1Z7S3

The crystal structure of coxsackievirus a21
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
GLPTMNTPGSNQFLTSDDFQSPCALPNFDVTPPIHIPGEVKNMMELAEIDTLIPMNAVDGKVNTMEMYQIPLNDNLSKAPIFCLSLSPASDKRLSHTMLGEILNYYTHWTGSIRFTFLFCGSMMATGKLLLSYSPPGAKPPTNRKDAMLGTHIIWDLGLQSSCSMVAPWISNTVYRRCARDDFTEGGFITCFYQTRIVVPASTPTSMFMLGFVSACPDFSVRLLKDTPHISQSKLIGRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human COXSACKIEVIRUS A21
publication title The crystal structure of coxsackievirus a21 and its interaction with icam-1.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z7s300
4Q4W3 1RMU3 4QPGC 2HWB2 2RS51 5ABJB 1R092 3VBUB 1AL21 2WFF3 1RUI3 1W39A 2HWF2 1RUG3 1BMV1 4CEWC 3NAPA 3ZFGA 5L7OC 1AR62 1MEC2 3FBMA 3VBFB 1BEV2 3ZFEC 3JBG1 5C4WC 2X5IA 1AR82 1FMD1 4Q4Y3 4GB32 1FOD2 1AR91 4CDUA 2HWB1 3VBSB 4CDQB 1V9U3 1RHI2 1TME2 4IV3C 2GSYA 1NCQA 1VRH2 1PO23 1R091 2HWD3 1BBT2 2GH8A 3DPRA 2HWF1 5BNPA 3JD72 1AR61 1VBD2 1ZBE3 1RUC2 1MEC1 2HWE2 4WM7B 4RHV3 5A32B 1QJU3 4NWWA 4JGZC 2RR13 1BEV1 4Z92B 2PLV3 1FPN2 3ZXAC 5BNNC 1H8TC 1OOPC 2MEV2 2R043 4JGYB 1AR81 5CFCA 1VBC3 1NA1C 4N43A 1FOD1 1QJY3 1F8VA 4RR3C 1HQNA 1POV3 4Q4X2 4IV1A 1EAH3 1RHI1 1TME1 1ND2A 5C8CC 1VRH1 4QPGB 1AYM3 1NG0A 4Q4W2 1RMU2 1BBT1 1VB2A 4CDWA 3TN93 1RUD3 5K0UA 3IDEA 1VBD1 1K5MA 1RUC1 2HWE1 2WFF2 3VBHC 1OHFA 1RUI2 4CEWB 5L7OB 1PIV3 1FPN1 1EV13 3M8LA 1RUG2 2MEV1 4RQPA 4AEDC 3VDDC 2HWC3 5C4WB 1B35A 5BNOC 4Q4X1 2RS13 5C9AC 4QPIA 1PO13 4IV3B 4Q4W1 2VQ0A 1RMU1 4SBVA 5ACA3 1C8NA 1V9U2 3CJIC 1VAKA 1PO22 4GH4C 2WFF1 2DF7A 1NCRC 1RUI1 2RS33 1A6CA 4FTEA 5CFDA 1RUG1 1ND3C 1E57A 1ZBE2 3J8F3 5BNNB 4RHV2 1QJU2 1H8TB 1Z7S3 1OOPB 2RR12 1HRI3 2XBO3 4RS5C 2PLV2 4YVSA 1NA1B 1RVF3 4PDWA 1RUJ3 2R042 4RR3B 1CJDA 1VBC2 1QJY2 1X33A 5C8CB 1M06G 5JZGC 1V9U1 1EAH2 5J96B 4FTSA 1D4M3 5A33B 4NWVA 1PO21 1VBE3 1MQTC 1AYM2 3TN92 5FMOL 3VBHB 1RUD2 1ZBE1 4RHV1 1QJU1 3VBOC 1R1A3 4AEDB 2RR11 3VDDB 2PLV1 1PIV2 1VBB3 1EV12 2R073 2R041 2HWC2 5BNOB 1VBA3 5ABJA 5AC93 3VBUA 1VBC1 1QJY1 1R082 1HXS3 5C9AB 1POV1 1EAH1 2RS12 1ZBA3 1IHMA 3CJIB 1QJX3 3JB4C 1PO12 1AYM1 3VBFA 5ACA2 4FTBA 3TN91 4GH4B 2TBVA 1RUD1 4N53C 1AR73 4CEYA 1NCRB 2WZR3 1QJZA 1ND3B 2RS32 3VBSA 4CDQA 1PIV1 1EV11 2HWC1 4RS5B 3J8F2 2RM23 1R081 1PGL2 1Z7S2 2XBO2 1HRI2 3VBRC 4YVWC 2RS11 1RVF2 1RUJ2 2IZWA 2WS93 5JZGB 4WM7A 5A32A 4CDXC 1PO11 5ACA1 4WM8C 1MQTB 1QQP3 1D4M2 1CD3G 5FOJB 2RMU3 4JGYA 1VBE2 5D8AA 2RS31 1C8M3 3VBOB 4QPGA 2BFUL 3J8F1 4Y4YA 1PGL1 1Z7S1 1R1A2 2XBO1 1HRI1 3NAPC 3ZFGC 2WLPA 1AL0G 1VBB2 2R072 1DDLA 1RVF1 5LK7B 1RUJ1 1VBA2 2BPA2 5AC92 2XPJA 1POV0 1HXS2 3ZFFA 4Q4Y2 2X5IC 4CEWA 5L7OA 1D4M1 1ZBA2 4CDUC 3S6PA 1VBE1 3ZFEA 1QJX2 2HWD2 1NCQC 4N53B 1RUE3 1AR72 1FOD3 4GB33 3DPRC 2WZR2 5BNPC 4IV3A 1R1A1 1VBB1 2BBVA 1NY72 2R071 5J98B 1VBA1 5AC91 3VBRB 2RM22 4YVWB 1HXS1 4Q4Y1 2Y26A 5CFCC 3JD73 4N43C 4CDXB 1ZBA1 4JGZA 2WS92 4IV1C 2FZ2A 4WM8B 1ND2C 1QJX1 5BNNA 2HWD1 1OOPA 1PGW2 1F2NA 5DDJ3 1NA1A 1QQP2 1AR71 4RR3A 4CDWC 2RMU2 1COV3 1HRV3 2WZR1 5K0UC 1RUF3 5FMOS 1K5MC 2ZTNA 1NY71 1AUYA 1C8M2 2ZAHA 3NAPB 3ZFGB 1GFF2 1ASJ3 2RM21 4GMP3 4RQPC 3VBHA 1B35C 2X5IB 2WS91 4BCUA 2R063 4AEDA 4CDUB 3VDDA 3ZFFC 1PGW1 4QPIC 1AYN3 2BUKA 1QQP1 1NCQB 2RMU1 5BNOA 1RUH3 1TMF3 5C9AA 3DPRB 3JB8A 4CEYB 4FSJA 1RUE2 5BNPB 1C8M1 4Q4V3 3CJIA 5CFDC 1PVC3 4GMP0 4GH4A 2RS53 1NCRA 2FZ1A 5CFCB 4YVSC 1AL23 4N43B 4PDWC 1ND3A 4IV1B 1ND2B 4RS5A 1X36A 4CDWB 1VB4A 3JBG3 5DDJ2 1RUE1 5K0UB 4GB31 1COV2 1FMD3 1HRV2 1K5MB 5JZGA 1AR93 1NOVA 5D8AB 1RUF2 2HWB3 1MQTA 4RQPB 3LOBA 2BFUS 2ZZQA 1R093 1ASJ2 1B35B 5GKAC 5ABJC 3VBUC 3JD71 2HWF3 1WCDJ 3VBOA 3ZFFB 1AR63 1MEC3 4QPIB 2R062 1BEV3 5C4WA 5DDJ1 1AYN2 4Y5Z0 3VBFC 3ZFEB 1R083 1AR83 1HRV1 1COV1 1RUH2 1TMF2 4CEYC 1RUF1 1RHI3 4RFT0 1TME3 5CFDB 1OPOA 2QQPA 1VRH3 4Q4V2 3VBSC 4CDQC 1ASJ1 4GMP1 1PVC2 1SMVA 4N53A 1BBT3 4YVSB 2RS52 3HAGA 4PDWB 2WWSA 1VBD3 1RUC3 1AL22 2HWE3 4EJRA 2R061 1HX6A 1H8TA 1FPN3 4JGZB 4WM7C 1AYN1 2MEV3 1BMV2 1RUH1 1TMF1 3VBRA 4YVWA 4JGYC 4Q4X3 1RB8G 3JBG2 5C8CA 4LLFA 4CDXA 4Q4V1 1FMD2 5D8AC 5A33A 4WM8A 1AR92 1PVC1
chains in the Genus database with same CATH superfamily
4GULA 2JKBA 1RMU3 4OHVA 4KBZA 3AL6A 1CAVB 5FMCA 3ATGA 3IBMA 5EYXA 1OKQA 5HCBA 3I97A 4B29A 5C3OA 5FO9B 3RJRA 3DF0A 5FAXA 1R092 3VBUB 4YZ5A 1REFA 4MHRA 4NMIA 4BDVB 2VTXJ 1W9TA 1PNGA 3VHOA 2VTFA 1E5HA 2CSGA 1Q43A 1RUG3 2K0GA 5DAWA 5FJKA 5BPXA 5KXCA 1OA3A 1BVVA 3NAPA 5L7OC 1JODA 2XL7A 1AXZA 5A7NA 4XUOA 2WKKA 3VBFB 4RGGA 5C3RA 3JQXA 4DOUA 2VVEA 3HJRA 3WHTA 1UAIA 2UY9A 2W3JA 3ZSMA 2CDOA 2EXJA 4MGQA 2JG9B 1FMD1 4GB32 2IFWA 4LBQA 4ZZ5A 1MZFA 2WL1A 3N7KA 4UAPA 5JXIA 2YB7A 3VKFC 2YYOA 2HWB1 4FAHA 4CDQB 4UI9L 3VL8A 3BOWA 3H9AA 3ZSLA 2P5BA 1VRH2 4ITCA 4XMAA 1JBCA 4YG6A 3WF2A 5IVEA 4W6YA 2TEPA 2ADEA 5JOZA 1S1AA 4LK7A 3QH7A 5DUUA 3O1OA 1RIRA 2OUJA 4CCOA 2HWF1 4COVA 3OEAA 1S2BA 4NRMA 4UW5A 4XBNA 2JX9A 4HG6B 4AEJA 2KA3A 1MEC1 3J7LA 4RHV3 2EICA 5A32B 3WY6A 4QHOA 3N36A 4B8EA 2PLV3 3LEKA 1UPIA 4JRAA 4KGQA 4LA2A 4Z92B 3O1PA 5BNNC 2D93A 2QZ2A 1H8TC 3N9NA 2K9ZA 3USSA 2R043 3ACLA 3AVSA 2W87A 4YM3A 4CP1A 4QMAA 3J9SA 4N43A 1F8VA 3RZMA 1UMZA 4RR3C 4XF9A 3EHKA 4S2DA 2D6OX 4FT8A 5C5TA 1AX1A 2JG8C 1ND2A 5C8CC 2GMMA 4PF5A 4QPGB 4GD4A 4A7KA 2B7YA 3B69A 2QDNA 1AYM3 4Q4W2 1NXMA 3H0OA 3TN93 3DN7A 4E27A 2ZACA 1E5SA 3JZVA 3PLQA 3KCCA 1K5MA 1VALA 1Y7BA 3MV01 3OF1A 3UGGA 1SPPA 3M3CA 2OKXA 3ASIA 5A3MA 5FZCA 3IM0A 2F17A 3H8XA 4AEDC 2WNUC 3AMNA 2VPVA 2O14A 3VZNA 2VAUA 5FPXA 5C4WB 4AQ2A 2HJIA 5KR7A 4BQ2A 3PMEA 2A1XA 4YSFA 5A6XA 5EV7A 3IDCB 4UBHA 4BM8A 1GR3A 1UMIA 1YC61 2I2SA 2VBBA 4I3GA 4I2OA 3HNMA 1CWPA 1XB9A 2DU0A 1NE6A 2JDNA 4IQPA 4QPIA 4XFHA 1PO13 2VQ0A 1RMU1 4UW4A 5FWEA 5ACA3 3THDA 5GZEA 4LMFA 2GU9A 1JZ8A 3ES1A 3K4AA 4Q0SA 1UZWA 2HH9A 2ZHMA 2FDJA 3IAPA 5A1AA 4FPHA 2P4EA 1YEWA 1O59A 1ZRRA 1SBEA 2LROA 3HN1A 1NT0A 4MGSA 4XPVA 3BODA 5FYCA 4ASMB 1H30A 1O8SA 1AXYA 1RUG1 3O1MA 2VMHA 2VZ1A 3O14A 3ETQA 3NW4A 4Q29A 4CPBA 4Q0UA 2XBO3 4DXRA 3U0ZA 4RS5C 4FBFA 3Q8BA 4HKLA 4UFHA 1W8HA 1RVF3 4EN0A 4HVQA 2EAKA 3ACFA 1LOCA 4YNIA 4E4HA 3J7MA 4K9SA 3PHMA 1ENRA 4XHXA 3WVJA 4EN8B 2WNEA 1U5ZA 3GZUC 1MZ5A 1GOGA 3CU7A 1W6QA 4QXKA 1YI9A 4CVUA 3LSEA 3MPBA 2GDFA 1MQTC 4YW3A 3LF7A 4GXLA 5F5CA 5FZ3A 3GZEA 3Q8EA 5JVVA 5FYIA 3ORJA 3OGVA 2DVAA 3W5MA 3N7JA 4FTEA 2ZPXA 2IXIA 1RUD2 1IS6A 3LWCA 4XHBA 4LOTA 4I01A 1GZWA 5BV6A 4RHV1 5AVAA 4I0BA 3VBOC 4XFFA 3SKVA 4FOYA 2TNFA 2YGMA 4RN5A 2PLV1 2E53A 3U07A 4FP3A 1EV12 2IXJA 1XU1A 3J26N 4NPMA 4OI1A 3VV1A 2R041 1VBA3 3M3OA 5ABJA 3GGLA 1UZVA 5FZMA 1R082 3MLKA 1CIYA 1IQAA 1JHNA 3DXTA 1OBNA 3UL2A 3V64A 3ZXDA 2BRTA 2DCJA 4TN7A 4UW3A 5FYBA 2BQPA 5ANQA 4XABA 5FP9A 1W9SA 4W4ZA 4E8CA 2BJSA 1JZ3A 2A6XA 2OPKA 3AP7A 4FPOB 3HWJA 2G9ZA 1FNZA 1LHOA 1MS3A 4X8NA 1TZOA 1AYM1 1D0GA 3H8OA 3MDPA 3TN91 2OT7A 3D5OA 3I59B 5LY1A 3LIGA 5IT6A 3FZ3A 4BIOA 2R1DA 3RFRA 1GZTA 2E7TA 1QIQA 2W1SA 4LBQD 5FUNA 3WR0A 1U12A 2A5ZA 1LNSA 1WCKA 1ND3B 3G6JB 1I9RA 3Q9OA 4FQZA 4YW7A 3ZPYA 1YQ6A 4JAAA 1C57A 2JB8A 4P5YA 5FQ0A 2Q8OA 5KHIA 5LATA 4UWDA 2WO7A 4LO4B 2YY1A 2Y6HA 5JOYA 4TXWA 4UW6A 4XAAA 4PF1A 2CY6A 2FQPA 1LEDA 4IE7A 1BYHA 4HL0A 3BYWA 3VBRC 4YVWC 5AVPA 5JUVA 3I2KA 4PLOA 2IZWA 2WS93 2WR9A 4GWNA 4LJHA 1KDKA 4GJZA 4Y26A 5JZGB 3WXPA 3RZGA 1TEIA 1PO11 4EN9B 3NV4A 3M3IA 5ACA1 4L8QA 5FMDA 4M0NA 1W9WA 4LIVA 1QQP3 4FO9A 3VD7A 5FOJB 5F2SA 5JMCA 2G9GA 1H0BA 4NAMA 2W08A 5JOXA 4NOTA 2PA7A 3WDXA 5JR2A 3ZN6A 2BEOA 2R30A 3LFIA 2UURA 2ARCA 3ILRA 4XE9A 3T0AA 1WLWA 4CP9B 3WW3A 1UU4A 1RUNA 1H2MA 5A6QA 4IEQA 2BFUL 3MEPA 5GALA 4JDMA 1LHVA 2ZA9A 4H3WA 1LOGA 1PGL1 4ZXKA 1AX2A 2QDRA 2XBO1 2WLPA 4CUAA 1AL0G 4CCNA 2XB6C 1YYNA 2CGOA 4H7LA 2R072 1V6MA 1DDLA 1RVF1 5LK7B 4KMQA 2YV8A 3WCRA 1X9TA 3KQRA 2X5IC 4XF4A 4D3WA 4CU6A 1WBFA 2FDFA 3MW4A 2HEYF 2D3RA 4E4SA 5L7OA 5A3WA 4AVSA 2W94A 5FPAA 2JICA 1ZBA2 3A7QA 3LDRA 2WQZC 3T08A 3HBKA 4BQ3A 1Z0HA 1LENA 2QUOA 4KNCA 3AMPA 4XQDA 5C71A 2WAAA 1QJX2 2D6MA 1BHGA 1NCQC 1PK6B 2VJXA 1PZ8A 2V5YA 4FVVA 4N53B 4ZS2A 5IJRA 5IATA 4PIXA 1JYWA 1NZIA 3NV2A 1HV0A 2FHRA 4GB33 3S30A 3ZO0B 4LT5A 2JDUA 1HB1A 1UL9A 2VMIA 3L9JT 4Y20A 5FLIA 4CU8A 1R64A 1VE0A 2VOWA 3HQUA 4K20A 3HT2A 1W8WA 1ZM1A 1CESA 2ERFA 2VC9A 1D2SA 5FK7A 5H9PA 2GZWA 5J98B 3OOXA 1VBA1 4BXFA 3ZXEA 5FDBA 3SISA 2VVDA 1LU1A 2O1QA 3PUSA 1S0EA 2A3XA 4Q27A 4ATEA 3KT1A 2ZX4A 3B01A 3I4IA 2CU5A 2FDGA 3MIBA 4XCAA 3POBA 4YM2A 4WM8B 5F8PA 5BNNA 4IXLA 2HWD1 2UWAA 3POYA 1KDMA 3ZSJA 2QQKA 3H1MA 3B9CA 4P9LA 3RI8A 5FLJA 3ZIXA 4CCMA 3J7HA 4E4DX 3S5AA 3KV4A 3VDAA 2HKXA 1G8WA 4TWTA 4RR3A 3H7JA 4EZHA 3GCXA 4P9JA 1D4VB 5J1XA 1XNCA 1ULEA 1OUXA 2JG8A 4IEXA 2AREA 5IHRA 1SFYA 2BNNA 3T1LA 4GKYA 4FPFA 1CPNA 1W3VA 2WN3A 1QEXA 3DYPA 3I3EA 1NQJA 5IFTA 1NY71 1AUYA 4O7XA 4OQ8A 1C8M2 1YJLA 3NAPB 4Y4RA 4RD7A 3R0RA 1ASJ3 4GMP3 4XDQA 2P2KA 4RQPC 1HQWA 1V6OA 3K75B 3OGGA 5I0RA 4LLOA 2IXKA 2WC2A 1OLME 4WZCA 4AQ6A 1YQCA 1UU5A 2YG0A 1FYUA 2WS91 3NWKA 1HN0A 2VW2A 1A3KA 1LESA 3ELNA 3IWZA 4LBQB 2ZX0A 3FJSA 4PJYA 1QU0A 4AEDA 5F9TA 2WNUA 2LUWA 1RJ7A 5K7PA 2B4KA 1AYN3 3ZYHA 1QQP1 3TB0A 4OMDA 5JXJA 2ES3A 4MVTA 1ZZBA 5T5LA 1N3PA 1TVGA 1HJGA 4BQWA 1TG7A 1ST8A 2AENA 5FZHA 3JB8A 4FSJA 4YFWA 3FHQA 3KVAA 5LB6A 3P5BA 2WFPA 2ORZA 2XJQA 1PVC3 1ULPA 3E6DA 1WLTA 2EIGA 2R7EB 1D2QA 2WT2A 1OH4A 3OTFA 1J3RA 4HK9A 4G9SB 2OYZA 4A45A 5ISLA 4N43B 4LBOA 2CAUA 2B8MA 2WINB 1L7LA 4MGIE 1ND2B 1DQ2A 2ZCWA 4QX8A 4ZXEA 3LOIA 4HPKA 2P6HA 4YRDA 1Y9MA 1GWMA 4LO8A 4JCKA 4RS5A 1SDWA 1O4ZA 1X36A 1KFXL 3SEPA 4YWAA 2GN7A 5IAVA 3HQXA 1VB4A 4HT1T 1UCXA 4E8DA 1JOBA 3POFA 4GB31 2R0HA 2Z4FA 1G9BA 1COV2 1HRV2 1K5MB 3E5XA 2X09A 5FZ8A 1QXJA 2WAOA 3FC0A 3A0NA 1SPPB 5L9BA 4AI1A 1NE4A 1RUF2 1OPMA 2A6WA 5FZ1A 1MQTA 3W20A 3EXUA 1AX0A 4Q0PA 1N1SA 2GMEA 3OB8A 4LBNA 2JIJA 4AHXA 1TQ5A 2VL4A 1T6GC 5GKAC 3AB0A 3WNKA 4XTPA 4PLMA 4Y24A 4RL7A 5FPUA 2EIEA 5FK8A 3VBOA 1YIPA 3VKLA 4F8AA 2EALA 4QPIB 2HEWF 4A44A 1Q3EA 2VU9A 1QHDA 1N1TA 1REDA 1NAEA 3BOPA 3I2HA 5C4WA 4AW7A 4XUQA 2PMWB 3PU8A 4A6SA 1ZRCA 2BYVE 1VMHA 1BVP1 1OKOA 1R083 2VVFA 2E31A 3JU9A 4LHKA 1TMF2 3POWA 5FO8B 5JMOA 5DPNA 4ZONA 2A71A 1EP0A 4KH9A 1JYTA 1RHI3 5B4NA 3PJYA 1UN1A 3T0BA 4A3XA 3CF6E 4UFKA 3VBSC 1GOFA 1ASJ1 4GMP1 1LOEA 4P9GA 3AK0A 1SMVA 1STMA 2ZS6B 1BBT3 3CHXA 4Q8LA 1PMJX 3I2JA 2RS52 2PN5A 1IS5A 4DY3A 5JPNB 1N1VA 4HN1A 1UYPA 2BBAA 3N35A 2N7GA 4HSJA 2CGPA 2PHUA 1RUC3 3N9MA 2HWE3 3T4HB 4R4ZA 3BTAA 4TLFA 3OYWA 1HX6A 2YZ4A 3ZVXA 4NAOA 5T52A 2YC0A 2XUMA 4P02B 3ILFA 1AYN1 4LKEA 4WM7C 1W6QB 2MEV3 3MIGA 2V4VA 4JV4A 4QKBA 2ZX1A 4AG4A 3VBRA 4YVWA 4QHBA 5CVRA 1SHWB 1XU2A 2D98A 4JGYC 1MZ6A 3CZJA 4LULA 4MH0E 4BIFA 2R16A 4S2FA 5H9QA 2D6PA 5KXEA 3JBG2 4JHTA 5LA0A 4Q5OA 1YQ5A 2OZ6A 1V6NA 1VAVA 5FCCA 3ZN5A 4YW5A 1GZWB 4CA9A 3NJXA 3CZUA 1T2XA 1AR92 5LK5A 1PVC1 4AHWA 1S0DA 1LECA 5IWFA 5IVVA 2C5DA 1VAMA 4EWAA 2Y6JA 1T6BX 3UYJA 1QOOA 3KMHA 4GWMA 4RSUA 5ABJB 2V5DA 2F6BA 1MVEA 2KD7A 2WFF3 4YG3A 2XDVA 5FY8A 4QGLA 3T4VA 2XHKA 4HFSA 3WG3A 4ARXA 4JQRA 1RUI3 4LUMA 5BXXA 2ATFA 3FHIB 5M0TA 4CZSA 2R0FA 5FZ9A 1BMV1 1AR62 5IUQA 4QQHA 1ULCA 4LO7A 4B3NA 4LE4A 4LTAA 3GHMA 1BEV2 4DRRA 5FZKA 1GQGA 5IYYA 2D3PA 4QKNA 2Q5TA 2VOTA 3CJXA 1ENSA 3HD8B 2QTWB 3R05A 2X5IA 3K48A 5CKMA 1AR82 3CEWA 3VKOA 2JE7A 4JDOA 3TAYA 3ZYGA 4H14A 3V0BA 4N9HA 5DG1A 2OX0A 3IPVA 5APAA 4A2UA 4DNYA 1G9AA 1RUOA 2PHTA 1OLQA 5FZDA 1V9U3 2JXAA 5FQ0B 5BNNB 1TME2 5CG9A 1W05A 2XONA 2WNVC 3AMQA 3NVCA 1NCQA 2E26A 4IV3C 5FZFA 1YFYA 4C91A 2XJPA 3LIHA 3ZYPA 1S4CA 4WBBA 4XTMA 4ZU4A 5C5UA 1DQ5A 1Y4WA 3FUQA 3OGJA 2DBIA 2CL2A 2WUHA 4DO0A 2W92A 1LKNA 3ES4A 4QX1A 4CCJA 2ZGQA 2HLEA 3QOPA 5EHDA 3NJYA 1VBD2 1CONA 3UESA 1F35A 5FBZA 2VMEA 4LE3A 1QJU3 4NWWA 2VZ3A 2XOMA 3KHCA 4M01A 5JIAA 3CDZB 1FPN2 3VZJA 1OOPC 4XJ9A 4XZUG 5FREA 4AAPA 3KB5A 1VBC3 1NA1C 4I0AA 1FOD1 1VPHA 1H8VA 1KITA 1K5JA 2DUPA 3WP4A 4QDQA 5EPAA 5DXDA 3ZN6B 1S0IA 4ZPIA 1HQNA 4Q4X2 4EYUA 1FATA 1EAH3 1RHI1 4NIDA 2VTXA 3VZKA 5A6ZA 1V6IA 3MLJA 2DCKA 1A8MA 3GDBA 2JE9A 2OQ6A 2Z2SB 3CMGA 4BK4A 3KF3A 5FV3A 4K8RB 1BBT1 3U10A 2F4PA 1HDKA 1RXGA 1F4HA 4O65A 2GP3A 2BW8A 1UD1A 3KT7A 2GC1A 2C9AA 2WYFA 1PZ7A 2OUHA 5K0UA 4AFAA 2PTMA 3IDEA 4OQ9A 2P3KA 4NROA 1RUC1 5CU1A 2HWE1 4DQAA 4UFJA 1OHFA 1GWLA 2J1TA 4LA3A 5GLUA 1SFPA 3LDBA 4Q26A 3R6SA 3BKZA 1QJEA 5L7OB 2ZZJA 1W0NA 4N90A 3M8LA 2MEV1 4RQPA 4FXKB 2HWC3 3VDDC 1JW6A 3KWVA 3WSOA 1DGLA 2Y34A 2BP6A 1PZ9A 4COWA 2E33A 4AAXA 1SFNA 1AVBA 1ODMA 4XXAA 3WG4A 2VZQA 5C9AC 2VBDA 5LY2A 5CYYA 4E2SA 1GNHA 4Y20B 2RJKA 2QBXA 4BU2A 3RYKA 2IXLA 3MV11 3VKNA 2UY8A 5G04L 4NRQA 1OVSA 2IVJA 1GU3A 1W2UA 1LGCA 1O91A 1C8NA 1F31A 3AYEA 4SBVA 3NKTA 3CJIC 1LHWA 4PIZA 4XBQA 1JOPA 2AEYA 4UBGA 4YLZA 1CVNA 1CR7A 2ZHLA 1VP6A 1VAKA 2UWCA 3NSTA 3W9AA 1PO22 2VNVA 1WW5A 2WFF1 4CXWA 4I30A 4A7ZA 1NCRC 1RUI1 2DVBA 1OUSA 4PIYA 4R4XA 2RS33 4LKDA 3QCWA 4JRLA 1A6CA 1JUIA 3ZYIB 5T50A 1ZBE2 3J8F3 4LUKA 2XVKA 2QFEA 2Z5WA 3IDBB 4FFFA 1H8TB 4JDNA 5CNAA 1N3OA 3WDYA 4C8DA 2RR12 1HRI3 1VJ2A 2OZJA 1UXXX 2PHDA 1AZDA 4UXAA 2X05A 4NVPA 1YFUA 4FAGA 3LEGA 3VKMA 1RUJ3 3ACGA 4RR3B 1JYNA 4LITA 3I2OA 5FZ4A 3DYOA 1QJY2 5GLTA 2JG8B 1X33A 5C8CB 1RITA 3WEZA 2DCYA 3DL3A 2VBPA 1V9U1 1H6XA 4I3PA 5T54A 4PT6A 3WF0A 1D4M3 4HXCA 3ZDVA 5A33B 4META 2PFWA 5KXBA 4HANA 3VDCA 1QOTA 2B42B 1MACA 1JU4A 4L2NA 3ZXKA 4XQWA 4CCKA 1VR3A 3H42B 1ULDA 1OA2A 2A3YA 5IK5A 3H50A 2YPJA 1HIXA 1AJOA 1CAXA 2NYYA 1QJU1 3K51A 4AEDB 4LKSA 4A41A 2WNUB 1YJKA 2Y64A 2BU9A 1QDOA 2VXJA 2CV6A 1PIV2 1W2OA 4QGNA 2AUYA 2DUQA 4XILA 3NJZA 4INDA 5HCFA 1DYKA 4YFZA 3F2ZA 5AC93 3S0MA 1VBC1 3QBQA 2QQUA 4GWJA 1OQDA 4MO3M 3O1UA 3NV3A 2VW1A 2XVLA 5F5AA 4C1WA 1EAH1 2RS12 1HN1A 3GYDA 5A7SA 3BTZA 1TE1B 3O1TA 5ANNA 1JOJA 2EXIA 3OD0A 5DMYA 4H7MA 5FY5A 3JB4C 1JZ5A 2E6VA 4XJUA 3WP6A 3K4DA 4CU9A 4FTBA 1Q8QA 2ARXA 2TBVA 4GZ9A 4M4PA 3LA2A 3D0JA 3WDUA 3POJA 4CE8A 2RVAA 3OPTA 4NPLA 1W99A 5A3LA 4AL9A 1WWYA 4YM1A 1UY3A 4Z1VA 3M2MA 1XNKA 2FMDA 4JX0A 3VBSA 4DUVA 3ILNA 3B00A 1O7FA 2Y60A 4HPKB 3SHRA 2HWC1 1S0JA 4RS5B 3ACHA 3EMRA 4G4FA 4OZXA 1Z7S2 1PVXA 2GC3A 3MUZ1 1QMJA 5GZFA 1UIJA 3AZWA 3LA7A 5E1RA 4AVAA 2ENRA 2EIBA 2GN3A 2IWGB 3ZLIA 4D6SA 1JHJA 1SCRA 2A6YA 3T0DA 5CB7A 4R9AA 4WM7A 4DUWA 3AM2A 4CDXC 1NLQA 1QH6A 5F3CA 4DXTA 2LS6A 1CZTA 2PAEA 3MBWA 5FKCA 3WDTA 1MQTB 1LODA 3CQOA 4AFCA 4AEMA 3ZDSA 1CD3G 4Z8BA 3C7FA 2RMU3 4JGYA 4FPYA 1ZZ7A 1VBE2 4I02A 2VZVA 4IGQA 5DAQA 3N7MA 3CL1A 5KC5A 2VCMA 1HJFA 1SZBA 4BQYA 1PHMA 2RS31 4FPEA 3QH6A 4PI0A 5G05L 4DINB 3VBOB 2WJSA 2CNAA 3WDWA 4COUA 4A3ZA 5A6YA 3J8F1 2UYAA 1R1A2 1HRI1 3ZFGC 1BK1A 4Q0QA 1VBB2 4XC9A 3DXUA 4AGVA 4J25A 1RUJ1 1BJQA 4MYEA 2NM1A 3NQHA 1POV0 5FYTA 1WGPA 3FE5A 3WZ1A 1HXS2 4JHZA 4Q4Y2 1K45A 2ETEA 4AOCA 4P08A 2VUCA 4KU8A 4YGCA 2QQOA 1E5RA 1D4M1 4CDUC 2JDHA 2J1SA 4FFHA 2H0BA 3S6PA 5IVBA 1J58A 2O8OA 3WDVA 1TNFA 3APBA 1NZCA 3HN3A 5F2WA 4NHYA 1ODNA 3VN4A 1CIWA 2VZOA 1QH7A 1Q5OA 1V6KA 1AR72 3Q8CA 4G3YC 2K46A 4OYUA 1IKPA 1EYBA 2XJVA 2WZR2 5BNPC 5AFBA 5EYYA 3OYWB 2WNVA 4IV3A 2OA2A 5H9SA 2ZGLA 4YPJA 5FYHA 2BBVA 4L0PA 3GXUA 2J1UA 3ZM8A 2Z79A 2DFBA 5C3PA 5AC91 3VBRB 2RM22 4YVWB 1IS3A 3SITA 1O3RA 4XQ4A 2WO2A 5FZIA 2YFUA 5A3NA 4OI4A 4NHMA 3KQ4B 1WLCA 4HSLA 4JC1A 3IKWA 2QQWA 3I8TA 4OHZA 3AYDA 5J3UA 2XJUA 3AP6A 2TUNA 2EAAA 4Y22A 3OY8A 2ZABA 5K4LA 4XZPA 2WT1A 4BHPA 4BPZA 2FZ2A 5T5OA 5L36A 1W6MA 1OOPA 3I3DA 3K2OA 1G6NA 1AXKA 1SACA 2MNGA 2VULA 3OCPA 3OUJA 4AZZA 2DVFA 1NA1A 2C4XA 1EY2A 3GJBA 1H2KA 3PVOA 3TEXA 5FR3A 4CDWC 2WLQA 3L2YA 3PJQA 3OBAA 2A75A 4CCLA 2C0ZA 3NNLA 1YO8A 3AZZA 4LHSA 3NNMA 5L9RA 4D7TA 4LORA 2BTVC 3MF6A 3TRSB 4AI0A 1GFF2 4ONUA 5JIUA 5JSOA 1J3QA 3OD4A 3HNYM 3HPNA 5IVJA 1OF4A 3ETPA 4AVCA 4NHXA 1RC6A 1B35C 2ZHNA 3THPA 4PBOA 2E7AA 3V65A 2X5IB 3WNPA 1V70A 4BCUA 4GWIA 3A0KA 3V0BB 1S0FA 4Y33A 4JTOA 3IPVB 3VDDA 3ZFFC 3B93A 1PGW1 1OFNA 2BGPA 3KM5A 2Y8KA 3AC0A 4BOWA 2VUAA 5HXMA 2BUKA 1J3PA 2HBTA 4XACA 1NCQB 2Q8EA 1LGNA 4UYBA 2RMU1 4I0WB 2DV9A 4UOJA 4IW3A 1LOBA 1F4AA 2BWAA 5C9AA 5I91A 1DQ4A 2J1AA 4IE5A 1UZYA 4CEYB 1DQ6A 1JZ7A 1RUE2 5A3UA 2XGXA 1W8OA 3I3BA 1DCSA 4XYXA 1NLSA 2YC2A 1J83A 4FXGB 2YC4A 1LRHA 1YLLA 3CJIA 3MZHA 1DGWA 1WLDA 2YMZA 3O1SA 5J7MA 1Q8VA 4KQ7A 3CKHA 5FYVA 5IK4A 5CA6A 4M3CE 3H8RA 1UKGA 5LRSA 4QM8A 1NCRA 4HBNA 4NUBA 2EXKA 4YVSC 5HI0A 1AL23 5I8SA 2IFRA 3DYMA 3N7LA 4XIOA 1UZ0A 1KXGA 4HETA 2ZGUA 5FRAA 4ZZ8A 2R32A 2AEZA 4W50A 3BPZA 4GA9A 1QJFA 3ZSKA 1ENXA 4KL1A 4X8PA 2P3IA 2ZGMA 3J7NA 5GLWA 2NZ9A 5C3SA 3GZAA 3JUUA 3FFQA 1JMUB 2VOXA 2CWMA 2ARBA 4BQ5A 5FLHA 2PYTA 4LHLA 2ZAAA 5DDJ2 2NN8A 1NUKA 4XJ8A 2ET1A 4CEWB 5K0UB 1UY2A 2CWSA 4BMBA 2QQVA 5E16A 1FT9A 2W0XA 4QX5A 5DAVA 2VGDA 5D8AB 1KRIA 3AXEA 3W21A 3FHAA 1D7PM 2K2SA 5A70A 4OI0A 1W8NA 4RQPB 1UYZA 3LOBA 1R093 2WSVA 2Q1ZB 1GUIA 3MICA 5KWRA 4NR1A 5FOBB 3DUIA 2A6VA 5FXWA 4D94A 3SCHA 1WCDJ 4CXXA 1VRBA 1MZEA 1FAYA 1DBNA 2RG4A 2VOKA 5F3IA 3O1VA 2R062 2ILMA 1KJRA 2Q30A 5DZFA 3WQ0A 1WMDA 4IEPA 1K12A 5CKQA 3ZYFA 1I5ZA 1V6JA 4FP2A 1OURA 4N7IA 1RUH2 2MPFA 3ZXFA 4EZ4A 2CAVA 1C3HA 3KS7A 4LBJA 4L99A 5I0UA 3UV9A 4CEYC 1PMHX 4AE2A 4L92A 4MGYE 4XETA 4IEUA 5FJHA 3BTXA 1OPOA 1VRH3 3C7OA 4Q4V2 1TNRA 1QOSA 4P9IA 4QT6A 1LCLA 2WA3A 2E7QA 1AHSA 1JS9A 4Y1YA 4QXBA 4S2GA 1UY0A 3NRUA 3AYAA 2JKXA 4PQ9A 2D43A 2WWSA 5FZ6A 2GNMA 2VD7A 3ON7A 4NIAA 5FP4A 1FXZA 4HZFA 5CEHA 1XBFA 4QDSA 5E8AA 2PHFA 1H8TA 5FUIA 3KCXA 1O4TA 1W2AX 4XFBA 2YHJA 2HEVF 2VMDA 2DVGA 1E5IA 2JDMA 4Q0VA 2YBKA 1DGWX 3WOGA 4DIQA 4MADA 4AYUA 1A78A 5FY1A 1RB8G 5C8CA 4WVZA 3BTYA 4AI8A 4CDXA 4P00B 4FPKA 3TEYA 2AGSA 3OUIA 1FMD2 5D8AC 1CAXB 5A33A 5EZWA 3U14A 3N9PA 1IPKA 1IS4A 1JZ6A 4Q4W3 2YROA 3URFA 3MW2A 3R4DB 3T09A 2XLAA 2HWB2 4C1XA 3HEIA 2LALA 4NIIA 1SLCA 4OI2A 4DEQA 1CQ9A 1KS4A 4O9EA 3RRDA 1AL21 1U5XA 2VZSA 4AK3A 3WP3A 1XNBA 2IUWA 4ASLA 1ULFA 1GBGA 2HWF2 3SC7X 2VNGA 1W9FA 4IL7A 4JTNA 3MI8A 2ZOEB 4QD2A 4CEWC 5K9YA 1Y9GA 2Y6FA 3ZFGA 1LOFC 3EO6A 2VECA 1MEC2 3HT1A 1IQDC 2JD9A 2WBKA 1PX3A 4ES8A 3ZN4A 4BQ1A 1G9CA 5HPOA 1QNYA 3WNXA 4A4AA 4Q4Y3 1GNYA 1GZ9A 4YW4A 3ZYJB 1C1LA 2FBEA 4FFGA 2VZUA 3BI3A 4CDUA 3I3MA 2W1UA 4LPLA 5A80A 3VBSB 5T5JA 4C0HA 1ACCA 3K3NA 4QXCA 4CUGA 5KBFA 2GAUA 4ZU5A 5KHGA 4AR2A 1NXD1 2KR2A 2JENA 5HBAA 3O7OA 1R091 1JN2P 5LEKA 3AFKA 2MHFA 3WQ1A 3ACIA 1LHUA 4UFLA 1Y9QA 1J1LA 5IVFA 2ET7A 2VNRA 2GH8A 4WV8A 5HV0A 3RGBA 1KS5A 5BNPA 2XXZA 3JD72 5SV8A 1ENQA 5FWJA 4XXPA 4WM7B 3KLSA 2OVUA 4AGRA 2AR6A 3INAA 4QX0A 1JZ2A 4PQQA 1X8EA 2FDHA 3BPSA 1U0AA 5FP7A 4A7YA 4LO6B 5HCHA 2GNBA 3N9OA 4JGYB 5IW0A 1HW5A 3ZMOA 1UOJA 5KHKA 1JYIA 3PNAA 4CUBA 5DUVA 2BVVA 3ZOIA 5DABA 1A34A 3OEBA 4Y1ZA 1DHKB 1POV3 5LCWL 3N4MA 1QWRA 1F9KA 5A7QA 1YXWA 2SBAA 1DQ1A 2Z42A 3RMYA 3UKTA 1VRH1 1X7NA 1UMHA 3PUIA 2PQQA 4XURA 2VQTA 4B7KA 1IGOA 1NG0A 3WNNA 3DKQA 4V2WA 1RMU2 1VB2A 1S0GA 1OC1A 4CDWA 5K8SA 1RUD3 2W52A 3KV6A 4XFCA 2RDNA 5LEJA 2BERA 1ULGA 1EUUA 2RDRA 3VBHC 2V73A 3FL7A 3UNPA 3MYXA 2XH6A 3P3PA 2LM3A 2YUEA 1Z78A 4PLNA 4J1WA 1C5IA 1EV13 4QHZA 4J6GA 1RUG2 3NKGA 2DU1A 1UNBA 1VMJA 2XWJB 3KV5A 3WLUA 3BUCA 3NNFA 1SBDA 1WW4A 2VH9A 3OBRA 1O6UA 4BB3A 1B35A 1XQNA 3BCWA 2V72A 4MXWA 3PDQA 3DECA 4K1ZA 4P9WA 3W59A 5BNOC 3NNGA 5IK7A 1X8MA 5FZBA 1U5IA 3LE0A 3VD3A 4Z2AA 5B4XA 1DLCA 3VD4A 1GLHA 3UT0A 4IV3B 2WNVB 4Q4W1 2Q0AA 2P17A 5JI9A 3KZ4C 1CAWA 2PELA 2VY0A 3CBNA 2FCTA 5T3NA 1WD3A 3RWNA 3GCWA 2XQRA 2J7MA 4N9IA 1DYOA 4GH4C 5FY0A 5BNQA 5KXDA 4NPRA 3KD4A 1OLMA 1DU3D 2L9LA 3AZVA 3C7EA 4CUCA 5JXGA 4BISA 2AACA 2ZGOA 2WWUA 1LTEA 2PHWA 4EWDA 1U5YA 2D97A 3AKTA 1E57A 4Y22B 3ROUA 3ZXJA 2X29A 3OY8B 5JR7B 2YXSA 5FMBA 5GLVA 1W04A 4RHV2 3WF4A 1XC6A 1W6MB 1OOPB 1WD4A 3AKRA 3CLPA 5A7WA 3WX5A 2PLV2 1UPSA 4YVSA 1NA1B 1J84A 2GNTA 2RJLA 4XDPA 1C4RA 3H1WA 1O5LA 2R042 5EWSA 1DZQA 3BB6A 1CJDA 4QQLA 4V2VA 5CZKA 1W03A 3P6BA 1H1MA 3PUQA 5AFEA 2DUOA 1URXA 3PIJA 5T55A 1JYCA 2QE3A 5J96B 2WN2A 3LD8A 5KHJA 4QQ2A 4YW1A 5FBJA 2OXBA 5F1RA 2CYFA 3A21A 1AYM2 3SLIA 3AP4A 3LPFA 1YWKA 5LBCA 3TN92 1R1ZA 2NP0A 2RDQA 3WF1A 3BN6A 1DGRA 1GZCA 2DYCA 5LZ6A 1ZNPA 1F5FA 1UW8A 3AMHA 5K0UC 4EQVA 1SG3A 5I8TA 2J42A 4ZKTB 2Y6GA 3VDDB 4EV0A 5CISA 3AFGA 4PBPA 4H55A 1WW7A 1ZRDA 1OA4A 2R073 3EBRA 4IEVA 2WO3A 3IT8A 4FI9A 5CG8A 1DIWA 4XFIA 2VXRA 4ET7A 4XMIA 5C9AB 2YBPA 5GJ6A 5JXHA 2W1QA 4LQRA 1DZTA 1POV1 3AZYA 5I0SA 4M4RA 2UYBA 2D40A 2VZTA 4Z2WA 1ZBA3 4QPWA 3SCGA 1IHMA 2GC0A 2GC2A 2XWBB 2QKDA 4NHLA 3PVNA 3CJIB 3SH3A 1QJX3 3DGTA 5FPBA 3GBGA 2XQXA 5JAXA 1PO12 3HBZA 3SMHA 4OHXA 4O9GA 5ACA2 1ALYA 2VQUA 4BJ0A 3WNOA 3FLPA 3HVDA 2NLRA 1BLZA 1DGRN 1LU2A 1RUD1 4RGKA 3P3NA 1NCRB 4OCTA 3E97A 1CAUB 3WW1A 4NE9A 4CEYA 1BKZA 2OS2A 1JUHA 4DRVA 2DBNA 2WIIB 2ZGRA 1SQ4A 3T2PA 3TBDA 3C7HA 4WVMA 3OBZA 3MHZA 4EWEA 1HV1A 1EV11 2A70A 3R4SA 4IUGA 4L11A 5EP9A 4NIGA 5C7GA 3LQCA 1RINA 1HB3A 4QWNA 3RI9A 3JCIA 4L9BA 1R081 3RPQA 1PGL2 4QGMA 3H3LA 2XBO2 4LIUA 3THCA 3KCYA 1G86A 2LRPA 4GIQA 4HN0A 1RVF2 4HOOA 4IGPA 2XL9A 4XUPA 3MO4A 1LR5A 4IEYA 3EYPA 3MF9A 1DYPA 2ZGNA 5I0DA 2KXLA 4OULA 5DAXA 1KEXA 3WP5A 3ZKYA 4JQTA 2W46A 5F6KA 1O5UA 1MR5A 4Y1UA 2VOVA 4FOQA 5FZOA 3AP5A 4Q1PA 4KI5M 1CJPA 4YG0A 2QJVA 3GALA 1F5JA 5LA9A 4QU1A 1CX4A 1XYNA 4IGOA 5J36A 1S0CA 5D8AA 5FIXA 1ZZ6A 3CIHA 1C8M3 1H6YA 4AI2A 4KG0A 1IOAA 1HKDA 3FLTA 1GQHA 4Y4YA 3Q8FA 4BA6A 1UU6A 2VZRA 4QX2A 2AH2A 1W6OA 1V6LA 2E51A 1N47A 5EQUA 1XNDA 3B3QE 1WCSA 3PUAA 1REEA 2RDSA 1VBA2 1XSRA 3HMYA 1OMIA 2WZPP 1LHNA 1W06A 3AJYA 3ME2A 5GZDA 3U11A 4LEJA 4CEWA 3WG1A 1LOFA 3LZZA 4B4RA 1XNAA 4UF0A 3D3AA 3WUDA 2EIDA 4TYSA 5GLZA 2Q1FA 2JDZA 2JWPA 1PX4A 1HQLA 3SNMA 4CCDA 4KU7A 2XLGA 2HWD2 4TLGA 1OH3A 1VIWB 4XVHA 4OFGA 2FCVA 3H8UA 3ABZA 4LO5B 3I3QA 2NQYA 3WUCA 1XE0A 1IG0A 3DPRC 3V56A 5D21A 3PU3A 1KD7A 2WO1A 2GMPA 1GOHA 2D5FA 2WYSA 3IB3A 1J59A 3EJKA 4FOVA 4XF3A 2ARAA 4COYA 5A1FA 3TYJA 1NY72 2R071 4KGGA 4AGGA 2BNOA 2RE9A 4F3JA 1O3TA 1YQ8A 1I6XA 2ZBJA 1LAJA 5JPMB 1YCIA 3HQRA 2R49A 2I07B 4Q8KA 1GKBA 5CFCC 2WT0A 3JD73 2KM2A 4YARA 4CDXB 1ZBA1 2WS92 2PHRA 1H2LA 1W8ZA 4IV1C 4R52A 1US3A 3IDAA 1OD5A 5L19A 1QJX1 4P14A 5DUXA 2BGOA 3KVBA 4DY5A 2G9FA 2SLIA 3B5LB 1A8DA 1JI6A 1QQP2 2W91A 5F5QA 4FCAA 3RZZA 4AI3A 1COV3 1HRV3 1US2A 4XOGA 3AZXA 1N1YA 3LKJA 2NMNA 1RUF3 3C2UA 1ZRFA 1QY4A 5FMOS 3ZR5A 2AZ5A 2PAKA 2ADDA 5GZGA 2ZTNA 3ZXLA 1Q56A 1CX1A 1JYXA 3ZFGB 3NMBA 1BXHA 2X53S 1SBFA 1OQEA 2D5HA 1KJLA 5F3EA 5BUVA 5EJ1B 2BWCA 4E4ZA 3RZKA 4OZOA 1NX9A 2J1RA 1WA4A 3VD5A 3VBHA 2WSUA 5DQ0A 4K6BA 3PTYA 4ATFA 1S0BA 4CP2A 3VDBA 2ID4A 2DTYA 4GAZA 4QDRA 4IEZA 4WZFA 1PGSA 4CDUB 4DPNA 3WCSA 4GALA 4KG8A 2W95A 3BIWE 4LKFA 4RGAA 5BNOA 2H6BA 1TMF3 2ZXQA 2D3SA 5E88A 2QQJA 1FX5A 4XF0A 3WF3A 3ST7A 1V00A 5BNPB 5IAXA 1C8M1 3I7DA 4RYDA 1GYKA 3KF5A 3M70A 1C1FA 3MFCA 3CNAA 2CTVA 1OF3A 5CFDC 4PCRA 2C9KA 4GMP0 3ENRA 3NV1A 4GH4A 2RS53 1IKQA 2W47A 5FYYA 3FUOA 5FY7A 4QXHA 2JB4A 3GM8A 4HKWA 1GICA 2A7AA 4CCCA 1SLTA 1OSGA 4PDWC 4ZU7A 3EQEA 3O5SA 4E2GA 4HVRA 1GQPA 5DUWA 4D8MA 5A3TA 4OLLA 5F3GA 4CP0A 4LNVA 3QD6A 1W6PA 1UQXA 1ONAA 2P37A 2ZMNA 2D6NA 4CDWB 1ZZ8A 2J1EA 1W90A 2XLFA 3JBG3 3LCPA 5FY9A 4ZY9A 3RJ2X 1QXRA 3B94A 5D1IA 4DUXA 2B45X 1KFUL 2A6ZA 4FPGA 5FXXA 3OUHA 1QGLA 3OSDA 1AR93 3IMNA 4YZ1A 1W6NA 2JDYA 5F7UA 1UX6A 4IERA 3SEEA 1UY1A 3N3HA 1K3IA 1W8UA 2ZZQA 1GP6A 1YFXA 4QM9A 2Q4SA 1OLRA 1ASJ2 3I2GA 1LB2A 2ZMLA 1B35B 4FPCA 1H2NA 4MXWB 2DCZA 1Q8OA 2AYHA 2IVIB 3VBUC 1F15A 3OBTA 3JD71 1UOFA 4D7YA 5F5IA 3VUOA 4HLTA 2VCBA 3PURA 5L9VA 3ZFFB 1AR63 1GV9A 2GH2A 2IXHA 4K40A 5FP3A 3WW2A 5LW9A 3I2IA 2JEMA 5LRRA 4Y1VA 1BEV3 3ZSEA 5IVCA 1MPXA 1CAWB 1BCXA 1RL3A 5LASA 5C3QA 1AYN2 3SH5A 2ZGSA 1XE8A 2VZPA 3VBFC 3ZFEB 2BV4A 4BLIA 1AR83 1COV1 1HRV1 3U37A 4F7ZA 4BWOA 1CZSA 5H9RA 1SLAA 2OIIA 1MS0A 4AVVA 3FN9A 3ZIWA 3RYPA 1EUTA 4EN6B 1RUF1 2RHPA 1BK0A 2JG9C 3AKPA 3ALQA 3AXDA 3MIEA 2EA7A 3MPPG 4XFGA 1TME3 2WRAA 3AP9A 4R9BA 2QQPA 4CDQC 3VZMA 5I8YA 4AHYA 5LWBA 1PVC2 3U4SA 4OUMA 4QQOA 5A7WB 5FZLA 5F37A 2BDRA 4YVSB 2HYXA 3ZKUA 1WUVA 1XSQA 1OVPA 5A7PA 3T3YA 4CTEA 1VBD3 1MS9A 1OT5A 3T2OA 3Q8AA 3U4XA 2XKOA 3D82A 2D7FA 5D2AA 3UJQA 5JSPA 3J4UH 1FPN3 1XYOA 1LEMA 4JGZB 4Q1RA 2BOJA 3KT4A 3S5QA 2CHHA 3R4UA 2H6CA 1BMV2 2Y6KA 4FFIA 1TMF1 4MGTA 3BVCA 4JVAA 4IE6A 3M4FA 2VG9A 1MVQA 3GNEA 4H2AA 4HKOA 4Q4X3 2YFZA 3S7IA 3RWKX 4LLFA 4XEZA 2UU8A 2BGCA 5DG2A 2FD8A 4W65A 4NIHA 4B1MA 2BOIA 1YNAA 3D0SA 3F95A 5HV4A 4QPGC 5CAZA 5C6CA 2RS51 3L2HA 4Z82A 3W58A 3BU7A 2NPIA 3T2TA 1GNZA 1MS8A 2DVDA 1L7QA 3RQ0A 1UOGA 3P1IA 5DZEA 1SDDB 2VQAA 4CRQA 4QX3A 2VMGA 1W39A 2GALA 3B02A 3O0VA 2YU1A 3BGAA 1PNFA 3H7YA 1BZWA 3OG2A 2DCTA 4YM0A 2FDKA 2OQ7A 1IPSA 3W5NA 1ULOA 1JXNA 2ZEXA 1EPZA 3FBMA 4AVBA 4TZDA 3VHPA 3E5QA 1QNWA 4K7JA 3LA3A 3ZFEC 5E6HA 1QF3A 2BZDA 3JBG1 3VGIA 5C4WC 2VMCA 5FZEA 1KGYA 1UZZA 3V0AB 4LXLA 5J09A 2PHXA 1FOD2 4MGKE 3UKNA 1IPJA 3WV6A 3BU0A 1AR91 2RV9A 1FNYA 3C3VA 2ZKNA 1KQRA 2CGNA 4IETA 1YQ2A 4OUEA 1RHI2 4WVMB 4AFBA 4UT5A 4GQ7A 2GSYA 1PO23 2HWD3 4Y5TA 5T5PA 3T1MA 4EE2A 1X9PA 4MV2A 1CZVA 1CAUA 1J1TA 2J1VA 2E9QA 3GJAA 5BY5A 3LEIA 1BBT2 1HLCA 3MIHA 2X10A 3DPRA 4IDZA 2EVXA 4KBBA 1O3SA 1W8TA 1AR61 1ZBE3 4N8MA 1RUC2 4D69A 2HWE2 4V1PA 1RYYA 4JGZC 2RR13 1BEV1 3AYCA 2A73B 5EJZB 3ZXAC 5FZOB 1EPWA 2MEV2 4P5HA 2WQ8A 3PVBB 4P9XA 1AR81 2VUDA 1ZVFA 3I2FA 5CFCA 1QJY3 4IE4A 4HONA 2Q1MA 2EF6A 3USUB 2XVGA 5SV5A 3ZPOA 4IV1A 2C6SA 1TME1 5FKBA 4YW6A 5F6LB 5GM0A 3N9LA 1XNTA 4KWJA 2I45A 1X82A 1FI2A 1YUDA 1I5PA 4AFMA 1W2NA 1UY4A 1WBLA 2W39A 3I54A 4S2HA 1W6OB 2WZ8A 4R8HA 2WABA 1WMFA 2B9VA 4QB6A 3E6BA 2LW8A 3FMGA 5FZGA 1HB4A 5FZAA 2DDUA 3GBWA 3C8XA 4X6RB 1VBD1 1DG6A 1WKYA 5BYNA 2WFF2 1UOBA 3WG2A 4XW3A 5A7OA 1RGSA 2YGLA 1RUI2 3LB9A 4LOSA 4QQPA 2G1MA 2VO5A 1SLIA 1WCUA 1PIV3 1FPN1 3LDKA 1XXNA 3U78A 4DEVA 4UF0B 2XJTA 2ZEWA 2JJ6A 3LFMA 3OPWA 4IE0A 1UWWA 2YU2A 2UWBA 2P3YA 4Q4X1 3H3ZA 2RS13 1IZ3A 1WMXA 4W8JA 3UK9A 4EROA 2E63A 5EJ3A 5LA1A 4C90A 1PM7A 1Y3TA 4KWUA 5J37A 4QPYA 1ZX5A 4MX3A 4YGDA 3LPGA 3WQBA 1V9U2 4U36A 3WD5A 3ZX7A 1YHFA 4UFIA 5FYMA 1B09A 3FFZA 1RXFA 1XE7A 3MIFA 3WNLA 1O3QA 1LOAA 2DF7A 4TTGA 1WZXA 2WZEA 3IIIA 4XIKA 2RJ2A 1OFSA 3HIFA 2BVBA 1UX7A 1YRZA 2DWRA 5CFDA 3UGHA 1I1EA 1ND3C 4QX7A 1FV3A 1GMMA 3K46A 5FXVA 1GP4A 1QJU2 1W0OA 1Z7S3 2VUJA 2JDPA 2XJRA 5FO7B 4BZ4A 2D6LX 2Y0OA 3OJBA 2YDEA 4GKXA 4R9DA 3A22A 3UGFA 3GZTB 3AX4A 1DQ0A 4PDWA 4B1LA 5EFUA 3DKWA 1VBC2 2YPDA 4P9YA 4BK5A 5FPLA 1C5HA 1YIFA 4NO4A 1M06G 1I3HA 1SLLA 5C8WA 5HXVA 2Q8CA 1EAH2 5JZGC 4DXZA 4FTSA 1APNA 2Y38A 5TSWA 1XYPA 3IAQA 4GJYA 4NWVA 1PO21 1V0AA 2IXCA 1UF2C 1VBE3 3IN9A 4CPBD 3ITQA 3AKQA 5FYZA 2ZJCA 4AQSA 3PIGA 1D0HA 1WA6X 4M3CA 1YFWA 5A3OA 5FMOL 3NL1A 3VBHB 1HB2A 1PMIA 1X50A 5CIRA 3PUHA 3UJOA 1JTZX 1S2KA 1ZBE1 4ZHNA 1ZA7A 4EN7B 4E9KA 3IZOA 3BIEA 1R1A3 3MIDA 4M3CF 2RR11 3TEZA 3RDIA 3POIA 1CAVA 1VBB3 2Y0IA 4NRPA 3VZOA 3O1RA 2HWC2 2GP5A 2H0VA 2B9UA 3DV8A 4B7EA 3VBUA 3O0WA 5BNOB 3WHUA 5LBFA 1QJY1 2O8QA 1HXS3 5IVYA 2XG3A 3FX3A 1SEFA 3E1F1 4D6RA 2VNOA 2E32A 2IC1A 3CO2A 2VW0A 4YYOA 4XCBA 4LHNA 5FFOC 1SLBA 2CDPA 4AVTA 2XKPA 3GF6A 3VHRA 4QKDA 3VBFA 3B9IA 4BH9A 4GH4B 1L7RA 3ZYRA 2QQMA 4N53C 1AR73 1PK6C 5CKNA 5FYUA 4XUTA 2JG9A 4QB2A 3MFAA 2WZR3 4NN0A 1QJZA 2Q8DA 2ZHKA 2FDIA 2RS32 5HCAA 4CDQA 1PIV1 2JE8A 4BE3A 3RZHA 3A4UA 1GSLA 2O0OA 2P34A 1QDCA 2Y6LA 2ZEZA 3MLLA 5IFPA 1W6PB 2XJSA 3J8F2 2RM23 5CADA 3WW4A 4AFDA 3M7AA 2ZGTA 3B7MA 2XUEA 1HRI2 4JZRA 1NQDA 4LBLA 2P1BA 4XJWA 2G4IA 1Q8SA 2VCAA 2LTNA 2NMOA 2B39A 2RS11 3AKSA 3MUY1 4MXVA 3RNSA 5B2GB 1GWKA 1RUJ2 3ZMNA 4AWDA 1XPWA 1UIKA 1L3JA 5A32A 4CSWA 1W6NB 3D8CA 3JXSA 5FY4A 2W2IA 3FWEA 2PQSA 5DN2A 4MUVA 3QACA 5JSRA 2V09A 3POGA 3TEWA 4WM8C 4W6WA 3HR9A 1D4M2 3M3QA 3UKVA 5DZGA 5I0TA 2QQLA 2PHLA 4MSVA 3TNPB 4D6QA 4FPLA 2W5FA 1K42A 2PXJA 4YZ3A 2W68A 5ERLA 4ES9A 4M00A 4K8FA 1H4HA 2P3JA 4MLOA 2VE1A 1UXZA 4R9CA 3O12A 4DB5A 1BQPA 2Z69A 2D6KA 2QCSB 2DTWA 3PTRB 4QPGA 3N9QA 4Y5SA 1DZRA 5DAPA 4D0QA 1Z7S1 4BXSV 1W2TA 3NAPC 4M0HA 3D6EA 4BQ4A 4KWLA 4MHUA 3VLBB 3WINE 3WT3A 4B4PA 4CU7A 5JI7A 4ORFA 5A1LA 1XOYA 2BPA2 5AC92 2QQNA 4E2QA 2XPJA 2JDKA 3ZFFA 4NJ4A 2WQ4A 3A23A 3PL0A 3KGLA 3M3EA 3D4KA 3RMXA 4OUSA 1OI6A 4UFMA 4BMEA 3MGUA 5FYSA 1ZA4A 3KSCA 4QKFA 1QXPA 1VBE1 2C1FA 3ZFEA 4AHZA 3E6CC 3I2DA 3AL5A 3VD9A 5CBLA 2ZGKA 1M4WA 1RUE3 4ZS3A 3LSDA 3VB9A 3T30A 1FOD3 2XHNA 4PHZA 3KHBA 1LJ7A 3NNJA 1DP0A 4BYYA 4Q2FA 1RJ8A 1R1A1 1XRUA 4K21A 4XUNA 4Y3OA 4FOWA 1JZ4A 1NYWA 1VBB1 3U75A 1OQ1A 4JKLA 2C24A 4YGEA 5L73A 4XF1A 4DXSA 5FP8A 2B46X 1PM4A 4DS0A 4URTA 2OPWA 2JECA 4C0BA 2A3WA 1HXS1 4Q4Y1 1CGPA 2Y26A 3IIAA 5EIYB 1MS5A 3SQOA 5C70A 4J1XA 4N43C 4WVVA 1UO9A 4JKMA 5EXOA 4JGZA 2ZGPA 3TNQA 4XJAA 1MS1A 1ND2C 3SH4A 4A6OA 5FXZA 3LGRA 1PGW2 4OMCA 2WDBA 1F2NA 3DEMA 5DDJ3 2D44A 3POEA 1AR71 2X8KA 5LA2A 4IESA 2RMU2 3T2QA 4HK8A 5GZCA 3KV9A 2W1WA 5KHHA 2WZR1 1DF0A 3THTA 4MZUA 5FZ7A 3MW3A 1K5MC 5LBEA 2VMFA 1P8JA 2VR4A 2ZAHA 3WNMA 2QZ3A 5E89A 2RM21 1S2EA 4HMZA 4Y1XA 4CCEA 3U1XA 4XFAA 4MOAA 1NKGA 5JWPA 1W3XA 4LBKA 4PI2A 4MG2A 4KWKA 2YBSA 3OGSA 2F4LA 4YW2A 2EXHA 5FTTC 4ARYA 1O8PA 1S55A 4HVOA 5J48A 1W8FA 2R063 2W9XA 5JOWA 1POQA 1UKRA 1UYYA 4MGZE 1YI7A 3M1HA 4BLJA 2C26A 4QPIC 4QU2A 1MS4A 3RVHA 5KC6A 3E5UA 1G7YA 1RUH3 4LK6A 3HOBA 4XJZA 3SKJE 3V0AA 3LEMA 1FV2A 3NO8A 2WA4A 3DPRB 1H1IA 4QB1A 1Y43B 2VM9A 4FPJA 3UETA 3HNBM 5LBBA 4FQ4A 4Q4V3 4CYDA 1W0PA 2I74A 3O0XA 2DURA 1XJAA 2B5HA 3ECQA 3OGRA 3FBYA 4QAWA 2ZMKA 3RS6A 2AC1A 4N7UA 4AEKA 2DFCA 2QQIA 2WWJA 3JQWA 3I59A 3RSJA 2FZ1A 5CFCB 2FMYA 1WMEA 3G7DA 4K3UA 3PVEA 3ZR6A 4XAEA 2V4AA 4L97A 1ND3A 2OW4A 2QVSB 3DCQA 4IV1B 1WW6A 4YZ4A 5I93A 4TSVA 3TWIA 4COZA 2ZX3A 3S7EA 1NLRA 3FLRA 5F32A 2GNDA 3ZXGA 4IEOA 5JCTA 5FPVA 4YGBA 3PMSA 1RUE1 1DFQA 3USUA 2XMLA 3TOJA 4ISQA 1C28A 1FMD3 1OXCA 4I09A 1UYXA 4U2AA 3K3OA 5JZGA 3GHNA 3I49A 1NOVA 4D7SA 4F83A 3VHNA 1Q8PA 2HWB3 3IMMA 4AXOA 1CN1A 4OHYA 1QKQA 4RA0A 4XDOA 3ZYBA 2BFUS 5IK8A 1CPMA 4NHKA 3K4ZA 5FUPA 3NJVA 4LR4A 3GBFA 5ABJC 1JYVA 3S57A 1VLNA 2HWF3 4CP9A 1LULA 2J22A 1AJKA 1VMFA 3VZLA 3X29B 1DLLA 2PAMA 3H1YA 1MEC3 1N3QA 3SCFA 1WCQA 5F39A 3POSA 1ZZCA 1GANA 1O4YA 1ZZ9A 5DDJ1 1W28A 3RZJA 3AVRA 4X6QB 4Y5Z0 1W9YA 4DMIA 4JKKA 4OVEA 3RYRA 5JDBA 1AF9A 1IG3A 3SXWA 2ZKLA 2WNOA 5C33A 1H9WA 2HBUA 4W6XA 2R6QA 3AMMA 3BALA 4RFT0 5JLVA 1SCSA 5CFDB 3WQ7A 4O61A 3AJZA 4YZ2A 1ZRIA 2JDAA 4WVWA 4RFRB 4N53A 1PK6A 4ASKA 3KGZA 4AI9A 1G9DA 5FZ0A 1H1AA 4DZGA 3HAGA 1ZYBA 1G9FA 1RTVA 2BNMA 2ZEYA 2JIGA 4PDWB 4ISRA 3RG0A 4IEWA 4A42A 3C7GA 4AQTA 4B4QA 1OD3A 4AF9A 1AL22 4EJRA 2R061 2P6CA 4URAA 5FPZA 2XR4A 4LBMA 1H9PA 1JH5A 5A3PA 4XBLA 4SLIA 1RUH1 4K1YA 2VCCA 4Z07A 3K77A 4DFSA 4BQXA 2R1BA 2ZX2A 1ZREA 3EB7A 4M3CB 2QNKA 2Y33A 3VL9A 2FCUA 1JU3A 1H4GA 3OPZA 3LAGA 3H3UA 3RZLA 1LGBA 2ORXA 2G19A 2HYKA 1GP5A 3QLQA 2JD4A 4Q4V1 4CXYA 4WM8A 4OHWA
chains in the Genus database with same CATH topology
4GULA 2JKBA 1RMU3 4OHVA 1CAVB 3ATGA 3IBMA 5EYXA 1OKQA 5HCBA 4B29A 5FO9B 3RJRA 3DF0A 5FAXA 1R092 3VBUB 4YZ5A 1REFA 1PNGA 3VHOA 1Q43A 1RUG3 2K0GA 5BPXA 5KXCA 1OA3A 1BVVA 3NAPA 5L7OC 2XL7A 1AXZA 2WKKA 3VBFB 4RGGA 3JQXA 4DOUA 2VVEA 3WHTA 1UAIA 2UY9A 3ZSMA 2EXJA 2JG9B 1FMD1 4GB32 2IFWA 4LBQA 1MZFA 2WL1A 3N7KA 3VKFC 2YYOA 2HWB1 4FAHA 4CDQB 3VL8A 3BOWA 3H9AA 3ZSLA 1VRH2 4ITCA 4XMAA 1JBCA 4YG6A 4W6YA 2TEPA 5JOZA 1S1AA 3QH7A 5DUUA 1RIRA 2OUJA 2HWF1 4COVA 1S2BA 4UW5A 4AEJA 4XBNA 2JX9A 2KA3A 1MEC1 5A32B 4RHV3 3WY6A 3N36A 4B8EA 2PLV3 4JRAA 1UPIA 4KGQA 4LA2A 4Z92B 5BNNC 2D93A 2QZ2A 1H8TC 3USSA 2K9ZA 2R043 3ACLA 4YM3A 4CP1A 4QMAA 3J9SA 4N43A 1F8VA 1UMZA 4RR3C 4XF9A 3EHKA 4S2DA 2D6OX 4FT8A 1AX1A 2JG8C 1ND2A 5C8CC 2GMMA 4PF5A 4QPGB 4A7KA 2B7YA 3B69A 2QDNA 1AYM3 4Q4W2 1NXMA 3H0OA 3TN93 3DN7A 4E27A 2ZACA 3JZVA 3PLQA 3KCCA 1K5MA 1VALA 1Y7BA 3OF1A 3M3CA 3ASIA 5A3MA 3IM0A 4AEDC 2WNUC 3AMNA 2VPVA 3VZNA 5FPXA 5C4WB 4AQ2A 2HJIA 3PMEA 4YSFA 5EV7A 3IDCB 4UBHA 4BM8A 1GR3A 2I2SA 4I3GA 4I2OA 2DU0A 4QPIA 1NE6A 4IQPA 4XFHA 1PO13 2VQ0A 1RMU1 4UW4A 5ACA3 5GZEA 2GU9A 3ES1A 4Q0SA 2ZHMA 4FPHA 1ZRRA 1SBEA 3HN1A 4XPVA 3BODA 4ASMB 1H30A 1RUG1 1AXYA 2VMHA 3O14A 3ETQA 3NW4A 4Q29A 3U0ZA 4Q0UA 2XBO3 4RS5C 4FBFA 4HKLA 1RVF3 4EN0A 4HVQA 2EAKA 1LOCA 4YNIA 4K9SA 3PHMA 1ENRA 4XHXA 3WVJA 4EN8B 2WNEA 1U5ZA 3GZUC 1MZ5A 3CU7A 1W6QA 4QXKA 1YI9A 3LSEA 3MPBA 2GDFA 1MQTC 4YW3A 5JVVA 4GXLA 2DVAA 3N7JA 2ZPXA 2IXIA 1RUD2 1IS6A 3LWCA 4XHBA 4I01A 1GZWA 5BV6A 4RHV1 5AVAA 4I0BA 3VBOC 4XFFA 4FOYA 2TNFA 2YGMA 2PLV1 2E53A 3U07A 4FP3A 1EV12 2IXJA 1XU1A 3J26N 4OI1A 3VV1A 2R041 1VBA3 3M3OA 5ABJA 3UL2A 1R082 3MLKA 1IQAA 1JHNA 3V64A 3ZXDA 2DCJA 4UW3A 2BQPA 2A6XA 2OPKA 3AP7A 4FPOB 3HWJA 1FNZA 1LHOA 1MS3A 4X8NA 1AYM1 1D0GA 3MDPA 3TN91 3D5OA 3I59B 5IT6A 3FZ3A 4BIOA 2R1DA 2E7TA 4LBQD 3WR0A 1U12A 2A5ZA 1WCKA 3G6JB 1ND3B 3ZPYA 1I9RA 3Q9OA 4FQZA 4JAAA 1C57A 5FQ0A 2Q8OA 5KHIA 4LO4B 2YY1A 5JOYA 4UW6A 2CY6A 2FQPA 1LEDA 1BYHA 4HL0A 3VBRC 4YVWC 5AVPA 4PLOA 2IZWA 2WS93 4GWNA 1KDKA 4Y26A 5JZGB 3WXPA 1TEIA 1PO11 4EN9B 3NV4A 3M3IA 5ACA1 4L8QA 4M0NA 1QQP3 4FO9A 5FOJB 5JMCA 2G9GA 1H0BA 2W08A 5JOXA 4NOTA 2PA7A 3WDXA 3ZN6A 2BEOA 2R30A 2UURA 3ILRA 4XE9A 1WLWA 3WW3A 1UU4A 1RUNA 1H2MA 4IEQA 2BFUL 3MEPA 5GALA 4JDMA 1LHVA 2ZA9A 4H3WA 1LOGA 1PGL1 4ZXKA 1AX2A 2QDRA 2XBO1 2WLPA 1AL0G 2XB6C 1YYNA 2CGOA 4H7LA 2R072 1V6MA 1DDLA 1RVF1 5LK7B 2YV8A 3WCRA 3KQRA 2X5IC 4XF4A 4D3WA 1WBFA 3MW4A 2HEYF 2D3RA 4E4SA 5L7OA 4AVSA 2JICA 1ZBA2 2WQZC 1Z0HA 1LENA 2QUOA 4KNCA 3AMPA 4XQDA 1QJX2 2D6MA 1NCQC 1PK6B 4FVVA 4N53B 1PZ8A 2V5YA 4PIXA 3NV2A 3S30A 1HV0A 2FHRA 4GB33 3ZO0B 4LT5A 3L9JT 1UL9A 2VMIA 4Y20A 5FLIA 2VOWA 4K20A 3HT2A 1ZM1A 1CESA 2ERFA 1D2SA 5H9PA 2GZWA 5J98B 1VBA1 3ZXEA 5FDBA 3SISA 2VVDA 1LU1A 2O1QA 1S0EA 2A3XA 4Q27A 4ATEA 3KT1A 2ZX4A 3B01A 3I4IA 3MIBA 4YM2A 4WM8B 5BNNA 4IXLA 2HWD1 2UWAA 3POYA 1KDMA 3ZSJA 3H1MA 3ZIXA 3B9CA 4P9LA 3RI8A 5FLJA 4E4DX 2HKXA 1G8WA 4TWTA 4RR3A 3H7JA 4P9JA 1D4VB 1XNCA 1ULEA 2JG8A 4IEXA 2AREA 5K0UC 1SFYA 2BNNA 3T1LA 4GKYA 4FPFA 1CPNA 1NQJA 1NY71 1AUYA 1C8M2 1YJLA 3NAPB 4RD7A 3R0RA 1ASJ3 4GMP3 4XDQA 2P2KA 4RQPC 1HQWA 1V6OA 5I0RA 3OGGA 4LLOA 2IXKA 2WC2A 4WZCA 4AQ6A 1UU5A 1FYUA 2WS91 3NWKA 2VW2A 1A3KA 1LESA 3ELNA 3IWZA 4LBQB 2ZX0A 3FJSA 4PJYA 1QU0A 4AEDA 5F9TA 2WNUA 2LUWA 1RJ7A 5K7PA 1AYN3 1QQP1 3TB0A 2ES3A 4MVTA 1ZZBA 5T5LA 1N3PA 2AENA 3JB8A 4FSJA 4YFWA 2WFPA 2XJQA 1PVC3 3E6DA 1WLTA 2EIGA 1D2QA 2WT2A 2OYZA 3OTFA 1J3RA 4HK9A 4G9SB 4N43B 4LBOA 2CAUA 2B8MA 2WINB 4MGIE 1ND2B 1DQ2A 2ZCWA 3LOIA 4HPKA 4YRDA 4RS5A 4LO8A 4JCKA 1SDWA 1O4ZA 1X36A 1KFXL 2GN7A 3HQXA 1VB4A 4HT1T 1UCXA 4GB31 2R0HA 1COV2 1HRV2 1K5MB 3E5XA 1QXJA 3FC0A 3A0NA 4AI1A 1NE4A 1RUF2 1OPMA 2A6WA 1MQTA 3EXUA 1AX0A 4Q0PA 1N1SA 2GMEA 4LBNA 4AHXA 1TQ5A 1T6GC 5GKAC 3AB0A 4XTPA 4PLMA 4Y24A 4RL7A 3VBOA 1YIPA 3VKLA 4F8AA 2EALA 4QPIB 2HEWF 1Q3EA 2VU9A 1QHDA 1N1TA 1REDA 3BOPA 4AW7A 5C4WA 1ZRCA 2BYVE 1BVP1 1R083 2VVFA 3JU9A 4LHKA 1TMF2 3POWA 5FO8B 2A71A 1EP0A 4KH9A 1RHI3 3PJYA 1UN1A 4A3XA 3CF6E 3VBSC 1ASJ1 4GMP1 1LOEA 4P9GA 3AK0A 1SMVA 2ZS6B 1BBT3 4Q8LA 2RS52 2PN5A 1IS5A 4DY3A 5JPNB 1N1VA 4HN1A 3N35A 2N7GA 4HSJA 2CGPA 2PHUA 1RUC3 2HWE3 4R4ZA 3BTAA 4TLFA 3OYWA 1HX6A 2YZ4A 3ZVXA 5T52A 2YC0A 2XUMA 4WM7C 3ILFA 1AYN1 1W6QB 2MEV3 3MIGA 4JV4A 2ZX1A 4AG4A 3VBRA 4YVWA 4QHBA 5CVRA 1XU2A 4BIFA 2D98A 4JGYC 1MZ6A 4LULA 4MH0E 2R16A 4S2FA 5H9QA 2D6PA 5KXEA 3JBG2 2OZ6A 1V6NA 1VAVA 5FCCA 3ZN5A 4YW5A 1GZWB 1AR92 5LK5A 4AHWA 1PVC1 1S0DA 1LECA 2C5DA 1VAMA 4EWAA 1QOOA 3KMHA 4GWMA 4RSUA 5ABJB 2F6BA 1MVEA 2WFF3 4YG3A 4QGLA 2XHKA 4HFSA 3WG3A 4JQRA 1RUI3 4LUMA 5BXXA 2ATFA 3FHIB 4CZSA 2R0FA 1BMV1 1AR62 5IUQA 4QQHA 1ULCA 4LO7A 4B3NA 4LE4A 4LTAA 3GHMA 1BEV2 4DRRA 1GQGA 2D3PA 2Q5TA 3CJXA 3R05A 1ENSA 3HD8B 3VKOA 2X5IA 3K48A 1AR82 3CEWA 2JE7A 4JDOA 3TAYA 3ZYGA 4H14A 3V0BA 4N9HA 5DG1A 3IPVA 4A2UA 4DNYA 1G9AA 1RUOA 2PHTA 1OLQA 1V9U3 2JXAA 5FQ0B 1TME2 5CG9A 3ZYJB 3AMQA 2WNVC 4IV3C 3NVCA 1NCQA 4C91A 1YFYA 2XJPA 3ZYPA 4WBBA 4XTMA 4ZU4A 1DQ5A 3FUQA 3OGJA 2CL2A 1LKNA 3ES4A 2ZGQA 3QOPA 1VBD2 1CONA 5FBZA 4LE3A 1QJU3 4NWWA 4M01A 5JIAA 1FPN2 3VZJA 1OOPC 4XJ9A 5FREA 3KB5A 1VBC3 1NA1C 4I0AA 1FOD1 1H8VA 1KITA 2DUPA 3WP4A 5DXDA 3ZN6B 1S0IA 1HQNA 4Q4X2 1FATA 1EAH3 1RHI1 3VZKA 1V6IA 3MLJA 2DCKA 1A8MA 2JE9A 2Z2SB 1BBT1 3U10A 2F4PA 1HDKA 2BW8A 1UD1A 3KT7A 2GC1A 2C9AA 5K0UA 1PZ7A 2OUHA 4AFAA 2PTMA 3IDEA 2P3KA 1RUC1 5CU1A 2HWE1 4DQAA 1OHFA 4LA3A 5GLUA 3R6SA 4Q26A 5L7OB 2ZZJA 4N90A 3M8LA 2MEV1 4RQPA 4FXKB 2HWC3 3VDDC 1JW6A 1DGLA 1PZ9A 4COWA 1SFNA 1AVBA 4XXAA 3WG4A 5C9AC 4E2SA 1GNHA 4Y20B 2RJKA 3RYKA 2IXLA 3VKNA 2UY8A 3AYEA 1W2UA 4SBVA 1LGCA 1O91A 1C8NA 1F31A 4XBQA 3NKTA 3CJIC 1LHWA 4PIZA 4UBGA 4YLZA 1CVNA 1CR7A 2ZHLA 1VP6A 1VAKA 2UWCA 3NSTA 3W9AA 1PO22 1WW5A 2WFF1 4I30A 4A7ZA 1NCRC 1RUI1 2DVBA 4PIYA 4R4XA 2RS33 3QCWA 4JRLA 1A6CA 1JUIA 3ZYIB 5T50A 1ZBE2 3J8F3 4LUKA 2XVKA 2QFEA 2Z5WA 3IDBB 4JDNA 1H8TB 5CNAA 3WDYA 1N3OA 5BNNB 5KHGA 2RR12 1HRI3 1VJ2A 2OZJA 2PHDA 1AZDA 4UXAA 4NVPA 1YFUA 4FAGA 3VKMA 1RUJ3 4RR3B 1QJY2 5GLTA 2JG8B 1X33A 5C8CB 1RITA 2DCYA 3DL3A 1V9U1 4I3PA 5T54A 1D4M3 5A33B 4META 2PFWA 5KXBA 4HANA 1QOTA 2B42B 1MACA 4L2NA 3ZXKA 4XQWA 1VR3A 1ULDA 1OA2A 2A3YA 5IK5A 3H50A 2YPJA 1HIXA 1AJOA 1CAXA 2NYYA 1QJU1 3K51A 4AEDB 2WNUB 1YJKA 1QDOA 2CV6A 1PIV2 4QGNA 2AUYA 2DUQA 4XILA 3NJZA 4INDA 5HCFA 1DYKA 4YFZA 5AC93 3S0MA 1VBC1 3QBQA 1OQDA 3NV3A 2VW1A 2XVLA 4C1WA 1EAH1 2RS12 3GYDA 1TE1B 1JOJA 2EXIA 3OD0A 4H7MA 3JB4C 2E6VA 4XJUA 3WP6A 4FTBA 1Q8QA 2ARXA 2TBVA 3LA2A 3D0JA 3WDUA 5A3LA 4YM1A 4Z1VA 3M2MA 1XNKA 2FMDA 3VBSA 3ILNA 3B00A 1O7FA 4HPKB 3SHRA 2HWC1 1S0JA 4RS5B 4G4FA 4OZXA 1Z7S2 1PVXA 2GC3A 5GZFA 1QMJA 1UIJA 3AZWA 3LA7A 5E1RA 4AVAA 2ENRA 2GN3A 2IWGB 1SCRA 2A6YA 5CB7A 4R9AA 4WM7A 3AM2A 4CDXC 1QH6A 2PAEA 3WDTA 1MQTB 1LODA 4AFCA 4Z8BA 4AEMA 3ZDSA 1CD3G 2RMU3 4JGYA 4FPYA 1ZZ7A 1VBE2 4I02A 3N7MA 3CL1A 5KC5A 1PHMA 2RS31 4FPEA 3QH6A 4DINB 3VBOB 2WJSA 2CNAA 3WDWA 4COUA 3J8F1 2UYAA 1R1A2 1HRI1 3ZFGC 1BK1A 4Q0QA 1VBB2 4AGVA 1RUJ1 1BJQA 4MYEA 2NM1A 1POV0 1WGPA 3FE5A 3WZ1A 1HXS2 4Q4Y2 2ETEA 4YGCA 4KU8A 1D4M1 4CDUC 3S6PA 2H0BA 1J58A 2O8OA 3WDVA 1TNFA 3APBA 1NZCA 3VN4A 1CIWA 1QH7A 1Q5OA 1V6KA 1AR72 4G3YC 1IKPA 1EYBA 2XJVA 2WZR2 5BNPC 5AFBA 5EYYA 3OYWB 2WNVA 4IV3A 2OA2A 5H9SA 2ZGLA 2BBVA 2Z79A 2DFBA 5AC91 3VBRB 2RM22 4YVWB 1IS3A 3SITA 1O3RA 4XQ4A 4OI4A 4NHMA 1WLCA 4HSLA 4JC1A 3IKWA 3I8TA 4OHZA 5J3UA 3AYDA 2XJUA 3AP6A 2TUNA 2EAAA 4Y22A 3OY8A 2ZABA 4BHPA 4XZPA 2WT1A 4BPZA 2FZ2A 5T5OA 5L36A 1W6MA 1OOPA 1G6NA 1AXKA 1SACA 2MNGA 2VULA 3OCPA 2DVFA 1NA1A 1EY2A 1H2KA 3PVOA 4CDWC 2WLQA 3L2YA 3PJQA 2A75A 2C0ZA 1YO8A 3AZZA 4D7TA 2BTVC 3MF6A 3TRSB 4AI0A 1GFF2 4ONUA 5JIUA 5JSOA 1J3QA 3OD4A 4AVCA 1RC6A 1B35C 2ZHNA 3THPA 4PBOA 2E7AA 3V65A 2X5IB 1V70A 4BCUA 3A0KA 3V0BB 1S0FA 4JTOA 3IPVB 3VDDA 3ZFFC 3B93A 1PGW1 1OFNA 3KM5A 4BOWA 2VUAA 2BUKA 1J3PA 1NCQB 1LGNA 2RMU1 4I0WB 2DV9A 1LOBA 2BWAA 5C9AA 5I91A 1DQ4A 1UZYA 4CEYB 1DQ6A 1RUE2 2XGXA 4XYXA 1NLSA 4FXGB 1LRHA 1YLLA 3CJIA 3MZHA 1DGWA 1WLDA 2YMZA 5J7MA 1Q8VA 4KQ7A 5IK4A 5CA6A 4M3CE 1UKGA 5LRSA 4QM8A 1NCRA 4HBNA 2EXKA 4YVSC 5HI0A 1AL23 5I8SA 2IFRA 3N7LA 4XIOA 1KXGA 4HETA 2ZGUA 5FRAA 2R32A 3BPZA 4GA9A 3ZSKA 1ENXA 4KL1A 4X8PA 2P3IA 2ZGMA 5GLWA 2NZ9A 3GZAA 3JUUA 3FFQA 2VOXA 2CWMA 2ARBA 5FLHA 2PYTA 4LHLA 2ZAAA 5DDJ2 2NN8A 4XJ8A 2ET1A 5K0UB 2CWSA 4BMBA 5E16A 1FT9A 2W0XA 4QX5A 2VGDA 5D8AB 1KRIA 3AXEA 2K2SA 4OI0A 4RQPB 3LOBA 1R093 2WSVA 2Q1ZB 3MICA 5KWRA 4NR1A 5FOBB 3DUIA 2A6VA 4D94A 3SCHA 1WCDJ 1MZEA 1FAYA 1DBNA 2VOKA 2R062 2ILMA 1KJRA 2Q30A 5DZFA 3WQ0A 1WMDA 4IEPA 1I5ZA 1V6JA 4FP2A 4N7IA 1RUH2 2MPFA 3ZXFA 2CAVA 1C3HA 3KS7A 4LBJA 4L99A 5I0UA 3UV9A 4CEYC 4AE2A 5CADA 4L92A 4MGYE 4XETA 4IEUA 1OPOA 1VRH3 4Q4V2 1TNRA 1QOSA 4P9IA 4QT6A 1LCLA 2WA3A 2E7QA 1AHSA 4Y1YA 4S2GA 3AYAA 4PQ9A 2D43A 2WWSA 2GNMA 1FXZA 4HZFA 5E8AA 2PHFA 1H8TA 3KCXA 1O4TA 4XFBA 2YHJA 2HEVF 2DVGA 4Q0VA 1DGWX 3WOGA 4AYUA 1A78A 1RB8G 5C8CA 4WVZA 4AI8A 4CDXA 4FPKA 2AGSA 5D8AC 1FMD2 1CAXB 5A33A 5EZWA 1IPKA 1IS4A 4Q4W3 2YROA 3URFA 3MW2A 3R4DB 2XLAA 2HWB2 4C1XA 2LALA 1SLCA 4OI2A 1CQ9A 1KS4A 4O9EA 3RRDA 1AL21 1U5XA 4AK3A 3WP3A 1XNBA 4ASLA 1ULFA 1GBGA 2HWF2 2VNGA 4IL7A 4JTNA 3MI8A 2ZOEB 4QD2A 4CEWC 5K9YA 3ZFGA 1LOFC 3EO6A 2VECA 1MEC2 3HT1A 4ES8A 3ZN4A 4BQ1A 1G9CA 1QNYA 3WNXA 4Q4Y3 1GZ9A 4YW4A 1C1LA 2FBEA 4CDUA 3VBSB 4C0HA 5T5JA 5KBFA 2GAUA 4ZU5A 1NXD1 5HBAA 2JENA 3O7OA 1R091 1JN2P 5LEKA 3AFKA 2MHFA 3WQ1A 1LHUA 1Y9QA 1J1LA 2ET7A 2VNRA 2GH8A 4WV8A 1KS5A 5BNPA 3JD72 5SV8A 1ENQA 4XXPA 4WM7B 3KLSA 2OVUA 4AGRA 2AR6A 3INAA 1X8EA 1U0AA 4A7YA 4LO6B 2GNBA 4JGYB 5KHKA 1HW5A 3ZMOA 1JYIA 3PNAA 5DUVA 2BVVA 4Y1ZA 1DHKB 1POV3 3N4MA 1QWRA 1F9KA 1YXWA 2SBAA 1DQ1A 2Z42A 3RMYA 3UKTA 1VRH1 1X7NA 2PQQA 4B7KA 1IGOA 1NG0A 1RMU2 1VB2A 1S0GA 4CDWA 5K8SA 1RUD3 2W52A 4XFCA 5LEJA 1ULGA 3VBHC 2V73A 3MYXA 2XH6A 3P3PA 2LM3A 2YUEA 1Z78A 4PLNA 4J1WA 1C5IA 1EV13 4J6GA 1RUG2 3NKGA 2DU1A 2XWJB 3WLUA 1SBDA 1WW4A 2VH9A 3OBRA 1B35A 1XQNA 3BCWA 4MXWA 5BNOC 4K1ZA 3W59A 4P9WA 5IK7A 1X8MA 1U5IA 1GLHA 4IV3B 2WNVB 4Q4W1 2Q0AA 2P17A 5JI9A 3KZ4C 1CAWA 2PELA 2VY0A 5T3NA 3RWNA 1WD3A 4N9IA 5BNQA 4GH4C 5KXDA 4NPRA 3KD4A 1DU3D 3AZVA 2ZGOA 1LTEA 2PHWA 4EWDA 1U5YA 2D97A 3AKTA 1E57A 4Y22B 3ROUA 3ZXJA 2X29A 3OY8B 5JR7B 2YXSA 5GLVA 4RHV2 3AKRA 1W6MB 1OOPB 1WD4A 3CLPA 3WX5A 2PLV2 1UPSA 4YVSA 1NA1B 2GNTA 2RJLA 1C4RA 3H1WA 1O5LA 2R042 5EWSA 1DZQA 3BB6A 1CJDA 4QQLA