1D4M3

The crystal structure of coxsackievirus a9 to 2.9 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPTMNTPGSTQFLTSDDFQSPCALPQFDVTPSMNIPGEVKNLMEIAEVDSVVPVNNVQDTTDQMEMFRIPVTINAPLQQQVFGLRLQPGLDSVFKHTLLGEILNYYAHWSGSMKLTFVFCGSAMATGKFLIAYSPPGANPPKTRKDAMLGTHIIWDIGLQSSCVLCVPWISQTHYRLVQQDEYTSAGYVTCWYQTGMIVPPGTPNSSSIMCFASACNDFSVRMLRDTPFISQDNKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN (COXSACKIEVIRUS A9)
publication title The crystal structure of coxsackievirus A9: new insights into the uncoating mechanisms of enteroviruses.
pubmed doi rcsb
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d4m300
4CEYA 1TME2 1PVC2 1POV0 4AEDC 2RS51 4SBVA 1R083 4YVSB 1RHI3 3VBRA 1NA1B 3VDDC 1VBC2 1HRV1 1OOPC 1WCDJ 1W39A 1VBB2 1X36A 2WZR2 2HWB2 1CJDA 3ZFFC 5C9AA 3ZFEC 5FMOL 5C4WC 2RS12 1VBA2 1PO12 1FPN2 2WS93 1H8TC 5CFCB 1NCQC 3DPRA 1AUYA 1RMU3 2RR13 1VB2A 4Q4W2 1RUI3 1RUE3 1BEV2 2PLV3 1QQP1 3CJIB 2BFUS 3VBFA 4Q4Y2 1HXS2 1AR83 1POV1 5K0UB 1OPOA 4IV1A 3VBRC 4Q4V3 5BNPC 1EAH3 2MEV2 1AR62 4N53A 4RR3A 4CEWC 1X33A 5CFDC 5C9AC 1AL21 2HWD3 1FOD1 2VQ0A 1FMD1 5D8AC 1K5MA 4QPIC 5ACA2 4RS5B 3JD72 4GH4B 5C8CB 2FZ2A 2XBO1 4CDXA 2RS53 5CFCC 2RS32 1QJX2 5BNNB 1PIV2 1HRV3 3VBFC 1ASJ3 2BFUL 5DDJ1 1NG0A 4IV1C 1Z7S1 5L7OC 2BBVA 4FSJA 4RR3C 4WM8C 4PDWA 1ZBE1 1HRI1 4RQPA 3J8F2 4RS5C 4LLFA 4JGYA 1QQP3 4FTEA 1V9U1 1POV3 4QPGA 2RM21 2HWE1 1RMU2 2RR12 1RUH2 2HWF2 2IZWA 2PLV2 1AR91 4YVWB 1AL23 2WLPA 3VDDA 4CDQB 1FOD3 1GFF2 1OOPA 1FMD3 1RVF1 1EAH2 1AR71 3JBG2 3ZFFA 1BMV1 1C8NA 3ZFEA 1QJZA 4NWVA 2XBO3 5C4WA 5J98B 5ABJB 1H8TA 3NAPB 2Y26A 5DDJ3 1RUD1 2RS52 1EV11 1RUF1 4QPGC 4GB31 1Z7S3 2RMU2 2ZZQA 2XPJA 5A32B 1ZBE3 1ND2B 2GSYA 4YVWC 1MQTC 4IV3B 1HRI3 2R072 5BNPA 3TN92 1QJU2 1ASJ1 4CEWA 5CFDA 2X5IB 3VBUB 2R061 2QQPA 3VBOB 1C8M1 1RUJ2 1AYM1 1V9U3 5D8AA 4QPIA 1RUC1 2RM23 1F8VA 2HWE3 5ABJC 1NCRB 3VBSC 5CFCA 1RUG2 4Y4YA 3VBHB 2TBVA 1QQP2 4Z92B 1AR93 2ZAHA 1TMF1 1RVF3 1PGL2 1VBC1 1RB8G 1AR73 5K0UA 4YVSC 1HX6A 1AYN2 1VBB1 2WZR1 4IV3C 1NA1C 5AC91 2HWB1 2HWC2 5L7OA 4WM8A 3ZFGB 1FOD2 1ZBA1 1CD3G 1VBA1 2RS11 2X5IC 1PO11 3VBOC 4CDUB 3DPRB 1M06G 1A6CA 1MEC1 1VBD2 3HAGA 4RS5A 1R1A2 1RUD3 4GH4A 1EV13 1RUF3 1VRH2 4GB33 4Q4X2 2WFF2 1D4M1 1R092 3ZXAC 1E57A 5BNNA 4Q4Y1 4RHV1 1HXS1 5DDJ2 4N53B 5FOJB 1PGW2 3S6PA 3CJIC 1COV1 1Z7S2 2MEV1 2R041 5K0UC 1R082 3IDEA 2R063 4FTSA 1C8M3 1RHI2 1AYM3 1B35B 1HRI2 2WWSA 1IHMA 1RUC3 3JB8A 5ACA1 4WM7B 1DDLA 3JD71 4CDUC 4GH4C 2RS31 5C8CC 1QJX1 1TMF3 4N43B 1PIV1 4CDWB 1VBC3 2WS92 5BNNC 1VBB3 2WZR3 5AC93 2HWB3 4PDWB 1RUI2 1RUE2 5A33B 1NY72 4YVWA 1ZBA3 1MQTA 1AR72 1PO21 1AR82 1VBA3 1PO13 2RS13 4RQPB 1VBE1 1MEC3 4JGZB 5GKAC 4Q4V2 3J8F1 1D4M3 1VB4A 2HWD2 4Q4Y3 1ND3B 1HXS3 4RHV3 5ABJA 1RUD2 3VBSA 5JZGB 4AEDB 1EV12 1RUF2 4N43C 4GB32 1COV3 4CDWC 3FBMA 2MEV3 2R043 1RUH1 2HWF1 3VDDB 1SMVA 1OOPB 2DF7A 5BNOB 1BBT1 3ZFFB 5A32A 1HRV2 4YVSA 1F2NA 1ASJ2 5ACA3 3JD73 1AL0G 1NA1A 4IV3A 4CDQC 3JBG1 1HQNA 1QJY1 2R062 2RS33 1H8TB 2X5IA 1QJX3 1NCQB 1PIV3 1NOVA 3VBOA 4CEYB 1ND3C 1NCRA 5JZGC 3NAPC 1TMF2 2RMU1 3VBHA 1TME1 1PVC1 3VBRB 5BNPB 1OHFA 1PO23 1VBE3 5BNOC 4BCUA 4CEWB 5CFDB 3CJIA 2R071 5AC92 5C9AB 3TN91 1ND2C 3J8F3 1QJU1 4GMP0 5D8AB 3LOBA 4QPIB 1ZBA2 1AL22 3ZFGA 3M8LA 1MEC2 1RUJ1 1FMD2 4NWWA 3VBUC 4EJRA 4CDUA 1FPN1 1D4M2 2XBO2 4RFT0 1RUH3 4CEYC 2HWF3 1RUG1 1NCRC 5C8CA 3VBFB 4RHV2 4FTBA 4Q4W1 1BBT3 3VBHC 1BEV1 4IV1B 1COV2 1PGL1 2R042 5L7OB 3JBG3 1AYN1 4RR3B 4WM8B 1QJY3 2HWC1 1AR61 5LK7B 1ZBE2 1K5MB 1B35A 4GMP1 2BUKA 3ZFGC 1VBD1 1R1A1 4WM7A 4CDXB 1VRH1 3DPRC 4Q4X1 2WFF1 2RMU3 1TME3 1PVC3 1V9U2 1R091 3JB4C 2RM22 2ZTNA 4N43A 2HWE2 2R073 4CDWA 1PGW1 3TN93 5J96B 2BPA2 1QJU3 2FZ1A 4N53C 1AR92 1PO22 1R081 1VBE2 5A33A 1RHI1 1RUJ3 1RVF2 4Y5Z0 4CDQA 1BMV2 1K5MC 1FPN3 4JGZA 1B35C 1RUG3 2GH8A 4JGYB 4WM7C 4CDXC 4Q4W3 4QPGB 1BEV3 1ND3A 2WS91 5JZGA 4AEDA 1AYN3 3NAPA 2HWC3 1AR63 1MQTB 1RMU1 2RR11 1BBT2 1RUI1 1RUE1 2PLV1 1NY71 5BNOA 1AR81 4PDWC 4GMP3 5FMOS 1VBD3 1QJY2 1ND2A 4Q4V1 3ZFEB 4RQPC 1EAH1 1R1A3 5C4WB 1VRH3 1VAKA 4Q4X3 2WFF3 4JGZC 1C8M2 1AYM2 3VBSB 1R093 2HWD1 4JGYC 1RUC2 3VBUA 1NCQA
chains in the Genus database with same CATH superfamily
2A6XA 2XGXA 5FLHA 3FFZA 4LE4A 4NR1A 3ZN6A 1X9TA 5ABJA 1H1IA 5HV4A 4DS0A 4SBVA 3B69A 5DG1A 3HN3A 4YVSB 2HH9A 3HR9A 1RHI3 1UX6A 2QJVA 1OLRA 4WZCA 3B94A 4ZPIA 4NAOA 5FY8A 3VDDC 2P6HA 4AXOA 5FY7A 3RNSA 3Q8CA 1WW6A 1W39A 5EWSA 1VBB2 3Q8FA 2HWB2 5FYTA 3HVDA 5FZ4A 4AVCA 2Y6JA 5FDBA 3WG2A 5A7WB 3T2OA 1MS1A 4LA3A 3E5UA 2J1EA 4B29A 1ULCA 2FCUA 3RYRA 1VBA2 1PO12 3ACIA 4QX8A 5CB7A 3WDTA 4B8EA 3VKOA 2DBNA 1HV1A 1VR3A 1FPN2 1V6IA 4KGGA 4KNCA 5FYBA 5IK7A 4NIDA 2WS93 3PL0A 1GZ9A 1DCSA 2D5FA 3AP4A 4K9SA 4W6WA 2FDJA 1IKPA 4EWDA 2P3JA 3DPRA 4HG6B 4I30A 4CPBD 4E8DA 1W2NA 2B5HA 4QD2A 4AQSA 2KXLA 4LOSA 1RUI3 2GZWA 4Q4W2 4XF3A 1ENXA 1QQP1 3ZXKA 2HEYF 3VBFA 1C3HA 4Q4Y2 3WF1A 2JD9A 5K0UB 4UWDA 1BK1A 3H7YA 4QHZA 1FI2A 3BUCA 5EXOA 5JVVA 4QX0A 3MPPG 4Q4V3 2AC1A 1C5HA 5JR7B 1EAH3 3PIGA 1UCXA 1R64A 4ZXKA 2I74A 1LHWA 4N53A 5BXXA 4ZZ5A 5CFDC 5K7PA 1KDMA 1V6OA 2P17A 2HWD3 4C8DA 3VL8A 2D44A 4MGIE 1FOD1 3DL3A 3GZUC 2V4VA 1GICA 4RS5B 2VZ1A 3POWA 4GH4B 5ACA2 1FNYA 2RDSA 4XF9A 2HJIA 3IM0A 2VMHA 4CDXA 4IXLA 4XIOA 2RS53 2BBAA 3MO4A 4AK3A 5A6XA 1UZYA 1N1YA 1AX2A 1OLMA 1Q8VA 3PDQA 4D6SA 3KHBA 2D5HA 1PIV2 3MLJA 4UBHA 5FTTC 4CXYA 2WSVA 1W3XA 2GC1A 3OTFA 1H4HA 3DN7A 4QGMA 2Q8DA 1NG0A 3MHZA 1FV3A 3SXWA 4AFMA 4ZKTB 2I2SA 3HN1A 4NO4A 4Z1VA 1ZREA 1YYNA 3LA3A 2XR4A 1DQ0A 5FKCA 5A1LA 4RR3C 5FZAA 3WD5A 1APNA 1E5IA 1S0CA 2JX9A 4Y33A 2AGSA 4QB6A 2R0HA 3NJVA 1OBNA 3VV1A 3QOPA 4ARXA 1N1VA 5CEHA 2HYXA 3JCIA 3LEIA 4QHOA 2W1SA 4FPCA 5EP9A 4CXWA 4LLFA 1LODA 4P5HA 4Q0VA 5F6LB 2SBAA 1W99A 4MHUA 3UKVA 4COWA 3D82A 3ZXDA 4JGYA 4AE2A 4FTEA 4Z2WA 4NRPA 4QXKA 1W8TA 1FAYA 1OFNA 1YFUA 3FWEA 3K3OA 1W2AX 4DZGA 5FWJA 2R30A 2YPJA 5FIXA 4CZSA 4HSLA 2ZZJA 1JODA 2RR12 4RA0A 3RRDA 5FXXA 1SLLA 1MS9A 4NJ4A 1W2UA 1URXA 2VCMA 2I45A 4I0BA 2PHUA 5LK5A 2LW8A 2XQRA 1NXD1 1QJEA 1GFF2 1ONAA 1H1AA 1OOPA 3AK0A 4OQ9A 5A6QA 4XABA 5FZ0A 5JIUA 1ZRCA 1DZQA 1C8NA 4NWVA 2R7EB 2XBO3 4LQRA 2ZGRA 4XJZA 5C4WA 4AAXA 5F3CA 5TSWA 1YFWA 3EXUA 1FNZA 1CWPA 5FQ0A 3WG4A 4LIUA 3KVAA 2DBIA 4D6QA 4NIAA 4HKWA 5LBFA 2Y26A 1OKOA 3HMYA 1UIJA 1RUF1 4P00B 3I3MA 1W0OA 4GB31 4P9WA 1YFXA 2D6NA 3T2TA 2ORZA 4M4RA 3MIGA 2N7GA 1ZBE3 2E7TA 4CUAA 4YVWC 5FPVA 4IEPA 4IV3B 1HRI3 4UFLA 4XBNA 2XVLA 2BOIA 3S30A 4B7EA 1QJU2 4XFIA 1RTVA 5F5CA 4KH9A 2VD7A 4HOOA 2AEZA 2D98A 1HV0A 4Z07A 2W94A 5T5LA 1RGSA 1POQA 2YROA 4CP9A 5GM0A 4COUA 3RZHA 3DXTA 2XQXA 2VNVA 1SLAA 5EFUA 3ZN4A 3BTYA 5FREA 2WL1A 3QD6A 3VBSC 2XLGA 4QQPA 4ES8A 2D7FA 3UESA 4Q8KA 5CFCA 3VGIA 3VBHB 2TBVA 4M3CB 5LW9A 3TAYA 2OIIA 2FMDA 3INAA 3A7QA 3MW3A 2K9ZA 5EV7A 3OGRA 5F2SA 3ECQA 5FUIA 3A23A 1REFA 1VBC1 4LBKA 4CUCA 1AR73 1H30A 1WD3A 4OQ8A 4YVSC 2VCCA 1C28A 2XJVA 1AYN2 2C5DA 1QH7A 3FHAA 4YW4A 1DGWX 2EICA 2WN2A 2E26A 3BVCA 2VOTA 4GJYA 3FLTA 5AVAA 5H9SA 5FV3A 5C8WA 1DU3D 5L7OA 4JDOA 1PM7A 2ZCWA 3O1UA 2YZ4A 4WM8A 3ZFGB 1UKRA 2WZ8A 3TNQA 4QQOA 4E4SA 5C3RA 2B9VA 5CKQA 2J1UA 5HXVA 3RZGA 3VBOC 4CDUB 3DPRB 1A6CA 1VBD2 3DEMA 5FXVA 1W06A 1R1A2 2ZGNA 5BNQA 4XDOA 1WLTA 2DCZA 2WFF2 4UBGA 2V4AA 4Z82A 5H9PA 4BQYA 5CBLA 1DZTA 5LEJA 3RZMA 4QDRA 1R092 3RZLA 4NHMA 4GWJA 5HV0A 5A7OA 1H2LA 3J7LA 4RHV1 1HXS1 1LECA 3ZYFA 3QH7A 2YHJA 5L9BA 1XJAA 4N53B 3U14A 1O4ZA 3S6PA 3CL1A 2BGCA 1Z7S2 2V5DA 3H7JA 3NO8A 2VZ3A 2MEV1 2VU9A 2R041 1LOAA 5A7QA 3VZOA 5FZMA 5K0UC 1O3QA 1BHGA 3KB5A 3UETA 1W8ZA 1R082 1LHOA 2BWCA 1W8NA 3HQUA 1OVPA 3A0NA 1AYM3 3GGLA 1B35B 1WLWA 4OUSA 5DUXA 1PX3A 2VTXJ 4Q5OA 3U4SA 2A6YA 5FZFA 1WBLA 3DUIA 1SACA 2W2IA 3N4MA 4MSVA 1TE1B 1HQWA 1XNDA 4L2NA 1ENSA 1SLIA 3D0JA 4BXFA 4UFIA 2BOJA 2PHRA 5FO7B 2WZPP 4QXBA 1XNTA 2BP6A 4GH4C 4I3PA 3VKMA 1ZRDA 5J3UA 3MF6A 1JZ3A 1GMMA 3H8UA 1PGSA 2JKBA 5FYUA 3JZVA 1HN0A 1IQAA 3SH3A 4N43B 4MGTA 4Y20A 2PAMA 1S0GA 3G7DA 5FYCA 3E97A 4GWIA 4UYBA 4LPLA 1XYOA 4YZ1A 4BK5A 3GJBA 1UX7A 1GUIA 1VBB3 1RYYA 5EZWA 5KXCA 4DUVA 5AC93 2HWB3 1L7QA 2XJRA 4GWMA 1WW7A 2JIGA 2UYBA 4OHWA 4UW3A 1JH5A 2Y0OA 3ZSKA 2X05A 1NY72 4NPLA 1ZBA3 1VBA3 2J1AA 2A73B 4FFFA 1PO13 5I93A 1VE0A 2H0VA 2VNGA 2ZMLA 3RSJA 1CIYA 1G9FA 4LKDA 1OA3A 5JXGA 1XRUA 1JHNA 2A7AA 1C1FA 2C6SA 3JXSA 4FPFA 1IS4A 1YIFA 4M3CE 4CP0A 1BCXA 2F4LA 1UYPA 4A3ZA 1W6PA 4CU7A 2DU1A 2VMEA 4QU2A 5F5IA 4A4AA 5HPOA 2CYFA 2E53A 4Q4Y3 4X6QB 1DYKA 5F8PA 4A7YA 1EV12 1WKYA 4M00A 2DYCA 5JZGB 3MIEA 1PNGA 1I1EA 5FK8A 4OHZA 5A3NA 1KJRA 1N47A 1RUH1 2VZRA 4OMDA 1REDA 1ULDA 4IEOA 1OOPB 4M4PA 4OMCA 1S0FA 2G9ZA 3HQRA 5CAZA 5DPNA 3D3AA 3J7HA 2W46A 4AFBA 4TYSA 1CONA 3AKSA 3M3OA 5BYNA 1K45A 2Q1ZB 3ZXJA 4QAWA 5ACA3 1ASJ2 1ULEA 2TEPA 1GQHA 1NA1A 3VKFC 3I54A 3VL9A 1HQNA 5JPMB 4K1YA 4BQ3A 3BYWA 2R062 1G7YA 1OQEA 3KLSA 4NOTA 4MO3M 1H9WA 4PBOA 4QKDA 5FCCA 4P5YA 5LBBA 2RG4A 2GMMA 4L8QA 2QQUA 4FAGA 1NCQB 2ENRA 4D7SA 1PIV3 5DG2A 2EAKA 5IW0A 2WNVA 2OT7A 1MZ6A 1UZ0A 3DXUA 3IN9A 3WNXA 4Q0UA 4BHPA 1ND3C 1YQ6A 5LASA 3VDBA 4ZU4A 2H6CA 2K46A 1PMIA 4H3WA 3ZIXA 1TMF2 2RMU1 3PURA 4FOWA 4OI4A 2ZJCA 4LNVA 1WMEA 4GD4A 1PO23 4DB5A 3I2JA 5BNOC 4H14A 2FDKA 3CJIA 2R071 4BB3A 1DQ2A 2GN3A 1DF0A 3CNAA 3ES4A 3M7AA 3KCXA 4NAMA 1KGYA 4HT1T 2LM3A 2DUOA 4P9JA 4O9GA 4COYA 1MZ5A 1ACCA 4XFFA 5C5TA 1IPKA 1LESA 1MEC2 1RUJ1 1YUDA 2IXCA 2PHXA 3GBGA 4M01A 3T0DA 5F39A 2ZKLA 4ES9A 1VMFA 1LENA 1A3KA 2Y6KA 1FPN1 3ILFA 4QX2A 1D4M2 1YCIA 1P8JA 4Y1VA 5D2AA 1LHVA 1UO9A 3ZX7A 5C8CA 4Y3OA 4HZFA 2QQOA 4D94A 4GXLA 3HNBM 3PVEA 3DV8A 4LBMA 2AUYA 3OJBA 1BBT3 4Q4W1 4ISRA 2AENA 3VBHC 4IV1B 1PGL1 3TOJA 1W9FA 5L7OB 1SBEA 5DUVA 1X9PA 4DXZA 1LKNA 5HCBA 4WM8B 3OF1A 2Y33A 1QJY3 1TG7A 4JQRA 2CAVA 5KXEA 2VAUA 5CADA 1ULFA 3OG2A 4LE3A 4MGQA 3AMNA 1MS5A 2J22A 5F5AA 5EJ1B 4NPMA 2WAAA 2VULA 2OZ6A 5KXDA 3N7JA 5KXBA 2WYFA 5BV6A 2ZX1A 3ZFGC 5LWBA 2GMEA 3NNFA 4XFAA 2A6ZA 2JDNA 2AH2A 1VRH1 3THTA 3WW1A 1VMJA 2ATFA 3DPRC 3N9PA 4Q4X1 4EWAA 1TME3 1PVC3 1UOJA 1QKQA 2GNBA 3MIFA 3NJZA 3D8CA 4DNYA 1JYCA 4Q29A 2QQNA 4RL7A 3SEPA 2XH6A 3POSA 2XJPA 4S2DA 4CDWA 4MXWA 4Y22A 1PGW1 5FZ8A 4F3JA 2WDBA 3E5XA 4AGRA 4KQ7A 5J96B 1LULA 1QJU3 3OPZA 4FFHA 2ES3A 1IS6A 1JN2P 4N53C 4XBLA 1E5RA 1AHSA 4INDA 2QQKA 3U78A 1UN1A 1DFQA 3CZUA 4Z8BA 2VMFA 3OGSA 3BPSA 4MHRA 5FP3A 2CV6A 4J25A 4CDQA 3JQWA 2UU8A 3N7LA 4JGZA 1B35C 4LBJA 4NHLA 4UOJA 5IT6A 3KWVA 1PX4A 2A3XA 4Y20B 2GH8A 4CDXC 3H3LA 5LBEA 1FATA 2MHFA 5CISA 1TNFA 4D0QA 1PVXA 1RITA 5GJ6A 3O1OA 1MS4A 3I2FA 5C6CA 4XUPA 4AEDA 1AYN3 4IEXA 5EJZB 4QHBA 1WW4A 3LZZA 4D7YA 5FZOA 2WA3A 1BK0A 4COZA 1H6XA 2RR11 5J36A 1RUE1 1SFYA 1H1MA 5IAXA 1O7FA 2Y6HA 2EIGA 3NMBA 1QF3A 1C5IA 1VBD3 1UMHA 1ND2A 1R1A3 1N3QA 4YPJA 2UWBA 1VAKA 3ZKUA 2BGOA 2WFF3 4ARYA 1UY1A 1R093 4JGYC 1CIWA 3MIBA 3VBUA 2YC2A 4ATEA 1LGCA 5B2GB 3VHNA 2YUEA 5FMBA 2DURA 1K5JA 3VUOA 3GF6A 4CEYA 1Z0HA 2Y34A 2XL7A 2XG3A 4LA2A 4QXHA 4EN7B 4EZHA 1R083 3AVRA 5A1AA 5EHDA 2ARBA 3SCGA 1LU2A 1NA1B 1WD4A 3FUOA 4H7LA 1VBC2 3VBRA 4B4PA 5IHRA 2ZGMA 5FPUA 1PZ9A 1OOPC 5HCAA 4XUTA 4QX1A 4LIVA 4Q0SA 4HLTA 1CJDA 4YGCA 2WR9A 3SISA 5C9AA 2DTYA 1VMHA 4JV4A 3U4XA 5FMOL 5C4WC 4WVWA 3WNKA 1WCQA 1SQ4A 2R32A 3P5BA 5CIRA 2P4EA 5D1IA 1HJGA 2ZGPA 4QPWA 4JTNA 5GZFA 1HJFA 4QM9A 3I49A 1JZ4A 1W05A 1CAXA 4D69A 1NCQC 3WVJA 2XWJB 4AOCA 4JVAA 2VBBA 5A3PA 3F95A 1RMU3 4AVAA 1BEV2 2PLV3 5IJRA 4BQ5A 4YG6A 4QKFA 3CJIB 3POIA 4XVHA 3W59A 4EYUA 1J3RA 1HXS2 3MI8A 1POV1 4CA9A 1DYPA 4BYYA 4XMIA 1IS3A 1KITA 2AYHA 2MEV2 4Y1ZA 1O3TA 2Y6LA 1AR62 1T6GC 4HMZA 4EN8B 1X33A 4LO5B 2OVUA 2SLIA 1AL21 1SFNA 3OYWA 2WFPA 5KC6A 5IVVA 3GZTB 3S5QA 2NPIA 4RFRB 5SV8A 1Q5OA 4AI8A 4LUMA 1V6MA 2PELA 1PK6A 2VNOA 1GP4A 1WMFA 3J7NA 4FPGA 3RQ0A 5C8CB 1BQPA 2JWPA 1CAVA 2FZ2A 5CFCC 1O4TA 2W47A 3C7OA 4DXSA 5K9YA 1NQDA 4LUKA 1I6XA 2VVEA 1LHUA 1Y4WA 2WWUA 4UF0A 2DTWA 5FYSA 1WA6X 5BY5A 1Q8SA 1QHDA 3FBYA 1ASJ3 1HN1A 4NUBA 4YNIA 1UYZA 5GLVA 4JKMA 1V6NA 2WKKA 3SKJE 1UOBA 4IV1C 5I0RA 1Z7S1 1LJ7A 5FZEA 5L7OC 1JYTA 1WZXA 2YFZA 4FSJA 1H0BA 1KFXL 4NRQA 1GZWB 4WM8C 3I3BA 5FZHA 3I2GA 4HONA 3USSA 2KR2A 3M1HA 3KS7A 1STMA 1F35A 4MG2A 2VZPA 4RGAA 3LEGA 1SDDB 1W0NA 3OSDA 1UY2A 1S0JA 1J58A 4LBQB 1QQP3 1ZZ7A 5FYHA 2RJKA 1DQ6A 4MXWB 1W9SA 2JG9A 3LSEA 4Y22B 3T1MA 2R49A 2EIEA 3WUCA 3HJRA 1XYPA 4QPGA 4IGOA 4U2AA 4URTA 1KRIA 4YZ5A 3MFCA 5GZEA 3POGA 4BPZA 5FYYA 3IB3A 2P3IA 1RUH2 5EYYA 2HBTA 3GDBA 4KWJA 3PJYA 1YO8A 3LKJA 1F31A 5FYZA 3WP3A 4YVWB 4NHYA 1IPJA 1DYOA 2FCVA 2IXJA 2WUHA 2WLPA 4KG8A 5FZ9A 5JI7A 4CDQB 2JDZA 1FOD3 2OZJA 3RWKX 1RVF1 1GOGA 2H0BA 5I8YA 3R0RA 1GWKA 3POYA 2WINB 5GLZA 3ZFEA 4MUVA 2J7MA 5LRSA 1D7PM 3MUY1 4GKXA 3T08A 3ATGA 4QDSA 5I0UA 2ET1A 4Z2AA 2WQ4A 3MF9A 1V0AA 1W2OA 2V73A 4WVMA 5FZOB 1GNYA 4EROA 3S57A 3L2YA 5FPLA 3NNGA 3WF4A 3D5OA 1JYIA 1EV11 1G8WA 1NZIA 3UL2A 3O1VA 1ZRFA 4PLOA 4XURA 1GLHA 4YRDA 2RMU2 4DEQA 4PBPA 3AP7A 1WMXA 3V0BA 5A32B 5KHKA 3J26N 3WLUA 1ND2B 2HKXA 1W6NA 2GSYA 2JENA 5GLUA 4BQWA 3ZYGA 2R072 4MGYE 1WUVA 1LNSA 4I02A 1NLSA 1ASJ1 1JUHA 1UOFA 2J1VA 2Q0AA 3NNJA 3WEZA 3AP9A 1FX5A 3VBUB 4BLJA 4E9KA 2R061 1F4HA 3K3NA 2QQPA 2D6LX 3VBOB 1RUJ2 3M4FA 4UFKA 4QPIA 1GR3A 4HVRA 1UPIA 2VUAA 3WZ1A 3FUQA 3I3EA 4Q26A 1NCRB 4OI0A 3QH6A 1OF4A 3WINE 2CSGA 3C7EA 3ZSLA 3CKHA 4Y4YA 2WNOA 2E31A 1W3VA 4TXWA 4IE4A 4H2AA 5JDBA 1TMF1 4I2OA 2VG9A 1ZRIA 3ETQA 4UFMA 2GMPA 4MVTA 5F2WA 1G9BA 1PGL2 4N9IA 1RB8G 1A34A 4A7ZA 3SC7X 1F9KA 3Q9OA 3T1LA 4GJZA 4E2GA 3GCWA 1NA1C 4PIZA 3GXUA 4D3WA 3MV11 4URAA 3RJ2X 3ZN5A 3DF0A 4CCOA 4QT6A 3ZR5A 4OI2A 4DEVA 4YFZA 5JSRA 4P14A 1BKZA 2RS11 4XUNA 3WR0A 3KHCA 4LLOA 1RXFA 3TEXA 2D3PA 5LZ6A 1Q8QA 4Y1UA 1MEC1 1K12A 4LJHA 5EPAA 3AFGA 2WNVC 2WABA 4YW2A 3WDYA 1JZ6A 3Q8AA 3S7IA 1RUF3 1VRH2 3D4KA 3USUA 1UW8A 3I7DA 1NAEA 1OF3A 1ZZ9A 3PVNA 1ZA4A 4GB33 4Q4X2 1D4M1 3EHKA 2VJXA 4PLNA 3P3NA 1O5LA 4LO8A 1CN1A 3MW4A 3UV9A 3LGRA 4NMIA 2JD4A 2WYSA 3AC0A 3NW4A 5BNNA 4HFSA 5FZGA 5DDJ2 2JDHA 4AGGA 1W6QA 4LTAA 4FXGB 1PGW2 2BRTA 3CJIC 1DIWA 3IWZA 2Y0IA 3OYWB 2FDHA 3BB6A 3MDPA 3C2UA 4ASMB 3IIAA 4JKKA 2ET7A 2QTWB 2PAKA 3K4AA 4HKLA 5FBZA 2AR6A 2W08A 2OA2A 3KT4A 1YEWA 4FQ4A 4LBLA 1YJKA 1PZ7A 3EQEA 4WM7B 1DDLA 1EP0A 1UYXA 2D6KA 1BLZA 4P9GA 1H6YA 4UF0B 4BXSV 4EE2A 2H6BA 5A7SA 5APAA 4ZS3A 2RS31 5C8CC 3FHIB 5FLIA 4XF0A 4ATFA 4E2QA 4HK9A 1VBC3 1LOCA 1W8FA 2I07B 2K2SA 4OULA 4C0HA 4L9BA 4E4DX 2DCJA 2Y64A 1AZDA 5L73A 3UKTA 4N7IA 3NSTA 3HPNA 1YC61 1OD5A 1RUE2 4WZFA 1YHFA 2YC0A 1NT0A 2LS6A 1JYWA 4AVTA 2BBVA 5JXIA 1MQTA 3N35A 1A78A 4AAPA 4QWNA 3HNYM 4GKYA 4YG3A 5GKAC 5F6KA 1DZRA 2WJSA 3BCWA 2VZQA 1EPWA 4CCMA 3J8F1 4HL0A 5FZCA 3MICA 5FRAA 2Y60A 2ZHMA 2ZGTA 1JYXA 4KI5M 1QXJA 2ZGSA 2DCYA 1LEMA 4RGKA 4XJWA 3BODA 1ND3B 1HXS3 3LQCA 4RHV3 1X7NA 4YM0A 1RUD2 1N1TA 3IMMA 3OBAA 4QKBA 4LBOA 3AYCA 4IETA 4CDWC 3FBMA 2MEV3 3I2KA 2R043 4K3UA 3BPZA 4EZ4A 5DAQA 5I8TA 4BZ4A 1HDKA 2HWF1 1UXXX 1LAJA 2A3YA 1W6OA 1SMVA 3VLBB 1UY4A 5BNOB 1O59A 4JTOA 3WP5A 5FWEA 3PJQA 1TEIA 4HK8A 4A6SA 1G9DA 2ZMKA 2RVAA 2ZGQA 3OGJA 1F2NA 2VOWA 1AL0G 4CDQC 1MZEA 3JBG1 4KMQA 4HPKB 5BUVA 5C5UA 2VUDA 3AL6A 2BNNA 3MFAA 1ZVFA 5JIAA 1LGNA 2VMGA 4RSUA 4E4ZA 4ZHNA 3UNPA 2VOVA 4E8CA 1EUUA 3RVHA 2YG0A 1WBFA 2X5IA 2ADDA 5FFOC 4CUGA 1K3IA 2LUWA 1NOVA 4K8RB 3NV1A 4AQTA 3TEYA 1I9RA 4YYOA 4E27A 3X29B 3ZN6B 1QDCA 1D0HA 1VP6A 1H2MA 4B1MA 1RJ8A 2DCKA 3P6BA 4DQAA 2WNEA 3E6BA 3LAGA 4KL1A 4QKNA 5FPAA 1LOGA 3ZXEA 1MVEA 2DVFA 5A3TA 1IS5A 5C7GA 3ACFA 3GZEA 5FXZA 2UY9A 2WNUA 1OHFA 3OBZA 3OEBA 4IEZA 4L92A 2W9XA 1SEFA 2YXSA 3A0KA 2GALA 4BK4A 5JOXA 1SLBA 3APBA 3BU0A 1YXWA 5FAXA 1J84A 3MYXA 3I2OA 3TN91 1ND2C 3KQRA 1GBGA 1OA2A 3NRUA 4O65A 5L9VA 4ZXEA 2BJSA 5FPBA 2ARAA 4QB2A 4QPIB 1AL22 1EYBA 3VDCA 2AACA 3M8LA 1HLCA 2WT0A 2UY8A 2XJUA 1XE0A 3VBUC 3VD4A 3A21A 4XETA 2VVDA 2QQIA 3JQXA 5IYYA 2GNMA 1RUH3 1UZZA 4CEYC 5C71A 2DVBA 3LF7A 3KV9A 1NCRC 2YDEA 3FC0A 5FMDA 1JOJA 4HN0A 1PHMA 3VBFB 2XKOA 1GOFA 4FTBA 2XJQA 2F4PA 5F3IA 3WHUA 1BEV1 3B93A 3KV6A 5IVJA 1COV2 2IVIB 1O3RA 1OXCA 1TVGA 2BEOA 4C91A 1OUXA 4RYDA 5FZ1A 2VZTA 4OHXA 4V2VA 1AR61 1UQXA 3ASIA 2RV9A 3IPVA 3H8XA 4HETA 4RD7A 5L36A 2J1SA 5A6YA 3U11A 3OY8A 4K7JA 1QMJA 4ASKA 3USUB 4GMP1 3VN4A 1QEXA 1SG3A 4W65A 3CHXA 1S2EA 2Q1FA 4P9IA 1IGOA 1AJKA 4AFDA 4CDXB 2NP0A 4BIFA 3OCPA 4M0NA 1J59A 2FDIA 5FP4A 5GLWA 2RMU3 4MOAA 1VLNA 3O14A 5GZDA 1UY0A 1W04A 1W6QB 3T0BA 2ORXA 4D6RA 3CLPA 2LTNA 2ZEWA 1JW6A 3LE0A 3W20A 5L19A 1L3JA 2R073 3EMRA 2OQ6A 5DAPA 4BOWA 4G4FA 3IMNA 4N8MA 2OS2A 4L99A 4AWDA 2BPA2 2FZ1A 1VRBA 4NIGA 3DYOA 1WCSA 2G19A 3AKPA 5CVRA 5L9RA 1RUOA 1MS3A 1Q8PA 5T52A 2GP5A 1VBE2 4YGBA 5A33A 1IZ3A 1RUJ3 1UAIA 2ADEA 1RVF2 2G9FA 3W5NA 3RS6A 3I3DA 3N3HA 4DXRA 4IL7A 2QBXA 3J7MA 4QGNA 1FPN3 5J1XA 2VY0A 3ZSMA 2PHWA 2XONA 2UYAA 1BJQA 4ASLA 3NKTA 4JGYB 1BYHA 4WM7C 4XIKA 5JSOA 1LRHA 3GBFA 4TTGA 4CU6A 3SHRA 4D8MA 4JCKA 4Q4W3 3AYDA 3AMHA 1ZX5A 3ON7A 4XW3A 1PNFA 4JHZA 4I0WB 1FT9A 4OZOA 2NMOA 1PMHX 3GCXA 2BDRA 4MYEA 1CPNA 2VQAA 3NAPA 5JR2A 3AM2A 3K4ZA 3AZVA 3I8TA 1MQTB 1MPXA 2DUQA 3FHQA 4V2WA 3M2MA 4M0HA 4R52A 2EIBA 1LU1A 2R16A 2ZHNA 5FJHA 4YARA 1LGBA 4AI3A 3W9AA 1AR81 2OKXA 2WIIB 3LEMA 4QDQA 2D6PA 4AVBA 5J09A 3ZXLA 1JU4A 2UWCA 4RN5A 3V64A 5C4WB 1VRH3 4W6XA 2BV4A 5FUPA 4CCLA 4Q4X3 5FQ0B 1W2TA 3MPBA 4QMAA 3CEWA 5IVBA 4O61A 3CDZB 1E5HA 3PUAA 1JHJA 1CR7A 1TNRA 2QQJA 3B3QE 3ABZA 1NZCA 2VTXA 2XUMA 5I0TA 4FFIA 1SDWA 2BW8A 4XXPA 3U10A 5GZCA 2YBPA 1AF9A 4FOYA 4CUBA 2Y38A 1Q8OA 4F83A 4XE9A 3S0MA 3KQ4B 3POFA 2WN3A 1JOBA 2ZS6B 4LULA 3KMHA 4LHNA 3ZPYA 3V0AA 3WQ1A 3H1YA 3JU9A 1DG6A 1M4WA 3WDVA 4CU8A 2W3JA 4LBNA 1HRV1 4XAAA 4XDQA 1JZ7A 1WCDJ 4IEQA 3BN6A 3I3QA 2DUPA 2XVGA 4AW7A 2ZMNA 3FL7A 5LBCA 5IVEA 1G9CA 1D2SA 1OLME 5FOBB 2IXIA 4CP9B 3ZFEC 1UZWA 1O91A 3H50A 3WSOA 3B9IA 3RFRA 4CCCA 1QDOA 2PA7A 4R9CA 1J1TA 2RS12 2PHDA 3I59A 2NZ9A 1N3OA 2B39A 2NM1A 2DVDA 3AZXA 5IWFA 5FPXA 1CX1A 1GP6A 3ZPOA 2LROA 3VZJA 1XNBA 5CFCB 1BXHA 2DFBA 2R0FA 2EF6A 5JOZA 2W92A 3M3EA 4TLFA 2RR13 1FV2A 1RUE3 1MS0A 1NLQA 3ACHA 1G9AA 2DWRA 2BFUS 4FAHA 3IZOA 2AREA 1PM4A 1S4CA 1FYUA 1OPOA 2Z4FA 2GN7A 5A70A 1C1LA 1ZZ6A 4P9XA 5LB6A 1OA4A 3PMEA 2WZEA 5LCWL 2OX0A 5AFBA 4RR3A 1XU1A 1OD3A 4IEYA 1UMZA 3HNMA 4KU8A 1IKQA 5HCFA 1CQ9A 5IVYA 1ODMA 3VZKA 4I0AA 4MGSA 4AHYA 1UIKA 4Q0QA 2QQMA 1ZA7A 2BZDA 1UL9A 4YM1A 1FMD1 4CP1A 1GSLA 1K5MA 3LCPA 4QPIC 3ZDSA 4DOUA 1GWMA 1RJ7A 5BNNC 4QU1A 4R9AA 2OQ7A 2W68A 2Q5TA 1QJFA 1A8MA 1XC6A 3FLPA 4Q8LA 2CWMA 4LHLA 4R9DA 3WF0A 4GZ9A 3GM8A 2OYZA 3GNEA 3ME2A 4LORA 5FZIA 2RS32 4DFSA 4XFHA 4JQTA 5AVPA 2JECA 1ULGA 4A45A 2FHRA 3ZR6A 4AZZA 5IK4A 2QZ3A 1GWLA 1XYNA 3W5MA 3LEKA 3O7OA 3BOPA 3O1TA 5FZ7A 3VBFC 1ODNA 1UXZA 2DV9A 4JRLA 4P9YA 5DDJ1 4AEJA 3KF5A 2YBSA 1V00A 2W0XA 1VALA 3K4DA 3S7EA 2DVGA 1GOHA 2YPDA 2MNGA 4PDWA 5DAXA 3SH4A 2VNRA 3T4VA 4OHYA 5DZFA 1SHWB 4R9BA 2ZGLA 4RQPA 5C70A 2P3YA 5T5OA 3UJOA 3J8F2 2Q30A 3WQBA 4KU7A 4ONUA 3B02A 4B3NA 2QCSB 2JE9A 1QOSA 5DXDA 1XSRA 4LK6A 2BGPA 1SCSA 2W95A 3T3YA 1V9U1 1ZZBA 4I3GA 1LOBA 1POV3 3N36A 2RM21 2HWE1 5I8SA 4LOTA 4MGKE 2DDUA 2O1QA 3CU7A 4C90A 2O8OA 4XTMA 4Q2FA 1O3SA 2HWF2 2OUHA 3T2QA 3UKNA 3WNLA 4BQ2A 1LHNA 3OPWA 1AR91 5KHJA 1AL23 2Q1MA 3FN9A 3QCWA 4Q1RA 4Y1XA 1KD7A 4NHXA 1JYVA 2ZEXA 1EAH2 3GHMA 4A6OA 4JAAA 5A3LA 3JBG2 5JMOA 3JUUA 3ZFFA 1XE8A 4AHZA 1VAMA 2BU9A 5C33A 1QJZA 3NKGA 4ORFA 1W6PB 2UWAA 4DIQA 2XJSA 3O0VA 2IXKA 3FX3A 3FE5A 4CRQA 1OI6A 2GNTA 2VXRA 1OH4A 1H8TA 3NAPB 3UGHA 4NVPA 3WY6A 5BPXA 1XBFA 1CESA 3N9OA 5EYXA 1RUD1 3PVOA 2QNKA 2RS52 5DN2A 1YQCA 1RC6A 2CGPA 3BTAA 1Z7S3 4YZ4A 3KV5A 3THDA 2HLEA 2PQSA 2ZZQA 3AYEA 5IFPA 2GDFA 4LKSA 2E32A 4XQDA 5CA6A 2XOMA 1MQTC 3F2ZA 2VR4A 5BNPA 4QQ2A 5SV5A 1Y9GA 4TN7A 1I5PA 5IVCA 3TN92 3URFA 3VDAA 4CEWA 4LHSA 2NLRA 3BGAA 3U1XA 2D6MA 2PQQA 1C8M1 3G6JB 2VECA 2D3RA 5C3PA 5KHHA 5D8AA 3WX5A 2WNVB 1SPPA 3PNAA 1OVSA 2AEYA 1RUC1 5C3SA 2NYYA 4PF5A 1F8VA 1W9YA 5ABJC 1YQ8A 1YRZA 2VCBA 3POBA 1HQLA 5A6ZA 5FY0A 1SBFA 2C4XA 3KCCA 1D2QA 1S0BA 3DYMA 4IGPA 2YBKA 4YG0A 2C26A 2VUJA 2BYVE 2A6WA 2BNMA 2V72A 2ZAHA 1Q3EA 2VMCA 4P02B 1SFPA 4R4XA 3ILNA 1RVF3 2V09A 3EO6A 3I2IA 3LDBA 1QH6A 5FYVA 5K0UA 5B4NA 3NNLA 4DPNA 4ISQA 2WZR1 4YW7A 4EN0A 1DGWA 1LB2A 1GKBA 3H0OA 3DECA 3N9QA 3I59B 4AEKA 1KQRA 1NYWA 4YW6A 4CSWA 2CTVA 3UGFA 2FD8A 2BWAA 5F1RA 2X5IC 1CD3G 4XF1A 2G1MA 3THCA 3ZYHA 3N9NA 1C57A 3I2DA 4QQHA 3MV01 3HAGA 1AXZA 4RS5A 3W21A 2ZKNA 4GH4A 1EV13 1Q43A 1CJPA 1JI6A 1V6JA 2P5BA 3AZZA 4HANA 3UGGA 4DY3A 4CXXA 1LOFA 2YGLA 4IE6A 2CHHA 5FZ6A 3ZMNA 3WUDA 2CU5A 4YLZA 3ZXAC 1E57A 5FYMA 4AGVA 3GZAA 4HKOA 2C9AA 5E88A 2WNUC 4JC1A 2B8MA 1JOPA 3VD5A 2W5FA 1OKQA 1NE6A 1W8UA 4DO0A 3R4UA 1COV1 5FLJA 5FZDA 4CCKA 3I2HA 1LR5A 4AVSA 3FZ3A 4QGLA 1R1ZA 4PIXA 3KT7A 5ANNA 2R063 4FTSA 5E6HA 4Q1PA 3IIIA 3BIEA 5CYYA 1Y9MA 1HRI2 2WWSA 4QXCA 3WNOA 4C1WA 3ZO0B 1IHMA 2WSUA 2EXIA 2X09A 2VL4A 3JB8A 1OH3A 2WWJA 1F5FA 3JD71 4PI2A 4W50A 4YSFA 4GAZA 2VMIA 4FPEA 1ALYA 5H9RA 3C7GA 1W8WA 1QOTA 1NE4A 1XPWA 1QJX1 1TMF3 2ARXA 2JDUA 3UK9A 4DRVA 1DP0A 3KVBA 2ZGOA 3LDKA 1YNAA 3KSCA 4FPOB 4CDWB 3NV3A 3O0XA 1VJ2A 4AHXA 1BZWA 3WOGA 2RDQA 4BH9A 4BQXA 1AJOA 1OQ1A 1ZNPA 2W39A 2Q4SA 4E2SA 3ALQA 4PDWB 4W4ZA 2G4IA 1Y7BA 1S2BA 1S55A 4RQPB 2RS13 1AR72 1AR82 2QDNA 1VBE1 1AX1A 2WO2A 1MEC3 4JGZB 3PTRB 3NNMA 4GULA 5DZGA 5FZKA 1D4M3 1GZTA 1YFYA 4META 5CKMA 3WDUA 1IOAA 1VB4A 4JDMA 1C4RA 3IBMA 4UW5A 3SKVA 4DMIA 1OPMA 2GC0A 1WA4A 5IUQA 1JZ2A 5ISLA 4ZONA 3KT1A 5FP7A 4TWTA 4N9HA 5A80A 2F6BA 3R6SA 4XUQA 4AEDB 4YM2A 3K51A 3B00A 3PMSA 1GANA 2EXHA 3VZNA 2Z69A 2FBEA 1GP5A 3PLQA 4AI9A 1H2KA 2BVVA 1X8EA 5T50A 2DF7A 1CVNA 4QX7A 5F5QA 3PIJA 4XPVA 5FP8A 2BERA 3LWCA 3RZZA 1BVP1 1I5ZA 5E89A 4L0PA 3ZFFB 4FPJA 1HRV2 2F17A 1T2XA 3H3ZA 4PLMA 3AP6A 3AZYA 2E51A 4IV3A 5F3EA 1EUTA 4BMBA 3W58A 4YGEA 4FO9A 3CBNA 1KFUL 2ZGUA 1CPMA 1F15A 1YWKA 1ZRRA 2XLAA 4AQ2A 4BE3A 2RS33 4IEWA 4QM8A 5T3NA 1IQDC 1H8TB 3A22A 2D40A 4IW3A 2TUNA 5LATA 1GNHA 3L9JT 4FPYA 4YW5A 4Y1YA 3WP4A 4CEYB 5F7UA 2CDPA 2JJ6A 5FY9A 4F8AA 3AYAA 1N1SA 3DKQA 4JKLA 3NAPC 4AFCA 2W1WA 2B4KA 3VBHA 4M3CA 4Y26A 1AVBA 2L9LA 5FY1A 4EWEA 4AG4A 3VBRB 5BNPB 3M3QA 4NIHA 1RIRA 4MLOA 4WBBA 2EAAA 3WT3A 2B9UA 1XE7A 1U5ZA 2E33A 2B42B 2PTMA 3CZJA 4PJYA 4CEWB 2WRAA 5AC92 2YB7A 4KWLA 5C9AB 4LK7A 2XXZA 4I01A 1SCRA 3J8F3 3ETPA 3T4HB 5D8AB 3WNNA 4OHVA 3ACLA 1MS8A 1SPPB 1ZBA2 3E1F1 4XYXA 5DQ0A 3O1RA 4XOGA 5HI0A 1S1AA 4XXAA 3ZFGA 5JSPA 1B09A 1DQ1A 1FMD2 2E7QA 2C9KA 4NWWA 3RDIA 1RXGA 3PUIA 4XQ4A 3RWNA 1CAXB 3AB0A 3C8XA 2CL2A 2YGMA 4XAEA 2ZAAA 4CDUA 4EJRA 2DVAA 2XUEA 2HEWF 5T5PA 4CVUA 5F37A 3HT1A 2JIJA 2ZX0A 5KBFA 1DQ5A 1RUG1 2HWF3 4ET7A 3RI8A 2ERFA 2X8KA 5FKBA 1DLCA 4QB1A 2PMWB 3RYPA 4PT6A 2PAEA 4BJ0A 4XC9A 3OUHA 1PMJX 1LEDA 2J1TA 1M06G 1ZZ8A 1SLTA 3JBG3 3O12A 2ZX4A 1LCLA 5GALA 2D93A 1H8VA 2HWC1 3CQOA 4KWKA 3MIHA 4GWNA 5JXJA 2ZPXA 1OURA 1CZTA 3LFMA 3SCHA 1ZZCA 2ZABA 3CO2A 5A7NA 3UJQA 1B35A 4W8JA 1J83A 1MACA 4J6GA 4TLGA 2RDRA 2BUKA 1OUSA 1PK6B 4LEJA 4XHXA 1HB3A 3RPQA 1CAVB 1CZVA 2QUOA 3AX4A 2E63A 4CCDA 4XACA 4PIYA 1WCKA 3IT8A 3H9AA 1V9U2 2D6OX 3UYJA 1OQDA 1UU5A 2IVJA 3JB4C 2O14A 4IESA 3TNPB 2RM22 2ZTNA 4N43A 2HWE2 4HN1A 4JHTA 3WP6A 3ROUA 1DHKB 2YFUA 3U07A 1A8DA 5G05L 3TN93 3AL5A 3NV2A 4AL9A 4IUGA 2OXBA 4CCJA 1AR92 1PO22 4AQ6A 5LA9A 1WWYA 2BTVC 2CDOA 5FXWA 3EJKA 1AXYA 3H1MA 1RHI1 4H7MA 1W90A 1KS4A 4OVEA 4XMAA 4C0BA 4Y5Z0 5I0SA 1UOGA 2ILMA 2QVSB 1DGRA 1K5MC 3BOWA 3MW2A 2JDYA 2VQUA 5IK5A 5LA2A 3H42B 5FR3A 2YC4A 3SCFA 2C1FA 2EXJA 2JE7A 2JG9B 2VE1A 3U37A 4QPGB 1BEV3 3ZXFA 2GNDA 4CU9A 3GJAA 2ETEA 1WW5A 1ULPA 4XFCA 3R4DB 4UW4A 2WS91 3E6CC 1CAWA 5JZGA 4GQ7A 3ILRA 3THPA 1H2NA 2XWBB 4ZU7A 3I4IA 1NKGA 2CY6A 4BMEA 1AR63 2ZA9A 1BBT2 1RUI1 3T30A 2ZX2A 4XHBA 4S2GA 5AFEA 3KGZA 3VD7A 4CCEA 1DLLA 4PDWC 4GMP3 3K46A 2VTFA 3IDAA 5FZBA 1UF2C 4N7UA 3VZLA 1IG3A 1QJY2 3GALA 4Q4V1 3ZFEB 4RQPC 1EAH1 3O1PA 5F9TA 2XDVA 2WQZC 1Q56A 4LR4A 2XLFA 3HIFA 4JGZC 3E6DA 5I91A 1C8M2 3PU3A 1EPZA 4S2FA 2HWD1 2VQTA 1CAUA 4Q0PA 3ST7A 1RUC2 2CGOA 3MIDA 1NCQA 4QQLA 4WVMB 4XZUG 5CZKA 2QKDA 5EQUA 5JOWA 3HQXA 3EYPA 4BDVB 1MVQA 2C24A 3RMYA 4BLIA 3KCYA 1QGLA 4FT8A 2HYKA 1O8PA 1PVC2 1POV0 1TME2 5JLVA 2QDRA 4RGGA 5EJ3A 2RS51 5CNAA 4AEDC 3V0BB 4BQ1A 1VAVA 2FMYA 2K0GA 1W6NB 2IUWA 2JG8A 3ZMOA 3VD3A 1UY3A 3MEPA 2GU9A 4EN6B 1X36A 2VZSA 2GP3A 2WZR2 3LIGA 4MH0E 5CG8A 3D6EA 4BM8A 4XCBA 5T55A 1LTEA 3AKQA 5DUUA 1F4AA 4HXCA 3ZFFC 2JKXA 5FO9B 1V70A 1GQGA 5K8SA 4LITA 5FP9A 4Y24A 5FBJA 5KC5A 3BIWE 1YJLA 4AR2A 3LOIA 2JE8A 3ZXGA 3HEIA 2VZOA 2KM2A 1H8TC 1Y9QA 3AJZA 1MZFA 2ZXQA 2IWGB 3J4UH 3OBRA 4FCAA 2VW1A 3VD9A 1ZM1A 4FI9A 3POJA 2XL9A 2ZACA 1AUYA 2VOKA 4AI2A 3K77A 1VB2A 2JICA 2RJ2A 4FFGA 1GV9A 1Y3TA 3BALA 5CG9A 4L11A 4XTPA 2X10A 1W8OA 4GA9A 5IVFA 4Y5SA 1AR83 1JMUB 4FVVA 2A71A 2KD7A 2YU1A 4IV1A 1TZOA 3VBRC 4BIOA 5BNPC 1XOYA 2Q8OA 1SLCA 4J1WA 2HBUA 1UZVA 4CEWC 4AI1A 3FLRA 3HT2A 5C9AC 3SNMA 3N7MA 3HOBA 2O8QA 3UT0A 1SBDA 2XB6C 4X8NA 3SEEA 2VQ0A 4FP2A 1JBCA 4IGQA 4K40A 5D8AC 3T2PA 4BA6A 3JD72 4IERA 2WLQA 3ZLIA 4O9EA 3POEA 3K48A 2PXJA 2XBO1 2TNFA 4MXVA 4ZS2A 3LD8A 5J37A 5A3MA 1QJX2 5IFTA 5BNNB 2RHPA 2PN5A 2XHNA 1HB2A 5LA1A 2LALA 2QQWA 3PVBB 4FOVA 1HRV3 3ZKYA 1W0PA 4A7KA 4GALA 4OFGA 4LO4B 4DUWA 5HCHA 3PUSA 2BFUL 2EVXA 1XXNA 4X6RB 3RZJA 4CYDA 1YLLA 1V6LA 2BVBA 3V56A 4A41A 3BKZA 2P37A 3V65A 4P9LA 5H9QA 2IXLA 2AZ5A 4A3XA 4IEUA 4XFGA 2XMLA 1ZBE1 2Q8EA 1E5SA 4XDPA 5A3OA 3ENRA 1HRI1 4HVOA 3KV4A 1O8SA 2CWSA 1JS9A 1OLQA 4RS5C 4OI1A 3U75A 3LDRA 2QE3A 4LKEA 3DKWA 1PK6C 4QX5A 1HW5A 1GYKA 2D43A 4AVVA 4YM3A 4NPRA 4UI9L 1LOFC 1D4VB 4YFWA 2A1XA 3AFKA 4MX3A 5A7PA 1ZYBA 3WHTA 2P2KA 4DINB 1NLRA 1W9TA 1L7LA 4FP3A 4OCTA 4FBFA 1QIQA 3T0AA 3B5LB 3U0ZA 2VW0A 1RMU2 1X82A 2JDKA 3FJSA 2IZWA 2R1DA 4OUMA 1J3QA 4XJ9A 2PLV2 2YU2A 3LB9A 1UYYA 2E9QA 3RGBA 3Q8EA 3VDDA 2R6QA 2VMDA 1UMIA 3WCRA 5A3UA 4OZXA 3TRSB 1Y43B 3C7HA 1FMD3 2OUJA 5DAVA 3I97A 1HB4A 1KJLA 1S0EA 1AR71 1XNAA 2O0OA 4MV2A 3WDXA 4PQQA 1BMV1 3VKLA 2FDGA 5T54A 1QWRA 2ZX3A 2GC3A 3N9MA 4KG0A 4NE9A 4AF9A 2VPVA 1U5XA 2W91A 4AI0A 3IDBB 2Z2SB 4XJAA 1OSGA 1GU3A 5ERLA 5J98B 5ABJB 1CAWB 3AZWA 3MUZ1 2BNOA 2OW4A 1QXPA 1YQ5A 2KA3A 3PHMA 1AXKA 2JG9C 5DDJ3 3N9LA 3TYJA 1KEXA 3Q8BA 1F5JA 4QPGC 1G86A 2QQLA 1W6OB 5LY1A 1OMIA 1HIXA 3MGUA 1OFSA 3CF6E 4NRMA 5FJKA 2EIDA 3VB9A 2XPJA 3J9SA 1QOOA 3R4SA 1YI7A 4Q27A 5DAWA 2VGDA 1H4GA 4ZY9A 1GZCA 1X50A 4G9SB 4AEMA 3O5SA 1XB9A 5FPZA 4XF4A 3RYKA 5LEKA 2P3KA 3MBWA 2VUCA 5CFDA 3D0SA 4H55A 2W87A 4OLLA 3AXEA 1CAUB 2WBKA 2X5IB 1XQNA 3ELNA 3TWIA 3HD8B 4YGDA 4IDZA 1CX4A 1AYM1 1U5YA 1V9U3 1RINA 2VBDA 2J1RA 2WO3A 4V1PA 3ZSJA 1REEA 1AX0A 2VOXA 3N7KA 4B7KA 1UWWA 2FQPA 2RM23 2HWE3 4MZUA 4XUOA 5E16A 2J42A 1UD1A 2CGNA 3QACA 1RUG2 3VKNA 1UU6A 3RG0A 2GC2A 4UFHA 2JG8B 4XCAA 1QQP2 3MLLA 3ZDVA 4Z92B 2WA4A 1AR93 2ZHLA 2WNUB 3OGGA 4Y5TA 4QPYA 5FYIA 5IK8A 4B4QA 3B7MA 1TQ5A 4G3YC 4PCRA 3ORJA 1XU2A 4O7XA 1GQPA 5E1RA 5FUNA 3VZMA 4AYUA 1HX6A 3C7FA 1W8HA 1VBB1 4IV3C 5AC91 2HWB1 1ENQA 2HWC2 2DFCA 2A5ZA 2B7YA 2QFEA 3GBWA 1FOD2 2WT1A 3GHNA 2VW2A 1DGLA 4LHKA 1US3A 3SH5A 1ZBA1 3WW2A 1VBA1 5JAXA 2FDFA 1PO11 1JTZX 1MR5A 3LA7A 3PU8A 2EXKA 2JDAA 3RI9A 2WQ8A 1RUD3 2IXHA 3P1IA 2WAOA 4LMFA 5FMCA 3KD4A 5A1FA 5KWRA 5G04L 4DUXA 1VIWB 5F3GA 4EN9B 2VXJA 4Q4Y1 3P3PA 3PUQA 5FOJB 5FK7A 1O5UA 4D7TA 3ZYBA 1IG0A 2YV8A 3WDWA 4IQPA 3IPVB 2PFWA 1L7RA 3T09A 3A4UA 3IDEA 2VH9A 3PUHA 3RMXA 2CNAA 3OUIA 3WNPA 1C8M3 1RHI2 3OY8B 4PI0A 1W28A 1GZWA 1RUC3 3HBKA 1QU0A 3OD0A 3LPGA 5JPNB 5JUVA 1NUKA 2XHKA 3H3UA 3KGLA 5DZEA 5ACA1 1D0GA 2A75A 4FOQA 5KR7A 4CDUC 3BTZA 4J1XA 3NQHA 3OB8A 4SLIA 1XSQA 5F32A 3SQOA 3WNMA 1J3PA 5FZ3A 1JYNA 1W6MA 3ITQA 4LBQA 1PIV1 4PHZA 3NWKA 1O4YA 2PYTA 1OT5A 4JDNA 2IFWA 2WS92 2Y6GA 3HBZA 1QY4A 1SZBA 4GIQA 4MGZE 2GH2A 2ID4A 4K1ZA 4P08A 5CU1A 3VHOA 3SMHA 2WZR3 4BQ4A 5KHIA 2IC1A 3O0WA 4LXLA 1JZ8A 1RUI2 5A33B 2VC9A 2VZVA 2PHTA 1LOEA 3WG1A 5E8AA 4YVWA 4YW3A 1PO21 5JXHA 3SLIA 2P1BA 2WC2A 3C3VA 4EV0A 5I0DA 5T5JA 4Q4V2 3DGTA 4A42A 2NQYA 4A2UA 5JCTA 1KS5A 4LKFA 1XNKA 2XKPA 3TBDA 1YIPA 3IKWA 3FMGA 4E4HA 3WW3A 2NMNA 5D21A 2HWD2 3O1MA 1NQJA 4IE0A 4UT5A 4Y4RA 1DQ4A 3CIHA 3OBTA 4U36A 2C0ZA 3VBSA 1RUF2 4N43C 3WV6A 3QBQA 1W9WA 1KDKA 4GB32 1COV3 5HBAA 2VM9A 3H8RA 3VDDB 3AKRA 4HVQA 2OPKA 4ZZ8A 1J1LA 3ZSEA 3M3CA 2DU0A 2IFRA 4HBNA 4KWUA 2EALA 4WV8A 5JMCA 4LBQD 1RUNA 2RDNA 4COVA 1BBT1 5A32A 2VBPA 5IAVA 2Y8KA 3AJYA 5J48A 4YVSA 5J7MA 5M0TA 4PF1A 3EB7A 3LIHA 3JD73 2CAUA 4CE8A 3KF3A 5KHGA 4TSVA 4B1LA 4XBQA 1PZ8A 3TEWA 1QJY1 3WXPA 2P6CA 3M70A 3WF2A 4CP2A 2JB8A 3NV4A 4BU2A 1QJX3 3LSDA 3OGVA 4K20A 4LO6B 5A7WA 1JUIA 4XQWA 3VBOA 5DMYA 4CCNA 1W03A 3PTYA 4R4ZA 1HKDA 2JDPA 2JDMA 3WG3A 2P34A 3B9CA 5IATA 3K75B 4UAPA 1BVVA 1NCRA 2E7AA 5JZGC 4K21A 3CMGA 3R05A 3SITA 4W6YA 4AFAA 4I09A 3V0AB 4K8FA 4KBBA 1TME1 1PVC1 2VO5A 3M3IA 2YYOA 2ZBJA 2B45X 4FPLA 3IDCB 3RJRA 4L97A 1VBE3 1H9PA 1ULOA 3CJXA 4YZ3A 4BCUA 5CFDB 2G9GA 3ACGA 3VHPA 4YZ2A 3GYDA 5GLTA 3S5AA 3KZ4C 3OEAA 5B4XA 1S0IA 1HB1A 2ZEYA 1QJU1 2ZOEB 3FFQA 1US2A 4IEVA 5DUWA 4YWAA 2JB4A 4GMP0 4CTEA 3LOBA 1GNZA 1CGPA 1U0AA 2PHLA 1WCUA 4YW1A 4FPHA 4X8PA 5K4LA 3O1SA 2LRPA 3B01A 1QNWA 1WGPA 3DYPA 4TZDA 3LPFA 3IAQA 3ZYPA 4XEZA 1UPSA 2FCTA 3AKTA 4IE5A 1UKGA 2XBO2 3E5QA 4RFT0 1JXNA 4LT5A 4JX0A 4BISA 1X8MA 2Y6FA 2Z79A 2HEVF 3AMMA 3AMPA 5FO8B 2X29A 2ARCA 2XVKA 4R8HA 4RHV2 1WMDA 2YMZA 2DCTA 2ZEZA 2ZGKA 4BWOA 2JG8C 3WCSA 4NN0A 2R042 4DY5A 1YI9A 3MLKA 3TEZA 1AYN1 4RR3B 4XZPA 4XFBA 4XJ8A 1WLCA 4DRRA 2RJLA 4UXAA 2W1UA 1K42A 1Z78A 3AMQA 5LRRA 2JEMA 5LK7B 3EBRA 2A3WA 3ZIWA 1ZBE2 3MZHA 1K5MB 1YQ2A 1S0DA 1NX9A 1KXGA 1U5IA 3L2HA 3OD4A 4FPKA 1VBD1 4C1XA 4N90A 1N3PA 3HWJA 1R1A1 4FXKB 4WM7A 5JOYA 4XILA 1QNYA 2Q8CA 5C3QA 4XJUA 2WFF1 3QLQA 5FY5A 4MADA 2MPFA 2D97A 4DXTA 4A44A 4KBZA 1R091 2QQVA 3AXDA 3BTXA 2R1BA 3KM5A 4OUEA 5FY4A 3WQ7A 2YY1A 4OYUA 2WO7A 4QX3A 2ZHKA 1ST8A 2EA7A 1U12A 4K6BA 4EQVA 1RL3A 4NIIA 4IE7A 3BI3A 5HXMA 2V5YA 2VZUA 4ITCA 4HSJA 2VCAA 4AHWA 2W52A 2A6VA 1R081 3AVSA 2WO1A 3OOXA 1T6BX 4NROA 4NHKA 1V6KA 3ES1A 2WT2A 3ZYJB 3IAPA 2GAUA 1S2KA 1BMV2 4UW6A 4B4RA 1IPSA 1W6MB 2OPWA 3LA2A 2NN8A 2A70A 2PHFA 1RUG3 1O6UA 5JI9A 2JXAA 1FXZA 3NVCA 3WQ0A 3AP5A 2UURA 5FZLA 5EIYB 3NJYA 3WF3A 5JWPA 4WVZA 2B46X 5DABA 1JZ5A 2XJTA 4PQ9A 1WLDA 1UNBA 1DBNA 1ND3A 2VVFA 2E6VA 2Z42A 3BU7A 5A3WA 5LA0A 4UFJA 1NXMA 3ZYIB 4WVVA 4JRAA 3H1WA 5ANQA 2HWC3 5C3OA 1RMU1 3ZM8A 1OC1A 1UU4A 3OUJA 3H8OA 1QXRA 3OPTA 3RZKA 2PLV1 1NY71 4ZU5A 5BNOA 3NL1A 2Z5WA 4F7ZA 3NJXA 1ENRA 1XNCA 5FMOS 1CZSA 5LY2A 3TB0A 3WW4A 3VHRA 2BQPA 4KGQA 4JZRA 1DGRN 4HPKA 2X53S 3ZVXA 2W1QA 4CPBA 2RE9A 1I3HA 3DCQA 4M3CF 5GZGA 2D3SA 1VPHA 3ZOIA 1JU3A 1AYM2 3VBSB 4FQZA 4LO7A 1G6NA 1EY2A 4S2HA 3ZYRA 3LFIA 3K2OA 5CKNA 2QZ2A
chains in the Genus database with same CATH topology
2A6XA 2XGXA 5FLHA 3FFZA 4LE4A 4NR1A 3ZN6A 1H1IA 4DS0A 4SBVA 3B69A 5DG1A 4YVSB 3HR9A 1RHI3 1UX6A 2QJVA 1OLRA 4WZCA 3B94A 3VDDC 4AXOA 3RNSA 1WW6A 1W39A 5EWSA 1VBB2 2HWB2 4AVCA 5FDBA 3WG2A 1MS1A 4LA3A 3E5UA 4B29A 1ULCA 3RYRA 1VBA2 1PO12 5CB7A 3WDTA 4B8EA 3VKOA 4KNCA 1HV1A 1VR3A 1FPN2 1V6IA 4KGGA 5IK7A 2WS93 1GZ9A 2D5FA 3AP4A 4K9SA 4W6WA 4EWDA 1IKPA 2P3JA 3DPRA 4I30A 4QD2A 2B5HA 4AQSA 2KXLA 4Q4W2 1RUI3 2GZWA 4XF3A 1ENXA 1QQP1 3ZXKA 2HEYF 3VBFA 1C3HA 4Q4Y2 5K0UB 1BK1A 3H7YA 1FI2A 5EXOA 5JVVA 3MPPG 4Q4V3 5JR7B 1C5HA 1EAH3 1UCXA 4ZXKA 2I74A 1LHWA 4N53A 5BXXA 5CFDC 5K7PA 1KDMA 1V6OA 2P17A 2HWD3 3VL8A 2D44A 4MGIE 1FOD1 3DL3A 3GZUC 1GICA 4RS5B 3POWA 5ACA2 4GH4B 1FNYA 4XF9A 2HJIA 3IM0A 2VMHA 4CDXA 4IXLA 4XIOA 2RS53 4AK3A 1UZYA 1N1YA 1AX2A 1Q8VA 2D5HA 1PIV2 3MLJA 4UBHA 5FTTC 2WSVA 2GC1A 3OTFA 1H4HA 3DN7A 4QGMA 1NG0A 3SXWA 1FV3A 4AFMA 4ZKTB 2I2SA 3HN1A 4NO4A 4Z1VA 1ZREA 1YYNA 3LA3A 1DQ0A 4RR3C 3WD5A 1APNA 1S0CA 2JX9A 2AGSA 2R0HA 3VV1A 3QOPA 1N1VA 3JCIA 4FPCA 4LLFA 1LODA 4P5HA 4Q0VA 5F6LB 2SBAA 3UKVA 4COWA 3D82A 3ZXDA 4JGYA 4AE2A 4FTEA 4Z2WA 4QXKA 1FAYA 1OFNA 1YFUA 3FWEA 4DZGA 2R30A 2YPJA 4CZSA 4HSLA 2ZZJA 2RR12 3RRDA 4RA0A 1SLLA 1MS9A 1W2UA 1URXA 2I45A 4I0BA 2PHUA 5LK5A 1NXD1 3AK0A 1GFF2 1ONAA 1H1AA 1OOPA 5JIUA 1ZRCA 1DZQA 1C8NA 4NWVA 2XBO3 4XJZA 2ZGRA 5C4WA 5TSWA 1YFWA 3EXUA 1FNZA 5FQ0A 3WG4A 4HKWA 2Y26A 3HMYA 1UIJA 1RUF1 1W0OA 4GB31 4P9WA 1YFXA 2D6NA 3T2TA 3MIGA 2N7GA 1ZBE3 2E7TA 4YVWC 4IEPA 4IV3B 1HRI3 4XBNA 2XVLA 3S30A 4B7EA 1QJU2 4XFIA 1RTVA 4KH9A 2D98A 1HV0A 4Z07A 5T5LA 4COUA 1RGSA 2YROA 5GM0A 1SLAA 5EFUA 3ZN4A 5FREA 2WL1A 3QD6A 3VBSC 2XLGA 4QQPA 4ES8A 2D7FA 4Q8KA 5CFCA 3VGIA 3VBHB 2TBVA 4M3CB 3TAYA 2OIIA 2FMDA 3INAA 3MW3A 2K9ZA 5EV7A 3ECQA 1REFA 1VBC1 4LBKA 1AR73 1H30A 1WD3A 4YVSC 1C28A 2XJVA 1AYN2 2C5DA 1QH7A 4YW4A 1DGWX 5C8WA 5H9SA 3FLTA 5AVAA 1DU3D 5L7OA 4JDOA 1PM7A 2ZCWA 2YZ4A 4WM8A 3ZFGB 1UKRA 3TNQA 4QQOA 4E4SA 5HXVA 3VBOC 4CDUB 3DPRB 1A6CA 1VBD2 2ZGNA 1R1A2 5BNQA 1WLTA 2DCZA 2WFF2 4UBGA 4Z82A 5H9PA 5LEJA 5CBLA 1DZTA 1R092 4NHMA 1H2LA 4RHV1 1HXS1 1LECA 3QH7A 2YHJA 4N53B 1O4ZA 3S6PA 3CL1A 2BGCA 1Z7S2 3H7JA 3NO8A 2MEV1 2VU9A 2R041 1LOAA 3VZOA 5K0UC 1O3QA 3KB5A 1R082 1LHOA 2BWCA 3A0NA 1AYM3 1B35B 1WLWA 4OUSA 5DUXA 2A6YA 1WBLA 3DUIA 1SACA 3N4MA 4MSVA 1TE1B 1HQWA 1XNDA 4L2NA 1ENSA 1SLIA 3D0JA 2PHRA 5FO7B 2WZPP 4GH4C 4I3PA 1ZRDA 3VKMA 5J3UA 3MF6A 3H8UA 1PGSA 2JKBA 3JZVA 3SH3A 1IQAA 4N43B 4Y20A 2PAMA 1S0GA 3G7DA 3E97A 1XYOA 4YZ1A 5KXCA 1VBB3 5EZWA 5AC93 2HWB3 2XJRA 4GWMA 1WW7A 2UYBA 4OHWA 4UW3A 1JH5A 2Y0OA 3ZSKA 1NY72 1ZBA3 1VBA3 2A73B 1PO13 5I93A 2H0VA 2VNGA 2ZMLA 3RSJA 1G9FA 1OA3A 1XRUA 1JHNA 2A7AA 1C1FA 4FPFA 1IS4A 1YIFA 4M3CE 4CP0A 1BCXA 1W6PA 2DU1A 4QU2A 2CYFA 2E53A 4Q4Y3 4X6QB 1DYKA 5JZGB 4A7YA 1EV12 4M00A 2DYCA 3MIEA 1PNGA 1I1EA 4OHZA 1KJRA 1N47A 1RUH1 1REDA 1ULDA 4IEOA 1OOPB 1S0FA 5CAZA 4AFBA 4TYSA 1CONA 3AKSA 3M3OA 5BYNA 2Q1ZB 3ZXJA 5ACA3 1ASJ2 1ULEA 2TEPA 1GQHA 1NA1A 3VKFC 3I54A 3VL9A 1HQNA 5JPMB 4K1YA 2R062 1G7YA 1OQEA 3KLSA 4NOTA 5FCCA 1H9WA 4PBOA 2GMMA 4L8QA 4FAGA 1NCQB 2ENRA 4D7SA 1PIV3 5DG2A 2EAKA 2WNVA 1MZ6A 3IN9A 3WNXA 4Q0UA 4BHPA 1ND3C 4ZU4A 2H6CA 1PMIA 4H3WA 3ZIXA 1TMF2 2RMU1 4FOWA 4OI4A 2ZJCA 4LNVA 1WMEA 1PO23 4DB5A 5BNOC 4H14A 3CJIA 2R071 1DQ2A 2GN3A 1DF0A 3CNAA 3ES4A 3M7AA 3KCXA 4HT1T 2LM3A 2DUOA 4P9JA 4O9GA 4COYA 1MZ5A 4XFFA 1IPKA 1LESA 1MEC2 1RUJ1 1YUDA 2IXCA 2PHXA 3GBGA 4M01A 2ZKLA 4ES9A 1LENA 1A3KA 1FPN1 3ILFA 1D4M2 1YCIA 4Y1VA 1LHVA 3ZX7A 5C8CA 4HZFA 4D94A 4GXLA 3PVEA 3DV8A 4LBMA 2AUYA 3OJBA 1BBT3 4Q4W1 4ISRA 2AENA 3VBHC 4IV1B 1PGL1 3TOJA 5L7OB 1SBEA 5DUVA 4DXZA 1LKNA 5HCBA 4WM8B 3OF1A 1QJY3 4JQRA 2CAVA 5KXEA 5CADA 1ULFA 4LE3A 3AMNA 1MS5A 2VULA 2OZ6A 5KXDA 3N7JA 5KXBA 5BV6A 2ZX1A 3ZFGC 2GMEA 4XFAA 2A6ZA 2AH2A 1VRH1 3THTA 3WW1A 2ATFA 3DPRC 4Q4X1 4EWAA 1TME3 1PVC3 1QKQA 2GNBA 3MIFA 3NJZA 3D8CA 4DNYA 1JYCA 4Q29A 4RL7A 2XH6A 3POSA 2XJPA 4S2DA 4CDWA 4MXWA 4Y22A 1PGW1 4F3JA 3E5XA 4AGRA 5J96B 4KQ7A 1LULA 1QJU3 3OPZA 2ES3A 1IS6A 1JN2P 4N53C 4XBLA 1AHSA 4INDA 1UN1A 1DFQA 4Z8BA 2CV6A 4CDQA 3JQWA 2UU8A 3N7LA 4JGZA 1B35C 4LBJA 4NHLA 5IT6A 2A3XA 4Y20B 2GH8A 4CDXC 1FATA 2MHFA 1TNFA 1PVXA 1RITA 5GJ6A 1MS4A 5C6CA 4AEDA 1AYN3 4IEXA 4QHBA 1WW4A 3LZZA 4D7YA 2WA3A 4COZA 2RR11 5J36A 1RUE1 1SFYA 1H1MA 1O7FA 2EIGA 1QF3A 1C5IA 1VBD3 1ND2A 1R1A3 1N3QA 2UWBA 1VAKA 2WFF3 1R093 4JGYC 1CIWA 3MIBA 3VBUA 4ATEA 1LGCA 5B2GB 3VHNA 2YUEA 2DURA 3VUOA 3GF6A 4CEYA 1Z0HA 2XL7A 2XG3A 4LA2A 4EN7B 1R083 2ARBA 3SCGA 1LU2A 1NA1B 1WD4A 3FUOA 4H7LA 1VBC2 3VBRA 4B4PA 2ZGMA 1PZ9A 1OOPC 5HCAA 4Q0SA 4HLTA 1CJDA 4YGCA 5C9AA 3SISA 2DTYA 4JV4A 3U4XA 5FMOL 5C4WC 4WVWA 1SQ4A 2R32A 5CIRA 5D1IA 2ZGPA 4JTNA 5GZFA 4QM9A 4D69A 1CAXA 1NCQC 3WVJA 2XWJB 4JVAA 1RMU3 4AVAA 1BEV2 2PLV3 4YG6A 3CJIB 3W59A 1J3RA 1HXS2 3MI8A 1POV1 1DYPA 4BYYA 4XMIA 1IS3A 1KITA 2AYHA 2MEV2 4Y1ZA 1O3TA 1AR62 1T6GC 4HMZA 4EN8B 1X33A 4LO5B 2OVUA 2SLIA 1AL21 1SFNA 3OYWA 2WFPA 5KC6A 3GZTB 2NPIA 5SV8A 1Q5OA 4AI8A 4LUMA 1V6MA 2PELA 1PK6A 2VNOA 4FPGA 1WMFA 3RQ0A 5C8CB 1BQPA 1CAVA 2FZ2A 5CFCC 1O4TA 5K9YA 1NQDA 4LUKA 1I6XA 2VVEA 1LHUA 2DTWA 5BY5A 1Q8SA 1QHDA 3FBYA 1ASJ3 4YNIA 5GLVA 1V6NA 2WKKA 4IV1C 5I0RA 1Z7S1 1LJ7A 5L7OC 4FSJA 1H0BA 1KFXL 4WM8C 1GZWB 3USSA 3M1HA 3KS7A 4RGAA 1S0JA 1J58A 4LBQB 1QQP3 1ZZ7A 2RJKA 1DQ6A 4MXWB 2JG9A 4Y22B 3LSEA 3T1MA 3WUCA 2R49A 1XYPA 4QPGA 4U2AA 4URTA 1KRIA 4YZ5A 3MFCA 5GZEA 4BPZA 2P3IA 1RUH2 5EYYA 4KWJA 3PJYA 1YO8A 3LKJA 1F31A 3WP3A 4YVWB 1IPJA 5JI7A 2IXJA 2WLPA 4KG8A 4CDQB 2JDZA 1FOD3 2OZJA 1RVF1 2H0BA 5I8YA 3R0RA 3POYA 2WINB 5GLZA 3ZFEA 4MUVA 5LRSA 4GKXA 3ATGA 5I0UA 2ET1A 2WQ4A 3MF9A 2V73A 4WVMA 4EROA 3L2YA 3D5OA 1JYIA 1EV11 1G8WA 3UL2A 1ZRFA 4PLOA 1GLHA 4YRDA 2RMU2 4PBPA 3AP7A 3V0BA 5A32B 5KHKA 3J26N 3WLUA 1ND2B 2HKXA 1W6NA 2GSYA 2JENA 5GLUA 3ZYGA 2R072 4MGYE 1WUVA 4I02A 1NLSA 1ASJ1 1JUHA 2Q0AA 3AP9A 1FX5A 3VBUB 4BLJA 4E9KA 2R061 2QQPA 2D6LX 3VBOB 1RUJ2 3M4FA 4QPIA 1GR3A 4HVRA 1UPIA 2VUAA 3WZ1A 3FUQA 4Q26A 1NCRB 4OI0A 3QH6A 3WINE 3ZSLA 4Y4YA 5JDBA 1TMF1 4I2OA 2VG9A 3ETQA 2GMPA 4MVTA 1PGL2 1G9BA 4N9IA 1RB8G 4A7ZA 1F9KA 3Q9OA 3T1LA 4E2GA 1NA1C 4PIZA 4D3WA 3RJ2X 3ZN5A 3DF0A 4QT6A 4OI2A 4YFZA 5JSRA 4P14A 1BKZA 2RS11 3WR0A 4LLOA 2D3PA 1Q8QA 4Y1UA 1MEC1 1M06G 3AFGA 2WNVC 4YW2A 3WDYA 3S7IA 1RUF3 1VRH2 3D4KA 3USUA 1UW8A 3I7DA 1ZZ9A 3PVNA 4GB33 4Q4X2 1ZA4A 1D4M1 3EHKA 4PLNA 3P3NA 1O5LA 4LO8A 1CN1A 3MW4A 3UV9A 3LGRA 2JD4A 3NW4A 5BNNA 4HFSA 5DDJ2 4AGGA 1W6QA 4LTAA 4FXGB 1PGW2 3CJIC 1DIWA 3IWZA 2Y0IA 3OYWB 3BB6A 3MDPA 3C2UA 4ASMB 3IIAA 2ET7A 2PAKA 5FBZA 4HKLA 2AR6A 2W08A 2OA2A 3KT4A 4FQ4A 4LBLA 1YJKA 1PZ7A 3EQEA 4WM7B 1DDLA 1EP0A 2D6KA 4P9GA 2H6BA 2RS31 5C8CC 3FHIB 5FLIA 4XF0A 4ATFA 4E2QA 4HK9A 1VBC3 1LOCA 2I07B 2K2SA 4OULA 4C0HA 4L9BA 4E4DX 2DCJA 1AZDA 5L73A 3UKTA 4N7IA 3NSTA 1OD5A 1RUE2 4WZFA 1YHFA 2YC0A 4AVTA 2BBVA 1MQTA 3N35A 1A78A 4GKYA 4YG3A 5GKAC 5F6KA 1DZRA 2WJSA 3BCWA 1EPWA 3J8F1 4HL0A 3MICA 5FRAA 2ZHMA 2ZGTA 1QXJA 2ZGSA 2DCYA 1LEMA 4XJWA 3BODA 1ND3B 1HXS3 4RHV3 5ABJA 1X7NA 4YM0A 1RUD2 1N1TA 4LBOA 3AYCA 4IETA 4CDWC 3FBMA 2MEV3 4K3UA 2R043 3BPZA 5I8TA 4BZ4A 1HDKA 2HWF1 2A3YA 1W6OA 1SMVA 3VLBB 5BNOB 4JTOA 3WP5A 3PJQA 1TEIA 4HK8A 1G9DA 2ZMKA 2ZGQA 3OGJA 1F2NA 2VOWA 1AL0G 4CDQC 1MZEA 3JBG1 5BUVA 4HPKB 2BNNA 3MFAA 1ZVFA 5JIAA 1LGNA 2VMGA 4RSUA 4E4ZA 2VOVA 1WBFA 2X5IA 5FFOC 2LUWA 1NOVA 3NV1A 4AQTA 1I9RA 4YYOA 4E27A 3X29B 3ZN6B 1QDCA 1D0HA 1VP6A 1H2MA 1RJ8A 2DCKA 4DQAA 2WNEA 3E6BA 3LAGA 4KL1A 1LOGA 3ZXEA 1MVEA 2DVFA 1IS5A 2UY9A 2WNUA 1OHFA 4IEZA 4L92A 1SEFA 2YXSA 3A0KA 2GALA 5JOXA 1SLBA 3APBA 1YXWA 5FAXA 3MYXA 3TN91 1ND2C 3KQRA 1GBGA 1OA2A 4QPIB 1AL22 1EYBA 3M8LA 1HLCA 2WT0A 2UY8A 2XJUA 3VBUC 4XETA 2VVDA 3JQXA 1RUH3 1UZZA 2GNMA 4CEYC 2DVBA 1NCRC 2YDEA 3FC0A 1JOJA 4HN0A 1PHMA 3VBFB 2XKOA 4FTBA 2XJQA 2F4PA 3WHUA 1BEV1 3B93A 1COV2 1O3RA 2BEOA 4C91A 4OHXA 1AR61 3ASIA 3IPVA 4HETA 4RD7A 5L36A 3U11A 3OY8A 4K7JA 1QMJA 3USUB 4GMP1 3VN4A 4W65A 4P9IA 1IGOA 1AJKA 4AFDA 4CDXB 2NP0A 4BIFA 3OCPA 4M0NA 1J59A 5GLWA 2RMU3 1VLNA 3O14A 5GZDA 1W6QB 3CLPA 2LTNA 1JW6A 5L19A 1L3JA 2R073 4BOWA 4G4FA 3IMNA 4L99A 4AWDA 2BPA2 2FZ1A 1WCSA 5CVRA 3AKPA 1RUOA 1MS3A 1Q8PA 5T52A 1VBE2 4YGBA 5A33A 1IZ3A 1RUJ3 1UAIA 2G9FA 1RVF2 3RS6A 3N3HA 4IL7A 4QGNA 1FPN3 2VY0A 3ZSMA 2PHWA 2UYAA 1BJQA 4ASLA 3NKTA 4JGYB 1BYHA 4WM7C 4XIKA 5JSOA 1LRHA 3GBFA 3SHRA 4JCKA 4Q4W3 3AYDA 3AMHA 1ZX5A 4XW3A 1PNFA 4I0WB 1FT9A 2NMOA 4MYEA 1CPNA 2VQAA 3NAPA 3AM2A 3AZVA 3I8TA 1MQTB 2DUQA 3M2MA 4M0HA 4R52A 1LU1A 2R16A 2ZHNA 4YARA 1LGBA 4AI3A 3W9AA 1AR81 2WIIB 2D6PA 4AVBA 5J09A 3ZXLA 2UWCA 3V64A 5C4WB 1VRH3 4W6XA 4Q4X3 5FQ0B 3MPBA 4QMAA 3CEWA 1CR7A 1TNRA 3B3QE 1NZCA 2XUMA 3U10A 5I0TA 5GZCA 1SDWA 2BW8A 4XXPA 1AF9A 4FOYA 2Y38A 1Q8OA 4F83A 4XE9A 3S0MA 2ZS6B 4LULA 3KMHA 4LHNA 3ZPYA 3V0AA 3WQ1A 3H1YA 3JU9A 1DG6A 1M4WA 3WDVA 4LBNA 1HRV1 4XDQA 1WCDJ 4IEQA 2DUPA 2XVGA 4AW7A 2ZMNA 1G9CA 1D2SA 5FOBB 2IXIA 3ZFEC 1O91A 3H50A 3B9IA 1QDOA 2PA7A 4R9CA 1J1TA 2RS12 2PHDA 3I59A 2NZ9A 1N3OA 2B39A 2NM1A 2DVDA 3AZXA 5FPXA 3VZJA 1XNBA 5CFCB 1BXHA 2DFBA 2R0FA 2EF6A 5JOZA 3M3EA 4TLFA 2RR13 1FV2A 1RUE3 1MS0A 1G9AA 2DWRA 2BFUS 4FAHA 2AREA 1FYUA 1OPOA 2GN7A 1C1LA 1ZZ6A 4P9XA 1OA4A 3PMEA 5AFBA 4RR3A 1XU1A 4IEYA 1UMZA 4KU8A 5HCFA 1IKQA 4AHYA 1CQ9A 3VZKA 4I0AA 1UIKA 4Q0QA 1UL9A 4YM1A 1FMD1 4CP1A 1GSLA 1K5MA 3LCPA 4QPIC 3ZDSA 4DOUA 1RJ7A 4R9AA 3FLPA 2W68A 2Q5TA 1A8MA 4Q8LA 2CWMA 4LHLA 4R9DA 2OYZA 3GNEA 3ME2A 4DFSA 2RS32 4XFHA 5AVPA 2JECA 1ULGA 2FHRA 5IK4A 2QZ3A 1XYNA 3O7OA 3BOPA 3VBFC 4AEJA 4JRLA 2DV9A 4P9YA 5DDJ1 1V00A 2W0XA 1VALA 3S7EA 2DVGA 2MNGA 4PDWA 3SH4A 2VNRA 4OHYA 5DZFA 4R9BA 2ZGLA 4RQPA 5T5OA 3UJOA 3J8F2 2Q30A 4KU7A 4ONUA 3B02A 4B3NA 2QCSB 2JE9A 1QOSA 5DXDA 1SCSA 1V9U1 1ZZBA 4I3GA 1LOBA 1POV3 3N36A 2RM21 2HWE1 5I8SA 4MGKE 2O1QA 3CU7A 4C90A 2O8OA 4XTMA 4Q2FA 1O3SA 2HWF2 2OUHA 3UKNA 1LHNA 1AR91 5KHJA 1AL23 2Q1MA 4Y1XA 3QCWA 4Q1RA 1KD7A 1EAH2 3GHMA 5A3LA 4JAAA 3JBG2 3JUUA 3ZFFA 1XE8A 4AHZA 1VAMA 5C33A 1QJZA 3NKGA 4ORFA 1W6PB 2UWAA 2XJSA 3O0VA 2IXKA 3FX3A 3FE5A 4CRQA 1OI6A 2GNTA 2VXRA 1H8TA 3NAPB 4NVPA 3WY6A 5BPXA 1CESA 5EYXA 1RUD1 3PVOA 2QNKA 2RS52 1RC6A 2CGPA 3BTAA 1Z7S3 4YZ4A 2ZZQA 3AYEA 2GDFA 4XQDA 5CA6A 1MQTC 5BNPA 4QQ2A 5SV5A 3TN92 3URFA 4CEWA 2NLRA 2D6MA 2PQQA 1C8M1 3G6JB 2VECA 2D3RA 5KHHA 5D8AA 3WX5A 2WNVB 3PNAA 1RUC1 2NYYA 4PF5A 1F8VA 5ABJC 1YRZA 1HQLA 1SBFA 3KCCA 1D2QA 1S0BA 4YG0A 2VUJA 2BYVE 2A6WA 2BNMA