2OZ6A

Crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
201
Chain Sequence
MKLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLNSGDFFGELGLFEQERSAWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virulence Factor Regulator
publication title Crystal Structure of the Pseudomonas aeruginosa Virulence Factor Regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Dna binding protein
total genus 65
structure length 201
sequence length 206
ec nomenclature
pdb deposition date 2007-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2oz6A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oz6A01
1YLLA 1QBJA 3RDIA 1CAUB 3FFQA 1Y3TA 4BIFA 2VOOA 2HEOA 4KICA 2QVOA 4Z82A 1ZZ8A 2UZKA 2WC2A 2QUFA 1OPCA 4P9FA 3ST7A 2ET7A 3USSA 1IPKA 3EDPA 4QXKA 3KCCA 2FA5A 4IESA 5CVIA 3GUDA 2ZNZA 2H6BA 5CLSA 2IPQX 4ZYDA 4H0EA 4LB6B 4CDGA 2LF8A 1ZGAA 1W7PA 3DPTA 3GWZA 2IA2A 1XCBA 2V1XA 5D5WB 3JW4A 4P9GA 2PJPA 1U5TA 1R22A 3BJ6A 2HTSA 3RPQA 4LG0B 5BPDA 2FXAA 1DP7P 3WODF 3M9AA 4PZJA 4YSFA 4TLFA 4FT8A 2C0ZA 2NS0A 3K9TA 3KMHA 1D8KA 1BI2A 4A0XA 2HJIA 4MGRA 5D6FA 3IIAA 1SMTA 1X82A 4D7TA 2JRTA 4XFHA 3HIFA 4IEVA 3CUQB 1FP2A 2W24A 4IEOA 2J5PA 2DT5A 3I58A 1IRFA 1EYBA 5E8IA 2FBIA 4KDPA 3R4KA 3I53A 1SD4A 2PA7A 1J3RA 4G8XA 1EY2A 3I64A 4WBBA 1PDNC 2VT3A 1LDDA 4LLNA 2V1UA 2OD5A 3ZMZA 4AQ6A 4BXUA 1QGPA 3KZZA 4JV4A 3IBMA 3VODA 4UV8A 4UUVA 4XF3A 3ZN0A 3OCPA 1XD7A 1LRHA 2XLFA 4XFBA 4EVIA 4CHUA 4FAGA 5D8KB 2VE8A 2P5LC 1H1MA 3F72A 3CL1A 2ZFWA 4QM9A 4UNOA 2VE9A 2G7HA 4RD7A 3FHIB 2XKPA 4EM1A 4BHPA 2AXLA 1ZZBA 5I8YA 3QOPA 5LEJA 2CGPA 2HS5A 1OYWA 2Q0OA 4ZU7A 1DUXC 2CYYA 3T8RA 5CADA 4MGZE 3SXWA 2IXIA 1YS6A 3QU6A 2YX7A 2N7GA 4XLPF 2XVCA 4RB1A 2BV6A 3EUHA 3F8CA 1RC6A 2PQQA 1UHMA 2Z99A 3SMHA 1YFWA 2F2EA 1ZARA 3WE3A 2HYGD 3V4GA 2A61A 4CZZA 2A5YB 5DDGA 4M9ZA 4MGYE 2P5KA 4HBNA 4O5VA 3LAPA 2Q4SA 3JSOA 4HF1A 1XMKA 3OGJA 3FM5A 2VODA 1O57A 3RYKA 1XGNA 3MZHA 3DEUA 1SFXA 1RUNA 1BC8C 3CF6E 3HHGA 2DPUA 1RNLA 1QNTA 5FB2A 5BY5A 1VTNC 3HSRA 1ZYRF 1Q43A 4R8HA 4XRFA 2O1QA 4HQEA 3HT1A 4KWLA 2Y75A 3IKTA 4M74A 5KHKA 2OU2A 3ECOA 1J58A 3LFKA 2EVXA 3F6OA 1NHAA 5CVVA 2HYFA 1OMIA 3HUGA 1XGOA 4EQQA 5L3EA 2P8TA 2K4BA 3U11A 2GU9A 2P4WA 4IXAA 3LQRA 1OYYA 2YSRA 4R79A 4KU8A 4U88A 5L3GA 1D5VA 4Y15A 3C3VA 3I59B 1LDKB 2JSCA 4NVPA 2NNNA 3MCZA 2ZXJA 4HOBA 1YTYA 3RZZA 1R7JA 3L09A 4FAHA 3F22A 3BJOA 2MC3A 1ZH5A 3FXUA 4ESBA 3ZMDA 5IT9K 3VFZA 1DGWA 3TO9A 2MLGA 1SFUA 2L01A 3LWFA 3H3ZA 2VECA 2K27A 3J80K 1Z9CA 4M73A 4IF4A 2BE5F 3H92A 1NZCA 1MGTA 3GFMA 3NQOA 3ZMVA 3E6MA 5CVRA 3RJPA 4R1HA 1HKQA 1QZYA 3FMSA 5F6FA 2GQQA 3K2ZA 3KP2A 4A12A 1YW9A 4Z2YA 4AQ2A 1KQ9A 2AS5F 4HVOA 4AXOA 2XAJA 2ATFA 4E2GA 4Q0PA 4YRDA 3I7DA 4QGNA 1C0WA 5E1WA 1H9TA 2BBYA 1XE8A 2QBYA 2RC4A 5E17F 1U6GA 5JR7B 2WWYA 3U0ZA 5DCFA 1G3SA 1V4RA 1P6RA 4UHTA 4IHTA 1ZRDA 4L2NA 4Q0VA 4A0ZA 4HBLA 3JAMZ 2HWVA 3HTSB 1GXQA 2J5OA 1LDJA 4N9IA 3BB6A 3MZYA 5KK1A 2H27A 4ENKA 3H7JA 1QY4A 3FMQA 1P4XA 3AAFA 3GO5A 3HRTA 4PIZA 5HS8A 4ZYEA 2B0LA 5AONA 4LA3A 1EP0A 2ZNYA 4HLYA 4MHGA 4F8AA 1P4WA 1ZRRA 3MFKA 1IXRC 1WA4A 2YR2A 5HS7A 3NL1A 4XETA 2OZ6A 4LGWA 5E1RA 1ZN2A 1EV7A 4KMUX 5FDBA 1RZ4A 5HOOA 1G3TA 3COAC 2P6TA 1Q5OA 2DU9A 3ERED 1CAWB 2ISZA 2UY8A 1T39A 2B5HA 3EETA 1B9NA 3BPZA 3SFZA 3WG9A 2EJRA 5FCCA 4P55A 4EJOA 1XSXA 1YWKA 4OINF 1B6AA 3GFJA 3IC7A 5TRDA 2LKPA 3D5LA 3TGNA 2Z5UA 4XBFA 4AVPA 3FX3A 2VOPA 4UV9A 1E2XA 4HQMA 4BNCA 5ERIA 3D82A 2JPCA 3GFIA 1ONVA 2JPBA 3WTTC 4MTDA 2NAZA 1HW5A 5BPIA 3P7NA 1Z91A 2QQAA 5HLIA 3ELKA 1FBSA 1R00A 1CF7A 2MNGA 5KHJA 1IXCA 1J3PA 4PIYA 4XFFA 3E6CC 2XASA 4KIFA 5K5QA 2Q2EA 1XB4A 5I0TA 3HT2A 4D7SA 1QZZA 2XIGA 4PGHA 3RKYA 3U1DA 3IDCB 1ZAOA 2ACJA 2EFQA 3V7RA 2PHDA 1XGMA 4XFGA 1ZZ9A 3BU7A 2D93A 1IN7A 4K2EA 3ZMTA 4YARA 4XFCA 1ZRFA 1T38A 4PDKA 3CUOA 1BJAA 4BQAA 4UBHA 4L9VA 5CJ9A 3GYDA 1R5HA 4GO1A 4L0ZB 4M9SA 3F8NA 5ICGA 1MJAA 2PMHA 3BJAA 3I0TA 5LRRA 3NJZA 4M6YA 2Z69A 2FNPA 2Z2SB 3EO6A 4ZU5A 5T3NA 4U0YA 4B29A 2FNAA 3CO2A 4MQVA 2F5FA 3H3UA 4Q0SA 3C3WA 2IC1A 3FF5A 4HDUA 3P9KA 4WX9A 4R52A 1TQ5A 2XAHA 4BH9A 3LOIA 2VC0A 1KU3A 2ADUA 1QQIA 4OOIA 3TO6A 1LQ1A 1RL3A 3J81Z 5FLJA 3FM3A 2DO7A 2HQNA 4M71A 5BMZA 4UBGA 1SQ4A 1DPUA 4LK1F 1ZG5A 5LHGA 4XSXF 4X6RB 1GQHA 2GZWA 2M45A 3MPBA 1P4AA 2MHFA 4Q4ZF 1JHHA 2VQAA 1CAUA 1T0FA 3R0AA 1GQGA 5E1XA 3B02A 2IXHA 3C7JA 4L11A 1Q1HA 1MD0A 2K0GA 4WXDA 4KFCA 3WW1A 5DEQA 1X3UA 1ZRCA 3PLQA 1YHFA 1SFEA 4DNCA 4PGGA 3ML6A 5FLXK 1G4DA 3DN7A 1X8EA 4HX8A 3ZN1A 3BCWA 4N9HA 4XSZF 5K5RA 4QM8A 2MD5A 2YX4A 3H50A 1I5ZA 4ZYGA 4XF0A 4A6DA 1RTVA 1LJ9A 5BPXA 4IEQA 3SQNA 4I3PA 1UIKA 2DLLA 1L0OC 2W85A 5FQ0B 1FLIA 2FE3A 3KP6A 3KP5A 3ZPLA 5FGMA 4RB2C 3SHRA 2GH2A 4BHBA 2D5FA 3ES1A 5JAXA 2GWRA 2R7DA 1CGPA 4XFAA 5K1YA 4LG0A 2PMUA 1USTA 1YFHA 3TO7A 5JCTA 2FOKA 2CSOA 1MKMA 1QPMA 3I5UA 2A6HF 2G9WA 3GLXA 2C6YA 3PQKA 4G9YA 4HV5A 1J0RA 2TDXA 4I01A 2XAQA 3L00A 4YFKF 5J48A 2KXLA 3M8FA 2P17A 4E70A 3IWZA 1K79A 3MWMA 4P9UA 3K1MA 1FNNA 3CUQA 1H9GA 4OIOF 4ENNA 5BOXA 4IRIA 4KMFA 1SFNA 3ETQA 1D8JA 4EJTA 2CO5A 2F5CA 5TJJA 1KGSA 3BOQA 5E8GA 2WFPA 4LK0F 1FYKA 3O14A 5HDNA 2M5WA 3B73A 1HKTA 3KLNA 5DUIA 2O8XA 1KU9A 4HF0A 1BIAA 4OMYA 2F4PA 1MDMB 2V9VA 2XAFA 5JR3A 2HQRA 2LNBA 1FI2A 4LA2A 4RB0A 2PAKA 3KFWX 2CWEA 2D2WA 3WTYC 4O9GA 2PLYA 1CAXA 2RGVA 2GC1A 2HZTA 2EV0A 2FBHA 5D5UB 5DYMA 2K86A 2BNNA 3P9IA 3GYHX 4L9TA 1PMIA 4IPAA 4QLCU 4G6DA 2E1NA 5EEHA 2ISYA 3L2HA 5LGUA 1BI0A 4RGUA 4KT5C 4ESJA 3R60A 3HSFA 1W7PB 3F6VA 1O7LA 1FY7A 1R1VA 4FX4A 1YFXA 5J6XA 3NW4A 1U5TB 1ZNPA 4XLNF 2NYXA 1LKNA 3IKVA 2F5EA 3KETA 2M87A 5FLHA 3RYRA 3ROUA 1R36A 1TTYA 2GIVA 5HS9A 2BNMA 2IJLA 2EFWA 4ZH4F 2IRFG 3ABUA 5J8CA 3BY6A 4UVBA 3KGZA 4FBFA 4EJUA 3MYXA 2CQKA 3LWCA 1O3SA 4L5JA 1K7AA 3IRQA 4EV0A 1TW3A 1W7PD 4DINB 3LQQA 3LA2A 3H7YA 5ED4A 4MGKE 1IUYA 4N0BA 3IWFA 3N97A 1T98A 4AD9A 1ZVFA 5HDKA 1JHFA 3GVAA 3WGHA 5I0UA 4L9NA 1W4MA 1I1SA 3ACLA 2Q8KA 3FWEA 5DD4A 3MDPA 1GXPA 3QPHA 3JZVA 3Q9VA 2KIUA 3GX4X 4KN7X 1Y0UA 1FOKA 3EYYA 2ZO4A 1K6OA 1YFYA 3TQNA 5DV5A 1WLTA 2Y48A 3E6BA 5D6EA 1O5LA 2RQPA 2A3SA 2QQ9A 3HRSA 3UKVA 3GEZA 1ON2A 2XL9A 1UCRA 5A2QZ 2UYBA 4LEJA 5CVJA 5K8SA 3CLOA 4IEZA 5ILVA 1YW7A 4KIGA 4IETA 2HKXA 2VBYA 3GBFA 1MJ9A 1TQIA 5E16A 4YIIA 3KE2A 5AVPA 3UKTA 4KUMA 2L54A 3CUQC 3MAJA 4L0YB 2EB7A 5AIPA 1IPJA 1IZ1A 1FX7A 3EJKA 1U12A 2I45A 2QWWA 3I59A 4MTEA 3TDUC 5FPZA 5ILSA 1XMAA 3LAJA 4KIBA 3BZ6A 5JSPA 4Q48A 4YYOA 2EFOA 2IXLA 2RDPA 4ETSA 3S0MA 4ENMA 3T5XA 1B59A 4IRHA 2BEOA 3BDDA 1V70A 5FD5A 1ZHFA 1OYIA 3RPUA 1HBXG 4RAYA 3Q5FA 2CAUA 2HFHA 1YLFA 2GC3A 3L9FA 4META 1J2XA 3DFGA 1IAWA 4X6QB 1XSVA 3O2PE 3V7CA 2XL7A 4A2UA 2FQ3A 4OIRF 2PYTA 1F9NA 3P9CA 4E2SA 1LB2A 1XN7A 4J1XA 2VT2A 1TQMA 2YPRA 2ZJ2A 4IEUA 3TDZC 1K78B 1J7KA 2DBBA 2IP2A 3CO7C 3WGGA 1W5SA 1FYLA 5LHIA 2EA4A 2MH9A 5IT9Z 1KU2A 4RB3C 3BP8A 4AIJA 3FMRA 4KA4A 2DPDA 5BXXA 1ZZ7A 1J59A 4MEYF 2DFIA 2BYVE 5KHHA 3J80Z 1SD5A 4RGRA 1NYWA 4LLOA 3VB2A 1S7OA 4GCVA 3WTWC 2QVSB 4WWCA 2M1BA 2PAEA 2Q0AA 2QYOA 3CO6C 1VP6A 3ZDSA 2IXJA 4F7ZA 2O0YA 5DCMA 1LEBA 4ZZLA 3KGLA 2O3FA 2GC0A 1EH6A 3G3ZA 3GFLA 2UYAA 1XGSA 4B09A 4L5IA 4ASNA 3DP7A 1U78A 3V8JA 2UXXA 2W57A 1KQ0A 4L18B 5H6RA 3PFIA 1VR3A 3S7EA 4MV2A 3K0LA 4OFGA 4HVRA 3CDHA 4RGXA 1ON1A 3FZ3A 2FQPA 1YYVA 3F23A 3V8LA 1MJBA 3S2WA 2KIFA 1O3QA 1CAWA 3LAGA 3CJXA 2CAVA 1IN4A 4M9XA 3O6BB 5FD6A 3JAMK 2VN2A 3PQJA 5F1RA 4XF9A 3GZ5A 5DUKA 5JSRA 2P5VA 3OF1A 1HQCA 3RKXA 4JVAA 2NNYA 3M1EA 1IF1A 1YIOA 4JK1X 3Q9SA 1UW8A 2QCSB 4IEYA 1ZX5A 1J1LA 4RS8A 4MH0E 3SHFA 5D5XB 4M72A 3ELNA 3SZPA 5KVRA 4O3MA 4ZYHA 1RUOA 1ULYA 5LRSA 4HVQA 1FP1D 4YFXF 5JVTA 5D4RA 4EROA 1FT9A 3RKWA 4EM2A 3C18A 4KN4X 3WE2A 3WGIA 4GYIA 3E5UA 3T8TA 2IVMA 3D0JA 2FU4A 3VHRA 4IRGA 3JTHA 4O9EA 1I6XA 2Z9OA 2VONA 1EH8A 3RYPA 2Z33A 1DPRA 4Q0UA 1FXZA 4P96A 4ZU4A 4ESFA 4CGZA 3REOA 4EGYA 2HDCA 4UVCA 2OQRA 2DK5A 1WQ2A 3WTVC 1HSTA 4HLXA 3N4MA 3U10A 1S3JA 5FFXA 4HYEA 5L3CA 4AIHA 4XEZA 4WCGA 4IJAA 4XF4A 1S29A 1EPZA 1REPC 4UXNA 4IEXA 1SAXA 4S04A 2FSWA 1BOAA 3SCFA 4JBAA 4IEWA 1Z6TA 3ZMSA 3OOPA 3WW4A 1KU7A 3H1MA 4MQ9F 2V09A 1LR5A 4HW0A 4RAZA 2P6SA 3KLOA 1R58A 5L3DA 3ULQB 5JHUA 2PI0A 4AIKA 2P7VB 3DQVC 2QLZA 5EFUA 3NRVA 5I0SA 3BROA 4EJVA 3DF8A 4CICA 3ISPA 1ZLJA 1HKSA 4BHCA 2O6GE 4HSLA 3RIRA 1WGPA 1O3RA 1S8NA 1P92A 2OZJA 1BI1A 2H09A 4ON0A 1X7NA 2V79A 1U2WA 3R0JA 1RIOH 4LMYA 3LA7A 3H1WA 3IL2A 1G3WA 1IN6A 2FF4A 1PP8F 3M3IA 1ODDA 2O61A 4QGMA 3EYIA 1LNWA 1FZPB 2EV5A 4LTAA 2KJBA 2PFBA 3W6JB 1KQ8A 1ZZCA 3MQ0A 2P7CB 2XUBA 3O3KA 4LLLA 1PM7A 4MNUA 2MPFA 1QXJA 2CG4A 1CAVB 3VEPA 5JI6A 4WXCA 1UCXA 4HA8A 3WU0A 2VBZA 3HRUA 4KU7A 4M6XA 4G7ZF 5I0RA 1B9MA 2RV8A 1TW2A 3VOEA 3IRRA 2XHKA 3DPLC 5FPXA 2IXCA 2BNOA 4Y17A 2ETEA 4E2QA 5KHIA 1I27A 1AWCA 4AVCA 4HX4A 1F4KA 4HV6A 3E3VA 5D5VB 3WTUC 2FRHA 4A5MA 1NE6A 3PVBB 4JQFA 3T1BA 2DCTA 2Q30A 3F8BA 2JZYA 2ZMEB 1DZTA 5BUVA 4EM0B 4MX3A 2KJCA 4ORFA 5I93A 3IHUA 4HX7A 3JTGA 1R23A 6PAXA 4EGZA 4G7OF 3TKYA 1HXDA 4CO8A 3ZQ7A 2PBIA 3WTSC 2FBKA 4ZZDA 3GW2A 2QDRA 2IT0A 2OPKA 4ONUA 1J3QA 3H8UA 3FE5A 4JTOA 4HF2A 1Z7UA 1O7FA 2STTA 5I8SA 5LLQA 2FMYA 5H20A 3JSPA 4KWKA 4LUKA 3FHZA 4IERA 1J75A 1MDMA 3HSEA 2ESNA 2X4HA 3CLPA 1S7AA 2OQGA 2ZBKA 3ES4A 3QP5A 3TOBA 4I0AA 1H0MA 1Q3EA 3SXYA 1HW2A 5ICFA 4KYWA 3F8MA 1LEAA 2MLKA 4JTNA 1UHWA 2Q1ZB 2XGXA 2EWNA 1WSUA 2LSOA 2L4AA 2ZKLA 1DGRA 2KKOA 4MGIE 2MA3A 5K5OA 3EBRA 5D8LB 3EQEA 1IW7F 4I2OA 2E9QA 3WW3A 3HRMA 4OIPF 3HYIA 2W25A 2WTEA 2EAAA 5L3FA 1ZREA 2F5DA 1EH7A 1UIJA 1USSA 2KRFA 1VJ2A 3BALA 2IA0A 4U0VA 1V3FA 1L3JA 2OBPA 1GHCA 2PN6A 2H0VA 1QO0D 2GA1A 4HN0A 2G7UA 4AWXB 5CVUA 1R1TA 3K69A 3KZYA 1L3LA 5HI0A 2EA2A 2V1DA 2GC2A 4MZUA 5ILUA 3QP6A 3L7WA 1XDUA 1U3EM 1BBYA 2O03A 5I8TA 3W6KB 3ECHA 3L2CA 3HOTA 3ZMUA 3OV8A 4S05A 2YU3A 4YIFA 1TLHB 3BPVA 5F64A 5HLGA 3WTZA 2EK5A 1F1ZA 2ZCWA 3OTFA 5L3BA 4BAYA 3M8EA 1WI9A 2QJVA 1J9IA 2Y0OA 3H9AA 5BV6A 1STZA 1OD5A 2FMLA 3F3XA 3TOAA 1XDSA 2OYZA 1CAXB 3WW2A 1OR7A 3KSCA 2JT1A 4CXFA 3F8FA 5E20A 1J5YA 1ZGJA 4I02A 4HZFA 4QMAA 3G7DA 4FX0A 4LULA 3PNAA 5HVQC 1FBUA 1WRJA 4I0BA 4GULA 4PJYA 3DXJF 1YG2A 4I98B 4PIXA 4HDVA 1YS7A 3EQLF 2A6EF 2V6CA 3HTUA 3U9GA 3K1NA 2CFXA 2GXGA 3E6DA 5HLHA 1IN8A 1R1UA 4HSJA 4LFUA 1FSHA 1G6NA 4LLGF 2D1VA 5C8WA 1RI7A 1CX4A 2OZUA 4MUVA 5A2QK 3KP7A 3SCHA 2GAUA 2Y0MA 1FC3A 1UFMA 5KHGA 3QRFF 4KWJA 1GVJA 2HR3A 2D5HA 1DDNA 2QNKA 4GGGA 2UWMA 5J8FA 3BPXA 3KEOA 2OAZA 4MEXF 4FHTA 1BI3A 2D1HA 3WTXC 2IXKA 3OD0A 1D3YA 5D4SA 3HHHA 2A69F 5E1ZB 3F21A 2HOEA 3NSTA 4BYYA 1K78A 1U5TC 1Z6RA 2LDUA 2EV6A 5H6QA 5LHHA 4IHSA 3KP3A 5E18F 5I91A 4HAMA 3CEWA 4LUMA 4HLTA 2A07F 3BWGA 5D1IA 3SZTA 4O6JA 4K8FA 1FWZA 3DV8A 1JE8A 1UB9A 1IXSB 1NE4A 1HSJA 2DW4A 3I4PA 1F5TA 4HN1A 2M30A 4XFIA 1QXRA 3LZZA 1ZG3A 1IRGA 4QGLA 2MBFA 3UKNA 2B8MA 2H94A 4ENJA 5FFZA 2XLGA 3NVCA 4Q0QA 5BQTA 2M8EA 4UVAA 2R3SA 2RVCA 1KYWA 4UXAA 4J1WA 4QX5A 2E7XA 5JSOA 5JFRA 1NXMA 2DK8A 2RNJA 2DTRA 4YFNF 1FPQA 1Y9QA 2DAOA 5IT3A 2XKOA 4Q5SF 3V8KA 3KEQA 1OKRA 1BM9A 2OA2A 1B4AA 4WZCA 4B8XA 4GYGA 5AIQA 1Z1DA 2K9ZA 2RN7A 1ZG1A 3HOSA 2EA7A 3G73A 3FXRA 1Z05A 2STWA 4OLLA 2D45A 4I7HA 1XRUA 1TQPA 2NRAC 2OA4A 5LGNA 5LGTA 4OU0A 5EEGA 4QWQA 2QM3A 2ESHA 3FJSA 3U2RA 1FSEA 4WVZA 1XCVA 2XRNA 2PHLA 3FXQA 2QQBA 1MZBA 2PQ8A 1B1BA 5J7MA 1FYMA 1YFUA 5LEKA 4KNYA 2L4MA 2DQRA 2D40A 5FO5A 2PTMA 2XLAA 2VBXA 3LSTA 4NQWA 1KYZA 5CYVA 4RGSA 2VXZA 3NEUA 4I09A 3E5QA 4EWDA 2X0LA 1SD7A 1TNTA 3M70A 2XV4S 1T2KA 5DCMB 5ICEA 1YW8A 3EHKA 3I71A 5EZWA 3DL3A 4Y13A 2COMA 3DKWA 1KA8A 3ZP5A 4NB5A 2RKHA 3K1PA 4IVNA 2FEZA 2LF7A 3GZ6A 3H1YA 1H1IA 2QBYB 1P2FA 2K7LA 1TNSA 3I54A 1JGSA 1OFNA 2E1CA 3D0SA 3GXOA 4GXOA 2IW5A 4G6QA 4WK8F 3IDBB 4G7HF 4XF1A 2IA1A 2QENA 4U0WA 3T0YA 3R61A 1HW1A 1SMYF 3E97A 1R5GA 3RTRA 1JUHA 4TV7A 2MH2A 2QZ8A 3TNQA 2PAMA 2L3DA 3M7GA 1UPIA 2ZKZA 2E7WA 1XSDA 1UD1A 2HTJA 1W5TA 1BN5A 3RI4A 3S7IA 3TNPB 1QWRA 3QPTA 2UXNA 1IN5A 2A68F 1YQAA 4Z07A 2HGCA 4A6EA 2W84A 3SCGA 2DQLA 1PP7U 4DQ2A 4EWAA 2H6CA 2UY9A 1ZZ6A 3CJNA 4YNIA 2BGCA 2GA2A 1TBXA 1CAVA 1BIBA 4LB5A 1CF7B 2JTVA 4EMSA 1O5UA 4CYDA 2ETHA 2K02A 1WKMA 4Q29A 2L02A 3CTAA 1S6LA 1SEFA 1G3YA 4EWEA 4OIQF 2EFNA 1U8RA 2ET1A 3E5XA 3MEXA 4WF2A 5J3UA 3FZVA 1T6SA 3LA3A 3R6SA 4IEPA 4EJWA 4A5NA 1BC7C 3NKTA 1E17A 2GXBA 3HQXA 2XAGA 1LVAA 1I1GA 2VC1A 1A04A 3KP4A 5LBQA 5C6CA 2VPVA 4Q47A 1O4TA 2PFWA 4YG2F 2PG4A 1AOYA 2ZMEA 5CU1A 2B9UA 1JXSA 1X8MA 1XE7A 3J81K 1YUDA 3RNSA 3V7SA 4U7BA 5DD8A 4G94A 2O8QA 1WWXA 4L9JA 5FQ0A 3WU1B 1SD6A 4LJZF 4PCQA 5FLIA 5ICCA 4H7LA 1PUEE 2ELHA 3QAHA 5BS6A 5KBFA 1RGSA 2CW0F 4A0YA 4HMZA 1O3TA 1ZLKA 1YO5C 4AVAA 2Z3YA 3QU3A 4LD5A 4KL1A 3ABTA 2VBWA 4D0PA 4OMZA 4WXHA 2EFPA 5FLXZ 2CV6A 2PEXA 4AVBA 2DI3A 2HKOA 3J7AO 3GF2A 2XROA 1FBQA 4NHJA 2R7FA 1DZRA 2KIMA 3QACA 3C1DA 2WV0A 2K4JA 4U7DA 1OI6A 5HDGA 4P5OA
chains in the Genus database with same CATH superfamily
1FTTA 1X1BA 1QBJA 3RDIA 1Y3TA 4BIFA 5EG0B 4IV3B 2HEOA 1VBC2 2QVOA 5FO8B 1ZZ8A 1PMJX 4HK9A 2QUFA 2DCYA 2ET7A 3KF5A 1VQKI 3EDPA 4CEYC 4L8QA 1S0FA 2FA5A 3PU3A 5CYYA 4IESA 3ZFFB 5CVIA 1V5GA 3GUDA 1FMVA 2GOXB 1R083 2H6BA 5CG8A 5CLSA 4Q4V3 2NVUB 1DGLA 4A3KJ 2DFHA 3TW7A 1AA7A 3KX2A 4H0EA 5JZGA 4CDGA 3NV2A 3DPTA 3SH3A 1XBFA 2E35A 3AMHA 1U5TA 2VQ0A 4JQRA 5IVJA 2HTSA 5BPDA 2FXAA 2DU0A 4PZJA 4E7LA 2DVGA 1MEC3 2NS0A 3K9TA 2E33A 2RMU1 3C2HA 3HNYM 5F5QA 2Y6FA 4ZZ5A 4A0XA 4BXXJ 3OMYA 2KR2A 2XUEA 4Y1UA 4XFHA 4DY5A 2OT7A 1DGRN 2LD5A 4BXFA 1ENHA 2O8KA 1DG6A 2JE7A 1TP4A 5FZ1A 5A3WA 2RDNA 1AL21 1IRFA 2HVRA 1EYBA 5E8IA 4NIGA 5TSWA 2FBIA 3PIGA 3R4KA 3FXKA 1SD4A 1ENRA 2XVGA 1JJ6C 1J3RA 1N1YA 5FP4A 4NHYA 2VT3A 4YZ3A 2G1MA 4QU2A 1OKQA 4BXUA 1GLNA 2X51A 1XSRA 1D5YA 2F4MB 4C0BA 2K3PA 4XF3A 1UN1A 3ZN0A 3MHZA 3OCPA 3WDTA 2HBTA 3KV5A 4XFBA 3ZVXA 3W2WA 2RQQA 3GZNB 3F72A 4UNOA 3NMBA 3AZVA 2CUJA 1CQTA 2LBFA 4EM1A 4BHPA 4K1ZA 4A3ZA 5JOXA 5LEJA 3VPRA 2CGPA 1Z7S1 2GP3A 2HS5A 1AR63 3NNFA 1SG3A 2CYYA 5GZEA 2IXIA 2OJED 2A75A 2QFEA 3QU6A 2YX7A 2P1BA 1U5IA 1UHMA 5A33A 5HCHA 5FJHA 4XUQA 2YC0A 1RKTA 1YFWA 2VMHA 4YW7A 2ADDA 2XF5A 2A5YB 4CZZA 3N7LA 4M9ZA 4MGYE 5A6XA 3DPRA 2HNHA 4XUPA 4BDVB 3ENRA 1D1AA 3JRCA 2W9XA 2VODA 5EJ3A 2Z1DA 1OA2A 1JTXA 3I97A 3ZR8X 2R063 3DEUA 1SFXA 2Y6LA 4BQXA 4XJAA 1BC8C 3TRSB 1HRV1 5FB2A 5JZGC 1QKQA 1UMIA 1VTNC 1T2XA 1NAEA 1WZXA 1ZYRF 3I4NJ 2R32A 5J98B 4R8HA 2NMNA 1RJ8A 1Y6IA 1S0DA 3D5SC 3IKTA 4C30A 2RJKA 3ECOA 1J58A 1C8M1 1OMIA 1JKOC 2WLPA 4Q4Y1 1BR2A 3ZFEB 2A05A 2K4BA 3LQRA 4XBNA 1M1EB 4P5YA 4RFRB 2ZEWA 4R79A 5A3UA 3VD9A 2QEXI 2E26A 4KU8A 1REFA 1A36A 2HBUA 2PHFA 5IK7A 1M06G 2GSYA 3USUA 3I59B 1RMU1 3WHTA 2DVDA 2KLOA 2NNNA 3MCZA 1YTYA 5BNGA 3RZZA 2V26A 4MXWB 4FAHA 5JMOA 1HXS1 4BJ6C 4K3UA 2MC3A 1RUJ3 2X1EA 2VJIA 1SAUA 4LIUA 3FXUA 3FDYA 1V9U2 3RWNA 2DMQA 3MW4A 3THDA 3I4MJ 2JVHA 3S3MA 1ZA4A 1VBD3 1MQTB 1QJX1 4AIDA 2EIBA 2BE5F 3OPWA 1OPMA 3H92A 4DRVA 4Y22A 3GFMA 4LR4A 3NQOA 2DOAA 1XNBA 2HLEA 4A41A 4D0QA 3RJPA 4R1HA 4E4DX 4DXRA 4ZHNA 3A23A 1YW9A 3GDBA 5GADJ 1PZ7A 1KQ9A 3OYLA 2JDMA 1JJ8C 4HVOA 2LY1A 3CZ6A 4Q0PA 3I7DA 1QHGA 2DOFA 1C0WA 1SACA 5E1WA 3NV3A 2BBYA 4RBOA 1C57A 4AWDA 5JR7B 3U0ZA 3WINE 3SLIA 3DPRC 3IAPA 4QX0A 4YVWB 4UHTA 1Y8RB 4DUXA 4Q0VA 5EDNA 5BYNA 4A0ZA 1W06A 2LUWA 2JIJA 1GXQA 1LDJA 2RJ2A 3CCUI 1E5RA 5KK1A 3FBYA 3AAFA 3BG7A 3HRTA 1IQAA 4ZYEA 4Q26A 4HLYA 4MHGA 3K48A 4F8AA 1WA4A 4IW3A 5HS7A 5JI9A 4IXLA 1PIV3 1UY2A 3ZIWA 1ZN2A 4CCDA 1EV7A 2R7SA 3SEZA 4KMUX 3V64A 1LE8A 3BC8A 2WNEA 2V73A 1VQNI 3COAC 2P6TA 1S2KA 2ISZA 4NJ4A 1B9NA 1C4RA 3DYPA 5ABJA 4XZPA 5TRDA 3VB9A 1PGL1 4MFEA 4GKYA 1FOYA 1E2XA 4HQMA 4BNCA 5ERIA 3GFIA 2EIEA 1GICA 3CF2A 2WNUA 3DYOA 1ND3B 4AOCA 2JWTA 4UFHA 2R7QA 3KVAA 2JKBA 5HLIA 1R00A 4AYBN 1W6QB 4B1RA 2BTVC 1W2NA 3URFA 3E6CC 1ULGA 1C8NA 4PJ0C 3VYRB 3OS2A 1XYOA 5T55A 1LU2A 5K5QA 5EJZB 2Q2EA 3LF7A 5A1LA 4DZJA 5I0TA 2CU5A 3HT2A 1NA1C 2R072 3HN3A 3OYWB 1GOFA 1CPMA 4XMIA 3V7RA 1TWHJ 4A3FJ 2E1MB 3DWLE 1WLDA 3BU7A 4JKMA 4E27A 4IHXA 4FXKB 1IN7A 1Y9GA 2OPTA 1ZBA3 1ZRFA 1URXA 4BQAA 4L9VA 5CJ9A 4F3JA 4E6KG 1OLRA 4TXWA 5FUNA 3GYDA 3JRFA 1TNFA 1MH3A 4ARYA 1W0PA 3J9SA 5ICGA 3M4FA 2Z69A 2FNPA 4DUVA 3EO6A 3M3QA 1S0EA 2WINB 4K40A 2H1KA 3ATGA 3CQZJ 2IC1A 4Q1RA 3FF5A 2OF7A 2XAHA 2MGQA 2BDRA 1MS3A 1EPWA 4DFSA 1RVF2 5A7WA 2YUEA 2BXZA 1SQ4A 2ZX0A 2KHMA 2E7TA 5LHGA 4X6RB 1GQHA 4Q4ZF 3A02A 3PUSA 3R0AA 3UNGC 1GQGA 1LECA 5H9PA 3C7JA 4WXDA 3WW1A 3OEBA 3JRAA 1X3UA 3PLQA 1YHFA 1SFEA 3APBA 1V9U1 3ML6A 4V2GA 1G4DA 3FBIB 4N9HA 4XSZF 4FQGA 4JDOA 4CU6A 1GWMA 3MUY1 3IMMA 1GZWB 3ZM8A 2X53S 4AVTA 2NS8A 1UIKA 3CQOA 2HI3A 2WNUC 2Q5TA 2K40A 5FQ0B 2FE3A 3KP6A 5FGMA 1W2AX 1JYTA 2GH2A 3V0AA 4LG0A 3ON7A 2HWC2 3VYTB 1YFHA 2FOKA 3I5UA 3ZMNA 2C6YA 3PQKA 4G9YA 4M4PA 3L00A 2XGEA 5C3RA 5J48A 4QXBA 1E5HA 4EN9B 5E6HA 2F5VA 2ID4A 2BPA2 4QKFA 3CUQA 3WQ0A 4N43A 4IO9F 1S0BA 4LBOA 3A01B 4CP2A 5HCAA 4IRIA 1D8JA 1WFXA 5B4XA 3BOQA 3O5SA 4YIRX 1QOSA 5KR7A 2LKSA 4WVWA 4N53C 2M5WA 3D8CA 2Y60A 4KBZA 5HNFA 3I2OA 1KU9A 2QQNA 3WUDA 1IG3A 4OMYA 3ZYHA 1MDMB 2M0CA 2XAFA 2DU1A 2LNBA 2KRHA 1FI2A 3GALA 3M7AA 4RB0A 2C4XA 4LA2A 1WI3A 3KFWX 5DDJ3 3T1LA 3IH2A 5HCFA 3WTYC 1YQ5A 2GC1A 5DUXA 2HZTA 2EV0A 3MN2A 4AU7A 2K86A 1HOMA 2MG4A 1TWAJ 4IPAA 1A34A 5HXMA 2CU7A 2VVFA 1D1BA 3PUIA 2W94A 3VSKA 5EP9A 3L2QA 4KH9A 3ZFGB 3LMMA 3ZYFA 1W7PB 1C1FA 1O7LA 1WD4A 2M4KA 1YFXA 2L7KA 3JB8A 4LNVA 1AR72 1LKNA 3GCXA 4UFKA 3CP8A 3IKVA 2YC4A 5FKOA 2F5EA 3J7HA 2M87A 3RYRA 3ZN6B 4FTSA 2WR9A 2BNMA 5F39A 3WNMA 2QUOA 2EFWA 2IRFG 3BY6A 1U5ZA 4KITB 1BA5A 3BU0A 2CQKA 5LK5A 4EV0A 1W7PD 2HEVF 3S6PA 2FMDA 3H7YA 5ED4A 4XQDA 1IUYA 4AQTA 3DF0A 4AR2A 2E63A 4RQPB 2V9KA 4AD9A 1JI8A 2WSVA 2AGSA 1JOPA 2R92J 1MZEA 4BK5A 4OUEA 4QQHA 2Q8KA 4R9DA 4HXCA 1VBB3 1LODA 1GXPA 4KN7X 1UX6A 1Y0UA 1LOGA 3EYYA 2ZO4A 1UZWA 1YFYA 4PK4A 1R081 1WLTA 3CDIA 3VBSB 3AC0A 1OCPA 3H0DA 3UKVA 2XGCA 4BQOA 4YVSA 1O4YA 4D5CA 4LEJA 2H0BA 4IETA 4BPZA 2GNDA 2HKXA 4GB32 2YFZA 1DIWA 4X0GA 4YIIA 1OCTC 2B4KA 1IHMA 4KUMA 3AP9A 3CUQC 1MEC1 3AZWA 4HRIA 4N43C 1MZFA 1H4HA 2G9FA 1IZ1A 3WNKA 1QJY3 2ZJPF 4MG2A 2QWWA 2VOXA 3AB0A 3RFRA 4D94A 3H9JA 4HKOA 1RUC1 5F9TA 3S8PA 2WQZC 3TAYA 5CZKA 1XMXA 4FVVA 4H4KC 4JX6A 1KXGA 3VUOA 2IXLA 4AEDA 4C8DA 5GALA 2V7FA 1JHNA 4H14A 3OIPA 4BE1A 2DODA 1RVF1 1KGYA 3GMEA 1V70A 1OYIA 2MYSA 5LBFA 2E6VA 2HFHA 5CFCB 2GC3A 3L9FA 5FY1A 2BWCA 4ITVA 3DFGA 1IAWA 3S57A 1XSVA 2XL7A 1NCQA 3CIHA 3H8XA 1WBLA 4A2UA 1UNBA 1F9NA 5F3GA 2MABA 2NVQJ 4E2SA 2Y0SA 2JG9B 2VT2A 3UV9A 1MIJA 5J96B 1VAKA 2EIKH 4UT5A 1K78B 1J7KA 5JXHA 4GWNA 3ZXEA 5LHIA 2EA4A 2UU8A 2DCKA 4AIJA 4AZZA 4BEHB 3PU8A 2DPDA 2BVLA 2ZGKA 2DURA 3ZPYA 2EINH 1AR61 1HLCA 1AKHB 3R4UA 4RGRA 1W9SA 4LLOA 1S7OA 3KB5A 1ORKA 1W6PA 1EAH3 1QJFA 4WWCA 1K83J 4QQLA 2PAEA 2QYOA 3CO6C 1VP6A 4NC8A 4XBQA 2O0YA 1LEBA 1W3XA 4ZZLA 5EV7A 3MZ8A 2OKXA 2PJRB 1PVEA 3V8JA 4Y5SA 2NS7A 4GA9A 5H6RA 4YZ4A 1GU3A 2R061 4OFGA 2WKKA 1D1CA 4HVRA 4YFZA 5HLTA 5A7SA 4FOWA 2F4IA 3WD5A 5A6QA 3F23A 2VJXA 4FOQA 3BTZA 3V8LA 3F0CA 1WZ2A 4XLHA 5FP9A 4OCTA 4B1LA 3O1RA 1H6XA 4M9XA 3O6BB 4NRMA 4AEJA 2MEV2 5F1RA 5DUKA 3GTMJ 1V0AA 2VNGA 4LBJA 1DU0A 2NNYA 3EXUA 1UW8A 3ZXJA 2FDIA 3FHQA 4MH0E 1IG7A 3SHFA 3HGYA 4NMIA 1ULYA 4BQ2A 3G2BA 5LRSA 3WT3A 4KBBA 4ZJZA 1OH3A 3JRDA 1FT9A 3FFZA 4AQSA 5APAA 1JYWA 1Y56A 3C18A 3ZYGA 3ZSEA 4I30A 1QNWA 4FFIA 5FYCA 4NWVA 3D0JA 2FU4A 1DYKA 4IRGA 2ORZA 4Y4YA 3OL3A 4NIDA 1A6IA 3VZJA 2FDJA 3BTJA 1EH8A 3QOEA 5J37A 1SLBA 1FXZA 4MHUA 4P96A 2ZFUA 4ESFA 1NCQC 3PDQA 3FISA 4AF9A 2KZGA 2D6OX 2F6CA 4EGYA 1JW6A 2HDCA 4JKKA 4Q27A 1VBD1 3KZIC 1VE0A 3KV4A 1PVC3 1W04A 2UWAA 3WTVC 3I2DA 3NNLA 4HLXA 3PNTA 3U10A 1S3JA 3N9NA 4GAZA 5FFXA 2ZACA 3VDDB 4Q2FA 2C9KA 5L3CA 2MSYA 4AIHA 4Y20B 1S29A 1EPZA 1LFUP 3WF1A 3THTA 4N4OB 2FSWA 1BOAA 4JBAA 1Z6TA 4CH7A 2BBAA 2WAEA 5C9AA 3ZR6A 3ASOH 5L9BA 2VVEA 5EFUA 4A3EJ 2JDPA 1KEXA 4CICA 2YBSA 3UETA 1HKSA 1N1TA 2QQMA 2O6GE 4HSLA 3RIRA 1QH7A 2NXNB 1WGPA 1YI2I 2J1TA 4OQ8A 1F43A 2Z42A 2O0OA 3IDEA 3H8OA 4ON0A 3AFHA 2V79A 4GJZA 4CEYB 4XKCA 3IL2A 1G3WA 5K9YA 4JQTA 1S7EA 3M3IA 1NY71 3AL0C 3NJVA 2RREA 1NZIA 5FYTA 1FZPB 3AZXA 4LTAA 2KJBA 1W6MB 2QQ8A 1ZZCA 2P7CB 2DTZA 4MNUA 1GDTA 3VHPA 1HV0A 2DFCA 2MPFA 1PIV1 3VKOA 3WF0A 1CAVB 3VEPA 3RKQA 3O8HA 4XJWA 2VUDA 1R5ID 1SANA 1WCQA 5EQUA 2VULA 1UG2A 1T8IA 5B1BH 3INAA 1L7QA 4QDQA 1D4M3 2FD5A 1YJ9I 2HWE2 3U1KA 3O1UA 4C91A 2XHKA 2IXCA 2WYFA 1W5CC 4Y17A 4E2QA 4AVCA 3OIOA 4D6SA 1XOYA 1F36A 1ETOA 1NE6A 3VKMA 1N47A 2DCTA 3A0NA 3F8BA 1HCRA 4MXVA 4DJAA 4EM0B 4MX3A 2KJCA 4QPQA 4CU8A 1ITYA 1FV2A 3LDBA 4EGZA 1LFBA 1HXDA 4I76A 3HGGA 4JOMA 2PBIA 5FXXA 5KWRA 1MZ6A 2QDRA 5IPAA 1A3KA 3FUOA 1DQ0A 1FMD2 4Q8KA 5LLQA 4LBKA 2EXJA 2VZQA 1PUFB 4IERA 5E79C 5LBCA 1SBDA 2ZSIB 1BK1A 5HPOA 2ZBKA 4I0AA 2D6LX 1JODA 5DUUA 2KDOA 1ZBA1 3SXYA 3HQRA 1HW2A 3BTCA 5EIYB 3F8MA 1LEAA 4Y26A 1UHWA 4HPKB 2WAOA 3A1YA 2L4AA 5AFEA 3OGVA 3VYSB 3EBRA 5D8LB 5IFPA 4BY7J 3WW3A 2VKHA 4OIPF 4HG2A 4QT6A 2W25A 5L3FA 2F5DA 1DZQA 1EH7A 2LMDA 3HOBA 4Q1PA 2DA5A 3BALA 3CCSI 4U0VA 1RUF2 1M4WA 5LA2A 2I2SA 5FPVA 2R7OA 5FP8A 4HN0A 2G7UA 3T2PA 5C5TA 2X1CA 3RZHA 3KZYA 3BIEA 4B44A 1AUYA 5LWBA 2YPJA 2LW8A 5JZGB 3T0AA 3QP6A 5JXGA 5EEAA 3ZOBA 4BM8A 4BCUA 1TME3 5IATA 2WZR3 1POQA 1F2NA 3WP4A 3HOTA 3ZMUA 4K21A 1RHI2 4RR3A 4S05A 2YU3A 1Y43B 5KCMA 5ACA3 1TLHB 3BPVA 1WH5A 5HLGA 1IGOA 1F1ZA 1LFPA 4BAYA 3JRHA 5A70A 1YIFA 2Y0OA 1RUH3 1WCMJ 1STZA 3B94A 3PIOF 1H89C 3KSCA 2JT1A 2CQNA 2VKDA 3TB0A 2AR6A 4MHRA 2WZPP 4FX0A 3GJBA 4CU9A 3F2ZA 2NZ9A 1E5SA 1WRJA 3RCOA 3S3OA 2RS12 4I0BA 3H0GJ 4GULA 2JDZA 4PJYA 4AK3A 5SV8A 5J4YA 4I98B 2JG8A 2XAUA 1GFF2 1WJEA 3J4UH 3THCA 1XNKA 3H42B 1Y9MA 2CFXA 2ZHKA 2XVLA 2CUZA 1C28A 1IN8A 1OQDA 4LLGF 2LBFB 3DCFA 5C8WA 2WLQA 4QQPA 2D3RA 2CSGA 4UW3A 2W92A 1GVJA 2QNKA 4DZPA 2WAFA 2UWMA 2BY1A 4HL0A 5J8FA 1WJBA 1X3ZB 4RL7A 1AYN2 2B63J 4LBMA 4QKDA 2OAZA 3PURA 2IXKA 5DDJ1 1BI3A 4CCEA 2WUHA 3OD0A 1RUG3 5D4SA 5T52A 5E1ZB 3F21A 1Z6RA 3OYJA 2VQUA 4NPLA 3DPRB 3HWJA 4QU1A 4IHSA 4XZUG 3SC7X 1XNDA 5I91A 3CEWA 1HF0A 2GN3A 3EUKL 5FXVA 4O6JA 3DV8A 1SFOJ 3C7HA 2JD4A 4OZOA 3ZR5A 1NE4A 1IOAA 1V6MA 5FYUA 3I4PA 2VIXA 1F5TA 2HWE1 4XFIA 1GLHA 3LZZA 1ZG3A 1IRGA 4HONA 4DOUA 3UKNA 2WRAA 2H94A 5FROA 2R5YA 2M8EA 2QQKA 2R3SA 1BW5A 1SLIA 2A6YA 2VB6A 4UXAA 1JN2P 4RR3C 1WMDA 4D7YA 2DK8A 2RNJA 4FPGA 3OYNA 5FYIA 3JU9A 1O59A 4DY3A 3HN1A 5IT3A 1VAMA 4AG4A 4Q5SF 4JHTA 4COVA 5CEHA 3MFCA 2JJ6A 4HETA 3ASNH 1VBB1 3ZQIA 4B8XA 2HWF2 2IGNA 4XIOA 3NKGA 2XXZA 1UXXX 2D98A 2A70A 1C5IA 5HV0A 2EA7A 1QVTA 3G73A 3B9IA 1YQ8A 2CDOA 4OULA 2STWA 5GTHC 5LGNA 4PQQA 4M0HA 3OR2C 5EEGA 4DBRA 2IVIB 1MMNA 2BFUL 2ESHA 3U2RA 2JG8C 2PHLA 2XRNA 2Z4FA 4PFOA 3OY8A 2HPIA 3G1LA 2P37A 3ZQLA 5T50A 4L0PA 5J7MA 4YWAA 4XIKA 4ZC3A 3A22A 4JDNA 1QJY1 4Y22B 2YPDA 1NA1B 3K2OA 4NQWA 1KYZA 2RV9A 1QJU2 5DAPA 2AQFA 3H8RA 4UYBA 1LEDA 2G4IA 4UW4A 4XYXA 1SD7A 1TNTA 1NK3P 1WUVA 2VAUA 4A7ZA 4GMP3 1MS1A 5J1YA 5FZ8A 1YW8A 3DL3A 4KWUA 3ZP5A 1D2QA 2KMUA 4JGZA 4IVNA 1AL0G 5C7GA 3Q8FA 3GCWA 2GLOA 3GTQJ 4C9YA 1UXZA 1JS9A 2OUMA 2IW5A 4LORA 4WK8F 1BL0A 4C1WA 1R1A2 2J42A 3LSGA 2IA1A 1S1AA 1AXKA 1O8PA 1IS5A 4UY8I 2W4SA 3BTLA 4KMQA 1PZ8A 5J1RA 1HW1A 5BNOA 5EZGA 2ZB9A 3TNQA 4DXTA 2WAQA 2ZEZA 1UPIA 4IE7A 2ZKZA 2E7WA 1XSDA 1UD1A 1LE8B 4FCYA 3T0BA 1LGCA 5CQEA 1LGNA 5KC5A 4R9CA 3S2HJ 3RZLA 3S7IA 3HXLA 1SHWB 1MS4A 4L9BA 4Z07A 3BIWE 4BK4A 3BR5A 5FAXA 4W97A 2YDEA 4CUGA 2DQLA 3TEZA 1PGW1 1ULEA 4RHV3 4XLFA 4EWAA 1B35A 2UY9A 1KD7A 3HPNA 2XPVA 4YNIA 3A4CA 2WNUB 1JUIA 4YW4A 1EV13 1OFSA 1D0YA 3RQIA 4LB5A 5A3NA 1BKZA 2JTVA 4ZDPA 1U9OA 3QODA 2AREA 2ETHA 5TGTA 2O5RA 3WF2A 3JBG3 1Z7LA 3LA3A 5F2SA 4A5NA 1BC7C 4KGGA 1N1SA 4S0HB 1I1GA 4PCRA 1A04A 3OGRA 2L0KA 2ZABA 2LS6A 1O4TA 5E89A 4DOZA 1MMSA 1BCXA 2VXDA 2ZMEA 1KFUL 3MI8A 2B9UA 1JXSA 4XAAA 4BMEA 3POYA 3J81K 3RNSA 4N53B 3I56I 1CVNA 3BUCA 4E7HA 4G94A 3JXSA 3K10A 2RM23 2ZEYA 5FLIA 1NG6A 2EXHA 4JGZC 2VZ3A 3KHCA 2ELHA 5GZFA 4A0YA 4JCKA 1YO5C 5JPMB 4AVAA 2Z3YA 5K7HA 1VALA 2FCTA 4OMZA 4E7ZA 5FLXZ 2CV6A 3K4ZA 4FOVA 1PVC1 2WT2A 3MLJA 3ZYIB 2WO3A 2YG0A 3GZUC 1UOFA 2R7VA 1WMEA 2KIMA 5A7WB 1AX0A 1VMJA 2K4JA 1JUSA 2LALA 3S32A 1BVVA 5BNOC 4RAGA 1ULCA 2HWF1 1OI6A 5F6KA 1FX5A 5FJ8J 1VRH3 1YLLA 3J8F3 2A3WA 5K0UA 2R1BA 3ONQA 1QU3A 1BMV1 2BHZA 5FLVA 2BW8A 5EYYA 4B7EA 2WY8Q 1GNYA 3J7ZI 3BG3A 3VZKA 4QXHA 3K46A 4UW6A 3GZEA 2CY6A 1WJ5A 3K3OA 3V42A 2J1AA 5DAVA 1K3IA 4W50A 1YJLA 2IPQX 2V4AA 1OUXA 2CWSA 5EJ1B 1B35C 4LOSA 4QB2A 4LB6B 2KT0A 2LF8A 2IA2A 1ZR2A 3JW4A 4QQOA 1LVKA 2PLV3 3V0AB 3BJ6A 1WVRA 2DXIA 3RPQA 4LG0B 2ECBA 1DP7P 3WODF 5FTTC 2QQWA 2VBBA 3KMHA 4E4ZA 5AC92 3OGGA 1OSGA 4YLZA 4OHWA 1BI2A 2WS93 3IIAA 3P5JA 1W36D 4D7TA 3WUCA 3HIFA 2OX0A 2WFF3 2WABA 3L9JT 3CUQB 1C1LA 4DS0A 4N43B 2BZDA 2VZ1A 1W8OA 1NK2P 2YUSA 2DT5A 2CQXA 2ZMEC 1MMAA 1RRJA 3C7GA 5CG9A 4NOTA 3HB9A 1ONAA 2EALA 2PA7A 2M3AA 1EY2A 3FLPA 3I64A 3GTKJ 3PVEA 4XDPA 2VKVA 4LLNA 3KVBA 1APLC 4Y1XA 3K4KA 1S0GA 2CTVA 2HEWF 3GTJJ 5JVGF 4JV4A 3IBMA 3VODA 1OISA 1POV0 4UV8A 4UWDA 1QGLA 2JXAA 2VXJA 4EVIA 2IWGB 2R7WA 1JTZX 2P5LC 3CL1A 2ZFWA 5JXIA 1YEWA 1GV5A 3AYEA 3RVHA 3ZYPA 3FHIB 4FPOB 5IY5H 2ZHMA 2DVBA 2GNBA 5I8YA 4Z6YA 3CMAI 2Q8DA 2A6XA 2DYSH 2Q0OA 1DUXC 1PGSA 4OQ9A 3I9V2 5CADA 3OYKA 1KJLA 4MGZE 5JMCA 2JA8J 1QZEA 1A35A 2N7GA 2WIIB 4FPJA 2XVCA 1COV2 4RB1A 1RC6A 4HSRA 3LSHA 4F3QA 4ZDOA 4TYSA 3WE3A 2HYGD 3V4GA 2LRDA 4A3MJ 1H6YA 5FZ0A 3HOUJ 3GHMA 4BIOA 1YJKA 3C7OA 1SLAA 3M3YJ 1BOBA 4MYEA 2E71A 1BEV2 3LAPA 2Q4SA 5F08A 3OGJA 3ALQA 1X3WB 1O57A 3RYKA 4Z2WA 3FL7A 1FNZA 2DPUA 1XB9A 4PDWA 1WW5A 3U07A 3MKYB 4XRFA 4J01A 1JOBA 2Y75A 2W1OA 4NROA 4W6YA 2CGNA 4UB8C 5FZBA 5KHKA 2QQLA 3WCRA 1JUMA 2R7ZJ 4PJLA 1NHAA 1SFYA 2DUQA 5GM0A 1WJAA 4BL0B 4DGWB 4ABZA 5IVEA 4EQQA 5L3EA 4U2AA 5IWFA 4MVTA 3U11A 2GU9A 1TME1 3HOYJ 2EIGA 1OYYA 2VOKA 1PYVA 1LESA 3KYCB 5FYZA 2AH2A 4OHVA 5ACA1 4COUA 4V19K 5L3GA 3WF3A 1LDKB 5LBEA 3TP0A 2ZXJA 3KYLA 4HOBA 2R042 4F55A 3OGSA 1RUH1 4FQZA 4XUNA 3F22A 1ZH5A 1W8FA 1G9CA 4CA0A 4ESBA 1MS9A 5IT9K 1DGWA 3SH4A 3LWFA 2QQUA 4NIAA 4L5EA 3NRUA 3MIGA 5IP9J 2VECA 2K27A 1Z9CA 2I5UA 3G6JB 3WDYA 4DIQA 3MIDA 2LLKA 2DA2A 2IUWA 2L7MP 3ZLIA 1POV3 2AUYA 1NZCA 2B9SA 4YELA 3W58A 1NCQB 4A3CJ 5CVRA 1WW4A 3DPUA 1HKQA 1QZYA 3FMSA 2GQQA 2VMFA 2NP0A 3KP2A 3VBFA 1SMVA 1CJPA 2KA3A 4V1PA 3UYJA 2AS5F 1WCDJ 5FMOL 2XAJA 1IJWC 1NQJA 3I3BA 4A45A 1MBKA 2VJ4A 4URAA 1W9YA 1H9TA 1KS5A 2TEPA 2XJVA 2RC4A 5E17F 1U6GA 5FK8A 1TC3C 2DTWA 5GPCA 4Z2AA 1W6PB 4KG8A 1AR92 1GV2A 4IHTA 2ZMNA 3G4SI 3LFMA 3AFGA 2HWVA 1YC61 1RUG1 2SBAA 3MZYA 3BB6A 3EMRA 5CB7A 2H27A 4ENKA 2VMCA 3S1RJ 4F92B 4NUBA 2KDZA 3NWSA 5J36A 2GDFA 4HFSA 1E0EA 4PDWC 5AONA 3AFKA 4XJUA 4LA3A 2ZNYA 3RMYA 3DBLB 1P4WA 1ZRRA 1WGXA 2BW3B 5FBZA 3BTXA 3DECA 2OZ6A 3LQCA 4XETA 3OYBA 2GMMA 4TLGA 5SV5A 1GT0C 3AL0B 3H5AA 2EIDA 1G3TA 3ERED 2UY8A 5C4WB 3EETA 3VBHA 3BPZA 1W2OA 4P55A 4EJOA 1YWKA 3O1OA 3GFJA 1PVXA 3VDBA 3WG7H 4FFGA 3PO3J 3TGNA 2Z5UA 3FKIJ 2EIJH 4UF0B 1PX3A 5FPAA 2VOPA 4UV9A 3VL8A 3D82A 4PQ9A 2NM1A 5FYMA 2JPBA 1RITA 1A8MA 1HV1A 5BPIA 1BJQA 3U14A 2NOGA 1FBSA 5IUQA 4IDZA 4PIYA 2FX0A 2E2JJ 4XFFA 4B4QA 3HEFA 1LAJA 2JE8A 4KIFA 1Q1VA 4B48A 4Q4X3 3MLLA 1XB4A 4PUSA 1Q56A 4FFFA 3O0XA 4QHZA 4NBQA 3PHMA 3H35A 4PGHA 1YRZA 5KXEA 1H30A 3IDCB 1ZAOA 2ACJA 4D69A 2PHDA 2UWCA 4HOOA 3DXUA 2D93A 2VW2A 4XFCA 4YARA 2ZX4A 3LB9A 4PDKA 5LA9A 5IVCA 1BJAA 4XE9A 3OYHA 4UBHA 2E31A 5CKMA 2VCMA 3K3NA 4XONA 1R5HA 4GO1A 4GMP1 3RQ4A 2DVFA 2E32A 3TYJA 5LRRA 4NDLA 3NJZA 4M6YA 5JR2A 4AYUA 2VMEA 1MSFC 4B29A 2Y31A 4N8MA 2FNAA 1ZBE2 1FPN2 3C3WA 2FCUA 2ZGUA 4C0HA 4BH9A 2VC0A 1KU3A 2AXTC 3AP5A 1QQIA 4YGBA 3ZKUA 4XIDA 5BMZA 2E51A 2LY9A 3BCBA 2MD0A 4CCOA 1DPUA 1NQDA 1WD3A 2K2SA 1V5EA 4QPWA 2M45A 1P4AA 3HPGA 3L2WA 4XN3A 2HWB2 2ZGOA 1JHHA 2VQAA 1W99A 1CAUA 1T0FA 3B02A 4CDQC 1MD0A 5FY4A 2F17A 4KFCA 4XMYA 1FYUA 1Q8SA 3JD73 3VBHC 4RM3A 1Q8OA 4DNCA 2YB7A 2ZMLA 4PGGA 5FLXK 1TL8A 4EZ4A 1X8EA 4COWA 3ZN1A 3BCWA 2MD5A 1RXFA 2ZGPA 3H50A 3PUHA 1RR8C 3D5RC 4XF0A 4IQJA 5BPXA 2WN2A 4SBVA 4IEQA 1L0OC 4B4RA 1FLIA 1D0HA 2I74A 3ZYRA 3KP5A 4RB2C 5M3FJ 3MF9A 3H5RA 5JAXA 2R7DA 2XPJA 5K1YA 1HDKA 4RHV1 1AR83 2PMUA 3BR3A 3KYDB 3CC2I 2CHHA 1T56A 5JHFA 2A6HF 4NC6A 2TDXA 3OYFA 2SLIA 2XAQA 4CUCA 4YFKF 1EV11 4G9SB 3ZXKA 1F8VA 2IFRA 5F1JA 3K1MA 1ULOA 3W3CA 2JDAA 4UUSA 2ZZJA 5BOXA 1W90A 1RESA 1BBT2 2VCBA 4A6OA 4LBQA 3JBG1 2YMZA 1RUD2 5E8GA 4LO4B 3FK7A 1AR91 4LK0F 3LD8A 3O14A 3CP2A 3HOWJ 2DA4A 4AI0A 2O8XA 4MSVA 3S3NA 1BIAA 5LBBA 3AJYA 3LDKA 2D6PA 3MVPA 4BE2A 2RS53 3LFUA 2PAKA 2C26A 4M3DA 2PLYA 4DUWA 1CAXA 3ZXFA 3CJTB 3P9IA 3GYHX 3ABLH 4QLCU 1YJNI 2A6ZA 3LDRA 1H9WA 2Y6JA 5FKCA 3FIWA 1W0NA 2V5DA 3L2HA 4LK7A 4QX8A 2CWMA 5M0TA 1BI0A 1LHWA 2W52A 2Y6HA 1QHHD 4CDXA 3F6VA 4UUTA 3SNMA 1VAVA 5J6XA 2YBPA 2WL1A 2C9AA 4XLNF 3PJQA 4PT6A 4RS5B 1JUPA 5D8AA 3OOXA 3KETA 2A6TA 5FLHA 1UZCA 1TTYA 1F31A 5FYVA 1T0FC 2FUG2 3ABUA 1NOVA 2RR13 2D3SA 3UK9A 1PJRA 4MO3M 4EJUA 1H88C 4CDWA 2FOWA 3MYXA 2NQYA 3LCPA 3LWCA 2J1VA 4B1MA 4L5JA 1K7AA 3IRQA 2AENA 3K4DA 3LQQA 4DO0A 1HDDC 3OD4A 1DQ2A 2A3XA 3RZGA 3DBRB 4J6GA 4N0BA 4ZTJA 1T98A 2W7NA 3QBQA 1MS8A 2IXSA 5I0UA 4BQQA 1W4MA 3N05A 4V2WA 3ACLA 4RR3B 1VPHA 5DD4A 1U0AA 1UU6A 3D3AA 4ISRA 1W2UA 2RDRA 4CZCA 1IGNA 4GWJA 2A5WA 3OJBA 2VI6A 3GX4X 3C8XA 3X2QH 4P9LA 1TT0A 3GLLA 4XICA 5DV5A 2Y48A 3E6BA 5D6EA 1O5LA 1MR5A 3H3LA 5EZHA 5A2QZ 2UYBA 3CLOA 4IEZA 4AI2A 1N1VA 2VBYA 4BB3A 4X8NA 5E16A 3UKTA 3OBAA 3MAJA 1JXNA 4L0YB 1FTZA 1IPJA 2X29A 5K7ZA 2Z79A 4B8EA 1RYYA 1FX7A 3B01A 2I45A 4MTEA 2WS91 5JIAA 2JG8B 5FPZA 2XPWA 5ILSA 4FO9A 4QX2A 1Z3XA 3LAJA 4BQ3A 4CUAA 4XW3A 4FP2A 2DT7B 4YYOA 1PNFA 2EFOA 4ETSA 2RNGA 1Z67A 3ZQHA 3L2VA 4IRHA 4NHMA 1EA3A 4DXZA 5DTDA 4AI9A 2IS6A 3DEWA 1Y39A 1HIXA 3NV4A 1HBXG 1NH3A 2HWB1 5F3EA 1IUFA 5JLXA 2L7FP 2FQ3A 2I07B 2PYTA 1GZ9A 4MLOA 3P9CA 4CDXC 4IEUA 4PJMA 1G8XA 3TDZC 3HQUA 4XBLA 2DBBA 3CO7C 1QPIA 1W5SA 2DA3A 3WR0A 1LUJB 3SKVA 3FMRA 1OLTA 3GM8A 4KA4A 5BXXA 1X2NA 1J59A 1F5JA 1PO13 1Z77A 3GBWA 1SD5A 4CDWC 3S5AA 3MIHA 5LY2A 4AW7A 4EN0A 2E5NA 1VBA2 4CP9A 3PJYA 3WTWC 2ZGQA 2QA4I 2E2HJ 4O61A 4HG6B 1OXCA 4KGQA 3ZDSA 1SDDB 2IXJA 4D6RA 3BZKA 2R5YB 1EH6A 1WCUA 4Y7NJ 4E7SA 1XTAA 3GFLA 1XGSA 2UYAA 4ASNA 1EJ9A 1U78A 1R093 2CRGA 3P3NA 3PFIA 1VR3A 5LZ6A 4AGRA 4GD4A 5IW0A 1SVOA 4YM3A 4MV2A 2W39A 4XUTA 2XWJB 4FPEA 4DBQA 4WM7A 2HOAA 2ZGSA 2KIFA 1O3QA 3B93A 3ZMOA 3G1OA 4AFBA 1SLCA 5FD6A 4QPOA 4ATFA 2XJSA 2VN2A 5FV3A 3PQJA 4PLOA 3GZ5A 3K4AA 5JSRA 3RQ0A 3AG4H 1OLME 3A0BC 4S2GA 3OF1A 1HQCA 1IRXA 1MSEC 1IF1A 1MBFA 3POBA 2VMDA 5JLWA 1ZX5A 1J1LA 4RS8A 5FZEA 1S5LC 2VZUA 3OY8B 5F0CA 1RUOA 1SC7A 5JOWA 1FP1D 3A21A 4XABA 1GQPA 3RKWA 4EM2A 5CFDA 5DM6F 4LQRA 2ZX2A 3POEA 4IEJA 2IVMA 1UMHA 3VHRA 2CV2A 1UY0A 4CPBA 3JTHA 1AL22 2BERA 1N25A 2Z9OA 3RYPA 5E8AA 1DPRA 3JUUA 2P3IA 2E53A 4BE0A 4FI9A 4WZFA 1KFXL 1R6RA 1A31A 4Y24A 4ZU4A 3ECQA 1UZVA 3REOA 1RUI3 3NWKA 3CCRI 2HYJA 4JGZB 2RAEA 5LD2C 4UVCA 5A1FA 1RC9A 1RUE3 3TEYA 1YYNA 2EICA 5FPLA 9ANTA 2XB6C 3MV01 2IS2A 4HYEA 4XEZA 4IJAA 3IAS2 2R5ZA 1REPC 4UXNA 3OBZA 1SAXA 4AGVA 4D7NA 4IEWA 3IAQA 2V09A 4OMDA 4DYQA 1YIJI 2P6SA 3KLOA 4BBRJ 5JHUA 4LHLA 2QLZA 4DYCA 5BNOB 5IK8A 5I0SA 4EJVA 1N3PA 2DWRA 3ISPA 5BNPC 2GMEA 3K77A 2DMPA 5EYXA 1XS9A 4RYDA 1S8NA 3PSFA 1P92A 2OZJA 2Q8OA 2ZXHA 5FZOA 4C2TA 5J1XA 1U2WA 4LMYA 3LA7A 3SZGA 3WG4A 1IN6A 2AO9A 2FF4A 5GZGA 4MFDA 3OYCA 1ODDA 2O61A 1AX1A 1LNWA 2EV5A 5C5UA 4WM7C 2D5VA 1KQ8A 1B35B 2XUBA 4YPJA 1ZA7A 3BKZA 5E3LA 2DFFA 4D8MA 4RMNA 3MICA 2HXOA 1QXJA 3VDCA 1RINA 5F5CA 5JI6A 4NAMA 4WXCA 3Q9OA 3RSNA 1BLZA 4BMBA 4HA8A 2QZ3A 4CYCA 1EUTA 2ZX1A 3SITA 3H1CA 4DPNA 2QBXA 2ZPXA 1DP3A 1B9MA 1FOWA 5KAFC 3IRRA 3DPLC 5CFDC 2OW4A 5FYSA 2ETEA 1ZTRA 5KHIA 1AWCA 4HX4A 4JDMA 3ZXLA 5D5VB 3WTUC 2FRHA 1RMU2 1Q8QA 3ZFFA 1T6BX 2BOLA 4JQFA 3OSFA 2Q30A 2ZMEB 2WADA 4ORFA 2QCOA 1QF3A 3JTGA 1DQ4A 1ZYBA 1R23A 4K7JA 4G7OF 2E5ZA 1TNRA 2CL2A 5M5WJ 3WNNA 3JQWA 3MEPA 3CCYA 2I8DA 1LOFA 1W8NA 4ZZDA 2PHUA 3GW2A 1APNA 4BQNA 2RS31 3RZKA 1GZTA 5HNHA 1J3QA 3FE5A 4HF2A 4W65A 1UO9A 2JDNA 3FHZA 1W8WA 3HSEA 2X4HA 2X5IC 3UL2A 2IGKA 4TN7A 3IKWA 4AEMA 1LHUA 2XB5A 3QP5A 5DM7F 1Q3EA 4YM2A 4KYWA 3VZMA 2MLKA 1WH7A 2IVJA 2JENA 2LSOA 2ZKLA 3UT0A 2TUNA 2KKOA 4MGIE 3PMEA 2R7EB 2MA3A 4Y5Z0 1S0CA 4CCMA 1UU5A 4BJ0A 4I2OA 3T2QA 2BOIA 2VW1A 4AI1A 1VRBA 2YGMA 4CXYA 1S72I 5FOJB 1ZREA 1UKGA 1UIJA 2DA1A 2FDFA 3W9AA 2P3YA 2KRFA 1VJ2A 4P14A 4TZDA 1L3JA 3QPSA 3G1MA 2OBPA 4URTA 1GHCA 3GTGJ 2H0VA 4P9IA 3ZXDA 1WKYA 1RETA 1WJFA 1PO23 4AI8A 4AWXB 2VZTA 4LO8A 4Y3OA 4IQ4A 5GLWA 1N78A 4Q4W2 2EA2A 2V1DA 1US2A 1CIWA 1D0GA 4F83A 1DLCA 4OHZA 4HNVA 4KI5M 1AU7A 1ZKGA 1XDUA 3RGBA 1BBYA 2O03A 2PELA 3FXMA 2BGOA 3ECHA 3HKZA 3TMOA 3I3DA 3JD71 4LOTA 1DDLA 2M2EA 4YIFA 3VN4A 4AHYA 4G3YC 5L19A 3NAPA 2EF6A 3ILNA 3KD4A 2EK5A 5L3BA 3TN92 2XUMA 4YRVA 1J9IA 4M3GA 5C71A 1PGL2 2OV7A 4FOYA 3AYDA 2FMLA 1V54H 1XDSA 2L7ZA 2ZS6B 2OYZA 3WW2A 4AVVA 2G19A 2ZHLA 2QKLB 2HH9A 3F8FA 5E20A 2EBIA 4S2FA 4I02A 1O91A 3FXOA 5T54A 5CISA 2E2IJ 3G7DA 5FK7A 1AR81 1UOGA 4LULA 3AYCA 4OVEA 3CCMI 4XORA 4EQVA 5H9QA 5FR3A 1OA4A 3WHBA 2XJPA 1HKDA 2JDUA 2KZVA 1YG2A 2W82A 4PIXA 1CQ9A 4HDVA 4IL7A 1YS7A 1LHVA 2GXGA 4QAWA 1U5XA 5HLHA 3I2JA 2XRLA 2AEZA 3TP3A 2BFUS 3DBHB 1FSHA 5FYYA 2ILMA 4B4CA 2D1VA 1CX4A 5A2QK 3NAUA 1HRI3 1R1ZA 1GR3A 3SDGA 3OYMA 4GWIA 4KWJA 2D5HA 1DDNA 1I5PA 1JYNA 2M4GA 2RS51 3BPXA 3KEOA 4YEJA 2D44A 4XXAA 4MEXF 4FHTA 1ENQA 4XJ9A 4M0NA 2HOEA 1ETKA 1U5TC 2LREA 3CZJA 2XQRA 4HEA2 4I6ZA 1OLMA 5E18F 3KHBA 3QQAA 4YW1A 3K4JA 3K4CA 4BDYA 5CAZA 5D1IA 4K8FA 3ZQQA 3JRGA 4CP1A 1UB9A 1IXSB 1HSJA 2QGUA 4PDWB 4FASD 4MGQA 2XDVA 2RR11 2B8MA 4ENJA 4CVUA 3ORJA 1ZK8A 4UVAA 3W2VA 5B4NA 5BNQA 4QX5A 4F93B 3W5NA 2E7XA 3NAPC 5JFRA 2ES3A 4Q8LA 3CNAA 3ZXGA 4LE3A 1FPQA 4U36A 2VUAA 4AFMA 2DAOA 2XKOA 3V8KA 3AMPA 1OKRA 1BM9A 3FLRA 4AHZA 4FTEA 5DUVA 3CJQB 5AIQA 3KCXA 4WVMA 3I8TA 3LOBA 1Y4WA 1WCSA 1ZG1A 3SH5A 2Y0SN 2VBDA 3HOSA 3FXRA 3TOJA 1VBE2 5LW9A 2H8RA 2CS3A 2FBEA 3ERMA 4I0WB 2ECCA 4IQPA 4QWQA 2QM3A 5ANQA 4X6AJ 1LU1A 4M3CF 2D3PA 1XCVA 3FXQA 1R64A 2Q8CA 1MZBA 2ZJCA 3RPUD 2CFOA 2LTNA 1YFUA 3O1VA 1SBFA 4BQ5A 2LG4A 2OUJA 2D40A 1B8IA 3CC7I 2B9VA 2PTMA 2VBXA 1TMF3 5CYVA 4H55A 4B3NA 2GALA 2C24A 1LGBA 4I09A 4F91B 2BVVA 2ZKNA 1ND2A 1S0JA 2AC1A 5HV4A 2X6YA 1YX3A 5DCMB 3KQRA 3NWTA 5ICEA 4C90A 1KZHA 2COMA 2DTYA 2KRCA 3ACHA 2JX9A 1OF3A 4NB5A 4M3CE 3K1PA 4J19A 5B2GB 3HL2A 4Q4W1 4X8PA 3HOVJ 2IS1A 3HJEA 2K7LA 1TNSA 3AKSA 3I54A 2GP5A 2VY0A 3GXOA 4GXOA 4AE2A 4ITCA 3BG6A 3M3EA 1H2LA 2ERFA 4G7HF 1UF2C 1A8DA 1ASJ1 3ABMH 1QQP3 2QENA 1UY3A 4U0WA 2DBNA 1B09A 2ZEXA 3R61A 1UZZA 5B1AH 3TN91 1AYM2 3LPGA 3RTRA 1OVSA 4MIMA 1W9FA 1MBEA 2MH2A 2X6OA 1MBHA 2PAMA 4A3XA 3BR6A 3KCYA 5F0FA 4Y4RA 3CC4I 4CDQB 3QLQA 4RA0A 4YW6A 3RI4A 1OF4A 1UAAA 2F48A 3VBHB 1OURA 2X48A 4NHLA 3AVRA 2UXNA 1IN5A 4Y5TA 5IYYA 5HCBA 3RI9A 1PP7U 3ILFA 3AMNA 1X9TA 4A3LJ 2GNMA 1R091 2H6CA 5IYCJ 4ZY9A 5DAXA 3IIIA 3AYAA 4BQ4A 4LLFA 3CJNA 1R082 3NQHA 4XRSA 1A6CA 1DU6A 4CYDA 5FOBB 1WKMA 3AJZA 2OS2A 1SPPA 3CTAA 4DZGA 3MGUA 3B6CA 1ZRIA 3AL6A 5A6ZA 2P6CA 4OIQF 2CV1A 1XJAA 1U8RA 3MEXA 4AM3A 1T6SA 3R6SA 1MEC2 4IEPA 2CYFA 4EJWA 5M5YJ 3NKTA 1UZ0A 2JDHA 4M01A 1LVAA 4FTBA 2RMU3 2QKMB 4Q47A 4C3JJ 4X1EA 4M6VA 4P08A 3PIJA 5IK5A 3J7NA 2R4GA 1ND2C 5CU1A 4CA9A 1RUC2 2Y26A 4ATEA 3DKYA 1YUDA 1JOJA 4U7BA 3NARA 5DD8A 1STMA 2O8QA 5FQ0A 5CPRB 3WU1B 4YW3A 3D1NI 5EWSA 2WY7Q 5ICCA 2KISA 3N9MA 5BS6A 5KBFA 1Z0XA 4AL9A 1LOBA 1ZLKA 1TEIA 1ODMA 3QU3A 1HQLA 4LD5A 1VQ9I 1QH6A 2W68A 5EHDA 3C2UA 5IVFA 1G9DA 4XCAA 1RUE1 2W1WA 2R30A 2RE9A 2XBO3 5IYBJ 4RSUA 1FBQA 4NHJA 2R7FA 1CZSA 5C4XJ 1SVMA 3NV1A 3WCSA 5ABJC 1YI9A 4FE7A 2DMTA 4PJNA 1H1AA 4U7DA 2HWD3 4OHYA 4CEWA 4QTRA 4P1WA 1OD3A 5HDGA 5FIXA 5IOYA 1AR62 1CAUB 1TG7A 1Z7S3 1DYPA 3OWTA 2VOOA 3CZUA 2JB4A 4KICA 4Z82A 2UZKA 1VBE1 3USSA 4QXKA 2X09A 3WSOA 2TNFA 2WBMA 1I3HA 4IZZA 1BQPA 3WG2A 5BNNA 1W9TA 3AK0A 4ASKA 2HQ5A 2W00A 4N90A 3I3LA 5IAVA 2ZNZA 3BR1A 3RG0A 1SVLA 3ETPA 4IV1A 3HOZJ 3L2UA 4GRIA 2DJNA 2PMZA 1W7PA 2FHRA 1XCBA 2R062 2YY1A 4P9GA 3B00A 1CPNA 1HRV3 3M9AA 4FT8A 1HX6A 2BQPA 3U4XA 3ESWB 3NNGA 2LVSA 3N7KA 2VL4A 2HJIA 2JDYA 5D6FA 3ZX7A 3FLTA 1I50J 5G05L 4OI0A 4AVZA 2JRTA 1C8M3 1PHMA 4Q4Y3 4AVSA 4NR1A 2W24A 2W1UA 3MV11 4LO7A 2E60A 4IEOA 1DCSA 1LULA 3OUIA 2DF7A 1GMMA 5F5IA 3I58A 3G71I 4CCKA 1G2HA 4KDPA 3I53A 3L2RA 1OOPA 3SFIA 1MW7A 1PDNC 2Z5WA 4D9JA 2OD5A 3ZMZA 1AYM1 4AQ6A 1QGPA 5L9VA 1FOD3 2H8WA 2L5QA 1HXS3 1RUJ2 3ASIA 1J83A 1LRHA 3JQXA 2XLFA 2Y69H 4FAGA 1C3HA 1H1MA 4QM9A 4F52A 3K51A 2G7HA 3F95A 1RKWA 4DYRA 3SEEA 4E7IA 1VB4A 1VBD2 2QSHX 2KFDA 1UJ8A 1QJX3 4CDXB 3QOPA 5A1AA 1QJZA 4RAFA 1V6JA 1BVP1 2VOTA 3T8RA 3SXWA 1VBC3 4CEWC 4XLPF 3CCLI 1V00A 2BV6A 5FZFA 1KRIA 1I39A 1ZARA 1IQDC 1G9AA 5FUIA 2A61A 4CDWB 5DDGA 5FMOS 1F9KA 4Q4V1 1POGA 3X29B 1JBCA 4HBNA 3JSOA 5BNNC 4Y33A 3SQOA 2FDHA 1X1DA 1DQ1A 2DYCA 3TEXA 4QHBA 1RNLA 4P02B 4IV1C 3HSRA 1Q43A 4HQEA 5JVVA 3HT1A 4KWLA 4HKWA 1PO21 4M74A 3VBOA 1NY72 1TE1B 4K9SA 2OU2A 1DF0A 4FPKA 1EUUA 3LFKA 2R49A 2EVXA 5CVVA 3OOUA 2JIGA 2O9LA 2YYOA 2GBYA 3HUGA 2WA3A 4QPGA 4LKDA 2K9QA 2P8TA 4FETA 2YU1A 3RZJA 1PIV2 4K20A 4AFDA 1BK0A 3AKTA 4M3CA 5EYRA 4DEQA 1V6KA 2VUMJ 1N3OA 3MIBA 1OCOH 4A44A 4U88A 4QDRA 1LKXA 4Y15A 2L9LA 4RM2A 3QD6A 2JSCA 3P3PA 1I1EA 1OOPC 1R7JA 2DMUA 2PJRA 1VZ0A 3L09A 1XU2A 1W0UA 3N9OA 1ETYA 2K9NA 2WNOA 2F4LA 3QYFA 3ZMDA 1YI7A 4XKBA 3KEYA 3VFZA 1LOEA 4XL9A 4J25A 2X8KA 3OBRA 3H3ZA 3QWLA 2DMNA 3J80K 4M73A 5F5AA 1Y1VJ 1I9RA 3UNPA 3OL4A 1MGTA 2GH8A 2LK2A 3E6MA 2BV4A 5F6FA 3K2ZA 5GKAC 4A12A 4XDQA 4LXLA 3P6BA 1G8WA 4AQ2A 3GF6A 1NUKA 2ATFA 4E2GA 2LFBA 5DN2A 1D4VB 4YRDA 3RZOJ 3I2GA 2VQCA 1HRI1 2LROA 2COBA 1ZBA2 2QBYA 2WWYA 2P3KA 4A93J 5DCFA 1V4RA 1P6RA 2VU9A 4CP9B 4YGDA 1JI6A 1ZRDA 4L2NA 1E57A 1LEMA 4YG0A 1SCSA 4HBLA 4YVSC 3JAMZ 4P9YA 1UHSA 4N9IA 3RMXA 4B47A 2J22A 3H7JA 2QSGX 1DYOA 1QY4A 3FMQA 5BNPB 4RGAA 5FYHA 4PIZA 2QQVA 5GAEJ 1EP0A 3MMYB 2VMIA 1IXRC 5KNLA 3LGRA 3VBOC 1JKRC 3NL1A 2W1QA 1ERDA 5E1RA 4FPCA 3JRBA 4ZKTB 1HJFA 5FDBA 2QDNA 1RZ4A 5JIUA 2DA6A 4QPGC 4WM7B 1YQ6A 1Q5OA 2DU9A 5FJKA 2UV1A 1T39A 1R71A 2B5HA 4AFCA 3MW3A 3A03A 4AEDC 3SFZA 5FCCA 3OYIA 1WJDA 1YXWA 4OINF 1B6AA 3IC7A 3LSMA 2ID6A 5FMDA 4IL6C 1X33A 1P7JA 1RUJ1 4XBFA 4AVPA 3FX3A 3MO4A 5GPAA 1MS0A 4QDSA 5EXOA 2JPCA 1V9U3 3DGTA 3WTTC 3LSDA 4QX1A 4D6QA 2NAZA 2EZLA 4GALA 1X1AA 3P7NA 1Z91A 2JVGA 3ELKA 5CFDB 2KIQA 1CF7A 2MNGA 1IXCA 2X1DA 2D43A 2X9DA 2HDWA 4IKFA 4PBPA 1PX4A 5C3QA 1CESA 2CW7A 2J1EA 3LOCA 3I55I 5FY5A 5IJRA 4D7SA 4XQ4A 4CCCA 3RKYA 2LH9A 2EFQA 5FMCA 1CZVA 2WAQN 1XGMA 4CP0A 2AHQA 5LFAA 1NLQA 2WDBA 5F2WA 2UWBA 3KV9A 1TMF1 3WDUA 1OT5A 4INDA 3SEQA 2X5IB 4JRLA 4YM0A 1ZQ3P 4M9SA 3MKWB 2WBKA 5F0HA 3C7FA 3BG9A 1MJAA 2PMHA 3BJAA 3AG2H 3I0TA 1GSLA 4P9XA 2JWPA 2O7OA 1AVBA 4II2A 5T3NA 2FZ2A 4XKWA 3CO2A 3DUIA 4MQVA 3H3UA 2WQ4A 4Q0SA 5DDJ2 2LY2A 3P9KA 2ID3A 4WX9A 4R52A 4CXWA 5LA0A 5LY1A 3B6AA 3PUFA 4OOIA 3J81Z 5FLJA 5KXBA 2DO7A 2HQNA 1K5MA 2CNAA 1DGRM 5FZOB 5E3MA 3BYWA 4LK1F 4BY1J 2LM3A 4XURA 3HC7A 5A3MA 2GZWA 3MPBA 1QQP1 2MHFA 2VOWA 1W39A 4QB6A 4FSJA 1EF4A 5E1XA 2VGDA 5FRNA 1PUFA 2IXHA 3R0RA 3W2AA 5DEQA 1LHNA 1KDMA 3QYEA 2W5FA 4UFMA 2WNVA 3VKFC 2TBVA 1NLRA 3DN7A 5J09A 3ACGA 5FBJA 5K5RA 4QM8A 1X50A 3ZSKA 1VQMI 4YFWA 2FDGA 4CYCB 1RTVA 4NNJA 1LJ9A 4EE2A 4IUGA 2JEMA 3SQNA 1VNDA 3WP5A 2DLLA 4CCNA 2W85A 4QPIA 4BACA 4BHBA 2D5FA 3ES1A 2DVAA 5GAGJ 1VBB2 3TWIA 3PUAA 4NAOA 1MNMC 1IV6A 3LEMA 3OYDA 2VKEA 1VIWB 1TWGJ 1XX5A 3OB8A 5JCTA 3EYPA 4LKSA 1MKMA 2JD9A 3B9CA 4HV5A 4GFBA 1A78A 4ZDLA 1IRZA 2KXLA 3M8FA 2R073 4B43A 4E70A 5A3PA 4FISA 3MWMA 1MVEA 2D6MA 4GJYA 5HODA 1FNNA 1QIQA 1H9GA 4OIOF 4BLIA 5C9AC 2PXJA 4YZ5A 1HB1A 4KMFA 4R4XA 1LOAA 2CO5A 4C3HJ 5FRAA 1FYKA 2W91A 5HDNA 2Y6KA 4JHZA 1QJY2 1HKTA 3KLNA 2ZGMA 5FXWA 5L73A 2GNTA 5CBLA 4M3EA 3OIQA 1DGWX 4HF0A 2GM4A 4NN0A 2V9VA 5JR3A 2HQRA 3IAM2 4OMCA 1JZ8A 4WV8A 1RUC3 5IK4A 1SCRA 4O9GA 2RGVA 2FBHA 5D5UB 5DYMA 2BNNA 1Y0NA 3HAGA 1PMIA 5GLTA 1RVF3 2ZGLA 4G6DA 4XHXA 2GXAA 4QIWN 2ISYA 2D6KA 5LGUA 3WNOA 2DV9A 4ESJA 3HSFA 1HJGA 2VPRA 2B46X 1R9TJ 1K5MC 2WJSA 3NW4A 3RI8A 1U5TB 4HANA 2WZEA 4Y52J 1BW6A 2DFBA 2XBO1 2Q1FA 5FZDA 1R36A 5A3OA 2IJLA 4DW6A 5J8CA 2X10A 4UVBA 3KGZA 4FBFA 1V5FA 2HWD1 4PBOA 4QB1A 1IS6A 4XLAA 2V1NA 4DINB 1HN1A 3GCMA 2WNVC 1RIRA 3LA2A 2AZ5A 4MGKE 3IWFA 3N97A 1W9WA 1ZVFA 5HDKA 2AYHA 1JHFA 5F3CA 1EAH2 1RJ7A 3VYUB 2QQIA 3MIFA 3FWEA 1T33A 3H9GA 1R4MB 3DTIA 2DDBA 2HWC3 3AKPA 3NAPB 3Q9VA 1E3HA 3PO2J 1O8SA 4QPIC 2KIUA 4AFAA 1FOKA 4BWOA 3BQZA 3TQNA 1PGW2 2WAAA 2RQPA 2QQ9A 1UOBA 3GEZA 1ON2A 2XL9A 2XJQA 1PK6A 4LBLA 3ZOIA 5FWJA 1YW7A 4KIGA 1VQ5I 4R9BA 3GBFA 1TQIA 3KE2A 5AVPA 1UMZA 1I3QJ 2P6HA 5AIPA 5A3LA 3EJKA 1U12A 1LCLA 4P00B 5IVVA 1GNZA 5H9SA 4LKFA 2EH3A 3TDUC 2PHRA 4KQ7A 1WLCA 1XMAA 4MGSA 2ZTNA 5A33B 3TEWA 5EJCA 4SLIA 5K4LA 2D97A 2RDPA 3Q8CA 3S0MA 3T5XA 5A32A 3VKLA 1XPXA 2BEOA 1ZHFA 1OHFA 3VD3A 4UFLA 5DMYA 3Q5FA 2ZAAA 4META 1J2XA 4XLEA 1W6NA 1U9NA 4X6QB 3V7CA 4HT1T 1D2SA 4DMIA 1AR73 1FOD1 4OIRF 1CX1A 1ST8A 4FP3A 3H3VK 1LB2A 4UOJA 2PX9A 4A69C 1TQMA 2YPRA 4XAEA 2JN6A 4BJTA 3ZYJB 2IP2A 2W1SA 4N7IA 3ABZA 1XNTA 4GXLA 2K5CA 1JZ6A 3A2KA 2MH9A 5IT9Z 3BT9A 3BP8A 1PVC2 2BWAA 2ARCA 1ZZ7A 5FZ7A 3T09A