3FBMA 2Y26A 1VRH2 4XFGA 4BJ0A 1UYXA 3PVNA 5EIYB 1AXZA 3JB4C 4X6RB 3HT1A 5LBEA 3RI8A 1NCQC 2WRAA 4AHWA 1ZRRA 5LBBA 2PLV3 5FYTA 1XNAA 4EN7B 1W2OA 2QCSB 2W46A 3AYEA 4A7ZA 3FJSA 1IKPA 4Y20A 1FPN2 3NQHA 5A7SA 2WUHA 3HQXA 3I59B 4R9AA 2Q8OA 1WCDJ 5C3PA 2XLAA 4ZXKA 1D2SA 2JD4A 3KVBA 4HL0A 2RHPA 4QQHA 3HQRA 4C90A 5JAXA 1GP4A 2JDZA 5FPBA 1K3IA 3OGSA 1AR83 2PYTA 1QXRA 1OA4A 1LODA 1S2KA 2R061 4LE3A 4NMIA 1QJY2 4QT6A 2KM2A 3Q8CA 4S2GA 1QJX1 3G6JB 4LO6B 4UW6A 4D94A 2V73A 2XJTA 1Y3TA 4WVMA 5D21A 1ULPA 2PTMA 4A3XA 4C1WA 5F5QA 2HYKA 4CDUC 1QGLA 4M00A 1KS4A 2QBXA 3SXWA 2QVSB 2HWD2 1XNDA 2D6NA 4FTEA 2A73B 3O1PA 4HMZA 3J4UH 5F37A 2QNKA 4UFLA 5C9AA 1HV0A 1Y43B 4Q0QA 1A6CA 3RZJA 3NL1A 1RUH2 1H6XA 1RUI2 1YQ6A 1CPNA 1LCLA 2WAOA 2XHNA 5FJKA 5FYSA 3VHPA 1QH6A 3N7KA 1ZZ8A 4CXYA 3TEXA 4XILA 4YM0A 3LCPA 3LDRA 3Q8BA 1JZ4A 5CEHA 4MHRA 5FZIA 1UX7A 4QX2A 3M3QA 2GNMA 2DWRA 4OMCA 4XQDA 1GWLA 1S2BA 1OXCA 3OEBA 2BWCA 5G04L 4L0PA 2C1FA 2JKBA 2PHTA 2Y38A 5CZKA 1LJ7A 4TLFA 1DGLA 2NMNA 5FZAA 4I01A 5IWFA 1JW6A 4H3WA 4YNIA 1JU4A 2D43A 1DGRN 4YVWC 4I3PA 1YQ8A 4CDQB 2DVDA 3H7JA 2ID4A 2RM23 3OSDA 2ZGRA 2JB8A 1IPKA 1ZZ6A 4LBOA 4YARA 4XUNA 5FOBB 1JYVA 3ZX7A 5J96B 5GLUA 2GSYA 1NE4A 5JZGC 1AYM3 2XKPA 1F15A 3ZN6B 4QKDA 4PLNA 3S0MA 3LEIA 4AK3A 1NX9A 3QH7A 5KXDA 2WO3A 4B4PA 5BY5A 4CUBA 4AEMA 3AKPA 3WP4A 1RITA 3O1OA 3BN6A 1LOGA 2Q4SA 4YM2A 4EZHA 4BYYA 3S30A 5FP4A 4BXFA 2YGLA 4NWVA 3RNSA 2F4LA 1WLTA 2XJQA 2ZTNA 2DCTA 4E4SA 2BOJA 2CHHA 4IE5A 4Y1YA 2R1DA 2Y6FA 4OZXA 2AZ5A 3EYPA 1J58A 1JN2P 1OA3A 2ERFA 3LFMA 2A6ZA 3T4HB 3WY6A 5JSOA 1S0FA 4W6XA 2R073 2VCBA 3KQRA 4QM9A 4XAAA 2BBAA 1JXNA 2EALA 2XOMA 1UU5A 4PCRA 3HNBM 2RMU2 3P1IA 3TBDA 2JJ6A 1F5JA 3IWZA 4ZONA 5IVEA 3RZMA 4OUMA 4KI5M 4W65A 2E6VA 4XETA 3U0ZA 2R063 3OPTA 4XEZA 4IE6A 4WM8A 5A6QA 2HWB2 4AQSA 1CESA 4XBNA 4XJ8A 4CCEA 1NCRA 1G9BA 2JDUA 2OX0A 3NKGA 3PURA 2YHJA 3CJIA 4MSVA 3POGA 4XDQA 4K7JA 4LITA 4XUQA 2DFBA 4B3NA 3SCGA 4NWWA 1C8M3 1VMJA 3UGFA 2ARXA 2QQKA 1AZDA 2F4PA 1LHWA 4H7MA 3T1MA 5F2SA 1YUDA 2AREA 1F35A 2QQLA 4JAAA 4QHZA 4OQ9A 4CUAA 4CDQC 4IGOA 4YWAA 2R0FA 3H8UA 4CCJA 4OI0A 1FMD1 1ASJ3 3AMMA 1HXS2 4MH0E 5IHRA 4COUA 3H3ZA 1OOPA 2CSGA 4K1ZA 1RUF2 1W99A 5IFPA 5BNNC 4N9IA 1U5IA 1KFUL 3ZLIA 4KWLA 4IETA 3NNMA 3KT1A 4NIGA 5LWBA 3GGLA 4KBBA 3MPPG 4YFWA 4AR2A 1NLQA 3THDA 1V6MA 1ZZ9A 1FATA 3RG0A 2G9ZA 4QB1A 1YRZA 2PQSA 5FZEA 1R092 3RRDA 3U10A 3VD7A 1R1A3 3WNMA 3ZXEA 4XVHA 4LXLA 3KCXA 4LT5A 2PA7A 2QQIA 3KS7A 2QUOA 2JG9A 2CU5A 4NO4A 1JOJA 3J9SA 3MFCA 2TUNA 2E26A 4KU7A 1LR5A 4CZSA 4O9GA 1IS3A 2WYFA 3BGAA 1H8TC 4QKFA 3ZFEB 1J1LA 1NQDA 1OD3A 1O7FA 3H8RA 4XIKA 4QPGB 4FFGA 4E2SA 3ZXDA 3U1XA 1RUD1 2AEZA 3WV6A 4IV1B 2NM1A 2YYOA 5JXGA 4NAMA 3IDAA 1SPPA 5A7WB 5FLHA 5T3NA 5C3QA 5FV3A 1C28A 2ZHLA 5LA2A 4PIZA 5T5JA 4TWTA 3U14A 4TZDA 1GWKA 1Z7S1 5D8AA 4AI3A 4MGYE 3OGRA 2VZPA 2ZAAA 1CONA 3V0BB 1EAH1 3BU7A 5LBFA 3ZPOA 1LENA 3AKTA 4GWIA 1TZOA 4LHSA 1FT9A 4HONA 1DIWA 5FZKA 3SQOA 1QOSA 4V1PA 1ND2A 3UGHA 1V9U1 2YFUA 4DRRA 1BVVA 3NRUA 3WNKA 1Z0HA 2CV6A 2WFF3 1TMF3 2GC0A 4V2VA 4HKOA 4Q4W3 3ZSJA 2C0ZA 1LAJA 2FDFA 2XJUA 1XSRA 4ET7A 1AUYA 1JZ7A 4UW5A 4U36A 3N7JA 4GB33 3H50A 1HB1A 3IIIA 5SV5A 5DZGA 3OPWA 4QX3A 1AYN2 2PELA 3THTA 2XVKA 4BLIA 1FMD3 2VM9A 3A22A 2WYSA 1WA6X 4FQ4A 4JGZA 4W6WA 5FMOS 5FZGA 2W91A 1UMZA 4FPJA 5C8CB 3P3PA 3MW2A 2D6LX 1OQ1A 3CJIB 5F2WA 5GM0A 1Y9GA 2E63A 3AM2A 5FYCA 3WG4A 4DUVA 1PMJX 5KHKA 1EPZA 1AJKA 1O4YA 1NXD1 1UF2C 2YZ4A 3POBA 4W8JA 4A6SA 1SBEA 1RUNA 5E88A 1Q43A 1RTVA 4NIIA 3AL5A 4NR1A 2RS12 3LWCA 2P3YA 1UZYA 4KU8A 3AZYA 2ADDA 4BB3A 3HN1A 1JZ8A 1RYYA 1GZCA 2J1VA 2XWBB 4XUOA 5IT6A 5F9TA 2JENA 2A3XA 2OUHA 1EUUA 3EQEA 1ZREA 5J1XA 4IV1C 4OMDA 2AACA 3CIHA 2EXHA 2B9UA 5DDJ1 3VBOB 4AL9A 1VBE2 3ZFGC 5ABJC 1PK6C 1UMIA 2VOKA 1DQ1A 2D3PA 2OUJA 1T2XA 2HKXA 1F9KA 3GZUC 3J7LA 3H1YA 1W9WA 4TSVA 5H9PA 3EMRA 5ACA1 4Y5TA 1GZWA 2EXJA 2OIIA 2WO1A 1F2NA 1ZA7A 2HWF3 3ASIA 2ZA9A 2Z69A 3AYDA 3EO6A 4BIFA 4E2GA 1ZZ7A 4X8PA 5CFDA 3ACGA 3WP6A 3CMGA 1HW5A 4P5HA 4QMAA 5EJZB 3T0AA 3OUJA 4FVVA 1UOJA 3OTFA 3GZAA 4YM1A 5K9YA 1JZ3A 1O59A 4YRDA 2I07B 3H1MA 1AR73 1W6NA 2KD7A 2WS91 3AMPA 3LKJA 2B9VA 3ZMNA 3EHKA 3N36A 4BWOA 3VBRC 4I0BA 2FCUA 3F95A 2Y34A 4BH9A 3KV5A 2V5YA 3T0DA 1NLSA 3CQOA 1OPMA 3ZXAC 2NQYA 1FPN1 1OLRA 3WSOA 1H6YA 1UY3A 3DYMA 3FL7A 3PUSA 5FZDA 5I8YA 3ENRA 1LOCA 4DS0A 3MPBA 1BBT3 2VPVA 4PJYA 3WW3A 5C8CC 2ZGMA 2KR2A 5IVVA 5L9BA 3CLPA 3WW4A 2JE7A 4GMP1 1U12A 2ZGOA 3A0KA 3MGUA 1WMDA 1RHI2 3LPGA 2JE8A 2HWD1 4QB6A 2GZWA 4FP2A 4B8EA 5F1RA 4YW3A 2BBVA 5D2AA 2HWC2 3ILFA 2XJPA 3J26N 4M3CF 1RUH1
chains in the Genus database with same CATH topology
1RUI1 4IEZA 4LHNA 4AVVA 2X53S 4XHXA 3UL2A 1VBD2 2CL2A 4Q0VA 1FX5A 1ZX5A 4R8HA 4FPHA 3VBOC 4L97A 4FAHA 2DVBA 3BIWE 1PVC2 5BNPC 1AR62 2R042 4PQ9A 4GWNA 2BVBA 4Y5Z0 1QKQA 3KCCA 5J98B 4FPLA 1SDWA 2VUJA 2KXLA 5L36A 2RR12 1W6OA 2ZGQA 3MEPA 4MLOA 1PGSA 3L2HA 4IEXA 1W6PB 3R4UA 1QXJA 1SFNA 3E6DA 2D40A 1QH7A 4DZGA 3ALQA 1JTZX 1ZRDA 3ILRA 1W39A 4QPIA 4ITCA 2GNTA 4HK9A 4BZ4A 4J1XA 4CEYB 3JZVA 1CPMA 3PLQA 1COV3 2RM22 4EN9B 4ZKTB 2YC0A 3MZHA 1OMIA 4YG6A 2WS93 1WD4A 5LEKA 2Z79A 2ZHKA 1NA1C 3ZFFB 1OFNA 3T1LA 1DGRA 1LHOA 1EV13 1GZWB 2ARBA 2XBO2 4YGDA 4AF9A 2P37A 3K51A 4CDXB 1HDKA 4JDOA 5KC5A 2ZKLA 1VAVA 2DTWA 4AI1A 2GALA 1DDLA 4NOTA 1GBGA 4FP3A 1WGPA 4Q4Y3 2WIIB 4X6QB 2HWB1 2VECA 3K48A 2BPA2 4K21A 3TWIA 2PHDA 4D3WA 1LGBA 1UPIA 2LUWA 2BQPA 1HKDA 3ROUA 3DV8A 1CR7A 4MGIE 1CD3G 4UW4A 3KLSA 2ZGTA 4NVPA 1C5HA 1UU4A 3TN92 1ND3C 3VKMA 2JXAA 3D82A 1FYUA 4GIQA 4DQAA 1EY2A 1KJLA 1J3PA 5CG9A 4EV0A 4Y22A 2WLQA 5FOJB 1HXS1 5J48A 3GF6A 4HKWA 1SLLA 2Y0IA 3DL3A 1D0HA 3C2UA 4INDA 1J1TA 1R082 4BLJA 1OPOA 2CWSA 3R0RA 5HCBA 1ENRA 1ASJ2 4MZUA 1REEA 5AFEA 4YG3A 4AYUA 2X5IB 2K9ZA 4GKXA 1QXPA 2ZBJA 4GULA 1NYWA 1PNGA 3JCIA 1NOVA 5T55A 1KJRA 3ZFFC 4AGGA 3N7LA 2DF7A 4C0BA 4CDXC 1J3QA 1TQ5A 4N43C 4EN8B 4WVZA 4Z92B 3ETQA 4RR3A 1TME1 3B7MA 2WFPA 4YGBA 3VZJA 2ET7A 4QGNA 5T5OA 3HD8B 3VBSA 3GNEA 4ES8A 3SCFA 1DZRA 5AC92 1V6KA 1X36A 1XYOA 2VY0A 4LE4A 3UJOA 1LOFC 1D0GA 4JCKA 5LK5A 2IXLA 3ZVXA 3KM5A 4HETA 1QJU3 4YFZA 3PVOA 3ELNA 3VDDB 3ZYRA 3WLUA 3NW4A 3AKQA 2VH9A 2B8MA 1CAWB 3PNAA 4YW4A 3WQ1A 2V09A 4JDNA 3AP9A 5KXEA 3ACLA 2VOWA 3MLLA 4JDMA 2A7AA 3MIHA 4N90A 1GV9A 3SISA 4Y24A 4KWKA 5JCTA 3OD0A 3B5LB 3ZXKA 3E5UA 3W9AA 1MQTB 3J8F2 2DVAA 5JI7A 2DUQA 2FBEA 1LRHA 1N1SA 4HT1T 5I0RA 4CP2A 2HEYF 1IS4A 4GXLA 1AYN1 1AL23 5FQ0A 2X5IC 4GB32 3VZLA 4AEKA 5GZCA 3HMYA 2UURA 3ATGA 4RQPB 2CGPA 1IZ3A 2DVFA 3O5SA 3WUCA 1ALYA 4NHMA 5J37A 1DQ0A 1GSLA 2EXKA 4WM7A 2RS11 5HCFA 2E7QA 2OYZA 4EROA 1V6JA 2CGNA 3MDPA 4LO8A 2ZMLA 3VGIA 4Y22B 1VB4A 3WX5A 4OI4A 1K5MB 3S6PA 2GN3A 4YGEA 3H7YA 2DCZA 5GALA 3VZNA 5DUUA 2A75A 1VBE1 2IXHA 2SLIA 1N47A 1RMU3 2ZGKA 4XXPA 2EXIA 3OCPA 3GZTB 4Z8BA 5L7OA 4YVWA 1WA4A 3E6CC 4AGVA 1PO23 3I8TA 1PGL2 4QXKA 1MS0A 1BEV1 4OI2A 2GMPA 5K0UB 4R9CA 1BQPA 2GNBA 1BKZA 3CU7A 5A32A 3PJYA 4NHLA 2XKOA 5BNOB 5JZGA 2A6YA 3N7MA 4YZ5A 4HN1A 1F5FA 4RHV2 3LB9A 4HN0A 3VZOA 2TBVA 4P14A 4XJ9A 4Z2WA 5C4WB 1F8VA 3DPRB 1ZRCA 1MQTC 2MEV2 4OI1A 5A33B 2XJRA 1X82A 2IXKA 2PAEA 3BTAA 1SFYA 3VV1A 4E2QA 3PTYA 3S7EA 3KB5A 5EFUA 4B4QA 2E7TA 5IK4A 2WZR3 5JPNB 4LBLA 2GC1A 2VGDA 2VNGA 3WD5A 2Z42A 3AMQA 4HPKA 1PM7A 4P9LA 1PGW2 3AJYA 3AP7A 3PHMA 3ILNA 3CEWA 3NAPC 4YW1A 4XZPA 3SNMA 2EIGA 4YM3A 4ZU7A 1RHI1 5LRRA 1B35A 1N1YA 3UV9A 2HWC1 3PJQA 4RS5C 1ZA4A 1ZYBA 1TEIA 2WNEA 4PF5A 1VBD1 2EVXA 2DFCA 4FOYA 5JR7B 4WZCA 2PAMA 3VL9A 4E27A 4CEWA 1PVC1 4XTMA 4Y1VA 2D7FA 1AR61 3UKVA 2R041 4YZ2A 3ZSLA 4GH4A 1ZBA2 2PN5A 5FQ0B 2NPIA 3VN4A 1W6QB 5K0UC 1RVF3 4PLMA 1RUJ2 1YI7A 1FNZA 3OY8B 4HK8A 4MUVA 5BNOC 3ZN5A 3IDBB 1SBFA 1N3QA 1NY72 5BNNA 5T52A 4LO5B 1PMIA 4WM7B 3WT3A 1PNFA 3VKNA 1O5UA 3UJQA 1EP0A 2IWGB 2JE9A 4LHLA 4IV3C 4QPYA 1OI6A 4QGLA 3EBRA 2GU9A 4Q4X3 1U5ZA 4L99A 4N7IA 4JGYA 4Y4YA 1H8TA 2AUYA 3OD4A 2WT1A 4MGKE 4Y26A 3B9CA 5CVRA 1CAXA 1UU6A 5DUXA 1D4M3 1LOBA 4M0NA 2XBO1 2HWE3 1RUE2 3WDXA 3IT8A 1C1LA 1FNYA 5GLZA 4B7KA 4XJUA 1RUG3 1Q8QA 4PDWA 1AX2A 1H2MA 5HI0A 3WG2A 2W52A 4AW7A 2RS33 4G9SB 3WHUA 2G9GA 4N53C 1N1VA 2CAVA 3SLIA 4YW2A 2VOVA 1QQP3 1WLDA 2B7YA 3B94A 3VBFB 2BVVA 4I09A 1GZ9A 2R1BA 1CJPA 1H30A 4ASLA 4LBMA 1L3JA 1KD7A 4Q8KA 3LZZA 2D98A 3TN91 2VULA 2Z2SB 4ZU4A 1CAVA 5B2GB 4CDWB 3SH3A 5I91A 4QX5A 2WNVA 4I2OA 1YNAA 3V56A 4CP0A 1MS1A 5I93A 1H2NA 3WDVA 1R081 4K40A 4L92A 1MVEA 1M06G 4DPNA 1DYPA 4B29A 4BA6A 2TEPA 1VBB2 2DURA 4SBVA 4Y1ZA 4AE2A 1ZBE3 5KHHA 1W0OA 4Q8LA 3FC0A 2UYAA 1FOD2 3NVCA 2FQPA 3VBUB 2VU9A 4GH4B 3O12A 4DRVA 2D93A 1Q8VA 2DCYA 1PIV1 2AGSA 2CY6A 2ZKNA 1LU1A 2XUMA 4Z82A 2OVUA 4AEDA 4S2HA 3ZYJB 3ZFGA 1PK6A 1YIPA 2WNUB 3RSJA 3RYKA 5KXBA 4DFSA 2PHLA 5D1IA 2RJLA 1ZRFA 1QJX3 3O0WA 1FXZA 3RMXA 2WA3A 3VBFC 4XIOA 4JTNA 4XF1A 4Y20B 3WDYA 4LBQA 4OLLA 4HVQA 4Q0PA 2P17A 3LOIA 4JGYB 4JTOA 3AFGA 2WSUA 1J3RA 1VBA2 4XBLA 3BPZA 1UIKA 4FXGB 1RUC2 4WV8A 3URFA 3JBG1 4FAGA 2WZPP 1H4HA 4RD7A 3VBRA 4CDWC 4BIOA 4WVMB 2DU0A 5CB7A 3FZ3A 3J8F1 1KXGA 2C5DA 2PHUA 2VQ0A 4R9DA 4BPZA 1LTEA 5C9AB 4D7SA 1AR91 2PFWA 1T6GC 3LSDA 2AENA 1LEDA 1O5LA 4Q1RA 3U11A 3WCSA 2WWSA 2GN7A 4AVTA 1I5ZA 4FOVA 4OULA 4XJAA 3JD72 4IESA 3KSCA 2FMYA 1UZZA 5FLIA 3OYWA 2GC3A 4LBKA 1ULGA 3MYXA 3HIFA 1CAVB 1M4WA 1IPJA 4Q26A 1XNKA 3FLPA 1V6NA 5BNPA 2WNUC 4MV2A 2RS52 1APNA 1U5YA 2OA2A 1I6XA 2WNVB 3FBYA 5GJ6A 1HQNA 4Q4V2 2H0BA 1DLLA 4IEVA 4EJRA 1UAIA 3INAA 3TB0A 1PGL1 4K8FA 1MZ5A 2WA4A 2DV9A 2A5ZA 2ZGUA 3WDWA 1H1MA 2XVLA 3AZXA 3SHRA 4FBFA 2ZJCA 1PO11 1BK1A 4RHV1 1QF3A 5IK7A 4M01A 1IS6A 4RA0A 1CAUA 1N1TA 2B5HA 2Y0OA 3MFAA 2MEV1 3M1HA 1UL9A 2CTVA 1H9PA 3JBG3 2VW1A 1LECA 1LGNA 1AVBA 4PIXA 1NA1A 2ZAHA 4WM8B 4COWA 4PIYA 4Q0UA 2WLPA 3KD4A 3IDCB 1NCRB 3AJZA 1Q5OA 1DZQA 1C3HA 1CX4A 1POV1 2A70A 5LEJA 1HRI2 5FFOC 5BUVA 1JYIA 2VMHA 1PGW1 4DOUA 1RIRA 2Q0AA 3VHOA 1MEC2 4K3UA 4P9WA 1X33A 2YROA 4LNVA 3ZFEC 1RGSA 1RUOA 2EAKA 3MIDA 4QPGC 2X8KA 2R30A 4R4XA 2A3WA 2PHXA 3AMHA 1OOPB 3SH4A 1NE6A 1ND3A 3AB0A 3AP4A 4L9BA 1SBDA 1A3KA 1H9WA 1ZBA1 3ZYIB 2BNOA 4ONUA 4XMIA 4AFAA 1RUD3 3AKRA 5EJ3A 2UWCA 1RUJ1 2BNMA 1EYBA 1Z7S3 3FHIB 2JG9B 4CP1A 4G4FA 5J7MA 3AZVA 2DYCA 3NV3A 3V0AA 4I30A 1EAH3 1QDOA 5EWSA 1VBC2 3OBRA 5TSWA 1VRH1 2WC2A 2ILMA 4C1XA 2I2SA 1XNBA 1Q8OA 4M0HA 1PO13 1Q8SA 4LBJA 1V9U3 2QQPA 4WM8C 4TYSA 1HRV2 4LLOA 1WMEA 5E16A 3CL1A 4E4DX 5D8AB 5L73A 3QOPA 1J59A 4N43A 2LM3A 3UKTA 3ME2A 2E7AA 2PLV2 2ETEA 4YVSA 4B7EA 2XL7A 4JC1A 1Q8PA 3CJIC 3W59A 3GBFA 4META 1CGPA 1X8MA 4YSFA 4AFBA 1QJY1 1RUE1 3HWJA 4WBBA 3FLRA 1S0CA 3ZXLA 1LOFA 2XHKA 3NKTA 1ND2B 5KHIA 1HLCA 4C91A 2C9AA 2HEVF 4RL7A 1AR82 4ORFA 3EXUA 1XRUA 4LHKA 5GKAC 1UIJA 2IXCA 3CNAA 4LBQD 4LTAA 4N7UA 4MX3A 1WLCA 4KGQA 1S0BA 4S2DA 1G86A 4M3CA 1C5IA 4JGZB 1VAMA 2VVEA 3M3OA 5DDJ3 1G9CA 3ZYPA 2JG9C 1YHFA 1IS5A 3FUQA 1BYHA 5KWRA 2E51A 5ACA3 3VBHA 3R05A 4KL1A 2FZ1A 1Q3EA 1GICA 1OQEA 1X8EA 4L2NA 3WVJA 3H0OA 2VOXA 3ZO0B 1VBB1 4OFGA 1DQ6A 1VRH3 3IBMA 1AYM2 3FLTA 5D8AC 1A8DA 1FOD1 2DUOA 2IXIA 2ZX2A 2BEOA 2XG3A 1S0GA 2JG8A 5JVVA 1AL0G 4H14A 2G4IA 5KBFA 4XF4A 4OHYA 1FPN3 3R6SA 3V65A 4OHXA 4AGRA 2D5FA 2R49A 3AXDA 5I0TA 1SLAA 5CFDB 2B45X 1XNCA 2RMU1 1KDKA 3V0AB 4IEOA 4IEYA 1H2LA 3O7OA 1G6NA 2DUPA 1QJY3 4AHYA 2NP0A 1W6NB 3WR0A 3WP5A 2R072 4GMP3 3FMGA 5C8WA 1GNHA 2HWD3 4AG4A 1CQ9A 1WBLA 2NMOA 2WQ4A 4GALA 5E8AA 2R062 1G9DA 1GYKA 3VZKA 1RUH3 1RUI3 2IZWA 1VBA1 4JGZC 3RPQA 3D5OA 3HR9A 1QMJA 1RUC1 3WG3A 4AI2A 1UKGA 4D69A 1A8MA 5JIUA 1XE7A 3HAGA 3B93A 2CNAA 4OUSA 4H7LA 5JMCA 3ZN4A 5CIRA 3AYAA 1C8M2 4XJWA 1RUF1 5FMOL 2R6QA 2VNOA 4Z1VA 2PAKA 4LR4A 1VALA 4CEYC 1YLLA 3LOBA 3OGGA 2ZPXA 3OBTA 2XPJA 2OZ6A 2D5HA 5KXCA 3NAPA 4A2UA 2ZGSA 1IOAA 4A7KA 3L2YA 1R091 4HSLA 4N9HA 4AXOA 3JUUA 1FV2A 3JD71 4LUKA 4RS5A 1WBFA 1YJLA 2VMGA 3VHNA 5JOZA 1W6OB 1W6MA 3AKSA 4D7TA 3TOJA 1R1A2 5CFDC 3SCHA 3AP5A 4BQ1A 2X29A 2RS51 2H0VA 2W0XA 4Y1UA 3KGLA 5JSRA 5T54A 4IEPA 5CFCA 4QPIB 4Q4V1 1BVP1 3RYPA 1GQHA 1NQJA 3QLQA 3NV1A 5HBAA 1VLNA 1W0PA 3E5XA 1H4GA 1CN1A 2HWB3 1MS5A 1PHMA 1GANA 4OHZA 4FTBA 1NCQA 1SCSA 2IFWA 3M8LA 5AVPA 5FLJA 4QGMA 4IV3A 2DTYA 4RFT0 1U5XA 3IPVA 1HQWA 1JUHA 3E97A 1Y9QA 4XF3A 3X29B 1XE8A 1AX1A 3ZXFA 2CWMA 2ZHMA 3ZPYA 2WFF2 5T50A 1IKQA 1TMF2 4CTEA 2VW0A 4Q4W2 4XJZA 5JOYA 1KS5A 1I3HA 1HXS3 4CDUA 1RUF3 3KT7A 4J6GA 1HRI1 2O8OA 1C4RA 4JV4A 4HBNA 1FMD2 1MEC1 5EYXA 2Z5WA 3M3EA 4JVAA 1LHVA 4KG8A 2UY9A 1D2QA 1DFQA 4N53A 1Q56A 3CJXA 5K7PA 5FPXA 3G7DA 4KWJA 5GZEA 1X7NA 3LA7A 3WUDA 4FOWA 5HXVA 5IUQA 4FPCA 1DHKB 1Z78A 3E6BA 3FFZA 3UK9A 2BNNA 5F6KA 4XFIA 1UKRA 4QQLA 3JB8A 1TME3 2ZABA 3FWEA 2UYBA 1IHMA 3VDDC 4RGGA 5CA6A 1D4VB 4GKYA 5FO9B 1TNRA 5HCAA 2VQAA 4FXKB 4HVOA 1TNFA 3KGZA 3ECQA 1SMVA 1QOTA 2PQQA 3R4SA 2FZ2A 2QZ3A 2QJVA 1VBC1 2D3SA 1LHUA 2K2SA 3I59A 4OHVA 2HWF2 4P9JA 1Z7S2 2P3IA 3ES1A 4RR3B 1O3RA 2XGXA 1SACA 2H6BA 1H1IA 1QDCA 5DZFA 1XU1A 2DCKA 3VBSB 4K6BA 5CFCB 1HRV1 4ZU5A 3AYCA 5I8TA 4AVAA 2D6PA 3BCWA 3SMHA 1AR72 4I3GA 3ZSKA 1GFF2 1TE1B 4M3CE 1WCSA 3TRSB 2PLV1 1H1AA 2OZJA 1LHNA 1RC6A 4LA3A 2FHRA 4Q29A 1AYN3 1YXWA 5FBZA 2JICA 3O0VA 4URTA 4RQPC 4PLOA 3ZXJA 1NCQB 4E9KA 2GAUA 2Q1ZB 1BBT2 5BYNA 1KITA 1AR81 1CJDA 4R4ZA 1K5MC 1X50A 3RJ2X 4IERA 5A3MA 2LALA 4HFSA 2O0OA 5DG2A 1XXNA 3GBGA 4LA2A 5AVAA 3M4FA 2RS13 1LGCA 4BMBA 1VP6A 4JRLA 4CDQA 5FO7B 1YFUA 4ISQA 1G9AA 1MZEA 1QWRA 1VBE3 2RR11 3MW3A 3ZN6A 2H6CA 1MACA 4YLZA 4AQ6A 5JSPA 1BEV3 3MIEA 3POSA 1REFA 3DPRC 2Q1MA 4EWAA 5DDJ2 5C4WC 1DG6A 1ENSA 2CGOA 3OPZA 3RS6A 1OA2A 1PZ7A 1ULEA 2RM21 4R9BA 4YG0A 4QD2A 3VBSC 4WZFA 4AI8A 1AYM1 2YMZA 2ZACA 3NJZA 4DXZA 1NZCA 5L7OB 4BHPA 4YVWB 3L9JT 3VZMA 2A6VA 1COV2 1LULA 3H3UA 1MR5A 2QZ2A 5A32B 2SBAA 5I0UA 5JZGB 4XF9A 2WS92 2ZX3A 2PHWA 2NLRA 4A7YA 4XE9A 2W39A 1EV12 1JBCA 2N7GA 4H55A 5JPMB 1XYNA 2R071 3B02A 1G9FA 4SLIA 1RHI3 2XJSA 4GMP0 4XW3A 3H1WA 5EV7A 2HWC3 3QH6A 3M7AA 4Q4Y2 4EN0A 3B01A 4KG0A 4FSJA 1GNZA 1VBD3 3DKWA 5FCCA 5EZWA 3VL8A 3B00A 4OVEA 1PVC3 4HPKB 1E57A 3D4KA 2MHFA 1AR63 4XFBA 2R043 1YO8A 3NV4A 2Q5TA 4QHBA 4WM7C 5T5LA 4Y1XA 1B35B 3V64A 4G3YC 2I74A 1C8M1 1W2UA 2BFUL 2RR13 2R32A 3GBWA 3USUA 2XJVA 4RGAA 3A0NA 1LKNA 1ASJ1 1QJZA 1V70A 2VUAA 4CEWB 2AYHA 3LAGA 2B39A 5L7OC 3ZFEA 5L19A 3MLKA 4E4ZA 1HX6A 1S0JA 4XTPA 3WNXA 4AVSA 1G7YA 5E89A 3Q9OA 4QPGA 1V6IA 3B69A 1MZ6A 2YPJA 4IV1A 3WQ0A 1R1A1 1SLTA 4XQWA 4IXLA 5ABJA 5BNNB 1QOOA 4L8QA 3A4UA 2B46X 2OW4A 2ZHNA 3RQ0A 3V0BA 2D6OX 3ZSMA 2XBO3 4EN6B 3C3VA 5AC91 4NN0A 2BTVC 5CADA 1S0IA 3APBA 1AX0A 3WG1A 1ZZCA 2CAUA 5H9SA 2QDRA 4O9EA 1DQ4A 4BCUA 1H8TB 4DMIA 1R1ZA 4XQ4A 1CAXB 1V6OA 4HLTA 1XYPA 1QJU2 2ZGNA 1LOEA 1RJ7A 2XLFA 5DZEA 1B35C 1PZ9A 3WP3A 2JECA 4HKLA 3TN93 4PDWB 4FQZA 5C8CA 4AFCA 4S2FA 1RJ8A 2WFF1 1TMF1 4Q4W1 5IK5A 3TNPB 1YJKA 4CEWC 3LA3A 2YUEA 3BODA 4GB31 1KRIA 1R083 4ATFA 4FPGA 3VBUC 4GH4C 4ASMB 2IC1A 1O4TA 1AL22 3NWKA 1ULFA 4KH9A 1LU2A 1OQDA 3OGJA 4AHXA 3AK0A 3ZDSA 3OJBA 1GKBA 2YGMA 1NG0A 3VBOA 1FI2A 2E9QA 3QBQA 3B9IA 1PIV3 2A6XA 5SV8A 3MIFA 4LUMA 3MICA 1G8WA 2GDFA 3PVBB 5JOXA 3CF6E 4K9SA 3USUB 3D0SA 2QFEA 1DYKA 3AZWA 4XF0A 2P34A 2NN8A 3MIBA 2D97A 1I9RA 2P3KA 4B4RA 5AC93 4FCAA 4JGYC 5FRAA 3OF1A 4F3JA </