2FCVA

Syrb2 with fe(ii), bromide, and alpha-ketoglutarate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
304
Chain Sequence
KKFALTAEQRASFEKNGFIGPFDAYSPEEMKETWKRTRLRLLDRSAAAYQDLDATNIANYDRHLDDDFLASHICRPEICDRVESILGPNVLCWRTEFFPKYPGDEGTDWHQADTFANASGKPQIIWPENEEFGGTITVWTAFTDANIANGCLQFIPGTQNSMNYDETKRMTYEPDANNSVVKDGVRRGFFGYDYRQLQIDENWKPDEASAVPMQMKAGQFIIFWSTLMHASYPHSGESQEMRMGFASRYVPSFVHVYPDSDHIEEYGGRISLEKYGAVQVIGDETPEYNRLVTHTTRGKKFEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords syringomycin biosynthesis enzyme 2
publication title Crystal structure of the non-haem iron halogenase SyrB2 in syringomycin biosynthesis.
pubmed doi rcsb
source organism Pseudomonas syringae
total genus 100
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2fcvA00
3NNJA 5LATA 3HQRA 2RG4A 4XACA 3ITQA 4UWDA 4MHUA 4MHRA 2RDRA 4JZRA 3OUIA 4Y5SA 5A3UA 3NNLA 4NHYA 5IAVA 3W21A 5LBEA 3BVCA 4NMIA 2JIGA 3W20A 5LBBA 2G1MA 2OPWA 4NHXA 3EMRA 2A1XA 2FCUA 3GJAA 5IAXA 5LB6A 3OBZA 2FCVA 2FCTA 3DKQA 5IATA 4XCAA 5EPAA 4BQWA 4Y5TA 2G19A 4ZPIA 4XAAA 5ERLA 3PL0A 4IW3A 5DAVA 2HBTA 3GJBA 2Y33A 5HV4A 5LASA 4J25A 5M0TA 3KT7A 2V4AA 3MGUA 5C5UA 2JIJA 3OUHA 3NNFA 5L9RA 4ZONA 2RDQA 4XC9A 5LA9A 5DAWA 5DAPA 3GZEA 2Y34A 3NNMA 4BQXA 5HV0A 3KT1A 4NHLA 5LBFA 5LBCA 4KBZA 3HQUA 3KT4A 5L9VA 2HBUA 4BQYA 3OUJA 4XABA 4XCBA 5DAXA 5C5TA 2RDSA 4NHKA 4Q5OA 5EP9A 5EQUA 5L9BA 4NHMA 4NAOA 5DAQA 2RDNA
chains in the Genus database with same CATH superfamily
1RB8G 1JZ2A 4W6XA 3LSDA 4IETA 3MYXA 4QX2A 3G7DA 1PO22 1R1A3 4NIIA 1LNSA 1L7QA 2C24A 5JOWA 2EAKA 4GALA 5A3WA 3O1MA 1NLRA 1DQ5A 2IVJA 4Y1XA 5I8YA 5KC5A 3ATGA 4R8HA 5FYCA 5JMOA 1RITA 4M0NA 4Q4X2 4QGNA 1GZWA 1MPXA 3AM2A 4FFGA 2ZEZA 4NR1A 1QJY3 2AACA 3CJXA 5A6YA 2XL9A 5BXXA 4MXVA 4OUEA 4QX1A 1PX3A 2R6QA 5FP8A 4P9XA 1MEC3 4A7ZA 2VQ0A 4LUMA 3HNYM 3HT1A 1O5UA 2VH9A 3ZKUA 1OC1A 2D44A 2NMNA 2Q8EA 1TE1B 2RE9A 3VDCA 2ARXA 3N36A 5K0UB 4NHXA 1HRV1 1AX2A 2QQKA 2FDJA 2R49A 2WINB 3EMRA 4LHNA 4Z1VA 1VRH1 1JZ4A 4AZZA 4CUAA 1PO13 1LHVA 4YRDA 1A8MA 4N90A 4D7TA 2UURA 1D4M3 3O14A 3H8XA 2OPKA 3VKLA 1DGRA 1LULA 5JI9A 4XQDA 4P9YA 1NE6A 5SV5A 2WKKA 1R092 2EAAA 2PYTA 2HEWF 3LDRA 4BJ0A 2XLAA 4I0BA 3DPRA 2NZ9A 4N9IA 2G19A 1Z78A 5AVPA 1CD3G 1HIXA 2VY0A 3KD4A 3K4ZA 2EXJA 2HLEA 2VECA 2ENRA 2G9ZA 1LOFC 2CTVA 3NV3A 1CVNA 1YNAA 3JQWA 1DF0A 2WNVB 1DQ2A 4DO0A 1RIRA 4CU7A 3HN1A 3JD71 5EJ3A 5KHGA 1KS5A 3ALQA 3E6CC 2WA3A 1O8PA 1Q8QA 3NNFA 4J1WA 1V6OA 2EALA 5I0RA 1U5ZA 1RUNA 3M3CA 4XXAA 1W2TA 3DUIA 1R081 4HG6B 1X36A 1POV3 3I54A 3I8TA 2VW1A 4META 4XTMA 4XDQA 1BVVA 5CFDB 2VL4A 4IV1A 1J83A 3UJOA 3RYPA 1AR73 2WS92 2EIGA 2Y60A 5FJHA 3T4VA 5A3NA 1UZVA 4IE5A 4XF4A 4FQ4A 3AL6A 3BYWA 3VZJA 4Q0PA 1AYN2 1NLQA 2E63A 1ZZ7A 2ET7A 3EYPA 2X5IA 1OPMA 3OD4A 4E4HA 2GU9A 1FNYA 4YZ2A 4LBOA 1UO9A 2HEVF 3TRSB 4FOWA 4Q4Y2 2ZBJA 3VL8A 4JKKA 3C7EA 1DZQA 1AX0A 1DZRA 1BK1A 2YXSA 4XUQA 1ZBA3 3WUCA 4JGYA 1OVPA 4WVMB 2OX0A 2DU1A 3JZVA 2XPJA 4CEWC 1ZZBA 5LEKA 4B8EA 2RDSA 5FPAA 1W8TA 2VNGA 2YROA 4XUPA 4QDQA 4YM1A 4CDXC 2WNOA 3O1VA 2WO3A 4B29A 2PAEA 2PHUA 4IEZA 2OZJA 1ND2A 5FZDA 2GP5A 4NPLA 4QX7A 4AI3A 4CDWA 3RRDA 4AQSA 4CUBA 3DECA 1GV9A 4P14A 5AC93 3H1YA 3OGVA 3ZYRA 2GH8A 1UN1A 3WDVA 3PVEA 4LULA 2ZGTA 2P4EA 3ILNA 2RG4A 4P9LA 2XVLA 1VRBA 3IN9A 4RS5C 2EA7A 3NJXA 2AH2A 4U2AA 3ZO0B 2FMYA 1ULEA 4Q29A 2JD9A 3A22A 4K21A 4BE3A 5C71A 1CX4A 4N9HA 3UK9A 1AR62 3WCSA 4AHZA 3DGTA 4V2VA 1KS4A 1MZ5A 4AHXA 2YDEA 2GALA 4HL0A 4M0HA 4MLOA 3ZXAC 1V9U1 1O4TA 4YW2A 4FTBA 2O14A 1MS0A 3TEWA 1WMXA 3P3PA 1HQNA 1YQ8A 3OPZA 5F3IA 1LEDA 2PLV3 5F2SA 1TNFA 2WAOA 1QF3A 3IB3A 1U0AA 1QDOA 1AF9A 3UL2A 3KQ4B 1G9CA 4HK9A 4AI9A 5JPMB 4Y22A 5C4WB 1JTZX 1PO21 5IHRA 5C9AB 1DYKA 2N7GA 1UYYA 1Q8VA 2NLRA 3KGZA 2BFUS 3PDQA 5C8CC 4TSVA 4Y5TA 1V70A 1G6NA 5BNPA 3WNKA 1O8SA 4AFCA 3KHCA 1DLLA 1ASJ2 1MS5A 4HK8A 4IE4A 5A70A 4UFIA 5HXMA 5GM0A 1W8HA 2ORZA 2IXHA 1JHJA 3SH4A 1XNDA 4L11A 1C8M2 5J96B 3CZJA 1RUH2 1OH4A 1XJAA 3WSOA 2EXHA 3B5LB 1QY4A 1IOAA 1O91A 2RJLA 3LDKA 2QJVA 1RMU3 2Y0OA 3AP7A 3LSEA 4COUA 2ZGLA 2VNRA 2ZX3A 3S5AA 3ZFGC 2CGPA 3JQXA 3GZEA 1SLTA 2ZACA 5IUQA 3OY8A 3WG1A 1GU3A 3U78A 1U5YA 1RUG2 4R4XA 4CP9A 1VBE3 1RUD1 2CAUA 3A21A 4JV4A 3VD3A 2RMU1 3MEPA 1IQDC 1R091 1UY3A 3HJRA 2VMGA 3KV5A 1ZA7A 4JGZC 4PDWC 4PIXA 4HSJA 3WQ7A 3BGAA 3MW4A 1RVF1 1IS4A 1EY2A 1OFNA 2YPDA 4FPOB 1EUUA 3LCPA 3SISA 5EHDA 3FE5A 1PMIA 3AKQA 1O3TA 5FY5A 2ZX1A 2JG8B 2UYAA 3OGJA 5CIRA 1OBNA 4NIHA 2D6NA 2BUKA 1WGPA 3HBKA 5DDJ3 4B3NA 1TMF3 4YW5A 2CU5A 4BU2A 4CDQC 2ARCA 5FYUA 2BVVA 2VO5A 4IESA 2O8QA 5FYSA 2E26A 2VMFA 4QPGC 2W3JA 1LGCA 5FZ4A 1O3RA 1HXS2 1GQPA 2NYYA 4C1WA 1VBD2 1RUJ3 4XJWA 1J3PA 1YRZA 1H8TC 2R061 4WM7B 3WW3A 4Z82A 2BBAA 3C3VA 1QGLA 3INAA 1PMHX 1DCSA 2XG3A 1PK6C 4LA2A 4ORFA 2R1BA 1AL0G 1COV3 4I30A 5K4LA 3GF6A 4OI2A 2UU8A 4LXLA 3BPZA 4IGOA 1RYYA 4MGSA 1PM4A 4QWNA 1JOBA 3ZIWA 2IVIB 5ANQA 4A41A 4Q4V2 1DP0A 4LTAA 2O8OA 2WL1A 5K0UA 1C1LA 1AYN1 4IDZA 1NXD1 4CTEA 4Q1PA 2Y6GA 5DZEA 2XBO3 5T50A 3B93A 4RHV2 2IZWA 5A7OA 3M2MA 2XJTA 2E31A 3SH3A 5IK5A 1FV2A 1GLHA 1V9U3 2J1EA 1GQGA 1VBA2 2VD7A 2YUEA 3AK0A 4GH4B 4GIQA 2XJPA 4QHOA 1ENSA 3S7IA 3S0MA 4AFAA 4AK3A 3WEZA 4IEQA 4S2HA 5T5LA 3U37A 1W6NB 5LRSA 5CAZA 2G1MA 5DUVA 1YFWA 2IWGB 1TEIA 2VMHA 3AKTA 4XPVA 1IS6A 4IERA 4GULA 5E16A 4DUXA 2D6KA 2MPFA 5I0DA 2WNVA 3POBA 4JDMA 3OBZA 3ZMNA 1ZM1A 3DYPA 3NJVA 5KWRA 2WO1A 4BQ3A 1QJU2 5ABJB 1FNZA 1CJDA 1TG7A 4JTNA 3TEYA 1R1ZA 3OTFA 1WD4A 1RUF2 4DOUA 4AQ2A 1ODMA 5KHIA 3UGFA 5CNAA 3AJZA 4DB5A 4D6RA 5GLVA 4XEZA 1VB4A 4Q4X3 4QKNA 5CFDA 1I5PA 5GLZA 2F17A 2VC9A 4AGVA 5H9RA 1WW7A 5FO7B 1YO8A 2XVGA 1ZX5A 4FPCA 4RD7A 3JCIA 1AR61 1PX4A 3SKVA 3ST7A 4JDOA 2HWC2 1UOBA 1KFUL 4AGGA 4OHWA 3TB0A 2WWUA 1OUXA 4XOGA 2ZGSA 2CDPA 1JYWA 4ATFA 1Q56A 3AXEA 3CBNA 4AEDC 1FMD2 2QQPA 1ULPA 4DUVA 4RFRB 1XE0A 5IFPA 4BQXA 1QKQA 2JE9A 1JU3A 1W0OA 1QIQA 4WVMA 2JXAA 3HNBM 2VU9A 3K46A 3H8OA 2JD4A 3WF1A 3LWCA 1JH5A 1V6KA 4OLLA 1IG3A 2J1VA 2WNUB 4QPWA 4IEOA 1ZRIA 4KBZA 1FXZA 4ZKTB 1VIWB 3U14A 2CWSA 3P1IA 5A3PA 1ASJ1 4YG3A 1LGNA 4A7YA 3AP4A 5I8TA 4YW3A 1H4HA 4E2GA 2XDVA 3IPVB 4FI9A 5JOYA 3VKOA 4XBLA 3J7MA 2D6PA 1JUIA 5CG9A 1I3HA 3AYCA 1CJPA 2IXCA 4XFFA 1NA1B 1ODNA 1X50A 1C5HA 3PUHA 4M3CE 4ZZ5A 2AREA 4JDNA 5EP9A 1HKDA 1SQ4A 5FP3A 3ZYPA 1WMEA 2ZKNA 1WA4A 4GKXA 1KGYA 3CU7A 1B35B 2VOWA 5FYIA 2JWPA 3AZXA 3MUY1 5JR7B 5CKNA 2WS93 3WF2A 4CXXA 2KR2A 3DPRC 1RUG1 2DCKA 3RZJA 1OOPB 3CO2A 4IV3C 3SH5A 4LBJA 3APBA 3E1F1 3MHZA 1SBEA 4CA9A 1AYN3 2GAUA 4GXLA 1YFUA 4EN7B 4AQ6A 2VW0A 5C8WA 1MEC2 2VG9A 5GZCA 2DF7A 2EF6A 2RS51 2VCBA 4FPHA 4Q4Y3 3KF5A 4Q0UA 5FY1A 5I0UA 4DUWA 1RJ8A 3GZTB 4KH9A 4XQ4A 1ZYBA 3THPA 1NCQB 1OLME 2G9FA 2QDNA 5C4WA 1JHNA 5C9AA 5H9SA 3PUAA 3QACA 4FPEA 1O4ZA 1YIFA 2MEV1 4S2GA 3ACLA 2YFUA 1BHGA 5J7MA 4WVWA 4JC1A 4KWUA 3ZYGA 4LBNA 2BJSA 5JI7A 2RM22 1VAKA 3HVDA 1FOD3 1JN2P 2W92A 3BALA 4OVEA 4YW4A 5FY4A 3WNMA 2DCYA 3H1WA 3H3ZA 3H42B 1NYWA 1S0CA 3M7AA 4LKFA 5FK7A 1OA2A 2PHFA 2Q30A 2W91A 3NL1A 3SC7X 3VBFC 4GJYA 2YG0A 3ZOIA 5JSOA 1IGOA 1BZWA 1RINA 2PTMA 1D4VB 2X5IC 1OLQA 3LA7A 4P5YA 3ZYIB 2FZ2A 3DCQA 4HKLA 4YG6A 4PQ9A 1J3QA 1GYKA 4NRMA 1GMMA 3C8XA 5DAVA 1N3QA 2WNEA 4ITCA 5F2WA 2VAUA 4I09A 1BEV1 4CU6A 1AXZA 3PUIA 1AR63 4RHV1 1D0GA 3B7MA 3RZMA 4PHZA 2V4AA 3BOWA 2H6BA 3NAPB 1XNAA 1AR91 2BTVC 1YQ6A 3ZXEA 1H2MA 4HBNA 1VBA1 5L9RA 1GNYA 2J1RA 1PZ8A 2MNGA 2RDQA 4FVVA 1NY71 1BCXA 1U5XA 2HWE3 4HZFA 1LENA 2JG8A 1HW5A 4ZU4A 5F7UA 2RJ2A 1OSGA 4IGQA 4DRRA 3UETA 4Z92B 4LOTA 3ZDVA 1O5LA 3O12A 4PI0A 1JZ5A 2X05A 4E2SA 3I2FA 3AMPA 1CZTA 3ECQA 4N53B 1D7PM 4Y1YA 4Y3OA 3A7QA 5FY7A 5JOZA 1QJU1 4WV8A 2Y64A 1BBT2 1RUF1 4I2OA 2Z69A 3B69A 3MIFA 1HQLA 4XIKA 3AFKA 4GMP3 5FXVA 4WM7A 1OA3A 4F8AA 2WO7A 3M8LA 4BISA 3VBRC 5BPXA 5GKAC 3VZOA 1SFYA 4LBMA 5BNOC 2HKXA 1C8M3 4PI2A 3R6SA 3ZN6B 2ZXQA 5C70A 4AAPA 2RHPA 3ES1A 1RUH3 1IPKA 2D40A 4RGGA 2X8KA 1VBB1 2P2KA 2WFF2 2WFPA 5DAXA 2VGDA 2HWB2 2A5ZA 2YYOA 3F2ZA 4GD4A 4E4SA 2P6CA 2Q8OA 4P00B 1YJKA 3O1UA 5FKBA 5FXXA 1IQAA 4ZY9A 4NN0A 2BGOA 4QMAA 4UW3A 2QKDA 2CNAA 2KXLA 2WT0A 2R1DA 5FPZA 4BCUA 4OULA 4QU1A 4P9GA 5CEHA 4HVRA 4UBGA 3MZHA 1BYHA 4JHZA 4AVBA 1OF4A 2BQPA 2F4LA 3GCWA 2GN7A 3LIGA 4GH4A 2ORXA 2RR12 4J6GA 5F5QA 2FMDA 5F32A 2W1WA 2ZHNA 4DXSA 5BNPC 1JZ3A 4ES8A 2ZS6B 4QD2A 3EBRA 5HCBA 2A3YA 2J1AA 1CIWA 5FYHA 3NNGA 1W6NA 1V0AA 4FOVA 3ZSKA 4MYEA 4UWDA 3S57A 4MADA 5CZKA 4EN8B 2TEPA 2XJSA 3O5SA 4MG2A 1F31A 2ZZQA 3PTRB 2ZAAA 4ZXKA 1AYM2 1K3IA 1MQTB 5ABJA 1MS9A 3POYA 2YU2A 2XQXA 4NMIA 1MVEA 1XB9A 1GBGA 2EIDA 4P9WA 1HXS3 1URXA 3PVOA 1AX1A 1VBD3 4K1YA 5DXDA 2A1XA 4AGRA 4CCOA 2XQRA 1OKOA 1R1A1 3IKWA 3OB8A 1S0JA 5GZFA 4QKDA 2Z5WA 3OBAA 5HPOA 2Y6JA 4LO8A 5GALA 3ZYJB 5JWPA 2WZR3 3DKQA 5EJZB 2GC0A 3AZYA 1W06A 5FTTC 1REEA 3PIJA 5IATA 2OT7A 5B2GB 4X6RB 2BNNA 5AVAA 4Q4V3 1PVC2 3NKTA 4CDWB 4M4PA 1N1SA 4H7MA 3WHTA 4AEMA 1QJY1 1WLWA 5FZFA 1MS8A 3IDEA 4Y4RA 5J1XA 1MEC1 2CYFA 4XXPA 4COZA 5IT6A 2IC1A 1A8DA 4MO3M 4NAMA 2VCMA 4TYSA 4C90A 1XNKA 2FZ1A 2IUWA 1BQPA 4QXCA 1JODA 3LPGA 5FZ1A 3QD6A 4TLGA 4ARYA 3AB0A 1UX6A 3ILFA 2H0BA 3ES4A 2WNUA 4BWOA 1ENRA 2ZGOA 4QQPA 1PO11 1UOJA 1NT0A 1X9PA 1ZZCA 2D3PA 2LW8A 1D4M1 3I3DA 5LA9A 1ENXA 3N7MA 2ES3A 1NCRB 2DWRA 1PIV2 3N7LA 3D0SA 1LOGA 2XXZA 4D7SA 1LRHA 3IPVA 4IE6A 3RZGA 2XHKA 5E89A 3RVHA 1O3QA 1J59A 5BNNB 2ZGRA 5KHHA 5LA0A 1N47A 2C9AA 1NA1A 2XOMA 3VB9A 1XSRA 5K0UC 3TEXA 4QX0A 1DGWA 5FK8A 3VKNA 1H1AA 1YLLA 1SDDB 3AYAA 4JRLA 3VN4A 5FPVA 2P37A 2WR9A 1QXRA 1B35A 3CF6E 2CHHA 4L99A 2W08A 1ZZ9A 2JEMA 4H3WA 3HT2A 5DDJ2 1UZWA 3T2TA 1HX6A 1XNTA 4MGIE 1U12A 3B00A 4Q8LA 1Z7S3 2NPIA 3ABZA 1OURA 1OOPA 2VXRA 3ROUA 1UF2C 3GALA 2HEYF 1UY4A 3RZZA 2HWC3 1J84A 1D0HA 1VBC2 1Y9MA 1POV1 2JDNA 4XCBA 4CVUA 1PGL2 4GJZA 1ALYA 2Q8CA 4LIVA 4YGDA 1FMD3 2XKOA 2C9KA 2WNVC 1AR71 3FFZA 2X10A 5FLJA 1L7RA 1UZZA 1K12A 1NCQA 2VTXA 3BKZA 1RUOA 3Q8FA 2WT2A 5D2AA 4EN9B 3AP5A 1QJEA 3ZKYA 4DMIA 2I07B 3O7OA 3OGSA 5D8AC 1S0FA 5CFDC 3RZKA 2OZ6A 3C2UA 2WSUA 3ZSMA 4ASLA 2QQWA 4O61A 4O65A 3GGLA 2RDRA 3VZNA 3I2KA 1ZBA1 4K3UA 2QUOA 4JHTA 2JJ6A 3OUIA 2XMLA 5EFUA 4LK7A 2WJSA 1XE7A 4NHYA 5AFEA 5LBEA 1W6PB 4XW3A 5FMCA 4Y4YA 2D6MA 2ZGPA 5FZ7A 3T2OA 2Q1FA 4LOSA 4HLTA 2XJVA 1HB4A 2QBXA 3MLJA 3NKGA 4EE2A 3A0NA 1SBDA 5AC91 3K51A 1HB1A 3S7EA 4BK5A 4MGZE 5JUVA 1EP0A 2ARBA 4XDOA 2OS2A 2ZGNA 4PF5A 3T0DA 4UI9L 3NAPA 2CSGA 4AG4A 4XCAA 2FDKA 4CZSA 4CU9A 4BQWA 1BVP1 4BH9A 2Y6KA 1C8NA 4YW6A 3FFQA 1OHFA 4XAAA 4RFT0 4OUMA 4Q4W2 2A6XA 2BOIA 4W4ZA 1MS3A 3USUB 2A75A 4YZ1A 3RNSA 4P9JA 4QAWA 2JKXA 3ZYHA 3R05A 3OD0A 3VBHB 2WWJA 3VD4A 3SEPA 2PHXA 1UD1A 3LDBA 4DEVA 2TNFA 4FTSA 3QCWA 4Q0VA 1D2SA 1SFNA 3P5BA 4N53A 3MGUA 4NROA 5FP4A 1HJFA 3VBSA 1CX1A 1ZNPA 1H1MA 1E5SA 1QH7A 2P3JA 3GHMA 4KMQA 5DUUA 4AVTA 4YM3A 1KDKA 3D4KA 2PLV1 5C3OA 3J7NA 4ZONA 2KM2A 2YB7A 2RM23 2E53A 2PHTA 2D93A 2GZWA 2Z79A 5FZLA 4UXAA 4YG0A 1SLLA 3FJSA 1MZFA 3POSA 4H7LA 4M3CF 3NJZA 1QHDA 4OMCA 1HN1A 1W6OB 2UWAA 2VOXA 3FHAA 2O1QA 3LEIA 4LKDA 3ZN6A 4EWDA 4XJ9A 4LEJA 3SCHA 3BI3A 4MUVA 2I74A 4JTOA 1V00A 5A7SA 1LCLA 2BZDA 4LHLA 1HV0A 1V6MA 1S0BA 2CGOA 5FIXA 3UESA 2BEOA 1JOJA 1BXHA 2R042 3ELNA 3GZUC 5FYVA 5FY0A 2D97A 3K4DA 4WVZA 3RYKA 4QB6A 1UQXA 2RS32 5C4WC 5A3MA 4EV0A 4IEUA 5C9AC 3ZFFB 3ETQA 3H9AA 2VNVA 4YWAA 4M3CB 5FZCA 4JKLA 4HVQA 1UPSA 3PMSA 2CAVA 1RMU1 1E5HA 2GMEA 4IE7A 2YU1A 1PNFA 5FFOC 5IVVA 2RS12 5A80A 1H1IA 1QEXA 3B02A 2XWJB 3HMYA 5L19A 4W50A 3POWA 3IZOA 1TME2 3GBFA 3VD5A 3VKMA 3D6EA 3BIWE 4NAOA 4MZUA 1J3RA 1PNGA 1VBE1 3AMNA 3M4FA 3WF4A 1JZ6A 1MQTA 1NQDA 1MS1A 5FBZA 4YARA 4H2AA 2JKBA 4R9DA 5CU1A 1V6NA 1WMFA 2VZRA 4YM2A 3GHNA 4DIQA 2VQUA 3M3QA 3HEIA 3SXWA 4QHBA 1HRI2 2WDBA 1BBT3 1GOHA 1DU3D 2R16A 4YZ4A 4X8NA 1X8EA 1QOOA 1J1TA 1PGSA 2X29A 1EV12 1XYPA 1DGWX 2Q1MA 5KXEA 2K46A 1CIYA 2YY1A 4COWA 5C3RA 4RGKA 2PA7A 2GNTA 3MF6A 5DDJ1 3B9IA 4OQ8A 1TMF1 1E5RA 4RQPB 2J7MA 1GNHA 1W90A 2WFF3 1ZZ8A 1FOD2 3N35A 2I2SA 4YW1A 2HWB3 2OW4A 5JVVA 3TNPB 4FBFA 3VBUC 1RUJ1 4OFGA 3IAQA 1LGBA 2A3XA 3FBMA 3HOBA 1PGL1 5JCTA 2JG8C 2EIBA 3AZZA 4Y1ZA 3PUQA 4XHXA 2FCUA 3K4AA 1COV1 3LOIA 3THCA 1OA4A 3U10A 4PBPA 3VZLA 1ZRRA 4XUOA 3WDWA 1UIKA 1H9PA 2Z4FA 2B5HA 2RR13 3EQEA 2QQVA 3MO4A 3Q9OA 1S0DA 1ST8A 4CCEA 3J7LA 3RYRA 4Z2WA 4WM7C 5FOBB 5FZGA 3CIHA 2VUCA 4YVWB 1GOGA 2RV9A 4W6WA 3TAYA 1YQCA 1NCRA 2XBO1 1KQRA 5FBJA 5E88A 2BNMA 4QX3A 1W2OA 2X53S 5BNNA 3D3AA 3UYJA 5HV4A 2HWD2 4OQ9A 1AYM3 5GZGA 5J37A 3KT7A 3M3EA 3U75A 4QXKA 1K42A 4JX0A 3A4UA 2HWE2 2AEZA 4LA3A 3WP4A 1RUC3 3IT8A 4GZ9A 4QQOA 4XAEA 3J4UH 1GZ9A 5F5CA 4YNIA 1H6XA 5DAWA 2TBVA 3N3HA 4IGPA 1NZIA 3MIDA 5FYBA 2Y34A 5C3PA 4HMZA 5DZFA 1HLCA 4RSUA 4NPRA 1FT9A 2A7AA 2AC1A 3CHXA 2W94A 1OUSA 5DPNA 1H4GA 1AL22 2A71A 1K5MC 1FI2A 4L97A 3SHRA 2DTWA 1V6LA 4XE9A 2YV8A 2BFUL 2WQ8A 3NRUA 4Q4X1 4N7IA 1PVC3 1A34A 1PMJX 5J09A 2A3WA 3GDBA 4CCDA 5FYZA 1AVBA 4AYUA 5LBCA 3ASIA 1UNBA 2ZGMA 1C57A 1CESA 1CR7A 1NQJA 2FHRA 3N4MA 3HPNA 2DYCA 2YFZA 3TN93 1WCUA 4L9BA 1AR83 1F2NA 3KF3A 3S6PA 3LZZA 2IXKA 2ZEYA 4PIZA 2BWCA 4K8RB 4GB32 1OI6A 4Y1UA 1CN1A 3LEMA 1DBNA 1SEFA 1POV0 3WQ0A 2ZX4A 2HYXA 5JOXA 3IDBB 4N43B 4P5HA 1JI6A 1F4AA 1GQHA 4CU8A 1PIV3 4QXBA 1YIPA 2VZVA 2WYFA 3IBMA 3UGHA 1W03A 2D6OX 1ONAA 3ZIXA 3IDAA 3H3UA 4I0AA 3OOXA 4IEPA 4AFMA 2ETEA 4QXHA 3BOPA 3LFMA 1YC61 5HBAA 1I9RA 1W6PA 4MV2A 4AVAA 4K7JA 5IW0A 1FYUA 2EXKA 1W28A 1NAEA 2FBEA 1PZ9A 3CLPA 1QJZA 4CDUB 1A6CA 3PTYA 4W6YA 4D6QA 4YGBA 3AX4A 3MIHA 4QM8A 2BYVE 1O59A 4DNYA 3AMHA 1QQP2 3LKJA 4NWWA 4K8FA 1QNWA 5A1LA 4CDXB 2H0VA 4LQRA 3LIHA 1VBC3 4XJUA 1WLTA 5L7OB 4FSJA 4KWKA 1XC6A 3K48A 4LPLA 2RS11 1UYPA 2O0OA 3GNEA 3RJ2X 4JRAA 3USUA 2ILMA 5FPBA 1N1YA 3CJIC 2VMCA 3NW4A 4XUNA 1WD3A 1X33A 2WZR2 2WS91 3BPSA 3DEMA 3Q8CA 3VBHA 4XBNA 3GJAA 5CFCB 2WABA 1NA1C 4BLIA 4YZ5A 3D5OA 2QQNA 2PN5A 1W9YA 4XJAA 2DVBA 1JOPA 1L3JA 4YGEA 2PQQA 4XQWA 4RS5B 3WP5A 1OPOA 3JBG3 5EPAA 2VVFA 3FN9A 3BTYA 2Q4SA 3RJRA 1B35C 1JXNA 1FPN2 4Q4Y1 4OZOA 5J36A 3AFGA 2ZHLA 4IW3A 4XFBA 3UGGA 1W6QB 4QKBA 5A7PA 1W6OA 3W59A 2PHRA 1QXPA 5FZHA 5JXJA 1UYZA 2VZUA 4HPKB 3KLSA 3OGRA 1PHMA 1VLNA 4MGTA 1W2AX 2AGSA 4OI0A 2R32A 3OUHA 1FOD1 4HSLA 1OFSA 3VBOC 4TZDA 3I2OA 3RI9A 3THDA 4INDA 2ZKLA 5T52A 1NCQC 1HJGA 1POQA 2VTXJ 3PHMA 1HDKA 3C7HA 4LE4A 4RN5A 1RL3A 3LB9A 1DQ4A 3ZFFA 4BQ4A 4M3CA 2BGCA 2QQUA 1Y43B 1H2LA 1Y4WA 5C8CB 4URTA 2VULA 4DXRA 1V6JA 4FQZA 2DTYA 3E6BA 3RFRA 1P8JA 3VZKA 3E6DA 2DUPA 3N9OA 5FYMA 1XXNA 4D3WA 5LY1A 2DVAA 2K9ZA 3I49A 2PAKA 2R0FA 4Q4W3 4N8MA 1Z7S2 4QGMA 3GM8A 1F35A 2GMMA 4BIOA 3MUZ1 4Q26A 4MVTA 2NQYA 5A7WB 4AE2A 4XZUG 2C4XA 2VMDA 4NO4A 5CKQA 4Z07A 2BRTA 3MV01 4Q8KA 3FZ3A 3NWKA 3HWJA 4LO7A 4BXSV 4K1ZA 3TYJA 1RUI2 2Q1ZB 3OG2A 5GZDA 1JZ7A 3V0BB 4R52A 1HB2A 2QQJA 1SLIA 3T1LA 5JSPA 3NV2A 1JYVA 2HWE1 3WR0A 1OLMA 5DUXA 2DVFA 1XPWA 1OVSA 4X8PA 5F3EA 4EQVA 5JPNB 3LE0A 1GFF2 2JICA 4NHMA 4AI8A 2E7AA 1WUVA 2EICA 3NAPC 1S55A 2RDNA 4RQPA 2XWBB 1DQ6A 3FHQA 5FZEA 4JGZB 1QH6A 4PDWB 1UXXX 1QXJA 2WBKA 1G9DA 4XYXA 2J1SA 4GMP1 2R043 4QDRA 3DYOA 4CEYB 3ITQA 3H7YA 4YVSB 3I3QA 2GC1A 3AKRA 4GWJA 4PIYA 3JB4C 5ISLA 2B46X 1X82A 1C8M1 2RS33 5JXGA 3T08A 4ASKA 2ZMNA 3OPTA 4N53C 1RUH1 4CCKA 4Y5SA 1W9SA 4OHXA 4CDQB 4Q0SA 3WX5A 5FOJB 2R7EB 1C28A 2ZGUA 2W95A 5IAVA 1UKRA 4UFLA 1DHKB 4C8DA 5JLVA 1OF3A 2RS13 4PF1A 4YVWA 3ZVXA 1H8TB 4B1MA 1TME3 3KCCA 2Z42A 4CP0A 3VDAA 3O1RA 3BUCA 4UFHA 2WZPP 3SKJE 1S0GA 3AMQA 2HWF2 2A70A 5A1FA 3O0WA 5IAXA 1ZREA 2PAMA 3PIGA 4Y24A 2VZSA 2FCTA 5FJKA 5A32B 2R072 3NJYA 3WW4A 4XMAA 2JENA 1HRI3 3H0OA 5FYYA 1SFPA 3SQOA 2ZAHA 4QKFA 4ET7A 3MBWA 4NRQA 3DL3A 2WYSA 3B9CA 1EV13 1NKGA 2DBNA 3IMMA 3PURA 4MGKE 4DS0A 1ND3B 1W39A 5FV3A 5FYTA 4FAHA 5A3LA 1N1VA 1EAH3 1RHI2 2E9QA 2XL7A 5FO9B 1YHFA 4XJ8A 2JDUA 5K7PA 3BB6A 5ACA3 2R30A 1UOGA 4HETA 1QQP1 2GC2A 5KBFA 3BU0A 3VD9A 1RXGA 2SBAA 4K9SA 4IV1C 4IEYA 1HXS1 1MZ6A 3WP3A 1VBD1 4OHZA 3V56A 2W9XA 2VQTA 4O7XA 3URFA 5I0SA 5T54A 4QQ2A 3EO6A 1K45A 4ASMB 2VM9A 1MQTC 1QOTA 2WZR1 2OUHA 3ACHA 4PQQA 3V64A 4A4AA 5T5OA 3MI8A 3PJQA 2OQ6A 4Q4V1 3PVNA 3U1XA 3K2OA 4KGGA 1F9KA 3I2HA 3I3EA 1GR3A 3OBRA 2WAAA 3JUUA 3S5QA 4Y20B 4N43A 4XDPA 2PFWA 5T5JA 4JGYC 3WG2A 1MS4A 2YC2A 1QJX2 3FLPA 1FPN1 3MDPA 3S30A 4A3ZA 4D0QA 3WLUA 4YGCA 2IFRA 2C26A 2ZABA 5F6KA 4HANA 1S2KA 1NOVA 2HWD3 3ZYBA 4V2WA 4OI4A 1ND2C 3NV4A 1SCRA 1B09A 1VMHA 1TQ5A 4LE3A 5DABA 1JYXA 4CDWC 1IG0A 1UCXA 2Y26A 4G9SB 1VPHA 4WM8B 5JZGB 4EWAA 2WA4A 4AEDB 4D94A 2YMZA 1DDLA 4CDUA 1MZEA 2W1UA 1ZBE2 5SV8A 2P3KA 1QU0A 1RGSA 1UY1A 3VLBB 3QOPA 1RXFA 3VBSB 3WG4A 2D43A 4RA0A 1AL23 3HQXA 4CDXA 4CCMA 1GZCA 5FAXA 3MFAA 2B4KA 1ULFA 1UPIA 5L7OA 1G9AA 1G8WA 1O7FA 4NWVA 4COYA 1UXZA 2FQPA 4DINB 5HCHA 3HNMA 3NO8A 5A6ZA 3T2QA 4E2QA 4YFZA 5LK7B 1SLBA 4DRVA 4JQRA 5BNNC 1Z7S1 4EN0A 1H9WA 3M3IA 3SMHA 3VKFC 5CFCA 1GP4A 1WW5A 3ACFA 4JZRA 4KWJA 4N7UA 3VDDB 5CISA 3PVBB 3GYDA 2E7QA 2HWC1 3I3MA 4XETA 4GB33 1DFQA 1UZ0A 1OD3A 4RS5A 4A6SA 2HJIA 4A7KA 4E8DA 2YC4A 1FMD1 1OLRA 1W05A 2B7YA 3PU3A 2MHFA 2ZGQA 1OKQA 1W6QA 5FMOS 2FDFA 3DN7A 5T5PA 1EPZA 1S2EA 4EZ4A 1ZRFA 4OMDA 3RS6A 5I93A 2XUMA 2QDRA 4HPKA 3WF3A 3BTZA 4IE0A 2XLFA 4IV3B 2OUJA 3D82A 5DG2A 3T3YA 2WN3A 2GC3A 1ENQA 3WT3A 5APAA 4Q2FA 2H6CA 4BIFA 4ZPIA 1UKGA 4LK6A 1QNYA 4P02B 4LHSA 1JYCA 5CKMA 3RDIA 5FZOB 2XONA 2VZ1A 4H55A 2OA2A 4KG8A 4SLIA 1CAUB 4B4QA 4WBBA 3KWVA 1QQP3 3DKWA 5C8CA 4QQLA 5M0TA 1RUC2 4BXFA 4E9KA 2ATFA 5FQ0B 4JKMA 4Y33A 5FZ0A 2V72A 1SBFA 1E57A 1W0PA 1LODA 3IDCB 4XTPA 4FXKB 1U5IA 3L9JT 1AJKA 1SACA 3OBTA 3C7OA 5A3TA 3EB7A 4XFAA 1WMDA 4HT1T 2IXLA 5BUVA 1LB2A 3QLQA 5A7WA 3USSA 4OYUA 3CNAA 3WNLA 1M06G 3KV4A 1NE4A 1UYXA 1HRV2 2W5FA 3LA3A 4MGYE 3VBFB 3WP6A 3I2IA 3AYEA 4WVVA 2VZTA 3V0BA 4YPJA 1F8VA 2GP3A 1Y9QA 2A6ZA 2Y0IA 4L8QA 4WZFA 5FUPA 5L73A 5DMYA 3X29B 3D0JA 2Z2SB 3KCXA 1FPN3 3TN92 1L7LA 1LR5A 2EVXA 3NMBA 4EYUA 1AR82 3SLIA 3PUSA 4A3XA 1CAVB 2W1QA 1CONA 2AR6A 2WIIB 4AFBA 4AWDA 2XJUA 3AVSA 2QQOA 4QPIB 4JGZA 1KD7A 4PDWA 1G86A 1UIJA 1QMJA 2ZMLA 4XVHA 3OEAA 3OUJA 2ZHMA 4URAA 1H0BA 5DQ0A 3LD8A 2RM21 4TLFA 1OMIA 1OQEA 1X9TA 2UWCA 3HAGA 5C5TA 4CEYA 2DCTA 4YVSA 1H2NA 5L9BA 3GBGA 1ULDA 2JDAA 3JD72 4KQ7A 1LHNA 1I5ZA 4ISRA 1R082 2V09A 4KG0A 4QPYA 2NN8A 2AZ5A 4CDQA 5T3NA 3I59B 5GLTA 3ZPYA 3GZAA 1W8WA 3ZLIA 3FUOA 2BERA 3RPQA 4LKEA 5BY5A 4AI0A 1OH3A 4I01A 1H8TA 4GMP0 4KBBA 5C6CA 1YXWA 3UNPA 2AYHA 4GWIA 3MPBA 3VBRB 1WCKA 4IEXA 2VW2A 5BNOB 4UF0B 5K8SA 2GNMA 1JU4A 3I4IA 4UFJA 5D21A 2OYZA 1BMV2 3WDYA 5A32A 2DU0A 1W3VA 1RUI3 2FDIA 5FZBA 3WDTA 5LW9A 3THTA 1V6IA 3NQHA 2YGMA 2QQMA 3W20A 5LBBA 5C3SA 3TEZA 4DQAA 4I3GA 1ND3A 1DQ0A 2BP6A 2CGNA 4G3YC 1WZXA 5JMCA 2BU9A 3CZUA 1XSQA 3ZYFA 4DXTA 3KGLA 5FZMA 3R4DB 1HB3A 4LIUA 1ULGA 1CAWB 3JBG2 5JAXA 3T30A 4SBVA 4FFHA 2W0XA 5F3GA 1DYOA 3VHRA 2VNOA 5F37A 1JYTA 1LHOA 2FCVA 1BBT1 4TTGA 5FZKA 3HN3A 2DFBA 5A33B 4EROA 5LZ6A 3UKNA 1YI9A 2BW8A 3MLKA 3MV11 1ZVFA 1CPNA 1RUE3 5CYYA 3ZXFA 1F5FA 2K0GA 3I3BA 3WNPA 4BQ2A 5FKCA 3U11A 4MX3A 4ZS2A 2WFF1 4K40A 2HWB1 2F4PA 2J42A 2XLGA 4MXWB 3V65A 4KU8A 1YCIA 2HH9A 5C5UA 4ZZ8A 5L36A 4AVCA 3KB5A 4Y20A 4AW7A 2DCZA 1AUYA 5LEJA 4UOJA 3EHKA 2AUYA 1APNA 3ETPA 3JB8A 3RWKX 5DAPA 3POIA 2VZOA 4M4RA 2P1BA 4RQPC 5HXVA 4HN0A 3VHOA 1DLCA 1XBFA 1CZSA 2Q0AA 3NVCA 4JCKA 3WDUA 2RR11 1Q8SA 2JG9B 2HWF3 3J7HA 3NNMA 4FPFA 4GWMA 4OCTA 4LITA 4ONUA 3V0AB 3CDZB 2R073 3M70A 1VP6A 1WLCA 3B3QE 3WNNA 2C5DA 3AP6A 4WM8A 4HKWA 4XF9A 5JZGA 4AEDA 1NX9A 3I97A 3R0RA 4FCAA 5GJ6A 2NP0A 1UU6A 4RR3B 3WXPA 1RHI3 4QQHA 1AYM1 2WZEA 2W1SA 3MW2A 4NRPA 3IAPA 3HQUA 3ZXJA 3JXSA 4JVAA 5JIAA 1H2KA 2ERFA 1XU1A 2EXIA 1I1EA 1RUC1 2W39A 4YVWC 2PHLA 1W9FA 3VHNA 4LO4B 3FL7A 1W0NA 1Y7BA 4ZU7A 4NHKA 4LR4A 1SDWA 1W2NA 4E4DX 5IJRA 4AVVA 4S2FA 5F8PA 4BB3A 4Z8BA 3VDDA 2V5DA 5F3CA 1F5JA 4HKOA 4PLOA 4XMIA 1HQWA 1KFXL 4IQPA 4UT5A 1TNRA 5LATA 5LY2A 1PVC1 4XIOA 4EN6B 2ZZJA 5KHJA 1IHMA 3OF1A 5IWFA 1AZDA 1RUD2 2JDZA 3E5UA 4U36A 3T1MA 2RMU2 1F4HA 1QJX3 3C7FA 3TN91 3T09A 3U07A 4A2UA 4CCNA 1G9BA 4XF1A 4FAGA 4MHUA 1AR81 1FAYA 1WCDJ 3ACGA 1RVF2 3KQRA 1W8FA 4IV3A 4YZ3A 1T2XA 4LBQB 5A3UA 4CRQA 3ORJA 5FLIA 1O6UA 3VDBA 3OJBA 1XQNA 4AR2A 1W9TA 1PIV1 2E6VA 1UY2A 3VV1A 1REFA 5FZOA 2B9VA 5I8SA 5C3QA 5KXCA 1UMIA 1ZBE3 4HONA 1CAUA 3JU9A 3KM5A 3I2DA 4QDSA 3SITA 3WV6A 2XVKA 4XBQA 3LOBA 4C0BA 2R062 1W8OA 5FQ0A 5D8AB 2ARAA 4N43C 5AFBA 3OEBA 4BQ1A 1EAH2 4OZXA 3AL5A 3ZFEB 3BTAA 4MH0E 4XHBA 3T0BA 3ZSEA 5ACA2 2E51A 2DUOA 4EZHA 5J3UA 1OXCA 1XYNA 4KWLA 4B1LA 3Q8EA 5FPXA 1CQ9A 2L9LA 4RYDA 5A7QA 4F83A 1VMFA 5BV6A 5KR7A 2UWBA 3GBWA 4FPKA 3VBFA 4PJYA 4R9AA 2BPA2 2BVBA 4YM0A 4AQTA 1VBC1 2IFWA 3O1PA 3AKSA 3L2YA 1BMV1 3QH7A 2VOKA 4KNCA 3AZWA 3WQ1A 4V1PA 3M1HA 2VQAA 3LF7A 1HN0A 4CDUC 3ZXDA 2P5BA 1W8NA 1JYNA 5IK8A 4KGQA 1JUHA 1LKNA 4UW5A 3VZMA 1CAVA 3UKTA 3IWZA 1CAXB 2ZEXA 3IIAA 5CBLA 4XILA 5E1RA 2G9GA 4QPIA 1YEWA 1BKZA 5B4XA 5FR3A 5L7OC 3JBG1 4NJ4A 3IM0A 1FV3A 1S1AA 4YFWA 5F5AA 3WF0A 1C4RA 4RGAA 2YGLA 1BK0A 2VR4A 3KT1A 4LKSA 3WD5A 4QGLA 3RSJA 3QBQA 2XB6C 2WUHA 3DV8A 3C7GA 1S0IA 5CFCC 5F39A 4AI1A 3DF0A 1PM7A 5J98B 2XHNA 4NVPA 1GP5A 3I59A 1D2QA 1K5JA 3MIBA 4XFGA 1OD5A 3G6JB 2WSVA 4PBOA 1QJFA 4A44A 3ILRA 5CA6A 5IFTA 2W87A 5DG1A 3VL9A 3RQ0A 1W2UA 4XABA 2LS6A 5E6HA 3WDXA 1KEXA 1UU4A 5GZEA 3VBRA 4D8MA 1FX5A 4Q5OA 3H3LA 1WWYA 4ZXEA 4GH4C 4CUGA 1SG3A 4AL9A 5BNOA 4NPMA 4UF0A 1S0EA 5EZWA 5FY8A 3AVRA 2GDFA 1GSLA 4CXYA 1X7NA 1A3KA 4L92A 1HRV3 2B9UA 1KRIA 3BU7A 4DFSA 1VRH3 5FUIA 4ARXA 1S4CA 3R4UA 1R64A 2V4VA 3CMGA 4Q4W1 5E8AA 2B8MA 5ABJC 4XACA 3LA2A 1KJRA 5FP7A 2X09A 4CCLA 4PLMA 4UW6A 5BNQA 1SLCA 1CAWA 1W9WA 2J22A 4XUTA 5F6LB 4CPBD 1Y9GA 2XGXA 4NUBA 2VBBA 1SHWB 3WINE 3O1TA 1VB2A 1YUDA 3OPWA 4TXWA 5A33A 1GICA 5T55A 2QQLA 2FDHA 1OT5A 1UAIA 4Z2AA 1PZ7A 2YPJA 3KVAA 2DFCA 2LALA 3JD73 2C1FA 2YBKA 4XFHA 5A7NA 4FT8A 5J48A 2OPWA 3OYWB 5CG8A 1N3PA 2DVDA 2E32A 2QVSB 3LGRA 4R4ZA 1DIWA 1GWLA 4UFMA 1R083 5G05L 1LAJA 1LOAA 5LB6A 4MXWA 3SCFA 2VUAA 1CPMA 5FO8B 2R041 4BOWA 2Y6HA 2TUNA 4KL1A 3HD8B 1XNCA 3B94A 4LBQD 1YWKA 1W6MA 1LEMA 2RS31 3LEGA 5LCWL 1WKYA 1MVQA 2F6BA 3N9QA 4KI5M 1ZA4A 5FZ6A 5GLUA 4A6OA 3PL0A 4CEWB 4CCJA 1UOFA 1T6BX 3BTXA 2HBTA 4X6QB 2JG9A 2WNUC 1EYBA 3J26N 3GJBA 5FMBA 3UKVA 5HI0A 3V0AA 2GN3A 1Q8OA 2JE7A 5LASA 5FUNA 4CP2A 5FRAA 2ADDA 2RS52 2VUDA 1KDMA 3GCXA 3VBUB 4CEYC 5LA2A 4YVSC 1TME1 3ME2A 4GAZA 1W8ZA 3HR9A 4C1XA 3ZN4A 2VZ3A 4RR3A 3WCRA 2MEV2 5FY9A 1VMJA 4E8CA 2DCJA 4DY5A 2XJRA 1CZVA 3HBZA 3M3OA 4LUKA 5LK5A 1UMHA 2ZTNA 1VE0A 2Y6LA 2WQ4A 1HRI1 3FX3A 5HV0A 1UZYA 2E33A 3VGIA 3ZMOA 1JW6A 2YBSA 2D7FA 5IVJA 1EV11 4KU7A 1ZRDA 3B01A 4CPBA 4HVOA 1EAH1 4YYOA 1OOPC 5LBFA 2XKPA 3H8RA 2LRPA 5ACA1 1NG0A 3DXTA 1T6GC 2ET1A 4I02A 3U4SA 5FZ8A 3AXDA 1UW8A 2YBPA 3PJYA 2WO2A 3UT0A 5L9VA 3MW3A 1UMZA 1GOFA 2Y6FA 1JZ8A 5F1RA 1SMVA 4NE9A 1BEV2 3POFA 5IVCA 1YI7A 4AVSA 3KMHA 1BLZA 4AOCA 2EIEA 4C91A 2P34A 1ND3C 2CL2A 4MOAA 1M4WA 2VCCA 1AR92 3LQCA 4ISQA 2KA3A 4B4RA 4L0PA 3BN6A 2VVEA 2AEYA 3FLRA 1K5MB 2P3YA 2VVDA 1NY72 1QDCA 4FPLA 3POJA 4LBQA 2BOJA 3NNJA 5C7GA 2PHWA 5JXIA 2VOTA 1OQ1A 1WBFA 1UL9A 2WZ8A 3HQRA 3WVJA 5FREA 1TZOA 4OI1A 4A45A 1PO23 1VALA 5CB7A 3KCYA 4BM8A 4FPGA 3K3OA 3OCPA 3MLLA 5GLWA 2WN2A 2ZCWA 1DYPA 2HWD1 3E5XA 2DVGA 3R4SA 1GZTA 3FUQA 3WHUA 5JIUA 1GKBA 3AKPA 1IZ3A 2A6YA 3BODA 3N9NA 4B7KA 3ZFGB 2B45X 3RWNA 4QT6A 5D8AA 1REDA 1S2BA 1US2A 1F15A 3RG0A 5FXWA 2J1TA 3ON7A 3WY6A 1LHWA 1N3OA 4GA9A 5FZ3A 2VJXA 2DBIA 3W21A 3ZFEA 2Y38A 1DGRN 1KXGA 2JIGA 1ULOA 2PMWB 1GWMA 3CEWA 5EWSA 3TBDA 1O4YA 3CL1A 3ZR5A 1Z0HA 4XZPA 4AHYA 1VBB2 3N9LA 4IXLA 3WQBA 1GWKA 4UBHA 4JQTA 1AL21 1C5IA 4FTEA 3RZHA 4LJHA 3P3NA 2QZ2A 1NXMA 2D3RA 1RJ7A 4WM8C 5JZGC 4W65A 1RUE2 2SLIA 5FZAA 4CCCA 1WCSA 3H8UA 2DUQA 4MSVA 4XFIA 3J8F2 4GQ7A 5IVEA 3WW2A 3U0ZA 3EJKA 4LLOA 4PLNA 2D5HA 1RUD3 1SPPB 2JB8A 2NMOA 4AF9A 5LWBA 1SZBA 5JXHA 2RMU3 5JR2A 4F3JA 1WLDA 1R093 3VBSC 3FLTA 4CXWA 2IXJA 1CAXA 5FDBA 1JS9A 3WUDA 3MF9A 1PGW2 3ZN5A 4BHPA 2LTNA 1RVF3 2P17A 1IPJA 3I2GA 4GB31 4QPGB 5FMDA 4ES9A 1NLSA 3WNOA 2CY6A 1I6XA 5FXZA 2C0ZA 2VCAA 3KZ4C 4I0WB 2CV6A 4B7EA 2BGPA 5F5IA 1PK6B 1EPWA 1GNZA 2ZOEB 2ZX2A 1WW4A 3AJYA 3KS7A 3CJIB 4LBKA 5CVRA 1NZCA 2OKXA 1Q8PA 5KHKA 2XR4A 4Q0QA 1SCSA 3VDDC 1CGPA 5TSWA 4CSWA 1LJ7A 1YYNA 1A78A 4XF0A 3ENRA 1VAVA 1AJOA 4AFDA 4LMFA 3K3NA 3NSTA 2R063 3SNMA 3ZR6A 1ZZ6A 3ZXLA 4AEJA 4COVA 2VMEA 1R1A2 4Q1RA 5IVBA 1G7YA 1LECA 1CWPA 1DG6A 4AI2A 2DDUA 3J9SA 1IKQA 4HFSA 1EUTA 4FOQA 5DUWA 1LESA 4AAXA 3E5QA 2Q5TA 4BZ4A 2ADEA 4PT6A 3FBYA 4QB1A 1VAMA 2D98A 2XUEA 4FFIA 3GXUA 1WW6A 5C33A 2DV9A 4FPJA 4BQ5A 2BV4A 2QQIA 2OVUA 1QJY2 2W46A 2VUJA 2XH6A 3KT4A 1LOFA 2WC2A 3O1OA 3PU8A 4QB2A 4BQYA 3PLQA 4BK4A 3VBOB 4IEWA 4TN7A 4BDVB 4ZU5A 2YHJA 4IEVA 4DPNA 5HCAA 2BDRA 3ZDSA 2QCSB 4UFKA 3ZSJA 2A73B 1UU5A 2HYKA 4Q27A 2QFEA 2W52A 3OGGA 1PO12 4LO5B 3BIEA 4HOOA 2KD7A 1D4M2 3WOGA 3K75B 3LPFA 1X8MA 1XYOA 4NIGA 4OHYA 5BYNA 2FDGA 1LU2A 4ZS3A 1BJQA 2C6SA 5FP9A 4OHVA 4FP3A 3U4XA 5A6XA 4YLZA 1J1LA 3AC0A 1OQDA 1IS3A 2JDKA 1YQ2A 2PELA 2VOVA 3KSCA 3OYWA 2IXIA 5FPLA 3A0KA 4NIAA 3VHPA 4S2DA 5IYYA 2WWSA 2W47A 2WQZC 3PMEA 4BPZA 3T0AA 2WLQA 5FPUA 1JBCA 5DZGA 2UYBA 2RVAA 4BMBA 2GNBA 1PVXA 4XF3A 2B39A 4IUGA 3VUOA 3NNLA 2VMIA 4CUCA 4ATEA 2B42B 2P6HA 1IKPA 2ZA9A 3POEA 5I91A 3BVCA 2ZMKA 4P08A 4CEWA 4QX8A 4QPIC 2E7TA 1WCQA 1GZWB 2VXJA 3F95A 4BYYA 1YQ5A 2QNKA 2VBPA 2ZPXA 3PNAA 1XRUA 1NCRC 5EJ1B 3AZVA 3K77A 3VBUA 3ZPOA 4EWEA 4C0HA 1C1FA 1AR72 4GWNA 3A23A 4M01A 3ZM8A 1N1TA 3DXUA 5EV7A 3DYMA 3WNXA 2WLPA 5FCCA 2ZEWA 2BNOA 2BBVA 2VZQA 2QE3A 5AC92 1HV1A 1JYIA 3I7DA 3KV6A 1WA6X 2JE8A 2NM1A 5LA1A 3WG3A 2W68A 4AEKA 1RUI1 2Y33A 4F7ZA 5IK4A 4LHKA 4PCRA 3RMYA 1ASJ3 1STMA 2WRAA 1DZTA 1H30A 4AXOA 2WT1A 4Y5Z0 3RMXA 1VR3A 1W99A 1ZBA2 2JIJA 1KITA 2RJKA 2JDPA 3DPRB 1Q5OA 3N9PA 4K6BA 3POGA 5FMOL 3RI8A 3KVBA 4I3PA 4R9CA 2QZ3A 4LORA 2A6VA 2I45A 1UWWA 1MACA 4LO6B 1H8VA 1RC6A 4O9EA 4Y1VA 4GKYA 1YFYA 2LM3A 1VJ2A 3EXUA 4E4ZA 4QHZA 4NOTA 5HCFA 3ZXKA 3T2PA 1RUE1 3MFCA 2UY9A 4HN1A 4FXGB 1UX7A 3RZLA 4JAAA 1ACCA 3J8F1 4LT5A 1RUG3 4QM9A 2QTWB 3N7JA 2GNDA 2ID4A 3FC0A 2ZHKA 5EYXA 3ZX7A 1K5MA 2VPVA 1RTVA 1PGW1 4M00A 3ZSLA 4XFCA 1O3SA 1H6YA 1LTEA 4IV1B 1QOSA 2HBUA 3AYDA 3FMGA 3WZ1A 2JB4A 2RS53 3N9MA 3KV9A 3Q8AA 2VTFA 2A6WA 4D7YA 5IK7A 3FWEA 1IPSA 1Q3EA 5JSRA 3L2HA 2PXJA 3O0XA 4DEQA 1QWRA 2MEV3 1XE8A 2HWF1 1VRH2 3W5MA 4E27A 4DY3A 1XNBA 5EYYA 2PLV2 2X5IB 3OSDA 4A42A 2VZPA 3E97A 1Y3TA 1YFXA 2R071 2UY8A 3ZFGA 4WZCA 1FATA 3MPPG 4UW4A 2JDHA 3H7JA 2PHDA 3LEKA 3NV1A 4MGQA 3LFIA 2FD8A 5KXDA 4BA6A 4JGYB 3MICA 3H1MA 4YW7A 3P6BA 4ZHNA 1RHI1 4IL7A 4QU2A 2JECA 2JG9C 1G9FA 5A6QA 5A3OA 4FOYA 5K9YA 4MHRA 4J1XA 1ND2B 3TOJA 5LRRA 2GSYA 1DGLA 2CDOA 1SLAA 4OUSA 1BEV3 1TVGA 4UAPA 2ZGKA 4AHWA 1E5IA 1ULCA 2LROA 2D5FA 3VBHC 3UV9A 2LUWA 2R0HA 4RHV3 1SPPA 3TNQA 3I2JA 4RR3C 4D69A 2Y8KA 5KC6A 1LOEA 3FHIB 1AR93 1XOYA 1RMU2 5DN2A 1VBA3 1AXKA 2CWMA 2JDYA 4QPGA 2GMPA 4O9GA 1Q43A 2JX9A 5H9PA 4D6SA 4BMEA 1LOBA 2VE1A 3ACIA 4FFFA 5FZ9A 3T4HB 2OQ7A 1GUIA 1VBE2 1XU2A 1PK6A 5F9TA 5JDBA 3MIGA 1QJX1 3CJIA 1LU1A 4K20A 3IIIA 3CQOA 3W58A 4L2NA 5KXBA 1QJU3 5ERLA 5A1AA 3W5NA 3SEEA 1DQ1A 2D6LX 2ZJCA 1RUF3 4BLJA 5D1IA 2J1UA 4W8JA 2GH2A 2W2IA 3KHBA 5FWJA 4YSFA 4J25A 2YZ4A 1W04A 3QH6A 4CE8A 3AP9A 4R9BA 3WW1A 5EIYB 4Y22B 3ZFFC 2Q8DA 1TMF2 2PQSA 5I0TA 3W9AA 1ZBE1 3VD7A 5IVFA 5EXOA 5ANNA 1AHSA 4G4FA 4XC9A 1NUKA 1VBB3 3H50A 4FO9A 1C3HA 5BNPB 3IMNA 1ZRCA 3CKHA 5IVYA 4CP1A 1RUJ2 1GANA 2ZX0A 4H14A 2DURA 5FWEA 3MIEA 1YJLA 4RL7A 3ZXGA 4Y26A 3VBOA 1W3XA 3Q8BA 4DZGA 1COV2 4UYBA 1JMUB 3J8F3 1US3A 1MR5A 1LHUA 3UJQA 3D8CA 3LAGA 5FZIA 4QX5A 4B4PA 4NHLA 2AENA 2XJQA 3N7KA 2VBDA 4LBLA 4LLFA 2V5YA 1UY0A 4LNVA 5G04L 1LOCA 4CYDA 2BWAA 4FP2A 4EJRA 2YC0A 3O0VA 3RGBA 4HXCA 3HIFA 3O1SA 2XBO2 1KJLA 3OY8B 3SCGA 4XJZA 4XURA 3TWIA 2G4IA 1IS5A 1W6MB 3ZFEC 3BCWA 4TWTA 4CP9B 2K2SA 5FLHA 1V9U2 1AXYA 4P9IA 1WBLA 2OIIA 2V73A 1GP6A 4NIDA 5CADA 5EQUA 1W8UA 2D3SA 3AMMA 5H9QA 2JDMA 1J58A 4DXZA 2P3IA 5DAQA 2OXBA 4FPYA 5B4NA
chains in the Genus database with same CATH topology
3NNJA 5LATA 3HQRA 2RG4A 4XACA 3ITQA 4UWDA 4MHUA 4MHRA 2RDRA 4JZRA 3OUIA 4Y5SA 5A3UA 3NNLA 4NHYA 5IAVA 3W21A 5LBEA 3BVCA 4NMIA 2JIGA 3W20A 5LBBA 2G1MA 2OPWA 4NHXA 3EMRA 2A1XA 2FCUA 3GJAA 5IAXA 5LB6A 3OBZA 2FCVA 2FCTA 3DKQA 5IATA 4XCAA 5EPAA 4BQWA 4Y5TA 2G19A 4ZPIA 4XAAA 5ERLA 3PL0A 4IW3A 5DAVA 2HBTA 3GJBA 2Y33A 5HV4A 5LASA 4J25A 5M0TA 3KT7A 2V4AA 3MGUA 5C5UA 2JIJA 3OUHA 3NNFA 5L9RA 4ZONA 2RDQA 4XC9A 5LA9A 5DAWA 5DAPA 3GZEA 2Y34A 3NNMA 4BQXA 5HV0A 3KT1A 4NHLA 5LBFA 5LBCA 4KBZA 3HQUA 3KT4A 5L9VA 2HBUA 4BQYA 3OUJA 4XABA 4XCBA 5DAXA 5C5TA 2RDSA 4NHKA 4Q5OA 5EP9A 5EQUA 5L9BA 4NHMA 4NAOA 5DAQA 2RDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNJ A;  5LAT A;  3HQR A;  2RG4 A;  4XAC A;  3ITQ A;  4UWD A;  4MHU A;  4MHR A;  2RDR A;  4JZR A;  3OUI A;  4Y5S A;  5A3U A;  3NNL A;  4NHY A;  5IAV A;  3W21 A;  5LBE A;  3BVC A;  4NMI A;  2JIG A;  3W20 A;  5LBB A;  2G1M A;  2OPW A;  4NHX A;  3EMR A;  2A1X A;  2FCU A;  3GJA A;  5IAX A;  5LB6 A;  3OBZ A;  2FCV A;  2FCT A;  3DKQ A;  5IAT A;  4XCA A;  5EPA A;  4BQW A;  4Y5T A;  2G19 A;  4ZPI A;  4XAA A;  5ERL A;  3PL0 A;  4IW3 A;  5DAV A;  2HBT A;  3GJB A;  2Y33 A;  5HV4 A;  5LAS A;  4J25 A;  5M0T A;  3KT7 A;  2V4A A;  3MGU A;  5C5U A;  2JIJ A;  3OUH A;  3NNF A;  5L9R A;  4ZON A;  2RDQ A;  4XC9 A;  5LA9 A;  5DAW A;  5DAP A;  3GZE A;  2Y34 A;  3NNM A;  4BQX A;  5HV0 A;  3KT1 A;  4NHL A;  5LBF A;  5LBC A;  4KBZ A;  3HQU A;  3KT4 A;  5L9V A;  2HBU A;  4BQY A;  3OUJ A;  4XAB A;  4XCB A;  5DAX A;  5C5T A;  2RDS A;  4NHK A;  4Q5O A;  5EP9 A;  5EQU A;  5L9B A;  4NHM A;  4NAO A;  5DAQ A;  2RDN A; 
#chains in the Genus database with same CATH topology
 1RB8 G;  1JZ2 A;  4W6X A;  3LSD A;  4IET A;  3MYX A;  4QX2 A;  3G7D A;  1PO2 2;  1R1A 3;  4NII A;  1LNS A;  1L7Q A;  2C24 A;  5JOW A;  2EAK A;  4GAL A;  5A3W A;  3O1M A;  1NLR A;  1DQ5 A;  2IVJ A;  4Y1X A;  5I8Y A;  5KC5 A;  3ATG A;  4R8H A;  5FYC A;  5JMO A;  1RIT A;  4M0N A;  4Q4X 2;  4QGN A;  1GZW A;  1MPX A;  3AM2 A;  4FFG A;  2ZEZ A;  4NR1 A;  1QJY 3;  2AAC A;  3CJX A;  5A6Y A;  2XL9 A;  5BXX A;  4MXV A;  4OUE A;  4QX1 A;  1PX3 A;  2R6Q A;  5FP8 A;  4P9X A;  1MEC 3;  4A7Z A;  2VQ0 A;  4LUM A;  3HNY M;  3HT1 A;  1O5U A;  2VH9 A;  3ZKU A;  1OC1 A;  2D44 A;  2NMN A;  2Q8E A;  1TE1 B;  2RE9 A;  3VDC A;  2ARX A;  3N36 A;  5K0U B;  4NHX A;  1HRV 1;  1AX2 A;  2QQK A;  2FDJ A;  2R49 A;  2WIN B;  3EMR A;  4LHN A;  4Z1V A;  1VRH 1;  1JZ4 A;  4AZZ A;  4CUA A;  1PO1 3;  1LHV A;  4YRD A;  1A8M A;  4N90 A;  4D7T A;  2UUR A;  1D4M 3;  3O14 A;  3H8X A;  2OPK A;  3VKL A;  1DGR A;  1LUL A;  5JI9 A;  4XQD A;  4P9Y A;  1NE6 A;  5SV5 A;  2WKK A;  1R09 2;  2EAA A;  2PYT A;  2HEW F;  3LDR A;  4BJ0 A;  2XLA A;  4I0B A;  3DPR A;  2NZ9 A;  4N9I A;  2G19 A;  1Z78 A;  5AVP A;  1CD3 G;  1HIX A;  2VY0 A;  3KD4 A;  3K4Z A;  2EXJ A;  2HLE A;  2VEC A;  2ENR A;  2G9Z A;  1LOF C;  2CTV A;  3NV3 A;  1CVN A;  1YNA A;  3JQW A;  1DF0 A;  2WNV B;  1DQ2 A;  4DO0 A;  1RIR A;  4CU7 A;  3HN1 A;  3JD7 1;  5EJ3 A;  5KHG A;  1KS5 A;  3ALQ A;  3E6C C;  2WA3 A;  1O8P A;  1Q8Q A;  3NNF A;  4J1W A;  1V6O A;  2EAL A;  5I0R A;  1U5Z A;  1RUN A;  3M3C A;  4XXA A;  1W2T A;  3DUI A;  1R08 1;  4HG6 B;  1X36 A;  1POV 3;  3I54 A;  3I8T A;  2VW1 A;  4MET A;  4XTM A;  4XDQ A;  1BVV A;  5CFD B;  2VL4 A;  4IV1 A;  1J83 A;  3UJO A;  3RYP A;  1AR7 3;  2WS9 2;  2EIG A;  2Y60 A;  5FJH A;  3T4V A;  5A3N A;  1UZV A;  4IE5 A;  4XF4 A;  4FQ4 A;  3AL6 A;  3BYW A;  3VZJ A;  4Q0P A;  1AYN 2;  1NLQ A;  2E63 A;  1ZZ7 A;  2ET7 A;  3EYP A;  2X5I A;  1OPM A;  3OD4 A;  4E4H A;  2GU9 A;  1FNY A;  4YZ2 A;  4LBO A;  1UO9 A;  2HEV F;  3TRS B;  4FOW A;  4Q4Y 2;  2ZBJ A;  3VL8 A;  4JKK A;  3C7E A;  1DZQ A;  1AX0 A;  1DZR A;  1BK1 A;  2YXS A;  4XUQ A;  1ZBA 3;  3WUC A;  4JGY A;  1OVP A;  4WVM B;  2OX0 A;  2DU1 A;  3JZV A;  2XPJ A;  4CEW C;  1ZZB A;  5LEK A;  4B8E A;  2RDS A;  5FPA A;  1W8T A;  2VNG A;  2YRO A;  4XUP A;  4QDQ A;  4YM1 A;  4CDX C;  2WNO A;  3O1V A;  2WO3 A;  4B29 A;  2PAE A;  2PHU A;  4IEZ A;  2OZJ A;  1ND2 A;  5FZD A;  2GP5 A;  4NPL A;  4QX7 A;  4AI3 A;  4CDW A;  3RRD A;  4AQS A;  4CUB A;  3DEC A;  1GV9 A;  4P14 A;  5AC9 3;  3H1Y A;  3OGV A;  3ZYR A;  2GH8 A;  1UN1 A;  3WDV A;  3PVE A;  4LUL A;  2ZGT A;  2P4E A;  3ILN A;  2RG4 A;  4P9L A;  2XVL A;  1VRB A;  3IN9 A;  4RS5 C;  2EA7 A;  3NJX A;  2AH2 A;  4U2A A;  3ZO0 B;  2FMY A;  1ULE A;  4Q29 A;  2JD9 A;  3A22 A;  4K21 A;  4BE3 A;  5C71 A;  1CX4 A;  4N9H A;  3UK9 A;  1AR6 2;  3WCS A;  4AHZ A;  3DGT A;  4V2V A;  1KS4 A;  1MZ5 A;  4AHX A;  2YDE A;  2GAL A;  4HL0 A;  4M0H A;  4MLO A;  3ZXA C;  1V9U 1;  1O4T A;  4YW2 A;  4FTB A;  2O14 A;  1MS0 A;  3TEW A;  1WMX A;  3P3P A;  1HQN A;  1YQ8 A;  3OPZ A;  5F3I A;  1LED A;  2PLV 3;  5F2S A;  1TNF A;  2WAO A;  1QF3 A;  3IB3 A;  1U0A A;  1QDO A;  1AF9 A;  3UL2 A;  3KQ4 B;  1G9C A;  4HK9 A;  4AI9 A;  5JPM B;  4Y22 A;  5C4W B;  1JTZ X;  1PO2 1;  5IHR A;  5C9A B;  1DYK A;  2N7G A;  1UYY A;  1Q8V A;  2NLR A;  3KGZ A;  2BFU S;  3PDQ A;  5C8C C;  4TSV A;  4Y5T A;  1V70 A;  1G6N A;  5BNP A;  3WNK A;  1O8S A;  4AFC A;  3KHC A;  1DLL A;  1ASJ 2;  1MS5 A;  4HK8 A;  4IE4 A;  5A70 A;  4UFI A;  5HXM A;  5GM0 A;  1W8H A;  2ORZ A;  2IXH A;  1JHJ A;  3SH4 A;  1XND A;  4L11 A;  1C8M 2;  5J96 B;  3CZJ A;  1RUH 2;  1OH4 A;  1XJA A;  3WSO A;  2EXH A;  3B5L B;  1QY4 A;  1IOA A;  1O91 A;  2RJL A;  3LDK A;  2QJV A;  1RMU 3;  2Y0O A;  3AP7 A;  3LSE A;  4COU A;  2ZGL A;  2VNR A;  2ZX3 A;  3S5A A;  3ZFG C;  2CGP A;  3JQX A;  3GZE A;  1SLT A;  2ZAC A;  5IUQ A;  3OY8 A;  3WG1 A;  1GU3 A;  3U78 A;  1U5Y A;  1RUG 2;  4R4X A;  4CP9 A;  1VBE 3;  1RUD 1;  2CAU A;  3A21 A;  4JV4 A;  3VD3 A;  2RMU 1;  3MEP A;  1IQD C;  1R09 1;  1UY3 A;  3HJR A;  2VMG A;  3KV5 A;  1ZA7 A;  4JGZ C;  4PDW C;  4PIX A;  4HSJ A;  3WQ7 A;  3BGA A;  3MW4 A;  1RVF 1;  1IS4 A;  1EY2 A;  1OFN A;  2YPD A;  4FPO B;  1EUU A;  3LCP A;  3SIS A;  5EHD A;  3FE5 A;  1PMI A;  3AKQ A;  1O3T A;  5FY5 A;  2ZX1 A;  2JG8 B;  2UYA A;  3OGJ A;  5CIR A;  1OBN A;  4NIH A;  2D6N A;  2BUK A;  1WGP A;  3HBK A;  5DDJ 3;  4B3N A;  1TMF 3;  4YW5 A;  2CU5 A;  4BU2 A;  4CDQ C;  2ARC A;  5FYU A;  2BVV A;  2VO5 A;  4IES A;  2O8Q A;  5FYS A;  2E26 A;  2VMF A;  4QPG C;  2W3J A;  1LGC A;  5FZ4 A;  1O3R A;  1HXS 2;  1GQP A;  2NYY A;  4C1W A;  1VBD 2;  1RUJ 3;  4XJW A;  1J3P A;  1YRZ A;  1H8T C;  2R06 1;  4WM7 B;  3WW3 A;  4Z82 A;  2BBA A;  3C3V A;  1QGL A;  3INA A;  1PMH X;  1DCS A;  2XG3 A;  1PK6 C;  4LA2 A;  4ORF A;  2R1B A;  1AL0 G;  1COV 3;  4I30 A;  5K4L A;  3GF6 A;  4OI2 A;  2UU8 A;  4LXL A;  3BPZ A;  4IGO A;  1RYY A;  4MGS A;  1PM4 A;  4QWN A;  1JOB A;  3ZIW A;  2IVI B;  5ANQ A;  4A41 A;  4Q4V 2;  1DP0 A;  4LTA A;  2O8O A;  2WL1 A;  5K0U A;  1C1L A;  1AYN 1;  4IDZ A;  1NXD 1;  4CTE A;  4Q1P A;  2Y6G A;  5DZE A;  2XBO 3;  5T50 A;  3B93 A;  4RHV 2;  2IZW A;  5A7O A;  3M2M A;  2XJT A;  2E31 A;  3SH3 A;  5IK5 A;  1FV2 A;  1GLH A;  1V9U 3;  2J1E A;  1GQG A;  1VBA 2;  2VD7 A;  2YUE A;  3AK0 A;  4GH4 B;  4GIQ A;  2XJP A;  4QHO A;  1ENS A;  3S7I A;  3S0M A;  4AFA A;  4AK3 A;  3WEZ A;  4IEQ A;  4S2H A;  5T5L A;  3U37 A;  1W6N B;  5LRS A;  5CAZ A;  2G1M A;  5DUV A;  1YFW A;  2IWG B;  1TEI A;  2VMH A;  3AKT A;  4XPV A;  1IS6 A;  4IER A;  4GUL A;  5E16 A;  4DUX A;  2D6K A;  2MPF A;  5I0D A;  2WNV A;  3POB A;  4JDM A;  3OBZ A;  3ZMN A;  1ZM1 A;  3DYP A;  3NJV A;  5KWR A;  2WO1 A;  4BQ3 A;  1QJU 2;  5ABJ B;  1FNZ A;  1CJD A;  1TG7 A;  4JTN A;  3TEY A;  1R1Z A;  3OTF A;  1WD4 A;  1RUF 2;  4DOU A;  4AQ2 A;  1ODM A;  5KHI A;  3UGF A;  5CNA A;  3AJZ A;  4DB5 A;  4D6R A;  5GLV A;  4XEZ A;  1VB4 A;  4Q4X 3;  4QKN A;  5CFD A;  1I5P A;  5GLZ A;  2F17 A;  2VC9 A;  4AGV A;  5H9R A;  1WW7 A;  5FO7 B;  1YO8 A;  2XVG A;  1ZX5 A;  4FPC A;  4RD7 A;  3JCI A;  1AR6 1;  1PX4 A;  3SKV A;  3ST7 A;  4JDO A;  2HWC 2;  1UOB A;  1KFU L;  4AGG A;  4OHW A;  3TB0 A;  2WWU A;  1OUX A;  4XOG A;  2ZGS A;  2CDP A;  1JYW A;  4ATF A;  1Q56 A;  3AXE A;  3CBN A;  4AED C;  1FMD 2;  2QQP A;  1ULP A;  4DUV A;  4RFR B;  1XE0 A;  5IFP A;  4BQX A;  1QKQ A;  2JE9 A;  1JU3 A;  1W0O A;  1QIQ A;  4WVM A;  2JXA A;  3HNB M;  2VU9 A;  3K46 A;  3H8O A;  2JD4 A;  3WF1 A;  3LWC A;  1JH5 A;  1V6K A;  4OLL A;  1IG3 A;  2J1V A;  2WNU B;  4QPW A;  4IEO A;  1ZRI A;  4KBZ A;  1FXZ A;  4ZKT B;  1VIW B;  3U14 A;  2CWS A;  3P1I A;  5A3P A;  1ASJ 1;  4YG3 A;  1LGN A;  4A7Y A;  3AP4 A;  5I8T A;  4YW3 A;  1H4H A;  4E2G A;  2XDV A;  3IPV B;  4FI9 A;  5JOY A;  3VKO A;  4XBL A;  3J7M A;  2D6P A;  1JUI A;  5CG9 A;  1I3H A;  3AYC A;  1CJP A;  2IXC A;  4XFF A;  1NA1 B;  1ODN A;  1X50 A;  1C5H A;  3PUH A;  4M3C E;  4ZZ5 A;  2ARE A;  4JDN A;  5EP9 A;  1HKD A;  1SQ4 A;  5FP3 A;  3ZYP A;  1WME A;  2ZKN A;  1WA4 A;  4GKX A;  1KGY A;  3CU7 A;  1B35 B;  2VOW A;  5FYI A;  2JWP A;  3AZX A;  3MUY 1;  5JR7 B;  5CKN A;  2WS9 3;  3WF2 A;  4CXX A;  2KR2 A;  3DPR C;  1RUG 1;  2DCK A;  3RZJ A;  1OOP B;  3CO2 A;  4IV3 C;  3SH5 A;  4LBJ A;  3APB A;  3E1F 1;  3MHZ A;  1SBE A;  4CA9 A;  1AYN 3;  2GAU A;  4GXL A;  1YFU A;  4EN7 B;  4AQ6 A;  2VW0 A;  5C8W A;  1MEC 2;  2VG9 A;  5GZC A;  2DF7 A;  2EF6 A;  2RS5 1;  2VCB A;  4FPH A;  4Q4Y 3;  3KF5 A;  4Q0U A;  5FY1 A;  5I0U A;  4DUW A;  1RJ8 A;  3GZT B;  4KH9 A;  4XQ4 A;  1ZYB A;  3THP A;  1NCQ B;  1OLM E;  2G9F A;  2QDN A;  5C4W A;  1JHN A;  5C9A A;  5H9S A;  3PUA A;  3QAC A;  4FPE A;  1O4Z A;  1YIF A;  2MEV 1;  4S2G A;  3ACL A;  2YFU A;  1BHG A;  5J7M A;  4WVW A;  4JC1 A;  4KWU A;  3ZYG A;  4LBN A;  2BJS A;  5JI7 A;  2RM2 2;  1VAK A;  3HVD A;  1FOD 3;  1JN2 P;  2W92 A;  3BAL A;  4OVE A;  4YW4 A;  5FY4 A;  3WNM A;  2DCY A;  3H1W A;  3H3Z A;  3H42 B;  1NYW A;  1S0C A;  3M7A A;  4LKF A;  5FK7 A;  1OA2 A;  2PHF A;  2Q30 A;  2W91 A;  3NL1 A;  3SC7 X;  3VBF C;  4GJY A;  2YG0 A;  3ZOI A;  5JSO A;  1IGO A;  1BZW A;  1RIN A;  2PTM A;  1D4V B;  2X5I C;  1OLQ A;  3LA7 A;  4P5Y A;  3ZYI B;  2FZ2 A;  3DCQ A;  4HKL A;  4YG6 A;  4PQ9 A;  1J3Q A;  1GYK A;  4NRM A;  1GMM A;  3C8X A;  5DAV A;  1N3Q A;  2WNE A;  4ITC A;  5F2W A;  2VAU A;  4I09 A;  1BEV 1;  4CU6 A;  1AXZ A;  3PUI A;  1AR6 3;  4RHV 1;  1D0G A;  3B7M A;  3RZM A;  4PHZ A;  2V4A A;  3BOW A;  2H6B A;  3NAP B;  1XNA A;  1AR9 1;  2BTV C;  1YQ6 A;  3ZXE A;  1H2M A;  4HBN A;  1VBA 1;  5L9R A;  1GNY A;  2J1R A;  1PZ8 A;  2MNG A;  2RDQ A;  4FVV A;  1NY7 1;  1BCX A;  1U5X A;  2HWE 3;  4HZF A;  1LEN A;  2JG8 A;  1HW5 A;  4ZU4 A;  5F7U A;  2RJ2 A;  1OSG A;  4IGQ A;  4DRR A;  3UET A;  4Z92 B;  4LOT A;  3ZDV A;  1O5L A;  3O12 A;  4PI0 A;  1JZ5 A;  2X05 A;  4E2S A;  3I2F A;  3AMP A;  1CZT A;  3ECQ A;  4N53 B;  1D7P M;  4Y1Y A;  4Y3O A;  3A7Q A;  5FY7 A;  5JOZ A;  1QJU 1;  4WV8 A;  2Y64 A;  1BBT 2;  1RUF 1;  4I2O A;  2Z69 A;  3B69 A;  3MIF A;  1HQL A;  4XIK A;  3AFK A;  4GMP 3;  5FXV A;  4WM7 A;  1OA3 A;  4F8A A;  2WO7 A;  3M8L A;  4BIS A;  3VBR C;  5BPX A;  5GKA C;  3VZO A;  1SFY A;  4LBM A;  5BNO C;  2HKX A;  1C8M 3;  4PI2 A;  3R6S A;  3ZN6 B;  2ZXQ A;  5C70 A;  4AAP A;  2RHP A;  3ES1 A;  1RUH 3;  1IPK A;  2D40 A;  4RGG A;  2X8K A;  1VBB 1;  2P2K A;  2WFF 2;  2WFP A;  5DAX A;  2VGD A;  2HWB 2;  2A5Z A;  2YYO A;  3F2Z A;  4GD4 A;  4E4S A;  2P6C A;  2Q8O A;  4P00 B;  1YJK A;  3O1U A;  5FKB A;  5FXX A;  1IQA A;  4ZY9 A;  4NN0 A;  2BGO A;  4QMA A;  4UW3 A;  2QKD A;  2CNA A;  2KXL A;  2WT0 A;  2R1D A;  5FPZ A;  4BCU A;  4OUL A;  4QU1 A;  4P9G A;  5CEH A;  4HVR A;  4UBG A;  3MZH A;  1BYH A;  4JHZ A;  4AVB A;  1OF4 A;  2BQP A;  2F4L A;  3GCW A;  2GN7 A;  3LIG A;  4GH4 A;  2ORX A;  2RR1 2;  4J6G A;  5F5Q A;  2FMD A;  5F32 A;  2W1W A;  2ZHN A;  4DXS A;  5BNP C;  1JZ3 A;  4ES8 A;  2ZS6 B;  4QD2 A;  3EBR A;  5HCB A;  2A3Y A;  2J1A A;  1CIW A;  5FYH A;  3NNG A;  1W6N A;  1V0A A;  4FOV A;  3ZSK A;  4MYE A;  4UWD A;  3S57 A;  4MAD A;  5CZK A;  4EN8 B;  2TEP A;  2XJS A;  3O5S A;  4MG2 A;  1F31 A;  2ZZQ A;  3PTR B;  2ZAA A;  4ZXK A;  1AYM 2;  1K3I A;  1MQT B;  5ABJ A;  1MS9 A;  3POY A;  2YU2 A;  2XQX A;  4NMI A;  1MVE A;  1XB9 A;  1GBG A;  2EID A;  4P9W A;  1HXS 3;  1URX A;  3PVO A;  1AX1 A;  1VBD 3;  4K1Y A;  5DXD A;  2A1X A;  4AGR A;  4CCO A;  2XQR A;  1OKO A;  1R1A 1;  3IKW A;  3OB8 A;  1S0J A;  5GZF A;  4QKD A;  2Z5W A;  3OBA A;  5HPO A;  2Y6J A;  4LO8 A;  5GAL A;  3ZYJ B;  5JWP A;  2WZR 3;  3DKQ A;  5EJZ B;  2GC0 A;  3AZY A;  1W06 A;  5FTT C;  1REE A;  3PIJ A;  5IAT A;  2OT7 A;  5B2G B;  4X6R B;  2BNN A;  5AVA A;  4Q4V 3;  1PVC 2;  3NKT A;  4CDW B;  4M4P A;  1N1S A;  4H7M A;  3WHT A;  4AEM A;  1QJY 1;  1WLW A;  5FZF A;  1MS8 A;  3IDE A;  4Y4R A;  5J1X A;  1MEC 1;  2CYF A;  4XXP A;  4COZ A;  5IT6 A;  2IC1 A;  1A8D A;  4MO3 M;  4NAM A;  2VCM A;  4TYS A;  4C90 A;  1XNK A;  2FZ1 A;  2IUW A;  1BQP A;  4QXC A;  1JOD A;  3LPG A;  5FZ1 A;  3QD6 A;  4TLG A;  4ARY A;  3AB0 A;  1UX6 A;  3ILF A;  2H0B A;  3ES4 A;  2WNU A;  4BWO A;  1ENR A;  2ZGO A;  4QQP A;  1PO1 1;  1UOJ A;  1NT0 A;  1X9P A;  1ZZC A;  2D3P A;  2LW8 A;  1D4M 1;  3I3D A;  5LA9 A;  1ENX A;  3N7M A;  2ES3 A;  1NCR B;  2DWR A;  1PIV 2;  3N7L A;  3D0S A;  1LOG A;  2XXZ A;  4D7S A;  1LRH A;  3IPV A;  4IE6 A;  3RZG A;  2XHK A;  5E89 A;  3RVH A;  1O3Q A;  1J59 A;  5BNN B;  2ZGR A;  5KHH A;  5LA0 A;  1N47 A;  2C9A A;  1NA1 A;  2XOM A;  3VB9 A;  1XSR A;  5K0U C;  3TEX A;  4QX0 A;  1DGW A;  5FK8 A;  3VKN A;  1H1A A;  1YLL A;  1SDD B;  3AYA A;  4JRL A;  3VN4 A;  5FPV A;  2P37 A;  2WR9 A;  1QXR A;  1B35 A;  3CF6 E;  2CHH A;  4L99 A;  2W08 A;  1ZZ9 A;  2JEM A;  4H3W A;  3HT2 A;  5DDJ 2;  1UZW A;  3T2T A;  1HX6 A;  1XNT A;  4MGI E;  1U12 A;  3B00 A;  4Q8L A;  1Z7S 3;  2NPI A;  3ABZ A;  1OUR A;  1OOP A;  2VXR A;  3ROU A;  1UF2 C;  3GAL A;  2HEY F;  1UY4 A;  3RZZ A;  2HWC 3;  1J84 A;  1D0H A;  1VBC 2;  1Y9M A;  1POV 1;  2JDN A;  4XCB A;  4CVU A;  1PGL 2;  4GJZ A;  1ALY A;  2Q8C A;  4LIV A;  4YGD A;  1FMD 3;  2XKO A;  2C9K A;  2WNV C;  1AR7 1;  3FFZ A;  2X10 A;  5FLJ A;  1L7R A;  1UZZ A;  1K12 A;  1NCQ A;  2VTX A;  3BKZ A;  1RUO A;  3Q8F A;  2WT2 A;  5D2A A;  4EN9 B;  3AP5 A;  1QJE A;  3ZKY A;  4DMI A;  2I07 B;  3O7O A;  3OGS A;  5D8A C;  1S0F A;  5CFD C;  3RZK A;  2OZ6 A;  3C2U A;  2WSU A;  3ZSM A;  4ASL A;  2QQW A;  4O61 A;  4O65 A;  3GGL A;  2RDR A;  3VZN A;  3I2K A;  1ZBA 1;  4K3U A;  2QUO A;  4JHT A;  2JJ6 A;  3OUI A;  2XML A;  5EFU A;  4LK7 A;  2WJS A;  1XE7 A;  4NHY A;  5AFE A;  5LBE A;  1W6P B;  4XW3 A;  5FMC A;  4Y4Y A;  2D6M A;  2ZGP A;  5FZ7 A;  3T2O A;  2Q1F A;  4LOS A;  4HLT A;  2XJV A;  1HB4 A;  2QBX A;  3MLJ A;  3NKG A;  4EE2 A;  3A0N A;  1SBD A;  5AC9 1;  3K51 A;  1HB1 A;  3S7E A;  4BK5 A;  4MGZ E;  5JUV A;  1EP0 A;  2ARB A;  4XDO A;  2OS2 A;  2ZGN A;  4PF5 A;  3T0D A;  4UI9 L;  3NAP A;  2CSG A;  4AG4 A;  4XCA A;  2FDK A;  4CZS A;  4CU9 A;  4BQW A;  1BVP 1;  4BH9 A;  2Y6K A;  1C8N A;  4YW6 A;  3FFQ A;  1OHF A;  4XAA A;  4RFT 0;  4OUM A;  4Q4W 2;  2A6X A;  2BOI A;  4W4Z A;  1MS3 A;  3USU B;  2A75 A;  4YZ1 A;  3RNS A;  4P9J A;  4QAW A;  2JKX A;  3ZYH A;  3R05 A;  3OD0 A;  3VBH B;  2WWJ A;  3VD4 A;  3SEP A;  2PHX A;  1UD1 A;  3LDB A;  4DEV A;  2TNF A;  4FTS A;  3QCW A;  4Q0V A;  1D2S A;  1SFN A;  3P5B A;  4N53 A;  3MGU A;  4NRO A;  5FP4 A;  1HJF A;  3VBS A;  1CX1 A;  1ZNP A;  1H1M A;  1E5S A;  1QH7 A;  2P3J A;  3GHM A;  4KMQ A;  5DUU A;  4AVT A;  4YM3 A;  1KDK A;  3D4K A;  2PLV 1;  5C3O A;  3J7N A;  4ZON A;  2KM2 A;  2YB7 A;  2RM2 3;  2E53 A;  2PHT A;  2D93 A;  2GZW A;  2Z79 A;  5FZL A;  4UXA A;  4YG0 A;  1SLL A;  3FJS A;  1MZF A;  3POS A;  4H7L A;  4M3C F;  3NJZ A;  1QHD A;  4OMC A;  1HN1 A;  1W6O B;  2UWA A;  2VOX A;  3FHA A;  2O1Q A;  3LEI A;  4LKD A;  3ZN6 A;  4EWD A;  4XJ9 A;  4LEJ A;  3SCH A;  3BI3 A;  4MUV A;  2I74 A;  4JTO A;  1V00 A;  5A7S A;  1LCL A;  2BZD A;  4LHL A;  1HV0 A;  1V6M A;  1S0B A;  2CGO A;  5FIX A;  3UES A;  2BEO A;  1JOJ A;  1BXH A;  2R04 2;  3ELN A;  3GZU C;  5FYV A;  5FY0 A;  2D97 A;  3K4D A;  4WVZ A;  3RYK A;  4QB6 A;  1UQX A;  2RS3 2;  5C4W C;  5A3M A;  4EV0 A;  4IEU A;  5C9A C;  3ZFF B;  3ETQ A;  3H9A A;  2VNV A;  4YWA A;  4M3C B;  5FZC A;  4JKL A;  4HVQ A;  1UPS A;  3PMS A;  2CAV A;  1RMU 1;  1E5H A;  2GME A;  4IE7 A;  2YU1 A;  1PNF A;  5FFO C;  5IVV A;  2RS1 2;  5A80 A;  1H1I A;  1QEX A;  3B02 A;  2XWJ B;  3HMY A;  5L19 A;  4W50 A;  3POW A;  3IZO A;  1TME 2;  3GBF A;  3VD5 A;  3VKM A;  3D6E A;  3BIW E;  4NAO A;  4MZU A;  1J3R A;  1PNG A;  1VBE 1;  3AMN A;  3M4F A;  3WF4 A;  1JZ6 A;  1MQT A;  1NQD A;  1MS1 A;  5FBZ A;  4YAR A;  4H2A A;  2JKB A;  4R9D A;  5CU1 A;  1V6N A;  1WMF A;  2VZR A;  4YM2 A;  3GHN A;  4DIQ A;  2VQU A;  3M3Q A;  3HEI A;  3SXW A;  4QHB A;  1HRI 2;  2WDB A;  1BBT 3;  1GOH A;  1DU3 D;  2R16 A;  4YZ4 A;  4X8N A;  1X8E A;  1QOO A;  1J1T A;  1PGS A;  2X29 A;  1EV1 2;  1XYP A;  1DGW X;  2Q1M A;  5KXE A;  2K46 A;  1CIY A;  2YY1 A;  4COW A;  5C3R A;  4RGK A;  2PA7 A;  2GNT A;  3MF6 A;  5DDJ 1;  3B9I A;  4OQ8 A;  1TMF 1;  1E5R A;  4RQP B;  2J7M A;  1GNH A;  1W90 A;  2WFF 3;  1ZZ8 A;  1FOD 2;  3N35 A;  2I2S A;  4YW1 A;  2HWB 3;  2OW4 A;  5JVV A;  3TNP B;  4FBF A;  3VBU C;  1RUJ 1;  4OFG A;  3IAQ A;  1LGB A;  2A3X A;  3FBM A;  3HOB A;  1PGL 1;  5JCT A;  2JG8 C;  2EIB A;  3AZZ A;  4Y1Z A;  3PUQ A;  4XHX A;  2FCU A;  3K4A A;  1COV 1;  3LOI A;  3THC A;  1OA4 A;  3U10 A;  4PBP A;  3VZL A;  1ZRR A;  4XUO A;  3WDW A;  1UIK A;  1H9P A;  2Z4F A;  2B5H A;  2RR1 3;  3EQE A;  2QQV A;  3MO4 A;  3Q9O A;  1S0D A;  1ST8 A;  4CCE A;  3J7L A;  3RYR A;  4Z2W A;  4WM7 C;  5FOB B;  5FZG A;  3CIH A;  2VUC A;  4YVW B;  1GOG A;  2RV9 A;  4W6W A;  3TAY A;  1YQC A;  1NCR A;  2XBO 1;  1KQR A;  5FBJ A;  5E88 A;  2BNM A;  4QX3 A;  1W2O A;  2X53 S;  5BNN A;  3D3A A;  3UYJ A;  5HV4 A;  2HWD 2;  4OQ9 A;  1AYM 3;  5GZG A;  5J37 A;  3KT7 A;  3M3E A;  3U75 A;  4QXK A;  1K42 A;  4JX0 A;  3A4U A;  2HWE 2;  2AEZ A;  4LA3 A;  3WP4 A;  1RUC 3;  3IT8 A;  4GZ9 A;  4QQO A;  4XAE A;  3J4U H;  1GZ9 A;  5F5C A;  4YNI A;  1H6X A;  5DAW A;  2TBV A;  3N3H A;  4IGP A;  1NZI A;  3MID A;  5FYB A;  2Y34 A;  5C3P A;  4HMZ A;  5DZF A;  1HLC A;  4RSU A;  4NPR A;  1FT9 A;  2A7A A;  2AC1 A;  3CHX A;  2W94 A;  1OUS A;  5DPN A;  1H4G A;  1AL2 2;  2A71 A;  1K5M C;  1FI2 A;  4L97 A;  3SHR A;  2DTW A;  1V6L A;  4XE9 A;  2YV8 A;  2BFU L;  2WQ8 A;  3NRU A;  4Q4X 1;  4N7I A;  1PVC 3;  1A34 A;  1PMJ X;  5J09 A;  2A3W A;  3GDB A;  4CCD A;  5FYZ A;  1AVB A;  4AYU A;  5LBC A;  3ASI A;  1UNB A;  2ZGM A;  1C57 A;  1CES A;  1CR7 A;  1NQJ A;  2FHR A;  3N4M A;  3HPN A;  2DYC A;  2YFZ A;  3TN9 3;  1WCU A;  4L9B A;  1AR8 3;  1F2N A;  3KF3 A;  3S6P A;  3LZZ A;  2IXK A;  2ZEY A;  4PIZ A;  2BWC A;  4K8R B;  4GB3 2;  1OI6 A;  4Y1U A;  1CN1 A;  3LEM A;  1DBN A;  1SEF A;  1POV 0;  3WQ0 A;  2ZX4 A;  2HYX A;  5JOX A;  3IDB B;  4N43 B;  4P5H A;  1JI6 A;  1F4A A;  1GQH A;  4CU8 A;  1PIV 3;  4QXB A;  1YIP A;  2VZV A;  2WYF A;  3IBM A;  3UGH A;  1W03 A;  2D6O X;  1ONA A;  3ZIX A;  3IDA A;  3H3U A;  4I0A A;  3OOX A;  4IEP A;  4AFM A;  2ETE A;  4QXH A;  3BOP A;  3LFM A;  1YC6 1;  5HBA A;  1I9R A;  1W6P A;  4MV2 A;  4AVA A;  4K7J A;  5IW0 A;  1FYU A;  2EXK A;  1W28 A;  1NAE A;  2FBE A;  1PZ9 A;  3CLP A;  1QJZ A;  4CDU B;  1A6C A;  3PTY A;  4W6Y A;  4D6Q A;  4YGB A;  3AX4 A;  3MIH A;  4QM8 A;  2BYV E;  1O59 A;  4DNY A;  3AMH A;  1QQP 2;  3LKJ A;  4NWW A;  4K8F A;  1QNW A;  5A1L A;  4CDX B;  2H0V A;  4LQR A;  3LIH A;  1VBC 3;  4XJU A;  1WLT A;  5L7O B;  4FSJ A;  4KWK A;  1XC6 A;  3K48 A;  4LPL A;  2RS1 1;  1UYP A;  2O0O A;  3GNE A;  3RJ2 X;  4JRA A;  3USU A;  2ILM A;  5FPB A;  1N1Y A;  3CJI C;  2VMC A;  3NW4 A;  4XUN A;  1WD3 A;  1X33 A;  2WZR 2;  2WS9 1;  3BPS A;  3DEM A;  3Q8C A;  3VBH A;  4XBN A;  3GJA A;  5CFC B;  2WAB A;  1NA1 C;  4BLI A;  4YZ5 A;  3D5O A;  2QQN A;  2PN5 A;  1W9Y A;  4XJA A;  2DVB A;  1JOP A;  1L3J A;  4YGE A;  2PQQ A;  4XQW A;  4RS5 B;  3WP5 A;  1OPO A;  3JBG 3;  5EPA A;  2VVF A;  3FN9 A;  3BTY A;  2Q4S A;  3RJR A;  1B35 C;  1JXN A;  1FPN 2;  4Q4Y 1;  4OZO A;  5J36 A;  3AFG A;  2ZHL A;  4IW3 A;  4XFB A;  3UGG A;  1W6Q B;  4QKB A;  5A7P A;  1W6O A;  3W59 A;  2PHR A;  1QXP A;  5FZH A;  5JXJ A;  1UYZ A;  2VZU A;  4HPK B;  3KLS A;  3OGR A;  1PHM A;  1VLN A;  4MGT A;  1W2A X;  2AGS A;  4OI0 A;  2R32 A;  3OUH A;  1FOD 1;  4HSL A;  1OFS A;  3VBO C;  4TZD A;  3I2O A;  3RI9 A;  3THD A;  4IND A;  2ZKL A;  5T52 A;  1NCQ C;  1HJG A;  1POQ A;  2VTX J;  3PHM A;  1HDK A;  3C7H A;  4LE4 A;  4RN5 A;  1RL3 A;  3LB9 A;  1DQ4 A;  3ZFF A;  4BQ4 A;  4M3C A;  2BGC A;  2QQU A;  1Y43 B;  1H2L A;  1Y4W A;  5C8C B;  4URT A;  2VUL A;  4DXR A;  1V6J A;  4FQZ A;  2DTY A;  3E6B A;  3RFR A;  1P8J A;  3VZK A;  3E6D A;  2DUP A;  3N9O A;  5FYM A;  1XXN A;  4D3W A;  5LY1 A;  2DVA A;  2K9Z A;  3I49 A;  2PAK A;  2R0F A;  4Q4W 3;  4N8M A;  1Z7S 2;  4QGM A;  3GM8 A;  1F35 A;  2GMM A;  4BIO A;  3MUZ 1;  4Q26 A;  4MVT A;  2NQY A;  5A7W B;  4AE2 A;  4XZU G;  2C4X A;  2VMD A;  4NO4 A;  5CKQ A;  4Z07 A;  2BRT A;  3MV0 1;  4Q8K A;  3FZ3 A;  3NWK A;  3HWJ A;  4LO7 A;  4BXS V;  4K1Z A;  3TYJ A;  1RUI 2;  2Q1Z B;  3OG2 A;  5GZD A;  1JZ7 A;  3V0B B;  4R52 A;  1HB2 A;  2QQJ A;  1SLI A;  3T1L A;  5JSP A;  3NV2 A;  1JYV A;  2HWE 1;  3WR0 A;  1OLM A;  5DUX A;  2DVF A;  1XPW A;  1OVS A;  4X8P A;  5F3E A;  4EQV A;  5JPN B;  3LE0 A;  1GFF 2;  2JIC A;  4NHM A;  4AI8 A;  2E7A A;  1WUV A;  2EIC A;  3NAP C;  1S55 A;  2RDN A;  4RQP A;  2XWB B;  1DQ6 A;  3FHQ A;  5FZE A;  4JGZ B;  1QH6 A;  4PDW B;  1UXX X;  1QXJ A;  2WBK A;  1G9D A;  4XYX A;  2J1S A;  4GMP 1;  2R04 3;  4QDR A;  3DYO A;  4CEY B;  3ITQ A;  3H7Y A;  4YVS B;  3I3Q A;  2GC1 A;  3AKR A;  4GWJ A;  4PIY A;  3JB4 C;  5ISL A;  2B46 X;  1X82 A;  1C8M 1;  2RS3 3;  5JXG A;  3T08 A;  4ASK A;  2ZMN A;  3OPT A;  4N53 C;  1RUH 1;  4CCK A;  4Y5S A;  1W9S A;  4OHX A;  4CDQ B;  4Q0S A;  3WX5 A;  5FOJ B;  2R7E B;  1C28 A;  2ZGU A;  2W95 A;  5IAV A;  1UKR A;  4UFL A;  1DHK B;  4C8D A;  5JLV A;  1OF3 A;  2RS1 3;  4PF1 A;  4YVW A;  3ZVX A;  1H8T B;  4B1M A;  1TME 3;  3KCC A;  2Z42 A;  4CP0 A;  3VDA A;  3O1R A;  3BUC A;  4UFH A;  2WZP P;  3SKJ E;  1S0G A;  3AMQ A;  2HWF 2;  2A70 A;  5A1F A;  3O0W A;  5IAX A;  1ZRE A;  2PAM A;  3PIG A;  4Y24 A;  2VZS A;  2FCT A;  5FJK A;  5A32 B;  2R07 2;  3NJY A;  3WW4 A;  4XMA A;  2JEN A;  1HRI 3;  3H0O A;  5FYY A;  1SFP A;  3SQO A;  2ZAH A;  4QKF A;  4ET7 A;  3MBW A;  4NRQ A;  3DL3 A;  2WYS A;  3B9C A;  1EV1 3;  1NKG A;  2DBN A;  3IMM A;  3PUR A;  4MGK E;  4DS0 A;  1ND3 B;  1W39 A;  5FV3 A;  5FYT A;  4FAH A;  5A3L A;  1N1V A;  1EAH 3;  1RHI 2;  2E9Q A;  2XL7 A;  5FO9 B;  1YHF A;  4XJ8 A;  2JDU A;  5K7P A;  3BB6 A;  5ACA 3;  2R30 A;  1UOG A;  4HET A;  1QQP 1;  2GC2 A;  5KBF A;  3BU0 A;  3VD9 A;  1RXG A;  2SBA A;  4K9S A;  4IV1 C;  4IEY A;  1HXS 1;  1MZ6 A;  3WP3 A;  1VBD 1;  4OHZ A;  3V56 A;  2W9X A;  2VQT A;  4O7X A;  3URF A;  5I0S A;  5T54 A;  4QQ2 A;  3EO6 A;  1K45 A;  4ASM B;  2VM9 A;  1MQT C;  1QOT A;  2WZR 1;  2OUH A;  3ACH A;  4PQQ A;  3V64 A;  4A4A A;  5T5O A;  3MI8 A;  3PJQ A;  2OQ6 A;  4Q4V 1;  3PVN A;  3U1X A;  3K2O A;  4KGG A;  1F9K A;  3I2H A;  3I3E A;  1GR3 A;  3OBR A;  2WAA A;  3JUU A;  3S5Q A;  4Y20 B;  4N43 A;  4XDP A;  2PFW A;  5T5J A;  4JGY C;  3WG2 A;  1MS4 A;  2YC2 A;  1QJX 2;  3FLP A;  1FPN 1;  3MDP A;  3S30 A;  4A3Z A;  4D0Q A;  3WLU A;  4YGC A;  2IFR A;  2C26 A;  2ZAB A;  5F6K A;  4HAN A;  1S2K A;  1NOV A;  2HWD 3;  3ZYB A;  4V2W A;  4OI4 A;  1ND2 C;  3NV4 A;  1SCR A;  1B09 A;  1VMH A;  1TQ5 A;  4LE3 A;  5DAB A;  1JYX A;  4CDW C;  1IG0 A;  1UCX A;  2Y26 A;  4G9S B;  1VPH A;  4WM8 B;  5JZG B;  4EWA A;  2WA4 A;  4AED B;  4D94 A;  2YMZ A;  1DDL A;  4CDU A;  1MZE A;  2W1U A;  1ZBE 2;  5SV8 A;  2P3K A;  1QU0 A;  1RGS A;  1UY1 A;  3VLB B;  3QOP A;  1RXF A;  3VBS B;  3WG4 A;  2D43 A;  4RA0 A;  1AL2 3;  3HQX A;  4CDX A;  4CCM A;  1GZC A;  5FAX A;  3MFA A;  2B4K A;  1ULF A;  1UPI A;  5L7O A;  1G9A A;  1G8W A;  1O7F A;  4NWV A;  4COY A;  1UXZ A;  2FQP A;  4DIN B;  5HCH A;  3HNM A;  3NO8 A;  5A6Z A;  3T2Q A;  4E2Q A;  4YFZ A;  5LK7 B;  1SLB A;  4DRV A;  4JQR A;  5BNN C;  1Z7S 1;  4EN0 A;  1H9W A;  3M3I A;  3SMH A;  3VKF C;  5CFC A;  1GP4 A;  1WW5 A;  3ACF A;  4JZR A;  4KWJ A;  4N7U A;  3VDD B;  5CIS A;  3PVB B;  3GYD A;  2E7Q A;  2HWC 1;  3I3M A;  4XET A;  4GB3 3;  1DFQ A;  1UZ0 A;  1OD3 A;  4RS5 A;  4A6S A;  2HJI A;  4A7K A;  4E8D A;  2YC4 A;  1FMD 1;  1OLR A;  1W05 A;  2B7Y A;  3PU3 A;  2MHF A;  2ZGQ A;  1OKQ A;  1W6Q A;  5FMO S;  2FDF A;  3DN7 A;  5T5P A;  1EPZ A;  1S2E A;  4EZ4 A;  1ZRF A;  4OMD A;  3RS6 A;  5I93 A;  2XUM A;  2QDR A;  4HPK A;  3WF3 A;  3BTZ A;  4IE0 A;  2XLF A;  4IV3 B;  2OUJ A;  3D82 A;  5DG2 A;  3T3Y A;  2WN3 A;  2GC3 A;  1ENQ A;  3WT3 A;  5APA A;  4Q2F A;  2H6C A;  4BIF A;  4ZPI A;  1UKG A;  4LK6 A;  1QNY A;  4P02 B;  4LHS A;  1JYC A;  5CKM A;  3RDI A;  5FZO B;  2XON A;  2VZ1 A;  4H55 A;  2OA2 A;  4KG8 A;  4SLI A;  1CAU B;  4B4Q A;  4WBB A;  3KWV A;  1QQP 3;  3DKW A;  5C8C A;  4QQL A;  5M0T A;  1RUC 2;  4BXF A;  4E9K A;  2ATF A;  5FQ0 B;  4JKM A;  4Y33 A;  5FZ0 A;  2V72 A;  1SBF A;  1E57 A;  1W0P A;  1LOD A;  3IDC B;  4XTP A;  4FXK B;  1U5I A;  3L9J T;  1AJK A;  1SAC A;  3OBT A;  3C7O A;  5A3T A;  3EB7 A;  4XFA A;  1WMD A;  4HT1 T;  2IXL A;  5BUV A;  1LB2 A;  3QLQ A;  5A7W A;  3USS A;  4OYU A;  3CNA A;  3WNL A;  1M06 G;  3KV4 A;  1NE4 A;  1UYX A;  1HRV 2;  2W5F A;  3LA3 A;  4MGY E;  3VBF B;  3WP6 A;  3I2I A;  3AYE A;  4WVV A;  2VZT A;  3V0B A;  4YPJ A;  1F8V A;  2GP3 A;  1Y9Q A;  2A6Z A;  2Y0I A;  4L8Q A;  4WZF A;  5FUP A;  5L73 A;  5DMY A;  3X29 B;  3D0J A;  2Z2S B;  3KCX A;  1FPN 3;  3TN9 2;  1L7L A;  1LR5 A;  2EVX A;  3NMB A;  4EYU A;  1AR8 2;  3SLI A;  3PUS A;  4A3X A;  1CAV B;  2W1Q A;  1CON A;  2AR6 A;  2WII B;  4AFB A;  4AWD A;  2XJU A;  3AVS A;  2QQO A;  4QPI B;  4JGZ A;  1KD7 A;  4PDW A;  1G86 A;  1UIJ A;  1QMJ A;  2ZML A;  4XVH A;  3OEA A;  3OUJ A;  2ZHM A;  4URA A;  1H0B A;  5DQ0 A;  3LD8 A;  2RM2 1;  4TLF A;  1OMI A;  1OQE A;  1X9T A;  2UWC A;  3HAG A;  5C5T A;  4CEY A;  2DCT A;  4YVS A;  1H2N A;  5L9B A;  3GBG A;  1ULD A;  2JDA A;  3JD7 2;  4KQ7 A;  1LHN A;  1I5Z A;  4ISR A;  1R08 2;  2V09 A;  4KG0 A;  4QPY A;  2NN8 A;  2AZ5 A;  4CDQ A;  5T3N A;  3I59 B;  5GLT A;  3ZPY A;  3GZA A;  1W8W A;  3ZLI A;  3FUO A;  2BER A;  3RPQ A;  4LKE A;  5BY5 A;  4AI0 A;  1OH3 A;  4I01 A;  1H8T A;  4GMP 0;  4KBB A;  5C6C A;  1YXW A;  3UNP A;  2AYH A;  4GWI A;  3MPB A;  3VBR B;  1WCK A;  4IEX A;  2VW2 A;  5BNO B;  4UF0 B;  5K8S A;  2GNM A;  1JU4 A;  3I4I A;  4UFJ A;  5D21 A;  2OYZ A;  1BMV 2;  3WDY A;  5A32 A;  2DU0 A;  1W3V A;  1RUI 3;  2FDI A;  5FZB A;  3WDT A;  5LW9 A;  3THT A;  1V6I A;  3NQH A;  2YGM A;  2QQM A;  3W20 A;  5LBB A;  5C3S A;  3TEZ A;  4DQA A;  4I3G A;  1ND3 A;  1DQ0 A;  2BP6 A;  2CGN A;  4G3Y C;  1WZX A;  5JMC A;  2BU9 A;  3CZU A;  1XSQ A;  3ZYF A;  4DXT A;  3KGL A;  5FZM A;  3R4D B;  1HB3 A;  4LIU A;  1ULG A;  1CAW B;  3JBG 2;  5JAX A;  3T30 A;  4SBV A;  4FFH A;  2W0X A;  5F3G A;  1DYO A;  3VHR A;  2VNO A;  5F37 A;  1JYT A;  1LHO A;  2FCV A;  1BBT 1;  4TTG A;  5FZK A;  3HN3 A;  2DFB A;  5A33 B;  4ERO A;  5LZ6 A;  3UKN A;  1YI9 A;  2BW8 A;  3MLK A;  3MV1 1;  1ZVF A;  1CPN A;  1RUE 3;  5CYY A;  3ZXF A;  1F5F A;  2K0G A;  3I3B A;  3WNP A;  4BQ2 A;  5FKC A;  3U11 A;  4MX3 A;  4ZS2 A;  2WFF 1;  4K40 A;  2HWB 1;  2F4P A;  2J42 A;  2XLG A;  4MXW B;  3V65 A;  4KU8 A;  1YCI A;  2HH9 A;  5C5U A;  4ZZ8 A;  5L36 A;  4AVC A;  3KB5 A;  4Y20 A;  4AW7 A;  2DCZ A;  1AUY A;  5LEJ A;  4UOJ A;  3EHK A;  2AUY A;  1APN A;  3ETP A;  3JB8 A;  3RWK X;  5DAP A;  3POI A;  2VZO A;  4M4R A;  2P1B A;  4RQP C;  5HXV A;  4HN0 A;  3VHO A;  1DLC A;  1XBF A;  1CZS A;  2Q0A A;  3NVC A;  4JCK A;  3WDU A;  2RR1 1;  1Q8S A;  2JG9 B;  2HWF 3;  3J7H A;  3NNM A;  4FPF A;  4GWM A;  4OCT A;  4LIT A;  4ONU A;  3V0A B;  3CDZ B;  2R07 3;  3M70 A;  1VP6 A;  1WLC A;  3B3Q E;  3WNN A;  2C5D A;  3AP6 A;  4WM8 A;  4HKW A;  4XF9 A;  5JZG A;  4AED A;  1NX9 A;  3I97 A;  3R0R A;  4FCA A;  5GJ6 A;  2NP0 A;  1UU6 A;  4RR3 B;  3WXP A;  1RHI 3;  4QQH A;  1AYM 1;  2WZE A;  2W1S A;  3MW2 A;  4NRP A;  3IAP A;  3HQU A;  3ZXJ A;  3JXS A;  4JVA A;  5JIA A;  1H2K A;  2ERF A;  1XU1 A;  2EXI A;  1I1E A;  1RUC 1;  2W39 A;  4YVW C;  2PHL A;  1W9F A;  3VHN A;  4LO4 B;  3FL7 A;  1W0N A;  1Y7B A;  4ZU7 A;  4NHK A;  4LR4 A;  1SDW A;  1W2N A;  4E4D X;  5IJR A;  4AVV A;  4S2F A;  5F8P A;  4BB3 A;  4Z8B A;  3VDD A;  2V5D A;  5F3C A;  1F5J A;  4HKO A;  4PLO A;  4XMI A;  1HQW A;  1KFX L;  4IQP A;  4UT5 A;  1TNR A;  5LAT A;  5LY2 A;  1PVC 1;  4XIO A;  4EN6 B;  2ZZJ A;  5KHJ A;  1IHM A;  3OF1 A;  5IWF A;  1AZD A;  1RUD 2;  2JDZ A;  3E5U A;  4U36 A;  3T1M A;  2RMU 2;  1F4H A;  1QJX 3;  3C7F A;  3TN9 1;  3T09 A;  3U07 A;  4A2U A;  4CCN A;  1G9B A;  4XF1 A;  4FAG A;  4MHU A;  1AR8 1;  1FAY A;  1WCD J;  3ACG A;  1RVF 2;  3KQR A;  1W8F A;  4IV3 A;  4YZ3 A;  1T2X A;  4LBQ B;  5A3U A;  4CRQ A;  3ORJ A;  5FLI A;  1O6U A;  3VDB A;  3OJB A;  1XQN A;  4AR2 A;  1W9T A;  1PIV 1;  2E6V A;  1UY2 A;  3VV1 A;  1REF A;  5FZO A;  2B9V A;  5I8S A;  5C3Q A;  5KXC A;  1UMI A;  1ZBE 3;  4HON A;  1CAU A;  3JU9 A;  3KM5 A;  3I2D A;  4QDS A;  3SIT A;  3WV6 A;  2XVK A;  4XBQ A;  3LOB A;  4C0B A;  2R06 2;  1W8O A;  5FQ0 A;  5D8A B;  2ARA A;  4N43 C;  5AFB A;  3OEB A;  4BQ1 A;  1EAH 2;  4OZX A;  3AL5 A;  3ZFE B;  3BTA A;  4MH0 E;  4XHB A;  3T0B A;  3ZSE A;  5ACA 2;  2E51 A;  2DUO A;  4EZH A;  5J3U A;  1OXC A;  1XYN A;  4KWL A;  4B1L A;  3Q8E A;  5FPX A;  1CQ9 A;  2L9L A;  4RYD A;  5A7Q A;  4F83 A;  1VMF A;  5BV6 A;  5KR7 A;  2UWB A;  3GBW A;  4FPK A;  3VBF A;  4PJY A;  4R9A A;  2BPA 2;  2BVB A;  4YM0 A;  4AQT A;  1VBC 1;  2IFW A;  3O1P A;  3AKS A;  3L2Y A;  1BMV 1;  3QH7 A;  2VOK A;  4KNC A;  3AZW A;  3WQ1 A;  4V1P A;  3M1H A;  2VQA A;  3LF7 A;  1HN0 A;  4CDU C;  3ZXD A;  2P5B A;  1W8N A;  1JYN A;  5IK8 A;  4KGQ A;  1JUH A;  1LKN A;  4UW5 A;  3VZM A;  1CAV A;  3UKT A;  3IWZ A;  1CAX B;  2ZEX A;  3IIA A;  5CBL A;  4XIL A;  5E1R A;  2G9G A;  4QPI A;  1YEW A;  1BKZ A;  5B4X A;  5FR3 A;  5L7O C;  3JBG 1;  4NJ4 A;  3IM0 A;  1FV3 A;  1S1A A;  4YFW A;  5F5A A;  3WF0 A;  1C4R A;  4RGA A;  2YGL A;  1BK0 A;  2VR4 A;  3KT1 A;  4LKS A;  3WD5 A;  4QGL A;  3RSJ A;  3QBQ A;  2XB6 C;  2WUH A;  3DV8 A;  3C7G A;  1S0I A;  5CFC C;  5F39 A;  4AI1 A;  3DF0 A;  1PM7 A;  5J98 B;  2XHN A;  4NVP A;  1GP5 A;  3I59 A;  1D2Q A;  1K5J A;  3MIB A;  4XFG A;  1OD5 A;  3G6J B;  2WSV A;  4PBO A;  1QJF A;  4A44 A;  3ILR A;  5CA6 A;  5IFT A;  2W87 A;  5DG1 A;  3VL9 A;  3RQ0 A;  1W2U A;  4XAB A;  2LS6 A;  5E6H A;  3WDX A;  1KEX A;  1UU4 A;  5GZE A;  3VBR A;  4D8M A;  1FX5 A;  4Q5O A;  3H3L A;  1WWY A;  4ZXE A;  4GH4 C;  4CUG A;  1SG3 A;  4AL9 A;  5BNO A;  4NPM A;  4UF0 A;  1S0E A;  5EZW A;  5FY8 A;  3AVR A;  2GDF A;  1GSL A;  4CXY A;  1X7N A;  1A3K A;  4L92 A;  1HRV 3;  2B9U A;  1KRI A;  3BU7 A;  4DFS A;  1VRH 3;  5FUI A;  4ARX A;  1S4C A;  3R4U A;  1R64 A;  2V4V A;  3CMG A;  4Q4W 1;  5E8A A;  2B8M A;  5ABJ C;  4XAC A;  3LA2 A;  1KJR A;  5FP7 A;  2X09 A;  4CCL A;  4PLM A;  4UW6 A;  5BNQ A;  1SLC A;  1CAW A;  1W9W A;  2J22 A;  4XUT A;  5F6L B;  4CPB D;  1Y9G A;  2XGX A;  4NUB A;  2VBB A;  1SHW B;  3WIN E;  3O1T A;  1VB2 A;  1YUD A;  3OPW A;  4TXW A;  5A33 A;  1GIC A;  5T55 A;  2QQL A;  2FDH A;  1OT5 A;  1UAI A;  4Z2A A;  1PZ7 A;  2YPJ A;  3KVA A;  2DFC A;  2LAL A;  3JD7 3;  2C1F A;  2YBK A;  4XFH A;  5A7N A;  4FT8 A;  5J48 A;  2OPW A;  3OYW B;  5CG8 A;  1N3P A;  2DVD A;  2E32 A;  2QVS B;  3LGR A;  4R4Z A;  1DIW A;  1GWL A;  4UFM A;  1R08 3;  5G05 L;  1LAJ A;  1LOA A;  5LB6 A;  4MXW A;  3SCF A;  2VUA A;  1CPM A;  5FO8 B;  2R04 1;  4BOW A;  2Y6H A;  2TUN A;  4KL1 A;  3HD8 B;  1XNC A;  3B94 A;  4LBQ D;  1YWK A;  1W6M A;  1LEM A;  2RS3 1;  3LEG A;  5LCW L;  1WKY A;  1MVQ A;  2F6B A;  3N9Q A;  4KI5 M;  1ZA4 A;  5FZ6 A;  5GLU A;  4A6O A;  3PL0 A;  4CEW B;  4CCJ A;  1UOF A;  1T6B X;  3BTX A;  2HBT A;  4X6Q B;  2JG9 A;  2WNU C;  1EYB A;  3J26 N;  3GJB A;  5FMB A;  3UKV A;  5HI0 A;  3V0A A;  2GN3 A;  1Q8O A;  2JE7 A;  5LAS A;  5FUN A;  4CP2 A;  5FRA A;  2ADD A;  2RS5 2;  2VUD A;  1KDM A;  3GCX A;  3VBU B;  4CEY C;  5LA2 A;  4YVS C;  1TME 1;  3ME2 A;  4GAZ A;  1W8Z A;  3HR9 A;  4C1X A;  3ZN4 A;  2VZ3 A;  4RR3 A;  3WCR A;  2MEV 2;  5FY9 A;  1VMJ A;  4E8C A;  2DCJ A;  4DY5 A;  2XJR A;  1CZV A;  3HBZ A;  3M3O A;  4LUK A;  5LK5 A;  1UMH A;  2ZTN A;  1VE0 A;  2Y6L A;  2WQ4 A;  1HRI 1;  3FX3 A;  5HV0 A;  1UZY A;  2E33 A;  3VGI A;  3ZMO A;  1JW6 A;  2YBS A;  2D7F A;  5IVJ A;  1EV1 1;  4KU7 A;  1ZRD A;  3B01 A;  4CPB A;  4HVO A;  1EAH 1;  4YYO A;  1OOP C;  5LBF A;  2XKP A;  3H8R A;  2LRP A;  5ACA 1;  1NG0 A;  3DXT A;  1T6G C;  2ET1 A;  4I02 A;  3U4S A;  5FZ8 A;  3AXD A;  1UW8 A;  2YBP A;  3PJY A;  2WO2 A;  3UT0 A;  5L9V A;  3MW3 A;  1UMZ A;  1GOF A;  2Y6F A;  1JZ8 A;  5F1R A;  1SMV A;  4NE9 A;  1BEV 2;  3POF A;  5IVC A;  1YI7 A;  4AVS A;  3KMH A;  1BLZ A;  4AOC A;  2EIE A;  4C91 A;  2P34 A;  1ND3 C;  2CL2 A;  4MOA A;  1M4W A;  2VCC A;  1AR9 2;  3LQC A;  4ISQ A;  2KA3 A;  4B4R A;  4L0P A;  3BN6 A;  2VVE A;  2AEY A;  3FLR A;  1K5M B;  2P3Y A;  2VVD A;  1NY7 2;  1QDC A;  4FPL A;  3POJ A;  4LBQ A;  2BOJ A;  3NNJ A;  5C7G A;  2PHW A;  5JXI A;  2VOT A;  1OQ1 A;  1WBF A;  1UL9 A;  2WZ8 A;  3HQR A;  3WVJ A;  5FRE A;  1TZO A;  4OI1 A;  4A45 A;  1PO2 3;  1VAL A;  5CB7 A;  3KCY A;  4BM8 A;  4FPG A;  3K3O A;  3OCP A;  3MLL A;  5GLW A;  2WN2 A;  2ZCW A;  1DYP A;  2HWD 1;  3E5X A;  2DVG A;  3R4S A;  1GZT A;  3FUQ A;  3WHU A;  5JIU A;  1GKB A;  3AKP A;  1IZ3 A;  2A6Y A;  3BOD A;  3N9N A;  4B7K A;  3ZFG B;  2B45 X;  3RWN A;  4QT6 A;  5D8A A;  1RED A;  1S2B A;  1US2 A;  1F15 A;  3RG0 A;  5FXW A;  2J1T A;  3ON7 A;  3WY6 A;  1LHW A;  1N3O A;  4GA9 A;  5FZ3 A;  2VJX A;  2DBI A;  3W21 A;  3ZFE A;  2Y38 A;  1DGR N;  1KXG A;  2JIG A;  1ULO A;  2PMW B;  1GWM A;  3CEW A;  5EWS A;  3TBD A;  1O4Y A;  3CL1 A;  3ZR5 A;  1Z0H A;  4XZP A;  4AHY A;  1VBB 2;  3N9L A;  4IXL A;  3WQB A;  1GWK A;  4UBH A;  4JQT A;  1AL2 1;  1C5I A;  4FTE A;  3RZH A;  4LJH A;  3P3N A;  2QZ2 A;  1NXM A;  2D3R A;  1RJ7 A;  4WM8 C;  5JZG C;  4W65 A;  1RUE 2;  2SLI A;  5FZA A;  4CCC A;  1WCS A;  3H8U A;  2DUQ A;  4MSV A;  4XFI A;  3J8F 2;  4GQ7 A;  5IVE A;  3WW2 A;  3U0Z A;  3EJK A;  4LLO A;  4PLN A;  2D5H A;  1RUD 3;  1SPP B;  2JB8 A;  2NMO A;  4AF9 A;  5LWB A;  1SZB A;  5JXH A;  2RMU 3;  5JR2 A;  4F3J A;  1WLD A;  1R09 3;  3VBS C;  3FLT A;  4CXW A;  2IXJ A;  1CAX A;  5FDB A;  1JS9 A;  3WUD A;  3MF9 A;  1PGW 2;  3ZN5 A;  4BHP A;  2LTN A;  1RVF 3;  2P17 A;  1IPJ A;  3I2G A;  4GB3 1;  4QPG B;  5FMD A;  4ES9 A;  1NLS A;  3WNO A;  2CY6 A;  1I6X A;  5FXZ A;  2C0Z A;  2VCA A;  3KZ4 C;  4I0W B;  2CV6 A;  4B7E A;  2BGP A;  5F5I A;  1PK6 B;  1EPW A;  1GNZ A;  2ZOE B;  2ZX2 A;  1WW4 A;  3AJY A;  3KS7 A;  3CJI B;  4LBK A;  5CVR A;  1NZC A;  2OKX A;  1Q8P A;  5KHK A;  2XR4 A;  4Q0Q A;  1SCS A;  3VDD C;  1CGP A;  5TSW A;  4CSW A;  1LJ7 A;  1YYN A;  1A78 A;  4XF0 A;  3ENR A;  1VAV A;  1AJO A;  4AFD A;  4LMF A;  3K3N A;  3NST A;  2R06 3;  3SNM A;  3ZR6 A;  1ZZ6 A;  3ZXL A;  4AEJ A;  4COV A;  2VME A;  1R1A 2;  4Q1R A;  5IVB A;  1G7Y A;  1LEC A;  1CWP A;  1DG6 A;  4AI2 A;  2DDU A;  3J9S A;  1IKQ A;  4HFS A;  1EUT A;  4FOQ A;  5DUW A;  1LES A;  4AAX A;  3E5Q A;  2Q5T A;  4BZ4 A;  2ADE A;  4PT6 A;  3FBY A;  4QB1 A;  1VAM A;  2D98 A;  2XUE A;  4FFI A;  3GXU A;  1WW6 A;  5C33 A;  2DV9 A;  4FPJ A;  4BQ5 A;  2BV4 A;  2QQI A;  2OVU A;  1QJY 2;  2W46 A;  2VUJ A;  2XH6 A;  3KT4 A;  1LOF A;  2WC2 A;  3O1O A;  3PU8 A;  4QB2 A;  4BQY A;  3PLQ A;  4BK4 A;  3VBO B;  4IEW A;  4TN7 A;  4BDV B;  4ZU5 A;  2YHJ A;  4IEV A;  4DPN A;  5HCA A;  2BDR A;  3ZDS A;  2QCS B;  4UFK A;  3ZSJ A;  2A73 B;  1UU5 A;  2HYK A;  4Q27 A;  2QFE A;  2W52 A;  3OGG A;  1PO1 2;  4LO5 B;  3BIE A;  4HOO A;  2KD7 A;  1D4M 2;  3WOG A;  3K75 B;  3LPF A;  1X8M A;  1XYO A;  4NIG A;  4OHY A;  5BYN A;  2FDG A;  1LU2 A;  4ZS3 A;  1BJQ A;  2C6S A;  5FP9 A;  4OHV A;  4FP3 A;  3U4X A;  5A6X A;  4YLZ A;  1J1L A;  3AC0 A;  1OQD A;  1IS3 A;  2JDK A;  1YQ2 A;  2PEL A;  2VOV A;  3KSC A;  3OYW A;  2IXI A;  5FPL A;  3A0K A;  4NIA A;  3VHP A;  4S2D A;  5IYY A;  2WWS A;  2W47 A;  2WQZ C;  3PME A;  4BPZ A;  3T0A A;  2WLQ A;  5FPU A;  1JBC A;  5DZG A;  2UYB A;  2RVA A;  4BMB A;  2GNB A;  1PVX A;  4XF3 A;  2B39 A;  4IUG A;  3VUO A;  3NNL A;  2VMI A;  4CUC A;  4ATE A;  2B42 B;  2P6H A;  1IKP A;  2ZA9 A;  3POE A;  5I91 A;  3BVC A;  2ZMK A;  4P08 A;  4CEW A;  4QX8 A;  4QPI C;  2E7T A;  1WCQ A;  1GZW B;  2VXJ A;  3F95 A;  4BYY A;  1YQ5 A;  2QNK A;  2VBP A;  2ZPX A;  3PNA A;  1XRU A;  1NCR C;  5EJ1 B;  3AZV A;  3K77 A;  3VBU A;  3ZPO A;  4EWE A;  4C0H A;  1C1F A;  1AR7 2;  4GWN A;  3A23 A;  4M01 A;  3ZM8 A;  1N1T A;  3DXU A;  5EV7 A;  3DYM A;  3WNX A;  2WLP A;  5FCC A;  2ZEW A;  2BNO A;  2BBV A;  2VZQ A;  2QE3 A;  5AC9 2;  1HV1 A;  1JYI A;  3I7D A;  3KV6 A;  1WA6 X;  2JE8 A;  2NM1 A;  5LA1 A;  3WG3 A;  2W68 A;  4AEK A;  1RUI 1;  2Y33 A;  4F7Z A;  5IK4 A;  4LHK A;  4PCR A;  3RMY A;  1ASJ 3;  1STM A;  2WRA A;  1DZT A;  1H30 A;  4AXO A;  2WT1 A;  4Y5Z 0;  3RMX A;  1VR3 A;  1W99 A;  1ZBA 2;  2JIJ A;  1KIT A;  2RJK A;  2JDP A;  3DPR B;  1Q5O A;  3N9P A;  4K6B A;  3POG A;  5FMO L;  3RI8 A;  3KVB A;  4I3P A;  4R9C A;  2QZ3 A;  4LOR A;  2A6V A;  2I45 A;  1UWW A;  1MAC A;  4LO6 B;  1H8V A;  1RC6 A;  4O9E A;  4Y1V A;  4GKY A;  1YFY A;  2LM3 A;  1VJ2 A;  3EXU A;  4E4Z A;  4QHZ A;  4NOT A;  5HCF A;  3ZXK A;  3T2P A;  1RUE 1;  3MFC A;  2UY9 A;  4HN1 A;  4FXG B;  1UX7 A;  3RZL A;  4JAA A;  1ACC A;  3J8F 1;  4LT5 A;  1RUG 3;  4QM9 A;  2QTW B;  3N7J A;  2GND A;  2ID4 A;  3FC0 A;  2ZHK A;  5EYX A;  3ZX7 A;  1K5M A;  2VPV A;  1RTV A;  1PGW 1;  4M00 A;  3ZSL A;  4XFC A;  1O3S A;  1H6Y A;  1LTE A;  4IV1 B;  1QOS A;  2HBU A;  3AYD A;  3FMG A;  3WZ1 A;  2JB4 A;  2RS5 3;  3N9M A;  3KV9 A;  3Q8A A;  2VTF A;  2A6W A;  4D7Y A;  5IK7 A;  3FWE A;  1IPS A;  1Q3E A;  5JSR A;  3L2H A;  2PXJ A;  3O0X A;  4DEQ A;  1QWR A;  2MEV 3;  1XE8 A;  2HWF 1;  1VRH 2;  3W5M A;  4E27 A;  4DY3 A;  1XNB A;  5EYY A;  2PLV 2;  2X5I B;  3OSD A;  4A42 A;  2VZP A;  3E97 A;  1Y3T A;  1YFX A;  2R07 1;  2UY8 A;  3ZFG A;  4WZC A;  1FAT A;  3MPP G;  4UW4 A;  2JDH A;  3H7J A;  2PHD A;  3LEK A;  3NV1 A;  4MGQ A;  3LFI A;  2FD8 A;  5KXD A;  4BA6 A;  4JGY B;  3MIC A;  3H1M A;  4YW7 A;  3P6B A;  4ZHN A;  1RHI 1;  4IL7 A;  4QU2 A;  2JEC A;  2JG9 C;  1G9F A;  5A6Q A;  5A3O A;  4FOY A;  5K9Y A;  4MHR A;  4J1X A;  1ND2 B;  3TOJ A;  5LRR A;  2GSY A;  1DGL A;  2CDO A;  1SLA A;  4OUS A;  1BEV 3;  1TVG A;  4UAP A;  2ZGK A;  4AHW A;  1E5I A;  1ULC A;  2LRO A;  2D5F A;  3VBH C;  3UV9 A;  2LUW A;  2R0H A;  4RHV 3;  1SPP A;  3TNQ A;  3I2J A;  4RR3 C;  4D69 A;  2Y8K A;  5KC6 A;  1LOE A;  3FHI B;  1AR9 3;  1XOY A;  1RMU 2;  5DN2 A;  1VBA 3;  1AXK A;  2CWM A;  2JDY A;  4QPG A;  2GMP A;  4O9G A;  1Q43 A;  2JX9 A;  5H9P A;  4D6S A;  4BME A;  1LOB A;  2VE1 A;  3ACI A;  4FFF A;  5FZ9 A;  3T4H B;  2OQ7 A;  1GUI A;  1VBE 2;  1XU2 A;  1PK6 A;  5F9T A;  5JDB A;  3MIG A;  1QJX 1;  3CJI A;  1LU1 A;  4K20 A;  3III A;  3CQO A;  3W58 A;  4L2N A;  5KXB A;  1QJU 3;  5ERL A;  5A1A A;  3W5N A;  3SEE A;  1DQ1 A;  2D6L X;  2ZJC A;  1RUF 3;  4BLJ A;  5D1I A;  2J1U A;  4W8J A;  2GH2 A;  2W2I A;  3KHB A;  5FWJ A;  4YSF A;  4J25 A;  2YZ4 A;  1W04 A;  3QH6 A;  4CE8 A;  3AP9 A;  4R9B A;  3WW1 A;  5EIY B;  4Y22 B;  3ZFF C;  2Q8D A;  1TMF 2;  2PQS A;  5I0T A;  3W9A A;  1ZBE 1;  3VD7 A;  5IVF A;  5EXO A;  5ANN A;  1AHS A;  4G4F A;  4XC9 A;  1NUK A;  1VBB 3;  3H50 A;  4FO9 A;  1C3H A;  5BNP B;  3IMN A;  1ZRC A;  3CKH A;  5IVY A;  4CP1 A;  1RUJ 2;  1GAN A;  2ZX0 A;  4H14 A;  2DUR A;  5FWE A;  3MIE A;  1YJL A;  4RL7 A;  3ZXG A;  4Y26 A;  3VBO A;  1W3X A;  3Q8B A;  4DZG A;  1COV 2;  4UYB A;  1JMU B;  3J8F 3;  1US3 A;  1MR5 A;  1LHU A;  3UJQ A;  3D8C A;  3LAG A;  5FZI A;  4QX5 A;  4B4P A;  4NHL A;  2AEN A;  2XJQ A;  3N7K A;  2VBD A;  4LBL A;  4LLF A;  2V5Y A;  1UY0 A;  4LNV A;  5G04 L;  1LOC A;  4CYD A;  2BWA A;  4FP2 A;  4EJR A;  2YC0 A;  3O0V A;  3RGB A;  4HXC A;  3HIF A;  3O1S A;  2XBO 2;  1KJL A;  3OY8 B;  3SCG A;  4XJZ A;  4XUR A;  3TWI A;  2G4I A;  1IS5 A;  1W6M B;  3ZFE C;  3BCW A;  4TWT A;  4CP9 B;  2K2S A;  5FLH A;  1V9U 2;  1AXY A;  4P9I A;  1WBL A;  2OII A;  2V73 A;  1GP6 A;  4NID A;  5CAD A;  5EQU A;  1W8U A;  2D3S A;  3AMM A;  5H9Q A;  2JDM A;  1J58 A;  4DXZ A;  2P3I A;  5DAQ A;  2OXB A;  4FPY A;  5B4N A; 
#chains in the Genus database with same CATH homology
 3NNJ A;  5LAT A;  3HQR A;  2RG4 A;  4XAC A;  3ITQ A;  4UWD A;  4MHU A;  4MHR A;  2RDR A;  4JZR A;  3OUI A;  4Y5S A;  5A3U A;  3NNL A;  4NHY A;  5IAV A;  3W21 A;  5LBE A;  3BVC A;  4NMI A;  2JIG A;  3W20 A;  5LBB A;  2G1M A;  2OPW A;  4NHX A;  3EMR A;  2A1X A;  2FCU A;  3GJA A;  5IAX A;  5LB6 A;  3OBZ A;  2FCV A;  2FCT A;  3DKQ A;  5IAT A;  4XCA A;  5EPA A;  4BQW A;  4Y5T A;  2G19 A;  4ZPI A;  4XAA A;  5ERL A;  3PL0 A;  4IW3 A;  5DAV A;  2HBT A;  3GJB A;  2Y33 A;  5HV4 A;  5LAS A;  4J25 A;  5M0T A;  3KT7 A;  2V4A A;  3MGU A;  5C5U A;  2JIJ A;  3OUH A;  3NNF A;  5L9R A;  4ZON A;  2RDQ A;  4XC9 A;  5LA9 A;  5DAW A;  5DAP A;  3GZE A;  2Y34 A;  3NNM A;  4BQX A;  5HV0 A;  3KT1 A;  4NHL A;  5LBF A;  5LBC A;  4KBZ A;  3HQU A;  3KT4 A;  5L9V A;  2HBU A;  4BQY A;  3OUJ A;  4XAB A;  4XCB A;  5DAX A;  5C5T A;  2RDS A;  4NHK A;  4Q5O A;  5EP9 A;  5EQU A;  5L9B A;  4NHM A;  4NAO A;  5DAQ A;  2RDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...