2TUNA

Conformational changes in the (ala-84-val) mutant of tumor necrosis factor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
151
structure length
151
Chain Sequence
TPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIVVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lymphokine
molecule keywords TUMOR NECROSIS FACTOR-ALPHA
publication title Conformational Changes in the (Ala-84-Val) Mutant of Tumor Necrosis Factor
rcsb
source organism Homo sapiens
total genus 23
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tunA00
1ALYA 4KGQA 1OSGA 4OUMA 4QQHA 4MXVA 2RE9A 4MXWB 1JTZX 5CIRA 1C3HA 3FC0A 2JG9C 1O91A 2HEVF 2AZ5A 1GR3A 3IT8A 2HEYF 5L36A 1D0GA 1U5YA 1PK6B 1TNFA 3B93A 4G3YC 3WD5A 2JG8B 4MXWA 4HT1T 4D7YA 3B94A 2E7AA 2RJKA 5L19A 5HBAA 5TSWA 1DG6A 2Q1MA 2WNVB 4TSVA 2R6QA 5BNQA 4J6GA 3K51A 3AB0A 3TYJA 1PK6A 4F3JA 4RSUA 5KWRA 1RJ7A 4QPYA 2JG8A 2QDNA 1XU1A 2OIIA 3TWIA 4EN0A 3B9IA 4E4DX 1I9RA 3V56A 1OQEA 1U5XA 2WNVA 1D2QA 2WNUA 1PK6C 2R30A 1KD7A 2R32A 2JG8C 1RJ8A 4E4SA 2QE3A 3ALQA 1U5ZA 4GIQA 2WNVC 2WNUB 4OULA 4N90A 4KGGA 2RJLA 2X29A 4OUSA 1XU2A 1WCKA 1KXGA 3QBQA 3K48A 3ME2A 4G4FA 5KC5A 4QQPA 2ZJCA 2TUNA 4MSVA 2Z5WA 4QQ2A 2TNFA 4DB5A 1DU3D 1OQDA 1JH5A 3QD6A 1S55A 1D4VB 1TNRA 2ZPXA 3MI8A 1A8MA 2KA3A 2JG9B 3L9JT 4QQOA 1IQAA 3LKJA 4KG8A 2HEWF 1C28A 2WNUC 5KC6A 2O0OA 4TWTA 3URFA 4DOUA 4NN0A 2JG9A 2Q8OA 4QQLA
chains in the Genus database with same CATH superfamily
2D6MA 2JKXA 3KCCA 1BQPA 3POGA 3JUUA 4FQ4A 4Y20A 5D2AA 1X9TA 1F4HA 2DCZA 1O8SA 3JCIA 3PDQA 5EPAA 5K0UA 5KXBA 4XACA 2NN8A 2NMOA 3M3QA 4FAHA 1GZWB 4LXLA 1ASJ1 1C3HA 1KEXA 2VCAA 5C9AC 2G9ZA 5GZDA 3ZDVA 3D6EA 2WT1A 4HFSA 5FMCA 3T2QA 5FZEA 4BLJA 2C9KA 1SBDA 1XJAA 3O14A 3PUHA 3VDDC 3IN9A 4Q1RA 5F5IA 1OXCA 5FY9A 2IWGB 4A7ZA 1PK6B 3R4UA 4G3YC 1PZ9A 3PLQA 1G9BA 1W6MA 3FBMA 3I2FA 1LOCA 5HCAA 2P3KA 1C5IA 2FMDA 2MNGA 4XEZA 4S2GA 3HR9A 1J1LA 3R6SA 2D40A 4ET7A 2FCUA 3LIHA 5FYTA 5TSWA 1WLWA 2WZR3 5IVVA 1UOFA 5FZ7A 4OMDA 4TSVA 4M0NA 5BNNB 3AFKA 5DDJ1 1SMVA 1K42A 2ADEA 1O7FA 5A7QA 4DUVA 1TME3 4QXBA 3FZ3A 1RL3A 4CCOA 5LEJA 2I07B 1KDMA 2ZGTA 2XUEA 4RSUA 3SXWA 4A6OA 3RI8A 1BKZA 3WHTA 3R4SA 4EWEA 3PVOA 3PU8A 2B5HA 4GAZA 4I3PA 4ZS3A 2RS51 1AYN3 1GBGA 1HQLA 4E4DX 4EYUA 3I7DA 4ATFA 3I3MA 5IVCA 1AR92 1DQ4A 3VN4A 1F2NA 4W6XA 4XPVA 1ZBA3 2ZGPA 1QJY3 3Q8FA 4LMFA 1IS5A 3VHPA 1LRHA 2PN5A 4CDQA 4A2UA 2DUOA 2J1AA 1DQ5A 2IXHA 5GKAC 5AFBA 1EV12 1GSLA 3LDRA 3M8LA 4CCKA 5E88A 5EJ1B 1L7RA 3W5NA 3OUJA 3VD3A 2P3JA 1W2AX 2BYVE 1EY2A 4CCLA 3POJA 3A7QA 4KGGA 2VBBA 2O8QA 4QX7A 1IG0A 3QH6A 1QJU1 1OVPA 2VO5A 2CDOA 2DVDA 2Q1ZB 3HT2A 5KC5A 4PLNA 4KWUA 4LKDA 4KQ7A 2D6PA 3LD8A 1RMU1 2R0HA 5DUWA 4YARA 4BCUA 2FZ1A 3Q9OA 1RVF2 2TNFA 3POFA 5AC91 2ZXQA 2Y64A 1EAH3 1LU1A 2QJVA 5GZCA 3QD6A 5A1AA 2GH8A 3ELNA 1PZ7A 5H9PA 4BA6A 2EXKA 4XFIA 1LOFA 2HWD3 2VQAA 2LROA 5FP7A 1YQ5A 5IFTA 2QQUA 4ES9A 3POIA 4BIOA 3ZPOA 4QX2A 1LODA 1C57A 3OEBA 4QQOA 1QXPA 3UGHA 3ZYIB 5CFDB 3W5MA 2BGOA 1MPXA 2DFCA 4PQQA 2C26A 1V6IA 1JZ6A 2GP3A 1CVNA 1MZEA 3V0AA 4NIGA 5LA0A 4GB33 2DUPA 2WZ8A 2QZ2A 1F31A 4A42A 3IDBB 3RZMA 1CAVB 1E5IA 3DYPA 3IDAA 3KSCA 4FPOB 1VBE2 1W2TA 3NNGA 4YM3A 2UWCA 5FMOS 2VVFA 1KS4A 4RR3B 2JG9A 1IS6A 3HQRA 3ZFEA 1J3PA 4QPIA 1CIYA 4OVEA 4D6RA 1CAUA 4IW3A 3I2KA 1R1A2 2C4XA 4MXVA 2W87A 1UAIA 4BQ4A 1PX3A 4HKOA 4CCDA 1K5MA 1O4YA 2XLFA 3N7KA 5EFUA 1S0DA 1E5SA 1YI7A 2VMHA 3LDKA 1LAJA 2AUYA 4MV2A 5IVYA 2XL7A 1W8ZA 4BXSV 2I2SA 3TN92 1GFF2 2XLAA 4NHLA 2PLV2 4AG4A 1QOSA 3GYDA 2JDHA 2ORZA 2BWCA 3MW3A 3OUIA 3IT8A 5IAVA 3TEXA 1OPMA 1IS4A 1U5YA 5JSRA 2ADDA 3J7MA 4YGDA 1UZVA 4HG6B 5LA1A 3WG2A 1AR83 2GC2A 4LHLA 4TTGA 3KCYA 4QX3A 3ZYJB 5D8AA 1CONA 5F5QA 5ANNA 4CEYC 1OLMA 5JIAA 5A1FA 2CWSA 1S4CA 2DBNA 4XQDA 4JV4A 1V9U2 1TEIA 2ZEYA 4GWIA 2UYAA 4UW3A 3VHOA 4Q4Y3 4DXTA 5KHIA 2W52A 1O5LA 2ZGUA 5IFPA 5JIUA 3H8UA 2WWJA 3OY8B 3O1OA 3H7YA 5IUQA 3MIFA 4NPRA 1SPPA 4LBOA 4RQPC 2XJTA 5J3UA 3BI3A 3GHMA 1WWYA 2WUHA 3RJ2X 4QPYA 4AQ6A 4EN0A 1U5IA 1XU1A 1OLQA 2PQSA 2QVSB 4W65A 3BTZA 3PIGA 3PTRB 3NL1A 3NV4A 3ZYRA 3O1VA 1VBC3 2BRTA 1KQRA 2GMMA 5FYHA 1ZRDA 5FTTC 1AVBA 1BVP1 2IXCA 2VXRA 4KBBA 3UKNA 2ORXA 1Q8SA 1HV1A 2WS92 1ENQA 2FBEA 5E8AA 4CDQB 1W0OA 1HRI3 1MS4A 2XONA 5BNPC 1DDLA 5CZKA 3F2ZA 5FY4A 3OUHA 3D4KA 4XJ8A 1H2KA 2BJSA 4DXZA 1VAKA 2RS33 4EN8B 1O4ZA 2RMU2 5K9YA 1QDOA 1RUOA 5FMDA 2A7AA 4INDA 4OI4A 4QGMA 1TMF3 4JQRA 4NMIA 4OZOA 2QQNA 4DRRA 1NUKA 3ZYPA 5F6LB 2N7GA 3AP7A 1UCXA 2RJLA 2WYFA 5FO8B 3RZJA 1DYKA 4Q0UA 1RXGA 2A71A 2HKXA 4FFFA 3ON7A 2A6XA 5FJHA 2PA7A 5BPXA 2JIJA 4R8HA 4N8MA 4QQ2A 2Z42A 4MSVA 3FLPA 3U0ZA 4AGRA 3WDVA 2VCCA 3MHZA 1G9FA 5FYZA 1H0BA 2BWAA 2R073 1PO23 3IPVA 2QZ3A 2RS12 2CWMA 4A6SA 4MGZE 4AYUA 1CZVA 1OOPC 1YIPA 4H7LA 2VNVA 4E8DA 1HXS3 3TB0A 3U4SA 2IVJA 4GD4A 5DZGA 4D6QA 4QKNA 5BNOA 4Y4RA 2UY8A 3N7JA 5C3RA 4LKEA 4GULA 3DKQA 4HPKB 1A8DA 2BUKA 4K6BA 1W9YA 1YQCA 4PDWA 2IUWA 4YG3A 3VBSB 2EIEA 2SBAA 4YVWB 4LBQA 1C28A 1PMIA 4AVAA 4CDUB 1OQ1A 1OKQA 5T55A 2EALA 4COZA 2ZGRA 1LOBA 3VLBB 4FPYA 1QOTA 2VTFA 1RIRA 3FUOA 2Y6LA 4IEOA 4Z07A 4LIUA 3VZLA 3WUCA 3QCWA 4RFRB 5FJKA 2HWB2 3OYWA 4Q4V3 2OKXA 2UU8A 3NSTA 1AXZA 4DPNA 2WWUA 4L99A 3ENRA 4AOCA 2XBO1 2BZDA 3D5OA 4ISQA 1YHFA 4N43B 3E97A 3OGSA 4UYBA 2ARXA 5B2GB 3ZSKA 4UFLA 1QJEA 2BTVC 2XVGA 1CZSA 4GJYA 4E8CA 4I0BA 2NPIA 5K0UC 5J7MA 5LB6A 5DN2A 3J8F3 2R062 3AZYA 5F3IA 1PGL2 1AYM1 4JX0A 1D0GA 1GLHA 1MQTB 1D4M2 2VNOA 3C2UA 3KF5A 1XRUA 1HIXA 2HWE3 1UZWA 5L9RA 4I3GA 5KHHA 4AR2A 3OTFA 4LJHA 3B94A 3AZWA 4JGZB 3JBG2 2UWAA 5LASA 4OI1A 2ARAA 1I1EA 1OPOA 3DKWA 5FYBA 3R4DB 5A3UA 1FOD1 4SBVA 4F7ZA 1DFQA 2R49A 3FJSA 4ZXEA 1Z7S1 3CNAA 5A1LA 1ZZBA 3MW2A 4CE8A 4L2NA 1RUH3 2D6OX 2WT2A 3UL2A 2ZHNA 4IV3B 1ZNPA 5JAXA 4Y1UA 4PF1A 2V73A 5FZ9A 3M1HA 2OVUA 2OZ6A 3WZ1A 3ZN6B 3UGGA 3GJBA 1U5XA 1DBNA 3CBNA 3CJIA 2WT0A 1OLME 2PAKA 3MF9A 1QWRA 2JKBA 4FQZA 4L92A 3SEPA 4FPCA 4GXLA 4YZ4A 1QOOA 2WO1A 5I91A 3KWVA 2IXLA 3VBUC 4CEWB 4JC1A 1QU0A 4DQAA 1O3QA 4HXCA 3WQ7A 4N90A 4TXWA 3SCGA 3IDCB 5FP3A 1LKNA 3H7JA 2G19A 1KXGA 1S2BA 4CDQC 1D7PM 3JU9A 2J42A 1UX6A 2WZR1 2YPDA 3O0WA 4W4ZA 3ZDSA 3SLIA 5A7OA 1HRV2 2ZGOA 4JRLA 2QQWA 4BLIA 3HBKA 2WQZC 2ZX0A 4DB5A 2JDMA 1TME1 1XSQA 2RR13 3R0RA 1WLDA 4CU9A 1U0AA 2PHLA 2IZWA 4Q0PA 4LE3A 1I6XA 1W8UA 3E5QA 1CQ9A 4IE7A 1OUXA 1VB4A 1RTVA 3WR0A 4LUMA 2EAAA 1PIV2 5K7PA 1GQPA 1YFXA 5KHGA 1KDKA 1WUVA 3V0BA 4KBZA 3I2OA 3UETA 1XNTA 1QJU2 2IXKA 4P9GA 1CAVA 4XAEA 4COUA 4PIYA 2VE1A 3BIWE 2Q5TA 1ZBA1 1QJY1 1LHVA 1W03A 3NJVA 5HCHA 1NG0A 1LOFC 3HPNA 3TAYA 5K8SA 3OGRA 3H8XA 4GH4A 4K8FA 4XJUA 5AVPA 2VW0A 2PHUA 1UY1A 2AEYA 3VD5A 2JDPA 2DU1A 3ZXLA 4AGVA 2VQUA 4XE9A 2DV9A 3RI9A 2VMIA 5I8TA 1UZZA 2FDFA 4XF9A 1VRH2 5FZHA 5I8YA 3WF3A 1W9SA 2A6VA 4OUMA 2DVAA 2E31A 2DVBA 2EXHA 2WDBA 4IE5A 1AHSA 1EUTA 1HJGA 4NR1A 5CIRA 1HB1A 3VBFB 1EAH1 3ZO0B 1JZ7A 4M0HA 1MZ5A 4ZU5A 5A6QA 3U4XA 1H2NA 2JG9C 3ZFEC 5LZ6A 1JUHA 1W3XA 4NWWA 4LO5B 2HWD1 2IXJA 1KS5A 1Q5OA 4OZXA 1UN1A 3PUQA 4K1ZA 5IWFA 1CPMA 3MICA 1K5MC 1UXZA 4LHKA 4XOGA 2EIGA 4PJYA 4GJZA 4QPGA 3AMHA 1MS3A 2VAUA 4NHMA 4MXWA 2VBPA 2K0GA 1W04A 4HT1T 4IV1A 5LK5A 4UAPA 3USUB 4XJ9A 2JDUA 3FUQA 4GB31 5FOBB 1Y7BA 5I0UA 5J48A 2VNRA 2WSUA 2ZMLA 1H2LA 1QY4A 3I3DA 4R52A 1R093 3GCXA 4N53B 4YGEA 5FYUA 4V2VA 2XGXA 1ULPA 3I3QA 5D8AC 4YVSB 5F3GA 2J7MA 5FZ4A 1OH3A 4B4PA 4F3JA 1PO12 1UYXA 3NMBA 4QXKA 1SDDB 5KXEA 3EMRA 1W6PA 4OQ8A 5FMOL 1US2A 2AREA 1C4RA 2Q8CA 4B4QA 4IEVA 4ARXA 3VBHB 2D98A 2JB8A 1XOYA 5BY5A 5C8CB 5T5LA 1X9PA 2RV9A 1OD5A 2W46A 3A0NA 3AYDA 3OBAA 4XBLA 3WY6A 5FXVA 1JOBA 4OULA 1RUI3 1TZOA 1AR81 3KVAA 1LR5A 3VKMA 1NZCA 1LU2A 2ES3A 3ILRA 3N7MA 4D3WA 5HPOA 5IYYA 1BJQA 5FY1A 3I97A 4C1WA 2CL2A 2BGCA 2ZEZA 4Q4Y1 1RHI2 5JI9A 1RUC3 4LHSA 2QQJA 2ET1A 2AGSA 1RUE2 4LBQD 3ZFFB 5H9SA 2OPWA 3EHKA 5JR2A 2AACA 1S2KA 2E9QA 2IVIB 2CGPA 1VMJA 3H8OA 2QQLA 2BNMA 3BN6A 2QQMA 2O1QA 3PTYA 4WM7B 3AL5A 5ACA3 1UL9A 1VBC1 3RRDA 5DUVA 1NLSA 1YQ6A 2PQQA 2VPVA 2OA2A 3N7LA 1H1IA 1HRI1 3N9MA 4JTOA 2A75A 1VBB2 1S0CA 2V09A 4P9WA 5LBFA 1YI9A 4CDXA 5BNOC 4HLTA 4GALA 4ONUA 2RS31 4L97A 4P14A 3MF6A 4AHZA 2BW8A 5B4XA 1WW5A 3CLPA 3SCHA 1TMF1 2ZKNA 1M4WA 3RZZA 4E2SA 4PDWC 4D94A 3FLRA 2YG0A 4K1YA 2HBTA 3AP4A 2HH9A 2YHJA 5FP9A 3DPRA 5EJ3A 4I0WB 4Q0VA 2RDNA 3WQ1A 1G8WA 4NPMA 3B02A 3I3BA 5IW0A 2Y34A 4MGIE 1FATA 2WNEA 4AVVA 1BK1A 3PL0A 2LRPA 2P3IA 1UZ0A 2R071 1PO21 4V2WA 3LPGA 4U36A 4GMP3 1MQTA 4KI5M 1RUF3 2ZX3A 4BU2A 1UMZA 2V4AA 1AF9A 1HXS1 5F6KA 3ZN5A 5JXGA 2GH2A 3JZVA 2XJPA 5C4WA 1CPNA 4XIKA 2YGLA 4LR4A 2ZABA 1WW7A 1CD3G 4LEJA 2RM22 3WD5A 2JG8B 4GWMA 3MIGA 2HLEA 5K4LA 1HDKA 1IHMA 4B3NA 5KXDA 1MZ6A 4Y22B 3THDA 2JE8A 4RGAA 2XBO2 2QFEA 3ZXGA 1W06A 4R9BA 4AAPA 2FCVA 2WAAA 2E6VA 2VJXA 3MPBA 2XH6A 4YGBA 3WF4A 2YYOA 1NQDA 4BQXA 4FPLA 4XXPA 5FZKA 3U78A 3POEA 4Q4X2 4YW5A 3VKFC 3ZYFA 4NOTA 1AYM2 3DYOA 4Q4V1 4OHXA 1EPZA 4JKKA 1JUIA 2DCJA 3AXEA 4QX0A 4TN7A 5CFCC 4LLFA 1V0AA 4YW1A 3I2DA 3J4UH 1ZZ6A 1LHWA 3IMNA 5F37A 3ZIWA 3DCQA 2KR2A 2OUJA 2ZGQA 2G9GA 2WO7A 2XB6C 1PNFA 4H7MA 4NROA 2PMWB 2WA3A 5H9QA 4Q29A 3AP9A 3J8F1 2A3YA 4RGKA 3CJIC 4U2AA 5FZ0A 2WNUB 2OX0A 5FZAA 2HWE1 3THPA 1RB8G 2A6YA 3VKOA 4ASKA 2W1QA 1XNBA 2VCMA 5FQ0B 4AI0A 3GBGA 2DTYA 2ID4A 2JDNA 5HXMA 1WA4A 4XZPA 2GALA 3H50A 2GN3A 3ACHA 2D6KA 4JGYA 1AR73 4YZ5A 1BBT3 3K4AA 3O1PA 4M4RA 4XBQA 5FBJA 1RUH1 2VUJA 1SG3A 3PNAA 3BU7A 3CZUA 5JXJA 1NYWA 2R043 3ZFGA 3DUIA 4TYSA 1YIFA 1SCRA 5EQUA 2XG3A 3VL9A 1GNZA 4AE2A 2WZR2 5EIYB 4LULA 2EICA 1ULEA 2EXJA 3GBFA 2XQXA 4WZCA 5KC6A 3OOXA 3VBRB 3ZKUA 1TME2 3BALA 1C1LA 3E6BA 1GP5A 1LNSA 4X8PA 1VR3A 4XFHA 5FZLA 4CCJA 1SQ4A 3VHNA 1D0HA 4I2OA 1V70A 5FBZA 5I93A 1FV2A 2B46X 1COV2 1AYN2 2WR9A 4LBKA 5I0RA 1JU3A 1OVSA 1NLQA 1UU6A 1ZBE2 1PGW1 2PHDA 4V1PA 4PIXA 4QQHA 4CTEA 4GH4C 4XW3A 2YPJA 4RN5A 2LTNA 1NCRB 4AFMA 2DWRA 1C8M3 1NCQB 5C70A 1Z0HA 3AZVA 2RR11 3LA7A 4ZPIA 5FPXA 1QNWA 5FOJB 2Z4FA 1X33A 1OF4A 3NW4A 1RUJ3 1UO9A 2RDSA 2TEPA 4YW6A 1IQDC 3ETQA 4RA0A 5LK7B 5J37A 2XJQA 1J3RA 3H42B 2VZSA 1G6NA 2D5FA 1CAWB 3FLTA 5DAXA 4AI3A 5JXIA 4AHXA 1WD3A 1JZ2A 1JYXA 4CDWB 3ZSLA 3KS7A 1WCSA 2E7AA 3WG4A 2RJKA 4OHYA 3IDEA 4R9CA 1R082 4XCBA 2GMPA 1IPSA 1FPN3 3T4VA 3UKVA 3NAPC 4QM9A 1O3TA 1JYIA 5FWJA 4QPGC 3NQHA 3ZLIA 1W6OA 5FY5A 1VBA2 3JD72 4D7SA 3U07A 4LNVA 3SH3A 2ZGSA 3ACGA 4ZONA 3EYPA 3VZKA 2CYFA 2QDNA 4S2HA 1S0BA 2E63A 4UT5A 4Y5TA 5HV0A 2A6ZA 2HWC2 2OXBA 5FIXA 4AEKA 1OQEA 3KF3A 2WAOA 2HWF2 3LIGA 5FY0A 5JWPA 5CG9A 1MS9A 1ND3A 3A0KA 3A22A 4KWJA 1ACCA 4K40A 2R32A 5A7SA 2QDRA 3AKQA 4UFMA 4RHV3 5FZ1A 3PUAA 3DYMA 5FXXA 2VW1A 3OSDA 4IE6A 4PI2A 4AI9A 3TNPB 1UKRA 3L2HA 4PI0A 4YZ2A 4LUKA 1N1VA 3CHXA 4FOQA 2RDRA 5JOWA 3VL8A 4G4FA 2VY0A 3K48A 2ZCWA 1AL0G 1Q3EA 1UOBA 2BEOA 2JICA 3PVEA 4B1MA 5JOYA 3BTXA 2VM9A 3SMHA 4FFHA 3WV6A 3NWKA 3ILFA 1R091 3LCPA 4GZ9A 5FY7A 3ZXDA 1KGYA 2WSVA 3AKSA 4B8EA 3LEMA 3GXUA 3RGBA 3VDCA 3N9QA 3IAQA 4CP1A 1REDA 2P4EA 4QDQA 4A3XA 4MZUA 4QX1A 3ZSJA 2Y6HA 3P5BA 1J1TA 4ORFA 1UKGA 5FMBA 1YC61 3RMXA 2YXSA 3HNYM 2JB4A 2QNKA 4QU1A 4BE3A 3VGIA 2B4KA 2CY6A 5EYYA 4PCRA 1XB9A 5GZGA 5FK7A 1KITA 1WLCA 1NA1B 1T2XA 1O5UA 5FXZA 4AEDA 1HKDA 4A7KA 5CFCB 5LCWL 2Y6JA 3ST7A 3NV3A 1H1MA 4E2QA 1W9TA 2W3JA 4OUEA 5IVFA 1LGNA 1URXA 4NRQA 4ZXKA 1X50A 1AL23 3KCXA 4OFGA 4XC9A 4YW7A 4LKSA 3VZMA 3U1XA 2KM2A 1FV3A 1RUI1 1B09A 4HKWA 2Y6FA 5A7WA 5ABJB 1VBC2 2VZTA 1QQP3 4FP2A 4CDXC 5A3TA 4D69A 3M3EA 4KGQA 2GZWA 1W6NB 3I54A 4DFSA 1RUC1 1W8TA 3FL7A 4RS5A 3WUDA 4DNYA 4O9EA 2IC1A 1AX0A 2WFF2 3AP5A 4Z2WA 2EAKA 1OHFA 4BQYA 5IK7A 3G7DA 1LHOA 4LO6B 2VVDA 2Q8EA 5L7OB 1AR62 3KT7A 3DPRC 5FZFA 1NQJA 3NVCA 4WVMB 3WQ0A 5JZGC 1Y4WA 4YG6A 2A70A 3J7NA 3JXSA 5ACA1 1F9KA 3HN3A 5IVBA 2RVAA 4UF0B 1OMIA 1DGRN 3S5AA 5DG2A 1F8VA 4FFIA 2F17A 3C7EA 1ND2A 3C7GA 3WW4A 5F32A 4DY3A 1CN1A 1HW5A 2CGNA 4CP9A 5C4WC 3O1UA 2WNVB 2V5YA 4QU2A 3HEIA 2ARBA 4KMQA 5BNQA 1HXS2 5FDBA 1POV3 2P5BA 1MEC2 1SFNA 3AXDA 5BYNA 1B35B 1RC6A 4R4XA 4CA9A 1ULCA 2A1XA 1YXWA 3DECA 3ZYBA 1EYBA 4OCTA 1DLCA 2VZ1A 2FDGA 2XXZA 3DN7A 4UWDA 3OGGA 3RYPA 5LRRA 4AFBA 3MBWA 1JODA 1VJ2A 3SNMA 3RYKA 2QTWB 2UY9A 3KM5A 4K3UA 4XAAA 2NM1A 1US3A 4GMP1 5DAVA 5JI7A 4AI2A 1RUF1 5C3PA 1HQNA 1O6UA 2WNUA 4D0QA 2WABA 3RJRA 4XJZA 1UU4A 1H8TB 4COVA 4HMZA 3O7OA 4MOAA 1BEV2 2X5IB 4BWOA 2D7FA 2H0BA 4ASLA 3O0XA 4CXWA 4FI9A 3K75B 4BQ2A 1APNA 3T1LA 1DZTA 1OA3A 4LHNA 1E5RA 1NOVA 3LGRA 4HSLA 1AR93 5GLVA 1CAXB 1WBFA 1YQ8A 4Q4W2 2H6CA 2CTVA 3OF1A 5CG8A 4YM2A 5FZOB 1XYNA 5FZDA 3NJYA 2AEZA 3CMGA 2DCYA 3J9SA 3LQCA 5GLUA 1EV13 5C3QA 1BMV2 1QMJA 2WO2A 4RGGA 5FLJA 2ZPXA 3MEPA 4IL7A 3UJQA 3WNNA 1C8NA 1Q8QA 5GZFA 3FHAA 2VOWA 2VMFA 1BZWA 2VNGA 3LDBA 4YPJA 4XUPA 4H14A 5C9AB 1VIWB 2V4VA 1JZ4A 4IGPA 3WF2A 4JGYC 3C7OA 3B9CA 4QPWA 1RUD2 1VAMA 3LKJA 4CRQA 3VDDB 4XIOA 4NPLA 5IAXA 1QJZA 2HEWF 1UMHA 3AKTA 3CZJA 2I45A 3IM0A 3ZFGC 2C24A 3N4MA 4XHXA 3PURA 3ZPYA 4Y1ZA 3VBOA 1GWKA 1RUH2 1X8MA 3MV11 4KWLA 5IVEA 5LA2A 2B42B 2P37A 2EXIA 3DL3A 1NCQA 5DMYA 2Q8OA 4Z92B 1N3QA 4BXFA 1LJ7A 2C1FA 1DYPA 3VUOA 3JQWA 2RE9A 4IEQA 3Q8CA 3BGAA 3IB3A 1AR71 1GZ9A 4S2FA 1BBT1 4N7UA 1F5FA 4X6RB 4A7YA 1MVEA 5A32B 2Q1FA 1IGOA 1VBE3 3Q8EA 4RD7A 4C0HA 2ATFA 1BVVA 4XHBA 2R041 2AZ5A 1ZVFA 2FQPA 1AXYA 4WM8A 4BM8A 1RINA 2EIDA 2Y38A 5A6XA 1MS0A 1FAYA 3MW4A 4XFGA 4XDPA 4GWJA 3WF0A 1R1A3 2YC0A 1ZRCA 3OPTA 5FKCA 2B9VA 4DEQA 5FYCA 4D7TA 1H6XA 1GZWA 1AJOA 4YW3A 1VBD3 5L19A 3WW3A 2AH2A 3SCFA 3USSA 2FDHA 5LBBA 5SV5A 1GYKA 3EBRA 3LOIA 3O1TA 1FMD2 1W8HA 1S0IA 4CP0A 2WQ4A 4YW4A 2VOTA 3WINE 2Y6KA 4XDOA 4ZZ5A 1LULA 4KNCA 4QD2A 1PK6A 1KJLA 1GWMA 5JPMB 4TZDA 2JDYA 1LEDA 4BMEA 2CSGA 3O12A 4M3CB 3T0BA 2J1TA 5E6HA 2DU0A 1I9RA 2WIIB 1C8M1 2YMZA 1V9U3 3KHCA 1DQ6A 3CEWA 3CKHA 1ODNA 5BNNA 3O1MA 2K2SA 1X7NA 5HI0A 5C6CA 4OHVA 1RUJ1 5BUVA 2J1UA 3ACLA 4R9AA 1JYCA 3NNMA 1ASJ2 5T54A 5GLWA 1LOEA 4XYXA 1W9FA 5HCBA 3WW2A 4CU8A 4Q0QA 4CCNA 4IXLA 4KH9A 1ND3C 1UWWA 5JZGB 2GP5A 4FSJA 1T6GC 1RXFA 3ZYGA 3KZ4C 3ME2A 1XNKA 2WS93 2WN3A 3BOWA 4MYEA 3H1MA 5DAWA 5F5AA 1FPN1 4PQ9A 1JBCA 2MHFA 4B1LA 2BBVA 1OQDA 2W2IA 3RZKA 4XCAA 2QCSB 2RMU3 4BQ3A 4CUCA 4YSFA 4R9DA 5FPZA 2YUEA 4NUBA 1JYNA 3H3LA 4IGOA 5DDJ2 4A3ZA 3WDYA 3T2TA 1FNYA 1N1YA 2VL4A 4ASMB 5KHJA 3LA3A 2PTMA 1PNGA 3EO6A 4MUVA 2R7EB 3HMYA 4PF5A 2E7QA 5A7PA 4Q26A 2ZAAA 4XUNA 4FBFA 2PYTA 4HVRA 1PM7A 3R05A 5C71A 3PUIA 2OS2A 4QXCA 2O0OA 1J83A 2RS52 2YY1A 4NIIA 1M06G 2QKDA 1F35A 3AFGA 3AL6A 4RHV1 3KQRA 3Q8AA 3VDBA 1PVC3 2RG4A 4Q5OA 3WDXA 5FUIA 4C0BA 4AI8A 3S7EA 1QEXA 5CVRA 4CEYB 4K21A 5JSPA 2WL1A 2YBSA 1ZREA 5FPBA 3IIIA 3VDAA 1OUSA 4AEDC 3H0OA 3CIHA 4RYDA 5EYXA 3JQXA 5CFDA 5GM0A 5FFOC 5FY8A 3GHNA 2ILMA 5L7OA 4A44A 3ZXEA 4WVMA 3VV1A 3WT3A 5FUNA 4RQPB 5CAZA 1VALA 1LOAA 4I02A 4E2GA 3E6CC 4UFJA 4H2AA 4L8QA 4MHRA 1RMU2 2JECA 4P08A 4UF0A 1PVXA 1W28A 2BP6A 4PIZA 5DZEA 4Q8KA 5JCTA 2VOVA 2VMGA 3PMEA 3PU3A 2VVEA 4RR3A 2D97A 5AC92 2J22A 2VTXJ 4RS5C 5DUXA 2HWB3 4DUXA 3FHQA 4XXAA 4L11A 1WW6A 1TNFA 3WF1A 5BNPB 3BOPA 1QXJA 5C8WA 2DF7A 4LK6A 4N9IA 1J59A 3ZXKA 5CYYA 3RZGA 1QF3A 1RUC2 5BXXA 4NIAA 3N36A 3WX5A 4DXRA 1JS9A 2FDKA 3LFIA 5IVJA 3VZOA 3NKGA 2G4IA 1AL21 4FAGA 4D8MA 5CISA 1JZ5A 2Y8KA 3WP3A 4UW6A 3ES1A 3AB0A 3ATGA 4AZZA 3AKPA 2R063 5LWBA 5EHDA 2JXAA 1PM4A 1ND2C 5ACA2 1D4M3 2O14A 4FOVA 1QQP1 2BOIA 1WW4A 2W5FA 2GNDA 2YC4A 2YBPA 3AYCA 4QPIC 3T0DA 4Y26A 4Z82A 3IIAA 3TNQA 3TRSB 4AI1A 4Z1VA 5H9RA 4WVVA 5FZMA 1YNAA 3JBG3 4GA9A 1OOPB 2VGDA 1RYYA 1UNBA 1W0PA 2BNNA 1BHGA 1YJLA 1K45A 4YW2A 3OY8A 4AFDA 3HQUA 5A3WA 4RL7A 5FAXA 4F83A 1VMFA 3POYA 2QE3A 1XNDA 4NHXA 5FCCA 1G9CA 3GF6A 3L2YA 5FZ8A 3EB7A 3ROUA 2BPA2 3WG1A 4FO9A 2FCTA 4OUSA 4FPGA 4WV8A 4AK3A 4YRDA 3SC7X 1O8PA 2Y6GA 5FO7B 2ZAHA 5J98B 5A70A 4CPBA 2X8KA 4FTEA 1YFYA 2V72A 3KD4A 4AF9A 3C3VA 3K4DA 4A4AA 4SLIA 2HBUA 1POV1 2VZUA 3E5UA 3LSDA 4JVAA 3RZLA 5J96B 4AHYA 1G9DA 3N9NA 5FZCA 4BQ1A 1JU4A 3RYRA 3W20A 3NV2A 3WP5A 1RITA 3I59B 3IMMA 4NHKA 1V6LA 2D93A 2XL9A 2VBDA 3M3OA 3Q8BA 4QGLA 1DGRA 1LHUA 1ZRRA 2MPFA 4P9JA 2XKPA 2YROA 1HRV3 1GOFA 3GGLA 5EXOA 1DYOA 2VR4A 4LITA 4Y20B 1GV9A 2WWSA 1YQ2A 3SQOA 5K0UB 4AVTA 1IPKA 2FZ2A 1RUG3 4TWTA 3F95A 4QXHA 4OYUA 3LFMA 2XVLA 3T2PA 3NNJA 4UW5A 1PIV3 3KLSA 2KD7A 2D3PA 3ZSEA 3AP6A 2YU1A 4O61A 1AR91 4HPKA 3ZSMA 1JZ3A 4QHOA 1ALYA 4XFFA 5C5UA 3VBSA 1BYHA 1OSGA 4YVWA 4Y1XA 1HX6A 2DTWA 4LPLA 1OF3A 5F3EA 3VBOC 3K4ZA 4CDUA 5JPNB 3H8RA 2ET7A 3A23A 3J26N 3WHUA 4LKFA 4QGNA 3FC0A 1EV11 5A33B 1MZFA 1TVGA 2CDPA 4JKMA 1O91A 2P34A 3MO4A 3AYAA 4TLGA 2LS6A 4AL9A 2D43A 2A6WA 2HEYF 5DAQA 1VRH3 1ZA4A 1RGSA 4QB1A 4LOTA 1HN0A 3ZVXA 3VBUB 2WYSA 2Y0OA 5A3LA 5F2SA 2XHNA 2X09A 1JYVA 3KHBA 4M3CF 2YFZA 4W6WA 4C90A 2ERFA 4WM8C 4N43A 4XQWA 3IWZA 3LEGA 2R6QA 2PAEA 2PHXA 1G7YA 2DURA 1S2EA 5AFEA 3AM2A 4HVQA 3GCWA 1FX5A 1ENRA 2PXJA 3K51A 4PT6A 1YO8A 4W8JA 2OYZA 1IKPA 4EZ4A 4FXGB 1XQNA 1UXXX 4LQRA 5FV3A 1RJ7A 3P3NA 4XMAA 3J7HA 3HQXA 4JAAA 3T2OA 5FPUA 2ZKLA 3N3HA 2VZPA 5GZEA 2X53S 4META 4PBOA 1NE6A 4ZKTB 3O0VA 4JGZA 3VD4A 4XABA 1JW6A 2VD7A 1TQ5A 3OPWA 1A78A 1HB4A 4HK8A 1VBE1 1PK6C 4X6QB 4AAXA 4S2DA 4BJ0A 4OHZA 1ZA7A 1PX4A 4FPHA 1IKQA 5FXWA 4XETA 5IK5A 1A3KA 3QOPA 4E4SA 3KV4A 1WLTA 3D3AA 4NO4A 1PO13 4IV3A 4QKDA 4XILA 1F4AA 1PHMA 1V00A 1R1A1 3ALQA 2NZ9A 3ABZA 4XBNA 1SLTA 1FYUA 3UYJA 3ZN6A 4NRPA 2X29A 5LBEA 1VBD1 3NJZA 2FD8A 5CEHA 5B4NA 3WDUA 1XYPA 1AXKA 2NP0A 1CESA 5T5OA 1OFNA 3V0AB 2VXJA 2ZEXA 4CEWA 3WDWA 3ILNA 4EROA 1NKGA 2CAUA 1H1AA 3H3ZA 2E32A 4GMP0 4LO4B 1NE4A 2P17A 3V64A 3AJYA 3NNFA 4PLOA 4AEMA 1IPJA 1JHNA 1FOD2 1QJX3 1W6QB 2JIGA 3DEMA 1MACA 2X05A 1CGPA 1YRZA 1Z7S2 1NXD1 2JG9B 3GBWA 3ZFEB 1V9U1 2DBIA 2J1EA 4UBGA 4MGTA 2WJSA 4JQTA 3OGJA 1RHI3 1CAUB 1RUE3 4IE0A 5F7UA 4FXKB 4JCKA 1UYZA 1K5MB 4BQ5A 3U75A 4CXXA 2QQPA 4KU7A 3VKLA 4HN0A 3ZR5A 2VC9A 3T1MA 4XFAA 2XPJA 3UT0A 4XF1A 1I5PA 1YEWA 4LE4A 3SEEA 1VAVA 3PJYA 2FMYA 3EXUA 4QQLA 2E26A 2PELA 2WS91 5FK8A 1H4HA 4NIHA 4J1WA 1D2SA 1GP4A 1VBB3 4PLMA 3T3YA 2BNOA 4MH0E 1JMUB 3IZOA 5D8AB 4EWAA 5C33A 4BH9A 1UD1A 2RMU1 1NX9A 3CO2A 5DQ0A 1W8FA 5LW9A 1WZXA 3NKTA 4MGSA 3FMGA 5EZWA 4CVUA 2ZMKA 5CFDC 2YB7A 1ZRFA 1P8JA 4BOWA 4BB3A 1BLZA 3FFZA 2ZGMA 5JLVA 2DUQA 4LK7A 4LORA 2YC2A 5KXCA 1SPPB 2C0ZA 3HWJA 1HJFA 3KV6A 5L36A 2YGMA 4GQ7A 1VB2A 3A4UA 3GNEA 4EQVA 1H4GA 1UMIA 2CGOA 2PAMA 2ZGKA 4JDNA 4MX3A 3X29B 4NHYA 5T5JA 5A3NA 3VBFA 2NQYA 5F5CA 2VTXA 3KV9A 4BZ4A 2ZEWA 4RR3C 3BU0A 1HB3A 4DRVA 5FP8A 4AWDA 3KMHA 3K3NA 1JOPA 1PVC1 1ZBA2 2W1WA 1QJY2 3N35A 4ZU7A 2WLPA 4EWDA 5JOXA 4FTBA 1SFYA 1UIJA 4QB2A 1LESA 2BQPA 4MGYE 1W8NA 5FP4A 3S7IA 3TEWA 4HETA 1DCSA 1CR7A 2OUHA 2RM23 3PIJA 4QDSA 3USUA 3KV5A 2VECA 4DIQA 3C7HA 1QH6A 2E7TA 4MG2A 4OI0A 1K5JA 4WVWA 2XWBB 5EWSA 5F39A 3K3OA 3LB9A 3B5LB 2GU9A 4OMCA 4CPBD 1EUUA 2AC1A 4N53A 4NE9A 2VOXA 3S57A 2W95A 3BCWA 2AYHA 2B9UA 2XJVA 3FHIB 4M3CE 4Q4X3 4YVSA 3BODA 1EAH2 4AGGA 3IPVB 3VZNA 1C5HA 2HWB1 4YGCA 5DPNA 1W9WA 4FPJA 1WCQA 4P9XA 3WCSA 3NV1A 5BNOB 3ETPA 2HWD2 2CAVA 1HLCA 1JHJA 3KQ4B 5FR3A 3LZZA 4IV1C 1CX4A 3POSA 1KFXL 2VUCA 2JD9A 1S0FA 2YU2A 4QQPA 3VBHA 2Y33A 5C8CA 4YZ1A 2UYBA 4IEXA 4PDWB 3DXUA 3A21A 1DU3D 3IBMA 4LBQB 1UU5A 3UESA 4BISA 5IATA 3PVNA 2BFUS 5E89A 4GB32 4W6YA 2R061 4GKYA 1PGL1 4IESA 2IFRA 1D4M1 5J36A 2ZBJA 3MI8A 2HJIA 2XQRA 2W91A 4MADA 4Q8LA 2HYKA 1UIKA 4ZU4A 4RFT0 1PMHX 4EE2A 3DXTA 1QDCA 5JXHA 1GQGA 2A73B 2XJSA 2ZS6B 5IT6A 3JBG1 1QGLA 3OYWB 4OI2A 5JMOA 4XJAA 4KG8A 1HV0A 5IJRA 3ZFFA 2F6BA 4DXSA 1C1FA 1WD4A 1CZTA 3G6JB 3OD4A 3C7FA 2K46A 4QM8A 4C91A 4XJWA 4B7KA 4NRMA 1W2NA 2WFPA 1A34A 2MEV3 4QDRA 4C1XA 4WM7A 1N3OA 1NY71 2ZX2A 1OI6A 1GQHA 4NN0A 4L9BA 1W39A 4P5HA 1REEA 5FLIA 5C5TA 2DVFA 1QXRA 2E51A 3GZAA 4O9GA 5A33A 4QX5A 3EJKA 3M70A 5A7NA 3THCA 3O1SA 4CP2A 1AR82 4LBMA 4UFIA 1YFWA 3O5SA 2GMEA 1FNZA 3MLJA 1QHDA 2J1VA 1ZZ8A 5KHKA 1OA2A 4EN7B 1H6YA 3BPSA 4FPEA 4XUTA 3THTA 3MIBA 4Q4Y2 2IXIA 5LY2A 4YNIA 4ITCA 4XQ4A 4UI9L 5IHRA 3VBSC 2DCTA 2WN2A 4UOJA 3VBUA 1UPIA 1G86A 3EQEA 4FT8A 1COV3 2D3RA 1DLLA 3CQOA 3ACIA 4HK9A 4YVWC 5G05L 1UY4A 2VULA 4CDUC 1ZBE3 1W0NA 1SHWB 3BIEA 3BVCA 2GC0A 1HRV1 2WLQA 3KGZA 5T5PA 3K77A 2C6SA 1OKOA 3VD7A 1MS1A 3AK0A 3H1YA 2JWPA 4UXAA 5FKBA 4ARYA 3HVDA 1RUG1 3D0SA 2ZMNA 4AW7A 3CJIB 1SLLA 4QMAA 1DG6A 3T09A 2C5DA 1MR5A 3B69A 1UYPA 4N9HA 4J6GA 2TBVA 2JENA 4NWVA 1HRI2 1PIV1 4NVPA 1L7LA 1XBFA 3HOBA 4JHTA 1S0GA 4QX8A 1E5HA 2RS32 3S0MA 1QH7A 1SZBA 2BBAA 2P2KA 2JG8A 2OIIA 4XUOA 1Z78A 4N43C 1TMF2 4FPFA 2XLGA 1STMA 2PHTA 2W0XA 3AZZA 4J1XA 4P9LA 3WNPA 4WM8B 4IETA 4Y22A 1R083 5ERLA 1BCXA 3T08A 4EN6B 3TN93 1WMFA 1GOGA 4Q1PA 3LSEA 1A6CA 1JYWA 2WA4A 4P02B 1WBLA 3B3QE 5G04L 1MQTC 4Y5SA 3SISA 1QKQA 3U10A 1KD7A 3AVSA 5KR7A 3OJBA 1VBA3 2QBXA 3JD73 1NXMA 4K8RB 3RWKX 5ISLA 2R072 1PO22 4XFBA 2VZRA 4JGZC 1VRH1 1J3QA 4XVHA 4GIQA 5LEKA 1BK0A 2UURA 4ATEA 4FTSA 2HWC3 2P1BA 4GKXA 1UY3A 3AC0A 3N9LA 2W39A 5A3MA 3V0BB 2HWF3 3LWCA 1WA6X 1WCKA 4YFZA 1G9AA 1N1SA 5C3SA 3GJAA 3WNOA 4IV3C 1ONAA 2W92A 2ZZJA 4AQ2A 1ENXA 1W6QA 2ZACA 1JOJA 1KFUL 1Y9GA 2SLIA 2ZHMA 1GNYA 3LF7A 3POWA 4XUQA 5CU1A 1JH5A 2EIBA 3LAGA 4IEWA 3T30A 1S55A 2W68A 4HONA 4K20A 1WMXA 1YLLA 2XJRA 4GH4B 5CB7A 2RHPA 3HNBM 1CIWA 1A8MA 3KT4A 5FYYA 2Y60A 1W99A 4P9YA 5GALA 3V65A 3PUSA 5FQ0A 4UFKA 5I0SA 1VBD2 3FN9A 4PBPA 4CEWC 3OGVA 3BUCA 4Q4V2 2XWJB 4BMBA 5HV4A 4HOOA 4BHPA 2FHRA 1W8WA 1DF0A 4JDMA 4QHZA 1NZIA 3BYWA 4JHZA 2CNAA 3URFA 1PO11 4E9KA 3APBA 4IERA 2WRAA 1KRIA 4BIFA 1SCSA 3GM8A 4M00A 5A3OA 4CCEA 4IGQA 1POV0 2VMEA 5A3PA 2GSYA 5LY1A 3NAPB 3H3UA 4YYOA 1WMDA 3J8F2 4HANA 1V6NA 4Y5Z0 4ZS2A 4QPGB 3CU7A 4LIVA 2HWE2 4Y1YA 3I8TA 1VLNA 2XKOA 4LBLA 4MXWB 4IV1B 4XF4A 1H9WA 3VBRA 2HYXA 3BKZA 3INAA 3WVJA 3KT1A 1QIQA 3ZN4A 1AX2A 4O65A 1RVF3 4QKFA 2JEMA 4FFGA 5IK8A 3FE5A 4QWNA 3UKTA 2ENRA 4FVVA 1L7QA 1ZRIA 4IEZA 3FWEA 4CU6A 1QJX1 1V6OA 1OH4A 1SLIA 2ARCA 5I8SA 4D6SA 2WKKA 2OQ7A 2Z69A 2F4PA 3MUZ1 2BVBA 3B01A 3HNMA 1HN1A 1RHI1 2CV6A 2NLRA 1NCRA 1S0EA 1RUE1 4HN1A 2P6HA 3S30A 4D7YA 5CKNA 3HIFA 1W6PB 1Y3TA 2WFF3 1O3SA 3PVBB 4QT6A 1YFUA 4EV0A 3U37A 1VPHA 3ACFA 4DEVA 3SH5A 1AR63 1DZRA 4X8NA 5KBFA 2BDRA 3E6DA 3JB4C 1SLCA 3ZXJA 3M4FA 2BV4A 3BTAA 1CAWA 1Q56A 1FXZA 1VMHA 2VZVA 3NRUA 4OQ9A 2GDFA 3VBFC 3D82A 5KWRA 4CDWA 3MLKA 4LA2A 4XMIA 1YUDA 1WKYA 2JDZA 1VBB1 5EV7A 4BDVB 2G9FA 3WDTA 5T3NA 1ULFA 2F4LA 1PGW2 2R30A 1PVC2 1QJFA 1MEC3 1QNYA 3AYEA 1RJ8A 3VHRA 1V6KA 2RR12 4MVTA 3KVBA 5DG1A 1E57A 2ZX4A 1K3IA 3N9PA 3LA2A 3I3EA 2PLV3 3AKRA 2GC1A 4AVCA 3AMNA 3OBZA 3MIHA 4N53C 4KWKA 4IQPA 4MLOA 2B39A 2GAUA 4YVSC 2LW8A 1DQ2A 1OA4A 4DINB 3ORJA 5C7GA 3UNPA 3RG0A 4CDXB 1BEV3 3I2IA 2ZGLA 2B45X 3I4IA 3RMYA 4LBNA 2XMLA 4TLFA 5FPLA 4FP3A 1Q43A 3W59A 2RM21 3ZIXA 3LE0A 3VBHC 5C8CC 1LTEA 1W8OA 2ETEA 5T52A 4ES8A 3KGLA 3RWNA 3VKNA 5FREA 3HN1A 3MUY1 4Q4W3 1Q8PA 5HXVA 2Q0AA 4XDQA 3DPRB 2RJ2A 4Q2FA 5FZ6A 1ENSA 2VZOA 3M2MA 1ULGA 2QQKA 5DUUA 3U11A 4AQTA 4URAA 2D3SA 2QQOA 2W08A 2ZA9A 3WG3A 4Z8BA 5JMCA 3OD0A 5JSOA 1EPWA 4Q4X1 2E53A 4K7JA 3QLQA 1FT9A 4AFAA 2GN7A 3ITQA 1AJKA 2WBKA 4DOUA 1ODMA 4J25A 1OBNA 2R1DA 5C4WB 1L3JA 3ZFFC 2OQ6A 4COYA 4QHBA 1RUD3 1NA1A 4I30A 2VCBA 2R16A 3RNSA 5JOZA 3PMSA 5CFCA 1UW8A 3RVHA 4LTAA 5CADA 4WM7C 4XURA 2I74A 5A6ZA 2OZJA 4YM1A 3J7LA 3LEIA 1DGWX 4EZHA 1I5ZA 1NY72 1R092 2RS13 1ZZ7A 4BPZA 5ABJA 1F15A 2BFUL 2XUMA 4E4HA 3NO8A 1Y9MA 1UQXA 5ANQA 3LPFA 1DQ0A 1ULOA 1W6NA 1GNHA 3QH7A 4CUGA 1SEFA 4QKBA 1VP6A 4NJ4A 4DS0A 5D21A 3FBYA 4YM0A 2FDIA 1O59A 1NAEA 1SDWA 2VH9A 3CL1A 1TE1B 3K2OA 3DF0A 5T50A 5F8PA 4IEUA 5FPAA 2DDUA 2UWBA 5JVVA 1X36A 2MEV1 3ZXFA 2Q30A 2EA7A 3NNLA 1LB2A 3TYJA 4E4ZA 2YFUA 1ZZCA 1XNAA 1WGPA 2H6BA 1SACA 4R4ZA 1JZ8A 4LLOA 3SH4A 1XC6A 3I2JA 5FZBA 2DFBA 5C3OA 3O1RA 1RUI2 3IKWA 3V56A 3GDBA 3AJZA 3MIEA 1JXNA 1RUG2 5FRAA 4B4RA 2WNVA 2ZTNA 1LGCA 3DGTA 1U12A 1FMD3 4XTMA 5M0TA 4Y4YA 1GMMA 3K46A 3E1F1 4BQWA 3BPZA 3HJRA 4HVOA 5FZ3A 2JG8C 4BK5A 2D5HA 2JD4A 4JGYB 2W1SA 3TOJA 1COV1 1AYN1 1B35A 3N9OA 2G1MA 4HKLA 5F3CA 1POQA 5SV8A 1ZBE1 4AHWA 2XVKA 5FYMA 1RUNA 4M01A 1XXNA 2AR6A 3MLLA 4KG0A 2A3XA 1XE8A 4JKLA 3ZFGB 4P5YA 3HBZA 5FYSA 1Y43B 4XZUG 3SITA 2B8MA 4MHUA 5FO9B 1XU2A 2A3WA 3QBQA 2LALA 5LA9A 4DO0A 5CKMA 1YYNA 5FPVA 1OD3A 2J1SA 2A5ZA 2VG9A 4ISRA 4E27A 2X10A 3WNXA 5EJZB 1H8TA 4JZRA 1MVQA 1ASJ3 2D6NA 1CX1A 1IOAA 2X5IA 1CJPA 3MDPA 2VW2A 2NMNA 3LEKA 4LT5A 1JYTA 3HAGA 3OG2A 2JDAA 1R64A 1CAXA 1J84A 1R081 4XTPA 4NAMA 3M3CA 4DY5A 3TN91 1GZCA 4CXYA 1W2OA 5LBCA 3ZKYA 4YZ3A 5FZOA 1SBEA 1X82A 3MIDA 3OCPA 4UBHA 2WNUC 2EVXA 3TBDA 1DZQA 1VBA1 2Z2SB 2D44A 3JD71 3WOGA 3NAPA 2QUOA 1V6MA 1BXHA 4G9SB 5DDJ3 1RUF2 3BB6A 2LUWA 1LGBA 3WP4A 2WO3A 5DABA 1GZTA 2HWC1 5C9AA 3KB5A 4ZZ8A 1F5JA 4FCAA 1TG7A 2HWF1 2GNTA 3VB9A 5J1XA 1LEMA 3B00A 3VDDA 4JTNA 3MPPG 4CU7A 5JUVA 5AVAA 2WQ8A 1O3RA 1IZ3A 2H0VA 1PZ8A 2VQ0A 1H9PA 2RS53 1DHKB 2BOJA 2BGPA 3GZUC 4HZFA 4Y3OA 1LENA 5FWEA 1GOHA 4ZHNA 2QQIA 3TEYA 5LRSA 3WNLA 4EJRA 5FYVA 3MGUA 2PHRA 3MYXA 3HT1A 1IS3A 1GP6A 4CYDA 1W6OB 3MFAA 5BV6A 1GR3A 2V5DA 1N1TA 3VBRC 5CA6A 1FI2A 4YG0A 1JN2P 2Q4SA 2VQTA 5GJ6A 4W50A 4YFWA 4I0AA 1QJU3 4JRAA 2WZEA 3AMQA 4P00B 5HBAA 1O4TA 4UFHA 5L9BA 2JJ6A 1J58A 1RMU3 1GICA 3E5XA 5A32A 5CKQA 3LOBA 4DZGA 1ND3B 4LA3A 2VU9A 1W6MB 1DGWA 5E16A 3RS6A 1Q8VA 4CUBA 1OFSA 5AC93 3MZHA 4CSWA 1CWPA 1QJX2 1NCRC 4NAOA 1GANA 3W21A 1NCQC 1LCLA 5DZFA 1UY2A 4AFCA 4F8AA 4HL0A 1UX7A 5F9TA 5J09A 1LECA 4C8DA 2WC2A 5A6YA 4LBJA 1W05A 3GZEA 1ULDA 3OEAA 3SKJE 2ZHLA 3MV01 1YWKA 5FLHA 3ZOIA 1CJDA 1UOGA 1D2QA 1RVF1 3QACA 4HSJA 5FZIA 3RFRA 4CDWC 4IEYA 1OLRA 4I09A 4CUAA 5DAPA 1AR72 1SFPA 4FOYA 1OT5A 1BBT2 4O7XA 2JE9A 4K9SA 2BU9A 2XDVA 1UZYA 3C8XA 3GZTB 2E33A 2CU5A 1U5ZA 4LO7A 4M3CA 4AVBA 2R042 3WNMA 1WCDJ 3VD9A 1SLBA 2WFF1 4KU8A 1ST8A 1EP0A 2XOMA 1GWLA 2WNOA 4CCCA 1UPSA 2W9XA 1GKBA 1IG3A 3CF6E 3ZX7A 1AR61 2Y26A 2ZHKA 5HCFA 4AEDB 4Y1VA 3H1WA 5E1RA 3M7AA 2JDKA 4IUGA 2O8OA 1D4VB 2PHFA 5DXDA 1H8VA 4MO3M 3RPQA 3W9AA 2P3YA 3ECQA 4BYYA 5JZGA 1Q8OA 4MGKE 4P9IA 2KA3A 2ZZQA 3L9JT 1VRBA 1W90A 4JDOA 5A7WB 3S5QA 1UOJA 4IDZA 3ZM8A 3ZMNA 4H55A 4OLLA 2WZPP 3I49A 5BNNC 2VOKA 4RS5B 1AUYA 2PFWA 1MEC1 3WQBA 3RZHA 5EP9A 1C8M2 3FX3A 3P6BA 3ZXAC 2OPKA 1S1AA 2VZQA 1XSRA 4YLZA 5FZGA 1H30A 5F2WA 2DVGA 2VUAA 1X8EA 1RUJ2 2PLV1 3D0JA 3JB8A 1UF2C 3RSJA 4LO8A 4M4PA 1DQ1A 3UV9A 3BTYA 2DYCA 1VE0A 2Z79A 3OBTA 1UY0A 1GUIA 2WINB 3OPZA 5FUPA 3VZJA 1DIWA 3POBA 1V6JA 4XF3A 3UK9A 4HBNA 1YJKA 1OC1A 5FYIA 1UYYA 4URTA 1ZZ9A 4A45A 5D1IA 1JTZX 1ND2B 5JDBA 3TEZA 1WCUA 2QQVA 4AXOA 4EN9B 4QPIB 1BEV1 1W2UA 1R1ZA 4CP9B 4I01A 3AZXA 1OURA 1FPN2 1GU3A 2EF6A 2RDQA 1T6BX 4LOSA 4MGQA 4CEYA 1KJRA 2HEVF 1NA1C 1LOGA 2JE7A 4COWA 2GNBA 1YCIA 4Q4W1 2D6LX 3B93A 4Y24A 3B7MA 5GLTA 1MS5A 2XJUA 2VMCA 2J1RA 3T0AA 1NLRA 4RQPA 4XFCA 3ZYHA 4FPKA 2VZ3A 1BMV1 2ZGNA 5F1RA 2VUDA 2Q1MA 3D8CA 5ABJC 2VMDA 1XE7A 1NT0A 2YBKA 3GALA 3S6PA 4PHZA 1LHNA 2YZ4A 2AENA 1XE0A 4RHV2 1AX1A 2CHHA 3WCRA 3WW1A 4AEJA 1N47A 5BNPA 5I0DA 1HB2A 1RUD1 3AMMA 2W47A 3TWIA 3UJOA 2KXLA 2PHWA 3B9IA 1PMJX 4AVSA 5LATA 5L7OC 4L0PA 2K9ZA 3ASIA 2YV8A 4IE4A 1XNCA 1XPWA 2C9AA 4Y33A 5A80A 3NJXA 4A41A 3AVRA 5L9VA 4DMIA 3WP6A 3P1IA 4WZFA 1W3VA 2MEV2 4UW4A 2GNMA 2IFWA 3RDIA 5JR7B 3ZR6A 2RS11 2R0FA 4IEPA 1H2MA 2Y0IA 4Z2AA 2XR4A 4N7IA 3MFCA 5GLZA 2JX9A 4NIDA 4XF0A 2WNVC 2YDEA 3PHMA 3RQ0A 2FDJA 1N3PA 4QAWA 2BVVA 3I2HA 1MS8A 1ZM1A 1K12A 1OOPA 4AQSA 3WXPA 1JI6A 3ZMOA 3AMPA 2OW4A 1DP0A 2ZJCA 3IAPA 3PJQA 1S0JA 4H3WA 4Q0SA 5APAA 1B35C 2TUNA 2Z5WA 3HD8B 3DV8A 3I2GA 3M3IA 3CJXA 1I3HA 1WMEA 2BERA 2ZX1A 4QB6A 4DUWA 4YWAA 2B7YA 2XBO3 2XHKA 4B29A 4CCMA 3W58A 3AX4A 1TNRA 4KL1A 3VBOB 1HQWA 1AL22 1SBFA 3ES4A 4ZY9A 4BK4A 1SLAA 2W1UA 2DCKA 4Q27A 2Q8DA 4WVZA 3WSOA 1REFA 1Y9QA 1AZDA 1AYM3 5CNAA 1H8TC 4GWNA 2L9LA 2W94A 1IQAA 1QQP2 3FFQA 2X5IC 1ZYBA 3P3PA 3T4HB 5CBLA 1FMD1 4WBBA 2P6CA 2GC3A 3WLUA 2OT7A 3SHRA 5IK4A 3WEZA 3SKVA 4OHWA 3U14A 3WNKA 1ZX5A 2NYYA 3OB8A 2ZOEB 3I59A 4FOWA 3CDZB 5L73A 2LM3A 1FOD3 5I0TA 2R1BA 1PGSA 4CZSA 1Z7S3 3UGFA 4B7EA 1XYOA 1DGLA 3OBRA 3H9AA
chains in the Genus database with same CATH topology
2D6MA 3KCCA 1BQPA 4FQ4A 3JUUA 3TN92 4Y20A 2DCZA 3JCIA 5K0UA 5KXBA 2NN8A 2NMOA 3M3QA 4FAHA 1GZWB 1ASJ1 1C3HA 5C9AC 5GZDA 3D6EA 2WT1A 4HFSA 4BLJA 1SBDA 3O14A 3VDDC 3IN9A 4Q1RA 4A7ZA 2IWGB 1G9BA 1PK6B 3R4UA 4G3YC 1PZ9A 3PLQA 1W6MA 3FBMA 1LOCA 5HCAA 2P3KA 1C5IA 2FMDA 2MNGA 4XEZA 4S2GA 3HR9A 1J1LA 3R6SA 2D40A 5TSWA 1WLWA 2WZR3 4TSVA 4M0NA 5BNNB 3AFKA 5DDJ1 1SMVA 1O7FA 1TME3 3FZ3A 1RL3A 5LEJA 2I07B 1KDMA 2ZGTA 4RSUA 3SXWA 3RI8A 1BKZA 3WHTA 3R4SA 4EWEA 3PVOA 2B5HA 4E4DX 4I3PA 2RS51 1AYN3 1GBGA 1HQLA 3I7DA 4ATFA 1AR92 1DQ4A 3VN4A 1F2NA 4W6XA 4XPVA 1ZBA3 2ZGPA 1QJY3 1IS5A 3VHPA 1LRHA 2PN5A 4CDQA 4A2UA 2DUOA 1DQ5A 2IXHA 5GKAC 5AFBA 1EV12 1GSLA 3M8LA 5E88A 2P3JA 2BYVE 1EY2A 4KGGA 2O8QA 3QH6A 1QJU1 2Q1ZB 2DVDA 3HT2A 5KC5A 4PLNA 4KQ7A 2D6PA 1RMU1 2R0HA 5DUWA 4BCUA 2FZ1A 3Q9OA 1RVF2 2TNFA 5AC91 1EAH3 1LU1A 2QJVA 5GZCA 3QD6A 2GH8A 3ELNA 1PZ7A 5H9PA 4BA6A 2EXKA 4XFIA 1LOFA 2HWD3 2VQAA 4ES9A 4BIOA 1LODA 1C57A 4QQOA 1QXPA 3ZYIB 5CFDB 2DFCA 1V6IA 1CVNA 1MZEA 3V0AA 4GB33 2DUPA 2QZ2A 1F31A 3IDBB 1CAVB 4FPOB 3KSCA 1VBE2 4YM3A 2UWCA 5FMOS 2VVFA 1KS4A 4RR3B 2JG9A 1IS6A 3ZFEA 1J3PA 4QPIA 4OVEA 1CAUA 1R1A2 4MXVA 1UAIA 4HKOA 1K5MA 1O4YA 2XLFA 3N7KA 5EFUA 1S0DA 2VMHA 1YI7A 1LB2A 2AUYA 4MV2A 2XL7A 2I2SA 1GFF2 2XLAA 4NHLA 2PLV2 4AG4A 1QOSA 3GYDA 2BWCA 3MW3A 3IT8A 1OPMA 1IS4A 1U5YA 5JSRA 4YGDA 3WG2A 1AR83 2GC2A 4LHLA 3KCYA 3ZYJB 5D8AA 1CONA 5F5QA 4CEYC 5JIAA 2CWSA 4XQDA 4JV4A 1V9U2 1TEIA 3VHOA 5KHIA 2UYAA 4UW3A 4Q4Y3 2W52A 1O5LA 2ZGUA 5JIUA 3H8UA 3OY8B 3H7YA 5IUQA 3MIFA 4NPRA 4LBOA 4RQPC 2XJTA 5J3UA 3GHMA 3RJ2X 4QPYA 4AQ6A 4EN0A 1U5IA 1XU1A 1OLQA 2QVSB 4W65A 3NL1A 3NV4A 3ZYRA 1VBC3 1KQRA 2GMMA 1ZRDA 5FTTC 1AVBA 1BVP1 2IXCA 2VXRA 4KBBA 3UKNA 1Q8SA 1HV1A 2WS92 1ENQA 2FBEA 5E8AA 1W0OA 1HRI3 1MS4A 5BNPC 1DDLA 3D4KA 4XJ8A 1H2KA 4DXZA 1VAKA 2RS33 4EN8B 1O4ZA 2RMU2 5K9YA 1QDOA 1RUOA 2A7AA 4INDA 4OI4A 4QGMA 1TMF3 4JQRA 4DRRA 3ZYPA 5F6LB 2N7GA 3AP7A 1UCXA 2RJLA 5FO8B 1DYKA 4Q0UA 2A71A 2HKXA 2A6XA 2PA7A 5BPXA 4R8HA 4QQ2A 2Z42A 4MSVA 3FLPA 3U0ZA 4AGRA 3WDVA 1G9FA 1H0BA 2BWAA 2R073 1PO23 3IPVA 2QZ3A 2RS12 2CWMA 4MGZE 4AYUA 1YIPA 1OOPC 4H7LA 1HXS3 3TB0A 5BNOA 5DZGA 2UY8A 3N7JA 4GULA 4HPKB 1A8DA 2BUKA 4K6BA 4YG3A 4PDWA 3VBSB 2SBAA 4YVWB 4LBQA 1C28A 1PMIA 4AVAA 4CDUB 1OQ1A 1OKQA 5T55A 2EALA 4COZA 2ZGRA 1LOBA 3VLBB 4FPYA 1QOTA 1RIRA 3FUOA 4IEOA 4Z07A 3VZLA 3WUCA 3QCWA 2HWB2 3OYWA 4Q4V3 2UU8A 3NSTA 1AXZA 4DPNA 4L99A 3ENRA 2XBO1 3D5OA 4ISQA 1YHFA 4N43B 3E97A 2ARXA 5B2GB 3ZSKA 2BTVC 2XVGA 4I0BA 2NPIA 5K0UC 5J7MA 3J8F3 2R062 3AZYA 1PGL2 1AYM1 1D0GA 1GLHA 1MQTB 1D4M2 2VNOA 3C2UA 1XRUA 1HIXA 2HWE3 4I3GA 5KHHA 3OTFA 3B94A 3AZWA 4JGZB 3JBG2 2UWAA 4OI1A 1I1EA 1OPOA 3DKWA 3R4DB 1FOD1 4SBVA 4F7ZA 1DFQA 2R49A 3FJSA 1Z7S1 3CNAA 1ZZBA 3MW2A 4L2NA 1RUH3 2D6OX 2WT2A 3UL2A 2ZHNA 4IV3B 1ZNPA 5JAXA 4Y1UA 2V73A 3M1HA 2OVUA 2OZ6A 3WZ1A 3ZN6B 1U5XA 1DBNA 3CJIA 2WT0A 2PAKA 3MF9A 1QWRA 2JKBA 4FQZA 4L92A 4FPCA 4GXLA 4YZ4A 1QOOA 5I91A 2IXLA 3VBUC 4CEWB 4JC1A 1QU0A 4DQAA 1O3QA 3WQ7A 4N90A 3SCGA 3IDCB 1LKNA 3H7JA 4CDQC 1KXGA 1S2BA 3JU9A 3ZDSA 1UX6A 2WZR1 3O0WA 3SLIA 1HRV2 2ZGOA 4JRLA 4BLIA 2WQZC 2ZX0A 4DB5A 1TME1 3R0RA 2RR13 1WLDA 1U0AA 2PHLA 2IZWA 4Q0PA 4LE3A 1I6XA 3E5QA 1CQ9A 1VB4A 1RTVA 3WR0A 4LUMA 2EAAA 1PIV2 5K7PA 5KHGA 1YFXA 1KDKA 1WUVA 3V0BA 1QJU2 2IXKA 4P9GA 1CAVA 4COUA 4PIYA 3BIWE 2Q5TA 1ZBA1 1QJY1 1LHVA 1NG0A 1LOFC 3TAYA 5K8SA 4GH4A 4K8FA 4XJUA 5AVPA 2VW0A 2PHUA 2DU1A 3ZXLA 4AGVA 4XE9A 2DV9A 3RI9A 2VMIA 5I8TA 1UZZA 4XF9A 1VRH2 5I8YA 2A6VA 4OUMA 2DVAA 2DVBA 2EXHA 1AHSA 4NR1A 5CIRA 3VBFB 1EAH1 3ZO0B 4M0HA 1MZ5A 4ZU5A 3U4XA 1H2NA 2JG9C 3ZFEC 1JUHA 4NWWA 4LO5B 2HWD1 2IXJA 1KS5A 1Q5OA 4OZXA 1UN1A 4K1ZA 1CPMA 3MICA 1K5MC 4XOGA 4LHKA 2EIGA 4PJYA 4QPGA 3AMHA 1MS3A 4NHMA 4MXWA 2K0GA 4HT1T 4IV1A 5LK5A 3USUB 4XJ9A 3FUQA 4GB31 5FOBB 1Y7BA 5I0UA 5J48A 2VNRA 2WSUA 2ZMLA 1H2LA 1QY4A 4R52A 1R093 4N53B 4YGEA 2XGXA 5D8AC 4YVSB 4B4PA 4F3JA 1PO12 4QXKA 5KXEA 1W6PA 5FMOL 2AREA 1C4RA 4B4QA 4IEVA 3VBHB 2D98A 5BY5A 5C8CB 5T5LA 4XBLA 1OD5A 3AYDA 3A0NA 3WY6A 4OULA 1RUI3 1AR81 1LR5A 3VKMA 1NZCA 1LU2A 2ES3A 3ILRA 3N7MA 4D3WA 1BJQA 4C1WA 2CL2A 2BGCA 4Q4Y1 1RHI2 5JI9A 1RUC3 2ET1A 2AGSA 1RUE2 4LBQD 3ZFFB 5H9SA 3EHKA 1S2KA 2E9QA 2CGPA 2BNMA 2O1QA 3PTYA 4WM7B 5ACA3 1UL9A 1VBC1 3RRDA 5DUVA 1NLSA 2PQQA 2VPVA 2OA2A 3N7LA 1H1IA 1HRI1 4JTOA 2A75A 1VBB2 1S0CA 2V09A 4P9WA 4CDXA 1YI9A 5BNOC 4HLTA 4GALA 4ONUA 2RS31 4L97A 4P14A 3MF6A 4AHZA 2BW8A 3SCHA 1WW5A 3CLPA 1TMF1 2ZKNA 1M4WA 3RZZA 4E2SA 4PDWC 4D94A 3FLRA 4K1YA 3AP4A 2YHJA 3DPRA 5EJ3A 4I0WB 4Q0VA 3WQ1A 1G8WA 3B02A 4MGIE 1FATA 2WNEA 4AVVA 1BK1A 2P3IA 2R071 1PO21 4U36A 4GMP3 1MQTA 1RUF3 2ZX3A 1UMZA 1AF9A 1HXS1 5F6KA 3ZN5A 2GH2A 3JZVA 2XJPA 5C4WA 1CPNA 4XIKA 2YGLA 4LR4A 2ZABA 1WW7A 1CD3G 4LEJA 2RM22 3WD5A 2JG8B 4GWMA 3MIGA 4B3NA 1HDKA 1IHMA 5KXDA 1MZ6A 4Y22B 4RGAA 2XBO2 2QFEA 3ZXGA 4R9BA 2E6VA 3MPBA 2XH6A 4YGBA 2YYOA 1NQDA 4FPLA 4XXPA 3VKFC 4Q4X2 4YW5A 4NOTA 1AYM2 4Q4V1 4OHXA 1EPZA 1JUIA 2DCJA 3AXEA 5CFCC 4LLFA 4YW1A 3I2DA 3J4UH 1ZZ6A 1LHWA 3IMNA 3ZIWA 2OUJA 2ZGQA 2G9GA 2XB6C 1PNFA 4H7MA 2WA3A 5H9QA 4Q29A 3AP9A 3J8F1 2A3YA 3CJIC 4U2AA 2WNUB 2HWE1 3THPA 1RB8G 2A6YA 3VKOA 1XNBA 5FQ0B 4AI0A 3GBGA 2DTYA 1WA4A 4XZPA 2GALA 3H50A 2GN3A 2D6KA 4JGYA 1AR73 4YZ5A 1BBT3 4XBQA 1RUH1 2VUJA 3PNAA 3BU7A 1NYWA 2R043 3ZFGA 3DUIA 4TYSA 1YIFA 1SCRA 2XG3A 3VL9A 1GNZA 4AE2A 2WZR2 4LULA 1ULEA 2EXJA 3GBFA 4WZCA 5KC6A 3VBRB 1TME2 3BALA 1C1LA 3E6BA 4X8PA 1VR3A 4XFHA 1SQ4A 3VHNA 1D0HA 4I2OA 1V70A 5FBZA 5I93A 1FV2A 2B46X 1COV2 1AYN2 4LBKA 5I0RA 2PHDA 1UU6A 1ZBE2 4V1PA 1PGW1 4PIXA 4QQHA 4CTEA 4GH4C 4XW3A 2YPJA 2LTNA 1NCRB 4AFMA 2DWRA 1C8M3 1NCQB 1Z0HA 3AZVA 2RR11 3LA7A 5FPXA 1QNWA 5FOJB 1X33A 3NW4A 1RUJ3 2TEPA 3ETQA 4RA0A 5LK7B 5J37A 2XJQA 1J3RA 1G6NA 2D5FA 1CAWB 3FLTA 4AI3A 4AHXA 1WD3A 4CDWB 3ZSLA 3KS7A 1WCSA 2E7AA 3WG4A 2RJKA 4OHYA 3IDEA 4R9CA 1R082 2GMPA 1FPN3 3UKVA 3NAPC 4QM9A 1O3TA 1JYIA 4QPGC 1W6OA 1VBA2 3JD72 4D7SA 3U07A 4LNVA 3SH3A 2ZGSA 3VZKA 2CYFA 2QDNA 4S2HA 1S0BA 2E63A 2A6ZA 2HWC2 4AEKA 1OQEA 2HWF2 5JWPA 1MS9A 1ND3A 3A0KA 4KWJA 4K40A 2R32A 2QDRA 3AKQA 4RHV3 2VW1A 3TNPB 1UKRA 3L2HA 4YZ2A 4LUKA 1N1VA 5JOWA 4FOQA 3VL8A 4G4FA 2VY0A 3K48A 2ZCWA 1AL0G 1Q3EA 2BEOA 2JICA 3PVEA 5JOYA 3SMHA 3WV6A 3NWKA 3ILFA 1R091 3LCPA 3ZXDA 2WSVA 3AKSA 4B8EA 4CP1A 1REDA 4A3XA 4MZUA 3ZSJA 1J1TA 4ORFA 1UKGA 3RMXA 2YXSA 2QNKA 4BE3A 3VGIA 2CY6A 5EYYA 4PCRA 5GZGA 1KITA 1WLCA 1NA1B 1O5UA 4AEDA 1HKDA 4A7KA 5CFCB 3ST7A 3NV3A 1H1MA 4E2QA 1LGNA 1URXA 4ZXKA 1X50A 1AL23 3KCXA 4OFGA 3VZMA 2KM2A 1FV3A 1RUI1 1B09A 4HKWA 5ABJB 1VBC2 4FP2A 1QQP3 4CDXC 4D69A 3M3EA 4KGQA 2GZWA 1W6NB 3I54A 4DFSA 1RUC1 4RS5A 4DNYA 3WUDA 4O9EA 2IC1A 1AX0A 2WFF2 3AP5A 4Z2WA 2EAKA 1OHFA 5IK7A 3G7DA 1LHOA 4LO6B 2VVDA 5L7OB 1AR62 3KT7A 3DPRC 1NQJA 3NVCA 4WVMB 3WQ0A 5JZGC 4YG6A 2A70A 5ACA1 1F9KA 1OMIA 1DGRN 5DG2A 1F8VA 1ND2A 3WW4A 4DY3A 1CN1A 1HW5A 2CGNA 5C4WC 2WNVB 2V5YA 4QU2A 2ARBA 5BNQA 1HXS2 5FDBA 1POV3 1MEC2 1SFNA 3AXDA 5BYNA 1B35B 1RC6A 4R4XA 1ULCA 1YXWA 1EYBA 3DN7A 3OGGA 3RYPA 5LRRA 4AFBA 1VJ2A 3SNMA 3RYKA 2UY9A 3KM5A 4K3UA 2NM1A 4GMP1 5JI7A 4AI2A 1RUF1 1HQNA 2WNUA 3RJRA 4XJZA 1UU4A 1H8TB 4COVA 4HMZA 3O7OA 1BEV2 2X5IB 4BWOA 2D7FA 2H0BA 4ASLA 3O0XA 1APNA 3T1LA 1DZTA 1OA3A 4LHNA 1NOVA 3LGRA 4HSLA 1AR93 5GLVA 1CAXB 1WBFA 4Q4W2 2H6CA 2CTVA 3OF1A 5CG8A 4YM2A 1XYNA 2DCYA 3J9SA 5GLUA 1BMV2 1EV13 1QMJA 4RGGA 5FLJA 2ZPXA 3MEPA 4IL7A 3UJQA 1C8NA 1Q8QA 5GZFA 2VOWA 1BZWA 2VNGA 4H14A 5C9AB 1VIWB 4JGYC 3B9CA 1RUD2 1VAMA 3LKJA 4CRQA 3VDDB 4XIOA 1QJZA 2HEWF 3AKTA 2I45A 3IM0A 3ZFGC 3N4MA 4XHXA 3ZPYA 4Y1ZA 3VBOA 1RUH2 1X8MA 4KWLA 2B42B 2P37A 2EXIA 3DL3A 1NCQA 2Q8OA 4Z92B 1N3QA 1LJ7A 2C1FA 1DYPA 3VUOA 3JQWA 2RE9A 4IEQA 1AR71 1GZ9A 4S2FA 1BBT1 4N7UA 1F5FA 4X6RB 4A7YA 1MVEA 5A32B 4C0HA 1IGOA 1VBE3 4RD7A 2ATFA 1BVVA 4XHBA 2R041 2AZ5A 1ZVFA 2FQPA 1AXYA 4WM8A 4BM8A 1RINA 2Y38A 1MS0A 1FAYA 3MW4A 4XFGA 1ZRCA 1R1A3 2YC0A 4D7TA 1GZWA 1AJOA 4YW3A 1VBD3 5L19A 3WW3A 2AH2A 3SCFA 3USSA 5SV5A 1GYKA 3EBRA 3LOIA 1FMD2 1S0IA 4CP0A 2WQ4A 4YW4A 3WINE 1LULA 4KNCA 4QD2A 1PK6A 1KJLA 5JPMB 4TZDA 1LEDA 4BMEA 3O12A 4M3CB 2DU0A 1I9RA 2WIIB 1C8M1 2YMZA 1V9U3 1DQ6A 3CEWA 5BNNA 2K2SA 1X7NA 5HI0A 5C6CA 4OHVA 1RUJ1 5BUVA 3ACLA 4R9AA 1JYCA 1ASJ2 5T54A 5GLWA 1LOEA 4XYXA 5HCBA 3WW2A 4Q0QA 4IXLA 4KH9A 1ND3C 5JZGB 4FSJA 1T6GC 3ZYGA 3KZ4C 3ME2A 1XNKA 2WS93 4MYEA 3BOWA 3H1MA 1FPN1 4PQ9A 1JBCA 2MHFA 2BBVA 1OQDA 2QCSB 2RMU3 4YSFA 4R9DA 5FPZA 2YUEA 5DDJ2 3WDYA 3T2TA 1FNYA 1N1YA 4ASMB 5KHJA 3LA3A 2PTMA 1PNGA 3EO6A 4MUVA 3HMYA 4PF5A 2E7QA 4Q26A 2ZAAA 4FBFA 2PYTA 4HVRA 1PM7A 3R05A 2O0OA 2RS52 2YY1A 1M06G 2QKDA 3AFGA 4RHV1 3KQRA 1PVC3 3WDXA 4C0BA 4AI8A 3S7EA 5CVRA 4CEYB 4K21A 5JSPA 2WL1A 1ZREA 4AEDC 3H0OA 5EYXA 3JQXA 5CFDA 5GM0A 5FFOC 3GHNA 2ILMA 5L7OA 3ZXEA 4WVMA 3VV1A 3WT3A 4RQPB 5CAZA 1VALA 1LOAA 4I02A 4E2GA 3E6CC 4L8QA 1RMU2 2JECA 1PVXA 4PIZA 5DZEA 4Q8KA 5JCTA 2VOVA 2VMGA 3PMEA 4RR3A 2VVEA 5AC92 2D97A 4RS5C 5DUXA 2HWB3 4XXAA 4L11A 1WW6A 1TNFA 5BNPB 3BOPA 1QXJA 5C8WA 2DF7A 4N9IA 1J59A 3ZXKA 1QF3A 1RUC2 5BXXA 3N36A 3WX5A 3VZOA 3NKGA 2G4IA 1AL21 4FAGA 3WP3A 4UW6A 3ES1A 3AB0A 3ATGA 3AKPA 2R063 2JXAA 1ND2C 5ACA2 1D4M3 4FOVA 1QQP1 4QPIC 1WW4A 2GNDA 3AYCA 4Y26A 4Z82A 3IIAA 3TNQA 3TRSB 4AI1A 4Z1VA 5H9RA 4WVVA 1YNAA 3JBG3 4GA9A 1OOPB 2VGDA 1W0PA 2BNNA 1YJLA 4YW2A 4AFDA 3OY8A 4RL7A 5FAXA 4F83A 3POYA 2QE3A 1XNDA 5FCCA 1G9CA 3GF6A 3L2YA 3ROUA 2BPA2 3WG1A 4FO9A 4OUSA 4FPGA 4WV8A 4AK3A 4YRDA 5FO7B 2ZAHA 5J98B 2X8KA 4FTEA 1YFYA 3KD4A 4AF9A 3C3VA 4SLIA 1POV1 3E5UA 3LSDA 4JVAA 5J96B 4AHYA 1G9DA 4BQ1A 3RYRA 3NV2A 3WP5A 1RITA 3I59B 4NHKA 1V6LA 2D93A 2XL9A 3M3OA 4QGLA 1DGRA 1LHUA 1ZRRA 2MPFA 4P9JA 2XKPA 2YROA 1HRV3 5EXOA 4Y20B 1GV9A 2WWSA 5K0UB 4AVTA 1IPKA 2FZ2A 1RUG3 4TWTA 2XVLA 4UW5A 1PIV3 3KLSA 2D3PA 3ZSEA 3AP6A 1AR91 4HPKA 3ZSMA 1ALYA 4XFFA 3VBSA 1BYHA 1OSGA 4YVWA 4Y1XA 1HX6A 2DTWA 3VBOC 4CDUA 5JPNB 2ET7A 3J26N 3WHUA 4QGNA 3FC0A 1EV11 5A33B 1MZFA 1O91A 2P34A 3AYAA 2D43A 2A6WA 2HEYF 1VRH3 1ZA4A 1RGSA 3ZVXA 3VBUB 5A3LA 2Y0OA 4M3CF 4W6WA 4C90A 2ERFA 4WM8C 4N43A 4XQWA 3IWZA 2R6QA 2PAEA 2PHXA 1G7YA 2DURA 5AFEA 3AM2A 4HVQA 4CDQB 1FX5A 1ENRA 3K51A 2OYZA 1YO8A 1IKPA 4FXGB 1XQNA 1RJ7A 3P3NA 4XMAA 3HQXA 4JAAA 2ZKLA 3N3HA 5GZEA 2X53S 4META 4PBOA 1NE6A 4ZKTB 3O0VA 4JGZA 4YARA 1JW6A 4X6QB 1TQ5A 1A78A 4HK8A 1VBE1 1PK6C 4S2DA 4OHZA 4FPHA 1IKQA 4XETA 5IK5A 1A3KA 3QOPA 4E4SA 1WLTA 4NO4A 1PO13 4IV3A 4XILA 1PHMA 1V00A 3ALQA 1R1A1 2NZ9A 4XBNA 1SLTA 1FYUA 3ZN6A 2X29A 1VBD1 3NJZA 3WDUA 1XYPA 1AXKA 2NP0A 1CESA 5T5OA 1OFNA 3V0AB 4CEWA 3WDWA 3ILNA 4EROA 2CAUA 1H1AA 3H3ZA 4GMP0 4LO4B 1NE4A 2P17A 3V64A 3AJYA 4PLOA 4AEMA 1IPJA 1JHNA 1FOD2 1QJX3 1W6QB 1CGPA 1MACA 1YRZA 1Z7S2 1NXD1 2JG9B 3GBWA 3ZFEB 1V9U1 4UBGA 2WJSA 3OGJA 1RHI3 1CAUB 1RUE3 4FXKB 4JCKA 1K5MB 2QQPA 4KU7A 3VKLA 4HN0A 3T1MA 4XFAA 2XPJA 4XF1A 4LE4A 1VAVA 3PJYA 2FMYA 3EXUA 4QQLA 2WS91 2PELA 1H4HA 4J1WA 1D2SA 1VBB3 4PLMA 2BNOA 4MH0E 4EWAA 5D8AB 5C33A 4BH9A 1UD1A 2RMU1 3CO2A 3NKTA 3FMGA 5EZWA 2ZMKA 5CFDC 1ZRFA 4BOWA 3FFZA 2ZGMA 5JLVA 2DUQA 5KXCA 2C0ZA 3HWJA 5L36A 2YGMA 4GQ7A 1VB2A 3A4UA 3GNEA 1H4GA 2CGOA 2PAMA 2ZGKA 4JDNA 4MX3A 3X29B 5T5JA 3VBFA 2NQYA 4BZ4A 4RR3C 4DRVA 4AWDA 3KMHA 1PVC1 1ZBA2 3N35A 1QJY2 4ZU7A 2WLPA 4EWDA 5JOXA 4FTBA 1SFYA 1UIJA 1LESA 2BQPA 4MGYE 3S7IA 4HETA 2RM23 1CR7A 2OUHA 3USUA 2VECA 1QH6A 2E7TA 4OI0A 4WVWA 2XWBB 5EWSA 3LB9A 3B5LB 2GU9A 4N53A 2VOXA 3BCWA 2AYHA 2B9UA 2XJVA 3FHIB 4M3CE 4Q4X3 4YVSA 3BODA 1EAH2 4AGGA 3IPVB 3VZNA 1C5HA 2HWB1 4YGCA 4FPJA 4P9XA 3WCSA 3NV1A 5BNOB 2HWD2 2CAVA 1HLCA 3LZZA 4IV1C 1CX4A 3POSA 1KFXL 1S0FA 4QQPA 3VBHA 5C8CA 4YZ1A 2UYBA 4IEXA 4PDWB 3IBMA 1DU3D 4LBQB 1UU5A 3PVNA 2BFUS 5E89A 4GB32 4W6YA 2R061 4GKYA 1PGL1 4IESA 2IFRA 1D4M1 5J36A 2ZBJA 3MI8A 2HJIA 4Q8LA 4ZU4A 2HYKA 1UIKA 4RFT0 1QDCA 1GQGA 2A73B 2XJSA 2ZS6B 5IT6A 3JBG1 1QGLA 3OYWB 4OI2A 4XJAA 4KG8A 1HV0A 3ZFFA 2F6BA 1C1FA 1WD4A 3G6JB 3OD4A 4QM8A 4C91A 4XJWA 4B7KA 2WFPA 2MEV3 4C1XA 4WM7A 1N3OA 1NY71 2ZX2A 1OI6A 1GQHA 4NN0A 4L9BA 1W39A 4P5HA 1REEA 5FLIA 2DVFA 1QXRA 2E51A 3GZAA 4O9GA 5A33A 4QX5A 3EJKA 3M70A 4CP2A 1AR82 4LBMA 1YFWA 3O5SA 2GMEA 1FNZA 3MLJA 1QHDA 1ZZ8A 5KHKA 1OA2A 4EN7B 4FPEA 3THTA 3MIBA 4Q4Y2 2IXIA 4YNIA 4ITCA 4XQ4A 3VBSC 2DCTA 3VBUA 1UPIA 1G86A 3EQEA 4FT8A 1COV3 1DLLA 2D3RA 4YVWC 4HK9A 4CDUC 2VULA 1ZBE3 2GC0A 1HRV1 2WLQA 3KGZA 5T5PA 1MS1A 3AK0A 3H1YA 4UXAA 1RUG1 3D0SA 2ZMNA 4AW7A 3CJIB 1SLLA 4QMAA 1DG6A 2C5DA 1MR5A 3B69A 4N9HA 4J6GA 2TBVA 2JENA 4NWVA 1HRI2 1PIV1 4NVPA 1S0GA 2RS32 3S0MA 1QH7A 2P2KA 2JG8A 2OIIA 1Z78A 4N43C 1TMF2 4FPFA 2XLGA 2W0XA 2PHTA 3AZZA 4P9LA 4J1XA 4WM8B 4IETA 4Y22A 1R083 1BCXA 4EN6B 3TN93 1WMFA 4Q1PA 3LSEA 1A6CA 2WA4A 1WBLA 3B3QE 3SISA 1MQTC 3U10A 1QKQA 1KD7A 3OJBA 1VBA3 3JD73 1NXMA 2R072 1PO22 4XFBA 4JGZC 1VRH1 1J3QA 4GIQA 5LEKA 2UURA 4ATEA 4FTSA 2HWC3 4GKXA 2W39A 5A3MA 3V0BB 2HWF3 3LWCA 1WCKA 4YFZA 1G9AA 1N1SA 4IV3C 1ONAA 2ZZJA 4AQ2A 1ENXA 1W6QA 2ZACA 1JOJA 1KFUL 2SLIA 2ZHMA 3POWA 5CU1A 5CG9A 1JH5A 4IEWA 3LAGA 1S55A 2W68A 4K20A 1YLLA 2XJRA 4GH4B 5CB7A 2RHPA