1Z7S3

The crystal structure of coxsackievirus a21
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
239
structure length
239
Chain Sequence
GLPTMNTPGSNQFLTSDDFQSPCALPNFDVTPPIHIPGEVKNMMELAEIDTLIPMNAVDGKVNTMEMYQIPLNDNLSKAPIFCLSLSPASDKRLSHTMLGEILNYYTHWTGSIRFTFLFCGSMMATGKLLLSYSPPGAKPPTNRKDAMLGTHIIWDLGLQSSCSMVAPWISNTVYRRCARDDFTEGGFITCFYQTRIVVPASTPTSMFMLGFVSACPDFSVRLLKDTPHISQSKLIGRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of coxsackievirus a21 and its interaction with icam-1.
pubmed doi rcsb
molecule tags Virus
molecule keywords Human COXSACKIEVIRUS A21
total genus 38
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1z7s300
4CEYB 4EJRA 1R1A1 4QPIC 5BNOA 1COV2 2RS32 1VBA3 1OOPA 4CDWB 1QJZA 3ZFEB 1RUD2 4CDUB 1BMV2 1AR72 1PGW2 3VBHB 3M8LA 2HWF1 4QPIB 1RMU3 4Q4V2 1B35C 3VBUA 4CEYC 3J8F3 1VBA2 1AR71 1NCQA 4GMP1 2IZWA 1RUC1 2HWD3 1RHI2 4YVSC 4CDXC 5FMOS 1C8M3 2DF7A 1RMU1 4NWVA 4CDUA 3ZFEA 1H8TC 4GH4B 1PO21 5CFDA 1R1A3 1E57A 4RFT0 3VBOC 1RUG2 4Q4X2 1PVC1 3ZXAC 1RUF3 2X5IC 1F8VA 1OHFA 1AL22 5BNNC 2HWE1 1FOD3 1NCRB 4Z92B 5CFCA 1K5MB 1VBE1 5FOJB 1HXS3 2RS33 2XBO1 4RHV1 1BBT2 4Q4W2 1FPN2 4YVWB 4CDXB 1AR62 1RUI2 4RQPA 1V9U3 2RR11 2RS51 4CDQC 5A33A 5BNPC 1RUD3 1PVC3 1QJY2 1C8NA 5K0UC 3VDDB 2WZR3 1A6CA 2WS92 5J96B 1Z7S1 4AEDC 3VBFA 4RR3A 1PVC2 1ND2C 4BCUA 1BBT3 2HWB3 1C8M1 1PO22 4AEDA 3VBFC 1RUJ2 2WFF3 1AYN3 1QJX2 5C4WB 1AUYA 4SBVA 5D8AC 1HXS2 1QJY3 2MEV3 1ASJ1 3VBOB 1PGL2 1MEC2 3J8F2 1QQP1 5LK7B 1EAH1 4FTBA 2RMU2 4WM7B 1D4M2 3VBRA 1VBD2 2HWF2 4GH4C 1VBC3 4CDQA 4WM8B 5C9AB 1MQTC 1RUD1 1BMV1 4GB32 4Y4YA 1H8TA 5DDJ1 4IV1B 1QJU3 3NAPC 1NA1B 2RR13 3FBMA 5ACA1 5JZGC 3DPRB 5D8AA 1AYN2 1B35B 4GMP0 1NY72 1RVF2 2Y26A 1AYM1 5JZGB 2R072 1RHI3 3JD72 4IV1C 1AR93 4N43B 4JGYA 1PGL1 1TME1 5BNPB 1HXS1 2XBO3 4RHV3 5CFCB 4PDWA 1POV1 1ZBA2 3ZFEC 5AC91 2HWC1 4CDWC 1RUJ1 3ZFGB 1VBB2 1ZBE3 1Z7S3 1FMD3 1AL0G 2RS13 3ZFFA 2RR12 5A32A 1AR61 1PO12 4CEYA 1RUH3 4QPGC 1R082 1DDLA 4RS5B 4JGZA 5J98B 1RUC3 2RM21 2XBO2 4LLFA 4RHV2 3CJIB 1RUE3 1VB2A 1VBB3 1ZBE2 5CFCC 1QJU1 4Q4X3 4QPGA 1X36A 2GH8A 3VDDC 2R071 3JD71 2HWE2 1ZBA1 1WCDJ 2R073 1HRV3 3JD73 4N53C 2BBVA 3VBHC 2FZ1A 1K5MA 1OPOA 1MQTB 4WM7A 3TN91 4WM8C 4N43C 4YVWC 1AYM2 1VBD1 2TBVA 2X5IA 5L7OC 3DPRC 1PGW1 2BPA2 1AL23 3J8F1 5D8AB 1ASJ2 1RHI1 1B35A 1RUC2 1GFF2 4RR3C 2RS31 1ND3A 5C8CA 1R093 1R1A2 2RMU1 1FOD1 3JBG1 4IV1A 4WM7C 1AR82 1CD3G 2BFUS 4IV3A 1VRH1 1OOPC 1W39A 4GB33 1EV11 1VRH3 4CEWC 3TN92 4JGYB 4Q4V3 1ZBE1 3ZFGA 3LOBA 1M06G 4N53A 1R091 2HWC3 3VBOA 2R061 5C8CB 3VBRC 2WS91 1IHMA 4CEWA 1QJU2 5BNNA 4CDQB 1R081 5C9AA 3NAPA 3HAGA 1PO11 2PLV1 1HRV2 1VB4A 1POV0 4N53B 1FPN1 3JB8A 3CJIA 4FSJA 3TN93 1RUI3 1ZBA3 2VQ0A 1VAKA 1VBE2 1NCRC 1HRV1 1RUI1 2RS11 1EAH3 4CEWB 1QQP3 5C9AC 1FMD2 1COV3 4Q4X1 4CDWA 1RB8G 1RUE1 1RVF1 1V9U1 1AYN1 1VBB1 2BFUL 5BNOB 1AL21 1NG0A 1R083 1TME3 2HWB2 2R063 4QPIA 5BNOC 1QJX3 1VBA1 4RQPB 3VBFB 2FZ2A 1EAH2 3JBG2 2HWD2 1TMF1 5A32B 1EV13 4Q4Y1 4Q4V1 5JZGA 5ACA2 1ND3C 3JB4C 1PIV1 4GB31 1PO23 3JBG3 4Q4Y2 1D4M1 4CDXA 4YVSA 1C8M2 1HX6A 1QQP2 3VBRB 1MEC1 1AYM3 1VBE3 1AR91 3VBUC 1COV1 1BEV1 3VBHA 1RUG3 3IDEA 1NCQC 2R041 1VBD3 2HWF3 4Q4W3 1RUF2 3DPRA 4RQPC 1OOPB 1V9U2 5DDJ3 1AR63 1ND2A 4YVWA 4RS5C 2RS52 1FMD1 5K0UA 4QPGB 1AR83 2R043 2X5IB 2RS12 4FTEA 1RUJ3 2WFF2 2ZZQA 4NWWA 1ASJ3 1X33A 1BEV3 4PDWC 1PO13 2WFF1 2QQPA 1AR73 1ND2B 3VBUB 1MEC3 1RVF3 2RM23 5CFDB 4AEDB 2PLV2 4RS5A 2WS93 4JGZB 1BBT1 1PIV3 2ZTNA 1RUH1 1RUF1 4Q4Y3 1HRI3 5ABJA 2HWC2 1RMU2 2R062 4JGZC 1NA1C 1HRI1 1HQNA 4IV3B 1FPN3 1RUG1 1POV3 1ND3B 1EV12 1NY71 4PDWB 1VRH2 1FOD2 2R042 1F2NA 4WM8A 5DDJ2 4FTSA 1D4M3 1NA1A 5C4WC 1NCRA 1VBC2 1TMF2 5ACA3 1VBC1 1NCQB 4Y5Z0 4N43A 1PIV2 4IV3C 3VBSB 1QJX1 1CJDA 4GH4A 2PLV3 2HWD1 1QJY1 2MEV1 5K0UB 1RUH2 3ZFGC 5L7OB 4CDUC 1HRI2 2HWB1 2WZR2 1Z7S2 2BUKA 1SMVA 3VBSA 1K5MC 2WLPA 1RUE2 5BNPA 2RM22 2XPJA 3NAPB 5C8CC 5C4WA 1NOVA 5BNNB 5L7OA 5CFDC 2RMU3 1TMF3 2WZR1 3CJIC 3S6PA 4Q4W1 5AC93 5GKAC 3VBSC 5A33B 4JGYC 3ZFFC 5ABJC 1H8TB 2ZAHA 2RS53 3ZFFB 4GMP3 4RR3B 1R092 5ABJB 5AC92 5FMOL 3VDDA 4YVSB 1BEV2 2HWE3 1MQTA 1AR92 2GSYA 1TME2 2WWSA 1AR81 2MEV2
chains in the Genus database with same CATH superfamily
5F3GA 1WCUA 2ZS6B 2Q5TA 2DV9A 2JECA 2OS2A 4AI1A 5I91A 5IHRA 4MGSA 2JDAA 2BERA 4F7ZA 1EPWA 1WW5A 2Z42A 2DURA 4S2GA 2IFRA 4CDWB 5F9TA 1S1AA 4XJZA 1IOAA 3SKVA 1YFUA 3ZFEB 2UYBA 4YW5A 3KHCA 1AR72 3BTAA 4PQQA 4AVBA 1KRIA 2ZX3A 2HWF1 2E9QA 1LGBA 4QM8A 3BU7A 1LR5A 3PIJA 4FOVA 4JRLA 4FPCA 2XLAA 4P00B 3J8F3 4KGGA 5JR7B 1AR71 4AK3A 1NCQA 1ULOA 4KMQA 4XF4A 5FV3A 1EUTA 2JX9A 4BHPA 2BOIA 4LHLA 3VD7A 1PK6A 4YVSC 4QGNA 3DUIA 5FMOS 5A6XA 3HWJA 4FAHA 3RZLA 4LNVA 2JD4A 4FCAA 5GLVA 4CUBA 4GH4B 3DXTA 1PNGA 5CFDA 5C71A 3BCWA 1HB2A 3IPVB 2J1UA 1W2TA 3E5XA 5IUQA 5C8WA 1H30A 3RPQA 3ZN6B 3P5BA 4HZFA 5FYVA 2Q1MA 2WNVA 2VW1A 5BNNC 3WW1A 3TEZA 4NR1A 4JTNA 1FOD3 3T08A 3FFQA 1DQ5A 3LIGA 2CWSA 1HXS3 2RS33 2QCSB 5JPNB 3USUA 5BUVA 4M01A 3ZIWA 4KWKA 1FPN2 3CLPA 2IXJA 1UOGA 4QX1A 1DQ1A 2RR11 4S2FA 4QAWA 1W3VA 3E97A 3U11A 3SISA 4AGRA 1XQNA 4AFAA 4OI1A 3GF6A 3PUQA 2D40A 5FPLA 2XKOA 4O9EA 1NXD1 1C8NA 4HG6B 1YQ5A 3SHRA 3NNMA 4OLLA 4BQYA 3ZYPA 5LA0A 1KDKA 2WS92 2ZGRA 4B1LA 4E2SA 1J83A 4BQ5A 1W6PB 4MGTA 3OY8A 1CPMA 2LALA 1V6MA 2I2SA 1W2NA 4K8RB 2OZ6A 2JG9A 3UJOA 1W28A 1MS0A 2DFBA 3VZKA 4B7EA 1H9PA 2B7YA 2DUPA 3I3BA 4YW7A 3WDVA 5I93A 4XBLA 4LORA 1RUJ2 5FFOC 1N3QA 4ZKTB 5A3TA 2WBKA 1OUSA 1JTZX 3HIFA 4FFHA 1BJQA 4QB2A 3GCXA 1HXS2 2MEV3 4LLOA 1ASJ1 3POFA 4P08A 3VBOB 1MEC2 4B4QA 1LOBA 4BISA 4JX0A 1ULFA 5LZ6A 3K3NA 2VUDA 5LBFA 2PTMA 1QH7A 1ULGA 3J7NA 3OUHA 1D4M2 2WZEA 2Y60A 3HT1A 3VBRA 3RJ2X 2EXHA 1ENRA 4GH4C 2D5FA 4WM8B 3MYXA 1CPNA 1UKRA 3TNPB 1BMV1 1O59A 4BIOA 2KR2A 1OSGA 3NAPC 1NA1B 1LNSA 1OKQA 1T6BX 4D6QA 5ANNA 2Q30A 4GMP0 4TTGA 1U12A 3DL3A 4A7ZA 1FX5A 5FZAA 5JZGB 2R072 3JD72 2BVBA 2VH9A 4IV1C 1LOFA 1DYOA 4XFFA 5BYNA 5JI9A 5AVPA 4QX5A 5L9RA 1Y9GA 4RHV3 4Y33A 3G7DA 3PL0A 5BNPB 1DQ6A 5CFCB 5A80A 3ZFEC 5FZHA 4B8EA 5AC91 3WHTA 4CDWC 3PHMA 2CGOA 3T1MA 4A2UA 2P1BA 1XPWA 3LSEA 2VNRA 3ZX7A 3H7YA 5DAVA 1ZZ6A 1XXNA 1FMD3 3HJRA 1AL0G 1VE0A 2VG9A 3BVCA 5I0SA 3BOPA 4QX7A 2BGOA 3ZFFA 3JZVA 4C8DA 3D6EA 1GMMA 4FXKB 1W8NA 1CR7A 1DF0A 3M1HA 4OUEA 5FMDA 4RS5B 4RGKA 5CADA 3AKQA 1QHDA 3I2DA 3I7DA 2E6VA 2QQKA 1W6MA 2D7FA 2XBO2 4GAZA 3ZXEA 3IB3A 4CPBD 1HQLA 5E16A 2QBXA 2WWJA 3OF1A 4WVZA 4ET7A 1ZRDA 1XB9A 3RDIA 3RI9A 2VQUA 4OMDA 2VULA 3LA2A 1RUE3 1VB2A 3P3PA 2ARAA 4N7IA 4XXPA 3K3OA 2V4AA 5CFCC 3N9OA 2ZX0A 1JU4A 1GUIA 1NLRA 1TNRA 2J42A 2ZJCA 1C28A 5C3PA 4IEXA 4Q4X3 1A8DA 2JKBA 3K2OA 4CU8A 1FYUA 3CHXA 1PZ9A 5FQ0B 2GDFA 3A0KA 2R071 3JD71 3VDDC 4W6WA 3W20A 3CQOA 4E27A 4FOQA 1DGLA 4HK8A 1I5PA 2DVAA 2K46A 2WLQA 4TN7A 5I0UA 1ONAA 1S0EA 4LO7A 1HRV3 4N53C 2UWBA 3ORJA 3NV4A 2FZ1A 1PMJX 2V73A 4FP3A 3CEWA 2D3RA 4YSFA 3ZMNA 4EWDA 1UZYA 4QD2A 4WM7A 1AVBA 2EXJA 3TN91 1QF3A 4WM8C 4Y26A 3C8XA 2K0GA 1OBNA 4YVWC 3U1XA 3ZR6A 2OZJA 2WYSA 2LS6A 1YIPA 2A73B 1XOYA 2B42B 3MFCA 5CAZA 3ILNA 3Q8FA 1PGW1 1N3OA 4CUGA 4XZPA 3ACIA 1DIWA 1UY0A 4IEZA 2I45A 2RDNA 1IS6A 1NLSA 2JG9C 4ONUA 4QXKA 4ZZ8A 1ASJ2 5B4NA 3ACGA 3OPWA 3TEYA 1BCXA 1QJFA 4WVMB 3ZYBA 4HKOA 3LPGA 2CGNA 1UY1A 3H8UA 4IQPA 4OUMA 1ZA7A 3JBG1 4XXAA 5A7SA 4BXFA 1RUOA 5FO8B 2PHUA 3RWKX 3AXDA 5K8SA 1CD3G 1Z0HA 5JWPA 4YARA 5EQUA 1SZBA 4LPLA 4BXSV 1ZZBA 3SEPA 4F8AA 2E26A 1MZFA 3AMQA 4JGYB 4Q2FA 2AUYA 3PUIA 4P9WA 4Q4V3 4AGGA 3LOBA 4MGQA 2V09A 4RYDA 3VZMA 2WIIB 2HWC3 4CTEA 1FV2A 1SLCA 3E6CC 4X6QB 1ENSA 2FBEA 2WS91 4IGOA 3LGRA 2WZPP 3NJXA 4ZU7A 2D6MA 1Q3EA 3W9AA 1IHMA 3B94A 2JKXA 2WYFA 4B1MA 3T4HB 5C3QA 2VXJA 3MUZ1 1JYXA 4G4FA 4YFZA 1PO11 4LR4A 1F4HA 4CUCA 1UIJA 4BE3A 4GWJA 1MACA 3VKFC 3RMXA 1W8WA 1KS5A 2VCMA 2ZHMA 4LUKA 4N53B 1FPN1 3FE5A 4FOWA 1J59A 1YXWA 1O8PA 3WQ7A 4DUXA 1XNCA 1KD7A 2R6QA 3K4ZA 5KHKA 2ZCWA 4LTAA 1X9TA 2GC0A 2VTXJ 3H1WA 2VOVA 2WRAA 3M3IA 4D7SA 3RZZA 2RS11 1EAH3 5G05L 1T2XA 1NUKA 1LOCA 5FYCA 5CISA 1FATA 4ZXKA 3W59A 3K48A 1COV3 2PAEA 5HI0A 5DAXA 3X29B 4EQVA 1OUXA 1RVF1 4DPNA 1BK1A 1AYN1 1VBB1 2DTWA 4NUBA 4NHXA 3OUJA 3I2JA 1YIFA 4QQLA 4V2VA 1JMUB 1CIYA 4UW3A 3U10A 2JJ6A 1WD3A 4LKDA 1KDMA 4CCJA 1I6XA 2PELA 4QPIA 1ODNA 4NIAA 4YM3A 2FDKA 3OOXA 5J36A 5E8AA 5JSRA 2P3KA 5FWJA 4RQPB 1W3XA 3VBFB 5LY1A 3AZXA 1UKGA 1DQ2A 4BMBA 3HN3A 1ND3C 1UY4A 2QE3A 2VW2A 3GHNA 5LY2A 3I49A 3KF5A 4BLJA 3J7MA 5A6ZA 1PIV1 1IGOA 4GB31 4CP0A 3B9CA 5CNAA 1PO23 1W06A 3DV8A 5BNQA 1W0NA 2W1QA 5FPBA 2CTVA 4DO0A 2ZABA 4V1PA 3R05A 3C7EA 3WUCA 1GLHA 2ZGKA 4FOYA 2JDPA 1HX6A 4AEMA 5HV4A 4BQWA 3KM5A 2LM3A 3N9PA 1Y4WA 1Y7BA 4CU9A 4E8DA 3ES4A 4CCCA 4CRQA 1RIRA 3DYOA 2RG4A 3LFMA 4XUPA 4CVUA 4QWNA 2XHNA 3VBHA 1MZ5A 3WNNA 4P02B 2VCCA 5FZOB 4OHYA 3UT0A 1NCQC 1VBD3 4XUQA 2A3WA 1ALYA 2HWF3 4GJYA 3OG2A 4AI0A 2WQ4A 4RQPC 2WQ8A 4LHKA 1A78A 1OOPB 1MR5A 4Z2AA 1A3KA 2C4XA 2Q1ZB 1AR63 2YFUA 2DVFA 4BPZA 1XYPA 3KS7A 2RS52 4LE4A 4IW3A 3LWCA 4MSVA 4QPGB 1RC6A 3MW2A 2Y6JA 4OCTA 3OD0A 2RS12 4JQTA 3RZKA 4MH0E 1G9CA 3H8RA 3DCQA 3UYJA 3LEMA 1BEV3 2QQUA 2D98A 4EWAA 4YZ3A 2WFF1 2QQPA 3HQRA 1DCSA 5JVVA 1F5FA 4Y5TA 5KXCA 4FPKA 3CF6E 4IERA 4XABA 1GP4A 1HDKA 1MEC3 3O1TA 1SBEA 1SDDB 1RXGA 5CFDB 1WLCA 2D5HA 4AEDB 5C3RA 1H2LA 2PHLA 3NV1A 4NIHA 4QT6A 5CYYA 1W99A 5D1IA 4K6BA 4D7YA 1BBT1 2YU2A 4A7YA 2DVDA 4Q1PA 3VHNA 1WMXA 4I0WB 2ZTNA 5A7PA 4Y20A 5DZEA 2ET1A 1DLLA 2IXCA 1RMU2 2XH6A 3H50A 3N7KA 3KVBA 1UPSA 4U36A 5F3IA 3SITA 3AK0A 2PQQA 4QX2A 1XJAA 3AP9A 4MVTA 3RZJA 1HRI1 3FHIB 4MGZE 4FI9A 4IV3B 3WG4A 5APAA 4Y1ZA 3VDAA 1POV3 3SLIA 1UWWA 4JZRA 2D43A 2QQIA 1NY71 3KF3A 5F1RA 1PX4A 4NRPA 5KXEA 5JOYA 2FCTA 1LJ7A 4QHOA 3MLJA 5FXWA 3FUQA 3NV2A 3C7OA 3SCHA 5IYYA 2R042 2YGMA 4FTSA 4TLGA 3KWVA 4AR2A 2R49A 3KT7A 3O0WA 5T5JA 3ZYGA 4NPMA 4D94A 5JCTA 2XUEA 3ZKYA 1G9BA 1G86A 5C5UA 3S30A 4HK9A 1NYWA 2YY1A 3CKHA 5EPAA 3N3HA 2BWCA 4KWJA 2FCVA 4Q0PA 4YLZA 3EBRA 4R8HA 1REFA 4K20A 2OIIA 2YBSA 3WP3A 1CAUA 4N43A 4XHXA 3FN9A 4ITCA 4UYBA 1PNFA 2J1SA 1WMEA 3N9QA 2HYXA 4OULA 4XUOA 3AZZA 3NSTA 4Y22B 2W9XA 2WWUA 4K8FA 4NIIA 3RG0A 1UF2C 1PMHX 1UZZA 1K45A 2HWD1 4GWIA 4UAPA 1QJY1 5K0UB 5GZEA 1RUH2 3MHZA 5A3LA 1G9AA 3TRSB 4HBNA 1YJKA 1NZCA 2OYZA 4UFKA 2VTXA 1DLCA 1CAUB 2ES3A 1LOAA 4HANA 1SCSA 1YQ2A 1GZWA 1R64A 5FPVA 1C3HA 3POEA 2WLPA 1AXKA 3OSDA 5CB7A 3VGIA 4NRQA 4XJ8A 4FPJA 5C33A 3D5OA 3J26N 2VUCA 4Y1YA 4IETA 1W9YA 3AKSA 5C4WA 3VHPA 1NOVA 3PVBB 2PQSA 3ZYRA 2VZ3A 2WZR1 3H3UA 5DXDA 3H1YA 4HKWA 3MIBA 3S6PA 4OHZA 5GKAC 5AC93 2DTYA 4ATEA 3S57A 4LJHA 5ABJC 1LODA 5GALA 1BVVA 1LKNA 4MGYE 1WLTA 1ZZ7A 5CIRA 3B5LB 3QD6A 5FYYA 3U07A 4DEVA 3S0MA 4RR3B 1GYKA 1LOEA 4R4ZA 1NX9A 5AC92 3N9NA 4DUWA 1SPPB 5KWRA 3AYEA 2HWE3 4LA2A 5BXXA 1SFPA 1GZ9A 1AR92 3AP7A 4WZCA 4AOCA 2CY6A 2HBTA 5FYMA 1K42A 1JS9A 4DOUA 4CU6A 3MO4A 1QJY2 1YHFA 1F15A 2VNGA 4YWAA 4CEYB 2QQMA 4XETA 4MZUA 3WDTA 4QPIC 2PHRA 1D7PM 3KV6A 2RS32 3ITQA 4BDVB 5I0DA 4TZDA 5FZ9A 1SQ4A 1OA3A 1OXCA 5FAXA 2JDUA 1LHWA 3T2TA 4I0BA 1QJZA 3VB9A 4YNIA 5DAWA 2IWGB 4AF9A 1BMV2 3AZVA 2PHDA 3M8LA 1P8JA 5FY0A 5DUUA 2BJSA 1MPXA 2DYCA 2P3JA 1JZ5A 3ZN6A 2PHFA 4JKKA 5HBAA 1QH6A 2VR4A 3URFA 2IZWA 4MUVA 4PHZA 4X6RB 2Y6LA 3K51A 2C24A 4YM0A 1L7LA 3I2GA 2JE9A 5FREA 1H2NA 5AVAA 1HB3A 1H2KA 2W68A 3AMPA 1OD5A 2B5HA 2D97A 2YBPA 1CZTA 4GZ9A 2E63A 2QVSB 5GZFA 5FZIA 4RFT0 3VBOC 1WW4A 1YQ8A 4HN0A 1JOPA 1KS4A 3J7LA 1Q8OA 4AFMA 5F5IA 4W50A 2CV6A 3ALQA 3WY6A 2W08A 2X5IC 4R52A 1LEDA 1OHFA 3N9MA 4YG0A 4HVQA 5CA6A 5DAQA 4N7UA 2KM2A 4UF0B 4XC9A 1RINA 2X10A 4QKDA 3WNKA 2H6CA 2W91A 3N35A 2K2SA 4P9LA 4GIQA 2VOXA 4P9IA 3AM2A 4LO5B 1BBT2 4LMFA 1Y9MA 5FPXA 2CNAA 4YVWB 1R1ZA 3ZDSA 4CDXB 4CPBA 4KL1A 5F5QA 1IPKA 1LOGA 1RUI2 4RQPA 4BA6A 1V9U3 1J3PA 4IE5A 1GNZA 4WV8A 3FLRA 3LEGA 3RVHA 4Q0QA 1S4CA 5JUVA 2OKXA 4WVMA 3MUY1 1WCSA 4MYEA 1QDCA 2W47A 5A1FA 1WLWA 3VDDB 2VZOA 1BZWA 5IJRA 3ELNA 3EHKA 2DWRA 1WWYA 3H8XA 1Z7S1 4XURA 4AEDC 3IDAA 3Q9OA 2VMEA 2ZX2A 5KHHA 3MFAA 5J1XA 2JWPA 1FNYA 3KV4A 3AL5A 2D6OX 4FXGB 4MADA 1J1TA 2HJIA 1QOSA 4XEZA 3I2OA 3NNLA 4AHYA 1CAXA 3WNOA 2HWB3 4BZ4A 2VMHA 3RGBA 1ZREA 5D2AA 1QKQA 2JDKA 4AHXA 3PU3A 2W92A 1YCIA 2VU9A 1AYN3 1QJX2 2ZEXA 4EN9B 2JB8A 3J7HA 2CL2A 4MXVA 5A7OA 4QQ2A 2EF6A 3ETQA 3D0JA 4AAXA 3LDBA 4SBVA 1YI7A 5D8AC 1MS5A 4I3GA 3QBQA 3ZFFC 1PGL2 2GMEA 4IE0A 3J8F2 1OT5A 5C6CA 3D4KA 2GZWA 1EAH1 2WA4A 5EXOA 2FHRA 3GZEA 1QMJA 3QCWA 2F4LA 2CAUA 4DZGA 5DQ0A 1VBD2 1WCKA 2HWF2 2JG8B 4CDQA 1UMHA 1IZ3A 1T6GC 5DUVA 5FY4A 1WW6A 3AYDA 4Z07A 4QB1A 4FP2A 3AKTA 4AGVA 4GB32 2DCJA 4TYSA 5K4LA 5DDJ1 3O7OA 1QJU3 2E33A 2EVXA 2ILMA 1WA4A 2ARCA 3CBNA 3GM8A 5LWBA 1APNA 2VVDA 3DPRB 3GZTB 4FPFA 4BQXA 2VE1A 5D8AA 4NE9A 4H2AA 4LOSA 3SQOA 3AYCA 3BTZA 4LT5A 3WZ1A 1C5HA 1CX1A 3ZMOA 1RHI3 4HSLA 4XF1A 3M2MA 1PGL1 1TME1 1OQEA 1OFNA 2HBUA 2CSGA 2Q8OA 1ZBA2 4MGKE 1UOFA 1Y43B 1W6MB 4KG8A 2R32A 2HWC1 4OI4A 4WVWA 5M0TA 1JYNA 4AVAA 2Y6FA 3UJQA 1VBB2 4QPYA 4NIDA 4META 1X7NA 5HCFA 3ZXGA 3O1VA 4YZ5A 2RS13 3UGGA 1XSRA 3GBWA 2BGCA 4J1WA 3AKPA 1UOBA 2J1VA 1AR61 1CZVA 3CNAA 2LW8A 1VIWB 3OYWB 1GQGA 3VDCA 1R082 5J37A 3H3ZA 5DG2A 1Q8SA 4A6OA 2ZX1A 4F83A 1QU0A 4DXSA 5LCWL 4L11A 2RM21 3POBA 4RHV2 3WF1A 2IUWA 1OH4A 1OLME 1UYZA 2AYHA 2ZA9A 3ACLA 3C2UA 1WZXA 3LD8A 4LEJA 5B2GB 1REDA 5IAVA 3N4MA 3DKWA 1WUVA 2P3YA 4FQZA 3N9LA 4UW6A 2W2IA 2QJVA 2W52A 2QQLA 1X9PA 4HKLA 1QXRA 3RI8A 3TYJA 1VBB3 3ZN4A 2JDYA 2GC2A 3N7JA 3EB7A 2D6PA 3DYPA 3M4FA 2WNVC 2QKDA 4AI2A 4D69A 4QPGA 3W5MA 1X36A 1YNAA 1O4YA 1UZWA 4DS0A 4TSVA 1UYXA 5JMOA 2O14A 2C9KA 2WT2A 2FMDA 2Q0AA 1W0OA 1U5YA 3VBHC 5FZ6A 2QQNA 3BALA 1JU3A 2OA2A 3BKZA 1VJ2A 2QQWA 1MQTB 4UW5A 2ZGMA 2DCZA 4UWDA 4CA9A 3V0BB 3H42B 4IEQA 2BWAA 4Y1XA 1C5IA 4YGDA 4GWMA 2X5IA 2UWAA 2Z69A 4UOJA 5FY5A 1BHGA 1XU1A 5L7OC 3UKVA 1AX0A 3EXUA 2ARBA 5I0TA 3UL2A 4XTMA 2BPA2 1AL23 3L2YA 1UNBA 2VUJA 2XLGA 1JHJA 1H1AA 1B35A 4ATFA 1GFF2 2Y8KA 5H9RA 2WO7A 1ND3A 1SG3A 5FXXA 1R093 1R1A2 1XRUA 3SH3A 2RMU1 4XJ9A 2SLIA 4KBZA 3ZSKA 4D6RA 2RVAA 4PI2A 3JCIA 1AR82 2V4VA 3ECQA 1I9RA 4IV3A 4XOGA 3AFGA 1OOPC 1VR3A 3MF6A 3MPBA 3PNAA 5IVJA 3NNFA 1N1TA 2Y6GA 1ULDA 3AZYA 3ZLIA 2ARXA 3TN92 5IT6A 1J3RA 2A7AA 4NAOA 4L97A 1C1LA 1U5XA 2QUOA 1M06G 3IAPA 1R091 1UQXA 3QH6A 3ZO0B 2J22A 3VBOA 5IVCA 5F5CA 4RGGA 3MIGA 1XE8A 1VMHA 4AVTA 1ZRCA 2A6YA 5FR3A 3IPVA 2WO3A 3ZSLA 1BVP1 5BNNA 5F37A 2V72A 3ZKUA 1R081 2B8MA 4O65A 3HAGA 3M7AA 4NJ4A 1JYIA 3KSCA 3TAYA 3OBZA 1CZSA 5A3PA 2PLV1 3OEBA 4YW2A 5FZDA 1HRV2 3FX3A 1KGYA 2GNBA 4GJZA 4LBNA 3DGTA 4ZY9A 2BNNA 5DUWA 4E2QA 5CKQA 3JB8A 3TN93 1RUI3 2ZGPA 2Q8CA 2AGSA 3ZPOA 2AENA 5KBFA 1VBE2 5J3UA 4J25A 4PBPA 5B4XA 5FY8A 1H9WA 2VZRA 2EIBA 4MGIE 3H7JA 3W21A 4Y4RA 1DYKA 1SLTA 4KBBA 4QMAA 1H2MA 2VPVA 5FZ1A 4AAPA 2D6NA 4AVVA 5C9AC 3J9SA 1SEFA 1ULEA 2IVIB 5FPZA 2WSVA 3KQ4B 3I59A 4Q4X1 1ZYBA 4UFJA 5EZWA 3GXUA 1RB8G 4OZXA 1PK6B 3ZYIB 1LULA 2VMFA 2BFUL 2RDSA 3ROUA 2D3PA 1AL21 1NG0A 1OF3A 1OPMA 2ZZJA 3E5QA 4ISQA 4HL0A 2R063 4PIXA 4FFIA 2ZGUA 4CYDA 4ZXEA 1E5SA 5DPNA 4R9DA 2VMIA 1I3HA 5FYHA 2IXHA 1QJX3 3WSOA 2FDFA 3FBYA 4W4ZA 4ES9A 3R4UA 1VBA1 2FZ2A 1EAH2 3WG2A 2GALA 2HWD2 5A32B 5JAXA 2XJPA 2VY0A 2ZEWA 4Q4Y1 4H7MA 4AEKA 4QU2A 3S5AA 5JZGA 4IE7A 1TEIA 3ZXKA 3UKNA 4CP1A 1IPJA 3KZ4C 3UKTA 4BMEA 5FZEA 2UURA 3UNPA 4Y5SA 3KHBA 1L3JA 4HN1A 1MS9A 3RQ0A 1MS1A 3BPZA 1D4M1 4XFHA 1LTEA 4XUTA 4BK5A 1VMJA 2Y38A 5L19A 1IQDC 2VC9A 1QIQA 3ZVXA 1MEC1 3IDBB 3ZYHA 1AYM3 2Y64A 1RITA 4Y1UA 1O5UA 4CP9A 2J7MA 3O1RA 1COV1 1BEV1 3GBFA 4JKMA 2YC4A 1W05A 5BPXA 5AFBA 2R041 5D21A 4XMIA 4OZOA 1H6YA 1RUF2 1GP5A 3I4IA 3VN4A 4PF5A 4R9BA 1V9U2 4COWA 5DDJ3 2R0FA 2VVEA 1ND2A 2VM9A 2VZUA 4Z8BA 1XNBA 3A7QA 3VKNA 2UWCA 1KQRA 1PGSA 2WKKA 1WMDA 1FMD1 4XE9A 4NO4A 4CCOA 2RDQA 4DY5A 3MZHA 1AR83 1JHNA 2R043 2JD9A 5FY7A 5A3WA 2X5IB 1ST8A 5GM0A 1PZ8A 4FTEA 2YU1A 1NE4A 1OQDA 1VP6A 3H9AA 3FWEA 5JDBA 4XFGA 2RDRA 2XVGA 4AHWA 1ASJ3 3MICA 4AVCA 2UY8A 5FJHA 3O1UA 1ULCA 4ISRA 3RSJA 1AR73 2VBBA 4YG3A 1ND2B 3VBUB 1UU4A 4AI8A 4K1ZA 3E6DA 1S0IA 2CU5A 1HLCA 2VQAA 3KQRA 2O8QA 2ZGSA 4RS5A 1UOJA 5LBEA 3A0NA 4JGZB 5FMBA 1C1FA 2RJ2A 4XFIA 1PIV3 3SH4A 5JMCA 2VVFA 4PIZA 4ARXA 2R16A 2XJSA 3IKWA 5DZGA 1RUF1 3B9IA 4Q4Y3 2WABA 3D82A 2PXJA 3HMYA 4IE4A 4RFRB 4XYXA 4A41A 2W94A 4RN5A 2YC0A 5DN2A 5CKNA 2ADEA 4MXWA 5FYIA 2WNUB 3MGUA 5A6QA 1F4AA 1HQNA 1VMFA 4TXWA 3MIFA 1FPN3 2EAKA 4EN8B 1HN1A 3FLTA 1VAMA 5JR2A 3PIGA 2ERFA 3AKRA 2W1SA 4QXCA 2P6HA 4MO3M 5EIYB 1VRH2 3WUDA 3MIHA 1ZZ9A 1FOD2 2DCTA 1E5RA 4WM8A 4JHZA 4YM2A 5FZGA 2FDIA 4JTOA 2DVGA 2R1DA 2B4KA 4DQAA 1D4M3 1LHUA 1K12A 5A3OA 1NA1A 1VAVA 5T5PA 4NN0A 5C4WC 4M0HA 2P6CA 1VBC2 4D8MA 4ARYA 5ACA3 4QQPA 5LASA 3RNSA 1DGRA 1D0GA 2XMLA 3ES1A 1NCQB 3C7GA 4F3JA 2V5YA 1S0DA 3FHQA 4YRDA 4Y5Z0 5LW9A 2A6WA 4CCDA 3BUCA 2ZHLA 1PIV2 4FPEA 3GGLA 1V6KA 4IXLA 4XMAA 1JYTA 3H1MA 5JI7A 2VTFA 3ZYJB 1HQWA 4GKYA 2PLV3 4IESA 1FV3A 1QOTA 3KCYA 5FY9A 4DXZA 2GP3A 3M3OA 5FZKA 3PURA 1NQDA 4CZSA 2LROA 5F6LB 2HKXA 4YPJA 2VL4A 1XYOA 2JDHA 2GC1A 2WZR2 1F9KA 2VOKA 5EV7A 4Q0SA 1AX1A 5IVEA 4Z1VA 3WV6A 4B4RA 4LBMA 3VBSA 4QB6A 5I0RA 4AHZA 5JOWA 1W9FA 1BKZA 5BNPA 5KXDA 1HIXA 4S2DA 2XPJA 3BIWE 4QKBA 4QQOA 3IWZA 5CU1A 4XHBA 2NPIA 5L7OA 2HLEA 2RMU3 3USUB 2PFWA 3CJIC 4JDOA 3WF4A 2ZGQA 4Q4W1 1SACA 4AWDA 5A33B 2BNOA 3P3NA 1LOFC 5TSWA 4LIVA 1C57A 2ADDA 5FDBA 2IC1A 2VGDA 2XJUA 1K5JA 2GMPA 2J1RA 4AG4A 5BV6A 4M00A 2RS53 3MW4A 2R1BA 1AJKA 4EN6B 1GNYA 1R092 1CAWB 1W6NB 3NJZA 3KV5A 2P3IA 3THTA 1UYYA 3VDDA 2XVKA 3OBRA 3CIHA 4BQ2A 1GICA 5A6YA 2XL9A 1SDWA 3POJA 4BOWA 2VECA 3M3EA 1I5ZA 1N3PA 2WWSA 1AR81 2MEV2 1JUIA 1LEMA 3HT2A 1OA4A 1J58A 2YMZA 5GZGA 1OLRA 1R1A1 1IS5A 3V0AA 1IG0A 5BNOA 2HYKA 4BQ1A 1WA6X 3M70A 2P34A 2RJLA 4RA0A 3W5NA 5LB6A 3VKMA 4CXXA 2XQRA 2Y0OA 4HETA 3GJAA 3IBMA 1RUD2 4CDUB 3KGZA 2DU1A 5FZ7A 2B45X 3VBHB 3A22A 1RMU3 3GNEA 4Q4V2 4INDA 3VBUA 4LHSA 5CEHA 2WA3A 4MLOA 2BDRA 3O12A 4PI0A 4Q1RA 3RS6A 4IDZA 3FFZA 3OD4A 4MX3A 4QDRA 2O1QA 1Y3TA 4AI9A 1XC6A 1US3A 4JV4A 4CDXC 1C8M3 2E7QA 3H3LA 3ZOIA 2DF7A 1RMU1 3NL1A 4NOTA 2AACA 1BK0A 4NWVA 4BLIA 1H8TC 1G9DA 1N1VA 3RMYA 3C3VA 3HN1A 4QU1A 1RUG2 3K4AA 1PMIA 3PU8A 1YC61 3K4DA 2XQXA 3ZXAC 3V56A 1V0AA 2ZXQA 4XF3A 1F8VA 2EXKA 4X8PA 2MHFA 4ZPIA 3GBGA 5EHDA 1RJ7A 4B3NA 1YI9A 1NCRB 5CFCA 4YZ2A 1K5MB 2VD7A 3RJRA 2ZMLA 3K75B 3RYKA 5HXVA 4RHV1 2D93A 4CP9B 1CONA 5FOJB 5LBBA 1UCXA 4Q26A 4Q5OA 4XFAA 1WGPA 1GZTA 2P37A 4Q4W2 3WLUA 1YJLA 4K21A 1AR62 1D0HA 1W8UA 1W8TA 2RS51 5FKCA 4CDQC 2OQ7A 1O7FA 4YGEA 5KHGA 2ET7A 2YHJA 3TEWA 2NQYA 1DQ4A 1PVC3 1DU3D 3KCCA 2ZMKA 2WZR3 4DRVA 1A6CA 5J96B 4FO9A 4QXBA 3WDXA 2YXSA 1AX2A 4P9JA 4S2HA 4QHZA 4RR3A 4I01A 3POWA 4ASKA 4XCAA 1PVC2 3HVDA 4PT6A 1GU3A 4YW4A 4XQ4A 1BBT3 1J1LA 1GOGA 5FYSA 4C0BA 1PO22 2O0OA 3MI8A 5A70A 1QJEA 4AEDA 1QNYA 2NMNA 3VBFC 1DHKB 3VHOA 3Q8AA 4YZ1A 3SEEA 2IFWA 3ZXJA 5C4WB 3FC0A 1QOOA 2A5ZA 2OQ6A 4CXWA 4OHXA 2L9LA 1AUYA 5GZDA 4OQ9A 3SNMA 3WW4A 2YFZA 5GLZA 1W90A 3KLSA 3UETA 1OURA 1X8EA 2W46A 4Y22A 5JXGA 5FUNA 1NE6A 2Z5WA 4M0NA 3PJQA 3VHRA 4FTBA 2P4EA 3RRDA 1FT9A 4WM7B 1W6QB 3ON7A 2QQVA 3AB0A 3VUOA 5FIXA 1VBC3 4NPRA 5C9AB 1XYNA 2CAVA 5A7QA 2DBNA 3LOIA 4IV1B 2OPWA 1CQ9A 2P17A 1J3QA 2RR13 5JZGC 5HCBA 5ACA1 1UMZA 4I2OA 4LO8A 5IWFA 2W1UA 1AYN2 1B35B 5IAXA 3MPPG 1RVF2 2Y26A 5CBLA 1AYM1 5LEKA 3GZAA 1AR93 4JDMA 2PYTA 1IG3A 4N43B 1JN2P 2QDRA 1HXS1 1Q56A 2OW4A 3S7IA 4CUAA 2J1AA 4GULA 2BRTA 4PDWA 3A23A 3TNQA 1IS4A 2G9GA 2YG0A 4Q0VA 1SLIA 3ZN5A 1RUJ1 5IVYA 4A44A 1UYPA 4XDQA 5KC6A 3T0DA 3S7EA 4EYUA 4FPLA 1O6UA 4M4PA 3A4UA 3CL1A 1HN0A 1ACCA 1GZCA 4DMIA 2Z2SB 5T54A 4ASMB 5FLIA 3GHMA 1LB2A 1QY4A 3HNBM 3DKQA 2ZGTA 5A32A 2TNFA 1PO12 4IEVA 5E88A 4CEYA 1H4HA 4A42A 5FMCA 1DGRN 4CCEA 3OGGA 2RE9A 5LK5A 1O8SA 2XHKA 4WBBA 4DFSA 4FPHA 1CJPA 1GQHA 2VJXA 3JQXA 5J98B 4QHBA 1GZWB 3WNXA 1W2OA 3AZWA 1U5IA 2PN5A 4IEYA 3E6BA 4JQRA 1W04A 5A3MA 2MNGA 5A1AA 3ST7A 3B69A 1W6OA 3I2IA 4HPKB 1E5IA 5E89A 5FKBA 1US2A 1OQ1A 4TLFA 2Z4FA 1X8MA 2K9ZA 4AQ2A 3MIEA 3GYDA 3MLLA 4MOAA 3T1LA 2GH8A 1CIWA 5LATA 4Y3OA 2H0BA 5FYUA 4CP2A 1UU5A 2LTNA 2QNKA 4WVVA 2XONA 3AP4A 1A34A 2R073 3JD73 3WW2A 1W8OA 4CCMA 2BBVA 2VMDA 1SFNA 5IATA 2AH2A 5LA1A 4I30A 1K5MA 3PMEA 4E4HA 3FL7A 1UAIA 1TZOA 3VKLA 4N43C 2V5DA 3U4XA 1AYM2 1WBLA 3U0ZA 2GNTA 4XCBA 1SCRA 1XU2A 2TBVA 1LU2A 1XNTA 5KXBA 5I8SA 2NP0A 2FDHA 1QNWA 2F6BA 2A3YA 3NNJA 2XLFA 1H1MA 3AMNA 4NMIA 4IE6A 1KEXA 3BU0A 1W8HA 4KI5M 2Y0IA 3J4UH 3N7MA 1SLBA 2CYFA 2GU9A 3NQHA 1KXGA 2RS31 5C8CA 5K9YA 2C5DA 3OCPA 2QTWB 2A6ZA 3LEKA 3PUSA 4WM7C 2BFUS 1DQ0A 4COZA 1D2SA 1SLLA 1PK6C 4GXLA 2ZHNA 2P2KA 3PMSA 4OFGA 1W39A 4GB33 1EV11 1PZ7A 1OFSA 2CDPA 2WUHA 4CEWC 4P14A 1SLAA 4AQSA 3ILFA 3OGRA 2CWMA 3LFIA 4I3PA 4K9SA 1EY2A 3ZFGA 1WLDA 3H8OA 4YW3A 3HQUA 2I74A 3KB5A 1DP0A 2D6KA 1MVQA 1EYBA 1S2BA 2AZ5A 2R061 2XWJB 4JCKA 2W0XA 3VBRC 4GQ7A 3ZSEA 2FCUA 3CJXA 4OQ8A 2JDZA 3AC0A 3QH7A 5A7NA 4U2AA 4HFSA 5HPOA 2W5FA 3HR9A 5EYXA 1QJU2 1KJLA 1NKGA 4CDQB 3NAPA 4JAAA 4LE3A 1TVGA 3G6JB 3I59B 3SMHA 3AMHA 3KT4A 1VB4A 3TB0A 1POV0 4UFMA 3VL9A 4UF0A 2HH9A 3CJIA 4NHKA 4LITA 2AREA 3POIA 4OUSA 3TWIA 4EE2A 3I3MA 4PCRA 2KA3A 3L9JT 1NCRC 2A75A 1TE1B 2SBAA 4B7KA 1HRV1 3U37A 1JYVA 5EYYA 1S2KA 4CEWB 5SV8A 5C70A 3ZM8A 2ZEZA 2AR6A 4IL7A 5T50A 3DF0A 4YW1A 4CU7A 2G1MA 4GALA 4ORFA 2XJVA 4I02A 5F3CA 5FY1A 1TQ5A 4P9GA 5F39A 4C91A 5IK8A 1CAVA 2QFEA 2NYYA 3DEMA 1XSQA 3DXUA 1R083 1N1SA 4L99A 2NLRA 4BK4A 3BIEA 5H9SA 1AF9A 1WW7A 4H3WA 1GQPA 3NW4A 4IGPA 4NHYA 3LDRA 2ZKLA 1W0PA 1K3IA 2XUMA 2ZX4A 4LO6B 3WDWA 4C90A 3EYPA 1EV13 3OGJA 4Q4V1 3FLPA 2DBIA 1WCQA 1DG6A 2JB4A 3AJZA 1HB4A 2E53A 1VPHA 3RYPA 4XPVA 2X09A 4KU8A 1Q8PA 1ZA4A 3LA3A 4PLOA 4AFDA 4BJ0A 3HBZA 3BTXA 3HOBA 5JLVA 4XIOA 2WC2A 3T3YA 1YQCA 1V00A 3OJBA 4CDXA 4XACA 4QKFA 5FK7A 1SPPA 3KGLA 4LBKA 1QQP2 1AXZA 1ZZCA 2JG8A 3ZXFA 2DU0A 3IM0A 3PJYA 3VD4A 3AVRA 1VBE3 4QGLA 3VBUC 2W39A 4DRRA 3LKJA 4V2WA 4BWOA 1DBNA 3CZUA 4Q4W3 1BQPA 4FFGA 1AXYA 4L0PA 3VD3A 1AZDA 5FZ8A 2JE8A 4AQTA 4CXYA 1RYYA 2XGXA 2GN3A 3POYA 4BB3A 3EMRA 5HV0A 2G4IA 2XL7A 2D6LX 2VAUA 5K0UA 3BPSA 4EZ4A 1O91A 3HD8B 2OXBA 1POQA 5FO9B 5IVFA 2GMMA 1LAJA 3PVEA 4C1WA 1S2EA 1LGNA 4RGAA 4Q0UA 3LSDA 2WFF2 3NO8A 4ZU4A 3WP4A 4NPLA 4DB5A 2ZGOA 4NWWA 3VDBA 2QZ3A 1X33A 4PDWC 1JOJA 4W65A 1QWRA 1ULPA 2A71A 3PDQA 1X82A 1YYNA 1JUHA 2QDNA 1RVF3 2MPFA 2RM23 4O61A 3WP5A 4L8QA 3SCGA 5JOXA 5A3NA 5J7MA 4XILA 5CG9A 4CE8A 1CAXB 4XBQA 3IDCB 3BODA 4AZZA 5A1LA 4LBQD 2JDMA 3IIIA 1HRI3 2PHTA 3POGA 4JKLA 2HWC2 4PF1A 1W6OB 4HPKA 3NKGA 2R062 5FOBB 3CMGA 4UI9L 3BI3A 5C3SA 2QQOA 2YPDA 3LB9A 3R0RA 1D4VB 4CCLA 2YGLA 4M4RA 4UT5A 2GNDA 2TUNA 1AJOA 3UESA 2OUJA 2Y34A 1W9TA 4FPOB 3SH5A 2JG8C 2Y6HA 4LA3A 1ND3B 1EV12 1JW6A 3OGSA 4PDWB 1V70A 4OYUA 4EROA 1LU1A 4LKEA 2VCBA 2FDJA 5DDJ2 1DGWA 5FPAA 3T0BA 4EV0A 4Y20B 2UU8A 5BY5A 4ZHNA 3MV11 5HXMA 3WNLA 1A8MA 1W03A 2JDNA 3V0BA 4OHVA 3O1OA 3ZPYA 3GDBA 4M3CA 3RFRA 1RUNA 3ETPA 3B01A 3ZXDA 1U5ZA 4X8NA 3WQ0A 3VKOA 1UX6A 1VBC1 1G6NA 2JENA 2Y33A 3MEPA 3U4SA 3IN9A 4D7TA 4DINB 3NWKA 2EIEA 2BW8A 1PM4A 1QGLA 1XE7A 1SBDA 3VLBB 1XNKA 1JYCA 1QJX1 3GCWA 3PUHA 1CJDA 3A21A 3AP5A 5FWEA 3THDA 4GH4A 4NHLA 3WQBA 3WX5A 1Q8VA 1Q5OA 3I54A 4DXRA 2GN7A 1VLNA 3O0XA 1IKQA 3AL6A 1HKDA 3NV3A 4OVEA 4QXHA 5L7OB 3I2KA 1O4ZA 4UFHA 3EO6A 5FUPA 3WCRA 3WINE 4URAA 2EAAA 3KCXA 3BGAA 1DYPA 1CN1A 2VW0A 2HWB1 1W6QA 2WNUC 2WNOA 3BOWA 4MV2A 2E51A 5IFTA 4MG2A 1Z7S2 4L9BA 3MIDA 4LHNA 3R4DB 3I2FA 2W95A 1C4RA 1SMVA 4ZZ5A 1K5MC 4MHUA 4CSWA 4XAEA 4FT8A 1RUE2 1OC1A 3VZNA 5IK7A 3JU9A 4KH9A 2YB7A 1V6JA 2ZACA 3HEIA 5F3EA 3D0SA 4Y1VA 3NAPB 1W9WA 3I97A 2EXIA 5FP8A 3RWNA 1MS3A 1TMF3 3LE0A 3FJSA 3WCSA 3F2ZA 3V64A 3VBSC 5FP4A 3GZUC 3Q8BA 4JGYC 3B00A 4LXLA 2E32A 2Y6KA 4UFIA 4W6XA 5CKMA 3AJYA 1H8TB 5FBZA 1AHSA 2IXLA 4XVHA 2WT0A 2ZAHA 4KQ7A 2A3XA 3ZFFB 5ISLA 5E6HA 3T2PA 2VQTA 3SXWA 4BIFA 5KHJA 4AXOA 1BYHA 5FYZA 5F7UA 5CVRA 3BB6A 4EN0A 3PUAA 1BEV2 1NLQA 3WDYA 1MQTA 3AVSA 4NIGA 4K7JA 5F32A 5FZ3A 4LUMA 3VD5A 2JIJA 4AFBA 1NXMA 3WEZA 5L36A 1S0GA 1HJFA 4YZ4A 1RJ8A 1CAVB 1V6OA 2VMCA 5FLJA 1I1EA 4EJRA 1G7YA 1COV2 2WFPA 1WBFA 2G9ZA 2XR4A 4TWTA 2UYAA 3P1IA 4XIKA 1VBA3 5FLHA 1OOPA 1YFYA 1UY3A 4H14A 1QXJA 2BEOA 3NJVA 5KHIA 1PGW2 3I2HA 3EJKA 4GA9A 4QPIB 2G9FA 3K77A 1WKYA 4PBOA 1B35C 3MV01 1YLLA 1E5HA 4HOOA 4QX8A 4ZS3A 4CEYC 4DNYA 5FYTA 3ZSMA 1Z78A 1DZQA 1VBA2 3T30A 4KU7A 4RSUA 4FFFA 3ENRA 1JODA 4GMP1 4FAGA 1RUC1 2HWD3 3OUIA 1RHI2 3WG3A 5FQ0A 1OA2A 3VV1A 1RTVA 5L9VA 1XNAA 5JXIA 2JE7A 3M3QA 4R4XA 1CWPA 1UX7A 4CDUA 1ZZ8A 3ZFEA 4QQHA 1D2QA 1PO21 1Y9QA 1GSLA 2LRPA 2TEPA 4O9GA 2VXRA 2VMGA 1R1A3 1YFWA 1E57A 2YV8A 3HBKA 1HV0A 1GWKA 2C0ZA 4IEOA 3AYAA 4N8MA 3ABZA 4Q4X2 1PVC1 3ACFA 2ZKNA 4NVPA 3WNMA 1RUF3 4EN7B 3AX4A 2RJKA 1AL22 2XOMA 3I3DA 5DG1A 5FZOA 2VCAA 4N9IA 2HWE1 1OVPA 5F5AA 2KXLA 2C1FA 1OVSA 4Z92B 4EZHA 4P9XA 3MBWA 4XAAA 1O3SA 1VBE1 2FMYA 4BQ4A 1NT0A 2XBO1 4LBLA 1PVXA 5IVBA 4NHMA 1H1IA 1OI6A 4K40A 2PAKA 1CGPA 3P6BA 4IEUA 4Q8KA 1F5JA 2XB6C 1UD1A 4LO4B 1YUDA 3BN6A 4ZS2A 4E4SA 1IS3A 3OEAA 1GNHA 4QX0A 4ZONA 1NQJA 5DMYA 3MW3A 1CESA 2BV4A 2BZDA 3INAA 5JSOA 1OMIA 5A33A 5BNPC 1H6XA 1GOHA 1RUD3 2BNMA 3VD9A 2VO5A 4PJYA 2A1XA 2HEYF 5K0UC 4LOTA 4XDOA 1FXZA 3CDZB 4LQRA 4AW7A 3CO2A 4E4DX 4BH9A 5H9PA 1GWMA 1NAEA 1UMIA 3IAQA 3LPFA 3VBFA 3NVCA 1S55A 4HXCA 1BXHA 3Q8EA 4B4PA 1LRHA 4LIUA 4I0AA 3O1PA 4N9HA 4IEWA 4SLIA 1ND2C 2X05A 3THPA 3C7FA 3AMMA 4BCUA 1N1YA 5EWSA 3WHUA 5CG8A 1C8M1 2VBPA 4OI0A 5FPUA 5FBJA 1H8VA 2WFF3 2YZ4A 1L7RA 5FCCA 4LK7A 3OGVA 1J84A 3OB8A 4A45A 4A3XA 1LHNA 4QDSA 4K1YA 3AP6A 3K46A 4HMZA 2FDGA 1QJY3 4R9CA 5L73A 4QM9A 3WT3A 4GD4A 1O3QA 3DYMA 1QQP1 2WJSA 5LK7B 1H0BA 2DDUA 3QOPA 2BP6A 2ZGLA 2RMU2 1KFXL 1GWLA 3HQXA 4P5HA 4XJWA 5FZFA 3IT8A 1MQTC 1BLZA 1UU6A 1YO8A 4FPYA 1RUD1 5J48A 5FZBA 1CVNA 4Y4YA 1H8TA 4JRAA 1STMA 2WAOA 2ZPXA 5ERLA 2NMOA 3RYRA 2PAMA 2DUQA 2N7GA 3FBMA 3R4SA 1JYWA 1NY72 4DUVA 4AE2A 4D0QA 3O0VA 1W6PA 1SBFA 5GLUA 1LHOA 4JGYA 4DIQA 1S0JA 2XBO3 4E9KA 4A4AA 1POV1 2W87A 1M4WA 2IVJA 2ZHKA 4PIYA 5FXVA 1JZ2A 2X8KA 3PTRB 1W8ZA 2HEWF 1RGSA 1HB1A 2WDBA 2XWBB 2QZ2A 3KV9A 2XJRA 4YFWA 5EFUA 5H9QA 5E1RA 3ZFGB 1ZBE3 3BTYA 3O1MA 1ZX5A 4E8CA 2WNUA 2OT7A 1W8FA 3ZR5A 1Z7S3 3D8CA 5T5OA 3NRUA 3V65A 2WAAA 2Q8EA 5DZFA 3VL8A 2IXIA 2RR12 4HVOA 4XF0A 4NROA 3KMHA 2EALA 4H7LA 3HPNA 2XG3A 1RUH3 1WMFA 1YRZA 3OBTA 2ZBJA 4QPGC 1DDLA 2BU9A 3PLQA 3O5SA 4JGZA 5FZ4A 4CCNA 2WN3A 2XXZA 2DCKA 5ANQA 1RUC3 2YPJA 2ID4A 2VOWA 4IEPA 4LLFA 1XE0A 5EJZB 4A6SA 4NAMA 2WN2A 4G9SB 3ZIXA 1XBFA 3OBAA 3T09A 3CJIB 3JUUA 5FO7B 4M3CB 2YUEA 1ZBE2 1TG7A 3U14A 2H6BA 5GZCA 3PVNA 1TNFA 1QJU1 3FMGA 3RZGA 3M3CA 2NZ9A 4Q27A 2P5BA 5F2WA 5FZLA 1VALA 3CZJA 4FPGA 1F31A 5LA2A 4D3WA 3IMNA 2HWE2 2Z79A 2W1WA 1ZBA1 1WCDJ 4XFBA 2ZMNA 1UZVA 1DFQA 5JIUA 4AVSA 1FI2A 1LGCA 2WL1A 2BTVC 4AI3A 1O3RA 1UIKA 2O8OA 3ASIA 4M3CF 2AEZA 4IGQA 4K3UA 1OPOA 4R9AA 4OHWA 1OLMA 1YQ6A 4BM8A 4Z2WA 4DY3A 3W58A 4COVA 1O5LA 3MF9A 3S5QA 1VBD1 3T4VA 4Z82A 4XUNA 1WD4A 2VOTA 2ATFA 1YFXA 2PHWA 1LECA 3DPRC 4GKXA 3WDUA 4A7KA 4FBFA 5HCHA 4LBJA 4G3YC 2E7TA 3WR0A 3J8F1 5J09A 2ZEYA 5D8AB 1RHI1 4Q8LA 1RUC2 1JZ7A 3QACA 4E2GA 1ZRIA 3KVAA 4RR3C 3D3AA 5F2SA 5FXZA 3THCA 2DCYA 3O14A 1ZRFA 4LK6A 5I8TA 3OTFA 1FOD1 4IV1A 4PLMA 4AEJA 2YC2A 1VRH1 3CU7A 1GANA 1QXPA 3I3EA 4QDQA 5K7PA 2F4PA 2WT1A 4RD7A 1JBCA 1VRH3 2ORZA 1UN1A 1S0CA 3KT1A 4OI2A 1ZBE1 3LDKA 3SKJE 4P9YA 4HVRA 4BQ3A 4N53A 1QEXA 5FZCA 5C5TA 4RL7A 4XJUA 2EA7A 1YWKA 2YYOA 4MHRA 3WF2A 3ZYFA 5C8CB 3ZSJA 1NZIA 2ZAAA 3NJYA 4KG0A 3U78A 4JC1A 3OYWA 3FZ3A 4CEWA 2XJTA 2JICA 2XVLA 3E5UA 3WF3A 1LHVA 5C9AA 4W8JA 4XDPA 4UBHA 5LRRA 5EP9A 5IK4A 4UBGA 1YEWA 1W2UA 2WO1A 5A7WB 1ZNPA 2WSUA 3HNMA 2A6VA 1DZTA 3GALA 2GC3A 2JIGA 2R7EB 4QPWA 1MS8A 1JI6A 5JPMB 3WOGA 4FSJA 4HONA 1GBGA 1ZBA3 2VQ0A 4BYYA 1VAKA 4XTPA 5JXHA 5DABA 2W3JA 3ME2A 5LEJA 2BVVA 1ZVFA 3ACHA 1RUI1 4XF9A 2A70A 4ASLA 3LIHA 5GLTA 4FVVA 1QQP3 1GKBA 2E7AA 1OF4A 4P5YA 1XNDA 4B29A 1FMD2 3E1F1 5JSPA 3UK9A 1LESA 1OH3A 5A7WA 4CDWA 4AL9A 4QGMA 1RUE1 5T52A 1V9U1 2C26A 3JXSA 4BU2A 4CCKA 4L2NA 1JXNA 3WP6A 3WQ1A 5BNOB 3V0AB 2ZGNA 2GP5A 4UW4A 1TME3 2HWB2 4URTA 5GLWA 3WG1A 4I09A 2JG9B 2GH2A 5BNOC 3FHAA 4KGQA 1IKPA 1W2AX 3NNGA 3RZMA 1MVEA 5A3UA 3USSA 3JBG2 1TMF1 3WD5A 2Q4SA 3OPTA 1B09A 5T3NA 3PVOA 5ACA2 2XKPA 5FYBA 5DAPA 3WVJA 4WZFA 4YGBA 2YDEA 3JB4C 3LCPA 3GJBA 5AFEA 5F8PA 2JEMA 1UY2A 4C0HA 4Q29A 2VNOA 3I8TA 3R6SA 2BOJA 3LA7A 4LKSA 3VZOA 1ENXA 2PA7A 3DECA 3B3QE 4LKFA 3JBG3 4PLNA 4LBQB 1JZ6A 3RZHA 4Q4Y2 3B7MA 5FZ0A 4PQ9A 3ATGA 2WNVB 1C8M2 2C6SA 4YVSA 1SFYA 2VZPA 5FP3A 3SC7X 3TBDA 2Q1FA 3VBRB 2DUOA 1FNZA 3DN7A 4L92A 4D6SA 1AR91 4DXTA 1S0FA 4J6GA 5T55A 1RUG3 1EP0A 3IDEA 4W6YA 1PX3A 2A6XA 2CDOA 4ZU5A 4KWLA 3DPRA 5LBCA 4JHTA 3O1SA 2PMWB 2D3SA 1Q8QA 1ZM1A 1O4TA 5EJ3A 4HT1T 3NMBA 5G04L 4YVWA 2KD7A 5IFPA 5IK5A 4RS5C 5JOZA 1UW8A 2R0HA 5C3OA 2WQZC 3H0OA 2BGPA 3APBA 2OVUA 5L9BA 1LCLA 1OD3A 1RUJ3 1V6IA 3OY8B 3OPZA 3TEXA 2ZZQA 2OUHA 5LRSA 4OMCA 2IXKA 1EUUA 1PO13 1IPSA 1W9SA 2NN8A 2R30A 4YM1A 2XJQA 1GP6A 3SCFA 2FD8A 1IQAA 2YBKA 4AFCA 3IZOA 1X50A 1HW5A 3LZZA 2E31A 3T2OA 1PM7A 3LF7A 2PLV2 1O3TA 1ENQA 4HSJA 2EICA 3WXPA 2C9AA 3MDPA 2WS93 1GR3A 2WR9A 5C7GA 5KR7A 2DFCA 4EWEA 1F35A 4COUA 2B9UA 1H4GA 5FJKA 2RHPA 5EJ1B 1JZ4A 1RUH1 1MS4A 5ABJA 2VUAA 2HEVF 1CAWA 1W6NA 4JGZC 4J1XA 4C1XA 1NA1C 1UL9A 2YROA 2ORXA 3VZJA 4COYA 5IW0A 4DEQA 3LEIA 2CGPA 5IVVA 4XW3A 1RXFA 2G19A 5JIAA 1RL3A 2BQPA 2B9VA 3WW3A 1RUG1 4XBNA 2X53S 1Q43A 2AC1A 3ILRA 3BYWA 4YG6A 4UXAA 3MLKA 2Q8DA 2OX0A 4E4ZA 1DGWX 3L2HA 3WNPA 2VNVA 1L7QA 2BYVE 2PHXA 1F2NA 2WO2A 3HNYM 1URXA 3JQWA 4N90A 4QKNA 1FAYA 1KJRA 5JXJA 1KFUL 4YYOA 4FQ4A 4KWUA 3PTYA 3QLQA 2AEYA 2VZ1A 1NCRA 1HV1A 1UO9A 2I07B 2EIGA 1MZEA 1TMF2 2QQJA 3IIAA 4XQDA 4UFLA 5DUXA 2OPKA 2VBDA 3B93A 3Q8CA 4H55A 2RV9A 5FK8A 4QX3A 4HLTA 2B46X 2ZOEB 1JH5A 4IV3C 1EPZA 1GOFA 3VBSB 5HCAA 4M3CE 3T2QA 1UPIA 3C7HA 2DVBA 5SV5A 1PHMA 3UV9A 2XDVA 1KITA 5T5LA 1GV9A 4AYUA 3I3QA 5FUIA 2MEV1 5FZMA 3ZFGC 2VZSA 3LQCA 1LENA 2LUWA 4CDUC 3FUOA 1V6LA 1DZRA 5LA9A 1HRI2 5I8YA 2ETEA 3LAGA 1UZ0A 2F17A 3B02A 1UXZA 2BUKA 3ZXLA 4GWNA 4NRMA 2J1EA 4A3ZA 2BBAA 1V6NA 2UY9A 3U75A 4XFCA 3UGHA 4AQ6A 2RM22 2X29A 5FP7A 1CX4A 5FTTC 3IMMA 4XZUG 3VZLA 4IUGA 5CZKA 1VRBA 2D44A 2J1TA 3AFKA 3EQEA 5F6KA 1G8WA 5C8CC 5BNNB 2H0VA 5CFDC 4LBQA 4JVAA 2GNMA 4XQWA 3NKTA 2WNEA 4ES8A 1UXXX 4O7XA 1S0BA 1OKOA 1HJGA 1U0AA 5GJ6A 2CHHA 1ODMA 4JDNA 3N7LA 2WINB 3TOJA 3WF0A 4LULA 2FQPA 2VZTA 4KNCA 1MZ6A 1JOBA 1QDOA 4MXWB 4Y24A 2VZVA 4XJAA 4LBOA 3AXEA 4YW6A 4GMP3 5KC5A 2VZQA 1ZRRA 1SHWB 5ABJB 2GAUA 1G9FA 5FMOL 2WZ8A 2B39A 3UGFA 2EIDA 1REEA 1N47A 4YVSB 1JZ3A 3ZDVA 2NM1A 3POSA 5FRAA 4YGCA 2GSYA 1TME2 5FP9A 3T0AA 2ENRA 3F95A 3N36A 1OLQA 1JZ8A 3KD4A 2JXAA
chains in the Genus database with same CATH topology
2ZS6B 2Q5TA 2DV9A 2JECA 4AI1A 5I91A 4F7ZA 1EPWA 1WW5A 2Z42A 2DURA 4S2GA 2IFRA 4CDWB 1S1AA 4XJZA 1IOAA 1YFUA 3ZFEB 2UYBA 4YW5A 1AR72 3BTAA 4AVBA 1KRIA 2ZX3A 2HWF1 2E9QA 1LGBA 4QM8A 3BU7A 1LR5A 4FOVA 4JRLA 4FPCA 2XLAA 3J8F3 4KGGA 5JR7B 1AR71 4AK3A 1NCQA 4XF4A 2JX9A 4BHPA 4LHLA 1PK6A 4YVSC 4QGNA 3DUIA 5FMOS 3HWJA 4FAHA 4LNVA 2JD4A 4FCAA 5GLVA 4GH4B 1PNGA 5CFDA 3BCWA 3IPVB 3E5XA 5IUQA 5C8WA 1H30A 3RPQA 3ZN6B 4HZFA 2Q1MA 2WNVA 2VW1A 5BNNC 3WW1A 4NR1A 4JTNA 1FOD3 3FFQA 1DQ5A 2CWSA 1HXS3 2RS33 2QCSB 5JPNB 3USUA 5BUVA 4M01A 3ZIWA 4KWKA 1FPN2 3CLPA 2IXJA 1DQ1A 2RR11 4S2FA 3U11A 3E97A 4AGRA 3SISA 1XQNA 4AFAA 4OI1A 3GF6A 2D40A 2XKOA 4O9EA 1NXD1 1C8NA 3SHRA 4OLLA 3ZYPA 1KDKA 2WS92 2ZGRA 4E2SA 1W6PB 3OY8A 1CPMA 2LALA 1V6MA 2I2SA 2OZ6A 2JG9A 3UJOA 1MS0A 2DFBA 3VZKA 4B7EA 1H9PA 2B7YA 2DUPA 3WDVA 5I93A 4XBLA 1RUJ2 5FFOC 1N3QA 4ZKTB 1JTZX 3HIFA 1BJQA 1HXS2 2MEV3 4LLOA 1ASJ1 3VBOB 1MEC2 4B4QA 1LOBA 1ULFA 2PTMA 1QH7A 1ULGA 1D4M2 3HT1A 3VBRA 3RJ2X 2EXHA 1ENRA 4GH4C 2D5FA 4WM8B 3MYXA 1CPNA 1UKRA 3TNPB 1BMV1 4BIOA 1OSGA 3NAPC 1NA1B 1OKQA 2Q30A 4GMP0 1U12A 3DL3A 4A7ZA 1FX5A 5JZGB 2R072 3JD72 2BVBA 2VH9A 4IV1C 1LOFA 4XFFA 5JI9A 5BYNA 5AVPA 4QX5A 5BNPB 4RHV3 3G7DA 1DQ6A 5CFCB 3ZFEC 4B8EA 5AC91 3WHTA 4CDWC 3PHMA 2CGOA 3T1MA 4A2UA 3LSEA 2VNRA 3ZX7A 3H7YA 1ZZ6A 1XXNA 1FMD3 1AL0G 2VG9A 5I0SA 3BOPA 3ZFFA 3JZVA 3D6EA 4FXKB 1CR7A 1DF0A 3M1HA 4RS5B 5CADA 3AKQA 1QHDA 3I2DA 3I7DA 2E6VA 1W6MA 2D7FA 2XBO2 3ZXEA 1HQLA 5E16A 1ZRDA 3OF1A 4WVZA 3RDIA 3RI9A 2VULA 3LA2A 1RUE3 1VB2A 3P3PA 4N7IA 4XXPA 5CFCC 2ZX0A 1NLRA 1TNRA 2ZJCA 1C28A 4IEXA 4Q4X3 1A8DA 2JKBA 1FYUA 1PZ9A 5FQ0B 2GDFA 3A0KA 2R071 3JD71 3VDDC 4W6WA 4E27A 4FOQA 1DGLA 4HK8A 2DVAA 2WLQA 5I0UA 1ONAA 1S0EA 4LO7A 1HRV3 4N53C 2UWBA 3NV4A 2FZ1A 2V73A 4FP3A 3CEWA 2D3RA 4YSFA 3ZMNA 4EWDA 1UZYA 4QD2A 4WM7A 1AVBA 2EXJA 3TN91 1QF3A 4WM8C 4Y26A 4YVWC 2K0GA 2OZJA 1YIPA 2A73B 2B42B 3MFCA 5CAZA 3ILNA 1PGW1 1N3OA 4XZPA 1DIWA 4IEZA 2I45A 1IS6A 1NLSA 2JG9C 4ONUA 4QXKA 1ASJ2 1BCXA 4WVMB 4HKOA 2CGNA 3H8UA 4IQPA 4OUMA 3JBG1 4XXAA 1RUOA 5FO8B 2PHUA 3AXDA 5K8SA 1CD3G 1Z0HA 5JWPA 4YARA 1ZZBA 4F8AA 1MZFA 3AMQA 4JGYB 4Q2FA 2AUYA 4Q4V3 4P9WA 4AGGA 3LOBA 2V09A 3VZMA 2WIIB 2HWC3 4CTEA 1FV2A 1SLCA 3E6CC 4X6QB 1ENSA 2FBEA 2WS91 2WZPP 3LGRA 4ZU7A 2D6MA 1Q3EA 3W9AA 1IHMA 3B94A 4G4FA 4YFZA 1PO11 4LR4A 1UIJA 4BE3A 1MACA 3VKFC 3RMXA 1KS5A 2ZHMA 4LUKA 4N53B 1FPN1 3FE5A 4FOWA 1J59A 1YXWA 3WQ7A 1XNCA 1KD7A 2R6QA 5KHKA 2ZCWA 4LTAA 2GC0A 3H1WA 2VOVA 3M3IA 4D7SA 3RZZA 2RS11 1EAH3 1LOCA 1FATA 4ZXKA 3W59A 3K48A 1COV3 2PAEA 5HI0A 3X29B 4DPNA 1RVF1 1BK1A 1AYN1 1VBB1 2DTWA 1YIFA 4QQLA 4UW3A 2JJ6A 1WD3A 1KDMA 1I6XA 2PELA 4QPIA 4YM3A 5J36A 5E8AA 5JSRA 2P3KA 4RQPB 3VBFB 3AZXA 1UKGA 1DQ2A 4BMBA 1ND3C 2QE3A 2VW2A 3GHNA 4BLJA 1PIV1 1IGOA 4GB31 4CP0A 3B9CA 5CNAA 1PO23 3DV8A 5BNQA 2CTVA 2ZABA 4V1PA 3R05A 3WUCA 1GLHA 2ZGKA 4FOYA 4AEMA 1HX6A 3KM5A 2LM3A 1Y7BA 3ES4A 4CRQA 1RIRA 3VBHA 1MZ5A 4OHYA 1NCQC 1VBD3 2A3WA 1ALYA 2HWF3 4AI0A 2WQ4A 4RQPC 4LHKA 1A78A 1OOPB 1MR5A 1A3KA 2Q1ZB 1AR63 2DVFA 4BPZA 1XYPA 3KS7A 2RS52 4LE4A 4QPGB 3LWCA 4MSVA 1RC6A 3MW2A 3OD0A 2RS12 4MH0E 1G9CA 1BEV3 4EWAA 2D98A 4YZ3A 2WFF1 2QQPA 5JVVA 1F5FA 5KXCA 4FPKA 3CF6E 4IERA 1HDKA 1MEC3 1SBEA 5CFDB 1WLCA 2D5HA 4AEDB 1H2LA 2PHLA 3NV1A 4QT6A 5D1IA 4K6BA 4D7YA 1BBT1 4A7YA 2DVDA 4Q1PA 3VHNA 4I0WB 2ZTNA 4Y20A 5DZEA 2ET1A 1DLLA 2IXCA 1RMU2 2XH6A 3H50A 3N7KA 3SITA 1UPSA 4U36A 3AK0A 2PQQA 4MVTA 3AP9A 1HRI1 3FHIB 4MGZE 4IV3B 3WG4A 4Y1ZA 1POV3 3SLIA 2D43A 1NY71 5F1RA 5KXEA 5JOYA 1LJ7A 3MLJA 3FUQA 3NV2A 3SCHA 2R042 2YGMA 4FTSA 5JCTA 2R49A 3KT7A 3O0WA 5T5JA 3ZYGA 4D94A 1G9BA 1G86A 3S30A 4HK9A 1NYWA 2YY1A 3N3HA 2BWCA 4KWJA 4Q0PA 4YLZA 3EBRA 4R8HA 1REFA 4K20A 2OIIA 3WP3A 1CAUA 4N43A 4XHXA 4ITCA 1PNFA 1WMEA 4OULA 3AZZA 3NSTA 4Y22B 4K8FA 3RG0A 1UF2C 1UZZA 2HWD1 1QJY1 5K0UB 5GZEA 1RUH2 5A3LA 1G9AA 3TRSB 4HBNA 1YJKA 1NZCA 2OYZA 1CAUB 2ES3A 1LOAA 4HANA 1SCSA 1GZWA 1C3HA 2WLPA 1AXKA 3VGIA 5CB7A 4XJ8A 4FPJA 5C33A 3D5OA 3J26N 4Y1YA 4IETA 3AKSA 5C4WA 3VHPA 1NOVA 3PVBB 3ZYRA 2WZR1 3H3UA 5DXDA 3S6PA 3H1YA 4HKWA 3MIBA 4OHZA 5GKAC 5AC93 2DTYA 4ATEA 5ABJC 1LODA 5GALA 1LKNA 1BVVA 4MGYE 1WLTA 1ZZ7A 5CIRA 3B5LB 3QD6A 3U07A 3S0MA 4RR3B 1GYKA 1LOEA 4R4ZA 5AC92 5KWRA 3AYEA 2HWE3 4LA2A 5BXXA 1GZ9A 1AR92 3AP7A 4WZCA 2CY6A 4DOUA 1QJY2 1YHFA 2VNGA 4CEYB 4XETA 4MZUA 3WDTA 4QPIC 2PHRA 2RS32 4TZDA 1SQ4A 1OA3A 5FAXA 1LHWA 3T2TA 4I0BA 1QJZA 4YNIA 2IWGB 4AF9A 1BMV2 3AZVA 2PHDA 3M8LA 5DUUA 2DYCA 2P3JA 3ZN6A 2PHFA 5HBAA 1QH6A 3URFA 2IZWA 4MUVA 4X6RB 3K51A 4YM0A 2JE9A 5FREA 1H2NA 5AVAA 1H2KA 2W68A 3AMPA 1OD5A 2B5HA 2D97A 2E63A 2QVSB 5GZFA 4RFT0 3VBOC 1WW4A 4HN0A 1KS4A 1Q8OA 4AFMA 2CV6A 3ALQA 3WY6A 2W08A 2X5IC 4R52A 1LEDA 1OHFA 4YG0A 4HVQA 5CA6A 4N7UA 2KM2A 1RINA 2H6CA 3N35A 2K2SA 4P9LA 4GIQA 2VOXA 4P9IA 3AM2A 4LO5B 1BBT2 5FPXA 2CNAA 4YVWB 1R1ZA 3ZDSA 4CDXB 4KL1A 5F5QA 1IPKA 1LOGA 1RUI2 4RQPA 4BA6A 1V9U3 1J3PA 4WV8A 1GNZA 3FLRA 4Q0QA 4WVMA 1WCSA 4MYEA 1QDCA 1WLWA 3VDDB 1BZWA 3ELNA 3EHKA 2DWRA 1Z7S1 4AEDC 3Q9OA 2ZX2A 5KHHA 3MFAA 1FNYA 2D6OX 4FXGB 1J1TA 2HJIA 1QOSA 4XEZA 4AHYA 1CAXA 2HWB3 4BZ4A 2VMHA 1ZREA 1QKQA 4AHXA 1YCIA 2VU9A 1AYN3 1QJX2 4EN9B 2CL2A 4MXVA 4QQ2A 2EF6A 3ETQA 3D0JA 4SBVA 1YI7A 5D8AC 1MS5A 4I3GA 3QBQA 1PGL2 2GMEA 3J8F2 5C6CA 3D4KA 2GZWA 1EAH1 2WA4A 5EXOA 2FHRA 1QMJA 3QCWA 2CAUA 4DZGA 1VBD2 1WCKA 2HWF2 2JG8B 4CDQA 1IZ3A 1T6GC 5DUVA 1WW6A 3AYDA 4Z07A 4AGVA 4FP2A 3AKTA 4GB32 2DCJA 4TYSA 5DDJ1 3O7OA 1QJU3 2ILMA 2EVXA 1WA4A 1APNA 2VVDA 3DPRB 3GZTB 4FPFA 5D8AA 3AYCA 4LT5A 3WZ1A 1C5HA 3ZMOA 1RHI3 4HSLA 4XF1A 3M2MA 1PGL1 1TME1 1OQEA 1OFNA 2Q8OA 1ZBA2 4MGKE 1Y43B 1W6MB 4KG8A 2R32A 2HWC1 4OI4A 4WVWA 4AVAA 3UJQA 1VBB2 4QPYA 4META 1X7NA 5HCFA 3ZXGA 4YZ5A 2RS13 3GBWA 2BGCA 4J1WA 3AKPA 1AR61 3CNAA 3OYWB 1VIWB 1GQGA 1R082 5J37A 3H3ZA 5DG2A 1Q8SA 4F83A 2ZX1A 1QU0A 4L11A 2RM21 4RHV2 3ACLA 2AYHA 2ZA9A 3C2UA 4LEJA 5B2GB 1REDA 3N4MA 3DKWA 1WUVA 4FQZA 4UW6A 4HKLA 2QJVA 2W52A 3TYJA 1QXRA 3RI8A 1VBB3 3ZN4A 2GC2A 3N7JA 2D6PA 3M4FA 2WNVC 2QKDA 4AI2A 4D69A 4QPGA 1X36A 1YNAA 1O4YA 4DS0A 4TSVA 2WT2A 2FMDA 2Q0AA 1W0OA 1U5YA 3VBHC 3BALA 2OA2A 1VJ2A 4UW5A 1MQTB 2ZGMA 2DCZA 3V0BB 4IEQA 2BWAA 4Y1XA 1C5IA 4YGDA 4GWMA 2X5IA 2UWAA 2Z69A 5L7OC 1XU1A 3UKVA 1AX0A 3EXUA 2ARBA 5I0TA 3UL2A 4XTMA 2BPA2 1AL23 3L2YA 2VUJA 2XLGA 1H1AA 1B35A 4ATFA 1GFF2 5H9RA 1ND3A 1R093 1R1A2 1XRUA 3SH3A 2RMU1 4XJ9A 2SLIA 3ZSKA 3JCIA 1AR82 3ECQA 4IV3A 1I9RA 4XOGA 3AFGA 1OOPC 1VR3A 3MF6A 3MPBA 3PNAA 1N1TA 1ULDA 3AZYA 2ARXA 3TN92 5IT6A 1J3RA 2A7AA 4L97A 1C1LA 1U5XA 2QUOA 1M06G 1R091 3QH6A 3ZO0B 3VBOA 4RGGA 3MIGA 1XE8A 4AVTA 1ZRCA 2A6YA 3IPVA 3ZSLA 1BVP1 5BNNA 1R081 2B8MA 1JYIA 3HAGA 3M7AA 3KSCA 3TAYA 2PLV1 4YW2A 1HRV2 3FX3A 4LBNA 2GNBA 3DGTA 2BNNA 5DUWA 4E2QA 3JB8A 3TN93 2ZGPA 1RUI3 2AGSA 2AENA 5KBFA 1VBE2 5J3UA 4PBPA 1H9WA 4MGIE 3H7JA 1DYKA 1SLTA 4KBBA 4QMAA 1H2MA 2VPVA 5C9AC 2D6NA 4AVVA 3J9SA 1SEFA 1ULEA 5FPZA 2WSVA 3I59A 4Q4X1 1ZYBA 5EZWA 1RB8G 4OZXA 1PK6B 3ZYIB 1LULA 3ROUA 2BFUL 2D3PA 1AL21 1NG0A 1OPMA 2ZZJA 3E5QA 4ISQA 4HL0A 2R063 4PIXA 2ZGUA 4CYDA 4R9DA 2VMIA 1I3HA 2IXHA 1QJX3 3FBYA 4ES9A 3R4UA 1VBA1 2FZ2A 1EAH2 3WG2A 2GALA 2HWD2 5A32B 5JAXA 2XJPA 2VY0A 4Q4Y1 4H7MA 4AEKA 4QU2A 5JZGA 1TEIA 3ZXKA 3UKNA 4CP1A 1IPJA 3KZ4C 3UKTA 4BMEA 2UURA 1L3JA 4HN1A 1MS9A 3RQ0A 1MS1A 3BPZA 1D4M1 4XFHA 1LTEA 5L19A 2Y38A 3ZVXA 1MEC1 3IDBB 1AYM3 1RITA 4Y1UA 1O5UA 1COV1 1BEV1 3GBFA 5BPXA 5AFBA 2R041 4XMIA 1RUF2 3I4IA 3VN4A 4PF5A 4R9BA 1V9U2 4COWA 5DDJ3 2R0FA 2VVEA 1ND2A 4Z8BA 1XNBA 3VKNA 2UWCA 1KQRA 1PGSA 2WKKA 1WMDA 1FMD1 4XE9A 4NO4A 4DY5A 3MZHA 1AR83 1JHNA 2R043 2X5IB 5GM0A 1PZ8A 4FTEA 1NE4A 1OQDA 1VP6A 3H9AA 3FWEA 5JDBA 4XFGA 2XVGA 4AHWA 1ASJ3 3MICA 4AVCA 2UY8A 1ULCA 4ISRA 3RSJA 1AR73 4YG3A 1ND2B 3VBUB 1UU4A 4AI8A 4K1ZA 3E6DA 1S0IA 2VQAA 1HLCA 3KQRA 2O8QA 2ZGSA 4RS5A 3A0NA 4JGZB 1C1FA 4XFIA 1PIV3 3SH4A 5JMCA 2VVFA 4PIZA 2R16A 2XJSA 3IKWA 5DZGA 1RUF1 3B9IA 4Q4Y3 3D82A 3HMYA 4XYXA 2YC0A 4MXWA 2WNUB 3MGUA 1HQNA 3MIFA 1FPN3 2EAKA 4EN8B 3FLTA 1VAMA 2ERFA 3AKRA 1VRH2 3WUDA 3MIHA 1ZZ9A 1FOD2 2DCTA 4YM2A 4WM8A 4JTOA 2DVGA 2R1DA 4DQAA 1D4M3 1LHUA 1NA1A 1VAVA 5T5PA 4NN0A 5C4WC 4M0HA 1VBC2 5ACA3 4QQPA 3RNSA 1DGRA 1D0GA 3ES1A 1NCQB 4F3JA 2V5YA 1S0DA 4YRDA 4Y5Z0 2A6WA 2ZHLA 1PIV2 4FPEA 1V6KA 4IXLA 4XMAA 3H1MA 5JI7A 3ZYJB 1HQWA 4GKYA 2PLV3 4IESA 1FV3A 1QOTA 3KCYA 4DXZA 3M3OA 1NQDA 4CZSA 5F6LB 2HKXA 2WZR2 1XYOA 2GC1A 1F9KA 2VOKA 5EV7A 4Q0SA 1AX1A 4Z1VA 3WV6A 4B4RA 4LBMA 3VBSA 5I0RA 4AHZA 5JOWA 1BKZA 5BNPA 5KXDA 1HIXA 4S2DA 2XPJA 3BIWE 5CU1A 4QQOA 3IWZA 4XHBA 2NPIA 5L7OA 2RMU3 3USUB 2PFWA 3CJIC 4JDOA 4AWDA 2ZGQA 4Q4W1 1SACA 5A33B 2BNOA 3P3NA 1LOFC 5TSWA 1C57A 5FDBA 2IC1A 2VGDA 2XJUA 2GMPA 5BV6A 4AG4A 4M00A 2RS53 3MW4A 2R1BA 1AJKA 4EN6B 1R092 1CAWB 1W6NB 3NJZA 2P3IA 3THTA 3VDDA 2XVKA 3OBRA 1GICA 2XL9A 1SDWA 4BOWA 2VECA 3M3EA 1I5ZA 1N3PA 2WWSA 1AR81 2MEV2 1JUIA 1LEMA 3HT2A 1OA4A 1J58A 2YMZA 5GZGA 1OLRA 1R1A1 1IS5A 3V0AA 5BNOA 2HYKA 4BQ1A 3M70A 2P34A 2RJLA 4RA0A 3VKMA 4HETA 2Y0OA 3IBMA 1RUD2 4CDUB 3KGZA 2DU1A 2B45X 3VBHB 1RMU3 3GNEA 4Q4V2 4INDA 3VBUA 2WA3A 4MLOA 3O12A 4Q1RA 3RS6A 3FFZA 3OD4A 4MX3A 2O1QA 1Y3TA 4JV4A 4CDXC 1C8M3 2E7QA 2DF7A 1RMU1 3NL1A 4NOTA 4NWVA 4BLIA 1H8TC 1G9DA 1N1VA 3RMYA 3C3VA 3HN1A 1RUG2 1PMIA 3ZXAC 3V56A 4XF3A 1F8VA 2EXKA 4X8PA 2MHFA 3GBGA 4B3NA 1RJ7A 1YI9A 1NCRB 5CFCA 4YZ2A 1K5MB 3RJRA 2ZMLA 3RYKA 5FOJB 5HXVA 4RHV1 2D93A 1CONA 1UCXA 4Q26A 4XFAA 1WGPA 2P37A 4Q4W2 3WLUA 1YJLA 4K21A 1AR62 1D0HA 2RS51 4CDQC 1O7FA 4YGEA 5KHGA 2ET7A 2YHJA 2NQYA 1DQ4A 1PVC3 1DU3D 3KCCA 2ZMKA 2WZR3 4DRVA 1A6CA 5J96B 4FO9A 3WDXA 2YXSA 1AX2A 4P9JA 4S2HA 4RR3A 4I01A 3POWA 1PVC2 4YW4A 4XQ4A 1BBT3 1J1LA 4C0BA 1PO22 2O0OA 3MI8A 4AEDA 1QNYA 2NMNA 3VBFC 1DHKB 3VHOA 4YZ1A 2IFWA 3ZXJA 5C4WB 3FC0A 1QOOA 2A5ZA 4OHXA 5GZDA 1AUYA 3SNMA 3WW4A 5GLZA 3KLSA 1X8EA 4Y22A 1NE6A 2Z5WA 4M0NA 3PJQA 3VHRA 4FTBA 3RRDA 1FT9A 4WM7B 1W6QB 3AB0A 3VUOA 1VBC3 4NPRA 5C9AB 1XYNA 2CAVA 3LOIA 4IV1B 1CQ9A 2P17A 1J3QA 2RR13 5JZGC 5HCBA 5ACA1 1UMZA 4I2OA 4LO8A 1AYN2 1B35B 3MPPG 1RVF2 2Y26A 5CBLA 1AYM1 5LEKA 3GZAA 1AR93 4JDMA 2PYTA 4N43B 1JN2P 2QDRA 1HXS1 1Q56A 2OW4A 3S7IA 4GULA 4PDWA 3TNQA 1IS4A 2G9GA 4Q0VA 1SLIA 3ZN5A 1RUJ1 5KC6A 4XDQA 3S7EA 4FPLA 3A4UA 3CL1A 1GZCA 4DMIA 2Z2SB 5T54A 4ASMB 5FLIA 3GHMA 1LB2A 1QY4A 2ZGTA 5A32A 2TNFA 1PO12 4IEVA 5E88A 4CEYA 1H4HA 1DGRN 3OGGA 2RE9A 5LK5A 4WBBA 2XHKA 4DFSA 4FPHA 1CJPA