1XRUA

Crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
281
structure length
281
Chain Sequence
GSAMDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDTGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVAVKEIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
publication title The crystal structure of 5-keto-4-deoxyuronate isomerase from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 72
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 5.3.1.17: 5-dehydro-4-deoxy-D-glucuronate isomerase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04962 KduI KduI/IolB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xruA02
2.60.120.520 Mainly Beta Sandwich Jelly Rolls pectin degrading enzyme 5-keto 4- deoxyuronate isomerase, domain 1 1xruA01
1DGRA 1ZX5A 4K8FA 1ZZ9A 3RYPA 4IERA 4KU8A 4IEVA 1UIKA 5K8SA 3NW4A 3H7YA 4IEPA 2BNMA 4QGLA 4WZCA 1YFXA 4LTAA 4META 5JSPA 5J7MA 1XE8A 3M3IA 3H1YA 1TQ5A 3EBRA 4J1XA 5FLJA 4I02A 1CAUB 1SFNA 2OA2A 4LUKA 1CAUA 1LKNA 1G6NA 1O3RA 2WC2A 1CGPA 3H8UA 2CAVA 4I09A 4YYOA 4XFBA 2UYAA 1YUDA 4QM8A 3SMHA 2ET7A 3E97A 1FI2A 4ONUA 4O9GA 1FT9A 4H7LA 2Z69A 4Q29A 3H1WA 1UD1A 3WW1A 4DINB 4D7SA 4ZU7A 4CYDA 4HVOA 4XF0A 3SCHA 4UXAA 1IPJA 3GYDA 3FHIB 3OF1A 1ZREA 2GU9A 2OPKA 1O3SA 5JR7B 2D5FA 3I54A 1ZZCA 4I01A 1CX4A 2GC0A 2XLFA 4UBHA 3CLPA 3E6DA 4R52A 4HBNA 1IPKA 1DZRA 5I0TA 3R6SA 4HSJA 5E1RA 3CEWA 3D0SA 1L3JA 4UBGA 4ZU5A 4WVZA 2CV6A 5JCTA 4NVPA 1Q3EA 4IETA 3WW3A 1RGSA 2XKPA 2DCTA 4IEYA 1QWRA 3HIFA 2QDRA 3MDPA 1YFUA 3EHKA 4E2SA 4HVRA 4OLLA 5AVPA 3FFQA 5FPXA 3UKVA 5FLHA 4YNIA 2GC1A 5HI0A 2QCSB 1J3QA 1J1LA 1RTVA 2GC3A 2XLGA 4P9GA 1VR3A 1JUHA 2PAMA 4EROA 4XFAA 3BCWA 1O4TA 4XF4A 3DV8A 4JVAA 1Y3TA 3UKNA 3LA3A 1NE4A 4KWLA 2IXLA 5JSOA 3NVCA 4IEWA 1I6XA 4YRDA 2BEOA 2E9QA 4PIYA 3H3UA 4OFGA 3FJSA 3GBFA 2CAUA 4B29A 5I0RA 1Y9QA 4N9IA 3IIAA 2PHDA 4HN0A 1RUOA 3BU7A 2PQQA 5KHGA 5BPXA 5KHHA 3EO6A 2UY9A 2PAKA 5KHKA 3TNPB 4E2QA 3RZZA 3I59B 3I59A 5FLIA 1UPIA 3NL1A 2H6BA 4HLTA 2ET1A 4I0BA 3FX3A 1EYBA 3ACLA 1YHFA 2ATFA 4BHPA 2OZJA 3WW2A 4EWEA 4MX3A 3QACA 4YARA 4PJYA 2N7GA 2VQAA 1LR5A 1YWKA 4N9HA 1ZZBA 5JAXA 1RUNA 4Z07A 4IEZA 2XL9A 3M70A 3IDBB 2GAUA 1YLLA 5FPZA 4LLOA 2EVXA 4Q0PA 3B02A 1UCXA 2QVSB 3ZDSA 4PIXA 4D7TA 1ZZ7A 1OMIA 3BALA 4QGNA 2WFPA 1DZTA 3JZVA 4Q0VA 4IEXA 3RDIA 3HQXA 5I91A 5BY5A 2MPFA 3OD0A 4Q0SA 2QJVA 2B5HA 1O7FA 1NYWA 3ROUA 4WBBA 2F4PA 2Y0OA 4QMAA 3RYKA 2HKXA 3LOIA 2PHLA 4Q0UA 2H0VA 4BYYA 5F1RA 5CU1A 2IXHA 3KGZA 2IXCA 2IC1A 5I93A 1OFNA 2H6CA 4I2OA 4FT8A 3O14A 1H1MA 4RD7A 5I8SA 1XE7A 4QM9A 1DGWA 4XF3A 2PFWA 1X8MA 3LAGA 4HSLA 5I0SA 2EAAA 3UKTA 3U0ZA 4AQ2A 3LZZA 4AQ6A 1ZVFA 2K9ZA 2P17A 3WW4A 4MGKE 1CAVB 1CAVA 1CAWB 1CAWA 1ZZ6A 3EQEA 5KBFA 4I3PA 2FQPA 3FE5A 3PNAA 3OTFA 3S7EA 3KCCA 2K0GA 1WA4A 5I0UA 3HT2A 4IEOA 3DN7A 1QXJA 1QXRA 3VHRA 3OGJA 4XFCA 1J58A 1Q43A 2C0ZA 3KSCA 2XGXA 3ST7A 3BB6A 5JSRA 4QGMA 1UW8A 3E5UA 3H1MA 4XEZA 3LA7A 4YSFA 5CADA 4XF9A 4MGZE 4PIZA 1WGPA 3L2HA 3HT1A 5LRRA 2VECA 3CO2A 3EJKA 4XF1A 3SXWA 1I5ZA 4EWDA 1HW5A 4GULA 1ZRRA 4ORFA 4BH9A 1O3TA 4JTNA 1QY4A 2GC2A 1ZZ8A 1OD5A 1J59A 4AVAA 2GZWA 4HMZA 2D5HA 3H9AA 4BIFA 1GQHA 2HJIA 3QOPA 5I8TA 3LWCA 1O5UA 5FCCA 5FDBA 4EWAA 2BYVE 2XL7A 3ES4A 4LA2A 4QXKA 5D1IA 2XHKA 2Q1ZB 2MHFA 3H7JA 5LEKA 4LEJA 1CAXB 1U12A 1CAXA 2Q4SA 2XLAA 1RC6A 5C6CA 1LB2A 5CVRA 4AVBA 2OYZA 5BV6A 2BGCA 4MH0E 1SQ4A 4HZFA 5KHJA 3ETQA 5EFUA 4F7ZA 4MZUA 5J48A 4J1WA 4I0AA 1J3PA 3FWEA 3RNSA 4MGIE 3H50A 3MYXA 1OI6A 2CGPA 3PVBB 3NJZA 2D93A 2PYTA 4LA3A 3RYRA 3N4MA 4HN1A 1SEFA 4QX5A 2UYBA 4JV4A 1X7NA 2KXLA 3C3VA 2FMYA 3ES1A 2O1QA 5I8YA 4KWJA 3SCFA 1FXZA 3NSTA 3DKWA 5T3NA 2XKOA 4MUVA 1NXMA 4F8AA 3USSA 2QNKA 2MNGA 1YFYA 5EZWA 4IESA 2UY8A 3ELNA 2BNNA 2GH2A 3S0MA 4IEQA 1O5LA 4IEUA 3IDCB 1LRHA 3LA2A 5C8WA 4FBFA 5LEJA 1X82A 3E6BA 1ZRCA 2VPVA 1ZNPA 1PMIA 3TNQA 4A2UA 3KGLA 4FAHA 1ZRFA 2O8QA 1X8EA 4Z82A 4Q0QA 2Q30A 3CF6E 2OZ6A 4KL1A 1Q5OA 4ZU4A 4X6RB 3IWZA 5FQ0B 1V70A 5FQ0A 1WLTA 4AVCA 3G7DA 1GQGA 1YFWA 2Q0AA 1EPZA 2ZCWA 4XFFA 1J3RA 1EP0A 3E5XA 4L2NA 4LUMA 3U10A 3E5QA 3D0JA 2Z2SB 3CJXA 3CL1A 2EA7A 2I45A 5BXXA 3D82A 4JTOA 2IXIA 3MZHA 1RL3A 4O9EA 1PM7A 3PLQA 4TLFA 5BUVA 4E2GA 2BNOA 2PAEA 1VJ2A 5J3UA 3RPQA 2V09A 4MV2A 3U11A 4AXOA 2PTMA 2B9UA 1XRUA 1UIJA 3NKTA 3S7IA 3SCGA 1O3QA 4KWKA 2PA7A 5E16A 2ETEA 3BPZA 2IXJA 3DL3A 3IBMA 1ZRDA 4KU7A 3OCPA 1NE6A 1H1IA 2D40A 3I7DA 3H3ZA 4FAGA 4LULA 1VP6A 4X6QB 3FZ3A 1EY2A 4L11A 4XFIA 3E6CC 2ZKLA 4XETA 4R8HA 5LRSA 3MPBA 4HVQA 5KHIA 3KMHA 2IXKA 1NZCA 4XFGA 2B8MA 4MGYE 4XFHA 4EV0A 3SHRA
chains in the Genus database with same CATH superfamily
4FPKA 4K8FA 2C26A 4IERA 4KU8A 2XPJA 4QT6A 1GNYA 1GICA 4TXWA 1XNBA 1HQLA 1VMHA 4NAOA 4XBNA 5FZ6A 5CB7A 4QU1A 2WQZC 3ZDVA 4RGGA 4LTAA 3HMYA 4TN7A 4C0BA 5J7MA 1TME1 5K7PA 4CUBA 3N3HA 4LO8A 3TN91 1PK6C 2HYXA 2JDMA 4Y33A 1V9U2 3DUIA 1PO13 1ULPA 3AYEA 3EBRA 3H8RA 3VHPA 4AI8A 3CJIB 1CAUB 2ZOEB 3AXDA 3CJIA 1CAUA 2FHRA 5LBCA 3T2TA 3VZJA 4AQTA 4B1MA 5A1FA 2VULA 4FPHA 4XTMA 5FY9A 1EAH3 1QXPA 4WVWA 1XU2A 3MICA 3KVAA 4LBQD 3BIWE 3GCXA 1K45A 4LK7A 1RUD3 3HNBM 2Y6HA 2R0HA 4R4XA 2E51A 4XFBA 2CYFA 4XJAA 4MOAA 4CP0A 4CDUA 3VDBA 2VW2A 2GSYA 1ALYA 4ZXEA 1N1SA 2WO3A 4DMIA 1DQ6A 1YNAA 1REDA 2BERA 1JZ4A 3I8TA 2E26A 2K46A 3J9SA 4O9GA 4QPIB 1S4CA 4QPIA 1C5HA 2Z69A 3H1WA 4Q29A 2AEYA 3NNMA 4FVVA 4ZU7A 4B8EA 4CYDA 4AFAA 4QHOA 3EYPA 3FHIB 4M00A 2VW1A 2WNEA 2D6PA 2VMIA 3H0OA 2XJTA 3DYPA 4RQPC 2NM1A 2VCAA 1WMEA 1CQ9A 5EHDA 1UN1A 1AR62 4FQZA 1VAMA 2XJPA 2P3KA 1S0IA 4YM2A 2P1BA 4CCDA 2XQXA 2CGOA 3SH3A 3PMEA 4R52A 2YB7A 1ZM1A 3I2OA 3Q8BA 2HWF1 5DMYA 1KFXL 2DCJA 3PL0A 1HRI3 5EJZB 4BJ0A 3N9OA 4IE0A 1ENRA 2PLV1 1C8M3 1L3JA 4TYSA 4UBGA 5FFOC 2OVUA 3CNAA 3WEZA 3ZFFB 4ASLA 3ZFFA 1G9FA 4Z1VA 1GNHA 5JCTA 3ZM8A 1Q3EA 3B9IA 4WM7A 4IE6A 5F5AA 1AR93 4LKFA 2QUOA 4YVSB 1QWRA 4P08A 4YVSA 2OT7A 1GZTA 3HIFA 3PURA 2B7YA 3IPVB 1Y43B 3IPVA 4N53C 3I2HA 1SCSA 4A7YA 1W03A 1W04A 2NQYA 1XXNA 2ZEYA 3M3OA 4E2SA 3KHBA 4QHZA 2R0FA 3POJA 4OLLA 5AVPA 4Y1ZA 4M0HA 4YW3A 1V6KA 5CFCB 4GIQA 5FLHA 5CFCA 1U0AA 3ACHA 1H6YA 4QQ2A 1SLAA 4D3WA 2YMZA 5FK7A 4BQXA 2QQOA 4GB32 3T0DA 2VNRA 4HFSA 2YGMA 3WHUA 1RTVA 2RE9A 3Q8AA 5FP8A 4ES9A 2PAMA 4NHYA 5FYBA 1UKGA 4XFAA 3TB0A 3BOPA 1RUF2 1GZ9A 4UW6A 4XDOA 5G04L 5LA1A 1VBC1 3U75A 4BQ1A 3R4DB 4XDQA 1H8TC 3IZOA 3RI8A 3LCPA 2EALA 4AZZA 1BHGA 3NVCA 1I6XA 4LKSA 1M06G 1UY2A 4AGRA 2RS52 1D2QA 4AI1A 1UYYA 3PIGA 4OFGA 4QDQA 3KQRA 1WLWA 2YG0A 1HQNA 4B29A 3AMHA 3IIAA 2PHDA 2OQ6A 3OSDA 4FSJA 5BPXA 2AR6A 2ZMNA 3T2QA 3I3EA 2YC4A 3IB3A 4K6BA 5KHKA 4RS5C 4KQ7A 1GFF2 4GAZA 1UPIA 2D43A 2YPJA 1SLBA 5T5PA 3FX3A 4IGQA 3EXUA 4E4SA 5FYSA 3PUHA 3ZYGA 2BU9A 1FYUA 1SLTA 5BNPB 2PELA 2A6ZA 4CTEA 5BNPA 4P9XA 5HPOA 3WZ1A 1OVSA 1D4M3 1PM4A 1AR83 4LOSA 3WD5A 4DRRA 3ZN6B 4XXPA 3ZN6A 5GZCA 3WW2A 5FXVA 3A21A 4EWEA 2ZGSA 3VHNA 3K77A 2W5FA 2BJSA 4OVEA 4CDUC 1RJ7A 3MIFA 4JHTA 2VTXJ 1J83A 1PVC2 1VE0A 2TNFA 1XPWA 4Q4X3 5F8PA 5IVFA 2VOKA 1Q8OA 2VZRA 1A34A 3FLRA 2FDIA 4ES8A 2N7GA 1W28A 2CGNA 4I0WB 4OQ9A 2DFBA 1ZZBA 1ULFA 1X36A 2D3RA 5JVVA 1OSGA 4Z07A 1XSQA 5JAXA 1RUNA 3MLKA 3VBUB 3VBUA 3H42B 1Q8QA 2W1SA 2A3YA 3A23A 2WABA 5DAVA 4ASMB 3GZTB 1OF4A 2GAUA 2ZGQA 2HWB1 1JYXA 4TTGA 3WNXA 1UCXA 2Y34A 4CP2A 5JMOA 1XBFA 3NV3A 3J7HA 4P9WA 2QKDA 2DUPA 4P9LA 1KFUL 3BALA 4XCBA 2WFPA 4HK8A 2XJSA 4IW3A 5GLUA 2DWRA 3RJ2X 3IAPA 3WUCA 2LW8A 3ZXGA 4DXTA 1DG6A 2OQ7A 3M3CA 4FXGB 5KR7A 2DVGA 1ULGA 2YXSA 3LSEA 5KC5A 2B5HA 2W2IA 3HVDA 3OGGA 2YBKA 1LHNA 5F7UA 4O65A 4PI0A 1KDKA 1OKQA 2E7TA 4A3XA 4QMAA 4XMIA 3RYKA 4WM7C 4MO3M 4R9DA 2H0VA 3C2UA 5F1RA 1BEV2 3POIA 2VTXA 1N3OA 1OVPA 2C5DA 5AC91 4U36A 1C1LA 1OFNA 3NO8A 3B94A 4ITCA 5EPAA 3THTA 2ZGMA 5HCFA 4ISQA 1Y7BA 5J37A 4AG4A 1CWPA 4UI9L 2JDPA 3OEAA 2BDRA 4NPRA 5HBAA 1R1A1 2GMPA 1X8MA 4CU7A 5BNQA 2UU8A 2B4KA 4AQ2A 1MS0A 1YJLA 1ZVFA 4NMIA 1GANA 2W1WA 4W6YA 3W9AA 4YGDA 1DQ2A 1UMHA 2RR11 3BOWA 1W2UA 1W6MB 1HRV1 3ENRA 1W6MA 5D8AA 5D8AB 3ZSEA 3WDTA 1NCQC 4CDXB 1QOTA 1WCKA 4CDXA 5HCAA 5ISLA 1Z78A 4Q4Y1 5K4LA 3WXPA 3KV5A 1XU1A 3P3PA 3C7HA 4I3PA 3WX5A 2J1RA 1ENXA 3MIDA 2D7FA 1ASJ1 1HV1A 4BK4A 2X10A 2XOMA 1NAEA 2QTWB 2DF7A 3VZMA 1HB4A 3WP6A 4MGTA 1WA6X 4RHV2 1XNCA 5C4WB 5C4WA 4XJ9A 4Q27A 2K0GA 4NIAA 2GMMA 4IEOA 5LA2A 1LCLA 3DN7A 4AL9A 3OGJA 2HH9A 1WBLA 1DYKA 3T4HB 1JH5A 1Q43A 1SG3A 1WD3A 1WD4A 5IFTA 3RZJA 5CAZA 4XACA 2XWBB 1D2SA 1RUC1 2WSVA 3H1MA 5DPNA 4CEWC 1ULOA 3LA7A 4GD4A 5FBJA 4YSFA 3V56A 1MS4A 3D8CA 2A73B 4PIZA 3HNYM 2WS93 2V5DA 3L2HA 5BNPC 5LRRA 1PGL2 2VECA 3MI8A 4MHRA 3EJKA 2NMNA 2PLV2 3SNMA 2VBBA 5CG9A 3K48A 3R4UA 2BWAA 4GULA 1VBD2 1W2TA 3LDRA 5K0UC 2DBNA 4GH4B 4RYDA 2Y26A 1O3TA 4GH4A 2X53S 5A70A 3KVBA 4AVAA 4HMZA 4OI4A 3N7JA 3H9AA 1CGPA 2BGPA 2CDPA 1BK1A 4FQ4A 1IZ3A 2DUQA 4W8JA 3APBA 1AUYA 2RM21 1UZYA 3JB4C 2RV9A 5C5UA 2XL7A 2JIJA 3ES4A 4BMEA 5C5TA 4HXCA 2XHKA 1REFA 5J09A 4RGKA 4GWNA 5LEKA 3NNLA 3C8XA 3THCA 2IVIB 2Q4SA 2QQVA 5C6CA 3RZMA 1OC1A 1RVF3 3H3LA 5CEHA 5L19A 3WQ0A 1O8PA 1Z7S2 1XQNA 3RWNA 4ISRA 3JCIA 3RMXA 4K3UA 2R32A 4MH0E 2Y0IA 3M4FA 4M0NA 2ARBA 1RMU3 2ZTNA 4DZGA 5CFDA 5CFDB 3IDAA 3VBSC 1QOSA 2VZPA 5C3OA 3JBG2 1H1AA 4J1WA 4XJ8A 4GKXA 1AR71 4ZY9A 4I0AA 4W50A 5IVJA 1J3PA 4AEJA 3PU3A 2BGOA 2UURA 4PF1A 2GDFA 2XMLA 3NJZA 1UOBA 2C9KA 4R9CA 4G4FA 1KD7A 4CXXA 4JV4A 4CDWB 5FPUA 4HK9A 4CDWA 5J1XA 3P6BA 1STMA 1AVBA 3C3VA 3MW2A 5E8AA 2E32A 5FP9A 1PHMA 4Q2FA 2W52A 4A6OA 2J1SA 2O1QA 1PO21 1UZZA 5I8YA 2BZDA 1QJX3 4LBQB 4P00B 4XZUG 4LBQA 1JHJA 1ONAA 3ACGA 4GJZA 1WLCA 1MQTB 4C91A 2XUMA 1MQTA 1MS1A 2C1FA 3ZN4A 3USSA 2R062 2QNKA 2UWCA 1PGW1 1YFYA 2MNGA 3BYWA 3POYA 3PVEA 4CDXC 5HXMA 3GBWA 1PX4A 1WCUA 1YQ2A 2BRTA 2W1QA 1LJ7A 3OYWB 4JC1A 1MZ5A 3OYWA 5FUNA 3S0MA 4JKLA 2AACA 3FMGA 1LGBA 1O5LA 2BBVA 2FCTA 2V4VA 4CCJA 1RUE2 5C8WA 1OKOA 1NA1C 5FY8A 4JDNA 5LEJA 4H55A 4LO6B 1V6JA 2WJSA 3B9CA 1TVGA 2LUWA 2OPWA 2VJXA 1S0DA 1S2KA 5FZOB 5T5OA 5JOZA 5JWPA 5FZOA 5AC93 1LHWA 5DUXA 4NIDA 4UW5A 4DUWA 2D98A 4Z8BA 2MEV3 3O0VA 2ZEWA 2HWB2 3HPNA 2I74A 2OZ6A 5ABJB 4LBKA 4UAPA 5ABJA 5KXDA 4MYEA 4FTEA 4ZU4A 4YG6A 3IWZA 4IUGA 4GJYA 3PMSA 1SBFA 2ZGNA 2VUCA 4LJHA 1BMV2 3AMNA 1EP0A 3WG2A 3GJBA 4LHLA 2WR9A 4LUMA 4AGVA 4Q4V1 3D3AA 3T3YA 4CCEA 2IZWA 2Z2SB 4LK6A 3AKPA 3T1MA 3AP5A 3CDZB 5FZGA 2DCZA 2RS12 2EA7A 2I45A 1RXFA 2JG9B 2VY0A 2JG9A 1BBT2 5KXCA 3H8OA 3MZHA 5LZ6A 1RL3A 1CIYA 5DDJ2 4O9EA 2D3SA 5C3PA 1DLCA 3ILNA 3WDYA 2ZMLA 3DF0A 1AYM1 1DLLA 4HOOA 3T1LA 2I07B 4IXLA 1RIRA 5FZFA 3RPQA 3KV9A 4E8CA 3MBWA 3U11A 5LBEA 2W46A 2HWE3 3O1RA 2Q8DA 4OHZA 2A6VA 1DQ4A 1NG0A 1XRUA 1UIJA 4HKWA 3S7IA 4QXHA 3RZGA 4LE3A 1HIXA 3ZFEB 3I49A 3ZFEA 1KXGA 1RUG3 3ZYFA 2PA7A 5GALA 1X50A 1L7LA 5J96B 4YFZA 1S0FA 5ACA1 1VRH2 3BPZA 1ZRDA 3HQUA 1GNZA 1FOD1 2O8OA 1HRV2 3ZMNA 1AF9A 3TWIA 4CCNA 2G9ZA 3I3BA 1H1IA 4OQ8A 3H3ZA 1UMZA 5HV0A 1FX5A 4LULA 5F2WA 2CNAA 1TE1B 4AFBA 4AR2A 2WSUA 5JIUA 2RS33 3P3NA 5CFDC 4FP3A 1ASJ2 4XFIA 1JYWA 4AYUA 5EJ3A 4FTSA 4XFGA 4NIHA 2V72A 1F4AA 4LKDA 3GHNA 1RUH2 4QX3A 1TEIA 2WKKA 1UOJA 3ME2A 2Z5WA 1PO11 4EV0A 4UFHA 4K21A 3PVOA 1DGRA 1ZX5A 1UOGA 1WMDA 1Q56A 4V1PA 3NV2A 1UIKA 1EAH1 2BFUL 4IEVA 4CUAA 3SH4A 1Z0HA 1RUD1 2PXJA 1MR5A 1WW7A 1S0JA 1O4YA 5IHRA 2Y60A 2WWUA 1LODA 1DHKB 4AGGA 1HLCA 5C3SA 4AF9A 1UMIA 4YVWB 5JSPA 4ZONA 3S5AA 4YVWA 2ZHMA 3VLBB 4OMCA 1RITA 1OT5A 1GQPA 3FLPA 2ZZJA 4J1XA 3BGAA 1AXYA 1ST8A 4AEDC 1FMD3 5FLJA 4JKKA 4LUKA 3O1SA 3A4UA 1HJGA 3PIJA 5J36A 3VL9A 1AL22 3HAGA 1GZCA 3FN9A 4XUTA 3SITA 3H8UA 4LXLA 4I09A 4BU2A 3KV6A 1QJY3 3UJOA 4LNVA 3WG3A 5IK5A 1YRZA 2XDVA 1YUDA 2YFZA 5B4XA 2WLQA 3M7AA 4UFIA 5F5QA 4FTBA 1SMVA 1PK6B 1OQEA 2HEYF 4P02B 1PK6A 1LOAA 3HEIA 4XC9A 3V65A 2J1AA 3K4AA 4ONUA 2RM22 4H7LA 2VNOA 1FV3A 4DINB 5LB6A 1NQDA 1UD1A 1W8FA 3OBAA 1HRI1 1YQ5A 2AZ5A 2BVVA 3B7MA 4D7SA 4QPWA 4HVOA 4XF0A 2R7EB 1IPJA 3C7FA 3GYDA 5LY2A 3VD3A 1C8M1 2GALA 3VD9A 2OPKA 4FPFA 4Y1VA 1O3SA 5JR7B 2D5FA 4W4ZA 2KA3A 4U2AA 4XBLA 3I54A 1KJRA 2C6SA 2VZ3A 2X09A 1IQDC 1ZZCA 1W9WA 1JZ5A 4LIVA 1SBEA 4C1XA 2JB8A 1XSRA 3E6DA 1LNSA 5L9RA 5IVYA 3TEYA 2SLIA 3AB0A 3UK9A 4ZHNA 4NIGA 2JG9C 1DZRA 1VBA3 5CZKA 5I0TA 4L8QA 3R6SA 3RZKA 4HSJA 3GZAA 5E1RA 3MW3A 3LPFA 5FOJB 2JDUA 3CQOA 3ACIA 3CEWA 5IUQA 1XNKA 4DQAA 3U4XA 2R1DA 4YG3A 1VBE2 2CV6A 4K20A 4WV8A 3SH5A 1CIWA 3QD6A 4IGOA 4NVPA 3WW3A 5BNOC 1RGSA 2WRAA 2XKPA 5EIYB 3NNJA 5DZFA 1GYKA 1ZBA2 3HBZA 2QQIA 1E5SA 1LENA 2WAOA 5JIAA 3ZFEC 5DUVA 3RZLA 1PO22 1QF3A 2PHWA 3LFMA 5IAXA 4OHWA 5FPXA 5A6XA 3RRDA 1XNAA 4M3CE 4YNIA 3ZYHA 4SLIA 3T30A 2VXRA 1SACA 3U4SA 3B3QE 2QCSB 2FMDA 2XVLA 3GZUC 4ZS2A 4Q4V3 1IKQA 4D7YA 5FPVA 1Y4WA 1JUHA 1W0NA 4EROA 1UQXA 1RUJ3 4QXCA 4M3CF 4AHWA 1QQP2 1C28A 4FPJA 1W6OB 4N53B 2DCKA 1W6OA 4N53A 4XF4A 1OBNA 3DV8A 1EV13 3BTXA 1C4RA 3UKNA 2NMOA 3KHCA 1MEC3 3MLLA 5A7NA 5K9YA 3RJRA 2Q1MA 2F17A 2P3IA 2IXLA 3NV1A 2OS2A 1WW5A 3OD4A 5JSOA 2R043 2QDNA 2BEOA 1AYM3 1BQPA 2E9QA 1NXD1 2JB4A 2WBKA 3A7QA 3AM2A 4DXSA 3DYMA 4YZ3A 3H3UA 2G9GA 5IAVA 2CAUA 2E63A 3ZKYA 1LU1A 3DEMA 4N9IA 5A3LA 1NOVA 3CZUA 1Y9MA 3OPWA 5BYNA 2WFF2 1RUOA 3WDXA 2DYCA 1D4M1 1YIFA 1UYZA 3GF6A 5FMOS 3EO6A 5KHHA 3BN6A 4CPBD 3VKMA 5DUUA 1H8TB 1H8TA 4YW5A 3RZZA 3VBOC 2FD8A 2GP3A 1JYTA 4Q4X1 5IK7A 3NL1A 5GKAC 3NMBA 4HLTA 2ET1A 1OHFA 1EYBA 1OFSA 3DPRC 4FFIA 5FO7B 1V6OA 2RDNA 2ZHNA 1QJZA 5JPNB 1MVEA 1V9U3 1XNTA 2JDZA 5DXDA 5JUVA 1B09A 1LHVA 1W9FA 2HWC2 3POSA 3PTYA 4P9YA 4BPZA 3N36A 4RS5B 1I9RA 4RS5A 1H2LA 3SEEA 4JQRA 3K75B 1IOAA 1UY1A 2VOWA 4QPGA 1EUUA 4N9HA 1YWKA 2DU0A 2QQKA 2Y64A 4CE8A 1NY72 1RHI2 2HEWF 3QBQA 1VALA 3R4SA 3KV4A 3IMNA 3M70A 4NOTA 5AVAA 3IM0A 1FPN2 2ZPXA 3C7EA 4KNCA 3NAPC 4RR3C 1FOD2 4CDUB 5FPZA 4Q0PA 1LOFA 3B02A 4OUSA 4UOJA 2WA4A 2QVSB 4LR4A 2GNTA 3GNEA 3ZXDA 3ZMOA 4QGNA 4LBMA 1W8NA 1O4ZA 4FFFA 2ZGTA 1DZTA 4Q1PA 4Q0VA 4D6RA 3RDIA 3HQXA 3RG0A 3VD7A 4AK3A 4CP9B 3IN9A 3J7LA 4CP9A 4Q4W1 3OD0A 4JGZC 4Q0SA 1O7FA 1A8DA 4DUVA 1NYWA 3ROUA 4XPVA 4AI0A 4QQOA 1UY0A 2W94A 3N9LA 4AHXA 2HKXA 4QU2A 1RUI2 4EZHA 2PQSA 4HT1T 2LRPA 3LOIA 4HETA 5FYZA 2EAKA 5C9AC 1MS8A 3TEZA 2QE3A 2ZS6B 3WT3A 4CP1A 2IXHA 4XUPA 1AYN2 4I2OA 4XIOA 1RUD2 1H1MA 4JDOA 3WP5A 2ZABA 5FO9B 1XE7A 3AYCA 1DGWA 5JXJA 2EICA 1NQJA 5GLZA 4OHXA 1CR7A 3UKTA 3U0ZA 3V0BB 3AZVA 3V0BA 1E5RA 3KT4A 4WM7B 3UESA 2QBXA 3ECQA 1W3VA 1VAVA 1RYYA 1FATA 1F31A 4MGKE 5F5CA 1WZXA 3W21A 5FMDA 5JXIA 3T2OA 3HNMA 1LHOA 2JWPA 1DYOA 4FOQA 1OQ1A 5J98B 3ZSJA 4IGPA 3S30A 5FPAA 1JOBA 5KBFA 4DIQA 4LPLA 1R081 1GP6A 3FE5A 2W87A 3TAYA 2VZTA 1ENSA 1OA2A 2RMU3 4FI9A 5F6KA 5JZGC 4E4DX 4QX2A 4RN5A 3ZSLA 2WT1A 3GZEA 3WF2A 3S7EA 3AKTA 3KCCA 2WS91 1OLQA 1HRI2 4K1YA 4A45A 3ETPA 1NCQB 1ULDA 1NCQA 3HN1A 1QXJA 4PLNA 1M4WA 5H9SA 3B69A 4XFCA 1J58A 2VU9A 3N9MA 4NHXA 5D21A 2C0ZA 3KSCA 1ZYBA 2VQUA 5JSRA 4X8NA 5C3QA 1AR92 1PZ8A 2WWJA 2V5YA 4MSVA 1HDKA 3KM5A 2QFEA 4NAMA 5CADA 5E6HA 4DS0A 5FZ1A 4MGZE 2WQ8A 4EN9B 1KRIA 1WGPA 3ZN5A 3HT1A 3ZPYA 1SLCA 2NZ9A 3CO2A 1YIPA 2VMDA 3SXWA 1BXHA 4JKMA 3A0KA 4QKNA 5FWEA 2V73A 1I5ZA 4XXAA 1NLSA 2NPIA 4C8DA 3D4KA 3D6EA 4LORA 4PLOA 5F9TA 1AXZA 4ORFA 5APAA 3WNOA 1AL0G 4QPGC 4CEWB 1R091 1RVF1 2R30A 1QY4A 1YC61 2GC2A 1OD5A 3LE0A 2W39A 4LQRA 4XW3A 1AX2A 2PN5A 1GQHA 4JRLA 1PGSA 4XQDA 2A5ZA 1UNBA 5FK8A 5M0TA 4DEVA 3QOPA 1QNYA 2JE7A 1RMU1 1WKYA 3TOJA 4DB5A 5FDBA 2HWD1 3WG4A 5CBLA 2BYVE 4QXKA 3LOBA 2YFUA 1DYPA 1LOFC 2DVFA 3L9JT 5A32B 3VBFC 5K0UB 5A32A 5K0UA 3JD71 2XLAA 1RC6A 2WDBA 1S0CA 2R16A 4MHUA 3IKWA 4PQQA 4QB1A 5TSWA 3QH6A 3AP6A 4I30A 2RJ2A 3LFIA 3WP3A 2OYZA 4BQ5A 1N1VA 2A70A 2G4IA 2RDQA 2VD7A 3FUQA 4HKOA 1IG3A 5EFUA 4MZUA 1DDLA 3Q8CA 4ASKA 4OHYA 1UU5A 3AZWA 4NPMA 4WVMB 2C9AA 1T2XA 4WVMA 3VDDC 4DPNA 2R071 5C8CC 1JU3A 1QJX1 3UGGA 1FAYA 3MYXA 3LEKA 1OI6A 3KCXA 2QZ2A 3PVBB 4LA3A 1NUKA 1QEXA 2D93A 2PYTA 3DKQA 4JX0A 5FZ3A 3RYRA 5L9VA 3N4MA 1V6NA 1AR82 4XJUA 4F3JA 5L7OC 5FMCA 1SEFA 5LY1A 2BVBA 3NKGA 2JJ6A 1UZVA 4C90A 1BKZA 4XBQA 1ULEA 3VBSB 3AZXA 4ZS3A 3VBSA 5IK4A 2Q5TA 3KLSA 2QQNA 2Y6FA 2JENA 4HL0A 4UFLA 1I5PA 5SV5A 1GKBA 3O7OA 5A1AA 1CJPA 4P9IA 4DOUA 2BWCA 2XKOA 4MUVA 3OGSA 3VKLA 4GA9A 4F8AA 2PHTA 1NX9A 2RG4A 1W6NB 2AGSA 5EZWA 1W6NA 3AP7A 5FY1A 2MEV1 2UY8A 3ELNA 1P8JA 5IVBA 2BNNA 3GGLA 5A3PA 2ILMA 1W9TA 4Q4W3 4XQ4A 4YM1A 3VDCA 1TME2 3VKFC 4OI1A 4AAXA 1ULCA 4CRQA 4LHNA 3TN92 2JICA 2A3XA 2VMEA 1G7YA 4IQPA 5AFBA 3LSDA 4MXVA 5A7WB 3VD5A 4AEKA 2VPVA 5A7WA 1TNFA 5C33A 1YQ8A 2XXZA 3LEMA 1QOOA 4A2UA 1SDWA 4FAHA 3BTYA 2BW8A 2QQLA 1GSLA 4QDRA 1MS9A 3LQCA 4QD2A 1NLRA 2CHHA 4Q0QA 5A6QA 3CF6E 1SDDB 2YHJA 2W92A 1R1ZA 1WLDA 4C0HA 3AL6A 1Q5OA 3O1VA 5FO8B 3F2ZA 3IMMA 5CKQA 5A7PA 1JZ3A 1X9TA 3KWVA 5D2AA 5FUIA 1NA1B 1GQGA 1YFWA 3O1MA 1NA1A 1EPZA 1BYHA 3VBRC 1J3RA 3E5XA 4PT6A 3U78A 1UKRA 3E5QA 4L97A 5GLWA 2HWE1 1W3XA 2OUHA 3ZYRA 4IE4A 1JMUB 3FC0A 5BXXA 2XJUA 1RUG1 4E4HA 3AXEA 1R083 1OPMA 3P5BA 1PM7A 4EN8B 4YW7A 3MIBA 5FYIA 2BNOA 2BPA2 1JBCA 5IWFA 3HOBA 2PAEA 1UPSA 1VJ2A 2ZZQA 1GOGA 4YW6A 5KC6A 2HWF2 2V09A 3WR0A 5FP7A 2B39A 3WNNA 4M01A 4PDWC 2D3PA 2PTMA 2RS31 4NWVA 5H9PA 3DXUA 3PTRB 4ARXA 3SKVA 1AZDA 2VCBA 1TMF3 1NCRC 1K42A 4NIIA 1O3QA 2Q8CA 1DFQA 1X33A 2JG8C 5JXGA 5E16A 3S57A 5LWBA 3SQOA 4AOCA 2XG3A 3MO4A 2ETEA 1KEXA 5A3WA 5E89A 3T0AA 4GXLA 2VOTA 1SFPA 1H9WA 4KU7A 1NE6A 3NNGA 1DGLA 3I7DA 3ZXJA 2LS6A 2F6BA 1S0EA 4Y22B 1C8NA 4Y22A 2DCYA 2OIIA 1OA3A 1VP6A 3WCSA 4XE9A 2BV4A 4XQWA 3M2MA 1WWYA 3E6CC 2WYFA 3GJAA 4XETA 3MPBA 4HVQA 3RSJA 3KMHA 2BQPA 5GZDA 1NZCA 3OPTA 3WCRA 1MVQA 4MGYE 2GN3A 1W99A 2WS92 1R093 3JBG3 3HD8B 1U5XA 2FDJA 4FPGA 1UOFA 3I3QA 4S2DA 2OX0A 4XFHA 1XYPA 1SFYA 2IFRA 1QJU3 2JKXA 1FMD1 5FY4A 1VBC2 1QJEA 1W9YA 4GKYA 2A71A 1ZZ9A 3P1IA 3RYPA 3UETA 2HWD3 3GM8A 1JUIA 5FWJA 2ORZA 1QJY1 3H7YA 1SPPB 3Q8FA 4W6WA 2BNMA 1SPPA 4QGLA 2DTYA 5B4NA 4E4ZA 3POWA 2Z42A 1COV3 2YBSA 3JD73 4LHKA 1H2MA 4META 4OUMA 5FXZA 1XB9A 2VMCA 4N43C 1F2NA 4AI3A 2VZ1A 3M3IA 5DG1A 4CU8A 2ZGUA 3L2YA 1H6XA 5CNAA 1LESA 4I02A 4NR1A 1LHUA 1LKNA 3VZNA 2WC2A 4COVA 5HCBA 4BE3A 2R063 4IV3C 3ZO0B 3J7NA 3PUAA 2J7MA 2IUWA 1VBB3 3I2JA 3HR9A 1W9SA 2XBO1 4JRAA 3A22A 5IVVA 1IS6A 2Y6LA 1BZWA 5EWSA 4YYOA 3VN4A 2UYAA 4XJWA 2R073 2EIEA 3SKJE 1W8ZA 2YBPA 3JQXA 4QM8A 2ZHKA 2ET7A 1RUE3 4WVVA 4B7EA 4NRMA 1ZBE3 1RMU2 1FT9A 2WZEA 4AEDB 4BIOA 5IVEA 3WF0A 4AEDA 4FXKB 3WW1A 4CZSA 4IE7A 4BLJA 1VBA1 4LBOA 2Q8EA 3SCHA 2PHXA 1TNRA 3OG2A 1ZREA 2YROA 4NJ4A 4CA9A 4N7IA 1US2A 4H14A 1YQ6A 5FMBA 2VZSA 2ZKNA 3K2OA 3O1PA 1JOJA 2JE8A 4NHKA 4Q8KA 4I01A 1YXWA 1CX4A 2GC0A 2XLFA 4UBHA 1VRBA 1ENQA 2V4AA 2XWJB 3CLPA 3KF5A 4CEYC 2W08A 4C1WA 3LEIA 4RA0A 1JZ6A 5IYYA 3BIEA 2GNDA 4Q1RA 4HBNA 1IPKA 4QB2A 2E31A 1MPXA 5LBBA 3PJYA 4AFDA 4QX1A 2WZR1 4MXWB 1CZTA 5FY7A 4MXWA 2AREA 4JGYC 4B1LA 1HB3A 4MGQA 1OLRA 2RS13 5FZEA 2L9LA 3HBKA 5FY5A 4WVZA 3GALA 4XILA 4IEYA 1RUJ1 1ZRIA 1IS5A 4K8RB 3LDBA 4AHYA 2QDRA 3BU0A 3DGTA 3ZXEA 3ZFGC 2ORXA 1EV11 2P5BA 2YPDA 2ZGLA 3CZJA 3LGRA 3MDPA 2WZPP 3X29B 2W47A 1MEC1 3D5OA 2YY1A 2UWBA 4Q26A 5FY0A 5FZIA 3I2KA 1G9AA 1K12A 1W8UA 2R041 1K5MC 5FYVA 4TZDA 5HI0A 3MV11 5AC92 5BNOB 1J1LA 5BNOA 2MEV2 4GMP1 2XLGA 3OEBA 4P9GA 1VR3A 4L9BA 1HXS1 4XURA 1R1A2 5FZDA 2PMWB 3DECA 2BP6A 1Y3TA 1PVXA 4JVAA 4SBVA 4EE2A 2HBUA 3LF7A 1NE4A 4KWLA 3AMPA 4W65A 5F3GA 3VL8A 2RR12 4KWUA 5FPLA 2X5IC 2W95A 4IEWA 4YRDA 3UGHA 3OB8A 3NJYA 5FZ0A 3WINE 4Q4Y2 4GWJA 3FJSA 5IVCA 5I0RA 2FDKA 1Y9QA 3IDEA 4HN0A 1V9U1 4RSUA 2VO5A 2D6OX 3SISA 2PQQA 4Z92B 5KHGA 5ANQA 2XR4A 2WUHA 5F3IA 2UY9A 5JLVA 2PAKA 1CVNA 3TEWA 2JDKA 3TNPB 4KGQA 1ZA4A 4A42A 4D0QA 3C7OA 1S55A 1V6LA 3BVCA 4L99A 3QLQA 3VBHC 5EQUA 2VVEA 4ET7A 3WNKA 1ODMA 3AFGA 1WCSA 3ACLA 1YHFA 5LA9A 3ZYIB 1QU0A 4PLMA 4AVTA 2VNVA 2ATFA 4OZOA 2AEZA 5JR2A 4BHPA 1CZVA 2BBAA 4BWOA 1N47A 1RUC2 1ZA7A 1CX1A 2OZJA 4S2HA 3PUSA 5GZGA 2CWSA 4J25A 3VBOB 4QQLA 1AL23 3T09A 4IL7A 3VBOA 4QX0A 1JU4A 4NROA 4CVUA 4UT5A 3QACA 3UGFA 4YARA 4PJYA 5FAXA 1LR5A 2E7QA 2P3JA 2RS32 3AKQA 3J8F3 1AR61 2VZOA 2JD9A 3DPRB 2I2SA 4V2WA 2GN7A 3DPRA 1JZ8A 1QKQA 1YCIA 2XL9A 4BB3A 2FBEA 1V0AA 5FKCA 1GBGA 1RJ8A 4FFGA 2OUJA 4LHSA 1CONA 2FZ1A 1W05A 4IV1C 5DG2A 1U5ZA 1YLLA 4LO7A 3ITQA 5FPBA 4NPLA 3SC7X 1EUTA 3VGIA 2ES3A 1ZZ7A 5DAPA 3WF4A 3KCYA 2RDRA 2W0XA 4GZ9A 1L7QA 4Y4YA 4AFMA 3JZVA 5EP9A 1IHMA 4H2AA 5I91A 5BY5A 5IATA 3ZX7A 3A0NA 1QIQA 2QJVA 3WP4A 4DXZA 4RR3B 3NAPB 2XBO3 4RR3A 1ODNA 3NAPA 1XYOA 3VZLA 4WBBA 2DUOA 3ZIWA 2W3JA 2ZX0A 4DEQA 4FCAA 1QDOA 1W6QB 3ZSKA 2YV8A 2J1VA 1W6QA 4LLFA 2RDSA 2Y38A 1FMD2 1W0OA 1HN1A 2WO1A 2ZEXA 2PHLA 4Q0UA 1OH4A 4AI2A 4BYYA 1PX3A 3KGZA 2IXCA 2IC1A 2G9FA 2GNBA 2Y6JA 4GB31 4XUQA 5I93A 2NP0A 5FZKA 2H6CA 1O59A 2VR4A 1AR72 4XJZA 3FUOA 4RD7A 1BCXA 2P34A 4E8DA 4A41A 5I0DA 4JGZB 3AMMA 4JGZA 2J1TA 1A6CA 1FV2A 1ZBA3 4QM9A 1UX7A 4XF3A 1BVVA 4BXSV 2UWAA 4HSLA 5HV4A 2EAAA 2RMU1 4R4ZA 4OYUA 4Y5Z0 3LZZA 4AQ6A 2XH6A 1ND2C 4LE4A 2VBPA 1UU4A 2K9ZA 5SV8A 5C9AB 2ZA9A 5C9AA 1YYNA 2WT0A 2RS51 2XJQA 5FJHA 5GLVA 3MUY1 3WDVA 1AHSA 3HN3A 3KF3A 1ZZ6A 5L73A 3T4VA 3RZHA 3EQEA 2WZR3 4FPCA 5FREA 3WY6A 4INDA 2FQPA 4AHZA 4X8PA 3Q9OA 4FOWA 1W90A 5IW0A 3RI9A 4EQVA 1AX0A 1K5JA 2VH9A 1PGW2 4BQYA 2ZACA 2B42B 3N7MA 1LAJA 3JXSA 4O7XA 5EJ1B 3OBZA 2AENA 2J1UA 2EXHA 1VBA2 3AL5A 2VMHA 1IKPA 3M1HA 1QH7A 3AKRA 4A44A 5KWRA 2WT2A 1QXRA 3MEPA 3VHRA 4F83A 3AP9A 1HKDA 3PUIA 2A7AA 3N9QA 1LULA 4COYA 1N3PA 3HQRA 2XGXA 3BB6A 4QGMA 1J84A 1OUXA 1AJKA 1CPNA 1OURA 1PIV3 2ID4A 4S2FA 2O0OA 5JZGB 5JZGA 4OUEA 4GMP3 1D4VB 2ADDA 3AP4A 4TLGA 1ACCA 5CA6A 2WQ4A 3BPSA 3I3MA 1RB8G 1LECA 1HXS3 3ILFA 4GWMA 4XF1A 4XCAA 2R1BA 2VQTA 3PJQA 4AQSA 4G9SB 4OULA 4Y3OA 4ZZ8A 2EXKA 4E27A 4MGSA 3ILRA 4JZRA 1XNDA 3FBYA 4K7JA 2VOXA 4Q4V2 1POV1 2QQUA 2BFUS 1ZRRA 5DZGA 4BH9A 2VVDA 1XE0A 4EZ4A 1B35C 5CKMA 4BDVB 2HWC3 5A7SA 1ZZ8A 2JDHA 2EXIA 2WLPA 2GZWA 3MF6A 2D5HA 4AI9A 4BIFA 2ZEZA 4D6QA 2HJIA 1IG0A 3I2DA 4Y20B 1MEC2 4Y20A 3WDWA 1O5UA 5FBZA 1OLMA 5DAXA 5FCCA 3UYJA 1LOGA 1CN1A 2LTNA 1VIWB 2WNUA 4QB6A 4XZPA 1AYM2 1RHI3 3GBGA 4Q8LA 2QQWA 4R9AA 4WM8C 5D1IA 5FYYA 3ZXLA 4KG0A 4H7MA 3MIEA 4HKLA 4LEJA 1U12A 3MFCA 4QPGB 3NNFA 2VOVA 4OZXA 2ZAHA 4KMQA 4ARYA 5CVRA 3OJBA 4BQ2A 2J42A 2VW0A 3CMGA 3RMYA 5F3EA 2YDEA 1QGLA 4RGAA 1SQ4A 1F15A 1UY4A 3WVJA 1BEV1 5ACA2 4QX8A 1MZFA 2GNMA 3EB7A 1PMHX 2WA3A 3K3OA 3E1F1 3MIGA 5J48A 4LBLA 4AW7A 1EPWA 3VBFB 3VBFA 1APNA 1BVP1 4MGIE 4UFJA 4GMP0 5F39A 1MZ6A 2P3YA 5A7QA 4PI2A 2WNVC 1N1YA 1DGRN 2DVBA 4Y5TA 5G05L 4RFRB 4MVTA 3WSOA 5F32A 1AR63 3FFZA 3FHQA 1RUI3 4LIUA 3USUB 4HN1A 3VDAA 4QX5A 2UYBA 3USUA 5KXBA 1F35A 3BODA 1KS5A 4LO4B 4QQPA 2CL2A 1AYN3 4E9KA 1UYXA 1L7RA 1H2KA 3VDDB 4KWJA 3LIGA 1ND3C 1PO12 3SCFA 3VDDA 5C8CA 3DKWA 2JIGA 5C8CB 4OI0A 5C7GA 1NXMA 2DTWA 1Q8VA 2JDAA 1IQAA 3JUUA 1EAH2 2RVAA 2F4LA 4A6SA 5A3OA 4FOVA 5L7OB 5L7OA 3WUDA 4RHV1 3VB9A 4QX7A 3ZIXA 2WZ8A 1URXA 3HWJA 1KITA 3I2GA 1W2OA 4IEUA 1BK0A 1T6BX 2R6QA 4M4PA 5BNNC 1LRHA 4COUA 1DU3D 3LA2A 2JKBA 1G9CA 1IGOA 2X29A 2BUKA 2D44A 1SBDA 1YO8A 2Q1FA 4M4RA 4AE2A 2P2KA 1LOBA 3E6BA 1QJFA 3B01A 4N7UA 4XUNA 5FP3A 1W2AX 3NRUA 3S6PA 4B3NA 2CY6A 5JPMB 1PMIA 4K40A 5LW9A 1JODA 4FP2A 4GB33 4N8MA 3K51A 1ZRFA 3TYJA 1X8EA 4Z82A 3ALQA 1GWLA 1WCDJ 2VM9A 2XONA 5CIRA 1W8TA 2E53A 2DV9A 2ENRA 2Q30A 2VC9A 5C70A 2CTVA 1PGL1 2A6WA 4CSWA 1POQA 2G19A 4KL1A 3M3QA 4XUOA 3J7MA 1RUF3 2NYYA 3H8XA 2WYSA 1V70A 3W5NA 3K46A 2Z4FA 3G7DA 3PUQA 4AVCA 4YZ2A 2ZCWA 4BQWA 1UL9A 4XFFA 5FRAA 1O8SA 5F37A 4L2NA 1VBD1 2VNGA 3K4DA 1F5JA 4PBOA 1UXZA 3U10A 5F2SA 3CKHA 2RS53 1LGCA 1REEA 1VAKA 3OGRA 4QQHA 1C8M2 4YW4A 1UF2C 4YPJA 1TMF1 3CL1A 3GXUA 2VMGA 1C57A 1DZQA 3D82A 3N9PA 4JTOA 5FTTC 2QQPA 1LOEA 1VMJA 4YM3A 1XJAA 5FZ7A 3PLQA 5KXEA 2IVJA 3R0RA 4TSVA 3ATGA 4TLFA 3INAA 2VUAA 5BUVA 3VBRB 2B45X 4P5HA 3VBRA 4NE9A 3BUCA 2DURA 5FZBA 4CEWA 5A6YA 4MV2A 5F6LB 3W20A 4AXOA 3AZYA 5L9BA 4Y5SA 1AXKA 1Z7S1 5IFPA 3DYOA 2WNUC 1HB1A 3O1OA 1XYNA 4YLZA 2ERFA 4KWKA 4EN6B 3PDQA 2RMU2 3CHXA 3GHMA 2D6KA 1H9PA 3DL3A 3IBMA 2QQMA 3JBG1 4FO9A 3OCPA 4CCCA 2WNOA 1QJU1 3AVRA 1PVC3 4DUXA 4TWTA 4FPOB 2C4XA 4PDWB 2VTFA 4PDWA 3FZ3A 4YZ4A 2ZX2A 3AMQA 3LIHA 3UV9A 5FV3A 1NCRB 1NCRA 4R8HA 3AVSA 2OXBA 4AWDA 2JG8B 1W6PB 3N35A 1LGNA 2JG8A 1W6PA 2ZHLA 3I2IA 4DNYA 2IXKA 3WHTA 1SHWB 4COZA 2B8MA 1COV1 1POV3 1E5IA 1R64A 1Q8SA 2AYHA 4DXRA 3NWKA 3OPZA 3ACFA 1Q8PA 2W91A 5A3TA 5A3UA 3CJIC 5T5LA 1E5HA 5A1LA 2R061 5LATA 5K8SA 3NW4A 3IT8A 5LK7B 5DZEA 1VBB1 1UX6A 4RL7A 4IEPA 4HPKB 2CDOA 3VV1A 4HPKA 4WZCA 1MS5A 3FHAA 4A4AA 1YFXA 2X8KA 3LB9A 3LPGA 1F5FA 1RUE1 4OI2A 5FUPA 1G9BA 1ZBE1 1XE8A 3MHZA 4J6GA 5EXOA 1NZIA 1D4M2 4NO4A 3H1YA 2A6XA 3I97A 1TQ5A 1W0PA 1OUSA 1PZ7A 4QPIC 4YW2A 3KS7A 4DO0A 1J1TA 2OA2A 1SFNA 4BXFA 2E33A 1G6NA 1BEV3 2JX9A 1H4GA 3OBTA 5FYMA 3T0BA 1O3RA 5FOBB 1DBNA 3V64A 5C71A 3PU8A 4KG8A 2CAVA 3OBRA 4Q4X2 3WF1A 4BLIA 3DCQA 3F95A 2YYOA 2J22A 2ZX1A 1CZSA 4N43B 1TME3 3IAQA 4N43A 4WZFA 5ANNA 3SMHA 3RGBA 3TN93 3E97A 1FI2A 1D0GA 4NRQA 1BMV1 3VUOA 5FZ8A 3URFA 5H9RA 3ZXFA 1F4HA 1WMFA 1YI7A 3CIHA 3B93A 3ZYBA 4MLOA 3ZR6A 2YU2A 2WWSA 4IV3B 4UXAA 3OF1A 4IV3A 1POV0 2FDHA 4M3CB 1OOPB 2OW4A 4M3CA 1OOPA 1WUVA 2RS11 2GU9A 3MV01 5GLTA 3RS6A 2XVGA 4UWDA 1DIWA 3ON7A 2XVKA 1BBT1 5EV7A 4IE5A 1KDMA 5T52A 3ZFFC 3VD4A 2VVFA 2ZAAA 3WQBA 5JOYA 2LM3A 2GH8A 5DDJ1 3POBA 4UW4A 2KR2A 3N7KA 4YVSC 3O0XA 4QKFA 4RHV3 1QNWA 4ZXKA 3C7GA 4LOTA 5H9QA 4JAAA 4UFKA 1IS3A 2TEPA 1JTZX 4Q5OA 2W68A 1BJQA 5FXWA 4BMBA 4EYUA 4ZZ5A 5CFCC 1VB2A 1UXXX 3D0SA 4ZU5A 4QKBA 4LBNA 1GZWB 5FR3A 5JDBA 2CSGA 1GZWA 4QHBA 4IETA 1JYVA 4URAA 1VRH1 2DCTA 4KH9A 4NHLA 4NUBA 2KM2A 3B5LB 1OH3A 4OCTA 4CEYA 1SCRA 4Q4W2 4CEYB 1HN0A 4EN0A 1JHNA 2HWF3 3DXTA 5A80A 4JQTA 2XUEA 1YFUA 3K3NA 1H2NA 3EHKA 4AVSA 4HVRA 3TRSB 5FYCA 1VPHA 3O12A 4JGYB 3FFQA 4JGYA 5DN2A 2PLV3 4XAAA 3UKVA 2DU1A 1D0HA 3WF3A 4PHZA 2GC1A 4Y1UA 3WQ7A 3O0WA 1WCQA 5IK8A 1OA4A 2ZX3A 1J3QA 1VBD3 2ZGOA 4V2VA 5A7OA 2GC3A 5L36A 1HX6A 3FLTA 1KS4A 1RUH1 1UAIA 3BCWA 3ZFGB 1DGWX 3ABZA 1O4TA 2Q8OA 3ZFGA 4B7KA 3BI3A 5GM0A 5DUWA 4O61A 1S2EA 5FJKA 3CU7A 3LA3A 3FL7A 2OKXA 1K5MB 4L0PA 1K5MA 1GOFA 1W06A 2WL1A 4R9BA 5FZ4A 4YZ5A 4PIYA 1XOYA 1LOCA 3VZOA 1JZ2A 3POGA 3GBFA 4JHZA 1JI6A 5B2GB 3WNMA 3OOXA 4XDPA 1R082 3KQ4B 1Z7S3 2D97A 3BU7A 5FKBA 4CCMA 2X05A 1VBC3 5A3NA 5T50A 3N7LA 3GCWA 4E2QA 1N3QA 1H4HA 1X9PA 2XHNA 3MIHA 1AL21 3J4UH 5JI7A 3I59B 3KB5A 2X5IB 3I59A 2X5IA 5FLIA 1C3HA 2IWGB 4CPBA 1U5YA 3SEPA 2H6BA 1UY3A 3J8F1 4I0BA 4OHVA 4BK5A 1TMF2 2JECA 4HONA 2ADEA 2AUYA 2J1EA 2BOJA 2YUEA 4QKDA 3VBUC 3VZKA 5LCWL 4G3YC 3CBNA 2HBTA 4XVHA 1N1TA 3LD8A 1G9DA 3IIIA 1GU3A 2ARCA 2VZQA 5CYYA 1GWKA 3ASIA 2JE9A 3K4ZA 4MX3A 2DVAA 1W8WA 1BLZA 1GWMA 1W8OA 4Z2WA 2TUNA 4YWAA 1PNFA 4B4PA 1DQ1A 4EJRA 3MF9A 2LROA 3VBHB 1YI9A 2VQAA 1JYCA 1SLLA 2VZUA 3VBHA 1LU2A 3HJRA 4YGBA 1O91A 2FCUA 1G86A 1KGYA 4IEZA 2VZVA 3OY8B 5GZFA 3OY8A 4PCRA 3OGVA 3JQWA 4BQ3A 4S2GA 5CG8A 2AH2A 3IDBB 1OOPC 2EXJA 1R092 1RVF2 3KD4A 4UYBA 3T08A 2ZXQA 4LLOA 4LBJA 2EVXA 3BTAA 4I3GA 1QJU2 5FZAA 3VHOA 1RINA 3RVHA 4AVVA 3TEXA 3MFAA 3ZDSA 3WG1A 4FPEA 1G8WA 4PIXA 4D7TA 5DABA 1HQWA 3O1TA 1OMIA 1PMJX 1VBE1 2P37A 2B46X 2HWD2 3W59A 1DQ0A 5LK5A 4NWWA 4IEXA 1JN2P 4LITA 5HCHA 4CCOA 3M8LA 2MPFA 4LMFA 1COV2 1ZBA1 3JD72 4IV1B 3THDA 3ZKUA 1OLME 2QZ3A 4IV1A 5EYXA 5LA0A 4A3ZA 4CU9A 2HWB3 1VMFA 2Y6KA 3I2FA 1S2BA 2F4PA 2HLEA 2Y0OA 1JOPA 2D6NA 4QAWA 3ZYJB 4QPYA 3AYAA 2BTVC 3ZOIA 1WW6A 1JYIA 4P5YA 2GMEA 2VAUA 4FPYA 5CU1A 5D8AC 2GP5A 3KT1A 5EYYA 1MZEA 1VB4A 3WNPA 1GUIA 1VBB2 2TBVA 1W8HA 1CESA 3UJQA 2XB6C 3O14A 4FT8A 4Y26A 3WV6A 4BZ4A 1E57A 2K2SA 2WIIB 4CDQB 1A3KA 2R072 1QJX2 4CDQA 1QQP1 5I8SA 3W5MA 2P4EA 4PF5A 3ZR5A 5JMCA 4CUGA 4PQ9A 3RFRA 4AAPA 4COWA 3NJXA 1IS4A 2PFWA 1QH6A 3AKSA 3LAGA 4YM0A 1V6MA 4DY3A 5I0SA 1BBT3 1ZBE2 3AZZA 4NN0A 1C1FA 3LEGA 4D6SA 1DP0A 5DDJ3 2FZ2A 2VGDA 5C4WC 2P17A 3FBMA 3WW4A 2A6YA 1CAVB 1MACA 3MGUA 1CAVA 1CAWB 3O5SA 1CAWA 3UT0A 4YG0A 4LO5B 2NN8A 2PHRA 2D6LX 4Y1YA 4Y1XA 2ZBJA 2ZJCA 1OQDA 2WFF1 3R05A 2A1XA 1S0BA 5FXXA 1AJOA 5FZHA 2JEMA 3AFKA 3PNAA 1R1A3 1PIV1 2A75A 3OTFA 1JZ7A 4A7ZA 2XJVA 4GWIA 1GMMA 4BA6A 5IT6A 1CPMA 5LASA 1ND2B 1ND2A 1VRH3 3LDKA 2RR13 1TZOA 1HRV3 1WA4A 3OUHA 3ZSMA 4GALA 5I0UA 3LKJA 3BKZA 3HT2A 5CKNA 2HYKA 4NRPA 5A33B 4Q4Y3 5A33A 3ORJA 1JXNA 3AK0A 1JYNA 2PHFA 5AFEA 1FNZA 5DAWA 2VBDA 3O1UA 3B00A 3ST7A 1S0GA 1ASJ3 1UW8A 1GV9A 4KBBA 2ZMKA 3E5UA 4GH4C 1T6GC 2HWC1 4IDZA 5FZMA 4YW1A 4B4RA 1NT0A 4XEZA 2YC0A 4XF9A 4HG6B 3UNPA 2Y33A 4A7KA 2E6VA 1HJFA 1RUH3 2W9XA 3GDBA 3MUZ1 4B4QA 3VKOA 1S1AA 1GOHA 4HANA 4JDMA 4N90A 4AEMA 3V0AB 3V0AA 3U1XA 5C3RA 4RFT0 1NY71 1RHI1 5DAQA 4EWDA 1HW5A 1OPOA 5GZEA 4XTPA 1XC6A 5JXHA 1LEDA 3POFA 1FPN1 1RUC3 2HWE2 1JS9A 4JTNA 1IPSA 1J59A 1UU6A 2VCMA 2RHPA 1WW4A 4GQ7A 1FNYA 2DDUA 4L92A 3TBDA 2ZGRA 4PBPA 4BM8A 4DRVA 1QDCA 1RUG2 4K1ZA 5I8TA 1O6UA 3LWCA 3THPA 3ZXKA 4QDSA 5CISA 5F3CA 1GLHA 3S5QA 5FZ9A 2BOIA 4EWAA 1A8MA 4ZKTB 2YC2A 3JU9A 4LA2A 4CCKA 1F8VA 1D7PM 5DQ0A 2VL4A 3ZLIA 2Q1ZB 2MHFA 3H7JA 3W58A 1RXGA 1U5IA 1V00A 1CAXB 1CAXA 1B35B 1VLNA 1B35A 2VG9A 3AC0A 4P14A 1LB2A 3M3EA 4KI5M 5JOXA 4AVBA 5A3MA 1OD3A 4ZPIA 5FMOL 1RUI1 1US3A 3BTZA 2WINB 1SZBA 2YU1A 5BV6A 2QQJA 2BGCA 4Z2AA 4ATFA 1H8VA 4CDWC 4HZFA 4BISA 5KHJA 2SBAA 1LEMA 2RM23 3ETQA 1AYN1 1QHDA 4XOGA 4F7ZA 4BOWA 3AYDA 4LT5A 3ZPOA 4WM8B 4WM8A 3FWEA 3RNSA 2Y6GA 3H50A 1DQ5A 4XMAA 2D6MA 4D69A 1AX1A 1MQTC 2P6HA 2RJLA 5IJRA 4D8MA 2CGPA 1YJKA 4KBZA 5FP4A 1GP4A 4XHBA 2DBIA 1WMXA 2PHUA 4DFSA 1OF3A 1X7NA 4YFWA 2FDFA 3VKNA 2KXLA 4CDQC 1UWWA 2G1MA 2DFCA 3KZ4C 2FMYA 4XHXA 3ES1A 3MW4A 1AR73 4Y24A 4BQ4A 1WBFA 2WO2A 1FXZA 3J8F2 2EIGA 3NSTA 5ERLA 4D94A 4UW3A 1I3HA 5T3NA 4W6XA 2WNVB 2CU5A 3SLIA 2WNVA 5JI9A 2C24A 2RJKA 3AJZA 2XQRA 5FYTA 1VBE3 4XAEA 1A78A 2ZGPA 4IESA 1QJY2 3J26N 2GH2A 3ZYPA 2WO7A 4IEQA 2Z79A 5JOWA 5ABJC 4YGCA 2WAAA 1RUF1 1DF0A 4H3WA 3IDCB 4BCUA 1PO23 4FBFA 3RWKX 1ND3B 1YEWA 1ND3A 4UF0B 2W1UA 1X82A 3N9NA 4UF0A 1W39A 2JDNA 1GP5A 3WDUA 1ZRCA 3JB8A 5T5JA 4CCLA 1JW6A 1ZNPA 1AR91 1KQRA 1SLIA 2JD4A 2VMFA 3AJYA 3MPPG 3TNQA 1NKGA 3G6JB 3QCWA 2B9VA 3KGLA 2O8QA 2ARXA 2XBO2 2O14A 1UO9A 2YGLA 5T55A 3WNLA 3WQ1A 4FFHA 4YZ1A 2VE1A 1QQP3 4X6RB 2VQ0A 2WN2A 5BNNB 5BNNA 5FQ0B 4LKEA 5FQ0A 1WLTA 3RQ0A 4QWNA 2Q0AA 4RQPB 4RQPA 3AX4A 1I1EA 2Y8KA 1OXCA 3WOGA 3D0JA 5LBFA 3CJXA 4MG2A 5A6ZA 4CU6A 3ZXAC 2JDYA 1NLQA 4DY5A 1YQCA 1PZ9A 1QMJA 4MADA 2IXIA 4JCKA 1CD3G 2WFF3 3U07A 3UL2A 4AFCA 3NV4A 1W2NA 4CXWA 4YGEA 5E88A 3POEA 2ARAA 3NQHA 3U14A 4E2GA 2ZX4A 4P9JA 5FZCA 3ZVXA 1HB2A 2KD7A 2YZ4A 3MLJA 5J3UA 1PVC1 4CXYA 5FYUA 2IFWA 3OUJA 1V6IA 3NJVA 3WLUA 3U37A 2AC1A 2WZR2 2FDGA 1GR3A 2B9UA 1MS3A 5T54A 3NKTA 5FYHA 4KGGA 3PHMA 1H0BA 3EMRA 3SCGA 4OMDA 2DVDA 1Y9GA 2EIBA 2A3WA 2CWMA 2EF6A 2XJRA 2P6CA 2VUJA 5HXVA 2ZGKA 4EN7B 1DCSA 2NLRA 3I3DA 2IXJA 5FIXA 4XIKA 1F9KA 1RUJ2 3Q8EA 4QXBA 3QH7A 2D40A 1PNGA 2VUDA 1TG7A 4FAGA 4Y4RA 1EV12 1KJLA 1K3IA 2R49A 5FZLA 4UFMA 2VCCA 2LALA 3KT7A 4X6QB 1EY2A 4L11A 4URTA 5F5IA 1UYPA 2WNUB 2ZKLA 1AR81 2R042 3OUIA 5LRSA 2FCVA 1PIV2 4FOYA 4XYXA 3T2PA 2EIDA 5KHIA 2JXAA 1UZWA 4K9SA 2VXJA 5GJ6A 3I4IA 5ACA3 4FPLA 1FPN3 4YVWC 1FOD3 2HEVF 1UZ0A 1HXS2 2WN3A 3PVNA 4NHMA 1HV0A 1CJDA 4ATEA 4CUCA 2E7AA 2H0BA 1C5IA 1H30A 1LTEA 4XABA 3SHRA
chains in the Genus database with same CATH topology
4FPKA 4K8FA 4IERA 4KU8A 2XPJA 4QT6A 1GICA 1XNBA 1HQLA 4XBNA 5CB7A 2WQZC 4RGGA 4LTAA 3HMYA 4C0BA 5J7MA 1TME1 5K7PA 3N3HA 4LO8A 3TN91 1PK6C 1V9U2 3DUIA 1PO13 3AYEA 3EBRA 3VHPA 4AI8A 3CJIB 1CAUB 2ZOEB 3AXDA 3CJIA 1CAUA 2FHRA 3VZJA 3T2TA 4AQTA 2VULA 4FPHA 4XTMA 1EAH3 1QXPA 4WVWA 1XU2A 3MICA 4LBQD 3BIWE 1RUD3 2R0HA 4R4XA 2E51A 4XFBA 2CYFA 4XJAA 4CP0A 4CDUA 2VW2A 2GSYA 1ALYA 1N1SA 4DMIA 1DQ6A 1YNAA 1REDA 3I8TA 3J9SA 4O9GA 4QPIB 4QPIA 1C5HA 2Z69A 3H1WA 4Q29A 4FVVA 4ZU7A 4B8EA 4CYDA 4AFAA 3FHIB 4M00A 2VW1A 2WNEA 2D6PA 2VMIA 3H0OA 2XJTA 4RQPC 2NM1A 1WMEA 1CQ9A 1UN1A 1AR62 4FQZA 1VAMA 2XJPA 2P3KA 1S0IA 4YM2A 2CGOA 3SH3A 3PMEA 4R52A 1ZM1A 2HWF1 1KFXL 2DCJA 1HRI3 1ENRA 2PLV1 1C8M3 1L3JA 4TYSA 4UBGA 5FFOC 2OVUA 3CNAA 3ZFFB 4ASLA 3ZFFA 1G9FA 4Z1VA 1GNHA 5JCTA 1Q3EA 3B9IA 4WM7A 1AR93 2QUOA 4YVSB 1QWRA 4YVSA 3HIFA 2B7YA 3IPVB 1Y43B 3IPVA 4N53C 1SCSA 4A7YA 2NQYA 1XXNA 3M3OA 4E2SA 2R0FA 4OLLA 5AVPA 4YW3A 4Y1ZA 4M0HA 5CFCB 1V6KA 4GIQA 5FLHA 5CFCA 1U0AA 4QQ2A 1SLAA 4D3WA 2YMZA 4GB32 2VNRA 4HFSA 2YGMA 3WHUA 1RTVA 2RE9A 4ES9A 2PAMA 1UKGA 4XFAA 3TB0A 3BOPA 1RUF2 1GZ9A 4UW6A 1VBC1 4BQ1A 3R4DB 4XDQA 1H8TC 3RI8A 3LCPA 2EALA 3NVCA 1I6XA 1M06G 4AGRA 2RS52 1D2QA 4AI1A 4OFGA 3KQRA 1WLWA 1HQNA 4B29A 3AMHA 3IIAA 2PHDA 4FSJA 5BPXA 2AR6A 2ZMNA 5KHKA 4K6BA 4RS5C 4KQ7A 1GFF2 1UPIA 2D43A 2YPJA 1SLBA 5T5PA 3FX3A 3EXUA 4E4SA 3ZYGA 1FYUA 1SLTA 5BNPB 2PELA 2A6ZA 4CTEA 5BNPA 4P9XA 3WZ1A 1D4M3 1AR83 3WD5A 4DRRA 3ZN6B 4XXPA 3ZN6A 5GZCA 3WW2A 4EWEA 2ZGSA 3VHNA 4CDUC 4OVEA 1RJ7A 3MIFA 1PVC2 2TNFA 4Q4X3 2VOKA 1Q8OA 3FLRA 4ES8A 2N7GA 2CGNA 4I0WB 2DFBA 1ZZBA 1ULFA 1X36A 2D3RA 5JVVA 1OSGA 4Z07A 5JAXA 1RUNA 3MLKA 3VBUB 3VBUA 1Q8QA 2A3YA 4ASMB 3GZTB 2GAUA 2ZGQA 2HWB1 3WNXA 1UCXA 4CP2A 3NV3A 4P9WA 2QKDA 2DUPA 4P9LA 1KFUL 3BALA 2WFPA 4HK8A 2XJSA 3RJ2X 5GLUA 2DWRA 3ZXGA 3WUCA 1DG6A 3M3CA 4FXGB 2DVGA 1ULGA 2YXSA 3LSEA 5KC5A 2B5HA 3OGGA 1LHNA 1KDKA 1OKQA 2E7TA 4A3XA 4QMAA 4XMIA 3RYKA 4WM7C 4R9DA 2H0VA 3C2UA 5F1RA 1BEV2 1N3OA 2C5DA 5AC91 4U36A 1C1LA 1OFNA 3NO8A 3B94A 4ITCA 3THTA 2ZGMA 5HCFA 4ISQA 1Y7BA 5J37A 4AG4A 5HBAA 4NPRA 1R1A1 2GMPA 1X8MA 5BNQA 2UU8A 4AQ2A 1MS0A 1YJLA 1ZVFA 4W6YA 1GANA 3W9AA 4YGDA 1DQ2A 2RR11 3BOWA 1W2UA 1W6MB 1HRV1 3ENRA 1W6MA 5D8AA 5D8AB 3ZSEA 3WDTA 1NCQC 4CDXB 1QOTA 1WCKA 4CDXA 5HCAA 1Z78A 4Q4Y1 3WXPA 1XU1A 3P3PA 4I3PA 3WX5A 1ENXA 3MIDA 2D7FA 1ASJ1 1HV1A 2DF7A 3VZMA 3WP6A 4RHV2 1XNCA 5C4WB 5C4WA 4XJ9A 4Q27A 2K0GA 2GMMA 4IEOA 1LCLA 3DN7A 3OGJA 1WBLA 1DYKA 1JH5A 1Q43A 1WD3A 1WD4A 5CAZA 2XWBB 1D2SA 1RUC1 2WSVA 3H1MA 4CEWC 3LA7A 4YSFA 3V56A 1MS4A 3D8CA 2A73B 4PIZA 2WS93 3L2HA 5BNPC 5LRRA 1PGL2 2VECA 3MI8A 3EJKA 2NMNA 2PLV2 3SNMA 5CG9A 3K48A 3R4UA 2BWAA 4GULA 1VBD2 5K0UC 1O3TA 4GH4B 2Y26A 4GH4A 2X53S 4AVAA 4HMZA 4OI4A 3N7JA 3H9AA 1BK1A 4FQ4A 1IZ3A 2DUQA 3APBA 1AUYA 2RM21 1UZYA 3JB4C 2XL7A 3ES4A 4BMEA 2XHKA 1REFA 5J09A 4GWNA 5LEKA 2Q4SA 5C6CA 1RVF3 5L19A 3WQ0A 1Z7S2 1XQNA 3RWNA 4ISRA 3JCIA 3RMXA 4K3UA 2R32A 4MH0E 2Y0IA 3M4FA 4M0NA 2ARBA 1RMU3 2ZTNA 4DZGA 5CFDA 5CFDB 3VBSC 1QOSA 3JBG2 1H1AA 4J1WA 4XJ8A 4GKXA 1AR71 4I0AA 1J3PA 4AEJA 2UURA 2GDFA 3NJZA 4R9CA 4G4FA 1KD7A 4JV4A 4CDWB 4HK9A 4CDWA 1AVBA 3C3VA 3MW2A 5E8AA 1PHMA 4Q2FA 2W52A 2O1QA 1PO21 1UZZA 5I8YA 1QJX3 4LBQB 4LBQA 1ONAA 1WLCA 1MQTB 4C91A 2XUMA 1MQTA 1MS1A 2C1FA 3ZN4A 3USSA 2R062 2QNKA 2UWCA 1PGW1 1YFYA 2MNGA 3POYA 4CDXC 3PVEA 3GBWA 1LJ7A 3OYWB 4JC1A 1MZ5A 3OYWA 3S0MA 3FMGA 1LGBA 1O5LA 2BBVA 1RUE2 5C8WA 1NA1C 4JDNA 5LEJA 4H55A 4LO6B 1V6JA 2WJSA 3B9CA 2LUWA 1S0DA 1S2KA 5T5OA 5JOZA 5JWPA 5AC93 1LHWA 5DUXA 4UW5A 2D98A 4Z8BA 2MEV3 3O0VA 2HWB2 2I74A 2OZ6A 5ABJB 4LBKA 5ABJA 5KXDA 4MYEA 4FTEA 4ZU4A 4YG6A 3IWZA 3PMSA 1SBFA 2ZGNA 1BMV2 3AMNA 1EP0A 3WG2A 4LHLA 4LUMA 4AGVA 4Q4V1 2IZWA 2Z2SB 3AKPA 3T1MA 3AP5A 2DCZA 2RS12 2EA7A 2I45A 2JG9B 2VY0A 2JG9A 1BBT2 5KXCA 3MZHA 1RL3A 5DDJ2 4O9EA 2D3SA 3ILNA 3WDYA 2ZMLA 3DF0A 1AYM1 1DLLA 3T1LA 2I07B 4IXLA 1RIRA 3RPQA 3U11A 2HWE3 4OHZA 2A6VA 1DQ4A 1NG0A 1XRUA 1UIJA 4HKWA 3S7IA 4LE3A 1HIXA 3ZFEB 3ZFEA 1KXGA 1RUG3 2PA7A 5GALA 1X50A 5J96B 4YFZA 1S0FA 5ACA1 1VRH2 3BPZA 1ZRDA 1GNZA 1FOD1 2O8OA 1HRV2 3ZMNA 1AF9A 3TWIA 1H1IA 3H3ZA 1UMZA 1FX5A 4LULA 2CNAA 1TE1B 4AFBA 2WSUA 5JIUA 2RS33 3P3NA 5CFDC 4FP3A 1ASJ2 4XFIA 4AYUA 5EJ3A 4FTSA 4XFGA 3GHNA 1RUH2 1TEIA 2WKKA 3ME2A 2Z5WA 1PO11 4EV0A 4K21A 3PVOA 1DGRA 1ZX5A 1WMDA 1Q56A 4V1PA 3NV2A 1UIKA 1EAH1 2BFUL 4IEVA 3SH4A 1Z0HA 1RUD1 1MR5A 1WW7A 1S0JA 1O4YA 1LODA 1DHKB 4AGGA 1HLCA 5JSPA 4AF9A 4YVWB 4YVWA 2ZHMA 3VLBB 1RITA 3FLPA 2ZZJA 4J1XA 1AXYA 4AEDC 1FMD3 5FLJA 4LUKA 3A4UA 5J36A 3VL9A 1AL22 3HAGA 1GZCA 3SITA 3H8UA 4I09A 1QJY3 3UJOA 4LNVA 3WG3A 5IK5A 1YRZA 1YUDA 2WLQA 3M7AA 5F5QA 4FTBA 1SMVA 1PK6B 1OQEA 2HEYF 1PK6A 1LOAA 3V65A 4ONUA 2RM22 4H7LA 2VNOA 1FV3A 4DINB 1NQDA 1UD1A 1HRI1 2BVVA 2AZ5A 3B7MA 4D7SA 4HVOA 4XF0A 1IPJA 3GYDA 1C8M1 2GALA 2OPKA 4FPFA 4Y1VA 1O3SA 5JR7B 2D5FA 2KA3A 4U2AA 4XBLA 3I54A 1KJRA 1ZZCA 1SBEA 4C1XA 3E6DA 2SLIA 3AB0A 3UK9A 2JG9C 1DZRA 1VBA3 5I0TA 4L8QA 3R6SA 4HSJA 3GZAA 5E1RA 3MW3A 5FOJB 3CEWA 3U4XA 5IUQA 1XNKA 4DQAA 2R1DA 4YG3A 1VBE2 2CV6A 4K20A 4WV8A 3SH5A 1CIWA 3QD6A 4NVPA 3WW3A 5BNOC 1RGSA 2XKPA 5DZFA 1GYKA 1ZBA2 3HBZA 1LENA 5JIAA 3ZFEC 5DUVA 1PO22 1QF3A 2PHWA 4OHWA 5FPXA 3RRDA 4M3CE 4YNIA 4SLIA 2VXRA 1SACA 3B3QE 2QCSB 2FMDA 2XVLA 3GZUC 4Q4V3 1IKQA 4D7YA 1JUHA 4EROA 4AHWA 1RUJ3 4M3CF 1QQP2 1C28A 4FPJA 1W6OB 4N53B 2DCKA 1W6OA 4N53A 4XF4A 3DV8A 1EV13 1C4RA 3UKNA 2NMOA 1MEC3 3MLLA 5K9YA 3RJRA 2Q1MA 2P3IA 2IXLA 3NV1A 1WW5A 3OD4A 5JSOA 2R043 2QDNA 2BEOA 1AYM3 1BQPA 2E9QA 1NXD1 3AM2A 4YZ3A 3H3UA 2G9GA 2CAUA 2E63A 1LU1A 5A3LA 4N9IA 1NOVA 5BYNA 2WFF2 1RUOA 3WDXA 2DYCA 1D4M1 1YIFA 3GF6A 5FMOS 3EO6A 5KHHA 3VKMA 5DUUA 1H8TB 1H8TA 4YW5A 3RZZA 3VBOC 4Q4X1 3NL1A 5GKAC 4HLTA 2ET1A 1OHFA 1EYBA 1OFSA 3DPRC 5FO7B 1V6OA 2ZHNA 1QJZA 5JPNB 1MVEA 1V9U3 2JDZA 5DXDA 1B09A 1LHVA 2HWC2 3POSA 3PTYA 4P9YA 4BPZA 3N36A 4RS5B 1I9RA 4RS5A 1H2LA 4JQRA 1IOAA 2VOWA 4QPGA 4N9HA 1YWKA 2DU0A 1NY72 1RHI2 2HEWF 3QBQA 1VALA 3R4SA 3IMNA 3M70A 4NOTA 5AVAA 3IM0A 1FPN2 2ZPXA 4KNCA 4RR3C 3NAPC 1FOD2 4CDUB 5FPZA 4Q0PA 1LOFA 3B02A 4OUSA 2WA4A 2QVSB 4LR4A 2GNTA 3GNEA 3ZXDA 3ZMOA 4QGNA 4LBMA 1O4ZA 2ZGTA 1DZTA 4Q1PA 4Q0VA 3RDIA 3HQXA 3RG0A 4AK3A 3IN9A 4Q4W1 3OD0A 4JGZC 4Q0SA 1O7FA 1A8DA 1NYWA 3ROUA 4XPVA 4AI0A 4QQOA 4AHXA 2HKXA 4QU2A 1RUI2 4HT1T 3LOIA 4HETA 5C9AC 2EAKA 1MS8A 2QE3A 2ZS6B 3WT3A 4CP1A 2IXHA 1AYN2 4I2OA 4XIOA 1RUD2 1H1MA 4JDOA 3WP5A 2ZABA 5FO9B 1XE7A 3AYCA 1DGWA 1NQJA 5GLZA 4OHXA 1CR7A 3UKTA 3U0ZA 3V0BB 3AZVA 3V0BA 3KT4A 4WM7B 3ECQA 1VAVA 1F31A 1FATA 4MGKE 1LHOA 5J98B 3ZSJA 4FOQA 1OQ1A 3S30A 5KBFA 1R081 3FE5A 3TAYA 1ENSA 1OA2A 2RMU3 5F6KA 5JZGC 4E4DX 3ZSLA 2WT1A 3S7EA 3AKTA 3KCCA 2WS91 1OLQA 1HRI2 4K1YA 1NCQB 1ULDA 1NCQA 3HN1A 1QXJA 4PLNA 1M4WA 5H9SA 3B69A 4XFCA 1J58A 2VU9A 2C0ZA 3KSCA 1ZYBA 5JSRA 4X8NA 1AR92 1PZ8A 4MSVA 2V5YA 1HDKA 3KM5A 2QFEA 5CADA 4DS0A 4MGZE 4EN9B 1KRIA 1WGPA 3ZN5A 3HT1A 3ZPYA 1SLCA 2NZ9A 3CO2A 1YIPA 3SXWA 1BXHA 3A0KA 2V73A 1I5ZA 4XXAA 1NLSA 2NPIA 3D4KA 3D6EA 4PLOA 5F9TA 1AXZA 4ORFA 1AL0G 4QPGC 4CEWB 2R30A 1R091 1RVF1 1QY4A 2GC2A 4CEWA 1OD5A 4XW3A 2W39A 1AX2A 2PN5A 1GQHA 4JRLA 1PGSA 4XQDA 2A5ZA 3QOPA 1QNYA 2JE7A 1RMU1 3TOJA 4DB5A 5FDBA 2HWD1 3WG4A 5CBLA 2BYVE 4QXKA 3LOBA 1DYPA 1LOFC 2DVFA 3L9JT 5A32B 3VBFC 5K0UB 5A32A 5K0UA 3JD71 2XLAA 1RC6A 1S0CA 2R16A 3IKWA 5TSWA 3QH6A 3AP6A 4I30A 3WP3A 2OYZA 1N1VA 2A70A 2G4IA 3FUQA 4HKOA 5EFUA 4MZUA 1DDLA 4OHYA 1UU5A 3AZWA 4WVMB 2C9AA 4WVMA 3VDDC 4DPNA 2R071 5C8CC 1QJX1 1FAYA 3MYXA 1OI6A 3KCXA 2QZ2A 3PVBB 4LA3A 2D93A 2PYTA 3RYRA 3N4MA 1V6NA 1AR82 4XJUA 4F3JA 5L7OC 1SEFA 2BVBA 3NKGA 2JJ6A 4C90A 1BKZA 4XBQA 1ULEA 3VBSB 3AZXA 3VBSA 5IK4A 2Q5TA 3KLSA 2JENA 4HL0A 5SV5A 1GKBA 3O7OA 1CJPA 4P9IA 4DOUA 2BWCA 2XKOA 4MUVA 3VKLA 4GA9A 4F8AA 2PHTA 1W6NB 2AGSA 5EZWA 1W6NA 3AP7A 2MEV1 2UY8A 3ELNA 2BNNA 2ILMA 4Q4W3 4XQ4A 4YM1A 1TME2 3VKFC 4OI1A 1ULCA 4CRQA 4LHNA 3TN92 2JICA 2A3XA 1G7YA 4IQPA 5AFBA 3LSDA 4MXVA 4AEKA 2VPVA 1TNFA 5C33A 1QOOA 4A2UA 1SDWA 4FAHA 2BW8A 1GSLA 1MS9A 4QD2A 1NLRA 4Q0QA 3CF6E 2YHJA 1R1ZA 1WLDA 4C0HA 1Q5OA 5FO8B 1NA1B 1GQGA 1YFWA 1NA1A 1EPZA 1BYHA 3VBRC 1J3RA 3E5XA 1UKRA 3E5QA 4L97A 5GLWA 2HWE1 2OUHA 3ZYRA 5BXXA 3FC0A 2XJUA 1RUG1 3AXEA 1R083 1OPMA 1PM7A 4EN8B 3MIBA 2BNOA 2BPA2 1JBCA 2PAEA 1UPSA 1VJ2A 2ZZQA 5KC6A 2HWF2 2V09A 3WR0A 2B39A 4M01A 4PDWC 2D3PA 2PTMA 2RS31 4NWVA 5H9PA 1AZDA 1TMF3 1NCRC 1O3QA 1DFQA 1X33A 2JG8C 5E16A 2XG3A 2ETEA 5E89A 4GXLA 4KU7A 1H9WA 3ZXJA 1NE6A 1DGLA 3I7DA 2F6BA 1S0EA 4Y22B 1C8NA 4Y22A 2DCYA 2OIIA 1OA3A 1VP6A 3WCSA 4XE9A 4XQWA 3M2MA 3E6CC 4XETA 3MPBA 4HVQA 3RSJA 3KMHA 2BQPA 5GZDA 1NZCA 3WCRA 1MVQA 4MGYE 2GN3A 2WS92 1R093 3JBG3 3HD8B 1U5XA 4FPGA 4S2DA 4XFHA 2IFRA 1SFYA 1XYPA 1QJU3 1FMD1 1VBC2 4GKYA 2A71A 1ZZ9A 3RYPA 2HWD3 1JUIA 3H7YA 1QJY1 4W6WA 2BNMA 4QGLA 2DTYA 4E4ZA 3POWA 2Z42A 1COV3 4OUMA 3JD73 4LHKA 1H2MA 4META 4N43C 1F2NA 4AI3A 3M3IA 5DG1A 2ZGUA 3L2YA 5CNAA 1LESA 4I02A 4NR1A 1LHUA 1LKNA 3VZNA 2WC2A 4COVA 5HCBA 4BE3A 2R063 4IV3C 3ZO0B 1VBB3 3HR9A 2XBO1 4JRAA 1IS6A 5EWSA 1BZWA 4YYOA 3VN4A 2UYAA 4XJWA 2R073 3JQXA 4QM8A 2ZHKA 2ET7A 1RUE3 4WVVA 4B7EA 1ZBE3 1RMU2 1FT9A 4BIOA 4AEDB 4AEDA 4FXKB 3WW1A 4CZSA 4BLJA 1VBA1 4LBOA 3SCHA 2PHXA 1TNRA 1ZREA 2YROA 4N7IA 4H14A 2ZKNA 1JOJA 4NHKA 4Q8KA 4I01A 1YXWA 1CX4A 2GC0A 2XLFA 4UBHA 1ENQA 3CLPA 2XWJB 4CEYC 2W08A 4C1WA 4RA0A 2GNDA 4Q1RA 4HBNA 1IPKA 4AFDA 3PJYA 2WZR1 4MXWB 4MXWA 2AREA 4JGYC 1OLRA 2RS13 4WVZA 3GALA 4XILA 4IEYA 1RUJ1 1IS5A 4AHYA 2QDRA 3DGTA 3ZXEA 3ZFGC 1EV11 3MDPA 2ZGLA 3LGRA 2WZPP 3X29B 3D5OA 1MEC1 2YY1A 2UWBA 4Q26A 1G9AA 2R041 1K5MC 4TZDA 5HI0A 5AC92 5BNOB 1J1LA 5BNOA 2MEV2 4GMP1 2XLGA 4P9GA 1VR3A 4L9BA 1HXS1 1R1A2 4JVAA 1Y3TA 1PVXA 4SBVA 1NE4A 4KWLA 3AMPA 4W65A 3VL8A 2RR12 2X5IC 4IEWA 4YRDA 3WINE 4Q4Y2 3FJSA 5I0RA 1Y9QA 3IDEA 4HN0A 1V9U1 4RSUA 2D6OX 3SISA 2PQQA 4Z92B 5KHGA 2UY9A 5JLVA 2PAKA 1CVNA 3TNPB 4KGQA 1ZA4A 1S55A 1V6LA 4L99A 3QLQA 3VBHC 2VVEA 3AFGA 1WCSA 3ACLA 1YHFA 3ZYIB 1QU0A 4PLMA 4AVTA 2ATFA 4BHPA 4BWOA 1N47A 1RUC2 2OZJA 4S2HA 5GZGA 2CWSA 3VBOB