1XRUA

Crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
281
structure length
281
Chain Sequence
b'GSAMDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVAVKEIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
publication title The crystal structure of 5-keto-4-deoxyuronate isomerase from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 72
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 5.3.1.17: 5-dehydro-4-deoxy-D-glucuronate isomerase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04962 KduI KduI/IolB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xruA02
2.60.120.520 Mainly Beta Sandwich Jelly Rolls pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1 1xruA01
2XLAA 4J1XA 3H3UA 4RD7A 5JR7B 2D40A 2O8QA 3SCHA 2IXIA 3OF1A 5JCTA 4BIFA 3H7JA 2OZ6A 3EO6A 4O9EA 4AVCA 2B8MA 3CLPA 4EWAA 4MGIE 4AVBA 4XF4A 3D0SA 1UW8A 4NVPA 1QXRA 4IEOA 4HVQA 1EY2A 2V09A 1FT9A 3PLQA 2MPFA 4HN0A 4I2OA 3H7YA 1CAUA 4D7TA 4I01A 2GH2A 4HVOA 4XFCA 1NXMA 4IEUA 5I91A 3M70A 1CX4A 2PA7A 4MGYE 4Q0UA 1DGRA 4HSLA 5C8WA 1O7FA 4LULA 4FBFA 4HZFA 3QOPA 4EV0A 1J59A 3I54A 5JSOA 3FFQA 4QGNA 4MZUA 1SEFA 1ZRDA 5KHHA 5LEJA 3MDPA 4KU7A 4I02A 1RUNA 4L11A 2GC2A 3WW3A 3SMHA 2GAUA 4XEZA 4AVAA 1EP0A 3BU7A 4IEXA 4YYOA 2HJIA 3ES1A 3D0JA 4Z07A 3KGLA 2CV6A 4R52A 3RPQA 1CAWB 1X7NA 3E5XA 2WFPA 3NL1A 3QACA 2UY9A 5JAXA 1J3PA 1CAVA 1PM7A 1H1IA 3FX3A 3UKVA 1QY4A 4AXOA 2IXKA 1XRUA 1QXJA 3IDCB 1TQ5A 3H1MA 2ATFA 2I45A 3H1YA 3HT2A 1J1LA 4PJYA 2H6BA 4LA3A 2Z2SB 3TNQA 5J3UA 5D1IA 4YARA 4YSFA 3IBMA 2D5HA 4J1WA 1DGWA 2IXLA 1XE7A 5AVPA 5FLHA 5J48A 2Q0AA 3E6CC 3USSA 1WLTA 1IPKA 3BB6A 5FPZA 3ACLA 2H0VA 2PFWA 4IEWA 3U10A 3NJZA 1X8EA 4OFGA 5KHKA 5BV6A 2QJVA 5BXXA 5C6CA 3CJXA 4IEZA 5I93A 4WZCA 5E16A 4R8HA 2K0GA 4XFGA 3OD0A 1Y3TA 4TLFA 2VECA 4LA2A 4Q0SA 3RDIA 2PAEA 4Q0PA 4XF9A 4F7ZA 1NE4A 1CAXA 1PMIA 3I59B 2OPKA 4LTAA 2EVXA 2EA7A 4BH9A 4XFBA 2XL9A 2C0ZA 2DCTA 1J3QA 5KHIA 3NVCA 3HIFA 2B5HA 3OCPA 5J7MA 4JV4A 3E6BA 5CVRA 1VJ2A 5F1RA 3MZHA 3S7EA 1O5LA 4IEPA 2XKOA 3KMHA 1YWKA 4FAHA 1O3SA 3LA7A 1YFUA 2QVSB 5FPXA 3CF6E 5BY5A 4N9HA 2EAAA 2PHDA 1ZZ6A 3DN7A 3IDBB 2QNKA 3FWEA 4AQ2A 1LKNA 3PVBB 4IERA 1QWRA 3SHRA 3UKNA 4YNIA 1RUOA 4KL1A 2B9UA 2QDRA 1LB2A 4E2QA 1EYBA 3DKWA 1JUHA 5BPXA 2N7GA 1O3RA 2OZJA 3H50A 3NKTA 4OLLA 3ZDSA 3RNSA 3LOIA 2BYVE 4E2GA 4F8AA 1ZX5A 5FQ0B 3CEWA 4QGMA 1Q5OA 3SXWA 4ZU7A 4Q0QA 3ES4A 3IIAA 3FHIB 1NE6A 4QMAA 3DL3A 5JSRA 4BHPA 2XL7A 3FE5A 4HBNA 1YFWA 3RYPA 5FLIA 3BPZA 4XETA 1OFNA 1YLLA 1YFYA 5FDBA 3ST7A 4QM9A 3L2HA 3MYXA 4LUMA 5I8YA 3SCFA 3VHRA 2P17A 5JSPA 1U12A 2GC0A 1FXZA 2OA2A 2XKPA 4MGKE 1O3TA 1RL3A 3E6DA 5I0SA 3E97A 4IEVA 3BALA 2BNNA 1RGSA 2MNGA 3LWCA 4UXAA 4JTOA 2MHFA 4LLOA 4A2UA 1IPJA 3G7DA 4HN1A 4EWEA 4X6RB 4I0BA 4QX5A 5I0RA 1VR3A 5I0TA 5LRRA 1GQGA 3TNPB 1Q43A 3E5QA 3U11A 1O3QA 2PYTA 3B02A 1X8MA 4XF0A 2CGPA 4IEQA 1ZRCA 4B29A 1OMIA 2BNOA 2GC1A 1UIKA 5I8SA 1L3JA 2GU9A 2XLGA 2Q30A 3RYRA 2GZWA 1SFNA 2ZCWA 4XFIA 1H1MA 4LEJA 4LUKA 1CAUB 4XFFA 4I3PA 4HSJA 1HW5A 5LRSA 3WW1A 4ORFA 4CYDA 4L2NA 1UPIA 4EWDA 3GYDA 4Z82A 4KWKA 4Q0VA 2QCSB 3LZZA 3ETQA 4HMZA 3WW2A 4ONUA 4XFAA 4UBHA 2PHLA 3R6SA 2Q1ZB 1G6NA 2IXCA 4AQ6A 3EQEA 4E2SA 2IXHA 2XHKA 1EPZA 1OD5A 4FT8A 2BEOA 3DV8A 3E5UA 3H9AA 4N9IA 5I0UA 3HQXA 1SQ4A 4XFHA 4KWLA 4IESA 4XF1A 4MX3A 4O9GA 4KWJA 4QM8A 2KXLA 3JZVA 4KU8A 4X6QB 3LA3A 5KHJA 1X82A 3C3VA 5CU1A 1Q3EA 3NW4A 2UYBA 4MV2A 2FMYA 4IEYA 1RC6A 1CAVB 2D93A 2O1QA 4QXKA 4ZU5A 4ZU4A 4FAGA 1Y9QA 2XLFA 3HT1A 1ZZ8A 3I59A 3MPBA 3UKTA 2CAUA 4MGZE 3D82A 1UCXA 1ZZCA 2PAMA 3CO2A 4QGLA 1ZRRA 3ROUA 1I5ZA 4YRDA 3O14A 4META 1WA4A 4JVAA 1ZRFA 5EFUA 3KCCA 2BNMA 2ET1A 3S0MA 4Q29A 5HI0A 4WVZA 1NYWA 3GBFA 5FCCA 2BGCA 1DZRA 4DINB 3U0ZA 4GULA 5KBFA 4I0AA 4BYYA 3N4MA 1VP6A 3KSCA 2IC1A 1O5UA 2E9QA 5KHGA 4XF3A 1YFXA 5BUVA 1FI2A 1UIJA 2F4PA 5FLJA 2Z69A 2K9ZA 4MH0E 4HLTA 3NSTA 4PIZA 4PIYA 1V70A 3RYKA 1CAXB 1OI6A 1I6XA 3EHKA 1CGPA 3LA2A 2D5FA 1NZCA 2PTMA 5E1RA 3EBRA 3IWZA 3M3IA 5FQ0A 2HKXA 3KGZA 3SCGA 3I7DA 4IETA 3OGJA 2GC3A 3EJKA 3LAGA 2H6CA 5T3NA 1DZTA 1O4TA 2OYZA 4EROA 2WC2A 2Y0OA 1ZZ7A 1RTVA 3CL1A 1XE8A 4UBGA 2CAVA 2UY8A 4K8FA 1GQHA 1YHFA 1ZREA 3ELNA 1CAWA 3H3ZA 1YUDA 1UD1A 3RZZA 2PAKA 4P9GA 1LR5A 4H7LA 4PIXA 5I8TA 3OTFA 1ZNPA 4JTNA 5K8SA 3FZ3A 2ZKLA 3BCWA 2FQPA 2XGXA 3S7IA 3WW4A 3PNAA 4WBBA 2ETEA 1LRHA 2Q4SA 4D7SA 4I09A 5CADA 2PQQA 2UYAA 2VQAA 1WGPA 2VPVA 3H8UA 4HVRA 5EZWA 1ZVFA 1ZZ9A 1ZZBA 5LEKA 2IXJA 1J3RA 3H1WA 4MUVA 1J58A 2ET7A 3FJSA
chains in the Genus database with same CATH superfamily
3AXDA 4J1XA 1QJY3 5JR7B 3SCHA 1POV1 1MR5A 5FWEA 5BNPB 1OA3A 3A23A 2BVVA 1YI7A 2GMEA 4AVVA 4AVCA 4QHOA 3CLPA 4Q5OA 4MGIE 5FTTC 4XF4A 5KC5A 3ON7A 4HPKB 1G7YA 1QXRA 3AK0A 5IVFA 2JDAA 3IMMA 1SZBA 1TNRA 2MPFA 5EYYA 1NCRC 2WINB 5GLWA 1DQ6A 1RUJ2 4I2OA 5FZ8A 1RMU2 3QLQA 4QQPA 5IFTA 1X50A 2XDVA 2UU8A 1JUIA 1F2NA 1BK1A 1GV9A 4I01A 3SQOA 4CCJA 4D7TA 1SG3A 1SCRA 1X36A 2E7TA 1W2TA 5KXCA 5LZ6A 4Y1UA 2E51A 4JQTA 1HX6A 4MGYE 1DGRN 1PZ9A 4DY5A 3HN1A 1S4CA 2J1UA 4FBFA 3WXPA 1R092 2ADEA 3B94A 3I54A 1ND3A 2QQJA 3MI8A 4XHBA 3ZSLA 2DVBA 4CEWC 3FHAA 4ZONA 5FP3A 4D3WA 1SEFA 5EHDA 5CAZA 3CZJA 1K12A 3POJA 4ISRA 3PTRB 3WDVA 4AAXA 4CDQC 1MQTC 1NKGA 3K51A 3ZOIA 3GBGA 4NIHA 3WNXA 1W0PA 4NHMA 2VZ1A 1Z7S3 3VHPA 3M8LA 1H2KA 3VBUC 4YW1A 2GAUA 4XEZA 1EP0A 3IAPA 4JHTA 2ORZA 5LK5A 1HRI2 2OUJA 2VC9A 3D3AA 3D0JA 1DDLA 4Z07A 4FFHA 4I0WB 4K1YA 3WNPA 4R52A 1PO13 3RPQA 4GMP0 4W6YA 1UOBA 3NJYA 3E5XA 3LDKA 5ABJB 3IB3A 1SLCA 4A3ZA 4KG8A 2JKBA 5BNPC 2UY9A 5LW9A 1Z78A 3ZDVA 1PM7A 3PTYA 3UKVA 1AR91 4KWUA 1G9BA 1FPN3 4FPLA 1WBLA 1O59A 1XSQA 2VOXA 3KLSA 1KS4A 4S2FA 2FCUA 1UZVA 3CZUA 4YGBA 1RUE1 2PXJA 5F39A 3H1MA 3NNJA 2TNFA 1A3KA 1SLBA 2BDRA 2MEV3 4PJYA 4CDWA 2ZTNA 1HB1A 4YZ2A 2HWD3 3USUA 3A0KA 1GP4A 4LBKA 3WNMA 2Z2SB 1PNFA 4ET7A 4YSFA 2XJRA 4R9AA 2FCVA 3OBRA 5FZ0A 5F5QA 3TAYA 5J48A 1ASJ1 3QH7A 2I2SA 4M4PA 3UGHA 5F5CA 1TEIA 4TXWA 1K42A 3ACLA 1HLCA 4ES9A 1NA1B 5FOBB 3OEBA 1UKRA 5KHKA 3PJQA 3ZXFA 1F8VA 3FL7A 5C8CA 1AYN3 4BMEA 2HWC1 5IK4A 1YJLA 3CJXA 3JD71 5LY2A 3T0BA 2UWAA 1MS1A 3JB4C 3KF5A 4Q4Y2 1O4YA 3C7FA 5HCAA 2FDGA 4R8HA 2K0GA 2CTVA 4Z2WA 2V73A 4KG0A 1FOD1 1SDWA 4M3CA 5FZLA 2E26A 2VR4A 4IV3A 4DEQA 4EJRA 1FMD2 3WT3A 1RUH2 1VAVA 1W6QA 1OF4A 2PAEA 3AYCA 3ACHA 4Q4W2 4ATFA 4NPMA 5ABJC 4YG0A 1S2KA 3AYAA 1NE4A 1OSGA 3CJIA 5CIRA 3UYJA 2OPKA 2EVXA 5F37A 1VMJA 1AX0A 3OJBA 3KM5A 2DU1A 2XL9A 4CCNA 2DCTA 4M3CE 1SBFA 4E4SA 2DCYA 5KHIA 2GNMA 4YW6A 3UNPA 1Q8QA 3NVCA 1HXS1 4KBZA 1O8PA 3OG2A 4JV4A 5FK8A 5AC91 3SNMA 4XBNA 1VJ2A 4AK3A 2P3IA 1Y43B 1JZ7A 4CDXB 2VUJA 2LROA 1D4VB 1YWKA 2RR13 2W3JA 4NRPA 5FYUA 3UESA 1YFUA 4WM8A 4XZUG 1C8M2 1KQRA 4Y1ZA 4GD4A 2CSGA 4AVSA 5FPXA 5J09A 4YM3A 2EAAA 1AL22 1SLLA 3KHCA 5CBLA 4TLGA 1GKBA 5BYNA 2DUQA 3TN92 4CCMA 1RUG2 2WNEA 5E6HA 5A1LA 2QQNA 1H8VA 4YFWA 3IDBB 1Q8SA 2R073 1BEV1 1TVGA 1BYHA 2E32A 4AQ2A 1OPMA 2V4AA 4TYSA 2ZX0A 2G9ZA 3B93A 4IERA 4KNCA 1NA1C 4FO9A 3UKNA 1NY71 2PHUA 1WCKA 1DG6A 2B9UA 2QDRA 3CMGA 3HNYM 3OPWA 5LK7B 1RUOA 3ZFFB 1CX1A 1JUHA 1A78A 3C8XA 4LJHA 4Y1YA 4AHZA 3VDBA 3POSA 2P3KA 4MADA 4MVTA 2ZZQA 1G9CA 2NPIA 1N47A 4OLLA 4QB1A 3LOIA 4EN9B 2W0XA 2BYVE 2BBAA 4XIKA 4WVWA 3M2MA 5DPNA 5FP7A 5LASA 4D6RA 4A45A 2XPJA 2NZ9A 2RS53 2A75A 2YV8A 2DCKA 2QE3A 2XWJB 5JR2A 1KRIA 3WSOA 1OH3A 1GU3A 2XUMA 2ZPXA 3I97A 3ZYJB 4CUBA 3AMPA 2VOWA 2YBSA 1YO8A 5JSRA 2W91A 3OBZA 2XL7A 3FE5A 4HBNA 5H9PA 4A7KA 4OI2A 2D6LX 3VD9A 2HWE2 3A0NA 3WR0A 4CTEA 1WD4A 3ZXKA 5C9AB 1YLLA 1YFYA 3FLRA 4GKXA 3P3NA 4H2AA 2OQ6A 5FDBA 2OUHA 3WV6A 1Y9MA 4CDXC 3L2HA 3WDUA 1HQLA 1UOFA 3IKWA 2YMZA 5DAXA 1VBE1 3I3EA 4Z2AA 1V6JA 5I8YA 4C0BA 1TNFA 2PLV2 3NO8A 5FY7A 4XCBA 4XJ9A 1C1LA 5F6KA 4AEDA 2OA2A 1O91A 3JBG2 4P9JA 1URXA 2EF6A 4U36A 5I0SA 3W21A 3GHNA 4IEVA 2EICA 3HBKA 3BALA 2MNGA 1RGSA 1KFXL 4JTOA 1N1SA 2HBTA 1MVEA 3AKTA 1RB8G 4RN5A 3NJVA 4HN1A 4NROA 3AFKA 1CJDA 4X6RB 4I0BA 4IGQA 2VMDA 3GALA 1UKGA 4QX5A 3ZFFC 1VR3A 5LRRA 2HEVF 3TNPB 3WNLA 3ZKUA 1YI9A 4XACA 1RJ8A 5BNQA 1OKOA 4GJYA 2ZGNA 2NMNA 5F3GA 5FY4A 4AI2A 5FAXA 2JEMA 3B02A 1PGSA 4FPFA 2XJUA 3J7LA 4URAA 1AZDA 2GNDA 3I3DA 1ZRCA 4XC9A 3V0AB 3KV5A 3RZKA 3VHNA 3WUDA 3MHZA 1W0OA 2YFZA 3VDAA 1JZ8A 2JXAA 2XHNA 2FDFA 1TMF2 4LNVA 4S2HA 2A6ZA 3BIWE 1H2MA 1L3JA 2A3WA 2A6YA 2XLGA 5IVYA 1BQPA 1SFPA 2WWJA 1D4M1 4N53B 4RYDA 1SFNA 3LF7A 5C70A 3MEPA 2ZHNA 4K8RB 2OX0A 4P9YA 4XFIA 1DF0A 4YVWA 1ZBE2 1LOEA 2VZ3A 3LD8A 2Q8OA 2WZPP 4Y4RA 1PM4A 5FXZA 2QQIA 3TOJA 4E4HA 5C9AC 1C57A 1K5JA 4EN7B 5IAXA 4AGGA 1K5MA 2BVBA 2FHRA 2RM21 4QD2A 3VN4A 4AL9A 1AR93 5SV8A 4GMP3 2K2SA 1BK0A 1UPIA 4FP2A 2ERFA 2Z42A 1PIV1 4Y1VA 2BERA 3T4VA 2QCSB 3LQCA 2WFF1 3ETQA 2TBVA 3VV1A 1LTEA 1W9FA 2G19A 2Z4FA 4Q4X3 1YJKA 4LE4A 2VMIA 4ONUA 2ZX2A 3VL9A 3GCWA 5FYTA 1VBD1 2BFUS 2WN3A 1NQDA 3Q8FA 4M0NA 1XQNA 4LBNA 1KJRA 2ZGKA 3M3OA 1BVP1 3WX5A 1HRV2 2XHKA 2VUCA 1EPZA 4V2WA 1OD5A 4YGCA 4FT8A 1XNBA 2VXJA 4PBOA 3HN3A 4MYEA 3UV9A 1GOGA 3AMHA 5CFCA 4CCLA 2VZOA 3LFIA 1ASJ3 1UX7A 2V5DA 3UGFA 4AQSA 4LR4A 2JB8A 4D94A 5C5UA 2Y26A 3JZVA 4KU8A 5A6YA 1BBT2 4QQOA 4D69A 3C3VA 1LOFC 5CU1A 3OUJA 2D3SA 3K3NA 4IQPA 5DDJ3 2VZPA 2FMYA 2HWC3 1QNWA 1H4HA 4IEYA 4CUAA 4COWA 2B9VA 3U1XA 4QKNA 5FRAA 3URFA 5A7WB 4ZU4A 2JG8A 2ZKNA 1AJKA 3I2GA 4GWIA 4QKFA 4XUQA 4YW2A 4N53C 3WUCA 1FOD3 1MZ5A 4KGGA 1MZ6A 2AUYA 3LPGA 1WMEA 3MPBA 3UKTA 3P6BA 3D82A 1U5YA 1ZZCA 2PAMA 1BZWA 2DWRA 1HB3A 2W5FA 1WCSA 5DUVA 3I8TA 3VHOA 1ZRRA 4NAMA 4BU2A 4OQ8A 3B69A 3S57A 2IUWA 5K0UA 1WA6X 4S2GA 4LBQD 3O14A 4J25A 4Y22A 2WNUB 1GZWB 4META 1UO9A 5T55A 1PVC3 5T5JA 4CU9A 4AEMA 1F5FA 3FLTA 5EFUA 2O0OA 4CP9A 2O8OA 1QJZA 4IDZA 4E27A 1HXS3 2VTXA 2J22A 1W39A 3MPPG 4WVZA 5A3MA 2KA3A 2HYXA 3KQ4B 2ARCA 3INAA 5ANQA 1VRH2 3WD5A 4QX0A 3ZSEA 5FCCA 3F2ZA 1SHWB 1QJX3 3TEXA 4E9KA 5HV4A 3B9CA 4P5HA 3N7LA 5KBFA 4QPGA 3I2FA 4I0AA 1V6MA 2JWPA 4JDMA 4D6QA 3VD3A 4FPGA 2R30A 1VBA1 2WNVA 3PUQA 5GLTA 4CCEA 1CZTA 2J1EA 1YQ8A 1LEDA 4XF3A 1W8ZA 4GZ9A 1MACA 4OUMA 4Y5Z0 4ZPIA 1DLLA 4IV1A 2A73B 2Z69A 5A7PA 4AE2A 1BEV3 1LECA 4FPJA 3K3OA 2NQYA 3ZXJA 5JLVA 1HQWA 2VZVA 4PIZA 2ARBA 4PIYA 5JXIA 1UAIA 4ASLA 1Y9GA 1YQ6A 1UYYA 1V70A 3RYKA 4XE9A 4LOTA 1UY4A 1OI6A 3FFZA 2VQ0A 3EHKA 3V0BB 5JIUA 3MIGA 1D2QA 2W95A 1ENRA 4LBOA 1IOAA 2EALA 4MSVA 5FZ6A 1RIRA 1XBFA 3LIGA 3VBOA 5F9TA 4CU6A 4NOTA 4L8QA 3Q8CA 1RHI1 3V65A 5HBAA 4KGQA 2GC3A 1JZ5A 5T3NA 3RI8A 3N9OA 1VB2A 3LSEA 2ID4A 1LU2A 5FWJA 3WHUA 1GBGA 1ZZ7A 2Y0OA 1W6OA 4YG3A 2VUDA 2QFEA 2WNUC 3GXUA 3WLUA 4IE7A 2E31A 1YUDA 3AYDA 3RZZA 2P37A 5T50A 1QEXA 2ILMA 1QNYA 3B7MA 3OTFA 2OKXA 1X9PA 2PHRA 1QF3A 4NHLA 4U2AA 1PO22 1RUF2 4HXCA 2VNOA 3S7IA 3PNAA 4FPHA 2FCTA 4AFCA 1TME1 1W2OA 5C3OA 2W9XA 4D7SA 3J8F2 3ZFEB 2RS12 3AVSA 3GJBA 2P2KA 5JOWA 2ZMLA 5IVVA 1UMHA 4NIDA 1WW5A 4BLJA 5ACA1 1JTZX 1L7QA 2FDKA 1QJY2 3DF0A 3ETPA 1FV3A 4UW5A 4QXHA 3VKNA 2WR9A 4ZXEA 1YQCA 4FVVA 5IVEA 1W8OA 5FZKA 3TYJA 2JG9B 1AR62 2XWBB 1OD3A 1TG7A 2IXJA 2XJQA 2RDNA 3OYWA 4RR3B 1PO11 1NUKA 4MUVA 1J58A 2ET7A 1YC61 4H14A 2Q8DA 5EV7A 2WKKA 2XLAA 5CB7A 3MIDA 2D40A 2IVIB 2IXIA 2R0HA 3VBFA 3WEZA 1B35B 1XB9A 3AP7A 1PGW1 4BIFA 3THDA 1WLCA 1QJU2 2VBPA 2ZGQA 3B5LB 4YZ5A 1DFQA 2B8MA 2YPDA 1MEC1 1LESA 1UW8A 3U4XA 4JGYB 4HVQA 2V09A 5K4LA 4FPOB 4CCDA 2R49A 2W39A 3L9JT 5IVCA 3NV3A 4AWDA 4HN0A 4QX1A 2NN8A 4IE4A 5FBZA 5FZOB 1D4M3 2IFWA 1CAUA 3N9PA 4PCRA 3RVHA 2GDFA 2GH2A 3P1IA 2W1WA 3Q8EA 3A4UA 5JI7A 1CX4A 1JW6A 2MEV1 1Q8OA 1WMFA 2HWD1 3FBYA 5D8AB 4DMIA 3D8CA 1QJEA 1DGRA 1ZRIA 1IQAA 4V1PA 5FP4A 4EQVA 5CA6A 5HXMA 2RM23 2EAKA 1LGBA 1IS4A 1O7FA 2RHPA 3EXUA 4GWMA 4IW3A 4AFAA 5C71A 3QOPA 5JSOA 3OGVA 1PIV3 5EIYB 3OOXA 4YW3A 3UETA 1LGCA 4CXXA 2WT0A 4DO0A 5BNOB 4LPLA 1GICA 2DU0A 2WFF3 1RXGA 1DZQA 3ZFEC 1F4HA 2W1SA 5KHHA 2XBO3 4CP1A 5AFBA 3BIEA 1W0NA 1IQDC 1ULEA 2RV9A 4KU7A 5T52A 4DB5A 1JYXA 3TEZA 2WA4A 1ALYA 5AFEA 4XYXA 4JGZA 3LDRA 4I30A 4L11A 1ENQA 1RVF3 1GZ9A 1VBD3 4HONA 3ZXAC 4XMAA 1GYKA 1PHMA 2VAUA 3AKPA 5A6ZA 4X8PA 3RMYA 4IEXA 3U75A 2B7YA 4FFGA 4UFHA 4WM7A 1FPN2 2D6NA 2JG9C 4E4DX 5FIXA 5GZGA 1L7RA 4PI0A 4RR3C 2WIIB 1V9U2 2CV6A 3LB9A 1CAWB 2VMCA 2WWSA 1OLRA 2RVAA 2OQ7A 1X7NA 1R082 2DTWA 1UMIA 4RSUA 2WFPA 4DFSA 1HKDA 1UOGA 3ZYBA 3I2IA 4AF9A 3NL1A 1ND2B 1B35C 4H3WA 1W05A 2HBUA 1H8TA 2YXSA 3MGUA 4YM2A 4XVHA 1J3PA 1HN1A 5DZFA 1H1IA 4YVSB 4O7XA 4B1LA 1CIWA 5GZFA 2E63A 4XAAA 3AKRA 3FN9A 3HVDA 2ZMNA 2ZXQA 1PK6B 4ISQA 2PN5A 4JGYC 4LKSA 5JDBA 1AR72 2JDUA 2IXKA 4UOJA 3PUAA 2XOMA 1W9SA 2ZEYA 4XZPA 1QIQA 2HWB2 2VCCA 3JQXA 3ZXLA 1TQ5A 1POQA 5K7PA 3PVNA 2UWCA 2Y6FA 4HOOA 4AAPA 4EYUA 5L9RA 2I45A 1COV2 1QDCA 2QQVA 2RR11 2J7MA 2XVKA 2ZGLA 3I2KA 3K48A 3MBWA 4K1ZA 1DQ2A 1UU6A 1E5SA 2ENRA 5FMOL 3SH5A 3UK9A 5D8AC 2NP0A 3GDBA 2B46X 3P3PA 4WVVA 4LT5A 5J3UA 2WN2A 3IPVA 3OD4A 2A6VA 3AJYA 2WLQA 1RUI3 1AYN2 1D0HA 3IBMA 3M3EA 4BB3A 4IE6A 4JRLA 2R071 4L99A 4CDUA 4ZKTB 5BNOC 1T2XA 5F5AA 5FYSA 1UF2C 3USSA 5FKCA 4GXLA 3M4FA 1NCQB 4IEWA 4UFJA 2VL4A 1X8EA 4OFGA 2XJTA 4BK4A 1PZ8A 5L7OB 3POGA 2QJVA 3ZN4A 5FP8A 2JE8A 5L19A 2HLEA 5C6CA 2VBBA 4IEZA 3ZXDA 5I93A 4P9IA 5LA1A 5FO8B 4XFGA 2PELA 3KZ4C 3MIBA 5A33A 1Y3TA 2A70A 4TLFA 4LA2A 3RDIA 3A22A 2FZ2A 2GP3A 1QU0A 1W6NB 5A32B 2RS51 1JZ2A 2DCZA 2D3PA 4PF1A 3GJAA 5JPNB 1VBB3 4XF9A 3VZKA 1YYNA 5L36A 3MF6A 1CAXA 3BTXA 4NIGA 1PMIA 2R32A 1ND2C 3I59B 3K4AA 5B4NA 5KR7A 4OI0A 1N3PA 1QHDA 4AG4A 4YVSC 2C0ZA 2D44A 3I4IA 5FZ7A 3GZTB 1PK6C 1S0BA 1J3QA 2VD7A 3ACIA 2YC2A 1OQDA 3OCPA 4COUA 1CR7A 4IGOA 5CVRA 5IYYA 2NMOA 1ND3B 4MHUA 4UWDA 1OLME 2WNOA 1IPSA 5EJZB 5F1RA 3T30A 1RHI3 1O5LA 4IEPA 1R1A2 3KMHA 1YIFA 3VKLA 3OGSA 1O3SA 3DGTA 4ZY9A 2SLIA 2VM9A 4XUPA 1NCRA 1W3VA 3WNOA 2WZR1 5BY5A 3DPRB 4LO8A 4C91A 4NRQA 1U5IA 5F5IA 3ZVXA 3O1SA 1JH5A 3NV1A 4FPKA 4LORA 4XW3A 4QT6A 3WP3A 3ZN6B 5J37A 2QNKA 2Y60A 5FZMA 1G9FA 2ZABA 4AGVA 1AL0G 3BI3A 1FNZA 5H9QA 4XILA 4LLFA 1NCQC 2W94A 4YNIA 4KL1A 2CY6A 5L7OC 1XU2A 3DKWA 4CEWA 2VZRA 4OUEA 2RMU2 3UT0A 4YZ4A 5A7NA 2N7GA 5IVJA 1ULGA 1CZVA 1MQTA 1TME3 2OZJA 4XAEA 3OSDA 3CIHA 3TEYA 1O8SA 4BQ2A 4QPYA 1BVVA 5FZGA 3T2TA 3RG0A 2J1RA 4RFRB 5FZ9A 5FQ0B 3VBUA 4PI2A 1Q5OA 4NWWA 4PLOA 4QX7A 5ACA3 2GMPA 4RHV3 3S5AA 4ZU7A 4XTPA 5FXVA 3M3QA 5LBBA 4E4ZA 4D8MA 1NE6A 3AVRA 3IN9A 3U14A 3ZFGB 4BXFA 5HCBA 3AM2A 5C7GA 2BUKA 1V6IA 1YFWA 3RYPA 2EXJA 5BNPA 3BPZA 1LODA 3CQOA 1OFNA 1ND3C 4DPNA 5L9BA 1H30A 2RS33 2QKDA 3ST7A 4HPKA 4QM9A 1QQP1 3CKHA 1WCDJ 3AKQA 3B01A 5F6LB 4GMP1 2FMDA 3VHRA 2FBEA 1Q8PA 4FCAA 5KXDA 1Y4WA 1MEC3 2H0BA 3T4HB 2I74A 1OUSA 3DPRC 1CPMA 4IL7A 3AMNA 1XYPA 2GC0A 5C8CB 4H55A 1FXZA 1GMMA 2XKPA 3LCPA 5EXOA 2DUPA 4Q4X1 3E97A 1GUIA 2WRAA 4M0HA 1C28A 1UY1A 5FO7B 1FATA 4XHXA 1QH7A 2UWBA 3AYEA 1IHMA 4LBQA 4YZ3A 5A70A 1ZA4A 1IPJA 1EV13 2PHXA 3GHMA 1AXYA 2P4EA 4LXLA 2WO7A 5D21A 1GWKA 5FV3A 3WQ0A 1I3HA 3QCWA 3UJOA 4Q4Y1 2QZ2A 1LHUA 4LK6A 2CU5A 2CDOA 1EAH1 3R4SA 2XQRA 4NRMA 4YRDA 3V64A 4A6SA 4OULA 1XNAA 4HK8A 1FMD1 4ZHNA 3ZMOA 1UU4A 3E5QA 3B9IA 4OHXA 4Q4W1 4ZS3A 3U11A 3WY6A 5DMYA 1W9TA 2RE9A 2QQMA 2WS91 5EPAA 4BZ4A 2X53S 2L9LA 3AFGA 4LIVA 4TSVA 1UY0A 5EQUA 2CGPA 3DYPA 2BOIA 3AP9A 4IEQA 3W58A 4KBBA 4EN6B 1W6MB 3KT4A 5DDJ1 2VZQA 1W8WA 1UIKA 5I8SA 1RYYA 3J26N 2CWMA 3ZFGC 1WW4A 2GNBA 1AR92 2R6QA 2GZWA 4BQ5A 5H9RA 2JE9A 3LGRA 4COYA 5ABJA 1HB4A 5F3CA 4QPWA 1WBFA 5A3LA 2OT7A 3IDEA 4LEJA 1FV2A 4MXWB 3OGGA 4XFFA 1RUE2 4HSJA 1GOFA 2F17A 1J84A 3WW1A 2W46A 5LRSA 4FP3A 2E33A 4CYDA 1AX1A 1APNA 4LIUA 1RUC2 5LA9A 4GWJA 4BLIA 2R1BA 1PVC1 2R7EB 4IXLA 4V2VA 5DABA 4EWDA 2ZJCA 3AL5A 4J6GA 4B7KA 4CP2A 4M00A 1OQEA 1ZBA2 2D6KA 2E7AA 4QDQA 4Z82A 3WG3A 4OI4A 1RINA 5C8CC 2LS6A 3HR9A 3FHQA 3LZZA 4WVMB 1H0BA 3ZLIA 4RA0A 4UBHA 5LBFA 5B2GB 2TEPA 1LOAA 1XNCA 2ZGPA 1C8NA 3R6SA 3THCA 1QJX1 2Q1ZB 4FOWA 1G6NA 1W90A 2YROA 3R05A 4XJAA 5T54A 3ZO0B 2IXCA 4AOCA 3SC7X 4FXGB 3SEPA 4CU7A 1OVSA 2R043 3EQEA 5FZDA 4QHZA 3VBRB 2ZBJA 4NUBA 4EZ4A 2AEZA 4QXBA 5T5LA 3WCSA 5ISLA 3KVBA 3AMMA 3NV4A 4E8CA 2A6WA 2BEOA 2HWC2 3I3BA 3JD72 4LBMA 4LMFA 3HQXA 4N9IA 5JZGA 1NLRA 1OXCA 2DFCA 5FPBA 1GZCA 1NA1A 3KCXA 1UNBA 4OUSA 5FZ1A 3EB7A 3O0VA 1MS3A 4NPRA 4MX3A 2DBNA 1H9WA 3ALQA 4QQLA 2Y6HA 3RZGA 2KXLA 1MS8A 4QU1A 4JKKA 3GF6A 4YLZA 1Q3EA 2UYBA 4MV2A 1YQ5A 3DECA 4N7UA 1CAVB 2ZEWA 5FREA 2PHWA 4KQ7A 3WF0A 5FMDA 1NAEA 3VBSA 5F2SA 5EJ3A 1Y9QA 1LAJA 2ORXA 2XLFA 3H42B 4A7ZA 1JZ4A 1XC6A 3KS7A 1ONAA 4AHWA 4AEDB 4XIOA 2VE1A 1HXS2 5AC92 1UCXA 4COZA 1DCSA 1PNGA 2GN7A 5LB6A 5A80A 4INDA 5A6XA 2LUWA 3FMGA 3KF3A 1I5ZA 1RITA 5DAPA 3PVOA 3JBG1 3NNLA 1WA4A 1RUJ3 1UXZA 1RMU3 2JDZA 4RQPA 5JIAA 3KCCA 1QOOA 3I2DA 3ZYFA 3S0MA 2CGOA 1DQ5A 1LNSA 5SV5A 2KR2A 4CDXA 1JYWA 3T0AA 1W2UA 2EXIA 5FZ4A 4JKMA 4DXSA 5FJHA 1NYWA 3GBFA 4YW7A 2HH9A 3NKGA 2VVEA 4COVA 1BEV2 2A3YA 4GULA 4K20A 3LEMA 4OHWA 5FO9B 1R093 4BQYA 1W8TA 4N43B 2WZR3 3FUOA 1VP6A 2YB7A 5FBJA 3N4MA 2DFBA 5H9SA 3VBRC 3KVAA 2CWSA 1ULFA 4RS5B 2WDBA 4Y20A 1VRBA 4NPLA 1YFXA 2F6BA 1UIJA 1W06A 1JHNA 1NG0A 5HXVA 1GNZA 5FLJA 3ZXEA 3CHXA 3DEMA 2QQKA 2WQ4A 4YVWB 5K9YA 4XPVA 3THPA 1BXHA 4NO4A 2ARAA 2ZAHA 3POYA 1HRI3 2VTFA 4LHKA 1UY3A 1I6XA 2Y34A 4Q2FA 1SDDB 2YY1A 1NZCA 1ULCA 1VMFA 4QQ2A 2GP5A 1AYM1 1ZM1A 2PTMA 4UW6A 4GB31 1CN1A 5E1RA 5FZBA 4ATEA 3SCGA 2DVDA 4F3JA 3AC0A 5FPAA 4SLIA 2ZHMA 4Y1XA 5CZKA 4AEDC 2W92A 3LAGA 1DZTA 1O4TA 4XJ8A 5ERLA 2Y8KA 5LCWL 1QDOA 1RTVA 1O4ZA 2DDUA 1JU4A 3CL1A 5JOZA 1W28A 3ITQA 4YPJA 1US3A 2XONA 1X9TA 1GQHA 1YHFA 4BM8A 1W8NA 3OY8B 3H3ZA 1VBE2 1UD1A 3J9SA 4YZ1A 1LR5A 5JMOA 5C9AA 4BK5A 3OEAA 4H7LA 2JDMA 3MLLA 1LHOA 4PIXA 1SBEA 1G9DA 4P08A 1XPWA 4XDPA 2VNGA 4A42A 5K8SA 3MV01 4TTGA 1QQP3 2XGXA 3ZN5A 3ZYRA 4FTEA 3N7KA 3WW4A 4N43C 4WBBA 3WHTA 4C1WA 3RI9A 2ETEA 1LRHA 2QTWB 4XDQA 1M4WA 4HANA 1JYTA 2Q4SA 4RS5C 2XBO1 3LOBA 3OPTA 4QX2A 5CADA 2BPA2 2PQQA 1FX5A 1J1TA 1N1VA 2D6OX 2JG8B 2R062 3H8UA 1OT5A 4HVRA 4LKFA 1RVF1 3ZM8A 1IG0A 2YGLA 2BZDA 4YVWC 4UFIA 4NHXA 4GH4B 2VMFA 3ZPYA 3RWKX 2ZGSA 4Q4Y3 4PF5A 4R4ZA 1EAH3 1L7LA 2Z5WA 5LEKA 3B00A 5JXJA 5K0UB 4DRRA 1VAMA 2HWF2 4FTSA 1FMD3 2W52A 1RUH3 3H1WA 4RGAA 4Q4W3 4HETA 4OQ9A 3WP6A 2B45X 2WS93 4CP0A 4D6SA 2QDNA 4G4FA 1CJPA 1SBDA 1D4M2 1T6BX 3I2OA 1LOFA 1YIPA 2ZGMA 3OF1A 4ZS2A 5CYYA 3WG4A 5JCTA 3H7JA 2OZ6A 5C3PA 2LRPA 1OURA 4Q4V1 4R4XA 4EWAA 2FDHA 2K46A 4AVBA 1VALA 1IZ3A 3D0SA 1QKQA 4TWTA 5FZIA 2VJXA 4N53A 4IEOA 1EY2A 2Y6GA 3PLQA 1N1TA 2OW4A 3BODA 3HBZA 1OOPB 4QPGB 1YRZA 2RM22 2VMGA 3ZSJA 4B1MA 3H7YA 2VXRA 3NAPB 4DNYA 1H1AA 2D3RA 2VH9A 2YBKA 4HVOA 4JRAA 4XFCA 3RZHA 2WFF2 4IEUA 4LBJA 4OHVA 5I91A 3M70A 2AGSA 2VU9A 1C8M3 1QH6A 3N7JA 5DXDA 4IV1B 3O1PA 1YQ2A 4Q0UA 1AL23 4NIAA 1GOHA 3K77A 3TN93 1VBD2 3U07A 3ZIXA 5FY1A 2XH6A 2B42B 4HZFA 1RUI1 3SKJE 3RZMA 4AVTA 3PMSA 4EV0A 1IS5A 2BWAA 3FFQA 4G3YC 4QGNA 3T2QA 3VZLA 4UFLA 1LHVA 4MZUA 3MLKA 1LOCA 1ZRDA 3AZVA 2JX9A 3ECQA 4XUNA 2VVFA 2XUEA 4DIQA 4LOSA 1UPSA 2RJKA 2JG8C 2ZX4A 4LE3A 3POIA 2GC2A 3RQ0A 3DXUA 4LO7A 1UU5A 2VCMA 2FD8A 4GH4C 2FDIA 1CWPA 1XE0A 4UFMA 4AVAA 4PDWB 4YFZA 4DEVA 1AR82 3PMEA 4YYOA 4PQ9A 2A71A 1DLCA 5C33A 1W6OB 1ZYBA 5K0UC 5HCHA 3KV4A 5A7QA 1G86A 3PUSA 5FYCA 2JDPA 4YWAA 1E5RA 3AB0A 1VBB1 3A7QA 4JCKA 1LU1A 3MIFA 3VZNA 3DUIA 3QACA 5D2AA 3RJRA 4L9BA 3FBMA 1GQPA 4W6XA 3W5NA 2JECA 5A7WA 1DP0A 4AFBA 2Q8EA 1KEXA 2C1FA 3D5OA 1QY4A 1W3XA 2HWE3 2Y64A 2TUNA 2WJSA 3AZXA 1XYNA 2AEYA 3BYWA 1OOPC 3QD6A 3IDCB 4QPGC 3V56A 3HQRA 3PDQA 4QWNA 2VZUA 4EZHA 3MW4A 3NAPC 4B4QA 5LWBA 3VDCA 1NXD1 1RUF1 3CDZB 4MGQA 2DURA 5JI9A 1J1LA 3VL8A 2AZ5A 3W20A 2WNUA 1GZWA 3I2JA 2LW8A 4A6OA 5A3OA 4IV1C 2H6BA 4MGSA 2X5IB 2BGPA 1SPPB 2C6SA 3JBG3 2X8KA 2XG3A 4CE8A 5T5PA 4J1WA 1WD3A 4UF0B 4AHXA 1DGWA 1KGYA 2IXLA 5FLHA 4CEYB 1VBA2 3NRUA 4G9SB 3OYWB 3SKVA 2CNAA 3BB6A 3K75B 5FPZA 4EE2A 2W08A 2V5YA 2X29A 4LO6B 3U10A 4BQXA 3GZEA 3VBHB 5F3IA 4NIIA 3O5SA 1M06G 3NV2A 1OUXA 4EN0A 4PDWC 2VZTA 4BQ4A 3MUZ1 2OXBA 3PL0A 2JB4A 4AI1A 4URTA 2VECA 5EYXA 4F83A 5FY0A 3KCYA 2OPWA 5L73A 2C5DA 1HJFA 3ME2A 4Q0PA 2RJLA 1F4AA 1ULPA 4RHV1 2YC4A 4BOWA 2JJ6A 1TMF3 3ILFA 5A3NA 1GNHA 1UYPA 3RRDA 1RHI2 3V0BA 1C3HA 1VBC1 3AMQA 1S55A 2Q1FA 2VUAA 3DKQA 1OFSA 5FYMA 4YGDA 3Q8AA 3IZOA 3JXSA 2NM1A 3M1HA 1JOJA 1MVQA 1ZBE3 3T0DA 4BE3A 1AYM3 3HIFA 2B5HA 4RL7A 1B09A 4GB33 4QB6A 3U78A 5IT6A 2RS31 3WDYA 1HB2A 3MZHA 1K3IA 4NE9A 3HMYA 4XTMA 2QVSB 4CXWA 3PJYA 4JGZB 2VVDA 4N9HA 5FUNA 3ORJA 4Q8KA 5C3SA 2X5IC 2RDSA 5GKAC 3P5BA 1U0AA 2B39A 2PHDA 5J98B 1P8JA 3I49A 1SLIA 1KJLA 3O1VA 2RDQA 2YHJA 1NX9A 5HV0A 5KC6A 3GM8A 4JHZA 3IT8A 2WBKA 4BIOA 4CEYC 1TME2 4QPIB 1EV11 2VG9A 1MS0A 3TRSB 1LKNA 3PVBB 3T2OA 1XSRA 1QWRA 5C4WA 3SHRA 3LDBA 4W8JA 1HRV3 3VBHC 1C4RA 4W6WA 2AR6A 4OMCA 1YCIA 3OPZA 1DQ4A 2ZGTA 1Z7S2 1V6KA 3ZFEA 1V9U1 2VOVA 2YC0A 4YGEA 1DYKA 3MV11 3OB8A 1JXNA 2WZ8A 1UZWA 3ZX7A 1BMV1 1GNYA 1OBNA 4JZRA 3X29B 1RUD1 4MXVA 1CZSA 1OLQA 2P6CA 4F8AA 3MW3A 1LHNA 1PO12 1UL9A 1DIWA 3CEWA 5AVAA 3RMXA 3H8XA 3W59A 4CSWA 1JZ3A 4JC1A 4LHNA 2JKXA 3GCXA 4Q0QA 5BNNB 1R1ZA 3ES4A 3IIAA 5FUPA 3ZKYA 1W6PB 3FHIB 3N9NA 4RR3A 4QMAA 2VQUA 3DL3A 2ZX3A 3ZMNA 1ODMA 1Z0HA 2HWB1 2ZEXA 1MEC2 2BP6A 3MW2A 1COV1 2G9GA 1UYXA 1B35A 2VW2A 3BGAA 1WCUA 4GQ7A 4XETA 2WSUA 5CG9A 5IHRA 2ZX1A 1ODNA 4CDUB 1I5PA 3HWJA 1N3QA 5HPOA 1NT0A 5F3EA 1UN1A 2ZS6B 3MYXA 4JGYA 4Q4V3 1QGLA 2XMLA 3POWA 3SCFA 3RGBA 2MEV2 1VIWB 2DF7A 2P17A 1LEMA 4JGZC 2HWD2 5FZOA 3AP4A 5JSPA 2JDKA 2JICA 1U12A 1NLSA 5FK7A 2Y6KA 4MGKE 4WZFA 4BISA 5JXHA 1RL3A 4QXCA 5DG2A 2BNNA 4CPBA 3LWCA 2A1XA 5D8AA 4LLOA 4QPIC 1KFUL 2EXKA 3VB9A 4A2UA 1F15A 1KXGA 1UZYA 3T2PA 3G7DA 5CISA 3MFCA 5FMCA 4EWEA 2R041 4FI9A 1PMHX 2WQ8A 3DCQA 1HIXA 1Q8VA 2YU1A 3MIHA 4BQ3A 1ST8A 5FJKA 3PU3A 3EMRA 5J36A 4Y5TA 5CFDB 2WUHA 3ACGA 2JDYA 2PYTA 1UXXX 2XXZA 1CONA 1DGLA 3U37A 1X8MA 3QH6A 1W2NA 2C4XA 2Y6LA 2E6VA 3B3QE 2VQTA 4XF0A 4BQWA 1NLQA 2YG0A 3VDDA 1PX4A 4XJUA 4B4RA 5JXGA 4DOUA 3RWNA 3SH4A 5LBCA 4B29A 4Q1PA 3K46A 3I2HA 2GC1A 4AZZA 1SLTA 3HJRA 2XVGA 3E1F1 5BNNC 4IUGA 1NOVA 1LULA 4JQRA 4YM1A 2GU9A 5IATA 2WABA 4NN0A 3RYRA 5J7MA 1XOYA 3ZYPA 1BJQA 2ZCWA 5E88A 4DXZA 1H1MA 3R0RA 1IKQA 1AUYA 4LUKA 2GSYA 4GAZA 3AJZA 1U5XA 3WP5A 1KDKA 2DVAA 2JENA 4YVSA 4CDUC 5L9VA 1OLMA 5IWFA 4AEJA 2Q8CA 5IVBA 2Y38A 1PK6A 2RR12 4L2NA 1VPHA 1KDMA 3IAQA 1RUJ1 3CBNA 1RMU1 1JS9A 2I07B 3GYDA 3IMNA 3JUUA 4M3CF 4NMIA 4OI1A 3KT1A 2EIBA 3POBA 4KWKA 4NHKA 5JOYA 1OA4A 1CESA 5A1FA 1HV0A 4HMZA 5FYVA 2CHHA 1PX3A 4XURA 5FYBA 2ZMKA 1PVXA 2XB6C 1US2A 3PU8A 3NJXA 2R072 1C5HA 5DZGA 1E5HA 1PO23 1RUF3 1RXFA 2XR4A 5GALA 1WZXA 4AQ6A 1R091 5LA2A 2BFUL 1OQ1A 2P3JA 2O14A 2R1DA 2IXHA 1WMXA 3J8F3 1POV0 3C7OA 2RS13 3WDXA 2VCBA 4Y3OA 5IK8A 3ILNA 3KB5A 1V6OA 4QHBA 1OF3A 2ZGOA 3DV8A 2A5ZA 1MS9A 3E5UA 4R9BA 5CFDC 5CEHA 4XFHA 1FAYA 4PBPA 3I3MA 1VLNA 1GFF2 5L7OA 3KV9A 4KWLA 4XF1A 3KD4A 1A6CA 2CYFA 4O9GA 4KWJA 2IFRA 1S0DA 4HG6B 4QM8A 3SH3A 1REFA 2RS52 4JDNA 3VKOA 5KHJA 1X82A 1HRI1 5FZCA 3NW4A 1AR63 1SLAA 4XMIA 5DZEA 3WZ1A 1RC6A 2D93A 4CDQA 2DVFA 1GP5A 2SBAA 4QXKA 3ZR5A 4ZU5A 2ZACA 3POEA 1W6NA 5A32A 2D6MA 2WLPA 4QX3A 1HN0A 4FAGA 1WMDA 4AI0A 1O6UA 2WQZC 1JZ6A 4ZXKA 3I59A 1QJU3 4JKLA 5JOXA 4FFIA 1XU1A 2CAUA 4MGZE 2V72A 4QQHA 5IK5A 3CO2A 2WT2A 4QGLA 2W2IA 4LBQB 3J7HA 5JMCA 3ROUA 3O1RA 1DYOA 3PVEA 5I0DA 1VBC3 1SFYA 2EIDA 5JUVA 2WSVA 4PHZA 4CUGA 4CDWB 3USUB 3T1MA 2WAAA 2WZR2 2ZEZA 1QOTA 4BA6A 4GALA 2BNMA 2ET1A 2LALA 5J1XA 1D7PM 4FOVA 5DUWA 5FYZA 5KXEA 1W04A 5HI0A 3VGIA 4EN8B 4IE0A 2DV9A 1DGWX 1UWWA 4DINB 3DPRA 4JDOA 5FZAA 1OA2A 5FZ3A 4L0PA 4BYYA 1CIYA 3KSCA 4AGRA 2IC1A 3MUY1 1O5UA 2E9QA 3PURA 3WNNA 3ZN6A 5KHGA 1FI2A 1U5ZA 4XJWA 3ZSMA 4D0QA 2DYCA 1S0JA 1JOPA 5DQ0A 1K45A 3J7NA 3WG1A 2K9ZA 3AKSA 2Y6JA 4HLTA 4M3CB 4IV3B 4UYBA 3ZYGA 4ZZ5A 2A6XA 3RZLA 1W6QB 1DHKB 2VGDA 3ZR6A 1JHJA 5LA0A 1X33A 3CJIB 1WUVA 4Q1RA 3WF4A 3ENRA 4YW4A 3VZOA 4BXSV 1V9U3 4MLOA 2D5FA 1RUH1 1BLZA 3BOPA 5GM0A 1R083 5C5TA 5B4XA 5KXBA 3IWZA 3M3IA 4WV8A 2HKXA 4UFKA 1S0IA 2OVUA 5FXXA 2QQWA 5FQ0A 1RUD3 3I7DA 1CVNA 2BWCA 3OGJA 4Y26A 3LE0A 3EJKA 1RUC1 2H6CA 5F2WA 5GLZA 3O1UA 2OYZA 2QQOA 2WC2A 3WINE 5GLUA 1ZBA1 3ZFGA 5I0RA 1XE8A 4LK7A 1AR73 2CAVA 2WT1A 3NNMA 4K8FA 4C0HA 2HYKA 4WM8B 2WO3A 1QQP2 3WVJA 4CDWC 4JX0A 2HWB3 4TN7A 5EP9A 4P9GA 2YYOA 5CNAA 4FFFA 1G9AA 1KS5A 1COV3 2WA3A 2VOTA 4MOAA 3RJ2X 4BWOA 5JZGB 1C8M1 2ZAAA 4PQQA 4JTNA 4Q4X2 4O61A 1AL21 4QB2A 2ZKLA 4ITCA 4K40A 3F95A 1LGNA 3TN91 3O1MA 1RUG1 1UX6A 2J1TA 3AZYA 4RFT0 1VE0A 4C8DA 3R4UA 2XJSA 1ZA7A 1EAH2 3C2UA 3HOBA 4C90A 3DYMA 1WGPA 1UZ0A 1V6NA 3VBSB 4P9LA 3O0XA 1ASJ2 4LBLA 2VO5A 4IV3C 2WS92 4CU8A 1UOJA 2CL2A 1F9KA 2J1SA 3EYPA 4FQZA 1JYNA 2PHFA 1ZZ9A 1ZZBA 4HT1T 3LEKA 4Y4YA 2VCAA 4FQ4A 3CJIC 3THTA 4L92A 3BKZA 2CGNA 1XNTA 1JU3A 3NWKA 1OH4A 3N9MA 3GZUC 5DDJ2 5T5OA 2C26A 5FYIA 1CPNA 1AHSA 1F35A 2WAOA 1W9YA 4DUWA 4QDRA 1NZIA 1JI6A 3BU0A 2J1VA 4JAAA 3H3UA 4NAOA 2VNRA 4RD7A 2O8QA 1FOD2 4RQPB 1W6MA 4I3GA 2B4KA 3WQBA 5TSWA 1QOSA 5FYYA 1HV1A 1JOBA 3EO6A 3HNBM 1W2AX 2GNTA 4O9EA 3U4SA 4NVPA 3NMBA 4MG2A 2HWE1 1FT9A 1W03A 4H7MA 1WLWA 4WM8C 2X05A 4E8DA 4HKWA 3MICA 3VUOA 1PVC2 3M7AA 1S0CA 1UQXA 2YDEA 4FPYA 4MXWA 1J83A 2RG4A 3Q8BA 4GA9A 4HL0A 4K6BA 2QQUA 4IGPA 4QU2A 1R1A3 4Y20B 4S2DA 4MGTA 1NXMA 3WP4A 5A3PA 3K4DA 5JZGC 1FYUA 2VW1A 3N3HA 4W50A 2PLV1 2PA7A 5IUQA 4CPBD 1I9RA 4HSLA 5FPLA 5C8WA 4LULA 1QJX2 1OPOA 2VW0A 1E57A 3LFMA 3W5MA 2C24A 3GNEA 1J59A 2X09A 4WVMA 3UGGA 5C3QA 3BTZA 3HQUA 1LENA 4CZSA 2ZGUA 3OBAA 5GZCA 5LEJA 3KWVA 4CXYA 3MDPA 2VZSA 4I02A 4O65A 1RUNA 3VBSC 3WDTA 2WWUA 3AP5A 4CCCA 2P3YA 2WZEA 4QDSA 1OC1A 3WW3A 2P5BA 3VBRA 2AACA 2RMU3 4L97A 2QQLA 3SMHA 3WF1A 4Z92B 1UMZA 2QZ3A 2IZWA 2WYSA 3BU7A 1NY72 2NLRA 4DQAA 4AR2A 3H8OA 2HJIA 4AYUA 3ES1A 3WOGA 3L2YA 1GWMA 3KGLA 2RDRA 5F32A 2NYYA 3ZYHA 4A4AA 4FPCA 3SLIA 4QAWA 2D7FA 4RQPC 1TMF1 3ZFFA 1POV3 4DUVA 2YGMA 1JODA 5IJRA 3WG2A 5JAXA 2D43A 1KD7A 3ZPOA 4A7YA 2ZGRA 1CAVA 3T3YA 2BJSA 1W8HA 3FX3A 4B7EA 4DXRA 1W8UA 2AC1A 3LPFA 5JWPA 5F8PA 1K5MB 3LIHA 5FR3A 1ZBE1 1LHWA 4AXOA 1WCQA 1XRUA 5FZEA 1QXJA 2FZ1A 2Q1MA 2W1QA 3RSJA 4HK9A 4LQRA 1N3OA 5FKBA 4AQTA 3N36A 1STMA 4PLNA 4P9WA 3DXTA 2ATFA 5FMOS 3WF2A 3BVCA 3FUQA 1IGOA 2IWGB 3H1YA 1REEA 2DBIA 3HT2A 4XXAA 3D6EA 3SITA 3G6JB 1H9PA 2G1MA 2D98A 3OUHA 4CRQA 4DRVA 4LA3A 3TNQA 1ULDA 2D6PA 4FPEA 1XNKA 2GALA 5D1IA 3APBA 4A3XA 4YARA 3JU9A 3T08A 3NNFA 2D5HA 2R061 5FZHA 5FY8A 1XE7A 2G9FA 5AVPA 3H0OA 2VMHA 4HFSA 5DAQA 2Q0AA 4FOYA 3E6CC 3LKJA 1WLTA 5A6QA 1IPKA 2J1AA 2RJ2A 2YZ4A 1BHGA 5CFCB 4XCAA 2H0VA 1IS3A 2PFWA 4XUTA 1IKPA 1DBNA 3NJZA 2VMEA 3IM0A 4N43A 2VY0A 1HRV1 5BV6A 2A3XA 3BTAA 4UAPA 4Y33A 4XOGA 3RFRA 4K3UA 2HWF1 5BXXA 4LHSA 4RS5A 3VD4A 1EUUA 2XJVA 4XBQA 4C1XA 3O7OA 4WZCA 5E16A 1IG3A 3OD0A 4CCKA 5APAA 4LHLA 4Q0SA 1D0GA 4FOQA 4XXPA 2C9KA 5A3UA 2QBXA 3ZYIB 3N7MA 1BBT1 4OYUA 1AYM2 4GB32 2GN3A 4F7ZA 5GZEA 3HD8B 4BJ0A 4XBLA 4LTAA 3MLJA 4SBVA 2EA7A 4N90A 3PIJA 2W87A 4BH9A 1F31A 4XFBA 2DUOA 1VMHA 2BTVC 4OMDA 1K5MC 3SISA 5FP9A 4Y22B 2OIIA 3N9QA 4P14A 5G05L 5A7OA 3CU7A 1PZ7A 1XYOA 3E6BA 3LEIA 3V0AA 1AVBA 2PQSA 1OKQA 1RUE3 1UY2A 3ABZA 4CP9B 3GZAA 3S7EA 2XKOA 1RUC3 2UURA 3AZZA 4XJZA 2PMWB 3MF9A 4FAHA 3IDAA 5FFOC 3LA7A 4NWVA 2Y33A 3OY8A 4OCTA 1D2SA 5G04L 3CF6E 1ZBA3 4BMBA 4P02B 2P6HA 4R9CA 3UL2A 1VAKA 1ZZ6A 2JDHA 2ZZJA 3PIGA 2WNVB 1PIV2 1VRH1 4W4ZA 5FY5A 3DN7A 5EJ1B 1RJ7A 3FWEA 4PLMA 2XBO2 5CFCC 1MS4A 4GIQA 1AR81 1ENSA 2A7AA 1UYZA 1LB2A 4QX8A 4E2QA 1EYBA 1RVF2 4UW4A 2WL1A 3VKFC 1RUG3 3UJQA 5BPXA 3JD73 4FSJA 3VLBB 2BGOA 1O3RA 1YNAA 1ULOA 1DQ1A 3H50A 3NKTA 1XJAA 5LATA 3RNSA 3K2OA 3ZDSA 4KMQA 4Q8LA 4A41A 3TWIA 4E2GA 1LOGA 3R4DB 3T1LA 2ZHKA 4CUCA 1ZX5A 2JD4A 4BCUA 1UZZA 1YXWA 4GH4A 4QGMA 3VBOB 4DZGA 1S2BA 3SXWA 4B3NA 2VNVA 4AHYA 5FZFA 5FUIA 4Y24A 1H2LA 2W68A 5EWSA 3KT7A 4Q4V2 4BHPA 4ASKA 1BCXA 2KD7A 5FLIA 5AC93 1XNDA 1AX2A 1H2NA 2ADDA 3O0WA 5E8AA 1GP6A 2E53A 4K9SA 1QJFA 3ZXGA 5FMBA 1DYPA 4LUMA 3TEWA 1LOBA 1OOPA 1CQ9A 2HEYF 5A3TA 4ZZ8A 3NAPA 1YEWA 3ATGA 4RGGA 1SMVA 4K21A 3POFA 3W9AA 5LY1A 1O3TA 3E6DA 1RUI2 2WNVC 3KV6A 4LKDA 4UXAA 1QMJA 3AP6A 2BV4A 2MHFA 1PO21 1JYIA 2WO1A 4CA9A 3K4ZA 1GANA 2Y0IA 2PLV3 3VKMA 4FTBA 3C7EA 1EUTA 1TE1B 3J8F1 2RS11 5I0TA 2GMMA 1GQGA 4AW7A 4PT6A 4D7YA 3TBDA 5FY9A 5FPUA 1Q43A 2DTYA 4B4PA 1REDA 1O3QA 3ZIWA 4NJ4A 1QJY1 3BOWA 3GGLA 4LO4B 2G4IA 5GZDA 2J42A 2YFUA 4XQ4A 4OZOA 3VBOC 1QXPA 1WKYA 2WYFA 3KQRA 4N8MA 4PDWA 1OMIA 2BNOA 1VBB2 1AR61 3VBFB 5DAVA 2BQPA 2W47A 1I1EA 4NHYA 3J4UH 5IW0A 4P00B 2Q30A 2R0FA 1MZEA 1SACA 4LO5B 3IIIA 5DG1A 1H6YA 1QJU1 5M0TA 2C9AA 4ES8A 1CAUB 1CD3G 3Q9OA 5FXWA 2ZA9A 4I3PA 1HW5A 4R9DA 2AREA 4A44A 4ORFA 1DU3D 2JE7A 2PHTA 3VD5A 2YU2A 1NQJA 2AENA 2P34A 5FOJB 3RZJA 3WCRA 1HDKA 5C4WB 1VBE3 1C5IA 1JYVA 4HKLA 4YW5A 4M01A 4OZXA 1H4GA 4Q0VA 2EIEA 3CNAA 4N7IA 1W9WA 3OBTA 1S2EA 1JN2P 3WW2A 4Q26A 3AXEA 4XFAA 2OS2A 2ZOEB 3N35A 3LSDA 2PHLA 2X5IA 3O1TA 1S0EA 2JD9A 4OHYA 1Z7S1 2LM3A 4W65A 4P9XA 4AEKA 1SPPA 2JIJA 2VTXJ 4GJZA 3S6PA 4LKEA 4AFMA 5J96B 2QUOA 5GJ6A 4E2SA 3TB0A 4UF0A 1HJGA 4XUOA 3M3CA 1PGL1 4CEYA 4UI9L 2BU9A 2R063 3H9AA 4RGKA 5I0UA 1SQ4A 4WM7B 1MPXA 3RS6A 4BPZA 1JMUB 3VBHA 4DXTA 2XQXA 4IESA 1JBCA 2ARXA 2EXHA 1AXKA 3ASIA 5E89A 4X6QB 2EIGA 3LA3A 1G8WA 3VZJA 4CCOA 1FPN1 3O12A 1N1YA 2GH8A 4RHV2 5ANNA 3VBFC 5ACA2 2HWF3 1H8TB 3HEIA 5DUUA 4OHZA 1R081 1VBC2 2O1QA 4Q27A 1C1FA 5CKNA 1S1AA 3HT1A 1EPWA 1ZZ8A 1PGL2 2D97A 2P1BA 4UW3A 1BBT3 5LBEA 5C3RA 2XVLA 2R16A 3MFAA 1KITA 4MHRA 5JPMB 4Z8BA 2RS32 5IK7A 2JG9A 1Y7BA 1AR71 1LJ7A 3ACFA 4HKOA 4KI5M 3H8RA 1PGW2 2CDPA 3S5QA 5C4WC 5FYHA 4AI9A 4JVAA 3ILRA 4DUXA 4P5YA 1ZRFA 1ACCA 2AH2A 4GKYA 3KHBA 1BKZA 1FNYA 4X8NA 3IPVB 1WW7A 3H3LA 4K7JA 4Q29A 4BDVB 2BW8A 2Z79A 3DYOA 3J7MA 1AJOA 1W99A 1WWYA 3BPSA 3MIEA 2BRTA 4LITA 2BGCA 1DZRA 3NNGA 3U0ZA 1EV12 4ARXA 4OVEA 3VDDB 3A21A 1AYN1 3WQ1A 2IVJA 2QQPA 3FC0A 5DN2A 3HAGA 1GSLA 2WO2A 1MS5A 2HEWF 4QPIA 3PUHA 1GR3A 4B8EA 5BUVA 1V6LA 4ASMB 1A34A 2F4PA 1VRH3 2YPJA 4Y5SA 2W1UA 5A33B 1AF9A 4WM7C 1XXNA 4MH0E 2FDJA 3D4KA 1W8FA 3JB8A 3LEGA 1BMV2 1RUD2 1WLDA 3NSTA 1S0GA 3NQHA 1AR83 1A8MA 3SEEA 3C7GA 4QKDA 1CAXB 1JYCA 4IE5A 5BNOA 4ARYA 4YM0A 1CGPA 1H8TC 3AX4A 3LA2A 3VD7A 1OVPA 4XQWA 4Z1VA 2X10A 5CKQA 1T6GC 3HNMA 4GWNA 3C7HA 3EBRA 5F7UA 4TZDA 2VULA 4XDOA 3O1OA 3KGZA 3S30A 3BUCA 4IETA 5KWRA 2DCJA 3WNKA 5BNNA 1TZOA 5DUXA 1W6PA 4EROA 5IFPA 3AZWA 3MO4A 5FPVA 4KH9A 2YUEA 2Q5TA 5A3WA 4UBGA 2LTNA 2UY8A 5HCFA 3FLPA 1F5JA 1WW6A 3JCIA 3WQ7A 1GWLA 3ELNA 1CAWA 1MZFA 1NCRB 2ZHLA 4M4RA 3BTYA 1ZREA 1R64A 4BQ1A 1S0FA 4AI8A 2PAKA 1A8DA 2YBPA 2JIGA 1HQNA 2DVGA 1R1A1 3AL6A 2F4LA 1ND2A 2VBDA 4DY3A 5I8TA 2JDNA 2V4VA 3N9LA 1ZNPA 1GLHA 1V00A 3QBQA 4XQDA 4UT5A 4AFDA 1GZTA 4YG6A 1ENXA 4AI3A 2VOKA 3FZ3A 1H6XA 3PHMA 3BCWA 4MO3M 2FQPA 3VZMA 3VDDC 2XJPA 4CVUA 5A7SA 2R042 4XABA 3JQWA 4CEWB 1PMJX 3HPNA 1VBA3 2BOJA 5IAVA 1Q56A 3WF3A 4I09A 4CDQB 1LCLA 5A1AA 2UYAA 1MQTB 2VQAA 5JVVA 2VPVA 2KM2A 1OHFA 4NR1A 4DS0A 2AYHA 3GBWA 5EZWA 1DQ0A 2RMU1 3T09A 1ZVFA 3OUIA 5CKMA 3VBUB 3WDWA 2BBVA 3PUIA 2ES3A 5CFDA 3I3QA 3BN6A 4FXKB 3OGRA 4QKBA 5DAWA 1VB4A 2E7QA 5CG8A 1J3RA 3ZSKA 5GLVA 1SCSA 1V0AA 3FJSA 1IS6A 1AXZA 1NCQA 1E5IA
chains in the Genus database with same CATH topology
3AXDA 4J1XA 1QJY3 5JR7B 3SCHA 1POV1 1MR5A 5BNPB 1OA3A 2BVVA 1YI7A 2GMEA 4AVVA 4AVCA 3CLPA 4MGIE 5FTTC 4XF4A 5KC5A 4HPKB 1G7YA 1QXRA 3AK0A 1TNRA 2MPFA 5EYYA 1NCRC 2WINB 5GLWA 1DQ6A 1RUJ2 4I2OA 1RMU2 3QLQA 4QQPA 1X50A 2UU8A 1JUIA 1F2NA 1BK1A 1GV9A 4I01A 4D7TA 1SCRA 1X36A 2E7TA 5KXCA 4Y1UA 2E51A 1HX6A 4MGYE 1DGRN 1PZ9A 4DY5A 3HN1A 4FBFA 3WXPA 1R092 3I54A 3B94A 1ND3A 3MI8A 4XHBA 3ZSLA 2DVBA 4CEWC 4D3WA 1SEFA 5CAZA 3WDVA 4ISRA 4CDQC 1MQTC 3K51A 3GBGA 3WNXA 1W0PA 4NHMA 1Z7S3 3VHPA 3M8LA 1H2KA 3VBUC 4YW1A 2GAUA 4XEZA 1EP0A 5LK5A 1HRI2 2OUJA 3D0JA 1DDLA 4Z07A 4I0WB 4K1YA 4R52A 1PO13 3RPQA 4GMP0 4W6YA 3E5XA 5ABJB 1SLCA 4KG8A 2JKBA 5BNPC 2UY9A 1Z78A 1PM7A 3PTYA 3UKVA 1AR91 1G9BA 1FPN3 4FPLA 1WBLA 2VOXA 3KLSA 1KS4A 4S2FA 4YGBA 1RUE1 3H1MA 2TNFA 1A3KA 1SLBA 2MEV3 4PJYA 4CDWA 2ZTNA 4YZ2A 2HWD3 3USUA 3A0KA 4LBKA 2Z2SB 1PNFA 4YSFA 2XJRA 4R9AA 3OBRA 5F5QA 3TAYA 5J48A 1ASJ1 3QH7A 2I2SA 1TEIA 3ACLA 1HLCA 4ES9A 1NA1B 5FOBB 5KHKA 1UKRA 3PJQA 3ZXFA 1F8VA 5C8CA 1AYN3 4BMEA 2HWC1 5IK4A 1YJLA 3CJXA 3JD71 2UWAA 1MS1A 3JB4C 4Q4Y2 1O4YA 5HCAA 4R8HA 2K0GA 2CTVA 4Z2WA 2V73A 4KG0A 1FOD1 1SDWA 4M3CA 4EJRA 4IV3A 1FMD2 3WT3A 1RUH2 1VAVA 1W6QA 2PAEA 3AYCA 4Q4W2 4ATFA 5ABJC 4YG0A 1S2KA 3AYAA 1NE4A 1OSGA 3CJIA 5CIRA 2OPKA 2EVXA 3OJBA 1AX0A 3KM5A 2DU1A 2XL9A 2DCTA 4M3CE 1SBFA 4E4SA 2DCYA 5KHIA 2GNMA 1Q8QA 3NVCA 1HXS1 5AC91 5J7MA 4JV4A 3SNMA 4XBNA 1VJ2A 4AK3A 2P3IA 1Y43B 4CDXB 2VUJA 1D4VB 1YWKA 2RR13 1YFUA 4WM8A 1KQRA 1C8M2 4Y1ZA 4AVSA 5FPXA 5J09A 4YM3A 2EAAA 1AL22 1SLLA 5CBLA 5BYNA 1GKBA 2DUQA 3TN92 1RUG2 2WNEA 1H8VA 4YFWA 3IDBB 1Q8SA 2R073 1BEV1 1BYHA 4AQ2A 1OPMA 4TYSA 2ZX0A 3B93A 4IERA 4KNCA 1NA1C 4FO9A 3UKNA 1NY71 2PHUA 1WCKA 1DG6A 2B9UA 2QDRA 5LK7B 1RUOA 3ZFFB 1JUHA 1A78A 4Y1YA 4AHZA 3POSA 2P3KA 4MVTA 2ZZQA 1G9CA 2NPIA 1N47A 4OLLA 3LOIA 4EN9B 2W0XA 2BYVE 4XIKA 4WVWA 3M2MA 2XPJA 2NZ9A 2RS53 2A75A 2YV8A 2DCKA 2QE3A 2XWJB 1KRIA 2XUMA 2ZPXA 3ZYJB 3AMPA 2VOWA 1YO8A 5JSRA 2XL7A 3FE5A 4HBNA 5H9PA 4A7KA 4OI2A 2D6LX 2HWE2 3A0NA 3WR0A 4CTEA 1WD4A 3ZXKA 5C9AB 1YLLA 1YFYA 3FLRA 4GKXA 3P3NA 5FDBA 2OUHA 3WV6A 4CDXC 3L2HA 3WDUA 1HQLA 3IKWA 2YMZA 1VBE1 5I8YA 1V6JA 4C0BA 1TNFA 2PLV2 3NO8A 4XJ9A 5F6KA 1C1LA 4AEDA 2OA2A 1O91A 3JBG2 4P9JA 1URXA 2EF6A 4U36A 5I0SA 3GHNA 4IEVA 3BALA 2MNGA 1RGSA 1KFXL 4JTOA 1N1SA 1MVEA 3AKTA 1RB8G 4HN1A 3AFKA 1CJDA 4X6RB 4I0BA 3GALA 4QX5A 1UKGA 5I0RA 3ZFFC 1VR3A 5LRRA 2HEVF 3TNPB 1YI9A 1RJ8A 5BNQA 2ZGNA 2NMNA 4AI2A 5FAXA 2JEMA 3B02A 1PGSA 4FPFA 2XJUA 1AZDA 2GNDA 1ZRCA 3V0AB 3VHNA 3WUDA 1W0OA 2JXAA 1TMF2 4LNVA 4S2HA 2A6ZA 3BIWE 1H2MA 1L3JA 2A3WA 2A6YA 2XLGA 1BQPA 1D4M1 4N53B 1SFNA 3MEPA 2ZHNA 4XFIA 4P9YA 1DF0A 4YVWA 1ZBE2 1LOEA 2WZPP 2Q8OA 3TOJA 5C9AC 1C57A 4EN7B 4AGGA 1K5MA 2BVBA 2FHRA 2RM21 4QD2A 3VN4A 1AR93 5SV8A 4GMP3 2K2SA 1UPIA 4FP2A 2ERFA 2Z42A 1PIV1 4Y1VA 2QCSB 2WFF1 3ETQA 2TBVA 3VV1A 1LTEA 4Q4X3 1YJKA 4LE4A 2VMIA 4ONUA 2ZX2A 3VL9A 1VBD1 2BFUS 1NQDA 4M0NA 1XQNA 4LBNA 1KJRA 2ZGKA 3M3OA 1BVP1 3WX5A 1HRV2 2XHKA 1EPZA 1OD5A 4YGCA 4FT8A 1XNBA 4PBOA 4MYEA 3UV9A 3AMHA 5CFCA 1ASJ3 4AQSA 4LR4A 4D94A 2Y26A 3JZVA 4KU8A 1BBT2 4QQOA 4D69A 3C3VA 1LOFC 5CU1A 2D3SA 4IQPA 5DDJ3 2FMYA 1QNWA 2HWC3 1H4HA 4IEYA 4COWA 5FRAA 3URFA 4ZU4A 2JG8A 2ZKNA 1AJKA 4YW2A 4N53C 3WUCA 1FOD3 1MZ5A 4KGGA 1MZ6A 2AUYA 1WMEA 3MPBA 3UKTA 3D82A 1U5YA 1ZZCA 2PAMA 1BZWA 2DWRA 1WCSA 5DUVA 3I8TA 3VHOA 1ZRRA 3B69A 5K0UA 4S2GA 4Y22A 4LBQD 3O14A 4YRDA 2WNUB 1GZWB 4META 5T55A 1PVC3 5T5JA 4AEMA 1F5FA 3FLTA 5EFUA 2O0OA 2O8OA 1QJZA 4E27A 1HXS3 1W39A 3MPPG 4WVZA 5A3MA 2KA3A 3INAA 1VRH2 3WD5A 3ZSEA 5FCCA 4E9KA 1QJX3 3B9CA 4P5HA 3N7LA 5KBFA 4QPGA 4I0AA 1V6MA 4JDMA 4FPGA 2R30A 1VBA1 2WNVA 5GLTA 1LEDA 4XF3A 1MACA 4OUMA 4Y5Z0 1DLLA 4IV1A 2A73B 2Z69A 4AE2A 1BEV3 1LECA 4FPJA 2NQYA 3ZXJA 5JLVA 1HQWA 4PIZA 2ARBA 4PIYA 1UAIA 4ASLA 1V70A 3RYKA 4XE9A 1OI6A 3FFZA 2VQ0A 3EHKA 3V0BB 5JIUA 3MIGA 1D2QA 1ENRA 4LBOA 1IOAA 2EALA 4MSVA 1RIRA 3VBOA 4NOTA 4L8QA 1RHI1 3V65A 5HBAA 4KGQA 2GC3A 5T3NA 3RI8A 1VB2A 3LSEA 1LU2A 3WHUA 1GBGA 1ZZ7A 2Y0OA 1W6OA 4YG3A 2QFEA 2WNUC 3WLUA 1YUDA 3AYDA 3RZZA 2P37A 5T50A 2ILMA 1QNYA 3B7MA 3OTFA 2PHRA 1QF3A 4NHLA 4U2AA 1PO22 1RUF2 2VNOA 3S7IA 3PNAA 4FPHA 4AFCA 1TME1 4D7SA 3J8F2 3ZFEB 2RS12 5JOWA 2P2KA 2ZMLA 1WW5A 4BLJA 5ACA1 1JTZX 1QJY2 3DF0A 1FV3A 4UW5A 3VKNA 4FVVA 3TYJA 2JG9B 1AR62 2XWBB 2IXJA 2XJQA 3OYWA 4RR3B 1PO11 4MUVA 1J58A 2ET7A 4H14A 5EV7A 2WKKA 2XLAA 5CB7A 3MIDA 2D40A 2IXIA 2R0HA 3VBFA 1B35B 3AP7A 1PGW1 4BIFA 1WLCA 1QJU2 2ZGQA 3B5LB 4YZ5A 1DFQA 2B8MA 1MEC1 1LESA 1UW8A 3U4XA 4JGYB 4HVQA 2V09A 4FPOB 2R49A 2W39A 3L9JT 3NV3A 4AWDA 4HN0A 2NN8A 5FBZA 1D4M3 2IFWA 1CAUA 4PCRA 2GDFA 2GH2A 3A4UA 5JI7A 1CX4A 1JW6A 2MEV1 1Q8OA 1WMFA 2HWD1 3FBYA 5D8AB 4DMIA 3D8CA 1DGRA 5CA6A 1IQAA 4V1PA 2RM23 2EAKA 1LGBA 1IS4A 1O7FA 2RHPA 3EXUA 4GWMA 4AFAA 3QOPA 5JSOA 1PIV3 4YW3A 1LGCA 5BNOB 2WT0A 1GICA 2DU0A 2WFF3 1DZQA 3ZFEC 1PGL2 5KHHA 2XBO3 4CP1A 5AFBA 5T52A 1ULEA 4DB5A 4KU7A 2WA4A 1ALYA 5AFEA 4XYXA 4JGZA 4I30A 4L11A 1ENQA 1RVF3 1GZ9A 1VBD3 3ZXAC 4XMAA 1GYKA 1PHMA 3AKPA 4X8PA 3RMYA 4IEXA 2B7YA 4WM7A 1FPN2 2D6NA 2JG9C 4E4DX 5GZGA 4RR3C 2WIIB 1V9U2 2CV6A 3LB9A 1CAWB 2WWSA 1OLRA 1X7NA 1R082 2DTWA 4RSUA 4DFSA 2WFPA 1HKDA 4AF9A 3NL1A 1ND2B 1B35C 4H3WA 1H8TA 2YXSA 3MGUA 4YM2A 1J3PA 5DZFA 1H1IA 4YVSB 1CIWA 5GZFA 2E63A 3AKRA 2ZMNA 1PK6B 4ISQA 2PN5A 4JGYC 5JDBA 1AR72 2IXKA 4XZPA 2HWB2 3JQXA 3ZXLA 1TQ5A 5K7PA 3PVNA 2UWCA 2I45A 1COV2 1QDCA 2RR11 5F9TA 2ZGLA 2XVKA 3K48A 4K1ZA 5KWRA 1DQ2A 1UU6A 2ENRA 5FMOL 3SH5A 3UK9A 2NP0A 5D8AC 4WVVA 2B46X 3P3PA 4LT5A 5J3UA 3IPVA 3OD4A 2A6VA 3AJYA 2WLQA 1RUI3 1AYN2 1D0HA 3IBMA 3M3EA 5BNOC 4JRLA 4L99A 2R071 4CDUA 4ZKTB 1UF2C 3USSA 4GXLA 3M4FA 1NCQB 4IEWA 1X8EA 4OFGA 2XJTA 1PZ8A 5L7OB 2QJVA 3ZN4A 5L19A 5C6CA 4IEZA 3ZXDA 5I93A 4P9IA 5FO8B 4XFGA 2PELA 3KZ4C 3MIBA 5A33A 1Y3TA 2A70A 4TLFA 4LA2A 3RDIA 2FZ2A 5A32B 1QU0A 1W6NB 2RS51 2DCZA 2D3PA 5JPNB 1VBB3 4XF9A 3VZKA 1YYNA 5L36A 3MF6A 1CAXA 1PMIA 2R32A 1ND2C 3I59B 4OI0A 1N3PA 1QHDA 4AG4A 4YVSC 2C0ZA 2D44A 3I4IA 3GZTB 1PK6C 1S0BA 1J3QA 1OQDA 3OCPA 4COUA 1CR7A 5CVRA 2NMOA 1ND3B 5F1RA 1RHI3 1O5LA 4IEPA 1R1A2 3KMHA 1YIFA 3VKLA 1O3SA 3DGTA 2SLIA 1NCRA 2WZR1 5BY5A 3DPRB 4LO8A 4C91A 1U5IA 3ZVXA 1JH5A 3NV1A 4FPKA 4XW3A 4QT6A 3WP3A 3ZN6B 5J37A 2QNKA 1G9FA 2ZABA 4AGVA 1AL0G 1FNZA 5H9QA 4XILA 4LLFA 1NCQC 4YNIA 4KL1A 2CY6A 5L7OC 1XU2A 3DKWA 4CEWA 2RMU2 4YZ4A 2N7GA 1ULGA 1MQTA 1TME3 2OZJA 4QPYA 1BVVA 3T2TA 3RG0A 5FQ0B 3VBUA 1Q5OA 4NWWA 4PLOA 5ACA3 2GMPA 4RHV3 4ZU7A 4XTPA 3M3QA 4E4ZA 1NE6A 3IN9A 3ZFGB 5HCBA 3AM2A 2BUKA 1V6IA 1YFWA 3RYPA 2EXJA 5BNPA 3BPZA 1LODA 1OFNA 1ND3C 4DPNA 1H30A 2RS33 2QKDA 3ST7A 4HPKA 4QM9A 1QQP1 1WCDJ 3AKQA 3B01A 5F6LB 4GMP1 2FMDA 3VHRA 1Q8PA 2FBEA 4FCAA 5KXDA 1MEC3 2H0BA 2I74A 3DPRC 1CPMA 4IL7A 3AMNA 1XYPA 2GC0A 5C8CB 4H55A 1FXZA 3LCPA 2XKPA 5EXOA 2DUPA 4Q4X1 3E97A 4M0HA 5FO7B 1C28A 1FATA 4XHXA 1QH7A 2UWBA 3AYEA 1IHMA 4LBQA 4YZ3A 1ZA4A 1IPJA 1EV13 2PHXA 3GHMA 1AXYA 3WQ0A 1I3HA 3QCWA 3UJOA 4Q4Y1 2QZ2A 1LHUA 1EAH1 3R4SA 3V64A 4OULA 4HK8A 1FMD1 3ZMOA 1UU4A 3E5QA 3B9IA 4OHXA 4Q4W1 3U11A 3WY6A 2RE9A 2WS91 4BZ4A 2X53S 3AFGA 4TSVA 2CGPA 4IEQA 3AP9A 3W58A 4KBBA 4EN6B 1W6MB 3KT4A 5DDJ1 1UIKA 5I8SA 3J26N 2CWMA 3ZFGC 1WW4A 2GNBA 1AR92 2R6QA 2GZWA 5H9RA 2JE9A 3LGRA 4COYA 5ABJA 1WBFA 5A3LA 3IDEA 4LEJA 1FV2A 4MXWB 3OGGA 4XFFA 1RUE2 4HSJA 5LRSA 3WW1A 4FP3A 4CYDA 1AX1A 1APNA 1RUC2 1NCQA 4BLIA 2R1BA 1PVC1 4IXLA 4EWDA 2ZJCA 4J6GA 4B7KA 4CP2A 4M00A 1OQEA 1ZBA2 2D6KA 2E7AA 4Z82A 3WG3A 4OI4A 1RINA 5C8CC 3HR9A 3LZZA 4WVMB 1H0BA 4RA0A 4UBHA 5B2GB 2TEPA 1LOAA 1XNCA 2ZGPA 1C8NA 3R6SA 1QJX1 2Q1ZB 4FOWA 1G6NA 3R05A 2YROA 4XJAA 5T54A 3ZO0B 2IXCA 4FXGB 2R043 3EQEA 3VBRB 2ZBJA 3WCSA 5T5LA 3AMMA 3NV4A 2A6WA 2BEOA 2HWC2 4LBMA 3JD72 4N9IA 5JZGA 3HQXA 1NLRA 2DFCA 1GZCA 1NA1A 3KCXA 4OUSA 3O0VA 1MS3A 4NPRA 4MX3A 1H9WA 3ALQA 4QQLA 2KXLA 1MS8A 3GF6A 4YLZA 1Q3EA 2UYBA 4MV2A 4N7UA 1CAVB 5FREA 2PHWA 4KQ7A 3VBSA 5EJ3A 1Y9QA 2XLFA 4A7ZA 3KS7A 1ONAA 4AHWA 4AEDB 4XIOA 1HXS2 5AC92 1UCXA 4COZA 1PNGA 2GN7A 4INDA 2LUWA 3FMGA 1I5ZA 1RITA 3PVOA 3JBG1 1WA4A 1RUJ3 1RMU3 2JDZA 4RQPA 5JIAA 3KCCA 1QOOA 3I2DA 3S0MA 2CGOA 1DQ5A 4CDXA 5SV5A 1W2UA 2EXIA 1NYWA 3GBFA 3NKGA 2VVEA 4COVA 1BEV2 2A3YA 4GULA 4K20A 4OHWA 5FO9B 1R093 4N43B 3N4MA 2WZR3 3FUOA 1VP6A 2DFBA 5H9SA 3VBRC 2CWSA 1ULFA 4RS5B 4Y20A 1YFXA 2F6BA 1UIJA 1JHNA 1NG0A 5HXVA 1GNZA 5FLJA 3ZXEA 4YVWB 2WQ4A 4XPVA 3THPA 1BXHA 4NO4A 2ZAHA 3POYA 1HRI3 4LHKA 1I6XA 4Q2FA 2YY1A 1NZCA 1ULCA 4QQ2A 1AYM1 1ZM1A 2PTMA 4UW6A 4GB31 1CN1A 5E1RA 4ATEA 3SCGA 2DVDA 4F3JA 4SLIA 2ZHMA 4Y1XA 4AEDC 3LAGA 1DZTA 1O4TA 4XJ8A 1QDOA 1RTVA 1O4ZA 3CL1A 5JOZA 1GQHA 1YHFA 4BM8A 3OY8B 3H3ZA 1VBE2 1UD1A 3J9SA 4YZ1A 1LR5A 5C9AA 4H7LA 3MLLA 1LHOA 4PIXA 1SBEA 1G9DA 2VNGA 5K8SA 1QQP3 2XGXA 3ZN5A 3ZYRA 4FTEA 3N7KA 3WW4A 4N43C 4WBBA 3WHTA 4C1WA 3RI9A 2ETEA 1LRHA 4XDQA 1M4WA 4HANA 2Q4SA 4RS5C 2XBO1 3LOBA 5CADA 2BPA2 2PQQA 1FX5A 1J1TA 1N1VA 2D6OX 2JG8B 2R062 3H8UA 4HVRA 1RVF1 2YGLA 4YVWC 4GH4B 3ZPYA 2ZGSA 4Q4Y3 4PF5A 4R4ZA 1EAH3 2Z5WA 5LEKA 3B00A 5K0UB 4DRRA 1VAMA 2HWF2 4FTSA 1FMD3 2W52A 1RUH3 3H1WA 4RGAA 4Q4W3 4HETA 3WP6A 2B45X 2WS93 4CP0A 2QDNA 4G4FA 1CJPA 1SBDA 1D4M2 1LOFA 1YIPA 2ZGMA 3OF1A 3WG4A 5JCTA 3H7JA 2OZ6A 4Q4V1 4R4XA 4EWAA 4AVBA 1VALA 1IZ3A 3D0SA 1QKQA 4TWTA 4N53A 4IEOA 1EY2A 3PLQA 1N1TA 2OW4A 3BODA 3HBZA 1OOPB 4QPGB 1YRZA 2RM22 2VMGA 3ZSJA 3H7YA 2VXRA 3NAPB 4DNYA 1H1AA 2D3RA 2VH9A 4HVOA 4XFCA 4JRAA 2WFF2 4IEUA 4LBJA 4OHVA 5I91A 3M70A 2AGSA 2VU9A 1C8M3 1QH6A 3N7JA 5DXDA 4IV1B 4Q0UA 1AL23 3TN93 1VBD2 3U07A 3ZIXA 2XH6A 2B42B 4HZFA 1RUI1 4AVTA 3PMSA 4EV0A 1IS5A 2BWAA 3FFQA 4G3YC 4QGNA 3VZLA 1LHVA 4MZUA 3MLKA 1LOCA 1ZRDA 3AZVA 2JX9A 3ECQA 2VVFA 1UPSA 2RJKA 2JG8C 2ZX4A 4LE3A 2GC2A 3RQ0A 4LO7A 1UU5A 4GH4C 4AVAA 4PDWB 4YFZA 1AR82 3PMEA 4YYOA 4PQ9A 2A71A 5C33A 1W6OB 1ZYBA 5K0UC 1G86A 3AB0A 1VBB1 4JCKA 3VZNA 1LU1A 3MIFA 3DUIA 3QACA 3RJRA 4L9BA 3FBMA 4W6XA 2JECA 4AFBA 2C1FA 3D5OA 1QY4A 3R4DB 2HWE3 3QD6A 2TUNA 2WJSA 3AZXA 1XYNA 1OOPC 4QPGC 3IDCB 3V56A 3MW4A 3NAPC 4B4QA 1NXD1 1RUF1 5JI9A 2DURA 1J1LA 3VL8A 2AZ5A