1Z7S3

The crystal structure of coxsackievirus a21
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
b'GLPTMNTPGSNQFLTSDDFQSPCALPNFDVTPPIHIPGEVKNMMELAEIDTLIPMNAVDGKVNTMEMYQIPLNDNLSKAPIFCLSLSPASDKRLSHTMLGEILNYYTHWTGSIRFTFLFCGSMMATGKLLLSYSPPGAKPPTNRKDAMLGTHIIWDLGLQSSCSMVAPWISNTVYRRCARDDFTEGGFITCFYQTRIVVPASTPTSMFMLGFVSACPDFSVRLLKDTPHISQSKLIGRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human COXSACKIEVIRUS A21
publication title The crystal structure of coxsackievirus a21 and its interaction with icam-1.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z7s300
1AR73 5DDJ3 4GH4B 1R1A3 1RHI1 1AYN2 1AR71 5DDJ1 1R1A1 1X36A 2WZR2 3VBHB 1PGL2 2IZWA 4RFT0 2ZTNA 5K0UA 1VBA3 1FMD2 5K0UC 1VBA1 1RUE2 1C8NA 2GH8A 4CEWB 1VB4A 5L7OA 4GMP3 1HRI3 3ZFGC 5ACA1 5CFCA 4GMP1 1HRI1 4YVWB 3VBRA 2ZAHA 1BMV2 5CFCC 4FTBA 4Y5Z0 1FOD3 3VBRC 3J8F3 1AL22 3ZFFB 3J8F1 5AC92 1RUF2 4QPGB 4CDXA 3JD73 5FMOL 2TBVA 4CDXC 5BNNB 4RS5A 1DDLA 1NCRB 4RS5C 1TME3 1ZBE2 4FTSA 1TME1 1COV2 2HWC3 1PVC2 1PO13 1ASJ2 4IV3A 2HWC1 1EV12 1PO11 5K0UB 2RS32 4IV3C 3IDEA 1X33A 4WM7A 1GFF2 1TMF3 5C8CA 4WM7C 1RVF2 3ZFGB 1D4M2 5C8CC 1TMF1 3LOBA 1NY71 1F2NA 2XBO2 1RB8G 5ABJA 1Z7S3 4CDUA 5ABJC 1Z7S1 1HRV3 4CDUC 2Y26A 1ND3A 4Q4Y3 4Q4X3 5J96B 4QPIA 4FSJA 1HRV1 1ND3C 4RHV2 4N43A 4Q4Y1 4Q4X1 4QPIC 4N43C 2PLV3 4CDXB 1EAH2 1E57A 1MEC2 2PLV1 4RS5B 1R092 4RQPA 1SMVA 1AYM3 4NWWA 2RM22 2R072 3TN92 4RQPC 1OPOA 2BPA2 1AYM1 2WS93 1VBB3 4GB32 1AR92 4IV3B 1RUD2 2R063 1VBB1 2WS91 3ZFEA 1C8M2 3ZFEC 1PGW2 2R061 2BFUS 3VBOA 1HXS2 1VRH3 1AR82 3VBOC 3JBG2 1BBT3 1NA1A 1VRH1 1CJDA 1NA1C 1BBT1 1V9U3 4CDUB 4Q4W2 1AUYA 1FPN3 3M8LA 5DDJ2 1V9U1 1R1A2 1FPN1 4QPIB 5BNPA 5BNOA 2WLPA 4N43B 4CDQA 5BNOC 1MQTB 3DPRA 1RUC3 4N53B 4CDQC 1QJZA 1VBA2 3DPRC 1AYN3 1RUC1 3VBSA 5FOJB 3VBSC 1AYN1 5L7OC 1ZBA3 4RQPB 5ACA2 4CDWA 2HWD2 1HRI2 4GMP0 1ZBA1 1PGL1 4CDWC 2VQ0A 3S6PA 4WM8A 1FOD1 4JGZB 1VBC2 3J8F2 2R043 3ZFEB 4WM8C 1PIV2 4IV1A 4RR3A 2R041 5A33A 4IV1C 1NG0A 2HWB2 2RS13 4RR3C 2BUKA 1QQP2 3JD71 1RUG2 2RS11 1NA1B 1AL23 1RMU3 4EJRA 5JZGA 4PDWA 1OOPA 1H8TA 4AEDA 5JZGC 1RMU1 4PDWC 1OOPC 1H8TC 4AEDC 1QJY2 1NOVA 2HWE3 1B35A 1PO12 2BBVA 2HWE1 3VBFA 1VBD3 1ZBE3 1B35C 1HX6A 1R082 3VBFC 1AR63 1VBD1 2WFF3 5C9AA 5A32A 2X5IA 5L7OB 1AR61 5C9AC 2WFF1 1ASJ3 5CFDA 2X5IC 4Z92B 5CFCB 3NAPA 3VBUA 1K5MA 2QQPA 3VBRB 5CFDC 1CD3G 1ASJ1 3NAPC 3VBUC 1K5MC 3VDDA 1Z7S2 3VDDC 4WM8B 1HRV2 2HWF2 4IV1B 4Q4X2 1POV3 4RR3B 2XBO3 1POV1 2XBO1 2RS53 2RR12 5JZGB 1OOPB 2RS51 4AEDB 1RUI2 1QJU2 1AYM2 1VBE3 1RUJ3 2WS92 1QJX2 1VBE1 3VBFB 1RUJ1 5J98B 4Q4V3 1PO23 2R062 4WM7B 2RM23 2R073 5C8CB 5C9AB 4Q4V1 1PO21 5A32B 2RM21 2R071 2X5IB 4YVWA 4GB33 5D8AA 1VRH2 4YVWC 3VBUB 5ABJB 5D8AC 4GB31 1C8M3 1RHI2 2RMU3 1RUH3 4SBVA 1VAKA 1AR72 2BFUL 3VDDB 1BEV3 3ZXAC 1ND3B 1C8M1 2RMU1 1RUH1 2MEV3 1AR83 1BEV1 1WCDJ 5BNPC 4NWVA 2MEV1 1AR81 2WWSA 4LLFA 1NCRA 1VB2A 1NCRC 4Q4W3 1RUC2 1ND2A 2WZR3 4Q4W1 1ND2C 2WZR1 1FMD3 1NCQA 1ZBA2 4BCUA 1RUE3 1FMD1 1NCQC 4FTEA 1FOD2 1RUE1 3CJIA 4YVSA 3JB4C 3CJIC 4YVSC 5ACA3 3ZFGA 2R042 3VBOB 2HWD3 3JD72 2HWD1 1BMV1 2RS12 5FMOS 5D8AB 5AC93 1VBC3 1HQNA 1PIV3 1AL21 1RUF3 1TME2 5C4WA 1RMU2 5AC91 1VBC1 2GSYA 1PIV1 5C4WC 1RUF1 2HWB3 4CEYA 1QQP3 1M06G 1RUG3 5BNPB 5BNOB 2HWC2 4CEYC 2HWB1 1QQP1 1IHMA 4CDQB 1RUG1 2HWE2 3DPRB 2DF7A 1ZBE1 5GKAC 1COV3 1VBD2 3VBSB 1PVC3 4JGYA 1QJY3 1ND2B 1COV1 1AR62 1TMF2 2ZZQA 2WFF2 4JGYC 1NY72 1PVC1 1EV13 1QJY1 2RS33 4CDWB 1EV11 1NCQB 1R083 2RS31 5LK7B 1RVF3 1R081 1A6CA 1D4M3 3CJIB 4YVSB 4Q4Y2 2FZ1A 1RVF1 1D4M1 5A33B 1POV0 2PLV2 4GH4A 4GH4C 4PDWB 4RHV3 1H8TB 2RS52 2HWF3 3VBHA 5C4WB 4RHV1 1W39A 1EAH3 2HWF1 3VBHC 4CEYB 1MQTA 1MEC3 1R093 1EAH1 1AL0G 4N53A 1MQTC 1B35B 1VBB2 1MEC1 2XPJA 2RR13 1F8VA 4N53C 4CEWA 1R091 1VBE2 1RUJ2 1RUI3 3TN93 2RR11 4CEWC 3HAGA 1QJU3 1RUI1 4Q4V2 1PO22 3TN91 4JGYB 5CFDB 1AR93 1QJU1 1RUD3 3NAPB 1K5MB 1BBT2 1AR91 1QJX3 1RUD1 3ZFFA 4JGZA 1QJX1 1V9U2 1HXS3 3ZFFC 4JGZC 1PGW1 1OHFA 4QPGA 2RMU2 1FPN2 1RUH2 3JBG3 1BEV2 1HXS1 4QPGC 2FZ2A 5BNNA 3JBG1 2MEV2 4Y4YA 3JB8A 5BNNC 1RHI3 3FBMA
chains in the Genus database with same CATH superfamily
2VD7A 3RG0A 4LBOA 2ES3A 2G1MA 1IKPA 2PXJA 3RWKX 1RHI1 3WP5A 5L7OA 1AYN2 4BPZA 4Y20A 3V0AA 1PZ9A 1X36A 5KWRA 4K8FA 4FPHA 3UKTA 2GNTA 1UZZA 1J3PA 2IZWA 1IG0A 1R1ZA 5FZ1A 3T0BA 1VBA3 3N7MA 5HXMA 1JZ4A 1LEMA 5JSRA 1OFNA 2Y6LA 3ZXGA 5FPXA 5K8SA 3SXWA 3ELNA 3LDRA 3NW4A 5JLVA 4F83A 5F37A 3AP5A 4AHZA 1KEXA 2J1SA 3Q9OA 3VZNA 1VB4A 4Z8BA 2BP6A 3AZYA 3UKNA 4LUKA 2EIBA 4GMP3 3HBKA 4I0BA 3K77A 5L73A 3ZFGC 1V6NA 1EPWA 4YVWB 1E5RA 1JU3A 4Q1PA 5A3LA 4LIUA 5CFCC 2G4IA 2XJTA 3ZMNA 5KXEA 4XE9A 1TNFA 3HBZA 4QHZA 2OKXA 5JSOA 1OA4A 5DUVA 1AL22 3USSA 2WN3A 2R30A 3J8F1 1CGPA 5L9BA 4D6RA 4E2GA 2YROA 1XNTA 4G3YC 4LHNA 4NRMA 4UW5A 1K12A 2LW8A 2JJ6A 5FWEA 2BYVE 3JD73 3RZLA 4FPKA 1MZFA 3LFMA 5FMOL 4B1MA 1Q43A 1YI7A 4CCEA 3E6BA 1H30A 4WBBA 3W20A 1TME3 2YXSA 2I07B 1ZBE2 1XNDA 4O9GA 3UT0A 1CAUB 3EHKA 1IG3A 4NIHA 2JE9A 2XHNA 1PZ8A 5KXBA 1GQGA 4FTSA 3WX5A 1EP0A 2YZ4A 3PVBB 1W2OA 1LOAA 5FO9B 2QDRA 3VDBA 1PO13 3TEWA 3DYMA 2ZGRA 3AKSA 5FCCA 1LAJA 3JZVA 2VOKA 2VZ3A 4IV3A 1JMUB 2G9GA 1GZTA 5IUQA 4Y1VA 1EV12 3NMBA 3WF2A 3LZZA 3WW4A 4FO9A 1UX7A 3BTXA 3O5SA 5A1FA 1GKBA 4CEWA 5F3EA 4JC1A 5LASA 3A21A 4B8EA 5C8CA 3TEYA 1W06A 1JZ5A 4O61A 1SCSA 4AEKA 4BB3A 5A80A 1RB8G 2X53S 1YFYA 5JXGA 2VECA 2JDKA 3KCXA 4KL1A 3THCA 3UL2A 3FFQA 1SLLA 5A7PA 5FZOB 1V0AA 2WNUC 4PT6A 5J37A 1HRV1 4EE2A 4M00A 4XFIA 3H3LA 3O1TA 1GZCA 2F17A 4Q4X1 1ZVFA 4B1LA 3QCWA 4N43C 1O91A 4OLLA 3H1YA 2DBNA 1EAH2 1H1IA 3ZOIA 2PQQA 3HNMA 1MS3A 2GP5A 1MEC2 1KFUL 1LOFA 5FY8A 2I74A 4QB1A 3SHRA 4RS5B 1QXPA 2IC1A 2ZGUA 2DU1A 1E5SA 2C9KA 2P34A 3ME2A 2A6ZA 1WBLA 4AVCA 3HT1A 4UFJA 1AYM3 2WZEA 4YWAA 3VN4A 3TN92 5A3UA 1DU3D 4RQPC 2QQJA 5F1RA 3AK0A 1VP6A 2XJUA 3IBMA 2PFWA 4GB32 1GP4A 1ZZ7A 4A6SA 1AR92 4F8AA 3I2KA 4JV4A 2R063 3ZFEA 4NPRA 3HVDA 4YGBA 3LGRA 2W9XA 3K3NA 2JICA 1CQ9A 3RI8A 4CZSA 2ARCA 3KS7A 2JENA 2BFUS 1O4YA 3VBOA 1C5IA 3HNYM 2VAUA 1HXS2 3N9NA 3OSDA 1UOBA 1JYVA 3NNJA 3IZOA 1WKYA 4P9IA 4XABA 2Y6KA 4Q0PA 1VRH1 1IS6A 1LGCA 2DFBA 3IMNA 4XXAA 3CKHA 1NA1C 1VMFA 1BBT1 3AB0A 4E2QA 2YYOA 3NWKA 3OPTA 1UO9A 4CDUB 5I0SA 3J7LA 2JDZA 5KHKA 4LLOA 4UWDA 3M8LA 1NZIA 2P3IA 2X29A 5DDJ2 5T5OA 4X6QB 1R1A2 4QPIB 3LD8A 3BOWA 4I01A 3FN9A 4HMZA 2ZAAA 2XWBB 2VTXJ 4HSLA 3DPRA 2Q5TA 1RUC3 4KI5M 4CDQC 1QNWA 2VW0A 3KVBA 3NJVA 2HEVF 4ZZ8A 3O1SA 3QACA 3V56A 5FTTC 5FZKA 3DGTA 3OBRA 4HKLA 4D7TA 1SPPA 5FDBA 4L92A 3QOPA 3NNLA 4J1XA 2AH2A 1AYN1 1Q8QA 5FYCA 2VZ1A 3K3OA 1SBFA 2UY8A 5ACA2 3LDKA 4JKLA 3ZX7A 4CDWA 2HWD2 1HRI2 2EICA 2JWPA 4NAOA 5M0TA 3DV8A 2XQXA 5SV5A 2I45A 3WQ1A 1G9BA 3KT1A 4FPEA 3S6PA 1PMJX 4PJYA 4CCLA 1YEWA 4QX3A 5FUIA 3PIGA 1S0JA 1I5ZA 5GM0A 2XVKA 3B69A 4AWDA 1PIV2 4FXKB 1OXCA 5FP8A 3E6DA 4RR3A 2HJIA 2J1RA 5DAVA 2ENRA 1NG0A 3SMHA 2HWB2 3VD9A 2BVBA 4W50A 1CZSA 4K8RB 2KA3A 5FOBB 2RS11 2XKOA 1PNFA 2NM1A 5FY1A 3THDA 5JZGA 4V2VA 4Y3OA 3AL5A 4Q5OA 3RFRA 2WO1A 1I1EA 1OOPA 1ULOA 4OHYA 1U0AA 2VJXA 4LO7A 1H8TC 1H6YA 1QJY2 4Z82A 1NOVA 1D4VB 3IDBB 1W0PA 2HWE3 2WZPP 5K7PA 4HXCA 5KXDA 2GC1A 3FC0A 1PX4A 2WNVB 1YYNA 3VBFA 1GNYA 1VBD3 2D5FA 4BQ2A 3BODA 1LR5A 1GWLA 4S2DA 4CA9A 3GJAA 1S1AA 1AR63 2QQIA 1YJKA 3T4VA 4CU6A 3MLLA 4EN0A 3GBGA 1BYHA 3GBWA 2JDHA 2X5IA 2EF6A 3WP6A 3MGUA 5FP9A 2WFF1 2CYFA 5CFDA 4AFCA 4Z92B 3JU9A 5CFCB 1K5MA 4O9EA 4YARA 3ZN5A 2QQWA 4XF9A 4L8QA 3NAPC 1UKRA 2A75A 3ZXEA 4LEJA 1CIYA 4AFAA 3RZHA 1U5YA 4LTAA 3Q8BA 4CCJA 3VDDC 2EAKA 3T08A 3PNAA 4PLOA 2WBKA 4LO5B 5EWSA 3LIGA 4JVAA 1J3QA 1D7PM 1GQHA 2A71A 1DZRA 2HWF2 3AFGA 5GLUA 3C7OA 2OZ6A 5LBBA 3ZYGA 1W03A 4M0HA 3RYRA 1UAIA 2WA3A 2VCMA 3MUY1 2ZGMA 2Z4FA 5BYNA 1WW6A 4QX2A 5FP4A 3BPSA 4LITA 4XOGA 1CX4A 3MIDA 2D3SA 2IXKA 1W6QA 1UYZA 4TYSA 4DQAA 5EYYA 2RS51 1MPXA 3WG4A 4AEDB 1HQWA 2W1WA 2ZEXA 4L11A 2W08A 5DABA 2YHJA 5FK7A 5JDBA 1W6PA 4WV8A 1WLDA 1JH5A 2DCYA 2WQZC 3KCCA 1VBE3 2D40A 1CPMA 1RUJ3 3DCQA 3W5NA 2NLRA 1EY2A 1LEDA 1LU1A 1CPNA 1QJX2 2C0ZA 4HPKA 3HIFA 3RYPA 4A42A 1PO23 1XNAA 5ANNA 5I8TA 5C9AB 3ZSEA 5A32B 2JG8C 4HONA 5IFTA 3MIHA 4MHRA 5D8AA 1QKQA 3FZ3A 4AL9A 2A73B 3VZKA 2VCBA 3VBUB 2Z5WA 3ZM8A 2WABA 3ITQA 4GB31 1C8M3 1XSRA 4RYDA 2WC2A 4PQ9A 2P17A 2WNUB 3LSEA 2GALA 4DXSA 4NHKA 1QEXA 4DXZA 2RMU1 2BNNA 1OMIA 2MEV3 2YBKA 4QDQA 3RGBA 5E6HA 4KU7A 3WNPA 3ZSLA 4FAGA 1OH4A 4XQWA 1QJFA 2ZZJA 3POGA 3WEZA 4NWVA 3GHNA 5C5UA 4GIQA 4AE2A 1M4WA 1ENRA 3GZUC 5T3NA 5EPAA 3I2HA 1NCRC 3UYJA 4FFIA 5FZCA 2GP3A 3WDTA 3PJQA 4MUVA 1HB1A 2W1UA 3AX4A 3AJZA 4FCAA 4AAXA 1O8PA 2WSVA 1NLRA 2HEYF 1ND2C 5G04L 3IM0A 5FXVA 2VNVA 2WZR1 3PVEA 1H2MA 3C7HA 4EN9B 1LODA 1ZBA2 3C7EA 1Y9MA 3CJXA 3FLTA 2D97A 4Q1RA 4BCUA 1FMD1 1S55A 3KF3A 3M3EA 3MICA 4DRVA 1YIPA 5I8YA 2HBUA 3B9IA 3CJIA 5FMCA 3TOJA 3POFA 1CAXB 4YVSC 3ZFGA 2R042 1DLCA 1KJRA 3SISA 4FOYA 5FZ4A 5FY4A 2IUWA 2VMGA 3JD72 1A3KA 2HWD1 1NXD1 2EA7A 1REFA 2G19A 2VXRA 3ZXKA 3AYAA 5C3OA 3H1WA 4YM2A 4Z1VA 4AF9A 1OSGA 1V6JA 1W8WA 3AYDA 1VBC3 3Q8FA 1GP6A 1HQNA 1OPMA 2ZHNA 4HN1A 4Y1YA 4R4XA 1TME2 2RDQA 4GULA 3T0DA 1RMU2 4LBLA 3SQOA 1X82A 4YGDA 2Z69A 5EJZB 4BQYA 2B5HA 2A1XA 4AI3A 2GSYA 4D6QA 1AXYA 1PIV1 3LB9A 3BCWA 4JTOA 5C4WC 1QQP3 1UNBA 1WLTA 1RUG3 4BXFA 3F95A 5EJ1B 3FMGA 4CEYC 1JYXA 2HWB1 3O0WA 3POBA 1L3JA 2VH9A 1GOHA 4U2AA 2DCKA 2Y6JA 4LA2A 4HL0A 4XF3A 4CDQB 5IHRA 5JOYA 5F7UA 4D6SA 1LCLA 4GXLA 1PM7A 3POJA 5JI7A 5EQUA 1MVQA 4I3GA 4AFBA 5JXHA 3ZN6A 5LB6A 3MW3A 1S0FA 4JGYA 4JKMA 1UPSA 1COV1 4Q0SA 2ZGTA 4C90A 3GZEA 3NL1A 1EV13 1QJY1 4IGQA 5JIUA 2BGOA 2BGPA 2YGMA 3KWVA 3I3MA 2ZABA 4LBQD 3HD8B 1L7RA 2JDYA 2ZMNA 5EYXA 3P5BA 2Q1FA 1WA6X 1V6MA 3ZPYA 3BU0A 3BYWA 1UKGA 5BPXA 1RVF1 1AX1A 1WLWA 3O12A 4FFHA 4IESA 3I2DA 5A33B 4JKKA 3O0XA 2NMNA 1CAVB 3H7JA 2FDGA 4NMIA 1GZWB 3EMRA 1POV0 5IVYA 4X8PA 5A6XA 5C3SA 1W90A 4LHKA 3QH7A 5LBCA 3PJYA 1RIRA 1H8TB 1JZ8A 3UKVA 3W58A 1OQ1A 2FDHA 5KC6A 3TAYA 1AXZA 2D5HA 3ZPOA 3ZLIA 2D6MA 4JX0A 1EAH3 1Y4WA 2HWF1 1R64A 3OY8B 4XAAA 1MEC3 3VHRA 5C33A 4LORA 1WWYA 5I93A 4XETA 3BIWE 4QB2A 3RZGA 4N53A 4LNVA 5L19A 1HIXA 1BHGA 1OVPA 3RSJA 2DTYA 4AVVA 4KMQA 1G9DA 3RYKA 2VCCA 3TN93 4NJ4A 5F8PA 4DFSA 3E5UA 1CZVA 4EWEA 1YUDA 4OHVA 4Q4V2 3ROUA 5FQ0B 2FDJA 1TEIA 4LKFA 4AI0A 2BTVC 5CIRA 1AR93 1RC6A 1G9CA 1JYCA 3NAPB 5FMDA 2E7QA 2EALA 1JBCA 4XUQA 5E88A 1ZYBA 2V73A 5FYIA 1RUD1 4QX5A 4CU7A 4JGZA 1HB2A 3OUHA 5D1IA 5A6YA 5K9YA 1K42A 1QJX1 2V4AA 1HXS3 2ORXA 1OHFA 2CDOA 5FZ8A 2W5FA 4AHXA 1YNAA 1NLSA 3PUHA 1S0CA 2N7GA 1IZ3A 2PYTA 5DUWA 5CBLA 1BEV2 4XIOA 1K3IA 4JAAA 4TLFA 5DAQA 5I91A 3BALA 4Y4YA 1W9FA 1UXXX 1RXFA 3LA2A 4W65A 1LJ7A 4CE8A 5KC5A 3VDCA 3ZDSA 5CKQA 3FBMA 1S0BA 1NQDA 1AR73 1YQ2A 2AEZA 4GH4B 5DDJ3 5SV8A 4YLZA 4META 4BIFA 5JR2A 1R1A3 3LEMA 3AM2A 3AVSA 1E5IA 4EQVA 3D5OA 1DG6A 5HPOA 3L2YA 2JE7A 3AMNA 3VBHB 3GALA 3WZ1A 4D0QA 3N9OA 1PGL2 4I2OA 5K0UA 2QJVA 2ZTNA 5FLJA 5HXVA 2XVGA 2YG0A 4P14A 4W6XA 2IXJA 1ULPA 2CAVA 2VG9A 2WRAA 4S2GA 1VBA1 1GBGA 1RUE2 2CSGA 4K9SA 5IK7A 5FZAA 5A7WB 2DCTA 3HQXA 2ZX1A 2MHFA 1DQ2A 1HRI3 3UV9A 4E4ZA 1CZTA 4ISQA 2GU9A 5A3WA 3TNPB 5E16A 2CGNA 3ETPA 4GMP1 4K20A 4F3JA 1T2XA 4N90A 1BMV2 5IW0A 1KITA 4PF5A 1N3QA 1SLIA 4FTBA 3VBRC 1FOD3 2GMEA 2A3YA 3OD4A 5TSWA 3OGRA 4Y26A 1A34A 1YFXA 2BBAA 3ZFFB 2SBAA 1K5JA 5AC92 5IVEA 5LK5A 4YFZA 1EUUA 1HKDA 3AC0A 3A0NA 3ZXLA 2QNKA 3THTA 4E4SA 2HH9A 2CY6A 4CDXA 1UYYA 2ZHKA 5CNAA 5JMOA 4E9KA 4UOJA 5K4LA 3R6SA 4R9AA 4B4QA 3RZJA 1UY0A 4XPVA 1XNBA 1DDLA 1NCRB 3K4DA 3T2QA 4TSVA 1O4ZA 5A7OA 4RS5C 1LOGA 2B42B 4LBQB 1WGPA 1ALYA 1XNKA 3WHUA 4Q8LA 1AZDA 3RQ0A 2QVSB 1NYWA 2GZWA 1TME1 4CSWA 1W6OB 1WCKA 4MO3M 4Y20B 3WF4A 5T5PA 2XJQA 4COVA 4E4DX 1PVC2 2VTFA 4NIDA 3PUQA 5T5LA 3D3AA 1JUIA 2OA2A 3FFZA 5IWFA 4B7EA 4BA6A 1PO11 2GNMA 1W2NA 3OTFA 4HK8A 3POEA 4HN0A 3H3UA 1KS4A 2VBDA 1VMJA 1X33A 4JRLA 4WM7A 2D6PA 3ECQA 5E8AA 4YPJA 3GGLA 3HOBA 4FOQA 3FBYA 3I3DA 4CCMA 3TYJA 1MVEA 4LKSA 1D4M2 5FZDA 3LOBA 2WFPA 4IEUA 3J7MA 4EN8B 2J7MA 2PHDA 1JYIA 4TN7A 4FPJA 1RUNA 3I2OA 3V65A 5ABJC 2C24A 2VMDA 1UOFA 3ZKUA 4CDUC 2Y26A 4CCCA 1ND3A 4Q4Y3 5J96B 3N9LA 3OG2A 4FSJA 2VBBA 5DN2A 1NLQA 4RHV2 4Z07A 4QKNA 3ZXDA 3FHIB 2FBEA 4QPIC 4QT6A 4QX0A 5GZFA 4YZ4A 2D43A 4K3UA 4YM0A 2DVAA 2PLV3 2YFZA 4WVZA 1UOJA 5JSPA 2V4VA 1OA2A 3ES4A 4LBKA 2WDBA 4NRQA 1DP0A 4ZHNA 2ZGKA 1R092 4OZOA 2P37A 4HFSA 5FYZA 5C70A 3HPNA 2QTWB 1XU2A 1OKOA 2D7FA 1US3A 2FMDA 3DECA 4NWWA 2JG9B 3SKJE 4OMCA 5CADA 5F3IA 3FHAA 5C71A 2Y60A 4N7UA 1AYM1 1HDKA 1A8MA 2BPA2 4DRRA 4AGGA 1VBB3 4ARXA 4DB5A 1H9PA 4PHZA 1N1SA 3HN1A 4IV3B 3I2GA 4P5HA 4UW3A 1BXHA 1SLTA 5FZEA 1CAWB 1HB4A 4QQPA 3WXPA 1C8M2 2QZ2A 3SH5A 1F4AA 2R061 3WW1A 4N7IA 1W6MA 2XG3A 5HV4A 3O7OA 5JPNB 1ENQA 1BVP1 4COWA 2BJSA 2OQ7A 2XLFA 3OEBA 3POIA 5F5IA 3N9PA 3WSOA 4FAHA 2JEMA 4MV2A 3SKVA 2F4PA 1MS1A 1QJEA 1W3VA 2WINB 2WQ4A 3LEIA 3AKQA 3ATGA 5I0TA 1GR3A 4OUSA 2VL4A 4OULA 4BQXA 4DO0A 2YGLA 2A6YA 4PI2A 5FRAA 2E7AA 1AUYA 1W9TA 2AREA 4EWDA 3B02A 1W8HA 2Y0OA 2EXJA 1XYNA 3OYWB 4LO6B 4AHYA 3BTZA 1BCXA 5BNOA 1UMZA 2VQAA 4XFGA 4HVQA 4ET7A 5B4NA 2Y6HA 2NPIA 4W4ZA 2A3WA 3T2OA 3TEXA 3CEWA 3I3BA 3BUCA 4XVHA 5FKCA 2YPJA 3I2FA 1X9TA 1T6GC 2WNVC 5H9PA 3U1XA 4CPBD 5JMCA 4XEZA 4RGAA 2IVIB 3VZOA 2JIJA 1RUC1 5FOJB 4YM3A 1JYNA 3AZVA 4IE0A 1C5HA 2GN7A 4QKDA 3BN6A 3VBSC 1ZBA3 5A7QA 4CUCA 1O6UA 1OBNA 4CP9A 1JS9A 2Y34A 4XF1A 1XNCA 5FY9A 3LIHA 1QH6A 1PGL1 2TNFA 1AJOA 4M01A 1SQ4A 4U36A 2VQ0A 4ZXEA 4A3ZA 3D6EA 5IJRA 2PHLA 3PUSA 5C8WA 4WM8A 4AI9A 2YPDA 1OURA 4H7LA 1ZZ9A 1VBC2 2R043 3ZFEB 4FI9A 2ARXA 3OGVA 4IV1A 4FBFA 1J1LA 3N9QA 5EHDA 5JXIA 1W8NA 4AFDA 5LRRA 1MZ5A 4RD7A 2CAUA 5DZFA 1QQP2 5GLWA 2RJLA 5A3TA 1RUG2 2EXKA 2OZJA 3PVOA 1DBNA 5LEJA 4P9GA 5FZLA 1H0BA 4AVAA 1RMU3 3M3QA 4AOCA 4PDWA 1PVXA 5AVPA 1Y3TA 2IXIA 4FOWA 4WVVA 4AEDC 4XXPA 1YRZA 2X8KA 4B3NA 2O1QA 2XL9A 3HNBM 4FPYA 4ES9A 3WNOA 5DZGA 2Y8KA 1UPIA 2PHTA 2DTWA 5F9TA 3GZTB 1W6NA 1XE0A 4MGZE 4H55A 5C3PA 2VBPA 1B35A 4ORFA 4ZKTB 1LENA 2BBVA 1I5PA 2HWE1 3KT7A 4QD2A 1JOPA 3EXUA 3H8UA 2IXCA 2BQPA 2QUOA 1JZ7A 1W04A 4RFRB 1VBD1 5BNQA 2RG4A 4K1YA 5E1RA 3DKQA 1AR61 1SPPB 4B29A 5C9AC 1N1YA 1ASJ3 1VMHA 3A22A 1JXNA 1ZRDA 2UWCA 5GLVA 2QQPA 3GJBA 4OHXA 3VBRB 4YG0A 1CD3G 3WINE 2HYXA 3VBUC 1CVNA 1MR5A 4PBPA 2W39A 5FIXA 1UD1A 1Z7S2 1DGLA 1WD3A 2JECA 3WDXA 3HN3A 2Z2SB 3PUAA 5EIYB 1YXWA 4LA3A 5LCWL 4RR3B 1ONAA 5CKMA 5C3RA 3M3OA 1WMXA 4NE9A 1RTVA 2Y6GA 4KBBA 4Y22A 5FBJA 5T5JA 1J84A 1N1VA 1QDCA 2YB7A 3WQBA 2QQLA 2J1AA 5C7GA 1O3RA 1UY2A 4NHMA 4QDRA 1OD5A 2WIIB 4N9IA 5JZGB 2R6QA 1D2SA 1KJLA 1OOPB 2JD4A 2C1FA 2ID4A 4ZS2A 5DXDA 4DXRA 1LB2A 2EIEA 2VMCA 2ZEZA 1W8FA 2VZTA 5HCAA 3ZYHA 2FD8A 4NPLA 3GF6A 3UGHA 3RRDA 1FX5A 2UWAA 2QKDA 4MGYE 3U07A 3AZZA 3KCYA 4AQSA 5KHHA 4XUOA 4YGCA 1RITA 2E26A 3H50A 2BU9A 2WS92 5LATA 3CIHA 2GMPA 1VBE1 4O7XA 1XRUA 5F2SA 3VBFB 1RUJ1 5J98B 3RPQA 3WW2A 4Q4V3 5A1LA 4AW7A 2B4KA 2VU9A 4A44A 1JI6A 1AVBA 3ACHA 3PDQA 1PO21 3SNMA 2R32A 3SLIA 2X5IB 4YVWA 4MH0E 4KU8A 4RGGA 1W2UA 4CUGA 1IS5A 1IS3A 3N7JA 3D0JA 2AEYA 4QKFA 5ABJB 1GQPA 2PAEA 3N7KA 2CNAA 3LOIA 4HANA 3MLKA 3PVNA 1AR72 1LHVA 4NPMA 1BEV3 3LA7A 3V64A 3ZR6A 3ZSKA 5IK4A 1C8M1 2FHRA 4BMEA 3NRUA 3PTYA 3VL8A 1Q3EA 2ZMKA 2ZHMA 3NNGA 3MO4A 2MEV1 4LLFA 3KHCA 2E32A 3RJRA 2PMWB 4YZ3A 4KWKA 3PHMA 2Q8DA 1GZ9A 4O65A 5FPVA 5J7MA 4ISRA 1UOGA 4Q4W3 3HJRA 3DEMA 1CAUA 1FV2A 2FDKA 3ACIA 1PMHX 5LA1A 3AMQA 2WWJA 4CP0A 4QGNA 1HN0A 3OBZA 1W6QB 3S5QA 3VKOA 4XFCA 3WUCA 1PX3A 4IE5A 2RDRA 1JUHA 3T30A 4XUPA 1NCQA 4RL7A 3VZJA 1TZOA 2AR6A 1RUE3 4NO4A 1W6PB 4DUWA 4XUNA 1ZRIA 1FOD2 3M70A 2H0VA 1PK6C 3O0VA 5JOWA 1MZ6A 2EVXA 1H1AA 4TWTA 1XSQA 2B8MA 2RJ2A 2V72A 2VUCA 1KDMA 4DUXA 5LW9A 1PM4A 1X8EA 4AQTA 4CCNA 1U12A 2B9UA 5D8AB 5FMOS 5FYBA 2CHHA 5AC93 2JE8A 1JYWA 4JCKA 3IWZA 1AL21 4HVOA 3ZMOA 4UT5A 2PELA 1VBC1 1RJ7A 2XOMA 4Y1XA 3WCSA 3B94A 5BNPB 3V0BA 2QQMA 1D0HA 3H8RA 4F7ZA 4R4ZA 3I3QA 1QQP1 1IHMA 1RUG1 3KGZA 5F6LB 4HG6B 2TUNA 1UYXA 5FZ9A 4ONUA 4GWMA 3RNSA 1ODMA 3AZWA 3ETQA 1H1MA 1N3OA 1ZBE1 1W28A 5FREA 2ZGNA 3GNEA 3I4IA 3VBSB 3NSTA 5FPUA 1PVC3 4D69A 3K4AA 3FUOA 2ZZQA 1ODNA 4FT8A 1U5ZA 1V70A 4UFKA 2OUHA 5FK8A 4OI2A 4JHTA 1DGWX 3WNLA 4A6OA 1TQ5A 2P3YA 2VQTA 2WNOA 2XUEA 4CRQA 2CWSA 2P2KA 1DQ0A 4ZS3A 1EV11 3NO8A 5A6QA 1R083 2VUAA 4IEQA 2OW4A 5FZIA 5LK7B 1XB9A 4LT5A 5ISLA 3WNKA 3HQUA 1A6CA 3O1OA 1D4M3 2RHPA 4IEPA 3SEPA 3CJIB 4OUMA 2XJSA 3HR9A 3IPVB 4Q4Y2 5IK8A 1VLNA 4M3CA 4XIKA 4MXWA 1JHJA 3NQHA 3D0SA 1REDA 4D8MA 3CL1A 3USUA 2VUDA 5APAA 2PLV2 4UF0A 3R4UA 3WDVA 2BOJA 4GH4C 3ZYBA 4RHV3 1DFQA 4K21A 4J6GA 3N7LA 3PL0A 3ALQA 5B2GB 4G9SB 1O4TA 4XAEA 4BWOA 1ZNPA 3KM5A 3VBHC 2VR4A 4ATFA 1CX1A 2WL1A 3ZXJA 1R093 1EAH1 2YU2A 1JODA 4XUTA 1MQTC 4YG6A 1VBB2 2PQSA 1MEC1 2YU1A 3POYA 5FZMA 1H9WA 1NX9A 4J25A 3U10A 3M7AA 1UXZA 2ZMLA 3IMMA 2BERA 4OI4A 3AP6A 1GNZA 3CF6E 5ANQA 4BMBA 4NIIA 2B45X 3LCPA 5F5CA 2JKXA 3TNQA 2R49A 2FCUA 2J1VA 1X7NA 2WKKA 4ZU5A 1JOJA 5T54A 3TN91 4JGYB 4ASMB 1LHNA 3R4SA 4HZFA 4YW7A 5KR7A 4Y1ZA 1QXRA 4SLIA 1BKZA 1UMHA 3GZAA 3OBAA 4AG4A 3ORJA 3E5XA 4YW2A 4L97A 1AR91 3ZVXA 2DV9A 3ZXFA 4G4FA 2C4XA 3PU8A 4XFAA 4M3CE 3ZFFC 1FNZA 4LBJA 4EN7B 4M4RA 4WVMB 4QPGA 4OQ8A 2VMIA 1RUH2 1SFPA 3NNFA 4RSUA 1HXS1 2PN5A 4PLNA 1JU4A 3KHBA 3WG3A 2VNRA 3P3PA 4IDZA 5BNNA 4EN6B 1HJGA 2AC1A 1T6BX 1YO8A 3HMYA 4CUAA 4ZU7A 1UZYA 2CGPA 4J1WA 1UL9A 2OYZA 2OVUA 1MS4A 1GMMA 1BK0A 3HEIA 4ZZ5A 2RE9A 1W9WA 1ZRFA 1AR71 5DDJ1 1HN1A 5GJ6A 5F5QA 4RA0A 1R1A1 2R1BA 4FPOB 1QGLA 2FDIA 4OHWA 5A3OA 3DYOA 3T4HB 4RFT0 3B5LB 4D7YA 1SCRA 5J48A 3MFAA 2GNBA 4AVBA 4ZY9A 2ZEYA 1WMDA 5CVRA 5A3NA 4A7YA 2D6LX 3I8TA 1LESA 1C8NA 2D3RA 2GH8A 1Y9GA 2YBPA 2A6VA 1UIKA 1ACCA 5EXOA 3SC7X 2JDAA 1QU0A 2Z42A 4OUEA 3TRSB 4TTGA 3LEKA 5ACA1 2Q1ZB 3MHZA 5CFCA 5KXCA 3ZDVA 1HRI1 5F3CA 1UF2C 5IVFA 5JCTA 4DY5A 3AYCA 5FYHA 3NV3A 1O3QA 1LKNA 4UW6A 2Q0AA 4R52A 1LECA 2JX9A 5LWBA 1V6IA 2ZKLA 5LY1A 1C4RA 1SACA 2NP0A 1RUF2 1ULEA 4BM8A 1PMIA 3W59A 4GWIA 1QH7A 2WUHA 4Q26A 5FP7A 4P5YA 5FYYA 3ZYIB 1V6KA 4IUGA 3B3QE 2C5DA 1GWMA 2VE1A 2ZX2A 4XZUG 3T09A 3UGGA 4N9HA 5L36A 3MW4A 2ZXQA 2F4LA 3J7NA 4INDA 3I59B 1I6XA 2Q1MA 3JXSA 1H4GA 4XJUA 5FZ0A 1MS9A 1OLMA 4R8HA 2JG9C 2HWC3 1ZX5A 2JIGA 1WW5A 3GM8A 1ASJ2 3UGFA 4LKDA 5T52A 2R0FA 3LAGA 1LHUA 1YFUA 3KV4A 3MF6A 5K0UB 4I0WB 4MOAA 2RS32 1IQDC 4IV3C 1OLRA 1PK6B 2CV6A 2W52A 2ZJCA 2AYHA 3ILFA 4I30A 3UESA 2W94A 4DEVA 3WW3A 1O3TA 2OQ6A 1TMF3 2VMEA 2YFUA 4CP2A 2WO2A 3VZLA 5CEHA 1ZM1A 3SH4A 2WT0A 4FPLA 5C8CC 1B09A 4QGMA 4X6RB 2JB4A 1YWKA 3GHMA 3P3NA 5FZBA 5LRSA 2E7TA 4Q2FA 1SFNA 1APNA 1XYOA 1H4HA 3CZUA 1IQAA 1Z7S3 1DIWA 1OC1A 3MIGA 5GZCA 5JOZA 2A7AA 1A78A 4ZU4A 5G05L 4BJ0A 5DUXA 2K2SA 2WNUA 1STMA 2JB8A 4NIGA 2BRTA 4AFMA 1BLZA 4YRDA 4N43A 4Q4Y1 3L9JT 3VD7A 1JTZX 4CDXB 1VJ2A 4A41A 2WYFA 1WW7A 4JTNA 5IFPA 1E57A 4UI9L 2PLV1 3EO6A 4H2AA 3W9AA 3WF1A 1UZVA 1G6NA 3ZKYA 1LOFC 1OLME 1LNSA 2VY0A 4RQPA 5J09A 1J3RA 4LR4A 2AACA 1GOFA 1XJAA 4H14A 3T0AA 1OPOA 2UYBA 4BU2A 3VHNA 4YG3A 5GZGA 1G9AA 4K7JA 3A23A 2FCTA 2WS93 3IAPA 1QWRA 1ZZCA 3S57A 4QWNA 1URXA 2DU0A 4E8CA 3OGJA 1F31A 1VBB1 3OD0A 4QQOA 2GAUA 1UMIA 2ZGSA 2ZX3A 3ZSMA 3VB9A 3ZFEC 1PGW2 3H0OA 3FE5A 4HBNA 3RZZA 4YW4A 2E31A 1XC6A 3N3HA 4AVSA 4GALA 1TNRA 2VZQA 1JYTA 1AXKA 3VBOC 3S7EA 2AUYA 3JBG2 3KV6A 2W46A 5A1AA 5IK5A 4A4AA 1NA1A 3QBQA 1CJDA 3WHTA 5DUUA 5A3MA 1W2TA 3WUDA 4AHWA 3KV9A 4MGSA 3W21A 2LUWA 5GLZA 4V1PA 1V9U3 2RV9A 1OKQA 2C26A 4Q4W2 2ARBA 5F3GA 1FPN3 1ULFA 3QD6A 5IVVA 4UAPA 4QHOA 1IKQA 2D44A 1XBFA 4JQRA 5GZDA 4XF4A 4OCTA 3U0ZA 4L9BA 5FPAA 1VRBA 2WLPA 2QDNA 3ES1A 3MPPG 4GA9A 1IPKA 3H9AA 2D6KA 4LO4B 4BLJA 4CDQA 1LGNA 1MQTB 2QQUA 4CCKA 4H3WA 3AKRA 1S2BA 2GN3A 5BXXA 2VZSA 5FY0A 4QDSA 3DPRC 3KVAA 3LFIA 3WF3A 2BWCA 4L2NA 5HCBA 1MS5A 2DBIA 3J7HA 4FPCA 2W0XA 4K40A 4CCDA 2R7EB 2XH6A 5IVBA 4GMP0 1ZBA1 3LWCA 2CWMA 4CDWC 4XC9A 1UU5A 3S5AA 3FLPA 5JVVA 1WW4A 3JCIA 1JZ6A 4UFMA 2DURA 2X09A 3J8F2 1J83A 1L7QA 5F32A 1SZBA 1Q8PA 3N9MA 1NE6A 3APBA 4IEXA 3RDIA 4B7KA 5CKNA 2R041 5A33A 4DOUA 3AMHA 3MBWA 2OS2A 1W6MB 2LRPA 3WCRA 4QKBA 1CAVA 4RR3C 1KFXL 3JD71 2VVDA 1AX2A 4MSVA 3KLSA 4DS0A 1E5HA 1LHWA 3IIIA 5FBZA 1BQPA 1SEFA 4TXWA 5FUNA 3R0RA 1H8TA 1XXNA 2CL2A 5FLIA 5HI0A 5JZGC 1Z0HA 1GYKA 5FY7A 1RMU1 4IXLA 2X05A 4JZRA 1OOPC 4AK3A 3FWEA 4GJZA 3V0AB 2G9FA 2VM9A 3OY8A 5A6ZA 1DQ6A 1LRHA 2P1BA 2O8OA 2V5YA 4GWJA 3P1IA 1NE4A 4B4PA 4HLTA 5E89A 3E6CC 2KXLA 3K2OA 3WP3A 3U4SA 3EQEA 3EBRA 4KWUA 4LK6A 1HX6A 1OT5A 1R082 4R9CA 3UETA 1C28A 4MXVA 3VBFC 4LIVA 1V00A 2A6XA 1ZA4A 3MYXA 4DEQA 5CA6A 4FOVA 3DYPA 2BZDA 2ZX4A 5L7OB 3C8XA 1JW6A 2YC2A 1RL3A 4XYXA 2XB6C 3H7YA 2QQVA 2A6WA 2X5IC 1WCSA 2JKBA 3GXUA 3BB6A 3ZYRA 3NAPA 4CP9B 4JQTA 5CFDC 1ASJ1 1H8VA 1UYPA 2MNGA 4LE4A 4TZDA 3TB0A 3K46A 1KQRA 1K5MC 3FLRA 2DFCA 4RGKA 4UFIA 5LBFA 3VDDA 1W9YA 2BDRA 1Q8VA 4PQQA 1XU1A 1AF9A 2VZVA 2ZKNA 2RDSA 2XL7A 4WM8B 4LQRA 1S2EA 2Z79A 2ZGOA 1HRV2 3F2ZA 2J1EA 1SG3A 3M4FA 4IV1B 4Q4X2 1POV3 1MZEA 1W8ZA 2XBO3 3K75B 3WT3A 1DZTA 1LHOA 1NUKA 4M0NA 3WQ7A 2ZPXA 3U14A 3IT8A 4BHPA 1D0GA 3H8OA 3ON7A 4M4PA 1W8OA 4KBZA 1UCXA 3URFA 1Z78A 1UU4A 2ET7A 1BZWA 1ULDA 2PTMA 3M1HA 4GWNA 2VOWA 1XOYA 4YSFA 2EIGA 3KT4A 3G6JB 2QE3A 5HCFA 4JDNA 2H0BA 2J22A 4MGIE 3VKFC 1XE7A 2LTNA 3OPZA 1CN1A 3MW2A 3PMSA 4QXCA 4Y24A 5FP3A 3A0KA 3VL9A 4DNYA 1DYPA 5FV3A 5FY5A 1V6LA 5FZ3A 2Y64A 3BKZA 2B39A 2NZ9A 3J26N 3CZJA 5J36A 1C1FA 4GKYA 4MADA 5A7WA 5LEKA 3KSCA 1Q8OA 3RZMA 2RM23 1FATA 2R073 2JG8A 2VCAA 4LE3A 4DINB 3OJBA 5C8CB 4OMDA 4JDOA 4Q4V1 3DXTA 3J4UH 1MACA 4QXBA 3NJXA 3LA3A 2R1DA 3G7DA 5D21A 1ENXA 2ATFA 1VRH2 3BPZA 1SFYA 3OEAA 3MEPA 4A2UA 2ZEWA 3CBNA 3HWJA 5D8AC 3ASIA 4JRAA 3C7FA 4GQ7A 1DZQA 4UW4A 1IOAA 1RUH3 1VAKA 1KDKA 2BFUL 1KRIA 1UZ0A 4XDOA 3ZXAC 4AQ2A 1VE0A 4OI1A 1AR83 3T3YA 3HT2A 4KQ7A 1BEV1 4QPYA 1GANA 3VKLA 5IYYA 1WCDJ 3LEGA 1TE1B 4BZ4A 1GP5A 5BNPC 3MF9A 5CG8A 3ILRA 3AXEA 4XTMA 1NCRA 1LOEA 5FYSA 3H1MA 1YQ6A 4NN0A 1S4CA 4Y22B 5H9SA 4E4HA 4LBQA 1J59A 5EZWA 1ND2A 4QQHA 1W6OA 4DIQA 2ILMA 4Q4W1 1YQCA 4LBNA 4AEMA 4C0HA 1AX0A 2OX0A 3H42B 3ZR5A 4OI0A 3GYDA 2JDMA 3B93A 4CUBA 4AR2A 2DDUA 1RXGA 3EB7A 3DXUA 4W6YA 2VZRA 3VZMA 4A7KA 1F5FA 5HV0A 4FTEA 2IWGB 5BUVA 2XDVA 4E27A 2CU5A 1YI9A 2HYKA 1RUE1 1ZA7A 5FZGA 2E51A 2QQOA 2B7YA 4YVSA 4ZONA 4XQ4A 3C3VA 1NXMA 2Y6FA 4NAMA 1VAMA 3AL6A 1GICA 3CJIC 3VKNA 4C91A 1OVSA 3VBOB 1KD7A 1JZ3A 5J3UA 1YQ5A 5EJ3A 3KMHA 1YIFA 4NIAA 4IEVA 1H2LA 2ZBJA 3UNPA 1BMV1 2RS12 4PBOA 3H3ZA 3CNAA 1REEA 3PIJA 3I54A 3SCGA 2YC4A 5FR3A 3W5MA 2XQRA 3CO2A 2B46X 1RUF3 3BI3A 3KQRA 5FZFA 5C4WA 2Y38A 5AC91 3O1VA 1QMJA 2W1QA 3ZYJB 4XTPA 1G9FA 1QIQA 3RWNA 3UK9A 4CEYA 3MUZ1 1HLCA 5KHGA 2HWC2 3KF5A 2EXIA 2YY1A 5FZHA 3DPRB 5FZ7A 4YNIA 3O1UA 1W0OA 1U5IA 2VGDA 1X8MA 4W8JA 5GKAC 2GMMA 1UY1A 5DG1A 3WR0A 4DUVA 1QF3A 5CAZA 4XMIA 5FYVA 1GV9A 1VR3A 1DLLA 2JG9A 1TMF2 3LE0A 1PNGA 2A70A 2WFF2 2W91A 3NKTA 4I3PA 4JGYC 4OZXA 4YW1A 1NY72 1PVC1 3WV6A 4CYDA 5C3QA 2W3JA 5GZEA 2RS33 4CDWB 3LKJA 2ZOEB 1NCQB 3KD4A 1FNYA 3VD4A 1CAWA 3AFKA 3PTRB 4NR1A 5GALA 3CMGA 4OHZA 1HQLA 1R081 1UIJA 3Q8CA 2ZGLA 3B7MA 4KWLA 3ABZA 3GCWA 1XYPA 5A7NA 1SLAA 2SLIA 1D4M1 1KGYA 2PAKA 5JPMB 2ET1A 4HSJA 2WNEA 3OBTA 4URTA 4PLMA 5LA2A 1H2KA 4HETA 3MIBA 4UFLA 4LMFA 1OF4A 2QQKA 3MZHA 3FL7A 1PZ7A 4EROA 2XWJB 2VPVA 1OFSA 2RS52 1RUOA 3VV1A 3OYWA 1CIWA 2BWAA 3WG2A 4RHV1 1C1LA 1VAVA 2FCVA 4QHBA 5EV7A 4BH9A 4CXWA 1RJ8A 2X10A 2JDPA 4XCBA 3V0BB 1AL0G 2IFRA 2YV8A 3RS6A 2WQ8A 5AFEA 2RR13 2BGCA 1F5JA 1LOCA 1VALA 4IW3A 4N53C 1R091 3FHQA 4UBGA 4CP1A 3WOGA 4L0PA 1RUI3 3OCPA 2ETEA 5JWPA 3T1MA 4LHSA 3RVHA 4AI2A 1WA4A 1QJU3 3A7QA 2IXLA 4KG0A 2KD7A 5CFDB 4COYA 1SBEA 3SEEA 1YJLA 1K5MB 1O8SA 2L9LA 2XONA 3ZN4A 4QGLA 2XLAA 5L9RA 3R05A 1UU6A 4AGRA 2W47A 1ZZ6A 1DQ1A 1G86A 1WUVA 1V9U2 5FJKA 4LBMA 4JGZC 5F6KA 5HCHA 4BISA 2BW8A 4A3XA 1O3SA 2RMU2 1FPN2 3JBG3 3VDAA 3INAA 4K6BA 1DGWA 3EYPA 3D8CA 4IGPA 4NUBA 4M3CB 4ARYA 4MXWB 4FPGA 2VZOA 3WQ0A 1DYOA 5DAPA 1FYUA 4YW3A 4ZPIA 3NJYA 3B01A 1RYYA 1RHI3 2AENA 5CB7A 3USUB 3ZSJA 2B9VA 3SCHA 2VO5A 3WDYA 5C5TA 3CDZB 5JI9A 1W0NA 4UF0B 4AZZA 1YFWA 1EYBA 1O7FA 1S0DA 4I02A 4IEOA 5FPLA 1Y7BA 1F9KA 4XHBA 2A5ZA 2WZR2 5FXWA 2VOVA 3M3CA 3ACFA 5AFBA 4XMAA 3E1F1 5FYUA 3DF0A 1ZRCA 5I8SA 1N47A 1FMD2 1UQXA 4MVTA 4D94A 5FUPA 3M2MA 5K0UC 4E8DA 3IDAA 3AKPA 4KH9A 1WLCA 1DCSA 2E6VA 2K46A 4FFFA 3T1LA 1X50A 2E53A 1GLHA 1L7LA 3MLJA 4HPKB 4CEWB 5A70A 2WLQA 3IKWA 1WCUA 4D3WA 4ES8A 3SITA 3KB5A 3OOXA 2PHRA 1MS0A 3K48A 4XFFA 2V09A 3HQRA 2J42A 5IT6A 1GUIA 4KNCA 3VBRA 2P3JA 2ZAHA 3OPWA 4LO8A 2C9AA 1GOGA 1S0EA 4KGGA 4Y5Z0 2E33A 3PLQA 3J8F3 4BDVB 2W1SA 4KWJA 2JDNA 2VC9A 1EUTA 2WO7A 3OUIA 5FZOA 4GJYA 4PIXA 4R9DA 5CZKA 1VIWB 5JXJA 2VVEA 4QPGB 3VLBB 3BU7A 4BQWA 3D4KA 2LM3A 4CDXC 2TBVA 5BNNB 4RS5A 1DQ5A 4TLGA 4P9WA 5FO8B 2V5DA 2Q8CA 4BIOA 4CCOA 3UJQA 3I2IA 1COV2 5A3PA 2EAAA 2BVVA 1WZXA 4PI0A 3ZYFA 2ZCWA 1Q5OA 4K1ZA 3S7IA 2HWC1 2C6SA 3R4DB 4IEWA 4Q27A 1KXGA 3TBDA 1NQJA 4DPNA 4XJ9A 1QOOA 1OQEA 3O1RA 4UFHA 3C2UA 1ZREA 4L99A 4XQDA 4COZA 3I2JA 3IDEA 3RMXA 3NKGA 4QPWA 2VXJA 1S0IA 1GFF2 2BOIA 3NV2A 3WNMA 1G7YA 4WM7C 3WDUA 1RVF2 4GKXA 4S2FA 3ZFGB 3U37A 1TMF1 5LBEA 3ACGA 3M3IA 2VZUA 4LUMA 1NY71 1F2NA 2XBO2 4XFHA 4PF1A 5ABJA 5DQ0A 3MV11 2DVDA 1GSLA 3WY6A 5FO7B 4CDUA 1QNYA 1QOSA 2DVBA 4WZFA 3THPA 4CPBA 1Z7S1 3AZXA 1HRV3 4Z2AA 2P5BA 4Q4X3 2WYSA 4JHZA 3EJKA 4QPIA 2EXHA 2OPKA 4P08A 1ND3C 2R16A 3AP7A 2IFWA 3U11A 1LGBA 4XACA 4Y5TA 1G8WA 1LULA 2WZ8A 2UYAA 4QU2A 3NJZA 2XKPA 2UWBA 1HV0A 1ULGA 3MIEA 4QX7A 2XJVA 1W99A 3SCFA 5CU1A 1WBFA 2XMLA 2W95A 4W6WA 1K45A 2PHXA 2DVFA 4DMIA 3O14A 1W8UA 4IGOA 4MGKE 1SMVA 1DHKB 2E63A 3N36A 3ZN6B 3C7GA 4C1XA 2RM22 2R072 2DYCA 3O1MA 2RVAA 4MZUA 2QZ3A 3LSDA 4UYBA 5DPNA 4AXOA 2ADEA 3IN9A 1W3XA 2QFEA 2W2IA 4S2HA 4XDQA 2VUJA 5FJHA 1P8JA 1RUD2 1Y43B 3NV1A 4XCAA 2WS91 5LA9A 4Q8KA 3J9SA 1FAYA 4Q0VA 1PHMA 1FV3A 1HB3A 1OLQA 4QM9A 4OFGA 1BVVA 4FQ4A 4I09A 4IEZA 4P9LA 4XF0A 3RI9A 2ZX0A 4DZGA 4YZ2A 4MG2A 1VRH3 1XPWA 3ENRA 1AR82 2E9QA 3PURA 2DCJA 4YFWA 5EFUA 3MFCA 3MPBA 5H9RA 3VD5A 5IVCA 1BBT3 5KHIA 2K9ZA 4OYUA 5FZ6A 5J1XA 1OI6A 4BLIA 4BQ1A 4Q0UA 5IAVA 2WR9A 4FP3A 4QAWA 4RN5A 2WSUA 2O14A 2VZPA 2GC3A 4BK4A 2MPFA 1W2AX 1C3HA 1FXZA 4EYUA 1QOTA 1V9U1 4CU9A 3O1PA 5FXZA 2J1TA 1FPN1 4P9JA 3FJSA 5BNPA 3ACLA 4M3CF 3BGAA 4EZHA 2D98A 4NHLA 4N43B 2WNVA 5CYYA 5BNOC 5T55A 4FPFA 1W8TA 2LALA 2FMYA 2IVJA 4N53B 1QJZA 1VBA2 5F39A 2VW2A 3WG1A 2DUPA 4XHXA 3I3EA 1AHSA 2QCSB 4AQ6A 1AYN3 1CONA 2ZHLA 3L2HA 3VBSA 1C57A 3VHOA 2XR4A 5L7OC 2J1UA 1IPSA 4YW6A 5JAXA 4RQPB 4XDPA 3NNMA 1SLBA 2OIIA 5FYMA 4BQ3A 5B4XA 1UW8A 5FMBA 4XFBA 4AI1A 1LU2A 4QM8A 1A8DA 4IE4A 4HT1T 4OVEA 1FOD1 5FAXA 3PU3A 4PIZA 1AJKA 4JGZB 1EPZA 3WLUA 3UJOA 3U75A 4WM8C 3TEZA 1ZRRA 2PHFA 2CTVA 3IPVA 2PHUA 2DVGA 3DUIA 1SLCA 5I0UA 4IV1C 1ENSA 5ERLA 2RS13 4CU8A 2BUKA 1US2A 4LULA 3RMYA 1O59A 2P6CA 4JDMA 4LK7A 2VULA 4Y33A 3S0MA 1NA1B 5LY2A 1AL23 4EJRA 3WF0A 3WVJA 1F15A 4HVRA 3N4MA 1KS5A 4AEDA 4FVVA 2ZGQA 4P9YA 4KG8A 1DF0A 4PDWC 1UY4A 1H6XA 5DMYA 1QDOA 2DWRA 2UY9A 2XJRA 3BIEA 1W05A 1UZWA 2HEWF 4HKOA 3WP4A 4EWAA 1IGOA 2D6OX 3MI8A 4MGQA 5DZEA 3WNXA 3GDBA 1SHWB 2P6HA 1PO12 4IE6A 4BQ5A 1TG7A 3OB8A 2VMFA 3Q8AA 4IETA 1ZBE3 4YM1A 5FPZA 5LA0A 1B35C 1O5UA 4AEJA 2YUEA 2WFF3 4AAPA 4QB6A 5C9AA 1I3HA 5JIAA 3IAQA 1LOBA 4C8DA 5A32A 5BY5A 2H6CA 1OUSA 1BJQA 3NV4A 4MHUA 4NHYA 1YCIA 5AVAA 4BQ4A 1V6OA 2JXAA 2KM2A 1O5LA 4GAZA 4PIYA 5FXXA 3MIFA 1CJPA 3VBUA 1DGRN 2GDFA 4WZCA 1UY3A 1TVGA 2BV4A 4IQPA 1GNHA 4FFGA 2Y0IA 4WVMA 1S2KA 4CVUA 2H6BA 4LJHA 4QXKA 3BTAA 3LPGA 4XJAA 2WN2A 4NRPA 1Q8SA 3GBFA 1QY4A 4XBNA 5FYTA 5EP9A 2WT2A 4Y4RA 3GCXA 1LTEA 1POV1 2HLEA 1Q56A 5DAXA 2XBO1 4Y5SA 2NQYA 1GWKA 4QMAA 4OQ9A 5F2WA 2RS53 1YQ8A 2RR12 3LQCA 3Q8EA 2YDEA 2OT7A 2W68A 1Y9QA 2DUQA 2HKXA 3DL3A 1RUI2 3OGSA 4MX3A 2Q4SA 4NHXA 2LROA 2WJSA 4R9BA 5D2AA 3T2TA 3ZIWA 1DQ4A 3B9CA 2AZ5A 2VOTA 4ITCA 4EV0A 1QJU2 1AYM2 1DYKA 2VNGA 2XJPA 2XXZA 1OD3A 2P3KA 2WAAA 5I0DA 3T2PA 2NN8A 2BNMA 4Q0QA 4WVWA 2UU8A 3SH3A 5KHJA 1SDWA 4YW5A 1CAXA 1RINA 4HOOA 4LPLA 2R062 1RGSA 4WM7B 4V2WA 1ZZ8A 2EIDA 2RM21 2R071 2WA4A 4NROA 4A45A 3WD5A 1JHNA 5IVJA 4GB33 1CWPA 4YVWC 2GNDA 4YGEA 2W87A 1CR7A 3I97A 2VTXA 2VMHA 5C6CA 1RHI2 2ERFA 2I2SA 2RMU3 4SBVA 4LOTA 4XBQA 3VDDB 1ST8A 3E5QA 1VPHA 4LOSA 1XQNA 1ND3B 3X29B 5CG9A 1S0GA 4IE7A 2FDFA 4KGQA 1RUH1 2PAMA 1U5XA 4GZ9A 2BEOA 2HBTA 2PA7A 4IL7A 1D2QA 1POQA 1YHFA 3IB3A 2WWSA 1AR81 3LF7A 1UWWA 4P00B 2Y33A 2R0HA 4E2SA 2WWUA 1NZCA 1UX6A 1VB2A 3A4UA 2IXHA 4YZ1A 1OH3A 1QXJA 4PCRA 2TEPA 1RUC2 2OPWA 3MV01 2FQPA 4XILA 3I59A 5BV6A 4C1WA 2NYYA 2WZR3 3KQ4B 4FXGB 4QQLA 4CXXA 2XLGA 3AJYA 5FLHA 2ZACA 4IERA 1FMD3 3AKTA 3AVRA 3I49A 4AGVA 1NKGA 2D6NA 5DG2A 2ZA9A 3KZ4C 3AXDA 1N3PA 1NCQC 1PK6A 4LKEA 1PGSA 1ZZBA 3LDBA 4XJZA 4A7ZA 2YC0A 4XJ8A 3RZKA 1XE8A 3P6BA 2RDNA 3AP4A 4DXTA 4URAA 1F4HA 4XBLA 3JB4C 2DCZA 2GC0A 2QQNA 2JDUA 1WD4A 3LPFA 5ACA3 4AI8A 4MYEA 4BK5A 2HWD3 4NVPA 2JG8B 3ZIXA 1GZWA 2OUJA 2XUMA 1OF3A 1WCQA 1DGRA 5A7SA 2WAOA 2GC2A 1FI2A 2QBXA 5FWJA 4FQZA 5JUVA 2CDPA 3ST7A 3KV5A 3CU7A 4DY3A 3BTYA 3B00A 1FT9A 1J58A 1YLLA 1PIV3 2O8QA 1CESA 1H2NA 3PMEA 1JZ2A 2ZS6B 3VHPA 4C0BA 1RUF1 2HWB3 4AYUA 3QH6A 4QX8A 1HJFA 1WMEA 3CHXA 3ILNA 1M06G 5BNOB 2XGXA 3U4XA 3RJ2X 3ZYPA 2VNOA 2OXBA 1X9PA 2HWE2 2KR2A 4QX1A 4EZ4A 5I0RA 3ZO0B 2DF7A 4I0AA 4XJWA 2VW1A 3K51A 4Y1UA 2Q8OA 2ARAA 1COV3 2CGOA 2PHWA 2VQUA 1VBD2 3AMPA 3KGLA 4HK9A 3IDCB 3H8XA 1QJY3 2ADDA 2AGSA 5FQ0A 1ND2B 1AR62 2UURA 3MDPA 4LXLA 5H9QA 3U78A 4BOWA 5DAWA 5L9VA 3FX3A 3QLQA 2W92A 1ULCA 2ORZA 1MS8A 1JOBA 5CISA 2RS31 4B4RA 4HKWA 1J1TA 4BE3A 1HV1A 1F35A 2YMZA 5GLTA 4ASLA 1QHDA 1RVF3 1SBDA 2JD9A 2ZGPA 1I9RA 3AMMA 4CXYA 2DUOA 3S30A 4YVSB 5FFOC 2FZ1A 3POSA 1UN1A 3FUQA 3N35A 4XW3A 1OUXA 2VVFA 5T50A 3VUOA 4MGTA 4QU1A 4BYYA 4GH4A 3VKMA 2A3XA 4X8NA 1HW5A 4QQ2A 3AYEA 4PDWB 2Q30A 1IS4A 1WMFA 4FP2A 2HWF3 1JN2P 3OUJA 4QXHA 1OQDA 3BOPA 1SDDB 3VBHA 4BXSV 5FKBA 3OGGA 5C4WB 1W39A 4ASKA 2XPJA 4YZ5A 1YC61 4NOTA 4XZPA 4CEYB 1MQTA 4MLOA 3JUUA 5JR7B 1W6NB 4H7MA 2VOXA 1B35B 2WO3A 3NVCA 5IAXA 3BVCA 3OF1A 1F8VA 4D7SA 1BK1A 1VBE2 2GH2A 1RUJ2 2G9ZA 3D82A 3K4ZA 2RR11 4CEWC 4N8MA 5JOXA 2BNOA 4CTEA 5F5AA 3CLPA 2RJKA 3HAGA 1RUI1 1PO22 4P02B 4ZXKA 1IPJA 1OA3A 4YYOA 3WDWA 3WNNA 4COUA 5IATA 5KBFA 4Z2WA 3DN7A 1QJU1 1RUD3 2XVLA 4AVTA 4LHLA 2F6BA 2NMOA 1BBT2 1NT0A 3IIAA 2D93A 2YBSA 1QJX3 3I7DA 3TWIA 2K0GA 5LZ6A 5FPBA 3ZFFA 3CQOA 2P4EA 4XURA 1NAEA 2Q8EA 3DKWA 3PUIA 5HBAA 4IEYA 1PGW1 4Q29A 4UXAA 1N1TA 1W9SA 1GU3A 2WT1A 2XHKA 2D3PA 3E97A 3VGIA 4P9XA 4QPGC 4ATEA 3POWA 2FZ2A 3JBG1 2MEV2 2LS6A 3JQXA 4GD4A 3JB8A 5BNNC 3VD3A 2O0OA 3JQWA 4UBHA 3AP9A
chains in the Genus database with same CATH topology
3RG0A 4LBOA 2ES3A 1IKPA 1RHI1 3WP5A 1AYN2 4BPZA 4Y20A 3V0AA 1PZ9A 1X36A 5KWRA 4K8FA 4FPHA 3UKTA 2GNTA 1UZZA 1J3PA 2IZWA 1R1ZA 1VBA3 3N7MA 1LEMA 5JSRA 1OFNA 3ZXGA 5FPXA 5K8SA 3SXWA 3ELNA 3NW4A 5JLVA 4F83A 3AP5A 4AHZA 3Q9OA 3VZNA 4Z8BA 1VB4A 5L7OA 3UKNA 3AZYA 4LUKA 4GMP3 4I0BA 5L73A 3ZFGC 1V6NA 1EPWA 4YVWB 4Q1PA 5A3LA 5CFCC 2G4IA 2XJTA 3ZMNA 5KXEA 4XE9A 1TNFA 3HBZA 5JSOA 1OA4A 5DUVA 1AL22 3USSA 2R30A 3J8F1 1CGPA 4E2GA 2YROA 4G3YC 4LHNA 4UW5A 2JJ6A 2BYVE 3JD73 4FPKA 1MZFA 5FMOL 1Q43A 1YI7A 3E6BA 1H30A 4WBBA 1TME3 2YXSA 2I07B 1ZBE2 1XNDA 4O9GA 1CAUB 3EHKA 2JE9A 5KXBA 1PZ8A 1GQGA 4FTSA 3WX5A 1EP0A 2YZ4A 3PVBB 1LOAA 5FO9B 2QDRA 1PO13 2ZGRA 3AKSA 5FCCA 3JZVA 2VOKA 4IV3A 2G9GA 5IUQA 4Y1VA 1EV12 3LZZA 3WW4A 4FO9A 3O5SA 1GKBA 4JC1A 4B8EA 5C8CA 1SCSA 4AEKA 1RB8G 2X53S 1YFYA 2VECA 3KCXA 4KL1A 3UL2A 3FFQA 1SLLA 5J37A 2WNUC 1HRV1 4M00A 4XFIA 1GZCA 4Q4X1 1ZVFA 3QCWA 4N43C 1O91A 4OLLA 3H1YA 1EAH2 1H1IA 2PQQA 1MS3A 1MEC2 1KFUL 1LOFA 3SHRA 2I74A 4RS5B 1QXPA 2IC1A 2ZGUA 2DU1A 2P34A 3ME2A 2A6ZA 1WBLA 4AVCA 3HT1A 1AYM3 3VN4A 3TN92 1DU3D 4RQPC 5F1RA 3AK0A 1VP6A 2XJUA 3IBMA 2PFWA 4GB32 1ZZ7A 4F8AA 1AR92 4JV4A 2R063 3ZFEA 4NPRA 4YGBA 3LGRA 2JICA 1CQ9A 3RI8A 4CZSA 3KS7A 2JENA 2BFUS 1O4YA 3VBOA 1C5IA 1HXS2 4P9IA 4Q0PA 1VRH1 1IS6A 1LGCA 2DFBA 3IMNA 4XXAA 1NA1C 1BBT1 3AB0A 4E2QA 2YYOA 3NWKA 5I0SA 4CDUB 2JDZA 5KHKA 4LLOA 3M8LA 5DDJ2 2P3IA 2X29A 5T5OA 4X6QB 1R1A2 4QPIB 3BOWA 4I01A 4HMZA 2ZAAA 2XWBB 4HSLA 3DPRA 2Q5TA 1RUC3 4CDQC 1QNWA 2VW0A 2HEVF 3QACA 3V56A 5FTTC 3DGTA 3OBRA 4HKLA 4D7TA 5FDBA 4L92A 3QOPA 4J1XA 2AH2A 1AYN1 1Q8QA 1SBFA 2UY8A 5ACA2 3ZX7A 4CDWA 2HWD2 1HRI2 3DV8A 5SV5A 2I45A 3WQ1A 1G9BA 3KT1A 4FPEA 3S6PA 4PJYA 1S0JA 1I5ZA 5GM0A 2XVKA 3B69A 4AWDA 1PIV2 4FXKB 3E6DA 4RR3A 2HJIA 2ENRA 1NG0A 3SMHA 2HWB2 2BVBA 2KA3A 5FOBB 2RS11 2XKOA 1PNFA 2NM1A 5JZGA 1I1EA 1OOPA 4OHYA 1U0AA 4LO7A 1H8TC 1QJY2 4Z82A 1NOVA 1D4VB 3IDBB 1W0PA 2HWE3 2WZPP 5K7PA 5KXDA 2GC1A 3FC0A 2WNVB 1YYNA 3VBFA 1VBD3 2D5FA 3BODA 1LR5A 4S2DA 1S1AA 1AR63 1YJKA 3MLLA 4EN0A 3GBGA 1BYHA 3GBWA 2X5IA 3WP6A 2EF6A 3MGUA 2WFF1 2CYFA 5CFDA 4AFCA 4Z92B 3JU9A 5CFCB 1K5MA 4O9EA 4YARA 3ZN5A 3ZXEA 4XF9A 4L8QA 3NAPC 1UKRA 2A75A 4AFAA 4LEJA 1U5YA 4LTAA 3VDDC 2EAKA 3PNAA 4PLOA 4LO5B 5EWSA 4JVAA 1J3QA 2A71A 1GQHA 5GLUA 1DZRA 2HWF2 3AFGA 2OZ6A 3ZYGA 4M0HA 3RYRA 1UAIA 2WA3A 2ZGMA 5BYNA 1WW6A 4XOGA 1CX4A 3MIDA 2D3SA 2IXKA 1W6QA 4TYSA 4DQAA 5EYYA 2RS51 3WG4A 4AEDB 1HQWA 4L11A 2W08A 2YHJA 5JDBA 1W6PA 4WV8A 1WLDA 1JH5A 2DCYA 2WQZC 3KCCA 1VBE3 2D40A 1CPMA 1RUJ3 2NLRA 1EY2A 1LEDA 1LU1A 1CPNA 1QJX2 2C0ZA 4HPKA 3HIFA 3RYPA 1PO23 5I8TA 5C9AB 3ZSEA 5A32B 2JG8C 3MIHA 5D8AA 1QKQA 3FZ3A 2A73B 3VZKA 3VBUB 2Z5WA 4GB31 1C8M3 2WC2A 4PQ9A 2P17A 2WNUB 3LSEA 2GALA 4NHKA 4DXZA 2RMU1 2BNNA 1OMIA 2MEV3 4KU7A 4FAGA 3ZSLA 4XQWA 2ZZJA 4NWVA 3GHNA 4GIQA 4AE2A 1M4WA 1ENRA 3GZUC 5T3NA 1NCRC 3WDTA 3PJQA 4MUVA 3AX4A 3AJZA 4FCAA 2WSVA 1NLRA 2HEYF 1ND2C 3IM0A 2WZR1 3PVEA 1H2MA 4EN9B 1LODA 1ZBA2 3CJXA 3FLTA 4Q1RA 2D97A 4BCUA 1FMD1 1S55A 3M3EA 3MICA 4DRVA 1YIPA 3B9IA 3CJIA 3TOJA 1CAXB 4YVSC 3ZFGA 2R042 1KJRA 3SISA 4FOYA 2VMGA 3JD72 1A3KA 1NXD1 2EA7A 2HWD1 1REFA 2VXRA 3ZXKA 3AYAA 3H1WA 4YM2A 4Z1VA 4AF9A 1OSGA 1V6JA 3AYDA 4HN1A 1VBC3 1HQNA 1OPMA 4Y1YA 2ZHNA 4R4XA 1TME2 4GULA 1RMU2 4LBLA 1X82A 4YGDA 2Z69A 2B5HA 4AI3A 2GSYA 1AXYA 1PIV1 3LB9A 3BCWA 4JTOA 5C4WC 1QQP3 1WLTA 1RUG3 3FMGA 4CEYC 2HWB1 3O0WA 1L3JA 2VH9A 4CDQB 4U2AA 2DCKA 4LA2A 4XF3A 4HL0A 5JOYA 1LCLA 4GXLA 1PM7A 5JI7A 1MVQA 4I3GA 4AFBA 3ZN6A 3MW3A 1S0FA 4JGYA 1UPSA 1COV1 4Q0SA 2ZGTA 4C90A 3NL1A 1EV13 1QJY1 5JIUA 2YGMA 2ZABA 4LBQD 3HD8B 2ZMNA 5EYXA 1V6MA 3ZPYA 1UKGA 5BPXA 1RVF1 1AX1A 1WLWA 3O12A 4IESA 3I2DA 5A33B 3O0XA 2NMNA 1CAVB 3H7JA 1GZWB 1POV0 4X8PA 4LHKA 3QH7A 3PJYA 1RIRA 1H8TB 3UKVA 3W58A 1OQ1A 5KC6A 3TAYA 1AXZA 2D5HA 2D6MA 1EAH3 2HWF1 3OY8B 1MEC3 3VHRA 5C33A 5I93A 4XETA 3BIWE 4N53A 4LNVA 5L19A 1HIXA 3RSJA 2DTYA 4AVVA 1G9DA 3RYKA 3TN93 4DFSA 3E5UA 4EWEA 1YUDA 4OHVA 4Q4V2 3ROUA 5FQ0B 1TEIA 4AI0A 2BTVC 5CIRA 1AR93 1RC6A 1G9CA 1JYCA 3NAPB 2E7QA 2EALA 1JBCA 5E88A 1ZYBA 2V73A 1RUD1 4QX5A 4JGZA 5D1IA 5K9YA 1QJX1 1HXS3 1OHFA 4AHXA 1YNAA 1NLSA 5DUWA 1S0CA 2N7GA 1IZ3A 2PYTA 5CBLA 1BEV2 4XIOA 4JAAA 4TLFA 5I91A 3BALA 4Y4YA 3LA2A 5KC5A 4W65A 1LJ7A 3ZDSA 3FBMA 1S0BA 1NQDA 1AR73 5DDJ3 4GH4B 4BIFA 5SV8A 4YLZA 4META 1R1A3 3AM2A 3D5OA 1DG6A 3L2YA 2JE7A 3AMNA 3VBHB 3GALA 3WZ1A 1PGL2 4I2OA 5K0UA 2QJVA 2ZTNA 5FLJA 5HXVA 2XVGA 4P14A 4W6XA 2IXJA 2CAVA 2VG9A 4S2GA 1VBA1 1GBGA 1RUE2 4K9SA 5IK7A 2DCTA 3HQXA 2ZX1A 2MHFA 1DQ2A 1HRI3 3UV9A 4E4ZA 4ISQA 2GU9A 3TNPB 5E16A 2CGNA 4GMP1 4K20A 4F3JA 4N90A 1BMV2 1KITA 4PF5A 1N3QA 1SLIA 4FTBA 3VBRC 1FOD3 2GMEA 2A3YA 3OD4A 5TSWA 4Y26A 1YFXA 3ZFFB 2SBAA 5AC92 5LK5A 4YFZA 1HKDA 3A0NA 3ZXLA 2QNKA 3THTA 4E4SA 2CY6A 4CDXA 2ZHKA 5CNAA 4E9KA 3R6SA 4R9AA 4B4QA 4XPVA 1XNBA 1DDLA 1NCRB 4TSVA 1O4ZA 4RS5C 1LOGA 2B42B 4LBQB 1WGPA 1ALYA 1XNKA 3WHUA 4Q8LA 1AZDA 3RQ0A 2QVSB 1NYWA 2GZWA 1TME1 1W6OB 1WCKA 4Y20B 5T5PA 2XJQA 4COVA 4E4DX 1PVC2 5T5LA 1JUIA 2OA2A 3FFZA 4B7EA 4BA6A 1PO11 2GNMA 3OTFA 4HK8A 4HN0A 3H3UA 1KS4A 1X33A 4JRLA 4WM7A 2D6PA 3ECQA 5E8AA 4FOQA 3FBYA 3TYJA 1MVEA 1D4M2 3LOBA 2WFPA 4IEUA 4EN8B 2PHDA 1JYIA 4FPJA 1RUNA 3V65A 5ABJC 4CDUC 2Y26A 1ND3A 4Q4Y3 5J96B 4FSJA 4RHV2 4Z07A 3ZXDA 3FHIB 2FBEA 4QPIC 4QT6A 5GZFA 4YZ4A 2D43A 4K3UA 4YM0A 2DVAA 2PLV3 4WVZA 5JSPA 1OA2A 3ES4A 4LBKA 2ZGKA 1R092 2P37A 4HFSA 1XU2A 2D7FA 2FMDA 4NWWA 2JG9B 5CADA 4N7UA 1AYM1 1HDKA 1A8MA 2BPA2 4DRRA 4AGGA 1VBB3 4DB5A 1H9PA 1N1SA 3HN1A 4IV3B 4P5HA 4UW3A 1BXHA 1SLTA 1CAWB 4QQPA 3WXPA 1C8M2 2QZ2A 3SH5A 3WW1A 2R061 4N7IA 1W6MA 2XG3A 3O7OA 5JPNB 1ENQA 1BVP1 4COWA 2XLFA 4FAHA 2JEMA 4MV2A 2F4PA 1MS1A 2WINB 2WQ4A 5I0TA 3AKQA 3ATGA 1GR3A 4OUSA 4OULA 2YGLA 2A6YA 5FRAA 2E7AA 1AUYA 2AREA 4EWDA 3B02A 2Y0OA 4AHYA 2EXJA 1XYNA 3OYWB 4LO6B 1BCXA 5BNOA 1UMZA 2VQAA 4XFGA 4HVQA 2NPIA 2A3WA 3CEWA 2YPJA 1T6GC 2WNVC 5H9PA 5JMCA 4XEZA 4RGAA 3VZOA 1RUC1 5FOJB 4YM3A 3AZVA 1C5HA 2GN7A 3VBSC 1ZBA3 4XF1A 1XNCA 1QH6A 1PGL1 2TNFA 1AJOA 4M01A 1SQ4A 4U36A 2VQ0A 3D6EA 2PHLA 5C8WA 4WM8A 4H7LA 1ZZ9A 1VBC2 2R043 3ZFEB 2ARXA 4IV1A 4FBFA 1J1LA 4AFDA 5LRRA 1MZ5A 4RD7A 2CAUA 5DZFA 1QQP2 5GLWA 2RJLA 1RUG2 2EXKA 2OZJA 3PVOA 1DBNA 5LEJA 4P9GA 1H0BA 4AVAA 1RMU3 3M3QA 4PDWA 1PVXA 5AVPA 1Y3TA 2IXIA 4FOWA 4WVVA 4AEDC 4XXPA 1YRZA 2X8KA 4B3NA 2O1QA 2XL9A 4FPYA 4ES9A 5DZGA 1UPIA 2PHTA 2DTWA 5F9TA 3GZTB 1W6NA 4MGZE 4H55A 1B35A 4ORFA 4ZKTB 1LENA 2BBVA 2HWE1 4QD2A 3KT7A 3H8UA 3EXUA 2IXCA 2BQPA 2QUOA 1VBD1 5BNQA 4K1YA 5E1RA 1AR61 4B29A 5C9AC 1N1YA 1ASJ3 1JXNA 1ZRDA 2UWCA 5GLVA 2QQPA 4OHXA 3VBRB 4YG0A 1CD3G 3WINE 3VBUC 1CVNA 1MR5A 4PBPA 2W39A 1UD1A 1Z7S2 1DGLA 1WD3A 2JECA 3WDXA 2Z2SB 1YXWA 4LA3A 4RR3B 1ONAA 3M3OA 5T5JA 1RTVA 4KBBA 4Y22A 1N1VA 1QDCA 1O3RA 4NHMA 1OD5A 2WIIB 4N9IA 5JZGB 2R6QA 1D2SA 1KJLA 1OOPB 2JD4A 2C1FA 1LB2A 5DXDA 5HCAA 3GF6A 3RRDA 1FX5A 2UWAA 2QKDA 4MGYE 3U07A 3AZZA 3KCYA 4AQSA 5KHHA 4YGCA 1RITA 3H50A 2WS92 2GMPA 1VBE1 1XRUA 3VBFB 1RUJ1 5J98B 3RPQA 3WW2A 4Q4V3 4AW7A 2VU9A 1AVBA 1PO21 3SNMA 2R32A 3SLIA 2X5IB 4YVWA 4MH0E 4KU8A 4RGGA 1W2UA 1IS5A 1IS3A 3N7JA 3D0JA 5ABJB 2PAEA 3N7KA 2CNAA 3LOIA 4HANA 3MLKA 3PVNA 1AR72 1LHVA 5IK4A 1BEV3 3LA7A 3V64A 3ZSKA 1C8M1 2FHRA 4BMEA 3PTYA 3VL8A 1Q3EA 2ZMKA 2ZHMA 2MEV1 4LLFA 3RJRA 4YZ3A 4KWKA 3PHMA 1GZ9A 5J7MA 4ISRA 4Q4W3 1CAUA 1FV2A 3AMQA 4CP0A 4QGNA 1W6QB 3VKOA 4XFCA 3WUCA 1JUHA 1NCQA 4RL7A 3VZJA 2AR6A 1RUE3 4NO4A 1W6PB 1FOD2 3M70A 2H0VA 1PK6C 3O0VA 5JOWA 1MZ6A 2EVXA 1H1AA 4TWTA 2B8MA 1KDMA 1X8EA 4AQTA 1U12A 2B9UA 5D8AB 5FMOS 5AC93 4JCKA 3IWZA 1AL21 4HVOA 3ZMOA 2PELA 1VBC1 1RJ7A 4Y1XA 3WCSA 3B94A 5BNPB 3V0BA 1D0HA 4F7ZA 4R4ZA 1QQP1 1IHMA 1RUG1 3KGZA 5F6LB 2TUNA 4ONUA 4GWMA 3RNSA 3AZWA 3ETQA 1H1MA 1N3OA 1ZBE1 5FREA 2ZGNA 3GNEA 3I4IA 3VBSB 3NSTA 1PVC3 4D69A 3FUOA 2ZZQA 4FT8A 1U5ZA 1V70A 2OUHA 4OI2A 1DGWX 4Z2WA 1TQ5A 4CRQA 2CWSA 2P2KA 1DQ0A 1EV11 3NO8A 1R083 2VUAA 4IEQA 2OW4A 5LK7B 4LT5A 1A6CA 1D4M3 2RHPA 4IEPA 3CJIB 4OUMA 2XJSA 3HR9A 3IPVB 4Q4Y2 5IK8A 1VLNA 4M3CA 4XIKA 4MXWA 3D0SA 1REDA 3CL1A 3USUA 2PLV2 3R4UA 3WDVA 4GH4C 4RHV3 1DFQA 4K21A 4J6GA 3N7LA 5B2GB 3ALQA 4G9SB 1O4TA 4BWOA 1ZNPA 3KM5A 3VBHC 4ATFA 2WL1A 3ZXJA 1R093 1EAH1 1MQTC 4YG6A 1VBB2 5C6CA 1MEC1 3POYA 2XPJA 3U10A 1H9WA 3M7AA 4OI4A 2ZMLA 4CEWA 4BMBA 3AP6A 1GNZA 3CF6E 2B45X 3LCPA 3TNQA 2R49A 1X7NA 2WKKA 4ZU5A 1JOJA 5T54A 3TN91 4JGYB 4ASMB 1LHNA 3R4SA 4HZFA 4Y1ZA 1QXRA 4SLIA 1BKZA 4AG4A 3GZAA 3E5XA 4YW2A 4L97A 1AR91 3ZVXA 2DV9A 3ZXFA 4G4FA 4XFAA 4M3CE 3ZFFC 1FNZA 4LBJA 4EN7B 4WVMB 4QPGA 2VMIA 1RUH2 4RSUA 1HXS1 2PN5A 4PLNA 3WG3A 2VNRA 3P3PA 5BNNA 4EN6B 1YO8A 3HMYA 4ZU7A 1UZYA 2CGPA 4J1WA 1UL9A 2OYZA 2OVUA 1MS4A 2RE9A 1ZRFA 1AR71 5DDJ1 5GJ6A 5F5QA 4RA0A 1R1A1 2R1BA 4FPOB 1QGLA 4OHWA 4D7YA 4RFT0 3B5LB 1SCRA 5J48A 3MFAA 2GNBA 4AVBA 5CVRA 1WMDA 4A7YA 2D6LX 3I8TA 1LESA 1C8NA 2D3RA 2GH8A 2A6VA 1UIKA 5EXOA 1QU0A 2Z42A 3TRSB 5ACA1 2Q1ZB 5CFCA 5KXCA 1HRI1 1UF2C 5JCTA 4DY5A 3AYCA 3NV3A 1O3QA 1LKNA 4UW6A 2Q0AA 4R52A 1LECA 2JX9A 1V6IA 2ZKLA 1C4RA 1SACA 2NP0A 1RUF2 1ULEA 4BM8A 1PMIA 3W59A 1QH7A 4Q26A 3ZYIB 1V6KA 3B3QE 2C5DA 2ZX2A 5L36A 4N9HA 3MW4A 4INDA 3I59B 1I6XA 2Q1MA 4XJUA 1H4GA 1MS9A 4R8HA 2JG9C 2HWC3 1ZX5A 1WW5A 1ASJ2 5T52A 2R0FA 3LAGA 1LHUA 1YFUA 3MF6A 5K0UB 4I0WB 2RS32 4IV3C 1OLRA 1PK6B 2CV6A 2W52A 2ZJCA 2AYHA 3ILFA 4I30A 1O3TA 3WW3A 1TMF3 4CP2A 3VZLA 1ZM1A 3SH4A 2WT0A 4FPLA 5C8CC 1B09A 4QGMA 4X6RB 3P3NA 1YWKA 3GHMA 5LRSA 2E7TA 4Q2FA 1SFNA 1APNA 1XYOA 1H4HA 1IQAA 1Z7S3 1DIWA 3MIGA 5GZCA 5JOZA 2A7AA 1A78A 4ZU4A 5DUXA 2K2SA 2WNUA 4AFMA 4YRDA 4N43A 4Q4Y1 3L9JT 1JTZX 4CDXB 1VJ2A 1WW7A 4JTNA 1E57A 2PLV1 3EO6A 3W9AA 1G6NA 1LOFC 2VY0A 4RQPA 5J09A 1J3RA 4LR4A 4H14A 1OPOA 2UYBA 3VHNA 4YG3A 5GZGA 1G9AA 4K7JA 2WS93 1QWRA 1ZZCA 1URXA 2DU0A 3OGJA 1F31A 1VBB1 3OD0A 4QQOA 2GAUA 2ZGSA 2ZX3A 3ZSMA 3ZFEC 1PGW2 3H0OA 3FE5A 4HBNA 3RZZA 4YW4A 3N3HA 4AVSA 4GALA 1TNRA 1AXKA 3VBOC 3S7EA 2AUYA 3JBG2 5IK5A 1NA1A 3QBQA 1CJDA 3WHTA 5DUUA 5A3MA 3WUDA 4AHWA 2LUWA 5GLZA 4V1PA 1V9U3 1OKQA 4Q4W2 2ARBA 1FPN3 1ULFA 3QD6A 1IKQA 2D44A 4JQRA 5GZDA 4XF4A 3U0ZA 4L9BA 2WLPA 2QDNA 3ES1A 3MPPG 4GA9A 1IPKA 3H9AA 2D6KA 4LO4B 4BLJA 4CDQA 1LGNA 1MQTB 4H3WA 3AKRA 1S2BA 2GN3A 5BXXA 3DPRC 2BWCA 4L2NA 5HCBA 1MS5A 4FPCA 2W0XA 4K40A 2XH6A 4GMP0 1ZBA1 3LWCA 2CWMA 4CDWC 1UU5A 3FLPA 5JVVA 1WW4A 3JCIA 2DURA 3J8F2 1Q8PA 4IEXA 1NE6A 3APBA 3RDIA 4B7KA 2R041 5A33A