5IAXA

Mechanistic and structural analysis of substrate recognition and cofactor binding by an unusual bacterial prolyl hydroxylase - co-bap4h-ppg
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
199
Chain Sequence
EQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVDVNDIAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYKPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Procollagen-Proline Dioxygenase
publication title Bacillus anthracis Prolyl 4-Hydroxylase Modifies Collagen-like Substrates in Asymmetric Patterns.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 58
structure length 199
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5iaxA01
2V4AA 5IAVA 4XC9A 5DAQA 5LBFA 4NAOA 5EP9A 4XAAA 5LA9A 5DAWA 2RDQA 3BVCA 5LBCA 3NNLA 3OUIA 4J25A 5DAXA 4XCBA 2G1MA 4Q5OA 5LASA 3OBZA 3HQRA 3PL0A 5EQUA 4IW3A 5C5TA 2FCUA 5LBBA 5L9VA 2RDSA 3OUJA 4Y5SA 5L9BA 4XACA 3GJBA 3DKQA 4NHLA 4BQYA 3NNJA 5L9RA 3HQUA 3EMRA 4NHMA 4UWDA 3ITQA 3NNMA 2JIJA 4ZONA 2OPWA 3GZEA 4XABA 5C5UA 2RG4A 5IATA 4BQXA 5HV4A 2JIGA 5M0TA 5HV0A 4NMIA 2HBUA 4JZRA 2RDRA 3OUHA 4KBZA 3W21A 4Y5TA 4NHXA 2A1XA 4ZPIA 5ERLA 3KT1A 5LB6A 5A3UA 3MGUA 3GJAA 5DAVA 3KT7A 4NHYA 4XCAA 4MHUA 3KT4A 2HBTA 2Y34A 2Y33A 3NNFA 5DAPA 4MHRA 3W20A 5LBEA 4NHKA 2FCVA 5LATA 2FCTA 5EPAA 2RDNA 2G19A 4BQWA 5IAXA
chains in the Genus database with same CATH superfamily
4BQ2A 5FY8A 1RUH3 2GNTA 1L7LA 3AM2A 4Q4Y3 5FY5A 5IVFA 4EV0A 5BUVA 1IQAA 1PIV3 4NVPA 1HV0A 3D82A 4AR2A 4FO9A 2JKXA 1ZBE2 2YFUA 2A3XA 4B4QA 1BVVA 2PHXA 2AZ5A 2RJ2A 4XVHA 2HWE1 2YGLA 2GC2A 4FPYA 2RDQA 1X50A 3K51A 1DGRN 2BZDA 1VBB3 5F3GA 3THCA 2VXRA 2XKOA 4XF1A 4IEXA 4I0WB 2Q1MA 1KRIA 2EXJA 3PUHA 4CP9A 1OH3A 5L36A 5AC92 5A6QA 3HQRA 5GJ6A 1P8JA 1SBDA 1JI6A 2VJXA 1ALYA 1VAKA 3O1TA 5L7OC 2MEV2 2QDRA 4AGVA 4Z1VA 1QDOA 3Q8BA 1VBA2 5FPLA 1IPSA 3NMBA 3LKJA 5L9VA 4Q4V1 3OG2A 4ET7A 2K0GA 2RDSA 2RR12 3ZX7A 5JVVA 2FDIA 1UD1A 2E6VA 1QJU3 1K45A 4IV1A 4UBGA 1GOGA 1ND3A 2VTXJ 3HBKA 4LBJA 3WDYA 1JMUB 3H7YA 3ACHA 3ZSKA 2RS52 4M3CB 1CIYA 3KZ4C 3B9IA 4W8JA 2BVBA 3KQRA 4IGOA 2V73A 4TN7A 3OSDA 1AUYA 1GKBA 1NX9A 2A70A 5DQ0A 5T3NA 4CRQA 1V6IA 3K4AA 4Z82A 1F5JA 1X8MA 3QOPA 3WDTA 3HT1A 1NAEA 2PAKA 3FN9A 1OURA 4XHXA 2VCMA 2F4LA 4P9GA 3RYPA 3ZYRA 3FX3A 4M3CF 3ZKUA 4QQ2A 1UY0A 3RG0A 5JXGA 1T2XA 2GH2A 5C4WA 4UAPA 1AR83 4XIKA 5FO9B 5FLIA 4HVOA 4L2NA 2ENRA 5HXVA 2C9AA 1N47A 1W39A 2ZGNA 4BCUA 4CVUA 1JZ5A 4AEJA 2VMIA 4YW4A 5A3WA 3GYDA 3CL1A 4FQ4A 2O8OA 2E9QA 5J96B 1US3A 4LHNA 4DXRA 1S4CA 5FPXA 3JZVA 4Y5TA 1KJRA 1MZFA 1U5ZA 4LIUA 1Y9QA 3B94A 4HN0A 5EHDA 3T4VA 3U37A 4CCCA 5FP4A 1VALA 2HWB2 3EB7A 4QDRA 5T5OA 3MO4A 1S55A 4N7IA 5ERLA 4FVVA 1CZVA 4FFIA 5CFCA 1CR7A 2HLEA 2J7MA 2ZGSA 3RZLA 1AYN1 1KDMA 4QX0A 4HBNA 2JICA 1K12A 4MO3M 3VGIA 4COUA 2J1AA 4XCAA 1KEXA 3LE0A 2XLGA 3RWNA 4G3YC 3KT4A 2X5IC 4P9YA 1DQ5A 3RPQA 4C1XA 2R071 5IVVA 2XWBB 4GJZA 5F3IA 3VD4A 3AYEA 1DDLA 3PNAA 1PNGA 4CE8A 2V5YA 4Q4W1 5F1RA 3WW4A 3FHAA 1MQTC 1KXGA 4Q1PA 4GMP3 3G6JB 2WNVA 1B09A 1IG3A 4OVEA 3DN7A 3WW3A 2XKPA 5EYYA 1QQP3 1XNKA 4YM0A 1O4YA 1Z0HA 2DDUA 1RUOA 2P3JA 1WBFA 4BK5A 4JAAA 5A7OA 3LSEA 5C8CB 1VMHA 5DAQA 4KBBA 1RVF1 4H55A 4DFSA 1CPNA 2VO5A 1JYXA 4QHBA 3LEIA 2VTXA 3JBG1 3O1PA 1AR93 1R083 3WR0A 1BHGA 3AL6A 3GHMA 3RZHA 1W9SA 1POV1 1DYPA 1N1VA 1PO13 1ULPA 4O7XA 1SG3A 2CGPA 3AP7A 4DXTA 2DVDA 1OMIA 4OHXA 4A6SA 3CDZB 3KV9A 5K0UA 3RI8A 4JQRA 2E53A 5IWFA 4Z2WA 5T5PA 3N9PA 3I2FA 2MNGA 4JV4A 4BXFA 2YROA 1FX5A 4Q5OA 1COV1 3VBUA 1OLQA 5A1LA 3VDDC 1TZOA 1NCRB 3NV2A 3RDIA 4IV1C 3ZIWA 3VKOA 1ND3C 2VBBA 2VCBA 5CU1A 5JDBA 1GLHA 4DB5A 4Y4RA 5JOYA 3E6DA 2RS12 1CD3G 1ZBE3 3CQOA 5K9YA 2DTWA 2QZ2A 3AP6A 4HL0A 3GZTB 3GJBA 3AKPA 1S1AA 3JB8A 4NR1A 3ZSJA 4CEWB 4L99A 3RGBA 5JOXA 1C5HA 3U0ZA 3E97A 2VNOA 2RM22 1W04A 2FQPA 3UGGA 2OPKA 2V09A 1AL22 1GSLA 1NA1B 4N43A 2XMLA 4Y22A 3T1MA 5I8TA 4AFAA 1UN1A 3ITQA 1F5FA 2DUPA 5A3LA 2XHNA 3HNBM 3PHMA 1OOPC 3QH6A 4P9WA 1AXZA 1LEMA 1QNYA 5K4LA 2DURA 4A2UA 5AC93 3DYOA 4I3GA 4DY5A 5J48A 3K46A 4IESA 4H2AA 5FFOC 1K3IA 1NUKA 5CVRA 5FUIA 1EPZA 1VBA3 1BQPA 2EIBA 3AMMA 3CEWA 1YFWA 4TLGA 3U10A 3HOBA 2ARBA 2RR13 3KMHA 3MF9A 2A6VA 4O9GA 5HI0A 2H0VA 4LEJA 4PF5A 1RUJ1 4AI0A 1LOBA 1YQ5A 4CDWC 2VD7A 1HKDA 4AI9A 3H42B 1U5YA 2RS53 4J1XA 4HK9A 1OA4A 3MICA 5G04L 1X9PA 3J7MA 2PAEA 1QJFA 3KS7A 1OSGA 1UOGA 1H8TB 5J98B 3C7GA 2VPVA 2ZGUA 4A41A 5FQ0A 1L3JA 1W28A 1GNYA 1R091 2DCTA 1ACCA 2ZEWA 5FZBA 1BCXA 5FZFA 1VRH1 3H3UA 3MZHA 4FI9A 2F4PA 2VL4A 1WUVA 1W9YA 4O65A 2OS2A 4GD4A 3ZMNA 5CB7A 3W9AA 4JGYA 1VB2A 2CU5A 2WFPA 3ZXDA 1Q8PA 2DF7A 2J1RA 3M3OA 2VCAA 3JD71 4AG4A 1MPXA 1YFUA 2WNVC 4YM3A 1UXZA 2W3JA 4GJYA 1LOCA 4RA0A 2FCVA 5FPZA 4FTBA 2DVAA 2WO1A 3ON7A 5IUQA 3ILFA 3RRDA 3TN92 4MV2A 1YI9A 1EUUA 1TMF1 3UGHA 4CCKA 1K5MA 2QKDA 1NQDA 3ZSMA 2HWB3 5LEKA 4A7KA 1WLWA 1BK1A 1UKGA 2WZR2 1UYYA 3AMHA 5FY7A 3VKNA 2YPJA 5CADA 4PQQA 1FPN2 2GZWA 4D7SA 1H2KA 4HPKB 3ZSLA 3MIDA 1J58A 4M0NA 3UJQA 3MIGA 5A3MA 2WQ4A 5K0UC 1TME2 1XE7A 4QX7A 1UU5A 3B00A 1XSRA 1ULFA 5LA2A 5C9AA 2VMDA 4CPBA 5KR7A 5DAXA 1FMD1 1REDA 4B1LA 2ARAA 2DUOA 3DF0A 3CMGA 1FOD2 4CDQA 2DU0A 3I2KA 2R32A 5I0UA 2CY6A 4MOAA 2BBVA 1BZWA 1YIPA 1DZTA 5CBLA 4TSVA 1V6OA 2YBKA 3M7AA 5DUWA 4OHWA 3LDRA 4OZOA 2VM9A 2PXJA 4XPVA 3VHNA 3MEPA 1AR61 5FIXA 3ZFGA 2J42A 3I3BA 1LB2A 4Q4X3 4N43C 2GALA 3WNPA 1NCQC 4XUTA 1JUIA 1W8FA 5I0RA 4PDWA 3DL3A 4OULA 4QX2A 4YW7A 2XONA 1YXWA 3IDEA 5FREA 4KG0A 1PO22 1O8PA 4GWIA 5LEJA 2CNAA 2XJPA 4Y20B 1GFF2 3GBWA 1WKYA 3VD7A 2DCZA 2C5DA 4BB3A 1JOBA 3IT8A 4AFCA 3WP5A 1SLAA 1XPWA 2ADEA 3DPRA 3J8F2 3ORJA 5FP8A 5F5CA 2E7TA 3GZEA 1J83A 3FZ3A 1KD7A 2XGXA 4QKNA 5DUVA 5FY0A 2JB8A 4QHZA 4QX5A 5F5QA 1Q8VA 2IXKA 2WR9A 4BMBA 5DMYA 5A3OA 2R041 2RS13 1RJ8A 1CPMA 4DUVA 5HV4A 3PUQA 5FR3A 5IK4A 2PN5A 3GALA 1ZRDA 1HQNA 2EIDA 4NMIA 1U5IA 1XYOA 3DXTA 1LTEA 2VQAA 3HEIA 4JZRA 3OUHA 4LLOA 4PIYA 4Y1ZA 5FY9A 4LNVA 2AYHA 1I6XA 3CZUA 1A3KA 4W50A 1D0GA 3SH4A 1AL23 3OBRA 4H7LA 1EUTA 2IUWA 1QH7A 3PVNA 5FK7A 1OUSA 2XJSA 3M70A 2CHHA 2X05A 1WMFA 3OGGA 4UT5A 5H9SA 1SHWB 3H50A 5LRSA 4JGYC 1AR72 4I3PA 3OGVA 5DAVA 3M2MA 4K6BA 1W6NB 4RS5B 4FPHA 3FUOA 3HWJA 1B35B 1FV3A 5C71A 4W4ZA 5IFPA 3BU7A 3GF6A 4XW3A 2XG3A 4GA9A 1QJY2 3WW2A 1CQ9A 1W6OB 2E33A 3WCRA 2LALA 1PGL2 4YW6A 3D0SA 5CFDB 4NWWA 4XMAA 1GU3A 1UZ0A 5JMOA 2Q1ZB 1W2AX 3ILNA 2RE9A 2BNMA 3POJA 1ENRA 5JSRA 2Q8DA 1DQ2A 5JXIA 2O1QA 4WVZA 2P2KA 4FTSA 4E4HA 3W59A 4CDXB 4S2GA 5EPAA 2W68A 4JDOA 3NKTA 4Z07A 4QAWA 4RHV3 3HJRA 4LQRA 1UIJA 3RYKA 1WLDA 1W6QA 2ZX0A 1JOPA 1N1TA 2ZMKA 1N3PA 2W95A 5E88A 4TYSA 3AYDA 3P6BA 3I7DA 1W2TA 2QQNA 1AZDA 4A4AA 4M3CE 5C9AC 1R64A 5DABA 1R1A2 1V00A 2ZACA 4PI2A 4RN5A 4ZS3A 2FDFA 1IOAA 1KITA 1JU3A 1Q56A 2XUMA 4XJUA 2YU2A 3T0BA 4CDQC 4YZ5A 4XF3A 2D6MA 2WNUA 2WN3A 2A73B 2VG9A 4FOQA 1ZVFA 4YW3A 4IE6A 2RMU3 3TN93 4P14A 5IVJA 2G4IA 4NWVA 4YM2A 4GH4A 2ZGQA 1EAH1 5KBFA 4Q27A 2WWJA 1QMJA 4URAA 5A32A 2EIEA 2WZR3 2XBO1 1JHJA 2CTVA 4QX3A 2VZSA 2PA7A 1JOJA 4V2WA 5T5JA 1W6MB 3ATGA 1VJ2A 4IE7A 2ORXA 3T3YA 4EN9B 1F2NA 3UL2A 3IKWA 4WM8C 1LKNA 3NJYA 3IBMA 4BYYA 2ZKLA 1L7RA 2DV9A 3CJIA 3OD4A 3R0RA 3FJSA 2ZGOA 1TME3 2G9ZA 3MHZA 4N53A 5EJ3A 4NHLA 2AC1A 4YVSA 5KHGA 3DPRC 1OKOA 5IFTA 1US2A 4JKLA 4LE4A 1WZXA 1UZVA 2IXCA 1WMXA 5E8AA 1FOD3 1POQA 3V0BB 3U11A 4WM7A 3DEMA 3PIJA 2E31A 3B93A 3CLPA 4AHZA 3SC7X 5DN2A 2GP3A 3V65A 5A33A 1XU1A 3W21A 4HKWA 1DHKB 5C5UA 2A7AA 4P02B 2RG4A 2VUAA 5EWSA 3WEZA 3URFA 4LBQA 1QOTA 4RGGA 4LKFA 2JWPA 4EWAA 1IS4A 1AYM1 3NV1A 1SLBA 1DLLA 2ZEZA 4SBVA 4Q8KA 4XTPA 3VL9A 3PDQA 1W8ZA 1RUH1 1PO23 3H3ZA 5L73A 3HMYA 4R9BA 4DZGA 3KM5A 1C8M1 3OB8A 5GLZA 1VRBA 3UETA 1KGYA 5FZ0A 5BNNB 1YJKA 1ST8A 4FSJA 3WNXA 2KM2A 4HVRA 4RR3A 2GP5A 3J8F3 1CAVB 1H9PA 3ES4A 5LY1A 1VBB1 3SISA 1RUC2 1UKRA 2OT7A 2ZZQA 3V0AB 4PBPA 1RITA 4CA9A 4GKYA 3BI3A 2VR4A 5DZGA 5I8YA 3CKHA 3DUIA 3ZVXA 1A6CA 4LA3A 5IK7A 5A6YA 1VIWB 3M3EA 2OQ7A 4META 4BOWA 2QDNA 1DF0A 4OMDA 2UWCA 2WC2A 2F6BA 1JYWA 1Q8OA 2I07B 4EROA 4WZFA 3VBOB 2CYFA 1PGW1 2VAUA 1JXNA 1AR73 1W8WA 3LA7A 4L8QA 3LB9A 3MFAA 1V6MA 2NMNA 4XETA 3USUA 1F9KA 4JRAA 3TYJA 5FJHA 3LSDA 1ONAA 2RV9A 1QJY3 4XJWA 3RJRA 4CXWA 4LKSA 2E26A 3DXUA 5FMDA 4JGZB 4XAAA 2DCYA 4AE2A 3ZN5A 4LOSA 1W03A 2VC9A 2OIIA 2VQ0A 2Y26A 5LWBA 4AVVA 1LHOA 2HYXA 2RS31 2BYVE 4HZFA 1NQJA 4QB6A 4XZPA 2VOVA 4YG3A 5FP7A 1LGNA 3V56A 1ULGA 2P34A 3ZKYA 3L2YA 1V6KA 1JH5A 1WMDA 2QQWA 1GQPA 2W92A 3ZMOA 2K2SA 5FOJB 4QU2A 2OUHA 5FCCA 4UF0A 4NIIA 1HRV1 3LEGA 1UYPA 4OHZA 1VBE2 4AQSA 4ZZ8A 3UESA 3M8LA 2ZGLA 4YVSC 4Z8BA 1OD5A 3ZFFB 1O5UA 4QXCA 1R1A3 1YCIA 2W1QA 2ZBJA 3J4UH 5C8CC 2AUYA 1NY72 4FOWA 1SZBA 3QH7A 5G05L 3G7DA 2P4EA 2F17A 4JRLA 1MVQA 3AYCA 3I2JA 3WQ1A 5FZ6A 4UFKA 3HD8B 4OQ9A 1BBT1 1VMFA 4CTEA 4DIQA 4AFMA 5JSPA 2JIJA 4J1WA 1XQNA 3CF6E 1W90A 4LO7A 2Z5WA 4W65A 3E5UA 2VOTA 1DGLA 1G7YA 1UZWA 5ACA1 2I2SA 4ZU7A 3IMMA 5D21A 4NRQA 4K3UA 5FPUA 3SMHA 1NCRC 2YHJA 4ZU5A 3VBSB 1DP0A 3Q8FA 1QQP1 2JKBA 1HJFA 5L7OA 1Y9MA 4YVWA 5DDJ1 2HBUA 5ANQA 3ZPYA 2TBVA 1C3HA 4MXWA 2BGOA 2WT0A 5CZKA 2CV6A 4UW5A 3VBHB 1S0FA 5IK5A 3JXSA 4L0PA 2NYYA 4CEWC 4LBMA 1Y4WA 2GMMA 2GSYA 3IZOA 2WZPP 2B9UA 3ROUA 1ENSA 4WZCA 4QB2A 4IGPA 1XNDA 4MADA 4NAMA 3WV6A 4AWDA 3WHTA 3C7EA 5GZGA 1XC6A 4Z2AA 2FDGA 2VUDA 4CP1A 5GLUA 2HEWF 1W99A 4Y20A 3C2UA 2WINB 1AL0G 2HBTA 4DUWA 1MS9A 2JE8A 4N90A 4LK6A 4MHRA 2P6CA 3IAQA 5C7GA 4GWNA 1XYPA 4MGIE 2P3IA 1QGLA 2WWSA 1CJPA 3AXEA 3U78A 4LPLA 5GKAC 3BN6A 1CVNA 3LEKA 1YHFA 2PLV2 3LFMA 1W3VA 3MW3A 4ORFA 1RUC3 4HANA 1H1AA 1OUXA 2VZQA 1VR3A 3INAA 3MF6A 4FXGB 1GNHA 3N9MA 1A8DA 2XR4A 4Y4YA 2FBEA 3WINE 5I0DA 3VHOA 5J37A 4ASMB 4ZZ5A 2ZAHA 5EJ1B 4FQZA 1SFNA 1ASJ1 5E16A 1DYOA 2A6YA 2R7EB 4QPGA 4XEZA 3WVJA 1REEA 2PHFA 5C8WA 1VBC2 1QJX2 1YFXA 3KLSA 2VNVA 2X5IA 4U36A 4B4RA 1GQHA 3A7QA 3WQBA 4UYBA 4XJAA 2NQYA 2R062 3FHQA 3AMNA 2XPJA 4BQ1A 5FLHA 2ZX2A 5F5IA 1LOGA 1JU4A 3J7LA 5T54A 4D6SA 5CFDA 3I49A 1WLTA 4WV8A 4P00B 1MQTA 2VOXA 1W9TA 1AX2A 1RJ7A 1CN1A 2HWF2 1WLCA 2HJIA 4J6GA 4QXKA 3N7MA 2O14A 4AEDB 3NKGA 5FXVA 3N7JA 4IV3B 4UW3A 2D44A 1RUI1 4CCEA 4UI9L 4UXAA 1DCSA 1J1TA 4NE9A 3AKQA 3J7NA 3KHBA 4ZXEA 1MEC1 2D3SA 2PAMA 1W9WA 2ZGTA 5SV8A 4JTNA 5FZOB 1N1SA 3M3CA 2QQKA 1C1LA 4RL7A 3LAGA 1YYNA 3AJZA 1A78A 1FI2A 1UF2C 5JPMB 2VMFA 1FYUA 3RMXA 3ZXKA 2O0OA 1E5HA 3VZMA 4DPNA 4CU8A 1FNZA 2JENA 1RUG2 2XJVA 2EAKA 2EXIA 3VZJA 5KHJA 1VBE3 3I59B 4YVWC 5LRRA 3GBGA 5IATA 2G9GA 5CIRA 3WG1A 4EZ4A 1CAWB 3N9NA 2W39A 1RUD1 2BDRA 3JUUA 1L7QA 4G9SB 3VDDA 3HAGA 5EYXA 4NN0A 2X10A 1F35A 5IVBA 3BTZA 1WCUA 2V4VA 2XUEA 5JI9A 1G9FA 4ISQA 2GC0A 2YC0A 3LF7A 3MIEA 3IDBB 2JXAA 4CCNA 4NJ4A 4V1PA 1PGSA 2QQUA 2ZX4A 3W5NA 5ABJB 5CAZA 4IEQA 2LUWA 3O5SA 1CAUA 5BNPB 3HPNA 4NHXA 1XNCA 2VOWA 2ZGPA 2B8MA 4K40A 3KT1A 1NLRA 4LMFA 5C6CA 2BV4A 1RUE2 4KG8A 5FTTC 3OY8A 1FV2A 2HWD1 3SCGA 2QCSB 3Q9OA 5HCHA 4Y26A 1SLIA 3E5QA 3OTFA 1OOPA 3MPBA 4Q26A 2EXKA 3UNPA 3NVCA 2X53S 2JX9A 1EPWA 4BDVB 3UGFA 1GZWB 2D6NA 4JVAA 1RHI1 2K9ZA 2BGPA 5FBZA 2Z4FA 2WA3A 1S0JA 2HWC2 2WRAA 3EHKA 4EZHA 2FDJA 4FFHA 1A34A 2OA2A 4XIOA 3ZXGA 3DKWA 2W1UA 5A7WA 5BNOB 4Q4X1 4CDWA 3EBRA 1HV1A 5CKMA 3WG2A 5JXHA 3LDKA 4ES8A 2HWE2 4O9EA 2IZWA 4OUSA 4QT6A 2Z2SB 2XJQA 3FBMA 4XHBA 3NWKA 3SKJE 5FOBB 3ZOIA 3MV11 4XDQA 5GZFA 4XQDA 2JDHA 4C91A 4QPGC 4A42A 1GV9A 3MLJA 1LGBA 1UY4A 4FTEA 1YLLA 1IQDC 4U2AA 3VBRB 2Q1FA 4RS5C 1IS3A 1B35C 2TNFA 5J1XA 1S0DA 4LBNA 1H0BA 1RYYA 4P9JA 1ZZ7A 1HN0A 3THPA 1YQ6A 5I93A 4Q4V2 1JYCA 5CFDC 4CCMA 3T09A 1MZ6A 4KWUA 1HRI1 1DYKA 1RGSA 2P6HA 2R16A 2Y6GA 3KGLA 3M3IA 2Q4SA 3QD6A 5JIAA 1HQWA 5FZLA 2B7YA 2PLV3 3RI9A 1QEXA 1O59A 2BWCA 5EQUA 4XF9A 3N7LA 1OLME 3VKFC 1JHNA 3AJYA 4CDXC 2CDPA 1UZYA 1KS5A 3OUJA 3EO6A 2WFF1 3MIFA 4X8PA 4XURA 1NE6A 1ND2B 1PK6B 1XNAA 4PIZA 4FP3A 2NPIA 4IEOA 2Y60A 2P5BA 5T50A 3BOWA 5IVCA 3D8CA 4QDQA 2WKKA 2ATFA 3HQUA 1VBC3 1QJX3 2ZPXA 3IN9A 3WZ1A 4AEMA 2WYFA 4D94A 5F2WA 4ISRA 4HMZA 3NAPB 3WQ0A 4R4ZA 2R063 2GMPA 1X8EA 1PZ7A 1PZ8A 4AVCA 1OLRA 3OBAA 1CIWA 1ZBA1 4XABA 3WSOA 3POSA 5KXCA 2WQ8A 4TXWA 5FZ7A 5JZGB 3ZSEA 4MGTA 4PF1A 3S57A 3S7EA 5HBAA 4I02A 4EN6B 2Y0IA 2HWF3 3N7KA 5BXXA 5JOZA 2VMEA 2R0HA 4RHV1 4MSVA 2JIGA 5D2AA 4QPIB 4K9SA 3K2OA 5C33A 1SPPA 4QGMA 1ZRCA 1XRUA 5FUPA 1I9RA 4Q0UA 4BLJA 1AYN2 1OH4A 2N7GA 1K42A 3RWKX 5D8AA 4EN8B 1NCQA 1AXYA 1WCDJ 2VW2A 2A1XA 2E32A 2YU1A 3SH5A 1WBLA 4MGSA 2R072 1J1LA 2BFUS 3OD0A 5JI7A 1RUF1 4MLOA 5FYYA 2PELA 1RUG3 4AHYA 2RMU1 3RZJA 4NHYA 2IXIA 2LS6A 2MEV3 3PTRB 4Q4W2 4YFZA 1SFYA 3GZAA 2JG9B 4CDUB 3E6CC 4P9LA 3M1HA 4Y3OA 4DOUA 2OUJA 1X7NA 1O7FA 3OGRA 3OYWB 3AKSA 2A75A 4MXVA 4PLOA 4AQTA 1ZA4A 1M06G 1Q8QA 2WS91 3BIEA 2ZHKA 2J22A 4EWDA 1GWKA 2TEPA 3ZN6B 1NKGA 1RVF2 4XFIA 4QWNA 5SV5A 4GKXA 1TNFA 3JBG2 2DU1A 3DYMA 2Q8EA 2UWAA 2G19A 1RB8G 3ST7A 2PHUA 4GXLA 5FYZA 1JBCA 4LXLA 1RUE3 5LZ6A 3ZO0B 3KV6A 4ARYA 3O1MA 1KFXL 4QGNA 5BNNC 2ETEA 2GNDA 4XC9A 3GCXA 2G9FA 1XOYA 2XXZA 3LOBA 1IPJA 3O12A 3S5QA 1COV2 4WVMA 4CEYB 4UFLA 4XMIA 3SCFA 2HWC3 4IGQA 5FRAA 5HXMA 4RQPB 3KCYA 4AI2A 5KWRA 1QOSA 3PTYA 1ENXA 1CX1A 3LA2A 4Y1XA 5FWEA 4KQ7A 2ZMNA 2C24A 4X6QB 2VCCA 1H8VA 2JG8A 1CJDA 5JUVA 1UNBA 1JYNA 3OGJA 4YG0A 3ZXLA 5CG9A 4AHWA 2HWE3 4YLZA 5FZHA 1OVSA 3H0OA 3AVSA 3FE5A 1BLZA 4BE3A 4KMQA 2C6SA 5I8SA 4YPJA 5A6XA 2ET7A 1QIQA 4ZU4A 4B1MA 3FHIB 1WA4A 1IG0A 2A6ZA 3CO2A 4ATEA 3H1YA 4FPLA 1W3XA 2AREA 4XUNA 3NW4A 3DKQA 4A44A 4BMEA 2AEZA 2Z79A 3CBNA 4CCDA 3ETPA 1GP4A 4KH9A 3PVOA 1UYXA 1YFYA 4JGZC 1VBD1 1W6PB 4NHMA 1Y9GA 3VZNA 4Q4V3 2BVVA 4CCLA 1GQGA 4AF9A 4IEUA 4LULA 2NP0A 1GP6A 3KVBA 1RUJ2 2BTVC 4QKBA 2Y0OA 4XXAA 1F8VA 1U0AA 2PMWB 3I2HA 1C57A 3KF3A 3I2DA 3R4SA 4WVWA 5JCTA 4KGGA 4YGBA 1PX3A 4ASLA 3KD4A 4WBBA 5FP3A 4UW4A 3KSCA 4KL1A 5F6LB 3ZXEA 1XE0A 2XQRA 3SCHA 2AH2A 5D8AC 5HV0A 1EV11 5M0TA 1R092 3O1OA 2ZGKA 4GQ7A 1VRH2 2ZX1A 4WM8A 2FDKA 3I97A 1RMU1 2CGOA 4YGEA 1URXA 2XH6A 5FK8A 3M3QA 5FYMA 1UY2A 2NMOA 2PTMA 2JB4A 4PLMA 1LULA 5FMCA 1S2EA 2NM1A 4AFDA 5JWPA 1YQ8A 3RSJA 3U1XA 1PMHX 1UX7A 3AVRA 1PVXA 1JYTA 3TNPB 3NO8A 2PHWA 5ISLA 3JD72 3UKTA 2VQUA 3MLLA 4COVA 1O3RA 4IQPA 3N4MA 5FZ4A 4YM1A 1N3OA 4LE3A 4LIVA 2P37A 3WOGA 1TG7A 4YW1A 1TMF2 1F31A 4MHUA 2ZKNA 2XWJB 1G86A 3NNFA 4GIQA 4GB31 5DAPA 3U07A 4LO8A 1LHNA 5T5LA 5HPOA 3LIGA 4CUGA 1UY1A 4BHPA 2RM23 1AYN3 3UT0A 2FCTA 3MPPG 4FOVA 3VBSC 3RZGA 2D3RA 4B7KA 3IPVB 3LDBA 3FLPA 3DCQA 2R49A 4ARXA 2Y6KA 1HXS1 4GMP0 3ZYPA 1LCLA 4XFGA 1V9U1 1HB3A 3ACLA 4AEKA 1Y3TA 2WNEA 4F7ZA 3T08A 4W6YA 2P1BA 3A23A 1OHFA 3NSTA 2IXHA 3D0JA 1TE1B 4Q4W3 2VZOA 3GGLA 1VP6A 1OI6A 1FMD2 4IEZA 4M3CA 3UK9A 4K8FA 4D6RA 1PZ9A 3IDCB 3FLRA 3T0DA 4YZ3A 2WZ8A 3PJYA 4BQ4A 1ULOA 1STMA 2JG8C 5DZFA 5JIUA 5H9RA 3VZOA 4XFCA 3GCWA 5A7PA 2CDOA 5A6ZA 4J25A 4E8CA 3E6BA 4ASKA 1AR62 1DFQA 2D7FA 1BEV1 2QQVA 2WNOA 3JBG3 5EFUA 5FZIA 1J3RA 5A80A 1VAVA 4DY3A 1NT0A 3B9CA 3MBWA 2PHTA 4P9IA 5LASA 1D4M1 5DUXA 2OQ6A 1OC1A 3MDPA 1POV3 4P5HA 1DIWA 2XHKA 3OJBA 3TOJA 3ES1A 4COYA 2ERFA 1Z7S1 2FZ1A 2FCUA 4D8MA 5C5TA 2VE1A 4Y1YA 4Y33A 1CGPA 1DQ6A 1SCRA 4R9AA 1K5JA 1T6BX 4H3WA 1XNTA 4KGQA 2VUCA 3N35A 1E5SA 2NN8A 5L9BA 1NLQA 3ZN4A 2YG0A 4INDA 4ZKTB 1COV3 3H8UA 4ES9A 2MPFA 4AVBA 4QXBA 5FZ3A 3NJVA 4JTOA 4N8MA 2WABA 3CZJA 2YBPA 4Q0SA 2VXJA 1OA2A 1DBNA 1Q43A 1BMV1 1Q8SA 1KFUL 4D0QA 3HN3A 2IVIB 2Y6HA 2R042 5DZEA 2WT1A 3MLKA 2RVAA 1SDWA 1APNA 2B46X 1LHUA 3LIHA 4PQ9A 1PVC1 3ZFEB 1AHSA 2D3PA 3HBZA 3NV4A 2J1UA 2P3YA 1S2BA 5J3UA 3KGZA 1IS6A 1FPN3 3M4FA 3ZLIA 4BH9A 4CP9B 2BPA2 5JPNB 3P3PA 1V6JA 4RFT0 4XDPA 1IZ3A 2XL9A 3ZXAC 2VMHA 2H6BA 3T4HB 3UJOA 4UFJA 2Q8CA 4HT1T 3PU3A 1WCQA 2ET1A 2P17A 4OI1A 3O1VA 1GUIA 4IV1B 4AEDC 3WUCA 4UFHA 4IV3C 1MS8A 4IETA 1RUJ3 3K4DA 3W58A 5C8CA 4MGQA 2DVGA 4CU7A 1BYHA 4LKDA 3I3MA 2DUQA 1W8TA 2WSUA 4QXHA 4MVTA 1SEFA 2D5FA 3GJAA 5A1AA 4OI0A 5FXWA 1XSQA 1UOFA 4KU8A 3O1SA 3DECA 5CKQA 4FFGA 4I0BA 1W8NA 1YNAA 2Y34A 1J59A 4M4RA 2CAUA 5F3CA 5C4WB 2R6QA 4NPLA 2HEYF 4AI1A 1R093 2JD9A 4AOCA 1PM4A 1ULEA 3HNMA 4L11A 4V2VA 3RJ2X 4HETA 1VRH3 1FATA 3TBDA 1WA6X 2MHFA 4Q4Y1 4TTGA 1PIV1 3LPFA 5I0SA 1F4AA 1NCRA 2KXLA 1DLCA 3BTXA 2XVKA 5E1RA 2YPDA 4I30A 4AHXA 2O8QA 3JD73 3I2OA 4ZS2A 3SEEA 3MUY1 3VHRA 4BQWA 4D7YA 1RC6A 2W5FA 5D1IA 3BTAA 1QDCA 1DZQA 4QPIA 2WLQA 4AGRA 3NNGA 1W8HA 3KVAA 2W0XA 4CEWA 4AI8A 2A5ZA 2WLPA 3P1IA 3OCPA 5LBFA 4RSUA 1LENA 1TMF3 5FZMA 3VZLA 1EAH2 3WNNA 2HEVF 1NA1A 5FYHA 5CFCB 2WAOA 4GULA 4BA6A 2XBO2 1IKPA 3GM8A 1H1MA 4NPMA 3GNEA 1H4HA 3BVCA 4FFFA 4HONA 1RTVA 2IXLA 5FZGA 4AYUA 1OFSA 2GAUA 3C7FA 1JUHA 5FZCA 3WF2A 3N36A 1DGWA 4IE5A 1DU3D 4DQAA 2AEYA 2G1MA 1QJU1 2ID4A 1GANA 4I0AA 3ACGA 1UOBA 3HN1A 5BNOC 1ZZ8A 3A22A 3JCIA 3RZZA 2W52A 2VECA 4EJRA 2BOIA 2WNVB 3R05A 4FT8A 4OHVA 2DWRA 2D6LX 2QTWB 2VU9A 1FMD3 1KJLA 5A3PA 5B4NA 2BJSA 3ILRA 2C26A 4EN7B 1LNSA 3MI8A 4BWOA 2QJVA 3KV5A 3GDBA 1H8TA 2W47A 2R1BA 3RNSA 1UXXX 1AR81 1HLCA 1ZRRA 3AZYA 4XILA 1AR63 3LQCA 1BK0A 1G6NA 2JDPA 1GOHA 3AMPA 2BP6A 4NIGA 2BFUL 3R4DB 4B29A 1AYM2 3WDUA 1W2OA 3POBA 1OD3A 5J09A 5F2SA 5GLVA 1RINA 1RUH2 2LTNA 3D4KA 1VB4A 5JR7B 5DUUA 3O7OA 2VUJA 1C8M2 3VBUB 1U12A 2QVSB 2SBAA 4B4PA 2XQXA 3UKVA 4W6WA 3Q8AA 4E2QA 3CJXA 1JZ6A 5IHRA 2ZHMA 4JKMA 4XQWA 3QBQA 2WBKA 5FPVA 1Q3EA 1UOJA 1VBB2 1D4VB 2YGMA 2CSGA 1ZREA 3KHCA 4DUXA 1QU0A 4OI2A 3UV9A 2AR6A 4BZ4A 1PK6C 1ND2C 3PVBB 2VBDA 5C3RA 4QPYA 4S2DA 4B3NA 2VMCA 1ODMA 1MVEA 2R043 4ZXKA 3U14A 4IE0A 4HPKA 4N43B 2Q5TA 2Q8OA 3S7IA 4LUKA 1PMIA 4NO4A 5BY5A 2OYZA 4K20A 4YGCA 5APAA 1D0HA 3NAPC 2Q30A 4NIDA 2OZ6A 3K3NA 3C8XA 2EIGA 2ZOEB 1LRHA 4GMP1 1WW6A 1OFNA 2Y33A 2OXBA 2FDHA 5FMOS 2XVLA 4JC1A 3VZKA 1PGW2 2W1WA 5A70A 3SKVA 1F15A 3AXDA 4QHOA 5KHHA 3WG4A 2P3KA 5FZDA 2QFEA 1SFPA 4M00A 4CP0A 5BV6A 3BU0A 4GALA 2WJSA 2ARCA 4LJHA 4QPIC 3FFZA 5FPBA 1QF3A 1M4WA 4BU2A 1AR91 1R081 2RDNA 3CNAA 4XJ9A 4ATFA 1REFA 3K4ZA 4GWMA 3IB3A 4LITA 1CX4A 1PO11 1NA1C 2ZHLA 3JB4C 1QY4A 3NL1A 2RS32 3QLQA 2YFZA 4XFBA 2D6KA 3UKNA 3WQ7A 3P5BA 1G9DA 2CGNA 3GXUA 4NUBA 3WLUA 1SCSA 1BVP1 4Q29A 4TWTA 4L97A 3ACIA 4L92A 2VZRA 3AYAA 4OFGA 1QJZA 4NRPA 4X8NA 5GLWA 2VQTA 2WIIB 4C1WA 3B3QE 4P5YA 1OQ1A 2HKXA 1VE0A 2JG9C 1HRV2 4JGYB 5LBCA 4QD2A 4CDUC 5K7PA 3RS6A 1J84A 3E1F1 4MUVA 3U4SA 1LJ7A 1UPIA 2A3YA 2XLFA 1ZBE1 3I4IA 3JQXA 1XYNA 3T2OA 2DCJA 4DRVA 1CESA 2VW0A 1DQ1A 1LOFC 5FY1A 4IW3A 1DGWX 1K5MB 5TSWA 2GN7A 3EXUA 1H8TC 1X82A 1NLSA 2BRTA 3FFQA 4QPWA 3POGA 4YSFA 3KF5A 3VV1A 4QGLA 2KA3A 4FPJA 1ZZCA 2E51A 2GH8A 4LUMA 1CZSA 5LA0A 1EAH3 3VDCA 4TZDA 2ADDA 4YW5A 2H0BA 1BBT2 1X33A 2XB6C 4QM8A 4XACA 4ITCA 5AC91 2XBO3 1Z78A 2XJRA 5IJRA 3AZVA 2HH9A 3I8TA 3VD3A 2R0FA 1ENQA 2MEV1 2BGCA 4CCJA 1HDKA 4QU1A 1VBA1 3GHNA 5FZ9A 5ACA2 2RR11 4CEYC 1FT9A 1LU2A 1W6NA 4RS5A 2DTYA 1B35A 2IXJA 4XUOA 4RQPC 2QQPA 2QNKA 4P08A 1UCXA 1QQP2 2BBAA 4P9XA 3ZYGA 1W6OA 5C9AB 3O0WA 5DDJ2 2RS51 4KWLA 5FO7B 3WNMA 1CWPA 4FP2A 2UWBA 4CDQB 1WWYA 3AK0A 4F3JA 4FAHA 4IXLA 1MS0A 1NXMA 4LOTA 3H8OA 4IUGA 2R1DA 3K75B 1JN2P 3O1RA 5JOWA 5FMBA 1SLLA 4NPRA 3ABZA 2YV8A 4CDXA 2QBXA 4BQ3A 3WG3A 4S2HA 3ZFGB 2VVDA 3LWCA 4CUBA 2W91A 3RVHA 1NZIA 4HSJA 1RIRA 2EAAA 2Z69A 3BCWA 3BPSA 4PDWB 1JTZX 1YWKA 2QQLA 3B5LB 2FD8A 3W5MA 2DFCA 3PLQA 3AC0A 1AYM3 3AZWA 4LBOA 4XBNA 5AVPA 4OZXA 5A3UA 3CHXA 3VBFB 1HW5A 1JZ7A 3Q8EA 5GM0A 2VNGA 1ZZBA 3IAPA 1YI7A 3I3QA 1OPMA 3EJKA 4OUMA 4YG6A 1C8M3 4E4ZA 1G9AA 3DPRB 3WF3A 4PT6A 2HYKA 1MS3A 3VLBB 4FPGA 5H9QA 3MIHA 2YY1A 2HWB1 1ULCA 2E7QA 3WY6A 4A7YA 3THTA 1LESA 2C4XA 2JEMA 4FCAA 4AQ6A 1W8UA 3BGAA 4NHKA 1WMEA 1X9TA 3ZFEA 1S0EA 3AZXA 3NRUA 1C1FA 2WQZC 2XL7A 1JZ4A 4D7TA 1UW8A 2PQQA 1W6MA 5F7UA 4YZ1A 1GICA 2VZVA 2UYAA 3QACA 4KI5M 4EQVA 4AFBA 1UMIA 5FBJA 3FWEA 4GWJA 5A3TA 5BYNA 1ASJ2 3USSA 3KCXA 5K8SA 3WD5A 5KXDA 1E5IA 4MG2A 2J1TA 3CIHA 2GNBA 4OCTA 1W9FA 2YZ4A 1NXD1 4R52A 3ZXFA 4XE9A 4XUQA 3VB9A 4OQ8A 4I01A 3VD5A 1LHVA 2VBPA 4BXSV 1ZX5A 2YC4A 1GNZA 3I2IA 4QQOA 5DAWA 3ETQA 4K1ZA 5T55A 3V0BA 4EYUA 3OPTA 4HXCA 3S0MA 3MUZ1 4FXKB 3IDAA 2PHDA 2X8KA 1ZZ6A 1UO9A 1JYVA 1O8SA 2CWMA 2IWGB 5FY4A 2Y38A 2WAAA 1Q5OA 4O61A 2ORZA 1XE8A 5FP9A 4N7UA 5LK5A 1RUI2 4RGAA 2V5DA 1OLMA 2RS33 3GZUC 4A45A 2XDVA 1C28A 4DEQA 1CAXB 1I5ZA 5CEHA 1MEC2 3TEWA 4DXZA 2BERA 4NRMA 5FYIA 1W6QB 4QX8A 1NYWA 2VY0A 2VNRA 2BOJA 3AB0A 5AVAA 5BNNA 1C5IA 3BOPA 1H9WA 1GZ9A 3NNJA 4A7ZA 5BNQA 1HRV3 1OVPA 1AVBA 2WA4A 1CAVA 3SXWA 2Y6LA 4MZUA 2RS11 5DG1A 1RUD2 3ELNA 4XDOA 4COZA 3V0AA 2WNUB 2UU8A 4IDZA 4HN1A 5LK7B 4XFFA 1AF9A 4XBLA 1S0CA 1H2LA 2RM21 4GH4B 4NROA 2ZEXA 1AL21 5A32B 3ZDVA 4LHSA 2WDBA 2UURA 3C7OA 4X6RB 4Y5Z0 5GZDA 5A7QA 3S30A 5KC6A 1H4GA 2NZ9A 1J3PA 1VAMA 1WW5A 3SH3A 5C3OA 1BBT3 4BJ0A 1SMVA 3ENRA 5JAXA 4BISA 4FPOB 3POYA 2RDRA 4KBZA 1D2QA 2IFWA 3WT3A 2A6XA 1E57A 2HWD2 1QWRA 2XJUA 5A7SA 3VBOA 3EYPA 5C3SA 1RXFA 3CJIB 5ACA3 3KB5A 2ZZJA 4YZ2A 1A8MA 2UYBA 5BPXA 4N53B 3TEXA 4UBHA 1GBGA 3WP4A 4PI0A 1V0AA 2DVFA 4YVSB 4C0HA 5GZCA 1RHI2 3AFGA 4W6XA 5DDJ3 4JGZA 5J36A 1H2MA 4RGKA 2Q0AA 2ZXQA 4QX1A 3T2QA 5LA1A 1EY2A 3EQEA 2WL1A 5A1FA 4QQLA 2R30A 4WM7B 4N9HA 4Q4X2 3ZFEC 3FLTA 4FAGA 4PLNA 4LHLA 5A33B 3KWVA 1H1IA 2GN3A 1N3QA 2RJLA 2W94A 4UW6A 4CYDA 4SLIA 4E8DA 1NOVA 2D6OX 1WD3A 2ZAAA 4LBQB 4PCRA 3ZIXA 5CG8A 3WUDA 1IGOA 3QCWA 1UWWA 2VULA 4XBQA 4BLIA 5HCFA 2DBIA 4YRDA 1MR5A 4JDMA 2DVBA 2ZGMA 3HQXA 3T0AA 1SQ4A 3WP3A 4BIFA 1H30A 5FZAA 4BM8A 4CP2A 3ZFFA 1W06A 1QXJA 2V4AA 3IMNA 2FMDA 4AK3A 3TN91 1KS4A 3IIAA 4RR3B 5EXOA 4AAPA 4DS0A 3PU8A 4CPBD 4RD7A 5E89A 1HRI2 4XUPA 4C90A 3H1MA 4KU7A 2WZR1 3SEPA 3SHRA 5FKCA 3A0KA 4QQHA 3TEZA 1H6YA 1FPN1 2D6PA 4HKLA 2BQPA 4YWAA 3W20A 3WNKA 3OUIA 3DYPA 1QJEA 4C0BA 4AGGA 1VMJA 1TEIA 5C4WC 1GOFA 4FPEA 3ZM8A 2WFF2 3V64A 2ZJCA 2W46A 3B69A 4Q8LA 5IYYA 1TME1 4B8EA 2BU9A 1O91A 1ASJ3 5EV7A 2CWSA 5F5AA 3D3AA 2BWAA 5IVYA 3VBSA 1Y43B 1G8WA 5JLVA 1JZ2A 4EE2A 2PQSA 2X29A 3PUSA 4KWJA 2EICA 4LBKA 2B4KA 1H2NA 1FOD1 1O4TA 4R4XA 3USUB 4LTAA 3VBHA 3BUCA 2VMGA 3MIBA 3PURA 4COWA 3ZYBA 2K46A 4MYEA 5JMCA 1ZBA2 2B5HA 1S2KA 3B02A 4YZ4A 3J7HA 1TNRA 1LU1A 1R1ZA 3AX4A 2QZ3A 1MZEA 3AL5A 3EMRA 3LFIA 4KWKA 5IW0A 4BQ5A 5F39A 4CUAA 5CFCC 3HVDA 4JDNA 3U75A 1IS5A 2VOKA 2RJKA 1FXZA 3IM0A 4RHV2 1UL9A 4MH0E 3ZPOA 2AACA 2EVXA 4M4PA 2B39A 1RXGA 5FJKA 3CU7A 5GZEA 3T2TA 3K3OA 1TQ5A 1RUI3 3N9QA 3UYJA 2VZUA 1PO21 2A71A 4XF4A 1PX4A 4UFIA 3ZYFA 3TEYA 1MEC3 1X36A 1LR5A 2JJ6A 5A3NA 4Q1RA 3VBOC 3OPWA 5FMOL 4BQXA 4GAZA 1HX6A 3DV8A 4K8RB 4UF0B 4URTA 5IVEA 1GP5A 2B9VA 4XYXA 2XLAA 1XNBA 3J8F1 1BKZA 4AXOA 2D97A 3VN4A 1GWLA 1RUF2 3PMSA 5F9TA 1F4HA 2OW4A 2JD4A 1W2NA 3T2PA 2RMU2 1ZZ9A 2JDUA 1GR3A 4DO0A 2J1SA 1LAJA 3I54A 4EN0A 1GZCA 1RUD3 3T1LA 2WWUA 4PBOA 1KDKA 3LEMA 1SACA 4CU6A 2D5HA 5B2GB 3RYRA 2XOMA 3FBYA 2C9KA 5FLJA 1MZ5A 3DGTA 3H1WA 3BALA 5IT6A 1I1EA 2C1FA 2WS92 3VKMA 4JQTA 4WVVA 2KR2A 2GMEA 1W05A 1S0BA 3MV01 4JX0A 3RMYA 3WDWA 2JE7A 1LEDA 2EF6A 5F8PA 2WN2A 1EP0A 1AR71 2EA7A 2JDNA 3PMEA 3VBUC 1HQLA 3ZYJB 1WCKA 2HWD3 1OQDA 4MGKE 5LW9A 5FZ1A 5KHIA 5FPAA 5FZKA 2YC2A 1QJY1 1MACA 5L7OB 4YVWB 1LHWA 1HIXA 2LROA 1PGL1 1QOOA 4MXWB 4CCOA 2YDEA 1RHI3 1DQ4A 4D69A 1DGRA 3BKZA 4XFHA 4S2FA 4NIAA 3ZFFC 3P3NA 2J1EA 1E5RA 2YYOA 4K21A 4AEDA 5IAVA 1VPHA 2FZ2A 1C8NA 4IV3A 1XBFA 3MW4A 4IL7A 1OPOA 3L9JT 3R4UA 3WHUA 1JW6A 5F37A 3LCPA 3PVEA 3POWA 1BXHA 2VZTA 2VTFA 1HN1A 5EZWA 5FZOA 3TWIA 1JYIA 1UMZA 4AAXA 2Y8KA 5FZ8A 4GZ9A 5F32A 3FC0A 3WDXA 3NNLA 1S0GA 3VBFA 2ZHNA 3AP4A 5KXBA 4XQ4A 2D40A 1O4ZA 4FPCA 4XCBA 1R1A1 3I59A 5CNAA 4YARA 3OBZA 2DYCA 1CAWA 2YXSA 4CUCA 4AQ2A 2R073 4AI3A 4YYOA 3ACFA 3NQHA 3LA3A 5FYSA 3VBHC 5LCWL 2W1SA 3LZZA 1PMJX 4A3ZA 5LBBA 1W8OA 1VBD2 2JDKA 2PHRA 4K1YA 5AFEA 4Y5SA 3WNLA 4Y1UA 3AKRA 1ZM1A 3WP6A 1JZ3A 1HRI3 2BUKA 2E63A 3ZDSA 1WCSA 3VKLA 3I3EA 1LODA 3THDA 5ABJA 2B45X 2ZGRA 5JSOA 4FBFA 5BNPA 5L9RA 3AFKA 5L19A 3SNMA 1OQEA 2BW8A 4E2GA 3LGRA 1OT5A 2AGSA 4MGYE 2BEOA 1RVF3 2D98A 1SDDB 2WFF3 4LA2A 4OMCA 4QPGB 3C7HA 4ZY9A 3WCSA 3NNMA 3POFA 2ZS6B 2W87A 4LBQD 4PJYA 5FYVA 1EV12 3O1UA 3JQWA 1MS5A 2YB7A 1D2SA 2OPWA 2YMZA 3H3LA 2X5IB 4ZONA 1UX6A 4QKFA 5FYTA 1GZWA 3S6PA 1S0IA 4OI4A 1RMU2 1GZTA 3WF1A 5C3QA 5GALA 1UMHA 4HG6B 2XVGA 5F6KA 1LOEA 1LECA 1SBEA 2KD7A 3WF4A 4BPZA 4JHZA 4CXXA 5T52A 3I2GA 2NLRA 4HK8A 1O3TA 5BNOA 3BYWA 1K5MC 2W08A 1T6GC 1MQTB 2L9LA 4XZUG 1IHMA 1ZBA3 5FKBA 3AP5A 3WX5A 5AFBA 1UYZA 1WD4A 2GU9A 3OGSA 3LD8A 1CAXA 3ZYHA 1AX0A 1MS1A 2OZJA 5DXDA 2JDMA 3FMGA 4L9BA 3VD9A 4GB32 1OA3A 4DMIA 4H7MA 1I5PA 4XF0A 2UY9A 3D5OA 5B4XA 3MGUA 4F83A 1O5LA 1H6XA 3VBRA 4HSLA 1IPKA 4IERA 4Q2FA 2OX0A 1AJKA 3SLIA 2QQMA 3AP9A 2ZTNA 3B7MA 4OUEA 4TLFA 3ZR5A 2W2IA 3BB6A 3S5AA 1HXS2 4BIOA 1DZRA 1ODNA 1V9U2 2ZX3A 4XXPA 1QXPA 1AX1A 3WXPA 4UFMA 3AZZA 1RUF3 4Q0QA 1RUC1 2ZCWA 4E4DX 2VVFA 1C4RA 2VH9A 2Y6FA 5LY2A 3VDDB 2ES3A 1XJAA 3E5XA 5KC5A 3ZR6A 1WGPA 2DCKA 1PM7A 2WO2A 2WSVA 1J3QA 1ND3B 3WDVA 4JHTA 1HB1A 4E4SA 4QM9A 3ZFGC 4CZSA 5IAXA 2JE9A 2FHRA 4FPKA 1YJLA 1PK6A 1ND2A 1OXCA 3TNQA 4PDWC 2WS93 1CAUB 3Q8CA 4RFRB 3T30A 3VHPA 3WNOA 1JODA 4NAOA 2Y64A 4Y1VA 1BEV2 1GWMA 3PUAA 3VBFC 3OY8B 2JDYA 5LA9A 2VZPA 3HIFA 1D4M2 1W2UA 4DRRA 3J26N 3OF1A 3NAPA 3POIA 4HKOA 3I3DA 1OOPB 5GLTA 1Z7S2 1ZRFA 3NJZA 1FAYA 1MS4A 1NZCA 4EWEA 1OBNA 2Y6JA 5FDBA 3F2ZA 4AZZA 5JZGA 3JU9A 3MYXA 4LT5A 4D6QA 3POEA 3PUIA 1UY3A 4FOYA 5A7WB 2X09A 4K7JA 3PL0A 4CDWB 1JZ8A 1QHDA 5ABJC 2SLIA 5I0TA 1BMV2 5BNPC 1QXRA 4CXYA 3MW2A 4I09A 4OLLA 4DINB 2ZABA 1PVC2 1YEWA 3LPGA 5JR2A 4LO5B 2LW8A 2PYTA 1AXKA 4M0HA 4BQYA 3HNYM 1OF3A 1VBE1 2QUOA 1G9BA 2B42B 4CU9A 3AMQA 2QQIA 1I3HA 3RFRA 3H7JA 1QNWA 3HR9A 1ZYBA 2JG9A 3VUOA 3FUQA 4CDUA 4IEVA 2WT2A 5IK8A 1W0PA 1NY71 3OPZA 2CL2A 1YUDA 2VZ1A 2WO7A 4OYUA 1VBD3 4QB1A 1IKQA 2C0ZA 3N3HA 3A21A 3OYWA 5FXZA 4DNYA 1O3QA 1TVGA 1ULDA 1YRZA 5CISA 3BTYA 3K77A 1LOFA 3ZN6A 1W0OA 4HFSA 4NOTA 3GBFA 3OEAA 4KNCA 1UZZA 5DPNA 2I45A 3K48A 3BODA 5HCBA 4Z92B 4LKEA 5FAXA 4D3WA 3VBRC 1ZNPA 2WO3A 4C8DA 4R8HA 3ASIA 4UOJA 4XTMA 4AVSA 1UU6A 1GMMA 2VZ3A 1EV13 2VGDA 4HLTA 2LM3A 3ZYIB 1CZTA 2DFBA 5LB6A 2A6WA 4AVAA 5K0UB 3KT7A 4Q4Y2 4QKDA 1RMU3 3NV3A 3OEBA 4CEYA 1PIV2 2WNUC 4RQPA 2EALA 4QQPA 1YQCA 5C3PA 4LO4B 2IFRA 4GH4C 3APBA 3A4UA 3ZXJA 5J7MA 3LOIA 1VLNA 2VVEA 3TB0A 5LBEA 2GC1A 3OBTA 5E6HA 5EIYB 4PIXA 4LLFA 5LATA 1SLTA 2JDAA 5FXXA 1SLCA 2YBSA 1UAIA 4RYDA 1XXNA 1SPPB 1LOAA 3F95A 3SITA 3BIWE 4GB33 2WUHA 5FYUA 3CJIC 4Y22B 2RHPA 3KCCA 1NCQB 4HOOA 5D8AB 4YGDA 5HCAA 3R6SA 4XAEA 3X29B 4N53C 2IVJA 5KHKA 2WYSA 5H9PA 1NE4A 5FUNA 1U5XA 1HB4A 4IEWA 5EP9A 4Q0PA 5EJZB 3RZMA 1W6PA 4XJ8A 3KV4A 1HXS3 1QJU2 2A3WA 4E27A 3PIGA 2PLV1 1V9U3 3WF0A 5C70A 1UIKA 5JZGC 4WM7C 2XJTA 1YC61 1YQ2A 1AJOA 3B01A 1DG6A 2YUEA 5F3EA 5FYCA 4FPFA 4ZHNA 2J1VA 2BNOA 1RUNA 1UPSA 2ARXA 1RL3A 1UQXA 2IC1A 2PFWA 3N9LA 4QMAA 3VDAA 4ONUA 1XU2A 3D6EA 4QDSA 4NIHA 1JS9A 2WZEA 1YO8A 3ALQA 4YW2A 2D93A 2CAVA 3A0NA 2QE3A 1KQRA 1POV0 2EXHA 3NJXA 3PJQA 4BK4A 1VBC1 1QJX1 5DG2A 1AR82 2TUNA 4XJZA 1CONA 2ILMA 5FQ0B 4E2SA 5CA6A 2PHLA 1BEV3 1HJGA 2AENA 4CSWA 2LRPA 2R061 3H9AA 1UU4A 2V72A 3VL8A 1D4M3 3SQOA 3H8XA 5JXJA 4E9KA 3L2HA 4LO6B 4RR3C 4LHKA 4Y24A 1Z7S3 4AW7A 5CYYA 4UWDA 1D7PM 1WW7A 2JDZA 3O0XA 4WVMB 1G9CA 1BJQA 4I2OA 2HWF1 1HB2A 1GYKA 1XB9A 2JECA 2ZMLA 4R9CA 2GC3A 2D43A 4A6OA 4AL9A 3IIIA 2OKXA 4F8AA 4YFWA 1O6UA 1W0NA 1V6NA 3C3VA 4G4FA 3RQ0A 2JG8B 3KQ4B 4OHYA 5FV3A 4LBLA 5FO8B 1SBFA 3H8RA 1PHMA 2E7AA 2VW1A 2Z42A 3N9OA 1QKQA 3WW1A 5FWJA 3BPZA 4M01A 3O14A 4DXSA 1PVC3 4IEYA 3IPVA 4AVTA 3TAYA 3RZKA 3ECQA 4A3XA 1RUG1 3AKTA 4HVQA 1N1YA 4IE4A 2QQOA 4B7EA 2ZA9A 4DEVA 4JCKA 5I91A 1ZRIA 2FMYA 2OVUA 1V6LA 2GDFA 5KXEA 2UY8A 5FZEA 3HT2A 4ZPIA 1ZA7A 1Y7BA 1EYBA 4YNIA 5CKNA 3O0VA 4MX3A 3J9SA 4LORA 2W9XA 4Q0VA 4LK7A 5ANNA 5A7NA 3OOXA 4LR4A 4XFAA 1OF4A 1WW4A 4MGZE 1DQ0A 3U4XA 1LGCA 1QH6A 1YIFA 2BNNA 2H6CA 1AR92 2I74A 1R082 3IWZA 4PHZA 1OKQA 1V70A 2QQJA 5FYBA 4N9IA 3TRSB 1PO12 1FNYA 1RUE1 2GNMA 3VDBA 4R9DA 4H14A 3MFCA 3FL7A 1O3SA 4IEPA 1PNFA 2ZEYA 4JKKA 4WM8B 3ME2A 1NG0A 4XOGA 2HWC1 2DBNA
chains in the Genus database with same CATH topology
2V4AA 5IAVA 4XC9A 5DAQA 5LBFA 4NAOA 5EP9A 4XAAA 5LA9A 5DAWA 2RDQA 3BVCA 5LBCA 3NNLA 3OUIA 4J25A 5DAXA 4XCBA 2G1MA 4Q5OA 5LASA 3OBZA 3HQRA 3PL0A 5EQUA 4IW3A 5C5TA 2FCUA 5LBBA 5L9VA 2RDSA 3OUJA 4Y5SA 5L9BA 4XACA 3GJBA 3DKQA 4NHLA 4BQYA 3NNJA 5L9RA 3HQUA 3EMRA 4NHMA 4UWDA 3ITQA 3NNMA 2JIJA 4ZONA 2OPWA 3GZEA 4XABA 5C5UA 2RG4A 5IATA 4BQXA 5HV4A 2JIGA 5M0TA 5HV0A 4NMIA 2HBUA 4JZRA 2RDRA 3OUHA 4KBZA 3W21A 4Y5TA 4NHXA 2A1XA 4ZPIA 5ERLA 3KT1A 5LB6A 5A3UA 3MGUA 3GJAA 5DAVA 3KT7A 4NHYA 4XCAA 4MHUA 3KT4A 2HBTA 2Y34A 2Y33A 3NNFA 5DAPA 4MHRA 3W20A 5LBEA 4NHKA 2FCVA 5LATA 2FCTA 5EPAA 2RDNA 2G19A 4BQWA 5IAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4A A;  5IAV A;  4XC9 A;  5DAQ A;  5LBF A;  4NAO A;  5EP9 A;  4XAA A;  5LA9 A;  5DAW A;  2RDQ A;  3BVC A;  5LBC A;  3NNL A;  3OUI A;  4J25 A;  5DAX A;  4XCB A;  2G1M A;  4Q5O A;  5LAS A;  3OBZ A;  3HQR A;  3PL0 A;  5EQU A;  4IW3 A;  5C5T A;  2FCU A;  5LBB A;  5L9V A;  2RDS A;  3OUJ A;  4Y5S A;  5L9B A;  4XAC A;  3GJB A;  3DKQ A;  4NHL A;  4BQY A;  3NNJ A;  5L9R A;  3HQU A;  3EMR A;  4NHM A;  4UWD A;  3ITQ A;  3NNM A;  2JIJ A;  4ZON A;  2OPW A;  3GZE A;  4XAB A;  5C5U A;  2RG4 A;  5IAT A;  4BQX A;  5HV4 A;  2JIG A;  5M0T A;  5HV0 A;  4NMI A;  2HBU A;  4JZR A;  2RDR A;  3OUH A;  4KBZ A;  3W21 A;  4Y5T A;  4NHX A;  2A1X A;  4ZPI A;  5ERL A;  3KT1 A;  5LB6 A;  5A3U A;  3MGU A;  3GJA A;  5DAV A;  3KT7 A;  4NHY A;  4XCA A;  4MHU A;  3KT4 A;  2HBT A;  2Y34 A;  2Y33 A;  3NNF A;  5DAP A;  4MHR A;  3W20 A;  5LBE A;  4NHK A;  2FCV A;  5LAT A;  2FCT A;  5EPA A;  2RDN A;  2G19 A;  4BQW A;  5IAX A; 
#chains in the Genus database with same CATH topology
 4BQ2 A;  5FY8 A;  1RUH 3;  2GNT A;  1L7L A;  3AM2 A;  4Q4Y 3;  5FY5 A;  5IVF A;  4EV0 A;  5BUV A;  1IQA A;  1PIV 3;  4NVP A;  1HV0 A;  3D82 A;  4AR2 A;  4FO9 A;  2JKX A;  1ZBE 2;  2YFU A;  2A3X A;  4B4Q A;  1BVV A;  2PHX A;  2AZ5 A;  2RJ2 A;  4XVH A;  2HWE 1;  2YGL A;  2GC2 A;  4FPY A;  2RDQ A;  1X50 A;  3K51 A;  1DGR N;  2BZD A;  1VBB 3;  5F3G A;  3THC A;  2VXR A;  2XKO A;  4XF1 A;  4IEX A;  4I0W B;  2Q1M A;  1KRI A;  2EXJ A;  3PUH A;  4CP9 A;  1OH3 A;  5L36 A;  5AC9 2;  5A6Q A;  3HQR A;  5GJ6 A;  1P8J A;  1SBD A;  1JI6 A;  2VJX A;  1ALY A;  1VAK A;  3O1T A;  5L7O C;  2MEV 2;  2QDR A;  4AGV A;  4Z1V A;  1QDO A;  3Q8B A;  1VBA 2;  5FPL A;  1IPS A;  3NMB A;  3LKJ A;  5L9V A;  4Q4V 1;  3OG2 A;  4ET7 A;  2K0G A;  2RDS A;  2RR1 2;  3ZX7 A;  5JVV A;  2FDI A;  1UD1 A;  2E6V A;  1QJU 3;  1K45 A;  4IV1 A;  4UBG A;  1GOG A;  1ND3 A;  2VTX J;  3HBK A;  4LBJ A;  3WDY A;  1JMU B;  3H7Y A;  3ACH A;  3ZSK A;  2RS5 2;  4M3C B;  1CIY A;  3KZ4 C;  3B9I A;  4W8J A;  2BVB A;  3KQR A;  4IGO A;  2V73 A;  4TN7 A;  3OSD A;  1AUY A;  1GKB A;  1NX9 A;  2A70 A;  5DQ0 A;  5T3N A;  4CRQ A;  1V6I A;  3K4A A;  4Z82 A;  1F5J A;  1X8M A;  3QOP A;  3WDT A;  3HT1 A;  1NAE A;  2PAK A;  3FN9 A;  1OUR A;  4XHX A;  2VCM A;  2F4L A;  4P9G A;  3RYP A;  3ZYR A;  3FX3 A;  4M3C F;  3ZKU A;  4QQ2 A;  1UY0 A;  3RG0 A;  5JXG A;  1T2X A;  2GH2 A;  5C4W A;  4UAP A;  1AR8 3;  4XIK A;  5FO9 B;  5FLI A;  4HVO A;  4L2N A;  2ENR A;  5HXV A;  2C9A A;  1N47 A;  1W39 A;  2ZGN A;  4BCU A;  4CVU A;  1JZ5 A;  4AEJ A;  2VMI A;  4YW4 A;  5A3W A;  3GYD A;  3CL1 A;  4FQ4 A;  2O8O A;  2E9Q A;  5J96 B;  1US3 A;  4LHN A;  4DXR A;  1S4C A;  5FPX A;  3JZV A;  4Y5T A;  1KJR A;  1MZF A;  1U5Z A;  4LIU A;  1Y9Q A;  3B94 A;  4HN0 A;  5EHD A;  3T4V A;  3U37 A;  4CCC A;  5FP4 A;  1VAL A;  2HWB 2;  3EB7 A;  4QDR A;  5T5O A;  3MO4 A;  1S55 A;  4N7I A;  5ERL A;  4FVV A;  1CZV A;  4FFI A;  5CFC A;  1CR7 A;  2HLE A;  2J7M A;  2ZGS A;  3RZL A;  1AYN 1;  1KDM A;  4QX0 A;  4HBN A;  2JIC A;  1K12 A;  4MO3 M;  3VGI A;  4COU A;  2J1A A;  4XCA A;  1KEX A;  3LE0 A;  2XLG A;  3RWN A;  4G3Y C;  3KT4 A;  2X5I C;  4P9Y A;  1DQ5 A;  3RPQ A;  4C1X A;  2R07 1;  5IVV A;  2XWB B;  4GJZ A;  5F3I A;  3VD4 A;  3AYE A;  1DDL A;  3PNA A;  1PNG A;  4CE8 A;  2V5Y A;  4Q4W 1;  5F1R A;  3WW4 A;  3FHA A;  1MQT C;  1KXG A;  4Q1P A;  4GMP 3;  3G6J B;  2WNV A;  1B09 A;  1IG3 A;  4OVE A;  3DN7 A;  3WW3 A;  2XKP A;  5EYY A;  1QQP 3;  1XNK A;  4YM0 A;  1O4Y A;  1Z0H A;  2DDU A;  1RUO A;  2P3J A;  1WBF A;  4BK5 A;  4JAA A;  5A7O A;  3LSE A;  5C8C B;  1VMH A;  5DAQ A;  4KBB A;  1RVF 1;  4H55 A;  4DFS A;  1CPN A;  2VO5 A;  1JYX A;  4QHB A;  3LEI A;  2VTX A;  3JBG 1;  3O1P A;  1AR9 3;  1R08 3;  3WR0 A;  1BHG A;  3AL6 A;  3GHM A;  3RZH A;  1W9S A;  1POV 1;  1DYP A;  1N1V A;  1PO1 3;  1ULP A;  4O7X A;  1SG3 A;  2CGP A;  3AP7 A;  4DXT A;  2DVD A;  1OMI A;  4OHX A;  4A6S A;  3CDZ B;  3KV9 A;  5K0U A;  3RI8 A;  4JQR A;  2E53 A;  5IWF A;  4Z2W A;  5T5P A;  3N9P A;  3I2F A;  2MNG A;  4JV4 A;  4BXF A;  2YRO A;  1FX5 A;  4Q5O A;  1COV 1;  3VBU A;  1OLQ A;  5A1L A;  3VDD C;  1TZO A;  1NCR B;  3NV2 A;  3RDI A;  4IV1 C;  3ZIW A;  3VKO A;  1ND3 C;  2VBB A;  2VCB A;  5CU1 A;  5JDB A;  1GLH A;  4DB5 A;  4Y4R A;  5JOY A;  3E6D A;  2RS1 2;  1CD3 G;  1ZBE 3;  3CQO A;  5K9Y A;  2DTW A;  2QZ2 A;  3AP6 A;  4HL0 A;  3GZT B;  3GJB A;  3AKP A;  1S1A A;  3JB8 A;  4NR1 A;  3ZSJ A;  4CEW B;  4L99 A;  3RGB A;  5JOX A;  1C5H A;  3U0Z A;  3E97 A;  2VNO A;  2RM2 2;  1W04 A;  2FQP A;  3UGG A;  2OPK A;  2V09 A;  1AL2 2;  1GSL A;  1NA1 B;  4N43 A;  2XML A;  4Y22 A;  3T1M A;  5I8T A;  4AFA A;  1UN1 A;  3ITQ A;  1F5F A;  2DUP A;  5A3L A;  2XHN A;  3HNB M;  3PHM A;  1OOP C;  3QH6 A;  4P9W A;  1AXZ A;  1LEM A;  1QNY A;  5K4L A;  2DUR A;  4A2U A;  5AC9 3;  3DYO A;  4I3G A;  4DY5 A;  5J48 A;  3K46 A;  4IES A;  4H2A A;  5FFO C;  1K3I A;  1NUK A;  5CVR A;  5FUI A;  1EPZ A;  1VBA 3;  1BQP A;  2EIB A;  3AMM A;  3CEW A;  1YFW A;  4TLG A;  3U10 A;  3HOB A;  2ARB A;  2RR1 3;  3KMH A;  3MF9 A;  2A6V A;  4O9G A;  5HI0 A;  2H0V A;  4LEJ A;  4PF5 A;  1RUJ 1;  4AI0 A;  1LOB A;  1YQ5 A;  4CDW C;  2VD7 A;  1HKD A;  4AI9 A;  3H42 B;  1U5Y A;  2RS5 3;  4J1X A;  4HK9 A;  1OA4 A;  3MIC A;  5G04 L;  1X9P A;  3J7M A;  2PAE A;  1QJF A;  3KS7 A;  1OSG A;  1UOG A;  1H8T B;  5J98 B;  3C7G A;  2VPV A;  2ZGU A;  4A41 A;  5FQ0 A;  1L3J A;  1W28 A;  1GNY A;  1R09 1;  2DCT A;  1ACC A;  2ZEW A;  5FZB A;  1BCX A;  5FZF A;  1VRH 1;  3H3U A;  3MZH A;  4FI9 A;  2F4P A;  2VL4 A;  1WUV A;  1W9Y A;  4O65 A;  2OS2 A;  4GD4 A;  3ZMN A;  5CB7 A;  3W9A A;  4JGY A;  1VB2 A;  2CU5 A;  2WFP A;  3ZXD A;  1Q8P A;  2DF7 A;  2J1R A;  3M3O A;  2VCA A;  3JD7 1;  4AG4 A;  1MPX A;  1YFU A;  2WNV C;  4YM3 A;  1UXZ A;  2W3J A;  4GJY A;  1LOC A;  4RA0 A;  2FCV A;  5FPZ A;  4FTB A;  2DVA A;  2WO1 A;  3ON7 A;  5IUQ A;  3ILF A;  3RRD A;  3TN9 2;  4MV2 A;  1YI9 A;  1EUU A;  1TMF 1;  3UGH A;  4CCK A;  1K5M A;  2QKD A;  1NQD A;  3ZSM A;  2HWB 3;  5LEK A;  4A7K A;  1WLW A;  1BK1 A;  1UKG A;  2WZR 2;  1UYY A;  3AMH A;  5FY7 A;  3VKN A;  2YPJ A;  5CAD A;  4PQQ A;  1FPN 2;  2GZW A;  4D7S A;  1H2K A;  4HPK B;  3ZSL A;  3MID A;  1J58 A;  4M0N A;  3UJQ A;  3MIG A;  5A3M A;  2WQ4 A;  5K0U C;  1TME 2;  1XE7 A;  4QX7 A;  1UU5 A;  3B00 A;  1XSR A;  1ULF A;  5LA2 A;  5C9A A;  2VMD A;  4CPB A;  5KR7 A;  5DAX A;  1FMD 1;  1RED A;  4B1L A;  2ARA A;  2DUO A;  3DF0 A;  3CMG A;  1FOD 2;  4CDQ A;  2DU0 A;  3I2K A;  2R32 A;  5I0U A;  2CY6 A;  4MOA A;  2BBV A;  1BZW A;  1YIP A;  1DZT A;  5CBL A;  4TSV A;  1V6O A;  2YBK A;  3M7A A;  5DUW A;  4OHW A;  3LDR A;  4OZO A;  2VM9 A;  2PXJ A;  4XPV A;  3VHN A;  3MEP A;  1AR6 1;  5FIX A;  3ZFG A;  2J42 A;  3I3B A;  1LB2 A;  4Q4X 3;  4N43 C;  2GAL A;  3WNP A;  1NCQ C;  4XUT A;  1JUI A;  1W8F A;  5I0R A;  4PDW A;  3DL3 A;  4OUL A;  4QX2 A;  4YW7 A;  2XON A;  1YXW A;  3IDE A;  5FRE A;  4KG0 A;  1PO2 2;  1O8P A;  4GWI A;  5LEJ A;  2CNA A;  2XJP A;  4Y20 B;  1GFF 2;  3GBW A;  1WKY A;  3VD7 A;  2DCZ A;  2C5D A;  4BB3 A;  1JOB A;  3IT8 A;  4AFC A;  3WP5 A;  1SLA A;  1XPW A;  2ADE A;  3DPR A;  3J8F 2;  3ORJ A;  5FP8 A;  5F5C A;  2E7T A;  3GZE A;  1J83 A;  3FZ3 A;  1KD7 A;  2XGX A;  4QKN A;  5DUV A;  5FY0 A;  2JB8 A;  4QHZ A;  4QX5 A;  5F5Q A;  1Q8V A;  2IXK A;  2WR9 A;  4BMB A;  5DMY A;  5A3O A;  2R04 1;  2RS1 3;  1RJ8 A;  1CPM A;  4DUV A;  5HV4 A;  3PUQ A;  5FR3 A;  5IK4 A;  2PN5 A;  3GAL A;  1ZRD A;  1HQN A;  2EID A;  4NMI A;  1U5I A;  1XYO A;  3DXT A;  1LTE A;  2VQA A;  3HEI A;  4JZR A;  3OUH A;  4LLO A;  4PIY A;  4Y1Z A;  5FY9 A;  4LNV A;  2AYH A;  1I6X A;  3CZU A;  1A3K A;  4W50 A;  1D0G A;  3SH4 A;  1AL2 3;  3OBR A;  4H7L A;  1EUT A;  2IUW A;  1QH7 A;  3PVN A;  5FK7 A;  1OUS A;  2XJS A;  3M70 A;  2CHH A;  2X05 A;  1WMF A;  3OGG A;  4UT5 A;  5H9S A;  1SHW B;  3H50 A;  5LRS A;  4JGY C;  1AR7 2;  4I3P A;  3OGV A;  5DAV A;  3M2M A;  4K6B A;  1W6N B;  4RS5 B;  4FPH A;  3FUO A;  3HWJ A;  1B35 B;  1FV3 A;  5C71 A;  4W4Z A;  5IFP A;  3BU7 A;  3GF6 A;  4XW3 A;  2XG3 A;  4GA9 A;  1QJY 2;  3WW2 A;  1CQ9 A;  1W6O B;  2E33 A;  3WCR A;  2LAL A;  1PGL 2;  4YW6 A;  3D0S A;  5CFD B;  4NWW A;  4XMA A;  1GU3 A;  1UZ0 A;  5JMO A;  2Q1Z B;  1W2A X;  3ILN A;  2RE9 A;  2BNM A;  3POJ A;  1ENR A;  5JSR A;  2Q8D A;  1DQ2 A;  5JXI A;  2O1Q A;  4WVZ A;  2P2K A;  4FTS A;  4E4H A;  3W59 A;  4CDX B;  4S2G A;  5EPA A;  2W68 A;  4JDO A;  3NKT A;  4Z07 A;  4QAW A;  4RHV 3;  3HJR A;  4LQR A;  1UIJ A;  3RYK A;  1WLD A;  1W6Q A;  2ZX0 A;  1JOP A;  1N1T A;  2ZMK A;  1N3P A;  2W95 A;  5E88 A;  4TYS A;  3AYD A;  3P6B A;  3I7D A;  1W2T A;  2QQN A;  1AZD A;  4A4A A;  4M3C E;  5C9A C;  1R64 A;  5DAB A;  1R1A 2;  1V00 A;  2ZAC A;  4PI2 A;  4RN5 A;  4ZS3 A;  2FDF A;  1IOA A;  1KIT A;  1JU3 A;  1Q56 A;  2XUM A;  4XJU A;  2YU2 A;  3T0B A;  4CDQ C;  4YZ5 A;  4XF3 A;  2D6M A;  2WNU A;  2WN3 A;  2A73 B;  2VG9 A;  4FOQ A;  1ZVF A;  4YW3 A;  4IE6 A;  2RMU 3;  3TN9 3;  4P14 A;  5IVJ A;  2G4I A;  4NWV A;  4YM2 A;  4GH4 A;  2ZGQ A;  1EAH 1;  5KBF A;  4Q27 A;  2WWJ A;  1QMJ A;  4URA A;  5A32 A;  2EIE A;  2WZR 3;  2XBO 1;  1JHJ A;  2CTV A;  4QX3 A;  2VZS A;  2PA7 A;  1JOJ A;  4V2W A;  5T5J A;  1W6M B;  3ATG A;  1VJ2 A;  4IE7 A;  2ORX A;  3T3Y A;  4EN9 B;  1F2N A;  3UL2 A;  3IKW A;  4WM8 C;  1LKN A;  3NJY A;  3IBM A;  4BYY A;  2ZKL A;  1L7R A;  2DV9 A;  3CJI A;  3OD4 A;  3R0R A;  3FJS A;  2ZGO A;  1TME 3;  2G9Z A;  3MHZ A;  4N53 A;  5EJ3 A;  4NHL A;  2AC1 A;  4YVS A;  5KHG A;  3DPR C;  1OKO A;  5IFT A;  1US2 A;  4JKL A;  4LE4 A;  1WZX A;  1UZV A;  2IXC A;  1WMX A;  5E8A A;  1FOD 3;  1POQ A;  3V0B B;  3U11 A;  4WM7 A;  3DEM A;  3PIJ A;  2E31 A;  3B93 A;  3CLP A;  4AHZ A;  3SC7 X;  5DN2 A;  2GP3 A;  3V65 A;  5A33 A;  1XU1 A;  3W21 A;  4HKW A;  1DHK B;  5C5U A;  2A7A A;  4P02 B;  2RG4 A;  2VUA A;  5EWS A;  3WEZ A;  3URF A;  4LBQ A;  1QOT A;  4RGG A;  4LKF A;  2JWP A;  4EWA A;  1IS4 A;  1AYM 1;  3NV1 A;  1SLB A;  1DLL A;  2ZEZ A;  4SBV A;  4Q8K A;  4XTP A;  3VL9 A;  3PDQ A;  1W8Z A;  1RUH 1;  1PO2 3;  3H3Z A;  5L73 A;  3HMY A;  4R9B A;  4DZG A;  3KM5 A;  1C8M 1;  3OB8 A;  5GLZ A;  1VRB A;  3UET A;  1KGY A;  5FZ0 A;  5BNN B;  1YJK A;  1ST8 A;  4FSJ A;  3WNX A;  2KM2 A;  4HVR A;  4RR3 A;  2GP5 A;  3J8F 3;  1CAV B;  1H9P A;  3ES4 A;  5LY1 A;  1VBB 1;  3SIS A;  1RUC 2;  1UKR A;  2OT7 A;  2ZZQ A;  3V0A B;  4PBP A;  1RIT A;  4CA9 A;  4GKY A;  3BI3 A;  2VR4 A;  5DZG A;  5I8Y A;  3CKH A;  3DUI A;  3ZVX A;  1A6C A;  4LA3 A;  5IK7 A;  5A6Y A;  1VIW B;  3M3E A;  2OQ7 A;  4MET A;  4BOW A;  2QDN A;  1DF0 A;  4OMD A;  2UWC A;  2WC2 A;  2F6B A;  1JYW A;  1Q8O A;  2I07 B;  4ERO A;  4WZF A;  3VBO B;  2CYF A;  1PGW 1;  2VAU A;  1JXN A;  1AR7 3;  1W8W A;  3LA7 A;  4L8Q A;  3LB9 A;  3MFA A;  1V6M A;  2NMN A;  4XET A;  3USU A;  1F9K A;  4JRA A;  3TYJ A;  5FJH A;  3LSD A;  1ONA A;  2RV9 A;  1QJY 3;  4XJW A;  3RJR A;  4CXW A;  4LKS A;  2E26 A;  3DXU A;  5FMD A;  4JGZ B;  4XAA A;  2DCY A;  4AE2 A;  3ZN5 A;  4LOS A;  1W03 A;  2VC9 A;  2OII A;  2VQ0 A;  2Y26 A;  5LWB A;  4AVV A;  1LHO A;  2HYX A;  2RS3 1;  2BYV E;  4HZF A;  1NQJ A;  4QB6 A;  4XZP A;  2VOV A;  4YG3 A;  5FP7 A;  1LGN A;  3V56 A;  1ULG A;  2P34 A;  3ZKY A;  3L2Y A;  1V6K A;  1JH5 A;  1WMD A;  2QQW A;  1GQP A;  2W92 A;  3ZMO A;  2K2S A;  5FOJ B;  4QU2 A;  2OUH A;  5FCC A;  4UF0 A;  4NII A;  1HRV 1;  3LEG A;  1UYP A;  4OHZ A;  1VBE 2;  4AQS A;  4ZZ8 A;  3UES A;  3M8L A;  2ZGL A;  4YVS C;  4Z8B A;  1OD5 A;  3ZFF B;  1O5U A;  4QXC A;  1R1A 3;  1YCI A;  2W1Q A;  2ZBJ A;  3J4U H;  5C8C C;  2AUY A;  1NY7 2;  4FOW A;  1SZB A;  3QH7 A;  5G05 L;  3G7D A;  2P4E A;  2F17 A;  4JRL A;  1MVQ A;  3AYC A;  3I2J A;  3WQ1 A;  5FZ6 A;  4UFK A;  3HD8 B;  4OQ9 A;  1BBT 1;  1VMF A;  4CTE A;  4DIQ A;  4AFM A;  5JSP A;  2JIJ A;  4J1W A;  1XQN A;  3CF6 E;  1W90 A;  4LO7 A;  2Z5W A;  4W65 A;  3E5U A;  2VOT A;  1DGL A;  1G7Y A;  1UZW A;  5ACA 1;  2I2S A;  4ZU7 A;  3IMM A;  5D21 A;  4NRQ A;  4K3U A;  5FPU A;  3SMH A;  1NCR C;  2YHJ A;  4ZU5 A;  3VBS B;  1DP0 A;  3Q8F A;  1QQP 1;  2JKB A;  1HJF A;  5L7O A;  1Y9M A;  4YVW A;  5DDJ 1;  2HBU A;  5ANQ A;  3ZPY A;  2TBV A;  1C3H A;  4MXW A;  2BGO A;  2WT0 A;  5CZK A;  2CV6 A;  4UW5 A;  3VBH B;  1S0F A;  5IK5 A;  3JXS A;  4L0P A;  2NYY A;  4CEW C;  4LBM A;  1Y4W A;  2GMM A;  2GSY A;  3IZO A;  2WZP P;  2B9U A;  3ROU A;  1ENS A;  4WZC A;  4QB2 A;  4IGP A;  1XND A;  4MAD A;  4NAM A;  3WV6 A;  4AWD A;  3WHT A;  3C7E A;  5GZG A;  1XC6 A;  4Z2A A;  2FDG A;  2VUD A;  4CP1 A;  5GLU A;  2HEW F;  1W99 A;  4Y20 A;  3C2U A;  2WIN B;  1AL0 G;  2HBT A;  4DUW A;  1MS9 A;  2JE8 A;  4N90 A;  4LK6 A;  4MHR A;  2P6C A;  3IAQ A;  5C7G A;  4GWN A;  1XYP A;  4MGI E;  2P3I A;  1QGL A;  2WWS A;  1CJP A;  3AXE A;  3U78 A;  4LPL A;  5GKA C;  3BN6 A;  1CVN A;  3LEK A;  1YHF A;  2PLV 2;  3LFM A;  1W3V A;  3MW3 A;  4ORF A;  1RUC 3;  4HAN A;  1H1A A;  1OUX A;  2VZQ A;  1VR3 A;  3INA A;  3MF6 A;  4FXG B;  1GNH A;  3N9M A;  1A8D A;  2XR4 A;  4Y4Y A;  2FBE A;  3WIN E;  5I0D A;  3VHO A;  5J37 A;  4ASM B;  4ZZ5 A;  2ZAH A;  5EJ1 B;  4FQZ A;  1SFN A;  1ASJ 1;  5E16 A;  1DYO A;  2A6Y A;  2R7E B;  4QPG A;  4XEZ A;  3WVJ A;  1REE A;  2PHF A;  5C8W A;  1VBC 2;  1QJX 2;  1YFX A;  3KLS A;  2VNV A;  2X5I A;  4U36 A;  4B4R A;  1GQH A;  3A7Q A;  3WQB A;  4UYB A;  4XJA A;  2NQY A;  2R06 2;  3FHQ A;  3AMN A;  2XPJ A;  4BQ1 A;  5FLH A;  2ZX2 A;  5F5I A;  1LOG A;  1JU4 A;  3J7L A;  5T54 A;  4D6S A;  5CFD A;  3I49 A;  1WLT A;  4WV8 A;  4P00 B;  1MQT A;  2VOX A;  1W9T A;  1AX2 A;  1RJ7 A;  1CN1 A;  2HWF 2;  1WLC A;  2HJI A;  4J6G A;  4QXK A;  3N7M A;  2O14 A;  4AED B;  3NKG A;  5FXV A;  3N7J A;  4IV3 B;  4UW3 A;  2D44 A;  1RUI 1;  4CCE A;  4UI9 L;  4UXA A;  1DCS A;  1J1T A;  4NE9 A;  3AKQ A;  3J7N A;  3KHB A;  4ZXE A;  1MEC 1;  2D3S A;  2PAM A;  1W9W A;  2ZGT A;  5SV8 A;  4JTN A;  5FZO B;  1N1S A;  3M3C A;  2QQK A;  1C1L A;  4RL7 A;  3LAG A;  1YYN A;  3AJZ A;  1A78 A;  1FI2 A;  1UF2 C;  5JPM B;  2VMF A;  1FYU A;  3RMX A;  3ZXK A;  2O0O A;  1E5H A;  3VZM A;  4DPN A;  4CU8 A;  1FNZ A;  2JEN A;  1RUG 2;  2XJV A;  2EAK A;  2EXI A;  3VZJ A;  5KHJ A;  1VBE 3;  3I59 B;  4YVW C;  5LRR A;  3GBG A;  5IAT A;  2G9G A;  5CIR A;  3WG1 A;  4EZ4 A;  1CAW B;  3N9N A;  2W39 A;  1RUD 1;  2BDR A;  3JUU A;  1L7Q A;  4G9S B;  3VDD A;  3HAG A;  5EYX A;  4NN0 A;  2X10 A;  1F35 A;  5IVB A;  3BTZ A;  1WCU A;  2V4V A;  2XUE A;  5JI9 A;  1G9F A;  4ISQ A;  2GC0 A;  2YC0 A;  3LF7 A;  3MIE A;  3IDB B;  2JXA A;  4CCN A;  4NJ4 A;  4V1P A;  1PGS A;  2QQU A;  2ZX4 A;  3W5N A;  5ABJ B;  5CAZ A;  4IEQ A;  2LUW A;  3O5S A;  1CAU A;  5BNP B;  3HPN A;  4NHX A;  1XNC A;  2VOW A;  2ZGP A;  2B8M A;  4K40 A;  3KT1 A;  1NLR A;  4LMF A;  5C6C A;  2BV4 A;  1RUE 2;  4KG8 A;  5FTT C;  3OY8 A;  1FV2 A;  2HWD 1;  3SCG A;  2QCS B;  3Q9O A;  5HCH A;  4Y26 A;  1SLI A;  3E5Q A;  3OTF A;  1OOP A;  3MPB A;  4Q26 A;  2EXK A;  3UNP A;  3NVC A;  2X53 S;  2JX9 A;  1EPW A;  4BDV B;  3UGF A;  1GZW B;  2D6N A;  4JVA A;  1RHI 1;  2K9Z A;  2BGP A;  5FBZ A;  2Z4F A;  2WA3 A;  1S0J A;  2HWC 2;  2WRA A;  3EHK A;  4EZH A;  2FDJ A;  4FFH A;  1A34 A;  2OA2 A;  4XIO A;  3ZXG A;  3DKW A;  2W1U A;  5A7W A;  5BNO B;  4Q4X 1;  4CDW A;  3EBR A;  1HV1 A;  5CKM A;  3WG2 A;  5JXH A;  3LDK A;  4ES8 A;  2HWE 2;  4O9E A;  2IZW A;  4OUS A;  4QT6 A;  2Z2S B;  2XJQ A;  3FBM A;  4XHB A;  3NWK A;  3SKJ E;  5FOB B;  3ZOI A;  3MV1 1;  4XDQ A;  5GZF A;  4XQD A;  2JDH A;  4C91 A;  4QPG C;  4A42 A;  1GV9 A;  3MLJ A;  1LGB A;  1UY4 A;  4FTE A;  1YLL A;  1IQD C;  4U2A A;  3VBR B;  2Q1F A;  4RS5 C;  1IS3 A;  1B35 C;  2TNF A;  5J1X A;  1S0D A;  4LBN A;  1H0B A;  1RYY A;  4P9J A;  1ZZ7 A;  1HN0 A;  3THP A;  1YQ6 A;  5I93 A;  4Q4V 2;  1JYC A;  5CFD C;  4CCM A;  3T09 A;  1MZ6 A;  4KWU A;  1HRI 1;  1DYK A;  1RGS A;  2P6H A;  2R16 A;  2Y6G A;  3KGL A;  3M3I A;  2Q4S A;  3QD6 A;  5JIA A;  1HQW A;  5FZL A;  2B7Y A;  2PLV 3;  3RI9 A;  1QEX A;  1O59 A;  2BWC A;  5EQU A;  4XF9 A;  3N7L A;  1OLM E;  3VKF C;  1JHN A;  3AJY A;  4CDX C;  2CDP A;  1UZY A;  1KS5 A;  3OUJ A;  3EO6 A;  2WFF 1;  3MIF A;  4X8P A;  4XUR A;  1NE6 A;  1ND2 B;  1PK6 B;  1XNA A;  4PIZ A;  4FP3 A;  2NPI A;  4IEO A;  2Y60 A;  2P5B A;  5T50 A;  3BOW A;  5IVC A;  3D8C A;  4QDQ A;  2WKK A;  2ATF A;  3HQU A;  1VBC 3;  1QJX 3;  2ZPX A;  3IN9 A;  3WZ1 A;  4AEM A;  2WYF A;  4D94 A;  5F2W A;  4ISR A;  4HMZ A;  3NAP B;  3WQ0 A;  4R4Z A;  2R06 3;  2GMP A;  1X8E A;  1PZ7 A;  1PZ8 A;  4AVC A;  1OLR A;  3OBA A;  1CIW A;  1ZBA 1;  4XAB A;  3WSO A;  3POS A;  5KXC A;  2WQ8 A;  4TXW A;  5FZ7 A;  5JZG B;  3ZSE A;  4MGT A;  4PF1 A;  3S57 A;  3S7E A;  5HBA A;  4I02 A;  4EN6 B;  2Y0I A;  2HWF 3;  3N7K A;  5BXX A;  5JOZ A;  2VME A;  2R0H A;  4RHV 1;  4MSV A;  2JIG A;  5D2A A;  4QPI B;  4K9S A;  3K2O A;  5C33 A;  1SPP A;  4QGM A;  1ZRC A;  1XRU A;  5FUP A;  1I9R A;  4Q0U A;  4BLJ A;  1AYN 2;  1OH4 A;  2N7G A;  1K42 A;  3RWK X;  5D8A A;  4EN8 B;  1NCQ A;  1AXY A;  1WCD J;  2VW2 A;  2A1X A;  2E32 A;  2YU1 A;  3SH5 A;  1WBL A;  4MGS A;  2R07 2;  1J1L A;  2BFU S;  3OD0 A;  5JI7 A;  1RUF 1;  4MLO A;  5FYY A;  2PEL A;  1RUG 3;  4AHY A;  2RMU 1;  3RZJ A;  4NHY A;  2IXI A;  2LS6 A;  2MEV 3;  3PTR B;  4Q4W 2;  4YFZ A;  1SFY A;  3GZA A;  2JG9 B;  4CDU B;  3E6C C;  4P9L A;  3M1H A;  4Y3O A;  4DOU A;  2OUJ A;  1X7N A;  1O7F A;  3OGR A;  3OYW B;  3AKS A;  2A75 A;  4MXV A;  4PLO A;  4AQT A;  1ZA4 A;  1M06 G;  1Q8Q A;  2WS9 1;  3BIE A;  2ZHK A;  2J22 A;  4EWD A;  1GWK A;  2TEP A;  3ZN6 B;  1NKG A;  1RVF 2;  4XFI A;  4QWN A;  5SV5 A;  4GKX A;  1TNF A;  3JBG 2;  2DU1 A;  3DYM A;  2Q8E A;  2UWA A;  2G19 A;  1RB8 G;  3ST7 A;  2PHU A;  4GXL A;  5FYZ A;  1JBC A;  4LXL A;  1RUE 3;  5LZ6 A;  3ZO0 B;  3KV6 A;  4ARY A;  3O1M A;  1KFX L;  4QGN A;  5BNN C;  2ETE A;  2GND A;  4XC9 A;  3GCX A;  2G9F A;  1XOY A;  2XXZ A;  3LOB A;  1IPJ A;  3O12 A;  3S5Q A;  1COV 2;  4WVM A;  4CEY B;  4UFL A;  4XMI A;  3SCF A;  2HWC 3;  4IGQ A;  5FRA A;  5HXM A;  4RQP B;  3KCY A;  4AI2 A;  5KWR A;  1QOS A;  3PTY A;  1ENX A;  1CX1 A;  3LA2 A;  4Y1X A;  5FWE A;  4KQ7 A;  2ZMN A;  2C24 A;  4X6Q B;  2VCC A;  1H8V A;  2JG8 A;  1CJD A;  5JUV A;  1UNB A;  1JYN A;  3OGJ A;  4YG0 A;  3ZXL A;  5CG9 A;  4AHW A;  2HWE 3;  4YLZ A;  5FZH A;  1OVS A;  3H0O A;  3AVS A;  3FE5 A;  1BLZ A;  4BE3 A;  4KMQ A;  2C6S A;  5I8S A;  4YPJ A;  5A6X A;  2ET7 A;  1QIQ A;  4ZU4 A;  4B1M A;  3FHI B;  1WA4 A;  1IG0 A;  2A6Z A;  3CO2 A;  4ATE A;  3H1Y A;  4FPL A;  1W3X A;  2ARE A;  4XUN A;  3NW4 A;  3DKQ A;  4A44 A;  4BME A;  2AEZ A;  2Z79 A;  3CBN A;  4CCD A;  3ETP A;  1GP4 A;  4KH9 A;  3PVO A;  1UYX A;  1YFY A;  4JGZ C;  1VBD 1;  1W6P B;  4NHM A;  1Y9G A;  3VZN A;  4Q4V 3;  2BVV A;  4CCL A;  1GQG A;  4AF9 A;  4IEU A;  4LUL A;  2NP0 A;  1GP6 A;  3KVB A;  1RUJ 2;  2BTV C;  4QKB A;  2Y0O A;  4XXA A;  1F8V A;  1U0A A;  2PMW B;  3I2H A;  1C57 A;  3KF3 A;  3I2D A;  3R4S A;  4WVW A;  5JCT A;  4KGG A;  4YGB A;  1PX3 A;  4ASL A;  3KD4 A;  4WBB A;  5FP3 A;  4UW4 A;  3KSC A;  4KL1 A;  5F6L B;  3ZXE A;  1XE0 A;  2XQR A;  3SCH A;  2AH2 A;  5D8A C;  5HV0 A;  1EV1 1;  5M0T A;  1R09 2;  3O1O A;  2ZGK A;  4GQ7 A;  1VRH 2;  2ZX1 A;  4WM8 A;  2FDK A;  3I97 A;  1RMU 1;  2CGO A;  4YGE A;  1URX A;  2XH6 A;  5FK8 A;  3M3Q A;  5FYM A;  1UY2 A;  2NMO A;  2PTM A;  2JB4 A;  4PLM A;  1LUL A;  5FMC A;  1S2E A;  2NM1 A;  4AFD A;  5JWP A;  1YQ8 A;  3RSJ A;  3U1X A;  1PMH X;  1UX7 A;  3AVR A;  1PVX A;  1JYT A;  3TNP B;  3NO8 A;  2PHW A;  5ISL A;  3JD7 2;  3UKT A;  2VQU A;  3MLL A;  4COV A;  1O3R A;  4IQP A;  3N4M A;  5FZ4 A;  4YM1 A;  1N3O A;  4LE3 A;  4LIV A;  2P37 A;  3WOG A;  1TG7 A;  4YW1 A;  1TMF 2;  1F31 A;  4MHU A;  2ZKN A;  2XWJ B;  1G86 A;  3NNF A;  4GIQ A;  4GB3 1;  5DAP A;  3U07 A;  4LO8 A;  1LHN A;  5T5L A;  5HPO A;  3LIG A;  4CUG A;  1UY1 A;  4BHP A;  2RM2 3;  1AYN 3;  3UT0 A;  2FCT A;  3MPP G;  4FOV A;  3VBS C;  3RZG A;  2D3R A;  4B7K A;  3IPV B;  3LDB A;  3FLP A;  3DCQ A;  2R49 A;  4ARX A;  2Y6K A;  1HXS 1;  4GMP 0;  3ZYP A;  1LCL A;  4XFG A;  1V9U 1;  1HB3 A;  3ACL A;  4AEK A;  1Y3T A;  2WNE A;  4F7Z A;  3T08 A;  4W6Y A;  2P1B A;  3A23 A;  1OHF A;  3NST A;  2IXH A;  3D0J A;  1TE1 B;  4Q4W 3;  2VZO A;  3GGL A;  1VP6 A;  1OI6 A;  1FMD 2;  4IEZ A;  4M3C A;  3UK9 A;  4K8F A;  4D6R A;  1PZ9 A;  3IDC B;  3FLR A;  3T0D A;  4YZ3 A;  2WZ8 A;  3PJY A;  4BQ4 A;  1ULO A;  1STM A;  2JG8 C;  5DZF A;  5JIU A;  5H9R A;  3VZO A;  4XFC A;  3GCW A;  5A7P A;  2CDO A;  5A6Z A;  4J25 A;  4E8C A;  3E6B A;  4ASK A;  1AR6 2;  1DFQ A;  2D7F A;  1BEV 1;  2QQV A;  2WNO A;  3JBG 3;  5EFU A;  5FZI A;  1J3R A;  5A80 A;  1VAV A;  4DY3 A;  1NT0 A;  3B9C A;  3MBW A;  2PHT A;  4P9I A;  5LAS A;  1D4M 1;  5DUX A;  2OQ6 A;  1OC1 A;  3MDP A;  1POV 3;  4P5H A;  1DIW A;  2XHK A;  3OJB A;  3TOJ A;  3ES1 A;  4COY A;  2ERF A;  1Z7S 1;  2FZ1 A;  2FCU A;  4D8M A;  5C5T A;  2VE1 A;  4Y1Y A;  4Y33 A;  1CGP A;  1DQ6 A;  1SCR A;  4R9A A;  1K5J A;  1T6B X;  4H3W A;  1XNT A;  4KGQ A;  2VUC A;  3N35 A;  1E5S A;  2NN8 A;  5L9B A;  1NLQ A;  3ZN4 A;  2YG0 A;  4IND A;  4ZKT B;  1COV 3;  3H8U A;  4ES9 A;  2MPF A;  4AVB A;  4QXB A;  5FZ3 A;  3NJV A;  4JTO A;  4N8M A;  2WAB A;  3CZJ A;  2YBP A;  4Q0S A;  2VXJ A;  1OA2 A;  1DBN A;  1Q43 A;  1BMV 1;  1Q8S A;  1KFU L;  4D0Q A;  3HN3 A;  2IVI B;  2Y6H A;  2R04 2;  5DZE A;  2WT1 A;  3MLK A;  2RVA A;  1SDW A;  1APN A;  2B46 X;  1LHU A;  3LIH A;  4PQ9 A;  1PVC 1;  3ZFE B;  1AHS A;  2D3P A;  3HBZ A;  3NV4 A;  2J1U A;  2P3Y A;  1S2B A;  5J3U A;  3KGZ A;  1IS6 A;  1FPN 3;  3M4F A;  3ZLI A;  4BH9 A;  4CP9 B;  2BPA 2;  5JPN B;  3P3P A;  1V6J A;  4RFT 0;  4XDP A;  1IZ3 A;  2XL9 A;  3ZXA C;  2VMH A;  2H6B A;  3T4H B;  3UJO A;  4UFJ A;  2Q8C A;  4HT1 T;  3PU3 A;  1WCQ A;  2ET1 A;  2P17 A;  4OI1 A;  3O1V A;  1GUI A;  4IV1 B;  4AED C;  3WUC A;  4UFH A;  4IV3 C;  1MS8 A;  4IET A;  1RUJ 3;  3K4D A;  3W58 A;  5C8C A;  4MGQ A;  2DVG A;  4CU7 A;  1BYH A;  4LKD A;  3I3M A;  2DUQ A;  1W8T A;  2WSU A;  4QXH A;  4MVT A;  1SEF A;  2D5F A;  3GJA A;  5A1A A;  4OI0 A;  5FXW A;  1XSQ A;  1UOF A;  4KU8 A;  3O1S A;  3DEC A;  5CKQ A;  4FFG A;  4I0B A;  1W8N A;  1YNA A;  2Y34 A;  1J59 A;  4M4R A;  2CAU A;  5F3C A;  5C4W B;  2R6Q A;  4NPL A;  2HEY F;  4AI1 A;  1R09 3;  2JD9 A;  4AOC A;  1PM4 A;  1ULE A;  3HNM A;  4L11 A;  4V2V A;  3RJ2 X;  4HET A;  1VRH 3;  1FAT A;  3TBD A;  1WA6 X;  2MHF A;  4Q4Y 1;  4TTG A;  1PIV 1;  3LPF A;  5I0S A;  1F4A A;  1NCR A;  2KXL A;  1DLC A;  3BTX A;  2XVK A;  5E1R A;  2YPD A;  4I30 A;  4AHX A;  2O8Q A;  3JD7 3;  3I2O A;  4ZS2 A;  3SEE A;  3MUY 1;  3VHR A;  4BQW A;  4D7Y A;  1RC6 A;  2W5F A;  5D1I A;  3BTA A;  1QDC A;  1DZQ A;  4QPI A;  2WLQ A;  4AGR A;  3NNG A;  1W8H A;  3KVA A;  2W0X A;  4CEW A;  4AI8 A;  2A5Z A;  2WLP A;  3P1I A;  3OCP A;  5LBF A;  4RSU A;  1LEN A;  1TMF 3;  5FZM A;  3VZL A;  1EAH 2;  3WNN A;  2HEV F;  1NA1 A;  5FYH A;  5CFC B;  2WAO A;  4GUL A;  4BA6 A;  2XBO 2;  1IKP A;  3GM8 A;  1H1M A;  4NPM A;  3GNE A;  1H4H A;  3BVC A;  4FFF A;  4HON A;  1RTV A;  2IXL A;  5FZG A;  4AYU A;  1OFS A;  2GAU A;  3C7F A;  1JUH A;  5FZC A;  3WF2 A;  3N36 A;  1DGW A;  4IE5 A;  1DU3 D;  4DQA A;  2AEY A;  2G1M A;  1QJU 1;  2ID4 A;  1GAN A;  4I0A A;  3ACG A;  1UOB A;  3HN1 A;  5BNO C;  1ZZ8 A;  3A22 A;  3JCI A;  3RZZ A;  2W52 A;  2VEC A;  4EJR A;  2BOI A;  2WNV B;  3R05 A;  4FT8 A;  4OHV A;  2DWR A;  2D6L X;  2QTW B;  2VU9 A;  1FMD 3;  1KJL A;  5A3P A;  5B4N A;  2BJS A;  3ILR A;  2C26 A;  4EN7 B;  1LNS A;  3MI8 A;  4BWO A;  2QJV A;  3KV5 A;  3GDB A;  1H8T A;  2W47 A;  2R1B A;  3RNS A;  1UXX X;  1AR8 1;  1HLC A;  1ZRR A;  3AZY A;  4XIL A;  1AR6 3;  3LQC A;  1BK0 A;  1G6N A;  2JDP A;  1GOH A;  3AMP A;  2BP6 A;  4NIG A;  2BFU L;  3R4D B;  4B29 A;  1AYM 2;  3WDU A;  1W2O A;  3POB A;  1OD3 A;  5J09 A;  5F2S A;  5GLV A;  1RIN A;  1RUH 2;  2LTN A;  3D4K A;  1VB4 A;  5JR7 B;  5DUU A;  3O7O A;  2VUJ A;  1C8M 2;  3VBU B;  1U12 A;  2QVS B;  2SBA A;  4B4P A;  2XQX A;  3UKV A;  4W6W A;  3Q8A A;  4E2Q A;  3CJX A;  1JZ6 A;  5IHR A;  2ZHM A;  4JKM A;  4XQW A;  3QBQ A;  2WBK A;  5FPV A;  1Q3E A;  1UOJ A;  1VBB 2;  1D4V B;  2YGM A;  2CSG A;  1ZRE A;  3KHC A;  4DUX A;  1QU0 A;  4OI2 A;  3UV9 A;  2AR6 A;  4BZ4 A;  1PK6 C;  1ND2 C;  3PVB B;  2VBD A;  5C3R A;  4QPY A;  4S2D A;  4B3N A;  2VMC A;  1ODM A;  1MVE A;  2R04 3;  4ZXK A;  3U14 A;  4IE0 A;  4HPK A;  4N43 B;  2Q5T A;  2Q8O A;  3S7I A;  4LUK A;  1PMI A;  4NO4 A;  5BY5 A;  2OYZ A;  4K20 A;  4YGC A;  5APA A;  1D0H A;  3NAP C;  2Q30 A;  4NID A;  2OZ6 A;  3K3N A;  3C8X A;  2EIG A;  2ZOE B;  1LRH A;  4GMP 1;  1WW6 A;  1OFN A;  2Y33 A;  2OXB A;  2FDH A;  5FMO S;  2XVL A;  4JC1 A;  3VZK A;  1PGW 2;  2W1W A;  5A70 A;  3SKV A;  1F15 A;  3AXD A;  4QHO A;  5KHH A;  3WG4 A;  2P3K A;  5FZD A;  2QFE A;  1SFP A;  4M00 A;  4CP0 A;  5BV6 A;  3BU0 A;  4GAL A;  2WJS A;  2ARC A;  4LJH A;  4QPI C;  3FFZ A;  5FPB A;  1QF3 A;  1M4W A;  4BU2 A;  1AR9 1;  1R08 1;  2RDN A;  3CNA A;  4XJ9 A;  4ATF A;  1REF A;  3K4Z A;  4GWM A;  3IB3 A;  4LIT A;  1CX4 A;  1PO1 1;  1NA1 C;  2ZHL A;  3JB4 C;  1QY4 A;  3NL1 A;  2RS3 2;  3QLQ A;  2YFZ A;  4XFB A;  2D6K A;  3UKN A;  3WQ7 A;  3P5B A;  1G9D A;  2CGN A;  3GXU A;  4NUB A;  3WLU A;  1SCS A;  1BVP 1;  4Q29 A;  4TWT A;  4L97 A;  3ACI A;  4L92 A;  2VZR A;  3AYA A;  4OFG A;  1QJZ A;  4NRP A;  4X8N A;  5GLW A;  2VQT A;  2WII B;  4C1W A;  3B3Q E;  4P5Y A;  1OQ1 A;  2HKX A;  1VE0 A;  2JG9 C;  1HRV 2;  4JGY B;  5LBC A;  4QD2 A;  4CDU C;  5K7P A;  3RS6 A;  1J84 A;  3E1F 1;  4MUV A;  3U4S A;  1LJ7 A;  1UPI A;  2A3Y A;  2XLF A;  1ZBE 1;  3I4I A;  3JQX A;  1XYN A;  3T2O A;  2DCJ A;  4DRV A;  1CES A;  2VW0 A;  1DQ1 A;  1LOF C;  5FY1 A;  4IW3 A;  1DGW X;  1K5M B;  5TSW A;  2GN7 A;  3EXU A;  1H8T C;  1X82 A;  1NLS A;  2BRT A;  3FFQ A;  4QPW A;  3POG A;  4YSF A;  3KF5 A;  3VV1 A;  4QGL A;  2KA3 A;  4FPJ A;  1ZZC A;  2E51 A;  2GH8 A;  4LUM A;  1CZS A;  5LA0 A;  1EAH 3;  3VDC A;  4TZD A;  2ADD A;  4YW5 A;  2H0B A;  1BBT 2;  1X33 A;  2XB6 C;  4QM8 A;  4XAC A;  4ITC A;  5AC9 1;  2XBO 3;  1Z78 A;  2XJR A;  5IJR A;  3AZV A;  2HH9 A;  3I8T A;  3VD3 A;  2R0F A;  1ENQ A;  2MEV 1;  2BGC A;  4CCJ A;  1HDK A;  4QU1 A;  1VBA 1;  3GHN A;  5FZ9 A;  5ACA 2;  2RR1 1;  4CEY C;  1FT9 A;  1LU2 A;  1W6N A;  4RS5 A;  2DTY A;  1B35 A;  2IXJ A;  4XUO A;  4RQP C;  2QQP A;  2QNK A;  4P08 A;  1UCX A;  1QQP 2;  2BBA A;  4P9X A;  3ZYG A;  1W6O A;  5C9A B;  3O0W A;  5DDJ 2;  2RS5 1;  4KWL A;  5FO7 B;  3WNM A;  1CWP A;  4FP2 A;  2UWB A;  4CDQ B;  1WWY A;  3AK0 A;  4F3J A;  4FAH A;  4IXL A;  1MS0 A;  1NXM A;  4LOT A;  3H8O A;  4IUG A;  2R1D A;  3K75 B;  1JN2 P;  3O1R A;  5JOW A;  5FMB A;  1SLL A;  4NPR A;  3ABZ A;  2YV8 A;  4CDX A;  2QBX A;  4BQ3 A;  3WG3 A;  4S2H A;  3ZFG B;  2VVD A;  3LWC A;  4CUB A;  2W91 A;  3RVH A;  1NZI A;  4HSJ A;  1RIR A;  2EAA A;  2Z69 A;  3BCW A;  3BPS A;  4PDW B;  1JTZ X;  1YWK A;  2QQL A;  3B5L B;  2FD8 A;  3W5M A;  2DFC A;  3PLQ A;  3AC0 A;  1AYM 3;  3AZW A;  4LBO A;  4XBN A;  5AVP A;  4OZX A;  5A3U A;  3CHX A;  3VBF B;  1HW5 A;  1JZ7 A;  3Q8E A;  5GM0 A;  2VNG A;  1ZZB A;  3IAP A;  1YI7 A;  3I3Q A;  1OPM A;  3EJK A;  4OUM A;  4YG6 A;  1C8M 3;  4E4Z A;  1G9A A;  3DPR B;  3WF3 A;  4PT6 A;  2HYK A;  1MS3 A;  3VLB B;  4FPG A;  5H9Q A;  3MIH A;  2YY1 A;  2HWB 1;  1ULC A;  2E7Q A;  3WY6 A;  4A7Y A;  3THT A;  1LES A;  2C4X A;  2JEM A;  4FCA A;  4AQ6 A;  1W8U A;  3BGA A;  4NHK A;  1WME A;  1X9T A;  3ZFE A;  1S0E A;  3AZX A;  3NRU A;  1C1F A;  2WQZ C;  2XL7 A;  1JZ4 A;  4D7T A;  1UW8 A;  2PQQ A;  1W6M A;  5F7U A;  4YZ1 A;  1GIC A;  2VZV A;  2UYA A;  3QAC A;  4KI5 M;  4EQV A;  4AFB A;  1UMI A;  5FBJ A;  3FWE A;  4GWJ A;  5A3T A;  5BYN A;  1ASJ 2;  3USS A;  3KCX A;  5K8S A;  3WD5 A;  5KXD A;  1E5I A;  4MG2 A;  2J1T A;  3CIH A;  2GNB A;  4OCT A;  1W9F A;  2YZ4 A;  1NXD 1;  4R52 A;  3ZXF A;  4XE9 A;  4XUQ A;  3VB9 A;  4OQ8 A;  4I01 A;  3VD5 A;  1LHV A;  2VBP A;  4BXS V;  1ZX5 A;  2YC4 A;  1GNZ A;  3I2I A;  4QQO A;  5DAW A;  3ETQ A;  4K1Z A;  5T55 A;  3V0B A;  4EYU A;  3OPT A;  4HXC A;  3S0M A;  3MUZ 1;  4FXK B;  3IDA A;  2PHD A;  2X8K A;  1ZZ6 A;  1UO9 A;  1JYV A;  1O8S A;  2CWM A;  2IWG B;  5FY4 A;  2Y38 A;  2WAA A;  1Q5O A;  4O61 A;  2ORZ A;  1XE8 A;  5FP9 A;  4N7U A;  5LK5 A;  1RUI 2;  4RGA A;  2V5D A;  1OLM A;  2RS3 3;  3GZU C;  4A45 A;  2XDV A;  1C28 A;  4DEQ A;  1CAX B;  1I5Z A;  5CEH A;  1MEC 2;  3TEW A;  4DXZ A;  2BER A;  4NRM A;  5FYI A;  1W6Q B;  4QX8 A;  1NYW A;  2VY0 A;  2VNR A;  2BOJ A;  3AB0 A;  5AVA A;  5BNN A;  1C5I A;  3BOP A;  1H9W A;  1GZ9 A;  3NNJ A;  4A7Z A;  5BNQ A;  1HRV 3;  1OVP A;  1AVB A;  2WA4 A;  1CAV A;  3SXW A;  2Y6L A;  4MZU A;  2RS1 1;  5DG1 A;  1RUD 2;  3ELN A;  4XDO A;  4COZ A;  3V0A A;  2WNU B;  2UU8 A;  4IDZ A;  4HN1 A;  5LK7 B;  4XFF A;  1AF9 A;  4XBL A;  1S0C A;  1H2L A;  2RM2 1;  4GH4 B;  4NRO A;  2ZEX A;  1AL2 1;  5A32 B;  3ZDV A;  4LHS A;  2WDB A;  2UUR A;  3C7O A;  4X6R B;  4Y5Z 0;  5GZD A;  5A7Q A;  3S30 A;  5KC6 A;  1H4G A;  2NZ9 A;  1J3P A;  1VAM A;  1WW5 A;  3SH3 A;  5C3O A;  1BBT 3;  4BJ0 A;  1SMV A;  3ENR A;  5JAX A;  4BIS A;  4FPO B;  3POY A;  2RDR A;  4KBZ A;  1D2Q A;  2IFW A;  3WT3 A;  2A6X A;  1E57 A;  2HWD 2;  1QWR A;  2XJU A;  5A7S A;  3VBO A;  3EYP A;  5C3S A;  1RXF A;  3CJI B;  5ACA 3;  3KB5 A;  2ZZJ A;  4YZ2 A;  1A8M A;  2UYB A;  5BPX A;  4N53 B;  3TEX A;  4UBH A;  1GBG A;  3WP4 A;  4PI0 A;  1V0A A;  2DVF A;  4YVS B;  4C0H A;  5GZC A;  1RHI 2;  3AFG A;  4W6X A;  5DDJ 3;  4JGZ A;  5J36 A;  1H2M A;  4RGK A;  2Q0A A;  2ZXQ A;  4QX1 A;  3T2Q A;  5LA1 A;  1EY2 A;  3EQE A;  2WL1 A;  5A1F A;  4QQL A;  2R30 A;  4WM7 B;  4N9H A;  4Q4X 2;  3ZFE C;  3FLT A;  4FAG A;  4PLN A;  4LHL A;  5A33 B;  3KWV A;  1H1I A;  2GN3 A;  1N3Q A;  2RJL A;  2W94 A;  4UW6 A;  4CYD A;  4SLI A;  4E8D A;  1NOV A;  2D6O X;  1WD3 A;  2ZAA A;  4LBQ B;  4PCR A;  3ZIX A;  5CG8 A;  3WUD A;  1IGO A;  3QCW A;  1UWW A;  2VUL A;  4XBQ A;  4BLI A;  5HCF A;  2DBI A;  4YRD A;  1MR5 A;  4JDM A;  2DVB A;  2ZGM A;  3HQX A;  3T0A A;  1SQ4 A;  3WP3 A;  4BIF A;  1H30 A;  5FZA A;  4BM8 A;  4CP2 A;  3ZFF A;  1W06 A;  1QXJ A;  2V4A A;  3IMN A;  2FMD A;  4AK3 A;  3TN9 1;  1KS4 A;  3IIA A;  4RR3 B;  5EXO A;  4AAP A;  4DS0 A;  3PU8 A;  4CPB D;  4RD7 A;  5E89 A;  1HRI 2;  4XUP A;  4C90 A;  3H1M A;  4KU7 A;  2WZR 1;  3SEP A;  3SHR A;  5FKC A;  3A0K A;  4QQH A;  3TEZ A;  1H6Y A;  1FPN 1;  2D6P A;  4HKL A;  2BQP A;  4YWA A;  3W20 A;  3WNK A;  3OUI A;  3DYP A;  1QJE A;  4C0B A;  4AGG A;  1VMJ A;  1TEI A;  5C4W C;  1GOF A;  4FPE A;  3ZM8 A;  2WFF 2;  3V64 A;  2ZJC A;  2W46 A;  3B69 A;  4Q8L A;  5IYY A;  1TME 1;  4B8E A;  2BU9 A;  1O91 A;  1ASJ 3;  5EV7 A;  2CWS A;  5F5A A;  3D3A A;  2BWA A;  5IVY A;  3VBS A;  1Y43 B;  1G8W A;  5JLV A;  1JZ2 A;  4EE2 A;  2PQS A;  2X29 A;  3PUS A;  4KWJ A;  2EIC A;  4LBK A;  2B4K A;  1H2N A;  1FOD 1;  1O4T A;  4R4X A;  3USU B;  4LTA A;  3VBH A;  3BUC A;  2VMG A;  3MIB A;  3PUR A;  4COW A;  3ZYB A;  2K46 A;  4MYE A;  5JMC A;  1ZBA 2;  2B5H A;  1S2K A;  3B02 A;  4YZ4 A;  3J7H A;  1TNR A;  1LU1 A;  1R1Z A;  3AX4 A;  2QZ3 A;  1MZE A;  3AL5 A;  3EMR A;  3LFI A;  4KWK A;  5IW0 A;  4BQ5 A;  5F39 A;  4CUA A;  5CFC C;  3HVD A;  4JDN A;  3U75 A;  1IS5 A;  2VOK A;  2RJK A;  1FXZ A;  3IM0 A;  4RHV 2;  1UL9 A;  4MH0 E;  3ZPO A;  2AAC A;  2EVX A;  4M4P A;  2B39 A;  1RXG A;  5FJK A;  3CU7 A;  5GZE A;  3T2T A;  3K3O A;  1TQ5 A;  1RUI 3;  3N9Q A;  3UYJ A;  2VZU A;  1PO2 1;  2A71 A;  4XF4 A;  1PX4 A;  4UFI A;  3ZYF A;  3TEY A;  1MEC 3;  1X36 A;  1LR5 A;  2JJ6 A;  5A3N A;  4Q1R A;  3VBO C;  3OPW A;  5FMO L;  4BQX A;  4GAZ A;  1HX6 A;  3DV8 A;  4K8R B;  4UF0 B;  4URT A;  5IVE A;  1GP5 A;  2B9V A;  4XYX A;  2XLA A;  1XNB A;  3J8F 1;  1BKZ A;  4AXO A;  2D97 A;  3VN4 A;  1GWL A;  1RUF 2;  3PMS A;  5F9T A;  1F4H A;  2OW4 A;  2JD4 A;  1W2N A;  3T2P A;  2RMU 2;  1ZZ9 A;  2JDU A;  1GR3 A;  4DO0 A;  2J1S A;  1LAJ A;  3I54 A;  4EN0 A;  1GZC A;  1RUD 3;  3T1L A;  2WWU A;  4PBO A;  1KDK A;  3LEM A;  1SAC A;  4CU6 A;  2D5H A;  5B2G B;  3RYR A;  2XOM A;  3FBY A;  2C9K A;  5FLJ A;  1MZ5 A;  3DGT A;  3H1W A;  3BAL A;  5IT6 A;  1I1E A;  2C1F A;  2WS9 2;  3VKM A;  4JQT A;  4WVV A;  2KR2 A;  2GME A;  1W05 A;  1S0B A;  3MV0 1;  4JX0 A;  3RMY A;  3WDW A;  2JE7 A;  1LED A;  2EF6 A;  5F8P A;  2WN2 A;  1EP0 A;  1AR7 1;  2EA7 A;  2JDN A;  3PME A;  3VBU C;  1HQL A;  3ZYJ B;  1WCK A;  2HWD 3;  1OQD A;  4MGK E;  5LW9 A;  5FZ1 A;  5KHI A;  5FPA A;  5FZK A;  2YC2 A;  1QJY 1;  1MAC A;  5L7O B;  4YVW B;  1LHW A;  1HIX A;  2LRO A;  1PGL 1;  1QOO A;  4MXW B;  4CCO A;  2YDE A;  1RHI 3;  1DQ4 A;  4D69 A;  1DGR A;  3BKZ A;  4XFH A;  4S2F A;  4NIA A;  3ZFF C;  3P3N A;  2J1E A;  1E5R A;  2YYO A;  4K21 A;  4AED A;  5IAV A;  1VPH A;  2FZ2 A;  1C8N A;  4IV3 A;  1XBF A;  3MW4 A;  4IL7 A;  1OPO A;  3L9J T;  3R4U A;  3WHU A;  1JW6 A;  5F37 A;  3LCP A;  3PVE A;  3POW A;  1BXH A;  2VZT A;  2VTF A;  1HN1 A;  5EZW A;  5FZO A;  3TWI A;  1JYI A;  1UMZ A;  4AAX A;  2Y8K A;  5FZ8 A;  4GZ9 A;  5F32 A;  3FC0 A;  3WDX A;  3NNL A;  1S0G A;  3VBF A;  2ZHN A;  3AP4 A;  5KXB A;  4XQ4 A;  2D40 A;  1O4Z A;  4FPC A;  4XCB A;  1R1A 1;  3I59 A;  5CNA A;  4YAR A;  3OBZ A;  2DYC A;  1CAW A;  2YXS A;  4CUC A;  4AQ2 A;  2R07 3;  4AI3 A;  4YYO A;  3ACF A;  3NQH A;  3LA3 A;  5FYS A;  3VBH C;  5LCW L;  2W1S A;  3LZZ A;  1PMJ X;  4A3Z A;  5LBB A;  1W8O A;  1VBD 2;  2JDK A;  2PHR A;  4K1Y A;  5AFE A;  4Y5S A;  3WNL A;  4Y1U A;  3AKR A;  1ZM1 A;  3WP6 A;  1JZ3 A;  1HRI 3;  2BUK A;  2E63 A;  3ZDS A;  1WCS A;  3VKL A;  3I3E A;  1LOD A;  3THD A;  5ABJ A;  2B45 X;  2ZGR A;  5JSO A;  4FBF A;  5BNP A;  5L9R A;  3AFK A;  5L19 A;  3SNM A;  1OQE A;  2BW8 A;  4E2G A;  3LGR A;  1OT5 A;  2AGS A;  4MGY E;  2BEO A;  1RVF 3;  2D98 A;  1SDD B;  2WFF 3;  4LA2 A;  4OMC A;  4QPG B;  3C7H A;  4ZY9 A;  3WCS A;  3NNM A;  3POF A;  2ZS6 B;  2W87 A;  4LBQ D;  4PJY A;  5FYV A;  1EV1 2;  3O1U A;  3JQW A;  1MS5 A;  2YB7 A;  1D2S A;  2OPW A;  2YMZ A;  3H3L A;  2X5I B;  4ZON A;  1UX6 A;  4QKF A;  5FYT A;  1GZW A;  3S6P A;  1S0I A;  4OI4 A;  1RMU 2;  1GZT A;  3WF1 A;  5C3Q A;  5GAL A;  1UMH A;  4HG6 B;  2XVG A;  5F6K A;  1LOE A;  1LEC A;  1SBE A;  2KD7 A;  3WF4 A;  4BPZ A;  4JHZ A;  4CXX A;  5T52 A;  3I2G A;  2NLR A;  4HK8 A;  1O3T A;  5BNO A;  3BYW A;  1K5M C;  2W08 A;  1T6G C;  1MQT B;  2L9L A;  4XZU G;  1IHM A;  1ZBA 3;  5FKB A;  3AP5 A;  3WX5 A;  5AFB A;  1UYZ A;  1WD4 A;  2GU9 A;  3OGS A;  3LD8 A;  1CAX A;  3ZYH A;  1AX0 A;  1MS1 A;  2OZJ A;  5DXD A;  2JDM A;  3FMG A;  4L9B A;  3VD9 A;  4GB3 2;  1OA3 A;  4DMI A;  4H7M A;  1I5P A;  4XF0 A;  2UY9 A;  3D5O A;  5B4X A;  3MGU A;  4F83 A;  1O5L A;  1H6X A;  3VBR A;  4HSL A;  1IPK A;  4IER A;  4Q2F A;  2OX0 A;  1AJK A;  3SLI A;  2QQM A;  3AP9 A;  2ZTN A;  3B7M A;  4OUE A;  4TLF A;  3ZR5 A;  2W2I A;  3BB6 A;  3S5A A;  1HXS 2;  4BIO A;  1DZR A;  1ODN A;  1V9U 2;  2ZX3 A;  4XXP A;  1QXP A;  1AX1 A;  3WXP A;  4UFM A;  3AZZ A;  1RUF 3;  4Q0Q A;  1RUC 1;  2ZCW A;  4E4D X;  2VVF A;  1C4R A;  2VH9 A;  2Y6F A;  5LY2 A;  3VDD B;  2ES3 A;  1XJA A;  3E5X A;  5KC5 A;  3ZR6 A;  1WGP A;  2DCK A;  1PM7 A;  2WO2 A;  2WSV A;  1J3Q A;  1ND3 B;  3WDV A;  4JHT A;  1HB1 A;  4E4S A;  4QM9 A;  3ZFG C;  4CZS A;  5IAX A;  2JE9 A;  2FHR A;  4FPK A;  1YJL A;  1PK6 A;  1ND2 A;  1OXC A;  3TNQ A;  4PDW C;  2WS9 3;  1CAU B;  3Q8C A;  4RFR B;  3T30 A;  3VHP A;  3WNO A;  1JOD A;  4NAO A;  2Y64 A;  4Y1V A;  1BEV 2;  1GWM A;  3PUA A;  3VBF C;  3OY8 B;  2JDY A;  5LA9 A;  2VZP A;  3HIF A;  1D4M 2;  1W2U A;  4DRR A;  3J26 N;  3OF1 A;  3NAP A;  3POI A;  4HKO A;  3I3D A;  1OOP B;  5GLT A;  1Z7S 2;  1ZRF A;  3NJZ A;  1FAY A;  1MS4 A;  1NZC A;  4EWE A;  1OBN A;  2Y6J A;  5FDB A;  3F2Z A;  4AZZ A;  5JZG A;  3JU9 A;  3MYX A;  4LT5 A;  4D6Q A;  3POE A;  3PUI A;  1UY3 A;  4FOY A;  5A7W B;  2X09 A;  4K7J A;  3PL0 A;  4CDW B;  1JZ8 A;  1QHD A;  5ABJ C;  2SLI A;  5I0T A;  1BMV 2;  5BNP C;  1QXR A;  4CXY A;  3MW2 A;  4I09 A;  4OLL A;  4DIN B;  2ZAB A;  1PVC 2;  1YEW A;  3LPG A;  5JR2 A;  4LO5 B;  2LW8 A;  2PYT A;  1AXK A;  4M0H A;  4BQY A;  3HNY M;  1OF3 A;  1VBE 1;  2QUO A;  1G9B A;  2B42 B;  4CU9 A;  3AMQ A;  2QQI A;  1I3H A;  3RFR A;  3H7J A;  1QNW A;  3HR9 A;  1ZYB A;  2JG9 A;  3VUO A;  3FUQ A;  4CDU A;  4IEV A;  2WT2 A;  5IK8 A;  1W0P A;  1NY7 1;  3OPZ A;  2CL2 A;  1YUD A;  2VZ1 A;  2WO7 A;  4OYU A;  1VBD 3;  4QB1 A;  1IKQ A;  2C0Z A;  3N3H A;  3A21 A;  3OYW A;  5FXZ A;  4DNY A;  1O3Q A;  1TVG A;  1ULD A;  1YRZ A;  5CIS A;  3BTY A;  3K77 A;  1LOF A;  3ZN6 A;  1W0O A;  4HFS A;  4NOT A;  3GBF A;  3OEA A;  4KNC A;  1UZZ A;  5DPN A;  2I45 A;  3K48 A;  3BOD A;  5HCB A;  4Z92 B;  4LKE A;  5FAX A;  4D3W A;  3VBR C;  1ZNP A;  2WO3 A;  4C8D A;  4R8H A;  3ASI A;  4UOJ A;  4XTM A;  4AVS A;  1UU6 A;  1GMM A;  2VZ3 A;  1EV1 3;  2VGD A;  4HLT A;  2LM3 A;  3ZYI B;  1CZT A;  2DFB A;  5LB6 A;  2A6W A;  4AVA A;  5K0U B;  3KT7 A;  4Q4Y 2;  4QKD A;  1RMU 3;  3NV3 A;  3OEB A;  4CEY A;  1PIV 2;  2WNU C;  4RQP A;  2EAL A;  4QQP A;  1YQC A;  5C3P A;  4LO4 B;  2IFR A;  4GH4 C;  3APB A;  3A4U A;  3ZXJ A;  5J7M A;  3LOI A;  1VLN A;  2VVE A;  3TB0 A;  5LBE A;  2GC1 A;  3OBT A;  5E6H A;  5EIY B;  4PIX A;  4LLF A;  5LAT A;  1SLT A;  2JDA A;  5FXX A;  1SLC A;  2YBS A;  1UAI A;  4RYD A;  1XXN A;  1SPP B;  1LOA A;  3F95 A;  3SIT A;  3BIW E;  4GB3 3;  2WUH A;  5FYU A;  3CJI C;  4Y22 B;  2RHP A;  3KCC A;  1NCQ B;  4HOO A;  5D8A B;  4YGD A;  5HCA A;  3R6S A;  4XAE A;  3X29 B;  4N53 C;  2IVJ A;  5KHK A;  2WYS A;  5H9P A;  1NE4 A;  5FUN A;  1U5X A;  1HB4 A;  4IEW A;  5EP9 A;  4Q0P A;  5EJZ B;  3RZM A;  1W6P A;  4XJ8 A;  3KV4 A;  1HXS 3;  1QJU 2;  2A3W A;  4E27 A;  3PIG A;  2PLV 1;  1V9U 3;  3WF0 A;  5C70 A;  1UIK A;  5JZG C;  4WM7 C;  2XJT A;  1YC6 1;  1YQ2 A;  1AJO A;  3B01 A;  1DG6 A;  2YUE A;  5F3E A;  5FYC A;  4FPF A;  4ZHN A;  2J1V A;  2BNO A;  1RUN A;  1UPS A;  2ARX A;  1RL3 A;  1UQX A;  2IC1 A;  2PFW A;  3N9L A;  4QMA A;  3VDA A;  4ONU A;  1XU2 A;  3D6E A;  4QDS A;  4NIH A;  1JS9 A;  2WZE A;  1YO8 A;  3ALQ A;  4YW2 A;  2D93 A;  2CAV A;  3A0N A;  2QE3 A;  1KQR A;  1POV 0;  2EXH A;  3NJX A;  3PJQ A;  4BK4 A;  1VBC 1;  1QJX 1;  5DG2 A;  1AR8 2;  2TUN A;  4XJZ A;  1CON A;  2ILM A;  5FQ0 B;  4E2S A;  5CA6 A;  2PHL A;  1BEV 3;  1HJG A;  2AEN A;  4CSW A;  2LRP A;  2R06 1;  3H9A A;  1UU4 A;  2V72 A;  3VL8 A;  1D4M 3;  3SQO A;  3H8X A;  5JXJ A;  4E9K A;  3L2H A;  4LO6 B;  4RR3 C;  4LHK A;  4Y24 A;  1Z7S 3;  4AW7 A;  5CYY A;  4UWD A;  1D7P M;  1WW7 A;  2JDZ A;  3O0X A;  4WVM B;  1G9C A;  1BJQ A;  4I2O A;  2HWF 1;  1HB2 A;  1GYK A;  1XB9 A;  2JEC A;  2ZML A;  4R9C A;  2GC3 A;  2D43 A;  4A6O A;  4AL9 A;  3III A;  2OKX A;  4F8A A;  4YFW A;  1O6U A;  1W0N A;  1V6N A;  3C3V A;  4G4F A;  3RQ0 A;  2JG8 B;  3KQ4 B;  4OHY A;  5FV3 A;  4LBL A;  5FO8 B;  1SBF A;  3H8R A;  1PHM A;  2E7A A;  2VW1 A;  2Z42 A;  3N9O A;  1QKQ A;  3WW1 A;  5FWJ A;  3BPZ A;  4M01 A;  3O14 A;  4DXS A;  1PVC 3;  4IEY A;  3IPV A;  4AVT A;  3TAY A;  3RZK A;  3ECQ A;  4A3X A;  1RUG 1;  3AKT A;  4HVQ A;  1N1Y A;  4IE4 A;  2QQO A;  4B7E A;  2ZA9 A;  4DEV A;  4JCK A;  5I91 A;  1ZRI A;  2FMY A;  2OVU A;  1V6L A;  2GDF A;  5KXE A;  2UY8 A;  5FZE A;  3HT2 A;  4ZPI A;  1ZA7 A;  1Y7B A;  1EYB A;  4YNI A;  5CKN A;  3O0V A;  4MX3 A;  3J9S A;  4LOR A;  2W9X A;  4Q0V A;  4LK7 A;  5ANN A;  5A7N A;  3OOX A;  4LR4 A;  4XFA A;  1OF4 A;  1WW4 A;  4MGZ E;  1DQ0 A;  3U4X A;  1LGC A;  1QH6 A;  1YIF A;  2BNN A;  2H6C A;  1AR9 2;  2I74 A;  1R08 2;  3IWZ A;  4PHZ A;  1OKQ A;  1V70 A;  2QQJ A;  5FYB A;  4N9I A;  3TRS B;  1PO1 2;  1FNY A;  1RUE 1;  2GNM A;  3VDB A;  4R9D A;  4H14 A;  3MFC A;  3FL7 A;  1O3S A;  4IEP A;  1PNF A;  2ZEY A;  4JKK A;  4WM8 B;  3ME2 A;  1NG0 A;  4XOG A;  2HWC 1;  2DBN A; 
#chains in the Genus database with same CATH homology
 2V4A A;  5IAV A;  4XC9 A;  5DAQ A;  5LBF A;  4NAO A;  5EP9 A;  4XAA A;  5LA9 A;  5DAW A;  2RDQ A;  3BVC A;  5LBC A;  3NNL A;  3OUI A;  4J25 A;  5DAX A;  4XCB A;  2G1M A;  4Q5O A;  5LAS A;  3OBZ A;  3HQR A;  3PL0 A;  5EQU A;  4IW3 A;  5C5T A;  2FCU A;  5LBB A;  5L9V A;  2RDS A;  3OUJ A;  4Y5S A;  5L9B A;  4XAC A;  3GJB A;  3DKQ A;  4NHL A;  4BQY A;  3NNJ A;  5L9R A;  3HQU A;  3EMR A;  4NHM A;  4UWD A;  3ITQ A;  3NNM A;  2JIJ A;  4ZON A;  2OPW A;  3GZE A;  4XAB A;  5C5U A;  2RG4 A;  5IAT A;  4BQX A;  5HV4 A;  2JIG A;  5M0T A;  5HV0 A;  4NMI A;  2HBU A;  4JZR A;  2RDR A;  3OUH A;  4KBZ A;  3W21 A;  4Y5T A;  4NHX A;  2A1X A;  4ZPI A;  5ERL A;  3KT1 A;  5LB6 A;  5A3U A;  3MGU A;  3GJA A;  5DAV A;  3KT7 A;  4NHY A;  4XCA A;  4MHU A;  3KT4 A;  2HBT A;  2Y34 A;  2Y33 A;  3NNF A;  5DAP A;  4MHR A;  3W20 A;  5LBE A;  4NHK A;  2FCV A;  5LAT A;  2FCT A;  5EPA A;  2RDN A;  2G19 A;  4BQW A;  5IAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...