1D4M3

The crystal structure of coxsackievirus a9 to 2.9 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPTMNTPGSTQFLTSDDFQSPCALPQFDVTPSMNIPGEVKNLMEIAEVDSVVPVNNVQDTTDQMEMFRIPVTINAPLQQQVFGLRLQPGLDSVFKHTLLGEILNYYAHWSGSMKLTFVFCGSAMATGKFLIAYSPPGANPPKTRKDAMLGTHIIWDIGLQSSCVLCVPWISQTHYRLVQQDEYTSAGYVTCWYQTGMIVPPGTPNSSSIMCFASACNDFSVRMLRDTPFISQDNKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COXSACKIEVIRUS A9)
publication title The crystal structure of coxsackievirus A9: new insights into the uncoating mechanisms of enteroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d4m300
4AEDC 1AR63 3JB4C 1AL23 1HRV2 1EAH2 3NAPC 5ABJB 3VBOC 5K0UC 1E57A 1H8TB 1ND2C 2WS91 5C8CB 1VBA1 4WM8A 5A33A 4RHV1 2WFF1 4CEWC 2WS93 4GMP0 4WM7A 1FPN1 5BNPC 4IV3B 1K5MC 4RHV3 2WFF3 4CDXB 1HRV1 1ND3A 1ASJ1 1RHI2 1EAH1 1FPN3 2R042 1RUG2 1HRV3 1ASJ3 1R092 1VBE2 1EAH3 1MEC2 4YVWA 1AUYA 4GH4C 1VBD1 1VRH2 2RS32 3NAPA 5K0UA 3VBOA 1VBD3 5ACA1 2BPA2 3ZFGB 3VBHB 5ACA3 1ZBA2 3VDDC 1MEC1 5GKAC 5BNPA 1NCQB 2QQPA 1VRH1 4NWVA 1GFF2 3M8LA 5J96B 4FTBA 1BBT2 1V9U1 5AC92 1NG0A 1QJU2 1C8M2 1CD3G 1V9U3 2HWD2 4GH4A 1X33A 1AR91 1POV1 1QJX2 1AR93 1AR82 1POV3 4Q4Y1 3VDDA 1BEV1 3VBUB 2WLPA 4Q4Y3 1BEV3 5BNOB 2RMU2 1HX6A 1RUC3 5ABJC 2ZAHA 4SBVA 3TN92 1H8TC 2BUKA 5C8CC 4IV3C 4RQPB 1MQTB 4GMP1 4CDXC 4N43B 4RS5B 4GMP3 1COV3 5BNNB 1WCDJ 2Y26A 4GB31 1PGL1 1DDLA 1HRI2 4GB33 2HWF1 4CDWB 1R083 5ABJA 1PO22 1H8TA 2HWF3 4NWWA 4FSJA 5C8CA 5CFCB 2HWB2 4LLFA 3ZFGC 3VBHC 1RUI2 1SMVA 1ZBE2 1RVF2 2PLV2 4IV3A 1NCQC 1PVC1 3JD72 4CDXA 5DDJ2 2RR11 4CDQB 1FOD3 1PVC3 1NY72 1PO21 1EV13 2RR13 1W39A 1PIV2 4BCUA 1VBA3 3JD71 1RUD1 4QPIB 3JD73 1RUD3 3ZFGA 3VBHA 1QQP2 3VBUC 3DPRA 1NCQA 2R072 3CJIB 2MEV2 1RMU2 5BNOC 1C8NA 2GH8A 2HWE2 1B35B 1RHI1 2XBO2 1RB8G 3ZXAC 2R041 1RUG1 1R091 1CJDA 1RHI3 1VBE1 1QQP1 1PO12 4N53A 1RUJ2 2R071 2X5IA 2R043 3DPRB 1RUG3 2RM22 4RQPC 1R093 1MQTC 3FBMA 1VBE3 1QQP3 4N43C 4CDUA 4QPGB 1MEC3 2RS31 4Q4X2 4RS5C 2GSYA 1Z7S2 1BMV2 1NA1B 5BNNC 5FOJB 4Q4W2 1VRH3 2RS33 3VBUA 1RUE2 5A32B 1RUH2 1ZBA1 1PO11 1D4M2 5BNOA 1HQNA 4N53B 2X5IB 4CDWC 1AYM2 5C9AA 1ZBA3 1QJZA 4CDUB 1FMD2 1BBT1 2RS52 5CFCC 5AC91 1QJU1 4Q4W1 4RFT0 1C8M1 1BBT3 4RQPA 3VBSB 1RUH1 5AC93 1MQTA 1QJU3 1VB2A 2HWD1 4N43A 1C8M3 4CDQC 5L7OB 4RS5A 1AYM1 4FTEA 5BNNA 2HWD3 5C9AB 1VBC2 4CEWB 1FMD1 1QJX1 2BBVA 1R1A2 2HWC2 1AR72 1VAKA 1AR81 1TME2 1TMF2 1QJX3 1F2NA 4Y5Z0 1HXS2 4CDWA 2BFUS 4QPIC 1AR83 1RUF2 2IZWA 2RMU1 2R062 4JGZB 5CFCA 5JZGB 2WZR2 3TN91 2RMU3 1AR71 4Z92B 1AYN2 4CEYB 3TN93 4CDQA 2FZ1A 5C4WB 1AR73 1RUF1 3ZFFA 1PGW2 1B35C 5LK7B 1RUF3 4YVSB 4PDWB 1NOVA 3J8F2 3DPRC 1AYN1 4QPIA 1HRI1 1OOPB 1X36A 1AR62 1AL22 4QPGC 4JGYB 2TBVA 1VBB2 1OHFA 1PGW1 1NA1C 1HRI3 3ZFFB 5FMOS 2HWB1 1PO23 3CJIA 1RUI1 4IV1B 1ZBE1 1RVF1 2PLV1 2WS92 4N53C 2X5IC 2HWB3 4RHV2 5D8AB 1RUI3 2WFF2 5DDJ1 2DF7A 1B35A 1M06G 1ZBE3 1RVF3 2PLV3 4CDUC 2WWSA 1VBB1 4Q4V2 2ZTNA 1NY71 5J98B 5DDJ3 5CFDB 4RR3B 1ASJ2 1VBB3 1PIV1 3VBSC 4QPGA 1PIV3 5L7OC 1NA1A 1NCRB 5C9AC 3VBFB 3VBRB 1VBD2 4Q4V1 2VQ0A 3ZFEB 5A32A 4Q4V3 5ACA2 4Y4YA 2MEV1 1RMU1 2R073 4JGZC 2MEV3 1RMU3 1OPOA 1VB4A 2HWE1 4WM8B 4AEDA 5A33B 5JZGC 2FZ2A 2XBO1 4WM7B 1V9U2 2HWE3 3VBSA 2XBO3 1ND3B 4CEYC 1ND2A 5C4WC 5L7OA 1RUJ1 2RM21 4CEWA 1PO13 1RUJ3 1K5MA 4Q4X1 2RM23 3S6PA 1AR92 1Z7S1 1BMV1 4YVSC 4YVWB 4PDWC 4AEDB 4Q4X3 3NAPB 1Z7S3 1RUE1 4Q4Y2 4Q4W3 1BEV2 1D4M1 1OOPC 3VBOB 1ND2B 5K0UB 2BFUL 4JGYC 4JGZA 1RUE3 5JZGA 1RUH3 1D4M3 1RUC2 3JB8A 3ZFFC 3JBG2 5BNPB 1AYM3 1K5MB 2RS51 4CEYA 3IDEA 5C4WA 1FMD3 4IV1C 2RS53 2RS12 5D8AC 4EJRA 4YVSA 1RUC1 4PDWA 5CFDC 4RR3C 1COV2 1VBC1 2XPJA 3JBG1 4GH4B 1R1A1 1F8VA 2HWC1 1VBC3 3JBG3 1TME1 3CJIC 1OOPA 1TMF1 1R1A3 1HXS1 2RS11 4GB32 2HWC3 4JGYA 1PGL2 1NCRC 1TME3 1R082 3LOBA 1TMF3 3VDDB 3VBFC 3VBRC 2RS13 1HXS3 2HWF2 2R061 1QJY2 1A6CA 1COV1 2WZR1 5FMOL 3ZFEC 4IV1A 2R063 2ZZQA 2WZR3 5D8AA 1FOD2 1AYN3 1R081 1PVC2 4WM8C 4RR3A 5CFDA 1EV12 2RR12 4WM7C 1QJY1 1POV0 3HAGA 1ND3C 3J8F1 1QJY3 1VBA2 1NCRA 1IHMA 3VBFA 1AL0G 1AR61 1AL21 3J8F3 1FOD1 3VBRA 4FTSA 1FPN2 1RUD2 1EV11 4YVWC 3ZFEA
chains in the Genus database with same CATH superfamily
4AEDC 1UAIA 3NQHA 1AL23 2VNRA 2WN2A 4PBOA 4YGDA 1W0NA 4Z2WA 3S5AA 3A4UA 3K4AA 5EV7A 5CKNA 3ZIWA 3E97A 2DUOA 4FQZA 2IVIB 2R49A 4NIAA 2PTMA 4ITCA 1VBA1 5C8CB 4Y1YA 5A33A 4Q0VA 2ZJCA 4CEWC 2JKXA 2WS93 1DG6A 4WM7A 1FPN1 4C1XA 1V6NA 5L36A 1RXFA 3VL8A 3J9SA 4RHV3 2WFF3 1W2UA 3K4ZA 1EAH1 1XNKA 1AVBA 1IGOA 2VAUA 4LBJA 2WJSA 2R042 1J58A 1RUG2 1HRV3 3CDZB 3AZVA 1CESA 1NLQA 2HEVF 5JSRA 1OT5A 4K20A 2WNVB 4Y3OA 2OA2A 5A3WA 4AAPA 1BHGA 4GH4C 5AVPA 3NJXA 2E9QA 2Y8KA 4GXLA 2VTXJ 4OULA 4Z1VA 4HKOA 3AP9A 1LOFA 4MUVA 4QWNA 3WVJA 3RZZA 4N8MA 5T5LA 3ZM8A 5GLVA 3WCRA 2IXJA 2DUPA 4MOAA 3H8XA 4LK7A 4UW3A 1YJKA 1ZBA2 3VDDC 3WUDA 5FBZA 4B3NA 1MEC1 1HN0A 1CAUA 4JKKA 5FYHA 4R9DA 3VD9A 2RHPA 4HSJA 4UI9L 2VR4A 5KXDA 4HK9A 2EXHA 1VRH1 5EJZB 1Y9MA 5FYBA 2WYFA 4FTBA 1BBT2 1V9U1 3RMYA 3TAYA 5AC92 3AZXA 4U2AA 3FBYA 3Q8FA 4AI2A 3SKVA 1W9TA 3ZXGA 1GQHA 1O3SA 1QOSA 1HJFA 2HWD2 5FZ3A 1GZTA 1ACCA 3ACIA 2YBPA 2A3WA 4L97A 1AR91 4R4ZA 1OLME 2QQWA 5H9QA 3VD5A 1V6JA 1QJX2 1UMZA 1UNBA 1KEXA 2YV8A 1RL3A 5IJRA 3SHRA 4BMBA 1K12A 2RV9A 3ETQA 2I07B 1Q8OA 1BEV1 2ZACA 3M3CA 3N9OA 4Q4Y1 5KXCA 4LBNA 4MGQA 4DUWA 1ALYA 4EN6B 5F5CA 2UWBA 5JMOA 1H1AA 3LEGA 4DQAA 1GP6A 1UIJA 4YFWA 3I3MA 2A3YA 5E6HA 5A80A 5ABJC 3NMBA 1NZCA 4LUKA 4OFGA 4K9SA 2BUKA 2AEZA 2YPJA 3SH4A 2VW1A 1SFPA 1X8MA 4D6RA 1UXZA 2WN3A 1UZZA 2D3PA 1IG3A 1W6QA 3VLBB 3SCHA 2RDNA 2XUEA 1G9DA 1W0PA 4IV3C 1DQ2A 4KBBA 4RQPB 4XZPA 5AFBA 5HPOA 1I9RA 2O1QA 1J83A 4XJAA 3IAPA 1SBDA 3LFIA 4I30A 4WVMB 5FMCA 2FDGA 5A6QA 1W06A 2TNFA 4RS5B 4R9CA 3EBRA 1H4GA 2W0XA 4GMP3 4OUSA 5A3MA 3ASIA 2VMFA 5BNNB 2GDFA 1FYUA 4EWDA 1ZREA 1JODA 3WNXA 2VZVA 5FZBA 4ATFA 5F6KA 3W20A 2VUAA 1W28A 4RA0A 5IVEA 2W1QA 2I45A 5F6LB 2KA3A 3KV9A 1XU1A 2E26A 2W3JA 3DYPA 3KF5A 1N1SA 2VOKA 4UXAA 4DZGA 3O1RA 4TXWA 2BGOA 1GR3A 1R083 2VZQA 4XFAA 3ZR6A 3W5MA 2J1TA 1S0DA 2BU9A 1F4AA 4FPOB 1H8TA 1DQ5A 4IUGA 2CL2A 4LBMA 4XZUG 3WSOA 4FSJA 2PELA 4BJ0A 4HZFA 2PN5A 1ONAA 4YPJA 4LLFA 1O4YA 3VKFC 3ZFGC 2I74A 3VBHC 1RUI2 1YLLA 4I09A 1S0CA 2ID4A 3CEWA 1V6LA 1UD1A 2PLV2 3GCXA 3LF7A 4Y20A 5FO8B 1NCQC 2OZ6A 2JEMA 3VD7A 4EN8B 3JD72 4CDXA 4FVVA 2Z69A 5HXVA 1NUKA 4ES9A 2FHRA 4KG0A 1NY72 2VGDA 1CX1A 1EV13 4PI2A 2RR13 1LOFC 5A32A 1OFNA 4QDQA 4K8FA 1PIV2 2XG3A 1LESA 2B4KA 2Q0AA 3OY8A 3R4DB 4LBQB 5EPAA 2E6VA 3JQWA 3H0OA 4NVPA 2YGMA 3KD4A 1S0GA 4A6OA 1U12A 3I2FA 3PU8A 5KXBA 3ZYBA 3PVEA 1DQ1A 4PF5A 2JE7A 1NE6A 2C6SA 2DWRA 3MIEA 3GBWA 4DB5A 3K48A 1RUD3 5HCBA 1H2LA 3OBZA 4IEVA 5FZ8A 3IMNA 2R0HA 2YYOA 4CP2A 2VCAA 1I3HA 1K5JA 3B3QE 1HKDA 3R05A 1VMJA 1W2TA 3CJIB 1W6NB 4M01A 3MICA 1W8TA 1WA6X 5FY0A 2R30A 2E33A 1C28A 1C8NA 1QU0A 1PX4A 5CBLA 1TG7A 2QQIA 2HWE2 4V2WA 1H2NA 3BVCA 4E2GA 4QQ2A 5FIXA 3GNEA 2BBAA 4QGNA 5F9TA 1G9CA 2YROA 1R091 1QQP1 4TSVA 1PHMA 2JX9A 2R043 1RUG3 3DPRB 5SV5A 1YQCA 1UU6A 3B01A 4CU7A 5L19A 4N43C 5IUQA 3O1PA 1C1FA 2RS31 5FYTA 5A3TA 4S2HA 3BTYA 1BMV2 3SLIA 1C57A 2WC2A 4R8HA 5FXWA 3VBUA 4LO8A 1W05A 1OFSA 4GIQA 3RI9A 1AXZA 1CJPA 5DAWA 1XNCA 3VD3A 4CCEA 1CVNA 1D4M2 2EIBA 2UURA 3AJYA 3M4FA 4UFLA 5BNOA 5K9YA 3WDTA 4CUBA 3RPQA 1LRHA 3TEYA 1ZBA3 3LSEA 5FP4A 4AVTA 5JMCA 1JU3A 3ILRA 2C9KA 1FMD2 3D8CA 3WG4A 3OUIA 3LD8A 3PTRB 1OUSA 1ZA7A 4WV8A 1LU1A 1XE0A 1QJU1 2LW8A 3O0VA 3I7DA 1J1LA 2E32A 3ALQA 1C8M1 4I01A 4JTOA 1A8DA 1MZFA 4XF9A 5FYUA 2QCSB 1BBT3 3WNKA 2BVBA 4FAGA 1AX1A 4N9IA 2QQKA 2XMLA 1LGCA 3T0AA 5AC93 3WW2A 1NQDA 2UYAA 2ZKLA 4DS0A 4LKFA 4CDQC 4P00B 5A7SA 1N1VA 3MV11 4U36A 1AYM1 2VOXA 1H2MA 1JZ5A 1XBFA 2HWD3 5FZMA 2D93A 4CEWB 1JUIA 1O6UA 2WA3A 2JECA 3IIIA 5J3UA 4CU6A 5LBEA 4JQTA 1UMIA 1AR81 1TME2 2FDJA 3PMSA 1QJX3 2B8MA 3AMNA 1F2NA 1V00A 3T2TA 2VD7A 5GLZA 3ZXKA 5FPXA 3KQRA 1W6MA 2QQLA 1ZRDA 1YUDA 5FZIA 2ORXA 1ZRFA 5IFPA 2RMU1 1ENRA 4HSLA 5EP9A 4I0BA 2ET1A 4BXSV 5CFCA 1LB2A 1QNWA 1Y7BA 5A7QA 2B39A 4BWOA 2QDNA 1AR71 3BOPA 3PHMA 3NNJA 5FZAA 2L9LA 3SEEA 2P34A 4ZU7A 3VZOA 5LW9A 2ZGKA 2XHNA 5C4WB 3I2GA 5IT6A 5APAA 3FN9A 4LK6A 4AI0A 1XU2A 1B35C 1CIYA 4R52A 3K51A 2JG8B 1RUF3 2WSVA 4YVSB 4PDWB 3ZSLA 3K3OA 3VZKA 3C7OA 5FZ0A 3D3AA 3PIJA 3J8F2 5D1IA 5FZHA 3IB3A 4LOTA 4M0NA 4QQHA 1W8WA 4QU1A 2X10A 1SBEA 1PMJX 3TEXA 4HVRA 4QHZA 4OI0A 4QPGC 3O0XA 1APNA 3POSA 1SLAA 4JGYB 2YBKA 5FCCA 1VBB2 1PGW1 4MVTA 2CWMA 2VTXA 4D8MA 1L7QA 5FMOS 1F35A 4QXHA 2ZHKA 1T2XA 1W2OA 4QXBA 4D6SA 4MGIE 4AFBA 1EYBA 1CAXA 4IV1B 3O1OA 2CGNA 4A7KA 3T3YA 1VP6A 1VMFA 4A42A 5LA1A 2JIGA 2VW0A 1RUI3 3WP5A 4M3CE 2TEPA 2XKOA 2PLV3 2WWSA 3MGUA 4Q4V2 5EFUA 3ACHA 3OD4A 5J98B 2VPVA 5CFDB 2JKBA 1O7FA 1UYXA 3U10A 4B29A 1JYXA 3BTAA 5LEJA 3ELNA 3P5BA 2CDOA 1V6IA 2HBUA 3I3EA 2BNOA 1CGPA 4HN1A 4LBOA 2VVDA 2OPKA 1IS4A 1PGSA 1PIV3 5L7OC 3BIEA 4QKNA 5IFTA 4NHMA 1NA1A 3MW4A 4I3GA 1LECA 3S7EA 1XXNA 3DKQA 3FUQA 3RSJA 3VBFB 1ODMA 3IPVB 3TB0A 3KLSA 2W94A 1TQ5A 1STMA 5C33A 1VR3A 1EPWA 1OA4A 3GJAA 3ZFEB 3WNLA 1HW5A 1W90A 2VW2A 4FO9A 1G7YA 1RTVA 3IZOA 3WQ7A 1OMIA 2RDSA 5EWSA 1EUTA 1UXXX 4ZY9A 4PI0A 1YIPA 5FMBA 1S0IA 2JG9C 5JOWA 4JGZC 4OZOA 1ZYBA 3N36A 4BK5A 3LSDA 1OPOA 5A33B 5KBFA 1DU3D 1GNYA 2TUNA 5FYVA 2XBO1 4NUBA 3WF2A 2YC4A 4WM7B 1W9FA 4XJUA 2R0FA 4XF0A 5FQ0B 3GXUA 4XW3A 2HWE3 2E7TA 4DEQA 1AJOA 3DYMA 3POBA 1WKYA 1OUXA 3I2DA 4LHSA 2E7AA 2X29A 1JYIA 2YU1A 4EZ4A 2RM21 3WW4A 1IPKA 5EXOA 3DGTA 3U4XA 1TVGA 2Y34A 1GOFA 5T52A 1K5MA 3AVSA 2DCTA 3S6PA 1Z7S1 4CSWA 3BN6A 2B7YA 3UGFA 2RJKA 5GALA 1J3PA 1LGBA 4LLOA 4OHXA 3U75A 5BV6A 1GOHA 2GNTA 5LY2A 3SNMA 3FC0A 4NIHA 4XDPA 2GMMA 3HT1A 3FX3A 2BFUL 3H1WA 3HPNA 4V1PA 1NYWA 4L9BA 3WF3A 4FXKB 5JZGA 5JI7A 1ULOA 3AK0A 4A44A 5FPAA 1D4M3 1RUC2 4WZFA 3S0MA 1CAUB 1SFNA 2ZGNA 5FXXA 3ZYIB 1TNRA 1WLWA 2W5FA 5ISLA 5JR2A 4OMDA 4P9YA 4NAOA 1FMD3 3PMEA 1FV3A 1KGYA 4EROA 4XFIA 2ZABA 3KV4A 3PLQA 3WOGA 3WP4A 4AAXA 4B1MA 2RG4A 2J42A 4FPLA 2QVSB 1SCRA 1QOOA 1UO9A 2XPJA 1NT0A 3EHKA 3JBG1 2DFBA 4QX7A 5FY8A 4BM8A 3SKJE 2JJ6A 2D98A 3OGGA 3OSDA 2WKKA 2R7EB 2VMCA 3VN4A 3Q9OA 4XIOA 5LA9A 4FT8A 1I5PA 4GB32 5JCTA 2CWSA 3LEMA 1PGL2 1SLCA 2WUHA 4JCKA 1TME3 2QUOA 3LOBA 3PVOA 4MXWA 3VBRC 2Y64A 3N9MA 3BPSA 4BZ4A 3HQUA 4YG6A 4LA2A 2D43A 3LGRA 1D0GA 3E6BA 3V0BB 2ZGOA 1QHDA 3LPFA 4W6YA 4ZHNA 2DCJA 2ZZQA 5A7PA 3M70A 1PK6A 5ANNA 5JXIA 1VMHA 4NO4A 1YXWA 4QX8A 4YW5A 3ZOIA 5F5AA 4PJYA 1FOD2 3RJ2X 1IS3A 1UWWA 1XNDA 2R32A 2WNEA 1R081 1ZVFA 5E1RA 4XTPA 4TLGA 4W6WA 1W6QB 2YY1A 3FHQA 2A70A 5DPNA 5FP9A 3ENRA 3JZVA 1POV0 1QDOA 5FLIA 2N7GA 2AH2A 1ND3C 3NJYA 1A34A 4I0WB 3PJQA 4LPLA 5FPBA 2WAAA 3PTYA 1S0BA 3ZYFA 5K8SA 1OH3A 3TEZA 4NIIA 1KQRA 1NCRA 2P1BA 4Y1UA 1AR61 1JBCA 3J8F3 4O7XA 3GBGA 3R0RA 1B09A 1MVQA 1EV11 3AFKA 2WO7A 1KS4A 3JB4C 1HRV2 5FY7A 3H42B 1DQ6A 3NAPC 1LHOA 4QKDA 2VE1A 2B45X 4H7LA 2G9FA 2Y60A 2GNBA 2YMZA 4LO7A 1E57A 1G9FA 1H8TB 2B42B 1FNZA 4GJZA 2IFWA 2ZPXA 4YZ2A 1W3XA 4MGZE 1POQA 2EAKA 2ZGSA 1DYOA 5JI9A 1AXYA 2W95A 3USUA 4QM9A 2XONA 4PQQA 1MS5A 2A1XA 4Y20B 1K5MC 2CV6A 1YQ6A 4CDXB 2OS2A 4XQ4A 1ASJ1 4OLLA 1JHNA 4GWMA 3MW3A 1SHWB 3V65A 1CR7A 4XMIA 4ZU4A 1GQGA 4B4RA 2W92A 1D0HA 1WA4A 4DRRA 2H0VA 4Y5SA 4QU2A 1UKRA 1WGPA 1SDWA 4NIDA 3WG3A 4R4XA 4D7YA 4E4SA 4FPKA 4MHUA 2VBPA 5C3QA 3ZX7A 5A1LA 1ZX5A 2JDKA 2K2SA 1VBD1 5GZEA 5SV8A 1UOBA 3T09A 3LIGA 3CZJA 3T0BA 4B7KA 1HV0A 2YC2A 4JHZA 3RYRA 1OA2A 4KWKA 4Q26A 4IE0A 4OCTA 4MG2A 1CONA 2RE9A 4JX0A 3DV8A 5ACA1 1ZRCA 1V70A 5E89A 1HQLA 5GLTA 4AQ6A 3O14A 2WZEA 4DUXA 4QQOA 5C70A 5FZLA 1VAVA 4UW5A 1MS3A 5GKAC 4J6GA 3BI3A 4XPVA 5IAVA 4CUAA 2F6BA 3TYJA 3VDBA 2BDRA 4CP0A 3C7FA 4CP9A 1BK0A 2YG0A 3J7HA 3IN9A 2Y33A 4RGAA 1CX4A 1GFF2 3M8LA 3AZWA 5BNQA 5BY5A 2IFRA 2DV9A 1NG0A 2VL4A 4XE9A 4BB3A 1C3HA 4K1YA 5JUVA 4MXVA 1SEFA 2LUWA 4LA3A 5IW0A 1LOAA 3FHAA 2ZXQA 3N35A 4P9IA 4ISRA 4PIXA 2ZEXA 4GH4A 3NRUA 2A73B 2J7MA 1WUVA 4LJHA 2JB4A 2ORZA 4OMCA 1LENA 3GHMA 3G6JB 2JICA 4XTMA 4ZS3A 4FPFA 1POV1 3CMGA 2FCTA 4YW7A 3ZSJA 4C0HA 4IE5A 1IG0A 2EIDA 2QZ3A 2WDBA 3VDDA 2CTVA 3C7HA 2AEYA 4QGMA 4YM0A 4O65A 1SACA 3B94A 3VBUB 1TE1B 2XB6C 2WLPA 1IKQA 2RVAA 4BQ2A 4KWLA 3AKTA 4MZUA 5BNOB 2OUJA 3OG2A 4FFGA 4LULA 4BHPA 3WNOA 4D69A 3CNAA 4LE3A 2OPWA 1RUC3 4LXLA 3MIBA 3POWA 2QNKA 4IEUA 4NOTA 3WNMA 2PXJA 1W8FA 4UBGA 3DF0A 3NV3A 3TN92 4AVCA 1YFXA 1SLBA 1F15A 3ZPOA 4UT5A 3GALA 1S0FA 1OVSA 3HN1A 2XJPA 5FYCA 1NE4A 2C4XA 3KWVA 1W6OB 1UN1A 4KNCA 4XXPA 3R4SA 4XUPA 1H4HA 3LPGA 5IK8A 1QXPA 2WINB 5J7MA 5JVVA 4AHXA 3V56A 3I54A 3HNBM 1JI6A 1FATA 4LNVA 5FZGA 3MIDA 2DVDA 5GLWA 3VL9A 3RZGA 3ZLIA 3BTXA 4FXGB 4IDZA 5FJKA 2FDKA 5HXMA 5IVFA 1GMMA 4NN0A 2Q5TA 4YZ4A 3H1MA 4HG6B 2IVJA 4GB33 1LODA 2HWF1 5FYIA 3P3NA 3RZKA 5ABJA 2V4AA 3FLTA 5EZWA 1W8HA 1URXA 2BWAA 5GZFA 4CRQA 5FOBB 2YPDA 4NWWA 2PHDA 4PLMA 4H7MA 4XCBA 5CFCB 5FZDA 2HWB2 1ENXA 2RDRA 1XQNA 5A70A 1UOJA 1SMVA 3Q8EA 1ZBE2 3I97A 1RVF2 1FI2A 2EICA 4IV3A 2XJTA 1LTEA 3NWKA 1AHSA 1PVC1 5DDJ2 5JXHA 5IK4A 2JWPA 1F31A 2PAKA 1FOD3 3GGLA 2AACA 5M0TA 5FP7A 2A6XA 3JQXA 5T3NA 3PUHA 5A7NA 4BQYA 1X50A 3VDCA 1J3QA 4LR4A 1UZ0A 1W39A 3WQ0A 4IGQA 4AW7A 5KXEA 4BCUA 4B7EA 3FHIB 4Q0PA 3RQ0A 2W2IA 3AKRA 3JD71 3T4VA 3GDBA 3SC7X 1F5FA 3ACGA 4W8JA 3WNPA 2JE9A 2ZEZA 3IWZA 4NRPA 4XDQA 5F5QA 5FWJA 1H1MA 1K42A 2C5DA 4GJYA 4P9XA 2PHXA 3VBHA 3ZFGA 2FDFA 1X82A 5J37A 2XGXA 1NCQA 3ILNA 2MEV2 1MVEA 4Z8BA 1CAXB 4Y33A 2GH8A 4WVVA 1CPNA 1W9WA 3AKQA 3FMGA 3PUAA 4P9JA 3W5NA 1RHI1 4ZXEA 2DDUA 4XFCA 5IVVA 1C1LA 1OF4A 5HCFA 1MZ5A 2Q1FA 4OUMA 4YZ5A 2DVGA 1VBE1 3OTFA 1H30A 1WBFA 4URAA 3BPZA 4N53A 2X5IA 2ZGPA 3C7EA 3FBMA 1MQTC 4E8CA 2FDIA 4AWDA 4AVBA 4DXTA 2HKXA 2OIIA 3IKWA 4INDA 1NA1B 5FOJB 3WEZA 4LO5B 3NV4A 1L7LA 4UFHA 4Q4W2 2VUJA 4CTEA 5T54A 3MBWA 2XJVA 4JV4A 1RUH2 4Q8KA 5DZGA 3OOXA 2DUQA 2VM9A 5FY5A 3ZXEA 1JUHA 5C3RA 2CGOA 5I93A 1HQNA 2XH6A 5I0SA 4CDWC 5B2GB 1A78A 2W08A 4HONA 4ZONA 3KVBA 4G3YC 4CDUB 3T2PA 5CEHA 2RS52 1SZBA 2ERFA 3N7LA 2BTVC 1UY3A 3M2MA 4RFT0 4CCJA 3GBFA 3RG0A 2FBEA 5F7UA 5FKCA 2RJ2A 3BTZA 5JDBA 3Q8CA 4UFKA 3USSA 2K0GA 1VB2A 5E8AA 4N43A 3T1LA 1SG3A 4RYDA 1JHJA 3KT7A 5C9AB 1VBC2 2OXBA 5FLJA 1ST8A 2ZX3A 1FMD1 3LIHA 2NN8A 1HLCA 2E51A 5JOYA 2EA7A 5T5OA 2FQPA 5JPNB 3UESA 1N1TA 2P3IA 1QXJA 2P37A 1C5IA 3VZMA 5I0DA 5LA2A 3MO4A 1OKOA 3AVRA 1BZWA 1D4VB 2QJVA 4QPIC 2P6CA 1RUF2 3OEAA 1HIXA 3AZZA 4CCKA 1V6KA 2R062 2P3JA 5JZGB 4YW4A 5CADA 1GZWA 2ILMA 2WZR2 3NJZA 4UFMA 3WDWA 5I8TA 2E63A 1LULA 3AM2A 4CYDA 4D6QA 4CA9A 4X6QB 5EYXA 3RZHA 4Z92B 1VIWB 1AYN2 1J1TA 3TN93 1H1IA 4CDQA 2FZ1A 2XJQA 4C91A 4FPHA 4PHZA 4LT5A 4FPCA 3LKJA 2I2SA 4NRMA 4M4PA 4YYOA 3WX5A 4H3WA 3ZFFA 4LKDA 4P5YA 5HI0A 4HMZA 4S2FA 2CGPA 4COWA 3AP7A 3RYKA 1DGRA 3Q8BA 1WW5A 4HKLA 5KHIA 1BKZA 5DG1A 3E5QA 3W21A 1JYTA 2P5BA 3BOWA 3WP3A 1GLHA 5LWBA 4BE3A 5F2WA 5FZOA 3FJSA 4IEWA 1LOGA 4ISQA 1HRI1 5DAQA 1NZIA 1TEIA 4LKEA 1OQ1A 4N90A 4D7TA 1L3JA 2GNMA 5ANQA 1MS4A 3HD8B 2D5FA 3B02A 2LTNA 2VMEA 1LHVA 1ULPA 5DG2A 5E16A 4QD2A 3WG1A 3KB5A 3KS7A 1E5HA 1YEWA 1DLCA 2IXHA 2YC0A 5A3NA 1DQ0A 4ZKTB 4IEQA 4N53C 2R1DA 4OHWA 2HWB3 1PK6B 2EF6A 1PZ7A 2UY9A 2X5IC 3IBMA 4MV2A 3OCPA 2DF7A 1B35A 3WUCA 5LZ6A 1YFWA 1ZBE3 1RVF3 1CZTA 1PMHX 2A5ZA 1VBB1 5B4NA 5C3OA 5FREA 3INAA 5DDJ3 4FOYA 2CY6A 3AYCA 1V6MA 3QCWA 2AGSA 1FX5A 1W8NA 3VBSC 3I59A 5FZKA 1F9KA 3GYDA 5I0UA 3THPA 2PHTA 4QPGA 3EQEA 1SLLA 2VG9A 1NCRB 3AMHA 5DAXA 3CLPA 4HN0A 4Q4V1 4BISA 1FNYA 2ARCA 4DIQA 3HOBA 1QNYA 2A6YA 2HLEA 2J1UA 3LB9A 1AZDA 2JXAA 2VULA 4I02A 4FPYA 4YRDA 4AYUA 2CSGA 3O1TA 4WZCA 1PM7A 5FR3A 4Y4YA 1RMU1 3N7KA 1WW4A 4HT1T 3RWNA 4E2SA 2Y6FA 2VZ1A 1JOPA 1SLIA 5HCHA 2OW4A 1LEMA 4C90A 2MEV3 2FZ2A 3SITA 1GKBA 1HB4A 1O59A 2BNMA 3USUB 1S4CA 1UF2C 1Q5OA 3D6EA 1O3TA 5FJHA 5FPZA 1V9U2 2J1EA 5FY4A 2NLRA 4QX5A 4GWIA 4BU2A 4CEYC 2DVAA 1ND2A 1YWKA 2VTFA 3AYAA 1RUJ1 5L7OA 2ZMLA 1G9BA 5FFOC 4XFHA 4ORFA 2ZX0A 4YWAA 4C1WA 4DINB 2CAVA 2LM3A 4Q4X1 1K3IA 1LNSA 1AR92 4TN7A 4AEDB 3RZLA 5F39A 1NXMA 5F3IA 1O8SA 2BNNA 1REDA 2GMEA 3WR0A 5IYYA 3POEA 2LRPA 4YG0A 1RUE1 2CNAA 3AXEA 3UJQA 4Q4Y2 1KFUL 1BEV2 1OOPC 3B69A 3O7OA 2VZSA 2GN7A 4O9GA 2Z79A 4Q4W3 3GJBA 4YGEA 2JG9A 3OGVA 4JGZA 2C0ZA 1LHWA 4NRQA 1RUH3 3FFZA 4K3UA 3ZFFC 3MW2A 2HJIA 5GLUA 2XJUA 3DYOA 1OURA 4DXZA 2SLIA 1H9PA 3IDEA 2JDAA 2WZPP 4DY5A 2DVBA 4CCOA 2RS53 2H0BA 3NSTA 3KGZA 2BEOA 2QTWB 4Q0SA 5D8AC 1UYYA 2BZDA 4BLJA 3EO6A 2P4EA 4XDOA 1RUC1 5C5TA 4RR3C 1COV2 1AF9A 3N9LA 5FUNA 4GH4B 3ZKYA 2O8QA 3THDA 1W8UA 1R1A1 3BCWA 3D82A 4A45A 2HWC1 2VOWA 2XXZA 4L11A 1VBC3 3BU7A 3RZJA 1IQAA 2HYXA 1TMF1 3OBAA 1VPHA 3WHUA 1HXS1 3UKVA 1PMIA 5E88A 1J59A 3M3IA 3OGRA 4ASMB 4LIUA 1WD4A 1DP0A 3VDDB 2QKDA 2VXRA 1ZA4A 2RS13 3LOIA 5FO7B 4LHNA 1WCSA 3HQXA 4XYXA 1KITA 1LGNA 3MHZA 1XYOA 3NV1A 3GM8A 1GOGA 1RJ7A 3M7AA 5DABA 2R063 2ET7A 1N3PA 3OBRA 2Q8OA 4TWTA 2WZR3 2Y0OA 1MPXA 2F4PA 2KM2A 4OI1A 2GC3A 1Q43A 2DBIA 3PUIA 3T4HB 2B5HA 2Y6JA 3PJYA 4LHKA 4X6RB 5C3PA 3T2OA 1AYN3 4WM8C 2FMDA 3N9QA 4FOQA 4K40A 4E9KA 2GALA 4BK4A 1IS6A 2EVXA 3SCFA 3NNFA 1OPMA 2BWCA 4BQWA 2VZRA 3MYXA 2OZJA 3HAGA 3SQOA 1CAWA 3H8RA 5EYYA 1QJY3 2JDNA 1EUUA 1V6OA 2V5YA 2YBSA 3DUIA 4J25A 3UKNA 2C26A 2RDQA 3J7LA 4XACA 5FK8A 4N9HA 4AR2A 4DEVA 4EQVA 3E5XA 2ZOEB 3VBRA 1AL21 1S1AA 1FOD1 2X53S 2XUMA 5A6XA 5FMDA 1YIFA 2AC1A 4YVWC 4JDMA 4AF9A 1DZTA 2XHKA 3ZYHA 4QMAA 1WLCA 4D94A 2WO3A 1F5JA 3F95A 1W8OA 3M3OA 4UF0A 5ABJB 4FBFA 4Z07A 4AXOA 3VBOC 2OUHA 5K0UC 1ND2C 4PBPA 2D7FA 2WS91 2ZX4A 4NHKA 3GZEA 2VUCA 4UOJA 4NHLA 2A3XA 3RI8A 3NV2A 4RHV1 5FXVA 3W9AA 2WFF1 1LAJA 3HN3A 3L2YA 4GMP0 5BNPC 2W1WA 4IV3B 4KL1A 1ENSA 4QX2A 2XLAA 4BH9A 1HRV1 1ND3A 3S5QA 2VZPA 1ZZCA 5LBCA 3ZYGA 4GULA 5JSPA 1FPN3 2VCBA 1YRZA 1R092 5JOZA 4MGYE 4IEOA 3PUSA 1NAEA 3J7NA 1EAH3 4XF4A 4ZS2A 4BDVB 4B8EA 2HEWF 3LEKA 3GCWA 4DPNA 4M3CF 4JVAA 2VC9A 4PIZA 4A41A 1D7PM 4IE7A 4IW3A 4UWDA 1AUYA 1WCKA 3VV1A 3KT4A 4FFHA 3IDAA 2NMOA 3KV6A 2RS32 3NAPA 4E8DA 4ZZ8A 2KR2A 4XAEA 5K4LA 1C4RA 4IL7A 3VDAA 1CN1A 5JXGA 3E6DA 2XKPA 1XRUA 1LR5A 2WLQA 3I2HA 1I1EA 4AI3A 2BGPA 2YDEA 3M1HA 1YC61 3ZFGB 3VBHB 4MSVA 4QB2A 4YLZA 1YJLA 3VHRA 1W2NA 1NCQB 5L9RA 4XFBA 2QFEA 1UX6A 5CG9A 3KM5A 4EN7B 2YXSA 2QQPA 2CHHA 1G86A 2R6QA 4IEPA 4NJ4A 4IESA 2Z4FA 3FE5A 3UJOA 2Y6GA 4AEJA 1QJU2 3KCCA 2WNUC 1C8M2 1H0BA 2ZEYA 4KI5M 5IHRA 4PF1A 1V9U3 3WCSA 4H14A 3NNLA 4Q2FA 4XJZA 1QWRA 1OLQA 4LO6B 3K77A 1OLRA 5FYZA 5H9PA 5FPUA 1XOYA 2DTYA 4KU8A 1DF0A 1X33A 3K4DA 4ZU5A 2YZ4A 5EIYB 1ZM1A 3U78A 4ASLA 2C1FA 4XXAA 4HLTA 3MLLA 5AVAA 4A4AA 3ZN5A 2D6OX 3NKTA 1AR93 2BJSA 1UX7A 4AGRA 2GP3A 3E1F1 3NO8A 1OLMA 1WD3A 4XFFA 4BA6A 4JC1A 1AR82 2WT2A 3ME2A 2ARBA 1O8PA 2PA7A 5FZ6A 2PHLA 2DFCA 2D3SA 2OT7A 2QQNA 1K45A 1RIRA 4QQLA 4Q4Y3 5T55A 1BEV3 4LORA 1JN2P 1O5LA 3P3PA 3RJRA 1ENQA 1JOJA 2RMU2 4X8NA 1QDCA 3ILFA 5I8YA 2ZAHA 4SBVA 2PHWA 4GWJA 2ZS6B 3ECQA 4DNYA 5C8CC 3ZYRA 4NHYA 4P02B 4OI2A 1U5IA 4QKBA 1DGWX 1VLNA 2VZTA 4A3XA 5LCWL 4Y4RA 3A21A 5IK5A 3RMXA 4GMP1 2WO1A 3H8UA 4N43B 3TNPB 2D6PA 4KG8A 4DXSA 2G19A 5KHJA 3I49A 3BB6A 3WW1A 1GANA 2YGLA 3MF9A 2NQYA 4AVVA 4MH0E 1COV3 3PURA 4DMIA 3FLRA 3SMHA 5C8WA 1AJKA 4AOCA 1QF3A 4JKMA 4QHBA 2CDPA 1N1YA 2WNVC 1DDLA 2VMGA 1DLLA 2ZGTA 3CF6E 1S0JA 4I3PA 4Q0UA 5FPVA 1G6NA 3T1MA 1SLTA 1PO22 2Z5WA 5B4XA 5CNAA 2Z2SB 3N7MA 1R1ZA 1GP4A 4LBQA 4CXWA 4KGQA 3I4IA 4XJ9A 2R16A 1J84A 1GZWB 1RUNA 5F3GA 2IUWA 3KHBA 5FUIA 3VHNA 3NNGA 3IDBB 5FKBA 1KJLA 2RR11 4CDQB 2ZMNA 1JZ6A 4GKYA 1QH7A 4Y1VA 3A22A 2QQOA 1OXCA 1G8WA 1Z78A 2BP6A 2PHRA 2UY8A 3WF1A 4LKSA 1W6NA 2G4IA 2K46A 3QH7A 1UKGA 1S2BA 5FYSA 2BV4A 5LA0A 2Y6KA 2EXIA 5FZOB 1GZ9A 1T6BX 1RUD1 3K2OA 3VGIA 2GZWA 2YB7A 4S2DA 3PL0A 3FZ3A 2ZHNA 5D2AA 2FCUA 1HN1A 4IERA 4W4ZA 3RWKX 5T5PA 4C0BA 1JYWA 2DU0A 4DFSA 3DPRA 4AZZA 2G9ZA 2R072 3OY8B 1H2KA 2EIGA 3LDRA 1JYVA 3IMMA 1UY2A 3A0NA 4CUCA 3V0AA 2PQQA 3GHNA 2WBKA 2NZ9A 2XWJB 4G9SB 3TBDA 3MZHA 4XFGA 2AUYA 1B35B 2XBO2 4ARXA 4CP1A 1S2KA 4KU7A 4KMQA 4HANA 3A0KA 3WV6A 1ZZBA 1UMHA 3ZXAC 1JZ3A 2R041 1DGLA 1RUG1 2D5HA 1CJDA 1PO12 3LQCA 5FZ1A 4YARA 1ULGA 2RM22 4RQPC 1R093 3I59B 3B7MA 1QQP3 3H9AA 1MZ6A 3EMRA 4LMFA 4QPGB 4RN5A 3T2QA 3MIGA 5A3UA 4RS5C 2AYHA 1WLTA 4XOGA 1Z7S2 5BNNC 4OYUA 4XVHA 4HOOA 2QQJA 5C3SA 1E5RA 4E4ZA 4IETA 4LTAA 2RS33 3TNQA 2QDRA 2WO2A 1BK1A 1MACA 4K8RB 1ZRRA 5A32B 4XMAA 1NX9A 1ZBA1 2V5DA 4FFFA 1GSLA 4YG3A 4YGBA 3NNMA 3ZSKA 3H8OA 2C24A 2NYYA 1E5IA 1US2A 3OPTA 3UKTA 4AQ2A 3U11A 1S0EA 4LIVA 5F3CA 1GWLA 3ZKUA 4F3JA 1QJZA 2VQTA 2W87A 2XQXA 4UW6A 3PU3A 1BBT1 5FXZA 1H6YA 5AC91 3CBNA 1DIWA 1RXGA 1S55A 4NPLA 4Q4W1 3D4KA 4Q5OA 3UL2A 3QLQA 4QX0A 4CCNA 3WXPA 3HBZA 4C8DA 5JAXA 2DCYA 1O4ZA 1RUH1 1MQTA 1QJU3 2VJXA 5IVBA 2HWD1 3ES1A 1C8M3 1UIKA 2QE3A 1OH4A 2QQUA 2WL1A 4O9EA 2YFZA 4BQ1A 5L7OB 1LOEA 3ON7A 3WNNA 2GH2A 4M4RA 2JB8A 4EWEA 2P2KA 1QJX1 3C2UA 2BBVA 4MGTA 4QAWA 1YQ2A 3VHOA 4Y5Z0 4TYSA 3POJA 4FAHA 4CDWA 2BFUS 3HQRA 5ERLA 1AR83 1F4HA 2B9UA 5D21A 2ZKNA 2LS6A 1GZCA 1KRIA 2JG9B 1XNTA 1WMEA 4JGZB 2DTWA 1IS5A 2V72A 4FPEA 1JYCA 4Y1XA 3KMHA 3OB8A 5IAXA 3HVDA 2XQRA 2ZGRA 4P14A 1U0AA 2VBDA 3CQOA 3N4MA 2RMU3 1ZRIA 3AMMA 4AG4A 1P8JA 2JD9A 3DXUA 3U14A 4CVUA 4DUVA 3ZDVA 1QY4A 2ZGUA 4BXFA 2GC2A 3N7JA 1AR73 3EYPA 3WZ1A 4UBHA 1RUF1 2IXCA 3RGBA 3SXWA 1YCIA 3LWCA 1W6MB 3ACFA 1FT9A 2VVFA 4MGSA 1LHNA 4B4PA 4NROA 1NOVA 4BIFA 5CU1A 2NPIA 4AI8A 4E4DX 1HV1A 4XCAA 4PIYA 5LBBA 3SCGA 2F4LA 3DPRC 4AHYA 1AYN1 1D2QA 3MLKA 3OBTA 4KBZA 4QPIA 4R9AA 2JDUA 4NR1A 1NQJA 2X05A 1X36A 4YZ3A 4YW1A 5CISA 1AR62 2BQPA 4OVEA 2TBVA 2HEYF 3MV01 3ZXFA 2XOMA 5A7OA 3PDQA 1IQDC 5KR7A 3ATGA 4LBQD 1EY2A 2HBTA 2WT1A 1PO23 2SBAA 3DECA 3MIHA 4FFIA 1RUI1 3HR9A 3DKWA 5KHHA 4BQXA 4XHBA 2PLV1 2XDVA 3PVNA 4RFRB 3AYDA 3FWEA 4FP3A 4FI9A 3LAGA 1M06G 4EE2A 1WMFA 4YM2A 5C7GA 1MS9A 1ZNPA 4MHRA 1V0AA 2ZTNA 1N3QA 1NY71 1LCLA 3UETA 4M3CA 1ASJ2 3WDYA 1WW6A 3IDCB 1PIV1 1GBGA 1QJFA 1EP0A 3GZTB 4UFJA 1JW6A 3H3ZA 1LKNA 4HBNA 4Y26A 1QIQA 3THCA 1G9AA 5FY1A 1CAWB 2E53A 3U0ZA 2ZZJA 1VJ2A 2WZ8A 3VB9A 4W65A 1NLRA 2Q30A 5F3EA 3BYWA 2GAUA 2ZX1A 3OF1A 5F2SA 4XF1A 3VBRB 4CUGA 2CAUA 1VBD2 2JE8A 4KWUA 5FQ0A 4I0AA 2MNGA 3MUZ1 1CAVA 4RD7A 5H9SA 3T0DA 4COVA 4AFDA 1Y3TA 2BGCA 3D5OA 3VZJA 3ORJA 3WY6A 5ACA2 1Q8QA 2VVEA 1FXZA 3FFQA 4IE4A 5FAXA 4CCCA 4DXRA 5DMYA 1MZEA 3DEMA 4RSUA 4UF0B 5JWPA 1ODNA 2E7QA 4E4HA 4WVWA 4QB6A 1QKQA 4YFZA 2R073 2ZEWA 2HWE1 1FV2A 1VB4A 1XSQA 5CG8A 1UW8A 3WG2A 1Q8PA 2ARAA 4BYYA 4OHZA 5IK7A 3MUY1 3VBSA 2JDMA 2XBO3 1ND3B 5HV4A 5C4WC 4K21A 5FZEA 3BALA 4PLOA 5CZKA 2VECA 4WBBA 3CIHA 5FYMA 1VAMA 4HPKA 4MX3A 1W9YA 2OQ7A 1LOBA 1PO13 2VUDA 5DQ0A 5I0TA 2RM23 3PVBB 3POYA 4EYUA 2JG8C 1BMV1 4YVSC 1WMDA 4PDWC 3G7DA 4QDSA 3X29B 4ET7A 4GKXA 5FPLA 4CXXA 3O5SA 3NAPB 5KC6A 2ES3A 1Z7S3 2D6NA 3BODA 3MDPA 2G1MA 2R1BA 3JCIA 4UW4A 3UGGA 3A7QA 3VKMA 4AFMA 3HJRA 3I3QA 1D4M1 3AXDA 4HK8A 4JGYC 2AZ5A 4DOUA 5CB7A 3MEPA 5JIAA 1MS1A 3U4SA 1GP5A 2GMPA 4AHZA 3BU0A 1YQ5A 3VKNA 1SPPA 2CYFA 4ARYA 1EPZA 3LEIA 1K5MB 2XVLA 1UZYA 4KH9A 3WLUA 3WW3A 4CEYA 3AX4A 2GC0A 2OQ6A 2FD8A 1RC6A 5LK5A 1PNGA 4IV1C 2RS12 4IQPA 5LRSA 1TNFA 2W52A 3ABZA 3HEIA 4WVZA 2CU5A 1MR5A 1L7RA 4IGPA 5FZ7A 1ULDA 5CFDC 3BGAA 5FY9A 3V0BA 3KF3A 3I2IA 4YGCA 1NKGA 5IVYA 2O14A 4BOWA 2JD4A 1OC1A 2VMIA 1O5UA 3URFA 1F8VA 2ZGLA 3I3BA 3I8TA 1XC6A 2JDHA 3F2ZA 3JBG3 3VZNA 1TME1 3I3DA 1OOPA 1GWKA 3POIA 3GZAA 4OI4A 3WHTA 3DL3A 2IC1A 4AE2A 5FZ4A 4XABA 3UNPA 2KXLA 2GP5A 3VBFC 4HVQA 1JH5A 3POFA 1X8EA 2A7AA 3S57A 2HWF2 1QJY2 3PNAA 1A6CA 1COV1 3IT8A 3Q8AA 4IEXA 5FMOL 3ZFEC 1LEDA 2OYZA 1AX2A 3HMYA 3J26N 4V2VA 4A3ZA 3LDBA 1OA3A 4FP2A 4KWJA 3B9IA 5FRAA 2A6ZA 2IXLA 2FDHA 3ETPA 5D8AA 4E2QA 2XL9A 1WCUA 4XBLA 4Y22A 3LA7A 1N47A 5EJ1B 3QOPA 5GM0A 5JLVA 1UL9A 3B5LB 2D6KA 2WAOA 4FQ4A 1PVC2 1CIWA 4RR3A 5CIRA 3RVHA 3ZN6A 4MXWB 4WM7C 2WQZC 2DCZA 2VBBA 3OGJA 4XF3A 4LE4A 4QPYA 5DXDA 5DUWA 4F7ZA 4JAAA 3J8F1 1Y9GA 1I6XA 4E27A 3KT1A 1PNFA 2VZ3A 3AP5A 5DAPA 1VBA2 3ZSEA 5I91A 4YM1A 3ZVXA 5A1FA 2AENA 1AL0G 4OHYA 3S7IA 1R64A 3ES4A 3DCQA 5FZ9A 2VXJA 5G05L 4QGLA 4QPWA 5LEKA 1FPN2 3RNSA 2H6BA 2JDPA 4BQ3A 3VHPA 1HDKA 2PYTA 1AR63 1NLSA 2EALA 2J22A 4P9WA 5FYYA 4XQWA 4BLIA 2FMYA 5CKQA 1EAH2 4GD4A 3WQ1A 1JU4A 1GV9A 3H7JA 1REEA 1UOFA 2E31A 5BPXA 1U5YA 1UY4A 4TTGA 1US3A 4QM8A 3CJXA 4WM8A 3K3NA 4XILA 4OQ9A 4COZA 2MHFA 2NM1A 2G9GA 4Y5TA 4XQDA 4A7YA 5FDBA 5I8SA 3OYWA 2YUEA 2WQ4A 5T50A 1RHI2 5BUVA 5TSWA 2A75A 2WWJA 4AQTA 5A6ZA 3LA2A 1X9PA 1YNAA 1ASJ3 1BJQA 1VBE2 4CPBA 4Z82A 1QXRA 5IVCA 5J36A 4IGOA 1MEC2 3WT3A 2AR6A 1YYNA 4GA9A 3HWJA 1WWYA 1JOBA 2YHJA 1D2SA 2DYCA 5DZEA 2VU9A 4YVWA 3IAQA 2JDZA 4L92A 1VRH2 1MS0A 3C3VA 3MI8A 3GZUC 5FK7A 1H8VA 5IVJA 1HB2A 5K0UA 3VBOA 1VBD3 1GQPA 2W1SA 5GJ6A 4AFAA 5JR7B 3TWIA 2VY0A 2BPA2 2PAMA 1GNHA 1DHKB 4BMEA 3RZMA 1CPMA 3LFMA 3T30A 5ACA3 2WFPA 2A6VA 1XYNA 5KHKA 4ONUA 5DUXA 3UV9A 5BNPA 2ZBJA 3ZPYA 2Q4SA 3AKSA 3LCPA 4H55A 4YNIA 4RL7A 1O3RA 2PHFA 5DZFA 3UT0A 2O8OA 1W6PA 2XVGA 5FUPA 1ULEA 4NWVA 2LROA 5AFEA 5J96B 1YFUA 1U5XA 5GZCA 4IXLA 1Y9QA 1IPJA 4N7IA 4O61A 4FPJA 5DN2A 1CD3G 3OJBA 1E5SA 3DXTA 3QBQA 3RRDA 4AFCA 3WF0A 1C5HA 4JQRA 3TEWA 5F37A 2D6LX 1X7NA 4MYEA 2P6HA 4P5HA 1DQ4A 4JKLA 1VALA 1H6XA 4CP9B 3ROUA 1WZXA 3K75B 3FUOA 4MADA 1A8MA 3I2OA 2XJSA 2GNDA 3UK9A 1JZ7A 1POV3 1W6OA 1W2AX 1DGWA 2QQVA 4NAMA 5CAZA 5KHGA 2XLFA 3UYJA 4EV0A 5C71A 3NW4A 2Q8DA 3ZSMA 4QB1A 3B9CA 3VUOA 3MIFA 4XBQA 4XUTA 4OQ8A 3QD6A 3BIWE 4LBKA 3ZXJA 1HX6A 2VMDA 5A7WA 1JZ8A 2VNGA 1BVP1 2WNUA 4YW6A 5L9BA 1H8TC 5IATA 4XUNA 3POGA 1FAYA 4LHLA 2VCCA 2Y38A 3IM0A 1OVPA 1RJ8A 1PVXA 1LHUA 1YFYA 2W47A 3B93A 5JPMB 3AMPA 3EB7A 1W04A 2Y6HA 1MS8A 1MQTB 4CDXC 4COYA 1YQ8A 2X8KA 5K7PA 4NIGA 2A6WA 4JDNA 1DFQA 1QGLA 2VMHA 4IE6A 4I2OA 2D6MA 3AC0A 2UWCA 4F8AA 1A3KA 1XE7A 1WCDJ 3CO2A 3H3LA 2B46X 2Y26A 4GB31 3WDUA 1RUOA 1PGL1 1Y43B 4LOSA 4AI1A 4D3WA 3CHXA 1HRI2 2EXJA 1O91A 1DZRA 2ZHLA 4CDWB 1XJAA 1VRBA 4AHWA 3WDVA 4AI9A 4ASKA 4EN9B 3KQ4B 2HWF3 1UYZA 5C8CA 2O0OA 1XE8A 3CL1A 5JOXA 1O3QA 5F1RA 3NVCA 4META 3ZO0B 4Q1RA 2ZX2A 2BOIA 3AL5A 2ADDA 1KD7A 1RITA 2Q8EA 1OF3A 4QX1A 3H1YA 5FBJA 1M4WA 1Q8SA 4LBLA 4XUQA 4DY3A 1PVC3 5FLHA 1PO21 2XL7A 3N3HA 4LITA 4OUEA 1Q3EA 2QQMA 2OVUA 5GZDA 2QZ2A 3O0WA 3HNYM 1JYNA 3O1SA 5FTTC 3SH5A 1OD3A 1GUIA 3H7YA 1Y4WA 4UFIA 2DU1A 1DGRN 1ZZ8A 2WNVA 2VOTA 3MFAA 2D3RA 3WF4A 1OKQA 3H3UA 3HT2A 3I2KA 1XYPA 3T08A 5C5UA 1VBA3 3B00A 4QPIB 4ZPIA 1ZZ9A 3A23A 4PQ9A 1HQWA 4JHTA 2VQUA 4AQSA 3O1VA 2D40A 5J1XA 2VOVA 4QHOA 5FP8A 3MLJA 1XPWA 3JD73 4ZXKA 4MLOA 3O1MA 3AMQA 2PFWA 3RYPA 1BQPA 1SFYA 2W1UA 5FZCA 4XURA 5G04L 5FWEA 1QQP2 3VBUC 2ADEA 4PCRA 2NP0A 1UYPA 1WBLA 4CCLA 4Q0QA 1UU4A 3AL6A 3AKPA 1RMU2 5BNOC 3OD0A 2IXIA 2D97A 4YZ1A 5A3PA 3KVAA 1VE0A 3ZYPA 2XR4A 2J1AA 3CU7A 3J7MA 4HVOA 5HCAA 3LDKA 1RB8G 4NHXA 2V4VA 4OHVA 3WINE 1UOGA 4CPBD 4M3CB 1RHI3 4S2GA 4L2NA 4URTA 4NE9A 1RUJ2 2R071 2PMWB 4A2UA 5L9VA 1WCQA 1UPIA 3JXSA 1VBE3 5H9RA 1O4TA 3QACA 4CDUA 1IOAA 1PZ9A 1MEC3 2WNOA 3C7GA 4Q4X2 4XBNA 3CKHA 2D44A 2GSYA 4F83A 2ZGMA 2BOJA 5EQUA 1VRH3 4ES8A 3UGHA 1CAVB 3ZXLA 3OEBA 1RUE2 1YHFA 1UY0A 4AEMA 4HETA 1PO11 5CA6A 4TZDA 1CQ9A 1DYKA 1PM4A 4QQPA 5A6YA 4L99A 5LY1A 4N53B 2X5IB 4XAAA 1AYM2 1XNAA 5C9AA 4L8QA 4XETA 3N9PA 2VO5A 3DN7A 3SISA 5LB6A 1XSRA 4JTNA 1BYHA 2AREA 2Y0IA 1JS9A 4MO3M 5CVRA 5CFCC 4JDOA 2PAEA 3VKOA 2PQSA 4N7UA 3ZMNA 3OPWA 5KWRA 3ZIXA 3VKLA 5KC5A 2PHUA 5CKMA 4IEZA 5DUVA 2ZHMA 1W9SA 4RQPA 4Y24A 2Z42A 3VBSB 1HB1A 2V73A 2X09A 1WW7A 4GZ9A 3BUCA 1HJGA 4WVMA 4RS5A 4FTEA 4Y1ZA 3ZR5A 1YO8A 2BRTA 3GF6A 4HPKB 5BNNA 5HBAA 2KD7A 3D0SA 4YSFA 1R1A2 4CZSA 5FO9B 2DBNA 2HWC2 1AR72 5I0RA 1WLDA 1VAKA 4CCDA 5EJ3A 2Q1ZB 1TMF2 4CXYA 4MGKE 3OUHA 2ARXA 4UYBA 1HXS2 2ZGQA 2GU9A 4XJWA 2V09A 1IKPA 4W6XA 4NMIA 3NKGA 4ATEA 3M3QA 1OSGA 2VCMA 4OZXA 3S30A 2IZWA 1GWMA 4IEYA 4UAPA 4HKWA 4QXKA 4XIKA 4B4QA 1KXGA 1NXD1 3TN91 1SPPB 1TZOA 2XLGA 4M00A 1UQXA 2UWAA 1ULFA 2DURA 2ATFA 2WYSA 3D0JA 4CEYB 5IWFA 1LOCA 3EXUA 1ZZ6A 2RJLA 3LZZA 3PIGA 4EWAA 4DRVA 3M3EA 4QDRA 3J4UH 3MFCA 1PGW2 4Q29A 2EXKA 4RGKA 5DAVA 2W68A 1AXKA 4JZRA 5HV0A 3SH3A 3JU9A 5LK7B 1QH6A 2F17A 2WWUA 3EJKA 2YFUA 1N3OA 4LO4B 2OKXA 4BPZA 1IZ3A 4Z2AA 1QJEA 3MPPG 4PT6A 1OI6A 1BLZA 2ZA9A 2XWBB 3P6BA 3QH6A 3ZDSA 4AK3A 3VD4A 1OOPB 1AL22 4EJRA 5L73A 2IWGB 1SCSA 1OHFA 2WRAA 1NA1C 1PX3A 1YI7A 3AFGA 1HRI3 4AL9A 4D0QA 3ZFFB 3V0AB 4QKFA 3MPBA 3OUJA 1J3RA 5CYYA 1W0OA 3U1XA 4FOVA 2HWB1 3CJIA 3ZYJB 1ZBE1 1DBNA 1RVF1 1ZZ7A 2WS92 1OQDA 2WSUA 3U37A 1SBFA 1JZ4A 4RHV2 5D8AB 5DDJ1 2WFF2 1LU2A 1DCSA 4QX3A 4Y22B 4P9LA 3KSCA 4CDUC 4JRAA 4NPRA 2VNVA 2EIEA 4RR3B 5FZFA 3HBKA 4M0HA 2BVVA 4AEKA 3ZN6B 1QOTA 1VBB3 3ZMOA 2W39A 4QT6A 2W91A 4PLNA 2W46A 1JXNA 1W03A 3H50A 2ZAAA 4TLFA 2MPFA 4LUMA 3VZLA 3WP6A 2EAAA 1Z0HA 4HXCA 4Q27A 4SLIA 4AVSA 1LJ7A 5C9AC 4GWNA 5LRRA 3AP6A 2WA4A 2VQ0A 1W8ZA 4AVAA 1UZWA 3RFRA 5F5IA 3P1IA 2P17A 4LQRA 4Q4V3 2UU8A 3FL7A 4ZZ5A 2A71A 4D7SA 1JTZX 3O1UA 2MEV1 3E5UA 3KCYA 2LALA 3ZXDA 1KFXL 1WMXA 3WDXA 5A3OA 3ITQA 1DZQA 4AGGA 2XJRA 4R9BA 1RMU3 2VZOA 4WM8B 4AEDA 2Y6LA 4A6SA 5JZGC 4K7JA 3OGSA 3RDIA 5C6CA 5T5JA 4AGVA 1SQ4A 4GAZA 2J1RA 1REFA 4Q8LA 1XNBA 3OYWB 4XUOA 3RS6A 5FV3A 3ST7A 3BKZA 5F8PA 4Q1PA 1CZSA 1UPSA 3N9NA 3I2JA 1RGSA 4KQ7A 4A7ZA 5JSOA 4CEWA 3KZ4C 1GICA 1RUJ3 5FP3A 5LBFA 3AZYA 1DYPA 4CE8A 4CCMA 4FOWA 1PZ8A 1W3VA 1RYYA 2P3KA 4YVWB 4YM3A 2WIIB 4Q4X3 3R6SA 4CU9A 1S2EA 2K9ZA 3LE0A 1RINA 1UU5A 2ZMKA 4BIOA 3KCXA 3VBOB 5K0UB 1HB3A 1ND2B 2BYVE 3HNMA 4NPMA 4EZHA 3AYEA 3FLPA 1RUE3 1OD5A 1BVVA 4XJ8A 3WD5A 3THTA 1I5ZA 5LASA 2NMNA 1BXHA 3JB8A 1KDMA 3JUUA 3JBG2 5JXJA 4COUA 5BNPB 1AYM3 2VZUA 2ENRA 2RS51 1OQEA 4X8PA 1W99A 1AX0A 3IIAA 1XB9A 1BCXA 1X9TA 3W58A 1W6PB 3C8XA 5C4WA 4J1WA 4XC9A 1Q8VA 3NL1A 1UCXA 1OBNA 1PK6C 3APBA 2JENA 1KDKA 3MF6A 1QEXA 1GU3A 5JIUA 1KJRA 3WQBA 4B1LA 2JG8A 2GN3A 2VNOA 4YVSA 4BQ5A 4PDWA 3SEPA 2WABA 1VBC1 2WT0A 2ZCWA 3HIFA 4K1ZA 5F32A 3AP4A 2J1VA 4G4FA 4XHXA 3KGLA 4K6BA 4L0PA 5A3LA 2WR9A 3OPZA 2QBXA 5J48A 2VQAA 5DUUA 1JMUB 3CJIC 1UZVA 4HL0A 4JRLA 4YW3A 1Q56A 2HH9A 3L9JT 1CWPA 1R1A3 2JDYA 1GYKA 2RS11 3R4UA 2BERA 2B9VA 2HWC3 3ACLA 4JGYA 1YI9A 4P9GA 1NCRC 5A1AA 1R082 2P3YA 1TMF3 3AJZA 2C9AA 1HXS3 4KGGA 1IPSA 2R061 3O12A 2WZR1 2JIJA 5BXXA 4IV1A 4GQ7A 4P08A 1SDDB 2UYBA 1ULCA 3U07A 2HYKA 5GZGA 2Q8CA 3K46A 5LATA 5A7WB 4CU8A 2H6CA 3CZUA 4FPGA 2WNUB 3AB0A 4FCAA 2ETEA 3L2HA 4H2AA 2FCVA 4RGGA 2YU2A 5EHDA 4XEZA 5CFDA 3W59A 1T6GC 4J1XA 4EN0A 1EV12 2BW8A 2RR12 2DCKA 2GC1A 2W9XA 1QJY1 1CZVA 1H9WA 5J09A 3NJVA 3E6CC 4LEJA 1QMJA 2WQ8A 3KV5A 4DO0A 1JZ2A 3KHCA 1UY1A 1U5ZA 1GNZA 2XVKA 4QXCA 4YW2A 3ZN4A 3TRSB 4BQ4A 2Q1MA 1IHMA 2J1SA 2DVFA 2VH9A 3TOJA 3V64A 3VBFA 3IPVA 3PUQA 3LA3A 1KS5A 4HFSA 2OX0A 4W50A 4GALA 4FTSA 1RUD2 5BYNA 2IXKA 3ZFEA
chains in the Genus database with same CATH topology
4AEDC 1UAIA 1AL23 2VNRA 4Z2WA 4PBOA 4YGDA 3A4UA 5EV7A 3ZIWA 3E97A 2DUOA 4FQZA 2R49A 2PTMA 4ITCA 1VBA1 5C8CB 4Y1YA 5A33A 4Q0VA 2ZJCA 4CEWC 2WS93 1DG6A 4WM7A 1FPN1 4C1XA 1V6NA 5L36A 3VL8A 3J9SA 4RHV3 2WFF3 1W2UA 1EAH1 1XNKA 1AVBA 1IGOA 4LBJA 2WJSA 2R042 1J58A 1RUG2 1HRV3 3AZVA 1CESA 2HEVF 5JSRA 4K20A 2WNVB 2OA2A 4GH4C 5AVPA 2E9QA 4GXLA 4OULA 4Z1VA 4HKOA 3AP9A 1LOFA 4MUVA 3WVJA 3RZZA 5T5LA 5GLVA 3WCRA 2IXJA 2DUPA 4UW3A 1YJKA 1ZBA2 3VDDC 3WUDA 5FBZA 4B3NA 1MEC1 1CAUA 4R9DA 2RHPA 4HSJA 5KXDA 4HK9A 2EXHA 1VRH1 4FTBA 1BBT2 1V9U1 3RMYA 3TAYA 5AC92 3AZXA 4U2AA 3FBYA 4AI2A 3ZXGA 1GQHA 1O3SA 1QOSA 2HWD2 2A3WA 4L97A 1AR91 4R4ZA 5H9QA 1V6JA 1QJX2 1UMZA 3SHRA 2YV8A 1RL3A 4BMBA 3ETQA 2I07B 1Q8OA 1BEV1 2ZACA 3M3CA 4Q4Y1 5KXCA 4LBNA 1ALYA 4EN6B 2UWBA 1H1AA 4DQAA 1UIJA 4YFWA 2A3YA 5ABJC 1NZCA 4LUKA 4OFGA 4K9SA 2BUKA 2YPJA 3SH4A 2VW1A 1X8MA 1UZZA 2D3PA 1W6QA 3VLBB 3SCHA 1G9DA 1W0PA 4IV3C 1DQ2A 4KBBA 4RQPB 4XZPA 5AFBA 1I9RA 2O1QA 4XJAA 4I30A 1SBDA 4WVMB 2TNFA 4RS5B 4R9CA 3EBRA 1H4GA 2W0XA 4GMP3 4OUSA 5A3MA 3ASIA 5BNNB 2GDFA 1FYUA 4EWDA 1ZREA 3WNXA 4ATFA 5F6KA 2VUAA 4RA0A 5F6LB 2I45A 2KA3A 1XU1A 1N1SA 2VOKA 4UXAA 4DZGA 1GR3A 1R083 4XFAA 1S0DA 4FPOB 4LBMA 1H8TA 1DQ5A 2CL2A 4FSJA 2PELA 4HZFA 2PN5A 1ONAA 4LLFA 1O4YA 3VKFC 3ZFGC 2I74A 3VBHC 1RUI2 1YLLA 4I09A 1S0CA 3CEWA 1V6LA 1UD1A 2PLV2 4Y20A 5FO8B 1NCQC 2OZ6A 2JEMA 4EN8B 3JD72 4CDXA 4FVVA 2Z69A 5HXVA 4ES9A 2FHRA 4KG0A 1NY72 2VGDA 1EV13 2RR13 1LOFC 1OFNA 4K8FA 1PIV2 2XG3A 1LESA 3OY8A 2Q0AA 3R4DB 4LBQB 2E6VA 3JQWA 3H0OA 4NVPA 2YGMA 3KD4A 1S0GA 5KXBA 1U12A 3PVEA 1DQ1A 4PF5A 2JE7A 1NE6A 2DWRA 3MIEA 3GBWA 4DB5A 3K48A 1RUD3 5HCBA 1H2LA 4IEVA 3IMNA 2R0HA 2YYOA 4CP2A 1I3HA 3B3QE 3R05A 1HKDA 3CJIB 1W6NB 4M01A 3MICA 2R30A 1C28A 1C8NA 1QU0A 5CBLA 2HWE2 1H2NA 4E2GA 4QQ2A 3GNEA 4QGNA 5F9TA 1G9CA 2YROA 1R091 1QQP1 4TSVA 1PHMA 2JX9A 2R043 1RUG3 3DPRB 5SV5A 1UU6A 3B01A 5L19A 4N43C 5IUQA 1C1FA 2RS31 4S2HA 1BMV2 3SLIA 1C57A 2WC2A 4R8HA 3VBUA 4LO8A 1OFSA 4GIQA 3RI9A 1AXZA 1CJPA 1XNCA 5BNOA 1CVNA 1D4M2 5K9YA 2UURA 3AJYA 3M4FA 3WDTA 3RPQA 1LRHA 1ZBA3 3LSEA 4AVTA 5JMCA 3ILRA 1FMD2 3D8CA 3WG4A 4WV8A 1LU1A 1QJU1 3O0VA 3I7DA 1J1LA 3ALQA 4I01A 1C8M1 4JTOA 4XF9A 1A8DA 1MZFA 2QCSB 1BBT3 2BVBA 4FAGA 1AX1A 4N9IA 5AC93 1LGCA 3WW2A 1NQDA 2UYAA 2ZKLA 4DS0A 4CDQC 1N1VA 4U36A 1AYM1 2VOXA 1H2MA 2HWD3 2D93A 4CEWB 1JUIA 2WA3A 2JECA 5J3UA 1AR81 1TME2 3PMSA 1QJX3 2B8MA 3AMNA 1F2NA 1V00A 3T2TA 3ZXKA 5GLZA 5FPXA 3KQRA 1W6MA 1ZRDA 1YUDA 1ZRFA 2RMU1 1ENRA 4HSLA 4I0BA 2ET1A 5CFCA 1LB2A 1QNWA 1Y7BA 2B39A 4BWOA 2QDNA 1AR71 3BOPA 3PHMA 2P34A 4ZU7A 3VZOA 2ZGKA 5C4WB 5IT6A 4AI0A 1XU2A 1B35C 4R52A 3K51A 2JG8B 1RUF3 2WSVA 4YVSB 4PDWB 3ZSLA 3VZKA 3J8F2 5D1IA 4M0NA 4QQHA 1SBEA 4HVRA 4OI0A 4QPGC 3O0XA 1APNA 3POSA 1SLAA 4JGYB 5FCCA 1VBB2 1PGW1 4MVTA 2CWMA 5FMOS 2ZHKA 4MGIE 4AFBA 1EYBA 1CAXA 4IV1B 2CGNA 4A7KA 1VP6A 2VW0A 1RUI3 3WP5A 4M3CE 2TEPA 2XKOA 2PLV3 2WWSA 3MGUA 4Q4V2 5EFUA 3OD4A 5J98B 2VPVA 5CFDB 2JKBA 1O7FA 3U10A 4B29A 5LEJA 3BTAA 3ELNA 1V6IA 2BNOA 1CGPA 4HN1A 4LBOA 2VVDA 2OPKA 1IS4A 1PGSA 1PIV3 5L7OC 4NHMA 1NA1A 3MW4A 4I3GA 1LECA 3S7EA 1XXNA 3FUQA 3RSJA 3VBFB 3IPVB 3TB0A 3KLSA 1TQ5A 5C33A 1VR3A 1EPWA 1OA4A 3ZFEB 1HW5A 2VW2A 4FO9A 1G7YA 1RTVA 3WQ7A 1OMIA 5EWSA 1YIPA 1S0IA 2JG9C 5JOWA 4JGZC 5KBFA 1ZYBA 3N36A 3LSDA 1OPOA 5A33B 1DU3D 2TUNA 2XBO1 4WM7B 4XJUA 2R0FA 4XF0A 5FQ0B 4XW3A 2HWE3 2E7TA 1AJOA 3I2DA 2E7AA 2X29A 1JYIA 2RM21 3WW4A 1IPKA 5EXOA 3DGTA 3U4XA 5T52A 1K5MA 2DCTA 3S6PA 1Z7S1 2B7YA 2RJKA 5GALA 1J3PA 1LGBA 4LLOA 4OHXA 5BV6A 2GNTA 3SNMA 3FC0A 2GMMA 3HT1A 3FX3A 2BFUL 3H1WA 4V1PA 1NYWA 4L9BA 4FXKB 5JZGA 5JI7A 3AK0A 1D4M3 1RUC2 4WZFA 3S0MA 1CAUB 1SFNA 2ZGNA 3ZYIB 1TNRA 1WLWA 4P9YA 1FMD3 3PMEA 1FV3A 4EROA 4XFIA 2ZABA 3PLQA 3WOGA 3WP4A 4FPLA 2QVSB 1SCRA 1QOOA 2XPJA 3EHKA 3JBG1 2DFBA 4BM8A 2JJ6A 2D98A 3OGGA 2WKKA 3VN4A 3Q9OA 4XIOA 4FT8A 4GB32 5JCTA 2CWSA 1PGL2 1SLCA 4JCKA 1TME3 2QUOA 3LOBA 3PVOA 4MXWA 3VBRC 4BZ4A 4YG6A 4LA2A 2D43A 3LGRA 1D0GA 3E6BA 3V0BB 2ZGOA 1QHDA 4W6YA 2DCJA 2ZZQA 3M70A 1PK6A 4NO4A 1YXWA 4YW5A 4PJYA 1FOD2 3RJ2X 1IS3A 1XNDA 2WNEA 2R32A 1R081 1ZVFA 5E1RA 4XTPA 4W6WA 2YY1A 1W6QB 2A70A 3ENRA 3JZVA 1POV0 1QDOA 5FLIA 2N7GA 2AH2A 1ND3C 4I0WB 3PJQA 3PTYA 1S0BA 5K8SA 1KQRA 1NCRA 4Y1UA 1AR61 1JBCA 3J8F3 3GBGA 3R0RA 1B09A 1MVQA 1EV11 3AFKA 3JB4C 1KS4A 1HRV2 1DQ6A 3NAPC 1LHOA 2B45X 4H7LA 2G9FA 2GNBA 2YMZA 4LO7A 1E57A 1G9FA 1H8TB 2B42B 1FNZA 2IFWA 2ZPXA 4YZ2A 4MGZE 2EAKA 2ZGSA 5JI9A 1AXYA 3USUA 4QM9A 1MS5A 4Y20B 1K5MC 2CV6A 4CDXB 4XQ4A 1ASJ1 4OLLA 1JHNA 4GWMA 3MW3A 3V65A 1CR7A 4XMIA 4ZU4A 1GQGA 4B4RA 1D0HA 1WA4A 4DRRA 2H0VA 4QU2A 1UKRA 1WGPA 1SDWA 3WG3A 4R4XA 4D7YA 4E4SA 4FPKA 3ZX7A 1ZX5A 2K2SA 1VBD1 5GZEA 5SV8A 4B7KA 1KRIA 1HV0A 3RYRA 1OA2A 4KWKA 4Q26A 1CONA 2RE9A 3DV8A 5ACA1 1ZRCA 1V70A 5E89A 1HQLA 5GLTA 4AQ6A 3O14A 4QQOA 1VAVA 4UW5A 1MS3A 5GKAC 4J6GA 4XPVA 2F6BA 3TYJA 4CP0A 3IN9A 4RGAA 1CX4A 1GFF2 3M8LA 3AZWA 5BNQA 5BY5A 2IFRA 2DV9A 1NG0A 4XE9A 1C3HA 4K1YA 4MXVA 1SEFA 2LUWA 4LA3A 1LOAA 3N35A 4P9IA 4PIXA 4ISRA 4GH4A 2A73B 1WUVA 1LENA 3GHMA 3G6JB 2JICA 4XTMA 4FPFA 1POV1 3ZSJA 4C0HA 2QZ3A 3VDDA 2CTVA 4YM0A 4QGMA 3VBUB 1SACA 3B94A 1TE1B 2XB6C 2WLPA 1IKQA 4KWLA 3AKTA 4MZUA 5BNOB 2OUJA 4LULA 4BHPA 4D69A 3CNAA 4LE3A 1RUC3 3MIBA 3POWA 2QNKA 4IEUA 4NOTA 4AVCA 4UBGA 3DF0A 3NV3A 3TN92 1YFXA 1SLBA 3GALA 1S0FA 3HN1A 2XJPA 1NE4A 1W6OB 1UN1A 4KNCA 4XXPA 3R4SA 1H4HA 5IK8A 1QXPA 2WINB 5J7MA 5JVVA 4AHXA 3V56A 3I54A 4LNVA 1FATA 3MIDA 2DVDA 5GLWA 3VL9A 4FXGB 4NN0A 2Q5TA 4YZ4A 3H1MA 4GB33 1LODA 2HWF1 3P3NA 5ABJA 3FLTA 5EZWA 2BWAA 1URXA 5GZFA 4CRQA 5FOBB 4NWWA 2PHDA 4PLMA 4H7MA 5CFCB 2HWB2 1ENXA 1XQNA 1SMVA 1ZBE2 1RVF2 1FI2A 4IV3A 2XJTA 1LTEA 3NWKA 1AHSA 1PVC1 5DDJ2 5IK4A 2PAKA 1F31A 1FOD3 2A6XA 3JQXA 5T3NA 1X50A 1J3QA 4LR4A 1W39A 3WQ0A 4AW7A 5KXEA 4BCUA 4B7EA 3FHIB 4Q0PA 3RQ0A 3AKRA 3JD71 1F5FA 2JE9A 3IWZA 4XDQA 5F5QA 1H1MA 2C5DA 4P9XA 2PHXA 3VBHA 3ZFGA 1X82A 5J37A 2XGXA 1NCQA 3ILNA 2MEV2 1MVEA 4Z8BA 1CAXB 2GH8A 4WVVA 1CPNA 3AKQA 3FMGA 4P9JA 1RHI1 4XFCA 1C1LA 5HCFA 1MZ5A 4OUMA 4YZ5A 2DVGA 1VBE1 3OTFA 1H30A 1WBFA 3BPZA 4N53A 2X5IA 2ZGPA 3FBMA 1MQTC 4AWDA 4AVBA 2HKXA 2OIIA 3IKWA 4INDA 1NA1B 5FOJB 4LO5B 3NV4A 4Q4W2 2VUJA 4CTEA 5T54A 2XJVA 4JV4A 1RUH2 4Q8KA 5DZGA 2DUQA 3ZXEA 1JUHA 2CGOA 1HQNA 2XH6A 5I0SA 4CDWC 5B2GB 1A78A 2W08A 4G3YC 4CDUB 2RS52 2ERFA 3N7LA 2BTVC 3M2MA 4RFT0 3GBFA 3RG0A 2FBEA 5JDBA 3USSA 2K0GA 1VB2A 5E8AA 4N43A 3T1LA 3KT7A 5C9AB 1VBC2 5FLJA 2ZX3A 1FMD1 2NN8A 1HLCA 2E51A 5JOYA 2EA7A 5T5OA 2FQPA 5JPNB 1N1TA 2P3IA 1QXJA 2P37A 1C5IA 3VZMA 1BZWA 1D4VB 2QJVA 4QPIC 1RUF2 1HIXA 3AZZA 1V6KA 2R062 2P3JA 5JZGB 4YW4A 5CADA 1GZWA 2ILMA 2WZR2 3NJZA 3WDWA 5I8TA 2E63A 1LULA 3AM2A 4CYDA 4X6QB 5EYXA 4Z92B 1VIWB 1AYN2 1J1TA 3TN93 1H1IA 4CDQA 2FZ1A 2XJQA 4C91A 4FPHA 4LT5A 4FPCA 3LKJA 2I2SA 4YYOA 3V0AA 3WX5A 5HI0A 4H3WA 3ZFFA 2CGPA 4HMZA 4S2FA 4COWA 3AP7A 3RYKA 1DGRA 4HKLA 1WW5A 5KHIA 1BKZA 5DG1A 3E5QA 3BOWA 3WP3A 1GLHA 4BE3A 3FJSA 4IEWA 1LOGA 4ISQA 1HRI1 1TEIA 1OQ1A 4N90A 4D7TA 1L3JA 2GNMA 1MS4A 3HD8B 2D5FA 3B02A 2LTNA 5DG2A 1LHVA 5E16A 3WG1A 4QD2A 3KB5A 3KS7A 2IXHA 2YC0A 1DQ0A 4ZKTB 4IEQA 4N53C 2R1DA 4OHWA 2X5IC 2HWB3 1PK6B 2EF6A 1PZ7A 2UY9A 3IBMA 4MV2A 3OCPA 2DF7A 1B35A 3WUCA 1YFWA 1ZBE3 1RVF3 2A5ZA 1VBB1 5FREA 3INAA 5DDJ3 4FOYA 2CY6A 3AYCA 1V6MA 3QCWA 2AGSA 1FX5A 3VBSC 3I59A 5I0UA 1F9KA 3GYDA 3THPA 2PHTA 4QPGA 3EQEA 1SLLA 2VG9A 1NCRB 3AMHA 3CLPA 4HN0A 4Q4V1 1FNYA 1QNYA 2A6YA 3LB9A 4I02A 4YRDA 1AZDA 2JXAA 2VULA 5A32A 4FPYA 4AYUA 4WZCA 1PM7A 4Y4YA 1RMU1 3N7KA 1WW4A 4HT1T 3RWNA 4E2SA 1SLIA 2OW4A 1LEMA 4C90A 2MEV3 2FZ2A 3SITA 1GKBA 2BNMA 3USUB 1O3TA 1UF2C 1Q5OA 3D6EA 5FPZA 1V9U2 2NLRA 4QX5A 4CEYC 2DVAA 1ND2A 1YWKA 3AYAA 1RUJ1 5L7OA 2ZMLA 1G9BA 5FFOC 4XFHA 4ORFA 2ZX0A 4C1WA 4DINB 2CAVA 2LM3A 4Q4X1 1AR92 4AEDB 1NXMA 2BNNA 1REDA 2GMEA 3WR0A 4YG0A 1RUE1 2CNAA 3AXEA 3UJQA 4Q4Y2 1KFUL 1BEV2 1OOPC 3B69A 3O7OA 4Q4W3 2GN7A 4O9GA 2Z79A 4YGEA 2JG9A 4JGZA 2C0ZA 1LHWA 1RUH3 3FFZA 4K3UA 3ZFFC 3MW2A 2HJIA 5GLUA 2XJUA 4DXZA 2SLIA 1H9PA 3IDEA 2WZPP 4DY5A 2DVBA 2RS53 2H0BA 3NSTA 3KGZA 2BEOA 4Q0SA 5D8AC 4BLJA 3EO6A 1RUC1 4RR3C 1COV2 1AF9A 4GH4B 2O8QA 3BCWA 1R1A1 3D82A 2HWC1 2VOWA 4L11A 1VBC3 3BU7A 1IQAA 1TMF1 3WHUA 1HXS1 3UKVA 1PMIA 5E88A 1J59A 3M3IA 4ASMB 1WD4A 3VDDB 2QKDA 2VXRA 1ZA4A 2RS13 3LOIA 5FO7B 4LHNA 1WCSA 3HQXA 4XYXA 1KITA 1LGNA 1XYOA 3NV1A 1RJ7A 3M7AA 2R063 2ET7A 1N3PA 3OBRA 2Q8OA 4TWTA 2WZR3 2Y0OA 2F4PA 2KM2A 4OI1A 2GC3A 1Q43A 2B5HA 4LHKA 3PJYA 4X6RB 1AYN3 4WM8C 2FMDA 4FOQA 4K40A 4E9KA 2GALA 1IS6A 2EVXA 3SCFA 1OPMA 2BWCA 3MYXA 2OZJA 3HAGA 1CAWA 5EYYA 1QJY3 3UKNA 1V6OA 2V5YA 3DUIA 4N9HA 3E5XA 2ZOEB 3VBRA 1AL21 1S1AA 1FOD1 2X53S 2XUMA 1YIFA 4YVWC 4JDMA 4AF9A 1DZTA 2XHKA 4QMAA 1WLCA 4D94A 1F5JA 3M3OA 5ABJB 4FBFA 4Z07A 4AXOA 3VBOC 2OUHA 5K0UC 1ND2C 4PBPA 2D7FA 2WS91 2ZX4A 4NHKA 3RI8A 4NHLA 2A3XA 3W9AA 3NV2A 4RHV1 2WFF1 3L2YA 4GMP0 5BNPC 4IV3B 4KL1A 1ENSA 2XLAA 4BH9A 1HRV1 1ND3A 1ZZCA 3ZYGA 5JSPA 4GULA 1FPN3 1YRZA 1R092 5JOZA 4MGYE 4IEOA 4XF4A 1EAH3 4B8EA 2HEWF 4DPNA 4M3CF 4JVAA 4PIZA 1AUYA 1WCKA 3VV1A 3KT4A 2NMOA 2RS32 3NAPA 1C4RA 4IL7A 1CN1A 3E6DA 2XKPA 1XRUA 1LR5A 2WLQA 1I1EA 4AI3A 2YDEA 3M1HA 3ZFGB 3VBHB 4MSVA 4YLZA 1YJLA 3VHRA 1NCQB 4XFBA 2QFEA 1UX6A 5CG9A 3KM5A 4EN7B 2YXSA 2QQPA 1G86A 2R6QA 4IEPA 4IESA 3FE5A 3UJOA 4AEJA 1QJU2 3KCCA 2WNUC 1C8M2 1H0BA 1V9U3 3WCSA 4H14A 4Q2FA 4XJZA 1QWRA 1OLQA 4LO6B 1OLRA 5H9PA 4ZU5A 2DTYA 4KU8A 1DF0A 1X33A 2YZ4A 1ZM1A 4ASLA 2C1FA 4XXAA 4HLTA 3MLLA 5AVAA 3ZN5A 2D6OX 3NKTA 1AR93 4AGRA 4BA6A 3NO8A 4XFFA 1WD3A 5JLVA 4JC1A 1AR82 2WT2A 3ME2A 2ARBA 2PA7A 2PHLA 2DFCA 2D3SA 5T55A 1RIRA 4QQLA 4Q4Y3 1BEV3 1JN2P 1O5LA 3P3PA 3RJRA 1ENQA 1JOJA 2RMU2 4X8NA 1QDCA 3ILFA 5I8YA 2ZAHA 4SBVA 2PHWA 2ZS6B 3ECQA 4DNYA 5C8CC 3ZYRA 4OI2A 1U5IA 1DGWX 1VLNA 4A3XA 5IK5A 3RMXA 4GMP1 3H8UA 4N43B 3TNPB 2D6PA 4KG8A 5KHJA 3BB6A 3WW1A 1GANA 2YGLA 3MF9A 2NQYA 4AVVA 4MH0E 1COV3 4DMIA 3FLRA 3SMHA 5C8WA 1AJKA 1QF3A 4QHBA 1N1YA 2WNVC 1DDLA 2VMGA 1DLLA 2ZGTA 3CF6E 1S0JA 4I3PA 4Q0UA 1G6NA 3T1MA 1SLTA 1PO22 2Z5WA 5CNAA 2Z2SB 3N7MA 1R1ZA 4LBQA 4KGQA 3I4IA 4XJ9A 2R16A 1GZWB 1RUNA 3VHNA 3IDBB 1KJLA 2RR11 4CDQB 2ZMNA 4GKYA 1QH7A 4Y1VA 1G8WA 1Z78A 2PHRA 2UY8A 1W6NA 2G4IA 3QH7A 1UKGA 1S2BA 2EXIA 1GZ9A 3VGIA 1RUD1 2GZWA 4S2DA 3FZ3A 2ZHNA 4IERA 5T5PA 4C0BA 2DU0A 4DFSA 3DPRA 2R072 3OY8B 1H2KA 2EIGA 3A0NA 2PQQA 3GHNA 4G9SB 2NZ9A 2XWJB