2JJ6A

Crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
VPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-RELATED PROTEIN
publication title Crystal Structure of the Putative Carbohydrate Recognition Domain of Human Galectin-Related Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jj6A00
3AP5A 4LBMA 1LU1A 1QNYA 2AUYA 2ZKNA 2DU0A 4LBNA 4YW2A 5DZGA 1BZWA 5H9QA 2AENA 1MZ6A 3OBTA 1SLBA 1ULDA 1X50A 1BQPA 1QDCA 1AX1A 2ARBA 3AYDA 3WNXA 3V65A 2ZHKA 4P14A 4R9BA 1SLCA 3WCRA 4BM8A 3SH4A 2H0BA 2WT0A 4D69A 1UX6A 4NO4A 5E8AA 4XJUA 1O4ZA 3OJBA 2LALA 3A0NA 3M1HA 2E53A 3ZXJA 1IS5A 5IUQA 2G4IA 4M3CB 1SFYA 1LHWA 3WVJA 3Q9OA 2YV8A 3T2TA 1DQ5A 1QF3A 2DVAA 3D4KA 2DTWA 1CONA 4I30A 4YZ2A 1W6MB 4XYXA 4FP3A 5GLUA 4Y20B 1DBNA 2EXHA 1NLSA 1LOFA 2ZGQA 4BMEA 3FLTA 2A6ZA 1G9FA 2ZGSA 1S1AA 3ZSLA 3ZYPA 4YZ5A 5H9RA 1JXNA 1LCLA 4M3CF 1V6MA 3ZXEA 2AYHA 2D6PA 1HDKA 1GSLA 4FP2A 2ZGMA 5DZEA 3WDVA 1IS4A 4BMBA 4FQZA 4Z8BA 4UW3A 2PELA 1LODA 5FREA 1LGBA 2A6XA 4AVSA 1DHKB 3AYCA 2DVBA 2P3IA 5DUXA 1LEMA 1GBGA 5GZGA 3N36A 2R1DA 3ASIA 4K21A 3AP9A 3FFZA 2DV9A 2ZGNA 1TEIA 3N7JA 4K1YA 3ZSJA 4DQAA 1RITA 1GZCA 1LOFC 1FV2A 4P9YA 3W58A 5JOWA 4C1WA 4YFWA 2AGSA 2UWBA 4M3CA 3B00A 1LECA 3B9CA 5GLVA 1EPWA 3WUCA 3TB0A 1H30A 4Q8LA 2EXIA 4ITCA 1VALA 4FPOB 4W65A 3ZXKA 4PF5A 2P3KA 3VKLA 4Y20A 4CTEA 1B09A 2PHWA 3DGTA 3W59A 1YO8A 3WHTA 2ZBJA 3RS6A 4YM2A 1LESA 1LENA 2VU9A 1YYNA 5H9SA 1WW7A 2W52A 1D0HA 3SNMA 4DRVA 4ATEA 2ZHMA 2Z42A 1G7YA 2NN8A 3O0WA 1QU0A 3GALA 2ES3A 5GZEA 1FX5A 3WV6A 5DG2A 3N3HA 1MS5A 2ARXA 2ZHNA 1AZDA 4SLIA 4DFSA 4HL0A 3JU9A 4HANA 1IKQA 2CWSA 4FOYA 5KXBA 3VKNA 1S0BA 1N3QA 2A3WA 2VUAA 1MS0A 2YZ4A 1O4YA 2D6MA 5KXEA 2A5ZA 3WDXA 3NV4A 2E7TA 2A3YA 1W6PB 1FYUA 2GNMA 3IMNA 2XB6C 1YI7A 5F5QA 5JDBA 3N7LA 3PVEA 1SLTA 3WCSA 3D5OA 4XMIA 4YZ4A 3ZXLA 3AP4A 2CY6A 2I2SA 3WHUA 2WLQA 4DS0A 1APNA 1QKQA 1PZ7A 5CBLA 2WT1A 5E88A 1MS8A 3PVNA 4GWNA 2WSUA 4FOQA 3PJQA 3UJOA 1AX0A 2VW2A 1W0OA 3SISA 1GYKA 2JE9A 5JMCA 5EYYA 1LHNA 2GDFA 2PHXA 1CESA 2YMZA 1AJKA 2NYYA 2D6OX 2DVDA 3ILRA 2GMEA 1UPSA 1GLHA 1U0AA 2CYFA 4YM3A 1H9PA 1HQLA 3ILNA 1CN1A 3OY8B 2ZGRA 4XMAA 2P34A 1UKGA 2BQPA 1PZ8A 2EIGA 3AZXA 3NV2A 5EXOA 4ZXKA 2R49A 3AX4A 4YW3A 5GALA 4Y22B 3WDYA 1LOCA 1OFSA 2VXRA 3FLRA 1YXWA 2E51A 2GN7A 4Y26A 1CJPA 1LHOA 2A6VA 2PHFA 2VW0A 4P9XA 4BPZA 1W6PA 1A3KA 1GV9A 2W08A 3UJQA 3BODA 2SBAA 4UW6A 4LBJA 2WJSA 3IPVB 3APBA 1ULEA 3SH5A 2E6VA 1W0PA 2ZA9A 4ISRA 3NWKA 4GXLA 3RMYA 3ZPYA 2YY1A 3T1MA 5HCFA 2GMPA 1C1LA 4XILA 2ZMLA 4RA0A 2D3PA 1W6OB 2DUQA 4AYUA 3AYEA 3AZZA 2PHRA 5KXCA 1G9BA 1ENRA 3O0XA 1ENQA 4FPEA 3ILFA 4JC1A 2NMNA 1I3HA 1AF9A 2OUJA 5EWSA 1AXZA 4Y1YA 4XXPA 2ZHLA 1BJQA 4FOVA 1MVQA 5HCBA 4TZDA 3OY8A 4U36A 1FNYA 1XQNA 2A7AA 1V6OA 3FBYA 4ASMB 4AVVA 1SLLA 3O12A 4YW1A 1S0JA 2V5YA 5T5JA 2ZABA 4Y22A 3H0OA 4Y24A 1FV3A 2AR6A 4ZKTB 1QOOA 1DYKA 5JVVA 5IK7A 2CL2A 3HR9A 3OPZA 1SBDA 4AWDA 4YGCA 1G9DA 3USUB 1GZWB 4Q1PA 3B3QE 3IPVA 5SV8A 4XZPA 1C1FA 4M00A 3V0AB 4XE9A 4FPGA 2NM1A 1KJLA 1JBCA 2HYKA 4Y1XA 5GLWA 3KM5A 4YGBA 1F31A 2D7FA 1WLWA 4XTMA 4LBQB 4CRQA 1W6OA 1WW4A 1R1ZA 2R0HA 1WBFA 1WW6A 1WD4A 3CNAA 3PMEA 3UK9A 4BOWA 3VKMA 3T1LA 1MR5A 4XXAA 4AGRA 3SITA 1DQ1A 4XJAA 5T5PA 1KQRA 1UL9A 3LSEA 4FPCA 1D2SA 4WZFA 1S0GA 1SCRA 1OQ1A 4LBLA 1H9WA 1LU2A 3AYAA 4JCKA 4YG0A 2AREA 3GNEA 4Q26A 3WDWA 1AXKA 3AZVA 1SCSA 4ISQA 1S0FA 1WLCA 4CZSA 3B01A 1RINA 2OUHA 1CQ9A 1UMZA 2GN3A 1LOGA 1PZ9A 3WOGA 3KQRA 2EALA 3MW2A 3USUA 1C4RA 1GZWA 4NOTA 3M3OA 2ZMNA 1S0EA 2ERFA 1LTEA 3V0AA 3PVOA 3FLPA 1SBEA 2GNBA 4YZ3A 4UW5A 2GNTA 1QNWA 1G9CA 1S0DA 4LBQA 1LOBA 5IT6A 1MS3A 4AGGA 1MS9A 1Q8VA 2D3SA 4YW5A 3AXDA 1Q8OA 2W68A 3V64A 1CPMA 2DVGA 1VAVA 2R1BA 2DWRA 5DUWA 4PQ9A 1IS6A 1AVBA 2ZGOA 5DG1A 4FPHA 2Q5TA 2VH9A 3HMYA 1YIFA 4Y1ZA 3MW3A 1HKDA 1IOAA 1JUIA 3VKFC 1JN2P 1QDOA 2WKKA 3WZ1A 4FVVA 4XBQA 2JKBA 2DYCA 3AZWA 2UU8A 3LSDA 4AVTA 3AJYA 5JOXA 2GMMA 2OW4A 1DQ4A 4GALA 3HN1A 1JYCA 1G9AA 1MVEA 4Q8KA 1CR7A 4JRAA 5DXDA 1FNZA 3ENRA 3VKOA 2VY0A 3R4UA 1GANA 5HCAA 3RG0A 3NV3A 4L8QA 1UZZA 4YGDA 5E89A 4BQ1A 2FHRA 3A4UA 5T5OA 1LOAA 1VIWB 4Q2FA 5T54A 3N7MA 1IKPA 1FATA 1N1TA 4FPKA 4PBPA 1V6IA 4FPJA 1WLDA 3N7KA 4GA9A 1BXHA 2UWCA 5EYXA 1QGLA 5L73A 1LEDA 2D6KA 2DUPA 4YW4A 2YXSA 1AXYA 4R9DA 2DTYA 2EAKA 3WG1A 4PBOA 1CVNA 1S0IA 3BOPA 5LK5A 3SH3A 4M3CE 1HLCA 1KJRA 3AJZA 1HQWA 4LBOA 2KM2A 2ZGPA 2UURA 1BYHA 2CNAA 1SLAA 1KITA 1ONAA 2PHTA 4FQ4A 1N3OA 2JDZA 3WG2A 1UAIA 1DZQA 1WBLA 3ZSMA 3U4XA 4XJ8A 1IS3A 3POYA 5CB7A 3OBRA 1GNHA 1W6QB 1WCSA 1VAMA 1WUVA 2P2KA 1N1SA 2WQZC 1V00A 2DURA 3JUUA 4FOWA 2NZ9A 5IK4A 2E7QA 1GKBA 3LCPA 1NXD1 3B69A 5T52A 1V6LA 2EF6A 5FRAA 2DU1A 3IKWA 5F9TA 1V6JA 4K20A 1F5FA 1LGCA 1SACA 4WVVA 2DUOA 1DQ2A 4IQPA 4F83A 3O5SA 3FUOA 5JOYA 2WNEA 1GNZA 4R9CA 1Q56A 3RRDA 3MW4A 1DYPA 2C9AA 4C1XA 1V6NA 2A3XA 3QCWA 4YGEA 2JJ6A 3M3EA 3RQ0A 4LBQD 1Q8QA 1FAYA 2XG3A 1ZM1A 2YROA 1LGNA 1ULFA 1MS4A 3R4SA 1JW6A 3MEPA 1KRIA 5GLTA 2CTVA 3WLUA 3POWA 4RL7A 3DUIA 2ZGKA 4WV8A 1W6QA 3WDUA 2A6WA 2WT2A 4YM0A 2WSVA 3OGGA 5T50A 1Z78A 1JHNA 1LOEA 2SLIA 4PCRA 5GZDA 4MYEA 1N1VA 2PHUA 5KXDA 1C57A 1SLIA 2EXKA 1J1TA 1SBFA 4BLJA 2ZGTA 1AX2A 1QOSA 4YG3A 1G8WA 1I1EA 1ULCA 1G86A 1UZYA 5GZFA 4H55A 5H9PA 3TAYA 2LTNA 3IM0A 1AJOA 2CWMA 3FUQA 3R05A 3V0BB 4FPYA 2NP0A 1URXA 2P37A 3I8TA 3WUDA 3NV1A 5BYNA 1DFQA 1Y7BA 1Z0HA 3QLQA 1VLNA 1KDKA 4P9WA 4XIKA 2R0FA 2EXJA 3ZSKA 5AVAA 3AP6A 4YFZA 1MS1A 2NMOA 4M01A 4DRRA 1W6MA 2ZACA 4XJ9A 3SLIA 4Y1UA 1A78A 2V73A 5CA6A 1YRZA 1JYIA 2D6LX 4FPFA 3ZXFA 2JE7A 3RMXA 3A0KA 2TEPA 1F9KA 4YG6A 1MACA 1V6KA 1KDMA 1CPNA 1N47A 1GICA 1LULA 1LHUA 2A70A 1UN1A 1W6NB 2JD4A 3AP7A 1QOTA 3D6EA 4Q27A 4UW4A 1OKQA 3ZVXA 3C2UA 1WD3A 5GLZA 3BIWE 3VUOA 3ATGA 3L2YA 4Y1VA 4LBKA 4XJWA 4XJZA 3WG4A 5GM0A 5CAZA 1DQ6A 3M2MA 5DUVA 5IK5A 4KBBA 2D3RA 2D43A 2VW1A 3OYWB 5GJ6A 5GZCA 3MPPG 3I4IA 2ENRA 4BLIA 3V0BA 1Q8SA 4GKXA 1MZ5A 1RIRA 1N1YA 2C5DA 4XBNA 1A8DA 4XOGA 5DZFA 1LHVA 4XBLA 1DGLA 4XIOA 2GNDA 3RSJA 4U2AA 3POSA 4YZ1A 3O0VA 4TYSA 2D6NA 4XDQA 4XHXA 3WDTA 2AH2A 5JOZA 4OZXA 1N3PA 2ZGUA 2DVFA 2ZAAA 1Q8PA 1S0CA 1DLLA 3N35A 3IN9A 3WG3A 4DPNA 2A71A 5DUUA 1CIWA 2W39A 3AFKA 1DQ0A 4YM1A 2B7YA 2R16A 2JECA 3BTAA 4FPLA 1W6NA 2GALA 2RHPA 1ENSA 1ULGA 5IK8A 1GZ9A 2A6YA 4GKYA 1LJ7A 1BKZA 4GWMA 3AZYA 3M3CA 4R9AA 5CNAA 2A75A 5T5LA 4AGVA 3UL2A 3VV1A 3OYWA 2UWAA 2D44A 1QMJA 2P3JA 4Q1RA 3ZYRA 3AK0A 2ZMKA 1WW5A 4WVWA 4ATFA 2ZGLA 1DIWA 4XHBA 5T55A 3INAA 3M3QA 2ZZJA 4K1ZA 2OVUA 5JLVA 1ZA4A 4YLZA 4XTPA 2FMDA 3AXEA 1JOJA
chains in the Genus database with same CATH superfamily
1D7PM 2AUYA 4LBNA 2DU0A 2HJIA 1SLBA 3HNYM 4GIQA 4O9GA 2ARBA 3AYDA 5IVFA 4XUPA 4P14A 1C3HA 2P1BA 4MSVA 2VCBA 2NLRA 3SH4A 2DDUA 3HEIA 1GR3A 5CFCC 1P8JA 4JKMA 2H0BA 4OI2A 4HVQA 2VOXA 1T6GC 4K8RB 4UBGA 4NO4A 1O3SA 1CAWA 1EAH2 4HKOA 1UZWA 1ASJ2 1H1MA 3U4SA 1VBB2 3WNNA 3OJBA 5FZOB 4ASKA 1IGOA 1VBC2 4M3CB 5C7GA 3WVJA 3SKVA 1W39A 3T2TA 4LHSA 1WMDA 2DVAA 1RUNA 4WM8B 5JAXA 4XAEA 4QPIA 3VHPA 4ES9A 1PMJX 2B46X 3MLJA 4Y20B 3ECQA 2VZRA 1NLSA 5FZHA 3SHRA 4BMEA 1HRV1 3P3PA 4IEZA 3FLTA 3EHKA 1QJX3 4YZ5A 2JDUA 5CVRA 1LCLA 4M3CF 1V6MA 3QOPA 4QD2A 4LNVA 3DECA 1ZREA 3T09A 5LA1A 3GXUA 1OURA 5DZEA 4BMBA 1OPOA 1XBFA 2XGXA 4UW3A 4OHZA 1BMV2 3KV5A 1VAKA 3MFAA 4D94A 2B45X 3ETPA 5FY5A 3BTYA 3O1PA 1VBE2 2XJTA 3KCXA 4GB33 1REDA 1AR83 1LEMA 3SEEA 5EZWA 2XLGA 1AR91 2BTVC 5C4WB 2QTWB 2MNGA 1NG0A 1TEIA 4OHXA 4DQAA 5J96B 1WKYA 2ZX2A 1S55A 4RQPC 1RITA 1QH6A 1UD1A 1GZCA 2QJVA 4P9GA 2IFWA 5FZOA 1GMMA 4MGZE 3EBRA 4MH0E 2AGSA 4M3CA 4OQ9A 2HWE2 4QAWA 5GLVA 1WGPA 2H6CA 3CJXA 4I3GA 4PIXA 3KV4A 1RVF2 3RDIA 3TB0A 4WM8A 4ITCA 3ZXKA 4FPOB 2Y0IA 3VL8A 3VKLA 3E5XA 4Y20A 4CTEA 3DGTA 1LB2A 5JIUA 1YO8A 3KB5A 1G6NA 1Y9QA 3HOBA 2H0VA 2XWBB 1FMD3 2YYOA 2ZBJA 3WHTA 3VDAA 3OUIA 1LESA 4KL1A 4DY5A 3VGIA 1W8HA 5FCCA 1WW7A 1UX7A 1XU1A 2W52A 1B35C 2HWF3 3H3LA 4UOJA 1F4AA 2ZHMA 4XFHA 1CAUB 3RZKA 3CEWA 1QU0A 2ES3A 4LMFA 4IEPA 4DEVA 1MS5A 1UW8A 1AZDA 4N9IA 5AFBA 3POJA 5ANQA 5AFEA 3W21A 1IKQA 4FOYA 5C4WA 1N3QA 2NQYA 2VUAA 5L36A 2YFUA 2FDKA 3PDQA 3I7DA 3WW4A 5FY4A 1ZRIA 3NV4A 1D0GA 1S2EA 1WCUA 5F6KA 1XC6A 4L97A 1YI7A 5JDBA 3PVEA 2V09A 1AYN2 2PMWB 1YQ5A 4XMIA 3WCSA 2MEV2 4AEDB 4P5HA 2Y6LA 1UWWA 3C7HA 3NNGA 3NL1A 3C7OA 5FZKA 4YVWB 2XHNA 5BXXA 5BNPC 1POV3 2F4PA 3NAPC 1GYKA 1UYPA 1RC6A 3J9SA 5EYYA 2PA7A 1DYOA 4B1LA 5FJKA 3E6BA 1CAUA 3MUY1 1CESA 4KWKA 2NYYA 3ILRA 2GMEA 1U0AA 1HRV2 3POFA 1QJY1 4GH4C 3ZLIA 2ARAA 5DQ0A 3LDKA 5FUNA 4IL7A 3OY8B 3MGUA 4IEOA 3CF6E 3OBAA 1QHDA 1PZ8A 1EUUA 1C28A 4ZXKA 3MIHA 4UI9L 5J48A 4Y22B 2C1FA 3F95A 1W9FA 3FLRA 2BJSA 2E26A 2E51A 2GN7A 4Y26A 4ZXEA 2PFWA 2VW0A 4P9XA 4DUVA 2GH2A 4QU2A 1JZ5A 1GV9A 1NT0A 3RZLA 4OUEA 4QWNA 2SBAA 2CGPA 4C0HA 5C9AB 3N9LA 4LBJA 3ZFEC 2RJKA 3APBA 1RMU2 5DAWA 2Z79A 3WW2A 1AR92 2BFUL 2E6VA 4A44A 1HRI2 5EV7A 4AEDA 3O1SA 2W1WA 1GQPA 1PO13 1JUHA 2YY1A 2GC1A 3IDBB 1GZTA 1AYM1 4NVPA 2VD7A 1W6OB 4YVWA 2GC2A 4IUGA 1HB3A 2QBXA 3P1IA 4QHZA 1UF2C 4CXYA 4M4PA 5LA2A 3MZHA 1AR63 4MOAA 4FPEA 2VOVA 3ILFA 2NMNA 1MQTC 1RXFA 1TE1B 3WD5A 3WF3A 1W28A 2OUJA 1PK6B 4HBNA 1AXZA 2X5IB 4XF1A 4Y1YA 5A3WA 3UGFA 3ZKYA 5JPMB 1HW5A 5HCBA 4B4QA 3OY8A 2YBSA 1FNYA 2XJVA 2YPJA 4CDXB 5LZ6A 5FIXA 3PJYA 1SLLA 3HJRA 3O12A 5DABA 3DEMA 2XR4A 3ORJA 1ZNPA 4Y22A 4NHXA 3ACHA 1FV3A 2XMLA 4JHZA 4W6WA 2AR6A 4Q4X1 2RJLA 1DYKA 3PUAA 4AR2A 4ZKTB 3W5MA 2W9XA 5C3OA 4FTBA 4YGCA 1WA6X 5DAPA 3LIGA 1OLME 4TWTA 4CEYC 5C9AA 5FBJA 5SV8A 3T2PA 1C1FA 3V0AB 4XE9A 2NM1A 3JB8A 1PHMA 4CDUB 2D7FA 1H1IA 2LM3A 2Q0AA 4EQVA 2O14A 1UKRA 4LBQB 4L2NA 3T0AA 1W6OA 1R1ZA 2RR11 1STMA 1WBFA 1WD4A 1ODMA 2YFZA 4BHPA 5HPOA 5JCTA 1JZ8A 4Q4Y2 4XXAA 2W46A 3WP5A 1DG6A 1PK6A 1RUE2 4WZFA 2X5IA 1SCRA 5FV3A 1RUH3 1OQ1A 4OULA 4LBLA 5HXVA 4A7YA 1LU2A 4CDXA 3JBG3 1UXXX 3HWJA 1QJU1 4YNIA 1TMF1 1XYOA 1YEWA 5FMOL 3PURA 4I3PA 1R091 4ISQA 4IV1B 4QDRA 4M0HA 1RINA 2VMFA 1UMZA 2QKDA 2RMU1 2J42A 1LOGA 1PZ9A 1C4RA 1RUJ3 1JZ2A 4NOTA 4O65A 2ERFA 3V0AA 2P6CA 2V5DA 3CO2A 2L9LA 3KV6A 3TWIA 4LA3A 2GNTA 1QNWA 2LRPA 4LBQA 3DPRB 3U1XA 1LOBA 3BB6A 4JKLA 4ES8A 1XJAA 2CDPA 3VBFC 1ZZ6A 1NCRB 4YW5A 3GHNA 4HG6B 3RNSA 4LKFA 4Q4W1 4RS5B 4YW7A 2W68A 5FZBA 1IPSA 1VBA3 2HEYF 3GHMA 2DVGA 3OCPA 5M0TA 2R7EB 2DWRA 4PQ9A 2X10A 3E6CC 3MW3A 2WWJA 4IV1A 4B1MA 1IOAA 1JUIA 1JN2P 2ZPXA 4QX3A 3VD3A 4EN9B 4EROA 3RYPA 2WIIB 4CPBA 2XDVA 1IPKA 2ZKLA 3MHZA 2OW4A 4GALA 5JWPA 1GFF2 4OCTA 2WABA 2ZTNA 1R64A 4BB3A 5CFDB 1Y9GA 1CR7A 4B3NA 3ENRA 3VKOA 4LUMA 3DPRA 2EIDA 2JE8A 4N8MA 3RG0A 3NV3A 4L8QA 1YQ6A 4BQ1A 2FHRA 3A4UA 1NCRA 5T5OA 1LOAA 3I3DA 4RS5A 1FATA 3HIFA 4PBPA 2WFF1 1CGPA 3D3AA 1BCXA 2FDIA 4IEWA 5EYXA 4K6BA 5FZAA 5JXGA 5KWRA 1HX6A 2Y8KA 3DKWA 1RUG1 1QQP2 4C0BA 4LORA 3FFQA 5C8CA 4R9DA 4PBOA 3LD8A 1OD3A 1X82A 2Y6FA 4QQLA 4R4ZA 4DXTA 2FDGA 3SH3A 3A23A 1HLCA 3ELNA 1W8FA 3BIEA 1KJRA 2XBO2 1OUSA 5I0RA 4I2OA 2KM2A 4XUQA 2UURA 4Z2AA 1K45A 2OKXA 2PHTA 3PVBB 4BJ0A 5CFDA 4Y5TA 4OUMA 3T4HB 3ZSMA 5JR2A 1DZQA 2HLEA 5FPVA 4MVTA 4NIAA 4QB6A 1Z7S3 1ALYA 2R062 2VOKA 4XFFA 4NR1A 1WCSA 2RMU2 2WQZC 1YJKA 2P17A 3JUUA 3KGZA 2ZEXA 4FOWA 4ZZ8A 5ACA1 2E7QA 5JXJA 2WYSA 3LCPA 1H8TC 2W5FA 1UOBA 1NXD1 2WS92 1LR5A 1JZ3A 2V4VA 3LA7A 3PTRB 2F17A 4QB1A 5DDJ2 3TNQA 5F9TA 3K3NA 3K4AA 2RM22 4HMZA 1MZEA 3U0ZA 1EPZA 2HWC1 2Q1ZB 2G9ZA 1SHWB 3O5SA 2WNEA 1GNZA 1Q56A 1DYPA 3MIBA 4LHNA 4CDQC 4Q4W2 1WCDJ 4XZUG 4A41A 4MUVA 5DPNA 2JJ6A 3EO6A 2JICA 1QJEA 5FZ3A 1VP6A 1RB8G 1OI6A 1ND2B 1YLLA 4C8DA 3H42B 1W8UA 4MLOA 4RL7A 1J3RA 4AVBA 1H6YA 3DUIA 5LY2A 4BQWA 5IVEA 4EWDA 3AKSA 2K0GA 2PYTA 3LAGA 2XLFA 1JHNA 3AB0A 1VBD1 4MYEA 3AMPA 1PVC2 4XQ4A 5FZ1A 3H3ZA 1C57A 2CGOA 2JWPA 4AQSA 3WP3A 5FO8B 4JQTA 1OBNA 3LE0A 2PLV1 3NW4A 2JDMA 3OGSA 4XEZA 1UZYA 3AKPA 4P9LA 3MICA 4E8CA 3ZM8A 2VECA 3CZUA 1URXA 2E33A 3ACLA 3NV1A 3IBMA 1DFQA 2WFF2 3B94A 3QLQA 1HXS2 4P9WA 5IVJA 1NA1B 2W1SA 4JRLA 1F2NA 5ANNA 2PHLA 2NMOA 1OXCA 4M01A 2X53S 4BH9A 1W6MA 2VOWA 5F3GA 4XJ9A 5FXXA 4MV2A 1ND2A 2VVDA 3KT1A 2V73A 3OPTA 1H4HA 3ZXFA 5C70A 2WUHA 2JE7A 1R1A2 3RMXA 3G6JB 5J98B 4TSVA 2BRTA 2IUWA 3UK9A 1V6KA 1OD5A 1N47A 5EJ1B 1GICA 2A70A 1LHUA 1XPWA 4CU8A 1JYVA 3ZVXA 4UW4A 1JTZX 1UZVA 1EV13 2P3YA 4MGSA 5FPZA 3ATGA 4Y1VA 5AC92 2Y34A 2IVIB 3PUQA 4HXCA 4XJZA 4XVHA 5CAZA 4BU2A 1DQ6A 2W91A 4NIHA 2D43A 2VW1A 3OYWB 2VL4A 3QBQA 1HIXA 4LHKA 4GD4A 1YWKA 4LK7A 3WQ7A 1Q8SA 2ZOEB 4GKXA 3AMQA 4S2DA 4XOGA 5C71A 3OEAA 1F35A 2HWB2 4XIOA 3POGA 1W05A 2GNDA 1NA1A 1RXGA 4G9SB 4U2AA 3ZFGB 4CCOA 1UYZA 3M3IA 4TYSA 1US2A 4XDQA 1CIYA 1N3PA 4L11A 4BXFA 2ZAAA 5IYYA 1O91A 1OA2A 1DLLA 1S0CA 1J3PA 4LIUA 4KMQA 5CU1A 4CXXA 1YFWA 4OQ8A 2A71A 5DUUA 5AVPA 2WL1A 3AFKA 1V9U3 3LEMA 1JYWA 2R16A 1RUOA 1TME1 1HV1A 4PIYA 1PO22 1GZ9A 4D8MA 2J1SA 3K2OA 1LJ7A 5C6CA 3THCA 5LW9A 5A6ZA 5CNAA 5T5LA 4ZU4A 4OHVA 1H2LA 2W95A 4AXOA 3OYWA 2YGLA 1EP0A 4N90A 4Q5OA 3IMMA 1GP6A 3AK0A 3P3NA 1IG3A 1OH3A 4CCKA 3KCCA 4XCBA 2ZGLA 4I02A 5T55A 5D8AB 4LE3A 4GMP1 3M3QA 5IFPA 5JLVA 3NRUA 5A32B 1ZA4A 3ZFGA 2FMDA 3IDEA 2PQSA 3AP5A 3D0SA 4A2UA 4CUBA 2ZKNA 4YW2A 4D6SA 5A3UA 4ZPIA 1PGL2 1VMJA 1VRBA 3KT7A 1C8M1 1MZ6A 3OBTA 4JDOA 3W9AA 4I01A 2RS13 3BGAA 1DZRA 4IE0A 3WP6A 5FLJA 1R081 3V65A 4R9BA 3WCRA 3NO8A 1L7RA 2R043 1BEV3 2RS31 3I3BA 2VNRA 1OFNA 1UX6A 5FR3A 5K0UC 1GOGA 3I2HA 3EB7A 3HD8B 3HQRA 1O4ZA 3SQOA 1NUKA 4M0NA 5F39A 5LBCA 2QCSB 3A0NA 4UWDA 3D82A 3ZXJA 1IS5A 3S0MA 4RN5A 1SFYA 1LHWA 3BI3A 3Q9OA 1DQ5A 4QM9A 5A6YA 4I30A 4FP3A 5GLUA 5KBFA 2EICA 4AEDC 3J8F3 2ZGQA 2ETEA 1T6BX 5J37A 2DBIA 2QQJA 3Q8BA 5D8AA 3J26N 3ZSLA 5A32A 4L9BA 3SC7X 1JXNA 3H7JA 4RGGA 3TOJA 4YVWC 3DKQA 3VL9A 4KGGA 1GSLA 4FP2A 3BPSA 1PGW1 3P5BA 3UV9A 1K3IA 2R073 2D40A 3ZYJB 3RFRA 3DYPA 1LGBA 2JB8A 4XFIA 4AVSA 4DINB 2I74A 2DVBA 4IV3B 1D4M2 5GZGA 4AFCA 1OUXA 3N36A 1ZBA2 5FFOC 2R1DA 5DAXA 4IDZA 5FQ0B 2V4AA 3VBUB 2KR2A 3AP9A 3ZMOA 1I9RA 1Q5OA 2GP5A 1FPN3 4CEWB 3BN6A 3A7QA 1X36A 2XL9A 4IE4A 1LOFC 3SCFA 1Y4WA 4C1WA 5FYHA 3VDBA 5IW0A 2Y26A 5HV0A 4Q8LA 1BBT3 2EXIA 1OA4A 1OPMA 1TVGA 2E9QA 2X8KA 4MZUA 4PF5A 5EJZB 3VBHC 2FQPA 2PHWA 3A22A 1OC1A 1VBB1 1KFUL 5FOBB 2MHFA 4QGMA 3MYXA 2K9ZA 2VU9A 3NNJA 2IVJA 5FJHA 1X9TA 4LULA 5FP7A 1YYNA 4FXKB 4HOOA 4JKKA 1QJX1 3FMGA 2C0ZA 2BVBA 4QPGB 3RGBA 3SNMA 3ZKUA 4JGYB 1O3QA 3DCQA 1MEC3 2JX9A 4M4RA 1PK6C 2QQMA 3NMBA 5GZEA 1FX5A 2WZPP 2X5IC 4LQRA 2RS52 3HAGA 4H14A 3KZ4C 2XQXA 3ACGA 4HL0A 2OPKA 4IV3A 1UOGA 2C26A 4QDSA 4CDXC 1DCSA 1RJ7A 1ST8A 2CWSA 2YC0A 4LUKA 3VBUA 5FQ0A 1JYNA 1AR81 4CVUA 4CEWA 4QX8A 1MS0A 1C8M2 1XNCA 3LA2A 2BVVA 2WZR2 5FZMA 4FFFA 2A5ZA 1J83A 4XDOA 4Z07A 1BVP1 4Q4V3 5LCWL 3K77A 4HPKB 4WM7B 4QX1A 1VJ2A 4HETA 2RS32 5LBEA 5JXIA 1F8VA 1RUC2 4E4ZA 3D5OA 4IEQA 3AP4A 3ZIXA 5JZGB 1QKQA 4OHYA 4CDUC 3PVNA 4P5YA 3RZHA 1XXNA 1AX0A 2VW2A 4QPWA 4QPGA 3VHRA 4AVAA 3SISA 1RVF1 1PIV3 2JE9A 2B39A 2GDFA 4JGYA 4LLOA 3DF0A 4EN0A 3JD73 3H8XA 5FYIA 4YM3A 1UPSA 1GLHA 1HQLA 3OTFA 1CN1A 1X9PA 1SDDB 4PI2A 3W20A 1RHI2 3AZXA 4LO8A 3WT3A 2J1EA 1HJGA 1H2MA 3GBGA 5C3RA 1OFSA 4UFJA 1SFNA 4LITA 2A6VA 1H4GA 1YJLA 4IV1C 3LOBA 4BXSV 3AMMA 4HPKA 3IAPA 4WM7A 3OSDA 5CADA 1CX1A 4NPMA 5FKCA 3TN93 4LOTA 1COV3 1UOFA 2BNNA 2ZA9A 3M70A 2WNUC 4ISRA 2ZAHA 3QACA 4LKEA 4TN7A 5JZGA 4F8AA 5HCFA 4NRQA 4XILA 2ZMLA 4AYUA 3DPRC 4AFBA 4CCDA 2XL7A 3AYEA 2PHRA 5B4XA 4IGOA 1G9BA 4CUAA 1ENRA 3I59B 3O0XA 1AYN1 1K5MC 3TEZA 1NCRC 2MEV1 1I3HA 1DZTA 4RS5C 4COZA 4MXVA 1VB4A 5EWSA 2BUKA 5E6HA 4FOVA 1MVQA 5FBZA 2GSYA 3C3VA 3MI8A 1RUD3 1XQNA 1V6OA 2RV9A 4Z82A 4ASMB 4AVVA 5SV5A 1QJX2 3AKRA 2NP0A 4LIVA 2OQ7A 2ZABA 5T5JA 2VAUA 3H0OA 5FXZA 5IK7A 2WBKA 3HR9A 3ON7A 5GKAC 2WRAA 4A6OA 5FZEA 3OGVA 4Q1PA 2H6BA 4NIGA 1XE0A 3U10A 2JIJA 4GB32 4B8EA 2VZ3A 4FPGA 1AR82 4J25A 4Z92B 1JBCA 2HYKA 4SBVA 4RHV3 2J22A 1XE7A 3MPBA 4JGZB 3A21A 1PO11 2VJXA 4XTMA 2Z5WA 2WWSA 4CRQA 5F5AA 3T0DA 3OEBA 1WW4A 1DGRA 2E31A 3LKJA 1EAH3 1XOYA 3PMEA 2O1QA 3POEA 4PQQA 1CWPA 3VKMA 1RMU1 3I59A 1MR5A 1GP5A 2GC3A 1JU3A 2GC0A 2YPDA 4XCAA 1HRI1 4UFIA 4AGRA 1YHFA 1VBC3 4KQ7A 4XJAA 4Q0VA 1S2BA 1KQRA 3LSEA 3SITA 4MGKE 2DFCA 5BNOB 1OVPA 2BBAA 2I07B 2VQ0A 4QU1A 2G19A 4QHBA 5FKBA 3T4VA 4JCKA 1C5HA 1FMD2 4GAZA 2EIBA 2AREA 3WQBA 5FZFA 1OHFA 4NUBA 5A7OA 4Q26A 4QX5A 3AZVA 1A8MA 2CAUA 3TRSB 1W8TA 2VCAA 1S0FA 1WLCA 4K40A 2HWF2 4R4XA 2OUHA 3MV11 2BOJA 3WOGA 3KQRA 5C3PA 1GWKA 5C5UA 3MLKA 2XH6A 4NN0A 4META 5FPUA 2ZMNA 3ZXDA 1FOD3 3ETQA 3NKTA 2QNKA 3PVOA 3BALA 2GNBA 3CKHA 4KU8A 4JGZA 4UW5A 4Y5SA 1G9CA 3BU7A 1W90A 4H2AA 4NHKA 2KD7A 2W94A 3PIGA 1AR73 1RUF3 1MS3A 2VTXJ 4AGGA 1E5SA 1ZZ7A 4WBBA 2D3SA 4LJHA 3VDCA 1RJ8A 5D1IA 4OMCA 1UY3A 2VMIA 4YARA 1Q8OA 2Q8CA 5BNOA 5FY8A 3V56A 2X09A 2JDAA 2LROA 1VAVA 5FK7A 1OOPC 1UU6A 3MF6A 4JX0A 2D97A 3E5UA 4ARXA 3KHCA 5L7OB 4Q4Y1 2WQ8A 2AACA 3HMYA 1RUE1 1KFXL 2VNVA 2HBTA 3AMNA 1JZ6A 1HKDA 1ZZBA 3VKFC 3IB3A 2ZCWA 3WZ1A 4BQ2A 2WN2A 5EFUA 5IVVA 3BUCA 2QVSB 3THDA 2DYCA 5EP9A 3GGLA 1RUI3 3X29B 1J84A 3AJYA 5JOXA 5FO9B 1JYCA 2LS6A 1ND2C 3PMSA 2O8OA 1DP0A 1MVEA 1QXJA 4Q8KA 5DXDA 3IAQA 3OGRA 2QDNA 4J1XA 5A1AA 2VY0A 4AE2A 2JG9B 5CZKA 5HCAA 5F7UA 1OKOA 3Q8AA 4S2GA 5E89A 5FWEA 5LBFA 1UU4A 4KNCA 4N9HA 2C4XA 3KD4A 5A7PA 1ACCA 3ES4A 5I0UA 2XKOA 1V6IA 3CL1A 1WLDA 1NX9A 3N7KA 3BTXA 1BXHA 2UWCA 1QGLA 2QZ3A 1PO12 5L73A 4PLOA 3ZFFC 4CCMA 1VBA1 1LEDA 1W0NA 5FZ7A 4E4HA 5L9BA 5L7OA 4QQOA 1AR62 4NAOA 4QQPA 1CVNA 3BOPA 1UO9A 3J7MA 4GWJA 5LK5A 3WW1A 3N4MA 4M3CE 1GWMA 1Q43A 1NA1C 1YC61 2A73B 5B2GB 2ZGPA 1HRV3 4RR3C 1WMFA 1KITA 4FQ4A 4MO3M 1WBLA 3VZNA 1IS3A 1CZSA 5CB7A 2W0XA 3OBRA 1GNHA 2JG9A 2P2KA 4XF4A 5C5TA 1N1SA 2DURA 2G9FA 1GNYA 2OT7A 4QX2A 1GKBA 2TBVA 3H8RA 5F3IA 3JB4C 4PDWB 3GJBA 4JTOA 1ZYBA 5FZ0A 4DEQA 3B69A 2IWGB 5T52A 1V6LA 2BFUS 2EF6A 3F2ZA 5B4NA 2W1QA 5KC6A 3TEWA 3RPQA 1AR93 1V6JA 2J1RA 2QUOA 2XKPA 1IHMA 3KSCA 3OPWA 1LGCA 1SACA 5FLHA 3RYRA 3VBOC 4ET7A 2DUOA 4F83A 5E1RA 2GZWA 4R9CA 1Y9MA 1NKGA 3RRDA 3MW4A 1D4VB 2JENA 1NLQA 2Q1MA 3VD4A 2C9AA 4Y5Z0 4A7KA 2ARCA 5CKMA 3VZOA 1V6NA 2A3XA 3QCWA 3VHOA 1YCIA 4JDNA 2XPJA 1ZBE3 3M3EA 3LGRA 3ZFGC 1V0AA 4NJ4A 1Q8QA 3UKVA 1QQP1 1RUH2 3VDDC 4RFT0 1ULFA 3PUHA 1JW6A 3LEGA 3MEPA 3LZZA 4MGTA 5GLTA 1XNAA 5FYVA 4BZ4A 2W1UA 3WQ1A 4MXWB 5FY7A 4PIZA 2VZTA 4WV8A 3NVCA 1ZZ9A 2VMEA 3VN4A 2XBO1 4AI1A 5LY1A 3PUSA 2WSVA 1W06A 2XJQA 3OGGA 4EE2A 5FP8A 1HB1A 1RUJ2 2SLIA 4PDWA 5GZDA 1N1VA 2PHUA 4XQWA 5KXDA 2JG8C 4H7LA 2EXKA 2R061 1H0BA 3J7LA 3E6DA 3ZDVA 1JZ7A 2JDKA 2ZGTA 1QOSA 4YG3A 1W2TA 5EHDA 1I1EA 1ULCA 4HN1A 5IAXA 4Y24A 4DXSA 4N53B 1KS5A 1NQJA 1SQ4A 4H55A 5H9PA 3V0BB 3R05A 3FUQA 1UNBA 2P37A 3GZAA 3H3UA 3KMHA 2WS91 3WUDA 2YU2A 3S5QA 3IT8A 1Y7BA 5BYNA 5DDJ1 4YRDA 5BY5A 2RM21 1EYBA 3ZSKA 4N43B 4PT6A 1VBA2 4YFZA 4DRRA 3CU7A 4DB5A 4IE6A 2ZACA 1T2XA 2XXZA 1A78A 3DL3A 5F6LB 2BPA2 2J7MA 3SXWA 3C7GA 3LWCA 5A1FA 1JYIA 4O7XA 4MXWA 5FMOS 4B4PA 3A0KA 2TEPA 3IZOA 1OLRA 2MPFA 1F9KA 1MACA 1KDMA 3R4UA 3AP7A 2BV4A 1UN1A 3D6EA 1QOTA 3ZX7A 3WP4A 4LO5B 1WD3A 5K7PA 1QJY3 3IIIA 3BIWE 5C8CB 1H1AA 3VUOA 3L2YA 4XJWA 2N7GA 4CP2A 2JDHA 3I49A 5FAXA 3RWKX 5DAQA 3M2MA 4Y33A 5IK5A 4KBBA 5CFCB 5GJ6A 3AVSA 1VB2A 1GU3A 1BVVA 4N53A 3ZMNA 2B9UA 4LTAA 5F32A 3V0BA 2QQPA 1PVC1 1ZZCA 1RIRA 4XBNA 2QQUA 1A8DA 4LT5A 1LHVA 2WA3A 4IGPA 4FSJA 4N43A 3ZYIB 2DCTA 4XETA 1WMXA 3O0VA 4X8NA 3ZYFA 4RGKA 4WZCA 5JOZA 1JODA 2VZQA 3NJXA 1AYM3 1F15A 1Q8PA 3LB9A 4RFRB 5CG9A 1HXS1 1W99A 4IXLA 5FYTA 1DQ0A 1OH4A 2F4LA 4IV3C 1W8NA 4NPRA 4X6RB 1AL23 4BA6A 5LWBA 2OYZA 5IK8A 3MFCA 2A6YA 3PU8A 2HYXA 1R1A1 1EV11 3C7EA 3IDAA 4QT6A 2RDRA 4XW3A 5CFCA 4PJYA 5C8WA 2DF7A 1TNRA 1Z7S2 2HKXA 1SMVA 4Q4X3 4Q1RA 5LATA 3ITQA 2BWAA 4LA2A 4ASLA 4CP9B 3HQXA 4D3WA 5AC91 4H3WA 3SEPA 5FPLA 3B5LB 4Q0SA 4BQ5A 3GBFA 2VVEA 2K46A 2XVKA 3INAA 5IATA 2EAAA 5HBAA 4YLZA 5GZFA 4IEYA 2XHKA 1LU1A 1QNYA 2WZ8A 2ADDA 4QPGC 2BWCA 1BZWA 2AENA 4JQRA 4JGYC 5FZ4A 2WAOA 1ULDA 1X50A 2B4KA 4AQ6A 2RR13 1WWYA 1BQPA 4HONA 1AX1A 2HWB1 3WNXA 3VB9A 2IZWA 1SLCA 5FK8A 5A33B 4BM8A 4BK5A 3BVCA 1NYWA 3AM2A 2F6BA 4BISA 3OGJA 4W6XA 5CEHA 5HV4A 2FD8A 5I91A 1OA3A 2QQIA 1DDLA 2Y6GA 3BU0A 3O1RA 1NZIA 4A42A 2LALA 5F3CA 4XUNA 3M1HA 1JOBA 1QJU3 1QJFA 4QXHA 1TMF3 2VR4A 3UGHA 1QF3A 3D4KA 4WM7C 4CP9A 1R093 1CONA 4AZZA 1PO21 3H9AA 3K4ZA 1W6MB 1XNTA 4HSJA 2VMCA 4DIQA 5JZGC 4A4AA 2A6ZA 1S1AA 5A7QA 5H9RA 3EYPA 5FY0A 2VE1A 2AYHA 4PI0A 1HDKA 1O8PA 2Y33A 2JKXA 4NROA 1IS4A 4Z8BA 2W92A 4FQZA 1WMEA 4P02B 1LODA 3OOXA 5FREA 4MX3A 4FO9A 1IQDC 1K12A 3WNPA 5BNPB 1DHKB 2WA4A 4QQ2A 5A33A 1GBGA 1OVSA 2VNOA 4XUTA 5A80A 1W2AX 1PGL1 1QXRA 1Y3TA 2VZ1A 2ZGNA 4J6GA 2FZ1A 3N7JA 4K1YA 4QPIC 4Y3OA 1O4TA 2LUWA 2Q8DA 3WF1A 4P9YA 3NJZA 5ABJB 3W58A 3ACIA 2O0OA 2OZJA 4IESA 2UWBA 4YFWA 5K8SA 2JXAA 3B00A 1LECA 3B9CA 4UFMA 5FO7B 1EPWA 1H30A 2VUJA 1VALA 3DXTA 4W65A 3HPNA 4EV0A 2P3KA 4URAA 5FY1A 1YNAA 3RS6A 2BOIA 1EV12 1LENA 2Y64A 3ZFEB 1UYXA 3T2OA 1QEXA 2QQVA 5LK7B 1D0HA 4DRVA 1QY4A 4ATEA 5L9VA 4A45A 1JYTA 2Z42A 5IVCA 2NN8A 3GCXA 4Z1VA 1QWRA 1W2UA 5IVBA 3RJRA 2EIEA 2FDJA 3N3HA 4BCUA 3O1MA 3S57A 1LNSA 5BNPA 3I2JA 1MZFA 3JU9A 4HANA 1S0BA 2A3WA 1U5ZA 4WM8C 5BNQA 1U5YA 3TEXA 1J58A 2YZ4A 1O4YA 1ULOA 2IXKA 4NPLA 3WDXA 5LEKA 5ABJA 1RUG3 2A3YA 1FYUA 1VR3A 2GNMA 3PIJA 2KA3A 2WN3A 1D4M1 1K5JA 1ZBA1 2J1VA 3CJIB 3CLPA 3KLSA 5J7MA 5BNNB 4AK3A 1V9U2 4EN6B 4RSUA 4P9JA 4XFAA 2CV6A 5T3NA 2YC2A 2WT1A 5E16A 1MS8A 2WSUA 4FOQA 3UJOA 3U78A 4TTGA 3ZFEA 1HN1A 2G9GA 1W0OA 3DN7A 2XQRA 4N7IA 1W9TA 4AHZA 1NOVA 4A3ZA 2BNMA 3I54A 3CBNA 2C6SA 5C4WC 1AJKA 2DVDA 4AF9A 3PLQA 2CYFA 5ACA3 5IFTA 2IFRA 1H9PA 4I0BA 2DBNA 3ILNA 4BIOA 5BNOC 2ZGRA 5C3SA 4XMAA 1XU2A 1UKGA 2P34A 2BQPA 1VRH3 2EIGA 4QPYA 3ZO0B 2WLPA 3PNAA 2R49A 3AX4A 4NWVA 4YW3A 5FMCA 4E2GA 2VXRA 1CJPA 1OLQA 2PHFA 4ARYA 2HWC3 2WYFA 2RS51 5G04L 5A70A 2OZ6A 4XUOA 2VPVA 1I5ZA 4HT1T 2X05A 3BODA 5LA0A 3LDBA 4MG2A 3CJIA 3IPVB 1ULEA 2OS2A 2QQKA 3LF7A 4Q4V1 3RZZA 3SH5A 5BNNA 5DMYA 3VZMA 2R042 3RI9A 3NWKA 1BEV2 2WZR1 5JSRA 2ILMA 1VE0A 1GQGA 1PX4A 2GMPA 2W3JA 3VLBB 2QQWA 1E5IA 4RA0A 1O7FA 3OUHA 3ZYGA 3AZZA 2BERA 3OF1A 1TZOA 5KXCA 1YFXA 2YBPA 1RUC1 5A3NA 2V72A 3KWVA 1AF9A 2E7AA 4UFKA 1W9YA 1LKNA 1UZ0A 4I09A 1DF0A 1BJQA 1WLTA 3JD71 3PUIA 1NE4A 3J8F2 4U36A 4CP1A 5FDBA 4LE4A 1VBD3 3CQOA 2HWD1 4QXCA 1S0JA 2V5YA 5L7OC 5EQUA 1K42A 1O6UA 4UYBA 4GQ7A 3RZGA 1QOOA 4X6QB 5JVVA 1F4HA 3OPZA 4LHLA 2PLV3 3R6SA 1FXZA 1VPHA 5FYCA 3U75A 3ABZA 2LW8A 4AWDA 4A7ZA 1JYXA 1G9DA 2R072 4RYDA 3USUB 3MLLA 1RHI1 4CYDA 3IPVA 4DZGA 4XZPA 3D0JA 2VZPA 2C24A 5I8YA 4CUGA 3I2FA 1KJLA 2BZDA 4D7TA 3DYMA 5I0DA 4Y1XA 5JUVA 3KM5A 1RYYA 1X7NA 4YGBA 1F31A 2P6HA 1COV1 2VUDA 1FPN2 4B7EA 3GM8A 4IE7A 2R0HA 2R32A 1JI6A 2RDQA 3CNAA 4OI4A 1NCQB 5LRRA 4LOSA 1E5RA 3O14A 5FYMA 1BK0A 1KD7A 1W8WA 4CXWA 4C91A 1DQ1A 3K51A 3KS7A 3LQCA 4FPCA 1UL9A 1BBT2 4GJZA 5T5PA 3SCHA 3BYWA 1S0GA 3VBRB 2OQ6A 4CE8A 4YSFA 1PM7A 2Q8EA 1H9WA 4OLLA 4YG0A 1VMFA 1O5LA 3DXUA 5F3EA 3HNBM 5C9AC 3GNEA 3ZR6A 2B5HA 2VCCA 3WDWA 1AXKA 1SCSA 5KR7A 4CZSA 3B01A 3H1YA 3GYDA 4Q29A 3HVDA 3MF9A 2CU5A 2EALA 1MEC2 3E1F1 3MW2A 3USUA 4E9KA 4ZU5A 2VBBA 4ZU7A 2FDFA 2VO5A 1E57A 1S0EA 1LTEA 1NY72 1MPXA 3FLPA 4GZ9A 2D5HA 2WINB 1SBEA 3CZJA 4YZ3A 4BQYA 2ZX3A 2IXLA 3ZPOA 1J1LA 1S0DA 2YBKA 4XF0A 5IJRA 3UKTA 5IT6A 4TLGA 4JVAA 1MS9A 1NCQA 3K75B 1OSGA 1QIQA 4GB31 4Q4V2 4KWLA 1SFPA 4PDWC 4H7MA 1YI9A 3ACFA 1CPMA 3VBRA 1TME3 4QXKA 2K2SA 5ISLA 5I8TA 2R1BA 5LRSA 3OD0A 4YVSB 2UY9A 4UAPA 1REEA 2Y6HA 2ZGOA 1JOPA 1CAXB 5FZLA 2Q5TA 5FP4A 1YIFA 1S2KA 3S6PA 1PIV2 4IETA 4AAPA 4CCNA 2WKKA 2DCYA 2VUCA 3JD72 4XBQA 1FMD1 2WC2A 3AZWA 4XQDA 2VZUA 2UU8A 2HWD2 2FMYA 4FFIA 5FYZA 4XFGA 1VMHA 2GMMA 5A6QA 4GMP3 3HN1A 1G9AA 1FOD1 1HQNA 5HCHA 1FNZA 1BHGA 2HWF1 4W4ZA 1CJDA 4NHLA 1GANA 2VQTA 5FZ6A 1UZZA 5F1RA 2CSGA 5JI7A 3T08A 1R083 5T54A 1IKPA 1N1TA 4FPKA 4GULA 2XVLA 1SG3A 3ZDSA 3TN92 4CCJA 2XVGA 1COV2 5I93A 2Y0OA 4YVSA 4AHYA 4BWOA 2D6KA 4XC9A 4KG0A 2Y6JA 4N53C 1CAXA 4W50A 4CU7A 5A3LA 1U5XA 5A3PA 2DTYA 3M4FA 4ORFA 3WG1A 3PHMA 3T3YA 3K4DA 3UT0A 5FP9A 1HQWA 4N43C 3CDZB 4LBOA 5D21A 3H7YA 3H8OA 1BYHA 5JPNB 1RUD2 2CNAA 4URTA 1ONAA 1POV1 2VMGA 2JDZA 3K46A 1AL0G 1M06G 5FWJA 3POYA 4KWUA 4AW7A 3WHUA 1VAMA 4L99A 2NZ9A 3U14A 2ZX0A 2OIIA 4LR4A 4KI5M 4CDWB 2XJPA 5C8CC 3KT4A 3URFA 3I3EA 2FCVA 4AEMA 3MIDA 4UF0B 4BYYA 1H2NA 2DU1A 3IKWA 3H1MA 4RHV2 4JTNA 4WVVA 5JOYA 4IQPA 3WQ0A 3UGGA 3FUOA 3BKZA 2D5FA 4LXLA 3WW3A 2YG0A 5CFDC 3VD9A 4C1XA 5EIYB 3GZUC 3LPFA 3AL6A 3RQ0A 2WZEA 4KH9A 1FI2A 1UCXA 2XG3A 1ASJ3 2IC1A 2YROA 1VBB3 3HT2A 3LIHA 3NNMA 4AI8A 4E2QA 3I3QA 1MS4A 3R4SA 4Q0PA 5F2SA 3O1OA 1KRIA 2CTVA 3WLUA 3M8LA 1AR61 2OPWA 4AFDA 1W2OA 4V2WA 4E27A 3GBWA 3WDUA 3RZJA 2YB7A 3MV01 4HLTA 3WNKA 4AEJA 2WT2A 3ZYBA 4COVA 4YM0A 4BQXA 4KG8A 1LOEA 5KC5A 4CDWA 1NQDA 4DNYA 3USSA 1JHJA 1FOD2 2J1TA 2ZX1A 4OYUA 3I2OA 2BBVA 4UF0A 1POV0 3HBZA 2WR9A 1HB4A 2BNOA 2QDRA 3P6BA 5LEJA 1SBFA 5BUVA 2D98A 4IEXA 2ATFA 1JU4A 1PVXA 1Q3EA 3LEIA 2WAAA 1HB2A 2LTNA 1O5UA 2VZSA 1AR72 1RUF2 3TAYA 1VBE3 2VZVA 4FPYA 4DXZA 4NRPA 1VLNA 2QFEA 1KDKA 4XIKA 2EXJA 1XNKA 5KHHA 3ZXAC 4CUCA 2DCZA 2Q30A 1ULPA 2Z4FA 3MIGA 4QMAA 1ZBE1 4A3XA 2VZOA 4AAXA 2D6LX 2HWE3 4FPFA 2FCTA 1L3JA 3TBDA 1RVF3 3MDPA 3NJVA 4QKNA 1OQDA 3ME2A 4QKDA 4X8PA 1U5IA 5KHJA 2JD4A 5A3OA 1RUH1 4HN0A 1W3XA 3C2UA 5GLZA 5FY9A 4I0AA 3JBG1 1RUI2 3J7HA 5A7WB 4LLFA 5JI9A 1WCKA 1CX4A 2D3RA 4V2VA 4P9IA 1OLMA 1PMIA 2BU9A 4INDA 2O8QA 3O1UA 4AG4A 5FPAA 1RUJ1 5K0UB 4ZS2A 1AHSA 3OBZA 1N1YA 1A6CA 2BDRA 2WWUA 4YWAA 5IAVA 5IWFA 5FLIA 5A7NA 3LFIA 3AFGA 3B9IA 1SZBA 1ENXA 3AMHA 3OG2A 3S7EA 5JSOA 4XHXA 2IXIA 4COUA 1RGSA 4EWEA 2DCKA 5K4LA 5CKNA 2G1MA 2FBEA 3N35A 2ZEYA 3IN9A 4LPLA 5CYYA 3WG3A 5A1LA 1BK1A 1AYN3 4O9EA 4FBFA 2MEV3 3BTAA 5FXVA 2AZ5A 4D7SA 5J1XA 3BCWA 4NAMA 4LKSA 4QB2A 1ULGA 3R4DB 1HJFA 3KF5A 3MBWA 3ZN4A 3AZYA 4AEKA 5A7WA 5JMOA 2A75A 4S2HA 4AI3A 5ABJC 3UL2A 2TNFA 3J4UH 3DYOA 4IEVA 5FOJB 2UWAA 1QMJA 2P3JA 5BPXA 3UETA 4UFLA 5K0UA 1EY2A 2ZMKA 1WW5A 4QX0A 4AVCA 3C8XA 1SDWA 1UY4A 3WF0A 4ATFA 5JXHA 1L7LA 1DIWA 1OF4A 1ZVFA 3L9JT 3MO4A 4B29A 2PXJA 2ZZJA 1SEFA 2OVUA 3IDCB 4XTPA 1ZRDA 3AXEA 1U12A 4TLFA 4LBMA 4BE3A 1ZZ8A 4AQ2A 2YHJA 5H9QA 1X33A 5DZGA 3VBHB 4QDQA 1KS4A 1XNDA 5HI0A 1CD3G 1QDCA 1RMU3 2ZHKA 2YC4A 3BTZA 1HRI3 2P4EA 4AFAA 3N9MA 1TQ5A 3K48A 2WT0A 1ZBE2 4MHUA 4D69A 1KXGA 4HZFA 5E8AA 1PNGA 5C33A 1AL21 4XJUA 2R30A 5K9YA 3Q8EA 4XDPA 2E53A 4MADA 5IUQA 2G4IA 4K3UA 5FZ9A 4HKLA 2YV8A 3CJIC 2DTWA 4YZ2A 2XWJB 2XOMA 5KHIA 4XYXA 5BNNC 5HXMA 2BGPA 1ZRFA 1DBNA 1YIPA 2EXHA 3WNLA 1UXZA 4QQHA 3WNMA 1J3QA 1LOFA 3JBG2 4EJRA 5CISA 1G9FA 1RTVA 2ZGSA 3ZYPA 4EWAA 3KVBA 2CHHA 1ZX5A 3GJAA 3ZXEA 3B7MA 3B93A 1Z7S1 2D6PA 3VBHA 2ZGMA 3WDVA 2PQQA 3U11A 1WA4A 1OF3A 4XF9A 2PELA 3VZKA 2RDSA 2A6XA 4D6QA 3HBKA 1XSRA 2BGOA 3ROUA 1XYNA 3AYCA 1ZRRA 2P3IA 5DUXA 3ZSEA 4NIDA 1OMIA 4ZZ5A 4J1WA 3FC0A 4FI9A 4YYOA 1I5PA 3ASIA 2WNVB 4K21A 4UBHA 2VXJA 3FFZA 2DV9A 4GWIA 1PGSA 4HK9A 4EN7B 3EMRA 3ZSJA 4NE9A 4CCEA 1JH5A 1FV2A 3IWZA 2ORXA 3KCYA 5D8AC 4AL9A 5C3QA 5JOWA 4Q4Y3 2E63A 4OZOA 3WUCA 1RUE3 3VBSB 1GOHA 3N9QA 4XACA 2ZS6B 1ND3B 4O61A 1B09A 3RYKA 2WO7A 3POBA 1JS9A 3W59A 3WR0A 1XE8A 1HN0A 2HEWF 1C5IA 4KWJA 1DGRN 4B7KA 3WEZA 1QJY2 4YM2A 3I2IA 1O3TA 5FZDA 2WFPA 1GUIA 1O3RA 2VGDA 5H9SA 3AKTA 2HEVF 2XUEA 2WNUB 4MHRA 2HBUA 5KHGA 4S2FA 4E4DX 1G7YA 1S4CA 3O0WA 4CDUA 5A6XA 3GALA 3WV6A 2XUMA 3N9NA 4AOCA 4AQTA 5DG2A 3CHXA 2CGNA 2WO2A 2ARXA 2ZHNA 4SLIA 4DFSA 1TG7A 1WZXA 3TNPB 1AUYA 3LA3A 3THPA 3I3MA 1K5MB 5KXBA 2WNVA 4NWWA 3VKNA 3FHQA 2VG9A 2Q4SA 5I8SA 3GF6A 2D6MA 1L7QA 2YU1A 2ID4A 2QE3A 3FBMA 4QX7A 5KXEA 2ZX4A 2E7TA 3CIHA 1W6PB 1AYM2 1IZ3A 3IMNA 5FTTC 2VTFA 3T2QA 1XRUA 2VOTA 2TUNA 5G05L 2XB6C 3VBSA 1W03A 5F5QA 2AEYA 3N7LA 1F5JA 1SLTA 4AI0A 4YZ4A 3ZXLA 4D7YA 1ND3A 2CY6A 2I2SA 2VMDA 4IGQA 2WLQA 4IE5A 4DS0A 1AL22 1APNA 2ZEWA 1PZ7A 5CBLA 3HNMA 5E88A 4GWNA 4E2SA 3OD4A 2UY8A 3PJQA 4UT5A 4CCCA 3KV9A 2VVFA 3BOWA 5CIRA 3D8CA 4CU9A 2B8MA 1NCQC 5L9RA 5JMCA 2WNOA 4G3YC 1LHNA 2WNUA 3VBUC 3SCGA 2PHXA 2YMZA 4Q4X2 2D6OX 4CEWC 2EA7A 2VMHA 3VBRC 5JIAA 1DGWA 5FZCA 4IERA 4B4RA 2PAEA 1GQHA 4NIIA 2Z2SB 1K5MA 1IPJA 1YFYA 4V1PA 5EXOA 3NV2A 4HVRA 5GALA 3WDYA 4FTEA 5J36A 1LOCA 3KGLA 4RQPB 1YXWA 4QGLA 5I0TA 1LHOA 1W3VA 4BPZA 4HKWA 1LAJA 5EJ3A 1W6PA 1A3KA 3EXUA 2PN5A 3Q8CA 2W08A 3M7AA 2RR12 3UJQA 4UW6A 3WSOA 4BIFA 4E8DA 2WO1A 1J59A 2WJSA 3MUZ1 4L0PA 1W0PA 3JQXA 4GXLA 3RMYA 5JR7B 1UMIA 3KHBA 5LA9A 3T1MA 3ZPYA 1YFUA 3PU3A 2IXHA 1QQP3 1C1LA 2GAUA 4W6YA 5TSWA 5CG8A 2D3PA 2DUQA 2JDYA 1CZVA 4I0WB 2AC1A 4MGQA 4P00B 4WVMB 5A3MA 1YUDA 4Y4RA 4F7ZA 2QQLA 4W8JA 1B35B 1QJU2 1ENQA 4BQ3A 1V9U1 3NSTA 4JC1A 1TMF2 1UMHA 2VBPA 3NNLA 4C90A 4MGYE 4FAHA 1NLRA 2XBO3 1R092 1YQ8A 5FYBA 3TEYA 4XXPA 2ZHLA 3FE5A 3VD7A 4ONUA 3JXSA 4TZDA 4DY3A 2B42B 1PNFA 2A7AA 3FBYA 4YVSC 3S7IA 5FMDA 3JQWA 3FHAA 4JV4A 4YW1A 1ODNA 3UKNA 2QQNA 3H8UA 3GZEA 2R063 5LBBA 3RI8A 2RMU3 1VRH1 4RQPA 3AL5A 3TYJA 2CL2A 1SBDA 4Z2WA 3RVHA 1UIJA 2Y38A 3UNPA 1OOPB 1GZWB 1UOJA 3NNFA 3B3QE 3WXPA 2WS93 4WVZA 1NE6A 4EYUA 2XONA 4M00A 5LASA 5DDJ3 1LRHA 2RM23 4AI2A 1UU5A 3OB8A 5DAVA 4GJYA 2YUEA 5FPBA 2JDNA 1WLWA 2J1UA 4XABA 4PHZA 2RS11 4KGQA 4WVMA 4AHWA 5EPAA 1WW6A 4BDVB 3NAPB 4BOWA 4Q4W3 2BYVE 1B35A 2BP6A 4OI1A 3T1LA 1NAEA 2IXCA 3OUJA 5FYYA 3KVAA 4EN8B 5J09A 2BGCA 2R041 1BEV1 1M4WA 3I2KA 4KU7A 1I6XA 2JD9A 1D2SA 4GH4B 4LK6A 2KXLA 3EJKA 3UYJA 5KHKA 1JMUB 2XLAA 3FN9A 3LEKA 1WCQA 3AYAA 4ZS3A 4RGAA 1NZCA 1V70A 4YPJA 1DU3D 3O7OA 4DO0A 2WO3A 4AI9A 4DMIA 4OVEA 1CQ9A 2GN3A 2ZEZA 3ZFFB 1OOPA 3J8F1 1GZWA 4HVOA 1QJZA 5IHRA 3M3OA 1PVC3 2J1AA 4Q0UA 5ERLA 1H8VA 4XPVA 2ZJCA 4CA9A 3RJ2X 4ZONA 3K3OA 1IQAA 5FZIA 4P08A 1C8NA 3S30A 3ZIWA 2R071 4QKFA 2CAVA 2X29A 5FZ8A 3NAPA 1Q8VA 4RR3B 1X8EA 2D93A 1RUG2 4BQ4A 3HQUA 2NPIA 1YQCA 1MQTB 2WFF3 1HXS3 1O8SA 4CDWC 5J3UA 3BPZA 1X8MA 3GCWA 3AXDA 3V64A 4GH4A 4ZHNA 4PF1A 1REFA 3I2GA 2FZ2A 1FPN1 2CDOA 4UXAA 2WDBA 4AFMA 4CU6A 5DUWA 1QH7A 1Y43B 3O1TA 5FYUA 1IS6A 1AVBA 1O59A 2RVAA 3I2DA 4NRMA 1R1A3 4FPHA 3FHIB 5DG1A 4HSLA 1UPIA 2VH9A 2VNGA 2Y60A 4Y1ZA 2ET7A 2DFBA 3U37A 1BBT1 4PLNA 1XB9A 2OXBA 5F8PA 3VBOB 1QDOA 4JGZC 3ZFFA 4K9SA 2VC9A 4FVVA 2JKBA 4OMDA 2ZZQA 3WY6A 4CEYB 5ACA2 2RJ2A 5AC93 5JSPA 1OT5A 2FDHA 3LSDA 5FMBA 4AVTA 1DQ4A 3JZVA 2ADEA 3ALQA 2R6QA 4NHYA 1W04A 1VRH2 4JRAA 5F5CA 3WNOA 1CAVB 2RDNA 3FL7A 1MEC1 4BK4A 4EZHA 2HWC2 4RR3A 2VBDA 2JB4A 4YGDA 3VDDB 4EZ4A 1NY71 1MQTA 1ZA7A 2HWB3 1VIWB 4Q2FA 3N7MA 2EVXA 1UY0A 4FPJA 3VD5A 1SPPB 3U07A 4GA9A 1DGWX 5I0SA 3EQEA 2PAMA 3GDBA 3Q8FA 4LKDA 2VCMA 3T0BA 2RS12 2UYBA 4COYA 1EUTA 1BLZA 1UIKA 2DUPA 4YW4A 2AEZA 2HH9A 1PMHX 2YXSA 4FFGA 3GZTB 1AXYA 1CZTA 2ET1A 4XURA 2JG8B 2EAKA 1W9WA 4JAAA 1PM4A 3NKGA 4N7UA 4NHMA 4QHOA 1POQA 2ZXQA 2BEOA 1S0IA 4FFHA 4LEJA 3VBOA 1H2KA 1PO23 3JCIA 3AJZA 3S5AA 4CEYA 3ZN5A 4L92A 3DV8A 3J7NA 2ORZA 1W9SA 3ZYHA 4COWA 1A34A 1SLAA 3NJYA 4HK8A 1VBD2 2JIGA 1N3OA 4KBZA 3WG2A 1UAIA 2E32A 1PIV1 2VULA 5FXWA 3U4XA 4XJ8A 4ZY9A 4XF3A 2RG4A 1CAVA 5BV6A 1W6QB 1UYYA 1WUVA 3UESA 1D2QA 4XFCA 1V00A 5IK4A 2PLV2 4XAAA 3VDDA 3VBFB 4OHWA 1GOFA 1UQXA 2VQAA 4DUWA 3KF3A 1E5HA 1UY2A 4YW6A 1SPPA 5FRAA 5IVYA 4RD7A 4K20A 3WINE 1F5FA 1KGYA 5CKQA 5A3TA 2Z69A 3SMHA 1DQ2A 2XJUA 4LO4B 4OFGA 1W8ZA 3O1VA 2YDEA 2JG8A 2RE9A 2OX0A 5F2WA 3PTYA 3FX3A 3TN91 4YGEA 1H6XA 2JG9C 3FWEA 4JHTA 4LO6B 1PX3A 4E4SA 4LBQD 2PAKA 1FAYA 3N9PA 1ZM1A 4K8FA 1LGNA 4K7JA 1KEXA 1RL3A 3POWA 3VZJA 3HT1A 2ZGKA 1YQ2A 1HV0A 1W6QA 3IIAA 2Y6KA 4QXBA 3FJSA 3ZR5A 2A6WA 2YGMA 1US3A 3VBFA 5T50A 1Z78A 4OUSA 1RUD1 5APAA 2FCUA 3B02A 4PCRA 2W2IA 2IXJA 3THTA 4IW3A 3R0RA 4G4FA 1SLIA 5FP3A 1W2NA 5FYSA 3QD6A 4R8HA 1J1TA 1UY1A 4BLJA 3AVRA 1AX2A 4GMP0 4CCLA 1G8WA 1G86A 2A1XA 4CPBD 3E97A 3IM0A 1AJOA 2CWMA 3C7FA 3VZLA 4DUXA 3I8TA 3WF4A 5FZGA 3LOIA 4FXGB 1Z0HA 3H50A 1D4M3 2B9VA 3T30A 1ZBA3 2XJRA 2W87A 5FPXA 2R0FA 4JDMA 4RHV1 5AVAA 4CSWA 3AP6A 4FTSA 2WQ4A 1MS1A 1TME2 5FUPA 3ZXGA 4D0QA 1ZRCA 3ST7A 5F5IA 3SLIA 1W8OA 1EAH1 3LFMA 4Y1UA 1ASJ1 2GU9A 3VHNA 5CA6A 1YRZA 3CMGA 3PL0A 2Q8OA 2C9KA 4PLMA 4FAGA 1VBC1 4NMIA 4JZRA 4YG6A 4CP0A 1DLCA 1CPNA 3ZN6B 1LULA 5GLWA 4HFSA 1W6NB 4Q27A 4XFBA 1H8TB 1OKQA 2PHDA 3G7DA 3WF2A 4UFHA 2OA2A 1IG0A 1TNFA 4LBKA 5D2AA 3WG4A 5GM0A 2VTXA 3LPGA 4Q0QA 5DUVA 3N9OA 3FZ3A 3SKJE 5L19A 5GZCA 3MPPG 3I4IA 2ENRA 4BLIA 1OQEA 4AHXA 4F3JA 1BMV1 2RS53 4CDQB 3AKQA 3H1WA 1MZ5A 2C5DA 3POIA 3LDRA 3MIEA 5FUIA 5DZFA 2DCJA 1VBE1 1DGLA 4XBLA 4OI0A 1R082 3E5QA 5DN2A 5F37A 4TXWA 3RSJA 2VM9A 3POSA 2QZ2A 4YZ1A 1C8M3 4DXRA 4FCAA 2WZR3 2BW8A 2D6NA 2JDPA 3QH6A 2VQUA 3ES1A 3WDTA 1AR71 1RUF1 2AH2A 4OZXA 2GH8A 2ZGUA 2DVFA 2XJSA 3RWNA 2JEMA 4DPNA 1XSQA 2GP3A 1GWLA 4IEUA 2W47A 4MGIE 4QM8A 2RS33 1CIWA 2W39A 3HN3A 1RUC3 1XYPA 2HWE1 4YM1A 3NQHA 2B7YA 3WX5A 2JECA 3ZN6A 4FPLA 1W6NA 2GALA 2QQOA 1H8TA 2PTMA 2RHPA 1ENSA 4DOUA 2WNVC 1JZ4A 4LO7A 4GKYA 1NXMA 3I97A 1CAWB 5A7SA 1BKZA 1GP4A 4FT8A 3M3CA 4GWMA 4R9AA 5LB6A 3W5NA 2HWD3 3L2HA 2P5BA 4Y4YA 4AGVA 3KQ4B 4QGNA 3VV1A 3RZMA 2D44A 3QH7A 3VBSC 3ZYRA 4QPIB 1QXPA 1PGW2 3MIFA 4WVWA 4CDQA 1ND3C 1RUI1 4A6SA 2Q1FA 3AC0A 4XHBA 4D6RA 1RHI3 2UYAA 1FT9A 3ZOIA 4K1ZA 4R52A 2I45A 4QKBA 1XNBA 1JOJA
chains in the Genus database with same CATH topology
2AUYA 4LBNA 2DU0A 2HJIA 1SLBA 4GIQA 4O9GA 2ARBA 3AYDA 4P14A 1C3HA 4MSVA 2NLRA 3SH4A 1GR3A 5CFCC 4OI2A 2H0BA 4HVQA 2VOXA 1T6GC 4UBGA 4NO4A 1O3SA 1CAWA 1EAH2 4HKOA 1ASJ2 1H1MA 1VBB2 3OJBA 1IGOA 1VBC2 4M3CB 3WVJA 1W39A 3T2TA 1WMDA 2DVAA 1RUNA 4WM8B 5JAXA 4QPIA 3VHPA 4ES9A 2B46X 3MLJA 4Y20B 3ECQA 1NLSA 3SHRA 4BMEA 1HRV1 3P3PA 4IEZA 3FLTA 3EHKA 1QJX3 4YZ5A 5CVRA 1LCLA 4M3CF 1V6MA 3QOPA 4QD2A 4LNVA 1ZREA 5DZEA 4BMBA 1OPOA 2XGXA 4UW3A 4OHZA 1BMV2 1VAKA 3MFAA 4D94A 2B45X 1VBE2 2XJTA 3KCXA 4GB33 1REDA 1AR83 1LEMA 5EZWA 2XLGA 1AR91 2BTVC 5C4WB 2MNGA 1NG0A 1TEIA 4OHXA 4DQAA 5J96B 2ZX2A 1S55A 4RQPC 1RITA 1QH6A 1UD1A 1GZCA 2QJVA 4P9GA 2IFWA 4MGZE 3EBRA 4MH0E 2AGSA 4M3CA 2HWE2 5GLVA 1WGPA 2H6CA 3CJXA 4I3GA 4PIXA 3RDIA 1RVF2 3TB0A 4WM8A 4ITCA 3ZXKA 4FPOB 2Y0IA 3VL8A 3VKLA 3E5XA 4Y20A 4CTEA 3DGTA 1LB2A 1YO8A 3KB5A 1G6NA 1Y9QA 2H0VA 2XWBB 1FMD3 2YYOA 2ZBJA 3WHTA 1LESA 4KL1A 4DY5A 3VGIA 5FCCA 1WW7A 2W52A 1XU1A 1B35C 2HWF3 2ZHMA 4XFHA 1CAUB 3CEWA 1QU0A 2ES3A 4IEPA 1MS5A 1UW8A 1AZDA 4N9IA 5AFBA 5AFEA 1IKQA 4FOYA 5C4WA 1N3QA 2NQYA 2VUAA 5L36A 3I7DA 3WW4A 3NV4A 1D0GA 5F6KA 4L97A 1YI7A 5JDBA 3PVEA 2V09A 1AYN2 3WCSA 4XMIA 2MEV2 4AEDB 4P5HA 3NL1A 4YVWB 5BNPC 5BXXA 1POV3 2F4PA 3NAPC 1GYKA 1RC6A 3J9SA 5EYYA 2PA7A 3E6BA 1CAUA 4KWKA 1CESA 2NYYA 3ILRA 2GMEA 1U0AA 1HRV2 1QJY1 4GH4C 4IL7A 3OY8B 3MGUA 4IEOA 3CF6E 1QHDA 1PZ8A 1C28A 4ZXKA 3MIHA 5J48A 4Y22B 2C1FA 3FLRA 2E51A 2GN7A 4Y26A 2PFWA 2VW0A 4P9XA 2GH2A 4QU2A 1GV9A 2CGPA 2SBAA 4C0HA 5C9AB 4LBJA 3ZFEC 2RJKA 3APBA 1RMU2 3WW2A 2Z79A 1AR92 2BFUL 2E6VA 1HRI2 5EV7A 4AEDA 1PO13 1JUHA 2YY1A 2GC1A 3IDBB 1AYM1 4NVPA 1W6OB 4YVWA 2GC2A 1UF2C 3MZHA 1AR63 4FPEA 2VOVA 3ILFA 2NMNA 1MQTC 3WD5A 1TE1B 2OUJA 1PK6B 4HBNA 1AXZA 2X5IB 4XF1A 4Y1YA 5JPMB 1HW5A 5HCBA 4B4QA 3OY8A 1FNYA 2XJVA 2YPJA 4CDXB 3PJYA 1SLLA 3O12A 1ZNPA 4Y22A 4Y24A 1FV3A 4W6WA 2AR6A 4Q4X1 2RJLA 1DYKA 4ZKTB 4FTBA 4YGCA 4TWTA 4CEYC 5C9AA 5SV8A 1C1FA 3V0AB 4XE9A 2NM1A 3JB8A 1PHMA 4CDUB 2D7FA 1H1IA 2LM3A 2Q0AA 1UKRA 4LBQB 4L2NA 1W6OA 1R1ZA 2RR11 1WBFA 1WD4A 4BHPA 5JCTA 4Q4Y2 4XXAA 3WP5A 1DG6A 1PK6A 1RUE2 4WZFA 2X5IA 1SCRA 1RUH3 1OQ1A 4OULA 4LBLA 5HXVA 4A7YA 1LU2A 4CDXA 3JBG3 3HWJA 1QJU1 4YNIA 1TMF1 1XYOA 5FMOL 4I3PA 1R091 4ISQA 4IV1B 4M0HA 1RINA 1UMZA 2QKDA 2RMU1 1LOGA 1PZ9A 1C4RA 1RUJ3 4NOTA 2ERFA 3V0AA 3CO2A 3TWIA 4LA3A 2GNTA 1QNWA 4LBQA 3DPRB 1LOBA 3BB6A 4ES8A 3VBFC 1ZZ6A 1NCRB 4YW5A 3GHNA 3RNSA 4Q4W1 4RS5B 2W68A 1VBA3 2HEYF 3GHMA 3OCPA 2DVGA 2DWRA 4PQ9A 3E6CC 3MW3A 4IV1A 1IOAA 1JUIA 1JN2P 2ZPXA 4EN9B 4EROA 3RYPA 2WIIB 1IPKA 2ZKLA 2OW4A 4GALA 5JWPA 1GFF2 5CFDB 2ZTNA 1CR7A 4B3NA 3ENRA 3VKOA 4LUMA 3DPRA 3RG0A 3NV3A 4L8QA 4BQ1A 2FHRA 3A4UA 1NCRA 5T5OA 1LOAA 4RS5A 1FATA 3HIFA 4PBPA 2WFF1 1CGPA 1BCXA 4IEWA 5EYXA 4K6BA 5KWRA 1HX6A 3DKWA 1RUG1 1QQP2 4C0BA 3FFQA 5C8CA 4R9DA 4PBOA 4R4ZA 4QQLA 1X82A 3SH3A 3ELNA 1HLCA 1KJRA 2XBO2 5I0RA 4I2OA 2KM2A 2UURA 2PHTA 3PVBB 5CFDA 4OUMA 3ZSMA 1DZQA 4MVTA 1Z7S3 1ALYA 2R062 2VOKA 4XFFA 4NR1A 2RMU2 2WQZC 1WCSA 1YJKA 2P17A 3JUUA 3KGZA 4FOWA 5ACA1 2E7QA 3LCPA 1H8TC 1NXD1 2WS92 1LR5A 3LA7A 5DDJ2 3TNQA 5F9TA 2RM22 4HMZA 1MZEA 3U0ZA 1EPZA 2HWC1 2Q1ZB 3O5SA 2WNEA 1GNZA 1Q56A 1DYPA 3MIBA 4LHNA 4CDQC 4Q4W2 1WCDJ 4MUVA 2JJ6A 3EO6A 2JICA 1VP6A 1RB8G 1OI6A 1ND2B 1YLLA 4MLOA 4RL7A 4AVBA 1J3RA 3DUIA 4EWDA 3AKSA 2K0GA 2PYTA 3LAGA 2XLFA 1JHNA 3AB0A 1VBD1 4MYEA 3AMPA 1PVC2 4XQ4A 3H3ZA 1C57A 2CGOA 4AQSA 3WP3A 2PLV1 3NW4A 4XEZA 1UZYA 3AKPA 4P9LA 3MICA 2VECA 1URXA 3ACLA 3NV1A 3IBMA 1DFQA 2WFF2 3B94A 3QLQA 1HXS2 4P9WA 1NA1B 4JRLA 1F2NA 2PHLA 2NMOA 4M01A 2X53S 4BH9A 1W6MA 2VOWA 4XJ9A 4MV2A 1ND2A 2VVDA 3KT1A 2V73A 1H4HA 3ZXFA 2JE7A 1R1A2 3RMXA 3G6JB 5J98B 4TSVA 3UK9A 1V6KA 1OD5A 1N47A 1GICA 2A70A 1LHUA 3ZVXA 4UW4A 1JTZX 1EV13 5FPZA 5AC92 3ATGA 4Y1VA 4XJZA 5CAZA 1DQ6A 2D43A 2VW1A 3OYWB 3QBQA 1HIXA 4LHKA 1YWKA 3WQ7A 1Q8SA 2ZOEB 4GKXA 3AMQA 4S2DA 4XOGA 2HWB2 4XIOA 2GNDA 1NA1A 3ZFGB 4G9SB 4U2AA 3M3IA 4TYSA 4XDQA 1N3PA 4L11A 2ZAAA 1O91A 1OA2A 1DLLA 1S0CA 1J3PA 5CU1A 1YFWA 2A71A 5DUUA 5AVPA 2WL1A 3AFKA 1V9U3 2R16A 1RUOA 1TME1 1HV1A 4PIYA 1PO22 1GZ9A 1LJ7A 5C6CA 5CNAA 5T5LA 4ZU4A 4OHVA 1H2LA 4AXOA 3OYWA 2YGLA 1EP0A 4N90A 3P3NA 3AK0A 3KCCA 2ZGLA 4I02A 5T55A 5D8AB 4LE3A 4GMP1 3M3QA 5JLVA 5A32B 1ZA4A 3ZFGA 2FMDA 3IDEA 3AP5A 3D0SA 4A2UA 2ZKNA 4YW2A 1PGL2 3KT7A 1C8M1 1MZ6A 3OBTA 4JDOA 3W9AA 4I01A 2RS13 1DZRA 3WP6A 5FLJA 1R081 3V65A 4R9BA 3WCRA 3NO8A 2R043 1BEV3 2RS31 2VNRA 1OFNA 1UX6A 5K0UC 3HD8B 1O4ZA 4M0NA 2QCSB 3A0NA 3D82A 3ZXJA 1IS5A 3S0MA 1SFYA 1LHWA 3Q9OA 1DQ5A 4QM9A 4I30A 4FP3A 5GLUA 5KBFA 4AEDC 3J8F3 2ZGQA 2ETEA 5J37A 5D8AA 3J26N 3ZSLA 5A32A 4L9BA 1JXNA 3H7JA 4RGGA 3TOJA 4YVWC 3VL9A 4KGGA 1GSLA 4FP2A 1PGW1 3UV9A 2R073 2D40A 3ZYJB 1LGBA 4XFIA 4AVSA 4DINB 2I74A 2DVBA 4IV3B 1D4M2 5GZGA 4AFCA 3N36A 1ZBA2 5FFOC 2R1DA 5FQ0B 3VBUB 3AP9A 3ZMOA 1I9RA 1Q5OA 1FPN3 4CEWB 1X36A 2XL9A 3SCFA 1LOFC 4C1WA 2Y26A 4Q8LA 1BBT3 2EXIA 1OA4A 1OPMA 2E9QA 2X8KA 4MZUA 4PF5A 3VBHC 2FQPA 2PHWA 1VBB1 1KFUL 5FOBB 2MHFA 4QGMA 3MYXA 2K9ZA 2VU9A 4LULA 1YYNA 4FXKB 4QPGB 1QJX1 3FMGA 2C0ZA 2BVBA 3SNMA 4JGYB 1O3QA 1MEC3 2JX9A 1PK6C 5GZEA 1FX5A 2WZPP 2X5IC 2RS52 3HAGA 4H14A 3KZ4C 4HL0A 4IV3A 2OPKA 5FO8B 4CDXC 5FQ0A 1RJ7A 2CWSA 2YC0A 3VBUA 4LUKA 1AR81 4CEWA 1MS0A 1C8M2 1XNCA 3LA2A 2BVVA 2WZR2 2A5ZA 4Z07A 1BVP1 4Q4V3 4HPKB 4WM7B 1VJ2A 4HETA 2RS32 1F8VA 1RUC2 4E4ZA 3D5OA 4IEQA 3AP4A 3ZIXA 5JZGB 1QKQA 4OHYA 4CDUC 3PVNA 1XXNA 1AX0A 2VW2A 3VHRA 4QPGA 4AVAA 3SISA 1RVF1 1PIV3 2JE9A 2B39A 2GDFA 4JGYA 4LLOA 3DF0A 4EN0A 3JD73 4YM3A 1UPSA 1GLHA 1HQLA 3OTFA 1CN1A 1RHI2 3AZXA 4LO8A 3WT3A 3GBGA 1H2MA 1OFSA 1SFNA 2A6VA 1H4GA 1YJLA 4IV1C 3LOBA 3AMMA 4HPKA 4WM7A 5CADA 3TN93 1COV3 2BNNA 2ZA9A 4ISRA 3M70A 2WNUC 5C33A 2ZAHA 3QACA 5JZGA 4F8AA 5HCFA 4XILA 2ZMLA 4AYUA 3DPRC 4AFBA 2XL7A 3AYEA 2PHRA 1G9BA 1ENRA 3I59B 3O0XA 1AYN1 1K5MC 1NCRC 2MEV1 1I3HA 1DZTA 4RS5C 4COZA 4MXVA 1VB4A 5EWSA 2BUKA 4FOVA 1MVQA 5FBZA 2GSYA 3C3VA 3MI8A 1RUD3 1XQNA 1V6OA 4ASMB 4Z82A 4AVVA 5SV5A 1QJX2 3AKRA 5T5JA 2ZABA 3H0OA 5IK7A 3HR9A 5GKAC 4Q1PA 2H6BA 3U10A 4GB32 4B8EA 4FPGA 1AR82 4Z92B 1JBCA 2HYKA 4SBVA 4RHV3 3MPBA 1XE7A 4JGZB 1PO11 4XTMA 2Z5WA 2WWSA 4CRQA 1WW4A 1DGRA 3LKJA 3PMEA 1EAH3 2O1QA 3VKMA 1RMU1 3I59A 1MR5A 2GC3A 2GC0A 1HRI1 4AGRA 1YHFA 1VBC3 4KQ7A 4XJAA 4Q0VA 1S2BA 1KQRA 3LSEA 3SITA 4MGKE 2DFCA 5BNOB 2I07B 2VQ0A 4QHBA 4JCKA 1C5HA 1FMD2 2AREA 1OHFA 4Q26A 4QX5A 3AZVA 1A8MA 2CAUA 3TRSB 1S0FA 1WLCA 4K40A 2HWF2 4R4XA 2OUHA 3WOGA 3KQRA 3MLKA 2XH6A 4NN0A 4META 2ZMNA 3ZXDA 1FOD3 3ETQA 3NKTA 2QNKA 3PVOA 3BALA 2GNBA 4KU8A 4JGZA 4UW5A 1G9CA 3BU7A 4NHKA 1AR73 1RUF3 1MS3A 4AGGA 1ZZ7A 4WBBA 2D3SA 1RJ8A 5D1IA 4YARA 2VMIA 1Q8OA 5BNOA 3V56A 1VAVA 1OOPC 1UU6A 3MF6A 2D97A 3E5UA 5L7OB 4Q4Y1 3HMYA 1RUE1 1KFXL 3AMNA 1HKDA 1ZZBA 3VKFC 2ZCWA 3WZ1A 5EFUA 2QVSB 2DYCA 1RUI3 3X29B 3AJYA 5JOXA 5FO9B 1JYCA 3PMSA 1ND2C 2O8OA 1MVEA 1QXJA 4Q8KA 5DXDA 4J1XA 2QDNA 2VY0A 4AE2A 2JG9B 5HCAA 5E89A 4S2GA 1UU4A 4KNCA 4N9HA 3KD4A 3ES4A 5I0UA 2XKOA 1V6IA 3CL1A 1WLDA 3N7KA 1BXHA 2UWCA 1QGLA 2QZ3A 1PO12 5L73A 4PLOA 3ZFFC 1VBA1 1LEDA 5L7OA 4QQOA 1AR62 4QQPA 1CVNA 3BOPA 5LK5A 3WW1A 3N4MA 4M3CE 1Q43A 1NA1C 2A73B 5B2GB 2ZGPA 1HRV3 4RR3C 1WMFA 1KITA 4FQ4A 1WBLA 3VZNA 1IS3A 5CB7A 2W0XA 3OBRA 1GNHA 2P2KA 2JG9A 4XF4A 1N1SA 2DURA 2G9FA 1GKBA 2TBVA 3JB4C 4PDWB 4JTOA 1ZYBA 3B69A 2IWGB 5T52A 1V6LA 2BFUS 2EF6A 5KC6A 3RPQA 1AR93 1V6JA 2QUOA 2XKPA 3KSCA 1IHMA 5FLHA 3VBOC 1LGCA 1SACA 3RYRA 2DUOA 4F83A 5E1RA 2GZWA 4R9CA 3RRDA 3MW4A 1D4VB 2JENA 2Q1MA 2C9AA 4Y5Z0 4A7KA 3VZOA 1V6NA 2A3XA 3QCWA 3VHOA 1YCIA 4JDNA 2XPJA 1ZBE3 3M3EA 3LGRA 3ZFGC 1Q8QA 3UKVA 1QQP1 1RUH2 3VDDC 4RFT0 1ULFA 1JW6A 3MEPA 3LZZA 5GLTA 4BZ4A 3WQ1A 4MXWB 4PIZA 4WV8A 3NVCA 1ZZ9A 3VN4A 2XBO1 4AI1A