2TUNA

Conformational changes in the (ala-84-val) mutant of tumor necrosis factor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
151
structure length
151
Chain Sequence
b'TPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIVVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR NECROSIS FACTOR-ALPHA
publication title Conformational Changes in the (Ala-84-Val) Mutant of Tumor Necrosis Factor
rcsb
source organism Homo sapiens
molecule tags Lymphokine
total genus 23
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tunA00
1D2QA 3WD5A 1PK6C 2ZJCA 4F3JA 4KGGA 2WNUA 2JG9B 3TWIA 1DG6A 2HEVF 4DB5A 2OIIA 3IT8A 4J6GA 1TNFA 1JTZX 5TSWA 1I9RA 2JG8B 4QQPA 1KXGA 1XU2A 4RSUA 5KC5A 1D0GA 2KA3A 4TSVA 2R6QA 1D4VB 1U5XA 2JG9A 5KC6A 5HBAA 4QQHA 3L9JT 3FC0A 4MXWB 4E4DX 2R30A 5L19A 3URFA 4QPYA 3K48A 2WNVB 4DOUA 2Q1MA 2R32A 4GIQA 3V56A 4N90A 1JH5A 2RJKA 4G3YC 1ALYA 4EN0A 1DU3D 5CIRA 2RJLA 4MXWA 1S55A 2X29A 2WNVA 2E7AA 2WNUC 1U5YA 3QBQA 2RE9A 3LKJA 5KWRA 4OULA 1RJ8A 2HEYF 1OQDA 2HEWF 2AZ5A 1C3HA 2JG8A 1RJ7A 1WCKA 1KD7A 1PK6B 4TWTA 3MI8A 3AB0A 4MXVA 4OUSA 4MSVA 3ALQA 4E4SA 3ME2A 1XU1A 5BNQA 2TNFA 4QQOA 2JG9C 4HT1T 2Z5WA 1TNRA 1U5ZA 2WNVC 3B94A 5L36A 3K51A 4QQLA 2Q8OA 1O91A 1PK6A 4QQ2A 3B9IA 2O0OA 2JG8C 2TUNA 1A8MA 2ZPXA 2QDNA 1IQAA 1OQEA 2WNUB 4KG8A 1C28A 1OSGA 4OUMA 3QD6A 4NN0A 3B93A 4D7YA 2QE3A 3TYJA 4KGQA 4G4FA 1GR3A
chains in the Genus database with same CATH superfamily
2EXIA 3ZFEC 5C6CA 2HKXA 1ENQA 3FUOA 2XBO3 1I1EA 2ZMLA 3NNLA 4LKDA 4NAMA 4P9IA 4K6BA 5LK7B 4KI5M 4Q4V1 2AEYA 1IS5A 1OOPA 4E8DA 2R7EB 1XRUA 3KB5A 3IT8A 3MV11 3PNAA 1X82A 3AKSA 2AACA 3N4MA 4NRMA 5GZCA 1AL0G 3G7DA 4NROA 3P5BA 1ND2C 1VR3A 2A6XA 1GP5A 2MEV2 3NSTA 5A6QA 5CA6A 2VMHA 2VZ3A 1HQWA 5FZKA 1W3VA 5DN2A 4L9BA 3N7KA 1ND3B 3NVCA 5DAXA 4PIXA 3VHPA 2DTWA 3JD72 2VQTA 3MBWA 5GJ6A 1PIV1 3ST7A 3KHBA 3UKTA 3ZFFA 1RC6A 4Q2FA 4NOTA 3T3YA 3MUY1 3RYPA 3M3OA 4PLMA 1WCUA 3K48A 1W6QB 2VMDA 5I8SA 4IGQA 5J37A 1I5PA 3U4XA 3SEEA 3KM5A 4PQQA 5FZLA 4XETA 5DABA 4FOVA 2WZEA 2J42A 2Y6FA 4BYYA 4OI0A 3MPPG 3NNFA 1W8FA 1MS5A 3ZXGA 3MIEA 3AC0A 3FUQA 2D7FA 3IWZA 3NQHA 4S2DA 3MO4A 3ZXAC 2VECA 4FPKA 1TE1B 2DFBA 1FV3A 1HLCA 1HQLA 5CIRA 2XVKA 2ET1A 3UL2A 3J7NA 5IUQA 3FFZA 4AWDA 2FHRA 2ADDA 4E2QA 4PI0A 2WS92 5LBBA 4CVUA 3C7OA 5FYBA 4INDA 2OXBA 5JOXA 2R041 2VNRA 1GZCA 3MIGA 4M3CE 1LHOA 4Y33A 5EXOA 5FMCA 4XDOA 1LTEA 4CTEA 1C8M3 3ZYJB 5FYYA 1WLCA 3VN4A 1R092 3LEIA 1UZ0A 1QJX2 1VBB1 4OUSA 2NN8A 3ZVXA 5FQ0A 4HSJA 4I30A 1H8TA 4C90A 2CWSA 3J8F2 4FP2A 3WQ0A 4PF5A 1DQ6A 3IPVA 1ZRCA 3WG2A 2ERFA 2RR13 1W8HA 3ZR5A 2CU5A 4CUGA 5BNNB 2Z5WA 1Z78A 3B02A 3M70A 2B4KA 5ANQA 2A6YA 1W2NA 4I0AA 5GALA 3MV01 4MG2A 4XFIA 1FI2A 4FBFA 5J7MA 5J36A 2DUPA 1KS4A 1ZRRA 2P3IA 2QQVA 4QDSA 4YW2A 1F5JA 3QACA 2A1XA 4AF9A 5FPVA 5EYYA 2WA3A 5M0TA 3VZJA 4CU8A 1OOPB 4XEZA 3ZO0B 5FREA 1VBC1 4BH9A 3PUQA 2Z42A 3Q8EA 1E5IA 4W6XA 3ORJA 2OZ6A 2ZX0A 2EICA 1AYM1 4YFWA 3RDIA 4EN8B 5A3UA 5LY2A 4CP1A 3H7JA 2DFCA 4QPIB 3DYMA 2ETEA 3J7LA 4LBQD 3GHNA 2EF6A 1KQRA 5A3NA 5F8PA 5C9AC 4LE4A 2I45A 3IAQA 2WO7A 4FXKB 4Z82A 3SITA 4LOTA 2F6BA 2R49A 1R64A 2UWBA 1REFA 1STMA 1URXA 1PVC3 3HT2A 1IGOA 4COZA 1XYNA 1IS3A 3GCWA 3ZFFB 1XOYA 4O61A 3OD0A 5JPMB 5BUVA 4YPJA 2RHPA 4JKLA 2YFUA 2K46A 5EJ1B 4QHOA 5FY8A 3WSOA 5KHKA 5CG8A 4Q29A 3PMEA 1UWWA 3HIFA 4N53A 2CAVA 5GLWA 3THPA 4QU1A 3PTRB 1MACA 2B9UA 5JOWA 3KQRA 2WFF1 1AR92 4QHBA 2Q30A 4EWEA 1H4GA 3SEPA 1TMF3 3VBHA 1NYWA 4B1LA 4Q4X2 2ORXA 3PU3A 4QQHA 5D8AC 4AEJA 5GZEA 3ZYIB 5EJ3A 4WM8C 2C4XA 2RS33 1NQDA 1JMUB 3T09A 3E6CC 2G9FA 3URFA 1IPKA 1POV3 1W2OA 3OUJA 4HLTA 4ZXEA 1UNBA 1W9SA 2B46X 2R1BA 2XWJB 2VVDA 1HN0A 2RS12 2FD8A 4AQSA 5IFPA 2QBXA 4XFAA 4RN5A 1QY4A 2B7YA 1RHI1 4B3NA 4CCJA 1XNCA 2AREA 2YMZA 2MNGA 2X10A 4HKOA 5H9SA 3SCFA 4A3XA 5BNNC 1QOTA 3KGZA 4A45A 2D98A 3ZYPA 4COWA 2WYSA 4LQRA 3ZN5A 1AYN1 5FQ0B 1SHWB 4Y1UA 5DDJ2 5LK5A 3ILRA 3WOGA 2ZAAA 5A80A 1SDWA 2ZKLA 5C70A 1H8TB 1VRH1 4ORFA 1HJGA 3F2ZA 3IPVB 4FTBA 1YJLA 3UESA 2W3JA 3MYXA 4W6YA 4YZ4A 3VBOA 3W5NA 4HVQA 4OLLA 4Z92B 2WUHA 4TXWA 1YRZA 4A44A 2RMU3 5FCCA 4JHZA 3DXTA 1QQP2 3EMRA 1MZ5A 3W21A 4A7YA 1ULGA 4E2GA 3UGGA 2UY9A 4QPIC 2WINB 4XIKA 3T1MA 1RUD1 4BMEA 1RUC3 1U12A 2W0XA 3T4HB 4BWOA 1AR61 4ASLA 3PUIA 4META 3LSDA 1GICA 4XOGA 1UX7A 2BQPA 1W03A 2XXZA 3WG4A 1NQJA 1V9U1 1VAKA 2VZTA 3R0RA 2D6OX 3VUOA 4DXRA 2BV4A 2P34A 3WNPA 3TNQA 3ZFFC 1ULCA 4FFIA 2YBSA 5FMOL 1IPJA 4WM7C 5CFDC 4QQ2A 2O0OA 2V09A 2D3SA 1WCQA 1Z0HA 2R16A 1FPN1 4AVBA 4YW4A 5A3TA 2CAUA 1UPIA 1OQEA 1CN1A 4IEZA 5EQUA 4Q4Y3 4XIOA 2CDPA 3UKVA 2VXRA 4N43A 1YNAA 1FAYA 2QZ3A 3LWCA 2Q4SA 1SFPA 3H8RA 1R1A1 2E63A 4I09A 3CU7A 1JODA 4AGGA 3LQCA 2HWF3 5E8AA 4COVA 2FDIA 3PDQA 4HFSA 5FYHA 2PELA 3NAPC 4N53B 5FJHA 1Y9GA 4UWDA 1UQXA 2QQMA 2PLV2 4LITA 1AR83 3N9OA 2ZAHA 1ZBA1 4CEYA 1BCXA 3VBHB 5ANNA 5C7GA 3LOIA 5A7PA 3ZYRA 2WAOA 1OPOA 1TME2 3AYDA 4IUGA 4IE4A 3ZSMA 3M4FA 4EN9B 1GFF2 1VBD2 1LOFC 1N1VA 4I01A 4I0BA 3ACLA 1H1IA 4LK6A 2WABA 4ZXKA 3CIHA 3LA7A 3WF3A 2RDSA 2R071 1UYYA 5B2GB 1UX6A 3AKPA 2HWC1 2ZA9A 1MS4A 3RYRA 1Q8OA 2FCUA 3SCGA 2KA3A 4PQ9A 5CAZA 1RL3A 1VJ2A 2HWB1 2VW0A 2WLPA 4DRRA 1QNYA 5FP4A 5ACA2 4C0HA 1WW7A 3L9JT 2WT0A 3WP6A 3ZSKA 4D6SA 1LGNA 4JGZA 4Y22A 5FYSA 2AUYA 1AXZA 1EAH1 4ATEA 5FDBA 1OH3A 1PZ9A 4RHV1 4XXPA 1PMJX 2W91A 4QB2A 1APNA 1CD3G 1NT0A 1QH6A 1DBNA 1RUG1 2VL4A 4X6RB 3VBOB 1AR73 4FCAA 1JZ2A 3K77A 5IVBA 1EV12 5EP9A 1MR5A 2Y6LA 3RGBA 5JIAA 3MF6A 1E5HA 2F4LA 1GYKA 1UF2C 3MEPA 4QKDA 2X09A 3KT4A 5F5CA 3PIJA 2C6SA 4OQ9A 1ZA4A 4XTPA 5FY0A 3PURA 3V64A 2PHWA 3GYDA 5FJKA 3LPFA 3WXPA 2EVXA 1COV2 1I3HA 2R061 4HVOA 4IEQA 4XJZA 4AEDA 1RUJ2 2GN3A 2YHJA 4MOAA 5FZCA 3WG3A 3WEZA 3FLRA 1HKDA 2LS6A 4UFIA 1JOBA 3SMHA 5E6HA 4QX7A 5IW0A 3KMHA 5JI7A 4J1XA 4EN6B 3P6BA 5CYYA 3RPQA 3WF2A 3VBRC 3WF1A 3MI8A 4LO4B 2ZGTA 2Q5TA 4CEWC 3O1SA 5AVAA 1MVEA 5A7SA 1JI6A 3VKFC 5AC93 1GV9A 5B4XA 1JHNA 3DCQA 1X33A 3FLTA 5DUUA 4HANA 4N43B 2RS51 2JB4A 3FL7A 5KHIA 4CCKA 2XJSA 1VMFA 1U5ZA 4NUBA 2ZOEB 3QLQA 4IV1C 4HN0A 4NWVA 4OHZA 5DZEA 4LBKA 3KCYA 2VZQA 3SKJE 5FLJA 4D7TA 1OA4A 2VMCA 1UMHA 3DKWA 3SH4A 1J59A 1RUF3 1W9YA 2HYXA 3FBMA 5A3OA 1MS9A 1J1LA 4CDQA 2E31A 3B5LB 1H8VA 3KVAA 4CEYB 2VQAA 2IVJA 1Y9MA 4NR1A 2YC2A 3IM0A 4XF0A 4BQ2A 1NA1C 3P3NA 1WD3A 4XVHA 2PYTA 2JE7A 4IEWA 4OI2A 3PLQA 2O1QA 5FXWA 4QAWA 2VBDA 2ET7A 2XQRA 3KZ4C 5FYCA 3IB3A 3N7JA 4GULA 5LA2A 4MH0E 1KEXA 2WC2A 3AP6A 2DVAA 3SNMA 2Y6JA 4Q4V2 1CAUA 5FO8B 2CSGA 4XQDA 3K4DA 1AHSA 1LULA 3WLUA 3ITQA 1S4CA 3VBUC 3ZPYA 5LBFA 4A41A 2X05A 4RFRB 5FK8A 5GKAC 3VKNA 4NWWA 2E32A 1CZSA 2HEVF 4FI9A 4MLOA 4JGZB 1RUE1 2PAEA 4Y22B 3OGVA 3HBZA 4MVTA 4XMAA 5A7OA 2ZGPA 1BBT3 3I3DA 5TSWA 1ZZ7A 4JTNA 1DQ4A 1Y3TA 4QQPA 3WW3A 2I07B 2BFUS 5K0UA 3GBWA 3O1UA 1NZCA 2AYHA 5F3CA 1PIV2 1D4VB 1U5XA 2WQ8A 3BN6A 4YNIA 2BBVA 4P9JA 4YFZA 1AL23 1ZX5A 1HRI3 1NXMA 1O8SA 2JB8A 4SLIA 1X8MA 5I8TA 5I0TA 1JYCA 3OGJA 1W6OA 4LBLA 1YLLA 2JWPA 4HL0A 5FZDA 3Q8CA 4QWNA 4AEDB 5FXZA 3NWKA 5JWPA 2BNOA 2JDUA 4M4PA 4YLZA 4N43C 2EXKA 3N9QA 4BZ4A 1PGL1 3VLBB 2B8MA 4K3UA 1H1AA 4DUWA 3DXUA 3JD73 4A42A 2FMYA 2YDEA 2EALA 1HB4A 5LA1A 3TEXA 5FP9A 2R042 1JOPA 4HPKA 1IS6A 4TYSA 2ATFA 3LF7A 1VAVA 1RYYA 1DZQA 2Q1ZB 2VOKA 2ZMNA 1AF9A 1B09A 3GBFA 1XXNA 2F4PA 1T6GC 3ILFA 3M3CA 4NHMA 4S2GA 3POFA 4LKEA 3HD8B 4OULA 5D21A 4H7MA 1VBB2 3H1YA 4ZONA 2WO2A 4UI9L 1ZRFA 2D6NA 2QQNA 3LZZA 5FYZA 1J3QA 4XJ9A 4ARYA 1OT5A 2KXLA 3LDBA 3NMBA 4BOWA 4MXVA 4CP2A 2WWUA 1SFYA 2ZX1A 3I2DA 3OBTA 5FKCA 2HJIA 1WCSA 2GMMA 3LA2A 2WS93 4XXAA 2IXHA 1KGYA 2GAUA 4QX2A 2VMFA 1GLHA 1JYTA 1NZIA 4QXCA 2BP6A 5GLZA 1ZA7A 5F2SA 3RRDA 3WNOA 4RQPA 3ROUA 1SMVA 1XE7A 1R093 2VUJA 3GZUC 3ZOIA 4YM3A 5FWJA 5FZ0A 2HWD1 2MPFA 5DG1A 5FZ8A 3H9AA 1WLWA 3ZFEA 3HN1A 3N7LA 4XHBA 4AVCA 3CZJA 3LAGA 3MW3A 3ZDVA 4AHWA 1CAUB 3NO8A 5FO7B 1VBC2 2FDJA 3J8F3 4UFJA 1X36A 3SKVA 1PGSA 2ZGQA 4TTGA 4D3WA 1C28A 1AYM2 3AJYA 3VDBA 1JYVA 4DXZA 3O1VA 3TBDA 4JV4A 2XL7A 3WHUA 1RUOA 2AH2A 4BK4A 2QKDA 2JXAA 2XL9A 1W2UA 5FO9B 4WV8A 1C1LA 4BMBA 5A6XA 2GC1A 1OUSA 1ZZ6A 4ZU5A 5JLVA 5JAXA 1LKNA 1CAWA 1ZBE1 1MQTC 4AEDC 1JUIA 1YFWA 4HBNA 2D6KA 2HWE1 3WD5A 2ZCWA 1K12A 5BXXA 4DS0A 4LHLA 1PO21 3I3BA 1FX5A 3E1F1 2D43A 3H42B 5GLTA 4BISA 4GWIA 1UU4A 2DURA 1L7QA 1JYIA 2A6VA 2WA4A 3FMGA 5BY5A 2JKXA 2J1VA 1KDMA 2ILMA 4DIQA 3RZJA 5LCWL 2ZGLA 2WFF2 4NIDA 1W6OB 2JG8B 1KXGA 1PZ8A 3ES4A 4P9WA 2WN2A 4R9CA 2PHRA 3H7YA 1MPXA 4LBQA 1YQ6A 3RG0A 1GNZA 1AJKA 2BGOA 4CYDA 4Z07A 4R8HA 3C7HA 1J3RA 4MGKE 5FZ1A 2FDKA 4NJ4A 4AL9A 3AZWA 4H3WA 4HXCA 4YW7A 3ZXEA 4KQ7A 1HX6A 2BGPA 4NHKA 2C0ZA 2WSVA 2VW1A 4FOWA 2D5FA 4JX0A 4X8PA 3BPSA 5DAWA 2E51A 2GP3A 3V65A 4E4ZA 3R6SA 3O7OA 1YEWA 1ZM1A 1RHI2 3PVNA 3EYPA 3IKWA 4HPKB 4JKKA 4CXWA 1WMFA 1QEXA 2XONA 4LO8A 1GWMA 4COUA 1AXYA 4Z8BA 1N47A 5DZFA 5KXEA 1AR93 4HN1A 2Q1MA 3TNPB 1Q43A 2HYKA 4V2WA 3ZKUA 4GAZA 1W99A 1Q8PA 1AYN2 1NLRA 1S0BA 1GKBA 1VLNA 4IEVA 4MGYE 4QGNA 3AP5A 4I02A 3L2YA 4MGQA 3W58A 4RS5C 4A2UA 5HI0A 3H3ZA 1VRH2 4CUAA 1DLCA 3AMNA 4B4PA 1EPWA 1RMU1 2PHLA 1B35C 3A0NA 3POEA 4W8JA 4NIIA 3WQ1A 1UZYA 5IVCA 5C4WC 1W0OA 4Y5Z0 1UIKA 1IG3A 2RS13 4AVTA 1M4WA 2JX9A 2CGPA 2QTWB 4CXXA 2DCJA 1W2TA 3IMMA 4NIGA 2VZPA 3MIFA 2PMWB 4RQPB 3KCXA 5F5AA 1TEIA 2HEYF 3N36A 4QX5A 3VKMA 5LA0A 1RUD2 3RYKA 1EUTA 3POWA 4RR3A 4YVSC 5CKMA 5FUPA 2IXIA 3ZFEB 1UY0A 1AR62 1AX2A 3AB0A 2FMDA 1UW8A 1QJY3 1V9U2 3SH5A 4Y24A 3ME2A 2DUOA 2B9VA 3AL5A 1GNYA 1V00A 2A3XA 3HOBA 5F6KA 1KJRA 5J1XA 3DF0A 5IYYA 4XJWA 1T6BX 2JE8A 1XNDA 2JE9A 1FPN2 4QMAA 3GJAA 1CAWB 1CR7A 1GUIA 2J7MA 1OLQA 4FO9A 4HZFA 4B1MA 5C9AA 2JG8C 4DMIA 3TEYA 3OEAA 4XBQA 4ES9A 4AFDA 3P3PA 2PXJA 1W8WA 3JBG1 1HV0A 2Y8KA 2V5DA 2J22A 2W68A 3N9MA 4N8MA 1R1A2 5T52A 3BKZA 2OW4A 1VPHA 2JDYA 2O8OA 2HBTA 3T4VA 2OQ7A 1VIWB 2DU0A 1UY1A 5JUVA 3HNYM 1LU1A 4L2NA 1JZ6A 3AJZA 4P08A 3E5QA 2JICA 1ZBA2 2QDRA 2OA2A 4I3GA 4ISQA 2C9AA 5FPLA 3ZR6A 4RA0A 5FZBA 4LBQB 4QX3A 3KT7A 3MLJA 1SDDB 1OQ1A 2NMNA 4F3JA 5D8AA 4ASMB 2FDFA 5A3WA 5JXHA 4WM8A 1WBFA 1Z7S3 4EJRA 5FPAA 3BOWA 2GC2A 5A3MA 1NY71 2QQKA 1SLCA 1Y4WA 2OKXA 3U0ZA 1ASJ1 1PGW1 2D40A 2R072 1O59A 4CDXC 2HWC2 3EB7A 3NV4A 2FDGA 3LB9A 1DIWA 3O0VA 2CYFA 2RM23 3ZYGA 2ZGNA 3I49A 2HWB2 3VBFC 3KHCA 4QD2A 3TEWA 1GSLA 1H6XA 2BFUL 5J98B 2JJ6A 3WQBA 4U2AA 1D4M1 5KHGA 4MGSA 5EFUA 2A75A 1C8M1 4RQPC 2A3WA 2E7QA 1EAH2 1PO11 1QU0A 2KR2A 3KLSA 3RMXA 4ATFA 1PNGA 3VB9A 2XB6C 2PAKA 1LECA 3O0XA 5FK7A 3ZX7A 4RHV2 3NNMA 2YBPA 1CX1A 2YGMA 4AHXA 1F15A 4JZRA 4GD4A 3GZTB 1S2KA 1RUG2 4RGGA 2E33A 1T2XA 1YQ2A 4OI4A 3RZZA 4MGIE 1CPMA 2ARAA 2VTFA 4PLOA 4EZ4A 4LE3A 1S2BA 4LO6B 3WCRA 2RR11 4FP3A 4BLIA 1DQ2A 1SCRA 2D5HA 4CCNA 4QPIA 3MW4A 4RR3B 1Q8VA 1JW6A 2R062 3I3QA 1DLLA 4BB3A 4BQWA 2RJLA 4EROA 1LOCA 4WBBA 5L9RA 1ODMA 5HXMA 2IC1A 4DNYA 2X29A 4XJ8A 3MDPA 4LO7A 3KV4A 3U10A 2LTNA 1EV13 5CFDA 4WM7A 3GJBA 2HEWF 2EA7A 3LSEA 4DRVA 1S0JA 5KHJA 4Q27A 1VMHA 3TN91 3V0BA 1MS8A 4QKFA 3LA3A 5C9AB 1FMD1 4MSVA 1GANA 2RS52 3ALQA 1WCDJ 3HWJA 3JU9A 1DGWA 1GQPA 2H0VA 3IIAA 5LRRA 4IE5A 1L3JA 2FZ1A 4Y5SA 1WWYA 1QH7A 1PVC1 1OURA 3DYPA 1OLME 5IFTA 3IDAA 1O7FA 2G19A 2BNNA 3NAPA 1G9BA 4PIYA 2LUWA 1QJZA 1DDLA 4AQTA 1O4YA 4LBJA 1HJFA 4F8AA 2H0BA 1AUYA 4JKMA 2J1TA 2V73A 1W8OA 1CVNA 3M3EA 1TMF1 4IEOA 5D8AB 3CHXA 4WM8B 4YVWC 5IAXA 3KV6A 4YGCA 1LOFA 4W50A 2W46A 3FHQA 5I8YA 2W1WA 3WP4A 3PJYA 3ZFGC 2XUMA 5HV0A 3DECA 3P1IA 2QZ2A 1YFUA 2RS31 2Z2SB 4P9XA 5SV5A 4CPBD 3B93A 4XQ4A 4K7JA 1POV1 2FQPA 4XFGA 1TZOA 1YXWA 1A78A 1MZ6A 2XUEA 4AI0A 2ZX2A 3GZEA 3WW4A 3MICA 3LPGA 4LJHA 3BGAA 4HG6B 1E57A 4DUXA 2ZJCA 2XR4A 3K3NA 5T54A 4OZOA 1RUE2 2Y0OA 3CJIA 3LGRA 4H7LA 1K42A 1O5LA 4K8FA 5FMDA 5IT6A 5FOBB 4QKNA 4RR3C 4DB5A 1XNBA 1W05A 1CX4A 3FFQA 1HB1A 2BUKA 3OBAA 4MGTA 1JYXA 1TNFA 3NNGA 4MADA 5CNAA 1LENA 4Q4V3 2IVIB 2RDNA 1GQGA 5LW9A 3AMPA 3EJKA 1H2MA 1DFQA 2EXJA 2Q8EA 1C5IA 1MZEA 1RUH3 3ON7A 4FXGB 3T08A 2EAAA 2WQZC 2AC1A 1DCSA 4OHXA 3N9LA 2VCMA 1C57A 1YIPA 1SFNA 4I3PA 3ZKYA 2DF7A 4PIZA 2IFWA 4DY5A 1VRBA 1ZRDA 1S1AA 1R081 5T3NA 3U11A 3NV2A 4ZU7A 1RUC1 2A71A 4M3CA 3JB8A 2IXCA 1OA2A 1OC1A 2VZSA 3OPZA 5F3IA 3UETA 3ENRA 1PGL2 2RV9A 2ZGOA 3GF6A 5LRSA 2A3YA 2D44A 1SEFA 1SG3A 4FPYA 4IEUA 1J58A 4WM7B 1H4HA 2Y60A 3VBRA 3W59A 5CFDB 2BTVC 4O9GA 1REEA 4CEWA 5J96B 1WMDA 3H3UA 4DQAA 4AEMA 1FATA 3UNPA 3V0BB 1DU3D 1UO9A 2BNMA 2B5HA 2GMEA 2VQ0A 1XNTA 4XUPA 5K4LA 4MXWA 2VCAA 3RQ0A 2XOMA 1CONA 5C3SA 2WT1A 2Y38A 2BVBA 3CO2A 4Q4Y1 1O3RA 2GU9A 1ZREA 4IV1A 1H2KA 1Q5OA 5KWRA 4IGOA 4MHUA 1BLZA 1RJ8A 2W1QA 1FOD3 3NV1A 3ACIA 3OJBA 2ZHKA 3NAPB 4H2AA 4AFBA 1WCKA 2WRAA 2HWF1 1SBEA 2V5YA 1O5UA 1RTVA 2VNVA 5A6ZA 4CCOA 3POJA 1NA1A 5F2WA 1AR81 2P17A 1NKGA 1HRV3 3WNMA 3NKGA 2TNFA 4AVAA 1MS1A 5EIYB 1VBB3 2VOVA 3CBNA 5JR2A 5LASA 1SLLA 3ILNA 5H9QA 2NM1A 4JDOA 4W6WA 5DUVA 3PUAA 4X6QB 3VBUA 1QDOA 4XACA 4D6QA 4O9EA 5BV6A 2W52A 3OGSA 3IDBB 2QVSB 2WZPP 4IV3C 3RMYA 3FN9A 1A8DA 2UWAA 3R4DB 4Q4W3 5FZ3A 4B8EA 4CCEA 1JYWA 2GNTA 3CJIB 4Q5OA 4FVVA 2X8KA 3H1MA 4ZKTB 4L11A 5FZ4A 2OUJA 4PJYA 1ZBE2 2YC0A 4CU7A 3PJQA 3RVHA 2YU1A 3I2OA 2P4EA 2HWE2 2ZGSA 4C1WA 3OEBA 5JXGA 1PO22 2DWRA 4FPFA 1N1SA 2ZX4A 4G4FA 5IK5A 5KXCA 2VAUA 4IGPA 3OPTA 1NUKA 3J7HA 3S57A 1D2QA 2WO3A 1IKPA 1S0GA 3RFRA 3MFCA 1VB4A 1AR71 2VD7A 1AYM3 5AFEA 4CE8A 1KFXL 1SLBA 3QH7A 5CU1A 3VL8A 3EHKA 1HXS3 4A3ZA 2ES3A 3MUZ1 1J84A 4YRDA 5F5IA 1KFUL 4HSLA 4JDMA 5SV8A 3GM8A 2YPJA 3NV3A 1CJPA 3PVOA 1I9RA 3NJYA 1W3XA 4M3CB 1H2NA 2BWAA 4XZPA 2CHHA 5C71A 4N9IA 1V6MA 2NLRA 3AP7A 4RSUA 1LR5A 4Q8LA 2IXKA 3KV5A 4NIHA 3VD4A 1UY4A 3AXDA 3WQ7A 1H0BA 2D3PA 3VBRB 4TSVA 1YQ8A 2GNBA 4CEWB 3T1LA 4FSJA 3HAGA 3H8UA 3AMHA 5FPBA 1LU2A 5HBAA 3PIGA 4XC9A 4ZS2A 2PHUA 2QUOA 4CP9A 3ASIA 4FAGA 1AVBA 1NCQC 1UOJA 2XKOA 4MXWB 1S0IA 4XABA 5H9PA 3RJRA 5FY4A 5FPXA 4M0HA 4KU8A 5IVEA 3M8LA 3AP9A 4AW7A 5AC91 3BTAA 2JDMA 4JTOA 2ID4A 2NMOA 1NOVA 2YG0A 3N3HA 3QCWA 4Y1YA 2VZVA 4DOUA 4IV1B 2BPA2 3ZXKA 4LBMA 1US2A 1XJAA 2RVAA 1UMZA 2A70A 2ZGUA 4GMP1 1UYZA 1RMU2 4N90A 5ISLA 1OA3A 3INAA 3C7FA 4AYUA 4D69A 1VBE1 1ALYA 1LHWA 2E7TA 2SLIA 2ZS6B 4Q0UA 4E4HA 5C3OA 4LMFA 4FPJA 2VNGA 5HPOA 5FYIA 4EWDA 5LATA 1RUF1 4W4ZA 4URAA 1NA1B 1ST8A 4JGYC 1RGSA 4H55A 2WZR1 4AAPA 3CJIC 2WYFA 5CG9A 2OT7A 5E1RA 1AYN3 2P3KA 4FTSA 3WG1A 3AXEA 1UOGA 1BZWA 2ZEYA 4XUOA 1WW5A 4RL7A 1C3HA 1K3IA 2FCVA 3ETPA 3RI8A 4KWUA 3RZHA 2HBUA 1VRH3 2JDZA 4XCBA 4ZHNA 4URTA 5CISA 1BEV1 4LNVA 1KITA 1HW5A 3VBUB 3ZSEA 5HCAA 1CQ9A 4IEXA 4RYDA 1G9AA 1OVPA 1GU3A 4AGRA 2XKPA 1Q56A 4JAAA 4LPLA 5JSOA 1AZDA 1K5JA 3A21A 4LXLA 4XHXA 4IXLA 4LULA 2FCTA 4UBGA 5G05L 1LESA 1IS4A 3VZMA 1LODA 4QGLA 2RJ2A 2W1SA 2VC9A 2DBNA 3A4UA 1JZ7A 5F5QA 1OD3A 5FLIA 3BIWE 2YC4A 3K51A 1AR63 1HN1A 1MQTA 1BBT1 3JBG2 1CZVA 5FY9A 3A23A 3BALA 2Q8OA 4AEKA 3T0DA 3GDBA 4AI3A 2IXLA 4EQVA 4XMIA 4QHZA 1V9U3 3VHRA 5L9VA 4KBZA 1UKRA 5FY1A 4XZUG 4YW6A 2N7GA 3D4KA 4BIOA 3LD8A 1I5ZA 4TN7A 1QOSA 4R4ZA 3O1MA 3PU8A 1OF4A 4B29A 1TQ5A 2J1UA 2LW8A 1AL21 2NZ9A 2QJVA 3K3OA 3VHOA 1HRI1 1ACCA 1FPN3 1BQPA 4FPGA 1C8NA 2PTMA 3C8XA 5EPAA 3AKQA 4HKWA 4TLGA 3T30A 2B39A 4WVZA 1IOAA 1G8WA 3KWVA 2LRPA 3KS7A 1CIWA 4FFHA 1PX3A 1OH4A 4OCTA 3LDKA 1QXPA 1NY72 1YCIA 3WP3A 3UGHA 5DMYA 4Q8KA 1ASJ2 1VP6A 4GB33 3ES1A 1R1A3 1C1FA 1PGW2 2TEPA 3HNBM 4PT6A 3WCSA 5CADA 4AXOA 4XCAA 5JR7B 1JBCA 2P37A 4HMZA 5C33A 5DZGA 4CP9B 4LA2A 2OIIA 4UOJA 1D4M2 1ZBA3 2X53S 2OX0A 3MIBA 3PUSA 1IG0A 1UZVA 5A1AA 4LUMA 1DF0A 5IAVA 2Z69A 4OMCA 3MF9A 1N1YA 1PO12 2BBAA 5FUNA 3AK0A 4RS5A 2DTYA 4QDQA 4CU9A 1B35A 3RZGA 1PM4A 2WR9A 5C4WA 2R073 3O5SA 1YO8A 2HWC3 2IFRA 4Z1VA 4UBHA 1YUDA 2RR12 1RINA 5FP8A 1LOBA 2P5BA 2VBBA 1POQA 3H1WA 3KGLA 4BPZA 4R9BA 1UU6A 5JOYA 3H8OA 1QXRA 2BZDA 1QJU3 4GIQA 4YVSA 4FFGA 5GLVA 2OZJA 1K5MA 2DCYA 1YWKA 5ERLA 2QQIA 4DEVA 4RHV3 5IVJA 5IWFA 2BU9A 4HETA 1CAVA 1GOGA 5CB7A 4QKBA 3RZMA 4M4RA 1BYHA 4GJYA 3TB0A 2J1EA 4JRAA 3NJZA 1QWRA 2JDNA 5D2AA 2WWJA 4KBBA 1GQHA 4ASKA 2W2IA 3TN92 3LFMA 1DGRA 2VZ1A 1F4AA 2VNOA 1OQDA 2I74A 1FMD2 3ZMNA 2WO1A 2JG8A 5FZOA 1MQTB 1UCXA 2IXJA 5L7OA 2MEV3 3B9CA 5LEJA 3J9SA 2CY6A 4FOQA 2E53A 4QPWA 5L73A 4HK9A 3AL6A 1W6MA 5F39A 5A32A 3PVEA 2CL2A 2W92A 2JDAA 1H30A 1OUXA 3LIGA 2A6WA 2J1RA 5CFCC 2XJPA 2CWMA 2DCTA 2EAKA 2ZGRA 1QJEA 5JZGC 1C4RA 4OUEA 1O91A 1RUI1 1RIRA 1TMF2 2RS53 1U0AA 5FAXA 2DU1A 4KNCA 4OYUA 2WL1A 5IVFA 4ZPIA 2ZPXA 1NLQA 2EIBA 2RS32 2XGXA 4LK7A 4CDUA 2YV8A 5IATA 3FHIB 4KWLA 4CDXA 4UT5A 5IJRA 2Q0AA 4JHTA 3VBFA 1XBFA 4KG0A 4QGMA 1V6IA 1BKZA 4YW1A 1SCSA 2GH8A 1XNKA 3EO6A 4HOOA 1GNHA 1W9WA 5CVRA 4GKYA 1HIXA 4PHZA 5FXXA 2O14A 4RS5B 2VZUA 5FY7A 1V6JA 3LDRA 1QMJA 1QJX3 4LIVA 2WNUA 4QX8A 1O3SA 3U78A 1B35B 2ADEA 4XBLA 1PNFA 3VD5A 4OHWA 4BDVB 5LZ6A 1AXKA 3O1TA 5C4WB 1XYOA 3S7EA 3ATGA 3D6EA 4CU6A 5IHRA 4UXAA 4XUTA 4XE9A 5K8SA 1RVF1 4CPBA 4N7UA 2W39A 5FBJA 2G9ZA 3ZYHA 3TOJA 4ZZ8A 2FDHA 4AI8A 1V6OA 5F37A 3ZDSA 3WNLA 2PA7A 4U36A 1E5SA 4YVSB 1RUE3 4JC1A 3HR9A 1K5MB 2BYVE 1R082 1F4HA 5ABJC 2CGOA 2JG9A 4YG0A 1RB8G 2V72A 2PHTA 4I2OA 4KMQA 4K1ZA 5IVYA 1CAVB 3G6JB 1E5RA 5A7NA 1DYOA 1QKQA 1ZRIA 1QJY1 2VGDA 5L19A 3HQUA 1QJFA 2NQYA 3O1RA 3UV9A 3T2QA 3HN3A 1VBA1 5DG2A 1F9KA 1GZWA 2DCKA 4UFKA 5APAA 5FZOB 4AFCA 1DHKB 3UK9A 5L7OB 2QFEA 3A7QA 3GXUA 1PMIA 4K9SA 3E6DA 4Q4Y2 5JMOA 1F5FA 1W6MB 5T5PA 5A32B 5EZWA 2VW2A 5JXJA 2C9KA 4XAEA 3NW4A 1FT9A 4QU2A 3C7EA 1MEC1 1NXD1 4PDWC 4K40A 4Y1XA 3WR0A 3H50A 4QM9A 2HWF2 2KM2A 3D82A 3LKJA 1LRHA 4N9HA 4NPLA 2WKKA 4UFHA 3M3IA 5FTTC 3TAYA 4YG6A 2P3YA 4IESA 4DPNA 2PHFA 3VDDC 1AR82 5A7QA 1D7PM 1WUVA 1NX9A 1CJDA 1GZTA 2GP5A 5AFBA 4YVWA 1GMMA 5HXVA 5HV4A 4Q4X3 3MLKA 1UZZA 4LORA 1OKOA 5FWEA 3THTA 2EIEA 4IW3A 4K21A 4XJAA 3ZFGA 1PZ7A 3BODA 1Z7S1 3K2OA 4CDUB 1RXFA 4K8RB 1NCRA 4ZY9A 3L2HA 4CDXB 5FUIA 3N7MA 4XF3A 2A73B 4CZSA 4XAAA 1QHDA 5C8CC 3VBFB 3O1PA 2ZHLA 1SZBA 1HB3A 2QCSB 3F95A 4QQLA 3BI3A 3J26N 1GP6A 2RM21 5LB6A 4KWJA 2Y6HA 1JU4A 1W8NA 2J1AA 4YM1A 2W87A 4F83A 4XUNA 3ZXFA 4IDZA 1NG0A 2C26A 2WNUB 4KG8A 1K5MC 2XQXA 2W08A 1FNZA 4XJUA 5DDJ3 3RNSA 3I2GA 3OY8A 1BMV1 1ONAA 3U75A 4D7SA 5BPXA 1F2NA 4E2SA 4NN0A 1O3QA 4IE7A 2XBO1 4LTAA 5A6YA 1AR72 2J1SA 1UIJA 4YW5A 4Y20A 4BXFA 4ZU4A 4P5YA 4C1XA 3B7MA 5I0UA 1PK6C 2W9XA 4NPMA 5FR3A 4MGZE 5CBLA 3OCPA 1QQP3 1JZ3A 3WW2A 1G9FA 4CXYA 2Q8CA 2JG9B 1OF3A 1YC61 1ZBE3 5L7OC 5CEHA 1Q8SA 2HWE3 2Z4FA 5FZMA 5JCTA 4J6GA 3D5OA 1JN2P 4NE9A 1DP0A 4YW3A 1Y43B 2B45X 3SISA 3WDXA 4B7KA 3OBZA 4LLOA 4WVMB 1IZ3A 2JENA 3IDEA 4NMIA 5HCFA 3SXWA 4BQ3A 5LEKA 4NAOA 4FPEA 1H6YA 4GWJA 2H6CA 3B00A 3ZXLA 1GZWB 1MS3A 1V6NA 5AC92 1OFSA 4LKSA 1S0EA 5FYUA 5JIUA 1LEMA 4M3CF 1ENSA 1YFYA 1WBLA 1HQNA 2IUWA 5BNPC 1YHFA 2ZZQA 2C1FA 1UXXX 2ZTNA 5J3UA 5FRAA 1ZZBA 2LROA 3CDZB 3DV8A 3JQWA 1HB2A 4CSWA 2HH9A 1K45A 2DVGA 4CDUC 1VBE2 5KR7A 4GWNA 4DZGA 4DUVA 1OHFA 3DKQA 2XJUA 4ET7A 4P9GA 5AVPA 3RWNA 1MS0A 1RUF2 2DBIA 2Y6GA 4UAPA 3VV1A 1EUUA 5IK4A 3ZIXA 2PLV3 2UWCA 4AE2A 3AZXA 3JZVA 3ZM8A 2WZR2 5EJZB 4V1PA 4CRQA 2ZZJA 3KSCA 1V6KA 4YVWB 2VOTA 3QOPA 5F3GA 1JZ4A 4QB1A 2E9QA 3ABZA 1J3PA 3ZFGB 1TME3 3I3MA 4GH4C 4P02B 4EYUA 3JQXA 1VBD3 2Y0IA 1NCRB 2WNUC 1U5YA 2WQ4A 4XF1A 1UYXA 1RMU3 3R05A 4XDPA 1BEV2 4F7ZA 4WVVA 1W8TA 1X50A 1W8UA 1DGRN 1RJ7A 4XQWA 2GN7A 4TWTA 5FMBA 1FV2A 2OUHA 4IV3A 3VZNA 1NLSA 3JUUA 1VALA 3BU7A 3KQ4B 1W6NA 4ZS3A 2Q8DA 4HVRA 5ACA3 1JU3A 3RZKA 1EYBA 5I91A 5FZIA 1WA6X 1BBT2 3S5QA 3VKOA 5FLHA 2JG9C 3OY8B 5JSPA 3M7AA 3S5AA 2XVLA 1PX4A 2WNVC 2ZEZA 4HONA 3AKTA 2DCZA 4PLNA 4CA9A 4XFBA 4BHPA 3DN7A 5J48A 1W28A 4Y20B 5I93A 3CNAA 4PF1A 5FP3A 2Y64A 2GNDA 3LFIA 4A7KA 1AL22 1ULPA 5LY1A 1HRI2 1JS9A 1RUH1 3U4SA 4TZDA 2BOJA 2BOIA 2FBEA 4L97A 1JZ8A 1NE6A 5FZ7A 3T2TA 1EY2A 1A6CA 2UYBA 5BNOC 5HCBA 1YI7A 2B42B 1GWKA 2SBAA 5FZ9A 1DQ5A 1COV3 3ZSLA 3OGRA 5I0DA 3JBG3 3AFGA 4OI1A 1RUJ3 2XHKA 2K0GA 2WLQA 1IPSA 3LEGA 4AGVA 3AKRA 3ZYFA 4B4QA 2W47A 2JD9A 5JOZA 3CZUA 4QX0A 1JHJA 4KGGA 1O4TA 1Y7BA 2VR4A 4FPOB 4FPCA 5A7WA 4MV2A 3DYOA 4SBVA 1NCQA 5FIXA 1ENRA 5EWSA 3TWIA 2GMPA 4BM8A 3I2HA 2ZX3A 5JVVA 4P5HA 1OKQA 3I54A 4AQ6A 1UKGA 3WNXA 1UD1A 2CGNA 2QQPA 5IK8A 3KF5A 1JTZX 4LEJA 3I7DA 4W65A 4UW4A 2X5IA 3VBSA 4BA6A 1XU2A 2D6PA 4CCMA 1CWPA 1FNYA 3VD7A 1ASJ3 2PHXA 3UYJA 3POIA 1NCRC 3KD4A 2NYYA 3T0BA 1FOD1 1GWLA 3M2MA 3VDCA 4C0BA 5FKBA 3S6PA 5KHHA 4OMDA 3WZ1A 2JD4A 4JDNA 4JGYA 4G9SB 1D4M3 3VGIA 3LEMA 2V4AA 3WW1A 4E8CA 4WVWA 4QPYA 4D0QA 2QQWA 1PO13 1HRV1 2WJSA 3D0JA 3VD9A 3FX3A 1WW6A 2ZHNA 2DVFA 1UYPA 4XBNA 4GJZA 1YFXA 2O8QA 3GBGA 3KT1A 4TLFA 4ITCA 1XE8A 2RJKA 1UPSA 3WNKA 3I2JA 1J1TA 4AG4A 4IV3B 3BTYA 1I6XA 5C5UA 3MPBA 4XYXA 5A33A 4BE3A 2ZGKA 1JUHA 4ARXA 2RMU1 1W6NB 4OHVA 5FY5A 4Q4W1 3CJXA 1OLMA 3PL0A 5GZDA 4YZ1A 3B3QE 4XF4A 2VZRA 1IHMA 1MZFA 2JIJA 1X9TA 2RE9A 5F3EA 1V70A 4BU2A 4CDWA 4DO0A 3VDAA 4EZHA 1XQNA 4K1YA 4PCRA 3DPRA 4FTEA 5GZGA 4LHSA 2AR6A 3BPZA 1KD7A 4YM2A 1ND3C 2RG4A 1PIV3 1VB2A 4LA3A 4NHYA 2OQ6A 3MHZA 1SACA 4Y3OA 4RGKA 2VMEA 1BHGA 4KWKA 3H8XA 5DAQA 1BXHA 1QNWA 1GP4A 3E5XA 5C5TA 2XLFA 1XU1A 3TN93 3MLLA 4QQOA 3OUIA 1XB9A 3I2FA 2BERA 5DUXA 1JZ5A 1G9CA 1HXS1 1RUI2 5FYMA 3ZN4A 1FMD3 1KRIA 5DPNA 2DV9A 1XPWA 3E6BA 4NVPA 5LBCA 2GZWA 3ZLIA 4MUVA 4NPRA 3ACHA 5I0RA 1NE4A 3FLPA 3LIHA 4L92A 1DZRA 3FZ3A 4XUQA 4COYA 2ENRA 1LOEA 2PHDA 2YFZA 3CMGA 1V6LA 2VVFA 2P1BA 3AYAA 3FBYA 3NRUA 3D8CA 2VMIA 5A7WB 2OPKA 5FYVA 3I59A 1NCQB 2EIGA 2WWSA 3BTZA 1OSGA 2R043 3UJQA 5LA9A 1C5HA 2P6HA 3AFKA 3WVJA 1EPZA 5GM0A 5E16A 2IWGB 3OTFA 3NNJA 3VBSB 2GDFA 2X5IB 1BVVA 3LE0A 2HWD2 4YGEA 3K4AA 5DQ0A 4UFMA 5CKQA 1WA4A 2GALA 3HEIA 5T5OA 4CCCA 1QOOA 4MO3M 4XW3A 4BQ1A 3ZYBA 2BGCA 3J7MA 3MIHA 1ULOA 3D3AA 4YGDA 5A1LA 2ZACA 4DFSA 1RVF2 5FPUA 1CIYA 3PVBB 4FPLA 4UW5A 3IZOA 1KDKA 4JGYB 4UYBA 2BVVA 3GGLA 2JKBA 4AI2A 2JEMA 3VD3A 4BCUA 3GNEA 2XHNA 1G7YA 2WSUA 1G6NA 2OVUA 5IVVA 1SPPA 1RUNA 1W04A 1WMEA 5F9TA 1ODNA 5FBZA 4XFCA 4IE6A 1PVXA 3Q8FA 1D0GA 3FHAA 2QQUA 2R6QA 1QJY2 3OD4A 3E5UA 4XTMA 4IEYA 4QPGA 1VBC3 3EBRA 2NP0A 2V4VA 1S0CA 1WGPA 3ECQA 5A33B 4JCKA 4CUBA 4E4DX 1OOPC 3EXUA 3CKHA 3CF6E 4GALA 4V2VA 3USSA 1VBA2 2W95A 1JOJA 4HK8A 3R4UA 4D94A 2WT2A 3ZSJA 1JXNA 1HDKA 2DUQA 4L0PA 3AYEA 1L7RA 4R52A 1R083 4CDWB 2CDOA 4P00B 1OXCA 2WDBA 3DPRB 4LIUA 2ZXQA 1OLRA 4BQ5A 2VE1A 3I2KA 4IQPA 4OVEA 4YM0A 1MEC2 4O65A 4AQ2A 4FOYA 3THDA 1G9DA 4A6OA 2XJVA 2L9LA 5B4NA 5FXVA 1G86A 3BCWA 2BW8A 4Y5TA 4QM8A 3W20A 1O6UA 5CFCA 2QQOA 2E7AA 2VU9A 5L36A 3WT3A 1L7LA 4IEPA 2WFF3 4AI1A 5JZGA 3OYWA 2WN3A 3B01A 5E88A 3C7GA 3WF0A 4ISRA 1OPMA 2VULA 4QXHA 3POYA 3R4SA 1DGWX 1BVP1 3T2PA 3VBSC 1D0HA 1XE0A 1Z7S2 2X5IC 4GQ7A 4Q0QA 3SHRA 1BK1A 2ARCA 4GB31 3USUA 4BQXA 4DY3A 1LB2A 3DEMA 2QQLA 2D6MA 2G1MA 1VMJA 4Q0PA 3I59B 5DAVA 3OOXA 1OFNA 3O1OA 4UF0A 2XWBB 2RM22 1RHI3 4IE0A 1TNRA 1W6PA 3EQEA 5J09A 4YZ2A 4AVVA 4LLFA 2PQQA 2OYZA 4Y1ZA 2BEOA 1XYPA 1SLIA 3TRSB 2Z79A 3AX4A 3AYCA 2W5FA 4R4XA 4EWAA 1BMV2 3CL1A 1ZZ8A 4FQ4A 1S2EA 2QNKA 4R9DA 2VY0A 1UOBA 2D6LX 2QDNA 1DGLA 4R9AA 5CZKA 5FP7A 3SH3A 5A70A 4LT5A 2XBO2 1U5IA 3SQOA 4D8MA 1H8TC 1REDA 4XF9A 4XFHA 2QQJA 1W8ZA 2ZABA 2XLAA 1CAXA 2Q1FA 5K7PA 4B4RA 4YSFA 3TYJA 1ENXA 1SPPB 5C3PA 2XLGA 3OGGA 5C3QA 4AI9A 5JMCA 4IETA 3N35A 5ABJA 1RUD3 4I0WB 1QJU1 1DQ0A 4LR4A 4NRQA 1P8JA 1W0PA 3FE5A 4CDWC 2DDUA 3CLPA 2P2KA 3KVBA 2VTXJ 3E97A 2AGSA 3DPRC 1Y9QA 3OPWA 3WDUA 2YU2A 1WD4A 1DG6A 4QPGB 5EV7A 3WDWA 4RFT0 3AM2A 4OQ8A 3APBA 2EIDA 3VL9A 4LO5B 4PBOA 5FZ6A 5KXBA 4YGBA 5FPZA 2PAMA 3POSA 1GOHA 1UU5A 1X9PA 1LHVA 4YZ5A 3BU0A 3DUIA 5EHDA 1ZZCA 3Q8AA 5KC5A 1OVSA 2BRTA 1YQ5A 1ZZ9A 4LBNA 1ULDA 4LHKA 2ORZA 1UMIA 5F6LB 4E9KA 3ZN6A 2MEV1 1WLTA 1AX1A 2XDVA 3S0MA 3NKTA 2XJTA 4IERA 4ONUA 2VG9A 2NPIA 4PDWA 1OMIA 1TG7A 1FXZA 3RZLA 1UY3A 4DINB 3HMYA 3JD71 3UKNA 5CFCB 1CESA 4N7IA 3MZHA 4FAHA 5FZEA 3IIIA 1PHMA 3SLIA 2R0FA 3DL3A 3VDDA 5JZGB 3QH6A 2GC3A 3KV9A 3OYWB 4N53C 1WW4A 3ZXDA 3ETQA 3U07A 1A34A 2VM9A 3WHTA 1C8M2 4A6SA 2JIGA 3PTYA 4G3YC 4BLJA 2UY8A 4NHXA 4KH9A 3VBHC 3U14A 1CPNA 3HVDA 4GMP3 1LAJA 3O12A 2VMGA 3USUB 3WF4A 3AVRA 5JDBA 1IKQA 1Q3EA 4K20A 4A4AA 1VBE3 1AX0A 5C8CA 3OG2A 2UURA 3QBQA 4UF0B 2YB7A 2XJRA 3Q9OA 1XC6A 4C91A 1W6PB 4D6RA 1W90A 2HWB3 2MHFA 2WS91 1BK0A 1QF3A 5JSRA 2F17A 2WZR3 1XSQA 4RD7A 2VPVA 1ULEA 1PM7A 3RJ2X 3MGUA 1A3KA 3CQOA 1EAH3 4AK3A 4MZUA 4BJ0A 1R091 2YXSA 5C3RA 5C8WA 3BIEA 1QJX1 2VCCA 2WNOA 3MIDA 1BEV3 1RUG3 1N3OA 2OS2A 4QPGC 1EP0A 3J8F1 4M0NA 4P9YA 1CAXB 5I0SA 1N3PA 3LCPA 4Q26A 4Y1VA 3VBOC 5HCHA 1RUH2 2I2SA 1PK6A 3HJRA 1PMHX 1YJKA 2BWCA 1MVQA 1POV0 2XG3A 4UW3A 1W2AX 2C5DA 1LEDA 3S7IA 3IMNA 4M00A 3JXSA 5T5LA 2LALA 1A8MA 5ABJB 3JCIA 3LOBA 4NO4A 2JDKA 2GC0A 3WP5A 2R063 1UY2A 1UZWA 2YY1A 3ACFA 1O4ZA 5F7UA 4AZZA 1DYKA 1LGBA 3ZMOA 4AR2A 4OUMA 5LBEA 1PVC2 2Y6KA 5K9YA 2A6ZA 3BB6A 1US3A 3MW2A 3PUHA 1QGLA 2VO5A 3HPNA 2QE3A 2ZGMA 1ULFA 1AJOA 4GKXA 4Q1PA 1LOGA 2ZEXA 1GZ9A 3CEWA 4UFLA 4XURA 2W94A 4CCLA 3KCCA 3WDTA 2HLEA 2IZWA 1SQ4A 4UW6A 1KJLA 2YYOA 3HNMA 4FPHA 5BYNA 1CZTA 1RITA 1SLAA 2XVGA 3ZN6B 3BVCA 4RGAA 1LGCA 5BNPA 1YIFA 2D97A 1DQ1A 3TEZA 1W9TA 1S0DA 2YPDA 2DVDA 4PDWB 3THCA 1W9FA 1YI9A 3ELNA 4Y26A 3OBRA 3OB8A 2BJSA 4YARA 1H2LA 1FOD2 1GBGA 1X7NA 2VUAA 3AZZA 3GCXA 3RSJA 4QT6A 3SCHA 1VAMA 1V0AA 2R0HA 5FZAA 3VDDB 2ARXA 4ZZ5A 4LHNA 4IL7A 2GH2A 5G04L 3AZYA 5KC6A 4QX1A 4AAXA 4LOSA 4CEYC 1AR91 1HRV2 3J4UH 2K2SA 2VH9A 3RWKX 3C3VA 3FC0A 3OUHA 3SC7X 1J83A 1H9WA 2JDHA 2R30A 3M1HA 4GH4A 4S2HA 4LKFA 3H3LA 3AP4A 4Q4X1 4GWMA 3VHNA 3AZVA 3VZKA 3RS6A 3HQXA 1UL9A 4AVSA 4C8DA 5C8CB 1SLTA 2R32A 4BIFA 2D93A 1UN1A 4L99A 3WDYA 4CDQB 3WDVA 3V0AA 2RS11 2W1UA 2RMU2 2YGLA 5A1FA 4Q4W2 2VXJA 2RDRA 5F1RA 4YWAA 1WKYA 4QXKA 5DAPA 3WINE 1LCLA 5F32A 3BTXA 1RUC2 4JGZC 1ZYBA 4WZFA 4BK5A 2WNVA 5T50A 5DDJ1 2YZ4A 2D3RA 2CV6A 1FYUA 2VJXA 3N9NA 2CTVA 4QB6A 3ZXJA 4EE2A 5JXIA 3VZOA 2FZ2A 3POBA 2DVBA 4QXBA 3WUDA 4WVMA 3IDCB 1GOFA 1PK6B 2VBPA 3I8TA 3MFAA 5A3PA 4MX3A 2K9ZA 4NRPA 3HBKA 2GSYA 2VQUA 2WZ8A 4FFFA 5BNOA 1HXS2 1QQP1 1ND2A 2VZOA 2VOXA 2WAAA 3FJSA 1LOAA 1TVGA 2BDRA 5T55A 3BUCA 4XILA 4PI2A 1M06G 4Y4RA 2CNAA 4MHRA 3A0KA 4HT1T 5K0UB 4DEQA 3N9PA 3DGTA 4JVAA 1OI6A 1H9PA 2VUDA 5LWBA 3BYWA 4A7ZA 1NAEA 1W39A 2WNEA 2ZHMA 2GNMA 2DYCA 2VUCA 3B9IA 1XSRA 2TUNA 3JB4C 4E27A 4S2FA 2YBKA 4DXSA 2E6VA 1IQAA 3PHMA 4OHYA 2VOWA 1RUI3 3GALA 2ARBA 5BNPB 4GZ9A 3K4ZA 3O14A 4CCDA 2P3JA 5T5JA 5FV3A 2P6CA 2Y34A 2ZEWA 5IK7A 5E89A 4NIAA 1XNAA 5FZFA 1F8VA 4QDRA 4X8NA 4AHZA 4OFGA 4CUCA 5KXDA 3I3EA 3T0AA 3U1XA 1UOFA 4AOCA 3W5MA 2C24A 2AENA 1WMXA 3AVSA 5GLUA 4BXSV 4LUKA 3S30A 2ZKNA 4CDQC 4EV0A 5FOJB 3WNNA 2PLV1 4Q0SA 4HKLA 3GZAA 2G4IA 4GH4B 2PQSA 4OZXA 4DXTA 2PFWA 2XH6A 1DZTA 3PMSA 4YZ3A 2HWD3 5D1IA 4BQ4A 1O8PA 2OPWA 1O3TA 3BOPA 1TME1 1YQCA 1W06A 1VBD1 1N3QA 4NHLA 2TBVA 4B7EA 5JPNB 2WIIB 3ACGA 2VCBA 1RVF3 4GMP0 4FQZA 4AHYA 3V0AB 2Y26A 1YYNA 4P9LA 4GA9A 3WUCA 1S0FA 5DUWA 1LHUA 2VTXA 3W9AA 1H1MA 3X29B 1Q8QA 4AFMA 3HQRA 2XMLA 4LBOA 4O7XA 5FZHA 5ACA1 5JI9A 5FFOC 2WNVB 5KBFA 1R1ZA 1F31A 3M3QA 3AMQA 3B69A 1UXZA 1PO23 1WZXA 4Q1RA 3V56A 1JH5A 1ND3A 1OD5A 5K0UC 4J25A 3UT0A 1QXJA 3I97A 2WFPA 4Y4YA 4J1WA 2JECA 4EN0A 2PN5A 1IQDC 4AFAA 4YYOA 1QDCA 1EV11 5A3LA 1VBA3 5FYTA 3NJVA 4FT8A 3VKLA 5BNOB 3A22A 4EN7B 1ND2B 2RDQA 3IAPA 4KU7A 1BJQA 1W6QA 1S55A 2ZBJA 2YROA 2E26A 3POGA 1ZVFA 3HT1A 5EYXA 1D2SA 2XJQA 3UGFA 4JQRA 3IBMA 1ZNPA 1COV1 3H0OA 3IN9A 3RI9A 3K75B 3UJOA 2AZ5A 4Z2WA 5H9RA 1RUJ1 4JRLA 5CKNA 1LHNA 1MEC3 3AMMA 4GB32 4WZCA 1HV1A 2R1DA 1CGPA 2AEZA 2LM3A 3NJXA 1DYPA 3WY6A 4PBPA 2H6BA 2YUEA 1SBDA 1X8EA 2ZMKA 3K46A 3FWEA 4KL1A 4P14A 5L9BA 2JDPA 3WV6A 4E4SA 3Q8BA 5BNQA 3GHMA 1RXGA 2EXHA 3WX5A 3KF3A 4XDQA 3ZIWA 4GXLA 3NL1A 3B94A 4H14A 1N1TA 5FZGA 4ES8A 2VVEA 4MYEA 2G9GA 5FMOS 3ZPOA 2XPJA 1OBNA 1KS5A 1LJ7A 1LNSA 1F35A 3C2UA 5DXDA 2Y33A 1W0NA 3OSDA 2UU8A 2A7AA 2KD7A 3D0SA 1JYNA 3T2OA 1WLDA 3O0WA 4XPVA 4JQTA 2A5ZA 5BNNA 3VZLA 1UAIA 2WBKA 4BQYA 3I4IA 3OF1A 3QD6A 4CP0A 5GZFA 3LEKA 4Q0VA 1QJU2 4D7YA 4YG3A 4Z2AA 4KGQA 1VE0A 4L8QA 3U37A 3I2IA 1SBFA 4XFFA 1GR3A 2UYAA 4M01A 1QIQA
chains in the Genus database with same CATH topology
2EXIA 3ZFEC 5C6CA 2HKXA 1ENQA 3FUOA 2XBO3 2ZMLA 4P9IA 4K6BA 5LK7B 4Q4V1 1IS5A 1OOPA 1XRUA 3KB5A 3IT8A 3PNAA 1X82A 3AKSA 3N4MA 5GZCA 1AL0G 3G7DA 1ND2C 1VR3A 2A6XA 2MEV2 3NSTA 5CA6A 2VMHA 1HQWA 4L9BA 3N7KA 1ND3B 3NVCA 4PIXA 3VHPA 2DTWA 3JD72 5GJ6A 3UKTA 1PIV1 3ST7A 3ZFFA 1RC6A 4Q2FA 4NOTA 3RYPA 3M3OA 4PLMA 3K48A 1W6QB 5I8SA 5J37A 3U4XA 3KM5A 4XETA 4FOVA 4BYYA 4OI0A 3MPPG 1MS5A 3ZXGA 3MIEA 3FUQA 2D7FA 3IWZA 4S2DA 3ZXAC 2VECA 4FPKA 1TE1B 2DFBA 1FV3A 1HLCA 1HQLA 5CIRA 2XVKA 2ET1A 3UL2A 5IUQA 3FFZA 4AWDA 2FHRA 4E2QA 2WS92 5JOXA 4INDA 2R041 2VNRA 1GZCA 3MIGA 4M3CE 1LHOA 5EXOA 1LTEA 4CTEA 1C8M3 3ZYJB 1WLCA 3VN4A 1R092 1QJX2 1VBB1 4OUSA 2NN8A 3ZVXA 5FQ0A 4HSJA 4I30A 1H8TA 4C90A 2CWSA 3J8F2 4FP2A 3WQ0A 4PF5A 1DQ6A 3IPVA 1ZRCA 3WG2A 2ERFA 2RR13 5BNNB 2Z5WA 1Z78A 3B02A 3M70A 2A6YA 4I0AA 5GALA 4XFIA 1FI2A 4FBFA 5J7MA 5J36A 2DUPA 1KS4A 1ZRRA 2P3IA 4YW2A 1F5JA 3QACA 4AF9A 5EYYA 2WA3A 3VZJA 1OOPB 4XEZA 3ZO0B 5FREA 1VBC1 4BH9A 2Z42A 4W6XA 2OZ6A 2ZX0A 1AYM1 4YFWA 3RDIA 4EN8B 4CP1A 3H7JA 2DFCA 4QPIB 2ETEA 4LBQD 3GHNA 2EF6A 1KQRA 5C9AC 4LE4A 2I45A 4FXKB 4Z82A 3SITA 2F6BA 2R49A 2UWBA 1REFA 1URXA 1PVC3 3HT2A 1IGOA 4COZA 1XYNA 1IS3A 3ZFFB 3OD0A 5JPMB 5BUVA 2RHPA 5KHKA 5CG8A 4Q29A 3PMEA 3THPA 3HIFA 4N53A 2CAVA 5GLWA 1MACA 2B9UA 5JOWA 3KQRA 2WFF1 1AR92 4QHBA 2Q30A 4EWEA 1H4GA 1TMF3 3VBHA 1NYWA 4Q4X2 4QQHA 5D8AC 4AEJA 5GZEA 3ZYIB 5EJ3A 4WM8C 2RS33 1NQDA 3E6CC 2G9FA 3URFA 1IPKA 1POV3 4HLTA 2R1BA 2XWJB 2B46X 2VVDA 2RS12 4AQSA 4XFAA 1QY4A 2B7YA 1RHI1 4B3NA 1XNCA 2AREA 2YMZA 2MNGA 4HKOA 5H9SA 3SCFA 4A3XA 5BNNC 1QOTA 3KGZA 2D98A 3ZYPA 4COWA 3ZN5A 1AYN1 5FQ0B 4Y1UA 5DDJ2 5LK5A 3ILRA 3WOGA 2ZAAA 1SDWA 2ZKLA 1H8TB 1VRH1 4ORFA 3IPVB 4FTBA 1YJLA 4W6YA 3MYXA 4YZ4A 3VBOA 4HVQA 4OLLA 4Z92B 1YRZA 2RMU3 5FCCA 1QQP2 1MZ5A 4A7YA 1ULGA 4E2GA 2UY9A 4QPIC 2WINB 4XIKA 3T1MA 1RUD1 4BMEA 1RUC3 1U12A 2W0XA 4BWOA 1AR61 4ASLA 4META 3LSDA 1GICA 4XOGA 2BQPA 3WG4A 1NQJA 1V9U1 1VAKA 3R0RA 2D6OX 3VUOA 2P34A 3ZFFC 3TNQA 1ULCA 5FMOL 1IPJA 4WM7C 5CFDC 4QQ2A 2O0OA 2V09A 2D3SA 1Z0HA 2R16A 1FPN1 4AVBA 4YW4A 2CAUA 1UPIA 1OQEA 1CN1A 4IEZA 4Q4Y3 4XIOA 3UKVA 2VXRA 4N43A 1YNAA 1FAYA 2QZ3A 3LWCA 2Q4SA 1R1A1 2E63A 4I09A 3CU7A 4AGGA 2HWF3 5E8AA 4COVA 4HFSA 2PELA 3NAPC 4N53B 2PLV2 1AR83 4CEYA 2ZAHA 1ZBA1 1BCXA 3VBHB 3LOIA 3ZYRA 3ZSMA 1OPOA 1TME2 3AYDA 4EN9B 3M4FA 1GFF2 1VBD2 1LOFC 1N1VA 4I01A 4I0BA 3ACLA 1H1IA 4ZXKA 3LA7A 2R071 1UX6A 3AKPA 2HWC1 2ZA9A 1MS4A 3RYRA 1Q8OA 3SCGA 2KA3A 4PQ9A 5CAZA 1RL3A 1VJ2A 2HWB1 2VW0A 2WLPA 4DRRA 1QNYA 5ACA2 4C0HA 1WW7A 3L9JT 2WT0A 3WP6A 3ZSKA 1LGNA 4JGZA 4Y22A 2AUYA 1AXZA 1EAH1 4ATEA 5FDBA 1PZ9A 4RHV1 4XXPA 1APNA 1CD3G 1QH6A 1DBNA 1RUG1 4X6RB 3VBOB 1AR73 4FCAA 1EV12 1MR5A 5JIAA 3MF6A 1GYKA 1UF2C 3MEPA 3KT4A 1ZA4A 4XTPA 3V64A 2PHWA 3GYDA 3WXPA 2EVXA 1COV2 1I3HA 2R061 4HVOA 4IEQA 4XJZA 4AEDA 1RUJ2 2GN3A 2YHJA 3WG3A 3FLRA 1HKDA 3SMHA 5JI7A 3KMHA 4EN6B 4J1XA 3RPQA 3VBRC 3MI8A 4LO4B 2ZGTA 2Q5TA 4CEWC 5AVAA 1MVEA 3VKFC 5AC93 1GV9A 1JHNA 1X33A 3FLTA 5DUUA 4HANA 4N43B 2RS51 5KHIA 2XJSA 1U5ZA 2ZOEB 3QLQA 4IV1C 4HN0A 4NWVA 4OHZA 5DZEA 4LBKA 3KCYA 5FLJA 4D7TA 1OA4A 3DKWA 3SH4A 1J59A 1RUF3 3FBMA 1MS9A 1J1LA 4CDQA 3B5LB 4CEYB 1H8VA 2VQAA 4NR1A 3IM0A 4XF0A 1NA1C 3P3NA 1WD3A 2PYTA 2JE7A 4IEWA 4OI2A 3PLQA 2O1QA 2ET7A 3KZ4C 3N7JA 4GULA 4MH0E 2WC2A 3AP6A 2DVAA 3SNMA 4Q4V2 5FO8B 1CAUA 4XQDA 1AHSA 1LULA 3WLUA 3VBUC 3ZPYA 5GKAC 3VKNA 4NWWA 2HEVF 4MLOA 4JGZB 1RUE1 2PAEA 4Y22B 3HBZA 4MVTA 4XMAA 2ZGPA 1BBT3 5TSWA 1ZZ7A 4JTNA 1DQ4A 1Y3TA 4QQPA 3WW3A 2I07B 2BFUS 5K0UA 3GBWA 1NZCA 2AYHA 1PIV2 1D4VB 1U5XA 4YNIA 2BBVA 4P9JA 4YFZA 1AL23 1ZX5A 1HRI3 1NXMA 4SLIA 1X8MA 5I8TA 5I0TA 1JYCA 3OGJA 1W6OA 4LBLA 1YLLA 4HL0A 4AEDB 3NWKA 5JWPA 2BNOA 4YLZA 4N43C 2EXKA 4BZ4A 1PGL1 3VLBB 2B8MA 4K3UA 1H1AA 3JD73 2FMYA 2YDEA 2EALA 2R042 4HPKA 1IS6A 4TYSA 2ATFA 1VAVA 1DZQA 2Q1ZB 2VOKA 2ZMNA 1AF9A 1B09A 3GBFA 1XXNA 2F4PA 1T6GC 3ILFA 3M3CA 4NHMA 4S2GA 3HD8B 4OULA 4H7MA 1VBB2 3H1YA 1ZRFA 2D6NA 3LZZA 1J3QA 4XJ9A 2KXLA 4BOWA 4MXVA 4CP2A 1SFYA 2ZX1A 3I2DA 3OBTA 2HJIA 1WCSA 2GMMA 3LA2A 2WS93 4XXAA 2IXHA 2GAUA 1GLHA 3RRDA 5GLZA 4RQPA 3ROUA 1SMVA 1XE7A 1R093 2VUJA 3GZUC 4YM3A 2HWD1 2MPFA 5DG1A 3H9AA 1WLWA 3ZFEA 3HN1A 3N7LA 4XHBA 4AVCA 3LAGA 3MW3A 4AHWA 1CAUB 3NO8A 5FO7B 1VBC2 3J8F3 1X36A 1PGSA 2ZGQA 4D3WA 1C28A 1AYM2 3AJYA 4DXZA 3TBDA 4JV4A 2XL7A 3WHUA 1RUOA 2AH2A 2QKDA 2JXAA 2XL9A 1W2UA 5FO9B 4WV8A 1C1LA 4BMBA 2GC1A 1ZZ6A 4ZU5A 5JLVA 5JAXA 1LKNA 1CAWA 1ZBE1 1MQTC 4AEDC 1JUIA 1YFWA 4HBNA 2D6KA 2HWE1 3WD5A 2ZCWA 5BXXA 4DS0A 4LHLA 1PO21 1FX5A 2D43A 5GLTA 1UU4A 2DURA 1JYIA 2A6VA 2WA4A 3FMGA 5BY5A 1KDMA 2ILMA 2ZGLA 2WFF2 1W6OB 2JG8B 1KXGA 1PZ8A 3ES4A 4P9WA 4R9CA 2PHRA 3H7YA 4LBQA 1GNZA 1AJKA 4CYDA 4Z07A 4R8HA 1J3RA 4MGKE 3AZWA 4H3WA 3ZXEA 4KQ7A 1HX6A 4NHKA 2C0ZA 2WSVA 2VW1A 4FOWA 2D5FA 4X8PA 3V65A 2E51A 4E4ZA 3R6SA 3O7OA 3PVNA 1ZM1A 1RHI2 4HPKB 5B2GB 3IKWA 1WMFA 4LO8A 4COUA 1AXYA 4Z8BA 1N47A 5KXEA 1AR93 4HN1A 2Q1MA 3TNPB 1Q43A 2HYKA 1Q8PA 1AYN2 1NLRA 1S0BA 1GKBA 1VLNA 4IEVA 4MGYE 4QGNA 3AP5A 4I02A 3L2YA 3W58A 4RS5C 4A2UA 5HI0A 3H3ZA 1VRH2 3AMNA 4B4PA 1EPWA 1RMU1 2PHLA 1B35C 3A0NA 3WQ1A 1UZYA 5C4WC 1W0OA 4Y5Z0 1UIKA 2RS13 4AVTA 1M4WA 2JX9A 2CGPA 2DCJA 3MIFA 4RQPB 3KCXA 1TEIA 2HEYF 3N36A 4QX5A 3VKMA 1RUD2 3RYKA 4YVSC 3POWA 4RR3A 3ZFEB 2IXIA 1AR62 1AX2A 3AB0A 2FMDA 1UW8A 1QJY3 1V9U2 3SH5A 4Y24A 3ME2A 2DUOA 1V00A 2A3XA 5F6KA 1KJRA 3DF0A 4XJWA 1XNDA 2JE9A 1FPN2 4QMAA 1CAWB 1CR7A 4FO9A 4HZFA 1OLQA 5C9AA 2JG8C 4DMIA 4XBQA 4ES9A 4AFDA 3P3PA 3JBG1 1HV0A 2W68A 1R1A2 5T52A 2OW4A 2O8OA 1VIWB 2DU0A 1LU1A 4L2NA 3AJZA 3E5QA 2JICA 1ZBA2 2QDRA 2OA2A 4I3GA 4ISQA 2C9AA 4RA0A 4LBQB 3KT7A 3MLJA 1OQ1A 2NMNA 4F3JA 5D8AA 4ASMB 4WM8A 1WBFA 1Z7S3 4EJRA 3BOWA 2GC2A 5A3MA 1NY71 1SLCA 3U0ZA 1ASJ1 1PGW1 2D40A 2R072 4CDXC 2HWC2 3NV4A 3LB9A 1DIWA 3O0VA 2CYFA 2RM23 3ZYGA 2ZGNA 2HWB2 3VBFC 4QD2A 1GSLA 2BFUL 5J98B 2JJ6A 4U2AA 1D4M1 5KHGA 5EFUA 2A75A 1C8M1 4RQPC 2A3WA 2E7QA 1EAH2 1PO11 1QU0A 3KLSA 3RMXA 4ATFA 1PNGA 2XB6C 2PAKA 1LECA 3O0XA 3ZX7A 4RHV2 2YGMA 4AHXA 4RGGA 3GZTB 1S2KA 1RUG2 4OI4A 3RZZA 4MGIE 1CPMA 4PLOA 4LE3A 1S2BA 4LO6B 3WCRA 2RR11 4FP3A 4BLIA 1DQ2A 1SCRA 2D5HA 4QPIA 3MW4A 4RR3B 1Q8VA 1JW6A 2R062 1DLLA 2RJLA 4EROA 1LOCA 4WBBA 2IC1A 4DNYA 2X29A 4XJ8A 3MDPA 4LO7A 3U10A 2LTNA 1EV13 5CFDA 4WM7A 2HEWF 2EA7A 3LSEA 4DRVA 1S0JA 5KHJA 4Q27A 3TN91 3V0BA 1MS8A 3LA3A 5C9AB 1FMD1 4MSVA 1GANA 2RS52 3ALQA 1WCDJ 3HWJA 3JU9A 1DGWA 3IIAA 2H0VA 5LRRA 1L3JA 2FZ1A 1QH7A 1PVC1 1O7FA 2BNNA 3NAPA 1G9BA 4PIYA 2LUWA 1QJZA 1DDLA 4AQTA 1O4YA 4LBJA 4F8AA 2H0BA 1AUYA 2V73A 5D8AB 1CVNA 3M3EA 1TMF1 4IEOA 4WM8B 4YVWC 4YGCA 1LOFA 5I8YA 3WP4A 3PJYA 3ZFGC 2XUMA 2QZ2A 1YFUA 2RS31 2Z2SB 4P9XA 5SV5A 3B93A 4XQ4A 4K7JA 1POV1 2FQPA 4XFGA 1YXWA 1A78A 1MZ6A 4AI0A 2ZX2A 3WW4A 3MICA 1E57A 2ZJCA 5T54A 1RUE2 2Y0OA 3CJIA 3LGRA 4H7LA 1O5LA 4K8FA 5IT6A 5FOBB 4DB5A 4RR3C 1XNBA 1CX4A 3FFQA 2BUKA 1TNFA 5CNAA 1LENA 4Q4V3 1GQGA 3AMPA 3EJKA 1H2MA 1DFQA 2EXJA 1C5IA 1MZEA 1RUH3 4FXGB 2EAAA 2WQZC 4OHXA 1C57A 1YIPA 1SFNA 4I3PA 2DF7A 4PIZA 2IFWA 4DY5A 1ZRDA 1S1AA 1R081 5T3NA 3U11A 3NV2A 4ZU7A 1RUC1 2A71A 4M3CA 3JB8A 2IXCA 1OA2A 3OPZA 3ENRA 1PGL2 3GF6A 2ZGOA 5LRSA 2A3YA 2D44A 1SEFA 4FPYA 4IEUA 1J58A 4WM7B 1H4HA 3VBRA 3W59A 5CFDB 5J96B 2BTVC 4O9GA 1REEA 4CEWA 1WMDA 3H3UA 4DQAA 4AEMA 1FATA 3V0BB 1DU3D 2BNMA 2B5HA 2GMEA 2VQ0A 4MXWA 3RQ0A 1CONA 2WT1A 2Y38A 2BVBA 3CO2A 4Q4Y1 1O3RA 2GU9A 1ZREA 4IV1A 1H2KA 1Q5OA 5KWRA 1RJ8A 1FOD3 3NV1A 3OJBA 4AFBA 2ZHKA 3NAPB 1WCKA 2HWF1 1SBEA 2V5YA 1O5UA 1RTVA 1NA1A 1AR81 2P17A 1HRV3 3NKGA 2TNFA 4AVAA 1MS1A 1VBB3 2VOVA 1SLLA 3ILNA 5H9QA 2NM1A 4JDOA 4W6WA 5DUVA 4X6QB 3VBUA 1QDOA 4O9EA 5BV6A 2W52A 3IDBB 2QVSB 2WZPP 4IV3C 3RMYA 1A8DA 2UWAA 3R4DB 4Q4W3 4B8EA 2GNTA 3CJIB 4FVVA 2X8KA 3H1MA 4ZKTB 4L11A 2OUJA 4PJYA 1ZBE2 2YC0A 3PJQA 2HWE2 2ZGSA 4C1WA 1PO22 2DWRA 4FPFA 1N1SA 2ZX4A 4G4FA 5IK5A 5KXCA 1D2QA 1IKPA 1S0GA 3MFCA 1VB4A 1AR71 1AYM3 5AFEA 1KFXL 1SLBA 3QH7A 5CU1A 3VL8A 3EHKA 1HXS3 2ES3A 4YRDA 1KFUL 4HSLA 4JDMA 5SV8A 3PVOA 2YPJA 3NV3A 1CJPA 4M3CB 1I9RA 4XZPA 5KBFA 1H2NA 2BWAA 4N9IA 1V6MA 2NLRA 3AP7A 4RSUA 1LR5A 4Q8LA 2IXKA 3AXDA 3WQ7A 1H0BA 2D3PA 3VBRB 4TSVA 2GNBA 4CEWB 3T1LA 4FSJA 3HAGA 3H8UA 3AMHA 1LU2A 5HBAA 2PHUA 2QUOA 3ASIA 4FAGA 1AVBA 1NCQC 2XKOA 4MXWB 1S0IA 5H9PA 3RJRA 5FPXA 4M0HA 4KU8A 3M8LA 3AP9A 4AW7A 5AC91 3BTAA 4JTOA 2NMOA 1NOVA 3N3HA 3QCWA 4Y1YA 4DOUA 4IV1B 2BPA2 3ZXKA 4LBMA 4GMP1 1UMZA 2A70A 2ZGUA 4N90A 1RMU2 1OA3A 3INAA 4AYUA 4D69A 1VBE1 1ALYA 1LHWA 2E7TA 2SLIA 2ZS6B 4Q0UA 4FPJA 2VNGA 4EWDA 1RUF1 1NA1B 4JGYC 1RGSA 4H55A 2WZR1 3CJIC 5CG9A 5E1RA 1AYN3 2P3KA 4FTSA 3WG1A 3AXEA 1BZWA 1WW5A 4RL7A 1C3HA 3RI8A 1VRH3 2JDZA 4URTA 1BEV1 4LNVA 1KITA 1HW5A 3VBUB 3ZSEA 5HCAA 1CQ9A 4IEXA 1G9AA 4AGRA 2XKPA 1Q56A 4JAAA 5JSOA 1AZDA 4XHXA 4IXLA 4LULA 4UBGA 3VZMA 1LESA 1IS4A 1LODA 4QGLA 3A4UA 5F5QA 5FLIA 3BIWE 5L36A 3K51A 1AR63 1MQTA 4AEKA 1BBT1 3JBG2 2Q8OA 3BALA 4AI3A 2IXLA 4XMIA 1V9U3 3VHRA 1UKRA 2N7GA 3D4KA 4BIOA 1I5ZA 1QOSA 4R4ZA 4B29A 1TQ5A 1AL21 2NZ9A 2QJVA 3VHOA 1HRI1 1FPN3 1BQPA 4FPGA 1C8NA 2PTMA 3AKQA 4HKWA 2B39A 4WVZA 1IOAA 1G8WA 3KS7A 1CIWA 1QXPA 1NY72 1YCIA 3WP3A 4Q8KA 1ASJ2 1VP6A 4GB33 3ES1A 1R1A3 1C1FA 1PGW2 2TEPA 3WCSA 4AXOA 5JR7B 1JBCA 2P37A 4HMZA 5C33A 5DZGA 4LA2A 2OIIA 1D4M2 1ZBA3 2X53S 3MIBA 4LUMA 1DF0A 2Z69A 3MF9A 1N1YA 1PO12 3AK0A 4RS5A 2DTYA 1B35A 5C4WA 2R073 3O5SA 1YO8A 2HWC3 2IFRA 4Z1VA 4UBHA 1YUDA 2RR12 1RINA 1LOBA 3H1WA 3KGLA 4BPZA 4R9BA 1UU6A 5JOYA 1QXRA 4GIQA 1QJU3 4YVSA 5GLVA 2OZJA 1K5MA 2DCYA 1YWKA 4RHV3 4HETA 1CAVA 5CB7A 1BYHA 3TB0A 4JRAA 3NJZA 1QWRA 4KBBA 1GQHA 3TN92 1DGRA 2VNOA 1OQDA 2I74A 1FMD2 3ZMNA 5L7OA 2JG8A 1MQTB 1UCXA 2IXJA 5LEJA 2MEV3 3B9CA 3J9SA 2CY6A 4FOQA 2E53A 5L73A 4HK9A 1W6MA 5A32A 3PVEA 2CL2A 1H30A 2A6WA 5CFCC 2XJPA 2CWMA 2DCTA 2EAKA 2ZGRA 5JZGC 1C4RA 1O91A 1RUI1 1RIRA 1TMF2 2RS53 1U0AA 5FAXA 2DU1A 4KNCA 2WL1A 2ZPXA 2RS32 2XGXA 4CDUA 2YV8A 3FHIB 4KWLA 4CDXA 2Q0AA 3VBFA 4KG0A 4QGMA 1V6IA 1BKZA 4YW1A 1SCSA 2GH8A 1XNKA 3EO6A 1GNHA 5CVRA 4GKYA 1HIXA 4RS5B 1V6JA 1QMJA 1QJX3 1O3SA 2WNUA 1B35B 4XBLA 1PNFA 4OHWA 1AXKA 5C4WB 1XYOA 3S7EA 3ATGA 3D6EA 4UXAA 5K8SA 4XE9A 1RVF1 4N7UA 2W39A 3TOJA 4AI8A 1V6OA 3ZDSA 2PA7A 4U36A 4YVSB 1RUE3 4JC1A 3HR9A 1K5MB 2BYVE 1R082 5ABJC 2CGOA 2JG9A 4YG0A 1RB8G 4I2OA 2PHTA 4K1ZA 1CAVB 3G6JB 1QKQA 1QJY1 2VGDA 5L19A 2NQYA 3UV9A 1VBA1 5DG2A 1F9KA 1GZWA 2DCKA 5L7OB 4AFCA 1DHKB 3UK9A 2QFEA 1PMIA 4K9SA 3E6DA 4Q4Y2 1F5FA 1W6MB 5T5PA 5A32B 5EZWA 2VW2A 3NW4A 1FT9A 4QU2A 1MEC1 1NXD1 4PDWC 4K40A 4Y1XA 3WR0A 3H50A 4QM9A 2HWF2 2KM2A 3D82A 3LKJA 1LRHA 4N9HA 5FTTC 2WKKA 3M3IA 3TAYA 4YG6A 4IESA 4DPNA 2PHFA 3VDDC 1AR82 1WUVA 1CJDA 5AFBA 4YVWA 5HXVA 4Q4X3 3MLKA 1UZZA 3THTA 4K21A 3ZFGA 4XJAA 1PZ7A 3BODA 1Z7S1 4CDUB 1NCRA 3L2HA 4CDXB 3N7MA 4XF3A 2A73B 4CZSA 1QHDA 5C8CC 3VBFB 2ZHLA 4QQLA 2QCSB 3J26N 2RM21 4KWJA 4YM1A 4F83A 3ZXFA 1NG0A 2WNUB 4KG8A 1K5MC 2W08A 1FNZA 4XJUA 5DDJ3 3RNSA 1BMV1 3OY8A 1ONAA 4D7SA 5BPXA 1F2NA 4E2SA 4NN0A 1O3QA 2XBO1 4LTAA 1AR72 1UIJA 4YW5A 4Y20A 4ZU4A 4C1XA 3B7MA 5I0UA 1PK6C 4MGZE 5CBLA 3OCPA 1QQP3 3WW2A 1G9FA 2JG9B 1ZBE3 5L7OC 1Q8SA 2HWE3 5JCTA 4J6GA 3D5OA 1JN2P 4YW3A 1Y43B 2B45X 3SISA 3WDXA 4B7KA 4LLOA 4WVMB 1IZ3A 2JENA 3IDEA 5HCFA 3SXWA 5LEKA 4FPEA 2H6CA 3B00A 3ZXLA 1GZWB 1MS3A 1V6NA 5AC92 1OFSA 1S0EA 5JIUA 1LEMA 4M3CF 1ENSA 1YFYA 1WBLA 1HQNA 5BNPC 1YHFA 2ZZQA 2C1FA 2ZTNA 5J3UA 5FRAA 1ZZBA 3JQWA 3DV8A 2DVGA 4CDUC 1VBE2 4GWNA 4DZGA 1OHFA 2XJUA 4P9GA 5AVPA 3RWNA 1MS0A 1RUF2 3VV1A 4A7KA 5IK4A 3ZIXA 2PLV3 2UWCA 4AE2A 3AZXA 3JZVA 4CRQA 2WZR2 5CADA 4V1PA 2ZZJA 3KSCA 1V6KA 4YVWB 3QOPA 2E9QA 1J3PA 3ZFGB 1TME3 4GH4C 3JQXA 1VBD3 2Y0IA 1NCRB 2WNUC 1U5YA 2WQ4A 4XF1A 1RMU3 3R05A 1BEV2 4F7ZA 4WVVA 1X50A 1DGRN 1RJ7A 4XQWA 2GN7A 4TWTA 1FV2A 2OUHA 4IV3A 3VZNA 1NLSA 3JUUA 1VALA 3BU7A 1W6NA 4HVRA 5ACA3 1EYBA 5I91A 1BBT2 3VKOA 5FLHA 2JG9C 3OY8B 5JSPA 3M7AA 2XVLA 2WNVC 3AKTA 2DCZA 4PLNA 4XFBA 4BHPA 3DN7A 5J48A 4Y20B 5I93A 3CNAA 2GNDA 1AL22 1HRI2 1RUH1 4TZDA 2FBEA 4L97A 1NE6A 3T2TA 5BNOC 1EY2A 1A6CA 2UYBA 5HCBA 1YI7A 2B42B 2SBAA 1DQ5A 1COV3 3ZSLA 3JBG3 3AFGA 4OI1A 1RUJ3 2XHKA 2K0GA 2WLQA 4AGVA 3AKRA 4B4QA 5JOZA 4KGGA 1O4TA 1Y7BA 4FPOB 4FPCA 4MV2A 4SBVA 1NCQA 1ENRA 5EWSA 3TWIA 2GMPA 4BM8A 2ZX3A 5JVVA 4P5HA 1OKQA 3I54A 4AQ6A 1UKGA 3WNXA 1UD1A 2CGNA 2QQPA 5IK8A 1JTZX 4LEJA 3I7DA 4W65A 4UW4A 2X5IA 3VBSA 4BA6A 1XU2A 2D6PA 1FNYA 1ASJ3 2PHXA 1NCRC 3KD4A 2NYYA 1FOD1 3M2MA 4C0BA 3S6PA 5KHHA 3WZ1A 2JD4A 4JDNA 4JGYA 4G9SB 1D4M3 3VGIA 3WW1A 4WVWA 4QPYA 1PO13 1HRV1 2WJSA 3D0JA 3FX3A 1WW6A 2ZHNA 2DVFA 4XBNA 1YFXA 2O8QA 3GBGA 3KT1A 4TLFA 4ITCA 1XE8A 2RJKA 1UPSA 1J1TA 4AG4A 4IV3B 1I6XA 3MPBA 4XYXA 5A33A 4BE3A 2ZGKA 1JUHA 2RMU1 1W6NB 4OHVA 4Q4W1 3CJXA 5GZDA 4YZ1A 3B3QE 4XF4A 1IHMA 1MZFA 2RE9A 1V70A 4CDWA 1XQNA 4K1YA 4PCRA 3DPRA 4FTEA 5GZGA 2AR6A 3BPZA 1KD7A 4YM2A 1ND3C 1PIV3 1VB2A 4LA3A 1SACA 4KWKA 1BXHA 1QNWA 3E5XA 2XLFA 1XU1A 3TN93 3MLLA 4QQOA 5DUXA 1G9CA 1HXS1 1RUI2 3ZN4A 1FMD3 1KRIA 2DV9A 3E6BA 4NVPA 2GZWA 4MUVA 4NPRA 5I0RA 1NE4A 3FLPA 4L92A