5IAXA

Mechanistic and structural analysis of substrate recognition and cofactor binding by an unusual bacterial prolyl hydroxylase - co-bap4h-ppg
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
199
Chain Sequence
EQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVDVNDIAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYKPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Procollagen-Proline Dioxygenase
publication title Bacillus anthracis Prolyl 4-Hydroxylase Modifies Collagen-like Substrates in Asymmetric Patterns.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 58
structure length 199
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5iaxA01
5M0TA 4JZRA 2G1MA 3OUHA 4NAOA 3GZEA 2FCTA 2FCVA 5HV0A 5EP9A 5EQUA 2FCUA 3MGUA 5ERLA 2RDRA 3OUIA 2Y33A 5IAVA 3NNLA 4XC9A 4ZONA 5C5TA 3W20A 5LBFA 3PL0A 5HV4A 2Y34A 3KT4A 3ITQA 5LBBA 4UWDA 5EPAA 3OBZA 3KT7A 5DAWA 5LA9A 4ZPIA 5LATA 2RDNA 4BQYA 4NHKA 4XACA 5LBEA 4NHLA 5DAXA 3BVCA 5LB6A 5LBCA 2JIGA 2HBTA 2RDSA 4IW3A 4NHMA 4BQWA 3NNJA 4MHUA 2OPWA 2V4AA 5C5UA 3GJAA 4MHRA 4Y5TA 5L9RA 5A3UA 5LASA 4Y5SA 2RG4A 2RDQA 4KBZA 5DAQA 3HQRA 4BQXA 4NMIA 3W21A 3NNFA 2JIJA 3DKQA 4J25A 5IATA 3HQUA 4NHXA 4XABA 5L9VA 3NNMA 5IAXA 4XCBA 2G19A 2A1XA 3GJBA 5L9BA 5DAVA 4Q5OA 3OUJA 3KT1A 4XCAA 4XAAA 3EMRA 2HBUA 4NHYA 5DAPA
chains in the Genus database with same CATH superfamily
4JRAA 2WN3A 2XMLA 3KV9A 5A6QA 1PM7A 5F5CA 3H1WA 5DDJ1 3JCIA 3BI3A 3JQXA 3VHRA 3WQ7A 4AQTA 1L7LA 4KU7A 4NAOA 1F8VA 1GNHA 1W6NB 4B7EA 1WMDA 3NJZA 4AG4A 2VW0A 2BBVA 1EAH3 1N3OA 3R05A 3D6EA 2WSVA 2ETEA 2ZGNA 4CU6A 1HIXA 5I8YA 3HNYM 1RVF1 2VW1A 1W0OA 4QX2A 3THPA 1VBB2 2JD9A 1MS3A 1RUD2 5FYHA 4BIFA 3ZFEB 3IDBB 5HV4A 2NN8A 3GZUC 3POWA 2GP3A 3BOWA 1ZYBA 3N7KA 4CDUA 3C7HA 4QKFA 2JG9A 4Y1YA 4C0HA 2R042 1H0BA 2HEYF 2EAKA 5ABJC 1NLQA 4I2OA 1FMD2 2E31A 5LATA 2B39A 1CAVA 4NWWA 2XKOA 4E8DA 4D6SA 2B46X 2EALA 2Q8CA 2A6YA 2XVLA 3IIAA 1G86A 2XB6C 1CAXA 4H55A 2CDPA 3R4SA 2WC2A 3IT8A 5E16A 3BU7A 3TB0A 3KMHA 2WDBA 3BGAA 3PU8A 4JDMA 3K75B 3ST7A 1D0GA 2VCCA 3GNEA 2QQPA 5IK4A 4JGYC 3QBQA 2RDSA 4YZ2A 1V6LA 1AXKA 4YVWB 4OHWA 4JTNA 4UBHA 1EY2A 3U07A 2VAUA 4MGYE 4BXFA 4EE2A 2J1VA 2RS31 4E4HA 4CDXB 1Y9MA 1H8TB 5J36A 3GJAA 1L7QA 5DDJ2 1WW6A 4N90A 1YJLA 2ET1A 3ZKUA 5FMOS 3W5MA 1GU3A 2NLRA 1D2QA 5KWRA 2YMZA 2BJSA 3HMYA 4K8RB 4XUTA 1ST8A 2UU8A 5FYYA 3TN91 4XTPA 4LLOA 1HQNA 4PI2A 2HWC3 3PDQA 3PJQA 5FZ8A 2YGMA 5DAQA 3JD72 2CV6A 1B35C 1UZWA 1X82A 4RHV3 3ZFFC 5GM0A 1BZWA 5CFDC 2PHTA 3POEA 3NVCA 1QMJA 1E5RA 1H4GA 5IVJA 2WZR1 1GZWB 2OKXA 3ZFEA 3KVAA 1UY2A 5I0TA 1ULGA 3NMBA 3T0AA 1HQLA 1N1TA 1H2LA 4B29A 2QZ2A 2XKPA 4QDQA 5FZ7A 4N9IA 4ET7A 1TNFA 2IXIA 4PIZA 2KM2A 2GMEA 3D4KA 2ORZA 3LQCA 4Q0SA 1W3XA 4Q4V3 5T5PA 5A32A 1KS4A 1F5JA 1LCLA 3ME2A 4O9EA 2EXIA 1OH3A 1HXS3 3OGSA 4Q27A 5FXVA 1D4M1 4DY3A 1ASJ3 1CQ9A 4MYEA 1W6OB 3K3NA 2D6MA 4YGDA 1BEV2 3P6BA 3TYJA 2GNBA 4LK6A 4P9XA 4XIOA 1Z7S1 4E8CA 5EXOA 4NIHA 1J3PA 3T30A 3T1LA 5FPVA 1KEXA 3DYPA 2DVFA 1ZBA1 5H9RA 1YIFA 2ILMA 5FMCA 5FCCA 4M4RA 4P14A 4W6WA 2FDGA 4WVWA 1HB3A 1VP6A 4ISQA 1OURA 1W8TA 4Y33A 5BNNB 2DCTA 3CLPA 4JZRA 1BBT2 1PNFA 4GH4B 5E89A 1RUC1 3AMNA 4H2AA 3GCWA 1DP0A 1T6BX 1PHMA 1YFWA 4FQZA 4IV1B 1VPHA 2FCTA 1OF4A 2XR4A 4P9JA 4XETA 3OEAA 4ASLA 2ENRA 3CJIA 1CIYA 4U2AA 2VW2A 3T2OA 2VQUA 2CGPA 2HWB3 3FMGA 3I2HA 3MF6A 2P3IA 3RDIA 3V56A 1PGW1 2BRTA 3E97A 2WZR2 3JXSA 3NNLA 5AFBA 4OULA 4W65A 4NPMA 4IDZA 5LZ6A 3NV3A 4QM8A 2ARCA 1F35A 3NKGA 2RS13 3ITQA 3KGLA 3FFQA 4UFHA 1AR93 1LHOA 5K8SA 2NQYA 3AZYA 2ZXQA 3LKJA 3OTFA 4I3PA 3B7MA 4EN9B 2IC1A 1CR7A 1RL3A 1D4M2 4ZPIA 1HLCA 3N7MA 2RDNA 1IZ3A 4QGLA 1CZVA 4LJHA 3I4IA 4XJ8A 3RJ2X 3VBRC 2YROA 3WOGA 2J1AA 1NZIA 4XMAA 5ANNA 5C8CC 3USUB 4COWA 1GYKA 2HJIA 1K5JA 1LHUA 1SACA 2CL2A 2ZEXA 4OUEA 1UN1A 3AVRA 1CGPA 3AMPA 4YW3A 2ADDA 5LRRA 1XE7A 2ARAA 2W94A 1TG7A 3NO8A 4RS5B 5FUNA 1TQ5A 5FY0A 5J48A 4MH0E 5JZGB 3LEMA 2NM1A 3BTYA 3H9AA 1X8MA 1NCRB 1ENXA 3JBG1 2W1WA 2C5DA 5FPXA 3VBUC 3OY8B 4BJ0A 2WO7A 3R4UA 1VBD3 2HWE3 4FPKA 4Y20A 5LASA 2VULA 1GSLA 3LPFA 4FTEA 3WDUA 1QGLA 3GYDA 1XXNA 4L92A 5CEHA 1W06A 3JB4C 2B8MA 4BMBA 1UMZA 3NJVA 2B42B 4PIXA 1OLME 1RHI1 3CMGA 4AFBA 1V6KA 3NJXA 1VMFA 4GB32 4JHTA 4QHOA 1TZOA 4U36A 4IV3C 4KL1A 1Q56A 3THDA 2ZHLA 2ZZQA 5A7PA 4LKSA 4BA6A 3I49A 1FOD2 4XJAA 2BOJA 3OGJA 2QE3A 3NNMA 2RM23 1H2KA 2RR12 4Q0QA 1C8M1 3WEZA 1KGYA 4OMDA 5E8AA 3PTYA 1K45A 2YUEA 1M4WA 1CJPA 1NLRA 3U4SA 3IM0A 5K0UA 1I5ZA 4RD7A 2GN3A 2YC0A 4C1XA 4D69A 1AL23 1UPSA 2I74A 2VH9A 3WP5A 3AJZA 4BH9A 1JZ7A 2RS52 5GZGA 3RYRA 2SLIA 1NKGA 5JWPA 4RA0A 3N7LA 3AP9A 3ZPYA 5I93A 3AXEA 4RSUA 2BQPA 1G8WA 4Y1UA 1YUDA 4AYUA 4DPNA 3ZIXA 1NX9A 3MIEA 4V2WA 3I2OA 4C8DA 2X8KA 3MIDA 3PIJA 4BE3A 1GMMA 1GOFA 3JBG2 2DBNA 3ZXDA 3LB9A 4NN0A 1G9CA 2P4EA 3ZMOA 2DU1A 4CEWA 1BYHA 4N7UA 1Y43B 3I54A 4OI4A 5J37A 2VY0A 5JOWA 1LOEA 1M06G 1AR61 1AR81 4HK8A 4CVUA 1RITA 4LNVA 1I6XA 4KWKA 1JBCA 4DB5A 3RVHA 4LBOA 1G6NA 1K3IA 1MS0A 1ULEA 1ZX5A 4FP3A 4OHVA 4Q1PA 4XDQA 2JG8B 1RHI2 2OXBA 5F39A 2K2SA 3AFKA 4DRRA 2YFZA 1LNSA 1RUJ1 2DU0A 4ZONA 3K51A 3T0BA 2PQSA 2W5FA 1POV0 1G9DA 1YFYA 2VMFA 4JGZA 1AR72 4NRMA 5I8TA 2Y0IA 3RI9A 3VL9A 1OMIA 1V6JA 1XQNA 1PO13 3AZWA 3C8XA 5T3NA 3AXDA 3VB9A 2PQQA 3SCGA 2DUPA 4BHPA 1W0PA 4AQ6A 2WFF3 5A7OA 5H9PA 3WCSA 5LA9A 3ASIA 2JXAA 4IEXA 3AP6A 5AC92 4X6RB 4K9SA 5D8AB 3VZJA 1RJ7A 2CWMA 5HCHA 3A22A 1REDA 3BIEA 3O1PA 3C7GA 2GN7A 5JUVA 4B1LA 3VZLA 2HKXA 3FFZA 2G4IA 4J1XA 4ZU5A 2B45X 5DG2A 2AR6A 4XZPA 2Z42A 4LPLA 1IS3A 2A71A 5L7OA 4Q4X1 1HJFA 1HRV1 3VKFC 5I0DA 4QDSA 4XF3A 1CWPA 3WNMA 3MHZA 1SPPA 2P1BA 1ZRCA 1PO21 5GZDA 4JCKA 3TRSB 4S2FA 1US2A 2W68A 1OQ1A 4AEDA 5BV6A 1FV3A 5L9RA 1KDKA 1AR62 4MO3M 4IEUA 3ACGA 4Q4W1 3VBOB 3M1HA 3FBYA 4Z2AA 2NMOA 5KXEA 2VUDA 2W91A 4GAZA 4QX8A 3D5OA 1AYM3 5F3IA 3ROUA 2RDQA 3WUCA 2VQTA 1OFNA 4ONUA 3U10A 5FQ0B 1LR5A 1STMA 1T6GC 1RUE1 1E57A 3IAPA 4HT1T 2WNUA 1EV13 3V64A 1GNYA 1TE1B 3EB7A 1VBA2 3AMQA 4UT5A 1Y4WA 4W8JA 3AP4A 5BYNA 3HQXA 1XSQA 3FLRA 4MVTA 3VD5A 1P8JA 2D6PA 4FSJA 2BP6A 3I2KA 3V0AB 1LAJA 2WO3A 1S0BA 2QQIA 5A33B 3OPTA 1YXWA 4NPLA 2IWGB 3WXPA 2DTYA 4DFSA 3I3QA 4E2QA 3PUAA 1UNBA 1WD3A 4K7JA 2AUYA 3OPZA 3BALA 4QPIA 4R52A 5EJZB 4QQOA 1X36A 2R49A 3K46A 4P9LA 2Z5WA 3MPPG 4YGCA 5FPUA 1NQJA 1QDCA 5FMDA 5GLZA 2ZX1A 1WGPA 1S0CA 4OHYA 4CCOA 3GF6A 2PHLA 4IE0A 2BVVA 2PXJA 3OCPA 4MX3A 3OUJA 4PDWB 5FZ4A 3ZO0B 3S0MA 1QU0A 4K3UA 1H9WA 1FATA 4FAHA 4J6GA 2JDYA 4Q4X2 5C3QA 1HRV2 1MZ5A 5IHRA 2K9ZA 2ZZJA 2BGCA 4UFKA 1SEFA 4BWOA 3UJOA 4KWLA 3DPRA 2FZ1A 1AX2A 3OPWA 1PO22 3VN4A 5CFCA 4XILA 3BTZA 1JYIA 1UCXA 3FUOA 2VUAA 1REFA 1IKQA 2ZHMA 4BMEA 2AEYA 1W8NA 1MS1A 1KD7A 2UY9A 3MUY1 1POV1 1FPN1 1ZZ7A 3T4HB 1DZQA 1W6MB 2HWC2 2DYCA 3KHBA 5JSPA 3H8OA 3I3MA 4FTBA 3VZMA 1F31A 3E5QA 5FP8A 1RUE2 3M3QA 3VD9A 1DCSA 4YVWC 5ERLA 4A42A 4UOJA 4M0HA 4OZOA 4E4ZA 4CPBD 1C5HA 4QU1A 5J09A 2DWRA 5HCAA 4XC9A 1LRHA 3SC7X 1U5IA 3CDZB 3ZDVA 5C6CA 4CDXC 4R9AA 1H8TC 4EN8B 3Q8AA 2XJRA 3NAPB 2UY8A 5HCBA 3HOBA 3RZKA 4XUNA 4GMP0 1V0AA 2VU9A 1QJU1 3LA7A 3LCPA 4Q4V2 4NWVA 3VD4A 1BVP1 1HXS2 3KZ4C 3M3EA 4RGAA 4EWEA 2E7QA 5JOZA 4DOUA 1QJZA 4Y1ZA 1ASJ2 1KDMA 2WINB 1POQA 5FUIA 4HSLA 4FPGA 1MEC3 1TMF1 5IVCA 2PMWB 5FMOL 2KR2A 4L0PA 4LO8A 4FPFA 5DZGA 3INAA 2YHJA 5LBEA 3O1MA 5T54A 1BXHA 4XAEA 3T1MA 4META 4BLJA 1GZCA 1F4HA 2XBO2 2HWD1 1S0EA 4AEMA 3GALA 3PLQA 2JJ6A 1ZREA 1YRZA 4CXWA 1SLCA 1W8FA 2YY1A 3AYEA 1RIRA 3P3NA 2WO2A 4UYBA 4O61A 4XFAA 4D7SA 5FY7A 3W9AA 4MGZE 4N53B 3O1SA 3ZPOA 5DMYA 5JPNB 3ZN6A 2F6BA 4AK3A 1XYPA 2Q0AA 2PLV1 3D82A 4DNYA 5FJKA 1UU5A 2FHRA 3WQ0A 3PUSA 2DV9A 2X5IA 1RVF3 2E32A 2OUJA 1H9PA 1EPZA 1JZ2A 4N7IA 5C4WB 1O5LA 5FXXA 4MXWA 1VLNA 4QXCA 4HN1A 3SHRA 1S0FA 2DF7A 3KCCA 4OHZA 5BNNC 2RS12 2E6VA 1QJU2 1AR92 2A73B 2QQKA 4GH4C 4N43A 4QAWA 3MI8A 5L19A 4QD2A 3RMXA 4GJZA 1DQ5A 4IV1C 3AYAA 3WZ1A 3FC0A 3ZXFA 2AEZA 1U5ZA 2VBDA 3BKZA 2G9FA 3DN7A 5FYMA 2N7GA 5ACA1 4AQ2A 2JECA 3LEIA 2J22A 1CAUA 3OD4A 4LO6B 3ZYJB 2DURA 5DABA 1CX1A 4D94A 2BTVC 3O1VA 4CCDA 3EQEA 3MIBA 3MLLA 2PAEA 2QQMA 2E7AA 5JIUA 5G04L 3MLJA 4ZY9A 5FAXA 4IGPA 5JMOA 4CCLA 2BGOA 3JUUA 5EJ3A 5IK5A 2RS33 4OMCA 1LODA 4XYXA 1W9SA 3WR0A 2R1DA 1UYYA 1RUG1 2HWE2 2IFRA 2R7EB 3J26N 4P9YA 1HRI1 1RUNA 1BMV1 1A8MA 2J1EA 4GMP1 1VAMA 4ZZ5A 3WF0A 2QQUA 3I8TA 5FYUA 3H7YA 2XWBB 3FE5A 1LB2A 1YNAA 2J1TA 4AFDA 4Z2WA 1G7YA 1J1LA 2AREA 2HH9A 3MGUA 3OYWA 4LIUA 4Q4Y2 3DV8A 4K40A 4AFCA 1QJY1 5JXHA 2F17A 2CHHA 3HR9A 2D5FA 4RS5C 2DCZA 2Q8DA 5JZGC 3O0WA 4WM7B 4XPVA 5FYTA 1NCRC 3EO6A 2VXJA 1Z0HA 4RGGA 2BFUL 4L8QA 4XFHA 4A4AA 4JC1A 5FR3A 1NCQB 1VRH1 3BTAA 5TSWA 5BNPB 4JAAA 3UKTA 4QMAA 2BOIA 2A70A 4LO7A 1R1ZA 1MS4A 3OBZA 1AJOA 2RJ2A 3HN3A 2XHKA 1QJX2 4IE6A 4YM3A 1XE0A 2W1UA 3WD5A 3GZTB 5ACA2 4AGVA 1MVQA 2QTWB 1GOHA 4K8FA 2EF6A 2VTXJ 3BB6A 3MFCA 4I02A 5EYXA 3UJQA 4BK5A 4MGQA 4IE4A 3VDDB 4L11A 2DFCA 2BDRA 4XFIA 1Z7S3 4UI9L 1RMU3 1GQPA 1Y3TA 1SLTA 2Y0OA 4Q0UA 3VBFA 4KWJA 1WBLA 5B2GB 5DG1A 3NSTA 1JYXA 5EWSA 3MPBA 1JOBA 4EZ4A 2A7AA 1ZVFA 1KXGA 2QDNA 4CP9A 2FMDA 2TUNA 1UXZA 1GZTA 2D44A 4MHUA 5FZ1A 3N9NA 2PN5A 1VALA 1HB1A 1HRI2 4TSVA 4FO9A 4QPWA 1ND2B 2W87A 1HKDA 4CEYB 2D40A 1O5UA 1RUC3 2WS91 3J7NA 3OBTA 2JDKA 3GGLA 3LEKA 5EIYB 4YW5A 3OG2A 5I91A 4YG0A 4CZSA 3J7MA 3H3LA 5FZAA 4CDQC 3BOPA 5JXJA 1QJY2 3Q8CA 3WT3A 2VM9A 2P6HA 1DZTA 3RZHA 1TVGA 2VCMA 4WM8B 4P5HA 1N1VA 1OHFA 1GICA 1REEA 3J4UH 3JB8A 1PVC2 4PF1A 5FZEA 4BQ1A 1JHJA 5FP7A 2ZGUA 1YLLA 3BU0A 3WG4A 1NQDA 1PO12 2AGSA 2QQOA 5C9AB 4HG6B 3UV9A 2ZMLA 2WFF2 2ORXA 3QOPA 2EA7A 2XGXA 5CG9A 1AZDA 5IVBA 4BCUA 1X7NA 2DBIA 2J1SA 2DCYA 3H8RA 2GAUA 2JG8C 3V0BA 2EXJA 3A23A 3AVSA 2WA3A 3IDAA 5T5LA 5ABJA 3TEWA 1W2OA 4DS0A 1XNKA 3O0XA 3RJRA 1DF0A 4MXVA 4LULA 4M4PA 3B9CA 1COV1 1F15A 3R4DB 1PMHX 3NKTA 3U1XA 4ITCA 2HBUA 4OFGA 3ILFA 5FPLA 4AGRA 4AI3A 1VMHA 2AENA 1RUD1 1RUH3 4HKWA 2GDFA 4JGYA 1H2MA 1LENA 1OFSA 1UZYA 2ET7A 4P9IA 5D8AC 2YYOA 1VAVA 3M4FA 4LQRA 3WF3A 5A7WA 2QDRA 2Q8OA 4LOTA 1GLHA 4LBQA 1OLQA 5KHIA 1MQTB 5BUVA 1EUTA 1FMD1 4LBNA 4QXKA 1LU1A 1V9U3 1PK6B 5FBJA 3PVEA 1UX6A 5FUPA 1G9FA 4YM1A 5JI9A 1SFNA 1O8SA 1B35A 2QQJA 3ZFFA 2R072 5LK7B 1F5FA 2ZX3A 1E5IA 1ZBE3 2HLEA 3GXUA 3N3HA 5CFDA 4BQ4A 4Q8KA 1DQ0A 4HSJA 1RGSA 4C90A 3RZMA 5HCFA 1RUF1 2XONA 3POBA 3VBOC 4CA9A 1LOBA 3HNBM 1MS8A 4LE4A 3T0DA 2VZ3A 4NVPA 1RC6A 1OLRA 2DVAA 2BNMA 4LBJA 5A3LA 1O91A 2JKXA 3PIGA 1R092 3F95A 4ZXKA 3ZXLA 1C8M3 4QU2A 4AFAA 5KBFA 5A3PA 4AI9A 1LOAA 4CCMA 1X9TA 1J3QA 2J42A 3M2MA 4Y22B 5T5OA 1N3QA 4YRDA 1LOCA 2Y8KA 5FFOC 2K46A 2ERFA 3A4UA 4QX1A 1COV2 4EZHA 4XDPA 4Y5Z0 3IB3A 2XLFA 1PGL2 2P5BA 3HJRA 3PUIA 1ALYA 3Q8FA 4E4SA 1NE4A 5LEKA 3JD71 2Y6GA 3M70A 4QKDA 2HWF3 4JKKA 4QB1A 3U37A 3H8UA 1DQ1A 2W08A 2PA7A 3LWCA 4OI2A 1I3HA 3O1TA 1GV9A 3HT1A 4HANA 5FZOA 2XUMA 3GHMA 2IVIB 1ODNA 3KF3A 1MS5A 3ZXGA 2JWPA 5CAZA 4CRQA 2O8QA 3I59A 3AL5A 4JQTA 4LIVA 1LGNA 4L9BA 4PDWC 5LY2A 4CCJA 2E7TA 2H0BA 3VGIA 2LRPA 2WNOA 3SNMA 4PLNA 4OHXA 4GQ7A 4LITA 3SH4A 3MFAA 3RI8A 4AW7A 2VGDA 4X6QB 3WDTA 4ATEA 4BQXA 1BEV1 2A6VA 1RUJ3 1OOPB 2VVDA 3S30A 1G9BA 2D3PA 2A6WA 1RUF2 1NAEA 2R061 2VR4A 3VBHB 4PJYA 2XQRA 3WCRA 2WO1A 3HQUA 3HD8B 1QNYA 2XVKA 1SBDA 5FP9A 3H7JA 1NUKA 2A3YA 5DUUA 5JPMB 1BBT1 2QBXA 3LGRA 5JCTA 1FT9A 4UF0A 5CVRA 1QXJA 3BIWE 1DYKA 3HWJA 3SXWA 3NAPC 4KMQA 4OUSA 4J1WA 3H1YA 4XXPA 3VBRA 4LO5B 2JE8A 3ZOIA 4E27A 1J58A 2WLQA 4QB2A 5C8CA 5AVAA 5F8PA 1OI6A 3QLQA 4KU8A 4DY5A 1KFXL 4KGGA 4XJWA 3T08A 4KBBA 3IPVB 4FXKB 3DYOA 4MADA 1XRUA 3J8F1 4HPKA 1SBEA 3ZXKA 2IFWA 3AKTA 1PMIA 2CU5A 5FP3A 1IPSA 1JZ8A 5I0RA 3J9SA 5JSOA 3THCA 5HPOA 2X53S 4WVMB 3VBUA 3FHAA 4BK4A 2H6BA 4DIQA 4OQ8A 1XYOA 1OA4A 2FCUA 1N1SA 3VKLA 2EVXA 4UAPA 5FZ6A 2ZKLA 1XYNA 3B9IA 3VBSB 4AI0A 1VB2A 4EN6B 5D1IA 1QJEA 4GJYA 5LEJA 5AVPA 4AVAA 4NIAA 2YB7A 4KG0A 4BDVB 1LULA 1N47A 2R062 2GH2A 4FBFA 2ZEZA 3S6PA 3RNSA 4A44A 4N53C 1W2UA 4HBNA 2VTFA 2GP5A 4ZHNA 5FMBA 2YC4A 3ALQA 4IV3A 5EPAA 5DZFA 2VL4A 2VCAA 2GU9A 4F7ZA 5FO7B 4D6QA 2CWSA 5KHGA 1WMXA 4AVBA 1J3RA 1CESA 1G9AA 2D7FA 3UKNA 3NV2A 2VPVA 1UXXX 5CU1A 2D43A 3WG3A 5C4WC 3CU7A 4FOVA 1QQP3 2WQ4A 2JE9A 1V6OA 4Q29A 3MIFA 3S7EA 5LCWL 1U5XA 1H30A 3ZYBA 3E5XA 1WW7A 2PFWA 2R30A 1ZRRA 2HBTA 2ZGTA 1I5PA 1YI9A 3ZXJA 3ACLA 4BQ2A 2WA4A 1NT0A 1ND3B 3K48A 4XIKA 4YW6A 2OUHA 4GB31 3ZSEA 3J8F2 4BOWA 3LOBA 2OPWA 3AKSA 4LEJA 1IS4A 5CIRA 3WNPA 4A7KA 1FOD1 1ULCA 3MV11 4TWTA 4QQPA 4Q1RA 4XE9A 5DUVA 1VB4A 1POV3 2UWAA 3LA3A 1FPN3 1F4AA 2WJSA 1W6QB 4XJUA 4YZ3A 4A41A 3SQOA 4MGTA 1R081 2QUOA 1ULDA 1TME1 2RR11 3BPSA 2PHUA 3SITA 4Y5SA 2QCSB 4EWAA 2BNNA 4XBNA 3WP3A 1BKZA 4LKDA 4M3CB 4D8MA 4FOQA 5FWJA 1R1A3 1YYNA 3APBA 2VOXA 1ZRDA 5JXGA 3HQRA 5CADA 3OSDA 4FPYA 2FDIA 2WYSA 4YPJA 4CYDA 1LGBA 1C1FA 2RS51 3P3PA 2VZPA 3U75A 3M7AA 1J59A 1BHGA 1JYCA 1APNA 1OT5A 1ZZ8A 3TEZA 1NZCA 2CSGA 5BXXA 5BNOB 4XABA 1XB9A 3NRUA 2GZWA 3P5BA 3ES1A 2MHFA 2PYTA 1UF2C 4FT8A 4FOYA 3PMEA 4WVZA 2LM3A 3LA2A 4QWNA 3H3ZA 2WFPA 1TMF3 2X29A 3O12A 3AP5A 4EJRA 3AJYA 3ZVXA 4WM7C 3WW4A 3ZM8A 4CXYA 1W6PA 3EXUA 4YFWA 5DAVA 2EAAA 1C5IA 1PNGA 5FZHA 1NCQC 1PIV3 3AM2A 4AQSA 5BNPC 5K9YA 3IKWA 3WF4A 2HWD3 1WBFA 1YHFA 5K7PA 3MW4A 5KC5A 4MGIE 4CDWB 5J7MA 3FHIB 4H7LA 3WF2A 1VBC1 2HEVF 5DAPA 3IIIA 3AMHA 3LEGA 5LY1A 1KJRA 4JV4A 1AR71 2FQPA 2ZPXA 3UT0A 2C9KA 4FPJA 2CGOA 2OZ6A 1YC61 4JKLA 1R082 3VDDC 1LKNA 1CAWB 1IS5A 1TME2 3D0SA 4LKFA 3SISA 2VTXA 2PLV3 2VC9A 1W28A 3WNXA 2XL9A 4PQ9A 3ZSMA 4G4FA 2QKDA 3AP7A 5AC91 1RUI2 2VZSA 4I30A 5EV7A 1C8NA 2XDVA 2Y33A 5BNQA 2BERA 4UBGA 2VVEA 2W3JA 2WAOA 2DTWA 2EIEA 1WUVA 1AYN3 5A3NA 2BBAA 1ND2C 4LUKA 4CEYC 4HETA 3C3VA 3RSJA 2Y6FA 1QH7A 5LBFA 3VD7A 1HDKA 5IT6A 1RXGA 1K5MB 1BQPA 2Q30A 2VOVA 5EYYA 4W6YA 5FV3A 1SDWA 2XJVA 5FZ0A 2BWAA 3WDYA 1NXMA 1IS6A 5DN2A 5T50A 4CCCA 4YLZA 4CDQB 4XBLA 1W6NA 2DUQA 2GALA 2JB8A 2QQWA 5CZKA 2PHDA 4CSWA 1PGSA 2XJPA 1R64A 3ETPA 4WM8C 3OBRA 1SBFA 4XJZA 3RPQA 4AF9A 5FZFA 2Z4FA 4BPZA 3I7DA 3LZZA 3CF6E 4IXLA 3I97A 2QJVA 5J3UA 4QPYA 3ACIA 2GMPA 3WW2A 5C9AC 1CZTA 2JDNA 1RUH2 1V6NA 3X29B 1GP4A 1LECA 1VBC2 3CKHA 3LDBA 3N4MA 1NYWA 1VBA1 4FPHA 1UU4A 2MEV2 2V4AA 4QKBA 3DCQA 3TBDA 2Y38A 5H9QA 4GKYA 1OKOA 4IESA 2DVDA 4RQPB 1OVPA 3K4ZA 2ZEWA 3POFA 2B9UA 2OVUA 3T09A 5A3UA 1LEMA 1Q8VA 2A5ZA 2VVFA 3FWEA 1ENSA 1GNZA 1GUIA 1QF3A 1TNRA 4XURA 4ES9A 2IXHA 2FZ2A 1FV2A 2Q4SA 5FREA 1UY3A 2QZ3A 3ZSKA 3IMMA 2ZS6B 4BXSV 2PHWA 4YVWA 4FPCA 4XZUG 1DDLA 1GZ9A 3T2PA 4O9GA 3LOIA 4XTMA 3LE0A 3W58A 4FAGA 2V73A 3E6CC 2L9LA 3WW1A 4WZCA 1SDDB 3NNFA 1OQEA 4CDXA 1VRH3 1H8TA 3KV4A 1SLIA 4J25A 4UW3A 1AXYA 1GWKA 1O59A 5E6HA 1CX4A 1MQTC 2PELA 1L7RA 4YFZA 1OPMA 4Q8LA 4LA3A 4DQAA 1EAH2 1PK6C 1JN2P 3JU9A 1UQXA 2A1XA 4AHZA 3ZYIB 2XPJA 4GWIA 5FYSA 1XPWA 3A7QA 2HWC1 2YXSA 1OA2A 4QPGB 3VKMA 2YU2A 3VDBA 5A6XA 3ABZA 1HV1A 2HWF2 3WNKA 5JR7B 2B7YA 4JQRA 1GZWA 3GBGA 4R9BA 4YGEA 3VD3A 2GC3A 1NLSA 3O5SA 2D98A 3WV6A 1SFPA 4C1WA 4CTEA 1UZZA 2YDEA 3SLIA 3M3CA 4ARXA 2J1RA 3MW3A 4BIOA 1JHNA 2FMYA 4XVHA 4Q4V1 2YC2A 1HX6A 4S2HA 5FPZA 5DZEA 2MPFA 1HXS1 2V09A 5H9SA 1O3RA 2AYHA 3WHTA 1CPMA 1W6OA 4R4XA 2Q1MA 4D6RA 3SCFA 1ASJ1 3VZOA 2RMU3 1AHSA 1X50A 2HYXA 3ZYFA 3WP6A 2VG9A 3OUIA 1VJ2A 5HI0A 3DGTA 4XW3A 1I1EA 3E6BA 1JUHA 2Y6KA 4TYSA 2C6SA 4AE2A 1O4ZA 2J1UA 2VZVA 1OD3A 5IJRA 3QH6A 3UGFA 2ZGPA 1VMJA 2WN2A 2XBO1 4YVSB 3WP4A 5BNNA 3K3OA 4HXCA 4Q0PA 2Z79A 4GH4A 3TNPB 3NWKA 4Z07A 3L2YA 2DDUA 1W2NA 3SH5A 1IHMA 4IV1A 3ZFGB 3CHXA 2GNMA 4MUVA 3PJYA 3TEYA 1JU4A 1ZRIA 2ARXA 2NZ9A 1IQDC 1BLZA 1NA1B 5CISA 4YW2A 3AZXA 3NJYA 4OYUA 4RHV2 4NHKA 1OOPC 3SEEA 3WDWA 4AI2A 2Y64A 3MLKA 5GLVA 2HWB1 2R16A 5CBLA 4MV2A 3BVCA 1WLDA 3ZKYA 3VBHC 4YYOA 3DKWA 4QQ2A 5FYIA 1VBE3 3TOJA 2P37A 4IQPA 2O14A 2OT7A 2LTNA 1SMVA 1H8VA 1VBB3 2ATFA 2R6QA 3NNJA 2G9ZA 2RS11 5F32A 3BTXA 2QQVA 4B4PA 5KXDA 1Q8PA 1AR91 4ISRA 4F8AA 4RGKA 5GJ6A 5IVFA 1SCRA 4OCTA 3LPGA 2XLAA 5GZEA 2G9GA 1SG3A 2KA3A 5AFEA 1WMFA 2R043 2VNGA 4AVVA 2GNTA 5F6LB 1HJGA 3USUA 4CUGA 1UZ0A 1JZ4A 4NOTA 2XH6A 4DUVA 3DYMA 4BQ3A 4DXSA 1OSGA 3ETQA 3QACA 5FWEA 5KR7A 1DU3D 3LIHA 2PHXA 1DLCA 2I07B 3VUOA 4AI8A 4RR3B 4RS5A 3DUIA 3ZYHA 5JZGA 1XNCA 3A0KA 5GZFA 2Y60A 1UD1A 1NCRA 5A6ZA 1WLWA 2WNEA 3EYPA 1FX5A 1X8EA 3OY8A 4QT6A 5J98B 5CB7A 3UGHA 1UOJA 3E6DA 2WNVB 1RJ8A 5DDJ3 1PMJX 1VBD1 3KD4A 3HN1A 2HWE1 4S2GA 3VBSC 3GJBA 4ZS3A 2VQAA 1MPXA 2HWB2 2EXKA 4NPRA 3DXUA 2OIIA 1W9TA 2E51A 5L73A 2Q1ZB 1CD3G 3KSCA 4Q4Y1 3MO4A 5A3TA 2D3SA 1IKPA 5JVVA 5C70A 2E53A 1DGRN 1JZ6A 5T5JA 3RRDA 3ELNA 4B7KA 2WWJA 1O7FA 4DXTA 3VKNA 4MSVA 4OUMA 3OUHA 3RZLA 3T2QA 3M8LA 4CDUB 2JG9B 2OQ6A 4N8MA 2C0ZA 2GMMA 4QXBA 5JAXA 2D6OX 3OGRA 1LEDA 2KD7A 2XLGA 4CP1A 1QJX1 4NIDA 1C3HA 1AL21 1CAVB 3I3EA 4Y4YA 2EIGA 1ND3C 2JX9A 2LALA 1CAXB 1SFYA 1BEV3 1YQ8A 2BPA2 4LR4A 1ZA7A 1GOGA 5FXWA 4FPLA 4LT5A 2YU1A 2CY6A 4ES8A 4QX5A 1V00A 4QHZA 2VE1A 2P6CA 1N3PA 3VDCA 1IPKA 2W9XA 1UMHA 1JODA 3LDRA 3ON7A 1VBD2 5C8WA 4LORA 5DAWA 4YM2A 3MIHA 1RYYA 2YGLA 1BBT3 2OPKA 2ZCWA 5A1LA 5FY1A 2D93A 2ZHNA 2WYFA 3THTA 4AAPA 4QDRA 2JG8A 3TN93 3V65A 3G6JB 3FUQA 4M00A 5L36A 1J1TA 4GALA 1US3A 4LBMA 1GWMA 3FLTA 5F5QA 5BNOC 2XJUA 5JSRA 4E9KA 1LTEA 2WZR3 3TWIA 4BQWA 3ECQA 1PVC1 5BY5A 1JOPA 2WL1A 3VV1A 3NNGA 1UW8A 2RM22 2YG0A 2ZX4A 1ZNPA 2VMCA 3AX4A 3VDAA 1WCKA 2CGNA 1PO11 3IAQA 3S7IA 1W39A 1BK0A 1LU2A 2WFF1 5D8AA 2JDMA 4MGSA 5A32B 3WNOA 4AZZA 1W9FA 4LHKA 2W52A 5DUXA 3ZX7A 1AL22 2LS6A 4XF1A 1QH6A 1D4M3 4Q26A 1H1AA 1H2NA 4Y1XA 4CE8A 5KHJA 1W3VA 4CDWC 3N7JA 1AX0A 5FY5A 5J1XA 2ID4A 4HFSA 1KQRA 4FP2A 3PNAA 4YZ1A 1AF9A 1K12A 2ZBJA 3L9JT 4XF4A 1X33A 1ZBA3 2LROA 4CXXA 4XEZA 3U0ZA 1UIKA 2WZPP 1FNZA 4XF9A 5FZIA 4QX7A 1KJLA 4QX3A 4M0NA 4I3GA 2VUCA 5D21A 1Q43A 4NHXA 1ZRFA 4NIGA 3CIHA 2X09A 4HKOA 4F3JA 2ZA9A 3FLPA 3OB8A 4GD4A 3VBOA 2O1QA 5IAXA 3GBFA 3TEXA 5F37A 2JE7A 2B9VA 4G9SB 2VOTA 4GULA 2LW8A 1AYM1 4LOSA 1JW6A 4XFGA 4BLIA 4COVA 5FQ0A 4GXLA 3GHNA 4IL7A 1RUOA 2FBEA 2DCKA 3I2JA 1GBGA 2JENA 3CJIB 5FLIA 3RQ0A 2X05A 1YIPA 3KT1A 4EN7B 3HEIA 4AHWA 2BGPA 5F5AA 3KCXA 4SBVA 1CIWA 1K5MC 1RXFA 1UX7A 1V70A 3V0AA 4L2NA 1AX1A 2UWCA 4GB33 2R071 1OUSA 1LHNA 4LBLA 5A33A 1I9RA 3KF5A 1A34A 1MZEA 1FOD3 2Z2SB 1CONA 4M01A 5F3GA 1H1IA 4NRQA 1PVXA 4PHZA 5FPBA 4LHLA 2E9QA 3NV1A 1R091 2RR13 5FY8A 1QJFA 1WWYA 4RL7A 5EQUA 4PDWA 3H50A 3H8XA 1OLMA 5APAA 3R6SA 4C0BA 2P3YA 1UKRA 3PURA 4IEQA 2ZJCA 4ZU7A 3FHQA 4FXGB 3CBNA 1XU1A 3LAGA 3OGGA 5C5TA 3W20A 4Z92B 1PGL1 3KGZA 2KXLA 4RQPC 3DECA 4INDA 3GDBA 1UPIA 2K0GA 2AH2A 2V4VA 4QQLA 5EHDA 5JR2A 2AC1A 4KI5M 3O0VA 5SV5A 5ISLA 2DUOA 3PHMA 2GNDA 3RFRA 5FZ3A 1W6MA 3JBG3 3UNPA 4HMZA 1AYM2 1VR3A 4TXWA 4HL0A 1S0IA 4IEVA 4LHNA 3IDEA 2R1BA 2FDFA 2GC1A 4Y20B 1PM4A 1EV12 4YM0A 1OXCA 1XE8A 4XUQA 5LRSA 1CZSA 1DGLA 3AFGA 1S0GA 3WNNA 3NAPA 2JIGA 2YV8A 2VOWA 1RHI3 1A3KA 4S2DA 4K1ZA 4IW3A 4NHMA 5IVEA 1ULFA 1WLCA 2Y6HA 4FQ4A 2BUKA 3Q9OA 5B4XA 4B3NA 4JVAA 1YO8A 4CCNA 1K42A 1W90A 1AR73 2RJLA 1A6CA 3ZMNA 4MZUA 2JDAA 1DYOA 2WLPA 4EWDA 4A45A 4WVVA 4KG8A 4Y5TA 4QPGC 4Z82A 4A6OA 4BZ4A 2RMU2 2UURA 3BN6A 1MZFA 5FO9B 1IQAA 1X9PA 1KRIA 2XQXA 1MEC1 3EHKA 4IETA 1WCDJ 5FYBA 4Q2FA 1XSRA 1J84A 4K6BA 4MG2A 3POJA 5K0UB 1DQ4A 4M3CE 5FLJA 4UFMA 4A3XA 4XJ9A 2C24A 3A21A 1DYPA 4Y26A 2E63A 2V5DA 1LOFC 2IUWA 5EJ1B 3C7EA 1NY71 2BV4A 2JB4A 3DKQA 5C71A 2VNRA 2VMIA 3USSA 5IATA 1LHVA 4N53A 1YQCA 3PUHA 4UFIA 2WQZC 5CKQA 1YWKA 3PMSA 4ASKA 4DINB 3WX5A 4FPEA 1ENQA 5FP4A 4CEWB 2A75A 1W0NA 1AR63 1AR83 3KB5A 5CKNA 1U12A 4YW4A 4TTGA 2PHRA 4GA9A 1VBE2 5C4WA 3T2TA 4JDNA 4W6XA 4Y1VA 4QGMA 4YVSC 3EJKA 5C7GA 1F9KA 3ZIWA 4XAAA 3WDVA 3EMRA 1KS5A 1DHKB 5A3WA 2FDKA 3ZFGC 1VBA3 2WR9A 4C91A 4JGZB 3B01A 5IVVA 1NA1C 2HEWF 4HVQA 5M0TA 1WCSA 1W9WA 3J7HA 1NXD1 4MLOA 1MEC2 3RGBA 5T55A 4EN0A 1YQ2A 4BQ5A 2W1QA 3AZZA 3J7LA 3ZR5A 2IXCA 3G7DA 5C3PA 1FAYA 2VBPA 1XNAA 1GP5A 4CU8A 1UY0A 5C3OA 2RDRA 3C7FA 3MYXA 5GLTA 3H42B 4UFLA 1WKYA 3LSEA 1QY4A 3Q8EA 1AJKA 1S4CA 2D6NA 3I3BA 1NY72 1RTVA 1W2AX 2QFEA 2VXRA 2ZGRA 1S2EA 1LGCA 3POIA 3KQ4B 3GM8A 3ILNA 5LA2A 5A7SA 3N9LA 4Q4X3 5F6KA 1HRV3 4A6SA 4GWMA 1LOGA 2VBBA 5L7OB 4DUXA 1PZ7A 4YG3A 1PO23 2RVAA 1SPPB 3KT7A 3KQRA 4AEDB 4F83A 4QQHA 3K4DA 4RFRB 5JLVA 3N35A 4Q4W3 3WHUA 1DQ6A 3MW2A 1RVF2 3Q8BA 1UY4A 4FVVA 4LTAA 4XACA 1OF3A 1ZM1A 4RR3C 1WLTA 3RMYA 1XNDA 3OD0A 5JIAA 5F5IA 2SBAA 2VCBA 1RUE3 2C4XA 4WM7A 3VHPA 2QNKA 2WIIB 2JDZA 4W4ZA 2PHFA 4JX0A 2WNUB 4QB6A 5LWBA 1NCQA 3N9QA 5BNPA 3AC0A 2VMGA 1ZZCA 2WNVC 1GWLA 5DUWA 1OVSA 4QKNA 1WW5A 3TAYA 5SV8A 3K77A 3RYPA 3WDXA 3KWVA 1J83A 3NL1A 3BYWA 3GBWA 1C28A 2CAUA 2ZGSA 4MHRA 5FY4A 4D0QA 3HBZA 4IUGA 1MS9A 5IW0A 2F4PA 2WSUA 4CCKA 2FDHA 3VDDA 3WG2A 2LUWA 3CQOA 2VNOA 3LD8A 4QPIB 4KBZA 5A70A 1UO9A 3POGA 3U78A 4M3CF 1RMU1 4BISA 3UETA 2ZGQA 1Q8SA 1SHWB 1H1MA 3LF7A 3MF9A 4O7XA 1UY1A 4ARYA 4NE9A 2RS32 2XBO3 4GWJA 3UESA 2D6KA 4FFIA 1Q3EA 1ULPA 4CDUC 3HVDA 1ND2A 1ZZBA 2JG9C 5F3EA 4CEYA 5L9VA 3OBAA 3AYCA 2VUJA 2O8OA 3DPRB 5F2SA 1JYNA 4HONA 4NAMA 5CFCB 2RHPA 3NQHA 3CZUA 3TN92 2G19A 4XHXA 5HBAA 2WABA 1OD5A 5A1FA 5FZ9A 4AEJA 3WQ1A 1H6YA 1U5YA 2D97A 3VZNA 4BU2A 4D7YA 1VRBA 1D2SA 4WM8A 5I0SA 3B00A 3MUZ1 4XXAA 1IG3A 3RWNA 2OZJA 5GLUA 5FLHA 4BYYA 1HV0A 1RUI1 2JICA 3URFA 3FBMA 3B5LB 2GH8A 5C9AA 4NUBA 4UFJA 5FZDA 3I2DA 1MZ6A 4V1PA 2ZEYA 1GR3A 1QJU3 1XOYA 3WINE 4P02B 3I2IA 5CA6A 4EV0A 1XNTA 4KH9A 2VJXA 3B93A 2Q5TA 3ENRA 3KS7A 2XG3A 1S55A 4I0BA 2YPDA 2WWUA 2YBKA 2ZHKA 1EYBA 4K20A 2GC0A 1NE6A 3GZEA 2FCVA 2D3RA 3RG0A 2JD4A 1SZBA 1UYXA 1Z7S2 5EP9A 1RMU2 1B09A 4FFHA 4LK7A 1O8PA 3POSA 4QXHA 4TZDA 2FD8A 3AMMA 1WD4A 5C3RA 1ZBA2 4LLFA 1UMIA 2BFUS 2H6CA 1UZVA 4KQ7A 4QHBA 1JMUB 4YW7A 3RZZA 3ZFEC 4YARA 3QD6A 2WAAA 2AZ5A 1OKQA 1OBNA 3HPNA 1RUH1 5JI7A 5A1AA 3M3IA 3WLUA 3PL0A 3PVOA 5LBBA 1UWWA 1RUC2 2B5HA 2EXHA 2WBKA 4N9HA 4XFCA 3AB0A 2VMHA 1W8UA 2MEV1 3OJBA 2NP0A 5B4NA 2DVGA 4CCEA 4KNCA 4AHYA 1MQTA 1CVNA 3AYDA 1QWRA 3H0OA 4IGQA 3ZN6B 3HAGA 4P00B 1LESA 3W59A 3WNLA 1PK6A 3SKVA 3UGGA 1PGW2 4NR1A 1QOSA 1V9U1 2BVBA 1L3JA 2TEPA 3IZOA 4JDOA 2JKBA 2P2KA 4BB3A 2ZABA 4IEOA 2WT0A 2X5IB 2XWJB 4XBQA 2V72A 4PCRA 5LB6A 2W92A 4Q4Y3 2CYFA 1BVVA 2RJKA 4Y24A 1HB2A 4L97A 4RFT0 1ZBE1 1QOTA 4MXWB 3R0RA 3T3YA 4Z8BA 4XUPA 5FYZA 1E5SA 4WZFA 3UKVA 5JDBA 4N43B 3CEWA 1BJQA 2A6ZA 5CKMA 4NRPA 3KVBA 1PZ9A 5KXCA 3KLSA 4Y22A 1ODMA 1DGWX 3OEBA 1XBFA 3CJIC 3NW4A 1Q8OA 3KCYA 1UKGA 1A78A 4R8HA 5FK8A 2ZKNA 1QJX3 5HXVA 1EAH1 1SLBA 2RG4A 5IVYA 1NOVA 4D7TA 4LXLA 5ACA3 2MNGA 4DZGA 4IEPA 2RE9A 1YEWA 1C57A 1CAUB 1F2NA 2YFUA 3QCWA 4D3WA 1DLLA 2HWF1 4SLIA 4XFBA 2EICA 4O65A 1UOFA 2Q1FA 3U14A 4WBBA 4DXZA 2B4KA 3PTRB 1UOBA 3ZSLA 4K21A 2ZMKA 1IGOA 3MIGA 1RUG3 1GKBA 4JKMA 1HRI3 3VHOA 4XCBA 2YBSA 4DXRA 1O3SA 2W2IA 4GMP3 5A80A 1JYVA 5CG8A 4IEYA 1W03A 4ZXEA 1V9U2 2EIBA 5FKBA 5GLWA 4AFMA 1JOJA 1SQ4A 1QJY3 4COUA 1OOPA 1T2XA 3OYWB 1ZBE2 3OGVA 4P08A 1W9YA 5IUQA 2A3WA 3VBHA 4ASMB 1FYUA 2Y26A 1PVC3 5KC6A 1WA6X 4WV8A 2C26A 3I2GA 1C8M2 5LW9A 3WVJA 3F2ZA 1FI2A 2TBVA 4CUCA 3LSDA 2CAVA 1JS9A 4ZKTB 2NYYA 2IZWA 3ACHA 1YI7A 4PBPA 2TNFA 4TLGA 1JYWA 4XDOA 4PLOA 5A6YA 4HK9A 1JYTA 4NIIA 1S2KA 4I09A 2VZTA 4P9WA 2VNVA 4RHV1 5FZLA 5IAVA 4AWDA 1AXZA 4E2SA 3VBFB 5CYYA 1LHWA 1C1LA 3GCXA 3PU3A 3IPVA 1WW4A 1XJAA 1QOOA 1D4VB 1VAKA 3SMHA 3UK9A 5C3SA 4YW1A 2WZ8A 3KT4A 4CP9B 2YPJA 4LA2A 4UWDA 4XUOA 1WA4A 1GQHA 2PAMA 3ZR6A 1AR82 4QM9A 1UYPA 4LUMA 2WS93 1WZXA 4OLLA 3CO2A 2YBPA 4WVMA 3N36A 5K0UC 2QVSB 1Q5OA 3LFMA 4DMIA 2ZMNA 4OI1A 3L2HA 2Y6JA 2OA2A 1HN0A 3PVNA 3VBSA 1YJKA 1QKQA 3CNAA 2VZOA 1YQ5A 4NHLA 1O4TA 4JHZA 3KM5A 1RUJ2 3B02A 5DAXA 2XUEA 1HW5A 5FZBA 2WZEA 1PZ8A 5LBCA 4YSFA 4X8PA 1ZZ9A 1WMEA 4PF5A 1UIJA 5FZCA 3AK0A 5J96B 1W8WA 2ZGOA 1QEXA 2W95A 2XL7A 4PLMA 4AVTA 2R073 1Z78A 1DGWA 4GWNA 2D5HA 3K2OA 4XQDA 4CEWC 3S5AA 4V2VA 1JH5A 3WUDA 4B4RA 1AUYA 4XQ4A 1YQ6A 2ARBA 5EFUA 2RV9A 2FDJA 4UXAA 1R093 3N9PA 4COZA 4PIYA 3FL7A 4GZ9A 1QQP1 3V0BB 3ACFA 4E4DX 5ABJB 4R9CA 1FNYA 2IXKA 1W99A 2VZ1A 4AAXA 4NJ4A 2NMNA 3AKQA 5FZKA 1COV3 1VE0A 1IPJA 4JGZC 3JZVA 2Q8EA 5FO8B 4NMIA 1ND3A 5A3OA 2VZRA 3O1RA 1GQGA 2A3XA 2E26A 5KHHA 4AEKA 3E1F1 2JIJA 1RUD3 4GKXA 4FCAA 3MICA 5I0UA 3W5NA 3ZLIA 4YWAA 3MZHA 1Q8QA 4KGQA 4JGYB 4AOCA 2CTVA 2UYAA 3SKJE 4FOWA 5IFPA 3RZJA 1W6QA 4Q4W2 2A6XA 1DGRA 3BPZA 3BCWA 3M3OA 5A7WB 1AVBA 4LBQD 2PAKA 4UW6A 2ZGKA 4M3CA 4UW4A 2BW8A 2XVGA 4LBQB 1FMD3 2F4LA 1R1A1 2IVJA 1C4RA 4HKLA 1JZ3A 1S1AA 4AVCA 2GC2A 1GANA 1JUIA 2BWCA 5L7OC 3UYJA 3KV6A 4FPOB 4AL9A 3ATGA 3HBKA 3PUQA 1ONAA 4NHYA 1B35B 4HVOA 5I8SA 3ZFFB 3WG1A 4CP0A 4DEVA 5BNOA 5CFDB 5G05L 4AEDC 1RUF3 3ZXAC 1ENRA 5GALA 1W04A 1WCUA 4FTSA 1Y9GA 3ZYPA 1QQP2 1SLAA 4COYA 1JU3A 2P34A 4YG6A 1NG0A 4P5YA 4CU7A 2JDPA 5HV0A 3I3DA 3EBRA 2WNUC 4NO4A 3RWKX 4AGGA 5F7UA 2OW4A 2P3KA 3WSOA 1PIV1 4XF0A 4CDWA 4EROA 3VL8A 3JD73 3LDKA 4PBOA 3O14A 3NV4A 4TLFA 2XXZA 2R0HA 1FXZA 5IYYA 2XJTA 1OA3A 4Y3OA 3MBWA 2BNOA 2XHNA 4HN0A 3AZVA 2NPIA 4Y4RA 4YZ4A 4EQVA 2Y34A 3B94A 3HIFA 5FK7A 4LMFA 1EUUA 4OVEA 1FPN2 1CAWA 3P1IA 4ZS2A 4QPIC 5FZOB 2RM21 2ES3A 4A3ZA 4UW5A 1IG0A 5FRAA 4ZZ8A 3WW3A 4ATFA 1JZ5A 5IK7A 4H7MA 1HN1A 2BU9A 1R1A2 2OQ7A 2VMDA 4IERA 3I59B 2ZOEB 4BQYA 1JXNA 3LFIA 1IOAA 4RN5A 1U0AA 4IGOA 4P9GA 2W0XA 2DVBA 4XMIA 2ZX2A 4G3YC 4BM8A 1AYN1 4MGKE 5DQ0A 3DPRC 1ZA4A 4Z1VA 5CFCC 2WT1A 2W46A 3UL2A 1O6UA 5F1RA 1YFXA 1K5MA 1PX3A 2R063 2CDOA 4H14A 3RZGA 5F3CA 2UWBA 1W8HA 1O3QA 4HLTA 4MOAA 4CDQA 1UYZA 2EIDA 2P3JA 5C5UA 4IE7A 5C33A 2CNAA 1S0DA 5FIXA 4OI0A 1TMF2 3HNMA 3D3AA 3IMNA 5JOXA 2YZ4A 4A2UA 2BEOA 1O3TA 2Y6LA 3CJXA 1XNBA 4XQWA 4A7YA 2HYKA 2I2SA 3DEMA 4HZFA 3AKRA 2GSYA 5D2AA 1GP6A 1QHDA 4UF0B 1PIV2 3A0NA 3ORJA 2BYVE 4XHBA 4LE3A 2HWD2 5FBZA 4AXOA 4ZU4A 3CZJA 3AKPA 5GKAC 5FOBB 1Y9QA 3U4XA 1QDOA 4URTA 5CNAA 3VBRB 3W21A 5GZCA 2WQ8A 3IDCB 1HB4A 4LHSA 1JTZX 5C8CB 1W8ZA 1D7PM 3WQBA 2AACA 3O1UA 2IXJA 2DFBA 4RYDA 4KWUA 1RB8G 4RQPA 3ZN5A 4IEWA 2QQLA 3J8F3 1N1YA 4LKEA 4E2GA 2PLV2 4HPKB 5ANQA 1ACCA 5E1RA 5JXIA 2XJSA 2BZDA 2Z69A 4FFGA 4NROA 3BODA 4EYUA 1CPNA 1H4HA 5HXMA 4K1YA 5LA0A 5A7QA 1QNWA 2ZX0A 3VBUB 3ZYGA 5F9TA 4PI0A 1KFUL 1AYN2 2D6LX 5KXBA 3POYA 4Q0VA 3DL3A 3D8CA 1DIWA 1V6IA 1YFUA 3C7OA 3MDPA 3ZN4A 3K4AA 1SCSA 2C1FA 1DZRA 3ILRA 3GZAA 1QXPA 1RINA 1S2BA 3IN9A 2ZACA 3SCHA 4XFFA 2VOKA 3MV01 3KV5A 3ZYRA 5E88A 3C2UA 3ZXEA 4IV3B 2G1MA 1KITA 2IXLA 2ZGMA 2WUHA 3T4VA 4L99A 3ZDSA 3QH7A 1OUXA 4AI1A 3FN9A 5DXDA 5BPXA 3H3UA 3S57A 4B1MA 2QQNA 1S0JA 2X5IC 1W2TA 3N9OA 1AL0G 5FZGA 4QPGA 5K4LA 4URAA 1H6XA 5DPNA 5LK5A 4AR2A 1O4YA 4LBKA 5FZMA 5IWFA 4I01A 1Y7BA 3IBMA 4IE5A 3TNQA 3MEPA 4X8NA 3RYKA 4A7ZA 1GFF2 4QGNA 4YNIA 4N43C 1EV11 2OS2A 1CJDA 2PTMA 2R32A 1SLLA 3VHNA 1EPWA 1OC1A 1VIWB 3DF0A 4AHXA 3O7OA 1LOFA 4H3WA 4IEZA 1RUG2 4CUBA 1BMV2 3S5QA 5FXZA 3SEPA 2JEMA 1DQ2A 2ZAAA 2JDUA 3JQWA 1URXA 4ORFA 2XOMA 5FKCA 1R083 2P17A 1ULOA 1TME3 3E5UA 2OX0A 4FI9A 1DG6A 3KHCA 2RMU1 5FOJB 1WCQA 4PQQA 4QX0A 1YCIA 4R4ZA 3WY6A 3AL6A 4B4QA 4DUWA 2R0FA 1RUI3 5LA1A 1LJ7A 3SH3A 2X10A 1UL9A 1JI6A 1W05A 3VKOA 2RS53 4YVSA 1VRH2 5FYVA 2VMEA 2VZQA 4FFFA 4CU9A 1HQWA 1DFQA 1W8OA 2WWSA 3N9MA 1UAIA 3OF1A 5JMCA 1EP0A 3I2FA 3ZFGA 2VECA 5FY9A 2W1SA 5F2WA 1NA1A 2DCJA 4PT6A 5FYCA 3FZ3A 3ES4A 2O0OA 2ZGLA 1BK1A 3D0JA 2VD7A 5A7NA 1PX4A 2VQ0A 2XJQA 2H0VA 1OH4A 4OQ9A 4LO4B 3BUCA 1MR5A 4HOOA 4YGBA 4OZXA 1UOGA 3B69A 4DRVA 2W39A 1W6PB 1VBE1 4CPBA 4B8EA 1BCXA 1DBNA 2ZAHA 5FJHA 5EZWA 2W47A 3HT2A 3FX3A 1VBB1 5FTTC 3WF1A 2I45A 3O1OA 2J7MA 5T52A 2WT2A 1VBC3 1V6MA 2WRAA 2WS92 5JOYA 4JTOA 3PVBB 1A8DA 3CL1A 5FDBA 4I0AA 1MACA 2MEV3 4W50A 3FJSA 4TN7A 3ZSJA 5IK8A 3OOXA 2R041 3LIGA 3VZKA 4DO0A 3U11A 1OPOA 3VBFC 3B3QE 1CN1A 1OQDA 1TEIA 2ZTNA 3H1MA 5L9BA 2V5YA 4CP2A 3DXTA 4AVSA 5AC93 5KHKA 4XOGA 2E33A 2C9AA 4Q5OA 1QIQA 2VZUA 4GIQA 3RS6A 2JDHA 4DEQA 4RR3A 1MVEA 1XC6A 4I0WB 4XCAA 5FPAA 1UU6A 1XU2A 4R9DA 1E5HA 5IFTA 2UYBA 1ZZ6A 4JRLA 4YZ5A 2VO5A 1QXRA 2ADEA 4HVRA 3VLBB 2OYZA 1D0HA 2WKKA 4CUAA 5A3MA 3IWZA 2WNVA
chains in the Genus database with same CATH topology
5M0TA 4JZRA 2G1MA 3OUHA 4NAOA 3GZEA 2FCTA 2FCVA 5HV0A 5EP9A 5EQUA 2FCUA 3MGUA 5ERLA 2RDRA 3OUIA 2Y33A 5IAVA 3NNLA 4XC9A 4ZONA 5C5TA 3W20A 5LBFA 3PL0A 5HV4A 2Y34A 3KT4A 3ITQA 5LBBA 4UWDA 5EPAA 3OBZA 3KT7A 5DAWA 5LA9A 4ZPIA 5LATA 2RDNA 4BQYA 4NHKA 4XACA 5LBEA 4NHLA 5DAXA 3BVCA 5LB6A 5LBCA 2JIGA 2HBTA 2RDSA 4IW3A 4NHMA 4BQWA 3NNJA 4MHUA 2OPWA 2V4AA 5C5UA 3GJAA 4MHRA 4Y5TA 5L9RA 5A3UA 5LASA 4Y5SA 2RG4A 2RDQA 4KBZA 5DAQA 3HQRA 4BQXA 4NMIA 3W21A 3NNFA 2JIJA 3DKQA 4J25A 5IATA 3HQUA 4NHXA 4XABA 5L9VA 3NNMA 5IAXA 4XCBA 2G19A 2A1XA 3GJBA 5L9BA 5DAVA 4Q5OA 3OUJA 3KT1A 4XCAA 4XAAA 3EMRA 2HBUA 4NHYA 5DAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M0T A;  4JZR A;  2G1M A;  3OUH A;  4NAO A;  3GZE A;  2FCT A;  2FCV A;  5HV0 A;  5EP9 A;  5EQU A;  2FCU A;  3MGU A;  5ERL A;  2RDR A;  3OUI A;  2Y33 A;  5IAV A;  3NNL A;  4XC9 A;  4ZON A;  5C5T A;  3W20 A;  5LBF A;  3PL0 A;  5HV4 A;  2Y34 A;  3KT4 A;  3ITQ A;  5LBB A;  4UWD A;  5EPA A;  3OBZ A;  3KT7 A;  5DAW A;  5LA9 A;  4ZPI A;  5LAT A;  2RDN A;  4BQY A;  4NHK A;  4XAC A;  5LBE A;  4NHL A;  5DAX A;  3BVC A;  5LB6 A;  5LBC A;  2JIG A;  2HBT A;  2RDS A;  4IW3 A;  4NHM A;  4BQW A;  3NNJ A;  4MHU A;  2OPW A;  2V4A A;  5C5U A;  3GJA A;  4MHR A;  4Y5T A;  5L9R A;  5A3U A;  5LAS A;  4Y5S A;  2RG4 A;  2RDQ A;  4KBZ A;  5DAQ A;  3HQR A;  4BQX A;  4NMI A;  3W21 A;  3NNF A;  2JIJ A;  3DKQ A;  4J25 A;  5IAT A;  3HQU A;  4NHX A;  4XAB A;  5L9V A;  3NNM A;  5IAX A;  4XCB A;  2G19 A;  2A1X A;  3GJB A;  5L9B A;  5DAV A;  4Q5O A;  3OUJ A;  3KT1 A;  4XCA A;  4XAA A;  3EMR A;  2HBU A;  4NHY A;  5DAP A; 
#chains in the Genus database with same CATH topology
 4JRA A;  2WN3 A;  2XML A;  3KV9 A;  5A6Q A;  1PM7 A;  5F5C A;  3H1W A;  5DDJ 1;  3JCI A;  3BI3 A;  3JQX A;  3VHR A;  3WQ7 A;  4AQT A;  1L7L A;  4KU7 A;  4NAO A;  1F8V A;  1GNH A;  1W6N B;  4B7E A;  1WMD A;  3NJZ A;  4AG4 A;  2VW0 A;  2BBV A;  1EAH 3;  1N3O A;  3R05 A;  3D6E A;  2WSV A;  2ETE A;  2ZGN A;  4CU6 A;  1HIX A;  5I8Y A;  3HNY M;  1RVF 1;  2VW1 A;  1W0O A;  4QX2 A;  3THP A;  1VBB 2;  2JD9 A;  1MS3 A;  1RUD 2;  5FYH A;  4BIF A;  3ZFE B;  3IDB B;  5HV4 A;  2NN8 A;  3GZU C;  3POW A;  2GP3 A;  3BOW A;  1ZYB A;  3N7K A;  4CDU A;  3C7H A;  4QKF A;  2JG9 A;  4Y1Y A;  4C0H A;  2R04 2;  1H0B A;  2HEY F;  2EAK A;  5ABJ C;  1NLQ A;  4I2O A;  1FMD 2;  2E31 A;  5LAT A;  2B39 A;  1CAV A;  4NWW A;  2XKO A;  4E8D A;  4D6S A;  2B46 X;  2EAL A;  2Q8C A;  2A6Y A;  2XVL A;  3IIA A;  1G86 A;  2XB6 C;  1CAX A;  4H55 A;  2CDP A;  3R4S A;  2WC2 A;  3IT8 A;  5E16 A;  3BU7 A;  3TB0 A;  3KMH A;  2WDB A;  3BGA A;  3PU8 A;  4JDM A;  3K75 B;  3ST7 A;  1D0G A;  2VCC A;  3GNE A;  2QQP A;  5IK4 A;  4JGY C;  3QBQ A;  2RDS A;  4YZ2 A;  1V6L A;  1AXK A;  4YVW B;  4OHW A;  4JTN A;  4UBH A;  1EY2 A;  3U07 A;  2VAU A;  4MGY E;  4BXF A;  4EE2 A;  2J1V A;  2RS3 1;  4E4H A;  4CDX B;  1Y9M A;  1H8T B;  5J36 A;  3GJA A;  1L7Q A;  5DDJ 2;  1WW6 A;  4N90 A;  1YJL A;  2ET1 A;  3ZKU A;  5FMO S;  3W5M A;  1GU3 A;  2NLR A;  1D2Q A;  5KWR A;  2YMZ A;  2BJS A;  3HMY A;  4K8R B;  4XUT A;  1ST8 A;  2UU8 A;  5FYY A;  3TN9 1;  4XTP A;  4LLO A;  1HQN A;  4PI2 A;  2HWC 3;  3PDQ A;  3PJQ A;  5FZ8 A;  2YGM A;  5DAQ A;  3JD7 2;  2CV6 A;  1B35 C;  1UZW A;  1X82 A;  4RHV 3;  3ZFF C;  5GM0 A;  1BZW A;  5CFD C;  2PHT A;  3POE A;  3NVC A;  1QMJ A;  1E5R A;  1H4G A;  5IVJ A;  2WZR 1;  1GZW B;  2OKX A;  3ZFE A;  3KVA A;  1UY2 A;  5I0T A;  1ULG A;  3NMB A;  3T0A A;  1HQL A;  1N1T A;  1H2L A;  4B29 A;  2QZ2 A;  2XKP A;  4QDQ A;  5FZ7 A;  4N9I A;  4ET7 A;  1TNF A;  2IXI A;  4PIZ A;  2KM2 A;  2GME A;  3D4K A;  2ORZ A;  3LQC A;  4Q0S A;  1W3X A;  4Q4V 3;  5T5P A;  5A32 A;  1KS4 A;  1F5J A;  1LCL A;  3ME2 A;  4O9E A;  2EXI A;  1OH3 A;  1HXS 3;  3OGS A;  4Q27 A;  5FXV A;  1D4M 1;  4DY3 A;  1ASJ 3;  1CQ9 A;  4MYE A;  1W6O B;  3K3N A;  2D6M A;  4YGD A;  1BEV 2;  3P6B A;  3TYJ A;  2GNB A;  4LK6 A;  4P9X A;  4XIO A;  1Z7S 1;  4E8C A;  5EXO A;  4NIH A;  1J3P A;  3T30 A;  3T1L A;  5FPV A;  1KEX A;  3DYP A;  2DVF A;  1ZBA 1;  5H9R A;  1YIF A;  2ILM A;  5FMC A;  5FCC A;  4M4R A;  4P14 A;  4W6W A;  2FDG A;  4WVW A;  1HB3 A;  1VP6 A;  4ISQ A;  1OUR A;  1W8T A;  4Y33 A;  5BNN B;  2DCT A;  3CLP A;  4JZR A;  1BBT 2;  1PNF A;  4GH4 B;  5E89 A;  1RUC 1;  3AMN A;  4H2A A;  3GCW A;  1DP0 A;  1T6B X;  1PHM A;  1YFW A;  4FQZ A;  4IV1 B;  1VPH A;  2FCT A;  1OF4 A;  2XR4 A;  4P9J A;  4XET A;  3OEA A;  4ASL A;  2ENR A;  3CJI A;  1CIY A;  4U2A A;  2VW2 A;  3T2O A;  2VQU A;  2CGP A;  2HWB 3;  3FMG A;  3I2H A;  3MF6 A;  2P3I A;  3RDI A;  3V56 A;  1PGW 1;  2BRT A;  3E97 A;  2WZR 2;  3JXS A;  3NNL A;  5AFB A;  4OUL A;  4W65 A;  4NPM A;  4IDZ A;  5LZ6 A;  3NV3 A;  4QM8 A;  2ARC A;  1F35 A;  3NKG A;  2RS1 3;  3ITQ A;  3KGL A;  3FFQ A;  4UFH A;  1AR9 3;  1LHO A;  5K8S A;  2NQY A;  3AZY A;  2ZXQ A;  3LKJ A;  3OTF A;  4I3P A;  3B7M A;  4EN9 B;  2IC1 A;  1CR7 A;  1RL3 A;  1D4M 2;  4ZPI A;  1HLC A;  3N7M A;  2RDN A;  1IZ3 A;  4QGL A;  1CZV A;  4LJH A;  3I4I A;  4XJ8 A;  3RJ2 X;  3VBR C;  2YRO A;  3WOG A;  2J1A A;  1NZI A;  4XMA A;  5ANN A;  5C8C C;  3USU B;  4COW A;  1GYK A;  2HJI A;  1K5J A;  1LHU A;  1SAC A;  2CL2 A;  2ZEX A;  4OUE A;  1UN1 A;  3AVR A;  1CGP A;  3AMP A;  4YW3 A;  2ADD A;  5LRR A;  1XE7 A;  2ARA A;  2W94 A;  1TG7 A;  3NO8 A;  4RS5 B;  5FUN A;  1TQ5 A;  5FY0 A;  5J48 A;  4MH0 E;  5JZG B;  3LEM A;  2NM1 A;  3BTY A;  3H9A A;  1X8M A;  1NCR B;  1ENX A;  3JBG 1;  2W1W A;  2C5D A;  5FPX A;  3VBU C;  3OY8 B;  4BJ0 A;  2WO7 A;  3R4U A;  1VBD 3;  2HWE 3;  4FPK A;  4Y20 A;  5LAS A;  2VUL A;  1GSL A;  3LPF A;  4FTE A;  3WDU A;  1QGL A;  3GYD A;  1XXN A;  4L92 A;  5CEH A;  1W06 A;  3JB4 C;  2B8M A;  4BMB A;  1UMZ A;  3NJV A;  2B42 B;  4PIX A;  1OLM E;  1RHI 1;  3CMG A;  4AFB A;  1V6K A;  3NJX A;  1VMF A;  4GB3 2;  4JHT A;  4QHO A;  1TZO A;  4U36 A;  4IV3 C;  4KL1 A;  1Q56 A;  3THD A;  2ZHL A;  2ZZQ A;  5A7P A;  4LKS A;  4BA6 A;  3I49 A;  1FOD 2;  4XJA A;  2BOJ A;  3OGJ A;  2QE3 A;  3NNM A;  2RM2 3;  1H2K A;  2RR1 2;  4Q0Q A;  1C8M 1;  3WEZ A;  1KGY A;  4OMD A;  5E8A A;  3PTY A;  1K45 A;  2YUE A;  1M4W A;  1CJP A;  1NLR A;  3U4S A;  3IM0 A;  5K0U A;  1I5Z A;  4RD7 A;  2GN3 A;  2YC0 A;  4C1X A;  4D69 A;  1AL2 3;  1UPS A;  2I74 A;  2VH9 A;  3WP5 A;  3AJZ A;  4BH9 A;  1JZ7 A;  2RS5 2;  5GZG A;  3RYR A;  2SLI A;  1NKG A;  5JWP A;  4RA0 A;  3N7L A;  3AP9 A;  3ZPY A;  5I93 A;  3AXE A;  4RSU A;  2BQP A;  1G8W A;  4Y1U A;  1YUD A;  4AYU A;  4DPN A;  3ZIX A;  1NX9 A;  3MIE A;  4V2W A;  3I2O A;  4C8D A;  2X8K A;  3MID A;  3PIJ A;  4BE3 A;  1GMM A;  1GOF A;  3JBG 2;  2DBN A;  3ZXD A;  3LB9 A;  4NN0 A;  1G9C A;  2P4E A;  3ZMO A;  2DU1 A;  4CEW A;  1BYH A;  4N7U A;  1Y43 B;  3I54 A;  4OI4 A;  5J37 A;  2VY0 A;  5JOW A;  1LOE A;  1M06 G;  1AR6 1;  1AR8 1;  4HK8 A;  4CVU A;  1RIT A;  4LNV A;  1I6X A;  4KWK A;  1JBC A;  4DB5 A;  3RVH A;  4LBO A;  1G6N A;  1K3I A;  1MS0 A;  1ULE A;  1ZX5 A;  4FP3 A;  4OHV A;  4Q1P A;  4XDQ A;  2JG8 B;  1RHI 2;  2OXB A;  5F39 A;  2K2S A;  3AFK A;  4DRR A;  2YFZ A;  1LNS A;  1RUJ 1;  2DU0 A;  4ZON A;  3K51 A;  3T0B A;  2PQS A;  2W5F A;  1POV 0;  1G9D A;  1YFY A;  2VMF A;  4JGZ A;  1AR7 2;  4NRM A;  5I8T A;  2Y0I A;  3RI9 A;  3VL9 A;  1OMI A;  1V6J A;  1XQN A;  1PO1 3;  3AZW A;  3C8X A;  5T3N A;  3AXD A;  3VB9 A;  2PQQ A;  3SCG A;  2DUP A;  4BHP A;  1W0P A;  4AQ6 A;  2WFF 3;  5A7O A;  5H9P A;  3WCS A;  5LA9 A;  3ASI A;  2JXA A;  4IEX A;  3AP6 A;  5AC9 2;  4X6R B;  4K9S A;  5D8A B;  3VZJ A;  1RJ7 A;  2CWM A;  5HCH A;  3A22 A;  1RED A;  3BIE A;  3O1P A;  3C7G A;  2GN7 A;  5JUV A;  4B1L A;  3VZL A;  2HKX A;  3FFZ A;  2G4I A;  4J1X A;  4ZU5 A;  2B45 X;  5DG2 A;  2AR6 A;  4XZP A;  2Z42 A;  4LPL A;  1IS3 A;  2A71 A;  5L7O A;  4Q4X 1;  1HJF A;  1HRV 1;  3VKF C;  5I0D A;  4QDS A;  4XF3 A;  1CWP A;  3WNM A;  3MHZ A;  1SPP A;  2P1B A;  1ZRC A;  1PO2 1;  5GZD A;  4JCK A;  3TRS B;  4S2F A;  1US2 A;  2W68 A;  1OQ1 A;  4AED A;  5BV6 A;  1FV3 A;  5L9R A;  1KDK A;  1AR6 2;  4MO3 M;  4IEU A;  3ACG A;  4Q4W 1;  3VBO B;  3M1H A;  3FBY A;  4Z2A A;  2NMO A;  5KXE A;  2VUD A;  2W91 A;  4GAZ A;  4QX8 A;  3D5O A;  1AYM 3;  5F3I A;  3ROU A;  2RDQ A;  3WUC A;  2VQT A;  1OFN A;  4ONU A;  3U10 A;  5FQ0 B;  1LR5 A;  1STM A;  1T6G C;  1RUE 1;  1E57 A;  3IAP A;  4HT1 T;  2WNU A;  1EV1 3;  3V64 A;  1GNY A;  1TE1 B;  3EB7 A;  1VBA 2;  3AMQ A;  4UT5 A;  1Y4W A;  4W8J A;  3AP4 A;  5BYN A;  3HQX A;  1XSQ A;  3FLR A;  4MVT A;  3VD5 A;  1P8J A;  2D6P A;  4FSJ A;  2BP6 A;  3I2K A;  3V0A B;  1LAJ A;  2WO3 A;  1S0B A;  2QQI A;  5A33 B;  3OPT A;  1YXW A;  4NPL A;  2IWG B;  3WXP A;  2DTY A;  4DFS A;  3I3Q A;  4E2Q A;  3PUA A;  1UNB A;  1WD3 A;  4K7J A;  2AUY A;  3OPZ A;  3BAL A;  4QPI A;  4R52 A;  5EJZ B;  4QQO A;  1X36 A;  2R49 A;  3K46 A;  4P9L A;  2Z5W A;  3MPP G;  4YGC A;  5FPU A;  1NQJ A;  1QDC A;  5FMD A;  5GLZ A;  2ZX1 A;  1WGP A;  1S0C A;  4OHY A;  4CCO A;  3GF6 A;  2PHL A;  4IE0 A;  2BVV A;  2PXJ A;  3OCP A;  4MX3 A;  3OUJ A;  4PDW B;  5FZ4 A;  3ZO0 B;  3S0M A;  1QU0 A;  4K3U A;  1H9W A;  1FAT A;  4FAH A;  4J6G A;  2JDY A;  4Q4X 2;  5C3Q A;  1HRV 2;  1MZ5 A;  5IHR A;  2K9Z A;  2ZZJ A;  2BGC A;  4UFK A;  1SEF A;  4BWO A;  3UJO A;  4KWL A;  3DPR A;  2FZ1 A;  1AX2 A;  3OPW A;  1PO2 2;  3VN4 A;  5CFC A;  4XIL A;  3BTZ A;  1JYI A;  1UCX A;  3FUO A;  2VUA A;  1REF A;  1IKQ A;  2ZHM A;  4BME A;  2AEY A;  1W8N A;  1MS1 A;  1KD7 A;  2UY9 A;  3MUY 1;  1POV 1;  1FPN 1;  1ZZ7 A;  3T4H B;  1DZQ A;  1W6M B;  2HWC 2;  2DYC A;  3KHB A;  5JSP A;  3H8O A;  3I3M A;  4FTB A;  3VZM A;  1F31 A;  3E5Q A;  5FP8 A;  1RUE 2;  3M3Q A;  3VD9 A;  1DCS A;  4YVW C;  5ERL A;  4A42 A;  4UOJ A;  4M0H A;  4OZO A;  4E4Z A;  4CPB D;  1C5H A;  4QU1 A;  5J09 A;  2DWR A;  5HCA A;  4XC9 A;  1LRH A;  3SC7 X;  1U5I A;  3CDZ B;  3ZDV A;  5C6C A;  4CDX C;  4R9A A;  1H8T C;  4EN8 B;  3Q8A A;  2XJR A;  3NAP B;  2UY8 A;  5HCB A;  3HOB A;  3RZK A;  4XUN A;  4GMP 0;  1V0A A;  2VU9 A;  1QJU 1;  3LA7 A;  3LCP A;  4Q4V 2;  4NWV A;  3VD4 A;  1BVP 1;  1HXS 2;  3KZ4 C;  3M3E A;  4RGA A;  4EWE A;  2E7Q A;  5JOZ A;  4DOU A;  1QJZ A;  4Y1Z A;  1ASJ 2;  1KDM A;  2WIN B;  1POQ A;  5FUI A;  4HSL A;  4FPG A;  1MEC 3;  1TMF 1;  5IVC A;  2PMW B;  5FMO L;  2KR2 A;  4L0P A;  4LO8 A;  4FPF A;  5DZG A;  3INA A;  2YHJ A;  5LBE A;  3O1M A;  5T54 A;  1BXH A;  4XAE A;  3T1M A;  4MET A;  4BLJ A;  1GZC A;  1F4H A;  2XBO 2;  2HWD 1;  1S0E A;  4AEM A;  3GAL A;  3PLQ A;  2JJ6 A;  1ZRE A;  1YRZ A;  4CXW A;  1SLC A;  1W8F A;  2YY1 A;  3AYE A;  1RIR A;  3P3N A;  2WO2 A;  4UYB A;  4O61 A;  4XFA A;  4D7S A;  5FY7 A;  3W9A A;  4MGZ E;  4N53 B;  3O1S A;  3ZPO A;  5DMY A;  5JPN B;  3ZN6 A;  2F6B A;  4AK3 A;  1XYP A;  2Q0A A;  2PLV 1;  3D82 A;  4DNY A;  5FJK A;  1UU5 A;  2FHR A;  3WQ0 A;  3PUS A;  2DV9 A;  2X5I A;  1RVF 3;  2E32 A;  2OUJ A;  1H9P A;  1EPZ A;  1JZ2 A;  4N7I A;  5C4W B;  1O5L A;  5FXX A;  4MXW A;  1VLN A;  4QXC A;  4HN1 A;  3SHR A;  1S0F A;  2DF7 A;  3KCC A;  4OHZ A;  5BNN C;  2RS1 2;  2E6V A;  1QJU 2;  1AR9 2;  2A73 B;  2QQK A;  4GH4 C;  4N43 A;  4QAW A;  3MI8 A;  5L19 A;  4QD2 A;  3RMX A;  4GJZ A;  1DQ5 A;  4IV1 C;  3AYA A;  3WZ1 A;  3FC0 A;  3ZXF A;  2AEZ A;  1U5Z A;  2VBD A;  3BKZ A;  2G9F A;  3DN7 A;  5FYM A;  2N7G A;  5ACA 1;  4AQ2 A;  2JEC A;  3LEI A;  2J22 A;  1CAU A;  3OD4 A;  4LO6 B;  3ZYJ B;  2DUR A;  5DAB A;  1CX1 A;  4D94 A;  2BTV C;  3O1V A;  4CCD A;  3EQE A;  3MIB A;  3MLL A;  2PAE A;  2QQM A;  2E7A A;  5JIU A;  5G04 L;  3MLJ A;  4ZY9 A;  5FAX A;  4IGP A;  5JMO A;  4CCL A;  2BGO A;  3JUU A;  5EJ3 A;  5IK5 A;  2RS3 3;  4OMC A;  1LOD A;  4XYX A;  1W9S A;  3WR0 A;  2R1D A;  1UYY A;  1RUG 1;  2HWE 2;  2IFR A;  2R7E B;  3J26 N;  4P9Y A;  1HRI 1;  1RUN A;  1BMV 1;  1A8M A;  2J1E A;  4GMP 1;  1VAM A;  4ZZ5 A;  3WF0 A;  2QQU A;  3I8T A;  5FYU A;  3H7Y A;  2XWB B;  3FE5 A;  1LB2 A;  1YNA A;  2J1T A;  4AFD A;  4Z2W A;  1G7Y A;  1J1L A;  2ARE A;  2HH9 A;  3MGU A;  3OYW A;  4LIU A;  4Q4Y 2;  3DV8 A;  4K40 A;  4AFC A;  1QJY 1;  5JXH A;  2F17 A;  2CHH A;  3HR9 A;  2D5F A;  4RS5 C;  2DCZ A;  2Q8D A;  5JZG C;  3O0W A;  4WM7 B;  4XPV A;  5FYT A;  1NCR C;  3EO6 A;  2VXJ A;  1Z0H A;  4RGG A;  2BFU L;  4L8Q A;  4XFH A;  4A4A A;  4JC1 A;  5FR3 A;  1NCQ B;  1VRH 1;  3BTA A;  5TSW A;  5BNP B;  4JAA A;  3UKT A;  4QMA A;  2BOI A;  2A70 A;  4LO7 A;  1R1Z A;  1MS4 A;  3OBZ A;  1AJO A;  2RJ2 A;  3HN3 A;  2XHK A;  1QJX 2;  4IE6 A;  4YM3 A;  1XE0 A;  2W1U A;  3WD5 A;  3GZT B;  5ACA 2;  4AGV A;  1MVQ A;  2QTW B;  1GOH A;  4K8F A;  2EF6 A;  2VTX J;  3BB6 A;  3MFC A;  4I02 A;  5EYX A;  3UJQ A;  4BK5 A;  4MGQ A;  4IE4 A;  3VDD B;  4L11 A;  2DFC A;  2BDR A;  4XFI A;  1Z7S 3;  4UI9 L;  1RMU 3;  1GQP A;  1Y3T A;  1SLT A;  2Y0O A;  4Q0U A;  3VBF A;  4KWJ A;  1WBL A;  5B2G B;  5DG1 A;  3NST A;  1JYX A;  5EWS A;  3MPB A;  1JOB A;  4EZ4 A;  2A7A A;  1ZVF A;  1KXG A;  2QDN A;  4CP9 A;  2FMD A;  2TUN A;  1UXZ A;  1GZT A;  2D44 A;  4MHU A;  5FZ1 A;  3N9N A;  2PN5 A;  1VAL A;  1HB1 A;  1HRI 2;  4TSV A;  4FO9 A;  4QPW A;  1ND2 B;  2W87 A;  1HKD A;  4CEY B;  2D40 A;  1O5U A;  1RUC 3;  2WS9 1;  3J7N A;  3OBT A;  2JDK A;  3GGL A;  3LEK A;  5EIY B;  4YW5 A;  3OG2 A;  5I91 A;  4YG0 A;  4CZS A;  3J7M A;  3H3L A;  5FZA A;  4CDQ C;  3BOP A;  5JXJ A;  1QJY 2;  3Q8C A;  3WT3 A;  2VM9 A;  2P6H A;  1DZT A;  3RZH A;  1TVG A;  2VCM A;  4WM8 B;  4P5H A;  1N1V A;  1OHF A;  1GIC A;  1REE A;  3J4U H;  3JB8 A;  1PVC 2;  4PF1 A;  5FZE A;  4BQ1 A;  1JHJ A;  5FP7 A;  2ZGU A;  1YLL A;  3BU0 A;  3WG4 A;  1NQD A;  1PO1 2;  2AGS A;  2QQO A;  5C9A B;  4HG6 B;  3UV9 A;  2ZML A;  2WFF 2;  2ORX A;  3QOP A;  2EA7 A;  2XGX A;  5CG9 A;  1AZD A;  5IVB A;  4BCU A;  1X7N A;  2DBI A;  2J1S A;  2DCY A;  3H8R A;  2GAU A;  2JG8 C;  3V0B A;  2EXJ A;  3A23 A;  3AVS A;  2WA3 A;  3IDA A;  5T5L A;  5ABJ A;  3TEW A;  1W2O A;  4DS0 A;  1XNK A;  3O0X A;  3RJR A;  1DF0 A;  4MXV A;  4LUL A;  4M4P A;  3B9C A;  1COV 1;  1F15 A;  3R4D B;  1PMH X;  3NKT A;  3U1X A;  4ITC A;  2HBU A;  4OFG A;  3ILF A;  5FPL A;  4AGR A;  4AI3 A;  1VMH A;  2AEN A;  1RUD 1;  1RUH 3;  4HKW A;  2GDF A;  4JGY A;  1H2M A;  1LEN A;  1OFS A;  1UZY A;  2ET7 A;  4P9I A;  5D8A C;  2YYO A;  1VAV A;  3M4F A;  4LQR A;  3WF3 A;  5A7W A;  2QDR A;  2Q8O A;  4LOT A;  1GLH A;  4LBQ A;  1OLQ A;  5KHI A;  1MQT B;  5BUV A;  1EUT A;  1FMD 1;  4LBN A;  4QXK A;  1LU1 A;  1V9U 3;  1PK6 B;  5FBJ A;  3PVE A;  1UX6 A;  5FUP A;  1G9F A;  4YM1 A;  5JI9 A;  1SFN A;  1O8S A;  1B35 A;  2QQJ A;  3ZFF A;  2R07 2;  5LK7 B;  1F5F A;  2ZX3 A;  1E5I A;  1ZBE 3;  2HLE A;  3GXU A;  3N3H A;  5CFD A;  4BQ4 A;  4Q8K A;  1DQ0 A;  4HSJ A;  1RGS A;  4C90 A;  3RZM A;  5HCF A;  1RUF 1;  2XON A;  3POB A;  3VBO C;  4CA9 A;  1LOB A;  3HNB M;  1MS8 A;  4LE4 A;  3T0D A;  2VZ3 A;  4NVP A;  1RC6 A;  1OLR A;  2DVA A;  2BNM A;  4LBJ A;  5A3L A;  1O91 A;  2JKX A;  3PIG A;  1R09 2;  3F95 A;  4ZXK A;  3ZXL A;  1C8M 3;  4QU2 A;  4AFA A;  5KBF A;  5A3P A;  4AI9 A;  1LOA A;  4CCM A;  1X9T A;  1J3Q A;  2J42 A;  3M2M A;  4Y22 B;  5T5O A;  1N3Q A;  4YRD A;  1LOC A;  2Y8K A;  5FFO C;  2K46 A;  2ERF A;  3A4U A;  4QX1 A;  1COV 2;  4EZH A;  4XDP A;  4Y5Z 0;  3IB3 A;  2XLF A;  1PGL 2;  2P5B A;  3HJR A;  3PUI A;  1ALY A;  3Q8F A;  4E4S A;  1NE4 A;  5LEK A;  3JD7 1;  2Y6G A;  3M70 A;  4QKD A;  2HWF 3;  4JKK A;  4QB1 A;  3U37 A;  3H8U A;  1DQ1 A;  2W08 A;  2PA7 A;  3LWC A;  4OI2 A;  1I3H A;  3O1T A;  1GV9 A;  3HT1 A;  4HAN A;  5FZO A;  2XUM A;  3GHM A;  2IVI B;  1ODN A;  3KF3 A;  1MS5 A;  3ZXG A;  2JWP A;  5CAZ A;  4CRQ A;  2O8Q A;  3I59 A;  3AL5 A;  4JQT A;  4LIV A;  1LGN A;  4L9B A;  4PDW C;  5LY2 A;  4CCJ A;  2E7T A;  2H0B A;  3VGI A;  2LRP A;  2WNO A;  3SNM A;  4PLN A;  4OHX A;  4GQ7 A;  4LIT A;  3SH4 A;  3MFA A;  3RI8 A;  4AW7 A;  2VGD A;  4X6Q B;  3WDT A;  4ATE A;  4BQX A;  1BEV 1;  2A6V A;  1RUJ 3;  1OOP B;  2VVD A;  3S30 A;  1G9B A;  2D3P A;  2A6W A;  1RUF 2;  1NAE A;  2R06 1;  2VR4 A;  3VBH B;  4PJY A;  2XQR A;  3WCR A;  2WO1 A;  3HQU A;  3HD8 B;  1QNY A;  2XVK A;  1SBD A;  5FP9 A;  3H7J A;  1NUK A;  2A3Y A;  5DUU A;  5JPM B;  1BBT 1;  2QBX A;  3LGR A;  5JCT A;  1FT9 A;  4UF0 A;  5CVR A;  1QXJ A;  3BIW E;  1DYK A;  3HWJ A;  3SXW A;  3NAP C;  4KMQ A;  4OUS A;  4J1W A;  3H1Y A;  4XXP A;  3VBR A;  4LO5 B;  2JE8 A;  3ZOI A;  4E27 A;  1J58 A;  2WLQ A;  4QB2 A;  5C8C A;  5AVA A;  5F8P A;  1OI6 A;  3QLQ A;  4KU8 A;  4DY5 A;  1KFX L;  4KGG A;  4XJW A;  3T08 A;  4KBB A;  3IPV B;  4FXK B;  3DYO A;  4MAD A;  1XRU A;  3J8F 1;  4HPK A;  1SBE A;  3ZXK A;  2IFW A;  3AKT A;  1PMI A;  2CU5 A;  5FP3 A;  1IPS A;  1JZ8 A;  5I0R A;  3J9S A;  5JSO A;  3THC A;  5HPO A;  2X53 S;  4WVM B;  3VBU A;  3FHA A;  4BK4 A;  2H6B A;  4DIQ A;  4OQ8 A;  1XYO A;  1OA4 A;  2FCU A;  1N1S A;  3VKL A;  2EVX A;  4UAP A;  5FZ6 A;  2ZKL A;  1XYN A;  3B9I A;  3VBS B;  4AI0 A;  1VB2 A;  4EN6 B;  5D1I A;  1QJE A;  4GJY A;  5LEJ A;  5AVP A;  4AVA A;  4NIA A;  2YB7 A;  4KG0 A;  4BDV B;  1LUL A;  1N47 A;  2R06 2;  2GH2 A;  4FBF A;  2ZEZ A;  3S6P A;  3RNS A;  4A44 A;  4N53 C;  1W2U A;  4HBN A;  2VTF A;  2GP5 A;  4ZHN A;  5FMB A;  2YC4 A;  3ALQ A;  4IV3 A;  5EPA A;  5DZF A;  2VL4 A;  2VCA A;  2GU9 A;  4F7Z A;  5FO7 B;  4D6Q A;  2CWS A;  5KHG A;  1WMX A;  4AVB A;  1J3R A;  1CES A;  1G9A A;  2D7F A;  3UKN A;  3NV2 A;  2VPV A;  1UXX X;  5CU1 A;  2D43 A;  3WG3 A;  5C4W C;  3CU7 A;  4FOV A;  1QQP 3;  2WQ4 A;  2JE9 A;  1V6O A;  4Q29 A;  3MIF A;  3S7E A;  5LCW L;  1U5X A;  1H30 A;  3ZYB A;  3E5X A;  1WW7 A;  2PFW A;  2R30 A;  1ZRR A;  2HBT A;  2ZGT A;  1I5P A;  1YI9 A;  3ZXJ A;  3ACL A;  4BQ2 A;  2WA4 A;  1NT0 A;  1ND3 B;  3K48 A;  4XIK A;  4YW6 A;  2OUH A;  4GB3 1;  3ZSE A;  3J8F 2;  4BOW A;  3LOB A;  2OPW A;  3AKS A;  4LEJ A;  1IS4 A;  5CIR A;  3WNP A;  4A7K A;  1FOD 1;  1ULC A;  3MV1 1;  4TWT A;  4QQP A;  4Q1R A;  4XE9 A;  5DUV A;  1VB4 A;  1POV 3;  2UWA A;  3LA3 A;  1FPN 3;  1F4A A;  2WJS A;  1W6Q B;  4XJU A;  4YZ3 A;  4A41 A;  3SQO A;  4MGT A;  1R08 1;  2QUO A;  1ULD A;  1TME 1;  2RR1 1;  3BPS A;  2PHU A;  3SIT A;  4Y5S A;  2QCS B;  4EWA A;  2BNN A;  4XBN A;  3WP3 A;  1BKZ A;  4LKD A;  4M3C B;  4D8M A;  4FOQ A;  5FWJ A;  1R1A 3;  1YYN A;  3APB A;  2VOX A;  1ZRD A;  5JXG A;  3HQR A;  5CAD A;  3OSD A;  4FPY A;  2FDI A;  2WYS A;  4YPJ A;  4CYD A;  1LGB A;  1C1F A;  2RS5 1;  3P3P A;  2VZP A;  3U75 A;  3M7A A;  1J59 A;  1BHG A;  1JYC A;  1APN A;  1OT5 A;  1ZZ8 A;  3TEZ A;  1NZC A;  2CSG A;  5BXX A;  5BNO B;  4XAB A;  1XB9 A;  3NRU A;  2GZW A;  3P5B A;  3ES1 A;  2MHF A;  2PYT A;  1UF2 C;  4FT8 A;  4FOY A;  3PME A;  4WVZ A;  2LM3 A;  3LA2 A;  4QWN A;  3H3Z A;  2WFP A;  1TMF 3;  2X29 A;  3O12 A;  3AP5 A;  4EJR A;  3AJY A;  3ZVX A;  4WM7 C;  3WW4 A;  3ZM8 A;  4CXY A;  1W6P A;  3EXU A;  4YFW A;  5DAV A;  2EAA A;  1C5I A;  1PNG A;  5FZH A;  1NCQ C;  1PIV 3;  3AM2 A;  4AQS A;  5BNP C;  5K9Y A;  3IKW A;  3WF4 A;  2HWD 3;  1WBF A;  1YHF A;  5K7P A;  3MW4 A;  5KC5 A;  4MGI E;  4CDW B;  5J7M A;  3FHI B;  4H7L A;  3WF2 A;  1VBC 1;  2HEV F;  5DAP A;  3III A;  3AMH A;  3LEG A;  5LY1 A;  1KJR A;  4JV4 A;  1AR7 1;  2FQP A;  2ZPX A;  3UT0 A;  2C9K A;  4FPJ A;  2CGO A;  2OZ6 A;  1YC6 1;  4JKL A;  1R08 2;  3VDD C;  1LKN A;  1CAW B;  1IS5 A;  1TME 2;  3D0S A;  4LKF A;  3SIS A;  2VTX A;  2PLV 3;  2VC9 A;  1W28 A;  3WNX A;  2XL9 A;  4PQ9 A;  3ZSM A;  4G4F A;  2QKD A;  3AP7 A;  5AC9 1;  1RUI 2;  2VZS A;  4I30 A;  5EV7 A;  1C8N A;  2XDV A;  2Y33 A;  5BNQ A;  2BER A;  4UBG A;  2VVE A;  2W3J A;  2WAO A;  2DTW A;  2EIE A;  1WUV A;  1AYN 3;  5A3N A;  2BBA A;  1ND2 C;  4LUK A;  4CEY C;  4HET A;  3C3V A;  3RSJ A;  2Y6F A;  1QH7 A;  5LBF A;  3VD7 A;  1HDK A;  5IT6 A;  1RXG A;  1K5M B;  1BQP A;  2Q30 A;  2VOV A;  5EYY A;  4W6Y A;  5FV3 A;  1SDW A;  2XJV A;  5FZ0 A;  2BWA A;  3WDY A;  1NXM A;  1IS6 A;  5DN2 A;  5T50 A;  4CCC A;  4YLZ A;  4CDQ B;  4XBL A;  1W6N A;  2DUQ A;  2GAL A;  2JB8 A;  2QQW A;  5CZK A;  2PHD A;  4CSW A;  1PGS A;  2XJP A;  1R64 A;  3ETP A;  4WM8 C;  3OBR A;  1SBF A;  4XJZ A;  3RPQ A;  4AF9 A;  5FZF A;  2Z4F A;  4BPZ A;  3I7D A;  3LZZ A;  3CF6 E;  4IXL A;  3I97 A;  2QJV A;  5J3U A;  4QPY A;  3ACI A;  2GMP A;  3WW2 A;  5C9A C;  1CZT A;  2JDN A;  1RUH 2;  1V6N A;  3X29 B;  1GP4 A;  1LEC A;  1VBC 2;  3CKH A;  3LDB A;  3N4M A;  1NYW A;  1VBA 1;  4FPH A;  1UU4 A;  2MEV 2;  2V4A A;  4QKB A;  3DCQ A;  3TBD A;  2Y38 A;  5H9Q A;  4GKY A;  1OKO A;  4IES A;  2DVD A;  4RQP B;  1OVP A;  3K4Z A;  2ZEW A;  3POF A;  2B9U A;  2OVU A;  3T09 A;  5A3U A;  1LEM A;  1Q8V A;  2A5Z A;  2VVF A;  3FWE A;  1ENS A;  1GNZ A;  1GUI A;  1QF3 A;  1TNR A;  4XUR A;  4ES9 A;  2IXH A;  2FZ2 A;  1FV2 A;  2Q4S A;  5FRE A;  1UY3 A;  2QZ3 A;  3ZSK A;  3IMM A;  2ZS6 B;  4BXS V;  2PHW A;  4YVW A;  4FPC A;  4XZU G;  1DDL A;  1GZ9 A;  3T2P A;  4O9G A;  3LOI A;  4XTM A;  3LE0 A;  3W58 A;  4FAG A;  2V73 A;  3E6C C;  2L9L A;  3WW1 A;  4WZC A;  1SDD B;  3NNF A;  1OQE A;  4CDX A;  1VRH 3;  1H8T A;  3KV4 A;  1SLI A;  4J25 A;  4UW3 A;  1AXY A;  1GWK A;  1O59 A;  5E6H A;  1CX4 A;  1MQT C;  2PEL A;  1L7R A;  4YFZ A;  1OPM A;  4Q8L A;  4LA3 A;  4DQA A;  1EAH 2;  1PK6 C;  1JN2 P;  3JU9 A;  1UQX A;  2A1X A;  4AHZ A;  3ZYI B;  2XPJ A;  4GWI A;  5FYS A;  1XPW A;  3A7Q A;  2HWC 1;  2YXS A;  1OA2 A;  4QPG B;  3VKM A;  2YU2 A;  3VDB A;  5A6X A;  3ABZ A;  1HV1 A;  2HWF 2;  3WNK A;  5JR7 B;  2B7Y A;  4JQR A;  1GZW A;  3GBG A;  4R9B A;  4YGE A;  3VD3 A;  2GC3 A;  1NLS A;  3O5S A;  2D98 A;  3WV6 A;  1SFP A;  4C1W A;  4CTE A;  1UZZ A;  2YDE A;  3SLI A;  3M3C A;  4ARX A;  2J1R A;  3MW3 A;  4BIO A;  1JHN A;  2FMY A;  4XVH A;  4Q4V 1;  2YC2 A;  1HX6 A;  4S2H A;  5FPZ A;  5DZE A;  2MPF A;  1HXS 1;  2V09 A;  5H9S A;  1O3R A;  2AYH A;  3WHT A;  1CPM A;  1W6O A;  4R4X A;  2Q1M A;  4D6R A;  3SCF A;  1ASJ 1;  3VZO A;  2RMU 3;  1AHS A;  1X50 A;  2HYX A;  3ZYF A;  3WP6 A;  2VG9 A;  3OUI A;  1VJ2 A;  5HI0 A;  3DGT A;  4XW3 A;  1I1E A;  3E6B A;  1JUH A;  2Y6K A;  4TYS A;  2C6S A;  4AE2 A;  1O4Z A;  2J1U A;  2VZV A;  1OD3 A;  5IJR A;  3QH6 A;  3UGF A;  2ZGP A;  1VMJ A;  2WN2 A;  2XBO 1;  4YVS B;  3WP4 A;  5BNN A;  3K3O A;  4HXC A;  4Q0P A;  2Z79 A;  4GH4 A;  3TNP B;  3NWK A;  4Z07 A;  3L2Y A;  2DDU A;  1W2N A;  3SH5 A;  1IHM A;  4IV1 A;  3ZFG B;  3CHX A;  2GNM A;  4MUV A;  3PJY A;  3TEY A;  1JU4 A;  1ZRI A;  2ARX A;  2NZ9 A;  1IQD C;  1BLZ A;  1NA1 B;  5CIS A;  4YW2 A;  3AZX A;  3NJY A;  4OYU A;  4RHV 2;  4NHK A;  1OOP C;  3SEE A;  3WDW A;  4AI2 A;  2Y64 A;  3MLK A;  5GLV A;  2HWB 1;  2R16 A;  5CBL A;  4MV2 A;  3BVC A;  1WLD A;  3ZKY A;  3VBH C;  4YYO A;  3DKW A;  4QQ2 A;  5FYI A;  1VBE 3;  3TOJ A;  2P37 A;  4IQP A;  2O14 A;  2OT7 A;  2LTN A;  1SMV A;  1H8V A;  1VBB 3;  2ATF A;  2R6Q A;  3NNJ A;  2G9Z A;  2RS1 1;  5F32 A;  3BTX A;  2QQV A;  4B4P A;  5KXD A;  1Q8P A;  1AR9 1;  4ISR A;  4F8A A;  4RGK A;  5GJ6 A;  5IVF A;  1SCR A;  4OCT A;  3LPG A;  2XLA A;  5GZE A;  2G9G A;  1SG3 A;  2KA3 A;  5AFE A;  1WMF A;  2R04 3;  2VNG A;  4AVV A;  2GNT A;  5F6L B;  1HJG A;  3USU A;  4CUG A;  1UZ0 A;  1JZ4 A;  4NOT A;  2XH6 A;  4DUV A;  3DYM A;  4BQ3 A;  4DXS A;  1OSG A;  3ETQ A;  3QAC A;  5FWE A;  5KR7 A;  1DU3 D;  3LIH A;  2PHX A;  1DLC A;  2I07 B;  3VUO A;  4AI8 A;  4RR3 B;  4RS5 A;  3DUI A;  3ZYH A;  5JZG A;  1XNC A;  3A0K A;  5GZF A;  2Y60 A;  1UD1 A;  1NCR A;  5A6Z A;  1WLW A;  2WNE A;  3EYP A;  1FX5 A;  1X8E A;  3OY8 A;  4QT6 A;  5J98 B;  5CB7 A;  3UGH A;  1UOJ A;  3E6D A;  2WNV B;  1RJ8 A;  5DDJ 3;  1PMJ X;  1VBD 1;  3KD4 A;  3HN1 A;  2HWE 1;  4S2G A;  3VBS C;  3GJB A;  4ZS3 A;  2VQA A;  1MPX A;  2HWB 2;  2EXK A;  4NPR A;  3DXU A;  2OII A;  1W9T A;  2E51 A;  5L73 A;  2Q1Z B;  1CD3 G;  3KSC A;  4Q4Y 1;  3MO4 A;  5A3T A;  2D3S A;  1IKP A;  5JVV A;  5C70 A;  2E53 A;  1DGR N;  1JZ6 A;  5T5J A;  3RRD A;  3ELN A;  4B7K A;  2WWJ A;  1O7F A;  4DXT A;  3VKN A;  4MSV A;  4OUM A;  3OUH A;  3RZL A;  3T2Q A;  3M8L A;  4CDU B;  2JG9 B;  2OQ6 A;  4N8M A;  2C0Z A;  2GMM A;  4QXB A;  5JAX A;  2D6O X;  3OGR A;  1LED A;  2KD7 A;  2XLG A;  4CP1 A;  1QJX 1;  4NID A;  1C3H A;  1AL2 1;  1CAV B;  3I3E A;  4Y4Y A;  2EIG A;  1ND3 C;  2JX9 A;  2LAL A;  1CAX B;  1SFY A;  1BEV 3;  1YQ8 A;  2BPA 2;  4LR4 A;  1ZA7 A;  1GOG A;  5FXW A;  4FPL A;  4LT5 A;  2YU1 A;  2CY6 A;  4ES8 A;  4QX5 A;  1V00 A;  4QHZ A;  2VE1 A;  2P6C A;  1N3P A;  3VDC A;  1IPK A;  2W9X A;  1UMH A;  1JOD A;  3LDR A;  3ON7 A;  1VBD 2;  5C8W A;  4LOR A;  5DAW A;  4YM2 A;  3MIH A;  1RYY A;  2YGL A;  1BBT 3;  2OPK A;  2ZCW A;  5A1L A;  5FY1 A;  2D93 A;  2ZHN A;  2WYF A;  3THT A;  4AAP A;  4QDR A;  2JG8 A;  3TN9 3;  3V65 A;  3G6J B;  3FUQ A;  4M00 A;  5L36 A;  1J1T A;  4GAL A;  1US3 A;  4LBM A;  1GWM A;  3FLT A;  5F5Q A;  5BNO C;  2XJU A;  5JSR A;  4E9K A;  1LTE A;  2WZR 3;  3TWI A;  4BQW A;  3ECQ A;  1PVC 1;  5BY5 A;  1JOP A;  2WL1 A;  3VV1 A;  3NNG A;  1UW8 A;  2RM2 2;  2YG0 A;  2ZX4 A;  1ZNP A;  2VMC A;  3AX4 A;  3VDA A;  1WCK A;  2CGN A;  1PO1 1;  3IAQ A;  3S7I A;  1W39 A;  1BK0 A;  1LU2 A;  2WFF 1;  5D8A A;  2JDM A;  4MGS A;  5A32 B;  3WNO A;  4AZZ A;  1W9F A;  4LHK A;  2W52 A;  5DUX A;  3ZX7 A;  1AL2 2;  2LS6 A;  4XF1 A;  1QH6 A;  1D4M 3;  4Q26 A;  1H1A A;  1H2N A;  4Y1X A;  4CE8 A;  5KHJ A;  1W3V A;  4CDW C;  3N7J A;  1AX0 A;  5FY5 A;  5J1X A;  2ID4 A;  4HFS A;  1KQR A;  4FP2 A;  3PNA A;  4YZ1 A;  1AF9 A;  1K12 A;  2ZBJ A;  3L9J T;  4XF4 A;  1X33 A;  1ZBA 3;  2LRO A;  4CXX A;  4XEZ A;  3U0Z A;  1UIK A;  2WZP P;  1FNZ A;  4XF9 A;  5FZI A;  4QX7 A;  1KJL A;  4QX3 A;  4M0N A;  4I3G A;  2VUC A;  5D21 A;  1Q43 A;  4NHX A;  1ZRF A;  4NIG A;  3CIH A;  2X09 A;  4HKO A;  4F3J A;  2ZA9 A;  3FLP A;  3OB8 A;  4GD4 A;  3VBO A;  2O1Q A;  5IAX A;  3GBF A;  3TEX A;  5F37 A;  2JE7 A;  2B9V A;  4G9S B;  2VOT A;  4GUL A;  2LW8 A;  1AYM 1;  4LOS A;  1JW6 A;  4XFG A;  4BLI A;  4COV A;  5FQ0 A;  4GXL A;  3GHN A;  4IL7 A;  1RUO A;  2FBE A;  2DCK A;  3I2J A;  1GBG A;  2JEN A;  3CJI B;  5FLI A;  3RQ0 A;  2X05 A;  1YIP A;  3KT1 A;  4EN7 B;  3HEI A;  4AHW A;  2BGP A;  5F5A A;  3KCX A;  4SBV A;  1CIW A;  1K5M C;  1RXF A;  1UX7 A;  1V70 A;  3V0A A;  4L2N A;  1AX1 A;  2UWC A;  4GB3 3;  2R07 1;  1OUS A;  1LHN A;  4LBL A;  5A33 A;  1I9R A;  3KF5 A;  1A34 A;  1MZE A;  1FOD 3;  2Z2S B;  1CON A;  4M01 A;  5F3G A;  1H1I A;  4NRQ A;  1PVX A;  4PHZ A;  5FPB A;  4LHL A;  2E9Q A;  3NV1 A;  1R09 1;  2RR1 3;  5FY8 A;  1QJF A;  1WWY A;  4RL7 A;  5EQU A;  4PDW A;  3H50 A;  3H8X A;  1OLM A;  5APA A;  3R6S A;  4C0B A;  2P3Y A;  1UKR A;  3PUR A;  4IEQ A;  2ZJC A;  4ZU7 A;  3FHQ A;  4FXG B;  3CBN A;  1XU1 A;  3LAG A;  3OGG A;  5C5T A;  3W20 A;  4Z92 B;  1PGL 1;  3KGZ A;  2KXL A;  4RQP C;  3DEC A;  4IND A;  3GDB A;  1UPI A;  2K0G A;  2AH2 A;  2V4V A;  4QQL A;  5EHD A;  5JR2 A;  2AC1 A;  4KI5 M;  3O0V A;  5SV5 A;  5ISL A;  2DUO A;  3PHM A;  2GND A;  3RFR A;  5FZ3 A;  1W6M A;  3JBG 3;  3UNP A;  4HMZ A;  1AYM 2;  1VR3 A;  4TXW A;  4HL0 A;  1S0I A;  4IEV A;  4LHN A;  3IDE A;  2R1B A;  2FDF A;  2GC1 A;  4Y20 B;  1PM4 A;  1EV1 2;  4YM0 A;  1OXC A;  1XE8 A;  4XUQ A;  5LRS A;  1CZS A;  1DGL A;  3AFG A;  1S0G A;  3WNN A;  3NAP A;  2JIG A;  2YV8 A;  2VOW A;  1RHI 3;  1A3K A;  4S2D A;  4K1Z A;  4IW3 A;  4NHM A;  5IVE A;  1ULF A;  1WLC A;  2Y6H A;  4FQ4 A;  2BUK A;  3Q9O A;  5B4X A;  4B3N A;  4JVA A;  1YO8 A;  4CCN A;  1K42 A;  1W90 A;  1AR7 3;  2RJL A;  1A6C A;  3ZMN A;  4MZU A;  2JDA A;  1DYO A;  2WLP A;  4EWD A;  4A45 A;  4WVV A;  4KG8 A;  4Y5T A;  4QPG C;  4Z82 A;  4A6O A;  4BZ4 A;  2RMU 2;  2UUR A;  3BN6 A;  1MZF A;  5FO9 B;  1IQA A;  1X9P A;  1KRI A;  2XQX A;  1MEC 1;  3EHK A;  4IET A;  1WCD J;  5FYB A;  4Q2F A;  1XSR A;  1J84 A;  4K6B A;  4MG2 A;  3POJ A;  5K0U B;  1DQ4 A;  4M3C E;  5FLJ A;  4UFM A;  4A3X A;  4XJ9 A;  2C24 A;  3A21 A;  1DYP A;  4Y26 A;  2E63 A;  2V5D A;  1LOF C;  2IUW A;  5EJ1 B;  3C7E A;  1NY7 1;  2BV4 A;  2JB4 A;  3DKQ A;  5C71 A;  2VNR A;  2VMI A;  3USS A;  5IAT A;  1LHV A;  4N53 A;  1YQC A;  3PUH A;  4UFI A;  2WQZ C;  5CKQ A;  1YWK A;  3PMS A;  4ASK A;  4DIN B;  3WX5 A;  4FPE A;  1ENQ A;  5FP4 A;  4CEW B;  2A75 A;  1W0N A;  1AR6 3;  1AR8 3;  3KB5 A;  5CKN A;  1U12 A;  4YW4 A;  4TTG A;  2PHR A;  4GA9 A;  1VBE 2;  5C4W A;  3T2T A;  4JDN A;  4W6X A;  4Y1V A;  4QGM A;  4YVS C;  3EJK A;  5C7G A;  1F9K A;  3ZIW A;  4XAA A;  3WDV A;  3EMR A;  1KS5 A;  1DHK B;  5A3W A;  2FDK A;  3ZFG C;  1VBA 3;  2WR9 A;  4C91 A;  4JGZ B;  3B01 A;  5IVV A;  1NA1 C;  2HEW F;  4HVQ A;  5M0T A;  1WCS A;  1W9W A;  3J7H A;  1NXD 1;  4MLO A;  1MEC 2;  3RGB A;  5T55 A;  4EN0 A;  1YQ2 A;  4BQ5 A;  2W1Q A;  3AZZ A;  3J7L A;  3ZR5 A;  2IXC A;  3G7D A;  5C3P A;  1FAY A;  2VBP A;  1XNA A;  1GP5 A;  4CU8 A;  1UY0 A;  5C3O A;  2RDR A;  3C7F A;  3MYX A;  5GLT A;  3H42 B;  4UFL A;  1WKY A;  3LSE A;  1QY4 A;  3Q8E A;  1AJK A;  1S4C A;  2D6N A;  3I3B A;  1NY7 2;  1RTV A;  1W2A X;  2QFE A;  2VXR A;  2ZGR A;  1S2E A;  1LGC A;  3POI A;  3KQ4 B;  3GM8 A;  3ILN A;  5LA2 A;  5A7S A;  3N9L A;  4Q4X 3;  5F6K A;  1HRV 3;  4A6S A;  4GWM A;  1LOG A;  2VBB A;  5L7O B;  4DUX A;  1PZ7 A;  4YG3 A;  1PO2 3;  2RVA A;  1SPP B;  3KT7 A;  3KQR A;  4AED B;  4F83 A;  4QQH A;  3K4D A;  4RFR B;  5JLV A;  3N35 A;  4Q4W 3;  3WHU A;  1DQ6 A;  3MW2 A;  1RVF 2;  3Q8B A;  1UY4 A;  4FVV A;  4LTA A;  4XAC A;  1OF3 A;  1ZM1 A;  4RR3 C;  1WLT A;  3RMY A;  1XND A;  3OD0 A;  5JIA A;  5F5I A;  2SBA A;  2VCB A;  1RUE 3;  2C4X A;  4WM7 A;  3VHP A;  2QNK A;  2WII B;  2JDZ A;  4W4Z A;  2PHF A;  4JX0 A;  2WNU B;  4QB6 A;  5LWB A;  1NCQ A;  3N9Q A;  5BNP A;  3AC0 A;  2VMG A;  1ZZC A;  2WNV C;  1GWL A;  5DUW A;  1OVS A;  4QKN A;  1WW5 A;  3TAY A;  5SV8 A;  3K77 A;  3RYP A;  3WDX A;  3KWV A;  1J83 A;  3NL1 A;  3BYW A;  3GBW A;  1C28 A;  2CAU A;  2ZGS A;  4MHR A;  5FY4 A;  4D0Q A;  3HBZ A;  4IUG A;  1MS9 A;  5IW0 A;  2F4P A;  2WSU A;  4CCK A;  2FDH A;  3VDD A;  3WG2 A;  2LUW A;  3CQO A;  2VNO A;  3LD8 A;  4QPI B;  4KBZ A;  5A70 A;  1UO9 A;  3POG A;  3U78 A;  4M3C F;  1RMU 1;  4BIS A;  3UET A;  2ZGQ A;  1Q8S A;  1SHW B;  1H1M A;  3LF7 A;  3MF9 A;  4O7X A;  1UY1 A;  4ARY A;  4NE9 A;  2RS3 2;  2XBO 3;  4GWJ A;  3UES A;  2D6K A;  4FFI A;  1Q3E A;  1ULP A;  4CDU C;  3HVD A;  1ND2 A;  1ZZB A;  2JG9 C;  5F3E A;  4CEY A;  5L9V A;  3OBA A;  3AYC A;  2VUJ A;  2O8O A;  3DPR B;  5F2S A;  1JYN A;  4HON A;  4NAM A;  5CFC B;  2RHP A;  3NQH A;  3CZU A;  3TN9 2;  2G19 A;  4XHX A;  5HBA A;  2WAB A;  1OD5 A;  5A1F A;  5FZ9 A;  4AEJ A;  3WQ1 A;  1H6Y A;  1U5Y A;  2D97 A;  3VZN A;  4BU2 A;  4D7Y A;  1VRB A;  1D2S A;  4WM8 A;  5I0S A;  3B00 A;  3MUZ 1;  4XXA A;  1IG3 A;  3RWN A;  2OZJ A;  5GLU A;  5FLH A;  4BYY A;  1HV0 A;  1RUI 1;  2JIC A;  3URF A;  3FBM A;  3B5L B;  2GH8 A;  5C9A A;  4NUB A;  4UFJ A;  5FZD A;  3I2D A;  1MZ6 A;  4V1P A;  2ZEY A;  1GR3 A;  1QJU 3;  1XOY A;  3WIN E;  4P02 B;  3I2I A;  5CA6 A;  4EV0 A;  1XNT A;  4KH9 A;  2VJX A;  3B93 A;  2Q5T A;  3ENR A;  3KS7 A;  2XG3 A;  1S55 A;  4I0B A;  2YPD A;  2WWU A;  2YBK A;  2ZHK A;  1EYB A;  4K20 A;  2GC0 A;  1NE6 A;  3GZE A;  2FCV A;  2D3R A;  3RG0 A;  2JD4 A;  1SZB A;  1UYX A;  1Z7S 2;  5EP9 A;  1RMU 2;  1B09 A;  4FFH A;  4LK7 A;  1O8P A;  3POS A;  4QXH A;  4TZD A;  2FD8 A;  3AMM A;  1WD4 A;  5C3R A;  1ZBA 2;  4LLF A;  1UMI A;  2BFU S;  2H6C A;  1UZV A;  4KQ7 A;  4QHB A;  1JMU B;  4YW7 A;  3RZZ A;  3ZFE C;  4YAR A;  3QD6 A;  2WAA A;  2AZ5 A;  1OKQ A;  1OBN A;  3HPN A;  1RUH 1;  5JI7 A;  5A1A A;  3M3I A;  3WLU A;  3PL0 A;  3PVO A;  5LBB A;  1UWW A;  1RUC 2;  2B5H A;  2EXH A;  2WBK A;  4N9H A;  4XFC A;  3AB0 A;  2VMH A;  1W8U A;  2MEV 1;  3OJB A;  2NP0 A;  5B4N A;  2DVG A;  4CCE A;  4KNC A;  4AHY A;  1MQT A;  1CVN A;  3AYD A;  1QWR A;  3H0O A;  4IGQ A;  3ZN6 B;  3HAG A;  4P00 B;  1LES A;  3W59 A;  3WNL A;  1PK6 A;  3SKV A;  3UGG A;  1PGW 2;  4NR1 A;  1QOS A;  1V9U 1;  2BVB A;  1L3J A;  2TEP A;  3IZO A;  4JDO A;  2JKB A;  2P2K A;  4BB3 A;  2ZAB A;  4IEO A;  2WT0 A;  2X5I B;  2XWJ B;  4XBQ A;  2V72 A;  4PCR A;  5LB6 A;  2W92 A;  4Q4Y 3;  2CYF A;  1BVV A;  2RJK A;  4Y24 A;  1HB2 A;  4L97 A;  4RFT 0;  1ZBE 1;  1QOT A;  4MXW B;  3R0R A;  3T3Y A;  4Z8B A;  4XUP A;  5FYZ A;  1E5S A;  4WZF A;  3UKV A;  5JDB A;  4N43 B;  3CEW A;  1BJQ A;  2A6Z A;  5CKM A;  4NRP A;  3KVB A;  1PZ9 A;  5KXC A;  3KLS A;  4Y22 A;  1ODM A;  1DGW X;  3OEB A;  1XBF A;  3CJI C;  3NW4 A;  1Q8O A;  3KCY A;  1UKG A;  1A78 A;  4R8H A;  5FK8 A;  2ZKN A;  1QJX 3;  5HXV A;  1EAH 1;  1SLB A;  2RG4 A;  5IVY A;  1NOV A;  4D7T A;  4LXL A;  5ACA 3;  2MNG A;  4DZG A;  4IEP A;  2RE9 A;  1YEW A;  1C57 A;  1CAU B;  1F2N A;  2YFU A;  3QCW A;  4D3W A;  1DLL A;  2HWF 1;  4SLI A;  4XFB A;  2EIC A;  4O65 A;  1UOF A;  2Q1F A;  3U14 A;  4WBB A;  4DXZ A;  2B4K A;  3PTR B;  1UOB A;  3ZSL A;  4K21 A;  2ZMK A;  1IGO A;  3MIG A;  1RUG 3;  1GKB A;  4JKM A;  1HRI 3;  3VHO A;  4XCB A;  2YBS A;  4DXR A;  1O3S A;  2W2I A;  4GMP 3;  5A80 A;  1JYV A;  5CG8 A;  4IEY A;  1W03 A;  4ZXE A;  1V9U 2;  2EIB A;  5FKB A;  5GLW A;  4AFM A;  1JOJ A;  1SQ4 A;  1QJY 3;  4COU A;  1OOP A;  1T2X A;  3OYW B;  1ZBE 2;  3OGV A;  4P08 A;  1W9Y A;  5IUQ A;  2A3W A;  3VBH A;  4ASM B;  1FYU A;  2Y26 A;  1PVC 3;  5KC6 A;  1WA6 X;  4WV8 A;  2C26 A;  3I2G A;  1C8M 2;  5LW9 A;  3WVJ A;  3F2Z A;  1FI2 A;  2TBV A;  4CUC A;  3LSD A;  2CAV A;  1JS9 A;  4ZKT B;  2NYY A;  2IZW A;  3ACH A;  1YI7 A;  4PBP A;  2TNF A;  4TLG A;  1JYW A;  4XDO A;  4PLO A;  5A6Y A;  4HK9 A;  1JYT A;  4NII A;  1S2K A;  4I09 A;  2VZT A;  4P9W A;  2VNV A;  4RHV 1;  5FZL A;  5IAV A;  4AWD A;  1AXZ A;  4E2S A;  3VBF B;  5CYY A;  1LHW A;  1C1L A;  3GCX A;  3PU3 A;  3IPV A;  1WW4 A;  1XJA A;  1QOO A;  1D4V B;  1VAK A;  3SMH A;  3UK9 A;  5C3S A;  4YW1 A;  2WZ8 A;  3KT4 A;  4CP9 B;  2YPJ A;  4LA2 A;  4UWD A;  4XUO A;  1WA4 A;  1GQH A;  2PAM A;  3ZR6 A;  1AR8 2;  4QM9 A;  1UYP A;  4LUM A;  2WS9 3;  1WZX A;  4OLL A;  3CO2 A;  2YBP A;  4WVM A;  3N36 A;  5K0U C;  2QVS B;  1Q5O A;  3LFM A;  4DMI A;  2ZMN A;  4OI1 A;  3L2H A;  2Y6J A;  2OA2 A;  1HN0 A;  3PVN A;  3VBS A;  1YJK A;  1QKQ A;  3CNA A;  2VZO A;  1YQ5 A;  4NHL A;  1O4T A;  4JHZ A;  3KM5 A;  1RUJ 2;  3B02 A;  5DAX A;  2XUE A;  1HW5 A;  5FZB A;  2WZE A;  1PZ8 A;  5LBC A;  4YSF A;  4X8P A;  1ZZ9 A;  1WME A;  4PF5 A;  1UIJ A;  5FZC A;  3AK0 A;  5J96 B;  1W8W A;  2ZGO A;  1QEX A;  2W95 A;  2XL7 A;  4PLM A;  4AVT A;  2R07 3;  1Z78 A;  1DGW A;  4GWN A;  2D5H A;  3K2O A;  4XQD A;  4CEW C;  3S5A A;  4V2V A;  1JH5 A;  3WUD A;  4B4R A;  1AUY A;  4XQ4 A;  1YQ6 A;  2ARB A;  5EFU A;  2RV9 A;  2FDJ A;  4UXA A;  1R09 3;  3N9P A;  4COZ A;  4PIY A;  3FL7 A;  4GZ9 A;  1QQP 1;  3V0B B;  3ACF A;  4E4D X;  5ABJ B;  4R9C A;  1FNY A;  2IXK A;  1W99 A;  2VZ1 A;  4AAX A;  4NJ4 A;  2NMN A;  3AKQ A;  5FZK A;  1COV 3;  1VE0 A;  1IPJ A;  4JGZ C;  3JZV A;  2Q8E A;  5FO8 B;  4NMI A;  1ND3 A;  5A3O A;  2VZR A;  3O1R A;  1GQG A;  2A3X A;  2E26 A;  5KHH A;  4AEK A;  3E1F 1;  2JIJ A;  1RUD 3;  4GKX A;  4FCA A;  3MIC A;  5I0U A;  3W5N A;  3ZLI A;  4YWA A;  3MZH A;  1Q8Q A;  4KGQ A;  4JGY B;  4AOC A;  2CTV A;  2UYA A;  3SKJ E;  4FOW A;  5IFP A;  3RZJ A;  1W6Q A;  4Q4W 2;  2A6X A;  1DGR A;  3BPZ A;  3BCW A;  3M3O A;  5A7W B;  1AVB A;  4LBQ D;  2PAK A;  4UW6 A;  2ZGK A;  4M3C A;  4UW4 A;  2BW8 A;  2XVG A;  4LBQ B;  1FMD 3;  2F4L A;  1R1A 1;  2IVJ A;  1C4R A;  4HKL A;  1JZ3 A;  1S1A A;  4AVC A;  2GC2 A;  1GAN A;  1JUI A;  2BWC A;  5L7O C;  3UYJ A;  3KV6 A;  4FPO B;  4AL9 A;  3ATG A;  3HBK A;  3PUQ A;  1ONA A;  4NHY A;  1B35 B;  4HVO A;  5I8S A;  3ZFF B;  3WG1 A;  4CP0 A;  4DEV A;  5BNO A;  5CFD B;  5G05 L;  4AED C;  1RUF 3;  3ZXA C;  1ENR A;  5GAL A;  1W04 A;  1WCU A;  4FTS A;  1Y9G A;  3ZYP A;  1QQP 2;  1SLA A;  4COY A;  1JU3 A;  2P34 A;  4YG6 A;  1NG0 A;  4P5Y A;  4CU7 A;  2JDP A;  5HV0 A;  3I3D A;  3EBR A;  2WNU C;  4NO4 A;  3RWK X;  4AGG A;  5F7U A;  2OW4 A;  2P3K A;  3WSO A;  1PIV 1;  4XF0 A;  4CDW A;  4ERO A;  3VL8 A;  3JD7 3;  3LDK A;  4PBO A;  3O14 A;  3NV4 A;  4TLF A;  2XXZ A;  2R0H A;  1FXZ A;  5IYY A;  2XJT A;  1OA3 A;  4Y3O A;  3MBW A;  2BNO A;  2XHN A;  4HN0 A;  3AZV A;  2NPI A;  4Y4R A;  4YZ4 A;  4EQV A;  2Y34 A;  3B94 A;  3HIF A;  5FK7 A;  4LMF A;  1EUU A;  4OVE A;  1FPN 2;  1CAW A;  3P1I A;  4ZS2 A;  4QPI C;  5FZO B;  2RM2 1;  2ES3 A;  4A3Z A;  4UW5 A;  1IG0 A;  5FRA A;  4ZZ8 A;  3WW3 A;  4ATF A;  1JZ5 A;  5IK7 A;  4H7M A;  1HN1 A;  2BU9 A;  1R1A 2;  2OQ7 A;  2VMD A;  4IER A;  3I59 B;  2ZOE B;  4BQY A;  1JXN A;  3LFI A;  1IOA A;  4RN5 A;  1U0A A;  4IGO A;  4P9G A;  2W0X A;  2DVB A;  4XMI A;  2ZX2 A;  4G3Y C;  4BM8 A;  1AYN 1;  4MGK E;  5DQ0 A;  3DPR C;  1ZA4 A;  4Z1V A;  5CFC C;  2WT1 A;  2W46 A;  3UL2 A;  1O6U A;  5F1R A;  1YFX A;  1K5M A;  1PX3 A;  2R06 3;  2CDO A;  4H14 A;  3RZG A;  5F3C A;  2UWB A;  1W8H A;  1O3Q A;  4HLT A;  4MOA A;  4CDQ A;  1UYZ A;  2EID A;  2P3J A;  5C5U A;  4IE7 A;  5C33 A;  2CNA A;  1S0D A;  5FIX A;  4OI0 A;  1TMF 2;  3HNM A;  3D3A A;  3IMN A;  5JOX A;  2YZ4 A;  4A2U A;  2BEO A;  1O3T A;  2Y6L A;  3CJX A;  1XNB A;  4XQW A;  4A7Y A;  2HYK A;  2I2S A;  3DEM A;  4HZF A;  3AKR A;  2GSY A;  5D2A A;  1GP6 A;  1QHD A;  4UF0 B;  1PIV 2;  3A0N A;  3ORJ A;  2BYV E;  4XHB A;  4LE3 A;  2HWD 2;  5FBZ A;  4AXO A;  4ZU4 A;  3CZJ A;  3AKP A;  5GKA C;  5FOB B;  1Y9Q A;  3U4X A;  1QDO A;  4URT A;  5CNA A;  3VBR B;  3W21 A;  5GZC A;  2WQ8 A;  3IDC B;  1HB4 A;  4LHS A;  1JTZ X;  5C8C B;  1W8Z A;  1D7P M;  3WQB A;  2AAC A;  3O1U A;  2IXJ A;  2DFB A;  4RYD A;  4KWU A;  1RB8 G;  4RQP A;  3ZN5 A;  4IEW A;  2QQL A;  3J8F 3;  1N1Y A;  4LKE A;  4E2G A;  2PLV 2;  4HPK B;  5ANQ A;  1ACC A;  5E1R A;  5JXI A;  2XJS A;  2BZD A;  2Z69 A;  4FFG A;  4NRO A;  3BOD A;  4EYU A;  1CPN A;  1H4H A;  5HXM A;  4K1Y A;  5LA0 A;  5A7Q A;  1QNW A;  2ZX0 A;  3VBU B;  3ZYG A;  5F9T A;  4PI0 A;  1KFU L;  1AYN 2;  2D6L X;  5KXB A;  3POY A;  4Q0V A;  3DL3 A;  3D8C A;  1DIW A;  1V6I A;  1YFU A;  3C7O A;  3MDP A;  3ZN4 A;  3K4A A;  1SCS A;  2C1F A;  1DZR A;  3ILR A;  3GZA A;  1QXP A;  1RIN A;  1S2B A;  3IN9 A;  2ZAC A;  3SCH A;  4XFF A;  2VOK A;  3MV0 1;  3KV5 A;  3ZYR A;  5E88 A;  3C2U A;  3ZXE A;  4IV3 B;  2G1M A;  1KIT A;  2IXL A;  2ZGM A;  2WUH A;  3T4V A;  4L99 A;  3ZDS A;  3QH7 A;  1OUX A;  4AI1 A;  3FN9 A;  5DXD A;  5BPX A;  3H3U A;  3S57 A;  4B1M A;  2QQN A;  1S0J A;  2X5I C;  1W2T A;  3N9O A;  1AL0 G;  5FZG A;  4QPG A;  5K4L A;  4URA A;  1H6X A;  5DPN A;  5LK5 A;  4AR2 A;  1O4Y A;  4LBK A;  5FZM A;  5IWF A;  4I01 A;  1Y7B A;  3IBM A;  4IE5 A;  3TNQ A;  3MEP A;  4X8N A;  3RYK A;  4A7Z A;  1GFF 2;  4QGN A;  4YNI A;  4N43 C;  1EV1 1;  2OS2 A;  1CJD A;  2PTM A;  2R32 A;  1SLL A;  3VHN A;  1EPW A;  1OC1 A;  1VIW B;  3DF0 A;  4AHX A;  3O7O A;  1LOF A;  4H3W A;  4IEZ A;  1RUG 2;  4CUB A;  1BMV 2;  3S5Q A;  5FXZ A;  3SEP A;  2JEM A;  1DQ2 A;  2ZAA A;  2JDU A;  3JQW A;  1URX A;  4ORF A;  2XOM A;  5FKC A;  1R08 3;  2P17 A;  1ULO A;  1TME 3;  3E5U A;  2OX0 A;  4FI9 A;  1DG6 A;  3KHC A;  2RMU 1;  5FOJ B;  1WCQ A;  4PQQ A;  4QX0 A;  1YCI A;  4R4Z A;  3WY6 A;  3AL6 A;  4B4Q A;  4DUW A;  2R0F A;  1RUI 3;  5LA1 A;  1LJ7 A;  3SH3 A;  2X10 A;  1UL9 A;  1JI6 A;  1W05 A;  3VKO A;  2RS5 3;  4YVS A;  1VRH 2;  5FYV A;  2VME A;  2VZQ A;  4FFF A;  4CU9 A;  1HQW A;  1DFQ A;  1W8O A;  2WWS A;  3N9M A;  1UAI A;  3OF1 A;  5JMC A;  1EP0 A;  3I2F A;  3ZFG A;  2VEC A;  5FY9 A;  2W1S A;  5F2W A;  1NA1 A;  2DCJ A;  4PT6 A;  5FYC A;  3FZ3 A;  3ES4 A;  2O0O A;  2ZGL A;  1BK1 A;  3D0J A;  2VD7 A;  5A7N A;  1PX4 A;  2VQ0 A;  2XJQ A;  2H0V A;  1OH4 A;  4OQ9 A;  4LO4 B;  3BUC A;  1MR5 A;  4HOO A;  4YGB A;  4OZX A;  1UOG A;  3B69 A;  4DRV A;  2W39 A;  1W6P B;  1VBE 1;  4CPB A;  4B8E A;  1BCX A;  1DBN A;  2ZAH A;  5FJH A;  5EZW A;  2W47 A;  3HT2 A;  3FX3 A;  1VBB 1;  5FTT C;  3WF1 A;  2I45 A;  3O1O A;  2J7M A;  5T52 A;  2WT2 A;  1VBC 3;  1V6M A;  2WRA A;  2WS9 2;  5JOY A;  4JTO A;  3PVB B;  1A8D A;  3CL1 A;  5FDB A;  4I0A A;  1MAC A;  2MEV 3;  4W50 A;  3FJS A;  4TN7 A;  3ZSJ A;  5IK8 A;  3OOX A;  2R04 1;  3LIG A;  3VZK A;  4DO0 A;  3U11 A;  1OPO A;  3VBF C;  3B3Q E;  1CN1 A;  1OQD A;  1TEI A;  2ZTN A;  3H1M A;  5L9B A;  2V5Y A;  4CP2 A;  3DXT A;  4AVS A;  5AC9 3;  5KHK A;  4XOG A;  2E33 A;  2C9A A;  4Q5O A;  1QIQ A;  2VZU A;  4GIQ A;  3RS6 A;  2JDH A;  4DEQ A;  4RR3 A;  1MVE A;  1XC6 A;  4I0W B;  4XCA A;  5FPA A;  1UU6 A;  1XU2 A;  4R9D A;  1E5H A;  5IFT A;  2UYB A;  1ZZ6 A;  4JRL A;  4YZ5 A;  2VO5 A;  1QXR A;  2ADE A;  4HVR A;  3VLB B;  2OYZ A;  1D0H A;  2WKK A;  4CUA A;  5A3M A;  3IWZ A;  2WNV A; 
#chains in the Genus database with same CATH homology
 5M0T A;  4JZR A;  2G1M A;  3OUH A;  4NAO A;  3GZE A;  2FCT A;  2FCV A;  5HV0 A;  5EP9 A;  5EQU A;  2FCU A;  3MGU A;  5ERL A;  2RDR A;  3OUI A;  2Y33 A;  5IAV A;  3NNL A;  4XC9 A;  4ZON A;  5C5T A;  3W20 A;  5LBF A;  3PL0 A;  5HV4 A;  2Y34 A;  3KT4 A;  3ITQ A;  5LBB A;  4UWD A;  5EPA A;  3OBZ A;  3KT7 A;  5DAW A;  5LA9 A;  4ZPI A;  5LAT A;  2RDN A;  4BQY A;  4NHK A;  4XAC A;  5LBE A;  4NHL A;  5DAX A;  3BVC A;  5LB6 A;  5LBC A;  2JIG A;  2HBT A;  2RDS A;  4IW3 A;  4NHM A;  4BQW A;  3NNJ A;  4MHU A;  2OPW A;  2V4A A;  5C5U A;  3GJA A;  4MHR A;  4Y5T A;  5L9R A;  5A3U A;  5LAS A;  4Y5S A;  2RG4 A;  2RDQ A;  4KBZ A;  5DAQ A;  3HQR A;  4BQX A;  4NMI A;  3W21 A;  3NNF A;  2JIJ A;  3DKQ A;  4J25 A;  5IAT A;  3HQU A;  4NHX A;  4XAB A;  5L9V A;  3NNM A;  5IAX A;  4XCB A;  2G19 A;  2A1X A;  3GJB A;  5L9B A;  5DAV A;  4Q5O A;  3OUJ A;  3KT1 A;  4XCA A;  4XAA A;  3EMR A;  2HBU A;  4NHY A;  5DAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...