2JJ6A

Crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
VPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN-RELATED PROTEIN
publication title Crystal Structure of the Putative Carbohydrate Recognition Domain of Human Galectin-Related Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jj6A00
1GZWA 1I3HA 3WVJA 2CY6A 1FV3A 3B9CA 3ZXKA 1KITA 5LK5A 1ENQA 3V64A 3WZ1A 5E88A 4M3CE 1W6MB 5GZCA 1EPWA 3A0KA 3KQRA 2D6LX 3OY8B 4ISQA 3JU9A 5DZEA 4HL0A 3HN1A 5T54A 4YFZA 1WD3A 2DYCA 3ILFA 3L2YA 3WCRA 4YZ3A 5JOYA 3ILNA 1KDMA 2ARXA 4XJWA 5EXOA 1SBEA 5FREA 3AJZA 1ULGA 1WW4A 2JE7A 1AJKA 3WG3A 3M3CA 1S0FA 4Y22A 4M3CA 1GICA 1W0PA 5KXEA 3B69A 2ZACA 3V0BA 2W52A 1LJ7A 1IS5A 2DV9A 3ZXEA 2NN8A 3ZYRA 2DTWA 4PF5A 1GANA 2A71A 4Q27A 1R1ZA 4Y20A 4Y1XA 5GLZA 3POSA 5JOWA 2GNDA 4YG6A 5GLWA 3N35A 1DFQA 4LBJA 2I2SA 3ZSMA 4R9AA 1CESA 5H9QA 2ZHLA 1MVEA 3FUOA 3SNMA 1BQPA 1QDCA 4AVSA 1BKZA 1VALA 2WT2A 2D6MA 3AYEA 1DQ6A 1LOGA 2UURA 4GKXA 1IKQA 3BTAA 2A6XA 2C9AA 4YW1A 1SACA 2DVDA 4PBPA 2NZ9A 4BOWA 2V5YA 2DVAA 4LBQD 1SLCA 4LBLA 2XG3A 3ZXFA 1SLIA 1N1TA 1WW5A 1G9DA 4YGDA 5E89A 1V6KA 1LGNA 1GBGA 1ULFA 3RRDA 1RINA 4FPFA 3BIWE 2E7QA 2UWAA 3T1LA 2D3PA 2DUOA 2UWCA 3AP4A 1WD4A 4YGEA 2ZGLA 3CNAA 4YW3A 3IKWA 5CAZA 1Z0HA 4UW6A 1AF9A 3WDUA 2BQPA 2GNMA 4Q1RA 1U0AA 5GZEA 1S0DA 3AYDA 4FPGA 4XMAA 3MW3A 3I4IA 1CQ9A 2ZMNA 1V6MA 2EAKA 2ES3A 2ZMLA 4H55A 2ERFA 2LTNA 2ZGUA 2ZZJA 2ZGTA 2PHUA 4R9BA 4KBBA 5GLUA 4XHXA 3Q9OA 1W6QB 4K1ZA 4GALA 4FPOB 1ENRA 1W6OB 5IUQA 1QOOA 1LODA 4XYXA 4Y1YA 1PZ8A 4FOVA 1DQ4A 2D43A 2AENA 1VAMA 2W08A 2CWSA 3NWKA 4JRAA 3AX4A 5GZFA 2A3YA 4WZFA 3O12A 3N3HA 5KXCA 1OKQA 1H9WA 2DU1A 2Q5TA 2YZ4A 3WDYA 1S0CA 5FRAA 3WHUA 3OBRA 4BM8A 3D4KA 2JE9A 1S0EA 2PHXA 2A7AA 1HDKA 1KJLA 4ITCA 2E7TA 3WHTA 2HYKA 3A0NA 1FATA 1S0JA 4DPNA 2EXHA 3AZXA 1AVBA 2AREA 2GN7A 1N47A 3VV1A 3T2TA 1LGCA 1OQ1A 1N1VA 1UX6A 2EF6A 3WDWA 3DGTA 4K1YA 3WG4A 1N1SA 2DU0A 4P9YA 3N7KA 1CONA 4Y1VA 3V0AA 1G9AA 4LBQA 3AJYA 5EWSA 3RQ0A 5GALA 1LENA 4BMEA 1JHNA 5IT6A 1MS4A 4R9DA 1C1FA 3OYWA 4Y26A 3H0OA 1V6IA 1Q8SA 4UW4A 1GSLA 4XJUA 3ASIA 1RIRA 4YGBA 5IK7A 3AZZA 3WV6A 5JMCA 3O0WA 1D0HA 1JN2P 5T5OA 1FYUA 2AH2A 3HR9A 2A70A 2UU8A 3B3QE 3N7MA 3ZXJA 5HCFA 2ZHMA 1MACA 5DZFA 1JUIA 2W68A 4NO4A 5F5QA 1SLBA 1JYCA 4YFWA 4I30A 2A6WA 2ZGKA 4JC1A 5EYYA 2NM1A 3BOPA 4NOTA 5BYNA 3RS6A 2ZGNA 1V6LA 5CA6A 2VXRA 3FLTA 3JUUA 1WLCA 5IK5A 2NYYA 2WSVA 4LBKA 4Q26A 3B00A 3N7JA 1WBFA 1I1EA 4C1WA 1LOBA 1MVQA 1JW6A 3AXEA 1TEIA 5T5LA 2WT0A 2PHRA 1DYKA 5T50A 1N3QA 2CTVA 4UW5A 1KDKA 2P34A 1W6NB 2ZKNA 1S0IA 1YXWA 5KXDA 2DTYA 2ZGRA 3AZVA 1PZ9A 2JECA 2JD4A 3POYA 5AVAA 2DWRA 1APNA 1Q56A 1GZCA 1IS3A 3LCPA 5GZGA 2VUAA 4AYUA 3V65A 3AYAA 1O4ZA 1DHKB 1CR7A 4FP3A 2CL2A 1VAVA 3SITA 1MR5A 2P3IA 4M01A 2EIGA 2GDFA 2AUYA 3PVOA 1GV9A 3FUQA 3RMXA 3M3QA 5GJ6A 4Q8KA 1C4RA 4BLJA 4YW5A 3MPPG 3WNXA 4AVVA 2GNTA 1NXD1 4CZSA 4XTMA 2D6KA 4DRRA 1ULEA 2VW0A 2WQZC 1HLCA 1ULCA 1FX5A 5JOXA 3IPVA 3ZSLA 1Q8QA 2R0HA 4FPLA 4XMIA 3TB0A 2FHRA 2DUQA 4YLZA 4FQ4A 2WLQA 4YM0A 3AZYA 4FPEA 1DIWA 5DUVA 1S0GA 1SLLA 2DURA 4FOQA 4WV8A 5DZGA 3PMEA 1DQ0A 4P14A 3ILRA 1Q8OA 5CB7A 3M2MA 3MW2A 3VKOA 3AP5A 4XBQA 4DFSA 1WUVA 2W39A 5JOZA 4XZPA 1F9KA 4XBLA 1D2SA 4ISRA 4Y24A 1MS9A 2YMZA 1SBFA 4DQAA 3D6EA 4DS0A 3AP9A 3PVNA 2YY1A 4LBQB 4TYSA 2EXJA 1CPNA 2P3KA 2V73A 5T52A 1IKPA 1KRIA 1YRZA 4XIKA 3GALA 2GMMA 2YROA 4XJZA 1DQ1A 4P9XA 3VKFC 1GNHA 5H9SA 2GNBA 1XQNA 3OJBA 3VKMA 3ZVXA 2A6YA 1AXYA 1DGLA 1JXNA 2D6OX 1WW6A 2NMOA 1S0BA 5DUWA 1QNYA 3PJQA 1N3OA 1ULDA 3D5OA 3HMYA 1LEDA 5T5JA 2ZGPA 2GMPA 4YZ5A 4YW2A 4PQ9A 2D7FA 4DRVA 1HQWA 2ENRA 3LSEA 1QU0A 4FVVA 4FPKA 4ATFA 3QLQA 1MZ5A 1W6MA 4FPJA 1GZWB 1G8WA 2ZABA 1A8DA 3OY8A 2NMNA 5DUXA 3N36A 4XIOA 4XJ9A 2ARBA 5T55A 1BJQA 3AP6A 5L73A 4FPYA 3UJQA 3AXDA 1AX0A 1KJRA 2VW1A 1S1AA 3OPZA 2YXSA 3C2UA 3FBYA 1GNZA 1MZ6A 3R4UA 2VW2A 4FPHA 5DG2A 4Y1ZA 1UZZA 1WW7A 4FP2A 1AXZA 3WUCA 1IS6A 1BXHA 1OFSA 4Y22B 1C57A 4M3CB 4U36A 1LECA 4L8QA 4R9CA 5E8AA 3V0BB 3W59A 3ZSKA 4AGGA 1ENSA 3SLIA 4ATEA 1BZWA 1H30A 2ZGSA 4U2AA 1G9FA 2D6NA 2ZHKA 1LU1A 4Y20B 3SH3A 1LOAA 5DG1A 1A78A 4ZXKA 4F83A 4Q2FA 3AZWA 1DZQA 1MS1A 2ZHNA 3VKLA 3MW4A 2CYFA 1YYNA 4Q8LA 4AGRA 3BODA 1ONAA 1CPMA 1SBDA 3M3EA 4MYEA 3FLPA 4LBOA 3AYCA 3WLUA 2OW4A 3SH4A 1VIWB 3W58A 1W6PA 1UPSA 1RITA 1J1TA 2CWMA 1LHWA 1LHNA 3QCWA 4XXAA 2OVUA 4BLIA 1LULA 1WBLA 1QNWA 2NP0A 4SLIA 1ZA4A 1MS0A 3NV4A 3WOGA 2PELA 2P2KA 4XE9A 3WG1A 1SLAA 2JDZA 5F9TA 1DBNA 1LU2A 3WDVA 1IS4A 4CTEA 1SCRA 2R0FA 4IQPA 1UAIA 1W6QA 4YZ2A 1LHOA 1LOCA 1LTEA 1W6OA 4FOWA 3UK9A 1AJOA 1F31A 2SLIA 4Q1PA 5GLTA 1PZ7A 2EXIA 1DLLA 3AFKA 3SH5A 4YZ1A 2D3RA 2DVBA 4XJAA 3RSJA 4Z8BA 1YI7A 1ZM1A 3A4UA 2WSUA 1G9CA 2JKBA 2AR6A 5IK8A 3TAYA 1GYKA 4YG0A 4XXPA 4Y1UA 1LOFC 2D3SA 1AX1A 2C5DA 2XB6C 3NV2A 3NV3A 4YW4A 3IN9A 1MS3A 2E6VA 2ZA9A 4GA9A 4LBMA 4RA0A 1UN1A 1JBCA 1N1YA 1WLWA 3AP7A 3O0VA 1CIWA 4RL7A 3KM5A 4WVVA 3VUOA 1UL9A 1HKDA 3ZSJA 3ZYPA 3IMNA 2E53A 1LOEA 1UMZA 3APBA 4M3CF 4YM1A 2P37A 3ATGA 2Z42A 2ZBJA 3IM0A 3RMYA 1LEMA 3WDTA 1B09A 1V6JA 2EXKA 1Q8VA 1CN1A 2A3WA 2E51A 1V6OA 2R1BA 3MEPA 4YGCA 2WKKA 1KQRA 1G86A 2B7YA 4OZXA 2VU9A 5CNAA 1AZDA 4AVTA 3V0AB 1WLDA 2FMDA 4GKYA 4C1XA 1Z78A 1O4YA 3LSDA 2SBAA 1JOJA 3OYWB 1VLNA 3U4XA 1W0OA 2A75A 3GNEA 3PVEA 2D6PA 5HCBA 5HCAA 2LALA 2AGSA 2P3JA 5CBLA 1URXA 1Q8PA 1DQ2A 2ZGOA 1MS5A 1Y7BA 3USUA 4XBNA 1G9BA 4BQ1A 2ZGQA 1WCSA 1V6NA 2TEPA 4FQZA 1X50A 5GLVA 5JVVA 4BMBA 1G7YA 1W6PB 2DVGA 4TZDA 4GXLA 3AK0A 3SISA 2OUHA 4GWMA 1FNYA 2ZMKA 1W6NA 3INAA 4LBNA 5IK4A 3ZXLA 3UJOA 3OGGA 1JYIA 1DYPA 5GM0A 5KXBA 1UKGA 2WJSA 2PHWA 4XOGA 4YG3A 2R49A 2VH9A 1YIFA 4W65A 2D44A 3M1HA 1LGBA 4P9WA 5H9RA 2A6VA 3VKNA 3WG2A 4XJ8A 4WVWA 4XTPA 2CNAA 2ZAAA 1F5FA 4FPCA 2PHFA 1FV2A 3POWA 5GZDA 4CRQA 1GZ9A 3O0XA 2A5ZA 2A6ZA 2H0BA 5EYXA 1LESA 4D69A 1IOAA 1C1LA 1HQLA 1AXKA 1BYHA 1LHVA 3DUIA 1GLHA 1QF3A 4PBOA 1CVNA 1N3PA 2R16A 5JDBA 1QMJA 1AX2A 2RHPA 4HANA 3WCSA 2KM2A 1MS8A 3ENRA 3N7LA 5DUUA 1SFYA 4JCKA 1QGLA 5H9PA 3R4SA 4K21A 1QOTA 1V00A 1A3KA 4XHBA 4YM3A 2DVFA 1LOFA 3IPVB 3ZPYA 2JJ6A 3UL2A 4M00A 1CJPA 3B01A 1H9PA 1YO8A 4XILA 2AYHA 3FFZA 2PHTA 2VY0A 4ASMB 4ZKTB 3RG0A 4AWDA 1LHUA 5T5PA 3FLRA 2A3XA 5JLVA 1QDOA 1NLSA 3M3OA 4AGVA 1QOSA 2WT1A 1FNZA 2GALA 1QKQA 5SV8A 1LCLA 2YV8A 2DUPA 4XDQA 4YZ4A 1GKBA 2R1DA 4UW3A 3WUDA 2G4IA 4YM2A 4PCRA 1SCSA 2UWBA 2ZGMA 4K20A 4BPZA 2WNEA 3WDXA 2GN3A 1FAYA 3O5SA 4FOYA 1DQ5A 2GMEA 3OBTA 3I8TA 2OUJA 3T1MA 2EALA 3R05A 1UZYA 5DXDA 3USUB 4GWNA 3NV1A 1SLTA
chains in the Genus database with same CATH superfamily
2W0XA 2O14A 3FMGA 4N90A 4A45A 2WRAA 2XL7A 2CY6A 5EJZB 1FV3A 2UY8A 5A32A 1VRH1 2X53S 5ABJB 3MIEA 1QQP1 4JDOA 5FZFA 4PI0A 5JIUA 1K12A 4AEDA 4M3CE 1W6MB 5GZCA 1EPWA 1AR91 2WR9A 2D6LX 1YFWA 3KQRA 3MDPA 3OY8B 4MGKE 4RQPA 5T54A 3OEAA 3ST7A 4RS5C 4FAGA 1STMA 2DYCA 3RI8A 4BCUA 2JB4A 3WCRA 2F4LA 4RD7A 2WFF3 2ARXA 2WNVB 5EXOA 3RFRA 4BQXA 2GC2A 3AJZA 1HRI1 2P6CA 3PTYA 4YSFA 1COV3 1S2KA 1BBT2 3M3CA 1PO22 4M3CA 1W0PA 4JKKA 4B3NA 1OBNA 4BQWA 2QQVA 3RJRA 2DV9A 3SCGA 3ZYRA 2RJKA 3URFA 1X33A 2HWB3 4NAOA 4PF5A 2A71A 2RR11 1R1ZA 4B7KA 1PGL2 2VCAA 4QX7A 1UMHA 3POSA 1D4VB 1US3A 4IW3A 3MFCA 1DZRA 4B29A 1UY3A 1F15A 3LDKA 1S2EA 3N35A 4FXGB 4UBHA 1HQNA 1OOPA 1UXZA 2I2SA 4JKLA 4LBJA 2Q8DA 3ZSMA 4BZ4A 1UY0A 3JD71 5LA1A 1BQPA 2VZRA 1QDCA 5JPNB 1E5RA 1BKZA 2XONA 1DLCA 2VE1A 1S4CA 1LOGA 4OYUA 4GB32 2DVDA 4YW1A 4PBPA 4AHZA 2V5YA 2DVAA 2RJ2A 2WZ8A 4BOWA 4CVUA 5FZ8A 4AEDC 1CAVB 2XG3A 5FZGA 2XVGA 1LGNA 3DPRC 3NJYA 5C70A 3WQ7A 4LEJA 2I74A 5LA9A 2V4AA 4B4PA 3BCWA 1PGW2 3CNAA 4YW3A 1Z0HA 2HH9A 1AF9A 1PM4A 2YDEA 4Q1RA 2W95A 1S0DA 1GP5A 4XMAA 2QQWA 3MW3A 3I4IA 3IB3A 3IDAA 1PGSA 1VBE1 2Z4FA 1QJZA 2ZJCA 3LE0A 3T3YA 1JTZX 5CU1A 2ZGTA 2PHUA 2ET1A 5A70A 3HIFA 4KBBA 4XHXA 2DF7A 3Q9OA 1H1AA 1ZZ8A 1ENRA 1W6OB 2VQAA 2JWPA 3ACHA 4XYXA 5F3GA 1IGOA 1NXMA 1PZ8A 2D43A 2AENA 3SCHA 3CL1A 3ZLIA 1UD1A 4WZFA 2WAAA 4KNCA 5KXCA 3QOPA 2YBKA 4AAXA 1TE1B 2JG9A 5JXHA 5C4WA 2X5IC 3OF1A 3LQCA 1ZBE1 5CKNA 5FQ0A 5FRAA 3WHUA 5JXGA 2XXZA 1S0EA 4YVWB 4RQPB 3ACFA 3I59B 3VBHA 1JS9A 4IEOA 3ZDSA 1X7NA 1HB3A 2FDKA 2DBIA 2GU9A 4JGYB 1FATA 3KGLA 4HSLA 3AZXA 4BE3A 1AVBA 2AREA 1R1A2 2VMEA 3VV1A 2WNUB 3J4UH 4YVSC 1GWKA 1HB4A 3TNPB 2VZ3A 1OA2A 1W2NA 4P9JA 4AVCA 1KGYA 2Y26A 3E5QA 3GZUC 3DGTA 1V0AA 2VMDA 4CCNA 3GZEA 3KQ4B 1N1SA 5APAA 3WW4A 1IPSA 4QDQA 4AFBA 3EO6A 1CONA 4LBQA 4I0AA 1FXZA 5J96B 1LENA 3TEYA 2ET7A 5IT6A 4AG4A 1MS4A 4R9DA 3ZR6A 2G1MA 4CPBA 5I0DA 4XJUA 2JD9A 3M3IA 1OOPB 2K0GA 3AZZA 3GHMA 5FZLA 4EROA 5FJKA 3ZYGA 3NW4A 1FYUA 3B9IA 3B3QE 3HR9A 1RUG1 3BTXA 2ARAA 5HCFA 1YWKA 5IFTA 1JUIA 5C4WC 2W68A 4ONUA 1W2OA 1FPN2 4XDOA 1FMD1 1O3SA 2A6WA 5E1RA 3ZXAC 4CCLA 1W9SA 5EYYA 5JSPA 3BOPA 4COYA 1OA4A 1VE0A 1QJU3 2VXRA 5IAXA 2J42A 4QQOA 4AR2A 4KWJA 3E5XA 2E33A 4FFFA 1LOBA 1YFYA 1Y43B 2VCCA 5FKBA 5T5LA 2PHRA 2YB7A 4OI2A 2JICA 5T50A 1N3QA 2CTVA 2HWD2 1KDKA 2P34A 3KF3A 3WINE 5FDBA 3AM2A 2WZR3 1YXWA 2DTYA 2ZGRA 4TSVA 3AZVA 4AI0A 1GQHA 2JD4A 4LJHA 5C3OA 3SC7X 1APNA 3I2GA 2OZ6A 3ACGA 3LCPA 1OLQA 2RS11 3LOBA 1RUH1 1O4ZA 1ASJ3 3OB8A 4PI2A 4LO6B 3U0ZA 1DG6A 2RDSA 1JMUB 3H1YA 3NJVA 4M01A 2GDFA 3RMXA 2XJVA 3FUQA 3M3QA 5GJ6A 2VQ0A 1H6XA 1PMJX 1NXD1 5FYZA 1NA1A 1VBA3 4BA6A 4YPJA 5KWRA 4XTMA 4QGNA 2VAUA 2RG4A 5FQ0B 4CU8A 4UFKA 1K5JA 4DMIA 2JIJA 2R0HA 3TB0A 2WLQA 3ZIXA 5CFDA 2R7EB 3AZYA 4FPEA 3WR0A 1S0GA 5BXXA 2DURA 4FOQA 4AQ2A 1JYXA 4P14A 1BK0A 3ILRA 1UOGA 4AFMA 1Q8OA 4H7MA 3SHRA 2A1XA 4WM8B 2Q8OA 4CDXA 5AC92 1FT9A 5FPAA 3VKOA 2XGXA 3AP5A 4B7EA 2QBXA 1WZXA 3ZMNA 4MVTA 3TN93 5JR7B 4NAMA 1WUVA 2QQNA 2W39A 4LKDA 4QT6A 4XUOA 3RZZA 4DFSA 4YARA 5L36A 4QGLA 3AL5A 4ISRA 4CP0A 2VOWA 1MS9A 3B02A 3ITQA 4Y24A 3RZKA 3CEWA 2E32A 1OPOA 2YY1A 3HQXA 4LBQB 4TYSA 4ZS2A 3WEZA 1VBB3 2V73A 1CPNA 2Y6LA 3OSDA 4XF4A 3U4SA 2D93A 1KRIA 4XIKA 3GALA 2YROA 1PIV2 3VKFC 1DQ1A 5H9SA 1NG0A 1RUF3 2NMOA 1S0BA 1HXS2 2WS91 5HXVA 2E9QA 3KV6A 2AEYA 3RWNA 2JG8A 4COUA 3B7MA 5JAXA 1ULDA 3LA3A 1ZRFA 3H42B 1QJU2 1MQTC 1NA1C 1YQCA 2VUJA 2W46A 4TN7A 1F4HA 2YGLA 3BYWA 4P5HA 5FP4A 1P8JA 4FVVA 5FO7B 4I3PA 1AL21 3K51A 1K42A 3LIGA 4FPJA 3K4DA 2ZABA 3EHKA 1A8DA 4KWKA 3JBG3 5DUXA 3VD4A 3N36A 3AMHA 1I9RA 3GCWA 3LOIA 3MV11 3PUAA 3T30A 4XIOA 2ARBA 5L9VA 1BJQA 5FP7A 5L73A 4KI5M 2FDIA 4LA2A 4CCEA 5FY7A 3A23A 1OFNA 5FZCA 1BVP1 4C0BA 2B5HA 2VW1A 5C9AC 1W8UA 3OPZA 3MIFA 3LDBA 1ASJ2 4CEWC 1QJY2 1WKYA 2J1TA 3C2UA 3FBYA 1OVPA 1NCRA 1PO13 5A3PA 1MZ6A 2R6QA 2O8QA 5DG2A 4QX3A 1WGPA 1UZZA 4XCBA 3WUCA 1GMMA 3GJAA 2DFBA 4CUCA 4NMIA 4EYUA 4L8QA 4R9CA 3V0BB 1RHI1 4Q4X3 4Q4V3 1ST8A 2V5DA 3SLIA 3H8UA 1RUJ2 3VBFA 1VBD1 4A7KA 4QX1A 1G9FA 2JDYA 2QVSB 5JSRA 2RVAA 1X8EA 2YBPA 4ZONA 1A78A 5DG1A 2W87A 3TNQA 4F83A 2ZHNA 2O8OA 2VXJA 3T08A 3WQ1A 1NE6A 1YYNA 3RYRA 1HRV3 3ZN6A 4Q8LA 3M8LA 2QTWB 5CYYA 4GAZA 2I07B 4H7LA 4L99A 1W8HA 2UY9A 2HEWF 1JYNA 4OULA 3WNMA 3PMSA 4JAAA 3WLUA 2HWC1 4BQYA 1VIWB 3W58A 2BDRA 5J98B 3VB9A 1CAXA 1VRH3 5ISLA 4KG8A 4F8AA 1QQP3 1VBB2 4IDZA 2WBKA 4LITA 5F32A 3H8XA 4O9EA 1QNWA 3O1RA 1AR93 1WMEA 3GGLA 1BMV1 2VZUA 4BIFA 2DCKA 1NCRC 5A7QA 3S7IA 3AVSA 3NV4A 2P2KA 1RUF2 4A6OA 2AC1A 2PA7A 2YFUA 2WAOA 1ZZ9A 4KGQA 4FTBA 1SCRA 3G7DA 1HRI3 2R0FA 1BLZA 2ORXA 1W6QA 4Q4Y2 4YZ2A 4XFCA 1RUNA 5DAQA 3BVCA 3UK9A 5GLTA 3WF0A 2H0VA 1E5HA 4LLFA 1XOYA 1J59A 4CCDA 5K7PA 1ZZCA 2JDMA 2D3RA 2JG8B 5BPXA 3RSJA 3T0BA 2RR13 4F7ZA 4PLMA 5K0UC 5T3NA 2WSUA 5K8SA 2BYVE 4HK9A 3TAYA 3KV5A 1H2KA 2JKXA 4A7ZA 4HOOA 4YG0A 2YGMA 4O61A 2HWE1 1XBFA 5IWFA 3H7YA 2QQLA 3JD73 1AYN1 4IETA 2F6BA 3IN9A 4AOCA 4FTSA 1DDLA 3HNMA 1DZTA 3K77A 4Y4RA 4LBMA 1PO12 4HFSA 3WT3A 1JBCA 5LBCA 2LM3A 2G19A 5A33A 4I0BA 3O0VA 1BEV1 2DFCA 1D4M1 3SXWA 5AFBA 3VUOA 3MF9A 2OKXA 3BALA 4HSJA 3V56A 1HJGA 4QB1A 4HONA 4UF0A 3ROUA 3HNYM 4ZU4A 3IIAA 2RJLA 3VDDC 2PMWB 3HD8B 3FJSA 3VBRC 5CADA 4LOTA 4X8PA 4IEUA 2AEZA 3IMMA 1Q8VA 1PX4A 1ZYBA 1V6OA 2R1BA 3VZMA 4KGGA 1I5ZA 2VU9A 4AFDA 2EIEA 2G9ZA 2NLRA 4XFIA 3S30A 3CZUA 1QJFA 1VBE3 3VBFB 3V0AB 4GKYA 4C1XA 5FYSA 3I3EA 4CCCA 3T2OA 3TYJA 2IXJA 2R061 3WF1A 4GZ9A 4DB5A 1IPKA 3AB0A 3GBWA 3GNEA 5HCAA 5FZAA 2AGSA 2HEYF 5LEJA 3LGRA 2RMU1 1PK6B 3TBDA 1Q8PA 1DQ2A 2W5FA 3JQXA 5I91A 4LIVA 1RJ7A 4CP9A 5GLVA 2TEPA 2Q1ZB 1X50A 4FQZA 4FXKB 4IE7A 3VBSA 2DVGA 5K9YA 2TNFA 1QXPA 3U1XA 3SISA 3OPTA 3H3LA 4RR3B 4D0QA 3ME2A 1PMHX 5IVCA 2ZMKA 4X6QB 1AYM2 5IK4A 1O5LA 1VP6A 4AVAA 2PHLA 2QQKA 1WA4A 4NWVA 4BK4A 4DXZA 2WINB 1VJ2A 4A3XA 5BNPB 4LMFA 4DEQA 4XFFA 1W39A 3M1HA 1RUI1 1JHJA 4N43A 5FYCA 1H4GA 1RJ8A 1F5JA 5FXZA 3E97A 2CNAA 2ZAAA 1EPZA 3WNOA 2VNVA 3K2OA 3H9AA 2WUHA 4LQRA 1MZEA 5I0UA 5HXMA 1NZIA 5A80A 4IE0A 1UU6A 2J1AA 4CDUC 1YLLA 3W5MA 5L9RA 2YPDA 3TWIA 1H8TC 1C1LA 1AXKA 2ZKLA 2B42B 4N9HA 3LEMA 2OQ6A 3MYXA 4WVZA 4B1LA 1MS8A 3ENRA 1RUG3 5DUUA 4P00B 1JI6A 5DDJ2 1SFYA 2VCMA 3FN9A 2FZ1A 3H1MA 1QOTA 1V00A 1AR72 1JODA 2ZX4A 1A3KA 4YM3A 4QQ2A 1FMD3 3IPVB 2TBVA 5FZHA 3VDBA 4XVHA 1WCDJ 3LFIA 1PVXA 1YO8A 4XUTA 3FFZA 3VN4A 3E6BA 3DN7A 4E4SA 3WP4A 4S2FA 4RFT0 4ZKTB 5T5PA 5JLVA 1GP6A 5DAVA 1JZ8A 2J1RA 3OOXA 1C28A 4MSVA 1DYOA 4WVMA 1UXXX 4J1XA 1QKQA 2XJQA 5CVRA 4LK6A 1GKBA 4LKSA 2G4IA 3J26N 2W1UA 1SCSA 5I8YA 1W2TA 3WDXA 3UT0A 5A3MA 3ZXGA 3RDIA 3VLBB 2BP6A 2RS13 1RUH3 4FOYA 4HG6B 1W90A 1CAUA 2Y6KA 4O9GA 4IV1A 4KH9A 1NZCA 4KBZA 5BNNA 2VZSA 2EALA 3CLPA 4UWDA 1TME2 5M0TA 1UZYA 1UW8A 1CAWB 3CQOA 5DXDA 3KLSA 2O0OA 1GZWA 4UAPA 4TLGA 4LKEA 1W8TA 1W2UA 3BB6A 1KITA 1CZSA 1OURA 1HW5A 2IXCA 4ISQA 5LY2A 3USSA 3FFQA 1WD3A 2B8MA 2RS51 2K46A 4K8FA 5HV4A 3ILFA 4MGZE 3M4FA 3ZR5A 3ZPOA 5JOYA 3L9JT 4XJWA 4AQSA 1HN0A 4LUMA 5FREA 4M4PA 3GXUA 2G9GA 4CEYB 3ALQA 5JUVA 3ZYIB 4Y22A 3FHQA 5J37A 5KXEA 1ND2A 3IBMA 5J1XA 2ZACA 4YW6A 2ZX1A 2W52A 1IS5A 2W3JA 1G6NA 1NCQB 2DTWA 2VUCA 1GANA 4Q27A 4Y20A 4Y1XA 2YBSA 4N53C 1HJFA 2MEV2 2UYBA 4MLOA 4CE8A 5GLWA 4N8MA 2ZZQA 3I2IA 1W04A 2ADEA 4AAPA 3KVBA 4R9AA 1CESA 3I3DA 5FBJA 2ZHLA 5H9QA 1MVEA 3IWZA 5FO8B 2FCVA 4NIIA 4AVSA 4H2AA 5KR7A 1SEFA 2D6MA 4G9SB 3K48A 4GKXA 1IKQA 4HVRA 1FOD1 1ODNA 3MUZ1 4UI9L 4Y5SA 3ZX7A 2NZ9A 4NUBA 1ULOA 2VZVA 5FY5A 1L7RA 1AL23 1E57A 2WWJA 4XFBA 3KZ4C 4BQ3A 4YGDA 1G9DA 5A7WA 3H8OA 1ULFA 4FCAA 2RM22 2Y8KA 4PIZA 3T1LA 2D3PA 2DUOA 5A7NA 4QPIA 4DZGA 3AP4A 1WD4A 4YGEA 4CDWA 3KB5A 2EIBA 5CAZA 2RV9A 4Z92B 2GC0A 2HJIA 3WDUA 4COWA 2HBTA 5JMOA 4LKFA 4AHWA 4WVMB 2PQSA 2GZWA 2ZMNA 2ZMLA 2ES3A 3B93A 4PQQA 4ES9A 2ERFA 4NPLA 2LTNA 5KBFA 1CD3G 4QMAA 3W21A 2OX0A 3NJXA 1EUUA 3ZFFB 2BJSA 1UOFA 5C6CA 3QH6A 1UY1A 3LZZA 4QKBA 1RUE2 2WABA 4FPOB 4KQ7A 1RHI3 1CAUB 5IUQA 1LODA 4IV1B 2P1BA 4UYBA 5BNNB 5C8CA 1PNFA 5C7GA 3AX4A 4W6YA 4D7SA 1VBC2 2WQ4A 1H9WA 3ACIA 3S7EA 2Y38A 3NAPB 4FT8A 5B4XA 1OF3A 4L97A 4CCJA 4B8EA 2D5HA 3OBRA 2QQPA 4XCAA 5L19A 4BXSV 3RI9A 1HDKA 5ACA1 3GDBA 1Q43A 4CDWC 2HWC3 5BNOC 1RVF1 3CKHA 4DPNA 5GKAC 4CXYA 1PVC1 1QXRA 1RMU1 4UFIA 3T2TA 4AI8A 1R081 4YW7A 4EN6B 1N1VA 1WLTA 4N9IA 5DAPA 3WDWA 1VMHA 4R52A 4XEZA 4D6QA 1DGRN 2CDOA 4K1YA 5LRSA 2H6CA 4RS5A 2P4EA 3WG4A 4P9YA 2XUMA 3N7KA 4QX8A 3GBGA 3AJYA 4Q0UA 5EWSA 5A3WA 1JHNA 1SMVA 1C1FA 4Y26A 1V6IA 5LK7B 2Y0IA 4UT5A 2KA3A 4YRDA 5FZDA 3WV6A 1T2XA 3O0WA 4XQ4A 4NJ4A 1J3RA 1JN2P 1HX6A 3OD0A 4JHZA 5FXVA 5T5OA 2AH2A 3N7MA 2UU8A 2ZPXA 4ZZ5A 5F3IA 4NPMA 5KHGA 1RUD2 4RGKA 4NO4A 5F5QA 1UOBA 5G05L 1SLBA 1ZRIA 2PLV2 4Y4YA 4NIGA 4I30A 4P9IA 2WNVC 3VHRA 2WC2A 2NM1A 4NOTA 2IXLA 2HWE3 1H1MA 1R64A 2W94A 2DCTA 1AYN3 5FLJA 3RS6A 4RHV1 1V6LA 2Y6HA 3FLTA 4YYOA 1AR81 5IK5A 4LBKA 4QHOA 4QPIB 5IJRA 2CAUA 4QWNA 3N7JA 4C1WA 1D4M3 1CIYA 1V9U3 1MVQA 2EA7A 4AE2A 4OI0A 5KHIA 2RS33 2GC3A 1DYKA 3DPRA 4E2SA 3MIDA 4UW5A 5FYTA 5C5TA 1S0IA 3BTZA 2WQ8A 4G3YC 1PZ9A 5CFCC 3AVRA 3NSTA 2QCSB 4BDVB 3LFMA 1GZCA 3UETA 3THPA 1OUXA 5GZGA 3TEWA 1YJKA 2VUAA 3X29B 3ZDVA 4QHZA 1RUC1 4EQVA 1DHKB 4HKLA 1CR7A 2B4KA 2GH8A 5FXXA 1K5MA 4FP3A 1GOHA 3M7AA 4HXCA 5C8CB 2EIGA 4DUXA 4OUMA 5EV7A 1TMF3 2FMYA 1C4RA 3NMBA 4BLJA 3WW2A 1XYOA 2DCYA 2OXBA 3MPPG 4YW5A 2R063 4CZSA 2ZX3A 2HWC2 3ON7A 2XOMA 2BFUL 4MOAA 3DV8A 5KHKA 2W47A 1ULEA 2VW0A 2WQZC 1HLCA 3T2PA 1D7PM 1FX5A 4CSWA 1BHGA 3D0SA 2PAEA 2RMU3 3PDQA 4FPLA 2FHRA 4XMIA 3WD5A 4FQ4A 5JR2A 4YM0A 5DUVA 5F2SA 4BQ2A 1SLLA 5DZGA 3NNFA 3PMEA 3I2KA 4GMP1 5A3OA 4CDQC 2X5IA 3PU3A 4DINB 4GJYA 2VZ1A 1R092 4NWWA 2Y34A 3HT1A 4P02B 5CB7A 2VVFA 3MW2A 1W8NA 4XBQA 4NRQA 4IV3A 5FK8A 5JOZA 4I02A 1F9KA 4AEKA 1D2SA 1GOFA 4RS5B 1X9PA 2WO1A 4MV2A 5IW0A 2VG9A 3VBUC 5FZOA 5EQUA 4DQAA 3D6EA 4EN0A 3O1OA 3WW1A 1Y9GA 1AL0G 3U11A 3FBMA 4YVSA 2VJXA 2OYZA 1YRZA 4IEXA 4LO5B 1K5MC 4P9XA 3ZVXA 2GNBA 4JTOA 1AXYA 1MEC1 1RUI3 1W2AX 1X8MA 1ZBA2 2XLGA 4MUVA 4XFAA 3ZXDA 2Y6GA 4YVWC 5F3EA 3HMYA 2FCUA 2ZGPA 3LEIA 1YQ5A 1U5ZA 4L92A 4DRVA 3RVHA 4JGYC 3I2OA 1HQWA 4LTAA 1EV13 3LSEA 4NHYA 3MIBA 5LASA 1QU0A 2Q8EA 1QH7A 1V9U2 3J9SA 4W4ZA 3QLQA 2RS32 4PDWC 4IEQA 2Y33A 5EP9A 3PUHA 1NE4A 2BU9A 4YWAA 4CCOA 3ZO0B 2WFF2 4XJ9A 5A32B 3WF4A 4AI3A 2BBAA 2FCTA 3ZMOA 3PLQA 5HPOA 4AEDB 2VMFA 5K4LA 1COV2 1AUYA 4IV3C 4NVPA 3HJRA 1UYYA 2HWB2 1IQAA 3CJIC 3R4UA 1RXFA 1TMF2 3DXTA 4FPHA 1WW7A 4FP2A 4PIYA 1AXZA 4K9SA 1OFSA 2VOVA 3IDCB 5DAXA 4M3CB 1LECA 1CZTA 2ZCWA 4KMQA 4XFGA 3ZSKA 4LPLA 1KFXL 2PFWA 4LK7A 4AGGA 3IIIA 3BPSA 4QXKA 1ND3C 3U07A 4AFCA 2ZHKA 4ET7A 2VR4A 1LU1A 5LA2A 1XJAA 4URAA 5JXIA 5IVFA 3AZWA 1C8M1 1RL3A 3VKLA 4Z2AA 4OZOA 2VGDA 2J1VA 1K45A 4AGRA 3ACLA 5HI0A 4HPKA 3M3EA 1NY71 2P3YA 4MG2A 2R071 3N9PA 3FLPA 2ILMA 2XHNA 3HQRA 4BIOA 4DXTA 1WMDA 3H3ZA 4B1MA 1VR3A 2X5IB 1D0GA 1UPSA 4XXAA 1J1TA 1LHWA 1LHNA 1UZ0A 5JSOA 2OVUA 3VZKA 4BLIA 3LEKA 4EZHA 2CDPA 3OEBA 2XBO1 5CG8A 1WBLA 2ZEWA 1GP4A 2BZDA 4QXBA 1M4WA 1XB9A 2DCJA 3RZLA 3PUSA 2BNOA 4SLIA 3VHPA 2Z69A 4XAAA 5FO9B 2RS53 4JX0A 1H2MA 1RUI2 1XNKA 2JDZA 4RSUA 4XE9A 5F9TA 3BUCA 1UF2C 1LU2A 1OT5A 3FWEA 1IS4A 2BRTA 3FHIB 1ZREA 3ZM8A 3KHCA 1EY2A 1SDDB 1EV12 1LOCA 2J22A 4FOWA 4JZRA 4D7YA 1W03A 2XWBB 2BUKA 5FLIA 4Q1PA 3RWKX 1PZ7A 4XABA 1JZ3A 1UYXA 1BCXA 1W8FA 2VTXA 3A4UA 2Q1FA 2JKBA 1CWPA 4ZZ8A 1OA3A 4GD4A 1Z7S1 4WM8C 1LOFC 5FPLA 3POJA 4E2QA 2HWF1 2XJSA 3KF5A 4NIDA 3HN3A 5JXJA 1UU4A 3RNSA 1MQTA 2JG9B 5C4WB 4XC9A 1N1YA 2ARCA 1FOD3 2GH2A 4OHVA 2CGPA 1CIWA 3FC0A 4Q0SA 3KM5A 4EN9B 5HBAA 2MNGA 3P5BA 2PAMA 1SFNA 3GJBA 4I01A 3VBHB 3ZYPA 4QKNA 3NRUA 5J36A 1QWRA 3PJYA 5BY5A 1EUTA 1ZNPA 2WYSA 2Z42A 3W20A 1V6JA 2EXKA 4LHNA 5DN2A 4JQRA 5C9AA 4LORA 4CEWA 3MEPA 2WKKA 4ZY9A 1KQRA 5FBZA 5FZKA 5DMYA 2JEMA 1XRUA 4AVTA 2Q4SA 3I97A 3UV9A 4MGYE 3I3BA 3LSDA 2VOTA 4LIUA 5A1LA 2GP5A 1EAH1 1VLNA 3NNLA 4GWIA 2A75A 1S55A 2D6PA 3CZJA 2YC4A 5FK7A 2LALA 1AR61 3GZAA 3LA2A 4ASLA 1SPPA 4Y5Z0 2P3JA 1GUIA 4HPKB 5CBLA 1CX1A 2ZGOA 4EWEA 3O1TA 4IE6A 5EPAA 4XBNA 3U10A 1JU3A 2VMCA 5F6LB 4Y5TA 2ZGQA 5D2AA 2CU5A 4MADA 1W9FA 4QX2A 4AXOA 5FWJA 4HBNA 2WNOA 4J25A 2BWAA 4HMZA 1UNBA 3AK0A 4NRMA 2R32A 3MIGA 4DUVA 4O65A 4ES8A 1FNYA 1NLRA 2WZR2 2QZ2A 4UOJA 1W6NA 4LBNA 2XKPA 2B46X 3GBFA 3NQHA 3PIJA 1RVF3 1JYIA 1PVC3 1DYPA 4OFGA 5KXBA 1RMU3 5FYVA 5FV3A 1R083 4NHLA 2PHWA 4QPGC 2K2SA 4YG3A 3T0AA 1JZ2A 2R49A 2VH9A 5J3UA 3IAQA 3WG2A 3VKNA 2A6VA 1YI9A 2VOKA 4DO0A 4XJ8A 1O8PA 4Y3OA 2DCZA 4FPCA 1F5FA 2OIIA 4HLTA 3KCYA 4CRQA 1TVGA 1VBA2 2AACA 3O0XA 1J3QA 2ZX0A 4HK8A 1QJX1 5L7OC 3MLLA 1IOAA 3BTYA 4IEZA 2WDBA 1LHVA 4PBOA 3DUIA 1GLHA 3KV4A 4ZXEA 1CVNA 1NT0A 5FYIA 5JDBA 4Q4W1 2EAAA 2OS2A 4LNVA 2KM2A 5FFOC 3WNLA 2RDRA 1UOJA 1PMIA 1NA1B 3OCPA 5ANNA 1POQA 5K0UA 4AK3A 5CIRA 3S57A 3A21A 3R4SA 4HT1T 4K21A 1AHSA 3EQEA 2FD8A 3TN92 1F8VA 3HVDA 3KSCA 3NKGA 1H9PA 5CFDB 4XILA 1YQ6A 4RHV3 4W50A 4N7IA 5FMDA 1YUDA 4TLFA 1UU5A 3R0RA 1AR83 3O1SA 4QPYA 4CDXB 3RG0A 3GM8A 4MGTA 2A3XA 4E4ZA 4JRLA 1QHDA 3M3OA 3SCFA 1QOSA 4QQPA 4IGPA 2VTFA 2XLFA 2GALA 1BBT1 1U5XA 1PO21 5SV8A 4CEWB 4DUWA 1X82A 1HIXA 2VZQA 4YZ4A 4MX3A 2R1DA 4UW3A 3LKJA 1XE7A 3VDDA 3WUDA 1OH3A 1I5PA 1O59A 2ZX2A 3EJKA 3O14A 1W3VA 4YM2A 4OUSA 4IXLA 3EMRA 2A73B 3VBRA 1L3JA 1OXCA 4K20A 4BPZA 1PGL1 1MZFA 3POGA 2LW8A 5FP3A 5LATA 1RUC3 1T6GC 2GMEA 4BQ4A 3SEEA 3I8TA 3OBAA 4ARYA 1RTVA 2CHHA 1SPPB 5LZ6A 3LA7A 2WLPA 3JBG2 1I3HA 3HT2A 3PURA 5LBFA 3WVJA 5F37A 3J8F1 4YNIA 4GB31 5LK5A 3V64A 1E5SA 4Z82A 2KR2A 2Q1MA 5E88A 2ZEXA 3VDAA 5FPBA 5FZ7A 2BW8A 3LPGA 2PTMA 5FIXA 3NNGA 4HL0A 3HN1A 4OUEA 5DZEA 4B4RA 4GMP3 4CXXA 1XPWA 3C7HA 3L2YA 3P3NA 3QBQA 1PGW1 3ILNA 2P5BA 3H3UA 1HV0A 1SBEA 4ZS3A 5C8WA 5JCTA 1REEA 4OI4A 2JE7A 3DF0A 3WG3A 5I8SA 4Q4X2 1GICA 4Q4V2 3B69A 2PHDA 5A6XA 1NCRB 3AKSA 3ZXEA 2NN8A 1S2BA 1X9TA 1L7LA 1QH6A 5G04L 3WNNA 1RC6A 3R6SA 1OD3A 5GLZA 3RGBA 3T4VA 4YG6A 5JOWA 1HRV2 3WQBA 3C7OA 5JZGA 1DFQA 3U37A 1O4TA 2ZEYA 4D6SA 3FUOA 1MEC3 1F2NA 1RUOA 4L9BA 3B94A 4NRPA 1VALA 2WT2A 4LR4A 4RR3C 5D8AC 2L9LA 3DYMA 3AMNA 4P9GA 4FTEA 4CDUA 3BTAA 4NIAA 2C9AA 3ZN6B 5C33A 1DCSA 4LUKA 4X8NA 4EJRA 1H8TA 1VRH2 4LBQD 4QX5A 4QXCA 1QQP2 2R30A 1SLCA 4GIQA 3VGIA 3ZXFA 4I09A 1WW5A 3OPWA 5L9BA 4CPBD 1AR92 5E89A 1V6KA 3RPQA 1GBGA 3RRDA 5A3UA 1RINA 5BNPC 3K3NA 1CZVA 1GOGA 1XXNA 4OQ9A 3PL0A 3CF6E 4E2GA 1ZBE3 4Z07A 1CAXB 3IKWA 2HYXA 3K46A 4K6BA 4UW6A 3WY6A 1R1A1 4MGQA 2G9FA 3IZOA 4X6RB 1HRI2 1PHMA 1TNFA 1U0AA 2CV6A 3MF6A 1PX3A 3WF3A 4OHWA 4OHXA 2CGNA 1CQ9A 2IVIB 1V6MA 1B35A 2VOXA 2VC9A 4H55A 2XPJA 3ZFGC 3DCQA 2OPWA 3VDDB 4Q5OA 4NROA 2X8KA 2QE3A 2ZGUA 2ZZJA 2RR12 4XW3A 3VBRB 3KV9A 4R9BA 1OD5A 2JDAA 5GLUA 3VHNA 1VRBA 1W6QB 3GF6A 3P1IA 4GALA 4D3WA 5JZGC 1SZBA 5EZWA 1XE0A 3JD72 4B4QA 2W08A 2CWSA 5GZFA 3LIHA 4C90A 3C7FA 4EE2A 2A3YA 5B4NA 2GP3A 3O12A 3N3HA 1OKQA 1C8M3 1ZRRA 2Q5TA 4QU1A 5FZ4A 3WDYA 3LPFA 1A34A 1FPN1 1S0CA 1W9TA 5TSWA 4BM8A 5FZIA 2PHXA 5B2GB 2VNGA 2KXLA 3AKPA 4DNYA 3CIHA 3E1F1 1UQXA 2EIDA 4ITCA 1DGRA 2E7TA 5A33B 3I2DA 1F35A 3D0JA 4JGZC 2EXHA 4E4DX 5A1FA 2C24A 4CU6A 5J7MA 1N47A 2IXKA 1UX6A 1WMXA 3VDCA 2XBO3 4UF0B 4OLLA 2HWD1 1B35C 1PM7A 1VBE2 3VZLA 2FDFA 1BK1A 3ZFEC 4Y1VA 2VZTA 4LXLA 3RQ0A 5CG9A 5EJ1B 5J48A 1OQDA 4BWOA 3OYWA 3BI3A 5EFUA 1QXJA 4UW4A 2IZWA 3ASIA 4YGBA 3JB8A 3NJZA 2QDNA 3GYDA 1D0HA 1UZVA 5LCWL 5FZ6A 3BN6A 4TTGA 3CDZB 2A70A 4QX0A 1CJDA 5IVVA 4N53A 1MACA 5DZFA 2VBBA 4AZZA 4EWAA 4CDUB 2ZS6B 5LA0A 4I2OA 1ZBE2 3HNBM 4QPWA 1H8TB 1JYCA 1Y9MA 1XNCA 2ZGKA 4JC1A 4BH9A 1Z7S3 5JI9A 4CEYC 1XSQA 2HWF3 1H1IA 5BYNA 3NNMA 5FMCA 4CP9B 3LB9A 1WLCA 4ZU5A 2WSVA 3BIEA 5AVPA 2C4XA 3B00A 3VBSB 1RGSA 4QQLA 5FZEA 5AC91 1WBFA 4RGGA 4EWDA 1JW6A 4XF1A 1TEIA 3MFAA 2BGOA 2WT0A 4C91A 5ANQA 1LB2A 1ZVFA 2ZKNA 1O3TA 3N9QA 3I2HA 1ZA7A 5FXWA 2JECA 1SFPA 1YIPA 4R4XA 2XL9A 4CUAA 4CXWA 3V65A 4CUGA 1C8M2 2FBEA 1DGWA 1PIV1 2XR4A 2VL4A 4NE9A 4I0WB 2CL2A 4N43B 1VAVA 3SITA 1SQ4A 4IGOA 2P3IA 4S2GA 1HXS1 2P17A 1RUG2 3OGSA 3WNXA 2GNTA 1QJU1 3NNJA 3PTRB 3MHZA 1GQGA 1EAH3 4I3GA 2D6KA 4IE5A 2XLAA 4DRRA 4K8RB 4OHZA 1FMD2 1ULCA 2RDQA 3P6BA 5E16A 2WS93 3DEMA 1POV0 5FZ0A 5FY0A 1DIWA 2VNRA 1H8VA 1Q5OA 1UY4A 3I3MA 1SG3A 1TQ5A 4JTNA 1OH4A 2BGPA 3SMHA 3DXUA 3M2MA 3RYKA 3ZFFC 2QQJA 2ETEA 2JIGA 4XACA 2H6BA 5ERLA 1ASJ1 1ZZ7A 4XZPA 1QJY1 3VHOA 4XBLA 5FUNA 3IDBB 2E63A 2QQOA 3CU7A 2XH6A 3HBZA 4L0PA 2GAUA 5BNOA 1SBFA 4NHKA 4QB6A 3VBOA 4DS0A 1REFA 3PVNA 4JQTA 1XE8A 1O5UA 2P3KA 2RS12 1RUH2 1IKPA 2VBPA 3W9AA 2F4PA 4NHMA 3T4HB 2W91A 3VKMA 3H8RA 1JH5A 1KS4A 4GH4C 1XQNA 1QJEA 2ZTNA 4E27A 1DGLA 1JXNA 1RUJ1 2D6OX 4WM7C 1QNYA 2O1QA 1N3OA 2W9XA 3OGJA 3OUHA 4D6RA 3D5OA 1LEDA 2C26A 4N53B 1X36A 2GMPA 3ETPA 4XFHA 4PQ9A 2D7FA 3N9MA 5FJHA 2ENRA 2FZ2A 1YNAA 2IFRA 3NKTA 1VBD3 1H4HA 2CGOA 2XJTA 4FPKA 4ATFA 1MZ5A 1W6MA 2BEOA 4MZUA 4Q4W3 3VD5A 1GZWB 3VD7A 1G8WA 4XUQA 3OY8A 3CBNA 4S2DA 2NMNA 4E8CA 2EICA 5F5CA 4XZUG 3UJQA 4RN5A 2WNVA 3FE5A 2D40A 1VBB1 3EB7A 2PXJA 3C3VA 1S1AA 3SKVA 1UY2A 1FI2A 3KVAA 1DP0A 4ASKA 1JZ6A 4PHZA 2YXSA 1GNZA 4JHTA 4FAHA 3VBOC 1RUF1 2VW2A 4Y1ZA 5A6QA 4G4FA 1KXGA 4Y22B 1C57A 1ND2B 4IE4A 2JX9A 3WXPA 5E8AA 3Q8BA 1BBT3 4Q4Y1 2MHFA 4K7JA 4CP1A 4ATEA 1BZWA 2ZGSA 4MXWA 2K9ZA 5CFCA 3GCXA 1XYPA 2WS92 2D6NA 4DY3A 3CO2A 1XU2A 4Y20B 4Q2FA 4BK5A 1DZQA 1MS1A 2LROA 2CYFA 5A3TA 3IAPA 5F2WA 2QZ3A 5I0TA 2C0ZA 2JDKA 5ABJC 3K3OA 1OLRA 3ZYJB 2W1QA 1AL22 3BODA 1ONAA 1CPMA 1SBDA 1UIJA 1CAVA 1XSRA 3OUJA 4QKFA 3WNKA 1UCXA 3TEZA 4V1PA 1WCQA 1JYWA 5A6ZA 3AYCA 4QXHA 3W5NA 2OW4A 1U5IA 4OMCA 1PO11 4KU8A 3SH4A 3J8F3 2RDNA 5IYYA 1TZOA 1YC61 4GB33 1RITA 2CWMA 1J3PA 3ZOIA 3QCWA 4FFHA 1TG7A 2J1UA 2Y6FA 4HVOA 5A7WB 4QM9A 4A3ZA 5FUPA 2Y60A 5LEKA 2NP0A 1UYZA 4CDQA 1ZA4A 3WOGA 4OQ8A 2PELA 4CDWB 1LR5A 1SDWA 4IEYA 1OI6A 3MGUA 1SLAA 1POV1 3THDA 4AFAA 1UZWA 1BEV3 1LNSA 2LS6A 3MIHA 2VMGA 3FL7A 4FFGA 3MI8A 1RHI2 1UAIA 2P6HA 2EVXA 1HV1A 1LTEA 1W6OA 3IDEA 3K4ZA 1AJOA 2SLIA 3KT1A 3VBUA 1VBD2 2EXIA 1DLLA 4YZ1A 1RXGA 2V09A 1XNBA 4XJAA 4Z8BA 4BJ0A 1QIQA 1UPIA 2NQYA 2VD7A 2VVEA 4UFHA 1GYKA 1W9WA 5AFEA 4Y1UA 1XU1A 2C5DA 3NV2A 1ZZBA 4SBVA 3AKQA 4YVWA 4QU2A 3I59A 2ZA9A 4GJZA 1NLQA 1UN1A 4JGYA 1WLWA 1UYPA 2NPIA 3AP7A 2WZEA 2BNMA 4WVVA 4K40A 2WNUA 1UL9A 1OC1A 4E9KA 3ZSJA 4PDWA 3C8XA 4MGSA 1BMV2 2YPJA 3IMNA 3U14A 1AYM1 2XHKA 2XQXA 2ZXQA 3HOBA 2J1SA 3UKVA 4M3CF 1NKGA 2JDNA 2P37A 4S2HA 5LB6A 3IM0A 1LEMA 2D5FA 4RGAA 3WDTA 1R1A3 1B09A 3Q8FA 1CN1A 4OI1A 4M0NA 4N7UA 2XQRA 2VBDA 5CNAA 2B7YA 4OZXA 5FMBA 1O3QA 5CFCB 2YU2A 3CJIA 1H2NA 4MXWB 4HZFA 2Q0AA 1Z78A 3POIA 1O4YA 4BB3A 4ZU7A 5FWEA 5FMOS 2XVLA 2XJRA 1JOJA 2R041 4P08A 4XF3A 3J8F2 3U4XA 4PJYA 5HCBA 1Q3EA 4UBGA 3ZYFA 1NQDA 4H3WA 1ND3A 2HWE2 1UX7A 1AYN2 5FY8A 5J09A 1Y7BA 4RQPC 2IC1A 3ZYHA 5IHRA 2BVBA 4A7YA 1NAEA 1G9BA 2WL1A 5DDJ1 2FDJA 5C3QA 4W6WA 1NYWA 1WCSA 4HN0A 4IESA 4LE4A 5JVVA 1JU4A 1G7YA 1AR71 1VAKA 1BEV2 1FPN3 1D4M2 2D98A 2QJVA 2WNUC 2OUHA 5LBBA 4GWMA 2OZJA 3INAA 4CDQB 4QB2A 4LO4B 3RZMA 3OTFA 3UYJA 3UJOA 4H14A 3I7DA 5GM0A 4XAEA 4M0HA 1UKGA 2WJSA 2XKOA 3DPRB 2BGCA 3KWVA 4LO8A 4XOGA 4EZ4A 2WFPA 2HWD3 3HBKA 1LGBA 1OOPC 4HN1A 1JOPA 5H9RA 3VBUB 3N9LA 3ZKYA 5FPXA 1I1EA 3DKWA 2PHFA 1FV2A 3POWA 2R062 3JZVA 2FDGA 3QH7A 2A5ZA 4XPVA 5F5AA 5EYXA 4AQ6A 1K5MB 3UKNA 3S6PA 1U5YA 2ORZA 2IVJA 2ZEZA 1KFUL 2RMU2 4LHLA 1TME1 2Y64A 4ZHNA 5FP9A 2RHPA 1ZRDA 3WCSA 1YQ2A 3N7LA 4JVAA 2VTXJ 5D21A 1QGLA 5H9PA 2DBNA 5F7UA 1ALYA 3MV01 1OLME 1H0BA 4QDSA 3QACA 4WM8A 1LOFA 4XURA 4ZPIA 3AMQA 3ZPYA 4HKOA 3UL2A 3R4DB 4M00A 1CJPA 1ZZ6A 2YFZA 2YG0A 4PDWB 3AL6A 4TXWA 1YCIA 2C1FA 2VY0A 5IAVA 4COZA 4ASMB 4D94A 5D1IA 1DU3D 5AC93 4RFRB 3U78A 2BOIA 2XJUA 1OLMA 4AGVA 4AW7A 4CA9A 2WT1A 2XVKA 4IV3B 4P5YA 5A7PA 4ORFA 3IT8A 3WP5A 5EIYB 1LCLA 1M06G 2DUPA 1IHMA 4XDQA 2YYOA 4Q0PA 5FZOB 3D3AA 3T0DA 3CJIB 4PCRA 2UWBA 1Y3TA 2ZGMA 4DXSA 3MBWA 4YVSB 2WNEA 1W9YA 3BU7A 2VM9A 2MEV1 3C7EA 2W2IA 2JG9C 4JDMA 3O5SA 4DXRA 1DQ5A 3OBTA 4BYYA 4IERA 1PIV3 2OUJA 3T1MA 1ND3B 5F3CA 3PUIA 1HXS3 5FR3A 1SLTA 3VBHC 4DEVA 1V70A 2E26A 1TNRA 3B9CA 3F95A 3ZXKA 1WCKA 4LT5A 1ENQA 3WZ1A 4IGQA 3Q8CA 5IVYA 3A0KA 1Y4WA 1XNDA 2RM21 2V72A 2VULA 3JU9A 5DPNA 1F4AA 1OPMA 3AFGA 4IEVA 5KHHA 3MPBA 4EN8B 4YFZA 2IWGB 4YZ3A 2YU1A 1KDMA 3N4MA 3A7QA 1ULGA 3CJXA 1WW4A 1AJKA 5E6HA 2BBVA 2IXHA 1S0FA 1WCUA 1QEXA 3V0BA 3PIGA 1QJY3 4EV0A 2WO2A 1LJ7A 4Q0QA 1UMIA 4CU7A 4LO7A 4LA3A 1JUHA 1GWLA 2YC0A 1NOVA 2GNDA 3AC0A 4QPGA 3AMMA 5FTTC 4A6SA 2VMHA 1RUE1 1JZ7A 4V2WA 1RUJ3 3C7GA 4FI9A 3SNMA 4C0HA 3SEPA 1OVSA 3G6JB 2V4VA 4LE3A 3AYEA 1DQ6A 2UURA 1VBC1 2IUWA 2A6XA 3TRSB 1SACA 5L7OA 4NR1A 5IATA 1GFF2 1EYBA 4HKWA 4MH0E 4XQWA 5A1AA 4LBLA 5C3SA 1SLIA 1N1TA 4AL9A 4NN0A 1GNYA 4HVQA 4FPFA 3BIWE 2E7QA 5LRRA 1DF0A 2UWAA 2RS52 3O1UA 1QY4A 3JB4C 2UWCA 1JZ5A 5DQ0A 1HB1A 1HN1A 2ZGLA 4AVBA 2BQPA 2GNMA 4A4AA 2C9KA 5GZEA 3HQUA 3AYDA 4FPGA 1IG3A 2BWCA 4CU9A 5ACA3 3MUY1 1GR3A 2EAKA 2IFWA 2JB8A 3UGFA 4AF9A 1ZX5A 3BKZA 1BVVA 3KS7A 1NQJA 5FY4A 4AHXA 3LF7A 4QHBA 3THCA 1A6CA 5FPUA 1YEWA 3ECQA 4MHUA 2WZPP 2WA4A 2D97A 5CISA 4K1ZA 2ZAHA 3I3QA 4NHXA 4Q4Y3 1QOOA 2VUDA 4Y1YA 1I6XA 3BU0A 2CSGA 4FOVA 1DQ4A 5FYBA 3SQOA 1VAMA 1VPHA 3NWKA 4JRAA 1D2QA 5LBEA 5CFDC 2RE9A 1H2LA 3QD6A 2VZOA 1RUD1 5DAWA 1FOD2 2DU1A 2YZ4A 4A44A 2PLV1 4CDXC 3D4KA 2JE9A 2Q30A 5LW9A 2A7AA 3GZTB 3H50A 1MQTB 1ULPA 4HETA 3S0MA 1KJLA 1W8WA 1ZRCA 3WHTA 2HYKA 3A0NA 3WF2A 1S0JA 1W05A 2QQIA 2BV4A 5F39A 3DKQA 2BVVA 2GN7A 3WSOA 1ODMA 1IQDC 1LGCA 3E5UA 1OQ1A 2QNKA 2EF6A 2BTVC 4BISA 2VMIA 4IEPA 1T6BX 1CGPA 4MXVA 2WA3A 1OKOA 1ENXA 4MGIE 2DU0A 1Y9QA 3A22A 1CX4A 2OQ7A 1GQPA 1POV3 4J6GA 1G9AA 2FQPA 3V0AA 2JG8C 2HLEA 5GALA 3P3PA 5C9AB 4BMEA 2VQUA 3LDRA 2HBUA 3H0OA 1KEXA 4QPGB 1Q8SA 4A2UA 1GSLA 3S5AA 1RIRA 5FPZA 4DOUA 5IK7A 4QDRA 5JMCA 1YHFA 2YHJA 1PK6A 4DIQA 3WW3A 3ZXJA 1W8OA 2Z5WA 2ZHMA 3NVCA 3ES1A 1XNAA 5CZKA 4KG0A 5LY1A 5L7OB 2UYAA 1O8SA 2JXAA 4YFWA 5IFPA 3THTA 3PVBB 1JOBA 3KHBA 3HPNA 4FO9A 5D8AA 4RR3A 2BFUS 2JENA 3KD4A 3E6CC 2ZGNA 2XMLA 5ACA2 5CA6A 3JUUA 3N9NA 4Z1VA 2NYYA 5FZBA 4URTA 1RVF2 1YFXA 4Q26A 2WN2A 1R091 1PVC2 3ZN4A 3ZN5A 1RMU2 1R082 4NIHA 1H6YA 3AXEA 3E6DA 5BNPA 3EBRA 4FBFA 1W99A 4TWTA 4IUGA 1W6NB 4WZCA 4PF1A 2WWSA 3J7HA 3KCCA 3KMHA 4L11A 5FCCA 1MPXA 3CHXA 1AYM3 5KXDA 2I45A 4LHKA 3POYA 3VBFC 5AVAA 1WA6X 2DWRA 5FYUA 1Q56A 1VMFA 4PT6A 4PLNA 1IS3A 2BERA 3O1PA 4AYUA 4GULA 2Q8CA 3AYAA 1WMFA 1C8NA 3ZFGA 1MR5A 2CAVA 3RYPA 1PK6C 3PVOA 2AUYA 1SHWB 1GV9A 1ZBA1 1C3HA 5FAXA 4Q8KA 3MZHA 3VL9A 2QFEA 4GWJA 4K3UA 4AVVA 2Y0OA 5BUVA 1W06A 1O91A 2R043 5I0RA 4OHYA 5JWPA 5A7SA 3BOWA 2PAKA 5JOXA 1V9U1 3IPVA 1Q8QA 1IPJA 3LEGA 4JKMA 4W6XA 3ZSLA 2DUQA 3HWJA 2RS31 4YLZA 4RHV2 1IG0A 4META 5K0UB 3BPZA 4WV8A 1AR82 1DQ0A 5DDJ3 4CYDA 1O3RA 2QQMA 3KCXA 1OHFA 2ADDA 2WFF1 5FOJB 3RZGA 3J7LA 3MO4A 1AR73 1US2A 3I54A 4W8JA 2ZOEB 1COV1 4C8DA 3ELNA 2XWJB 5C71A 2YMZA 4JGZA 2HWB1 1WWYA 1TMF1 2QUOA 3AP9A 4P9LA 1VB4A 5KHJA 2YUEA 1K3IA 2EXJA 2AZ5A 1UWWA 1O7FA 3Q8EA 4GQ7A 5T52A 4R8HA 1RUC2 3ZSEA 4IEWA 4UFLA 2GMMA 4XJZA 2J1EA 2X29A 1W0NA 1GNHA 1OQEA 3OJBA 5C5UA 5A3NA 2A6YA 5FY9A 4CCMA 3PHMA 3ZFEA 1WW6A 4M4RA 4CP2A 5DUWA 3PJQA 4XF9A 3VD3A 1CAWA 2W1WA 3GHNA 2N7GA 5T5JA 4YZ5A 4AQTA 4YW2A 1NUKA 1DGWX 2J7MA 2X10A 2PYTA 5FYYA 1A8MA 1O6UA 3OGVA 1J58A 4LHSA 3ZKUA 4JDNA 1TME3 5D8AB 4XETA 1GWMA 2VPVA 4R4ZA 3VZOA 3BGAA 5BV6A 5T55A 2JE8A 3AP6A 1JYTA 4AI1A 4FPYA 3ZYBA 3DYPA 1XC6A 3AXDA 5FZ1A 1AX0A 2YC2A 2QQUA 1KJRA 4CEYA 2R073 4LULA 4FFIA 4PIXA 4L2NA 3ETQA 3L2HA 5FMOL 4QGMA 2B9UA 4UXAA 3O7OA 4A42A 1NCQA 1IS6A 3B5LB 1BXHA 2R042 3UGHA 4U36A 4XUNA 3UKTA 3DYOA 4XF0A 5F5IA 1EV11 3W59A 3N9OA 3ZFGB 1ENSA 4LLOA 1H30A 1MEC2 1W8ZA 4U2AA 3WP3A 1U12A 3SH3A 1LOAA 4UFJA 4XDPA 5HCHA 4ZXKA 4FSJA 1E5IA 1J83A 2MEV3 4Y33A 3MW4A 3PUQA 5JZGB 1VMJA 4WBBA 3VBSC 5IVEA 3H7JA 5I0SA 1YQ8A 2GSYA 4MYEA 1YFUA 3NO8A 4E4HA 4LBOA 3FX3A 1GU3A 3F2ZA 2HKXA 2XDVA 2WO3A 3J7MA 1W6PA 3D82A 3I49A 4OCTA 1LULA 2C6SA 3LWCA 4Z2WA 2OA2A 1C5HA 3POEA 3T09A 4UFMA 2IXIA 2ATFA 5BNQA 4BU2A 2RM23 1MS0A 2VZPA 3MLKA 4N43C 3WP6A 4JGZB 3WG1A 1NCQC 3KGZA 3UNPA 1DBNA 4D8MA 3ZFFA 4OVEA 3WDVA 2Y6JA 4CTEA 2B39A 1OUSA 2X09A 2JDUA 4IQPA 3HEIA 3OGRA 1B35B 1LHOA 1OF4A 3OG2A 1F31A 4EN7B 3KT7A 3ZFEB 3PU8A 3AFKA 3JCIA 3SH5A 2DVBA 1YI7A 1ZM1A 4OMDA 1G9CA 1RYYA 5FLHA 2AR6A 3WX5A 3Q8AA 5IK8A 3NL1A 3NAPA 5F6KA 1W3XA 1RUE3 2OPKA 4GH4A 4KWUA 3T2QA 3VL8A 4XXPA 3UESA 4WM7A 2D3SA 1AX1A 3WQ0A 1NY72 2XB6C 3ABZA 2R072 3NV3A 4YW4A 3EXUA 1OMIA 1MS3A 2E6VA 1OSGA 4GA9A 4RA0A 4COVA 1VBC3 3U75A 5C3RA 1J84A 1AR63 2GC1A 2TUNA 1LKNA 4E8DA 4RL7A 3MLJA 4KU7A 2XBO2 1HKDA 1YJLA 3KT4A 2FDHA 3POBA 4QAWA 4QKDA 2WZR1 2E53A 1LRHA 3HAGA 3K75B 4J1WA 5EHDA 1LOEA 3AKTA 4Q29A 3S5QA 4MHRA 1UMZA 3APBA 5FPVA 4JV4A 4YM1A 3ATGA 3OUIA 2ZBJA 5I93A 3RMYA 5EJ3A 2BOJA 2A3WA 4BXFA 2E51A 4YGCA 1NX9A 5FZ3A 3TEXA 2LRPA 1G86A 4INDA 2JDPA 1RB8G 2ID4A 4IV1C 4LOSA 4AI9A 3RZHA 5BNNC 1AZDA 4BHPA 1WLDA 2FMDA 3D8CA 3TOJA 1C5IA 2DDUA 2SBAA 1VBA1 3OYWB 5LWBA 2XJPA 2BNNA 2JDHA 1IZ3A 1W0OA 3PVEA 3NAPC 2B45X 5F8PA 5FUIA 2F17A 4BQ5A 3H1WA 3ES4A 1Z7S2 2QDRA 1URXA 2HWF2 5FP8A 5FOBB 1MS5A 3USUA 2KD7A 4CCKA 2VO5A 3OD4A 4BQ1A 1RUD3 2WYFA 5A3LA 5KC5A 1QJX3 1V6NA 1UIKA 4BMBA 3VZNA 1W6PB 3FHAA 3LAGA 5ABJA 4TZDA 2PLV3 3K4AA 2VVDA 3I2FA 4GXLA 2B9VA 3TN91 2PN5A 5FKCA 5IVJA 4F3JA 5KC6A 5JI7A 4ARXA 1ND2C 4PLOA 1KD7A 2OT7A 3ZXLA 2E31A 2MPFA 5FYHA 3OGGA 4KL1A 4RYDA 3VZJA 3LD8A 3PNAA 3CMGA 4AEMA 2QKDA 5CKQA 1KS5A 5FYMA 5A7OA 1UO9A 2HEVF 1YIFA 4W65A 2D44A 2VNOA 4D7TA 4P9WA 1JYVA 3RZJA 4IL7A 4KWLA 5F1RA 1HB2A 2Z79A 4GMP0 5FZMA 3SKJE 4WVWA 4XTPA 4V2VA 1PNGA 5GZDA 5FY1A 2E7AA 3J7NA 1GZ9A 1EAH2 3AMPA 3POFA 3UGGA 1UKRA 2A6ZA 3JQWA 1PO23 2H0BA 4AEJA 1JZ4A 1LESA 2WN3A 4XQDA 4D69A 1AR62 1W28A 4GH4B 3ORJA 1HQLA 1BYHA 1QF3A 3AKRA 4WM7B 1N3PA 2R16A 4QQHA 5SV5A 5FZ9A 1QMJA 1AX2A 4DY5A 4HANA 2VCBA 2VECA 3DL3A 3JBG1 2Z2SB 5C3PA 2LUWA 3MICA 1L7QA 1LAJA 4JCKA 1EP0A 2XUEA 1GZTA 4QPIC 5DABA 3DECA 4XUPA 4XHBA 2DVFA 3RJ2X 1J1LA 2JJ6A 5JPMB 5CKMA 3B01A 3OBZA 3VD9A 1XNTA 2AYHA 5IVBA 2PHTA 4A41A 1XYNA 2WWUA 4QM8A 1LHUA 4AWDA 3FLRA 5CEHA 1R093 2W92A 5JIAA 4O7XA 1QDOA 1NLSA 3O1VA 4MO3M 1FNZA 2WO7A 4Q4X1 4Q4V1 2YV8A 2BPA2 2X05A 4AI2A 3JXSA 3WNPA 4AHYA 5BNOB 2WIIB 3VBOB 2PQQA 4CUBA 5C8CC 5HV0A 5A6YA 3ZIWA 1VB2A 4Q0VA 2VQTA 2GN3A 1FAYA 5I8TA 2W1SA 1HRV1 1QJX2 3I2JA 1ACCA 3EYPA 1REDA 3O1MA 4QD2A 3R05A 3M70A 4Q4W2 4NPRA 4GWNA 1ZBA3 3FZ3A 3NV1A 3USUB
chains in the Genus database with same CATH topology
2W0XA 3FMGA 4N90A 2XL7A 2CY6A 1FV3A 2UY8A 5A32A 1VRH1 2X53S 5ABJB 3MIEA 1QQP1 4JDOA 5JIUA 4AEDA 4M3CE 1W6MB 5GZCA 1EPWA 1AR91 3KQRA 2D6LX 1YFWA 3MDPA 3OY8B 4MGKE 4RQPA 5T54A 3ST7A 4RS5C 4FAGA 2DYCA 3RI8A 4BCUA 3WCRA 4RD7A 2WFF3 2ARXA 2WNVB 5EXOA 2GC2A 3AJZA 1HRI1 3PTYA 4YSFA 1COV3 1S2KA 1BBT2 3M3CA 1PO22 4M3CA 1W0PA 4B3NA 3RJRA 2DV9A 3SCGA 3ZYRA 2RJKA 3URFA 1X33A 2HWB3 4PF5A 2A71A 2RR11 1R1ZA 4B7KA 1PGL2 3POSA 1D4VB 3MFCA 1DZRA 4B29A 3N35A 4FXGB 4UBHA 1HQNA 1OOPA 2I2SA 4LBJA 3ZSMA 4BZ4A 3JD71 1BQPA 1QDCA 5JPNB 1BKZA 1LOGA 4GB32 2DVDA 4YW1A 4PBPA 4AHZA 2V5YA 2DVAA 4BOWA 4AEDC 1CAVB 2XG3A 2XVGA 1LGNA 3DPRC 3WQ7A 4LEJA 2I74A 4B4PA 3BCWA 1PGW2 3CNAA 4YW3A 1Z0HA 1AF9A 2YDEA 4Q1RA 1S0DA 4XMAA 3MW3A 3I4IA 1PGSA 1VBE1 1QJZA 2ZJCA 1JTZX 5CU1A 2ZGTA 2PHUA 2ET1A 3HIFA 4KBBA 4XHXA 2DF7A 3Q9OA 1H1AA 1ZZ8A 1ENRA 1W6OB 2VQAA 4XYXA 1IGOA 1NXMA 1PZ8A 2D43A 2AENA 3SCHA 3CL1A 1UD1A 4WZFA 4KNCA 5KXCA 3QOPA 1TE1B 2JG9A 5C4WA 2X5IC 3OF1A 1ZBE1 5FQ0A 5FRAA 3WHUA 1S0EA 4YVWB 4RQPB 3I59B 3VBHA 3ZDSA 4IEOA 1X7NA 2GU9A 4JGYB 1FATA 3KGLA 4HSLA 3AZXA 4BE3A 1AVBA 2AREA 1R1A2 3VV1A 2WNUB 3J4UH 4YVSC 3TNPB 4AVCA 1OA2A 4P9JA 2Y26A 3E5QA 3GZUC 3DGTA 3WW4A 1N1SA 4AFBA 3EO6A 1CONA 4LBQA 4I0AA 1FXZA 5J96B 1LENA 2ET7A 5IT6A 4AG4A 1MS4A 4R9DA 4XJUA 3M3IA 1OOPB 2K0GA 3AZZA 3GHMA 4EROA 3ZYGA 3NW4A 1FYUA 3B9IA 3B3QE 3HR9A 1RUG1 5HCFA 1YWKA 1JUIA 5C4WC 2W68A 4ONUA 1FPN2 1FMD1 1O3SA 2A6WA 5E1RA 3ZXAC 5EYYA 5JSPA 3BOPA 4COYA 1OA4A 1QJU3 2VXRA 4QQOA 4KWJA 3E5XA 1LOBA 1YFYA 1Y43B 5T5LA 2PHRA 4OI2A 2JICA 5T50A 1N3QA 2CTVA 2HWD2 1KDKA 2P34A 3WINE 5FDBA 3AM2A 2WZR3 1YXWA 2DTYA 2ZGRA 4TSVA 3AZVA 4AI0A 1GQHA 2JD4A 1APNA 2OZ6A 3LCPA 1OLQA 2RS11 3LOBA 1RUH1 1O4ZA 1ASJ3 4LO6B 3U0ZA 1DG6A 4M01A 3H1YA 2GDFA 3RMXA 2XJVA 3FUQA 3M3QA 5GJ6A 2VQ0A 5KWRA 1NXD1 4BA6A 1NA1A 1VBA3 4XTMA 4QGNA 5FQ0B 4DMIA 2R0HA 3TB0A 2WLQA 3ZIXA 5CFDA 3AZYA 4FPEA 3WR0A 4AQ2A 1S0GA 5BXXA 2DURA 4FOQA 4P14A 3ILRA 4AFMA 1Q8OA 4H7MA 3SHRA 4CDXA 4WM8B 2Q8OA 5AC92 1FT9A 4B7EA 3VKOA 2XGXA 3AP5A 3ZMNA 4MVTA 3TN93 5JR7B 4QT6A 1WUVA 2W39A 4DFSA 3RZZA 4YARA 5L36A 4QGLA 4ISRA 4CP0A 2VOWA 1MS9A 3B02A 4Y24A 3CEWA 1OPOA 2YY1A 3HQXA 4LBQB 4TYSA 1VBB3 2V73A 1CPNA 4XF4A 2D93A 1KRIA 4XIKA 3GALA 2YROA 1PIV2 3VKFC 1DQ1A 5H9SA 1NG0A 1RUF3 2NMOA 1S0BA 1HXS2 2WS91 5HXVA 2E9QA 3RWNA 4COUA 5JAXA 2JG8A 3B7MA 1ULDA 3LA3A 1QJU2 1MQTC 1NA1C 2VUJA 2YGLA 4P5HA 4FVVA 5FO7B 4I3PA 1AL21 3K51A 4FPJA 2ZABA 3EHKA 1A8DA 4KWKA 3JBG3 5DUXA 3N36A 3AMHA 1I9RA 3LOIA 4XIOA 2ARBA 1BJQA 5L73A 4LA2A 1OFNA 1BVP1 4C0BA 2B5HA 2VW1A 5C9AC 3OPZA 3MIFA 4CEWC 1ASJ2 1QJY2 3C2UA 3FBYA 1PO13 1NCRA 1MZ6A 2R6QA 2O8QA 5DG2A 1WGPA 1UZZA 3WUCA 2DFBA 4L8QA 4R9CA 3V0BB 1RHI1 4Q4X3 4Q4V3 3SLIA 3H8UA 1RUJ2 3VBFA 1VBD1 4A7KA 1G9FA 2QVSB 5JSRA 1X8EA 5DG1A 3TNQA 1A78A 4F83A 2ZHNA 2O8OA 3WQ1A 1NE6A 1YYNA 3RYRA 1HRV3 3ZN6A 4Q8LA 3M8LA 2I07B 4H7LA 4L99A 2UY9A 2HEWF 4OULA 3PMSA 4JAAA 3WLUA 2HWC1 1VIWB 3W58A 5J98B 1CAXA 1VRH3 4KG8A 4F8AA 1QQP3 1VBB2 4O9EA 1QNWA 1AR93 1WMEA 1BMV1 4BIFA 2DCKA 1NCRC 3S7IA 3NV4A 2P2KA 1RUF2 2PA7A 1ZZ9A 4KGQA 4FTBA 1SCRA 3G7DA 1HRI3 2R0FA 4Q4Y2 1W6QA 4YZ2A 1RUNA 4XFCA 3UK9A 5GLTA 2H0VA 1J59A 4LLFA 5K7PA 1ZZCA 2D3RA 2JG8B 5BPXA 3RSJA 4F7ZA 2RR13 4PLMA 5K0UC 5T3NA 2WSUA 5K8SA 2BYVE 4HK9A 3TAYA 1H2KA 4A7ZA 4YG0A 2YGMA 2HWE1 3H7YA 3JD73 1AYN1 4IETA 2F6BA 3IN9A 4FTSA 1DDLA 1DZTA 3WT3A 4LBMA 1PO12 4HFSA 1JBCA 2LM3A 5A33A 4I0BA 3O0VA 1BEV1 2DFCA 1D4M1 3SXWA 5AFBA 3VUOA 3MF9A 3BALA 4HSJA 3V56A 3ROUA 4ZU4A 3IIAA 2RJLA 3VDDC 3HD8B 3FJSA 3VBRC 5CADA 4X8PA 4IEUA 1Q8VA 1ZYBA 1V6OA 2R1BA 3VZMA 4KGGA 1I5ZA 2VU9A 4AFDA 2NLRA 4XFIA 3S30A 1VBE3 3VBFB 3V0AB 4GKYA 4C1XA 3TYJA 2IXJA 2R061 4DB5A 1IPKA 3AB0A 3GBWA 3GNEA 5HCAA 5LEJA 2AGSA 2HEYF 3LGRA 2RMU1 1PK6B 3TBDA 1Q8PA 1DQ2A 3JQXA 5I91A 1RJ7A 5GLVA 2TEPA 2Q1ZB 1X50A 4FQZA 4FXKB 3VBSA 2DVGA 5K9YA 2TNFA 1QXPA 3SISA 4RR3B 3ME2A 2ZMKA 4X6QB 1AYM2 1O5LA 1VP6A 4AVAA 2PHLA 1WA4A 4NWVA 4DXZA 2WINB 1VJ2A 4A3XA 5BNPB 4XFFA 1W39A 3M1HA 1RUI1 4N43A 1H4GA 1RJ8A 1F5JA 3E97A 2CNAA 2ZAAA 1EPZA 5I0UA 3H9AA 1MZEA 1UU6A 4CDUC 1YLLA 3TWIA 1H8TC 1C1LA 1AXKA 2ZKLA 2B42B 4N9HA 3MYXA 4WVZA 1MS8A 3ENRA 1RUG3 5DUUA 5DDJ2 1SFYA 2FZ1A 3H1MA 1QOTA 1V00A 1AR72 2ZX4A 1A3KA 4YM3A 4QQ2A 1FMD3 3IPVB 2TBVA 1WCDJ 1PVXA 1YO8A 3FFZA 3VN4A 3E6BA 3DN7A 4E4SA 3WP4A 4S2FA 4RFT0 4ZKTB 5T5PA 5JLVA 1C28A 4MSVA 4WVMA 4J1XA 1QKQA 2XJQA 5CVRA 1GKBA 2G4IA 3J26N 1SCSA 5I8YA 3WDXA 5A3MA 3ZXGA 3RDIA 3VLBB 2RS13 1RUH3 4FOYA 4O9GA 1CAUA 4IV1A 4KH9A 1NZCA 5BNNA 2EALA 3CLPA 1TME2 1UZYA 1UW8A 1CAWB 5DXDA 3KLSA 2O0OA 1GZWA 1W2UA 3BB6A 1KITA 1HW5A 2IXCA 4ISQA 3USSA 3FFQA 1WD3A 2B8MA 2RS51 4K8FA 3ILFA 4MGZE 3M4FA 5JOYA 3L9JT 4XJWA 4AQSA 4LUMA 5FREA 2G9GA 4CEYB 3ALQA 3ZYIB 4Y22A 5J37A 5KXEA 1ND2A 3IBMA 2ZACA 2ZX1A 2W52A 1IS5A 1G6NA 1NCQB 2DTWA 1GANA 4Q27A 4Y20A 4Y1XA 4N53C 2MEV2 2UYBA 4MLOA 5GLWA 2ZZQA 4R9AA 1CESA 5H9QA 2ZHLA 1MVEA 3IWZA 5FO8B 4AVSA 1SEFA 2D6MA 4G9SB 3K48A 4GKXA 1IKQA 4HVRA 1FOD1 3ZX7A 2NZ9A 1AL23 1E57A 4XFBA 3KZ4C 1G9DA 4YGDA 1ULFA 4FCAA 2RM22 4PIZA 3T1LA 2D3PA 2DUOA 4DZGA 4QPIA 3AP4A 1WD4A 4YGEA 4CDWA 3KB5A 5CAZA 4Z92B 2GC0A 2HJIA 3WDUA 4COWA 4AHWA 4WVMB 2GZWA 2ZMNA 2ZMLA 2ES3A 3B93A 4ES9A 2ERFA 2LTNA 5KBFA 1CD3G 4QMAA 3ZFFB 5C6CA 3QH6A 3LZZA 1RUE2 4FPOB 4KQ7A 1RHI3 1CAUB 5IUQA 1LODA 4IV1B 5BNNB 5C8CA 1PNFA 3AX4A 4W6YA 4D7SA 1VBC2 2WQ4A 1H9WA 3S7EA 2Y38A 3NAPB 4FT8A 4L97A 4B8EA 2D5HA 3OBRA 2QQPA 5L19A 3RI9A 1HDKA 5ACA1 1Q43A 4CDWC 2HWC3 5BNOC 1RVF1 4DPNA 5GKAC 1PVC1 1QXRA 1RMU1 3T2TA 4AI8A 1R081 4EN6B 1N1VA 1WLTA 4N9IA 3WDWA 4XEZA 4R52A 1DGRN 4K1YA 5LRSA 2H6CA 4RS5A 3WG4A 4P9YA 2XUMA 3N7KA 3GBGA 3AJYA 4Q0UA 5EWSA 1JHNA 1SMVA 1C1FA 4Y26A 1V6IA 5LK7B 2Y0IA 2KA3A 4YRDA 3WV6A 3O0WA 4XQ4A 1J3RA 1JN2P 1HX6A 3OD0A 5T5OA 2AH2A 3N7MA 2UU8A 2ZPXA 5KHGA 1RUD2 4NO4A 5F5QA 1SLBA 2PLV2 4Y4YA 4I30A 4P9IA 2WNVC 3VHRA 2WC2A 2NM1A 4NOTA 2IXLA 2HWE3 1H1MA 2DCTA 1AYN3 5FLJA 3RS6A 4RHV1 1V6LA 3FLTA 4YYOA 1AR81 5IK5A 4LBKA 4QPIB 2CAUA 3N7JA 4C1WA 1D4M3 1V9U3 1MVQA 2EA7A 4AE2A 5KHIA 2RS33 2GC3A 1DYKA 3DPRA 4E2SA 3MIDA 4UW5A 1S0IA 5CFCC 4G3YC 1PZ9A 3NSTA 2QCSB 1GZCA 3THPA 5GZGA 1YJKA 2VUAA 3X29B 1RUC1 1DHKB 4HKLA 1CR7A 2GH8A 1K5MA 4FP3A 3M7AA 5C8CB 2EIGA 4OUMA 5EV7A 1TMF3 2FMYA 1C4RA 4BLJA 3WW2A 1XYOA 2DCYA 3MPPG 4YW5A 2R063 4CZSA 2ZX3A 2HWC2 2BFUL 3DV8A 5KHKA 1ULEA 2VW0A 2WQZC 1HLCA 1FX5A 3D0SA 2PAEA 2RMU3 4FPLA 4XMIA 2FHRA 3WD5A 4FQ4A 4YM0A 5DUVA 1SLLA 5DZGA 3PMEA 4GMP1 4CDQC 4DINB 2X5IA 1R092 4NWWA 3HT1A 5CB7A 2VVFA 3MW2A 4XBQA 4IV3A 5JOZA 4I02A 1F9KA 4AEKA 1D2SA 4RS5B 4MV2A 2VG9A 3VBUC 4EN0A 4DQAA 3D6EA 3WW1A 3U11A 1AL0G 3FBMA 4YVSA 2OYZA 1YRZA 4IEXA 4LO5B 1K5MC 4P9XA 3ZVXA 2GNBA 4JTOA 1AXYA 1MEC1 1RUI3 2XLGA 1X8MA 1ZBA2 4MUVA 4XFAA 3ZXDA 4YVWC 3HMYA 2ZGPA 1U5ZA 4L92A 4DRVA 4JGYC 1HQWA 4LTAA 1EV13 3LSEA 3MIBA 1QU0A 1QH7A 1V9U2 3J9SA 3QLQA 2RS32 4PDWC 4IEQA 1NE4A 3ZO0B 2WFF2 4XJ9A 5A32B 4AI3A 3ZMOA 3PLQA 4AEDB 1COV2 1AUYA 4IV3C 4NVPA 2HWB2 1IQAA 3CJIC 3R4UA 4FPHA 1TMF2 4PIYA 1WW7A 4FP2A 1AXZA 4K9SA 1OFSA 2VOVA 3IDCB 4M3CB 1LECA 2ZCWA 4XFGA 3ZSKA 1KFXL 2PFWA 4AGGA 4QXKA 1ND3C 3U07A 4AFCA 2ZHKA 1LU1A 3AZWA 1C8M1 1RL3A 3VKLA 2VGDA 4AGRA 3ACLA 5HI0A 4HPKA 3M3EA 1NY71 2R071 3FLPA 2ILMA 4BIOA 1WMDA 3H3ZA 1VR3A 2X5IB 1D0GA 1UPSA 4XXAA 1J1TA 1LHWA 1LHNA 5JSOA 2OVUA 3VZKA 4BLIA 2XBO1 5CG8A 1WBLA 1M4WA 2DCJA 2BNOA 4SLIA 3VHPA 2Z69A 5FO9B 2RS53 1H2MA 1RUI2 1XNKA 2JDZA 4RSUA 4XE9A 5F9TA 1UF2C 1LU2A 3FWEA 1IS4A 3FHIB 1ZREA 1EY2A 1EV12 1LOCA 4FOWA 4D7YA 2XWBB 2BUKA 5FLIA 4Q1PA 1PZ7A 1BCXA 3A4UA 2JKBA 1OA3A 1Z7S1 4WM8C 1LOFC 4E2QA 2HWF1 2XJSA 1UU4A 3RNSA 1MQTA 2JG9B 5C4WB 1N1YA 1FOD3 2GH2A 4OHVA 2CGPA 1CIWA 3FC0A 4Q0SA 3KM5A 4EN9B 5HBAA 2MNGA 2PAMA 1SFNA 4I01A 3VBHB