2JJ6A

Crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
b'VPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-RELATED PROTEIN
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Crystal Structure of the Putative Carbohydrate Recognition Domain of Human Galectin-Related Protein
pubmed doi rcsb
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jj6A00
1S0EA 5GLWA 3AYAA 2ZAAA 4ASMB 1C1LA 5BYNA 4HL0A 3FLTA 1LU2A 2DVGA 4BMBA 4GWMA 1QGLA 1S0JA 3WUDA 1A78A 1IS4A 1Q8OA 2A3YA 2ENRA 1A8DA 2HYKA 4GKXA 2V5YA 5T50A 3T1MA 3USUA 3W59A 2AH2A 4CZSA 1JBCA 2WSVA 1GICA 1LCLA 1S0CA 3ATGA 4XJAA 4YGCA 3ILRA 4YM2A 1DGLA 1MS3A 1W6PA 5EWSA 4XBLA 3OPZA 3WDVA 1WBLA 3OY8B 5JDBA 3ZYRA 1QDCA 1VALA 1MZ6A 5GZGA 4DRRA 2P37A 2R49A 3PVEA 4Q8KA 4R9DA 2W52A 1XQNA 3SH4A 5F9TA 3VUOA 3V0BA 1PZ7A 4K20A 2AGSA 1AX0A 1LOAA 1WW6A 4ISQA 2C9AA 2NM1A 4YM3A 2AREA 2UWBA 4NO4A 4Z8BA 3QCWA 2Z42A 5E8AA 3A4UA 5DUXA 3UJOA 1KJRA 1N47A 4R9AA 3N7JA 2YY1A 1AX1A 2E7TA 2EXKA 2E7QA 2VW1A 3PMEA 4KBBA 4RL7A 4K21A 5EXOA 3NWKA 1DLLA 1W6PB 2AENA 3WZ1A 1GZ9A 1FNYA 1IOAA 3ENRA 1BZWA 4XMIA 2ES3A 4YW5A 5H9RA 2KM2A 2A6WA 4Y1VA 4PCRA 4Y1ZA 5DG2A 1LJ7A 1W6QA 3AZVA 4XE9A 3OBRA 4AVSA 2A70A 1HKDA 3VKLA 2DVDA 3B01A 5T54A 5SV8A 2GALA 1UL9A 1CVNA 4FPYA 4LBLA 1IS3A 3VKNA 2DYCA 4P9YA 2OW4A 1QKQA 3KM5A 1DYPA 1SACA 1GLHA 5T55A 4D69A 1LOFA 4ATEA 1ULFA 1N3PA 1S1AA 1UPSA 5JOYA 4FPEA 4FPOB 1OFSA 3AXEA 1SLAA 2H0BA 4XJ8A 4LBMA 4Y22B 1YRZA 2PHWA 5L73A 3SLIA 4P9WA 1AJKA 1W6NA 1AJOA 2NN8A 3WG4A 5JOXA 1Q56A 4P9XA 4XXPA 3WVJA 3OYWA 1TEIA 4XTMA 1LGNA 1DIWA 3OGGA 4Y20A 4YW4A 4YW1A 4AVTA 5HCFA 4GXLA 3D4KA 2ZGOA 2DUQA 1MVEA 1W6QB 2AUYA 3BODA 2LALA 5IUQA 2R0FA 2V73A 4RA0A 1SCRA 4LBQD 1VIWB 2NZ9A 3N36A 5F5QA 2A7AA 5CBLA 2R16A 3D5OA 3UK9A 5CA6A 4PBPA 2A75A 4TYSA 2D7FA 2WJSA 2EXHA 3WG3A 3SH3A 1LGBA 2VXRA 2JJ6A 1BQPA 2WNEA 3GALA 5T52A 5IK4A 1OKQA 3RMXA 3IMNA 1DQ1A 3AYEA 2D3SA 4ITCA 3N35A 5DZFA 3RS6A 2ZGPA 5GLZA 5HCBA 2W68A 2DU0A 2NMOA 2GNTA 5DXDA 1LODA 2A5ZA 4BM8A 5T5LA 4M3CE 5DG1A 1DYKA 2JECA 2CL2A 2WT0A 1LHOA 1JN2P 1V6LA 2LTNA 1LOGA 2PHTA 5GALA 4AVVA 1BJQA 2PHXA 3A0NA 3VKMA 1G8WA 2EAKA 3USUB 2A6YA 5DUVA 4AGVA 2ZGTA 2E6VA 3RRDA 2D43A 2ZGRA 4WVVA 3APBA 1LTEA 1LGCA 4YZ2A 3NV3A 5JMCA 3WLUA 4FQZA 1BYHA 2UWAA 2A71A 3ILFA 4DRVA 2GNMA 1W6NB 2ZZJA 1WD3A 3ZXEA 1FAYA 3V0BB 2PHRA 2CYFA 1CR7A 2XG3A 2YMZA 3GNEA 1VLNA 1C57A 3U4XA 1HDKA 1ULEA 5JOZA 4PF5A 1S0GA 3NV1A 3AP6A 3MW3A 4YZ1A 3IPVA 1AXZA 4LBQA 4XIOA 1AZDA 1ULCA 1JYCA 1LHVA 1WW7A 2ZHNA 1GNZA 1S0FA 2ZGNA 4OZXA 3SISA 5EYXA 1C4RA 4Q27A 4FPHA 1N1VA 1N3OA 4XBQA 1CESA 1N1TA 4Q1PA 2ZABA 1ZM1A 4Y1UA 5H9PA 4XYXA 1GYKA 4Y24A 3AZYA 1Q8PA 1JHNA 1KDMA 2ZGQA 3V0AA 1D0HA 1UZYA 1LHNA 4LBOA 4UW3A 3IKWA 2NP0A 5KXDA 2A6ZA 4ZXKA 5DZEA 3WV6A 3IN9A 1DBNA 1CIWA 5CAZA 2P34A 1G9DA 1GBGA 1HQLA 1LULA 3HN1A 4YZ5A 4FOYA 2ZA9A 3T2TA 5GZFA 2EF6A 2WSUA 4ATFA 1NXD1 2D6KA 3RG0A 2GN7A 4UW6A 4Y1YA 3POWA 4R9BA 5DUWA 1DFQA 1R1ZA 1A3KA 1Y7BA 2ZACA 2CTVA 3H0OA 3M3QA 3O5SA 3Q9OA 2OVUA 3IPVB 1KITA 3OJBA 3AP7A 5JVVA 3DGTA 1VAVA 1FNZA 1IS6A 2W08A 3AFKA 2ZHKA 3AZWA 3WDWA 1W6OA 2YROA 4FOQA 5IT6A 3AXDA 3FUOA 3WHTA 3UJQA 2WT2A 1LESA 2YZ4A 2UWCA 3MEPA 3O0WA 1V6OA 3N7KA 3WNXA 1U0AA 3RSJA 3ZXFA 2ZMLA 2AYHA 1FV2A 1LOBA 2Q5TA 3FBYA 2OUJA 2R1DA 2ZGMA 1WLWA 1MS9A 1G9CA 1KRIA 4AGGA 1CN1A 2D6NA 1LENA 3ZXKA 1I3HA 2WKKA 4UW5A 1F5FA 1MS4A 3OY8A 3JUUA 2CWMA 3B00A 2NMNA 1DZQA 3PVOA 2DWRA 4YG6A 5KXCA 5IK8A 1RIRA 1MR5A 4XJ9A 1YI7A 3FLRA 5JOWA 4YM1A 3POYA 1WW5A 3POSA 3AP9A 4K1ZA 4Q1RA 4XOGA 3ASIA 3ZSKA 1FX5A 1F31A 2BQPA 3I4IA 3R4UA 2GNBA 4YG3A 3AK0A 1BXHA 4YGBA 1H9PA 2FHRA 3MW4A 2DVFA 2R1BA 4FQ4A 1LECA 1YO8A 3B3QE 4XXAA 1MACA 4DFSA 1RINA 1LOCA 4XJWA 1SBFA 2DV9A 4AWDA 2D44A 1WD4A 4M3CA 3RQ0A 1QOSA 5GLUA 4GALA 3VKFC 2E51A 2ZMKA 1I1EA 3M3EA 1W6MA 5DUUA 3D6EA 3M1HA 4YFZA 1GZWB 1SLCA 2DURA 3HMYA 4YM0A 1ULDA 1MS1A 1Z78A 1MS0A 2VU9A 5CB7A 4YW2A 1Q8QA 1DQ5A 4AGRA 3L2YA 3WCSA 1FATA 5GM0A 3AYCA 1Q8VA 3M3CA 3ZSMA 4M01A 4L8QA 4LBQB 4XJUA 4LBKA 2P3JA 4FPLA 4F83A 5GZCA 2VH9A 3JU9A 1DQ0A 1BKZA 4HANA 3TB0A 3NV4A 4NOTA 4PBOA 1LOEA 4YFWA 1ONAA 2JD4A 2WLQA 2DTYA 3WDUA 2ZGKA 5GLVA 1GV9A 2GMPA 1Z0HA 1YYNA 3O0XA 5GZDA 2JE9A 1GSLA 2ZHLA 3WG2A 3N7LA 1JXNA 1WLDA 1V6NA 3ZSLA 2D6MA 1QNYA 2GMMA 3ZXLA 3AJZA 3AP4A 3V65A 1AXYA 1FV3A 2D3PA 5EYYA 4XMAA 2GDFA 2GN3A 2R0HA 3HR9A 2P3KA 5T5PA 5IK7A 4ZKTB 1DQ4A 2ZMNA 2B7YA 2DUPA 3QLQA 4LBNA 1GZWA 5H9QA 1QU0A 1J1TA 3WUCA 4BMEA 4TZDA 1HLCA 5GLTA 2ERFA 4FVVA 5HCAA 1URXA 4FP3A 4FP2A 1MS5A 4GA9A 4JCKA 5CNAA 2UURA 3OBTA 2UU8A 1FYUA 2DVBA 3N3HA 4M3CF 1WBFA 3R4SA 2G4IA 1V6JA 4K1YA 4SLIA 3FLPA 4XJZA 3M2MA 1D2SA 4WV8A 3A0KA 4H55A 5DZGA 1O4YA 1JYIA 1N1YA 1AVBA 1QF3A 5H9SA 5IK5A 4U36A 1IKQA 1N3QA 2C5DA 4C1WA 1WLCA 4FOWA 2YV8A 4XZPA 1G9AA 3BIWE 3ILNA 1LHUA 1QOOA 1HQWA 1JOJA 1QOTA 5KXBA 3V64A 4CTEA 1GKBA 3BTAA 3AZXA 3WDTA 4BPZA 1KJLA 1C1FA 3B9CA 3LSDA 5T5OA 2ZGSA 1CONA 2RHPA 5KXEA 1G9FA 4FOVA 1O4ZA 1QNWA 2VUAA 3INAA 1SLIA 2PHUA 1V6KA 4FPFA 3VV1A 3ZVXA 1MS8A 3AYDA 3R05A 4FPKA 1GANA 1UZZA 2ZGLA 1VAMA 5AVAA 2SLIA 1PZ9A 1QMJA 2W39A 1LU1A 3RMYA 4XTPA 3CNAA 2D6LX 2P2KA 4DS0A 2FMDA 3MPPG 4ISRA 4XHXA 1GNHA 4PQ9A 2DU1A 2EXJA 3B69A 3WG1A 4BQ1A 1CPMA 1YXWA 2ARBA 4DPNA 4CRQA 3V0AB 4YG0A 1X50A 4GWNA 1W0PA 3FUQA 2OUHA 2VY0A 3M3OA 5GZEA 2XB6C 4C1XA 3IM0A 4XIKA 5LK5A 3PJQA 1AX2A 1QDOA 3TAYA 3W58A 1Q8SA 1ZA4A 3ZPYA 4WVWA 2ZGUA 3VKOA 2DVAA 2EXIA 1G86A 4YGEA 4XHBA 1JW6A 3ZSJA 1SCSA 3OYWB 4I30A 4IQPA 5FREA 2CWSA 3ZYPA 1APNA 1UKGA 2A6XA 4Y20B 4UW4A 1LEDA 1LOFC 1OQ1A 2SBAA 1SFYA 1F9KA 3SITA 3FFZA 1MZ5A 2DTWA 3DUIA 4AYUA 1W0OA 4Q8LA 4U2AA 2ZHMA 4JRAA 2VW0A 5FRAA 3SH5A 1KQRA 1S0BA 3C2UA 1AXKA 2DUOA 3O12A 3O0VA 2JE7A 2E53A 3AJYA 4YGDA 2CNAA 4GKYA 4BLJA 1MVQA 1SLBA 1UN1A 1H30A 1V6MA 2WQZC 4BLIA 2A6VA 2TEPA 4FPJA 1WCSA 1SBDA 4YZ4A 1DHKB 2ARXA 1NLSA 3WHUA 2D6OX 2GNDA 4MYEA 2A3XA 4XILA 5E89A 1DQ6A 2WT1A 3AZZA 1B09A 1ENSA 1LEMA 1SLTA 1UAIA 2NYYA 1S0DA 2ZBJA 3WDXA 3ZXJA 4W65A 1ENRA 1W6MB 1DQ2A 1RITA 2EIGA 4XBNA 4YZ3A 4Y26A 3PVNA 1SBEA 3I8TA 2A3WA 1YIFA 4FPGA 4Q26A 1N1SA 1IKPA 2D3RA 2I2SA 1ENQA 2D6PA 2VW2A 2ZKNA 2PELA 2GMEA 4FPCA 4P14A 2P3IA 1CPNA 1EPWA 1H9WA 2AR6A 2YXSA 4XDQA 5GJ6A 5E88A 4DQAA 1S0IA 2PHFA 1WUVA 4BOWA 3BOPA 2JKBA 2CY6A 1JUIA 1CQ9A 1PZ8A 1ULGA 1W6OB 1WW4A 2JDZA 3LCPA 3LSEA 1IS5A 4M00A 4Y1XA 3AP5A 5T5JA 3WDYA 1UX6A 1V6IA 3N7MA 4YLZA 3WOGA 3T1LA 5JLVA 4LBJA 3AX4A 1AF9A 1SLLA 4WZFA 4Q2FA 1LHWA 1CJPA 2EALA 3NV2A 4R9CA 1G9BA 3MW2A 3SNMA 1G7YA 1UMZA 4JC1A 3UL2A 3KQRA 4YW3A 3WCRA 1KDKA 4M3CB 1V00A 4Y22A 1GZCA
chains in the Genus database with same CATH superfamily
1TMF3 1OH3A 5BY5A 1S0EA 2ZAAA 2O14A 4PDWC 1LU2A 2W95A 3BB6A 2XBO1 2XPJA 4GWMA 3ORJA 1H8VA 3ZYGA 4IGPA 3TOJA 2WO3A 4LHLA 1D4M2 1PVXA 4CU8A 2R32A 2B9UA 2G9ZA 3LIGA 3T1MA 3MF6A 3ZO0B 4OULA 4XUTA 3USUA 2AH2A 4A6SA 2WSVA 1GICA 4OYUA 4ZU4A 2VZQA 3ATGA 5AVPA 2GH8A 5D8AC 2Y34A 2QQVA 5EWSA 4BK5A 2RDRA 3WDVA 3CLPA 2IXLA 4MHUA 1QDCA 3DF0A 4R4XA 1VMHA 4P5YA 1VBE1 3WP5A 4CEYA 4DRRA 3BOWA 1UYXA 4Q8KA 2DCYA 4HVQA 2HWB1 2VULA 1OQDA 1UXZA 2WZEA 1XQNA 4META 5FZFA 5FP7A 1FPN2 3SH4A 5J48A 5A7SA 1OFNA 2R063 5CZKA 2Y6HA 1NLQA 4Q4W3 3DPRA 1HRI3 3DPRB 1C5IA 2UWBA 4A44A 1CJDA 5E8AA 1O6UA 3NNGA 3WQBA 1N47A 3N7JA 2E7TA 2VW1A 4QU1A 5A7WA 2RS12 1BBT1 4KBBA 2QQPA 5EXOA 3NWKA 5IVFA 1FPN1 1GZ9A 5A1FA 2MEV3 3ENRA 1PO11 3G6JB 3FC0A 4Y1VA 4JRLA 4Y1ZA 3WT3A 5KXDA 4IDZA 1W6QA 1Y3TA 4XE9A 4PIXA 2A70A 2TBVA 3H50A 1SQ4A 2DVDA 3B01A 4HPKA 5JZGA 1IS3A 1H2NA 3GCWA 1ZRIA 2GC0A 3VKNA 2DYCA 3ZX7A 1RUG1 2QE3A 3KCCA 3WNLA 2WNUA 3VHPA 1PGSA 4D69A 1OF4A 1VBE2 4Z82A 2XUEA 4N9IA 2W1WA 4FPEA 4LBMA 4LKEA 2WRAA 5FYMA 4JGZB 3SLIA 4EN8B 3LD8A 1LRHA 4YARA 5A32B 1W6NA 4IV1A 2NN8A 2HWD1 4FXGB 3WG4A 1NAEA 4XXPA 5ABJA 4I02A 1YFYA 1TEIA 4MX3A 1LGNA 5CIRA 1TME2 5CKNA 1V0AA 2ZGOA 2DUQA 1W6QB 3E5XA 4CCNA 2R0FA 5A80A 4OUMA 3SCHA 1K5MA 4LBQD 2E32A 3AVRA 3VZMA 2A7AA 5CBLA 2R16A 3WP6A 3D5OA 4IEUA 3UK9A 4MGZE 4PBPA 4LKSA 4TYSA 3ZYBA 4QB1A 4BK4A 2EXHA 2WZPP 3VDDA 1STMA 3PU8A 5I8TA 1ZZ7A 5FYTA 3NNJA 5FOJB 2ETEA 2GAUA 3AB0A 4AEMA 3RMXA 1HXS1 1YQ2A 1J3RA 3IMNA 2XL7A 2K0GA 2D3SA 3ZR6A 4CDXC 4EWDA 4ITCA 3N35A 1ULOA 3U14A 5DZFA 4J1WA 2ZGPA 2EVXA 2BU9A 3NJVA 4PHZA 4MGKE 2C9KA 4WM8B 3WSOA 4YWAA 2ADEA 2A5ZA 4ORFA 1GU3A 2PLV3 3ZFGC 1F5JA 1QH6A 4CXYA 2RS53 3GHNA 2O1QA 4CUCA 5FZ4A 2R042 1W9SA 3S7EA 1PO21 4HN0A 2QQOA 5G05L 1J1LA 4DUVA 4ZS3A 4QMAA 2PHXA 2WO1A 2HJIA 3TNPB 1C28A 1WA4A 3I7DA 3BIEA 1G8WA 1W8UA 4V1PA 3USUB 5DUVA 4QXHA 1Q43A 2Y6KA 4N53A 1BMV1 5TSWA 4NRPA 5EIYB 4NPLA 3VBUC 2ZGRA 2BGPA 3APBA 4QM8A 2ZEYA 1H1MA 3ES1A 4MGIE 1HRV3 3NV3A 3WLUA 4CDUC 4I3PA 4NVPA 4B4PA 3ILFA 1QWRA 1WD3A 2Y60A 1FAYA 3JQWA 3V0BB 2DFCA 1W8OA 5LRRA 3H1MA 3SXWA 2XG3A 3PU3A 1OLQA 1ASJ2 1V9U2 5LY2A 3WP3A 1NOVA 2XONA 5JOZA 5CEHA 1O3SA 3N4MA 1AXZA 1AZDA 1S4CA 4A4AA 1GNZA 1S0FA 1R081 2ZGNA 3K3NA 4RGAA 4UFMA 4XETA 1IPKA 1C4RA 3ZDVA 1YLLA 4W6XA 5LBFA 3T30A 4JQTA 1UY1A 2I74A 1ST8A 2ZABA 2K2SA 1GYKA 5FYHA 3RGBA 2BVBA 1Q8PA 3LEMA 2ZGQA 5C3PA 2R043 2XJSA 1LHNA 5A3NA 5FCCA 1O5UA 3KQ4B 5A6QA 5K8SA 4PF1A 4XCBA 1ZBE1 2VG9A 5LBBA 2VECA 2VNRA 3R6SA 3WV6A 3RZMA 5CAZA 5FLHA 1G9DA 1UYPA 3DV8A 3KS7A 4CPBA 2Y26A 2XVLA 4YZ5A 3PMSA 5AFEA 1IG3A 4D0QA 3J7MA 4QPWA 3ZN6A 3CDZB 2EF6A 3AM2A 4CDQB 3WF4A 3MBWA 4K8RB 4QPIB 3E6CC 1ZA7A 1TE1B 3OTFA 5AC93 2YC4A 5FYCA 4PLNA 3RJ2X 1XNAA 5JSOA 1JZ4A 3TEXA 4QXKA 4YVSC 1XOYA 3USSA 2OVUA 1EAH2 2VPVA 3LAGA 1MQTB 2WLPA 3AP7A 3OJBA 4O61A 2VNOA 5LK7B 3ALQA 3DGTA 5DDJ3 4CSWA 5A7WB 3AFKA 3AZWA 4QGNA 1TVGA 1QJX1 4ASLA 5C3SA 3WHTA 4MG2A 2J1EA 3UJQA 4A2UA 1LESA 2FCUA 4DB5A 3I2HA 4A41A 1UOGA 1VPHA 1YJKA 4CDUB 2W87A 1VBD3 4LOTA 1U0AA 2XJQA 2EIBA 2ZMLA 4DUWA 3FBYA 3DYOA 4X8PA 1HX6A 4QHBA 3VBUB 4URTA 5JXJA 1JH5A 2VCBA 2QQIA 3ACIA 2QTWB 1F5FA 1PO13 3VD3A 1DLCA 3D8CA 4IERA 1REFA 4GH4C 4RS5B 4JHTA 1DZQA 1ND2C 2F4PA 2HWE2 3HBKA 4JGYA 2E33A 4XVHA 2XGXA 3TEWA 4EN0A 1MR5A 2PLV1 4QQOA 3SC7X 1YI7A 3AL6A 3FLRA 2BUKA 5J36A 5JOWA 4Q1RA 2BTVC 5J09A 5FZ1A 5EJZB 4PI2A 3UGFA 4CCLA 2BQPA 3I4IA 1RUH1 4Q4V2 3ZFGB 3AK0A 5J3UA 1YFUA 2ZCWA 3WNNA 1LECA 1UWWA 5AC92 3LA7A 1UXXX 4XXAA 4CXXA 1MACA 4DFSA 2WA3A 1LOCA 5LATA 1SBFA 3N9PA 5FLJA 3MGUA 2DV9A 4QB2A 3M3IA 2Q0AA 3ETQA 4HVOA 2D44A 4W4ZA 4AWDA 3RZGA 4H2AA 4LQRA 4M3CA 2KXLA 1UW8A 2RDSA 4XDPA 3PJYA 4RR3C 1NXMA 5F7UA 3LQCA 2JG8B 4GWIA 3HMYA 1SLCA 2DURA 2JENA 4RQPA 1OOPA 1F4AA 4IE7A 5KC5A 3VB9A 2VU9A 3GJAA 4MXWA 2J1VA 4W6WA 5CB7A 5IVBA 5F3CA 2J1TA 5C70A 4HKWA 3WCSA 4BE3A 1OVPA 4LITA 5C4WB 3NQHA 4L8QA 2YHJA 4H14A 2NPIA 3QD6A 4RHV2 5FXVA 3DXUA 3OGJA 4FPLA 4BQYA 3JU9A 4QPIA 3LGRA 2BWCA 4QKNA 4KMQA 3TB0A 3W9AA 3NV4A 4COUA 4Q4X1 1RJ7A 3KHBA 1CIYA 2WLQA 4AR2A 4QGMA 3PIGA 3D82A 2GMPA 5GZDA 3O0XA 5HCHA 2VCAA 1UZ0A 2E31A 4LLOA 3P3PA 1UYZA 1RUI2 1V6NA 3P6BA 4LE3A 5FUNA 3VBRB 4GD4A 2Y33A 3AJZA 3BU7A 2G9GA 4LHKA 5HXMA 3OCPA 2IVJA 1Z7S1 5FQ0A 1O3RA 2GN3A 2R0HA 2RR11 2P3KA 2ZMNA 4MSVA 1XYPA 5F5AA 3RZJA 2WN3A 2DUPA 3TBDA 1UF2C 4TTGA 2X05A 4LBNA 3T3YA 2R30A 2XQXA 3WUCA 3CJIA 5DQ0A 4EN7B 4N53C 1VMFA 4FVVA 4OHXA 2OA2A 1URXA 4FP3A 2CGPA 2W0XA 1MS5A 3OBTA 1LB2A 5KHJA 4AEDA 5F1RA 2DVBA 4BQWA 1VRH1 3PIJA 4IEWA 4K1YA 4XABA 3FLPA 1GNYA 4XUQA 4C0HA 3FHIB 1KXGA 1JYIA 3KZ4C 1ND3A 4U36A 2W91A 1BK0A 5F3EA 3RYPA 2JDYA 2PHDA 3CIHA 5F3GA 4ZZ8A 2PAKA 1J3PA 4C1WA 1VBC1 1G9AA 3HD8B 1QOOA 2YBSA 5FR3A 1JOJA 2E7AA 2EA7A 2W1QA 2WQ8A 3LA2A 4JKLA 2DFBA 4XW3A 4H7LA 3BTAA 3WDTA 3LWCA 3LSDA 4LKDA 3I2OA 5EP9A 2OPKA 2ZGSA 1CONA 5LA2A 3VHOA 3NRUA 4Y3OA 4G4FA 1WMDA 3WD5A 5EV7A 5ANNA 4OQ9A 5LCWL 1K3IA 2PHUA 3VV1A 1EP0A 1MS8A 3AYDA 1OMIA 3ON7A 5EJ1B 5C33A 2VMFA 5AVAA 4OI4A 2XH6A 2BZDA 2L9LA 4CDWC 4CCOA 1QMJA 2W39A 5F8PA 5ACA2 1W3VA 4XTPA 3KV9A 2X29A 2RMU1 3B93A 1GNHA 4PQ9A 1UQXA 4FFHA 1OC1A 4IEOA 1BK1A 1PMJX 1CPMA 1YXWA 4WM7A 1JOBA 3I59A 4YG0A 1ALYA 4OMDA 4GWNA 1W0PA 3FUQA 5JIAA 4FO9A 5JZGB 2VY0A 4NRMA 5I0SA 3HN3A 1QDOA 1OA2A 1CWPA 1TNFA 4PIYA 2FMYA 4LT5A 4N7IA 4LNVA 2GC1A 1ZA4A 4MGSA 1BVP1 1G86A 3LPGA 1OLRA 3TYJA 1RUE3 5IHRA 5C3OA 5DAVA 3OYWB 4R52A 1D2QA 4J6GA 4AQ2A 2ARCA 1UKGA 2A6XA 3D3AA 1TZOA 3J26N 2VZOA 3JQXA 1LOFC 1W90A 5F5IA 4ZU7A 3OD0A 4WM7B 2Q8OA 3FFZA 5CFCC 5L36A 4UI9L 1C5HA 1W0OA 2IC1A 5FY1A 1JOPA 5A32A 3THTA 2WAAA 2ZHMA 5L7OA 1KQRA 1EV13 2JEMA 3O12A 3O0VA 1PO22 5I93A 4GKYA 2JG9A 5C8CC 3H8OA 1CGPA 2VQ0A 4AW7A 1FI2A 1UY3A 1V6MA 2ZEXA 2VO5A 4QX8A 2A6VA 4BLIA 2VVDA 4LHNA 4HPKB 3A22A 1NCQB 1PK6A 2AACA 2GSYA 2RR13 3U07A 4O9GA 3WHUA 2ZX3A 1NCQC 2GNDA 1SLTA 1QQP3 3MF9A 3NNMA 1W8FA 2XWBB 4XF1A 5A3PA 2WZ8A 5C8CB 1W6MB 2EIGA 1K12A 4XBNA 2LS6A 1OOPB 3OBAA 4FPGA 4ARYA 1N1SA 3VZNA 1O3QA 1YWKA 2D3RA 2I2SA 2VM9A 3AMPA 4MADA 1RUC2 2VW2A 2ZKNA 5E6HA 4B7KA 3P1IA 1ODMA 3OGSA 2XLGA 2R061 2YXSA 5GJ6A 4DQAA 5E88A 1FOD3 5CFDA 5A3TA 1YIPA 2FD8A 1S0IA 2PHFA 4RN5A 1Q5OA 1JHJA 5FZMA 1SDWA 2IWGB 2Q1MA 1JUIA 3CKHA 4YVWC 1K5MC 1BEV2 1F35A 3W21A 4M00A 1IS5A 1W0NA 2RV9A 3WDYA 1UX6A 1V6IA 1WKYA 3E6BA 3PUSA 4AHXA 2R7EB 2V4VA 4ARXA 1OD5A 3AX4A 1W04A 2XHKA 3NJYA 2QNKA 3Q8EA 2JG8A 5J98B 2EALA 1XC6A 3QACA 3SNMA 1UU4A 4JC1A 4LXLA 2ET1A 1VBA3 1ZZBA 1EAH1 5CKQA 4EROA 2BPA2 4AHZA 1H4HA 3AKQA 4OFGA 4PI0A 1XSQA 4KQ7A 4Y22A 2VBDA 4LEJA 5FUPA 3JXSA 3AYAA 4ASMB 4HL0A 3T0DA 3LA3A 2QKDA 2RG4A 4N90A 1QGLA 5LA1A 2A1XA 3S57A 2JDAA 1A8DA 4GKXA 4W8JA 2HWF3 5T50A 3E1F1 4OHZA 1AR81 2IFWA 1HB1A 1OLMA 2CDPA 5APAA 2WN2A 3HAGA 4QPGA 1S0CA 3S6PA 4YGCA 1DGLA 1MS3A 1U5XA 3H7JA 4NPMA 4CCCA 4AI1A 3LB9A 3OY8B 1GP4A 1VALA 1MZ6A 1ASJ3 1OF3A 1PMHX 3EO6A 4EV0A 2D40A 1AR93 3GGLA 1NYWA 5IJRA 5FZDA 4R9DA 1O8PA 3IWZA 2YU2A 5F9TA 3VUOA 3V0BA 4QAWA 1XNDA 4K20A 2AGSA 1AX0A 1GQGA 1LOAA 2JIJA 4ISQA 4X6QB 5DN2A 3THCA 2B5HA 2KA3A 1X9PA 4YNIA 2CU5A 2C9AA 5EJ3A 2AREA 4NO4A 3JD72 4WBBA 2QUOA 2Z42A 3VBFB 3LOBA 2P6HA 3VZLA 5DUXA 3KF5A 2ZZQA 4XFBA 3ZFEC 4R9AA 1VB2A 4KBZA 4S2HA 2VZSA 2PN5A 2E7QA 2YGLA 1W8WA 1FMD1 5I8YA 1W2OA 4RL7A 1DLLA 1PX4A 2AEZA 1FNYA 1IOAA 1BZWA 3NKTA 4QPYA 3SEEA 3S5QA 5ACA1 2ES3A 4YW5A 5H9RA 5LA0A 3C7FA 3S0MA 4PCRA 4AVSA 2C26A 2P4EA 5T54A 2QCSB 2GALA 3O7OA 4CUGA 5K7PA 1CAVA 5BNPC 4P9YA 2HEWF 3VBRC 2OW4A 5FZ0A 5JXHA 2Q4SA 1GLHA 5HBAA 3CBNA 3IT8A 1W9YA 4WM8A 1KGYA 1N3PA 5FYUA 2YFZA 3WF3A 4ATEA 2ET7A 5JOYA 4LUMA 4Y22B 1SLAA 2H0BA 4JDNA 4KH9A 4A3ZA 2LRPA 3ZFFC 2PHWA 2JB4A 1HB4A 3VDAA 4AVCA 4P9WA 1AJKA 1JYVA 1WLTA 3LFMA 1UCXA 5CADA 1TMF1 1Q56A 4OI1A 4I09A 1FT9A 1QY4A 3T2OA 2VQUA 3OYWA 5E16A 4XTMA 3GM8A 1DIWA 4ES9A 3RJRA 1RUF2 1HV1A 3LKJA 3D4KA 3B7MA 3BODA 3I54A 4GB33 3VBSA 1NCRC 4E27A 1VBB2 1VIWB 4EWEA 5FY8A 1AR62 1S2BA 1BLZA 4J25A 4KWKA 3NNFA 2XBO2 4AHYA 2QQWA 2X10A 2XVKA 3GZEA 3KB5A 3ZYFA 1KS5A 1X36A 3MICA 1YCIA 2JG8C 1AL23 1A6CA 1UMHA 2VXRA 1AR72 3CF6E 3AFGA 1BQPA 3GALA 4UAPA 5FP3A 1LKNA 1OKQA 3VD7A 3BYWA 5A3LA 3H9AA 4AAPA 2RJ2A 3CMGA 4MVTA 1YJLA 4QX7A 5GLZA 4D3WA 5HCBA 4LOSA 2DU0A 2NMOA 2GNTA 1WGPA 1ZBE3 4B1LA 4NR1A 1M4WA 3U75A 2JECA 4HMZA 2R041 4OLLA 4Q0VA 4B8EA 4OHYA 5I91A 3CZUA 3K2OA 1LHOA 4CXWA 4A3XA 2HBTA 1SPPB 2LTNA 3ZMOA 4NN0A 1LOGA 5GALA 2LROA 1BCXA 3A21A 2BNNA 4I0AA 2XWJB 1ND2B 3VKMA 1PGW1 5A1AA 4GH4B 4RS5C 5FYVA 2A6YA 3VBSB 3WW2A 4EJRA 2R6QA 3HBZA 1QJEA 4AI9A 3O1TA 1PVC3 4KI5M 4HSLA 2VNVA 3FE5A 2O8OA 2D43A 4OUSA 5LBCA 5IWFA 2WUHA 4CDXA 1LGCA 3HJRA 3KT4A 1IZ3A 1OA3A 4M0HA 3I3BA 3VBHB 4IEQA 3V56A 5F37A 3FHQA 1AR63 3M4FA 3ZYIB 2ZEWA 1NKGA 2A71A 2ZZJA 1W6NB 3D0JA 5DDJ1 3ZXEA 1BVVA 3J8F1 3BTZA 1CAXA 2OZJA 2PHRA 4EWAA 2CYFA 1CR7A 4A7KA 4BHPA 3GNEA 1QJX3 3PVBB 2BP6A 1MQTC 3NV1A 3ETPA 4OQ8A 1UO9A 3IPVA 5C8WA 1HW5A 1YI9A 5FMCA 1ULCA 1LHVA 1WW7A 4OZXA 4YVSB 3RZLA 4XF3A 2VVEA 3K4ZA 5FMBA 1SHWB 4Q27A 4E4ZA 4FPHA 4ZPIA 2ZAHA 1CESA 4QPIC 5FP9A 4Q1PA 2IXHA 4UFLA 3NL1A 4Y1UA 1OBNA 2Z79A 4XYXA 5H9PA 2E63A 4Y24A 2RMU2 1H6XA 5A7OA 4CDQC 3F2ZA 4GAZA 4FXKB 3T2QA 1B35A 4AFBA 2RS51 1D0HA 1UZYA 3G7DA 3DKQA 2DBIA 2QQNA 2RM23 2NP0A 2MEV2 3URFA 5A70A 2A6ZA 4ZXKA 3IZOA 1DBNA 4RGGA 3I2FA 1XNTA 3HN1A 2PMWB 3HT2A 4IV3A 4IV3C 4FFIA 2QQLA 4FOYA 4A6OA 3WX5A 5JMOA 1WMXA 2I45A 2WA4A 2Q8CA 1FMD2 5D1IA 3RG0A 4Y1YA 3POWA 4XQWA 5FP4A 5FUIA 2UY8A 4AXOA 3NAPC 1R1ZA 1Y7BA 1A3KA 2MEV1 4P9JA 4QQLA 2CTVA 5C3QA 3M3QA 1QIQA 3PTRB 1ND2A 4QD2A 2VVFA 4DIQA 4E9KA 1R093 3JB4C 4LMFA 3E5UA 5JVVA 4AAXA 5KHIA 1JZ6A 4DXZA 3BKZA 1IS6A 2JD9A 4QXBA 1US2A 4FFFA 2OT7A 4PDWA 5A1LA 2WT2A 3O0WA 3S7IA 5KR7A 4RD7A 3UV9A 1V6OA 3WNXA 4L92A 3ZSEA 3IIIA 1XE0A 1C8NA 2AYHA 3K3OA 3POEA 2RE9A 4ZZ5A 4YRDA 1WLWA 1G9CA 3BU0A 2D6NA 2RMU3 1LENA 3DN7A 1RVF3 1R083 1CAWB 1MS4A 4MHRA 5FBZA 5FY0A 3VN4A 5A33A 3WQ0A 1UIJA 2QDNA 3J4UH 2WINB 2QJVA 3LOIA 4GMP1 4RYDA 2DWRA 4QQPA 5FLIA 5FPXA 3MLJA 5D21A 4YVSA 3RZZA 4ZS2A 3VD4A 3MFAA 1MZEA 1RIRA 5FTTC 4XJ9A 4L2NA 1OPOA 3VL9A 5A3OA 5KC6A 1UU6A 1UY4A 3POYA 4K1ZA 4XOGA 4IGOA 3ZSKA 3ASIA 5CYYA 1FX5A 1F31A 3MFCA 1QJU1 1J84A 2GNBA 1BMV2 1BXHA 4PJYA 3MLLA 2DVFA 2R1BA 2IXCA 1YO8A 3OEBA 4FQ4A 4Q4Y2 2EICA 4QB6A 1E5HA 4WM8C 3J8F3 4IV1C 1RINA 5FMDA 4XJWA 5A6YA 1AR61 1HIXA 1JU4A 1NT0A 2WS91 1YFXA 3GF6A 2XDVA 1BEV1 4CDXB 1QOSA 2WNVC 4JKKA 3VKFC 2H6CA 5DUUA 3RWKX 1XNCA 4YFZA 4XF0A 1GZWB 1ULDA 3IDCB 1Z78A 1W99A 5FZOA 4HVRA 1RUI1 3UKVA 2FQPA 5GM0A 3U78A 3M3CA 3ZSMA 4LBQB 2WZR3 3ACLA 2Q8DA 4F83A 1PHMA 3VZOA 1BKZA 4HANA 2JDKA 3KT7A 4NOTA 1R082 1LOEA 4PBOA 3DYPA 2W3JA 5GLVA 1DU3D 4X8NA 2QDRA 1SFNA 2W1UA 1JZ5A 4EYUA 5BNOC 4JDMA 3GBWA 3N7LA 4CEWC 2QQKA 1WLDA 4CYDA 1W8NA 1QNYA 2GMMA 3ZXLA 3AP4A 1SEFA 2BGOA 1W2NA 4QQ2A 2QFEA 2VMIA 5SV5A 4B3NA 2VTXA 3ACGA 5C4WA 5T5PA 1E5RA 4RS5A 3RZKA 5LY1A 1XRUA 4FT8A 4K7JA 3QH7A 3QLQA 3VDDC 3VBOB 1GZWA 3ZDSA 3Q8AA 1YQ6A 4MXWB 1FOD2 3ECQA 3K51A 2ZEZA 1JI6A 4BQXA 2JDHA 3KHCA 1KEXA 4UFIA 1FYUA 3N3HA 4M3CF 2X5IC 4Z1VA 2BRTA 2R072 5HV0A 3OGVA 4SLIA 1X8EA 2WBKA 1RGSA 2B9VA 3KSCA 4XJZA 1BBT2 4DMIA 1D2SA 3NJZA 3A0KA 4H55A 5FFOC 1AVBA 2PHLA 4LO6B 5H9SA 5IK5A 5B4XA 1HB2A 3AVSA 1ZX5A 1EAH3 3P5BA 3WNPA 4XPVA 1J59A 5FZAA 2BBAA 2BW8A 2WZR2 5F2WA 3OOXA 1LAJA 2CV6A 2PQQA 4BYYA 1VBA2 4FOWA 4HETA 1NUKA 3BIWE 4MV2A 1LHUA 4Y4RA 4G3YC 1DGRN 3PLQA 5KXBA 2ZXQA 5D8AB 4A7YA 4CTEA 2VAUA 1PK6B 3AZXA 4GJYA 5IW0A 3K46A 2JKXA 3B9CA 4CPBD 2UYAA 1G9FA 2XXZA 2VD7A 5B4NA 1O4ZA 1QNWA 4AQTA 3INAA 1JZ3A 4KWJA 4FPFA 3ZVXA 1OUXA 2RDNA 4BISA 2ZGLA 1VAMA 4HXCA 4DINB 5L7OB 1CAXB 3B94A 1WCQA 4LA3A 1LU1A 1COV2 3CNAA 2J1RA 2P2KA 2D98A 2FMDA 3EB7A 4B4RA 4DS0A 4PDWB 2J42A 1DGRA 2JDUA 3B69A 2GZWA 4LJHA 4XAAA 3JCIA 4O65A 2JWPA 5CKMA 4BQ1A 2JX9A 2ARBA 1AYN2 4TXWA 1W9WA 3OGRA 4QX1A 3IAPA 4CRQA 3V0AB 4PLOA 1RJ8A 1QJU3 5CVRA 4JAAA 5BV6A 1AR92 4W6YA 2IXKA 3M3OA 2E26A 4Q4V3 4C8DA 4XIKA 3PJQA 4LIVA 1GWKA 3GCXA 4GQ7A 5FIXA 3TAYA 3WF1A 2P3YA 4NE9A 3MV01 1Q8SA 5JSPA 4NIHA 4WVWA 3K77A 1D4VB 4D94A 3HQRA 1NCQA 1JW6A 4GULA 1Y9MA 3ZMNA 1LR5A 4YYOA 5K0UB 3IMMA 5FREA 2CWSA 3ZM8A 3ZYPA 1APNA 4Y20B 1JYXA 4OVEA 3CHXA 1OQ1A 1SFYA 1F9KA 2CDOA 3AMQA 3E6DA 5BXXA 1W8HA 1L7LA 1ZBA1 3LE0A 2XLAA 3OUJA 4JRAA 2JXAA 4RHV1 5FAXA 5FRAA 3SH5A 3UKNA 1VE0A 2Y8KA 1AXKA 3O1VA 4F8AA 2DUOA 4Q4W1 3LDRA 4HOOA 1UY0A 2E53A 2X5IB 3AJYA 3E5QA 2Y0OA 4YGDA 2JG9C 3VBHA 1OI6A 1XB9A 1SLBA 2WO2A 2YC2A 2HWB3 1H30A 4CUAA 4XZUG 1JZ8A 2TEPA 1WCSA 3NKGA 2ARXA 1U5IA 1W9FA 2BEOA 3OSDA 3ZR5A 5J96B 2C1FA 1IHMA 3FX3A 4IEZA 4MYEA 3U4SA 4C0BA 4RFT0 5B2GB 2WT1A 3CU7A 1B09A 1ENSA 2WR9A 2XVGA 5FK8A 4DXTA 1DGWA 1D4M3 3ACFA 4JX0A 3O14A 1DQ2A 1AR83 1MPXA 4Y26A 1HV0A 3PDQA 3OG2A 4Q26A 4XFHA 2EIEA 1X9TA 5KHHA 2VOWA 4DO0A 2WNVA 1UU5A 1UOJA 3F95A 1H9WA 2AR6A 4ZONA 3ZKYA 5BNNC 2XKOA 5ISLA 2VTXJ 3FHAA 3POIA 5GKAC 5JAXA 4BOWA 1GZTA 4F7ZA 2CY6A 1W6OB 1NCRA 1RUG3 1ULGA 3LCPA 4Y1XA 2HEYF 3LIHA 1XYNA 3K4DA 1AYM3 5T5JA 5C6CA 1AF9A 1SLLA 2ATFA 4HZFA 3U1XA 4BQ4A 1LHWA 3IDAA 2W92A 4DXSA 3NV2A 2OX0A 4R9CA 5F39A 4BWOA 1G9BA 1Y9QA 3ZXAC 1VMJA 4XC9A 1O4TA 3MO4A 4PLMA 5ABJB 4EN6B 4PIZA 3UT0A 3CL1A 1RUH2 4Q4V1 2NLRA 4CEYC 4YW6A 5AC91 3VBFA 1X82A 3RYKA 5FV3A 5IATA 5GLWA 3WEZA 2B4KA 2I07B 2VZ3A 5BYNA 4UF0A 1NE6A 1ND3C 1S0JA 3IDEA 4BQ3A 1A78A 1IS4A 1J83A 4FBFA 2GU9A 3H3LA 5FJKA 2A3YA 4I01A 2HWD2 2ENRA 2B39A 2HYKA 3ZYJB 1UX7A 2H6BA 4HKLA 4AZZA 2V5YA 2DBNA 2GC3A 1AR82 3K4AA 3LEIA 4QHZA 4AEDB 4GZ9A 1TME1 1VBE3 4P9LA 1EY2A 4CZSA 1HXS3 5IVVA 4NROA 3NAPA 2QVSB 2FZ2A 1LCLA 3CJIC 3K48A 1MEC2 1NA1C 4MGQA 1QQP1 3N9LA 4QPGB 3ILRA 4UBGA 4YM2A 4E4SA 4CU6A 2DCKA 1H8TB 1WBLA 2ILMA 5JDBA 3EHKA 3B9IA 3ZYRA 4BZ4A 3HQUA 1OUSA 5GZGA 3U10A 2TUNA 2P37A 3PVEA 3WP4A 3EJKA 5F3IA 1POV3 3HNMA 2BBVA 2W52A 1COV1 1W3XA 3MIGA 1DP0A 1E5IA 4IXLA 1PZ7A 4OI2A 3VBRA 1WW6A 2VR4A 2Y64A 4NHLA 2VZTA 5FPLA 1A34A 1QJFA 3WQ1A 2NM1A 4Q4X3 3D0SA 4YM3A 2Y38A 1W2UA 4Z8BA 2W46A 4O9EA 2ZTNA 3A4UA 4XFGA 3UJOA 3GHMA 4HBNA 4XFAA 2YY1A 3GZTB 4LULA 1OHFA 1AX1A 2EXKA 2RM21 4URAA 2WDBA 3PHMA 3PMEA 1RUH3 4UFHA 4XF9A 1Z7S2 2RS33 4K21A 3U0ZA 1ZREA 1W6PB 2AENA 1AL0G 3DECA 3WZ1A 1ACCA 1J3QA 4ASKA 2A6WA 4B1MA 2VZ1A 5DAWA 2XJTA 1H1AA 1Q3EA 3NAPB 4E2GA 1JMUB 3SKJE 5SV8A 4FPYA 1YQ5A 4LBLA 1JUHA 4CDWA 2XJRA 5DAQA 4FTSA 2Y6GA 5BNPA 4H7MA 5C9AB 2DCZA 5A3WA 3O1RA 1X33A 1QKQA 3IBMA 3I3DA 3KM5A 4KGQA 4LR4A 4MXVA 4JZRA 5ERLA 1NLRA 1ULFA 2V72A 4XJ8A 1I6XA 1OFSA 1V70A 1WA6X 2MHFA 1PM7A 3AXEA 3H7YA 3HIFA 4LIUA 5L73A 2RR12 3ABZA 1PX3A 3WNOA 4DEQA 4N43B 4L97A 5FZKA 2VL4A 1D4M1 4S2GA 5JOXA 3WVJA 3MLKA 4P9XA 1XE7A 4BQ5A 5HXVA 1RUJ1 4FTEA 4XFIA 3TEYA 3DEMA 1L3JA 3OGGA 3JZVA 4YW1A 5HCFA 3ZFGA 4GXLA 2GP5A 3A23A 2AUYA 2LALA 4XFFA 1SCRA 4D8MA 2R062 2PA7A 4OI0A 4Q4X2 3LF7A 4XCAA 1LNSA 4R8HA 4AK3A 3H1YA 5FQ0B 1AR71 4MZUA 3WG3A 3SH3A 1K45A 3J9SA 3NJXA 2JJ6A 4LK7A 3THPA 2G19A 2ORZA 2WNEA 5IK4A 1FOD1 1DQ1A 3AYEA 4LK6A 4UFJA 1JS9A 2VZRA 5FY5A 3RS6A 1VRBA 2ZX2A 4IEPA 2FBEA 3O1SA 2W68A 2ZKLA 1PMIA 3S30A 2WFF3 3VBHC 1POQA 2W5FA 4BM8A 5T5LA 4M3CE 4QT6A 2CL2A 1OA4A 1YQ8A 4YVWA 3ZIXA 5LEKA 2VGDA 1JN2P 5FXXA 2O0OA 3T4VA 2PHTA 3NO8A 2WC2A 3VBSC 5DMYA 3EMRA 4AVVA 1BJQA 3AL5A 1KD7A 1PIV2 4AFMA 2EAKA 2PTMA 5KHGA 3MI8A 5AFBA 4NWWA 5FPBA 4JDOA 2E6VA 2X8KA 4I0BA 3AKSA 1RXFA 3RRDA 3HQXA 1CX1A 3KVBA 1LTEA 1NY71 2ZX1A 3FWEA 4YZ2A 5JR7B 2WO7A 1B35C 2GC2A 3ZN6B 2D97A 1W9TA 5JMCA 4FQZA 1QXPA 4JGZA 1PNFA 2J1SA 1UMIA 2KR2A 2UWAA 4UWDA 4XEZA 4Z2AA 2GNMA 3UNPA 2WFPA 2FCTA 2FDHA 2HBUA 1POV0 4BIFA 3L9JT 4KU7A 1ZZ8A 4COYA 5JIUA 5FZ7A 1VLNA 3U4XA 3KMHA 2XMLA 2VBPA 3E97A 2VOXA 4AOCA 4YZ1A 4LBQA 4DEVA 3CQOA 1AR91 1QJY3 4ZXEA 2AC1A 2LM3A 2BFUS 3KCYA 4LKFA 1RUNA 5FZIA 2HWF1 4CP1A 2HEVF 4QX5A 1NCRB 2WFF2 3IB3A 1N3OA 4KWUA 4XBQA 1RUJ3 1UIKA 4IGQA 2PLV2 1ZM1A 4AFDA 3C8XA 3OPWA 2C24A 3OUHA 3AZYA 3U11A 2VOTA 3AKRA 3UYJA 1JHNA 3TEZA 3J7HA 4LBOA 4UW3A 1AUYA 5K4LA 3AC0A 4AI8A 1HRV1 1GOGA 2K9ZA 4N43C 4NHKA 2ZX4A 4QM9A 1CIWA 3MV11 3NVCA 1PIV3 2P34A 1GBGA 1HQLA 2HWE1 3T2TA 5GZFA 5F5CA 5JSRA 2RJKA 4HSJA 5LW9A 2WSUA 5FZGA 3I2GA 1U12A 4Q29A 2VUDA 2D6KA 2R073 4UW6A 3EQEA 2VOKA 3MIHA 3T2PA 1GUIA 1HRV2 3HNYM 2BNOA 1HB3A 5ANQA 3POJA 2D5HA 3BCWA 3RNSA 1KITA 4BJ0A 3MIFA 3N9QA 4QHOA 5A33B 2OYZA 4OZOA 1FNZA 3I59B 3PNAA 1X7NA 2W08A 4NPRA 3WDWA 1V9U3 2XR4A 4FI9A 4LHSA 1OKOA 1RUF3 1W6OA 2YROA 4Z07A 3ZFEB 3AXDA 1HRI1 3TNQA 4UOJA 1S55A 4KNCA 1JYNA 3MEPA 1QJY2 5KBFA 4FFGA 1B35B 3N7KA 2VMCA 4XF4A 5C3RA 3RI9A 3QH6A 1LOBA 3VD5A 1RUJ2 4IETA 2BGCA 2HWC3 2OUJA 4Q0SA 1MS9A 5I0TA 5K0UA 3N9OA 4MH0E 4NIAA 2DCJA 4E2SA 4AQ6A 1I3HA 1UPIA 3KD4A 3H1WA 1COV3 3OY8A 3JUUA 2CWMA 3OF1A 4K6BA 4NUBA 2NMNA 1W28A 1CAUB 1IGOA 1NA1B 1I1EA 5IK8A 1RUD2 3CJIB 4Z92B 2P1BA 2EIDA 1WZXA 2OPWA 4ONUA 1UOFA 1H2KA 3O1MA 5DABA 4CCJA 4YM1A 4EE2A 3MYXA 3POSA 1QJU2 4MUVA 4CP2A 5A3MA 3PL0A 4AFAA 4YG3A 4YGBA 4NHYA 5C71A 5CFDB 2FHRA 3AMHA 3MW4A 3B3QE 5FZHA 2A73B 4NIGA 3HT1A 1SG3A 2BWAA 2Z69A 4D6SA 2Q1FA 1GWMA 1WD4A 5LBEA 1L7RA 2ORXA 4GALA 4B29A 4LPLA 4CEYB 5F32A 2YC0A 1AHSA 1C8M1 1W6MA 3M3EA 4IEVA 5C8CA 4N8MA 1QJZA 3POGA 3CEWA 3M1HA 4Q5OA 3VDCA 1GFF2 3WR0A 1YNAA 1QH7A 2JDMA 1DDLA 2PXJA 4YW2A 1Q8QA 4AGRA 4JGYC 2IXJA 1FATA 4HFSA 3AYCA 1Q8VA 2MNGA 4M01A 4SBVA 2FDKA 4CUBA 4YSFA 4LBKA 1YEWA 2P3JA 4COVA 1RMU2 5GZCA 3R0RA 2VH9A 3MIDA 2VXJA 1QJX2 4AVAA 2HWB2 2YPJA 4AL9A 5BNNB 1OVSA 2VCCA 2GP3A 2JD4A 2DTYA 2ZGKA 2P17A 2WL1A 1GV9A 4NWVA 1Z0HA 1YYNA 4RGKA 4CDUA 5L19A 2FDGA 2W94A 2JE9A 1GSLA 2W2IA 3PURA 4LO5B 3VHRA 3WG2A 4B7EA 2HYXA 3C7GA 3RFRA 3ZSLA 2D6MA 4JTNA 1OLME 3MUY1 3Q8FA 5C9AC 5C9AA 1VP6A 1RUF1 2V09A 4RR3A 5C5UA 2YGMA 3V65A 2PAEA 3NSTA 2D3PA 2YB7A 3VHNA 2GDFA 2JDNA 5IK7A 5FZ9A 2RM22 1DQ4A 5E1RA 1O5LA 1CAUA 1NX9A 1S2KA 3GDBA 3LEGA 2DDUA 1J1TA 4RQPB 5FK7A 3J7NA 1T6BX 3QBQA 5H9QA 4BMEA 3I97A 5GLTA 2ERFA 4K3UA 3UESA 5HCAA 4F3JA 4FP2A 2OIIA 4AI0A 5CNAA 2UURA 5CISA 1FMD3 1RUG2 2JG9B 2UU8A 1ZBA3 2VQAA 4IE5A 1WBFA 1UNBA 5F6LB 3R4SA 1V6JA 1AYM2 2WWUA 4BU2A 1SZBA 1XU1A 2XJUA 4AI2A 4WV8A 2Z5WA 3FMGA 1QF3A 1A8MA 3MPBA 3RI8A 3ZFFA 5CFCB 5I0DA 4WM7C 2VCMA 1RUE2 1RHI2 4RHV3 1H0BA 2C5DA 3EBRA 1RMU3 3ITQA 3WW1A 3KWVA 4M4PA 4BXSV 4CP0A 1F4HA 1ZRDA 3ILNA 1H8TC 3KV6A 4KWLA 3GZAA 5K0UC 1HQWA 3KF3A 2P5BA 4AEKA 5JXIA 4MGTA 2AEYA 3V64A 1AYN1 1YHFA 5LZ6A 1WMFA 1OQEA 3GYDA 5FZOB 4BPZA 4ZY9A 4D7SA 3GBFA 5FPUA 4MLOA 2RHPA 5KXEA 4FOVA 2VUAA 2W9XA 1G6NA 4D6RA 1SLIA 2PAMA 1HJGA 1V6KA 3IDBB 2X09A 1XE8A 3R05A 3FBMA 1GANA 4FPKA 1UZZA 3N9NA 5FPZA 5FY9A 5JZGC 5FPVA 3H8XA 1W39A 4CE8A 1ND3B 3RMYA 4CA9A 4AFCA 3MPPG 5FYYA 2CSGA 3C7EA 2LUWA 2DU1A 2XHNA 3NNLA 4Z2WA 3VZJA 2Z4FA 1PGW2 4DPNA 2JE8A 3N9MA 3Q8BA 5FMOS 5C7GA 5L7OC 4CDWB 1X50A 2YPDA 4Y5TA 2Z2SB 3DYMA 1Y9GA 5GZEA 1KFXL 1ZBA2 4K40A 5LK5A 1GQHA 4J1XA 1FPN3 1AX2A 4Q4Y3 1OH4A 5IFPA 1RUC3 5IYYA 4Q4W2 3W58A 4GMP3 5JPMB 3BPZA 1PK6C 1F15A 2ZGUA 3PUIA 5DAPA 5LB6A 3VKOA 5LEJA 4YGEA 4XHBA 1C8M3 1MZFA 2RJLA 1RHI3 3KT1A 4NAOA 5FDBA 1SCSA 1W2TA 2RS13 4IQPA 1NG0A 4HK9A 1BEV3 1Z7S3 1UKRA 2F17A 4W50A 4P00B 4UW4A 3ZIWA 1LEDA 1XBFA 3GZUC 1VBD1 2DTWA 3DUIA 2IUWA 2C0ZA 4Q8LA 4RFRB 4IE4A 2V4AA 1S0BA 3C2UA 1ZVFA 4EQVA 2ID4A 2VZPA 5FZLA 1VBC2 2VUJA 4LO8A 4XFCA 4HT1T 5D2AA 1XNBA 4BLJA 1MVQA 1JYWA 1UN1A 2IFRA 2VJXA 2F4LA 4CU7A 2IVIB 2BOJA 1RYYA 3VBOC 4QGLA 3WQ7A 4BQ2A 5J1XA 2D6OX 4UT5A 5E89A 5FMOL 3AZZA 1LEMA 3ZN5A 3BVCA 4CP9A 1FXZA 1UZWA 1JU3A 3LDBA 5DPNA 3ZXJA 2HWC1 3UETA 1GP5A 1TME3 4N7UA 2HWF2 2ZOEB 4OUEA 1XJAA 1NZIA 3PVNA 1O8SA 1SBEA 1ZZ9A 3I8TA 2A3WA 2B42B 4NHMA 4UF0B 4ZU5A 4CEWB 5FZBA 5BNOB 2VZVA 2D6PA 3C7OA 2PELA 2GMEA 4FPCA 4P14A 5F6KA 4BB3A 1H4GA 2P3IA 5CU1A 3RDIA 2D5FA 2PYTA 4XDQA 1ZZ6A 4DOUA 1KS4A 4L0PA 1CQ9A 1H2LA 2JDZA 1WW4A 4YW7A 2ZPXA 1REDA 3AP5A 3CZJA 3ELNA 4HK8A 2WWJA 4QKFA 1H8TA 5C4WC 3X29B 1BBT3 5JLVA 3KGZA 2QQMA 4P02B 3JD73 4Q2FA 4WZFA 4GB31 4XUOA 1EV12 3EXUA 2OKXA 1G7YA 4Q0QA 1UMZA 4COWA 3I3QA 3GJBA 3KQRA 4WVMB 3UL2A 3VBUA 4RR3B 3WCRA 4B4QA 4DUXA 2WNVB 4JQRA 1HN0A 1OSGA 2XOMA 1QXRA 2FCVA 1WCUA 1C1LA 3TN92 3FLTA 3HEIA 2DVGA 4JTOA 4BMBA 3SCGA 4N9HA 4IV1B 4CCDA 3WUDA 1HQNA 1Q8OA 3FL7A 3NW4A 5BNNA 5J7MA 3O1UA 4E4HA 2IXIA 2QZ3A 1EUUA 5G04L 3UGGA 3PUHA 2WWSA 5EQUA 4K8FA 3W59A 1MQTA 1WMEA 3IAQA 1JBCA 3M70A 1F8VA 2Q1ZB 2ADDA 2W1SA 3EYPA 4NMIA 4Q4Y1 4XJAA 3TN91 4D7TA 5FOBB 5EZWA 5FP8A 2XKPA 1W6PA 3T0BA 1S2EA 4XBLA 3OPZA 2VOVA 4IUGA 3WW4A 4FAHA 4EZHA 2Q8EA 3J7LA 4CDQA 2R49A 1GQPA 2BVVA 4C91A 4E8DA 5FBJA 3T4HB 1JZ2A 1HJFA 2AZ5A 4DZGA 5BNOA 1XYOA 4V2VA 3QCWA 2B46X 1V9U1 1UYYA 5M0TA 1KJRA 1PNGA 1PVC1 3MIBA 3NMBA 4AQSA 4EN9B 1GMMA 1NZCA 3U37A 4ES8A 5A3UA 3PUAA 4AF9A 4RQPC 3VDDB 3VGIA 5JUVA 4H3WA 3AKPA 4XMIA 4AVBA 2KM2A 3TN93 2X53S 3OBZA 3I2IA 4GH4A 1LJ7A 5DG2A 1RL3A 3AZVA 1W8ZA 1ODNA 3OBRA 1HKDA 1ZBE2 5FKBA 3VKLA 3ZYHA 5FO9B 3MHZA 4LA2A 1UL9A 1CVNA 3L2HA 3OEAA 3I2JA 2VMEA 1DGWX 5T55A 1DYPA 1SACA 3HOBA 1LOFA 2BFUL 1K42A 4IV3B 1S1AA 1UPSA 3ZN4A 2VC9A 4FAGA 4FPOB 1KRIA 4HKOA 2PFWA 2RDQA 3SMHA 4C90A 1YRZA 5FZ3A 4X6RB 3BI3A 2VMGA 4Y5SA 1AJOA 2WZR1 5EPAA 5FWJA 3AMMA 5DDJ2 5JWPA 1GWLA 1VBA1 1RC6A 1UY2A 4Y20A 4YW4A 3ZOIA 5FJHA 4AVTA 1RB8G 3I49A 4M4RA 1O59A 1MVEA 5IUQA 3T08A 2V73A 2YG0A 4RA0A 3N36A 2NZ9A 4JGYB 4IEYA 5F5QA 5CG9A 5CA6A 2WABA 1R091 1VBD2 2A75A 4Q0PA 2D7FA 2WJSA 4L99A 2O8QA 3O1OA 2HWC2 1LGBA 4XUPA 5T52A 5LA9A 5A7PA 5F2SA 1EUTA 3T09A 4XURA 2HWE3 1XSRA 4QDSA 5I8SA 2HLEA 1MEC1 4QDQA 1RUD3 1JYTA 3I2KA 5DXDA 5I0UA 1YQCA 1LODA 5FZ6A 5IFTA 5CFDC 2WAOA 4FTBA 2FDIA 2BOIA 5DG1A 2JB8A 3I3MA 1DYKA 1I9RA 4DNYA 4EZ4A 2WT0A 2XUMA 4FCAA 3RVHA 1T2XA 1V6LA 5EHDA 1TMF2 2XLFA 4V2WA 2BERA 4ZHNA 4Y4YA 5CG8A 2Q30A 2R071 3A0NA 2G1MA 4TLGA 1RTVA 3RYRA 2ZGTA 4AGVA 3GBGA 2PQSA 5FY7A 1ZZCA 5J37A 1W06A 5D8AA 3VL8A 5JR2A 5FPAA 3RWNA 1ZRCA 4R4ZA 4P9GA 4WVVA 3WF2A 2MPFA 1CX4A 2CGNA 4P08A 1X8MA 1SFPA 1U5YA 2C4XA 4TWTA 4LORA 4AE2A 1BYHA 1NQJA 4DRVA 4GIQA 4K9SA 4N43A 3KV5A 4XAEA 1XNKA 3M8LA 4I3GA 4CEWA 1OT5A 1IQAA 2E9QA 1EPZA 1VRH3 1AL22 1W05A 2YMZA 1AR73 4UFKA 2OZ6A 1GOFA 5BUVA 1C57A 1F2NA 1HDKA 1ULEA 1ZYBA 4IW3A 2KD7A 4MOAA 1S0GA 4PF5A 2VBBA 1ZNPA 4CP9B 3AP6A 3MW3A 4JHZA 1RUOA 1I5PA 4XIOA 2WNOA 2XJPA 1JYCA 2ZHNA 5C5TA 3SISA 1NA1A 5EYXA 5A7NA 1YC61 1N1VA 1RUI3 1N1TA 4BIOA 5JXGA 3DKWA 5FY4A 1D0GA 3FN9A 3LZZA 2RVAA 4BH9A 5DAXA 1KDMA 2RS32 2ZJCA 1XXNA 3V0AA 3FFQA 4BCUA 3OB8A 2Y6FA 1SDDB 1RXGA 2CHHA 3IKWA 3MIEA 2Y6JA 4O7XA 5LASA 3BPSA 5DZEA 5A7QA 3IN9A 1PGL2 4JGZC 3ZFFB 4AEJA 1QXJA 1CD3G 5CFCA 4E4DX 2FDFA 5A6XA 1LULA 3HPNA 4LO7A 2ZA9A 3OUIA 1XPWA 4NJ4A 1PVC2 2N7GA 2GH2A 3H8UA 1J58A 2XL9A 5HV4A 4ATFA 1U5ZA 3ZKUA 1NXD1 2GN7A 1TNRA 4R9BA 4FSJA 3J8F2 2FZ1A 5DUWA 1GR3A 4LE4A 1DFQA 5I0RA 5K9YA 2ZACA 4OHVA 5T3NA 3H0OA 3A7QA 2WIIB 3O5SA 1PGL1 4XDOA 3Q9OA 4IE0A 3IPVB 2ARAA 1I5ZA 3H8RA 1ZRFA 4DXRA 3MUZ1 4NIDA 1WWYA 1VAVA 4KL1A 1VRH2 4QQHA 4JVAA 3B5LB 3SQOA 2IZWA 1P8JA 2ZHKA 2CAUA 2YYOA 1H1IA 3BTYA 4FOQA 5IT6A 1YFWA 4QKDA 3FUOA 1GOHA 2YZ4A 4LUKA 2UWCA 1REEA 1CZTA 3DPRC 4P5HA 3I2DA 4IEXA 4BDVB 3BTXA 3RSJA 3ZXFA 2BV4A 1WCDJ 3H3ZA 1FV2A 1NQDA 2J22A 2Q5TA 3S5AA 2J7MA 2R1DA 2ZX0A 1US3A 2ZGMA 1OD3A 2OQ6A 4HONA 5FXWA 2Y0IA 4Y33A 1CN1A 3KV4A 4WVMA 4AGGA 3ZPOA 1NE4A 3ZXKA 4CU9A 2WKKA 4UW5A 4NAMA 5ACA3 2YDEA 2HKXA 3B00A 3JD71 5KWRA 5FXZA 3PVOA 3OPTA 1O3TA 4E8CA 4HLTA 4YG6A 1GP6A 5KXCA 5JCTA 3PUQA 3H42B 4Q0UA 1E5SA 1SPPA 4BA6A 4IESA 2V5DA 2VUCA 1M06G 5FO8B 5JI9A 3DXTA 5JPNB 1RVF1 1WW5A 3AP9A 3LPFA 4JKMA 2RS52 2BYVE 3FZ3A 2FDJA 3R4UA 3ZXDA 1EV11 2HH9A 1H9PA 3BGAA 4XUNA 4BXFA 5HI0A 4JV4A 1R1A3 3CJXA 4S2FA 1RMU1 3ZFEA 2RS11 2VZUA 5FZEA 1R092 4P9IA 4GMP0 1C8M2 5FO7B 3RQ0A 3ST7A 1T6GC 5GLUA 4YPJA 2E51A 2ZMKA 4OHWA 2BDRA 2CGOA 4KG0A 4INDA 4M0NA 3D6EA 4YM0A 3ME2A 4KU8A 1MS1A 1MS0A 4QDRA 3WF0A 2ZS6B 5FYBA 1DYOA 1JZ7A 3LDKA 4D6QA 1DQ5A 3L2YA 4LLFA 1IPJA 2CAVA 1VAKA 3QOPA 1O7FA 3FJSA 1PO23 4XJUA 1VBC3 4L9BA 1K5MB 2WFF1 4GWJA 2WQ4A 4YVWB 5FWEA 3SEPA 1DQ0A 3KGLA 4LTAA 1RVF2 5IVEA 4QX0A 4YFWA 3MZHA 1ONAA 3LFIA 3WDUA 2OQ7A 2X5IA 4GJZA 1R1A1 4A45A 4QU2A 3WNMA 2UY9A 2ZHLA 3AKTA 5FYZA 1QQP2 2F6BA 4CCMA 2WYFA 1JXNA 3POBA 3THDA 4A42A 5BNPB 1OOPC 1CAVB 2YBKA 5LWBA 2YU1A 4TLFA 4UXAA 4AI3A 4TN7A 3CO2A 1OPMA 5JI7A 1AXYA 1FV3A 2WNUB 4WZCA 3BUCA 5EYYA 2WS92 4XMAA 3HR9A 4COZA 4UYBA 1E57A 4ZKTB 1RHI1 1R1A2 2B7YA 4OMCA 4DY5A 1JTZX 3TRSB 1H6YA 1QU0A 2B8MA 1DF0A 4LO4B 3C3VA 4TZDA 1HLCA 1HN1A 1VR3A 3P3NA 2YBPA 4ET7A 4KG8A 2QQUA 1SMVA 4GA9A 4JCKA 3RZHA 3UKTA 5L9RA 2P6CA 1W03A 3SCFA 2RS31 3RPQA 1VBB1 2XQRA 3TWIA 3VBFC 2G4IA 3KCXA 3M2MA 2VQTA 3K75B 1IPSA 5DZGA 1O4YA 1IG0A 1N1YA 2QQJA 4TSVA 1IKQA 1N3QA 1XU2A 3ZXGA 1WLCA 4IE6A 1DG6A 2YV8A 4XZPA 1R64A 5EFUA 3HNBM 5IVCA 4KGGA 3W5MA 1QOTA 4RSUA 1DCSA 2OXBA 1ASJ1 1ENXA 1GKBA 3VDBA 4S2DA 2XJVA 2LW8A 4QPGC 2WYSA 1KJLA 1C1FA 1CZVA 2J1AA 3ZLIA 3ROUA 5T5OA 5BNQA 2VMHA 3UGHA 1L7QA 4AEDC 4A7ZA 4AHWA 3HWJA 3KVAA 5FYSA 3DL3A 4E2QA 1C3HA 1NY72 2SLIA 1PZ9A 1PO12 2WS93 2D6LX 2NQYA 1RUD1 1UZVA 3ES4A 3I3EA 3POFA 4ISRA 4XHXA 3T0AA 4G9SB 1TG7A 4CCKA 1O91A 4WVZA 2EXJA 3WG1A 4HN1A 2BJSA 1ZRRA 1KFUL 2K46A 1CZSA 5IVJA 4NHXA 2OUHA 2G9FA 1VJ2A 1OURA 3IIAA 5ABJC 5HPOA 2XB6C 4XQDA 4C1XA 4DY3A 3IM0A 3W20A 4QX3A 3ACHA 4D7YA 3SKVA 2YFUA 3SHRA 1VB4A 2EAAA 3ZPYA 4AG4A 1YUDA 2DVAA 2EXIA 2VE1A 3VBOA 3WINE 1W2AX 2QBXA 4Y5Z0 5IAVA 5IVYA 5FZ8A 3ZSJA 3JBG2 4QXCA 1H2MA 2JIGA 4I30A 3BN6A 2JDPA 4PQQA 1UOBA 4I2OA 4OCTA 2SBAA 3C7HA 3SITA 4MGYE 2OS2A 2BNMA 1MZ5A 4AYUA 3W5NA 2D93A 4U2AA 5FZCA 2VW0A 3PTYA 4NIIA 4XQ4A 2C6SA 3WXPA 1JODA 3M7AA 1PIV1 2JE7A 2CNAA 1EYBA 1W8TA 3GXUA 4IL7A 2Y6LA 2JICA 4HG6B 2W47A 3R4DB 3VD9A 1POV1 3H3UA 2WQZC 4N53B 1AL21 4FPJA 1AYM1 1DZRA 1SBDA 1DHKB 4YZ4A 5LRSA 1NLSA 1PM4A 5IAXA 2A3XA 4XILA 5FKCA 1DQ6A 1CAWA 3VZKA 1UAIA 2ZBJA 3WDXA 2NYYA 1AYN3 1S0DA 3KLSA 2HWD3 4L11A 1QHDA 2DCTA 2WNUC 4W65A 1ENRA 3HVDA 4XACA 3BALA 3VLBB 1RITA 3WW3A 4YZ3A 1Y4WA 1BHGA 3JBG1 1YIFA 4CVUA 1HXS2 3Q8CA 1ULPA 4GB32 4QX2A 3DCQA 3B02A 1IKPA 3MDPA 4NRQA 2QZ2A 1ENQA 1VBB3 4QKBA 3OD4A 1DZTA 1MEC3 4MO3M 3O1PA 2XBO3 1CPNA 1EPWA 4PT6A 5A6ZA 4UBHA 1TQ5A 2YUEA 5FYIA 2UYBA 1UD1A 3WY6A 3JBG3 2VMDA 3AMNA 1WUVA 1K5JA 4QWNA 3BOPA 2JKBA 1PZ8A 1D7PM 3LSEA 3JB8A 1OXCA 2B45X 5L9VA 1QEXA 4YLZA 3N7MA 2H0VA 5BPXA 1HRI2 3T1LA 4LBJA 1RUE1 4I0WB 3WOGA 5L9BA 2J1UA 1QJY1 1CJPA 2VTFA 2DF7A 3MW2A 4CCEA 1RUC1 1WCKA 2VNGA 3WNKA 5KHKA 2TNFA 4YW3A 1KDKA 1IQDC 3LEKA 1Y43B 4M3CB 1V00A 1GZCA
chains in the Genus database with same CATH topology
1TMF3 5BY5A 1S0EA 2ZAAA 4PDWC 1LU2A 3BB6A 2XBO1 2XPJA 4GWMA 1H8VA 3ZYGA 3TOJA 4LHLA 1D4M2 1PVXA 2R32A 2B9UA 3T1MA 3MF6A 3ZO0B 4OULA 3USUA 2AH2A 2WSVA 1GICA 4ZU4A 3ATGA 5AVPA 2GH8A 5D8AC 5EWSA 3WDVA 3CLPA 2IXLA 1QDCA 3DF0A 4R4XA 4CEYA 1VBE1 3WP5A 4DRRA 3BOWA 4Q8KA 4HVQA 2DCYA 2HWB1 2VULA 1OQDA 1XQNA 4META 3SH4A 1FPN2 5J48A 1OFNA 2R063 4Q4W3 3DPRA 1HRI3 3DPRB 1C5IA 2UWBA 1CJDA 5E8AA 1N47A 3N7JA 2E7TA 2VW1A 2RS12 1BBT1 4KBBA 2QQPA 5EXOA 3NWKA 1FPN1 1GZ9A 2MEV3 3ENRA 1PO11 3G6JB 3FC0A 4Y1VA 4JRLA 4Y1ZA 3WT3A 5KXDA 4XE9A 1W6QA 1Y3TA 4PIXA 2A70A 2TBVA 3H50A 1SQ4A 2DVDA 3B01A 4HPKA 5JZGA 1IS3A 1H2NA 3VKNA 2GC0A 3ZX7A 2DYCA 1RUG1 2QE3A 3KCCA 2WNUA 3VHPA 1PGSA 4D69A 1VBE2 4Z82A 4N9IA 4FPEA 4LBMA 4JGZB 3SLIA 4EN8B 1LRHA 4YARA 5A32B 1W6NA 4IV1A 2NN8A 2HWD1 4FXGB 3WG4A 4XXPA 5ABJA 4I02A 1YFYA 1TEIA 4MX3A 1LGNA 5CIRA 1TME2 2ZGOA 2DUQA 1W6QB 3E5XA 2R0FA 4OUMA 3SCHA 1K5MA 4LBQD 3VZMA 2A7AA 5CBLA 2R16A 3WP6A 3D5OA 4IEUA 3UK9A 4MGZE 4PBPA 4TYSA 2EXHA 2WZPP 3VDDA 5I8TA 1ZZ7A 5FOJB 2ETEA 2GAUA 3AB0A 4AEMA 3RMXA 1HXS1 4CDXC 1J3RA 3IMNA 2XL7A 2K0GA 2D3SA 4EWDA 4ITCA 3N35A 5DZFA 4J1WA 2ZGPA 2EVXA 4MGKE 4WM8B 2A5ZA 4ORFA 2PLV3 3ZFGC 1F5JA 1QH6A 2RS53 3GHNA 2O1QA 2R042 3S7EA 1PO21 4HN0A 1J1LA 4QMAA 2PHXA 2HJIA 3TNPB 1C28A 1WA4A 3I7DA 1G8WA 4V1PA 3USUB 5DUVA 1Q43A 4N53A 1BMV1 5TSWA 3VBUC 2ZGRA 3APBA 4QM8A 1H1MA 3ES1A 4MGIE 1HRV3 3NV3A 3WLUA 4CDUC 4I3PA 4NVPA 4B4PA 3ILFA 1QWRA 1WD3A 3V0BB 1FAYA 3JQWA 2DFCA 5LRRA 3H1MA 3SXWA 2XG3A 1OLQA 1ASJ2 1V9U2 3WP3A 1NOVA 5JOZA 1O3SA 3N4MA 1AXZA 1AZDA 1GNZA 1S0FA 1R081 2ZGNA 4RGAA 4XETA 1IPKA 1C4RA 1YLLA 4W6XA 2I74A 2ZABA 2K2SA 1GYKA 2BVBA 1Q8PA 2ZGQA 2R043 2XJSA 1LHNA 5FCCA 1O5UA 5K8SA 1ZBE1 2VG9A 2VECA 2VNRA 3R6SA 3WV6A 5CAZA 5FLHA 1G9DA 3DV8A 3KS7A 5AFEA 2Y26A 2XVLA 4YZ5A 3PMSA 3ZN6A 2EF6A 3AM2A 4CDQB 4QPIB 3E6CC 1TE1B 3OTFA 5AC93 4PLNA 3RJ2X 5JSOA 4QXKA 4YVSC 3USSA 2OVUA 1EAH2 2VPVA 3LAGA 1MQTB 2WLPA 3AP7A 3OJBA 2VNOA 5LK7B 3ALQA 3DGTA 5DDJ3 3AFKA 3AZWA 4QGNA 1QJX1 4ASLA 3WHTA 3UJQA 4A2UA 1LESA 4DB5A 4CDUB 1YJKA 1VBD3 1U0AA 2XJQA 2ZMLA 3FBYA 4X8PA 1HX6A 4QHBA 3VBUB 4URTA 1JH5A 1F5FA 1PO13 3D8CA 4IERA 1REFA 4GH4C 4RS5B 1DZQA 1ND2C 2F4PA 2HWE2 4JGYA 2XGXA 4EN0A 1MR5A 2PLV1 4QQOA 1YI7A 3FLRA 2BUKA 5J36A 5JOWA 4Q1RA 2BTVC 5J09A 5J3UA 2BQPA 3I4IA 1RUH1 4Q4V2 3ZFGB 3AK0A 1YFUA 2ZCWA 1LECA 5AC92 3LA7A 4XXAA 1MACA 4DFSA 2WA3A 1LOCA 1SBFA 5FLJA 3MGUA 2DV9A 3M3IA 2Q0AA 3ETQA 4HVOA 2D44A 4AWDA 4M3CA 2KXLA 1UW8A 3PJYA 4RR3C 1NXMA 2JG8B 3HMYA 1SLCA 2DURA 2JENA 4RQPA 1OOPA 5KC5A 2VU9A 4MXWA 4W6WA 5CB7A 4HKWA 3WCSA 4BE3A 5C4WB 4L8QA 2YHJA 4H14A 2NPIA 3QD6A 4RHV2 3OGJA 4FPLA 3JU9A 4QPIA 3LGRA 2BWCA 3TB0A 3W9AA 3NV4A 4COUA 4Q4X1 1RJ7A 2WLQA 4QGMA 3D82A 2GMPA 5GZDA 3O0XA 4LLOA 3P3PA 1RUI2 1V6NA 3VBRB 4LE3A 3BU7A 3AJZA 2G9GA 4LHKA 3OCPA 1Z7S1 5FQ0A 1O3RA 2GN3A 2R0HA 2RR11 2P3KA 2ZMNA 4MSVA 1XYPA 3TBDA 2DUPA 1UF2C 4LBNA 2R30A 3WUCA 3CJIA 4EN7B 4N53C 4OHXA 4FVVA 2OA2A 1URXA 4FP3A 2CGPA 2W0XA 1MS5A 3OBTA 1LB2A 5KHJA 4AEDA 5F1RA 2DVBA 1VRH1 4IEWA 4K1YA 3FLPA 4C0HA 3FHIB 1KXGA 1JYIA 3KZ4C 1ND3A 4U36A 3RYPA 2PHDA 2PAKA 1J3PA 4C1WA 1VBC1 1G9AA 3HD8B 1QOOA 1JOJA 2E7AA 2EA7A 3LA2A 4XW3A 2DFBA 4H7LA 3BTAA 3WDTA 3LWCA 3LSDA 3VHOA 2OPKA 2ZGSA 1CONA 4G4FA 1WMDA 3WD5A 5EV7A 2PHUA 3VV1A 1EP0A 1MS8A 3AYDA 1OMIA 5C33A 5AVAA 4OI4A 2XH6A 4CDWC 1QMJA 2W39A 5ACA2 4XTPA 2X29A 2RMU1 3B93A 1GNHA 4PQ9A 4IEOA 1BK1A 1CPMA 1YXWA 4WM7A 3I59A 4YG0A 1ALYA 5JIAA 4GWNA 1W0PA 3FUQA 5JZGB 4FO9A 2VY0A 5I0SA 1QDOA 1OA2A 1TNFA 4PIYA 2FMYA 4LT5A 4N7IA 4LNVA 2GC1A 1ZA4A 1BVP1 1G86A 1OLRA 3TYJA 1RUE3 3OYWB 4R52A 1D2QA 4J6GA 4AQ2A 1UKGA 2A6XA 3J26N 3JQXA 1LOFC 4ZU7A 3OD0A 4WM7B 2Q8OA 3FFZA 5CFCC 5L36A 1C5HA 1W0OA 2IC1A 5A32A 3THTA 2ZHMA 5L7OA 1KQRA 1EV13 2JEMA 3O12A 3O0VA 1PO22 5I93A 4GKYA 2JG9A 5C8CC 1CGPA 2VQ0A 4AW7A 1FI2A 1V6MA 4BLIA 2A6VA 2VVDA 4LHNA 4HPKB 1NCQB 1PK6A 2GSYA 2RR13 3U07A 4O9GA 3WHUA 2ZX3A 1NCQC 2GNDA 1SLTA 1QQP3 3MF9A 4XF1A 2XWBB 5C8CB 1W6MB 2EIGA 4XBNA 1OOPB 4FPGA 1N1SA 3VZNA 1O3QA 1YWKA 2D3RA 2I2SA 3AMPA 1RUC2 2VW2A 2ZKNA 4B7KA 2XLGA 2R061 2YXSA 5GJ6A 4DQAA 5E88A 1FOD3 5CFDA 1YIPA 1S0IA 2PHFA 1Q5OA 1SDWA 2IWGB 2Q1MA 1JUIA 4YVWC 1K5MC 1BEV2 4M00A 1IS5A 3WDYA 1UX6A 1V6IA 3E6BA 4AHXA 1OD5A 3AX4A 2XHKA 2QNKA 5J98B 2JG8A 2EALA 3QACA 3SNMA 1UU4A 4JC1A 2ET1A 1VBA3 1ZZBA 1EAH1 4EROA 2BPA2 4AHZA 3AKQA 1H4HA 4OFGA 4Y22A 4KQ7A 4LEJA 3AYAA 4ASMB 4HL0A 3LA3A 2QKDA 4N90A 1QGLA 1A8DA 4GKXA 2HWF3 5T50A 4OHZA 1AR81 2IFWA 3HAGA 4QPGA 1S0CA 3S6PA 4YGCA 1DGLA 1MS3A 1U5XA 3H7JA 4AI1A 3LB9A 3OY8B 1VALA 1MZ6A 1ASJ3 3EO6A 4EV0A 2D40A 1AR93 1NYWA 4R9DA 3IWZA 5F9TA 3VUOA 3V0BA 1XNDA 4K20A 2AGSA 1AX0A 1GQGA 1LOAA 4ISQA 4X6QB 2B5HA 2KA3A 4YNIA 2C9AA 5EJ3A 2AREA 4NO4A 3JD72 4WBBA 2QUOA 2Z42A 3VBFB 3LOBA 3VZLA 5DUXA 2ZZQA 4XFBA 3ZFEC 4R9AA 1VB2A 4S2HA 2PN5A 2E7QA 2YGLA 1FMD1 5I8YA 4RL7A 1DLLA 1FNYA 1IOAA 1BZWA 3NKTA 4QPYA 5ACA1 2ES3A 4YW5A 5H9RA 3S0MA 4PCRA 4AVSA 5T54A 2QCSB 2GALA 3O7OA 5K7PA 1CAVA 5BNPC 4P9YA 2HEWF 3VBRC 2OW4A 2Q4SA 1GLHA 5HBAA 3IT8A 4WM8A 4ATEA 1N3PA 5JOYA 2ET7A 4LUMA 4Y22B 1SLAA 2H0BA 4JDNA 4KH9A 4AVCA 3ZFFC 2PHWA 4P9WA 1AJKA 1WLTA 5CADA 1UCXA 1TMF1 1Q56A 4OI1A 4I09A 1FT9A 1QY4A 3OYWA 5E16A 4XTMA 1DIWA 4ES9A 3RJRA 1RUF2 1HV1A 3LKJA 3D4KA 3B7MA 3BODA 3I54A 4GB33 3VBSA 1NCRC 4E27A 1VBB2 1VIWB 4EWEA 1AR62 1S2BA 4KWKA 2XBO2 4AHYA 2XVKA 3KB5A 1KS5A 1X36A 3MICA 1YCIA 2JG8C 1AL23 1A6CA 2VXRA 1AR72 3CF6E 3AFGA 1BQPA 3GALA 1LKNA 1OKQA 5A3LA 3H9AA 4MVTA 1YJLA 5GLZA 4D3WA 5HCBA 2DU0A 2NMOA 2GNTA 1WGPA 1ZBE3 4NR1A 1M4WA 2JECA 4HMZA 2R041 4OLLA 4Q0VA 4B8EA 4OHYA 5I91A 1LHOA 4A3XA 2LTNA 3ZMOA 4NN0A 1LOGA 5GALA 1BCXA 2BNNA 4I0AA 2XWJB 1ND2B 3VKMA 1PGW1 4GH4B 4RS5C 2A6YA 3VBSB 3WW2A 4EJRA 2R6QA 3HBZA 1PVC3 4HSLA 3FE5A 2O8OA 2D43A 4OUSA 4CDXA 1LGCA 3KT4A 1IZ3A 1OA3A 4M0HA 3VBHB 4IEQA 3V56A 3M4FA 1AR63 3ZYIB 2A71A 2ZZJA 1W6NB 3D0JA 5DDJ1 3ZXEA 1BVVA 3J8F1 1CAXA 2OZJA 2PHRA 4EWAA 2CYFA 1CR7A 4A7KA 4BHPA 3GNEA 1QJX3 3PVBB 1MQTC 3NV1A 3IPVA 5C8WA 1HW5A 1YI9A 1ULCA 1LHVA 1WW7A 4OZXA 4YVSB 4XF3A 2VVEA 4Q27A 4E4ZA 4FPHA 2ZAHA 1CESA 4QPIC 4Q1PA 2IXHA 3NL1A 4Y1UA 2Z79A 4XYXA 5H9PA 2E63A 4Y24A 2RMU2 4CDQC 4FXKB 1B35A 4AFBA 2RS51 1D0HA 1UZYA 3G7DA 2RM23 2NP0A 2MEV2 3URFA 2A6ZA 4ZXKA 1DBNA 4RGGA 3HN1A 3HT2A 4IV3A 4IV3C 4FOYA 3WX5A 2I45A 2WA4A 1FMD2 5D1IA 3RG0A 4Y1YA 3POWA 4XQWA 2UY8A 4AXOA 3NAPC 1R1ZA 1Y7BA 1A3KA 2MEV1 4P9JA 4QQLA 2CTVA 3M3QA 1ND2A 4QD2A 2VVFA 4E9KA 1R093 3JB4C 3E5UA 5JVVA 5KHIA 4DXZA 1IS6A 4PDWA 2WT2A 3O0WA 3S7IA 4RD7A 3UV9A 1V6OA 3WNXA 4L92A 3ZSEA 1C8NA 2AYHA 2RE9A 4YRDA 1WLWA 1G9CA 2D6NA 2RMU3 1LENA 3DN7A 1RVF3 1R083 1MS4A 1CAWB 5FBZA 3VN4A 5A33A 3WQ0A 1UIJA 2QDNA 3J4UH 2WINB 2QJVA 3LOIA 4GMP1 2DWRA 4QQPA 5FLIA 5FPXA 3MLJA 4YVSA 3RZZA 3MFAA 1MZEA 1RIRA 5FTTC 4XJ9A 4L2NA 1OPOA 3VL9A 5KC6A 1UU6A 3POYA 4K1ZA 4XOGA 3ZSKA 3ASIA 1BMV2 1FX5A 1F31A 3MFCA 1QJU1 2GNBA 1BXHA 4PJYA 3MLLA 2DVFA 2R1BA 2IXCA 1YO8A 4FQ4A 4Q4Y2 4WM8C 5BXXA 3J8F3 4IV1C 1RINA 4XJWA 1AR61 1HIXA 2WS91 3GF6A 1YFXA 1BEV1 4CDXB 1QOSA 2WNVC 3VKFC 2H6CA 5DUUA 1XNCA 4YFZA 4XF0A 1GZWB 1ULDA 3IDCB 1Z78A 4HVRA 1RUI1 3UKVA 2FQPA 5GM0A 3M3CA 3ZSMA 4LBQB 2WZR3 3ACLA 4F83A 1PHMA 3VZOA 1BKZA 4HANA 3KT7A 4NOTA 1R082 1LOEA 4PBOA 5GLVA 1DU3D 4X8NA 2QDRA 1SFNA 5BNOC 4JDMA 3GBWA 3N7LA 4CEWC 1WLDA 4CYDA 1QNYA 2GMMA 3ZXLA 3AP4A 1SEFA 4QQ2A 2QFEA 2VMIA 5SV5A 4B3NA 5T5PA 5C4WA 4RS5A 1XRUA 4FT8A 4K7JA 3QH7A 3QLQA 3VDDC 3VBOB 1GZWA 3ZDSA 4MXWB 1FOD2 3ECQA 3K51A 1FYUA 3N3HA 4M3CF 2X5IC 4Z1VA 2R072 4SLIA 1X8EA 3KSCA 1RGSA 4XJZA 4DMIA 1BBT2 1D2SA 3NJZA 3A0KA 4H55A 5FFOC 1AVBA 2PHLA 4LO6B 5H9SA 5IK5A 1ZX5A 1EAH3 4XPVA 1J59A 2WZR2 2BW8A 2CV6A 2PQQA 4BYYA 1VBA2 4FOWA 4HETA 4MV2A 3BIWE 1LHUA 4G3YC 1DGRN