5IAXA

Mechanistic and structural analysis of substrate recognition and cofactor binding by an unusual bacterial prolyl hydroxylase - co-bap4h-ppg
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
199
Chain Sequence
b'EQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVDVNDIAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYKPPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Procollagen-Proline Dioxygenase
molecule tags Oxidoreductase
source organism Bacillus anthracis
publication title Bacillus anthracis Prolyl 4-Hydroxylase Modifies Collagen-like Substrates in Asymmetric Patterns.
pubmed doi rcsb
total genus 58
structure length 199
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5iaxA01
5HV0A 4J25A 3NNLA 5LA9A 3KT1A 2V4AA 4NHKA 3OUIA 4NHMA 2Y34A 5LBFA 5A3UA 4XCBA 4XCAA 4Y5TA 5LBCA 3MGUA 5DAQA 4JZRA 5EQUA 3DKQA 4XACA 4KBZA 3EMRA 4MHUA 2RDRA 3ITQA 4NHLA 5M0TA 2Y33A 3NNFA 5IAXA 4BQXA 5LBEA 4ZONA 4ZPIA 5LBBA 5DAPA 3GZEA 4XABA 3OUHA 4BQWA 4NHYA 5LASA 3HQUA 2HBUA 3KT4A 2G1MA 5HV4A 2HBTA 2JIGA 4UWDA 2RG4A 3OUJA 5LB6A 5L9VA 2RDSA 2FCTA 2FCUA 3KT7A 4XAAA 2G19A 5DAWA 5DAVA 5EPAA 5L9BA 4Q5OA 3W21A 2A1XA 2OPWA 5ERLA 4MHRA 2JIJA 5C5TA 3NNJA 3GJBA 3PL0A 5LATA 3HQRA 5L9RA 4NHXA 4XC9A 3NNMA 3W20A 3OBZA 3BVCA 4BQYA 5C5UA 4Y5SA 4NMIA 5IAVA 5IATA 5DAXA 3GJAA 2RDQA 2RDNA 4NAOA 5EP9A 4IW3A 2FCVA
chains in the Genus database with same CATH superfamily
2CY6A 2P4EA 1V6LA 1UYZA 4HSLA 2QJVA 2VZSA 3WDWA 1GQHA 1AR61 3RDIA 1NCQB 3K4AA 1SDDB 5GLZA 2WINB 1HW5A 5DDJ1 4V2VA 4WV8A 4MG2A 1DHKB 1IGOA 5FAXA 3DKQA 4K1YA 4OUEA 2ZX3A 4BCUA 2E53A 4Y33A 3LWCA 3T2TA 1GBGA 2IVJA 1RITA 4EN0A 4LBMA 1EAH3 2E9QA 1VBD3 1SFYA 1NXMA 3MW4A 4MYEA 3SXWA 1QOTA 3UV9A 1RB8G 1G9CA 1PK6B 1VB4A 3POSA 1W9SA 4KMQA 5AFEA 5FPBA 5H9RA 2D3SA 1NZCA 4XIKA 1DU3D 3SC7X 5F1RA 1CJDA 1UL9A 4HSJA 3AP6A 2MEV1 5C33A 4BDVB 3U37A 1HJGA 5JI7A 4RGAA 1VBC2 5I0DA 1CIWA 4GMP3 1MVQA 3WHTA 1ALYA 5APAA 3LIGA 1J3PA 1UOBA 5JSPA 2ETEA 4XE9A 1IS6A 2Z4FA 1VIWB 2HH9A 3V0BB 2IC1A 2DVGA 4L11A 3T0BA 1WCUA 1XNAA 5L9VA 5AVPA 1OFNA 3DYOA 4QPIC 3M4FA 5CFDA 4EV0A 2HWB3 5KHIA 3KT7A 4DNYA 2FDHA 4IEWA 3J4UH 1QGLA 2GC1A 2VNVA 4NJ4A 1I1EA 1OC1A 2P3YA 4LUMA 2BRTA 1LOGA 3OGSA 1D2QA 4NIDA 3UT0A 1ENQA 4N7IA 5IT6A 4COYA 3ZXJA 5GLWA 2I74A 4J6GA 1N1SA 2JIJA 5AC91 2X53S 4DEVA 2XL7A 5HCAA 4CDWC 3H8UA 2PAKA 3LPGA 4E4SA 2C26A 2BU9A 3HQRA 2BVVA 2GAUA 2HWF1 4CP0A 3ZFEA 5A7OA 3T1LA 4JHTA 3AL5A 2DBNA 3HN1A 2BGOA 2WSUA 1LGBA 2UYAA 4M0NA 2QQVA 4D6SA 2Y6LA 3IIAA 4WBBA 3ACIA 3GM8A 3LDRA 1F5JA 5J3UA 1U12A 4BQYA 4GH4B 4Z8BA 3OBAA 1N3OA 4LK6A 2F17A 2RR12 2EIDA 1ONAA 3AYDA 3PJQA 5FUNA 3ZN5A 4BISA 2XVLA 2P3KA 1PO23 1TME1 1W0OA 2H6BA 4GB32 2NM1A 1GOGA 1HJFA 1L7QA 3ZLIA 2J42A 3IPVA 1AR62 2CDOA 4Z2AA 4S2GA 5JOZA 1TVGA 1QJZA 1YQ8A 1KD7A 2RDQA 4KH9A 2F4LA 2OX0A 2VNOA 2VCCA 1W0PA 2ZTNA 4I02A 5HCBA 5IHRA 1PMIA 3AZYA 1RVF3 4GAZA 4JGZA 4QKDA 3W5MA 5CFDB 3CZUA 3PTYA 4NAMA 1TNFA 3KT1A 1PK6A 3LKJA 4AHYA 5F5AA 1S0DA 1OHFA 3CLPA 5CNAA 4HVOA 4L9BA 5HXVA 5CKNA 5CEHA 1FV2A 4P14A 4QGNA 3M3IA 1VMHA 4MUVA 4FFGA 4WM7C 5JXGA 5FDBA 1UNBA 3A0NA 3SKVA 4P5HA 4B4PA 5FYYA 2ZACA 5F39A 4OHVA 1FMD2 1QJY1 3DECA 2VUAA 5FZIA 3WNOA 1D4M1 3BODA 2WYSA 1J3RA 2Y33A 5EZWA 1UY3A 4GALA 5FYSA 5D21A 1DF0A 1OLRA 2ZZJA 4OLLA 5L19A 4G4FA 3UGGA 2EIBA 2J1RA 3EXUA 3QLQA 1N1YA 2VVDA 4C91A 3OUHA 3VLBB 4QXHA 5EV7A 1WMXA 2I45A 3ZXAC 4B8EA 4P9LA 3WNNA 4URAA 3WQ7A 1POV0 4HXCA 3IZOA 3UNPA 4DXSA 3AZWA 3OSDA 4AVAA 1BHGA 1GWKA 4JRLA 4W65A 2G1MA 4LBKA 3NV1A 4A6OA 2AH2A 4DZGA 4K3UA 1W99A 2GALA 2GDFA 5A7WA 2PHFA 4YZ1A 5HXMA 3C8XA 5A3LA 2WWUA 4DUXA 5BXXA 2DCJA 2ENRA 2JG8A 3K4DA 2ILMA 3THTA 4M3CB 2PLV3 2ZGNA 4Y4YA 2D43A 2VTXJ 3MIEA 3VDDA 3VD9A 1W2AX 4PIZA 4CCDA 5BV6A 1VAKA 1KDMA 4CA9A 3WNMA 1XQNA 1XXNA 2Q5TA 3FUOA 2CGPA 1W6QB 1UOJA 4MSVA 3WDVA 1Y9MA 3LPFA 4I0AA 3ZR6A 4LT5A 5BNOC 1D4M3 1LNSA 1PZ8A 3K3OA 1X8EA 2I2SA 4K21A 5JMOA 4R9AA 1LGCA 2VTFA 3Q9OA 5F3GA 2IXIA 3WP6A 5LATA 2P17A 2EXIA 4HVRA 4OVEA 4ZKTB 2EAKA 2DCTA 3BIWE 1TNRA 3N35A 4MGZE 2Y38A 1OBNA 4B4QA 2IXJA 4EWAA 2PHTA 2PA7A 2VCAA 5FPAA 2E31A 2XJSA 2FHRA 4XFHA 1TMF3 4Q4X2 1OOPB 4XUNA 1PHMA 1BEV3 1M4WA 2JB8A 4PLOA 4QM8A 3WDUA 1YI7A 2ZPXA 4LNVA 1AL0G 1LENA 1RUF2 3KB5A 5SV8A 1V9U1 1AR92 2WJSA 2YDEA 4M3CA 5IVYA 1W28A 3VD3A 4RFRB 4XXPA 1W06A 5JI9A 2O8OA 5L36A 3I2IA 4B4RA 5C6CA 1W0NA 3TN92 4IV3C 1CR7A 5A7WB 3FLPA 3KVAA 4HMZA 4LHNA 1MS5A 2W39A 3P1IA 2WO3A 5FYMA 4LBNA 5A80A 3NKGA 4XETA 5EP9A 2XLGA 2FCVA 2QQLA 2QVSB 3MFCA 3Q8BA 1D4VB 4N53A 5FY9A 3T4VA 4E4DX 1TE1B 3VBRC 5GZDA 3GZUC 3WNPA 1POV1 2R042 1QJY2 4JDOA 5CA6A 4ZHNA 3BYWA 3HWJA 2CWMA 1Z7S1 1RUH2 1V6MA 3JB4C 4K9SA 1YEWA 4XCAA 4AFAA 1EUUA 5GALA 1J84A 2MPFA 2V72A 3HQXA 4GKYA 4XACA 4Y26A 4IEZA 2VE1A 3LOIA 1UMIA 4C0HA 5IVFA 1LU1A 4DY3A 2ZKLA 1DQ4A 1JYTA 1FOD1 2PELA 4P08A 3N4MA 2OYZA 1FXZA 1XYOA 3NJYA 2XVKA 3VBSC 1JHNA 4TYSA 5EYYA 5FZOA 1W2NA 1BKZA 3DGTA 4V2WA 1OOPA 1JZ4A 2OT7A 3NL1A 4Z07A 4LOTA 4PJYA 1CAXB 1Y4WA 5FK8A 2D40A 3LDBA 3VBHC 4CDXC 1BBT3 5L7OB 4N53C 1XNTA 5DUXA 3ZO0B 1VPHA 4CCMA 4RR3B 3FFZA 1W2TA 3T2PA 2GN3A 3WG3A 4FPOB 3POEA 3WINE 4GB31 2OUJA 3BI3A 5JIAA 1FNZA 1C1FA 4MX3A 5IVJA 4KG0A 1J83A 3M3EA 3VBHA 1ZZ7A 2XGXA 1CQ9A 3NNLA 4ZS3A 1DQ5A 2C9KA 1NLQA 4LPLA 1GLHA 4IXLA 2A6WA 1NCRA 4FTSA 2VQTA 1W8TA 3MW2A 1MZFA 2BW8A 2CYFA 3OUJA 2A3XA 5FZKA 1MS4A 4AWDA 1LHOA 1VMJA 4A3ZA 1U5YA 1O3TA 4YG3A 3TN93 3UL2A 1O5LA 3VKLA 3NJXA 4UT5A 1VBE1 1MZ5A 5IK4A 2OA2A 4QQHA 1MR5A 5DAWA 3WW1A 2VQAA 2HWE1 3NAPA 1BEV1 3TNPB 1GWMA 3VB9A 4CXWA 1DBNA 1QOSA 4QT6A 4CDQA 1MS0A 3POYA 1XU1A 3I2OA 1DGWX 4XTMA 1TMF1 2HWB2 4EWDA 1C8M1 2JWPA 5FTTC 1S2EA 3PL0A 4LUKA 1DYPA 2QQIA 1GOHA 3BPZA 4K6BA 5L9RA 2LALA 4OI1A 3ZYHA 2CWSA 1H6YA 1L3JA 1DYKA 1JH5A 3ZN6B 2D3RA 2EICA 2VMGA 3A21A 4Y1ZA 1OPOA 1KS5A 2WFF2 3KQRA 3DN7A 4FPJA 3WDTA 4LHSA 5ACA2 3BKZA 1LODA 3ZYPA 1SACA 1WD3A 2VAUA 3HBKA 3WQ0A 1ODNA 3HR9A 4K8RB 2DWRA 1GMMA 3RFRA 3MV01 4Q4V1 5FBZA 3VGIA 1FPN1 2PLV1 4CDUB 2ZHMA 4IV3B 2XB6C 5KXDA 3U14A 4CTEA 4META 1A34A 1R082 3C3VA 2D97A 1QJX1 4A7YA 5FP8A 3KCYA 4K20A 3POWA 4HPKB 3H1YA 3WQ1A 5KXBA 5L7OC 5GLTA 1WWYA 3FFQA 1H1IA 3ZYIB 4BK5A 4FOWA 1ZBA1 4BQ1A 2V4AA 2UYBA 3PIGA 2C0ZA 4NHKA 3TOJA 5T54A 2RS32 1HXS2 1UKGA 1W6MB 1RYYA 1UO9A 4D94A 5G05L 2OKXA 1MVEA 1OD5A 2VW2A 5T5JA 5ACA3 1V00A 1Y9QA 2N7GA 4C1XA 3ACGA 4Q26A 4AHWA 1W03A 5FZ6A 4YM1A 4E9KA 3WNKA 4JCKA 1HX6A 4Q27A 1FT9A 5FZ1A 1JZ3A 2P5BA 5CADA 3M3QA 1OUSA 1U5IA 3RNSA 3WDXA 1G9AA 2VO5A 1WCSA 4KGQA 2WA4A 2G9ZA 3U07A 4WM7A 3CNAA 5I0SA 5L7OA 4QDSA 1KITA 4LOSA 4AW7A 2WIIB 5K4LA 2XOMA 2ZAHA 3TEZA 3MLLA 5ISLA 5FYCA 1AR71 1V6IA 3ACFA 2VUDA 1W6OB 2W52A 4Q0QA 4ES8A 3ZX7A 4Q4V3 3ZVXA 1SLLA 4CEWB 4PI2A 4S2HA 3OYWA 4R8HA 1XSRA 3MHZA 3H8RA 1Z0HA 5FKCA 1EAH2 3N9LA 3T4HB 1QJEA 4RL7A 5KXCA 3VKOA 4YW6A 5CYYA 2PN5A 3EHKA 3E97A 4BJ0A 5FLHA 4DMIA 2BNNA 3ZYGA 2CTVA 4UW4A 4SBVA 3VD7A 5JMCA 1CN1A 1LTEA 2RG4A 4Y3OA 5FYZA 2R1BA 1G8WA 1HXS3 2QZ2A 2ZOEB 1NCRC 2FCTA 5FMOS 3VUOA 4CDQB 2XKPA 4QM9A 3WW3A 3CZJA 1TEIA 3BCWA 4IE7A 1GQGA 2WFF3 3PVNA 4HVQA 3OGGA 1OKOA 2Z42A 5FWEA 3ZSKA 1DG6A 1YC61 4S2FA 1QXJA 3W21A 5C3SA 4CCEA 5J36A 4AL9A 1NA1A 1V6OA 4PLNA 2VMFA 3RS6A 3NNJA 4AXOA 3GJBA 4E2GA 4YVSA 4NO4A 4R9CA 5FZ3A 4JGZC 3S5AA 3BTYA 5I0UA 4AEDA 3R4UA 1BYHA 2ZEWA 1H0BA 4M00A 3TEYA 3LQCA 4COVA 2ZGTA 1G9DA 1HQNA 4XHBA 3OY8B 4A42A 4AEDC 3B5LB 1ZRRA 3M3CA 3LA7A 4FQZA 1GNZA 4XILA 3U11A 3ZXEA 5I8TA 1S1AA 4E4ZA 5FMOL 1VE0A 1RUJ1 5K9YA 1X36A 1VBB2 4UFJA 4LORA 5DN2A 5FPVA 2DVAA 1WLDA 2A73B 5I8SA 4EN9B 1FOD3 3O14A 5JXHA 5JUVA 3IB3A 1WLCA 2O1QA 4KL1A 3DUIA 4Q8LA 1UAIA 4QPIB 1VBA1 2DYCA 4FTEA 1E5HA 1GV9A 1GZWB 2EF6A 4TTGA 4XUQA 1NA1B 4PF5A 3WQBA 1HXS1 1RUD1 2EXKA 4XDOA 1AR73 2Q4SA 5C9AA 1VAMA 3ZKYA 1K3IA 3VBFC 2IFRA 3I3QA 3N7MA 1R1A1 3TNQA 2R7EB 3LEIA 5E88A 4LTAA 3KV5A 1S2BA 4GA9A 1JU4A 2XJQA 3TB0A 1MEC2 2GSYA 4XURA 4NR1A 3I2DA 3CJIC 4QPGA 5LBFA 1RUOA 1ND3A 1VBC3 2VOXA 3HNMA 4M4PA 1UYXA 4ITCA 1OQ1A 5CFCB 5C8WA 5LCWL 3MGUA 1NOVA 1SZBA 1UWWA 3AKRA 1Q8OA 4MGSA 3B69A 1QQP1 4KBZA 1DCSA 1YNAA 2Q1MA 5HI0A 3EMRA 5JZGA 4Q0VA 5FZ9A 1CIYA 2ZMKA 3I4IA 4GKXA 4IEYA 1K5JA 2IXHA 1RUI1 2RS53 3PUAA 4M4RA 1YFWA 4BOWA 3JD72 2EAAA 4F8AA 1PGW2 1YYNA 1WW7A 1AL21 4GWJA 3WXPA 1LRHA 5K0UB 1FX5A 2BBVA 3HEIA 4BLJA 4IGQA 2BOJA 3QCWA 2RMU3 1RUH3 4ASMB 3AP4A 4AK3A 1AVBA 1KEXA 4DY5A 5FMBA 3O7OA 4N9HA 2AGSA 5LBBA 4A45A 4XABA 5CISA 1JZ7A 1AYM1 1GZ9A 2HWC1 1K42A 4COWA 5DDJ3 3ON7A 1H2KA 1WCKA 4OHWA 3HN3A 5D2AA 1CAXA 2HWC2 3OEBA 3WCRA 4FPCA 5DZEA 3S30A 4XJ9A 4CDUA 3FHQA 2RS33 3B93A 4HL0A 3JQXA 1RHI2 2Y6JA 1NXD1 4OYUA 1WGPA 4ASKA 3LZZA 5A32B 3VDDC 4LULA 3VZMA 2LM3A 1OPMA 2ZGSA 1JOJA 1MS3A 2RS12 3RVHA 2W08A 2ZGUA 3CL1A 5LY1A 1PGW1 2GMEA 1E5SA 1EUTA 2RDSA 3WEZA 4B1MA 3WDYA 1QNYA 2O14A 1ENXA 4XF3A 3ZOIA 5AVAA 5CFCA 2YFUA 5JCTA 4DB5A 5GZGA 3JZVA 4DXZA 1NCQA 3GCXA 3NV2A 2XBO1 5L9BA 1ZRCA 2GNBA 5IVEA 4BZ4A 2OPWA 1OQEA 1V9U2 5ERLA 5BYNA 4X6RB 2XBO2 3GHMA 4LO7A 2J1VA 2GC0A 4D0QA 2CV6A 3POJA 4L0PA 2VCBA 2G9GA 1NLSA 1AYM3 1F5FA 1GZCA 1YJLA 4OHZA 4LO6B 4FVVA 3JXSA 2RMU1 5A3OA 3WY6A 1KDKA 1CAUA 4WZCA 2DCKA 1W2OA 3KWVA 4HONA 4FBFA 5BNPC 1COV3 3RWNA 1JUIA 4PBPA 2FDIA 2Z2SB 3MIDA 1YQ2A 2VXJA 1BJQA 3HIFA 1TME2 1QH7A 2WT1A 4W6YA 1U5ZA 4BWOA 3GHNA 4AAXA 1WUVA 2AR6A 1UY0A 1RTVA 4CDQC 2RR11 1QQP3 2MNGA 1O6UA 1LHWA 4E4HA 2W1UA 4XW3A 2VZUA 3POIA 4UXAA 4UW6A 2HYKA 2FD8A 4FTBA 1SCRA 2YGLA 1DQ2A 2VBPA 3RRDA 2W95A 4XHXA 3Q8FA 3KCXA 4R4ZA 1QXRA 2B9VA 1WBLA 3CMGA 2HWD1 4O61A 4AVTA 4CCLA 2BQPA 2FZ1A 4OUSA 1H4HA 4N7UA 1OQDA 3WG4A 1WCQA 1GZTA 3GCWA 1AL22 2C24A 2VL4A 4YYOA 2Y34A 2ZS6B 2XLFA 4I0BA 2WA3A 4LO5B 5DXDA 3H8OA 3SHRA 5DAQA 4JZRA 1OF4A 5AFBA 1H8TA 1X8MA 1OH4A 3JBG2 1J58A 1RUH1 1TME3 4YG6A 4MHUA 2LTNA 4MGQA 1RUC3 1Z7S3 4XTPA 2RDRA 3LOBA 4IETA 3WSOA 4AHXA 2ZGRA 4MH0E 4CCCA 5C3OA 5FJKA 4FCAA 2JE7A 3I59B 1PVC1 5KHHA 5FY7A 4UYBA 1UIJA 2WZR1 3FMGA 2TUNA 4WVVA 1RJ8A 4NPLA 5LK5A 1HN1A 4NN0A 4QPWA 3WOGA 5LY2A 3BU7A 4HOOA 1DIWA 3GZEA 4Y1XA 1OFSA 1RMU1 1FV3A 1G7YA 1ZA4A 2BGCA 4BQWA 4NHYA 4KWUA 1MZ6A 1UX6A 3AFGA 1F2NA 2BWCA 1BZWA 4HT1T 4KQ7A 1TZOA 1FMD3 2R061 4MZUA 1O4TA 2DUPA 5DG1A 2D93A 3EQEA 4AOCA 4QKBA 2R043 3ASIA 3HMYA 5JPMB 1GUIA 1COV1 2JDPA 4GB33 4J1XA 1UCXA 1SG3A 2JDKA 1NT0A 1Q8PA 2JIGA 1LGNA 1UXXX 2AZ5A 1HB3A 2JG9B 3DYMA 1S0BA 3ZFFA 5A3TA 2ATFA 2XWBB 1GANA 4UBGA 2B45X 4CDWA 1UW8A 2D6NA 1JODA 1I9RA 4Q4W3 2G19A 3POBA 3I97A 4MO3M 1D7PM 4HK9A 1A8MA 4XEZA 1A6CA 2VZRA 2ZHNA 3K51A 3DPRB 4NPMA 5FLIA 2DUQA 3E6CC 2ZGKA 4XUPA 4JGZB 3NW4A 3RYRA 3C7EA 1X9TA 4UBHA 4YW2A 1AR82 1NKGA 4D6RA 1X33A 5GZEA 4XC9A 2ZEXA 4BB3A 4LHKA 2WAOA 3BB6A 2QE3A 4D6QA 4LE4A 4BQ4A 4J1WA 3ZMNA 4FFIA 2X5IC 1GICA 3U1XA 4HPKA 3S7IA 1UKRA 3RZMA 4FPEA 1ASJ2 4KBBA 1JUHA 4TWTA 5BNNB 1RL3A 1HV1A 2A6XA 1XE0A 1JYXA 3ZFFB 2KXLA 5F2WA 4DEQA 3CF6E 1RUF1 5BNOA 4IEPA 5GJ6A 4CDUC 5ACA1 1EYBA 3X29B 1C4RA 2E51A 1ULCA 1ODMA 3U0ZA 2Z79A 4QX2A 4I3PA 2B4KA 1JTZX 3OB8A 5IW0A 4AI8A 1GP4A 1H9PA 3IN9A 3WD5A 2YBPA 2D98A 2ZEZA 3O0XA 3JD71 3J26N 3POFA 4FXKB 4Q0PA 4YGCA 4GXLA 4AAPA 4XJZA 2P1BA 2DVDA 2B46X 2PHXA 3ZXKA 4COUA 3D0JA 1JYIA 4WZFA 5LBCA 3ZSJA 2DV9A 1JOBA 2KM2A 2VH9A 3HNYM 2QQWA 4XDQA 3WW2A 2Q8DA 3GZAA 2C4XA 3T09A 5H9SA 2OQ7A 1ZBA2 4HKWA 4WM7B 2BERA 3PUQA 3PUIA 3DCQA 1Q3EA 1UMZA 5IYYA 3I2FA 3FC0A 5A1AA 3VDCA 5ABJC 2PQQA 3ILRA 1W6OA 3N3HA 5FKBA 2ZXQA 2ZA9A 3R05A 5BNOB 2H6CA 3O1PA 5JXJA 2DU0A 2JE8A 1YQ6A 2WSVA 4O9EA 4XFIA 5IJRA 2VU9A 1FPN2 2RM21 2WL1A 1MQTC 3LDKA 1T6BX 3NJVA 2OUHA 5F5IA 5BNPB 1PO21 1BVVA 2UU8A 1B09A 3WF4A 1ULGA 2HBUA 2Q0AA 2VBDA 3USUA 5FXZA 4R4XA 2DURA 2ID4A 4KNCA 1UIKA 2OIIA 3MV11 4PBOA 3MZHA 4RR3A 1RXGA 5F2SA 2GMPA 4A3XA 4I3GA 3RMXA 3ZN4A 2GNMA 4CU6A 3PJYA 4Z92B 1RVF2 2VQUA 3B7MA 4H14A 4JTOA 2IZWA 4XUOA 4MGKE 4Z82A 5A3PA 3DPRA 4H7MA 1CX4A 3KS7A 1WMFA 1FYUA 2Y6FA 5IVVA 1AR81 1LU2A 2WQ8A 2LROA 1OVSA 4P02B 4FAHA 5HCHA 1HRV1 2DBIA 5FBJA 2XBO3 2DVBA 1VP6A 2BVBA 5E8AA 4V1PA 5EPAA 1BQPA 4DXTA 4FPLA 4P5YA 3K75B 4FQ4A 4AG4A 4BIFA 3IPVB 4PI0A 3AZVA 4KU7A 3S6PA 4PDWB 1OMIA 1PM4A 2XH6A 4FP3A 3BTAA 2JDAA 2FBEA 2W1QA 1NYWA 4Q0UA 3NAPB 1PZ9A 3V0AB 1XBFA 3QD6A 4P9GA 3G7DA 4I0WB 4UAPA 4XDPA 4XYXA 5FUIA 1UU4A 3NNMA 4MGTA 1NE6A 4XBNA 5JXIA 3L9JT 4RFT0 4LKFA 4LO8A 1OURA 1ZZCA 1ND2A 2BTVC 1JYWA 3ZXGA 5EJ3A 3AKQA 5JLVA 2AEZA 4NIIA 4A44A 1W9FA 3BVCA 3CU7A 4Y1YA 1KXGA 3V56A 2ZGMA 5KHKA 2CSGA 1R1A3 4NMIA 3ZYRA 4AZZA 4CPBD 3GZTB 1VBB1 2VM9A 1VRH3 5F6LB 4N9IA 4QB2A 1JZ5A 5FFOC 4NRPA 3VBFB 4LXLA 3P6BA 1HRV2 4CU8A 2OZ6A 5FP9A 1KRIA 2JICA 1SFPA 3NNGA 1RUJ2 2PAMA 3LA2A 1IOAA 4AE2A 2FQPA 3FZ3A 2PYTA 3KV6A 1G9BA 5IK8A 1E5RA 2VD7A 1YUDA 1YIFA 2SBAA 3IAPA 2BYVE 2D6LX 5HV0A 1HQLA 1QIQA 3MLJA 4KWLA 5IVBA 5EXOA 4XPVA 5GZFA 1U5XA 4BQ3A 3KHCA 2ZCWA 4PQ9A 5JSOA 5CZKA 3OJBA 2GP3A 3M8LA 3E5QA 1RXFA 1VB2A 4Q4Y3 1ND2B 3VL8A 4B1LA 3RZGA 2VJXA 3WV6A 3L2YA 1TG7A 1OXCA 1IZ3A 5FMDA 3VBSB 2AEYA 3ORJA 3URFA 3FE5A 1S55A 1W6NA 2WUHA 3H1MA 3QH6A 5BNNC 5C9AC 3VBUB 1CVNA 3FN9A 4CYDA 1ZA7A 3OEAA 3T3YA 2PHUA 1C1LA 3WG2A 2VC9A 3WW4A 4NROA 3ZIXA 1VBD1 2EIEA 4Y24A 5A33B 1GNYA 5JDBA 3SH3A 1OKQA 2WNVC 5LBEA 4JKMA 4BQXA 4MOAA 3U4SA 2A71A 4JGYB 3T2OA 1V6NA 2WLPA 1Q8SA 3AZXA 4QPGB 1OT5A 4W4ZA 1VRH1 4CRQA 1E5IA 3GBWA 4GIQA 4CUBA 3AYAA 4JQTA 3RWKX 3OOXA 1N3QA 1J59A 1AHSA 5T3NA 2FDKA 1VRH2 2RHPA 4YW7A 5JWPA 3IDAA 2JDZA 1O5UA 5D8AB 1ZYBA 1SQ4A 1PZ7A 5HV4A 3H50A 1Y7BA 4YVSC 4CEWA 5T5OA 1K45A 4XUTA 2Z5WA 1APNA 4DUWA 2Y0OA 1ACCA 2P6CA 4W6XA 1YFUA 3H8XA 2QQNA 4Y1VA 2WYFA 1JXNA 4HKLA 1RHI1 3SMHA 4ZU5A 2XQRA 5E6HA 1JMUB 2QTWB 1PO22 5FLJA 2GNTA 2RS31 3Q8AA 5A7QA 1NLRA 2D6OX 1AR83 2JB4A 1HLCA 2VNGA 4LO4B 1CONA 2VUCA 4EROA 2JECA 2D44A 1A8DA 1XYNA 2DDUA 2WNOA 3DXTA 3MW3A 1WCDJ 3TYJA 1LULA 2CGNA 2PAEA 1W9TA 4CUGA 4EWEA 5LA2A 1PIV1 4HN1A 4PQQA 2F4PA 1O59A 3C7FA 2D3PA 4A6SA 1D4M2 2BWAA 5T52A 1BCXA 4QPGC 2K46A 4Q2FA 1Q8VA 2Y6HA 5FYIA 1QDOA 4MVTA 1D2SA 1GFF2 3PMEA 1XE8A 2DFCA 4AEDB 1WLWA 5EJZB 5F9TA 1GWLA 2QDNA 4BQ2A 3NJZA 4RGGA 2AREA 5A1LA 3OD0A 5DZGA 4CU7A 5FPZA 1IKQA 1UY1A 2D5FA 4CEYB 2WNUC 1LHVA 3M70A 3PU3A 2RJ2A 3KZ4C 2HJIA 2E6VA 2IXLA 4U36A 3G6JB 4QX5A 4PIYA 4PT6A 1AX2A 2OVUA 5K8SA 1NY72 3ZR5A 4NAOA 2ERFA 2LS6A 4CEWC 5FYBA 3CJIB 4XFAA 2JX9A 4QX3A 1KJLA 1QKQA 1AUYA 5CIRA 5C71A 5BNNA 4LLOA 1MEC3 2YXSA 4XFBA 3ZFGA 2BNOA 4CVUA 1MPXA 2R16A 3B02A 2XXZA 3I3BA 2ZGLA 4XCBA 1NZIA 1W6NB 3P3PA 2Y6KA 4FOYA 1ULOA 4XBQA 5FK7A 1FI2A 4AI9A 2JDNA 1YWKA 5FZAA 2R071 4I09A 4WVWA 3P5BA 1QJU3 1F4AA 2WNVA 3OGJA 1ZZ9A 1W8NA 4XJUA 4YG0A 1C57A 2K9ZA 5KR7A 2ZX4A 3V0BA 3AKTA 4OQ8A 1F35A 4NHLA 4UF0B 2XR4A 2FDFA 4AGVA 3NNFA 4Q29A 1DZTA 1FMD1 3BOPA 4N8MA 4HG6B 1RUD2 3T30A 4CDXB 4PHZA 4BXSV 1V0AA 4LQRA 5FY0A 3WG1A 4AQ2A 1PVC2 4A7ZA 1REEA 1KFUL 2JD4A 1Y43B 3LEMA 4Y5Z0 2BDRA 1JW6A 5AC92 3H7JA 4OHYA 1I3HA 3ZMOA 5FOJB 4CSWA 2VZ1A 2Q8OA 3AL6A 1ZRFA 4QXCA 1MS9A 4WM8C 3POGA 3VV1A 2WZR3 2YY1A 4HLTA 2EIGA 5I93A 4FXGB 3VL9A 4CP1A 2XL9A 5A70A 1ASJ3 1SBDA 3RZKA 3RZJA 1WA6X 3UJQA 4G3YC 1ND2C 4ATFA 1BVP1 2YC2A 3B9CA 3EYPA 4EQVA 3SH4A 4X8PA 2QQOA 3CBNA 5IFTA 1W2UA 1ZZBA 3LGRA 3LFIA 4LE3A 4JTNA 1YXWA 3OYWB 4G9SB 4MGIE 1NQJA 2VUJA 2FCUA 2WO7A 3F95A 1QHDA 4YM2A 5L73A 2IWGB 4XJAA 1JN2P 2A75A 2ZEYA 1OA4A 2VOWA 2VVFA 2XPJA 1UYYA 1W8WA 1RGSA 5FZEA 2EXHA 4Q5OA 4TSVA 4RN5A 1AJKA 2R49A 3DF0A 4EZHA 2ZZQA 5FPXA 4MHRA 3L2HA 2HEYF 2PHRA 4AFDA 2YC0A 5FPUA 4BMBA 3IT8A 1S0GA 4IL7A 1IS3A 1HRI2 1W8ZA 1WLTA 2B42B 4YPJA 3SEEA 1CZSA 3VZKA 1W3VA 4JC1A 4CCNA 2HWF2 3W20A 4DIQA 2YB7A 2GNDA 1MQTB 1DYOA 2VECA 2PHDA 3VHRA 1A3KA 1AX0A 4B3NA 1XYPA 4EN6B 3MIBA 3RGBA 2RS52 1JYCA 3BIEA 1S0EA 4O65A 4R52A 4IE5A 1W9WA 4TLGA 1DDLA 4JGYA 3RZLA 5IAVA 3LIHA 3WX5A 5JOYA 1RMU3 4RHV1 4OUMA 4AEMA 3JCIA 4JX0A 4KGGA 5K0UC 3S0MA 3AMPA 1YQCA 3VBOC 2R073 2B7YA 4NWWA 1S0IA 5A33A 4MGYE 1PVXA 3SCFA 2XLAA 1ZBE1 2ADEA 1L7RA 3EB7A 2WS91 4YFWA 1HN0A 4ATEA 4AVBA 5FP7A 2HEVF 1LEMA 1CGPA 4NRQA 2HWD2 2OS2A 3FBYA 1YJKA 1XC6A 1RUNA 1Y3TA 1W6MA 4QKFA 1DLCA 3B3QE 3AYCA 4IE4A 4OMDA 3CQOA 4RR3C 4NWVA 3LCPA 4HANA 1UD1A 4J25A 4DFSA 3O1UA 1LEDA 2WFPA 4FSJA 5LA1A 2ZX1A 1J1TA 2X09A 4UFMA 1QMJA 1ENSA 2YG0A 4LKEA 4NHMA 4E8DA 1SLCA 5A3UA 2BUKA 2G4IA 1QJFA 1XE7A 4JKKA 2J1AA 1IG0A 2A3WA 3OGVA 5EQUA 1CAWA 2YV8A 3WF3A 2QCSB 4D69A 2PTMA 4RSUA 3JBG3 5B4NA 5FQ0A 2RR13 2UY9A 4RD7A 3VDDB 1OA2A 3VKNA 2BPA2 4L99A 4NRMA 5A6XA 1LOFC 3D82A 1EPWA 3LAGA 3QH7A 5J09A 3MIHA 4ZZ8A 2VPVA 1BLZA 5M0TA 1A78A 1O4YA 2C1FA 3RZZA 2EVXA 2WC2A 1H8VA 1RVF1 2AACA 3T0AA 1ZBE2 2XONA 5FZ7A 3PUHA 1SFNA 4PF1A 2YU2A 3ZPYA 2X8KA 3HD8B 4FO9A 5CKQA 4LLFA 3ZPOA 1V6JA 4ZONA 4COZA 1ZBE3 1EV12 1UPIA 1YCIA 3FHIB 3AK0A 3LFMA 4QKNA 1XNKA 3I8TA 3TWIA 1Q8QA 5ANNA 1AR93 1RMU2 1C8M3 1SHWB 3J7HA 1B35A 4CP2A 1LKNA 1DQ1A 1ZBA3 3GDBA 5JZGB 4GJZA 5JPNB 5FY5A 2NZ9A 2ZGOA 3R6SA 5C70A 2DCYA 4Q4X1 4ZY9A 1RUI3 1H2LA 1X9PA 5FZBA 3ZYFA 4XQ4A 4LK7A 4AI3A 2ZMLA 4L92A 2XUMA 4FT8A 3FJSA 3FX3A 5LB6A 2JDYA 4LEJA 1ZZ8A 4JAAA 4ES9A 1R093 5DMYA 3ZXFA 2YYOA 2XUEA 2XMLA 3MPPG 4IGPA 1UPSA 3DV8A 4CCOA 2JENA 2JJ6A 1NCRB 1SLAA 4QDRA 1T2XA 3AX4A 4IEUA 3WZ1A 5I0TA 1XOYA 3ZFEC 4QQ2A 5F32A 4TLFA 3N9NA 3KGLA 3B94A 1BXHA 2B9UA 1EV11 5FZ0A 1H8TB 1R092 2TBVA 4YVWB 2YMZA 4Y20A 1T6GC 3O0WA 3UESA 1KGYA 1RIRA 1EPZA 2I07B 4FP2A 2VCMA 1YQ5A 3MLKA 4D7TA 4Z1VA 2ZAAA 2C6SA 2XWJB 1O8SA 4W8JA 2WO2A 4JGYC 3UJOA 1CAVA 1OI6A 4YARA 2XDVA 1O4ZA 4BE3A 2GP5A 1J1LA 4QHBA 2JXAA 3W59A 3VBRA 3AKSA 1CWPA 1IQAA 2WZ8A 5FO7B 5DZFA 3ACHA 1ULPA 3OTFA 1AL23 2QFEA 4P9WA 4LJHA 3QBQA 3ZXLA 1AR91 5FZGA 2LRPA 3VHPA 1JYNA 2MEV2 2ET1A 4E2SA 1ZZ6A 2O0OA 5FY1A 2EA7A 2Y64A 2HWC3 2QBXA 2OZJA 4RQPA 4Q4Y1 4IV3A 5FYVA 4XZUG 4D3WA 4YFZA 2ADDA 5JR7B 3ELNA 5EYXA 1UY2A 2CAUA 3P3NA 2XJTA 4DRVA 4JKLA 1W3XA 3FHAA 3H42B 4M0HA 3KGZA 1H6XA 4YZ4A 4AF9A 2WO1A 1RUG3 4YW5A 5T55A 4DXRA 2W91A 3I54A 5IK7A 2P2KA 5KBFA 4QDQA 2P3JA 3O1MA 3DL3A 3K3NA 2ORZA 5EFUA 4IERA 3AMMA 2QQPA 2HWB1 1HB4A 3B01A 4Y5TA 4PLMA 1GNHA 5F5CA 1DQ6A 3M1HA 3SNMA 2ZGQA 2HEWF 3KV9A 4DQAA 3I2KA 1UX7A 3HT2A 3FLTA 4H2AA 1WA4A 3HJRA 4O7XA 3VBUC 1ZM1A 3RQ0A 4ZXEA 2VOTA 1XJAA 1AR63 2HLEA 2KD7A 3PU8A 3IMNA 2HWD3 4QB6A 4YGBA 1PIV2 1LJ7A 5F5QA 3VBHB 2PXJA 5F3IA 3RSJA 2JD9A 4UOJA 5IAXA 1PO12 3V65A 1IS4A 3O1SA 1DQ0A 1COV2 4AFBA 1LHNA 1WD4A 2EALA 1K5MA 4Q8KA 2ORXA 2ZGPA 3JQWA 3KMHA 3J8F3 1IPJA 1F4HA 3WUDA 3ZM8A 1P8JA 2VTXA 3PNAA 3CHXA 3WP3A 3WNLA 1C28A 2XKOA 2VMIA 2J7MA 3A0KA 3BOWA 3NV3A 4LBJA 5LASA 3TAYA 1ASJ1 3U78A 2JG8B 4ZU7A 3WHUA 4AHZA 1C3HA 1BMV1 1Z7S2 1I5PA 2Y60A 2RV9A 3ZSEA 2DF7A 1HIXA 1W8UA 2WFF1 4QPYA 1NUKA 1ST8A 4Q0SA 1RUG2 1W6QA 2K0GA 4WM8A 3N7JA 1O7FA 4Y22A 2A3YA 2W1WA 5A7PA 2ZKNA 1QF3A 2CDPA 3AYEA 5TSWA 3RPQA 2QQMA 1H30A 4ONUA 2OXBA 1QU0A 1LOEA 4OMCA 3AB0A 5FREA 3PDQA 1JHJA 5CFDC 4XIOA 3ZIWA 2YHJA 1PVC3 1ZNPA 1UY4A 2BGPA 5D1IA 1QY4A 3N7KA 4XOGA 4PDWA 3MO4A 4LKSA 5F8PA 1V70A 2JDHA 2JG9A 2P3IA 3DEMA 3NSTA 2Q8EA 5FWJA 4N43C 1QJX3 2RVAA 4MXWB 2R1DA 2YPDA 4NHXA 4QX1A 1CJPA 4N43B 5BY5A 5F7UA 1R1ZA 2VZTA 2D5HA 3B9IA 4K7JA 2UURA 2OPKA 2KA3A 4AGGA 4A4AA 3PLQA 1MACA 1X7NA 4RQPB 3MDPA 2OQ6A 2B8MA 4DPNA 2XQXA 4ZS2A 4GZ9A 4RYDA 5FXVA 1STMA 3WCSA 4DOUA 1AYM2 3ILNA 2FMYA 4HETA 4LA3A 1PM7A 1G6NA 1RUE1 1QH6A 5IK5A 3O1TA 4GJYA 5C4WB 5A32A 2HWE2 1WW5A 3UETA 1VBD2 4M01A 1NAEA 2W94A 3T1MA 1ZX5A 2P34A 1DZRA 3PVBB 1B35C 1KQRA 2NMOA 2QKDA 3D4KA 1YI9A 4AQTA 5FZMA 5LRRA 4EJRA 4RGKA 1J3QA 1CPNA 4W6WA 2UWBA 2Y0IA 2ZABA 5FIXA 1UMHA 2GMMA 5FZHA 1LOAA 1R1A2 1FOD2 2G9FA 3GF6A 3M3OA 3NO8A 4CE8A 3H9AA 2QDRA 1UU5A 2BJSA 2VULA 1W05A 4AGRA 3BALA 4NE9A 4UW5A 1AYN1 1HKDA 3E6DA 1RUF3 2NQYA 3BN6A 4XMIA 2LW8A 4Q4Y2 1WMDA 3MEPA 5LK7B 4BU2A 4KWJA 5E16A 1Q5OA 3C7HA 1BEV2 3ITQA 2L9LA 1VALA 1LAJA 1DP0A 1W8HA 3VDAA 3T0DA 1I6XA 5SV5A 3WF2A 2W68A 4RS5B 2WR9A 1OLQA 3VKFC 3VKMA 1OSGA 3WF0A 3ZFFC 1WW4A 1JU3A 1F8VA 1W6PB 5DQ0A 2BFUL 3HT1A 5DUUA 4BH9A 2ET7A 2PQSA 2VG9A 1GKBA 1VBA2 2J1TA 4CUCA 1LOCA 1Z78A 4WVMA 2ARAA 2Y6GA 4OCTA 5FY8A 4XF4A 1HQWA 3J7MA 3IMMA 3F2ZA 1JS9A 4O9GA 3CJIA 3C7OA 1IS5A 2NYYA 4AR2A 3MIFA 4Y22B 1WMEA 1U0AA 1DGRA 1QJU2 2QUOA 4XVHA 1NG0A 1O3SA 2HWE3 1F31A 2Y26A 3RYPA 4Q4W1 2W1SA 3BTZA 4RS5A 5I91A 3KF3A 4H55A 3RG0A 4OQ9A 3T08A 1KFXL 1QEXA 4LBQD 4QX7A 2XHNA 4L97A 4NIHA 4AQ6A 2J1SA 1GZWA 4IEVA 3NQHA 1QWRA 2ZX0A 5F37A 4H3WA 5CKMA 3WNXA 2HYXA 4QWNA 2JG9C 4D8MA 3DXUA 3RI9A 4XAAA 3K48A 5H9PA 2WNEA 4TN7A 5DUVA 1IQDC 5A6ZA 3ME2A 2BZDA 4L2NA 1YIPA 2Z69A 1TQ5A 1UYPA 5LWBA 2A1XA 3A22A 4CDXA 1AR72 5FR3A 2VOVA 5C5TA 1C5IA 5FXWA 3VZJA 3W9AA 5LW9A 3K77A 3TRSB 4QU1A 4JRAA 1YFYA 5JAXA 4QU2A 1JZ8A 2WQ4A 4QXBA 4K1ZA 3J7LA 1GSLA 1JI6A 2YPJA 4GMP0 4C8DA 4IESA 1W04A 3UYJA 4CXXA 4OI0A 1HRI1 1REFA 2VXRA 1XU2A 4FAGA 4FOQA 4P00B 1LECA 3AP7A 3USUB 4B7EA 1MS8A 2BBAA 2P37A 4BQ5A 2WAAA 4DRRA 2JDUA 2PLV2 5C5UA 3O0VA 5K0UA 2A6ZA 1HB2A 2ZX2A 4H7LA 5E89A 1OUXA 5G04L 3AFKA 5JVVA 1X82A 3BGAA 4XFFA 1IPKA 5LEKA 3I3EA 3KLSA 2AENA 4YRDA 5DUWA 3GJAA 2ARXA 2NMNA 1AXZA 2VZPA 1ZREA 1O91A 4QMAA 1OVPA 1DGLA 4EN7B 2A5ZA 2JKBA 2RS11 1H1AA 5C4WC 4LBOA 1SCSA 5A3NA 3ALQA 1PMJX 3ROUA 3AZZA 4AVCA 5A1FA 2NP0A 4CDWB 1VJ2A 2QQUA 2P6HA 3R0RA 4INDA 2CNAA 2MEV3 3CJXA 1Y9GA 3AM2A 3AMHA 3ATGA 3N9MA 1S0FA 2WZEA 3KVBA 4XMAA 5FV3A 3RMYA 2JE9A 4Z2WA 4HK8A 5JIUA 4XZPA 1FAYA 1QQP2 1FNYA 4GULA 5FZ8A 3FLRA 1VRBA 4Y1UA 1US2A 4RQPC 4X6QB 4IV1C 3WT3A 5FO8B 2JKXA 2QQKA 3I7DA 1JZ2A 1UOFA 2WT0A 2WKKA 5FO9B 3AXDA 2C5DA 2RM22 1R083 4ISQA 4QHZA 3THCA 4NVPA 4LBLA 5FOBB 4ZXKA 1SBFA 1HB1A 1UOGA 2AYHA 4IEQA 3K2OA 4QQLA 4AVSA 3MPBA 1QDCA 3FBMA 1EY2A 4X8NA 5F3CA 4JDMA 2X05A 4YNIA 3OGRA 3MF9A 2W47A 4ASLA 1QJU1 3OPWA 5A7NA 1PO13 1AXKA 3IAQA 4KU8A 3NKTA 5BNPA 5J48A 4QX8A 4ZPIA 2RM23 5C3QA 4Q4W2 1LOBA 1AZDA 1POQA 3I59A 3FWEA 3MBWA 4IE0A 1V9U3 1YLLA 4JVAA 1PIV3 4NPRA 3O1VA 1G86A 3ZXDA 3ZSLA 3MF6A 2ZHLA 3S7EA 5ABJA 1AX1A 2ES3A 1D0HA 1IG3A 2R0FA 2XJVA 1MEC1 4YVWA 2PMWB 4GD4A 4IEXA 4ORFA 2W46A 3O12A 1F9KA 2VY0A 3MYXA 2CAVA 1BK0A 4YZ2A 1OF3A 1UN1A 2JG8C 2V4VA 3MIGA 4P9IA 3NVCA 3PHMA 3D8CA 3VZNA 2Y8KA 1NCQC 2PHLA 5FMCA 1O3QA 1GR3A 5ANQA 3D0SA 1OD3A 5CFCC 3H3ZA 5GKAC 1OH3A 1RUE3 2DUOA 2XJRA 2HKXA 1EV13 5EJ1B 3VN4A 1O8PA 2E32A 3T2QA 1AYN2 4AEJA 4YW4A 3K46A 3NWKA 3GBGA 4CP9B 1VAVA 4FPYA 4LMFA 2LUWA 4XF0A 2Q1ZB 5DAVA 1CAUB 5FZDA 4K8FA 3I3MA 2ZMNA 2IUWA 4BA6A 3HAGA 3NAPC 1ND3C 3C2UA 4FFHA 5GM0A 3SCGA 4CPBA 5J98B 5LEJA 5HBAA 1PNFA 3CDZB 2V5YA 2RMU2 3LD8A 2DTYA 3O5SA 3EJKA 3DYPA 1RINA 4FI9A 3VD4A 5JOXA 4W50A 1KJRA 3PTRB 4N53B 2Q8CA 2F6BA 4ET7A 1QOOA 2J1EA 2MHFA 4P9JA 4K40A 3JD73 1QJX2 2RJKA 4DUVA 3OBZA 2E7AA 2R062 1QJY3 1C8M2 2R6QA 2X5IB 4N43A 4CU9A 4E8CA 2VMHA 4QGLA 3HBZA 4RHV2 4Y5SA 1JYVA 3EO6A 2FZ2A 1LR5A 2GZWA 3PMSA 3U10A 2XG3A 3KM5A 5FYTA 3AKPA 4DINB 4LA2A 1PK6C 4QAWA 5KC5A 1AJOA 2VMCA 3BTXA 4LBQA 1BBT2 3J9SA 3USSA 3TEXA 3ENRA 2ARBA 4XXAA 3VD5A 1XNCA 4CEYC 2B5HA 3H0OA 3VBOB 4AI2A 5I0RA 3FL7A 1DLLA 2R32A 5C3RA 1R64A 4TXWA 2DVFA 2JEMA 1SMVA 2WDBA 2EXJA 4BLIA 4UFIA 1N47A 3OUIA 5K7PA 5FZOB 5CVRA 1US3A 5CG9A 2X5IA 1CPMA 2W0XA 3UGHA 3OBTA 4GWIA 4OI4A 4OULA 4AEKA 4E2QA 1YHFA 5CG8A 5J37A 4MADA 1OLMA 1CZVA 2VBBA 3N9OA 4RHV3 4AVVA 4YZ5A 4ARXA 4XJWA 1VBA3 3AC0A 1N1TA 2XJPA 2VZQA 2TEPA 3MUZ1 5CU1A 5KXEA 4JV4A 4DS0A 2ZBJA 2D6MA 3KD4A 4HKOA 4SLIA 3SKJE 1RUG1 4YGEA 1AXYA 4YVWC 2E33A 3ZDSA 2D6PA 4F3JA 1MS1A 4EZ4A 2B39A 4F83A 2GC3A 1X50A 2A70A 1IKPA 5DAPA 2WWSA 4HZFA 4Y4RA 4YM0A 2BOIA 4QB1A 4C90A 4BIOA 2FDGA 3LB9A 4GH4A 2IXKA 1CD3G 3GBFA 3IWZA 5T50A 3U4XA 3H7YA 3HQUA 1B35B 3THDA 3TEWA 1SLIA 1RC6A 1W8FA 5B2GB 4WM8B 1E57A 1HDKA 4QPIA 2WABA 4BM8A 1LHUA 2K2SA 2IXCA 3HVDA 3D3AA 4N90A 4XAEA 2Q1FA 3DKWA 5FPLA 5EIYB 1SLBA 1UZVA 2XHKA 2YUEA 4UWDA 3SCHA 3UKNA 3B00A 3OF1A 4P9YA 2VZ3A 2R0HA 3Q8EA 5KHGA 3SISA 1JBCA 3MI8A 1UZWA 1LESA 4XFGA 2CGOA 2VNRA 3N36A 5AC93 1OA3A 2WN3A 2BV4A 1W39A 1XB9A 3KSCA 3K4ZA 1SBEA 4R9DA 5H9QA 5LRSA 4LR4A 5DPNA 2IFWA 4AI0A 2KR2A 1EP0A 4FPGA 1H4GA 2D6KA 4Q4V2 1HRI3 4URTA 1UZ0A 4I01A 4AYUA 3OCPA 1D0GA 1V6KA 2VOKA 2NLRA 4Q1PA 5IWFA 3A23A 4GQ7A 2VGDA 4YW3A 4IV1B 3I2JA 3W58A 4ZZ5A 4YW1A 4D7SA 1BK1A 1PGL1 3ZDVA 1ZRDA 2WZPP 3J8F2 4GH4C 4FPHA 1TMF2 1S0CA 4Q4X3 2WS92 3M2MA 4QQPA 3UKTA 4CUAA 5LA0A 1XPWA 1BMV2 1VR3A 2NPIA 2DCZA 1Q56A 3WF1A 2C9AA 3OPTA 1QXPA 1AF9A 2YZ4A 4YVSB 3QOPA 3INAA 3I3DA 3HNBM 2WRAA 1K12A 2WWJA 4MXVA 4E27A 3SLIA 5LZ6A 1YFXA 4KG8A 3ZYJB 5JSRA 3BU0A 1M06G 3ZFGC 2VMEA 1PO11 2E26A 2WNUB 3FUQA 4YWAA 2BFUS 2DTWA 3KV4A 5IUQA 3SQOA 3SEPA 5KWRA 3KF5A 1O3RA 2A7AA 3ES4A 3Q8CA 1NX9A 1S2KA 3HPNA 3PURA 4PCRA 4IW3A 5GLUA 3W5NA 1GU3A 2GN7A 1RUI2 3I2HA 4IDZA 1MQTA 1ZVFA 3C7GA 5EWSA 5LA9A 5KC6A 3SITA 5IFPA 3VHNA 1WKYA 1R081 4UFKA 1ULEA 1URXA 4MXWA 1DFQA 4R9BA 3S5QA 1C8NA 1WZXA 2YGMA 4WVZA 4OHXA 5A6QA 1YO8A 2UY8A 2W92A 4CXYA 3O1RA 2DU1A 4JDNA 2WLQA 2VVEA 1W6PA 4RS5C 4BYYA 1PMHX 1FPN3 2H0VA 4IQPA 5JR2A 4IV1A 1JOPA 3THPA 1W9YA 2RJLA 2WZR2 3JB8A 3WR0A 4JQRA 1PX3A 1XRUA 5C9AB 4GWNA 2CL2A 2D7FA 5BPXA 4TZDA 1QNWA 4I2OA 2QNKA 5FQ0B 4KWKA 2R072 3UKVA 4L8QA 2WS93 3IIIA 5HCFA 1RUD3 3R4DB 1LB2A 1LOFA 2Q30A 1N1VA 2VR4A 5DG2A 1G9FA 3GALA 3J7NA 4QQOA 1HV0A 2ZJCA 3A7QA 3LA3A 5C4WA 3UK9A 3ECQA 4FPKA 4KI5M 3KT4A 4LIUA 4UW3A 1RUC2 1VMFA 5FYUA 3U75A 3WLUA 1UXZA 2YROA 3ES1A 3PUSA 4XQWA 4EYUA 1RHI3 2W2IA 4ARYA 1VBE3 5JZGC 2HBTA 4QX0A 3BUCA 5FCCA 1MZEA 2YFZA 5F6KA 1CX1A 3UGFA 4UFHA 5C8CB 3D6EA 5HPOA 5D8AA 3V64A 3TN91 4JHZA 1SPPA 1W90A 3IDEA 3VZLA 3O1OA 4D7YA 5FZCA 3OPZA 4A41A 4DO0A 4QGMA 1PGSA 1VBC1 5C8CC 2O8QA 3KQ4B 1GOFA 1RUE2 3E5UA 3R4SA 2H0BA 3OBRA 2PFWA 5T5LA 2J1UA 2GU9A 5BNQA 3VBOA 3BPSA 4OZOA 2A6YA 3ZFGB 1Q43A 2WNVB 3ST7A 5E1RA 2VW0A 1RJ7A 2R041 3GGLA 2V5DA 3JUUA 5GZCA 3VBFA 1ZRIA 4S2DA 2GC2A 3RI8A 1KS4A 2RS51 3H1WA 4RA0A 3WUCA 3ZKUA 4FFFA 2R063 4FPFA 3KHBA 4CP9A 1S4CA 2WT2A 2RS13 2NN8A 1SDWA 1ND3B 5FJHA 1FATA 2W3JA 3CO2A 3J8F1 4YLZA 2HWF3 1NY71 5J96B 1VBB3 1SPPB 2VMDA 3M7AA 2AC1A 3N7LA 4CZSA 1OLME 3AMQA 5CAZA 4A2UA 2VQ0A 2RE9A 1OOPC 3OG2A 5DDJ2 3N9QA 2XVGA 3V0AA 3TBDA 4M3CF 4AQSA 5KHJA 1ULDA 4CEYA 1N3PA 3PVEA 3VBSA 3NRUA 1VBE2 4XF1A 3CEWA 3I2GA 1ULFA 1CAVB 3NV4A 4IEOA 5JOWA 3VHOA 4XBLA 4B7KA 3AXEA 5J7MA 1NA1C 4BK4A 1POV3 2J22A 3ABZA 3ILFA 2R30A 3OD4A 4IE6A 2V73A 1GP5A 4C0BA 2W87A 1PGL2 2CHHA 5FZFA 3LSEA 4YGDA 1UF2C 1UU6A 3IM0A 3AJYA 5FP4A 4GMP1 1JZ6A 3H3UA 2A6VA 2DFBA 3LEKA 3N9PA 1EAH1 1BBT1 1PX4A 5DABA 1XNBA 5FRAA 2JDMA 3D5OA 1NQDA 4HN0A 5FP3A 2VZOA 3E1F1 2WQZC 2IVIB 3AJZA 3PIJA 4LBQB 5CBLA 3VZOA 3RYKA 4BXFA 3LSDA 3HOBA 2WN2A 5CB7A 4Q1RA 3JU9A 2E7TA 3QACA 3PVOA 4FOVA 1WBFA 3ZFEB 5ABJB 4OI2A 5C7GA 2E63A 4A7KA 4BMEA 3VDBA 1UQXA 1H8TC 5EHDA 2E7QA 3RZHA 1L7LA 1H2NA 5A7SA 5GLVA 3IKWA 3GXUA 2W9XA 1RUC1 4EN8B 4BHPA 1DGWA 2OW4A 4LKDA 1ENRA 3AMNA 4NUBA 2UWCA 2YU1A 3GNEA 4UFLA 4LIVA 5F3EA 2XJUA 3AVSA 5A6YA 1UZZA 3NMBA 1SEFA 3AVRA 4ZU4A 4LHLA 2WBKA 1RUJ3 5IVCA 3WP5A 5C8CA 3MICA 1CESA 2VW1A 4NIGA 2BP6A 1I5ZA 3ZYBA 1HRV3 4HBNA 4YM3A 1SLTA 2QZ3A 1PNGA 5D8AC 4CCJA 4OZXA 3A4UA 4GWMA 3VBUA 1LCLA 2VZVA 3MUY1 4M3CE 2ARCA 1YRZA 3E6BA 3IBMA 4AFMA 1IHMA 1AYN3 1R091 2BNMA 3AP5A 3MFAA 5A3MA 3ACLA 2YBSA 4MLOA 2FMDA 2X10A 4IUGA 4AFCA 4F7ZA 4LITA 1W8OA 1K5MB 1IPSA 3ETPA 5I8YA 4EE2A 2WNUA 1CZTA 4Y20B 1GQPA 2QQJA 3VBRB 1F15A 4I30A 1REDA 1VLNA 2GH2A 2UWAA 3LF7A 3H3LA 5FZ4A 3CKHA 3I49A 1S0JA 2W5FA 1C5HA 1GYKA 3IDBB 3WP4A 1NE4A 5J1XA 5BUVA 3EBRA 1CAWB 3LE0A 4P9XA 3DPRC 4PDWC 5FXXA 4XFCA 5A3WA 5T5PA 5C3PA 3S57A 5B4XA 4UI9L 4MV2A 5FYHA 5FUPA 4IGOA 2TNFA 5FY4A 4AI1A 2X29A 4PIXA 3ZSMA 4CCKA 4HFSA 4QHOA 1H9WA 3E5XA 3OY8A 4QD2A 2CU5A 4XJ8A 1H1MA 4NOTA 5FZLA 1WW6A 3ETQA 1GP6A 2V09A 4XF9A 4OFGA 2PHWA 4YZ3A 3JBG1 3KCCA 3WVJA 4YSFA 2YC4A 5IATA 5DAXA 3RJRA 2GH8A 1DZQA 4NIAA 2YBKA 3CIHA 3ZN6A 4BPZA 3GYDA 3IDCB 2SLIA 4UF0A 1XSQA 3APBA 3AP9A 4ISRA 3SH5A 2ZHKA 4XQDA 4WVMB 2FDJA 4QXKA 4C1WA 4U2AA 2RDNA 2AUYA 3LEGA 1XNDA 1H2MA 3RJ2X 4B29A 1K5MC 2BEOA 1UZYA 1DGRN
chains in the Genus database with same CATH topology
5HV0A 4J25A 3NNLA 5LA9A 3KT1A 2V4AA 4NHKA 3OUIA 4NHMA 2Y34A 5LBFA 5A3UA 4XCBA 4XCAA 4Y5TA 5LBCA 3MGUA 5DAQA 4JZRA 5EQUA 3DKQA 4XACA 4KBZA 3EMRA 4MHUA 2RDRA 3ITQA 4NHLA 5M0TA 2Y33A 3NNFA 5IAXA 4BQXA 5LBEA 4ZONA 4ZPIA 5LBBA 5DAPA 3GZEA 4XABA 3OUHA 4BQWA 4NHYA 5LASA 3HQUA 2HBUA 3KT4A 2G1MA 5HV4A 2HBTA 2JIGA 4UWDA 2RG4A 3OUJA 5LB6A 5L9VA 2RDSA 2FCTA 2FCUA 3KT7A 4XAAA 2G19A 5DAWA 5DAVA 5EPAA 5L9BA 4Q5OA 3W21A 2A1XA 2OPWA 5ERLA 4MHRA 2JIJA 5C5TA 3NNJA 3GJBA 3PL0A 5LATA 3HQRA 5L9RA 4NHXA 4XC9A 3NNMA 3W20A 3OBZA 3BVCA 4BQYA 5C5UA 4Y5SA 4NMIA 5IAVA 5IATA 5DAXA 3GJAA 2RDQA 2RDNA 4NAOA 5EP9A 4IW3A 2FCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HV0 A;  4J25 A;  3NNL A;  5LA9 A;  3KT1 A;  2V4A A;  4NHK A;  3OUI A;  4NHM A;  2Y34 A;  5LBF A;  5A3U A;  4XCB A;  4XCA A;  4Y5T A;  5LBC A;  3MGU A;  5DAQ A;  4JZR A;  5EQU A;  3DKQ A;  4XAC A;  4KBZ A;  3EMR A;  4MHU A;  2RDR A;  3ITQ A;  4NHL A;  5M0T A;  2Y33 A;  3NNF A;  5IAX A;  4BQX A;  5LBE A;  4ZON A;  4ZPI A;  5LBB A;  5DAP A;  3GZE A;  4XAB A;  3OUH A;  4BQW A;  4NHY A;  5LAS A;  3HQU A;  2HBU A;  3KT4 A;  2G1M A;  5HV4 A;  2HBT A;  2JIG A;  4UWD A;  2RG4 A;  3OUJ A;  5LB6 A;  5L9V A;  2RDS A;  2FCT A;  2FCU A;  3KT7 A;  4XAA A;  2G19 A;  5DAW A;  5DAV A;  5EPA A;  5L9B A;  4Q5O A;  3W21 A;  2A1X A;  2OPW A;  5ERL A;  4MHR A;  2JIJ A;  5C5T A;  3NNJ A;  3GJB A;  3PL0 A;  5LAT A;  3HQR A;  5L9R A;  4NHX A;  4XC9 A;  3NNM A;  3W20 A;  3OBZ A;  3BVC A;  4BQY A;  5C5U A;  4Y5S A;  4NMI A;  5IAV A;  5IAT A;  5DAX A;  3GJA A;  2RDQ A;  2RDN A;  4NAO A;  5EP9 A;  4IW3 A;  2FCV A; 
#chains in the Genus database with same CATH topology
 2CY6 A;  2P4E A;  1V6L A;  1UYZ A;  4HSL A;  2QJV A;  2VZS A;  3WDW A;  1GQH A;  1AR6 1;  3RDI A;  1NCQ B;  3K4A A;  1SDD B;  5GLZ A;  2WIN B;  1HW5 A;  5DDJ 1;  4V2V A;  4WV8 A;  4MG2 A;  1DHK B;  1IGO A;  5FAX A;  3DKQ A;  4K1Y A;  4OUE A;  2ZX3 A;  4BCU A;  2E53 A;  4Y33 A;  3LWC A;  3T2T A;  1GBG A;  2IVJ A;  1RIT A;  4EN0 A;  4LBM A;  1EAH 3;  2E9Q A;  1VBD 3;  1SFY A;  1NXM A;  3MW4 A;  4MYE A;  3SXW A;  1QOT A;  3UV9 A;  1RB8 G;  1G9C A;  1PK6 B;  1VB4 A;  3POS A;  1W9S A;  4KMQ A;  5AFE A;  5FPB A;  5H9R A;  2D3S A;  1NZC A;  4XIK A;  1DU3 D;  3SC7 X;  5F1R A;  1CJD A;  1UL9 A;  4HSJ A;  3AP6 A;  2MEV 1;  5C33 A;  4BDV B;  3U37 A;  1HJG A;  5JI7 A;  4RGA A;  1VBC 2;  5I0D A;  1CIW A;  4GMP 3;  1MVQ A;  3WHT A;  1ALY A;  5APA A;  3LIG A;  1J3P A;  1UOB A;  5JSP A;  2ETE A;  4XE9 A;  1IS6 A;  2Z4F A;  1VIW B;  2HH9 A;  3V0B B;  2IC1 A;  2DVG A;  4L11 A;  3T0B A;  1WCU A;  1XNA A;  5L9V A;  5AVP A;  1OFN A;  3DYO A;  4QPI C;  3M4F A;  5CFD A;  4EV0 A;  2HWB 3;  5KHI A;  3KT7 A;  4DNY A;  2FDH A;  4IEW A;  3J4U H;  1QGL A;  2GC1 A;  2VNV A;  4NJ4 A;  1I1E A;  1OC1 A;  2P3Y A;  4LUM A;  2BRT A;  1LOG A;  3OGS A;  1D2Q A;  4NID A;  3UT0 A;  1ENQ A;  4N7I A;  5IT6 A;  4COY A;  3ZXJ A;  5GLW A;  2I74 A;  4J6G A;  1N1S A;  2JIJ A;  5AC9 1;  2X53 S;  4DEV A;  2XL7 A;  5HCA A;  4CDW C;  3H8U A;  2PAK A;  3LPG A;  4E4S A;  2C26 A;  2BU9 A;  3HQR A;  2BVV A;  2GAU A;  2HWF 1;  4CP0 A;  3ZFE A;  5A7O A;  3T1L A;  4JHT A;  3AL5 A;  2DBN A;  3HN1 A;  2BGO A;  2WSU A;  1LGB A;  2UYA A;  4M0N A;  2QQV A;  4D6S A;  2Y6L A;  3IIA A;  4WBB A;  3ACI A;  3GM8 A;  3LDR A;  1F5J A;  5J3U A;  1U12 A;  4BQY A;  4GH4 B;  4Z8B A;  3OBA A;  1N3O A;  4LK6 A;  2F17 A;  2RR1 2;  2EID A;  1ONA A;  3AYD A;  3PJQ A;  5FUN A;  3ZN5 A;  4BIS A;  2XVL A;  2P3K A;  1PO2 3;  1TME 1;  1W0O A;  2H6B A;  4GB3 2;  2NM1 A;  1GOG A;  1HJF A;  1L7Q A;  3ZLI A;  2J42 A;  3IPV A;  1AR6 2;  2CDO A;  4Z2A A;  4S2G A;  5JOZ A;  1TVG A;  1QJZ A;  1YQ8 A;  1KD7 A;  2RDQ A;  4KH9 A;  2F4L A;  2OX0 A;  2VNO A;  2VCC A;  1W0P A;  2ZTN A;  4I02 A;  5HCB A;  5IHR A;  1PMI A;  3AZY A;  1RVF 3;  4GAZ A;  4JGZ A;  4QKD A;  3W5M A;  5CFD B;  3CZU A;  3PTY A;  4NAM A;  1TNF A;  3KT1 A;  1PK6 A;  3LKJ A;  4AHY A;  5F5A A;  1S0D A;  1OHF A;  3CLP A;  5CNA A;  4HVO A;  4L9B A;  5HXV A;  5CKN A;  5CEH A;  1FV2 A;  4P14 A;  4QGN A;  3M3I A;  1VMH A;  4MUV A;  4FFG A;  4WM7 C;  5JXG A;  5FDB A;  1UNB A;  3A0N A;  3SKV A;  4P5H A;  4B4P A;  5FYY A;  2ZAC A;  5F39 A;  4OHV A;  1FMD 2;  1QJY 1;  3DEC A;  2VUA A;  5FZI A;  3WNO A;  1D4M 1;  3BOD A;  2WYS A;  1J3R A;  2Y33 A;  5EZW A;  1UY3 A;  4GAL A;  5FYS A;  5D21 A;  1DF0 A;  1OLR A;  2ZZJ A;  4OLL A;  5L19 A;  4G4F A;  3UGG A;  2EIB A;  2J1R A;  3EXU A;  3QLQ A;  1N1Y A;  2VVD A;  4C91 A;  3OUH A;  3VLB B;  4QXH A;  5EV7 A;  1WMX A;  2I45 A;  3ZXA C;  4B8E A;  4P9L A;  3WNN A;  4URA A;  3WQ7 A;  1POV 0;  4HXC A;  3IZO A;  3UNP A;  4DXS A;  3AZW A;  3OSD A;  4AVA A;  1BHG A;  1GWK A;  4JRL A;  4W65 A;  2G1M A;  4LBK A;  3NV1 A;  4A6O A;  2AH2 A;  4DZG A;  4K3U A;  1W99 A;  2GAL A;  2GDF A;  5A7W A;  2PHF A;  4YZ1 A;  5HXM A;  3C8X A;  5A3L A;  2WWU A;  4DUX A;  5BXX A;  2DCJ A;  2ENR A;  2JG8 A;  3K4D A;  2ILM A;  3THT A;  4M3C B;  2PLV 3;  2ZGN A;  4Y4Y A;  2D43 A;  2VTX J;  3MIE A;  3VDD A;  3VD9 A;  1W2A X;  4PIZ A;  4CCD A;  5BV6 A;  1VAK A;  1KDM A;  4CA9 A;  3WNM A;  1XQN A;  1XXN A;  2Q5T A;  3FUO A;  2CGP A;  1W6Q B;  1UOJ A;  4MSV A;  3WDV A;  1Y9M A;  3LPF A;  4I0A A;  3ZR6 A;  4LT5 A;  5BNO C;  1D4M 3;  1LNS A;  1PZ8 A;  3K3O A;  1X8E A;  2I2S A;  4K21 A;  5JMO A;  4R9A A;  1LGC A;  2VTF A;  3Q9O A;  5F3G A;  2IXI A;  3WP6 A;  5LAT A;  2P17 A;  2EXI A;  4HVR A;  4OVE A;  4ZKT B;  2EAK A;  2DCT A;  3BIW E;  1TNR A;  3N35 A;  4MGZ E;  2Y38 A;  1OBN A;  4B4Q A;  2IXJ A;  4EWA A;  2PHT A;  2PA7 A;  2VCA A;  5FPA A;  2E31 A;  2XJS A;  2FHR A;  4XFH A;  1TMF 3;  4Q4X 2;  1OOP B;  4XUN A;  1PHM A;  1BEV 3;  1M4W A;  2JB8 A;  4PLO A;  4QM8 A;  3WDU A;  1YI7 A;  2ZPX A;  4LNV A;  1AL0 G;  1LEN A;  1RUF 2;  3KB5 A;  5SV8 A;  1V9U 1;  1AR9 2;  2WJS A;  2YDE A;  4M3C A;  5IVY A;  1W28 A;  3VD3 A;  4RFR B;  4XXP A;  1W06 A;  5JI9 A;  2O8O A;  5L36 A;  3I2I A;  4B4R A;  5C6C A;  1W0N A;  3TN9 2;  4IV3 C;  1CR7 A;  5A7W B;  3FLP A;  3KVA A;  4HMZ A;  4LHN A;  1MS5 A;  2W39 A;  3P1I A;  2WO3 A;  5FYM A;  4LBN A;  5A80 A;  3NKG A;  4XET A;  5EP9 A;  2XLG A;  2FCV A;  2QQL A;  2QVS B;  3MFC A;  3Q8B A;  1D4V B;  4N53 A;  5FY9 A;  3T4V A;  4E4D X;  1TE1 B;  3VBR C;  5GZD A;  3GZU C;  3WNP A;  1POV 1;  2R04 2;  1QJY 2;  4JDO A;  5CA6 A;  4ZHN A;  3BYW A;  3HWJ A;  2CWM A;  1Z7S 1;  1RUH 2;  1V6M A;  3JB4 C;  4K9S A;  1YEW A;  4XCA A;  4AFA A;  1EUU A;  5GAL A;  1J84 A;  2MPF A;  2V72 A;  3HQX A;  4GKY A;  4XAC A;  4Y26 A;  4IEZ A;  2VE1 A;  3LOI A;  1UMI A;  4C0H A;  5IVF A;  1LU1 A;  4DY3 A;  2ZKL A;  1DQ4 A;  1JYT A;  1FOD 1;  2PEL A;  4P08 A;  3N4M A;  2OYZ A;  1FXZ A;  1XYO A;  3NJY A;  2XVK A;  3VBS C;  1JHN A;  4TYS A;  5EYY A;  5FZO A;  1W2N A;  1BKZ A;  3DGT A;  4V2W A;  1OOP A;  1JZ4 A;  2OT7 A;  3NL1 A;  4Z07 A;  4LOT A;  4PJY A;  1CAX B;  1Y4W A;  5FK8 A;  2D40 A;  3LDB A;  3VBH C;  4CDX C;  1BBT 3;  5L7O B;  4N53 C;  1XNT A;  5DUX A;  3ZO0 B;  1VPH A;  4CCM A;  4RR3 B;  3FFZ A;  1W2T A;  3T2P A;  2GN3 A;  3WG3 A;  4FPO B;  3POE A;  3WIN E;  4GB3 1;  2OUJ A;  3BI3 A;  5JIA A;  1FNZ A;  1C1F A;  4MX3 A;  5IVJ A;  4KG0 A;  1J83 A;  3M3E A;  3VBH A;  1ZZ7 A;  2XGX A;  1CQ9 A;  3NNL A;  4ZS3 A;  1DQ5 A;  2C9K A;  1NLQ A;  4LPL A;  1GLH A;  4IXL A;  2A6W A;  1NCR A;  4FTS A;  2VQT A;  1W8T A;  3MW2 A;  1MZF A;  2BW8 A;  2CYF A;  3OUJ A;  2A3X A;  5FZK A;  1MS4 A;  4AWD A;  1LHO A;  1VMJ A;  4A3Z A;  1U5Y A;  1O3T A;  4YG3 A;  3TN9 3;  3UL2 A;  1O5L A;  3VKL A;  3NJX A;  4UT5 A;  1VBE 1;  1MZ5 A;  5IK4 A;  2OA2 A;  4QQH A;  1MR5 A;  5DAW A;  3WW1 A;  2VQA A;  2HWE 1;  3NAP A;  1BEV 1;  3TNP B;  1GWM A;  3VB9 A;  4CXW A;  1DBN A;  1QOS A;  4QT6 A;  4CDQ A;  1MS0 A;  3POY A;  1XU1 A;  3I2O A;  1DGW X;  4XTM A;  1TMF 1;  2HWB 2;  4EWD A;  1C8M 1;  2JWP A;  5FTT C;  1S2E A;  3PL0 A;  4LUK A;  1DYP A;  2QQI A;  1GOH A;  3BPZ A;  4K6B A;  5L9R A;  2LAL A;  4OI1 A;  3ZYH A;  2CWS A;  1H6Y A;  1L3J A;  1DYK A;  1JH5 A;  3ZN6 B;  2D3R A;  2EIC A;  2VMG A;  3A21 A;  4Y1Z A;  1OPO A;  1KS5 A;  2WFF 2;  3KQR A;  3DN7 A;  4FPJ A;  3WDT A;  4LHS A;  5ACA 2;  3BKZ A;  1LOD A;  3ZYP A;  1SAC A;  1WD3 A;  2VAU A;  3HBK A;  3WQ0 A;  1ODN A;  3HR9 A;  4K8R B;  2DWR A;  1GMM A;  3RFR A;  3MV0 1;  4Q4V 1;  5FBZ A;  3VGI A;  1FPN 1;  2PLV 1;  4CDU B;  2ZHM A;  4IV3 B;  2XB6 C;  5KXD A;  3U14 A;  4CTE A;  4MET A;  1A34 A;  1R08 2;  3C3V A;  2D97 A;  1QJX 1;  4A7Y A;  5FP8 A;  3KCY A;  4K20 A;  3POW A;  4HPK B;  3H1Y A;  3WQ1 A;  5KXB A;  5L7O C;  5GLT A;  1WWY A;  3FFQ A;  1H1I A;  3ZYI B;  4BK5 A;  4FOW A;  1ZBA 1;  4BQ1 A;  2V4A A;  2UYB A;  3PIG A;  2C0Z A;  4NHK A;  3TOJ A;  5T54 A;  2RS3 2;  1HXS 2;  1UKG A;  1W6M B;  1RYY A;  1UO9 A;  4D94 A;  5G05 L;  2OKX A;  1MVE A;  1OD5 A;  2VW2 A;  5T5J A;  5ACA 3;  1V00 A;  1Y9Q A;  2N7G A;  4C1X A;  3ACG A;  4Q26 A;  4AHW A;  1W03 A;  5FZ6 A;  4YM1 A;  4E9K A;  3WNK A;  4JCK A;  1HX6 A;  4Q27 A;  1FT9 A;  5FZ1 A;  1JZ3 A;  2P5B A;  5CAD A;  3M3Q A;  1OUS A;  1U5I A;  3RNS A;  3WDX A;  1G9A A;  2VO5 A;  1WCS A;  4KGQ A;  2WA4 A;  2G9Z A;  3U07 A;  4WM7 A;  3CNA A;  5I0S A;  5L7O A;  4QDS A;  1KIT A;  4LOS A;  4AW7 A;  2WII B;  5K4L A;  2XOM A;  2ZAH A;  3TEZ A;  3MLL A;  5ISL A;  5FYC A;  1AR7 1;  1V6I A;  3ACF A;  2VUD A;  1W6O B;  2W52 A;  4Q0Q A;  4ES8 A;  3ZX7 A;  4Q4V 3;  3ZVX A;  1SLL A;  4CEW B;  4PI2 A;  4S2H A;  3OYW A;  4R8H A;  1XSR A;  3MHZ A;  3H8R A;  1Z0H A;  5FKC A;  1EAH 2;  3N9L A;  3T4H B;  1QJE A;  4RL7 A;  5KXC A;  3VKO A;  4YW6 A;  5CYY A;  2PN5 A;  3EHK A;  3E97 A;  4BJ0 A;  5FLH A;  4DMI A;  2BNN A;  3ZYG A;  2CTV A;  4UW4 A;  4SBV A;  3VD7 A;  5JMC A;  1CN1 A;  1LTE A;  2RG4 A;  4Y3O A;  5FYZ A;  2R1B A;  1G8W A;  1HXS 3;  2QZ2 A;  2ZOE B;  1NCR C;  2FCT A;  5FMO S;  3VUO A;  4CDQ B;  2XKP A;  4QM9 A;  3WW3 A;  3CZJ A;  1TEI A;  3BCW A;  4IE7 A;  1GQG A;  2WFF 3;  3PVN A;  4HVQ A;  3OGG A;  1OKO A;  2Z42 A;  5FWE A;  3ZSK A;  1DG6 A;  1YC6 1;  4S2F A;  1QXJ A;  3W21 A;  5C3S A;  4CCE A;  5J36 A;  4AL9 A;  1NA1 A;  1V6O A;  4PLN A;  2VMF A;  3RS6 A;  3NNJ A;  4AXO A;  3GJB A;  4E2G A;  4YVS A;  4NO4 A;  4R9C A;  5FZ3 A;  4JGZ C;  3S5A A;  3BTY A;  5I0U A;  4AED A;  3R4U A;  1BYH A;  2ZEW A;  1H0B A;  4M00 A;  3TEY A;  3LQC A;  4COV A;  2ZGT A;  1G9D A;  1HQN A;  4XHB A;  3OY8 B;  4A42 A;  4AED C;  3B5L B;  1ZRR A;  3M3C A;  3LA7 A;  4FQZ A;  1GNZ A;  4XIL A;  3U11 A;  3ZXE A;  5I8T A;  1S1A A;  4E4Z A;  5FMO L;  1VE0 A;  1RUJ 1;  5K9Y A;  1X36 A;  1VBB 2;  4UFJ A;  4LOR A;  5DN2 A;  5FPV A;  2DVA A;  1WLD A;  2A73 B;  5I8S A;  4EN9 B;  1FOD 3;  3O14 A;  5JXH A;  5JUV A;  3IB3 A;  1WLC A;  2O1Q A;  4KL1 A;  3DUI A;  4Q8L A;  1UAI A;  4QPI B;  1VBA 1;  2DYC A;  4FTE A;  1E5H A;  1GV9 A;  1GZW B;  2EF6 A;  4TTG A;  4XUQ A;  1NA1 B;  4PF5 A;  3WQB A;  1HXS 1;  1RUD 1;  2EXK A;  4XDO A;  1AR7 3;  2Q4S A;  5C9A A;  1VAM A;  3ZKY A;  1K3I A;  3VBF C;  2IFR A;  3I3Q A;  3N7M A;  1R1A 1;  3TNQ A;  2R7E B;  3LEI A;  5E88 A;  4LTA A;  3KV5 A;  1S2B A;  4GA9 A;  1JU4 A;  2XJQ A;  3TB0 A;  1MEC 2;  2GSY A;  4XUR A;  4NR1 A;  3I2D A;  3CJI C;  4QPG A;  5LBF A;  1RUO A;  1ND3 A;  1VBC 3;  2VOX A;  3HNM A;  4M4P A;  1UYX A;  4ITC A;  1OQ1 A;  5CFC B;  5C8W A;  5LCW L;  3MGU A;  1NOV A;  1SZB A;  1UWW A;  3AKR A;  1Q8O A;  4MGS A;  3B69 A;  1QQP 1;  4KBZ A;  1DCS A;  1YNA A;  2Q1M A;  5HI0 A;  3EMR A;  5JZG A;  4Q0V A;  5FZ9 A;  1CIY A;  2ZMK A;  3I4I A;  4GKX A;  4IEY A;  1K5J A;  2IXH A;  1RUI 1;  2RS5 3;  3PUA A;  4M4R A;  1YFW A;  4BOW A;  3JD7 2;  2EAA A;  4F8A A;  1PGW 2;  1YYN A;  1WW7 A;  1AL2 1;  4GWJ A;  3WXP A;  1LRH A;  5K0U B;  1FX5 A;  2BBV A;  3HEI A;  4BLJ A;  4IGQ A;  2BOJ A;  3QCW A;  2RMU 3;  1RUH 3;  4ASM B;  3AP4 A;  4AK3 A;  1AVB A;  1KEX A;  4DY5 A;  5FMB A;  3O7O A;  4N9H A;  2AGS A;  5LBB A;  4A45 A;  4XAB A;  5CIS A;  1JZ7 A;  1AYM 1;  1GZ9 A;  2HWC 1;  1K42 A;  4COW A;  5DDJ 3;  3ON7 A;  1H2K A;  1WCK A;  4OHW A;  3HN3 A;  5D2A A;  1CAX A;  2HWC 2;  3OEB A;  3WCR A;  4FPC A;  5DZE A;  3S30 A;  4XJ9 A;  4CDU A;  3FHQ A;  2RS3 3;  3B93 A;  4HL0 A;  3JQX A;  1RHI 2;  2Y6J A;  1NXD 1;  4OYU A;  1WGP A;  4ASK A;  3LZZ A;  5A32 B;  3VDD C;  4LUL A;  3VZM A;  2LM3 A;  1OPM A;  2ZGS A;  1JOJ A;  1MS3 A;  2RS1 2;  3RVH A;  2W08 A;  2ZGU A;  3CL1 A;  5LY1 A;  1PGW 1;  2GME A;  1E5S A;  1EUT A;  2RDS A;  3WEZ A;  4B1M A;  3WDY A;  1QNY A;  2O14 A;  1ENX A;  4XF3 A;  3ZOI A;  5AVA A;  5CFC A;  2YFU A;  5JCT A;  4DB5 A;  5GZG A;  3JZV A;  4DXZ A;  1NCQ A;  3GCX A;  3NV2 A;  2XBO 1;  5L9B A;  1ZRC A;  2GNB A;  5IVE A;  4BZ4 A;  2OPW A;  1OQE A;  1V9U 2;  5ERL A;  5BYN A;  4X6R B;  2XBO 2;  3GHM A;  4LO7 A;  2J1V A;  2GC0 A;  4D0Q A;  2CV6 A;  3POJ A;  4L0P A;  2VCB A;  2G9G A;  1NLS A;  1AYM 3;  1F5F A;  1GZC A;  1YJL A;  4OHZ A;  4LO6 B;  4FVV A;  3JXS A;  2RMU 1;  5A3O A;  3WY6 A;  1KDK A;  1CAU A;  4WZC A;  2DCK A;  1W2O A;  3KWV A;  4HON A;  4FBF A;  5BNP C;  1COV 3;  3RWN A;  1JUI A;  4PBP A;  2FDI A;  2Z2S B;  3MID A;  1YQ2 A;  2VXJ A;  1BJQ A;  3HIF A;  1TME 2;  1QH7 A;  2WT1 A;  4W6Y A;  1U5Z A;  4BWO A;  3GHN A;  4AAX A;  1WUV A;  2AR6 A;  1UY0 A;  1RTV A;  4CDQ C;  2RR1 1;  1QQP 3;  2MNG A;  1O6U A;  1LHW A;  4E4H A;  2W1U A;  4XW3 A;  2VZU A;  3POI A;  4UXA A;  4UW6 A;  2HYK A;  2FD8 A;  4FTB A;  1SCR A;  2YGL A;  1DQ2 A;  2VBP A;  3RRD A;  2W95 A;  4XHX A;  3Q8F A;  3KCX A;  4R4Z A;  1QXR A;  2B9V A;  1WBL A;  3CMG A;  2HWD 1;  4O61 A;  4AVT A;  4CCL A;  2BQP A;  2FZ1 A;  4OUS A;  1H4H A;  4N7U A;  1OQD A;  3WG4 A;  1WCQ A;  1GZT A;  3GCW A;  1AL2 2;  2C24 A;  2VL4 A;  4YYO A;  2Y34 A;  2ZS6 B;  2XLF A;  4I0B A;  2WA3 A;  4LO5 B;  5DXD A;  3H8O A;  3SHR A;  5DAQ A;  4JZR A;  1OF4 A;  5AFB A;  1H8T A;  1X8M A;  1OH4 A;  3JBG 2;  1J58 A;  1RUH 1;  1TME 3;  4YG6 A;  4MHU A;  2LTN A;  4MGQ A;  1RUC 3;  1Z7S 3;  4XTP A;  2RDR A;  3LOB A;  4IET A;  3WSO A;  4AHX A;  2ZGR A;  4MH0 E;  4CCC A;  5C3O A;  5FJK A;  4FCA A;  2JE7 A;  3I59 B;  1PVC 1;  5KHH A;  5FY7 A;  4UYB A;  1UIJ A;  2WZR 1;  3FMG A;  2TUN A;  4WVV A;  1RJ8 A;  4NPL A;  5LK5 A;  1HN1 A;  4NN0 A;  4QPW A;  3WOG A;  5LY2 A;  3BU7 A;  4HOO A;  1DIW A;  3GZE A;  4Y1X A;  1OFS A;  1RMU 1;  1FV3 A;  1G7Y A;  1ZA4 A;  2BGC A;  4BQW A;  4NHY A;  4KWU A;  1MZ6 A;  1UX6 A;  3AFG A;  1F2N A;  2BWC A;  1BZW A;  4HT1 T;  4KQ7 A;  1TZO A;  1FMD 3;  2R06 1;  4MZU A;  1O4T A;  2DUP A;  5DG1 A;  2D93 A;  3EQE A;  4AOC A;  4QKB A;  2R04 3;  3ASI A;  3HMY A;  5JPM B;  1GUI A;  1COV 1;  2JDP A;  4GB3 3;  4J1X A;  1UCX A;  1SG3 A;  2JDK A;  1NT0 A;  1Q8P A;  2JIG A;  1LGN A;  1UXX X;  2AZ5 A;  1HB3 A;  2JG9 B;  3DYM A;  1S0B A;  3ZFF A;  5A3T A;  2ATF A;  2XWB B;  1GAN A;  4UBG A;  2B45 X;  4CDW A;  1UW8 A;  2D6N A;  1JOD A;  1I9R A;  4Q4W 3;  2G19 A;  3POB A;  3I97 A;  4MO3 M;  1D7P M;  4HK9 A;  1A8M A;  4XEZ A;  1A6C A;  2VZR A;  2ZHN A;  3K51 A;  3DPR B;  4NPM A;  5FLI A;  2DUQ A;  3E6C C;  2ZGK A;  4XUP A;  4JGZ B;  3NW4 A;  3RYR A;  3C7E A;  1X9T A;  4UBH A;  4YW2 A;  1AR8 2;  1NKG A;  4D6R A;  1X33 A;  5GZE A;  4XC9 A;  2ZEX A;  4BB3 A;  4LHK A;  2WAO A;  3BB6 A;  2QE3 A;  4D6Q A;  4LE4 A;  4BQ4 A;  4J1W A;  3ZMN A;  4FFI A;  2X5I C;  1GIC A;  3U1X A;  4HPK A;  3S7I A;  1UKR A;  3RZM A;  4FPE A;  1ASJ 2;  4KBB A;  1JUH A;  4TWT A;  5BNN B;  1RL3 A;  1HV1 A;  2A6X A;  1XE0 A;  1JYX A;  3ZFF B;  2KXL A;  5F2W A;  4DEQ A;  3CF6 E;  1RUF 1;  5BNO A;  4IEP A;  5GJ6 A;  4CDU C;  5ACA 1;  1EYB A;  3X29 B;  1C4R A;  2E51 A;  1ULC A;  1ODM A;  3U0Z A;  2Z79 A;  4QX2 A;  4I3P A;  2B4K A;  1JTZ X;  3OB8 A;  5IW0 A;  4AI8 A;  1GP4 A;  1H9P A;  3IN9 A;  3WD5 A;  2YBP A;  2D98 A;  2ZEZ A;  3O0X A;  3JD7 1;  3J26 N;  3POF A;  4FXK B;  4Q0P A;  4YGC A;  4GXL A;  4AAP A;  4XJZ A;  2P1B A;  2DVD A;  2B46 X;  2PHX A;  3ZXK A;  4COU A;  3D0J A;  1JYI A;  4WZF A;  5LBC A;  3ZSJ A;  2DV9 A;  1JOB A;  2KM2 A;  2VH9 A;  3HNY M;  2QQW A;  4XDQ A;  3WW2 A;  2Q8D A;  3GZA A;  2C4X A;  3T09 A;  5H9S A;  2OQ7 A;  1ZBA 2;  4HKW A;  4WM7 B;  2BER A;  3PUQ A;  3PUI A;  3DCQ A;  1Q3E A;  1UMZ A;  5IYY A;  3I2F A;  3FC0 A;  5A1A A;  3VDC A;  5ABJ C;  2PQQ A;  3ILR A;  1W6O A;  3N3H A;  5FKB A;  2ZXQ A;  2ZA9 A;  3R05 A;  5BNO B;  2H6C A;  3O1P A;  5JXJ A;  2DU0 A;  2JE8 A;  1YQ6 A;  2WSV A;  4O9E A;  4XFI A;  5IJR A;  2VU9 A;  1FPN 2;  2RM2 1;  2WL1 A;  1MQT C;  3LDK A;  1T6B X;  3NJV A;  2OUH A;  5F5I A;  5BNP B;  1PO2 1;  1BVV A;  2UU8 A;  1B09 A;  3WF4 A;  1ULG A;  2HBU A;  2Q0A A;  2VBD A;  3USU A;  5FXZ A;  4R4X A;  2DUR A;  2ID4 A;  4KNC A;  1UIK A;  2OII A;  3MV1 1;  4PBO A;  3MZH A;  4RR3 A;  1RXG A;  5F2S A;  2GMP A;  4A3X A;  4I3G A;  3RMX A;  3ZN4 A;  2GNM A;  4CU6 A;  3PJY A;  4Z92 B;  1RVF 2;  2VQU A;  3B7M A;  4H14 A;  4JTO A;  2IZW A;  4XUO A;  4MGK E;  4Z82 A;  5A3P A;  3DPR A;  4H7M A;  1CX4 A;  3KS7 A;  1WMF A;  1FYU A;  2Y6F A;  5IVV A;  1AR8 1;  1LU2 A;  2WQ8 A;  2LRO A;  1OVS A;  4P02 B;  4FAH A;  5HCH A;  1HRV 1;  2DBI A;  5FBJ A;  2XBO 3;  2DVB A;  1VP6 A;  2BVB A;  5E8A A;  4V1P A;  5EPA A;  1BQP A;  4DXT A;  4FPL A;  4P5Y A;  3K75 B;  4FQ4 A;  4AG4 A;  4BIF A;  3IPV B;  4PI0 A;  3AZV A;  4KU7 A;  3S6P A;  4PDW B;  1OMI A;  1PM4 A;  2XH6 A;  4FP3 A;  3BTA A;  2JDA A;  2FBE A;  2W1Q A;  1NYW A;  4Q0U A;  3NAP B;  1PZ9 A;  3V0A B;  1XBF A;  3QD6 A;  4P9G A;  3G7D A;  4I0W B;  4UAP A;  4XDP A;  4XYX A;  5FUI A;  1UU4 A;  3NNM A;  4MGT A;  1NE6 A;  4XBN A;  5JXI A;  3L9J T;  4RFT 0;  4LKF A;  4LO8 A;  1OUR A;  1ZZC A;  1ND2 A;  2BTV C;  1JYW A;  3ZXG A;  5EJ3 A;  3AKQ A;  5JLV A;  2AEZ A;  4NII A;  4A44 A;  1W9F A;  3BVC A;  3CU7 A;  4Y1Y A;  1KXG A;  3V56 A;  2ZGM A;  5KHK A;  2CSG A;  1R1A 3;  4NMI A;  3ZYR A;  4AZZ A;  4CPB D;  3GZT B;  1VBB 1;  2VM9 A;  1VRH 3;  5F6L B;  4N9I A;  4QB2 A;  1JZ5 A;  5FFO C;  4NRP A;  3VBF B;  4LXL A;  3P6B A;  1HRV 2;  4CU8 A;  2OZ6 A;  5FP9 A;  1KRI A;  2JIC A;  1SFP A;  3NNG A;  1RUJ 2;  2PAM A;  3LA2 A;  1IOA A;  4AE2 A;  2FQP A;  3FZ3 A;  2PYT A;  3KV6 A;  1G9B A;  5IK8 A;  1E5R A;  2VD7 A;  1YUD A;  1YIF A;  2SBA A;  3IAP A;  2BYV E;  2D6L X;  5HV0 A;  1HQL A;  1QIQ A;  3MLJ A;  4KWL A;  5IVB A;  5EXO A;  4XPV A;  5GZF A;  1U5X A;  4BQ3 A;  3KHC A;  2ZCW A;  4PQ9 A;  5JSO A;  5CZK A;  3OJB A;  2GP3 A;  3M8L A;  3E5Q A;  1RXF A;  1VB2 A;  4Q4Y 3;  1ND2 B;  3VL8 A;  4B1L A;  3RZG A;  2VJX A;  3WV6 A;  3L2Y A;  1TG7 A;  1OXC A;  1IZ3 A;  5FMD A;  3VBS B;  2AEY A;  3ORJ A;  3URF A;  3FE5 A;  1S55 A;  1W6N A;  2WUH A;  3H1M A;  3QH6 A;  5BNN C;  5C9A C;  3VBU B;  1CVN A;  3FN9 A;  4CYD A;  1ZA7 A;  3OEA A;  3T3Y A;  2PHU A;  1C1L A;  3WG2 A;  2VC9 A;  3WW4 A;  4NRO A;  3ZIX A;  1VBD 1;  2EIE A;  4Y24 A;  5A33 B;  1GNY A;  5JDB A;  3SH3 A;  1OKQ A;  2WNV C;  5LBE A;  4JKM A;  4BQX A;  4MOA A;  3U4S A;  2A71 A;  4JGY B;  3T2O A;  1V6N A;  2WLP A;  1Q8S A;  3AZX A;  4QPG B;  1OT5 A;  4W4Z A;  1VRH 1;  4CRQ A;  1E5I A;  3GBW A;  4GIQ A;  4CUB A;  3AYA A;  4JQT A;  3RWK X;  3OOX A;  1N3Q A;  1J59 A;  1AHS A;  5T3N A;  2FDK A;  1VRH 2;  2RHP A;  4YW7 A;  5JWP A;  3IDA A;  2JDZ A;  1O5U A;  5D8A B;  1ZYB A;  1SQ4 A;  1PZ7 A;  5HV4 A;  3H50 A;  1Y7B A;  4YVS C;  4CEW A;  5T5O A;  1K45 A;  4XUT A;  2Z5W A;  1APN A;  4DUW A;  2Y0O A;  1ACC A;  2P6C A;  4W6X A;  1YFU A;  3H8X A;  2QQN A;  4Y1V A;  2WYF A;  1JXN A;  4HKL A;  1RHI 1;  3SMH A;  4ZU5 A;  2XQR A;  5E6H A;  1JMU B;  2QTW B;  1PO2 2;  5FLJ A;  2GNT A;  2RS3 1;  3Q8A A;  5A7Q A;  1NLR A;  2D6O X;  1AR8 3;  2JB4 A;  1HLC A;  2VNG A;  4LO4 B;  1CON A;  2VUC A;  4ERO A;  2JEC A;  2D44 A;  1A8D A;  1XYN A;  2DDU A;  2WNO A;  3DXT A;  3MW3 A;  1WCD J;  3TYJ A;  1LUL A;  2CGN A;  2PAE A;  1W9T A;  4CUG A;  4EWE A;  5LA2 A;  1PIV 1;  4HN1 A;  4PQQ A;  2F4P A;  1O59 A;  3C7F A;  2D3P A;  4A6S A;  1D4M 2;  2BWA A;  5T52 A;  1BCX A;  4QPG C;  2K46 A;  4Q2F A;  1Q8V A;  2Y6H A;  5FYI A;  1QDO A;  4MVT A;  1D2S A;  1GFF 2;  3PME A;  1XE8 A;  2DFC A;  4AED B;  1WLW A;  5EJZ B;  5F9T A;  1GWL A;  2QDN A;  4BQ2 A;  3NJZ A;  4RGG A;  2ARE A;  5A1L A;  3OD0 A;  5DZG A;  4CU7 A;  5FPZ A;  1IKQ A;  1UY1 A;  2D5F A;  4CEY B;  2WNU C;  1LHV A;  3M70 A;  3PU3 A;  2RJ2 A;  3KZ4 C;  2HJI A;  2E6V A;  2IXL A;  4U36 A;  3G6J B;  4QX5 A;  4PIY A;  4PT6 A;  1AX2 A;  2OVU A;  5K8S A;  1NY7 2;  3ZR5 A;  4NAO A;  2ERF A;  2LS6 A;  4CEW C;  5FYB A;  3CJI B;  4XFA A;  2JX9 A;  4QX3 A;  1KJL A;  1QKQ A;  1AUY A;  5CIR A;  5C71 A;  5BNN A;  4LLO A;  1MEC 3;  2YXS A;  4XFB A;  3ZFG A;  2BNO A;  4CVU A;  1MPX A;  2R16 A;  3B02 A;  2XXZ A;  3I3B A;  2ZGL A;  4XCB A;  1NZI A;  1W6N B;  3P3P A;  2Y6K A;  4FOY A;  1ULO A;  4XBQ A;  5FK7 A;  1FI2 A;  4AI9 A;  2JDN A;  1YWK A;  5FZA A;  2R07 1;  4I09 A;  4WVW A;  3P5B A;  1QJU 3;  1F4A A;  2WNV A;  3OGJ A;  1ZZ9 A;  1W8N A;  4XJU A;  4YG0 A;  1C57 A;  2K9Z A;  5KR7 A;  2ZX4 A;  3V0B A;  3AKT A;  4OQ8 A;  1F35 A;  4NHL A;  4UF0 B;  2XR4 A;  2FDF A;  4AGV A;  3NNF A;  4Q29 A;  1DZT A;  1FMD 1;  3BOP A;  4N8M A;  4HG6 B;  1RUD 2;  3T30 A;  4CDX B;  4PHZ A;  4BXS V;  1V0A A;  4LQR A;  5FY0 A;  3WG1 A;  4AQ2 A;  1PVC 2;  4A7Z A;  1REE A;  1KFU L;  2JD4 A;  1Y43 B;  3LEM A;  4Y5Z 0;  2BDR A;  1JW6 A;  5AC9 2;  3H7J A;  4OHY A;  1I3H A;  3ZMO A;  5FOJ B;  4CSW A;  2VZ1 A;  2Q8O A;  3AL6 A;  1ZRF A;  4QXC A;  1MS9 A;  4WM8 C;  3POG A;  3VV1 A;  2WZR 3;  2YY1 A;  4HLT A;  2EIG A;  5I93 A;  4FXG B;  3VL9 A;  4CP1 A;  2XL9 A;  5A70 A;  1ASJ 3;  1SBD A;  3RZK A;  3RZJ A;  1WA6 X;  3UJQ A;  4G3Y C;  1ND2 C;  4ATF A;  1BVP 1;  2YC2 A;  3B9C A;  3EYP A;  4EQV A;  3SH4 A;  4X8P A;  2QQO A;  3CBN A;  5IFT A;  1W2U A;  1ZZB A;  3LGR A;  3LFI A;  4LE3 A;  4JTN A;  1YXW A;  3OYW B;  4G9S B;  4MGI E;  1NQJ A;  2VUJ A;  2FCU A;  2WO7 A;  3F95 A;  1QHD A;  4YM2 A;  5L73 A;  2IWG B;  4XJA A;  1JN2 P;  2A75 A;  2ZEY A;  1OA4 A;  2VOW A;  2VVF A;  2XPJ A;  1UYY A;  1W8W A;  1RGS A;  5FZE A;  2EXH A;  4Q5O A;  4TSV A;  4RN5 A;  1AJK A;  2R49 A;  3DF0 A;  4EZH A;  2ZZQ A;  5FPX A;  4MHR A;  3L2H A;  2HEY F;  2PHR A;  4AFD A;  2YC0 A;  5FPU A;  4BMB A;  3IT8 A;  1S0G A;  4IL7 A;  1IS3 A;  1HRI 2;  1W8Z A;  1WLT A;  2B42 B;  4YPJ A;  3SEE A;  1CZS A;  3VZK A;  1W3V A;  4JC1 A;  4CCN A;  2HWF 2;  3W20 A;  4DIQ A;  2YB7 A;  2GND A;  1MQT B;  1DYO A;  2VEC A;  2PHD A;  3VHR A;  1A3K A;  1AX0 A;  4B3N A;  1XYP A;  4EN6 B;  3MIB A;  3RGB A;  2RS5 2;  1JYC A;  3BIE A;  1S0E A;  4O65 A;  4R52 A;  4IE5 A;  1W9W A;  4TLG A;  1DDL A;  4JGY A;  3RZL A;  5IAV A;  3LIH A;  3WX5 A;  5JOY A;  1RMU 3;  4RHV 1;  4OUM A;  4AEM A;  3JCI A;  4JX0 A;  4KGG A;  5K0U C;  3S0M A;  3AMP A;  1YQC A;  3VBO C;  2R07 3;  2B7Y A;  4NWW A;  1S0I A;  5A33 A;  4MGY E;  1PVX A;  3SCF A;  2XLA A;  1ZBE 1;  2ADE A;  1L7R A;  3EB7 A;  2WS9 1;  4YFW A;  1HN0 A;  4ATE A;  4AVB A;  5FP7 A;  2HEV F;  1LEM A;  1CGP A;  4NRQ A;  2HWD 2;  2OS2 A;  3FBY A;  1YJK A;  1XC6 A;  1RUN A;  1Y3T A;  1W6M A;  4QKF A;  1DLC A;  3B3Q E;  3AYC A;  4IE4 A;  4OMD A;  3CQO A;  4RR3 C;  4NWV A;  3LCP A;  4HAN A;  1UD1 A;  4J25 A;  4DFS A;  3O1U A;  1LED A;  2WFP A;  4FSJ A;  5LA1 A;  2ZX1 A;  1J1T A;  2X09 A;  4UFM A;  1QMJ A;  1ENS A;  2YG0 A;  4LKE A;  4NHM A;  4E8D A;  1SLC A;  5A3U A;  2BUK A;  2G4I A;  1QJF A;  1XE7 A;  4JKK A;  2J1A A;  1IG0 A;  2A3W A;  3OGV A;  5EQU A;  1CAW A;  2YV8 A;  3WF3 A;  2QCS B;  4D69 A;  2PTM A;  4RSU A;  3JBG 3;  5B4N A;  5FQ0 A;  2RR1 3;  2UY9 A;  4RD7 A;  3VDD B;  1OA2 A;  3VKN A;  2BPA 2;  4L99 A;  4NRM A;  5A6X A;  1LOF C;  3D82 A;  1EPW A;  3LAG A;  3QH7 A;  5J09 A;  3MIH A;  4ZZ8 A;  2VPV A;  1BLZ A;  5M0T A;  1A78 A;  1O4Y A;  2C1F A;  3RZZ A;  2EVX A;  2WC2 A;  1H8V A;  1RVF 1;  2AAC A;  3T0A A;  1ZBE 2;  2XON A;  5FZ7 A;  3PUH A;  1SFN A;  4PF1 A;  2YU2 A;  3ZPY A;  2X8K A;  3HD8 B;  4FO9 A;  5CKQ A;  4LLF A;  3ZPO A;  1V6J A;  4ZON A;  4COZ A;  1ZBE 3;  1EV1 2;  1UPI A;  1YCI A;  3FHI B;  3AK0 A;  3LFM A;  4QKN A;  1XNK A;  3I8T A;  3TWI A;  1Q8Q A;  5ANN A;  1AR9 3;  1RMU 2;  1C8M 3;  1SHW B;  3J7H A;  1B35 A;  4CP2 A;  1LKN A;  1DQ1 A;  1ZBA 3;  3GDB A;  5JZG B;  4GJZ A;  5JPN B;  5FY5 A;  2NZ9 A;  2ZGO A;  3R6S A;  5C70 A;  2DCY A;  4Q4X 1;  4ZY9 A;  1RUI 3;  1H2L A;  1X9P A;  5FZB A;  3ZYF A;  4XQ4 A;  4LK7 A;  4AI3 A;  2ZML A;  4L92 A;  2XUM A;  4FT8 A;  3FJS A;  3FX3 A;  5LB6 A;  2JDY A;  4LEJ A;  1ZZ8 A;  4JAA A;  4ES9 A;  1R09 3;  5DMY A;  3ZXF A;  2YYO A;  2XUE A;  2XML A;  3MPP G;  4IGP A;  1UPS A;  3DV8 A;  4CCO A;  2JEN A;  2JJ6 A;  1NCR B;  1SLA A;  4QDR A;  1T2X A;  3AX4 A;  4IEU A;  3WZ1 A;  5I0T A;  1XOY A;  3ZFE C;  4QQ2 A;  5F32 A;  4TLF A;  3N9N A;  3KGL A;  3B94 A;  1BXH A;  2B9U A;  1EV1 1;  5FZ0 A;  1H8T B;  1R09 2;  2TBV A;  4YVW B;  2YMZ A;  4Y20 A;  1T6G C;  3O0W A;  3UES A;  1KGY A;  1RIR A;  1EPZ A;  2I07 B;  4FP2 A;  2VCM A;  1YQ5 A;  3MLK A;  4D7T A;  4Z1V A;  2ZAA A;  2C6S A;  2XWJ B;  1O8S A;  4W8J A;  2WO2 A;  4JGY C;  3UJO A;  1CAV A;  1OI6 A;  4YAR A;  2XDV A;  1O4Z A;  4BE3 A;  2GP5 A;  1J1L A;  4QHB A;  2JXA A;  3W59 A;  3VBR A;  3AKS A;  1CWP A;  1IQA A;  2WZ8 A;  5FO7 B;  5DZF A;  3ACH A;  1ULP A;  3OTF A;  1AL2 3;  2QFE A;  4P9W A;  4LJH A;  3QBQ A;  3ZXL A;  1AR9 1;  5FZG A;  2LRP A;  3VHP A;  1JYN A;  2MEV 2;  2ET1 A;  4E2S A;  1ZZ6 A;  2O0O A;  5FY1 A;  2EA7 A;  2Y64 A;  2HWC 3;  2QBX A;  2OZJ A;  4RQP A;  4Q4Y 1;  4IV3 A;  5FYV A;  4XZU G;  4D3W A;  4YFZ A;  2ADD A;  5JR7 B;  3ELN A;  5EYX A;  1UY2 A;  2CAU A;  3P3N A;  2XJT A;  4DRV A;  4JKL A;  1W3X A;  3FHA A;  3H42 B;  4M0H A;  3KGZ A;  1H6X A;  4YZ4 A;  4AF9 A;  2WO1 A;  1RUG 3;  4YW5 A;  5T55 A;  4DXR A;  2W91 A;  3I54 A;  5IK7 A;  2P2K A;  5KBF A;  4QDQ A;  2P3J A;  3O1M A;  3DL3 A;  3K3N A;  2ORZ A;  5EFU A;  4IER A;  3AMM A;  2QQP A;  2HWB 1;  1HB4 A;  3B01 A;  4Y5T A;  4PLM A;  1GNH A;  5F5C A;  1DQ6 A;  3M1H A;  3SNM A;  2ZGQ A;  2HEW F;  3KV9 A;  4DQA A;  3I2K A;  1UX7 A;  3HT2 A;  3FLT A;  4H2A A;  1WA4 A;  3HJR A;  4O7X A;  3VBU C;  1ZM1 A;  3RQ0 A;  4ZXE A;  2VOT A;  1XJA A;  1AR6 3;  2HLE A;  2KD7 A;  3PU8 A;  3IMN A;  2HWD 3;  4QB6 A;  4YGB A;  1PIV 2;  1LJ7 A;  5F5Q A;  3VBH B;  2PXJ A;  5F3I A;  3RSJ A;  2JD9 A;  4UOJ A;  5IAX A;  1PO1 2;  3V65 A;  1IS4 A;  3O1S A;  1DQ0 A;  1COV 2;  4AFB A;  1LHN A;  1WD4 A;  2EAL A;  1K5M A;  4Q8K A;  2ORX A;  2ZGP A;  3JQW A;  3KMH A;  3J8F 3;  1IPJ A;  1F4H A;  3WUD A;  3ZM8 A;  1P8J A;  2VTX A;  3PNA A;  3CHX A;  3WP3 A;  3WNL A;  1C28 A;  2XKO A;  2VMI A;  2J7M A;  3A0K A;  3BOW A;  3NV3 A;  4LBJ A;  5LAS A;  3TAY A;  1ASJ 1;  3U78 A;  2JG8 B;  4ZU7 A;  3WHU A;  4AHZ A;  1C3H A;  1BMV 1;  1Z7S 2;  1I5P A;  2Y60 A;  2RV9 A;  3ZSE A;  2DF7 A;  1HIX A;  1W8U A;  2WFF 1;  4QPY A;  1NUK A;  1ST8 A;  4Q0S A;  1RUG 2;  1W6Q A;  2K0G A;  4WM8 A;  3N7J A;  1O7F A;  4Y22 A;  2A3Y A;  2W1W A;  5A7P A;  2ZKN A;  1QF3 A;  2CDP A;  3AYE A;  5TSW A;  3RPQ A;  2QQM A;  1H30 A;  4ONU A;  2OXB A;  1QU0 A;  1LOE A;  4OMC A;  3AB0 A;  5FRE A;  3PDQ A;  1JHJ A;  5CFD C;  4XIO A;  3ZIW A;  2YHJ A;  1PVC 3;  1ZNP A;  1UY4 A;  2BGP A;  5D1I A;  1QY4 A;  3N7K A;  4XOG A;  4PDW A;  3MO4 A;  4LKS A;  5F8P A;  1V70 A;  2JDH A;  2JG9 A;  2P3I A;  3DEM A;  3NST A;  2Q8E A;  5FWJ A;  4N43 C;  1QJX 3;  2RVA A;  4MXW B;  2R1D A;  2YPD A;  4NHX A;  4QX1 A;  1CJP A;  4N43 B;  5BY5 A;  5F7U A;  1R1Z A;  2VZT A;  2D5H A;  3B9I A;  4K7J A;  2UUR A;  2OPK A;  2KA3 A;  4AGG A;  4A4A A;  3PLQ A;  1MAC A;  1X7N A;  4RQP B;  3MDP A;  2OQ6 A;  2B8M A;  4DPN A;  2XQX A;  4ZS2 A;  4GZ9 A;  4RYD A;  5FXV A;  1STM A;  3WCS A;  4DOU A;  1AYM 2;  3ILN A;  2FMY A;  4HET A;  4LA3 A;  1PM7 A;  1G6N A;  1RUE 1;  1QH6 A;  5IK5 A;  3O1T A;  4GJY A;  5C4W B;  5A32 A;  2HWE 2;  1WW5 A;  3UET A;  1VBD 2;  4M01 A;  1NAE A;  2W94 A;  3T1M A;  1ZX5 A;  2P34 A;  1DZR A;  3PVB B;  1B35 C;  1KQR A;  2NMO A;  2QKD A;  3D4K A;  1YI9 A;  4AQT A;  5FZM A;  5LRR A;  4EJR A;  4RGK A;  1J3Q A;  1CPN A;  4W6W A;  2UWB A;  2Y0I A;  2ZAB A;  5FIX A;  1UMH A;  2GMM A;  5FZH A;  1LOA A;  1R1A 2;  1FOD 2;  2G9F A;  3GF6 A;  3M3O A;  3NO8 A;  4CE8 A;  3H9A A;  2QDR A;  1UU5 A;  2BJS A;  2VUL A;  1W05 A;  4AGR A;  3BAL A;  4NE9 A;  4UW5 A;  1AYN 1;  1HKD A;  3E6D A;  1RUF 3;  2NQY A;  3BN6 A;  4XMI A;  2LW8 A;  4Q4Y 2;  1WMD A;  3MEP A;  5LK7 B;  4BU2 A;  4KWJ A;  5E16 A;  1Q5O A;  3C7H A;  1BEV 2;  3ITQ A;  2L9L A;  1VAL A;  1LAJ A;  1DP0 A;  1W8H A;  3VDA A;  3T0D A;  1I6X A;  5SV5 A;  3WF2 A;  2W68 A;  4RS5 B;  2WR9 A;  1OLQ A;  3VKF C;  3VKM A;  1OSG A;  3WF0 A;  3ZFF C;  1WW4 A;  1JU3 A;  1F8V A;  1W6P B;  5DQ0 A;  2BFU L;  3HT1 A;  5DUU A;  4BH9 A;  2ET7 A;  2PQS A;  2VG9 A;  1GKB A;  1VBA 2;  2J1T A;  4CUC A;  1LOC A;  1Z78 A;  4WVM A;  2ARA A;  2Y6G A;  4OCT A;  5FY8 A;  4XF4 A;  1HQW A;  3J7M A;  3IMM A;  3F2Z A;  1JS9 A;  4O9G A;  3CJI A;  3C7O A;  1IS5 A;  2NYY A;  4AR2 A;  3MIF A;  4Y22 B;  1WME A;  1U0A A;  1DGR A;  1QJU 2;  2QUO A;  4XVH A;  1NG0 A;  1O3S A;  2HWE 3;  1F31 A;  2Y26 A;  3RYP A;  4Q4W 1;  2W1S A;  3BTZ A;  4RS5 A;  5I91 A;  3KF3 A;  4H55 A;  3RG0 A;  4OQ9 A;  3T08 A;  1KFX L;  1QEX A;  4LBQ D;  4QX7 A;  2XHN A;  4L97 A;  4NIH A;  4AQ6 A;  2J1S A;  1GZW A;  4IEV A;  3NQH A;  1QWR A;  2ZX0 A;  5F37 A;  4H3W A;  5CKM A;  3WNX A;  2HYX A;  4QWN A;  2JG9 C;  4D8M A;  3DXU A;  3RI9 A;  4XAA A;  3K48 A;  5H9P A;  2WNE A;  4TN7 A;  5DUV A;  1IQD C;  5A6Z A;  3ME2 A;  2BZD A;  4L2N A;  1YIP A;  2Z69 A;  1TQ5 A;  1UYP A;  5LWB A;  2A1X A;  3A22 A;  4CDX A;  1AR7 2;  5FR3 A;  2VOV A;  5C5T A;  1C5I A;  5FXW A;  3VZJ A;  3W9A A;  5LW9 A;  3K77 A;  3TRS B;  4QU1 A;  4JRA A;  1YFY A;  5JAX A;  4QU2 A;  1JZ8 A;  2WQ4 A;  4QXB A;  4K1Z A;  3J7L A;  1GSL A;  1JI6 A;  2YPJ A;  4GMP 0;  4C8D A;  4IES A;  1W04 A;  3UYJ A;  4CXX A;  4OI0 A;  1HRI 1;  1REF A;  2VXR A;  1XU2 A;  4FAG A;  4FOQ A;  4P00 B;  1LEC A;  3AP7 A;  3USU B;  4B7E A;  1MS8 A;  2BBA A;  2P37 A;  4BQ5 A;  2WAA A;  4DRR A;  2JDU A;  2PLV 2;  5C5U A;  3O0V A;  5K0U A;  2A6Z A;  1HB2 A;  2ZX2 A;  4H7L A;  5E89 A;  1OUX A;  5G04 L;  3AFK A;  5JVV A;  1X82 A;  3BGA A;  4XFF A;  1IPK A;  5LEK A;  3I3E A;  3KLS A;  2AEN A;  4YRD A;  5DUW A;  3GJA A;  2ARX A;  2NMN A;  1AXZ A;  2VZP A;  1ZRE A;  1O91 A;  4QMA A;  1OVP A;  1DGL A;  4EN7 B;  2A5Z A;  2JKB A;  2RS1 1;  1H1A A;  5C4W C;  4LBO A;  1SCS A;  5A3N A;  3ALQ A;  1PMJ X;  3ROU A;  3AZZ A;  4AVC A;  5A1F A;  2NP0 A;  4CDW B;  1VJ2 A;  2QQU A;  2P6H A;  3R0R A;  4IND A;  2CNA A;  2MEV 3;  3CJX A;  1Y9G A;  3AM2 A;  3AMH A;  3ATG A;  3N9M A;  1S0F A;  2WZE A;  3KVB A;  4XMA A;  5FV3 A;  3RMY A;  2JE9 A;  4Z2W A;  4HK8 A;  5JIU A;  4XZP A;  1FAY A;  1QQP 2;  1FNY A;  4GUL A;  5FZ8 A;  3FLR A;  1VRB A;  4Y1U A;  1US2 A;  4RQP C;  4X6Q B;  4IV1 C;  3WT3 A;  5FO8 B;  2JKX A;  2QQK A;  3I7D A;  1JZ2 A;  1UOF A;  2WT0 A;  2WKK A;  5FO9 B;  3AXD A;  2C5D A;  2RM2 2;  1R08 3;  4ISQ A;  4QHZ A;  3THC A;  4NVP A;  4LBL A;  5FOB B;  4ZXK A;  1SBF A;  1HB1 A;  1UOG A;  2AYH A;  4IEQ A;  3K2O A;  4QQL A;  4AVS A;  3MPB A;  1QDC A;  3FBM A;  1EY2 A;  4X8N A;  5F3C A;  4JDM A;  2X05 A;  4YNI A;  3OGR A;  3MF9 A;  2W47 A;  4ASL A;  1QJU 1;  3OPW A;  5A7N A;  1PO1 3;  1AXK A;  3IAQ A;  4KU8 A;  3NKT A;  5BNP A;  5J48 A;  4QX8 A;  4ZPI A;  2RM2 3;  5C3Q A;  4Q4W 2;  1LOB A;  1AZD A;  1POQ A;  3I59 A;  3FWE A;  3MBW A;  4IE0 A;  1V9U 3;  1YLL A;  4JVA A;  1PIV 3;  4NPR A;  3O1V A;  1G86 A;  3ZXD A;  3ZSL A;  3MF6 A;  2ZHL A;  3S7E A;  5ABJ A;  1AX1 A;  2ES3 A;  1D0H A;  1IG3 A;  2R0F A;  2XJV A;  1MEC 1;  4YVW A;  2PMW B;  4GD4 A;  4IEX A;  4ORF A;  2W46 A;  3O12 A;  1F9K A;  2VY0 A;  3MYX A;  2CAV A;  1BK0 A;  4YZ2 A;  1OF3 A;  1UN1 A;  2JG8 C;  2V4V A;  3MIG A;  4P9I A;  3NVC A;  3PHM A;  3D8C A;  3VZN A;  2Y8K A;  1NCQ C;  2PHL A;  5FMC A;  1O3Q A;  1GR3 A;  5ANQ A;  3D0S A;  1OD3 A;  5CFC C;  3H3Z A;  5GKA C;  1OH3 A;  1RUE 3;  2DUO A;  2XJR A;  2HKX A;  1EV1 3;  5EJ1 B;  3VN4 A;  1O8P A;  2E32 A;  3T2Q A;  1AYN 2;  4AEJ A;  4YW4 A;  3K46 A;  3NWK A;  3GBG A;  4CP9 B;  1VAV A;  4FPY A;  4LMF A;  2LUW A;  4XF0 A;  2Q1Z B;  5DAV A;  1CAU B;  5FZD A;  4K8F A;  3I3M A;  2ZMN A;  2IUW A;  4BA6 A;  3HAG A;  3NAP C;  1ND3 C;  3C2U A;  4FFH A;  5GM0 A;  3SCG A;  4CPB A;  5J98 B;  5LEJ A;  5HBA A;  1PNF A;  3CDZ B;  2V5Y A;  2RMU 2;  3LD8 A;  2DTY A;  3O5S A;  3EJK A;  3DYP A;  1RIN A;  4FI9 A;  3VD4 A;  5JOX A;  4W50 A;  1KJR A;  3PTR B;  4N53 B;  2Q8C A;  2F6B A;  4ET7 A;  1QOO A;  2J1E A;  2MHF A;  4P9J A;  4K40 A;  3JD7 3;  1QJX 2;  2RJK A;  4DUV A;  3OBZ A;  2E7A A;  2R06 2;  1QJY 3;  1C8M 2;  2R6Q A;  2X5I B;  4N43 A;  4CU9 A;  4E8C A;  2VMH A;  4QGL A;  3HBZ A;  4RHV 2;  4Y5S A;  1JYV A;  3EO6 A;  2FZ2 A;  1LR5 A;  2GZW A;  3PMS A;  3U10 A;  2XG3 A;  3KM5 A;  5FYT A;  3AKP A;  4DIN B;  4LA2 A;  1PK6 C;  4QAW A;  5KC5 A;  1AJO A;  2VMC A;  3BTX A;  4LBQ A;  1BBT 2;  3J9S A;  3USS A;  3TEX A;  3ENR A;  2ARB A;  4XXA A;  3VD5 A;  1XNC A;  4CEY C;  2B5H A;  3H0O A;  3VBO B;  4AI2 A;  5I0R A;  3FL7 A;  1DLL A;  2R32 A;  5C3R A;  1R64 A;  4TXW A;  2DVF A;  2JEM A;  1SMV A;  2WDB A;  2EXJ A;  4BLI A;  4UFI A;  1N47 A;  3OUI A;  5K7P A;  5FZO B;  5CVR A;  1US3 A;  5CG9 A;  2X5I A;  1CPM A;  2W0X A;  3UGH A;  3OBT A;  4GWI A;  4OI4 A;  4OUL A;  4AEK A;  4E2Q A;  1YHF A;  5CG8 A;  5J37 A;  4MAD A;  1OLM A;  1CZV A;  2VBB A;  3N9O A;  4RHV 3;  4AVV A;  4YZ5 A;  4ARX A;  4XJW A;  1VBA 3;  3AC0 A;  1N1T A;  2XJP A;  2VZQ A;  2TEP A;  3MUZ 1;  5CU1 A;  5KXE A;  4JV4 A;  4DS0 A;  2ZBJ A;  2D6M A;  3KD4 A;  4HKO A;  4SLI A;  3SKJ E;  1RUG 1;  4YGE A;  1AXY A;  4YVW C;  2E33 A;  3ZDS A;  2D6P A;  4F3J A;  1MS1 A;  4EZ4 A;  2B39 A;  4F83 A;  2GC3 A;  1X50 A;  2A70 A;  1IKP A;  5DAP A;  2WWS A;  4HZF A;  4Y4R A;  4YM0 A;  2BOI A;  4QB1 A;  4C90 A;  4BIO A;  2FDG A;  3LB9 A;  4GH4 A;  2IXK A;  1CD3 G;  3GBF A;  3IWZ A;  5T50 A;  3U4X A;  3H7Y A;  3HQU A;  1B35 B;  3THD A;  3TEW A;  1SLI A;  1RC6 A;  1W8F A;  5B2G B;  4WM8 B;  1E57 A;  1HDK A;  4QPI A;  2WAB A;  4BM8 A;  1LHU A;  2K2S A;  2IXC A;  3HVD A;  3D3A A;  4N90 A;  4XAE A;  2Q1F A;  3DKW A;  5FPL A;  5EIY B;  1SLB A;  1UZV A;  2XHK A;  2YUE A;  4UWD A;  3SCH A;  3UKN A;  3B00 A;  3OF1 A;  4P9Y A;  2VZ3 A;  2R0H A;  3Q8E A;  5KHG A;  3SIS A;  1JBC A;  3MI8 A;  1UZW A;  1LES A;  4XFG A;  2CGO A;  2VNR A;  3N36 A;  5AC9 3;  1OA3 A;  2WN3 A;  2BV4 A;  1W39 A;  1XB9 A;  3KSC A;  3K4Z A;  1SBE A;  4R9D A;  5H9Q A;  5LRS A;  4LR4 A;  5DPN A;  2IFW A;  4AI0 A;  2KR2 A;  1EP0 A;  4FPG A;  1H4G A;  2D6K A;  4Q4V 2;  1HRI 3;  4URT A;  1UZ0 A;  4I01 A;  4AYU A;  3OCP A;  1D0G A;  1V6K A;  2VOK A;  2NLR A;  4Q1P A;  5IWF A;  3A23 A;  4GQ7 A;  2VGD A;  4YW3 A;  4IV1 B;  3I2J A;  3W58 A;  4ZZ5 A;  4YW1 A;  4D7S A;  1BK1 A;  1PGL 1;  3ZDV A;  1ZRD A;  2WZP P;  3J8F 2;  4GH4 C;  4FPH A;  1TMF 2;  1S0C A;  4Q4X 3;  2WS9 2;  3M2M A;  4QQP A;  3UKT A;  4CUA A;  5LA0 A;  1XPW A;  1BMV 2;  1VR3 A;  2NPI A;  2DCZ A;  1Q56 A;  3WF1 A;  2C9A A;  3OPT A;  1QXP A;  1AF9 A;  2YZ4 A;  4YVS B;  3QOP A;  3INA A;  3I3D A;  3HNB M;  2WRA A;  1K12 A;  2WWJ A;  4MXV A;  4E27 A;  3SLI A;  5LZ6 A;  1YFX A;  4KG8 A;  3ZYJ B;  5JSR A;  3BU0 A;  1M06 G;  3ZFG C;  2VME A;  1PO1 1;  2E26 A;  2WNU B;  3FUQ A;  4YWA A;  2BFU S;  2DTW A;  3KV4 A;  5IUQ A;  3SQO A;  3SEP A;  5KWR A;  3KF5 A;  1O3R A;  2A7A A;  3ES4 A;  3Q8C A;  1NX9 A;  1S2K A;  3HPN A;  3PUR A;  4PCR A;  4IW3 A;  5GLU A;  3W5N A;  1GU3 A;  2GN7 A;  1RUI 2;  3I2H A;  4IDZ A;  1MQT A;  1ZVF A;  3C7G A;  5EWS A;  5LA9 A;  5KC6 A;  3SIT A;  5IFP A;  3VHN A;  1WKY A;  1R08 1;  4UFK A;  1ULE A;  1URX A;  4MXW A;  1DFQ A;  4R9B A;  3S5Q A;  1C8N A;  1WZX A;  2YGM A;  4WVZ A;  4OHX A;  5A6Q A;  1YO8 A;  2UY8 A;  2W92 A;  4CXY A;  3O1R A;  2DU1 A;  4JDN A;  2WLQ A;  2VVE A;  1W6P A;  4RS5 C;  4BYY A;  1PMH X;  1FPN 3;  2H0V A;  4IQP A;  5JR2 A;  4IV1 A;  1JOP A;  3THP A;  1W9Y A;  2RJL A;  2WZR 2;  3JB8 A;  3WR0 A;  4JQR A;  1PX3 A;  1XRU A;  5C9A B;  4GWN A;  2CL2 A;  2D7F A;  5BPX A;  4TZD A;  1QNW A;  4I2O A;  2QNK A;  5FQ0 B;  4KWK A;  2R07 2;  3UKV A;  4L8Q A;  2WS9 3;  3III A;  5HCF A;  1RUD 3;  3R4D B;  1LB2 A;  1LOF A;  2Q30 A;  1N1V A;  2VR4 A;  5DG2 A;  1G9F A;  3GAL A;  3J7N A;  4QQO A;  1HV0 A;  2ZJC A;  3A7Q A;  3LA3 A;  5C4W A;  3UK9 A;  3ECQ A;  4FPK A;  4KI5 M;  3KT4 A;  4LIU A;  4UW3 A;  1RUC 2;  1VMF A;  5FYU A;  3U75 A;  3WLU A;  1UXZ A;  2YRO A;  3ES1 A;  3PUS A;  4XQW A;  4EYU A;  1RHI 3;  2W2I A;  4ARY A;  1VBE 3;  5JZG C;  2HBT A;  4QX0 A;  3BUC A;  5FCC A;  1MZE A;  2YFZ A;  5F6K A;  1CX1 A;  3UGF A;  4UFH A;  5C8C B;  3D6E A;  5HPO A;  5D8A A;  3V64 A;  3TN9 1;  4JHZ A;  1SPP A;  1W90 A;  3IDE A;  3VZL A;  3O1O A;  4D7Y A;  5FZC A;  3OPZ A;  4A41 A;  4DO0 A;  4QGM A;  1PGS A;  1VBC 1;  5C8C C;  2O8Q A;  3KQ4 B;  1GOF A;  1RUE 2;  3E5U A;  3R4S A;  2H0B A;  3OBR A;  2PFW A;  5T5L A;  2J1U A;  2GU9 A;  5BNQ A;  3VBO A;  3BPS A;  4OZO A;  2A6Y A;  3ZFG B;  1Q43 A;  2WNV B;  3ST7 A;  5E1R A;  2VW0 A;  1RJ7 A;  2R04 1;  3GGL A;  2V5D A;  3JUU A;  5GZC A;  3VBF A;  1ZRI A;  4S2D A;  2GC2 A;  3RI8 A;  1KS4 A;  2RS5 1;  3H1W A;  4RA0 A;  3WUC A;  3ZKU A;  4FFF A;  2R06 3;  4FPF A;  3KHB A;  4CP9 A;  1S4C A;  2WT2 A;  2RS1 3;  2NN8 A;  1SDW A;  1ND3 B;  5FJH A;  1FAT A;  2W3J A;  3CO2 A;  3J8F 1;  4YLZ A;  2HWF 3;  1NY7 1;  5J96 B;  1VBB 3;  1SPP B;  2VMD A;  3M7A A;  2AC1 A;  3N7L A;  4CZS A;  1OLM E;  3AMQ A;  5CAZ A;  4A2U A;  2VQ0 A;  2RE9 A;  1OOP C;  3OG2 A;  5DDJ 2;  3N9Q A;  2XVG A;  3V0A A;  3TBD A;  4M3C F;  4AQS A;  5KHJ A;  1ULD A;  4CEY A;  1N3P A;  3PVE A;  3VBS A;  3NRU A;  1VBE 2;  4XF1 A;  3CEW A;  3I2G A;  1ULF A;  1CAV B;  3NV4 A;  4IEO A;  5JOW A;  3VHO A;  4XBL A;  4B7K A;  3AXE A;  5J7M A;  1NA1 C;  4BK4 A;  1POV 3;  2J22 A;  3ABZ A;  3ILF A;  2R30 A;  3OD4 A;  4IE6 A;  2V73 A;  1GP5 A;  4C0B A;  2W87 A;  1PGL 2;  2CHH A;  5FZF A;  3LSE A;  4YGD A;  1UF2 C;  1UU6 A;  3IM0 A;  3AJY A;  5FP4 A;  4GMP 1;  1JZ6 A;  3H3U A;  2A6V A;  2DFB A;  3LEK A;  3N9P A;  1EAH 1;  1BBT 1;  1PX4 A;  5DAB A;  1XNB A;  5FRA A;  2JDM A;  3D5O A;  1NQD A;  4HN0 A;  5FP3 A;  2VZO A;  3E1F 1;  2WQZ C;  2IVI B;  3AJZ A;  3PIJ A;  4LBQ B;  5CBL A;  3VZO A;  3RYK A;  4BXF A;  3LSD A;  3HOB A;  2WN2 A;  5CB7 A;  4Q1R A;  3JU9 A;  2E7T A;  3QAC A;  3PVO A;  4FOV A;  1WBF A;  3ZFE B;  5ABJ B;  4OI2 A;  5C7G A;  2E63 A;  4A7K A;  4BME A;  3VDB A;  1UQX A;  1H8T C;  5EHD A;  2E7Q A;  3RZH A;  1L7L A;  1H2N A;  5A7S A;  5GLV A;  3IKW A;  3GXU A;  2W9X A;  1RUC 1;  4EN8 B;  4BHP A;  1DGW A;  2OW4 A;  4LKD A;  1ENR A;  3AMN A;  4NUB A;  2UWC A;  2YU1 A;  3GNE A;  4UFL A;  4LIV A;  5F3E A;  2XJU A;  3AVS A;  5A6Y A;  1UZZ A;  3NMB A;  1SEF A;  3AVR A;  4ZU4 A;  4LHL A;  2WBK A;  1RUJ 3;  5IVC A;  3WP5 A;  5C8C A;  3MIC A;  1CES A;  2VW1 A;  4NIG A;  2BP6 A;  1I5Z A;  3ZYB A;  1HRV 3;  4HBN A;  4YM3 A;  1SLT A;  2QZ3 A;  1PNG A;  5D8A C;  4CCJ A;  4OZX A;  3A4U A;  4GWM A;  3VBU A;  1LCL A;  2VZV A;  3MUY 1;  4M3C E;  2ARC A;  1YRZ A;  3E6B A;  3IBM A;  4AFM A;  1IHM A;  1AYN 3;  1R09 1;  2BNM A;  3AP5 A;  3MFA A;  5A3M A;  3ACL A;  2YBS A;  4MLO A;  2FMD A;  2X10 A;  4IUG A;  4AFC A;  4F7Z A;  4LIT A;  1W8O A;  1K5M B;  1IPS A;  3ETP A;  5I8Y A;  4EE2 A;  2WNU A;  1CZT A;  4Y20 B;  1GQP A;  2QQJ A;  3VBR B;  1F15 A;  4I30 A;  1RED A;  1VLN A;  2GH2 A;  2UWA A;  3LF7 A;  3H3L A;  5FZ4 A;  3CKH A;  3I49 A;  1S0J A;  2W5F A;  1C5H A;  1GYK A;  3IDB B;  3WP4 A;  1NE4 A;  5J1X A;  5BUV A;  3EBR A;  1CAW B;  3LE0 A;  4P9X A;  3DPR C;  4PDW C;  5FXX A;  4XFC A;  5A3W A;  5T5P A;  5C3P A;  3S57 A;  5B4X A;  4UI9 L;  4MV2 A;  5FYH A;  5FUP A;  4IGO A;  2TNF A;  5FY4 A;  4AI1 A;  2X29 A;  4PIX A;  3ZSM A;  4CCK A;  4HFS A;  4QHO A;  1H9W A;  3E5X A;  3OY8 A;  4QD2 A;  2CU5 A;  4XJ8 A;  1H1M A;  4NOT A;  5FZL A;  1WW6 A;  3ETQ A;  1GP6 A;  2V09 A;  4XF9 A;  4OFG A;  2PHW A;  4YZ3 A;  3JBG 1;  3KCC A;  3WVJ A;  4YSF A;  2YC4 A;  5IAT A;  5DAX A;  3RJR A;  2GH8 A;  1DZQ A;  4NIA A;  2YBK A;  3CIH A;  3ZN6 A;  4BPZ A;  3GYD A;  3IDC B;  2SLI A;  4UF0 A;  1XSQ A;  3APB A;  3AP9 A;  4ISR A;  3SH5 A;  2ZHK A;  4XQD A;  4WVM B;  2FDJ A;  4QXK A;  4C1W A;  4U2A A;  2RDN A;  2AUY A;  3LEG A;  1XND A;  1H2M A;  3RJ2 X;  4B29 A;  1K5M C;  2BEO A;  1UZY A;  1DGR N; 
#chains in the Genus database with same CATH homology
 5HV0 A;  4J25 A;  3NNL A;  5LA9 A;  3KT1 A;  2V4A A;  4NHK A;  3OUI A;  4NHM A;  2Y34 A;  5LBF A;  5A3U A;  4XCB A;  4XCA A;  4Y5T A;  5LBC A;  3MGU A;  5DAQ A;  4JZR A;  5EQU A;  3DKQ A;  4XAC A;  4KBZ A;  3EMR A;  4MHU A;  2RDR A;  3ITQ A;  4NHL A;  5M0T A;  2Y33 A;  3NNF A;  5IAX A;  4BQX A;  5LBE A;  4ZON A;  4ZPI A;  5LBB A;  5DAP A;  3GZE A;  4XAB A;  3OUH A;  4BQW A;  4NHY A;  5LAS A;  3HQU A;  2HBU A;  3KT4 A;  2G1M A;  5HV4 A;  2HBT A;  2JIG A;  4UWD A;  2RG4 A;  3OUJ A;  5LB6 A;  5L9V A;  2RDS A;  2FCT A;  2FCU A;  3KT7 A;  4XAA A;  2G19 A;  5DAW A;  5DAV A;  5EPA A;  5L9B A;  4Q5O A;  3W21 A;  2A1X A;  2OPW A;  5ERL A;  4MHR A;  2JIJ A;  5C5T A;  3NNJ A;  3GJB A;  3PL0 A;  5LAT A;  3HQR A;  5L9R A;  4NHX A;  4XC9 A;  3NNM A;  3W20 A;  3OBZ A;  3BVC A;  4BQY A;  5C5U A;  4Y5S A;  4NMI A;  5IAV A;  5IAT A;  5DAX A;  3GJA A;  2RDQ A;  2RDN A;  4NAO A;  5EP9 A;  4IW3 A;  2FCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...