2JJ6A

Crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
VPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative Carbohydrate Recognition Domain of Human Galectin-Related Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords GALECTIN-RELATED PROTEIN
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jj6A00
4DRRA 3KQRA 2W52A 2OW4A 1JW6A 1QU0A 1YXWA 1KQRA 4I30A 2ZA9A 5KXCA 4YGDA 2AUYA 3RMYA 1A3KA 4Q2FA 4YG6A 1JYIA 1SBFA 4WZFA 4YW1A 3OY8A 4BQ1A 4FP3A 1N1TA 1DBNA 5E88A 2A71A 4ISQA 1S0EA 1LGBA 2EXHA 3AZWA 4UW4A 3FBYA 2CY6A 1AJOA 1DQ5A 4XBQA 1LU2A 2GMPA 3MPPG 3NV1A 4PBPA 4YGEA 4BMEA 1WLWA 4YZ5A 2R16A 2HYKA 4LBKA 4WVVA 1AX1A 1Q8VA 4LBMA 2JECA 3N7KA 1DGLA 3FLPA 3WDTA 4YZ2A 3AP4A 1YO8A 1GZWB 2GDFA 2VW0A 3BOPA 5IK7A 1WLCA 1DFQA 1JUIA 1SFYA 5JOZA 2VW2A 3FLTA 2DVDA 1VAMA 3FUOA 4R9DA 5H9SA 3WHTA 4YFZA 2JE7A 1GV9A 3SH3A 1QOOA 2W39A 1G86A 3O0WA 4OZXA 1AXZA 2NN8A 2E51A 2D6MA 2DTYA 1C1FA 1LEMA 1LJ7A 2UU8A 2EAKA 3RSJA 4HANA 4BMBA 4FPJA 3VUOA 1GICA 3M3EA 4UW3A 3WDWA 3PMEA 2EXKA 1LOGA 4PF5A 1X50A 3AZXA 1ONAA 4Q8LA 3VKOA 2Z42A 4F83A 4Y24A 3N7MA 1DQ2A 2R49A 5EXOA 4PBOA 4ITCA 3N36A 2GNDA 2PHFA 2UWAA 1LHVA 3B9CA 3L2YA 4Q1PA 3WOGA 1IS3A 1ENQA 4R9AA 1CR7A 1OKQA 3FUQA 1BZWA 2DUOA 3ZXJA 4DPNA 3W59A 1N1YA 5DZGA 4FOWA 3USUB 1KDMA 2PHTA 1S0BA 5H9RA 3M1HA 3NV4A 2YMZA 4Y26A 5IT6A 2JDZA 4IQPA 4XIKA 3JU9A 4FOQA 3AP5A 1Q56A 4K21A 5JDBA 1QDOA 3OY8B 4JRAA 4YW3A 2ZHMA 4Y20B 2ZGLA 4CZSA 2ERFA 5JLVA 2ARBA 1FATA 3ZXLA 1V6IA 1HQLA 3IN9A 1BJQA 1CJPA 1MS0A 4UW5A 3RS6A 4YM0A 1G7YA 3AYCA 1MS8A 2D6LX 4GXLA 4LBQB 5E89A 1UZYA 5HCAA 3B01A 1GLHA 2ZGNA 2OVUA 1FNZA 2VH9A 4Q26A 1OQ1A 1NXD1 5GALA 2KM2A 2NMNA 4AGGA 3ILNA 2G4IA 1V6MA 3AP9A 4FPKA 1RIRA 2YV8A 4M3CA 2B7YA 3V64A 4YM3A 3WDXA 1SLCA 2H0BA 4RL7A 3IM0A 2A6YA 4K1ZA 2A3WA 1GYKA 3WG3A 2SLIA 3D6EA 3M3CA 2DUPA 4XJ9A 4DS0A 1WW6A 1LULA 1S0FA 1N47A 2P3IA 2GNBA 3MW2A 4XE9A 5FREA 1BQPA 2JD4A 4CTEA 2AGSA 2ZZJA 3NV3A 1NLSA 3N7JA 1MR5A 3FFZA 4K20A 1CPNA 3ZXKA 5CNAA 5GZDA 4GWNA 3PVEA 3SITA 2A6XA 3SNMA 5DUVA 1EPWA 3I4IA 3GNEA 2OUJA 1FX5A 4H55A 1AZDA 1V6LA 5JVVA 1ENSA 2ES3A 1GSLA 4Y1ZA 5GLUA 3V0BB 1VAVA 1AXKA 1LHWA 3IKWA 2ZGPA 2ZGOA 2D6NA 1YI7A 1LOBA 3ENRA 5F5QA 2DU1A 3ZYRA 3WDUA 4DQAA 5GM0A 3C2UA 3WDYA 3ZXEA 1WBFA 2FHRA 3AXEA 4AGRA 5L73A 1WD4A 2DVFA 2ZHKA 3M2MA 1FAYA 4LBJA 3OYWA 2ZBJA 2ZGUA 5DZEA 4XDQA 2E7QA 4WV8A 3OYWB 1B09A 5DZFA 1MS9A 2E6VA 2UWCA 5GZCA 3AYAA 4P14A 1H9WA 5HCBA 1LODA 5KXDA 3WG1A 1UN1A 2V5YA 4FPFA 2GN7A 4LBLA 2ZGKA 4P9XA 3D5OA 3H0OA 4M01A 1V00A 4YFWA 1O4ZA 2CNAA 1C57A 1MS5A 1LGNA 3BTAA 4HL0A 4XOGA 1MVEA 1ULEA 1IKPA 4GKYA 1R1ZA 2VU9A 1SLAA 2EIGA 4MYEA 3AP6A 4YZ3A 4C1WA 3APBA 4ZKTB 4M3CB 2GNMA 3VKFC 2YZ4A 1DLLA 4XJAA 3M3QA 5CB7A 3AYEA 2D43A 3O5SA 4AVSA 1F5FA 3WG2A 1CVNA 1SACA 3OBRA 5T50A 3RG0A 5F9TA 1N3OA 2D3SA 2UURA 5CA6A 2PHRA 2YXSA 4Q1RA 2ZGQA 2WKKA 3RMXA 3INAA 5IK5A 1Z0HA 2JKBA 2R1DA 2YY1A 4Y1UA 3I8TA 5JOYA 1SLIA 1ULCA 3PVOA 2DURA 1QKQA 4XJWA 4XMAA 1IOAA 1S1AA 2ENRA 1UAIA 1GNZA 1MS1A 2NYYA 5DXDA 3T1MA 2A6VA 4M3CF 2D6KA 3O0XA 1DQ0A 1BYHA 2EALA 4XILA 5LK5A 4ASMB 2R0HA 5GLVA 3WVJA 5GZGA 1LOFA 2D3RA 1LEDA 1WW4A 2JE9A 1S0GA 3DGTA 4FPCA 2C9AA 4YG0A 3OPZA 1YYNA 2WNEA 1JHNA 2LTNA 5DG1A 4FQZA 1BXHA 3UK9A 1I1EA 2NZ9A 1MS4A 1AJKA 2WJSA 3Q9OA 2FMDA 2P37A 4R9BA 2EXIA 1G9DA 1W6MB 5BYNA 1GBGA 1RITA 2DVGA 4NO4A 1Q8PA 2WQZC 2VUAA 4P9WA 5E8AA 1D0HA 1MZ6A 1HQWA 3N35A 5DUXA 4FPLA 3ZXFA 1CPMA 4YGCA 3R4UA 3N7LA 3WV6A 3WUDA 3R4SA 1LOEA 2R0FA 1W6NB 3BODA 3OBTA 2AENA 1V6NA 1W6QA 3WNXA 5T5OA 4UW6A 1QNYA 2ZGTA 4XBLA 4Q8KA 3WDVA 1SLLA 5GZEA 1UZZA 2V73A 4XXPA 3IPVB 1Q8SA 2ZGMA 1GKBA 1AXYA 2EF6A 1Q8OA 4LBNA 2CYFA 2D6OX 3AJZA 3IPVA 4TZDA 2Q5TA 2NMOA 5HCFA 2BQPA 2PHWA 4DFSA 1DIWA 1HLCA 4FPHA 1IS5A 2GALA 3HR9A 2WSVA 3RQ0A 5JOXA 1PZ8A 1SBDA 2VW1A 3ZSKA 3V0AA 4AWDA 2PHUA 1ZM1A 1H30A 2CTVA 1CONA 1VIWB 2DU0A 3POWA 4Y20A 2WT1A 2ZHNA 1HKDA 4AVTA 4FOYA 2YROA 3AP7A 5EWSA 4XJZA 5H9QA 4FOVA 3AXDA 5GJ6A 1LU1A 3AZZA 2DYCA 3D4KA 3JUUA 4FPEA 1VLNA 3W58A 1KITA 1SCRA 5DG2A 2A5ZA 3WG4A 2DTWA 4XYXA 1J1TA 2DVBA 5T5JA 1TEIA 3HMYA 2XB6C 1D2SA 2RHPA 3A0KA 3AX4A 4Z8BA 1O4YA 4BPZA 2ZMNA 5KXBA 1DYKA 1KDKA 1W6PB 1W0PA 1URXA 1W6PA 4Y1XA 2NP0A 2R1BA 3UJQA 3NV2A 3NWKA 1W6MA 2D44A 1LGCA 3QCWA 3B69A 2P3KA 2ZAAA 2ZGRA 2WT2A 3LCPA 3T1LA 1OFSA 4YZ4A 1KJRA 3V65A 3TB0A 3MW4A 1G9AA 3UL2A 3SH4A 3AJYA 1S0DA 5EYYA 1SCSA 2DV9A 1AF9A 1JBCA 2GN3A 2ZKNA 2AH2A 2D6PA 3WCRA 3ZSLA 2DWRA 1F9KA 1Y7BA 1CQ9A 4RA0A 4Q27A 3V0BA 4YM1A 2NM1A 1GNHA 4DRVA 1W6QB 4XTPA 2CWMA 4XZPA 2D3PA 4M3CE 4YW2A 3TAYA 3FLRA 5JOWA 1H9PA 3QLQA 3PVNA 3VKNA 1S0CA 1N1SA 3ATGA 1BKZA 4KBBA 1G9FA 3USUA 4R9CA 3ZPYA 2W68A 2ZMLA 4LBOA 1KRIA 4M00A 3AK0A 1KJLA 3ASIA 1WW5A 3BIWE 3KM5A 1IS4A 2VY0A 3O0VA 4PCRA 1DQ1A 4FPOB 4CRQA 2I2SA 3PJQA 5KXEA 3SH5A 4ATEA 3M3OA 4BLJA 3POYA 1IKQA 1QF3A 4C1XA 1SLTA 1FYUA 1UKGA 2A3YA 1IS6A 3A4UA 1UX6A 5IK4A 1DHKB 3UJOA 1W6OB 4GA9A 1C4RA 2E53A 4JC1A 4L8QA 4P9YA 1JXNA 1Q8QA 2JJ6A 3AFKA 3AYDA 5EYXA 4GWMA 2LALA 1UL9A 2PELA 5AVAA 1G9CA 5H9PA 2DUQA 3RRDA 1MZ5A 3LSEA 1QOTA 1LCLA 4Y22B 4Y1YA 2XG3A 4YW5A 5GLTA 2UWBA 3ZVXA 1CIWA 1GANA 4YM2A 4XTMA 4AGVA 4D69A 1QNWA 2VXRA 4TYSA 1FNYA 1JN2P 2AR6A 1WW7A 4GALA 1YIFA 1APNA 1G8WA 3MW3A 5T54A 3ZSJA 3SLIA 4AVVA 4Y1VA 2ZACA 1QGLA 3ILRA 1XQNA 1SBEA 2ARXA 1N3PA 1WD3A 4FQ4A 2EXJA 1QOSA 5GLZA 2CWSA 1FV2A 1AX2A 3B00A 5CAZA 4BLIA 1DZQA 1S0IA 2ZABA 2ZHLA 5DUWA 1SLBA 1WCSA 2A6WA 1DQ6A 3IMNA 1CN1A 4XJUA 5GZFA 1RINA 1AVBA 1MS3A 5T5LA 4BM8A 2PHXA 2WSUA 1MACA 4W65A 2A75A 2CL2A 3OJBA 4LBQD 5IK8A 4XIOA 2SBAA 2ZMKA 1ULFA 2P34A 1V6OA 5T55A 4ATFA 1QDCA 1VALA 1WBLA 2WT0A 4ZXKA 3AZVA 5CBLA 1PZ7A 2GMEA 3HN1A 4U36A 4XMIA 1AX0A 1N1VA 1FV3A 3U4XA 4YGBA 4YG3A 1HDKA 1GZCA 1MVQA 2GMMA 1LESA 1LHNA 3OGGA 1LOCA 5DUUA 3WHUA 2W08A 2A3XA 2OUHA 4YZ1A 4GKXA 4FPGA 1DQ4A 5FRAA 5GLWA 1ULDA 1V6KA 4FP2A 1V6JA 1ULGA 3B3QE 2DVAA 3MEPA 2C5DA 1GZWA 3T2TA 1W6NA 1G9BA 3LSDA 2A7AA 2GNTA 1YRZA 4BOWA 2A70A 2P2KA 4K1YA 1W6OA 1W0OA 1C1LA 5IUQA 3AZYA 1LTEA 1LHUA 4YLZA 3VKMA 3VKLA 1LOAA 4JCKA 3DUIA 2TEPA 4PQ9A 3CNAA 4WVWA 1GZ9A 4Y22A 3SISA 1F31A 1N3QA 1S0JA 2P3JA 2E7TA 3ZSMA 1A78A 4FVVA 3O12A 1WUVA 2D7FA 4NOTA 3WUCA 3V0AB 1UPSA 5T5PA 3WLUA 1ZA4A 3ZYPA 1Z78A 5T52A 2AYHA 3R05A 4YW4A 4SLIA 2ZGSA 1LOFC 1DYPA 2A6ZA 4XXAA 3N3HA 1LENA 4XHXA 4FPYA 4LBQA 3WCSA 1UMZA 1LHOA 4XJ8A 5SV8A 4XBNA 1QMJA 3ILFA 4XHBA 4ISRA 4AYUA 2WLQA 3VV1A 3GALA 3POSA 3WZ1A 3A0NA 4U2AA 1I3HA 5JMCA 1JOJA 1CESA 1LECA 1WLDA 1A8DA 2AREA 1ENRA 1U0AA 1JYCA 1PZ9A
chains in the Genus database with same CATH superfamily
2VR4A 2VMIA 4URTA 5A32A 1OHFA 1QU0A 2C1FA 3J26N 3NW4A 2ZA9A 1I5ZA 4IE4A 1CAVB 1QY4A 5FLHA 1A3KA 2ZEYA 1RUE3 1ZBE2 2WWUA 4IEXA 4Q2FA 4XF9A 1SBFA 1X82A 1QXPA 2VMDA 5FPXA 5JXJA 4BCUA 1OT5A 2WZ8A 4I3GA 2B45X 3HQUA 4EN6B 4JGYA 1UZ0A 4Q4X2 1N1TA 1RHI1 3DV8A 4RR3B 3WNMA 3FX3A 4BYYA 3GBFA 2AEZA 2OPWA 4ISQA 4B1LA 4NR1A 1HW5A 4N43B 1KS4A 1JU3A 3M7AA 3MICA 4XBQA 1AJOA 1RUJ1 4XF3A 5IFTA 3RYPA 1OPMA 1S2BA 1YQ5A 2MNGA 3JBG2 2R16A 1QJFA 2HYKA 3NAPB 4LBKA 3VD3A 4XACA 2IC1A 1EP0A 1LRHA 3J8F3 1O5UA 4LO8A 4QQOA 4Z2WA 2PLV1 1O8PA 2QQIA 3G7DA 2VW0A 5LBEA 3VHNA 1DG6A 1GZTA 2R32A 3ACLA 5LA9A 1VAMA 5F5IA 4A7KA 4ARYA 2JE7A 4MHUA 1XU2A 1W06A 4Q0PA 4EWAA 4MLOA 2ORZA 3ZFFC 1I9RA 4OZXA 2HKXA 2PYTA 3JD71 3K46A 4HANA 1IQDC 2ZJCA 4LO4B 3PMEA 3TWIA 3WDWA 5FUIA 4GH4C 1M06G 1X50A 1ONAA 2Z42A 4Y24A 1DQ2A 5ABJA 3AMHA 3ZN5A 2GNDA 4AK3A 1MEC2 1R1A3 1RUNA 2PHFA 4D6RA 4Q1PA 2H6CA 3L2YA 3HNYM 1CZTA 1CR7A 2DFBA 1QJX3 3AVSA 3FUQA 2D97A 4YSFA 5C8WA 1W99A 5A3WA 4XABA 3ZXJA 4KMQA 5K9YA 5A7NA 1E5SA 4MX3A 1RXFA 1QJZA 4RGKA 2R063 4PI2A 4Y26A 2JDZA 2YFUA 1HXS2 4CP9B 2BWAA 2VNRA 3LF7A 2QCSB 4GH4B 5KWRA 3OSDA 1QDOA 4NIHA 5A3UA 3PDQA 1RUJ2 3LA2A 3MFAA 3Q8EA 1RUE2 1ZBE3 2ARBA 2JDYA 1CAXB 1V6IA 1C8M1 1HQLA 3MV11 4CPBD 4YWAA 4CYDA 3RDIA 1GLHA 1FNZA 3IWZA 2Y6LA 4QHBA 4AZZA 3LOIA 5FZ0A 2NMNA 1JZ6A 1AR82 2G4IA 1PX3A 3KWVA 4H7MA 3POIA 5C3PA 1NQDA 1HQNA 4EN9B 3AL5A 2WLPA 3V64A 3VBRA 5IVEA 3WDXA 4BISA 1JYVA 2H0BA 4RL7A 1O4TA 4K1ZA 2A3WA 2TUNA 5E16A 3J7LA 2KA3A 4XJ9A 2R042 4DS0A 5FDBA 5FY4A 1N47A 2WZPP 1TMF1 4CDWB 4Q4V1 3PL0A 5I0TA 4QPIB 1OI6A 2PLV2 3AMPA 2B46X 4FSJA 5IVFA 1W2AX 1W8NA 2JD4A 2Y38A 4B3NA 4CTEA 4DNYA 4NPRA 4YNIA 1JODA 4XFBA 4DXSA 5FP4A 4E4SA 3RYRA 3IZOA 3WF1A 4D8MA 3ZN6B 1CPNA 2C0ZA 3ZOIA 3ZXKA 3OGSA 1KXGA 3PVEA 3AB0A 3S6PA 3SNMA 2C9KA 1JHJA 1EPWA 3S7IA 2YB7A 1U5ZA 4JKKA 1FX5A 1ND2A 5FLIA 5J1XA 4H55A 1ALYA 4JX0A 1AZDA 4XFFA 3T1MA 2VCMA 3V0BB 5GLUA 3TEXA 1LB2A 2ATFA 2ZGOA 5FK8A 4CCOA 4DXRA 4CUCA 5F5QA 2Q1ZB 2ORXA 5FZAA 4IEZA 4CU8A 3WDYA 2VMGA 3ZXEA 4MG2A 2FHRA 3AXEA 2BFUS 1Y9GA 1VBB1 4CCCA 2DVFA 3JZVA 3LPGA 1FAYA 4A2UA 4P00B 1WMDA 2WZR3 3IDAA 2E7QA 1OA4A 3FC0A 2E6VA 1VRH1 1WCDJ 3FE5A 3BTZA 1W3XA 3H1MA 3AYAA 3POJA 4P14A 4RS5B 1H9WA 3I2KA 4WBBA 2XUMA 1H6YA 4JQRA 5EV7A 5TSWA 4LBLA 1HN1A 4P9XA 2WN2A 2WNVC 1RUD3 3D5OA 4M01A 5DDJ3 4K8FA 5BV6A 5CISA 1VBD3 2CNAA 5GLVA 3BTAA 4LORA 5A3OA 1ASJ3 4XOGA 2VZVA 4Y4YA 3DF0A 5IJRA 5APAA 1OH4A 3WQBA 4A44A 4F8AA 1SLAA 4ZU7A 3VDDA 5A6ZA 4EN8B 2EIGA 2XL9A 3AP6A 3K2OA 4HKWA 3APBA 3RWNA 4ZKTB 4M3CB 3GBWA 2GNMA 2YZ4A 3H7YA 5L36A 4CVUA 4KWLA 4Q4Y3 3M3QA 3AYEA 2B4KA 2XBO1 4JTOA 2HWF2 2PHLA 4RGAA 3WG2A 1RVF1 3EXUA 5C71A 2VQTA 1H4HA 1ZZBA 2FCVA 2O8QA 2UURA 1ND3B 2YXSA 4Q1RA 3UGFA 1FXZA 4IV3B 2WKKA 1UMHA 3OEBA 4CUAA 3E6BA 3KSCA 2J1UA 1UD1A 1QQP1 1X9TA 3A21A 5JOYA 5L19A 5IK5A 1SLIA 1ULCA 2QQWA 5FXZA 2R062 1QKQA 4XJWA 3BUCA 3K3OA 2RS13 1H2MA 4Y5TA 4W6WA 2QTWB 1SDWA 3URFA 5A33B 3U1XA 4HBNA 1H1IA 4PIYA 3B02A 4XILA 5FYVA 5AFEA 4OCTA 1C3HA 5FYSA 4ASMB 4PIXA 2HWD3 4CCEA 4J1XA 1LOFA 2WFPA 2X10A 3W20A 1JZ3A 2KXLA 1WW4A 4FPCA 2VZ1A 4YG0A 3ES1A 2WNEA 1JHNA 5E6HA 2GH8A 2ZAHA 5A1FA 2ZX2A 4DB5A 1MZFA 4QAWA 1WGPA 3OEAA 4BXSV 4BQ2A 1XYOA 5FYUA 1B35B 1CX1A 1GBGA 1RITA 2WQZC 2VUAA 5E8AA 5FCCA 5DUXA 1O91A 1PO11 4Q0SA 4LOSA 2LW8A 3JB4C 1GR3A 1GOHA 3H9AA 3WUDA 1Q43A 4OI4A 1FOD2 1LOEA 3CJIA 4QM8A 1JZ7A 5FZIA 3MPBA 1AR71 3E1F1 5FZ8A 5KHHA 1SEFA 2Z69A 3WDVA 4ZZ8A 4CU7A 4XXPA 4E2QA 4QGLA 3IPVB 3LQCA 4CP0A 4XZUG 1AXYA 1ASJ2 1Q8OA 2VUJA 3IPVA 3JBG3 4LBNA 4A7YA 1HJFA 4HLTA 5HCFA 1XBFA 1DIWA 2BGOA 4MXWB 4CDXB 2RS31 4FPHA 1IS5A 3CQOA 3RYKA 2GALA 4CPBA 2JENA 4E8DA 1W2OA 5JOXA 2IVIB 2OZ6A 1OBNA 4EV0A 2FDKA 3V0AA 3KQ4B 4BQXA 2AEYA 5DDJ1 1CAXA 4NIIA 3VBFC 1HB1A 3HVDA 1TNFA 4HPKB 5EWSA 2YROA 2XVGA 3AP7A 3HT1A 4HPKA 2WUHA 2J1VA 3BYWA 4QGMA 4Z82A 4S2DA 4AFBA 1WLTA 5F37A 3JUUA 1PIV2 4P9JA 1XRUA 1W8WA 5DG2A 3IDEA 3UT0A 4DUWA 4I2OA 2W5FA 4CEWC 5JXGA 1OPOA 1UKRA 2J1AA 2CU5A 3FBMA 3HMYA 3WXPA 4CU6A 3ZYJB 4CXWA 3OOXA 3MV01 1D2SA 3SCGA 3KT7A 2FMYA 3A0KA 2RMU3 2VCCA 5ANNA 5FZOA 3U11A 3I2DA 4HFSA 5FKBA 1ND3C 1W0PA 1Z7S3 1ZNPA 4QKFA 2VGDA 4NWVA 2Y33A 5FXVA 2WNUA 5T3NA 1DLCA 3SHRA 3KHCA 4BQ4A 1YFYA 4BIOA 3JB8A 2JXAA 2NP0A 4UAPA 5DAQA 4AQ6A 3RI9A 1HB2A 2ID4A 3KVAA 3GF6A 3QCWA 4QWNA 3KT1A 4D3WA 4HK8A 2K0GA 2AC1A 2RMU1 4LKEA 5FZFA 3DKWA 2QQJA 1XU1A 3POFA 4BQ5A 1UF2C 4XUPA 2B5HA 1AF9A 1SFNA 4LTAA 4OULA 4ZPIA 1XJAA 2VC9A 1Y7BA 4AI2A 4Q4V3 2Q4SA 3AKTA 4YM1A 2NM1A 4DRVA 1W6QB 1UYZA 2CWMA 3NKGA 2BRTA 2HYXA 2IVJA 1H9PA 2VMCA 2YC0A 3PVNA 3ZYHA 5EJZB 3VKNA 1S0CA 1N1SA 3WNKA 3ATGA 1BKZA 2RS12 2XVLA 4OLLA 4QKNA 5FJHA 3RI8A 3S30A 3AC0A 4LBOA 1KRIA 1A8MA 1NCRC 4DZGA 1RGSA 1PK6B 3ASIA 1WW5A 5FK7A 4XFGA 5LA0A 3KM5A 3O0VA 2RR12 1O6UA 4XQ4A 5FOJB 2QUOA 1OLMA 2BV4A 1UWWA 1CIYA 3SH5A 1PO22 4YVWA 3WQ7A 4BLJA 4C1XA 1SLTA 4B4RA 2K9ZA 1V9U2 4H2AA 1RYYA 3WF0A 1J84A 1HRI1 5D1IA 2LRPA 1TNRA 3CJIB 2EAAA 1W6OB 4GA9A 2CSGA 2E53A 4LPLA 5FXXA 1WA6X 5IVBA 5J09A 5GKAC 3I2IA 1G9CA 2P4EA 4CCNA 1MZ5A 3POGA 1QOTA 4JQTA 1DP0A 1LCLA 4Y22B 3RJRA 3TBDA 3T2QA 2XG3A 4YW5A 4C90A 3ZVXA 1GANA 1XNTA 1HRV3 1ZRFA 1QNWA 1W9YA 2PN5A 4AFCA 4DINB 4DEQA 1PNFA 4XFAA 4AHZA 4A3ZA 3BTYA 4COZA 1APNA 3ZSJA 3MW3A 3SLIA 5AC91 5FYIA 5FTTC 5CG8A 1QGLA 3T4HB 3T0BA 4V1PA 2RG4A 1WD3A 3ACGA 2BERA 3RZKA 4OI1A 1QJU1 3B93A 3H8OA 4PIZA 4RFRB 1LAJA 1FV2A 2W1QA 1RUF3 4QX5A 1W9FA 3C7GA 2YC2A 2ZABA 3JD73 1AR81 5DUWA 1SLBA 1AR93 2HJIA 3TYJA 2RS32 3JCIA 3R0RA 2A75A 3ZKYA 3VBFA 3SMHA 5IK8A 2JG8A 2SBAA 3ETQA 4J6GA 2ZXQA 1XE8A 4C0HA 3FFQA 1OH3A 1RUG1 4ZXKA 4AVAA 5EZWA 3AZVA 4ORFA 4NWWA 5CBLA 1PZ7A 3ZXGA 5A3LA 2Q1MA 3H3ZA 1FV3A 3U4XA 5FYMA 3RZJA 1MVQA 2I45A 1LESA 2VBDA 4RR3A 1UY4A 2XWJB 1NA1A 5A3TA 1VBA2 4MUVA 4AI0A 4LK6A 1YI9A 5FRAA 4AEDA 1NY72 1POV1 1V6JA 3T08A 1ULGA 4BQYA 2DVAA 1H1MA 4EN0A 1G9BA 1J58A 4DY3A 3LEGA 2VULA 4QPGC 3PNAA 2P2KA 3ZYGA 5K0UC 4NAMA 4QQLA 5A80A 2OKXA 4IE6A 2GC2A 1V0AA 2EA7A 1PIV3 3VKMA 5FZ4A 3VKLA 5J7MA 3BPSA 3DUIA 1S4CA 2XQXA 1W03A 4CCDA 1GZ9A 1N3QA 1VRH3 2ZZQA 5HXMA 3LGRA 1F15A 1VRBA 2ZX1A 4FVVA 4OHVA 2D7FA 4NOTA 3WUCA 3V0AB 5T5PA 2WWSA 4K3UA 3WLUA 5J96B 1Z78A 1RTVA 2AYHA 1D7PM 2O14A 5FZ6A 2D93A 3B5LB 4SLIA 3VZJA 2A6ZA 1H1AA 4XXAA 3N3HA 2XVKA 4UF0B 3POEA 4XHXA 3KHBA 1W3VA 4META 1HXS1 4XBNA 4S2FA 5EQUA 5BPXA 1PO12 3ILFA 4LHSA 4GIQA 3VL8A 4WVMB 4M4PA 2V72A 3VBUB 3GALA 3I3DA 3VV1A 5JMCA 2TBVA 1CESA 3HN3A 2W47A 4KWKA 4PT6A 2B42B 4H7LA 1ENRA 4IUGA 4RR3C 3JD72 1NZIA 1PZ9A 3GZUC 2W52A 1GWLA 4XF1A 2OW4A 3WW3A 4A7ZA 1YXWA 5J36A 4QQPA 1JTZX 2AUYA 1VAKA 1JYIA 5FO8B 1E5HA 4WZFA 3OY8A 1D2QA 2ZEXA 1OVSA 4LHNA 5I0DA 3QH7A 2QQLA 4D6QA 3GCXA 1XPWA 4IV3A 4M0NA 5LBFA 5C8CC 1HRV2 1S0EA 2R041 2YBKA 1XSQA 1Z7S2 1X7NA 1LU2A 3NAPA 3NV1A 3CDZB 1Z7S1 1M4WA 3WQ1A 1NCRA 1YQ2A 3DXTA 1OD5A 4OMCA 4HVOA 4LBMA 5KBFA 5FZDA 1DGLA 2UY9A 3WP5A 1YO8A 2GDFA 1NKGA 2XHKA 4ZS2A 3L9JT 1WLCA 1WCQA 5CFCB 1CWPA 4J25A 4LXLA 2VW2A 4XDPA 4KI5M 3FUOA 3BN6A 3K77A 4AEMA 4HSJA 4XF4A 1PNGA 1GV9A 2WL1A 3ZFEC 1STMA 2ETEA 5FJKA 1BK1A 3J7MA 3O0WA 2NN8A 2UU8A 1OOPC 4BMBA 1C1FA 1LEMA 1LJ7A 5JXIA 2EAKA 1JYXA 3WEZA 4FPJA 2JG8C 2PQQA 4O65A 2OT7A 1TE1B 2VAUA 3M3EA 1QH6A 2K46A 4R8HA 1AHSA 1AYM2 4K40A 5F3EA 5FUPA 1UOBA 3AZXA 4N53B 1BBT2 2JIJA 4TLFA 1CD3G 4B29A 2IWGB 2R49A 5EXOA 4PBOA 3AKRA 1VBE2 3WOGA 5FMOS 4C91A 3RZZA 5LATA 1OKQA 4O61A 3IAPA 1RUF2 2VNVA 5FYCA 1UCXA 2AACA 2XMLA 1UZVA 3M8LA 4MGYE 4ZHNA 2RS51 1K45A 3USUB 1US3A 1AL22 1R091 1S0BA 3NV4A 4MADA 1ULOA 5IFPA 3CJXA 1AL21 1R092 4IQPA 3IAQA 1E5RA 1WCUA 4FOQA 2Q8EA 2W3JA 1R1A1 2WO2A 5FYTA 4COYA 5AFBA 1W05A 2R073 5JDBA 3VZNA 4JRAA 3IDBB 4IE7A 4YW3A 3VBSA 3I59B 2ZHMA 4YVSB 1HXS3 4JDMA 4RHV1 3ZFGB 4OI0A 2VCBA 2W1SA 3FL7A 4IV1A 1HV1A 1BJQA 1CJPA 1RUG3 4RS5C 4L0PA 4YM0A 2HEVF 5CEHA 5E89A 5LY2A 1CZSA 5HCAA 3LZZA 1D4M3 2GC1A 2IXKA 2OVUA 1VBC1 1Y4WA 3T2PA 4CDUA 3O1PA 1CJDA 4IEOA 4XUNA 3MIGA 4B4PA 4K6BA 2GU9A 1V6MA 3S0MA 1NXMA 1HB4A 1V9U3 4ZS3A 1RIRA 4YM3A 4Z1VA 1O3QA 4YVWC 1JYNA 1VMHA 2IXLA 5IYYA 1BVP1 3VHOA 2E26A 2VZTA 3BCWA 4EROA 3D6EA 3UYJA 1ZRCA 1TME2 3OG2A 1RHI3 1S0FA 2BNNA 1AYN2 2BBAA 2GNBA 3IIIA 2QQOA 4XDOA 2JG9A 1QJEA 1OLQA 2TNFA 2QJVA 1UNBA 2JG9B 1D0GA 1RC6A 4XE9A 3WD5A 4AW7A 4UWDA 1F4AA 4B8EA 1NLSA 3J7HA 2MEV2 3MI8A 3VHPA 3N7JA 1OF4A 4QXBA 2OPKA 5C3RA 3AKPA 4QPYA 5BNPB 5CNAA 4ZU4A 5FPAA 2WNUC 5GZDA 5KHIA 3LEKA 1NYWA 2XGXA 4G9SB 4JGZA 5J98B 5DUVA 5FR3A 1V6LA 1UU4A 1MEC3 1R1A2 1H8VA 1REDA 2DCZA 2VE1A 2D6NA 2WN3A 1YI7A 1LOBA 3DYOA 3IKWA 4ONUA 4QX3A 3RNSA 1VBA3 4LKSA 2G19A 2WNOA 4DQAA 1K5MA 1OOPB 3HQRA 2D40A 3K48A 5CIRA 2W94A 3VL9A 1X36A 4GMP3 2BZDA 2G9ZA 2HWD1 2BW8A 2CGOA 2RR11 3MDPA 4AVBA 4XAEA 5DN2A 2VZRA 2ZGUA 4IEUA 1B35A 4WV8A 2QQPA 1RMU1 1B09A 1QJY1 4LE3A 4GH4A 3F2ZA 4IERA 2UWCA 4TLGA 4DIQA 2JICA 5HCHA 3PTYA 1EUTA 1E5IA 5LBBA 3C7OA 5HCBA 5DQ0A 2V5YA 3H8RA 1ZA7A 5C33A 5K7PA 4RN5A 1WMEA 3NNLA 4QM9A 4UFJA 4RQPA 4WM8A 2BDRA 1YIPA 2BVBA 3OUIA 4LMFA 1R081 1ULEA 4GKYA 4WM8B 4FAGA 1QH7A 4N9IA 5JZGB 4I02A 3SCFA 3I2GA 1RVF3 4MYEA 1HRV1 5FY1A 4IV3C 4C1WA 4YZ3A 4LLFA 5FPUA 1COV1 2VXJA 3W5MA 4PHZA 4JRLA 5LB6A 2ZEWA 4XJAA 1DGRN 4B4QA 2NLRA 4CDQB 2J1TA 1YNAA 4EN7B 4AVSA 3MLJA 2VOXA 1SACA 4CUGA 2HEWF 1PK6C 3N9LA 4FI9A 3RG0A 4P5HA 2WZR2 1S55A 4XVHA 4PDWA 2ZGQA 3GXUA 2OQ7A 5CFDA 1AYN3 2JDNA 3I3MA 1A6CA 1VRH2 2JKBA 2R1DA 3I8TA 1KS5A 1MQTA 3ORJA 1SPPB 3PIGA 3PVOA 4XMAA 4CE8A 5JSRA 4JGYC 3P5BA 5CZKA 1J3RA 3WINE 3PU8A 4GAZA 4UI9L 2A6VA 1QWRA 3GZAA 3HD8B 3O0XA 4D94A 4CSWA 5C9AA 4WM7C 1BBT1 1BYHA 4A4AA 5LK5A 2P17A 1AYM1 1RUI2 1WMXA 2R0HA 1JZ4A 2PMWB 2JE9A 1S0GA 3DGTA 5FPLA 2D5FA 1YYNA 2JG9C 5FWEA 1RMU3 3U14A 5HV4A 1BXHA 3UK9A 3USSA 3ZYIB 4AOCA 1AJKA 1EV13 2PXJA 2QVSB 2WC2A 3POBA 1OMIA 1GQHA 1U5XA 2WJSA 5D8AA 3CIHA 3Q9OA 3JQXA 2EXIA 4JGYB 1C8M3 2IFRA 2WFF1 1DGWX 5BUVA 1ZX5A 3OBZA 3VBOA 4P9WA 1JMUB 5A70A 2WA4A 1HQWA 4QPGA 4RD7A 2W46A 4FPLA 4XETA 1CPMA 4AL9A 3WV6A 2WINB 3R4SA 4OVEA 1EYBA 1SZBA 4ASLA 1DCSA 1OF3A 2ZGTA 3T09A 1ND2B 4Q8KA 1SLLA 3LPFA 1UZZA 3MIDA 2V73A 1D4M2 1VBD2 2ZGMA 1GKBA 3P3PA 3QD6A 3QACA 2VPVA 2CYFA 2ZX0A 4KG8A 3VDDC 4AAXA 2Q5TA 2NMOA 1T6GC 2BQPA 2HH9A 3HR9A 3WF4A 5JWPA 4I0BA 2P6HA 5IVYA 3BTXA 2IXCA 5IW0A 1COV2 1ACCA 5CKQA 4XAAA 4N8MA 2C26A 4IXLA 4CUBA 3GDBA 4LA2A 5L9RA 2DCTA 4XJZA 2R6QA 1NG0A 4I0WB 5H9QA 1LU1A 4TN7A 3H7JA 3WR0A 3K4DA 5BNOB 2OA2A 2A5ZA 1JYWA 2Z2SB 2P1BA 4Y33A 3UGHA 5L9VA 3WG4A 5JZGA 2WNVA 5BNNB 2VVEA 1TMF2 5HPOA 5LRSA 2RJLA 2XB6C 2XKPA 4YW7A 3ZMNA 4D7TA 5K0UB 3O1OA 3NQHA 1RUG2 1IPSA 5FZ3A 3VZKA 2EIEA 2F6BA 5KXBA 1UOFA 4K8RB 4R52A 1DYOA 4OHZA 1W6PB 2XR4A 2CAVA 4IEPA 1W6PA 1PGW2 5KHJA 5C5TA 4H3WA 4Y1XA 1YUDA 3VD7A 2X5IB 4LKFA 3NV2A 3TN93 1DU3D 1W6MA 1LGCA 1UYYA 3B69A 4ZY9A 5CFDB 4E4HA 4RFT0 4UOJA 1KJRA 3V65A 4BE3A 3TB0A 5IVCA 1G9AA 5F6LB 2BEOA 2AZ5A 1PVC1 3AJYA 3SH4A 4ZZ5A 1NCRB 1S0DA 1SCSA 2XJVA 1JBCA 1EAH2 2ZKNA 1QJY2 4QDRA 1BHGA 4H14A 4HETA 1LKNA 5A6QA 5JR2A 1V9U1 2FZ1A 3C7EA 1JZ8A 3HJRA 1FOD3 4XTPA 3OGVA 4CEYB 3KV5A 1FT9A 2EIBA 4LJHA 4OUEA 3QLQA 1U12A 3DYMA 1K5JA 2RJ2A 2ADEA 4R9CA 1H4GA 1MZEA 1CAUA 3ROUA 1JU4A 4E8CA 3MHZA 3AK0A 3BIWE 2Z79A 3BKZA 1OXCA 4PCRA 4QDSA 5JSPA 1UW8A 2I2SA 3WQ0A 4D6SA 4ATEA 3QBQA 2HWF3 2DCKA 1RHI2 1RJ8A 3WW4A 2OXBA 1YWKA 3ZN6A 2XPJA 5LK7B 1AL23 2A3YA 1ST8A 3ZX7A 3OGRA 3VBSC 4DUXA 3WX5A 5IK4A 1DHKB 3UJOA 4E4ZA 4W6YA 3J4UH 5F7UA 1PGL1 2XONA 1Q8QA 5AVAA 4GWMA 2PELA 1UL9A 2XBO3 4Q4V2 1RUOA 3KCXA 2VOKA 2DUQA 4JV4A 5H9PA 3IMMA 2BOJA 3RRDA 1CX4A 3HPNA 2K2SA 5LASA 1H8TA 1UIKA 5DAXA 2DDUA 4D69A 2GH2A 2JKXA 4KWUA 2V4AA 4WZCA 1NCQB 3O1VA 3I3BA 3OBAA 4IE5A 2A73B 4NHKA 4Q4X3 3VBSB 2QFEA 3TEYA 2IZWA 1J83A 1NQJA 2ZACA 3ILRA 3NKTA 2VMEA 3GZEA 2XH6A 4RSUA 2HWC3 3W9AA 4AEKA 5BNNC 2CWSA 3B00A 1AX2A 4P5YA 2VQ0A 2FCTA 2ZHLA 3M70A 5JI9A 3VBHB 2WQ4A 3TEZA 4BB3A 4P02B 1CN1A 2FQPA 5JAXA 4HZFA 5JMOA 1RINA 1AVBA 5T5LA 1ZRIA 2R7EB 2VTFA 1ZBE1 1RUD2 4LBQD 1QJY3 2YBPA 4A45A 2MEV3 2X5IC 1XB9A 2ZMKA 4W50A 4CDWC 1AYM3 1V6OA 5T55A 1LNSA 3ZFFB 2Y6JA 4BDVB 5FFOC 1QDCA 2CGNA 2WT0A 1CZVA 4U36A 1FOD1 3OD0A 4S2GA 1LR5A 3NMBA 1GZCA 3OGGA 4IGPA 4MO3M 1NA1B 5FYZA 1LOCA 3WHUA 1W9WA 2W08A 1KFXL 3N9MA 2A3XA 2OUHA 1L7LA 2XJRA 4UXAA 5FY8A 2XLAA 4YZ1A 4GB33 1DQ4A 5D8AC 5ISLA 3ZLIA 1TG7A 4YRDA 1V6KA 3AMQA 3MLKA 3NNMA 4QX8A 1VE0A 3DL3A 1GWKA 3B3QE 3MEPA 4M0HA 4FFGA 4W4ZA 3I54A 4ASKA 1YRZA 4MH0E 2RJKA 3IT8A 3PUQA 2WS91 4UFMA 4IV1C 4YLZA 3ZR5A 4EWEA 3GM8A 1EUUA 1LOAA 4OQ8A 3B94A 1R64A 3CMGA 3OD4A 4WVWA 3SISA 4B7EA 2P3JA 4A41A 2E7TA 1R083 3ZSMA 1A78A 4A3XA 2Y64A 3I3QA 3NNFA 4AFDA 2RR13 5T52A 1RMU2 2MPFA 4YW4A 2C24A 3MIEA 4UBGA 4X8NA 4QB1A 1DYPA 5FP3A 4LA3A 1VBA1 4FPYA 4LBQA 3T4VA 1GFF2 4EE2A 1QMJA 2E9QA 2OQ6A 1KD7A 3BALA 3BU7A 3D3AA 2WLQA 3H50A 2H6BA 2UYBA 4L9BA 2Z5WA 3A0NA 3WZ1A 4AG4A 4ZONA 2VZ3A 2GAUA 1LECA 1WLDA 4AQSA 2R061 3UGGA 1EY2A 1MQTC 3NSTA 1OC1A 4KWJA 4QU2A 4FO9A 4MGTA 5A1LA 3KQRA 1AR92 4IEQA 5ACA2 5C5UA 3LEIA 5FBJA 5SV5A 5FPZA 2RDSA 2Y60A 3M4FA 4QPIC 4WM7A 5KXCA 4ES9A 4YG6A 2HWB2 1PGSA 3VDBA 5A3MA 4YW1A 5C4WB 4Y5Z0 4BQ1A 3GYDA 4LHKA 4PLNA 5J37A 1IG0A 5E88A 1L3JA 1VB4A 2Z4FA 5CFCC 2FBEA 2A71A 3TN91 3U10A 4A6OA 1Y9MA 1AUYA 2EXHA 4L11A 1MQTB 2VTXA 1YCIA 1H2NA 1DQ5A 4P9GA 4NHYA 3CEWA 2GMPA 3MPPG 4YGEA 3OPTA 4BMEA 4D7SA 5C7GA 3AMMA 5DAWA 4GWIA 2JEMA 1AX1A 3TRSB 1Q8VA 2JECA 3N7KA 3VBFB 3LE0A 4LEJA 4EWDA 2JG8B 3V56A 1GZWB 5IK7A 1KFUL 1X33A 4LOTA 5I8YA 1EV11 2HWC2 3DKQA 3WNPA 5L7OB 1JUIA 4DEVA 1UU5A 1UU6A 2WRAA 3FLTA 1RUF1 4KGGA 5L7OA 2DVDA 4XEZA 5H9SA 4CXYA 1Y3TA 1GU3A 3O1UA 1RUC1 2JDAA 4YFZA 2FDIA 2VO5A 3SH3A 3QOPA 1K42A 5IVVA 1QOOA 2W39A 1G86A 2PTMA 3FHIB 2QZ2A 1GP5A 1AXZA 1RUJ3 1QQP3 2D6MA 1US2A 1K5MC 2E51A 2VTXJ 2JDMA 3LIGA 3PMSA 3CZUA 3N4MA 3VUOA 1YJLA 1R082 4M4RA 3VN4A 4UW3A 4EQVA 5A7WB 3KD4A 1JI6A 4NVPA 4TSVA 1BMV2 1OURA 1LOGA 1L7QA 3MF6A 3N9NA 4Q8LA 5A7SA 1ZREA 1GMMA 2YGLA 2ZX3A 5F5AA 2XKOA 3N7MA 3LFIA 2OS2A 2WO3A 3N36A 4XC9A 1AR61 3DECA 5ABJC 1IS3A 1ENQA 4PLMA 3RPQA 2VZQA 1W28A 3I2OA 1BZWA 2DUOA 1ZZ7A 1JOPA 5FO7B 3VDCA 4DPNA 1Y43B 2CDOA 3W59A 2Y0OA 5DZGA 4C0BA 4FOWA 1HRI3 1KDMA 1JH5A 1HN0A 2PHTA 1K5MB 2XJUA 3WSOA 5JCTA 3S57A 2CGPA 2EVXA 2YG0A 4NUBA 3JU9A 2KD7A 3SCHA 1Q56A 1ZZ9A 3I59A 2VM9A 3KGLA 3LDKA 3BB6A 3EJKA 1A34A 4QX2A 2FZ2A 5FMOL 2UY8A 2ERFA 4YVWB 3RMYA 1FATA 4DUVA 1DGRA 3CLPA 4UW5A 4JDNA 5FMCA 4Z2AA 1G7YA 4LBQB 5LY1A 1CGPA 5FY9A 3P1IA 2VVFA 4CEWB 3B01A 2ZGNA 3HAGA 1W90A 2VH9A 1QEXA 2MEV1 4FXGB 4DXZA 5C3SA 1OQ1A 1NXD1 2WWJA 2YUEA 4E2SA 5JR7B 1XNBA 4MGKE 1IGOA 2KM2A 4BJ0A 4NAOA 4LR4A 3IDCB 4K7JA 4XFIA 5A33A 5A32B 3GGLA 3I7DA 3KF3A 4FPKA 4M3CA 3GZTB 2B7YA 2XJPA 3THPA 3RZGA 3ES4A 1RUC2 1SLCA 1W8HA 2JDUA 4GJYA 1ENXA 1GYKA 2ARAA 4HKLA 2SLIA 3M3CA 1ZRDA 1FPN2 3PJYA 1WW6A 2J22A 1MEC1 4BXFA 3D0JA 3RVHA 1PHMA 4LQRA 4Q4W3 2R043 2NPIA 2ZZJA 5F2SA 2DCYA 4Q4W1 4INDA 1MR5A 1IQAA 3FFZA 3IB3A 3FHQA 1ZZ8A 4HSLA 1YHFA 4XFHA 1YEWA 4QXCA 1EAH1 4GWNA 1AR62 1PO21 1IPKA 4JHZA 1PVC2 3WF3A 4EZ4A 1REEA 4D0QA 4Z07A 2WFF3 3GNEA 2OUJA 1NAEA 2B9VA 1O5LA 1XE7A 3MIFA 4P08A 4MSVA 5JVVA 5FWJA 4B7KA 1ENSA 4Y1ZA 3WNLA 2YPDA 1HV0A 3KT4A 1PO13 4V2VA 1LHWA 4UYBA 2ZGPA 2C4XA 3LFMA 2DU1A 3ZYRA 3WDUA 4GB32 3BIEA 2J1RA 3C2UA 3NO8A 3HEIA 4LO7A 1WBFA 2FD8A 2PFWA 4LULA 4AGRA 5L73A 4OUSA 2ZHKA 3H3UA 2Q0AA 4QB6A 2ZBJA 4ZXEA 2PLV3 1GNYA 1XE0A 2RVAA 3I2JA 1JOBA 1GP6A 3PVBB 5FZLA 5GZCA 1Q5OA 3AL6A 4QMAA 5J3UA 5CFDC 1LODA 1W8ZA 1CAWA 4KNCA 5ABJB 1UN1A 4W6XA 4N53A 2ZGKA 3OF1A 2BYVE 5CKMA 3H0OA 3VLBB 4YFWA 4GMP1 2VJXA 5C4WA 4Y1YA 1LGNA 3JBG1 1JYTA 1MVEA 1IKPA 2RDRA 1R1ZA 4FTSA 3RZLA 1C28A 2XUEA 4I01A 3UKVA 1QJX2 4UT5A 1O7FA 5AVPA 3H8UA 3LIHA 1OVPA 1QJX1 3VKFC 1I5PA 3S5AA 1S2EA 1BCXA 2BOIA 1DLLA 2ZPXA 1OA2A 5CB7A 1H8TB 3EQEA 2WR9A 5I8TA 1YFUA 5FZ9A 5FQ0B 2D43A 2E33A 5B2GB 1CVNA 1SMVA 5EIYB 1RUI1 1O3TA 5T50A 1CAVA 5F9TA 1N3OA 2CDPA 4FXKB 4HMZA 4N7IA 4HK9A 2N7GA 4CDWA 2Y6FA 5FP7A 3RMXA 5DABA 3INAA 4NPLA 4Y1UA 3W5NA 3E5XA 3WP4A 1ZVFA 4QKDA 3WY6A 5JXHA 4N43A 1IOAA 1XSRA 2NYYA 4XUOA 2Q30A 4BWOA 4M3CF 2ILMA 1DQ0A 1RUD1 3ALQA 3KMHA 3KV4A 2QDNA 1AR83 1J1LA 1BEV1 3BPZA 3DPRB 4HOOA 5K0UA 1UOGA 4BH9A 5GZGA 3O1SA 2D3RA 1LEDA 2VNGA 1SFPA 5A6XA 3OPZA 3QH6A 2PAMA 2LTNA 3C7FA 5IAVA 3ZFEA 3VBUC 1I1EA 2NZ9A 3O7OA 1MS4A 1RUH2 4LIVA 3LB9A 4KQ7A 4OHWA 1WZXA 2P37A 2WIIB 2FDFA 3N9QA 1R093 2DVGA 4JKLA 3RFRA 3A23A 1Q8PA 2XJSA 3AKQA 3ZSEA 4PDWC 4D7YA 4EJRA 5IATA 1MZ6A 1NUKA 2YU1A 3ZXFA 3DPRC 3MUY1 1QJU2 4GD4A 3I49A 5J48A 1DGWA 3BODA 2WS93 1V6NA 3D0SA 3WW1A 2NQYA 4MV2A 4XPVA 1QHDA 5BY5A 4E4DX 4IGOA 1UZWA 4OUMA 1QNYA 5F6KA 5T5OA 2HWE1 5GZEA 1EPZA 2IUWA 2XLGA 1Q8SA 4PLOA 1YFXA 4P9IA 1Q3EA 2D6OX 5JSOA 4UFIA 4TZDA 3OPWA 3UETA 3KCCA 2PHWA 4LUKA 4DFSA 1HLCA 3IIAA 4OI2A 5KC5A 2WSVA 4CP2A 3S7EA 3RQ0A 4CP9A 5A7PA 1SBDA 2VW1A 4AI9A 1ASJ1 2B9UA 4AWDA 2PAKA 5JPNB 4O9GA 1IG3A 1ZM1A 1H30A 2YHJA 1TME3 1NA1C 3POWA 4NHXA 2WT1A 2ZHNA 1HKDA 4Y20A 4AVTA 4FTBA 4DXTA 1HRI2 1YLLA 5JUVA 4OYUA 3CU7A 1VPHA 4YYOA 4FOVA 3AXDA 5GJ6A 4BIFA 1T2XA 4FPEA 4OMDA 3D4KA 4AQ2A 5C3OA 1VLNA 4AI3A 3ZN4A 4LHLA 2WNVB 3ELNA 4NJ4A 4NMIA 3WP6A 5BNNA 5I0SA 1BK0A 1G6NA 2DTWA 4L97A 4XYXA 4AHYA 1J1TA 5T5JA 1AYN1 1BBT3 1TEIA 3WW2A 5FZMA 5IHRA 2RHPA 3EHKA 3KZ4C 5FZBA 2W95A 1O4YA 4QPWA 5AC92 2ZMNA 5A3NA 2VBPA 4N90A 2PA7A 1DYKA 2LM3A 3UNPA 1KDKA 2JE8A 3J7NA 1XNDA 1NCQC 5FZKA 4HKOA 3E6DA 4GB31 2R1BA 3UJQA 4LLOA 3B9IA 5C8CB 5LZ6A 4JHTA 1DDLA 1COV3 1ULPA 2IXJA 2P3KA 4CEYC 5FXWA 2ZGRA 2WT2A 1JS9A 2WQ8A 3LCPA 1OFSA 4YZ4A 1POV3 5D21A 4EZHA 2DFCA 3N9OA 3MW4A 4QXKA 4QX7A 3KGZA 3UL2A 2ARCA 1KEXA 4QPGB 2GN3A 2AH2A 2D6PA 3Q8FA 4HN0A 3TNQA 3ZSLA 3LWCA 2DWRA 1CQ9A 3BOWA 2BFUL 1C5IA 5IVJA 2PAEA 2VL4A 5CFCA 5F1RA 4G4FA 4XZPA 2D3PA 3BGAA 3VBRB 4ARXA 4M3CE 3UKNA 3FLRA 1NLRA 1HX6A 4AR2A 3BU0A 5JIUA 1G9FA 2W68A 2ZMLA 3GBGA 4CDXA 1TQ5A 3UV9A 1KJLA 1VB2A 3LOBA 4QD2A 4LUMA 3THDA 3W21A 4AQTA 1ZBA2 3ZDSA 4CCMA 4CRQA 4DY5A 5FMDA 1OUSA 3NNGA 3KLSA 5JIAA 1WA4A 3LAGA 3M3OA 4NRMA 1F2NA 5ERLA 2YBSA 1VP6A 3POYA 4NRQA 5FZEA 5A1AA 1IKQA 3I97A 4BQWA 4J1WA 5ACA3 3PURA 4MGSA 5BNPA 3A4UA 4LO5B 1BMV1 1UX6A 2V4VA 5F3CA 5C70A 1O3SA 1C4RA 4COUA 3VZMA 4L8QA 4P9YA 1JXNA 2JJ6A 2RS33 2VCAA 5EYXA 5LEKA 3ETPA 5LEJA 1O3RA 2G9GA 5I0UA 4HVRA 3U07A 5BNOA 3LSEA 1AR63 5I91A 4AFAA 4MHRA 3A22A 4LE4A 2ZOEB 2QQKA 1WWYA 2UWBA 2XWBB 1CIWA 4MXWA 4A6SA 4YM2A 4AXOA 1BEV2 2HWE3 1YQ8A 1JN2P 3MBWA 2GZWA 4L2NA 2VVDA 4QX0A 2WDBA 1WW7A 1W8OA 5FV3A 4FTEA 1AR73 1YQ6A 4XUTA 3VBHC 5A7QA 2VMFA 1YIFA 1IPJA 3ZFGA 4UF0A 2HBTA 4QB2A 4QXHA 1J3QA 2Y34A 2G9FA 1UPIA 1N3PA 2ARXA 1RL3A 4HG6B 4FQ4A 1ODNA 1RUC3 2EXJA 1NZCA 3MLLA 3OB8A 3ZIWA 2BUKA 4YARA 1OKOA 1HIXA 3ZO0B 1X8MA 2ZX4A 4IL7A 1FPN3 2W87A 3M3IA 4BLIA 1S0IA 1NE4A 1X8EA 1WCSA 2A6WA 3IMNA 3I3EA 1GOFA 5GZFA 4EYUA 2XBO2 1ZZ6A 3NNJA 2GP3A 4COWA 2X29A 2PHXA 2WSUA 1QJU3 4W65A 3E6CC 1PMJX 4IEVA 3VB9A 4N9HA 4RGGA 5HV0A 2QDRA 1SG3A 3MF9A 4XCAA 4XIOA 5FPBA 4XQDA 4S2HA 3ZFEB 2ZCWA 2B39A 1OOPA 1ZBA1 5LBCA 3HNBM 2O1QA 4WM8C 5FYBA 1FPN1 5FZGA 2FDHA 1VALA 1PK6A 4GULA 3VD4A 2W1UA 2GMEA 3HN1A 2X5IA 1AX0A 2RS11 1H2LA 5C8CA 4YGBA 1HDKA 2GMMA 2YGMA 5DPNA 1LHNA 4XFCA 5DUUA 3T2OA 4FBFA 1B35C 1DF0A 3EB7A 4Q0VA 1H2KA 4R4ZA 3ACIA 2OYZA 3RWKX 1ULDA 1NLQA 1OLRA 4FP2A 5G04L 4TWTA 2JIGA 1UY3A 3SEEA 4FFIA 2C5DA 3ZXAC 3T2TA 1W6NA 3LSDA 2GNTA 3CBNA 2A70A 3HOBA 1W6OA 3L2HA 2VMHA 3BI3A 4CEYA 3AZYA 1LTEA 4NHMA 3O1MA 5I0RA 4JCKA 1QXJA 3MIBA 1D4VB 2TEPA 4PQ9A 3J9SA 3CNAA 4Y22A 4AF9A 2VG9A 3NVCA 5I8SA 1NT0A 2C6SA 2LUWA 2VUDA 3O12A 1WUVA 2V09A 4X6RB 5FZ1A 1AR91 3ZYPA 2HWE2 4IDZA 1W9TA 5FAXA 5HI0A 5K8SA 1VJ2A 3R05A 1AR72 3H42B 1LOFC 4HONA 5FUNA 3SC7X 1RUH3 2BGPA 1F35A 4QDQA 1VBB2 3WCSA 2GSYA 2WYSA 2BNMA 4XJ8A 5SV8A 2WZR1 1FMD2 1SHWB 4XHBA 2R071 4SBVA 3I2HA 4AYUA 4AHXA 3O1RA 3KV6A 3POSA 4U2AA 5LA1A 4IETA 3J8F2 2VOWA 3OCPA 2FDGA 4TYSA 5FY7A 3AMNA 1A8DA 4CDUB 3KB5A 2AREA 2VZOA 1U0AA 4XW3A 5FZCA 3CHXA 1JYCA 3ECQA 3KVBA 4NPMA 1BVVA 1EAH3 4BK4A 2WS92 5G05L 4DRRA 3OUJA 1JW6A 2EIDA 4IW3A 2OIIA 1KQRA 3TEWA 4I30A 2PHDA 4RHV2 4YGDA 3RJ2X 3DXUA 1UYPA 2D98A 3C7HA 4FP3A 1RXGA 3OTFA 2HWB3 1DBNA 2E63A 1WMFA 2UYAA 1QXRA 1LGBA 2JB8A 3FWEA 3AZWA 4UW4A 3FBYA 2CY6A 5FOBB 4PBPA 5F32A 4DOUA 1WLWA 4RQPC 4YZ5A 2RV9A 4E2GA 1SQ4A 3DPRA 4WVVA 4CDXC 4AEDC 5CKNA 2XJTA 3FLPA 1O8SA 3WDTA 4YZ2A 3AP4A 3MGUA 3NJXA 3BOPA 3UESA 1DFQA 1POQA 5LA2A 1SDDB 1PX4A 2IXHA 1TME1 3PUHA 5EP9A 2VQUA 4QT6A 1SFYA 4CCKA 1OD3A 5FPVA 4HXCA 5JOZA 3EO6A 1U5IA 4R9DA 5KHGA 2XJQA 3WHTA 4YW6A 4URAA 5ANQA 1UO9A 3R6SA 5KR7A 3RSJA 2DTYA 5CG9A 4ES8A 4JDOA 1W2TA 1UY0A 1MPXA 3IBMA 1NE6A 3NJZA 5F3IA 3CKHA 1GICA 3T0DA 4OHYA 4Q0QA 3S5QA 3J8F1 4AEDB 3VBOC 2EXKA 4PF5A 2JDPA 3VKOA 2Q8DA 4F83A 2RE9A 4O7XA 2QQVA 1ND2C 2XOMA 1XOYA 2JDKA 4E9KA 2WAOA 4JGZC 1JZ2A 4ITCA 1W8UA 3JXSA 2UWAA 1LHVA 3B9CA 3E5QA 4PF1A 4HVQA 5LCWL 4R9AA 3VDDB 2IFWA 5CU1A 3NJVA 3X29B 2BU9A 4KG0A 4YPJA 2JWPA 5A3PA 1VBE3 1N1YA 1VR3A 3HBZA 1ZZCA 3U0ZA 4FCAA 2F4LA 5H9RA 3M1HA 2FDJA 1PM4A 2YMZA 4UBHA 1QIQA 2W91A 4QQHA 4XIKA 1UY1A 5IT6A 1HJGA 2WO1A 3F95A 2F4PA 3AP5A 4KU8A 4K21A 4QHZA 2BJSA 3OY8B 3U78A 2JDHA 3HQXA 4Y20B 3WP3A 1IHMA 2ZGLA 3LD8A 3PIJA 4CZSA 2JD9A 5JLVA 3MUZ1 3PUAA 5FKCA 3VZLA 3ZXLA 3IN9A 4PDWB 1MS0A 3RS6A 5BNOC 5JPMB 3AYCA 1BEV3 1MS8A 2D6LX 4GXLA 2YDEA 1UZYA 4CDUC 4Z92B 2YFZA 3LDBA 4LNVA 4DO0A 2QNKA 4Q26A 3GHMA 3LA3A 1UYXA 3Q8AA 2JB4A 2GP5A 2QQUA 2ZKLA 3MFCA 5GALA 3TOJA 4X8PA 4AGGA 3ILNA 3T30A 2W9XA 1W8TA 4BQ3A 3AP9A 2I07B 2YV8A 4KU7A 1GOGA 4HT1T 1NX9A 1VBB3 5K4LA 1UMIA 5FY0A 3IM0A 2A6YA 3WG3A 2DUPA 4UFLA 3A7QA 2BPA2 1LULA 1UXXX 2W92A 1ND3A 2P3IA 5C3QA 3AKSA 3MW2A 2YYOA 3T0AA 1UXZA 3CJIC 2R072 3OGJA 5FREA 1BQPA 3UKTA 3PUIA 4AHWA 1XYPA 2AGSA 2VD7A 3WNNA 3NV3A 1XXNA 3OUHA 2F17A 4K20A 3RGBA 1YJKA 4OZOA 2P3YA 2Q8CA 3SITA 5C9AB 2A6XA 3GJAA 4NN0A 3I4IA 5FZ7A 5FO9B 1W39A 2GC0A 2RMU2 4MGZE 3VD9A 4Q0UA 2R30A 4GMP0 4DMIA 1JZ5A 2ES3A 2BGCA 1GSLA 3GHNA 1VAVA 1AXKA 5F39A 2QE3A 3CZJA 3ENRA 1PVXA 3NL1A 5CYYA 4CU9A 5GM0A 2QQMA 2RM22 2XXZA 3Q8CA 2RS52 4LKDA 1ZYBA 1NCQA 1WD4A 2GC3A 1S2KA 3M2MA 4LBJA 3R4DB 3OYWA 2W2IA 4NE9A 4NROA 1XNAA 5DZEA 3VBOB 3WNOA 4XDQA 3OYWB 2DF7A 3BVCA 5DZFA 1MS9A 1QQP2 4KL1A 5FP9A 2E32A 5CVRA 5EPAA 2XL7A 2FCUA 5KXDA 3WG1A 4FPFA 2GN7A 5AC93 3SKVA 1V00A 2J7MA 1O4ZA 3NAPC 2E31A 1C57A 1MS5A 4HL0A 4ET7A 3H8XA 2WABA 3T3YA 2VU9A 2X8KA 1TVGA 4QGNA 1RUI3 2WAAA 1GP4A 5IWFA 1H6XA 3FMGA 2Q1FA 1XNCA 2HLEA 1W2UA 1VMJA 2J42A 2MHFA 5FZHA 2LS6A 5FZOB 4OFGA 3KS7A 4KBZA 1NY71 4O9EA 1L7RA 3O5SA 3ZKUA 1F5FA 1PO23 5E1RA 2ADDA 3H3LA 3OBRA 4IESA 3PTRB 2D3SA 3G6JB 5CA6A 4QPIA 5B4XA 4XUQA 2PHRA 1GWMA 3HNMA 4IV1B 1UQXA 1VBD1 1XNKA 4JKMA 5ACA1 2IXIA 3O14A 4P9LA 1Z0HA 2YY1A 4YVSC 1W2NA 3ZFGC 2DURA 5F2WA 4AI8A 5B4NA 3VBHA 3KCYA 1S1AA 2ENRA 1UAIA 1GNZA 1MS1A 2V5DA 3ABZA 3K51A 2HWD2 4FT8A 2D6KA 5DXDA 3VBUA 4A42A 4JAAA 4AE2A 1FMD1 3ACHA 2O0OA 4KGQA 4MGIE 3TNPB 1F4HA 4ZU5A 2EALA 2I74A 2XHNA 1AL0G 1RVF2 3SXWA 1FMD3 3WVJA 1POV0 3ZR6A 4NIGA 2WFF2 2YC4A 3MZHA 5F5CA 4JZRA 2C9AA 3ZFFA 4IGQA 3ZYBA 2KR2A 4MZUA 5DG1A 1UX7A 1OUXA 3CF6E 4FQZA 3FZ3A 3THCA 4E27A 3K3NA 5FIXA 1FI2A 2RDQA 3EBRA 1PMIA 2FMDA 4R9BA 4XURA 4N7UA 1G9DA 1W6MB 4Q4W2 2CAUA 2WBKA 1EV12 2CV6A 2HWC1 2OZJA 3FJSA 2VZPA 4NO4A 5BYNA 4NIDA 4BHPA 1D0HA 3N35A 1YFWA 2VBBA 2LROA 4FFFA 4YGCA 3VGIA 1J3PA 1OLME 1PIV1 3N7LA 3K4ZA 3PU3A 3R4UA 4QU1A 1J59A 1IZ3A 2R0FA 1W6NB 3OBTA 3PHMA 2AENA 3ZDVA 1W6QA 1F5JA 1OQDA 2VQAA 3EYPA 1REFA 3K4AA 4N53C 4NRPA 3WNXA 4UW6A 4LT5A 4QQ2A 1WKYA 4XBLA 2D5HA 1TMF3 3DEMA 3ITQA 3ME2A 1PM7A 2WYFA 2EF6A 5FP8A 1H0BA 3VBRC 3AJZA 3ST7A 3P6BA 3PLQA 3K75B 4I09A 4QX1A 4OHXA 4FFHA 2DBIA 3VZOA 5JI7A 4BU2A 4CDQA 4JTNA 1PZ8A 2XQRA 3CO2A 1K3IA 1RUH1 2WO7A 3NJYA 3ZSKA 2BVVA 5CADA 1CAWB 2PHUA 2CTVA 3Q8BA 1CONA 1VIWB 2DU0A 3VHRA 4B1MA 1PGL2 2VECA 4CXXA 3AVRA 4PJYA 4FOYA 5C6CA 5IAXA 1SPPA 3EMRA 1GQGA 3AZZA 2DYCA 3W58A 1OA3A 2B8MA 1KITA 1SCRA 4GWJA 3FN9A 3SQOA 1W9SA 4KH9A 2DVBA 3E97A 2H0VA 1PVC3 4GQ7A 3ZXDA 3CL1A 1YC61 5FQ0A 4Z8BA 3AX4A 5HXVA 1RJ7A 3ON7A 3ZMOA 4BPZA 5FY5A 2DCJA 4GJZA 5DDJ2 5EFUA 2X05A 4UFHA 1URXA 3SKJE 1OQEA 1JUHA 5FMBA 3NWKA 2O8OA 4Y3OA 2D44A 4YVSA 5FBZA 1Y9QA 3DCQA 3RZHA 4C8DA 4MXVA 2ZAAA 5D8AB 2RS53 3B7MA 4PI0A 2EICA 4WVZA 2P6CA 2J1EA 4UFKA 3T1LA 5KHKA 3ZPOA 4G3YC 4Q4Y1 5EYYA 2DV9A 3VD5A 3WCRA 3WF2A 1T6BX 1F9KA 5BNPC 4RA0A 2BNOA 1OFNA 4Q27A 3V0BA 5L7OC 1GNHA 4CCJA 4AI1A 1OSGA 1GQPA 1W8FA 4YW2A 1DZTA 5LRRA 3TAYA 3ZIXA 5JOWA 5L9BA 3SEPA 1D4M1 3GCWA 4KBBA 3USUA 2W0XA 3ZPYA 1VBC2 4M00A 4R4XA 2JX9A 2Y6HA 3AM2A 5M0TA 1IS4A 2VY0A 3KV9A 3WT3A 1DQ1A 4HN1A 5EJ1B 4FPOB 4X6QB 3PJQA 5KXEA 1C8M2 3U75A 4RS5A 4AAPA 1VMFA 4AVCA 3D8CA 4I3PA 1QF3A 1FYUA 1UKGA 1V70A 5BXXA 1IS6A 2ET7A 2X09A 5EHDA 3NRUA 4I0AA 4RHV3 4WVMA 3O1TA 4L99A 3N9PA 4JC1A 2ZEZA 1PGW1 4RQPB 2XLFA 3AFKA 3AYDA 2LALA 5LW9A 2DBNA 3H1YA 2VOTA 4MVTA 1RUE1 2Y6GA 5JZGC 2QBXA 4NIAA 5GLTA 4PQQA 2QQNA 1E57A 3HIFA 4XTMA 4OQ9A 4AGVA 1W04A 5A7OA 1VBE1 2VXRA 1FNYA 2AR6A 1XC6A 2ET1A 3E5UA 2BP6A 4Q29A 1UIJA 3I2FA 2RM21 2WNUB 3VDAA 4GALA 2Y8KA 2QZ3A 3C3VA 1G8WA 5T54A 4LK7A 4FAHA 4AVVA 2A1XA 1I6XA 4CCLA 2WZEA 4Y1VA 3U4SA 3C8XA 5HBAA 4QKBA 1XQNA 4Y4RA 1SBEA 4AFMA 4RYDA 2X53S 3GJBA 4Q4Y2 1DZRA 3DN7A 4CEWA 1QOSA 4LIUA 3FHAA 2HBUA 3PUSA 3ZYFA 5GLZA 3LKJA 4AEJA 5CAZA 1PMHX 1WCKA 1X9PA 1BLZA 1DZQA 1NOVA 2VZSA 2E7AA 5A6YA 2Y0IA 4JGZB 4V2WA 3D82A 4TXWA 3H1WA 5F3GA 1DQ6A 2YPJA 4N43C 3HT2A 4MOAA 4XJUA 2BBVA 4BM8A 4BZ4A 1MS3A 2Q8OA 4JVAA 3DYPA 4IEYA 1MACA 2VZUA 3OJBA 2CL2A 4W8JA 5BNQA 1XYNA 1P8JA 4WM7B 2OX0A 4F3JA 2XDVA 4XF0A 4Q5OA 5D2AA 4BA6A 1ULFA 1HB3A 1W0NA 1YQCA 2P34A 5LWBA 5FLJA 2PQSA 4ATFA 5FYHA 3AFGA 1WBLA 5DAPA 2CHHA 1U5YA 1CAUB 4XMIA 4CP1A 1N1VA 2Y6KA 4NHLA 4YG3A 3TN92 1UOJA 4LO6B 3MO4A 2WA3A 4GZ9A 2QKDA 4Q4X1 1TZOA 1C8NA 4GKXA 4FPGA 4F7ZA 3THTA 1O59A 2P5BA 2RM23 2VOVA 4L92A 3LA7A 5GLWA 1K12A 3U37A 3RZMA 5KC6A 1ODMA 2HWB1 3MIHA 4CDQC 3HWJA 5C4WC 1GZWA 5FYYA 2A7AA 4LITA 4BOWA 4COVA 4K1YA 3JQWA 1W0OA 2HEYF 1C1LA 2YU2A 4TTGA 5IUQA 1LHUA 2HWF1 2VNOA 4XQWA 4QHOA 2L9LA 2ZTNA 2Y26A 1F31A 1S0JA 2VUCA 3HBKA 2ZS6B 2RDNA 1F8VA 5I93A 4MGQA 1C5HA 4XCBA 1UY2A 4K9SA 1UPSA 1ZBA3 1GUIA 1ZA4A 4Y5SA 2J1SA 3LDRA 5DMYA 3LEMA 2ZGSA 4IEWA 5F8PA 2BTVC 5A7WA 3ACFA 1LENA 4BK5A 2BWCA 1RB8G 1UMZA 1LHOA 1VBC3 5EJ3A 3P3NA 4CA9A 5C9AC 2W1WA 4ISRA 3ZM8A 1ZRRA 2G1MA 3KF5A 1I3HA 1JOJA 1KGYA 4IE0A 1H8TC 5DAVA 3MYXA
chains in the Genus database with same CATH topology
2VMIA 4URTA 5A32A 1OHFA 1QU0A 2C1FA 3J26N 3NW4A 2ZA9A 1I5ZA 3RMYA 1CAVB 1QY4A 5FLHA 1A3KA 4IEXA 1RUE3 1ZBE2 4Q2FA 4XF9A 1SBFA 1X82A 1QXPA 5FPXA 4BCUA 4I3GA 2B45X 4EN6B 4JGYA 4Q4X2 1N1TA 1RHI1 3DV8A 4RR3B 3FX3A 4BYYA 3GBFA 4ISQA 4NR1A 1HW5A 4N43B 1KS4A 3M7AA 3MICA 4XBQA 1AJOA 1RUJ1 4XF3A 3RYPA 1OPMA 1S2BA 2MNGA 3JBG2 2R16A 2HYKA 3NAPB 4LBKA 2IC1A 1EP0A 1LRHA 3J8F3 1O5UA 4LO8A 4QQOA 4Z2WA 2PLV1 3G7DA 2VW0A 3VHNA 1DG6A 2R32A 3ACLA 1VAMA 4A7KA 2JE7A 1XU2A 4Q0PA 4EWAA 4MLOA 3ZFFC 1I9RA 4OZXA 2HKXA 2PYTA 3JD71 4HANA 2ZJCA 4LO4B 3PMEA 3TWIA 3WDWA 4GH4C 1M06G 1X50A 1ONAA 2Z42A 4Y24A 1DQ2A 5ABJA 3AMHA 3ZN5A 2GNDA 4AK3A 1MEC2 1R1A3 1RUNA 2PHFA 4Q1PA 2H6CA 3L2YA 1CR7A 2DFBA 1QJX3 3FUQA 2D97A 4YSFA 5C8WA 5K9YA 3ZXJA 4MX3A 1QJZA 2R063 4Y26A 2JDZA 1HXS2 2BWAA 2VNRA 2QCSB 4GH4B 5KWRA 1QDOA 1RUJ2 3LA2A 3MFAA 1RUE2 1ZBE3 2ARBA 1CAXB 1V6IA 1C8M1 1HQLA 4CYDA 3RDIA 1GLHA 1FNZA 3IWZA 4QHBA 3LOIA 2NMNA 1AR82 2G4IA 4H7MA 1NQDA 1HQNA 4EN9B 2WLPA 3V64A 3VBRA 3WDXA 2H0BA 4RL7A 1O4TA 4K1ZA 2A3WA 2TUNA 5E16A 2KA3A 4XJ9A 2R042 4DS0A 5FDBA 2WZPP 1N47A 1TMF1 4CDWB 4Q4V1 5I0TA 4QPIB 1OI6A 2PLV2 3AMPA 2B46X 4FSJA 2JD4A 2Y38A 4B3NA 4CTEA 4DNYA 4NPRA 4YNIA 4XFBA 4E4SA 3RYRA 3ZN6B 1CPNA 2C0ZA 3ZXKA 1KXGA 3PVEA 3AB0A 3S6PA 3SNMA 1EPWA 3S7IA 1U5ZA 5FLIA 1FX5A 1ND2A 4H55A 1ALYA 4XFFA 1AZDA 3V0BB 5GLUA 1LB2A 2ATFA 2ZGOA 5F5QA 2Q1ZB 4IEZA 3WDYA 2VMGA 3ZXEA 2FHRA 3AXEA 2BFUS 1VBB1 2DVFA 3JZVA 1FAYA 4A2UA 1WMDA 2WZR3 2E7QA 1OA4A 3FC0A 2E6VA 1VRH1 1WCDJ 3FE5A 3H1MA 3AYAA 4RS5B 4P14A 1H9WA 4WBBA 2XUMA 5EV7A 4JQRA 5TSWA 4LBLA 4P9XA 2WNVC 1RUD3 3D5OA 4M01A 5DDJ3 4K8FA 5BV6A 1VBD3 2CNAA 5GLVA 3BTAA 1ASJ3 4XOGA 4Y4YA 3DF0A 4F8AA 4ZU7A 1SLAA 3VDDA 4EN8B 2EIGA 2XL9A 3AP6A 3RWNA 4HKWA 3APBA 4ZKTB 4M3CB 3GBWA 2GNMA 2YZ4A 3H7YA 5L36A 4KWLA 4Q4Y3 3M3QA 3AYEA 2XBO1 4JTOA 2HWF2 2PHLA 4RGAA 3WG2A 1RVF1 3EXUA 1H4HA 1ZZBA 2O8QA 2UURA 1ND3B 2YXSA 4Q1RA 1FXZA 4IV3B 2WKKA 3E6BA 3KSCA 5IK5A 1UD1A 1QQP1 5L19A 5JOYA 1SLIA 1ULCA 2R062 1QKQA 4XJWA 2RS13 1H2MA 4W6WA 1SDWA 3URFA 5A33B 4HBNA 1H1IA 4PIYA 3B02A 4XILA 5AFEA 1C3HA 4ASMB 4PIXA 2HWD3 4J1XA 1LOFA 2WFPA 2KXLA 1WW4A 4FPCA 4YG0A 3ES1A 2WNEA 1JHNA 2GH8A 2ZAHA 2ZX2A 4DB5A 1MZFA 1WGPA 1XYOA 1B35B 1GBGA 1RITA 2WQZC 2VUAA 5E8AA 5FCCA 5DUXA 1O91A 1PO11 4Q0SA 3JB4C 1GR3A 3H9AA 3WUDA 1Q43A 4OI4A 1FOD2 1LOEA 3CJIA 4QM8A 3MPBA 1AR71 5KHHA 1SEFA 2Z69A 3WDVA 4XXPA 4E2QA 4QGLA 3IPVB 4CP0A 1AXYA 1ASJ2 1Q8OA 2VUJA 3IPVA 3JBG3 4LBNA 4A7YA 4HLTA 5HCFA 1DIWA 4MXWB 4CDXB 2RS31 4FPHA 1IS5A 3RYKA 2GALA 2JENA 5JOXA 2OZ6A 4EV0A 3V0AA 5DDJ1 1CAXA 3VBFC 1TNFA 4HPKB 5EWSA 2YROA 2XVGA 3AP7A 3HT1A 4HPKA 4QGMA 4AFBA 4Z82A 4S2DA 1WLTA 3JUUA 1PIV2 4P9JA 1XRUA 5DG2A 3IDEA 4I2OA 4CEWC 1OPOA 1UKRA 3FBMA 3HMYA 3WXPA 3ZYJB 1D2SA 3SCGA 3KT7A 2FMYA 3A0KA 2RMU3 3U11A 3I2DA 4HFSA 1ND3C 1W0PA 1Z7S3 1ZNPA 2VGDA 4NWVA 2WNUA 5T3NA 3SHRA 1YFYA 4BIOA 3JB8A 2JXAA 2NP0A 4AQ6A 3RI9A 3GF6A 3QCWA 3KT1A 4D3WA 4HK8A 2K0GA 2RMU1 3DKWA 1XU1A 1UF2C 2B5HA 1AF9A 1SFNA 4LTAA 4OULA 1Y7BA 4Q4V3 2Q4SA 3AKTA 4YM1A 2NM1A 4DRVA 1W6QB 2CWMA 3NKGA 2YC0A 1H9PA 3PVNA 3VKNA 1S0CA 1N1SA 3ATGA 1BKZA 2RS12 2XVLA 4OLLA 3RI8A 3S30A 4LBOA 1KRIA 1A8MA 1NCRC 4DZGA 1RGSA 1PK6B 3ASIA 1WW5A 4XFGA 3KM5A 3O0VA 2RR12 4XQ4A 5FOJB 2QUOA 3SH5A 1PO22 4YVWA 3WQ7A 4BLJA 4C1XA 1SLTA 4B4RA 2K9ZA 1V9U2 1HRI1 5D1IA 3CJIB 1TNRA 2EAAA 1W6OB 4GA9A 2E53A 5J09A 5GKAC 1G9CA 1MZ5A 1QOTA 1LCLA 4Y22B 3RJRA 3TBDA 2XG3A 4YW5A 4C90A 3ZVXA 1GANA 1HRV3 1ZRFA 1QNWA 2PN5A 4AFCA 4DINB 1PNFA 4XFAA 4AHZA 4COZA 1APNA 3ZSJA 3MW3A 3SLIA 5AC91 5FTTC 5CG8A 1QGLA 4V1PA 1WD3A 4OI1A 1QJU1 3B93A 4PIZA 1FV2A 1RUF3 4QX5A 2ZABA 3JD73 1AR81 5DUWA 1SLBA 1AR93 2HJIA 3TYJA 2RS32 3JCIA 3R0RA 2A75A 3VBFA 3SMHA 5IK8A 2JG8A 2SBAA 3ETQA 4J6GA 1XE8A 4C0HA 3FFQA 1RUG1 4AVAA 4ZXKA 5EZWA 3AZVA 4ORFA 4NWWA 5CBLA 1PZ7A 3ZXGA 5A3LA 2Q1MA 3H3ZA 1FV3A 3U4XA 1MVQA 2I45A 1LESA 4RR3A 2XWJB 1NA1A 1VBA2 4MUVA 4AI0A 1YI9A 5FRAA 4AEDA 1NY72 1POV1 1V6JA 1ULGA 2DVAA 1H1MA 4EN0A 1G9BA 1J58A 4DY3A 2VULA 4QPGC 3PNAA 2P2KA 3ZYGA 5K0UC 4QQLA 2GC2A 2EA7A 1PIV3 3VKMA 3VKLA 5J7MA 3DUIA 1GZ9A 1N3QA 1VRH3 2ZZQA 3LGRA 4FVVA 4OHVA 2ZX1A 2D7FA 4NOTA 3WUCA 3V0AB 5T5PA 2WWSA 4K3UA 3WLUA 5J96B 1Z78A 1RTVA 2AYHA 3VZJA 2D93A 3B5LB 4SLIA 2A6ZA 1H1AA 4XXAA 3N3HA 2XVKA 4XHXA 4META 1HXS1 4XBNA 4S2FA 5BPXA 1PO12 3ILFA 4GIQA 3VL8A 4WVMB 3VBUB 3GALA 3VV1A 5JMCA 2TBVA 1CESA 4KWKA 2B42B 4H7LA 1ENRA 4RR3C 3JD72 1PZ9A 3GZUC 2W52A 4XF1A 2OW4A 3WW3A 4A7ZA 1YXWA 5J36A 4QQPA 1JTZX 2AUYA 1VAKA 1JYIA 5FO8B 4WZFA 3OY8A 1D2QA 4LHNA 3QH7A 4IV3A 4M0NA 5C8CC 1HRV2 1S0EA 2R041 1Z7S2 1X7NA 1LU2A 3NAPA 3NV1A 1Z7S1 1M4WA 3WQ1A 1NCRA 1OD5A 5KBFA 4HVOA 4LBMA 1DGLA 2UY9A 3WP5A 1YO8A 2GDFA 2XHKA 3L9JT 1WLCA 5CFCB 2VW2A 3FUOA 4AEMA 4HSJA 4XF4A 1PNGA 1GV9A 2WL1A 3ZFEC 2ETEA 1BK1A 3O0WA 2UU8A 2NN8A 1OOPC 4BMBA 1C1FA 1LEMA 1LJ7A 2EAKA 4FPJA 2JG8C 2PQQA 1TE1B 3M3EA 1QH6A 4R8HA 1AHSA 1AYM2 4K40A 3AZXA 4N53B 1BBT2 4TLFA 1CD3G 4B29A 2IWGB 2R49A 5EXOA 4PBOA 3AKRA 1VBE2 3WOGA 5FMOS 4C91A 3RZZA 1OKQA 1RUF2 1UCXA 3M8LA 4MGYE 2RS51 3USUB 1AL22 1R091 1S0BA 3NV4A 3CJXA 1AL21 1R092 4IQPA 4FOQA 4COYA 1R1A1 5AFBA 2R073 5JDBA 3VZNA 4JRAA 3IDBB 3VBSA 4YW3A 3I59B 2ZHMA 4YVSB 1HXS3 4JDMA 4RHV1 3ZFGB 4OI0A 4IV1A 1HV1A 1BJQA 1CJPA 1RUG3 4RS5C 4YM0A 2HEVF 5E89A 5HCAA 3LZZA 1D4M3 2GC1A 2IXKA 2OVUA 1VBC1 4CDUA 1CJDA 4IEOA 3MIGA 4B4PA 4K6BA 2GU9A 1V6MA 1NXMA 1V9U3 1RIRA 4YM3A 4Z1VA 1O3QA 4YVWC 2IXLA 1BVP1 3VHOA 3BCWA 4EROA 3D6EA 1ZRCA 1TME2 1RHI3 1S0FA 2BNNA 1AYN2 2GNBA 2JG9A 1OLQA 2TNFA 2QJVA 2JG9B 1D0GA 1RC6A 4XE9A 3WD5A 4AW7A 4B8EA 1NLSA 3VHPA 2MEV2 3MI8A 3N7JA 2OPKA 3AKPA 4QPYA 5BNPB 5CNAA 4ZU4A 5GZDA 2WNUC 5KHIA 1NYWA 2XGXA 4G9SB 4JGZA 5J98B 5DUVA 1V6LA 1UU4A 1MEC3 1R1A2 1H8VA 1REDA 2DCZA 3IKWA 2D6NA 4ONUA 1YI7A 1LOBA 3RNSA 4DQAA 3S0MA 1VBA3 1K5MA 1OOPB 5CIRA 2D40A 3K48A 3VL9A 1X36A 4GMP3 2HWD1 2BW8A 2CGOA 2RR11 3MDPA 4AVBA 2ZGUA 4IEUA 1B35A 4WV8A 2QQPA 1RMU1 1B09A 1QJY1 4LE3A 4GH4A 4IERA 2UWCA 2JICA 3PTYA 5HCBA 2V5YA 5C33A 5K7PA 1WMEA 4QM9A 4RQPA 4WM8A 2BVBA 1YIPA 1R081 1ULEA 4GKYA 4WM8B 4FAGA 1QH7A 4N9IA 5JZGB 4I02A 3SCFA 1RVF3 4MYEA 1HRV1 4IV3C 4C1WA 4YZ3A 4LLFA 1COV1 4JRLA 4XJAA 1DGRN 4B4QA 2NLRA 4CDQB 1YNAA 4EN7B 4AVSA 3MLJA 2VOXA 1SACA 2HEWF 1PK6C 3RG0A 4P5HA 2WZR2 1S55A 4PDWA 2ZGQA 5CFDA 1AYN3 1A6CA 1VRH2 2JKBA 2R1DA 3I8TA 1KS5A 1MQTA 3PVOA 4XMAA 5JSRA 4JGYC 1J3RA 3WINE 2A6VA 1QWRA 3GZAA 3HD8B 3O0XA 4D94A 5C9AA 4WM7C 1BBT1 1BYHA 5LK5A 2P17A 1AYM1 1RUI2 2R0HA 2JE9A 1S0GA 3DGTA 2D5FA 1YYNA 2JG9C 1RMU3 1BXHA 3UK9A 3USSA 3ZYIB 1AJKA 1EV13 2WC2A 2QVSB 1OMIA 1GQHA 1U5XA 2WJSA 5D8AA 3Q9OA 3JQXA 2EXIA 4JGYB 1C8M3 2IFRA 2WFF1 1DGWX 5BUVA 1ZX5A 3VBOA 4P9WA 2WA4A 1HQWA 4QPGA 4RD7A 4FPLA 4XETA 1CPMA 3WV6A 2WINB 3R4SA 4OVEA 1EYBA 4ASLA 2ZGTA 1ND2B 4Q8KA 1SLLA 1UZZA 3MIDA 2V73A 1D4M2 1VBD2 2ZGMA 1GKBA 3P3PA 3QD6A 3QACA 2VPVA 2CYFA 2ZX0A 4KG8A 3VDDC 2Q5TA 2NMOA 1T6GC 2BQPA 3HR9A 5JWPA 4I0BA 2IXCA 1COV2 4IXLA 4LA2A 2DCTA 4XJZA 2R6QA 1NG0A 4I0WB 5H9QA 1LU1A 3H7JA 3WR0A 5BNOB 2OA2A 2A5ZA 2Z2SB 3WG4A 5JZGA 2WNVA 5BNNB 2VVEA 1TMF2 5LRSA 2RJLA 2XB6C 2XKPA 3ZMNA 4D7TA 5K0UB 1RUG2 3VZKA 2F6BA 5KXBA 4OHZA 4R52A 1W6PB 2CAVA 4IEPA 1W6PA 1PGW2 5KHJA 4H3WA 4Y1XA 1YUDA 2X5IB 3NV2A 3TN93 1DU3D 1W6MA 1LGCA 3B69A 5CFDB 4RFT0 1KJRA 3V65A 4BE3A 3TB0A 1G9AA 5F6LB 2BEOA 2AZ5A 1PVC1 3AJYA 3SH4A 1NCRB 1S0DA 2XJVA 1SCSA 1JBCA 1EAH2 2ZKNA 1QJY2 4H14A 4HETA 1LKNA 1V9U1 2FZ1A 1FOD3 4XTPA 4CEYB 1FT9A 3QLQA 1U12A 4R9CA 1H4GA 1MZEA 1CAUA 3ROUA 3AK0A 3BIWE 2Z79A 4PCRA 5JSPA 1UW8A 2I2SA 3WQ0A 4ATEA 3QBQA 2HWF3 2DCKA 1RHI2 1RJ8A 3WW4A 1YWKA 3ZN6A 5LK7B 1AL23 2A3YA 3ZX7A 3VBSC 3WX5A 5IK4A 1DHKB 3UJOA 4E4ZA 4W6YA 3J4UH 1PGL1 1Q8QA 5AVAA 4GWMA 2PELA 1UL9A 2XBO3 4Q4V2