1D4M3

The crystal structure of coxsackievirus a9 to 2.9 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
b'GLPTMNTPGSTQFLTSDDFQSPCALPQFDVTPSMNIPGEVKNLMEIAEVDSVVPVNNVQDTTDQMEMFRIPVTINAPLQQQVFGLRLQPGLDSVFKHTLLGEILNYYAHWSGSMKLTFVFCGSAMATGKFLIAYSPPGANPPKTRKDAMLGTHIIWDIGLQSSCVLCVPWISQTHYRLVQQDEYTSAGYVTCWYQTGMIVPPGTPNSSSIMCFASACNDFSVRMLRDTPFISQDNKLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COXSACKIEVIRUS A9)
publication title The crystal structure of coxsackievirus A9: new insights into the uncoating mechanisms of enteroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d4m300
5FOJB 5A33A 1V9U1 3JB8A 2RS51 2HWC2 1GFF2 1PIV1 1D4M2 4PDWB 3VBSC 1QQP1 1PO12 1RUF2 4N43B 2DF7A 1VBE3 2RS33 1R092 1RMU1 2R073 1R1A2 4GH4B 1MQTA 5CFDC 3JD72 1R1A1 1ZBE2 5AC92 1X33A 3LOBA 4BCUA 4CDXC 1ZBE1 2HWB3 3VBUA 1DDLA 5AC91 1ASJ2 1ZBA3 1BBT2 5K0UA 1RUE3 4IV3A 5C9AC 1ASJ1 1FPN1 1AR62 1RVF3 4JGYC 1ND3A 1AR61 3CJIC 1AR72 1RUD2 2RR12 3TN92 2WZR1 1OOPC 1QJX3 4Y5Z0 1AR71 4RHV2 1RUD1 1RB8G 4PDWC 1PGW1 5LK7B 4N43C 1VRH3 4GB31 1W39A 1NCQA 3VBFC 4AEDB 4GH4C 1NA1A 3ZFGA 4JGZA 1TMF3 5BNPB 3NAPB 1AYN3 5D8AB 3VDDA 1RUI1 2HWF2 4FTEA 1VBA3 4CDWA 4Q4Y2 5ABJA 2HWD2 1QJU1 1RHI2 1VBD2 3JB4C 4GMP3 1WCDJ 1RHI1 5A32A 4RS5B 1HRV2 3VBHB 1AR82 2HWE1 1AR92 1A6CA 1NY71 5CFCB 2BFUS 1AR91 1NA1B 1FOD3 1MQTC 1RUC2 4QPGB 2PLV1 5D8AC 5L7OB 1RUG2 1Z7S3 1EAH2 1PVC2 1R083 3ZFFA 1VBE2 2RS32 2XPJA 1BMV2 5C4WA 1AYM3 5GKAC 4RQPB 2R072 1PO23 1VAKA 1QJY1 1ND3C 1AL23 4IV1A 4Q4X1 2HWB2 1OHFA 1HRI1 5A32B 5CFDB 1POV3 1ZBA2 2WS93 4RS5C 2X5IB 2FZ2A 1RUE2 3VBHC 4CDUA 4FTBA 4YVSB 2XBO3 1RUE1 1VB2A 4GMP0 1RVF2 5CFCC 4Q4V3 3VBOB 1FMD3 4SBVA 1NCQC 3JBG1 1NCRB 1AL0G 1NA1C 1AR83 1QJX2 1PGL2 4QPGC 5BNOB 5L7OC 4CEYB 1EV13 3VDDC 1PGL1 1K5MA 4QPIA 1COV3 1OOPB 1RUC3 1VRH2 2MEV3 4RQPC 1HXS1 1RUG3 1VRH1 1EAH3 1TMF2 2HWC1 1PVC3 5ABJC 1AYN2 1D4M1 1H8TB 5ACA2 1F8VA 1PO11 1RUF1 1RUJ3 3VBFB 1TMF1 1AYN1 1R091 2BPA2 1VBA2 2RS12 5J96B 2X5IC 4YVSC 3JD71 1VBB3 4RR3B 3VBOC 4CDQA 4NWVA 1NCRC 5DDJ3 1F2NA 1C8M3 1POV0 1RUH3 1BBT1 4GMP1 5BNOC 4Y4YA 5JZGB 4CEYC 3DPRB 3ZFFC 5A33B 5C4WC 1AUYA 2RR11 3TN91 4Q4W3 1FOD2 4RFT0 5C8CA 4RHV1 1M06G 1VBC3 1H8TC 2R063 1ND2A 1Z7S2 3J8F3 3IDEA 1R082 2VQ0A 1MQTB 1AYM2 1Z7S1 2ZTNA 5ACA3 1PO22 2R043 3VBUB 2RS13 4RR3C 1B35A 1V9U3 5K0UB 2HWF1 1AL22 4CEWA 4IV3B 5JZGC 2WS92 4Q4Y1 1AL21 3DPRC 1ND3B 1POV1 2HWD1 2XBO2 1RMU3 1VBD1 2RMU2 4Q4V2 1FMD2 3VBRA 2XBO1 4YVWA 2BFUL 5FMOS 4Q4V1 1FMD1 2WLPA 1HRV1 5C8CB 4WM8A 1AR81 1EV12 1NCQB 1ND2B 3VBSA 1COV2 3ZFGB 4JGZB 1EV11 2MEV2 3VDDB 1RUC1 1RUG1 3VBUC 2WZR3 1RUJ2 1EAH1 4CDWB 1PVC1 5K0UC 1VBE1 2RS31 4IV3C 4CDXA 1BMV1 1RUJ1 2R071 5ABJB 2WFF3 5BNNA 5C9AA 4EJRA 3CJIB 3S6PA 1VBB2 1MEC3 4JGYA 5DDJ2 2HWB1 3CJIA 1C8M2 1VBB1 1RUH2 2RM23 1ZBA1 1RUI3 5C8CC 1C8M1 2RMU3 4PDWA 1ND2C 3M8LA 4N43A 1RVF1 3ZFGC 4JGZC 4Q4W2 1QJU3 4GH4A 1QJX1 4Z92B 2Y26A 1VBC2 4FTSA 3ZFFB 2R062 5C4WB 1TME3 4CDWC 1B35C 3J8F2 1VBC1 4NWWA 1QJZA 2HWE3 4N53A 5BNNB 4LLFA 2R042 4IV1B 5ACA1 2R041 1V9U2 3VBRC 2RS52 1VBA1 2PLV3 2RS11 4CDUB 1PIV2 1QQP2 4WM8C 1HX6A 1RMU2 1OPOA 2GH8A 4AEDA 1QJY3 5BNPA 1K5MB 3NAPA 5D8AA 4QPIB 4Q4X3 1HQNA 1HRI3 1BEV3 2FZ1A 1NOVA 1FPN2 4N53B 5BNNC 1FOD1 1E57A 1CJDA 4IV1C 3JBG3 3ZFEA 2WZR2 1C8NA 1R081 4CDUC 1AYM1 1PGW2 4RS5A 2QQPA 2WFF2 2GSYA 1SMVA 1PO21 3VBHA 4CDQB 4GB32 2RS53 2WFF1 1HXS3 3ZXAC 1PIV3 5CFCA 1MEC2 1VB4A 1QQP3 5J98B 2HWC3 2RM22 1D4M3 2WS91 1MEC1 1K5MC 1PO13 1RUF3 1RUI2 4QPGA 5FMOL 4QPIC 4WM7A 5L7OA 2RM21 1R093 1R1A3 2RMU1 4RQPA 3JD73 1IHMA 1ZBE3 1QJU2 4N53C 5AC93 1NG0A 3ZFEB 1ASJ3 1TME2 1FPN3 1BBT3 1COV1 2MEV1 1TME1 2ZAHA 5CFDA 1AR63 2WWSA 2X5IA 2HWE2 1B35B 1NY72 4CDQC 4YVSA 1AR73 4CEWB 1RUD3 2RR13 3TN93 3VBOA 4AEDC 1NCRA 4RHV3 2PLV2 2BBVA 4GB33 5BNPC 5BNOA 3NAPC 4CEYA 4WM7B 3VBRB 4YVWB 1OOPA 5DDJ1 1RUH1 4WM8B 1QJY2 2TBVA 4FSJA 3VBSB 1CD3G 2HWF3 3FBMA 1H8TA 4Q4X2 3ZFEC 3VBFA 1HRI2 4Q4Y3 1BEV2 2HWD3 4Q4W1 1RHI3 1BEV1 1VBD3 4CEWC 4CDXB 2BUKA 2R061 3JBG2 3HAGA 4RR3A 3J8F1 1HRV3 2IZWA 5C9AB 2ZZQA 5JZGA 1AR93 4WM7C 3DPRA 4JGYB 4YVWC 1X36A 1HXS2
chains in the Genus database with same CATH superfamily
4ZZ5A 4Y26A 1V9U1 2WIIB 1OFSA 3VV1A 4K9SA 1L3JA 4GWMA 1EYBA 2OPWA 2ATFA 4NRMA 4ASKA 4N43B 1J1TA 2VPVA 1AXKA 2RS33 3UYJA 1R092 3ES1A 4UOJA 2VZPA 2R073 4AWDA 1JXNA 1QNYA 4I30A 1SPPB 4LA3A 1FT9A 3BIWE 3C8XA 4E8DA 1VMJA 4BYYA 1ZBE2 2Y60A 3A0KA 3KCXA 4P5YA 4CCKA 5AC92 5IVVA 1RUOA 4MGTA 1X33A 3LOBA 4CDXC 2W52A 2Y6FA 3GZAA 3PMEA 4PT6A 1MS5A 2PHWA 3LF7A 3VBUA 1SACA 4UF0B 2LS6A 1BBT2 1DIWA 3CNAA 2W94A 5K0UA 3MPBA 5C9AC 4EN6B 4IEUA 1ASJ1 3T2PA 4BZ4A 3KCYA 3PVEA 1OH4A 2ORZA 1P8JA 4UWDA 1DQ1A 1ZYBA 1UY3A 4I3GA 2PHDA 5FO7B 3D6EA 4KWJA 2L9LA 1AR61 3RZMA 4OMDA 1OOPC 4KGGA 1YJKA 4DUXA 4CUAA 1JYCA 3BTZA 5E1RA 1RUD1 1RB8G 4FOQA 1GUIA 1PGW1 4K6BA 1CJPA 5LK7B 4HN0A 5FUPA 5ERLA 4EWEA 4HSJA 4QAWA 4CE8A 2UWCA 1W6PB 2P3YA 4ONUA 2UY8A 5DN2A 1U5YA 5T52A 5A7NA 3ENRA 4QXCA 4U36A 1NA1A 3ZFGA 2DUOA 1TMF3 1PGSA 3VL9A 2UYBA 1AYN3 5C3QA 3UNPA 1DQ2A 2XQXA 1W8UA 5FYUA 5KHIA 1RUI1 4KU8A 2JDPA 2OKXA 5FPXA 4FPHA 4C1WA 5DAPA 2YBKA 2VMEA 4FAHA 3WW4A 5FJKA 1C1LA 4DPNA 1OC1A 3VHRA 4BQ5A 1O91A 4P9XA 3B00A 1DGLA 2VY0A 1G9DA 4H7LA 1XC6A 4HG6B 1TG7A 3I2DA 3WG3A 3CF6E 4EE2A 3EJKA 3VDAA 3K75B 1QOTA 1RHI2 4JDMA 1IGOA 5LBFA 4AQ2A 1VBD2 4B1LA 5T5PA 1E5SA 1SCRA 5A32A 1REDA 2WUHA 5FAXA 1TNFA 2VZ3A 4RS5B 5KHHA 3ZSLA 3ACLA 4SLIA 4LBOA 2OYZA 3VDCA 1WMXA 2FMYA 1AR82 1J3PA 5LEKA 4M4PA 3LFIA 5LA9A 3LEMA 4A6OA 2ZGOA 5CFCB 4BXSV 1K12A 1CIWA 2ZX0A 3VZLA 1AR91 1CAXB 3M1HA 2ZJCA 4AL9A 2C26A 3GNEA 5DUUA 1FOD3 1KFXL 3N9MA 2CNAA 4IEZA 5FZFA 4BQ1A 5D8AC 2WQ8A 4QKDA 2VCCA 4MOAA 2XLAA 4UXAA 2VBBA 1S0JA 1OSGA 2WINB 1EP0A 1R083 4FPGA 4LKDA 2ZGRA 3U1XA 3O1TA 4Z2WA 3WNOA 5FZ8A 2JE8A 3IDBB 1UQXA 1D4VB 3L9JT 4JQTA 5GKAC 1S0CA 2G1MA 3BU0A 4FAGA 2VQUA 1VAKA 2XMLA 3BN6A 3C7HA 1QJY1 2ZHNA 4Q2FA 1LCLA 1SBFA 3DXUA 5KWRA 1UAIA 2ZHMA 4W4ZA 1LODA 4AAXA 2P3IA 2GC1A 4Q4X1 5IAXA 2HWB2 1HRI1 4XTMA 2LUWA 3NNLA 3LEGA 5T50A 1VAVA 2C1FA 2X5IB 1RUE2 1J59A 4E2QA 3VBHC 3UJOA 5JSOA 2DBNA 2R32A 5FZKA 2XOMA 4C90A 1AX0A 3MFAA 5F5QA 3VZOA 1WW7A 4M0NA 4YLZA 2JXAA 1NCQC 1GZTA 2WNUC 2Q8OA 4FBFA 5JIUA 2VMGA 3FZ3A 3FLRA 1AL0G 4HT1T 5JI9A 3BU7A 1AR83 5FZEA 1QJX2 3QCWA 5GM0A 3WHTA 1QOSA 4QPGC 2BDRA 3SEEA 4CEYB 2WRAA 1U5ZA 1WLCA 1HJGA 1KRIA 3VDDC 1GP4A 3GZTB 3QBQA 4KBZA 1K5MA 5EZWA 4Y20A 2IWGB 2JDHA 3WDWA 5AFBA 1COV3 1O3RA 1VRH2 4XETA 1OVSA 2H6BA 1HXS1 2MEV3 3RNSA 1W06A 2E7TA 5CEHA 1JI6A 2QZ3A 4AZZA 1J84A 2BTVC 2R1DA 4ZU7A 3HOBA 1OD3A 1H8TB 5CAZA 4HOOA 1WCSA 1TMF1 3WDVA 1JZ8A 5FZHA 3CZUA 1AYN1 2YYOA 2C9KA 4DNYA 1R091 1VR3A 2V5DA 3N9NA 4XDOA 3IB3A 2CAUA 5FUNA 3B02A 1XNAA 2QQVA 4XAAA 1JW6A 4H7MA 3NW4A 2ZACA 3ZDVA 2KR2A 1IKQA 1UU5A 3NJYA 1RITA 3H3UA 4JX0A 4YVSC 1LR5A 2I74A 3ZMNA 5KHGA 4WBBA 2D6OX 2EXIA 3H3LA 3T2TA 2W9XA 1UMHA 2JKBA 3I8TA 3VBOC 3HD8B 5DDJ3 1NCRC 4K8RB 3A21A 4GWJA 4D8MA 4FCAA 1FNZA 5CNAA 1BBT1 2DFBA 2BVBA 4LHSA 5BNOC 1KXGA 2VOWA 3THCA 1O4YA 1RXGA 5KC5A 2A6VA 4WZCA 1STMA 1LAJA 4C91A 1JUHA 1HQWA 4P08A 5A33B 2JDMA 5C4WC 3OY8A 5A3OA 1UF2C 4R4ZA 4RD7A 4Q4W3 2VNGA 1LHVA 3LKJA 2GALA 4RFT0 5G04L 2ADEA 3GCXA 3V0BA 1W6OB 3NV1A 2IUWA 3EBRA 2ZZJA 1XU2A 5IUQA 4KG8A 3ACHA 1UYYA 3U4SA 3WW2A 1AYM2 1S0BA 2DVGA 5HCAA 4E27A 4A3ZA 4Q26A 3ON7A 1O59A 1KJLA 4Q29A 2Z4FA 4UT5A 1GNYA 2R043 3P1IA 5FREA 5T54A 5J3UA 3LWCA 1A78A 1BJQA 2XUMA 3LPFA 2E53A 1AL22 3ZSKA 3B69A 3URFA 5BUVA 1I3HA 1WMFA 3SKVA 4X6RB 4COWA 2WS92 1IQAA 5JZGC 2WNVC 3DPRC 1AJKA 3VKMA 1JZ7A 1ND3B 4LMFA 4MGSA 4U2AA 1YHFA 3RYPA 5A3UA 1VBD1 3OYWB 4IE7A 3VBRA 1XYOA 4K20A 1W6NA 3W59A 2G9GA 3W5MA 3WF2A 2D3PA 1D0GA 1UZ0A 3HR9A 4UW6A 4TZDA 3BTYA 4QKBA 5DUWA 1AR81 1EV12 1O4ZA 1X9PA 3VBSA 1ND2B 4YM3A 2Q8DA 3ORJA 5GLWA 4ASMB 1OLME 1W9FA 2ET1A 4CU9A 2Q1MA 3OGGA 3AXEA 1D2SA 1HB3A 2Y33A 4FP3A 3LDKA 3ZFEB 2UYAA 2AYHA 3D0JA 2FCVA 1RUJ2 2WZR3 4CDWB 2WT1A 1HV1A 5IW0A 4IV3C 2DVDA 1UY2A 3VLBB 5ABJB 1OD5A 2BNNA 4GZ9A 5DABA 1EUUA 1D2QA 5T5OA 1V00A 4EJRA 4KU7A 5J09A 3PU3A 3S6PA 2PAMA 5C7GA 5L19A 2QE3A 4TXWA 4LO7A 3DYOA 5HCBA 1W90A 2VMDA 2HWB1 5FJHA 3POFA 2TNFA 5FIXA 4O7XA 5JCTA 2OUHA 5A7WB 1YI7A 2ZEZA 4W6XA 5C8CC 4N90A 4L2NA 2VULA 3AJYA 4DRVA 1PHMA 2W68A 4LUMA 2ZBJA 2XHNA 4UFLA 2GDFA 3AX4A 1IZ3A 4N43A 4AI0A 2V72A 1U5XA 3T0DA 1IS4A 4M0HA 2XLGA 2ZX2A 1YWKA 2VE1A 3V64A 3IN9A 3VD3A 4CP1A 2VZOA 1SPPA 3BI3A 3O0VA 1QJX1 2JDUA 2LROA 4LO8A 2Y26A 1SBEA 2GNTA 2QQKA 5F1RA 3SLIA 5I8YA 4Z92B 1VIWB 4L8QA 1VBC2 1F4AA 4FTSA 3ZFFB 3IMNA 2R062 5J48A 2HEWF 3OGSA 4NWWA 4BPZA 3WG2A 1PVXA 2BOJA 3AKRA 4UF0A 3U4XA 2K2SA 4HMZA 2Q8EA 2B8MA 2IXLA 3PUHA 4OCTA 1UX7A 3OJBA 3QLQA 4MUVA 4EN0A 1BKZA 5A3TA 4W6WA 1UXXX 2FHRA 1LGCA 3GZEA 4XF9A 2R041 4IE5A 3B9IA 1KS4A 3LA3A 1GKBA 4CP0A 3F2ZA 2HJIA 2RS52 2PLV3 2AGSA 3VL8A 4CDUB 1MZ5A 3O12A 1ODNA 2QDRA 4GA9A 2FD8A 1QQP2 3OG2A 2AC1A 5FP3A 5BV6A 3AFGA 4V2VA 1V6JA 1XSQA 2XB6C 5C33A 1RMU2 1ZZCA 1XYNA 3ASIA 3G7DA 2ARXA 4LUKA 1HB2A 3HIFA 2VL4A 1W6PA 5DAWA 4Q27A 4QT6A 2Q8CA 4Z8BA 1RC6A 5FYTA 2GH8A 2UWAA 4XF0A 2CGOA 3RPQA 4CPBD 3OGRA 5D1IA 5LW9A 1PM4A 3E6BA 5H9PA 4LBQB 4CU8A 1GU3A 4PIZA 4FPOB 3OUHA 4LJHA 3R4DB 4I0BA 4QU2A 5L9VA 2CY6A 2EAKA 2CWMA 2JDNA 1S0DA 3WP4A 5BY5A 1BEV3 3PHMA 1CAWB 4OI0A 2JECA 4XE9A 1FPN2 1N3OA 4ATEA 5BNNC 3M3CA 5EXOA 3EYPA 4BQ3A 1R64A 1WA6X 3L2HA 1XB9A 5F2WA 4XBLA 2FDIA 2P3KA 5CYYA 3I2JA 4OQ8A 2Z42A 3QH6A 1AYM1 1GZWB 2EICA 2WFPA 5FRAA 4RS5A 4AGGA 2WFF2 2XKOA 5CIRA 4FPEA 4FQZA 4MGZE 4NUBA 3H42B 4CDQB 3KHBA 2RS53 2WWUA 2XJSA 5CFCA 2PA7A 1MEC2 5FZIA 1CPNA 1QQP3 5FY8A 2HWC3 3ACIA 4Q0VA 1CAXA 2DUQA 3EXUA 2JG8C 4EZHA 1J83A 1RJ8A 2WS91 3OD4A 4G3YC 4XYXA 3WNNA 1JYTA 4UW3A 4MH0E 3KF3A 3HT2A 2E7QA 3RZLA 5DZEA 3U75A 5JSPA 1BLZA 4GIQA 5LCWL 2IXJA 2R16A 2BJSA 3ROUA 3W20A 2F6BA 4P9YA 3OEAA 4EWAA 1XRUA 2VUJA 4BQ2A 1TME2 1FPN3 4J25A 1QDCA 3K4AA 2PHUA 5GZDA 5FDBA 3PU8A 2ETEA 4P00B 5FZLA 2X5IA 3AP4A 1IG0A 3HEIA 4BM8A 2GP3A 1B35B 2WN3A 2XJQA 4HVOA 4K7JA 2O1QA 2WAOA 1LTEA 3B93A 3I3DA 4C8DA 2RR13 3HNYM 4HKOA 5FKCA 4A4AA 3A4UA 4QKFA 3CMGA 3UESA 3DN7A 4D7YA 1G7YA 1W9YA 4AEDC 4I01A 4RHV3 5A1FA 2FDGA 4A7KA 2BBVA 5HI0A 3LCPA 5H9RA 1UOBA 3AZYA 5C70A 1J3QA 5IT6A 2D6LX 3WP3A 4CEYA 2RV9A 1KFUL 5A3WA 4DY5A 4GJZA 3FHQA 1C28A 2K46A 1MS4A 5C3PA 3C7FA 2JD4A 1KD7A 4NPRA 2JEMA 1SHWB 1ZZ6A 2YGLA 5FOBB 5GLZA 2ADDA 2HWF3 4OZXA 4LBQD 3POIA 1JOBA 1H8TA 3ZFEC 1YUDA 2VQAA 1PZ7A 1ENRA 5A6YA 1JZ5A 1DZRA 2VO5A 3HWJA 3NNGA 1H2NA 3PURA 5FY1A 4UYBA 2HWD3 3BOWA 3JQXA 5GZGA 4OI1A 3THDA 2W5FA 3ZX7A 1BEV1 1DGRA 1CVNA 3MLLA 2OZ6A 2YC4A 5IWFA 4CDXB 1SQ4A 2R061 3I2FA 3JBG2 2E51A 3HAGA 3M7AA 2QBXA 4UFIA 4NR1A 3RZGA 3INAA 1XNKA 2IZWA 1ZZ8A 4ZONA 5C9AB 2X09A 2B46X 2GMPA 3AZXA 4DRRA 1O6UA 1WGPA 2GC0A 4MSVA 2WAAA 1DCSA 4WM7C 4NHKA 4YVWC 3I2KA 3T2QA 1UX6A 1EY2A 4UW5A 4XILA 4C0HA 4MXVA 5A33A 1LOEA 4LBLA 2BP6A 3JB8A 2JDZA 2RS51 5I8SA 5CG9A 3K77A 2RDNA 5JR2A 4DXSA 1D4M2 2EAAA 4NO4A 1GOHA 1QQP1 1QJEA 2DF7A 1VBE3 3CQOA 3H1MA 1W6OA 1RMU1 3GJBA 4XMIA 4BDVB 3ZN4A 5F3CA 3RYRA 5KXEA 5LASA 1IQDC 4Y1ZA 3ZDSA 5CFDC 1FI2A 1XYPA 3LA7A 4I0WB 4YG0A 4CUGA 1LOFC 1GR3A 3KV5A 5FZ3A 5CZKA 2IXIA 2YV8A 3E97A 3CU7A 3RI9A 5T55A 4BCUA 3WP6A 1JYXA 2VXJA 3MI8A 4G9SB 5FXZA 1NLRA 1F15A 4BOWA 1ASJ2 3J7HA 1ZBA3 2DWRA 4LHLA 4Y4RA 4YARA 2DCJA 3BYWA 5I0UA 1LRHA 3RZJA 3NKTA 4NHMA 2A70A 4QQLA 1FPN1 4IEOA 1AR62 3QH7A 4NIDA 2XUEA 4B7KA 1UOFA 1RVF3 1PX3A 4JGYC 4QX5A 1ND3A 4OUEA 4XFBA 1H1AA 2OXBA 3AP5A 1RUD2 3U07A 2GU9A 3TN92 5A3NA 2XWJB 4PQQA 4XFAA 3OYWA 2DBIA 2EIDA 4PDWC 5FXXA 3WY6A 4A7YA 2VOVA 4R9CA 1F4HA 1ALYA 2CGNA 4FPKA 3Q8CA 3KGZA 3K46A 2A5ZA 5FK7A 1QJFA 1W39A 3VBFC 4GH4C 3USSA 4AI3A 2PHTA 4HKWA 4J6GA 2ZGPA 3AMHA 5EJ3A 2DFCA 1XQNA 4YW4A 2PXJA 4HK8A 5D8AB 4XC9A 2GNMA 2BEOA 5K7PA 3VZJA 4FTEA 5LA0A 3MIDA 3N4MA 4LA2A 4CDWA 4NN0A 2RJ2A 1CZTA 2IXCA 4Q4Y2 1H1MA 1JS9A 4HVRA 3RG0A 3MIEA 1UNBA 1ZZ7A 2CGPA 1C4RA 5ABJA 1NYWA 5KXBA 3J9SA 3TEXA 1I5PA 2P4EA 5C5UA 5FBJA 4DXZA 1WCDJ 4GULA 5FZ0A 1OQDA 3DKWA 4FPYA 3PNAA 2WZPP 2HBUA 5IVJA 2P2KA 1DP0A 4LHKA 1CONA 5E16A 2WR9A 5KHJA 3VBHB 5A7WA 4Y1YA 3C7GA 5IVEA 4KWUA 3HPNA 4QGMA 3PUQA 3AKQA 1AR92 1SBDA 4LHNA 2BFUS 2RE9A 2OPKA 4YW6A 2WNUB 2WKKA 4CZSA 1OH3A 2HBTA 4QPGB 2VW0A 4XJUA 3ZVXA 3B9CA 5GALA 4MGQA 2Y6JA 2MPFA 2JWPA 4IE4A 4CU7A 4A6SA 5L36A 1CZVA 2BGPA 1Z7S3 1BXHA 4QX2A 5FZGA 3ZR5A 1PVC2 1IS6A 4YNIA 1XU1A 3ZFFA 2RS32 2JDYA 4S2HA 2NMOA 2XPJA 1BMV2 2IVJA 4COZA 4PBPA 2R072 4BE3A 1S2BA 4NMIA 2W39A 5JUVA 5CA6A 4QM9A 2WT0A 5E8AA 4MO3M 2XDVA 3VZNA 4YFZA 2Y0OA 5GZFA 3UGHA 5A1AA 4IEYA 4K40A 4BK5A 3MF6A 4AI9A 2XHKA 5F5AA 1POV3 1SDWA 1UPSA 2W46A 4LR4A 5FQ0B 2NN8A 1EUTA 4CDUA 3VD9A 1GZ9A 2A3XA 2VVDA 2ZX4A 2XBO3 3KV9A 1IPKA 3G6JB 3M2MA 3MW2A 4MX3A 1DQ6A 4YVSB 2X29A 3AYAA 2WO3A 4AFMA 4GMP0 4Q4V3 2ZHKA 1FMD3 1V6LA 2BWCA 3VBOB 4SBVA 4YW2A 3WSOA 3JBG1 3N35A 1NCRB 4HSLA 4IGQA 1UMIA 2NYYA 4A2UA 1JOPA 1NA1C 2WZEA 1IPSA 4AEJA 5JAXA 2W0XA 3HBKA 2R0HA 5BNOB 3SEPA 1ENXA 2E26A 4XFHA 4UW4A 5FYHA 5L7OC 1OURA 1TNRA 4CCCA 1F35A 3TWIA 4LBQA 3N7LA 4QPWA 1WCKA 2V4VA 5FYYA 3KCCA 3S5AA 1UU4A 2VG9A 1YFYA 2VOKA 4V2WA 3SMHA 4RQPC 4I02A 5JXIA 4XZPA 5LEJA 5EV7A 4NPLA 3ZYJB 1CAWA 1TMF2 1PVC3 4PJYA 3U14A 5J36A 1X9TA 1AYN2 2EIBA 4DOUA 1D4M1 1LU2A 5E88A 1Y43B 3I49A 4JKMA 1XPWA 2XKPA 3I2IA 1PK6C 1RYYA 1ULFA 4AHZA 2BPA2 4Q0UA 3PDQA 3NRUA 2GZWA 4AVCA 1FXZA 1LESA 4JHZA 4XHBA 3GZUC 3HNMA 2B9VA 4AAPA 1GZWA 4MYEA 5DAXA 3T0AA 4QM8A 1VBB3 4QQOA 1C3HA 1OFNA 4CDQA 1F9KA 2A73B 3A22A 4NWVA 1MACA 1F2NA 4E4ZA 3C7EA 3LSDA 1N47A 5JZGB 2WT2A 2WNVB 4KGQA 3DPRB 5FPBA 5FO9B 3H50A 4QDSA 2Q4SA 5IYYA 1H2LA 3RMYA 2VM9A 2DVFA 2Y6GA 2ZEWA 4IQPA 4DEVA 4Z1VA 2P6CA 3TN91 3OPWA 4FFIA 2CHHA 1FOD2 4MXWB 1QEXA 2VAUA 5DUXA 3S30A 4QQPA 5KBFA 5LBEA 1M06G 3NMBA 1LU1A 5K8SA 3V56A 3ACGA 3IDEA 1MZ6A 1R082 1MQTB 2DU1A 3VGIA 1Y4WA 1Z7S1 2WNOA 1U12A 2F4LA 3VDBA 1W8OA 1ZA7A 3NJXA 1QMJA 3JCIA 2ZGMA 1L7LA 5FYSA 3B94A 4OI2A 4RR3C 3KZ4C 1O4TA 3FJSA 1B35A 1DLCA 1PM7A 2RVAA 2NQYA 4IV3B 5CKQA 4YGEA 2PELA 3K4DA 4LK7A 1AHSA 2XJRA 4HFSA 1GANA 4Q4Y1 1Y7BA 1WCUA 2VUDA 1VE0A 4XPVA 1YYNA 1POV1 2OUJA 3UK9A 3ZR6A 3A0NA 4PHZA 1URXA 4NIHA 3GCWA 4YGCA 2XBO1 1C57A 1YIFA 2VXRA 4MGIE 1XNCA 2VU9A 4AK3A 4Q4V1 3MV11 1FMD1 4XJ9A 2WLPA 3MUZ1 5C8CB 4EWDA 1LJ7A 1NZIA 1OQ1A 1J3RA 1IS3A 4QB1A 3SHRA 4BQWA 1K42A 1WD3A 1COV2 1H9PA 4GKXA 2MEV2 2Z79A 2XJVA 2YU2A 4R8HA 4XVHA 2XL9A 1NE6A 4Y3OA 1DZTA 4N8MA 2E31A 4QDQA 4DY3A 1X8MA 1Y9MA 2J1AA 5FY7A 1REFA 1MZFA 2D3SA 1PVC1 1T6BX 2RS31 4CDXA 1BMV1 5CKMA 5L9BA 2DTYA 2QTWB 3GYDA 1UPIA 5IAVA 3WF3A 1OUSA 2QUOA 2HEVF 2R071 2VTXA 3TNPB 2H6CA 4AEKA 4AOCA 1OI6A 3AL6A 5C9AA 5FBZA 2ZX3A 1GQGA 4HPKB 1S2KA 1ZX5A 3MDPA 1UYXA 4X8PA 1PMHX 1W9TA 4LXLA 3C2UA 3AP9A 2A6XA 4GD4A 3D8CA 5DDJ2 1X82A 1O7FA 2QCSB 4A45A 1VBB1 2RM23 2X10A 5LRRA 1YFUA 3GHMA 4FXGB 3OTFA 5FMCA 3T3YA 4CXXA 4H2AA 3POJA 4BQYA 3RSJA 1IPJA 4KI5M 3M8LA 3ATGA 2CWSA 2DCKA 3MIBA 1LEDA 2YGMA 2XWBB 4JGZC 2CDOA 5FP4A 4XF4A 2VZ1A 2I45A 1GYKA 1W9WA 3POWA 1QJU3 4L9BA 4Q4W2 4CCNA 1A8MA 1MPXA 2IC1A 4ARXA 3KM5A 4UAPA 2YC2A 4GXLA 2G9FA 1LECA 2D93A 2YHJA 5A6XA 4YGDA 4HBNA 2VOXA 4LE4A 3PL0A 3P5BA 2HWE3 4ISQA 4N53A 4XMAA 1G8WA 4DQAA 5BNNB 4XEZA 4LK6A 2CYFA 3D82A 2R042 4MGKE 2D43A 4EQVA 1LOBA 2XLFA 1FAYA 4M00A 4ASLA 4HKLA 1W9SA 3N9OA 4AGRA 3O1RA 2W1QA 3VBRC 2A3WA 4AHYA 2KD7A 2R30A 3WP5A 2O8QA 1Q5OA 1YQCA 4IEVA 1IG3A 4JV4A 4YG3A 1HX6A 2BGCA 1X50A 4HETA 2MNGA 4ZKTB 1OPOA 5FZ7A 4G4FA 3ZPOA 3BOPA 2QQMA 4AVBA 2WBKA 2IFWA 3E6DA 2D44A 3V65A 3GHNA 2A6WA 1I6XA 1VP6A 2YFZA 3KT1A 1JBCA 3AMQA 4CXWA 5LY1A 1AX2A 4DXRA 4KL1A 5D8AA 1H6XA 2HH9A 5FP9A 1OMIA 1UKGA 1CAVA 3DKQA 3WQ1A 3UKVA 3ZN6B 3PUIA 2ZMLA 3J7LA 2FZ1A 3NO8A 4Z82A 2VCBA 1KDMA 2G19A 1FOD1 4OVEA 3ZO0B 1E57A 3WEZA 3TBDA 4IV1C 3PMSA 2PTMA 1QNWA 3WQ7A 2WZR2 4DO0A 4Y22B 1C8NA 1R081 2ZGKA 1QWRA 4Q1RA 4DIQA 3NKGA 3ZKYA 4E4DX 1HV0A 1W99A 1WW4A 4FQ4A 4CCJA 5I91A 5JXJA 4DMIA 3X29B 2VNRA 1UOGA 3VBHA 1BZWA 1GNZA 3LZZA 4P9JA 4GB32 1F31A 4NPMA 4JZRA 1PZ9A 1HQLA 1CESA 1JZ6A 5BPXA 4BISA 1PNGA 2WNUA 1I1EA 4AHXA 4NIAA 3BB6A 4CCMA 1PO13 1RUF3 4LBNA 4QPGA 5FMOL 4QPIC 5JXGA 2B9UA 2RM21 4QDRA 2NPIA 5A7SA 1R1A3 1V70A 3MIHA 4XUOA 3Q8BA 1YFWA 3RJRA 4LOSA 5A3MA 3ECQA 1W3XA 3ABZA 3JD73 5F3EA 1XJAA 4QB6A 1NG0A 4LKSA 1LEMA 1A34A 1ZRIA 1R1ZA 4AFDA 4J1WA 4YW7A 1V6NA 1F5JA 1WLWA 1JOJA 3AMMA 3CL1A 3A7QA 4XIOA 1TQ5A 3UGGA 2YXSA 4PF1A 3OBTA 3VD5A 1COV1 4XAEA 4A44A 5FUIA 4E8CA 2MEV1 3DL3A 2VMHA 2ZAHA 4NRQA 5LK5A 4IGPA 3HVDA 5FQ0A 4O61A 1G9FA 5HV0A 3OEBA 4L92A 5JOZA 4YVSA 1EPZA 4BIFA 1AR73 4GWIA 3ZXEA 4IEWA 1AJOA 4WVWA 1Q43A 3VBOA 3MFCA 1NCRA 1FV3A 3HQRA 1HKDA 2PLV2 4S2FA 5FPZA 3T30A 4AGVA 4GB33 1WW6A 3TOJA 2QQIA 1XE0A 3WD5A 4B4RA 3A23A 5BNOA 4B1MA 3VHOA 2GMEA 4WM7B 3OGVA 4Y5SA 4YVWB 4JQRA 4LBMA 4AXOA 1RTVA 3WDTA 1K5JA 1NZCA 4K1ZA 5FZCA 1K45A 1POQA 3KGLA 2VMCA 5DDJ1 4JVAA 4WM8B 2QZ2A 2HYXA 2ZMKA 2TBVA 1W2AX 2PHLA 4JHTA 4AEMA 3FBMA 3ZLIA 3NNFA 1WA4A 4XCBA 5FZ9A 3E5QA 5JSRA 5E6HA 3TRSB 3F95A 4CCOA 5FPUA 2ENRA 3W5NA 1BEV2 3J7MA 5LZ6A 2B42B 5B2GB 3QOPA 4IEXA 4Q4W1 5KHKA 1IKPA 1H1IA 1UY1A 3TEWA 1ULEA 1W6QB 3VKFC 1MS8A 4CEWC 4PCRA 2WC2A 4FOVA 1F5FA 4BU2A 1LOGA 4N7IA 4E2SA 4MHRA 4OYUA 1C5IA 5CVRA 2AH2A 1HRV3 1W8HA 2V09A 2OZJA 2A6YA 3NV2A 1NXD1 4NOTA 4OULA 5CADA 5JZGA 2CTVA 5LA2A 5I0RA 2WNVA 1DYKA 3DPRA 4JGYB 5T5LA 3W21A 4ZS3A 2YG0A 5FLHA 2KA3A 4HZFA 2ZEXA 5FOJB 4BK4A 3R05A 5JI7A 1XSRA 1SLTA 2HWC2 4PLMA 4R9DA 1GFF2 1V6KA 4GWNA 1SFPA 1PZ8A 4PDWB 4MXWA 2QFEA 3N7JA 3R0RA 1AF9A 5L9RA 3W58A 1JMUB 1HIXA 4QXKA 4UI9L 2CU5A 2GNBA 3TEZA 1CQ9A 2AR6A 2ZPXA 3FHAA 3HT1A 5DQ0A 2FCUA 3ZM8A 4GH4B 1MQTA 2VZUA 2GC2A 5EJZB 4QHOA 1R1A1 3POBA 2QQNA 4XQDA 5FCCA 4DEQA 4XBQA 3FLPA 2BWAA 5AVAA 3U11A 2Y8KA 1GLHA 3LIHA 1UL9A 4R9BA 4AHWA 1WMEA 3Q9OA 4IV3A 3N9QA 4V1PA 5C3SA 3J7NA 3AYEA 3PJYA 2E6VA 1HDKA 2BYVE 3CHXA 3KQ4B 3U78A 3WDYA 5FFOC 2JG9B 4BLJA 1Z78A 2OS2A 3CJIC 3FN9A 1G6NA 3CJXA 2RR12 3H8UA 4FPLA 5JOWA 2WZR1 5EYYA 3O1UA 1EPWA 1X7NA 3AB0A 4JTNA 1N1VA 2R6QA 3I59B 1AR71 4RHV2 2BGOA 5HPOA 1JYWA 1U5IA 3WT3A 2WQZC 3LDBA 1PMJX 4J1XA 4M3CB 4MLOA 1MVEA 4YYOA 2JIGA 1SEFA 1DQ4A 3GBWA 4R52A 3IPVB 3PJQA 4GB31 2BRTA 1YC61 1VJ2A 4OQ9A 4ZY9A 5BNPB 4XIKA 1A8DA 3NAPB 4E9KA 1OLRA 1BQPA 3DV8A 5JPNB 3KVBA 2OA2A 3MZHA 2HWF2 1TE1B 1Q8OA 1VBA3 3PTRB 3NJVA 5GLUA 1WD4A 3SQOA 2VZSA 3ZIWA 2WL1A 1B09A 1D7PM 2FDJA 2VVFA 4PLNA 5JXHA 1O5UA 2HWD2 2I07B 4MZUA 2B45X 1OA3A 3P3PA 3MBWA 2R49A 1G9CA 4QQHA 5FZ4A 4AFAA 1G9BA 3IT8A 1IS5A 2PN5A 1KS5A 1ZZ9A 3OPTA 2DYCA 4KH9A 5ANQA 3MIFA 3RWNA 5FZ1A 4YFWA 3KSCA 2DU0A 2ZKNA 4FI9A 1W0PA 1W6MB 1SLIA 4XFCA 3IWZA 5DZFA 5K4LA 3WG1A 2VCMA 1OLMA 2NP0A 3S0MA 1A6CA 2B4KA 2D40A 2E32A 5JWPA 4XJAA 4CCLA 4RFRB 4XBNA 4YSFA 1NA1B 1ULDA 5LATA 5GJ6A 5J7MA 1JHNA 1WW5A 2VW2A 2YBPA 2A75A 1N3QA 2PLV1 5L7OB 1RXFA 2JX9A 3O1VA 2GAUA 4AVTA 4ES8A 5FPLA 5FXVA 5T3NA 4P9IA 4XDPA 1EAH2 2LALA 5DUVA 4YW3A 1VBE2 2GH2A 4PIYA 1OT5A 3KT4A 1JU3A 2K0GA 2Q30A 4RQPB 1C1FA 2DVBA 5EIYB 2DCYA 1UZVA 2HEYF 4B29A 1PO23 4JKKA 2GP5A 3WDXA 4XZUG 1N3PA 4QQ2A 3RFRA 2MHFA 2K9ZA 1REEA 3M4FA 4FO9A 5SV5A 1YJLA 3LOIA 3ZXLA 1ND3C 4B4QA 2HLEA 1PK6B 1OHFA 4ZS2A 1QXPA 4YG6A 5FYCA 5A32B 1ZBA2 5LB6A 3AL5A 4ZPIA 3O1PA 3EO6A 2WYSA 1W8NA 2J22A 4LE3A 4AI2A 1ZVFA 4O65A 3WQ0A 4FTBA 3ZYIB 2AUYA 3KD4A 4HANA 1VB2A 2WJSA 1RVF2 5F39A 1W04A 3H7YA 2N7GA 4BWOA 4LQRA 2QNKA 2QQOA 3B7MA 2F17A 4Q0PA 1W2NA 3AP7A 4ZU4A 4Z2AA 3RZHA 4UFKA 1QHDA 2ET7A 4QKNA 1BHGA 4IE6A 1CWPA 1ZA4A 4L99A 3MYXA 1PGL1 4OMCA 2VUCA 3WLUA 2VZVA 4PBOA 1OOPB 2DV9A 4OHXA 5CU1A 3D4KA 2OQ6A 3VN4A 1Y9QA 3ZN6A 1T2XA 3DF0A 3THTA 1EAH3 1OA4A 2HWC1 4BIOA 4CP2A 5ABJC 1XNBA 3AC0A 3ZXJA 3GBFA 4JC1A 1RIRA 4P14A 2J42A 1F8VA 5FPVA 3ZSEA 3KMHA 3USUB 1RL3A 4AYUA 1MVQA 3GJAA 5D21A 4QHBA 3SKJE 3PIJA 5G05L 5DZGA 5EFUA 4AI8A 1HLCA 1H0BA 2Q1ZB 4Y22A 4CYDA 3CLPA 2PQQA 1QIQA 1UOJA 1W8ZA 5F6LB 4BH9A 4FPJA 4K1YA 1A3KA 1OQEA 4UFJA 3TNQA 1AX1A 2WA3A 1OBNA 1PNFA 2NM1A 3ZYGA 3DYPA 4RR3B 2VGDA 3WZ1A 4NRPA 2ZGSA 2D6PA 3SCFA 1HN1A 4N9HA 1C8M3 1RUH3 2ILMA 2PAKA 3POGA 1GWMA 3QACA 4Y4YA 3H1WA 2Y6HA 3WOGA 1DQ5A 3PTYA 4KG0A 4YW5A 3ACFA 1XBFA 1QH7A 1W8WA 3ZFFC 1KJRA 3PVOA 4CPBA 1AUYA 1QOOA 3R6SA 2RR11 5FP7A 3UT0A 2XH6A 3AMNA 3JQWA 3FL7A 4RHV1 4KNCA 4YZ2A 2UURA 4KWKA 1ND2A 3T09A 1Z7S2 3J8F3 1GQHA 2XR4A 2PMWB 2OT7A 1H6YA 3GF6A 3MV01 5JMCA 2WWJA 1HB4A 2J1SA 4LITA 3ZYHA 1OUXA 1H2KA 2J1RA 1WLTA 2ZTNA 4META 4X8NA 4WV8A 5DAVA 3WW3A 2A7AA 5IK4A 3M3EA 3MLKA 3MW3A 2TEPA 2KXLA 5A7PA 3NJZA 5H9QA 3FMGA 1V9U3 2HWF1 4D7TA 1UY4A 4B4PA 4MG2A 2VUAA 1UMZA 5LA1A 5C6CA 2OIIA 4EN7B 3LE0A 4P9GA 4PF5A 3WUDA 4NAMA 1AVBA 1GOFA 5KC6A 1OPMA 1U0AA 1CR7A 2HWD1 2XBO2 4DFSA 1BK0A 4LKEA 4AVAA 5I8TA 2VJXA 5GLTA 1WBLA 2RMU2 4Q4V2 1FMD2 4N7UA 4LORA 4YVWA 4DXTA 3OY8B 3BPSA 2YPJA 1MZEA 2YROA 3VHPA 2VBPA 3QD6A 3OPZA 4XTPA 1S0EA 3ES4A 4WM8A 5IVYA 4XW3A 1QXJA 3VUOA 3V0BB 1V6OA 1NCQB 1NT0A 5CG8A 4EZ4A 4HLTA 4JAAA 3SCHA 1ZREA 1OVPA 2EXJA 2G9ZA 3T1MA 4JGZB 1E5HA 3UJQA 4QWNA 3EHKA 2EALA 2DUPA 3VDDB 3I3MA 3WF4A 4BB3A 3BTXA 1S2EA 5APAA 4OFGA 3UETA 3VBUC 1LOFA 3T08A 3O1SA 1EAH1 1W6QA 5K0UC 2D7FA 1W28A 3D5OA 4FFHA 3S7IA 1VBE1 4P9WA 4Y24A 1GNHA 3LAGA 3HMYA 4PI2A 2VW1A 4LBJA 2PHRA 1FYUA 2OX0A 4YM2A 1GP5A 3IDCB 5A3PA 3ST7A 1VBB2 3R4SA 1SFNA 4JGYA 1YQ2A 1CPMA 2JB4A 3KLSA 3WUCA 2JDKA 4ISRA 1CAUB 3K51A 2IFRA 1ZBA1 3OBAA 4E2GA 3DUIA 3HQUA 4CUCA 1RUI3 1UCXA 2ZGTA 1QGLA 1C8M1 1Q56A 2RMU3 4PDWA 5FY0A 2W91A 4YM1A 2C6SA 1RVF1 4IEPA 2EXHA 3H3ZA 3ZFGC 2D5FA 2VH9A 1HB1A 1YFXA 2BVVA 5A1LA 5FZBA 1LNSA 4Q8KA 2BBAA 4GH4A 5FYMA 2P5BA 5I0DA 3BTAA 5BXXA 4GKYA 3E5UA 4YM0A 3OCPA 2ZGLA 3WINE 5C4WB 4IUGA 2NLRA 4BQ4A 1B35C 2AEZA 5DAQA 5IVFA 1KEXA 4NROA 4X6QB 4XUNA 2P6HA 1ZM1A 2ZOEB 2SLIA 5HXMA 3AKPA 2P37A 1ODMA 3DGTA 1JYNA 3KWVA 3MGUA 4LLFA 3TEYA 3N9LA 4RSUA 2RJLA 3KV4A 3R4UA 4IV1B 4LKFA 4AVSA 4BLIA 3FE5A 2JG9A 2YDEA 1W2OA 4CRQA 4AQTA 3ZYRA 3S57A 2PHFA 3WF0A 2P1BA 5C8WA 1PIV2 2VOTA 1UZWA 3I59A 3BCWA 1E5IA 3WW1A 3EMRA 2B39A 3KQRA 4M3CA 3MLJA 1BYHA 3FHIB 2D5HA 1W05A 1ACCA 2VR4A 1VMFA 3H8OA 3IPVA 3AVRA 1LOAA 1LENA 5A6ZA 3U10A 4XJWA 3T4HB 1QJY3 2ZCWA 1QH6A 2D97A 4OHVA 5BNPA 3Q8AA 3NAPA 5FZOB 1OF3A 4F3JA 4QPIB 3ZXGA 1JZ2A 4Q4X3 2ZABA 1HQNA 4JCKA 2Y0IA 1HRI3 1Q8VA 4L97A 4HXCA 1S55A 5H9SA 2UWBA 4GQ7A 1LB2A 3P6BA 5FP8A 5HCFA 4OHYA 4LNVA 3CDZB 4YW1A 1YEWA 2VECA 3GGLA 3M3QA 4TYSA 3KF5A 1BVP1 3GDBA 4OHZA 3TB0A 5FO8B 3NNMA 5AFEA 1JZ3A 4WVZA 3O14A 2J1TA 3V0AB 2FDFA 4JTOA 4WVMB 1VRBA 2Q5TA 2ZEYA 4M3CF 1KQRA 2QDNA 4HONA 4DUWA 2QQPA 4YRDA 2GSYA 1SMVA 1W6MA 2ARCA 3HNBM 3POSA 3AXDA 5C3OA 1W03A 2DCZA 5T5JA 3D3AA 1HXS3 2BNMA 3CO2A 3HQXA 3VKNA 1PIV3 3WVJA 4LPLA 2BERA 1MS1A 5J98B 4NIGA 1V6MA 4YZ1A 2RM22 3POEA 3AZZA 4AG4A 1K5MC 2JDAA 2Y6LA 4M4RA 3NSTA 4E4SA 3RJ2X 5J37A 5L7OA 1NLQA 1R093 4NHXA 5IVBA 4OUMA 5A3LA 2HKXA 3ZPYA 1O3SA 2ARBA 1G86A 2RMU1 4M01A 2FQPA 5DG1A 4RQPA 4HL0A 1IHMA 3BPZA 3LDRA 1ZBE3 1QJU2 4N53C 5AC93 2W87A 3M70A 5FZDA 2JIJA 3K3NA 4BQXA 1PMIA 2ZA9A 2XJUA 1YNAA 5FY9A 4XUPA 2BNOA 3RQ0A 1L7RA 2PYTA 4W6YA 2XG3A 3B5LB 1LHNA 1GSLA 4BHPA 3OUJA 1BBT3 5F5IA 4QPYA 1KITA 1PK6A 1TVGA 3K2OA 2XONA 2CV6A 4UFHA 4AE2A 2WWSA 4CP9B 1CIYA 2HWE2 2JJ6A 4K8FA 5IJRA 1NY72 1DBNA 4CA9A 1XXNA 2DURA 2D6KA 3I2HA 4CEWB 4FFFA 4COUA 5JOYA 5FLIA 1JZ4A 5HBAA 2D6NA 2W92A 5C71A 4IESA 2ARAA 4JKLA 1ULCA 2D3RA 1UN1A 5IFTA 1LHOA 3ZSMA 4N9IA 1RINA 3WNXA 3OOXA 4F7ZA 3I2OA 2KM2A 3APBA 1DLLA 4AW7A 5JDBA 1AXYA 4XFIA 5LWBA 1OOPA 3CKHA 3KV6A 2VMFA 3LD8A 1JN2P 2RDRA 2V5YA 1NLSA 5A80A 1DGRN 3WXPA 4FSJA 1CD3G 2Z2SB 5FKBA 2XVKA 3MF9A 3USUA 3JU9A 2YB7A 1NXMA 5IFPA 2J1EA 1ENSA 2E33A 1GICA 1M4WA 3N9PA 3ITQA 2EVXA 3UV9A 1RHI3 2JD9A 1VBD3 4GJYA 2C4XA 2JICA 2V4AA 3L2YA 2BUKA 3RZZA 2SBAA 1WCQA 4RR3A 2NMNA 3WNMA 3TAYA 5EPAA 1SDDB 4BXFA 2OW4A 2W1WA 3FLTA 3IKWA 3AJZA 2ZZQA 4LBKA 1VLNA 2EA7A 4D94A 5EWSA 4DS0A 2YZ4A 2VC9A 3K48A 1CN1A 4QX3A 1J1LA 1GWKA 4XJ8A 5L73A 4CVUA 1DZQA 1SLCA 1X36A 4JDOA 2X8KA 3CJIB 3WG4A 4K21A 2W1UA 1QU0A 3N7MA 4NHYA 3DEMA 1SLBA 1H8VA 3ILRA 3SH3A 2LM3A 1PIV1 1QY4A 4URTA 1ULGA 2LRPA 3LFMA 1PO12 1RUF2 3VBSC 2RDSA 3KB5A 2X53S 1HN0A 4P9LA 1R1A2 2JG8B 1N1SA 2ZGUA 3WX5A 3SISA 2WYFA 4Q1PA 4D6SA 4XQ4A 3NWKA 4TTGA 2BOIA 3JD72 3E6CC 4OLLA 5F32A 1H9WA 4XJZA 4QX0A 4QXBA 1I9RA 2YC0A 3CBNA 1NE4A 1ZBE1 2A1XA 2HWB3 3OGJA 5AC91 1DDLA 2XJTA 3I2GA 4AQSA 1CX4A 1RUE3 5FV3A 2PAEA 2EF6A 2QVSB 5BYNA 1H4HA 4XFFA 5HV4A 1O8SA 3OBZA 2VTXJ 3PVNA 1RUNA 1ZRDA 4AR2A 1AR72 1O8PA 3FX3A 2WABA 3AM2A 4QGNA 1LHUA 5KXCA 1QJX3 1US3A 4JRAA 4NE9A 4Y5Z0 3O0XA 3ZIXA 2O8OA 1WLDA 1UO9A 4OHWA 3NL1A 4IXLA 3I7DA 2E7AA 1FNYA 4N43C 2VMIA 1ULPA 3OUIA 5BNQA 3DCQA 3S7EA 3ZN5A 1VRH3 4RN5A 3HJRA 1NCQA 4R9AA 3SH4A 2WLQA 5F3IA 3ILNA 4AEDB 1GZCA 3CIHA 3LB9A 2VVEA 5AVPA 5LRSA 4QX7A 5FYBA 4JGZA 2JB8A 1UW8A 3RS6A 3VZMA 4FOWA 1K3IA 3OB8A 1KDKA 4INDA 3VDDA 4EN9B 3OD0A 4QXHA 4ES9A 1S0IA 3RMXA 2CDPA 5FWJA 2E63A 5CBLA 3AYCA 1ST8A 1US2A 3THPA 2QQWA 4ET7A 3SC7X 4CUBA 3I3QA 1YQ6A 4W50A 1JODA 1UWWA 1IOAA 1UU6A 1W2UA 1QJU1 1APNA 2P34A 3Q8EA 4W8JA 4K3UA 4RYDA 1JH5A 3JB4C 4GMP3 5EQUA 1UKRA 5IK5A 1RHI1 4CU6A 4DINB 3IDAA 4BA6A 5FYVA 1W8FA 2TUNA 3OBRA 4NIIA 3H8RA 1HRV2 3IAPA 1CAUA 3WNPA 5FTTC 1AZDA 4QMAA 3GBGA 5HCHA 4YZ5A 1ZZBA 2HWE1 5DPNA 4D3WA 1UYPA 3W9AA 1NY71 1G9AA 4ATFA 3WCSA 3BODA 4LO5B 2X05A 2ZHLA 2ZX1A 3GM8A 4HVQA 3Q8FA 4ARYA 4CCEA 1MQTC 1RUC2 1OKQA 3MPPG 2Y34A 3OF1A 2YMZA 4LEJA 5ANNA 1WUVA 1RUG2 2XJPA 2VNOA 2XXZA 2W1SA 2QQJA 1KGYA 5IK8A 2ZXQA 1N1TA 1UZYA 1DG6A 3FUOA 2YU1A 5C4WA 2DCTA 1AYM3 3K3OA 2B7YA 3HN1A 4XACA 2IVIB 2Y64A 2HYKA 1YIPA 1OXCA 4Q0QA 4Y1VA 5F8PA 5FY4A 4DUVA 3FWEA 4XDQA 1O3TA 4RA0A 2WSUA 4WVVA 1YI9A 1JHJA 2J1UA 2GN3A 4F8AA 5JMOA 1AL23 2RJKA 4IV1A 4MGYE 4IEQA 4O9EA 1DYPA 4Z07A 5CFDB 4RS5C 2WS93 4FPCA 3WR0A 2FZ2A 2FBEA 5IK7A 5K9YA 1SG3A 4D6RA 5B4NA 2WZ8A 4UBGA 3P3NA 1RJ7A 1RUE1 2LW8A 3J26N 4ZXKA 2C9AA 5CFCC 4LIVA 4AFCA 1WBFA 5GZEA 1NQDA 5D2AA 2V73A 5FY5A 4HN1A 3RYKA 1UYZA 1GQPA 2IXKA 4I3PA 3IM0A 1PGL2 1Q3EA 4LOTA 1OKOA 5F5CA 1Y9GA 3N36A 1LGBA 3E5XA 4A7ZA 4BMBA 1QDOA 1EV13 4IERA 4FP2A 3ETPA 3N7KA 3B3QE 3ZYPA 1UY0A 5FZOA 2D6MA 1JYIA 2WO7A 4QPIA 5F7UA 1RUC3 2ES3A 1JU4A 5FZAA 3J4UH 1V6IA 1RUG3 3MW4A 5CB7A 4MHUA 3WNLA 1VRH1 1NQJA 3ZYBA 3O1OA 4ZXEA 5JR7B 3WCRA 2ZMNA 1OA2A 2EIEA 5ACA2 1PO11 1RUF1 1RUJ3 1S0FA 4JDNA 2GC3A 3VBFB 1CX1A 4XFGA 4B7EA 1ENQA 2B5HA 4E4HA 1VBA2 3V0AA 2RS12 4WVMA 5J96B 1XNTA 2X5IC 3RI8A 3ZKUA 1DF0A 4TLFA 5IATA 3IIAA 3M3IA 2W95A 1Q8PA 1MS3A 3JD71 4TLGA 1JUIA 3LQCA 3PIGA 3T4VA 2C5DA 2AENA 3AZWA 3I4IA 5FZMA 3B01A 5A70A 4LULA 4URAA 1POV0 3EB7A 4GMP1 2WNEA 1RGSA 4CEYC 2OQ7A 2QQLA 3FUQA 3LA2A 4CSWA 4ZHNA 5GLVA 4F83A 2YFUA 1DQ0A 1DGWA 3C7OA 3ZXFA 2VNVA 2DDUA 2WDBA 1SFYA 2RDQA 4KBBA 5A7QA 5C8CA 1AXZA 1VBC3 1VALA 1H8TC 2UY9A 5E89A 2R063 4UFMA 3FC0A 5LBBA 4A42A 3ELNA 1Z0HA 2BV4A 2RHPA 2WN2A 3E1F1 3H9AA 4BJ0A 2J7MA 3RRDA 2VQ0A 3SNMA 3EQEA 3I3BA 4W65A 5FMDA 3N3HA 2E9QA 4ITCA 2PHXA 2WSVA 5ACA3 2JE9A 2QJVA 2W2IA 1PO22 4P02B 1CGPA 4QX8A 1GBGA 5HXVA 4CP9A 1L7QA 1OF4A 3AVSA 4MVTA 2BW8A 2RS13 5SV8A 3VBUB 1O3QA 5C3RA 3KT7A 1JTZX 2P17A 1X8EA 1GV9A 4A41A 5K0UB 1YQ5A 3C3VA 3SCGA 5B4XA 4CEWA 2I2SA 2XVGA 1AL21 5CISA 3PUAA 1LKNA 2IXHA 2QKDA 2Q0AA 4HPKA 4MADA 1CZSA 4EROA 5I93A 1RMU3 3IZOA 1VMHA 2VBDA 1NX9A 3AYDA 3FFQA 4H3WA 4LO4B 4UBHA 1MR5A 4L0PA 5FXWA 2BFUL 1UZZA 2A71A 3CZJA 3ME2A 5FMOS 1VAMA 4C1XA 4YWAA 5FZ6A 3K4ZA 1HRV1 3SITA 5FPAA 5FMBA 2YUEA 2J1VA 3I97A 2QQUA 1FX5A 4WZFA 3DXTA 5A6QA 3ZXKA 4AVVA 5DXDA 3KVAA 2FDHA 5DMYA 3ZFGB 4P5HA 4TSVA 1EV11 1TZOA 5TSWA 3BIEA 2FMDA 2ORXA 3HBZA 4QU1A 3ZXDA 5GZCA 3NVCA 1XE8A 1RUC1 2BU9A 3ILFA 1O5LA 3SXWA 1RUG1 1OLQA 5DG2A 5F9TA 3MUY1 5KXDA 4R4XA 5M0TA 5EHDA 2R0FA 2GN7A 1RUJ1 1YRZA 2WFF3 2CAVA 5BNNA 4OZOA 5FYZA 2JENA 1ZRCA 2Y6KA 5FR3A 1JYVA 2AZ5A 3RGBA 4QGLA 3O0WA 1MEC3 3MHZA 3RDIA 1S1AA 2C0ZA 2Z69A 1BCXA 1T6GC 1Y3TA 5J1XA 3CJIA 1C8M2 1RUH2 4XCAA 1E5RA 4YZ3A 3MO4A 2H0VA 1S4CA 4PI0A 3I54A 1ND2C 4TN7A 4CXYA 3AP6A 1PX4A 1GMMA 3IMMA 3PUSA 2PQSA 1GP6A 1UXZA 2AREA 3M3OA 1UIKA 3NV3A 2JG8A 2O14A 5JIAA 4H55A 3ALQA 5KR7A 2PFWA 4I09A 4GALA 4IGOA 3BVCA 2CL2A 3MIGA 1TME3 5EP9A 4CDWC 1DGWX 2XQRA 3J8F2 1VBC1 2A3YA 5I0TA 5LBCA 3LGRA 2VQTA 1QJZA 3ZSJA 1UD1A 5F2SA 3RZKA 2NZ9A 1WMDA 3D0SA 3WDUA 4XOGA 3AKSA 2CSGA 1VPHA 1FV2A 4IW3A 3RWKX 2C24A 1YLLA 2OVUA 3NV4A 3AFKA 1XE7A 4O9GA 2D98A 3TYJA 3VZKA 4D6QA 4IL7A 4XHXA 5ACA1 4I2OA 2VZRA 4TWTA 2ZGQA 2FCTA 4FFGA 1V9U2 5EJ1B 2GMMA 1LGNA 1D0HA 3LEIA 3WHUA 1VBA1 4AQ6A 2RS11 4OUSA 4QD2A 1HJFA 1QKQA 4D69A 4WM8C 3LIGA 4LLOA 4B8EA 5CKNA 4ORFA 1YXWA 1W3VA 2GNDA 1BK1A 2FDKA 2XGXA 4XUTA 4AEDA 4CCDA 4S2DA 3VKOA 2AEYA 2VD7A 3O7OA 4YZ4A 4M3CE 4NJ4A 3H8XA 5FLJA 4XURA 1K5MB 3WV6A 4Y20B 2G4IA 5FK8A 3S5QA 3DYMA 1W8TA 2DVAA 3ZOIA 4PLOA 2H0BA 4Y33A 1H30A 5F6KA 3POYA 2VTFA 4PIXA 1V0AA 2XL7A 2W3JA 1NOVA 3O5SA 4S2GA 4D0QA 1DHKB 4YGBA 3WQBA 4N53B 3VD4A 1TEIA 1DU3D 1FATA 1W0OA 4PQ9A 5I0SA 1CJDA 4FOYA 4XXPA 3T2OA 5LY2A 4GAZA 3JBG3 4NAOA 1UIJA 3VB9A 3ZFEA 3BGAA 2Y38A 3AZVA 2ZGNA 3U37A 5JVVA 3AKTA 4CDUC 4KMQA 3KS7A 5FYIA 3H1YA 1PGW2 1YO8A 2YPDA 4FT8A 4IE0A 4LIUA 3UKTA 4A3XA 1QF3A 3H7JA 2JKXA 1PO21 2Z5WA 3ETQA 2WO1A 4RGKA 1W2TA 2BZDA 1XNDA 2WFF1 3JUUA 5A7OA 1S0GA 3DECA 3ZXAC 3AK0A 3JXSA 5JOXA 1VB4A 1DYOA 1HW5A 1SLLA 2BQPA 4B3NA 5IVCA 1GWLA 3T1LA 1Q8SA 4Y5TA 1ZRFA 1D4M3 1MEC1 2A6ZA 1J58A 2WA4A 3UL2A 3H0OA 1RUI2 3IIIA 4RGAA 4FVVA 4WM7A 4RGGA 4COYA 1XOYA 1CAVB 3IBMA 4QHZA 4XABA 1I5ZA 3LEKA 3JZVA 4QX1A 4RL7A 4DB5A 4JRLA 4I0AA 1W0NA 1LHWA 1H2MA 4HK9A 1QXRA 2ERFA 4XF3A 1MS0A 2WQ4A 3PVBB 3WNKA 1ASJ3 3LPGA 2JG9C 4OI4A 4XQWA 2JE7A 3HN3A 2LTNA 2VZQA 1BVVA 3FFZA 3MEPA 3PLQA 4EV0A 1WKYA 3LSEA 5EYXA 3AMPA 1SCSA 1TME1 5CFDA 1AR63 4AF9A 2R1BA 4EYUA 4BMEA 4CDQC 2EIGA 4EN8B 4ZU5A 1ZRRA 4AI1A 1RUD3 3BKZA 3TN93 3VD7A 3RVHA 4CTEA 5F37A 4FXKB 2VCAA 2F4PA 2AACA 2R7EB 4KQ7A 4XF1A 2RG4A 3ZMOA 4Q0SA 2W47A 5F3GA 4AFBA 4COVA 5BNPC 3KHCA 2DTWA 3UKNA 3NAPC 3NNJA 4L11A 4NHLA 3OSDA 3NQHA 3VBRB 4NVPA 1C5HA 1W6NB 4XUQA 1NKGA 1H4GA 3BUCA 1DFQA 1ULOA 3U0ZA 3ZYFA 2YY1A 1RUH1 1QJY2 1YQ8A 3IAQA 2XVLA 3T0BA 3UGFA 3VBSB 2Q1FA 4Q8LA 4XXAA 1Q8QA 1ZNPA 1LOCA 3CEWA 2O0OA 3VKLA 1N1YA 4Q4X2 1SLAA 4FPFA 3VBFA 1HRI2 4DZGA 1LULA 1WWYA 4Q4Y3 3WF1A 5C5TA 2WO2A 1NAEA 3GXUA 1ONAA 4IDZA 3SH5A 4D7SA 2ZKLA 2ZAAA 4MV2A 4Y1UA 3VHNA 4LO6B 5JPMB 4H14A 2YBSA 4YPJA 2P3JA 1GOGA 4QB2A 5ISLA 3MICA 5JLVA 3BALA 4LT5A 3GALA 3J8F1 1SZBA 2VZTA 1MS9A 2EXKA 1NUKA 5FWEA 4ZZ8A 2UU8A 4KWLA 2ID4A 2W08A 3FBYA 2ZS6B 4LTAA 1YCIA 4IETA 1AR93 4Y1XA 5IHRA 3I3EA 1WZXA 3O1MA 4Q5OA 1HXS2 4C0BA
chains in the Genus database with same CATH topology
4Y26A 1V9U1 2WIIB 1OFSA 3VV1A 4K9SA 1L3JA 4GWMA 1EYBA 2ATFA 4N43B 1J1TA 2VPVA 1AXKA 2RS33 1R092 3ES1A 2R073 4AWDA 1JXNA 1QNYA 4I30A 4LA3A 1FT9A 3BIWE 4BYYA 1ZBE2 3A0KA 3KCXA 5AC92 1RUOA 1X33A 3LOBA 4CDXC 2W52A 3GZAA 3PMEA 3VBUA 1MS5A 2PHWA 1SACA 1BBT2 1DIWA 3CNAA 5K0UA 3MPBA 5C9AC 4EN6B 4IEUA 1ASJ1 4BZ4A 3KCYA 3PVEA 1DQ1A 1ZYBA 4I3GA 2PHDA 5FO7B 3D6EA 4KWJA 1AR61 1OOPC 4KGGA 1YJKA 1JYCA 5E1RA 1RUD1 1RB8G 4FOQA 1PGW1 4K6BA 1CJPA 5LK7B 4HN0A 4EWEA 4HSJA 2UWCA 1W6PB 4ONUA 2UY8A 1U5YA 5T52A 3ENRA 4U36A 1NA1A 3ZFGA 2DUOA 1TMF3 1PGSA 3VL9A 2UYBA 1AYN3 1DQ2A 5KHIA 1RUI1 4KU8A 5FPXA 4FPHA 4C1WA 4FAHA 3WW4A 1C1LA 4DPNA 3VHRA 1O91A 4P9XA 3B00A 1DGLA 2VY0A 1G9DA 4H7LA 3I2DA 3WG3A 3CF6E 3EJKA 1QOTA 1RHI2 4JDMA 1IGOA 4AQ2A 1VBD2 5T5PA 1SCRA 5A32A 1REDA 5FAXA 1TNFA 4RS5B 5KHHA 3ZSLA 3ACLA 4SLIA 4LBOA 2OYZA 2FMYA 1AR82 1J3PA 5LEKA 2ZGOA 5CFCB 1CIWA 2ZX0A 3VZLA 1AR91 1CAXB 3M1HA 2ZJCA 3GNEA 5DUUA 1FOD3 1KFXL 2CNAA 4IEZA 4BQ1A 5D8AC 2XLAA 4UXAA 1S0JA 1OSGA 2WINB 1EP0A 1R083 4FPGA 2ZGRA 4Z2WA 3IDBB 5GKAC 1D4VB 3L9JT 1S0CA 4FAGA 1VAKA 1QJY1 2ZHNA 4Q2FA 1LCLA 1SBFA 5KWRA 1UAIA 2ZHMA 1LODA 2P3IA 2GC1A 4Q4X1 2HWB2 1HRI1 4XTMA 2LUWA 5T50A 1J59A 1VAVA 2C1FA 2X5IB 1RUE2 4E2QA 3VBHC 3UJOA 5JSOA 2R32A 4C90A 1AX0A 3MFAA 5F5QA 3VZOA 1WW7A 4M0NA 4YLZA 2JXAA 1NCQC 2WNUC 2Q8OA 4FBFA 5JIUA 2VMGA 3FZ3A 3FLRA 1AL0G 4HT1T 5JI9A 3BU7A 1AR83 1QJX2 3QCWA 5GM0A 3WHTA 1QOSA 4QPGC 4CEYB 1U5ZA 1WLCA 1KRIA 3VDDC 3GZTB 3QBQA 1K5MA 5EZWA 4Y20A 2IWGB 3WDWA 5AFBA 1COV3 1O3RA 1VRH2 4XETA 2MEV3 2H6BA 1HXS1 3RNSA 2E7TA 2QZ3A 2BTVC 2R1DA 4ZU7A 5CAZA 1H8TB 1WCSA 1TMF1 3WDVA 1AYN1 2YYOA 4DNYA 1R091 1VR3A 2CAUA 3B02A 1JW6A 4H7MA 3NW4A 2ZACA 1IKQA 1UU5A 4YVSC 1RITA 3H3UA 1LR5A 2I74A 3ZMNA 5KHGA 4WBBA 2D6OX 2EXIA 3T2TA 2JKBA 3I8TA 3VBOC 3HD8B 5DDJ3 1NCRC 4FCAA 1FNZA 5CNAA 1BBT1 2DFBA 2BVBA 5BNOC 1KXGA 2VOWA 1O4YA 5KC5A 2A6VA 4WZCA 4C91A 1JUHA 1HQWA 5A33B 5C4WC 3OY8A 1UF2C 4R4ZA 4RD7A 4Q4W3 2VNGA 1LHVA 3LKJA 2GALA 4RFT0 3V0BA 1W6OB 3NV1A 3EBRA 2ZZJA 1XU2A 5IUQA 4KG8A 3WW2A 1AYM2 1S0BA 2DVGA 4E27A 4Q26A 4Q29A 1KJLA 2R043 5FREA 5T54A 5J3UA 3LWCA 1A78A 1BJQA 2XUMA 2E53A 1AL22 3ZSKA 3B69A 3URFA 5BUVA 1I3HA 1WMFA 4X6RB 4COWA 2WS92 1IQAA 5JZGC 2WNVC 3DPRC 1AJKA 3VKMA 1ND3B 4U2AA 1YHFA 3RYPA 1VBD1 3OYWB 3VBRA 1XYOA 4K20A 1W6NA 3W59A 2G9GA 2D3PA 1D0GA 3HR9A 4UW6A 4TZDA 5DUWA 1AR81 1EV12 1O4ZA 3VBSA 1ND2B 5GLWA 4ASMB 2ET1A 2Q1MA 3OGGA 3AXEA 1D2SA 4FP3A 2UYAA 2AYHA 3D0JA 1RUJ2 2WZR3 4CDWB 2WT1A 1HV1A 4IV3C 2DVDA 3VLBB 5ABJB 1OD5A 2BNNA 1D2QA 5T5OA 1V00A 4EJRA 4KU7A 5J09A 3S6PA 2PAMA 5L19A 2QE3A 4LO7A 5HCBA 2HWB1 2TNFA 5JCTA 2OUHA 1YI7A 4W6XA 5C8CC 4N90A 4L2NA 2VULA 3AJYA 4DRVA 1PHMA 2W68A 4LUMA 2ZBJA 2GDFA 3AX4A 1IZ3A 4N43A 4AI0A 1U5XA 1IS4A 4M0HA 2XLGA 2ZX2A 1YWKA 4CP1A 3V64A 3IN9A 3O0VA 1QJX1 4LO8A 5F1RA 4Z92B 2Y26A 1SBEA 2GNTA 5I8YA 3SLIA 1VIWB 4L8QA 1VBC2 4FTSA 3ZFFB 3IMNA 2R062 5J48A 2HEWF 4NWWA 4BPZA 3WG2A 1PVXA 3AKRA 3U4XA 2K2SA 4HMZA 2B8MA 2IXLA 3OJBA 3QLQA 4MUVA 4EN0A 1BKZA 4W6WA 2FHRA 1LGCA 4XF9A 4CP0A 2R041 3B9IA 1KS4A 3LA3A 1GKBA 2HJIA 2RS52 2PLV3 2AGSA 3VL8A 4CDUB 1MZ5A 3O12A 2QDRA 4GA9A 1QQP2 5BV6A 3AFGA 1V6JA 2XB6C 5C33A 1RMU2 1ZZCA 1XYNA 3ASIA 3G7DA 2ARXA 4LUKA 3HIFA 4YM3A 4Z8BA 1W6PA 4Q27A 4QT6A 1RC6A 2GH8A 2UWAA 4XF0A 2CGOA 3RPQA 5D1IA 3E6BA 5H9PA 4LBQB 4PIZA 4FPOB 4QU2A 3R4DB 4I0BA 2CY6A 2EAKA 2CWMA 1S0DA 3WP4A 5BY5A 1BEV3 3PHMA 1CAWB 4OI0A 2JECA 4XE9A 1FPN2 1N3OA 4ATEA 5BNNC 3M3CA 5EXOA 3L2HA 4XBLA 2P3KA 2Z42A 3QH6A 1AYM1 1GZWB 2WFPA 5FRAA 4AGGA 4RS5A 2WFF2 2XKOA 5CIRA 4FPEA 4FQZA 4MGZE 4CDQB 2RS53 2XJSA 5CFCA 2PA7A 1MEC2 1CPNA 1QQP3 2HWC3 4Q0VA 1CAXA 2DUQA 3EXUA 2JG8C 1RJ8A 2WS91 3OD4A 4G3YC 4XYXA 4UW3A 4MH0E 3HT2A 2E7QA 5DZEA 5JSPA 4GIQA 2IXJA 2R16A 3ROUA 2F6BA 4P9YA 4EWAA 1XRUA 2VUJA 1TME2 1FPN3 1QDCA 2PHUA 5GZDA 5FDBA 2ETEA 2X5IA 3AP4A 4BM8A 2XJQA 1B35B 4HVOA 4K7JA 2O1QA 3B93A 1LTEA 2RR13 4HKOA 4D7YA 3A4UA 3DN7A 1G7YA 4AEDC 4I01A 4RHV3 4A7KA 2BBVA 5HI0A 3LCPA 5H9RA 3AZYA 5IT6A 1J3QA 2D6LX 3WP3A 4CEYA 1KFUL 4DY5A 1C28A 1MS4A 2JD4A 1KD7A 4NPRA 2JEMA 1ZZ6A 5FOBB 2YGLA 5GLZA 2HWF3 4OZXA 4LBQD 1H8TA 3ZFEC 1YUDA 2VQAA 1PZ7A 1ENRA 1DZRA 3HWJA 1H2NA 5GZGA 2HWD3 3BOWA 3JQXA 4OI1A 3ZX7A 1BEV1 1DGRA 1CVNA 3MLLA 2OZ6A 4CDXB 1SQ4A 2R061 3JBG2 2E51A 3HAGA 3M7AA 4NR1A 3INAA 1XNKA 2IZWA 1ZZ8A 5C9AB 2B46X 2GMPA 3AZXA 4DRRA 1WGPA 2GC0A 4MSVA 4WM7C 4NHKA 4YVWC 1UX6A 1EY2A 4UW5A 4XILA 4C0HA 4MXVA 5A33A 1LOEA 4LBLA 3JB8A 2JDZA 2RS51 5I8SA 5CG9A 1D4M2 2EAAA 4NO4A 1QQP1 2DF7A 1VBE3 3H1MA 1W6OA 1RMU1 4XMIA 3ZN4A 5KXEA 3RYRA 4Y1ZA 3ZDSA 5CFDC 1FI2A 1XYPA 3LA7A 4I0WB 4YG0A 1LOFC 1GR3A 2IXIA 2YV8A 3E97A 3CU7A 3RI9A 5T55A 4BCUA 3WP6A 3MI8A 4G9SB 1NLRA 4BOWA 1ASJ2 4LHLA 1ZBA3 2DWRA 4YARA 5HCAA 2DCJA 5I0UA 1LRHA 3NKTA 4NHMA 2A70A 4QQLA 1FPN1 4IEOA 1AR62 3QH7A 4B7KA 1RVF3 4JGYC 4QX5A 1ND3A 4XFBA 1H1AA 3AP5A 1RUD2 3U07A 2GU9A 3TN92 2XWJB 4XFAA 3OYWA 4PDWC 3WY6A 4A7YA 2VOVA 4R9CA 1ALYA 2CGNA 4FPKA 3KGZA 2A5ZA 1W39A 3VBFC 4GH4C 3USSA 4AI3A 2PHTA 4HKWA 4J6GA 2ZGPA 3AMHA 5EJ3A 2DFCA 1XQNA 4YW4A 4HK8A 5D8AB 2GNMA 2BEOA 5K7PA 3VZJA 4FTEA 3N4MA 3MIDA 4LA2A 4CDWA 4NN0A 2IXCA 4Q4Y2 1H1MA 4HVRA 3RG0A 3MIEA 1ZZ7A 1C4RA 5ABJA 1NYWA 5KXBA 3J9SA 4DXZA 1WCDJ 4GULA 1OQDA 3DKWA 4FPYA 3PNAA 2WZPP 2P2KA 4LHKA 1CONA 5E16A 5KHJA 3VBHB 4Y1YA 4QGMA 3AKQA 1AR92 1SBDA 4LHNA 2BFUS 2RE9A 2OPKA 2WNUB 2WKKA 4CZSA 4QPGB 4XJUA 2VW0A 3ZVXA 3B9CA 5GALA 2MPFA 5L36A 1Z7S3 1BXHA 1PVC2 1IS6A 4YNIA 1XU1A 3ZFFA 2RS32 4S2HA 2XPJA 2NMOA 1BMV2 4COZA 4PBPA 2R072 4BE3A 1S2BA 2W39A 5CA6A 4QM9A 2WT0A 5E8AA 3VZNA 4YFZA 2Y0OA 5GZFA 4IEYA 4K40A 3MF6A 2XHKA 1POV3 1SDWA 1UPSA 4LR4A 5FQ0B 2NN8A 4CDUA 1GZ9A 2A3XA 2VVDA 2ZX4A 2XBO3 3M2MA 1IPKA 3G6JB 3MW2A 4KNCA 4MX3A 1DQ6A 4YVSB 2X29A 3AYAA 4AFMA 4GMP0 4Q4V3 2ZHKA 1FMD3 1V6LA 2BWCA 3VBOB 4SBVA 4YW2A 3JBG1 3N35A 1NCRB 4HSLA 4A2UA 2NYYA 1NA1C 4AEJA 5JAXA 2W0XA 2R0HA 5BNOB 1ENXA 4XFHA 4UW4A 5L7OC 1TNRA 3TWIA 4LBQA 3N7LA 1WCKA 3KCCA 1UU4A 2VG9A 1YFYA 2VOKA 3SMHA 4RQPC 4I02A 4XZPA 5LEJA 5EV7A 3ZYJB 1CAWA 1TMF2 1PVC3 4PJYA 5J36A 1AYN2 4DOUA 1D4M1 1LU2A 5E88A 1Y43B 2XKPA 1PK6C 1ULFA 4AHZA 2BPA2 4Q0UA 2GZWA 4AVCA 1FXZA 1LESA 4XHBA 3GZUC 1GZWA 4MYEA 4QM8A 1VBB3 4QQOA 1C3HA 1OFNA 4CDQA 1F9KA 2A73B 4NWVA 1MACA 1F2NA 4E4ZA 3LSDA 1N47A 5JZGB 2WT2A 2WNVB 4KGQA 3DPRB 5FO9B 3H50A 2Q4SA 1H2LA 3RMYA 2DVFA 4IQPA 4Z1VA 3TN91 4MXWB 1FOD2 3S30A 5DUXA 1M06G 4QQPA 5KBFA 1LU1A 5K8SA 3V56A 3IDEA 1MZ6A 1R082 1MQTB 2DU1A 3VGIA 1Z7S1 1U12A 1QMJA 3JCIA 2ZGMA 3B94A 4OI2A 4RR3C 3KZ4C 1O4TA 3FJSA 1B35A 1PM7A 2NQYA 4IV3B 4YGEA 2PELA 1AHSA 2XJRA 4HFSA 1GANA 4Q4Y1 1Y7BA 4XPVA 1YYNA 1POV1 2OUJA 3UK9A 3A0NA 1URXA 4YGCA 2XBO1 1C57A 1YIFA 2VXRA 4MGIE 1XNCA 2VU9A 4AK3A 4Q4V1 1FMD1 4XJ9A 2WLPA 5C8CB 4EWDA 1LJ7A 1OQ1A 1J3RA 1IS3A 3SHRA 1WD3A 1COV2 1H9PA 4GKXA 2MEV2 2Z79A 2XJVA 4R8HA 2XL9A 1NE6A 1DZTA 4DY3A 1X8MA 1REFA 1MZFA 2D3SA 1PVC1 2RS31 4CDXA 1BMV1 2DTYA 3GYDA 1UPIA 2QUOA 2HEVF 2R071 3TNPB 2H6CA 4AEKA 1OI6A 5C9AA 5FBZA 2ZX3A 1GQGA 4HPKB 1S2KA 1ZX5A 3MDPA 4X8PA 3C2UA 3AP9A 2A6XA 3D8CA 5DDJ2 1X82A 1O7FA 2QCSB 1VBB1 2RM23 5LRRA 1YFUA 3GHMA 4FXGB 3OTFA 3RSJA 1IPJA 3M8LA 3ATGA 2CWSA 2DCKA 3MIBA 1LEDA 2YGMA 2XWBB 4JGZC 4XF4A 2I45A 1GYKA 3POWA 4Q4W2 1QJU3 4L9BA 1A8MA 2IC1A 3KM5A 4GXLA 2G9FA 1LECA 2D93A 2YHJA 4YGDA 4HBNA 2VOXA 4LE4A 4ISQA 2HWE3 4N53A 4DQAA 4XMAA 1G8WA 5BNNB 4XEZA 2CYFA 3D82A 2R042 4MGKE 2D43A 1LOBA 2XLFA 1FAYA 4M00A 4ASLA 4HKLA 4AGRA 3VBRC 2A3WA 4AHYA 2R30A 3WP5A 2O8QA 1Q5OA 4IEVA 4JV4A 4YG3A 1HX6A 2BGCA 1X50A 4HETA 2MNGA 4ZKTB 1OPOA 4AVBA 4G4FA 3BOPA 3E6DA 2IFWA 3V65A 2D44A 3GHNA 2A6WA 1I6XA 1VP6A 3KT1A 1JBCA 3AMQA 1AX2A 4KL1A 5D8AA 1OMIA 1UKGA 1CAVA 3WQ1A 3UKVA 3ZN6B 2ZMLA 2FZ1A 3NO8A 4Z82A 1KDMA 1FOD1 4OVEA 3ZO0B 1E57A 3TBDA 4IV1C 3PMSA 2PTMA 1QNWA 3WQ7A 2WZR2 4Y22B 1C8NA 1R081 2ZGKA 1QWRA 4Q1RA 3NKGA 4E4DX 1HV0A 1WW4A 4FQ4A 5I91A 4DMIA 3X29B 2VNRA 3VBHA 1BZWA 1GNZA 3LZZA 4P9JA 4GB32 1F31A 1PZ9A 1HQLA 1CESA 5BPXA 1PNGA 2WNUA 1I1EA 4AHXA 3BB6A 1PO13 1RUF3 4LBNA 4QPGA 5FMOL 4QPIC 2B9UA 2RM21 2NPIA 1R1A3 1V70A 3MIHA 1YFWA 3RJRA 5A3MA 3ECQA 3JD73 1NG0A 1LEMA 1R1ZA 4AFDA 4J1WA 1V6NA 1F5JA 1WLWA 1JOJA 3AMMA 3CL1A 4XIOA 3ZFEB 1TQ5A 2YXSA 3OBTA 1COV1 2MEV1 3DL3A 2VMHA 2ZAHA 5LK5A 5FQ0A 1G9FA 5JOZA 4L92A 4YVSA 1EPZA 4BIFA 1AR73 3ZXEA 4IEWA 1AJOA 4WVWA 1Q43A 3VBOA 3MFCA 1NCRA 1FV3A 5FPZA 1HKDA 2PLV2 4S2FA 4AGVA 4GB33 1WW6A 3TOJA 3WD5A 4B4RA 5BNOA 3VHOA 2GMEA 4WM7B 4YVWB 4JQRA 4LBMA 4AXOA 1RTVA 3WDTA 1NZCA 4K1ZA 5DDJ1 3KGLA 4JVAA 4WM8B 2QZ2A 2ZMKA 2TBVA 2PHLA 4AEMA 3FBMA 1WA4A 3E5QA 5JSRA 3TRSB 2ENRA 1BEV2 2B42B 5B2GB 3QOPA 4IEXA 4Q4W1 5KHKA 1IKPA 1H1IA 1ULEA 1W6QB 3VKFC 1MS8A 4CEWC 4PCRA 2WC2A 4FOVA 1F5FA 1LOGA 4N7IA 4E2SA 5CVRA 1C5IA 2AH2A 1HRV3 2V09A 2OZJA 2A6YA 3NV2A 1NXD1 4NOTA 4OULA 5CADA 5JZGA 2CTVA 5I0RA 2WNVA 1DYKA 3DPRA 4JGYB 5T5LA 5FLHA 2KA3A 4HZFA 5FOJB 3R05A 5JI7A 1SLTA 2HWC2 4PLMA 4R9DA 1GFF2 1V6KA 4GWNA 4PDWB 1PZ8A 4MXWA 2QFEA 3N7JA 3R0RA 1AF9A 3W58A 1HIXA 4QXKA 2GNBA 1CQ9A 2AR6A 2ZPXA 3HT1A 4GH4B 1MQTA 2GC2A 1R1A1 4XQDA 5FCCA 4XBQA 3FLPA 2BWAA 5AVAA 3U11A 1GLHA 4R9BA 1UL9A 4AHWA 1WMEA 3Q9OA 4IV3A 4V1PA 3AYEA 3PJYA 2E6VA 1HDKA 2BYVE 3WDYA 5FFOC 2JG9B 4BLJA 1Z78A 3CJIC 1G6NA 3CJXA 2RR12 3H8UA 4FPLA 5JOWA 2WZR1 5EYYA 1EPWA 1X7NA 3AB0A 4JTNA 1N1VA 2R6QA 3I59B 1AR71 4RHV2 1U5IA 3WT3A 2WQZC 4J1XA 4M3CB 4MLOA 1MVEA 4YYOA 1SEFA 1DQ4A 3GBWA 4R52A 3IPVB 3PJQA 4GB31 1VJ2A 5BNPB 4XIKA 1A8DA 3NAPB 4E9KA 1OLRA 1BQPA 3DV8A 5JPNB 2OA2A 3MZHA 2HWF2 1TE1B 1Q8OA 1VBA3 5GLUA 1WD4A 3ZIWA 2WL1A 1B09A 4PLNA 2VVFA 1O5UA 2HWD2 2I07B 4MZUA 2B45X 1OA3A 3P3PA 2R49A 1G9CA 4QQHA 4AFAA 1G9BA 3IT8A 1IS5A 2PN5A 1KS5A 1ZZ9A 4KH9A 2DYCA 3MIFA 3RWNA 4YFWA 3KSCA 2DU0A 2ZKNA 1W0PA 1W6MB 1SLIA 4XFCA 3IWZA 5DZFA 3WG1A 2NP0A 3S0MA 1A6CA 2D40A 5JWPA 4XJAA 4XBNA 4YSFA 1NA1B 1ULDA 5J7MA 5GJ6A 1JHNA 1WW5A 2VW2A 2A75A 1N3QA 2PLV1 5L7OB 2JX9A 2GAUA 4AVTA 4ES8A 5T3NA 4P9IA 5DUVA 1EAH2 2LALA 4YW3A 1VBE2 2GH2A 4PIYA 3KT4A 2K0GA 2Q30A 4RQPB 1C1FA 2DVBA 2DCYA 2HEYF 4B29A 1PO23 3WDXA 1N3PA 4QQ2A 2MHFA 2K9ZA 1REEA 3M4FA 4FO9A 5SV5A 1YJLA 3LOIA 3ZXLA 1ND3C 4B4QA 1PK6B 1OHFA 1QXPA 4YG6A 5A32B 1ZBA2 3EO6A 4AI2A 4LE3A 1ZVFA 3WQ0A 4FTBA 3ZYIB 2AUYA 3KD4A 4HANA 1VB2A 2WJSA 1RVF2 3H7YA 2N7GA 4BWOA 2QNKA 3B7MA 4Q0PA 3AP7A 4ZU4A 1QHDA 2ET7A 1ZA4A 4L99A 3MYXA 1PGL1 3WLUA 4PBOA 1OOPB 2DV9A 4OHXA 5CU1A 3D4KA 3VN4A 1Y9QA 3ZN6A 3DF0A <