2FCVA

Syrb2 with fe(ii), bromide, and alpha-ketoglutarate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
304
Chain Sequence
KKFALTAEQRASFEKNGFIGPFDAYSPEEMKETWKRTRLRLLDRSAAAYQDLDATNIANYDRHLDDDFLASHICRPEICDRVESILGPNVLCWRTEFFPKYPGDEGTDWHQADTFANASGKPQIIWPENEEFGGTITVWTAFTDANIANGCLQFIPGTQNSMNYDETKRMTYEPDANNSVVKDGVRRGFFGYDYRQLQIDENWKPDEASAVPMQMKAGQFIIFWSTLMHASYPHSGESQEMRMGFASRYVPSFVHVYPDSDHIEEYGGRISLEKYGAVQVIGDETPEYNRLVTHTTRGKKFEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords syringomycin biosynthesis enzyme 2
publication title Crystal structure of the non-haem iron halogenase SyrB2 in syringomycin biosynthesis.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Biosynthetic protein
total genus 100
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2fcvA00
3HQUA 3PL0A 2FCTA 3W21A 5IAVA 5HV0A 4XC9A 2G19A 4XACA 5IATA 3KT4A 3KT1A 5LASA 5LBEA 2RDNA 2RG4A 4XABA 5LB6A 4BQXA 4KBZA 5IAXA 2V4AA 2OPWA 5EP9A 3ITQA 5LBCA 2HBUA 3NNJA 3OBZA 3OUHA 2RDRA 4MHUA 2A1XA 3KT7A 2G1MA 4Q5OA 4NHLA 5DAVA 4BQYA 2Y34A 3NNFA 4NAOA 3W20A 2Y33A 4XCBA 5ERLA 2JIGA 4XCAA 2RDQA 3HQRA 2RDSA 4NMIA 3EMRA 5M0TA 3NNLA 4XAAA 5DAWA 4NHYA 3DKQA 4BQWA 4J25A 2FCVA 5L9VA 4NHMA 3GJAA 5EPAA 5LBFA 4ZPIA 3OUIA 5HV4A 5LA9A 3OUJA 4JZRA 5L9BA 5LBBA 5L9RA 5A3UA 4IW3A 3BVCA 4NHKA 5C5TA 5C5UA 2JIJA 2HBTA 5EQUA 3MGUA 4NHXA 4Y5SA 4ZONA 5DAXA 2FCUA 3NNMA 3GJBA 4UWDA 3GZEA 4MHRA 5DAQA 4Y5TA 5LATA 5DAPA
chains in the Genus database with same CATH superfamily
1D2SA 1PM7A 3BIEA 2VU9A 4UBHA 4GQ7A 4SLIA 3WW3A 3KF5A 3RS6A 3T0AA 3ZFFA 5CBLA 1W6PB 4YYOA 1MZFA 1XOYA 2VGDA 4Y1XA 1RUE3 3M4FA 4AOCA 1QJU1 4RHV1 3AFKA 4A41A 4FPKA 1IKPA 3HMYA 1HB3A 2KD7A 3HT1A 3KCXA 4XACA 4MADA 2ZJCA 1JI6A 1HJGA 4QQ2A 2R32A 2ZZQA 4OI0A 1NX9A 2PLV1 4O65A 3SEPA 5A6QA 3E97A 1H8TA 3RPQA 1HXS3 3AM2A 4R4ZA 3ILNA 4B4PA 4D8MA 3N7KA 5FZBA 1L7QA 2DVAA 1N47A 1ZZBA 2ZS6B 2HH9A 1V9U1 3POIA 2BVVA 3POWA 3WDVA 5FZ0A 1XYPA 3FHIB 4X6QB 4ZU4A 3EJKA 1OOPA 2IXJA 1XYNA 4QKNA 4KWJA 1ZBA2 2JJ6A 2DF7A 3HNBM 4RFT0 3U37A 4CUCA 4Q0PA 1PK6A 2VXRA 1BYHA 1ASJ2 5CFCA 3J8F1 3I54A 2HLEA 5LEKA 4QX5A 4QU1A 5FZOB 2RS53 3MIBA 1BHGA 2FBEA 4DEVA 4EWEA 1GFF2 3K4AA 1VBE1 5FY0A 2XGXA 2D6LX 5DG1A 2JE9A 1CIYA 2JEMA 4L8QA 5DABA 1YCIA 3SLIA 2P6CA 3KQ4B 4ES9A 1U5XA 4Q1PA 1Z7S2 2IXKA 2Y0IA 3HQRA 5FZ8A 1QJEA 2RS13 2XVKA 4XAEA 3ZX7A 4LBLA 4AHZA 1NQJA 4RR3A 3CNAA 4LK6A 5DAWA 5APAA 4Y1YA 1IZ3A 3LEKA 2K46A 3JUUA 3LPFA 1HJFA 4HBNA 4XF9A 5L9VA 4NHMA 3GJAA 2E33A 5IJRA 4WVWA 1F5FA 1LOAA 3K75B 1Q3EA 5LBFA 4HZFA 2TEPA 4AVCA 4A4AA 2UWCA 5DUVA 5FO8B 4CU9A 4L2NA 1ZM1A 3ZXEA 3ZMOA 2VTXJ 1NKGA 3WHTA 4XJ9A 3SQOA 4Y1VA 1REEA 1HQWA 4AQTA 2NLRA 2NP0A 5T5JA 3PIGA 3MF6A 1MQTC 4MOAA 1NY71 5A70A 3ZXDA 5A7QA 1XNBA 2ZGOA 3R4SA 4BIOA 1C3HA 1MQTB 3BU0A 2CAUA 2XVLA 3AL6A 3HEIA 3N9OA 1XPWA 3VZLA 1FOD1 3UGFA 3E6DA 2MHFA 4Z2WA 1BK0A 2NN8A 2P3KA 3ZYJB 2DUOA 1W6NB 4IERA 4KNCA 1RXFA 3T0BA 5AVPA 3JQXA 2JDYA 2RS33 2ZCWA 3QLQA 1LOEA 4FPOB 3BTXA 1AYM2 1OKQA 3PUHA 1RUH2 1JMUB 2J1UA 2XJSA 1SBEA 4IE7A 4KG8A 1U0AA 2YBPA 3KVBA 4N9IA 1E5SA 1RINA 3S5AA 4HVOA 1UKGA 5T5OA 3FE5A 5L7OA 4GULA 1OXCA 4IEPA 4NPLA 3NJVA 4UFJA 4DO0A 2PQSA 3SCHA 1H2NA 1UXXX 3D82A 4QXKA 3AP6A 4UFKA 4XJWA 1KD7A 1JYNA 4BE3A 2EVXA 1DYPA 4XFCA 3IBMA 1UZWA 4CUGA 4FI9A 4Q4X1 5F5CA 3CZUA 1HDKA 1H4GA 1KJLA 2ZGMA 1FMD1 1W9FA 3PURA 4EN7B 4I0AA 1BQPA 4HK9A 3OJBA 1PGW1 4AVBA 3EO6A 1RITA 2C9KA 2HWC1 1WCDJ 1H1MA 1RUD2 1JU4A 1T6GC 3O1RA 4CUAA 4OUSA 1COV2 2ZX0A 3M3IA 1SG3A 1O8PA 5JPMB 5EP9A 5FZ3A 3AP9A 4W6WA 3VBSA 1BZWA 2K2SA 1AR63 2EA7A 4I0BA 4IEZA 2A6VA 5FPVA 5EZWA 2MEV2 4CEWA 1DLCA 2V09A 2YB7A 4QQHA 2W3JA 2WNUA 5GLWA 2JX9A 3VBFC 4QDRA 5B2GB 2D7FA 3P5BA 2ZEXA 4YLZA 1TME2 3VBFB 1LU1A 2NMOA 2IZWA 2WZEA 3INAA 3NSTA 3VHOA 2Z69A 5LA2A 1LGCA 3P6BA 3VHNA 2DUQA 3WNNA 5A33B 2VZSA 1NYWA 2GALA 3MW4A 3USSA 1IS4A 3HVDA 1YQ2A 4K3UA 2A3YA 2RMU2 1EAH3 4JKMA 3G7DA 1SDDB 2AEYA 1WLDA 4H7MA 5FYUA 3ZR6A 3NV4A 1UNBA 3W9AA 4RS5C 3RYPA 3WG4A 2MNGA 5FYYA 2AUYA 3QCWA 4QGLA 1QH7A 5GZGA 1IKQA 2AGSA 4RS5B 5IVEA 3NNLA 1EPZA 1R093 5JSRA 5LEJA 1R1ZA 4LUMA 3UGGA 1K5MA 4I09A 1JZ2A 1US3A 5IWFA 1QMJA 4UFLA 3VDAA 3ZFGC 3ROUA 3NJYA 1G7YA 2BTVC 3ENRA 3LCPA 4FT8A 1CJPA 2Y6JA 3T2PA 4AZZA 3ZFGB 3HQXA 3APBA 4ATFA 4L0PA 1QJY1 4CCJA 2Y6HA 2PTMA 4COUA 2QQLA 3ZKUA 4XHXA 3NNGA 3DL3A 1EUTA 4UFMA 3OG2A 4CRQA 4E4ZA 4DZGA 1TMF1 4FTBA 1LEDA 3S30A 3WDXA 3ZKYA 2VTFA 3OUJA 1Z0HA 4EWAA 4RN5A 3I2FA 3UETA 2E31A 3IMMA 3K3OA 1PZ9A 4Q4W2 3VUOA 3VD5A 3LPGA 1BK1A 1RUNA 4NHKA 4HKOA 3V0AB 3CEWA 4ORFA 3P1IA 2WA3A 3HBKA 2VZUA 2P3JA 5CYYA 4CCEA 1AL22 1SLTA 1YC61 4HPKB 1RB8G 2WS91 1VBB3 3WW2A 2ZXQA 4X8NA 3TEWA 1VBD1 2XR4A 2BNNA 2XJQA 2A73B 1LHOA 2UY9A 4QQOA 4Y1UA 3TN91 2FDGA 2FDIA 1O6UA 1IS6A 4MHRA 4MV2A 2F6BA 2EF6A 2QCSB 3OY8B 4LEJA 3E6CC 1GUIA 1RUJ1 2RJ2A 5T50A 2XMLA 4H55A 3V65A 2QQPA 1LAJA 2WT1A 1HRI2 3PNAA 4AI9A 2CSGA 1PO22 2VXJA 2ERFA 4F7ZA 2IVIB 3VBOC 1C8NA 1OLQA 4JQTA 5IAVA 4LOSA 2FDFA 5HV0A 1H9PA 1IGOA 1KS5A 3VBOB 3VKOA 5IFPA 1NLRA 3IIAA 1Y9MA 1H4HA 2W1WA 3ZPOA 1NCRA 1MACA 3UYJA 3IDEA 1YUDA 1DP0A 1N1YA 5FY4A 4MXVA 4NN0A 1ZBE3 2BGOA 5DUXA 4LKDA 5FZ7A 3MIFA 3IDCB 1OA3A 4Q4Y2 4JHZA 4GJZA 1YQ8A 5EXOA 2X05A 2HBUA 4V2VA 4YVSA 5D21A 1EUUA 1UXZA 2EICA 2O8QA 3Q8FA 3V64A 1HN0A 3ACFA 3WD5A 4BYYA 3THDA 3H3LA 4IE6A 3KT7A 2G1MA 2GC1A 5FZMA 4XJ8A 3ZXJA 4EN0A 1W0OA 4GB33 1AYN1 2WBKA 3WLUA 2VC9A 3ZXGA 4XF3A 1OLME 1XRUA 1I1EA 2YHJA 1QXJA 3A0KA 2QVSB 3CBNA 5FZ9A 4AHXA 3NO8A 4FAGA 5CFDC 2JDZA 3AKRA 4JDMA 3GBFA 5HBAA 1UY1A 1QQP1 2BRTA 3KWVA 5ACA2 1AX2A 5IK8A 5CFDB 4BB3A 3W5NA 1ACCA 4MYEA 3RWNA 2VUDA 3D8CA 2JDAA 4OFGA 3LKJA 2DVBA 2OUJA 4Y5Z0 1DHKB 3B3QE 1XJAA 5KWRA 4Y20A 3MLJA 5KC6A 4QMAA 4AQ6A 5IYYA 3H3ZA 4LHSA 1IQAA 2I74A 5A3TA 3I59A 2DVFA 2VBPA 3ETPA 2W95A 4JTOA 1CPMA 5J96B 3PHMA 4XZPA 1AR81 1QIQA 3CZJA 3VBRA 5A1AA 3LIHA 4N7UA 4S2HA 2YV8A 1BEV3 1WMXA 4E2SA 4HKWA 1CX1A 2DCYA 3H50A 2H0BA 3MFAA 4HONA 2ADDA 2CY6A 2OS2A 2ILMA 2BOIA 2B8MA 2HKXA 3CJIA 4BIFA 3N7JA 4LBQD 2WN3A 1PO12 1JOPA 4AW7A 2DDUA 3QACA 5C5TA 2DCZA 4IE5A 1Q8QA 1EV12 4ZY9A 2X5IA 2WLPA 3IIIA 3MYXA 5FXXA 1W8UA 2OZ6A 4PBPA 3R4DB 3GALA 3VD4A 2DU1A 2IXCA 4DFSA 5E89A 4CPBA 4OULA 1A8MA 3DGTA 1LRHA 3K4DA 4LXLA 3NRUA 4P08A 5T5LA 2O14A 1J83A 3LFIA 3NV2A 4XQWA 2DTYA 3NQHA 1PIV2 5E16A 4RGAA 2D6MA 4BZ4A 4QXBA 1VR3A 3A7QA 2VOVA 4MZUA 1OPMA 4GKYA 1GNYA 2PHUA 2W5FA 4Y5TA 1ZBA3 3KV4A 3PVEA 1QKQA 2ATFA 4OZOA 1MZ6A 3AJZA 4Q0VA 1STMA 2GZWA 5F6LB 2RS52 3T08A 1HW5A 2XJTA 4K7JA 4QPGA 3RYRA 5C3QA 5C3OA 1LGBA 4DPNA 2HWD1 4IEYA 4MG2A 4BQ5A 5LK7B 5HCBA 4AI0A 4Q4V1 2RS12 2GDFA 4QM9A 1AL0G 4UW6A 3IKWA 1NCQC 3THTA 2WABA 2Y60A 4MO3M 1Z7S3 1CGPA 2ET1A 2R0HA 1DGWX 1J84A 1NCQB 2RDNA 3AMMA 3KQRA 3TRSB 5FY5A 5LB6A 1BVVA 3UKVA 1O3SA 4BQXA 4SBVA 1BBT1 3BCWA 4INDA 3NJZA 2OPWA 1UX7A 2W52A 4QPYA 4CEYC 1RUI1 3OGSA 5EJZB 2XKOA 1LNSA 1LU2A 3NNJA 4YPJA 4XUPA 2QQNA 4CEYB 4PLNA 3Q8CA 3TBDA 4QQLA 1C5IA 4QKDA 2P34A 1VP6A 5AC91 1K5JA 3ON7A 2VUJA 2WT2A 2AREA 2ZGLA 3OTFA 4XTMA 5J48A 5LRSA 5DAVA 1LHWA 1O91A 2L9LA 2ZAHA 2Q1FA 4P9LA 2ZKNA 4FO9A 4XCBA 3RG0A 2CDOA 4PCRA 3DKWA 4UI9L 3C8XA 1GOFA 2WLQA 4UW4A 5FP4A 1PMJX 1MPXA 1OLMA 4FVVA 5JOZA 1YFUA 1OD3A 1OLRA 1G8WA 1WZXA 1OPOA 1YQ6A 3K48A 4CCNA 1AYM3 1RUH3 1C8M2 5FZFA 2XQXA 5D8AA 2GNMA 3LDKA 2PXJA 2VR4A 4GWJA 4CE8A 4F3JA 2Y6FA 1AUYA 4N8MA 1SACA 2JE8A 3OB8A 5FP8A 5ABJC 4CSWA 1CR7A 4MVTA 5JMOA 2Q8DA 3I49A 2WYFA 3FBMA 5ABJB 4OZXA 2VCBA 3LSEA 3NKTA 3WY6A 1W6NA 4FQ4A 4A7YA 3ZYFA 2ZHKA 3HJRA 1QDOA 4D7TA 2NMNA 3T09A 1XSRA 4K20A 1CD3G 4OVEA 1KDKA 3SC7X 3HNYM 5ANNA 4N9HA 4LO5B 2WSVA 1O4YA 4A2UA 4AGRA 4BDVB 2VVEA 2NZ9A 1UZZA 3ZXFA 4JGYC 3MW3A 5FY9A 4CCCA 4CU8A 2JIJA 1CESA 5FYHA 4CTEA 4JGYB 1PNFA 4LORA 1QNWA 3IMNA 5FYVA 1RUD3 5H9PA 1Z78A 2BNOA 4M00A 5JDBA 5JR2A 4Y5SA 1ZZ6A 3OGVA 1F4HA 1PZ8A 3GBWA 2XBO1 4QKFA 4JC1A 1AR62 4DINB 3MV01 1O3TA 5JVVA 2I07B 2B5HA 1VBA1 4FFFA 5DMYA 3OOXA 2MEV3 2VCMA 1MEC3 2DYCA 2J1TA 1W9YA 4FAHA 5DUUA 2MPFA 3WP3A 2A3WA 4WM7C 4EN8B 1PHMA 4BQ4A 2JXAA 1TME3 1KFXL 2BVBA 3AKPA 1E5RA 3H3UA 3JD73 2VQTA 4WM7B 4W8JA 4B3NA 1IS5A 5L36A 2Q8CA 4C0HA 3WP6A 3VKMA 3RZZA 5AFEA 3GZTB 4UFIA 1RMU1 2XOMA 2RMU3 4E4SA 1LOFC 1Q56A 2AYHA 2VO5A 5DN2A 4XYXA 3ILRA 3IT8A 4MGIE 3OYWB 1UU5A 4L99A 1HB4A 3N4MA 4Z92B 4YWAA 2WNVC 4MSVA 5J1XA 4YW1A 2JG9C 3IDBB 1GU3A 3FMGA 3BODA 2WNVB 5EJ1B 3FHQA 3ZSMA 3HNMA 3I2HA 5DDJ1 4NE9A 4OMDA 4B1MA 2JG9B 2D3SA 5A33A 5HXVA 5GM0A 3E5UA 1FPN3 3OBZA 4CP9B 1ZRDA 1RVF1 1W9WA 3ZLIA 5FY1A 2XLGA 1HRV1 1CX4A 1RUF1 2A1XA 2EAAA 2OX0A 5GJ6A 1CQ9A 4CZSA 4OHVA 2ZTNA 1DYKA 1R083 4W50A 4UW3A 4QX1A 3UK9A 2BPA2 5BNQA 3O0WA 3AB0A 3HT2A 2ADEA 2HEWF 4YSFA 2CV6A 3T2OA 5CKMA 4JGZC 1DQ5A 3ALQA 4QB6A 1GICA 2W87A 3MO4A 4R8HA 2GN7A 3ZFGA 4CCDA 4TN7A 4C8DA 3BALA 4JGZB 2WFF1 3UGHA 1YNAA 4QXCA 2LW8A 2HWB2 2XL7A 4FXGB 2ZBJA 1AL23 3O1VA 1PVC1 5I0TA 2JDMA 2P4EA 4QHBA 4RSUA 1LJ7A 1XE0A 1W90A 4BOWA 2P3IA 3DKQA 1GMMA 2C4XA 3VN4A 5DPNA 3ZR5A 3ACIA 3RRDA 4IL7A 4URTA 2XG3A 1NZIA 5FPXA 3V0AA 4TWTA 4AI1A 1A34A 4H7LA 1IPKA 2UWAA 3JBG1 4DMIA 5H9QA 4C1WA 3RDIA 1SPPB 2DCJA 3ACHA 3FLPA 5C3SA 4HPKA 1HRI3 5C4WC 3LFMA 3K4ZA 1PO23 1W2OA 4AR2A 3FN9A 1ULDA 4PDWC 3RI9A 4QM8A 1WD3A 3ATGA 3UV9A 1AVBA 5C4WB 1KITA 4PDWB 3BPZA 3O5SA 5DZGA 5JUVA 2VZ1A 1OVSA 4P9XA 4RQPC 3BVCA 4BH9A 4EQVA 1FAYA 2XHKA 1SEFA 3FHAA 3IAPA 1DQ6A 2P2KA 4RQPB 3NV1A 1LEMA 1V6MA 2W39A 5LK5A 1HB1A 2RVAA 4AEJA 5FR3A 1TMF2 2E53A 2JB8A 3GJBA 5SV5A 1S0BA 4YW7A 4K9SA 5DZFA 4AEDC 3K51A 1HIXA 1AF9A 4GB32 3HOBA 4LIVA 4AEDB 4F8AA 2OW4A 1RUE1 1V70A 4M3CB 3IAQA 4GMP0 3N7MA 4EV0A 4NRQA 2JKXA 1MZ5A 1WCQA 1O7FA 3ST7A 4EROA 3U0ZA 2FDKA 4FXKB 3AXEA 1QJFA 4Z07A 3ABZA 1KRIA 5ACA3 1VBD2 2XPJA 4LBQB 3U10A 3H1WA 5L19A 2CDPA 4Y24A 1OUSA 1VRH2 1P8JA 5FZCA 1HXS1 3OPWA 5A6XA 4FPFA 1SCSA 1UOFA 2XVGA 4BXSV 1JYIA 5GALA 5FBZA 1QOSA 1UOGA 4PI2A 3D0JA 2VECA 2CGNA 1UAIA 1F4AA 1GWKA 2D6PA 3AVSA 1N1VA 4QGNA 4DRVA 3OF1A 4IETA 1GWMA 4KBZA 1AX0A 5KHJA 4XE9A 4JKLA 4WVZA 1D4M2 2C24A 1S4CA 4KGGA 1BEV2 4QX7A 3TOJA 1RC6A 2TUNA 4XZUG 4XW3A 2HEVF 4COYA 1RL3A 2R062 2DURA 4NHLA 4B7EA 3A23A 4OHXA 2PN5A 5EYYA 4LJHA 3RJ2X 1CONA 3PU8A 1W9TA 4KH9A 2ZGKA 4GXLA 3WVJA 4ZZ8A 1UYYA 3Q9OA 1B09A 1PO13 3VDDC 2EXIA 2VUCA 3UNPA 1BMV1 1GV9A 3O1TA 4QX8A 1EV13 3D6EA 3OSDA 4MX3A 1UY2A 3VDDB 2JIGA 3POBA 4XEZA 3B93A 3ZSLA 1POQA 1EY2A 5FZEA 1AYN2 4E27A 1X82A 1SLAA 2HWF2 2BUKA 3EB7A 1NE6A 1HV0A 4GMP3 1PIV3 3THPA 1XSQA 3ZO0B 5FWJA 1Y9GA 4WV8A 3AX4A 3AZVA 2QTWB 3AMHA 3ZYGA 2RJKA 1QQP2 3PLQA 2EALA 4QDSA 1FYUA 4LITA 2GC0A 2JG8C 3B9IA 1MS9A 1W03A 1Q8OA 2ENRA 2QQJA 2R7EB 4AI3A 3FC0A 3M3EA 4NVPA 5FLJA 5KR7A 2JG8B 1GKBA 2XONA 1RUOA 1ZZ8A 2G4IA 2FZ1A 4G9SB 5CKQA 3ZDSA 4YG6A 2B4KA 1W8HA 2W9XA 5F8PA 4A42A 5FOJB 1JZ4A 2RS31 4J1WA 3RJRA 2Y6LA 1H0BA 4CP2A 2QQMA 3C7GA 1REDA 4HN0A 2KA3A 2VD7A 4J6GA 1HLCA 4R9CA 3GBGA 4B4QA 2VG9A 3WNPA 2BDRA 3E6BA 2WWUA 3VDCA 2JKBA 3NNMA 1ULGA 3E5XA 4EJRA 5KHIA 1MR5A 4OUEA 1RUG2 2OQ6A 1W2AX 1C5HA 2UURA 3K2OA 4AK3A 1PMHX 2K0GA 2WWJA 1WBFA 2W08A 2I2SA 2W47A 3UKTA 3F2ZA 4TLFA 3POEA 3PJYA 5DAQA 2VL4A 4HL0A 3UT0A 4CDWC 5LATA 1NCQA 5F3CA 1B35C 2EXHA 2PLV3 2ZX1A 4CDWB 3ES1A 4Y1ZA 5JWPA 2D6NA 5JZGC 3BGAA 2QNKA 1B35B 4NAMA 5FKBA 4GH4A 5BYNA 5JZGB 4BK5A 2YPJA 4OMCA 3KV6A 3SH4A 1LOCA 2D43A 3I2IA 4RA0A 2OIIA 1W05A 1WW5A 5AFBA 4QU2A 3KT4A 4UBGA 4OHWA 2ARAA 5LASA 3C7EA 5LBEA 3M70A 1UD1A 3H8OA 1NUKA 5A7SA 2WWSA 1C8M3 2CHHA 4LMFA 1JUIA 2D3RA 1WGPA 1QGLA 2E51A 5JR7B 5GLVA 2YC2A 4AVTA 3N35A 4QPIA 1G9DA 2GMMA 3F95A 3OUHA 5K4LA 4FP2A 4EN9B 2YDEA 1VBC2 1LCLA 3JZVA 5LRRA 4W6YA 2CU5A 1XXNA 1SBFA 1ND2C 1G6NA 1Q8SA 1EAH1 2VNVA 1S0EA 2XJUA 1VRBA 1ND2B 1WUVA 2JWPA 3RI8A 3SISA 3SNMA 5IVJA 3O12A 4XETA 2GN3A 4R9AA 4NO4A 5BV6A 5J3UA 2ZEYA 4XTPA 1JHNA 4NOTA 4P9YA 1DZTA 2RR12 3AKQA 5FYMA 4Y4RA 2FZ2A 1D7PM 2EIEA 4BMEA 5FY8A 2FQPA 3NAPC 1VAMA 4BHPA 5BNOC 4JHTA 4YZ2A 3WG1A 3C7OA 4AQSA 2Q1ZB 3NAPB 4YW2A 1JODA 5BNOB 5IVVA 2P6HA 4D3WA 1DDLA 3SXWA 2R1BA 3SEEA 4YZ5A 3VL9A 4CDXC 1MEC2 1J3QA 1L7LA 2W46A 4HXCA 2PYTA 4DEQA 1ZRIA 1AX1A 4YM2A 2FMYA 5KXCA 5EPAA 4IV3C 4CDXB 4Q26A 2WZ8A 3AP5A 2E63A 4WM8C 3X29B 4XJZA 3JD72 4IV3B 4JGYA 2QZ2A 2BOJA 4NUBA 3C7HA 4TYSA 4WM8B 3K77A 1FOD3 3WQBA 3ILFA 4FPYA 4M3CE 2BFUL 5B4NA 1UOJA 1W8ZA 3CF6E 1SLCA 4JRAA 5FP9A 4QQPA 3SHRA 3ZXKA 2JICA 4NPMA 4PJYA 3EQEA 1OD5A 2JDNA 5L9RA 1J3PA 1VBB1 3S5QA 3VD7A 4ZKTB 1YWKA 1NXMA 4JV4A 5HPOA 1GZWB 1E5HA 1YIPA 1BLZA 4QHOA 1VMJA 5FK7A 3GNEA 2C26A 3N9NA 1JHJA 4WVVA 3NMBA 4CU6A 3PDQA 1U5YA 1FPN2 4IE4A 3O0VA 1MVQA 5BNNC 1XBFA 5JSPA 2XLFA 2WO7A 3AMNA 3POGA 4CDUA 3HR9A 4Y26A 3VHRA 1ZNPA 5KC5A 2GC2A 1HX6A 4RL7A 5BNNB 4AI8A 1C4RA 1W6MB 2R49A 4AVSA 1R082 2ZMKA 2SBAA 1SHWB 2X09A 4XPVA 1UYZA 1XE8A 1F35A 1QOTA 2D40A 2ZPXA 4XMAA 3O1OA 2VMCA 4N43A 2WZPP 1E5IA 3S57A 2WUHA 4DNYA 1GOGA 5FMDA 4HN1A 1JOBA 1POV0 1NT0A 3KMHA 4ES8A 2X10A 2ZGUA 2IWGB 2WQ8A 2R071 4GD4A 1OVPA 1ZZCA 3ELNA 1LB2A 3PMEA 2OYZA 2JENA 5KHGA 1ZBE1 2G9FA 2YU2A 3O14A 5I0UA 3LA2A 2RM22 1Y3TA 2HWB3 5IATA 4LKEA 4LBKA 1YJLA 3J7LA 1RYYA 2JD4A 2ARXA 1KQRA 2AZ5A 2W1SA 4YARA 1HV1A 2IXIA 1NQDA 2WIIB 3JXSA 3MW2A 4FBFA 4JAAA 2W0XA 3U4SA 5C9AA 2X29A 3LSDA 3P3PA 5FQ0A 4DY3A 3IPVB 3WW4A 3FFQA 2DCKA 1CN1A 3I7DA 2IFWA 3Q8EA 3DECA 3LWCA 1RMU2 1DGWA 4IEWA 1UZYA 3U1XA 1XYOA 4B7KA 3BTYA 5A32A 3RGBA 2E7AA 1TVGA 2VZRA 5CB7A 1LGNA 3WCSA 4AHYA 2PAMA 4GALA 2DWRA 1CZVA 2Y8KA 2FD8A 4HMZA 1GBGA 2D44A 5FZLA 1IOAA 2TNFA 3IWZA 3NKGA 1M06G 3MFCA 2R041 4IQPA 5FPUA 4PLMA 1ZA4A 4ISRA 4TXWA 1UY3A 1YFYA 1R1A2 3BPSA 1OA2A 1V6IA 4LBMA 5T52A 4OCTA 3LE0A 3W59A 1ND3C 1KDMA 1JU3A 3AMQA 2RHPA 2I45A 3OEBA 1RUF2 1ND3B 1SPPA 2F4LA 4FOQA 3WF0A 4NMIA 5DXDA 3I2OA 4BMBA 1CAVB 1TMF3 4X6RB 3MIGA 1ZRFA 1RUC1 4AVVA 3T2QA 5BNPC 4PDWA 5JXHA 3B00A 4A6SA 3HBZA 1SFYA 5FREA 1NA1A 4TTGA 2VBBA 1CZSA 1POV3 2AENA 5DG2A 1WKYA 4AG4A 5BNPB 2PELA 2BBAA 3B02A 3D0SA 4P5HA 1WLWA 4RQPA 1MS3A 1PX4A 3VZOA 1AR91 1RHI2 1WW7A 4XDOA 3AZYA 1UYXA 2VCAA 3U07A 1G9FA 3W5MA 1DGLA 5DZEA 3FFZA 2WT0A 1UU4A 1WD4A 4F83A 1VBD3 1YFXA 1PMIA 2PA7A 4BU2A 1JZ6A 5F9TA 2WINB 1VRH3 1K3IA 4D6QA 3A21A 5A3UA 2LALA 2KXLA 2WC2A 4AEDA 1NZCA 2CTVA 5EQUA 2XB6C 4AQ2A 5T3NA 4AFAA 2JDUA 4M3CA 1V6KA 1HQLA 4NHXA 2D93A 4CDQC 3DYOA 5JXGA 1RJ7A 1ZBA1 1REFA 2Z42A 4E9KA 2VNOA 4I3GA 2VULA 2RJLA 4GA9A 4XQ4A 3HWJA 4CDQB 3T2TA 4PQ9A 1ASJ1 1CAWA 1D4M3 1DQ2A 1O3RA 4LO8A 4P9GA 1AR72 4Z8BA 2VJXA 3OGGA 5FWEA 4Y3OA 3ZYIB 3CHXA 5DUWA 1GP4A 1H30A 2R063 2XH6A 3QOPA 5FKCA 1EYBA 2GU9A 1DLLA 5H9RA 4B4RA 5FZ1A 1PGL2 2QFEA 3J7HA 1SBDA 1Z7S1 5GZDA 2KR2A 3DPRC 4K1YA 3SCGA 3D3AA 4LA2A 5F3EA 3ZXLA 5FZKA 2A70A 4A3ZA 3DPRB 5FPBA 2VW1A 1ZRCA 1QXRA 3AC0A 5FFOC 1VAKA 2ZKLA 1QY4A 4LLOA 1CPNA 4ASLA 2VZQA 1W6PA 1V0AA 2VTXA 1OOPC 1WLCA 1AYN3 1I6XA 1N1TA 2WRAA 3AFGA 3OBAA 5LWBA 3N9QA 2ZX2A 2HWF3 2BGPA 1W04A 1JW6A 3PIJA 5JLVA 1OOPB 4YZ4A 2BWCA 1OQEA 3DXTA 5CZKA 2DV9A 5FV3A 1YQ5A 2DFCA 3ZSJA 2E9QA 2HWE2 1QQP3 3M3QA 5C6CA 3SKVA 2CNAA 4EZ4A 2WA4A 3OBRA 1S0GA 2V73A 2BQPA 1WCKA 2ZGNA 3LA7A 3VDDA 4AGGA 1X9TA 3FX3A 2VPVA 4XOGA 4BLJA 4DUVA 1LECA 2NYYA 3BTZA 1H1IA 4XURA 4WZFA 1XU2A 3H42B 4Y22B 5FLHA 3I3MA 3RZGA 5FXWA 1UIJA 2BZDA 4KL1A 4RR3C 5A3LA 1WW4A 2D98A 1QJX2 2DCTA 4S2DA 2A6WA 4BISA 4IEQA 1AYM1 1RUH1 2WZR2 4RR3B 2ZGQA 5C8CC 4B8EA 5FUIA 1MZEA 3BOPA 1AR83 5C8CB 2RDQA 4IV1C 3LEGA 2P17A 4PLOA 2C9AA 5FZOA 1AZDA 4D6RA 2VAUA 1L3JA 2KM2A 4IV1B 3B94A 4RD7A 1HN1A 4AGVA 4QPWA 3C3VA 1FT9A 1QJU2 4RHV2 1RUG3 3NJXA 3PVBB 5E8AA 4BJ0A 1CAXB 4C90A 3KGZA 1JZ8A 1Y43B 1EP0A 3FJSA 3J4UH 2PLV2 4HVQA 1UU6A 1JS9A 5A7OA 5IT6A 5CU1A 1ALYA 2VZVA 1X36A 3GHNA 3T4VA 2WL1A 4DUXA 4P14A 4P00B 2IVJA 3BN6A 4HANA 2GP3A 2YGLA 4NJ4A 1VB2A 4AFMA 4DUWA 1UZ0A 4V2WA 3ZFEC 4A44A 3VL8A 1RUD1 1V9U2 3MI8A 1QNYA 3ZFEB 2EXKA 3AZZA 1COV1 4KQ7A 5CEHA 1D0HA 3MUY1 3ZIXA 3B7MA 3N9LA 4RGGA 5FZAA 4D0QA 5LY2A 4E2GA 1FNZA 3MGUA 3R05A 1RGSA 1E57A 2MEV1 3J8F2 4CDWA 1ENQA 2O1QA 2PAKA 4FPCA 4TSVA 3POJA 5L7OC 1MQTA 4ZONA 2HJIA 3BU7A 1VBE2 5L7OB 1JZ7A 1W8WA 2G9ZA 1TME1 4LO7A 3I3DA 4PF1A 4UWDA 4XUTA 2B7YA 1YQCA 3MLLA 3OD4A 4GZ9A 3WHUA 5A6ZA 4G3YC 4Z2AA 5I91A 1US2A 4NWWA 2A3XA 4MGQA 1VBC3 3TYJA 4IXLA 2Q1MA 1JBCA 4FPHA 2VZ3A 2BBVA 4ZZ5A 3O1UA 1UY4A 2RMU1 2R16A 2VQ0A 5JOXA 1RTVA 1GZTA 1N3PA 3AKSA 3OEAA 3RZMA 3CKHA 3AJYA 1XQNA 4QX2A 1QEXA 1V00A 4XQDA 3W21A 5ISLA 2RR13 2CGPA 4QX3A 1PNGA 4IEVA 4BM8A 4J1XA 2K9ZA 3VBSC 3H0OA 1JXNA 1YEWA 4I3PA 4Q29A 3U78A 1S2KA 2WAAA 3RZKA 4DOUA 1GR3A 1UCXA 5CIRA 3KT1A 5FYBA 3VBSB 4ASKA 4CUBA 3S6PA 4CEWC 2WQZC 2E6VA 1FX5A 3KCCA 2A6YA 2YMZA 1NY72 1ND2A 2YXSA 3QBQA 5A6YA 4YVWC 4UF0B 1LHUA 1ULEA 1UO9A 4ZS3A 4CEWB 5FTTC 4HETA 1OHFA 4YVWB 4XFHA 4CP1A 3MPPG 5LBCA 1QH6A 5A7NA 2VCCA 1ENRA 1FOD2 1ZYBA 3HIFA 2XQRA 3GF6A 3U14A 4XVHA 3PTRB 4Q4W1 1W28A 3WP4A 1G9CA 1O4ZA 2ZMLA 3NAPA 1GP6A 3UJQA 2LS6A 2VE1A 2EAKA 1S0IA 3T1LA 4AAXA 4BPZA 2JD9A 1DG6A 1QXPA 1N3QA 1VLNA 3AK0A 2DVGA 1AL21 1UMZA 4HSJA 4NAOA 3CDZB 2CGOA 1UQXA 2JDKA 4K8FA 4CDXA 3LEIA 1K5MC 3VBFA 3BYWA 1CAUB 4W4ZA 4JQRA 4COWA 5FZ6A 4IV3A 1UX6A 1K5MB 3ES4A 3CIHA 3H8UA 1SZBA 1QOOA 3VBUC 1UKRA 4IUGA 3AYAA 1MS5A 3VKFC 3GDBA 3RVHA 1UW8A 3ACGA 4QXHA 4Q4X2 3VBUB 2JECA 3ZN5A 2Y64A 1AHSA 4I02A 4NHYA 1LOGA 1FMD2 1HRI1 4WVMB 1PO21 3WDUA 1PGW2 5KXBA 1C1LA 4RS5A 2BW8A 4DB5A 4BWOA 5F5AA 2V5YA 2HWC2 3RZLA 1DQ1A 4JDNA 2Q30A 3KHCA 5LW9A 2OVUA 3FUQA 3KCYA 1W2UA 3OUIA 4LHNA 1FNYA 4G4FA 1JYWA 1UY0A 2D97A 3WF1A 1Q8PA 4R9DA 3QH6A 3TB0A 5FYCA 1LHNA 1N3OA 1U12A 1ZZ9A 2J7MA 1A8DA 2XBO3 5GZEA 1ZRRA 2SLIA 4O7XA 1BJQA 3HN3A 4IE0A 4JZRA 2Z4FA 2O0OA 4KWUA 1VBA3 2UU8A 3OPTA 1W6MA 1KGYA 1TZOA 1ZVFA 1YO8A 2G9GA 4K8RB 2RM23 4Q4Y1 5FJKA 4AAPA 2Q0AA 4EZHA 1D4VB 4NPRA 4O9EA 4X8PA 3WEZA 1A6CA 4HOOA 3I2KA 1JZ3A 2Y38A 4HT1T 5T55A 4P5YA 4NRMA 3M3CA 4UT5A 3GGLA 2YG0A 4YGCA 5A1LA 5K8SA 4DXTA 3MZHA 4IDZA 4YFWA 1G9BA 3GXUA 2CAVA 2AEZA 3KVAA 5C3PA 1TE1B 4D6SA 1RMU3 2JDPA 1PM4A 5EYXA 3IM0A 5JI7A 2WJSA 4Q8KA 1BCXA 5ACA1 2BYVE 4GIQA 1FATA 4XJUA 5J36A 1JTZX 3B5LB 3BB6A 3LQCA 3HQUA 3G6JB 1YHFA 4ZU5A 4CU7A 5FYIA 3OBTA 5IHRA 1UPSA 1NCRC 2JE7A 1UMIA 4W6XA 2ORXA 4NIGA 2WKKA 5DDJ3 3IPVA 4NIHA 5F5IA 3OY8A 3GCXA 1NCRB 1R1A3 3J26N 4LHKA 1QJY2 4PI0A 2YFUA 3C7FA 4LNVA 4AYUA 4UXAA 3AYEA 1BXHA 4XC9A 1ULFA 3L9JT 2VMEA 2A6XA 2ZHNA 4ATEA 3LGRA 4YVSC 4COVA 1RUF3 2JB4A 3WXPA 1Q8VA 2GSYA 3GZUC 2E7TA 3KLSA 1IPSA 4M0NA 5A7WB 4YVSB 1D2QA 4JTNA 3VBOA 5FYTA 5C3RA 3AZXA 3UESA 3DN7A 2GC3A 4K40A 3WQ7A 2Z5WA 1S0DA 5FK8A 1J1TA 1QWRA 2YBSA 4HSLA 4YFZA 4YZ3A 3K46A 1ZX5A 1W0PA 2R072 3WG3A 2LROA 3A0NA 2RDRA 1TNRA 1YLLA 3HN1A 2J22A 4A3XA 2QBXA 3BOWA 1GWLA 2OT7A 1RHI3 2ZEWA 2WS92 1PO11 2NM1A 3FWEA 3V0BB 4FPJA 4EN6B 2BGCA 2Q8EA 3HD8B 3I2JA 5SV8A 3RYKA 1CWPA 3TAYA 1PVXA 1CAVA 4DS0A 1X9PA 4K6BA 2LM3A 3WINE 4FPEA 2HYKA 2BEOA 2Y34A 2GMPA 3TN92 2PQQA 1TG7A 3OGJA 2Y33A 3ZOIA 3M1HA 1OQ1A 1IPJA 4XMIA 3KGLA 3RQ0A 5CA6A 1RUJ2 2YU1A 2YBKA 1GZ9A 1PZ7A 4GMP1 4N90A 3O7OA 4Q0SA 5BXXA 4FSJA 1XC6A 1FV2A 3PU3A 4H3WA 3LOBA 2RDSA 1O4TA 5CFDA 1M4WA 3U75A 1FV3A 2W1QA 2P3YA 3TNQA 4AXOA 2RS51 3O0XA 5JXJA 4ARYA 2IFRA 2R042 4J25A 1URXA 1AR73 2AACA 4EWDA 1D0GA 2GNTA 3R0RA 4MLOA 4YM1A 2XUMA 3WCRA 1SMVA 2VMHA 2CYFA 5FIXA 2RS11 2VOKA 5K7PA 2X5IC 1A78A 3EBRA 4FFGA 4MGSA 1DGRN 1X8MA 2X5IB 4YNIA 4CDQA 4YGBA 4LPLA 1RUC2 4KWLA 3AXDA 3I3BA 4YW6A 5LBBA 1W99A 3MIHA 4R4XA 3UKNA 5HCHA 4XUNA 3MHZA 3POSA 1U5IA 1SDWA 2CWSA 2VMFA 4B1LA 4IEXA 3GZAA 4L97A 1DFQA 4V1PA 4QD2A 2W92A 1AR92 3VDBA 1CZTA 1YYNA 3KV9A 1OSGA 5ANQA 4E8CA 1Y7BA 4XBQA 4XF1A 2QKDA 3VB9A 2HWE3 1XNAA 2D6OX 4QPGC 3SITA 5JI9A 3DPRA 4I2OA 1OQDA 2C1FA 1W9SA 2J1SA 3USUB 4QPGB 1OURA 1JH5A 5IFTA 5J09A 3WP5A 4W65A 2WSUA 4XFAA 5FP7A 1LULA 5K0UC 2J1AA 4I01A 1S2BA 3W58A 3VBHC 5FYSA 1RXGA 1ENXA 1ENSA 5HI0A 5K0UB 2VQUA 2YUEA 1C28A 1YFWA 2F4PA 4AEMA 1YIFA 4C0BA 5I93A 1QJX3 4FQZA 2B42B 3VBHB 5JOWA 1SFNA 4LLFA 1OH4A 1AR82 2BFUS 2WZR3 1C8M1 2DFBA 4LO6B 4XXAA 3THCA 5FP3A 3LDBA 4JKKA 5FUPA 5CADA 2TBVA 1OFSA 1JYCA 3GCWA 1O8SA 3A22A 4KI5M 4Y22A 4XDQA 4TZDA 2VNRA 2PAEA 4S2FA 1QJU3 4RHV3 3ZVXA 5CVRA 5EV7A 3EYPA 4BQ2A 2QZ3A 2P1BA 2WFPA 1XB9A 1W6QB 4CXWA 5JMCA 3DV8A 1O5UA 4UFHA 5J7MA 1RIRA 2E7QA 5IVCA 3CO2A 1YJKA 3PUIA 1OT5A 3DYPA 4R9BA 3J9SA 4Y33A 5JZGA 5C8CA 4N53C 1UZVA 2XKPA 4XIKA 4AHWA 2H6BA 1IS3A 2BJSA 3S0MA 2GH8A 5F3GA 3PUAA 4IV1A 1WCSA 2BU9A 2EIGA 2W91A 3KM5A 4N53B 5E6HA 4CEYA 1UPIA 5LA1A 3K3NA 1V9U3 2HEYF 3T4HB 1DIWA 5BY5A 2ZX4A 1CAXA 3FZ3A 4LR4A 5D8AC 1AR61 1O5LA 4QB2A 1UMHA 3E5QA 5FPLA 3KZ4C 1VB4A 4YRDA 5JCTA 3CU7A 5D8AB 4XDPA 2LTNA 4AEKA 2XJVA 3J8F3 3WQ0A 5JAXA 4XFIA 5FPZA 3NL1A 2HYXA 4JVAA 4CA9A 2HWD2 1GOHA 1VBE3 1W3XA 4XAAA 2H0VA 3O1SA 4NIAA 3T1MA 1CIWA 3VZJA 2YPDA 4Q4V2 2GAUA 4XFFA 5I0RA 1GNZA 4M3CF 3ZFEA 1G86A 4FOYA 1X50A 5FZDA 5F2SA 3ZPYA 4ZPIA 1NLSA 2ZGPA 3VZKA 3MV11 3WT3A 4DXZA 4B29A 3WOGA 4FCAA 1BBT2 3MIEA 2A71A 4QX0A 1R091 1RUI2 3M8LA 4GAZA 4L92A 3ORJA 5FUNA 5E1RA 2A7AA 5IUQA 2Q4SA 2VUAA 1H2MA 3VGIA 4AFDA 5ABJA 2V72A 2EIBA 5LY1A 2X8KA 1LODA 2C6SA 4Z82A 1I3HA 2AC1A 4ARXA 3MDPA 5AC92 4D7YA 2ZGRA 2HBTA 1C1FA 3BUCA 4YGDA 2IXHA 5F7UA 2ZZJA 4PIZA 3WF4A 4OYUA 1W3VA 4MXWB 2VVDA 4E4DX 3RSJA 1CJDA 1OF3A 2UY8A 2CL2A 3FL7A 4LTAA 5IK5A 4ASMB 1ZREA 1QU0A 3IZOA 3IB3A 3BKZA 4PIYA 4QGMA 3LZZA 4MUVA 5GLTA 2VQAA 5IVBA 5D2AA 4BA6A 2R30A 2WO2A 2XHNA 2YFZA 4UF0A 5FMBA 4ITCA 5FO7B 2HWB1 3ZN6B 2DBIA 4FFHA 1LOBA 2WDBA 1ONAA 4YVWA 5A3OA 4CXYA 4JDOA 2AR6A 4D69A 2VMIA 1PGSA 4MH0E 1GSLA 5FZHA 4FOVA 1QF3A 4HKLA 4WM7A 5CKNA 4OHYA 4XFBA 1S0CA 3TEXA 4LUKA 3ZSEA 4CCOA 1AJKA 1C57A 2ID4A 4C1XA 4KGQA 4JCKA 3I97A 4Q4X3 1O3QA 3WR0A 4E4HA 1FMD3 3OYWA 3SCFA 1UIKA 5IAXA 1LOFA 1Q43A 2V4AA 1WMDA 4HG6B 3ITQA 5KXEA 3DCQA 1CAUA 2HWC3 2ZEZA 1W6OB 2WNVA 2VW2A 3PVNA 4LULA 4MHUA 1XNDA 3WW1A 3L2HA 1J3RA 2JG9A 1RJ8A 2VBDA 4O9GA 4YG0A 2ZHMA 2XBO2 4Q5OA 2ZHLA 2VMGA 1DQ0A 1W8OA 2Y26A 1YI7A 4CVUA 4AVAA 3VBUA 4CP9A 1KEXA 3VZMA 3AZWA 1JYTA 1VBA2 1DF0A 3SH3A 3D5OA 4YZ1A 5JOYA 4YM3A 2DU0A 4LHLA 5FMOS 3H7JA 4WVMA 2QDRA 1CVNA 1MS0A 5F5QA 3R6SA 3WNXA 3P3NA 3ZYRA 3ZSKA 3GM8A 4GB31 1AXYA 1POV1 3MPBA 1KFUL 1MS4A 2ZABA 3GYDA 2ZX3A 4JGZA 1DZQA 2QQWA 3DUIA 4GWNA 4YW3A 5C71A 1S1AA 2ARCA 1ODNA 1MS1A 4HLTA 5I8YA 2FCVA 3VLBB 5LCWL 3LDRA 3RMXA 5HCAA 1F5JA 1V6NA 1XNCA 2LUWA 2E32A 2UWBA 3HAGA 5T5PA 2Q5TA 4ISQA 1VRH1 5A80A 1A3KA 1APNA 4HVRA 5JSOA 1W8TA 3GHMA 5DDJ2 5FZ4A 5KHHA 1OMIA 4N7IA 4L11A 3SKJE 4LE3A 4AWDA 4UOJA 1XE7A 1RVF2 1VAVA 1OA4A 2C5DA 2PHFA 1QJY3 1BKZA 1GP5A 1HRV2 3LF7A 4QDQA 1DGRA 3AMPA 3WDTA 3ZDVA 3WUCA 4QHZA 4LO4B 4UYBA 5C5UA 5C4WA 1AXKA 1TNFA 1D4M1 1TEIA 2PFWA 2D6KA 3ME2A 2XXZA 2RE9A 4LA3A 4ZXEA 3ZYBA 5BUVA 4FTEA 2LRPA 1BEV1 3Q8AA 3RZJA 5C33A 5DAXA 2FCUA 1YRZA 1EPWA 3AVRA 3I3QA 2R061 3FLRA 1XNTA 3VV1A 3I8TA 4I30A 2WFF2 2R073 3URFA 2CWMA 1VJ2A 4O61A 5FAXA 2Y0OA 3WZ1A 3KS7A 1FXZA 4Q8LA 1PVC2 1X7NA 3GZEA 3M3OA 3OD0A 2WS93 5F2WA 4LIUA 2DVDA 2ES3A 2Z79A 4A7ZA 2N7GA 1LHVA 2VOXA 5A7WA 2YC0A 1OUXA 5C8WA 5A3WA 4XILA 4BK4A 3PL0A 2VZPA 3WNKA 4BQ1A 4LBJA 2YGMA 3DYMA 3TN93 5FY7A 1UOBA 2D3PA 1V6JA 3MLKA 3B69A 3RWKX 5G04L 4P9IA 1NG0A 5E88A 3SMHA 4E8DA 5LA0A 2Y6KA 3JBG2 2HWF1 1RUJ3 2PHRA 2ETEA 1G9AA 5D1IA 2G19A 1KXGA 2VMDA 4PHZA 3M2MA 5F32A 1OF4A 1ZZ7A 2WO3A 3WDYA 4DIQA 3V0BA 4TLGA 2BNMA 4LBQA 3RMYA 1J1LA 5EWSA 2A6ZA 3ZFFC 2PHWA 2D5HA 2RG4A 2A75A 5IVYA 2ET7A 2R043 5FMOL 3ZFFB 1OKOA 2XWBB 4HK8A 1LENA 4S2GA 1KS4A 1W0NA 3ZYPA 3JU9A 4D94A 3N9MA 2X53S 3N7LA 1V6OA 2UYAA 4PF5A 4OI4A 2ZGTA 2XDVA 1H8TC 1I5PA 1WLTA 4PIXA 4CXXA 5F39A 3AP4A 4C91A 4Q0QA 3HPNA 3C2UA 4BQYA 1H8VA 3LEMA 1H8TB 1H2LA 1H1AA 4EE2A 1K42A 3AP7A 1RUC3 1NE4A 1IHMA 4UW5A 5F6KA 3O1MA 4P9JA 2YROA 5ERLA 3B01A 4CP0A 1RUE2 5FXZA 3CJXA 1RUG1 4XJAA 1WMEA 1L7RA 2PHLA 1AR93 2E26A 1PK6C 3T0DA 5CFCC 2VNGA 2IC1A 2IUWA 4L9BA 5IVFA 2OKXA 1PK6B 1WW6A 5CFCB 5FPAA 1HXS2 2BV4A 2OA2A 2YZ4A 4KMQA 1OFNA 5FMCA 3WF3A 1MVEA 3U4XA 3H8RA 1JOJA 5HXMA 2PHDA 4Q2FA 3VD3A 2QQOA 4JRLA 4QWNA 3DXUA 1XNKA 2GNDA 4WBBA 4NR1A 3ETQA 2W94A 4M4PA 4XBLA 5HV4A 3L2YA 3RNSA 2XUEA 2DTWA 3BTAA 1VMHA 4CPBD 3EXUA 5A1FA 1HKDA 5L9BA 1GQPA 1VIWB 5L73A 5GLUA 3TNPB 4AFBA 4ET7A 2A5ZA 3LB9A 1UWWA 3USUA 1ASJ3 1NLQA 2JG8A 4XHBA 5FO9B 3OGRA 3T3YA 1U5ZA 3VD9A 2W2IA 2RV9A 1UN1A 4MGKE 1W8NA 5FZIA 3MF9A 1W2TA 4IEOA 1VBC1 3IN9A 3J7MA 4QT6A 5A3MA 5K0UA 4KWKA 4GJYA 1BMV2 5FRAA 1GQGA 2ZGSA 2JDHA 3CQOA 3ASIA 3VBHA 2VVFA 1ZA7A 2B9UA 3PTYA 4QB1A 4AE2A 2J1VA 4DXRA 4GH4C 3N9PA 2RR11 2VOWA 3ACLA 4RGKA 5FOBB 2BWAA 4GH4B 2XJPA 2OZJA 4R52A 3T30A 4URAA 2VH9A 3O1PA 4YW4A 5JIAA 4K1ZA 5J98B 1W6QA 4LK7A 1SQ4A 2Z2SB 2PHXA 1NOVA 2XWJB 1WMFA 3KF3A 4P02B 3B9CA 4ZS2A 1AJOA 1DZRA 1MEC1 2J1RA 2EIDA 4LKFA 3AYCA 3I3EA 2AH2A 3KB5A 5I0SA 1B35A 1WWYA 3CLPA 3NWKA 4QPIC 5FBJA 5IK7A 1UYPA 2W1UA 4P9WA 3WUDA 3WNMA 2IXLA 3VKLA 4CYDA 4N53A 3JD71 1JYXA 2HWD3 4OLLA 4QPIB 4FTSA 2GNBA 3Q8BA 4PBOA 1UF2C 2W68A 4Q4V3 2RS32 3ZIWA 2VZTA 1DBNA 4EYUA 2P5BA 5FJHA 1K12A 3FLTA 3NVCA 4UAPA 2BERA 2PMWB 1F15A 2V4VA 2GMEA 1GZCA 1BBT3 1ULOA 3WG2A 3H1YA 2R6QA 1RUI3 4U2AA 4LT5A 5FYZA 3ECQA 5A7PA 2DBNA 1S2EA 2NPIA 2B39A 1JN2P 3H8XA 5LZ6A 1FPN1 3ZMNA 5AC93 1LESA 2WNUC 1O59A 4BLIA 1H6XA 3PMSA 5C7GA 1T6BX 1F8VA 1Y9QA 2YC4A 2WNUB 4META 4XCAA 1R081 2QQIA 2QQVA 4AI2A 1AXZA 5CAZA 1SCRA 3EMRA 4OQ9A 5IK4A 4A6OA 5M0TA 3N3HA 1V6LA 3I2DA 1NAEA 4PQQA 5T54A 2VM9A 2OUHA 3VKNA 3TEYA 4DRRA 2ZACA 1HB2A 3I2GA 3POYA 4GKXA 4M4RA 2EXJA 1VPHA 5CG8A 2QUOA 4PT6A 5BNOA 3KD4A 1COV3 1W06A 2DUPA 2VOTA 5CISA 3RZHA 3PUSA 3KHBA 4LBNA 1SLIA 2J42A 3NV3A 4XF0A 2YY1A 1T2XA 2RM21 4K21A 1MS8A 1WBLA 4XIOA 5FLIA 1VE0A 2QJVA 4MXWA 4XBNA 4ZU7A 1WCUA 2QQUA 5B4XA 1ULPA 2VY0A 3LIGA 4OI1A 5J37A 4WM8A 2F17A 2ARBA 1DQ4A 1QJZA 1J58A 3JQWA 4IW3A 4LKSA 4CDUC 4NIDA 1EAH2 3LA3A 5A3PA 1DCSA 4IGPA 4CDUB 4D7SA 5EIYB 2WNOA 1WA6X 4KBBA 2GH2A 1NXD1 3OCPA 3ZN6A 3J7NA 4N43C 4A7KA 4IESA 5FZGA 1I5ZA 4MGZE 1R092 4YG3A 2GP5A 3LAGA 4Q27A 4KU7A 1GZWA 4LE4A 4N43B 3ZYHA 5FDBA 1S55A 2WQ4A 1S0JA 2OXBA 2WO1A 4XUOA 5C70A 1GNHA 4I0WB 4QKBA 3JB4C 2QDNA 2UYBA 2WN2A 4LOTA 4LBOA 1R1A1 1DYOA 3TWIA 2WYSA 1IQDC 3A4UA 3BIWE 4Q1RA 4Q0UA 3EHKA 4M01A 3KV5A 4AL9A 1WA4A 4E2QA 4FOWA 5BNNA 4DQAA 3MBWA 3QD6A 1VALA 5HCFA 1Q5OA 1QDCA 1VMFA 3M7AA 2Q8OA 3SH5A 4FPLA 5I8TA 1F9KA 1X8EA 2FCTA 3H1MA 5C9AC 5GZFA 2YYOA 4H2AA 2FHRA 4LQRA 5F3IA 5AVAA 5GZCA 3AYDA 1S0FA 1W6OA 3AL5A 5CNAA 2ZOEB 4ONUA 5C9AB 1X33A 1F2NA 3LOIA 4H14A 5FQ0B 1YI9A 4Q4W3 4RFRB 2FDHA 3KSCA 4A45A 1FI2A 2C0ZA 2WR9A 4CCKA 1QHDA 5JPNB 2ORZA 3E1F1 3IDAA 5A32B 4KG0A 1RHI1 4XABA 4FFIA 5F1RA 1VBB2 2R1DA 2J1EA 4Y4YA 2D5FA 4RYDA 1GLHA 4ZHNA 1IG0A 5JIUA 2OQ7A 4WZCA 5TSWA 3BI3A 3LD8A 3NW4A 4QAWA 3WSOA 5A3NA 1DU3D 3ZM8A 3WDWA 4OI2A 3WNLA 1KJRA 2B9VA 3OPZA 3D4KA 1OBNA 4GWMA 1K45A 2P37A 4BQ3A 1RVF3 5EHDA 5I8SA 1SLBA 3DF0A 1HRV3 1W39A 3AKTA 2O8OA 3FUOA 3NNFA 4FPGA 4NROA 4IEUA 3VZNA 3W20A 3CL1A 4OUMA 4FP3A 1ULCA 5DQ0A 2ZMNA 2QE3A 2OPKA 2QQKA 3WQ1A 3JB8A 2WNEA 4M0HA 4XF4A 4IGQA 1NA1C 4XUQA 1TQ5A 5EFUA 5KHKA 3WV6A 1AR71 5BPXA 4AF9A 1NA1B 3I4IA 1GANA 3PVOA 1GQHA 2B45X 4NWVA 1HQNA 2R0FA 4YW5A 4XXPA 5EJ3A 5H9SA 4MGYE 1W8FA 4YM0A 3ZXAC 1LR5A 1ZBE2 2VW0A 4NIIA 3U11A 4BQWA 2WFF3 3N36A 4U36A 1PGL1 1ND3A 5IW0A 5I0DA 1ODMA 1YXWA 3H9AA 5K9YA 1H9WA 1Y4WA 4DXSA 2B46X 2VZOA 1OC1A 1PVC3 1W2NA 1EV11 2ZAAA 3FBYA 3POFA 4CCLA 4Q4Y3 1JYVA 3DEMA 1BVP1 2PHTA 5KBFA 5G05L 3S7EA 4XFGA 3MUZ1 1XU1A 3S7IA 5F37A 1SLLA 2XJRA 3MIDA 3WX5A 3PUQA 4HFSA 2XLAA 4Y20B 5LA9A 2BP6A 5BNPA 3V56A 3MICA 2NQYA 3WF2A 3VHPA 1J59A 2ZA9A 1PIV1 4JX0A 2FMDA 5GKAC 3JBG3 4BXFA 4COZA 3RFRA 4YGEA 1H2KA 1PX3A 3I59B 3VBRC 1H6YA 1F31A 1SFPA 4Z1VA 2FDJA 2HWE1 3H7YA 4ZXKA 2WAOA 3VBRB 3TEZA 1ST8A 3ZN4A 3CMGA 1JZ5A 1CAWB 1I9RA 4OQ8A 4KU8A 1UL9A 2XL9A 4BCUA 3R4UA 4NRPA 3CJIC 5JXIA 3JCIA 4GWIA 1OH3A 2H6CA 1LTEA 2V5DA 1N1SA 3WNOA 5FCCA 3CJIB 4OHZA 1GYKA 4IGOA 3UL2A 5CG9A 4DY5A 1R64A 3QH7A 5GLZA 3MEPA 2Y6GA 5FXVA 1QJX1 1OI6A 3UJOA 5KXDA 4MGTA 4CCMA 3PJQA 4AFCA 2WZR1 1LKNA 1IG3A 5DAPA 1JUHA
chains in the Genus database with same CATH topology
3HQUA 3PL0A 2FCTA 3W21A 5IAVA 5HV0A 4XC9A 2G19A 4XACA 5IATA 3KT4A 3KT1A 5LASA 5LBEA 2RDNA 2RG4A 4XABA 5LB6A 4BQXA 4KBZA 5IAXA 2V4AA 2OPWA 5EP9A 3ITQA 5LBCA 2HBUA 3NNJA 3OBZA 3OUHA 2RDRA 4MHUA 2A1XA 3KT7A 2G1MA 4Q5OA 4NHLA 5DAVA 4BQYA 2Y34A 3NNFA 4NAOA 3W20A 2Y33A 4XCBA 5ERLA 2JIGA 4XCAA 2RDQA 3HQRA 2RDSA 4NMIA 3EMRA 5M0TA 3NNLA 4XAAA 5DAWA 4NHYA 3DKQA 4BQWA 4J25A 2FCVA 5L9VA 4NHMA 3GJAA 5EPAA 5LBFA 4ZPIA 3OUIA 5HV4A 5LA9A 3OUJA 4JZRA 5L9BA 5LBBA 5L9RA 5A3UA 4IW3A 3BVCA 4NHKA 5C5TA 5C5UA 2JIJA 2HBTA 5EQUA 3MGUA 4NHXA 4Y5SA 4ZONA 5DAXA 2FCUA 3NNMA 3GJBA 4UWDA 3GZEA 4MHRA 5DAQA 4Y5TA 5LATA 5DAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQU A;  3PL0 A;  2FCT A;  3W21 A;  5IAV A;  5HV0 A;  4XC9 A;  2G19 A;  4XAC A;  5IAT A;  3KT4 A;  3KT1 A;  5LAS A;  5LBE A;  2RDN A;  2RG4 A;  4XAB A;  5LB6 A;  4BQX A;  4KBZ A;  5IAX A;  2V4A A;  2OPW A;  5EP9 A;  3ITQ A;  5LBC A;  2HBU A;  3NNJ A;  3OBZ A;  3OUH A;  2RDR A;  4MHU A;  2A1X A;  3KT7 A;  2G1M A;  4Q5O A;  4NHL A;  5DAV A;  4BQY A;  2Y34 A;  3NNF A;  4NAO A;  3W20 A;  2Y33 A;  4XCB A;  5ERL A;  2JIG A;  4XCA A;  2RDQ A;  3HQR A;  2RDS A;  4NMI A;  3EMR A;  5M0T A;  3NNL A;  4XAA A;  5DAW A;  4NHY A;  3DKQ A;  4BQW A;  4J25 A;  2FCV A;  5L9V A;  4NHM A;  3GJA A;  5EPA A;  5LBF A;  4ZPI A;  3OUI A;  5HV4 A;  5LA9 A;  3OUJ A;  4JZR A;  5L9B A;  5LBB A;  5L9R A;  5A3U A;  4IW3 A;  3BVC A;  4NHK A;  5C5T A;  5C5U A;  2JIJ A;  2HBT A;  5EQU A;  3MGU A;  4NHX A;  4Y5S A;  4ZON A;  5DAX A;  2FCU A;  3NNM A;  3GJB A;  4UWD A;  3GZE A;  4MHR A;  5DAQ A;  4Y5T A;  5LAT A;  5DAP A; 
#chains in the Genus database with same CATH topology
 1D2S A;  1PM7 A;  3BIE A;  2VU9 A;  4UBH A;  4GQ7 A;  4SLI A;  3WW3 A;  3KF5 A;  3RS6 A;  3T0A A;  3ZFF A;  5CBL A;  1W6P B;  4YYO A;  1MZF A;  1XOY A;  2VGD A;  4Y1X A;  1RUE 3;  3M4F A;  4AOC A;  1QJU 1;  4RHV 1;  3AFK A;  4A41 A;  4FPK A;  1IKP A;  3HMY A;  1HB3 A;  2KD7 A;  3HT1 A;  3KCX A;  4XAC A;  4MAD A;  2ZJC A;  1JI6 A;  1HJG A;  4QQ2 A;  2R32 A;  2ZZQ A;  4OI0 A;  1NX9 A;  2PLV 1;  4O65 A;  3SEP A;  5A6Q A;  3E97 A;  1H8T A;  3RPQ A;  1HXS 3;  3AM2 A;  4R4Z A;  3ILN A;  4B4P A;  4D8M A;  3N7K A;  5FZB A;  1L7Q A;  2DVA A;  1N47 A;  1ZZB A;  2ZS6 B;  2HH9 A;  1V9U 1;  3POI A;  2BVV A;  3POW A;  3WDV A;  5FZ0 A;  1XYP A;  3FHI B;  4X6Q B;  4ZU4 A;  3EJK A;  1OOP A;  2IXJ A;  1XYN A;  4QKN A;  4KWJ A;  1ZBA 2;  2JJ6 A;  2DF7 A;  3HNB M;  4RFT 0;  3U37 A;  4CUC A;  4Q0P A;  1PK6 A;  2VXR A;  1BYH A;  1ASJ 2;  5CFC A;  3J8F 1;  3I54 A;  2HLE A;  5LEK A;  4QX5 A;  4QU1 A;  5FZO B;  2RS5 3;  3MIB A;  1BHG A;  2FBE A;  4DEV A;  4EWE A;  1GFF 2;  3K4A A;  1VBE 1;  5FY0 A;  2XGX A;  2D6L X;  5DG1 A;  2JE9 A;  1CIY A;  2JEM A;  4L8Q A;  5DAB A;  1YCI A;  3SLI A;  2P6C A;  3KQ4 B;  4ES9 A;  1U5X A;  4Q1P A;  1Z7S 2;  2IXK A;  2Y0I A;  3HQR A;  5FZ8 A;  1QJE A;  2RS1 3;  2XVK A;  4XAE A;  3ZX7 A;  4LBL A;  4AHZ A;  1NQJ A;  4RR3 A;  3CNA A;  4LK6 A;  5DAW A;  5APA A;  4Y1Y A;  1IZ3 A;  3LEK A;  2K46 A;  3JUU A;  3LPF A;  1HJF A;  4HBN A;  4XF9 A;  5L9V A;  4NHM A;  3GJA A;  2E33 A;  5IJR A;  4WVW A;  1F5F A;  1LOA A;  3K75 B;  1Q3E A;  5LBF A;  4HZF A;  2TEP A;  4AVC A;  4A4A A;  2UWC A;  5DUV A;  5FO8 B;  4CU9 A;  4L2N A;  1ZM1 A;  3ZXE A;  3ZMO A;  2VTX J;  1NKG A;  3WHT A;  4XJ9 A;  3SQO A;  4Y1V A;  1REE A;  1HQW A;  4AQT A;  2NLR A;  2NP0 A;  5T5J A;  3PIG A;  3MF6 A;  1MQT C;  4MOA A;  1NY7 1;  5A70 A;  3ZXD A;  5A7Q A;  1XNB A;  2ZGO A;  3R4S A;  4BIO A;  1C3H A;  1MQT B;  3BU0 A;  2CAU A;  2XVL A;  3AL6 A;  3HEI A;  3N9O A;  1XPW A;  3VZL A;  1FOD 1;  3UGF A;  3E6D A;  2MHF A;  4Z2W A;  1BK0 A;  2NN8 A;  2P3K A;  3ZYJ B;  2DUO A;  1W6N B;  4IER A;  4KNC A;  1RXF A;  3T0B A;  5AVP A;  3JQX A;  2JDY A;  2RS3 3;  2ZCW A;  3QLQ A;  1LOE A;  4FPO B;  3BTX A;  1AYM 2;  1OKQ A;  3PUH A;  1RUH 2;  1JMU B;  2J1U A;  2XJS A;  1SBE A;  4IE7 A;  4KG8 A;  1U0A A;  2YBP A;  3KVB A;  4N9I A;  1E5S A;  1RIN A;  3S5A A;  4HVO A;  1UKG A;  5T5O A;  3FE5 A;  5L7O A;  4GUL A;  1OXC A;  4IEP A;  4NPL A;  3NJV A;  4UFJ A;  4DO0 A;  2PQS A;  3SCH A;  1H2N A;  1UXX X;  3D82 A;  4QXK A;  3AP6 A;  4UFK A;  4XJW A;  1KD7 A;  1JYN A;  4BE3 A;  2EVX A;  1DYP A;  4XFC A;  3IBM A;  1UZW A;  4CUG A;  4FI9 A;  4Q4X 1;  5F5C A;  3CZU A;  1HDK A;  1H4G A;  1KJL A;  2ZGM A;  1FMD 1;  1W9F A;  3PUR A;  4EN7 B;  4I0A A;  1BQP A;  4HK9 A;  3OJB A;  1PGW 1;  4AVB A;  3EO6 A;  1RIT A;  2C9K A;  2HWC 1;  1WCD J;  1H1M A;  1RUD 2;  1JU4 A;  1T6G C;  3O1R A;  4CUA A;  4OUS A;  1COV 2;  2ZX0 A;  3M3I A;  1SG3 A;  1O8P A;  5JPM B;  5EP9 A;  5FZ3 A;  3AP9 A;  4W6W A;  3VBS A;  1BZW A;  2K2S A;  1AR6 3;  2EA7 A;  4I0B A;  4IEZ A;  2A6V A;  5FPV A;  5EZW A;  2MEV 2;  4CEW A;  1DLC A;  2V09 A;  2YB7 A;  4QQH A;  2W3J A;  2WNU A;  5GLW A;  2JX9 A;  3VBF C;  4QDR A;  5B2G B;  2D7F A;  3P5B A;  2ZEX A;  4YLZ A;  1TME 2;  3VBF B;  1LU1 A;  2NMO A;  2IZW A;  2WZE A;  3INA A;  3NST A;  3VHO A;  2Z69 A;  5LA2 A;  1LGC A;  3P6B A;  3VHN A;  2DUQ A;  3WNN A;  5A33 B;  2VZS A;  1NYW A;  2GAL A;  3MW4 A;  3USS A;  1IS4 A;  3HVD A;  1YQ2 A;  4K3U A;  2A3Y A;  2RMU 2;  1EAH 3;  4JKM A;  3G7D A;  1SDD B;  2AEY A;  1WLD A;  4H7M A;  5FYU A;  3ZR6 A;  3NV4 A;  1UNB A;  3W9A A;  4RS5 C;  3RYP A;  3WG4 A;  2MNG A;  5FYY A;  2AUY A;  3QCW A;  4QGL A;  1QH7 A;  5GZG A;  1IKQ A;  2AGS A;  4RS5 B;  5IVE A;  3NNL A;  1EPZ A;  1R09 3;  5JSR A;  5LEJ A;  1R1Z A;  4LUM A;  3UGG A;  1K5M A;  4I09 A;  1JZ2 A;  1US3 A;  5IWF A;  1QMJ A;  4UFL A;  3VDA A;  3ZFG C;  3ROU A;  3NJY A;  1G7Y A;  2BTV C;  3ENR A;  3LCP A;  4FT8 A;  1CJP A;  2Y6J A;  3T2P A;  4AZZ A;  3ZFG B;  3HQX A;  3APB A;  4ATF A;  4L0P A;  1QJY 1;  4CCJ A;  2Y6H A;  2PTM A;  4COU A;  2QQL A;  3ZKU A;  4XHX A;  3NNG A;  3DL3 A;  1EUT A;  4UFM A;  3OG2 A;  4CRQ A;  4E4Z A;  4DZG A;  1TMF 1;  4FTB A;  1LED A;  3S30 A;  3WDX A;  3ZKY A;  2VTF A;  3OUJ A;  1Z0H A;  4EWA A;  4RN5 A;  3I2F A;  3UET A;  2E31 A;  3IMM A;  3K3O A;  1PZ9 A;  4Q4W 2;  3VUO A;  3VD5 A;  3LPG A;  1BK1 A;  1RUN A;  4NHK A;  4HKO A;  3V0A B;  3CEW A;  4ORF A;  3P1I A;  2WA3 A;  3HBK A;  2VZU A;  2P3J A;  5CYY A;  4CCE A;  1AL2 2;  1SLT A;  1YC6 1;  4HPK B;  1RB8 G;  2WS9 1;  1VBB 3;  3WW2 A;  2ZXQ A;  4X8N A;  3TEW A;  1VBD 1;  2XR4 A;  2BNN A;  2XJQ A;  2A73 B;  1LHO A;  2UY9 A;  4QQO A;  4Y1U A;  3TN9 1;  2FDG A;  2FDI A;  1O6U A;  1IS6 A;  4MHR A;  4MV2 A;  2F6B A;  2EF6 A;  2QCS B;  3OY8 B;  4LEJ A;  3E6C C;  1GUI A;  1RUJ 1;  2RJ2 A;  5T50 A;  2XML A;  4H55 A;  3V65 A;  2QQP A;  1LAJ A;  2WT1 A;  1HRI 2;  3PNA A;  4AI9 A;  2CSG A;  1PO2 2;  2VXJ A;  2ERF A;  4F7Z A;  2IVI B;  3VBO C;  1C8N A;  1OLQ A;  4JQT A;  5IAV A;  4LOS A;  2FDF A;  5HV0 A;  1H9P A;  1IGO A;  1KS5 A;  3VBO B;  3VKO A;  5IFP A;  1NLR A;  3IIA A;  1Y9M A;  1H4H A;  2W1W A;  3ZPO A;  1NCR A;  1MAC A;  3UYJ A;  3IDE A;  1YUD A;  1DP0 A;  1N1Y A;  5FY4 A;  4MXV A;  4NN0 A;  1ZBE 3;  2BGO A;  5DUX A;  4LKD A;  5FZ7 A;  3MIF A;  3IDC B;  1OA3 A;  4Q4Y 2;  4JHZ A;  4GJZ A;  1YQ8 A;  5EXO A;  2X05 A;  2HBU A;  4V2V A;  4YVS A;  5D21 A;  1EUU A;  1UXZ A;  2EIC A;  2O8Q A;  3Q8F A;  3V64 A;  1HN0 A;  3ACF A;  3WD5 A;  4BYY A;  3THD A;  3H3L A;  4IE6 A;  3KT7 A;  2G1M A;  2GC1 A;  5FZM A;  4XJ8 A;  3ZXJ A;  4EN0 A;  1W0O A;  4GB3 3;  1AYN 1;  2WBK A;  3WLU A;  2VC9 A;  3ZXG A;  4XF3 A;  1OLM E;  1XRU A;  1I1E A;  2YHJ A;  1QXJ A;  3A0K A;  2QVS B;  3CBN A;  5FZ9 A;  4AHX A;  3NO8 A;  4FAG A;  5CFD C;  2JDZ A;  3AKR A;  4JDM A;  3GBF A;  5HBA A;  1UY1 A;  1QQP 1;  2BRT A;  3KWV A;  5ACA 2;  1AX2 A;  5IK8 A;  5CFD B;  4BB3 A;  3W5N A;  1ACC A;  4MYE A;  3RWN A;  2VUD A;  3D8C A;  2JDA A;  4OFG A;  3LKJ A;  2DVB A;  2OUJ A;  4Y5Z 0;  1DHK B;  3B3Q E;  1XJA A;  5KWR A;  4Y20 A;  3MLJ A;  5KC6 A;  4QMA A;  4AQ6 A;  5IYY A;  3H3Z A;  4LHS A;  1IQA A;  2I74 A;  5A3T A;  3I59 A;  2DVF A;  2VBP A;  3ETP A;  2W95 A;  4JTO A;  1CPM A;  5J96 B;  3PHM A;  4XZP A;  1AR8 1;  1QIQ A;  3CZJ A;  3VBR A;  5A1A A;  3LIH A;  4N7U A;  4S2H A;  2YV8 A;  1BEV 3;  1WMX A;  4E2S A;  4HKW A;  1CX1 A;  2DCY A;  3H50 A;  2H0B A;  3MFA A;  4HON A;  2ADD A;  2CY6 A;  2OS2 A;  2ILM A;  2BOI A;  2B8M A;  2HKX A;  3CJI A;  4BIF A;  3N7J A;  4LBQ D;  2WN3 A;  1PO1 2;  1JOP A;  4AW7 A;  2DDU A;  3QAC A;  5C5T A;  2DCZ A;  4IE5 A;  1Q8Q A;  1EV1 2;  4ZY9 A;  2X5I A;  2WLP A;  3III A;  3MYX A;  5FXX A;  1W8U A;  2OZ6 A;  4PBP A;  3R4D B;  3GAL A;  3VD4 A;  2DU1 A;  2IXC A;  4DFS A;  5E89 A;  4CPB A;  4OUL A;  1A8M A;  3DGT A;  1LRH A;  3K4D A;  4LXL A;  3NRU A;  4P08 A;  5T5L A;  2O14 A;  1J83 A;  3LFI A;  3NV2 A;  4XQW A;  2DTY A;  3NQH A;  1PIV 2;  5E16 A;  4RGA A;  2D6M A;  4BZ4 A;  4QXB A;  1VR3 A;  3A7Q A;  2VOV A;  4MZU A;  1OPM A;  4GKY A;  1GNY A;  2PHU A;  2W5F A;  4Y5T A;  1ZBA 3;  3KV4 A;  3PVE A;  1QKQ A;  2ATF A;  4OZO A;  1MZ6 A;  3AJZ A;  4Q0V A;  1STM A;  2GZW A;  5F6L B;  2RS5 2;  3T08 A;  1HW5 A;  2XJT A;  4K7J A;  4QPG A;  3RYR A;  5C3Q A;  5C3O A;  1LGB A;  4DPN A;  2HWD 1;  4IEY A;  4MG2 A;  4BQ5 A;  5LK7 B;  5HCB A;  4AI0 A;  4Q4V 1;  2RS1 2;  2GDF A;  4QM9 A;  1AL0 G;  4UW6 A;  3IKW A;  1NCQ C;  3THT A;  2WAB A;  2Y60 A;  4MO3 M;  1Z7S 3;  1CGP A;  2ET1 A;  2R0H A;  1DGW X;  1J84 A;  1NCQ B;  2RDN A;  3AMM A;  3KQR A;  3TRS B;  5FY5 A;  5LB6 A;  1BVV A;  3UKV A;  1O3S A;  4BQX A;  4SBV A;  1BBT 1;  3BCW A;  4IND A;  3NJZ A;  2OPW A;  1UX7 A;  2W52 A;  4QPY A;  4CEY C;  1RUI 1;  3OGS A;  5EJZ B;  2XKO A;  1LNS A;  1LU2 A;  3NNJ A;  4YPJ A;  4XUP A;  2QQN A;  4CEY B;  4PLN A;  3Q8C A;  3TBD A;  4QQL A;  1C5I A;  4QKD A;  2P34 A;  1VP6 A;  5AC9 1;  1K5J A;  3ON7 A;  2VUJ A;  2WT2 A;  2ARE A;  2ZGL A;  3OTF A;  4XTM A;  5J48 A;  5LRS A;  5DAV A;  1LHW A;  1O91 A;  2L9L A;  2ZAH A;  2Q1F A;  4P9L A;  2ZKN A;  4FO9 A;  4XCB A;  3RG0 A;  2CDO A;  4PCR A;  3DKW A;  4UI9 L;  3C8X A;  1GOF A;  2WLQ A;  4UW4 A;  5FP4 A;  1PMJ X;  1MPX A;  1OLM A;  4FVV A;  5JOZ A;  1YFU A;  1OD3 A;  1OLR A;  1G8W A;  1WZX A;  1OPO A;  1YQ6 A;  3K48 A;  4CCN A;  1AYM 3;  1RUH 3;  1C8M 2;  5FZF A;  2XQX A;  5D8A A;  2GNM A;  3LDK A;  2PXJ A;  2VR4 A;  4GWJ A;  4CE8 A;  4F3J A;  2Y6F A;  1AUY A;  4N8M A;  1SAC A;  2JE8 A;  3OB8 A;  5FP8 A;  5ABJ C;  4CSW A;  1CR7 A;  4MVT A;  5JMO A;  2Q8D A;  3I49 A;  2WYF A;  3FBM A;  5ABJ B;  4OZX A;  2VCB A;  3LSE A;  3NKT A;  3WY6 A;  1W6N A;  4FQ4 A;  4A7Y A;  3ZYF A;  2ZHK A;  3HJR A;  1QDO A;  4D7T A;  2NMN A;  3T09 A;  1XSR A;  4K20 A;  1CD3 G;  4OVE A;  1KDK A;  3SC7 X;  3HNY M;  5ANN A;  4N9H A;  4LO5 B;  2WSV A;  1O4Y A;  4A2U A;  4AGR A;  4BDV B;  2VVE A;  2NZ9 A;  1UZZ A;  3ZXF A;  4JGY C;  3MW3 A;  5FY9 A;  4CCC A;  4CU8 A;  2JIJ A;  1CES A;  5FYH A;  4CTE A;  4JGY B;  1PNF A;  4LOR A;  1QNW A;  3IMN A;  5FYV A;  1RUD 3;  5H9P A;  1Z78 A;  2BNO A;  4M00 A;  5JDB A;  5JR2 A;  4Y5S A;  1ZZ6 A;  3OGV A;  1F4H A;  1PZ8 A;  3GBW A;  2XBO 1;  4QKF A;  4JC1 A;  1AR6 2;  4DIN B;  3MV0 1;  1O3T A;  5JVV A;  2I07 B;  2B5H A;  1VBA 1;  4FFF A;  5DMY A;  3OOX A;  2MEV 3;  2VCM A;  1MEC 3;  2DYC A;  2J1T A;  1W9Y A;  4FAH A;  5DUU A;  2MPF A;  3WP3 A;  2A3W A;  4WM7 C;  4EN8 B;  1PHM A;  4BQ4 A;  2JXA A;  1TME 3;  1KFX L;  2BVB A;  3AKP A;  1E5R A;  3H3U A;  3JD7 3;  2VQT A;  4WM7 B;  4W8J A;  4B3N A;  1IS5 A;  5L36 A;  2Q8C A;  4C0H A;  3WP6 A;  3VKM A;  3RZZ A;  5AFE A;  3GZT B;  4UFI A;  1RMU 1;  2XOM A;  2RMU 3;  4E4S A;  1LOF C;  1Q56 A;  2AYH A;  2VO5 A;  5DN2 A;  4XYX A;  3ILR A;  3IT8 A;  4MGI E;  3OYW B;  1UU5 A;  4L99 A;  1HB4 A;  3N4M A;  4Z92 B;  4YWA A;  2WNV C;  4MSV A;  5J1X A;  4YW1 A;  2JG9 C;  3IDB B;  1GU3 A;  3FMG A;  3BOD A;  2WNV B;  5EJ1 B;  3FHQ A;  3ZSM A;  3HNM A;  3I2H A;  5DDJ 1;  4NE9 A;  4OMD A;  4B1M A;  2JG9 B;  2D3S A;  5A33 A;  5HXV A;  5GM0 A;  3E5U A;  1FPN 3;  3OBZ A;  4CP9 B;  1ZRD A;  1RVF 1;  1W9W A;  3ZLI A;  5FY1 A;  2XLG A;  1HRV 1;  1CX4 A;  1RUF 1;  2A1X A;  2EAA A;  2OX0 A;  5GJ6 A;  1CQ9 A;  4CZS A;  4OHV A;  2ZTN A;  1DYK A;  1R08 3;  4W50 A;  4UW3 A;  4QX1 A;  3UK9 A;  2BPA 2;  5BNQ A;  3O0W A;  3AB0 A;  3HT2 A;  2ADE A;  2HEW F;  4YSF A;  2CV6 A;  3T2O A;  5CKM A;  4JGZ C;  1DQ5 A;  3ALQ A;  4QB6 A;  1GIC A;  2W87 A;  3MO4 A;  4R8H A;  2GN7 A;  3ZFG A;  4CCD A;  4TN7 A;  4C8D A;  3BAL A;  4JGZ B;  2WFF 1;  3UGH A;  1YNA A;  4QXC A;  2LW8 A;  2HWB 2;  2XL7 A;  4FXG B;  2ZBJ A;  1AL2 3;  3O1V A;  1PVC 1;  5I0T A;  2JDM A;  2P4E A;  4QHB A;  4RSU A;  1LJ7 A;  1XE0 A;  1W90 A;  4BOW A;  2P3I A;  3DKQ A;  1GMM A;  2C4X A;  3VN4 A;  5DPN A;  3ZR5 A;  3ACI A;  3RRD A;  4IL7 A;  4URT A;  2XG3 A;  1NZI A;  5FPX A;  3V0A A;  4TWT A;  4AI1 A;  1A34 A;  4H7L A;  1IPK A;  2UWA A;  3JBG 1;  4DMI A;  5H9Q A;  4C1W A;  3RDI A;  1SPP B;  2DCJ A;  3ACH A;  3FLP A;  5C3S A;  4HPK A;  1HRI 3;  5C4W C;  3LFM A;  3K4Z A;  1PO2 3;  1W2O A;  4AR2 A;  3FN9 A;  1ULD A;  4PDW C;  3RI9 A;  4QM8 A;  1WD3 A;  3ATG A;  3UV9 A;  1AVB A;  5C4W B;  1KIT A;  4PDW B;  3BPZ A;  3O5S A;  5DZG A;  5JUV A;  2VZ1 A;  1OVS A;  4P9X A;  4RQP C;  3BVC A;  4BH9 A;  4EQV A;  1FAY A;  2XHK A;  1SEF A;  3FHA A;  3IAP A;  1DQ6 A;  2P2K A;  4RQP B;  3NV1 A;  1LEM A;  1V6M A;  2W39 A;  5LK5 A;  1HB1 A;  2RVA A;  4AEJ A;  5FR3 A;  1TMF 2;  2E53 A;  2JB8 A;  3GJB A;  5SV5 A;  1S0B A;  4YW7 A;  4K9S A;  5DZF A;  4AED C;  3K51 A;  1HIX A;  1AF9 A;  4GB3 2;  3HOB A;  4LIV A;  4AED B;  4F8A A;  2OW4 A;  1RUE 1;  1V70 A;  4M3C B;  3IAQ A;  4GMP 0;  3N7M A;  4EV0 A;  4NRQ A;  2JKX A;  1MZ5 A;  1WCQ A;  1O7F A;  3ST7 A;  4ERO A;  3U0Z A;  2FDK A;  4FXK B;  3AXE A;  1QJF A;  4Z07 A;  3ABZ A;  1KRI A;  5ACA 3;  1VBD 2;  2XPJ A;  4LBQ B;  3U10 A;  3H1W A;  5L19 A;  2CDP A;  4Y24 A;  1OUS A;  1VRH 2;  1P8J A;  5FZC A;  1HXS 1;  3OPW A;  5A6X A;  4FPF A;  1SCS A;  1UOF A;  2XVG A;  4BXS V;  1JYI A;  5GAL A;  5FBZ A;  1QOS A;  1UOG A;  4PI2 A;  3D0J A;  2VEC A;  2CGN A;  1UAI A;  1F4A A;  1GWK A;  2D6P A;  3AVS A;  1N1V A;  4QGN A;  4DRV A;  3OF1 A;  4IET A;  1GWM A;  4KBZ A;  1AX0 A;  5KHJ A;  4XE9 A;  4JKL A;  4WVZ A;  1D4M 2;  2C24 A;  1S4C A;  4KGG A;  1BEV 2;  4QX7 A;  3TOJ A;  1RC6 A;  2TUN A;  4XZU G;  4XW3 A;  2HEV F;  4COY A;  1RL3 A;  2R06 2;  2DUR A;  4NHL A;  4B7E A;  3A23 A;  4OHX A;  2PN5 A;  5EYY A;  4LJH A;  3RJ2 X;  1CON A;  3PU8 A;  1W9T A;  4KH9 A;  2ZGK A;  4GXL A;  3WVJ A;  4ZZ8 A;  1UYY A;  3Q9O A;  1B09 A;  1PO1 3;  3VDD C;  2EXI A;  2VUC A;  3UNP A;  1BMV 1;  1GV9 A;  3O1T A;  4QX8 A;  1EV1 3;  3D6E A;  3OSD A;  4MX3 A;  1UY2 A;  3VDD B;  2JIG A;  3POB A;  4XEZ A;  3B93 A;  3ZSL A;  1POQ A;  1EY2 A;  5FZE A;  1AYN 2;  4E27 A;  1X82 A;  1SLA A;  2HWF 2;  2BUK A;  3EB7 A;  1NE6 A;  1HV0 A;  4GMP 3;  1PIV 3;  3THP A;  1XSQ A;  3ZO0 B;  5FWJ A;  1Y9G A;  4WV8 A;  3AX4 A;  3AZV A;  2QTW B;  3AMH A;  3ZYG A;  2RJK A;  1QQP 2;  3PLQ A;  2EAL A;  4QDS A;  1FYU A;  4LIT A;  2GC0 A;  2JG8 C;  3B9I A;  1MS9 A;  1W03 A;  1Q8O A;  2ENR A;  2QQJ A;  2R7E B;  4AI3 A;  3FC0 A;  3M3E A;  4NVP A;  5FLJ A;  5KR7 A;  2JG8 B;  1GKB A;  2XON A;  1RUO A;  1ZZ8 A;  2G4I A;  2FZ1 A;  4G9S B;  5CKQ A;  3ZDS A;  4YG6 A;  2B4K A;  1W8H A;  2W9X A;  5F8P A;  4A42 A;  5FOJ B;  1JZ4 A;  2RS3 1;  4J1W A;  3RJR A;  2Y6L A;  1H0B A;  4CP2 A;  2QQM A;  3C7G A;  1RED A;  4HN0 A;  2KA3 A;  2VD7 A;  4J6G A;  1HLC A;  4R9C A;  3GBG A;  4B4Q A;  2VG9 A;  3WNP A;  2BDR A;  3E6B A;  2WWU A;  3VDC A;  2JKB A;  3NNM A;  1ULG A;  3E5X A;  4EJR A;  5KHI A;  1MR5 A;  4OUE A;  1RUG 2;  2OQ6 A;  1W2A X;  1C5H A;  2UUR A;  3K2O A;  4AK3 A;  1PMH X;  2K0G A;  2WWJ A;  1WBF A;  2W08 A;  2I2S A;  2W47 A;  3UKT A;  3F2Z A;  4TLF A;  3POE A;  3PJY A;  5DAQ A;  2VL4 A;  4HL0 A;  3UT0 A;  4CDW C;  5LAT A;  1NCQ A;  5F3C A;  1B35 C;  2EXH A;  2PLV 3;  2ZX1 A;  4CDW B;  3ES1 A;  4Y1Z A;  5JWP A;  2D6N A;  5JZG C;  3BGA A;  2QNK A;  1B35 B;  4NAM A;  5FKB A;  4GH4 A;  5BYN A;  5JZG B;  4BK5 A;  2YPJ A;  4OMC A;  3KV6 A;  3SH4 A;  1LOC A;  2D43 A;  3I2I A;  4RA0 A;  2OII A;  1W05 A;  1WW5 A;  5AFB A;  4QU2 A;  3KT4 A;  4UBG A;  4OHW A;  2ARA A;  5LAS A;  3C7E A;  5LBE A;  3M70 A;  1UD1 A;  3H8O A;  1NUK A;  5A7S A;  2WWS A;  1C8M 3;  2CHH A;  4LMF A;  1JUI A;  2D3R A;  1WGP A;  1QGL A;  2E51 A;  5JR7 B;  5GLV A;  2YC2 A;  4AVT A;  3N35 A;  4QPI A;  1G9D A;  2GMM A;  3F95 A;  3OUH A;  5K4L A;  4FP2 A;  4EN9 B;  2YDE A;  1VBC 2;  1LCL A;  3JZV A;  5LRR A;  4W6Y A;  2CU5 A;  1XXN A;  1SBF A;  1ND2 C;  1G6N A;  1Q8S A;  1EAH 1;  2VNV A;  1S0E A;  2XJU A;  1VRB A;  1ND2 B;  1WUV A;  2JWP A;  3RI8 A;  3SIS A;  3SNM A;  5IVJ A;  3O12 A;  4XET A;  2GN3 A;  4R9A A;  4NO4 A;  5BV6 A;  5J3U A;  2ZEY A;  4XTP A;  1JHN A;  4NOT A;  4P9Y A;  1DZT A;  2RR1 2;  3AKQ A;  5FYM A;  4Y4R A;  2FZ2 A;  1D7P M;  2EIE A;  4BME A;  5FY8 A;  2FQP A;  3NAP C;  1VAM A;  4BHP A;  5BNO C;  4JHT A;  4YZ2 A;  3WG1 A;  3C7O A;  4AQS A;  2Q1Z B;  3NAP B;  4YW2 A;  1JOD A;  5BNO B;  5IVV A;  2P6H A;  4D3W A;  1DDL A;  3SXW A;  2R1B A;  3SEE A;  4YZ5 A;  3VL9 A;  4CDX C;  1MEC 2;  1J3Q A;  1L7L A;  2W46 A;  4HXC A;  2PYT A;  4DEQ A;  1ZRI A;  1AX1 A;  4YM2 A;  2FMY A;  5KXC A;  5EPA A;  4IV3 C;  4CDX B;  4Q26 A;  2WZ8 A;  3AP5 A;  2E63 A;  4WM8 C;  3X29 B;  4XJZ A;  3JD7 2;  4IV3 B;  4JGY A;  2QZ2 A;  2BOJ A;  4NUB A;  3C7H A;  4TYS A;  4WM8 B;  3K77 A;  1FOD 3;  3WQB A;  3ILF A;  4FPY A;  4M3C E;  2BFU L;  5B4N A;  1UOJ A;  1W8Z A;  3CF6 E;  1SLC A;  4JRA A;  5FP9 A;  4QQP A;  3SHR A;  3ZXK A;  2JIC A;  4NPM A;  4PJY A;  3EQE A;  1OD5 A;  2JDN A;  5L9R A;  1J3P A;  1VBB 1;  3S5Q A;  3VD7 A;  4ZKT B;  1YWK A;  1NXM A;  4JV4 A;  5HPO A;  1GZW B;  1E5H A;  1YIP A;  1BLZ A;  4QHO A;  1VMJ A;  5FK7 A;  3GNE A;  2C26 A;  3N9N A;  1JHJ A;  4WVV A;  3NMB A;  4CU6 A;  3PDQ A;  1U5Y A;  1FPN 2;  4IE4 A;  3O0V A;  1MVQ A;  5BNN C;  1XBF A;  5JSP A;  2XLF A;  2WO7 A;  3AMN A;  3POG A;  4CDU A;  3HR9 A;  4Y26 A;  3VHR A;  1ZNP A;  5KC5 A;  2GC2 A;  1HX6 A;  4RL7 A;  5BNN B;  4AI8 A;  1C4R A;  1W6M B;  2R49 A;  4AVS A;  1R08 2;  2ZMK A;  2SBA A;  1SHW B;  2X09 A;  4XPV A;  1UYZ A;  1XE8 A;  1F35 A;  1QOT A;  2D40 A;  2ZPX A;  4XMA A;  3O1O A;  2VMC A;  4N43 A;  2WZP P;  1E5I A;  3S57 A;  2WUH A;  4DNY A;  1GOG A;  5FMD A;  4HN1 A;  1JOB A;  1POV 0;  1NT0 A;  3KMH A;  4ES8 A;  2X10 A;  2ZGU A;  2IWG B;  2WQ8 A;  2R07 1;  4GD4 A;  1OVP A;  1ZZC A;  3ELN A;  1LB2 A;  3PME A;  2OYZ A;  2JEN A;  5KHG A;  1ZBE 1;  2G9F A;  2YU2 A;  3O14 A;  5I0U A;  3LA2 A;  2RM2 2;  1Y3T A;  2HWB 3;  5IAT A;  4LKE A;  4LBK A;  1YJL A;  3J7L A;  1RYY A;  2JD4 A;  2ARX A;  1KQR A;  2AZ5 A;  2W1S A;  4YAR A;  1HV1 A;  2IXI A;  1NQD A;  2WII B;  3JXS A;  3MW2 A;  4FBF A;  4JAA A;  2W0X A;  3U4S A;  5C9A A;  2X29 A;  3LSD A;  3P3P A;  5FQ0 A;  4DY3 A;  3IPV B;  3WW4 A;  3FFQ A;  2DCK A;  1CN1 A;  3I7D A;  2IFW A;  3Q8E A;  3DEC A;  3LWC A;  1RMU 2;  1DGW A;  4IEW A;  1UZY A;  3U1X A;  1XYO A;  4B7K A;  3BTY A;  5A32 A;  3RGB A;  2E7A A;  1TVG A;  2VZR A;  5CB7 A;  1LGN A;  3WCS A;  4AHY A;  2PAM A;  4GAL A;  2DWR A;  1CZV A;  2Y8K A;  2FD8 A;  4HMZ A;  1GBG A;  2D44 A;  5FZL A;  1IOA A;  2TNF A;  3IWZ A;  3NKG A;  1M06 G;  3MFC A;  2R04 1;  4IQP A;  5FPU A;  4PLM A;  1ZA4 A;  4ISR A;  4TXW A;  1UY3 A;  1YFY A;  1R1A 2;  3BPS A;  1OA2 A;  1V6I A;  4LBM A;  5T52 A;  4OCT A;  3LE0 A;  3W59 A;  1ND3 C;  1KDM A;  1JU3 A;  3AMQ A;  2RHP A;  2I45 A;  3OEB A;  1RUF 2;  1ND3 B;  1SPP A;  2F4L A;  4FOQ A;  3WF0 A;  4NMI A;  5DXD A;  3I2O A;  4BMB A;  1CAV B;  1TMF 3;  4X6R B;  3MIG A;  1ZRF A;  1RUC 1;  4AVV A;  3T2Q A;  5BNP C;  4PDW A;  5JXH A;  3B00 A;  4A6S A;  3HBZ A;  1SFY A;  5FRE A;  1NA1 A;  4TTG A;  2VBB A;  1CZS A;  1POV 3;  2AEN A;  5DG2 A;  1WKY A;  4AG4 A;  5BNP B;  2PEL A;  2BBA A;  3B02 A;  3D0S A;  4P5H A;  1WLW A;  4RQP A;  1MS3 A;  1PX4 A;  3VZO A;  1AR9 1;  1RHI 2;  1WW7 A;  4XDO A;  3AZY A;  1UYX A;  2VCA A;  3U07 A;  1G9F A;  3W5M A;  1DGL A;  5DZE A;  3FFZ A;  2WT0 A;  1UU4 A;  1WD4 A;  4F83 A;  1VBD 3;  1YFX A;  1PMI A;  2PA7 A;  4BU2 A;  1JZ6 A;  5F9T A;  2WIN B;  1VRH 3;  1K3I A;  4D6Q A;  3A21 A;  5A3U A;  2LAL A;  2KXL A;  2WC2 A;  4AED A;  1NZC A;  2CTV A;  5EQU A;  2XB6 C;  4AQ2 A;  5T3N A;  4AFA A;  2JDU A;  4M3C A;  1V6K A;  1HQL A;  4NHX A;  2D93 A;  4CDQ C;  3DYO A;  5JXG A;  1RJ7 A;  1ZBA 1;  1REF A;  2Z42 A;  4E9K A;  2VNO A;  4I3G A;  2VUL A;  2RJL A;  4GA9 A;  4XQ4 A;  3HWJ A;  4CDQ B;  3T2T A;  4PQ9 A;  1ASJ 1;  1CAW A;  1D4M 3;  1DQ2 A;  1O3R A;  4LO8 A;  4P9G A;  1AR7 2;  4Z8B A;  2VJX A;  3OGG A;  5FWE A;  4Y3O A;  3ZYI B;  3CHX A;  5DUW A;  1GP4 A;  1H30 A;  2R06 3;  2XH6 A;  3QOP A;  5FKC A;  1EYB A;  2GU9 A;  1DLL A;  5H9R A;  4B4R A;  5FZ1 A;  1PGL 2;  2QFE A;  3J7H A;  1SBD A;  1Z7S 1;  5GZD A;  2KR2 A;  3DPR C;  4K1Y A;  3SCG A;  3D3A A;  4LA2 A;  5F3E A;  3ZXL A;  5FZK A;  2A70 A;  4A3Z A;  3DPR B;  5FPB A;  2VW1 A;  1ZRC A;  1QXR A;  3AC0 A;  5FFO C;  1VAK A;  2ZKL A;  1QY4 A;  4LLO A;  1CPN A;  4ASL A;  2VZQ A;  1W6P A;  1V0A A;  2VTX A;  1OOP C;  1WLC A;  1AYN 3;  1I6X A;  1N1T A;  2WRA A;  3AFG A;  3OBA A;  5LWB A;  3N9Q A;  2ZX2 A;  2HWF 3;  2BGP A;  1W04 A;  1JW6 A;  3PIJ A;  5JLV A;  1OOP B;  4YZ4 A;  2BWC A;  1OQE A;  3DXT A;  5CZK A;  2DV9 A;  5FV3 A;  1YQ5 A;  2DFC A;  3ZSJ A;  2E9Q A;  2HWE 2;  1QQP 3;  3M3Q A;  5C6C A;  3SKV A;  2CNA A;  4EZ4 A;  2WA4 A;  3OBR A;  1S0G A;  2V73 A;  2BQP A;  1WCK A;  2ZGN A;  3LA7 A;  3VDD A;  4AGG A;  1X9T A;  3FX3 A;  2VPV A;  4XOG A;  4BLJ A;  4DUV A;  1LEC A;  2NYY A;  3BTZ A;  1H1I A;  4XUR A;  4WZF A;  1XU2 A;  3H42 B;  4Y22 B;  5FLH A;  3I3M A;  3RZG A;  5FXW A;  1UIJ A;  2BZD A;  4KL1 A;  4RR3 C;  5A3L A;  1WW4 A;  2D98 A;  1QJX 2;  2DCT A;  4S2D A;  2A6W A;  4BIS A;  4IEQ A;  1AYM 1;  1RUH 1;  2WZR 2;  4RR3 B;  2ZGQ A;  5C8C C;  4B8E A;  5FUI A;  1MZE A;  3BOP A;  1AR8 3;  5C8C B;  2RDQ A;  4IV1 C;  3LEG A;  2P17 A;  4PLO A;  2C9A A;  5FZO A;  1AZD A;  4D6R A;  2VAU A;  1L3J A;  2KM2 A;  4IV1 B;  3B94 A;  4RD7 A;  1HN1 A;  4AGV A;  4QPW A;  3C3V A;  1FT9 A;  1QJU 2;  4RHV 2;  1RUG 3;  3NJX A;  3PVB B;  5E8A A;  4BJ0 A;  1CAX B;  4C90 A;  3KGZ A;  1JZ8 A;  1Y43 B;  1EP0 A;  3FJS A;  3J4U H;  2PLV 2;  4HVQ A;  1UU6 A;  1JS9 A;  5A7O A;  5IT6 A;  5CU1 A;  1ALY A;  2VZV A;  1X36 A;  3GHN A;  3T4V A;  2WL1 A;  4DUX A;  4P14 A;  4P00 B;  2IVJ A;  3BN6 A;  4HAN A;  2GP3 A;  2YGL A;  4NJ4 A;  1VB2 A;  4AFM A;  4DUW A;  1UZ0 A;  4V2W A;  3ZFE C;  4A44 A;  3VL8 A;  1RUD 1;  1V9U 2;  3MI8 A;  1QNY A;  3ZFE B;  2EXK A;  3AZZ A;  1COV 1;  4KQ7 A;  5CEH A;  1D0H A;  3MUY 1;  3ZIX A;  3B7M A;  3N9L A;  4RGG A;  5FZA A;  4D0Q A;  5LY2 A;  4E2G A;  1FNZ A;  3MGU A;  3R05 A;  1RGS A;  1E57 A;  2MEV 1;  3J8F 2;  4CDW A;  1ENQ A;  2O1Q A;  2PAK A;  4FPC A;  4TSV A;  3POJ A;  5L7O C;  1MQT A;  4ZON A;  2HJI A;  3BU7 A;  1VBE 2;  5L7O B;  1JZ7 A;  1W8W A;  2G9Z A;  1TME 1;  4LO7 A;  3I3D A;  4PF1 A;  4UWD A;  4XUT A;  2B7Y A;  1YQC A;  3MLL A;  3OD4 A;  4GZ9 A;  3WHU A;  5A6Z A;  4G3Y C;  4Z2A A;  5I91 A;  1US2 A;  4NWW A;  2A3X A;  4MGQ A;  1VBC 3;  3TYJ A;  4IXL A;  2Q1M A;  1JBC A;  4FPH A;  2VZ3 A;  2BBV A;  4ZZ5 A;  3O1U A;  1UY4 A;  2RMU 1;  2R16 A;  2VQ0 A;  5JOX A;  1RTV A;  1GZT A;  1N3P A;  3AKS A;  3OEA A;  3RZM A;  3CKH A;  3AJY A;  1XQN A;  4QX2 A;  1QEX A;  1V00 A;  4XQD A;  3W21 A;  5ISL A;  2RR1 3;  2CGP A;  4QX3 A;  1PNG A;  4IEV A;  4BM8 A;  4J1X A;  2K9Z A;  3VBS C;  3H0O A;  1JXN A;  1YEW A;  4I3P A;  4Q29 A;  3U78 A;  1S2K A;  2WAA A;  3RZK A;  4DOU A;  1GR3 A;  1UCX A;  5CIR A;  3KT1 A;  5FYB A;  3VBS B;  4ASK A;  4CUB A;  3S6P A;  4CEW C;  2WQZ C;  2E6V A;  1FX5 A;  3KCC A;  2A6Y A;  2YMZ A;  1NY7 2;  1ND2 A;  2YXS A;  3QBQ A;  5A6Y A;  4YVW C;  4UF0 B;  1LHU A;  1ULE A;  1UO9 A;  4ZS3 A;  4CEW B;  5FTT C;  4HET A;  1OHF A;  4YVW B;  4XFH A;  4CP1 A;  3MPP G;  5LBC A;  1QH6 A;  5A7N A;  2VCC A;  1ENR A;  1FOD 2;  1ZYB A;  3HIF A;  2XQR A;  3GF6 A;  3U14 A;  4XVH A;  3PTR B;  4Q4W 1;  1W28 A;  3WP4 A;  1G9C A;  1O4Z A;  2ZML A;  3NAP A;  1GP6 A;  3UJQ A;  2LS6 A;  2VE1 A;  2EAK A;  1S0I A;  3T1L A;  4AAX A;  4BPZ A;  2JD9 A;  1DG6 A;  1QXP A;  1N3Q A;  1VLN A;  3AK0 A;  2DVG A;  1AL2 1;  1UMZ A;  4HSJ A;  4NAO A;  3CDZ B;  2CGO A;  1UQX A;  2JDK A;  4K8F A;  4CDX A;  3LEI A;  1K5M C;  3VBF A;  3BYW A;  1CAU B;  4W4Z A;  4JQR A;  4COW A;  5FZ6 A;  4IV3 A;  1UX6 A;  1K5M B;  3ES4 A;  3CIH A;  3H8U A;  1SZB A;  1QOO A;  3VBU C;  1UKR A;  4IUG A;  3AYA A;  1MS5 A;  3VKF C;  3GDB A;  3RVH A;  1UW8 A;  3ACG A;  4QXH A;  4Q4X 2;  3VBU B;  2JEC A;  3ZN5 A;  2Y64 A;  1AHS A;  4I02 A;  4NHY A;  1LOG A;  1FMD 2;  1HRI 1;  4WVM B;  1PO2 1;  3WDU A;  1PGW 2;  5KXB A;  1C1L A;  4RS5 A;  2BW8 A;  4DB5 A;  4BWO A;  5F5A A;  2V5Y A;  2HWC 2;  3RZL A;  1DQ1 A;  4JDN A;  2Q30 A;  3KHC A;  5LW9 A;  2OVU A;  3FUQ A;  3KCY A;  1W2U A;  3OUI A;  4LHN A;  1FNY A;  4G4F A;  1JYW A;  1UY0 A;  2D97 A;  3WF1 A;  1Q8P A;  4R9D A;  3QH6 A;  3TB0 A;  5FYC A;  1LHN A;  1N3O A;  1U12 A;  1ZZ9 A;  2J7M A;  1A8D A;  2XBO 3;  5GZE A;  1ZRR A;  2SLI A;  4O7X A;  1BJQ A;  3HN3 A;  4IE0 A;  4JZR A;  2Z4F A;  2O0O A;  4KWU A;  1VBA 3;  2UU8 A;  3OPT A;  1W6M A;  1KGY A;  1TZO A;  1ZVF A;  1YO8 A;  2G9G A;  4K8R B;  2RM2 3;  4Q4Y 1;  5FJK A;  4AAP A;  2Q0A A;  4EZH A;  1D4V B;  4NPR A;  4O9E A;  4X8P A;  3WEZ A;  1A6C A;  4HOO A;  3I2K A;  1JZ3 A;  2Y38 A;  4HT1 T;  5T55 A;  4P5Y A;  4NRM A;  3M3C A;  4UT5 A;  3GGL A;  2YG0 A;  4YGC A;  5A1L A;  5K8S A;  4DXT A;  3MZH A;  4IDZ A;  4YFW A;  1G9B A;  3GXU A;  2CAV A;  2AEZ A;  3KVA A;  5C3P A;  1TE1 B;  4D6S A;  1RMU 3;  2JDP A;  1PM4 A;  5EYX A;  3IM0 A;  5JI7 A;  2WJS A;  4Q8K A;  1BCX A;  5ACA 1;  2BYV E;  4GIQ A;  1FAT A;  4XJU A;  5J36 A;  1JTZ X;  3B5L B;  3BB6 A;  3LQC A;  3HQU A;  3G6J B;  1YHF A;  4ZU5 A;  4CU7 A;  5FYI A;  3OBT A;  5IHR A;  1UPS A;  1NCR C;  2JE7 A;  1UMI A;  4W6X A;  2ORX A;  4NIG A;  2WKK A;  5DDJ 3;  3IPV A;  4NIH A;  5F5I A;  3OY8 A;  3GCX A;  1NCR B;  1R1A 3;  3J26 N;  4LHK A;  1QJY 2;  4PI0 A;  2YFU A;  3C7F A;  4LNV A;  4AYU A;  4UXA A;  3AYE A;  1BXH A;  4XC9 A;  1ULF A;  3L9J T;  2VME A;  2A6X A;  2ZHN A;  4ATE A;  3LGR A;  4YVS C;  4COV A;  1RUF 3;  2JB4 A;  3WXP A;  1Q8V A;  2GSY A;  3GZU C;  2E7T A;  3KLS A;  1IPS A;  4M0N A;  5A7W B;  4YVS B;  1D2Q A;  4JTN A;  3VBO A;  5FYT A;  5C3R A;  3AZX A;  3UES A;  3DN7 A;  2GC3 A;  4K40 A;  3WQ7 A;  2Z5W A;  1S0D A;  5FK8 A;  1J1T A;  1QWR A;  2YBS A;  4HSL A;  4YFZ A;  4YZ3 A;  3K46 A;  1ZX5 A;  1W0P A;  2R07 2;  3WG3 A;  2LRO A;  3A0N A;  2RDR A;  1TNR A;  1YLL A;  3HN1 A;  2J22 A;  4A3X A;  2QBX A;  3BOW A;  1GWL A;  2OT7 A;  1RHI 3;  2ZEW A;  2WS9 2;  1PO1 1;  2NM1 A;  3FWE A;  3V0B B;  4FPJ A;  4EN6 B;  2BGC A;  2Q8E A;  3HD8 B;  3I2J A;  5SV8 A;  3RYK A;  1CWP A;  3TAY A;  1PVX A;  1CAV A;  4DS0 A;  1X9P A;  4K6B A;  2LM3 A;  3WIN E;  4FPE A;  2HYK A;  2BEO A;  2Y34 A;  2GMP A;  3TN9 2;  2PQQ A;  1TG7 A;  3OGJ A;  2Y33 A;  3ZOI A;  3M1H A;  1OQ1 A;  1IPJ A;  4XMI A;  3KGL A;  3RQ0 A;  5CA6 A;  1RUJ 2;  2YU1 A;  2YBK A;  1GZ9 A;  1PZ7 A;  4GMP 1;  4N90 A;  3O7O A;  4Q0S A;  5BXX A;  4FSJ A;  1XC6 A;  1FV2 A;  3PU3 A;  4H3W A;  3LOB A;  2RDS A;  1O4T A;  5CFD A;  1M4W A;  3U75 A;  1FV3 A;  2W1Q A;  2P3Y A;  3TNQ A;  4AXO A;  2RS5 1;  3O0X A;  5JXJ A;  4ARY A;  2IFR A;  2R04 2;  4J25 A;  1URX A;  1AR7 3;  2AAC A;  4EWD A;  1D0G A;  2GNT A;  3R0R A;  4MLO A;  4YM1 A;  2XUM A;  3WCR A;  1SMV A;  2VMH A;  2CYF A;  5FIX A;  2RS1 1;  2VOK A;  5K7P A;  2X5I C;  1A78 A;  3EBR A;  4FFG A;  4MGS A;  1DGR N;  1X8M A;  2X5I B;  4YNI A;  4CDQ A;  4YGB A;  4LPL A;  1RUC 2;  4KWL A;  3AXD A;  3I3B A;  4YW6 A;  5LBB A;  1W99 A;  3MIH A;  4R4X A;  3UKN A;  5HCH A;  4XUN A;  3MHZ A;  3POS A;  1U5I A;  1SDW A;  2CWS A;  2VMF A;  4B1L A;  4IEX A;  3GZA A;  4L97 A;  1DFQ A;  4V1P A;  4QD2 A;  2W92 A;  1AR9 2;  3VDB A;  1CZT A;  1YYN A;  3KV9 A;  1OSG A;  5ANQ A;  4E8C A;  1Y7B A;  4XBQ A;  4XF1 A;  2QKD A;  3VB9 A;  2HWE 3;  1XNA A;  2D6O X;  4QPG C;  3SIT A;  5JI9 A;  3DPR A;  4I2O A;  1OQD A;  2C1F A;  1W9S A;  2J1S A;  3USU B;  4QPG B;  1OUR A;  1JH5 A;  5IFT A;  5J09 A;  3WP5 A;  4W65 A;  2WSU A;  4XFA A;  5FP7 A;  1LUL A;  5K0U C;  2J1A A;  4I01 A;  1S2B A;  3W58 A;  3VBH C;  5FYS A;  1RXG A;  1ENX A;  1ENS A;  5HI0 A;  5K0U B;  2VQU A;  2YUE A;  1C28 A;  1YFW A;  2F4P A;  4AEM A;  1YIF A;  4C0B A;  5I93 A;  1QJX 3;  4FQZ A;  2B42 B;  3VBH B;  5JOW A;  1SFN A;  4LLF A;  1OH4 A;  1AR8 2;  2BFU S;  2WZR 3;  1C8M 1;  2DFB A;  4LO6 B;  4XXA A;  3THC A;  5FP3 A;  3LDB A;  4JKK A;  5FUP A;  5CAD A;  2TBV A;  1OFS A;  1JYC A;  3GCW A;  1O8S A;  3A22 A;  4KI5 M;  4Y22 A;  4XDQ A;  4TZD A;  2VNR A;  2PAE A;  4S2F A;  1QJU 3;  4RHV 3;  3ZVX A;  5CVR A;  5EV7 A;  3EYP A;  4BQ2 A;  2QZ3 A;  2P1B A;  2WFP A;  1XB9 A;  1W6Q B;  4CXW A;  5JMC A;  3DV8 A;  1O5U A;  4UFH A;  5J7M A;  1RIR A;  2E7Q A;  5IVC A;  3CO2 A;  1YJK A;  3PUI A;  1OT5 A;  3DYP A;  4R9B A;  3J9S A;  4Y33 A;  5JZG A;  5C8C A;  4N53 C;  1UZV A;  2XKP A;  4XIK A;  4AHW A;  2H6B A;  1IS3 A;  2BJS A;  3S0M A;  2GH8 A;  5F3G A;  3PUA A;  4IV1 A;  1WCS A;  2BU9 A;  2EIG A;  2W91 A;  3KM5 A;  4N53 B;  5E6H A;  4CEY A;  1UPI A;  5LA1 A;  3K3N A;  1V9U 3;  2HEY F;  3T4H B;  1DIW A;  5BY5 A;  2ZX4 A;  1CAX A;  3FZ3 A;  4LR4 A;  5D8A C;  1AR6 1;  1O5L A;  4QB2 A;  1UMH A;  3E5Q A;  5FPL A;  3KZ4 C;  1VB4 A;  4YRD A;  5JCT A;  3CU7 A;  5D8A B;  4XDP A;  2LTN A;  4AEK A;  2XJV A;  3J8F 3;  3WQ0 A;  5JAX A;  4XFI A;  5FPZ A;  3NL1 A;  2HYX A;  4JVA A;  4CA9 A;  2HWD 2;  1GOH A;  1VBE 3;  1W3X A;  4XAA A;  2H0V A;  3O1S A;  4NIA A;  3T1M A;  1CIW A;  3VZJ A;  2YPD A;  4Q4V 2;  2GAU A;  4XFF A;  5I0R A;  1GNZ A;  4M3C F;  3ZFE A;  1G86 A;  4FOY A;  1X50 A;  5FZD A;  5F2S A;  3ZPY A;  4ZPI A;  1NLS A;  2ZGP A;  3VZK A;  3MV1 1;  3WT3 A;  4DXZ A;  4B29 A;  3WOG A;  4FCA A;  1BBT 2;  3MIE A;  2A71 A;  4QX0 A;  1R09 1;  1RUI 2;  3M8L A;  4GAZ A;  4L92 A;  3ORJ A;  5FUN A;  5E1R A;  2A7A A;  5IUQ A;  2Q4S A;  2VUA A;  1H2M A;  3VGI A;  4AFD A;  5ABJ A;  2V72 A;  2EIB A;  5LY1 A;  2X8K A;  1LOD A;  2C6S A;  4Z82 A;  1I3H A;  2AC1 A;  4ARX A;  3MDP A;  5AC9 2;  4D7Y A;  2ZGR A;  2HBT A;  1C1F A;  3BUC A;  4YGD A;  2IXH A;  5F7U A;  2ZZJ A;  4PIZ A;  3WF4 A;  4OYU A;  1W3V A;  4MXW B;  2VVD A;  4E4D X;  3RSJ A;  1CJD A;  1OF3 A;  2UY8 A;  2CL2 A;  3FL7 A;  4LTA A;  5IK5 A;  4ASM B;  1ZRE A;  1QU0 A;  3IZO A;  3IB3 A;  3BKZ A;  4PIY A;  4QGM A;  3LZZ A;  4MUV A;  5GLT A;  2VQA A;  5IVB A;  5D2A A;  4BA6 A;  2R30 A;  2WO2 A;  2XHN A;  2YFZ A;  4UF0 A;  5FMB A;  4ITC A;  5FO7 B;  2HWB 1;  3ZN6 B;  2DBI A;  4FFH A;  1LOB A;  2WDB A;  1ONA A;  4YVW A;  5A3O A;  4CXY A;  4JDO A;  2AR6 A;  4D69 A;  2VMI A;  1PGS A;  4MH0 E;  1GSL A;  5FZH A;  4FOV A;  1QF3 A;  4HKL A;  4WM7 A;  5CKN A;  4OHY A;  4XFB A;  1S0C A;  3TEX A;  4LUK A;  3ZSE A;  4CCO A;  1AJK A;  1C57 A;  2ID4 A;  4C1X A;  4KGQ A;  4JCK A;  3I97 A;  4Q4X 3;  1O3Q A;  3WR0 A;  4E4H A;  1FMD 3;  3OYW A;  3SCF A;  1UIK A;  5IAX A;  1LOF A;  1Q43 A;  2V4A A;  1WMD A;  4HG6 B;  3ITQ A;  5KXE A;  3DCQ A;  1CAU A;  2HWC 3;  2ZEZ A;  1W6O B;  2WNV A;  2VW2 A;  3PVN A;  4LUL A;  4MHU A;  1XND A;  3WW1 A;  3L2H A;  1J3R A;  2JG9 A;  1RJ8 A;  2VBD A;  4O9G A;  4YG0 A;  2ZHM A;  2XBO 2;  4Q5O A;  2ZHL A;  2VMG A;  1DQ0 A;  1W8O A;  2Y26 A;  1YI7 A;  4CVU A;  4AVA A;  3VBU A;  4CP9 A;  1KEX A;  3VZM A;  3AZW A;  1JYT A;  1VBA 2;  1DF0 A;  3SH3 A;  3D5O A;  4YZ1 A;  5JOY A;  4YM3 A;  2DU0 A;  4LHL A;  5FMO S;  3H7J A;  4WVM A;  2QDR A;  1CVN A;  1MS0 A;  5F5Q A;  3R6S A;  3WNX A;  3P3N A;  3ZYR A;  3ZSK A;  3GM8 A;  4GB3 1;  1AXY A;  1POV 1;  3MPB A;  1KFU L;  1MS4 A;  2ZAB A;  3GYD A;  2ZX3 A;  4JGZ A;  1DZQ A;  2QQW A;  3DUI A;  4GWN A;  4YW3 A;  5C71 A;  1S1A A;  2ARC A;  1ODN A;  1MS1 A;  4HLT A;  5I8Y A;  2FCV A;  3VLB B;  5LCW L;  3LDR A;  3RMX A;  5HCA A;  1F5J A;  1V6N A;  1XNC A;  2LUW A;  2E32 A;  2UWB A;  3HAG A;  5T5P A;  2Q5T A;  4ISQ A;  1VRH 1;  5A80 A;  1A3K A;  1APN A;  4HVR A;  5JSO A;  1W8T A;  3GHM A;  5DDJ 2;  5FZ4 A;  5KHH A;  1OMI A;  4N7I A;  4L11 A;  3SKJ E;  4LE3 A;  4AWD A;  4UOJ A;  1XE7 A;  1RVF 2;  1VAV A;  1OA4 A;  2C5D A;  2PHF A;  1QJY 3;  1BKZ A;  1GP5 A;  1HRV 2;  3LF7 A;  4QDQ A;  1DGR A;  3AMP A;  3WDT A;  3ZDV A;  3WUC A;  4QHZ A;  4LO4 B;  4UYB A;  5C5U A;  5C4W A;  1AXK A;  1TNF A;  1D4M 1;  1TEI A;  2PFW A;  2D6K A;  3ME2 A;  2XXZ A;  2RE9 A;  4LA3 A;  4ZXE A;  3ZYB A;  5BUV A;  4FTE A;  2LRP A;  1BEV 1;  3Q8A A;  3RZJ A;  5C33 A;  5DAX A;  2FCU A;  1YRZ A;  1EPW A;  3AVR A;  3I3Q A;  2R06 1;  3FLR A;  1XNT A;  3VV1 A;  3I8T A;  4I30 A;  2WFF 2;  2R07 3;  3URF A;  2CWM A;  1VJ2 A;  4O61 A;  5FAX A;  2Y0O A;  3WZ1 A;  3KS7 A;  1FXZ A;  4Q8L A;  1PVC 2;  1X7N A;  3GZE A;  3M3O A;  3OD0 A;  2WS9 3;  5F2W A;  4LIU A;  2DVD A;  2ES3 A;  2Z79 A;  4A7Z A;  2N7G A;  1LHV A;  2VOX A;  5A7W A;  2YC0 A;  1OUX A;  5C8W A;  5A3W A;  4XIL A;  4BK4 A;  3PL0 A;  2VZP A;  3WNK A;  4BQ1 A;  4LBJ A;  2YGM A;  3DYM A;  3TN9 3;  5FY7 A;  1UOB A;  2D3P A;  1V6J A;  3MLK A;  3B69 A;  3RWK X;  5G04 L;  4P9I A;  1NG0 A;  5E88 A;  3SMH A;  4E8D A;  5LA0 A;  2Y6K A;  3JBG 2;  2HWF 1;  1RUJ 3;  2PHR A;  2ETE A;  1G9A A;  5D1I A;  2G19 A;  1KXG A;  2VMD A;  4PHZ A;  3M2M A;  5F32 A;  1OF4 A;  1ZZ7 A;  2WO3 A;  3WDY A;  4DIQ A;  3V0B A;  4TLG A;  2BNM A;  4LBQ A;  3RMY A;  1J1L A;  5EWS A;  2A6Z A;  3ZFF C;  2PHW A;  2D5H A;  2RG4 A;  2A75 A;  5IVY A;  2ET7 A;  2R04 3;  5FMO L;  3ZFF B;  1OKO A;  2XWB B;  4HK8 A;  1LEN A;  4S2G A;  1KS4 A;  1W0N A;  3ZYP A;  3JU9 A;  4D94 A;  3N9M A;  2X53 S;  3N7L A;  1V6O A;  2UYA A;  4PF5 A;  4OI4 A;  2ZGT A;  2XDV A;  1H8T C;  1I5P A;  1WLT A;  4PIX A;  4CXX A;  5F39 A;  3AP4 A;  4C91 A;  4Q0Q A;  3HPN A;  3C2U A;  4BQY A;  1H8V A;  3LEM A;  1H8T B;  1H2L A;  1H1A A;  4EE2 A;  1K42 A;  3AP7 A;  1RUC 3;  1NE4 A;  1IHM A;  4UW5 A;  5F6K A;  3O1M A;  4P9J A;  2YRO A;  5ERL A;  3B01 A;  4CP0 A;  1RUE 2;  5FXZ A;  3CJX A;  1RUG 1;  4XJA A;  1WME A;  1L7R A;  2PHL A;  1AR9 3;  2E26 A;  1PK6 C;  3T0D A;  5CFC C;  2VNG A;  2IC1 A;  2IUW A;  4L9B A;  5IVF A;  2OKX A;  1PK6 B;  1WW6 A;  5CFC B;  5FPA A;  1HXS 2;  2BV4 A;  2OA2 A;  2YZ4 A;  4KMQ A;  1OFN A;  5FMC A;  3WF3 A;  1MVE A;  3U4X A;  3H8R A;  1JOJ A;  5HXM A;  2PHD A;  4Q2F A;  3VD3 A;  2QQO A;  4JRL A;  4QWN A;  3DXU A;  1XNK A;  2GND A;  4WBB A;  4NR1 A;  3ETQ A;  2W94 A;  4M4P A;  4XBL A;  5HV4 A;  3L2Y A;  3RNS A;  2XUE A;  2DTW A;  3BTA A;  1VMH A;  4CPB D;  3EXU A;  5A1F A;  1HKD A;  5L9B A;  1GQP A;  1VIW B;  5L73 A;  5GLU A;  3TNP B;  4AFB A;  4ET7 A;  2A5Z A;  3LB9 A;  1UWW A;  3USU A;  1ASJ 3;  1NLQ A;  2JG8 A;  4XHB A;  5FO9 B;  3OGR A;  3T3Y A;  1U5Z A;  3VD9 A;  2W2I A;  2RV9 A;  1UN1 A;  4MGK E;  1W8N A;  5FZI A;  3MF9 A;  1W2T A;  4IEO A;  1VBC 1;  3IN9 A;  3J7M A;  4QT6 A;  5A3M A;  5K0U A;  4KWK A;  4GJY A;  1BMV 2;  5FRA A;  1GQG A;  2ZGS A;  2JDH A;  3CQO A;  3ASI A;  3VBH A;  2VVF A;  1ZA7 A;  2B9U A;  3PTY A;  4QB1 A;  4AE2 A;  2J1V A;  4DXR A;  4GH4 C;  3N9P A;  2RR1 1;  2VOW A;  3ACL A;  4RGK A;  5FOB B;  2BWA A;  4GH4 B;  2XJP A;  2OZJ A;  4R52 A;  3T30 A;  4URA A;  2VH9 A;  3O1P A;  4YW4 A;  5JIA A;  4K1Z A;  5J98 B;  1W6Q A;  4LK7 A;  1SQ4 A;  2Z2S B;  2PHX A;  1NOV A;  2XWJ B;  1WMF A;  3KF3 A;  4P02 B;  3B9C A;  4ZS2 A;  1AJO A;  1DZR A;  1MEC 1;  2J1R A;  2EID A;  4LKF A;  3AYC A;  3I3E A;  2AH2 A;  3KB5 A;  5I0S A;  1B35 A;  1WWY A;  3CLP A;  3NWK A;  4QPI C;  5FBJ A;  5IK7 A;  1UYP A;  2W1U A;  4P9W A;  3WUD A;  3WNM A;  2IXL A;  3VKL A;  4CYD A;  4N53 A;  3JD7 1;  1JYX A;  2HWD 3;  4OLL A;  4QPI B;  4FTS A;  2GNB A;  3Q8B A;  4PBO A;  1UF2 C;  2W68 A;  4Q4V 3;  2RS3 2;  3ZIW A;  2VZT A;  1DBN A;  4EYU A;  2P5B A;  5FJH A;  1K12 A;  3FLT A;  3NVC A;  4UAP A;  2BER A;  2PMW B;  1F15 A;  2V4V A;  2GME A;  1GZC A;  1BBT 3;  1ULO A;  3WG2 A;  3H1Y A;  2R6Q A;  1RUI 3;  4U2A A;  4LT5 A;  5FYZ A;  3ECQ A;  5A7P A;  2DBN A;  1S2E A;  2NPI A;  2B39 A;  1JN2 P;  3H8X A;  5LZ6 A;  1FPN 1;  3ZMN A;  5AC9 3;  1LES A;  2WNU C;  1O59 A;  4BLI A;  1H6X A;  3PMS A;  5C7G A;  1T6B X;  1F8V A;  1Y9Q A;  2YC4 A;  2WNU B;  4MET A;  4XCA A;  1R08 1;  2QQI A;  2QQV A;  4AI2 A;  1AXZ A;  5CAZ A;  1SCR A;  3EMR A;  4OQ9 A;  5IK4 A;  4A6O A;  5M0T A;  3N3H A;  1V6L A;  3I2D A;  1NAE A;  4PQQ A;  5T54 A;  2VM9 A;  2OUH A;  3VKN A;  3TEY A;  4DRR A;  2ZAC A;  1HB2 A;  3I2G A;  3POY A;  4GKX A;  4M4R A;  2EXJ A;  1VPH A;  5CG8 A;  2QUO A;  4PT6 A;  5BNO A;  3KD4 A;  1COV 3;  1W06 A;  2DUP A;  2VOT A;  5CIS A;  3RZH A;  3PUS A;  3KHB A;  4LBN A;  1SLI A;  2J42 A;  3NV3 A;  4XF0 A;  2YY1 A;  1T2X A;  2RM2 1;  4K21 A;  1MS8 A;  1WBL A;  4XIO A;  5FLI A;  1VE0 A;  2QJV A;  4MXW A;  4XBN A;  4ZU7 A;  1WCU A;  2QQU A;  5B4X A;  1ULP A;  2VY0 A;  3LIG A;  4OI1 A;  5J37 A;  4WM8 A;  2F17 A;  2ARB A;  1DQ4 A;  1QJZ A;  1J58 A;  3JQW A;  4IW3 A;  4LKS A;  4CDU C;  4NID A;  1EAH 2;  3LA3 A;  5A3P A;  1DCS A;  4IGP A;  4CDU B;  4D7S A;  5EIY B;  2WNO A;  1WA6 X;  4KBB A;  2GH2 A;  1NXD 1;  3OCP A;  3ZN6 A;  3J7N A;  4N43 C;  4A7K A;  4IES A;  5FZG A;  1I5Z A;  4MGZ E;  1R09 2;  4YG3 A;  2GP5 A;  3LAG A;  4Q27 A;  4KU7 A;  1GZW A;  4LE4 A;  4N43 B;  3ZYH A;  5FDB A;  1S55 A;  2WQ4 A;  1S0J A;  2OXB A;  2WO1 A;  4XUO A;  5C70 A;  1GNH A;  4I0W B;  4QKB A;  3JB4 C;  2QDN A;  2UYB A;  2WN2 A;  4LOT A;  4LBO A;  1R1A 1;  1DYO A;  3TWI A;  2WYS A;  1IQD C;  3A4U A;  3BIW E;  4Q1R A;  4Q0U A;  3EHK A;  4M01 A;  3KV5 A;  4AL9 A;  1WA4 A;  4E2Q A;  4FOW A;  5BNN A;  4DQA A;  3MBW A;  3QD6 A;  1VAL A;  5HCF A;  1Q5O A;  1QDC A;  1VMF A;  3M7A A;  2Q8O A;  3SH5 A;  4FPL A;  5I8T A;  1F9K A;  1X8E A;  2FCT A;  3H1M A;  5C9A C;  5GZF A;  2YYO A;  4H2A A;  2FHR A;  4LQR A;  5F3I A;  5AVA A;  5GZC A;  3AYD A;  1S0F A;  1W6O A;  3AL5 A;  5CNA A;  2ZOE B;  4ONU A;  5C9A B;  1X33 A;  1F2N A;  3LOI A;  4H14 A;  5FQ0 B;  1YI9 A;  4Q4W 3;  4RFR B;  2FDH A;  3KSC A;  4A45 A;  1FI2 A;  2C0Z A;  2WR9 A;  4CCK A;  1QHD A;  5JPN B;  2ORZ A;  3E1F 1;  3IDA A;  5A32 B;  4KG0 A;  1RHI 1;  4XAB A;  4FFI A;  5F1R A;  1VBB 2;  2R1D A;  2J1E A;  4Y4Y A;  2D5F A;  4RYD A;  1GLH A;  4ZHN A;  1IG0 A;  5JIU A;  2OQ7 A;  4WZC A;  5TSW A;  3BI3 A;  3LD8 A;  3NW4 A;  4QAW A;  3WSO A;  5A3N A;  1DU3 D;  3ZM8 A;  3WDW A;  4OI2 A;  3WNL A;  1KJR A;  2B9V A;  3OPZ A;  3D4K A;  1OBN A;  4GWM A;  1K45 A;  2P37 A;  4BQ3 A;  1RVF 3;  5EHD A;  5I8S A;  1SLB A;  3DF0 A;  1HRV 3;  1W39 A;  3AKT A;  2O8O A;  3FUO A;  3NNF A;  4FPG A;  4NRO A;  4IEU A;  3VZN A;  3W20 A;  3CL1 A;  4OUM A;  4FP3 A;  1ULC A;  5DQ0 A;  2ZMN A;  2QE3 A;  2OPK A;  2QQK A;  3WQ1 A;  3JB8 A;  2WNE A;  4M0H A;  4XF4 A;  4IGQ A;  1NA1 C;  4XUQ A;  1TQ5 A;  5EFU A;  5KHK A;  3WV6 A;  1AR7 1;  5BPX A;  4AF9 A;  1NA1 B;  3I4I A;  1GAN A;  3PVO A;  1GQH A;  2B45 X;  4NWV A;  1HQN A;  2R0F A;  4YW5 A;  4XXP A;  5EJ3 A;  5H9S A;  4MGY E;  1W8F A;  4YM0 A;  3ZXA C;  1LR5 A;  1ZBE 2;  2VW0 A;  4NII A;  3U11 A;  4BQW A;  2WFF 3;  3N36 A;  4U36 A;  1PGL 1;  1ND3 A;  5IW0 A;  5I0D A;  1ODM A;  1YXW A;  3H9A A;  5K9Y A;  1H9W A;  1Y4W A;  4DXS A;  2B46 X;  2VZO A;  1OC1 A;  1PVC 3;  1W2N A;  1EV1 1;  2ZAA A;  3FBY A;  3POF A;  4CCL A;  4Q4Y 3;  1JYV A;  3DEM A;  1BVP 1;  2PHT A;  5KBF A;  5G05 L;  3S7E A;  4XFG A;  3MUZ 1;  1XU1 A;  3S7I A;  5F37 A;  1SLL A;  2XJR A;  3MID A;  3WX5 A;  3PUQ A;  4HFS A;  2XLA A;  4Y20 B;  5LA9 A;  2BP6 A;  5BNP A;  3V56 A;  3MIC A;  2NQY A;  3WF2 A;  3VHP A;  1J59 A;  2ZA9 A;  1PIV 1;  4JX0 A;  2FMD A;  5GKA C;  3JBG 3;  4BXF A;  4COZ A;  3RFR A;  4YGE A;  1H2K A;  1PX3 A;  3I59 B;  3VBR C;  1H6Y A;  1F31 A;  1SFP A;  4Z1V A;  2FDJ A;  2HWE 1;  3H7Y A;  4ZXK A;  2WAO A;  3VBR B;  3TEZ A;  1ST8 A;  3ZN4 A;  3CMG A;  1JZ5 A;  1CAW B;  1I9R A;  4OQ8 A;  4KU8 A;  1UL9 A;  2XL9 A;  4BCU A;  3R4U A;  4NRP A;  3CJI C;  5JXI A;  3JCI A;  4GWI A;  1OH3 A;  2H6C A;  1LTE A;  2V5D A;  1N1S A;  3WNO A;  5FCC A;  3CJI B;  4OHZ A;  1GYK A;  4IGO A;  3UL2 A;  5CG9 A;  4DY5 A;  1R64 A;  3QH7 A;  5GLZ A;  3MEP A;  2Y6G A;  5FXV A;  1QJX 1;  1OI6 A;  3UJO A;  5KXD A;  4MGT A;  4CCM A;  3PJQ A;  4AFC A;  2WZR 1;  1LKN A;  1IG3 A;  5DAP A;  1JUH A; 
#chains in the Genus database with same CATH homology
 3HQU A;  3PL0 A;  2FCT A;  3W21 A;  5IAV A;  5HV0 A;  4XC9 A;  2G19 A;  4XAC A;  5IAT A;  3KT4 A;  3KT1 A;  5LAS A;  5LBE A;  2RDN A;  2RG4 A;  4XAB A;  5LB6 A;  4BQX A;  4KBZ A;  5IAX A;  2V4A A;  2OPW A;  5EP9 A;  3ITQ A;  5LBC A;  2HBU A;  3NNJ A;  3OBZ A;  3OUH A;  2RDR A;  4MHU A;  2A1X A;  3KT7 A;  2G1M A;  4Q5O A;  4NHL A;  5DAV A;  4BQY A;  2Y34 A;  3NNF A;  4NAO A;  3W20 A;  2Y33 A;  4XCB A;  5ERL A;  2JIG A;  4XCA A;  2RDQ A;  3HQR A;  2RDS A;  4NMI A;  3EMR A;  5M0T A;  3NNL A;  4XAA A;  5DAW A;  4NHY A;  3DKQ A;  4BQW A;  4J25 A;  2FCV A;  5L9V A;  4NHM A;  3GJA A;  5EPA A;  5LBF A;  4ZPI A;  3OUI A;  5HV4 A;  5LA9 A;  3OUJ A;  4JZR A;  5L9B A;  5LBB A;  5L9R A;  5A3U A;  4IW3 A;  3BVC A;  4NHK A;  5C5T A;  5C5U A;  2JIJ A;  2HBT A;  5EQU A;  3MGU A;  4NHX A;  4Y5S A;  4ZON A;  5DAX A;  2FCU A;  3NNM A;  3GJB A;  4UWD A;  3GZE A;  4MHR A;  5DAQ A;  4Y5T A;  5LAT A;  5DAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...