5DQ0A

Structure of human neuropilin-2 b1 domain with novel and unique zinc binding site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
157
Chain Sequence
CNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title To be published
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 39
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dq0A00
2VZTA 3CIHA 3THCA 1UY0A 3SKJE 3T0AA 1CZSA 2E33A 4XUPA 1GOGA 5C7GA 1H6YA 2QBXA 1J84A 2J1TA 1D7PM 4W4ZA 5F7UA 2WO2A 5HXMA 1JZ6A 1US3A 1JZ8A 2XOMA 1OT5A 4PF1A 3HOBA 4JHZA 1K3IA 3IDAA 2JKXA 3OGSA 3C7FA 5JUVA 3NJVA 4BXSV 3WF0A 2W1WA 3W5NA 3K4AA 5C70A 3ACHA 3VDCA 3LPGA 3NRUA 4QX2A 1JZ2A 3EYPA 4XUTA 1UY2A 4GWIA 2YG0A 2VZQA 2ID4A 4MADA 2W47A 3T2QA 1O8PA 5LA2A 2BGOA 3HJRA 4JKKA 3HPNA 3NQHA 4OMDA 3SEEA 3AC0A 2VO5A 4MO3M 3UESA 3WNLA 3T2PA 1JYWA 3BN6A 3U37A 1SHWB 1XNTA 3FHQA 4DXTA 2C26A 4M4RA 4XUQA 2V5DA 2W1QA 1W9SA 3WNKA 3VDBA 1PX3A 2Y6HA 3F2ZA 1JZ4A 2BBAA 4GZ9A 3D3AA 4E8DA 1O8SA 2VC9A 2L9LA 4QX3A 1NX9A 1EUUA 3T0DA 3UETA 3A21A 2VZ1A 2VJXA 2WAOA 4KMQA 5IJRA 3CMGA 4LHSA 4A42A 2VCCA 4D0QA 3HEIA 2VR4A 2Y6LA 1JU4A 3BGAA 4HG6B 2BGPA 1H6XA 2WZEA 3OGRA 1JZ3A 4XVHA 1JYXA 2WN2A 3VD9A 2WQ8A 3LEIA 3T2OA 2QQNA 1PX4A 3C7HA 4ET7A 3OBAA 4JX0A 3FL7A 5CYYA 2J1SA 4QX1A 5J1XA 3CDZB 4P5YA 2VZPA 4QAWA 4DEVA 1IQDC 3WF1A 1K45A 5IHRA 1UMIA 3FHAA 4ARYA 4A44A 3GXUA 4FI9A 2ZEWA 4CU6A 4JKMA 4CUAA 2VMFA 5IFTA 4RYDA 3WNMA 4QPWA 5DMYA 1WCQA 4A4AA 4ARXA 2V72A 4P00B 2WZ8A 3IAQA 2BZDA 5G05L 3T09A 4CU8A 2EICA 1L7RA 1L7QA 3I2KA 1UY4A 3P6BA 4IUGA 2VOTA 5IYYA 3NNGA 1UYYA 3C7OA 4UAPA 2WN3A 5G04L 1RYYA 4AAXA 2J1AA 1JHJA 3SKVA 4DEQA 4QDSA 1HN1A 2QQKA 1OD3A 2YC4A 3A7QA 4TXWA 4UI9L 4OYUA 2E31A 4PT6A 3I3BA 3WF2A 3DECA 5A1AA 3MV01 3DYOA 2J22A 4P08A 2VCBA 1R64A 3WEZA 3CZJA 5LCWL 4CVUA 2XONA 2QQIA 2DDUA 3OB8A 3CZUA 4OUEA 3WNNA 2W1UA 1UXZA 4QX0A 1JZ5A 3HNBM 2VZOA 1K42A 1OF4A 3FN9A 2J1RA 3T08A 2BERA 2Y8KA 3A22A 2W1SA 2YFUA 4DUXA 3CKHA 4LPLA 3WNPA 2DCKA 3I3DA 3I97A 4XUOA 2W87A 4PQQA 1UY1A 5EIYB 2W92A 3CQOA 2ZEYA 1OH4A 1UXXX 4YPJA 2JD9A 5JXHA 3I2JA 2C9KA 1ULPA 2VQTA 4QDQA 1TG7A 3ACFA 2VCAA 4A6OA 1TVGA 2J1EA 2DCJA 4JKLA 2YC2A 1OF3A 1SDDB 1UYZA 4QB6A 4DXRA 2VZSA 4W8JA 5LA1A 2QQLA 1LNSA 3OGVA 3VD7A 4M4PA 3EB7A 1UYXA 4MGQA 2VMDA 3ETPA 4LQRA 5JXGA 3LQCA 1UZ0A 3THDA 3LE0A 3MUY1 5JXJA 3PUHA 2VMEA 3ECQA 1GQPA 3IAPA 4LKSA 4XZUG 2ORZA 4A41A 4KI5M 1GU3A 1DYOA 4OMCA 5EJ1B 2B4KA 2ZEZA 1JI6A 1SG3A 4A45A 4XURA 1JYNA 5B4NA 1NAEA 4W50A 5HPOA 2WO3A 1ULOA 4L0PA 5FUIA 2Y6KA 2W5FA 4AG4A 4BK5A 1J83A 3ACIA 3WF3A 1XPWA 2V4VA 4ZXEA 1NKGA 4BK4A 1NUKA 2X09A 4BDVB 4A3ZA 1GUIA 2ZXQA 1MPXA 1PMJX 1K12A 3K4ZA 1KGYA 2YFZA 1CIYA 2R7EB 3GDBA 2W91A 2QQJA 3IB3A 4MOAA 3ABZA 3OG2A 5JXIA 2E26A 3WQBA 2KD7A 5DN2A 5LA0A 3W5MA 3GGLA 2W94A 2ZEXA 2C4XA 2QQMA 1W8NA 1F4HA 4KWUA 2Y6GA 3DYPA 2WDBA 5IFPA 2VL4A 2J7MA 1CZTA 3P1IA 1XC6A 3LPFA 1UMHA 1GMMA 2VM9A 2JE8A 2VMCA 2LW8A 2WUHA 4ZZ5A 4DUWA 4ZZ8A 5JR2A 1PMHX 2E32A 3I2IA 3K75B 2VZUA 5DPNA 2VZVA 2OKXA 1W8OA 1GNYA 3T0BA 2WABA 3GM8A 1GOFA 3HNYM 1W99A 3MO4A 4TTGA 2XHNA 2VTFA 2QQOA 5JMOA 3OEBA 3I3EA 3NJXA 3I2FA 1WKYA 2HLEA 3C8XA 3MV11 2J1UA 2W46A 3PUIA 2VZRA 4QB1A 4MGSA 2HYXA 4DXSA 2JDAA 3I2HA 1W9WA 4RN5A 3OEAA 3VD3A 3JXSA 4BJ0A 2ORXA 4CUCA 1P8JA 2RJ2A 2Y6JA 3HN3A 2W95A 1UX7A 3A23A 4Z2AA 1CX1A 3K77A 3VDAA 4DUVA 3C7GA 2LS6A 2W9XA 2W3JA 1YQ2A 1UY3A 2EIDA 1BHGA 3WF4A 5DQ0A 3HNMA 4CU7A 1W0NA 1O59A 1GOHA 4E8CA 4GWJA 2X10A 1XNAA 3C7EA 4UOJA 3LEKA 2VQUA 3UNPA 3IIIA 3J7HA 3ZM8A 3SEPA 2EIEA 3K46A 3I2GA 1JZ7A 1DP0A 5EJZB 2YB7A 4ZY9A 2Y64A 3VD5A 2B9VA 4P02B 5B4XA 4OZOA 3K4DA 3E1F1 2WO1A 4QDRA 2CDOA 4D8MA 3WSOA 2WAAA 5I0DA 3ACGA 5CZKA 1UWWA 3WNOA 2X05A 2Z4FA 1F4AA 1I5PA 1CZVA 2CDPA 3MUZ1 2J1VA 2RVAA 2WBKA 2WYSA 4XUNA 1JYVA 3MBWA 3LEGA 4QB2A 1JU3A 5C71A 3DYMA 2EIBA 1T2XA 2RV9A 2XQXA 1KEXA 4CUBA 2VZ3A 3VD4A 2PQSA 1EUTA 1DLCA 1W9TA 1US2A 4CU9A
chains in the Genus database with same CATH superfamily
4CDXB 3UGGA 3W9AA 4JTNA 1PK6B 4L92A 3CIHA 2HWE1 2HWB3 1MS1A 1UY0A 3SKJE 3AMNA 4GXLA 1CZSA 1DZRA 1O6UA 2ZHLA 4BA6A 2WIIB 1GOGA 3VN4A 4QM8A 2Q0AA 4LOSA 1S1AA 2WO2A 4N90A 1V6JA 1PGW1 3MYXA 3OJBA 5HV4A 4FPLA 1EV13 1XSQA 4WM7C 5KHIA 1RVF2 2WR9A 4WBBA 2XJSA 5FZ8A 4ISRA 1OOPB 2Z69A 5A7SA 2R073 1W28A 3ES1A 4JHZA 1LOBA 4XAAA 4XAEA 2GZWA 1YQ6A 1GZCA 3K48A 3N36A 5JUVA 2FDFA 1RUE3 2W1WA 1REFA 2BNNA 2BVBA 3BCWA 5JR7B 2R1DA 1QY4A 1X8MA 3VDCA 1JUIA 1WMEA 2G9ZA 2OZJA 2XKOA 3RZLA 4M0HA 1A34A 1RUC2 3NV1A 2DU1A 4QX2A 3NL1A 5HV0A 3RZHA 5CNAA 3ZLIA 1FAYA 2W0XA 4GWIA 3VBSC 1D4M3 2IVIB 5FUPA 1MEC1 2GP5A 1I9RA 5C4WB 1NXMA 1UZVA 2RS12 1ND2C 4Q4W3 3WCRA 1WW4A 3WXPA 1LENA 2R6QA 1H2KA 3BPSA 3R4SA 5LA2A 3HJRA 1CIWA 2AENA 1ALYA 4LKFA 4XJAA 1PNFA 2JX9A 2OUHA 1X33A 2RS32 3H7JA 4FQ4A 4EWEA 1C8NA 1W2NA 3T2PA 1W6PB 1SHWB 1OI6A 1PNGA 5FYYA 5KC5A 3H8UA 1BEV3 2UU8A 2VQAA 4AFAA 3O7OA 1EAH2 2V5DA 1FMD1 3T4HB 4NWVA 3VDBA 5KXEA 1TMF2 1PX3A 4BOWA 2HWF2 4GZ9A 2IVJA 2OQ6A 4RQPC 4RR3B 1KD7A 2CTVA 5DDJ2 5JZGB 4D3WA 3ZN5A 5FZMA 3LFIA 3LIHA 4OCTA 5BV6A 2VD7A 3UETA 5FKBA 4RHV1 4LOTA 5LRSA 4E4ZA 2WAOA 4GB33 3GBWA 3GCXA 4CSWA 5FP3A 4XJWA 1N1YA 3CMGA 3JD72 4A42A 2VCCA 2GC2A 4RD7A 3HEIA 4KBBA 4ONUA 1COV2 2GNDA 1SLLA 2D43A 1DQ0A 1NLQA 3S5AA 4W6WA 1WA6X 5FZOA 2A6VA 4AVVA 4KQ7A 3QACA 1AR91 1CWPA 1NG0A 4QPGA 4XXPA 4XVHA 1JYXA 1YXWA 3I59A 3VD9A 4BH9A 3G6JB 2WQ8A 3FHIB 4EV0A 1RVF3 1W8WA 3AFKA 2JDUA 1UNBA 4DZGA 2UY8A 4QKDA 5FY7A 1F15A 1PIV2 4XFFA 3RWNA 3TOJA 1BCXA 2A6ZA 4XJ8A 4XCBA 4EN0A 5FYBA 1FXZA 3AM2A 4CCCA 2W52A 4YVSA 4LKDA 1IS5A 1ZRIA 3GF6A 2WA3A 2WFF1 3M3CA 4E4DX 4D6QA 5T5PA 4IE0A 3ZR5A 2KR2A 2R041 4LUMA 4DEVA 5JAXA 2XWJB 3ACLA 2FQPA 3TN92 1JTZX 4Q26A 5D8AB 5IHRA 2JE9A 2BYVE 3LWCA 3ZMOA 3RG0A 2IXHA 1QOSA 5A3PA 2GSYA 2ZGMA 3DF0A 5CB7A 5C5UA 5IVYA 2XDVA 5FXVA 1MEC3 2VAUA 3ME2A 4IEXA 3V56A 4NHYA 4FI9A 2DV9A 1QKQA 2ZEWA 2QUOA 3OD0A 4BYYA 4CUAA 1I6XA 4O7XA 4C1WA 3S7IA 2ZZQA 3AYDA 2RDQA 4OI1A 3PU8A 3NKGA 3WNMA 2NMNA 4QXKA 4Y33A 4YZ1A 3RZMA 3IN9A 1UOGA 1R1A3 4EN6B 2DUQA 1W9FA 3M8LA 1ONAA 2BZDA 4QPGB 4HN1A 3SMHA 4AOCA 2EF6A 2RDSA 2LRPA 4M00A 1PGW2 2VECA 4XMAA 2BRTA 1V0AA 1AX1A 1XNKA 3WNXA 5KHGA 3NV2A 2XUEA 4LBOA 4QKFA 4LTAA 3P5BA 2E7TA 1RINA 3AYCA 3ZMNA 2VOTA 3VLBB 3O12A 1DQ5A 3AMQA 2PYTA 3L2YA 4NAOA 3U75A 1NA1A 2WN3A 1W8ZA 1COV1 3NNFA 1D4VB 4AAXA 1WUVA 2ZX0A 4GJYA 4YVSB 3JCIA 5CISA 2WT0A 3WDWA 1J3RA 1CAXB 4KWJA 4YGCA 3WD5A 1AR62 5FZFA 4N9IA 1OD3A 3LIGA 2F4PA 3CBNA 2XHKA 3IKWA 1QOOA 5FREA 5A3MA 4AFBA 2VG9A 1QJY3 4RGKA 5F8PA 1LODA 3W59A 1H2MA 1MZ5A 2E31A 4OYUA 2QQUA 1VAKA 3VBOA 3H3ZA 2YGMA 2A1XA 3MV01 3K2OA 1YEWA 2RR11 4J1WA 4P08A 1D0HA 4EZHA 2MNGA 4XFIA 3MZHA 2BBVA 3AXEA 5IVFA 5IUQA 5LCWL 4XDQA 3N35A 5A6QA 2H6BA 2GU9A 1DU3D 2XONA 1KXGA 3VDDB 4CCLA 1GR3A 4Y20A 4FFFA 3U10A 3ON7A 4Y5SA 2NPIA 5D8AC 1K42A 1OXCA 3JBG3 3K51A 1DZTA 2J1RA 1R092 2XJPA 4K21A 5FK7A 1BEV2 2Q8DA 2NLRA 2DFCA 3T08A 2CWSA 5T5OA 4AQTA 2XBO2 1GKBA 3B93A 2VW1A 4DOUA 1DG6A 2QQWA 1QIQA 2YFUA 4QU2A 3CKHA 4P14A 3WNPA 4HVQA 3H8XA 4H55A 4ASKA 3BALA 1X7NA 5L9VA 2JG9A 1WMXA 4P9JA 3K3NA 1KFUL 4QX7A 5FZHA 4AFDA 2W92A 1GBGA 4EROA 2HJIA 4IQPA 4K8FA 1H9WA 3IIAA 1YQ8A 5J98B 4QKBA 1GFF2 3H8OA 1ACCA 1VAVA 3CF6E 4FO9A 4A7YA 2RS13 2JD9A 1NZCA 1IPJA 3I2JA 2QE3A 1QQP2 5F32A 2VQTA 3GJBA 2XLFA 3VV1A 1WGPA 3HWJA 1ND2B 3BB6A 4A6OA 4MXVA 3ZFEA 2HWC3 2B5HA 4V2WA 4DIQA 5CFDC 1UZWA 1SEFA 2BP6A 2Q8OA 2I07B 2W2IA 4FOVA 4MH0E 5CG8A 4QB6A 2IUWA 2ZJCA 4K9SA 5ERLA 4XHXA 2WNVC 1UMZA 3ETPA 2XWBB 3J8F3 3LQCA 1RC6A 3GJAA 4WVVA 3LE0A 3THDA 3WQ1A 1K5MA 3R05A 4H2AA 3PL0A 5JXJA 1CAUA 3PUHA 4PIYA 4IEQA 3OPWA 3VKLA 2ZPXA 4AZZA 2F6BA 3BTAA 2Z5WA 5F5CA 2ZZJA 2JEMA 3IAPA 1V6MA 4YWAA 1QJX3 1XYOA 1GICA 4L8QA 3SC7X 5BNPC 1GU3A 1DYOA 3NSTA 5E16A 3N9QA 4PQ9A 4A2UA 4BXFA 1UAIA 1DYKA 5FY9A 5EPAA 3EJKA 2B4KA 4RFT0 4AHYA 2ZEZA 3UK9A 1HRI1 3ZO0B 1RUH3 2OUJA 3POEA 4Q4V1 3LDKA 4A45A 4R9DA 4Z1VA 5B4NA 2V09A 1NAEA 5FOBB 4IV1A 1BMV1 5HCAA 1W6OB 3U07A 4HL0A 3SH3A 2K0GA 1ULOA 3ZXKA 2AACA 5FXXA 2P2KA 1MS9A 1PO23 1OFNA 2WFF2 5EWSA 4CXXA 4MG2A 4D7YA 4AL9A 5KC6A 3ZN6B 3ITQA 3SISA 4S2HA 1E5RA 2EXKA 2W5FA 1EPWA 1PO21 1FYUA 2JXAA 4Y26A 4FPKA 1RUI1 4BK5A 2TBVA 1NQDA 5CEHA 4AVBA 3WF3A 1OH3A 2I45A 3KCXA 2ARCA 1RUD3 1OQ1A 1YFYA 2JDZA 4DQAA 1S0BA 3UYJA 3QBQA 2B42B 3B9CA 1W0OA 1N3QA 2OQ7A 2A3YA 2ZXQA 4PIXA 4A3ZA 1MPXA 3O1PA 1LGCA 4LULA 2XJTA 3K4ZA 4F8AA 1AR92 1KGYA 2WZR2 2Q4SA 2QQJA 3ZSEA 1FV2A 4FTEA 1B09A 3BIEA 4K1ZA 1PZ8A 5FYVA 2B7YA 1RUF3 4WVZA 5FXWA 5LA0A 1H8VA 3GZAA 3KM5A 3W5MA 3GGLA 2WS91 5FKCA 3I3QA 4QPIC 5FIXA 2W94A 1I5ZA 2R042 3E97A 2C4XA 5FLHA 1UOJA 3ZXEA 3T1LA 3ZDVA 5C9AC 1LCLA 2XR4A 5ACA3 4I2OA 4AI3A 2Y6GA 3H50A 4XF0A 5LY1A 2HWB1 3PU3A 5IFPA 4XQWA 2J7MA 4IV1B 4NPRA 3LPFA 5GZEA 1UMHA 3MPBA 3T30A 1GMMA 4Q0PA 3SCFA 1ZA4A 3CJXA 5FZGA 1AXZA 1Q56A 5ISLA 4Q27A 3ZYRA 3HIFA 3QOPA 1LKNA 1S0DA 1W90A 3P3NA 4N9HA 5LB6A 4GH4B 1BLZA 4LO6B 3I2IA 3PVOA 3WHTA 2VZUA 5DPNA 4KU7A 4SLIA 1GZ9A 2X5IC 4JAAA 5F39A 2VUAA 2GP3A 5FMOS 1AL21 4LBKA 1QXPA 1YI7A 1GOFA 4NVPA 2RS52 1GQGA 3ILRA 4B29A 1W99A 5AFBA 3T1MA 4JDOA 2RS11 3IZOA 2VTFA 4WV8A 4AHZA 3M3IA 5C9AB 5C6CA 1LTEA 2GMMA 2Z42A 2PHLA 4CCEA 1RXFA 5CA6A 2JD4A 4B1MA 1WKYA 5A7WB 2RM21 3VKNA 1QEXA 2EAKA 1W8FA 3WDTA 2VVFA 4RSUA 3MIGA 3AP9A 4R9CA 3PJYA 5FR3A 1W9WA 4I02A 4RN5A 4V1PA 4AEDC 4B4RA 1LAJA 2WZR3 3OEAA 1TMF1 1POQA 1H1AA 3JXSA 5FV3A 4YARA 1SZBA 1WLDA 3PLQA 1PK6C 4CUCA 1J3QA 1P8JA 2ZHMA 2SBAA 3WINE 4CDQA 5C5TA 2Y6JA 2YHJA 4Q4X3 3ELNA 3JUUA 1JXNA 4N43C 2W95A 1OBNA 1UX7A 1CX1A 2WL1A 3PUSA 4W65A 5FUNA 3C7GA 3KGZA 4NO4A 3WP3A 1I3HA 2LS6A 1LU2A 3T3YA 3EXUA 4LORA 3VBFC 1LOFC 1BHGA 1U5XA 4FSJA 3JQWA 2BV4A 5CKQA 1FX5A 3HNMA 3N9OA 4FOYA 4CU7A 2E7QA 3KHCA 5BNOC 1NCQA 4Q0VA 3JD71 3SH4A 4E8CA 2Y0IA 3LSEA 5FZCA 4FFHA 1COV3 1Z7S1 1E5IA 1SACA 1ENXA 1RUJ1 3C7EA 4LLOA 1WMDA 4MVTA 1QNWA 4AQ2A 2VQUA 2YU2A 4I3PA 5EP9A 3LSDA 3OUHA 2FHRA 1RUH2 3AL6A 3J7HA 3VGIA 2O1QA 3H7YA 2R062 3I2GA 4LBMA 4M0NA 1Y4WA 2XVLA 1DP0A 4Y22B 2WNUA 3IMMA 2G4IA 2Y64A 5EYYA 3L2HA 1L3JA 2W08A 1IOAA 2GH8A 3POYA 2BGCA 3QLQA 4HK9A 3POGA 2XG3A 2WO1A 4JGZC 3AMPA 4OZOA 4S2FA 4W6XA 5BY5A 3WSOA 5ACA1 4XPVA 1PO22 4GH4C 5A32B 2WAAA 5DDJ3 3ACGA 5FY5A 3ZYBA 4N53B 1EY2A 2Q8CA 4AHXA 2ATFA 2JIJA 1XYNA 2X05A 4N8MA 1G9DA 1G9BA 4GWNA 2CDPA 2J1VA 4LO8A 4E27A 3E5XA 1JYVA 1N3PA 4Y5TA 4K7JA 4UFJA 5C4WA 2A6YA 2UWAA 1MACA 1UIJA 3OYWA 3Q8FA 3VL9A 5BNOB 1D2SA 1YIPA 1JU3A 4XF3A 2PXJA 3VHRA 2HEYF 2EIBA 4TSVA 4GIQA 3FE5A 3OF1A 1CPMA 2XQXA 1KEXA 2PFWA 4CUBA 2CSGA 4YG6A 2P3JA 2ZGLA 3LCPA 1N47A 4ORFA 1RMU2 4H14A 3VD4A 4ASLA 1QJU1 1AYM2 5IVVA 4XHBA 1GSLA 4K6BA 1US2A 4UYBA 3IBMA 4AEMA 1JZ7A 3WX5A 1VRBA 1ULDA 4BISA 1QWRA 3THCA 1KITA 2GN7A 3VKOA 1SMVA 2E33A 4O65A 3VDDC 3WR0A 2BVVA 3J7LA 4YW1A 5C7GA 5A3TA 4GULA 1JW6A 2J1TA 4Y22A 3VBOB 5K8SA 5HXMA 4R9BA 1OA3A 4HMZA 3VBFB 1JZ8A 1RJ7A 1LESA 5CAZA 2FDGA 2XOMA 1H1IA 3KZ4C 4IW3A 5FY4A 1F5FA 4QMAA 1HQWA 3LDRA 5A6ZA 4FTBA 1F2NA 2JDYA 3LA2A 2XB6C 3PMEA 3BOWA 2B39A 2Q5TA 3WF0A 2O0OA 1B35A 2O8QA 3W5NA 4FT8A 3LA3A 1XU1A 1H9PA 1XU2A 3AZYA 3LPGA 2Q8EA 3H0OA 1PVC2 3H3UA 4NIDA 3NRUA 3IDCB 5FPAA 4S2DA 1JZ2A 3EYPA 2HBTA 4MGKE 2YV8A 3WY6A 4UBHA 5IWFA 5GJ6A 2YG0A 1X82A 4ZPIA 4X8NA 1QH7A 2VZQA 1Y3TA 3CL1A 2EXJA 5A3UA 1ZRRA 2N7GA 3JBG2 4UW5A 3T2QA 3DPRC 4PCRA 2JG9B 4LA2A 5FP7A 1XE0A 3HPNA 3CEWA 3NQHA 1HV0A 4OMDA 3A0KA 3B9IA 4PLOA 5L9BA 4BE3A 3U4XA 3TEYA 3KT7A 3GHNA 4XQDA 3HT2A 3KT4A 2WLPA 3MIFA 4IGPA 1WW6A 1LHUA 1OVPA 3BN6A 1UCXA 1ZZ7A 3SXWA 3RI9A 1S2BA 1XNTA 3FHQA 5FWEA 3UJQA 2H0BA 4QQHA 4XUQA 4L97A 5FP9A 3BU0A 1RITA 1CJDA 2W1QA 1W9SA 3M7AA 1PIV1 2JB4A 1DFQA 1UD1A 3N7MA 1EAH1 2Y6HA 4FPOB 4MXWB 1NCRA 5I0TA 1V6LA 3N7KA 3VZJA 5I0SA 4PDWA 1NX9A 4QX3A 1AF9A 1G9FA 1XBFA 5FZBA 2B8MA 2D6PA 2R0HA 2KM2A 4HOOA 3SCHA 2RM22 2A3WA 5I8YA 2K9ZA 2RMU1 3OCPA 3SLIA 3MHZA 3DKQA 1GP4A 5CU1A 5A7WA 3D4KA 2JB8A 4BPZA 2ET1A 4AVTA 4DS0A 1PM7A 5BNNC 2Y6LA 2BPA2 1S0EA 4XE9A 1N3OA 2TEPA 3D0SA 5DUVA 5T50A 1UPSA 1WW5A 4XDPA 4YNIA 4DPNA 1HRV2 2IWGB 1WCKA 2AGSA 3JB8A 1VALA 2AYHA 1ND3C 2VOWA 2ZA9A 1HW5A 2QKDA 2EAAA 2B9UA 1HB4A 3OUJA 1CAVA 1H2LA 1W8UA 3T2OA 2VNVA 3ZSJA 5J7MA 2DFBA 3AYAA 3F95A 4AAPA 3DXTA 2HWF1 4QXBA 4QHOA 1AYN1 1UU4A 4UXAA 1H8TB 2ZMKA 1SLCA 1MQTC 5CYYA 4C91A 4NE9A 1WCSA 4DY3A 3J9SA 4R52A 4QX1A 4CPBD 2GAUA 4XEZA 1CVNA 1OHFA 1SBFA 2AEYA 3CDZB 2IXCA 1OLRA 4HONA 1W3VA 1YO8A 4OLLA 3KT1A 1XXNA 1UOFA 1VLNA 1WA4A 3SHRA 1GYKA 1IQDC 1T6GC 2ZX2A 5FLJA 5AC93 1MS5A 5JZGA 3UV9A 2ZGTA 3FMGA 1JS9A 2R043 2VBPA 4JV4A 4OHWA 4ISQA 3FHAA 2O8OA 3KV9A 1D4M1 1DGWA 1ND3B 4Q2FA 5ANQA 1HQNA 1XOYA 2WWSA 2ET7A 4GAZA 4B7KA 1TME3 1REEA 1LGNA 2JDHA 4N53A 1R1A1 1DF0A 1W06A 4QPWA 4DNYA 5FQ0B 1ZBE2 5K0UC 1EV11 4AFCA 2IFRA 4P00B 1A6CA 1RIRA 3N9MA 2ZBJA 4JRLA 5DZEA 3T09A 2EICA 1RUD2 1DQ1A 1R081 3I59B 4UF0A 4Y5Z0 3RQ0A 3MIDA 5GLUA 2E53A 1L7RA 3I8TA 3TWIA 1RUI3 4DMIA 1L7QA 3I2KA 4OHVA 3VBHA 4Y1XA 3P6BA 5F1RA 3V0BA 4GKYA 4IUGA 4PI0A 5IYYA 2CGPA 4D7TA 1UYYA 3DKWA 2WNEA 3FC0A 5KXDA 1X8EA 1HRV3 2XXZA 5DABA 1VP6A 1PO12 4QXCA 1OKQA 2XJUA 1RYYA 4E4SA 5A3LA 1JHJA 3SKVA 2VMIA 5DAVA 5C8CA 4JGYA 4EJRA 2NZ9A 4QDSA 3V65A 5BNQA 2RS33 4XDOA 1HN1A 3ZX7A 1CD3G 2FBEA 4Q4V3 2YC4A 3WP5A 5IK7A 4LJHA 2ZCWA 2RR13 4Q4W2 4PT6A 3KS7A 3I2DA 3WF2A 2ETEA 4XF4A 4CEYC 2J22A 2VUDA 2WWJA 1SPPB 4R9AA 4URAA 5FZLA 1OOPA 5A1LA 1QGLA 3RSJA 4XBLA 1RUI2 1W0PA 4CDXC 4YW7A 1WBLA 5A3WA 2A71A 3ZFGA 4AXOA 3G7DA 1NLSA 5LA9A 2MHFA 1KDKA 4AVCA 3WVJA 1Q5OA 3WNNA 5IK8A 1KRIA 3FN9A 3R4DB 1HB1A 5FMDA 2RDRA 4JZRA 2PHFA 2A75A 1AYM3 3MLJA 3Q8BA 3RRDA 1UU5A 1W2TA 4KG8A 2DCKA 1QMJA 4Y4YA 3WQ7A 2VUJA 3POBA 3VBHB 3I97A 3ZYPA 4YFZA 3PJQA 4WZCA 3V0BB 5A6YA 5EIYB 5A7QA 3WZ1A 3WUCA 5DZGA 3WW3A 3CQOA 1Y7BA 3TEWA 2QQPA 1Z7S2 2IZWA 4GMP1 3BKZA 3WDYA 1OH4A 4P9YA 1UU6A 2JE7A 1RHI1 1DBNA 4Q1PA 4AI9A 1GNZA 4ZXKA 1PVC3 4JVAA 4CEWC 1JYIA 4XC9A 4CYDA 3VBUC 3M1HA 4AI1A 1Y43B 2V5YA 4LHLA 2Z79A 1V6IA 5CFCA 2FMYA 4UW4A 2AC1A 4KGGA 2CYFA 3HAGA 2ZACA 2VW0A 4L11A 3SCGA 4BIFA 1OF3A 1AVBA 1HQLA 1NY71 1AHSA 1UYZA 2Q1ZB 5C3QA 5C3RA 5CADA 4W8JA 4JTOA 1LHNA 5JLVA 3OGVA 1SPPA 2MEV3 5FZ1A 1V9U1 4YG3A 4MGQA 4QHZA 1VMHA 2P17A 3AB0A 1RUOA 5T3NA 2E9QA 1POV1 1SQ4A 4BQ4A 3MUY1 4CDWB 3GZEA 2YPDA 1RHI2 2JENA 3ZYGA 5C3OA 3W21A 3J26N 5ABJB 1MQTB 1W6NB 4XFGA 4YM1A 1HRV1 3OSDA 3JU9A 4LBJA 4LKEA 4XZUG 3FLTA 3OYWB 4KI5M 5HCHA 2W39A 1DGWX 4AI8A 1TME2 4OMCA 4LO4B 3AVRA 3AYEA 3NAPC 4NIGA 2VE1A 3ZPOA 1JI6A 1HJGA 2AR6A 4TN7A 4XURA 2QZ3A 4J25A 1AR63 5JVVA 4W50A 5FXZA 4J1XA 4UW6A 3ZYJB 4C8DA 1TEIA 1SBEA 2RMU2 3KF5A 2GC1A 2XL7A 4K20A 3E5QA 2TNFA 3E5UA 4NIHA 2IC1A 1Q43A 1HIXA 4I01A 4MGYE 3POSA 4CXWA 4LBQD 3VBSA 2XGXA 4Y1YA 3H3LA 1RUD1 1PGL2 1V6KA 5FBJA 4CCKA 1OA4A 1ND2A 2ERFA 3S30A 5L7OC 2DURA 3ACIA 3MFCA 1QDCA 2GNTA 4WM8B 4IXLA 4ZXEA 2UURA 1NKGA 5A7PA 1YC61 2I74A 1E57A 2HWB2 2JKBA 2Y38A 2C5DA 4LR4A 2HWD2 3N7JA 5DUXA 4BDVB 4XW3A 1PMJX 1JH5A 3USUA 4CE8A 2X53S 4V2VA 4XOGA 3MW3A 5DAWA 1AR73 1CIYA 1W6QB 1POV0 1HXS3 2R063 3GDBA 4XFCA 4MOAA 4AVAA 3ABZA 3FFQA 2FDKA 2IXKA 4D7SA 4QD2A 4DY5A 1BMV2 4EN8B 5C8WA 2WQ4A 1PZ7A 5IT6A 3MPPG 3BUCA 1IGOA 1OURA 1HRI2 1FOD3 2E26A 1SFYA 3OUIA 1HXS2 1SFNA 2ADEA 3S5QA 5A6XA 4FPCA 4XACA 1LOGA 5FLIA 2ZKLA 3VZKA 1IKPA 4JHTA 2ZEXA 5A80A 4O61A 3B01A 1DQ6A 4H7LA 4RHV2 3RZJA 4XJUA 3RFRA 1NQJA 2CHHA 3VUOA 1YFUA 4QM9A 2OS2A 1Q8PA 3DXUA 5GKAC 4LXLA 1AX0A 1U5YA 3ZXLA 1R082 1L7LA 2D44A 2VNRA 4ITCA 4RR3C 4RQPB 4WM8C 4QX5A 2WRAA 4A3XA 1VBB3 5FPUA 2Y6FA 1H2NA 4WVWA 2VMCA 5KXCA 4K3UA 2GC0A 5FZ6A 2DCZA 3TEZA 5FP4A 2YGLA 3ALQA 1H0BA 4PJYA 4NIIA 1WLCA 1QU0A 2VZVA 3BU7A 4QGNA 4CP2A 1GNYA 5FYCA 2WS92 4EYUA 1X9PA 3GM8A 3IWZA 1ZZ8A 4LE4A 4URTA 3WHUA 2D6NA 3AJYA 3HT1A 2RS51 4YSFA 4LBQB 1AXKA 3OEBA 4AEKA 5GLVA 5AC91 1R1ZA 1W8HA 5L19A 4GD4A 1UOBA 3EBRA 5ANNA 2XH6A 3THTA 1GWMA 3C8XA 5FOJB 3BPZA 2WZPP 1BBT1 3S6PA 4YLZA 1IKQA 2VZRA 5BUVA 1WMFA 4QB1A 4TYSA 4WZFA 2HYXA 4IEOA 2JDKA 1AR83 1UKGA 2JDAA 4I0WB 5AVAA 5L7OB 3BI3A 1TQ5A 5F6KA 1JUHA 4KWLA 3WG2A 4G4FA 3WW1A 1R091 4FFGA 5FJHA 1ZZ9A 2XKPA 1BKZA 1DLLA 5A33A 4MV2A 4E4HA 3HN3A 1TMF3 4O9GA 2JWPA 1TNRA 3THPA 4LK7A 3A23A 4Z2AA 1WD3A 3K77A 1JN2P 1LEDA 2ENRA 5ACA2 3BTYA 1QOTA 1LU1A 4XQ4A 3WF4A 1YYNA 2AEZA 1UX6A 2D3PA 4PBOA 2WNVB 5J96B 1W0NA 1QXJA 3VBRA 5JMCA 1VMFA 1O59A 1GOHA 3T2TA 4H3WA 2R061 1TZOA 4GWJA 2EXHA 3ZXJA 3MLLA 4YW6A 5C3SA 2RG4A 4I30A 1QJEA 1EPZA 1XYPA 1RUJ2 5F3IA 3O5SA 3SEPA 4BMBA 3CJIB 2GDFA 1IS4A 1WWYA 5BNPB 3LDBA 3VD5A 2Y60A 4Z8BA 1BVVA 1NA1C 5B4XA 4LEJA 4IDZA 4QDRA 5FYIA 4D8MA 5KR7A 2A7AA 1C5IA 4MYEA 2YUEA 2P6HA 3DV8A 1V9U2 2P4EA 4R4ZA 3GBGA 1J1LA 4YZ3A 3RMXA 3ZPYA 1G9CA 1H4GA 2DTYA 4HN0A 5LATA 4QGLA 4YYOA 2I2SA 1QJZA 1LGBA 2R072 2DTWA 2PMWB 3ES4A 3MIEA 2IXJA 3RWKX 3U11A 1W6NA 1UZZA 2Z4FA 5EJ3A 4A7ZA 3AP5A 1CZVA 3MUZ1 2WYSA 5F3GA 3LEGA 4F83A 4LUKA 5H9SA 1SDWA 1ASJ2 5FO7B 4QB2A 4XYXA 4PI2A 1UZYA 4PLNA 3I3MA 3DYMA 4UF0B 4QPYA 4GB31 3LF7A 1MVQA 1GWLA 2ZGNA 4INDA 1T2XA 4FCAA 5FWJA 1MZEA 1QJU3 3BIWE 1Y9GA 1MS8A 1ULCA 1Z78A 2X8KA 3PMSA 3ROUA 5IVBA 1RUF1 1GANA 2RJKA 4LHNA 4OUMA 1AR82 3N7LA 4CP0A 1BJQA 1OLME 5K9YA 1DGLA 2PQSA 5J36A 2NM1A 4M3CE 1DZQA 4MGTA 3UJOA 5C8CB 4M01A 2CGNA 2IXLA 2QZ2A 2UYBA 1S0GA 4XBNA 2VZTA 2VCMA 2A73B 4RGGA 3TNPB 1AZDA 3T0AA 2VMHA 4XUPA 1ZX5A 5HCFA 1W2UA 4TWTA 2JG9C 1H6YA 4XF1A 2QBXA 3POWA 1XB9A 5EFUA 4QQLA 2ADDA 5GALA 5T54A 5F7UA 3BTXA 4OHYA 1O91A 2VH9A 3T4VA 4EWDA 3M4FA 3LOBA 3R0RA 3MI8A 4BLJA 1JZ6A 1US3A 4MHUA 4HVOA 1VAMA 1OSGA 4AEJA 1RB8G 1OT5A 3OPZA 4YW3A 3AFGA 3HOBA 2XJVA 5HXVA 1K3IA 5H9RA 2SLIA 3IDAA 3UT0A 2JKXA 3V0AB 1QJY2 5A32A 3NJVA 4KWKA 4BXSV 4IV3C 4JC1A 4XTPA 2JG8A 2VULA 5C70A 3ZFEC 3LA7A 3ACHA 4OI0A 1H8TC 1NYWA 4BQ3A 2DCTA 4MGIE 1FPN1 2OPKA 5FZDA 1ZZCA 1RUG3 1UY2A 4YZ2A 4META 4CEYB 5AC92 1U12A 4FTSA 1AR61 2HKXA 2JDMA 3OPTA 1GP5A 3FZ3A 3WG4A 5FYHA 4NUBA 2W47A 1OLMA 5CKMA 2XMLA 1CAVB 4B4QA 2BGOA 3IDEA 4NPMA 5IVCA 3AKPA 4JKKA 2IFWA 2ZHKA 1X36A 2K2SA 4KU8A 4LBLA 5FPLA 3VZOA 4COZA 5I93A 5FY0A 2LM3A 2VO5A 4MO3M 5BPXA 1CN1A 2WZR1 3UESA 3H1MA 5C33A 5JOXA 1LRHA 2HYKA 1AL0G 5F9TA 3ATGA 5IAVA 4DXTA 4IL7A 1R083 2C26A 3HBZA 3D82A 4CDWC 3CO2A 4OZXA 2CL2A 2HWD3 1PMIA 5CIRA 3QCWA 5FZAA 3S0MA 2A5ZA 3AVSA 3F2ZA 2BBAA 4X6RB 1JZ4A 5LEKA 3D3AA 3KLSA 3IPVA 4IV1C 1OD5A 2JICA 2L9LA 4NOTA 3GHMA 3VHPA 4L2NA 4NRPA 4DB5A 2VW2A 3W58A 3T0DA 3S57A 3A21A 1FOD2 2VZ1A 2VJXA 1F5JA 2RS31 3NV3A 4X6QB 4IEPA 5APAA 1URXA 3WQ0A 5E6HA 4MHRA 4KMQA 4OVEA 1JOJA 2QDNA 5FCCA 4BQ1A 5IJRA 3U78A 4XIKA 4FP2A 5LY2A 1G9AA 2RMU3 2VR4A 3OY8B 2PHUA 3LB9A 5ABJA 1JU4A 2DVFA 4HG6B 1YFXA 1XQNA 2AZ5A 3NNJA 2YU1A 3ZFFA 1I1EA 1Q8OA 1JYTA 3AP7A 1O4ZA 2P3YA 2D6LX 4FOQA 4RL7A 1PVC1 1LOAA 2WN2A 3KV6A 4FPYA 2GALA 1J3PA 1IG0A 2XJRA 1AR93 4B7EA 3C7HA 4ET7A 3OBAA 1KQRA 4JRAA 3FL7A 1AYN2 5FYUA 5A3NA 3D6EA 3OOXA 1MVEA 3UKTA 1ZRFA 1NA1B 3O0VA 5JIAA 3AP6A 1BXHA 5J1XA 4QPIA 4RS5B 1LHVA 4IEYA 5CKNA 2YY1A 4P5YA 1CAXA 3ILNA 2XQRA 5FAXA 2QVSB 2WINB 2WWUA 3NW4A 2YXSA 3B7MA 4UW3A 1QQP3 5A7NA 2O14A 1LB2A 1NCRB 4PHZA 1C28A 1K45A 4CCNA 1W3XA 3CJIA 5LK7B 1V6NA 2WLQA 3LZZA 4K40A 5HBAA 1UMIA 3LEMA 3E6CC 4ARYA 1SFPA 2XVKA 5KHKA 5E89A 3USUB 1QJU2 4NRQA 2OA2A 3GXUA 2Q30A 1AR81 3PHMA 1VBD3 2HBUA 1LJ7A 4FVVA 4JKMA 3ZFGB 2YBKA 4DRVA 2X5IA 3ZSMA 4OULA 4RYDA 3UKVA 4DINB 1CAWB 2D3SA 1GWKA 3KCCA 5LASA 1H1MA 4XZPA 5FMCA 4A4AA 4RS5C 3UKNA 4NROA 2LALA 4UFLA 4FP3A 4CCDA 2WZ8A 2OT7A 1QHDA 3IAQA 1ZM1A 5DAXA 1SCRA 2P34A 4DFSA 2ZMLA 4UT5A 4SBVA 2Q1FA 3WCSA 4Q8KA 4WVMB 1RUE1 4QQOA 1UY4A 4ZHNA 4A7KA 3AZXA 4JQRA 4YVWA 1PHMA 1V00A 1ST8A 3RVHA 4Q4X1 3J7NA 4HBNA 1FPN3 3C7OA 4FOWA 1QJFA 4MUVA 1VE0A 1ZBA1 4XILA 2F17A 2A3XA 2J1AA 4CDUA 4QPIB 5IATA 3DN7A 1VJ2A 4HT1T 2QFEA 1PK6A 1RUNA 1K5JA 2D7FA 4Z82A 4N7IA 3J4UH 2QQKA 4TXWA 3A7QA 3AZVA 1FPN2 2WJSA 1FOD1 2PAKA 1HJFA 3GZTB 3K3OA 1CESA 4P9XA 3MIHA 3I3BA 3N3HA 3VBFA 1LOFA 2OIIA 4XMIA 3I2OA 5EZWA 3U4SA 2VCBA 4ZU4A 5JI7A 3CZJA 5EQUA 4HSJA 1Y9QA 1NCQC 3D8CA 2DVAA 2XBO3 2QQIA 2YBSA 1EAH3 2BNMA 2JG8B 2DDUA 4IE7A 1W6MB 5DAPA 5F2SA 1XNCA 4DXZA 4TZDA 2W1UA 1UXZA 2E7AA 2VZOA 1OF4A 2ZX4A 2QCSB 3NNMA 4NHXA 1AJOA 4B3NA 2WNUC 4IEUA 5JDBA 1WCUA 2BERA 1Q3EA 4HFSA 1G86A 4I09A 4XABA 5KXBA 5I8TA 5A33B 2W1SA 4Q4V2 3C2UA 3KQRA 4DUXA 4LPLA 3JBG1 1ENSA 4ATEA 1S0IA 3HBKA 5FZ7A 4Z2WA 4GJZA 3A4UA 4PQQA 3PDQA 4CXYA 5JPNB 2PLV1 1W2AX 3ZDSA 5F5AA 1VIWB 2ZEYA 4N7UA 4WM7A 1W6PA 1IHMA 1UXXX 4YPJA 2R30A 4CDUB 3SQOA 4FBFA 4DO0A 1YHFA 1ULPA 2C9KA 2PLV3 3TN93 4QDQA 3VBSB 5C4WC 4XXAA 5GZFA 3KVAA 2DBNA 5J37A 2VCAA 4L9BA 2RM23 5LRRA 2YDEA 1TVGA 4Q4X2 2ZAHA 5JOWA 2DCJA 4HSLA 2AREA 5LEJA 4FXGB 4BMEA 1ZBE3 4DXRA 2ZS6B 1VBB2 2DUPA 2HWC1 1POV3 4PDWB 5JPMB 1NY72 1LNSA 2GNBA 1VBC1 3HQXA 4M4PA 3VD7A 5JOZA 1UYXA 2VMDA 4LQRA 5JXGA 3HQUA 1OC1A 5BYNA 3JQXA 3N9PA 4LA3A 1Y9MA 4Q0UA 5D1IA 1QQP1 1VMJA 1FV3A 1DCSA 2EIGA 5FRAA 3VDDA 3ECQA 2P1BA 3VKFC 4EN7B 2BU9A 2ORZA 1DGRA 1Z0HA 3MF9A 1HRI3 1C5HA 1KS5A 2NQYA 3R4UA 4LK6A 3OBZA 4A41A 1WCDJ 2G9GA 2WT2A 1VBD1 3JD73 1A8MA 1A8DA 1BZWA 5EJ1B 4QT6A 5FY1A 1QJX1 2BQPA 2UY9A 1VRH2 1JYNA 4RQPA 3TNQA 2DWRA 3RNSA 2PELA 5HPOA 2NP0A 2JJ6A 1HDKA 2XJQA 1VR3A 1OA2A 5FYMA 1O5UA 5DXDA 1YFWA 1HB2A 4L0PA 4WM7B 2XLAA 5KBFA 4KBZA 1V6OA 4Z07A 4GALA 4KL1A 1AJKA 2ZGSA 5F6LB 1D2QA 4Q29A 3VZLA 2QNKA 4C0BA 1DIWA 1VBA3 4AG4A 4CRQA 4BWOA 3ZIWA 4AE2A 1OMIA 3FWEA 2FDHA 3GZUC 3O14A 4CCMA 2JDPA 2BJSA 5T52A 4AEDB 1NUKA 1NOVA 2ZGUA 4FAGA 1PIV3 3RYKA 4CPBA 1GUIA 4F7ZA 5AFEA 1MS0A 4LBQA 1E5HA 4UFIA 1O5LA 1UN1A 1O3QA 1BBT2 1K12A 2Q1MA 4IERA 4QPGC 2YFZA 2W91A 1YQCA 2H0VA 3NJYA 1Q8QA 4RFRB 3KMHA 1DGRN 4QXHA 3RPQA 1C57A 3SITA 4N43B 3BOPA 3TRSB 3NWKA 4XJZA 1S55A 1M06G 1RUG2 5JXIA 1ZRDA 1B35B 4KNCA 2X5IB 1HXS1 2BWCA 1RMU3 2FDJA 1YJLA 2PAEA 2KD7A 2PHRA 1W2OA 5DN2A 2EALA 4XFHA 2DU0A 2XVGA 1ULFA 4LO5B 4GMP3 3AXDA 4YVSC 2ZABA 3N9LA 1IPKA 4PDWC 4YGEA 1YNAA 5DZFA 2QQMA 4P9GA 5A7OA 4CP9B 1W8NA 3EHKA 3QD6A 5CG9A 3ZXDA 1HB3A 1F4HA 1RUE2 2DVGA 2ZGQA 2ZGKA 4KWUA 4ZS3A 3ZYFA 1LEMA 3PVNA 1OFSA 1RXGA 2MEV2 5FMOL 4UWDA 1XJAA 2P3IA 4YG0A 1CZTA 1EYBA 3P1IA 3UL2A 3ZSLA 1XC6A 5FTTC 5JSPA 1J58A 3JB4C 4OQ9A 1FMD2 2JE8A 2YBPA 1RVF1 4MX3A 2A6WA 3LFMA 4S2GA 3ZVXA 5I91A 5A1FA 4QQ2A 4XCAA 3NVCA 2HWF3 1VBB1 4JGYB 4ZZ8A 2BTVC 2WT1A 1UF2C 5LBFA 5JR2A 2ZHNA 1PMHX 3K75B 1E5SA 4HVRA 3RS6A 4Q0QA 4QGMA 3ZSKA 2Y34A 4XIOA 1MZFA 2CNAA 3OTFA 3VB9A 5BNNB 2WABA 1ZZ6A 3O0XA 3PURA 2P3KA 3HNYM 3UGHA 3RMYA 2WNUB 1WLTA 3MO4A 1S0FA 3FFZA 3IMNA 5JMOA 2QQOA 3AJZA 4ES9A 4HLTA 4P5HA 1SLAA 4P9IA 2OX0A 1G7YA 3RJRA 1IQAA 3X29B 2Z2SB 5IK4A 2LROA 4GKXA 2HWE3 5C3PA 2HLEA 1KJRA 4AFMA 3MV11 3PUIA 3TBDA 5FZKA 4EWAA 5SV8A 1REDA 1LOCA 4L99A 1QXRA 1Q8SA 1U5IA 2ZMNA 4HPKA 1HLCA 5FZ4A 3I2HA 1XE7A 5EYXA 2BFUL 3EO6A 1JODA 2DVDA 5JZGC 2BEOA 3VD3A 3ZFFB 1QDOA 1V9U3 1IG3A 4OQ8A 5JSOA 4YFWA 5FFOC 2Y0OA 3LKJA 2B45X 2HWC2 5LZ6A 5H9PA 4LHKA 4AI0A 4BM8A 1X50A 5E1RA 3USSA 4C1XA 3VDAA 1VBA2 3NJZA 3ZKYA 3AZZA 3OD4A 1CPNA 2W9XA 3VBOC 3WP4A 4MZUA 1UY3A 2HWE2 2F4LA 4YGBA 2RR12 1F8VA 5DQ0A 4U36A 2KA3A 4RHV3 3WT3A 4D94A 1NLRA 1W05A 3B3QE 3PTRB 3PUQA 1NE6A 1VB4A 1XNAA 3LEKA 2ZOEB 3NV4A 5CFCB 3QH7A 4Q5OA 3C3VA 3UNPA 2C9AA 3RJ2X 5EV7A 3MGUA 5JOYA 1PO13 3ZM8A 1XE8A 3IM0A 2EIEA 5D8AA 4K1YA 1YUDA 5K0UB 3WW2A 2RE9A 1U5ZA 2YB7A 3PIJA 4W6YA 5EJZB 4ZY9A 3VHNA 1BQPA 2B9VA 4I0BA 2PHWA 2XBO1 1PO11 1QJY1 3GALA 2VOKA 1KJLA 4P02B 5DDJ1 3E1F1 4HKWA 1BEV1 1SLIA 4IE5A 1NT0A 1PM4A 4IE6A 4KG0A 3O1TA 1FMD3 3U14A 5I0DA 2JIGA 3MF6A 4LT5A 3O1UA 3LGRA 1FNZA 2D6OX 4QQPA 3NO8A 4YGDA 5CZKA 1UWWA 2R1BA 3I4IA 3WNOA 2CAUA 3PVEA 1YJKA 1VRH3 2RVAA 3Q9OA 1DQ2A 1CGPA 2WBKA 2VNGA 4XUNA 1RJ8A 1QH6A 4Q4Y2 4CUGA 4BU2A 1QNYA 5LBCA 4BHPA 4CTEA 3WOGA 1QF3A 4IE4A 2C24A 4B8EA 3AZWA 4IEVA 1PZ9A 4CEYA 5A70A 1DHKB 2PHDA 5FZIA 2ARAA 5CFDA 5I0RA 5J09A 1C1FA 3ZFGC 1AYM1 1WW7A 2CU5A 2D6KA 2ZAAA 4GQ7A 3GCWA 3M3EA 4YVWB 1TE1B 2VZ3A 5GLZA 4BQ2A 5GM0A 1YWKA 4EQVA 2WS93 1DLCA 4AGRA 3O1OA 4AW7A 2WNVA 4JGZB 4COYA 2XL9A 2UYAA 3FLRA 3WUDA 1NCQB 4LBNA 3Q8EA 1K5MC 4LO7A 3ZYHA 3AKRA 1AL22 3PUAA 4Q4Y1 1N1SA 5F2WA 2D97A 2C6SA 3ENRA 1MZ6A 5E88A 1J84A 2BFUS 4EE2A 4W4ZA 1D7PM 2BWAA 2R071 2RHPA 4CP1A 2G1MA 5BNPA 1JMUB 2WFPA 4JQTA 4PF1A 1IS3A 3I49A 2WNOA 3KVBA 4CEWA 3O1VA 2QJVA 1C3HA 3E6BA 3OGSA 3C7FA 4OHXA 5FO9B 3FUOA 3K4AA 4GMP0 3TYJA 2TUNA 2BUKA 4TLGA 3ZKUA 1UW8A 3MDPA 4JDNA 2RS53 4XUTA 5FJKA 5FZOB 4ZS2A 3B69A 1F9KA 3Q8CA 4AHWA 1YCIA 1GZWA 5JIUA 2ID4A 2CWMA 4MADA 1GP6A 1O4TA 1V70A 3KQ4B 3ZXAC 1PVXA 1LOEA 1Z7S3 1W9YA 1NE4A 4AI2A 1O8PA 2YMZA 2HEVF 5FPBA 4COUA 1FATA 4IESA 3SEEA 4XBQA 3AC0A 1LHWA 4CCJA 3AMHA 1WBFA 3RYRA 2GN3A 3WNLA 3AKSA 3GYDA 4HZFA 4O9EA 1UPIA 1JYWA 4HXCA 3WV6A 2GH2A 3CU7A 3U37A 2HWD1 4Y1UA 4PLMA 3TAYA 4FPGA 5FBZA 2YYOA 3CHXA 5JCTA 4M4RA 2IXIA 3CLPA 3KGLA 4Y4RA 4NR1A 3NAPA 3WNKA 4AF9A 3AKQA 3ILFA 3CNAA 1XSRA 5F5QA 2EA7A 1CJPA 2R0FA 3OGGA 4IGQA 4X8PA 4E8DA 2A6XA 1O8SA 1GQHA 1S0JA 1ULGA 2VC9A 3FX3A 3INAA 4KH9A 1EUUA 5HI0A 1X9TA 4NRMA 5IVEA 1VBE3 2LTNA 5C9AA 3MW2A 3VKMA 1JOBA 5FO8B 1ULEA 1FNYA 2VXRA 3HR9A 5LK5A 4CEWB 3DPRB 5IVJA 1G6NA 1FI2A 2WO7A 4NPLA 4BIOA 1ZREA 2FDIA 1CAUB 2FD8A 2G9FA 4LHSA 5L7OA 3TEXA 4D0QA 1ZVFA 4Q0SA 3H42B 1CAWA 1VBD2 3ZN4A 3APBA 3VZNA 3O1SA 3BGAA 3DL3A 2BGPA 1G8WA 1XNDA 3RYPA 3KD4A 3MW4A 5GZGA 1H6XA 2WZEA 3OGRA 1RUC1 4FPHA 4XFAA 5I8SA 3ZR6A 1JZ3A 4CA9A 4LIVA 1HX6A 4NHKA 2H6CA 3LEIA 1UL9A 4U2AA 2QQNA 3VHOA 1PX4A 4JX0A 2R32A 1W6OA 3KWVA 1ZBE1 2R16A 4MLOA 2J1SA 1PGL1 3WDXA 3MEPA 4IETA 3WDUA 1WLWA 1OQEA 3AP4A 3ZXFA 4HKLA 1ODNA 4QX8A 4OI2A 2WA4A 2VZPA 2UWBA 2D93A 2VOXA 4QAWA 4UFHA 3NNLA 2RDNA 3KSCA 1HV1A 2VBDA 4JCKA 1MR5A 1OLQA 4A6SA 5B2GB 5KHJA 5SV5A 4MSVA 3WF1A 4FFIA 5FK8A 4AEDA 4RR3A 4WM8A 1CR7A 3IPVB 5F3EA 2FZ1A 1GLHA 3POIA 5GLTA 4YW4A 2VMGA 1MS4A 1FT9A 1LR5A 1RUG1 1JBCA 1OVSA 1TME1 5FZ9A 4CDQC 4COWA 3AMMA 4G3YC 1C4RA 1NZIA 1W6QA 5IW0A 3TN91 4A44A 5DG2A 4B4PA 3ST7A 4C90A 2BOJA 3DGTA 4N43A 1YIFA 1F35A 1S4CA 4CU6A 1ZRCA 2VMFA 5CVRA 4QWNA 5TSWA 2FZ2A 5IFTA 2WKKA 1ZA7A 5DMYA 4H7MA 1IS6A 4E9KA 1WCQA 3M2MA 1BBT3 4ARXA 5K4LA 3GNEA 1IZ3A 3WP6A 4M3CB 5BNOA 2V72A 3N9NA 2GMPA 2KXLA 4E2QA 3VBUB 1BVP1 3HN1A 5G05L 3JZVA 4CU8A 2GNMA 1ZZBA 4D69A 3PTYA 5FPXA 3POFA 2OPWA 4HANA 4PIZA 2P6CA 2WSVA 3LAGA 4BZ4A 4TLFA 2ARBA 3N4MA 4Q1RA 4ZKTB 5FYSA 3W20A 3WW4A 3NNGA 5FMBA 3RZZA 3B5LB 2PHTA 3HVDA 3KV5A 1W39A 4UAPA 5G04L 3A0NA 3MLKA 2PQQA 5JWPA 4JGZA 3OBTA 1AUYA 4DEQA 4IEZA 1UKRA 4Q8LA 1RTVA 1UQXA 2J42A 4GH4A 4RGAA 4XFBA 1KFXL 2DUOA 4I0AA 1UYPA 1O3SA 1MEC2 1DDLA 2Y26A 5GZCA 2VTXJ 4XTMA 5DG1A 4UI9L 2ES3A 5T5JA 2CV6A 2HH9A 2PTMA 4K8RB 1T6BX 5KHHA 3Q8AA 4ZU5A 3M3QA 2ARXA 4IGOA 2D3RA 1CONA 4D6SA 1LECA 4BQWA 3LOIA 3DECA 5A1AA 2VUCA 3DYOA 4EZ4A 4AWDA 1R64A 3FBMA 4OI4A 4NMIA 3WEZA 3KCYA 3RI8A 2DF7A 3MFAA 3VBRC 2YC0A 3S7EA 1K5MB 3V0AA 1J1TA 4CVUA 1MS3A 2DVBA 2DYCA 3WDVA 2E51A 1A3KA 3OB8A 3CZUA 1YLLA 3B02A 4OUEA 2BW8A 4QX0A 4BQXA 3HNBM 5IAXA 1JZ5A 2MPFA 2AH2A 2GC3A 1KDMA 3H1WA 4M3CA 2VU9A 5T55A 1AR71 2Y8KA 2WQZC 2PHXA 3A22A 1VRH1 3H1YA 4P9LA 3H9AA 4Z92B 3NMBA 1R1A2 4GWMA 2FCTA 3SNMA 4WVMA 4NJ4A 1ZNPA 3I3DA 4XUOA 2W87A 2BOIA 1H30A 1UY1A 4IV3B 3J7MA 2PLV2 1VPHA 4AGVA 2D6MA 1ZYBA 1EP0A 2C1FA 5JXHA 3KV4A 3ZXGA 3ASIA 4Q4Y3 3ZN6A 5F3CA 2ZGRA 3POJA 4GB32 1SBDA 3U1XA 3VZMA 4PBPA 1TG7A 3ACFA 2X29A 4IEWA 1B35C 3O1RA 4QKNA 2J1EA 1C8M3 1RHI3 1UO9A 3BYWA 4JKLA 1RL3A 3AK0A 1VBC3 2YC2A 4MXWA 2VVEA 3WG1A 5L36A 1SDDB 4NHMA 4CCOA 2VZSA 4D6RA 1C8M1 5A3OA 5LA1A 1ASJ3 1PGSA 2CY6A 2QQLA 3WG3A 3HQRA 5FYZA 5GZDA 3EB7A 1SLBA 4FPJA 1CX4A 4FPEA 4J6GA 1J59A 1F31A 1JHNA 1UZ0A 3DPRA 4AR2A 5JI9A 4KGQA 2MEV1 3ORJA 1AL23 4ZONA 2B46X 2VMEA 2VXJA 3J8F1 1W6MA 3OY8A 4Y20B 1GQPA 1Q8VA 3QH6A 4NAMA 4YW2A 3KB5A 4I3GA 4LKSA 4LNVA 2YZ4A 5LWBA 4BCUA 4HETA 4YW5A 2Y33A 4B1LA 4OFGA 4CP9A 3MICA 5JSRA 3SH5A 1S0CA 2P5BA 4UFKA 5FZEA 2D40A 5CBLA 5CFDB 2E63A 2HEWF 1RUJ3 3UGFA 1SG3A 1STMA 5FY8A 2NYYA 1NCRC 2FMDA 1N1TA 1OUXA 4IV3A 2JG8C 3D5OA 3D0JA 1H4HA 4YZ4A 4ZU7A 2WO3A 1H8TA 1O4YA 1VB2A 2XLGA 1W03A 4AK3A 2PA7A 4LE3A 5FUIA 3L9JT 5FPVA 3ZYIB 2Y6KA 2D98A 4COVA 4R4XA 2ZKNA 2ZX1A 2AUYA 2EXIA 2QDRA 2R49A 4RA0A 4M3CF 4UBGA 1AXYA 2PN5A 3ZFEB 1J83A 1EV12 1XPWA 5BNNA 1VBE1 3ETQA 2V4VA 4BQ5A 2YPJA 2OW4A 4BK4A 2V73A 2X09A 4BB3A 3P3PA 1YI9A 1D0GA 1YRZA 3LD8A 3RZGA 3HD8B 4G9SB 1ND3A 2R7EB 2VTXA 5BXXA 4FAHA 3IB3A 5EHDA 3OG2A 4XJ9A 1OPMA 4CDWA 2FCUA 2WYFA 4XETA 2VY0A 1QJX2 4DRRA 1SCSA 5AVPA 3WQBA 4HPKB 1MQTA 4MGZE 2C0ZA 3B00A 2CGOA 2D5HA 3ZOIA 2XPJA 3URFA 4YM2A 4CDQB 1HKDA 2OYZA 3J8F2 4OUSA 4AQSA 1A78A 2XUMA 1C1LA 1S2KA 3DYPA 5J3UA 3OGJA 1O3RA 2WDBA 1RUC3 2VL4A 1VBE2 5E8AA 2VQ0A 4E2SA 5FZ0A 3U0ZA 5T5LA 2FCVA 2VM9A 5ABJC 2LW8A 5D2AA 4YM3A 2UWCA 2BNOA 1BK0A 2WUHA 4UFMA 1LHOA 1S2EA 2VPVA 4DUWA 4ZZ5A 3KF3A 3ZFFC 1AYN3 3FBYA 3RZKA 2E32A 3BODA 4N53C 5M0TA 3NAPB 1ENQA 2OKXA 2DBIA 5LBEA 1W8OA 3T0BA 3R6SA 1OPOA 5J48A 1D4M2 5K7PA 1JYCA 2JECA 3M3OA 2RJLA 5K0UA 4TTGA 5H9QA 3M70A 2XHNA 5EXOA 1NXD1 2V4AA 4NIAA 5FP8A 1SLTA 3I3EA 3NJXA 5IK5A 1N1VA 2WSUA 1CQ9A 2WC2A 5LW9A 4ES8A 2CAVA 3I2FA 5KWRA 4DUVA 2J1UA 2LUWA 2W46A 3VBHC 3FJSA 1XRUA 2ZX3A 5FZ3A 4MGSA 1R093 3FLPA 4BQYA 4DXSA 1IPSA 1DYPA 4QHBA 5L73A 3O0WA 3B94A 4C0HA 3DUIA 3AX4A 2VVDA 3IT8A 3AKTA 1AR72 1ASJ1 1GNHA 2OXBA 3CJIC 4LITA 4NHLA 5C8CC 4JGYC 5DUWA 3PVBB 4R8HA 4BJ0A 4CZSA 1OUSA 2ORXA 1UIKA 4AVSA 2NN8A 1VBC2 3PIGA 2VNOA 2RJ2A 5DAQA 2ZTNA 1C8M2 4E2GA 4AGGA 2D5FA 5F37A 2YROA 1O3TA 4Y24A 4EN9B 3NKTA 4XF9A 2P37A 3MIBA 5FYTA 4GA9A 1GV9A 4Y1ZA 2W3JA 1YQ2A 3I54A 1WD4A 2EVXA 2EIDA 3RDIA 1DQ4A 4NWWA 4PF5A 4CU9A 1OOPC 4RS5A 3IDBB 3EMRA 4CDXA 1WZXA 2OVUA 1W8TA 1JOPA 4Q4W1 5FDBA 4AYUA 1ZBA3 1TNFA 2X10A 4UOJA 3ZIXA 2QQVA 1RUH1 3OBRA 1W04A 5DUUA 2E6VA 4F3JA 2DCYA 5D21A 3GBFA 1RUF2 3EQEA 3IIIA 5I0UA 4ASMB 3K46A 2VOVA 4YVWC 3WLUA 2ZGOA 3E6DA 4JDMA 5LBBA 1APNA 3FUQA 4HK8A 1ODMA 3KHBA 1OKOA 4Y3OA 3VL8A 4FQZA 1ZBA2 1U0AA 1HN0A 3K4DA 2NMOA 4BLIA 4CDUC 3O1MA 3DEMA 2CDOA 2OZ6A 4OHZA 4FXKB 4AQ6A 2ILMA 1VBA1 2PAMA 4HKOA 4LMFA 5FPZA 3V64A 3TB0A 4P9WA 2QTWB 4QU1A 4Y1VA 4YZ5A 4FPFA 3BVCA 2G19A 1BYHA 5FQ0A 2BDRA 1F4AA 1I5PA 1OQDA 3PNAA 1LULA 3DCQA 3BTZA 2W68A 1GZTA 3MBWA 3H8RA 3VBUA 5C71A 1GZWB 2WFF3 3I7DA 5CFCC 4ATFA 5GLWA 1BK1A 2VGDA 4LIUA 2RV9A 1O7FA 5HCBA 4YM0A 4NN0A 2ZGPA 2GMEA 5L9RA 3RGBA 4YRDA 1RMU1 2VBBA 1AX2A 5F5IA 4LLFA 1EUTA 1ENRA 1KS4A 1W9TA 1YQ5A 2JDNA 3AL5A 3HMYA 2A70A 1M4WA 2K46A 1RGSA 1XNBA 3VBRB
chains in the Genus database with same CATH topology
2VZTA 3CIHA 3THCA 1UY0A 3SKJE 3T0AA 1CZSA 2E33A 4XUPA 1GOGA 5C7GA 1H6YA 2QBXA 1J84A 2J1TA 1D7PM 4W4ZA 5F7UA 2WO2A 5HXMA 1JZ6A 1US3A 1JZ8A 2XOMA 1OT5A 4PF1A 3HOBA 4JHZA 1K3IA 3IDAA 2JKXA 3OGSA 3C7FA 5JUVA 3NJVA 4BXSV 3WF0A 2W1WA 3W5NA 3K4AA 5C70A 3ACHA 3VDCA 3LPGA 3NRUA 4QX2A 1JZ2A 3EYPA 4XUTA 1UY2A 4GWIA 2YG0A 2VZQA 2ID4A 4MADA 2W47A 3T2QA 1O8PA 5LA2A 2BGOA 3HJRA 4JKKA 3HPNA 3NQHA 4OMDA 3SEEA 3AC0A 2VO5A 4MO3M 3UESA 3WNLA 3T2PA 1JYWA 3BN6A 3U37A 1SHWB 1XNTA 3FHQA 4DXTA 2C26A 4M4RA 4XUQA 2V5DA 2W1QA 1W9SA 3WNKA 3VDBA 1PX3A 2Y6HA 3F2ZA 1JZ4A 2BBAA 4GZ9A 3D3AA 4E8DA 1O8SA 2VC9A 2L9LA 4QX3A 1NX9A 1EUUA 3T0DA 3UETA 3A21A 2VZ1A 2VJXA 2WAOA 4KMQA 5IJRA 3CMGA 4LHSA 4A42A 2VCCA 4D0QA 3HEIA 2VR4A 2Y6LA 1JU4A 3BGAA 4HG6B 2BGPA 1H6XA 2WZEA 3OGRA 1JZ3A 4XVHA 1JYXA 2WN2A 3VD9A 2WQ8A 3LEIA 3T2OA 2QQNA 1PX4A 3C7HA 4ET7A 3OBAA 4JX0A 3FL7A 5CYYA 2J1SA 4QX1A 5J1XA 3CDZB 4P5YA 2VZPA 4QAWA 4DEVA 1IQDC 3WF1A 1K45A 5IHRA 1UMIA 3FHAA 4ARYA 4A44A 3GXUA 4FI9A 2ZEWA 4CU6A 4JKMA 4CUAA 2VMFA 5IFTA 4RYDA 3WNMA 4QPWA 5DMYA 1WCQA 4A4AA 4ARXA 2V72A 4P00B 2WZ8A 3IAQA 2BZDA 5G05L 3T09A 4CU8A 2EICA 1L7RA 1L7QA 3I2KA 1UY4A 3P6BA 4IUGA 2VOTA 5IYYA 3NNGA 1UYYA 3C7OA 4UAPA 2WN3A 5G04L 1RYYA 4AAXA 2J1AA 1JHJA 3SKVA 4DEQA 4QDSA 1HN1A 2QQKA 1OD3A 2YC4A 3A7QA 4TXWA 4UI9L 4OYUA 2E31A 4PT6A 3I3BA 3WF2A 3DECA 5A1AA 3MV01 3DYOA 2J22A 4P08A 2VCBA 1R64A 3WEZA 3CZJA 5LCWL 4CVUA 2XONA 2QQIA 2DDUA 3OB8A 3CZUA 4OUEA 3WNNA 2W1UA 1UXZA 4QX0A 1JZ5A 3HNBM 2VZOA 1K42A 1OF4A 3FN9A 2J1RA 3T08A 2BERA 2Y8KA 3A22A 2W1SA 2YFUA 4DUXA 3CKHA 4LPLA 3WNPA 2DCKA 3I3DA 3I97A 4XUOA 2W87A 4PQQA 1UY1A 5EIYB 2W92A 3CQOA 2ZEYA 1OH4A 1UXXX 4YPJA 2JD9A 5JXHA 3I2JA 2C9KA 1ULPA 2VQTA 4QDQA 1TG7A 3ACFA 2VCAA 4A6OA 1TVGA 2J1EA 2DCJA 4JKLA 2YC2A 1OF3A 1SDDB 1UYZA 4QB6A 4DXRA 2VZSA 4W8JA 5LA1A 2QQLA 1LNSA 3OGVA 3VD7A 4M4PA 3EB7A 1UYXA 4MGQA 2VMDA 3ETPA 4LQRA 5JXGA 3LQCA 1UZ0A 3THDA 3LE0A 3MUY1 5JXJA 3PUHA 2VMEA 3ECQA 1GQPA 3IAPA 4LKSA 4XZUG 2ORZA 4A41A 4KI5M 1GU3A 1DYOA 4OMCA 5EJ1B 2B4KA 2ZEZA 1JI6A 1SG3A 4A45A 4XURA 1JYNA 5B4NA 1NAEA 4W50A 5HPOA 2WO3A 1ULOA 4L0PA 5FUIA 2Y6KA 2W5FA 4AG4A 4BK5A 1J83A 3ACIA 3WF3A 1XPWA 2V4VA 4ZXEA 1NKGA 4BK4A 1NUKA 2X09A 4BDVB 4A3ZA 1GUIA 2ZXQA 1MPXA 1PMJX 1K12A 3K4ZA 1KGYA 2YFZA 1CIYA 2R7EB 3GDBA 2W91A 2QQJA 3IB3A 4MOAA 3ABZA 3OG2A 5JXIA 2E26A 3WQBA 2KD7A 5DN2A 5LA0A 3W5MA 3GGLA 2W94A 2ZEXA 2C4XA 2QQMA 1W8NA 1F4HA 4KWUA 2Y6GA 3DYPA 2WDBA 5IFPA 2VL4A 2J7MA 1CZTA 3P1IA 1XC6A 3LPFA 1UMHA 1GMMA 2VM9A 2JE8A 2VMCA 2LW8A 2WUHA 4ZZ5A 4DUWA 4ZZ8A 5JR2A 1PMHX 2E32A 3I2IA 3K75B 2VZUA 5DPNA 2VZVA 2OKXA 1W8OA 1GNYA 3T0BA 2WABA 3GM8A 1GOFA 3HNYM 1W99A 3MO4A 4TTGA 2XHNA 2VTFA 2QQOA 5JMOA 3OEBA 3I3EA 3NJXA 3I2FA 1WKYA 2HLEA 3C8XA 3MV11 2J1UA 2W46A 3PUIA 2VZRA 4QB1A 4MGSA 2HYXA 4DXSA 2JDAA 3I2HA 1W9WA 4RN5A 3OEAA 3VD3A 3JXSA 4BJ0A 2ORXA 4CUCA 1P8JA 2RJ2A 2Y6JA 3HN3A 2W95A 1UX7A 3A23A 4Z2AA 1CX1A 3K77A 3VDAA 4DUVA 3C7GA 2LS6A 2W9XA 2W3JA 1YQ2A 1UY3A 2EIDA 1BHGA 3WF4A 5DQ0A 3HNMA 4CU7A 1W0NA 1O59A 1GOHA 4E8CA 4GWJA 2X10A 1XNAA 3C7EA 4UOJA 3LEKA 2VQUA 3UNPA 3IIIA 3J7HA 3ZM8A 3SEPA 2EIEA 3K46A 3I2GA 1JZ7A 1DP0A 5EJZB 2YB7A 4ZY9A 2Y64A 3VD5A 2B9VA 4P02B 5B4XA 4OZOA 3K4DA 3E1F1 2WO1A 4QDRA 2CDOA 4D8MA 3WSOA 2WAAA 5I0DA 3ACGA 5CZKA 1UWWA 3WNOA 2X05A 2Z4FA 1F4AA 1I5PA 1CZVA 2CDPA 3MUZ1 2J1VA 2RVAA 2WBKA 2WYSA 4XUNA 1JYVA 3MBWA 3LEGA 4QB2A 1JU3A 5C71A 3DYMA 2EIBA 1T2XA 2RV9A 2XQXA 1KEXA 4CUBA 2VZ3A 3VD4A 2PQSA 1EUTA 1DLCA 1W9TA 1US2A 4CU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZT A;  3CIH A;  3THC A;  1UY0 A;  3SKJ E;  3T0A A;  1CZS A;  2E33 A;  4XUP A;  1GOG A;  5C7G A;  1H6Y A;  2QBX A;  1J84 A;  2J1T A;  1D7P M;  4W4Z A;  5F7U A;  2WO2 A;  5HXM A;  1JZ6 A;  1US3 A;  1JZ8 A;  2XOM A;  1OT5 A;  4PF1 A;  3HOB A;  4JHZ A;  1K3I A;  3IDA A;  2JKX A;  3OGS A;  3C7F A;  5JUV A;  3NJV A;  4BXS V;  3WF0 A;  2W1W A;  3W5N A;  3K4A A;  5C70 A;  3ACH A;  3VDC A;  3LPG A;  3NRU A;  4QX2 A;  1JZ2 A;  3EYP A;  4XUT A;  1UY2 A;  4GWI A;  2YG0 A;  2VZQ A;  2ID4 A;  4MAD A;  2W47 A;  3T2Q A;  1O8P A;  5LA2 A;  2BGO A;  3HJR A;  4JKK A;  3HPN A;  3NQH A;  4OMD A;  3SEE A;  3AC0 A;  2VO5 A;  4MO3 M;  3UES A;  3WNL A;  3T2P A;  1JYW A;  3BN6 A;  3U37 A;  1SHW B;  1XNT A;  3FHQ A;  4DXT A;  2C26 A;  4M4R A;  4XUQ A;  2V5D A;  2W1Q A;  1W9S A;  3WNK A;  3VDB A;  1PX3 A;  2Y6H A;  3F2Z A;  1JZ4 A;  2BBA A;  4GZ9 A;  3D3A A;  4E8D A;  1O8S A;  2VC9 A;  2L9L A;  4QX3 A;  1NX9 A;  1EUU A;  3T0D A;  3UET A;  3A21 A;  2VZ1 A;  2VJX A;  2WAO A;  4KMQ A;  5IJR A;  3CMG A;  4LHS A;  4A42 A;  2VCC A;  4D0Q A;  3HEI A;  2VR4 A;  2Y6L A;  1JU4 A;  3BGA A;  4HG6 B;  2BGP A;  1H6X A;  2WZE A;  3OGR A;  1JZ3 A;  4XVH A;  1JYX A;  2WN2 A;  3VD9 A;  2WQ8 A;  3LEI A;  3T2O A;  2QQN A;  1PX4 A;  3C7H A;  4ET7 A;  3OBA A;  4JX0 A;  3FL7 A;  5CYY A;  2J1S A;  4QX1 A;  5J1X A;  3CDZ B;  4P5Y A;  2VZP A;  4QAW A;  4DEV A;  1IQD C;  3WF1 A;  1K45 A;  5IHR A;  1UMI A;  3FHA A;  4ARY A;  4A44 A;  3GXU A;  4FI9 A;  2ZEW A;  4CU6 A;  4JKM A;  4CUA A;  2VMF A;  5IFT A;  4RYD A;  3WNM A;  4QPW A;  5DMY A;  1WCQ A;  4A4A A;  4ARX A;  2V72 A;  4P00 B;  2WZ8 A;  3IAQ A;  2BZD A;  5G05 L;  3T09 A;  4CU8 A;  2EIC A;  1L7R A;  1L7Q A;  3I2K A;  1UY4 A;  3P6B A;  4IUG A;  2VOT A;  5IYY A;  3NNG A;  1UYY A;  3C7O A;  4UAP A;  2WN3 A;  5G04 L;  1RYY A;  4AAX A;  2J1A A;  1JHJ A;  3SKV A;  4DEQ A;  4QDS A;  1HN1 A;  2QQK A;  1OD3 A;  2YC4 A;  3A7Q A;  4TXW A;  4UI9 L;  4OYU A;  2E31 A;  4PT6 A;  3I3B A;  3WF2 A;  3DEC A;  5A1A A;  3MV0 1;  3DYO A;  2J22 A;  4P08 A;  2VCB A;  1R64 A;  3WEZ A;  3CZJ A;  5LCW L;  4CVU A;  2XON A;  2QQI A;  2DDU A;  3OB8 A;  3CZU A;  4OUE A;  3WNN A;  2W1U A;  1UXZ A;  4QX0 A;  1JZ5 A;  3HNB M;  2VZO A;  1K42 A;  1OF4 A;  3FN9 A;  2J1R A;  3T08 A;  2BER A;  2Y8K A;  3A22 A;  2W1S A;  2YFU A;  4DUX A;  3CKH A;  4LPL A;  3WNP A;  2DCK A;  3I3D A;  3I97 A;  4XUO A;  2W87 A;  4PQQ A;  1UY1 A;  5EIY B;  2W92 A;  3CQO A;  2ZEY A;  1OH4 A;  1UXX X;  4YPJ A;  2JD9 A;  5JXH A;  3I2J A;  2C9K A;  1ULP A;  2VQT A;  4QDQ A;  1TG7 A;  3ACF A;  2VCA A;  4A6O A;  1TVG A;  2J1E A;  2DCJ A;  4JKL A;  2YC2 A;  1OF3 A;  1SDD B;  1UYZ A;  4QB6 A;  4DXR A;  2VZS A;  4W8J A;  5LA1 A;  2QQL A;  1LNS A;  3OGV A;  3VD7 A;  4M4P A;  3EB7 A;  1UYX A;  4MGQ A;  2VMD A;  3ETP A;  4LQR A;  5JXG A;  3LQC A;  1UZ0 A;  3THD A;  3LE0 A;  3MUY 1;  5JXJ A;  3PUH A;  2VME A;  3ECQ A;  1GQP A;  3IAP A;  4LKS A;  4XZU G;  2ORZ A;  4A41 A;  4KI5 M;  1GU3 A;  1DYO A;  4OMC A;  5EJ1 B;  2B4K A;  2ZEZ A;  1JI6 A;  1SG3 A;  4A45 A;  4XUR A;  1JYN A;  5B4N A;  1NAE A;  4W50 A;  5HPO A;  2WO3 A;  1ULO A;  4L0P A;  5FUI A;  2Y6K A;  2W5F A;  4AG4 A;  4BK5 A;  1J83 A;  3ACI A;  3WF3 A;  1XPW A;  2V4V A;  4ZXE A;  1NKG A;  4BK4 A;  1NUK A;  2X09 A;  4BDV B;  4A3Z A;  1GUI A;  2ZXQ A;  1MPX A;  1PMJ X;  1K12 A;  3K4Z A;  1KGY A;  2YFZ A;  1CIY A;  2R7E B;  3GDB A;  2W91 A;  2QQJ A;  3IB3 A;  4MOA A;  3ABZ A;  3OG2 A;  5JXI A;  2E26 A;  3WQB A;  2KD7 A;  5DN2 A;  5LA0 A;  3W5M A;  3GGL A;  2W94 A;  2ZEX A;  2C4X A;  2QQM A;  1W8N A;  1F4H A;  4KWU A;  2Y6G A;  3DYP A;  2WDB A;  5IFP A;  2VL4 A;  2J7M A;  1CZT A;  3P1I A;  1XC6 A;  3LPF A;  1UMH A;  1GMM A;  2VM9 A;  2JE8 A;  2VMC A;  2LW8 A;  2WUH A;  4ZZ5 A;  4DUW A;  4ZZ8 A;  5JR2 A;  1PMH X;  2E32 A;  3I2I A;  3K75 B;  2VZU A;  5DPN A;  2VZV A;  2OKX A;  1W8O A;  1GNY A;  3T0B A;  2WAB A;  3GM8 A;  1GOF A;  3HNY M;  1W99 A;  3MO4 A;  4TTG A;  2XHN A;  2VTF A;  2QQO A;  5JMO A;  3OEB A;  3I3E A;  3NJX A;  3I2F A;  1WKY A;  2HLE A;  3C8X A;  3MV1 1;  2J1U A;  2W46 A;  3PUI A;  2VZR A;  4QB1 A;  4MGS A;  2HYX A;  4DXS A;  2JDA A;  3I2H A;  1W9W A;  4RN5 A;  3OEA A;  3VD3 A;  3JXS A;  4BJ0 A;  2ORX A;  4CUC A;  1P8J A;  2RJ2 A;  2Y6J A;  3HN3 A;  2W95 A;  1UX7 A;  3A23 A;  4Z2A A;  1CX1 A;  3K77 A;  3VDA A;  4DUV A;  3C7G A;  2LS6 A;  2W9X A;  2W3J A;  1YQ2 A;  1UY3 A;  2EID A;  1BHG A;  3WF4 A;  5DQ0 A;  3HNM A;  4CU7 A;  1W0N A;  1O59 A;  1GOH A;  4E8C A;  4GWJ A;  2X10 A;  1XNA A;  3C7E A;  4UOJ A;  3LEK A;  2VQU A;  3UNP A;  3III A;  3J7H A;  3ZM8 A;  3SEP A;  2EIE A;  3K46 A;  3I2G A;  1JZ7 A;  1DP0 A;  5EJZ B;  2YB7 A;  4ZY9 A;  2Y64 A;  3VD5 A;  2B9V A;  4P02 B;  5B4X A;  4OZO A;  3K4D A;  3E1F 1;  2WO1 A;  4QDR A;  2CDO A;  4D8M A;  3WSO A;  2WAA A;  5I0D A;  3ACG A;  5CZK A;  1UWW A;  3WNO A;  2X05 A;  2Z4F A;  1F4A A;  1I5P A;  1CZV A;  2CDP A;  3MUZ 1;  2J1V A;  2RVA A;  2WBK A;  2WYS A;  4XUN A;  1JYV A;  3MBW A;  3LEG A;  4QB2 A;  1JU3 A;  5C71 A;  3DYM A;  2EIB A;  1T2X A;  2RV9 A;  2XQX A;  1KEX A;  4CUB A;  2VZ3 A;  3VD4 A;  2PQS A;  1EUT A;  1DLC A;  1W9T A;  1US2 A;  4CU9 A; 
#chains in the Genus database with same CATH topology
 4CDX B;  3UGG A;  3W9A A;  4JTN A;  1PK6 B;  4L92 A;  3CIH A;  2HWE 1;  2HWB 3;  1MS1 A;  1UY0 A;  3SKJ E;  3AMN A;  4GXL A;  1CZS A;  1DZR A;  1O6U A;  2ZHL A;  4BA6 A;  2WII B;  1GOG A;  3VN4 A;  4QM8 A;  2Q0A A;  4LOS A;  1S1A A;  2WO2 A;  4N90 A;  1V6J A;  1PGW 1;  3MYX A;  3OJB A;  5HV4 A;  4FPL A;  1EV1 3;  1XSQ A;  4WM7 C;  5KHI A;  1RVF 2;  2WR9 A;  4WBB A;  2XJS A;  5FZ8 A;  4ISR A;  1OOP B;  2Z69 A;  5A7S A;  2R07 3;  1W28 A;  3ES1 A;  4JHZ A;  1LOB A;  4XAA A;  4XAE A;  2GZW A;  1YQ6 A;  1GZC A;  3K48 A;  3N36 A;  5JUV A;  2FDF A;  1RUE 3;  2W1W A;  1REF A;  2BNN A;  2BVB A;  3BCW A;  5JR7 B;  2R1D A;  1QY4 A;  1X8M A;  3VDC A;  1JUI A;  1WME A;  2G9Z A;  2OZJ A;  2XKO A;  3RZL A;  4M0H A;  1A34 A;  1RUC 2;  3NV1 A;  2DU1 A;  4QX2 A;  3NL1 A;  5HV0 A;  3RZH A;  5CNA A;  3ZLI A;  1FAY A;  2W0X A;  4GWI A;  3VBS C;  1D4M 3;  2IVI B;  5FUP A;  1MEC 1;  2GP5 A;  1I9R A;  5C4W B;  1NXM A;  1UZV A;  2RS1 2;  1ND2 C;  4Q4W 3;  3WCR A;  1WW4 A;  3WXP A;  1LEN A;  2R6Q A;  1H2K A;  3BPS A;  3R4S A;  5LA2 A;  3HJR A;  1CIW A;  2AEN A;  1ALY A;  4LKF A;  4XJA A;  1PNF A;  2JX9 A;  2OUH A;  1X33 A;  2RS3 2;  3H7J A;  4FQ4 A;  4EWE A;  1C8N A;  1W2N A;  3T2P A;  1W6P B;  1SHW B;  1OI6 A;  1PNG A;  5FYY A;  5KC5 A;  3H8U A;  1BEV 3;  2UU8 A;  2VQA A;  4AFA A;  3O7O A;  1EAH 2;  2V5D A;  1FMD 1;  3T4H B;  4NWV A;  3VDB A;  5KXE A;  1TMF 2;  1PX3 A;  4BOW A;  2HWF 2;  4GZ9 A;  2IVJ A;  2OQ6 A;  4RQP C;  4RR3 B;  1KD7 A;  2CTV A;  5DDJ 2;  5JZG B;  4D3W A;  3ZN5 A;  5FZM A;  3LFI A;  3LIH A;  4OCT A;  5BV6 A;  2VD7 A;  3UET A;  5FKB A;  4RHV 1;  4LOT A;  5LRS A;  4E4Z A;  2WAO A;  4GB3 3;  3GBW A;  3GCX A;  4CSW A;  5FP3 A;  4XJW A;  1N1Y A;  3CMG A;  3JD7 2;  4A42 A;  2VCC A;  2GC2 A;  4RD7 A;  3HEI A;  4KBB A;  4ONU A;  1COV 2;  2GND A;  1SLL A;  2D43 A;  1DQ0 A;  1NLQ A;  3S5A A;  4W6W A;  1WA6 X;  5FZO A;  2A6V A;  4AVV A;  4KQ7 A;  3QAC A;  1AR9 1;  1CWP A;  1NG0 A;  4QPG A;  4XXP A;  4XVH A;  1JYX A;  1YXW A;  3I59 A;  3VD9 A;  4BH9 A;  3G6J B;  2WQ8 A;  3FHI B;  4EV0 A;  1RVF 3;  1W8W A;  3AFK A;  2JDU A;  1UNB A;  4DZG A;  2UY8 A;  4QKD A;  5FY7 A;  1F15 A;  1PIV 2;  4XFF A;  3RWN A;  3TOJ A;  1BCX A;  2A6Z A;  4XJ8 A;  4XCB A;  4EN0 A;  5FYB A;  1FXZ A;  3AM2 A;  4CCC A;  2W52 A;  4YVS A;  4LKD A;  1IS5 A;  1ZRI A;  3GF6 A;  2WA3 A;  2WFF 1;  3M3C A;  4E4D X;  4D6Q A;  5T5P A;  4IE0 A;  3ZR5 A;  2KR2 A;  2R04 1;  4LUM A;  4DEV A;  5JAX A;  2XWJ B;  3ACL A;  2FQP A;  3TN9 2;  1JTZ X;  4Q26 A;  5D8A B;  5IHR A;  2JE9 A;  2BYV E;  3LWC A;  3ZMO A;  3RG0 A;  2IXH A;  1QOS A;  5A3P A;  2GSY A;  2ZGM A;  3DF0 A;  5CB7 A;  5C5U A;  5IVY A;  2XDV A;  5FXV A;  1MEC 3;  2VAU A;  3ME2 A;  4IEX A;  3V56 A;  4NHY A;  4FI9 A;  2DV9 A;  1QKQ A;  2ZEW A;  2QUO A;  3OD0 A;  4BYY A;  4CUA A;  1I6X A;  4O7X A;  4C1W A;  3S7I A;  2ZZQ A;  3AYD A;  2RDQ A;  4OI1 A;  3PU8 A;  3NKG A;  3WNM A;  2NMN A;  4QXK A;  4Y33 A;  4YZ1 A;  3RZM A;  3IN9 A;  1UOG A;  1R1A 3;  4EN6 B;  2DUQ A;  1W9F A;  3M8L A;  1ONA A;  2BZD A;  4QPG B;  4HN1 A;  3SMH A;  4AOC A;  2EF6 A;  2RDS A;  2LRP A;  4M00 A;  1PGW 2;  2VEC A;  4XMA A;  2BRT A;  1V0A A;  1AX1 A;  1XNK A;  3WNX A;  5KHG A;  3NV2 A;  2XUE A;  4LBO A;  4QKF A;  4LTA A;  3P5B A;  2E7T A;  1RIN A;  3AYC A;  3ZMN A;  2VOT A;  3VLB B;  3O12 A;  1DQ5 A;  3AMQ A;  2PYT A;  3L2Y A;  4NAO A;  3U75 A;  1NA1 A;  2WN3 A;  1W8Z A;  1COV 1;  3NNF A;  1D4V B;  4AAX A;  1WUV A;  2ZX0 A;  4GJY A;  4YVS B;  3JCI A;  5CIS A;  2WT0 A;  3WDW A;  1J3R A;  1CAX B;  4KWJ A;  4YGC A;  3WD5 A;  1AR6 2;  5FZF A;  4N9I A;  1OD3 A;  3LIG A;  2F4P A;  3CBN A;  2XHK A;  3IKW A;  1QOO A;  5FRE A;  5A3M A;  4AFB A;  2VG9 A;  1QJY 3;  4RGK A;  5F8P A;  1LOD A;  3W59 A;  1H2M A;  1MZ5 A;  2E31 A;  4OYU A;  2QQU A;  1VAK A;  3VBO A;  3H3Z A;  2YGM A;  2A1X A;  3MV0 1;  3K2O A;  1YEW A;  2RR1 1;  4J1W A;  4P08 A;  1D0H A;  4EZH A;  2MNG A;  4XFI A;  3MZH A;  2BBV A;  3AXE A;  5IVF A;  5IUQ A;  5LCW L;  4XDQ A;  3N35 A;  5A6Q A;  2H6B A;  2GU9 A;  1DU3 D;  2XON A;  1KXG A;  3VDD B;  4CCL A;  1GR3 A;  4Y20 A;  4FFF A;  3U10 A;  3ON7 A;  4Y5S A;  2NPI A;  5D8A C;  1K42 A;  1OXC A;  3JBG 3;  3K51 A;  1DZT A;  2J1R A;  1R09 2;  2XJP A;  4K21 A;  5FK7 A;  1BEV 2;  2Q8D A;  2NLR A;  2DFC A;  3T08 A;  2CWS A;  5T5O A;  4AQT A;  2XBO 2;  1GKB A;  3B93 A;  2VW1 A;  4DOU A;  1DG6 A;  2QQW A;  1QIQ A;  2YFU A;  4QU2 A;  3CKH A;  4P14 A;  3WNP A;  4HVQ A;  3H8X A;  4H55 A;  4ASK A;  3BAL A;  1X7N A;  5L9V A;  2JG9 A;  1WMX A;  4P9J A;  3K3N A;  1KFU L;  4QX7 A;  5FZH A;  4AFD A;  2W92 A;  1GBG A;  4ERO A;  2HJI A;  4IQP A;  4K8F A;  1H9W A;  3IIA A;  1YQ8 A;  5J98 B;  4QKB A;  1GFF 2;  3H8O A;  1ACC A;  1VAV A;  3CF6 E;  4FO9 A;  4A7Y A;  2RS1 3;  2JD9 A;  1NZC A;  1IPJ A;  3I2J A;  2QE3 A;  1QQP 2;  5F32 A;  2VQT A;  3GJB A;  2XLF A;  3VV1 A;  1WGP A;  3HWJ A;  1ND2 B;  3BB6 A;  4A6O A;  4MXV A;  3ZFE A;  2HWC 3;  2B5H A;  4V2W A;  4DIQ A;  5CFD C;  1UZW A;  1SEF A;  2BP6 A;  2Q8O A;  2I07 B;  2W2I A;  4FOV A;  4MH0 E;  5CG8 A;  4QB6 A;  2IUW A;  2ZJC A;  4K9S A;  5ERL A;  4XHX A;  2WNV C;  1UMZ A;  3ETP A;  2XWB B;  3J8F 3;  3LQC A;  1RC6 A;  3GJA A;  4WVV A;  3LE0 A;  3THD A;  3WQ1 A;  1K5M A;  3R05 A;  4H2A A;  3PL0 A;  5JXJ A;  1CAU A;  3PUH A;  4PIY A;  4IEQ A;  3OPW A;  3VKL A;  2ZPX A;  4AZZ A;  2F6B A;  3BTA A;  2Z5W A;  5F5C A;  2ZZJ A;  2JEM A;  3IAP A;  1V6M A;  4YWA A;  1QJX 3;  1XYO A;  1GIC A;  4L8Q A;  3SC7 X;  5BNP C;  1GU3 A;  1DYO A;  3NST A;  5E16 A;  3N9Q A;  4PQ9 A;  4A2U A;  4BXF A;  1UAI A;  1DYK A;  5FY9 A;  5EPA A;  3EJK A;  2B4K A;  4RFT 0;  4AHY A;  2ZEZ A;  3UK9 A;  1HRI 1;  3ZO0 B;  1RUH 3;  2OUJ A;  3POE A;  4Q4V 1;  3LDK A;  4A45 A;  4R9D A;  4Z1V A;  5B4N A;  2V09 A;  1NAE A;  5FOB B;  4IV1 A;  1BMV 1;  5HCA A;  1W6O B;  3U07 A;  4HL0 A;  3SH3 A;  2K0G A;  1ULO A;  3ZXK A;  2AAC A;  5FXX A;  2P2K A;  1MS9 A;  1PO2 3;  1OFN A;  2WFF 2;  5EWS A;  4CXX A;  4MG2 A;  4D7Y A;  4AL9 A;  5KC6 A;  3ZN6 B;  3ITQ A;  3SIS A;  4S2H A;  1E5R A;  2EXK A;  2W5F A;  1EPW A;  1PO2 1;  1FYU A;  2JXA A;  4Y26 A;  4FPK A;  1RUI 1;  4BK5 A;  2TBV A;  1NQD A;  5CEH A;  4AVB A;  3WF3 A;  1OH3 A;  2I45 A;  3KCX A;  2ARC A;  1RUD 3;  1OQ1 A;  1YFY A;  2JDZ A;  4DQA A;  1S0B A;  3UYJ A;  3QBQ A;  2B42 B;  3B9C A;  1W0O A;  1N3Q A;  2OQ7 A;  2A3Y A;  2ZXQ A;  4PIX A;  4A3Z A;  1MPX A;  3O1P A;  1LGC A;  4LUL A;  2XJT A;  3K4Z A;  4F8A A;  1AR9 2;  1KGY A;  2WZR 2;  2Q4S A;  2QQJ A;  3ZSE A;  1FV2 A;  4FTE A;  1B09 A;  3BIE A;  4K1Z A;  1PZ8 A;  5FYV A;  2B7Y A;  1RUF 3;  4WVZ A;  5FXW A;  5LA0 A;  1H8V A;  3GZA A;  3KM5 A;  3W5M A;  3GGL A;  2WS9 1;  5FKC A;  3I3Q A;  4QPI C;  5FIX A;  2W94 A;  1I5Z A;  2R04 2;  3E97 A;  2C4X A;  5FLH A;  1UOJ A;  3ZXE A;  3T1L A;  3ZDV A;  5C9A C;  1LCL A;  2XR4 A;  5ACA 3;  4I2O A;  4AI3 A;  2Y6G A;  3H50 A;  4XF0 A;  5LY1 A;  2HWB 1;  3PU3 A;  5IFP A;  4XQW A;  2J7M A;  4IV1 B;  4NPR A;  3LPF A;  5GZE A;  1UMH A;  3MPB A;  3T30 A;  1GMM A;  4Q0P A;  3SCF A;  1ZA4 A;  3CJX A;  5FZG A;  1AXZ A;  1Q56 A;  5ISL A;  4Q27 A;  3ZYR A;  3HIF A;  3QOP A;  1LKN A;  1S0D A;  1W90 A;  3P3N A;  4N9H A;  5LB6 A;  4GH4 B;  1BLZ A;  4LO6 B;  3I2I A;  3PVO A;  3WHT A;  2VZU A;  5DPN A;  4KU7 A;  4SLI A;  1GZ9 A;  2X5I C;  4JAA A;  5F39 A;  2VUA A;  2GP3 A;  5FMO S;  1AL2 1;  4LBK A;  1QXP A;  1YI7 A;  1GOF A;  4NVP A;  2RS5 2;  1GQG A;  3ILR A;  4B29 A;  1W99 A;  5AFB A;  3T1M A;  4JDO A;  2RS1 1;  3IZO A;  2VTF A;  4WV8 A;  4AHZ A;  3M3I A;  5C9A B;  5C6C A;  1LTE A;  2GMM A;  2Z42 A;  2PHL A;  4CCE A;  1RXF A;  5CA6 A;  2JD4 A;  4B1M A;  1WKY A;  5A7W B;  2RM2 1;  3VKN A;  1QEX A;  2EAK A;  1W8F A;  3WDT A;  2VVF A;  4RSU A;  3MIG A;  3AP9 A;  4R9C A;  3PJY A;  5FR3 A;  1W9W A;  4I02 A;  4RN5 A;  4V1P A;  4AED C;  4B4R A;  1LAJ A;  2WZR 3;  3OEA A;  1TMF 1;  1POQ A;  1H1A A;  3JXS A;  5FV3 A;  4YAR A;  1SZB A;  1WLD A;  3PLQ A;  1PK6 C;  4CUC A;  1J3Q A;  1P8J A;  2ZHM A;  2SBA A;  3WIN E;  4CDQ A;  5C5T A;  2Y6J A;  2YHJ A;  4Q4X 3;  3ELN A;  3JUU A;  1JXN A;  4N43 C;  2W95 A;  1OBN A;  1UX7 A;  1CX1 A;  2WL1 A;  3PUS A;  4W65 A;  5FUN A;  3C7G A;  3KGZ A;  4NO4 A;  3WP3 A;  1I3H A;  2LS6 A;  1LU2 A;  3T3Y A;  3EXU A;  4LOR A;  3VBF C;  1LOF C;  1BHG A;  1U5X A;  4FSJ A;  3JQW A;  2BV4 A;  5CKQ A;  1FX5 A;  3HNM A;  3N9O A;  4FOY A;  4CU7 A;  2E7Q A;  3KHC A;  5BNO C;  1NCQ A;  4Q0V A;  3JD7 1;  3SH4 A;  4E8C A;  2Y0I A;  3LSE A;  5FZC A;  4FFH A;  1COV 3;  1Z7S 1;  1E5I A;  1SAC A;  1ENX A;  1RUJ 1;  3C7E A;  4LLO A;  1WMD A;  4MVT A;  1QNW A;  4AQ2 A;  2VQU A;  2YU2 A;  4I3P A;  5EP9 A;  3LSD A;  3OUH A;  2FHR A;  1RUH 2;  3AL6 A;  3J7H A;  3VGI A;  2O1Q A;  3H7Y A;  2R06 2;  3I2G A;  4LBM A;  4M0N A;  1Y4W A;  2XVL A;  1DP0 A;  4Y22 B;  2WNU A;  3IMM A;  2G4I A;  2Y64 A;  5EYY A;  3L2H A;  1L3J A;  2W08 A;  1IOA A;  2GH8 A;  3POY A;  2BGC A;  3QLQ A;  4HK9 A;  3POG A;  2XG3 A;  2WO1 A;  4JGZ C;  3AMP A;  4OZO A;  4S2F A;  4W6X A;  5BY5 A;  3WSO A;  5ACA 1;  4XPV A;  1PO2 2;  4GH4 C;  5A32 B;  2WAA A;  5DDJ 3;  3ACG A;  5FY5 A;  3ZYB A;  4N53 B;  1EY2 A;  2Q8C A;  4AHX A;  2ATF A;  2JIJ A;  1XYN A;  2X05 A;  4N8M A;  1G9D A;  1G9B A;  4GWN A;  2CDP A;  2J1V A;  4LO8 A;  4E27 A;  3E5X A;  1JYV A;  1N3P A;  4Y5T A;  4K7J A;  4UFJ A;  5C4W A;  2A6Y A;  2UWA A;  1MAC A;  1UIJ A;  3OYW A;  3Q8F A;  3VL9 A;  5BNO B;  1D2S A;  1YIP A;  1JU3 A;  4XF3 A;  2PXJ A;  3VHR A;  2HEY F;  2EIB A;  4TSV A;  4GIQ A;  3FE5 A;  3OF1 A;  1CPM A;  2XQX A;  1KEX A;  2PFW A;  4CUB A;  2CSG A;  4YG6 A;  2P3J A;  2ZGL A;  3LCP A;  1N47 A;  4ORF A;  1RMU 2;  4H14 A;  3VD4 A;  4ASL A;  1QJU 1;  1AYM 2;  5IVV A;  4XHB A;  1GSL A;  4K6B A;  1US2 A;  4UYB A;  3IBM A;  4AEM A;  1JZ7 A;  3WX5 A;  1VRB A;  1ULD A;  4BIS A;  1QWR A;  3THC A;  1KIT A;  2GN7 A;  3VKO A;  1SMV A;  2E33 A;  4O65 A;  3VDD C;  3WR0 A;  2BVV A;  3J7L A;  4YW1 A;  5C7G A;  5A3T A;  4GUL A;  1JW6 A;  2J1T A;  4Y22 A;  3VBO B;  5K8S A;  5HXM A;  4R9B A;  1OA3 A;  4HMZ A;  3VBF B;  1JZ8 A;  1RJ7 A;  1LES A;  5CAZ A;  2FDG A;  2XOM A;  1H1I A;  3KZ4 C;  4IW3 A;  5FY4 A;  1F5F A;  4QMA A;  1HQW A;  3LDR A;  5A6Z A;  4FTB A;  1F2N A;  2JDY A;  3LA2 A;  2XB6 C;  3PME A;  3BOW A;  2B39 A;  2Q5T A;  3WF0 A;  2O0O A;  1B35 A;  2O8Q A;  3W5N A;  4FT8 A;  3LA3 A;  1XU1 A;  1H9P A;  1XU2 A;  3AZY A;  3LPG A;  2Q8E A;  3H0O A;  1PVC 2;  3H3U A;  4NID A;  3NRU A;  3IDC B;  5FPA A;  4S2D A;  1JZ2 A;  3EYP A;  2HBT A;  4MGK E;  2YV8 A;  3WY6 A;  4UBH A;  5IWF A;  5GJ6 A;  2YG0 A;  1X82 A;  4ZPI A;  4X8N A;  1QH7 A;  2VZQ A;  1Y3T A;  3CL1 A;  2EXJ A;  5A3U A;  1ZRR A;  2N7G A;  3JBG 2;  4UW5 A;  3T2Q A;  3DPR C;  4PCR A;  2JG9 B;  4LA2 A;  5FP7 A;  1XE0 A;  3HPN A;  3CEW A;  3NQH A;  1HV0 A;  4OMD A;  3A0K A;  3B9I A;  4PLO A;  5L9B A;  4BE3 A;  3U4X A;  3TEY A;  3KT7 A;  3GHN A;  4XQD A;  3HT2 A;  3KT4 A;  2WLP A;  3MIF A;  4IGP A;  1WW6 A;  1LHU A;  1OVP A;  3BN6 A;  1UCX A;  1ZZ7 A;  3SXW A;  3RI9 A;  1S2B A;  1XNT A;  3FHQ A;  5FWE A;  3UJQ A;  2H0B A;  4QQH A;  4XUQ A;  4L97 A;  5FP9 A;  3BU0 A;  1RIT A;  1CJD A;  2W1Q A;  1W9S A;  3M7A A;  1PIV 1;  2JB4 A;  1DFQ A;  1UD1 A;  3N7M A;  1EAH 1;  2Y6H A;  4FPO B;  4MXW B;  1NCR A;  5I0T A;  1V6L A;  3N7K A;  3VZJ A;  5I0S A;  4PDW A;  1NX9 A;  4QX3 A;  1AF9 A;  1G9F A;  1XBF A;  5FZB A;  2B8M A;  2D6P A;  2R0H A;  2KM2 A;  4HOO A;  3SCH A;  2RM2 2;  2A3W A;  5I8Y A;  2K9Z A;  2RMU 1;  3OCP A;  3SLI A;  3MHZ A;  3DKQ A;  1GP4 A;  5CU1 A;  5A7W A;  3D4K A;  2JB8 A;  4BPZ A;  2ET1 A;  4AVT A;  4DS0 A;  1PM7 A;  5BNN C;  2Y6L A;  2BPA 2;  1S0E A;  4XE9 A;  1N3O A;  2TEP A;  3D0S A;  5DUV A;  5T50 A;  1UPS A;  1WW5 A;  4XDP A;  4YNI A;  4DPN A;  1HRV 2;  2IWG B;  1WCK A;  2AGS A;  3JB8 A;  1VAL A;  2AYH A;  1ND3 C;  2VOW A;  2ZA9 A;  1HW5 A;  2QKD A;  2EAA A;  2B9U A;  1HB4 A;  3OUJ A;  1CAV A;  1H2L A;  1W8U A;  3T2O A;  2VNV A;  3ZSJ A;  5J7M A;  2DFB A;  3AYA A;  3F95 A;  4AAP A;  3DXT A;  2HWF 1;  4QXB A;  4QHO A;  1AYN 1;  1UU4 A;  4UXA A;  1H8T B;  2ZMK A;  1SLC A;  1MQT C;  5CYY A;  4C91 A;  4NE9 A;  1WCS A;  4DY3 A;  3J9S A;  4R52 A;  4QX1 A;  4CPB D;  2GAU A;  4XEZ A;  1CVN A;  1OHF A;  1SBF A;  2AEY A;  3CDZ B;  2IXC A;  1OLR A;  4HON A;  1W3V A;  1YO8 A;  4OLL A;  3KT1 A;  1XXN A;  1UOF A;  1VLN A;  1WA4 A;  3SHR A;  1GYK A;  1IQD C;  1T6G C;  2ZX2 A;  5FLJ A;  5AC9 3;  1MS5 A;  5JZG A;  3UV9 A;  2ZGT A;  3FMG A;  1JS9 A;  2R04 3;  2VBP A;  4JV4 A;  4OHW A;  4ISQ A;  3FHA A;  2O8O A;  3KV9 A;  1D4M 1;  1DGW A;  1ND3 B;  4Q2F A;  5ANQ A;  1HQN A;  1XOY A;  2WWS A;  2ET7 A;  4GAZ A;  4B7K A;  1TME 3;  1REE A;  1LGN A;  2JDH A;  4N53 A;  1R1A 1;  1DF0 A;  1W06 A;  4QPW A;  4DNY A;  5FQ0 B;  1ZBE 2;  5K0U C;  1EV1 1;  4AFC A;  2IFR A;  4P00 B;  1A6C A;  1RIR A;  3N9M A;  2ZBJ A;  4JRL A;  5DZE A;  3T09 A;  2EIC A;  1RUD 2;  1DQ1 A;  1R08 1;  3I59 B;  4UF0 A;  4Y5Z 0;  3RQ0 A;  3MID A;  5GLU A;  2E53 A;  1L7R A;  3I8T A;  3TWI A;  1RUI 3;  4DMI A;  1L7Q A;  3I2K A;  4OHV A;  3VBH A;  4Y1X A;  3P6B A;  5F1R A;  3V0B A;  4GKY A;  4IUG A;  4PI0 A;  5IYY A;  2CGP A;  4D7T A;  1UYY A;  3DKW A;  2WNE A;  3FC0 A;  5KXD A;  1X8E A;  1HRV 3;  2XXZ A;  5DAB A;  1VP6 A;  1PO1 2;  4QXC A;  1OKQ A;  2XJU A;  1RYY A;  4E4S A;  5A3L A;  1JHJ A;  3SKV A;  2VMI A;  5DAV A;  5C8C A;  4JGY A;  4EJR A;  2NZ9 A;  4QDS A;  3V65 A;  5BNQ A;  2RS3 3;  4XDO A;  1HN1 A;  3ZX7 A;  1CD3 G;  2FBE A;  4Q4V 3;  2YC4 A;  3WP5 A;  5IK7 A;  4LJH A;  2ZCW A;  2RR1 3;  4Q4W 2;  4PT6 A;  3KS7 A;  3I2D A;  3WF2 A;  2ETE A;  4XF4 A;  4CEY C;  2J22 A;  2VUD A;  2WWJ A;  1SPP B;  4R9A A;  4URA A;  5FZL A;  1OOP A;  5A1L A;  1QGL A;  3RSJ A;  4XBL A;  1RUI 2;  1W0P A;  4CDX C;  4YW7 A;  1WBL A;  5A3W A;  2A71 A;  3ZFG A;  4AXO A;  3G7D A;  1NLS A;  5LA9 A;  2MHF A;  1KDK A;  4AVC A;  3WVJ A;  1Q5O A;  3WNN A;  5IK8 A;  1KRI A;  3FN9 A;  3R4D B;  1HB1 A;  5FMD A;  2RDR A;  4JZR A;  2PHF A;  2A75 A;  1AYM 3;  3MLJ A;  3Q8B A;  3RRD A;  1UU5 A;  1W2T A;  4KG8 A;  2DCK A;  1QMJ A;  4Y4Y A;  3WQ7 A;  2VUJ A;  3POB A;  3VBH B;  3I97 A;  3ZYP A;  4YFZ A;  3PJQ A;  4WZC A;  3V0B B;  5A6Y A;  5EIY B;  5A7Q A;  3WZ1 A;  3WUC A;  5DZG A;  3WW3 A;  3CQO A;  1Y7B A;  3TEW A;  2QQP A;  1Z7S 2;  2IZW A;  4GMP 1;  3BKZ A;  3WDY A;  1OH4 A;  4P9Y A;  1UU6 A;  2JE7 A;  1RHI 1;  1DBN A;  4Q1P A;  4AI9 A;  1GNZ A;  4ZXK A;  1PVC 3;  4JVA A;  4CEW C;  1JYI A;  4XC9 A;  4CYD A;  3VBU C;  3M1H A;  4AI1 A;  1Y43 B;  2V5Y A;  4LHL A;  2Z79 A;  1V6I A;  5CFC A;  2FMY A;  4UW4 A;  2AC1 A;  4KGG A;  2CYF A;  3HAG A;  2ZAC A;  2VW0 A;  4L11 A;  3SCG A;  4BIF A;  1OF3 A;  1AVB A;  1HQL A;  1NY7 1;  1AHS A;  1UYZ A;  2Q1Z B;  5C3Q A;  5C3R A;  5CAD A;  4W8J A;  4JTO A;  1LHN A;  5JLV A;  3OGV A;  1SPP A;  2MEV 3;  5FZ1 A;  1V9U 1;  4YG3 A;  4MGQ A;  4QHZ A;  1VMH A;  2P17 A;  3AB0 A;  1RUO A;  5T3N A;  2E9Q A;  1POV 1;  1SQ4 A;  4BQ4 A;  3MUY 1;  4CDW B;  3GZE A;  2YPD A;  1RHI 2;  2JEN A;  3ZYG A;  5C3O A;  3W21 A;  3J26 N;  5ABJ B;  1MQT B;  1W6N B;  4XFG A;  4YM1 A;  1HRV 1;  3OSD A;  3JU9 A;  4LBJ A;  4LKE A;  4XZU G;  3FLT A;  3OYW B;  4KI5 M;  5HCH A;  2W39 A;  1DGW X;  4AI8 A;  1TME 2;  4OMC A;  4LO4 B;  3AVR A;  3AYE A;  3NAP C;  4NIG A;  2VE1 A;  3ZPO A;  1JI6 A;  1HJG A;  2AR6 A;  4TN7 A;  4XUR A;  2QZ3 A;  4J25 A;  1AR6 3;  5JVV A;  4W50 A;  5FXZ A;  4J1X A;  4UW6 A;  3ZYJ B;  4C8D A;  1TEI A;  1SBE A;  2RMU 2;  3KF5 A;  2GC1 A;  2XL7 A;  4K20 A;  3E5Q A;  2TNF A;  3E5U A;  4NIH A;  2IC1 A;  1Q43 A;  1HIX A;  4I01 A;  4MGY E;  3POS A;  4CXW A;  4LBQ D;  3VBS A;  2XGX A;  4Y1Y A;  3H3L A;  1RUD 1;  1PGL 2;  1V6K A;  5FBJ A;  4CCK A;  1OA4 A;  1ND2 A;  2ERF A;  3S30 A;  5L7O C;  2DUR A;  3ACI A;  3MFC A;  1QDC A;  2GNT A;  4WM8 B;  4IXL A;  4ZXE A;  2UUR A;  1NKG A;  5A7P A;  1YC6 1;  2I74 A;  1E57 A;  2HWB 2;  2JKB A;  2Y38 A;  2C5D A;  4LR4 A;  2HWD 2;  3N7J A;  5DUX A;  4BDV B;  4XW3 A;  1PMJ X;  1JH5 A;  3USU A;  4CE8 A;  2X53 S;  4V2V A;  4XOG A;  3MW3 A;  5DAW A;  1AR7 3;  1CIY A;  1W6Q B;  1POV 0;  1HXS 3;  2R06 3;  3GDB A;  4XFC A;  4MOA A;  4AVA A;  3ABZ A;  3FFQ A;  2FDK A;  2IXK A;  4D7S A;  4QD2 A;  4DY5 A;  1BMV 2;  4EN8 B;  5C8W A;  2WQ4 A;  1PZ7 A;  5IT6 A;  3MPP G;  3BUC A;  1IGO A;  1OUR A;  1HRI 2;  1FOD 3;  2E26 A;  1SFY A;  3OUI A;  1HXS 2;  1SFN A;  2ADE A;  3S5Q A;  5A6X A;  4FPC A;  4XAC A;  1LOG A;  5FLI A;  2ZKL A;  3VZK A;  1IKP A;  4JHT A;  2ZEX A;  5A80 A;  4O61 A;  3B01 A;  1DQ6 A;  4H7L A;  4RHV 2;  3RZJ A;  4XJU A;  3RFR A;  1NQJ A;  2CHH A;  3VUO A;  1YFU A;  4QM9 A;  2OS2 A;  1Q8P A;  3DXU A;  5GKA C;  4LXL A;  1AX0 A;  1U5Y A;  3ZXL A;  1R08 2;  1L7L A;  2D44 A;  2VNR A;  4ITC A;  4RR3 C;  4RQP B;  4WM8 C;  4QX5 A;  2WRA A;  4A3X A;  1VBB 3;  5FPU A;  2Y6F A;  1H2N A;  4WVW A;  2VMC A;  5KXC A;  4K3U A;  2GC0 A;  5FZ6 A;  2DCZ A;  3TEZ A;  5FP4 A;  2YGL A;  3ALQ A;  1H0B A;  4PJY A;  4NII A;  1WLC A;  1QU0 A;  2VZV A;  3BU7 A;  4QGN A;  4CP2 A;  1GNY A;  5FYC A;  2WS9 2;  4EYU A;  1X9P A;  3GM8 A;  3IWZ A;  1ZZ8 A;  4LE4 A;  4URT A;  3WHU A;  2D6N A;  3AJY A;  3HT1 A;  2RS5 1;  4YSF A;  4LBQ B;  1AXK A;  3OEB A;  4AEK A;  5GLV A;  5AC9 1;  1R1Z A;  1W8H A;  5L19 A;  4GD4 A;  1UOB A;  3EBR A;  5ANN A;  2XH6 A;  3THT A;  1GWM A;  3C8X A;  5FOJ B;  3BPZ A;  2WZP P;  1BBT 1;  3S6P A;  4YLZ A;  1IKQ A;  2VZR A;  5BUV A;  1WMF A;  4QB1 A;  4TYS A;  4WZF A;  2HYX A;  4IEO A;  2JDK A;  1AR8 3;  1UKG A;  2JDA A;  4I0W B;  5AVA A;  5L7O B;  3BI3 A;  1TQ5 A;  5F6K A;  1JUH A;  4KWL A;  3WG2 A;  4G4F A;  3WW1 A;  1R09 1;  4FFG A;  5FJH A;  1ZZ9 A;  2XKP A;  1BKZ A;  1DLL A;  5A33 A;  4MV2 A;  4E4H A;  3HN3 A;  1TMF 3;  4O9G A;  2JWP A;  1TNR A;  3THP A;  4LK7 A;  3A23 A;  4Z2A A;  1WD3 A;  3K77 A;  1JN2 P;  1LED A;  2ENR A;  5ACA 2;  3BTY A;  1QOT A;  1LU1 A;  4XQ4 A;  3WF4 A;  1YYN A;  2AEZ A;  1UX6 A;  2D3P A;  4PBO A;  2WNV B;  5J96 B;  1W0N A;  1QXJ A;  3VBR A;  5JMC A;  1VMF A;  1O59 A;  1GOH A;  3T2T A;  4H3W A;  2R06 1;  1TZO A;  4GWJ A;  2EXH A;  3ZXJ A;  3MLL A;  4YW6 A;  5C3S A;  2RG4 A;  4I30 A;  1QJE A;  1EPZ A;  1XYP A;  1RUJ 2;  5F3I A;  3O5S A;  3SEP A;  4BMB A;  3CJI B;  2GDF A;  1IS4 A;  1WWY A;  5BNP B;  3LDB A;  3VD5 A;  2Y60 A;  4Z8B A;  1BVV A;  1NA1 C;  5B4X A;  4LEJ A;  4IDZ A;  4QDR A;  5FYI A;  4D8M A;  5KR7 A;  2A7A A;  1C5I A;  4MYE A;  2YUE A;  2P6H A;  3DV8 A;  1V9U 2;  2P4E A;  4R4Z A;  3GBG A;  1J1L A;  4YZ3 A;  3RMX A;  3ZPY A;  1G9C A;  1H4G A;  2DTY A;  4HN0 A;  5LAT A;  4QGL A;  4YYO A;  2I2S A;  1QJZ A;  1LGB A;  2R07 2;  2DTW A;  2PMW B;  3ES4 A;  3MIE A;  2IXJ A;  3RWK X;  3U11 A;  1W6N A;  1UZZ A;  2Z4F A;  5EJ3 A;  4A7Z A;  3AP5 A;  1CZV A;  3MUZ 1;  2WYS A;  5F3G A;  3LEG A;  4F83 A;  4LUK A;  5H9S A;  1SDW A;  1ASJ 2;  5FO7 B;  4QB2 A;  4XYX A;  4PI2 A;  1UZY A;  4PLN A;  3I3M A;  3DYM A;  4UF0 B;  4QPY A;  4GB3 1;  3LF7 A;  1MVQ A;  1GWL A;  2ZGN A;  4IND A;  1T2X A;  4FCA A;  5FWJ A;  1MZE A;  1QJU 3;  3BIW E;  1Y9G A;  1MS8 A;  1ULC A;  1Z78 A;  2X8K A;  3PMS A;  3ROU A;  5IVB A;  1RUF 1;  1GAN A;  2RJK A;  4LHN A;  4OUM A;  1AR8 2;  3N7L A;  4CP0 A;  1BJQ A;  1OLM E;  5K9Y A;  1DGL A;  2PQS A;  5J36 A;  2NM1 A;  4M3C E;  1DZQ A;  4MGT A;  3UJO A;  5C8C B;  4M01 A;  2CGN A;  2IXL A;  2QZ2 A;  2UYB A;  1S0G A;  4XBN A;  2VZT A;  2VCM A;  2A73 B;  4RGG A;  3TNP B;  1AZD A;  3T0A A;  2VMH A;  4XUP A;  1ZX5 A;  5HCF A;  1W2U A;  4TWT A;  2JG9 C;  1H6Y A;  4XF1 A;  2QBX A;  3POW A;  1XB9 A;  5EFU A;  4QQL A;  2ADD A;  5GAL A;  5T54 A;  5F7U A;  3BTX A;  4OHY A;  1O91 A;  2VH9 A;  3T4V A;  4EWD A;  3M4F A;  3LOB A;  3R0R A;  3MI8 A;  4BLJ A;  1JZ6 A;  1US3 A;  4MHU A;  4HVO A;  1VAM A;  1OSG A;  4AEJ A;  1RB8 G;  1OT5 A;  3OPZ A;  4YW3 A;  3AFG A;  3HOB A;  2XJV A;  5HXV A;  1K3I A;  5H9R A;  2SLI A;  3IDA A;  3UT0 A;  2JKX A;  3V0A B;  1QJY 2;  5A32 A;  3NJV A;  4KWK A;  4BXS V;  4IV3 C;  4JC1 A;  4XTP A;  2JG8 A;  2VUL A;  5C70 A;  3ZFE C;  3LA7 A;  3ACH A;  4OI0 A;  1H8T C;  1NYW A;  4BQ3 A;  2DCT A;  4MGI E;  1FPN 1;  2OPK A;  5FZD A;  1ZZC A;  1RUG 3;  1UY2 A;  4YZ2 A;  4MET A;  4CEY B;  5AC9 2;  1U12 A;  4FTS A;  1AR6 1;  2HKX A;  2JDM A;  3OPT A;  1GP5 A;  3FZ3 A;  3WG4 A;  5FYH A;  4NUB A;  2W47 A;  1OLM A;  5CKM A;  2XML A;  1CAV B;  4B4Q A;  2BGO A;  3IDE A;  4NPM A;  5IVC A;  3AKP A;  4JKK A;  2IFW A;  2ZHK A;  1X36 A;  2K2S A;  4KU8 A;  4LBL A;  5FPL A;  3VZO A;  4COZ A;  5I93 A;  5FY0 A;  2LM3 A;  2VO5 A;  4MO3 M;  5BPX A;  1CN1 A;  2WZR 1;  3UES A;  3H1M A;  5C33 A;  5JOX A;  1LRH A;  2HYK A;  1AL0 G;  5F9T A;  3ATG A;  5IAV A;  4DXT A;  4IL7 A;  1R08 3;  2C26 A;  3HBZ A;  3D82 A;  4CDW C;  3CO2 A;  4OZX A;  2CL2 A;  2HWD 3;  1PMI A;  5CIR A;  3QCW A;  5FZA A;  3S0M A;  2A5Z A;  3AVS A;  3F2Z A;  2BBA A;  4X6R B;  1JZ4 A;  5LEK A;  3D3A A;  3KLS A;  3IPV A;  4IV1 C;  1OD5 A;  2JIC A;  2L9L A;  4NOT A;  3GHM A;  3VHP A;  4L2N A;  4NRP A;  4DB5 A;  2VW2 A;  3W58 A;  3T0D A;  3S57 A;  3A21 A;  1FOD 2;  2VZ1 A;  2VJX A;  1F5J A;  2RS3 1;  3NV3 A;  4X6Q B;  4IEP A;  5APA A;  1URX A;  3WQ0 A;  5E6H A;  4MHR A;  4KMQ A;  4OVE A;  1JOJ A;  2QDN A;  5FCC A;  4BQ1 A;  5IJR A;  3U78 A;  4XIK A;  4FP2 A;  5LY2 A;  1G9A A;  2RMU 3;  2VR4 A;  3OY8 B;  2PHU A;  3LB9 A;  5ABJ A;  1JU4 A;  2DVF A;  4HG6 B;  1YFX A;  1XQN A;  2AZ5 A;  3NNJ A;  2YU1 A;  3ZFF A;  1I1E A;  1Q8O A;  1JYT A;  3AP7 A;  1O4Z A;  2P3Y A;  2D6L X;  4FOQ A;  4RL7 A;  1PVC 1;  1LOA A;  2WN2 A;  3KV6 A;  4FPY A;  2GAL A;  1J3P A;  1IG0 A;  2XJR A;  1AR9 3;  4B7E A;  3C7H A;  4ET7 A;  3OBA A;  1KQR A;  4JRA A;  3FL7 A;  1AYN 2;  5FYU A;  5A3N A;  3D6E A;  3OOX A;  1MVE A;  3UKT A;  1ZRF A;  1NA1 B;  3O0V A;  5JIA A;  3AP6 A;  1BXH A;  5J1X A;  4QPI A;  4RS5 B;  1LHV A;  4IEY A;  5CKN A;  2YY1 A;  4P5Y A;  1CAX A;  3ILN A;  2XQR A;  5FAX A;  2QVS B;  2WIN B;  2WWU A;  3NW4 A;  2YXS A;  3B7M A;  4UW3 A;  1QQP 3;  5A7N A;  2O14 A;  1LB2 A;  1NCR B;  4PHZ A;  1C28 A;  1K45 A;  4CCN A;  1W3X A;  3CJI A;  5LK7 B;  1V6N A;  2WLQ A;  3LZZ A;  4K40 A;  5HBA A;  1UMI A;  3LEM A;  3E6C C;  4ARY A;  1SFP A;  2XVK A;  5KHK A;  5E89 A;  3USU B;  1QJU 2;  4NRQ A;  2OA2 A;  3GXU A;  2Q30 A;  1AR8 1;  3PHM A;  1VBD 3;  2HBU A;  1LJ7 A;  4FVV A;  4JKM A;  3ZFG B;  2YBK A;  4DRV A;  2X5I A;  3ZSM A;  4OUL A;  4RYD A;  3UKV A;  4DIN B;  1CAW B;  2D3S A;  1GWK A;  3KCC A;  5LAS A;  1H1M A;  4XZP A;  5FMC A;  4A4A A;  4RS5 C;  3UKN A;  4NRO A;  2LAL A;  4UFL A;  4FP3 A;  4CCD A;  2WZ8 A;  2OT7 A;  1QHD A;  3IAQ A;  1ZM1 A;  5DAX A;  1SCR A;  2P34 A;  4DFS A;  2ZML A;  4UT5 A;  4SBV A;  2Q1F A;  3WCS A;  4Q8K A;  4WVM B;  1RUE 1;  4QQO A;  1UY4 A;  4ZHN A;  4A7K A;  3AZX A;  4JQR A;  4YVW A;  1PHM A;  1V00 A;  1ST8 A;  3RVH A;  4Q4X 1;  3J7N A;  4HBN A;  1FPN 3;  3C7O A;  4FOW A;  1QJF A;  4MUV A;  1VE0 A;  1ZBA 1;  4XIL A;  2F17 A;  2A3X A;  2J1A A;  4CDU A;  4QPI B;  5IAT A;  3DN7 A;  1VJ2 A;  4HT1 T;  2QFE A;  1PK6 A;  1RUN A;  1K5J A;  2D7F A;  4Z82 A;  4N7I A;  3J4U H;  2QQK A;  4TXW A;  3A7Q A;  3AZV A;  1FPN 2;  2WJS A;  1FOD 1;  2PAK A;  1HJF A;  3GZT B;  3K3O A;  1CES A;  4P9X A;  3MIH A;  3I3B A;  3N3H A;  3VBF A;  1LOF A;  2OII A;  4XMI A;  3I2O A;  5EZW A;  3U4S A;  2VCB A;  4ZU4 A;  5JI7 A;  3CZJ A;  5EQU A;  4HSJ A;  1Y9Q A;  1NCQ C;  3D8C A;  2DVA A;  2XBO 3;  2QQI A;  2YBS A;  1EAH 3;  2BNM A;  2JG8 B;  2DDU A;  4IE7 A;  1W6M B;  5DAP A;  5F2S A;  1XNC A;  4DXZ A;  4TZD A;  2W1U A;  1UXZ A;  2E7A A;  2VZO A;  1OF4 A;  2ZX4 A;  2QCS B;  3NNM A;  4NHX A;  1AJO A;  4B3N A;  2WNU C;  4IEU A;  5JDB A;  1WCU A;  2BER A;  1Q3E A;  4HFS A;  1G86 A;  4I09 A;  4XAB A;  5KXB A;  5I8T A;  5A33 B;  2W1S A;  4Q4V 2;  3C2U A;  3KQR A;  4DUX A;  4LPL A;  3JBG 1;  1ENS A;  4ATE A;  1S0I A;  3HBK A;  5FZ7 A;  4Z2W A;  4GJZ A;  3A4U A;  4PQQ A;  3PDQ A;  4CXY A;  5JPN B;  2PLV 1;  1W2A X;  3ZDS A;  5F5A A;  1VIW B;  2ZEY A;  4N7U A;  4WM7 A;  1W6P A;  1IHM A;  1UXX X;  4YPJ A;  2R30 A;  4CDU B;  3SQO A;  4FBF A;  4DO0 A;  1YHF A;  1ULP A;  2C9K A;  2PLV 3;  3TN9 3;  4QDQ A;  3VBS B;  5C4W C;  4XXA A;  5GZF A;  3KVA A;  2DBN A;  5J37 A;  2VCA A;  4L9B A;  2RM2 3;  5LRR A;  2YDE A;  1TVG A;  4Q4X 2;  2ZAH A;  5JOW A;  2DCJ A;  4HSL A;  2ARE A;  5LEJ A;  4FXG B;  4BME A;  1ZBE 3;  4DXR A;  2ZS6 B;  1VBB 2;  2DUP A;  2HWC 1;  1POV 3;  4PDW B;  5JPM B;  1NY7 2;  1LNS A;  2GNB A;  1VBC 1;  3HQX A;  4M4P A;  3VD7 A;  5JOZ A;  1UYX A;  2VMD A;  4LQR A;  5JXG A;  3HQU A;  1OC1 A;  5BYN A;  3JQX A;  3N9P A;  4LA3 A;  1Y9M A;  4Q0U A;  5D1I A;  1QQP 1;  1VMJ A;  1FV3 A;  1DCS A;  2EIG A;  5FRA A;  3VDD A;  3ECQ A;  2P1B A;  3VKF C;  4EN7 B;  2BU9 A;  2ORZ A;  1DGR A;  1Z0H A;  3MF9 A;  1HRI 3;  1C5H A;  1KS5 A;  2NQY A;  3R4U A;  4LK6 A;  3OBZ A;  4A41 A;  1WCD J;  2G9G A;  2WT2 A;  1VBD 1;  3JD7 3;  1A8M A;  1A8D A;  1BZW A;  5EJ1 B;  4QT6 A;  5FY1 A;  1QJX 1;  2BQP A;  2UY9 A;  1VRH 2;  1JYN A;  4RQP A;  3TNQ A;  2DWR A;  3RNS A;  2PEL A;  5HPO A;  2NP0 A;  2JJ6 A;  1HDK A;  2XJQ A;  1VR3 A;  1OA2 A;  5FYM A;  1O5U A;  5DXD A;  1YFW A;  1HB2 A;  4L0P A;  4WM7 B;  2XLA A;  5KBF A;  4KBZ A;  1V6O A;  4Z07 A;  4GAL A;  4KL1 A;  1AJK A;  2ZGS A;  5F6L B;  1D2Q A;  4Q29 A;  3VZL A;  2QNK A;  4C0B A;  1DIW A;  1VBA 3;  4AG4 A;  4CRQ A;  4BWO A;  3ZIW A;  4AE2 A;  1OMI A;  3FWE A;  2FDH A;  3GZU C;  3O14 A;  4CCM A;  2JDP A;  2BJS A;  5T52 A;  4AED B;  1NUK A;  1NOV A;  2ZGU A;  4FAG A;  1PIV 3;  3RYK A;  4CPB A;  1GUI A;  4F7Z A;  5AFE A;  1MS0 A;  4LBQ A;  1E5H A;  4UFI A;  1O5L A;  1UN1 A;  1O3Q A;  1BBT 2;  1K12 A;  2Q1M A;  4IER A;  4QPG C;  2YFZ A;  2W91 A;  1YQC A;  2H0V A;  3NJY A;  1Q8Q A;  4RFR B;  3KMH A;  1DGR N;  4QXH A;  3RPQ A;  1C57 A;  3SIT A;  4N43 B;  3BOP A;  3TRS B;  3NWK A;  4XJZ A;  1S55 A;  1M06 G;  1RUG 2;  5JXI A;  1ZRD A;  1B35 B;  4KNC A;  2X5I B;  1HXS 1;  2BWC A;  1RMU 3;  2FDJ A;  1YJL A;  2PAE A;  2KD7 A;  2PHR A;  1W2O A;  5DN2 A;  2EAL A;  4XFH A;  2DU0 A;  2XVG A;  1ULF A;  4LO5 B;  4GMP 3;  3AXD A;  4YVS C;  2ZAB A;  3N9L A;  1IPK A;  4PDW C;  4YGE A;  1YNA A;  5DZF A;  2QQM A;  4P9G A;  5A7O A;  4CP9 B;  1W8N A;  3EHK A;  3QD6 A;  5CG9 A;  3ZXD A;  1HB3 A;  1F4H A;  1RUE 2;  2DVG A;  2ZGQ A;  2ZGK A;  4KWU A;  4ZS3 A;  3ZYF A;  1LEM A;  3PVN A;  1OFS A;  1RXG A;  2MEV 2;  5FMO L;  4UWD A;  1XJA A;  2P3I A;  4YG0 A;  1CZT A;  1EYB A;  3P1I A;  3UL2 A;  3ZSL A;  1XC6 A;  5FTT C;  5JSP A;  1J58 A;  3JB4 C;  4OQ9 A;  1FMD 2;  2JE8 A;  2YBP A;  1RVF 1;  4MX3 A;  2A6W A;  3LFM A;  4S2G A;  3ZVX A;  5I91 A;  5A1F A;  4QQ2 A;  4XCA A;  3NVC A;  2HWF 3;  1VBB 1;  4JGY B;  4ZZ8 A;  2BTV C;  2WT1 A;  1UF2 C;  5LBF A;  5JR2 A;  2ZHN A;  1PMH X;  3K75 B;  1E5S A;  4HVR A;  3RS6 A;  4Q0Q A;  4QGM A;  3ZSK A;  2Y34 A;  4XIO A;  1MZF A;  2CNA A;  3OTF A;  3VB9 A;  5BNN B;  2WAB A;  1ZZ6 A;  3O0X A;  3PUR A;  2P3K A;  3HNY M;  3UGH A;  3RMY A;  2WNU B;  1WLT A;  3MO4 A;  1S0F A;  3FFZ A;  3IMN A;  5JMO A;  2QQO A;  3AJZ A;  4ES9 A;  4HLT A;  4P5H A;  1SLA A;  4P9I A;  2OX0 A;  1G7Y A;  3RJR A;  1IQA A;  3X29 B;  2Z2S B;  5IK4 A;  2LRO A;  4GKX A;  2HWE 3;  5C3P A;  2HLE A;  1KJR A;  4AFM A;  3MV1 1;  3PUI A;  3TBD A;  5FZK A;  4EWA A;  5SV8 A;  1RED A;  1LOC A;  4L99 A;  1QXR A;  1Q8S A;  1U5I A;  2ZMN A;  4HPK A;  1HLC A;  5FZ4 A;  3I2H A;  1XE7 A;  5EYX A;  2BFU L;  3EO6 A;  1JOD A;  2DVD A;  5JZG C;  2BEO A;  3VD3 A;  3ZFF B;  1QDO A;  1V9U 3;  1IG3 A;  4OQ8 A;  5JSO A;  4YFW A;  5FFO C;  2Y0O A;  3LKJ A;  2B45 X;  2HWC 2;  5LZ6 A;  5H9P A;  4LHK A;  4AI0 A;  4BM8 A;  1X50 A;  5E1R A;  3USS A;  4C1X A;  3VDA A;  1VBA 2;  3NJZ A;  3ZKY A;  3AZZ A;  3OD4 A;  1CPN A;  2W9X A;  3VBO C;  3WP4 A;  4MZU A;  1UY3 A;  2HWE 2;  2F4L A;  4YGB A;  2RR1 2;  1F8V A;  5DQ0 A;  4U36 A;  2KA3 A;  4RHV 3;  3WT3 A;  4D94 A;  1NLR A;  1W05 A;  3B3Q E;  3PTR B;  3PUQ A;  1NE6 A;  1VB4 A;  1XNA A;  3LEK A;  2ZOE B;  3NV4 A;  5CFC B;  3QH7 A;  4Q5O A;  3C3V A;  3UNP A;  2C9A A;  3RJ2 X;  5EV7 A;  3MGU A;  5JOY A;  1PO1 3;  3ZM8 A;  1XE8 A;  3IM0 A;  2EIE A;  5D8A A;  4K1Y A;  1YUD A;  5K0U B;  3WW2 A;  2RE9 A;  1U5Z A;  2YB7 A;  3PIJ A;  4W6Y A;  5EJZ B;  4ZY9 A;  3VHN A;  1BQP A;  2B9V A;  4I0B A;  2PHW A;  2XBO 1;  1PO1 1;  1QJY 1;  3GAL A;  2VOK A;  1KJL A;  4P02 B;  5DDJ 1;  3E1F 1;  4HKW A;  1BEV 1;  1SLI A;  4IE5 A;  1NT0 A;  1PM4 A;  4IE6 A;  4KG0 A;  3O1T A;  1FMD 3;  3U14 A;  5I0D A;  2JIG A;  3MF6 A;  4LT5 A;  3O1U A;  3LGR A;  1FNZ A;  2D6O X;  4QQP A;  3NO8 A;  4YGD A;  5CZK A;  1UWW A;  2R1B A;  3I4I A;  3WNO A;  2CAU A;  3PVE A;  1YJK A;  1VRH 3;  2RVA A;  3Q9O A;  1DQ2 A;  1CGP A;  2WBK A;  2VNG A;  4XUN A;  1RJ8 A;  1QH6 A;  4Q4Y 2;  4CUG A;  4BU2 A;  1QNY A;  5LBC A;  4BHP A;  4CTE A;  3WOG A;  1QF3 A;  4IE4 A;  2C24 A;  4B8E A;  3AZW A;  4IEV A;  1PZ9 A;  4CEY A;  5A70 A;  1DHK B;  2PHD A;  5FZI A;  2ARA A;  5CFD A;  5I0R A;  5J09 A;  1C1F A;  3ZFG C;  1AYM 1;  1WW7 A;  2CU5 A;  2D6K A;  2ZAA A;  4GQ7 A;  3GCW A;  3M3E A;  4YVW B;  1TE1 B;  2VZ3 A;  5GLZ A;  4BQ2 A;  5GM0 A;  1YWK A;  4EQV A;  2WS9 3;  1DLC A;  4AGR A;  3O1O A;  4AW7 A;  2WNV A;  4JGZ B;  4COY A;  2XL9 A;  2UYA A;  3FLR A;  3WUD A;  1NCQ B;  4LBN A;  3Q8E A;  1K5M C;  4LO7 A;  3ZYH A;  3AKR A;  1AL2 2;  3PUA A;  4Q4Y 1;  1N1S A;  5F2W A;  2D97 A;  2C6S A;  3ENR A;  1MZ6 A;  5E88 A;  1J84 A;  2BFU S;  4EE2 A;  4W4Z A;  1D7P M;  2BWA A;  2R07 1;  2RHP A;  4CP1 A;  2G1M A;  5BNP A;  1JMU B;  2WFP A;  4JQT A;  4PF1 A;  1IS3 A;  3I49 A;  2WNO A;  3KVB A;  4CEW A;  3O1V A;  2QJV A;  1C3H A;  3E6B A;  3OGS A;  3C7F A;  4OHX A;  5FO9 B;  3FUO A;  3K4A A;  4GMP 0;  3TYJ A;  2TUN A;  2BUK A;  4TLG A;  3ZKU A;  1UW8 A;  3MDP A;  4JDN A;  2RS5 3;  4XUT A;  5FJK A;  5FZO B;  4ZS2 A;  3B69 A;  1F9K A;  3Q8C A;  4AHW A;  1YCI A;  1GZW A;  5JIU A;  2ID4 A;  2CWM A;  4MAD A;  1GP6 A;  1O4T A;  1V70 A;  3KQ4 B;  3ZXA C;  1PVX A;  1LOE A;  1Z7S 3;  1W9Y A;  1NE4 A;  4AI2 A;  1O8P A;  2YMZ A;  2HEV F;  5FPB A;  4COU A;  1FAT A;  4IES A;  3SEE A;  4XBQ A;  3AC0 A;  1LHW A;  4CCJ A;  3AMH A;  1WBF A;  3RYR A;  2GN3 A;  3WNL A;  3AKS A;  3GYD A;  4HZF A;  4O9E A;  1UPI A;  1JYW A;  4HXC A;  3WV6 A;  2GH2 A;  3CU7 A;  3U37 A;  2HWD 1;  4Y1U A;  4PLM A;  3TAY A;  4FPG A;  5FBZ A;  2YYO A;  3CHX A;  5JCT A;  4M4R A;  2IXI A;  3CLP A;  3KGL A;  4Y4R A;  4NR1 A;  3NAP A;  3WNK A;  4AF9 A;  3AKQ A;  3ILF A;  3CNA A;  1XSR A;  5F5Q A;  2EA7 A;  1CJP A;  2R0F A;  3OGG A;  4IGQ A;  4X8P A;  4E8D A;  2A6X A;  1O8S A;  1GQH A;  1S0J A;  1ULG A;  2VC9 A;  3FX3 A;  3INA A;  4KH9 A;  1EUU A;  5HI0 A;  1X9T A;  4NRM A;  5IVE A;  1VBE 3;  2LTN A;  5C9A A;  3MW2 A;  3VKM A;  1JOB A;  5FO8 B;  1ULE A;  1FNY A;  2VXR A;  3HR9 A;  5LK5 A;  4CEW B;  3DPR B;  5IVJ A;  1G6N A;  1FI2 A;  2WO7 A;  4NPL A;  4BIO A;  1ZRE A;  2FDI A;  1CAU B;  2FD8 A;  2G9F A;  4LHS A;  5L7O A;  3TEX A;  4D0Q A;  1ZVF A;  4Q0S A;  3H42 B;  1CAW A;  1VBD 2;  3ZN4 A;  3APB A;  3VZN A;  3O1S A;  3BGA A;  3DL3 A;  2BGP A;  1G8W A;  1XND A;  3RYP A;  3KD4 A;  3MW4 A;  5GZG A;  1H6X A;  2WZE A;  3OGR A;  1RUC 1;  4FPH A;  4XFA A;  5I8S A;  3ZR6 A;  1JZ3 A;  4CA9 A;  4LIV A;  1HX6 A;  4NHK A;  2H6C A;  3LEI A;  1UL9 A;  4U2A A;  2QQN A;  3VHO A;  1PX4 A;  4JX0 A;  2R32 A;  1W6O A;  3KWV A;  1ZBE 1;  2R16 A;  4MLO A;  2J1S A;  1PGL 1;  3WDX A;  3MEP A;  4IET A;  3WDU A;  1WLW A;  1OQE A;  3AP4 A;  3ZXF A;  4HKL A;  1ODN A;  4QX8 A;  4OI2 A;  2WA4 A;  2VZP A;  2UWB A;  2D93 A;  2VOX A;  4QAW A;  4UFH A;  3NNL A;  2RDN A;  3KSC A;  1HV1 A;  2VBD A;  4JCK A;  1MR5 A;  1OLQ A;  4A6S A;  5B2G B;  5KHJ A;  5SV5 A;  4MSV A;  3WF1 A;  4FFI A;  5FK8 A;  4AED A;  4RR3 A;  4WM8 A;  1CR7 A;  3IPV B;  5F3E A;  2FZ1 A;  1GLH A;  3POI A;  5GLT A;  4YW4 A;  2VMG A;  1MS4 A;  1FT9 A;  1LR5 A;  1RUG 1;  1JBC A;  1OVS A;  1TME 1;  5FZ9 A;  4CDQ C;  4COW A;  3AMM A;  4G3Y C;  1C4R A;  1NZI A;  1W6Q A;  5IW0 A;  3TN9 1;  4A44 A;  5DG2 A;  4B4P A;  3ST7 A;  4C90 A;  2BOJ A;  3DGT A;  4N43 A;  1YIF A;  1F35 A;  1S4C A;  4CU6 A;  1ZRC A;  2VMF A;  5CVR A;  4QWN A;  5TSW A;  2FZ2 A;  5IFT A;  2WKK A;  1ZA7 A;  5DMY A;  4H7M A;  1IS6 A;  4E9K A;  1WCQ A;  3M2M A;  1BBT 3;  4ARX A;  5K4L A;  3GNE A;  1IZ3 A;  3WP6 A;  4M3C B;  5BNO A;  2V72 A;  3N9N A;  2GMP A;  2KXL A;  4E2Q A;  3VBU B;  1BVP 1;  3HN1 A;  5G05 L;  3JZV A;  4CU8 A;  2GNM A;  1ZZB A;  4D69 A;  3PTY A;  5FPX A;  3POF A;  2OPW A;  4HAN A;  4PIZ A;  2P6C A;  2WSV A;  3LAG A;  4BZ4 A;  4TLF A;  2ARB A;  3N4M A;  4Q1R A;  4ZKT B;  5FYS A;  3W20 A;  3WW4 A;  3NNG A;  5FMB A;  3RZZ A;  3B5L B;  2PHT A;  3HVD A;  3KV5 A;  1W39 A;  4UAP A;  5G04 L;  3A0N A;  3MLK A;  2PQQ A;  5JWP A;  4JGZ A;  3OBT A;  1AUY A;  4DEQ A;  4IEZ A;  1UKR A;  4Q8L A;  1RTV A;  1UQX A;  2J42 A;  4GH4 A;  4RGA A;  4XFB A;  1KFX L;  2DUO A;  4I0A A;  1UYP A;  1O3S A;  1MEC 2;  1DDL A;  2Y26 A;  5GZC A;  2VTX J;  4XTM A;  5DG1 A;  4UI9 L;  2ES3 A;  5T5J A;  2CV6 A;  2HH9 A;  2PTM A;  4K8R B;  1T6B X;  5KHH A;  3Q8A A;  4ZU5 A;  3M3Q A;  2ARX A;  4IGO A;  2D3R A;  1CON A;  4D6S A;  1LEC A;  4BQW A;  3LOI A;  3DEC A;  5A1A A;  2VUC A;  3DYO A;  4EZ4 A;  4AWD A;  1R64 A;  3FBM A;  4OI4 A;  4NMI A;  3WEZ A;  3KCY A;  3RI8 A;  2DF7 A;  3MFA A;  3VBR C;  2YC0 A;  3S7E A;  1K5M B;  3V0A A;  1J1T A;  4CVU A;  1MS3 A;  2DVB A;  2DYC A;  3WDV A;  2E51 A;  1A3K A;  3OB8 A;  3CZU A;  1YLL A;  3B02 A;  4OUE A;  2BW8 A;  4QX0 A;  4BQX A;  3HNB M;  5IAX A;  1JZ5 A;  2MPF A;  2AH2 A;  2GC3 A;  1KDM A;  3H1W A;  4M3C A;  2VU9 A;  5T55 A;  1AR7 1;  2Y8K A;  2WQZ C;  2PHX A;  3A22 A;  1VRH 1;  3H1Y A;  4P9L A;  3H9A A;  4Z92 B;  3NMB A;  1R1A 2;  4GWM A;  2FCT A;  3SNM A;  4WVM A;  4NJ4 A;  1ZNP A;  3I3D A;  4XUO A;  2W87 A;  2BOI A;  1H30 A;  1UY1 A;  4IV3 B;  3J7M A;  2PLV 2;  1VPH A;  4AGV A;  2D6M A;  1ZYB A;  1EP0 A;  2C1F A;  5JXH A;  3KV4 A;  3ZXG A;  3ASI A;  4Q4Y 3;  3ZN6 A;  5F3C A;  2ZGR A;  3POJ A;  4GB3 2;  1SBD A;  3U1X A;  3VZM A;  4PBP A;  1TG7 A;  3ACF A;  2X29 A;  4IEW A;  1B35 C;  3O1R A;  4QKN A;  2J1E A;  1C8M 3;  1RHI 3;  1UO9 A;  3BYW A;  4JKL A;  1RL3 A;  3AK0 A;  1VBC 3;  2YC2 A;  4MXW A;  2VVE A;  3WG1 A;  5L36 A;  1SDD B;  4NHM A;  4CCO A;  2VZS A;  4D6R A;  1C8M 1;  5A3O A;  5LA1 A;  1ASJ 3;  1PGS A;  2CY6 A;  2QQL A;  3WG3 A;  3HQR A;  5FYZ A;  5GZD A;  3EB7 A;  1SLB A;  4FPJ A;  1CX4 A;  4FPE A;  4J6G A;  1J59 A;  1F31 A;  1JHN A;  1UZ0 A;  3DPR A;  4AR2 A;  5JI9 A;  4KGQ A;  2MEV 1;  3ORJ A;  1AL2 3;  4ZON A;  2B46 X;  2VME A;  2VXJ A;  3J8F 1;  1W6M A;  3OY8 A;  4Y20 B;  1GQP A;  1Q8V A;  3QH6 A;  4NAM A;  4YW2 A;  3KB5 A;  4I3G A;  4LKS A;  4LNV A;  2YZ4 A;  5LWB A;  4BCU A;  4HET A;  4YW5 A;  2Y33 A;  4B1L A;  4OFG A;  4CP9 A;  3MIC A;  5JSR A;  3SH5 A;  1S0C A;  2P5B A;  4UFK A;  5FZE A;  2D40 A;  5CBL A;  5CFD B;  2E63 A;  2HEW F;  1RUJ 3;  3UGF A;  1SG3 A;  1STM A;  5FY8 A;  2NYY A;  1NCR C;  2FMD A;  1N1T A;  1OUX A;  4IV3 A;  2JG8 C;  3D5O A;  3D0J A;  1H4H A;  4YZ4 A;  4ZU7 A;  2WO3 A;  1H8T A;  1O4Y A;  1VB2 A;  2XLG A;  1W03 A;  4AK3 A;  2PA7 A;  4LE3 A;  5FUI A;  3L9J T;  5FPV A;  3ZYI B;  2Y6K A;  2D98 A;  4COV A;  4R4X A;  2ZKN A;  2ZX1 A;  2AUY A;  2EXI A;  2QDR A;  2R49 A;  4RA0 A;  4M3C F;  4UBG A;  1AXY A;  2PN5 A;  3ZFE B;  1J83 A;  1EV1 2;  1XPW A;  5BNN A;  1VBE 1;  3ETQ A;  2V4V A;  4BQ5 A;  2YPJ A;  2OW4 A;  4BK4 A;  2V73 A;  2X09 A;  4BB3 A;  3P3P A;  1YI9 A;  1D0G A;  1YRZ A;  3LD8 A;  3RZG A;  3HD8 B;  4G9S B;  1ND3 A;  2R7E B;  2VTX A;  5BXX A;  4FAH A;  3IB3 A;  5EHD A;  3OG2 A;  4XJ9 A;  1OPM A;  4CDW A;  2FCU A;  2WYF A;  4XET A;  2VY0 A;  1QJX 2;  4DRR A;  1SCS A;  5AVP A;  3WQB A;  4HPK B;  1MQT A;  4MGZ E;  2C0Z A;  3B00 A;  2CGO A;  2D5H A;  3ZOI A;  2XPJ A;  3URF A;  4YM2 A;  4CDQ B;  1HKD A;  2OYZ A;  3J8F 2;  4OUS A;  4AQS A;  1A78 A;  2XUM A;  1C1L A;  1S2K A;  3DYP A;  5J3U A;  3OGJ A;  1O3R A;  2WDB A;  1RUC 3;  2VL4 A;  1VBE 2;  5E8A A;  2VQ0 A;  4E2S A;  5FZ0 A;  3U0Z A;  5T5L A;  2FCV A;  2VM9 A;  5ABJ C;  2LW8 A;  5D2A A;  4YM3 A;  2UWC A;  2BNO A;  1BK0 A;  2WUH A;  4UFM A;  1LHO A;  1S2E A;  2VPV A;  4DUW A;  4ZZ5 A;  3KF3 A;  3ZFF C;  1AYN 3;  3FBY A;  3RZK A;  2E32 A;  3BOD A;  4N53 C;  5M0T A;  3NAP B;  1ENQ A;  2OKX A;  2DBI A;  5LBE A;  1W8O A;  3T0B A;  3R6S A;  1OPO A;  5J48 A;  1D4M 2;  5K7P A;  1JYC A;  2JEC A;  3M3O A;  2RJL A;  5K0U A;  4TTG A;  5H9Q A;  3M70 A;  2XHN A;  5EXO A;  1NXD 1;  2V4A A;  4NIA A;  5FP8 A;  1SLT A;  3I3E A;  3NJX A;  5IK5 A;  1N1V A;  2WSU A;  1CQ9 A;  2WC2 A;  5LW9 A;  4ES8 A;  2CAV A;  3I2F A;  5KWR A;  4DUV A;  2J1U A;  2LUW A;  2W46 A;  3VBH C;  3FJS A;  1XRU A;  2ZX3 A;  5FZ3 A;  4MGS A;  1R09 3;  3FLP A;  4BQY A;  4DXS A;  1IPS A;  1DYP A;  4QHB A;  5L73 A;  3O0W A;  3B94 A;  4C0H A;  3DUI A;  3AX4 A;  2VVD A;  3IT8 A;  3AKT A;  1AR7 2;  1ASJ 1;  1GNH A;  2OXB A;  3CJI C;  4LIT A;  4NHL A;  5C8C C;  4JGY C;  5DUW A;  3PVB B;  4R8H A;  4BJ0 A;  4CZS A;  1OUS A;  2ORX A;  1UIK A;  4AVS A;  2NN8 A;  1VBC 2;  3PIG A;  2VNO A;  2RJ2 A;  5DAQ A;  2ZTN A;  1C8M 2;  4E2G A;  4AGG A;  2D5F A;  5F37 A;  2YRO A;  1O3T A;  4Y24 A;  4EN9 B;  3NKT A;  4XF9 A;  2P37 A;  3MIB A;  5FYT A;  4GA9 A;  1GV9 A;  4Y1Z A;  2W3J A;  1YQ2 A;  3I54 A;  1WD4 A;  2EVX A;  2EID A;  3RDI A;  1DQ4 A;  4NWW A;  4PF5 A;  4CU9 A;  1OOP C;  4RS5 A;  3IDB B;  3EMR A;  4CDX A;  1WZX A;  2OVU A;  1W8T A;  1JOP A;  4Q4W 1;  5FDB A;  4AYU A;  1ZBA 3;  1TNF A;  2X10 A;  4UOJ A;  3ZIX A;  2QQV A;  1RUH 1;  3OBR A;  1W04 A;  5DUU A;  2E6V A;  4F3J A;  2DCY A;  5D21 A;  3GBF A;  1RUF 2;  3EQE A;  3III A;  5I0U A;  4ASM B;  3K46 A;  2VOV A;  4YVW C;  3WLU A;  2ZGO A;  3E6D A;  4JDM A;  5LBB A;  1APN A;  3FUQ A;  4HK8 A;  1ODM A;  3KHB A;  1OKO A;  4Y3O A;  3VL8 A;  4FQZ A;  1ZBA 2;  1U0A A;  1HN0 A;  3K4D A;  2NMO A;  4BLI A;  4CDU C;  3O1M A;  3DEM A;  2CDO A;  2OZ6 A;  4OHZ A;  4FXK B;  4AQ6 A;  2ILM A;  1VBA 1;  2PAM A;  4HKO A;  4LMF A;  5FPZ A;  3V64 A;  3TB0 A;  4P9W A;  2QTW B;  4QU1 A;  4Y1V A;  4YZ5 A;  4FPF A;  3BVC A;  2G19 A;  1BYH A;  5FQ0 A;  2BDR A;  1F4A A;  1I5P A;  1OQD A;  3PNA A;  1LUL A;  3DCQ A;  3BTZ A;  2W68 A;  1GZT A;  3MBW A;  3H8R A;  3VBU A;  5C71 A;  1GZW B;  2WFF 3;  3I7D A;  5CFC C;  4ATF A;  5GLW A;  1BK1 A;  2VGD A;  4LIU A;  2RV9 A;  1O7F A;  5HCB A;  4YM0 A;  4NN0 A;  2ZGP A;  2GME A;  5L9R A;  3RGB A;  4YRD A;  1RMU 1;  2VBB A;  1AX2 A;  5F5I A;  4LLF A;  1EUT A;  1ENR A;  1KS4 A;  1W9T A;  1YQ5 A;  2JDN A;  3AL5 A;  3HMY A;  2A70 A;  1M4W A;  2K46 A;  1RGS A;  1XNB A;  3VBR B; 
#chains in the Genus database with same CATH homology
 2VZT A;  3CIH A;  3THC A;  1UY0 A;  3SKJ E;  3T0A A;  1CZS A;  2E33 A;  4XUP A;  1GOG A;  5C7G A;  1H6Y A;  2QBX A;  1J84 A;  2J1T A;  1D7P M;  4W4Z A;  5F7U A;  2WO2 A;  5HXM A;  1JZ6 A;  1US3 A;  1JZ8 A;  2XOM A;  1OT5 A;  4PF1 A;  3HOB A;  4JHZ A;  1K3I A;  3IDA A;  2JKX A;  3OGS A;  3C7F A;  5JUV A;  3NJV A;  4BXS V;  3WF0 A;  2W1W A;  3W5N A;  3K4A A;  5C70 A;  3ACH A;  3VDC A;  3LPG A;  3NRU A;  4QX2 A;  1JZ2 A;  3EYP A;  4XUT A;  1UY2 A;  4GWI A;  2YG0 A;  2VZQ A;  2ID4 A;  4MAD A;  2W47 A;  3T2Q A;  1O8P A;  5LA2 A;  2BGO A;  3HJR A;  4JKK A;  3HPN A;  3NQH A;  4OMD A;  3SEE A;  3AC0 A;  2VO5 A;  4MO3 M;  3UES A;  3WNL A;  3T2P A;  1JYW A;  3BN6 A;  3U37 A;  1SHW B;  1XNT A;  3FHQ A;  4DXT A;  2C26 A;  4M4R A;  4XUQ A;  2V5D A;  2W1Q A;  1W9S A;  3WNK A;  3VDB A;  1PX3 A;  2Y6H A;  3F2Z A;  1JZ4 A;  2BBA A;  4GZ9 A;  3D3A A;  4E8D A;  1O8S A;  2VC9 A;  2L9L A;  4QX3 A;  1NX9 A;  1EUU A;  3T0D A;  3UET A;  3A21 A;  2VZ1 A;  2VJX A;  2WAO A;  4KMQ A;  5IJR A;  3CMG A;  4LHS A;  4A42 A;  2VCC A;  4D0Q A;  3HEI A;  2VR4 A;  2Y6L A;  1JU4 A;  3BGA A;  4HG6 B;  2BGP A;  1H6X A;  2WZE A;  3OGR A;  1JZ3 A;  4XVH A;  1JYX A;  2WN2 A;  3VD9 A;  2WQ8 A;  3LEI A;  3T2O A;  2QQN A;  1PX4 A;  3C7H A;  4ET7 A;  3OBA A;  4JX0 A;  3FL7 A;  5CYY A;  2J1S A;  4QX1 A;  5J1X A;  3CDZ B;  4P5Y A;  2VZP A;  4QAW A;  4DEV A;  1IQD C;  3WF1 A;  1K45 A;  5IHR A;  1UMI A;  3FHA A;  4ARY A;  4A44 A;  3GXU A;  4FI9 A;  2ZEW A;  4CU6 A;  4JKM A;  4CUA A;  2VMF A;  5IFT A;  4RYD A;  3WNM A;  4QPW A;  5DMY A;  1WCQ A;  4A4A A;  4ARX A;  2V72 A;  4P00 B;  2WZ8 A;  3IAQ A;  2BZD A;  5G05 L;  3T09 A;  4CU8 A;  2EIC A;  1L7R A;  1L7Q A;  3I2K A;  1UY4 A;  3P6B A;  4IUG A;  2VOT A;  5IYY A;  3NNG A;  1UYY A;  3C7O A;  4UAP A;  2WN3 A;  5G04 L;  1RYY A;  4AAX A;  2J1A A;  1JHJ A;  3SKV A;  4DEQ A;  4QDS A;  1HN1 A;  2QQK A;  1OD3 A;  2YC4 A;  3A7Q A;  4TXW A;  4UI9 L;  4OYU A;  2E31 A;  4PT6 A;  3I3B A;  3WF2 A;  3DEC A;  5A1A A;  3MV0 1;  3DYO A;  2J22 A;  4P08 A;  2VCB A;  1R64 A;  3WEZ A;  3CZJ A;  5LCW L;  4CVU A;  2XON A;  2QQI A;  2DDU A;  3OB8 A;  3CZU A;  4OUE A;  3WNN A;  2W1U A;  1UXZ A;  4QX0 A;  1JZ5 A;  3HNB M;  2VZO A;  1K42 A;  1OF4 A;  3FN9 A;  2J1R A;  3T08 A;  2BER A;  2Y8K A;  3A22 A;  2W1S A;  2YFU A;  4DUX A;  3CKH A;  4LPL A;  3WNP A;  2DCK A;  3I3D A;  3I97 A;  4XUO A;  2W87 A;  4PQQ A;  1UY1 A;  5EIY B;  2W92 A;  3CQO A;  2ZEY A;  1OH4 A;  1UXX X;  4YPJ A;  2JD9 A;  5JXH A;  3I2J A;  2C9K A;  1ULP A;  2VQT A;  4QDQ A;  1TG7 A;  3ACF A;  2VCA A;  4A6O A;  1TVG A;  2J1E A;  2DCJ A;  4JKL A;  2YC2 A;  1OF3 A;  1SDD B;  1UYZ A;  4QB6 A;  4DXR A;  2VZS A;  4W8J A;  5LA1 A;  2QQL A;  1LNS A;  3OGV A;  3VD7 A;  4M4P A;  3EB7 A;  1UYX A;  4MGQ A;  2VMD A;  3ETP A;  4LQR A;  5JXG A;  3LQC A;  1UZ0 A;  3THD A;  3LE0 A;  3MUY 1;  5JXJ A;  3PUH A;  2VME A;  3ECQ A;  1GQP A;  3IAP A;  4LKS A;  4XZU G;  2ORZ A;  4A41 A;  4KI5 M;  1GU3 A;  1DYO A;  4OMC A;  5EJ1 B;  2B4K A;  2ZEZ A;  1JI6 A;  1SG3 A;  4A45 A;  4XUR A;  1JYN A;  5B4N A;  1NAE A;  4W50 A;  5HPO A;  2WO3 A;  1ULO A;  4L0P A;  5FUI A;  2Y6K A;  2W5F A;  4AG4 A;  4BK5 A;  1J83 A;  3ACI A;  3WF3 A;  1XPW A;  2V4V A;  4ZXE A;  1NKG A;  4BK4 A;  1NUK A;  2X09 A;  4BDV B;  4A3Z A;  1GUI A;  2ZXQ A;  1MPX A;  1PMJ X;  1K12 A;  3K4Z A;  1KGY A;  2YFZ A;  1CIY A;  2R7E B;  3GDB A;  2W91 A;  2QQJ A;  3IB3 A;  4MOA A;  3ABZ A;  3OG2 A;  5JXI A;  2E26 A;  3WQB A;  2KD7 A;  5DN2 A;  5LA0 A;  3W5M A;  3GGL A;  2W94 A;  2ZEX A;  2C4X A;  2QQM A;  1W8N A;  1F4H A;  4KWU A;  2Y6G A;  3DYP A;  2WDB A;  5IFP A;  2VL4 A;  2J7M A;  1CZT A;  3P1I A;  1XC6 A;  3LPF A;  1UMH A;  1GMM A;  2VM9 A;  2JE8 A;  2VMC A;  2LW8 A;  2WUH A;  4ZZ5 A;  4DUW A;  4ZZ8 A;  5JR2 A;  1PMH X;  2E32 A;  3I2I A;  3K75 B;  2VZU A;  5DPN A;  2VZV A;  2OKX A;  1W8O A;  1GNY A;  3T0B A;  2WAB A;  3GM8 A;  1GOF A;  3HNY M;  1W99 A;  3MO4 A;  4TTG A;  2XHN A;  2VTF A;  2QQO A;  5JMO A;  3OEB A;  3I3E A;  3NJX A;  3I2F A;  1WKY A;  2HLE A;  3C8X A;  3MV1 1;  2J1U A;  2W46 A;  3PUI A;  2VZR A;  4QB1 A;  4MGS A;  2HYX A;  4DXS A;  2JDA A;  3I2H A;  1W9W A;  4RN5 A;  3OEA A;  3VD3 A;  3JXS A;  4BJ0 A;  2ORX A;  4CUC A;  1P8J A;  2RJ2 A;  2Y6J A;  3HN3 A;  2W95 A;  1UX7 A;  3A23 A;  4Z2A A;  1CX1 A;  3K77 A;  3VDA A;  4DUV A;  3C7G A;  2LS6 A;  2W9X A;  2W3J A;  1YQ2 A;  1UY3 A;  2EID A;  1BHG A;  3WF4 A;  5DQ0 A;  3HNM A;  4CU7 A;  1W0N A;  1O59 A;  1GOH A;  4E8C A;  4GWJ A;  2X10 A;  1XNA A;  3C7E A;  4UOJ A;  3LEK A;  2VQU A;  3UNP A;  3III A;  3J7H A;  3ZM8 A;  3SEP A;  2EIE A;  3K46 A;  3I2G A;  1JZ7 A;  1DP0 A;  5EJZ B;  2YB7 A;  4ZY9 A;  2Y64 A;  3VD5 A;  2B9V A;  4P02 B;  5B4X A;  4OZO A;  3K4D A;  3E1F 1;  2WO1 A;  4QDR A;  2CDO A;  4D8M A;  3WSO A;  2WAA A;  5I0D A;  3ACG A;  5CZK A;  1UWW A;  3WNO A;  2X05 A;  2Z4F A;  1F4A A;  1I5P A;  1CZV A;  2CDP A;  3MUZ 1;  2J1V A;  2RVA A;  2WBK A;  2WYS A;  4XUN A;  1JYV A;  3MBW A;  3LEG A;  4QB2 A;  1JU3 A;  5C71 A;  3DYM A;  2EIB A;  1T2X A;  2RV9 A;  2XQX A;  1KEX A;  4CUB A;  2VZ3 A;  3VD4 A;  2PQS A;  1EUT A;  1DLC A;  1W9T A;  1US2 A;  4CU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...