5DQ0A

Structure of human neuropilin-2 b1 domain with novel and unique zinc binding site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
157
Chain Sequence
b'CNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTSGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title To be published
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dq0A00
3DECA 5DN2A 4DUVA 3C7GA 4DUXA 2VZRA 1PMHX 4UAPA 2W5FA 2XOMA 5G04L 4BK4A 5JXHA 2Y8KA 3HOBA 3MBWA 4DXSA 1W8NA 1UY1A 1EUUA 3HNYM 1OF3A 5JXJA 3ACFA 2E26A 1XNAA 3ABZA 4QDQA 3UETA 2VZ1A 1ULPA 3P1IA 2W94A 3MUY1 1PX4A 2ZEYA 4UI9L 3E1F1 2DDUA 2C9KA 4JHZA 3D3AA 2V5DA 2W87A 2VCCA 3NJXA 2W91A 3LEKA 1ULOA 3PUIA 4OMCA 3EYPA 2BZDA 1UY3A 3WNLA 3ACHA 2HLEA 3NJVA 3LEIA 3VD7A 3SEPA 2WN2A 3C7OA 4FI9A 2QQNA 4E8CA 4ZXEA 4DEVA 2LS6A 5F7UA 2VTFA 3F2ZA 2EIDA 2W9XA 3MUZ1 3WNNA 2QQOA 2WO3A 4A45A 3GXUA 4ZZ8A 3NRUA 1K12A 4PT6A 1JZ7A 2OKXA 5I0DA 4D8MA 2ZEZA 3U37A 3ZM8A 3I2IA 5CZKA 4ET7A 1W9SA 3THDA 1GOFA 1UMHA 1K42A 2VZTA 5LA1A 4ZZ5A 1OF4A 2YFZA 4QAWA 3IAPA 2QQKA 2X10A 2RV9A 2WBKA 1SG3A 2XHNA 4QX1A 4OZOA 2QQMA 3C7EA 1CIYA 4A3ZA 1I5PA 3WF1A 3WNKA 4JX0A 1CZTA 2WAOA 1XNTA 3OBAA 5J1XA 3JXSA 3PUHA 1F4AA 2HYXA 4BDVB 1UYXA 1JYVA 3IB3A 5IHRA 2J1TA 2YB7A 4QPWA 1O8SA 2W1SA 2ZXQA 4OUEA 3MV01 4GWIA 2WDBA 2JD9A 3OGRA 5IJRA 2C26A 2WO1A 3LPFA 5G05L 3W5NA 3I2JA 4XUTA 4ARYA 3WF0A 2J7MA 4TTGA 4XZUG 1L7RA 4UOJA 3VD9A 3WEZA 4CU8A 3EB7A 1OT5A 4KMQA 2J22A 5LCWL 5IYYA 3LQCA 4QX0A 1JHJA 1UY0A 1RYYA 4LQRA 3W5MA 3I3BA 3GDBA 5HPOA 2J1UA 2RVAA 4OMDA 2ZEWA 3BN6A 2Z4FA 3CKHA 1JZ5A 3OEAA 3DYOA 2X09A 4XURA 4P02B 4CU6A 4QB1A 3NNGA 5IFPA 1GQPA 4P08A 1US3A 2KD7A 1GOHA 3ACIA 3I2KA 1NKGA 2VOTA 5C7GA 3OG2A 1UXXX 1J83A 4AAXA 2PQSA 3T0AA 3VD3A 1W9WA 1PX3A 1OH4A 4MO3M 1UY4A 1UYZA 3A22A 2WUHA 5JMOA 1UX7A 5IFTA 4RYDA 3T2OA 2ORXA 2E33A 1DP0A 3MO4A 5A1AA 4GWJA 2WN3A 4XVHA 3P6BA 1J84A 1TVGA 2VZQA 2WZEA 4W8JA 3NQHA 1GOGA 3A7QA 2C4XA 3I2FA 4L0PA 2X05A 2J1SA 2V72A 2W1QA 1UYYA 5B4XA 1JI6A 3WNMA 3I97A 2EICA 2BGOA 2YC4A 3OEBA 3K77A 2L9LA 3C7HA 4AG4A 2QQJA 2JDAA 4HG6B 3WSOA 1IQDC 2W3JA 4PQQA 1JZ4A 2VM9A 5EJZB 3DYMA 3MV11 4XUNA 2WABA 1WKYA 3WF2A 4ZY9A 3HPNA 1CX1A 4QX3A 3WF3A 5CYYA 3I3EA 2BBAA 3CZUA 3A21A 3T2PA 2J1AA 3HN3A 1JYNA 3CZJA 1MPXA 3K4AA 1W0NA 3K75B 3LPGA 5JXGA 1JZ8A 1EUTA 3I2GA 3HJRA 4BJ0A 3HNMA 1D7PM 3SKVA 2B4KA 1KEXA 4MOAA 5DQ0A 4OYUA 1BHGA 2YG0A 4KI5M 2CDPA 4LKSA 1SHWB 4LHSA 1R64A 5EIYB 2W47A 4QDRA 1JU3A 1NAEA 4P5YA 3THCA 4A41A 4DUWA 2VZPA 4TXWA 2E31A 4D0QA 1JZ6A 4PF1A 4KWUA 4MGSA 3T0BA 5JR2A 5LA2A 2VQTA 2JE8A 1UZ0A 1F4HA 4A42A 1US2A 3BGAA 4P00B 3FN9A 4M4RA 2QBXA 3T08A 1W99A 2V4VA 5C71A 4BK5A 4QX2A 3ETPA 4M4PA 3UESA 2E32A 2J1VA 1HN1A 3CDZB 3HNBM 3T09A 4XUOA 2VZUA 4LPLA 3UNPA 3DYPA 3VD5A 3ACGA 2VZ3A 3HEIA 1UXZA 2VMFA 5FUIA 2EIBA 2YFUA 2VQUA 1O8PA 2ORZA 2JKXA 1LNSA 4MADA 3WF4A 1GUIA 3J7HA 4CU7A 2VCAA 1CZSA 2VCBA 3VD4A 1PMJX 2VZOA 4QB2A 3C7FA 3FHQA 1UY2A 3ECQA 5B4NA 2WYSA 1H6XA 4JKMA 1JYWA 2LW8A 1JYXA 3I3DA 2XONA 1UMIA 2VL4A 2Y6HA 1JU4A 1CZVA 1NX9A 1TG7A 5LA0A 2R7EB 1OD3A 2WAAA 3WNOA 2EIEA 3SKJE 5DPNA 4W50A 4GZ9A 4CUAA 2ZEXA 4IUGA 3VDBA 4XUQA 2Y6JA 2BGPA 4JKKA 2DCKA 4XUPA 3I2HA 2QQLA 1L7QA 2VZSA 4DXRA 1SDDB 1JZ2A 2VJXA 4ARXA 2XQXA 4Z2AA 5EJ1B 2VO5A 3GM8A 1DYOA 2J1RA 3LE0A 2VR4A 2W92A 2Y64A 1DLCA 3WNPA 1YQ2A 2WO2A 4BXSV 2BERA 3CIHA 2DCJA 3FL7A 4A44A 4YPJA 1NUKA 2W46A 3IDAA 2WQ8A 1T2XA 1GNYA 3T2QA 1XPWA 2CDOA 1KGYA 5JXIA 1K3IA 1H6YA 2VZVA 1WCQA 4JKLA 1XC6A 2VMDA 1O59A 2RJ2A 5C70A 3IAQA 2WZ8A 2VMCA 4MGQA 4A6OA 3CQOA 4CU9A 5HXMA 3K4ZA 3VDAA 1P8JA 3A23A 4W4ZA 1UWWA 2ID4A 2YC2A 1W9TA 2Y6KA 3WQBA 3SEEA 3OB8A 3C8XA 4A4AA 3CMGA 4CVUA 2W1WA 1K45A 2J1EA 1GMMA 2W1UA 4QDSA 1JZ3A 2B9VA 4RN5A 4E8DA 3OGSA 3AC0A 5DMYA 1W8OA 4CUCA 1GU3A 4QB6A 2W95A 4CUBA 2VC9A 3FHAA 3GGLA 3K4DA 3K46A 3T0DA 2Y6GA 2Y6LA 5JUVA 3IIIA 2VMEA 4DXTA 4DEQA 3LEGA 2QQIA 3VDCA 3OGVA
chains in the Genus database with same CATH superfamily
2DFBA 4XJWA 1ZA7A 3C7GA 2VBPA 2AYHA 1GANA 3VBFA 3PMEA 1ENRA 1MEC3 4AQ2A 1X8EA 3OPZA 1AX1A 5E88A 3HOBA 5JXHA 3LF7A 2YUEA 2ZGPA 5L7OC 1VMFA 3PVOA 3VBOB 1W8NA 3HNYM 5KXBA 3BOPA 4MYEA 5A3NA 5ABJB 3B94A 3VHRA 3ETQA 2ZKNA 4Y20A 5K8SA 3DPRA 4CCJA 3ZMNA 2VXRA 1PM4A 4LO7A 5H9QA 2W94A 3PLQA 3LA7A 1LTEA 3FZ3A 4GB32 1BLZA 2DUOA 4MV2A 2EIGA 5A1FA 5HCHA 1W3XA 3ZYFA 1WMDA 1ZZCA 2P17A 2C9KA 4LEJA 1LOFC 1RUOA 3M4FA 3VBOC 4IEOA 4CXYA 1XXNA 3CU7A 5ABJC 4IE7A 3O1SA 4XETA 1YO8A 4LKFA 5FP8A 5AC93 2PTMA 1ULOA 4CDWA 3ILFA 4M0NA 5SV5A 1H1AA 2D44A 1BVVA 3AJYA 4SLIA 1WD3A 5JCTA 3V0AA 5EFUA 4AEMA 3WNLA 1X33A 3ZYGA 3LEIA 4OFGA 1OXCA 1R092 1IS4A 5DZGA 5C8WA 5CFCB 4E8CA 3K2OA 4ZXEA 2BNNA 3O1RA 3GF6A 1R081 2DBIA 3ZOIA 4RL7A 3VV1A 4LR4A 1YCIA 4K7JA 4LBMA 3EO6A 3TWIA 5C3SA 3VBUC 4CEWA 5F7UA 2ZMLA 4CP1A 3F2ZA 2W9XA 5A7OA 3ZKYA 4CRQA 4TZDA 5F2SA 1F5JA 3ASIA 4QGLA 4N53A 1N3QA 5CFCC 3LOBA 2GP5A 4Q4V1 4BLJA 5C9AB 1XNKA 3CL1A 1EY2A 3CLPA 5IVBA 3IDCB 3ZM8A 3FLTA 5CZKA 3N9OA 2ZGQA 2WFF1 4Q8KA 3THDA 4I3PA 4QPIB 1KITA 4IEZA 3RWKX 1K42A 2VZTA 5LA1A 4ZZ5A 2ADEA 1OF4A 1PZ8A 1UMZA 3E5XA 2D6NA 4D6QA 3JBG2 5C9AC 5CNAA 1SLAA 2YU1A 5F6KA 2CGOA 4LBQB 3U11A 1S0CA 1REFA 4N9HA 1ENQA 1JTZX 2QKDA 1PGL2 3I59B 4YM3A 1NZCA 5LRRA 2RMU3 4KBBA 1AR82 1LOBA 4CCOA 4TLGA 1SFNA 1BZWA 1QEXA 4JTNA 1CIYA 4BISA 2N7GA 1XYNA 2W68A 3D0SA 2A6ZA 3WF1A 4XC9A 2MEV3 2R072 1H1MA 3AMMA 4HANA 3B3QE 4N7UA 5GLVA 5A6QA 2VMHA 3I4IA 4YW5A 1RHI3 4HK9A 4YWAA 1BYHA 3NV1A 4KU8A 2YGMA 3X29B 4NOTA 2AEYA 1N1TA 3LGRA 1UIJA 1MEC2 4QX8A 1NY71 3WLUA 1UYXA 4X6RB 3BIWE 2HEVF 3LSDA 1AZDA 2JDHA 1SLTA 4C1WA 5F5AA 4G4FA 4PCRA 4Y1UA 2KM2A 4IEVA 3UKTA 4QPWA 2W1SA 2ZXQA 1S2EA 4NUBA 3O7OA 2EAKA 4OUEA 4Y24A 5DAQA 5DG1A 1UOJA 3OGRA 4JHTA 3ATGA 1NYWA 5F6LB 5IJRA 5L73A 2ZMKA 1YNAA 2VVFA 5FZLA 3A0KA 1QQP3 4QGMA 4GXLA 2R32A 1LOEA 1XOYA 2PHFA 4XUTA 5DABA 3WG4A 4ZXKA 2IXKA 3IMMA 4URAA 4TTGA 4XZUG 2FDHA 4XDPA 3VD9A 4Q0QA 3WEZA 2DCZA 3AMPA 2Y0OA 5B2GB 2LROA 5FY7A 4CCDA 1VBD1 1AL23 1HIXA 1SMVA 5LCWL 1O3QA 4GALA 4AW7A 4LTAA 4AI1A 4COZA 1O4ZA 3UKNA 1S0IA 3LQCA 2RJLA 3ON7A 2AACA 3U0ZA 4E2GA 1FOD1 4RHV3 3RMYA 1NCQA 1N1SA 4FPYA 1APNA 1YLLA 1GWLA 1UY0A 4GA9A 4FFIA 2GU9A 3W5MA 1ZZ6A 2WKKA 4DB5A 4Z8BA 1S0BA 2RVAA 1W39A 1JZ5A 5DUXA 1Z0HA 3QBQA 2X09A 2D3RA 4QB1A 4LHKA 4CU6A 5IFPA 4HOOA 2D6OX 1M4WA 1NQJA 1GQPA 3PVNA 3KD4A 2W39A 3VKLA 1KRIA 1OQ1A 4Y1XA 2V09A 1CPNA 4I02A 1JXNA 1NCRB 1XBFA 1VBA1 2VOTA 3K3NA 2D3SA 2D93A 5C7GA 3SLIA 1V6JA 2YMZA 1X82A 3ILNA 4AEDB 3O14A 5FY4A 4CA9A 4Z07A 1JBCA 2HEYF 4HSJA 3AKQA 3N3HA 5GALA 1NT0A 3SH4A 5KWRA 2IZWA 2ZZJA 4XJUA 5FUPA 1PX3A 2A71A 4MGYE 5I0UA 3KV5A 3O0VA 4CDQA 2D6PA 5T55A 1UYZA 2JXAA 3LEMA 2XL7A 4HBNA 1W6OA 3AZXA 4AEDC 1AR71 2RMU2 3CBNA 4GJZA 3I2OA 1HB3A 5FXZA 2IVIB 3VBRA 4QKDA 2GC3A 5IFTA 1Q8OA 3T2OA 5IK8A 1W0OA 3VL8A 4ZONA 5FCCA 2VGDA 1H0BA 2E33A 3S7EA 4URTA 1IG3A 5FZMA 1GFF2 1ACCA 1S2BA 4BQ5A 4XVHA 2A6WA 2Z69A 5JPMB 1V6IA 2DURA 1E5RA 2D7FA 1RUI2 4W8JA 4YARA 5JDBA 1RHI2 2GN7A 3ZLIA 4AHYA 3T4HB 4YGEA 5KHGA 2OUJA 3A7QA 1RL3A 3WQ7A 5IT6A 3IDEA 1ONAA 3KF3A 1X36A 3PVBB 2J1SA 1QJU2 4YZ4A 3DEMA 4PJYA 3WDXA 2W1QA 1UYYA 2EA7A 2BU9A 4MGTA 1GWMA 2A3XA 4JC1A 3OY8A 4Q0SA 4XACA 3WNMA 4XJ9A 4AQSA 1FATA 4HVRA 2IFRA 3I8TA 2YC4A 3OEBA 1WBLA 3K77A 4YG3A 3KSCA 4HG6B 1N1VA 1TME1 1AL0G 1S2KA 1S0DA 1JW6A 5IVEA 2ATFA 2DVFA 1W8TA 2W3JA 4JGYB 2NPIA 1F31A 4K20A 2YPJA 1ASJ1 4N43A 4PIZA 1BMV2 5EJZB 5CADA 3POIA 4AVTA 2DUQA 4KG8A 5C3OA 2YGLA 4YW1A 4XBLA 4DY5A 5FXWA 4GQ7A 4CCLA 3UK9A 1D0HA 4UF0A 5FO8B 4QX3A 3VBSB 5BNNB 1HRI3 1D4M1 5FZ1A 3ZSEA 1AL22 3I3EA 3VZOA 4PLMA 4LUKA 4TYSA 1EAH3 2R062 2B46X 2XXZA 3POYA 4ISRA 3GALA 4LORA 5FYIA 5KBFA 3FHIB 2EALA 4RHV2 4OI0A 1RUG1 3MW2A 1WWYA 3POSA 5T5PA 1V9U3 5A6ZA 3B01A 3VBSC 2ZGMA 2WNUB 4G3YC 4CYDA 5BNNC 2AGSA 1MS5A 1AYM2 3CZJA 4AOCA 1MPXA 1Q8VA 1W0NA 3K4AA 3GJBA 2R043 1FMD3 3ES4A 1REEA 2RHPA 1NA1B 5IW0A 5JXGA 2WNOA 3A4UA 2HH9A 3HNMA 4Z2WA 1PO21 4XJZA 3WG3A 2RS52 1DZRA 3JU9A 3RGBA 1CAVB 2WNUC 1UD1A 4OYUA 5DQ0A 3TEYA 1PIV1 3RYRA 1LOCA 2QQPA 3PMSA 1ZA4A 1QJX1 1XNCA 1SHWB 4YZ3A 1XE7A 1OUSA 3ZR6A 1NA1C 4L9BA 1COV2 1CONA 1DU3D 4DXZA 5T5LA 2H6BA 2PELA 5FZ6A 4PF5A 1QF3A 4MGIE 5EWSA 4M00A 5GLWA 1TZOA 2BBVA 4XQ4A 3RYKA 1HKDA 3MIEA 5FJHA 4QXBA 1SLLA 4TXWA 3RVHA 4KWKA 2JECA 4NIHA 1RXFA 1W2OA 4HKWA 3ZKUA 1YYNA 3RNSA 5FUNA 1VAMA 2VQTA 2E6VA 4A3XA 5DZFA 5FYCA 2VOKA 3B7MA 4KNCA 4E4SA 5JLVA 4CXXA 2O0OA 2PAEA 1ULEA 1QJY3 2UY8A 3I54A 3MIBA 3UL2A 1RUD3 4D94A 2CYFA 4QQLA 1RVF1 4X8PA 4QKNA 1BKZA 3ETPA 4M4PA 3L9JT 4QX2A 4WVMA 2CSGA 2WS92 3VDDB 4NHYA 1HXS1 5A70A 3D6EA 2OVUA 1RIRA 1X50A 4HMZA 2J1VA 4YM0A 4NVPA 4MVTA 2FHRA 3HNBM 3SISA 3H7JA 1WMEA 3M70A 1EV11 2GC0A 4CDUA 4AXOA 1BK1A 1AR61 3AKPA 4S2DA 3VZLA 3ZYBA 5DUUA 3UJOA 3VDDC 2VMFA 2PHTA 2VNGA 4YFZA 2VE1A 3NNLA 2P6HA 1G8WA 2ORZA 3WF4A 1LNSA 1EP0A 5IVYA 4B7KA 3BALA 2CWMA 1G7YA 4YZ2A 5A3LA 2VCAA 3QH6A 1B35A 1QWRA 2C9AA 4LA2A 2XVLA 3IBMA 1E5IA 1HRI2 3FC0A 4K8RB 1Q43A 5ISLA 4CDXB 4M3CA 5CA6A 2RS13 4OZXA 3FMGA 1EAH2 2XUMA 1OBNA 1XYOA 4LO4B 3FHQA 1GQGA 3WW3A 3ZYRA 3INAA 3DKQA 1WD4A 3ILRA 3R6SA 2VVEA 1MS3A 4FOYA 5LB6A 3O12A 2WINB 2GDFA 4JKMA 5FYBA 5D21A 1UMIA 1JUIA 3V65A 4YFWA 1IKPA 4XABA 4CDXC 2B45X 3WY6A 5LA0A 3MIFA 4XPVA 2WT0A 2HWC2 2ZX3A 4FQ4A 4OI4A 3WP5A 3E97A 3TYJA 1W8HA 1HRV2 3WNOA 3U4XA 4Y1VA 1ENSA 2JG8B 2QUOA 4IUGA 4UW4A 3SCHA 4BA6A 4CEYA 4COUA 1OFSA 2Y6JA 5F3EA 3PVEA 2VY0A 3KHCA 1WCUA 1VMHA 2A1XA 3I2HA 2QQLA 2VZSA 4XFFA 4XYXA 3WDYA 2ZX1A 4XJ8A 2R6QA 2XQXA 5FP3A 2D40A 4Z2AA 2BYVE 2VO5A 4TWTA 3SH3A 2JG8C 4L92A 4YVSB 4ZU5A 4KU7A 2DF7A 2VR4A 3KV6A 1LGNA 4GH4A 3RMXA 1DLCA 3W20A 2RDNA 1ZZ8A 2P1BA 3OUHA 1UQXA 2EXIA 2JDMA 1UO9A 4XTMA 2Q8CA 2A3YA 5LRSA 2DCJA 3SC7X 3LA3A 1LCLA 5FY9A 4I0BA 1A3KA 4RS5A 3ZIWA 4GIQA 5JI9A 1T2XA 2WWJA 4XJAA 3SITA 5CKNA 1SFPA 3I2DA 4YVSC 4EYUA 2VW2A 1S1AA 3AK0A 2CDOA 1KGYA 3E6DA 4EV0A 5JXIA 5FXXA 4K9SA 4JKLA 3RYPA 1QJY2 3H9AA 1IQAA 2VMDA 4JCKA 1RUD2 2BRTA 4MGQA 5GZFA 5M0TA 4A6OA 4CU9A 3H3ZA 1DGRN 3A23A 4W4ZA 4XFAA 3PURA 1MS8A 1GV9A 4WZFA 1RUJ3 2ID4A 5FMOL 4BU2A 4AGGA 3PDQA 3KV9A 4MH0E 2Y6KA 4C8DA 5F2WA 4XZPA 3MIGA 3ZXAC 2IXCA 1LHNA 1ZBA2 1VRBA 1GMMA 1F2NA 4O7XA 4O9EA 4XFCA 5C5UA 3VB9A 5GLTA 1O91A 5EPAA 4HXCA 3W9AA 3AM2A 5I0SA 4OCTA 5FBJA 4DO0A 4B29A 5IATA 1U5XA 1OUXA 1SLBA 2W95A 2Y6FA 5F1RA 5GZGA 3MZHA 2EVXA 1DG6A 4R9CA 2FDKA 3JD71 5ANNA 5K0UB 3AYDA 1S4CA 2YBKA 3N7MA 4DNYA 2LM3A 3K46A 4OHXA 4Q29A 1SCRA 5FMCA 2RS12 4P9JA 1H8TA 1PK6B 2PHUA 1BBT1 4AFAA 3O5SA 3IIIA 1Z7S2 4BQ1A 4QM9A 3AZVA 4MXWB 1A34A 1RGSA 2VW0A 3AYAA 4DXTA 4HVQA 4I09A 3AB0A 3LEGA 2QQIA 5FZDA 3VDCA 1CAUB 3ZFGA 3FFQA 2PN5A 1UOFA 1AHSA 4ZS2A 5CB7A 1Y9MA 3E5QA 1PGW1 5FPAA 1PMHX 4FPOB 4Q4X1 3M3CA 2VUCA 4K40A 1PK6C 2CL2A 1E57A 3GZAA 3WDWA 1RUNA 1TMF3 4ASMB 5HV0A 2FBEA 1C4RA 3JB4C 1EUUA 4EZHA 5K9YA 5F3GA 5JXJA 2ZAAA 4Q4Y2 2E26A 1XNAA 2YY1A 3Q8AA 4XCBA 2VZ1A 3UETA 1ULPA 2A7AA 4CZSA 4R52A 2JDPA 4FPCA 1VBE3 4XF4A 2QTWB 2ZEYA 4QWNA 2P3JA 2AENA 2NYYA 3E1F1 1IPSA 4IV3A 3N9LA 1RTVA 4XEZA 1BK0A 3GZUC 4BMBA 5KXCA 1H4HA 2ZHNA 2V5DA 3AP9A 1Y9QA 5FZFA 4PDWB 4FAHA 4PQ9A 2W0XA 3WR0A 3J8F1 3U78A 4QHZA 5F9TA 4YZ1A 4CP9A 3P5BA 4ZPIA 3I3QA 3PUIA 2GMEA 1KJRA 2A75A 1VJ2A 1UY3A 4OMCA 4RQPA 3NJVA 4XILA 3GBGA 1R1A3 4KG0A 4NHLA 2P3KA 3VD7A 4QU2A 1WLTA 2ZA9A 3F95A 4GMP0 1CIWA 2QQNA 4YVWA 3O1TA 2JE9A 5FBZA 5A3OA 3T4VA 1D2SA 1RUE3 4PDWC 4YW6A 1VBC1 4HETA 1Q5OA 1DQ1A 4GMP3 3LDRA 1BJQA 1V6KA 5CAZA 2RE9A 1J3QA 3RFRA 3C2UA 3WNNA 3USSA 4XTPA 1KS4A 2ENRA 1NG0A 1KJLA 1GYKA 1K12A 4PT6A 4XBQA 3WW1A 5FP4A 1X8MA 4QQ2A 1VRH1 4D8MA 3W58A 1J1LA 2XJVA 1YI9A 4UXAA 3ZR5A 2B7YA 3Q8EA 3V64A 2QJVA 2RDRA 4U36A 4X8NA 1OLMA 1GOFA 4XAEA 5A3UA 1UMHA 4LBLA 1A6CA 4QU1A 4WZCA 1OMIA 4NIDA 5F39A 5CKMA 5T5OA 1RMU2 4NIIA 5D1IA 2HWF1 2RV9A 4AGRA 1SG3A 3JZVA 5FMDA 1HJFA 5AVPA 3TNPB 2UY9A 3V0BB 5BNOA 4OI2A 3ZDVA 2XHNA 3EHKA 1O3SA 3LKJA 3KZ4C 2GP3A 2Q1MA 3TN92 1GZWB 1MS9A 3U14A 2QQMA 2ZAHA 3ZSMA 1IPJA 1MEC1 1AX0A 1LAJA 1I5PA 4LULA 4M3CF 3WNKA 2BFUS 1JN2P 2VULA 4JX0A 4QD2A 4CP2A 4QPGA 1RC6A 1XNTA 3JXSA 3WVJA 2G9ZA 1CR7A 3H8UA 3PUHA 2UWAA 3VLBB 5LEJA 1F4AA 1VE0A 5FY8A 3MPBA 4LE3A 4O9GA 2YROA 4ITCA 4XHXA 3R05A 3POWA 3V56A 3IB3A 4HN0A 2J1TA 1ULFA 1QJZA 1PHMA 4PIYA 3U4SA 2JE7A 3R0RA 4YSFA 1S0JA 3OPWA 4QMAA 3MV01 2R30A 4LOTA 2JD9A 2X5IA 1VBE2 3AZZA 5CIRA 4DOUA 1VALA 4I0WB 5FZ3A 2EF6A 2B5HA 2C26A 1F5FA 5A7QA 4N9IA 1LOGA 2DYCA 5A7NA 4AVCA 4D6RA 4EJRA 3KMHA 1QJEA 5A7WB 2RS32 1CESA 1V00A 4JZRA 2WL1A 1AR83 2QCSB 4Q5OA 3MI8A 4OUMA 4XHBA 3ZYPA 5C4WB 1CD3G 2VVDA 4KBZA 1OT5A 1SBEA 4QPIA 4K21A 4EN0A 4KMQA 1WLWA 2WLQA 4LUMA 5LWBA 2R073 1W8UA 1R1A2 3BPZA 2BGCA 4NHKA 4FPLA 5IYYA 3RWNA 4E27A 2HWB1 3GBFA 4HZFA 5J36A 1G6NA 2BVBA 1JOBA 1FPN1 2J42A 3AMNA 1RUE2 4AHWA 3POGA 1YEWA 5C4WC 1C8M3 2JG9A 3M2MA 2O8OA 4PLNA 2J1UA 3NL1A 4OMDA 2ZEWA 4DZGA 2JENA 3HN1A 3MDPA 2P37A 3ZIXA 3NNGA 4IV1A 1D0GA 1QXPA 5T3NA 4D69A 4P08A 3DL3A 1OPMA 5LBBA 2HWE3 2V4AA 4AVAA 1PMIA 1O4YA 1JODA 3I2KA 2YHJA 1KXGA 2ARXA 5GLZA 1YFXA 4LBOA 1OSGA 2WO7A 3AJZA 5I8SA 4BH9A 1VBB3 4ATFA 1J83A 2ZPXA 4H3WA 3VBUB 4N8MA 1JYIA 5FR3A 2CAUA 4RFT0 1H2NA 2MEV1 3HMYA 1UW8A 3MF6A 2HWD1 2Q8OA 4NN0A 3ZO0B 1OKOA 5FO9B 2XVKA 4YLZA 5DUVA 3B69A 5LK5A 2ZX2A 2GNDA 1CX4A 1AR93 3N35A 3FFZA 4ONUA 4L11A 3SH5A 5JZGB 1ZYBA 2XL9A 3MO4A 4GWJA 2WN3A 1UZYA 3MLJA 2WWSA 1LECA 1J84A 5H9PA 3ZPOA 3GHMA 5IUQA 1LESA 1MQTA 3EXUA 5C3RA 2OPKA 3VUOA 2X05A 3I2FA 4L0PA 3LIHA 2G9FA 1W2NA 4MHRA 5JZGC 4C0BA 3I97A 3HT1A 1DZTA 1QQP1 3ZFEA 1M06G 1ZREA 2BWCA 5C8CA 2BGOA 5A7SA 2Q4SA 3NWKA 3VZMA 2L9LA 3L2HA 3BODA 5C5TA 3U75A 3TB0A 1POV0 4QHOA 5HBAA 3KT7A 2H0VA 2RM21 1W2UA 5JOWA 3R4UA 4Q4W1 5T50A 3ZXLA 5L36A 1BVP1 3N36A 1AL21 1AYN1 1WW4A 2EAAA 1POV3 2VM9A 5FZ4A 5A6XA 1JZ4A 4RGGA 2RJKA 4ORFA 4COVA 4XUNA 2WABA 1NCRA 5DAPA 4ZY9A 3HPNA 1CX1A 3WF3A 2GH8A 5KC5A 2EXHA 2DBNA 2BTVC 1PO11 2F17A 2B42B 4WM8A 1W28A 1DHKB 1GR3A 1HN0A 2BJSA 2HBTA 1JOJA 4H2AA 2BBAA 5BNPB 1ST8A 4MZUA 3WOGA 5C3PA 1UOBA 1RUI3 1G9DA 3USUA 3N7KA 1HV0A 4KWLA 1IOAA 2WFPA 3T2PA 3KV4A 1H30A 4JRLA 5EP9A 4MXVA 1QJU3 2WSUA 1JYNA 3KGLA 1QIQA 2TEPA 1C8M2 1CN1A 4QX5A 2XBO2 2GNBA 3Q9OA 5EJ3A 4O61A 2IWGB 1RJ8A 1GP6A 1LHOA 1IHMA 4WM7A 5BNPC 4XMIA 2WQZC 4Y20B 3VZJA 2ZGTA 3DPRB 3K75B 2XKPA 3EBRA 3KCCA 1N1YA 3LDKA 4QHBA 1EUTA 5FZ8A 1UYPA 1VAKA 2VTXJ 3Q8FA 4ASLA 2HWE2 5KHIA 3VBFC 4Y5SA 4AWDA 1PGSA 3J7MA 4IE6A 4MOAA 4AE2A 3AP4A 2AEZA 1AF9A 5C6CA 1CWPA 1BHGA 3KGZA 3ZXDA 1OKQA 2PLV2 1RUH1 2CDPA 4LKSA 1VBB2 4LHSA 2FZ1A 3DPRC 3E5UA 3SNMA 5FZHA 5EIYB 5DDJ2 2W47A 4NJ4A 1JU3A 2OUHA 4CDWB 1A78A 1NAEA 5FP9A 4L8QA 4N7IA 1FAYA 2WLPA 3V0AB 1WW7A 3VKOA 4Q4V3 4P5YA 2R063 1PVC2 4YW4A 3AVRA 2VZPA 1W0PA 3P3PA 4JGYA 4AL9A 4KWUA 3Q8BA 1GP4A 3O1PA 4Q8LA 4FP2A 3T0BA 1OLRA 5LA2A 3TEXA 1AR92 4FQZA 4B4PA 4CDWC 2JICA 1U0AA 1AYM3 1UZ0A 2JDNA 2TNFA 3VBSA 1LGCA 4HSLA 3WDUA 5I8YA 5JSPA 1UPSA 2VMGA 1QH7A 2PHRA 3CJIA 1JUHA 3H8OA 4M4RA 2QBXA 4O65A 5FPXA 5T52A 5F5CA 1ZBE2 2RS53 3ZMOA 3J7NA 4CEWC 3AL6A 2YXSA 4OUSA 4OULA 3CDZB 1ZVFA 2XVGA 4YNIA 3N9PA 1JYCA 4XUOA 2LALA 1LEDA 3RZJA 1W6PA 1COV3 4N53C 4XF1A 1VPHA 3UNPA 4NRMA 3DYPA 5HV4A 2NZ9A 4CPBA 2O1QA 2VZ3A 2O8QA 1UXZA 2UWBA 1LENA 5A3PA 1WBFA 1OURA 1QOOA 4H14A 1O8PA 4C90A 3OBTA 4RD7A 5FZOA 5LBFA 2JKXA 1ZZBA 3OGGA 2Y38A 4YW7A 3J7HA 5FQ0B 1SPPB 2NP0A 1WA4A 1V9U1 4D7YA 1DDLA 2QNKA 1H2LA 3RSJA 1QY4A 1V70A 1JOPA 4Y5Z0 4GAZA 1ND3B 1XSRA 4QQPA 4L97A 2CGNA 4UFKA 2R041 5JVVA 2WYSA 4W65A 5KHJA 1FMD1 2KA3A 3KT1A 4NRPA 4UW5A 3VKMA 1QGLA 2DVDA 4QXKA 1UF2C 2R0HA 3QACA 4LO8A 2WS93 4Q27A 2JJ6A 3I3DA 4NAOA 1JYWA 1JYXA 3NVCA 3PIGA 3MF9A 2XH6A 2FDGA 2YDEA 4JGZA 1ND3C 2E63A 3H42B 1OD3A 2QDNA 4BPZA 4OHZA 2EIEA 5DPNA 4XFHA 4XXAA 4GZ9A 3VHNA 3U10A 2QZ2A 4CUAA 4AI3A 1X9TA 4XUQA 1R082 1W6NB 1MS4A 4META 1GP5A 1JMUB 4XUPA 5FKBA 2WZPP 4PI2A 2ET7A 1SDDB 3EMRA 1MZFA 2QZ3A 5EJ1B 1YRZA 1W90A 5A6YA 4Q26A 1ZX5A 3GM8A 4QPYA 4F8AA 1DYOA 2QDRA 2W92A 2Y64A 3K51A 3WNPA 2OXBA 4Q4V2 2A6VA 3PL0A 1DQ6A 3H3LA 4YGBA 3CIHA 3GHNA 3MPPG 3FL7A 4B1MA 4B4RA 1RUD1 1UOGA 1NCQB 2WFF2 3ALQA 3IDAA 2A6YA 3LCPA 2QVSB 3OBRA 3KWVA 4MUVA 4ZU7A 1IS6A 1GNYA 3G7DA 1O5UA 4E4ZA 1JH5A 1XPWA 4YW2A 2VZVA 2HWC3 3KLSA 4BIFA 1ODNA 1HRV3 2A3WA 2RJ2A 1SQ4A 4UFHA 4FBFA 2OIIA 2WZ8A 3AP5A 1BEV1 5IVJA 1NCQC 1XE8A 3ZFFA 5HXMA 4LO6B 2PAMA 3J4UH 3OJBA 2FD8A 3S57A 3D8CA 2G19A 1UPIA 2BWAA 4AGVA 4EQVA 2YC2A 5JOXA 5LATA 2XJUA 3ME2A 4XBNA 3SEEA 4XDOA 1H8VA 3LSEA 3WQ1A 1QNYA 1X7NA 5IWFA 3CMGA 2XLGA 2W1WA 3B5LB 2J1EA 4LIUA 2RR11 4IE4A 5L9RA 2B9VA 2F4LA 4YGCA 5GZDA 4CDQB 1YQCA 5FZ7A 3ZXJA 1V6NA 3OGSA 1NY72 4FOQA 1I3HA 4NO4A 5FTTC 3WP6A 1W6OB 2WNVA 4OQ9A 4NIGA 3NAPA 1OLQA 3VBRB 5LW9A 4UWDA 4CUBA 5JI7A 1FV3A 2XHKA 4DPNA 4BQ2A 1OOPA 3GGLA 3K4DA 2EXKA 3LOIA 1TME3 1R1ZA 1C57A 2Y6GA 4CDQC 1ENXA 1HLCA 1PZ7A 5FYHA 2OQ7A 3RZGA 3ZN6A 1ASJ3 5F37A 2DTWA 1XU1A 2CAVA 3VBRC 3T08A 1SBDA 3DECA 5DN2A 1LU1A 2Z42A 5FZIA 5K7PA 4DUXA 3LB9A 1JHNA 4KH9A 4P14A 3OY8B 3IZOA 2W5FA 2XOMA 5G04L 4IDZA 1VBD2 2Y8KA 4C0HA 1KDMA 1V6LA 1STMA 2VW1A 4AFMA 3N7LA 2R1BA 4KQ7A 4FTEA 3MLKA 3NMBA 5IK4A 1OF3A 5DUWA 1ZBA3 1OH3A 4HONA 2XPJA 3SXWA 2VNOA 1CPMA 1DF0A 1FOD2 1YI7A 4QDQA 1RUG3 3JB8A 3P1IA 4ATEA 1QJFA 4N43B 2ZKLA 4FAGA 1MZEA 3ROUA 5F3CA 4UI9L 2D3PA 3O0XA 3S6PA 1TNRA 1YUDA 4FFHA 5IK5A 2DDUA 1U12A 3QOPA 2YV8A 3VN4A 3OPTA 4JHZA 1W6QB 2W87A 2G9GA 4QGNA 4LK6A 4I30A 3NJXA 5LBEA 1LOAA 2P2KA 2W91A 4B4QA 4XDQA 3IKWA 3LEKA 2DVGA 2Z5WA 1SACA 1Z7S3 4N43C 4NPRA 2VNVA 4IERA 2YZ4A 3WT3A 3DN7A 1SFYA 3EYPA 1PIV3 1W2AX 2HEWF 2HLEA 3ACHA 4LLFA 2WZR3 2XLFA 2XKOA 5FPVA 4AZZA 5FO7B 3C7OA 4FI9A 5FLHA 1VLNA 3DF0A 4NHXA 4AI2A 2ZCWA 4BM8A 3MLLA 4JQRA 3BB6A 3NKTA 2LUWA 4WVWA 2CGPA 2OS2A 2ZX4A 2LS6A 5KXDA 4JVAA 2Y60A 4EE2A 2VD7A 3DCQA 1XNDA 3HAGA 5CBLA 1W06A 1SLCA 5K0UA 2JIGA 4UYBA 1RUJ1 1LULA 5FPZA 3MUZ1 3UGGA 1Y4WA 3PUQA 3THPA 5BV6A 4Q4Y3 4AVVA 4A45A 1VR3A 1AR72 1W9FA 4ZZ8A 4MXWA 2ZGRA 5J3UA 3NRUA 1IS5A 1OD5A 2AREA 4M01A 1S0EA 4J1XA 3HBZA 5DAXA 1F9KA 1ODMA 2IXIA 4NROA 4U2AA 1JZ7A 2ZZQA 5I0DA 2R0FA 2ZEZA 4XMAA 2IC1A 3OD0A 3AYEA 2FCVA 2MNGA 1W9SA 4LE4A 4LITA 2FZ2A 1XJAA 3POJA 1ZRDA 3KQ4B 2VNRA 4IEUA 5AFEA 4QAWA 1CAXA 1RUC1 4CU8A 3IAPA 2QQKA 2X10A 2P6CA 1WCSA 4Y26A 4DMIA 1CJDA 2QQUA 2Y33A 2WBKA 4MHUA 4DS0A 2KR2A 2SLIA 3BTZA 3M8LA 1DBNA 3SHRA 4ISQA 1DQ5A 1FNYA 1LGBA 3AP7A 4OZOA 1HW5A 1DLLA 1TME2 4FT8A 3C7EA 3EJKA 4A3ZA 4AVSA 1W6MB 1ASJ2 2XJRA 3PNAA 1TMF1 1AJOA 3IM0A 3GZEA 5FIXA 4AI8A 5FY1A 4WVMB 5ANQA 3OBAA 2JEMA 1AXYA 1DCSA 2FMYA 5GLUA 3VBHA 3VHOA 2HYKA 4RR3A 4BDVB 1D4M2 3TEZA 4M0HA 1YIFA 4EN6B 4CUGA 5IHRA 1UZZA 5ACA1 2W2IA 5A32B 4LJHA 1IZ3A 4GWMA 4CDUB 5JWPA 5F5QA 3NJZA 4Y33A 1RUG2 1DIWA 4LK7A 4K1ZA 1W8WA 1RMU3 2VQAA 2PA7A 4QXHA 1OA4A 1VB2A 2BUKA 3BPSA 4R8HA 1C3HA 5E89A 3OYWB 4IEPA 4OHWA 4HKOA 5CFDA 3WF0A 5CKQA 1B35B 1TE1B 1L7RA 4UOJA 4CDUC 3H8RA 1LEMA 4Q2FA 4UT5A 4M3CB 4P5HA 3TN93 1FXZA 1PO22 5FRAA 5FLIA 2WNEA 3JQWA 4Y22A 5D8AA 4ZS3A 4AQ6A 3LIGA 4GULA 5A3WA 5FWJA 2J22A 4GMP1 1PIV2 4Q0UA 3KF5A 1DYPA 1H2MA 1IPKA 2WZR2 5FYZA 3THTA 2BPA2 1SDWA 4EZ4A 1QJX2 1KQRA 1CJPA 1LJ7A 4QX0A 1JHJA 4CCCA 4WBBA 4UW6A 1B35C 1OI6A 2ERFA 3POFA 3RG0A 1MVEA 2JWPA 3QCWA 5L9VA 3N4MA 1RYYA 3HQUA 5FV3A 3BTXA 3I3BA 2JB8A 3GDBA 4GB31 5L9BA 1V6OA 1VMJA 3S5QA 4E4HA 5BYNA 5HPOA 4AAPA 3GJAA 4J6GA 3DYOA 4XURA 1KD7A 3ZXEA 2BP6A 5FDBA 4LBNA 1K5MA 4F3JA 2AZ5A 4CEYB 3RZHA 3FE5A 2JX9A 1U5YA 2XWBB 1AXKA 2D6MA 2Q1ZB 4P9XA 1GWKA 2JDZA 2P3IA 3FLRA 2ZTNA 4A6SA 3TRSB 2W52A 2RS33 1R091 3O0WA 3OG2A 1K5JA 2C0ZA 4IEQA 3IPVA 4JTOA 1WMXA 4I2OA 4AAXA 1W8ZA 1XSQA 2GMMA 4GH4B 2WR9A 4QXCA 1RVF2 4CEYC 1KFUL 4AI0A 5GZCA 1W9WA 4PHZA 1HXS2 5JOYA 1OH4A 1CAWB 3KVAA 4MO3M 4E4DX 3KCXA 1UY4A 4RGAA 4H7LA 4HPKB 3PU8A 2ZGNA 2VOWA 2DUPA 4RS5B 4BXFA 3RRDA 4AR2A 4ES9A 1UIKA 5KHKA 4MG2A 5JMOA 3RJ2X 3S0MA 2WC2A 1EV12 3FWEA 5A7PA 1G9AA 4GH4C 4ZHNA 4XF0A 5CG9A 3BCWA 2BFUL 4FPKA 4GWNA 1JZ8A 5A1AA 1HV1A 3P6BA 1UU6A 2VZQA 1UU4A 3BOWA 2NN8A 4D3WA 5L7OA 5GM0A 2GNMA 4RS5C 3RPQA 1D2QA 3RDIA 2C4XA 3JD73 3ZYJB 5FZCA 2GNTA 4OQ8A 3JBG1 3AZYA 3K3OA 4YM1A 1EYBA 3JCIA 4NRQA 5B4XA 4AEJA 1A8DA 2EICA 1BBT3 2ZACA 5JIAA 1PGL1 4P9LA 4IEWA 1LOFA 2WWUA 3PUSA 3VBOA 1AR81 5KXEA 2CU5A 5ABJA 2H6CA 3ZYHA 1LR5A 2AC1A 4WV8A 1CGPA 2BQPA 1NLRA 4WVZA 2VBDA 3NNJA 3IN9A 4FPJA 4Q4X3 2R071 3E6CC 2DVBA 1YIPA 4Y5TA 3AL5A 1UL9A 3JQXA 4NE9A 1WKYA 4IE0A 5FMBA 3WF2A 1SBFA 3IMNA 5I0TA 1D4VB 4AHXA 5FY0A 4TSVA 1H8TB 4UBHA 3D0JA 3ACLA 3U1XA 2E7TA 2E53A 5FK7A 5HCAA 2ZABA 3VBUA 5FZ9A 3ZSLA 1GZCA 1NE6A 1WUVA 1RXGA 3FUQA 1H9WA 3HD8B 3JUUA 3ZFGB 3O1OA 3CZUA 3J7LA 3A21A 4EN7B 5LA9A 2J1AA 1DGWX 3HN3A 4AI9A 2ZGLA 1KFXL 3ZN4A 3MIDA 5CFCA 5I91A 3H8XA 1W04A 1LKNA 1CVNA 1H8TC 2D98A 3LFIA 4H55A 4KL1A 4XXPA 2YPDA 3J8F3 4B7EA 4EN8B 2MHFA 5AFBA 1UNBA 2GALA 2GH2A 3FBYA 4CPBD 4COYA 2H0BA 2RDQA 3ZFGC 2XDVA 5CG8A 2O14A 2ARCA 3I2GA 3HJRA 4FPFA 2PHXA 2E7QA 1DGWA 3BUCA 3SKVA 2B4KA 1XE0A 3WHUA 1KEXA 4W6YA 4IV3B 3GCWA 1VBC3 5C9AA 2UYAA 4V2WA 1HJGA 2YG0A 3NKGA 1H9PA 3NW4A 2OZJA 4KI5M 3ZYIB 4EN9B 4IQPA 2OA2A 1R64A 5KC6A 5EV7A 1DGLA 4RQPB 1DGRA 1I5ZA 5JPNB 4IV3C 1UU5A 1WW5A 1MZ6A 4RSUA 2GZWA 5H9SA 5DZEA 1TNFA 4D0QA 4DUWA 1QKQA 5J98B 3NNFA 4ZKTB 2V5YA 4FTBA 2D43A 3LZZA 4LBQA 3PHMA 4JDMA 4Y4RA 1Y43B 3I59A 4MGSA 5JR2A 2DU0A 2XBO3 3VHPA 1YC61 5FPBA 1W03A 4A42A 4GKYA 4RQPC 1Y3TA 1Q3EA 4PI0A 5A80A 2HWF3 4XF9A 1NOVA 3KQRA 3WW4A 2C24A 1QDCA 4YVWC 5LY2A 1WW6A 1W99A 5C71A 1J3RA 4LT5A 2ADDA 1ULCA 3JD72 4BK5A 4DFSA 2HBUA 4BQ4A 4CP0A 1OPOA 2JDYA 4K8FA 3MW3A 4OHYA 2QQWA 1BBT2 4LMFA 2PLV3 4CE8A 1POV1 4A7ZA 5JOZA 5DAVA 2ZS6B 2RMU1 4XIOA 4EWEA 1F15A 2VZUA 5DDJ3 1NXD1 5FXVA 2F6BA 4LPLA 1RUF3 3WW2A 1MS0A 3VD5A 3GYDA 2XJQA 4E9KA 1Q8QA 2JDKA 1PGW2 3M1HA 3NJYA 1PVC3 5FUIA 4Q4X2 2B9UA 1PVXA 2YFUA 2JD4A 2Q30A 5BNOB 4M3CE 1RUI1 4IE5A 1RHI1 4MADA 1OQEA 1GUIA 3T3YA 3B93A 3TAYA 3ZSKA 2VCBA 1QJU1 4IGOA 1PMJX 2VZOA 3KB5A 3CHXA 2NM1A 5A33B 4N90A 2K2SA 5APAA 1W3VA 2D6KA 1UY2A 4XFIA 4FPGA 4QPGB 5FYVA 5BNOC 4B8EA 1ND2B 2LRPA 4XW3A 1ZBE3 3H1YA 5E16A 1GKBA 2ZHMA 4CCMA 2F4PA 2ZGKA 2LW8A 3WHTA 5K4LA 2I07B 2D6LX 3MYXA 2ZGOA 3J8F2 5FYYA 4BZ4A 3DGTA 4W6WA 1BMV1 1TG7A 4EWDA 4BYYA 4Q0PA 1TQ5A 2Q8EA 3DXUA 4Q1PA 2HWB3 4QPGC 4W50A 2X5IB 3R4SA 1ND2C 2IUWA 1G9CA 3DUIA 3PTYA 5A1LA 2ZEXA 1FPN3 4S2GA 4R9BA 1BCXA 2CV6A 1YFYA 5IVCA 3BTYA 2BGPA 1ZRIA 2WT1A 4JKKA 2WRAA 1HX6A 1VBC2 2XUEA 3TBDA 3NV4A 1TEIA 4HN1A 5GJ6A 2R061 1JZ2A 2VJXA 1IGOA 1H4GA 3H1WA 2X8KA 4RHV1 4AF9A 4JRAA 4UFJA 4AEDA 3UJQA 3UGHA 4IEXA 2X5IC 3WQ0A 2J1RA 3LE0A 1GNZA 3S7IA 3KHBA 1H1IA 3B9IA 4AVBA 1VRH2 1AYM1 3FJSA 5I0RA 2WO2A 2P4EA 4RA0A 2BNOA 1ALYA 1O3RA 3BU7A 1VP6A 5BXXA 3T1MA 2Q8DA 3VBFB 4A44A 1NUKA 2W46A 4S2HA 2NMNA 1LHWA 1C5IA 3AKRA 1FX5A 2JG9B 4R9AA 4LO5B 1UCXA 3VZKA 2RS51 3T2QA 4QPIC 4LOSA 1UZWA 1QNWA 4QM8A 1RJ7A 5FQ0A 1SPPA 5J37A 1H6YA 3QLQA 3RS6A 4IV1B 3UYJA 2HWF2 4LHLA 4V2VA 5C70A 1ND3A 4LBJA 3OCPA 4LKEA 2HWD3 1COV1 3E6BA 1R083 2VOVA 3SCGA 3VDAA 1P8JA 2JG9C 2P3YA 2VBBA 4LBKA 4BLIA 4HK8A 5DXDA 3ZPYA 4HKLA 3K48A 3LWCA 1VB4A 1LU2A 2ZGUA 4K3UA 2NMOA 1W9TA 5A3MA 1E5SA 1BXHA 4IV1C 1ZZ7A 4BHPA 2G4IA 5I8TA 3M3EA 4D7TA 1HB4A 2XJPA 3B00A 1RUF2 4A4AA 2QFEA 4BQ3A 1K45A 1KS5A 4QDSA 1W2TA 4AFBA 3OTFA 4F7ZA 4FPHA 4RN5A 2VMIA 1QMJA 2R49A 3AC0A 3LAGA 1G9BA 5DMYA 1W8OA 2GN3A 5F32A 5IK7A 2I2SA 1W6NA 2LTNA 2XG3A 1NE4A 5FWEA 2WFF3 4XOGA 4CUCA 1GU3A 3CEWA 4CEWB 2XJSA 4NHMA 5JMCA 2PHWA 3N7JA 2WS91 4OHVA 3FHAA 1OVSA 2ZGSA 1G86A 5CU1A 5AC92 4AEKA 4E2SA 5BNNA 1QDOA 2RM23 4Q4W3 1UAIA 4PBOA 1MQTB 4N53B 4JQTA 1OHFA 1AYN3 3VKFC 4MSVA 1SEFA 5FOBB 3OGVA 3FUOA 2I74A 1W9YA 4D6SA 3WINE 4DUVA 1JYTA 2ZX0A 1DQ0A 1ZRFA 3RZZA 2VZRA 3PTRB 1YQ5A 1L7LA 1FNZA 2WQ4A 1FI2A 4P9WA 4UAPA 2JKBA 4BK4A 1PO13 2WNUA 3ZFEB 2WT2A 1J59A 3MBWA 5FZAA 1N3PA 4DXSA 3AZWA 5C8CB 3I3MA 1MQTC 1UY1A 2HWB2 4IXLA 1Y9GA 3ACFA 5HXVA 3ABZA 1FPN2 4GKXA 1HRI1 1NA1A 2VH9A 3MW4A 4CCNA 4FVVA 5F3IA 3MUY1 1PNGA 1PX4A 1EAH1 2B39A 2VTXA 3ENRA 3LDBA 3MEPA 3WUCA 1CAVA 4KWJA 3ZFEC 1GQHA 3D4KA 5C8CC 5FK8A 1DQ4A 3D3AA 2ARBA 5KHHA 1IS3A 4UBGA 2VCCA 4WM8B 4CSWA 5FZKA 3RZLA 4HLTA 4EWAA 1URXA 2AH2A 1AUYA 4LHNA 5FJKA 4IGPA 5T54A 3USUB 5LEKA 1YHFA 2BZDA 2HWC1 5J09A 2OW4A 3PIJA 4I3GA 1NXMA 2OX0A 4NAMA 1HRV1 1XYPA 1NCRC 2WN2A 2FDJA 3SEPA 4Y4YA 1RUH3 5IAXA 3CO2A 1HQNA 4LXLA 5SV8A 4C91A 4DEVA 4WM8C 5FZGA 1GZ9A 1L3JA 5DG2A 3WX5A 1VBD3 4WM7B 4XFBA 2VTFA 3OSDA 2EIDA 3PU3A 5HCFA 2PYTA 5E6HA 3WV6A 1AVBA 2MEV2 3J26N 2QQOA 2WO3A 1FOD3 1LHVA 1V6MA 2HWD2 3HT2A 3GXUA 4ES8A 1YQ8A 3HR9A 4Q0VA 4BE3A 3WD5A 1OLME 5TSWA 3OUJA 3BTAA 3NV2A 2OKXA 4Z1VA 2IVJA 2HJIA 5BY5A 2A6XA 2XWJB 3VDDA 5IVVA 4WM7C 3U37A 4AK3A 1E5HA 3I2IA 3ZSJA 4AYUA 4ET7A 5FYSA 3RJRA 3WNXA 4BB3A 2ZBJA 1MR5A 3NSTA 2CWSA 1I6XA 2YFZA 2A73B 1C28A 5FKCA 4CCKA 1VBA3 4R4XA 1QJY1 2BOJA 2B8MA 3AP6A 1QQP2 2XR4A 4HVOA 4Y1ZA 3VL9A 3I7DA 3ZXFA 5EYYA 4QX1A 2FMDA 2Y26A 3J9SA 1W6QA 2RM22 2PHLA 4LKDA 3H50A 3MICA 4Q4W2 3PUAA 4RFRB 1JS9A 4CDXA 4FXGB 1ULDA 3CJIB 1AYN2 1FV2A 3SCFA 1UKGA 1EPWA 4JGYC 3T2TA 1AR73 1U5ZA 3M7AA 3IDBB 1ZBA1 1CZTA 2WAOA 5J1XA 5FPUA 2JIJA 3PJYA 2A70A 1XQNA 4INDA 2E51A 4FXKB 3MFCA 3KCYA 2HYXA 1PO12 2C6SA 2FCUA 2YBSA 3D5OA 5AC91 2WA3A 1RITA 2CY6A 1JYVA 4EROA 2WJSA 1W6PB 2DTYA 4UFMA 3CJIC 5IAVA 5T5JA 1RINA 3D82A 3WCSA 3HQRA 2YB7A 3LFMA 1O8SA 2Q1FA 1NLQA 2PQQA 5HI0A 3O1MA 4GWIA 2JG8A 1OA2A 2WDBA 3AYCA 1C8NA 2ETEA 2YC0A 4BCUA 2UYBA 2RS11 3B9CA 4W6XA 1DZQA 1S0FA 3SMHA 1WA6X 2WO1A 1Z7S1 5EYXA 5FZOB 1RB8G 4BQXA 3LPFA 5G05L 3W5NA 3CNAA 1YFUA 3EQEA 3I2JA 2WZR1 5AVAA 4ARYA 1T6BX 2J7MA 2EXJA 2VXJA 4FCAA 1Y7BA 1O3TA 3EB7A 5J48A 4YVSA 2RG4A 5FOJB 5FAXA 4YG0A 3ES1A 2BVVA 3ST7A 1RUH2 5FP7A 3NV3A 4Q4Y1 5EHDA 4NWVA 4QT6A 2D97A 3MFAA 3ELNA 4JGZB 4LQRA 2DCTA 1D4M3 1NZIA 1WCKA 3A0NA 4LIVA 4QQOA 4NPMA 1VAVA 3BN6A 3CKHA 1J1TA 2Z4FA 4FFFA 5FPLA 3OEAA 4K1YA 3RQ0A 3W59A 4P02B 3BKZA 4BWOA 3WZ1A 1SLIA 4XQDA 1W6MA 2C1FA 1US3A 2KD7A 1C5HA 2G1MA 3GNEA 1GOHA 2IFWA 2XB6C 3ACIA 3HQXA 4JGZC 2IXJA 3T30A 1WCDJ 1NKGA 3O1UA 1F8VA 1UKRA 1GSLA 4UF0B 4FOVA 2BNMA 2BOIA 1MZ5A 1UXXX 1CQ9A 1PO23 2PQSA 4E2QA 1BEV3 5E1RA 3T0AA 1LB2A 3GCXA 3RZMA 2JDUA 5LBCA 3VD3A 5A32A 2JB4A 1MS1A 2QQVA 1VBA2 5CEHA 2OYZA 1I1EA 4PLOA 3AX4A 3POBA 1NLSA 3A22A 1QJX3 2WUHA 2NQYA 4R4ZA 3S30A 5HCBA 3RI8A 5JAXA 3OYWA 5F5IA 4FFGA 4OI1A 1UX7A 1QOTA 2DFCA 4RYDA 1NQDA 2VCMA 2D5FA 2ORXA 1N47A 2RR13 4B3NA 1DP0A 2PFWA 4I0AA 1PK6A 1TVGA 4Y1YA 1OFNA 2PAKA 2WZEA 4XCAA 3WG2A 3N9MA 4BMEA 4Z82A 3NQHA 5EXOA 3POEA 3ZFFB 4BQYA 4H7MA 4AFDA 2SBAA 1GOGA 3KVBA 5E8AA 4PIXA 1CAUA 1Q8PA 4KGGA 1HB2A 1V9U2 2ZHKA 3RZKA 1RMU1 2V72A 2BDRA 3M3OA 4DQAA 1KDKA 2AUYA 3AXDA 5GZEA 1JI6A 3IWZA 4KGQA 1GICA 1UN1A 4FOWA 3HIFA 5L19A 1ZRRA 1YFWA 2E9QA 2DCYA 1ULGA 1PNFA 2R042 3R4DB 1FMD2 1RVF3 1YWKA 3ZFFC 5LK7B 3C7HA 4AG4A 3AXEA 4A7KA 4F83A 2QQJA 2ES3A 2JDAA 4LA3A 3TN91 3UGFA 1HB1A 4X6QB 3UKVA 1EPZA 3WSOA 1HXS3 1IQDC 3WUDA 2XLAA 4LBQD 2YU2A 4FO9A 4XQWA 2WNVB 3DKWA 3ZXGA 5BNQA 3NAPB 2IXLA 4PQQA 5D2AA 5LY1A 3DYMA 2ZOEB 3S5AA 3MV11 1V0AA 4GJYA 1EV13 1OOPB 4DY3A 1AR63 1YXWA 4AFCA 4AHZA 1SZBA 2VOXA 4PDWA 3C3VA 5CYYA 2X29A 3U07A 3ZN6B 2WNVC 4NWWA 4ASKA 2CTVA 3NAPC 3CJXA 2UURA 1XRUA 3N9NA 5FZBA 1CAWA 3M3QA 1Q8SA 3IIAA 1XB9A 4HPKA 1C1FA 1OOPC 1OVPA 1VBE1 2WYFA 3AKTA 1UX6A 3PJQA 4XE9A 3ZDSA 3OF1A 3O1VA 1GLHA 5BPXA 3ZX7A 5KR7A 1QH6A 1X9PA 1GNHA 2VAUA 4BOWA 4QKFA 3BVCA 2RS31 4FP3A 2VQ0A 2R1DA 3LPGA 4BJ0A 4JDNA 3AKSA 1O5LA 1D7PM 4BQWA 2OT7A 1A8MA 5I93A 4MGKE 1HQWA 1IG0A 2AR6A 2R16A 1R1A1 5C33A 5FYTA 4YGDA 4AQTA 1QXRA 5FZ0A 2A5ZA 5FFOC 1YJLA 2NLRA 4A7YA 1BEV2 1FYUA 4COWA 1RUE1 1AXZA 4QDRA 4DINB 4JAAA 4L2NA 4TLFA 1WZXA 1AJKA 2TBVA 1WLDA 4ZU4A 4QKBA 4D7SA 3THCA 4RGKA 2XMLA 3BYWA 1VIWB 1GBGA 4A41A 4NIAA 2K46A 3AVSA 2E31A 3WDVA 1JZ6A 3OBZA 4PF1A 4XIKA 4YYOA 5JSOA 1REDA 3ZVXA 3WP3A 4JV4A 3LA2A 3V0BA 1IKQA 2GSYA 3HWJA 3FBMA 3OD4A 4QX7A 3URFA 2RR12 2JE8A 4IGQA 1F4HA 1RUC3 2W08A 2XJTA 1US2A 1GZWA 5FLJA 3DXTA 3BGAA 4P00B 3FN9A 5GKAC 3BI3A 3GBWA 2I45A 2V4VA 2K0GA 4NR1A 1YJKA 4FSJA 1ZZ9A 3TNQA 2VUAA 4TN7A 1WLCA 1W05A 3SQOA 2DWRA 3UESA 5K0UC 2E32A 2PMWB 4WVVA 5CISA 2WIIB 1HN1A 4XAAA 4IL7A 3T09A 1F35A 1QHDA 2Y0IA 3KM5A 3G6JB 3WP4A 2Q0AA 5FMOS 1CAXB 1XU2A 1YQ6A 5C3QA 3MGUA 4L99A 3ACGA 3HEIA 2ZHLA 3MIHA 5H9RA 4YZ5A 1MACA 3VKNA 2CHHA 2EIBA 4YM2A 4CCEA 2VQUA 3H3UA 3HVDA 1OA3A 5LZ6A 3KS7A 3AFGA 3TOJA 2Z2SB 3KT4A 5A7WA 1CZSA 4CU7A 1MVQA 5ACA3 1AR62 1PM7A 3L2YA 1FT9A 1BQPA 3DV8A 3VD4A 5DAWA 1ZNPA 4QB2A 5C4WA 3ZN5A 3C7FA 4G9SB 2PXJA 4PBPA 5CVRA 4OVEA 2VU9A 2VECA 2BV4A 3ORJA 1PZ9A 3ECQA 5B4NA 2KXLA 4GD4A 3ITQA 2WSVA 1HDKA 2UWCA 1H6XA 3VBHB 1QXJA 2GC2A 4RR3B 4SBVA 2XONA 2VL4A 2Y6HA 4R9DA 1JU4A 2ZJCA 3UV9A 1CZVA 1NX9A 2QE3A 2E7AA 4NPLA 2R7EB 4YW3A 3Q8CA 4I01A 3IT8A 1DYKA 2WAAA 5JIUA 2BW8A 2C5DA 4P9GA 2ARAA 4S2FA 3SKJE 3WDTA 1XNBA 3ZXKA 4Z92B 3VDBA 2ILMA 3VBHC 3BU0A 4HFSA 3UT0A 1QU0A 4RR3C 2DCKA 2GMPA 4GB33 2VG9A 1WGPA 4DXRA 1L7QA 5CFDB 1RUJ2 1B09A 4ARXA 4DRVA 4YRDA 3NNMA 5J7MA 2YYOA 2GC1A 4Y22B 5D8AB 4FTSA 1C1LA 4P9IA 3LD8A 5ERLA 3VZNA 1C8M1 3WXPA 1UZVA 2XBO1 4OLLA 1LHUA 2HKXA 3B02A 4QQHA 5FY5A 1YQ2A 1T6GC 4IETA 3OGJA 2Y34A 3OUIA 4P9YA 3FX3A 5F8PA 1WMFA 5CFDC 4BXSV 1HQLA 2BERA 2FQPA 2VUDA 3NO8A 2DV9A 1QOSA 3GZTB 2OZ6A 1R093 3AMQA 4YPJA 2DVAA 4DRRA 2GAUA 4FPEA 4LLOA 2HWE1 2WQ8A 5IVFA 1ZM1A 2UU8A 3OOXA 1LRHA 1S55A 4YG6A 1O4TA 1AX2A 5D8AC 5FREA 4MGZE 1OC1A 1J58A 1I9RA 3TEWA 1SCSA 3N9QA 1J3PA 1RUC2 4UFIA 3VGIA 1DQ2A 1K3IA 5FYMA 1WCQA 4XFGA 1XC6A 5JZGA 2VUJA 1K5MB 1O59A 2PLV1 2D5HA 1VBB1 4HL0A 3MHZA 3IAQA 2VMCA 3AFKA 5A33A 4Q1RA 5DDJ1 5J96B 3CQOA 2X53S 1LODA 3WCRA 1O7FA 1RUF1 2P34A 1U5IA 3H7YA 1S0GA 3K4ZA 4IEYA 5FYUA 4V1PA 3QH7A 2FDIA 1GZTA 1ND2A 2WA4A 2XQRA 5JR7B 1UWWA 4MX3A 3HBKA 3CF6E 4K6BA 1PVC1 4XF3A 1OQDA 4A2UA 4J1WA 1Q56A 2MPFA 3APBA 4IESA 3IPVB 5FZEA 3T1LA 2FDFA 3WQBA 4IW3A 2FCTA 3OB8A 1K5MC 3H0OA 1TMF2 3C8XA 4JDOA 4UW3A 3P3NA 3W21A 4CP9B 4CTEA 4CVUA 1ZRCA 1AR91 2Z79A 2OPWA 2W1UA 1N3OA 1JZ3A 2ZMNA 3I49A 1VRH3 5JSRA 2BEOA 3RI9A 2PHDA 3JBG3 2K9ZA 4Y3OA 3BIEA 4E8DA 4BIOA 5BUVA 4HT1T 3AMHA 4YVWB 5LASA 4DIQA 4J25A 2TUNA 4NMIA 2CNAA 4QB6A 5ACA2 2VC9A 1Z78A 2ET1A 1ZBE1 2Q5TA 1DFQA 2XGXA 3FLPA 2VPVA 1G9FA 4CXWA 3T0DA 2DU1A 3QD6A 1O6UA 2RDSA 2Y6LA 5A3TA 5JUVA 2VMEA 5EQUA 3M3IA 1H2KA 2IXHA 3WG1A 4LNVA 4B1LA 5L7OB 4C1XA 1W8FA 2V73A 2OQ6A 2YBPA 4DEQA 5BNPA 1POQA 4MLOA 4UFLA 5EZWA 3H1MA 2P5BA
chains in the Genus database with same CATH topology
3DECA 5DN2A 4DUVA 3C7GA 4DUXA 2VZRA 1PMHX 4UAPA 2W5FA 2XOMA 5G04L 4BK4A 5JXHA 2Y8KA 3HOBA 3MBWA 4DXSA 1W8NA 1UY1A 1EUUA 3HNYM 1OF3A 5JXJA 3ACFA 2E26A 1XNAA 3ABZA 4QDQA 3UETA 2VZ1A 1ULPA 3P1IA 2W94A 3MUY1 1PX4A 2ZEYA 4UI9L 3E1F1 2DDUA 2C9KA 4JHZA 3D3AA 2V5DA 2W87A 2VCCA 3NJXA 2W91A 3LEKA 1ULOA 3PUIA 4OMCA 3EYPA 2BZDA 1UY3A 3WNLA 3ACHA 2HLEA 3NJVA 3LEIA 3VD7A 3SEPA 2WN2A 3C7OA 4FI9A 2QQNA 4E8CA 4ZXEA 4DEVA 2LS6A 5F7UA 2VTFA 3F2ZA 2EIDA 2W9XA 3MUZ1 3WNNA 2QQOA 2WO3A 4A45A 3GXUA 4ZZ8A 3NRUA 1K12A 4PT6A 1JZ7A 2OKXA 5I0DA 4D8MA 2ZEZA 3U37A 3ZM8A 3I2IA 5CZKA 4ET7A 1W9SA 3THDA 1GOFA 1UMHA 1K42A 2VZTA 5LA1A 4ZZ5A 1OF4A 2YFZA 4QAWA 3IAPA 2QQKA 2X10A 2RV9A 2WBKA 1SG3A 2XHNA 4QX1A 4OZOA 2QQMA 3C7EA 1CIYA 4A3ZA 1I5PA 3WF1A 3WNKA 4JX0A 1CZTA 2WAOA 1XNTA 3OBAA 5J1XA 3JXSA 3PUHA 1F4AA 2HYXA 4BDVB 1UYXA 1JYVA 3IB3A 5IHRA 2J1TA 2YB7A 4QPWA 1O8SA 2W1SA 2ZXQA 4OUEA 3MV01 4GWIA 2WDBA 2JD9A 3OGRA 5IJRA 2C26A 2WO1A 3LPFA 5G05L 3W5NA 3I2JA 4XUTA 4ARYA 3WF0A 2J7MA 4TTGA 4XZUG 1L7RA 4UOJA 3VD9A 3WEZA 4CU8A 3EB7A 1OT5A 4KMQA 2J22A 5LCWL 5IYYA 3LQCA 4QX0A 1JHJA 1UY0A 1RYYA 4LQRA 3W5MA 3I3BA 3GDBA 5HPOA 2J1UA 2RVAA 4OMDA 2ZEWA 3BN6A 2Z4FA 3CKHA 1JZ5A 3OEAA 3DYOA 2X09A 4XURA 4P02B 4CU6A 4QB1A 3NNGA 5IFPA 1GQPA 4P08A 1US3A 2KD7A 1GOHA 3ACIA 3I2KA 1NKGA 2VOTA 5C7GA 3OG2A 1UXXX 1J83A 4AAXA 2PQSA 3T0AA 3VD3A 1W9WA 1PX3A 1OH4A 4MO3M 1UY4A 1UYZA 3A22A 2WUHA 5JMOA 1UX7A 5IFTA 4RYDA 3T2OA 2ORXA 2E33A 1DP0A 3MO4A 5A1AA 4GWJA 2WN3A 4XVHA 3P6BA 1J84A 1TVGA 2VZQA 2WZEA 4W8JA 3NQHA 1GOGA 3A7QA 2C4XA 3I2FA 4L0PA 2X05A 2J1SA 2V72A 2W1QA 1UYYA 5B4XA 1JI6A 3WNMA 3I97A 2EICA 2BGOA 2YC4A 3OEBA 3K77A 2L9LA 3C7HA 4AG4A 2QQJA 2JDAA 4HG6B 3WSOA 1IQDC 2W3JA 4PQQA 1JZ4A 2VM9A 5EJZB 3DYMA 3MV11 4XUNA 2WABA 1WKYA 3WF2A 4ZY9A 3HPNA 1CX1A 4QX3A 3WF3A 5CYYA 3I3EA 2BBAA 3CZUA 3A21A 3T2PA 2J1AA 3HN3A 1JYNA 3CZJA 1MPXA 3K4AA 1W0NA 3K75B 3LPGA 5JXGA 1JZ8A 1EUTA 3I2GA 3HJRA 4BJ0A 3HNMA 1D7PM 3SKVA 2B4KA 1KEXA 4MOAA 5DQ0A 4OYUA 1BHGA 2YG0A 4KI5M 2CDPA 4LKSA 1SHWB 4LHSA 1R64A 5EIYB 2W47A 4QDRA 1JU3A 1NAEA 4P5YA 3THCA 4A41A 4DUWA 2VZPA 4TXWA 2E31A 4D0QA 1JZ6A 4PF1A 4KWUA 4MGSA 3T0BA 5JR2A 5LA2A 2VQTA 2JE8A 1UZ0A 1F4HA 4A42A 1US2A 3BGAA 4P00B 3FN9A 4M4RA 2QBXA 3T08A 1W99A 2V4VA 5C71A 4BK5A 4QX2A 3ETPA 4M4PA 3UESA 2E32A 2J1VA 1HN1A 3CDZB 3HNBM 3T09A 4XUOA 2VZUA 4LPLA 3UNPA 3DYPA 3VD5A 3ACGA 2VZ3A 3HEIA 1UXZA 2VMFA 5FUIA 2EIBA 2YFUA 2VQUA 1O8PA 2ORZA 2JKXA 1LNSA 4MADA 3WF4A 1GUIA 3J7HA 4CU7A 2VCAA 1CZSA 2VCBA 3VD4A 1PMJX 2VZOA 4QB2A 3C7FA 3FHQA 1UY2A 3ECQA 5B4NA 2WYSA 1H6XA 4JKMA 1JYWA 2LW8A 1JYXA 3I3DA 2XONA 1UMIA 2VL4A 2Y6HA 1JU4A 1CZVA 1NX9A 1TG7A 5LA0A 2R7EB 1OD3A 2WAAA 3WNOA 2EIEA 3SKJE 5DPNA 4W50A 4GZ9A 4CUAA 2ZEXA 4IUGA 3VDBA 4XUQA 2Y6JA 2BGPA 4JKKA 2DCKA 4XUPA 3I2HA 2QQLA 1L7QA 2VZSA 4DXRA 1SDDB 1JZ2A 2VJXA 4ARXA 2XQXA 4Z2AA 5EJ1B 2VO5A 3GM8A 1DYOA 2J1RA 3LE0A 2VR4A 2W92A 2Y64A 1DLCA 3WNPA 1YQ2A 2WO2A 4BXSV 2BERA 3CIHA 2DCJA 3FL7A 4A44A 4YPJA 1NUKA 2W46A 3IDAA 2WQ8A 1T2XA 1GNYA 3T2QA 1XPWA 2CDOA 1KGYA 5JXIA 1K3IA 1H6YA 2VZVA 1WCQA 4JKLA 1XC6A 2VMDA 1O59A 2RJ2A 5C70A 3IAQA 2WZ8A 2VMCA 4MGQA 4A6OA 3CQOA 4CU9A 5HXMA 3K4ZA 3VDAA 1P8JA 3A23A 4W4ZA 1UWWA 2ID4A 2YC2A 1W9TA 2Y6KA 3WQBA 3SEEA 3OB8A 3C8XA 4A4AA 3CMGA 4CVUA 2W1WA 1K45A 2J1EA 1GMMA 2W1UA 4QDSA 1JZ3A 2B9VA 4RN5A 4E8DA 3OGSA 3AC0A 5DMYA 1W8OA 4CUCA 1GU3A 4QB6A 2W95A 4CUBA 2VC9A 3FHAA 3GGLA 3K4DA 3K46A 3T0DA 2Y6GA 2Y6LA 5JUVA 3IIIA 2VMEA 4DXTA 4DEQA 3LEGA 2QQIA 3VDCA 3OGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEC A;  5DN2 A;  4DUV A;  3C7G A;  4DUX A;  2VZR A;  1PMH X;  4UAP A;  2W5F A;  2XOM A;  5G04 L;  4BK4 A;  5JXH A;  2Y8K A;  3HOB A;  3MBW A;  4DXS A;  1W8N A;  1UY1 A;  1EUU A;  3HNY M;  1OF3 A;  5JXJ A;  3ACF A;  2E26 A;  1XNA A;  3ABZ A;  4QDQ A;  3UET A;  2VZ1 A;  1ULP A;  3P1I A;  2W94 A;  3MUY 1;  1PX4 A;  2ZEY A;  4UI9 L;  3E1F 1;  2DDU A;  2C9K A;  4JHZ A;  3D3A A;  2V5D A;  2W87 A;  2VCC A;  3NJX A;  2W91 A;  3LEK A;  1ULO A;  3PUI A;  4OMC A;  3EYP A;  2BZD A;  1UY3 A;  3WNL A;  3ACH A;  2HLE A;  3NJV A;  3LEI A;  3VD7 A;  3SEP A;  2WN2 A;  3C7O A;  4FI9 A;  2QQN A;  4E8C A;  4ZXE A;  4DEV A;  2LS6 A;  5F7U A;  2VTF A;  3F2Z A;  2EID A;  2W9X A;  3MUZ 1;  3WNN A;  2QQO A;  2WO3 A;  4A45 A;  3GXU A;  4ZZ8 A;  3NRU A;  1K12 A;  4PT6 A;  1JZ7 A;  2OKX A;  5I0D A;  4D8M A;  2ZEZ A;  3U37 A;  3ZM8 A;  3I2I A;  5CZK A;  4ET7 A;  1W9S A;  3THD A;  1GOF A;  1UMH A;  1K42 A;  2VZT A;  5LA1 A;  4ZZ5 A;  1OF4 A;  2YFZ A;  4QAW A;  3IAP A;  2QQK A;  2X10 A;  2RV9 A;  2WBK A;  1SG3 A;  2XHN A;  4QX1 A;  4OZO A;  2QQM A;  3C7E A;  1CIY A;  4A3Z A;  1I5P A;  3WF1 A;  3WNK A;  4JX0 A;  1CZT A;  2WAO A;  1XNT A;  3OBA A;  5J1X A;  3JXS A;  3PUH A;  1F4A A;  2HYX A;  4BDV B;  1UYX A;  1JYV A;  3IB3 A;  5IHR A;  2J1T A;  2YB7 A;  4QPW A;  1O8S A;  2W1S A;  2ZXQ A;  4OUE A;  3MV0 1;  4GWI A;  2WDB A;  2JD9 A;  3OGR A;  5IJR A;  2C26 A;  2WO1 A;  3LPF A;  5G05 L;  3W5N A;  3I2J A;  4XUT A;  4ARY A;  3WF0 A;  2J7M A;  4TTG A;  4XZU G;  1L7R A;  4UOJ A;  3VD9 A;  3WEZ A;  4CU8 A;  3EB7 A;  1OT5 A;  4KMQ A;  2J22 A;  5LCW L;  5IYY A;  3LQC A;  4QX0 A;  1JHJ A;  1UY0 A;  1RYY A;  4LQR A;  3W5M A;  3I3B A;  3GDB A;  5HPO A;  2J1U A;  2RVA A;  4OMD A;  2ZEW A;  3BN6 A;  2Z4F A;  3CKH A;  1JZ5 A;  3OEA A;  3DYO A;  2X09 A;  4XUR A;  4P02 B;  4CU6 A;  4QB1 A;  3NNG A;  5IFP A;  1GQP A;  4P08 A;  1US3 A;  2KD7 A;  1GOH A;  3ACI A;  3I2K A;  1NKG A;  2VOT A;  5C7G A;  3OG2 A;  1UXX X;  1J83 A;  4AAX A;  2PQS A;  3T0A A;  3VD3 A;  1W9W A;  1PX3 A;  1OH4 A;  4MO3 M;  1UY4 A;  1UYZ A;  3A22 A;  2WUH A;  5JMO A;  1UX7 A;  5IFT A;  4RYD A;  3T2O A;  2ORX A;  2E33 A;  1DP0 A;  3MO4 A;  5A1A A;  4GWJ A;  2WN3 A;  4XVH A;  3P6B A;  1J84 A;  1TVG A;  2VZQ A;  2WZE A;  4W8J A;  3NQH A;  1GOG A;  3A7Q A;  2C4X A;  3I2F A;  4L0P A;  2X05 A;  2J1S A;  2V72 A;  2W1Q A;  1UYY A;  5B4X A;  1JI6 A;  3WNM A;  3I97 A;  2EIC A;  2BGO A;  2YC4 A;  3OEB A;  3K77 A;  2L9L A;  3C7H A;  4AG4 A;  2QQJ A;  2JDA A;  4HG6 B;  3WSO A;  1IQD C;  2W3J A;  4PQQ A;  1JZ4 A;  2VM9 A;  5EJZ B;  3DYM A;  3MV1 1;  4XUN A;  2WAB A;  1WKY A;  3WF2 A;  4ZY9 A;  3HPN A;  1CX1 A;  4QX3 A;  3WF3 A;  5CYY A;  3I3E A;  2BBA A;  3CZU A;  3A21 A;  3T2P A;  2J1A A;  3HN3 A;  1JYN A;  3CZJ A;  1MPX A;  3K4A A;  1W0N A;  3K75 B;  3LPG A;  5JXG A;  1JZ8 A;  1EUT A;  3I2G A;  3HJR A;  4BJ0 A;  3HNM A;  1D7P M;  3SKV A;  2B4K A;  1KEX A;  4MOA A;  5DQ0 A;  4OYU A;  1BHG A;  2YG0 A;  4KI5 M;  2CDP A;  4LKS A;  1SHW B;  4LHS A;  1R64 A;  5EIY B;  2W47 A;  4QDR A;  1JU3 A;  1NAE A;  4P5Y A;  3THC A;  4A41 A;  4DUW A;  2VZP A;  4TXW A;  2E31 A;  4D0Q A;  1JZ6 A;  4PF1 A;  4KWU A;  4MGS A;  3T0B A;  5JR2 A;  5LA2 A;  2VQT A;  2JE8 A;  1UZ0 A;  1F4H A;  4A42 A;  1US2 A;  3BGA A;  4P00 B;  3FN9 A;  4M4R A;  2QBX A;  3T08 A;  1W99 A;  2V4V A;  5C71 A;  4BK5 A;  4QX2 A;  3ETP A;  4M4P A;  3UES A;  2E32 A;  2J1V A;  1HN1 A;  3CDZ B;  3HNB M;  3T09 A;  4XUO A;  2VZU A;  4LPL A;  3UNP A;  3DYP A;  3VD5 A;  3ACG A;  2VZ3 A;  3HEI A;  1UXZ A;  2VMF A;  5FUI A;  2EIB A;  2YFU A;  2VQU A;  1O8P A;  2ORZ A;  2JKX A;  1LNS A;  4MAD A;  3WF4 A;  1GUI A;  3J7H A;  4CU7 A;  2VCA A;  1CZS A;  2VCB A;  3VD4 A;  1PMJ X;  2VZO A;  4QB2 A;  3C7F A;  3FHQ A;  1UY2 A;  3ECQ A;  5B4N A;  2WYS A;  1H6X A;  4JKM A;  1JYW A;  2LW8 A;  1JYX A;  3I3D A;  2XON A;  1UMI A;  2VL4 A;  2Y6H A;  1JU4 A;  1CZV A;  1NX9 A;  1TG7 A;  5LA0 A;  2R7E B;  1OD3 A;  2WAA A;  3WNO A;  2EIE A;  3SKJ E;  5DPN A;  4W50 A;  4GZ9 A;  4CUA A;  2ZEX A;  4IUG A;  3VDB A;  4XUQ A;  2Y6J A;  2BGP A;  4JKK A;  2DCK A;  4XUP A;  3I2H A;  2QQL A;  1L7Q A;  2VZS A;  4DXR A;  1SDD B;  1JZ2 A;  2VJX A;  4ARX A;  2XQX A;  4Z2A A;  5EJ1 B;  2VO5 A;  3GM8 A;  1DYO A;  2J1R A;  3LE0 A;  2VR4 A;  2W92 A;  2Y64 A;  1DLC A;  3WNP A;  1YQ2 A;  2WO2 A;  4BXS V;  2BER A;  3CIH A;  2DCJ A;  3FL7 A;  4A44 A;  4YPJ A;  1NUK A;  2W46 A;  3IDA A;  2WQ8 A;  1T2X A;  1GNY A;  3T2Q A;  1XPW A;  2CDO A;  1KGY A;  5JXI A;  1K3I A;  1H6Y A;  2VZV A;  1WCQ A;  4JKL A;  1XC6 A;  2VMD A;  1O59 A;  2RJ2 A;  5C70 A;  3IAQ A;  2WZ8 A;  2VMC A;  4MGQ A;  4A6O A;  3CQO A;  4CU9 A;  5HXM A;  3K4Z A;  3VDA A;  1P8J A;  3A23 A;  4W4Z A;  1UWW A;  2ID4 A;  2YC2 A;  1W9T A;  2Y6K A;  3WQB A;  3SEE A;  3OB8 A;  3C8X A;  4A4A A;  3CMG A;  4CVU A;  2W1W A;  1K45 A;  2J1E A;  1GMM A;  2W1U A;  4QDS A;  1JZ3 A;  2B9V A;  4RN5 A;  4E8D A;  3OGS A;  3AC0 A;  5DMY A;  1W8O A;  4CUC A;  1GU3 A;  4QB6 A;  2W95 A;  4CUB A;  2VC9 A;  3FHA A;  3GGL A;  3K4D A;  3K46 A;  3T0D A;  2Y6G A;  2Y6L A;  5JUV A;  3III A;  2VME A;  4DXT A;  4DEQ A;  3LEG A;  2QQI A;  3VDC A;  3OGV A; 
#chains in the Genus database with same CATH topology
 2DFB A;  4XJW A;  1ZA7 A;  3C7G A;  2VBP A;  2AYH A;  1GAN A;  3VBF A;  3PME A;  1ENR A;  1MEC 3;  4AQ2 A;  1X8E A;  3OPZ A;  1AX1 A;  5E88 A;  3HOB A;  5JXH A;  3LF7 A;  2YUE A;  2ZGP A;  5L7O C;  1VMF A;  3PVO A;  3VBO B;  1W8N A;  3HNY M;  5KXB A;  3BOP A;  4MYE A;  5A3N A;  5ABJ B;  3B94 A;  3VHR A;  3ETQ A;  2ZKN A;  4Y20 A;  5K8S A;  3DPR A;  4CCJ A;  3ZMN A;  2VXR A;  1PM4 A;  4LO7 A;  5H9Q A;  2W94 A;  3PLQ A;  3LA7 A;  1LTE A;  3FZ3 A;  4GB3 2;  1BLZ A;  2DUO A;  4MV2 A;  2EIG A;  5A1F A;  5HCH A;  1W3X A;  3ZYF A;  1WMD A;  1ZZC A;  2P17 A;  2C9K A;  4LEJ A;  1LOF C;  1RUO A;  3M4F A;  3VBO C;  4IEO A;  4CXY A;  1XXN A;  3CU7 A;  5ABJ C;  4IE7 A;  3O1S A;  4XET A;  1YO8 A;  4LKF A;  5FP8 A;  5AC9 3;  2PTM A;  1ULO A;  4CDW A;  3ILF A;  4M0N A;  5SV5 A;  1H1A A;  2D44 A;  1BVV A;  3AJY A;  4SLI A;  1WD3 A;  5JCT A;  3V0A A;  5EFU A;  4AEM A;  3WNL A;  1X33 A;  3ZYG A;  3LEI A;  4OFG A;  1OXC A;  1R09 2;  1IS4 A;  5DZG A;  5C8W A;  5CFC B;  4E8C A;  3K2O A;  4ZXE A;  2BNN A;  3O1R A;  3GF6 A;  1R08 1;  2DBI A;  3ZOI A;  4RL7 A;  3VV1 A;  4LR4 A;  1YCI A;  4K7J A;  4LBM A;  3EO6 A;  3TWI A;  5C3S A;  3VBU C;  4CEW A;  5F7U A;  2ZML A;  4CP1 A;  3F2Z A;  2W9X A;  5A7O A;  3ZKY A;  4CRQ A;  4TZD A;  5F2S A;  1F5J A;  3ASI A;  4QGL A;  4N53 A;  1N3Q A;  5CFC C;  3LOB A;  2GP5 A;  4Q4V 1;  4BLJ A;  5C9A B;  1XNK A;  3CL1 A;  1EY2 A;  3CLP A;  5IVB A;  3IDC B;  3ZM8 A;  3FLT A;  5CZK A;  3N9O A;  2ZGQ A;  2WFF 1;  4Q8K A;  3THD A;  4I3P A;  4QPI B;  1KIT A;  4IEZ A;  3RWK X;  1K42 A;  2VZT A;  5LA1 A;  4ZZ5 A;  2ADE A;  1OF4 A;  1PZ8 A;  1UMZ A;  3E5X A;  2D6N A;  4D6Q A;  3JBG 2;  5C9A C;  5CNA A;  1SLA A;  2YU1 A;  5F6K A;  2CGO A;  4LBQ B;  3U11 A;  1S0C A;  1REF A;  4N9H A;  1ENQ A;  1JTZ X;  2QKD A;  1PGL 2;  3I59 B;  4YM3 A;  1NZC A;  5LRR A;  2RMU 3;  4KBB A;  1AR8 2;  1LOB A;  4CCO A;  4TLG A;  1SFN A;  1BZW A;  1QEX A;  4JTN A;  1CIY A;  4BIS A;  2N7G A;  1XYN A;  2W68 A;  3D0S A;  2A6Z A;  3WF1 A;  4XC9 A;  2MEV 3;  2R07 2;  1H1M A;  3AMM A;  4HAN A;  3B3Q E;  4N7U A;  5GLV A;  5A6Q A;  2VMH A;  3I4I A;  4YW5 A;  1RHI 3;  4HK9 A;  4YWA A;  1BYH A;  3NV1 A;  4KU8 A;  2YGM A;  3X29 B;  4NOT A;  2AEY A;  1N1T A;  3LGR A;  1UIJ A;  1MEC 2;  4QX8 A;  1NY7 1;  3WLU A;  1UYX A;  4X6R B;  3BIW E;  2HEV F;  3LSD A;  1AZD A;  2JDH A;  1SLT A;  4C1W A;  5F5A A;  4G4F A;  4PCR A;  4Y1U A;  2KM2 A;  4IEV A;  3UKT A;  4QPW A;  2W1S A;  2ZXQ A;  1S2E A;  4NUB A;  3O7O A;  2EAK A;  4OUE A;  4Y24 A;  5DAQ A;  5DG1 A;  1UOJ A;  3OGR A;  4JHT A;  3ATG A;  1NYW A;  5F6L B;  5IJR A;  5L73 A;  2ZMK A;  1YNA A;  2VVF A;  5FZL A;  3A0K A;  1QQP 3;  4QGM A;  4GXL A;  2R32 A;  1LOE A;  1XOY A;  2PHF A;  4XUT A;  5DAB A;  3WG4 A;  4ZXK A;  2IXK A;  3IMM A;  4URA A;  4TTG A;  4XZU G;  2FDH A;  4XDP A;  3VD9 A;  4Q0Q A;  3WEZ A;  2DCZ A;  3AMP A;  2Y0O A;  5B2G B;  2LRO A;  5FY7 A;  4CCD A;  1VBD 1;  1AL2 3;  1HIX A;  1SMV A;  5LCW L;  1O3Q A;  4GAL A;  4AW7 A;  4LTA A;  4AI1 A;  4COZ A;  1O4Z A;  3UKN A;  1S0I A;  3LQC A;  2RJL A;  3ON7 A;  2AAC A;  3U0Z A;  4E2G A;  1FOD 1;  4RHV 3;  3RMY A;  1NCQ A;  1N1S A;  4FPY A;  1APN A;  1YLL A;  1GWL A;  1UY0 A;  4GA9 A;  4FFI A;  2GU9 A;  3W5M A;  1ZZ6 A;  2WKK A;  4DB5 A;  4Z8B A;  1S0B A;  2RVA A;  1W39 A;  1JZ5 A;  5DUX A;  1Z0H A;  3QBQ A;  2X09 A;  2D3R A;  4QB1 A;  4LHK A;  4CU6 A;  5IFP A;  4HOO A;  2D6O X;  1M4W A;  1NQJ A;  1GQP A;  3PVN A;  3KD4 A;  2W39 A;  3VKL A;  1KRI A;  1OQ1 A;  4Y1X A;  2V09 A;  1CPN A;  4I02 A;  1JXN A;  1NCR B;  1XBF A;  1VBA 1;  2VOT A;  3K3N A;  2D3S A;  2D93 A;  5C7G A;  3SLI A;  1V6J A;  2YMZ A;  1X82 A;  3ILN A;  4AED B;  3O14 A;  5FY4 A;  4CA9 A;  4Z07 A;  1JBC A;  2HEY F;  4HSJ A;  3AKQ A;  3N3H A;  5GAL A;  1NT0 A;  3SH4 A;  5KWR A;  2IZW A;  2ZZJ A;  4XJU A;  5FUP A;  1PX3 A;  2A71 A;  4MGY E;  5I0U A;  3KV5 A;  3O0V A;  4CDQ A;  2D6P A;  5T55 A;  1UYZ A;  2JXA A;  3LEM A;  2XL7 A;  4HBN A;  1W6O A;  3AZX A;  4AED C;  1AR7 1;  2RMU 2;  3CBN A;  4GJZ A;  3I2O A;  1HB3 A;  5FXZ A;  2IVI B;  3VBR A;  4QKD A;  2GC3 A;  5IFT A;  1Q8O A;  3T2O A;  5IK8 A;  1W0O A;  3VL8 A;  4ZON A;  5FCC A;  2VGD A;  1H0B A;  2E33 A;  3S7E A;  4URT A;  1IG3 A;  5FZM A;  1GFF 2;  1ACC A;  1S2B A;  4BQ5 A;  4XVH A;  2A6W A;  2Z69 A;  5JPM B;  1V6I A;  2DUR A;  1E5R A;  2D7F A;  1RUI 2;  4W8J A;  4YAR A;  5JDB A;  1RHI 2;  2GN7 A;  3ZLI A;  4AHY A;  3T4H B;  4YGE A;  5KHG A;  2OUJ A;  3A7Q A;  1RL3 A;  3WQ7 A;  5IT6 A;  3IDE A;  1ONA A;  3KF3 A;  1X36 A;  3PVB B;  2J1S A;  1QJU 2;  4YZ4 A;  3DEM A;  4PJY A;  3WDX A;  2W1Q A;  1UYY A;  2EA7 A;  2BU9 A;  4MGT A;  1GWM A;  2A3X A;  4JC1 A;  3OY8 A;  4Q0S A;  4XAC A;  3WNM A;  4XJ9 A;  4AQS A;  1FAT A;  4HVR A;  2IFR A;  3I8T A;  2YC4 A;  3OEB A;  1WBL A;  3K77 A;  4YG3 A;  3KSC A;  4HG6 B;  1N1V A;  1TME 1;  1AL0 G;  1S2K A;  1S0D A;  1JW6 A;  5IVE A;  2ATF A;  2DVF A;  1W8T A;  2W3J A;  4JGY B;  2NPI A;  1F31 A;  4K20 A;  2YPJ A;  1ASJ 1;  4N43 A;  4PIZ A;  1BMV 2;  5EJZ B;  5CAD A;  3POI A;  4AVT A;  2DUQ A;  4KG8 A;  5C3O A;  2YGL A;  4YW1 A;  4XBL A;  4DY5 A;  5FXW A;  4GQ7 A;  4CCL A;  3UK9 A;  1D0H A;  4UF0 A;  5FO8 B;  4QX3 A;  3VBS B;  5BNN B;  1HRI 3;  1D4M 1;  5FZ1 A;  3ZSE A;  1AL2 2;  3I3E A;  3VZO A;  4PLM A;  4LUK A;  4TYS A;  1EAH 3;  2R06 2;  2B46 X;  2XXZ A;  3POY A;  4ISR A;  3GAL A;  4LOR A;  5FYI A;  5KBF A;  3FHI B;  2EAL A;  4RHV 2;  4OI0 A;  1RUG 1;  3MW2 A;  1WWY A;  3POS A;  5T5P A;  1V9U 3;  5A6Z A;  3B01 A;  3VBS C;  2ZGM A;  2WNU B;  4G3Y C;  4CYD A;  5BNN C;  2AGS A;  1MS5 A;  1AYM 2;  3CZJ A;  4AOC A;  1MPX A;  1Q8V A;  1W0N A;  3K4A A;  3GJB A;  2R04 3;  1FMD 3;  3ES4 A;  1REE A;  2RHP A;  1NA1 B;  5IW0 A;  5JXG A;  2WNO A;  3A4U A;  2HH9 A;  3HNM A;  4Z2W A;  1PO2 1;  4XJZ A;  3WG3 A;  2RS5 2;  1DZR A;  3JU9 A;  3RGB A;  1CAV B;  2WNU C;  1UD1 A;  4OYU A;  5DQ0 A;  3TEY A;  1PIV 1;  3RYR A;  1LOC A;  2QQP A;  3PMS A;  1ZA4 A;  1QJX 1;  1XNC A;  1SHW B;  4YZ3 A;  1XE7 A;  1OUS A;  3ZR6 A;  1NA1 C;  4L9B A;  1COV 2;  1CON A;  1DU3 D;  4DXZ A;  5T5L A;  2H6B A;  2PEL A;  5FZ6 A;  4PF5 A;  1QF3 A;  4MGI E;  5EWS A;  4M00 A;  5GLW A;  1TZO A;  2BBV A;  4XQ4 A;  3RYK A;  1HKD A;  3MIE A;  5FJH A;  4QXB A;  1SLL A;  4TXW A;  3RVH A;  4KWK A;  2JEC A;  4NIH A;  1RXF A;  1W2O A;  4HKW A;  3ZKU A;  1YYN A;  3RNS A;  5FUN A;  1VAM A;  2VQT A;  2E6V A;  4A3X A;  5DZF A;  5FYC A;  2VOK A;  3B7M A;  4KNC A;  4E4S A;  5JLV A;  4CXX A;  2O0O A;  2PAE A;  1ULE A;  1QJY 3;  2UY8 A;  3I54 A;  3MIB A;  3UL2 A;  1RUD 3;  4D94 A;  2CYF A;  4QQL A;  1RVF 1;  4X8P A;  4QKN A;  1BKZ A;  3ETP A;  4M4P A;  3L9J T;  4QX2 A;  4WVM A;  2CSG A;  2WS9 2;  3VDD B;  4NHY A;  1HXS 1;  5A70 A;  3D6E A;  2OVU A;  1RIR A;  1X50 A;  4HMZ A;  2J1V A;  4YM0 A;  4NVP A;  4MVT A;  2FHR A;  3HNB M;  3SIS A;  3H7J A;  1WME A;  3M70 A;  1EV1 1;  2GC0 A;  4CDU A;  4AXO A;  1BK1 A;  1AR6 1;  3AKP A;  4S2D A;  3VZL A;  3ZYB A;  5DUU A;  3UJO A;  3VDD C;  2VMF A;  2PHT A;  2VNG A;  4YFZ A;  2VE1 A;  3NNL A;  2P6H A;  1G8W A;  2ORZ A;  3WF4 A;  1LNS A;  1EP0 A;  5IVY A;  4B7K A;  3BAL A;  2CWM A;  1G7Y A;  4YZ2 A;  5A3L A;  2VCA A;  3QH6 A;  1B35 A;  1QWR A;  2C9A A;  4LA2 A;  2XVL A;  3IBM A;  1E5I A;  1HRI 2;  3FC0 A;  4K8R B;  1Q43 A;  5ISL A;  4CDX B;  4M3C A;  5CA6 A;  2RS1 3;  4OZX A;  3FMG A;  1EAH 2;  2XUM A;  1OBN A;  1XYO A;  4LO4 B;  3FHQ A;  1GQG A;  3WW3 A;  3ZYR A;  3INA A;  3DKQ A;  1WD4 A;  3ILR A;  3R6S A;  2VVE A;  1MS3 A;  4FOY A;  5LB6 A;  3O12 A;  2WIN B;  2GDF A;  4JKM A;  5FYB A;  5D21 A;  1UMI A;  1JUI A;  3V65 A;  4YFW A;  1IKP A;  4XAB A;  4CDX C;  2B45 X;  3WY6 A;  5LA0 A;  3MIF A;  4XPV A;  2WT0 A;  2HWC 2;  2ZX3 A;  4FQ4 A;  4OI4 A;  3WP5 A;  3E97 A;  3TYJ A;  1W8H A;  1HRV 2;  3WNO A;  3U4X A;  4Y1V A;  1ENS A;  2JG8 B;  2QUO A;  4IUG A;  4UW4 A;  3SCH A;  4BA6 A;  4CEY A;  4COU A;  1OFS A;  2Y6J A;  5F3E A;  3PVE A;  2VY0 A;  3KHC A;  1WCU A;  1VMH A;  2A1X A;  3I2H A;  2QQL A;  2VZS A;  4XFF A;  4XYX A;  3WDY A;  2ZX1 A;  4XJ8 A;  2R6Q A;  2XQX A;  5FP3 A;  2D40 A;  4Z2A A;  2BYV E;  2VO5 A;  4TWT A;  3SH3 A;  2JG8 C;  4L92 A;  4YVS B;  4ZU5 A;  4KU7 A;  2DF7 A;  2VR4 A;  3KV6 A;  1LGN A;  4GH4 A;  3RMX A;  1DLC A;  3W20 A;  2RDN A;  1ZZ8 A;  2P1B A;  3OUH A;  1UQX A;  2EXI A;  2JDM A;  1UO9 A;  4XTM A;  2Q8C A;  2A3Y A;  5LRS A;  2DCJ A;  3SC7 X;  3LA3 A;  1LCL A;  5FY9 A;  4I0B A;  1A3K A;  4RS5 A;  3ZIW A;  4GIQ A;  5JI9 A;  1T2X A;  2WWJ A;  4XJA A;  3SIT A;  5CKN A;  1SFP A;  3I2D A;  4YVS C;  4EYU A;  2VW2 A;  1S1A A;  3AK0 A;  2CDO A;  1KGY A;  3E6D A;  4EV0 A;  5JXI A;  5FXX A;  4K9S A;  4JKL A;  3RYP A;  1QJY 2;  3H9A A;  1IQA A;  2VMD A;  4JCK A;  1RUD 2;  2BRT A;  4MGQ A;  5GZF A;  5M0T A;  4A6O A;  4CU9 A;  3H3Z A;  1DGR N;  3A23 A;  4W4Z A;  4XFA A;  3PUR A;  1MS8 A;  1GV9 A;  4WZF A;  1RUJ 3;  2ID4 A;  5FMO L;  4BU2 A;  4AGG A;  3PDQ A;  3KV9 A;  4MH0 E;  2Y6K A;  4C8D A;  5F2W A;  4XZP A;  3MIG A;  3ZXA C;  2IXC A;  1LHN A;  1ZBA 2;  1VRB A;  1GMM A;  1F2N A;  4O7X A;  4O9E A;  4XFC A;  5C5U A;  3VB9 A;  5GLT A;  1O91 A;  5EPA A;  4HXC A;  3W9A A;  3AM2 A;  5I0S A;  4OCT A;  5FBJ A;  4DO0 A;  4B29 A;  5IAT A;  1U5X A;  1OUX A;  1SLB A;  2W95 A;  2Y6F A;  5F1R A;  5GZG A;  3MZH A;  2EVX A;  1DG6 A;  4R9C A;  2FDK A;  3JD7 1;  5ANN A;  5K0U B;  3AYD A;  1S4C A;  2YBK A;  3N7M A;  4DNY A;  2LM3 A;  3K46 A;  4OHX A;  4Q29 A;  1SCR A;  5FMC A;  2RS1 2;  4P9J A;  1H8T A;  1PK6 B;  2PHU A;  1BBT 1;  4AFA A;  3O5S A;  3III A;  1Z7S 2;  4BQ1 A;  4QM9 A;  3AZV A;  4MXW B;  1A34 A;  1RGS A;  2VW0 A;  3AYA A;  4DXT A;  4HVQ A;  4I09 A;  3AB0 A;  3LEG A;  2QQI A;  5FZD A;  3VDC A;  1CAU B;  3ZFG A;  3FFQ A;  2PN5 A;  1UOF A;  1AHS A;  4ZS2 A;  5CB7 A;  1Y9M A;  3E5Q A;  1PGW 1;  5FPA A;  1PMH X;  4FPO B;  4Q4X 1;  3M3C A;  2VUC A;  4K40 A;  1PK6 C;  2CL2 A;  1E57 A;  3GZA A;  3WDW A;  1RUN A;  1TMF 3;  4ASM B;  5HV0 A;  2FBE A;  1C4R A;  3JB4 C;  1EUU A;  4EZH A;  5K9Y A;  5F3G A;  5JXJ A;  2ZAA A;  4Q4Y 2;  2E26 A;  1XNA A;  2YY1 A;  3Q8A A;  4XCB A;  2VZ1 A;  3UET A;  1ULP A;  2A7A A;  4CZS A;  4R52 A;  2JDP A;  4FPC A;  1VBE 3;  4XF4 A;  2QTW B;  2ZEY A;  4QWN A;  2P3J A;  2AEN A;  2NYY A;  3E1F 1;  1IPS A;  4IV3 A;  3N9L A;  1RTV A;  4XEZ A;  1BK0 A;  3GZU C;  4BMB A;  5KXC A;  1H4H A;  2ZHN A;  2V5D A;  3AP9 A;  1Y9Q A;  5FZF A;  4PDW B;  4FAH A;  4PQ9 A;  2W0X A;  3WR0 A;  3J8F 1;  3U78 A;  4QHZ A;  5F9T A;  4YZ1 A;  4CP9 A;  3P5B A;  4ZPI A;  3I3Q A;  3PUI A;  2GME A;  1KJR A;  2A75 A;  1VJ2 A;  1UY3 A;  4OMC A;  4RQP A;  3NJV A;  4XIL A;  3GBG A;  1R1A 3;  4KG0 A;  4NHL A;  2P3K A;  3VD7 A;  4QU2 A;  1WLT A;  2ZA9 A;  3F95 A;  4GMP 0;  1CIW A;  2QQN A;  4YVW A;  3O1T A;  2JE9 A;  5FBZ A;  5A3O A;  3T4V A;  1D2S A;  1RUE 3;  4PDW C;  4YW6 A;  1VBC 1;  4HET A;  1Q5O A;  1DQ1 A;  4GMP 3;  3LDR A;  1BJQ A;  1V6K A;  5CAZ A;  2RE9 A;  1J3Q A;  3RFR A;  3C2U A;  3WNN A;  3USS A;  4XTP A;  1KS4 A;  2ENR A;  1NG0 A;  1KJL A;  1GYK A;  1K12 A;  4PT6 A;  4XBQ A;  3WW1 A;  5FP4 A;  1X8M A;  4QQ2 A;  1VRH 1;  4D8M A;  3W58 A;  1J1L A;  2XJV A;  1YI9 A;  4UXA A;  3ZR5 A;  2B7Y A;  3Q8E A;  3V64 A;  2QJV A;  2RDR A;  4U36 A;  4X8N A;  1OLM A;  1GOF A;  4XAE A;  5A3U A;  1UMH A;  4LBL A;  1A6C A;  4QU1 A;  4WZC A;  1OMI A;  4NID A;  5F39 A;  5CKM A;  5T5O A;  1RMU 2;  4NII A;  5D1I A;  2HWF 1;  2RV9 A;  4AGR A;  1SG3 A;  3JZV A;  5FMD A;  1HJF A;  5AVP A;  3TNP B;  2UY9 A;  3V0B B;  5BNO A;  4OI2 A;  3ZDV A;  2XHN A;  3EHK A;  1O3S A;  3LKJ A;  3KZ4 C;  2GP3 A;  2Q1M A;  3TN9 2;  1GZW B;  1MS9 A;  3U14 A;  2QQM A;  2ZAH A;  3ZSM A;  1IPJ A;  1MEC 1;  1AX0 A;  1LAJ A;  1I5P A;  4LUL A;  4M3C F;  3WNK A;  2BFU S;  1JN2 P;  2VUL A;  4JX0 A;  4QD2 A;  4CP2 A;  4QPG A;  1RC6 A;  1XNT A;  3JXS A;  3WVJ A;  2G9Z A;  1CR7 A;  3H8U A;  3PUH A;  2UWA A;  3VLB B;  5LEJ A;  1F4A A;  1VE0 A;  5FY8 A;  3MPB A;  4LE3 A;  4O9G A;  2YRO A;  4ITC A;  4XHX A;  3R05 A;  3POW A;  3V56 A;  3IB3 A;  4HN0 A;  2J1T A;  1ULF A;  1QJZ A;  1PHM A;  4PIY A;  3U4S A;  2JE7 A;  3R0R A;  4YSF A;  1S0J A;  3OPW A;  4QMA A;  3MV0 1;  2R30 A;  4LOT A;  2JD9 A;  2X5I A;  1VBE 2;  3AZZ A;  5CIR A;  4DOU A;  1VAL A;  4I0W B;  5FZ3 A;  2EF6 A;  2B5H A;  2C26 A;  1F5F A;  5A7Q A;  4N9I A;  1LOG A;  2DYC A;  5A7N A;  4AVC A;  4D6R A;  4EJR A;  3KMH A;  1QJE A;  5A7W B;  2RS3 2;  1CES A;  1V00 A;  4JZR A;  2WL1 A;  1AR8 3;  2QCS B;  4Q5O A;  3MI8 A;  4OUM A;  4XHB A;  3ZYP A;  5C4W B;  1CD3 G;  2VVD A;  4KBZ A;  1OT5 A;  1SBE A;  4QPI A;  4K21 A;  4EN0 A;  4KMQ A;  1WLW A;  2WLQ A;  4LUM A;  5LWB A;  2R07 3;  1W8U A;  1R1A 2;  3BPZ A;  2BGC A;  4NHK A;  4FPL A;  5IYY A;  3RWN A;  4E27 A;  2HWB 1;  3GBF A;  4HZF A;  5J36 A;  1G6N A;  2BVB A;  1JOB A;  1FPN 1;  2J42 A;  3AMN A;  1RUE 2;  4AHW A;  3POG A;  1YEW A;  5C4W C;  1C8M 3;  2JG9 A;  3M2M A;  2O8O A;  4PLN A;  2J1U A;  3NL1 A;  4OMD A;  2ZEW A;  4DZG A;  2JEN A;  3HN1 A;  3MDP A;  2P37 A;  3ZIX A;  3NNG A;  4IV1 A;  1D0G A;  1QXP A;  5T3N A;  4D69 A;  4P08 A;  3DL3 A;  1OPM A;  5LBB A;  2HWE 3;  2V4A A;  4AVA A;  1PMI A;  1O4Y A;  1JOD A;  3I2K A;  2YHJ A;  1KXG A;  2ARX A;  5GLZ A;  1YFX A;  4LBO A;  1OSG A;  2WO7 A;  3AJZ A;  5I8S A;  4BH9 A;  1VBB 3;  4ATF A;  1J83 A;  2ZPX A;  4H3W A;  3VBU B;  4N8M A;  1JYI A;  5FR3 A;  2CAU A;  4RFT 0;  1H2N A;  2MEV 1;  3HMY A;  1UW8 A;  3MF6 A;  2HWD 1;  2Q8O A;  4NN0 A;  3ZO0 B;  1OKO A;  5FO9 B;  2XVK A;  4YLZ A;  5DUV A;  3B69 A;  5LK5 A;  2ZX2 A;  2GND A;  1CX4 A;  1AR9 3;  3N35 A;  3FFZ A;  4ONU A;  4L11 A;  3SH5 A;  5JZG B;  1ZYB A;  2XL9 A;  3MO4 A;  4GWJ A;  2WN3 A;  1UZY A;  3MLJ A;  2WWS A;  1LEC A;  1J84 A;  5H9P A;  3ZPO A;  3GHM A;  5IUQ A;  1LES A;  1MQT A;  3EXU A;  5C3R A;  2OPK A;  3VUO A;  2X05 A;  3I2F A;  4L0P A;  3LIH A;  2G9F A;  1W2N A;  4MHR A;  5JZG C;  4C0B A;  3I97 A;  3HT1 A;  1DZT A;  1QQP 1;  3ZFE A;  1M06 G;  1ZRE A;  2BWC A;  5C8C A;  2BGO A;  5A7S A;  2Q4S A;  3NWK A;  3VZM A;  2L9L A;  3L2H A;  3BOD A;  5C5T A;  3U75 A;  3TB0 A;  1POV 0;  4QHO A;  5HBA A;  3KT7 A;  2H0V A;  2RM2 1;  1W2U A;  5JOW A;  3R4U A;  4Q4W 1;  5T50 A;  3ZXL A;  5L36 A;  1BVP 1;  3N36 A;  1AL2 1;  1AYN 1;  1WW4 A;  2EAA A;  1POV 3;  2VM9 A;  5FZ4 A;  5A6X A;  1JZ4 A;  4RGG A;  2RJK A;  4ORF A;  4COV A;  4XUN A;  2WAB A;  1NCR A;  5DAP A;  4ZY9 A;  3HPN A;  1CX1 A;  3WF3 A;  2GH8 A;  5KC5 A;  2EXH A;  2DBN A;  2BTV C;  1PO1 1;  2F17 A;  2B42 B;  4WM8 A;  1W28 A;  1DHK B;  1GR3 A;  1HN0 A;  2BJS A;  2HBT A;  1JOJ A;  4H2A A;  2BBA A;  5BNP B;  1ST8 A;  4MZU A;  3WOG A;  5C3P A;  1UOB A;  1RUI 3;  1G9D A;  3USU A;  3N7K A;  1HV0 A;  4KWL A;  1IOA A;  2WFP A;  3T2P A;  3KV4 A;  1H30 A;  4JRL A;  5EP9 A;  4MXV A;  1QJU 3;  2WSU A;  1JYN A;  3KGL A;  1QIQ A;  2TEP A;  1C8M 2;  1CN1 A;  4QX5 A;  2XBO 2;  2GNB A;  3Q9O A;  5EJ3 A;  4O61 A;  2IWG B;  1RJ8 A;  1GP6 A;  1LHO A;  1IHM A;  4WM7 A;  5BNP C;  4XMI A;  2WQZ C;  4Y20 B;  3VZJ A;  2ZGT A;  3DPR B;  3K75 B;  2XKP A;  3EBR A;  3KCC A;  1N1Y A;  3LDK A;  4QHB A;  1EUT A;  5FZ8 A;  1UYP A;  1VAK A;  2VTX J;  3Q8F A;  4ASL A;  2HWE 2;  5KHI A;  3VBF C;  4Y5S A;  4AWD A;  1PGS A;  3J7M A;  4IE6 A;  4MOA A;  4AE2 A;  3AP4 A;  2AEZ A;  1AF9 A;  5C6C A;  1CWP A;  1BHG A;  3KGZ A;  3ZXD A;  1OKQ A;  2PLV 2;  1RUH 1;  2CDP A;  4LKS A;  1VBB 2;  4LHS A;  2FZ1 A;  3DPR C;  3E5U A;  3SNM A;  5FZH A;  5EIY B;  5DDJ 2;  2W47 A;  4NJ4 A;  1JU3 A;  2OUH A;  4CDW B;  1A78 A;  1NAE A;  5FP9 A;  4L8Q A;  4N7I A;  1FAY A;  2WLP A;  3V0A B;  1WW7 A;  3VKO A;  4Q4V 3;  4P5Y A;  2R06 3;  1PVC 2;  4YW4 A;  3AVR A;  2VZP A;  1W0P A;  3P3P A;  4JGY A;  4AL9 A;  4KWU A;  3Q8B A;  1GP4 A;  3O1P A;  4Q8L A;  4FP2 A;  3T0B A;  1OLR A;  5LA2 A;  3TEX A;  1AR9 2;  4FQZ A;  4B4P A;  4CDW C;  2JIC A;  1U0A A;  1AYM 3;  1UZ0 A;  2JDN A;  2TNF A;  3VBS A;  1LGC A;  4HSL A;  3WDU A;  5I8Y A;  5JSP A;  1UPS A;  2VMG A;  1QH7 A;  2PHR A;  3CJI A;  1JUH A;  3H8O A;  4M4R A;  2QBX A;  4O65 A;  5FPX A;  5T52 A;  5F5C A;  1ZBE 2;  2RS5 3;  3ZMO A;  3J7N A;  4CEW C;  3AL6 A;  2YXS A;  4OUS A;  4OUL A;  3CDZ B;  1ZVF A;  2XVG A;  4YNI A;  3N9P A;  1JYC A;  4XUO A;  2LAL A;  1LED A;  3RZJ A;  1W6P A;  1COV 3;  4N53 C;  4XF1 A;  1VPH A;  3UNP A;  4NRM A;  3DYP A;  5HV4 A;  2NZ9 A;  4CPB A;  2O1Q A;  2VZ3 A;  2O8Q A;  1UXZ A;  2UWB A;  1LEN A;  5A3P A;  1WBF A;  1OUR A;  1QOO A;  4H14 A;  1O8P A;  4C90 A;  3OBT A;  4RD7 A;  5FZO A;  5LBF A;  2JKX A;  1ZZB A;  3OGG A;  2Y38 A;  4YW7 A;  3J7H A;  5FQ0 B;  1SPP B;  2NP0 A;  1WA4 A;  1V9U 1;  4D7Y A;  1DDL A;  2QNK A;  1H2L A;  3RSJ A;  1QY4 A;  1V70 A;  1JOP A;  4Y5Z 0;  4GAZ A;  1ND3 B;  1XSR A;  4QQP A;  4L97 A;  2CGN A;  4UFK A;  2R04 1;  5JVV A;  2WYS A;  4W65 A;  5KHJ A;  1FMD 1;  2KA3 A;  3KT1 A;  4NRP A;  4UW5 A;  3VKM A;  1QGL A;  2DVD A;  4QXK A;  1UF2 C;  2R0H A;  3QAC A;  4LO8 A;  2WS9 3;  4Q27 A;  2JJ6 A;  3I3D A;  4NAO A;  1JYW A;  1JYX A;  3NVC A;  3PIG A;  3MF9 A;  2XH6 A;  2FDG A;  2YDE A;  4JGZ A;  1ND3 C;  2E63 A;  3H42 B;  1OD3 A;  2QDN A;  4BPZ A;  4OHZ A;  2EIE A;  5DPN A;  4XFH A;  4XXA A;  4GZ9 A;  3VHN A;  3U10 A;  2QZ2 A;  4CUA A;  4AI3 A;  1X9T A;  4XUQ A;  1R08 2;  1W6N B;  1MS4 A;  4MET A;  1GP5 A;  1JMU B;  4XUP A;  5FKB A;  2WZP P;  4PI2 A;  2ET7 A;  1SDD B;  3EMR A;  1MZF A;  2QZ3 A;  5EJ1 B;  1YRZ A;  1W90 A;  5A6Y A;  4Q26 A;  1ZX5 A;  3GM8 A;  4QPY A;  4F8A A;  1DYO A;  2QDR A;  2W92 A;  2Y64 A;  3K51 A;  3WNP A;  2OXB A;  4Q4V 2;  2A6V A;  3PL0 A;  1DQ6 A;  3H3L A;  4YGB A;  3CIH A;  3GHN A;  3MPP G;  3FL7 A;  4B1M A;  4B4R A;  1RUD 1;  1UOG A;  1NCQ B;  2WFF 2;  3ALQ A;  3IDA A;  2A6Y A;  3LCP A;  2QVS B;  3OBR A;  3KWV A;  4MUV A;  4ZU7 A;  1IS6 A;  1GNY A;  3G7D A;  1O5U A;  4E4Z A;  1JH5 A;  1XPW A;  4YW2 A;  2VZV A;  2HWC 3;  3KLS A;  4BIF A;  1ODN A;  1HRV 3;  2A3W A;  2RJ2 A;  1SQ4 A;  4UFH A;  4FBF A;  2OII A;  2WZ8 A;  3AP5 A;  1BEV 1;  5IVJ A;  1NCQ C;  1XE8 A;  3ZFF A;  5HXM A;  4LO6 B;  2PAM A;  3J4U H;  3OJB A;  2FD8 A;  3S57 A;  3D8C A;  2G19 A;  1UPI A;  2BWA A;  4AGV A;  4EQV A;  2YC2 A;  5JOX A;  5LAT A;  2XJU A;  3ME2 A;  4XBN A;  3SEE A;  4XDO A;  1H8V A;  3LSE A;  3WQ1 A;  1QNY A;  1X7N A;  5IWF A;  3CMG A;  2XLG A;  2W1W A;  3B5L B;  2J1E A;  4LIU A;  2RR1 1;  4IE4 A;  5L9R A;  2B9V A;  2F4L A;  4YGC A;  5GZD A;  4CDQ B;  1YQC A;  5FZ7 A;  3ZXJ A;  1V6N A;  3OGS A;  1NY7 2;  4FOQ A;  1I3H A;  4NO4 A;  5FTT C;  3WP6 A;  1W6O B;  2WNV A;  4OQ9 A;  4NIG A;  3NAP A;  1OLQ A;  3VBR B;  5LW9 A;  4UWD A;  4CUB A;  5JI7 A;  1FV3 A;  2XHK A;  4DPN A;  4BQ2 A;  1OOP A;  3GGL A;  3K4D A;  2EXK A;  3LOI A;  1TME 3;  1R1Z A;  1C57 A;  2Y6G A;  4CDQ C;  1ENX A;  1HLC A;  1PZ7 A;  5FYH A;  2OQ7 A;  3RZG A;  3ZN6 A;  1ASJ 3;  5F37 A;  2DTW A;  1XU1 A;  2CAV A;  3VBR C;  3T08 A;  1SBD A;  3DEC A;  5DN2 A;  1LU1 A;  2Z42 A;  5FZI A;  5K7P A;  4DUX A;  3LB9 A;  1JHN A;  4KH9 A;  4P14 A;  3OY8 B;  3IZO A;  2W5F A;  2XOM A;  5G04 L;  4IDZ A;  1VBD 2;  2Y8K A;  4C0H A;  1KDM A;  1V6L A;  1STM A;  2VW1 A;  4AFM A;  3N7L A;  2R1B A;  4KQ7 A;  4FTE A;  3MLK A;  3NMB A;  5IK4 A;  1OF3 A;  5DUW A;  1ZBA 3;  1OH3 A;  4HON A;  2XPJ A;  3SXW A;  2VNO A;  1CPM A;  1DF0 A;  1FOD 2;  1YI7 A;  4QDQ A;  1RUG 3;  3JB8 A;  3P1I A;  4ATE A;  1QJF A;  4N43 B;  2ZKL A;  4FAG A;  1MZE A;  3ROU A;  5F3C A;  4UI9 L;  2D3P A;  3O0X A;  3S6P A;  1TNR A;  1YUD A;  4FFH A;  5IK5 A;  2DDU A;  1U12 A;  3QOP A;  2YV8 A;  3VN4 A;  3OPT A;  4JHZ A;  1W6Q B;  2W87 A;  2G9G A;  4QGN A;  4LK6 A;  4I30 A;  3NJX A;  5LBE A;  1LOA A;  2P2K A;  2W91 A;  4B4Q A;  4XDQ A;  3IKW A;  3LEK A;  2DVG A;  2Z5W A;  1SAC A;  1Z7S 3;  4N43 C;  4NPR A;  2VNV A;  4IER A;  2YZ4 A;  3WT3 A;  3DN7 A;  1SFY A;  3EYP A;  1PIV 3;  1W2A X;  2HEW F;  2HLE A;  3ACH A;  4LLF A;  2WZR 3;  2XLF A;  2XKO A;  5FPV A;  4AZZ A;  5FO7 B;  3C7O A;  4FI9 A;  5FLH A;  1VLN A;  3DF0 A;  4NHX A;  4AI2 A;  2ZCW A;  4BM8 A;  3MLL A;  4JQR A;  3BB6 A;  3NKT A;  2LUW A;  4WVW A;  2CGP A;  2OS2 A;  2ZX4 A;  2LS6 A;  5KXD A;  4JVA A;  2Y60 A;  4EE2 A;  2VD7 A;  3DCQ A;  1XND A;  3HAG A;  5CBL A;  1W06 A;  1SLC A;  5K0U A;  2JIG A;  4UYB A;  1RUJ 1;  1LUL A;  5FPZ A;  3MUZ 1;  3UGG A;  1Y4W A;  3PUQ A;  3THP A;  5BV6 A;  4Q4Y 3;  4AVV A;  4A45 A;  1VR3 A;  1AR7 2;  1W9F A;  4ZZ8 A;  4MXW A;  2ZGR A;  5J3U A;  3NRU A;  1IS5 A;  1OD5 A;  2ARE A;  4M01 A;  1S0E A;  4J1X A;  3HBZ A;  5DAX A;  1F9K A;  1ODM A;  2IXI A;  4NRO A;  4U2A A;  1JZ7 A;  2ZZQ A;  5I0D A;  2R0F A;  2ZEZ A;  4XMA A;  2IC1 A;  3OD0 A;  3AYE A;  2FCV A;  2MNG A;  1W9S A;  4LE4 A;  4LIT A;  2FZ2 A;  1XJA A;  3POJ A;  1ZRD A;  3KQ4 B;  2VNR A;  4IEU A;  5AFE A;  4QAW A;  1CAX A;  1RUC 1;  4CU8 A;  3IAP A;  2QQK A;  2X10 A;  2P6C A;  1WCS A;  4Y26 A;  4DMI A;  1CJD A;  2QQU A;  2Y33 A;  2WBK A;  4MHU A;  4DS0 A;  2KR2 A;  2SLI A;  3BTZ A;  3M8L A;  1DBN A;  3SHR A;  4ISQ A;  1DQ5 A;  1FNY A;  1LGB A;  3AP7 A;  4OZO A;  1HW5 A;  1DLL A;  1TME 2;  4FT8 A;  3C7E A;  3EJK A;  4A3Z A;  4AVS A;  1W6M B;  1ASJ 2;  2XJR A;  3PNA A;  1TMF 1;  1AJO A;  3IM0 A;  3GZE A;  5FIX A;  4AI8 A;  5FY1 A;  4WVM B;  5ANQ A;  3OBA A;  2JEM A;  1AXY A;  1DCS A;  2FMY A;  5GLU A;  3VBH A;  3VHO A;  2HYK A;  4RR3 A;  4BDV B;  1D4M 2;  3TEZ A;  4M0H A;  1YIF A;  4EN6 B;  4CUG A;  5IHR A;  1UZZ A;  5ACA 1;  2W2I A;  5A32 B;  4LJH A;  1IZ3 A;  4GWM A;  4CDU B;  5JWP A;  5F5Q A;  3NJZ A;  4Y33 A;  1RUG 2;  1DIW A;  4LK7 A;  4K1Z A;  1W8W A;  1RMU 3;  2VQA A;  2PA7 A;  4QXH A;  1OA4 A;  1VB2 A;  2BUK A;  3BPS A;  4R8H A;  1C3H A;  5E89 A;  3OYW B;  4IEP A;  4OHW A;  4HKO A;  5CFD A;  3WF0 A;  5CKQ A;  1B35 B;  1TE1 B;  1L7R A;  4UOJ A;  4CDU C;  3H8R A;  1LEM A;  4Q2F A;  4UT5 A;  4M3C B;  4P5H A;  3TN9 3;  1FXZ A;  1PO2 2;  5FRA A;  5FLI A;  2WNE A;  3JQW A;  4Y22 A;  5D8A A;  4ZS3 A;  4AQ6 A;  3LIG A;  4GUL A;  5A3W A;  5FWJ A;  2J22 A;  4GMP 1;  1PIV 2;  4Q0U A;  3KF5 A;  1DYP A;  1H2M A;  1IPK A;  2WZR 2;  5FYZ A;  3THT A;  2BPA 2;  1SDW A;  4EZ4 A;  1QJX 2;  1KQR A;  1CJP A;  1LJ7 A;  4QX0 A;  1JHJ A;  4CCC A;  4WBB A;  4UW6 A;  1B35 C;  1OI6 A;  2ERF A;  3POF A;  3RG0 A;  1MVE A;  2JWP A;  3QCW A;  5L9V A;  3N4M A;  1RYY A;  3HQU A;  5FV3 A;  3BTX A;  3I3B A;  2JB8 A;  3GDB A;  4GB3 1;  5L9B A;  1V6O A;  1VMJ A;  3S5Q A;  4E4H A;  5BYN A;  5HPO A;  4AAP A;  3GJA A;  4J6G A;  3DYO A;  4XUR A;  1KD7 A;  3ZXE A;  2BP6 A;  5FDB A;  4LBN A;  1K5M A;  4F3J A;  2AZ5 A;  4CEY B;  3RZH A;  3FE5 A;  2JX9 A;  1U5Y A;  2XWB B;  1AXK A;  2D6M A;  2Q1Z B;  4P9X A;  1GWK A;  2JDZ A;  2P3I A;  3FLR A;  2ZTN A;  4A6S A;  3TRS B;  2W52 A;  2RS3 3;  1R09 1;  3O0W A;  3OG2 A;  1K5J A;  2C0Z A;  4IEQ A;  3IPV A;  4JTO A;  1WMX A;  4I2O A;  4AAX A;  1W8Z A;  1XSQ A;  2GMM A;  4GH4 B;  2WR9 A;  4QXC A;  1RVF 2;  4CEY C;  1KFU L;  4AI0 A;  5GZC A;  1W9W A;  4PHZ A;  1HXS 2;  5JOY A;  1OH4 A;  1CAW B;  3KVA A;  4MO3 M;  4E4D X;  3KCX A;  1UY4 A;  4RGA A;  4H7L A;  4HPK B;  3PU8 A;  2ZGN A;  2VOW A;  2DUP A;  4RS5 B;  4BXF A;  3RRD A;  4AR2 A;  4ES9 A;  1UIK A;  5KHK A;  4MG2 A;  5JMO A;  3RJ2 X;  3S0M A;  2WC2 A;  1EV1 2;  3FWE A;  5A7P A;  1G9A A;  4GH4 C;  4ZHN A;  4XF0 A;  5CG9 A;  3BCW A;  2BFU L;  4FPK A;  4GWN A;  1JZ8 A;  5A1A A;  1HV1 A;  3P6B A;  1UU6 A;  2VZQ A;  1UU4 A;  3BOW A;  2NN8 A;  4D3W A;  5L7O A;  5GM0 A;  2GNM A;  4RS5 C;  3RPQ A;  1D2Q A;  3RDI A;  2C4X A;  3JD7 3;  3ZYJ B;  5FZC A;  2GNT A;  4OQ8 A;  3JBG 1;  3AZY A;  3K3O A;  4YM1 A;  1EYB A;  3JCI A;  4NRQ A;  5B4X A;  4AEJ A;  1A8D A;  2EIC A;  1BBT 3;  2ZAC A;  5JIA A;  1PGL 1;  4P9L A;  4IEW A;  1LOF A;  2WWU A;  3PUS A;  3VBO A;  1AR8 1;  5KXE A;  2CU5 A;  5ABJ A;  2H6C A;  3ZYH A;  1LR5 A;  2AC1 A;  4WV8 A;  1CGP A;  2BQP A;  1NLR A;  4WVZ A;  2VBD A;  3NNJ A;  3IN9 A;  4FPJ A;  4Q4X 3;  2R07 1;  3E6C C;  2DVB A;  1YIP A;  4Y5T A;  3AL5 A;  1UL9 A;  3JQX A;  4NE9 A;  1WKY A;  4IE0 A;  5FMB A;  3WF2 A;  1SBF A;  3IMN A;  5I0T A;  1D4V B;  4AHX A;  5FY0 A;  4TSV A;  1H8T B;  4UBH A;  3D0J A;  3ACL A;  3U1X A;  2E7T A;  2E53 A;  5FK7 A;  5HCA A;  2ZAB A;  3VBU A;  5FZ9 A;  3ZSL A;  1GZC A;  1NE6 A;  1WUV A;  1RXG A;  3FUQ A;  1H9W A;  3HD8 B;  3JUU A;  3ZFG B;  3O1O A;  3CZU A;  3J7L A;  3A21 A;  4EN7 B;  5LA9 A;  2J1A A;  1DGW X;  3HN3 A;  4AI9 A;  2ZGL A;  1KFX L;  3ZN4 A;  3MID A;  5CFC A;  5I91 A;  3H8X A;  1W04 A;  1LKN A;  1CVN A;  1H8T C;  2D98 A;  3LFI A;  4H55 A;  4KL1 A;  4XXP A;  2YPD A;  3J8F 3;  4B7E A;  4EN8 B;  2MHF A;  5AFB A;  1UNB A;  2GAL A;  2GH2 A;  3FBY A;  4CPB D;  4COY A;  2H0B A;  2RDQ A;  3ZFG C;  2XDV A;  5CG8 A;  2O14 A;  2ARC A;  3I2G A;  3HJR A;  4FPF A;  2PHX A;  2E7Q A;  1DGW A;  3BUC A;  3SKV A;  2B4K A;  1XE0 A;  3WHU A;  1KEX A;  4W6Y A;  4IV3 B;  3GCW A;  1VBC 3;  5C9A A;  2UYA A;  4V2W A;  1HJG A;  2YG0 A;  3NKG A;  1H9P A;  3NW4 A;  2OZJ A;  4KI5 M;  3ZYI B;  4EN9 B;  4IQP A;  2OA2 A;  1R64 A;  5KC6 A;  5EV7 A;  1DGL A;  4RQP B;  1DGR A;  1I5Z A;  5JPN B;  4IV3 C;  1UU5 A;  1WW5 A;  1MZ6 A;  4RSU A;  2GZW A;  5H9S A;  5DZE A;  1TNF A;  4D0Q A;  4DUW A;  1QKQ A;  5J98 B;  3NNF A;  4ZKT B;  2V5Y A;  4FTB A;  2D43 A;  3LZZ A;  4LBQ A;  3PHM A;  4JDM A;  4Y4R A;  1Y43 B;  3I59 A;  4MGS A;  5JR2 A;  2DU0 A;  2XBO 3;  3VHP A;  1YC6 1;  5FPB A;  1W03 A;  4A42 A;  4GKY A;  4RQP C;  1Y3T A;  1Q3E A;  4PI0 A;  5A80 A;  2HWF 3;  4XF9 A;  1NOV A;  3KQR A;  3WW4 A;  2C24 A;  1QDC A;  4YVW C;  5LY2 A;  1WW6 A;  1W99 A;  5C71 A;  1J3R A;  4LT5 A;  2ADD A;  1ULC A;  3JD7 2;  4BK5 A;  4DFS A;  2HBU A;  4BQ4 A;  4CP0 A;  1OPO A;  2JDY A;  4K8F A;  3MW3 A;  4OHY A;  2QQW A;  1BBT 2;  4LMF A;  2PLV 3;  4CE8 A;  1POV 1;  4A7Z A;  5JOZ A;  5DAV A;  2ZS6 B;  2RMU 1;  4XIO A;  4EWE A;  1F15 A;  2VZU A;  5DDJ 3;  1NXD 1;  5FXV A;  2F6B A;  4LPL A;  1RUF 3;  3WW2 A;  1MS0 A;  3VD5 A;  3GYD A;  2XJQ A;  4E9K A;  1Q8Q A;  2JDK A;  1PGW 2;  3M1H A;  3NJY A;  1PVC 3;  5FUI A;  4Q4X 2;  2B9U A;  1PVX A;  2YFU A;  2JD4 A;  2Q30 A;  5BNO B;  4M3C E;  1RUI 1;  4IE5 A;  1RHI 1;  4MAD A;  1OQE A;  1GUI A;  3T3Y A;  3B93 A;  3TAY A;  3ZSK A;  2VCB A;  1QJU 1;  4IGO A;  1PMJ X;  2VZO A;  3KB5 A;  3CHX A;  2NM1 A;  5A33 B;  4N90 A;  2K2S A;  5APA A;  1W3V A;  2D6K A;  1UY2 A;  4XFI A;  4FPG A;  4QPG B;  5FYV A;  5BNO C;  4B8E A;  1ND2 B;  2LRP A;  4XW3 A;  1ZBE 3;  3H1Y A;  5E16 A;  1GKB A;  2ZHM A;  4CCM A;  2F4P A;  2ZGK A;  2LW8 A;  3WHT A;  5K4L A;  2I07 B;  2D6L X;  3MYX A;  2ZGO A;  3J8F 2;  5FYY A;  4BZ4 A;  3DGT A;  4W6W A;  1BMV 1;  1TG7 A;  4EWD A;  4BYY A;  4Q0P A;  1TQ5 A;  2Q8E A;  3DXU A;  4Q1P A;  2HWB 3;  4QPG C;  4W50 A;  2X5I B;  3R4S A;  1ND2 C;  2IUW A;  1G9C A;  3DUI A;  3PTY A;  5A1L A;  2ZEX A;  1FPN 3;  4S2G A;  4R9B A;  1BCX A;  2CV6 A;  1YFY A;  5IVC A;  3BTY A;  2BGP A;  1ZRI A;  2WT1 A;  4JKK A;  2WRA A;  1HX6 A;  1VBC 2;  2XUE A;  3TBD A;  3NV4 A;  1TEI A;  4HN1 A;  5GJ6 A;  2R06 1;  1JZ2 A;  2VJX A;  1IGO A;  1H4G A;  3H1W A;  2X8K A;  4RHV 1;  4AF9 A;  4JRA A;  4UFJ A;  4AED A;  3UJQ A;  3UGH A;  4IEX A;  2X5I C;  3WQ0 A;  2J1R A;  3LE0 A;  1GNZ A;  3S7I A;  3KHB A;  1H1I A;  3B9I A;  4AVB A;  1VRH 2;  1AYM 1;  3FJS A;  5I0R A;  2WO2 A;  2P4E A;  4RA0 A;  2BNO A;  1ALY A;  1O3R A;  3BU7 A;  1VP6 A;  5BXX A;  3T1M A;  2Q8D A;  3VBF B;  4A44 A;  1NUK A;  2W46 A;  4S2H A;  2NMN A;  1LHW A;  1C5I A;  3AKR A;  1FX5 A;  2JG9 B;  4R9A A;  4LO5 B;  1UCX A;  3VZK A;  2RS5 1;  3T2Q A;  4QPI C;  4LOS A;  1UZW A;  1QNW A;  4QM8 A;  1RJ7 A;  5FQ0 A;  1SPP A;  5J37 A;  1H6Y A;  3QLQ A;  3RS6 A;  4IV1 B;  3UYJ A;  2HWF 2;  4LHL A;  4V2V A;  5C70 A;  1ND3 A;  4LBJ A;  3OCP A;  4LKE A;  2HWD 3;  1COV 1;  3E6B A;  1R08 3;  2VOV A;  3SCG A;  3VDA A;  1P8J A;  2JG9 C;  2P3Y A;  2VBB A;  4LBK A;  4BLI A;  4HK8 A;  5DXD A;  3ZPY A;  4HKL A;  3K48 A;  3LWC A;  1VB4 A;  1LU2 A;  2ZGU A;  4K3U A;  2NMO A;  1W9T A;  5A3M A;  1E5S A;  1BXH A;  4IV1 C;  1ZZ7 A;  4BHP A;  2G4I A;  5I8T A;  3M3E A;  4D7T A;  1HB4 A;  2XJP A;  3B00 A;  1RUF 2;  4A4A A;  2QFE A;  4BQ3 A;  1K45 A;  1KS5 A;  4QDS A;  1W2T A;  4AFB A;  3OTF A;  4F7Z A;  4FPH A;  4RN5 A;  2VMI A;  1QMJ A;  2R49 A;  3AC0 A;  3LAG A;  1G9B A;  5DMY A;  1W8O A;  2GN3 A;  5F32 A;  5IK7 A;  2I2S A;  1W6N A;  2LTN A;  2XG3 A;  1NE4 A;  5FWE A;  2WFF 3;  4XOG A;  4CUC A;  1GU3 A;  3CEW A;  4CEW B;  2XJS A;  4NHM A;  5JMC A;  2PHW A;  3N7J A;  2WS9 1;  4OHV A;  3FHA A;  1OVS A;  2ZGS A;  1G86 A;  5CU1 A;  5AC9 2;  4AEK A;  4E2S A;  5BNN A;  1QDO A;  2RM2 3;  4Q4W 3;  1UAI A;  4PBO A;  1MQT B;  4N53 B;  4JQT A;  1OHF A;  1AYN 3;  3VKF C;  4MSV A;  1SEF A;  5FOB B;  3OGV A;  3FUO A;  2I74 A;  1W9Y A;  4D6S A;  3WIN E;  4DUV A;  1JYT A;  2ZX0 A;  1DQ0 A;  1ZRF A;  3RZZ A;  2VZR A;  3PTR B;  1YQ5 A;  1L7L A;  1FNZ A;  2WQ4 A;  1FI2 A;  4P9W A;  4UAP A;  2JKB A;  4BK4 A;  1PO1 3;  2WNU A;  3ZFE B;  2WT2 A;  1J59 A;  3MBW A;  5FZA A;  1N3P A;  4DXS A;  3AZW A;  5C8C B;  3I3M A;  1MQT C;  1UY1 A;  2HWB 2;  4IXL A;  1Y9G A;  3ACF A;  5HXV A;  3ABZ A;  1FPN 2;  4GKX A;  1HRI 1;  1NA1 A;  2VH9 A;  3MW4 A;  4CCN A;  4FVV A;  5F3I A;  3MUY 1;  1PNG A;  1PX4 A;  1EAH 1;  2B39 A;  2VTX A;  3ENR A;  3LDB A;  3MEP A;  3WUC A;  1CAV A;  4KWJ A;  3ZFE C;  1GQH A;  3D4K A;  5C8C C;  5FK8 A;  1DQ4 A;  3D3A A;  2ARB A;  5KHH A;  1IS3 A;  4UBG A;  2VCC A;  4WM8 B;  4CSW A;  5FZK A;  3RZL A;  4HLT A;  4EWA A;  1URX A;  2AH2 A;  1AUY A;  4LHN A;  5FJK A;  4IGP A;  5T54 A;  3USU B;  5LEK A;  1YHF A;  2BZD A;  2HWC 1;  5J09 A;  2OW4 A;  3PIJ A;  4I3G A;  1NXM A;  2OX0 A;  4NAM A;  1HRV 1;  1XYP A;  1NCR C;  2WN2 A;  2FDJ A;  3SEP A;  4Y4Y A;  1RUH 3;  5IAX A;  3CO2 A;  1HQN A;  4LXL A;  5SV8 A;  4C91 A;  4DEV A;  4WM8 C;  5FZG A;  1GZ9 A;  1L3J A;  5DG2 A;  3WX5 A;  1VBD 3;  4WM7 B;  4XFB A;  2VTF A;  3OSD A;  2EID A;  3PU3 A;  5HCF A;  2PYT A;  5E6H A;  3WV6 A;  1AVB A;  2MEV 2;  3J26 N;  2QQO A;  2WO3 A;  1FOD 3;  1LHV A;  1V6M A;  2HWD 2;  3HT2 A;  3GXU A;  4ES8 A;  1YQ8 A;  3HR9 A;  4Q0V A;  4BE3 A;  3WD5 A;  1OLM E;  5TSW A;  3OUJ A;  3BTA A;  3NV2 A;  2OKX A;  4Z1V A;  2IVJ A;  2HJI A;  5BY5 A;  2A6X A;  2XWJ B;  3VDD A;  5IVV A;  4WM7 C;  3U37 A;  4AK3 A;  1E5H A;  3I2I A;  3ZSJ A;  4AYU A;  4ET7 A;  5FYS A;  3RJR A;  3WNX A;  4BB3 A;  2ZBJ A;  1MR5 A;  3NST A;  2CWS A;  1I6X A;  2YFZ A;  2A73 B;  1C28 A;  5FKC A;  4CCK A;  1VBA 3;  4R4X A;  1QJY 1;  2BOJ A;  2B8M A;  3AP6 A;  1QQP 2;  2XR4 A;  4HVO A;  4Y1Z A;  3VL9 A;  3I7D A;  3ZXF A;  5EYY A;  4QX1 A;  2FMD A;  2Y26 A;  3J9S A;  1W6Q A;  2RM2 2;  2PHL A;  4LKD A;  3H50 A;  3MIC A;  4Q4W 2;  3PUA A;  4RFR B;  1JS9 A;  4CDX A;  4FXG B;  1ULD A;  3CJI B;  1AYN 2;  1FV2 A;  3SCF A;  1UKG A;  1EPW A;  4JGY C;  3T2T A;  1AR7 3;  1U5Z A;  3M7A A;  3IDB B;  1ZBA 1;  1CZT A;  2WAO A;  5J1X A;  5FPU A;  2JIJ A;  3PJY A;  2A70 A;  1XQN A;  4IND A;  2E51 A;  4FXK B;  3MFC A;  3KCY A;  2HYX A;  1PO1 2;  2C6S A;  2FCU A;  2YBS A;  3D5O A;  5AC9 1;  2WA3 A;  1RIT A;  2CY6 A;  1JYV A;  4ERO A;  2WJS A;  1W6P B;  2DTY A;  4UFM A;  3CJI C;  5IAV A;  5T5J A;  1RIN A;  3D82 A;  3WCS A;  3HQR A;  2YB7 A;  3LFM A;  1O8S A;  2Q1F A;  1NLQ A;  2PQQ A;  5HI0 A;  3O1M A;  4GWI A;  2JG8 A;  1OA2 A;  2WDB A;  3AYC A;  1C8N A;  2ETE A;  2YC0 A;  4BCU A;  2UYB A;  2RS1 1;  3B9C A;  4W6X A;  1DZQ A;  1S0F A;  3SMH A;  1WA6 X;  2WO1 A;  1Z7S 1;  5EYX A;  5FZO B;  1RB8 G;  4BQX A;  3LPF A;  5G05 L;  3W5N A;  3CNA A;  1YFU A;  3EQE A;  3I2J A;  2WZR 1;  5AVA A;  4ARY A;  1T6B X;  2J7M A;  2EXJ A;  2VXJ A;  4FCA A;  1Y7B A;  1O3T A;  3EB7 A;  5J48 A;  4YVS A;  2RG4 A;  5FOJ B;  5FAX A;  4YG0 A;  3ES1 A;  2BVV A;  3ST7 A;  1RUH 2;  5FP7 A;  3NV3 A;  4Q4Y 1;  5EHD A;  4NWV A;  4QT6 A;  2D97 A;  3MFA A;  3ELN A;  4JGZ B;  4LQR A;  2DCT A;  1D4M 3;  1NZI A;  1WCK A;  3A0N A;  4LIV A;  4QQO A;  4NPM A;  1VAV A;  3BN6 A;  3CKH A;  1J1T A;  2Z4F A;  4FFF A;  5FPL A;  3OEA A;  4K1Y A;  3RQ0 A;  3W59 A;  4P02 B;  3BKZ A;  4BWO A;  3WZ1 A;  1SLI A;  4XQD A;  1W6M A;  2C1F A;  1US3 A;  2KD7 A;  1C5H A;  2G1M A;  3GNE A;  1GOH A;  2IFW A;  2XB6 C;  3ACI A;  3HQX A;  4JGZ C;  2IXJ A;  3T30 A;  1WCD J;  1NKG A;  3O1U A;  1F8V A;  1UKR A;  1GSL A;  4UF0 B;  4FOV A;  2BNM A;  2BOI A;  1MZ5 A;  1UXX X;  1CQ9 A;  1PO2 3;  2PQS A;  4E2Q A;  1BEV 3;  5E1R A;  3T0A A;  1LB2 A;  3GCX A;  3RZM A;  2JDU A;  5LBC A;  3VD3 A;  5A32 A;  2JB4 A;  1MS1 A;  2QQV A;  1VBA 2;  5CEH A;  2OYZ A;  1I1E A;  4PLO A;  3AX4 A;  3POB A;  1NLS A;  3A22 A;  1QJX 3;  2WUH A;  2NQY A;  4R4Z A;  3S30 A;  5HCB A;  3RI8 A;  5JAX A;  3OYW A;  5F5I A;  4FFG A;  4OI1 A;  1UX7 A;  1QOT A;  2DFC A;  4RYD A;  1NQD A;  2VCM A;  2D5F A;  2ORX A;  1N47 A;  2RR1 3;  4B3N A;  1DP0 A;  2PFW A;  4I0A A;  1PK6 A;  1TVG A;  4Y1Y A;  1OFN A;  2PAK A;  2WZE A;  4XCA A;  3WG2 A;  3N9M A;  4BME A;  4Z82 A;  3NQH A;  5EXO A;  3POE A;  3ZFF B;  4BQY A;  4H7M A;  4AFD A;  2SBA A;  1GOG A;  3KVB A;  5E8A A;  4PIX A;  1CAU A;  1Q8P A;  4KGG A;  1HB2 A;  1V9U 2;  2ZHK A;  3RZK A;  1RMU 1;  2V72 A;  2BDR A;  3M3O A;  4DQA A;  1KDK A;  2AUY A;  3AXD A;  5GZE A;  1JI6 A;  3IWZ A;  4KGQ A;  1GIC A;  1UN1 A;  4FOW A;  3HIF A;  5L19 A;  1ZRR A;  1YFW A;  2E9Q A;  2DCY A;  1ULG A;  1PNF A;  2R04 2;  3R4D B;  1FMD 2;  1RVF 3;  1YWK A;  3ZFF C;  5LK7 B;  3C7H A;  4AG4 A;  3AXE A;  4A7K A;  4F83 A;  2QQJ A;  2ES3 A;  2JDA A;  4LA3 A;  3TN9 1;  3UGF A;  1HB1 A;  4X6Q B;  3UKV A;  1EPZ A;  3WSO A;  1HXS 3;  1IQD C;  3WUD A;  2XLA A;  4LBQ D;  2YU2 A;  4FO9 A;  4XQW A;  2WNV B;  3DKW A;  3ZXG A;  5BNQ A;  3NAP B;  2IXL A;  4PQQ A;  5D2A A;  5LY1 A;  3DYM A;  2ZOE B;  3S5A A;  3MV1 1;  1V0A A;  4GJY A;  1EV1 3;  1OOP B;  4DY3 A;  1AR6 3;  1YXW A;  4AFC A;  4AHZ A;  1SZB A;  2VOX A;  4PDW A;  3C3V A;  5CYY A;  2X29 A;  3U07 A;  3ZN6 B;  2WNV C;  4NWW A;  4ASK A;  2CTV A;  3NAP C;  3CJX A;  2UUR A;  1XRU A;  3N9N A;  5FZB A;  1CAW A;  3M3Q A;  1Q8S A;  3IIA A;  1XB9 A;  4HPK A;  1C1F A;  1OOP C;  1OVP A;  1VBE 1;  2WYF A;  3AKT A;  1UX6 A;  3PJQ A;  4XE9 A;  3ZDS A;  3OF1 A;  3O1V A;  1GLH A;  5BPX A;  3ZX7 A;  5KR7 A;  1QH6 A;  1X9P A;  1GNH A;  2VAU A;  4BOW A;  4QKF A;  3BVC A;  2RS3 1;  4FP3 A;  2VQ0 A;  2R1D A;  3LPG A;  4BJ0 A;  4JDN A;  3AKS A;  1O5L A;  1D7P M;  4BQW A;  2OT7 A;  1A8M A;  5I93 A;  4MGK E;  1HQW A;  1IG0 A;  2AR6 A;  2R16 A;  1R1A 1;  5C33 A;  5FYT A;  4YGD A;  4AQT A;  1QXR A;  5FZ0 A;  2A5Z A;  5FFO C;  1YJL A;  2NLR A;  4A7Y A;  1BEV 2;  1FYU A;  4COW A;  1RUE 1;  1AXZ A;  4QDR A;  4DIN B;  4JAA A;  4L2N A;  4TLF A;  1WZX A;  1AJK A;  2TBV A;  1WLD A;  4ZU4 A;  4QKB A;  4D7S A;  3THC A;  4RGK A;  2XML A;  3BYW A;  1VIW B;  1GBG A;  4A41 A;  4NIA A;  2K46 A;  3AVS A;  2E31 A;  3WDV A;  1JZ6 A;  3OBZ A;  4PF1 A;  4XIK A;  4YYO A;  5JSO A;  1RED A;  3ZVX A;  3WP3 A;  4JV4 A;  3LA2 A;  3V0B A;  1IKQ A;  2GSY A;  3HWJ A;  3FBM A;  3OD4 A;  4QX7 A;  3URF A;  2RR1 2;  2JE8 A;  4IGQ A;  1F4H A;  1RUC 3;  2W08 A;  2XJT A;  1US2 A;  1GZW A;  5FLJ A;  3DXT A;  3BGA A;  4P00 B;  3FN9 A;  5GKA C;  3BI3 A;  3GBW A;  2I45 A;  2V4V A;  2K0G A;  4NR1 A;  1YJK A;  4FSJ A;  1ZZ9 A;  3TNQ A;  2VUA A;  4TN7 A;  1WLC A;  1W05 A;  3SQO A;  2DWR A;  3UES A;  5K0U C;  2E32 A;  2PMW B;  4WVV A;  5CIS A;  2WII B;  1HN1 A;  4XAA A;  4IL7 A;  3T09 A;  1F35 A;  1QHD A;  2Y0I A;  3KM5 A;  3G6J B;  3WP4 A;  2Q0A A;  5FMO S;  1CAX B;  1XU2 A;  1YQ6 A;  5C3Q A;  3MGU A;  4L99 A;  3ACG A;  3HEI A;  2ZHL A;  3MIH A;  5H9R A;  4YZ5 A;  1MAC A;  3VKN A;  2CHH A;  2EIB A;  4YM2 A;  4CCE A;  2VQU A;  3H3U A;  3HVD A;  1OA3 A;  5LZ6 A;  3KS7 A;  3AFG A;  3TOJ A;  2Z2S B;  3KT4 A;  5A7W A;  1CZS A;  4CU7 A;  1MVQ A;  5ACA 3;  1AR6 2;  1PM7 A;  3L2Y A;  1FT9 A;  1BQP A;  3DV8 A;  3VD4 A;  5DAW A;  1ZNP A;  4QB2 A;  5C4W A;  3ZN5 A;  3C7F A;  4G9S B;  2PXJ A;  4PBP A;  5CVR A;  4OVE A;  2VU9 A;  2VEC A;  2BV4 A;  3ORJ A;  1PZ9 A;  3ECQ A;  5B4N A;  2KXL A;  4GD4 A;  3ITQ A;  2WSV A;  1HDK A;  2UWC A;  1H6X A;  3VBH B;  1QXJ A;  2GC2 A;  4RR3 B;  4SBV A;  2XON A;  2VL4 A;  2Y6H A;  4R9D A;  1JU4 A;  2ZJC A;  3UV9 A;  1CZV A;  1NX9 A;  2QE3 A;  2E7A A;  4NPL A;  2R7E B;  4YW3 A;  3Q8C A;  4I01 A;  3IT8 A;  1DYK A;  2WAA A;  5JIU A;  2BW8 A;  2C5D A;  4P9G A;  2ARA A;  4S2F A;  3SKJ E;  3WDT A;  1XNB A;  3ZXK A;  4Z92 B;  3VDB A;  2ILM A;  3VBH C;  3BU0 A;  4HFS A;  3UT0 A;  1QU0 A;  4RR3 C;  2DCK A;  2GMP A;  4GB3 3;  2VG9 A;  1WGP A;  4DXR A;  1L7Q A;  5CFD B;  1RUJ 2;  1B09 A;  4ARX A;  4DRV A;  4YRD A;  3NNM A;  5J7M A;  2YYO A;  2GC1 A;  4Y22 B;  5D8A B;  4FTS A;  1C1L A;  4P9I A;  3LD8 A;  5ERL A;  3VZN A;  1C8M 1;  3WXP A;  1UZV A;  2XBO 1;  4OLL A;  1LHU A;  2HKX A;  3B02 A;  4QQH A;  5FY5 A;  1YQ2 A;  1T6G C;  4IET A;  3OGJ A;  2Y34 A;  3OUI A;  4P9Y A;  3FX3 A;  5F8P A;  1WMF A;  5CFD C;  4BXS V;  1HQL A;  2BER A;  2FQP A;  2VUD A;  3NO8 A;  2DV9 A;  1QOS A;  3GZT B;  2OZ6 A;  1R09 3;  3AMQ A;  4YPJ A;  2DVA A;  4DRR A;  2GAU A;  4FPE A;  4LLO A;  2HWE 1;  2WQ8 A;  5IVF A;  1ZM1 A;  2UU8 A;  3OOX A;  1LRH A;  1S55 A;  4YG6 A;  1O4T A;  1AX2 A;  5D8A C;  5FRE A;  4MGZ E;  1OC1 A;  1J58 A;  1I9R A;  3TEW A;  1SCS A;  3N9Q A;  1J3P A;  1RUC 2;  4UFI A;  3VGI A;  1DQ2 A;  1K3I A;  5FYM A;  1WCQ A;  4XFG A;  1XC6 A;  5JZG A;  2VUJ A;  1K5M B;  1O59 A;  2PLV 1;  2D5H A;  1VBB 1;  4HL0 A;  3MHZ A;  3IAQ A;  2VMC A;  3AFK A;  5A33 A;  4Q1R A;  5DDJ 1;  5J96 B;  3CQO A;  2X53 S;  1LOD A;  3WCR A;  1O7F A;  1RUF 1;  2P34 A;  1U5I A;  3H7Y A;  1S0G A;  3K4Z A;  4IEY A;  5FYU A;  4V1P A;  3QH7 A;  2FDI A;  1GZT A;  1ND2 A;  2WA4 A;  2XQR A;  5JR7 B;  1UWW A;  4MX3 A;  3HBK A;  3CF6 E;  4K6B A;  1PVC 1;  4XF3 A;  1OQD A;  4A2U A;  4J1W A;  1Q56 A;  2MPF A;  3APB A;  4IES A;  3IPV B;  5FZE A;  3T1L A;  2FDF A;  3WQB A;  4IW3 A;  2FCT A;  3OB8 A;  1K5M C;  3H0O A;  1TMF 2;  3C8X A;  4JDO A;  4UW3 A;  3P3N A;  3W21 A;  4CP9 B;  4CTE A;  4CVU A;  1ZRC A;  1AR9 1;  2Z79 A;  2OPW A;  2W1U A;  1N3O A;  1JZ3 A;  2ZMN A;  3I49 A;  1VRH 3;  5JSR A;  2BEO A;  3RI9 A;  2PHD A;  3JBG 3;  2K9Z A;  4Y3O A;  3BIE A;  4E8D A;  4BIO A;  5BUV A;  4HT1 T;  3AMH A;  4YVW B;  5LAS A;  4DIQ A;  4J25 A;  2TUN A;  4NMI A;  2CNA A;  4QB6 A;  5ACA 2;  2VC9 A;  1Z78 A;  2ET1 A;  1ZBE 1;  2Q5T A;  1DFQ A;  2XGX A;  3FLP A;  2VPV A;  1G9F A;  4CXW A;  3T0D A;  2DU1 A;  3QD6 A;  1O6U A;  2RDS A;  2Y6L A;  5A3T A;  5JUV A;  2VME A;  5EQU A;  3M3I A;  1H2K A;  2IXH A;  3WG1 A;  4LNV A;  4B1L A;  5L7O B;  4C1X A;  1W8F A;  2V73 A;  2OQ6 A;  2YBP A;  4DEQ A;  5BNP A;  1POQ A;  4MLO A;  4UFL A;  5EZW A;  3H1M A;  2P5B A; 
#chains in the Genus database with same CATH homology
 3DEC A;  5DN2 A;  4DUV A;  3C7G A;  4DUX A;  2VZR A;  1PMH X;  4UAP A;  2W5F A;  2XOM A;  5G04 L;  4BK4 A;  5JXH A;  2Y8K A;  3HOB A;  3MBW A;  4DXS A;  1W8N A;  1UY1 A;  1EUU A;  3HNY M;  1OF3 A;  5JXJ A;  3ACF A;  2E26 A;  1XNA A;  3ABZ A;  4QDQ A;  3UET A;  2VZ1 A;  1ULP A;  3P1I A;  2W94 A;  3MUY 1;  1PX4 A;  2ZEY A;  4UI9 L;  3E1F 1;  2DDU A;  2C9K A;  4JHZ A;  3D3A A;  2V5D A;  2W87 A;  2VCC A;  3NJX A;  2W91 A;  3LEK A;  1ULO A;  3PUI A;  4OMC A;  3EYP A;  2BZD A;  1UY3 A;  3WNL A;  3ACH A;  2HLE A;  3NJV A;  3LEI A;  3VD7 A;  3SEP A;  2WN2 A;  3C7O A;  4FI9 A;  2QQN A;  4E8C A;  4ZXE A;  4DEV A;  2LS6 A;  5F7U A;  2VTF A;  3F2Z A;  2EID A;  2W9X A;  3MUZ 1;  3WNN A;  2QQO A;  2WO3 A;  4A45 A;  3GXU A;  4ZZ8 A;  3NRU A;  1K12 A;  4PT6 A;  1JZ7 A;  2OKX A;  5I0D A;  4D8M A;  2ZEZ A;  3U37 A;  3ZM8 A;  3I2I A;  5CZK A;  4ET7 A;  1W9S A;  3THD A;  1GOF A;  1UMH A;  1K42 A;  2VZT A;  5LA1 A;  4ZZ5 A;  1OF4 A;  2YFZ A;  4QAW A;  3IAP A;  2QQK A;  2X10 A;  2RV9 A;  2WBK A;  1SG3 A;  2XHN A;  4QX1 A;  4OZO A;  2QQM A;  3C7E A;  1CIY A;  4A3Z A;  1I5P A;  3WF1 A;  3WNK A;  4JX0 A;  1CZT A;  2WAO A;  1XNT A;  3OBA A;  5J1X A;  3JXS A;  3PUH A;  1F4A A;  2HYX A;  4BDV B;  1UYX A;  1JYV A;  3IB3 A;  5IHR A;  2J1T A;  2YB7 A;  4QPW A;  1O8S A;  2W1S A;  2ZXQ A;  4OUE A;  3MV0 1;  4GWI A;  2WDB A;  2JD9 A;  3OGR A;  5IJR A;  2C26 A;  2WO1 A;  3LPF A;  5G05 L;  3W5N A;  3I2J A;  4XUT A;  4ARY A;  3WF0 A;  2J7M A;  4TTG A;  4XZU G;  1L7R A;  4UOJ A;  3VD9 A;  3WEZ A;  4CU8 A;  3EB7 A;  1OT5 A;  4KMQ A;  2J22 A;  5LCW L;  5IYY A;  3LQC A;  4QX0 A;  1JHJ A;  1UY0 A;  1RYY A;  4LQR A;  3W5M A;  3I3B A;  3GDB A;  5HPO A;  2J1U A;  2RVA A;  4OMD A;  2ZEW A;  3BN6 A;  2Z4F A;  3CKH A;  1JZ5 A;  3OEA A;  3DYO A;  2X09 A;  4XUR A;  4P02 B;  4CU6 A;  4QB1 A;  3NNG A;  5IFP A;  1GQP A;  4P08 A;  1US3 A;  2KD7 A;  1GOH A;  3ACI A;  3I2K A;  1NKG A;  2VOT A;  5C7G A;  3OG2 A;  1UXX X;  1J83 A;  4AAX A;  2PQS A;  3T0A A;  3VD3 A;  1W9W A;  1PX3 A;  1OH4 A;  4MO3 M;  1UY4 A;  1UYZ A;  3A22 A;  2WUH A;  5JMO A;  1UX7 A;  5IFT A;  4RYD A;  3T2O A;  2ORX A;  2E33 A;  1DP0 A;  3MO4 A;  5A1A A;  4GWJ A;  2WN3 A;  4XVH A;  3P6B A;  1J84 A;  1TVG A;  2VZQ A;  2WZE A;  4W8J A;  3NQH A;  1GOG A;  3A7Q A;  2C4X A;  3I2F A;  4L0P A;  2X05 A;  2J1S A;  2V72 A;  2W1Q A;  1UYY A;  5B4X A;  1JI6 A;  3WNM A;  3I97 A;  2EIC A;  2BGO A;  2YC4 A;  3OEB A;  3K77 A;  2L9L A;  3C7H A;  4AG4 A;  2QQJ A;  2JDA A;  4HG6 B;  3WSO A;  1IQD C;  2W3J A;  4PQQ A;  1JZ4 A;  2VM9 A;  5EJZ B;  3DYM A;  3MV1 1;  4XUN A;  2WAB A;  1WKY A;  3WF2 A;  4ZY9 A;  3HPN A;  1CX1 A;  4QX3 A;  3WF3 A;  5CYY A;  3I3E A;  2BBA A;  3CZU A;  3A21 A;  3T2P A;  2J1A A;  3HN3 A;  1JYN A;  3CZJ A;  1MPX A;  3K4A A;  1W0N A;  3K75 B;  3LPG A;  5JXG A;  1JZ8 A;  1EUT A;  3I2G A;  3HJR A;  4BJ0 A;  3HNM A;  1D7P M;  3SKV A;  2B4K A;  1KEX A;  4MOA A;  5DQ0 A;  4OYU A;  1BHG A;  2YG0 A;  4KI5 M;  2CDP A;  4LKS A;  1SHW B;  4LHS A;  1R64 A;  5EIY B;  2W47 A;  4QDR A;  1JU3 A;  1NAE A;  4P5Y A;  3THC A;  4A41 A;  4DUW A;  2VZP A;  4TXW A;  2E31 A;  4D0Q A;  1JZ6 A;  4PF1 A;  4KWU A;  4MGS A;  3T0B A;  5JR2 A;  5LA2 A;  2VQT A;  2JE8 A;  1UZ0 A;  1F4H A;  4A42 A;  1US2 A;  3BGA A;  4P00 B;  3FN9 A;  4M4R A;  2QBX A;  3T08 A;  1W99 A;  2V4V A;  5C71 A;  4BK5 A;  4QX2 A;  3ETP A;  4M4P A;  3UES A;  2E32 A;  2J1V A;  1HN1 A;  3CDZ B;  3HNB M;  3T09 A;  4XUO A;  2VZU A;  4LPL A;  3UNP A;  3DYP A;  3VD5 A;  3ACG A;  2VZ3 A;  3HEI A;  1UXZ A;  2VMF A;  5FUI A;  2EIB A;  2YFU A;  2VQU A;  1O8P A;  2ORZ A;  2JKX A;  1LNS A;  4MAD A;  3WF4 A;  1GUI A;  3J7H A;  4CU7 A;  2VCA A;  1CZS A;  2VCB A;  3VD4 A;  1PMJ X;  2VZO A;  4QB2 A;  3C7F A;  3FHQ A;  1UY2 A;  3ECQ A;  5B4N A;  2WYS A;  1H6X A;  4JKM A;  1JYW A;  2LW8 A;  1JYX A;  3I3D A;  2XON A;  1UMI A;  2VL4 A;  2Y6H A;  1JU4 A;  1CZV A;  1NX9 A;  1TG7 A;  5LA0 A;  2R7E B;  1OD3 A;  2WAA A;  3WNO A;  2EIE A;  3SKJ E;  5DPN A;  4W50 A;  4GZ9 A;  4CUA A;  2ZEX A;  4IUG A;  3VDB A;  4XUQ A;  2Y6J A;  2BGP A;  4JKK A;  2DCK A;  4XUP A;  3I2H A;  2QQL A;  1L7Q A;  2VZS A;  4DXR A;  1SDD B;  1JZ2 A;  2VJX A;  4ARX A;  2XQX A;  4Z2A A;  5EJ1 B;  2VO5 A;  3GM8 A;  1DYO A;  2J1R A;  3LE0 A;  2VR4 A;  2W92 A;  2Y64 A;  1DLC A;  3WNP A;  1YQ2 A;  2WO2 A;  4BXS V;  2BER A;  3CIH A;  2DCJ A;  3FL7 A;  4A44 A;  4YPJ A;  1NUK A;  2W46 A;  3IDA A;  2WQ8 A;  1T2X A;  1GNY A;  3T2Q A;  1XPW A;  2CDO A;  1KGY A;  5JXI A;  1K3I A;  1H6Y A;  2VZV A;  1WCQ A;  4JKL A;  1XC6 A;  2VMD A;  1O59 A;  2RJ2 A;  5C70 A;  3IAQ A;  2WZ8 A;  2VMC A;  4MGQ A;  4A6O A;  3CQO A;  4CU9 A;  5HXM A;  3K4Z A;  3VDA A;  1P8J A;  3A23 A;  4W4Z A;  1UWW A;  2ID4 A;  2YC2 A;  1W9T A;  2Y6K A;  3WQB A;  3SEE A;  3OB8 A;  3C8X A;  4A4A A;  3CMG A;  4CVU A;  2W1W A;  1K45 A;  2J1E A;  1GMM A;  2W1U A;  4QDS A;  1JZ3 A;  2B9V A;  4RN5 A;  4E8D A;  3OGS A;  3AC0 A;  5DMY A;  1W8O A;  4CUC A;  1GU3 A;  4QB6 A;  2W95 A;  4CUB A;  2VC9 A;  3FHA A;  3GGL A;  3K4D A;  3K46 A;  3T0D A;  2Y6G A;  2Y6L A;  5JUV A;  3III A;  2VME A;  4DXT A;  4DEQ A;  3LEG A;  2QQI A;  3VDC A;  3OGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...