2JJ6A

Crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
b'VPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-RELATED PROTEIN
publication title Crystal Structure of the Putative Carbohydrate Recognition Domain of Human Galectin-Related Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jj6A00
4FPKA 3WDTA 1AF9A 1TEIA 5JOWA 3VKLA 3HR9A 1FNYA 1RIRA 2Q5TA 5DG1A 2GALA 2WT1A 1WUVA 4AYUA 3FUQA 1DQ2A 1DIWA 4XE9A 1F31A 2ZGQA 1JYCA 3ZXEA 1SLAA 2EXJA 1QOTA 3O5SA 1BZWA 1QKQA 1DFQA 3SNMA 3LCPA 1DQ6A 3M3CA 2LALA 1S0GA 1MZ5A 2V73A 4U36A 3ENRA 4AGRA 1LHWA 2EF6A 4YGEA 5DZGA 1VAMA 3WV6A 2WNEA 1YI7A 2D6LX 1LEDA 1LESA 1ULDA 1WBLA 2G4IA 2PHRA 5JOXA 1LTEA 2DUOA 1JHNA 3O0VA 1UX6A 3AYCA 4UW3A 3WUCA 2ZGSA 1LGBA 2ENRA 1UMZA 3BOPA 1AXYA 1R1ZA 3FUOA 1LGCA 5DUVA 3SH4A 1UPSA 5EYYA 1RITA 2ZBJA 1PZ7A 4WV8A 4GALA 4JRAA 1LOFA 1ULGA 2A6YA 1V6KA 1V6MA 1VIWB 2EXKA 2UU8A 5DG2A 1X50A 1GANA 4YG3A 1SLLA 3QCWA 3WDVA 3MW2A 4K1YA 2YV8A 2W08A 1VLNA 1URXA 1UZYA 1SLCA 3SITA 2CNAA 2GNBA 1ENSA 5FREA 1DYPA 1JUIA 1V6OA 2AH2A 1MS0A 4R9AA 5T5JA 1WLWA 4XOGA 3ZYPA 1W0PA 2DU0A 1LJ7A 2E7TA 3OGGA 2D44A 3FFZA 1KJRA 1LGNA 2Z42A 4WVVA 4M3CB 3VUOA 2NN8A 3WLUA 1BKZA 5GZGA 4XHBA 3WDXA 1WLCA 3WCSA 1BJQA 4Y1ZA 2DURA 3O0WA 4FVVA 2VW1A 1QOSA 3SH3A 5DUWA 1QMJA 2P2KA 1Z0HA 4M3CA 5IK8A 3AJZA 1APNA 1IS3A 1CPNA 2GMEA 5HCFA 1FATA 1OFSA 2OVUA 3M3OA 4LBQD 1LHVA 3N7JA 4UW6A 2ZKNA 4BOWA 1LOEA 4XIOA 3HMYA 5E8AA 5HCBA 1DQ5A 1J1TA 1C1FA 3NWKA 5GZCA 3WUDA 1WW7A 5IUQA 4FOYA 3ZPYA 4YW2A 3ILNA 1S0JA 2DVDA 3OYWB 2WKKA 4FP3A 4Y1YA 1DYKA 4Z8BA 3AX4A 1Q8QA 2D6KA 1CESA 4D69A 1MS3A 3N36A 1S0CA 4UW4A 5GM0A 2EXIA 3ZXFA 1G9FA 3INAA 1CPMA 4FP2A 2DTWA 1ENQA 1H9PA 3OYWA 5GLWA 3AFKA 5H9RA 2E53A 4ZKTB 5CA6A 4YW5A 1Z78A 1JOJA 2JE9A 4XJ9A 2ZACA 2AGSA 2C5DA 1LU2A 3BIWE 1LOFC 2VXRA 1CQ9A 1W6MB 2AENA 4ITCA 4R9CA 4K21A 1WBFA 3N7LA 3UK9A 2ZHLA 4RA0A 1UN1A 2ZAAA 4DRRA 3D4KA 1YYNA 2VW0A 3AYAA 5AVAA 1MVQA 3M1HA 2C9AA 2ZHMA 2P3JA 1C57A 2WT2A 1S0FA 3JUUA 4XXAA 1W6MA 3Q9OA 4Q26A 2D43A 1G9CA 4LBQB 4IQPA 3ZSKA 3RS6A 2GMPA 1G9DA 1QGLA 4FPGA 5DUUA 2OUHA 2ZGTA 4CZSA 3SH5A 3B00A 2YROA 4OZXA 1CR7A 4LBQA 2YMZA 2W39A 4JCKA 4PQ9A 4YZ1A 3V0AB 4AWDA 4ISQA 3FBYA 5DZFA 1WD4A 4XIKA 1G86A 2JKBA 4YW3A 3JU9A 1N1VA 4XHXA 1BXHA 2ZGUA 3IPVA 4FQ4A 1N3QA 3V0AA 3SLIA 5GLZA 1C1LA 2DUQA 3WDYA 5JOYA 1AXZA 1SACA 2PHUA 2ES3A 1EPWA 5DZEA 1FAYA 1GV9A 3MPPG 4XTPA 5T52A 4DFSA 1LENA 3PMEA 5BYNA 3KM5A 1MS1A 2DVAA 4XZPA 1ZM1A 2DU1A 4XTMA 4PCRA 2VY0A 3OY8B 4BMEA 4M00A 1H9WA 1KJLA 1ENRA 2D3RA 4YZ5A 2JECA 5IK7A 1UZZA 4FPLA 2PHTA 2W52A 2NYYA 5H9QA 1S0IA 2ZGRA 1AJKA 3SISA 3OY8A 1D0HA 3POSA 5GLVA 4YFZA 1HLCA 1N3PA 2ZZJA 1I1EA 1DHKB 3T2TA 4GWMA 3V64A 4I30A 2DVBA 1SBFA 2ARBA 2VUAA 4FOQA 3M3EA 4P9YA 4XXPA 4YW4A 4L8QA 1CN1A 1DZQA 1LHNA 2EXHA 5IT6A 2CL2A 2ZGNA 1AVBA 3AZZA 3PJQA 1FYUA 4HL0A 2ZGOA 1FV2A 5GZDA 4PF5A 4YFWA 1QOOA 3W59A 2VH9A 3WHTA 1A78A 2ARXA 3I4IA 3R05A 1AX1A 4LBLA 3ZSJA 4Y22B 3B3QE 5HCAA 3WDUA 4XJZA 3UL2A 5JOZA 1YO8A 4AGVA 5SV8A 4CRQA 2JJ6A 3POYA 2E7QA 3DGTA 1OKQA 2A75A 3MW4A 4GKYA 2P3KA 4YZ4A 5GALA 2A7AA 4FPYA 1LODA 1ULFA 3ZVXA 1IKPA 4FPJA 1FNZA 4Y22A 3AXEA 1GZ9A 1YRZA 3AYDA 2UWBA 4LBKA 3WZ1A 3MEPA 2NMNA 4F83A 4YM3A 2OW4A 3I8TA 4C1WA 2GNTA 3AZYA 2ZMNA 3RG0A 2WLQA 3APBA 4TYSA 5JDBA 3AK0A 1IKQA 1SCRA 2D3SA 4FPFA 3HN1A 1GSLA 1UKGA 3U4XA 4Q27A 4XJUA 1G9AA 5IK4A 2ZMKA 1DLLA 2XB6C 4FPEA 1OQ1A 4GA9A 4NOTA 5T55A 4GKXA 4BQ1A 2ZABA 4FQZA 2CTVA 3M3QA 3T1MA 4XBNA 4ASMB 3TB0A 1F9KA 3ZYRA 5T5LA 1W6OB 2DUPA 1HDKA 1O4YA 2ZA9A 2GNMA 2WQZC 4Q8KA 3VV1A 4Y26A 4XJ8A 1DGLA 4AGGA 1SBEA 1QDOA 1VALA 1MACA 2GNDA 1HQLA 3IKWA 4R9DA 4YW1A 5T5PA 1W6OA 2CWMA 1GNHA 3AP4A 1CONA 4FOVA 3WHUA 1AXKA 5E89A 2DV9A 2ZGPA 2TEPA 4LBJA 3VKMA 3ZSMA 5T54A 1PZ8A 1AX2A 4XJAA 3T1LA 4BLJA 2PHXA 3D6EA 4FPOB 1KDMA 4BMBA 1BQPA 2DYCA 1QNYA 1NLSA 2ZGKA 5JVVA 3ZSLA 1MVEA 4H55A 3ZXJA 1N1SA 1I3HA 1S0BA 5JLVA 1A3KA 5H9PA 5CBLA 3IMNA 1SLTA 3WG3A 3LSEA 1KRIA 2DTYA 3NV3A 3OJBA 1GLHA 1IS6A 1G7YA 2A6XA 2D6OX 5KXEA 1AZDA 1W6PB 2GN7A 4FPCA 4DS0A 5KXCA 1MS5A 3PVNA 1WW6A 4XBQA 5GLTA 1ONAA 1Y7BA 2GN3A 3A0KA 4YG6A 3DUIA 1G9BA 4M3CF 1RINA 1NXD1 5FRAA 2P3IA 2UWAA 2ZHKA 2HYKA 1SLBA 3H0OA 4P9XA 1ULCA 3ZXLA 4ISRA 3R4SA 4YGDA 1PZ9A 2AYHA 3N7KA 1LECA 4XDQA 1LHOA 4K20A 5CAZA 1CVNA 1SFYA 4XMIA 3VKOA 3WCRA 1C4RA 4Q1PA 5F9TA 1HKDA 5T5OA 3NV1A 4C1XA 1N3OA 2V5YA 1JW6A 3OPZA 5GJ6A 2OUJA 1GZCA 4P9WA 5F5QA 1BYHA 2R0HA 4XBLA 4P14A 1JN2P 4Q8LA 1LOAA 3CNAA 3OBRA 4FOWA 3V65A 4HANA 2ERFA 5EWSA 1ULEA 1V6LA 4Y1XA 4XYXA 1Q8PA 5GZFA 1V00A 1HQWA 3V0BB 1GYKA 3B69A 1D2SA 4Q2FA 3USUB 2A6WA 2ZHNA 1CIWA 2H0BA 3AZVA 2FHRA 3N3HA 2R0FA 2I2SA 1WLDA 1SCSA 2A5ZA 2CWSA 1CJPA 2A70A 1GICA 3AJYA 3C2UA 4PBOA 3V0BA 1W6NB 3QLQA 5KXBA 1KITA 1V6IA 3USUA 4YM2A 2FMDA 4MYEA 2P37A 4ATEA 1FX5A 2WSVA 3OBTA 2VW2A 3NV2A 3A0NA 1S0DA 2SBAA 2E6VA 1QU0A 2AR6A 1W6NA 2JE7A 3WOGA 2R16A 4Q1RA 5CB7A 2EIGA 3AP5A 3W58A 2GMMA 1JBCA 2AREA 2D6MA 2LTNA 2A3YA 4M3CE 1N47A 3TAYA 2UWCA 3N7MA 2PHFA 2YXSA 4DRVA 5H9SA 3WDWA 1YXWA 2AUYA 1FV3A 5KXDA 3AXDA 1Q8OA 3BODA 5GLUA 3AP7A 1KDKA 4W65A 4XILA 5LK5A 4AVSA 3R4UA 2ZMLA 1V6NA 4YG0A 3WG2A 4WZFA 1MS8A 2A6VA 4FPHA 4LBMA 3IN9A 4NO4A 4GWNA 3UJQA 5T50A 1QNWA 1UAIA 4XMAA 1F5FA 1LOBA 1S1AA 3B01A 3ILFA 4LBOA 4Y24A 4YM1A 4BLIA 5L73A 1GKBA 1Q8SA 2WT0A 1O4ZA 1IS5A 2XG3A 2W68A 2R1DA 2YY1A 1G8WA 2A3WA 3FLRA 3M2MA 3WG4A 4UW5A 3AYEA 1JYIA 1ZA4A 1A8DA 2ZGLA 2D7FA 3ILRA 1U0AA 3LSDA 4RL7A 4YM0A 4TZDA 1GZWB 5DXDA 4YLZA 2A71A 4BM8A 1KQRA 2R1BA 5E88A 4YZ3A 2DWRA 3WNXA 4DPNA 1AX0A 3FLPA 1MS4A 1MR5A 2CY6A 4WVWA 3L2YA 2PELA 2YZ4A 1GBGA 1GZWA 1VAVA 3WG1A 1V6JA 1LCLA 3UJOA 1UL9A 3AP6A 3AZXA 3POWA 4ATFA 1QF3A 2DVGA 1S0EA 3N35A 1WW5A 5CNAA 3O12A 3ZXKA 2A6ZA 2EALA 4GXLA 1DQ0A 2E51A 1B09A 1Q8VA 2WJSA 1DQ4A 1SLIA 4JC1A 4K1ZA 4LBNA 5EYXA 1WD3A 4DQAA 1LOCA 1WW4A 2D6NA 2NZ9A 1JXNA 3FLTA 4CTEA 2PHWA 4AVTA 4SLIA 3KQRA 4YGCA 4XJWA 2DVFA 2D6PA 2BQPA 1YIFA 2NP0A 3A4UA 3ASIA 5EXOA 1MS9A 1GNZA 1LULA 2ZGMA 4BPZA 4U2AA 5JMCA 1XQNA 3BTAA 2SLIA 2KM2A 3NV4A 4YGBA 5IK5A 3VKNA 4PBPA 1DQ1A 1IS4A 5GZEA 2D3PA 2B7YA 1LEMA 4R9BA 2CYFA 4M01A 1W6PA 1IOAA 1LHUA 3AZWA 1Q56A 1SBDA 2VU9A 3RRDA 4YZ2A 1LOGA 1LU1A 4ZXKA 3RMXA 3B9CA 3WVJA 1W0OA 3RMYA 4AVVA 3AP9A 3ATGA 4Y1UA 3MW3A 2A3XA 3D5OA 2R49A 2WSUA 4Y20B 3RSJA 3VKFC 3GALA 5DUXA 2JDZA 1H30A 2NMOA 3GNEA 3IPVB 4Y1VA 3PVOA 1N1YA 2UURA 1W6QB 2RHPA 1MZ6A 3O0XA 2EAKA 2JD4A 1DBNA 2NM1A 3IM0A 4KBBA 1WCSA 4Y20A 2GDFA 1QDCA 3RQ0A 3PVEA 1AJOA 1W6QA 2P34A 1N1TA
chains in the Genus database with same CATH superfamily
2ARCA 4B1MA 3FBMA 2JG9A 2RG4A 4I3GA 3HR9A 1FNYA 1V70A 1WA4A 2WT1A 3TN93 1DQ2A 4NHKA 3ZXEA 3JD71 1SLAA 1QOTA 3I59A 4BK4A 1BZWA 1RC6A 3LA3A 4RFRB 4TLGA 1YCIA 1JZ5A 3ZFGA 2ZXQA 1NY72 5JWPA 5LBFA 3WF4A 2EIEA 3EB7A 1HRI1 3ENRA 1RUC3 3J4UH 4AGRA 3ZMOA 4HSJA 4YGEA 5D8AC 1YI7A 2D6LX 1OUSA 4Y5SA 1WBLA 3VL8A 1VBE1 2XUMA 3T08A 1LTEA 2DUOA 1UX6A 1OLMA 5FZGA 3BOPA 1LGBA 3PUAA 5JZGC 5BNOA 4E2SA 3SH4A 3C7GA 1FI2A 3AKTA 4AW7A 1YLLA 1V6KA 1V6MA 1VIWB 3OUIA 1X50A 1Y3TA 3SQOA 4CCJA 3QCWA 4KGQA 5FXVA 4CPBA 3WNMA 2D5HA 2WO3A 2WNOA 4YVSC 4HN1A 3ZIWA 1URXA 1QJFA 1RHI1 4MGQA 3WP4A 3SITA 3T2PA 2J1UA 1ENSA 1MEC3 4W6XA 4LOSA 3GDBA 3M3IA 4EN6B 2RMU3 2Y6LA 4AE2A 1PGSA 3WF3A 3VUOA 2Z42A 4WVVA 4JQTA 4DB5A 3DF0A 3IIIA 3AFGA 5GZGA 1W28A 5CFDB 1EYBA 2RV9A 2B46X 4BDVB 1DP0A 2ZAHA 2IVIB 2VW1A 3SH3A 5I0DA 4I02A 1OF3A 5J37A 1CPNA 1IS3A 2GMEA 1OA4A 2N7GA 4Y4RA 1OFSA 5EIYB 3M3OA 1WMFA 4G4FA 1ASJ2 5EZWA 1LOEA 3ACFA 5E8AA 3R6SA 4QX1A 5EJZB 4PLOA 4CEWC 4IDZA 2C0ZA 2HWC3 4XEZA 3ZMNA 4DUXA 5ISLA 2R061 2QFEA 4ONUA 3ITQA 3WX5A 4PI0A 1NLQA 1TMF2 1WW7A 5IUQA 3ZPYA 4BE3A 4YW2A 5TSWA 1S0JA 2DVDA 4PT6A 5FYUA 1VPHA 4N53A 1ND2C 4FP3A 4Y1YA 2NLRA 5J96B 3KSCA 3ST7A 4JVAA 4QPGA 5L36A 1AR61 2EAAA 1AR73 4JRLA 4D8MA 3L9JT 4BJ0A 2VOVA 3N36A 1S0CA 4P9IA 5GM0A 2XPJA 5KHHA 1G9FA 4QXHA 4DOUA 4B4QA 1ENQA 5H9RA 4ZKTB 1JTZX 5FUPA 5A7WB 5C70A 1Z78A 3KV5A 3QOPA 4KWLA 2TNFA 4LHNA 1UYPA 2QZ2A 4HPKB 4EYUA 2AGSA 5F32A 2C5DA 4HKOA 3ACIA 5CFCB 1U5ZA 4CDWA 1NY71 2WWSA 1CAXA 3GF6A 2GAUA 2VCAA 4K21A 5DAXA 2YU1A 3N7LA 3UK9A 3VDBA 4RA0A 3VZNA 1TVGA 5GKAC 1QJU2 2Y64A 1MVQA 4P5HA 2WBKA 4ZPIA 3C8XA 3HQXA 3VN4A 2P3JA 2WT2A 1QQP2 3ZM8A 5FZOA 3LOIA 4FTEA 1W6MA 1WMXA 3Q9OA 4Q26A 4AVBA 2WRAA 2VQTA 2JDYA 2R073 1HB4A 4AQ6A 3RS6A 1VRBA 1MEC2 3KT7A 1EAH1 5LA0A 1QGLA 2JG8A 2W0XA 2VE1A 3E97A 2W1WA 3S7EA 5C3PA 4LBQA 4URTA 2YMZA 2W39A 4P08A 3HQUA 1RUG1 4AI9A 5HXVA 3FBYA 5DZFA 5L7OB 4WVMA 4QPIB 3BU0A 1J58A 4PIZA 4XUPA 4PIXA 1OOPA 1G86A 1IQDC 3LB9A 4KG0A 4AI2A 4EWDA 2ZGUA 1UY3A 1XJAA 4AOCA 5F1RA 4O9GA 3SLIA 2DBNA 3JXSA 4GQ7A 2QQJA 2DUQA 3KGZA 2F6BA 4QM9A 3VBFB 5K4LA 1FAYA 2EICA 2QDNA 4XTPA 1QH7A 5KHIA 2J1RA 4UF0A 2DVAA 1YEWA 1GQHA 2W2IA 1KD7A 3PIJA 3T0BA 1AYN1 1WA6X 2VY0A 4LKFA 3THTA 4B29A 4E8DA 1H9WA 2QQUA 2VNOA 1QJZA 5CZKA 1NCRB 2VM9A 4D7SA 2JECA 3C7EA 3ZN6B 4B7EA 4HZFA 3U07A 1IGOA 1W39A 2XWJB 2AZ5A 1ASJ1 2O0OA 4UI9L 3WQBA 2UYAA 1AR72 1S0IA 1D0GA 3HIFA 4QAWA 2CAUA 3OY8A 3POSA 3T2OA 4AFCA 1HLCA 1N3PA 1ZZCA 4LO8A 2CAVA 3MDPA 4GWMA 5CEHA 2FDIA 1I5ZA 2ARBA 2WA3A 4GAZA 3TN91 3M3EA 3QACA 2PHLA 3G6JB 3MIFA 3F95A 4L8QA 5C5TA 5EHDA 4N90A 1REDA 1SG3A 4HK8A 4UWDA 3ZIXA 3AZZA 1AVBA 3WNKA 4QDRA 4HSLA 3EO6A 5K0UB 1FYUA 4HL0A 2FD8A 4GIQA 5FPVA 5FYCA 2D98A 5GZDA 3W20A 4A44A 1RUC1 3H7YA 5CFCC 2ARXA 3ZSJA 1AX1A 2WQ8A 1JODA 2BWCA 3B3QE 5HCAA 1PK6B 1NZIA 3WDUA 3LDBA 4X8PA 1W8FA 5JOZA 2QCSB 4AGVA 1CAUA 2XVLA 3POYA 1YFYA 2Y6KA 4GKYA 2A75A 4RSUA 4XETA 5GALA 4LKEA 2R072 1D7PM 4ES8A 1GZ9A 3AYDA 4LBKA 4QB1A 4EE2A 1A34A 1VBA3 1UXXX 1K5MC 2MEV3 5FXWA 2WNVB 4OQ9A 4NUBA 2Y33A 4F83A 5IVFA 2W46A 3EJKA 3KVAA 1PVXA 1WZXA 4NIHA 5A32B 1JZ2A 1L7QA 2RS32 3GHMA 3JB4C 2VUDA 3EMRA 2XJSA 4FPFA 3NNFA 4QM8A 1H2NA 2RMU1 1GSLA 1UKGA 2XLFA 1QJX3 2P6HA 2Y6GA 4QPIC 1VBC3 5BV6A 4DY3A 3RNSA 3VL9A 2YFZA 2XQXA 3U11A 3KCCA 1DLLA 2XB6C 4FPEA 1OQ1A 5T55A 3O1VA 2E32A 3NO8A 3MV01 4ZU5A 1AHSA 2BVVA 3UKNA 5LBEA 4LT5A 1ZBA3 3VBFC 3T1MA 2WN2A 4RHV2 4XBNA 3ZFGC 4I0WB 3GCWA 1SHWB 2G1MA 3TB0A 2RR13 5DAWA 1PO23 2DUPA 1W3XA 2PAKA 4L9BA 5KC6A 4Q8KA 4I0AA 3VV1A 3PUHA 1SBEA 5FTTC 4K8RB 2J1SA 1QDOA 1WCDJ 1ENXA 4RD7A 1MACA 1NCRC 2PXJA 3H50A 3IKWA 4R9DA 4XFFA 1OXCA 4YW1A 5T5PA 4D94A 2CWMA 1EV13 2HWC1 3VDCA 4HVOA 1BVVA 1CONA 5HCHA 5JI7A 3ZSMA 4XW3A 3D6EA 4FPOB 2QKDA 4Q0UA 4BMBA 2O8QA 1AR71 1NLSA 1US3A 5CISA 3ZSLA 1MVEA 4H55A 4OULA 1N1SA 2PQQA 3LIHA 1AR83 1VBB3 1ZVFA 3J8F3 5H9PA 3NSTA 1HB3A 2V4AA 3DYPA 5IW0A 3LSEA 3S6PA 4IE6A 3RI8A 1GLHA 1G7YA 1CZSA 1SQ4A 5K0UC 1XRUA 1W6PB 1YNAA 2IZWA 2XJRA 3PURA 4PLMA 5C9AB 3AVRA 3IDCB 3RGBA 4BQ2A 1RUH3 4NR1A 5GLTA 2WWUA 1Y9QA 1ONAA 5FAXA 3MIEA 4J1WA 1PK6C 4YG6A 1QXJA 3C7FA 1G9BA 3HT2A 4M3CF 3ZPOA 2MHFA 4EZHA 3E6BA 1ZRCA 4MGKE 2XXZA 3EBRA 4QWNA 4KMQA 3ETQA 3WEZA 3KD4A 3ZXLA 3K77A 3DYOA 2MEV2 4GJYA 3N7KA 4IV3A 4CXWA 3O1OA 1LECA 1E57A 4LXLA 1LNSA 4N43B 4XMIA 2XWBB 1KEXA 2VTXJ 3WCRA 4AF9A 1H2KA 3BU7A 1YJLA 4GJZA 5KHJA 1NYWA 5F9TA 2WNVC 1RUOA 2R071 2W3JA 2NQYA 4MXWB 5IVCA 2P5BA 2CU5A 3VBUA 5BNPB 4LK6A 1TE1B 5A1FA 1VBC2 1O4TA 5GJ6A 2YPJA 2R0HA 4XBLA 3WD5A 4Q8LA 3KV4A 3NAPA 1RTVA 1W8HA 1NA1A 1QH6A 2VCBA 1Q8PA 1SFNA 4E4ZA 3ZOIA 4CP9A 3A21A 4C8DA 1POQA 1PM7A 2BZDA 4IEPA 4QQOA 2RR12 2ZEXA 1D2SA 1REFA 2IFRA 3B69A 3HJRA 4MUVA 3TOJA 3USUB 4CCNA 2YBSA 5FO7B 5FCCA 5FOBB 1CIWA 5FK7A 4ZU7A 2XKOA 2QTWB 1YIPA 2CWSA 1CJPA 4BQ3A 1W6NB 5KXBA 1EV12 2WZR2 3E6DA 3PDQA 4YM2A 3CZJA 1NKGA 4ATEA 3OBTA 4ARXA 2IXHA 2QUOA 4K8FA 4CUBA 2JENA 4DMIA 3WNLA 5CB7A 4Q1RA 3W9AA 2EIGA 1J83A 1HX6A 3AP5A 4QB6A 1SZBA 3UYJA 2AREA 1XE0A 2VMGA 2A3YA 3PLQA 4M3CE 2LS6A 1AR82 1W2NA 3J8F2 1A8MA 4AQTA 2PHFA 3RJRA 2VPVA 2Q1FA 3WDWA 3ZFEB 3OSDA 3P3NA 2JKXA 4LORA 5GLUA 4RYDA 3Q8FA 4LPLA 1RUH2 3KS7A 4YG0A 3VBRB 4AG4A 2JIJA 2DCYA 2VUJA 2A6VA 4K3UA 3IB3A 5C9AC 4XQWA 1OD3A 2VD7A 2Y0IA 4Q0SA 5T50A 1QNWA 5IWFA 1S1AA 1LOBA 3B01A 3ILFA 5FZ8A 1FOD2 1RUI2 1GKBA 2J42A 4HK9A 1Q8SA 3ACGA 1EUTA 4CE8A 1G8WA 4L2NA 3NW4A 4GWIA 5LA2A 3U10A 3WG4A 1Y9MA 4NE9A 3B94A 4UW5A 4NRQA 3UETA 3TEYA 3UKVA 3ILRA 4Y33A 4H7LA 5D21A 4FTBA 1O6UA 4CXXA 4YLZA 1VBA1 2XLGA 2MEV1 3ZFFA 4DZGA 5IVBA 1KQRA 4MV2A 1O3RA 3PJYA 4DPNA 3LF7A 5BNPC 5FP9A 3NL1A 5BY5A 5C3RA 2W47A 1GOHA 3ME2A 3VGIA 3POEA 4D6QA 4DUWA 3L2YA 4PDWB 2IXCA 1LCLA 3MFAA 2Y38A 2KXLA 3AZXA 4L0PA 2DVGA 1QJX1 1SPPA 2VMDA 4QHBA 3N35A 1TNFA 4BU2A 3VLBB 5AC93 5EQUA 4IE0A 2E51A 4W6WA 2P17A 2VZRA 4K1ZA 2DFBA 1WD3A 3ZLIA 1ZBA1 1C5HA 4XPVA 4EN8B 3LZZA 5D8AA 3KGLA 3AKSA 4CCLA 4QB2A 5FZMA 1VMHA 4AVTA 2RR11 3BKZA 3KQRA 1PO21 1Q43A 3HQRA 4KWUA 4XJWA 2X8KA 1OH4A 4YGCA 2DVFA 2D6PA 5DABA 5IVYA 5LASA 5JZGA 4OMDA 1F4AA 5HPOA 3BPSA 1MS9A 1GNZA 1LULA 4P00B 2YC4A 4GWJA 5LK7B 2J22A 3HN3A 1W9WA 2BJSA 4YGBA 1EV11 5IK5A 4PBPA 3PMSA 1JH5A 4C91A 4OHXA 1H1IA 3KWVA 4YVSA 2HBTA 2ILMA 4LO7A 2OXBA 2XVKA 3Q8AA 4BH9A 3AZWA 1Q56A 1SBDA 2HEWF 2VU9A 1UWWA 4QQHA 3O1UA 2W94A 3OPTA 3SKJE 4V2VA 3ZFEC 4ZXKA 5A3PA 4Y5Z0 1KS5A 1W0OA 3OEAA 3WVJA 1V9U3 1AR81 1VBB1 1C28A 3AP9A 4YVWB 3CU7A 5FMDA 2RDSA 5LRRA 1OLQA 5LY2A 3VBRC 3WP3A 5HV4A 2A3XA 2R49A 3GBFA 4HN0A 1L7RA 1HW5A 5F3IA 3AL6A 1H30A 2OPKA 1PVC2 2XGXA 5DDJ3 2BV4A 1N1YA 2UURA 4QKDA 5FZ0A 1E5RA 1RUH1 2WABA 4DUVA 2EAKA 1JOPA 1E5SA 3MICA 1C8M2 5JXHA 4Y20A 3ZN4A 3RQ0A 3O1TA 1FPN3 3PVEA 4RS5B 2ORZA 2P34A 2PLV2 5G04L 1R083 4CEWA 1AF9A 4JGYB 3SC7X 3KZ4C 4YPJA 2X5IB 3VKLA 1XYPA 4IV1B 1RIRA 2Q5TA 5A1AA 1DIWA 1JYCA 1ND2A 4KG8A 2BNOA 3O5SA 4AQSA 2ADDA 4HFSA 4XFIA 3SNMA 3LCPA 1DQ6A 4AI1A 4LHKA 1KGYA 2DF7A 1SEFA 3KCYA 2JD9A 5LA1A 1U5YA 1WMDA 1LHWA 2EF6A 1ZREA 3ZSEA 2BNNA 1O5LA 3NQHA 4XF0A 2VECA 3WV6A 1VBD2 4JV4A 2WNEA 4HG6B 1OHFA 2E33A 2PHRA 3KF5A 4DEVA 1DZRA 3AL5A 1T6GC 2OZJA 3AYCA 1UMZA 1AXYA 1R1ZA 4LIVA 2Q0AA 4GB33 4B1LA 2IXLA 2MNGA 1UO9A 2ZBJA 5J09A 5JR2A 5LBCA 2A6YA 4MGYE 4Q4W3 5DG2A 4YG3A 1YI9A 4H3WA 3MW2A 2FMYA 2F4PA 1W04A 4MVTA 1PO13 2GNBA 1PGW2 2XJTA 3LWCA 4L92A 4M4RA 5I0SA 1JUIA 2AH2A 4MGTA 4XF9A 3OD4A 4R9AA 4NPMA 4AI0A 4CUGA 1WLWA 4XOGA 3ZYPA 5AFBA 5JPNB 2B4KA 4NROA 2DDUA 4FCAA 2D44A 4XQ4A 3FFZA 4RQPB 1LGNA 5C8CB 4QX3A 5FY4A 5ERLA 5FYHA 3WLUA 4XHBA 3WDXA 5FPBA 1BVP1 3WCSA 4Y1ZA 2DURA 3VHRA 4NAOA 4YVWC 1QOSA 3GCXA 4HXCA 3U78A 5JIAA 5DUWA 3WW4A 1QMJA 3GBWA 4LO4B 1EP0A 2YHJA 4FSJA 3AJZA 1APNA 3EHKA 5HCFA 1KS4A 2OVUA 2YPDA 2HWE2 2G19A 3VDAA 2RDQA 3AMHA 4XIOA 1VJ2A 5HCBA 1DQ5A 1FPN2 1C1FA 5GZCA 5KHGA 1GR3A 1E5IA 4LKSA 5BUVA 1R082 3HBZA 4BISA 2WS93 4IEYA 4MGZE 4RS5C 4W50A 4EROA 1UMHA 4A7ZA 4HBNA 1DYKA 5FYSA 1MZEA 2D93A 4JGYC 2K46A 3AX4A 5FP3A 4NHLA 2HWF2 1X9PA 4IV1C 5LRSA 4V1PA 4YARA 2EXIA 3ZXAC 3ZXDA 2BTVC 2KA3A 1LKNA 2YC2A 5CA6A 5GLWA 4EN0A 1XC6A 4XACA 4CUCA 2O14A 3C7HA 3SEEA 4XJ9A 1AL0G 1I5PA 2CGNA 2XL9A 2PHDA 5D1IA 4AZZA 5FZKA 4BHPA 1LOFC 1RMU3 2VXRA 3P6BA 3TEWA 1HB1A 5A7WA 3ZYFA 3VD4A 4ITCA 1YQ6A 3ES4A 5AC91 3WR0A 3LGRA 4DRRA 4HT1T 4HPKA 2ZTNA 4Q4W2 5AVAA 3ACHA 5APAA 5CFCA 2C9AA 1C57A 4QT6A 1S0FA 3CDZB 2XONA 2HEVF 1PX4A 2B45X 2LM3A 1PO12 2VMEA 4FO9A 1G9DA 5G05L 4LA2A 4OCTA 1XSQA 4O9EA 1JYWA 5L7OC 1XPWA 1H1AA 1JS9A 1ZRFA 4NMIA 3BCWA 3ECQA 4PQ9A 4IUGA 3V0AB 4OI2A 4AWDA 2K2SA 1PM4A 3GZEA 4XIKA 1PGW1 1X82A 5C8CC 2HJIA 2O1QA 2VULA 3JU9A 1UF2C 3I2IA 1BXHA 3IPVA 3JB8A 4CP0A 2HWB3 3K3NA 5GLZA 4LMFA 4B7KA 4P9JA 3MIGA 1H8VA 2CSGA 5L7OA 3GM8A 4QPIA 1TMF3 5FLHA 1V9U1 3QH6A 3HWJA 1POV3 3URFA 3POJA 5BYNA 5LATA 1PMHX 1MS1A 1DGRN 2DU1A 1CX4A 1E5HA 4PCRA 4WM8B 2VO5A 4XTMA 3SMHA 3VBFA 5DDJ1 1ZYBA 3H3LA 4D7YA 1VRH2 2WS92 2D3RA 4E4HA 3RWKX 2VZSA 1W8NA 4NIIA 4AVAA 4PF1A 4MSVA 2X05A 2W52A 2QDRA 2ZGRA 1FPN1 4M4PA 3NJXA 2ZKLA 5GLVA 3UKTA 1WGPA 4MGIE 1NCRA 1PIV2 1UU5A 1R081 3ZN6A 1I1EA 4NIGA 4LO5B 5I8TA 2W5FA 1H2MA 3I97A 4DNYA 3CLPA 4ES9A 1SBFA 2VG9A 5FBZA 4DIQA 4DY5A 4P9YA 4XXPA 2WA4A 4YW4A 5J36A 1QJU3 2EXHA 1LHNA 3VD9A 1ZBE2 4EV0A 1DGWA 1QQP3 2WZPP 3FMGA 2CL2A 2ZGNA 1RMU2 4N9IA 1FV2A 2W92A 3I2FA 3KT4A 1QOOA 3W59A 3K4ZA 1A78A 3I4IA 4LBLA 1CZVA 4Y22B 4CDQB 2IUWA 2J1AA 3ZYJB 1HRV3 4XJZA 2EIBA 4B4PA 2RE9A 5K0UA 5FZCA 2B9VA 2E7QA 3LFIA 4IEXA 3O1MA 3HOBA 3MW4A 3ZVXA 1R64A 2P3KA 2VZQA 1LODA 1ULFA 4GB31 3UNPA 4FPJA 1FNZA 3MGUA 4CA9A 3ZDVA 1PK6A 2WFPA 3WZ1A 2AEZA 4LJHA 4UFIA 4Q4W1 5A33B 2ET1A 2OW4A 5EJ3A 2ARAA 3VZOA 3I8TA 2GNTA 5LEJA 4ZY9A 1W8UA 4Z82A 4HETA 4NWVA 3T09A 2WLQA 3LE0A 1IPSA 4QHZA 4BK5A 3APBA 1PO11 4AHWA 4META 5B2GB 2D3SA 3AKRA 5BXXA 2WNVA 2BRTA 2HWB2 4Q27A 3NKGA 1ZNPA 5JXGA 4XJUA 4ZS2A 5A32A 4CCEA 5FXZA 4GA9A 4QHOA 4DEQA 1I6XA 5FY5A 1JU4A 3J7MA 3KLSA 2KD7A 4QU2A 1OMIA 2F4LA 2P4EA 3N9LA 4IE4A 2VUCA 3RYPA 1GWLA 3KMHA 2CGOA 5AVPA 2WQZC 4H7MA 1F4HA 4WM8C 4IE7A 4Y26A 3RYKA 1DGLA 2QJVA 2QQIA 4KL1A 3THPA 1QIQA 2GNDA 4LK7A 2BP6A 2XMLA 1DGWX 1NQJA 2WFF3 4H14A 5C8WA 1PX3A 3H8RA 3AP4A 2YG0A 1ND3B 3QH7A 1JHJA 3ZYHA 1OLRA 2DV9A 2GC1A 2ZGPA 2TEPA 2WS91 5J98B 3UV9A 3E5XA 5T54A 1PZ8A 3SCFA 1NAEA 3T1LA 4HMZA 4UAPA 2W91A 4IE5A 2ZEWA 2XL7A 1ULPA 2ZGKA 3ZXJA 1R1A2 4QXKA 4AFMA 3PUSA 1ALYA 4L11A 5JLVA 5IATA 3I2HA 1JMUB 4I09A 3IMNA 3BTZA 1SLTA 5DQ0A 1KRIA 2VOWA 1YFWA 4QDQA 2XQRA 2BOJA 5FZ4A 2A6XA 3GGLA 1S2EA 2IXKA 4COVA 3N9PA 4FPCA 5B4NA 4AFDA 1HRV2 2IVJA 1MS5A 5KBFA 4XUNA 4COZA 4RR3B 5JXIA 4CDQC 1RMU1 2G9FA 3DUIA 4OUMA 1NXD1 3AKPA 2RS33 2P3IA 4NAMA 4BQ4A 5C9AA 1QJY3 5FKCA 1ULCA 4XAEA 2XH6A 3R4SA 1PZ9A 4I3PA 4A2UA 1UD1A 1PHMA 4LE4A 5A3NA 5CFDC 4K20A 1CVNA 5J7MA 3P5BA 1C4RA 1RXFA 5FK8A 5IFTA 4Q4V3 3ZN5A 1K5JA 1N3OA 2V5YA 4RHV3 1JW6A 5FO9B 3OPZA 4N43A 1OLME 2LRPA 4HKLA 5F5QA 1UOBA 5FJHA 3WQ1A 1GOFA 1JN2P 3JCIA 4P14A 4BIFA 3T3YA 5FY9A 1LOAA 1OQEA 2JG9B 5LZ6A 2ZJCA 2W1SA 4FOWA 4MXWA 1LB2A 1CJDA 3DEMA 4HANA 3H8UA 4UYBA 5BNPA 2C4XA 1BK0A 5LY1A 1W9FA 4AFAA 4IEUA 3BTYA 3OTFA 5B4XA 2HWB1 1JU3A 1D4VB 5IVEA 4H2AA 3WNOA 4PHZA 4Q2FA 2A6WA 3MPBA 2WR9A 1TMF1 3I3DA 4YYOA 1GQGA 2ZX2A 1POV1 1WLDA 2RM22 4LLFA 3WF1A 5FPXA 1EY2A 3AJYA 4PBOA 5CYYA 2WFF2 3QLQA 4ZXEA 3USUA 3N9MA 1JZ8A 4MYEA 1Z7S3 2P37A 4AEDB 5FKBA 3T0AA 4HLTA 2B5HA 5FZHA 1ND3C 3R0RA 5M0TA 2VQUA 3MF9A 1QY4A 1W6NA 5I0UA 3W58A 3GYDA 5JSPA 2GMMA 1PGL1 2WYFA 1JBCA 1QWRA 3EXUA 1RB8G 1N47A 2GC0A 3E5QA 1HV1A 5DAPA 3N7MA 2IXIA 3VBSB 1YJKA 4GMP0 4FI9A 2AUYA 5LW9A 4NN0A 3POBA 3AXDA 3NNMA 1Q8OA 1VMFA 1FMD3 3NNGA 1KDKA 2VAUA 4MH0E 1NE6A 4NPLA 4CP2A 1QJU1 3MYXA 5F3EA 3WG2A 1H4HA 3ZKUA 3MLJA 1QQP1 1MS8A 5E16A 2VGDA 3LFMA 2GC2A 1S2BA 5CKNA 1AR93 3ZFEA 4FPHA 4LBMA 1STMA 4CCDA 4CCMA 4GWNA 3UJQA 4CEYB 1MEC1 4QQLA 3FE5A 1QJY2 2Q30A 3OOXA 2JE8A 3VBRA 4YM1A 4BLIA 1HRV1 3DCQA 3OCPA 2WT0A 4AHZA 1O4ZA 3B93A 2W68A 4BQWA 3KF3A 3M2MA 2YDEA 1YHFA 3T30A 4J6GA 4AL9A 3N9OA 4Q4V2 4QGNA 1CAVB 1ZZ7A 4QKBA 5C33A 1GZTA 1U0AA 4IEZA 2XBO3 3LPGA 1MPXA 3CO2A 3J7HA 2RJKA 5E88A 2QNKA 4YZ3A 2DWRA 3WNXA 4LUKA 2CY6A 3IBMA 4RGGA 4N53B 4WVWA 2RS53 2YZ4A 2VC9A 3AMNA 1V6JA 1VR3A 3VBOB 5JXJA 3POWA 1QF3A 2WZR3 1H0BA 1PNFA 5CNAA 5C7GA 3ZXKA 2EALA 2ZOEB 4K6BA 2PA7A 4PDWA 1SLIA 4IEWA 4JHZA 4S2GA 5EYXA 3WW2A 1HIXA 5A7PA 5FY1A 1WW4A 1F2NA 5F5AA 1JXNA 2JB8A 3M7AA 4MZUA 1EUUA 4SLIA 4Y3OA 3TNPB 1Z7S2 3D82A 1W0NA 3DYMA 2JDUA 2RVAA 5I0RA 3W5MA 5CG9A 2VBBA 4QXBA 2QBXA 2ZGMA 3WXPA 1NG0A 3UGFA 4YSFA 4NRPA 4AEDC 3MIDA 2WZ8A 3HAGA 3UT0A 2WFF1 2SLIA 3VKNA 3E5UA 4X6QB 1BK1A 1UPIA 1YWKA 2D3PA 2OT7A 3UGHA 1MQTB 1JYXA 4XF3A 2CYFA 4HONA 2ZX3A 3K3OA 1FMD2 2Q8EA 3VBSC 4LQRA 4GH4B 1O7FA 4OHZA 1FOD3 1RUI3 3RMXA 3B9CA 3U1XA 4CPBD 2QQWA 1XU2A 1Q5OA 1AR92 3MUZ1 5A3OA 4A6SA 5FO8B 4QDSA 3VZKA 3D5OA 2QQOA 4N8MA 3VKFC 5DUXA 3GNEA 3FWEA 3PVOA 4YVWA 1DF0A 1US2A 4CEYC 2QQNA 2RHPA 4AI8A 4M0NA 5A80A 1MZ6A 2H6CA 3FL7A 5FZFA 3NJYA 3POFA 1WCSA 4P9LA 5IVVA 2GDFA 1QDCA 4AAPA 1UCXA 2RS31 3JQWA 3HVDA 4WM7B 1QJY1 2MPFA 2XBO2 2VVEA 3FC0A 4E2QA 4FPKA 1DU3D 3WDTA 4NIDA 1TNRA 4NIAA 3U37A 1YFXA 1BMV2 1UKRA 5JOWA 1UQXA 5CVRA 3CHXA 1XSRA 5DG1A 3MZHA 3N4MA 1WUVA 2RS52 5F2WA 3FUQA 4Q4V1 4RS5A 1F31A 2ZGQA 3ORJA 4OI1A 2EXJA 1CIYA 2AC1A 5A7QA 4JGYA 4RHV1 1O59A 2XHNA 3M3CA 1YQ2A 4LITA 2WO2A 1GP4A 2LALA 2R30A 1MZ5A 1X7NA 2V73A 1Q3EA 4IV1A 1OQDA 3VBOC 5IFPA 2Y0OA 1IQAA 1VAMA 5A3MA 1XU1A 3THDA 3USSA 2RS12 1J3PA 1HN1A 4ZS3A 2XJPA 3I2KA 2G4IA 1CWPA 1ULDA 4MHUA 5LWBA 3WUCA 3K46A 4FXKB 2ENRA 4UOJA 4B4RA 1F5JA 3JBG2 4D6SA 4OHYA 1UPSA 4XZUG 2AEYA 2VVDA 4GALA 1LOFA 2UU8A 1OF4A 1W8ZA 1GANA 5JR7B 3POIA 3WDVA 4K9SA 3TEXA 3AVSA 3VZLA 4CU9A 5I93A 2YV8A 1PMIA 2VQ0A 2W08A 1CAUB 1HXS3 1Z7S1 2CNAA 4FFIA 4ARYA 1A6CA 3HNYM 1AYM2 5KR7A 3CF6E 4LE3A 1DYPA 3P3PA 1V6OA 5FREA 1K3IA 5T5JA 1CD3G 3BI3A 1W0PA 2BUKA 2DU0A 1MQTC 2R6QA 4Q0VA 3OGGA 1PVC3 2XVGA 5F2SA 4JHTA 5FBJA 5A3LA 2JDAA 4M3CB 1FT9A 2NN8A 3WNNA 2FCTA 1H1MA 4GH4C 1SMVA 3OUJA 2JICA 3A7QA 1C8M3 2F17A 4LOTA 4KWJA 5KWRA 1NLRA 1BJQA 1CGPA 4MXVA 4N43C 1W8OA 2C6SA 3O0WA 1TQ5A 3Q8BA 4FVVA 4LR4A 2OYZA 3H3ZA 1IHMA 4XCBA 5K7PA 1FMD1 1UYZA 2B9UA 2PLV3 3LDRA 2P2KA 4JGZB 4A41A 5C8CA 4WZCA 2R32A 4AHXA 4LBQD 4UW6A 4UFHA 2HYXA 4W8JA 2ZKNA 4BOWA 1AR91 5FY8A 2PN5A 3GZUC 1JZ4A 4AEMA 1XXNA 2VCMA 1J1TA 4QX7A 1W99A 3OUHA 4D3WA 3KCXA 3Q8EA 1VBC1 3NJZA 4QQPA 3WUDA 2W1QA 4TWTA 2A1XA 4JQRA 4RN5A 2WL1A 3OYWB 2WKKA 4N7UA 2QQPA 2O8OA 3QBQA 5FWEA 1KXGA 1Q8QA 1VBD3 4QX0A 5A7OA 4JDOA 1CESA 3S5QA 4D69A 1MS3A 2E26A 3ZXFA 2XBO1 4UW4A 3WT3A 3VHNA 3LEMA 4FP2A 1XE7A 2DTWA 3CJXA 4N9HA 4NPRA 3AFKA 4COUA 2E53A 3VDDB 5KXCA 3GZTB 4XUTA 3U4SA 4CUAA 1GNYA 2QVSB 1JOJA 4MG2A 2ZPXA 2RS51 1BBT2 1COV2 2ADEA 1DCSA 1K42A 2XHKA 4TTGA 1LU2A 4OI4A 2WWJA 4LUMA 2WZR1 2AENA 4P02B 1WBFA 4Q4Y2 2ZHLA 3WF0A 1UN1A 2CV6A 1CAWB 1UZ0A 1W2OA 1UIKA 2VW0A 3AYAA 3D4KA 1U5IA 4ZHNA 4NHXA 4OMCA 3BTXA 3M1HA 2VOKA 4PI2A 4OVEA 4FAGA 4GZ9A 1RYYA 3JUUA 2VQAA 4LTAA 1G9CA 2D43A 2XJQA 1J3QA 4IQPA 1HXS2 4LA3A 3J8F1 4EZ4A 3ZYBA 1ZRRA 2GMPA 4COYA 3AMPA 2OPWA 4OZOA 1Y43B 2EIDA 3I2GA 3SH5A 3B00A 4OZXA 1OUXA 5FZAA 3VD7A 1CR7A 4YZ1A 2YBKA 4XCAA 4DXZA 1UY1A 2BBVA 3K51A 5F39A 2HWE3 2JWPA 2RDNA 3U0ZA 5FY0A 3DPRB 3MLKA 4XHXA 2WZEA 2XUEA 4MLOA 3V0AA 1C1LA 4KI5M 2Y60A 5CU1A 5FZ6A 1W9SA 3VZJA 1FOD1 1RUI1 4P9GA 2QQLA 5F6KA 1AXZA 5DZEA 1XNCA 5JOYA 2FCVA 3NAPB 4JGZC 3D3AA 5E1RA 1GV9A 3MPPG 3OEBA 4DFSA 1LENA 3PMEA 2D97A 3KM5A 3RYRA 3PL0A 1NA1B 5FYBA 5JI9A 1DDLA 1ZM1A 1RUJ2 2HWF3 2A73B 2ID4A 2P3YA 1X8EA 2FQPA 3N9QA 3RZZA 1X36A 4BMEA 4A4AA 4M00A 3RDIA 4PDWC 1ACCA 1KJLA 2OS2A 3DL3A 5FLIA 4Z2AA 1ZZ6A 1UZZA 1HJGA 1EPZA 5FYIA 4CCKA 2FBEA 1HB2A 3SHRA 4WM8A 2X10A 3SISA 5L9RA 2E7AA 3CBNA 1H4GA 2XDVA 2ZZJA 5I91A 1DHKB 5FPAA 4LLOA 1Y4WA 5DMYA 3IAPA 4I30A 4E2GA 2DVBA 2LW8A 4QU1A 2VUAA 4CDUB 2I07B 1O91A 4NHYA 1CN1A 3VDDC 3FZ3A 3IZOA 5A6XA 5FWJA 1G6NA 5IT6A 5FMOS 2CGPA 3PJQA 3KHBA 2ZGOA 4PF5A 2FDHA 1U12A 2YFUA 2VH9A 3IDAA 5F8PA 2HH9A 2BPA2 4ZU4A 1SDDB 2BGCA 2ZEZA 1X9TA 3BVCA 3H7JA 5SV8A 4CRQA 4MGSA 2JJ6A 1W03A 2IC1A 1GWKA 3DGTA 3ES1A 3RZJA 4Q4X3 3SKVA 2FDJA 1IKPA 3QD6A 1XNKA 3LAGA 4OI0A 4Y22A 2DFCA 3AXEA 3PTYA 4CDQA 4FBFA 5KHKA 2GP5A 1LR5A 3JQXA 4AVCA 2VZVA 2NMNA 3I3QA 4BQYA 1WWYA 2W87A 3NKTA 3AZYA 3RG0A 2XR4A 5CFDA 1D2QA 1W2UA 2BDRA 4UXAA 1HXS1 1HN0A 1W90A 4XFCA 5A33A 3AK0A 1IKQA 3HN1A 2R063 2YB7A 1F15A 5FQ0B 1PVC1 1WMEA 1W8TA 1OA3A 1W2TA 2PAMA 1L3JA 1VRH3 2TUNA 2ZMKA 3DPRC 4NOTA 3B5LB 4GKXA 4AK3A 5JUVA 2FDFA 2JDPA 3K2OA 4BQ1A 1UOFA 4XC9A 2CTVA 1C8M1 3M3QA 1OKOA 2X5IC 5I0TA 4BCUA 5FXXA 4EN9B 3R4DB 1NX9A 4ASMB 4LHSA 1F9KA 4MHRA 1QXRA 3F2ZA 3TYJA 1W6OB 2PLV1 3RJ2X 5IAXA 1PIV3 1HRI2 2Z2SB 4E9KA 1HDKA 3W5NA 2GNMA 4IERA 2V4VA 1GUIA 1XNDA 2VZUA 2JDHA 4AGGA 3J26N 5DPNA 4YNIA 5LCWL 3CJIB 2G9GA 3S7IA 1RUD3 3GZAA 1GNHA 1ZBE3 5FMCA 3RZLA 3I3MA 4FOVA 1BEV3 4MADA 3CEWA 1OVPA 2BVBA 4XFHA 2Z5WA 4XAAA 4KH9A 2K0GA 5IVJA 4BLJA 2NPIA 3IMMA 1BQPA 2DYCA 3I3EA 1VBD1 1DG6A 1ND3A 2WUHA 4IW3A 5JVVA 1ZZ8A 1IZ3A 1S0BA 4CDUC 4CU8A 4E8CA 1YC61 1A3KA 4AAXA 2V09A 2VZ3A 3WG3A 2JDNA 4AI3A 2DTYA 1WKYA 3OJBA 1IS6A 4GD4A 2D6OX 1W06A 1O3SA 4QGLA 2VTXA 5C3QA 1XBFA 1WW6A 3OPWA 4XBQA 4MX3A 2ZS6B 3OGVA 3KT1A 1Y7BA 3A0KA 1QHDA 2OZ6A 1YQ8A 4Q4X2 3MV11 3K48A 3LA7A 1RINA 4OUSA 5FRAA 3T0DA 2YUEA 4UFKA 2UWAA 4RQPC 1GP5A 4UFMA 4F7ZA 1SLBA 4ZZ5A 2HLEA 1C8NA 3H1MA 4HKWA 4ISRA 5T3NA 2WNUB 4YGDA 2AYHA 5FLJA 4RR3A 4XDQA 3VBHB 5CAZA 2XLAA 2HEYF 1NCQB 4Q1PA 5FMBA 1ZZBA 5F3CA 5A1LA 4EN7B 4FFHA 3IIAA 3BOWA 4C1XA 3O7OA 2R062 4WVZA 2UYBA 5FZEA 5A3TA 4XFGA 4DXRA 1GZCA 2Z69A 5FDBA 3I3BA 4ASLA 3MF6A 4JDNA 4A45A 3OBRA 5HBAA 1AR62 2ERFA 5EWSA 3HBKA 2HWE1 4Y1XA 5GZFA 4TN7A 1RUE3 1HQWA 3WF2A 3V0BB 2VCCA 3E1F1 4QMAA 4FFGA 3TRSB 1J3RA 5FP8A 1LRHA 2ZHNA 4I01A 4MO3M 3T2QA 3AZVA 3O1PA 1O3TA 2R0FA 1OURA 3WQ7A 2A5ZA 2OIIA 5K9YA 4XFAA 1BHGA 1RUD2 5ABJB 4UFLA 3I49A 2FCUA 1KITA 2HWF1 2VMFA 1R1A3 2FMDA 3CJIC 1BEV2 3GJBA 2Q4SA 1FX5A 2WSVA 2GP3A 2VW2A 4PIYA 5FYYA 5J48A 3A0NA 1JI6A 1S0DA 2SBAA 2E6VA 2AR6A 4BYYA 4KU7A 2BFUS 1NQDA 2JE7A 3ABZA 4NVPA 2R16A 4YWAA 2R7EB 3MHZA 4FTSA 3WSOA 4XDOA 2LTNA 3FHIB 2WIIB 4NJ4A 4QKFA 4AEDA 3KHCA 2UWCA 1ODMA 3PUIA 3WW3A 3PU3A 1EAH2 5FY7A 4XDPA 1YXWA 1FV3A 1UU4A 3H1YA 4X8NA 4XABA 5FYMA 1JYTA 2GH2A 3AP7A 2WAOA 3LEGA 3BIEA 4TXWA 5A70A 1RUG2 3FN9A 1V6NA 3LD8A 1GQPA 4WZFA 3VBSA 3IAQA 4PLNA 2FZ1A 4QPYA 2E63A 3BPZA 4JDMA 2C26A 5FV3A 4OHWA 2BBAA 4LBOA 4Y24A 1JUHA 4KWKA 4BXSV 1S55A 2G9ZA 2R1DA 2WNUC 4I2OA 2B42B 4CEYA 4Q4X1 1ZA4A 3VBHC 1A8DA 2ZGLA 4IGOA 1NCQC 1HV0A 2D7FA 3B9IA 2RDRA 3LSDA 4YM0A 5FZ1A 1AYN2 1GZWB 3TBDA 2GSYA 1VMJA 1JYVA 4I0BA 5IJRA 1O3QA 3ROUA 3SXWA 5BNNB 3FLPA 1MS4A 3RI9A 1PMJX 1CAVA 3HT1A 4XF1A 4BIOA 4DXSA 3L2HA 2PELA 1GBGA 2RM23 3IWZA 1VAVA 4JKMA 1S4CA 4XVHA 3U14A 3WG1A 5IYYA 1RUE2 1D4M3 1UL9A 2K9ZA 3AP6A 3CQOA 4INDA 4PQQA 4QX2A 4ATFA 5IHRA 2BWAA 5L19A 1VRH1 1DQ0A 3KB5A 2P1BA 1Q8VA 4KGGA 3TN92 1DQ4A 4JC1A 2Z79A 3VBOA 5CADA 3NNJA 4ASKA 5C4WB 2D6NA 2NZ9A 4CTEA 2YYOA 1O8SA 4OQ8A 2VBDA 1B35B 1PIV1 5ABJC 1RUC2 1J84A 2BQPA 5BPXA 3WINE 4D6RA 1QJEA 1O5UA 4D0QA 4BPZA 1H2LA 3A22A 1RUD1 5EJ1B 3NJVA 2Y6FA 4QD2A 2HBUA 5JMCA 2CHHA 2KM2A 3RFRA 1ZBE1 2X29A 4CDXB 1BEV1 1DQ1A 2VR4A 3IDBB 3VB9A 2B7YA 1J1LA 5FPZA 4R9BA 1H8TB 3AMMA 3BN6A 4M01A 1W6PA 3M70A 2WLPA 1LHUA 1OFNA 3ZYGA 2ORXA 4V2WA 2JXAA 3RRDA 3PVBB 5EV7A 4YZ2A 5LB6A 1LU1A 4OHVA 5LEKA 3GJAA 3A23A 3CZUA 1XE8A 4AVVA 1ZZ9A 1MQTA 2Q1ZB 2W95A 3NMBA 1K5MB 4CVUA 3MW3A 3K4AA 3I2JA 4QGMA 2QE3A 2RMU2 3CKHA 1K12A 3RSJA 2CDOA 3AKQA 4GH4A 1F35A 3ACLA 3PU8A 4XUOA 3GALA 2P6CA 2NMOA 3IPVB 4Y1VA 4YW7A 5A7NA 5A3UA 3I2OA 1W6QB 2ZEYA 2VOTA 2NM1A 3IM0A 1DBNA 3ZR6A 3CL1A 1RJ8A 1DYOA 3ZYIB 4DO0A 3THCA 2XJVA 2D40A 5L9BA 1AJOA 1XYNA 3I59B 2X09A 3BUCA 3SCHA 2IFWA 2WO7A 1TEIA 5CIRA 3ZFGB 3FX3A 3WY6A 3ZDSA 2I45A 5SV5A 2GALA 4LO6B 2WDBA 1JZ6A 3MIHA 4KU8A 4AYUA 4WM7A 2B39A 4XE9A 2HWC2 5FPLA 2DCTA 5BNNC 1D4M2 1QKQA 1DFQA 3J9SA 3LPFA 3POGA 1IG0A 1R093 3VD5A 1S0GA 1ZX5A 3M4FA 4U36A 4UFJA 3ALQA 5BNOB 2YC0A 4C90A 5A6QA 3SCGA 5DZGA 2BW8A 2Z4FA 2Q8DA 4FT8A 4LULA 1LEDA 1LESA 5JMOA 5JOXA 1RUE1 3D0JA 1JHNA 3O0VA 4RFT0 5I8SA 4UW3A 2ZGSA 3FUOA 1DZTA 2OA2A 1LGCA 4Y4YA 5DUVA 4C0BA 5C4WC 5EYYA 1RITA 1WCUA 1PZ7A 4WV8A 4JRAA 3FHQA 1ULGA 2EXKA 2J1EA 4Z2WA 1NE4A 1B35C 3LEIA 5FYZA 1SLLA 4K1YA 3D0SA 1VLNA 1R1A1 2Y34A 1UZYA 3PTRB 1QXPA 2VMIA 4GULA 1SLCA 4Q0PA 1M06G 4BA6A 1JYNA 4CDXC 5A3WA 1MS0A 4RR3C 3MUY1 1LJ7A 2E7TA 3MO4A 1H8TC 5FOJB 5IAVA 1KJRA 1UZVA 3LKJA 2BNMA 3ETPA 3J7NA 1RUNA 1BKZA 2JDMA 2Q8OA 1F8VA 2VVFA 1WLCA 4IETA 4Q0QA 1BLZA 1UU6A 3KV9A 4NWWA 3OBAA 1RXGA 4S2FA 5JIUA 4XQDA 4M3CA 1Z0HA 4Q29A 4IESA 4WBBA 5IK8A 4B8EA 2DBIA 1FATA 1LHVA 3N7JA 2HWD3 4R4XA 5CG8A 1HJFA 3HMYA 3DKWA 4BZ4A 4L97A 1OA2A 4QPGB 4JGZA 3NWKA 1RUF3 1L7LA 2JG9C 4R52A 3ELNA 3EQEA 4JKKA 1VP6A 2WAAA 4FOYA 3DN7A 3ILNA 1UMIA 4KNCA 4HVRA 2UY8A 4Z8BA 1ZRIA 3K4DA 1RJ7A 4TLFA 3FFQA 4ET7A 4DXTA 2D6KA 2RS13 1BCXA 3JZVA 1RVF3 2PQSA 2XOMA 4R8HA 1R092 4PJYA 3INAA 1CPMA 4FAHA 3JBG3 1H9PA 3OYWA 1W3VA 2VZTA 2WN3A 3LIGA 2BOIA 4CDWB 4YW5A 1CAXB 2JE9A 3WP6A 2OX0A 4ZONA 2RM21 2ZACA 2BERA 2GC3A 5A7SA 4D7TA 5BNOC 1D4M1 3J7LA 3BIWE 5CKMA 1UX7A 4G9SB 5D2AA 3VDDA 5FZOB 5JSRA 1CQ9A 5ACA3 1X8MA 1W6MB 1YQ5A 4R9CA 4F3JA 1RL3A 1AYM3 3MBWA 2CDPA 2ZAAA 3CIHA 1YYNA 3KQ4B 1GP6A 1ULOA 5DAQA 2HKXA 4DINB 3RZKA 3W21A 2ZHMA 3BALA 3DKQA 2JG8B 4IGQA 5C6CA 5JAXA 2W1UA 4P5YA 4XXAA 4LBQB 3ZSKA 4R4ZA 3NVCA 4XUQA 2BU9A 5F3GA 1CAWA 2DCKA 3BB6A 1NZCA 4WVMB 3RVHA 2JX9A 5F7UA 3T4VA 4FPGA 5DUUA 2OUHA 1OOPB 2ZGTA 4CZSA 3LEKA 1YUDA 4Z07A 5I8YA 2YROA 2I74A 2PFWA 5A6ZA 4JKLA 1O8PA 2C24A 2PMWB 4JCKA 4YW6A 4ISQA 1XNBA 3IDEA 1WD4A 3UGGA 1REEA 2BYVE 5ANNA 4HVQA 5FZDA 2JKBA 4YW3A 4G3YC 1N1VA 3B7MA 3OD0A 1VBA2 2YGLA 3AMQA 1N3QA 3DXTA 3KV6A 4FQ4A 4FXGB 4UF0B 4XURA 5FFOC 1C3HA 4CXYA 5FP7A 3WDYA 1H6YA 1GFF2 3FHAA 1SACA 2PHUA 3GXUA 2ES3A 1EPWA 4AFBA 2HWD2 3DPRA 2C1FA 5T52A 2VMCA 2JEMA 3G7DA 4UBGA 5FMOL 3WW1A 4XZPA 1QJX2 1XOYA 1RUF2 4N53C 3H8XA 1GOGA 3OY8B 2X5IA 1AUYA 4S2DA 1PGL2 4QPGC 1ENRA 4EQVA 4YZ5A 5IK7A 4UT5A 4FPLA 3OGSA 1ZBA2 2PHTA 2NYYA 5H9QA 5HV0A 4LNVA 1LAJA 1AJKA 1BBT3 4JTNA 1COV3 3S30A 1D0HA 2QQMA 4MOAA 5DAVA 1RVF2 4YFZA 1PO22 2AACA 3MFCA 4ZZ8A 2PTMA 4GMP3 2WO1A 3T2TA 3PNAA 4SBVA 3V64A 4HOOA 4Q4Y3 3H9AA 4FOQA 2YGMA 4LHLA 1DZQA 4CDWC 3VHPA 3VD3A 1TME3 2QQVA 2ZX0A 1R091 2WINB 3I7DA 1V0AA 5ACA2 4YFWA 3RWNA 5KC5A 4CDUA 5LA9A 4AEJA 2JIGA 3WHTA 3R05A 5HI0A 3MIBA 5JSOA 3O14A 2VBPA 4W6YA 4QX8A 2VNVA 3UESA 1I9RA 3UL2A 1XNAA 1YO8A 4AR2A 1VBB2 2EA7A 4W4ZA 1OKQA 1JOBA 4YZ4A 2R043 4QQ2A 2A7AA 4FPYA 2JG8C 1VAKA 2Y8KA 3PUQA 1UIJA 1YRZA 3HEIA 2UWBA 3V56A 2KR2A 1MZFA 3MEPA 2IXJA 3LDKA 4YM3A 4RQPA 3ZO0B 4C1WA 2PAEA 2ZMNA 1OOPC 4QKNA 2VZ1A 1CX1A 2GU9A 4TYSA 1WCKA 5JDBA 1ZRDA 4M0HA 1SCRA 3U4XA 5F5CA 1RUJ3 2OQ6A 4FFFA 1UW8A 1NUKA 2VL4A 1G9AA 5IK4A 2ETEA 5J3UA 4KBZA 4WM7C 4AEKA 2E31A 4NRMA 3S5AA 2NP0A 2LROA 4IGPA 2ZABA 4FQZA 3EYPA 1UY0A 3D8CA 1IPJA 1VE0A 1VB4A 3LOBA 5FQ0A 1ST8A 1FXZA 4Z1VA 3ZYRA 2L9LA 5T5LA 4BXFA 2H6BA 4EJRA 5FZLA 2ZA9A 1O4YA 2OQ7A 3NNLA 3ZFFB 5HXMA 1BMV1 4XJ8A 1XYOA 2HWD1 1OD5A 1W05A 1VALA 2GH8A 1UXZA 4JX0A 5E6HA 4X6RB 3NRUA 1HQLA 1NT0A 1T2XA 4O65A 4A7KA 2YBPA 1W6OA 2OKXA 3OG2A 3TEZA 1RUF1 3MI8A 2YU2A 3WHUA 5FYTA 1AXKA 5E89A 3ZR5A 3Q8CA 3DECA 4LBJA 2XKPA 3DXUA 3VKMA 4A42A 3CJIA 1CZTA 1AX2A 2RJ2A 5DN2A 4XJAA 2PHXA 2EVXA 1KDMA 1UYXA 1UOJA 1QNYA 1UY4A 3OBZA 2RS11 2PYTA 3AC0A 3CMGA 1I3HA 1RVF1 1TME2 5EFUA 2Y6JA 3TWIA 3U75A 4CP1A 5CBLA 3JBG1 3OGJA 3HD8B 2Q1MA 5FUNA 5K8SA 3H8OA 3NV3A 2VNRA 1OVSA 5C3OA 4A6OA 5KXEA 2Y26A 3GHNA 4Z92B 1AZDA 1KFXL 4A7YA 2GN7A 3VZMA 5F5IA 3ZKYA 4DS0A 3PVNA 2ATFA 1AL23 4IV3B 2GN3A 2UY9A 2R042 1WCQA 3BYWA 3M8LA 5ACA1 3RPQA 4IEOA 4BQXA 1AYM1 2ZHKA 2HYKA 3H0OA 4P9XA 5AFEA 4QXCA 3B02A 2E9QA 5EPAA 2FDKA 3VBUB 2C9KA 4ORFA 1T6BX 1LHOA 5FIXA 1SFYA 4CU6A 3VKOA 1W2AX 3SEPA 1PNGA 1DGRA 2BEOA 4BWOA 1HKDA 5T5OA 3C7OA 1OSGA 3JD73 3NV1A 4TSVA 2WNUA 2ZX4A 5C5UA 4QPWA 4Q5OA 1TG7A 4COWA 2V72A 2WQ4A 3LA2A 3VBHA 4BB3A 2OUJA 1NCQA 4CP9B 4P9WA 1BYHA 1OBNA 1P8JA 3I54A 1HRI3 2BFUL 4IEQA 1WLTA 4L99A 4C0HA 4E4DX 2B8MA 3CNAA 3OF1A 5C71A 3V65A 4A3XA 1ULEA 1V6LA 2GZWA 5CKQA 5C3SA 4XYXA 1V00A 1VBE3 1K45A 3OB8A 1UZWA 3T4HB 1GYKA 4OYUA 2H0BA 2FHRA 3N3HA 4E4SA 3RZGA 2I2SA 3WQ0A 1POV0 1SCSA 1UOGA 1JZ7A 2A70A 3C2UA 1GICA 2J1VA 3V0BA 3ZXGA 5FUIA 4RGKA 1V6IA 1RHI3 5FZBA 2WYSA 4YRDA 4CCCA 3H1WA 5AC92 4IXLA 4EWAA 4CCOA 4O7XA 1OI6A 5J1XA 3NV2A 3N9NA 2VMHA 2JDKA 2ZZQA 1QU0A 1C5IA 3GBGA 4E27A 5ABJA 3WOGA 1M4WA 5ANQA 3RZHA 2D6MA 1BBT1 3IT8A 1COV1 4OFGA 4RGAA 5FJKA 3TAYA 1DLCA 1IPKA 2YXSA 3H3UA 3FJSA 1KFUL 1ODNA 3H42B 4GMP1 3VHOA 4DRVA 5H9SA 4J25A 4EWEA 3WP5A 2VTFA 2V5DA 5KXDA 1J59A 4Q4Y1 1YFUA 3BODA 4XILA 4W65A 5LK5A 4AQ2A 4AVSA 4B3NA 2RJLA 2ZMLA 2IWGB 3R4UA 5FR3A 5L9VA 4CU7A 1AL22 3AB0A 5FYVA 1TME1 4JTOA 1GU3A 2ZCWA 3IN9A 3C3VA 4NO4A 3K75B 4IV3C 2BGPA 3HPNA 4O61A 4Y5TA 2Q8CA 2H0VA 1UAIA 2W9XA 1F5FA 4IL7A 4XMAA 2VXJA 4QX5A 4AXOA 4BQ5A 2DCJA 5L73A 1QEXA 4IEVA 1IS5A 1RGSA 1V9U2 2ET7A 2XG3A 2A3WA 2YY1A 3FLRA 1XNTA 2R041 3VBUC 3AYEA 4OUEA 1AR63 1JYIA 3O1RA 1HQNA 3JD72 2QZ3A 4RL7A 2Y6HA 4TZDA 4K7JA 5DXDA 5FPUA 3NAPC 1W8WA 5F6LB 3ON7A 5DDJ2 1U5XA 5LBBA 2A71A 4BM8A 4CSWA 2R1BA 1SPPB 5FZ3A 1NA1C 1AX0A 2D5FA 5FZ9A 1MR5A 3TNQA 3HNBM 1GZWA 1ZA7A 1W9YA 3UJOA 1VBE2 2FDGA 1OT5A 3O1SA 4AHYA 1OPOA 3KVBA 1S0EA 2ZX1A 5FZ7A 1RUJ1 4CYDA 1WW5A 4K40A 5D8AB 1GWMA 3O12A 5BNNA 3DV8A 2A6ZA 4GXLA 1SDWA 1B09A 2WJSA 3S0MA 3LQCA 4JAAA 3I2DA 4LBNA 5JZGB 1OC1A 4DQAA 1LOCA 1NOVA 3FLTA 3RZMA 2PHWA 1RHI2 2J7MA 2WC2A 5BNQA 2DCZA 4UBHA 1YQCA 4LKDA 3PHMA 4LIUA 1EAH3 4URAA 4N7IA 1YIFA 1UY2A 3BGAA 4J1XA 3A4UA 3ASIA 5EXOA 5C4WA 4YVSB 4F8AA 4U2AA 1UYYA 1TZOA 5FP4A 1XQNA 2BGOA 3BTAA 3NV4A 1GMMA 1B35A 1RUG3 2QQKA 2X53S 4GB32 1IS4A 1UNBA 4JZRA 5GZEA 5EP9A 2VJXA 4NHMA 1NXMA 3AM2A 1LEMA 5A6YA 5JCTA 3E6CC 1IOAA 4A3ZA 5JPMB 2J1TA 3MLLA 4XFBA 1W9TA 1X33A 1LOGA 2LUWA 4CDXA 1JZ3A 3S57A 3HNMA 2VZPA 2VOXA 4XF4A 5FZIA 3RMYA 2JB4A 3ATGA 1H8TA 4Y1UA 4OLLA 3X29B 1OH3A 3ZX7A 1H6XA 3WNPA 2VZOA 2WSUA 4Y20B 4KQ7A 3OGRA 1AYN3 2JDZA 4S2HA 1XB9A 1S2KA 1SFPA 1K5MA 4CEWB 1AL21 3O0XA 2JD4A 1VB2A 1IG3A 4KBBA 1ASJ3 2TBVA 1Y9GA 4LEJA 2XJUA 3ZFFC 5F37A 3PIGA 2VNGA 1OPMA 3P1IA 1W6QA 2FZ2A 1ND2B 1N1TA
chains in the Genus database with same CATH topology
3FBMA 2JG9A 4I3GA 3HR9A 1FNYA 1V70A 1WA4A 2WT1A 3TN93 1DQ2A 4NHKA 3ZXEA 3JD71 1SLAA 1QOTA 3I59A 1BZWA 1RC6A 3LA3A 1YCIA 3ZFGA 1NY72 5JWPA 1HRI1 3ENRA 1RUC3 3J4UH 4AGRA 3ZMOA 4HSJA 4YGEA 5D8AC 1YI7A 2D6LX 1WBLA 3VL8A 1VBE1 2XUMA 1LTEA 2DUOA 1UX6A 3BOPA 1LGBA 5JZGC 5BNOA 4E2SA 3SH4A 1FI2A 3AKTA 4AW7A 1YLLA 1V6KA 1V6MA 1VIWB 1X50A 1Y3TA 3QCWA 4KGQA 2D5HA 4YVSC 4HN1A 3ZIWA 1URXA 3WP4A 1RHI1 3SITA 1ENSA 1MEC3 4W6XA 3M3IA 4EN6B 2RMU3 4AE2A 1PGSA 3VUOA 2Z42A 4WVVA 4DB5A 3DF0A 3AFGA 5GZGA 5CFDB 1EYBA 2B46X 2ZAHA 2VW1A 3SH3A 4I02A 5J37A 1CPNA 1IS3A 2GMEA 1OA4A 2N7GA 1OFSA 3M3OA 1WMFA 4G4FA 1ASJ2 5EZWA 1LOEA 5E8AA 3R6SA 4PLOA 4CEWC 2C0ZA 2HWC3 4XEZA 3ZMNA 2R061 2QFEA 4ONUA 3WX5A 1TMF2 1WW7A 5IUQA 3ZPYA 4BE3A 4YW2A 5TSWA 1S0JA 2DVDA 4N53A 1ND2C 4FP3A 4Y1YA 2NLRA 5J96B 3KSCA 3ST7A 4JVAA 4QPGA 5L36A 1AR61 2EAAA 1AR73 4JRLA 3L9JT 2VOVA 3N36A 1S0CA 4P9IA 5GM0A 2XPJA 5KHHA 1G9FA 4DOUA 4B4QA 1ENQA 5H9RA 4ZKTB 1JTZX 1Z78A 3QOPA 4KWLA 2TNFA 4LHNA 2QZ2A 4HPKB 2AGSA 2C5DA 4HKOA 5CFCB 1U5ZA 4CDWA 1NY71 2WWSA 1CAXA 3GF6A 2GAUA 3UK9A 4K21A 3N7LA 4RA0A 3VZNA 5GKAC 1QJU2 1MVQA 4P5HA 3HQXA 3VN4A 2P3JA 2WT2A 1QQP2 3LOIA 4FTEA 1W6MA 3Q9OA 4Q26A 4AVBA 2R073 4AQ6A 3RS6A 1MEC2 3KT7A 1EAH1 1QGLA 2JG8A 2W0XA 3E97A 3S7EA 4LBQA 4URTA 2YMZA 2W39A 1RUG1 5HXVA 3FBYA 5DZFA 5L7OB 4WVMA 4QPIB 1J58A 4PIZA 4PIXA 1OOPA 1G86A 3LB9A 4KG0A 4AI2A 4EWDA 2ZGUA 5F1RA 4O9GA 3SLIA 4GQ7A 2DUQA 3KGZA 2F6BA 4QM9A 3VBFB 1FAYA 2QDNA 4XTPA 1QH7A 5KHIA 2DVAA 1GQHA 1KD7A 1AYN1 2VY0A 3THTA 4B29A 1H9WA 2VNOA 1QJZA 1NCRB 4D7SA 2JECA 3ZN6B 4B7EA 4HZFA 3U07A 1IGOA 1W39A 2XWJB 2AZ5A 1ASJ1 2O0OA 2UYAA 1AR72 1S0IA 1D0GA 3HIFA 2CAUA 3OY8A 3POSA 4AFCA 1HLCA 1N3PA 1ZZCA 4LO8A 2CAVA 3MDPA 4GWMA 1I5ZA 2ARBA 2WA3A 3TN91 3M3EA 3QACA 2PHLA 3G6JB 3MIFA 4L8QA 4N90A 1REDA 4HK8A 3ZIXA 3AZZA 1AVBA 4HSLA 3EO6A 5K0UB 1FYUA 4HL0A 4GIQA 5GZDA 2D98A 1RUC1 3H7YA 5CFCC 2ARXA 3ZSJA 1AX1A 2BWCA 3B3QE 5HCAA 1PK6B 3WDUA 4X8PA 5JOZA 2QCSB 4AGVA 1CAUA 2XVLA 3POYA 1YFYA 4RSUA 4GKYA 2A75A 5GALA 4XETA 2R072 4ES8A 1GZ9A 3AYDA 4LBKA 1VBA3 1K5MC 2MEV3 4F83A 2WNVB 3EJKA 1PVXA 5A32B 2RS32 3GHMA 3JB4C 4QM8A 2XJSA 4FPFA 1H2NA 2RMU1 1GSLA 1UKGA 2XLFA 1QJX3 4QPIC 5BV6A 5L7OC 1VBC3 4DY3A 3RNSA 3VL9A 3U11A 3KCCA 1DLLA 2XB6C 4FPEA 1OQ1A 5T55A 3NO8A 4ZU5A 1AHSA 2BVVA 3UKNA 4LT5A 1ZBA3 3VBFC 3T1MA 4RHV2 4XBNA 3ZFGC 4I0WB 3TB0A 2RR13 1PO23 2DUPA 2PAKA 4L9BA 5KC6A 4Q8KA 4I0AA 3VV1A 1SBEA 5FTTC 1QDOA 1WCDJ 1ENXA 4RD7A 1MACA 1NCRC 3IKWA 3H50A 4R9DA 4XFFA 4YW1A 5T5PA 4D94A 2CWMA 1EV13 2HWC1 4HVOA 1BVVA 1CONA 5JI7A 3ZSMA 4XW3A 3D6EA 4FPOB 2QKDA 4Q0UA 4BMBA 2O8QA 1AR71 1NLSA 3ZSLA 1MVEA 4H55A 4OULA 1N1SA 2PQQA 1AR83 1VBB3 1ZVFA 3J8F3 5H9PA 3NSTA 3S6PA 3LSEA 3RI8A 1GLHA 1G7YA 1SQ4A 5K0UC 1XRUA 1W6PB 1YNAA 2IZWA 2XJRA 4PLMA 5C9AB 3IDCB 1RUH3 4NR1A 5GLTA 1Y9QA 1ONAA 5FAXA 3MIEA 4J1WA 1PK6C 4YG6A 1QXJA 1G9BA 3HT2A 4M3CF 2MHFA 1ZRCA 3E6BA 4MGKE 3EBRA 3ETQA 3ZXLA 3KD4A 2MEV2 3N7KA 4IV3A 1LECA 1E57A 4N43B 4XMIA 2XWBB 5KHJA 4AF9A 3WCRA 1H2KA 3BU7A 1YJLA 1RUOA 1NYWA 5F9TA 2WNVC 2R071 2NQYA 4MXWB 3VBUA 5BNPB 1TE1B 1VBC2 1O4TA 5GJ6A 2YPJA 2R0HA 4XBLA 3WD5A 4Q8LA 3NAPA 1RTVA 1NA1A 1QH6A 1Q8PA 1SFNA 4E4ZA 1PM7A 4IEPA 4QQOA 2RR12 3B69A 1D2SA 1REFA 2IFRA 4MUVA 3TOJA 3USUB 5FO7B 5FCCA 5FOBB 1CIWA 4ZU7A 2XKOA 1YIPA 2CWSA 1CJPA 1W6NB 5KXBA 1EV12 2WZR2 3E6DA 4YM2A 4ATEA 3OBTA 2IXHA 2QUOA 4K8FA 2JENA 4DMIA 5CB7A 4Q1RA 3W9AA 2EIGA 3AP5A 1HX6A 2AREA 2VMGA 3PLQA 2A3YA 4M3CE 1AR82 4AQTA 3J8F2 1A8MA 2PHFA 3RJRA 2VPVA 3WDWA 3ZFEB 3P3NA 5GLUA 1RUH2 3KS7A 4YG0A 3VBRB 4AG4A 2DCYA 2VUJA 2A6VA 4K3UA 5C9AC 4XQWA 2Y0IA 4Q0SA 5T50A 1QNWA 1S1AA 1LOBA 3B01A 3ILFA 1FOD2 1RUI2 1GKBA 4HK9A 1Q8SA 1G8WA 4L2NA 3NW4A 3WG4A 3U10A 4UW5A 3B94A 3UKVA 3ILRA 4H7LA 4FTBA 4YLZA 1VBA1 2XLGA 2MEV1 3ZFFA 4DZGA 1KQRA 4MV2A 1O3RA 3PJYA 4DPNA 5BNPC 3NL1A 5BY5A 3ME2A 3VGIA 3L2YA 4PDWB 2IXCA 1LCLA 3MFAA 2Y38A 2KXLA 3AZXA 2DVGA 1QJX1 4QHBA 3N35A 1TNFA 3VLBB 5AC93 2E51A 4W6WA 2P17A 4K1ZA 2DFBA 1WD3A 1ZBA1 1C5HA 4XPVA 4EN8B 3LZZA 5D8AA 3KGLA 3AKSA 4AVTA 2RR11 3KQRA 1PO21 1Q43A 4XJWA 4YGCA 2X8KA 2DVFA 2D6PA 5JZGA 1MS9A 1GNZA 1LULA 5LK7B 4YGBA 1EV11 5IK5A 4PBPA 3PMSA 1JH5A 4C91A 4OHXA 1H1IA 4YVSA 2ILMA 4LO7A 2XVKA 4BH9A 3AZWA 1Q56A 1SBDA 2HEWF 2VU9A 4QQHA 3ZFEC 4ZXKA 4Y5Z0 1KS5A 1W0OA 3WVJA 1V9U3 1AR81 1VBB1 1C28A 3AP9A 4YVWB 3CU7A 5LRRA 1OLQA 3VBRC 3WP3A 2A3XA 2R49A 3GBFA 4HN0A 1HW5A 1H30A 2OPKA 1PVC2 2XGXA 5DDJ3 1N1YA 2UURA 1RUH1 2EAKA 3MICA 1C8M2 4Y20A 3ZN4A 3RQ0A 1FPN3 3PVEA 4RS5B 2P34A 2PLV2 1R083 4CEWA 1AF9A 4JGYB 3KZ4C 2X5IB 3VKLA 1XYPA 4IV1B 1RIRA 2Q5TA 1DIWA 1JYCA 1ND2A 4KG8A 2BNOA 3O5SA 4AQSA 4HFSA 4XFIA 3SNMA 3LCPA 1DQ6A 4AI1A 4LHKA 2DF7A 3KCYA 1SEFA 1U5YA 1WMDA 1LHWA 2EF6A 1ZREA 3ZSEA 2BNNA 1O5LA 4XF0A 2VECA 3WV6A 1VBD2 4JV4A 2WNEA 1OHFA 2PHRA 1DZRA 1T6GC 2OZJA 3AYCA 1UMZA 1AXYA 1R1ZA 2Q0AA 4GB33 2IXLA 2MNGA 2ZBJA 5J09A 2A6YA 4MGYE 4Q4W3 5DG2A 4YG3A 1YI9A 4H3WA 3MW2A 2FMYA 2F4PA 4MVTA 1PO13 2GNBA 1PGW2 2XJTA 3LWCA 4L92A 5I0SA 1JUIA 2AH2A 4XF9A 3OD4A 4R9AA 4AI0A 5AFBA 1WLWA 4XOGA 3ZYPA 5JPNB 4FCAA 2D44A 4XQ4A 3FFZA 4RQPB 1LGNA 5C8CB 3WLUA 4XHBA 3WDXA 1BVP1 3WCSA 4Y1ZA 2DURA 3VHRA 4YVWC 1QOSA 5JIAA 5DUWA 3WW4A 1QMJA 3GBWA 4LO4B 1EP0A 2YHJA 4FSJA 3AJZA 1APNA 3EHKA 5HCFA 1KS4A 2OVUA 2HWE2 3AMHA 4XIOA 1VJ2A 5HCBA 1DQ5A 1FPN2 1C1FA 5GZCA 5KHGA 1GR3A 5BUVA 1R082 3HBZA 2WS93 4IEYA 4MGZE 4RS5C 4EROA 4A7ZA 4HBNA 1DYKA 1MZEA 2D93A 4JGYC 3AX4A 4NHLA 2HWF2 4IV1C 5LRSA 4V1PA 4YARA 2EXIA 3ZXAC 3ZXDA 2BTVC 2KA3A 1LKNA 5CA6A 5GLWA 4EN0A 4XJ9A 1AL0G 2CGNA 2XL9A 2PHDA 5D1IA 4BHPA 1LOFC 1RMU3 2VXRA 4ITCA 3ES4A 5AC91 3WR0A 3LGRA 4DRRA 4HT1T 4HPKA 2ZTNA 4Q4W2 5AVAA 5CFCA 2C9AA 1C57A 4QT6A 1S0FA 2HEVF 2B45X 2LM3A 1PO12 4FO9A 1G9DA 4LA2A 4O9EA 1H1AA 1ZRFA 3BCWA 3ECQA 4PQ9A 3V0AB 4OI2A 4AWDA 2K2SA 4XIKA 1PGW1 1X82A 5C8CC 2HJIA 2O1QA 2VULA 3JU9A 1UF2C 1BXHA 3IPVA 3JB8A 4CP0A 2HWB3 5GLZA 4B7KA 4P9JA 3MIGA 1H8VA 5L7OA 4QPIA 1TMF3 5FLHA 1V9U1 3QH6A 3HWJA 1POV3 3URFA 5BYNA 1MS1A 1DGRN 2DU1A 1CX4A 4PCRA 4WM8B 4XTMA 3VBFA 3SMHA 4D7YA 5DDJ1 1ZYBA 1VRH2 2WS92 2D3RA 4AVAA 4MSVA 2W52A 2QDRA 2ZGRA 1FPN1 2ZKLA 5GLVA 3UKTA 1WGPA 4MGIE 1NCRA 1PIV2 1UU5A 1R081 3ZN6A 1I1EA 4LO5B 5I8TA 1H2MA 4DNYA 3CLPA 4ES9A 1SBFA 2VG9A 5FBZA 4DY5A 5J36A 4P9YA 4XXPA 2WA4A 4YW4A 1QJU3 2EXHA 1LHNA 1ZBE2 4EV0A 1DGWA 1QQP3 2WZPP 3FMGA 2CL2A 2ZGNA 1RMU2 4N9IA 1FV2A 3KT4A 1QOOA 3W59A 1A78A 3I4IA 4LBLA 4Y22B 4CDQB 3ZYJB 1HRV3 4XJZA 4B4PA 2RE9A 5K0UA 4IEXA 2E7QA 3MW4A 3ZVXA 2P3KA 1LODA 1ULFA 4GB31 4FPJA 1FNZA 3MGUA 1PK6A 2WFPA 3WZ1A 4Q4W1 5A33B 2ET1A 2OW4A 5EJ3A 3VZOA 3I8TA 2GNTA 5LEJA 4Z82A 4HETA 4NWVA 2WLQA 3APBA 1PO11 4AHWA 4META 5B2GB 2D3SA 3AKRA 5BXXA 2WNVA 2HWB2 4Q27A 3NKGA 1ZNPA 4XJUA 5A32A 4GA9A 1I6XA 3KLSA 4QU2A 1OMIA 3RYPA 3KMHA 2CGOA 5AVPA 2WQZC 4H7MA 4WM8C 4Y26A 3RYKA 1DGLA 2QJVA 4KL1A 3THPA 2GNDA 1PGL2 5C8WA 1DGWX 1NQJA 2WFF3 4H14A 3AP4A 1ND3B 3QH7A 1OLRA 2DV9A 2GC1A 2ZGPA 2TEPA 2WS91 5J98B 3UV9A 3E5XA 5T54A 1PZ8A 3SCFA 3T1LA 4HMZA 2XL7A 2ZGKA 3ZXJA 1R1A2 4QXKA 4AFMA 1ALYA 4L11A 5JLVA 4I09A 3IMNA 1SLTA 1KRIA 2VOWA 1YFWA 2A6XA 2IXKA 4COVA 4FPCA 4AFDA 1HRV2 1MS5A 5KBFA 4COZA 4RR3B 4CDQC 1RMU1 2G9FA 3DUIA 4OUMA 1NXD1 3AKPA 2RS33 2P3IA 5C9AA 1QJY3 1ULCA 2XH6A 3R4SA 1PZ9A 4I3PA 4A2UA 1UD1A 1PHMA 4LE4A 5CFDC 4K20A 1CVNA 5J7MA 1C4RA 4Q4V3 3ZN5A 1N3OA 2V5YA 4RHV3 1JW6A 5FO9B 3OPZA 4N43A 4HKLA 5F5QA 3WQ1A 4P14A 1JN2P 3JCIA 4BIFA 1LOAA 1OQEA 2JG9B 2ZJCA 4MXWA 4FOWA 1LB2A 1CJDA 4HANA 3H8UA 5BNPA 4AFAA 4IEUA 3OTFA 2HWB1 1D4VB 4Q2FA 2A6WA 3MPBA 1TMF1 4YYOA 1GQGA 2ZX2A 1POV1 1WLDA 2RM22 4LLFA 5FPXA 1EY2A 3AJYA 4PBOA 2WFF2 3QLQA 3USUA 4MYEA 1Z7S3 2P37A 4AEDB 4HLTA 2B5HA 1ND3C 3R0RA 3MF9A 1QY4A 1W6NA 5I0UA 3W58A 3GYDA 5JSPA 2GMMA