2OZ6A

Crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
201
Chain Sequence
MKLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLNSGDFFGELGLFEQERSAWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Virulence Factor Regulator
publication title Crystal Structure of the Pseudomonas aeruginosa Virulence Factor Regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 65
structure length 201
sequence length 206
ec nomenclature
pdb deposition date 2007-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2oz6A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oz6A01
3WU0A 1V4RA 1G3TA 2K86A 3OGJA 1ZG3A 2KIUA 1YFXA 4O5VA 2FBKA 2VBWA 5CU1A 3KP4A 4JV4A 1ZRRA 1Q43A 5ILSA 2EK5A 4U0WA 4OMZA 3TO7A 1H0MA 5DUIA 5CVRA 1UCXA 2D40A 3DP7A 1S7OA 3IKVA 4UUVA 5EZWA 4WVZA 2DQLA 3E5XA 2FU4A 2FOKA 1HKSA 2L01A 3ZN1A 3C1DA 2LKPA 3HSFA 1ODDA 3LWFA 3WW2A 2IXLA 2LSOA 1G4DA 3WE2A 3ERED 1UB9A 3U11A 1X82A 2DPDA 3WW3A 4MGKE 1ONVA 5H20A 4HF0A 4Q29A 4KDPA 1W5TA 1JHFA 3GYDA 3MDPA 1ULYA 3V8KA 2QBYA 1V70A 1SD5A 3J80K 2V6CA 4EROA 4MTEA 5FLJA 2GXBA 3LAGA 4KMUX 4XFAA 5L3CA 1QO0D 3MZYA 5AIPA 1Y9QA 4XBFA 3I0TA 1MJAA 4G7OF 2ESHA 3W6JB 4HDVA 1T2KA 1I27A 4LFUA 4IJAA 1OD5A 1T0FA 2Q4SA 3OV8A 4QLCU 2F5FA 2BNOA 5FQ0A 2UWMA 4D7TA 2P7CB 5E16A 3G3ZA 1OYYA 3SQNA 1XSVA 3K1MA 1CAUA 4U0YA 2O0YA 1S29A 3SZPA 4PGHA 3TOBA 4LB6B 4ESFA 1QWRA 3KEQA 3UKNA 2MLKA 3TDUC 1J3QA 3KP7A 3ZP5A 2OBPA 2QLZA 4CHUA 3U2RA 4Q0PA 4I2OA 3HTUA 2OAZA 4HMZA 4LTAA 2H6BA 1S3JA 1SD4A 1FX7A 4ON0A 3R61A 4JTNA 2FEZA 1J9IA 5HLGA 2ZMEA 2HYFA 2O1QA 2HQRA 4AVCA 2DPUA 5K5QA 4BXUA 3SHRA 3ZMZA 1TW2A 4IEXA 2QNKA 5I8YA 5JFRA 1D5VA 1OI6A 5IT9Z 1K7AA 1WLTA 2VONA 4M72A 5FDBA 2M1BA 1CF7B 4G94A 2P5KA 2PBIA 4LGWA 1ZAOA 4MTDA 4L9JA 1E17A 2OZ6A 4FHTA 4I02A 2RGVA 3LA7A 2VOOA 2FNAA 4IHSA 1B9MA 1MJBA 2L02A 5FCCA 2QDRA 2VECA 3GFJA 2OA4A 5DCMA 4OU0A 4WXHA 4P9UA 2PQ8A 3RZZA 2LF7A 1O5UA 1I6XA 1AWCA 4RGXA 2GC0A 3C3WA 3MQ0A 4Q47A 1QZZA 1BC8C 3F3XA 1ZH5A 4PIXA 1R1TA 2GH2A 2OQGA 4MHGA 3ULQB 5FFZA 5BOXA 5FLXK 4M9XA 2HR3A 3EO6A 3SCGA 1NZCA 1FY7A 1RC6A 2Q8KA 2NNNA 2CAUA 4M9SA 3HHGA 4UV9A 3E97A 3I54A 2OPKA 4YNIA 2ZCWA 1F9NA 4UVAA 2PAMA 3CTAA 4A6DA 2D45A 2ETHA 3WTZA 2MH2A 1BI2A 5I8TA 1FZPB 1I1GA 2GU9A 5FFXA 1HKQA 2WV0A 2DQRA 4LK0F 4R1HA 4WX9A 3CLPA 5J48A 3VFZA 2O03A 1RUOA 4G7HF 3HRTA 1XRUA 1MJ9A 1DP7P 2UXXA 1X7NA 2KRFA 5AONA 4IEPA 4GYGA 5FPXA 3RJPA 3T1BA 3GZ5A 1HW2A 2DBBA 3N4MA 1F4KA 5AVPA 2ZO4A 5CYVA 3U1DA 3KP2A 3F6OA 2O3FA 2HEOA 2H09A 5BXXA 3TO9A 4YFNF 5D4SA 1IF1A 2P6SA 4MX3A 2AXLA 1ZX5A 1J1LA 1YHFA 2A68F 2P6TA 3RYKA 2GZWA 2MD5A 1VTNC 4RD7A 4M6YA 2YX7A 4KICA 3HSEA 3HUGA 1GXQA 3EBRA 3FHIB 3FF5A 3ROUA 2M8EA 5F1RA 1CGPA 1R23A 2D2WA 2MNGA 3QU3A 4Z82A 3QOPA 1ON1A 4UNOA 3D0JA 2H0VA 1R1UA 4FAGA 1U2WA 3VB2A 4EM1A 1Z7UA 4ZYGA 3KETA 3EQLF 1UW8A 5T3NA 2ET1A 5D5UB 4CGZA 4EJUA 1NE6A 2RN7A 4KIBA 3IL2A 4YFKF 4OOIA 3V4GA 2PMUA 3H92A 5LBQA 4EWAA 2PYTA 1ZLJA 4IRHA 1XGOA 5TRDA 3EYYA 4OIPF 2QQAA 2MPFA 3L09A 3FM3A 4MNUA 1R36A 4AIHA 4AVPA 4JK1X 4KIFA 2RNJA 3NQOA 4QM9A 1PP8F 1YUDA 3DXJF 1P6RA 4KWLA 3KGZA 2EFQA 1YFYA 4I09A 5I0SA 4IEQA 5L3BA 3WODF 2XLAA 2PMHA 2FBIA 3GWZA 1JE8A 2EV0A 2M87A 2IA2A 4AQ6A 3BJAA 5CVIA 1UIJA 4OIRF 1ZREA 4FBFA 5FO5A 2RQPA 3FXQA 1XSXA 4XFIA 1XDUA 3BCWA 1IRFA 4WXDA 1S8NA 3V7RA 6PAXA 1O4TA 1QZYA 3U0ZA 2MA3A 2V1DA 3CLOA 1Q1HA 2HJIA 1ZRCA 1E2XA 3M7GA 5BQTA 4UBGA 3CO7C 1OYIA 3RPUA 5I0TA 1Q3EA 3R4KA 1Z6RA 1FBUA 3F8NA 2E7WA 2ETEA 3LA2A 1LKNA 2X4HA 2XV4S 4ZU4A 3GF2A 3HRUA 3F21A 4BNCA 2HOEA 1UIKA 5DYMA 2EA2A 5D5WB 2EWNA 5H6RA 4RGRA 2Q1ZB 2XAFA 1IXCA 1USTA 4BHBA 1TW3A 2EB7A 3OF1A 4E2QA 2FE3A 2BBYA 3DEUA 3EDPA 1BIAA 3P9CA 1Z05A 5ICGA 5DCFA 4IRIA 2MLGA 4HQMA 4GYIA 1SFNA 3I59B 1XE7A 4I98B 2PQQA 4QGMA 4ENMA 1A04A 3ELKA 2L4MA 4MGRA 1J5YA 1KU3A 1ZLKA 1MGTA 4GCVA 4JVAA 4L5JA 4LEJA 3TDZC 4LK1F 2B0LA 4MGYE 2DO7A 1FSHA 4A5NA 1U3EM 1SMTA 1S6LA 3HHHA 1CAXB 1T38A 4K2EA 4IETA 3EHKA 2K02A 2KJCA 5LHGA 4IEVA 1WI9A 4OIOF 5J3UA 4HX8A 4WBBA 3VOEA 4UXAA 3L9FA 3PQKA 1F5TA 4NHJA 1ZARA 2FNPA 1JUHA 4PDKA 4MQ9F 2W85A 4CZZA 2DAOA 3OOPA 4G8XA 3S2WA 3C18A 3D82A 4A6EA 3UKVA 1HXDA 3WE3A 1BIBA 3LOIA 1H9TA 4ENNA 2PHLA 3MPBA 2PI0A 3RI4A 4AD9A 5C8WA 3T8RA 3SFZA 2P4WA 1IXSB 3G7DA 3CUQC 3ETQA 1ON2A 3ZN0A 3AAFA 1VR3A 2IXCA 1U5TB 1B9NA 2GA2A 3GFMA 3ZQ7A 3NJZA 3CEWA 2E9QA 2G7HA 2BV6A 1ZN2A 3SHFA 4LJZF 3LSTA 5J8FA 4QGNA 1WSUA 3IHUA 3K2ZA 4J1XA 3L7WA 4O3MA 2UZKA 4XF0A 1LDDA 3J81K 3TOAA 2VOPA 2O6GE 3KZYA 4EGZA 1IN4A 2YU3A 3RKXA 1K78B 2YX4A 2HZTA 4AWXB 1QBJA 4ZH4F 3HT1A 4LULA 4I01A 4QX5A 4HZFA 4XF4A 3REOA 1TTYA 2EFPA 1HBXG 3OD0A 3JZVA 3EJKA 4X6QB 1IAWA 4NVPA 1RI7A 3BU7A 1ZZ9A 2TDXA 1O3TA 2PJPA 2K7LA 2WWYA 4L9NA 1O3QA 3WTVC 4OMYA 3KLOA 1U78A 4KL1A 1BI1A 3ECOA 3IRQA 1RNLA 4HBNA 4P9GA 5J8CA 5CVUA 4LG0A 1USSA 4UBHA 2F5DA 3OCPA 1YO5C 1FYLA 1YS7A 2K27A 2VC1A 1QNTA 4AVBA 3I64A 3BZ6A 5D4RA 2L4AA 5FPZA 1Y0UA 1R7JA 3RPQA 5H6QA 2ATFA 3VODA 3FZVA 2WTEA 4U0VA 5AIQA 4YSFA 2Y0OA 2CGPA 1J58A 2VC0A 2GQQA 4HA8A 4UHTA 3C7JA 4D7SA 2LNBA 2LDUA 2ZBKA 5KHGA 4CICA 2A5YB 4MEXF 4WF2A 2KJBA 5BPIA 4LUKA 3L2CA 1FXZA 2IP2A 1BN5A 4KN7X 1REPC 3EETA 5FD6A 3H7YA 1FT9A 4R52A 3DL3A 2O8QA 3QAHA 4EWDA 2CSOA 1QPMA 1LVAA 2JZYA 1SAXA 2IXHA 4G6QA 4Q0VA 1MDMB 2ESNA 2OD5A 3ML6A 4HV5A 3T0YA 3RIRA 4BHCA 2V79A 2JTVA 1RUNA 3VEPA 3O6BB 1ZYRF 5I93A 2M30A 2G7UA 2ZKLA 3I58A 3MCZA 3DPLC 2CYYA 2JSCA 1TQMA 1P2FA 1XMKA 3FMSA 4XSZF 4OFGA 3E3VA 1VJ2A 2D5FA 2OZUA 1J3PA 3IBMA 1W7PD 4ORFA 4L9TA 1KGSA 4H0EA 4XSXF 1U5TC 1JHHA 3RYPA 4M9ZA 4BIFA 1DGRA 1BI0A 4IESA 3GFLA 3BROA 1FBSA 3P7NA 1L3LA 4IEZA 2E1CA 2AS5F 3M8FA 2GC3A 3KP6A 4MGIE 5FB2A 4HVOA 2PFWA 3ECHA 4M73A 4RB0A 2HQNA 5LEJA 4CDGA 2P5LC 5KVRA 4RB2C 3R60A 2PLYA 2C0ZA 4K8FA 3KEOA 3BY6A 2IC1A 3R0JA 2RVCA 3EUHA 4JTOA 2KIFA 5LRRA 2PEXA 4EJOA 2C6YA 1KYWA 1OMIA 1EV7A 1STZA 2XVCA 4ZYEA 2JT1A 2XGXA 3SZTA 2VPVA 1ZZ7A 1T39A 5KHHA 4HLTA 4U7BA 5FGMA 2JRTA 3KLNA 3ZMVA 2PFBA 3CJXA 1BOAA 4GGGA 4KFCA 1SQ4A 3O14A 4MH0E 2P17A 2QBYB 3WGIA 4N9HA 2HS5A 5JSPA 4A2UA 3IRRA 1X8EA 1ZHFA 2IA0A 4HV6A 3BWGA 5HDNA 4PIYA 1JGSA 2ZNYA 1EH6A 5FLIA 1FI2A 3WTSC 2ZKZA 4YYOA 4LLNA 1MD0A 2QM3A 2IT0A 4XRFA 4HX4A 5A2QZ 3DN7A 1YW7A 5HVQC 1YS6A 4R79A 2W57A 1QQIA 4UVCA 1GXPA 3SCHA 3LAPA 4ASNA 2A07F 3B73A 3S7EA 2KXLA 2IA1A 5LEKA 3TNPB 1DUXC 2XLGA 2PHDA 5IT9K 1CAUB 3RTRA 1HSTA 2QUFA 2K9ZA 3B02A 1LR5A 3Q9VA 1SD6A 2WC2A 3E6BA 1WWXA 1L0OC 3I4PA 2PN6A 1D3YA 5ICEA 2R3SA 3ES4A 1H1MA 2HTJA 4HBLA 2VN2A 4LLGF 4S05A 1SEFA 3E5QA 5BUVA 2XAJA 1OYWA 3KMHA 1FC3A 4Q0SA 2XIGA 4GULA 4CO8A 4TV7A 1UFMA 2OU2A 4HOBA 2F5CA 1QGPA 2J5PA 3GLXA 4LB5A 5D1IA 4ENJA 3TGNA 4AQ2A 4A5MA 1O7LA 1P4WA 2J5OA 2W25A 4Y15A 4E70A 4R8HA 1W4MA 4OINF 2NAZA 5K8SA 3QU6A 5J6XA 3SXYA 2XHKA 1BC7C 4HAMA 2NS0A 4Q0QA 2CQKA 2PG4A 3E5UA 4IEUA 1LEAA 2EV5A 4AVAA 4HW0A 3FX3A 1FNNA 2KKOA 2DI3A 2BYVE 3E6DA 1FP2A 3IDBB 1XMAA 1UHWA 2CV6A 2D5HA 1CAVA 1DZRA 2D93A 3CUQB 1PM7A 3JSPA 1EY2A 5HLHA 5L3GA 4XFFA 4B29A 1TNSA 3JTHA 2O8XA 2FA5A 4WWCA 2CG4A 2BGCA 3OTFA 4AXOA 3I59A 3FHZA 4L0YB 4E2GA 3WTUC 4QXKA 4IHTA 1IRGA 3J7AO 2ZXJA 4I0BA 4G7ZF 1RZ4A 3DF8A 2RC4A 2UYAA 4ENKA 3LA3A 5JSRA 4F8AA 4IRGA 3BOQA 3NKTA 2Z69A 4O6JA 3C3VA 3V8LA 4YARA 3I53A 1YYVA 1PUEE 4IEYA 4LA3A 3HSRA 3JAMZ 1CAXA 1IZ1A 4HQEA 5D6EA 5LLQA 4ZYDA 1B4AA 4LD5A 4HDUA 3QACA 4ONUA 1X3UA 5HS7A 3QPTA 4QWQA 2ZNZA 2CW0F 2RDPA 2VBXA 1P92A 2ELHA 2VT2A 1WRJA 3DFGA 1W7PA 2FSWA 2PA7A 2MC3A 3H1MA 3WTWC 2MHFA 1J75A 3CO6C 2UYBA 3V8JA 2OA2A 4P9FA 5ERIA 3FWEA 3FXUA 1FP1D 4RGUA 2NYXA 2A6HF 4JBAA 1HKTA 2UY9A 3TKYA 2A6EF 4FX4A 5J7MA 2Z5UA 2UY8A 4L18B 4B8XA 4L0ZB 1BM9A 4EWEA 2P7VB 2D1HA 2VXZA 3GO5A 1EPZA 5E1RA 1W5SA 3LQRA 1PP7U 1XN7A 5K5RA 3M9AA 4EVIA 3WGHA 1UPIA 1K6OA 4XFBA 3GW2A 4KT5C 1IN6A 3BPZA 5I91A 4RS8A 1QXRA 3ELNA 1B59A 1ZG1A 1K78A 2GXGA 3SMHA 2IJLA 3M70A 2HWVA 4U88A 3S7IA 1G3WA 1LRHA 2K4JA 2VQAA 4RAZA 2Q0AA 3HTSB 1OKRA 3Q5FA 2WFPA 1J0RA 3PLQA 1PDNC 3M1EA 3TQNA 2EFNA 2Y0MA 1EYBA 1KU2A 4FX0A 3LAJA 2B8MA 5HI0A 5JSOA 2Z9OA 3KGLA 1YFWA 5L3FA 2A3SA 2Z3YA 1RL3A 4HVQA 2IVMA 5BY5A 1GQGA 4RB3C 1O5LA 1R00A 1Y3TA 4IVNA 2QCSB 5D8LB 1OPCA 5BMZA 4EJWA 4U7DA 2ZJ2A 1EH7A 4XLPF 1CX4A 3MZHA 3CO2A 4IEWA 4KYWA 1HW5A 2OZJA 4EMSA 4I0AA 3Q9SA 2R7FA 1ZZBA 3K0LA 2ISZA 3NRVA 4OIQF 2XRNA 2Q30A 2QQBA 3BJOA 1XGNA 1FWZA 4P96A 3F22A 1RGSA 4B09A 4Q0UA 1H1IA 1I5ZA 4UV8A 3NEUA 1O7FA 2IPQX 3SCFA 4XFCA 5JHUA 3W6KB 5E8IA 4UVBA 1WA4A 2CAVA 2IXIA 3BPXA 4S04A 3GXOA 4RB1A 2STWA 1D8JA 3H1YA 1MZBA 2Q0OA 1J3RA 5K5OA 1TNTA 5EEHA 4Q48A 4AIJA 1MKMA 5L3DA 2MBFA 3J80Z 2PTMA 3JTGA 1BJAA 1YWKA 4E2SA 4CXFA 5DD8A 5D5XB 2QVSB 4EGYA 2HYGD 2RKHA 4ETSA 2OYZA 2XL7A 3PFIA 2DCTA 2GC2A 5HDGA 2STTA 4QGLA 4DNCA 4KU8A 4HF2A 4L11A 3NVCA 1FLIA 3ST7A 3S0MA 1ZZCA 1J7KA 1AOYA 5JAXA 3K1PA 3BP8A 3ZDSA 1ZRDA 3U9GA 3O2PE 4ZYHA 5LGNA 4XETA 1NE4A 1SFXA 1R5HA 3K9TA 1IPKA 3IKTA 5KBFA 4HSLA 2DU9A 2XKOA 1NYWA 5F6FA 1Z6TA 4PJYA 3WW1A 3ZPLA 2CFXA 3GVAA 1KA8A 2Q2EA 4HX7A 4N0BA 2BNMA 1FBQA 1CF7A 1LB2A 2N7GA 3M8EA 2DLLA 4I3PA 3R6SA 1YQAA 1YW8A 4HN0A 4JQFA 4MV2A 3D0SA 3WTTC 2XL9A 3ACLA 2NRAC 4BH9A 1X8MA 2FF4A 1KQ9A 3GFIA 1L3JA 1KU7A 2P8TA 3IIAA 4ZZDA 1XSDA 2IW5A 2K0GA 1EP0A 1G3SA 1CAWB 1R1VA 4NQWA 4M71A 3RYRA 2EJRA 2EFWA 4HYEA 3FMRA 2Z2SB 3P9KA 4HLXA 3KFWX 2H27A 1HQCA 4META 3H3ZA 1T98A 4Z2YA 4BHPA 4RAYA 3DV8A 4XF3A 1O57A 2HTSA 3RKYA 3U10A 5JR3A 3H7JA 4P5OA 2MH9A 3D5LA 4YIFA 5JR7B 4KA4A 1BI3A 2QQ9A 3IWFA 3TNQA 4RGSA 1TQIA 4Q5SF 5C6CA 2D1VA 2O61A 5D5VB 3ABUA 2VE9A 3EYIA 4LG0B 1O3SA 1C0WA 3JSOA 2GC1A 4ESJA 3CDHA 2QJVA 3QP5A 2QYOA 4EQQA 2DTRA 4ZU5A 4LUMA 1ZZ6A 1DPUA 2VBZA 4HF1A 4YFXF 5FLXZ 2LF8A 1ZG5A 5LGTA 4X6RB 3MYXA 3WTYC 2V09A 5ICCA 1FOKA 1B6AA 4HSJA 3CL1A 3WG9A 4H7LA 2M5WA 2KIMA 1P4AA 3QPHA 2JPCA 5E1ZB 1QY4A 5CLSA 1F1ZA 5F64A 3ZMUA 2QVOA 3T5XA 4DINB 1Z1DA 5HS8A 1XE8A 3HQXA 1J59A 5I8SA 3UKTA 4KWKA 4MZUA 2Y75A 2DW4A 2P5VA 2ISYA 1Z91A 3HRMA 5LRSA 1LEBA 4CYDA 2NNYA 3GZ6A 1UD1A 2FMYA 3JW4A 2HDCA 3IDCB 2XKPA 1IW7F 3KSCA 3CJNA 5FLHA 1S7AA 4MQVA 3TO6A 1RIOH 2XAQA 1G6NA 3FE5A 2G9WA 2M45A 4Y13A 3HRSA 3KE2A 4IF4A 1ZRFA 1UCRA 1K79A 3MWMA 2HKOA 5FQ0B 3CUQA 4ZZLA 1P4XA 2L54A 1DDNA 4PCQA 1BBYA 4G9YA 2YR2A 1WQ2A 1PMIA 1XGMA 3BALA 5DUKA 3I71A 4NB5A 3ZMDA 4IPAA 3USSA 1O3RA 2DK5A 5LHIA 4IXAA 1HW1A 2HKXA 4KN4X 3HOSA 3COAC 3E6CC 3MAJA 3K69A 4G6DA 3BB6A 5JVTA 2GA1A 2Y48A 5CADA 1YLLA 1YW9A 2ZMEB 2BE5F 5KK1A 3ES1A 2FQ3A 5HDKA 3K1NA 1FSEA 3F72A 4HN1A 4KU7A 2EA7A 4Z07A 3BDDA 4P55A 5A2QK 3NL1A 3NSTA 5I0RA 4MEYF 1DPRA 4FAHA 1VP6A 1XGSA 4XFHA 4WZCA 5KHKA 1ZNPA 3HIFA 1IN8A 2QZ8A 2YSRA 2R7DA 2F4PA 1JXSA 3G73A 3GBFA 4EV0A 2I45A 1IN5A 1IXRC 5DCMB 2VODA 3FFQA 1KQ0A 3FJSA 2K4BA 4YG2F 4MGZE 5BS6A 1LDJA 3WGGA 5CVJA 2HGCA 3V7SA 3IWZA 2PAKA 1TQ5A 2H6CA 4IERA 1H9GA 2GIVA 4LA2A 3R0AA 2FRHA 4KMFA 2GWRA 3GYHX 2B5HA 1HSJA 5HS9A 3RDIA 2VBYA 3E6MA 5E8GA 1IUYA 5L3EA 3I7DA 4TLFA 2E1NA 4L2NA 1TLHB 1G3YA 5EEGA 1KQ8A 1NHAA 3FZ3A 4FT8A 5E18F 1LNWA 2QENA 4XF9A 2FXAA 4OLLA 4XLNF 4BYYA 1SFEA 1TQPA 3F8MA 5HOOA 3QRFF 4EJTA 2H94A 4J1WA 2F5EA 3HYIA 1FYKA 5E1WA 4EM2A 4AIKA 5E17F 3LZZA 2HFHA 1ZGAA 3ZMTA 4EJVA 1R5GA 3GX4X 4BQAA 2EV6A 3LFKA 1YFUA 3VHRA 4YRDA 3ISPA 1V3FA 4M6XA 1IN7A 2YPRA 1RTVA 3GEZA 5BPDA 1SFUA 5LHHA 3IC7A 5D6FA 2IRFG 2F2EA 4O9GA 1YFHA 2RV8A 5E1XA 2OQRA 3F8CA 2XAHA 1SMYF 5IT3A 1QXJA 1LDKB 2FMLA 3WU1B 1KU9A 4KUMA 1U12A 3WTXC 5DDGA 1OFNA 2CO5A 1YG2A 3BJ6A 3P9IA 3KP3A 4XF1A 1U5TA 2ACJA 3H8UA 2V1XA 4WXCA 2CWEA 2BNNA 4A12A 5JI6A 4WCGA 4XFGA 3L2HA 3H3UA 5ED4A 1ZGJA 2ET7A 4GO1A 1U8RA 3JAMK 1LJ9A 5BPXA 1EH8A 1CAVB 1XCBA 2EVXA 2L3DA 3T8TA 1XD7A 3PVBB 2EAAA 5BV6A 4I7HA 3L00A 1UHMA 1YLFA 3M3IA 3FXRA 2PAEA 4A0YA 4D0PA 2E7XA 5DEQA 4PIZA 1ZZ8A 2EFOA 2A69F 3MFKA 2VE8A 4IEOA 4Q4ZF 1U6GA 1T6SA 4A0XA 1KYZA 5HLIA 3BPVA 3KP5A 4EM0B 2XLFA 3WW4A 1DGWA 4UXNA 1XCVA 3RNSA 2ADUA 3LQQA 4PZJA 2FQPA 1I1SA 3H50A 1NXMA 5KHJA 2X0LA 3J81Z 1GQHA 3F6VA 4N9IA 1WKMA 4L5IA 3GUDA 3ABTA 2EA4A 3CUOA 3HOTA 2IXKA 1SD7A 4ESBA 4MUVA 4LLLA 1GHCA 5ICFA 2XASA 1W7PB 5KHIA 4KWJA 1WGPA 5TJJA 3MEXA 1TBXA 3PQJA 1ZVFA 3EQEA 4XEZA 2ZFWA 2VT3A 4GXOA 5JCTA 2XROA 5K1YA 2JPBA 3V7CA 3CF6E 5ILVA 4HVRA 2Z99A 2DFIA 1FPQA 3I5UA 4HLYA 2DK8A 3KCCA 1B1BA 4A0ZA 4O9EA 2B9UA 3QP6A 1J2XA 5CVVA 3F23A 3N97A 2FBHA 5ILUA 1LQ1A 5DD4A 4ZU7A 1R58A 2W24A 1D8KA 3H9AA 2A61A 1XB4A 2Z33A 3FMQA 4Y17A 3PNAA 3DPTA 1IPJA 3F8BA 2W84A 2IXJA 4QMAA 4KNYA 2UXNA 3KZZA 3DQVC 3O3KA 4F7ZA 5EFUA 4BAYA 3RKWA 4LMYA 3SXWA 4LLOA 1DZTA 5I0UA 2XUBA 5DV5A 5FD5A 4KIGA 1Q5OA 1GVJA 5E20A 2QWWA 1OR7A 1MDMA 2COMA 3NW4A 4L9VA 4M74A 4QM8A 3ZMSA 1FYMA 5LGUA 3H1WA 1CAWA 2GAUA 1R22A 3FM5A 4YIIA 2V9VA 4PGGA 3F8FA 5CJ9A 4WK8F 2V1UA 3HT2A 1Z9CA 3LWCA 2BEOA 2DT5A 1YTYA 3DKWA 1XDSA 4DQ2A 1YIOA 5D8KB 2XAGA
chains in the Genus database with same CATH superfamily
3WU0A 1PK6C 2K86A 1ZG3A 2YB7A 1H88C 3BTXA 3A21A 3KP4A 4HNTA 2QZ3A 1Q43A 4U0WA 4BJTA 1VQ7I 2V26A 2MGQA 2WB1N 4ZDPA 5CVRA 1UCXA 5FK7A 3BG9A 2W95A 5LBEA 2GIZA 1S7OA 2QCOA 3DP7A 4QPIC 4Y4RA 4OUSA 5EZWA 1PVC2 2DQLA 5LBFA 1X1CA 5L19A 1HKSA 4C0BA 2Q8OA 2BHYA 3FK6A 2EIEA 5FZ3A 3LWFA 3WW2A 4R4ZA 5E88A 3CMMA 1G4DA 4B1RA 2R5YB 3ERED 1X82A 2CV2A 2IBDA 2WFF3 4FFGA 1BR1A 5H20A 1AYM1 4M00A 1QJFA 3CJIC 5ABJA 4LE3A 4IV1B 5KXCA 1NLQA 4XOPA 1W9YA 2VIXA 4ABZA 1JUMA 3DLLF 1RUG2 2LY2A 2QSGX 1QO0D 3MZYA 5AIPA 3R4DB 1XSRA 2YG0A 4Q4W2 1MVEA 2JIGA 4HDVA 4DUVA 3B6CA 1I27A 1QJX1 3V0AA 1OQEA 5A33A 4BQOA 4QHZA 4CCNA 2BNOA 5FQ0A 4IHYA 4D7TA 1WW5A 2ZXIA 1OYYA 3ERMA 4LBMA 2VZRA 1JS9A 1OVPA 1EAH3 5E8AA 5A6ZA 2O0YA 3TBDA 3MF6A 2RM23 4PGHA 4M3CF 4ESFA 3H1CA 4JZRA 1PJRA 4E7HA 3OL4A 1J3QA 1BA5A 3A7QA 4CHUA 2QLZA 4ZYAA 3HTUA 4HMZA 1PGL2 3RPUD 1SD4A 2DOAA 5KAIC 1VLNA 3MFCA 2BFUL 3CU7A 3OBTA 2VUJA 2XHNA 4NDLA 1RIRA 3ZR6A 1UMHA 4IEXA 5I8YA 1D5VA 2WA4A 5IT9Z 2ADEA 5HXVA 2R93J 4MYEA 4OZOA 5FDBA 2VZVA 1CF7B 2JENA 4G94A 2FZ2A 4WM8C 4XZPA 5EXOA 1JYWA 1MW7A 5EG0B 1HV1A 4QWNA 1B9MA 2HPIA 1HQNA 2BP6A 1VQMI 1YJNI 2VOWA 2DODA 3SFIA 4P9UA 2PQ8A 3NKGA 1W1WE 4E7ZA 4RGXA 1K5JA 2I8DA 5IOYA 4L9BA 1AZDA 5FBZA 4XM3A 4M9XA 1WCQA 2SLIA 3ZPOA 2XPJA 1S9HA 3S1MJ 1COV3 1VE0A 2CAUA 4M9SA 4UV9A 1ZA4A 3FN9A 1VBE1 3NJYA 5FPAA 1IDYA 2ZCWA 1F9NA 2AEZA 1OSGA 1ULPA 1I1GA 3OYCA 3KV6A 1HKQA 1FATA 3F95A 2DQRA 2GXAA 1QGLA 4R1HA 3Q8EA 3VFZA 2BRTA 3C8XA 4BL0B 2D43A 5B4NA 3BTZA 3RI9A 3W2WA 5AVAA 2DYCA 4IV1C 2UXXA 2KRFA 5AONA 3LDRA 2BY2A 4IEPA 1V9U2 4NAOA 1ZQ3P 5C3QA 1HW2A 2DBBA 1OPOA 1SLTA 3A0BC 1FOD3 1F4KA 3ZYHA 3QH7A 4PHZA 1NY71 5D4SA 3OSGA 1IF1A 2AXLA 3QPSA 1ZX5A 1J1LA 3BGAA 2R7XA 1YHFA 5A7OA 3TYJA 2RS32 2W1OA 2ZAHA 1GU3A 4RD7A 4M6YA 4AI8A 4JHTA 2VQHA 4Z1VA 3HUGA 2BBVA 5DM6F 3FF5A 3ROUA 2M8EA 2CU7A 2D2WA 4NC6A 5EPAA 1U5YA 4Q4Y1 4Z82A 3QOPA 1ON1A 2AXTC 4UNOA 1S55A 3CCEI 3D0JA 4K1YA 2QQUA 2CQ7A 1LVKA 5C3OA 4FAGA 5BNNA 1RKTA 1U2WA 5EZHA 1DQ1A 5T3NA 5CQGA 1LOAA 2ET1A 4CGZA 2AEYA 4Q4V3 3M3CA 3PTRB 1QJU2 4KIBA 3BZKA 4CP2A 3H92A 4EWAA 2D6NA 2O8KA 4LITA 3H5NA 2CFOA 3VBFB 2CHHA 2QQAA 4NHMA 5FIXA 5F37A 1OCPA 1POGA 2RNJA 3S2DJ 5BYNA 1BJZA 5KAFC 1YOVB 3N7JA 3KGZA 4IGPA 5I0SA 3IH4A 4SLIA 5D21A 1VBC3 4IE6A 3LMMA 2XLAA 1UN1A 4QXCA 2E53A 1JE8A 3WG3A 2OCCH 2FZ1A 1W8OA 4AQ6A 3FFZA 2GLOA 2WR9A 2HVRA 3MKZA 1ZREA 4FBFA 1XSXA 1XNCA 4B4QA 3HNBM 1IRFA 2VCCA 4BACA 4AHYA 5CKNA 3VBRB 1W3XA 1QZYA 3U0ZA 1TWAJ 1UMZA 2EH3A 2E1MB 3RZLA 3M7GA 3CO7C 2HVQA 3ZXLA 1JUIA 1XE0A 4PLNA 2HVSA 1Q3EA 4HXCA 1Z6RA 1FBUA 3GTOJ 2NOGA 3F8NA 3S16J 3GTGJ 3LA2A 3ZXSA 3GF2A 1CN1A 3AKSA 3TN92 1BR2A 3JBG3 3RG0A 2EA2A 3MVPA 5IVYA 2XAFA 5H9PA 2CMPA 4BHBA 1TW3A 3Q3SA 4I3GA 2WADA 5LA0A 3W9AA 4AFAA 1VQKI 2R1DA 1OCCH 3VV1A 1DQ5A 5DCFA 4JYKA 1H89C 4YVSB 3HWJA 4QGMA 1RUE2 2L4MA 5B5EC 4D9JA 1KU3A 1MGTA 1W3VA 2RV9A 3TDZC 1QRYA 5CQEA 1WJEA 5LA9A 1FSHA 1WJDA 1UOJA 4XJ9A 5FJ8J 1U0JA 2V9PA 1MQTA 2ZHNA 5C4WA 1FPN2 2K02A 4Q5OA 4UOJA 1PGW2 4M3EA 2GNBA 4AEDB 5J3UA 4HX8A 3LOBA 2V5DA 2ME6A 5F3EA 3OYJA 3J7AY 1VBA2 2BV4A 1LHNA 2VMIA 1SPPB 3MIBA 4PDKA 2JX9A 5L9BA 4G8XA 2JN6A 3C18A 4M3BA 2PHRA 2DYRH 1NG0A 3UKVA 1VIWB 2FD5A 3WE3A 4PJLA 2I2SA 1H9TA 3OYKA 4KISA 5DS9A 1EV13 3ZYBA 3T8RA 2LKXA 1PO22 2W52A 1SLIA 4OHWA 3ETQA 3AAFA 3VBFC 2XC7A 4A7YA 4BY1J 3USUB 1U5TB 5JI9A 2GA2A 2JRMA 1LOFA 1R6RA 1G8XA 4W1UA 3T0AA 4HL0A 3I56I 5L36A 1D1AA 3SHFA 3CD6I 5IYCJ 1WSUA 1TZOA 3L7WA 4XLEA 2RM21 3J81K 3TOAA 3A01A 2VOPA 2O6GE 3K3OA 4U2AA 4R9BA 4CE8A 1K78B 2NPIA 1V6IA 4HKWA 5LB6A 5FMCA 1H0BA 4I30A 1PGL1 2LK2A 1RINA 5FR3A 4I01A 3JREA 3UESA 3VSKA 3N35A 3VZJA 1NK2P 5FY7A 3PNTA 1WH7A 4COVA 2OS2A 3VBRC 4X6QB 1IAWA 3W6VA 1RI7A 1N3QA 3OYMA 2F4OB 1E3OC 2E1MC 2VJXA 2WNUB 1XX5A 2WWYA 1UZWA 2DFBA 3RWNA 4KL1A 3IH2A 3ECOA 2X10A 2IVJA 2JECA 2W4SA 5CVUA 1USSA 1FYUA 3OCPA 1QH7A 3W59A 2VC1A 5A7PA 1XNKA 5JOXA 3K70D 4YVSC 1Q8PA 2PHTA 4IHWA 3VODA 2WT0A 1AYN3 2Y0OA 1WVRA 3CCYA 2JA2A 5IFPA 1J58A 1COV1 4UHTA 3C7JA 3OYFA 2LNBA 2LDUA 2XBO1 4MEXF 5EV7A 3PUBA 2WSVA 4Z8BA 1JU3A 5GPAA 5EWSA 4KN7X 3A2KA 3H7YA 1DU3D 1Y43B 4IE4A 4AL9A 3NRUA 3AK0A 1YNAA 1F9KA 4ZZ5A 1E3PA 4AEDC 1ETOA 3M8LA 4EWDA 4BDVB 1VQPI 1QPMA 4FOWA 1SAXA 2VAUA 3AL0B 3ZN4A 1A78A 3BQZA 4QQLA 4Q0VA 4K40A 4QHBA 2OD5A 3I49A 1IQAA 3RIRA 1V9U1 5HLTA 3IDEA 2VZPA 4S2DA 1VRH1 3WG1A 2DFCA 3DPLC 3AFHA 2DDBA 1ALYA 3E3VA 1UELB 2A5WA 4QX0A 3BG6A 5LW9A 1W7PD 3AKRA 4H0EA 1U5TC 1JHHA 1GP5A 4XYXA 1HKDA 4QT6A 3BROA 2X1DA 1FBSA 4IEZA 3PUHA 4W6WA 1KFXL 1BR4A 3I8TA 2HWE2 2VVDA 1Y1WJ 5HV0A 3AYAA 3ECHA 3WQ1A 5LEJA 2P5LC 5KVRA 4RB2C 5GTHC 4K8FA 3BY6A 3EUHA 1W6MB 1FIPA 3C7EA 5GZDA 2JT1A 2J1TA 3SZTA 3ZXEA 2AREA 4NOTA 2VPVA 5KHHA 2JRTA 1BJQA 4KFCA 5ABJB 3RZMA 4CDUB 4E7LA 1VBC1 2WNUC 3S57A 3CMAI 4LBKA 2W94A 4A2UA 1RUD3 3IRRA 2PJRB 2ARXA 2JKXA 3JU9A 1EH6A 5FLIA 2YHJA 2ZKZA 1JHJA 3TB0A 2IT0A 5A2QZ 1XNTA 2QZ2A 1YS6A 3V0AB 3FUQA 3SCHA 4ASNA 9ANTA 3AMQA 5M5WJ 3BODA 5E6HA 2QQLA 1ENSA 3L2QA 1HQWA 3WF0A 1VAKA 1TNRA 2MEV2 1WCMJ 1MBHA 3JBG1 3Q9VA 5FAXA 3E6BA 4Y5TA 2L9RA 2XMLA 3I4PA 5CFDA 1I9RA 4MFDA 3ES4A 1AR92 3D4KA 4HBLA 1KFUL 4YZ1A 4ANJA 3K75B 4NE9A 5BUVA 4ASKA 1OYWA 1WWYA 1FMD1 2Y6KA 4NO4A 3AL0C 4GULA 4XNFA 3UKGA 4XJWA 1UX7A 1UFMA 2F5CA 5JOYA 5D1IA 2KLOA 3PU3A 5T50A 3IN9A 4Y15A 4R8HA 3HB9A 2LRDA 3X2QH 3PMSA 5J6XA 3U78A 4OI1A 2ARAA 3CCLI 4RA2A 3TP0A 4PDWB 4AVAA 4LBQA 3FX3A 1QEXA 1VBA1 4E8CA 2MD0A 1I1EA 5FZ0A 3HR9A 3THPA 1XMAA 2K3PA 1UHWA 2D93A 3WT3A 3CUQB 5L3GA 4QPWA 4B29A 2R042 2YU2A 1ETYA 4UFJA 2WNOA 4AXOA 1UO9A 4DXSA 1SDDB 4F93B 2ZXJA 3VBHB 5DUVA 1IUFA 2CV0A 3DF8A 3HBZA 5ACA2 5JSRA 4JDNA 2BW3B 2BQPA 1JYCA 2YU9J 4O6JA 1TMF3 3CCVI 4JQTA 1NAEA 1UY1A 4N90A 4FOYA 2VNOA 5LLQA 1C3HA 4EYUA 3QACA 4XQ4A 1BEV3 5ABJC 1S7EA 4Z6YA 4QWQA 2R7RA 1LESA 2RDPA 4URAA 1TT0A 5EF6A 1MS4A 3RZGA 4OAYA 3APBA 1DIWA 2FSWA 2ZMKA 2MHFA 3KQ4B 3CO6C 5H9SA 1RKWA 2DA6A 4CDXB 2OA2A 3AXDA 2LLKA 1U5ZA 1W0TA 5ERIA 1OFSA 3NAPB 1FP1D 2QGUA 3ZFGB 1GV5A 4F3QA 2A6HF 3MZ8A 2JJ7A 2CRGA 3AKZA 2Z5UA 2AGSA 1CONA 1X4PA 5AFEA 5JOWA 4GH4A 4A3EJ 1EPZA 3S30A 3WG7H 4NHKA 5E1RA 5A3UA 1W5SA 1RYYA 1LFBA 1XN7A 1R092 5K5RA 3M9AA 2OCEA 1K6OA 2LTPA 5J36A 4XFBA 3N9OA 5JZGA 5I91A 4B43A 1EF4A 4HNVA 3LOCA 1VQOI 5D8AA 3O1RA 1B59A 2OJED 1ZG1A 3RWKX 3SMHA 2IJLA 2HWVA 4XACA 3C7OA 2EIBA 1PZ9A 1MEC1 1LRHA 3WOGA 5CG8A 1LGBA 1IPSA 1QDCA 1BLZA 1H2NA 5FUIA 5KNLA 3A02A 5FKLA 2R7ZJ 2B9VA 4ASLA 1FAYA 3HM5A 4YM3A 2XQRA 1KU2A 3K4LA 1VBB3 1N1YA 1X2NA 5HI0A 1Z7S2 3G1MA 1XPWA 4J25A 1YFWA 3W2VA 2A3SA 1RL3A 1XYPA 2W2IA 4TN7A 1JODA 2XB0X 4E4DX 3GGLA 3WCSA 1MSEC 3HGYA 3JD72 4S2FA 5JPMB 4FQZA 2DMNA 5D8LB 1OPCA 2ZJ2A 3T1MA 1EH7A 4XLPF 4AW7A 4OHYA 4KYWA 1APLC 2HH9A 3TL4X 3OIOA 3I4MJ 1N1TA 5EJ3A 1X9TA 3H0DA 4ARYA 3MFAA 4I0AA 3QYBA 2R7FA 1ZZBA 1NH3A 2NQYA 4DBQA 3ZGKA 2ZABA 4P96A 3F22A 4B09A 1I5ZA 3C7GA 4J6GA 4UV8A 2HYKA 4GALA 1S1AA 5H9RA 1TWFJ 2RS51 3POIA 3OUJA 2HWF3 2IPQX 3HKZA 5JHUA 2WA0A 1UYXA 3BPXA 4QQPA 4S04A 4N4NB 2C9KA 1V6NA 1H4GA 4CDXC 5CBLA 2Q0OA 3ETPA 3TW6A 1XC5A 5LCWL 5EEHA 4C1WA 2XJVA 2AQEA 1MKMA 3NAPC 3ZFGC 3K4MA 4DYCA 2NLRA 5IK8A 2MBFA 1T33A 3KIOA 5B3SH 2WBMA 2DV9A 3WD5A 1EJ9A 1ULFA 1CJDA 3JTGA 4C30A 1Y56A 4YZ3A 2G9GA 4CXFA 2IAIA 2QVSB 5A32B 2HYGD 4FPCA 3SYTA 1C57A 5BNNC 2DCTA 2RJ2A 4QGLA 2PHFA 2EXHA 3NVCA 5FZEA 4XTPA 3MKYB 3JRFA 2JWPA 1RPWA 3K1PA 3BP8A 3HKZN 3ZYFA 3GBGA 4QPQA 4YGCA 2VMEA 1PVXA 3U9GA 3O2PE 2WFF2 5GLZA 5LGNA 3OSDA 1NE4A 4HSRA 3K9TA 3IKTA 5KBFA 1LENA 5F6FA 1QJEA 1O4XA 3JRDA 1T56A 5IYBJ 5GM0A 3ZPLA 3LPFA 3GVAA 2Q2EA 4HX7A 3DKXA 2XRLA 3S1NJ 1U5XA 2C5DA 2CW7A 2P81A 1C28A 1N1VA 4I3PA 1QKQA 2Y8KA 2CS3A 1YQAA 3A01B 4MV2A 3ZXKA 2BY0A 1X8MA 4XRSG 4W8JA 2QEXI 3IIAA 4NPRA 2CQXA 1AR91 3THDA 1G3SA 1RUJ3 2Y26A 1Z3YA 4HYEA 4B7KA 3MIFA 5DZFA 4LIVA 2LUWA 1VBD3 1EAH2 4HLXA 2H27A 4META 4BEHA 1Q8VA 4IQ4A 4HPKA 2WAEA 2EXJA 3RKYA 3UNPA 3H7JA 4KA4A 3F2ZA 1D2QA 5C6CA 4Y1XA 5D5VB 2VE9A 5F7UA 2R30A 3JSOA 3CDHA 3QP5A 1GUIA 3PHMA 1GZWA 1KS5A 1ZZ6A 1F8VA 4CEYB 2VBZA 4HF1A 4YFXF 2ORZA 1ZG5A 2PMZA 2EIGA 2VOXA 2ZGMA 1R083 2DF7A 5IATA 3E0JB 2Y0SA 1ZBA1 4HG6B 1P4AA 4QB1A 3EUKL 4YW2A 5DAXA 3ZX7A 1R5ID 3L2UA 1XU2A 5F1JA 1XE8A 4X0GA 2R061 1TMF1 2PHUA 3OGSA 4MZUA 1ZM1A 2Y75A 3RZOJ 3DYPA 2ISYA 1Z91A 2NMNA 5LRSA 1LEBA 2DXIA 2KIQA 2BERA 1UD1A 2FMYA 2V72A 1BEV1 2W08A 3CJNA 2H8WA 1BBT2 3FE5A 5HCFA 2G9WA 4BCUA 2M34A 2KR2A 4JRLA 4IF4A 1ZRFA 3HVDA 2Y0SN 1KEXA 4URTA 5JMCA 1JKRC 4DS0A 1PMIA 2XGEA 1XGMA 3BALA 4QB2A 1O3RA 4CA9A 5JDBA 3OUIA 2ZGRA 4RS5A 3VD9A 5A7NA 4ES8A 3COAC 1LOFC 2WZEA 5SV8A 3O1PA 4DUXA 3BR2A 1ERDA 5E3MA 1FOD2 2Y48A 5CADA 4DW6A 4IGOA 4BJ5C 2NOJB 1HB2A 3ZFFB 4PQ9A 4DXRA 2FQ3A 5HDKA 4Y20B 2XPUA 3K1NA 1FSEA 4XUQA 4HN1A 2VW2A 2CUZA 3NV2A 4LK7A 1LOCA 1Z67A 2ELJA 4PUSA 3QYEA 3NL1A 4RM3A 1VF9A 3DTEA 4V1PA 4ZXKA 4MEYF 4XBLA 2CYFA 4GJYA 4WZCA 5AC93 2RMU2 2DN0A 4LG3A 4Q4V2 2QSHX 4FPHA 2XJUA 2I45A 1IN5A 4CCDA 3PUSA 1GV9A 4YW6A 3EB7A 1JH5A 2K4BA 4OI4A 3BZCA 1TQ5A 1VBB1 3NMBA 2TNFA 3M4FA 4O65A 1E5IA 4XOGA 2GIVA 3LSMA 1OD3A 4RGAA 2GWRA 5CA6A 1HSJA 2G1MA 5HS9A 4CEYC 3RDIA 4B3XA 2VBYA 2G0EA 4OCTA 1IUYA 2XPVA 2L7MP 5L3EA 3I7DA 5FYHA 5DZEA 5IVFA 5E3OA 1Z0XA 5E18F 4XZUG 1CJPA 2GN7A 5FKNA 3AL6A 1X33A 1AXYA 3QRFF 5A3OA 3ZSMA 1FYKA 5E1WA 2R0HA 4AIKA 2DU0A 4CXWA 3LZZA 5FZ4A 3ZMTA 2Z16A 3I2IA 5C33A 1HCRA 3QLQA 4EN8B 3AP4A 4YRDA 1IN7A 3M8JA 4LKFA 5EJZB 4COZA 5LHHA 1OCTC 5K4LA 4PJMA 4UFIA 5DAVA 2WWUA 1W36C 4E7SA 4OULA 2HWF1 1LHOA 2OQRA 1XU1A 2NN8A 4CH7A 4BE3A 4A3IJ 3O1OA 4CYCA 2V4AA 4ISRA 5DDGA 1OFNA 1ASJ2 3MEPA 4PSWA 3KP3A 5DUUA 4XF1A 1Y39A 3FLTA 1PO13 2CWEA 4A12A 5JI6A 2B39A 4BB3A 5ED4A 2X6OA 2CQNA 2ET7A 3KT4A 3JAMK 4V19K 3DXTA 1XCBA 1MS1A 3T8TA 1XD7A 1GYKA 2MC4A 1ETQA 1VB4A 1W8NA 3ZFFC 2QQWA 4PIZA 1ZZ8A 5FZ6A 2EFOA 2A69F 4P00B 3WF4A 2A6XA 3EUHC 2OIIA 3JUUA 3RZHA 5JR2A 4MGTA 3OR2C 4EM0B 2E7TA 3ZQCA 3WW4A 1NZIA 4PLMA 4UXNA 2Q8CA 3I3EA 2DUPA 2L9SA 5KHJA 1VNDA 5T52A 2X0LA 3J81Z 1V54H 5F0HA 4N9IA 4L5IA 5CG9A 1JYVA 3ABTA 2EA4A 2EAKA 3V0BB 3HOTA 4GB31 3ITQA 2VQTA 4ESBA 1EV12 3U75A 5ICFA 2XASA 1OUSA 5KHIA 4G12A 3INAA 5B1BH 1WGPA 5TJJA 2P6HA 3DECA 1QQP3 4XRSA 1ZVFA 1RUJ1 1US3A 2B45X 2EQRA 2ZFWA 2VT3A 1FEXA 4GXOA 2XROA 4ZTJA 3V7CA 2J1EA 1AL22 1B8IA 4LE4A 3HOUJ 4XLFA 1VBD1 4YELA 3ZCOA 2HWB3 2XJPA 2DTZA 4O9EA 4KH9A 1RVF2 4WZFA 1CD3G 3F23A 3QPLA 5FY5A 1KRIA 1S0FA 5DD4A 2W24A 4KQ7A 3H9AA 1XB4A 4Y17A 3F8BA 2HEVF 1Y4WA 1ZYBA 2QDNA 2VXDA 1YQ2A 1JZ4A 2VJ5A 2JUCA 4CCOA 4BAYA 3RKWA 3ZIXA 4UW4A 2RDNA 1ZBE3 2XVGA 1ST8A 1W9FA 1DZTA 2ZXWH 5C4JJ 5I0UA 5D8AB 3RZDJ 2KRCA 4BQ4A 2QWWA 1KITA 5C3PA 4IE5A 3ZMSA 1FYMA 3H1WA 3ZQLA 3UV9A 2JD4A 1W2AX 3GZEA 2WWSA 3ZPYA 2L0KA 4WK8F 4NHYA 1YTYA 4LMFA 4GAZA 1MMSA 4FE4A 3VDAA 1V4RA 1UAIA 1OUXA 2JDZA 1G3TA 3OGJA 1YFXA 4OZXA 1ZRRA 1UOGA 1IS5A 5F04A 3SISA 5DUIA 4K1ZA 1AYN2 2IS1A 3ATGA 2D40A 1PGSA 4IE7A 1WMEA 3IKVA 4R9CA 2WNVB 2X5IB 4UUVA 1TVGA 2VQ0A 3SEQA 4L0PA 2FU4A 2FOKA 3C1DA 3KZ4C 4IZZA 4LIUA 4WM7B 5A7QA 4QSHA 4PK4A 2P0WA 3U11A 5GAHJ 3O1UA 1V6KA 1Q8OA 2C6SA 3OL3A 4HF0A 2QQMA 4QDQA 4KDPA 1JHFA 2WO3A 3UETA 3GYDA 4IE0A 4U87A 1ULYA 2QBYA 1SD5A 1T2XA 4DYQA 3J80K 4Y5SA 4EROA 4K8RB 4MTEA 3CF5F 3ZYPA 2GNMA 4KMUX 3LAGA 4XFAA 1Y9QA 1X1PA 4XHXA 2EZLA 4XBFA 2G9FA 3TAYA 5AFBA 2C1FA 3W6JB 3ZR8X 2HDDA 3KB5A 1BVP1 1T2KA 2CDPA 4P9XA 4IJAA 2W0XA 2D6MA 4JKKA 1OD5A 2W48A 2Q4SA 2FBEA 2QBXA 1V55H 1SVMA 3SEEA 3C2GA 3ZQFA 3DYMA 2B42B 5J4VA 2P7CB 2R7EB 1WLDA 1VALA 2VXRA 2ZHLA 4D69A 3K2OA 3CZUA 1CAUA 5C8CB 4AF9A 4U0YA 3CC2I 2NVTJ 1OCOH 3PUIA 3SZPA 4LB6B 3BT9A 4TYSA 3K4KA 1RRJA 2OTJI 3TDUC 3KP7A 2VI6A 3LSKA 3U2RA 3IAPA 4LTAA 1S3JA 4HSTA 1FX7A 2HBUA 1FMVA 3A03A 1J9IA 3NNFA 1KD7A 1QOSA 4EE2A 4D6SA 2HQRA 4UFKA 4IX7A 3DU5A 5D8AC 4G6TB 5JFRA 3NJVA 2AQFA 2NS7A 1OI6A 1WLTA 4M72A 3AZWA 4L99A 5IHRA 4MSVA 1RUD2 1LULA 1YX3A 2PBIA 3PVEA 2UWBA 2OZ6A 2VM9A 3OYGA 2RGVA 5LA2A 5E89A 1AVBA 4ISQA 4E9KA 2WY8Q 2K85A 2GOXB 1MJBA 4PF1A 2QDRA 1ITYA 2VECA 2NYYA 5DCMA 4OU0A 4WXHA 3GJAA 3J7ZI 2RG4A 2XB6C 4OUMA 3PIGA 4GMP0 2WABA 1O5UA 1NA1A 2YBKA 1JKQC 3SDGA 3WVJA 3AVSA 1IKQA 4E4SA 4Q47A 5FPLA 3F3XA 1YQ5A 1R1TA 2HPMA 3ULQB 3C2HA 1CIWA 1NLRA 2GNTA 1UHSA 3SCGA 3ACFA 2WNVC 1RC6A 2Q8KA 2NNNA 4YG0A 3TEZA 4GRIA 2RAEA 3HHGA 1US2A 4WM7C 1SCSA 2DMPA 1FOYA 3HDDA 4GIQA 3CTAA 2D45A 1J83A 3M3EA 5FY1A 3IDAA 1FZPB 1RUI3 5FFXA 2WV0A 1GZWB 1ENHA 5ANNA 4UUSA 2QQNA 5J48A 4G7HF 1TWHJ 2K5CA 2YC0A 1XRUA 5FYSA 1MJ9A 4C9YA 5CNAA 3D5SC 3RJPA 4X8PA 4EN0A 4H2AA 3N4MA 3IUOA 5AVPA 2ZO4A 5CYVA 4A93J 2A1XA 2HEOA 5BXXA 3TO9A 2VU9A 3DPRA 4MX3A 5C9AB 3LSPA 2VD7A 5DDJ1 5F5CA 5BNQA 4GJZA 2X51A 3HZJA 3RYKA 4J00A 1LKXA 2YX7A 4KICA 5F3GA 5HCHA 1GXQA 1F43A 2I07B 1FOWA 4A3JJ 1V6MA 3HOVJ 2YGMA 2WZPP 2XJRA 1R1UA 2IGOA 3HPGA 3VB2A 2KHMA 4ZYGA 5C8CC 3EQLF 3VKMA 2DCYA 4LO8A 1WZ2A 3LKJA 1R4MB 4YW4A 3IL2A 3IAM2 2PMUA 2RS11 1QQP1 2DUQA 1AR83 4IRHA 1XGOA 2DT7B 5TRDA 3I2OA 1Y8RB 4FQ4A 4Q4X2 1AUYA 4QX1A 4NN0A 4AIHA 3VKFC 3NQOA 1YUDA 4BK4A 3J8F2 1P6RA 2HWB1 2WY7Q 1YIJI 5LWBA 3ZYIB 1YFYA 1UKGA 2X8KA 5DG1A 4IEQA 1RHI2 4MXWA 2OW4A 1RC9A 1RVF1 4NUBA 5FKKA 2VW0A 5LATA 3LD8A 2PMHA 5JLVA 4MVTA 2FBIA 2EV0A 3GF6A 4OAZA 2M87A 3DCFA 4DYRA 3OYWA 3QOEA 5CVIA 1UIJA 5FO5A 1XDUA 4HETA 4Q2FA 1WJCA 1K61A 4WXDA 1S8NA 4JQRA 4GWNA 2ZJCA 6PAXA 3FXLA 4HT1T 4GDFA 3KV5A 2MA3A 1X1BA 2V1DA 2ZTNA 1Q1HA 4AFBA 4ZC3A 3S2HJ 4JKMA 2WIIB 2HWC2 4UBGA 1OYIA 1PUFA 1OKQA 2VG9A 3S17J 3E1F1 1W36D 1YJWI 2HOEA 4A3ZA 1ZTRA 1GLNA 4M4PA 2YY1A 1RJ7A 1H8AC 3QBQA 2Q1ZB 1D4VB 1IXCA 1GNHA 4NAMA 4E2QA 4A7KA 3DEUA 2WA3A 4IRIA 2MLGA 4HQMA 2VC9A 4GYIA 4A41A 1XE7A 3FC0A 4I98B 2PQQA 2VH9A 5FREA 3HOYJ 1WMFA 3DYOA 3OIQA 5C3RA 5IK4A 1ZLKA 2DFFA 4GCVA 1MNEA 3NJXA 3Q0VA 2YROA 4LK1F 4LT5A 2RVAA 4MGYE 5M3FJ 3H9GA 2NP0A 1EUTA 1U3EM 1H4HA 2JG9B 2ME0A 1DLLA 1T38A 5C9AC 2VQGA 4QKDA 3WHCA 2YFUA 5CFCB 4CXXA 3F0CA 2JB8A 1A3KA 3UT0A 4WBBA 1JZ8A 1K5MB 2RR12 3MPPG 2QQIA 4CZZA 4S2GA 3LDBA 4IOCF 3PIPF 4XK4A 1IS3A 4P5YA 5J37A 2HOTA 5FYTA 2ICWG 2K3FA 4CDQA 1BIBA 4MXVA 4XC9A 1XG1A 1MS0A 4XURA 2PHLA 5KC5A 5FYUA 2Y6LA 2E5NA 5C8WA 3BUCA 1ZKGA 3SFZA 2P4WA 5F0CA 4CYCB 5A6YA 3W5MA 4P9IA 2BOLA 2M7BA 2IXCA 2J1AA 5EJ1B 2YC2A 2ADDA 3ZQ7A 4DRVA 2RREA 2R5YA 2G7HA 2BV6A 4RS5C 1ZN2A 2ZB9A 3POGA 2GSYA 1HDDC 1HRI3 1I3HA 4IV3A 3ZMOA 1W90A 1I6HJ 4DNYA 1GKBA 4LNVA 3OYEA 4EGZA 1IN4A 3VDXA 2YU3A 5FOBB 5FY0A 3RKXA 1GZCA 4IV1A 2K9NA 1HLCA 4HK8A 5JXGA 3HPNA 1QBJA 4E4ZA 4ZH4F 4UW5A 3WDUA 3W21A 4QKNA 3BYWA 2OQ7A 3WCRA 4UUTA 3ILRA 2R4GA 4UFMA 4M3FA 1D1BA 4CXYA 2OUHA 4JX6A 3JB8A 3WP4A 4L9NA 4F3JA 3ZKUA 5DAWA 3VZOA 1WLWA 1S2EA 2P6CA 4OMYA 4B4PA 4D7NA 3LE0A 2AYHA 3M2MA 3N7KA 4XDOA 3ILNA 4NIDA 4M0HA 1RNLA 4HBNA 2QE3A 1XNBA 1QNWA 2F5DA 2NXNB 4OYUA 1FYLA 5M5XJ 3I64A 3OPZA 2M8GX 2E34A 3S5AA 3N7MA 4CVUA 2L4AA 1BZWA 4ET7A 1Y0UA 2DTWA 4CCJA 3RPQA 1SDWA 2JG8A 5H6QA 3CCMI 1W6PA 1CQTA 1YI2I 4YSFA 5C71A 4LBQD 1R1A3 3HOWJ 4E7IA 2GQQA 1YITI 2A71A 4XVHA 1ENQA 2KJBA 4BQNA 1HJGA 2A7AA 2JG9C 3FKJA 3MV11 3L1PA 1Y1VJ 4LUKA 1FXZA 2CU5A 3ZQHA 2OT7A 1RUI1 4GMP1 4X1EA 2AUYA 2BWCA 5CFCC 4R52A 1D4M1 3DL3A 3VBSA 2NMOA 3QAHA 5F5IA 4JX4A 4C0HA 4D7YA 3WUDA 5EG0A 1W39A 2OUJA 4QAWA 4E7JA 1E3HA 1IHMA 1LOBA 4HV5A 3KPHA 2JTVA 3O8GA 1RUNA 5EHDA 4Y1YA 4A44A 3VEPA 3GTPJ 5I93A 2R071 4CU9A 2G7UA 2ZKLA 3B6AA 3PUQA 2KA3A 2RHPA 2CYYA 1BL0A 4QX7A 1P2FA 1XMKA 4XSZF 4AU7A 5K0UA 5GADJ 2ZA9A 3BIWE 3AMMA 4L9TA 1KGSA 5IK7A 3RYPA 1OPMA 3SKVA 4M9ZA 3GFLA 2Z42A 3P7NA 1ACIA 3JRCA 1IQDC 1JZ3A 5FB2A 1UYPA 1GLHA 3WINE 4M73A 4RHV3 2R6QA 3R60A 3AVRA 1GICA 5KXDA 2P2KA 3BTLA 4QX8A 5BNPB 1BKZA 2F5VA 5LRRA 1O8PA 1SCRA 2A6VA 2XG3A 1K45A 4EJOA 2C6YA 2A3YA 1KYWA 3KS7A 1RMU3 1MBEA 3P3NA 5A70A 2LBFA 4ZYEA 1WZXA 4JGZB 4U7BA 4FFHA 2EXIA 3VBOA 4GGGA 3O14A 2LY1A 3T2QA 2W1WA 2QBYB 1QHGA 2D44A 1GVDA 2JDUA 3FHQA 2WQ8A 2ZEYA 1X8EA 1HA8A 4HV6A 1JXNA 2VZUA 4AEMA 3OSFA 4XQFA 1GNYA 1ZR4A 1ND2A 3UYJA 1FI2A 1AR72 4FSJA 4XRFA 4HX4A 2XF5A 1YW7A 2E31A 5HVQC 1QVTA 3RQ0A 1VMFA 5EYRA 1G59A 5JHFA 3CF2A 2UU8A 2H1LA 3S7EA 1PIV3 3WLUA 3MW2A 2JDPA 2HWD3 2IA1A 3S6PA 1OF4A 1DZQA 3VBFA 4IHVA 4FPYA 3TNPB 1DUXC 2XLGA 4M01A 4AIDA 1CAUB 3RQIA 4NIHA 2LMDA 2QUFA 3BG7A 3MGUA 1LR5A 1AYM3 4N8MA 3WEZA 4NC8A 2WC2A 1BMV2 5FJHA 4PFOA 3HD8B 1D3YA 5J1RA 3KVBA 2NVYJ 1IG0A 2D6KA 4LLGF 3W5NA 1UXZA 4S05A 4AEKA 5AC92 2XAJA 1WMXA 2JQ7A 1AR63 1JYXA 3KMHA 4Q0SA 3J4UH 4CO8A 2OU2A 4HOBA 2BZTA 2DVBA 3ZO0B 1QJX3 5LK5A 4BQ5A 1JZ7A 4AQ2A 1PZ8A 3VBRA 4W50A 2GMMA 1O7LA 2E7QA 1P4WA 2AC1A 2W47A 1REDA 5EJCA 4IQPA 2DA3A 1W4MA 4LBJA 3HNMA 2I5UA 5K8SA 3QU6A 4H4KC 4BMEA 1UMQA 4XORA 4HAMA 4AHWA 1GZ9A 2PG4A 3AG4H 2LD5A 3AZVA 3I2DA 4QU2A 4TLGA 1QOTA 1DGRM 3RMXA 3IDBB 2D5HA 2HLEA 5GALA 1CAVA 1F4AA 5HNFA 3J7NA 4XFFA 2WS92 3CDZB 4Y1UA 3JTHA 2CG4A 2BGCA 3I55I 2R32A 3D5RC 3OTFA 4YVSA 2VQCA 3MD2A 3FHZA 4CA0A 2DOEA 3WTUC 3RFRA 4TWTA 5A3PA 1IRGA 2IS2A 4I0BA 4AVTA 5BNPC 3MIDA 3U4XA 3CJQB 2UYAA 1CQ9A 2QUOA 4KBBA 4IRGA 3AP6A 2QKLB 2DCJA 4N7UA 2JMWA 4HKOA 3BN6A 1W8FA 1MBKA 3H36A 5FMOS 4D5CA 1PUEE 3FMGA 2J1RA 3HSRA 1D1CA 3G2BA 3JAMZ 3OBRA 1OKOA 3GCWA 4JGZC 4A3MJ 1C8M2 4UUSB 3WF3A 3ZR5A 2GP3A 4AEDA 1F31A 2ZNZA 4RL7A 2CW0F 4XTMA 2Q8EA 1IS6A 3MMYB 5DQ0A 1APNA 3TEYA 4BE1A 3MIHA 2FDIA 3H1MA 4DRRA 1J75A 3DPRB 3POYA 4BQWA 3V8JA 1C5HA 5EYYA 1YRNB 2TRTA 1R4NB 4ZKTB 3E1SA 4GKYA 4XR6A 1A8DA 1E5HA 1PO12 2EIMH 3FWEA 1A31A 3HOZJ 4JBAA 4RBOA 5GZFA 4DY3A 5IP6A 1HKTA 1JYNA 3IPVA 2TCTA 1DLCA 3A4UA 4Q27A 2A6EF 2VBPA 1HF0A 1VBE3 1KONA 3PTYA 3AFKA 2Y31A 4L0ZB 1BM9A 5CISA 2D1HA 4NIGA 3USUA 1YX5A 3P5JA 2F4LA 1B35A 5M3MJ 4H3WA 3NV4A 3B94A 4COWA 2XVLA 3WGHA 1UPIA 4O7XA 1KZHA 1SBDA 5IVVA 5G05L 3VDCA 4D5FA 3ELNA 5FYYA 1O6UA 1PHMA 1HXS3 1K78A 2GXGA 2E32A 3VLBB 1FOXA 3S7IA 1A36A 1HRV3 1G3WA 1R1A1 3S14J 3ABMH 3OYLA 3Q5FA 3A23A 2WFPA 1J0RA 1W06A 2ZHKA 3PLQA 4Q4Y3 4XN0A 2CW8A 1R49A 2WNUA 1WJ5A 2EFNA 2CSGA 2DCEA 3BTJA 4BISA 5J3LA 1HB1A 3OYWB 2L7FP 2RDSA 3PSIA 1XNAA 2VB6A 2E26A 1NG7A 5EGOA 1NA1C 4LHNA 2IVMA 5FK8A 1GQGA 4RB3C 5E79C 3MN2A 3BVCA 1UYYA 1S0CA 1ORKA 3H8RA 4EJWA 1PUFB 1RUH1 4EN6B 3A22A 3HEIA 3POBA 2Y0IA 4IEWA 2IZWA 4A3GJ 1PX3A 1ZBE2 1N75A 2ZMNA 2BGOA 1UOBA 2ISZA 3NRVA 2HQ5A 1Z0HA 1V6OA 4MADA 2QQBA 3AX4A 3BJOA 5IP7J 1PNFA 1CWPA 1IV6A 5JPNB 3ZN5A 2LRPA 1KQRA 3BOPA 4ZXEA 4AM3A 4M3CB 1GOHA 1S0JA 4RHV1 3VZKA 5ERLA 2YU1A 1X2MA 3B7MA 4P9LA 3W6KB 1WA4A 5DAQA 1IG3A 4A3CJ 1MIJA 4N53B 1I3AA 4RB1A 2WAAA 3S3MA 3PSFA 3DPRC 1MZBA 4L8QA 1BK1A 4A3LJ 5FY9A 5K5OA 1TNTA 1JZ6A 2F17A 3FXJA 3J80Z 2C24A 1UZYA 1PVEA 5DD8A 1GV2A 2DJNA 2RKHA 2OYZA 1WHUA 4P08A 2GC2A 2E33A 1GOGA 4DNCA 4HF2A 4L11A 4E6KG 3GTMJ 1XS9A 5K7PA 4B1LA 1ZZCA 1J7KA 4XUTA 4CDQB 2FCTA 4YG3A 4ATFA 3N05A 3WDYA 2E7AA 1SFXA 3O1TA 3S8PA 2XKOA 3H8XA 2EICA 1PVC3 3WW1A 1PIV1 2HWD1 1W6MA 4BS9A 2GALA 4XMIA 1PNGA 1KA8A 4AFDA 2Y34A 4E27A 2VCAA 4BXFA 1S0IA 3PU8A 3H9QA 4DOZA 3ZYJB 3M8EA 2DLLA 4IV3B 4YPJA 4ITVA 4HNUA 1S2KA 2PELA 3BQYA 1YW8A 3QH6A 2D98A 4JQFA 3BLYA 3AP9A 2XL9A 2Y6FA 3ACLA 4FPJA 4V2VA 1WW7A 3I3BA 4CDUA 3GFIA 1EA3A 1IGOA 1L3JA 1KU7A 2A6TA 3SH3A 4ZZDA 1F2NA 1XSDA 4XKVA 2PJRA 3BTIA 2JA5J 1EP0A 4AYUA 5DM7F 1CAWB 1X3WB 4D6QA 4U36A 4M71A 4JGYB 2EJRA 5T5LA 1AR61 1LAJA 1OFCX 3FMRA 4K3UA 4PI0A 2BU9A 1GSLA 5FZIA 4BKXA 1LGNA 2W1SA 1T98A 4D3WA 1WMDA 4AAXA 1LOGA 2L9NA 3U10A 5JR3A 4P5OA 4FFIA 5JR7B 5KR7A 3U37A 2L2OA 3IWFA 4UF0B 5FP9A 3RRDA 3TNQA 4Q5SF 4D1QA 3LGRA 3ABUA 3EYIA 4QB6A 2UWAA 1C0WA 4ESJA 2QJVA 4F52A 2K9QA 3ENRA 2DTRA 4LUMA 4P5HA 2IFRA 1VAMA 2LF8A 1TE1B 4CCLA 5LGTA 2V09A 3OS2A 2JG8B 4Y7NJ 1FOKA 4AQTA 1W6PB 3EXUA 1B09A 3DPUA 2M5WA 1Y7BA 4FPEA 3BPSA 2BVLA 3CHXA 3JQXA 4CP0A 2WDBA 5E1ZB 3POFA 3LSHA 3AP5A 4N43A 5F64A 3CCJI 2BPA2 3ZMUA 4N53C 5HS8A 3RJRA 1QHHD 1J59A 3CZ6A 5I8SA 5GZEA 2GNDA 1I50J 4EZ4A 3HRMA 1QIQA 5FY8A 2NNYA 1FX5A 3WF2A 3VBSB 4BWOA 3DBHB 2HDCA 3IDCB 2WV1A 3C7HA 2XXZA 1S7AA 4MQVA 1AXZA 5FXWA 1OCZH 1Q8SA 1RIOH 1G6NA 5JOZA 3FXMA 4PDWA 3EPZA 1RXGA 2ARBA 1L7RA 3URFA 5KCMA 1K79A 2HKOA 1MACA 4CDQC 3CUQA 1P4XA 3ZOBA 1DDNA 2ZGKA 2IGNA 1ODMA 4G9YA 2YR2A 3OD4A 1SG3A 3WQ7A 2FMDA 4IPAA 3USSA 5HV4A 5K0UB 5LHIA 5HXMA 1FTTA 1PM4A 1UF2C 3T3YA 4FXGB 3VBHA 3H35A 2XBO3 5FYCA 5FMOL 1GWLA 1SBEA 4AI9A 2BW3A 5JVTA 1NCRB 1IG7A 1YLLA 1YW9A 4IV3C 1YI7A 2BUKA 4BIOA 2ZMEB 2VMGA 5FLMJ 5FUPA 3ILFA 2JXAA 2EILH 3LL7A 2WO7A 3F72A 4DQAA 1UY3A 2LP0A 4PBOA 1HXS1 1V9U3 2ZEZA 3ABZA 4P55A 2LBFB 4JGYC 3NSTA 4C91A 1DPRA 2O0OA 2W39A 1VRH3 4G4FA 3HIFA 4CDXA 1HRV1 4V2GA 4LLFA 3VBOB 4CCCA 2QZ8A 1TL8A 5J96B 2R7DA 2F4PA 1JXSA 3OEBA 4KBZA 3HEFA 1KJRA 4W4ZA 2P3YA 2WRAA 4EV0A 3NAPA 2QQVA 2RS33 3ZFGA 2MW8A 1KQ0A 3OYAA 4X8NA 1AX2A 1CX1A 5CAZA 1AR82 5CVJA 3V7SA 3IWZA 1CESA 1ND2B 1M1EB 4IERA 1SANA 1DCSA 4XXAA 4BGDA 4RFRB 1CZSA 4A69C 4H14A 3VBUB 2FRHA 5FPBA 3NAUA 5GLTA 4AHXA 4X6AJ 1AKHA 1D2SA 4YVWA 5E8GA 2ZAAA 2E1NA 3ON7A 1TLHB 1YJ9I 5EEGA 4QQOA 4CZSA 2JG8C 3QD6A 1QU3A 1TQPA 2H94A 4J1WA 1ACCA 3FBMA 3HYIA 1DYPA 2Y60A 1UAAA 4EM2A 3D3AA 2MG4A 1ZGAA 2ZKNA 4EJVA 1R5GA 2G19A 2VMFA 3JQWA 3I3QA 1WCKA 1YFUA 1OJLA 4JP0A 4MGQA 1JZ2A 1SFPA 2HBTA 3HN1A 3ASIA 1ONAA 4M6XA 4GD4A 2WO2A 3VBSC 5BPDA 3GBWA 5J1YA 2ZS6B 2CNAA 2M7AA 5IFTA 2H8RA 3F9KA 4O9GA 1RUC1 2VE1A 4DXZA 1SMYF 4E4HA 1UKRA 1T0FC 2FMLA 1XB9A 1MBJA 5KC6A 3WTXC 2X05A 4KNCA 5J09A 1RUF2 3UGGA 4UFLA 3VD7A 4BY7J 5K0UC 4JC1A 2V1XA 2Q8DA 2E60A 4XFGA 3L2HA 4II3A 5T55A 3H3UA 1ZGJA 1NQDA 3TN93 4GO1A 1KDKA 1CAVB 2D97A 1NCRC 5BV6A 4I7HA 1R64A 3L00A 1YLFA 5DUXA 3FXRA 4BQ2A 2ZMEC 2PAEA 2VNVA 3WQ0A 2E7XA 1I5PA 5DEQA 2IVIB 1W9SA 2P3IA 1T08B 3K4CA 4QXBA 1U6GA 1FMD3 3ZOIA 4A0XA 1AX1A 1KYZA 2CGOA 4RA0A 5HLIA 4JAAA 3BPVA 2VOTA 3VKLA 5FYMA 1PVC1 1PMJX 3CZJA 5A1FA 3H0OA 3U4SA 3ZXAC 1TC3C 5C7GA 1XCVA 1QH6A 1I1SA 3H50A 1NXMA 4WVWA 3VBOC 3RQ4A 1K6YA 2YV8A 3MLJA 1WKMA 2XGDA 3J7LA 3GUDA 4Y22A 1YJLA 2IXKA 3PUFA 1NT0A 4ASMB 2BOIA 4LLLA 1VBA3 2CQQA 5A32A 2D7FA 5ANQA 1GUUA 1ND2C 3IZOA 1TBXA 2BVBA 2ZACA 4XEZA 1MZFA 1RUG1 5DN2A 4K9SA 5GP9A 3WP6A 3VBUC 2JPBA 5FYBA 3CF6E 4BJ0A 3RCOA 2DFIA 4OMDA 3IPVB 4Q4W1 3KCCA 4B3AA 4OHZA 5JI7A 2QFEA 4FISA 1G9FA 3QP6A 5DAPA 1J2XA 4XLAA 1KXGA 2FBHA 2V4VA 3HQUA 1B35B 3K4JA 2GBYA 3CCQI 1D8KA 4BPZA 1UG0A 2JKBA 2IXJA 4QPYA 4QMAA 1TWCJ 2UXNA 1IDZA 3DQVC 3S93A 4F7ZA 4UFHA 5A80A 4MOAA 2GOMA 2R7SA 1LE8A 3ZIWA 2PLV2 1TME2 4F91B 2KZGA 1OQDA 1GVJA 5E20A 1MDMA 2COMA 2EIJH 1SEUA 3WNKA 3CDLA 5LGUA 2NVXJ 1R22A 4YIIA 5LY2A 3PMEA 1OLMA 1BQPA 3H3LA 3F8FA 5CJ9A 3ABKH 3AZYA 2V1UA 1GFF2 1WCDJ 2ZZQA 2AZ5A 3ZQQA 1Q56A 3LWCA 2BEOA 2ZFUA 3DKWA 4DQ2A 1W2TA 3WNLA 2VMDA 4MHUA 3JRIA 4W6YA 4PJ0C 1YRZA 1JN2P 4JV4A 4MIMA 3SDBA 2EK5A 3TO7A 1YYNA 5IAVA 5H2FC 4JOMA 4I99C 5EGOB 5IVCA 2X85A 5FMDA 2FHRA 4CEYA 4WVZA 2JVGA 3E5XA 2L01A 3ZN1A 2LKPA 2ZC2A 3ZXDA 5J1XA 3S32A 2VZ3A 2LSOA 3AYCA 1LTEA 3K4DA 3WE2A 1UB9A 2KM2A 3WW3A 4MGKE 1MEC3 2J7MA 2Z79A 5DUWA 1HDPA 1SVLA 5FO7B 1EPWA 1D5YA 1UQXA 3V8KA 3CLQA 5KXEA 1TG7A 4FCYA 1OA4A 1GT0C 4OMCA 5FLJA 5TISC 3RMYA 5L3CA 2FX0A 1QJY2 2ZOEB 3NNLA 3K7AJ 1VPHA 2YBSA 2ESHA 1Q8QA 1JW6A 4LFUA 4FO9A 4LHSA 5J4YA 5FYVA 4QLCU 1K42A 2F5FA 1A6QA 5BNOB 2UWMA 5T5PA 4NIAA 1LNSA 1H30A 1D0ZA 1XSVA 2RS31 1S29A 3SZGA 1WLCA 3I4NJ 3KF5A 4OQ8A 1JT0A 1QWRA 2XUEA 3UKNA 1B35C 3ZP5A 2OBPA 3R4UA 4Q0PA 4I2OA 2OAZA 1G9DA 4L97A 1IRZA 4ON0A 1RMU2 5HLGA 2V9KA 1H9WA 2HWE3 4FQGA 2RS53 1QJU1 3ZFFA 2HYFA 2O1QA 3PL8A 4AVCA 2DPUA 3SHRA 3THCA 3ZMZA 3RS6A 4RFT0 4Y20A 1TW2A 3WNOA 3M3OA 2RNGA 3DEEA 3MIEA 2VONA 1W9TA 1E0EA 2P5KA 3ZM8A 3QODA 1E17A 4YGBA 4PJNA 3LA7A 2E2HJ 2FNAA 2VOOA 1UOFA 4IHSA 4LKDA 3FDYA 3PO2J 1YI9A 5FCCA 2QQOA 3GFJA 1MPXA 1VRBA 3CMEI 1URXA 2WN2A 1D0XA 1AWCA 4DUWA 3B93A 4G9SB 4D94A 3C3WA 5HBAA 1ZH5A 3GCMA 4UY8I 5B2GB 5BOXA 4MHGA 2HR3A 1V5GA 2R1BA 2A3XA 4ZONA 1FY7A 1AYM2 3W20A 2X6YA 4BK5A 4A42A 3NNJA 3ZSKA 2IGMA 3I54A 3LQCA 4UYBA 4OHVA 2OPKA 5T5JA 4YNIA 4UWDA 3LIHA 2PAMA 2MH2A 2DMUA 5EYXA 1QHDA 2GU9A 4RDUA 4FASD 4LK0F 1OURA 2YFZA 3U14A 4Q8KA 1V6JA 2CGNA 3RSNA 3VDDA 2O03A 1RUOA 1BCXA 2MEV3 3TN91 5FXVA 2DBIA 1UNBA 1TZLA 3T0BA 3B00A 2A5ZA 4NRQA 1X7NA 4KG8A 4UW3A 4GYGA 5FPXA 3MV01 3GZ5A 2ZGUA 1HLVA 3ACIA 1AR93 5I0DA 5GKAC 4II2A 2WNEA 2JA6J 3KP2A 4A3BJ 3KYCB 2H09A 1T6GC 3ACHA 5HNHA 2B7EA 4N43B 4YFNF 3Q0WA 1RUE1 4QDSA 2P6SA 1WBLA 1OOPB 3J7MA 2GZWA 2MD5A 2J42A 3EBRA 3FHIB 2ECCA 5JIAA 5F1RA 2MNGA 5BNOC 2P1BA 3QU3A 4INDA 1P7IA 1DP0A 2WZ8A 4M4RA 3LSRA 5L9RA 3KM5A 5M0TA 1FPN1 4FPGA 1Z7UA 2YDEA 1PGW1 1UW8A 5D5UB 4EJUA 2DFEA 3BTAA 3CNAA 2IFWA 3JRBA 4XIKA 4OOIA 3V4GA 3GTKJ 3UK9A 5LD2C 4FE7A 1GBGA 1KJLA 5LBQA 2DA4A 4M3CE 1IGNA 3ZSJA 3GTQJ 4CUGA 4Y1VA 4D0QA 2DFHA 5JVVA 1RETA 1N78A 2MPFA 4DGWB 3I97A 4MNUA 1R36A 1CZVA 4JK1X 1VZ0A 2DA5A 4KIFA 1ZBA3 1PP8F 1Z78A 4YFZA 3DXJF 2HYJA 5F3IA 5FZHA 1P8JA 4XOTA 1PO21 4ZY9A 4XKCA 5ACA3 1F15A 5L3BA 2B9SA 3WODF 1SZBA 2R063 3LNQA 4BQ3A 3O1MA 3LSJA 4DMIA 2ARCA 3ZLIA 4I0WB 2CUFA 4LORA 3B69A 3O7OA 1QU0A 3P1IA 5GLVA 1MMDA 2VLAA 3Q9OA 2FJ1A 3BJAA 4CDUC 4E8DA 4OIRF 4NWVA 3FXQA 4XFIA 5L9VA 4K6BA 3V0BA 2QKDA 4A4AA 2WT1A 1O4TA 1IS4A 3AKPA 4NMIA 1GDTA 2HJIA 5IP9J 1J84A 1ZRCA 1HC8A 2DCKA 3OBAA 1OA3A 4JDMA 3R4KA 1CR7A 2ETEA 1JOJA 5DZGA 1LKNA 2X4HA 2XV4S 3K2AA 3KLSA 4IXLA 3BCBA 3HRUA 4CDWB 4BNCA 5DYMA 5D5WB 3AJZA 1H2LA 1ETXA 2XF6A 2FE3A 1BIAA 3P9CA 5ICGA 2G9ZA 3IH3A 1VQ9I 1SFNA 3I59B 3AYDA 3W3CA 2WZR2 4NIIA 3I2FA 1N25A 1A04A 3ELKA 1AKHB 1NY72 4YVWB 4MGRA 1U9OA 2Y69H 5A7SA 4BXXJ 4AGGA 1WD4A 1WBFA 2GM4A 4A5NA 3G6EI 1SMTA 3HXLA 4Q4Y2 4CP9A 1S6LA 3HHHA 1CAXB 2VR4A 2L7ZA 4K2EA 4IETA 4N43C 2LALA 1OOPC 5LHGA 3WP3A 1WI9A 4OIOF 2W9XA 2A05A 3VOEA 3L9FA 1UZCA 1ENXA 4N4OB 3PQKA 2BXYA 4ZDLA 1F5TA 5FP4A 1ZARA 3M4OJ 5CEHA 2FNPA 3SC7X 2YGLA 2W85A 2Y6HA 3DBLB 3S2WA 1POQA 3VYUB 5CKQA 1M4WA 1HXDA 3LOIA 4PDWC 1YCIA 5FP3A 4ENNA 3CC4I 2R7TA 3MPBA 2BY1A 4UT5A 2PI0A 2X09A 3RI4A 4AD9A 5A3NA 1J1TA 1IXSB 3CUQC 2WNVA 2X5IA 1ON2A 3ZQIA 5B4XA 3JR9A 1VR3A 5FZAA 3JD73 1DQUA 3P6BA 4XDPA 1B9NA 5F2SA 2HI3A 3GFMA 4WM7A 2DURA 1DFQA 4IHXA 2E9QA 5CIRA 2ELKA 5JLXA 3LSGA 3VBHC 4EN7B 5J8FA 4QGNA 1NG6A 4O3MA 2GDFA 2UZKA 1W99A 3PJYA 4FTSA 1UU6A 2C9AA 4GXLA 3KZYA 2WB1A 2UWCA 2HZTA 2YS9A 2HQAA 4AWXB 4AHZA 1LPQA 4LULA 4TZDA 3S15J 4XONA 1JU4A 4L92A 2HWE1 4HZFA 4XF4A 2VUMJ 2YUEA 2EFPA 3KCYA 2OQ6A 3WHBA 1U0AA 4XJUA 2NS8A 1OA2A 4NVPA 4LOTA 2JDNA 2TDXA 3TEWA 5GZGA 2PJPA 4LKEA 2A6ZA 2FDGA 4D8MA 3KLOA 4P1WA 2DVGA 4Y22B 2RDQA 2VULA 4CDWC 4P9GA 4LBOA 5IPAA 4UBHA 3C2UA 5C8CA 1HQLA 3DKQA 5FXZA 2K27A 3VN4A 2QSFX 5FZ9A 5A1LA 4AVBA 2RE9A 3ASNH 1GANA 2YXSA 4P14A 1P9QC 1CPNA 5D4RA 4KITB 1B72B 4YM2A 1R7JA 2OPWA 3SJMA 2E35A 4W6XA 2L9LA 4CEWB 3CQOA 4HONA 2ATFA 1LFUP 2K40A 4YVWC 4RLQA 4XRMA 3FZVA 1W6OA 2WTEA 5AIQA 1LCLA 3IAQA 4GWIA 3BTCA 3PUAA 3P3PA 2ZX4A 4D7SA 5J1UA 2ZBKA 3AXEA 4CICA 4C8DA 3LFUA 4AFCA 3TEDA 2IP2A 5CKMA 1REPC 3EETA 5FD6A 3LPGA 4RM2A 3MHZA 1LE8B 5L7OA 2O8QA 2MEV1 2CSOA 4GB33 2IXHA 4DZJA 2OF7A 4XMYA 1MDMB 1G9CA 4HANA 3ML6A 1BXHA 2QQPA 5D2AA 3O6BB 1SBFA 1LJ7A 3MCZA 3IMMA 3OBZA 2WQ4A 3KCXA 3FMSA 5F0FA 1VI0A 4BQYA 2Z4FA 2RM22 3MUY1 3KZIC 3VPRA 1VJ2A 3TBIA 2OZUA 1J3PA 4ORFA 4XSXF 3OS0A 2W91A 1DGRA 1BI0A 3O0XA 4IESA 5FZBA 3O0VA 5IY5H 2E1CA 4EATA 3M8FA 5EP9A 3KP6A 3MKWB 1XC6A 2PHXA 3ZSLA 3G71I 2COBA 2HQNA 4RB0A 4CDGA 3SH4A 2PLYA 3HG9A 3KEOA 2IC1A 3R0JA 4BLJA 2RVCA 4GFBA 4JTOA 2I10A 2KIFA 1FV2A 1XTAA 2VL8A 1U5IA 1Z3XA 2R041 1WD3A 2XVCA 3UL2A 1E5SA 1QOOA 3SEZA 2XGXA 2CJJA 4NRPA 3PVNA 3WF1A 3FISA 5C9AA 4HLTA 5FGMA 1Z7LA 3BR6A 2XUMA 1BOAA 1SQ4A 4DFSA 1DGRN 4MH0E 5ACA1 4N9HA 4YEJA 3EUAA 3B9IA 1IC8A 4K7JA 3KV9A 2E63A 2Q1MA 2FQ4A 2R7QA 3FLPA 2ZNYA 5F2WA 3WTSC 2CWMA 4BJ6C 2QM3A 2PMZN 3DN7A 1BW6A 1L7QA 4BBRJ 1BBT3 1F35A 1COV2 4R79A 1DHKB 1QQIA 2W92A 2XBO2 5GPCA 3WHUA 4CEWC 1C8NA 1H6YA 1Y0NA 5IWFA 2BDRA 2PHDA 3KYDB 1LEMA 1HSTA 1VAVA 2K9ZA 5FWEA 1JUPA 3B02A 1WA6X 1H2KA 3AKTA 1JGGA 1HJFA 2A6WA 1ULDA 1L0OC 4L5EA 1MH3A 2PN6A 5ICEA 4Q1RA 2R3SA 3PJRA 2ID3A 2JEMA 2HXIA 3EMRA 4Y26A 1SEFA 2BWAA 3UGFA 1VRH2 2WZR1 5LZ6A 3T0DA 4IDZA 2W3JA 1R091 1U9NA 1FC3A 4TV7A 5FKOA 4COYA 3ME2A 2J5PA 5JXIA 4LB5A 3TGNA 3GTLJ 2JUGA 3HNYM 3ZXJA 4A5MA 1W6NB 3DBRB 4FI9A 3K77A 1VQNI 3MLLA 2NAZA 4ZZ8A 1JZ5A 1BW5A 3SXYA 2XHKA 1BC7C 2RMU3 1OF3A 2NS0A 4Q0QA 3FHNA 1LEAA 2JDYA 4C2UA 2DI3A 1X3ZB 2BYVE 1O4ZA 1FP2A 3OYDA 1DZRA 1EY2A 1RR8C 5HLHA 2Z1DA 2C26A 4QQHA 1DGWY 1O91A 1Z7S1 4L0YB