5DQ0A

Structure of human neuropilin-2 b1 domain with novel and unique zinc binding site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
157
Chain Sequence
CNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Neuropilin-2
publication title To be published
rcsb
source organism Homo sapiens
total genus 39
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dq0A00
5IJRA 3F2ZA 2XOMA 1W8NA 2ZEWA 2VL4A 1OT5A 5IHRA 3FHQA 3K4AA 3OGRA 4DXTA 1UX7A 1CZTA 1PMJX 3IB3A 1PMHX 2LW8A 3MUZ1 1JZ7A 3K75B 4XUQA 3OBAA 4RN5A 2ORXA 2J1RA 3I3DA 2R7EB 1DYOA 1TG7A 3WNOA 1XNTA 1XPWA 2VZ1A 4JKKA 3HEIA 4QAWA 3I2FA 3W5MA 2WQ8A 3FN9A 2V4VA 1JHJA 3BN6A 3VDAA 4P02B 1K3IA 1D7PM 3CIHA 5CYYA 3CMGA 2CDOA 3T2QA 5EJ1B 4A44A 3HJRA 3NNGA 3PUIA 5DMYA 4QX0A 3A22A 4CU9A 4GWIA 4TTGA 3JXSA 2WDBA 2WZ8A 3HNBM 2WAOA 3VD3A 2E33A 3C7EA 3IAQA 3LEGA 2B9VA 2J22A 4ET7A 2ZEXA 1UYZA 2BBAA 2Y6GA 5DN2A 3A21A 3DYMA 2BGOA 3OB8A 3GM8A 3MUY1 3SEPA 4UAPA 3I97A 4A42A 5C71A 4JX0A 4QX1A 3WF3A 1K42A 2RVAA 5EIYB 2VCAA 4M4PA 2ZXQA 1W0NA 1DLCA 4ZXEA 2VZ3A 1W8OA 4XUOA 2VZTA 4CUAA 4XUPA 5J1XA 4OUEA 2C26A 3ECQA 3OEAA 2VM9A 4LQRA 4L0PA 3LQCA 5JUVA 4UOJA 1UMIA 2DCJA 1XNAA 4BK5A 3T0AA 1EUTA 4OZOA 3ZM8A 3C7GA 3DECA 4QB6A 1UY2A 4D8MA 1JU4A 2X05A 4KI5M 2WO1A 3T0DA 1CZSA 2PQSA 3K4ZA 4JKMA 2J1UA 4QDRA 4GZ9A 2X09A 3I2IA 3GDBA 1GOGA 4FI9A 3DYOA 4XUTA 2V72A 5LCWL 3NJVA 3LEIA 2VZQA 2V5DA 5G04L 4QPWA 1JZ8A 2WO2A 3WQBA 4ARXA 1JYWA 2Y8KA 2B4KA 3J7HA 4CU8A 4LPLA 3NRUA 1OD3A 4Z2AA 3SKJE 4E8DA 5C7GA 1K45A 2WUHA 3BGAA 4BXSV 4CU6A 3K4DA 3ABZA 4PF1A 5HPOA 2DCKA 2VZUA 4IUGA 3T0BA 2YFUA 3I3EA 1H6YA 2YC2A 3LPFA 3I2JA 3WF4A 2Z4FA 4P00B 4LHSA 2VOTA 1UYXA 3WF1A 1F4AA 4W4ZA 2JE8A 4A41A 3FL7A 2QQIA 3OGSA 5IYYA 2W46A 3LE0A 5DQ0A 4W50A 3CQOA 3C7OA 3P1IA 2VTFA 4PT6A 1J83A 2YFZA 3WNLA 3I2GA 4BJ0A 3DYPA 4DUXA 2JDAA 2ID4A 3ACIA 1PX4A 1OF4A 2LS6A 1O59A 3NQHA 2W1SA 1UZ0A 1GNYA 2E32A 2QQKA 4MADA 1WCQA 2WAAA 3EYPA 3UETA 2WABA 3VD7A 3K46A 1UY0A 2KD7A 1HN1A 2HLEA 1NUKA 1CX1A 1LNSA 4QDSA 2VJXA 1JYVA 2ZEZA 4MGSA 3HPNA 4MO3M 1NAEA 4P08A 3CZUA 2QBXA 4JKLA 2X10A 3OGVA 3C8XA 2VMFA 3E1F1 3WNPA 2JKXA 5A1AA 3VD5A 4DEQA 2ORZA 2W3JA 2RJ2A 2WYSA 2J1SA 5JR2A 2YC4A 4XVHA 4W8JA 5EJZB 4QB1A 1SG3A 4D0QA 1W9SA 1JU3A 2WBKA 3FHAA 3NJXA 2EICA 3CDZB 2J1EA 2W1QA 4XUNA 2XHNA 1H6XA 4TXWA 4ARYA 1JYXA 2VMDA 1PX3A 2W91A 2WO3A 2WN2A 4HG6B 2QQMA 5HXMA 3VD9A 1P8JA 5LA1A 4A4AA 5JXHA 2EIDA 1IQDC 1R64A 4A6OA 2VZVA 4DXRA 4A45A 1JZ3A 4QX2A 3SEEA 3IIIA 4AAXA 1US2A 3A7QA 4CU7A 3WNKA 5JMOA 1UY1A 3GGLA 4OMDA 3IDAA 4LKSA 1SHWB 3HNYM 1MPXA 2VQTA 4UI9L 3WF0A 1O8SA 4BK4A 2W5FA 4DUWA 3IAPA 1XC6A 2WZEA 2Y6KA 5F7UA 4ZZ5A 2C4XA 4KWUA 5CZKA 2E26A 1OF3A 4CUBA 2W1WA 1T2XA 3UESA 3P6BA 4GWJA 1O8PA 5IFTA 3LEKA 1TVGA 2W47A 4XZUG 3A23A 3SKVA 4DEVA 1L7RA 4CUCA 1K12A 2BZDA 4PQQA 3ACHA 4A3ZA 4MGQA 2XQXA 3VD4A 3WNNA 3I3BA 3WNMA 2W95A 4P5YA 1L7QA 1UY3A 2CDPA 1JYNA 2VZSA 4QDQA 4BDVB 2C9KA 1UMHA 2QQNA 2VZPA 4QB2A 2J7MA 4ZY9A 4KMQA 5DPNA 1EUUA 2VMEA 3CKHA 4AG4A 2QQLA 1JZ2A 1W9TA 2BERA 2VC9A 3MO4A 3THCA 2WN3A 1UWWA 2E31A 3HOBA 5JXJA 3HNMA 1NX9A 1GOHA 4E8CA 2XONA 1RYYA 1W99A 1UXXX 4OMCA 3ETPA 2Y6LA 3T09A 3T08A 2VQUA 1UYYA 5B4NA 1KEXA 3GXUA 3ACGA 1CZVA 1ULPA 2EIBA 5C70A 2J1TA 1GUIA 4MOAA 5G05L 2JD9A 3WSOA 3VDBA 2QQOA 2Y6JA 2YG0A 2W94A 4OYUA 3WF2A 1JZ4A 2VCBA 2VCCA 1JI6A 4RYDA 1JZ6A 3CZJA 3MBWA 3U37A 3K77A 1W9WA 2QQJA 1UY4A 4ZZ8A 2W87A 1OH4A 1J84A 2VZRA 2YB7A 3EB7A 2VR4A 1NKGA 3OEBA 3ACFA 2RV9A 4M4RA 3MV11 4DXSA 5I0DA 2DDUA 1CIYA 1DP0A 5JXIA 3UNPA 2W9XA 1SDDB 1JZ5A 2OKXA 3AC0A 5FUIA 3PUHA 1F4HA 2VZOA 1I5PA 2W1UA 2Y6HA 1YQ2A 1BHGA 4JHZA 3C7FA 2W92A 3LPGA 2VMCA 1UXZA 3W5NA 3OG2A 2Y64A 1US3A 3MV01 5LA2A 3D3AA 3VDCA 1GU3A 2BGPA 4XURA 3T2PA 3C7HA 5LA0A 1GMMA 5B4XA 2J1AA 3WEZA 2L9LA 4CVUA 4DUVA 1KGYA 5IFPA 3HN3A 4YPJA 2J1VA 3THDA 1ULOA 3I2KA 1GOFA 1GQPA 2HYXA 4QX3A 2EIEA 2ZEYA 5JXGA 1WKYA 2VO5A 3T2OA 3I2HA
chains in the Genus database with same CATH superfamily
5IJRA 1QQP1 5LATA 1XNCA 3F2ZA 4GALA 5IAXA 4FQZA 1H2LA 1RUF1 2WQ4A 1F9KA 2OQ7A 2QNKA 4FXGB 4FCAA 4LA3A 5A7PA 4AL9A 5FY5A 1O3SA 1R1A1 1RXGA 1VP6A 2DUOA 1YQ6A 2F4PA 1QXPA 5LRRA 1ZRCA 5CFDB 3IB3A 2KR2A 1POV3 3H3UA 1A6CA 3WHTA 3BU7A 4CP9A 4C0BA 1MS5A 4YZ2A 1JZ7A 2FCTA 4RN5A 2ORXA 2JENA 3I3DA 3QOPA 1NLRA 3AMQA 2AGSA 1VMHA 2R7EB 1RJ7A 1YHFA 1TG7A 2E7TA 3LZZA 4XJ9A 2LROA 1PIV1 3LIGA 4WZCA 4XF1A 4Q8LA 3J9SA 2PLV2 3POSA 4YW5A 2ARCA 1S0IA 2WQ8A 1LJ7A 2BVBA 3PIJA 5J3UA 2V4VA 1JHJA 2DU1A 4DIQA 4QX7A 5KXDA 5BV6A 2YUEA 1K3IA 3CIHA 1LGNA 3KM5A 5LASA 3MYXA 2CDOA 5LW9A 1AR61 1KD7A 2RR12 1LOEA 2RMU3 4LKEA 1W90A 1QJU2 5DABA 4COUA 3WUDA 5LWBA 4QPGB 3VBUA 5DMYA 1NZCA 4CU9A 1W2TA 1JW6A 1ND2B 3JXSA 1WW4A 3PJQA 5C9AB 4QPGC 5FYHA 2HWF1 2WAOA 2ZGPA 4N7UA 4OHXA 4TYSA 4CDQB 5C9AC 4Q29A 2HWB1 3C7EA 5BNPC 2ZGQA 1J1LA 2YMZA 3LEGA 4ZS2A 2GZWA 3WG4A 2W08A 4DB5A 3LFMA 1ZA7A 3FBMA 3I2OA 4I3PA 1JYIA 3JBG2 3EXUA 1JOBA 2BBAA 4XC9A 1Z7S3 3MF6A 4Y20B 5D8AC 3WX5A 2XL7A 4HSLA 3ZMNA 2VUDA 4KU8A 2W39A 2HWC2 5T55A 4HK8A 2BGOA 1ND3A 4RS5A 5K0UB 4YM2A 3TEWA 2QQPA 2IFRA 2A6YA 4Y1ZA 3ES4A 1LULA 1N1YA 4NE9A 5K9YA 1UN1A 3LSEA 3VZOA 5C3OA 1SMVA 2WLQA 2FDFA 4QX1A 1VAKA 4Q4V2 2JDUA 3BIWE 5T5JA 3VKOA 3W20A 4ZHNA 1RB8G 1VBB2 5EIYB 2DTYA 2BOJA 3U4SA 3U78A 1F2NA 3PMEA 1UAIA 1LHUA 2AENA 2O14A 1TME2 3D4KA 4N53B 1W0NA 4ZXEA 1WW6A 1X82A 3POJA 4XJUA 4QPIC 3ILFA 5TSWA 1VJ2A 1AYM2 2XBO1 3B3QE 1VAMA 4Y4YA 1D2QA 3K2OA 4LHLA 3IN9A 1BLZA 1HXS1 2AEYA 1YXWA 1W39A 2PQQA 4RQPC 1ZRDA 1RIRA 1V6LA 2K0GA 3Q8CA 2VM9A 1AR92 1U5ZA 4C1WA 4JGYB 4L0PA 3WG2A 2R041 3E6CC 4AHXA 2IXLA 1RC6A 3GALA 3UT0A 1HRI2 4BK5A 4K7JA 3ZKYA 1EUTA 4Q8KA 1PGSA 1ULDA 1GP4A 5L73A 1OI6A 2GH8A 3ZM8A 3M3OA 1UY2A 1JOJA 1Y7BA 2X05A 4KI5M 2OXBA 2MEV1 3INAA 5FYVA 3ZSMA 3MIEA 3DKQA 3T0DA 1MR5A 1E5HA 5IK7A 4NROA 2GMMA 3ZYJB 5HV0A 1YFXA 1VLNA 1RUJ2 3CNAA 2B5HA 4JKMA 5FYSA 1FATA 2J1UA 2E51A 3IKWA 4GMP1 3I2IA 1Q3EA 4KWJA 1IG0A 4AVVA 4Q4Y1 4XUTA 2VPVA 3DKWA 3VN4A 5LCWL 4CPBA 2VZQA 4P5HA 2V5DA 3IPVA 1MACA 4JRLA 2VY0A 2B46X 1VBD3 1BVVA 4LHKA 1W6QB 5F5QA 4PI0A 3N3HA 3L2HA 1DF0A 1W0OA 3AK0A 3NNMA 4HKLA 3VDDA 4LPLA 3S7EA 3NRUA 4XCAA 3AZZA 2XJUA 1JYCA 5KC5A 3HD8B 1LHVA 4LLOA 4DXZA 3RZKA 3U4XA 4XBNA 2BTVC 4AR2A 1H8TB 1PNGA 4KU7A 5FYMA 3RZJA 3UKVA 4TSVA 1AR81 1OHFA 3O1PA 1HB3A 2DCYA 2IWGB 4EN9B 2UWBA 3K4DA 2XDVA 1RUH1 2Y34A 3V64A 4XHXA 5A6ZA 3NNFA 3GZAA 3MW2A 4FPEA 1QWRA 3ZFGC 1FYUA 3CU7A 4AVBA 4PDWA 2YC2A 5FREA 2DTWA 3LPFA 2MNGA 1DG6A 2EA7A 1XE0A 3OGGA 3PUAA 1WZXA 3AKQA 3PVNA 2K46A 5FMOS 5JPNB 3AKPA 1POV1 5FFOC 4YW1A 1X8EA 3BU0A 4DRRA 1LOBA 1F4AA 5GZEA 3MPBA 2A7AA 2JDKA 1BVP1 4C90A 2GU9A 1XNKA 3I8TA 1LODA 4LBJA 3AFKA 4K21A 3AKTA 3M8LA 1LOFC 4RGAA 1RVF1 2AUYA 5DQ0A 1JYTA 1MQTA 3CQOA 2R16A 2K9ZA 3K3OA 4PT6A 1AX1A 2R062 3BODA 4GJZA 3QACA 1O91A 3A4UA 3NNLA 3I2GA 5GLWA 3WNLA 4AFDA 3DF0A 4GH4A 4I09A 3O1VA 2R1DA 4HN0A 2ZOEB 1IG3A 1RUI3 2Y0OA 2BBVA 4V1PA 4BJ0A 2JDAA 2OS2A 1PX4A 4CDWB 5A70A 2G9ZA 2RMU1 1NA1B 5JI7A 3VDCA 5C3PA 3FFZA 3N9NA 4WVMB 3VHOA 2LUWA 4MADA 1TZOA 2GDFA 2WAAA 4PBPA 5FK7A 4CCMA 5C3QA 2BNMA 1D4M2 5L9VA 3RFRA 1E5RA 2KD7A 2CTVA 1NUKA 1JS9A 2ZAAA 3OJBA 4QDSA 1COV2 1SPPB 2WNVC 2IXJA 3B01A 4O9GA 2DURA 2V5YA 4MGSA 4HVOA 3HPNA 1YIFA 4CP2A 1Z7S1 3LFIA 3ZR5A 2X10A 3WP3A 1EV13 3C8XA 5LBBA 2ZAHA 1BKZA 2YDEA 3WDWA 1EAH1 2XKPA 3H1YA 4Q1RA 3N9OA 3NKGA 4I0WB 4DEQA 5A1FA 4MYEA 4B8EA 1QKQA 2ORZA 3Q8BA 3WLUA 1B35A 1PK6A 1N1TA 2W3JA 5DUUA 2XR4A 3ZR6A 3D82A 3HWJA 2P4EA 1OLRA 2FDJA 4DOUA 2DCTA 2P5BA 1Q5OA 4IESA 1H30A 4K3UA 1NY72 2WSUA 3AZXA 3F95A 4XVHA 5EJZB 3S0MA 4XACA 4BWOA 1S0CA 1W9SA 2XVKA 3MEPA 3G6JB 2XH6A 3VBOA 2E63A 2EXJA 2WBKA 2XJTA 4NN0A 2VNOA 3VZMA 4DO0A 2GH2A 1VRH2 3FHAA 2OZJA 1G9CA 3DL3A 4AWDA 1Q43A 1TMF1 1UU6A 4GWNA 5C4WB 4CRQA 1LGCA 3OSDA 1AR73 1H6XA 2LM3A 1WCUA 2P6HA 1V00A 3N7KA 4ARYA 4MGIE 5F6LB 4ZU4A 4AEJA 1HQNA 4QKFA 5FZLA 2OT7A 1RHI2 2DV9A 4XCBA 5IATA 1BCXA 2RDRA 1UZYA 1IQDC 1R64A 5T5PA 1FAYA 3BPZA 4DXRA 3CJIB 3L2YA 4LKFA 4A45A 4G9SB 1DQ0A 3CJIC 4QX2A 3SEEA 1IS4A 5A1LA 5KHIA 3IIIA 4M3CB 1Y9QA 3ZYBA 1UOBA 3A7QA 1YFWA 3TEYA 5AFEA 3WNKA 4Q5OA 1FPN2 1UY1A 5BXXA 1RUC3 3RDIA 2BNNA 1QDOA 1G9AA 1IZ3A 2K2SA 5LRSA 2V4AA 1WLDA 2OA2A 3WF0A 1O8SA 4IE0A 4XJZA 4QMAA 4BK4A 2BQPA 1S1AA 5C3RA 4JRAA 1X33A 1ZBA3 2XHKA 1W8WA 5A7NA 3KB5A 3GBWA 2E7QA 5F3CA 4NRQA 2EIGA 3O1OA 2RS32 2VQAA 2PAEA 2XWJB 4SLIA 2VOKA 4IE5A 2WZEA 5FDBA 1CIWA 1L7LA 4Z8BA 1UD1A 2FZ1A 1H0BA 3GBGA 4LE4A 1ST8A 3KCXA 3PMSA 4KWUA 5ERLA 3O14A 2ZGSA 1XSQA 5JSRA 1IPSA 1T2XA 2VH9A 4QPGA 1KS4A 4Z07A 5C9AA 2VE1A 3E6BA 4A6SA 3WW1A 5IFTA 3KWVA 1NCRB 3A23A 4XZUG 3VHRA 4COVA 4YGEA 4DEVA 5B2GB 5BNPA 4TLFA 4NR1A 3ACHA 3ROUA 2XQXA 4IEVA 2OZ6A 1JH5A 4JHTA 2G9GA 2XGXA 4IDZA 5ISLA 5DAXA 3FMGA 1AX0A 1IKPA 1QJZA 5D8AA 4P5YA 4XQ4A 4WM7B 1SCRA 4XFGA 2H0BA 4XPVA 2UWCA 4QDQA 4WM7C 5FZIA 2Q1MA 1CAXB 2VZPA 2J7MA 4HZFA 2D5HA 3N7LA 1JUIA 4R52A 3H8XA 2VMEA 2QQLA 4K40A 5DZEA 1JZ2A 1RUOA 2VC9A 2XKOA 3B02A 4IV3B 1PM7A 1YQ5A 5FZ1A 4L92A 1QJY3 4IV3C 5BNOB 1YLLA 4BQ5A 2E31A 4CP9B 5BNOC 5J98B 3UJQA 3L9JT 4Q2FA 1T6GC 5FMOL 3T3YA 1DIWA 4QPIA 3OD0A 1RYYA 5FLIA 5IVYA 2C9AA 1RUI1 3D6EA 4OMCA 2Y6LA 3OCPA 3NJYA 3ZYHA 2JEMA 4RQPA 3R0RA 4EN8B 1UCXA 3M3EA 2E7AA 4HKWA 3J8F2 2BPA2 4KGQA 3KT1A 4QM9A 1UKRA 5LZ6A 5CA6A 5FY1A 2HWE3 5G05L 2JD9A 2X5IA 3IM0A 3UGGA 3WSOA 4EQVA 3H8RA 4HK9A 2VW0A 5CIRA 4Z92B 2YG0A 3KMHA 2VCBA 2EAAA 3CF6E 3VBUB 2I74A 2JG9C 3TYJA 4YARA 3U37A 2QQJA 3MDPA 1UY4A 4ZZ8A 5IVFA 4PCRA 1CESA 3RYPA 4CUGA 4K9SA 1POQA 2W87A 3JB4C 3RPQA 1J84A 1FMD1 3EB7A 4N8MA 3M7AA 1SFNA 3B9IA 3ILRA 4AI1A 2WJSA 1LHOA 1QIQA 1W8TA 4LUKA 4M4RA 4XJWA 5FLHA 3MV11 1C3HA 1KITA 2PA7A 4QKNA 4OHZA 4DXSA 5I0DA 2IUWA 2OW4A 5JMCA 1AXZA 2BWCA 1HB2A 4LMFA 4RS5B 1ND3B 5E1RA 4XJAA 2P3IA 3UNPA 3I3MA 3BTZA 3BPSA 4RS5C 4HL0A 5DZFA 1R082 4QX8A 5FUIA 3PUHA 4RR3C 1F4HA 1REFA 2WR9A 4KGGA 1I5PA 3MIGA 4URAA 2Y6HA 2VG9A 1SLBA 4YRDA 1BHGA 1HV0A 3FX3A 4JHZA 4IEUA 3DV8A 2NM1A 2W92A 4IE7A 3MLJA 3QH7A 4FTEA 1K5MA 4N9IA 2B45X 3HVDA 4R4ZA 1UW8A 3AZYA 1PO11 2DUPA 3OG2A 2Y64A 4LO8A 5FKCA 2PHDA 3ZFGA 1F15A 4BQ1A 1PZ9A 5DUWA 1QJEA 5LA2A 1OH3A 1FI2A 2ET7A 2BGPA 2GSYA 2DBIA 2QQVA 3D3AA 3Q8AA 4XURA 4Y5Z0 4AXOA 1KDMA 4JDNA 4AEMA 4B4RA 4YZ5A 5FJKA 2Z5WA 5FZ6A 5LA0A 2YZ4A 2ZGOA 2J1AA 1XU2A 1PVC3 1LCLA 4IL7A 3SH3A 1GZ9A 5CFCC 1GBGA 5FBZA 5CVRA 4FSJA 3HN3A 4L8QA 4PLMA 5BPXA 2R073 3O7OA 5FKBA 1OXCA 1RXFA 1GQPA 2XUMA 4UW3A 1ASJ1 4R9BA 1RUC1 5T5LA 1WD4A 4BPZA 1V9U3 1IS6A 3JZVA 5DUXA 4AQTA 2BFUS 3T2OA 4EV0A 1PVXA 2YGMA 2PN5A 3WCRA 1YEWA 3ENRA 4BYYA 1ZBA1 2I2SA 4GB33 1ZRFA 3LCPA 4OHWA 1R091 3IWZA 3ZX7A 3DXUA 2XOMA 2ZGUA 5J96B 1ODNA 1OFSA 1W8NA 4U36A 1I3HA 3FHQA 2NZ9A 2VBPA 1QF3A 4DXTA 4JTOA 2XB6C 4P9LA 1VBC2 1PMHX 2A3XA 2LW8A 4YW6A 4UFKA 4K1YA 5GM0A 4Z2WA 1U5YA 1IPJA 2CHHA 1BEV2 4AI2A 3VDDB 4IE4A 2AYHA 4J6GA 2FCVA 4NO4A 1UX6A 2WNVA 3WW4A 3WHUA 1WGPA 1UKGA 2VZ1A 1DGLA 1Q56A 2D3PA 2W2IA 1QJY2 4GULA 5F37A 1O7FA 5FUNA 2G4IA 3ETQA 4MH0E 5EHDA 4AFMA 1OQEA 3AM2A 4NUBA 1PZ8A 2OPWA 1OLQA 2PLV3 4W6WA 3APBA 3CMGA 1S0BA 1W8FA 1XU1A 2PXJA 5JCTA 4PDWB 5EJ1B 3T2QA 1OPOA 4ASKA 3HJRA 1SBFA 5F3IA 1WMDA 3OUHA 1ZBE1 4XTPA 2RR13 3ZXLA 1O4YA 2G19A 4AZZA 1QJU3 2NN8A 3ASIA 3KGZA 5I0TA 1WA6X 1AX2A 2J22A 4XFIA 3ZYPA 5C5TA 4K8RB 1SDWA 3M3IA 4BMEA 3ZFEA 2BW8A 2A73B 2WS92 2WZR2 4XZPA 1X7NA 1V6IA 1MQTB 1Y9GA 2RDQA 1TQ5A 3A21A 4O65A 5F32A 3JBG3 1OQ1A 3PUSA 3OB8A 4KG0A 3RRDA 2VULA 3SISA 2IVJA 4I01A 5EYXA 2HWC3 2HWE1 1DQ2A 1CGPA 3ILNA 4XE9A 4N7IA 1J1TA 4JX0A 1EP0A 1NT0A 1W9FA 4IV1B 3VKMA 1E57A 5BYNA 3CEWA 4LBMA 2EVXA 4FOVA 4IV1C 4DY3A 4HMZA 2SLIA 1YJKA 1O6UA 1OLME 1V70A 3ELNA 3H1MA 5IK5A 4YVSC 5HCHA 4Q4V3 1LTEA 3ZXEA 4D7TA 2H6BA 2VZ3A 5FYTA 2Y33A 1W8OA 1VBB3 3HQUA 1CVNA 4YG3A 2GC1A 1TME3 3SH4A 4CUAA 4OUSA 5I91A 5J1XA 3ZXDA 5IVBA 4OUEA 1WD3A 3ZXAC 3CJXA 4DPNA 1AYM3 4YNIA 2AREA 1RUE2 5LBEA 3LQCA 5JUVA 4NIAA 4UOJA 3T4VA 1IGOA 4BQ3A 2FDIA 1FXZA 1AR93 2PHXA 4LLFA 4YM0A 1U5XA 3WZ1A 4OZOA 3MIFA 1B35B 1H2KA 1PK6B 3C7GA 1NG0A 3DECA 1YYNA 3H1WA 1B35C 2IC1A 3UKTA 1W8UA 3E6DA 1HRV3 4CCCA 4E2SA 2WL1A 1CZSA 1XOYA 1AYN2 3MICA 1G9DA 1O3RA 3GDBA 1GOGA 4PIXA 4QU2A 1RUJ3 3OPTA 3VBOB 3BB6A 3VHPA 2CGPA 4Q0SA 4KBBA 3I7DA 3OUIA 3VBOC 4P9JA 3PL0A 1CAUA 4OZXA 3HN1A 5A3UA 4TN7A 2VBDA 2VD7A 3PHMA 4HKOA 4YLZA 1H8VA 1JZ8A 1C8NA 4JV4A 3WQBA 4ARXA 1JYWA 4LTAA 4V2WA 4QKBA 4QXKA 4WM7A 4CDXC 1PVC1 3ZPYA 3ZIWA 4XDOA 4CCKA 4S2HA 5F3EA 4E8DA 2HJIA 1Q8PA 2R071 4I30A 4RGGA 1CR7A 4NVPA 5A3PA 2NQYA 4QXCA 1K45A 4B29A 1VB4A 2DVGA 3AXEA 4IV3A 2D6NA 4LNVA 1A34A 1V9U1 4BXSV 4CU6A 1V6JA 5ABJA 5BNOA 5HPOA 3ZXJA 1RUD1 2DCKA 5FP7A 4X6QB 1UYPA 4GB31 4IGPA 1OFNA 3KS7A 4IW3A 1SACA 4Y22A 3ORJA 2NLRA 2ZACA 1XE7A 4N9HA 3KVAA 4CSWA 2G1MA 5CG9A 3AZWA 2I45A 3IBMA 1BXHA 1VAVA 4LHSA 2VOTA 2WWSA 2BFUL 2OUJA 5FLJA 2R0FA 5IAVA 3K3NA 2TBVA 4IEXA 4W4ZA 2JX9A 3B00A 1BQPA 4ZU5A 5APAA 1OOPC 3WCSA 2X53S 1REEA 1ZZ9A 1AR62 2JG9A 1SCSA 2Q4SA 2VW1A 1V6NA 4RFT0 1BBT1 3C7OA 4HVQA 1JODA 2ARXA 2GNTA 1LEMA 2VTFA 5GLZA 3R05A 4HXCA 4XETA 4BIOA 1YQCA 5BNPB 2PLV1 5A32A 4WBBA 5C8WA 4TWTA 3NAPC 4YW7A 5KHHA 5FMCA 3LA7A 2R063 4DINB 4DUXA 3ACIA 3O0WA 1OF4A 2LS6A 2HYKA 5CU1A 5D8AB 1O5LA 2W1SA 2E32A 2QQKA 2VNGA 1U12A 4UXAA 4EN6B 4LOTA 2TEPA 3GJAA 2RR11 2XL9A 4AEKA 1NCQC 3FFQA 1E5IA 2DF7A 1H9WA 5E16A 5LK5A 1UY0A 3O1MA 2HLEA 2YBKA 2OX0A 4PLOA 1QMJA 2VJXA 4RR3A 3UYJA 1WCDJ 1ZRIA 2QZ2A 4L99A 1D4M3 3M3QA 1HW5A 2Q1ZB 2XJSA 4DQAA 2GNMA 2NP0A 3VL9A 3MI8A 1COV3 1UOJA 2QBXA 4JKLA 2Q1FA 1AHSA 2CAUA 4M3CF 4GKYA 4P9WA 1LRHA 2VMFA 4XJ8A 4D6SA 2Q5TA 4OCTA 2ZS6B 1H4GA 4QPIB 2JKXA 4CEYB 2HWC1 5J09A 3RVHA 1LOGA 2RJ2A 4M00A 2BWAA 1ODMA 1OMIA 2ZPXA 4CEYC 3LDBA 4RQPB 2XBO2 3ZSLA 4E4SA 4IEZA 2A6VA 1PGL2 1D4VB 3DN7A 4GIQA 4R4XA 3VBSB 4MZUA 1ZYBA 2ZX0A 5JSPA 3FBYA 2DU0A 1S2BA 4AVTA 1SG3A 4JGZC 2X5IB 3VBSC 4CCDA 5CFCA 1V0AA 1VBB1 4FFGA 4D0QA 1OQDA 1PGW2 1JU3A 2X5IC 2Z42A 5DG1A 1TME1 2A70A 1RTVA 2JDZA 2JXAA 3THPA 4CCJA 1HRV2 3MGUA 4Y1XA 1LECA 2XHNA 4OULA 5FR3A 2B8MA 1SFPA 4FFHA 4QGNA 5LEKA 4MXWB 1ZZ7A 1VRH3 4LO5B 2YY1A 4A7YA 5FP3A 4YGDA 4KL1A 3BI3A 2D40A 5A7QA 2VMDA 1PX3A 1BMV2 1ENSA 5HCBA 1AR91 5HXMA 3IZOA 1SLTA 4R9AA 4A4AA 3KVBA 5CKNA 1RHI3 1HJGA 2D97A 1HRI1 1UPSA 2A5ZA 4Q4Y2 1W2UA 4URTA 4B7EA 1W8HA 5A80A 4AAXA 1US2A 4E27A 1RUG2 5JOWA 4XDPA 4NIDA 2WT0A 4OI4A 3LOBA 1J58A 2AC1A 1GLHA 3WDTA 4FPYA 2BP6A 4UW6A 5JMOA 3LAGA 3LEMA 2XVGA 4OMDA 1RUJ1 5A3LA 4AGRA 5A3MA 1GICA 1GNZA 2QE3A 4LKSA 3HNYM 4XIKA 3UK9A 4LIUA 1FPN3 2VUCA 4FTSA 3JD72 3PUQA 1K5MB 4LITA 2XLFA 3O1TA 2YPDA 3ZN4A 3J7LA 4QWNA 4P14A 4DUWA 4XABA 4EWEA 1K5MC 2Q30A 2A3YA 3PLQA 2D93A 4R8HA 4FTBA 1S0DA 4LBQA 3ZFGB 4D69A 4NPMA 1HQWA 3LSDA 1RUH2 4FXKB 5F7UA 3C2UA 2RS33 3AYEA 5CZKA 2ZHLA 1JXNA 2E26A 2ZKLA 5FZCA 1DFQA 2WT1A 1DQ1A 3KHBA 4I0BA 1AL22 3P6BA 3UESA 4Y26A 5JWPA 4PIYA 2NMOA 3LEKA 2JICA 2W47A 3SKVA 1DZRA 2PTMA 1L7RA 1ENQA 1LHWA 1UQXA 3TWIA 3Q8EA 5M0TA 2QJVA 5IW0A 3USSA 3WNMA 3NSTA 4XQWA 5EV7A 4AVSA 2HEWF 5AC92 2W95A 3WP6A 3WINE 2LRPA 3AKRA 3NV2A 2CDPA 5H9QA 1MZEA 4LO7A 1N1VA 2EXHA 5DXDA 3HR9A 1RVF2 3KT4A 3GCXA 4CXYA 4LOSA 3AFGA 3ZYGA 1GSLA 1HB1A 2CWSA 1T6BX 2QQNA 2XVLA 3I4IA 4W6XA 5DPNA 5ANNA 4ZY9A 1LU2A 4XFBA 2DVDA 5EYYA 1SLLA 3ME2A 4CDUA 5E89A 2BERA 3MPPG 3AZVA 2OPKA 3SCGA 4TLGA 3P3PA 2QKDA 4H14A 4IV1A 2A6WA 2ZMKA 1V6MA 3HOBA 3WDVA 2TNFA 2RM23 3M1HA 4CXXA 4YVSA 2W68A 2ZBJA 4KWLA 1NX9A 3RGBA 4D7YA 1HQLA 1VIWB 1OC1A 2WNVB 1W2OA 3H8UA 2R061 4FOWA 1N3QA 4LK6A 1W3XA 3ZDSA 1MS4A 1G9BA 2NPIA 3NV1A 2ZX3A 5C70A 4JC1A 5KC6A 5A6XA 2FDHA 4LA2A 4QQHA 4B1LA 2QQOA 3J8F3 1UU5A 1EAH2 2ZA9A 2VXJA 2XJRA 2EF6A 1UMZA 2XMLA 2WT2A 4YFWA 4UFHA 3KV4A 1D4M1 2OVUA 3M2MA 3AYAA 1X36A 2VOXA 3GHMA 4MSVA 3VKLA 1PM4A 3MLLA 3B9CA 3RJRA 3S7IA 1C8M3 3MBWA 1X9TA 4FP2A 3WDXA 1COV1 3USUA 3LD8A 3TB0A 1W9WA 2HBTA 1GWMA 3POBA 1PZ7A 4BB3A 3RZLA 5JI9A 2CNAA 2VVEA 2VR4A 3OEBA 4XQDA 5KXEA 2RJKA 5LBCA 3ZFEB 1VRBA 3WQ7A 3N9PA 3AL6A 5KHKA 1NQDA 2ZKNA 3PVBB 1UF2C 4OVEA 4YVWB 3ZFEC 4P9GA 1CIYA 1W0PA 4XFAA 3KV6A 4YVWC 4OLLA 1Y3TA 1TMF2 5F5IA 3JUUA 3HQXA 5JXIA 4BLIA 5T3NA 3VBRC 2P1BA 1NZIA 1XNDA 2OKXA 4CDXA 4MLOA 2BNOA 3VBHB 2YBPA 4M0HA 2FZ2A 3WQ1A 3AB0A 1R083 4HSJA 3VBHC 2HEYF 4F7ZA 3WW2A 2A75A 1A78A 1W6MB 1S0JA 3C7FA 3TN92 3HMYA 1VRH1 2E6VA 2C24A 2DVFA 1CONA 2V73A 4NHKA 4PHZA 3SCFA 3HAGA 4FBFA 4IERA 1WCSA 4HPKA 3O5SA 2ZGNA 4NPLA 1Y9MA 2BDRA 4CE8A 4RHV3 1GU3A 3JU9A 2DYCA 2ZZJA 3C7HA 1EPWA 1I5ZA 2ILMA 3NVCA 2P2KA 5B4XA 1UOGA 1RHI1 4XYXA 3VBFC 4CCOA 3BTXA 3B5LB 5FXWA 1DYPA 5GLUA 2ADEA 2VTXJ 5BY5A 3B93A 5EXOA 5L19A 1KJLA 2FQPA 3E5XA 1WUVA 1UZZA 3N7MA 1VBD1 5ACA3 4RA0A 4AI3A 4GJYA 3THDA 3TOJA 5J7MA 1IS5A 2ZMNA 3I2KA 4ZONA 2HYXA 2C5DA 2GC2A 1OA2A 1OOPA 2JJ6A 4FAGA 5FO9B 2JE9A 4FPLA 1WLTA 4YYOA 1FT9A 3POIA 2D43A 1FPN1 3DEMA 2XJVA 1W6OA 3RQ0A 4H2AA 1WMEA 1S55A 3A0KA 3NAPA 3V56A 2CGNA 4QQPA 3S6PA 4QXHA 3AMNA 2VL4A 2UY8A 5IHRA 1CAUB 3K4AA 3OGRA 2CU5A 3ZYFA 5CEHA 1UX7A 3WNXA 4LT5A 2P3JA 2VMGA 5FP4A 4IGQA 5A3OA 5E88A 3S5QA 5FY4A 1G6NA 3K75B 3OBAA 4XUQA 2ZTNA 5DDJ2 1NCQA 3AVRA 1VBC3 4I3GA 3WNOA 4C8DA 4TZDA 1XNTA 4BLJA 2R0HA 3IT8A 1BEV3 2PHWA 4XDQA 3HEIA 2ZX2A 3I2FA 2RM22 3W5MA 5FTTC 3FN9A 5I0SA 2QCSB 4QGLA 2ES3A 1KQRA 4IE6A 1HIXA 1N3PA 3BN6A 4LHNA 4META 2ENRA 2ZGRA 4MVTA 4F3JA 1D7PM 2FHRA 5ABJC 2DCZA 4XXPA 1JMUB 4MXVA 4RL7A 1GZWA 3NWKA 5FZ7A 1CAWB 4Y22B 4Q4X2 4A44A 4CEYA 3NNGA 4L11A 1I1EA 3MZHA 3SCHA 3H3ZA 3A22A 2BEOA 4YM1A 2WDBA 2WFF2 3LDKA 2E33A 3PVEA 5I8YA 1OKOA 2VECA 2HH9A 5L7OC 2ARAA 4QU1A 3LB9A 4JQRA 3VBSA 2B9VA 4JGZA 1NOVA 3CLPA 5FZKA 5I93A 4ET7A 4YM3A 2GC3A 1V6KA 1LOAA 2UYAA 3FHIB 5E6HA 2ZEXA 1C8M2 2RDNA 2Y6GA 3WOGA 3OOXA 1TNRA 2JG9B 5F9TA 2D6OX 3DYMA 4Y5TA 2WS93 4AAPA 2WZR3 4Z1VA 4ZU7A 5BUVA 3GM8A 4MXWA 5IWFA 5T52A 2WNUC 5A32B 2D3SA 1EV11 3I97A 2EXIA 5GALA 3WR0A 3J8F1 1FMD2 5C71A 3PU8A 4AVCA 3IIAA 3Q8FA 5FZHA 3TBDA 3WF3A 5F39A 1ULGA 2RVAA 4FPJA 4CEWC 2VCAA 2FMDA 3OF1A 4XOGA 3T2TA 2DFBA 5F1RA 4NRPA 2ZXQA 2ARBA 1H2NA 1MS8A 3FUQA 4GXLA 2ZGKA 5BNNC 4NWWA 2VZTA 3S57A 3AMHA 1KJRA 2LALA 3CHXA 4RR3B 4XUPA 3RZZA 4XF4A 2GNBA 2QVSB 2C26A 3OEAA 2JB8A 1W03A 1KS5A 3I49A 2JDNA 1ALYA 2BOIA 2SBAA 1VMJA 1FX5A 1UMIA 2RS13 3FLRA 1VB2A 5J48A 4Q0VA 1VBE2 1H4HA 2XG3A 1AR71 1RUE3 4Y4RA 1OUXA 4QD2A 2B9UA 4KWKA 2Z2SB 4FPCA 4QB6A 2DWRA 5FZEA 3W5NA 2GN3A 1Q8OA 3LA3A 2PAKA 5FPXA 1R081 2WO1A 1MEC2 2WA4A 2ZJCA 4ONUA 3E5UA 2PAMA 1WCKA 2PFWA 2ZABA 4UFJA 1YIPA 1WMFA 5IT6A 3K4ZA 4NHXA 5ACA2 3KGLA 1IOAA 3WVJA 5CFCB 5CISA 4QDRA 3N9QA 1S4CA 2X09A 5IK4A 1DDLA 3ZO0B 2JECA 1AYN3 1LENA 1N1SA 4AOCA 3DYOA 5KXBA 2JD4A 4XAEA 3EJKA 3NJVA 2HWD2 3LEIA 4H55A 2GP5A 4RHV1 1XSRA 3URFA 1HX6A 1GWLA 1ASJ2 3BTYA 1B09A 2ZGTA 3IDBB 4L2NA 5T50A 1IPKA 2ZGMA 4AEDC 5CADA 1QGLA 4QHBA 4FFFA 4CU8A 3J7HA 1DGRA 3ZKUA 4AI0A 4JVAA 3SHRA 2H0VA 1OD3A 1QU0A 5FV3A 4N43C 4MUVA 2JWPA 5JZGC 5C3SA 3HBZA 2V09A 4LIVA 1KFUL 1RJ8A 1ENXA 2PHRA 4ISQA 5JVVA 3KHCA 2D44A 4X6RB 2GALA 3ABZA 1H2MA 3AXDA 3B94A 3FJSA 4PF1A 1C1FA 5FPVA 1RUF3 3R4UA 3ZXKA 1NLQA 2P3KA 3X29B 2JKBA 3AP6A 2YFUA 5FQ0A 2PHTA 5JSOA 3I3EA 3O1UA 4OI1A 3GHNA 2QZ3A 2O8OA 1H6YA 3SC7X 4CXWA 2CWMA 4M3CE 5FYYA 4ATFA 3I2JA 3FLPA 4OHYA 3WF4A 2BYVE 3VZNA 4CPBD 5HBAA 5BNQA 2P34A 2FD8A 3LGRA 2Z79A 3C3VA 1DYKA 4LBLA 1PMIA 1XJAA 4MHUA 4IEWA 5FZAA 1OSGA 1PIV3 5A7WB 4Q4W2 4LBQB 1BK0A 3WF1A 2AZ5A 2E9QA 4Y3OA 5E8AA 5C33A 4A41A 3AYDA 4MV2A 3OGSA 2QQWA 3AX4A 1BEV1 5IYYA 2W46A 1LKNA 3FZ3A 2YXSA 4W50A 4QX5A 1QNYA 4LBOA 1J83A 2RJLA 2W0XA 2WWUA 3TNQA 4WZFA 1ZBE2 3ZSEA 1AR63 5CG8A 1QJY1 4UBHA 3WG1A 2TUNA 4CCLA 2Y6FA 4RD7A 3WXPA 3RG0A 4Q0PA 4MHRA 4HVRA 4UF0A 1RINA 5DAWA 3RZHA 2ZX4A 3RYKA 5J37A 3FWEA 4O61A 1Z0HA 2ADDA 2AR6A 4EZHA 1O59A 1GZTA 2HWB3 3BKZA 2DBNA 3U10A 4XIOA 1CJPA 1FNYA 1GNYA 1WCQA 4DS0A 4YVWA 1DQ5A 1SLIA 4E4HA 3VBRA 3S30A 1ZM1A 2AEZA 3KV5A 3POFA 5KBFA 3EBRA 1AXYA 4PQ9A 1HN1A 1KDKA 2ZHMA 3HT2A 2JG8C 3BIEA 4FPKA 1D2SA 2ZMLA 4YZ3A 3VZLA 2PHFA 2BRTA 5JOYA 1JYVA 2ZEZA 2BGCA 4NRMA 4CDUB 1OVPA 5LEJA 5LY2A 2PYTA 4LULA 3VBHA 4LBNA 4CDUC 2XPJA 1VBA2 1DZTA 3CZUA 4P08A 1FNZA 3KF5A 2QQUA 2H6CA 3TAYA 1F35A 1W6MA 1FOD2 2A6ZA 4GD4A 4ZPIA 4YVSB 5GLVA 4BQWA 1JBCA 1UIKA 2WZR1 3WNPA 1QJX2 4Y1VA 5A1AA 4FPFA 3OY8A 2D6KA 3PIGA 4NPRA 1RMU2 3NV3A 4G3YC 1Z78A 2VGDA 5FXVA 2D6MA 5FOBB 2WYSA 2J1SA 5JIUA 3VV1A 5FO8B 1WMXA 3FE5A 2RS12 3VBFA 1QOSA 3WD5A 5IVEA 4W8JA 3POWA 2XBO3 4QB1A 4EWDA 2Z69A 3MLKA 5F8PA 5F3GA 4R9CA 3ZN6A 1QXRA 1GP5A 3AVSA 5HCFA 1ZVFA 4NHYA 5LBFA 4QXBA 1XRUA 3WDYA 1A8DA 3NJXA 1SBDA 1E5SA 2JDMA 1DHKB 2J1EA 1W6NA 3J7MA 2W1QA 4XUNA 1XYPA 5FZFA 3SXWA 1AJKA 4IQPA 3USUB 2F6BA 2B7YA 5FZ8A 4AVAA 4TXWA 4PF5A 4J25A 1W6PA 4HANA 1JYXA 2NMNA 2IXKA 2WO3A 3VLBB 4AE2A 1DGRN 5F2SA 4I0AA 1PO22 2QQMA 2ZX1A 5FUPA 4CTEA 1CPNA 1RUE1 3VD9A 1P8JA 3WP4A 2VUJA 5JXHA 3UL2A 4P9IA 4BU2A 2EIDA 2I07B 4J1XA 4A6OA 4EYUA 2F17A 3NNJA 3QCWA 5AVAA 1UOFA 2R49A 4QT6A 2P3YA 1JZ3A 5FRAA 4KQ7A 2IZWA 4X8NA 2C6SA 1GQGA 4R9DA 2X8KA 3DPRB 4XFFA 3VUOA 2RS52 4CDXB 4Q4Y3 1LHNA 3DPRC 3VZKA 3EHKA 4INDA 1RUG3 1AYN1 1J3PA 3CO2A 4XFCA 4AW7A 3RNSA 5J36A 3IDAA 3KF3A 2MPFA 4Y5SA 3WV6A 1C1LA 1O3TA 1MPXA 1QQP2 1AUYA 1ZZCA 3WP5A 3AMPA 3UGHA 1DQ4A 5C5UA 1RUF2 1S0EA 3VZJA 2VMHA 2W5FA 1YQ8A 4UW5A 4BM8A 2AACA 1R1A2 5FPAA 4NJ4A 2YU2A 4HPKB 3W9AA 3JD73 1OD5A 5T5OA 2AH2A 1AR83 3GF6A 4Z82A 3HIFA 3SITA 2A1XA 2ETEA 4WVVA 1CAWA 3AJZA 1RUH3 1ULCA 1OF3A 3RS6A 4OI2A 4CUBA 2VW2A 1Y4WA 3I2DA 1LR5A 1PIV2 3M4FA 4WVZA 3ZYIB 4W6YA 1WA4A 5FY7A 5L7OA 4COWA 3ZOIA 4X8PA 1HJFA 1AL23 1K12A 2BZDA 1OLMA 1NQJA 2B39A 3U14A 4CUCA 4MGQA 1YI7A 3D0JA 3OYWB 3VD4A 3I3BA 4EN0A 4Q0QA 2WNOA 4IEYA 1H1IA 4YW3A 1OOPB 1CQ9A 5CFDC 5LK7B 3IDEA 4E4DX 4FQ4A 2QUOA 3SNMA 4UFLA 5GZGA 4HT1T 2EXKA 3ZXGA 4BDVB 5K4LA 5AC93 1W6OB 1BBT2 1UMHA 2WNUA 4FOYA 2R1BA 3NAPB 4YFZA 1XB9A 2HWF2 1EUUA 1RVF3 3I59A 2ZHKA 3CKHA 4LE3A 2HWB2 5L9BA 2YYOA 3WT3A 1W9TA 4XBQA 3MO4A 4L9BA 4F83A 3RZMA 5FZ0A 4NWVA 1BYHA 1NYWA 3LIHA 3BYWA 4BIFA 4D6RA 3H8OA 4CEWA 5FP9A 2VU9A 5JXJA 1GKBA 1GQHA 1R1ZA 3NKTA 1QNWA 3HBKA 3IDCB 1S2EA 1NCQB 4A7KA 3NV4A 4COYA 1W05A 4JDOA 5BNNA 1I9RA 3FLTA 4CCNA 1QH7A 1QJU1 1YWKA 4M0NA 1EY2A 5CKMA 1UXXX 3I3QA 5T54A 2A71A 1XXNA 3FUOA 3T09A 5K8SA 3T08A 1DGWX 3KQRA 1J59A 1UYYA 1ND2C 1KEXA 1WBFA 3GXUA 4W65A 4CDQC 1IKQA 1SEFA 3NJZA 1CZVA 2EIBA 4YG6A 5A7SA 3GZUC 3T1LA 2J1TA 4G4FA 3WUCA 1GUIA 1MVQA 4MOAA 5FAXA 3ZLIA 4XMIA 4AFAA 3VDBA 2VNRA 2Y6JA 3JBG1 4GWMA 4OFGA 1BZWA 1GZWB 4NIHA 1YRZA 3WF2A 4ASMB 1WWYA 5IVJA 4UBGA 2HKXA 1LB2A 1EAH3 4RYDA 4O9EA 1M4WA 4XF3A 4BMBA 3K77A 1MS1A 1AXKA 1KFXL 1RL3A 1W06A 3VKFC 5K0UC 1J3RA 1HXS2 1YNAA 4WM8B 1OH4A 2VZRA 3D5OA 2YB7A 2XXZA 1XYOA 4JGZB 2UYBA 4WM8C 2P37A 3H50A 4Q4V1 3RWKX 3MIBA 3ZFFA 4QHZA 5CAZA 3E5QA 2RV9A 2R042 1REDA 1CAVA 4TTGA 1IS3A 1ZRRA 2QDRA 5H9SA 2IVIB 3WQ0A 3WDUA 5JAXA 2OQ6A 4N53C 1ZA4A 3FC0A 2WYFA 1X9PA 2W9XA 4AEDA 4AI9A 1AYM1 4IETA 4AK3A 1VMFA 3SMHA 5FXZA 2MEV2 1GFF2 4C91A 4EWAA 2XWBB 3POYA 5A3WA 2VVDA 1TMF3 4KBZA 2EALA 2C1FA 3V0BA 2CAVA 2VZOA 1PGL1 2W1UA 4N43A 1YQ2A 5ABJB 1OBNA 2D6LX 5JZGA 5H9RA 1URXA 4JGYC 1PGW1 2FCUA 3LPGA 3OGJA 5F5CA 5A3NA 3MIDA 4LO4B 2G9FA 3RSJA 4YSFA 1HRV1 2BVVA 4UWDA 1S0GA 1US3A 2GC0A 3TN93 4EN7B 4AF9A 1QEXA 2O8QA 3KSCA 2GAUA 3SH5A 4BE3A 4PJYA 3SLIA 2PHLA 5A6YA 2WFPA 2O0OA 1ZZ6A 1ONAA 2VVFA 1DGWA 3ES1A 3GNEA 1GMMA 3PDQA 2WO7A 4S2DA 4EZ4A 4AQSA 4NMIA 1BMV1 1ZNPA 1HLCA 2PHUA 5FY8A 1SZBA 3WEZA 1EPZA 4EE2A 4CVUA 1KGYA 2RG4A 3N7JA 5HXVA 4MGYE 5KR7A 5L9RA 4P9YA 5FXXA 3GZTB 3LWCA 4PBOA 1Y43B 5EWSA 4YPJA 2J1VA 1AR82 4FAHA 1HB4A 1O5UA 4XF9A 5A7WA 5A3TA 1ULOA 3V65A 1YCIA 3UJOA 1RUG1 4QX3A 4YW2A 2EIEA 2ZEYA 1Q8QA 1OKQA 3MHZA 2IXIA 2VBBA 1W8ZA 2VO5A 3OBZA 4XBLA 5FZ3A 2FDKA 4OQ8A 3I2HA 2CY6A 2WKKA 4YGBA 4FFIA 2ZEWA 3JD71 4B3NA 2WNEA 1OT5A 2Y60A 4GMP0 3BALA 2QFEA 1H8TC 3BVCA 5IVCA 4Q0UA 5FY0A 1CZTA 1PMJX 3MUZ1 2WA3A 1O4ZA 1KRIA 1ZZ8A 4K1ZA 2J1RA 1OPMA 1VALA 1DYOA 2YC0A 5DZGA 2JG8A 4D94A 1AL21 4RFRB 1XPWA 5DUVA 5A33A 5FOJB 5LY1A 3B7MA 5DDJ3 2IFWA 4JKKA 4AQ2A 5IUQA 1ULEA 4QAWA 4BQYA 4A3XA 5HI0A 1TEIA 3K48A 4K20A 5GKAC 5FZOA 5FPUA 3N36A 4RSUA 1YJLA 4CP1A 2YPJA 3VDAA 4BQXA 2RMU2 3ZXFA 4P02B 5KHGA 4LXLA 5CYYA 5AC91 4FPOB 5FQ0B 1GZCA 5KXCA 3AP4A 4LJHA 3ZMOA 3M70A 1GYKA 2UY9A 2OIIA 4CP0A 3QLQA 3PUIA 4HOOA 4P9XA 5C8CB 4QX0A 1K5JA 4GWIA 1AVBA 3ZVXA 2WZ8A 2HBUA 3HNBM 4QKDA 4ISRA 5C8CC 1NLSA 4Q4X3 3VD3A 4AI8A 1M06G 3IAQA 1Z7S2 2WFF3 3BCWA 1U0AA 5FYUA 1POV0 4NHLA 3Q9OA 5D2AA 4CDWC 1MS0A 3BUCA 3KT7A 4LEJA 1UYZA 4FT8A 1NA1C 2R6QA 1GWKA 5C8CA 2OUHA 3EO6A 5DN2A 3ZYRA 3DXTA 1V6OA 2QTWB 2Y38A 4H7MA 3MUY1 3SEPA 5A7OA 2ERFA 3IMMA 4UAPA 4HONA 2WQZC 4A42A 4UF0B 2HEVF 2WRAA 3H7YA 3PVOA 4LUMA 1HDKA 3D8CA 1K42A 5FP8A 1XE8A 1FMD3 1UZVA 4BOWA 2WLPA 4JQTA 2Y26A 4M4PA 4KNCA 3VL8A 1DLCA 3ALQA 1DQ6A 1RITA 1WBLA 3VBRB 5EPAA 4XUOA 4QGMA 4YZ4A 4Y1UA 5FBJA 3RMYA 1JUHA 1ULFA 3DPRA 5FYIA 4D7SA 2IXCA 2KXLA 3ECQA 4K6BA 5EZWA 3V0AB 1NY71 4LQRA 1A3KA 2NYYA 5SV5A 3U0ZA 2DCJA 2VTXA 4GAZA 5GZFA 3UKNA 3H7JA 5EP9A 5FO7B 1XNAA 2UWAA 5CB7A 2P6CA 4HBNA 3T0AA 3CL1A 1LEDA 3MFAA 2WC2A 2XUEA 3OY8B 4K8FA 3WW3A 4AGVA 5JIAA 2XJPA 1VBE3 1I6XA 2DVAA 1JU4A 1QHDA 1C4RA 3AYCA 1L3JA 4QQOA 1TE1B 4D8MA 5C4WC 1TNFA 3BOPA 3G7DA 1PO13 1UPIA 5FZMA 3VBFB 1X50A 4YG0A 5LB6A 2UURA 5SV8A 2C0ZA 2PQSA 4Q27A 2Q8CA 1MEC3 2P17A 4GZ9A 3ZN6B 5C6CA 5IVVA 1JOPA 2XJQA 3MF9A 1SLAA 4FI9A 3N9MA 1JN2P 4LR4A 4XTMA 4LBKA 4OHVA 5FK8A 3TN91 4BA6A 4BCUA 2A3WA 3LA2A 2V72A 1VBD2 2CGOA 1PHMA 4JZRA 5FWEA 2CSGA 1W6NB 3OYWA 2VOVA 2YGLA 3LKJA 5G04L 4QPWA 5CFDA 3W21A 1S2KA 2WO2A 2HWD3 4NOTA 5FZDA 1W6PB 2VNVA 4NIGA 4Q1PA 2R30A 3H0OA 2Y8KA 1C5IA 2B4KA 3JB8A 5GJ6A 3U75A 4OQ9A 1ASJ3 4DZGA 1SQ4A 4FO9A 4Z2AA 3SKJE 3GCWA 2VOWA 5K7PA 5A6QA 4RGKA 5C7GA 3AL5A 1CWPA 4MX3A 4XW3A 1NE6A 4ZS3A 4L97A 2WUHA 3KLSA 4YGCA 5FZ4A 1R093 1FV2A 2Y0IA 3BGAA 2RS31 2GMEA 1CD3G 2D7FA 4A7ZA 1S0FA 4B1MA 2VZUA 4IUGA 3T0BA 4BISA 2YHJA 1RUNA 2D98A 3N9LA 2FBEA 1CX4A 3VB9A 4B7KA 1ACCA 3U11A 4COZA 4OI0A 2EAKA 1AL0G 2MHFA 1AF9A 1ND2A 1OURA 2Z4FA 2Q8DA 4CCEA 3T30A 4N90A 4CDQA 5JDBA 1IQAA 4P00B 4QQ2A 1NE4A 2GMPA 2DFCA 1XBFA 5FYCA 1NCRC 3MW3A 4Y33A 2PMWB 2BJSA 1UYXA 3ZSKA 1DU3D 2XLGA 2J42A 2JE8A 3W58A 5FWJA 1DBNA 2YU1A 3FL7A 2QQIA 4Q4W3 1CPMA 4ES9A 3QH6A 5DDJ1 1Q8SA 5FPLA 4Y20A 5GZDA 3LE0A 5FYBA 3J4UH 2JE7A 3P1IA 1X8MA 3D0SA 3TEXA 4LK7A 1RUI2 1YI9A 4FVVA 3P5BA 2YFZA 5K0UA 5L7OB 1OVSA 1W28A 2WINB 4AGGA 3ATGA 3ZDVA 5EFUA 2RM21 3R4SA 4MGKE 4WM8A 2VMIA 1O4TA 3ON7A 1O3QA 1MZ5A 2QDNA 2UU8A 3DYPA 3KD4A 1ZBE3 2ID4A 1U5IA 3EQEA 2PELA 3QD6A 3NQHA 3HT1A 4GKXA 4E9KA 1AJOA 1UZ0A 1YO8A 3ZPOA 3EYPA 5FY9A 4N53A 3UETA 2WABA 3OTFA 4Q4X1 3VD7A 4DNYA 3K46A 2YBSA 3U1XA 2WNUB 4JTNA 5F6KA 3H42B 1LNSA 3N4MA 1LAJA 2WFF1 3I59B 5DG2A 4UFIA 3AP5A 5FZGA 4ZXKA 1H9PA 1UIJA 1EV12 2B42B 2YV8A 4MO3M 4QQLA 1NAEA 2ZCWA 4B4PA 5CNAA 4LKDA 1YUDA 1ZREA 4CEWB 2FMYA 4JGYA 4A2UA 3OGVA 2E53A 3E1F1 4AHYA 1VBA3 1CJDA 1C8M1 2LTNA 2D5FA 4BQ4A 1J3QA 4XF0A 2JIGA 3SQOA 4AFCA 5BNNB 3VD5A 5FIXA 2VQ0A 3AKSA 1FOD3 2JB4A 4KG8A 1HV1A 3TRSB 1QXJA 1WW7A 3VBUC 1QJX3 1NXD1 4HFSA 4XEZA 3NL1A 3RMXA 1RMU3 1DLLA 1QOTA 1G8WA 3PURA 4IEQA 3NW4A 2YC4A 5JR2A 1SBEA 3VGIA 2ET1A 1UNBA 5FMDA 3RI8A 3WY6A 4AQ6A 3J7NA 3AJYA 4UFMA 5I8TA 3VHNA 5I8SA 5IK8A 1XQNA 2F4LA 5AVPA 1WLCA 4YZ1A 3I54A 1AR72 5DAQA 2EICA 3CDZB 3E97A 1PO12 4NAOA 4XILA 5EJ3A 3U07A 1A8MA 4S2GA 1H1AA 4BH9A 4WVWA 2VUAA 1ND3C 4GQ7A 4XFHA 3WG3A 1W6QA 1W2NA 2DVBA 4NAMA 1HKDA 3UV9A 2W91A 2WN2A 1VR3A 4HG6B 3RYRA 3ZFFB 1ZZBA 5LA1A 2DUQA 5GLTA 3ZFFC 1CAVB 4IXLA 2JDHA 3T4HB 1H1MA 4ATEA 3O1SA 1C28A 4MG2A 1PO23 2VZVA 1VBE1 2D3RA 1H8TA 5AFBA 1WLWA 3NMBA 4AEDB 5JPMB 3QBQA 2XLAA 4Q26A 4JDMA 1RUC2 3DCQA 4RHV2 4ORFA 1CX1A 1MEC1 3O0XA 3RZGA 4CU7A 1UU4A 3V0BB 4OUMA 5FPBA 4NIIA 5HV4A 3GGLA 4N43B 4AYUA 2RS53 2ATFA 1ZBA2 2GP3A 2JDPA 5CKQA 5ACA1 5JZGB 1R092 1SHWB 4E4ZA 4S2FA 5FYZA 2VQTA 4UI9L 2Q8EA 2CYFA 3POGA 1UL9A 4F8AA 3RWNA 4NHMA 2HWD1 3MW4A 1QOOA 1QQP3 1STMA 3GYDA 4UT5A 5F2WA 3IAPA 4QHOA 1W3VA 1XC6A 4PI2A 5CBLA 2Y6KA 3S5AA 4ZZ5A 1LOFA 1R1A3 1APNA 5L36A 1IHMA 2X29A 2C4XA 1RUD3 3M3CA 1AZDA 2W1WA 4WV8A 3T1MA 2JDYA 4GWJA 1OA4A 1PNFA 1YFYA 4HN1A 2YROA 4ASLA 3ZSJA 1C5HA 1O8PA 4CA9A 4DFSA 3AMMA 3GZEA 1TVGA 3KQ4B 3AP9A 3OBRA 5LA9A 2ZGLA 1LU1A 1GANA 4LORA 4YW4A 4PQQA 4A3ZA 1DCSA 4C0HA 3CBNA 4HETA 3WNNA 2A6XA 2D6PA 5ANQA 3IPVB 1LGBA 1Q8VA 1VBC1 4CDWA 2JIJA 4E2QA 1JTZX 5FCCA 2VAUA 4DRVA 1NA1A 3J26N 1MZ6A 3PNAA 5D1IA 1L7QA 1UY3A 4UYBA 4WVMA 4HLTA 4QPYA 1JYNA 4IEOA 2VZSA 4XXAA 3TEZA 4ZKTB 1F8VA 1MS3A 4XMAA 3R6SA 4M01A 3N35A 2KA3A 3H3LA 3PJYA 4JCKA 3VDDC 1YFUA 2C9KA 2Q0AA 3O12A 3IMNA 4QB2A 1G9FA 1MVEA 4KMQA 5FZBA 1SPPA 4LBQD 4AHWA 5JOZA 4AG4A 1MS9A 1QY4A 3POEA 1WW5A 1BBT3 1NXMA 4J1WA 4Y1YA 3ZIXA 3THCA 2WIIB 2WN3A 1N47A 4Q4W1 2HWF3 2O1QA 4D6QA 1UWWA 4EJRA 4EROA 4DY5A 3OUJA 3HNMA 4IGOA 1W2AX 1D0HA 2OYZA 1GOHA 1HN0A 2XONA 4E8CA 2N7GA 2BU9A 2W52A 5HCAA 1VPHA 2JG8B 2RDSA 5A33B 1W99A 5EQUA 4PDWC 3LOIA 3MFCA 4V2VA 3ETPA 4AHZA 4CZSA 2VXRA 1W04A 2VQUA 2KM2A 2GN7A 5B4NA 2HWE2 1JHNA 1XYNA 2RHPA 4GA9A 2WSVA 2IXHA 3ACGA 1ULPA 5FMBA 1G86A 4MGZE 4FPGA 5FZOB 4D3WA 3V0AA 4O7XA 1G7YA 4UW4A 1MZFA 2WS91 3LF7A 3EMRA 4BQ2A 5I0UA 1BJQA 2W94A 4OYUA 4ES8A 1JZ4A 1DZQA 5D21A 3NO8A 2VCCA 3PTYA 3LDRA 1JI6A 2R32A 3ITQA 1MQTC 5C4WA 1JZ6A 3CZJA 4CYDA 3KV9A 3H9AA 2GNDA 4DMIA 3O1RA 4GH4B 1UO9A 4YWAA 5F5AA 5H9PA 3HQRA 4Y24A 4GH4C 3TNPB 1YC61 5KHJA 1VBA1 5FJHA 4LO6B 1NKGA 3AP7A 4JAAA 2CL2A 1SFYA 2ZHNA 4KH9A 4XHBA 5DAVA 1HXS3 2VCMA 3ACFA 1FOD1 1ZX5A 4E2GA 1N3OA 1W9YA 2DDUA 4U2AA 3CJIA 1QJX1 3JCIA 1CN1A 1LOCA 4PIZA 2R043 3K51A 3BOWA 3KCCA 1DP0A 4XAAA 5I0RA 1RMU1 1SDDB 3P3NA 4M3CA 1QDCA 1JZ5A 2BV4A 3DUIA 3RJ2X 3AC0A 5KWRA 4H7LA 1D0GA 1GV9A 4IEPA 3RI9A 3R4DB 1GP6A 2RS11 5JR7B 4H3WA 3ST7A 2BUKA 4PLNA 5FZ9A 2MEV3 2ZZQA 2FDGA 4BZ4A 3UGFA 4B4QA 4MGTA 2VMCA 2WWJA 1ENRA 1OUSA 1FV3A 1UXZA 1F31A 3KCYA 4GMP3 2Q8OA 3MV01 4BHPA 5JLVA 4ITCA 1HRI3 4I2OA 1PK6C 1GR3A 1LESA 1BK1A 3T2PA 3KZ4C 3W59A 1PVC2 1VE0A 3MIHA 1C57A 3OBTA 1PO21 5FPZA 2L9LA 3THTA 2R072 3A0NA 2WZPP 4DUVA 1F5JA 4FOQA 4C1XA 3BTAA 1QH6A 3OD4A 2CV6A 3VKNA 1NCRA 5IFPA 3PTRB 3JQWA 4SBVA 1F5FA 3O0VA 5GZCA 3ACLA 4BXFA 1GNHA 1V9U2 2XQRA 4QM8A 4I02A 3ZN5A 1GOFA 2RE9A 3OPZA 3GJBA 1RUD2 1KXGA 2RS51 4GB32 1OA3A 1UZWA 1EYBA 3DGTA 3JQXA 5JXGA 1RGSA 1XNBA 1WKYA 3B69A 4FPHA 4FP3A 3OPWA 3GBFA 1QJFA 5JOXA 4AFBA 3PU3A 1CAXA 1SLCA 5DAPA
chains in the Genus database with same CATH topology
5IJRA 3F2ZA 2XOMA 1W8NA 2ZEWA 2VL4A 1OT5A 5IHRA 3FHQA 3K4AA 3OGRA 4DXTA 1UX7A 1CZTA 1PMJX 3IB3A 1PMHX 2LW8A 3MUZ1 1JZ7A 3K75B 4XUQA 3OBAA 4RN5A 2ORXA 2J1RA 3I3DA 2R7EB 1DYOA 1TG7A 3WNOA 1XNTA 1XPWA 2VZ1A 4JKKA 3HEIA 4QAWA 3I2FA 3W5MA 2WQ8A 3FN9A 2V4VA 1JHJA 3BN6A 3VDAA 4P02B 1K3IA 1D7PM 3CIHA 5CYYA 3CMGA 2CDOA 3T2QA 5EJ1B 4A44A 3HJRA 3NNGA 3PUIA 5DMYA 4QX0A 3A22A 4CU9A 4GWIA 4TTGA 3JXSA 2WDBA 2WZ8A 3HNBM 2WAOA 3VD3A 2E33A 3C7EA 3IAQA 3LEGA 2B9VA 2J22A 4ET7A 2ZEXA 1UYZA 2BBAA 2Y6GA 5DN2A 3A21A 3DYMA 2BGOA 3OB8A 3GM8A 3MUY1 3SEPA 4UAPA 3I97A 4A42A 5C71A 4JX0A 4QX1A 3WF3A 1K42A 2RVAA 5EIYB 2VCAA 4M4PA 2ZXQA 1W0NA 1DLCA 4ZXEA 2VZ3A 1W8OA 4XUOA 2VZTA 4CUAA 4XUPA 5J1XA 4OUEA 2C26A 3ECQA 3OEAA 2VM9A 4LQRA 4L0PA 3LQCA 5JUVA 4UOJA 1UMIA 2DCJA 1XNAA 4BK5A 3T0AA 1EUTA 4OZOA 3ZM8A 3C7GA 3DECA 4QB6A 1UY2A 4D8MA 1JU4A 2X05A 4KI5M 2WO1A 3T0DA 1CZSA 2PQSA 3K4ZA 4JKMA 2J1UA 4QDRA 4GZ9A 2X09A 3I2IA 3GDBA 1GOGA 4FI9A 3DYOA 4XUTA 2V72A 5LCWL 3NJVA 3LEIA 2VZQA 2V5DA 5G04L 4QPWA 1JZ8A 2WO2A 3WQBA 4ARXA 1JYWA 2Y8KA 2B4KA 3J7HA 4CU8A 4LPLA 3NRUA 1OD3A 4Z2AA 3SKJE 4E8DA 5C7GA 1K45A 2WUHA 3BGAA 4BXSV 4CU6A 3K4DA 3ABZA 4PF1A 5HPOA 2DCKA 2VZUA 4IUGA 3T0BA 2YFUA 3I3EA 1H6YA 2YC2A 3LPFA 3I2JA 3WF4A 2Z4FA 4P00B 4LHSA 2VOTA 1UYXA 3WF1A 1F4AA 4W4ZA 2JE8A 4A41A 3FL7A 2QQIA 3OGSA 5IYYA 2W46A 3LE0A 5DQ0A 4W50A 3CQOA 3C7OA 3P1IA 2VTFA 4PT6A 1J83A 2YFZA 3WNLA 3I2GA 4BJ0A 3DYPA 4DUXA 2JDAA 2ID4A 3ACIA 1PX4A 1OF4A 2LS6A 1O59A 3NQHA 2W1SA 1UZ0A 1GNYA 2E32A 2QQKA 4MADA 1WCQA 2WAAA 3EYPA 3UETA 2WABA 3VD7A 3K46A 1UY0A 2KD7A 1HN1A 2HLEA 1NUKA 1CX1A 1LNSA 4QDSA 2VJXA 1JYVA 2ZEZA 4MGSA 3HPNA 4MO3M 1NAEA 4P08A 3CZUA 2QBXA 4JKLA 2X10A 3OGVA 3C8XA 2VMFA 3E1F1 3WNPA 2JKXA 5A1AA 3VD5A 4DEQA 2ORZA 2W3JA 2RJ2A 2WYSA 2J1SA 5JR2A 2YC4A 4XVHA 4W8JA 5EJZB 4QB1A 1SG3A 4D0QA 1W9SA 1JU3A 2WBKA 3FHAA 3NJXA 2EICA 3CDZB 2J1EA 2W1QA 4XUNA 2XHNA 1H6XA 4TXWA 4ARYA 1JYXA 2VMDA 1PX3A 2W91A 2WO3A 2WN2A 4HG6B 2QQMA 5HXMA 3VD9A 1P8JA 5LA1A 4A4AA 5JXHA 2EIDA 1IQDC 1R64A 4A6OA 2VZVA 4DXRA 4A45A 1JZ3A 4QX2A 3SEEA 3IIIA 4AAXA 1US2A 3A7QA 4CU7A 3WNKA 5JMOA 1UY1A 3GGLA 4OMDA 3IDAA 4LKSA 1SHWB 3HNYM 1MPXA 2VQTA 4UI9L 3WF0A 1O8SA 4BK4A 2W5FA 4DUWA 3IAPA 1XC6A 2WZEA 2Y6KA 5F7UA 4ZZ5A 2C4XA 4KWUA 5CZKA 2E26A 1OF3A 4CUBA 2W1WA 1T2XA 3UESA 3P6BA 4GWJA 1O8PA 5IFTA 3LEKA 1TVGA 2W47A 4XZUG 3A23A 3SKVA 4DEVA 1L7RA 4CUCA 1K12A 2BZDA 4PQQA 3ACHA 4A3ZA 4MGQA 2XQXA 3VD4A 3WNNA 3I3BA 3WNMA 2W95A 4P5YA 1L7QA 1UY3A 2CDPA 1JYNA 2VZSA 4QDQA 4BDVB 2C9KA 1UMHA 2QQNA 2VZPA 4QB2A 2J7MA 4ZY9A 4KMQA 5DPNA 1EUUA 2VMEA 3CKHA 4AG4A 2QQLA 1JZ2A 1W9TA 2BERA 2VC9A 3MO4A 3THCA 2WN3A 1UWWA 2E31A 3HOBA 5JXJA 3HNMA 1NX9A 1GOHA 4E8CA 2XONA 1RYYA 1W99A 1UXXX 4OMCA 3ETPA 2Y6LA 3T09A 3T08A 2VQUA 1UYYA 5B4NA 1KEXA 3GXUA 3ACGA 1CZVA 1ULPA 2EIBA 5C70A 2J1TA 1GUIA 4MOAA 5G05L 2JD9A 3WSOA 3VDBA 2QQOA 2Y6JA 2YG0A 2W94A 4OYUA 3WF2A 1JZ4A 2VCBA 2VCCA 1JI6A 4RYDA 1JZ6A 3CZJA 3MBWA 3U37A 3K77A 1W9WA 2QQJA 1UY4A 4ZZ8A 2W87A 1OH4A 1J84A 2VZRA 2YB7A 3EB7A 2VR4A 1NKGA 3OEBA 3ACFA 2RV9A 4M4RA 3MV11 4DXSA 5I0DA 2DDUA 1CIYA 1DP0A 5JXIA 3UNPA 2W9XA 1SDDB 1JZ5A 2OKXA 3AC0A 5FUIA 3PUHA 1F4HA 2VZOA 1I5PA 2W1UA 2Y6HA 1YQ2A 1BHGA 4JHZA 3C7FA 2W92A 3LPGA 2VMCA 1UXZA 3W5NA 3OG2A 2Y64A 1US3A 3MV01 5LA2A 3D3AA 3VDCA 1GU3A 2BGPA 4XURA 3T2PA 3C7HA 5LA0A 1GMMA 5B4XA 2J1AA 3WEZA 2L9LA 4CVUA 4DUVA 1KGYA 5IFPA 3HN3A 4YPJA 2J1VA 3THDA 1ULOA 3I2KA 1GOFA 1GQPA 2HYXA 4QX3A 2EIEA 2ZEYA 5JXGA 1WKYA 2VO5A 3T2OA 3I2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IJR A;  3F2Z A;  2XOM A;  1W8N A;  2ZEW A;  2VL4 A;  1OT5 A;  5IHR A;  3FHQ A;  3K4A A;  3OGR A;  4DXT A;  1UX7 A;  1CZT A;  1PMJ X;  3IB3 A;  1PMH X;  2LW8 A;  3MUZ 1;  1JZ7 A;  3K75 B;  4XUQ A;  3OBA A;  4RN5 A;  2ORX A;  2J1R A;  3I3D A;  2R7E B;  1DYO A;  1TG7 A;  3WNO A;  1XNT A;  1XPW A;  2VZ1 A;  4JKK A;  3HEI A;  4QAW A;  3I2F A;  3W5M A;  2WQ8 A;  3FN9 A;  2V4V A;  1JHJ A;  3BN6 A;  3VDA A;  4P02 B;  1K3I A;  1D7P M;  3CIH A;  5CYY A;  3CMG A;  2CDO A;  3T2Q A;  5EJ1 B;  4A44 A;  3HJR A;  3NNG A;  3PUI A;  5DMY A;  4QX0 A;  3A22 A;  4CU9 A;  4GWI A;  4TTG A;  3JXS A;  2WDB A;  2WZ8 A;  3HNB M;  2WAO A;  3VD3 A;  2E33 A;  3C7E A;  3IAQ A;  3LEG A;  2B9V A;  2J22 A;  4ET7 A;  2ZEX A;  1UYZ A;  2BBA A;  2Y6G A;  5DN2 A;  3A21 A;  3DYM A;  2BGO A;  3OB8 A;  3GM8 A;  3MUY 1;  3SEP A;  4UAP A;  3I97 A;  4A42 A;  5C71 A;  4JX0 A;  4QX1 A;  3WF3 A;  1K42 A;  2RVA A;  5EIY B;  2VCA A;  4M4P A;  2ZXQ A;  1W0N A;  1DLC A;  4ZXE A;  2VZ3 A;  1W8O A;  4XUO A;  2VZT A;  4CUA A;  4XUP A;  5J1X A;  4OUE A;  2C26 A;  3ECQ A;  3OEA A;  2VM9 A;  4LQR A;  4L0P A;  3LQC A;  5JUV A;  4UOJ A;  1UMI A;  2DCJ A;  1XNA A;  4BK5 A;  3T0A A;  1EUT A;  4OZO A;  3ZM8 A;  3C7G A;  3DEC A;  4QB6 A;  1UY2 A;  4D8M A;  1JU4 A;  2X05 A;  4KI5 M;  2WO1 A;  3T0D A;  1CZS A;  2PQS A;  3K4Z A;  4JKM A;  2J1U A;  4QDR A;  4GZ9 A;  2X09 A;  3I2I A;  3GDB A;  1GOG A;  4FI9 A;  3DYO A;  4XUT A;  2V72 A;  5LCW L;  3NJV A;  3LEI A;  2VZQ A;  2V5D A;  5G04 L;  4QPW A;  1JZ8 A;  2WO2 A;  3WQB A;  4ARX A;  1JYW A;  2Y8K A;  2B4K A;  3J7H A;  4CU8 A;  4LPL A;  3NRU A;  1OD3 A;  4Z2A A;  3SKJ E;  4E8D A;  5C7G A;  1K45 A;  2WUH A;  3BGA A;  4BXS V;  4CU6 A;  3K4D A;  3ABZ A;  4PF1 A;  5HPO A;  2DCK A;  2VZU A;  4IUG A;  3T0B A;  2YFU A;  3I3E A;  1H6Y A;  2YC2 A;  3LPF A;  3I2J A;  3WF4 A;  2Z4F A;  4P00 B;  4LHS A;  2VOT A;  1UYX A;  3WF1 A;  1F4A A;  4W4Z A;  2JE8 A;  4A41 A;  3FL7 A;  2QQI A;  3OGS A;  5IYY A;  2W46 A;  3LE0 A;  5DQ0 A;  4W50 A;  3CQO A;  3C7O A;  3P1I A;  2VTF A;  4PT6 A;  1J83 A;  2YFZ A;  3WNL A;  3I2G A;  4BJ0 A;  3DYP A;  4DUX A;  2JDA A;  2ID4 A;  3ACI A;  1PX4 A;  1OF4 A;  2LS6 A;  1O59 A;  3NQH A;  2W1S A;  1UZ0 A;  1GNY A;  2E32 A;  2QQK A;  4MAD A;  1WCQ A;  2WAA A;  3EYP A;  3UET A;  2WAB A;  3VD7 A;  3K46 A;  1UY0 A;  2KD7 A;  1HN1 A;  2HLE A;  1NUK A;  1CX1 A;  1LNS A;  4QDS A;  2VJX A;  1JYV A;  2ZEZ A;  4MGS A;  3HPN A;  4MO3 M;  1NAE A;  4P08 A;  3CZU A;  2QBX A;  4JKL A;  2X10 A;  3OGV A;  3C8X A;  2VMF A;  3E1F 1;  3WNP A;  2JKX A;  5A1A A;  3VD5 A;  4DEQ A;  2ORZ A;  2W3J A;  2RJ2 A;  2WYS A;  2J1S A;  5JR2 A;  2YC4 A;  4XVH A;  4W8J A;  5EJZ B;  4QB1 A;  1SG3 A;  4D0Q A;  1W9S A;  1JU3 A;  2WBK A;  3FHA A;  3NJX A;  2EIC A;  3CDZ B;  2J1E A;  2W1Q A;  4XUN A;  2XHN A;  1H6X A;  4TXW A;  4ARY A;  1JYX A;  2VMD A;  1PX3 A;  2W91 A;  2WO3 A;  2WN2 A;  4HG6 B;  2QQM A;  5HXM A;  3VD9 A;  1P8J A;  5LA1 A;  4A4A A;  5JXH A;  2EID A;  1IQD C;  1R64 A;  4A6O A;  2VZV A;  4DXR A;  4A45 A;  1JZ3 A;  4QX2 A;  3SEE A;  3III A;  4AAX A;  1US2 A;  3A7Q A;  4CU7 A;  3WNK A;  5JMO A;  1UY1 A;  3GGL A;  4OMD A;  3IDA A;  4LKS A;  1SHW B;  3HNY M;  1MPX A;  2VQT A;  4UI9 L;  3WF0 A;  1O8S A;  4BK4 A;  2W5F A;  4DUW A;  3IAP A;  1XC6 A;  2WZE A;  2Y6K A;  5F7U A;  4ZZ5 A;  2C4X A;  4KWU A;  5CZK A;  2E26 A;  1OF3 A;  4CUB A;  2W1W A;  1T2X A;  3UES A;  3P6B A;  4GWJ A;  1O8P A;  5IFT A;  3LEK A;  1TVG A;  2W47 A;  4XZU G;  3A23 A;  3SKV A;  4DEV A;  1L7R A;  4CUC A;  1K12 A;  2BZD A;  4PQQ A;  3ACH A;  4A3Z A;  4MGQ A;  2XQX A;  3VD4 A;  3WNN A;  3I3B A;  3WNM A;  2W95 A;  4P5Y A;  1L7Q A;  1UY3 A;  2CDP A;  1JYN A;  2VZS A;  4QDQ A;  4BDV B;  2C9K A;  1UMH A;  2QQN A;  2VZP A;  4QB2 A;  2J7M A;  4ZY9 A;  4KMQ A;  5DPN A;  1EUU A;  2VME A;  3CKH A;  4AG4 A;  2QQL A;  1JZ2 A;  1W9T A;  2BER A;  2VC9 A;  3MO4 A;  3THC A;  2WN3 A;  1UWW A;  2E31 A;  3HOB A;  5JXJ A;  3HNM A;  1NX9 A;  1GOH A;  4E8C A;  2XON A;  1RYY A;  1W99 A;  1UXX X;  4OMC A;  3ETP A;  2Y6L A;  3T09 A;  3T08 A;  2VQU A;  1UYY A;  5B4N A;  1KEX A;  3GXU A;  3ACG A;  1CZV A;  1ULP A;  2EIB A;  5C70 A;  2J1T A;  1GUI A;  4MOA A;  5G05 L;  2JD9 A;  3WSO A;  3VDB A;  2QQO A;  2Y6J A;  2YG0 A;  2W94 A;  4OYU A;  3WF2 A;  1JZ4 A;  2VCB A;  2VCC A;  1JI6 A;  4RYD A;  1JZ6 A;  3CZJ A;  3MBW A;  3U37 A;  3K77 A;  1W9W A;  2QQJ A;  1UY4 A;  4ZZ8 A;  2W87 A;  1OH4 A;  1J84 A;  2VZR A;  2YB7 A;  3EB7 A;  2VR4 A;  1NKG A;  3OEB A;  3ACF A;  2RV9 A;  4M4R A;  3MV1 1;  4DXS A;  5I0D A;  2DDU A;  1CIY A;  1DP0 A;  5JXI A;  3UNP A;  2W9X A;  1SDD B;  1JZ5 A;  2OKX A;  3AC0 A;  5FUI A;  3PUH A;  1F4H A;  2VZO A;  1I5P A;  2W1U A;  2Y6H A;  1YQ2 A;  1BHG A;  4JHZ A;  3C7F A;  2W92 A;  3LPG A;  2VMC A;  1UXZ A;  3W5N A;  3OG2 A;  2Y64 A;  1US3 A;  3MV0 1;  5LA2 A;  3D3A A;  3VDC A;  1GU3 A;  2BGP A;  4XUR A;  3T2P A;  3C7H A;  5LA0 A;  1GMM A;  5B4X A;  2J1A A;  3WEZ A;  2L9L A;  4CVU A;  4DUV A;  1KGY A;  5IFP A;  3HN3 A;  4YPJ A;  2J1V A;  3THD A;  1ULO A;  3I2K A;  1GOF A;  1GQP A;  2HYX A;  4QX3 A;  2EIE A;  2ZEY A;  5JXG A;  1WKY A;  2VO5 A;  3T2O A;  3I2H A; 
#chains in the Genus database with same CATH topology
 5IJR A;  1QQP 1;  5LAT A;  1XNC A;  3F2Z A;  4GAL A;  5IAX A;  4FQZ A;  1H2L A;  1RUF 1;  2WQ4 A;  1F9K A;  2OQ7 A;  2QNK A;  4FXG B;  4FCA A;  4LA3 A;  5A7P A;  4AL9 A;  5FY5 A;  1O3S A;  1R1A 1;  1RXG A;  1VP6 A;  2DUO A;  1YQ6 A;  2F4P A;  1QXP A;  5LRR A;  1ZRC A;  5CFD B;  3IB3 A;  2KR2 A;  1POV 3;  3H3U A;  1A6C A;  3WHT A;  3BU7 A;  4CP9 A;  4C0B A;  1MS5 A;  4YZ2 A;  1JZ7 A;  2FCT A;  4RN5 A;  2ORX A;  2JEN A;  3I3D A;  3QOP A;  1NLR A;  3AMQ A;  2AGS A;  1VMH A;  2R7E B;  1RJ7 A;  1YHF A;  1TG7 A;  2E7T A;  3LZZ A;  4XJ9 A;  2LRO A;  1PIV 1;  3LIG A;  4WZC A;  4XF1 A;  4Q8L A;  3J9S A;  2PLV 2;  3POS A;  4YW5 A;  2ARC A;  1S0I A;  2WQ8 A;  1LJ7 A;  2BVB A;  3PIJ A;  5J3U A;  2V4V A;  1JHJ A;  2DU1 A;  4DIQ A;  4QX7 A;  5KXD A;  5BV6 A;  2YUE A;  1K3I A;  3CIH A;  1LGN A;  3KM5 A;  5LAS A;  3MYX A;  2CDO A;  5LW9 A;  1AR6 1;  1KD7 A;  2RR1 2;  1LOE A;  2RMU 3;  4LKE A;  1W90 A;  1QJU 2;  5DAB A;  4COU A;  3WUD A;  5LWB A;  4QPG B;  3VBU A;  5DMY A;  1NZC A;  4CU9 A;  1W2T A;  1JW6 A;  1ND2 B;  3JXS A;  1WW4 A;  3PJQ A;  5C9A B;  4QPG C;  5FYH A;  2HWF 1;  2WAO A;  2ZGP A;  4N7U A;  4OHX A;  4TYS A;  4CDQ B;  5C9A C;  4Q29 A;  2HWB 1;  3C7E A;  5BNP C;  2ZGQ A;  1J1L A;  2YMZ A;  3LEG A;  4ZS2 A;  2GZW A;  3WG4 A;  2W08 A;  4DB5 A;  3LFM A;  1ZA7 A;  3FBM A;  3I2O A;  4I3P A;  1JYI A;  3JBG 2;  3EXU A;  1JOB A;  2BBA A;  4XC9 A;  1Z7S 3;  3MF6 A;  4Y20 B;  5D8A C;  3WX5 A;  2XL7 A;  4HSL A;  3ZMN A;  2VUD A;  4KU8 A;  2W39 A;  2HWC 2;  5T55 A;  4HK8 A;  2BGO A;  1ND3 A;  4RS5 A;  5K0U B;  4YM2 A;  3TEW A;  2QQP A;  2IFR A;  2A6Y A;  4Y1Z A;  3ES4 A;  1LUL A;  1N1Y A;  4NE9 A;  5K9Y A;  1UN1 A;  3LSE A;  3VZO A;  5C3O A;  1SMV A;  2WLQ A;  2FDF A;  4QX1 A;  1VAK A;  4Q4V 2;  2JDU A;  3BIW E;  5T5J A;  3VKO A;  3W20 A;  4ZHN A;  1RB8 G;  1VBB 2;  5EIY B;  2DTY A;  2BOJ A;  3U4S A;  3U78 A;  1F2N A;  3PME A;  1UAI A;  1LHU A;  2AEN A;  2O14 A;  1TME 2;  3D4K A;  4N53 B;  1W0N A;  4ZXE A;  1WW6 A;  1X82 A;  3POJ A;  4XJU A;  4QPI C;  3ILF A;  5TSW A;  1VJ2 A;  1AYM 2;  2XBO 1;  3B3Q E;  1VAM A;  4Y4Y A;  1D2Q A;  3K2O A;  4LHL A;  3IN9 A;  1BLZ A;  1HXS 1;  2AEY A;  1YXW A;  1W39 A;  2PQQ A;  4RQP C;  1ZRD A;  1RIR A;  1V6L A;  2K0G A;  3Q8C A;  2VM9 A;  1AR9 2;  1U5Z A;  4C1W A;  4JGY B;  4L0P A;  3WG2 A;  2R04 1;  3E6C C;  4AHX A;  2IXL A;  1RC6 A;  3GAL A;  3UT0 A;  1HRI 2;  4BK5 A;  4K7J A;  3ZKY A;  1EUT A;  4Q8K A;  1PGS A;  1ULD A;  1GP4 A;  5L73 A;  1OI6 A;  2GH8 A;  3ZM8 A;  3M3O A;  1UY2 A;  1JOJ A;  1Y7B A;  2X05 A;  4KI5 M;  2OXB A;  2MEV 1;  3INA A;  5FYV A;  3ZSM A;  3MIE A;  3DKQ A;  3T0D A;  1MR5 A;  1E5H A;  5IK7 A;  4NRO A;  2GMM A;  3ZYJ B;  5HV0 A;  1YFX A;  1VLN A;  1RUJ 2;  3CNA A;  2B5H A;  4JKM A;  5FYS A;  1FAT A;  2J1U A;  2E51 A;  3IKW A;  4GMP 1;  3I2I A;  1Q3E A;  4KWJ A;  1IG0 A;  4AVV A;  4Q4Y 1;  4XUT A;  2VPV A;  3DKW A;  3VN4 A;  5LCW L;  4CPB A;  2VZQ A;  4P5H A;  2V5D A;  3IPV A;  1MAC A;  4JRL A;  2VY0 A;  2B46 X;  1VBD 3;  1BVV A;  4LHK A;  1W6Q B;  5F5Q A;  4PI0 A;  3N3H A;  3L2H A;  1DF0 A;  1W0O A;  3AK0 A;  3NNM A;  4HKL A;  3VDD A;  4LPL A;  3S7E A;  3NRU A;  4XCA A;  3AZZ A;  2XJU A;  1JYC A;  5KC5 A;  3HD8 B;  1LHV A;  4LLO A;  4DXZ A;  3RZK A;  3U4X A;  4XBN A;  2BTV C;  4AR2 A;  1H8T B;  1PNG A;  4KU7 A;  5FYM A;  3RZJ A;  3UKV A;  4TSV A;  1AR8 1;  1OHF A;  3O1P A;  1HB3 A;  2DCY A;  2IWG B;  4EN9 B;  2UWB A;  3K4D A;  2XDV A;  1RUH 1;  2Y34 A;  3V64 A;  4XHX A;  5A6Z A;  3NNF A;  3GZA A;  3MW2 A;  4FPE A;  1QWR A;  3ZFG C;  1FYU A;  3CU7 A;  4AVB A;  4PDW A;  2YC2 A;  5FRE A;  2DTW A;  3LPF A;  2MNG A;  1DG6 A;  2EA7 A;  1XE0 A;  3OGG A;  3PUA A;  1WZX A;  3AKQ A;  3PVN A;  2K46 A;  5FMO S;  5JPN B;  3AKP A;  1POV 1;  5FFO C;  4YW1 A;  1X8E A;  3BU0 A;  4DRR A;  1LOB A;  1F4A A;  5GZE A;  3MPB A;  2A7A A;  2JDK A;  1BVP 1;  4C90 A;  2GU9 A;  1XNK A;  3I8T A;  1LOD A;  4LBJ A;  3AFK A;  4K21 A;  3AKT A;  3M8L A;  1LOF C;  4RGA A;  1RVF 1;  2AUY A;  5DQ0 A;  1JYT A;  1MQT A;  3CQO A;  2R16 A;  2K9Z A;  3K3O A;  4PT6 A;  1AX1 A;  2R06 2;  3BOD A;  4GJZ A;  3QAC A;  1O91 A;  3A4U A;  3NNL A;  3I2G A;  5GLW A;  3WNL A;  4AFD A;  3DF0 A;  4GH4 A;  4I09 A;  3O1V A;  2R1D A;  4HN0 A;  2ZOE B;  1IG3 A;  1RUI 3;  2Y0O A;  2BBV A;  4V1P A;  4BJ0 A;  2JDA A;  2OS2 A;  1PX4 A;  4CDW B;  5A70 A;  2G9Z A;  2RMU 1;  1NA1 B;  5JI7 A;  3VDC A;  5C3P A;  3FFZ A;  3N9N A;  4WVM B;  3VHO A;  2LUW A;  4MAD A;  1TZO A;  2GDF A;  2WAA A;  4PBP A;  5FK7 A;  4CCM A;  5C3Q A;  2BNM A;  1D4M 2;  5L9V A;  3RFR A;  1E5R A;  2KD7 A;  2CTV A;  1NUK A;  1JS9 A;  2ZAA A;  3OJB A;  4QDS A;  1COV 2;  1SPP B;  2WNV C;  2IXJ A;  3B01 A;  4O9G A;  2DUR A;  2V5Y A;  4MGS A;  4HVO A;  3HPN A;  1YIF A;  4CP2 A;  1Z7S 1;  3LFI A;  3ZR5 A;  2X10 A;  3WP3 A;  1EV1 3;  3C8X A;  5LBB A;  2ZAH A;  1BKZ A;  2YDE A;  3WDW A;  1EAH 1;  2XKP A;  3H1Y A;  4Q1R A;  3N9O A;  3NKG A;  4I0W B;  4DEQ A;  5A1F A;  4MYE A;  4B8E A;  1QKQ A;  2ORZ A;  3Q8B A;  3WLU A;  1B35 A;  1PK6 A;  1N1T A;  2W3J A;  5DUU A;  2XR4 A;  3ZR6 A;  3D82 A;  3HWJ A;  2P4E A;  1OLR A;  2FDJ A;  4DOU A;  2DCT A;  2P5B A;  1Q5O A;  4IES A;  1H30 A;  4K3U A;  1NY7 2;  2WSU A;  3AZX A;  3F95 A;  4XVH A;  5EJZ B;  3S0M A;  4XAC A;  4BWO A;  1S0C A;  1W9S A;  2XVK A;  3MEP A;  3G6J B;  2XH6 A;  3VBO A;  2E63 A;  2EXJ A;  2WBK A;  2XJT A;  4NN0 A;  2VNO A;  3VZM A;  4DO0 A;  2GH2 A;  1VRH 2;  3FHA A;  2OZJ A;  1G9C A;  3DL3 A;  4AWD A;  1Q43 A;  1TMF 1;  1UU6 A;  4GWN A;  5C4W B;  4CRQ A;  1LGC A;  3OSD A;  1AR7 3;  1H6X A;  2LM3 A;  1WCU A;  2P6H A;  1V00 A;  3N7K A;  4ARY A;  4MGI E;  5F6L B;  4ZU4 A;  4AEJ A;  1HQN A;  4QKF A;  5FZL A;  2OT7 A;  1RHI 2;  2DV9 A;  4XCB A;  5IAT A;  1BCX A;  2RDR A;  1UZY A;  1IQD C;  1R64 A;  5T5P A;  1FAY A;  3BPZ A;  4DXR A;  3CJI B;  3L2Y A;  4LKF A;  4A45 A;  4G9S B;  1DQ0 A;  3CJI C;  4QX2 A;  3SEE A;  1IS4 A;  5A1L A;  5KHI A;  3III A;  4M3C B;  1Y9Q A;  3ZYB A;  1UOB A;  3A7Q A;  1YFW A;  3TEY A;  5AFE A;  3WNK A;  4Q5O A;  1FPN 2;  1UY1 A;  5BXX A;  1RUC 3;  3RDI A;  2BNN A;  1QDO A;  1G9A A;  1IZ3 A;  2K2S A;  5LRS A;  2V4A A;  1WLD A;  2OA2 A;  3WF0 A;  1O8S A;  4IE0 A;  4XJZ A;  4QMA A;  4BK4 A;  2BQP A;  1S1A A;  5C3R A;  4JRA A;  1X33 A;  1ZBA 3;  2XHK A;  1W8W A;  5A7N A;  3KB5 A;  3GBW A;  2E7Q A;  5F3C A;  4NRQ A;  2EIG A;  3O1O A;  2RS3 2;  2VQA A;  2PAE A;  2XWJ B;  4SLI A;  2VOK A;  4IE5 A;  2WZE A;  5FDB A;  1CIW A;  1L7L A;  4Z8B A;  1UD1 A;  2FZ1 A;  1H0B A;  3GBG A;  4LE4 A;  1ST8 A;  3KCX A;  3PMS A;  4KWU A;  5ERL A;  3O14 A;  2ZGS A;  1XSQ A;  5JSR A;  1IPS A;  1T2X A;  2VH9 A;  4QPG A;  1KS4 A;  4Z07 A;  5C9A A;  2VE1 A;  3E6B A;  4A6S A;  3WW1 A;  5IFT A;  3KWV A;  1NCR B;  3A23 A;  4XZU G;  3VHR A;  4COV A;  4YGE A;  4DEV A;  5B2G B;  5BNP A;  4TLF A;  4NR1 A;  3ACH A;  3ROU A;  2XQX A;  4IEV A;  2OZ6 A;  1JH5 A;  4JHT A;  2G9G A;  2XGX A;  4IDZ A;  5ISL A;  5DAX A;  3FMG A;  1AX0 A;  1IKP A;  1QJZ A;  5D8A A;  4P5Y A;  4XQ4 A;  4WM7 B;  1SCR A;  4XFG A;  2H0B A;  4XPV A;  2UWC A;  4QDQ A;  4WM7 C;  5FZI A;  2Q1M A;  1CAX B;  2VZP A;  2J7M A;  4HZF A;  2D5H A;  3N7L A;  1JUI A;  4R52 A;  3H8X A;  2VME A;  2QQL A;  4K40 A;  5DZE A;  1JZ2 A;  1RUO A;  2VC9 A;  2XKO A;  3B02 A;  4IV3 B;  1PM7 A;  1YQ5 A;  5FZ1 A;  4L92 A;  1QJY 3;  4IV3 C;  5BNO B;  1YLL A;  4BQ5 A;  2E31 A;  4CP9 B;  5BNO C;  5J98 B;  3UJQ A;  3L9J T;  4Q2F A;  1T6G C;  5FMO L;  3T3Y A;  1DIW A;  4QPI A;  3OD0 A;  1RYY A;  5FLI A;  5IVY A;  2C9A A;  1RUI 1;  3D6E A;  4OMC A;  2Y6L A;  3OCP A;  3NJY A;  3ZYH A;  2JEM A;  4RQP A;  3R0R A;  4EN8 B;  1UCX A;  3M3E A;  2E7A A;  4HKW A;  3J8F 2;  2BPA 2;  4KGQ A;  3KT1 A;  4QM9 A;  1UKR A;  5LZ6 A;  5CA6 A;  5FY1 A;  2HWE 3;  5G05 L;  2JD9 A;  2X5I A;  3IM0 A;  3UGG A;  3WSO A;  4EQV A;  3H8R A;  4HK9 A;  2VW0 A;  5CIR A;  4Z92 B;  2YG0 A;  3KMH A;  2VCB A;  2EAA A;  3CF6 E;  3VBU B;  2I74 A;  2JG9 C;  3TYJ A;  4YAR A;  3U37 A;  2QQJ A;  3MDP A;  1UY4 A;  4ZZ8 A;  5IVF A;  4PCR A;  1CES A;  3RYP A;  4CUG A;  4K9S A;  1POQ A;  2W87 A;  3JB4 C;  3RPQ A;  1J84 A;  1FMD 1;  3EB7 A;  4N8M A;  3M7A A;  1SFN A;  3B9I A;  3ILR A;  4AI1 A;  2WJS A;  1LHO A;  1QIQ A;  1W8T A;  4LUK A;  4M4R A;  4XJW A;  5FLH A;  3MV1 1;  1C3H A;  1KIT A;  2PA7 A;  4QKN A;  4OHZ A;  4DXS A;  5I0D A;  2IUW A;  2OW4 A;  5JMC A;  1AXZ A;  2BWC A;  1HB2 A;  4LMF A;  4RS5 B;  1ND3 B;  5E1R A;  4XJA A;  2P3I A;  3UNP A;  3I3M A;  3BTZ A;  3BPS A;  4RS5 C;  4HL0 A;  5DZF A;  1R08 2;  4QX8 A;  5FUI A;  3PUH A;  4RR3 C;  1F4H A;  1REF A;  2WR9 A;  4KGG A;  1I5P A;  3MIG A;  4URA A;  2Y6H A;  2VG9 A;  1SLB A;  4YRD A;  1BHG A;  1HV0 A;  3FX3 A;  4JHZ A;  4IEU A;  3DV8 A;  2NM1 A;  2W92 A;  4IE7 A;  3MLJ A;  3QH7 A;  4FTE A;  1K5M A;  4N9I A;  2B45 X;  3HVD A;  4R4Z A;  1UW8 A;  3AZY A;  1PO1 1;  2DUP A;  3OG2 A;  2Y64 A;  4LO8 A;  5FKC A;  2PHD A;  3ZFG A;  1F15 A;  4BQ1 A;  1PZ9 A;  5DUW A;  1QJE A;  5LA2 A;  1OH3 A;  1FI2 A;  2ET7 A;  2BGP A;  2GSY A;  2DBI A;  2QQV A;  3D3A A;  3Q8A A;  4XUR A;  4Y5Z 0;  4AXO A;  1KDM A;  4JDN A;  4AEM A;  4B4R A;  4YZ5 A;  5FJK A;  2Z5W A;  5FZ6 A;  5LA0 A;  2YZ4 A;  2ZGO A;  2J1A A;  1XU2 A;  1PVC 3;  1LCL A;  4IL7 A;  3SH3 A;  1GZ9 A;  5CFC C;  1GBG A;  5FBZ A;  5CVR A;  4FSJ A;  3HN3 A;  4L8Q A;  4PLM A;  5BPX A;  2R07 3;  3O7O A;  5FKB A;  1OXC A;  1RXF A;  1GQP A;  2XUM A;  4UW3 A;  1ASJ 1;  4R9B A;  1RUC 1;  5T5L A;  1WD4 A;  4BPZ A;  1V9U 3;  1IS6 A;  3JZV A;  5DUX A;  4AQT A;  2BFU S;  3T2O A;  4EV0 A;  1PVX A;  2YGM A;  2PN5 A;  3WCR A;  1YEW A;  3ENR A;  4BYY A;  1ZBA 1;  2I2S A;  4GB3 3;  1ZRF A;  3LCP A;  4OHW A;  1R09 1;  3IWZ A;  3ZX7 A;  3DXU A;  2XOM A;  2ZGU A;  5J96 B;  1ODN A;  1OFS A;  1W8N A;  4U36 A;  1I3H A;  3FHQ A;  2NZ9 A;  2VBP A;  1QF3 A;  4DXT A;  4JTO A;  2XB6 C;  4P9L A;  1VBC 2;  1PMH X;  2A3X A;  2LW8 A;  4YW6 A;  4UFK A;  4K1Y A;  5GM0 A;  4Z2W A;  1U5Y A;  1IPJ A;  2CHH A;  1BEV 2;  4AI2 A;  3VDD B;  4IE4 A;  2AYH A;  4J6G A;  2FCV A;  4NO4 A;  1UX6 A;  2WNV A;  3WW4 A;  3WHU A;  1WGP A;  1UKG A;  2VZ1 A;  1DGL A;  1Q56 A;  2D3P A;  2W2I A;  1QJY 2;  4GUL A;  5F37 A;  1O7F A;  5FUN A;  2G4I A;  3ETQ A;  4MH0 E;  5EHD A;  4AFM A;  1OQE A;  3AM2 A;  4NUB A;  1PZ8 A;  2OPW A;  1OLQ A;  2PLV 3;  4W6W A;  3APB A;  3CMG A;  1S0B A;  1W8F A;  1XU1 A;  2PXJ A;  5JCT A;  4PDW B;  5EJ1 B;  3T2Q A;  1OPO A;  4ASK A;  3HJR A;  1SBF A;  5F3I A;  1WMD A;  3OUH A;  1ZBE 1;  4XTP A;  2RR1 3;  3ZXL A;  1O4Y A;  2G19 A;  4AZZ A;  1QJU 3;  2NN8 A;  3ASI A;  3KGZ A;  5I0T A;  1WA6 X;  1AX2 A;  2J22 A;  4XFI A;  3ZYP A;  5C5T A;  4K8R B;  1SDW A;  3M3I A;  4BME A;  3ZFE A;  2BW8 A;  2A73 B;  2WS9 2;  2WZR 2;  4XZP A;  1X7N A;  1V6I A;  1MQT B;  1Y9G A;  2RDQ A;  1TQ5 A;  3A21 A;  4O65 A;  5F32 A;  3JBG 3;  1OQ1 A;  3PUS A;  3OB8 A;  4KG0 A;  3RRD A;  2VUL A;  3SIS A;  2IVJ A;  4I01 A;  5EYX A;  2HWC 3;  2HWE 1;  1DQ2 A;  1CGP A;  3ILN A;  4XE9 A;  4N7I A;  1J1T A;  4JX0 A;  1EP0 A;  1NT0 A;  1W9F A;  4IV1 B;  3VKM A;  1E57 A;  5BYN A;  3CEW A;  4LBM A;  2EVX A;  4FOV A;  4IV1 C;  4DY3 A;  4HMZ A;  2SLI A;  1YJK A;  1O6U A;  1OLM E;  1V70 A;  3ELN A;  3H1M A;  5IK5 A;  4YVS C;  5HCH A;  4Q4V 3;  1LTE A;  3ZXE A;  4D7T A;  2H6B A;  2VZ3 A;  5FYT A;  2Y33 A;  1W8O A;  1VBB 3;  3HQU A;  1CVN A;  4YG3 A;  2GC1 A;  1TME 3;  3SH4 A;  4CUA A;  4OUS A;  5I91 A;  5J1X A;  3ZXD A;  5IVB A;  4OUE A;  1WD3 A;  3ZXA C;  3CJX A;  4DPN A;  1AYM 3;  4YNI A;  2ARE A;  1RUE 2;  5LBE A;  3LQC A;  5JUV A;  4NIA A;  4UOJ A;  3T4V A;  1IGO A;  4BQ3 A;  2FDI A;  1FXZ A;  1AR9 3;  2PHX A;  4LLF A;  4YM0 A;  1U5X A;  3WZ1 A;  4OZO A;  3MIF A;  1B35 B;  1H2K A;  1PK6 B;  3C7G A;  1NG0 A;  3DEC A;  1YYN A;  3H1W A;  1B35 C;  2IC1 A;  3UKT A;  1W8U A;  3E6D A;  1HRV 3;  4CCC A;  4E2S A;  2WL1 A;  1CZS A;  1XOY A;  1AYN 2;  3MIC A;  1G9D A;  1O3R A;  3GDB A;  1GOG A;  4PIX A;  4QU2 A;  1RUJ 3;  3OPT A;  3VBO B;  3BB6 A;  3VHP A;  2CGP A;  4Q0S A;  4KBB A;  3I7D A;  3OUI A;  3VBO C;  4P9J A;  3PL0 A;  1CAU A;  4OZX A;  3HN1 A;  5A3U A;  4TN7 A;  2VBD A;  2VD7 A;  3PHM A;  4HKO A;  4YLZ A;  1H8V A;  1JZ8 A;  1C8N A;  4JV4 A;  3WQB A;  4ARX A;  1JYW A;  4LTA A;  4V2W A;  4QKB A;  4QXK A;  4WM7 A;  4CDX C;  1PVC 1;  3ZPY A;  3ZIW A;  4XDO A;  4CCK A;  4S2H A;  5F3E A;  4E8D A;  2HJI A;  1Q8P A;  2R07 1;  4I30 A;  4RGG A;  1CR7 A;  4NVP A;  5A3P A;  2NQY A;  4QXC A;  1K45 A;  4B29 A;  1VB4 A;  2DVG A;  3AXE A;  4IV3 A;  2D6N A;  4LNV A;  1A34 A;  1V9U 1;  4BXS V;  4CU6 A;  1V6J A;  5ABJ A;  5BNO A;  5HPO A;  3ZXJ A;  1RUD 1;  2DCK A;  5FP7 A;  4X6Q B;  1UYP A;  4GB3 1;  4IGP A;  1OFN A;  3KS7 A;  4IW3 A;  1SAC A;  4Y22 A;  3ORJ A;  2NLR A;  2ZAC A;  1XE7 A;  4N9H A;  3KVA A;  4CSW A;  2G1M A;  5CG9 A;  3AZW A;  2I45 A;  3IBM A;  1BXH A;  1VAV A;  4LHS A;  2VOT A;  2WWS A;  2BFU L;  2OUJ A;  5FLJ A;  2R0F A;  5IAV A;  3K3N A;  2TBV A;  4IEX A;  4W4Z A;  2JX9 A;  3B00 A;  1BQP A;  4ZU5 A;  5APA A;  1OOP C;  3WCS A;  2X53 S;  1REE A;  1ZZ9 A;  1AR6 2;  2JG9 A;  1SCS A;  2Q4S A;  2VW1 A;  1V6N A;  4RFT 0;  1BBT 1;  3C7O A;  4HVQ A;  1JOD A;  2ARX A;  2GNT A;  1LEM A;  2VTF A;  5GLZ A;  3R05 A;  4HXC A;  4XET A;  4BIO A;  1YQC A;  5BNP B;  2PLV 1;  5A32 A;  4WBB A;  5C8W A;  4TWT A;  3NAP C;  4YW7 A;  5KHH A;  5FMC A;  3LA7 A;  2R06 3;  4DIN B;  4DUX A;  3ACI A;  3O0W A;  1OF4 A;  2LS6 A;  2HYK A;  5CU1 A;  5D8A B;  1O5L A;  2W1S A;  2E32 A;  2QQK A;  2VNG A;  1U12 A;  4UXA A;  4EN6 B;  4LOT A;  2TEP A;  3GJA A;  2RR1 1;  2XL9 A;  4AEK A;  1NCQ C;  3FFQ A;  1E5I A;  2DF7 A;  1H9W A;  5E16 A;  5LK5 A;  1UY0 A;  3O1M A;  2HLE A;  2YBK A;  2OX0 A;  4PLO A;  1QMJ A;  2VJX A;  4RR3 A;  3UYJ A;  1WCD J;  1ZRI A;  2QZ2 A;  4L99 A;  1D4M 3;  3M3Q A;  1HW5 A;  2Q1Z B;  2XJS A;  4DQA A;  2GNM A;  2NP0 A;  3VL9 A;  3MI8 A;  1COV 3;  1UOJ A;  2QBX A;  4JKL A;  2Q1F A;  1AHS A;  2CAU A;  4M3C F;  4GKY A;  4P9W A;  1LRH A;  2VMF A;  4XJ8 A;  4D6S A;  2Q5T A;  4OCT A;  2ZS6 B;  1H4G A;  4QPI B;  2JKX A;  4CEY B;  2HWC 1;  5J09 A;  3RVH A;  1LOG A;  2RJ2 A;  4M00 A;  2BWA A;  1ODM A;  1OMI A;  2ZPX A;  4CEY C;  3LDB A;  4RQP B;  2XBO 2;  3ZSL A;  4E4S A;  4IEZ A;  2A6V A;  1PGL 2;  1D4V B;  3DN7 A;  4GIQ A;  4R4X A;  3VBS B;  4MZU A;  1ZYB A;  2ZX0 A;  5JSP A;  3FBY A;  2DU0 A;  1S2B A;  4AVT A;  1SG3 A;  4JGZ C;  2X5I B;  3VBS C;  4CCD A;  5CFC A;  1V0A A;  1VBB 1;  4FFG A;  4D0Q A;  1OQD A;  1PGW 2;  1JU3 A;  2X5I C;  2Z42 A;  5DG1 A;  1TME 1;  2A70 A;  1RTV A;  2JDZ A;  2JXA A;  3THP A;  4CCJ A;  1HRV 2;  3MGU A;  4Y1X A;  1LEC A;  2XHN A;  4OUL A;  5FR3 A;  2B8M A;  1SFP A;  4FFH A;  4QGN A;  5LEK A;  4MXW B;  1ZZ7 A;  1VRH 3;  4LO5 B;  2YY1 A;  4A7Y A;  5FP3 A;  4YGD A;  4KL1 A;  3BI3 A;  2D40 A;  5A7Q A;  2VMD A;  1PX3 A;  1BMV 2;  1ENS A;  5HCB A;  1AR9 1;  5HXM A;  3IZO A;  1SLT A;  4R9A A;  4A4A A;  3KVB A;  5CKN A;  1RHI 3;  1HJG A;  2D97 A;  1HRI 1;  1UPS A;  2A5Z A;  4Q4Y 2;  1W2U A;  4URT A;  4B7E A;  1W8H A;  5A80 A;  4AAX A;  1US2 A;  4E27 A;  1RUG 2;  5JOW A;  4XDP A;  4NID A;  2WT0 A;  4OI4 A;  3LOB A;  1J58 A;  2AC1 A;  1GLH A;  3WDT A;  4FPY A;  2BP6 A;  4UW6 A;  5JMO A;  3LAG A;  3LEM A;  2XVG A;  4OMD A;  1RUJ 1;  5A3L A;  4AGR A;  5A3M A;  1GIC A;  1GNZ A;  2QE3 A;  4LKS A;  3HNY M;  4XIK A;  3UK9 A;  4LIU A;  1FPN 3;  2VUC A;  4FTS A;  3JD7 2;  3PUQ A;  1K5M B;  4LIT A;  2XLF A;  3O1T A;  2YPD A;  3ZN4 A;  3J7L A;  4QWN A;  4P14 A;  4DUW A;  4XAB A;  4EWE A;  1K5M C;  2Q30 A;  2A3Y A;  3PLQ A;  2D93 A;  4R8H A;  4FTB A;  1S0D A;  4LBQ A;  3ZFG B;  4D69 A;  4NPM A;  1HQW A;  3LSD A;  1RUH 2;  4FXK B;  5F7U A;  3C2U A;  2RS3 3;  3AYE A;  5CZK A;  2ZHL A;  1JXN A;  2E26 A;  2ZKL A;  5FZC A;  1DFQ A;  2WT1 A;  1DQ1 A;  3KHB A;  4I0B A;  1AL2 2;  3P6B A;  3UES A;  4Y26 A;  5JWP A;  4PIY A;  2NMO A;  3LEK A;  2JIC A;  2W47 A;  3SKV A;  1DZR A;  2PTM A;  1L7R A;  1ENQ A;  1LHW A;  1UQX A;  3TWI A;  3Q8E A;  5M0T A;  2QJV A;  5IW0 A;  3USS A;  3WNM A;  3NST A;  4XQW A;  5EV7 A;  4AVS A;  2HEW F;  5AC9 2;  2W95 A;  3WP6 A;  3WIN E;  2LRP A;  3AKR A;  3NV2 A;  2CDP A;  5H9Q A;  1MZE A;  4LO7 A;  1N1V A;  2EXH A;  5DXD A;  3HR9 A;  1RVF 2;  3KT4 A;  3GCX A;  4CXY A;  4LOS A;  3AFG A;  3ZYG A;  1GSL A;  1HB1 A;  2CWS A;  1T6B X;  2QQN A;  2XVL A;  3I4I A;  4W6X A;  5DPN A;  5ANN A;  4ZY9 A;  1LU2 A;  4XFB A;  2DVD A;  5EYY A;  1SLL A;  3ME2 A;  4CDU A;  5E89 A;  2BER A;  3MPP G;  3AZV A;  2OPK A;  3SCG A;  4TLG A;  3P3P A;  2QKD A;  4H14 A;  4IV1 A;  2A6W A;  2ZMK A;  1V6M A;  3HOB A;  3WDV A;  2TNF A;  2RM2 3;  3M1H A;  4CXX A;  4YVS A;  2W68 A;  2ZBJ A;  4KWL A;  1NX9 A;  3RGB A;  4D7Y A;  1HQL A;  1VIW B;  1OC1 A;  2WNV B;  1W2O A;  3H8U A;  2R06 1;  4FOW A;  1N3Q A;  4LK6 A;  1W3X A;  3ZDS A;  1MS4 A;  1G9B A;  2NPI A;  3NV1 A;  2ZX3 A;  5C70 A;  4JC1 A;  5KC6 A;  5A6X A;  2FDH A;  4LA2 A;  4QQH A;  4B1L A;  2QQO A;  3J8F 3;  1UU5 A;  1EAH 2;  2ZA9 A;  2VXJ A;  2XJR A;  2EF6 A;  1UMZ A;  2XML A;  2WT2 A;  4YFW A;  4UFH A;  3KV4 A;  1D4M 1;  2OVU A;  3M2M A;  3AYA A;  1X36 A;  2VOX A;  3GHM A;  4MSV A;  3VKL A;  1PM4 A;  3MLL A;  3B9C A;  3RJR A;  3S7I A;  1C8M 3;  3MBW A;  1X9T A;  4FP2 A;  3WDX A;  1COV 1;  3USU A;  3LD8 A;  3TB0 A;  1W9W A;  2HBT A;  1GWM A;  3POB A;  1PZ7 A;  4BB3 A;  3RZL A;  5JI9 A;  2CNA A;  2VVE A;  2VR4 A;  3OEB A;  4XQD A;  5KXE A;  2RJK A;  5LBC A;  3ZFE B;  1VRB A;  3WQ7 A;  3N9P A;  3AL6 A;  5KHK A;  1NQD A;  2ZKN A;  3PVB B;  1UF2 C;  4OVE A;  4YVW B;  3ZFE C;  4P9G A;  1CIY A;  1W0P A;  4XFA A;  3KV6 A;  4YVW C;  4OLL A;  1Y3T A;  1TMF 2;  5F5I A;  3JUU A;  3HQX A;  5JXI A;  4BLI A;  5T3N A;  3VBR C;  2P1B A;  1NZI A;  1XND A;  2OKX A;  4CDX A;  4MLO A;  2BNO A;  3VBH B;  2YBP A;  4M0H A;  2FZ2 A;  3WQ1 A;  3AB0 A;  1R08 3;  4HSJ A;  3VBH C;  2HEY F;  4F7Z A;  3WW2 A;  2A75 A;  1A78 A;  1W6M B;  1S0J A;  3C7F A;  3TN9 2;  3HMY A;  1VRH 1;  2E6V A;  2C24 A;  2DVF A;  1CON A;  2V73 A;  4NHK A;  4PHZ A;  3SCF A;  3HAG A;  4FBF A;  4IER A;  1WCS A;  4HPK A;  3O5S A;  2ZGN A;  4NPL A;  1Y9M A;  2BDR A;  4CE8 A;  4RHV 3;  1GU3 A;  3JU9 A;  2DYC A;  2ZZJ A;  3C7H A;  1EPW A;  1I5Z A;  2ILM A;  3NVC A;  2P2K A;  5B4X A;  1UOG A;  1RHI 1;  4XYX A;  3VBF C;  4CCO A;  3BTX A;  3B5L B;  5FXW A;  1DYP A;  5GLU A;  2ADE A;  2VTX J;  5BY5 A;  3B93 A;  5EXO A;  5L19 A;  1KJL A;  2FQP A;  3E5X A;  1WUV A;  1UZZ A;  3N7M A;  1VBD 1;  5ACA 3;  4RA0 A;  4AI3 A;  4GJY A;  3THD A;  3TOJ A;  5J7M A;  1IS5 A;  2ZMN A;  3I2K A;  4ZON A;  2HYX A;  2C5D A;  2GC2 A;  1OA2 A;  1OOP A;  2JJ6 A;  4FAG A;  5FO9 B;  2JE9 A;  4FPL A;  1WLT A;  4YYO A;  1FT9 A;  3POI A;  2D43 A;  1FPN 1;  3DEM A;  2XJV A;  1W6O A;  3RQ0 A;  4H2A A;  1WME A;  1S55 A;  3A0K A;  3NAP A;  3V56 A;  2CGN A;  4QQP A;  3S6P A;  4QXH A;  3AMN A;  2VL4 A;  2UY8 A;  5IHR A;  1CAU B;  3K4A A;  3OGR A;  2CU5 A;  3ZYF A;  5CEH A;  1UX7 A;  3WNX A;  4LT5 A;  2P3J A;  2VMG A;  5FP4 A;  4IGQ A;  5A3O A;  5E88 A;  3S5Q A;  5FY4 A;  1G6N A;  3K75 B;  3OBA A;  4XUQ A;  2ZTN A;  5DDJ 2;  1NCQ A;  3AVR A;  1VBC 3;  4I3G A;  3WNO A;  4C8D A;  4TZD A;  1XNT A;  4BLJ A;  2R0H A;  3IT8 A;  1BEV 3;  2PHW A;  4XDQ A;  3HEI A;  2ZX2 A;  3I2F A;  2RM2 2;  3W5M A;  5FTT C;  3FN9 A;  5I0S A;  2QCS B;  4QGL A;  2ES3 A;  1KQR A;  4IE6 A;  1HIX A;  1N3P A;  3BN6 A;  4LHN A;  4MET A;  2ENR A;  2ZGR A;  4MVT A;  4F3J A;  1D7P M;  2FHR A;  5ABJ C;  2DCZ A;  4XXP A;  1JMU B;  4MXV A;  4RL7 A;  1GZW A;  3NWK A;  5FZ7 A;  1CAW B;  4Y22 B;  4Q4X 2;  4A44 A;  4CEY A;  3NNG A;  4L11 A;  1I1E A;  3MZH A;  3SCH A;  3H3Z A;  3A22 A;  2BEO A;  4YM1 A;  2WDB A;  2WFF 2;  3LDK A;  2E33 A;  3PVE A;  5I8Y A;  1OKO A;  2VEC A;  2HH9 A;  5L7O C;  2ARA A;  4QU1 A;  3LB9 A;  4JQR A;  3VBS A;  2B9V A;  4JGZ A;  1NOV A;  3CLP A;  5FZK A;  5I93 A;  4ET7 A;  4YM3 A;  2GC3 A;  1V6K A;  1LOA A;  2UYA A;  3FHI B;  5E6H A;  2ZEX A;  1C8M 2;  2RDN A;  2Y6G A;  3WOG A;  3OOX A;  1TNR A;  2JG9 B;  5F9T A;  2D6O X;  3DYM A;  4Y5T A;  2WS9 3;  4AAP A;  2WZR 3;  4Z1V A;  4ZU7 A;  5BUV A;  3GM8 A;  4MXW A;  5IWF A;  5T52 A;  2WNU C;  5A32 B;  2D3S A;  1EV1 1;  3I97 A;  2EXI A;  5GAL A;  3WR0 A;  3J8F 1;  1FMD 2;  5C71 A;  3PU8 A;  4AVC A;  3IIA A;  3Q8F A;  5FZH A;  3TBD A;  3WF3 A;  5F39 A;  1ULG A;  2RVA A;  4FPJ A;  4CEW C;  2VCA A;  2FMD A;  3OF1 A;  4XOG A;  3T2T A;  2DFB A;  5F1R A;  4NRP A;  2ZXQ A;  2ARB A;  1H2N A;  1MS8 A;  3FUQ A;  4GXL A;  2ZGK A;  5BNN C;  4NWW A;  2VZT A;  3S57 A;  3AMH A;  1KJR A;  2LAL A;  3CHX A;  4RR3 B;  4XUP A;  3RZZ A;  4XF4 A;  2GNB A;  2QVS B;  2C26 A;  3OEA A;  2JB8 A;  1W03 A;  1KS5 A;  3I49 A;  2JDN A;  1ALY A;  2BOI A;  2SBA A;  1VMJ A;  1FX5 A;  1UMI A;  2RS1 3;  3FLR A;  1VB2 A;  5J48 A;  4Q0V A;  1VBE 2;  1H4H A;  2XG3 A;  1AR7 1;  1RUE 3;  4Y4R A;  1OUX A;  4QD2 A;  2B9U A;  4KWK A;  2Z2S B;  4FPC A;  4QB6 A;  2DWR A;  5FZE A;  3W5N A;  2GN3 A;  1Q8O A;  3LA3 A;  2PAK A;  5FPX A;  1R08 1;  2WO1 A;  1MEC 2;  2WA4 A;  2ZJC A;  4ONU A;  3E5U A;  2PAM A;  1WCK A;  2PFW A;  2ZAB A;  4UFJ A;  1YIP A;  1WMF A;  5IT6 A;  3K4Z A;  4NHX A;  5ACA 2;  3KGL A;  1IOA A;  3WVJ A;  5CFC B;  5CIS A;  4QDR A;  3N9Q A;  1S4C A;  2X09 A;  5IK4 A;  1DDL A;  3ZO0 B;  2JEC A;  1AYN 3;  1LEN A;  1N1S A;  4AOC A;  3DYO A;  5KXB A;  2JD4 A;  4XAE A;  3EJK A;  3NJV A;  2HWD 2;  3LEI A;  4H55 A;  2GP5 A;  4RHV 1;  1XSR A;  3URF A;  1HX6 A;  1GWL A;  1ASJ 2;  3BTY A;  1B09 A;  2ZGT A;  3IDB B;  4L2N A;  5T50 A;  1IPK A;  2ZGM A;  4AED C;  5CAD A;  1QGL A;  4QHB A;  4FFF A;  4CU8 A;  3J7H A;  1DGR A;  3ZKU A;  4AI0 A;  4JVA A;  3SHR A;  2H0V A;  1OD3 A;  1QU0 A;  5FV3 A;  4N43 C;  4MUV A;  2JWP A;  5JZG C;  5C3S A;  3HBZ A;  2V09 A;  4LIV A;  1KFU L;  1RJ8 A;  1ENX A;  2PHR A;  4ISQ A;  5JVV A;  3KHC A;  2D44 A;  4X6R B;  2GAL A;  3ABZ A;  1H2M A;  3AXD A;  3B94 A;  3FJS A;  4PF1 A;  1C1F A;  5FPV A;  1RUF 3;  3R4U A;  3ZXK A;  1NLQ A;  2P3K A;  3X29 B;  2JKB A;  3AP6 A;  2YFU A;  5FQ0 A;  2PHT A;  5JSO A;  3I3E A;  3O1U A;  4OI1 A;  3GHN A;  2QZ3 A;  2O8O A;  1H6Y A;  3SC7 X;  4CXW A;  2CWM A;  4M3C E;  5FYY A;  4ATF A;  3I2J A;  3FLP A;  4OHY A;  3WF4 A;  2BYV E;  3VZN A;  4CPB D;  5HBA A;  5BNQ A;  2P34 A;  2FD8 A;  3LGR A;  2Z79 A;  3C3V A;  1DYK A;  4LBL A;  1PMI A;  1XJA A;  4MHU A;  4IEW A;  5FZA A;  1OSG A;  1PIV 3;  5A7W B;  4Q4W 2;  4LBQ B;  1BK0 A;  3WF1 A;  2AZ5 A;  2E9Q A;  4Y3O A;  5E8A A;  5C33 A;  4A41 A;  3AYD A;  4MV2 A;  3OGS A;  2QQW A;  3AX4 A;  1BEV 1;  5IYY A;  2W46 A;  1LKN A;  3FZ3 A;  2YXS A;  4W50 A;  4QX5 A;  1QNY A;  4LBO A;  1J83 A;  2RJL A;  2W0X A;  2WWU A;  3TNQ A;  4WZF A;  1ZBE 2;  3ZSE A;  1AR6 3;  5CG8 A;  1QJY 1;  4UBH A;  3WG1 A;  2TUN A;  4CCL A;  2Y6F A;  4RD7 A;  3WXP A;  3RG0 A;  4Q0P A;  4MHR A;  4HVR A;  4UF0 A;  1RIN A;  5DAW A;  3RZH A;  2ZX4 A;  3RYK A;  5J37 A;  3FWE A;  4O61 A;  1Z0H A;  2ADD A;  2AR6 A;  4EZH A;  1O59 A;  1GZT A;  2HWB 3;  3BKZ A;  2DBN A;  3U10 A;  4XIO A;  1CJP A;  1FNY A;  1GNY A;  1WCQ A;  4DS0 A;  4YVW A;  1DQ5 A;  1SLI A;  4E4H A;  3VBR A;  3S30 A;  1ZM1 A;  2AEZ A;  3KV5 A;  3POF A;  5KBF A;  3EBR A;  1AXY A;  4PQ9 A;  1HN1 A;  1KDK A;  2ZHM A;  3HT2 A;  2JG8 C;  3BIE A;  4FPK A;  1D2S A;  2ZML A;  4YZ3 A;  3VZL A;  2PHF A;  2BRT A;  5JOY A;  1JYV A;  2ZEZ A;  2BGC A;  4NRM A;  4CDU B;  1OVP A;  5LEJ A;  5LY2 A;  2PYT A;  4LUL A;  3VBH A;  4LBN A;  4CDU C;  2XPJ A;  1VBA 2;  1DZT A;  3CZU A;  4P08 A;  1FNZ A;  3KF5 A;  2QQU A;  2H6C A;  3TAY A;  1F35 A;  1W6M A;  1FOD 2;  2A6Z A;  4GD4 A;  4ZPI A;  4YVS B;  5GLV A;  4BQW A;  1JBC A;  1UIK A;  2WZR 1;  3WNP A;  1QJX 2;  4Y1V A;  5A1A A;  4FPF A;  3OY8 A;  2D6K A;  3PIG A;  4NPR A;  1RMU 2;  3NV3 A;  4G3Y C;  1Z78 A;  2VGD A;  5FXV A;  2D6M A;  5FOB B;  2WYS A;  2J1S A;  5JIU A;  3VV1 A;  5FO8 B;  1WMX A;  3FE5 A;  2RS1 2;  3VBF A;  1QOS A;  3WD5 A;  5IVE A;  4W8J A;  3POW A;  2XBO 3;  4QB1 A;  4EWD A;  2Z69 A;  3MLK A;  5F8P A;  5F3G A;  4R9C A;  3ZN6 A;  1QXR A;  1GP5 A;  3AVS A;  5HCF A;  1ZVF A;  4NHY A;  5LBF A;  4QXB A;  1XRU A;  3WDY A;  1A8D A;  3NJX A;  1SBD A;  1E5S A;  2JDM A;  1DHK B;  2J1E A;  1W6N A;  3J7M A;  2W1Q A;  4XUN A;  1XYP A;  5FZF A;  3SXW A;  1AJK A;  4IQP A;  3USU B;  2F6B A;  2B7Y A;  5FZ8 A;  4AVA A;  4TXW A;  4PF5 A;  4J25 A;  1W6P A;  4HAN A;  1JYX A;  2NMN A;  2IXK A;  2WO3 A;  3VLB B;  4AE2 A;  1DGR N;  5F2S A;  4I0A A;  1PO2 2;  2QQM A;  2ZX1 A;  5FUP A;  4CTE A;  1CPN A;  1RUE 1;  3VD9 A;  1P8J A;  3WP4 A;  2VUJ A;  5JXH A;  3UL2 A;  4P9I A;  4BU2 A;  2EID A;  2I07 B;  4J1X A;  4A6O A;  4EYU A;  2F17 A;  3NNJ A;  3QCW A;  5AVA A;  1UOF A;  2R49 A;  4QT6 A;  2P3Y A;  1JZ3 A;  5FRA A;  4KQ7 A;  2IZW A;  4X8N A;  2C6S A;  1GQG A;  4R9D A;  2X8K A;  3DPR B;  4XFF A;  3VUO A;  2RS5 2;  4CDX B;  4Q4Y 3;  1LHN A;  3DPR C;  3VZK A;  3EHK A;  4IND A;  1RUG 3;  1AYN 1;  1J3P A;  3CO2 A;  4XFC A;  4AW7 A;  3RNS A;  5J36 A;  3IDA A;  3KF3 A;  2MPF A;  4Y5S A;  3WV6 A;  1C1L A;  1O3T A;  1MPX A;  1QQP 2;  1AUY A;  1ZZC A;  3WP5 A;  3AMP A;  3UGH A;  1DQ4 A;  5C5U A;  1RUF 2;  1S0E A;  3VZJ A;  2VMH A;  2W5F A;  1YQ8 A;  4UW5 A;  4BM8 A;  2AAC A;  1R1A 2;  5FPA A;  4NJ4 A;  2YU2 A;  4HPK B;  3W9A A;  3JD7 3;  1OD5 A;  5T5O A;  2AH2 A;  1AR8 3;  3GF6 A;  4Z82 A;  3HIF A;  3SIT A;  2A1X A;  2ETE A;  4WVV A;  1CAW A;  3AJZ A;  1RUH 3;  1ULC A;  1OF3 A;  3RS6 A;  4OI2 A;  4CUB A;  2VW2 A;  1Y4W A;  3I2D A;  1LR5 A;  1PIV 2;  3M4F A;  4WVZ A;  3ZYI B;  4W6Y A;  1WA4 A;  5FY7 A;  5L7O A;  4COW A;  3ZOI A;  4X8P A;  1HJF A;  1AL2 3;  1K12 A;  2BZD A;  1OLM A;  1NQJ A;  2B39 A;  3U14 A;  4CUC A;  4MGQ A;  1YI7 A;  3D0J A;  3OYW B;  3VD4 A;  3I3B A;  4EN0 A;  4Q0Q A;  2WNO A;  4IEY A;  1H1I A;  4YW3 A;  1OOP B;  1CQ9 A;  5CFD C;  5LK7 B;  3IDE A;  4E4D X;  4FQ4 A;  2QUO A;  3SNM A;  4UFL A;  5GZG A;  4HT1 T;  2EXK A;  3ZXG A;  4BDV B;  5K4L A;  5AC9 3;  1W6O B;  1BBT 2;  1UMH A;  2WNU A;  4FOY A;  2R1B A;  3NAP B;  4YFZ A;  1XB9 A;  2HWF 2;  1EUU A;  1RVF 3;  3I59 A;  2ZHK A;  3CKH A;  4LE3 A;  2HWB 2;  5L9B A;  2YYO A;  3WT3 A;  1W9T A;  4XBQ A;  3MO4 A;  4L9B A;  4F83 A;  3RZM A;  5FZ0 A;  4NWV A;  1BYH A;  1NYW A;  3LIH A;  3BYW A;  4BIF A;  4D6R A;  3H8O A;  4CEW A;  5FP9 A;  2VU9 A;  5JXJ A;  1GKB A;  1GQH A;  1R1Z A;  3NKT A;  1QNW A;  3HBK A;  3IDC B;  1S2E A;  1NCQ B;  4A7K A;  3NV4 A;  4COY A;  1W05 A;  4JDO A;  5BNN A;  1I9R A;  3FLT A;  4CCN A;  1QH7 A;  1QJU 1;  1YWK A;  4M0N A;  1EY2 A;  5CKM A;  1UXX X;  3I3Q A;  5T54 A;  2A71 A;  1XXN A;  3FUO A;  3T09 A;  5K8S A;  3T08 A;  1DGW X;  3KQR A;  1J59 A;  1UYY A;  1ND2 C;  1KEX A;  1WBF A;  3GXU A;  4W65 A;  4CDQ C;  1IKQ A;  1SEF A;  3NJZ A;  1CZV A;  2EIB A;  4YG6 A;  5A7S A;  3GZU C;  3T1L A;  2J1T A;  4G4F A;  3WUC A;  1GUI A;  1MVQ A;  4MOA A;  5FAX A;  3ZLI A;  4XMI A;  4AFA A;  3VDB A;  2VNR A;  2Y6J A;  3JBG 1;  4GWM A;  4OFG A;  1BZW A;  1GZW B;  4NIH A;  1YRZ A;  3WF2 A;  4ASM B;  1WWY A;  5IVJ A;  4UBG A;  2HKX A;  1LB2 A;  1EAH 3;  4RYD A;  4O9E A;  1M4W A;  4XF3 A;  4BMB A;  3K77 A;  1MS1 A;  1AXK A;  1KFX L;  1RL3 A;  1W06 A;  3VKF C;  5K0U C;  1J3R A;  1HXS 2;  1YNA A;  4WM8 B;  1OH4 A;  2VZR A;  3D5O A;  2YB7 A;  2XXZ A;  1XYO A;  4JGZ B;  2UYB A;  4WM8 C;  2P37 A;  3H50 A;  4Q4V 1;  3RWK X;  3MIB A;  3ZFF A;  4QHZ A;  5CAZ A;  3E5Q A;  2RV9 A;  2R04 2;  1RED A;  1CAV A;  4TTG A;  1IS3 A;  1ZRR A;  2QDR A;  5H9S A;  2IVI B;  3WQ0 A;  3WDU A;  5JAX A;  2OQ6 A;  4N53 C;  1ZA4 A;  3FC0 A;  2WYF A;  1X9P A;  2W9X A;  4AED A;  4AI9 A;  1AYM 1;  4IET A;  4AK3 A;  1VMF A;  3SMH A;  5FXZ A;  2MEV 2;  1GFF 2;  4C91 A;  4EWA A;  2XWB B;  3POY A;  5A3W A;  2VVD A;  1TMF 3;  4KBZ A;  2EAL A;  2C1F A;  3V0B A;  2CAV A;  2VZO A;  1PGL 1;  2W1U A;  4N43 A;  1YQ2 A;  5ABJ B;  1OBN A;  2D6L X;  5JZG A;  5H9R A;  1URX A;  4JGY C;  1PGW 1;  2FCU A;  3LPG A;  3OGJ A;  5F5C A;  5A3N A;  3MID A;  4LO4 B;  2G9F A;  3RSJ A;  4YSF A;  1HRV 1;  2BVV A;  4UWD A;  1S0G A;  1US3 A;  2GC0 A;  3TN9 3;  4EN7 B;  4AF9 A;  1QEX A;  2O8Q A;  3KSC A;  2GAU A;  3SH5 A;  4BE3 A;  4PJY A;  3SLI A;  2PHL A;  5A6Y A;  2WFP A;  2O0O A;  1ZZ6 A;  1ONA A;  2VVF A;  1DGW A;  3ES1 A;  3GNE A;  1GMM A;  3PDQ A;  2WO7 A;  4S2D A;  4EZ4 A;  4AQS A;  4NMI A;  1BMV 1;  1ZNP A;  1HLC A;  2PHU A;  5FY8 A;  1SZB A;  3WEZ A;  1EPZ A;  4EE2 A;  4CVU A;  1KGY A;  2RG4 A;  3N7J A;  5HXV A;  4MGY E;  5KR7 A;  5L9R A;  4P9Y A;  5FXX A;  3GZT B;  3LWC A;  4PBO A;  1Y43 B;  5EWS A;  4YPJ A;  2J1V A;  1AR8 2;  4FAH A;  1HB4 A;  1O5U A;  4XF9 A;  5A7W A;  5A3T A;  1ULO A;  3V65 A;  1YCI A;  3UJO A;  1RUG 1;  4QX3 A;  4YW2 A;  2EIE A;  2ZEY A;  1Q8Q A;  1OKQ A;  3MHZ A;  2IXI A;  2VBB A;  1W8Z A;  2VO5 A;  3OBZ A;  4XBL A;  5FZ3 A;  2FDK A;  4OQ8 A;  3I2H A;  2CY6 A;  2WKK A;  4YGB A;  4FFI A;  2ZEW A;  3JD7 1;  4B3N A;  2WNE A;  1OT5 A;  2Y60 A;  4GMP 0;  3BAL A;  2QFE A;  1H8T C;  3BVC A;  5IVC A;  4Q0U A;  5FY0 A;  1CZT A;  1PMJ X;  3MUZ 1;  2WA3 A;  1O4Z A;  1KRI A;  1ZZ8 A;  4K1Z A;  2J1R A;  1OPM A;  1VAL A;  1DYO A;  2YC0 A;  5DZG A;  2JG8 A;  4D94 A;  1AL2 1;  4RFR B;  1XPW A;  5DUV A;  5A33 A;  5FOJ B;  5LY1 A;  3B7M A;  5DDJ 3;  2IFW A;  4JKK A;  4AQ2 A;  5IUQ A;  1ULE A;  4QAW A;  4BQY A;  4A3X A;  5HI0 A;  1TEI A;  3K48 A;  4K20 A;  5GKA C;  5FZO A;  5FPU A;  3N36 A;  4RSU A;  1YJL A;  4CP1 A;  2YPJ A;  3VDA A;  4BQX A;  2RMU 2;  3ZXF A;  4P02 B;  5KHG A;  4LXL A;  5CYY A;  5AC9 1;  4FPO B;  5FQ0 B;  1GZC A;  5KXC A;  3AP4 A;  4LJH A;  3ZMO A;  3M70 A;  1GYK A;  2UY9 A;  2OII A;  4CP0 A;  3QLQ A;  3PUI A;  4HOO A;  4P9X A;  5C8C B;  4QX0 A;  1K5J A;  4GWI A;  1AVB A;  3ZVX A;  2WZ8 A;  2HBU A;  3HNB M;  4QKD A;  4ISR A;  5C8C C;  1NLS A;  4Q4X 3;  3VD3 A;  4AI8 A;  1M06 G;  3IAQ A;  1Z7S 2;  2WFF 3;  3BCW A;  1U0A A;  5FYU A;  1POV 0;  4NHL A;  3Q9O A;  5D2A A;  4CDW C;  1MS0 A;  3BUC A;  3KT7 A;  4LEJ A;  1UYZ A;  4FT8 A;  1NA1 C;  2R6Q A;  1GWK A;  5C8C A;  2OUH A;  3EO6 A;  5DN2 A;  3ZYR A;  3DXT A;  1V6O A;  2QTW B;  2Y38 A;  4H7M A;  3MUY 1;  3SEP A;  5A7O A;  2ERF A;  3IMM A;  4UAP A;  4HON A;  2WQZ C;  4A42 A;  4UF0 B;  2HEV F;  2WRA A;  3H7Y A;  3PVO A;  4LUM A;  1HDK A;  3D8C A;  1K42 A;  5FP8 A;  1XE8 A;  1FMD 3;  1UZV A;  4BOW A;  2WLP A;  4JQT A;  2Y26 A;  4M4P A;  4KNC A;  3VL8 A;  1DLC A;  3ALQ A;  1DQ6 A;  1RIT A;  1WBL A;  3VBR B;  5EPA A;  4XUO A;  4QGM A;  4YZ4 A;  4Y1U A;  5FBJ A;  3RMY A;  1JUH A;  1ULF A;  3DPR A;  5FYI A;  4D7S A;  2IXC A;  2KXL A;  3ECQ A;  4K6B A;  5EZW A;  3V0A B;  1NY7 1;  4LQR A;  1A3K A;  2NYY A;  5SV5 A;  3U0Z A;  2DCJ A;  2VTX A;  4GAZ A;  5GZF A;  3UKN A;  3H7J A;  5EP9 A;  5FO7 B;  1XNA A;  2UWA A;  5CB7 A;  2P6C A;  4HBN A;  3T0A A;  3CL1 A;  1LED A;  3MFA A;  2WC2 A;  2XUE A;  3OY8 B;  4K8F A;  3WW3 A;  4AGV A;  5JIA A;  2XJP A;  1VBE 3;  1I6X A;  2DVA A;  1JU4 A;  1QHD A;  1C4R A;  3AYC A;  1L3J A;  4QQO A;  1TE1 B;  4D8M A;  5C4W C;  1TNF A;  3BOP A;  3G7D A;  1PO1 3;  1UPI A;  5FZM A;  3VBF B;  1X50 A;  4YG0 A;  5LB6 A;  2UUR A;  5SV8 A;  2C0Z A;  2PQS A;  4Q27 A;  2Q8C A;  1MEC 3;  2P17 A;  4GZ9 A;  3ZN6 B;  5C6C A;  5IVV A;  1JOP A;  2XJQ A;  3MF9 A;  1SLA A;  4FI9 A;  3N9M A;  1JN2 P;  4LR4 A;  4XTM A;  4LBK A;  4OHV A;  5FK8 A;  3TN9 1;  4BA6 A;  4BCU A;  2A3W A;  3LA2 A;  2V72 A;  1VBD 2;  2CGO A;  1PHM A;  4JZR A;  5FWE A;  2CSG A;  1W6N B;  3OYW A;  2VOV A;  2YGL A;  3LKJ A;  5G04 L;  4QPW A;  5CFD A;  3W21 A;  1S2K A;  2WO2 A;  2HWD 3;  4NOT A;  5FZD A;  1W6P B;  2VNV A;  4NIG A;  4Q1P A;  2R30 A;  3H0O A;  2Y8K A;  1C5I A;  2B4K A;  3JB8 A;  5GJ6 A;  3U75 A;  4OQ9 A;  1ASJ 3;  4DZG A;  1SQ4 A;  4FO9 A;  4Z2A A;  3SKJ E;  3GCW A;  2VOW A;  5K7P A;  5A6Q A;  4RGK A;  5C7G A;  3AL5 A;  1CWP A;  4MX3 A;  4XW3 A;  1NE6 A;  4ZS3 A;  4L97 A;  2WUH A;  3KLS A;  4YGC A;  5FZ4 A;  1R09 3;  1FV2 A;  2Y0I A;  3BGA A;  2RS3 1;  2GME A;  1CD3 G;  2D7F A;  4A7Z A;  1S0F A;  4B1M A;  2VZU A;  4IUG A;  3T0B A;  4BIS A;  2YHJ A;  1RUN A;  2D98 A;  3N9L A;  2FBE A;  1CX4 A;  3VB9 A;  4B7K A;  1ACC A;  3U11 A;  4COZ A;  4OI0 A;  2EAK A;  1AL0 G;  2MHF A;  1AF9 A;  1ND2 A;  1OUR A;  2Z4F A;  2Q8D A;  4CCE A;  3T30 A;  4N90 A;  4CDQ A;  5JDB A;  1IQA A;  4P00 B;  4QQ2 A;  1NE4 A;  2GMP A;  2DFC A;  1XBF A;  5FYC A;  1NCR C;  3MW3 A;  4Y33 A;  2PMW B;  2BJS A;  1UYX A;  3ZSK A;  1DU3 D;  2XLG A;  2J42 A;  2JE8 A;  3W58 A;  5FWJ A;  1DBN A;  2YU1 A;  3FL7 A;  2QQI A;  4Q4W 3;  1CPM A;  4ES9 A;  3QH6 A;  5DDJ 1;  1Q8S A;  5FPL A;  4Y20 A;  5GZD A;  3LE0 A;  5FYB A;  3J4U H;  2JE7 A;  3P1I A;  1X8M A;  3D0S A;  3TEX A;  4LK7 A;  1RUI 2;  1YI9 A;  4FVV A;  3P5B A;  2YFZ A;  5K0U A;  5L7O B;  1OVS A;  1W28 A;  2WIN B;  4AGG A;  3ATG A;  3ZDV A;  5EFU A;  2RM2 1;  3R4S A;  4MGK E;  4WM8 A;  2VMI A;  1O4T A;  3ON7 A;  1O3Q A;  1MZ5 A;  2QDN A;  2UU8 A;  3DYP A;  3KD4 A;  1ZBE 3;  2ID4 A;  1U5I A;  3EQE A;  2PEL A;  3QD6 A;  3NQH A;  3HT1 A;  4GKX A;  4E9K A;  1AJO A;  1UZ0 A;  1YO8 A;  3ZPO A;  3EYP A;  5FY9 A;  4N53 A;  3UET A;  2WAB A;  3OTF A;  4Q4X 1;  3VD7 A;  4DNY A;  3K46 A;  2YBS A;  3U1X A;  2WNU B;  4JTN A;  5F6K A;  3H42 B;  1LNS A;  3N4M A;  1LAJ A;  2WFF 1;  3I59 B;  5DG2 A;  4UFI A;  3AP5 A;  5FZG A;  4ZXK A;  1H9P A;  1UIJ A;  1EV1 2;  2B42 B;  2YV8 A;  4MO3 M;  4QQL A;  1NAE A;  2ZCW A;  4B4P A;  5CNA A;  4LKD A;  1YUD A;  1ZRE A;  4CEW B;  2FMY A;  4JGY A;  4A2U A;  3OGV A;  2E53 A;  3E1F 1;  4AHY A;  1VBA 3;  1CJD A;  1C8M 1;  2LTN A;  2D5F A;  4BQ4 A;  1J3Q A;  4XF0 A;  2JIG A;  3SQO A;  4AFC A;  5BNN B;  3VD5 A;  5FIX A;  2VQ0 A;  3AKS A;  1FOD 3;  2JB4 A;  4KG8 A;  1HV1 A;  3TRS B;  1QXJ A;  1WW7 A;  3VBU C;  1QJX 3;  1NXD 1;  4HFS A;  4XEZ A;  3NL1 A;  3RMX A;  1RMU 3;  1DLL A;  1QOT A;  1G8W A;  3PUR A;  4IEQ A;  3NW4 A;  2YC4 A;  5JR2 A;  1SBE A;  3VGI A;  2ET1 A;  1UNB A;  5FMD A;  3RI8 A;  3WY6 A;  4AQ6 A;  3J7N A;  3AJY A;  4UFM A;  5I8T A;  3VHN A;  5I8S A;  5IK8 A;  1XQN A;  2F4L A;  5AVP A;  1WLC A;  4YZ1 A;  3I54 A;  1AR7 2;  5DAQ A;  2EIC A;  3CDZ B;  3E97 A;  1PO1 2;  4NAO A;  4XIL A;  5EJ3 A;  3U07 A;  1A8M A;  4S2G A;  1H1A A;  4BH9 A;  4WVW A;  2VUA A;  1ND3 C;  4GQ7 A;  4XFH A;  3WG3 A;  1W6Q A;  1W2N A;  2DVB A;  4NAM A;  1HKD A;  3UV9 A;  2W91 A;  2WN2 A;  1VR3 A;  4HG6 B;  3RYR A;  3ZFF B;  1ZZB A;  5LA1 A;  2DUQ A;  5GLT A;  3ZFF C;  1CAV B;  4IXL A;  2JDH A;  3T4H B;  1H1M A;  4ATE A;  3O1S A;  1C28 A;  4MG2 A;  1PO2 3;  2VZV A;  1VBE 1;  2D3R A;  1H8T A;  5AFB A;  1WLW A;  3NMB A;  4AED B;  5JPM B;  3QBQ A;  2XLA A;  4Q26 A;  4JDM A;  1RUC 2;  3DCQ A;  4RHV 2;  4ORF A;  1CX1 A;  1MEC 1;  3O0X A;  3RZG A;  4CU7 A;  1UU4 A;  3V0B B;  4OUM A;  5FPB A;  4NII A;  5HV4 A;  3GGL A;  4N43 B;  4AYU A;  2RS5 3;  2ATF A;  1ZBA 2;  2GP3 A;  2JDP A;  5CKQ A;  5ACA 1;  5JZG B;  1R09 2;  1SHW B;  4E4Z A;  4S2F A;  5FYZ A;  2VQT A;  4UI9 L;  2Q8E A;  2CYF A;  3POG A;  1UL9 A;  4F8A A;  3RWN A;  4NHM A;  2HWD 1;  3MW4 A;  1QOO A;  1QQP 3;  1STM A;  3GYD A;  4UT5 A;  5F2W A;  3IAP A;  4QHO A;  1W3V A;  1XC6 A;  4PI2 A;  5CBL A;  2Y6K A;  3S5A A;  4ZZ5 A;  1LOF A;  1R1A 3;  1APN A;  5L36 A;  1IHM A;  2X29 A;  2C4X A;  1RUD 3;  3M3C A;  1AZD A;  2W1W A;  4WV8 A;  3T1M A;  2JDY A;  4GWJ A;  1OA4 A;  1PNF A;  1YFY A;  4HN1 A;  2YRO A;  4ASL A;  3ZSJ A;  1C5H A;  1O8P A;  4CA9 A;  4DFS A;  3AMM A;  3GZE A;  1TVG A;  3KQ4 B;  3AP9 A;  3OBR A;  5LA9 A;  2ZGL A;  1LU1 A;  1GAN A;  4LOR A;  4YW4 A;  4PQQ A;  4A3Z A;  1DCS A;  4C0H A;  3CBN A;  4HET A;  3WNN A;  2A6X A;  2D6P A;  5ANQ A;  3IPV B;  1LGB A;  1Q8V A;  1VBC 1;  4CDW A;  2JIJ A;  4E2Q A;  1JTZ X;  5FCC A;  2VAU A;  4DRV A;  1NA1 A;  3J26 N;  1MZ6 A;  3PNA A;  5D1I A;  1L7Q A;  1UY3 A;  4UYB A;  4WVM A;  4HLT A;  4QPY A;  1JYN A;  4IEO A;  2VZS A;  4XXA A;  3TEZ A;  4ZKT B;  1F8V A;  1MS3 A;  4XMA A;  3R6S A;  4M01 A;  3N35 A;  2KA3 A;  3H3L A;  3PJY A;  4JCK A;  3VDD C;  1YFU A;  2C9K A;  2Q0A A;  3O12 A;  3IMN A;  4QB2 A;  1G9F A;  1MVE A;  4KMQ A;  5FZB A;  1SPP A;  4LBQ D;  4AHW A;  5JOZ A;  4AG4 A;  1MS9 A;  1QY4 A;  3POE A;  1WW5 A;  1BBT 3;  1NXM A;  4J1W A;  4Y1Y A;  3ZIX A;  3THC A;  2WII B;  2WN3 A;  1N47 A;  4Q4W 1;  2HWF 3;  2O1Q A;  4D6Q A;  1UWW A;  4EJR A;  4ERO A;  4DY5 A;  3OUJ A;  3HNM A;  4IGO A;  1W2A X;  1D0H A;  2OYZ A;  1GOH A;  1HN0 A;  2XON A;  4E8C A;  2N7G A;  2BU9 A;  2W52 A;  5HCA A;  1VPH A;  2JG8 B;  2RDS A;  5A33 B;  1W99 A;  5EQU A;  4PDW C;  3LOI A;  3MFC A;  4V2V A;  3ETP A;  4AHZ A;  4CZS A;  2VXR A;  1W04 A;  2VQU A;  2KM2 A;  2GN7 A;  5B4N A;  2HWE 2;  1JHN A;  1XYN A;  2RHP A;  4GA9 A;  2WSV A;  2IXH A;  3ACG A;  1ULP A;  5FMB A;  1G86 A;  4MGZ E;  4FPG A;  5FZO B;  4D3W A;  3V0A A;  4O7X A;  1G7Y A;  4UW4 A;  1MZF A;  2WS9 1;  3LF7 A;  3EMR A;  4BQ2 A;  5I0U A;  1BJQ A;  2W94 A;  4OYU A;  4ES8 A;  1JZ4 A;  1DZQ A;  5D21 A;  3NO8 A;  2VCC A;  3PTY A;  3LDR A;  1JI6 A;  2R32 A;  3ITQ A;  1MQT C;  5C4W A;  1JZ6 A;  3CZJ A;  4CYD A;  3KV9 A;  3H9A A;  2GND A;  4DMI A;  3O1R A;  4GH4 B;  1UO9 A;  4YWA A;  5F5A A;  5H9P A;  3HQR A;  4Y24 A;  4GH4 C;  3TNP B;  1YC6 1;  5KHJ A;  1VBA 1;  5FJH A;  4LO6 B;  1NKG A;  3AP7 A;  4JAA A;  2CL2 A;  1SFY A;  2ZHN A;  4KH9 A;  4XHB A;  5DAV A;  1HXS 3;  2VCM A;  3ACF A;  1FOD 1;  1ZX5 A;  4E2G A;  1N3O A;  1W9Y A;  2DDU A;  4U2A A;  3CJI A;  1QJX 1;  3JCI A;  1CN1 A;  1LOC A;  4PIZ A;  2R04 3;  3K51 A;  3BOW A;  3KCC A;  1DP0 A;  4XAA A;  5I0R A;  1RMU 1;  1SDD B;  3P3N A;  4M3C A;  1QDC A;  1JZ5 A;  2BV4 A;  3DUI A;  3RJ2 X;  3AC0 A;  5KWR A;  4H7L A;  1D0G A;  1GV9 A;  4IEP A;  3RI9 A;  3R4D B;  1GP6 A;  2RS1 1;  5JR7 B;  4H3W A;  3ST7 A;  2BUK A;  4PLN A;  5FZ9 A;  2MEV 3;  2ZZQ A;  2FDG A;  4BZ4 A;  3UGF A;  4B4Q A;  4MGT A;  2VMC A;  2WWJ A;  1ENR A;  1OUS A;  1FV3 A;  1UXZ A;  1F31 A;  3KCY A;  4GMP 3;  2Q8O A;  3MV0 1;  4BHP A;  5JLV A;  4ITC A;  1HRI 3;  4I2O A;  1PK6 C;  1GR3 A;  1LES A;  1BK1 A;  3T2P A;  3KZ4 C;  3W59 A;  1PVC 2;  1VE0 A;  3MIH A;  1C57 A;  3OBT A;  1PO2 1;  5FPZ A;  2L9L A;  3THT A;  2R07 2;  3A0N A;  2WZP P;  4DUV A;  1F5J A;  4FOQ A;  4C1X A;  3BTA A;  1QH6 A;  3OD4 A;  2CV6 A;  3VKN A;  1NCR A;  5IFP A;  3PTR B;  3JQW A;  4SBV A;  1F5F A;  3O0V A;  5GZC A;  3ACL A;  4BXF A;  1GNH A;  1V9U 2;  2XQR A;  4QM8 A;  4I02 A;  3ZN5 A;  1GOF A;  2RE9 A;  3OPZ A;  3GJB A;  1RUD 2;  1KXG A;  2RS5 1;  4GB3 2;  1OA3 A;  1UZW A;  1EYB A;  3DGT A;  3JQX A;  5JXG A;  1RGS A;  1XNB A;  1WKY A;  3B69 A;  4FPH A;  4FP3 A;  3OPW A;  3GBF A;  1QJF A;  5JOX A;  4AFB A;  3PU3 A;  1CAX A;  1SLC A;  5DAP A; 
#chains in the Genus database with same CATH homology
 5IJR A;  3F2Z A;  2XOM A;  1W8N A;  2ZEW A;  2VL4 A;  1OT5 A;  5IHR A;  3FHQ A;  3K4A A;  3OGR A;  4DXT A;  1UX7 A;  1CZT A;  1PMJ X;  3IB3 A;  1PMH X;  2LW8 A;  3MUZ 1;  1JZ7 A;  3K75 B;  4XUQ A;  3OBA A;  4RN5 A;  2ORX A;  2J1R A;  3I3D A;  2R7E B;  1DYO A;  1TG7 A;  3WNO A;  1XNT A;  1XPW A;  2VZ1 A;  4JKK A;  3HEI A;  4QAW A;  3I2F A;  3W5M A;  2WQ8 A;  3FN9 A;  2V4V A;  1JHJ A;  3BN6 A;  3VDA A;  4P02 B;  1K3I A;  1D7P M;  3CIH A;  5CYY A;  3CMG A;  2CDO A;  3T2Q A;  5EJ1 B;  4A44 A;  3HJR A;  3NNG A;  3PUI A;  5DMY A;  4QX0 A;  3A22 A;  4CU9 A;  4GWI A;  4TTG A;  3JXS A;  2WDB A;  2WZ8 A;  3HNB M;  2WAO A;  3VD3 A;  2E33 A;  3C7E A;  3IAQ A;  3LEG A;  2B9V A;  2J22 A;  4ET7 A;  2ZEX A;  1UYZ A;  2BBA A;  2Y6G A;  5DN2 A;  3A21 A;  3DYM A;  2BGO A;  3OB8 A;  3GM8 A;  3MUY 1;  3SEP A;  4UAP A;  3I97 A;  4A42 A;  5C71 A;  4JX0 A;  4QX1 A;  3WF3 A;  1K42 A;  2RVA A;  5EIY B;  2VCA A;  4M4P A;  2ZXQ A;  1W0N A;  1DLC A;  4ZXE A;  2VZ3 A;  1W8O A;  4XUO A;  2VZT A;  4CUA A;  4XUP A;  5J1X A;  4OUE A;  2C26 A;  3ECQ A;  3OEA A;  2VM9 A;  4LQR A;  4L0P A;  3LQC A;  5JUV A;  4UOJ A;  1UMI A;  2DCJ A;  1XNA A;  4BK5 A;  3T0A A;  1EUT A;  4OZO A;  3ZM8 A;  3C7G A;  3DEC A;  4QB6 A;  1UY2 A;  4D8M A;  1JU4 A;  2X05 A;  4KI5 M;  2WO1 A;  3T0D A;  1CZS A;  2PQS A;  3K4Z A;  4JKM A;  2J1U A;  4QDR A;  4GZ9 A;  2X09 A;  3I2I A;  3GDB A;  1GOG A;  4FI9 A;  3DYO A;  4XUT A;  2V72 A;  5LCW L;  3NJV A;  3LEI A;  2VZQ A;  2V5D A;  5G04 L;  4QPW A;  1JZ8 A;  2WO2 A;  3WQB A;  4ARX A;  1JYW A;  2Y8K A;  2B4K A;  3J7H A;  4CU8 A;  4LPL A;  3NRU A;  1OD3 A;  4Z2A A;  3SKJ E;  4E8D A;  5C7G A;  1K45 A;  2WUH A;  3BGA A;  4BXS V;  4CU6 A;  3K4D A;  3ABZ A;  4PF1 A;  5HPO A;  2DCK A;  2VZU A;  4IUG A;  3T0B A;  2YFU A;  3I3E A;  1H6Y A;  2YC2 A;  3LPF A;  3I2J A;  3WF4 A;  2Z4F A;  4P00 B;  4LHS A;  2VOT A;  1UYX A;  3WF1 A;  1F4A A;  4W4Z A;  2JE8 A;  4A41 A;  3FL7 A;  2QQI A;  3OGS A;  5IYY A;  2W46 A;  3LE0 A;  5DQ0 A;  4W50 A;  3CQO A;  3C7O A;  3P1I A;  2VTF A;  4PT6 A;  1J83 A;  2YFZ A;  3WNL A;  3I2G A;  4BJ0 A;  3DYP A;  4DUX A;  2JDA A;  2ID4 A;  3ACI A;  1PX4 A;  1OF4 A;  2LS6 A;  1O59 A;  3NQH A;  2W1S A;  1UZ0 A;  1GNY A;  2E32 A;  2QQK A;  4MAD A;  1WCQ A;  2WAA A;  3EYP A;  3UET A;  2WAB A;  3VD7 A;  3K46 A;  1UY0 A;  2KD7 A;  1HN1 A;  2HLE A;  1NUK A;  1CX1 A;  1LNS A;  4QDS A;  2VJX A;  1JYV A;  2ZEZ A;  4MGS A;  3HPN A;  4MO3 M;  1NAE A;  4P08 A;  3CZU A;  2QBX A;  4JKL A;  2X10 A;  3OGV A;  3C8X A;  2VMF A;  3E1F 1;  3WNP A;  2JKX A;  5A1A A;  3VD5 A;  4DEQ A;  2ORZ A;  2W3J A;  2RJ2 A;  2WYS A;  2J1S A;  5JR2 A;  2YC4 A;  4XVH A;  4W8J A;  5EJZ B;  4QB1 A;  1SG3 A;  4D0Q A;  1W9S A;  1JU3 A;  2WBK A;  3FHA A;  3NJX A;  2EIC A;  3CDZ B;  2J1E A;  2W1Q A;  4XUN A;  2XHN A;  1H6X A;  4TXW A;  4ARY A;  1JYX A;  2VMD A;  1PX3 A;  2W91 A;  2WO3 A;  2WN2 A;  4HG6 B;  2QQM A;  5HXM A;  3VD9 A;  1P8J A;  5LA1 A;  4A4A A;  5JXH A;  2EID A;  1IQD C;  1R64 A;  4A6O A;  2VZV A;  4DXR A;  4A45 A;  1JZ3 A;  4QX2 A;  3SEE A;  3III A;  4AAX A;  1US2 A;  3A7Q A;  4CU7 A;  3WNK A;  5JMO A;  1UY1 A;  3GGL A;  4OMD A;  3IDA A;  4LKS A;  1SHW B;  3HNY M;  1MPX A;  2VQT A;  4UI9 L;  3WF0 A;  1O8S A;  4BK4 A;  2W5F A;  4DUW A;  3IAP A;  1XC6 A;  2WZE A;  2Y6K A;  5F7U A;  4ZZ5 A;  2C4X A;  4KWU A;  5CZK A;  2E26 A;  1OF3 A;  4CUB A;  2W1W A;  1T2X A;  3UES A;  3P6B A;  4GWJ A;  1O8P A;  5IFT A;  3LEK A;  1TVG A;  2W47 A;  4XZU G;  3A23 A;  3SKV A;  4DEV A;  1L7R A;  4CUC A;  1K12 A;  2BZD A;  4PQQ A;  3ACH A;  4A3Z A;  4MGQ A;  2XQX A;  3VD4 A;  3WNN A;  3I3B A;  3WNM A;  2W95 A;  4P5Y A;  1L7Q A;  1UY3 A;  2CDP A;  1JYN A;  2VZS A;  4QDQ A;  4BDV B;  2C9K A;  1UMH A;  2QQN A;  2VZP A;  4QB2 A;  2J7M A;  4ZY9 A;  4KMQ A;  5DPN A;  1EUU A;  2VME A;  3CKH A;  4AG4 A;  2QQL A;  1JZ2 A;  1W9T A;  2BER A;  2VC9 A;  3MO4 A;  3THC A;  2WN3 A;  1UWW A;  2E31 A;  3HOB A;  5JXJ A;  3HNM A;  1NX9 A;  1GOH A;  4E8C A;  2XON A;  1RYY A;  1W99 A;  1UXX X;  4OMC A;  3ETP A;  2Y6L A;  3T09 A;  3T08 A;  2VQU A;  1UYY A;  5B4N A;  1KEX A;  3GXU A;  3ACG A;  1CZV A;  1ULP A;  2EIB A;  5C70 A;  2J1T A;  1GUI A;  4MOA A;  5G05 L;  2JD9 A;  3WSO A;  3VDB A;  2QQO A;  2Y6J A;  2YG0 A;  2W94 A;  4OYU A;  3WF2 A;  1JZ4 A;  2VCB A;  2VCC A;  1JI6 A;  4RYD A;  1JZ6 A;  3CZJ A;  3MBW A;  3U37 A;  3K77 A;  1W9W A;  2QQJ A;  1UY4 A;  4ZZ8 A;  2W87 A;  1OH4 A;  1J84 A;  2VZR A;  2YB7 A;  3EB7 A;  2VR4 A;  1NKG A;  3OEB A;  3ACF A;  2RV9 A;  4M4R A;  3MV1 1;  4DXS A;  5I0D A;  2DDU A;  1CIY A;  1DP0 A;  5JXI A;  3UNP A;  2W9X A;  1SDD B;  1JZ5 A;  2OKX A;  3AC0 A;  5FUI A;  3PUH A;  1F4H A;  2VZO A;  1I5P A;  2W1U A;  2Y6H A;  1YQ2 A;  1BHG A;  4JHZ A;  3C7F A;  2W92 A;  3LPG A;  2VMC A;  1UXZ A;  3W5N A;  3OG2 A;  2Y64 A;  1US3 A;  3MV0 1;  5LA2 A;  3D3A A;  3VDC A;  1GU3 A;  2BGP A;  4XUR A;  3T2P A;  3C7H A;  5LA0 A;  1GMM A;  5B4X A;  2J1A A;  3WEZ A;  2L9L A;  4CVU A;  4DUV A;  1KGY A;  5IFP A;  3HN3 A;  4YPJ A;  2J1V A;  3THD A;  1ULO A;  3I2K A;  1GOF A;  1GQP A;  2HYX A;  4QX3 A;  2EIE A;  2ZEY A;  5JXG A;  1WKY A;  2VO5 A;  3T2O A;  3I2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...