1Z7S3

The crystal structure of coxsackievirus a21
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
GLPTMNTPGSNQFLTSDDFQSPCALPNFDVTPPIHIPGEVKNMMELAEIDTLIPMNAVDGKVNTMEMYQIPLNDNLSKAPIFCLSLSPASDKRLSHTMLGEILNYYTHWTGSIRFTFLFCGSMMATGKLLLSYSPPGAKPPTNRKDAMLGTHIIWDLGLQSSCSMVAPWISNTVYRRCARDDFTEGGFITCFYQTRIVVPASTPTSMFMLGFVSACPDFSVRLLKDTPHISQSKLIGRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Human COXSACKIEVIRUS A21
publication title The crystal structure of coxsackievirus a21 and its interaction with icam-1.
pubmed doi rcsb
total genus 38
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z7s300
2BBVA 1COV1 2RS12 1ND2B 1HXS1 2HWB3 4JGYB 1HRV3 4Q4W2 2PLV2 1MEC2 1VBB3 4CDXC 1QJX2 1PVC1 5K0UA 3VBFA 1AL22 1FMD3 3JD73 1VAKA 1ZBA3 5CFCC 1MQTC 2HWE3 1EV13 1AL0G 1VBC1 1K5MA 5C4WB 4YVWA 5DDJ3 1VRH3 1QJU3 4CEYB 1PIV3 1AR93 1OOPC 4YVSC 4QPIC 5A32B 3VBRA 2RS53 1NCRC 1BBT3 2HWF2 1RUI1 1HQNA 1VB4A 1NCQC 5GKAC 3VBSC 5C9AA 3ZFFA 1F2NA 3VDDA 3VBUA 1HXS3 2TBVA 1RUC2 2RS11 3S6PA 4CDUB 3M8LA 4Q4W1 2PLV1 1MEC1 5J98B 5BNNB 1QJX1 1EAH3 1D4M2 1NA1B 1B35A 4WM7A 4RQPB 1AL21 2FZ1A 3DPRC 4CDQC 2BFUL 3NAPA 3ZFEC 3VBOC 5ABJC 2MEV2 4N53C 4IV1C 4CDXA 4JGYA 1RUI3 2X5IC 4FTBA 5BNOC 1FOD2 1PO21 4Q4Y3 2IZWA 5CFCA 1MQTA 4RHV1 5D8AC 2WWSA 2RMU2 2ZZQA 2RS13 2R072 1R1A2 4WM8C 1OOPA 5K0UB 1RUC1 4QPIA 3VBFB 5CFDC 4Q4W3 5BNPC 4CEWC 2PLV3 4RS5B 1QJX3 2BUKA 4FSJA 1AL23 1AR72 1D4M1 1NCQA 1ZBE2 5A33A 3VBSA 1C8NA 1ND3C 1RMU2 3VBRB 1Z7S2 5JZGC 1POV0 1R092 1X36A 5C9AB 3ZFFB 1AR82 1C8M2 1PO23 3VDDB 1RUD2 1FOD1 1CD3G 4RHV3 4BCUA 2FZ2A 3LOBA 1RUH1 4CDQA 5AC93 1RUC3 3VBOA 5ABJA 2R071 1R1A1 4RR3C 1B35B 1RUJ2 4WM7B 4IV1A 2X5IA 1RHI1 3HAGA 1D4M3 1OPOA 4SBVA 5ACA3 1V9U1 4AEDC 1AR71 1ZBE1 3JB4C 4CDWC 4EJRA 5D8AA 1RVF3 1RMU1 4CDXB 1A6CA 1NY72 4GH4C 4WM8A 1Z7S1 1R091 5CFDA 1ASJ2 5BNPA 2ZAHA 5CFCB 4IV3C 1MQTB 4RS5A 1AYM2 4Q4X3 1C8M1 1RUD1 1WCDJ 4GMP0 1RUH3 4GB32 1OOPB 2HWC1 3J8F2 1TME2 4YVSB 1ND3A 4QPIB 1POV1 2R073 1R1A3 4NWVA 1NCQB 5A33B 3VBSB 1RHI3 2GH8A 4QPGC 1V9U3 1AR73 1FPN2 1ZBE3 1COV3 4JGZC 1VBE2 1RMU3 1Z7S3 1R093 1VBA2 4Z92B 1NY71 1PVC3 2WS92 4RR3A 5L7OC 1W39A 2RS32 1ASJ1 4Q4V2 3DPRB 4CDQB 2HWD2 1VBC3 1QJY2 2HWC3 1AYM1 3ZFEB 3VBOB 5ABJB 2RM22 3J8F1 4CDWA 1TME1 4N53B 4IV1B 5J96B 1H8TC 2X5IB 5BNOB 4GH4A 5C8CC 3TN92 2HWF1 5LK7B 5FMOL 4IV3A 1M06G 5D8AB 4N43C 4GMP1 4WM8B 1FPN1 2BPA2 4PDWC 5CFDB 2HWB2 1VBE1 4CEWB 5BNPB 1BMV2 4YVSA 1VBB2 1MEC3 1SMVA 1VBA1 1NCRA 1ASJ3 3CJIC 2RS31 1PO12 3VBHC 1FMD2 3JD72 2R062 4QPGA 1ND3B 2WFF2 4Q4V1 1AYM3 1E57A 1BEV2 5JZGB 2HWD1 1QJY1 3J8F3 4JGZA 1VRH2 1QJU2 1TME3 2GSYA 2RM21 1R082 2MEV1 3ZFGC 1BBT2 5L7OA 2HWF3 1TMF2 1RUG2 4Y5Z0 1DDLA 1PGW2 4GMP3 3DPRA 1FPN3 1F8VA 1K5MC 4YVWC 3IDEA 1VBE3 4RR3B 2R042 3ZFEA 2RMU1 1H8TA 1CJDA 1VBA3 1BMV1 5C8CA 4N53A 5BNOA 2RS33 4AEDB 1EAH2 4FTEA 4Q4V3 1PO11 4CDWB 2WLPA 1FMD1 3JD71 2HWD3 2R061 2WFF1 1QJY3 1RB8G 3VBUC 1BEV1 4GH4B 2RM23 4PDWA 1VRH1 1QJU1 2QQPA 1AR62 1QJZA 5FOJB 2MEV3 4IV3B 4CEWA 1R081 1OHFA 1FOD3 1TMF1 1RUG1 3VBHA 1AR81 4Q4Y2 2ZTNA 1VB2A 1PGW1 3NAPC 2RMU3 5JZGA 1RUF2 1NCRB 2R041 1ND2C 2WZR2 4JGYC 4QPGB 3ZFGA 1RUJ1 3JBG2 2BFUS 1PO13 4JGZB 4RFT0 1EAH1 1QQP2 2R063 2WFF3 1BEV3 1VBD2 1PGL2 5L7OB 3ZXAC 5C4WC 2XBO2 4CEYC 1AR61 5FMOS 1R083 2RR12 1TMF3 1RUG3 1PO22 1AR83 1C8M3 1RUD3 1RUE2 3FBMA 4AEDA 4Q4Y1 4RHV2 1H8TB 4GB31 5AC92 1POV3 5C8CB 1HRI2 1NG0A 2R043 1RUF1 1RUJ3 4CDUC 2WZR1 4N43B 1AYN2 3JBG1 5ACA2 5BNNC 1GFF2 1NA1C 4PDWB 1QQP1 4RQPC 1X33A 1RVF2 1VBD1 4NWWA 1HRV2 1PGL1 4LLFA 1AR63 3CJIB 2XPJA 1ND2A 2XBO1 2VQ0A 3VBHB 2WS91 3JB8A 2Y26A 1NOVA 2RR11 4Q4X2 1ZBA2 2HWE2 1EV12 1RUH2 4GB33 1RUE1 5DDJ2 1PIV2 1AR92 3ZFGB 5AC91 1RUF3 1HRI1 5C4WA 1HX6A 4CEYA 2RS52 2WZR3 5K0UC 1RHI2 3TN91 3VBFC 3JBG3 5A32A 4RS5C 1V9U2 1K5MB 1AYN1 4YVWB 1QQP3 1COV2 5ACA1 1HXS2 1VBD3 1RVF1 2HWB1 4FTSA 1HRV1 2XBO3 3VBRC 1PVC2 2WS93 1VBB1 4CDUA 2RR13 3VBUB 2DF7A 5C9AC 1VBC2 3ZFFC 2HWC2 4N43A 4Q4X1 1RUE3 3VDDC 1ZBA1 5BNNA 1NA1A 2HWE1 1EV11 4RQPA 5DDJ1 1PIV1 1HRI3 1AR91 1RUI2 1IHMA 3TN93 2RS51 1AUYA 1BBT1 3CJIA 1B35C 4WM7C 1AYN3 4Y4YA 3NAPB
chains in the Genus database with same CATH superfamily
2IXIA 1MS9A 2BBVA 1SHWB 1DGRA 2XQRA 2RS12 1ND2B 3SHRA 2VVFA 4C91A 5JXHA 2Z5WA 1HN1A 2ZGMA 2ZHNA 2WA3A 3SITA 4FPKA 3H50A 4PF5A 2PLV2 4PHZA 4L99A 4Q4W2 1CAXB 5FZBA 5BY5A 2VH9A 1QDOA 5D2AA 3J7MA 5FPXA 4IGPA 4PLOA 3SKVA 2IXLA 3VBFA 4R9BA 1BZWA 1FMD3 3JD73 1C5IA 1UPSA 1JU4A 3KV6A 3PHMA 4FFFA 4PF1A 3ON7A 1ZBA3 5IVBA 2VBBA 4O9GA 1DQ5A 2VXRA 4WVVA 2HWE3 2GN3A 1VBC1 5A3UA 4HL0A 3U0ZA 1K5MA 3O1MA 5DAXA 5BXXA 3MPPG 4YVWA 2ZEYA 5FY0A 3SH5A 1OOPC 1Q56A 2Y0OA 4L97A 1SLBA 2HBUA 1GV9A 1FT9A 3RNSA 1W2OA 3THCA 3VBRA 4DY3A 1AVBA 4DQAA 1W9SA 5F9TA 1G7YA 1NCRC 1BBT3 2EA7A 2A6XA 1V6LA 1LOEA 3FJSA 3L9JT 4AQ6A 3ZPOA 4IEYA 1A3KA 3NW4A 2XJRA 1NCQC 3V0AA 4OHWA 3VBSC 2ZGRA 1AZDA 5C3SA 4COWA 4HLTA 3JXSA 3ZFFA 5FLHA 5T55A 3VBUA 2XJPA 4H14A 3ZYHA 1HXS3 3AKTA 4ZKTB 1V70A 5KXBA 2ZX3A 3D3AA 4CCCA 5FFOC 1RUC2 2JB4A 5IVVA 2RS11 3AP9A 5C5UA 1OXCA 3ZO0B 2ZHKA 2HYXA 3M8LA 2JDYA 3ZSKA 4MH0E 3NJZA 1O3RA 3NNLA 5FOBB 4Q4W1 5FCCA 4IL7A 2LW8A 2PLV1 1GANA 2RV9A 3FHQA 5J98B 1GOHA 5A3OA 3WQBA 5FZEA 4EV0A 1NA1B 1UF2C 4YW5A 1RGSA 1JODA 3KLSA 1YQ8A 4RQPB 2JDZA 5EHDA 1MS0A 3BN6A 2VMHA 5FZMA 2UURA 2ET1A 4IEVA 4JAAA 4BJ0A 1MS1A 2BFUL 3MW4A 5C8WA 1O5LA 2IFWA 4AXOA 3RZKA 3B94A 4M3CA 3N7JA 3FHIB 2CU5A 3IAPA 1C57A 2QUOA 5FZCA 1W6QB 2VZVA 2WNUB 4HETA 1ZA4A 3MUZ1 4UFHA 4Y4RA 5CISA 1KITA 3WX5A 1O4ZA 2VMDA 3BYWA 4NR1A 3T30A 4BZ4A 3WF4A 1WD3A 2ATFA 1O4YA 1SFPA 1FOD2 2VL4A 4OHVA 5F3GA 2ZJCA 3SXWA 1REDA 3LKJA 4CCLA 5FQ0A 3WHUA 1S2EA 1FV3A 3ITQA 4DXSA 5JXGA 3WG1A 1HB2A 2R49A 3I2OA 5LEKA 2ZMKA 1Q8QA 2RMU2 2PA7A 2OIIA 2ID4A 3PJQA 4Y3OA 4AZZA 1LGNA 1OOPA 1NLSA 3D0SA 1RUC1 5CFDC 4BQXA 1FV2A 1KQRA 2P1BA 2W1SA 3T1MA 4M00A 4K20A 4XURA 5LWBA 1QJX3 5FLIA 2Y6FA 4FSJA 4P08A 4ZS3A 1AL23 1NCQA 1Y9GA 1PM7A 4Q29A 3VBSA 5A3LA 3VZOA 1PMHX 4NAMA 1FI2A 2G19A 1ZZ7A 2H0VA 3WINE 4FXGB 2QQVA 4BXFA 1W8NA 3T09A 2VOXA 2JKXA 4TN7A 1WA4A 3B5LB 2OKXA 4AGGA 4QU2A 5FPBA 4CP2A 4EZHA 3TNPB 1IKPA 1FOD1 5AVAA 3HJRA 3WDTA 1Q8OA 3ZYJB 1GU3A 5K8SA 2QE3A 1W06A 4J25A 1W8ZA 3VB9A 1A78A 4A41A 5AC93 3O1SA 2VTXA 3AXDA 2WT2A 3K48A 4IEOA 2VZQA 2IXHA 4GWNA 3R4DB 2WO2A 3M7AA 1XYPA 2R16A 3ZN6A 3C7HA 2OW4A 3VZNA 2YBSA 3KV9A 3IMMA 3I2GA 4W65A 2AH2A 1I9RA 2J1RA 1SBFA 4WVZA 4DUVA 1BYHA 3K4AA 1JZ6A 1ZRDA 1D4M3 1DP0A 4XPVA 2D3SA 4Q8LA 4NIGA 1V9U1 3EB7A 2Q8CA 2ZHLA 4FPYA 3JB4C 4QQHA 3QOPA 1QNWA 1RVF3 1LESA 2VZSA 3RJ2X 1LCLA 5C6CA 2ZX2A 5FYBA 1A6CA 1NY72 1Y9QA 2A6ZA 3EBRA 1IS4A 5CFDA 3DYMA 3T0BA 1ASJ2 1S0FA 1W8TA 3OUIA 3D6EA 3ORJA 5KHGA 3PVNA 2VMIA 1MQTB 2YXSA 1WLWA 4Q4X3 1WD4A 1XC6A 2QKDA 4GB32 5A7OA 2DCJA 4CSWA 1TME2 1OSGA 2ADDA 2WNVA 3DEMA 5FZDA 5GLWA 2QQIA 4DUWA 1ZRIA 1EUTA 2R073 1R1A3 1QU0A 3OUJA 4P9JA 2NP0A 5JOZA 2FMDA 5J37A 3IDBB 1EUUA 4ITCA 5LA0A 3MIEA 4YZ3A 1GZ9A 2DDUA 2H6CA 1SLIA 5LY2A 5JSRA 4XF1A 1LAJA 1DYOA 4Q27A 1WBFA 4QPGC 4Z82A 4KQ7A 5BUVA 2WR9A 5F5CA 2WWJA 3WUCA 1SACA 4BQ5A 4A7ZA 4PIXA 2B4KA 1YFXA 5ANNA 1RMU3 4COVA 1XSRA 5A7NA 1UZVA 3CKHA 4I0BA 3MLLA 1Z0HA 4RYDA 4BISA 2JECA 4BMEA 5A3NA 3HNBM 3MICA 1NY71 4FFGA 1W6OA 4C1WA 2RS32 5IVEA 1ASJ1 1N1SA 3NSTA 3VD7A 1KGYA 4E4SA 2GP5A 3WW2A 1SCRA 2QTWB 1VIWB 4WVWA 1RL3A 3T3YA 2HWD2 4HANA 1VBC3 2NZ9A 3AKRA 2HWC3 3BTAA 3GZEA 4YYOA 4ZU7A 4YFWA 1SDWA 2EAAA 2WN3A 5FZAA 3ZFEB 4ZONA 2QVSB 4QHBA 2WSVA 1JOPA 1TME1 2XQXA 3DECA 1ZRCA 1W2TA 2Y8KA 1H8TC 4IV1B 2X5IB 4C0BA 5BNOB 5C8CC 2CAVA 2ZKNA 1UU4A 1RJ8A 3IMNA 4I09A 2D6LX 4R4XA 5EIYB 4QMAA 5FRAA 1W04A 4F8AA 4J1XA 2VZ1A 5FIXA 4D8MA 1JZ2A 4XTMA 3QBQA 4Y1VA 2EICA 4OCTA 3WNOA 4CTEA 3HBKA 4N8MA 1HQLA 1ACCA 1G9AA 3MIFA 1WGPA 1J1TA 2HWB2 2ARCA 4CEWB 5IVJA 1GQPA 3LEIA 4V1PA 3OBZA 5I8YA 1BMV2 4YVSA 1S0JA 4XJZA 4ES8A 1VBB2 1KD7A 1YJKA 2ARAA 1UPIA 4IE7A 2RS31 1GWKA 1JN2P 1FNZA 1ZVFA 4QPGA 1U5XA 5H9SA 3VHPA 1E57A 1GZWB 4DIQA 5JZGB 2HWD1 2EF6A 2VOTA 1TZOA 3J8F3 1WKYA 3LA2A 4BH9A 4EWAA 1QJU2 2P3JA 2KD7A 4HKOA 3BIEA 4DEQA 5IK4A 4XYXA 3BGAA 4ZZ8A 5LA2A 1R082 5CVRA 3ZFGC 3FHAA 1OA4A 4DUXA 1ZM1A 4RA0A 1RUG2 1UX7A 5FYSA 1DBNA 1DDLA 4GMP3 1W8WA 1UD1A 3MIGA 3DPRA 1FPN3 3UV9A 1KXGA 1SCSA 1F8VA 1V00A 3LF7A 2ZGNA 5GALA 3IDEA 2R042 4HK9A 5FKCA 4META 1CJDA 1H8TA 4MGKE 3I3BA 1OH3A 4E8DA 2G1MA 5C8CA 3WP4A 2F6BA 1MVQA 3FN9A 5FZOB 2ILMA 4XF3A 1BMV1 3RJRA 4NHYA 4P9XA 4QHZA 4AEDB 3AYAA 1FXZA 3ETQA 3PIJA 3GJBA 3KCXA 1OLMA 4YPJA 2B9VA 4XW3A 1GNZA 4XIOA 2JDNA 4LKEA 3C8XA 5I0UA 2RM23 3T2QA 1QJU1 2RVAA 1UXZA 2YU1A 5FOJB 3M1HA 5DUUA 1UYYA 2A6WA 4IV3B 4NOTA 2AACA 1Y9MA 4BOWA 3I59B 1R081 1K3IA 2VNGA 2VAUA 3IN9A 5FZKA 1OVPA 2B5HA 1FOD3 2GDFA 1RUG1 2YFUA 3PVBB 1NUKA 2HYKA 3UGFA 1XNDA 2OS2A 1OMIA 2VC9A 3KVBA 4QXBA 1NLRA 2YGLA 1XJAA 1GQGA 1ULOA 3NAPC 2A3YA 1IS3A 2RMU3 1U0AA 4A7YA 3N9PA 1NCRB 3OYWB 3AXEA 4YW1A 4EN0A 3FUOA 4JTNA 3SNMA 2R041 5FAXA 1H6XA 1ND2C 2EIBA 4X8PA 3ZFGA 1A34A 1NXMA 2WQ4A 2XHKA 4XQWA 5A7WA 4E27A 2X09A 3UK9A 1YI9A 2BFUS 5IFPA 2R063 4XMIA 2WFF3 4LE4A 4RGKA 2O1QA 4IE6A 1ODMA 5FYHA 5JR7B 2WJSA 2YZ4A 2BTVC 2OQ6A 4FPGA 1OQDA 2B8MA 3INAA 3ZXAC 4UYBA 1C5HA 1IS5A 2J7MA 1TQ5A 2XBO2 4XJAA 2VQAA 2DBIA 5FMOS 3U11A 4E4HA 4UI9L 1OFNA 5SV5A 3G7DA 3LPFA 4N90A 4S2FA 2ZKLA 3CEWA 1U5ZA 1SFYA 1V0AA 1Y3TA 2W68A 4IEQA 1BVVA 1RUE2 1ULCA 3FBMA 4AVAA 1ZZBA 2VTXJ 1CJPA 1W6MB 1CESA 3KT1A 5DAWA 3KV5A 3NVCA 1MPXA 3WP3A 3ECQA 1WW4A 1T6GC 3DXTA 2GNTA 3OG2A 5JLVA 4BU2A 2W87A 2JDAA 4H7LA 1DZRA 4L9BA 5FP3A 1D0GA 2ZA9A 4KL1A 3OTFA 3UKNA 5L19A 3RZZA 4FAGA 1OKOA 2D6NA 2GP3A 2JXAA 4GKXA 2Q5TA 2ZAAA 2FHRA 1IKQA 1NA1C 3NNGA 4FO9A 2ORXA 4RQPC 1XE8A 2CL2A 3ELNA 1DYKA 1X33A 1UCXA 1CN1A 3OOXA 4IE5A 1IG3A 1UZWA 4NWWA 4Z2AA 4CCOA 2A1XA 3BI3A 4NROA 3IPVB 5CBLA 1ND2A 2XBO1 2VQ0A 4J6GA 3CBNA 4QB1A 3VBHB 4CUCA 1A8DA 3JB8A 3NKGA 2WNUC 2QQOA 1PZ9A 3NL1A 5K9YA 1CAXA 4Y20B 1ZBA2 2DVAA 2FDKA 4D6RA 5KHJA 2HWE2 4B1LA 1RUH2 5JPMB 4GB33 1DQ4A 4Q1PA 3RMXA 2QDNA 1NQDA 1RUE1 5E88A 4BQYA 2XXZA 5IT6A 3PU8A 4XAEA 2XVLA 4X8NA 2VW2A 1O59A 1WWYA 4NIHA 4NUBA 2ZS6B 1HX6A 5CKNA 3ZSLA 4FPFA 5JOWA 1OH4A 2WZR3 3CL1A 2QFEA 4A3ZA 5KC6A 1C3HA 1SLTA 3JBG3 2PAKA 2B7YA 4KMQA 1DIWA 1ZNPA 1TNRA 2Y6HA 2ZGUA 3GZAA 2ZGOA 3MFAA 3UESA 1IPJA 1COV2 4CP1A 4P02B 1HXS2 2F17A 3RZJA 1VBD3 3S30A 3VHOA 2D40A 3W9AA 4UW5A 4AQ2A 1DCSA 2VE1A 5H9QA 5FLJA 1BCXA 2GMMA 1XRUA 2VXJA 4MGIE 4I01A 5K7PA 4XXAA 5FK7A 1OFSA 1TNFA 2W52A 2B39A 3POSA 4YG0A 1G9CA 3E6DA 3AMQA 1W2AX 4L11A 4UBHA 5FYYA 4B8EA 4DRRA 1ZBA1 2W92A 1NA1A 2RDNA 3OPZA 2A6YA 1YIPA 2HWE1 4H7MA 2WZ8A 4RQPA 4CCNA 4LBOA 3HIFA 1S4CA 1LOGA 4N7IA 4QKBA 1K12A 4R9AA 1DZQA 1IHMA 2UYBA 1BBT1 2WO3A 3CJIA 4W6XA 1W6QA 2WNUA 3IIAA 3T08A 3WV6A 5FYVA 1YFWA 4HSLA 3H7YA 4NRQA 5A7QA 4XJUA 5FJHA 1JU3A 2ADEA 4CYDA 5CAZA 2FDGA 1PX4A 3C7EA 2OA2A 3K51A 4KG8A 1COV1 1JTZX 2J42A 3ZDVA 4DNYA 1HXS1 2AGSA 1MZ5A 2HWB3 3RSJA 2YV8A 1N3OA 2Y6LA 3O0WA 3SEPA 3P1IA 1CAVB 3BTYA 3T0DA 1AX1A 3I2FA 1F31A 4M0HA 2XLGA 2XWBB 1MEC2 1VBB3 3BALA 4XDOA 4K6BA 1W9YA 3BTZA 3J4UH 1QJX2 1YYNA 3U1XA 4LITA 4MADA 5CU1A 2P3IA 1CR7A 5FJKA 5A80A 5A7SA 1AL22 1KS4A 3LA7A 4QXCA 1WLDA 1VALA 3AJYA 1MQTC 4YSFA 2JWPA 1EV13 4XZUG 5C4WB 1J58A 1GOGA 2BOJA 4AEMA 1QJU3 3W5MA 2Y60A 1AR93 4MZUA 1NQJA 1P8JA 3O0XA 4RD7A 4XCAA 3HOBA 2K9ZA 2VR4A 3HQRA 3HR9A 4WV8A 3LDKA 5I0RA 4DXRA 1V6JA 1HQNA 1BKZA 2BJSA 3ETPA 1VB4A 2VY0A 4ARYA 1DGWX 4IGQA 4GD4A 1UIKA 1W0OA 3AK0A 2VM9A 2RDSA 1DLCA 4JVAA 4IEUA 4F83A 5JOXA 1QEXA 5G04L 2TBVA 5C71A 3VUOA 4Q0VA 4H55A 4U2AA 1UOFA 1O7FA 5A6ZA 1MR5A 2CWMA 3T4VA 1EPWA 2J1EA 2BVBA 1IQAA 2NYYA 4P9IA 1MEC1 1QY4A 4LHNA 1HB1A 1VP6A 5LA9A 1QJX1 1D4M2 2R7EB 4MG2A 5LASA 3CZJA 1UU5A 2VOVA 4XFHA 1AL21 2K2SA 2FZ1A 3BU0A 4J1WA 4FI9A 4JC1A 4DO0A 5KHKA 4LT5A 4JKLA 2IUWA 4XUNA 3ZFEC 3WY6A 3AVSA 5C3RA 5JXIA 1OVSA 4HMZA 4IV1C 4JGYA 1RUI3 2X5IC 5BNOC 1ZRFA 3AKPA 4OULA 2Y34A 4Z07A 3RYRA 3ZR5A 5A3PA 1JZ8A 2W08A 1RTVA 2XUMA 4XFGA 4YGDA 1XB9A 4YW3A 4HFSA 5EP9A 2GN7A 2P6CA 2E51A 1JH5A 3FX3A 1MQTA 2RHPA 3ZOIA 1LULA 2WWSA 2R072 1R1A2 1JZ4A 2WAAA 4ORFA 4XUTA 2X29A 2CTVA 4COZA 3W58A 4CEWC 2G4IA 4MSVA 2NLRA 4XVHA 4CU9A 1Q8SA 4XACA 1NLQA 2YUEA 2BUKA 2QQLA 4K21A 5LBFA 1PHMA 2E9QA 1D4M1 2KXLA 4N9HA 4NHKA 3CIHA 1OD5A 1RMU2 1GOFA 3I2HA 5IVYA 4P9YA 4D7TA 2JG9B 5DPNA 5IW0A 4JKMA 1WW7A 3VKMA 5JZGC 4Q5OA 1NYWA 3P3NA 2B42B 1GYKA 4ARXA 5GLVA 4XABA 1YC61 5IFTA 4GJZA 5F5AA 3WNPA 1D2QA 1N3PA 3N4MA 5C9AB 4LHSA 4LO8A 3MF6A 4FPJA 1AR82 3AX4A 2J1UA 3E1F1 2VD7A 1J3PA 3N7LA 2FZ2A 2WINB 3KCYA 3LOBA 3GZUC 5JIAA 2LRPA 4AYUA 2CGNA 1UAIA 5IK8A 2JE9A 4R9CA 5H9RA 1OA3A 3RZHA 1N3QA 1YLLA 2R071 1R1A1 1B35B 5BV6A 1PNFA 1RUJ2 4WM7B 4PIZA 4IV1A 1J59A 2X5IA 5JMCA 3CMGA 3WW1A 1OF4A 4UF0B 2E53A 4UBGA 2YBKA 2GC0A 3BU7A 2QBXA 3DV8A 2Y38A 4NVPA 1LOFC 4UAPA 4UFJA 3RQ0A 4Y33A 1W6PB 4AEDC 3QH6A 3IZOA 1DLLA 2EIDA 4OQ9A 2DUOA 3KSCA 4CE8A 4EJRA 5ERLA 1UOBA 1RMU1 2A3XA 4CDXB 3RS6A 3A0NA 2EIEA 2ZX4A 1LU2A 3LIHA 2GC1A 3K3OA 4O7XA 4FFIA 3LGRA 2HEYF 4XQDA 1VPHA 4IV3C 4RS5A 4QQ2A 4HT1T 1WCDJ 2CDOA 4GMP0 1RUH3 2HWC1 3J8F2 4AGRA 5FXXA 2QQNA 4K7JA 2TNFA 5EZWA 4AEKA 4LHKA 4YZ1A 1X8MA 4AI2A 1GZWA 1ZZ6A 4EWEA 2G9FA 1V6OA 4QB6A 1YUDA 3WSOA 2UWBA 5EJ1B 3IAQA 3TAYA 2QQUA 3LSDA 4BPZA 3VLBB 2CY6A 2Y6GA 3HNYM 4GAZA 4TWTA 2X8KA 3AYDA 4KWLA 1SQ4A 1DG6A 3Q8CA 4HOOA 3ZVXA 1FPN2 3BODA 1XQNA 4LUKA 1COV3 4Q0QA 1G9FA 1JUIA 2GAUA 1K5JA 3C7GA 4GWMA 1FNYA 4JHTA 4XF9A 3HPNA 3NQHA 1W0NA 3OGJA 3UJOA 1Z7S3 5FYTA 2AREA 5A3WA 1R093 3MW3A 4K1ZA 1MZFA 3GNEA 3O14A 4MX3A 5L9VA 2WSUA 5GLTA 1WCUA 3U4XA 3QCWA 3R4UA 1UZZA 1W39A 3VDCA 4IESA 4AF9A 5HXMA 2D97A 2P5BA 4BLIA 3WDWA 3MYXA 5FZOA 2YPDA 1ENRA 1Z78A 1LOFA 2DU0A 2VJXA 3KD4A 4K1YA 3VBOB 3POEA 4QAWA 2RM22 3HN1A 3J8F1 3JZVA 3RI9A 2QQKA 5FO7B 4N53B 4QX8A 2FDHA 2Q0AA 4ZXEA 2IXJA 3D0JA 3I4IA 4Z1VA 4D69A 1RXFA 4U36A 4XOGA 5J36A 5JIUA 3K77A 4DZGA 5A70A 1F35A 3D4KA 5KC5A 4AL9A 5LK7B 4HZFA 2VOKA 5FMOL 4IV3A 1UMIA 3POIA 5JPNB 3C7OA 3I59A 2OT7A 4GMP1 4HVQA 3ACGA 4FPLA 4B4QA 3AP5A 1FPN1 2BPA2 1C4RA 2HKXA 4PCRA 5CNAA 1KDKA 2BGPA 4F7ZA 1Y7BA 4W6WA 1VAVA 1DGWA 1UKGA 3FC0A 1AXZA 2I2SA 3ACIA 5JVVA 1NE6A 2BU9A 4OHXA 3WVJA 4Z2WA 3S0MA 1S0EA 1W9FA 5IK5A 1MEC3 5JSOA 3E97A 3M70A 2IC1A 3OYWA 1NCRA 5L9BA 3V64A 4QHOA 4W6YA 1PGSA 1X7NA 4UXAA 3RVHA 3N9OA 4DXZA 3VBHC 4F3JA 4EROA 2R062 2WFF2 4XUOA 3L2YA 2VU9A 2KM2A 1UQXA 2VUAA 3CF6E 2D6MA 5L73A 1CPMA 2WA4A 1VRH2 1R1ZA 3WG4A 4Z8BA 2VNVA 5FP4A 2RM21 2O8OA 5T5JA 2GMEA 1R64A 2HH9A 4ZXKA 5GZCA 4XZPA 3I2IA 3LA3A 3Q9OA 1F15A 2VTFA 2P4EA 4XMAA 4Y5Z0 1HV1A 1SLCA 3MEPA 1XNKA 1LHVA 2VNRA 2E7TA 2Q1ZB 4S2DA 2EXIA 5DXDA 3SKJE 4AFBA 2ZGLA 2H0BA 1J3QA 1MS5A 1RIRA 4AHYA 1MACA 3K3NA 1T2XA 5TSWA 4A7KA 2LUWA 2LTNA 2RMU1 2DYCA 1QIQA 1MZEA 3ACHA 4QM8A 1W6MA 5JWPA 3N7MA 1DFQA 5CB7A 2J1SA 5BPXA 4AAXA 2QZ3A 1EAH2 1HB4A 2IVIB 4AI9A 1JS9A 5FO9B 4FTEA 4CDWB 4CP9B 2WLPA 2DWRA 3AMHA 5LATA 2R061 3ZYFA 2WFF1 1QJY3 2O0OA 4YZ2A 4XJ9A 1YO8A 4XQ4A 1O8SA 1OURA 1WLCA 1ZA7A 2BYVE 2CGPA 2XONA 4LBNA 5FPAA 1VRH1 4E9KA 1QJZA 3HT2A 5F1RA 3TEWA 3CU7A 3O1TA 3AL5A 3NNFA 3FMGA 2OZJA 3OGVA 3IPVA 4M3CE 1D7PM 4L92A 1OHFA 2HEVF 2W91A 2XG3A 1V6KA 3I8TA 1S2BA 5DABA 4EE2A 3VBHA 5FUIA 2FCUA 1F9KA 3KQ4B 2JE7A 2Q8EA 1LRHA 2DCTA 3DGTA 5LY1A 2XDVA 2WO1A 2VBPA 3POGA 2XH6A 4IUGA 2C9AA 2JDMA 2QJVA 1AX2A 3ACFA 4KBBA 4LA3A 4R52A 4TYSA 3ZPYA 2HLEA 3GCXA 2BNNA 2FBEA 5EYXA 1VRBA 2WYFA 2WZR2 3LE0A 4LOTA 2C24A 1S0CA 4AG4A 4OI1A 1UXXX 3JBG2 1H9PA 3PMEA 4LA2A 4XJWA 2E31A 3TWIA 1PO13 3GBGA 4JGZB 4UWDA 5GZEA 1EAH1 3ZXGA 1UIJA 3LCPA 4EYUA 1I5ZA 1ENSA 1XBFA 4P5YA 1X9PA 2ZX0A 1VBD2 4BB3A 5C33A 3I3EA 1HKDA 2D44A 2N7GA 5E6HA 1PGL2 2Q8DA 1UL9A 2VO5A 5L7OB 2XJQA 5C4WC 4E2QA 2Q1FA 3GXUA 3ZKYA 4IE4A 2EVXA 4AK3A 2DVGA 1TMF3 1PO22 2E26A 1AR83 2RDRA 3JU9A 4KU8A 4LR4A 3OD0A 3W59A 1CONA 2QCSB 4LBQB 3LEMA 4JHZA 2GNBA 3MGUA 4RHV2 4XEZA 4GB31 4OYUA 2QQMA 2A5ZA 2JDKA 2F4LA 1SBEA 4FPHA 2NPIA 3FWEA 1NZIA 2TUNA 2W9XA 4YW7A 5DMYA 3B9IA 4XAAA 4AVVA 3KGZA 1DGLA 1RUJ3 3RMYA 5F3CA 2WZR1 3ZMOA 4N43B 4XF0A 1W2UA 2W1WA 4ISQA 3WQ1A 2C9KA 2DCZA 3JBG1 1YEWA 4XCBA 2BRTA 4K40A 2V09A 3IT8A 4PDWB 5GZGA 1HB3A 2V72A 3FBYA 5KR7A 4WZFA 5JI7A 2VQTA 1VBD1 2CHHA 4IEXA 4AOCA 5JSPA 1PGL1 3UJQA 3PL0A 2XJTA 4A6OA 5JOYA 3LQCA 2C4XA 1WMFA 2XPJA 3QH7A 4AI3A 4OI0A 1RITA 2IWGB 3APBA 2P37A 3H1MA 2VZRA 2XJSA 1CAVA 1LHOA 3ZM8A 4CUGA 3NJYA 4AQTA 1WA6X 1RJ7A 4KWJA 1EV12 1YNAA 3HVDA 3MW2A 3B02A 2WAOA 5EJZB 5B4XA 5JAXA 4C8DA 1G9DA 4P5HA 3PMSA 1AR92 1YFYA 2P17A 2P34A 4NPRA 5FUNA 4KGQA 4NIDA 2VVDA 1RUF3 1WLTA 2VW1A 2D43A 5C4WA 2XMLA 5LBEA 1UMHA 4BMBA 4NO4A 3RWKX 4D0QA 2DTWA 3OGRA 2A7AA 3AP7A 4OI4A 4ATFA 4YM2A 2O14A 1AX0A 1KS5A 1RHI2 4FT8A 4PBPA 3KWVA 1UYPA 5FZ9A 1GWLA 4LBQD 3ZYIB 1AJKA 1QF3A 1K5MB 3A21A 4QX5A 4YVWB 5HV4A 5JUVA 4ZPIA 3RDIA 4E2SA 4O61A 4BA6A 1G6NA 4CCEA 3PNAA 2W5FA 3I2KA 2AEZA 1OKQA 1LB2A 1BVP1 4XFAA 5DG1A 3H8RA 3W5NA 1W05A 3ATGA 2W3JA 1EPZA 3AFGA 4NRMA 3BTXA 5CKMA 2HWB1 2ZBJA 5HPOA 4FTSA 2JG9C 4OMCA 1VBB1 3AYEA 3EMRA 4KGGA 2QQWA 2VCAA 1LR5A 2RR13 1ULPA 4W8JA 1OT5A 3VBUB 2DF7A 2JENA 3FUQA 1E5IA 3W20A 5C9AC 5FO8B 2XVGA 3HBZA 1SPPB 1XE7A 3PURA 3WNLA 4CA9A 3UETA 1FAYA 1EV11 2R1DA 5FMDA 1FATA 3B00A 5FBJA 1HRI3 1AR91 1UOGA 2Z79A 3R0RA 4N9IA 1JZ3A 4AHWA 4MGQA 3CO2A 1RUI2 5T5OA 4YM3A 4AVCA 1QMJA 5FZ6A 4UOJA 1B35C 1KJLA 1EP0A 4WM7C 2FDFA 1S0GA 4EN6B 4Y4YA 4DMIA 3OJBA 4QM9A 4W50A 5FV3A 2KA3A 1E5SA 2QDRA 3R6SA 1H4GA 4QX2A 2D3PA 1OQEA 1U5IA 3I2JA 3ROUA 1TVGA 2WUHA 5EYYA 2PELA 1HRV3 5LA1A 2A6VA 3ZYBA 4JV4A 3RYKA 4B1MA 3J9SA 4CZSA 1PZ8A 5HV0A 4CDXC 1N1VA 3ME2A 4NPLA 2JDHA 1E5HA 1WMDA 3CQOA 4XIKA 3U14A 3VZJA 1GP4A 1MVEA 1YRZA 2EXKA 1MS8A 3BIWE 1S0IA 1OPMA 4AWDA 1LU1A 5KWRA 2LROA 1JHJA 3SCHA 5F8PA 2GU9A 1VAKA 3NNJA 3KT7A 3H1WA 5T5LA 3RZLA 1AL0G 2XL9A 1G8WA 1Q8VA 1VRH3 3GBFA 5DDJ3 1PIV3 5FY5A 2WKKA 3NKTA 2BDRA 3JUUA 4B29A 4GALA 3VL8A 2JKBA 4G3YC 4LIUA 2JG9A 4L0PA 2DVFA 1DF0A 4YGCA 5FPLA 2V4AA 3CHXA 3NV1A 2FDIA 3H3ZA 2GC3A 2HWF2 1KEXA 1RUI1 2DU1A 5D1IA 5I8SA 2HEWF 4IETA 4JDOA 1X9TA 2C0ZA 4TXWA 4YFZA 2D93A 5LB6A 5C9AA 4LK7A 1F2NA 1JYNA 3A23A 3PUAA 3CZUA 2DVDA 2PHTA 3DYPA 2JIGA 3A7QA 3DN7A 3HWJA 2XJVA 4NPMA 3S6PA 5IHRA 1WW6A 3LSEA 2FCVA 3OY8B 1RUNA 4HN1A 4BLJA 3DCQA 5E8AA 4COYA 1EY2A 1S0BA 4LO4B 1E5RA 2VGDA 1LOCA 5BNNB 3MZHA 1EAH3 1SZBA 4RN5A 1B35A 4WM7A 1JYIA 1PZ7A 1AHSA 3N7KA 3POFA 4NJ4A 4NHMA 1H1IA 2VZUA 2R30A 3H7JA 4UF0A 3AB0A 1DQ2A 3NAPA 1OLME 1W6PA 1SLLA 4WVMB 1JZ7A 3HT1A 3VBOC 3VKNA 2W0XA 2ES3A 2MEV2 1ZYBA 4QX0A 3OEAA 4N53C 3FL7A 4CDXA 4FTBA 3WDUA 1JUHA 2CWSA 2GALA 3RWNA 2A70A 1REFA 1QOTA 3RYPA 3O0VA 3THPA 2IZWA 5F5QA 4UFMA 5I93A 3BPSA 5KXCA 2EXHA 4P9LA 2ZZQA 2YGMA 4QDRA 4DB5A 1ALYA 3O1UA 5DZEA 5C70A 5K0UB 2ARBA 1CAWB 3WHTA 4B4PA 1PNGA 1OBNA 1YCIA 2I74A 3AZWA 5GLZA 2OYZA 3V56A 2GC2A 5F3EA 3RPQA 3CLPA 5KXDA 1Q3EA 2ZCWA 3LWCA 4BQ4A 2WNVB 4XBLA 4GQ7A 4EN7B 1HLCA 5DAVA 1C8NA 5JR2A 4MXWB 5L9RA 1Z7S2 5JMOA 2PFWA 1POV0 1R092 2FQPA 3AZZA 4H2AA 3MUY1 2XVKA 1LHNA 1S1AA 1UO9A 1STMA 3GZTB 1F4HA 3BVCA 4NN0A 2YDEA 3T2PA 1UN1A 2ZGPA 1PO23 4Q26A 3PDQA 3VDDB 3P3PA 2CYFA 2YFZA 4XILA 1CD3G 4RHV3 4XDQA 3ST7A 1XNAA 3W21A 1UYXA 1RUH1 1ZRRA 1TE1B 2JDPA 4N7UA 5CKQA 3THDA 3OD4A 5AFEA 2WNOA 1GZCA 3V0BB 3H8XA 3MIBA 4GKYA 4IE0A 2WZPP 4TTGA 4ZS2A 3VBOA 4HSJA 3LOIA 2EALA 5GLUA 4DRVA 1DQ0A 3UNPA 4HXCA 2YY1A 4LORA 1QHDA 4QDQA 3BOPA 2J1AA 3M4FA 4CUAA 5FP7A 2OPWA 3HAGA 1WZXA 3H9AA 3N9NA 4L8QA 3T4HB 3EYPA 2BVVA 1J1LA 1H2KA 1AXKA 2YB7A 4MGYE 3WP5A 4A44A 1W90A 3O1VA 1X50A 4CDWC 5DQ0A 2P3KA 2P6HA 1XSQA 3HEIA 4V2WA 1VMJA 2FDJA 4OHZA 3FFZA 1UY2A 3SCGA 1Z7S1 1R091 2PTMA 4ASLA 1YIFA 5E16A 1BQPA 1DHKB 1LENA 4IEWA 3DF0A 5CFCB 3ENRA 1GKBA 1W6NB 4QD2A 5A6QA 3N3HA 5CIRA 1W9TA 3IKWA 5KHHA 3NJVA 2D5HA 4YVSB 3OBAA 2YC4A 3K46A 2B45X 4JQTA 4QPIB 3FE5A 1MZ6A 1W8FA 1POV1 4NWVA 5FY9A 4FCAA 1S55A 5F2SA 5IAXA 4RFRB 3ZSJA 4KBZA 4NHLA 5A33B 1ENQA 5KBFA 2W2IA 3R05A 1RHI3 4LTAA 5JXJA 2V73A 2GH8A 2JB8A 1PX3A 2I07B 1SLAA 3AYCA 3OSDA 1AR73 5FZ4A 3ZXKA 2AZ5A 1ZBE3 3B93A 3BCWA 2XGXA 5IVFA 4I30A 4JGZC 3VGIA 3SH3A 2R0HA 1IOAA 2XKPA 1GSLA 3A0KA 3K4ZA 2R0FA 3ZN5A 4EZ4A 5I91A 3JCIA 1JBCA 1Q8PA 1ULEA 3B3QE 4BYYA 4A42A 1XYOA 1QNYA 2BQPA 2Q4SA 3M3IA 2WS92 3POJA 4XFBA 5DUVA 2XOMA 5FP9A 5L7OC 4HPKB 4AAPA 1BXHA 5EXOA 3DPRB 4CDQB 2ETEA 3FLTA 1GLHA 3FZ3A 1QJY2 3WUDA 3PU3A 4FXKB 3LZZA 4H3WA 4LPLA 2YC0A 5ABJB 4HN0A 3KHBA 2WWUA 4CDWA 2VZOA 4Y26A 2TEPA 5J96B 3AM2A 5JCTA 2DBNA 1BLZA 5A7PA 1HN0A 3F2ZA 3MV01 2PN5A 1DQ1A 4TSVA 3TN92 2C1FA 2BWAA 2BEOA 1UOJA 3FLRA 3OGGA 1LHWA 1M06G 2C26A 4QU1A 2DCYA 3LEKA 5D8AB 4XBQA 3PUQA 4N43C 5FY4A 4BQ1A 5CA6A 4Y5SA 3ES4A 4MYEA 4WM8B 1UY3A 2I45A 2RG4A 1S2KA 2YG0A 3PVEA 4LIVA 5DAQA 4ZU5A 3I7DA 4PDWC 3WNXA 4D3WA 4DEVA 1DQ6A 1GUIA 4CCMA 5BNPB 4Q0PA 2D98A 3AZYA 3LEGA 1SMVA 4ZZ5A 3TRSB 1CQ9A 4AVBA 4RSUA 4PI2A 4R8HA 1X82A 1LOAA 4JRAA 1PO12 3I3DA 3U07A 3VDAA 5J3UA 1ND3B 1AYM3 1VAMA 1ZZ8A 1HJGA 1W3VA 1H9WA 1QJY1 3IDAA 4JGZA 3MI8A 3LFIA 1KFXL 1US2A 4QQPA 3AVRA 4HONA 5EJ3A 4CXYA 3KT4A 4G4FA 5FZFA 3M3QA 3AMMA 4LKFA 3UT0A 1IQDC 5FWJA 1LODA 4UW3A 4P9GA 2VVEA 2CSGA 3USSA 4ASMB 2HWF3 5L7OA 1TMF2 1W2NA 3N9LA 5M0TA 3TOJA 2YYOA 5DUXA 5A1FA 3TYJA 3ZDSA 1W9WA 2W39A 4QQOA 1K5MC 2OVUA 4YVWC 1H4HA 1VBE3 4YGBA 4RR3B 4LBQA 5IWFA 3ZFEA 1CX1A 1W99A 3C7FA 1OQ1A 2PQSA 1IPKA 3WD5A 1POQA 1VBA3 1YWKA 3U4SA 5C7GA 3RFRA 4FBFA 5HBAA 3J7NA 2AENA 5BNOA 2GNDA 2XLAA 4S2HA 1U5YA 3X29B 1PK6B 4Q4V3 4YG6A 1GQHA 1PO11 3EXUA 2GZWA 3E5XA 4Q8KA 3VKOA 5CZKA 3AP6A 5EPAA 3AZVA 1RB8G 1UZ0A 5FYMA 3VBUC 2AR6A 4GH4B 3BKZA 4JRLA 1FX5A 4GWJA 2RJ2A 4PDWA 4MO3M 5LBBA 1ZX5A 4AFAA 2MEV3 4IEZA 5F6KA 4O9EA 2Z42A 3AKQA 3NO8A 4CEWA 3J7HA 3ACLA 3HMYA 3MV11 4MOAA 4OMDA 4UFIA 2DUQA 2J22A 1GR3A 4BWOA 1TMF1 2NM1A 3V65A 1AR81 4Q4Y2 4AFMA 1X8EA 4CXXA 4QB2A 2CNAA 1XU2A 1XU1A 3B9CA 4IQPA 4LBLA 3BB6A 3K4DA 2YC2A 2VECA 5I0SA 2SBAA 1H0BA 1AXYA 4LBJA 2ENRA 1D4VB 1REEA 5JZGA 1RUF2 2ERFA 3PTRB 5L36A 3EQEA 4NMIA 2EAKA 3DL3A 2XKOA 5KHIA 1RUJ1 2AC1A 2VCMA 2MNGA 2ZX1A 4HVOA 4NE9A 4ONUA 5FY1A 5HI0A 3C3VA 1TG7A 2AEYA 3NJXA 1JYXA 4RFT0 4UFKA 3WDYA 5J09A 2E7QA 4QPYA 1UZYA 4RGAA 4ASKA 3LDBA 1BEV3 4QXKA 3J7LA 3TEZA 1H2NA 2ZHMA 1UKRA 2ZMNA 3I54A 3QACA 5HCFA 3D5OA 3ZSMA 4B4RA 4CPBD 1JYCA 4EN8B 4LBKA 3A22A 3HN3A 2Z4FA 1ULGA 4OUMA 3ZR6A 3NWKA 5F32A 3WW4A 3UKTA 2RR12 5B2GB 3P5BA 3UKVA 2JDUA 4NIIA 5F7UA 3I49A 3PJYA 4I0WB 5E1RA 4D6QA 4UW6A 4AEDA 4Q4Y1 5FZ0A 5HXVA 5DG2A 4D7SA 2X53S 1POV3 1DYPA 4KWUA 5FUPA 5FZ8A 3PTYA 1HRI2 1NG0A 1SPPA 2JG8B 1M4WA 4AE2A 4LULA 2WRAA 2KR2A 3J26N 1RUF1 3KGLA 4AHZA 3UGHA 2ZEWA 5F37A 3OCPA 2PYTA 4OVEA 5FPUA 2ZZJA 3WQ0A 4RGGA 5FPVA 5ACA2 4LKDA 4CU6A 5BNNC 5CEHA 1GFF2 5LEJA 3ZX7A 3KS7A 1O91A 3TBDA 4XHXA 2D6PA 5E89A 4AFDA 1CAUB 4PQ9A 4JX0A 1HRV2 4GIQA 3UGGA 4LLFA 2X10A 2A3WA 3N35A 1IGOA 1AR63 3JQXA 1JXNA 4Y5TA 3CJIB 3VD5A 3ZLIA 1QWRA 1O3TA 1CWPA 3HNMA 3WLUA 3DXUA 4RL7A 4FP2A 5HCHA 2BP6A 2Q1MA 3VN4A 2Y26A 1L7RA 2WABA 3PUSA 1N1TA 1NOVA 2RR11 4AVSA 1JOJA 1KFUL 1HV0A 2UY8A 3WEZA 3ZYGA 3S5AA 3WCRA 1QKQA 1YQ2A 5DDJ2 5A6YA 1PIV2 4QXHA 3ZXEA 1XXNA 4HBNA 5FXWA 3OPWA 5GM0A 5DZGA 1JOBA 4I3GA 5FXVA 4IERA 3EO6A 1HRI1 2CAUA 2DCKA 2VUCA 5LBCA 3BOWA 5FZLA 1W03A 1UY1A 5FR3A 2Y33A 5K0UC 4FAHA 5FZ7A 2VMFA 3WR0A 2Q30A 3VDBA 4AFCA 4DS0A 1V9U2 2J1TA 4JKKA 1QQP3 2EXJA 4YZ5A 5ACA1 4Q0UA 2J1VA 2WNVC 2BGOA 1PVXA 3OB8A 3JQWA 2OUHA 4ZHNA 3E6CC 4OHYA 1SBDA 2VCBA 4AVTA 2E63A 3SCFA 1GBGA 2BOIA 2B46X 3B01A 3K2OA 4XF4A 1HRV1 1LHUA 3WQ7A 2UWAA 1PVC2 3AL6A 2WS93 1UU6A 3CNAA 1J84A 4CXWA 4V2VA 2VQUA 2PMWB 3VZMA 4R4ZA 2RJLA 2O8QA 4TLGA 2UYAA 3OY8A 3OF1A 5FZGA 3G6JB 2ZEXA 4BIFA 5ISLA 5A1LA 2NN8A 3SQOA 2JJ6A 3VDDC 5BNNA 1NZCA 1KRIA 2G9GA 2XR4A 4BQ3A 4D7YA 1H2LA 1XNCA 3L2HA 5DDJ1 1PIV1 1V6NA 3KB5A 4UW4A 3E5QA 1GNYA 2JEMA 2GH2A 4D6SA 4C0HA 4ATEA 2X05A 1CIWA 2OQ7A 4WVMA 4PT6A 2DFCA 3AMPA 4FFHA 3Q8EA 3TN93 2L9LA 1TEIA 4Y22B 1AUYA 1J83A 2XWJB 1GMMA 1XNBA 2YU2A 3MHZA 3MFCA 1O4TA 1AYN3 3NNMA 1W28A 3AJZA 3POYA 3PIGA 4NAOA 4FOVA 4E4ZA 3WDVA 1GP6A 4Y20A 2JD9A 4FPCA 2W1QA 3ZSEA 2GNMA 3USUB 4JGYB 3ZKUA 3KCCA 3E6BA 3VD9A 1H2MA 2BERA 4P00B 5LK5A 3WNNA 3LFMA 5KXEA 1PVC1 4IW3A 1AJOA 2OX0A 5K0UA 3TB0A 1VMHA 1UMZA 1CAWA 5FYIA 3WF2A 1JYTA 1C1LA 3U78A 3MDPA 4JTOA 2VBDA 1D2SA 2NMNA 1UX6A 1XYNA 5CFCC 3KF3A 4MGSA 4JZRA 1OD3A 2QZ2A 3RI8A 1H6YA 1C1FA 4ISRA 5C3OA 1U12A 1O8PA 4LO6B 3SISA 4CEYB 2GMPA 1LGCA 4MGZE 1ZREA 3VD4A 2PQQA 4LKSA 1CZVA 3OPTA 2PHDA 5FZHA 1QJEA 5H9PA 3LB9A 2PHXA 3NMBA 3RRDA 4YVSC 1GICA 4QPIC 4I3PA 3T2TA 2JD4A 3KV4A 5A32B 4MXWA 2IFRA 4BQ2A 5C5TA 2RS53 4PI0A 5LRRA 3IM0A 4OFGA 3O1OA 3P6BA 4JCKA 4LO5B 2PAEA 4LXLA 5C3PA 2ZGKA 4LNVA 5GKAC 5FK8A 3T0AA 3O1RA 1VMFA 1RXGA 1CIYA 4QX3A 3VDDA 2WDBA 3SEEA 4PJYA 5HCAA 2P2KA 1LECA 1LNSA 1RINA 4SLIA 5F39A 1RC6A 3IWZA 3VHNA 4CDUB 3O1PA 3V0BA 2BNOA 1BK0A 2PHUA 3WT3A 2CDPA 2PHRA 2AYHA 2P3YA 5IUQA 5IYYA 4IDZA 4XFIA 1ODNA 1JW6A 1LJ7A 3WG3A 3WP6A 4ES9A 4DINB 5T5PA 2WO7A 1SG3A 2XL7A 5A6XA 1CVNA 1QOSA 3DPRC 4AI8A 4CDQC 1XNTA 5A3MA 5A1AA 2RDQA 2B9UA 1CGPA 1SDDB 2UU8A 3CDZB 5F6LB 5ABJC 3ZN4A 5LRSA 3PUHA 1ONAA 2QQJA 5DUWA 2C5DA 3ZMNA 1PO21 4Q4Y3 3N9QA 4OZXA 1ULDA 5J7MA 3LAGA 5CFCA 3M3OA 4RHV1 1CX4A 2UY9A 4LJHA 5D8AC 1W6NA 5FP8A 5EV7A 4TZDA 2RS13 4M4RA 4MXVA 4XE9A 4WM8C 4YW4A 4DPNA 2WC2A 5FKBA 1Q43A 2WBKA 4X6QB 1JI6A 3O12A 1V6MA 4QPIA 3VBFB 4Q4W3 5BNPC 4C1XA 2PLV3 4RS5B 5F3IA 2RJKA 1WUVA 4DXTA 3IB3A 2D3RA 2BGCA 5HCBA 1AR72 1G86A 2LS6A 4PQQA 5A33A 1XPWA 1ZBE2 3WCSA 2WL1A 4QWNA 4BXSV 4IGOA 1WMXA 4XETA 4CP0A 3PVOA 1ND3C 4COUA 2Z2SB 4DOUA 1PMJX 5F5IA 3VBRB 4YM0A 5FZ3A 3GM8A 5LZ6A 3RZMA 3THTA 2Q8OA 4LMFA 2ARXA 2E32A 4KU7A 5FZ1A 4MUVA 1W8UA 5K4LA 1X36A 4P14A 4JDMA 2XHNA 4MVTA 1L7QA 1S0DA 1DU3D 4CCJA 3V0AB 2ZGSA 5EFUA 3ZFFB 1C8M2 3DYOA 4B3NA 1J3RA 1RUD2 3VKFC 2HJIA 4HPKA 3H3UA 1LEMA 1YQCA 4IEPA 2WFPA 4CDQA 2VZTA 3I3MA 5JI9A 4WBBA 1OLRA 1GZTA 2VCCA 4LK6A 2DVBA 4NRPA 1RUC3 5ABJA 4RR3C 2W94A 1T6BX 3POBA 5ANQA 4BIOA 4OUSA 5IAVA 1OF3A 1W0PA 1HIXA 1YQ6A 3IBMA 3PUIA 1RHI1 1BK1A 4Y24A 1VJ2A 2RE9A 1OPOA 2PHLA 4SBVA 3GHMA 5ACA3 4M3CB 1PK6C 1AR71 1ZBE1 4HKLA 2E6VA 4I02A 1YJLA 4YARA 3ILRA 5D8AA 4K9SA 2MHFA 1YQ5A 3MBWA 3MIDA 4NIAA 1URXA 4Y1XA 4GH4C 4WM8A 3SC7X 3WG2A 3AMNA 4BCUA 3O5SA 1O6UA 4CRQA 5JDBA 3U75A 3MPBA 1W8HA 4MLOA 3GHNA 3M3CA 5BNPA 2K46A 1W8OA 2ZAHA 5FQ0B 1WCQA 3WW3A 3ZXJA 4PIYA 2VPVA 3ABZA 2Z69A 1AYM2 4GJYA 1G9BA 3C2UA 1C8M1 1RUD1 3M2MA 4PLMA 3GF6A 3S7EA 1OOPB 4QGMA 3WDXA 4YGEA 3T2OA 1ND3A 5EWSA 3WXPA 1I1EA 2EIGA 3AKSA 5LCWL 4ZU4A 1F4AA 3AC0A 3NRUA 3AP4A 4E4DX 5FYZA 3OGSA 4XFCA 4YWAA 4A4AA 1NCQB 4B7EA 4QGLA 4LQRA 3VBSB 2VMGA 4URTA 4JQRA 2JX9A 2V5DA 5FBZA 4P9WA 3DUIA 1V9U3 4URAA 1QGLA 1JZ5A 3GJAA 1JYVA 5CADA 1KJRA 5CG8A 1VBE2 1YI7A 3AZXA 4O65A 5BYNA 4LLOA 4QKDA 1QJFA 1ULFA 1VBA2 2D6KA 1OUSA 4LO7A 4S2GA 1ENXA 3GALA 4Z92B 4FP3A 3BPZA 1PVC3 2BWCA 4RR3A 2R32A 3LIGA 2VG9A 5AFBA 3TEXA 5T50A 2ZMLA 2ZEZA 4Q4V2 1LKNA 3GCWA 4GULA 4LEJA 4CPBA 2Y6KA 2ZACA 4YW6A 1AYM1 1GP5A 1PK6A 3O7OA 4AHXA 5J48A 2W47A 2WLQA 2DV9A 4W4ZA 3ZN6B 4UT5A 1ST8A 3NV2A 3OEBA 4MGTA 3MO4A 4XXPA 5FPZA 5FXZA 2R1BA 1O3QA 4L2NA 4YW2A 5FY8A 5B4NA 3I97A 4GH4A 3WF0A 3URFA 4X6RB 5J1XA 1WMEA 2JG8C 2D7FA 2VNOA 4AQSA 2ET7A 1QXJA 1LTEA 1UY0A 2HWF1 3N9MA 4AGVA 1N1YA 1YHFA 2K0GA 4DFSA 5C3QA 3MIHA 4QT6A 4NHXA 1Y4WA 1LOBA 3MLJA 2BNMA 4YZ4A 5IATA 4B7KA 4HK8A 1BJQA 1WCSA 2Y64A 1F5JA 3S7IA 5FYUA 3F95A 5CFDB 3RG0A 1VBE1 1QH6A 3MF9A 3Q8BA 4CVUA 3A4UA 3WNKA 4EQVA 3FLPA 3VV1A 4BK5A 2YROA 4IXLA 1VBA1 1V6IA 2WN2A 3KF5A 1ASJ3 4Q2FA 4XUPA 3CJIC 4EWDA 4MHRA 1FMD2 3JD72 5T3NA 5A3TA 1K45A 4Q4V1 5FDBA 3UYJA 2WZEA 4A6SA 1BEV2 2WNEA 1ZZ9A 3D8CA 3H1YA 4KI5M 2VULA 4BDVB 2FCTA 4M0NA 3GYDA 1TME3 2LALA 3DKQA 4XDPA 2GSYA 3KVAA 3B7MA 3VD3A 4I2OA 1OI6A 5FREA 1APNA 1OA2A 2MEV1 2VW0A 4BQWA 2WQ8A 3BUCA 3H8OA 4XHBA 2PHWA 1BBT2 2WYSA 1L3JA 2AUYA 5F2WA 2LM3A 3CJXA 3DKWA 3LDRA 3R4SA 3IIIA 4XUQA 5BNQA 1JHNA 1IS6A 4GA9A 1PGW2 1LEDA 1UY4A 2ZGQA 1DGRN 4CU7A 3E5UA 4BM8A 3ASIA 3GGLA 1H1AA 1HDKA 1AF9A 1N47A 1WBLA 1NE4A 1H8VA 3I3QA 2YBPA 2ZGTA 1W6OB 3IDCB 2OPKA 2VUJA 4YG3A 3ZXDA 2R6QA 3Q8AA 1HQWA 2ORZA 2VMCA 4UFLA 2WQZC 1NXD1 2VZPA 1VE0A 4YLZA 2MPFA 1H1MA 4N53A 4QGNA 3PLQA 5I0TA 2JG8A 3VHRA 5AVPA 3S57A 2RS33 4QPWA 4QKFA 5T52A 2WIIB 3H3LA 5IJRA 1PM4A 1QDCA 1QH7A 1FMD1 3JD71 2HWD3 2F4PA 1JYWA 2D6OX 1BEV1 3H42B 3I2DA 4M3CF 2V5YA 4G9SB 1EYBA 5FMBA 2Y0IA 2A71A 5SV8A 3LD8A 1O3SA 2QQPA 1AR62 3SLIA 4XBNA 3Q8FA 4PBOA 1CAUA 4K8RB 1PMIA 4MHUA 2DUPA 3OBRA 1OC1A 3U10A 3KHCA 3KZ4C 4CU8A 3SMHA 3TEYA 3ZIWA 3SH4A 1US3A 2ZTNA 1VB2A 3K75B 3H0OA 1D0HA 1LGBA 1PGW1 4WZCA 1WCKA 4QQLA 4ET7A 3MLKA 2CGOA 1C28A 4Y1ZA 3U37A 4A2UA 4INDA 3ES1A 1YFUA 3N36A 3ILFA 4JGYC 4QPGB 3VL9A 5CYYA 2V4VA 3FFQA 4FPEA 3T1LA 1NX9A 3RGBA 1OLQA 1OUXA 2VMEA 5IK7A 2BZDA 2SLIA 4HKWA 1GWMA 4Q0SA 4QX1A 1QQP2 2NQYA 4FPOB 4KG0A 1H30A 2JICA 4KWKA 3WF3A 3B69A 2PHFA 5I8TA 5FY7A 2W1UA 3POWA 5DAPA 4AI1A 4CCKA 3H8UA 4A3XA 3WF1A 3ZIXA 4CEYC 1I3HA 1AR61 1CZTA 3M3EA 1R083 3UL2A 1F5FA 2JIJA 2OZ6A 4XJ8A 1RUG3 1VLNA 5GZDA 1C8M3 2IVJA 1RUD3 4LUMA 1JMUB 1I6XA 3LPGA 1IZ3A 3ZXFA 2IXCA 1MS3A 4FVVA 1H8TB 4JDNA 4E2GA 4K8FA 5AC92 4CP9A 4DY5A 1BHGA 1UWWA 2ZOEB 2DTYA 3OUHA 4KH9A 5C8CB 1K42A 3QD6A 1HW5A 2R043 1UW8A 4C90A 1L7LA 1NKGA 1XOYA 3EHKA 1QOOA 5FYCA 2WT1A 3HQXA 4YRDA 1A8MA 4AI0A 4M01A 4LE3A 3D82A 4YM1A 4FOYA 4OLLA 3AFKA 4CDUC 2A73B 3HD8B 3NV4A 1NAEA 2ZPXA 1AYN2 1VR3A 1CZSA 4A45A 3ZYRA 4M4PA 4K3UA 3ILNA 2XLFA 3KMHA 2UWCA 4Y22A 4BHPA 2E33A 1UYZA 1QQP1 1MS4A 1RVF2 1O5UA 2ZXQA 3WZ1A 2VOWA 2PAMA 4Q1RA 4QX7A 3WOGA 4LHLA 4XC9A 4CCDA 3HQUA 4OZOA 4HG6B 3NV3A 4LBMA 1CPNA 4GZ9A 4MV2A 1B09A 3USUA 4Y1YA 4AR2A 5GJ6A 2WS91 4LOSA 3KQRA 2NMOA 2YPJA 4EN9B 3TNQA 4Q4X2 1SEFA 2IXKA 1KDMA 1Q5OA 5FTTC 5T54A 1W3XA 2DURA 1Y43B 5FMCA 1HJFA 4KNCA 4D94A 3ZFGB 3VZLA 2YMZA 5AC91 2FMYA 1ZZCA 5DN2A 1WW5A 2W95A 2D5FA 4Y1UA 5A7WB 2JE8A 4AEJA 1YXWA 4CEYA 1IPSA 2RS52 4XFFA 3WNMA 1RUOA 3QLQA 2WT0A 3ZXLA 2CV6A 4OQ8A 3TN91 5APAA 3VBFC 2VUDA 5A32A 4RS5C 1UNBA 4R9DA 4FQ4A 1AYN1 3GDBA 1IG0A 2H6BA 4ZY9A 5IVCA 1QXPA 2HBTA 1I5PA 2XJUA 4OI2A 4TLFA 2YHJA 2ZABA 4QKNA 1RVF1 3OBTA 3ZYPA 5G05L 4FOQA 4PLNA 3RZGA 3S5QA 2XBO3 5DZFA 2C6SA 3VBRC 1RYYA 2DFBA 5FWEA 4QDSA 2FD8A 2A75A 3KM5A 1NT0A 2G9ZA 2XUEA 4I0AA 2W46A 3VKLA 4CDUA 4CUBA 3VZKA 5EQUA 5GZFA 3GBWA 2BBAA 2Y6JA 1VBC2 4GWIA 3ZFFC 2HWC2 3EJKA 4N43A 4Q4X1 1QXRA 1RUE3 5I0DA 2BV4A 2OXBA 4FQZA 4GXLA 2BW8A 4BE3A 4YNIA 4AW7A 2QNKA 2VZ3A 5D21A 4BK4A 2XB6C 5CG9A 2PXJA 1SFNA 2OUJA 5LW9A 2RS51 3ALQA 2E7AA 1FYUA 4HVRA 4FOWA 1GNHA 4XTPA 4E8CA 4OUEA 1XE0A 5FZIA 3NAPB 1DZTA
chains in the Genus database with same CATH topology
2IXIA 1MS9A 2BBVA 1DGRA 2RS12 1ND2B 3SHRA 2VVFA 4C91A 2Z5WA 2ZGMA 2ZHNA 2WA3A 3SITA 4FPKA 3H50A 4PF5A 2PLV2 4Q4W2 4L99A 5BY5A 1CAXB 2VH9A 1QDOA 5FPXA 4PLOA 2IXLA 3VBFA 4R9BA 1BZWA 1FMD3 3JD73 1C5IA 1UPSA 3PHMA 1ZBA3 4O9GA 4WVVA 1DQ5A 2VXRA 2HWE3 2GN3A 1VBC1 4HL0A 3U0ZA 1K5MA 5BXXA 3MPPG 4YVWA 3SH5A 1OOPC 1Q56A 2Y0OA 4L97A 1SLBA 1GV9A 1FT9A 3RNSA 3VBRA 4DY3A 1AVBA 4DQAA 5F9TA 1G7YA 1NCRC 1BBT3 2EA7A 2A6XA 1V6LA 1LOEA 3FJSA 3L9JT 4AQ6A 4IEYA 1A3KA 3NW4A 2XJRA 1NCQC 3V0AA 4OHWA 3VBSC 2ZGRA 1AZDA 4COWA 4HLTA 3ZFFA 5FLHA 5T55A 3VBUA 2XJPA 4H14A 1HXS3 3AKTA 4ZKTB 1V70A 5KXBA 2ZX3A 5FFOC 1RUC2 2RS11 3AP9A 3ZO0B 2ZHKA 3ZSKA 3M8LA 4MH0E 3NJZA 1O3RA 5FOBB 4Q4W1 5FCCA 4IL7A 2PLV1 1GANA 5J98B 4EV0A 1NA1B 1UF2C 4YW5A 1RGSA 4RQPB 3KLSA 2JDZA 1MS0A 2VMHA 2UURA 2ET1A 4IEVA 4JAAA 1MS1A 2BFUL 3MW4A 5C8WA 1O5LA 2IFWA 4AXOA 3B94A 4M3CA 3N7JA 3FHIB 1C57A 2QUOA 1W6QB 2WNUB 4HETA 1ZA4A 1KITA 3WX5A 1O4ZA 4BZ4A 4NR1A 1WD3A 2ATFA 1O4YA 1FOD2 4OHVA 2ZJCA 3SXWA 1REDA 3LKJA 5FQ0A 3WHUA 1FV3A 3WG1A 2R49A 5LEKA 2ZMKA 1Q8QA 2RMU2 2PA7A 2OIIA 3PJQA 1LGNA 1OOPA 1NLSA 3D0SA 1RUC1 5CFDC 1FV2A 1KQRA 3T1MA 4M00A 4K20A 1QJX3 5FLIA 4FSJA 1AL23 1NCQA 1PM7A 4Q29A 3VBSA 5A3LA 3VZOA 1FI2A 1ZZ7A 2H0VA 3WINE 4FXGB 2VOXA 1WA4A 3B5LB 4AGGA 4QU2A 4CP2A 3TNPB 1IKPA 1FOD1 5AVAA 3WDTA 1Q8OA 3ZYJB 5K8SA 2QE3A 1A78A 5AC93 3AXDA 2WT2A 3K48A 4IEOA 2IXHA 4GWNA 3R4DB 3M7AA 1XYPA 2R16A 3ZN6A 2OW4A 3VZNA 4W65A 2AH2A 1I9RA 1SBFA 4WVZA 1BYHA 1ZRDA 1D4M3 4XPVA 2D3SA 4Q8LA 1V9U1 2ZHLA 4FPYA 3JB4C 4QQHA 3QOPA 1QNWA 1RVF3 1LESA 3RJ2X 5C6CA 1LCLA 2ZX2A 1A6CA 1NY72 1Y9QA 2A6ZA 3EBRA 1IS4A 5CFDA 1ASJ2 1S0FA 3D6EA 5KHGA 3PVNA 2VMIA 1MQTB 2YXSA 1WLWA 4Q4X3 1WD4A 2QKDA 4GB32 2DCJA 1TME2 1OSGA 2WNVA 5GLWA 2R073 1R1A3 1QU0A 4P9JA 2NP0A 5JOZA 2FMDA 5J37A 3IDBB 4ITCA 3MIEA 4YZ3A 1GZ9A 2H6CA 5JSRA 1SLIA 4XF1A 4Q27A 1WBFA 4QPGC 4Z82A 4KQ7A 5BUVA 3WUCA 1SACA 4A7ZA 4PIXA 1YFXA 1RMU3 4COVA 4I0BA 3MLLA 1Z0HA 2JECA 4BMEA 3MICA 1NY71 1W6OA 4C1WA 2RS32 1ASJ1 1N1SA 3NSTA 4E4SA 3WW2A 1SCRA 1VIWB 4WVWA 1RL3A 2HWD2 4HANA 1VBC3 2NZ9A 3AKRA 2HWC3 3BTAA 4YYOA 4ZU7A 4YFWA 1SDWA 2EAAA 3ZFEB 2QVSB 4QHBA 2WSVA 1TME1 1ZRCA 4IV1B 1H8TC 4C0BA 2X5IB 5BNOB 5C8CC 2CAVA 2ZKNA 1UU4A 1RJ8A 3IMNA 4I09A 2D6LX 4R4XA 4QMAA 5FRAA 4F8AA 4J1XA 4XTMA 3QBQA 4Y1VA 4CTEA 1HQLA 1G9AA 3MIFA 1WGPA 1J1TA 2HWB2 4CEWB 4V1PA 5I8YA 1BMV2 4YVSA 1S0JA 4XJZA 4ES8A 1VBB2 1KD7A 1YJKA 1UPIA 2RS31 1JN2P 1FNZA 1ZVFA 4QPGA 1U5XA 5H9SA 3VHPA 1E57A 1GZWB 5JZGB 2HWD1 2EF6A 3J8F3 3LA2A 4BH9A 4EWAA 1QJU2 2P3JA 4HKOA 5IK4A 4XYXA 1R082 5CVRA 3ZFGC 1OA4A 1ZM1A 4RA0A 1RUG2 1DBNA 1DDLA 4GMP3 1UD1A 3MIGA 3DPRA 1FPN3 3UV9A 1KXGA 1SCSA 1F8VA 1V00A 2ZGNA 5GALA 3IDEA 2R042 4HK9A 4META 1CJDA 1H8TA 4MGKE 1BMV1 5C8CA 3WP4A 2F6BA 1MVQA 2ILMA 4XF3A 3RJRA 4P9XA 4AEDB 3AYAA 1FXZA 3ETQA 3KCXA 4XW3A 1GNZA 4XIOA 5I0UA 2RM23 1QJU1 5FOJB 3M1HA 5DUUA 2A6WA 4IV3B 4NOTA 4BOWA 3I59B 1R081 2VNGA 3IN9A 2B5HA 1FOD3 2GDFA 1RUG1 3PVBB 2HYKA 1XNDA 1OMIA 1NLRA 2YGLA 1GQGA 3NAPC 2A3YA 1IS3A 2RMU3 1U0AA 4A7YA 3OYWB 1NCRB 3AXEA 4YW1A 4EN0A 3FUOA 4JTNA 3SNMA 2R041 5FAXA 1ND2C 4X8PA 3ZFGA 1NXMA 2WQ4A 2XHKA 4XQWA 4E27A 3UK9A 1YI9A 2BFUS 2R063 4XMIA 2WFF3 4LE4A 2O1QA 5JR7B 2WJSA 2YZ4A 2BTVC 4FPGA 1OQDA 2B8MA 3INAA 3ZXAC 1C5HA 1IS5A 2XBO2 1TQ5A 4XJAA 2VQAA 3U11A 5FMOS 1OFNA 5SV5A 3G7DA 4N90A 4S2FA 2ZKLA 3CEWA 1U5ZA 1SFYA 1Y3TA 2W68A 4IEQA 1BVVA 1RUE2 1ULCA 3FBMA 4AVAA 1ZZBA 1CJPA 1W6MB 1CESA 3KT1A 3NVCA 3WP3A 3ECQA 1WW4A 1T6GC 2GNTA 5JLVA 4H7LA 1DZRA 4L9BA 1D0GA 2ZA9A 4KL1A 3OTFA 3UKNA 5L19A 3RZZA 4FAGA 2JXAA 2D6NA 4GKXA 2Q5TA 2ZAAA 2FHRA 1IKQA 1NA1C 4FO9A 4RQPC 1XE8A 2CL2A 3ELNA 1DYKA 1X33A 1UCXA 1CN1A 4NWWA 3IPVB 5CBLA 1ND2A 2XBO1 2VQ0A 4J6GA 3VBHB 1A8DA 3JB8A 3NKGA 2WNUC 1PZ9A 3NL1A 5K9YA 1CAXA 4Y20B 1ZBA2 2DVAA 5KHJA 2HWE2 5JPMB 1RUH2 4GB33 1DQ4A 4Q1PA 3RMXA 2QDNA 1NQDA 1RUE1 5E88A 5IT6A 2XVLA 4X8NA 2VW2A 2ZS6B 1HX6A 3ZSLA 4FPFA 5JOWA 2WZR3 3CL1A 2QFEA 5KC6A 1C3HA 1SLTA 3JBG3 2PAKA 2B7YA 1DIWA 1ZNPA 1TNRA 2ZGUA 3GZAA 2ZGOA 3MFAA 1IPJA 1COV2 4CP1A 1HXS2 1VBD3 3S30A 3VHOA 2D40A 3W9AA 4UW5A 4AQ2A 5H9QA 5FLJA 1BCXA 2GMMA 1XRUA 4MGIE 4I01A 5K7PA 4XXAA 1OFSA 1TNFA 2W52A 2B39A 3POSA 4YG0A 1G9CA 3E6DA 3AMQA 4L11A 4UBHA 4B8EA 4DRRA 1ZBA1 3OPZA 1NA1A 2A6YA 1YIPA 2HWE1 4H7MA 4RQPA 4LBOA 3HIFA 4N7IA 1LOGA 4R9AA 1DZQA 1IHMA 2UYBA 1BBT1 3CJIA 4W6XA 1W6QA 2WNUA 3IIAA 3WV6A 1YFWA 4HSLA 3H7YA 4XJUA 4CYDA 5CAZA 3K51A 2OA2A 4KG8A 1COV1 1JTZX 4DNYA 1HXS1 2AGSA 1MZ5A 2HWB3 3RSJA 2YV8A 1N3OA 3O0WA 1CAVB 1AX1A 1F31A 4M0HA 2XLGA 2XWBB 1MEC2 1VBB3 3BALA 4K6BA 3J4UH 1QJX2 1YYNA 5CU1A 2P3IA 1CR7A 1AL22 1KS4A 3LA7A 1WLDA 1VALA 3AJYA 1MQTC 4YSFA 1EV13 5C4WB 1J58A 4AEMA 1QJU3 1AR93 4MZUA 1NQJA 3O0XA 4RD7A 2K9ZA 3HR9A 4WV8A 5I0RA 1V6JA 1HQNA 1BKZA 1VB4A 2VY0A 1DGWX 1UIKA 1W0OA 3AK0A 4JVAA 4IEUA 4F83A 5JOXA 2TBVA 3VUOA 4Q0VA 4H55A 4U2AA 1O7FA 1MR5A 2CWMA 1EPWA 2BVBA 1IQAA 2NYYA 4P9IA 1MEC1 1QY4A 4LHNA 1VP6A 1QJX1 1D4M2 1UU5A 2VOVA 4XFHA 1AL21 2K2SA 2FZ1A 4J1WA 4JC1A 5KHKA 4LT5A 3ZFEC 3WY6A 4HMZA 4IV1C 4JGYA 1RUI3 2X5IC 5BNOC 1ZRFA 3AKPA 4OULA 4Z07A 3RYRA 2W08A 1RTVA 2XUMA 4XFGA 4YGDA 4YW3A 4HFSA 2GN7A 2E51A 1JH5A 3FX3A 1MQTA 2RHPA 1LULA 2WWSA 2R072 1R1A2 4ORFA 2X29A 2CTVA 4COZA 3W58A 4CEWC 2G4IA 4MSVA 2NLRA 1Q8SA 2YUEA 2BUKA 4K21A 1PHMA 2E9QA 1D4M1 2KXLA 4N9HA 4NHKA 1OD5A 1RMU2 4P9YA 4D7TA 2JG9B 1WW7A 3VKMA 5JZGC 1NYWA 3P3NA 2B42B 1GYKA 5GLVA 1D2QA 1N3PA 3N4MA 5C9AB 4LO8A 3MF6A 4FPJA 1AR82 3AX4A 1J3PA 3N7LA 2FZ2A 2WINB 3KCYA 3LOBA 3GZUC 5JIAA 4AYUA 2CGNA 1UAIA 5IK8A 2JE9A 4R9CA 5H9RA 1OA3A 1N3QA 1YLLA 2R071 1R1A1 1B35B 5BV6A 1PNFA 1RUJ2 4WM7B 4PIZA 4IV1A 1J59A 2X5IA 5JMCA 3WW1A 2E53A 4UBGA 2GC0A 3BU7A 3DV8A 2Y38A 4NVPA 1LOFC 3RQ0A 1W6PB 4AEDC 3QH6A 1DLLA 2DUOA 3KSCA 4EJRA 1RMU1 2A3XA 4CDXB 3RS6A 3A0NA 2ZX4A 1LU2A 2GC1A 3LGRA 2HEYF 4XQDA 4IV3C 4RS5A 4QQ2A 4HT1T 1WCDJ 4GMP0 1RUH3 2HWC1 3J8F2 4AGRA 4K7JA 2TNFA 5EZWA 4AEKA 4LHKA 4YZ1A 1X8MA 4AI2A 1GZWA 1ZZ6A 4EWEA 2G9FA 1V6OA 1YUDA 2UWBA 3TAYA 3LSDA 4BPZA 3VLBB 2CY6A 4TWTA 2X8KA 3AYDA 4KWLA 1SQ4A 1DG6A 3ZVXA 1FPN2 3BODA 1XQNA 4LUKA 1COV3 4Q0QA 1G9FA 1JUIA 2GAUA 4GWMA 4XF9A 1FNYA 3UJOA 3OGJA 1Z7S3 2AREA 1R093 3MW3A 4K1ZA 1MZFA 3GNEA 3O14A 4MX3A 2WSUA 5GLTA 3U4XA 3QCWA 3R4UA 1UZZA 1W39A 4IESA 4AF9A 2D97A 4BLIA 3WDWA 3MYXA 1ENRA 1Z78A 1LOFA 2DU0A 3KD4A 4K1YA 3VBOB 2RM22 3HN1A 3J8F1 3JZVA 3RI9A 5FO7B 4N53B 2Q0AA 2IXJA 3D0JA 3I4IA 4Z1VA 4D69A 4XOGA 4U36A 5J36A 5JIUA 4DZGA 3D4KA 5KC5A 5LK7B 4HZFA 2VOKA 5FMOL 4IV3A 5JPNB 3I59A 4GMP1 4HVQA 4FPLA 4B4QA 3AP5A 1FPN1 2BPA2 1C4RA 2HKXA 4PCRA 5CNAA 1KDKA 4F7ZA 1Y7BA 4W6WA 1VAVA 1DGWA 1UKGA 3FC0A 1AXZA 2I2SA 5JVVA 1NE6A 4OHXA 3WVJA 3S0MA 4Z2WA 1S0EA 5IK5A 1MEC3 5JSOA 3E97A 3M70A 2IC1A 3OYWA 1NCRA 3V64A 4DXZA 4W6YA 1PGSA 1X7NA 4UXAA 3VBHC 4F3JA 4EROA 2R062 2WFF2 3L2YA 2VU9A 2KM2A 2VUAA 3CF6E 2D6MA 5L73A 1CPMA 2WA4A 1VRH2 1R1ZA 3WG4A 4Z8BA 2RM21 2O8OA 5T5JA 2GMEA 4ZXKA 5GZCA 4XZPA 3LA3A 3Q9OA 4XMAA 4Y5Z0 1HV1A 1SLCA 3MEPA 1XNKA 1LHVA 2VNRA 2E7TA 2Q1ZB 4S2DA 2EXIA 5DXDA 4AFBA 2ZGLA 2H0BA 1J3QA 1MS5A 1RIRA 4AHYA 1MACA 5TSWA 4A7KA 2LUWA 2LTNA 2RMU1 2DYCA 1MZEA 4QM8A 1W6MA 5JWPA 3N7MA 1DFQA 5CB7A 5BPXA 2QZ3A 1EAH2 4FTEA 5FO9B 4CDWB 2WLPA 2DWRA 3AMHA 4YZ2A 2R061 2WFF1 1QJY3 2O0OA 4XJ9A 1YO8A 4XQ4A 1WLCA 2BYVE 2CGPA 4LBNA 1VRH1 4E9KA 1QJZA 3HT2A 5F1RA 3CU7A 3FMGA 2OZJA 3IPVA 4M3CE 4L92A 1OHFA 2HEVF 2XG3A 1V6KA 3I8TA 1S2BA 3VBHA 1F9KA 2JE7A 1LRHA 2DCTA 3DGTA 2XH6A 2C9AA 2QJVA 1AX2A 4KBBA 4LA3A 4R52A 4TYSA 3ZPYA 2BNNA 2FBEA 5EYXA 2WZR2 1S0CA 4AG4A 4OI1A 3JBG2 1H9PA 3PMEA 4LA2A 4XJWA 3TWIA 1PO13 3GBGA 4JGZB 5GZEA 1EAH1 3ZXGA 1UIJA 3LCPA 1I5ZA 1ENSA 2ZX0A 1VBD2 5C33A 1HKDA 2D44A 2N7GA 1PGL2 1UL9A 5L7OB 2XJQA 5C4WC 4E2QA 2EVXA 4AK3A 2DVGA 1TMF3 1PO22 1AR83 3JU9A 4KU8A 4LR4A 3OD0A 3W59A 1CONA 2QCSB 4LBQB 4RHV2 4XEZA 2GNBA 3MGUA 4GB31 2A5ZA 1SBEA 4FPHA 2NPIA 3FWEA 2TUNA 3B9IA 4AVVA 3KGZA 1DGLA 1RUJ3 3RMYA 2WZR1 3ZMOA 4N43B 4XF0A 1W2UA 4ISQA 3WQ1A 2DCZA 3JBG1 4K40A 2V09A 3IT8A 4PDWB 5GZGA 3FBYA 4WZFA 5JI7A 1VBD1 4IEXA 5JSPA 1PGL1 3UJQA 2XJTA 5JOYA 1WMFA 2XPJA 3QH7A 4AI3A 4OI0A 1RITA 2IWGB 3APBA 2P37A 3H1MA 2XJSA 1CAVA 1LHOA 4AQTA 1RJ7A 4KWJA 1EV12 1YNAA 3MW2A 3B02A 5JAXA 1G9DA 4P5HA 3PMSA 1AR92 1YFYA 2P17A 2P34A 4NPRA 4KGQA 2VVDA 1RUF3 1WLTA 2VW1A 2D43A 5C4WA 4BMBA 4NO4A 2DTWA 4OI4A 2A7AA 3AP7A 4ATFA 4YM2A 1AX0A 1KS5A 1RHI2 4FT8A 4PBPA 4LBQD 3ZYIB 1AJKA 1QF3A 1K5MB 4YVWB 4QX5A 3RDIA 4E2SA 4BA6A 1G6NA 3PNAA 1OKQA 1LB2A 1BVP1 4XFAA 5DG1A 3ATGA 1EPZA 3AFGA 2HWB1 2ZBJA 4FTSA 2JG9C 1VBB1 3AYEA 4KGGA 1LR5A 2RR13 3VBUB 2DF7A 2JENA 3FUQA 5C9AC 5FO8B 2XVGA 3HBZA 1XE7A 1FAYA 1EV11 2R1DA 1FATA 3B00A 1HRI3 1AR91 4N9IA 2Z79A 3R0RA 4AHWA 3CO2A 1RUI2 5T5OA 4YM3A 4AVCA 1QMJA 1B35C 1KJLA 1EP0A 4WM7C 1S0GA 4EN6B 4Y4YA 4DMIA 3OJBA 4QM9A 2KA3A 2QDRA 3R6SA 1H4GA 2D3PA 1OQEA 1U5IA 3ROUA 5EYYA 2PELA 1HRV3 2A6VA 4CZSA 4JV4A 3RYKA 3J9SA 1PZ8A 4CDXC 1N1VA 3ME2A 4XIKA 1WMDA 3VZJA 1YRZA 1MVEA 2EXKA 1MS8A 3BIWE 1S0IA 1OPMA 4AWDA 1LU1A 5KWRA 3SCHA 2GU9A 1VAKA 3KT7A 3H1WA 5T5LA 1AL0G 2XL9A 1G8WA 1Q8VA 1VRH3 3GBFA 5DDJ3 1PIV3 2WKKA 3NKTA 3JUUA 4B29A 4GALA 3VL8A 2JKBA 4G3YC 2JG9A 2DVFA 1DF0A 4YGCA 3NV1A 3H3ZA 2GC3A 2HWF2 2DU1A 1RUI1 5D1IA 5I8SA 2HEWF 4IETA 4JDOA 2C0ZA 4YFZA 2D93A 5C9AA 1F2NA 2DVDA 2PHTA 3DN7A 3HWJA 2XJVA 3S6PA 1WW6A 3LSEA 3OY8B 1RUNA 4HN1A 4BLJA 4COYA 5E8AA 1EY2A 1S0BA 4LO4B 2VGDA 1LOCA 5BNNB 3MZHA 1EAH3 1B35A 4WM7A 1JYIA 1PZ7A 1AHSA 3N7KA 4NHMA 1H1IA 2R30A 3H7JA 3AB0A 1DQ2A 3NAPA 1W6PA 1SLLA 4WVMB 3HT1A 3VBOC 3VKNA 2W0XA 2ES3A 2MEV2 1ZYBA 4N53C 4CDXA 4FTBA 3WDUA 1JUHA 2CWSA 2GALA 3RWNA 2A70A 1REFA 1QOTA 3RYPA 3O0VA 3THPA 2IZWA 5F5QA 5I93A 5KXCA 2EXHA 4P9LA 2ZZQA 2YGMA 4DB5A 1ALYA 5DZEA 5K0UB 2ARBA 1CAWB 3WHTA 4B4PA 1PNGA 1YCIA 3AZWA 2I74A 5GLZA 2OYZA 3V56A 2GC2A 3RPQA 3CLPA 5KXDA 1Q3EA 2ZCWA 3LWCA 2WNVB 4XBLA 4GQ7A 4EN7B 1HLCA 1C8NA 4MXWB 1Z7S2 2PFWA 1POV0 1R092 2FQPA 3AZZA 2XVKA 1LHNA 1S1AA 3GZTB 4NN0A 2YDEA 1UN1A 2ZGPA 1PO23 4Q26A 3VDDB 3P3PA 2CYFA 4XILA 1CD3G 4RHV3 4XDQA 3ST7A 4BCUA 1ZRRA 1RUH1 4N7UA 1TE1B 3OD4A 5AFEA 3V0BB 1GZCA 3MIBA 4GKYA 2WZPP 3VBOA 4HSJA 3LOIA 2EALA 5GLUA 4DRVA 1DQ0A 2YY1A 1QHDA 3BOPA 3M4FA 3HAGA 3H9AA 4L8QA 2BVVA 1J1LA 1H2KA 1AXKA 4MGYE 3WP5A 1X50A 4CDWC 2P3KA 4OHZA 3FFZA 3SCGA 1Z7S1 1R091 2PTMA 4ASLA 1YIFA 5E16A 1BQPA 1DHKB 1LENA 4IEWA 3DF0A 5CFCB 3ENRA 1GKBA 1W6NB 4QD2A 3N3HA 5CIRA 3IKWA 5KHHA 2D5H