2OZ6A

Crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
201
Chain Sequence
b'MKLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLNSGDFFGELGLFEQERSAWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virulence Factor Regulator
publication title Crystal Structure of the Pseudomonas aeruginosa Virulence Factor Regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Dna binding protein
total genus 65
structure length 201
sequence length 206
ec nomenclature
pdb deposition date 2007-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2oz6A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oz6A01
3CO7C 1DZTA 3CLPA 3G73A 4KN7X 2O8XA 1KYWA 2A61A 3EO6A 1ZAOA 2PQ8A 2LSOA 5I91A 3LFKA 1ZGJA 4M9XA 5BPXA 3WGIA 4N9HA 5I93A 2QVSB 4KT5C 2O6GE 3BU7A 1XGMA 2UYAA 1IRFA 4EJOA 1GQHA 3BJOA 3GF2A 2UYBA 4GYGA 3GVAA 3GFJA 4IETA 1G6NA 2O3FA 4EJTA 1DP7P 4G6DA 3GZ6A 4NVPA 5HDGA 1IPJA 5FCCA 4F7ZA 2BBYA 3EJKA 3ABUA 3K69A 4XETA 2PEXA 3WE2A 2B8MA 2PBIA 2HDCA 4XFFA 3WW2A 3GFIA 4LUKA 4P9GA 1BI0A 5ED4A 2PFBA 2KJCA 3HSFA 2IPQX 4QGMA 2FEZA 1Z6RA 2LKPA 3W6JB 1IPKA 4KA4A 4HBNA 2ESNA 1FSEA 3FHZA 2ZBKA 1YFUA 1IN5A 2ZNZA 1DZRA 2X0LA 3GXOA 1AOYA 2PAEA 2YSRA 1YTYA 2FBKA 4E70A 5LGNA 3J81Z 5FDBA 3ZN1A 2F4PA 5CVRA 1P6RA 2QM3A 1TQ5A 5CU1A 4KNYA 4XFIA 3T8TA 2L4AA 2GH2A 3V7SA 1CAUB 1FZPB 1T38A 1BI2A 5LGTA 2HR3A 1YWKA 4N9IA 2DAOA 4Z07A 2BEOA 3PNAA 4L2NA 4IHSA 2EFQA 2MHFA 1CAVA 3IIAA 3CUQC 2J5PA 3V7RA 2GXBA 3LA7A 2B5HA 5K5RA 2PTMA 1XCBA 1BC7C 4OMZA 3VOEA 1H9GA 3F8BA 4B29A 1YFWA 2XKOA 2KXLA 4MH0E 1YW7A 3GWZA 2D45A 4EGYA 3WW3A 4KIGA 1WKMA 2LNBA 4WXDA 1D8KA 3NEUA 1D3YA 2OBPA 3AAFA 4GYIA 4XBFA 1REPC 2PMUA 3RYRA 2EJRA 2KRFA 3HRSA 4I0BA 3DKWA 4IEZA 4KN4X 4HV6A 5I8YA 4MTEA 4JTOA 5TJJA 4DQ2A 1I1GA 2H27A 4JV4A 4QMAA 2PQQA 3KFWX 2D40A 2OQGA 2CO5A 4LD5A 4M6YA 4JTNA 1TNTA 1U2WA 1I5ZA 3LA2A 5KHJA 1XCVA 4BAYA 3DPLC 1O5LA 3H1WA 4I3PA 1LKNA 5EEGA 5CVVA 2VE9A 1U8RA 1PM7A 1LEAA 1MZBA 2IJLA 2V9VA 2A07F 4XF1A 4IJAA 1R00A 2XL9A 2A6EF 3WE3A 4XF9A 3LAPA 2ETEA 5JAXA 3ZMDA 4PIYA 4F8AA 5JR3A 1H1MA 4ZYHA 2QVOA 1CGPA 1HW1A 2Z33A 3KP6A 2XUBA 4ZU4A 2AXLA 5JSPA 2JPBA 5E16A 1XRUA 1JHHA 4ETSA 3IHUA 3DL3A 3LOIA 3ZQ7A 4XFCA 2EA4A 4AIJA 3DPTA 2RV8A 2R7DA 5ILUA 1VR3A 4RD7A 2WFPA 4PJYA 2KIUA 1WWXA 1TBXA 1XB4A 1RL3A 3R60A 4U88A 5E8IA 4AVAA 3FFQA 4XLNF 4P55A 1OKRA 1L0OC 3FXQA 4ESJA 4AWXB 5H6QA 4ZYEA 2DPUA 5JCTA 4ZZDA 4J1XA 2L54A 1XDSA 1TQMA 4LA3A 4A6EA 3KP3A 3FXUA 3VEPA 4CDGA 2Z3YA 4HVRA 4AQ6A 1QZYA 3I0TA 3C3WA 4CGZA 1TQPA 2OZUA 4JK1X 1BI3A 1OI6A 3U2RA 2UY9A 4U0WA 1IZ1A 3QU3A 1V70A 5D5XB 1J3RA 3E3VA 1LVAA 1R23A 4Y13A 4HAMA 4RB2C 1UHWA 2VONA 5FLHA 3VHRA 1MDMB 4IEXA 1KA8A 2IRFG 2A3SA 2DW4A 4MGKE 4YFKF 3J81K 5LRSA 5FLJA 4KL1A 5E17F 3J7AO 4IEVA 2UZKA 3M3IA 1UPIA 2GIVA 5EFUA 2C6YA 2HQRA 3K1NA 3HHHA 1HSJA 2JTVA 5ICFA 2M45A 4MGIE 1GQGA 1KQ9A 2QZ8A 4LK0F 3M9AA 1OR7A 3BJ6A 6PAXA 4QGNA 1W5TA 5D6EA 2MLKA 3WTWC 2G9WA 4JVAA 4EM2A 4ASNA 1YLLA 4CICA 2BYVE 3HRMA 4MV2A 3T1BA 4O3MA 3BALA 3ZPLA 2WC2A 3GBFA 1ZZBA 4KUMA 1FY7A 1ZG5A 5KHKA 2KIFA 3OV8A 1KYZA 3ZMTA 1UFMA 2MD5A 3EYIA 2Z5UA 3F6OA 4YYOA 3CUQA 4D7TA 3L00A 3IKTA 2HYFA 2EA7A 2FOKA 4G9YA 4QX5A 3HQXA 2MBFA 1EH6A 1ULYA 1Q1HA 4PZJA 4LLNA 3RKXA 1ZREA 3LAJA 4I7HA 1O3SA 3B02A 2A5YB 1W7PB 2V1UA 1RTVA 3F3XA 2OA2A 2LF8A 4HQMA 1YG2A 4M6XA 2XAHA 1XD7A 4I0AA 3J80K 3H92A 2EV6A 3FXRA 2GXGA 3TNQA 3BP8A 1K79A 4Q0VA 2P5LC 3QRFF 3BPVA 4XFHA 4L9JA 4M71A 2QCSB 4H7LA 5J7MA 2XV4S 1DUXC 4IHTA 4LEJA 4X6RB 3UKVA 4G7OF 2UXNA 5HVQC 2P6TA 2OU2A 4LA2A 2L01A 2VOOA 4Q5SF 1R22A 4UVCA 3HT1A 3G3ZA 1QWRA 1UD1A 1DGWA 1ZVFA 3L09A 2UY8A 2H94A 5JSOA 1P92A 3ZDSA 1LJ9A 1FP1D 3KEOA 2PI0A 3QP5A 1LR5A 2PAKA 3I59A 3KZZA 2NAZA 5DCFA 3RYPA 2RKHA 2DQLA 3C7JA 1R1UA 3V8LA 4XRFA 2QLZA 5KBFA 3BOQA 3S7IA 3KP2A 2W25A 5L3CA 3KZYA 4IEOA 4Y17A 4WZCA 2Z2SB 4XFGA 4HF1A 4PCQA 2CW0F 2PA7A 3KSCA 4LMYA 5LHGA 5D5UB 4HDVA 2ADUA 1FBUA 4B8XA 2H6BA 1LRHA 3LQRA 3EETA 4ZYGA 4EV0A 1J9IA 4B09A 4O6JA 1PUEE 3EHKA 4LK1F 1BN5A 4KU7A 2A68F 2XGXA 4ZYDA 4ZU7A 4R8HA 3CL1A 5HS8A 1EY2A 3TO9A 2VBYA 3TOAA 4O9EA 1T0FA 1MJAA 2W24A 3RKYA 3KP5A 3TO6A 2E1CA 1S29A 4GXOA 4HX7A 4RB3C 2CFXA 4L5IA 1R5HA 3CTAA 1YQAA 1CAVB 1XSXA 3H3UA 4BHBA 5K5QA 5JHUA 3SCGA 3JSOA 1O4TA 3N4MA 2HTJA 2QWWA 1FYLA 4AVPA 1SD4A 4AIHA 2EA2A 4WX9A 3JZVA 1YLFA 2GU9A 4IESA 1B9MA 2RQPA 1EYBA 3KGLA 4YNIA 1HW5A 3GO5A 3L9FA 4ENNA 3HSRA 5BPIA 1BBYA 3QPTA 4EWAA 2DU9A 4FT8A 4IRIA 1ZN2A 3GYDA 1OD5A 2JT1A 4HW0A 4UBHA 1R1VA 4KMFA 3GX4X 1HQCA 5D1IA 5CVIA 1VTNC 2HKOA 3O6BB 2PN6A 5HOOA 1K78A 3HUGA 2H6CA 5C6CA 3V7CA 4MTDA 1E2XA 4L0ZB 1QBJA 1YFXA 2CQKA 1NHAA 2V1XA 1BC8C 3O14A 5BOXA 1EV7A 5FQ0B 2FBIA 2VQAA 1ZHFA 4FBFA 1PP7U 1RZ4A 3ZN0A 2XASA 3K1PA 1ZZ6A 2D5FA 2YPRA 3T0YA 1IUYA 5FLIA 5ILVA 4L0YB 4ENMA 4HN0A 4OIQF 2ATFA 2DFIA 4IEWA 2EFOA 4S05A 1R5GA 2XRNA 1GXQA 1O7FA 1SFUA 1Z91A 5ILSA 4MQVA 2PHDA 3KMHA 2VPVA 3EYYA 5JR7B 1U3EM 3H7YA 1C0WA 1WI9A 4KIBA 1FT9A 2QQ9A 1QO0D 3TKYA 3I58A 5I8TA 4A0ZA 2RGVA 2UXXA 3K1MA 5CVUA 1BOAA 3D0JA 3BWGA 3HRTA 3OTFA 5H6RA 4UV9A 4QM9A 4HVOA 2P6SA 2BNMA 1X8MA 2XAFA 5L3GA 1HBXG 5FFZA 5HLGA 1J0RA 1ZLJA 3F21A 1CX4A 4OMYA 5I8SA 2RC4A 2D2WA 3PFIA 5ICEA 2DI3A 3B73A 1RC6A 2VODA 1KU9A 4IRGA 4G7ZF 2QENA 4ENJA 2HJIA 2PLYA 1KQ0A 1G3YA 2ET7A 5CYVA 3D82A 3HIFA 4YG2F 1WSUA 3NVCA 4MUVA 2P17A 1H0MA 3V4GA 3ABTA 5T3NA 5F1RA 1Q43A 3M8FA 4M9ZA 4Q0SA 4D7SA 1R58A 5AONA 4HZFA 2Y0OA 1QNTA 4KIFA 2ZMEA 1L3LA 1J3PA 1T98A 2XLAA 1F1ZA 5F64A 2P5VA 3HSEA 2M8EA 4XFAA 4IEYA 4MHGA 1KU3A 2ESHA 2FNAA 5DDGA 3H1YA 4IPAA 3RKWA 3E97A 4ONUA 2H09A 1NE4A 2IXCA 1ZRRA 1J3QA 5BUVA 4IERA 1XDUA 4I98B 3WGHA 4KWKA 4Q0UA 1RUOA 3H7JA 4WXCA 4XF0A 3CUQB 2D1HA 1QQIA 2MLGA 2IT0A 4CZZA 2VBWA 2FU4A 5DEQA 2XAQA 1QXRA 2HFHA 4LB5A 3SMHA 4XEZA 4Z2YA 4META 5CLSA 2WTEA 2FE3A 1WRJA 2JPCA 4BH9A 4LLOA 2DK8A 3WTVC 2DPDA 1O57A 3SHRA 2V1DA 3WG9A 3T5XA 1I6XA 2QQBA 4BYYA 1SFXA 5ERIA 2NNYA 1UIJA 5L3DA 2OAZA 1TQIA 4XFBA 3R4KA 1YW9A 5I0SA 1DDNA 1U5TC 4Q4ZF 5E8GA 1UW8A 4PIXA 5E1RA 3P9KA 1SFEA 2EAAA 3J80Z 1B6AA 3ELNA 4I01A 2VOPA 2V79A 2NYXA 3QPHA 3O3KA 1USSA 4P9FA 1ON2A 1NXMA 3NQOA 1SMTA 4JBAA 1LNWA 4YIIA 2HQNA 3BDDA 2ETHA 4ESFA 1FC3A 3BJAA 2EB7A 2GQQA 1PP8F 2QQAA 5E1WA 3I59B 2QNKA 2IW5A 3TNPB 1KQ8A 5HS7A 3P7NA 3M70A 1A04A 3ZP5A 3DFGA 3LSTA 4MEYF 3LQQA 2IXKA 2F2EA 2G7HA 3WU0A 2MNGA 5ICGA 1HKSA 4ZZLA 5H20A 1UHMA 1MJ9A 3WODF 2FXAA 1EP0A 4YARA 2GC2A 5D8KB 2QBYA 1IXRC 1VP6A 4CXFA 4MX3A 2M87A 2Q8KA 2DLLA 2YX4A 1Y9QA 1MGTA 4OLLA 1J59A 3BY6A 4A5MA 3BPXA 2QDRA 1IXSB 3W6KB 4HSLA 5BV6A 1YIOA 5IT3A 1YS6A 1YHFA 2A6HF 1ZRFA 4GULA 5BMZA 2R3SA 4AVCA 3O2PE 3FM3A 2E7XA 2ZKLA 1FSHA 1WLTA 2OZJA 1B1BA 2PAMA 3M1EA 4M72A 4ON0A 2F5DA 2XAJA 1IXCA 3HHGA 3ECOA 4MNUA 2B9UA 2CGPA 5BPDA 4A12A 2VC0A 4E2SA 4U7BA 2K27A 3U1DA 3SCFA 1BJAA 4ESBA 1Z1DA 3ZMSA 1CF7A 3RNSA 2RNJA 3WTYC 4NQWA 4QM8A 3WW4A 5DUKA 5K5OA 2ISYA 1I1SA 4KWJA 2O8QA 1SQ4A 4OOIA 2ZJ2A 4Q29A 4FHTA 5D8LB 3U10A 1B4AA 2GZWA 5EZWA 4LLLA 1YYVA 1EH8A 5LEKA 1Q3EA 2LF7A 2EFWA 1ZRCA 5DYMA 3KETA 4HF0A 1K78B 5E1XA 2JRTA 3PLQA 2K0GA 1LDJA 2VC1A 2ZO4A 1USTA 2NRAC 2KIMA 4LJZF 4GCVA 4I09A 1MJBA 2VT3A 4HA8A 3REOA 2VBXA 4EGZA 4HSJA 4M73A 4PIZA 4LG0B 1S3JA 1SEFA 4WCGA 4BHPA 1DPUA 2E7WA 1ZZCA 3WTSC 2XKPA 4EJVA 4QLCU 1NZCA 3DF8A 3S2WA 1U5TA 1Z05A 3WU1B 3TQNA 3MCZA 5C8WA 5LHHA 1XN7A 5I0RA 3MPBA 2VECA 2MA3A 1KU7A 3RPUA 2TDXA 1XMAA 2FMYA 4U0VA 2LDUA 2Z99A 2UWMA 3CDHA 4Q48A 5FO5A 1KU2A 1UCRA 3Q9VA 2E1NA 4HX8A 4UNOA 4MEXF 5I0TA 5DV5A 4K8FA 3PVBB 3FZ3A 3GUDA 5J6XA 2HKXA 1YUDA 4ORFA 3IDCB 4TLFA 3FE5A 2Q0OA 5J8CA 1ZZ8A 4RGRA 1T39A 3CLOA 1SD6A 1W4MA 3IDBB 3TOBA 4YFNF 1W7PD 4R1HA 2ZNYA 3KP7A 4U0YA 1FBSA 2CWEA 4OFGA 3HOSA 4HX4A 4HBLA 5D4SA 3WTUC 3VODA 3IRQA 2DK5A 3E5QA 1ZG1A 4P96A 4L9VA 4LB6B 3TDZC 4KFCA 1P4WA 2CSOA 1BIAA 3R6SA 2HEOA 2ZMEB 2XROA 2VBZA 3JAMZ 4QXKA 3K9TA 3DQVC 3CO6C 2P8TA 3IRRA 1ZH5A 2B0LA 3FF5A 2D5HA 4YRDA 5ICCA 1SMYF 2ACJA 4NB5A 3MEXA 3RTRA 1QY4A 3CEWA 1J2XA 1PMIA 3OCPA 3K0LA 1KGSA 2DTRA 2COMA 4M74A 3RI4A 4OIPF 1MDMA 2HZTA 4KDPA 1IF1A 2F5FA 3FMSA 4A0XA 4ZU5A 4FX0A 3Q9SA 4LULA 2MC3A 3H9AA 4QWQA 3GYHX 4S04A 5J48A 3C18A 2XLFA 4A0YA 3RZZA 4GGGA 3L2CA 1BI1A 3MWMA 2BGCA 2WV0A 5FD5A 5KHIA 2CYYA 1YS7A 5HLHA 4LLGF 4BNCA 4L18B 2GWRA 1F9NA 3IC7A 5J8FA 1LEBA 4BXUA 3IBMA 1V4RA 2PFWA 5DCMA 1ON1A 5BY5A 2K7LA 4HOBA 1J5YA 1SAXA 3F72A 5LLQA 3QAHA 2HS5A 3DEUA 5J3UA 3ERED 1FOKA 4RGSA 2FNPA 3NJZA 4TV7A 2Y0MA 1FLIA 5IT9Z 2E9QA 1CAWA 4CO8A 3DV8A 5KK1A 2WWYA 2D1VA 2CAVA 3FJSA 3H8UA 1IN7A 1RUNA 1X82A 2L3DA 5BQTA 5K1YA 1FYMA 4UUVA 1ONVA 5K8SA 2O61A 2CG4A 2CV6A 1G3TA 1NE6A 1G3WA 4MZUA 4UV8A 3JTGA 2YX7A 1WA4A 3I53A 4LGWA 1Y0UA 4MGRA 2RN7A 2V6CA 2M5WA 1W7PA 4U7DA 4NHJA 1YFHA 3P9IA 4AQ2A 3FHIB 3U11A 2Z9OA 2XL7A 1WGPA 3VB2A 4BHCA 1GVJA 2GA2A 3HOTA 5JVTA 1R7JA 4KMUX 4HLTA 2FA5A 1W5SA 1X3UA 2QYOA 4I2OA 5HDKA 5LHIA 3CF6E 1U12A 2XHKA 1OMIA 3MZHA 4MQ9F 3CUOA 3U0ZA 4J1WA 2STWA 3GFLA 4N0BA 4IEUA 1O7LA 3KGZA 2MH9A 3FM5A 1NYWA 1J1LA 5BS6A 1H1IA 3FMRA 3KLNA 3GEZA 3I5UA 1B59A 4MGYE 5LGUA 4ZH4F 4HQEA 4FAGA 3RDIA 3DN7A 3QP6A 1ZRDA 1CAXA 1V3FA 5A2QZ 1FYKA 2F5EA 3IL2A 2C0ZA 1BM9A 4X6QB 4R79A 4G8XA 1ZYRF 4EROA 1J75A 3JAMK 2BV6A 3I54A 5JI6A 2IXLA 4HMZA 2ZCWA 4RGUA 4EJUA 4RAZA 2A69F 2Q2EA 2GA1A 1J7KA 2GC3A 4XF4A 4M9SA 1LQ1A 5FPXA 3D5LA 2IXIA 4RAYA 2Q0AA 5LBQA 1CF7B 3E6DA 1OYYA 5AIQA 1RIOH 2Y75A 5HI0A 5E18F 1EH7A 2IP2A 1HW2A 4EMSA 4OINF 4L9TA 4EQQA 2H0VA 1ZG3A 2DBBA 3I71A 3H50A 4LFUA 1U78A 4L9NA 4OIRF 2XLGA 3PQJA 3LWCA 5BXXA 3T8RA 1P4XA 1OYIA 4KICA 4UVAA 4EWEA 1ZGAA 1Z7UA 2AS5F 5D5VB 3KEQA 2FMLA 4A6DA 3QU6A 4H0EA 5D4RA 4UBGA 5KVRA 5DD4A 2GC1A 5DUIA 1SD5A 5F6FA 3C3VA 3ISPA 4CYDA 2FF4A 5L3EA 5EEHA 4EJWA 5FB2A 1F4KA 2EV5A 2PHLA 4XF3A 4P5OA 3NL1A 5KHHA 3SFZA 4CHUA 5FLXK 1XMKA 5E20A 1O5UA 2Q1ZB 1ZARA 2XAGA 2PG4A 1FWZA 1WQ2A 1PDNC 3LA3A 3K2ZA 3MAJA 3BCWA 2K9ZA 3S0MA 3ES1A 2DCTA 2HTSA 1U6GA 2PYTA 5IT9K 4XSZF 3BROA 1XGNA 2EWNA 4HLXA 1IRGA 3F6VA 2EFPA 1OYWA 3GLXA 3SZPA 1U5TB 2OYZA 3R0AA 1MKMA 3EDPA 3ACLA 2XIGA 5LRRA 4WVZA 1XE8A 2O1QA 1RI7A 5JFRA 3SQNA 3ML6A 4BQAA 1GXPA 1FPQA 4PDKA 1SD7A 1S6LA 2OD5A 5FQ0A 3NSTA 3KCCA 3WTZA 4YSFA 2BE5F 3U9GA 3P9CA 4DINB 5CVJA 4KU8A 5CADA 3E5UA 3E6BA 4L11A 4LTAA 2J5OA 4FAHA 2I45A 2OA4A 1H9TA 2IA0A 3F8FA 1S8NA 4HDUA 3ELKA 3HT2A 1XGOA 4A2UA 2M1BA 3OD0A 3ZMUA 3OF1A 4XLPF 2FQPA 1MD0A 4UXAA 5FPZA 1EPZA 1QPMA 2DQRA 4LUMA 4RGXA 4UHTA 3F8NA 3ETQA 2VT2A 4WXHA 1O3TA 5A2QK 3HYIA 4PGHA 3E6CC 2IA1A 1STZA 3KE2A 4Z82A 2IA2A 2V09A 4EVIA 1O3RA 2EV0A 1FBQA 1XE7A 3ROUA 1L3JA 5TRDA 3S7EA 2DT5A 3Q5FA 1UIKA 2K4BA 2MH2A 1JUHA 4IRHA 1JHFA 2P7VB 4HLYA 2P4WA 1Q5OA 1SFNA 2O0YA 1LB2A 1HSTA 4HN1A 3SXYA 4MGZE 3HRUA 2QUFA 1ZZ9A 3FX3A 1GHCA 2VN2A 1IN4A 4O5VA 2W57A 2L02A 2Z69A 4KWLA 2GC0A 2FQ3A 3E6MA 2M30A 1S7AA 4P9UA 4Q0QA 1TTYA 4AIKA 3VFZA 4QGLA 5FD6A 1IW7F 2W85A 3OOPA 2OPKA 4IXAA 4RB1A 1J58A 3MYXA 4WK8F 3EQEA 2BNNA 1XSVA 1CAUA 1RGSA 4ENKA 5DCMB 3SHFA 4HV5A 1OFNA 2IXJA 1DPRA 5D5WB 3D0SA 3HTUA 2IXHA 3FWEA 2HGCA 3N97A 1UB9A 3RJPA 5D6FA 3EBRA 2R7FA 3IWZA 4O9GA 4XSXF 3L2HA 4HVQA 1CAWB 1UCXA 3MZYA 2YR2A 1F5TA 1T2KA 4KYWA 3COAC 3RIRA 2VXZA 1ZNPA 4RS8A 4GO1A 4UVBA 5HDNA 3I7DA 4HYEA 1X8EA 1R1TA 3M7GA 4YIFA 3EUHA 2JZYA 2OZ6A 3ES4A 3LWFA 3DXJF 4BIFA 2EK5A 1LDKB 3SXWA 1D8JA 1FI2A 2G7UA 3GFMA 2ZKZA 3DP7A 3GZ5A 1P4AA 3SCHA 2Q30A 4G6QA 2BNOA 1TNSA 2W84A 2FBHA 1XSDA 2KKOA 3KP4A 4IF4A 3ZMVA 3WW1A 1YW8A 2EVXA 1JE8A 1E17A 1HXDA 3I64A 1AWCA 3IWFA 5CJ9A 2CAUA 2KJBA 2RVCA 3NKTA 2ISZA 2HWVA 3H1MA 4IEPA 3TO7A 4JQFA 4Y15A 2Y48A 1IN8A 1HKQA 3QOPA 3LAGA 5JSRA 1ZX5A 2NS0A 3F8MA 1O3QA 3G7DA 1G4DA 5AVPA 4OU0A 1CAXB 4EM0B 2NNNA 2Q4SA 1DGRA 4UXNA 4WBBA 3ULQB 4RB0A 1ODDA 3SZTA 3QACA 4E2QA 5LEJA 3PQKA 1HKTA 2N7GA 5DD8A 2ZXJA 1P2FA 1IAWA 3WGGA 4DNCA 4AVBA 2PJPA 4IEQA 1G3SA 1Z6TA 3MDPA 3UKTA 2QJVA 3ECHA 2XVCA 1RNLA 3NW4A 2GAUA 2ELHA 3JW4A 3F23A 2VE8A 4E2GA 1I27A 2RDPA 1X7NA 3E5XA 3BPZA 4EM1A 3R0JA 3NRVA 3M8EA 3EQLF 1K6OA 5E1ZB 1Y3TA 3TGNA 2K02A 4K2EA 2K4JA 2P7CB 3ZMZA 1R36A 5FFXA 2EFNA 4WWCA 1TW3A 2HOEA 4R52A 3RPQA 4Q0PA 4AXOA 3BZ6A 4I02A 4Q47A 4D0PA 3CJXA 2YU3A 2OQRA 1OPCA 4EWDA 3KLOA 3FMQA 1YO5C 3RYKA 4YFXF 1S7OA 2STTA 5L3FA 2IC1A 3UKNA 3ST7A 1QGPA 4PGGA 3LZZA 1TW2A 1QXJA 2IVMA 4IVNA 1B9NA 5FLXZ 3R61A 1LDDA 1BIBA 3TDUC 3CJNA 3JTHA 4L5JA 2X4HA 2L4MA 1FXZA 3FZVA 2D93A 1ZZ7A 2P5KA 3HTSB 1FP2A 5AIPA 2DO7A 1XGSA 3MFKA 1FX7A 5FGMA 1VJ2A 5HLIA 4OIOF 5HS9A 1QZZA 3L7WA 1Z9CA 4G7HF 4FX4A 4AD9A 3V8KA 2PMHA 3BB6A 3OGJA 3IKVA 2ZFWA 2JSCA 4G94A 1JGSA 2O03A 5I0UA 5L3BA 3H3ZA 3V8JA 2ET1A 3WTXC 1TLHB 1D5VA 1JXSA 1K7AA 4HF2A 4A5NA 1FNNA 5KHGA 3C1DA 3WTTC 3MQ0A 2MPFA 4LG0A 1ZLKA 3USSA 2FSWA 3GW2A 3I4PA 2HYGD 1T6SA 3JSPA 4WF2A 1IN6A 3F8CA 2FRHA 2F5CA 3F22A 2QBYB 2K86A 3CO2A 1YFYA
chains in the Genus database with same CATH superfamily
4YW4A 2CGOA 3CLPA 4JGZC 1E5SA 1LODA 3EO6A 1ZAOA 2ENRA 4M9XA 4N9HA 2KLOA 1LPQA 2Y8KA 4M3CE 4WM7A 1IRFA 3HEFA 4A3DJ 5FO9B 4XJ8A 5FYTA 3PL0A 1JYVA 4CDXB 1G6NA 3C2BA 2QDNA 5FCCA 3N9NA 2ZGNA 3VBSA 2CUZA 3PIJA 3BQZA 1UJ8A 4A3JJ 3WW2A 4P9GA 3ZN6A 2VO5A 3HSFA 4LT5A 1SFKA 4ZZ5A 3W6JB 1CN1A 2MG4A 2YU1A 1FSEA 2D3RA 4NIDA 2ZBKA 4ZY9A 3DWLE 2ZNZA 2RNGA 1S1AA 3CQZJ 1MEC3 1DBNA 3GXOA 5ABJB 3S6PA 2FBKA 1HN0A 2GP3A 2LD5A 2F4PA 4PDWB 1VBD1 3IP4B 4BXXJ 2L4AA 1JUPA 3I2HA 5CQEA 1CAUB 2VOXA 3C7HA 5JMCA 5KCMA 4KQ7A 1YWKA 2HPIA 4CEWB 1RUI3 2BEOA 2VCCA 2W1UA 4ZXEA 4L2NA 5FWEA 4IHSA 2EFQA 2W47A 2VQGA 1D0XA 1GWMA 2B5HA 1XCBA 2PTMA 5IFTA 1BC7C 1OT5A 4QX3A 5C8CB 2GMEA 1YFWA 1Z0XA 2QF7A 3USUA 2H0BA 4EGYA 3NEUA 1D3YA 2OBPA 4GYIA 1REPC 4JX0A 5FRAA 3HRSA 2F4OB 1O6UA 2VBBA 3HBZA 4HV6A 5I8YA 3O1RA 1XNKA 4HANA 3AP5A 3ACIA 2DMUA 1FIPA 3I4NJ 3KFWX 2D40A 1H0BA 2OQGA 2CO5A 4LD5A 1LGNA 3ZXAC 4E7HA 5F2WA 2EXHA 5A80A 4HEA2 4BAYA 3CZ6A 4L0PA 4I3PA 5CVVA 2VMCA 1U8RA 1ODMA 1WCKA 2V9VA 2QZ2A 1WBFA 2SLIA 2CQ7A 2A07F 4YM1A 1D0YA 5F3GA 2ETEA 1BBT2 2WFF2 5IVJA 5FYSA 1GOFA 3BR1A 3CMYA 5D8AC 1HW1A 3Q0UA 1QJZA 4Q4X2 2AXLA 5C44J 1XRUA 1FOD2 3DL3A 2JIJA 3AZYA 3ZQ7A 2L7MP 5FMCA 2ZGPA 4AI2A 3OIOA 1NK2P 4OULA 1WW5A 3ZQCA 2VVEA 5A7QA 2WFPA 1S55A 1AR73 1LUJB 2A7AA 2YY1A 1RL3A 5LCWL 5E8IA 1OKRA 5IOYA 4JGZA 2R7QA 1A6QA 4CDUB 3I8TA 3JD71 4C2UA 4AM3A 5GZGA 5K4LA 5JCTA 1UG0A 2L54A 1TQMA 1ASJ3 1LULA 4CDGA 4D6QA 2Z3YA 4HVRA 2FQ4A 4AQ6A 1UYYA 4ET7A 3RMYA 3BIWE 1TQPA 4P5HA 2BWAA 3K4JA 4IE0A 2VBPA 5D5XB 1PGW2 1ETOA 1LVAA 3U21A 1WJFA 1HCRA 3DXUA 1VBA2 3KD4A 1T0FC 5KXDA 1YX5A 1UU4A 3I3EA 4MGKE 5LRSA 1NQDA 4Y22A 3V0BB 4DZPA 5FLJA 2WS92 1KGYA 3J7AO 3KT1A 1Y56A 2R7WA 1QEXA 4RHV1 2UZKA 5CG8A 2A71A 1MQTC 1UPIA 2GIVA 3WQ1A 2HQRA 2JTVA 4MGIE 2M45A 1COV1 1KQ9A 2OF7A 3M9AA 1OF3A 3CBNA 3K46A 2ZEYA 4EM2A 1FV3A 3GM8A 4A44A 5BNPB 2WC2A 1FY7A 1ZG5A 5KHKA 3ZMTA 4CP9B 2MD5A 2Z5UA 3CCLI 4LHLA 2RS31 4NHLA 3L00A 4HONA 4QX5A 4EATA 1A34A 2MBFA 5DDJ1 3RZDJ 2WNEA 3QCWA 1ZREA 1X4OA 1GWLA 5CFCC 1O3SA 1IV6A 1VBC2 1E3OC 3TEDA 1LTEA 2ZJQF 4Q4W2 1EPWA 2WNOA 1R092 3Q0WA 1ITYA 1DZQA 3U75A 3H92A 2HWE3 2VULA 3FXRA 2MABA 3BP8A 1K79A 4B4QA 2WA4A 3W59A 2XF5A 5LK7B 4J19A 2CJJA 2P5LC 2OS2A 1QJX2 4M71A 4H7LA 4KNCA 4LEJA 4G7OF 4CA0A 4NIIA 1UAAA 1BQPA 3NNJA 3L2QA 1OUSA 4LA2A 4UVCA 3I2GA 3G3ZA 4HNVA 1QWRA 2CGNA 1KFUL 1IS4A 4HK8A 1DGWA 1QNYA 1P7JA 3L09A 3OYCA 3V0AA 3LDKA 4FCAA 2DA5A 2NMOA 3GTOJ 2VLAA 2XUEA 2Y6JA 5DCFA 2RKHA 3K70C 3HM5A 4UFKA 3PVNA 3V8LA 2EZKA 2ZGTA 4A93J 2A70A 5KBFA 4KBBA 2PHWA 5IY5H 2Z2SB 4FP3A 3I2IA 5DQ0A 2DDAA 2VL4A 3VBUC 4P9JA 5HLTA 3H8RA 3O0XA 3P5BA 3BPSA 5EDNA 3WDUA 1N3QA 2J42A 1HA8A 3LFIA 2VCBA 1J9IA 4XXAA 1YX3A 4B09A 3LSGA 4Y26A 1PZ7A 2CW7A 2VMIA 2A68F 4R8HA 4IX7A 5HS8A 3NARA 3TO9A 1UX6A 1T0FA 4UW6A 1XE0A 2NM1A 2W24A 3RKYA 2WBMA 2M0MA 1U8BA 4RB3C 2E60A 1UU5A 1YQAA 5AFEA 4YVWA 1MQTA 1W36C 1XSXA 1RJ8A 3FLRA 3MUY1 3MKYB 3HXLA 4ZS2A 1SD4A 3P3PA 4WX9A 1ZA4A 4Q4V2 2QKMB 1YLFA 4HK9A 4NRQA 3KS7A 4E9KA 3KGLA 3GTLJ 2I74A 3GO5A 3L9FA 2HH9A 3N7LA 3ZFFB 1BBYA 1KJRA 1WKYA 4EWAA 2DU9A 4IRIA 1ZN2A 4HW0A 3N7JA 3DLAA 1YRNA 2TNFA 1R1VA 1JOJA 2R062 2WR9A 1DQ5A 1U0AA 1GLHA 5CEHA 3GX4X 2G0EA 1MACA 2ILMA 1VTNC 2HKOA 4GB32 1W9TA 1ND3B 3HUGA 4UT5A 2E1MB 3ZXKA 4MTDA 2QA4I 1NH3A 4L0ZB 1V6JA 3AK0A 3LSJA 5FYVA 5CFCA 2VY0A 3O14A 2LKSA 4KH9A 5FQ0B 2FBIA 4RMNA 1ETKA 4B48A 1RZ4A 3ZN0A 1AX0A 3UJOA 3WOGA 2ES3A 3DPRB 1CR7A 2B39A 2XVGA 3GCMA 4BE3A 1UMZA 1E3HA 1R082 4NMIA 4BDZA 2PLV3 1R49A 2XRNA 4YW6A 1O7FA 1SFUA 5ACA1 3RGBA 3RWKX 1WZXA 1V55H 2JDHA 4MGSA 5LK5A 2VR4A 2P5BA 5F27A 3VZOA 1WI9A 2WAOA 3VDDC 4YGCA 1ZBA3 3K1MA 5CVUA 1BOAA 3D0JA 3HRTA 5H6RA 1IV8A 4UV9A 2RS51 4HVOA 1DGRN 3WP3A 4F52A 1X8MA 2ORXA 5JIAA 1ERDA 5HLGA 1ZLJA 2W1SA 4OMYA 1RUJ3 4LPLA 2D2WA 2ZFUA 3OY9A 3HR9A 1RC6A 4QT6A 4JKLA 2VODA 2QENA 1Z3XA 5JOXA 2HJIA 3HG9A 3I56I 1V54H 2VASA 2PLYA 1G3YA 1VBB1 1OPMA 4YG2F 2HWB2 2P17A 3VBUA 3QBQA 3ABTA 5FPBA 1R1A3 3WP6A 5F1RA 2VUCA 3KWVA 1Q43A 3M8FA 5AFBA 4A3LJ 4M9ZA 4QPIB 2ZMKA 4D7SA 1XG1A 1AX2A 1QZEA 4CVUA 1IJWC 4KIFA 1H9WA 1J3PA 1LE8B 2P5VA 4MHGA 2FNAA 5DDGA 3QH7A 2H09A 1VMHA 1ZRRA 5BUVA 4DBRA 1U9NA 1XDUA 1JKQC 4DRVA 1QVUA 4CYCB 1TME2 2XJRA 2R0HA 3VBRC 4XOGA 4XF0A 2ZB9A 5F8PA 2WO2A 4EN7B 4XJAA 2AHQA 4CZZA 2B4KA 1AR82 2JG8C 3NO8A 1OISA 2HFHA 1FMWA 3SMHA 2ZEZA 5FZOB 3THCA 4N53C 5KXBA 3L2VA 3PURA 1PIV3 1M1EB 1W6PA 2Q8OA 2DPDA 3SHRA 5L73A 4S2HA 5DZGA 5GZCA 1WJ5A 2VJJA 4RM3A 3MV01 5L9VA 4BYYA 1JZ3A 5ERIA 4QPGC 2VPRA 4QXHA 5L3DA 2OAZA 1K4SA 4XFBA 5FRNA 5I0SA 4D5CA 3DBLB 3PO2J 4JX5A 2K9QA 1MMGA 3KYCB 1XU2A 5E1RA 3P9KA 1RUF2 4RS5B 3KM5A 2JK3A 1G9DA 1PNGA 3MLKA 3C7EA 4HPKB 2L9RA 3AP6A 3VBHB 1TG7A 3HVDA 1SC7A 5FKNA 1NY71 1WJDA 2CV1A 2E1OA 4HL0A 4XL9A 1SVLA 2HWD1 5FKKA 4M0HA 3CCQI 2ETHA 1NX9A 5FR3A 1R4NB 2XGCA 1FC3A 3BJAA 2GQQA 2WT0A 1UYPA 2QNKA 2IW5A 5H9SA 5IW0A 1A04A 3VKMA 3ZP5A 3DFGA 3LSTA 4GKYA 3IV5A 3B6CA 2VUJA 3OGGA 2G7HA 1HKDA 5ICGA 4CCKA 4XM3A 5H20A 1UHMA 3CJIA 1N1SA 3VDDA 5BNNC 4OQ8A 1D7PM 3RZHA 5D8KB 2R5ZA 1POV3 3CMAI 5JR2A 1Y9QA 2JVGA 1MGTA 3MIFA 5JWPA 1WJCA 3BY6A 1K12A 4A5MA 3ZSMA 2OTLI 3QH6A 4HSLA 5BV6A 3ASIA 3GF6A 3VD4A 4AVCA 3O2PE 4JC1A 4CDXA 1G86A 2ZKLA 2NS7A 3EXUA 1HXS1 2ZOEB 3PUHA 3HHGA 4CA9A 3ECOA 4BJ0A 4MNUA 4W1UA 1AXYA 4A12A 2VC0A 1SLCA 4XCBA 1JYNA 3D1NI 3WDTA 2K27A 1AYM2 1BJAA 2RMU3 1UY2A 1WD4A 2DTWA 4M3CB 4E7SA 1RUD3 2D6LX 3GLLA 4AI3A 4PQQA 5DUKA 1I1SA 3IN9A 3JCIA 1IS6A 2O8QA 1SQ4A 4E4ZA 2ZJ2A 2JKBA 2WYFA 4FHTA 4K7JA 2QQ8A 1B4AA 1VAVA 2EXKA 2HVSA 3S3OA 2WYSA 1YYVA 1CJPA 3VBRA 3NNMA 1Q3EA 2EFWA 1T6GC 3INAA 4NAOA 2Y0IA 3RJRA 3S1RJ 5DYMA 3KETA 3RCOA 4AQSA 3AFGA 1SPPA 1VALA 2JG8A 2QSFX 3D6EA 2LVSA 5E1XA 1VB4A 4PF5A 3RVHA 2JRTA 3PLQA 4FSJA 3OYEA 2K0GA 2VC1A 3QYBA 2Y2ZA 2BV4A 2NRAC 4N53A 2MW8A 4F55A 2QFEA 5A6QA 2WABA 3RQIA 3REOA 4EGZA 4P9IA 1JZ6A 2NOJB 3UETA 2XQXA 4M0NA 2DCZA 4P9XA 1BR1A 1POGA 1U0JA 5IK4A 2M3AA 4QPGA 3KQRA 2RREA 3OYLA 5IYBJ 5LA0A 5A3LA 3WTSC 4EJVA 2WQZC 1NZCA 2CSGA 4N90A 4RGAA 4AE2A 4PT6A 2AEZA 1Z05A 1DQ4A 2ZHNA 3TQNA 3RZMA 3MCZA 4GWIA 3DLLF 1DFQA 1VLNA 3MPBA 2IS1A 2VECA 3UNGC 3RPUA 1GQPA 5F9TA 3BTAA 4CUGA 4KJZA 1PK6B 2CUEA 4YG3A 4Q48A 2F6CA 1UYXA 5HXMA 3Q9VA 3JQXA 5DV5A 3ILNA 2DF7A 2LOOA 4K8FA 5FROA 4NWWA 3HOZJ 4ORFA 1OPOA 1J84A 3FE5A 2XUMA 1D0HA 2R16A 3J7LA 1ENXA 1VI0A 5J47A 4XYXA 1SD6A 1N75A 4YFNF 4KWUA 4R1HA 2LKXA 4ZDPA 1HJGA 1MS0A 4OFGA 3HOSA 4QX7A 2ZJRF 3OG2A 5D4SA 5LY2A 2K9LA 3VODA 2XB0X 3E5QA 4FXGB 4K6BA 3T2QA 3RSJA 2Z42A 2CSOA 1BIAA 3R6SA 2YGMA 1MS8A 5D21A 4V2WA 2ZBJA 1V6OA 3CIHA 2O0OA 4XMIA 3IRRA 2B0LA 1H88C 1FOYA 1CVNA 2ACJA 3MEXA 3RTRA 3HKZN 3IH2A 3G1LA 3K0LA 4H3WA 4TYSA 1NUKA 1IF1A 3FMSA 4FX0A 4MSVA 3LPFA 2KD7A 4TSVA 4OI0A 5J48A 1BK0A 1A8DA 3JUUA 3BI3A 3OYAA 4P14A 2G9GA 3IH3A 4UW4A 2BFUS 2Q8DA 1OCPA 3EUKL 5FD5A 2JDZA 4FPGA 1JZ4A 2V7FA 1AUYA 3BTYA 5HLHA 4LLGF 1MSEC 2K5CA 1SBDA 1TVGA 2VXRA 3ZQFA 4R4XA 1LEBA 2A6TA 1YI7A 4BXUA 1XSRA 1W2OA 2WN2A 3B69A 1JXNA 3DEMA 5C3PA 2VQUA 3QAHA 2HS5A 3M7AA 2W4SA 5J3UA 3NNFA 3POSA 4TV7A 2Y0MA 1FLIA 4BK4A 1JKOC 2R93J 2VQCA 1TMF1 2ZGKA 5EWSA 2CAVA 3FJSA 4C3HJ 1QU0A 3H8UA 4XMAA 1IN7A 1RUNA 2VM9A 1H6YA 4UUVA 1ONVA 2O61A 3ZQQA 3WSOA 2CG4A 4NAMA 1NE6A 2YX7A 2ZHKA 2RN7A 4PLNA 2V6CA 1YHQI 4YZ2A 2M5WA 1E5HA 1U5XA 3H1CA 1RUH1 1KJLA 3UGGA 3VD7A 1WGPA 4IE4A 5CFDB 1Y8RB 3EYPA 4OHWA 5FPAA 5F6KA 3OS0A 1GVJA 2GA2A 1VBD3 5T52A 1W5SA 1QIQA 1ULOA 3N05A 1W0PA 3A03A 3VKNA 1GP5A 3WT3A 5LHIA 3CF6E 1V6LA 4Y20B 2WWJA 1IO2A 1RITA 3O1UA 4N0BA 1O7LA 3KGZA 4YLZA 1NYWA 3F95A 3FMRA 1UQXA 1H8TB 2RS11 4HQEA 5FV3A 5FUPA 3DN7A 3QP6A 5C7GA 1S5LC 1CAXA 2PX9A 1MR5A 1D2QA 5A2QZ 1FYKA 1E57A 1NLRA 4Y1YA 1ZRIA 4BY1J 1PGSA 4XQDA 4R79A 5LA2A 1J75A 3I54A 4LHNA 1DU3D 2IXLA 3EPZA 5JIUA 5JOYA 3SH3A 2XBO1 1HB1A 1W3VA 4Y33A 4XJZA 3SFIA 4XF4A 1LQ1A 4CCOA 3ENRA 1OOPC 3TP0A 3E1SA 3FDYA 2Q0AA 1X1CA 4XMYA 1CF7B 1RIOH 2Y75A 5HI0A 1EH7A 4AHXA 3A7QA 1TZOA 3WDWA 2H0VA 4E8DA 3VZJA 3ESWB 3A0NA 3ACHA 4LBLA 2XLGA 3PQJA 1XYPA 3T8RA 3DTIA 1OYIA 4KICA 4LBQD 1D0GA 1ZGAA 4D8MA 5C3EJ 3GHNA 2VVDA 2AS5F 5D5VB 4NHKA 1HRI1 2IZWA 2HXOA 2FMLA 1C8M2 1YJ9I 2WAFA 4XDOA 5FJKA 1N78A 4OHYA 1HRV1 5ISLA 2FF4A 5EEHA 1ZBE1 3UK9A 2EV5A 3ME2A 4P5OA 2HQAA 1XMKA 2PG4A 1F35A 1FWZA 3BQYA 4TTGA 1HQLA 1WQ2A 3ES1A 1NCQC 2O7OA 4YGBA 3JD73 2DCTA 3K4DA 1XQNA 1U6GA 5FYZA 1US2A 2BY0A 5IT9K 2RDQA 1GT0C 4BQYA 1Q8OA 3C2GA 4BBRJ 2FZ1A 2G9FA 3VPRA 4BE1A 2M0CA 2XVLA 3RZOJ 2E7QA 2E7TA 3NKGA 2OYZA 5KC6A 2Q1MA 1OFSA 1MKMA 5LRRA 4EN6B 5GZFA 5HBAA 1RI7A 2JWTA 3SQNA 3ML6A 1JKPC 4B7KA 5A32A 4M3FA 5FP7A 2KA3A 3IAS2 5FQ0A 4YG0A 1LU1A 3KCCA 4AVVA 1WMEA 4RHV3 2JMWA 3WCSA 5CVJA 1COV3 4AEDB 2J5OA 5KAFC 4IW3A 1VQ5I 3F8FA 5CQGA 1QJU2 3RFRA 1D4VB 4LJHA 2GM4A 1XNCA 1BVP1 3MIEA 1GWKA 2EILH 2CWSA 5FPVA 1IQDC 1ZYBA 3OF1A 2VW2A 1UWWA 4XLPF 2FQPA 4UXAA 4XTMA 2MEV2 1L7LA 1QPMA 2DQRA 4RGXA 4RGGA 4WXHA 1O3TA 2RS33 4PGHA 3E6CC 4RL7A 2IA2A 2V09A 3AG2H 2EV0A 5DDJ3 5HCFA 2H1KA 4C1WA 1RUG2 2IFWA 1DP3A 1DLLA 3URFA 2DMPA 5C4JJ 2MH2A 2ZSHB 3K4KA 1Q5OA 2O0YA 3UYJA 3OPTA 4QKFA 2P37A 4B1LA 4HKOA 2LRDA 3FX3A 3JBG2 2BOIA 2WB1N 3DU5A 2VN2A 5M3FJ 1NOVA 1UO9A 5FREA 4BM8A 2CL2A 4OCTA 4NBQA 2P3KA 2L02A 1YJWI 4B7EA 3GXUA 2FQ3A 2ZXIA 3FK7A 5FD6A 3AKQA 1QF3A 1K83J 3PNYA 2IS4A 4R9AA 2DCEA 3UKGA 5EJCA 4RB1A 2BNNA 4XIKA 4YM2A 1XSVA 2L5QA 3OYDA 2DCKA 1IS5A 4ENKA 2OTJI 1OFNA 2IXJA 3FWEA 3N97A 3PHMA 2R7UA 3ZR5A 3BZKA 3EBRA 2VMDA 3HNMA 4HVQA 3ZMNA 1AHDP 4CYCA 1YI2I 3RS6A 3KVBA 2HWC1 1CX1A 5B1AH 1ENSA 4M4PA 5CZKA 2YR2A 2AEYA 2BXZA 2ICWG 3B01A 1ZNPA 4GO1A 1NCQA 4NHMA 2D44A 3I7DA 1LOFC 2VZTA 1A6CA 1YIPA 1W6NB 5HNFA 2HWF2 4CTEA 2RM22 5FO8B 1LDKB 3SXWA 1WCQA 5CA6A 2K3FA 2VMGA 2QZ3A 2G7UA 1GV5A 3FBNB 4HFSA 5T5OA 1RKTA 3OBAA 2XH6A 4DOZA 3CESA 2JG9C 3SZGA 2OKXA 4ISRA 1PO21 1P8JA 4D7MA 2D97A 4RA2A 5KAIC 2HZDA 3WW1A 3WVJA 1HXDA 3CCRI 2D43A 1YOVB 1AWCA 3IWFA 4HPKA 1Q8QA 3NKTA 1S0JA 1GZ9A 3TO7A 1OLQA 2ZXWH 4JQFA 3QOPA 4LE3A 4RM2A 1UL9A 4AFMA 3LAGA 3DCQA 5C9AC 3LCPA 1MBKA 4EM0B 5F5AA 4OMCA 2Q4SA 1RMU2 1AR91 1KDKA 4RB0A 5T50A 1ODDA 5CB7A 5LEJA 2N7GA 5E3LA 1X1PA 1P2FA 1V9U1 2BVBA 4AVBA 3CMEI 1F2NA 4IEQA 3S5AA 2XWBB 2ZX2A 3ECHA 3HJRA 1IG3A 3KIOA 3J8F2 1X50A 2GAUA 2ELHA 1ODNA 3F23A 2OW4A 3WY6A 5JDBA 1X7NA 3E5XA 5DXDA 2W5FA 4EM1A 1GYKA 3AZZA 1IZ3A 5FY4A 1YQ8A 3M8EA 1K6OA 1FIAA 4MHUA 2B46X 3TGNA 5IP7J 2K02A 3DXTA 2P7CB 4ATFA 3A21A 2EF6A 1DDLA 1XSQA 3JB4C 1BHGA 5EZGA 5FZ8A 5F3CA 2JE8A 4Y1VA 5JZGC 4D0PA 3CJXA 4MFEA 5ACA3 5FKLA 1QQP1 1R6RA 1SANA 5SV8A 2L9NA 3SC7X 2QQOA 4A7KA 2L9SA 2M4GA 1YO5C 3AKTA 3RYKA 1B72B 1W2TA 4COZA 1QPIA 2IC1A 1QGPA 2ME0A 4D1QA 5FBZA 1TW2A 2JICA 5GLZA 2Y6GA 1MZ5A 2RS53 1D4M2 3MN2A 4LBNA 4KMQA 2X4HA 1NA1B 4BZ4A 2J1AA 4XVHA 2P5KA 1GOGA 2CMPA 1R1A2 1W6QB 2NVTJ 3OGRA 3N7MA 4G4FA 3BZCA 1FX7A 5FGMA 1VJ2A 2DJIA 1OXCA 5FPLA 3NWKA 2WL1A 1U5YA 5AC91 1VBB3 3V8KA 1JHNA 3BB6A 5F32A 4IOCF 2WN3A 3OGJA 2JSCA 3ZX7A 1JGSA 3HPNA 4XE9A 3V8JA 4TXWA 2I07B 2VKVA 3WTXC 2EIGA 1FX5A 4QPYA 4A5NA 1FNNA 2JDMA 2O9LA 3VYRB 1ZLKA 1OQ1A 1NG7A 2FSWA 4BXFA 2JG9A 1FNZA 3B6AA 4IV1B 1CQTA 1UYZA 3N9MA 1Y8QB 1F8VA 2PHRA 4FOWA 4PCRA 1YFYA 4JX4A 1DZTA 3DYPA 4KN7X 1LVKA 2A61A 2LSOA 5I91A 4IHVA 5B66C 3WGIA 2GMPA 2QVSB 1BOBA 4KT5C 4M3BA 3SKVA 4UUTA 3K2AA 2JB8A 3VYSB 3BU7A 5DM7F 4URTA 1XGMA 2UYAA 4MGTA 3BJOA 3GF2A 3C8XA 4XUQA 5C9AA 2UYBA 1Y39A 1JYIA 2O3FA 4EJTA 5DUVA 4NVPA 1N3OA 5HDGA 4F7ZA 1D2SA 3ZPYA 3EJKA 5EG0B 2PEXA 1IRZA 4IO9F 4Q1RA 4GJYA 2HDCA 4XFFA 3GFIA 1W8TA 1BI0A 4NJ4A 1WVRA 5FZ9A 4GJZA 4AI0A 2XB5A 2L7KA 2FEZA 1XJAA 2J7MA 4XDQA 2DA7A 4HBNA 2ESNA 1C28A 4NQWB 1IN5A 2E2HJ 3K4NA 1NT0A 4YPJA 4QQ2A 1AOYA 2PAEA 5GP9A 4ZHNA 3AL0B 4E70A 3J81Z 3HMYA 2AC1A 3ZN1A 5L7OB 2OCEA 3QQAA 1TQ5A 3L2RA 4HT1T 3PUIA 2VB6A 2NQYA 4KNYA 1AJKA 2R7XA 2VZ3A 4U87A 2HWD3 1T38A 3LGRA 4A4AA 3HBLA 1W9SA 2HR3A 2UWAA 1O4ZA 3JREA 1NXD1 4YVSC 3H0OA 1IUFA 5JZGA 1MVQA 4BACA 2PMWB 1ETQA 2V26A 1CAVA 1YQCA 1VMFA 3ZFGC 1JGGA 4DQAA 2LG4A 3V7RA 3LA7A 5K5RA 2P0WA 5ERLA 3VOEA 5SV5A 4B29A 4OAZA 4GA9A 2XKOA 1GR3A 3PUQA 3R4DB 3V64A 2QGUA 1YW7A 4RQPC 1H4GA 2JXAA 2A6VA 4E7KA 3WW3A 4KIGA 1D8KA 3RYRA 3DKWA 1GNYA 4KN4X 2ZGUA 2PN5A 1C5HA 1GUUA 5GZDA 4QMAA 1SMVA 2V1NA 2PQQA 4JTNA 5B4XA 1TNTA 4YZ1A 1OCTC 2A3XA 1QH7A 2EIJH 2NPIA 2VE9A 1MS5A 1CESA 3WCRA 1PM7A 1LEAA 2OPTA 2IJLA 1ND2C 3ZYFA 1HXS3 2V4VA 4XF1A 4IJAA 2HBTA 2J1RA 2XL9A 3WE3A 5H2FC 3LAPA 1OJLA 3HC7A 3HOBA 3ZMDA 1ULFA 1H1MA 4ZYHA 2XDVA 3J7YJ 3KP6A 2XC7A 2DMTA 1H9PA 3AMQA 4ZU4A 2JPBA 3PIPF 2NVQJ 5E16A 4ETSA 4IGPA 3IHUA 1WJEA 2R041 2NMNA 3LE0A 3O1SA 3AKPA 1JZ7A 4UI9L 3LEMA 2PHTA 2R7DA 5ILUA 2GN7A 2KIUA 1XB4A 3ZYGA 1S0IA 4NO4A 3FFQA 1WD3A 2JJ6A 5GAGJ 4ESJA 1HV1A 2AREA 3AFKA 3ZM8A 4CDQC 1QH6A 2DPUA 1ULPA 3TW6A 4ZZDA 3MUZ1 3M1CA 4Y4RA 1W05A 3H36A 5F08A 1UMIA 5ANQA 3OPWA 4K1YA 3ORJA 1BI3A 2DA2A 1OI6A 4BB3A 3U2RA 3S1NJ 4XLAA 1V70A 1J3RA 1H8TA 2VUAA 2TEPA 5LBCA 4Y13A 4HAMA 4YEJA 5FLHA 1UHWA 1KA8A 4LBKA 1ZM1A 3WLUA 2J1SA 5C3QA 2HDWA 4IEVA 4X1EA 4Y7NJ 5TISC 5EFUA 4DMIA 3GZEA 3X29B 5ICFA 4QDSA 3T4VA 2MC4A 1UNBA 4LK0F 3DKYA 1Z0HA 3WG1A 4JDNA 3BJ6A 6PAXA 3CCJI 1KRIA 1GSLA 1QGLA 2M4KA 4JQTA 3CJRB 4YFZA 1YYNA 4ZKTB 2R7TA 1IOAA 1YC61 4MV2A 3H5NA 4O3MA 3S14J 3BALA 3ZPLA 2DDBA 3LKJA 1W9YA 4KUMA 2FBEA 1W6OB 1DF0A 2KIFA 4YVSA 1UFMA 3F6OA 3ZXGA 3ZFGA 2YGLA 4D7TA 2Y0SA 2I8DA 2YC2A 4S2FA 4SLIA 4XKCA 2FOKA 5EXOA 4EZHA 3HQXA 4DRRA 1LHNA 1EH6A 1W90A 1ULYA 1N47A 3ZSEA 4RQPA 4XK4A 4E7IA 4BEHA 3B02A 1C5IA 3GZTB 4D9JA 1RTVA 1MZEA 3F3XA 2HDDA 1XX5A 3POEA 2XB6C 4NRMA 1LEMA 3WR0A 2XAHA 1XD7A 1XC6A 4I0AA 3W21A 3J80K 3FKJA 5BNOB 4IHXA 2EV6A 4CP2A 1RVF1 4Q1PA 3UV9A 4FETA 3TNQA 3DKQA 5DUWA 4D6SA 2GDFA 3Q8FA 1BBT1 2WFF1 3H42B 1ND2A 5DM6F 2DN0A 4GZ9A 3ZIWA 2G4IA 2W82A 4X6RB 4Q4X1 3UKVA 4XOTA 2P6TA 1S0FA 2OU2A 2L01A 5K9YA 1FOD1 4II3A 3GTJJ 4Q5SF 1NTCA 5JI9A 3ZQHA 4WV8A 1ZVFA 4QKBA 2UY8A 4WM7B 4A3IJ 1C4RA 4WZFA 1P92A 4TZDA 5TGTA 2LYCA 2PI0A 3QP5A 1LR5A 1S4CA 1OCZH 1FEXA 1UZ0A 3R05A 3VBSB 1R1UA 1AZDA 3SDGA 1MMAA 3ZMOA 1TWFJ 3AC0A 4IEOA 2VJXA 1TC3C 2JDKA 3UNPA 1W8WA 1S2EA 3ZN6B 3D5OA 3C2UA 4CDQA 5IK7A 5LHGA 4G3YC 5D5UB 3CQOA 4HDVA 5HNHA 3OL4A 2TBVA 3GTPJ 3LQRA 1R4MB 2E36A 3GCXA 1C3HA 1ZK8A 3ABKH 1PGW1 1TMF3 1Q8SA 2V4JC 1O8PA 1QDCA 3EHKA 5EJ1B 4OUMA 1VBA1 2Y6LA 5HCAA 1PVC2 3QYEA 3CL1A 1F36A 2WS91 4BQ2A 4OHVA 3GGLA 4XLCA 2JD9A 3PMSA 1RUH3 3TWIA 4UB6C 2XSDC 3RZKA 1A36A 1S29A 3GTQJ 1GDTA 1R5HA 4FOQA 5K5QA 3GTMJ 5BNQA 4Y1UA 3DUIA 1T95A 3N4MA 4YW3A 5FZKA 1HV0A 2HTJA 1G9FA 2EA2A 1YJLA 5JLVA 3USUB 4COVA 2GU9A 2HEVF 2RQPA 5GTIC 1E5IA 2AQFA 1AL22 1HW5A 2GIZA 2XHNA 4ENNA 5BPIA 4YGDA 4Z1VA 3GYDA 4GD4A 3IZOA 4RR3C 3V56A 4UBHA 1YQ6A 3ASOH 4KMFA 2VTXA 1UXXX 3LDBA 1CZSA 4QKNA 3CCYA 3J7HA 1FNYA 2RS13 3O6BB 1LJ7A 5HOOA 1K78A 2H6CA 3GCWA 4V2VA 1VBC1 1JUMA 2K9NA 1BC8C 1IGOA 4Q4W1 1H2MA 3FIWA 1PVXA 1R091 2VGDA 3T2OA 2BVMA 3FISA 2WT2A 1VNDA 5JVGF 5EZHA 3MO4A 2IVJA 5JXIA 2RR12 1DGRM 2XBO3 2OJED 3K1PA 3WD5A 3WNPA 3V65A 3T0YA 1QOSA 1AR62 5LD2C 4L0YB 1L7QA 2XG3A 1QJX1 4IEWA 4MLOA 1GXQA 4B1MA 2HYJA 4IL7A 4MQVA 3CC2I 2PHDA 2QQWA 5JR7B 4JGZB 1U3EM 4KIBA 3BR0A 1QO0D 4K21A 3I58A 5I8TA 4A0ZA 2DT7B 1HRI3 1YJKA 3N36A 1HRV3 2YBPA 3VHNA 1R71A 1ZBE3 1MBGA 1HBXG 1CX4A 5IVFA 1GV9A 2HOAA 1VAMA 3O1OA 3I55I 4LITA 1VFCA 3UR3C 1HOMA 2ET7A 5CYVA 3HIFA 3KV6A 4ASMB 5FYCA 1TE1B 3V4GA 1OQYA 2G1MA 2E5NA 4XILA 4BQNA 2WINB 4Y22B 5T3NA 5GPAA 3TP3A 3NJYA 4UWDA 3L2WA 3MKZA 2Y0OA 3KLSA 2Y9YA 1L3LA 1T98A 4AC0A 2E31A 5F64A 3EMRA 3AYAA 2DUOA 2Y34A 4IEYA 2LY2A 5IK5A 2EXIA 4OYUA 2ESHA 3E97A 4ONUA 1NE4A 2YBKA 2IXCA 4JGYC 1J3QA 2WJSA 4RSUA 1ALYA 3BG7A 4ZTJA 4BQWA 1MBFA 1CZTA 4XOPA 2WA3A 1UMQA 5IP6A 1G9BA 1VQ7I 2D1HA 2MLGA 4Q4V1 2KHMA 4RGKA 1N1VA 2XAQA 5L9RA 2EXJA 2YB7A 3O1MA 3VDXA 1W1WE 5CLSA 5F3EA 4BUPA 4BMBA 2FE3A 1UKRA 2R061 1EKEA 1WRJA 2JPCA 4KITB 2DUQA 2DK8A 2E2IJ 2I10A 4AR2A 4GB31 4BQOA 4RR3A 4I6ZA 4XICA 3WG9A 1VQ8I 2JD4A 4FPLA 5LA9A 1MNMC 1UIJA 3PL8A 2L7FP 3VDAA 3CKHA 2YPDA 4QPQA 3R4KA 5APAA 1YW9A 5K7PA 1IDYA 2VPLA 4OI2A 1U5TC 4GWJA 1D1CA 4TWTA 2HVQA 2QQPA 2EAAA 2EIDA 3ELNA 5FKBA 5LFAA 1GZTA 4BLIA 1VMJA 2HEWF 2ZACA 1R081 5JLWA 5D8AB 1ON2A 3I2KA 2DOAA 4JBAA 2ZZJA 2HQNA 3CZJA 3BDDA 3DBHB 1ONAA 4ESFA 5J37A 4E7LA 1NKGA 2BPA2 3GHMA 4P08A 4MEYF 1G2HA 3W5NA 4NC7A 1YI9A 2IXKA 5J4YA 2F2EA 2BP6A 4K40A 3WU0A 3QD6A 1YIFA 1CIWA 1N1YA 1MJ9A 2JDUA 4QTRA 3PUBA 2FXAA 1EP0A 5LY1A 4CXFA 1W2AX 4MX3A 3ZO0B 3NWTA 4INDA 1A35A 2DLLA 2OV7A 1U9OA 1J59A 3BPXA 2HWC3 2QDRA 2M7AA 4IV3C 5FLMJ 1YIOA 1P7IA 3CNAA 3GZAA 4EN8B 2HWB1 1YS6A 3OPZA 4AHZA 4L9BA 5BMZA 2R3SA 3L9JT 2IFRA 1OCRH 1WLTA 2OZJA 4A6SA 3LSIA 2K9MA 4M72A 3CDLA 4ON0A 2FX0A 1UY3A 1A6IA 1IXCA 5DAQA 5BPDA 2IS2A 3I2DA 1MQTB 4E2SA 4JHZA 4FPFA 3HKZA 3SH5A 2R5YB 3SCFA 4EZ4A 1RPWA 2F48A 4XUTA 3HDDA 5A7WA 1Z1DA 1PO23 2JKXA 3WF0A 5GJ6A 1YCIA 3WTYC 4NQWA 2X6YA 3WW4A 1OCOH 4CUAA 2Z79A 3NV4A 1T8IA 1TME1 4GDFA 1PUFA 4BIOA 5CKTA 3K48A 4Q29A 4JGYA 4LHKA 2GZWA 5EZWA 1YRNB 1AR81 3Q8EA 5LEKA 5C4WC 2CH0A 2LF7A 1JT0A 1ZRCA 3NAPC 1GUIA 1UG2A 4HF0A 4AU7A 3HUGB 3VN4A 3WNNA 3PUSA 2ZO4A 1YQ2A 2E32A 4AGVA 5FP9A 1SEUA 5CFCB 1AR93 2AR6A 3C7OA 2NVUB 2IXSA 3IKWA 5G04L 1XXNA 5FK8A 5IYYA 3SNMA 1V9U3 4YZ3A 4I09A 4L8QA 2F5VA 4B4PA 4PIZA 4PFPA 3TEZA 1SEFA 3LMMA 4WCGA 3D8CA 1DPUA 1UMHA 2E7WA 2JJ7A 1ZZCA 3MW4A 3MKWB 2W87A 1RUF1 1O8SA 3FXJA 4QLCU 3WEZA 1ENRA 3A4UA 3DF8A 4RA0A 4B47A 4DXZA 3S2WA 1U5TA 4PFOA 3H5AA 3LOBA 2CFOA 3WU1B 4W4ZA 2IGKA 3RWNA 2MA3A 4DOUA 2IEKA 2RHPA 5CISA 2TDXA 5HPOA 2FMYA 2K85A 2HOSA 4U0VA 4CPBD 3FBYA 2WNVC 4R9BA 3MV11 4E7ZA 5FZ3A 4QXBA 1WLDA 2E7AA 2DA6A 1UXZA 3UGHA 2E1NA 5FMBA 5HXVA 1QU3A 4MEXF 5F39A 2ARXA 1QQP3 3SQOA 3PVBB 1GZCA 3GUDA 5J6XA 1GFF2 3PJQA 2Q5TA 4QB6A 1LENA 3TN92 4NIGA 5J8CA 3H3VK 4X6AJ 4JZRA 1QHHD 3IMNA 4AF9A 1EV12 1OKQA 1OBNA 3HN3A 1W4MA 3IDBB 4XRSG 1GANA 3VBUB 2KIQA 2ZNYA 3VDBA 4U0YA 1FBSA 2CWEA 1VIWB 1YE9A 5L36A 4B3AA 4LKEA 3WTUC 1LU2A 2DK5A 4P96A 4LB6B 4XUPA 3ZGKA 4IV3A 1P4WA 2HEOA 1IKQA 3BN6A 2DFCA 2XROA 2VBZA 3JAMZ 4BY7J 3GZNB 3K9TA 1KXGA 5D2AA 5AC93 3CO6C 1JH5A 2LUWA 5GPCA 2D5HA 4YRDA 2ZX4A 2BY3A 3HJEA 3VYUB 1SMYF 2R1DA 2C9KA 1AXZA 1SDWA 1OH4A 5EIYB 1KGSA 2DTRA 2D6NA 1LOCA 5FK7A 2HZTA 4KDPA 3JRBA 4A0XA 4ZU5A 4LULA 4CH7A 2MC3A 1JTYA 3ACGA 4QWQA 3GYHX 2XLFA 4A0YA 2EALA 4B3XA 2I5UA 1W8UA 1I3AA 5A3PA 1N3PA 3MWMA 5FTTC 1MMDA 2VH9A 1UZVA 5EYYA 1W6PB 4BK5A 4WM8C 5KXCA 4NHXA 3IC7A 1Q8VA 2JA2A 1V4RA 2PFWA 2E26A 1W9FA 5C4WA 3NAPA 2W95A 4HSTA 5LLQA 3UESA 3LEKA 2ZMNA 4WVWA 4L99A 3NJZA 2FNPA 3I3LA 1HLVA 3H0GJ 2V73A 4DUWA 3DV8A 4XLEA 2X51A 1X1DA 2X8KA 3RKQA 2L3DA 1FYMA 4CZSA 2JWPA 5K7ZA 1EAH2 1CPMA 4AZZA 2CYFA 2VW1A 5KWRA 3JTGA 4LGWA 1RUE2 3OBZA 1ENHA 3QOEA 3AZVA 4AI8A 4J00A 2WQ8A 3FHIB 3ZSLA 5C70A 2X29A 3M2MA 1V6KA 4A3MJ 4BHCA 2QBXA 2R1BA 2E2JJ 5JVTA 4KMUX 2FA5A 4CP1A 1ZTRA 3WU2C 4DGWB 3MICA 3TEYA 4NC8A 3WG7H 1OURA 3VDDB 5HDKA 1V0AA 1U12A 1MZFA 2WNVA 3MZHA 5HV4A 2R7SA 2R5ZB 5FXVA 2HPMA 4J1WA 4XONA 2L0KA 3OJBA 1MMSA 3NV2A 4LMFA 2GLOA 2MH9A 3FM5A 4AHYA 2L9LA 5BS6A 4ITVA 3E1F1 3OGVA 4ZH4F 3VWBA 3RDIA 2BXYA 4PLOA 1MBHA 4HETA 5K0UC 2F5EA 4M01A 4BDVB 3ACFA 2YU2A 4G8XA 5F04A 1C1LA 2BV6A 1X36A 4XUNA 4HMZA 3K4AA 3OYJA 4EJUA 5C71A 3AVSA 1K6YA 1MMNA 2Q2EA 2Y30A 4ZS3A 5DAVA 2GC3A 5FPXA 3CP8A 4DB5A 1CONA 3D5LA 2IXIA 1JS9A 1KITA 5LBQA 3E6DA 1OYYA 5AIQA 3AL5A 5E18F 3W5MA 4EMSA 1W3XA 4AAXA 5IVEA 4OINF 5J98B 4L9TA 1ZG3A 3I71A 1Q1VA 3FXMA 4GAZA 3LWCA 5BXXA 1MZ6A 1HQNA 4NWVA 4UVAA 2V4AA 3G1MA 4BDYA 5CKNA 3SH4A 3VBRB 3O1VA 5CNAA 3QU6A 1ENQA 3S2HJ 2R043 4UBGA 1TZLA 5J3LA 1SD5A 3I3MA 3ISPA 1YRZA 5L3EA 1TNFA 4C9YA 3FUQA 4EJWA 1SPPB 2JG8B 1F4KA 1HDKA 3ABZA 2XXZA 5KHHA 4CHUA 5FLXK 5E20A 1SLBA 1O5UA 2Q1ZB 4LE4A 4N53B 3K2ZA 2VCAA 1QVTA 4XACA 5IFPA 4P00B 5FZ7A 4WM8A 2YUEA 3VB9A 3OY8A 2R072 4GH4C 1JBCA 1QKQA 4XXPA 4FPEA 3M3CA 3I4MJ 3BROA 4QPGB 3WHTA 3L2YA 4OI4A 3OIPA 2EFPA 4W6XA 1OYWA 5J09A 2BGOA 4TN7A 4UW3A 2R7VA 5FZAA 1N25A 3R0AA 3AKSA 4WVZA 2XIGA 2O1QA 4JYKA 5IUQA 1Y4WA 1FPQA 2P1BA 2OD5A 1IKPA 3NSTA 2DU0A 1QHGA 1FMD2 4NN0A 4YSFA 2BE5F 1SZBA 2WWSA 4YWAA 3FUOA 3OYIA 2ZHMA 1A5JA 3M3OA 4PBOA 2I45A 3WNLA 1JU4A 1KQRA 3ZSKA 2IA0A 1S8NA 4HDUA 3HT2A 2M1BA 4TLGA 4Y24A 1VRH1 5BNNB 1GNZA 3K4MA 1MD0A 1EPZA 4CDWC 5DZFA 4UHTA 1W28A 3F8NA 3ETQA 5T55A 2VT2A 5A2QK 3HYIA 4C0HA 4EVIA 5F0HA 1EUTA 1O3RA 2O8OA 1XNBA 2BZTA 1XE7A 3O0VA 1L3JA 3S7EA 4XIOA 5JPMB 1UIKA 5A7NA 1JHFA 2P7VB 4HLYA 2P4WA 2A1XA 4BJ6C 2A6XA 5K0UA 2ZGQA 2P34A 2WNUC 1HSTA 1YJNI 5J40A 2ERFA 1NAEA 3TBIA 3Q9OA 5A3OA 1IN4A 3WDVA 4O61A 4O5VA 1Z7S2 5EJZB 1RVF3 2OVUA 2DFFA 4OHZA 5H9RA 4JKMA 2UV1A 2GC0A 4LK7A 4UB8C 3KV9A 1BBT3 2WFF3 4IE7A 2ZGOA 1JN2P 3VFZA 4UYBA 4QGLA 2JB4A 1I39A 4Z6YA 1MBEA 3QPSA 4Q4X3 2NP0A 1J58A 3EQEA 3RZLA 1OFCX 1C8M1 2VU9A 3OOXA 1FOD3 5E3NA 3LIHA 5B1BH 3LF7A 3HB9A 1QJEA 3HTUA 2IXHA 2WKKA 1XYNA 2HGCA 5T5PA 2R7FA 3IWZA 1VB2A 2P2KA 3GJAA 2VZVA 4MGQA 3MZYA 3HOVJ 3J26N 1F5TA 4KYWA 2VXZA 3A2KA 3VZLA 2M2EA 4HYEA 3AVRA 4GMP0 4YIFA 3PSFA 2OZ6A 2IVIB 3ES4A 3LWFA 2E53A 1JOBA 1LGBA 1FI2A 3BG6A 1GU3A 1YITI 2ME6A 1OKOA 1ULGA 1VBA3 2Q30A 4AEKA 4IGQA 1CZVA 1TNSA 4BKXA 2ADDA 3MIHA 2WS93 4DFSA 1VQ6I 1K45A 1C1FA 3S15J 4ITCA 2VZ1A 1E17A 5IVBA 4XJWA 3JRIA 2CAUA 3OBRA 5LBBA 5E3MA 1AVBA 4FPJA 3H1MA 2BY1A 1QJU1 4LO5B 4MVTA 5D8AA 3KYLA 1APLC 1FPN2 5FWJA 1UOFA 5JSRA 4OQ9A 3F8MA 1O3QA 5AVPA 1CAXB 4D69A 4UF0A 1D1AA 2MEV1 3ZSJA 3OL3A 2X1EA 2X09A 2LY9A 4DPNA 2VKEA 3LDRA 3SZTA 3QACA 3PVOA 1HKTA 4CDWA 4QX0A 5DD8A 2ZXJA 5FMDA 2VMHA 1IAWA 3WGGA 1RUG1 3F2ZA 4FPOB 4FE4A 2F4LA 1G3SA 3MDPA 4QQHA 3UKTA 2QJVA 3I2OA 4K8RB 2XVCA 3GDBA 5JHFA 2CTVA 3OSDA 1VBC3 4UFLA 5GKAC 2NYYA 1I27A 4Q4W3 4CCEA 1R093 4K3UA 1VF9A 3R0JA 5JLXA 3KB5A 5LBEA 3JBG1 1TNRA 2WNUA 1H1AA 2K9SA 5KC5A 2JN6A 4K2EA 2FDGA 3ZMZA 1LOAA 1R36A 1XMXA 1G9CA 3HPGA 5A1LA 1QJX3 5FIXA 2KRCA 2OQRA 1NK3P 5CPRB 1OPCA 1OA3A 2OXBA 4P9YA 2FDIA 2DOFA 4IQPA 1SBFA 3KLOA 4QHZA 3FMQA 4JDMA 2VAUA 3OUJA 2R5YA 2STTA 3UKNA 3M8JA 2P3IA 3BYWA 2OQ6A 3DBRB 4XRMA 1BIBA 3ZKYA 1ACIA 2L4MA 1ETYA 3ZKUA 4Q4Y2 2WZR2 1DU0A 1ZZ7A 2BERA 2M34A 3MFKA 2R30A 2K46A 4OIOF 5FZIA 5HS9A 3AYEA 1QZZA 2FUG2 2HWF1 1LFUP 3K75B 1Z9CA 1MIJA 5EGOA 2RM21 4FX4A 1RHI1 4FE7A 2DFHA 2PMHA 2AH2A 5A32B 5FJ8J 1T08B 4L5EA 5LATA 1TT0A 5L3BA 3DEEA 2X85A 3H3ZA 3T4HB 2D7FA 4QD2A 4HF2A 3BLYA 2MPFA 2OT7A 3CCEI 1GVDA 3I4PA 2XMLA 4K9SA 2HYGD 1MH3A 4V1PA 2DWRA 1H2NA 3TAYA 2QBYB 1B35C 2K86A 1UZYA 3G73A 2LK2A 1KYWA 3RRDA 2JA6J 3KZIC 2GOMA 4AWDA 1ZGJA 5I93A 1O4YA 2W0XA 4Q4V3 2XGEA 1GQHA 2WLPA 3SKJE 1RMU1 3GVAA 3AKZA 4IETA 2RJ2A 1DP7P 3GZ6A 4YG6A 3ABUA 2RG4A 4XETA 1DG6A 3WE2A 2R063 4AFAA 2PBIA 2X1CA 3VHPA 3J4UH 5GALA 4GB33 2PFBA 5E8AA 3J8F1 2DODA 1Z6RA 2LKPA 4ZTFA 4V19K 3WF3A 1IPKA 1OOPB 3W20A 3MGUA 4JDOA 2ID6A 2NZ9A 2L9VA 2YSRA 3PU3A 2LFBA 4D0QA 5CVRA 4UY8I 1P6RA 2X5IC 2QM3A 1RUC2 2ZHLA 1R083 1EF4A 3THDA 3T8TA 2GH2A 3V7SA 1FZPB 3UL2A 1X1AA 4JKKA 5LGTA 4N43B 3ZXDA 4N9IA 2DAOA 2D6OX 2BZDA 4Z07A 2XF7A 3VBOC 4Q5OA 1BEV2 2DMNA 3W2AA 5FP4A 3IIAA 1X19A 3CUQC 2XPVA 4IZZA 5GM0A 2J5PA 5A6XA 3VBFC 2GXBA 2ZTNA 4HPQA 3HNYM 4ISQA 1REFA 1H9GA 5JUVA 4D7NA 3H9QA 1M06G 1S7EA 1D4M1 1NCQB 3GWZA 3BUCA 2PMUA 1PO12 2CUJA 2EJRA 1GKBA 5DMYA 3CLQA 4JTOA 5TJJA 4DQ2A 3SITA 1I1GA 5IATA 3DECA 2H27A 2NS8A 4YIRX 2R7OA 4PQ9A 2KT0A 4M6YA 1JI6A 1V6IA 1U2WA 1I5ZA 1XCVA 2HWB3 2JDYA 3FHQA 2O14A 1O5LA 4JOMA 2CQNA 3I3DA 4RBOA 4XC9A 3BGAA 1DCSA 1MZBA 1VBE2 1R00A 3TOJA 3BVCA 3BTXA 3H0DA 1R1ZA 3O7OA 5JAXA 4PIYA 4F8AA 1CGPA 2Z33A 2XUBA 4BGDA 2QSHX 5JSPA 2CQXA 4KI5M 2QQVA 4Y3OA 3AYCA 3LOIA 4XFCA 4DZGA 5LBFA 3VGIA 1Y43B 4LKDA 2EA4A 4HG2A 3MMYB 1PX4A 3DPTA 2A05A 3HOYJ 3AJYA 4RD7A 4PJYA 5DABA 1TME3 1B35A 4AVAA 4XLNF 1B8IA 4P55A 2CRGA 3GBWA 3FXQA 2AYHA 2DFEA 1X1BA 4AWXB 1S0BA 2D6KA 1AR83 2JQ7A 5FLVA 2VZSA 4LBQA 1BCXA 3U4SA 2JVHA 4CCJA 1XDSA 4LA3A 3KP3A 3FXUA 3VEPA 2XAUA 4A3FJ 4ZDOA 5B3SH 3SYTA 2A6YA 2VZOA 4FPYA 3C3WA 3WX5A 2OZUA 4HNUA 3ALQA 4U0WA 3MHZA 1IZ1A 5C3RA 4NDLA 3E3VA 1R23A 2YS9A 4FQGA 2DYSH 4RB2C 2VONA 3VHRA 1MDMB 2IRFG 4DYCA 5KHDA 3KT7A 4Y1ZA 2A3SA 2XJVA 4ARYA 1AKHA 1OA4A 4YFKF 3J81K 5JI7A 5IT6A 4KL1A 1CWPA 1LFPA 4HXCA 1VRBA 1RUF3 2VC9A 1K5MC 4QQOA 5FY8A 3WP5A 3CCUI 5H9PA 1HSJA 1AL0G 5FZLA 2QZ8A 3WV6A 4D7YA 1F15A 4F83A 3BR6A 1W5TA 2PELA 4LXLA 3G71I 2X5IA 2G9WA 2YZ4A 4ASNA 3KYDB 5A7OA 1YLLA 2BYVE 3HRMA 1WH5A 1REEA 3K4CA 3CJQB 3GBFA 1ZZBA 2YPJA 1RKWA 1O91A 3S8PA 1KYZA 3A0BC 3VBOA 2ZAHA 2V72A 1HN1A 1W03A 3WHUA 3CUQA 5IVCA 3BG9A 4JQRA 4CXXA 2HYFA 2ZC2A 2EA7A 5JMOA 4Y52J 4BL0B 1M4WA 1DYKA 4BLJA 2COBA 4PZJA 4LLNA 3RKXA 2VNRA 3KT4A 4I7HA 4IQ4A 4FP2A 5A33A 1Z77A 4W6WA 2BW3A 3MW2A 3LSMA 4IDZA 4XHXA 2CQQA 1W7PB 2V1UA 2YXSA 4I3GA 1ULCA 2LF8A 3U4XA 3C7GA 4W8JA 4M6XA 1YG2A 1G8XA 2P3JA 5A3TA 2JG9B 1JYXA 2ECBA 5FY5A 1QRYA 4A3KJ 3ZXSA 2WAQN 3T1MA 2Y6HA 4JHTA 4L9JA 5FZ1A 2FD8A 4DBQA 5J7MA 4IHTA 5F6LB 1WH7A 3G1OA 1MS1A 5JVVA 2UXNA 2VOOA 2J22A 2DYCA 3LSKA 4CU9A 2JRMA 4GRIA 2CW8A 2H94A 3ZIXA 4C1XA 4AQTA 2F4MB 5JSOA 3ZFEC 3ZDSA 1UOJA 4Q8KA 1JJ8C 3POFA 1NG6A 5C9AB 3KEOA 2FD5A 1KZHA 2PAKA 3I59A 2NAZA 3RYPA 2VG9A 1MS4A 2DQLA 4LOTA 4XRFA 4BA6A 2QLZA 3BOQA 3S7IA 1UAIA 5DG1A 3CDIA 1D1BA 2W25A 5L3CA 2C6SA 3WF1A 1SDDB 2WWUA 4QDRA 2HI3A 5FOJB 1WCUA 5BNNA 4Y5SA 2ADUA 1FBUA 3LFMA 3I3QA 4B8XA 3AZWA 5IK8A 3JCUC 3K51A 3N7KA 2RVAA 4ZYGA 4DEVA 4EV0A 5FP8A 2E6VA 4RLFA 3PIOF 2ZMEC 4O6JA 3ZOIA 5M5XJ 4LK1F 2VZPA 4KU7A 4ZYDA 4FFIA 1JYTA 3K4BA 2VBYA 1GV2A 1QJY2 1MJAA 3KP5A 4XAEA 4OUEA 2DFBA 4GXOA 2VE1A 1KDMA 5JZGB 3SLIA 4C90A 1CAVB 3CF2A 3FHAA 3H3UA 4BHBA 2DBNA 4EN0A 2DOEA 1SVOA 4AFDA 1GZWA 3MKLA 2XJQA 4D6RA 2ID4A 3HOXJ 1RRJA 4BOWA 2WRAA 4C30A 2QWWA 2LS6A 4AVPA 3A01A 4AOCA 3VLBB 4B4CA 4IESA 4AVZA 1EYBA 1WW7A 4E6KG 4YNIA 3QPTA 2EICA 2E33A 2W1WA 4CCMA 2VTFA 1G9AA 2B63J 2ZMLA 5F7UA 1FTZA 1HQCA 5CVIA 4FTEA 2LTNA 1AYN1 1HIXA 2EAKA 3J9SA 5C6CA 3O12A 5FY7A 4ZONA 1QBJA 2CQKA 2V1XA 1VQKI 5DUXA 4H2AA 1EV7A 2VQAA 1ZHFA 5JOZA 1UZCA 5A3UA 4FBFA 3DEWA 3R0RA 1MEC2 4IEJA 5C4XJ 1ZZ6A 3JRCA 4J6GA 5FLIA 4K20A 2VD7A 4IUGA 5FUIA 4ENMA 4HN0A 2ATFA 2DFIA 2EFOA 4QB1A 2KQRA 4S05A 4B8EA 2V9PA 4FOYA 5FAXA 1VQMI 4ZZ8A 1Z91A 4CEYC 3NNGA 1RUI2 2P4EA 3E7LA 4UFJA 4UFHA 4NHYA 1DIWA 1FT9A 2QQ9A 5BYNA 4FVVA 2XF6A 3VSKA 4QX2A 3E0JB 1JTXA 3BWGA 1H30A 3NV1A 4MO3M 4QM9A 2P6SA 2D3PA 4XURA 1BJQA 2XAFA 3ZFEA 2A3WA 2W39A 3BTCA 1UHSA 1V00A 2DI3A 4XQFA 2GNBA 4GKXA 4IRGA 4S2GA 4G7ZF 4ENJA 3LOCA 1JYCA 4XKBA 1WSUA 4MUVA 1H0MA 3FBIB 4AI9A 2QUOA 2ZX3A 1MH4A 4UW5A 1R58A 5AONA 5GLUA 1W8HA 3LSPA 2ZEWA 3JXSA 1PVC1 1WUVA 2BVVA 2ZMEA 2XLAA 5FMOL 4QU2A 1F4AA 3DYOA 3HSEA 2M8EA 4XFAA 1GICA 2F6BA 2WSVA 3H1YA 4IPAA 3FXKA 4N7IA 4AGRA 1VQOI 3K2OA 5IP9J 4YVSB 4KG0A 3WGHA 1AR72 4BCUA 4KWKA 2GXAA 3H7JA 2RQQA 4WXCA 2R7EB 4XAAA 3ZFGB 4N43C 4LO4B 1QQIA 2IT0A 3TEXA 3RSNA 1SFPA 4UFMA 1HB2A 1FOXA 2ZX1A 5DEQA 4A41A 1QXRA 4LB5A 1WCMJ 1QXPA 1AL21 1VRH3 3M3QA 1BMV2 2E51A 4Z2YA 4PJJA 1FATA 4RQPB 4BEHB 1SHWB 1PYVA 1ASJ2 5F37A 4YZ5A 1H4HA 2BBVA 4KISA 3KX2A 4LLOA 3WTVC 2R92J 1OLRA 5IVVA 4RAGA 4A69C 5F5CA 3M1HA 2LALA 4L97A 5FYBA 1I6XA 2Y38A 1S0EA 1DQ1A 1PJRA 1TQIA 2P3YA 1RVF2 4D94A 2YROA 4Q4ZF 2PMZN 4IQJA 1ND2B 3NQHA 2RR11 4Q26A 1SFEA 4B44A 3J80Z 4XBNA 4ATEA 3F9KA 2VOPA 1AR61 2V79A 2ZGMA 4DXSA 2YC0A 4P9FA 1USSA 4BS9A 1SAUA 1NXMA 3B94A 2LRPA 3NQOA 1SMTA 1I3QJ 4FTHA 2WY8Q 3AP9A 5FYUA 4LOCA 4MADA 4FTSA 1RESA 1PP8F 2PJRB 2B9VA 2QQAA 3ZQIA 2QSGX 1BJZA 4JRLA 3L1PA 1KQ8A 4CEYA 3P7NA 3M70A 2A5WA 2KPMA 3LQQA 5JXGA 3RQ0A 1IQAA 1C8M3 2R4GA 1HKSA 2O5RA 1QA6A 3WODF 2IGOA 1W0OA 2SBAA 4CDQB 1IHMA 4YARA 3HPHA 2DVBA 2QBYA 3A0HC 3UT0A 2M87A 4XTPA 1PGL2 3KQ4B 4EQVA 3SDBA 3RQ4A 3TW7A 4OLLA 5E89A 1YQ5A 5FKMA 2DA3A 3OYFA 4XZUG 1IXSB 3HBKA 3W6KB 4AEJA 1VQNI 1OCCH 2HXIA 2N8GA 5IT3A 1SACA 4LLFA 4CU7A 1YHFA 1MS9A 4A42A 2A6HF 1ZRFA 1W6MA 4GULA 3FM3A 2HWE2 3CCSI 1GOHA 5J96B 1X2MA 3M1EA 2PAMA 2GN3A 1GP4A 3HN1A 3ECQA 2F5DA 5FZEA 4YVWC 3K4LA 1LOEA 2B9UA 1ULDA 2CGPA 2A3YA 4PF1A 5C3OA 4U7BA 4KT6A 2VNOA 4ESBA 3B9IA 2CU5A 4F91B 1DYOA 4XN3A 3LEGA 2JIGA 1OOPA 2DVFA 5K5OA 3T0AA 4KWJA 1X9TA 3B7MA 3BC8A 4B3NA 4OOIA 2ZEXA 5D8LB 3U10A 3OBTA 3B93A 1JYWA 2LC2A 1QJU3 3POBA 4MFDA 3CJTB 2RDSA 3VL8A 4GIQA 3CF5F 4N43A 2JENA 4CP0A 3T1LA 1K78B 5EYRA 2W1QA 1HDPA 5F0CA 1VAKA 5DS9A 4W65A