5DQ0A

Structure of human neuropilin-2 b1 domain with novel and unique zinc binding site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
157
Chain Sequence
CNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title To be published
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dq0A00
3C7GA 4ZZ5A 3E1F1 1RYYA 3A23A 5DN2A 1UXZA 2W94A 5C70A 5CYYA 2W1WA 1P8JA 3HPNA 1GQPA 2HYXA 2VZOA 1UX7A 2WAAA 2ID4A 3A21A 1YQ2A 4CU7A 3HOBA 1O8SA 1L7RA 2QQIA 2Y8KA 1XPWA 3OG2A 2ZEWA 4GWJA 1EUTA 4QB1A 1SHWB 1H6XA 4OMDA 2WAOA 2VZTA 3K75B 2WUHA 3MUY1 2W95A 2JD9A 2V4VA 2C4XA 3WQBA 2EIBA 3K46A 3LPGA 4W4ZA 3MUZ1 2LW8A 3PUIA 2Y64A 5JR2A 2JDAA 2VMEA 2ORXA 3LE0A 3WF0A 2RVAA 1SG3A 3ACGA 4L0PA 4GZ9A 4W50A 1UYZA 4DUXA 1JI6A 2WABA 3FHQA 2W1UA 2Y6LA 4D0QA 1CX1A 2BBAA 3UETA 1GUIA 2B9VA 1JZ7A 3P6BA 4XVHA 2VMCA 2VZPA 2V72A 3WF3A 4OMCA 4XUTA 5I0DA 1GOHA 3K4AA 4E8CA 1NUKA 1F4AA 3WNKA 1XC6A 2ZEZA 3THDA 3WNNA 1ULPA 2R7EB 4QDRA 3EB7A 1KGYA 2VZSA 1JZ6A 1UY3A 3LEIA 1GU3A 1UYXA 3ACHA 4JX0A 2W92A 4D8MA 2WZ8A 2W91A 3CQOA 4LQRA 3GGLA 1PX4A 4LKSA 2VQTA 4P00B 3W5NA 3HN3A 2W1SA 4QB2A 3ABZA 3I2HA 1W8OA 2VTFA 3I97A 3F2ZA 1WCQA 5LA0A 1L7QA 1IQDC 2QQJA 4CU9A 1OD3A 4YPJA 2J7MA 4RN5A 1JHJA 4FI9A 4BK4A 2ZXQA 3I2FA 5B4XA 3VD9A 4IUGA 2W1QA 3CDZB 2QQOA 4QX1A 5HPOA 3LQCA 3I3EA 3THCA 2CDOA 2BERA 2ZEXA 3NQHA 3K4DA 4XUPA 1TG7A 4MGSA 4BK5A 2ZEYA 5DQ0A 3WSOA 1W9TA 3I3BA 4BXSV 4CUCA 2VO5A 4BDVB 3C8XA 1W8NA 2WO3A 1OF3A 2WDBA 4QPWA 3I2KA 4JHZA 1UY4A 5IFPA 1PMJX 2EIEA 3WF2A 4GWIA 1SDDB 3U37A 2J22A 3AC0A 2YG0A 2C26A 5IJRA 4DXRA 4CUBA 2WQ8A 2VM9A 4A4AA 3CMGA 3T2PA 5C71A 2BGOA 3WNLA 2W9XA 2VZUA 1DP0A 4DEQA 4M4PA 2X05A 3A7QA 1OH4A 1XNTA 3FN9A 2VCBA 1JZ5A 1O59A 3UESA 2BZDA 5JUVA 3NRUA 4ARYA 2XOMA 3OGRA 4KWUA 3T0DA 2W47A 4A41A 4LPLA 2Y6KA 3NJXA 4A6OA 4ZXEA 4HG6B 3T0AA 3HJRA 2VMFA 3FHAA 1UXXX 3T08A 5JXIA 2OKXA 1JZ2A 3LEKA 4A42A 5JXJA 2WN2A 5C7GA 4UI9L 5EJZB 4PT6A 4CU8A 2VZ1A 3OGVA 1JU4A 1GMMA 5EJ1B 3IIIA 3MV11 2YC4A 4A3ZA 1GOFA 5B4NA 3MBWA 2ORZA 5CZKA 4JKKA 1I5PA 1CZTA 2VZVA 3GXUA 3P1IA 5LCWL 3W5MA 3T0BA 2QBXA 5G04L 3HNMA 3ACFA 3WEZA 2V5DA 1US3A 4OYUA 4W8JA 3GDBA 3NJVA 3WF4A 3C7HA 2E32A 4DXTA 2VL4A 1GOGA 1K45A 2EIDA 5DMYA 1H6YA 4P02B 5JMOA 3BGAA 3DYMA 1JYXA 4QX3A 4LHSA 4DEVA 2E33A 2VCAA 1UY1A 1KEXA 4A44A 4QDSA 5LA2A 2KD7A 4CU6A 3K77A 1R64A 4XUNA 2VC9A 2J1TA 3VD5A 4PQQA 3WNPA 2CDPA 3T2QA 1BHGA 1K3IA 4KI5M 5JXGA 2W46A 1JZ8A 4TXWA 3SKJE 2XQXA 4A45A 2QQKA 4DXSA 1D7PM 2VZQA 3VD4A 1JZ3A 2RV9A 3DYPA 2X09A 3SKVA 3VDCA 5J1XA 4QDQA 2L9LA 4ARXA 2J1EA 1LNSA 2Z4FA 4P5YA 3WNMA 3EYPA 2C9KA 1ULOA 2X10A 2YFUA 1NX9A 1DLCA 3BN6A 5IFTA 3HNBM 3OBAA 2EICA 2WO1A 3MV01 4AG4A 1PMHX 3HEIA 1W9SA 2J1UA 3K4ZA 1UY2A 2VOTA 3HNYM 1W9WA 2VQUA 1JU3A 3GM8A 3VD3A 4CVUA 4ZY9A 2DDUA 1F4HA 2WYSA 2W3JA 4MADA 3C7OA 4MO3M 2Y6HA 1US2A 1WKYA 2B4KA 4TTGA 4DUVA 3I2IA 4QX0A 1UWWA 2XHNA 3SEEA 2DCKA 3C7FA 3ZM8A 4ZZ8A 3IAPA 3JXSA 3SEPA 2QQLA 1XNAA 1NKGA 4QAWA 1J83A 2RJ2A 2VZ3A 1J84A 3VD7A 5EIYB 3OB8A 5A1AA 1UZ0A 2J1RA 4XZUG 4QX2A 1CZVA 5F7UA 5IHRA 4XUQA 3T2OA 3A22A 2WN3A 2VR4A 1CZSA 3WNOA 1UY0A 1T2XA 2WZEA 2E31A 1HN1A 3CZJA 1EUUA 2J1VA 3VDAA 1TVGA 2JE8A 3PUHA 3ECQA 1K12A 1UYYA 3IDAA 3T09A 3LEGA 1OT5A 2JKXA 2YC2A 4OUEA 4CUAA 3OGSA 1JYWA 4PF1A 2WBKA 1CIYA 1K42A 4MGQA 3CKHA 1OF4A 1MPXA 5FUIA 3IB3A 5IYYA 3ETPA 5HXMA 2Y6JA 3MO4A 4RYDA 1JYVA 4XUOA 1UMIA 2VMDA 3CZUA 3IAQA 4UAPA 2HLEA 4JKMA 4JKLA 3I2JA 3I3DA 1JYNA 3UNPA 4M4RA 1JZ4A 3LPFA 1W0NA 2PQSA 2VZRA 2YFZA 2YB7A 3J7HA 1GNYA 2W87A 4ET7A 3ACIA 3OEBA 2VCCA 2E26A 2VJXA 4Z2AA 4XURA 2XONA 1PX3A 1O8PA 5G05L 2LS6A 4AAXA 2J1SA 3D3AA 2QQNA 3I2GA 3C7EA 4QB6A 2WO2A 3OEAA 5DPNA 4UOJA 3NNGA 4MOAA 2DCJA 1UMHA 4KMQA 1W99A 3CIHA 4DUWA 5LA1A 5JXHA 2W5FA 2Y6GA 3DYOA 3FL7A 1NAEA 4E8DA 4BJ0A 4P08A 3WF1A 4OZOA 3DECA 2J1AA 2QQMA 3VDBA 2BGPA 1DYOA
chains in the Genus database with same CATH superfamily
2BFUL 2BOIA 3C7GA 3V0AA 5FP4A 5HCFA 1WBLA 3G6JB 4CEWB 1AJOA 2W1WA 2P1BA 4HFSA 1POV1 2WNVB 3E97A 4NHYA 3ZYJB 4D7SA 3WP5A 2G4IA 2VZOA 4GIQA 1LOBA 3QOPA 4GMP0 5JOXA 4INDA 1YQ2A 1YRZA 5HCAA 1UPIA 4Y1ZA 5C33A 5EHDA 1XPWA 3LF7A 5I0RA 5FZGA 4GWJA 4Y24A 1NZCA 4QB1A 5CB7A 5JLVA 3O1MA 4V2WA 2OQ7A 1H2MA 2WAOA 3SH5A 4NROA 3O5SA 1QOOA 2FDIA 2E9QA 3K75B 4D69A 3SCHA 5CADA 2VNOA 3MUY1 1ZREA 3UKTA 1EAH2 1Y43B 4YWAA 5DUWA 5FQ0A 4AQ2A 3ZPYA 3U1XA 1OUSA 5EP9A 1AR91 2VXJA 4UW5A 4LBNA 4COYA 4ZXKA 1UOGA 3LPGA 1ONAA 2BNNA 3MUZ1 5AC93 2LW8A 4LKEA 1DGLA 1H8TB 3ES4A 2VMEA 2DU0A 3LE0A 1AL0G 3BOPA 1K5MA 1SG3A 1F31A 2VTXA 1PO11 2RS12 2E6VA 2VVEA 4Y1XA 4YZ4A 4GZ9A 2FCUA 4RS5C 1RXGA 4XPVA 4DUXA 1F2NA 5FKBA 3FHQA 3SLIA 3VLBB 5F2SA 3FLTA 3UETA 3URFA 1ULCA 4M01A 5F3EA 2B9VA 3E6BA 1JZ7A 1MQTB 1QEXA 2IXIA 4FPYA 3E5XA 4XVHA 4AVSA 4YW3A 1Y9GA 4LLFA 4CDXA 2B7YA 3HN1A 2DFBA 5I0DA 5J7MA 1FPN1 1RUOA 4COWA 1NE4A 4NHKA 3ZYIB 4E8CA 2R49A 2GH8A 1L7LA 1R092 4LA3A 1RGSA 1X82A 1F4AA 3POIA 4BMEA 3WNKA 4YZ5A 1XC6A 2DUQA 1ZYBA 4AVCA 3BU0A 3VBOB 4DB5A 3H8RA 2XJQA 2Y38A 1SPPB 1JYNA 5DUUA 2HKXA 4IL7A 4CXYA 5F1RA 3ZLIA 2VBPA 2WNUB 1GFF2 2OA2A 4XCAA 1QDCA 4MLOA 1JZ6A 1N3OA 1ZA7A 4J25A 1DGWX 2JDZA 2ZHNA 1OSGA 5DAVA 3WR0A 3B94A 2FDKA 4F83A 1GSLA 2CWSA 5BNNC 2RS33 3ZXGA 1AR71 3BALA 5BV6A 3VBHC 4QM8A 3AL5A 1HXS3 4S2DA 2PA7A 1PX4A 2WFPA 3LWCA 3MF6A 1W9YA 2VQTA 4LKSA 3WG4A 4BISA 4KWLA 1U5IA 4P00B 3W5NA 4J6GA 1J1LA 1KQRA 1QJU1 3R4SA 4G3YC 4E2SA 4IE5A 3AKRA 4JGYC 5FREA 4U36A 3KCCA 1OKOA 1X9PA 4LO6B 1X7NA 4Y20B 5BYNA 3GJBA 4OQ8A 3I97A 1UKRA 2LROA 2PAMA 4XXAA 3RZLA 3DKWA 1WW6A 1OUXA 5LA0A 2HWD2 2ZZJA 5IW0A 3CJIA 1OD3A 1R083 4Q4V3 3PDQA 1WCSA 4PLNA 5FWJA 3M8LA 3VZKA 2HH9A 3NNJA 3PTYA 4HPKB 1RL3A 4HVRA 1VPHA 5B4XA 2BRTA 1NA1C 3GNEA 2W1QA 5I8SA 4LE3A 3PJQA 4ATFA 1VBD3 5BNPA 4AVTA 4C90A 1PK6B 2ZGPA 3M1HA 3AKTA 1H4GA 2KA3A 3THCA 4FP3A 1W6QA 1R1A1 5IWFA 3MLLA 4BQ4A 2JWPA 3E5QA 5FMCA 5FZEA 3W20A 1W2UA 3EBRA 3NQHA 2W2IA 2PHUA 5SV5A 5A6YA 2YROA 4CDWC 3RDIA 4AI3A 4DZGA 1CD3G 1GNZA 3LIGA 1PNGA 1W2AX 4LKFA 5JCTA 1LU1A 3H3ZA 3S5QA 5DQ0A 5FYUA 3KV4A 3CHXA 1NCQC 4N43B 3KCXA 1W04A 1REDA 5A3UA 1J59A 1W03A 3KHBA 3RYKA 3VZOA 4BMBA 4BOWA 1KS5A 1Q56A 4QPWA 1NLQA 1CPNA 3JB4C 3ZKUA 4PIYA 2WINB 4OZXA 3O14A 4CEWC 3WINE 3HQUA 4UF0A 4XHXA 2XKOA 4LBMA 1V00A 1KS4A 2EIEA 4GWIA 4MZUA 1CX4A 1POV3 2JDYA 2YG0A 3VZMA 3I3QA 3MLJA 4LK6A 4B7KA 2P34A 4CDWA 2PHWA 1QMJA 2ADDA 3BPSA 1WLTA 2VM9A 4BWOA 1W8TA 4YRDA 3T2PA 4Q4W2 5A3TA 5IVVA 2GMEA 3VBRB 1LU2A 1UX6A 3LSDA 1BCXA 1DP0A 2OX0A 3H42B 4DEQA 3NVCA 3FUOA 2OPKA 4FPFA 3NWKA 4C1WA 2BOJA 3A7QA 1BKZA 4MXWA 2FDJA 1PZ7A 1O59A 3O0WA 2UURA 3UESA 5C9AA 2VNGA 2GNBA 4GH4B 2Z2SB 1ULFA 1DYKA 3CO2A 4IE4A 4CCKA 2CYFA 4EYUA 4KWUA 1HB1A 4DY5A 2ZA9A 3U07A 1LHVA 1AR93 3AP7A 2DUPA 3M2MA 4Q4X1 1RUF1 1PVC1 3TYJA 1DGWA 4QHOA 1H8TC 1LGBA 1YI7A 3TNPB 4N9HA 5I0UA 2XL7A 5GLWA 1UYPA 2Q8EA 1PO13 4AEKA 2VCMA 2JD4A 3IN9A 5FXVA 3ZDSA 3SCFA 1QJEA 3SISA 1WZXA 4YGDA 5IAVA 1LTEA 4IEVA 5DXDA 4NWVA 4A42A 3ASIA 2WN2A 4WBBA 4YG0A 5KWRA 1MQTC 4XFIA 3V0BA 1WA4A 1WCKA 3KWVA 3GZEA 3PU3A 3A0KA 1H9PA 3TEZA 3IDCB 4Z2WA 1FPN3 5JMCA 5JI9A 4IXLA 1SACA 5H9QA 2DTWA 5FP3A 4XILA 5FOJB 3UK9A 2YC4A 2B42B 3RI9A 1PGSA 4A3ZA 1SQ4A 1SFNA 2WQZC 1JMUB 3NJYA 2WR9A 2WL1A 3T0BA 1MS8A 3BCWA 4AGVA 4LKDA 1MQTA 1K5JA 4LBQA 3LB9A 4IE6A 3WEZA 2V5DA 1ZBA1 5FR3A 2A5ZA 2A75A 2JIGA 4W8JA 1GZWB 2DCYA 3MW4A 1POQA 1AR73 1OPMA 2BVBA 5FK7A 5GLVA 1H6YA 3VB9A 1ND3C 3AJYA 2K0GA 4YFZA 4QKBA 3D0SA 5JOZA 5FYVA 3LOBA 1EP0A 1QJU3 1VRH1 1VR3A 1JW6A 3D8CA 2BV4A 4WM8A 1DU3D 1MS5A 4OI1A 1UNBA 2Q0AA 1XNKA 2XH6A 4JZRA 4NPLA 2EXKA 3V64A 1VAKA 5LA2A 4WVWA 5CA6A 4FFFA 2CL2A 3TEXA 1Q8PA 5FZ9A 4EWEA 5GKAC 2RS32 1Q8QA 3IBMA 4PQQA 4E4HA 1HXS2 1CJDA 4QHZA 4LBLA 3S30A 5C4WB 2UU8A 1ODNA 1DF0A 2DVDA 4EWDA 3SCGA 4MGIE 1KJLA 2BYVE 1ND3A 1VP6A 4FQ4A 4NN0A 1JZ8A 4EJRA 1BXHA 3GALA 4TXWA 3SKJE 4KGGA 2D98A 3Q9OA 1PK6C 1OPOA 2WSVA 2OPWA 1BMV2 1R1A3 2QQKA 1ENQA 1UIKA 3L2YA 1BLZA 3D5OA 1LULA 5T5OA 5J37A 5I8YA 1R082 4L99A 5K9YA 1JZ3A 1XYPA 3VDCA 2DYCA 2L9LA 4ARXA 1LNSA 4YZ2A 4P5YA 4XZPA 2A6WA 1Q8SA 4RR3C 4UFIA 4X6RB 3O1RA 1OOPB 2C9KA 2YY1A 1IOAA 4A7YA 4QQLA 5DZFA 3WQ1A 2YFUA 4I09A 4N43C 3GJAA 3AZZA 4ISQA 3GBGA 3ZPOA 5FZAA 1NX9A 3AKSA 3BN6A 5IFTA 3AMQA 1IKQA 1FNZA 2EICA 1UZZA 2ILMA 2JE7A 4W6YA 3IPVA 5BXXA 3WUCA 2WO1A 4K21A 4HXCA 4UXAA 5FY5A 2VMIA 1DZQA 5F3IA 1HB3A 2PYTA 3WW2A 5HXVA 2Z5WA 4MH0E 4Q29A 3R6SA 2ZOEB 4CVUA 4RR3A 2DDUA 2Q8CA 3VBRC 4BH9A 1F4HA 1QF3A 5FZ7A 1REEA 4HOOA 2W3JA 2DURA 3C7OA 1RUG1 4MADA 5C3SA 3MIFA 2Y6HA 3UT0A 1PGL1 2WWJA 2RM22 4H3WA 1QXRA 5FY9A 1HIXA 3LAGA 4GH4C 4HT1T 2YBKA 4EE2A 5A7WA 1X8MA 3AM2A 5ERLA 5FP7A 1IG3A 2UWCA 1AJKA 3CEWA 3UL2A 3UYJA 3BVCA 3IIAA 5D1IA 4Q4X3 4ASKA 1RUF3 1H0BA 1PVC3 1QOTA 2ZHMA 3ZSJA 1PO21 4XF3A 2PQQA 2XJRA 3IAPA 1QKQA 2A6YA 2QQLA 4GB32 5KC6A 3OBZA 2WFF2 1NKGA 3KV9A 3ZN6B 4IE7A 1KD7A 5ANQA 5A1LA 1D2QA 4OVEA 2QTWB 3VD7A 2XDVA 5H9SA 2C1FA 5FTTC 3J8F1 1IGOA 3H3UA 4DXZA 4MV2A 4NOTA 3KF5A 2X29A 1B35B 1IS4A 1LEMA 4GULA 5H9RA 4BLIA 4BQXA 3VUOA 3RVHA 3AMMA 4XFCA 1LR5A 1MS3A 2YGMA 5DDJ1 1PO12 1T2XA 2V09A 2WZEA 5IVEA 1HN1A 4A3XA 2J1VA 2QNKA 2YHJA 5FYCA 5SV8A 3VDAA 5I8TA 4BYYA 4K3UA 5TSWA 2JE8A 3VL9A 1YQ5A 3N4MA 1K12A 3AVRA 3H8OA 4XTPA 2W08A 4LMFA 2RDNA 1QJZA 4QXBA 4MX3A 2D3SA 5F5QA 5K0UC 4D6QA 1C5HA 3VZJA 5ABJB 1ZBA3 4MVTA 4BU2A 4OUEA 4CEYA 5AVAA 4CCDA 4Y4YA 1F5FA 4QXHA 1ASJ2 1Q5OA 4Q5OA 4AGGA 3N7LA 5T5PA 5FUIA 1VRH3 1DQ5A 1VBB2 3IB3A 4Q1PA 3D4KA 1GANA 3ETPA 3HWJA 4B4QA 2VVFA 4RYDA 1UMIA 5K0UA 5A3OA 3ZYFA 1YI9A 1HRI2 3E5UA 5CG8A 1D2SA 2D6KA 2I74A 1O6UA 3JBG3 2DWRA 2E53A 2IC1A 3KT4A 4N53A 1JN2P 4TYSA 4ZONA 5FYBA 4AI9A 4M4RA 5J48A 4EN7B 2P2KA 4K1ZA 4C8DA 4Y5SA 2BBVA 1MZ6A 1E5HA 4XDPA 2XHKA 1H1AA 1HJGA 2D97A 2ZS6B 3G7DA 1GNYA 3VHRA 1G8WA 4ET7A 1QY4A 3ACIA 1ACCA 3PLQA 3K51A 4SLIA 3B00A 1Z7S1 1MS9A 4H7MA 3V0AB 2KM2A 2XONA 2ZGMA 3QH7A 5G05L 3RI8A 3OD0A 4AAXA 2B46X 1YFUA 2HWE1 4GWMA 1JUHA 1MZ5A 3OEAA 1MS1A 1SBDA 1QNWA 1LECA 5JIUA 3RMYA 1GP4A 1FMD1 1QXJA 1W99A 2VUDA 4DUWA 2GN3A 4Y3OA 5JXHA 1VAVA 2VECA 2JDNA 1RHI1 1T6BX 2Y6GA 3EHKA 5GZFA 3MF9A 1RUD1 3H9AA 2E7QA 2WLQA 2RE9A 4B8EA 5KC5A 4ASMB 4E8DA 2C6SA 4BJ0A 4B3NA 5FPXA 5A32A 1Q8OA 2C9AA 4XIKA 5LY2A 2AGSA 5C6CA 4BQWA 2QQMA 5CFCA 2VG9A 2VGDA 5FJHA 1MR5A 5CEHA 1CVNA 3N7JA 4H2AA 4LIUA 1WD4A 5FQ0B 3E1F1 4ZZ5A 2TUNA 2W94A 3AYDA 4AQSA 1AR62 1V6NA 3ZMNA 2BWCA 3HPNA 1GQPA 4ES8A 1W28A 4KBBA 3T2TA 2ID4A 1RUG3 1K5MB 1APNA 3MHZA 1L7RA 2QQIA 2Y8KA 4MHUA 1S2EA 5JI7A 5A7QA 3CBNA 2BTVC 1H6XA 5LEJA 1WUVA 3VGIA 4HVOA 2XXZA 5FUPA 5M0TA 4IGPA 4DOUA 2QKDA 3AFGA 4IV3C 4CDXB 3EJKA 3AZYA 2W95A 4M3CF 1QJY1 1WMEA 4Z1VA 1PO23 2GNTA 3UJOA 4C0HA 1W8UA 2H0VA 4HONA 5GZCA 2EIBA 4W4ZA 5FO8B 5C8WA 3KZ4C 3OPWA 2Y64A 2X8KA 3PUIA 2FZ1A 2XVLA 5A7NA 4KBZA 2D6NA 2ORXA 3WF0A 1AYM1 3U78A 1BBT2 4MG2A 3ZSMA 3VV1A 4M3CE 4NHLA 1W2TA 1SLLA 5FZ0A 1DHKB 5JDBA 4DIQA 2B9UA 4W50A 3MGUA 4DPNA 1GZ9A 2YYOA 1JI6A 1RUF2 3C3VA 2Y6LA 4D0QA 2VOXA 2WRAA 4IV3A 3ZFEB 3KV6A 1J1TA 4N7UA 2QJVA 2N7GA 5DDJ3 1XXNA 5IVFA 1GOHA 3K4AA 2XJPA 5JSRA 1SBEA 4O61A 4BQ5A 2FHRA 1NUKA 3HD8B 3NKGA 1XNBA 2CGOA 2HWC1 3AL6A 2LRPA 2ZEZA 3AJZA 3N3HA 4PLMA 4XJAA 1DIWA 5T5JA 3UGFA 3J7NA 1O7FA 3DGTA 1ENSA 1CN1A 2P3IA 4QDRA 3RMXA 3POYA 3ZMOA 4IEXA 3PMSA 5A7OA 1V6IA 1UZYA 2GMMA 1EV12 2VZSA 5FP9A 2KXLA 1WD3A 2WS91 1UY3A 2OXBA 1GKBA 1UYXA 2ZZQA 4AHZA 3P5BA 3CJIB 1S0CA 4JX0A 4LUKA 4M3CA 4QHBA 1DQ6A 3OY8A 5FWEA 1ENRA 4D8MA 4EN9B 2F4PA 1AX1A 2WNOA 2WZ8A 1OMIA 2W91A 2YGLA 2YV8A 4P9IA 3LFMA 4QQHA 1MZFA 5BNPB 3FHIB 1U5YA 2AUYA 4D7TA 2I45A 3EXUA 5ACA1 2HWB1 1ZBA2 1W6QB 3PNAA 2JEMA 2O0OA 4QQ2A 5IK5A 3WUDA 1CESA 4EQVA 1GWMA 1Y4WA 1XB9A 2CAUA 2VTFA 4J1XA 5JR7B 2WYFA 4Q4Y2 2WQ4A 4E2QA 5FLIA 4JRAA 4FTEA 1LOEA 4YW1A 5A3MA 3PUSA 1W6OA 1IS6A 1U0AA 3W58A 5FXWA 4YG6A 3F2ZA 1VRH2 2ZGLA 1WCQA 4CU9A 5FOBB 4YPJA 3T3YA 2SBAA 5F5CA 1S0FA 2ZPXA 3ZXEA 1V6JA 4RN5A 3A4UA 1Z7S3 2AACA 2ZXQA 2XUMA 4IUGA 3CDZB 4Q0PA 1D0GA 1LB2A 3JBG2 2HWE3 2F4LA 2P3YA 3I3MA 2DU1A 3LQCA 2PHTA 3I3EA 5IK8A 3R0RA 4UF0B 4UFHA 2G9FA 4OI4A 3O0VA 4RGKA 3SH4A 5FUNA 2CDOA 1LOCA 1TMF1 3MIDA 4E4DX 5EYXA 4ORFA 1ZBE3 4CDWB 5K4LA 3TN91 3K4DA 2ET1A 2GC2A 1RHI3 3M3OA 4HSJA 1XNDA 5FPAA 1RUD3 4MGSA 1VBE2 5FZIA 4BK5A 4XQDA 4NIDA 2Q30A 4PQ9A 3ORJA 2ZEYA 1HLCA 4YM1A 1W9TA 2P3JA 4CUCA 4A7KA 1OVPA 4MXWB 4IV1A 1W8NA 2WO3A 1REFA 2ZGOA 5C9AB 1AYN1 4LT5A 3NNFA 3DPRC 2Z69A 2YPDA 3KSCA 5DG2A 4ZPIA 1UY4A 3IKWA 5IFPA 1UZWA 3JD72 1G9AA 2YC0A 2G1MA 1SDDB 1OD5A 4ZKTB 4DRVA 2J22A 2XJUA 4XYXA 4AFDA 3BTZA 4DS0A 1GZCA 2VW1A 3UKNA 5KHGA 1G9CA 1K5MC 1AR81 2BW8A 1WGPA 3HVDA 3CMGA 3NNLA 5LBCA 3WOGA 1O4ZA 3DUIA 3OUJA 3WNLA 2W9XA 1GZTA 2VZUA 4M00A 5FY1A 1XSRA 4M4PA 3N7KA 3RSJA 2NMOA 1VE0A 3I59A 3DPRA 4N7IA 3V0BB 5LEKA 2ZGSA 3ZYGA 4D6RA 3VHPA 4CDXC 2C24A 1SFPA 1QJY3 2RMU1 1A8MA 2OIIA 3KMHA 3VBSC 3MLKA 4A41A 3OGGA 4IEPA 1M4WA 4LPLA 2WT0A 4QGMA 2Y6KA 4ASLA 1PGL2 2R071 4ZXEA 3HR9A 3H8XA 4N90A 1AYM3 2Q1FA 2VMFA 5L9VA 1T6GC 2PHLA 3FHAA 5L7OA 1ZZCA 3LIHA 4G4FA 4KG0A 3RYRA 3LA7A 1U5XA 3KVBA 1DZRA 4LBQB 5F39A 5D8AA 2FMDA 3LEKA 3VHOA 1JZ2A 1RVF3 1LRHA 1QJX1 1LOAA 1WW4A 3OSDA 3Q8BA 5FYSA 1W6NA 3ZFEC 4FSJA 2WZR1 2AREA 5F8PA 1C4RA 3VBSA 2HYKA 1N47A 2Y34A 2VY0A 5EJZB 2EA7A 1A34A 4MYEA 3UKVA 4OUSA 1M06G 1FX5A 2VZ1A 3OGVA 1O3RA 1WA6X 2G19A 3ZXLA 2IXCA 4YVSA 5JSOA 4F3JA 5JZGC 1QQP1 3IIIA 4S2FA 2V5YA 2HWC3 3H7YA 4WM8B 1GOFA 3J9SA 4XF0A 2R042 1GQGA 3MBWA 4FPKA 2ORZA 5CZKA 3ZN4A 1FNYA 1I5PA 4D3WA 2RDQA 4E2GA 4AVBA 5HV0A 3HQXA 1W8FA 5LCWL 4PDWA 4AGRA 3W5MA 1RUNA 1UN1A 5DDJ2 5BPXA 1CJPA 2HWF1 2WS93 4GD4A 1OLME 3SNMA 3WDVA 3ZFEA 3HNMA 3RZKA 3WQ0A 3CJIC 1E5RA 4NIAA 1URXA 1QIQA 1ZX5A 4GWNA 3JB8A 3WF4A 2XLAA 5E8AA 1MS4A 2H0BA 1ND3B 3Q8CA 3BOWA 4XTMA 4YG3A 2XQRA 4DXTA 5JZGA 5FZ6A 1GOGA 2PMWB 2BNMA 2JG8A 5LB6A 1S0IA 2BUKA 4P02B 4FXKB 5AVPA 3VBFC 5BNPC 5DMYA 4QX3A 5KHKA 4Q0SA 2AR6A 5FZCA 2P3KA 2RR11 5FZ3A 2A6XA 2OYZA 1SLCA 2E33A 4C1XA 1UCXA 2VCAA 4JDOA 2VD7A 2QE3A 4CU6A 1AXKA 1N1TA 1VBA1 2A3YA 3N9LA 4XUNA 2YDEA 1S0DA 4NUBA 5JOWA 5FMBA 5CISA 1D4M2 2A73B 3WNPA 4Z8BA 4NO4A 4FPJA 3T2QA 2VUAA 4NAOA 4XHBA 1AL21 1BHGA 1K3IA 4FPEA 5FZFA 3S7IA 1OLMA 4AW7A 3VBFA 2Z79A 3ST7A 2W46A 4K1YA 4YM0A 3IPVB 3KF3A 2PLV1 3L9JT 1XE7A 2HEYF 3OTFA 1UOFA 5CIRA 5JIAA 5I0TA 1YHFA 2CNAA 2ZX2A 4EZ4A 1TMF3 4GKYA 4AI0A 4MXVA 3H1WA 5C3RA 1RUI1 2I2SA 1D7PM 2GP5A 2VZQA 5DZEA 1AX2A 2X09A 3TN93 4RR3B 2GNDA 1BJQA 1AHSA 5FPVA 1W0OA 1KITA 1Z7S2 2Z4FA 1RUE1 2EXHA 2K9ZA 3UV9A 2NM1A 1TNRA 4NPRA 1H1IA 2VQ0A 1ULOA 2QFEA 1MVEA 1YIPA 5HI0A 1WMFA 3MIEA 1JS9A 5T3NA 5LBEA 2ARAA 2K46A 1AYN3 1ZZ9A 3O0XA 5C9AC 4J1WA 4IE0A 3MI8A 5A7WB 1JYIA 1ZBE2 3QH6A 4FQZA 4OULA 4JVAA 3NJZA 3NV4A 1RHI2 3BIWE 4IW3A 2Q8DA 4YM3A 5LWBA 2VOTA 3B02A 3GM8A 3VD3A 4FOWA 4CXXA 4LULA 1SLBA 1VBC2 1AR83 1ZZ6A 3AK0A 2WT2A 4Q0QA 3VN4A 2XMLA 3MIBA 5KXEA 2BJSA 4U2AA 1PIV1 4BQ1A 4MO3M 4WVZA 1YC61 2CU5A 1UKGA 3E6CC 3U75A 3WDTA 1IHMA 3DV8A 2FDFA 1X36A 1BVVA 1RJ8A 4O9GA 3U11A 1L3JA 4DUVA 4QX0A 5CAZA 1O4YA 1UWWA 2XHNA 2RMU3 3U4SA 3SEEA 2DCKA 4S2HA 2JDPA 1XU2A 2BQPA 4XABA 5A3LA 1N3QA 4NR1A 5A7SA 1RJ7A 4XFBA 4MSVA 1CAVA 1LJ7A 1ND2A 1UOBA 2R073 5IK4A 1NQDA 1HQLA 3WQ7A 4EROA 1GQHA 1CAXA 2D6OX 2WA3A 1NLSA 1NLRA 1W2OA 3BODA 3M3IA 5KHJA 1J83A 2OT7A 1D0HA 3FE5A 1NXD1 4BM8A 3J26N 1SLTA 2DBIA 4NRQA 5F6LB 3FMGA 2B8MA 5EIYB 1QJY2 2W0XA 4B1MA 1QJX3 1UZ0A 4CRQA 1YLLA 4CCOA 1LCLA 5AC92 3BYWA 1CZVA 5A6QA 2JE9A 4NAMA 4DRRA 4CEYB 1FYUA 2WA4A 3N35A 1NY71 4UW3A 4QQPA 5IVCA 2OUJA 3FWEA 1RIRA 5EQUA 3VKMA 2VR4A 4OHZA 2JIJA 4AE2A 1QQP3 1UY0A 1LOFA 4ISRA 4MHRA 4WM8C 1CR7A 4ZS3A 4RHV1 5A7PA 5FKCA 5DUXA 1TVGA 5DZGA 3LDBA 1AUYA 4BLJA 1RVF2 5K0UB 1UYYA 3KM5A 3I2DA 4A6SA 5E89A 2D3RA 2ZMNA 1KDMA 2HWF3 2A1XA 1YO8A 3CF6E 2FCVA 4N53B 1UL9A 1E5SA 3LEGA 2WT1A 2JKXA 2GN7A 2YC2A 3POBA 4FPGA 4LE4A 4NE9A 3VKNA 3OGSA 2ARBA 3OBRA 1JYWA 1C3HA 1CIYA 2WBKA 1BK0A 2WWUA 4NJ4A 4L2NA 4MGQA 3ME2A 1ST8A 4UFJA 1COV1 2P6CA 1OF4A 4KU8A 1J3QA 1MPXA 1TNFA 1SDWA 4AEJA 2RR13 4OLLA 2WS92 4TWTA 1BVP1 2AENA 4AEDA 1DZTA 3K3NA 3GF6A 3MO4A 2R0HA 3N9QA 1HDKA 4XUOA 4CUGA 5JSPA 2VMDA 3CZUA 3IAQA 4AI2A 1HJFA 2VTXJ 1VBA3 1VJ2A 4A7ZA 3JU9A 2R1DA 3VBUC 1G9DA 3O7OA 4KH9A 3U14A 4JKLA 3I2JA 3T2OA 2C5DA 4UBHA 3MW3A 4W6XA 3WP4A 4I0WB 3B93A 1LESA 4FCAA 4IEWA 1JZ4A 2V4AA 4JQRA 3O1OA 3N9MA 5FLJA 3AYEA 3VHNA 5FYYA 2VZRA 2RS51 2YFZA 3R4UA 1GBGA 2NZ9A 2YB7A 3AKPA 4HANA 4NIHA 5A32B 2W87A 4RGGA 2PLV3 2YMZA 4GQ7A 5A33A 2YZ4A 2CWMA 3OEBA 1ZRDA 3IMMA 2E26A 5CFCB 2Q5TA 4NWWA 2OS2A 2VUCA 2VJXA 3DCQA 3AZWA 4LBQD 1V70A 4Q4V2 4XURA 4Z2AA 1A8DA 3RGBA 4K7JA 3KVAA 5I93A 1RUI3 5A70A 2PHDA 1TZOA 1FATA 2BP6A 3VBUA 5DPNA 3HBKA 1HRV1 1YJKA 3NNGA 3MIHA 4XOGA 1VBD2 3F95A 2QQWA 4KU7A 5FZOA 1OURA 5I91A 1RUE3 3PVOA 1FT9A 5BNOA 2UWAA 3AP4A 2W5FA 4AHXA 1C1FA 2F6BA 1NT0A 2ZHLA 3ILNA 3K2OA 5FAXA 2CAVA 2BFUS 4QX7A 1W90A 4OI2A 2A6VA 3N9OA 1TMF2 4QMAA 5KXDA 4Y22A 3BTYA 2JICA 4OZOA 1NQJA 1V6KA 2J1AA 4Y1UA 1TME1 5FZ8A 1SCRA 3THTA 1GP6A 3TNQA 4AQTA 1VALA 4IDZA 1JODA 3AVSA 3MYXA 3WY6A 5J36A 1CPMA 2Y33A 1S4CA 3EQEA 3HT2A 1IS3A 1RYYA 2VQAA 3A23A 1XE8A 5DN2A 1ZRCA 5A3NA 5C70A 2JX9A 5CYYA 4JTOA 4JC1A 1P8JA 3NV2A 2HYXA 2Q4SA 4ZU5A 3N9NA 5FXZA 4CE8A 1AYN2 1PIV3 3AFKA 4QPIA 1W06A 3MW2A 4V1PA 1H2NA 3A21A 4CU7A 1W9FA 3HOBA 3M3CA 1MVQA 1O8SA 1OQEA 3OG2A 4QX8A 3ES1A 3H8UA 5CG9A 1EUTA 4AFMA 1PGW1 1DCSA 2P6HA 1YUDA 2Y60A 1YQ8A 3M70A 4IV3B 2GDFA 4XETA 5F32A 4X8PA 2Y6FA 3H50A 4XJZA 2UYAA 3B7MA 1AR82 4RSUA 1HW5A 2VXRA 2WUHA 4TSVA 4E9KA 1GYKA 1BYHA 2JDUA 3UJQA 2EIGA 4ES9A 2XWBB 4FPHA 1KRIA 2ES3A 1IZ3A 5GJ6A 3S6PA 3WQBA 1HV1A 3K46A 3BU7A 3SC7X 5JR2A 2JDAA 4I2OA 2FD8A 1F5JA 1VB2A 4LOTA 1AR92 4DO0A 3LKJA 5HCHA 3ACGA 3GHNA 2XJTA 2XR4A 3PVEA 4JGZC 1IPKA 3WXPA 2YU2A 1H2LA 1QH6A 1FV2A 3AMHA 5A1FA 4CEYC 2R072 2WABA 2W1UA 1ZVFA 3GZAA 2XL9A 1PVXA 3KB5A 4M3CB 3OY8B 1XNCA 4P5HA 4PJYA 1PZ9A 4JHTA 5DG1A 1GUIA 3S7EA 1VMHA 2YPJA 2VMCA 3P6BA 1R091 2VZPA 3SH3A 4OMCA 2CY6A 5IK7A 3IMNA 3B9IA 2DVAA 4RD7A 1WLWA 4RHV3 5FMOL 3RFRA 1JUIA 4Y1YA 4YZ1A 3RJRA 4JAAA 3VKLA 1QJX2 1J3PA 1C8NA 4YSFA 4PF5A 2R32A 1FPN2 3THDA 2FZ2A 1GLHA 3WNNA 3TB0A 2RJLA 2VE1A 4JGZA 4MGYE 2R7EB 4IGOA 4N53C 4JQTA 3ZOIA 3EB7A 1KGYA 2HEWF 1OFNA 5FJKA 1JOPA 1W6OB 2R30A 3JUUA 1ZRIA 3POGA 4FP2A 4N9IA 4XF9A 4Y5TA 4G9SB 4AR2A 1DQ4A 3LEIA 4D94A 5FK8A 3ACHA 1LHOA 1QGLA 3SHRA 2W92A 3ZXJA 1RB8G 1COV3 2G9GA 4LNVA 4AVAA 1JOBA 5LRSA 5FZDA 1CGPA 3WW1A 3ZYPA 2AYHA 4I02A 1WBFA 2HWF2 3GGLA 4IEUA 1JYTA 2XWJB 3OGJA 3WG3A 2BVVA 2O1QA 3HN3A 1AR72 4LBKA 2B5HA 1G7YA 2XVKA 3QCWA 4QB2A 3ABZA 4LBOA 1W8OA 3Q8EA 4WM7A 4CPBA 3BKZA 1QJU2 1BEV1 5EFUA 5J98B 4XF1A 4P9GA 2JDHA 3RWKX 4CP1A 5EYYA 2QDRA 2YBSA 2CSGA 2R0FA 3POWA 2JG9A 4QXCA 1PHMA 2RS53 2RR12 3LGRA 4KWKA 4XJ8A 3W9AA 1CIWA 3ENRA 3KQRA 4Q8KA 1ENXA 3ZXKA 3NAPA 3TWIA 3WW4A 3HT1A 4IV1B 5CFCC 4BK4A 2RG4A 1VBA2 4XFAA 3AYCA 5DAQA 2P5BA 5LK5A 2WJSA 4QX1A 1YYNA 1Y9QA 3WZ1A 1GWKA 1A78A 5A3PA 2IVIB 4R9CA 2I07B 1HRV3 5F2WA 1YIFA 4FFHA 3MPBA 4CP0A 5JPMB 3PURA 5LASA 5LATA 4GMP1 3W59A 2JDKA 1R1A2 1ZZBA 2PLV2 4XUPA 3VL8A 1TG7A 3FZ3A 5F9TA 4GJZA 3TRSB 3I2OA 2TEPA 2IXHA 2ZGNA 4JDMA 4PI0A 4QT6A 1N1YA 5C8CC 4PHZA 1MZEA 1DYPA 1NCRA 3WSOA 4YLZA 4R9DA 1OQDA 3I3BA 4XC9A 2PN5A 2ZKLA 3I59B 4C0BA 3DPRB 5LRRA 4WZCA 2VAUA 3WT3A 2HJIA 1TME3 3C8XA 1XU1A 3GHMA 1IG0A 1NG0A 1OF3A 1S2BA 2PELA 4FFGA 4XFFA 3ZFGA 4YNIA 1PM4A 4CCJA 5FZHA 3LCPA 2XUEA 4AOCA 1RUE2 2X53S 4JHZA 5L73A 5T5LA 1O4TA 5FY4A 4L97A 2VU9A 3U37A 2E63A 3KHCA 1W6PA 4Q4W1 4DXRA 2C26A 5FZ4A 5IJRA 5A3WA 4CUBA 3RZGA 1YWKA 3FBMA 2LALA 4QXKA 3WHUA 5C8CA 5H9PA 5L7OB 4BHPA 3CU7A 4EZHA 4BIOA 4EWAA 4YW2A 3I7DA 2FCTA 4Q26A 5D8AB 1W0PA 3HBZA 5CFDA 3GYDA 4ITCA 1BQPA 1W6NB 1FXZA 2UYBA 4HETA 3O1SA 1Q8VA 1V6OA 3VBSB 2NP0A 4URAA 1XNTA 5IAXA 3P3PA 3J4UH 3OOXA 1H30A 4AYUA 2SLIA 4LBJA 2XBO1 1PIV2 2XOMA 1CONA 3JQWA 3OGRA 1DBNA 4LIVA 4P9JA 4XFHA 4YVSB 2W47A 3T0DA 4YW7A 1NE6A 4L9BA 4X6QB 3NJXA 5FMDA 4SBVA 1YEWA 3HJRA 3J8F3 2UY9A 5LBBA 3AP5A 1GWLA 4Q4X2 4PDWB 1PVC2 3RZHA 1UXXX 4Y26A 5JXIA 5FY7A 2OKXA 4PBPA 1V9U1 4RQPB 1IPSA 4Z07A 5JXJA 2OW4A 3ZDVA 1R093 3TEYA 3GBFA 4PT6A 2XKPA 4YFWA 4CU8A 5JZGB 1XQNA 1JU4A 1YFXA 2JG8B 3RZZA 4X8NA 1AX0A 2IWGB 5EJ1B 3TOJA 2DF7A 3USUA 5LK7B 2JKBA 2GH2A 4HKLA 5J96B 2CGPA 4B29A 4LO8A 3BIEA 1CZTA 2VZVA 3GXUA 1H8VA 1ULDA 2EXIA 4LO5B 1MEC1 2VPVA 3T4VA 4IQPA 3ZFFA 2Q1ZB 2O8QA 2GP3A 3KV5A 2A70A 4CDUA 5G04L 2OQ6A 4PIZA 4RHV2 1DQ1A 3ACFA 4EV0A 1FI2A 3NKTA 1US3A 2GSYA 5FZ1A 4OYUA 1KFUL 3B5LB 3NJVA 3VBFB 5FZLA 2ET7A 1I5ZA 4NPMA 4XBNA 1UO9A 2E32A 2FDHA 4HK8A 4NIGA 1ULGA 2VOVA 1K45A 1AXZA 1RUH1 5KR7A 1W3XA 3BGAA 3DYMA 1JYXA 1LKNA 3O1TA 4DQAA 1A6CA 3VKFC 1VMJA 4LHSA 4DEVA 4BPZA 3CLPA 2VW0A 5D21A 3VDDC 3J7LA 1UY1A 1OA2A 4ONUA 2X5IA 3S0MA 1OLQA 1CQ9A 3C2UA 3R05A 4QDSA 1BEV3 4Q1RA 1COV2 1RUC1 1XYNA 4H14A 5FIXA 3ZIWA 4LO4B 2DVFA 5J09A 1GP5A 1LENA 2ZX1A 5L36A 2J1TA 2NPIA 2PTMA 4Z82A 5FV3A 3VD5A 2OUHA 5DABA 4UFKA 3WHTA 3ZO0B 1W8WA 4XAAA 1HKDA 4FOQA 4HBNA 5E16A 2PHXA 4XDOA 3NO8A 4YVWA 4IV1C 3WCRA 2VH9A 1BMV1 1Z78A 2RDSA 4OHWA 2NQYA 1O3SA 1G9BA 1NZIA 4HL0A 2PAEA 4RA0A 3T1LA 4UFLA 3VDDA 1FMD3 4A45A 1I9RA 4O65A 5F5AA 1O5UA 1ZNPA 4QPGA 3QD6A 2RS52 3H3LA 1WMDA 3D6EA 1VIWB 4GMP3 3VD4A 1J58A 5T55A 4W6WA 3SKVA 1F35A 2ZX4A 3POFA 4JV4A 4R4XA 1DLLA 5FXXA 3AYAA 3DKQA 1EPZA 3D0JA 5JOYA 2BWAA 5APAA 2GAUA 1RTVA 3EYPA 5LW9A 2XVGA 4MGTA 1W3VA 2WZPP 2NMNA 2X10A 4FFIA 1HRV2 3PL0A 3HNBM 5JWPA 3OBAA 3OD4A 4I0AA 3MV01 4NRMA 4OHVA 4AHYA 3WNXA 1PMHX 2DFCA 3HEIA 3PUQA 4JTNA 5CVRA 1W9SA 4AG4A 4OI0A 1JYCA 1CAVB 2J1UA 1UY2A 3K4ZA 4IGQA 1ND2B 3DXUA 3VZLA 2FDGA 3PVBB 4Y1VA 1JU3A 1CAXB 3NV3A 2LM3A 3OJBA 5FYMA 5GLTA 5HBAA 1DDLA 3AMPA 1UF2C 5L7OC 5FYIA 5C3QA 1JHNA 1TME2 1QH7A 1WCDJ 2PHFA 3OPTA 3H0OA 2XJVA 3RRDA 4CCNA 2RM21 5D8AC 2E51A 4TLFA 4KQ7A 4B4RA 1CAWA 1J3RA 2EVXA 1US2A 2JJ6A 4FPLA 3WVJA 2B4KA 2XLGA 2A71A 1YQCA 5T52A 1RUG2 2P37A 5FO7B 1SMVA 4PCRA 4FOYA 1JZ5A 2XBO3 1SZBA 1WCUA 4YVSC 3WDWA 1XJAA 1XSQA 3C7FA 4FO9A 1RUJ1 4GB31 4AQ6A 2WFF1 1W05A 3OYWA 5FBJA 4ZZ8A 2WC2A 5EXOA 3N9PA 1CAUA 1AZDA 1UU4A 3OUHA 5FPZA 3SEPA 1PGW2 4DINB 1EY2A 3I8TA 1XNAA 4Q8LA 4QAWA 4PDWC 3I4IA 1PO22 4IESA 5BUVA 2GZWA 2RJ2A 4IETA 1J84A 1W6MA 4F8AA 1V9U3 4RQPC 3OB8A 1DFQA 2DV9A 1C57A 4XZUG 4QX2A 4DFSA 5FPLA 2AEYA 4YZ3A 5IHRA 3KCYA 2GU9A 4L11A 4XUQA 5FBZA 1HV0A 1OBNA 2Q8OA 2VOWA 2IFRA 1H2KA 2ZGTA 3A22A 2ZAAA 2WN3A 3QACA 2JG8C 3J8F2 4GA9A 5FMOS 1UU6A 3WDXA 1ODMA 3WNOA 4E4SA 1HQWA 4CCMA 2E31A 3ELNA 1EUUA 2IZWA 5FY8A 4GAZA 5F37A 4AEDB 3PUHA 1X33A 4PI2A 1G9FA 5FLHA 5LY1A 1MEC3 2JENA 3LDKA 4RQPA 1AXYA 5CKMA 4E4ZA 2MNGA 3T09A 1ZZ7A 4CSWA 3EO6A 1IS5A 1LGNA 3DEMA 2VBBA 4BXFA 4GJYA 5GZEA 3FLRA 1Y3TA 4R4ZA 3UGHA 1ASJ1 5DAWA 4MGZE 5IVYA 1WLCA 1SLIA 2D6LX 4RS5A 2ARCA 4YARA 3D82A 4Z92B 4YGBA 1VBB1 4YW6A 5ACA3 1W39A 2HWB3 1WLDA 1RUH3 5A33B 1UD1A 2A7AA 4CP9A 5D2AA 5K8SA 1ZRRA 3B9CA 2ZKNA 1VLNA 2ERFA 4QU1A 4K8RB 2GNMA 1SCSA 3RYPA 3PHMA 1HRI1 3ILFA 3VBUB 3DN7A 3ON7A 4WVMA 4B7EA 2GC1A 1RUC3 5IVBA 2MEV1 3FBYA 4WV8A 3SMHA 2IXLA 4UAPA 3ZXDA 5T50A 4AL9A 5GZDA 1ZM1A 2D6PA 3ZVXA 5FZOB 4JKMA 5BNOB 2WKKA 3I3DA 1PZ8A 1QJFA 1S55A 3UNPA 2ZMKA 1PMIA 3LPFA 3KQ4B 1W0NA 4AVVA 2PQSA 5JAXA 2DTYA 2RHPA 4B1LA 4YYOA 1YNAA 3J7HA 3PTRB 2AZ5A 1XE0A 2JXAA 3GZUC 3N7MA 4Y22B 1OA3A 5T54A 3RPQA 4CP2A 3O1PA 2VCCA 5FRAA 5BNNA 1BEV2 2D7FA 1HB2A 3VBHA 4UYBA 4BZ4A 3OPZA 5FP8A 4LO7A 1O8PA 4CDQC 1LODA 2QQNA 3D3AA 3BTAA 4UW6A 3C7EA 2D43A 2UY8A 4QB6A 2D3PA 4Y5Z0 4A2UA 2R061 2YXSA 4UOJA 4H7LA 2NLRA 2DCJA 1UMHA 1X8EA 3KS7A 4XCBA 4YW5A 2HWE2 4KMQA 4K6BA 5HCBA 3HMYA 4JGYA 4AZZA 3CIHA 4OCTA 4QPIB 4HN1A 4Y4RA 1LEDA 4P14A 2OVUA 4D7YA 3OCPA 3DYOA 1LHUA 1FMD2 2IXKA 3FL7A 2GC3A 1UW8A 1S0JA 1IQAA 1NAEA 4QKDA 1FOD1 2ZTNA 3AZXA 3ZYHA 4XIOA 1QDOA 1RUD2 3ZXAC 2FMYA 1Q3EA 3DECA 1NXMA 4CDQA 1STMA 4ZS2A 2BGPA 1JBCA 1DYOA 4QKNA 1AR61 1NA1A 1ND2C 1YFWA 3ETQA 5BNQA 3LDRA 3PVNA 1UXZA 4D6SA 1S0GA 3L2HA 1KFXL 2D44A 3IT8A 2G9ZA 2O8OA 2D5HA 4OQ9A 5FZBA 2IXJA 4AFAA 3M7AA 4XEZA 1UX7A 2WAAA 2TBVA 1V6LA 2XG3A 5L9RA 2RM23 2WNVC 1XYOA 4CA9A 1F8VA 2W52A 3R4DB 3ROUA 3ZYRA 4FT8A 2ZEWA 1SHWB 3GBWA 1WWYA 3VKOA 3PIGA 2DCZA 4OMDA 4P9YA 1RMU1 4OHXA 2VZTA 1NCQA 4FTBA 1YFYA 4QPYA 5GLUA 5EZWA 4LLOA 5GM0A 4GB33 3B3QE 1LOFC 1RUJ3 5EJ3A 2WFF3 2JD9A 5A80A 2V4VA 1QNYA 2QZ3A 3V65A 1HN0A 5GZGA 3POEA 1POV0 4Q2FA 4CEWA 1UOJA 4MUVA 5KHIA 2OZ6A 2C4XA 1YCIA 1BBT1 2ZX3A 3LFIA 2P17A 3FFZA 1RINA 2WNVA 4QGNA 3LD8A 4JGZB 2WZR3 2RVAA 4DY3A 2R1BA 1JTZX 2XBO2 1C8M1 4L0PA 2VOKA 1DG6A 1W2NA 1G86A 4JDNA 4LTAA 5FYZA 1S1AA 1UYZA 2PXJA 3AX4A 1AYM2 1CX1A 1DQ2A 4R9AA 2WSUA 2BBAA 3FFQA 4N8MA 4F7ZA 1Y9MA 2A6ZA 4UBGA 1TQ5A 1DGRN 3ZKYA 3WF3A 2V72A 3CL1A 2YU1A 2WIIB 2DUOA 4NRPA 2OZJA 4XUTA 4FAGA 5A6ZA 3WW3A 4NHMA 3NW4A 1RXFA 3QBQA 3FC0A 3IZOA 4COZA 4AEDC 1LGCA 1V9U2 5DAXA 4O7XA 3HIFA 1YXWA 2D40A 2ZGRA 1OXCA 4NMIA 4XQWA 1A3KA 3ACLA 1EV11 4GALA 3RG0A 1JOJA 1H8TA 4WM7B 1ULPA 1F15A 3TBDA 1QOSA 4ZHNA 1N1VA 2HWC2 3PJYA 3VBOC 1VMFA 1ASJ3 2JG9B 1QU0A 3U4XA 1GU3A 2WNUC 1VBB3 4P9LA 2QQVA 3A0NA 3ZX7A 5CBLA 1SBFA 4AI1A 2ZMLA 3NAPB 2WWSA 3V56A 4K40A 2BGCA 1ZA4A 1MEC2 1OQ1A 4XBLA 2XB6C 2K2SA 4HK9A 4HMZA 3CQOA 3RZMA 5CNAA 3JCIA 4LQRA 1HRI3 4FXGB 2LUWA 1VRBA 1ZRFA 5EV7A 4Q4Y1 3KGLA 1HQNA 2MEV3 2ARXA 2Q1MA 2W1SA 1F9KA 3ZR5A 3POSA 5CU1A 3I2HA 3VBOA 4E27A 1ALYA 1AL23 2ZGQA 1SPPA 2D5FA 2ENRA 4JRLA 2HWB2 4XQ4A 5ACA2 3GZTB 1RUH2 5BNOC 1I1EA 2WNUA 3AXDA 3CJXA 4COUA 1N1SA 5FY0A 1KXGA 3VZNA 5B2GB 2JB8A 1L7QA 1IQDC 2QQJA 4AWDA 1NCRB 5EWSA 3WDYA 2J7MA 1I3HA 2GALA 2P4EA 3LA2A 2WNEA 3JBG1 4AFCA 1LHWA 4FBFA 1UIJA 1JHJA 4FI9A 1RUC2 1X9TA 1Z0HA 3I2FA 4HLTA 3ZFGB 3ATGA 3RQ0A 3VD9A 2FQPA 5C5TA 1G6NA 4XDQA 3O1VA 2QQOA 4LA2A 1E57A 5HPOA 1H9WA 5AFEA 2ATFA 2R063 3KT1A 3P3NA 3RWNA 1W6PB 1VBE1 4C91A 2BERA 4Q0VA 1UZVA 3JZVA 4QPIC 2ZEXA 5FPBA 3WDUA 4ZU4A 5C8CB 1C28A 3AKQA 2VMHA 4Y20A 4CYDA 2D93A 5CKQA 2WLPA 4P9WA 5FYTA 4CZSA 3T4HB 1OVSA 1FOD3 1GNHA 3TN92 2D6MA 3WP6A 5CFDB 4BXSV 4BA6A 3S57A 1HB4A 1N3PA 4XAEA 2VO5A 3LA3A 1MACA 5L19A 4BDVB 1DGRA 4HPKA 2QQPA 3JD71 3AXEA 1O3QA 2EAKA 1AR63 3M4FA 3NV1A 3GCXA 2CHHA 2WDBA 3I2KA 1GV9A 1PNFA 1GICA 3MIGA 4RL7A 1PK6A 2FBEA 3LZZA 3PMEA 2QQUA 1PMJX 2ETEA 3WF2A 4RFRB 4AEMA 3AC0A 3IDEA 2TNFA 4IERA 2WQ8A 3VDBA 3AZVA 4O9EA 3ZXFA 4A4AA 1H4HA 1S2KA 3JQXA 2ZHKA 4UFMA 5L9BA 4AK3A 4BE3A 1EAH1 2BGOA 3INAA 2JECA 5C71A 1HX6A 3DL3A 4R52A 2X05A 3MDPA 1DQ0A 1RMU3 3B01A 3WCSA 4DMIA 5LBFA 2A3WA 4N43A 1OH4A 1MS0A 1UU5A 2XPJA 4I3PA 3FN9A 2VCBA 2VMGA 1JXNA 2BZDA 4NIIA 3NRUA 4ARYA 5IVJA 5JUVA 2RJKA 1LAJA 2RS11 5J3UA 1SEFA 3USUB 1BBT3 3KD4A 2RMU2 4A6OA 1YQ6A 4HG6B 2A3XA 4LEJA 1BZWA 5FDBA 3S5AA 3T0AA 5JVVA 3ZFFB 1C8M3 5E1RA 3IWZA 3M3QA 3LEMA 4R9BA 5FCCA 3VBRA 4CDUB 3T08A 1RUJ2 3Q8FA 4M0NA 3APBA 4R8HA 2GC0A 4Q0UA 1S0EA 1O5LA 2V73A 4AXOA 3H7JA 3ZIXA 1IPJA 4LUMA 2ZBJA 2H6BA 4FPOB 5C7GA 1JH5A 2R16A 2EAAA 2QCSB 3KT7A 4UI9L 1UQXA 2Z42A 4IEZA 5KXBA 4FTSA 4GH4A 2AH2A 4MGKE 1FAYA 2R041 2WZR2 3AP6A 4XBQA 4UWDA 3FX3A 1GMMA 4XF4A 4QD2A 3FLPA 4KL1A 3MV11 4UW4A 4AFBA 1OFSA 1EV13 5B4NA 1QXPA 4JKKA 2VBDA 4WM7C 2X5IB 3BB6A 1QQP2 3NL1A 3P1IA 2ADEA 5LA9A 3DXTA 5KHHA 3NSTA 3FJSA 2QBXA 2JG9C 1C5IA 3SQOA 3T1MA 2JDMA 2YUEA 4URTA 3H1MA 3NAPC 1LHNA 1UAIA 2VUJA 3GDBA 4PLOA 4YVWB 1EPWA 1VAMA 3C7HA 4M0HA 1ULEA 3ZR6A 2VL4A 4LORA 2EIDA 3NNMA 5JMOA 4HKOA 1XRUA 3MZHA 3VDDB 4XE9A 4OFGA 4Q4Y3 1AVBA 3SITA 1GR3A 2DVGA 4LJHA 4QPGB 2HWD1 4CTEA 1KEXA 1RC6A 1D4M1 4UT5A 3KGZA 4A44A 2KD7A 5I0SA 3ALQA 3U10A 3K77A 1R64A 2VC9A 2Y0IA 1QHDA 2GMPA 2MHFA 2XGXA 1VB4A 1NCRC 1TE1B 5FPUA 2CDPA 1D4VB 1FV3A 4AF9A 2C0ZA 1GZWA 1SFYA 2ZAHA 4KI5M 2MEV2 4TZDA 2MPFA 5C4WC 3ZFGC 5JXGA 2HBUA 3OF1A 3USSA 3ZSKA 4ATEA 5KXCA 1AL22 1NOVA 4LITA 3TEWA 1U12A 2Y0OA 2XQXA 3ILRA 4QQOA 3WG2A 2DVBA 3ZYBA 2E7AA 4KG8A 1VBE3 2DCTA 5GLZA 3TAYA 3I49A 4DXSA 2BEOA 2BU9A 4QWNA 2RV9A 3DYPA 2DBNA 1SLAA 5FZKA 5J1XA 4LHNA 4S2GA 4K9SA 4QDQA 1O91A 4L92A 4RGAA 2NN8A 5FFOC 1RUI2 2CV6A 2J1EA 4XMIA 4BB3A 3WNMA 2PFWA 2QDNA 5CFDC 1CAWB 5C4WA 1TEIA 4BQYA 1ZBE1 4XMAA 5E6HA 2H6CA 2R062 1YJLA 5F6KA 4XJWA 1OOPC 1DLCA 2XJSA 3JD73 4CPBD 3MFAA 4CCEA 5LZ6A 3Q8AA 4AHWA 4CCLA 1VBC1 2W68A 5C5UA 2IUWA 3OYWB 2NYYA 4LHKA 3HNYM 1W9WA 2VQUA 3W21A 5F3CA 1W8ZA 4HKWA 1CAUB 1C1LA 1OHFA 3J7MA 1FOD2 1H1MA 5IUQA 4YGCA 4ZY9A 3BI3A 3ZSLA 4LXLA 1IKPA 1EAH3 4TN7A 1W6MB 2WYSA 3SXWA 5DUVA 3GCWA 1B09A 2XLFA 1WMXA 4LOSA 4BQ3A 1OOPA 2HBTA 3T30A 4ZU7A 4QKFA 3O1UA 1ZZ8A 1WKYA 4OHYA 4TTGA 4GKXA 1S0BA 3E6DA 2BNOA 3I2IA 2ZACA 1BK1A 3WLUA 3OUIA 4TLGA 2IFWA 4QGLA 3BUCA 2O14A 2RS13 4I01A 5F3GA 3THPA 1OH3A 4AI8A 4QX5A 1Y7BA 3ZM8A 3X29B 5C3PA 2ZGKA 1KJRA 4XJUA 3IDBB 3DF0A 3I54A 3JXSA 3U0ZA 5CKNA 3UGGA 2ZX0A 1RMU2 3ZFFC 4CCCA 2BPA2 2JB4A 4FAHA 1CWPA 5AC91 3MICA 1XOYA 1E5IA 2VW2A 2VZ3A 4NVPA 4CDUC 1W8HA 4DNYA 5A1AA 5IATA 1X50A 2J1RA 3AP9A 1QWRA 3PUAA 5F7UA 4HSLA 4RS5B 2VNRA 1UPSA 2F17A 2CTVA 2HEVF 2QUOA 4FOVA 4V2VA 1OA4A 2UWBA 4L8QA 5FYHA 2R043 2YBPA 4CP9B 4EN6B 2PAKA 1NYWA 4PIXA 5K7PA 3LOIA 1CZSA 1B35C 1OI6A 1RVF1 2QVSB 1C8M2 1XBFA 2QZ2A 5F5IA 1NY72 3RNSA 3CZJA 1WW5A 1UMZA 2AEZA 2ZJCA 3FUQA 4COVA 4YGEA 2E7TA 3ZN5A 5HV4A 3H1YA 4BIFA 2X5IC 2AC1A 1KDKA 2VVDA 3ECQA 4WVMB 4K8FA 3WV6A 3POJA 4OUMA 4KWJA 4XXPA 5FZMA 3WG1A 3AB0A 3IDAA 3ZN6A 5A6XA 4I0BA 4JCKA 4IEOA 2R6QA 5AFBA 4BCUA 4EN0A 1OT5A 3NMBA 4HZFA 4FPCA 1U5ZA 4EN8B 4CUAA 2WO7A 4PF1A 4YVWC 5ABJC 2B45X 1B35A 3KLSA 4PBOA 5JPNB 1K42A 4FVVA 3CKHA 1AF9A 3MFCA 4HVQA 3RZJA 5BNNB 3EMRA 2RS31 4META 3VBHB 2ZABA 5IYYA 4QPGC 2HWD3 5DAPA 1HXS1 4Q27A 5HXMA 3RS6A 3HQRA 5IT6A 2W39A 2ZCWA 2Y6JA 3MEPA 4YM2A 1JYVA 3K3OA 4QU2A 1D4M3 3BPZA 3HAGA 3LSEA 5ISLA 4IEYA 3ITQA 2HLEA 4HN0A 1EYBA 4JGYB 4AAPA 4XW3A 4IEQA 2KR2A 2B39A 2LTNA 5ABJA 4XACA 3WX5A 4KGQA 4LR4A 3PIJA 3O12A 1R1ZA 3K48A 5ANNA 4CXWA 3N36A 2Y26A 4XFGA 4KNCA 2PHRA 1R081 2EXJA 4Q4V1 4B4PA 4I3GA 3MPPG 5BY5A 4P9XA 4CDQB 2RDRA 4I30A 4LK7A 4W65A 4Y33A 5GALA 1NA1B 1LOGA 1PX3A 4WVVA 1VBD1 2LS6A 2J1SA 4H55A 3CNAA 3I2GA 3WP3A 4XJ9A 2EF6A 2WO2A 1V0AA 3AMNA 5EPAA 2EALA 3B69A 3QLQA 4GXLA 4LHLA 4MOAA 4YW4A 4RFT0 1I6XA 2IVJA 2VULA 5LA1A 2VNVA 3PU8A 5C3OA 3BTXA 3OBTA 1Q43A 4BQ2A 1V6MA 2J42A 1OKQA 3ZSEA 1WW7A 5E88A 3IM0A 5FO9B 2BDRA 1OLRA 3RJ2X 1PM7A 4P08A 1OC1A 5KBFA 3WF1A 4NHXA 3WD5A 1NCQB 2ZGUA 3M3EA 4Q4W3 4WZFA 4QM9A 2CGNA 1O3TA 4K20A 1RITA 1VBC3
chains in the Genus database with same CATH topology
3C7GA 4ZZ5A 3E1F1 1RYYA 3A23A 5DN2A 1UXZA 2W94A 5C70A 5CYYA 2W1WA 1P8JA 3HPNA 1GQPA 2HYXA 2VZOA 1UX7A 2WAAA 2ID4A 3A21A 1YQ2A 4CU7A 3HOBA 1O8SA 1L7RA 2QQIA 2Y8KA 1XPWA 3OG2A 2ZEWA 4GWJA 1EUTA 4QB1A 1SHWB 1H6XA 4OMDA 2WAOA 2VZTA 3K75B 2WUHA 3MUY1 2W95A 2JD9A 2V4VA 2C4XA 3WQBA 2EIBA 3K46A 3LPGA 4W4ZA 3MUZ1 2LW8A 3PUIA 2Y64A 5JR2A 2JDAA 2VMEA 2ORXA 3LE0A 3WF0A 2RVAA 1SG3A 3ACGA 4L0PA 4GZ9A 4W50A 1UYZA 4DUXA 1JI6A 2WABA 3FHQA 2W1UA 2Y6LA 4D0QA 1CX1A 2BBAA 3UETA 1GUIA 2B9VA 1JZ7A 3P6BA 4XVHA 2VMCA 2VZPA 2V72A 3WF3A 4OMCA 4XUTA 5I0DA 1GOHA 3K4AA 4E8CA 1NUKA 1F4AA 3WNKA 1XC6A 2ZEZA 3THDA 3WNNA 1ULPA 2R7EB 4QDRA 3EB7A 1KGYA 2VZSA 1JZ6A 1UY3A 3LEIA 1GU3A 1UYXA 3ACHA 4JX0A 2W92A 4D8MA 2WZ8A 2W91A 3CQOA 4LQRA 3GGLA 1PX4A 4LKSA 2VQTA 4P00B 3W5NA 3HN3A 2W1SA 4QB2A 3ABZA 3I2HA 1W8OA 2VTFA 3I97A 3F2ZA 1WCQA 5LA0A 1L7QA 1IQDC 2QQJA 4CU9A 1OD3A 4YPJA 2J7MA 4RN5A 1JHJA 4FI9A 4BK4A 2ZXQA 3I2FA 5B4XA 3VD9A 4IUGA 2W1QA 3CDZB 2QQOA 4QX1A 5HPOA 3LQCA 3I3EA 3THCA 2CDOA 2BERA 2ZEXA 3NQHA 3K4DA 4XUPA 1TG7A 4MGSA 4BK5A 2ZEYA 5DQ0A 3WSOA 1W9TA 3I3BA 4BXSV 4CUCA 2VO5A 4BDVB 3C8XA 1W8NA 2WO3A 1OF3A 2WDBA 4QPWA 3I2KA 4JHZA 1UY4A 5IFPA 1PMJX 2EIEA 3WF2A 4GWIA 1SDDB 3U37A 2J22A 3AC0A 2YG0A 2C26A 5IJRA 4DXRA 4CUBA 2WQ8A 2VM9A 4A4AA 3CMGA 3T2PA 5C71A 2BGOA 3WNLA 2W9XA 2VZUA 1DP0A 4DEQA 4M4PA 2X05A 3A7QA 1OH4A 1XNTA 3FN9A 2VCBA 1JZ5A 1O59A 3UESA 2BZDA 5JUVA 3NRUA 4ARYA 2XOMA 3OGRA 4KWUA 3T0DA 2W47A 4A41A 4LPLA 2Y6KA 3NJXA 4A6OA 4ZXEA 4HG6B 3T0AA 3HJRA 2VMFA 3FHAA 1UXXX 3T08A 5JXIA 2OKXA 1JZ2A 3LEKA 4A42A 5JXJA 2WN2A 5C7GA 4UI9L 5EJZB 4PT6A 4CU8A 2VZ1A 3OGVA 1JU4A 1GMMA 5EJ1B 3IIIA 3MV11 2YC4A 4A3ZA 1GOFA 5B4NA 3MBWA 2ORZA 5CZKA 4JKKA 1I5PA 1CZTA 2VZVA 3GXUA 3P1IA 5LCWL 3W5MA 3T0BA 2QBXA 5G04L 3HNMA 3ACFA 3WEZA 2V5DA 1US3A 4OYUA 4W8JA 3GDBA 3NJVA 3WF4A 3C7HA 2E32A 4DXTA 2VL4A 1GOGA 1K45A 2EIDA 5DMYA 1H6YA 4P02B 5JMOA 3BGAA 3DYMA 1JYXA 4QX3A 4LHSA 4DEVA 2E33A 2VCAA 1UY1A 1KEXA 4A44A 4QDSA 5LA2A 2KD7A 4CU6A 3K77A 1R64A 4XUNA 2VC9A 2J1TA 3VD5A 4PQQA 3WNPA 2CDPA 3T2QA 1BHGA 1K3IA 4KI5M 5JXGA 2W46A 1JZ8A 4TXWA 3SKJE 2XQXA 4A45A 2QQKA 4DXSA 1D7PM 2VZQA 3VD4A 1JZ3A 2RV9A 3DYPA 2X09A 3SKVA 3VDCA 5J1XA 4QDQA 2L9LA 4ARXA 2J1EA 1LNSA 2Z4FA 4P5YA 3WNMA 3EYPA 2C9KA 1ULOA 2X10A 2YFUA 1NX9A 1DLCA 3BN6A 5IFTA 3HNBM 3OBAA 2EICA 2WO1A 3MV01 4AG4A 1PMHX 3HEIA 1W9SA 2J1UA 3K4ZA 1UY2A 2VOTA 3HNYM 1W9WA 2VQUA 1JU3A 3GM8A 3VD3A 4CVUA 4ZY9A 2DDUA 1F4HA 2WYSA 2W3JA 4MADA 3C7OA 4MO3M 2Y6HA 1US2A 1WKYA 2B4KA 4TTGA 4DUVA 3I2IA 4QX0A 1UWWA 2XHNA 3SEEA 2DCKA 3C7FA 3ZM8A 4ZZ8A 3IAPA 3JXSA 3SEPA 2QQLA 1XNAA 1NKGA 4QAWA 1J83A 2RJ2A 2VZ3A 1J84A 3VD7A 5EIYB 3OB8A 5A1AA 1UZ0A 2J1RA 4XZUG 4QX2A 1CZVA 5F7UA 5IHRA 4XUQA 3T2OA 3A22A 2WN3A 2VR4A 1CZSA 3WNOA 1UY0A 1T2XA 2WZEA 2E31A 1HN1A 3CZJA 1EUUA 2J1VA 3VDAA 1TVGA 2JE8A 3PUHA 3ECQA 1K12A 1UYYA 3IDAA 3T09A 3LEGA 1OT5A 2JKXA 2YC2A 4OUEA 4CUAA 3OGSA 1JYWA 4PF1A 2WBKA 1CIYA 1K42A 4MGQA 3CKHA 1OF4A 1MPXA 5FUIA 3IB3A 5IYYA 3ETPA 5HXMA 2Y6JA 3MO4A 4RYDA 1JYVA 4XUOA 1UMIA 2VMDA 3CZUA 3IAQA 4UAPA 2HLEA 4JKMA 4JKLA 3I2JA 3I3DA 1JYNA 3UNPA 4M4RA 1JZ4A 3LPFA 1W0NA 2PQSA 2VZRA 2YFZA 2YB7A 3J7HA 1GNYA 2W87A 4ET7A 3ACIA 3OEBA 2VCCA 2E26A 2VJXA 4Z2AA 4XURA 2XONA 1PX3A 1O8PA 5G05L 2LS6A 4AAXA 2J1SA 3D3AA 2QQNA 3I2GA 3C7EA 4QB6A 2WO2A 3OEAA 5DPNA 4UOJA 3NNGA 4MOAA 2DCJA 1UMHA 4KMQA 1W99A 3CIHA 4DUWA 5LA1A 5JXHA 2W5FA 2Y6GA 3DYOA 3FL7A 1NAEA 4E8DA 4BJ0A 4P08A 3WF1A 4OZOA 3DECA 2J1AA 2QQMA 3VDBA 2BGPA 1DYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7G A;  4ZZ5 A;  3E1F 1;  1RYY A;  3A23 A;  5DN2 A;  1UXZ A;  2W94 A;  5C70 A;  5CYY A;  2W1W A;  1P8J A;  3HPN A;  1GQP A;  2HYX A;  2VZO A;  1UX7 A;  2WAA A;  2ID4 A;  3A21 A;  1YQ2 A;  4CU7 A;  3HOB A;  1O8S A;  1L7R A;  2QQI A;  2Y8K A;  1XPW A;  3OG2 A;  2ZEW A;  4GWJ A;  1EUT A;  4QB1 A;  1SHW B;  1H6X A;  4OMD A;  2WAO A;  2VZT A;  3K75 B;  2WUH A;  3MUY 1;  2W95 A;  2JD9 A;  2V4V A;  2C4X A;  3WQB A;  2EIB A;  3K46 A;  3LPG A;  4W4Z A;  3MUZ 1;  2LW8 A;  3PUI A;  2Y64 A;  5JR2 A;  2JDA A;  2VME A;  2ORX A;  3LE0 A;  3WF0 A;  2RVA A;  1SG3 A;  3ACG A;  4L0P A;  4GZ9 A;  4W50 A;  1UYZ A;  4DUX A;  1JI6 A;  2WAB A;  3FHQ A;  2W1U A;  2Y6L A;  4D0Q A;  1CX1 A;  2BBA A;  3UET A;  1GUI A;  2B9V A;  1JZ7 A;  3P6B A;  4XVH A;  2VMC A;  2VZP A;  2V72 A;  3WF3 A;  4OMC A;  4XUT A;  5I0D A;  1GOH A;  3K4A A;  4E8C A;  1NUK A;  1F4A A;  3WNK A;  1XC6 A;  2ZEZ A;  3THD A;  3WNN A;  1ULP A;  2R7E B;  4QDR A;  3EB7 A;  1KGY A;  2VZS A;  1JZ6 A;  1UY3 A;  3LEI A;  1GU3 A;  1UYX A;  3ACH A;  4JX0 A;  2W92 A;  4D8M A;  2WZ8 A;  2W91 A;  3CQO A;  4LQR A;  3GGL A;  1PX4 A;  4LKS A;  2VQT A;  4P00 B;  3W5N A;  3HN3 A;  2W1S A;  4QB2 A;  3ABZ A;  3I2H A;  1W8O A;  2VTF A;  3I97 A;  3F2Z A;  1WCQ A;  5LA0 A;  1L7Q A;  1IQD C;  2QQJ A;  4CU9 A;  1OD3 A;  4YPJ A;  2J7M A;  4RN5 A;  1JHJ A;  4FI9 A;  4BK4 A;  2ZXQ A;  3I2F A;  5B4X A;  3VD9 A;  4IUG A;  2W1Q A;  3CDZ B;  2QQO A;  4QX1 A;  5HPO A;  3LQC A;  3I3E A;  3THC A;  2CDO A;  2BER A;  2ZEX A;  3NQH A;  3K4D A;  4XUP A;  1TG7 A;  4MGS A;  4BK5 A;  2ZEY A;  5DQ0 A;  3WSO A;  1W9T A;  3I3B A;  4BXS V;  4CUC A;  2VO5 A;  4BDV B;  3C8X A;  1W8N A;  2WO3 A;  1OF3 A;  2WDB A;  4QPW A;  3I2K A;  4JHZ A;  1UY4 A;  5IFP A;  1PMJ X;  2EIE A;  3WF2 A;  4GWI A;  1SDD B;  3U37 A;  2J22 A;  3AC0 A;  2YG0 A;  2C26 A;  5IJR A;  4DXR A;  4CUB A;  2WQ8 A;  2VM9 A;  4A4A A;  3CMG A;  3T2P A;  5C71 A;  2BGO A;  3WNL A;  2W9X A;  2VZU A;  1DP0 A;  4DEQ A;  4M4P A;  2X05 A;  3A7Q A;  1OH4 A;  1XNT A;  3FN9 A;  2VCB A;  1JZ5 A;  1O59 A;  3UES A;  2BZD A;  5JUV A;  3NRU A;  4ARY A;  2XOM A;  3OGR A;  4KWU A;  3T0D A;  2W47 A;  4A41 A;  4LPL A;  2Y6K A;  3NJX A;  4A6O A;  4ZXE A;  4HG6 B;  3T0A A;  3HJR A;  2VMF A;  3FHA A;  1UXX X;  3T08 A;  5JXI A;  2OKX A;  1JZ2 A;  3LEK A;  4A42 A;  5JXJ A;  2WN2 A;  5C7G A;  4UI9 L;  5EJZ B;  4PT6 A;  4CU8 A;  2VZ1 A;  3OGV A;  1JU4 A;  1GMM A;  5EJ1 B;  3III A;  3MV1 1;  2YC4 A;  4A3Z A;  1GOF A;  5B4N A;  3MBW A;  2ORZ A;  5CZK A;  4JKK A;  1I5P A;  1CZT A;  2VZV A;  3GXU A;  3P1I A;  5LCW L;  3W5M A;  3T0B A;  2QBX A;  5G04 L;  3HNM A;  3ACF A;  3WEZ A;  2V5D A;  1US3 A;  4OYU A;  4W8J A;  3GDB A;  3NJV A;  3WF4 A;  3C7H A;  2E32 A;  4DXT A;  2VL4 A;  1GOG A;  1K45 A;  2EID A;  5DMY A;  1H6Y A;  4P02 B;  5JMO A;  3BGA A;  3DYM A;  1JYX A;  4QX3 A;  4LHS A;  4DEV A;  2E33 A;  2VCA A;  1UY1 A;  1KEX A;  4A44 A;  4QDS A;  5LA2 A;  2KD7 A;  4CU6 A;  3K77 A;  1R64 A;  4XUN A;  2VC9 A;  2J1T A;  3VD5 A;  4PQQ A;  3WNP A;  2CDP A;  3T2Q A;  1BHG A;  1K3I A;  4KI5 M;  5JXG A;  2W46 A;  1JZ8 A;  4TXW A;  3SKJ E;  2XQX A;  4A45 A;  2QQK A;  4DXS A;  1D7P M;  2VZQ A;  3VD4 A;  1JZ3 A;  2RV9 A;  3DYP A;  2X09 A;  3SKV A;  3VDC A;  5J1X A;  4QDQ A;  2L9L A;  4ARX A;  2J1E A;  1LNS A;  2Z4F A;  4P5Y A;  3WNM A;  3EYP A;  2C9K A;  1ULO A;  2X10 A;  2YFU A;  1NX9 A;  1DLC A;  3BN6 A;  5IFT A;  3HNB M;  3OBA A;  2EIC A;  2WO1 A;  3MV0 1;  4AG4 A;  1PMH X;  3HEI A;  1W9S A;  2J1U A;  3K4Z A;  1UY2 A;  2VOT A;  3HNY M;  1W9W A;  2VQU A;  1JU3 A;  3GM8 A;  3VD3 A;  4CVU A;  4ZY9 A;  2DDU A;  1F4H A;  2WYS A;  2W3J A;  4MAD A;  3C7O A;  4MO3 M;  2Y6H A;  1US2 A;  1WKY A;  2B4K A;  4TTG A;  4DUV A;  3I2I A;  4QX0 A;  1UWW A;  2XHN A;  3SEE A;  2DCK A;  3C7F A;  3ZM8 A;  4ZZ8 A;  3IAP A;  3JXS A;  3SEP A;  2QQL A;  1XNA A;  1NKG A;  4QAW A;  1J83 A;  2RJ2 A;  2VZ3 A;  1J84 A;  3VD7 A;  5EIY B;  3OB8 A;  5A1A A;  1UZ0 A;  2J1R A;  4XZU G;  4QX2 A;  1CZV A;  5F7U A;  5IHR A;  4XUQ A;  3T2O A;  3A22 A;  2WN3 A;  2VR4 A;  1CZS A;  3WNO A;  1UY0 A;  1T2X A;  2WZE A;  2E31 A;  1HN1 A;  3CZJ A;  1EUU A;  2J1V A;  3VDA A;  1TVG A;  2JE8 A;  3PUH A;  3ECQ A;  1K12 A;  1UYY A;  3IDA A;  3T09 A;  3LEG A;  1OT5 A;  2JKX A;  2YC2 A;  4OUE A;  4CUA A;  3OGS A;  1JYW A;  4PF1 A;  2WBK A;  1CIY A;  1K42 A;  4MGQ A;  3CKH A;  1OF4 A;  1MPX A;  5FUI A;  3IB3 A;  5IYY A;  3ETP A;  5HXM A;  2Y6J A;  3MO4 A;  4RYD A;  1JYV A;  4XUO A;  1UMI A;  2VMD A;  3CZU A;  3IAQ A;  4UAP A;  2HLE A;  4JKM A;  4JKL A;  3I2J A;  3I3D A;  1JYN A;  3UNP A;  4M4R A;  1JZ4 A;  3LPF A;  1W0N A;  2PQS A;  2VZR A;  2YFZ A;  2YB7 A;  3J7H A;  1GNY A;  2W87 A;  4ET7 A;  3ACI A;  3OEB A;  2VCC A;  2E26 A;  2VJX A;  4Z2A A;  4XUR A;  2XON A;  1PX3 A;  1O8P A;  5G05 L;  2LS6 A;  4AAX A;  2J1S A;  3D3A A;  2QQN A;  3I2G A;  3C7E A;  4QB6 A;  2WO2 A;  3OEA A;  5DPN A;  4UOJ A;  3NNG A;  4MOA A;  2DCJ A;  1UMH A;  4KMQ A;  1W99 A;  3CIH A;  4DUW A;  5LA1 A;  5JXH A;  2W5F A;  2Y6G A;  3DYO A;  3FL7 A;  1NAE A;  4E8D A;  4BJ0 A;  4P08 A;  3WF1 A;  4OZO A;  3DEC A;  2J1A A;  2QQM A;  3VDB A;  2BGP A;  1DYO A; 
#chains in the Genus database with same CATH topology
 2BFU L;  2BOI A;  3C7G A;  3V0A A;  5FP4 A;  5HCF A;  1WBL A;  3G6J B;  4CEW B;  1AJO A;  2W1W A;  2P1B A;  4HFS A;  1POV 1;  2WNV B;  3E97 A;  4NHY A;  3ZYJ B;  4D7S A;  3WP5 A;  2G4I A;  2VZO A;  4GIQ A;  1LOB A;  3QOP A;  4GMP 0;  5JOX A;  4IND A;  1YQ2 A;  1YRZ A;  5HCA A;  1UPI A;  4Y1Z A;  5C33 A;  5EHD A;  1XPW A;  3LF7 A;  5I0R A;  5FZG A;  4GWJ A;  4Y24 A;  1NZC A;  4QB1 A;  5CB7 A;  5JLV A;  3O1M A;  4V2W A;  2OQ7 A;  1H2M A;  2WAO A;  3SH5 A;  4NRO A;  3O5S A;  1QOO A;  2FDI A;  2E9Q A;  3K75 B;  4D69 A;  3SCH A;  5CAD A;  2VNO A;  3MUY 1;  1ZRE A;  3UKT A;  1EAH 2;  1Y43 B;  4YWA A;  5DUW A;  5FQ0 A;  4AQ2 A;  3ZPY A;  3U1X A;  1OUS A;  5EP9 A;  1AR9 1;  2VXJ A;  4UW5 A;  4LBN A;  4COY A;  4ZXK A;  1UOG A;  3LPG A;  1ONA A;  2BNN A;  3MUZ 1;  5AC9 3;  2LW8 A;  4LKE A;  1DGL A;  1H8T B;  3ES4 A;  2VME A;  2DU0 A;  3LE0 A;  1AL0 G;  3BOP A;  1K5M A;  1SG3 A;  1F31 A;  2VTX A;  1PO1 1;  2RS1 2;  2E6V A;  2VVE A;  4Y1X A;  4YZ4 A;  4GZ9 A;  2FCU A;  4RS5 C;  1RXG A;  4XPV A;  4DUX A;  1F2N A;  5FKB A;  3FHQ A;  3SLI A;  3VLB B;  5F2S A;  3FLT A;  3UET A;  3URF A;  1ULC A;  4M01 A;  5F3E A;  2B9V A;  3E6B A;  1JZ7 A;  1MQT B;  1QEX A;  2IXI A;  4FPY A;  3E5X A;  4XVH A;  4AVS A;  4YW3 A;  1Y9G A;  4LLF A;  4CDX A;  2B7Y A;  3HN1 A;  2DFB A;  5I0D A;  5J7M A;  1FPN 1;  1RUO A;  4COW A;  1NE4 A;  4NHK A;  3ZYI B;  4E8C A;  2R49 A;  2GH8 A;  1L7L A;  1R09 2;  4LA3 A;  1RGS A;  1X82 A;  1F4A A;  3POI A;  4BME A;  3WNK A;  4YZ5 A;  1XC6 A;  2DUQ A;  1ZYB A;  4AVC A;  3BU0 A;  3VBO B;  4DB5 A;  3H8R A;  2XJQ A;  2Y38 A;  1SPP B;  1JYN A;  5DUU A;  2HKX A;  4IL7 A;  4CXY A;  5F1R A;  3ZLI A;  2VBP A;  2WNU B;  1GFF 2;  2OA2 A;  4XCA A;  1QDC A;  4MLO A;  1JZ6 A;  1N3O A;  1ZA7 A;  4J25 A;  1DGW X;  2JDZ A;  2ZHN A;  1OSG A;  5DAV A;  3WR0 A;  3B94 A;  2FDK A;  4F83 A;  1GSL A;  2CWS A;  5BNN C;  2RS3 3;  3ZXG A;  1AR7 1;  3BAL A;  5BV6 A;  3VBH C;  4QM8 A;  3AL5 A;  1HXS 3;  4S2D A;  2PA7 A;  1PX4 A;  2WFP A;  3LWC A;  3MF6 A;  1W9Y A;  2VQT A;  4LKS A;  3WG4 A;  4BIS A;  4KWL A;  1U5I A;  4P00 B;  3W5N A;  4J6G A;  1J1L A;  1KQR A;  1QJU 1;  3R4S A;  4G3Y C;  4E2S A;  4IE5 A;  3AKR A;  4JGY C;  5FRE A;  4U36 A;  3KCC A;  1OKO A;  1X9P A;  4LO6 B;  1X7N A;  4Y20 B;  5BYN A;  3GJB A;  4OQ8 A;  3I97 A;  1UKR A;  2LRO A;  2PAM A;  4XXA A;  3RZL A;  3DKW A;  1WW6 A;  1OUX A;  5LA0 A;  2HWD 2;  2ZZJ A;  5IW0 A;  3CJI A;  1OD3 A;  1R08 3;  4Q4V 3;  3PDQ A;  1WCS A;  4PLN A;  5FWJ A;  3M8L A;  3VZK A;  2HH9 A;  3NNJ A;  3PTY A;  4HPK B;  1RL3 A;  4HVR A;  1VPH A;  5B4X A;  2BRT A;  1NA1 C;  3GNE A;  2W1Q A;  5I8S A;  4LE3 A;  3PJQ A;  4ATF A;  1VBD 3;  5BNP A;  4AVT A;  4C90 A;  1PK6 B;  2ZGP A;  3M1H A;  3AKT A;  1H4G A;  2KA3 A;  3THC A;  4FP3 A;  1W6Q A;  1R1A 1;  5IWF A;  3MLL A;  4BQ4 A;  2JWP A;  3E5Q A;  5FMC A;  5FZE A;  3W20 A;  1W2U A;  3EBR A;  3NQH A;  2W2I A;  2PHU A;  5SV5 A;  5A6Y A;  2YRO A;  4CDW C;  3RDI A;  4AI3 A;  4DZG A;  1CD3 G;  1GNZ A;  3LIG A;  1PNG A;  1W2A X;  4LKF A;  5JCT A;  1LU1 A;  3H3Z A;  3S5Q A;  5DQ0 A;  5FYU A;  3KV4 A;  3CHX A;  1NCQ C;  4N43 B;  3KCX A;  1W04 A;  1RED A;  5A3U A;  1J59 A;  1W03 A;  3KHB A;  3RYK A;  3VZO A;  4BMB A;  4BOW A;  1KS5 A;  1Q56 A;  4QPW A;  1NLQ A;  1CPN A;  3JB4 C;  3ZKU A;  4PIY A;  2WIN B;  4OZX A;  3O14 A;  4CEW C;  3WIN E;  3HQU A;  4UF0 A;  4XHX A;  2XKO A;  4LBM A;  1V00 A;  1KS4 A;  2EIE A;  4GWI A;  4MZU A;  1CX4 A;  1POV 3;  2JDY A;  2YG0 A;  3VZM A;  3I3Q A;  3MLJ A;  4LK6 A;  4B7K A;  2P34 A;  4CDW A;  2PHW A;  1QMJ A;  2ADD A;  3BPS A;  1WLT A;  2VM9 A;  4BWO A;  1W8T A;  4YRD A;  3T2P A;  4Q4W 2;  5A3T A;  5IVV A;  2GME A;  3VBR B;  1LU2 A;  1UX6 A;  3LSD A;  1BCX A;  1DP0 A;  2OX0 A;  3H42 B;  4DEQ A;  3NVC A;  3FUO A;  2OPK A;  4FPF A;  3NWK A;  4C1W A;  2BOJ A;  3A7Q A;  1BKZ A;  4MXW A;  2FDJ A;  1PZ7 A;  1O59 A;  3O0W A;  2UUR A;  3UES A;  5C9A A;  2VNG A;  2GNB A;  4GH4 B;  2Z2S B;  1ULF A;  1DYK A;  3CO2 A;  4IE4 A;  4CCK A;  2CYF A;  4EYU A;  4KWU A;  1HB1 A;  4DY5 A;  2ZA9 A;  3U07 A;  1LHV A;  1AR9 3;  3AP7 A;  2DUP A;  3M2M A;  4Q4X 1;  1RUF 1;  1PVC 1;  3TYJ A;  1DGW A;  4QHO A;  1H8T C;  1LGB A;  1YI7 A;  3TNP B;  4N9H A;  5I0U A;  2XL7 A;  5GLW A;  1UYP A;  2Q8E A;  1PO1 3;  4AEK A;  2VCM A;  2JD4 A;  3IN9 A;  5FXV A;  3ZDS A;  3SCF A;  1QJE A;  3SIS A;  1WZX A;  4YGD A;  5IAV A;  1LTE A;  4IEV A;  5DXD A;  4NWV A;  4A42 A;  3ASI A;  2WN2 A;  4WBB A;  4YG0 A;  5KWR A;  1MQT C;  4XFI A;  3V0B A;  1WA4 A;  1WCK A;  3KWV A;  3GZE A;  3PU3 A;  3A0K A;  1H9P A;  3TEZ A;  3IDC B;  4Z2W A;  1FPN 3;  5JMC A;  5JI9 A;  4IXL A;  1SAC A;  5H9Q A;  2DTW A;  5FP3 A;  4XIL A;  5FOJ B;  3UK9 A;  2YC4 A;  2B42 B;  3RI9 A;  1PGS A;  4A3Z A;  1SQ4 A;  1SFN A;  2WQZ C;  1JMU B;  3NJY A;  2WR9 A;  2WL1 A;  3T0B A;  1MS8 A;  3BCW A;  4AGV A;  4LKD A;  1MQT A;  1K5J A;  4LBQ A;  3LB9 A;  4IE6 A;  3WEZ A;  2V5D A;  1ZBA 1;  5FR3 A;  2A5Z A;  2A75 A;  2JIG A;  4W8J A;  1GZW B;  2DCY A;  3MW4 A;  1POQ A;  1AR7 3;  1OPM A;  2BVB A;  5FK7 A;  5GLV A;  1H6Y A;  3VB9 A;  1ND3 C;  3AJY A;  2K0G A;  4YFZ A;  4QKB A;  3D0S A;  5JOZ A;  5FYV A;  3LOB A;  1EP0 A;  1QJU 3;  1VRH 1;  1VR3 A;  1JW6 A;  3D8C A;  2BV4 A;  4WM8 A;  1DU3 D;  1MS5 A;  4OI1 A;  1UNB A;  2Q0A A;  1XNK A;  2XH6 A;  4JZR A;  4NPL A;  2EXK A;  3V64 A;  1VAK A;  5LA2 A;  4WVW A;  5CA6 A;  4FFF A;  2CL2 A;  3TEX A;  1Q8P A;  5FZ9 A;  4EWE A;  5GKA C;  2RS3 2;  1Q8Q A;  3IBM A;  4PQQ A;  4E4H A;  1HXS 2;  1CJD A;  4QHZ A;  4LBL A;  3S30 A;  5C4W B;  2UU8 A;  1ODN A;  1DF0 A;  2DVD A;  4EWD A;  3SCG A;  4MGI E;  1KJL A;  2BYV E;  1ND3 A;  1VP6 A;  4FQ4 A;  4NN0 A;  1JZ8 A;  4EJR A;  1BXH A;  3GAL A;  4TXW A;  3SKJ E;  4KGG A;  2D98 A;  3Q9O A;  1PK6 C;  1OPO A;  2WSV A;  2OPW A;  1BMV 2;  1R1A 3;  2QQK A;  1ENQ A;  1UIK A;  3L2Y A;  1BLZ A;  3D5O A;  1LUL A;  5T5O A;  5J37 A;  5I8Y A;  1R08 2;  4L99 A;  5K9Y A;  1JZ3 A;  1XYP A;  3VDC A;  2DYC A;  2L9L A;  4ARX A;  1LNS A;  4YZ2 A;  4P5Y A;  4XZP A;  2A6W A;  1Q8S A;  4RR3 C;  4UFI A;  4X6R B;  3O1R A;  1OOP B;  2C9K A;  2YY1 A;  1IOA A;  4A7Y A;  4QQL A;  5DZF A;  3WQ1 A;  2YFU A;  4I09 A;  4N43 C;  3GJA A;  3AZZ A;  4ISQ A;  3GBG A;  3ZPO A;  5FZA A;  1NX9 A;  3AKS A;  3BN6 A;  5IFT A;  3AMQ A;  1IKQ A;  1FNZ A;  2EIC A;  1UZZ A;  2ILM A;  2JE7 A;  4W6Y A;  3IPV A;  5BXX A;  3WUC A;  2WO1 A;  4K21 A;  4HXC A;  4UXA A;  5FY5 A;  2VMI A;  1DZQ A;  5F3I A;  1HB3 A;  2PYT A;  3WW2 A;  5HXV A;  2Z5W A;  4MH0 E;  4Q29 A;  3R6S A;  2ZOE B;  4CVU A;  4RR3 A;  2DDU A;  2Q8C A;  3VBR C;  4BH9 A;  1F4H A;  1QF3 A;  5FZ7 A;  1REE A;  4HOO A;  2W3J A;  2DUR A;  3C7O A;  1RUG 1;  4MAD A;  5C3S A;  3MIF A;  2Y6H A;  3UT0 A;  1PGL 1;  2WWJ A;  2RM2 2;  4H3W A;  1QXR A;  5FY9 A;  1HIX A;  3LAG A;  4GH4 C;  4HT1 T;  2YBK A;  4EE2 A;  5A7W A;  1X8M A;  3AM2 A;  5ERL A;  5FP7 A;  1IG3 A;  2UWC A;  1AJK A;  3CEW A;  3UL2 A;  3UYJ A;  3BVC A;  3IIA A;  5D1I A;  4Q4X 3;  4ASK A;  1RUF 3;  1H0B A;  1PVC 3;  1QOT A;  2ZHM A;  3ZSJ A;  1PO2 1;  4XF3 A;  2PQQ A;  2XJR A;  3IAP A;  1QKQ A;  2A6Y A;  2QQL A;  4GB3 2;  5KC6 A;  3OBZ A;  2WFF 2;  1NKG A;  3KV9 A;  3ZN6 B;  4IE7 A;  1KD7 A;  5ANQ A;  5A1L A;  1D2Q A;  4OVE A;  2QTW B;  3VD7 A;  2XDV A;  5H9S A;  2C1F A;  5FTT C;  3J8F 1;  1IGO A;  3H3U A;  4DXZ A;  4MV2 A;  4NOT A;  3KF5 A;  2X29 A;  1B35 B;  1IS4 A;  1LEM A;  4GUL A;  5H9R A;  4BLI A;  4BQX A;  3VUO A;  3RVH A;  3AMM A;  4XFC A;  1LR5 A;  1MS3 A;  2YGM A;  5DDJ 1;  1PO1 2;  1T2X A;  2V09 A;  2WZE A;  5IVE A;  1HN1 A;  4A3X A;  2J1V A;  2QNK A;  2YHJ A;  5FYC A;  5SV8 A;  3VDA A;  5I8T A;  4BYY A;  4K3U A;  5TSW A;  2JE8 A;  3VL9 A;  1YQ5 A;  3N4M A;  1K12 A;  3AVR A;  3H8O A;  4XTP A;  2W08 A;  4LMF A;  2RDN A;  1QJZ A;  4QXB A;  4MX3 A;  2D3S A;  5F5Q A;  5K0U C;  4D6Q A;  1C5H A;  3VZJ A;  5ABJ B;  1ZBA 3;  4MVT A;  4BU2 A;  4OUE A;  4CEY A;  5AVA A;  4CCD A;  4Y4Y A;  1F5F A;  4QXH A;  1ASJ 2;  1Q5O A;  4Q5O A;  4AGG A;  3N7L A;  5T5P A;  5FUI A;  1VRH 3;  1DQ5 A;  1VBB 2;  3IB3 A;  4Q1P A;  3D4K A;  1GAN A;  3ETP A;  3HWJ A;  4B4Q A;  2VVF A;  4RYD A;  1UMI A;  5K0U A;  5A3O A;  3ZYF A;  1YI9 A;  1HRI 2;  3E5U A;  5CG8 A;  1D2S A;  2D6K A;  2I74 A;  1O6U A;  3JBG 3;  2DWR A;  2E53 A;  2IC1 A;  3KT4 A;  4N53 A;  1JN2 P;  4TYS A;  4ZON A;  5FYB A;  4AI9 A;  4M4R A;  5J48 A;  4EN7 B;  2P2K A;  4K1Z A;  4C8D A;  4Y5S A;  2BBV A;  1MZ6 A;  1E5H A;  4XDP A;  2XHK A;  1H1A A;  1HJG A;  2D97 A;  2ZS6 B;  3G7D A;  1GNY A;  3VHR A;  1G8W A;  4ET7 A;  1QY4 A;  3ACI A;  1ACC A;  3PLQ A;  3K51 A;  4SLI A;  3B00 A;  1Z7S 1;  1MS9 A;  4H7M A;  3V0A B;  2KM2 A;  2XON A;  2ZGM A;  3QH7 A;  5G05 L;  3RI8 A;  3OD0 A;  4AAX A;  2B46 X;  1YFU A;  2HWE 1;  4GWM A;  1JUH A;  1MZ5 A;  3OEA A;  1MS1 A;  1SBD A;  1QNW A;  1LEC A;  5JIU A;  3RMY A;  1GP4 A;  1FMD 1;  1QXJ A;  1W99 A;  2VUD A;  4DUW A;  2GN3 A;  4Y3O A;  5JXH A;  1VAV A;  2VEC A;  2JDN A;  1RHI 1;  1T6B X;  2Y6G A;  3EHK A;  5GZF A;  3MF9 A;  1RUD 1;  3H9A A;  2E7Q A;  2WLQ A;  2RE9 A;  4B8E A;  5KC5 A;  4ASM B;  4E8D A;  2C6S A;  4BJ0 A;  4B3N A;  5FPX A;  5A32 A;  1Q8O A;  2C9A A;  4XIK A;  5LY2 A;  2AGS A;  5C6C A;  4BQW A;  2QQM A;  5CFC A;  2VG9 A;  2VGD A;  5FJH A;  1MR5 A;  5CEH A;  1CVN A;  3N7J A;  4H2A A;  4LIU A;  1WD4 A;  5FQ0 B;  3E1F 1;  4ZZ5 A;  2TUN A;  2W94 A;  3AYD A;  4AQS A;  1AR6 2;  1V6N A;  3ZMN A;  2BWC A;  3HPN A;  1GQP A;  4ES8 A;  1W28 A;  4KBB A;  3T2T A;  2ID4 A;  1RUG 3;  1K5M B;  1APN A;  3MHZ A;  1L7R A;  2QQI A;  2Y8K A;  4MHU A;  1S2E A;  5JI7 A;  5A7Q A;  3CBN A;  2BTV C;  1H6X A;  5LEJ A;  1WUV A;  3VGI A;  4HVO A;  2XXZ A;  5FUP A;  5M0T A;  4IGP A;  4DOU A;  2QKD A;  3AFG A;  4IV3 C;  4CDX B;  3EJK A;  3AZY A;  2W95 A;  4M3C F;  1QJY 1;  1WME A;  4Z1V A;  1PO2 3;  2GNT A;  3UJO A;  4C0H A;  1W8U A;  2H0V A;  4HON A;  5GZC A;  2EIB A;  4W4Z A;  5FO8 B;  5C8W A;  3KZ4 C;  3OPW A;  2Y64 A;  2X8K A;  3PUI A;  2FZ1 A;  2XVL A;  5A7N A;  4KBZ A;  2D6N A;  2ORX A;  3WF0 A;  1AYM 1;  3U78 A;  1BBT 2;  4MG2 A;  3ZSM A;  3VV1 A;  4M3C E;  4NHL A;  1W2T A;  1SLL A;  5FZ0 A;  1DHK B;  5JDB A;  4DIQ A;  2B9U A;  4W50 A;  3MGU A;  4DPN A;  1GZ9 A;  2YYO A;  1JI6 A;  1RUF 2;  3C3V A;  2Y6L A;  4D0Q A;  2VOX A;  2WRA A;  4IV3 A;  3ZFE B;  3KV6 A;  1J1T A;  4N7U A;  2QJV A;  2N7G A;  5DDJ 3;  1XXN A;  5IVF A;  1GOH A;  3K4A A;  2XJP A;  5JSR A;  1SBE A;  4O61 A;  4BQ5 A;  2FHR A;  1NUK A;  3HD8 B;  3NKG A;  1XNB A;  2CGO A;  2HWC 1;  3AL6 A;  2LRP A;  2ZEZ A;  3AJZ A;  3N3H A;  4PLM A;  4XJA A;  1DIW A;  5T5J A;  3UGF A;  3J7N A;  1O7F A;  3DGT A;  1ENS A;  1CN1 A;  2P3I A;  4QDR A;  3RMX A;  3POY A;  3ZMO A;  4IEX A;  3PMS A;  5A7O A;  1V6I A;  1UZY A;  2GMM A;  1EV1 2;  2VZS A;  5FP9 A;  2KXL A;  1WD3 A;  2WS9 1;  1UY3 A;  2OXB A;  1GKB A;  1UYX A;  2ZZQ A;  4AHZ A;  3P5B A;  3CJI B;  1S0C A;  4JX0 A;  4LUK A;  4M3C A;  4QHB A;  1DQ6 A;  3OY8 A;  5FWE A;  1ENR A;  4D8M A;  4EN9 B;  2F4P A;  1AX1 A;  2WNO A;  2WZ8 A;  1OMI A;  2W91 A;  2YGL A;  2YV8 A;  4P9I A;  3LFM A;  4QQH A;  1MZF A;  5BNP B;  3FHI B;  1U5Y A;  2AUY A;  4D7T A;  2I45 A;  3EXU A;  5ACA 1;  2HWB 1;  1ZBA 2;  1W6Q B;  3PNA A;  2JEM A;  2O0O A;  4QQ2 A;  5IK5 A;  3WUD A;  1CES A;  4EQV A;  1GWM A;  1Y4W A;  1XB9 A;  2CAU A;  2VTF A;  4J1X A;  5JR7 B;  2WYF A;  4Q4Y 2;  2WQ4 A;  4E2Q A;  5FLI A;  4JRA A;  4FTE A;  1LOE A;  4YW1 A;  5A3M A;  3PUS A;  1W6O A;  1IS6 A;  1U0A A;  3W58 A;  5FXW A;  4YG6 A;  3F2Z A;  1VRH 2;  2ZGL A;  1WCQ A;  4CU9 A;  5FOB B;  4YPJ A;  3T3Y A;  2SBA A;  5F5C A;  1S0F A;  2ZPX A;  3ZXE A;  1V6J A;  4RN5 A;  3A4U A;  1Z7S 3;  2AAC A;  2ZXQ A;  2XUM A;  4IUG A;  3CDZ B;  4Q0P A;  1D0G A;  1LB2 A;  3JBG 2;  2HWE 3;  2F4L A;  2P3Y A;  3I3M A;  2DU1 A;  3LQC A;  2PHT A;  3I3E A;  5IK8 A;  3R0R A;  4UF0 B;  4UFH A;  2G9F A;  4OI4 A;  3O0V A;  4RGK A;  3SH4 A;  5FUN A;  2CDO A;  1LOC A;  1TMF 1;  3MID A;  4E4D X;  5EYX A;  4ORF A;  1ZBE 3;  4CDW B;  5K4L A;  3TN9 1;  3K4D A;  2ET1 A;  2GC2 A;  1RHI 3;  3M3O A;  4HSJ A;  1XND A;  5FPA A;  1RUD 3;  4MGS A;  1VBE 2;  5FZI A;  4BK5 A;  4XQD A;  4NID A;  2Q30 A;  4PQ9 A;  3ORJ A;  2ZEY A;  1HLC A;  4YM1 A;  1W9T A;  2P3J A;  4CUC A;  4A7K A;  1OVP A;  4MXW B;  4IV1 A;  1W8N A;  2WO3 A;  1REF A;  2ZGO A;  5C9A B;  1AYN 1;  4LT5 A;  3NNF A;  3DPR C;  2Z69 A;  2YPD A;  3KSC A;  5DG2 A;  4ZPI A;  1UY4 A;  3IKW A;  5IFP A;  1UZW A;  3JD7 2;  1G9A A;  2YC0 A;  2G1M A;  1SDD B;  1OD5 A;  4ZKT B;  4DRV A;  2J22 A;  2XJU A;  4XYX A;  4AFD A;  3BTZ A;  4DS0 A;  1GZC A;  2VW1 A;  3UKN A;  5KHG A;  1G9C A;  1K5M C;  1AR8 1;  2BW8 A;  1WGP A;  3HVD A;  3CMG A;  3NNL A;  5LBC A;  3WOG A;  1O4Z A;  3DUI A;  3OUJ A;  3WNL A;  2W9X A;  1GZT A;  2VZU A;  4M00 A;  5FY1 A;  1XSR A;  4M4P A;  3N7K A;  3RSJ A;  2NMO A;  1VE0 A;  3I59 A;  3DPR A;  4N7I A;  3V0B B;  5LEK A;  2ZGS A;  3ZYG A;  4D6R A;  3VHP A;  4CDX C;  2C24 A;  1SFP A;  1QJY 3;  2RMU 1;  1A8M A;  2OII A;  3KMH A;  3VBS C;  3MLK A;  4A41 A;  3OGG A;  4IEP A;  1M4W A;  4LPL A;  2WT0 A;  4QGM A;  2Y6K A;  4ASL A;  1PGL 2;  2R07 1;  4ZXE A;  3HR9 A;  3H8X A;  4N90 A;  1AYM 3;  2Q1F A;  2VMF A;  5L9V A;  1T6G C;  2PHL A;  3FHA A;  5L7O A;  1ZZC A;  3LIH A;  4G4F A;  4KG0 A;  3RYR A;  3LA7 A;  1U5X A;  3KVB A;  1DZR A;  4LBQ B;  5F39 A;  5D8A A;  2FMD A;  3LEK A;  3VHO A;  1JZ2 A;  1RVF 3;  1LRH A;  1QJX 1;  1LOA A;  1WW4 A;  3OSD A;  3Q8B A;  5FYS A;  1W6N A;  3ZFE C;  4FSJ A;  2WZR 1;  2ARE A;  5F8P A;  1C4R A;  3VBS A;  2HYK A;  1N47 A;  2Y34 A;  2VY0 A;  5EJZ B;  2EA7 A;  1A34 A;  4MYE A;  3UKV A;  4OUS A;  1M06 G;  1FX5 A;  2VZ1 A;  3OGV A;  1O3R A;  1WA6 X;  2G19 A;  3ZXL A;  2IXC A;  4YVS A;  5JSO A;  4F3J A;  5JZG C;  1QQP 1;  3III A;  4S2F A;  2V5Y A;  2HWC 3;  3H7Y A;  4WM8 B;  1GOF A;  3J9S A;  4XF0 A;  2R04 2;  1GQG A;  3MBW A;  4FPK A;  2ORZ A;  5CZK A;  3ZN4 A;  1FNY A;  1I5P A;  4D3W A;  2RDQ A;  4E2G A;  4AVB A;  5HV0 A;  3HQX A;  1W8F A;  5LCW L;  4PDW A;  4AGR A;  3W5M A;  1RUN A;  1UN1 A;  5DDJ 2;  5BPX A;  1CJP A;  2HWF 1;  2WS9 3;  4GD4 A;  1OLM E;  3SNM A;  3WDV A;  3ZFE A;  3HNM A;  3RZK A;  3WQ0 A;  3CJI C;  1E5R A;  4NIA A;  1URX A;  1QIQ A;  1ZX5 A;  4GWN A;  3JB8 A;  3WF4 A;  2XLA A;  5E8A A;  1MS4 A;  2H0B A;  1ND3 B;  3Q8C A;  3BOW A;  4XTM A;  4YG3 A;  2XQR A;  4DXT A;  5JZG A;  5FZ6 A;  1GOG A;  2PMW B;  2BNM A;  2JG8 A;  5LB6 A;  1S0I A;  2BUK A;  4P02 B;  4FXK B;  5AVP A;  3VBF C;  5BNP C;  5DMY A;  4QX3 A;  5KHK A;  4Q0S A;  2AR6 A;  5FZC A;  2P3K A;  2RR1 1;  5FZ3 A;  2A6X A;  2OYZ A;  1SLC A;  2E33 A;  4C1X A;  1UCX A;  2VCA A;  4JDO A;  2VD7 A;  2QE3 A;  4CU6 A;  1AXK A;  1N1T A;  1VBA 1;  2A3Y A;  3N9L A;  4XUN A;  2YDE A;  1S0D A;  4NUB A;  5JOW A;  5FMB A;  5CIS A;  1D4M 2;  2A73 B;  3WNP A;  4Z8B A;  4NO4 A;  4FPJ A;  3T2Q A;  2VUA A;  4NAO A;  4XHB A;  1AL2 1;  1BHG A;  1K3I A;  4FPE A;  5FZF A;  3S7I A;  1OLM A;  4AW7 A;  3VBF A;  2Z79 A;  3ST7 A;  2W46 A;  4K1Y A;  4YM0 A;  3IPV B;  3KF3 A;  2PLV 1;  3L9J T;  1XE7 A;  2HEY F;  3OTF A;  1UOF A;  5CIR A;  5JIA A;  5I0T A;  1YHF A;  2CNA A;  2ZX2 A;  4EZ4 A;  1TMF 3;  4GKY A;  4AI0 A;  4MXV A;  3H1W A;  5C3R A;  1RUI 1;  2I2S A;  1D7P M;  2GP5 A;  2VZQ A;  5DZE A;  1AX2 A;  2X09 A;  3TN9 3;  4RR3 B;  2GND A;  1BJQ A;  1AHS A;  5FPV A;  1W0O A;  1KIT A;  1Z7S 2;  2Z4F A;  1RUE 1;  2EXH A;  2K9Z A;  3UV9 A;  2NM1 A;  1TNR A;  4NPR A;  1H1I A;  2VQ0 A;  1ULO A;  2QFE A;  1MVE A;  1YIP A;  5HI0 A;  1WMF A;  3MIE A;  1JS9 A;  5T3N A;  5LBE A;  2ARA A;  2K46 A;  1AYN 3;  1ZZ9 A;  3O0X A;  5C9A C;  4J1W A;  4IE0 A;  3MI8 A;  5A7W B;  1JYI A;  1ZBE 2;  3QH6 A;  4FQZ A;  4OUL A;  4JVA A;  3NJZ A;  3NV4 A;  1RHI 2;  3BIW E;  4IW3 A;  2Q8D A;  4YM3 A;  5LWB A;  2VOT A;  3B02 A;  3GM8 A;  3VD3 A;  4FOW A;  4CXX A;  4LUL A;  1SLB A;  1VBC 2;  1AR8 3;  1ZZ6 A;  3AK0 A;  2WT2 A;  4Q0Q A;  3VN4 A;  2XML A;  3MIB A;  5KXE A;  2BJS A;  4U2A A;  1PIV 1;  4BQ1 A;  4MO3 M;  4WVZ A;  1YC6 1;  2CU5 A;  1UKG A;  3E6C C;  3U75 A;  3WDT A;  1IHM A;  3DV8 A;  2FDF A;  1X36 A;  1BVV A;  1RJ8 A;  4O9G A;  3U11 A;  1L3J A;  4DUV A;  4QX0 A;  5CAZ A;  1O4Y A;  1UWW A;  2XHN A;  2RMU 3;  3U4S A;  3SEE A;  2DCK A;  4S2H A;  2JDP A;  1XU2 A;  2BQP A;  4XAB A;  5A3L A;  1N3Q A;  4NR1 A;  5A7S A;  1RJ7 A;  4XFB A;  4MSV A;  1CAV A;  1LJ7 A;  1ND2 A;  1UOB A;  2R07 3;  5IK4 A;  1NQD A;  1HQL A;  3WQ7 A;  4ERO A;  1GQH A;  1CAX A;  2D6O X;  2WA3 A;  1NLS A;  1NLR A;  1W2O A;  3BOD A;  3M3I A;  5KHJ A;  1J83 A;  2OT7 A;  1D0H A;  3FE5 A;  1NXD 1;  4BM8 A;  3J26 N;  1SLT A;  2DBI A;  4NRQ A;  5F6L B;  3FMG A;  2B8M A;  5EIY B;  1QJY 2;  2W0X A;  4B1M A;  1QJX 3;  1UZ0 A;  4CRQ A;  1YLL A;  4CCO A;  1LCL A;  5AC9 2;  3BYW A;  1CZV A;  5A6Q A;  2JE9 A;  4NAM A;  4DRR A;  4CEY B;  1FYU A;  2WA4 A;  3N35 A;  1NY7 1;  4UW3 A;  4QQP A;  5IVC A;  2OUJ A;  3FWE A;  1RIR A;  5EQU A;  3VKM A;  2VR4 A;  4OHZ A;  2JIJ A;  4AE2 A;  1QQP 3;  1UY0 A;  1LOF A;  4ISR A;  4MHR A;  4WM8 C;  1CR7 A;  4ZS3 A;  4RHV 1;  5A7P A;  5FKC A;  5DUX A;  1TVG A;  5DZG A;  3LDB A;  1AUY A;  4BLJ A;  1RVF 2;  5K0U B;  1UYY A;  3KM5 A;  3I2D A;  4A6S A;  5E89 A;  2D3R A;  2ZMN A;  1KDM A;  2HWF 3;  2A1X A;  1YO8 A;  3CF6 E;  2FCV A;  4N53 B;  1UL9 A;  1E5S A;  3LEG A;  2WT1 A;  2JKX A;  2GN7 A;  2YC2 A;  3POB A;  4FPG A;  4LE4 A;  4NE9 A;  3VKN A;  3OGS A;  2ARB A;  3OBR A;  1JYW A;  1C3H A;  1CIY A;  2WBK A;  1BK0 A;  2WWU A;  4NJ4 A;  4L2N A;  4MGQ A;  3ME2 A;  1ST8 A;  4UFJ A;  1COV 1;  2P6C A;  1OF4 A;  4KU8 A;  1J3Q A;  1MPX A;  1TNF A;  1SDW A;  4AEJ A;  2RR1 3;  4OLL A;  2WS9 2;  4TWT A;  1BVP 1;  2AEN A;  4AED A;  1DZT A;  3K3N A;  3GF6 A;  3MO4 A;  2R0H A;  3N9Q A;  1HDK A;  4XUO A;  4CUG A;  5JSP A;  2VMD A;  3CZU A;  3IAQ A;  4AI2 A;  1HJF A;  2VTX J;  1VBA 3;  1VJ2 A;  4A7Z A;  3JU9 A;  2R1D A;  3VBU C;  1G9D A;  3O7O A;  4KH9 A;  3U14 A;  4JKL A;  3I2J A;  3T2O A;  2C5D A;  4UBH A;  3MW3 A;  4W6X A;  3WP4 A;  4I0W B;  3B93 A;  1LES A;  4FCA A;  4IEW A;  1JZ4 A;  2V4A A;  4JQR A;  3O1O A;  3N9M A;  5FLJ A;  3AYE A;  3VHN A;  5FYY A;  2VZR A;  2RS5 1;  2YFZ A;  3R4U A;  1GBG A;  2NZ9 A;  2YB7 A;  3AKP A;  4HAN A;  4NIH A;  5A32 B;  2W87 A;  4RGG A;  2PLV 3;  2YMZ A;  4GQ7 A;  5A33 A;  2YZ4 A;  2CWM A;  3OEB A;  1ZRD A;  3IMM A;  2E26 A;  5CFC B;  2Q5T A;  4NWW A;  2OS2 A;  2VUC A;  2VJX A;  3DCQ A;  3AZW A;  4LBQ D;  1V70 A;  4Q4V 2;  4XUR A;  4Z2A A;  1A8D A;  3RGB A;  4K7J A;  3KVA A;  5I93 A;  1RUI 3;  5A70 A;  2PHD A;  1TZO A;  1FAT A;  2BP6 A;  3VBU A;  5DPN A;  3HBK A;  1HRV 1;  1YJK A;  3NNG A;  3MIH A;  4XOG A;  1VBD 2;  3F95 A;  2QQW A;  4KU7 A;  5FZO A;  1OUR A;  5I91 A;  1RUE 3;  3PVO A;  1FT9 A;  5BNO A;  2UWA A;  3AP4 A;  2W5F A;  4AHX A;  1C1F A;  2F6B A;  1NT0 A;  2ZHL A;  3ILN A;  3K2O A;  5FAX A;  2CAV A;  2BFU S;  4QX7 A;  1W90 A;  4OI2 A;  2A6V A;  3N9O A;  1TMF 2;  4QMA A;  5KXD A;  4Y22 A;  3BTY A;  2JIC A;  4OZO A;  1NQJ A;  1V6K A;  2J1A A;  4Y1U A;  1TME 1;  5FZ8 A;  1SCR A;  3THT A;  1GP6 A;  3TNQ A;  4AQT A;  1VAL A;  4IDZ A;  1JOD A;  3AVS A;  3MYX A;  3WY6 A;  5J36 A;  1CPM A;  2Y33 A;  1S4C A;  3EQE A;  3HT2 A;  1IS3 A;  1RYY A;  2VQA A;  3A23 A;  1XE8 A;  5DN2 A;  1ZRC A;  5A3N A;  5C70 A;  2JX9 A;  5CYY A;  4JTO A;  4JC1 A;  1P8J A;  3NV2 A;  2HYX A;  2Q4S A;  4ZU5 A;  3N9N A;  5FXZ A;  4CE8 A;  1AYN 2;  1PIV 3;  3AFK A;  4QPI A;  1W06 A;  3MW2 A;  4V1P A;  1H2N A;  3A21 A;  4CU7 A;  1W9F A;  3HOB A;  3M3C A;  1MVQ A;  1O8S A;  1OQE A;  3OG2 A;  4QX8 A;  3ES1 A;  3H8U A;  5CG9 A;  1EUT A;  4AFM A;  1PGW 1;  1DCS A;  2P6H A;  1YUD A;  2Y60 A;  1YQ8 A;  3M70 A;  4IV3 B;  2GDF A;  4XET A;  5F32 A;  4X8P A;  2Y6F A;  3H50 A;  4XJZ A;  2UYA A;  3B7M A;  1AR8 2;  4RSU A;  1HW5 A;  2VXR A;  2WUH A;  4TSV A;  4E9K A;  1GYK A;  1BYH A;  2JDU A;  3UJQ A;  2EIG A;  4ES9 A;  2XWB B;  4FPH A;  1KRI A;  2ES3 A;  1IZ3 A;  5GJ6 A;  3S6P A;  3WQB A;  1HV1 A;  3K46 A;  3BU7 A;  3SC7 X;  5JR2 A;  2JDA A;  4I2O A;  2FD8 A;  1F5J A;  1VB2 A;  4LOT A;  1AR9 2;  4DO0 A;  3LKJ A;  5HCH A;  3ACG A;  3GHN A;  2XJT A;  2XR4 A;  3PVE A;  4JGZ C;  1IPK A;  3WXP A;  2YU2 A;  1H2L A;  1QH6 A;  1FV2 A;  3AMH A;  5A1F A;  4CEY C;  2R07 2;  2WAB A;  2W1U A;  1ZVF A;  3GZA A;  2XL9 A;  1PVX A;  3KB5 A;  4M3C B;  3OY8 B;  1XNC A;  4P5H A;  4PJY A;  1PZ9 A;  4JHT A;  5DG1 A;  1GUI A;  3S7E A;  1VMH A;  2YPJ A;  2VMC A;  3P6B A;  1R09 1;  2VZP A;  3SH3 A;  4OMC A;  2CY6 A;  5IK7 A;  3IMN A;  3B9I A;  2DVA A;  4RD7 A;  1WLW A;  4RHV 3;  5FMO L;  3RFR A;  1JUI A;  4Y1Y A;  4YZ1 A;  3RJR A;  4JAA A;  3VKL A;  1QJX 2;  1J3P A;  1C8N A;  4YSF A;  4PF5 A;  2R32 A;  1FPN 2;  3THD A;  2FZ2 A;  1GLH A;  3WNN A;  3TB0 A;  2RJL A;  2VE1 A;  4JGZ A;  4MGY E;  2R7E B;  4IGO A;  4N53 C;  4JQT A;  3ZOI A;  3EB7 A;  1KGY A;  2HEW F;  1OFN A;  5FJK A;  1JOP A;  1W6O B;  2R30 A;  3JUU A;  1ZRI A;  3POG A;  4FP2 A;  4N9I A;  4XF9 A;  4Y5T A;  4G9S B;  4AR2 A;  1DQ4 A;  3LEI A;  4D94 A;  5FK8 A;  3ACH A;  1LHO A;  1QGL A;  3SHR A;  2W92 A;  3ZXJ A;  1RB8 G;  1COV 3;  2G9G A;  4LNV A;  4AVA A;  1JOB A;  5LRS A;  5FZD A;  1CGP A;  3WW1 A;  3ZYP A;  2AYH A;  4I02 A;  1WBF A;  2HWF 2;  3GGL A;  4IEU A;  1JYT A;  2XWJ B;  3OGJ A;  3WG3 A;  2BVV A;  2O1Q A;  3HN3 A;  1AR7 2;  4LBK A;  2B5H A;  1G7Y A;  2XVK A;  3QCW A;  4QB2 A;  3ABZ A;  4LBO A;  1W8O A;  3Q8E A;  4WM7 A;  4CPB A;  3BKZ A;  1QJU 2;  1BEV 1;  5EFU A;  5J98 B;  4XF1 A;  4P9G A;  2JDH A;  3RWK X;  4CP1 A;  5EYY A;  2QDR A;  2YBS A;  2CSG A;  2R0F A;  3POW A;  2JG9 A;  4QXC A;  1PHM A;  2RS5 3;  2RR1 2;  3LGR A;  4KWK A;  4XJ8 A;  3W9A A;  1CIW A;  3ENR A;  3KQR A;  4Q8K A;  1ENX A;  3ZXK A;  3NAP A;  3TWI A;  3WW4 A;  3HT1 A;  4IV1 B;  5CFC C;  4BK4 A;  2RG4 A;  1VBA 2;  4XFA A;  3AYC A;  5DAQ A;  2P5B A;  5LK5 A;  2WJS A;  4QX1 A;  1YYN A;  1Y9Q A;  3WZ1 A;  1GWK A;  1A78 A;  5A3P A;  2IVI B;  4R9C A;  2I07 B;  1HRV 3;  5F2W A;  1YIF A;  4FFH A;  3MPB A;  4CP0 A;  5JPM B;  3PUR A;  5LAS A;  5LAT A;  4GMP 1;  3W59 A;  2JDK A;  1R1A 2;  1ZZB A;  2PLV 2;  4XUP A;  3VL8 A;  1TG7 A;  3FZ3 A;  5F9T A;  4GJZ A;  3TRS B;  3I2O A;  2TEP A;  2IXH A;  2ZGN A;  4JDM A;  4PI0 A;  4QT6 A;  1N1Y A;  5C8C C;  4PHZ A;  1MZE A;  1DYP A;  1NCR A;  3WSO A;  4YLZ A;  4R9D A;  1OQD A;  3I3B A;  4XC9 A;  2PN5 A;  2ZKL A;  3I59 B;  4C0B A;  3DPR B;  5LRR A;  4WZC A;  2VAU A;  3WT3 A;  2HJI A;  1TME 3;  3C8X A;  1XU1 A;  3GHM A;  1IG0 A;  1NG0 A;  1OF3 A;  1S2B A;  2PEL A;  4FFG A;  4XFF A;  3ZFG A;  4YNI A;  1PM4 A;  4CCJ A;  5FZH A;  3LCP A;  2XUE A;  4AOC A;  1RUE 2;  2X53 S;  4JHZ A;  5L73 A;  5T5L A;  1O4T A;  5FY4 A;  4L97 A;  2VU9 A;  3U37 A;  2E63 A;  3KHC A;  1W6P A;  4Q4W 1;  4DXR A;  2C26 A;  5FZ4 A;  5IJR A;  5A3W A;  4CUB A;  3RZG A;  1YWK A;  3FBM A;  2LAL A;  4QXK A;  3WHU A;  5C8C A;  5H9P A;  5L7O B;  4BHP A;  3CU7 A;  4EZH A;  4BIO A;  4EWA A;  4YW2 A;  3I7D A;  2FCT A;  4Q26 A;  5D8A B;  1W0P A;  3HBZ A;  5CFD A;  3GYD A;  4ITC A;  1BQP A;  1W6N B;  1FXZ A;  2UYB A;  4HET A;  3O1S A;  1Q8V A;  1V6O A;  3VBS B;  2NP0 A;  4URA A;  1XNT A;  5IAX A;  3P3P A;  3J4U H;  3OOX A;  1H30 A;  4AYU A;  2SLI A;  4LBJ A;  2XBO 1;  1PIV 2;  2XOM A;  1CON A;  3JQW A;  3OGR A;  1DBN A;  4LIV A;  4P9J A;  4XFH A;  4YVS B;  2W47 A;  3T0D A;  4YW7 A;  1NE6 A;  4L9B A;  4X6Q B;  3NJX A;  5FMD A;  4SBV A;  1YEW A;  3HJR A;  3J8F 3;  2UY9 A;  5LBB A;  3AP5 A;  1GWL A;  4Q4X 2;  4PDW B;  1PVC 2;  3RZH A;  1UXX X;  4Y26 A;  5JXI A;  5FY7 A;  2OKX A;  4PBP A;  1V9U 1;  4RQP B;  1IPS A;  4Z07 A;  5JXJ A;  2OW4 A;  3ZDV A;  1R09 3;  3TEY A;  3GBF A;  4PT6 A;  2XKP A;  4YFW A;  4CU8 A;  5JZG B;  1XQN A;  1JU4 A;  1YFX A;  2JG8 B;  3RZZ A;  4X8N A;  1AX0 A;  2IWG B;  5EJ1 B;  3TOJ A;  2DF7 A;  3USU A;  5LK7 B;  2JKB A;  2GH2 A;  4HKL A;  5J96 B;  2CGP A;  4B29 A;  4LO8 A;  3BIE A;  1CZT A;  2VZV A;  3GXU A;  1H8V A;  1ULD A;  2EXI A;  4LO5 B;  1MEC 1;  2VPV A;  3T4V A;  4IQP A;  3ZFF A;  2Q1Z B;  2O8Q A;  2GP3 A;  3KV5 A;  2A70 A;  4CDU A;  5G04 L;  2OQ6 A;  4PIZ A;  4RHV 2;  1DQ1 A;  3ACF A;  4EV0 A;  1FI2 A;  3NKT A;  1US3 A;  2GSY A;  5FZ1 A;  4OYU A;  1KFU L;  3B5L B;  3NJV A;  3VBF B;  5FZL A;  2ET7 A;  1I5Z A;  4NPM A;  4XBN A;  1UO9 A;  2E32 A;  2FDH A;  4HK8 A;  4NIG A;  1ULG A;  2VOV A;  1K45 A;  1AXZ A;  1RUH 1;  5KR7 A;  1W3X A;  3BGA A;  3DYM A;  1JYX A;  1LKN A;  3O1T A;  4DQA A;  1A6C A;  3VKF C;  1VMJ A;  4LHS A;  4DEV A;  4BPZ A;  3CLP A;  2VW0 A;  5D21 A;  3VDD C;  3J7L A;  1UY1 A;  1OA2 A;  4ONU A;  2X5I A;  3S0M A;  1OLQ A;  1CQ9 A;  3C2U A;  3R05 A;  4QDS A;  1BEV 3;  4Q1R A;  1COV 2;  1RUC 1;  1XYN A;  4H14 A;  5FIX A;  3ZIW A;  4LO4 B;  2DVF A;  5J09 A;  1GP5 A;  1LEN A;  2ZX1 A;  5L36 A;  2J1T A;  2NPI A;  2PTM A;  4Z82 A;  5FV3 A;  3VD5 A;  2OUH A;  5DAB A;  4UFK A;  3WHT A;  3ZO0 B;  1W8W A;  4XAA A;  1HKD A;  4FOQ A;  4HBN A;  5E16 A;  2PHX A;  4XDO A;  3NO8 A;  4YVW A;  4IV1 C;  3WCR A;  2VH9 A;  1BMV 1;  1Z78 A;  2RDS A;  4OHW A;  2NQY A;  1O3S A;  1G9B A;  1NZI A;  4HL0 A;  2PAE A;  4RA0 A;  3T1L A;  4UFL A;  3VDD A;  1FMD 3;  4A45 A;  1I9R A;  4O65 A;  5F5A A;  1O5U A;  1ZNP A;  4QPG A;  3QD6 A;  2RS5 2;  3H3L A;  1WMD A;  3D6E A;  1VIW B;  4GMP 3;  3VD4 A;  1J58 A;  5T55 A;  4W6W A;  3SKV A;  1F35 A;  2ZX4 A;  3POF A;  4JV4 A;  4R4X A;  1DLL A;  5FXX A;  3AYA A;  3DKQ A;  1EPZ A;  3D0J A;  5JOY A;  2BWA A;  5APA A;  2GAU A;  1RTV A;  3EYP A;  5LW9 A;  2XVG A;  4MGT A;  1W3V A;  2WZP P;  2NMN A;  2X10 A;  4FFI A;  1HRV 2;  3PL0 A;  3HNB M;  5JWP A;  3OBA A;  3OD4 A;  4I0A A;  3MV0 1;  4NRM A;  4OHV A;  4AHY A;  3WNX A;  1PMH X;  2DFC A;  3HEI A;  3PUQ A;  4JTN A;  5CVR A;  1W9S A;  4AG4 A;  4OI0 A;  1JYC A;  1CAV B;  2J1U A;  1UY2 A;  3K4Z A;  4IGQ A;  1ND2 B;  3DXU A;  3VZL A;  2FDG A;  3PVB B;  4Y1V A;  1JU3 A;  1CAX B;  3NV3 A;  2LM3 A;  3OJB A;  5FYM A;  5GLT A;  5HBA A;  1DDL A;  3AMP A;  1UF2 C;  5L7O C;  5FYI A;  5C3Q A;  1JHN A;  1TME 2;  1QH7 A;  1WCD J;  2PHF A;  3OPT A;  3H0O A;  2XJV A;  3RRD A;  4CCN A;  2RM2 1;  5D8A C;  2E51 A;  4TLF A;  4KQ7 A;  4B4R A;  1CAW A;  1J3R A;  2EVX A;  1US2 A;  2JJ6 A;  4FPL A;  3WVJ A;  2B4K A;  2XLG A;  2A71 A;  1YQC A;  5T52 A;  1RUG 2;  2P37 A;  5FO7 B;  1SMV A;  4PCR A;  4FOY A;  1JZ5 A;  2XBO 3;  1SZB A;  1WCU A;  4YVS C;  3WDW A;  1XJA A;  1XSQ A;  3C7F A;  4FO9 A;  1RUJ 1;  4GB3 1;  4AQ6 A;  2WFF 1;  1W05 A;  3OYW A;  5FBJ A;  4ZZ8 A;  2WC2 A;  5EXO A;  3N9P A;  1CAU A;  1AZD A;  1UU4 A;  3OUH A;  5FPZ A;  3SEP A;  1PGW 2;  4DIN B;  1EY2 A;  3I8T A;  1XNA A;  4Q8L A;  4QAW A;  4PDW C;  3I4I A;  1PO2 2;  4IES A;  5BUV A;  2GZW A;  2RJ2 A;  4IET A;  1J84 A;  1W6M A;  4F8A A;  1V9U 3;  4RQP C;  3OB8 A;  1DFQ A;  2DV9 A;  1C57 A;  4XZU G;  4QX2 A;  4DFS A;  5FPL A;  2AEY A;  4YZ3 A;  5IHR A;  3KCY A;  2GU9 A;  4L11 A;  4XUQ A;  5FBZ A;  1HV0 A;  1OBN A;  2Q8O A;  2VOW A;  2IFR A;  1H2K A;  2ZGT A;  3A22 A;  2ZAA A;  2WN3 A;  3QAC A;  2JG8 C;  3J8F 2;  4GA9 A;  5FMO S;  1UU6 A;  3WDX A;  1ODM A;  3WNO A;  4E4S A;  1HQW A;  4CCM A;  2E31 A;  3ELN A;  1EUU A;  2IZW A;  5FY8 A;  4GAZ A;  5F37 A;  4AED B;  3PUH A;  1X33 A;  4PI2 A;  1G9F A;  5FLH A;  5LY1 A;  1MEC 3;  2JEN A;  3LDK A;  4RQP A;  1AXY A;  5CKM A;  4E4Z A;  2MNG A;  3T09 A;  1ZZ7 A;  4CSW A;  3EO6 A;  1IS5 A;  1LGN A;  3DEM A;  2VBB A;  4BXF A;  4GJY A;  5GZE A;  3FLR A;  1Y3T A;  4R4Z A;  3UGH A;  1ASJ 1;  5DAW A;  4MGZ E;  5IVY A;  1WLC A;  1SLI A;  2D6L X;  4RS5 A;  2ARC A;  4YAR A;  3D82 A;  4Z92 B;  4YGB A;  1VBB 1;  4YW6 A;  5ACA 3;  1W39 A;  2HWB 3;  1WLD A;  1RUH 3;  5A33 B;  1UD1 A;  2A7A A;  4CP9 A;  5D2A A;  5K8S A;  1ZRR A;  3B9C A;  2ZKN A;  1VLN A;  2ERF A;  4QU1 A;  4K8R B;  2GNM A;  1SCS A;  3RYP A;  3PHM A;  1HRI 1;  3ILF A;  3VBU B;  3DN7 A;  3ON7 A;  4WVM A;  4B7E A;  2GC1 A;  1RUC 3;  5IVB A;  2MEV 1;  3FBY A;  4WV8 A;  3SMH A;  2IXL A;  4UAP A;  3ZXD A;  5T50 A;  4AL9 A;  5GZD A;  1ZM1 A;  2D6P A;  3ZVX A;  5FZO B;  4JKM A;  5BNO B;  2WKK A;  3I3D A;  1PZ8 A;  1QJF A;  1S55 A;  3UNP A;  2ZMK A;  1PMI A;  3LPF A;  3KQ4 B;  1W0N A;  4AVV A;  2PQS A;  5JAX A;  2DTY A;  2RHP A;  4B1L A;  4YYO A;  1YNA A;  3J7H A;  3PTR B;  2AZ5 A;  1XE0 A;  2JXA A;  3GZU C;  3N7M A;  4Y22 B;  1OA3 A;  5T54 A;  3RPQ A;  4CP2 A;  3O1P A;  2VCC A;  5FRA A;  5BNN A;  1BEV 2;  2D7F A;  1HB2 A;  3VBH A;  4UYB A;  4BZ4 A;  3OPZ A;  5FP8 A;  4LO7 A;  1O8P A;  4CDQ C;  1LOD A;  2QQN A;  3D3A A;  3BTA A;  4UW6 A;  3C7E A;  2D43 A;  2UY8 A;  4QB6 A;  2D3P A;  4Y5Z 0;  4A2U A;  2R06 1;  2YXS A;  4UOJ A;  4H7L A;  2NLR A;  2DCJ A;  1UMH A;  1X8E A;  3KS7 A;  4XCB A;  4YW5 A;  2HWE 2;  4KMQ A;  4K6B A;  5HCB A;  3HMY A;  4JGY A;  4AZZ A;  3CIH A;  4OCT A;  4QPI B;  4HN1 A;  4Y4R A;  1LED A;  4P14 A;  2OVU A;  4D7Y A;  3OCP A;  3DYO A;  1LHU A;  1FMD 2;  2IXK A;  3FL7 A;  2GC3 A;  1UW8 A;  1S0J A;  1IQA A;  1NAE A;  4QKD A;  1FOD 1;  2ZTN A;  3AZX A;  3ZYH A;  4XIO A;  1QDO A;  1RUD 2;  3ZXA C;  2FMY A;  1Q3E A;  3DEC A;  1NXM A;  4CDQ A;  1STM A;  4ZS2 A;  2BGP A;  1JBC A;  1DYO A;  4QKN A;  1AR6 1;  1NA1 A;  1ND2 C;  1YFW A;  3ETQ A;  5BNQ A;  3LDR A;  3PVN A;  1UXZ A;  4D6S A;  1S0G A;  3L2H A;  1KFX L;  2D44 A;  3IT8 A;  2G9Z A;  2O8O A;  2D5H A;  4OQ9 A;  5FZB A;  2IXJ A;  4AFA A;  3M7A A;  4XEZ A;  1UX7 A;  2WAA A;  2TBV A;  1V6L A;  2XG3 A;  5L9R A;  2RM2 3;  2WNV C;  1XYO A;  4CA9 A;  1F8V A;  2W52 A;  3R4D B;  3ROU A;  3ZYR A;  4FT8 A;  2ZEW A;  1SHW B;  3GBW A;  1WWY A;  3VKO A;  3PIG A;  2DCZ A;  4OMD A;  4P9Y A;  1RMU 1;  4OHX A;  2VZT A;  1NCQ A;  4FTB A;  1YFY A;  4QPY A;  5GLU A;  5EZW A;  4LLO A;  5GM0 A;  4GB3 3;  3B3Q E;  1LOF C;  1RUJ 3;  5EJ3 A;  2WFF 3;  2JD9 A;  5A80 A;  2V4V A;  1QNY A;  2QZ3 A;  3V65 A;  1HN0 A;  5GZG A;  3POE A;  1POV 0;  4Q2F A;  4CEW A;  1UOJ A;  4MUV A;  5KHI A;  2OZ6 A;  2C4X A;  1YCI A;  1BBT 1;  2ZX3 A;  3LFI A;  2P17 A;  3FFZ A;  1RIN A;  2WNV A;  4QGN A;  3LD8 A;  4JGZ B;  2WZR 3;  2RVA A;  4DY3 A;  2R1B A;  1JTZ X;  2XBO 2;  1C8M 1;  4L0P A;  2VOK A;  1DG6 A;  1W2N A;  1G86 A;  4JDN A;  4LTA A;  5FYZ A;  1S1A A;  1UYZ A;  2PXJ A;  3AX4 A;  1AYM 2;  1CX1 A;  1DQ2 A;  4R9A A;  2WSU A;  2BBA A;  3FFQ A;  4N8M A;  4F7Z A;  1Y9M A;  2A6Z A;  4UBG A;  1TQ5 A;  1DGR N;  3ZKY A;  3WF3 A;  2V72 A;  3CL1 A;  2YU1 A;  2WII B;  2DUO A;  4NRP A;  2OZJ A;  4XUT A;  4FAG A;  5A6Z A;  3WW3 A;  4NHM A;  3NW4 A;  1RXF A;  3QBQ A;  3FC0 A;  3IZO A;  4COZ A;  4AED C;  1LGC A;  1V9U 2;  5DAX A;  4O7X A;  3HIF A;  1YXW A;  2D40 A;  2ZGR A;  1OXC A;  4NMI A;  4XQW A;  1A3K A;  3ACL A;  1EV1 1;  4GAL A;  3RG0 A;  1JOJ A;  1H8T A;  4WM7 B;  1ULP A;  1F15 A;  3TBD A;  1QOS A;  4ZHN A;  1N1V A;  2HWC 2;  3PJY A;  3VBO C;  1VMF A;  1ASJ 3;  2JG9 B;  1QU0 A;  3U4X A;  1GU3 A;  2WNU C;  1VBB 3;  4P9L A;  2QQV A;  3A0N A;  3ZX7 A;  5CBL A;  1SBF A;  4AI1 A;  2ZML A;  3NAP B;  2WWS A;  3V56 A;  4K40 A;  2BGC A;  1ZA4 A;  1MEC 2;  1OQ1 A;  4XBL A;  2XB6 C;  2K2S A;  4HK9 A;  4HMZ A;  3CQO A;  3RZM A;  5CNA A;  3JCI A;  4LQR A;  1HRI 3;  4FXG B;  2LUW A;  1VRB A;  1ZRF A;  5EV7 A;  4Q4Y 1;  3KGL A;  1HQN A;  2MEV 3;  2ARX A;  2Q1M A;  2W1S A;  1F9K A;  3ZR5 A;  3POS A;  5CU1 A;  3I2H A;  3VBO A;  4E27 A;  1ALY A;  1AL2 3;  2ZGQ A;  1SPP A;  2D5F A;  2ENR A;  4JRL A;  2HWB 2;  4XQ4 A;  5ACA 2;  3GZT B;  1RUH 2;  5BNO C;  1I1E A;  2WNU A;  3AXD A;  3CJX A;  4COU A;  1N1S A;  5FY0 A;  1KXG A;  3VZN A;  5B2G B;  2JB8 A;  1L7Q A;  1IQD C;  2QQJ A;  4AWD A;  1NCR B;  5EWS A;  3WDY A;  2J7M A;  1I3H A;  2GAL A;  2P4E A;  3LA2 A;  2WNE A;  3JBG 1;  4AFC A;  1LHW A;  4FBF A;  1UIJ A;  1JHJ A;  4FI9 A;  1RUC 2;  1X9T A;  1Z0H A;  3I2F A;  4HLT A;  3ZFG B;  3ATG A;  3RQ0 A;  3VD9 A;  2FQP A;  5C5T A;  1G6N A;  4XDQ A;  3O1V A;  2QQO A;  4LA2 A;  1E57 A;  5HPO A;  1H9W A;  5AFE A;  2ATF A;  2R06 3;  3KT1 A;  3P3N A;  3RWN A;  1W6P B;  1VBE 1;  4C91 A;  2BER A;  4Q0V A;  1UZV A;  3JZV A;  4QPI C;  2ZEX A;  5FPB A;  3WDU A;  4ZU4 A;  5C8C B;  1C28 A;  3AKQ A;  2VMH A;  4Y20 A;  4CYD A;  2D93 A;  5CKQ A;  2WLP A;  4P9W A;  5FYT A;  4CZS A;  3T4H B;  1OVS A;  1FOD 3;  1GNH A;  3TN9 2;  2D6M A;  3WP6 A;  5CFD B;  4BXS V;  4BA6 A;  3S57 A;  1HB4 A;  1N3P A;  4XAE A;  2VO5 A;  3LA3 A;  1MAC A;  5L19 A;  4BDV B;  1DGR A;  4HPK A;  2QQP A;  3JD7 1;  3AXE A;  1O3Q A;  2EAK A;  1AR6 3;  3M4F A;  3NV1 A;  3GCX A;  2CHH A;  2WDB A;  3I2K A;  1GV9 A;  1PNF A;  1GIC A;  3MIG A;  4RL7 A;  1PK6 A;  2FBE A;  3LZZ A;  3PME A;  2QQU A;  1PMJ X;  2ETE A;  3WF2 A;  4RFR B;  4AEM A;  3AC0 A;  3IDE A;  2TNF A;  4IER A;  2WQ8 A;  3VDB A;  3AZV A;  4O9E A;  3ZXF A;  4A4A A;  1H4H A;  1S2K A;  3JQX A;  2ZHK A;  4UFM A;  5L9B A;  4AK3 A;  4BE3 A;  1EAH 1;  2BGO A;  3INA A;  2JEC A;  5C71 A;  1HX6 A;  3DL3 A;  4R52 A;  2X05 A;  3MDP A;  1DQ0 A;  1RMU 3;  3B01 A;  3WCS A;  4DMI A;  5LBF A;  2A3W A;  4N43 A;  1OH4 A;  1MS0 A;  1UU5 A;  2XPJ A;  4I3P A;  3FN9 A;  2VCB A;  2VMG A;  1JXN A;  2BZD A;  4NII A;  3NRU A;  4ARY A;  5IVJ A;  5JUV A;  2RJK A;  1LAJ A;  2RS1 1;  5J3U A;  1SEF A;  3USU B;  1BBT 3;  3KD4 A;  2RMU 2;  4A6O A;  1YQ6 A;  4HG6 B;  2A3X A;  4LEJ A;  1BZW A;  5FDB A;  3S5A A;  3T0A A;  5JVV A;  3ZFF B;  1C8M 3;  5E1R A;  3IWZ A;  3M3Q A;  3LEM A;  4R9B A;  5FCC A;  3VBR A;  4CDU B;  3T08 A;  1RUJ 2;  3Q8F A;  4M0N A;  3APB A;  4R8H A;  2GC0 A;  4Q0U A;  1S0E A;  1O5L A;  2V73 A;  4AXO A;  3H7J A;  3ZIX A;  1IPJ A;  4LUM A;  2ZBJ A;  2H6B A;  4FPO B;  5C7G A;  1JH5 A;  2R16 A;  2EAA A;  2QCS B;  3KT7 A;  4UI9 L;  1UQX A;  2Z42 A;  4IEZ A;  5KXB A;  4FTS A;  4GH4 A;  2AH2 A;  4MGK E;  1FAY A;  2R04 1;  2WZR 2;  3AP6 A;  4XBQ A;  4UWD A;  3FX3 A;  1GMM A;  4XF4 A;  4QD2 A;  3FLP A;  4KL1 A;  3MV1 1;  4UW4 A;  4AFB A;  1OFS A;  1EV1 3;  5B4N A;  1QXP A;  4JKK A;  2VBD A;  4WM7 C;  2X5I B;  3BB6 A;  1QQP 2;  3NL1 A;  3P1I A;  2ADE A;  5LA9 A;  3DXT A;  5KHH A;  3NST A;  3FJS A;  2QBX A;  2JG9 C;  1C5I A;  3SQO A;  3T1M A;  2JDM A;  2YUE A;  4URT A;  3H1M A;  3NAP C;  1LHN A;  1UAI A;  2VUJ A;  3GDB A;  4PLO A;  4YVW B;  1EPW A;  1VAM A;  3C7H A;  4M0H A;  1ULE A;  3ZR6 A;  2VL4 A;  4LOR A;  2EID A;  3NNM A;  5JMO A;  4HKO A;  1XRU A;  3MZH A;  3VDD B;  4XE9 A;  4OFG A;  4Q4Y 3;  1AVB A;  3SIT A;  1GR3 A;  2DVG A;  4LJH A;  4QPG B;  2HWD 1;  4CTE A;  1KEX A;  1RC6 A;  1D4M 1;  4UT5 A;  3KGZ A;  4A44 A;  2KD7 A;  5I0S A;  3ALQ A;  3U10 A;  3K77 A;  1R64 A;  2VC9 A;  2Y0I A;  1QHD A;  2GMP A;  2MHF A;  2XGX A;  1VB4 A;  1NCR C;  1TE1 B;  5FPU A;  2CDP A;  1D4V B;  1FV3 A;  4AF9 A;  2C0Z A;  1GZW A;  1SFY A;  2ZAH A;  4KI5 M;  2MEV 2;  4TZD A;  2MPF A;  5C4W C;  3ZFG C;  5JXG A;  2HBU A;  3OF1 A;  3USS A;  3ZSK A;  4ATE A;  5KXC A;  1AL2 2;  1NOV A;  4LIT A;  3TEW A;  1U12 A;  2Y0O A;  2XQX A;  3ILR A;  4QQO A;  3WG2 A;  2DVB A;  3ZYB A;  2E7A A;  4KG8 A;  1VBE 3;  2DCT A;  5GLZ A;  3TAY A;  3I49 A;  4DXS A;  2BEO A;  2BU9 A;  4QWN A;  2RV9 A;  3DYP A;  2DBN A;  1SLA A;  5FZK A;  5J1X A;  4LHN A;  4S2G A;  4K9S A;  4QDQ A;  1O91 A;  4L92 A;  4RGA A;  2NN8 A;  5FFO C;  1RUI 2;  2CV6 A;  2J1E A;  4XMI A;  4BB3 A;  3WNM A;  2PFW A;  2QDN A;  5CFD C;  1CAW B;  5C4W A;  1TEI A;  4BQY A;  1ZBE 1;  4XMA A;  5E6H A;  2H6C A;  2R06 2;  1YJL A;  5F6K A;  4XJW A;  1OOP C;  1DLC A;  2XJS A;  3JD7 3;  4CPB D;  3MFA A;  4CCE A;  5LZ6 A;  3Q8A A;  4AHW A;  4CCL A;  1VBC 1;  2W68 A;  5C5U A;  2IUW A;  3OYW B;  2NYY A;  4LHK A;  3HNY M;  1W9W A;  2VQU A;  3W21 A;  5F3C A;  1W8Z A;  4HKW A;  1CAU B;  1C1L A;  1OHF A;  3J7M A;  1FOD 2;  1H1M A;  5IUQ A;  4YGC A;  4ZY9 A;  3BI3 A;  3ZSL A;  4LXL A;  1IKP A;  1EAH 3;  4TN7 A;  1W6M B;  2WYS A;  3SXW A;  5DUV A;  3GCW A;  1B09 A;  2XLF A;  1WMX A;  4LOS A;  4BQ3 A;  1OOP A;  2HBT A;  3T30 A;  4ZU7 A;  4QKF A;  3O1U A;  1ZZ8 A;  1WKY A;  4OHY A;  4TTG A;  4GKX A;  1S0B A;  3E6D A;  2BNO A;  3I2I A;  2ZAC A;  1BK1 A;  3WLU A;  3OUI A;  4TLG A;  2IFW A;  4QGL A;  3BUC A;  2O14 A;  2RS1 3;  4I01 A;  5F3G A;  3THP A;  1OH3 A;  4AI8 A;  4QX5 A;  1Y7B A;  3ZM8 A;  3X29 B;  5C3P A;  2ZGK A;  1KJR A;  4XJU A;  3IDB B;  3DF0 A;  3I54 A;  3JXS A;  3U0Z A;  5CKN A;  3UGG A;  2ZX0 A;  1RMU 2;  3ZFF C;  4CCC A;  2BPA 2;  2JB4 A;  4FAH A;  1CWP A;  5AC9 1;  3MIC A;  1XOY A;  1E5I A;  2VW2 A;  2VZ3 A;  4NVP A;  4CDU C;  1W8H A;  4DNY A;  5A1A A;  5IAT A;  1X50 A;  2J1R A;  3AP9 A;  1QWR A;  3PUA A;  5F7U A;  4HSL A;  4RS5 B;  2VNR A;  1UPS A;  2F17 A;  2CTV A;  2HEV F;  2QUO A;  4FOV A;  4V2V A;  1OA4 A;  2UWB A;  4L8Q A;  5FYH A;  2R04 3;  2YBP A;  4CP9 B;  4EN6 B;  2PAK A;  1NYW A;  4PIX A;  5K7P A;  3LOI A;  1CZS A;  1B35 C;  1OI6 A;  1RVF 1;  2QVS B;  1C8M 2;  1XBF A;  2QZ2 A;  5F5I A;  1NY7 2;  3RNS A;  3CZJ A;  1WW5 A;  1UMZ A;  2AEZ A;  2ZJC A;  3FUQ A;  4COV A;  4YGE A;  2E7T A;  3ZN5 A;  5HV4 A;  3H1Y A;  4BIF A;  2X5I C;  2AC1 A;  1KDK A;  2VVD A;  3ECQ A;  4WVM B;  4K8F A;  3WV6 A;  3POJ A;  4OUM A;  4KWJ A;  4XXP A;  5FZM A;  3WG1 A;  3AB0 A;  3IDA A;  3ZN6 A;  5A6X A;  4I0B A;  4JCK A;  4IEO A;  2R6Q A;  5AFB A;  4BCU A;  4EN0 A;  1OT5 A;  3NMB A;  4HZF A;  4FPC A;  1U5Z A;  4EN8 B;  4CUA A;  2WO7 A;  4PF1 A;  4YVW C;  5ABJ C;  2B45 X;  1B35 A;  3KLS A;  4PBO A;  5JPN B;  1K42 A;  4FVV A;  3CKH A;  1AF9 A;  3MFC A;  4HVQ A;  3RZJ A;  5BNN B;  3EMR A;  2RS3 1;  4MET A;  3VBH B;  2ZAB A;  5IYY A;  4QPG C;  2HWD 3;  5DAP A;  1HXS 1;  4Q27 A;  5HXM A;  3RS6 A;  3HQR A;  5IT6 A;  2W39 A;  2ZCW A;  2Y6J A;  3MEP A;  4YM2 A;  1JYV A;  3K3O A;  4QU2 A;  1D4M 3;  3BPZ A;  3HAG A;  3LSE A;  5ISL A;  4IEY A;  3ITQ A;  2HLE A;  4HN0 A;  1EYB A;  4JGY B;  4AAP A;  4XW3 A;  4IEQ A;  2KR2 A;  2B39 A;  2LTN A;  5ABJ A;  4XAC A;  3WX5 A;  4KGQ A;  4LR4 A;  3PIJ A;  3O12 A;  1R1Z A;  3K48 A;  5ANN A;  4CXW A;  3N36 A;  2Y26 A;  4XFG A;  4KNC A;  2PHR A;  1R08 1;  2EXJ A;  4Q4V 1;  4B4P A;  4I3G A;  3MPP G;  5BY5 A;  4P9X A;  4CDQ B;  2RDR A;  4I30 A;  4LK7 A;  4W65 A;  4Y33 A;  5GAL A;  1NA1 B;  1LOG A;  1PX3 A;  4WVV A;  1VBD 1;  2LS6 A;  2J1S A;  4H55 A;  3CNA A;  3I2G A;  3WP3 A;  4XJ9 A;  2EF6 A;  2WO2 A;  1V0A A;  3AMN A;  5EPA A;  2EAL A;  3B69 A;  3QLQ A;  4GXL A;  4LHL A;  4MOA A;  4YW4 A;  4RFT 0;  1I6X A;  2IVJ A;  2VUL A;  5LA1 A;  2VNV A;  3PU8 A;  5C3O A;  3BTX A;  3OBT A;  1Q43 A;  4BQ2 A;  1V6M A;  2J42 A;  1OKQ A;  3ZSE A;  1WW7 A;  5E88 A;  3IM0 A;  5FO9 B;  2BDR A;  1OLR A;  3RJ2 X;  1PM7 A;  4P08 A;  1OC1 A;  5KBF A;  3WF1 A;  4NHX A;  3WD5 A;  1NCQ B;  2ZGU A;  3M3E A;  4Q4W 3;  4WZF A;  4QM9 A;  2CGN A;  1O3T A;  4K20 A;  1RIT A;  1VBC 3; 
#chains in the Genus database with same CATH homology
 3C7G A;  4ZZ5 A;  3E1F 1;  1RYY A;  3A23 A;  5DN2 A;  1UXZ A;  2W94 A;  5C70 A;  5CYY A;  2W1W A;  1P8J A;  3HPN A;  1GQP A;  2HYX A;  2VZO A;  1UX7 A;  2WAA A;  2ID4 A;  3A21 A;  1YQ2 A;  4CU7 A;  3HOB A;  1O8S A;  1L7R A;  2QQI A;  2Y8K A;  1XPW A;  3OG2 A;  2ZEW A;  4GWJ A;  1EUT A;  4QB1 A;  1SHW B;  1H6X A;  4OMD A;  2WAO A;  2VZT A;  3K75 B;  2WUH A;  3MUY 1;  2W95 A;  2JD9 A;  2V4V A;  2C4X A;  3WQB A;  2EIB A;  3K46 A;  3LPG A;  4W4Z A;  3MUZ 1;  2LW8 A;  3PUI A;  2Y64 A;  5JR2 A;  2JDA A;  2VME A;  2ORX A;  3LE0 A;  3WF0 A;  2RVA A;  1SG3 A;  3ACG A;  4L0P A;  4GZ9 A;  4W50 A;  1UYZ A;  4DUX A;  1JI6 A;  2WAB A;  3FHQ A;  2W1U A;  2Y6L A;  4D0Q A;  1CX1 A;  2BBA A;  3UET A;  1GUI A;  2B9V A;  1JZ7 A;  3P6B A;  4XVH A;  2VMC A;  2VZP A;  2V72 A;  3WF3 A;  4OMC A;  4XUT A;  5I0D A;  1GOH A;  3K4A A;  4E8C A;  1NUK A;  1F4A A;  3WNK A;  1XC6 A;  2ZEZ A;  3THD A;  3WNN A;  1ULP A;  2R7E B;  4QDR A;  3EB7 A;  1KGY A;  2VZS A;  1JZ6 A;  1UY3 A;  3LEI A;  1GU3 A;  1UYX A;  3ACH A;  4JX0 A;  2W92 A;  4D8M A;  2WZ8 A;  2W91 A;  3CQO A;  4LQR A;  3GGL A;  1PX4 A;  4LKS A;  2VQT A;  4P00 B;  3W5N A;  3HN3 A;  2W1S A;  4QB2 A;  3ABZ A;  3I2H A;  1W8O A;  2VTF A;  3I97 A;  3F2Z A;  1WCQ A;  5LA0 A;  1L7Q A;  1IQD C;  2QQJ A;  4CU9 A;  1OD3 A;  4YPJ A;  2J7M A;  4RN5 A;  1JHJ A;  4FI9 A;  4BK4 A;  2ZXQ A;  3I2F A;  5B4X A;  3VD9 A;  4IUG A;  2W1Q A;  3CDZ B;  2QQO A;  4QX1 A;  5HPO A;  3LQC A;  3I3E A;  3THC A;  2CDO A;  2BER A;  2ZEX A;  3NQH A;  3K4D A;  4XUP A;  1TG7 A;  4MGS A;  4BK5 A;  2ZEY A;  5DQ0 A;  3WSO A;  1W9T A;  3I3B A;  4BXS V;  4CUC A;  2VO5 A;  4BDV B;  3C8X A;  1W8N A;  2WO3 A;  1OF3 A;  2WDB A;  4QPW A;  3I2K A;  4JHZ A;  1UY4 A;  5IFP A;  1PMJ X;  2EIE A;  3WF2 A;  4GWI A;  1SDD B;  3U37 A;  2J22 A;  3AC0 A;  2YG0 A;  2C26 A;  5IJR A;  4DXR A;  4CUB A;  2WQ8 A;  2VM9 A;  4A4A A;  3CMG A;  3T2P A;  5C71 A;  2BGO A;  3WNL A;  2W9X A;  2VZU A;  1DP0 A;  4DEQ A;  4M4P A;  2X05 A;  3A7Q A;  1OH4 A;  1XNT A;  3FN9 A;  2VCB A;  1JZ5 A;  1O59 A;  3UES A;  2BZD A;  5JUV A;  3NRU A;  4ARY A;  2XOM A;  3OGR A;  4KWU A;  3T0D A;  2W47 A;  4A41 A;  4LPL A;  2Y6K A;  3NJX A;  4A6O A;  4ZXE A;  4HG6 B;  3T0A A;  3HJR A;  2VMF A;  3FHA A;  1UXX X;  3T08 A;  5JXI A;  2OKX A;  1JZ2 A;  3LEK A;  4A42 A;  5JXJ A;  2WN2 A;  5C7G A;  4UI9 L;  5EJZ B;  4PT6 A;  4CU8 A;  2VZ1 A;  3OGV A;  1JU4 A;  1GMM A;  5EJ1 B;  3III A;  3MV1 1;  2YC4 A;  4A3Z A;  1GOF A;  5B4N A;  3MBW A;  2ORZ A;  5CZK A;  4JKK A;  1I5P A;  1CZT A;  2VZV A;  3GXU A;  3P1I A;  5LCW L;  3W5M A;  3T0B A;  2QBX A;  5G04 L;  3HNM A;  3ACF A;  3WEZ A;  2V5D A;  1US3 A;  4OYU A;  4W8J A;  3GDB A;  3NJV A;  3WF4 A;  3C7H A;  2E32 A;  4DXT A;  2VL4 A;  1GOG A;  1K45 A;  2EID A;  5DMY A;  1H6Y A;  4P02 B;  5JMO A;  3BGA A;  3DYM A;  1JYX A;  4QX3 A;  4LHS A;  4DEV A;  2E33 A;  2VCA A;  1UY1 A;  1KEX A;  4A44 A;  4QDS A;  5LA2 A;  2KD7 A;  4CU6 A;  3K77 A;  1R64 A;  4XUN A;  2VC9 A;  2J1T A;  3VD5 A;  4PQQ A;  3WNP A;  2CDP A;  3T2Q A;  1BHG A;  1K3I A;  4KI5 M;  5JXG A;  2W46 A;  1JZ8 A;  4TXW A;  3SKJ E;  2XQX A;  4A45 A;  2QQK A;  4DXS A;  1D7P M;  2VZQ A;  3VD4 A;  1JZ3 A;  2RV9 A;  3DYP A;  2X09 A;  3SKV A;  3VDC A;  5J1X A;  4QDQ A;  2L9L A;  4ARX A;  2J1E A;  1LNS A;  2Z4F A;  4P5Y A;  3WNM A;  3EYP A;  2C9K A;  1ULO A;  2X10 A;  2YFU A;  1NX9 A;  1DLC A;  3BN6 A;  5IFT A;  3HNB M;  3OBA A;  2EIC A;  2WO1 A;  3MV0 1;  4AG4 A;  1PMH X;  3HEI A;  1W9S A;  2J1U A;  3K4Z A;  1UY2 A;  2VOT A;  3HNY M;  1W9W A;  2VQU A;  1JU3 A;  3GM8 A;  3VD3 A;  4CVU A;  4ZY9 A;  2DDU A;  1F4H A;  2WYS A;  2W3J A;  4MAD A;  3C7O A;  4MO3 M;  2Y6H A;  1US2 A;  1WKY A;  2B4K A;  4TTG A;  4DUV A;  3I2I A;  4QX0 A;  1UWW A;  2XHN A;  3SEE A;  2DCK A;  3C7F A;  3ZM8 A;  4ZZ8 A;  3IAP A;  3JXS A;  3SEP A;  2QQL A;  1XNA A;  1NKG A;  4QAW A;  1J83 A;  2RJ2 A;  2VZ3 A;  1J84 A;  3VD7 A;  5EIY B;  3OB8 A;  5A1A A;  1UZ0 A;  2J1R A;  4XZU G;  4QX2 A;  1CZV A;  5F7U A;  5IHR A;  4XUQ A;  3T2O A;  3A22 A;  2WN3 A;  2VR4 A;  1CZS A;  3WNO A;  1UY0 A;  1T2X A;  2WZE A;  2E31 A;  1HN1 A;  3CZJ A;  1EUU A;  2J1V A;  3VDA A;  1TVG A;  2JE8 A;  3PUH A;  3ECQ A;  1K12 A;  1UYY A;  3IDA A;  3T09 A;  3LEG A;  1OT5 A;  2JKX A;  2YC2 A;  4OUE A;  4CUA A;  3OGS A;  1JYW A;  4PF1 A;  2WBK A;  1CIY A;  1K42 A;  4MGQ A;  3CKH A;  1OF4 A;  1MPX A;  5FUI A;  3IB3 A;  5IYY A;  3ETP A;  5HXM A;  2Y6J A;  3MO4 A;  4RYD A;  1JYV A;  4XUO A;  1UMI A;  2VMD A;  3CZU A;  3IAQ A;  4UAP A;  2HLE A;  4JKM A;  4JKL A;  3I2J A;  3I3D A;  1JYN A;  3UNP A;  4M4R A;  1JZ4 A;  3LPF A;  1W0N A;  2PQS A;  2VZR A;  2YFZ A;  2YB7 A;  3J7H A;  1GNY A;  2W87 A;  4ET7 A;  3ACI A;  3OEB A;  2VCC A;  2E26 A;  2VJX A;  4Z2A A;  4XUR A;  2XON A;  1PX3 A;  1O8P A;  5G05 L;  2LS6 A;  4AAX A;  2J1S A;  3D3A A;  2QQN A;  3I2G A;  3C7E A;  4QB6 A;  2WO2 A;  3OEA A;  5DPN A;  4UOJ A;  3NNG A;  4MOA A;  2DCJ A;  1UMH A;  4KMQ A;  1W99 A;  3CIH A;  4DUW A;  5LA1 A;  5JXH A;  2W5F A;  2Y6G A;  3DYO A;  3FL7 A;  1NAE A;  4E8D A;  4BJ0 A;  4P08 A;  3WF1 A;  4OZO A;  3DEC A;  2J1A A;  2QQM A;  3VDB A;  2BGP A;  1DYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...