1D4M3

The crystal structure of coxsackievirus a9 to 2.9 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPTMNTPGSTQFLTSDDFQSPCALPQFDVTPSMNIPGEVKNLMEIAEVDSVVPVNNVQDTTDQMEMFRIPVTINAPLQQQVFGLRLQPGLDSVFKHTLLGEILNYYAHWSGSMKLTFVFCGSAMATGKFLIAYSPPGANPPKTRKDAMLGTHIIWDIGLQSSCVLCVPWISQTHYRLVQQDEYTSAGYVTCWYQTGMIVPPGTPNSSSIMCFASACNDFSVRMLRDTPFISQDNKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COXSACKIEVIRUS A9)
publication title The crystal structure of coxsackievirus A9: new insights into the uncoating mechanisms of enteroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d4m300
2RR13 4Q4Y2 1TME1 1AYN3 2R062 1M06G 4Q4X2 1C8M3 1PVC3 1AR72 1AL0G 1MEC1 2PLV3 4CDXA 1VBD2 2WZR2 1VBE1 1VB4A 1FPN1 1RUE2 4AEDC 4GMP1 1HRI1 1MQTC 1AR81 2HWF3 1POV0 1PO21 3ZFFA 1ND2A 1CJDA 1VBA1 2R043 1HXS2 4GB32 4NWVA 5DDJ2 1EV11 2RS12 4YVWC 1R1A1 2X5IA 1QJZA 3VBFA 2BPA2 3VBHA 1RUC1 3JD71 3VDDC 4RFT0 5ACA2 3VBFB 3ZXAC 1AYM3 3TN93 1NY71 1AR93 2RMU1 1ZBA2 4RQPC 1CD3G 2XBO2 3VBSC 1R082 1QJY1 1TME2 4WM7B 4AEDA 1RUJ3 2HWD1 1MQTA 1RUF3 4Q4Y3 1MEC2 1TMF1 1X36A 4AEDB 1ZBE3 3VBOB 1Z7S2 1VBE2 1MQTB 2R063 1FPN2 4Q4X3 2RS31 1AR73 5BNNC 3HAGA 1VBD3 2WZR3 4YVWA 1B35C 4CDQC 1PO22 1HQNA 1RUE3 1NCRC 3VDDA 4YVWB 1COV2 1VBA2 5J96B 3VDDB 1EV12 1RUG1 1R1A2 4RQPA 1RUC2 1HXS3 3VBSA 2TBVA 1GFF2 5DDJ3 5FOJB 3LOBA 2RS13 4RR3B 4RQPB 2HWB1 1H8TB 4FTEA 1NY72 2RMU2 1AR61 1NA1B 5ACA3 4IV3B 4CEYC 1ZBA3 2XBO3 5BNNA 1V9U1 1RUD1 1B35A 4CDQA 5A33A 1OHFA 3JBG1 1TME3 1TMF2 5BNNB 1NCRA 1AYM2 1B35B 1HRV1 5A33B 2RS32 1MEC3 1AR92 3JB4C 1NCRB 2GSYA 1VBE3 2WFF1 1FPN3 4GMP3 5K0UB 1HRI3 1QJU1 1C8NA 1AR83 4Q4W1 3NAPC 1PO23 1RUF2 1RUG2 1A6CA 4LLFA 1ZBE2 3VBRC 1COV3 1AUYA 1VBA3 4CEYA 1R091 4WM7C 1EV13 1R1A3 1BMV2 4RHV1 4CEYB 1RUC3 5CFDC 2HWB2 4WM8C 3JD73 1AR62 3VBOC 1NCQC 4N53C 2RMU3 1RUH1 4GMP0 2RS51 1QJY3 1PGL1 1RUD2 3JBG2 3DPRB 1NG0A 2R071 1POV1 2VQ0A 4JGZC 2HWD3 1W39A 1HRV2 3NAPA 1D4M1 1RVF1 1TMF3 5AC91 3VBRA 3NAPB 2RS33 3IDEA 4JGYC 4NWWA 4RR3C 1QJU2 4WM7A 3VBRB 1H8TC 5CFDA 2WS91 1NA1C 4IV3C 4WM8A 4Q4V1 3VBOA 1NCQA 1RB8G 5CFDB 5L7OC 4N53A 1R092 1VRH1 4WM8B 1RUG3 1NCQB 4RHV2 4QPGC 4N53B 2QQPA 5JZGC 1HRI2 2WWSA 5FMOS 1AR82 2HWB3 4JGZA 2R041 1BEV1 5D8AC 2HWE1 1RUH2 1AR63 4SBVA 2GH8A 1VB2A 5C8CC 2RS52 4JGZB 1PGL2 5C9AC 1K5MB 5K0UC 5ABJC 4JGYA 1QQP1 2IZWA 2R072 4RR3A 2XPJA 2ZTNA 1RUD3 2BFUS 1H8TA 3JBG3 1D4M2 1RVF2 5FMOL 4JGYB 3JD72 1NA1A 2DF7A 4IV3A 5AC92 2FZ1A 1AL21 1HRV3 1F8VA 5L7OA 3VBUB 1EAH1 2HWC1 2WFF3 1QJY2 4QPGA 5L7OB 2WS92 1QJU3 3ZFGC 1DDLA 5JZGA 2BFUL 4Q4W3 4Q4V2 2HWD2 3FBMA 4QPGB 2MEV1 5D8AA 5C4WC 5JZGB 1VBD1 4PDWC 5C8CA 5GKAC 1R093 5D8AB 5C9AA 3DPRC 5K0UA 2ZAHA 5ABJA 5C8CB 4CDUB 1BBT1 4FTBA 4RHV3 4CEWC 5C9AB 1VBB1 2HWE2 5ABJB 1ASJ1 5BNPB 2RM21 4GB31 2BBVA 1RUH3 1PGW1 4IV1C 1RHI1 2RS53 1HX6A 1QQP2 4QPIB 1FOD1 3ZFEB 3JB8A 2R073 1POV3 3ZFGA 5A32B 1AL22 1PIV1 1D4M3 1RVF3 3J8F1 3S6PA 4YVSC 1EAH2 2HWC2 3ZFGB 4RS5C 5C4WA 5AC93 2FZ2A 4CDWC 1R081 4PDWA 1RUI1 1FMD1 1QJX1 1VBC1 5CFCC 5C4WB 3DPRA 4PDWB 1V9U2 2WS93 4CEWA 2MEV2 1Z7S1 4Q4V3 1PO11 1K5MC 4CEWB 1VRH3 4CDXB 1RMU1 4IV1A 1BBT2 2WFF2 1OPOA 2RR11 1VBB2 4Y5Z0 4IV1B 1ASJ2 1AYN1 1OOPC 1COV1 2RM22 4Q4W2 3ZFFB 1BEV3 1C8M1 2HWE3 1PVC1 1ND2B 1PGW2 2PLV1 3M8LA 3VBUC 1RHI2 1NOVA 4YVSA 4RS5A 1FOD2 4CDWA 1F2NA 5CFCA 2X5IB 4YVSB 1QQP3 2HWF1 4RS5B 3VBHB 4CDWB 1PIV2 4FTSA 3J8F2 5CFCB 1IHMA 1WCDJ 1AL23 1RUI2 1FMD2 1QJX2 1K5MA 1VBC2 2ZZQA 1EAH3 2HWC3 4BCUA 4CDUC 4Y4YA 1ND3C 5BNPC 1V9U3 1AYM1 1OOPA 1PO12 3TN91 1AR91 2MEV3 1RMU2 3VBUA 4QPIC 4GH4C 3CJIC 1OOPB 4EJRA 3ZFEC 2RR12 2WLPA 2Y26A 1AYN2 1BBT3 1RUJ1 4N43C 1RUF1 1C8M2 1VBB3 1PVC2 4Q4Y1 2PLV2 1X33A 1ASJ3 1ZBE1 5BNOC 2RM23 2R061 4Q4X1 1SMVA 4GB33 1AR71 1VRH2 1RHI3 2WZR1 1BMV1 2HWF2 4Z92B 5J98B 4CDUA 3VBSB 1FOD3 1VAKA 1RUE1 1E57A 1ND3A 5BNPA 1PIV3 2R042 1BEV2 3J8F3 4CDXC 1ND3B 1R083 4QPIA 1RUI3 4GH4A 1FMD3 1QJX3 3CJIA 1HXS1 3ZFEA 1VBC3 5DDJ1 2RS11 4GH4B 3CJIB 5A32A 3ZFFC 3TN92 4CDQB 1ND2C 4N43A 5ACA1 1Z7S3 4FSJA 1PO13 5BNOA 5LK7B 4N43B 2X5IC 1RMU3 1ZBA1 3VBFC 2XBO1 3VBHC 2BUKA 5BNOB 1RUJ2
chains in the Genus database with same CATH superfamily
3QACA 4F8AA 4MGYE 2DVAA 4CCDA 1TME1 3O0VA 3R0RA 4WVZA 1WMDA 3SQOA 2JENA 2XG3A 4URAA 4QDRA 1UO9A 4YW2A 2AEZA 5IWFA 1DIWA 1C8M3 1JYCA 1PVC3 3F2ZA 2PLV3 3OD0A 4XUPA 4NHYA 5FZHA 5HXVA 5CISA 4NIHA 1ST8A 3I2GA 4HPKA 4CDXA 2FDFA 1VBE1 3UGHA 4Q1RA 3GNEA 3MBWA 1U0AA 1JYVA 3V0BB 3PVBB 3L2HA 1LENA 4ZU5A 2FDIA 1NE4A 1JOPA 1ZZ9A 2GC1A 1YFYA 4WVMB 5KR7A 2B45X 2PTMA 1BCXA 2Q1ZB 4AFMA 4IEXA 3UKTA 4YW6A 3APBA 5GZDA 3PUQA 3WUDA 4UYBA 2NLRA 2G9GA 3B01A 5I8TA 2K9ZA 1CJDA 3WW2A 1K12A 1UY1A 1N3PA 1VBA1 2YY1A 1RYYA 4EN8B 5FZDA 3PJYA 1W8HA 2DCZA 2ZZJA 4DUWA 4NWVA 1OA3A 3FHQA 2RS12 3VLBB 1QJZA 5C3SA 4E4ZA 2Z2SB 1AVBA 5FYMA 1RUC1 4AF9A 3P3NA 4DEVA 4RFT0 1MR5A 1KEXA 2VGDA 5FP9A 5ACA2 5FMCA 5IVJA 1W2NA 2VVEA 3A7QA 4NOTA 1DF0A 1UWWA 2ZGNA 3BTYA 1C1FA 3ZSLA 3KLSA 2XBO2 3L2YA 1YNAA 4LO8A 2JE8A 3PVOA 1R082 3WDXA 1QJY1 3NKTA 2ZMKA 2AACA 2PN5A 5FRAA 3AZZA 5EV7A 4UFIA 2E53A 5FPXA 3RGBA 4LKFA 4NHKA 3OUIA 2GC0A 5KHIA 4OLLA 2BJSA 5CEHA 3I2OA 3PNAA 2Q1FA 4Q4Y3 4RYDA 1MEC2 2W5FA 3K51A 3GZAA 2GMEA 2GZWA 3VHOA 4FPEA 1MQTB 2R063 4LKSA 3SCGA 3ROUA 5K7PA 4OI0A 4GZ9A 4DOUA 4P9XA 4Q8LA 4PBPA 5FK7A 4Q0QA 2I74A 2W0XA 1DGLA 3EQEA 3HAGA 1UMHA 3RYRA 2XLAA 1B35C 5FZ4A 5FZ8A 4A4AA 4OMDA 3D5OA 2WNUB 5I93A 1F4AA 1NCRC 4MGSA 4OHXA 1O7FA 5EFUA 1IQAA 1IZ3A 1PM4A 3MPPG 2PHFA 3E5UA 3NWKA 1MS1A 4IERA 2VU9A 4MYEA 3V64A 1HV1A 1V6KA 2EALA 5A70A 1EV12 1RUG1 1XNKA 1F31A 1R1A2 1YRZA 3WP6A 1V6MA 1MZEA 1EY2A 4BH9A 5JXGA 5DDJ3 5FOJB 1OKQA 1DHKB 1H9PA 1H8TB 2VW2A 4R8HA 5FZKA 3OGVA 2RMU2 1NA1B 4IV3B 4O9EA 2GH2A 2ZGKA 4CCKA 1IS3A 2CAVA 4AVCA 3ZXGA 1UNBA 1UOGA 4DY5A 2YGLA 5E8AA 1X9TA 4MO3M 1JBCA 2XL9A 4WVWA 5FZEA 5AFEA 1O6UA 3AP6A 2XGXA 4EE2A 2DCJA 4LMFA 3A22A 3OYWB 2OIIA 4ZU7A 5HBAA 1AX1A 1B35A 3HNYM 3ACFA 5F5AA 1OHFA 2NM1A 1TME3 4XBQA 5BNNB 1NCRA 2C9KA 1JZ3A 4HK9A 1AYM2 1D0HA 1HRV1 2RS32 1DQ0A 4TYSA 1DZTA 1YXWA 4XF4A 3ZR6A 1VBE3 2W9XA 5I0TA 5CZKA 3ZO0B 3LIGA 2VM9A 4N90A 4HETA 3KVAA 3T0BA 2ZBJA 4WBBA 1XXNA 5K0UB 2QQOA 1C8NA 3Q8AA 2IXKA 1X50A 1K45A 1XSRA 3AXEA 3S57A 4Q4W1 2EA7A 1CAUB 5A7WB 5FPVA 1RUF2 3ZYIB 1HN1A 4CZSA 5SV8A 1QOSA 4D3WA 2QQLA 1GOGA 1COV3 1AUYA 1VBA3 2JDYA 1MACA 1E5HA 1MZ5A 1R091 4I09A 5E16A 4BM8A 4D94A 2BWCA 5LZ6A 4LOSA 4MH0E 1OQDA 2WAOA 2P5BA 4LNVA 4R9DA 4RHV1 4Y1ZA 3SLIA 2C6SA 1RUC3 2VUDA 2HWB2 3T2PA 5T5OA 1DQ1A 4WM8C 4YWAA 1DCSA 1BKZA 2Z4FA 2O8OA 2YC4A 3VBOC 3U1XA 3TAYA 5A3NA 5BUVA 5FY1A 1YJKA 3ILFA 4X6QB 5DAWA 4BQ3A 3OCPA 5FQ0B 5EXOA 1U5YA 4YGBA 1O4YA 4IGOA 2YBPA 4COWA 4Y1UA 5F7UA 3RZGA 1XE7A 2EF6A 4ARYA 1QJY3 5CNAA 4W6YA 4E2SA 1PGL1 1RUD2 2PELA 5EP9A 3M4FA 1YQ2A 2WN3A 1GMMA 2E7AA 2J22A 4AW7A 3CEWA 1VPHA 2IXJA 1Y9QA 1WMEA 3BGAA 4NPLA 4XZPA 5HCFA 4AVTA 5JAXA 2GNBA 5GLWA 1QMJA 3M3EA 3ES1A 1OLQA 1WCQA 4FFGA 3AP4A 3NAPB 2VMIA 1W9FA 2Y6GA 4S2HA 4XUTA 4YM2A 3SEEA 3T0DA 3RI8A 1OD3A 3KHCA 2BYVE 1U5XA 3BVCA 1WLDA 3BALA 4FQ4A 4TZDA 3E6CC 5IVYA 2WS91 4ZZ5A 1JUHA 4X8PA 4FPGA 3TEWA 4RD7A 4WM8A 2LUWA 3RG0A 2BGCA 4HZFA 4OHWA 3VBOA 1RB8G 4QQLA 3AYCA 1YI7A 3K75B 3R4SA 4HVOA 1GP4A 1W9TA 4MSVA 4N9HA 1CESA 1CPMA 1W8TA 3NO8A 4QQOA 5E89A 3V0AB 4CE8A 1RUG3 2ARXA 4KMQA 4N53B 4ES9A 2E26A 2QQPA 2PQSA 1L7LA 4JDMA 4BQ2A 3BCWA 2WWSA 5FREA 5FMOS 1CJPA 3NV3A 3IMNA 4L0PA 5DG1A 3VL9A 4AGRA 4LBLA 5LK5A 4LHNA 5KC5A 4PLMA 1RUH2 4SBVA 2RS52 2PAKA 3AJYA 2B7YA 1XYOA 1YLLA 2ZGLA 1QKQA 3ASIA 4FPLA 4I30A 4L8QA 5ANNA 3T1LA 5C9AC 2P6HA 3ZSMA 5ABJC 3H3UA 4BQXA 5FP4A 4FPJA 1HB3A 5FY9A 1I6XA 2ZTNA 1YI9A 2A3XA 2Y0IA 4QHBA 5H9PA 3ZXKA 5LCWL 3I3MA 3VV1A 1D4M2 3TEZA 1W2AX 2VNVA 5DZGA 4AE2A 5AC92 3IIIA 3LAGA 3ZXJA 1HRV3 5J1XA 3OGJA 3T2QA 1YWKA 5LB6A 2CAUA 2Z5WA 3HEIA 2V73A 5JVVA 4NIIA 1JZ4A 1SDWA 3ACHA 4L92A 3NV1A 4ISQA 4BQWA 5L7OB 4CXYA 4J1WA 2VE1A 4JTOA 5J3UA 5CG8A 1DDLA 1SCRA 2BFUL 4HL0A 4Q4W3 3DGTA 1MZ6A 1C5IA 3VDAA 2Y38A 4MGQA 4DFSA 4K20A 3J7MA 4PDWC 4IEVA 4HVQA 3POIA 3NRUA 3WW1A 3BU0A 1AX2A 2VW1A 4FT8A 1R093 3OBTA 1H4HA 4QU1A 5D8AB 1J1LA 5C9AA 4BB3A 1WLWA 3DPRC 3UJQA 5LRSA 5ABJA 4KWKA 4G4FA 5H9RA 4CDUB 5F2SA 4RHV3 2ZX2A 2AREA 4EZ4A 4CRQA 2ZHNA 1HJFA 2B4KA 1CAVA 3PUAA 4JHTA 4YLZA 5KHGA 5TSWA 3HBZA 1ZYBA 4UFKA 2NP0A 1GQPA 3TOJA 4IV1C 4QXBA 3GJBA 1MZFA 2HBUA 4XFIA 1H0BA 1QQP2 4DS0A 1VAMA 3A4UA 2DBIA 3KWVA 3PU8A 2CNAA 2WA4A 3B9IA 4FOQA 1KGYA 4PLOA 3ZFEB 5HPOA 1YYNA 2WR9A 2WRAA 3KCCA 4Y1VA 1JOBA 5H9QA 1XNBA 4KWUA 4I2OA 5DQ0A 3WDVA 4W4ZA 1UOJA 4P9WA 4H3WA 3OSDA 3RMYA 2D5FA 1BK1A 4DMIA 3ZFGB 1VMHA 2F17A 2C5DA 2JB8A 3BN6A 4LJHA 1R081 4PDWA 4RS5C 4ZHNA 2DCYA 4FPFA 4LIUA 3VKFC 5CFCC 2YFZA 4XJ8A 2DU0A 3R6SA 3DPRA 2D3PA 5GLVA 2CWMA 3AFKA 1V9U2 2WS93 5DG2A 4AFAA 2HEYF 5JR7B 4QXHA 5FP8A 1OA2A 3T2OA 1S0FA 4OI2A 1QDCA 3BPSA 3C7FA 4CEWB 4QAWA 3LDKA 4XAEA 2YDEA 4IEPA 4JQRA 4IV1A 4M0NA 2B42B 1WMXA 4YW7A 2WFF2 3NVCA 3I4IA 4QDSA 4UF0A 1IOAA 1OPOA 5F1RA 3SISA 4B4RA 4Q0UA 1ZVFA 4Y5Z0 4D0QA 4XABA 5AFBA 3W5NA 1NT0A 1QY4A 1RC6A 3KF5A 5IFPA 4NRMA 2XJPA 3KVBA 1V6JA 2J7MA 1EPWA 2RM22 3CIHA 1H9WA 2JE7A 3ZFFB 5IATA 4PHZA 3NL1A 1SCSA 1ACCA 3LEMA 4IGQA 1NOVA 3FUQA 4AFCA 1YQ8A 4RS5A 1DG6A 2PMWB 4M4RA 3LPGA 1F2NA 4KQ7A 3HQXA 3PIJA 4GWIA 3RSJA 5CFCA 4YVSB 2NPIA 3H9AA 2VUAA 2HWF1 4K9SA 5C3PA 3VBHB 1DQ6A 4CDWB 1GWMA 1PIV2 2X05A 2VOTA 2JD9A 2Z42A 1IHMA 2WA3A 2WZEA 3N9LA 3POWA 1V6OA 4LEJA 1ALYA 5GZFA 2BWAA 2ES3A 1STMA 4XACA 1UU6A 5FO8B 1JYTA 1VBC2 2BRTA 2CYFA 4QQHA 3M1HA 4BCUA 1NAEA 3BUCA 4MVTA 5C5TA 4JDNA 4NN0A 2D43A 3VUOA 3MICA 3H50A 5L9RA 1NQJA 3B00A 1IPSA 3CZUA 3WV6A 4K6BA 2HJIA 4META 5I91A 2NYYA 1BVVA 2NZ9A 3LA3A 4IEWA 5EZWA 1AYM1 2W68A 3I2FA 1ZRDA 1UKRA 4IEYA 4B7KA 3CF6E 4XF9A 5A3OA 3BYWA 5FR3A 2F4PA 4BZ4A 1EP0A 3N9PA 4QPIC 1O3SA 1Y3TA 1XBFA 3AK0A 3CJIC 4R9BA 4EJRA 3LEIA 1A8DA 3VZMA 3KT4A 5LY1A 2JKXA 5KXEA 1SPPB 2RR12 2WLPA 4YZ1A 1IQDC 1IS4A 2O1QA 4AI0A 1EPZA 1GP5A 3M3QA 4DINB 1AYN2 4C0HA 1RUJ1 2YB7A 2RE9A 3SHRA 1APNA 1QXJA 1RUF1 4HMZA 5F3IA 4BQ1A 1LR5A 4P9IA 4GWJA 3K4AA 4Q4X1 1SMVA 2DYCA 2ZGTA 4EWEA 3GYDA 1SLTA 4P00B 1AR71 4LO5B 2Y34A 1U5ZA 3WF4A 5LATA 3ITQA 4NPRA 3VBSB 1RXGA 1CAWB 4CUGA 5F6KA 2AEYA 2JECA 3LCPA 3UT0A 5J37A 4UBGA 3I7DA 4MOAA 3VDCA 3LGRA 1F4HA 1YFXA 1IKQA 2VZRA 3I54A 3WQ1A 3J7HA 2BZDA 4HFSA 3H8OA 4OZOA 3NJZA 5JCTA 2WLQA 1GR3A 4KH9A 1LHOA 1O8PA 4FPCA 1ND3B 2GNTA 1R083 1JZ7A 1W6PB 4QPIA 3H3LA 4JX0A 2HLEA 3CJIA 4I02A 5GJ6A 1DBNA 2Q1MA 4ZZ8A 1QJEA 3OJBA 1DYKA 1W8WA 2BTVC 5J7MA 3RZJA 2PAMA 3TN92 4CDQB 2WO2A 1GKBA 1N1TA 1JOJA 3FHIB 4YGEA 1ZRCA 1CZSA 4Q0VA 1W6NB 4IESA 1KQRA 1HQWA 4XAAA 3BOWA 2J1VA 5A7QA 4QX3A 4S2DA 2W94A 3WEZA 2VTXJ 2X5IC 2QJVA 4I0AA 5ERLA 2WFPA 5FK8A 4FFFA 2BUKA 2D98A 2P3JA 4I3PA 3FE5A 5FPAA 2VAUA 3KS7A 5T5JA 4XFFA 3THPA 4CCNA 1SBFA 2J1SA 2G4IA 3IZOA 2VXRA 5EJ1B 4K40A 5JSPA 5M0TA 2N7GA 1GQHA 4Y1YA 5JOXA 1C4RA 3V0BA 4SLIA 4UW3A 1AL0G 2WKKA 5IVCA 5FPBA 1N1SA 2WZR2 4WVMA 4Y20B 4YG6A 3UETA 1FPN1 1YHFA 3LDRA 4LTAA 3K2OA 1OUXA 2KXLA 2XVGA 4PCRA 5FLHA 3SCHA 1XE8A 4HT1T 2WAAA 1RUE2 2JICA 3IMMA 1V6NA 3N7LA 2OUJA 3O12A 3LOIA 4HOOA 4WVVA 1ODNA 4LK7A 3ORJA 1MQTC 2HWF3 1POV0 2VO5A 1UMZA 2RDQA 3F95A 1PO21 1D2SA 4ITCA 5JXIA 3Q8EA 1WKYA 4JVAA 4LXLA 4ORFA 2YBSA 4CP0A 3O0WA 1E5IA 2QBXA 4FP3A 5LEJA 4AAXA 1YQ6A 4FO9A 5DMYA 1TE1B 2RJKA 2R043 1RGSA 1HXS2 2WNUC 3HWJA 3AKPA 3J4UH 3NNJA 2D6NA 1VMFA 2X5IA 3KV5A 3BI3A 3H3ZA 4LR4A 3QOPA 1JHJA 4E4DX 3I2IA 1JTZX 2L9LA 5FOBB 3AMMA 1CX4A 3OUHA 3WNKA 3E97A 1LODA 3VBFB 4NIGA 5FZ9A 5FY4A 1AYM3 5LBCA 3I2JA 4I0WB 1SLIA 1IS5A 1QHDA 4H7LA 2DVGA 4KWJA 1ZBA2 3MF9A 1CD3G 3C7EA 2ORXA 4O61A 4UFMA 3RJRA 2CU5A 4QXCA 4YARA 1VP6A 2J1AA 4LHSA 4WM7B 5FZMA 4M0HA 1SZBA 3S7IA 1RUJ3 3S30A 1MQTA 3RNSA 3CU7A 3KM5A 1RUF3 1VALA 5JDBA 1JODA 1TMF1 2W1UA 2JJ6A 3LSDA 3USSA 1GNHA 1QF3A 2AUYA 4P5HA 2DUOA 3WNNA 2P6CA 4Q4X3 5KHKA 4D7SA 1AR73 1X8MA 2WNUA 5BNNC 1VBD3 3FLPA 1W03A 5FZOB 1BXHA 4QGMA 3N35A 1HQNA 2CHHA 4XFCA 3T1MA 4FFIA 4MXVA 3UYJA 4C8DA 2GNMA 1UU5A 1JZ2A 1SFYA 2D97A 2VOWA 1XQNA 1OF3A 5J96B 1W06A 1DP0A 2KD7A 5I0SA 1CN1A 2VOVA 2WNVB 3POBA 4MLOA 4MX3A 4YFWA 5FZ0A 1TNRA 5FJHA 2VZVA 4OCTA 4AR2A 2B5HA 3J7NA 4HG6B 2TBVA 2W87A 2W95A 2AYHA 5IK8A 1WW5A 4RR3B 5GM0A 5C7GA 3VHRA 3HR9A 4ZPIA 3BIEA 3USUA 3RZHA 5HCAA 2TNFA 4BDVB 2JDKA 1NY72 1RJ7A 2GN7A 4FPKA 4LHLA 1A34A 3G6JB 3P6BA 2BBAA 2D7FA 1VLNA 4PJYA 3UJOA 3OYWA 1QIQA 4LBNA 3VD7A 2UU8A 5C8WA 5IK4A 3SXWA 4GQ7A 4QQPA 3MW2A 5BNNA 1NXD1 1V9U1 3ZPOA 3JBG1 4YW4A 2VULA 5LY2A 2VW0A 2DU1A 1ENXA 3UESA 5L9VA 4OI4A 3PUIA 5IFTA 1WMFA 4IE7A 5I0DA 1AR92 2YZ4A 3O1OA 4QGLA 4DO0A 2QQWA 3LIHA 4AQ6A 2GSYA 1GICA 2Y33A 3W59A 2V72A 2WFF1 1FPN3 1HDKA 1SLBA 1UYPA 2VTFA 2K0GA 2EIDA 1CAUA 5A7WA 1VRBA 1SHWB 5C3OA 2XQXA 1QJU1 3VD5A 4EV0A 5FZ7A 3NV4A 4Z1VA 5GZGA 4FOVA 3I59B 1PO23 3NAPC 4FXGB 4HANA 3A0KA 3ZN6B 4CU9A 1LAJA 3I3QA 3RZZA 1ONAA 5JIUA 4BU2A 2QTWB 4DNYA 1DZRA 2VZSA 3OOXA 1H4GA 3U37A 4IEQA 4JCKA 3VD4A 4NR1A 2ZABA 1BMV2 1MS0A 4XFHA 1I5ZA 2UYBA 4CEYB 5FY7A 4NIDA 1F35A 2ZMLA 2F4LA 2TUNA 2VQUA 3PHMA 3N9NA 1GNYA 3NKGA 1AR62 4D7TA 4KG8A 1YUDA 3IPVB 4XDQA 4KI5M 2OX0A 1V6IA 4LO4B 1ZZ8A 4N53C 3CKHA 2R32A 4XVHA 1WBLA 1SEFA 4A7YA 1XOYA 2JD4A 2RJ2A 4A45A 4V1PA 5ANQA 1W3VA 3OB8A 1PNGA 3ACGA 5FO7B 1T2XA 2QQMA 1G9AA 2XJVA 2G19A 5EJZB 2VZTA 2LROA 5I0UA 4B8EA 4CUAA 2ZEXA 2VQ0A 4QHOA 3AZWA 2Y6HA 4DIQA 2A71A 2XB6C 3E5XA 3KV9A 3VZLA 2DTWA 3NAPA 1YEWA 4QKNA 1TMF3 3MLJA 4V2WA 3ZPYA 1K3IA 2W91A 4K7JA 3RWKX 3POSA 4AI9A 1UYXA 1W6MB 2BU9A 1FX5A 1LGCA 4CXWA 1TQ5A 2A75A 3SITA 1N3OA 4XDPA 4ZXKA 1UW8A 4OHYA 3ATGA 3NNMA 1R64A 3V0AA 5JIAA 3TYJA 3O1VA 1U5IA 1HIXA 1REFA 3Q8FA 4N53A 5CFDB 5L7OC 1OLME 2Y6JA 4ZXEA 2D93A 3H7JA 3B69A 2DFCA 1LKNA 2BVVA 4COUA 3VKLA 1NCQB 2QQUA 2ZX1A 4UW6A 5DN2A 2YPJA 3ALQA 2X10A 3CHXA 5FUIA 4CU6A 2QQIA 1W6QB 2GMPA 2Y64A 3FFZA 4MGKE 2ZX0A 4AHZA 3GHNA 5A7OA 4TLGA 1WW7A 2GMMA 3E5QA 4XC9A 3R4UA 1US3A 5A7PA 1OURA 4LO6B 3KGZA 4YW5A 1ENRA 4Y5TA 2HWE1 5D8AC 4AL9A 4UI9L 1MS8A 1VB2A 4Y1XA 4EROA 1ZRFA 4HVRA 3CO2A 4JGZB 2XUMA 3WR0A 1GSLA 3C8XA 3TNPB 4ISRA 4CUCA 1DGWX 5FZBA 5GZCA 2IZWA 2R072 1O4TA 4XDOA 1W0PA 2P3KA 3CMGA 5KXDA 2MHFA 3JBG3 1RVF2 2Q8OA 5IJRA 1BK0A 3EHKA 2DF7A 2JIGA 3AVRA 2PFWA 3ZYRA 2VMGA 1UXZA 3AKTA 5FLIA 3GZEA 1AL21 5L9BA 3HQRA 1XB9A 5L7OA 4B7EA 2EIBA 5DUUA 1Q5OA 4FOYA 3EYPA 3VBUB 1EAH1 4JC1A 5SV5A 4AHWA 4DUVA 5B2GB 2WFF3 2XJSA 4XJWA 1WZXA 3KGLA 2VL4A 5CG9A 3K4DA 3PVEA 1QJU3 4MADA 3ZFGC 1XNTA 3SH3A 3HOBA 3B94A 4Q4V2 2VZ3A 1I9RA 2HWD2 2JDZA 1UN1A 2IXHA 3FBMA 4KL1A 4QPGB 5FYTA 3T30A 2C1FA 4K8RB 2PQQA 3DXUA 2LRPA 5D8AA 3BTXA 3KCYA 3RWNA 2VNGA 4B3NA 3L9JT 1CIYA 1D7PM 5T5PA 1J83A 4LULA 1S0EA 3T4HB 1ZRRA 2ZAHA 4NUBA 4AHXA 1BBT1 4H2AA 1GOHA 2WO3A 2P2KA 4CEWC 2J1EA 1LHNA 4QX7A 1OSGA 3KD4A 3O7OA 2YPDA 3THCA 3WF0A 4QB2A 1H2NA 1LHWA 1GZ9A 3D82A 1UL9A 3CJXA 4UOJA 1W2OA 2QZ2A 4PF1A 2JG8B 1NLRA 1LHVA 2YHJA 3M70A 4AWDA 3VHPA 2PHUA 4CCMA 3O5SA 2PXJA 3RFRA 1PMJX 5DZFA 4LBMA 1FOD1 2Q8CA 2ZGUA 3RI9A 5JI9A 4J25A 4XBLA 1WCSA 2J1TA 5GLUA 2CWSA 3JB8A 1LULA 3ZFGA 3WX5A 5A32B 2QUOA 5T54A 2ARCA 3H1WA 1QNWA 2KR2A 5BYNA 3ZYHA 2Y6LA 1KDMA 4ES8A 3S6PA 2YV8A 2FDHA 4XETA 4YVSC 2HWC2 3KT1A 4NRQA 3FBYA 1NXMA 5F3GA 4CDWC 1H6XA 2XPJA 1OQ1A 4LBKA 1IG3A 1FMD1 4LBQB 5T3NA 5K9YA 3Q8CA 1OXCA 1ULPA 4P9YA 4A7ZA 3N3HA 5C4WB 4XXAA 3MIHA 3FL7A 2PHXA 3G7DA 1SBDA 2I07B 2MNGA 5GZEA 4C1WA 3RJ2X 3WNOA 1VAVA 3HD8B 5IAVA 4CEWA 2MEV2 1H1MA 4YG3A 4COYA 2DVFA 4G9SB 2H0VA 1POQA 2VMHA 3HN3A 1ZREA 3K4ZA 1PO11 1JI6A 1K5MC 2R30A 3QCWA 4XJAA 1AF9A 3AL5A 4CDXB 3NQHA 1RMU1 1QXPA 4AG4A 4LPLA 3OPZA 2PHDA 2VUJA 1L7RA 4HLTA 2V4VA 3BPZA 2Q5TA 4LBJA 4Q1PA 2E9QA 1VBB2 3VZOA 1Q56A 1Q8VA 3WDWA 2G9ZA 1D4VB 1ASJ2 3P3PA 3U0ZA 3H42B 1TNFA 2HWE3 1SDDB 1PGW2 3M8LA 3MF6A 2EXKA 2W3JA 3ZYGA 1RHI2 4UWDA 4YVSA 1WA6X 4YZ3A 2QQNA 2CV6A 4CDWA 2W46A 1WCKA 4IETA 4BISA 4BMBA 2G9FA 3GHMA 4F83A 1XC6A 2VG9A 2QDRA 1W9SA 4JKLA 4S2FA 1WLCA 4BIOA 1V0AA 4JV4A 3ZXFA 3J8F2 3HNMA 2XLFA 4M3CA 1LOFC 4A3XA 3VB9A 2JB4A 4XTPA 1AL23 4RA0A 1RUI2 1QJX2 4NHMA 1K5MA 4O7XA 4HONA 5J48A 3WP3A 1EAH3 3GDBA 4CCJA 4EQVA 4PQQA 4C0BA 2HYXA 5F9TA 5FP7A 5DAXA 4EWDA 3K3NA 5IT6A 4QB1A 2Q30A 1ND3C 2F6BA 5BNPC 3GJAA 5HV4A 4BA6A 4DPNA 3D0JA 1AXYA 1AR91 1JS9A 1SPPA 4FPOB 3WF2A 2YROA 3DCQA 5JI7A 5HXMA 2JDPA 1GWKA 2JG9C 3ZYJB 1L7QA 4IE6A 1BYHA 2JDNA 2EICA 5JMCA 4ASKA 1IPJA 5FY0A 2ZX3A 1W2TA 2QQJA 1BBT3 3IWZA 2DV9A 3MO4A 3NMBA 3WF3A 1BHGA 1C8M2 3QBQA 1PVC2 4KWLA 2PLV2 4E9KA 1Y4WA 1UIKA 4OQ8A 3POYA 2DVDA 1LOFA 3LE0A 2A3YA 3I3EA 2VVFA 3ST7A 4LT5A 2FHRA 2JWPA 3O1UA 1H2KA 4CP1A 2FCVA 1BMV1 4AI3A 1FOD3 4XF1A 4Y22B 3DKQA 3WHUA 3LQCA 4NIAA 4CUBA 2OYZA 4HXCA 2A73B 4Y33A 3I3DA 1ND3A 5BNPA 2OQ7A 1W6PA 4Q29A 4GJYA 2UY8A 1BEV2 1KS4A 1OVPA 2E51A 2C26A 2P17A 4NMIA 5CU1A 5LBEA 1O5UA 2ARBA 2C0ZA 1FT9A 3DECA 2Q0AA 4FOWA 3W20A 4B4PA 4XOGA 1CGPA 3D0SA 2D6LX 4DRVA 4JAAA 3ZX7A 1PK6B 4XIOA 1DYPA 1FMD3 1S0JA 2JG9A 3C7HA 4C90A 2RHPA 4DZGA 4GWMA 4ZS3A 1HB1A 2PHRA 2RS11 3WDTA 1W6NA 3GM8A 4GH4B 4ATEA 1PZ8A 1GANA 5FUPA 1UF2C 1JYIA 4AVAA 1ND2C 3MYXA 3FLRA 2XWBB 5ACA1 3N7JA 2D6MA 3WNPA 4JKKA 4AEKA 1JZ6A 3BOPA 1PO13 1RINA 2BDRA 4BK5A 4CCCA 2ARAA 2ZA9A 2IXCA 2XQRA 3POJA 3AX4A 3ECQA 4N43B 4AFDA 3ZVXA 1RMU3 3ABZA 3BTAA 3VBFC 2XBO1 1CR7A 2OQ6A 3WSOA 3WINE 3WNLA 2WBKA 2BVBA 4JRAA 3UKNA 3EXUA 1E5RA 4Q4Y2 3AMPA 3MDPA 2VPVA 3A21A 3GBFA 3OY8B 5T5LA 2R062 4Y20A 3UL2A 1M06G 2RG4A 2XLGA 1URXA 3FFQA 3IDCB 1UPIA 1MEC1 5FYUA 5FZIA 1GLHA 1T6BX 4LBOA 4ZS2A 1SLCA 1XU1A 4QGNA 5A6XA 4FXKB 5B4XA 1XE0A 4GMP1 1JHNA 1ULDA 4XTMA 3DXTA 4GIQA 4B29A 1G86A 1O4ZA 1W90A 3KHBA 4XUQA 1ND2A 4W6WA 1BQPA 5CKNA 1GBGA 1LNSA 1ZZCA 3AJZA 3KV4A 5JXHA 4Y4RA 1VE0A 2AENA 4GB32 5GLZA 1CONA 1AJKA 5DDJ2 1EV11 1NLSA 4Y24A 1H2LA 1R1A1 2D40A 3U11A 3VBFA 4TTGA 4BXFA 2VNOA 2BQPA 1FV3A 4BQ5A 2WNVC 5FFOC 4XPVA 4IGPA 3JQWA 3ZXAC 1Q43A 4QKDA 5KC6A 3ENRA 3ZDVA 3EO6A 4UW4A 1UOBA 4PI0A 4QX8A 2RMU1 1AR93 2VBBA 4XQ4A 1FXZA 1UAIA 4HKOA 4LITA 1OBNA 1KFXL 1HB2A 3R05A 4PQ9A 3S5AA 1GZWB 2AC1A 2HEVF 2W1QA 3EMRA 2WABA 4W65A 2JDUA 3ZM8A 5C3RA 3KCXA 1J3PA 4IE4A 4QMAA 1GZTA 1QOTA 1QXRA 1TME2 2WWJA 2YC0A 3B3QE 1KS5A 2B39A 4CVUA 4D6SA 3PUSA 2HWD1 3WQ0A 2ADDA 1YJLA 1X36A 1IKPA 2WNOA 1X9PA 4AEDB 5A3UA 2CL2A 5IYYA 2E6VA 3VBOB 4QM8A 5LW9A 1O3QA 1VBE2 4O65A 5FZOA 2XJUA 3RPQA 2RS31 2JDHA 2IFRA 5IVBA 4PIYA 2D3RA 1XNDA 2FMDA 4XHBA 2C24A 3DEMA 4QX0A 2P4EA 3IM0A 4LBQD 1KDKA 1J58A 3VL8A 2UWAA 2WNVA 5IUQA 3CZJA 4YVWB 1LEDA 3P1IA 1COV2 1VBA2 4LA2A 3S7EA 2E31A 3WLUA 2BGOA 2WL1A 1EYBA 2XVKA 2R6QA 2D44A 2RDNA 3VDDB 2VVDA 4YM0A 1UX6A 3N7KA 4I01A 3A0NA 4AGVA 3CNAA 1RUC2 5LA2A 5DUVA 4BK4A 1NQDA 5C6CA 1GFF2 3LOBA 4TN7A 2RS13 3ZKYA 3O1SA 3W5MA 4RQPB 2ZMNA 1UU4A 1JH5A 3FJSA 3C3VA 2HWB1 4WZFA 3KQ4B 1MVEA 2AGSA 5ACA3 2I2SA 5A3MA 2EIGA 5G05L 2IXIA 3VN4A 4CEYC 3VGIA 4DB5A 1WUVA 3VHNA 4ET7A 4XJ9A 2XBO3 4O9GA 4OUEA 5EIYB 4NRPA 1NE6A 1S0GA 1PX4A 1RUD1 3WVJA 1LESA 4JTNA 2VZQA 5IAXA 4XMIA 1UOFA 3KSCA 1S0DA 2XKPA 5A33B 2ERFA 1MEC3 1QNYA 5FZ1A 2NQYA 3AFGA 3JB4C 3DN7A 4YM3A 3DKWA 3LF7A 4XCBA 2VCBA 5EPAA 1OF4A 1VJ2A 4HSLA 1VMJA 1JMUB 3T3YA 3VD9A 3ZN6A 1W05A 4Q0PA 4GMP3 5LA1A 1RXFA 2HKXA 2EIEA 3ZSJA 1J1TA 5DAPA 5FIXA 5FYYA 3MW4A 5FZFA 1DLLA 5LA9A 4WV8A 1RUG2 1A6CA 3WHTA 1ZBE2 3PMSA 4CEYA 4CSWA 2XR4A 4GWNA 5BXXA 1EV13 2EXIA 1R1A3 2ET7A 3IPVA 4XBNA 2MPFA 4BLJA 5CFDC 5FWJA 2QCSB 3H8UA 5FLJA 5KXBA 5HCHA 1LEMA 4XFBA 2RDRA 2VC9A 2WO1A 4CP9B 1NCQC 1F5JA 2WSUA 2P1BA 5J36A 2BNOA 2EAKA 4QXKA 2RMU3 1RUH1 2NN8A 3RYKA 1G6NA 1H30A 1O8SA 5F39A 1SFPA 4GMP0 2H0BA 1V6LA 2RS51 4CA9A 1F15A 3JCIA 1C57A 2WT0A 5DUXA 3KMHA 3AP5A 4UW5A 5FPLA 4X6RB 3MFCA 4GJZA 4H14A 3DPRB 4FPHA 4JGZC 1L3JA 2HWD3 1UXXX 4BXSV 5FTTC 1HRV2 1W6MA 4A6SA 1D4M1 1LU1A 4E4SA 4RSUA 2G1MA 5CYYA 2BGPA 1K5JA 3WCSA 2IUWA 3WG2A 4XIKA 2OZJA 5A7NA 4P9JA 5AC91 4CCLA 4F7ZA 5IHRA 3ZXEA 2RS33 3NJYA 2W2IA 3IDEA 3M2MA 3PVNA 4HSJA 1LJ7A 1Y7BA 4NWWA 5D21A 5LRRA 3VZNA 5BV6A 2O0OA 2VBDA 3VBRB 3U10A 3I8TA 1H8TC 4LOTA 2Q8DA 5CFDA 1NA1C 2P3YA 4IV3C 2JDMA 3WG4A 4D69A 4KU8A 1NCQA 4M01A 2O8QA 1R092 1G8WA 2YG0A 5JR2A 2VCCA 2WN2A 3B93A 1U12A 2DBNA 1JXNA 1HKDA 3AMNA 4RHV2 4QPGC 3NW4A 4Z8BA 3OGRA 2OS2A 4UFJA 3WG1A 5L19A 1GNZA 3KQRA 1HRI2 1QH7A 1AR82 1IS6A 2HWB3 4JGZA 1UZVA 5CB7A 1BEV1 3OG2A 1DGRN 4W50A 4P5YA 3VKNA 2JX9A 5H9SA 3WW4A 1XYNA 4CU8A 1PGSA 2GP3A 1KD7A 1QH6A 3FMGA 3GCWA 2UYAA 3NNGA 3MGUA 4JZRA 4JKMA 1PGL2 4YSFA 5K0UC 4RGGA 3LFMA 2A6VA 2YFUA 2E63A 1DGRA 2XDVA 3AZXA 1QQP1 1YQ5A 3E6DA 3PDQA 3PIGA 3HT1A 1RITA 2WQ4A 2XONA 4I0BA 2ETEA 1DGWA 1RUD3 1OVSA 2BFUS 3EJKA 2JG8C 1H8TA 3MIDA 5FMOL 4JGYB 2VOKA 2X53S 3JD72 1NA1A 4UT5A 4IV3A 1H2MA 3INAA 3AZYA 3MHZA 4IW3A 2OZ6A 2DWRA 2LM3A 4CXXA 4R4ZA 1TZOA 1SQ4A 3PTYA 2FDGA 1ULFA 2JXAA 1D2QA 1W8UA 2CSGA 2JE9A 4F3JA 3PTRB 1ULCA 2QDNA 3ETQA 1W8ZA 4LE3A 4MHUA 4QPGA 2WS92 5FXZA 1X8EA 4BJ0A 3C2UA 4FP2A 5DAQA 1FYUA 3B5LB 3FC0A 5FZGA 4HN0A 2V5DA 3C7GA 3JZVA 1JYXA 2ADEA 2BV4A 2ZS6B 1XPWA 1UZZA 3HJRA 3JQXA 1GU3A 5G04L 5C4WC 2BW8A 1J3RA 5JZGB 2VZOA 3TEXA 4IDZA 1J59A 4PLNA 2WINB 4WZCA 4XE9A 2XJRA 2ZHKA 3N36A 4W8JA 1OMIA 4QX2A 1Z0HA 5GKAC 4A42A 3FZ3A 2VD7A 3DF0A 4BPZA 2FD8A 5K0UA 3H7YA 2A6ZA 5FYVA 4YPJA 3THDA 5C8CB 2V09A 4FTBA 1UZYA 2YYOA 2ZCWA 3OBAA 4YM1A 4OZXA 2JG8A 2R16A 2W92A 1JUIA 3CL1A 3MIEA 3OD4A 4AXOA 1MS9A 5F37A 2W47A 1XNAA 4X8NA 2RM21 3KZ4C 3HPNA 2DFBA 4GB31 3T4VA 1RUH3 4AI1A 2BBVA 2XWJB 1HQLA 1FATA 1GP6A 4BMEA 4UXAA 2RS53 2VXJA 1V00A 3HN1A 3PLQA 1HX6A 2VBPA 4QPIB 4KGQA 4XILA 2DUPA 4CTEA 5JUVA 5F5CA 3TNQA 4MGIE 1PIV1 3AKRA 1YFWA 4LBQA 3S0MA 2LALA 1D4M3 3POFA 4YFZA 5FJKA 4KBZA 3PUHA 5CAZA 5CBLA 4ARXA 5FQ0A 1YIFA 1TEIA 3ZSKA 5C4WA 5AC93 4OVEA 2W52A 4OFGA 5B4NA 4EWAA 1PX3A 4BQ4A 1VBC1 1LGBA 4NHLA 2XHNA 2YXSA 3LDBA 4LA3A 4CP2A 4Y3OA 1LRHA 1PVXA 4P08A 4AYUA 3MIGA 2TEPA 2A7AA 4RGAA 2PHTA 5C5UA 4BOWA 3N9MA 2WWUA 4ONUA 3NV2A 5DUWA 5FO9B 1LGNA 4IE0A 4Y26A 4XF0A 1LTEA 1OQEA 2VQTA 4YYOA 5F3CA 2XH6A 2J1UA 2QQKA 2RR11 2Y6KA 5L73A 2VTXA 1NYWA 1W8FA 4GKXA 4A2UA 2XJQA 2DVBA 3GCXA 4XF3A 2WSVA 1AYN1 2Q4SA 4GAZA 1COV1 4DQAA 3H1MA 4BHPA 1BEV3 2SBAA 4QKFA 2YU2A 3UV9A 4K21A 5FY8A 1Q8SA 1LU2A 5FYCA 2J42A 4DEQA 1OFNA 3RZKA 4YRDA 1P8JA 5F2WA 4K3UA 4COVA 1C28A 3S5QA 1OC1A 4RGKA 2X5IB 1QQP3 2E32A 2GC2A 2GNDA 4OMCA 5F6LB 5FMBA 3RS6A 4BQYA 1HJGA 5JSOA 3WP4A 1JYWA 5LBBA 2HEWF 2K2SA 2ORZA 5LA0A 3O1MA 3IDAA 4M4PA 4DUXA 3OPTA 4AVVA 1WCDJ 3GZTB 5FPZA 2ZGQA 4EYUA 3M3CA 2BEOA 3U07A 1JZ5A 2BP6A 1Y9MA 4LLOA 2EXHA 3CLPA 3RZLA 2ZZQA 3ZYPA 1S2KA 1DLCA 4XZUG 4CDUC 1Y9GA 3H8RA 1WGPA 3N9QA 4IL7A 3VKOA 2ILMA 3MW3A 5CADA 2VCMA 5FAXA 4AHYA 4D6RA 1ZNPA 2H6BA 2WYFA 3TEYA 4Q26A 4RN5A 1PK6C 1PZ9A 4URTA 1V9U3 2WNEA 1ODMA 1UY3A 2OVUA 3AYAA 3TN91 4MXWB 4XFAA 2D6KA 2D6OX 3K3OA 2JEMA 5A7SA 3UKVA 5HCBA 3GGLA 5FZLA 3CBNA 3RRDA 2VY0A 3MLLA 3HQUA 4GH4C 1OOPB 5A1AA 4HKLA 5LBFA 3ZFEC 1FV2A 4JDOA 3QH6A 1IPKA 2Y26A 4MZUA 1IG0A 3ZIWA 3AYEA 1UD1A 2GN3A 3B02A 5FZCA 4AK3A 1LECA 4N8MA 5KWRA 1C5HA 1ZZBA 5FWEA 4DY3A 3PMEA 5A3LA 4N43C 2UWCA 1CAXB 1UY4A 5CKMA 4LE4A 4DXRA 3B7MA 3OGSA 1ZBE1 2ZGSA 5ISLA 3WDUA 2RM23 4EN9B 2GU9A 5BPXA 2DDUA 4GB33 3P5BA 4IXLA 4Y22A 5FZ6A 1CZTA 3SNMA 1ZX5A 1W2UA 2EVXA 1VRH2 2XHKA 3MIFA 2A5ZA 2ZJCA 1CIWA 2OPWA 2WZR1 2FMYA 2HWF2 1SBEA 1H8VA 2YBKA 3EBRA 4CDUA 4E2GA 2B46X 1RUE1 1XSQA 1Q8OA 5GLTA 2KM2A 2LTNA 4XCAA 1SG3A 4J6GA 1W6OB 3SKVA 3USUB 2Y8KA 5APAA 1PIV3 1PK6A 4EN7B 3OPWA 2R042 4M00A 4PI2A 2YC2A 4IE5A 1Q3EA 4G3YC 5DZEA 1J3QA 3FN9A 5FY5A 3U75A 3ZSEA 4AOCA 5D2AA 2AH2A 2WT1A 1N1YA 2H6CA 2SLIA 3ME2A 5EQUA 5JSRA 3MV11 2P37A 4GH4A 3IKWA 4QQ2A 5JXJA 1HXS1 3ZFEA 1VBC3 1M4WA 4UBHA 1W8OA 3VDBA 5CKQA 4FI9A 3ZFFC 3K48A 5FBZA 2ATFA 1QJFA 3BODA 4N43A 2JKBA 5HI0A 1JYNA 4LQRA 5C71A 1LOAA 2D3SA 2Y60A 3QH7A 1G9FA 3WDYA 3WXPA 5LK7B 2GDFA 4CCOA 1ZBA1 3JU9A 1WLTA 3VBHC 2E7QA 3IBMA 3MV01 5BNOB 1RUJ2 3CQOA 3OY8A 4AFBA 1JN2P 2RR13 4D6QA 1SFNA 4N9IA 4ZONA 4TSVA 5E1RA 4BIFA 1LCLA 1AYN3 3WOGA 1N1VA 1FAYA 2W39A 2X8KA 3BIWE 3FX3A 3SCFA 2D6PA 4Q4X2 4OYUA 1AR72 4U2AA 2VMDA 3IAPA 5I0RA 1VBD2 1VB4A 4B1MA 1G9DA 1W04A 4I3GA 5C33A 2P3IA 1O3TA 4AEDC 2VZUA 4HPKB 2DURA 1HRI1 4Q0SA 3V56A 5FYBA 1AR81 4E27A 2C4XA 4QPYA 5HV0A 1Y43B 3EB7A 3ILNA 3ZFFA 4XJUA 4EN6B 3BU7A 4LUMA 2JDAA 2QZ3A 1QGLA 4Z2WA 2VOXA 4XQDA 3ELNA 5A3WA 3T2TA 4A6OA 2FDJA 1PMHX 4BLIA 5K8SA 5A1FA 3FHAA 4AQTA 2VZ1A 4W6XA 1PMIA 4YVWC 2QKDA 1UYZA 3UGFA 4ATFA 1G9BA 4KGGA 5JOYA 3HIFA 2BPA2 4NAMA 4L2NA 3VBHA 2YUEA 2ZPXA 4E4HA 1DYOA 2AR6A 1XU2A 5F3EA 3JD71 3VDDC 4D8MA 3TWIA 3ON7A 2WQ8A 2RVAA 3TN93 2XOMA 3LA2A 4QT6A 1GZWA 4MV2A 2ZAAA 3W58A 1NY71 4YGDA 5FYSA 2FDKA 2XVLA 3C7OA 4RQPC 5BNQA 4PBOA 2B8MA 4XHXA 1AX0A 4TLFA 3RVHA 1RJ8A 3VBSC 5A3TA 5EJ3A 4RFRB 4YG0A 4AEDA 1A78A 3AKSA 1H1AA 3ZIXA 4V2VA 3THTA 4E8DA 1BVP1 2IXLA 2CTVA 1UPSA 2R0HA 4YW1A 2R7EB 4QM9A 2PAEA 2VH9A 4Z82A 4FAGA 3J7LA 1ZBE3 4XMAA 5A6QA 1Z7S2 1KXGA 4CPBD 5FV3A 2CY6A 1FPN2 2VCAA 1QOOA 2QQVA 2Z79A 1G7YA 3T08A 1EUUA 5CVRA 3Q9OA 3WNMA 1YCIA 2WZR3 4FBFA 5IK5A 4YVWA 2IVJA 5T52A 4CDQC 1UCXA 1PO22 3QLQA 5EYXA 1RUE3 1ZZ7A 1RTVA 3IDBB 3VDDA 3O1PA 1PM7A 3AC0A 5E88A 4XJZA 2PHWA 2VJXA 5KHHA 4AAPA 3HBKA 2ZHMA 4JQTA 4LUKA 3ES4A 1QDOA 2ZHLA 4DXZA 1BJQA 2IC1A 1YFUA 4RQPA 3VBSA 1HXS3 4GD4A 1CAWA 5A1LA 5FCCA 2ZX4A 1MS3A 3POGA 1F9KA 1WW6A 1DQ5A 2VMEA 1GQGA 3TRSB 4FTEA 2BNNA 4L9BA 2NMOA 3WNXA 1AR61 1CZVA 4DRRA 1D0GA 2NMNA 2W08A 4Z07A 3WUCA 5FYZA 1C1LA 5J09A 2DTYA 3MI8A 1KRIA 1ZBA3 4TWTA 3PL0A 3ZXLA 4E8CA 1LOGA 1WBFA 4CDQA 5A6ZA 5A33A 1O91A 1TMF2 1R1ZA 1X82A 4AQSA 3LWCA 3BKZA 1B35B 2OKXA 2XXZA 3AMHA 3FUOA 3ACIA 5FYIA 2XKOA 2XL7A 1NCRB 4YW3A 3O14A 3D6EA 4FVVA 2Z69A 1GOFA 1ZM1A 4XUOA 1S2EA 3AZVA 1S0BA 5DXDA 1GYKA 2GP5A 1W3XA 4M3CF 2ZKLA 5JPMB 1QU0A 2JIJA 1HRI3 4QPWA 1SLAA 1AR83 4OHVA 1A8MA 1AJOA 1JW6A 2ZGMA 1REEA 1XRUA 4L97A 3HVDA 4A3ZA 2XMLA 2OW4A 2Y6FA 3WD5A 2R49A 3WQ7A 4A7KA 1NZIA 3NNFA 1UYYA 4LKDA 4LLFA 2X29A 3VBRC 4AI8A 4XXPA 2GALA 3K46A 5F32A 2BOIA 5IVVA 4QWNA 3VZJA 1CX1A 2XUEA 3AMQA 4B1LA 1ZA7A 5CA6A 3I97A 4LIVA 4WM7C 2CDPA 1RUNA 1T6GC 4E2QA 4CP9A 3WW3A 5JPNB 1X7NA 5LEKA 3TB0A 3JD73 4P14A 3LKJA 2A6YA 1S1AA 3GBWA 3D4KA 4C1XA 5C70A 2FCTA 3HT2A 3O1RA 1KFUL 4UAPA 2WJSA 1JU3A 3OBRA 1LOCA 3OBZA 3K77A 4NO4A 5IVFA 2V4AA 1YIPA 3MZHA 5LWBA 1UIJA 4U36A 4K1ZA 3OGGA 2BOJA 3M3IA 2AZ5A 3JBG2 4S2GA 1E5SA 2B9VA 3HNBM 1REDA 5IK7A 1NG0A 1S55A 1POV1 2R071 1S0CA 5T50A 1AZDA 1DZQA 1W39A 4LKEA 4Q8KA 1ZA4A 2FBEA 4JRLA 1RVF1 3W9AA 4MG2A 1KITA 3M7AA 3BTZA 3GF6A 4XEZA 1UY0A 4YZ5A 1K42A 1SLLA 2WYSA 4H55A 3U78A 5FBJA 5E6HA 3VBRA 3N4MA 2WZPP 5JMOA 4YNIA 4JGYC 1FI2A 3GALA 3OEBA 5FP3A 4Q5OA 4RR3C 1QJU2 4KG0A 4WM7A 1ULGA 4J1XA 1KJRA 1GUIA 1C3HA 2QNKA 4Y5SA 2ZEWA 1OLMA 3MIBA 3IAQA 4P9LA 2W1SA 2ZGPA 4BYYA 2D5HA 3WT3A 4Q4V1 5FKCA 3ZYFA 4LO7A 3Q8BA 1GV9A 5IVEA 2OXBA 2QVSB 3ZYBA 2ZOEB 1H1IA 2IVIB 3ETPA 4XFGA 4WM8B 1VRH1 3GBGA 3OEAA 4AEMA 3RZMA 4NVPA 4HBNA 4OHZA 4C91A 2CGNA 3ZN5A 3FWEA 4OUSA 2A70A 3R4DB 1UY2A 5JZGC 4ZU4A 3WG3A 1CWPA 2ZACA 3ZMOA 2ZXQA 3N9OA 2P34A 2R041 4XQWA 1KJLA 1W0NA 5FYHA 1AR63 3B9CA 2GH8A 2ZEZA 1OKOA 4M3CB 2GC3A 2WO7A 3DL3A 5K4LA 5C8CC 4MGTA 1W9WA 3I2DA 3ACLA 3H8XA 4NHXA 5FMDA 2OPKA 1US2A 5KXCA 1K5MB 3H1YA 4AI2A 2CDOA 4R9CA 4EZHA 4JGYA 5DABA 3VD3A 2B9UA 4RR3A 3SKJE 5FZ3A 4TXWA 4MHRA 1NUKA 1XNCA 4K8FA 2KA3A 3IIAA 4B4QA 2W1WA 4UFLA 1AHSA 1F5FA 1HV0A 2PA7A 1OLRA 2FZ1A 1DU3D 4HK8A 4KNCA 3LFIA 2OUHA 1TG7A 5I8SA 4BWOA 1F8VA 5FXVA 3WP5A 5D1IA 3NSTA 3URFA 2HWC1 2IFWA 2FCUA 1CQ9A 3DYMA 4K1YA 2CGPA 1ZRIA 2WT2A 3MEPA 2ZEYA 3E1F1 1QJY2 4JHZA 5GALA 1JZ8A 3FLTA 1MVQA 1DFQA 3OF1A 1EUTA 3LPFA 4CCEA 3CDZB 1WD3A 2VNRA 1Q8PA 2YGMA 4FQZA 5JZGA 4XUNA 1I1EA 1W0OA 2K46A 2XJTA 3WQBA 2MEV1 4AEJA 5CIRA 1B09A 1VBD1 4OI1A 3VKMA 4A41A 4AVSA 3OTFA 5BY5A 5C8CA 4R52A 5KBFA 3I3BA 2UURA 4GA9A 1IGOA 2R1DA 1LHUA 4HKWA 3IB3A 2IWGB 4MUVA 1UKGA 3PU3A 5FZAA 3AKQA 3AVSA 3NNLA 1NZCA 3QD6A 1ENQA 1OFSA 2A3WA 3I2KA 3AP9A 4QKBA 3I59A 2WZ8A 3GXUA 3MLKA 1VBB1 2HWE2 3A23A 5EYYA 5C9AB 3SH5A 3LEGA 3AP7A 1AXZA 4AGGA 5ABJB 1W28A 1ASJ1 1NX9A 2C9AA 5BNPB 4RL7A 1YQCA 2ID4A 1NKGA 3N7MA 1YO8A 4LHKA 3WCRA 1PGW1 2UY9A 2OA2A 3D3AA 1RHI1 1W8NA 2A6XA 1GWLA 1CAVB 3WY6A 4FCAA 4CPBA 5KHJA 2JG9B 2PHLA 3UGGA 4N7IA 1N47A 4NPMA 4IEZA 4AVBA 2FQPA 1WD4A 2VECA 1OH4A 2ZGRA 2RJLA 2YMZA 5DAVA 2BNMA 2R073 1POV3 3JXSA 2V5YA 4FPYA 4YGCA 1FNYA 5T55A 1LOBA 4Z2AA 1I3HA 2HH9A 1AL22 1N3QA 1RVF3 1DQ2A 2RV9A 3J8F1 3KF3A 3NJVA 1UQXA 3JUUA 3ZXDA 5FPUA 1EAH2 2FZ2A 1UX7A 1OH3A 4QD2A 1RUI1 1SACA 1QJX1 3LA7A 2YU1A 2WUHA 1NLQA 1HLCA 4FAHA 3MUY1 3U4SA 4OQ9A 2LW8A 2HYKA 4PDWB 2DUQA 1LOEA 1WW4A 2WC2A 1OD5A 3OUJA 3ZN4A 4COZA 5JOZA 1TVGA 1Z7S1 4Q4V3 3O0XA 1FNZA 4ASLA 3DYOA 4KBBA 5AVAA 1VRH3 3KT7A 1G9CA 2ZKNA 1RIRA 1BBT2 3ZR5A 4L99A 5FXXA 1HB4A 3RDIA 1J84A 1UMIA 4IUGA 5LASA 2R1BA 2Y0OA 4NROA 3ZOIA 3NJXA 1HN0A 4IV1B 1QEXA 5C3QA 3AM2A 1OOPC 3DV8A 4IEOA 4UF0B 1PHMA 4Q4W2 5F5QA 4D7YA 3ZKUA 5A6YA 5FDBA 3LZZA 3V65A 5L36A 5F5IA 1A3KA 1C8M1 1PVC1 1ND2B 2PLV1 3VBUC 4N7UA 3WF1A 2PYTA 3SEPA 2HBTA 2LS6A 3MPBA 1FOD2 3J9SA 4QHZA 2A1XA 2VMFA 3AXDA 3AL6A 4GKYA 4GULA 1W6QA 3IT8A 1Z78A 4R4XA 5EWSA 4CU7A 1OT5A 4LORA 3PJQA 4FFHA 4PF5A 4RS5B 3WZ1A 1S2BA 1ZZ6A 2CGOA 2VZPA 5JLVA 4INDA 3X29B 4FTSA 3TBDA 3HMYA 5CFCB 5A3PA 3LB9A 3DYPA 4YZ2A 3SMHA 3U4XA 1FMD2 1UZWA 1S0IA 1MPXA 1JU4A 3MUZ1 4AZZA 1WWYA 2HWC3 4M3CE 1BLZA 1OUSA 3LSEA 3AYDA 3ILRA 3LEKA 4H7MA 4QU2A 2ET1A 5AVPA 4DXSA 4ZKTB 1PZ7A 3H0OA 4MGZE 4QDQA 4MXWA 3UK9A 2O14A 4YZ4A 3SH4A 3I2HA 4Y4YA 3I49A 3M3OA 1RUOA 3ZDSA 1OA4A 4XURA 2J1RA 3W21A 5F8PA 1OOPA 1PO12 2MEV3 3J26N 1GZCA 1V70A 2UWBA 1RMU2 1W99A 3VBUA 1OPMA 3KB5A 2VUCA 1OI6A 1I5PA 2ENRA 4P02B 1XYPA 3BB6A 3D8CA 5FXWA 1CAXA 5JOWA 4P9GA 4BE3A 1ULEA 2BERA 3O1TA 1BZWA 3KV6A 4L11A 4UFHA 1H6YA 1VBB3 4Q4Y1 2E7TA 3DUIA 4QX5A 5EHDA 1UZ0A 4NE9A 5FUNA 1MS5A 1X33A 1ASJ3 5JWPA 2VQAA 5BNOC 2R061 1CVNA 2GAUA 1S4CA 4PT6A 2R0FA 3ZLIA 1HW5A 5I8YA 4OULA 1PNFA 1RHI3 3MFAA 4NAOA 2A6WA 4KU7A 4OUMA 4XW3A 1ENSA 3AB0A 3T0AA 4Z92B 4ZY9A 1W6OA 1CPNA 1VR3A 5J98B 3ZMNA 1VAKA 4CYDA 2WDBA 1MS4A 3UNPA 1ULOA 2WQZC 4Q27A 3RQ0A 4R9AA 3U14A 1E57A 2OT7A 4XYXA 2DCKA 2WIIB 2ZGOA 1Q8QA 2EXJA 3RYPA 4GXLA 5A80A 4GALA 3J8F3 3GZUC 1RL3A 4PIZA 1VIWB 5IW0A 4CDXC 1O5LA 1WA4A 2VR4A 2E33A 4ASMB 1XJAA 1RUI3 1QJX3 5DPNA 4IQPA 2Q8EA 4QB6A 3T09A 1O59A 2DCTA 1LB2A 5DDJ1 4HN1A 3IN9A 3SC7X 1AXKA 3CJIB 4EN0A 1W9YA 5A32A 1YC61 5FKBA 3POEA 4QX1A 2QE3A 2X09A 3RMXA 1Z7S3 4NJ4A 4FSJA 2EAAA 1DQ4A 2QFEA 4Q2FA 5BNOA 1WCUA 2I45A 4IEUA 3LD8A 2RDSA 3E6BA 2VMCA 4PIXA 3VZKA 4DXTA 1QWRA 4LK6A 4A44A 1O3RA 4AQ2A 3PURA
chains in the Genus database with same CATH topology
3QACA 4F8AA 4MGYE 2DVAA 1TME1 3O0VA 3R0RA 4WVZA 1WMDA 2JENA 2XG3A 4YW2A 1DIWA 1C8M3 1JYCA 1PVC3 2PLV3 3OD0A 5HXVA 4CDXA 4HPKA 1VBE1 4Q1RA 3GNEA 1U0AA 3V0BB 3PVBB 3L2HA 1LENA 4ZU5A 1NE4A 1ZZ9A 2GC1A 1YFYA 4WVMB 2B45X 2PTMA 1BCXA 2Q1ZB 4AFMA 4IEXA 3UKTA 3APBA 5GZDA 3WUDA 2NLRA 2G9GA 3B01A 5I8TA 2K9ZA 1CJDA 3WW2A 1N3PA 1VBA1 2YY1A 4EN8B 3PJYA 2DCZA 2ZZJA 4NWVA 1OA3A 3VLBB 2RS12 1QJZA 4E4ZA 2Z2SB 1AVBA 1RUC1 4AF9A 3P3NA 4RFT0 1MR5A 2VGDA 5ACA2 2VVEA 4NOTA 1DF0A 2ZGNA 1C1FA 3ZSLA 3KLSA 2XBO2 3L2YA 1YNAA 4LO8A 3PVOA 1R082 3WDXA 1QJY1 3NKTA 2ZMKA 2PN5A 5FRAA 3AZZA 5EV7A 5FPXA 2E53A 4NHKA 2GC0A 5KHIA 4OLLA 3PNAA 4Q4Y3 1MEC2 3K51A 3GZAA 2GMEA 2GZWA 3VHOA 4FPEA 1MQTB 2R063 3SCGA 5K7PA 3ROUA 4DOUA 4P9XA 4Q8LA 4PBPA 4Q0QA 2I74A 2W0XA 1DGLA 3EQEA 3HAGA 2XLAA 1B35C 3D5OA 2WNUB 5I93A 1NCRC 4OHXA 1O7FA 5EFUA 1IQAA 1IZ3A 3MPPG 3NWKA 2PHFA 3E5UA 1MS1A 4IERA 2VU9A 3V64A 1HV1A 1V6KA 2EALA 1EV12 1RUG1 1XNKA 1F31A 1R1A2 1YRZA 3WP6A 1V6MA 1MZEA 1EY2A 4BH9A 5DDJ3 5FOJB 1OKQA 1DHKB 1H9PA 1H8TB 2VW2A 4R8HA 2RMU2 1NA1B 4IV3B 4O9EA 2GH2A 2ZGKA 1IS3A 2CAVA 4AVCA 3ZXGA 4DY5A 2YGLA 5E8AA 4WVWA 1JBCA 2XL9A 5AFEA 3AP6A 2XGXA 5HBAA 2DCJA 3OYWB 2OIIA 4ZU7A 1AX1A 1B35A 1OHFA 2NM1A 1TME3 4XBQA 5BNNB 1NCRA 4HK9A 1AYM2 1D0HA 1HRV1 2RS32 1DQ0A 4TYSA 1DZTA 1YXWA 4XF4A 1VBE3 5I0TA 3ZO0B 4N90A 4HETA 2ZBJA 4WBBA 1XXNA 5K0UB 1C8NA 2IXKA 1X50A 3AXEA 4Q4W1 2EA7A 1CAUB 3ZYIB 1RUF2 4CZSA 5SV8A 1QOSA 4D3WA 1COV3 1AUYA 1VBA3 1MACA 1MZ5A 1R091 4I09A 5E16A 4BM8A 4D94A 2BWCA 4MH0E 4Y1ZA 1OQDA 4LNVA 4R9DA 3SLIA 4RHV1 1RUC3 2HWB2 5T5OA 1DQ1A 4WM8C 1BKZA 2O8OA 3VBOC 3TAYA 5BUVA 1YJKA 3ILFA 4X6QB 3OCPA 5FQ0B 5EXOA 1U5YA 4YGBA 1O4YA 4COWA 4Y1UA 1XE7A 2EF6A 1QJY3 5CNAA 4W6YA 4E2SA 1PGL1 1RUD2 2PELA 3M4FA 4AW7A 2E7AA 3CEWA 2IXJA 1Y9QA 1WMEA 4XZPA 5HCFA 4AVTA 5JAXA 2GNBA 5GLWA 1QMJA 3M3EA 3ES1A 1OLQA 3AP4A 3NAPB 2VMIA 4S2HA 4YM2A 3RI8A 2BYVE 1U5XA 1WLDA 3BALA 4FQ4A 4TZDA 3E6CC 2WS91 1JUHA 4X8PA 4FPGA 4RD7A 4WM8A 2LUWA 3RG0A 2BGCA 4HZFA 4OHWA 3VBOA 1RB8G 4QQLA 3AYCA 1YI7A 3R4SA 4HVOA 4MSVA 3RYRA 4QQOA 4OI0A 4N9HA 1CESA 1CPMA 3NO8A 5E89A 3V0AB 1RUG3 2ARXA 4N53B 4ES9A 2QQPA 4JDMA 3BCWA 2WWSA 5FREA 5FMOS 1CJPA 3NV3A 3IMNA 5DG1A 3VL9A 4AGRA 4LBLA 5LK5A 4LHNA 5KC5A 4PLMA 1RUH2 4SBVA 2RS52 2PAKA 3AJYA 2B7YA 1XYOA 1YLLA 2ZGLA 1QKQA 3ASIA 4FPLA 4I30A 4L8QA 3T1LA 5C9AC 3ZSMA 5ABJC 3H3UA 4FPJA 1I6XA 2ZTNA 1YI9A 2A3XA 2Y0IA 4QHBA 5H9PA 3ZXKA 3VV1A 1D4M2 5DZGA 4AE2A 5AC92 3LAGA 3ZXJA 1HRV3 3OGJA 1YWKA 2CAUA 2Z5WA 2V73A 5JVVA 1SDWA 5L7OB 4L92A 3NV1A 4ISQA 4J1WA 4JTOA 5J3UA 5CG8A 1DDLA 1SCRA 2BFUL 4HL0A 4Q4W3 3DGTA 1MZ6A 1C5IA 2Y38A 4DFSA 4K20A 4PDWC 4HVQA 4IEVA 3WW1A 1AX2A 2VW1A 4FT8A 1R093 3OBTA 1H4HA 5D8AB 5C9AA 1J1LA 1WLWA 3DPRC 3UJQA 5LRSA 5ABJA 4KWKA 4G4FA 4CDUB 4RHV3 2ZX2A 2AREA 4CRQA 2ZHNA 1CAVA 4YLZA 5KHGA 5TSWA 3HBZA 1ZYBA 2NP0A 3TOJA 4IV1C 1MZFA 4XFIA 1H0BA 1QQP2 4DS0A 1VAMA 3A4UA 4FOQA 2CNAA 2WA4A 3B9IA 3ZFEB 4PLOA 1YYNA 4Y1VA 3KCCA 5H9QA 1XNBA 4I2OA 3WDVA 4P9WA 4H3WA 3RMYA 2D5FA 1BK1A 4DMIA 3ZFGB 4RS5C 2C5DA 1R081 4PDWA 2DCYA 4FPFA 3VKFC 5CFCC 4XJ8A 2DU0A 3R6SA 3DPRA 2D3PA 5GLVA 2CWMA 3AFKA 1V9U2 2WS93 5DG2A 4AFAA 2HEYF 5JR7B 1OA2A 1S0FA 4OI2A 1QDCA 4CEWB 2YDEA 4IEPA 4JQRA 4IV1A 4M0NA 2B42B 2WFF2 3NVCA 3I4IA 1IOAA 1OPOA 5F1RA 3SISA 4B4RA 4Q0UA 1ZVFA 4Y5Z0 5AFBA 1RC6A 1QY4A 2XJPA 1V6JA 2RM22 1EPWA 1H9WA 2JE7A 3ZFFB 3NL1A 1SCSA 1NOVA 3FUQA 4AFCA 4RS5A 1DG6A 1F2NA 4KQ7A 3HQXA 3RSJA 5CFCA 4YVSB 2NPIA 3H9AA 2VUAA 2HWF1 4K9SA 3VBHB 1DQ6A 4CDWB 1PIV2 2Z42A 1IHMA 2WA3A 3POWA 1V6OA 4LEJA 1ALYA 5GZFA 2BWAA 2ES3A 1UU6A 5FO8B 1VBC2 2CYFA 4QQHA 3M1HA 4BCUA 4MVTA 4JDNA 4NN0A 2D43A 3VUOA 3MICA 3H50A 3WV6A 1NQJA 3B00A 4K6BA 2HJIA 4META 5I91A 2NYYA 1BVVA 2NZ9A 3LA3A 4IEWA 5EZWA 1AYM1 2W68A 1ZRDA 1UKRA 4IEYA 4B7KA 3CF6E 4XF9A 2F4PA 4BZ4A 1EP0A 4QPIC 1O3SA 1Y3TA 3AK0A 3CJIC 4R9BA 4EJRA 1A8DA 3VZMA 3KT4A 5KXEA 4YZ1A 2RR12 2WLPA 1IS4A 2O1QA 4AI0A 1EPZA 4DINB 3M3QA 1AYN2 4C0HA 1RUJ1 2RE9A 3SHRA 1APNA 1QXJA 1RUF1 4HMZA 4BQ1A 1LR5A 4P9IA 4Q4X1 1SMVA 2DYCA 2ZGTA 4EWEA 3GYDA 1SLTA 1AR71 4LO5B 1U5ZA 4NPRA 3VBSB 1CAWB 5F6KA 2JECA 3LCPA 5J37A 4UBGA 3I7DA 3LGRA 1YFXA 1IKQA 3I54A 3WQ1A 4HFSA 3NJZA 5JCTA 2WLQA 1GR3A 4KH9A 1LHOA 4FPCA 1ND3B 2GNTA 1R083 1W6PB 4QPIA 3CJIA 4I02A 5GJ6A 1DBNA 2Q1MA 3OJBA 1DYKA 2BTVC 5J7MA 2PAMA 3TN92 4CDQB 1GKBA 1N1TA 1JOJA 3FHIB 4YGEA 1ZRCA 4Q0VA 1W6NB 4IESA 1KQRA 1HQWA 3BOWA 4S2DA 2X5IC 2QJVA 4I0AA 2WFPA 2BUKA 2D98A 2P3JA 4I3PA 3FE5A 5T5JA 3KS7A 4XFFA 3THPA 1SBFA 2G4IA 2VXRA 4K40A 5JSPA 2N7GA 1GQHA 4Y1YA 5JOXA 1C4RA 3V0BA 4SLIA 4UW3A 1AL0G 2WKKA 1N1SA 2WZR2 4WVMA 4Y20B 4YG6A 1FPN1 1YHFA 4PCRA 4LTAA 5FLHA 2XVGA 2KXLA 3SCHA 4AVSA 1XE8A 4HT1T 1RUE2 2JICA 3O12A 1V6NA 3N7LA 2OUJA 4WVVA 3LOIA 1MQTC 2HWF3 1POV0 1UMZA 1PO21 1D2SA 4ITCA 4JVAA 4ORFA 4CP0A 3O0WA 4FP3A 5LEJA 4FO9A 1TE1B 2RJKA 2R043 1RGSA 1HXS2 2WNUC 3HWJA 3AKPA 3J4UH 2D6NA 2X5IA 3H3ZA 4LR4A 3QOPA 4E4DX 1JTZX 5FOBB 3AMMA 1CX4A 3E97A 1LODA 3VBFB 1AYM3 4I0WB 1SLIA 1IS5A 1QHDA 4H7LA 2DVGA 4KWJA 1ZBA2 3MF9A 1CD3G 3RJRA 4YARA 1VP6A 4WM7B 4M0HA 3S7IA 1RUJ3 3S30A 1MQTA 3RNSA 3CU7A 3KM5A 1RUF3 1VALA 5JDBA 1TMF1 2JJ6A 3LSDA 3USSA 1GNHA 1QF3A 2AUYA 4P5HA 2DUOA 4Q4X3 5KHKA 4D7SA 1AR73 1X8MA 2WNUA 5BNNC 1VBD3 3FLPA 1BXHA 4QGMA 3N35A 1HQNA 4XFCA 3T1MA 4MXVA 2GNMA 1UU5A 1SFYA 2D97A 2VOWA 1XQNA 5J96B 5I0SA 1CN1A 2VOVA 2WNVB 4MLOA 4MX3A 4YFWA 1TNRA 2B5HA 2TBVA 2AYHA 5IK8A 1WW5A 4RR3B 5GM0A 3VHRA 3HR9A 3USUA 5HCAA 2TNFA 1NY72 1RJ7A 2GN7A 4FPKA 4LHLA 3G6JB 2D7FA 1VLNA 4PJYA 3UJOA 3OYWA 4LBNA 2UU8A 5C8WA 5IK4A 3SXWA 4GQ7A 4QQPA 3MW2A 5BNNA 1NXD1 1V9U1 3JBG1 4YW4A 2VULA 2VW0A 2DU1A 1ENXA 4OI4A 1WMFA 1AR92 2YZ4A 4QGLA 4AQ6A 2GSYA 1GICA 3W59A 2WFF1 1FPN3 1HDKA 1SLBA 2K0GA 1CAUA 1QJU1 4EV0A 3NV4A 4Z1VA 5GZGA 4FOVA 3I59B 1PO23 3NAPC 4FXGB 4HANA 3A0KA 3ZN6B 3RZZA 1ONAA 5JIUA 4DNYA 1DZRA 1H4GA 4IEQA 4JCKA 4NR1A 2ZABA 1BMV2 1MS0A 4XFHA 1I5ZA 2UYBA 4CEYB 3PHMA 2ZMLA 2TUNA 3NKGA 1AR62 4D7TA 4KG8A 1YUDA 3IPVB 4XDQA 1V6IA 4LO4B 1ZZ8A 4N53C 2R32A 1WBLA 1SEFA 4A7YA 2JD4A 4V1PA 1PNGA 5FO7B 1G9AA 2XJVA 5I0UA 4B8EA 2VQ0A 3AZWA 2A71A 2XB6C 3E5XA 3VZLA 2DTWA 3NAPA 1TMF3 3MLJA 3ZPYA 4K7JA 3POSA 1W6MB 1FX5A 1LGCA 1TQ5A 2A75A 3SITA 1N3OA 4ZXKA 1UW8A 4OHYA 3ATGA 3V0AA 5JIAA 3TYJA 1U5IA 1HIXA 1REFA 4N53A 5CFDB 5L7OC 2D93A 3H7JA 3B69A 2DFCA 1LKNA 2BVVA 4COUA 3VKLA 1NCQB 2ZX1A 4UW6A 2YPJA 3ALQA 1W6QB 2GMPA 3FFZA 4MGKE 2ZX0A 4AHZA 3GHNA 1WW7A 2GMMA 3E5QA 3R4UA 4LO6B 3KGZA 4YW5A 1ENRA 5D8AC 2HWE1 4Y1XA 1MS8A 1VB2A 4EROA 1ZRFA 4HVRA 3CO2A 4JGZB 2XUMA 3WR0A 1GSLA 3TNPB 4ISRA 1DGWX 5GZCA 2IZWA 2R072 1O4TA 1W0PA 2P3KA 5KXDA 2MHFA 3JBG3 1RVF2 2Q8OA 3EHKA 2DF7A 3ZYRA 2PFWA 2VMGA 3AKTA 5FLIA 1AL21 5L7OA 4B7EA 5DUUA 1Q5OA 4FOYA 4AHWA 3VBUB 1EAH1 4JC1A 5SV5A 5B2GB 2WFF3 2XJSA 4XJWA 3KGLA 5CG9A 3PVEA 1QJU3 3ZFGC 3SH3A 3B94A 4Q4V2 1I9RA 2HWD2 2JDZA 1UN1A 2IXHA 3FBMA 4KL1A 4QPGB 2C1FA 5D8AA 2PQQA 3KCYA 3RWNA 2VNGA 4B3NA 3L9JT 5T5PA 4LULA 1S0EA 1ZRRA 2ZAHA 4AHXA 1BBT1 2P2KA 4CEWC 1LHNA 1OSGA 3KD4A 3O7OA 1H2NA 1LHWA 1GZ9A 3D82A 1UL9A 3CJXA 2QZ2A 2JG8B 1NLRA 1LHVA 2YHJA 3M70A 4AWDA 3VHPA 2PHUA 3O5SA 5DZFA 4LBMA 1FOD1 2ZGUA 3RI9A 5JI9A 4XBLA 1WCSA 5GLUA 2CWSA 3JB8A 1LULA 3ZFGA 3WX5A 5A32B 2QUOA 5T54A 3H1WA 1QNWA 5BYNA 1KDMA 4ES8A 3S6PA 2YV8A 4XETA 4YVSC 2HWC2 3KT1A 3FBYA 1NXMA 4CDWC 1OQ1A 4LBKA 4LBQB 1FMD1 5K9YA 5T3NA 4P9YA 4A7ZA 3N3HA 5C4WB 4XXAA 3MIHA 2PHXA 3G7DA 1SBDA 2I07B 2MNGA 5GZEA 4C1WA 3RJ2X 4CEWA 1VAVA 3HD8B 4COYA 2MEV2 1H1MA 4YG3A 2DVFA 4G9SB 2H0VA 1ZREA 2VMHA 1PO11 1K5MC 2R30A 3QCWA 4XJAA 1AF9A 4CDXB 1RMU1 1QXPA 4AG4A 3OPZA 2PHDA 2VUJA 4HLTA 3BPZA 2Q5TA 4LBJA 4Q1PA 2E9QA 1VBB2 3VZOA 1Q56A 1Q8VA 3WDWA 1D4VB 1ASJ2 3P3PA 3U0ZA 1TNFA 2HWE3 1PGW2 3M8LA 3MF6A 2EXKA 3ZYGA 1RHI2 4YVSA 4YZ3A 2CV6A 4CDWA 1WCKA 4IETA 4BMBA 2G9FA 3GHMA 4F83A 2VG9A 2QDRA 4S2FA 1WLCA 4BIOA 4JV4A 3ZXFA 3J8F2 2XLFA 4M3CA 1LOFC 4A3XA 4XTPA 1AL23 4RA0A 1RUI2 1QJX2 4NHMA 1K5MA 5J48A 3WP3A 1EAH3 4C0BA 5F9TA 4EWDA 5IT6A 2Q30A 1ND3C 2F6BA 5BNPC 4BA6A 4DPNA 3D0JA 1AXYA 1AR91 4FPOB 2YROA 5JI7A 3ZYJB 2JG9C 1BYHA 5JMCA 1IPJA 2ZX3A 1BBT3 3IWZA 2DV9A 1C8M2 3QBQA 1PVC2 4KWLA 2PLV2 4E9KA 1UIKA 3POYA 2DVDA 1LOFA 2A3YA 2VVFA 3ST7A 4LT5A 2FHRA 1H2KA 4CP1A 1BMV1 4AI3A 1FOD3 4XF1A 4Y22B 3WHUA 2OYZA 2A73B 1ND3A 5BNPA 1W6PA 4Q29A 2UY8A 1BEV2 1KS4A 2E51A 2P17A 5CU1A 1O5UA 2ARBA 2C0ZA 1FT9A 4B4PA 2Q0AA 4FOWA 1CGPA 4XOGA 3D0SA 2D6LX 4DRVA 4JAAA 3ZX7A 1PK6B 4XIOA 1DYPA 1FMD3 1S0JA 2JG9A 4C90A 2RHPA 4DZGA 4GWMA 2PHRA 2RS11 3WDTA 1W6NA 4GH4B 4ATEA 1PZ8A 1GANA 1UF2C 1JYIA 4AVAA 1ND2C 3MYXA 3FLRA 2XWBB 5ACA1 3N7JA 2D6MA 4AEKA 3BOPA 1PO13 1RINA 2ZA9A 2IXCA 4N43B 3AX4A 3ECQA 4AFDA 3ZVXA 1RMU3 3BTAA 3VBFC 2XBO1 1CR7A 3WINE 2BVBA 4JRAA 3UKNA 3EXUA 4Q4Y2 3AMPA 3MDPA 2VPVA 3GBFA 3OY8B 5T5LA 2R062 4Y20A 3UL2A 1M06G 2XLGA 3FFQA 1URXA 3IDCB 1UPIA 1MEC1 1GLHA 4LBOA 1SLCA 1XU1A 4QGNA 4FXKB 4GMP1 1JHNA 1ULDA 4XTMA 4GIQA 4B29A 1G86A 1O4ZA 1ND2A 4W6WA 1BQPA 1GBGA 3AJZA 1ZZCA 2AENA 4GB32 5GLZA 1CONA 1AJKA 5DDJ2 1EV11 1NLSA 4Y24A 1H2LA 1R1A1 2D40A 3U11A 3VBFA 2VNOA 2BQPA 1FV3A 2WNVC 5FFOC 4XPVA 3JQWA 3ZXAC 1Q43A 5KC6A 3ENRA 3EO6A 4UW4A 2RMU1 1AR93 4XQ4A 1FXZA 1UAIA 4HKOA 1KFXL 3R05A 4PQ9A 1GZWB 2HEVF 4W65A 3KCXA 1J3PA 4QMAA 1QXRA 1QOTA 1TME2 2YC0A 3B3QE 1KS5A 2B39A 2HWD1 3WQ0A 1YJLA 1X36A 1IKPA 4AEDB 1O3QA 2CL2A 2E6VA 3VBOB 4QM8A 1VBE2 2XJUA 3RPQA 2RS31 2IFRA 4PIYA 2D3RA 1XNDA 2FMDA 4XHBA 3IM0A 4LBQD 1KDKA 1J58A 3VL8A 2UWAA 2WNVA 5IUQA 4YVWB 1LEDA 1COV2 1VBA2 4LA2A 3WLUA 2WL1A 1EYBA 2XVKA 2R6QA 2D44A 3VDDB 2VVDA 4YM0A 1UX6A 3N7KA 4I01A 3A0NA 4AGVA 3CNAA 1RUC2 5DUVA 5C6CA 1NQDA 1GFF2 3LOBA 2RS13 4RQPB 2ZMNA 1UU4A 1JH5A 3FJSA 3C3VA 2HWB1 4WZFA 1MVEA 2AGSA 5ACA3 2I2SA 5A3MA 2EIGA 2IXIA 3VN4A 4CEYC 3VGIA 4DB5A 1WUVA 3VHNA 4XJ9A 2XBO3 4O9GA 1NE6A 1S0GA 1RUD1 3WVJA 1LESA 4JTNA 4XMIA 3KSCA 1S0DA 2XKPA 5A33B 2ERFA 1MEC3 1QNYA 2NQYA 3AFGA 3JB4C 3DN7A 4YM3A 3DKWA 1VJ2A 4HSLA 3ZN6A 4Q0PA 4GMP3 2HKXA 3ZSJA 1J1TA 3MW4A 1DLLA 4WV8A 1RUG2 1A6CA 3WHTA 1ZBE2 3PMSA 4CEYA 4GWNA 5BXXA 1EV13 2EXIA 1R1A3 2ET7A 3IPVA 4XBNA 2MPFA 4BLJA 5CFDC 2QCSB 3H8UA 5FLJA 5KXBA 1LEMA 4XFBA 1NCQC 1F5JA 2WSUA 5J36A 2BNOA 2EAKA 4QXKA 2RMU3 1RUH1 2NN8A 3RYKA 1G6NA 1H30A 4GMP0 2H0BA 1V6LA 2RS51 3JCIA 1C57A 2WT0A 5DUXA 3KMHA 3AP5A 4UW5A 4X6RB 3MFCA 4H14A 3DPRB 4FPHA 4JGZC 1L3JA 2HWD3 5FTTC 1HRV2 1W6MA 4E4SA 1D4M1 1LU1A 4RSUA 3WCSA 3WG2A 4XIKA 2OZJA