4LA3A

Crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
TLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELALTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dimethylsulphoniopropionate (DMSP) lyase DddQ
publication title Molecular insight into bacterial cleavage of oceanic dimethylsulfoniopropionate into dimethyl sulfide
pubmed doi rcsb
source organism Silicibacter lacuscaerulensis
total genus 54
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4la3A00
5KHGA 4XFIA 4PIYA 4GULA 3D82A 2PTMA 4L11A 4BIFA 2XLGA 2OZ6A 3R6SA 2B9UA 5KHIA 3BPZA 3SCGA 1ZZCA 3U11A 3D0SA 3FHIB 1YFWA 1ZZ8A 2GAUA 3DKWA 4FT8A 4AXOA 3RZZA 1Q5OA 2QJVA 4R52A 3TNQA 4AQ6A 5KBFA 1DZTA 3LA2A 4HBNA 1LB2A 3H1YA 3RYPA 2B8MA 4LA3A 4XF9A 5LRSA 4EWDA 4I01A 5BUVA 4HLTA 4I0AA 4QX5A 4BH9A 4UBHA 5JAXA 3E6DA 2KXLA 4AQ2A 1ZRDA 2D5HA 2PYTA 3TNPB 5LEKA 1SEFA 3CJXA 2QNKA 4WVZA 1ZZBA 2IXJA 1IPKA 4LA2A 5I91A 1EYBA 2PA7A 4ZU5A 1YHFA 3I59A 1O5UA 3RYRA 4Q0UA 4HZFA 1O4TA 1FI2A 4L2NA 2VECA 1LRHA 4HMZA 4HVQA 1O3QA 2GC2A 4KWKA 1UIKA 1X8EA 3UKTA 3BU7A 2CGPA 4KWLA 2GU9A 1VR3A 2MPFA 1VP6A 2Q30A 2XKOA 1EPZA 3M70A 5AVPA 3RNSA 4QGMA 2ZKLA 4KU8A 1X82A 1LR5A 4QXKA 2FQPA 4QGLA 1ZRRA 3E5XA 1QXRA 3D0JA 2PQQA 3RYKA 4HSJA 2WC2A 4ZU4A 2D93A 3I7DA 1EY2A 2E9QA 3RPQA 4ZU7A 1EP0A 2Z69A 4HSLA 1ZVFA 2QVSB 1H1MA 4XFBA 3HT1A 2PAEA 2O1QA 4F7ZA 4IEPA 2MHFA 1LKNA 3QOPA 1DGRA 1I6XA 4EWEA 3ES1A 1NE4A 3E6CC 1OD5A 1CX4A 3RDIA 1UIJA 4JTNA 1RC6A 1PM7A 3SXWA 2IXIA 2XGXA 2GC1A 3OGJA 1O3RA 1NZCA 4NVPA 1GQGA 4XFCA 4I0BA 1CAUA 4EWAA 4Z07A 4BHPA 1YLLA 3ETQA 4FBFA 2XLAA 4MGKE 2CAUA 2B5HA 4OLLA 3LZZA 4XETA 3DL3A 5LRRA 4Z82A 3U10A 1YWKA 2UY9A 1I5ZA 3JZVA 4P9GA 1VJ2A 2PHDA 1FXZA 2QDRA 2OYZA 3CO2A 1UCXA 2H6CA 5I0TA 4EROA 3ST7A 3C3VA 5BY5A 2XL7A 5C6CA 4E2QA 3IDBB 1U12A 4AVBA 3H1WA 3KGLA 3NKTA 5C8WA 3FFQA 1UD1A 1YFYA 3ELNA 4LLOA 1CGPA 2XLFA 4IERA 4HVRA 1X8MA 3G7DA 3LA7A 3WW3A 2FMYA 1OMIA 5FPZA 3O14A 2UYBA 2QCSB 4WZCA 3DN7A 1O3SA 4UXAA 5I8YA 3CL1A 3SMHA 4QM8A 1UW8A 4X6RB 4I09A 3S7EA 1NYWA 4QGNA 3EBRA 1QXJA 4CYDA 3H3UA 2ET1A 3HIFA 4OFGA 3HQXA 1J3PA 2EAAA 4J1XA 4IESA 2IXLA 4LTAA 5FQ0A 3N4MA 4UBGA 4XFAA 1J58A 2BGCA 5FLHA 5FQ0B 2BNNA 1G6NA 3I59B 2D5FA 2O8QA 4EV0A 3FX3A 5T3NA 2CAVA 1XE8A 3LAGA 3OF1A 1RUOA 1DZRA 5FCCA 3EJKA 4AVAA 2HKXA 2F4PA 2Z2SB 4I3PA 4DINB 3FZ3A 2DCTA 4XF1A 2Y0OA 1CAWA 4IETA 4Q0SA 4ORFA 2OPKA 2EVXA 4JTOA 4HN1A 2BEOA 1J3RA 1CAVA 3NVCA 3PLQA 2V09A 2GZWA 3MPBA 4XFGA 4BYYA 4MGZE 1V70A 5KHKA 3EHKA 4E2GA 4N9HA 1ZRFA 1IPJA 3BCWA 3WW4A 1ZNPA 1CAXA 2XL9A 1O7FA 4KL1A 1X7NA 1J3QA 1L3JA 2OZJA 3WW2A 3SHRA 4YSFA 1ZREA 1OFNA 2VPVA 3KSCA 5JSPA 3EQEA 3H8UA 4IEYA 3KGZA 3E5QA 5I8SA 2GH2A 3UKVA 5LEJA 2BYVE 3KCCA 2I45A 2K0GA 3B02A 5JR7B 2ET7A 4YRDA 5E1RA 3S0MA 3UKNA 4FAHA 5FLJA 4IEQA 3PNAA 2C0ZA 5J3UA 5J7MA 1CAUB 5CADA 4K8FA 5JCTA 2XKPA 4IEWA 4AVCA 2Q4SA 2EA7A 1WGPA 4ONUA 2UYAA 4N9IA 1XE7A 1FT9A 3L2HA 3H1MA 5EFUA 4MGIE 4XF3A 3M3IA 3MZHA 1ZZ6A 3S7IA 3E97A 4YARA 5F1RA 3NSTA 1UPIA 5BXXA 4YYOA 2ZCWA 1RTVA 4Q0VA 1YUDA 2Q0AA 4R8HA 3PVBB 3H9AA 1TQ5A 4B29A 2Q1ZB 3BB6A 3QACA 3H3ZA 2CV6A 1Q3EA 3NL1A 3NJZA 1PMIA 3VHRA 4MGYE 1QWRA 1YFUA 4QMAA 4LULA 4D7SA 4XFHA 4Q0PA 4RD7A 3SCFA 3CLPA 4MH0E 5HI0A 5KHJA 3LA3A 3E6BA 2IXKA 1JUHA 4A2UA 1GQHA 4J1WA 4IEZA 3MYXA 2PAMA 3ZDSA 1HW5A 2IXHA 4IEOA 1O3TA 1QY4A 3DV8A 4KWJA 3IDCB 1SFNA 3IIAA 1DGWA 5I93A 2UY8A 3IWZA 5K8SA 2IXCA 2BNMA 3FWEA 5FDBA 1ZZ9A 1ZZ7A 3H7YA 4XEZA 3CEWA 1Y9QA 3I54A 4H7LA 3EO6A 1H1IA 3WW1A 5I0SA 4MUVA 2H0VA 5JSRA 5J48A 1Q43A 3ACLA 1WLTA 3LWCA 5BV6A 2IC1A 1ZX5A 4D7TA 4KU7A 5E16A 1CAWB 3GYDA 1CAVB 4PIZA 4XFFA 3USSA 4HN0A 3FE5A 3ROUA 2WFPA 2H6BA 3H7JA 3OD0A 4XF0A 4JV4A 2VQAA 5CVRA 2GC0A 1CAXB 4F8AA 1SQ4A 4FAGA 1ZRCA 4I2OA 4IEVA 3E5UA 4MV2A 4IEUA 1XRUA 3HT2A 3BALA 1YFXA 4X6QB 3IBMA 2MNGA 3GBFA 5FLIA 4WBBA 4LUMA 2PHLA 5KHHA 3SCHA 2N7GA 4XF4A 4O9GA 4MZUA 1J59A 1WA4A 2ETEA 3CF6E 4I02A 4IEXA 1O5LA 4META 5I0UA 4QM9A 5EZWA 5FPXA 2PAKA 4TLFA 2ATFA 1NE6A 3NW4A 4O9EA 4MX3A 3OTFA 5CU1A 4JVAA 4PJYA 4HVOA 5BPXA 4Q29A 5I0RA 2OA2A 1NXMA 2XHKA 2K9ZA 3KMHA 2GC3A 1RL3A 4YNIA 1J1LA 3LOIA 3H50A 4LEJA 1OI6A 3MDPA 2D40A 5JSOA 2P17A 2HJIA 4LUKA 5D1IA 1Y3TA 4PIXA 1RUNA 2PFWA 4Q0QA 3FJSA 1RGSA 2BNOA 4E2SA 3OCPA 3U0ZA 5I8TA 3ES4A
chains in the Genus database with same CATH superfamily
2DFCA 1GZWA 4XFIA 5KHGA 2VBDA 3NKGA 4K20A 5HV4A 1GZWB 3D82A 2FBEA 3TEXA 3ALQA 4E8CA 2JJ6A 2XLGA 2OZ6A 3TN92 1I1EA 4HANA 1GNZA 1QF3A 1QGLA 2Y60A 1W04A 4CCCA 2HYKA 4AGVA 3SCGA 4C1XA 3AZWA 2PMWB 1UU5A 3D0SA 1YFWA 5A6QA 1ACCA 2X5IC 2EXKA 3DCQA 4AXOA 2I2SA 1CN1A 4FFIA 4PDWC 3PMEA 4RA0A 1WKYA 3M7AA 1Q5OA 3WEZA 5BNNA 4IGPA 1HRV3 1QJU2 5FY7A 3TNQA 4AQ6A 5T52A 1H4HA 2JEMA 1LGNA 5G04L 5C3SA 2VUDA 4HBNA 1PIV1 4OI0A 2P1BA 4LA3A 2ZJCA 4XF9A 1F15A 2EALA 2OW4A 2VMDA 3I3EA 3WP4A 5A1FA 2D44A 1PGL2 1ZRDA 4AQ2A 5CBLA 1KDKA 2AC1A 1AXZA 3C8XA 2D5HA 4X8NA 4XURA 1S0FA 4EZ4A 1ULFA 2WS92 4W65A 2QNKA 5JOZA 1LOGA 4QPGA 5FYIA 2XB6C 4DNYA 5C4WA 2PA7A 4ZU5A 3U37A 4EQVA 2X05A 4W6WA 1O4TA 2WSVA 2Y6FA 4NHXA 2AACA 4Z92B 1HB1A 4L2NA 1VBB3 4DUXA 4OCTA 1PVC3 5FYBA 3JBG3 4HMZA 3JXSA 1UIKA 3PTRB 1X8EA 3UKTA 3BU7A 2CGPA 2GU9A 2RHPA 1KFXL 1TME2 1EPZA 3M70A 4AFCA 1NQJA 1NY72 2DV9A 1J83A 1DYPA 3D6EA 4KU8A 4RQPB 4XJAA 4Y22B 2BV4A 5EYYA 2Q8OA 4QXKA 2FQPA 1POV0 1RUH3 1B35B 5F5QA 3GALA 2K2SA 3IAPA 4KG8A 5DZEA 2PQQA 1RJ8A 4CP1A 1SACA 1R1A1 3F2ZA 4N43A 2E32A 4HSJA 3VBSA 2FDFA 4YM0A 2D93A 1EY2A 4N43B 4ZU7A 1UZWA 1RMU3 5FXVA 1TNFA 3KLSA 4W4ZA 2CDOA 1H1MA 2W39A 4BQ3A 1S0IA 5ERLA 3HN1A 1Z0HA 5JZGB 1RHI3 1PO23 1S0JA 1VB4A 2QBXA 3VBHC 4AW7A 5JUVA 3QOPA 4IV1C 4Y20A 4W6XA 1KQRA 1PK6A 1OQEA 3B9IA 5EQUA 3RWNA 2A75A 2ZBJA 2OT7A 3ZXEA 1HJGA 1I6XA 4YW6A 1MQTA 1AL0G 2WDBA 1QQP3 1HQWA 2WT1A 4GB32 4NRPA 4D69A 5AC91 2VCCA 2JD4A 4LHNA 5HBAA 5K0UB 4Q1RA 3ZPYA 2QQUA 1UNBA 1UIJA 3I2HA 1PO13 1XNDA 4LIVA 1QJZA 1RC6A 1ND3C 1OUXA 4AOCA 1JZ4A 4JQTA 5B2GB 2AR6A 2GC1A 4JGYC 2WJSA 3VBUB 4Q2FA 1NZCA 3IAQA 3KCYA 4JHTA 4CEYC 3IDEA 1GQGA 1AR81 1WBFA 4MXWA 4XFCA 3POSA 4QQLA 1TNRA 4MXWB 4RR3C 3V0AA 1OKOA 3RZLA 1NA1A 4JKKA 3ETQA 2F17A 5F5IA 3S5AA 1EAH1 1BK1A 2ZGPA 1LNSA 3VDDB 5A6XA 1H6XA 2VTXJ 4GD4A 4Z1VA 2X29A 1Q8QA 3M8LA 2B39A 1VIWB 2ARXA 5L36A 1K45A 3LZZA 1JXNA 3DL3A 4F83A 3I4IA 1SCSA 4Z82A 4A7ZA 1POV3 3N9OA 1GP6A 1YWKA 3NAPA 5H9RA 3JZVA 4AHZA 1RVF2 4CCNA 4CZSA 3Q8CA 1CZSA 3NAPB 4P9GA 4D7YA 2PHDA 2OYZA 3M3QA 3KV9A 1UYPA 3A23A 3VKNA 5I0TA 2JG9C 5BY5A 2ARCA 4FO9A 2XL7A 1UO9A 5C6CA 1SCRA 4E4HA 2XHNA 5FWEA 4R4ZA 2P4EA 1DGLA 1IZ3A 3A7QA 5FTTC 5FXXA 3KGLA 5FJHA 3N35A 5ACA3 2BRTA 3FFQA 4EN0A 4LLOA 3WG3A 4BQWA 2P6HA 2IVIB 2ZA9A 5JLVA 1XNBA 2HYXA 1WCUA 4D6QA 1X8MA 4K21A 1VRH2 5FRAA 2JX9A 5C70A 3NJXA 4OMDA 4OUEA 1WLCA 4BE3A 3MHZA 4XBNA 1O3SA 3DN7A 3HAGA 4JRLA 5I8YA 1OURA 3CL1A 1WW7A 3WLUA 5ABJB 1A34A 4MG2A 2E53A 1JU4A 3QBQA 2W87A 3S7EA 3VZJA 1TMF3 2UWBA 1XNAA 1NYWA 4AGGA 1B09A 1W8FA 2BOJA 3EBRA 4CYDA 3MPPG 1V0AA 1F31A 2HWC1 2NPIA 1FYUA 5FO7B 3AVSA 1COV1 3ZIXA 2OQ6A 1VBA3 1J3PA 3N4MA 4DXRA 2RS13 3NNFA 1OFSA 4AFAA 2BGCA 4FPGA 4NPRA 3GNEA 2BVVA 4Q4X2 4DPNA 2XVKA 3EXUA 1G6NA 2YDEA 3I59B 1PX4A 4NUBA 1P8JA 5FZ4A 5A80A 4H7MA 5CEHA 1W2UA 1ZYBA 1AR63 4E9KA 2DWRA 5CFDA 4XJ9A 2R062 1W2NA 3OF1A 5J98B 2R6QA 2VCBA 1UWWA 4XBLA 2BWAA 4CDUB 3MIEA 1ZA7A 4OHZA 1ZBE1 2WRAA 4AVAA 4L0PA 4CU6A 2BBAA 4WM7A 4DINB 3FZ3A 5LBCA 3M3EA 2DCTA 1OOPB 2P3IA 4QDSA 3WNOA 2OPWA 1CAWA 2Y0OA 3ZR6A 3N36A 4IETA 3HMYA 2XJVA 4HN1A 1WD3A 1JZ3A 3NVCA 4CDXA 3UJQA 4XQDA 2ZTNA 4FP2A 4YVSB 3H8XA 4CDXB 2GZWA 1REEA 4QXHA 2JDZA 5FO9B 2BTVC 3VBRC 4KI5M 5KHKA 1O59A 2NMOA 2QTWB 3PUAA 4GIQA 3EHKA 3DYMA 5HV0A 3O7OA 2WWSA 1C1FA 1US2A 2DYCA 1VBC2 2VQUA 3BCWA 2VBPA 3T2OA 3THCA 1OKQA 2VTFA 1CAXA 3EYPA 4PLNA 5EPAA 5GZDA 1V00A 3ZDVA 4KL1A 4PI0A 1J3QA 1L3JA 2YMZA 3R4UA 4YSFA 1RUJ3 2WA3A 1ZREA 2VMGA 2HWB3 4J6GA 1QJX3 3ZSMA 3H8UA 1ND2B 1QOTA 2F6BA 5F2WA 1CZVA 1MS8A 3K3NA 3UKVA 2Y34A 4XZUG 5LEJA 2BYVE 2I45A 4N90A 5JR7B 4CUCA 1UOFA 2ET7A 4YRDA 5E1RA 5FMCA 3M2MA 2WABA 4Q5OA 2ZGNA 4RYDA 2C6SA 3ILRA 3UKNA 5IVJA 4FAHA 1R092 4XVHA 3AK0A 4JDOA 3WNNA 4IE4A 4IEQA 1MS4A 4NRMA 5HXVA 2TNFA 4B4QA 1O4YA 2VULA 2J1SA 2EIGA 4Y5Z0 3MFAA 1ULDA 4XYXA 2VZPA 3LIGA 4YWAA 5C3PA 3N7JA 2XKPA 4AVCA 3BTZA 2EA7A 3FN9A 1UQXA 4ONUA 5CKMA 1HRI2 4LKDA 1K12A 2H0BA 2VZTA 4CSWA 5DPNA 3ON7A 2XJSA 3N9QA 3PU8A 3A4UA 4XUPA 4XMIA 4OI1A 3H1MA 4YZ2A 1RITA 2A6XA 3WQ1A 3M3IA 3T2PA 1SBDA 5FZCA 4AFMA 4YARA 3NSTA 1W90A 4XILA 3ZFGA 1H8TC 4AEDB 4RL7A 3K48A 5FJKA 5BXXA 2W1SA 2HH9A 2DUOA 2QQIA 3QLQA 1WCSA 1IS4A 3FHAA 3ZYFA 4HK9A 1BBT2 3PVBB 4R8HA 1PGL1 1TQ5A 3RJ2X 5IVFA 2V4AA 3MIFA 5C33A 5APAA 3KV6A 3QACA 4OULA 3VD9A 3H3ZA 1EV12 3ZFEC 2D3SA 4JC1A 2YGMA 3AXEA 1PZ7A 4A6OA 1JI6A 5FZ7A 4MGYE 5DAVA 2X8KA 5HXMA 4QMAA 4LKEA 4QWNA 4XFHA 1RUG2 4Q0PA 4RD7A 1HXS3 5FBZA 5GLTA 2RS33 2QZ3A 3O12A 4UOJA 5A3PA 3MI8A 4MH0E 2I07B 2P2KA 5AVAA 4QPIC 4AGRA 1ST8A 2BW8A 3NWKA 3LA3A 4CP9A 5FYMA 1GQPA 3ILNA 4YW7A 2VNVA 4CP9B 1AL23 1SLAA 1RUF3 1JUHA 3ATGA 4YZ3A 2XBO3 1U5ZA 1VPHA 5FZ3A 3RMYA 4A2UA 4C0HA 1GQHA 1TME1 5KC5A 4YG0A 3UESA 3FL7A 1RUD3 3MYXA 4FFFA 4XAEA 5FYVA 4XABA 3WVJA 1NY71 4DFSA 3W5NA 1L7RA 1M4WA 2QZ2A 4CRQA 2IXHA 3IB3A 3BUCA 4FTSA 4P9IA 3HNMA 3IDCB 1SFNA 5KC6A 5I93A 5DDJ1 5K8SA 2BNMA 4XUOA 3FWEA 2XQRA 3H7YA 2C26A 4LO4B 2DVGA 4GWMA 3AM2A 2G4IA 2X53S 4QU2A 1HRV2 4XUNA 1VLNA 3LQCA 4COZA 5L7OA 4YZ4A 2H0VA 1K5MA 2Y6GA 2ZEXA 5FY1A 2DFBA 1BCXA 3ACLA 4P08A 2JDMA 2GP5A 1QOOA 4LO6B 4D7TA 1FNYA 1LECA 2JD9A 2XJQA 1GOHA 3G6JB 2RDQA 1D4M1 1DFQA 2VZ3A 2NMNA 1CIYA 1N1YA 3AP6A 3J8F3 2RDNA 3MUZ1 1XYNA 1LJ7A 1NAEA 1WW5A 2DTYA 1F4AA 3ZOIA 4JDNA 2Y6HA 2J1UA 2YZ4A 1QJFA 4MO3M 5FY9A 2VQAA 1S0GA 3P3PA 1RUC3 1VBB2 2WR9A 1CESA 4YFZA 1ZRCA 2RM23 4ITCA 4CCOA 3DEMA 1OVSA 3NRUA 2UURA 1SZBA 1AXYA 2WNVA 1XRUA 2AENA 5FZKA 1CONA 3MEPA 1TE1B 2A6ZA 2WO7A 4GWJA 1RINA 3BALA 3HOBA 4QQPA 1IS6A 4AVVA 5C9AA 1UKRA 3VBFA 3AL6A 4CCDA 3WDYA 5FZGA 4PI2A 1OA2A 2MNGA 3TRSB 1RUH2 5EV7A 4RQPC 4O7XA 4QPYA 4YGBA 3AKTA 3GBFA 1MEC1 5K4LA 4LUMA 3OPWA 3TAYA 1F4HA 2WZEA 1B35C 1HKDA 2N7GA 4CUAA 3ZPOA 1PNGA 1RVF1 1WA4A 3WQ0A 1AXKA 1SLIA 1Q8SA 3I2IA 2VUAA 1S0EA 2OS2A 4IEXA 3ZYPA 2QDNA 4RGGA 1F2NA 1GR3A 2P5BA 5FP8A 3MF9A 2VCAA 4YZ1A 1ULCA 2ZEWA 4YVWA 2W91A 1PO22 1C1LA 1JOBA 1W2AX 1R1A2 1YXWA 3BU0A 1VBD3 4R9AA 5JZGC 4DQAA 4MX3A 3OTFA 4URTA 1GLHA 2B9VA 2CNAA 3LEKA 2CDPA 4Z8BA 3AZYA 4Q29A 1JYIA 1JZ2A 4AQTA 2VOTA 1XPWA 1NXMA 1VALA 3VD4A 1UY4A 5EP9A 3UK9A 5K0UC 2E51A 1MS0A 5CAZA 2WFF3 5T5PA 3KMHA 1LHOA 5FXWA 4D6SA 4AG4A 2IFRA 3VKMA 2VO5A 4XXAA 5FKBA 2JE9A 5A7OA 3H50A 4HPKA 3D8CA 2EICA 3VBUC 4AE2A 1OI6A 4A7YA 5JSOA 5IVYA 3V0BA 1LCLA 3WR0A 2PFWA 4Q0QA 5DUVA 1ZA4A 3FJSA 2BNOA 4DXSA 3OCPA 3VBOB 1ZM1A 2V73A 1FV3A 3ORJA 4KG0A 4XDOA 3LDKA 4DZGA 1C8M3 1WMEA 5FZMA 4Y1VA 4IE0A 4JGZA 3LDBA 4H2AA 2VZRA 2VGDA 4GULA 5L19A 3VDDC 4DRRA 2PTMA 4L11A 2RV9A 2JECA 3IN9A 2WYSA 3O5SA 3MLLA 5A3UA 3VUOA 5GLUA 3R6SA 5C8CA 1HQNA 4GWNA 3FUOA 3CU7A 2HWD1 5KHIA 2ENRA 2XJRA 1UPSA 1YIFA 1IKQA 1Z7S3 1V6LA 3KF3A 1GP5A 2D98A 1JOJA 2GAUA 2NM1A 1D2QA 3DKWA 2DCYA 5JMCA 2FDKA 1W3VA 3DYPA 1NQDA 1NLQA 5A3NA 3WG1A 3RZZA 2QJVA 2XVLA 1QHDA 4RHV3 2C24A 2YY1A 1DZTA 2JDUA 1XYOA 3I3DA 4LHSA 4W8JA 5DABA 4BXFA 3PIGA 3GHMA 2DCJA 3RYPA 4Q8KA 3HN3A 5JIUA 2XJUA 3WG4A 4P9LA 5LRSA 1US3A 1SLCA 1W6QA 2VW1A 2GN7A 4BU2A 5CFCB 5JAXA 3E6DA 4RN5A 3IKWA 2MEV3 2W95A 1VBC1 3KQRA 1C5HA 3WDXA 4FI9A 1SLLA 2PYTA 2RDRA 1W9SA 5EJ1B 2VTXA 2YU1A 2YC0A 2DVAA 2YROA 4ISQA 2UWCA 5LEKA 3ACFA 4DUVA 4ZZ8A 4WM8B 4B3NA 5ABJC 1XB9A 1XNCA 4O65A 2J22A 1O5UA 3RYRA 4Q0UA 1VBE3 4YGCA 4YZ5A 4HZFA 3WD5A 3MUY1 1H8VA 1I5PA 4FFGA 5FWJA 4QX3A 1VBA2 5A6ZA 2VOWA 1RUE2 4HG6B 2XQXA 4BQ2A 1LRHA 1O3QA 1RIRA 2GC2A 5IVCA 4Q4Y3 4AK3A 4DXZA 2MPFA 3VKOA 4GMP1 1R091 2W9XA 3PURA 2P34A 1AUYA 1W8TA 1W9YA 1C57A 2A3WA 3RNSA 1COV2 3VZKA 4B7EA 4QX7A 1X82A 2GN3A 4AF9A 3OSDA 1YQ6A 4EYUA 4LR4A 1AYM1 2GDFA 1ZRRA 4F3JA 3W5MA 1QXRA 1NCQA 4AAXA 1Q56A 5FYTA 4DRVA 1NCQB 4CDUC 1UMIA 4ZU4A 1EP0A 2Y0IA 3C7FA 5FP4A 2NQYA 3BOPA 4A45A 4ASKA 1OOPC 1RJ7A 1VMFA 2W92A 2BPA2 3T4HB 2O1QA 4YGDA 2Q8DA 4IEPA 4IL7A 1ZBE2 1DLCA 2B46X 1YNAA 2R0FA 2ZGOA 2J1EA 5CNAA 2CWMA 4YVSC 2ZGUA 4E4SA 1BK0A 5AFBA 1DGRA 5L9BA 3ZXDA 3O1VA 5LK5A 2JIGA 1JYXA 3RI9A 4NWWA 3ZYGA 1UMZA 4ATFA 2WNUA 3NMBA 4NOTA 4COYA 3V56A 1MR5A 3ES1A 4BQ4A 1NCRA 3RDIA 4C1WA 4JTNA 2VH9A 3SXWA 1FOD3 1RUJ2 4OYUA 5FZBA 4EN8B 4QB1A 1RB8G 1DLLA 2BUKA 5JR2A 2HWB2 2XGXA 2YG0A 3OGJA 3O0VA 3OGGA 2W47A 3EMRA 2R0HA 1OXCA 5F7UA 2BP6A 1SPPA 1ND2C 2Z4FA 5D21A 4GJYA 4I0BA 1CAUA 4HKOA 4ASLA 4AZZA 4BQXA 2XMLA 1ZBA1 4NROA 4Z07A 4BHPA 2ZMLA 1FMD1 1YLLA 3MO4A 4OHXA 5FY0A 4MGKE 5JXIA 3O1UA 2R32A 4AHYA 1ASJ3 1HIXA 1OLMA 3P3NA 3CZJA 3WNPA 2D6NA 3RJRA 3SITA 2B5HA 1I3HA 3LF7A 3U4XA 4LO5B 3FLTA 3LSDA 4GH4C 5J96B 2FZ2A 1BEV3 1DYKA 1UYXA 2UY9A 1U5YA 5D8AA 5GZFA 3POGA 4QXBA 2YYOA 1VJ2A 1RUI3 3K4AA 1FXZA 2WZR3 4YW2A 3CO2A 4KWUA 1YQ2A 4PT6A 4TYSA 1NOVA 1WMXA 4TLGA 5FV3A 4BMBA 2R073 3MLKA 1XSRA 5BNOA 1NX9A 4E2QA 2GNMA 3NNLA 2WT2A 5FP3A 4AVBA 5A1AA 1GZ9A 1HRV1 1LOAA 1DQ2A 1N1VA 3H1WA 4SBVA 3WUDA 4NAOA 1UOGA 3NKTA 2VY0A 4AWDA 1YJKA 4DMIA 1W3XA 4CDQA 2RMU3 3QCWA 3JD73 3TBDA 4DOUA 2VL4A 5F3CA 4CDQB 3QH7A 1CGPA 4IERA 1NXD1 2G19A 1TZOA 2VXJA 4XIKA 4AEDC 3DPRC 4HVRA 3WHTA 3CJIA 5FIXA 2LRPA 4LMFA 3WW3A 4FCAA 4H14A 5BNNB 1CPNA 1WMFA 2P37A 1W6PA 2QCSB 2UYBA 4WZCA 3T08A 3UV9A 5LA0A 1MPXA 2VBBA 4Q4W3 5KWRA 4QHBA 1XC6A 4MGQA 1UW8A 2RR13 4NPMA 4X6RB 4AEMA 5SV5A 4DEVA 4E4DX 4YW1A 1R083 2RS32 3PVNA 4QGNA 2JB4A 3O1PA 1QXJA 3BTYA 1YO8A 3PUSA 3H3UA 2ET1A 4NHKA 5F8PA 1W6OA 2CGNA 2ZGRA 4YM1A 1VBB1 2JDNA 2Y6LA 4OFGA 1PVC1 5CYYA 4YPJA 2WIIB 3JBG1 2VCMA 2IXLA 1W9FA 4S2HA 4UBGA 3PHMA 1UOJA 2XBO2 4QPGB 1IOAA 4CP0A 5C4WB 1XOYA 3AYCA 2YFUA 3ILFA 4M00A 1RXFA 2D5FA 2O8QA 1X50A 4QX8A 4QKFA 1JUIA 3A0NA 3INAA 5F39A 4EV0A 2WLQA 4R9CA 3WQBA 4A7KA 4Z2AA 4C91A 4XDPA 5BNPA 1RUH1 3OG2A 1RUOA 1YEWA 3K2OA 3ZMNA 5L9VA 5HCHA 1O8SA 2Q5TA 2HKXA 2F4PA 2QQNA 2Z2SB 5JPNB 3APBA 3GBGA 2C5DA 4K8RB 5DUXA 5H9QA 4A6SA 3FLPA 1UX7A 2VVDA 4GZ9A 4LBKA 4M3CA 4EZHA 4AQSA 1QNWA 2HBTA 1AJOA 4Q0SA 2OPKA 1WLDA 4JTOA 3ZKYA 2OKXA 2BEOA 1J3RA 3PLQA 2O0OA 1RHI1 1PO21 2V09A 3QD6A 4V2VA 5DDJ2 2WL1A 2ZX2A 4FPKA 4G9SB 4XFGA 4PF5A 1LENA 1V70A 4MGZE 4KQ7A 4K7JA 4XXPA 3VBSB 3VLBB 3E1F1 3VGIA 4N9HA 3ZSLA 2XONA 2VOKA 4ISRA 5LCWL 1IPJA 4MGTA 1FV2A 2ZXQA 2DVDA 5C71A 2ARBA 5FYHA 5FOBB 4XPVA 1UXZA 3GXUA 1IS5A 4QDRA 3MBWA 5JXHA 2A71A 1N1TA 4Y20B 3WW2A 1PK6B 2HBUA 1JH5A 1OFNA 1DIWA 2JB8A 2VPVA 3ZXKA 1ULOA 1W03A 3EQEA 1D4M2 1PM4A 5DAPA 1UY3A 4PQQA 2RJKA 1MQTB 1UZ0A 3E5QA 5I8SA 1AX2A 2GH2A 3R05A 1DGRN 2YC2A 4KGGA 5JMOA 3B02A 3NJYA 3T1LA 1DQ5A 1OH3A 3S0MA 1LESA 1N1SA 4ET7A 4AI9A 5DN2A 4NIHA 1LOCA 2Z42A 5FLJA 3LEGA 4N53C 3R4SA 3AMMA 2C0ZA 1UX6A 3OY8A 1LGCA 5J7MA 3OY8B 3V0AB 5HCFA 3RI8A 3AMPA 1NA1B 3N9LA 1POV1 4YW3A 3ZXAC 4DEQA 5A7WA 3RZJA 5JCTA 1CX1A 5J37A 1S1AA 4YW5A 2JE7A 5FYUA 1KGYA 4Y1ZA 5JXGA 3KF5A 1H6YA 2W0XA 4M4RA 3RZMA 1MEC2 2PN5A 3J9SA 3EB7A 1VBD2 2Y8KA 4BWOA 1CJDA 1ZZ6A 2PHUA 3WDVA 4XQWA 1QH7A 4OMCA 3UL2A 4FP3A 2UWAA 4K40A 4WV8A 1WMDA 1UPIA 2JDYA 4YYOA 4BIOA 2BJSA 3LDRA 3MV11 3VDAA 1XE0A 3FFZA 1GWKA 4B29A 3PVEA 4HFSA 2WQ4A 5FPLA 1AR83 5JIAA 2OX0A 1CZTA 1F5FA 2J7MA 2WFF2 4JDMA 1WCQA 2CV6A 3OGRA 4AEJA 1Q3EA 3VDBA 2JICA 2GMMA 1KJRA 5A7NA 3I49A 1PMIA 2CY6A 3KHBA 2D7FA 1QWRA 2ZACA 2VE1A 3NV3A 5LATA 1TMF1 3AVRA 3NNGA 2AH2A 4QXCA 3THPA 3HD8B 4Y1XA 3GGLA 3HBZA 3CNAA 2F4LA 5DG2A 5LBFA 3WSOA 5KHJA 2HWF3 5E8AA 1SDDB 1VBA1 4UFLA 1RUE1 5IFPA 1IPSA 3VBOC 4IV3A 3GJBA 2FCUA 1JYCA 4QX0A 4CEWC 2A7AA 4HETA 1XQNA 4QT6A 3ABZA 4QHOA 2QQPA 1XXNA 1UXXX 4P9XA 2NZ9A 3CKHA 4XTMA 1AR61 3AP5A 4OI4A 3SEPA 1O3TA 2HEWF 1QY4A 1ENRA 2CYFA 2GMEA 3DV8A 3POBA 4KWJA 4O61A 4W6YA 5TSWA 4XUQA 3ZYRA 2PLV2 3LPGA 1IG3A 2G1MA 2UY8A 3NNMA 3S30A 2OQ7A 1OF4A 2QQJA 3KM5A 3ZFFA 2ZHMA 5FZ9A 2DURA 4XEZA 1Y9QA 3I54A 3R0RA 4XUTA 4H7LA 1HB3A 2EIDA 1O4ZA 5DUUA 1H1IA 2EIEA 2HWD2 3DXTA 3ME2A 3WW1A 5I0SA 1W6NA 5J36A 4HT1T 2ZX4A 4P14A 5CFDB 4LBOA 5J48A 1JODA 1SHWB 4IDZA 1WLTA 1DQ0A 2IZWA 1URXA 4H55A 4RGAA 1SMVA 1W06A 4CXWA 1UZYA 1ZX5A 3FBMA 3OUJA 4WM7B 4CA9A 3WNLA 5E16A 2MEV2 4XOGA 5CFCC 1CAWB 2C4XA 2QE3A 2TUNA 3W9AA 5ISLA 2LS6A 5FMOS 3BODA 1AYN3 1W39A 3GYDA 3W21A 3AC0A 1W05A 2WO1A 1OC1A 1J1TA 3POJA 4XJZA 5H9PA 5B4XA 1FPN3 2DUQA 4GA9A 4XFFA 3WF1A 1WW6A 2ZAAA 3USSA 4AHXA 1SDWA 1RUJ1 5L9RA 2CHHA 4WM8C 4IUGA 2HWB1 4P9JA 5LY1A 1QJX1 3PU3A 3H7JA 1XU1A 1PNFA 4LBMA 2DCZA 3M3CA 3VD5A 4M4PA 2WQ8A 1CAXB 1ENSA 4F8AA 2JDPA 4FAGA 3K75B 3P5BA 4IEVA 3ZM8A 4LOTA 3J7NA 4D8MA 4RS5A 4B4PA 5FZ1A 5GLVA 1GWMA 4PLOA 2A3YA 3SLIA 2JG8A 2VM9A 5A33A 1YFXA 2WN2A 1W0NA 2JG8B 4X6QB 5KXBA 1AR73 1C8NA 2FHRA 1SG3A 4P02B 5FZIA 3OJBA 3SKVA 1TVGA 5A3WA 5K7PA 5FLIA 2PHLA 1EUUA 3MLJA 2J1RA 1VMHA 4XF4A 4O9GA 5JDBA 1J59A 3PUIA 3VD3A 2QFEA 3CF6E 5LZ6A 1O5LA 1LOFC 1Q8PA 2VQTA 2C1FA 1AYM2 4CDWA 4QM9A 3WCRA 5FPXA 1QJY3 2PAKA 3LPFA 1AR93 4AR2A 4BM8A 3RZKA 2ATFA 2JIJA 4O9EA 4NAMA 1BKZA 4QHZA 4SLIA 3GZUC 2Q8CA 2DDUA 5CU1A 1F35A 1G86A 2ID4A 2R1BA 4JVAA 4PJYA 5LW9A 4QD2A 3BTXA 1OHFA 4HL0A 5I0RA 2Q8EA 1UF2C 2VXRA 3O0XA 4OI2A 3WOGA 3UJOA 5FMOL 3ZMOA 2JXAA 4JRAA 3OB8A 2K9ZA 1FOD2 3ZFGB 2Y38A 1UZZA 4S2FA 2ADDA 1KJLA 3TB0A 5FMBA 3NQHA 3DECA 5LB6A 4NN0A 4BB3A 3RWKX 5A1LA 3KS7A 2E7QA 1HXS1 1XJAA 2RS31 1H2KA 1ULPA 2P17A 2BDRA 4UF0A 5D1IA 1RUNA 3PTYA 3I2KA 5IAXA 4A3ZA 3TN93 4X8PA 1GZCA 1GZTA 4ZXKA 4DY5A 2VR4A 2X5IA 2G9ZA 4LQRA 2IFWA 1ASJ2 2WAAA 2ZEYA 4Q4V3 4XHXA 3ES4A 2BFUS 4PDWA 5DZFA 3UT0A 1RUF1 1LGBA 3P6BA 2Y26A 2XBO1 4MVTA 4PDWB 4TXWA 4Y33A 5E88A 1ZBA2 4OQ9A 1RUD1 3WDWA 4DUWA 1FMD2 4Y5SA 2VZSA 2ZPXA 2VU9A 4V1PA 1KD7A 1QJU3 3OGVA 3C7EA 3BPZA 3WQ7A 4NJ4A 2WZR2 4XJ8A 3UGHA 1DCSA 1ZZ8A 4B1MA 4XIOA 5FYSA 1IGOA 2JKBA 3N7MA 4LORA 2R072 1NLSA 3VKFC 1D0HA 3S57A 2ZGSA 2EF6A 2ORXA 1G9BA 1MS1A 3LA2A 5EHDA 3ZYBA 1SLBA 2WZ8A 3L9JT 4MADA 1LB2A 3H1YA 1W8UA 1V6KA 3Q8FA 2WS93 2B8MA 4JHZA 3AYAA 3H0OA 4BQ1A 5J1XA 1TG7A 4I01A 4HLTA 4I0AA 3H3LA 3C7HA 4DY3A 3LSEA 5B4NA 1XNKA 3GCXA 4DIQA 4COVA 5L7OB 3VB9A 5IJRA 3C7OA 5BNNC 3K4ZA 2OVUA 3TNPB 3J8F1 1K5MB 1SEFA 3CJXA 2D3RA 2VC9A 4UWDA 4WVZA 2CSGA 2IXJA 3J7HA 5FZEA 5ANQA 3THDA 3OEAA 5FPBA 1IG0A 2PHTA 3DUIA 4UFIA 4CCEA 3BIWE 3WHUA 4NIDA 1R082 3KQ4B 1BLZA 1YHFA 4YLZA 3B3QE 5DG1A 1NT0A 4R4XA 1X9TA 1EPWA 4D94A 1PGW2 1TME3 2DBNA 4JZRA 1D4VB 3SH5A 4FPJA 2YPDA 3LCPA 1UMHA 4LKSA 2BBVA 4AI2A 1LODA 1RUC1 2WBKA 2RM21 3RQ0A 4KWKA 3IZOA 2E7TA 1H4GA 1BXHA 4XDQA 2WQZC 4KWLA 4NHLA 2Q30A 2BFUL 2XKOA 3B7MA 3SH3A 1D2SA 4QGMA 3OUHA 4QPGC 2FD8A 4U36A 2ZKLA 1DHKB 5C4WC 5IATA 1LR5A 1BQPA 2QKDA 3VBHA 1PVC2 5A32A 5JOWA 4CCJA 3JBG2 3KB5A 4FVVA 4IV1A 3O1OA 1N3PA 5IVEA 1XNTA 3D0JA 2FMDA 1F8VA 3RYKA 4Z2WA 4ZS2A 3HPNA 2WNVB 4H3WA 1UAIA 1OF3A 3GZEA 4IE6A 3RPQA 3U75A 2ZGTA 5BNQA 5C5TA 2Z69A 4K1YA 2D6LX 5C9AB 4HSLA 2QVSB 2XH6A 4P5YA 3VBFB 4K1ZA 4MLOA 3HT1A 3GZTB 2PAEA 2A6YA 1ND3A 1QDCA 3IPVA 4GB33 4JCKA 3POWA 1VBD1 3POEA 5A3LA 1LKNA 3KCXA 3IPVB 5E6HA 5CG8A 1Y9GA 2VW0A 3LB9A 4LO8A 4JGYA 1RMU2 2AEYA 4CEYA 1JW6A 3CZUA 4D3WA 4N43C 5HCBA 3VBSC 3I97A 4CEYB 4QX2A 3MIHA 3MIDA 1QH6A 4EWEA 1HLCA 2J1AA 1RHI2 3WNKA 4GAZA 3N9MA 4RR3A 5FY4A 3OYWA 5A3MA 5CKNA 4YVWB 4TTGA 5FR3A 3E6CC 1OD5A 1CX4A 3OYWB 4LBQD 4Q1PA 2OUHA 4COWA 2WFF1 1KFUL 4OVEA 4XACA 4HKLA 3T3YA 1YIPA 4CP2A 4XW3A 2IXIA 1W6MA 4NE9A 4AEKA 1LOEA 1DQ1A 1PK6C 4YW4A 1O3RA 1W6MB 1QQP2 3BPSA 4OHVA 3O1TA 4NVPA 5F5AA 4BCUA 4FTEA 4Q27A 1MQTC 3T09A 1PO12 1H2LA 4GXLA 4D6RA 2FZ1A 1U5IA 4FBFA 2D6PA 2XLAA 3Q8EA 2JG9A 2CAUA 1C8M1 2BQPA 4R9BA 3T0AA 3VL9A 2J1VA 3AMNA 1OLME 2W2IA 3K3OA 4NHYA 2GSYA 5FY8A 3HNYM 3N7LA 4AFBA 4N8MA 4HPKB 4OLLA 5JWPA 4XETA 5LRRA 3IT8A 3V0BB 5E89A 2ZKNA 2B42B 4LBQA 1CQ9A 4PF1A 3N9PA 3UYJA 4LBQB 1IS3A 4CXYA 1NA1C 1Z7S1 2WO2A 2WO3A 4YFWA 2QDRA 2PLV1 4JGZB 4ARXA 1UCXA 2H6CA 3ST7A 1N3OA 4BK4A 4MGSA 1KDMA 1XYPA 1YQ5A 4FPLA 5T54A 3LGRA 1VRH3 5CG9A 4RHV1 2V5DA 2X09A 3Q8BA 5C8CB 3OGSA 4YG3A 1OQDA 1JU3A 1GWLA 4S2GA 3U4SA 3B94A 4Y1UA 3I3BA 3ELNA 4IQPA 1MZFA 1H30A 1U0AA 3NAPC 4AVTA 1IHMA 1GV9A 1S2EA 1CWPA 2XXZA 3I2GA 3VZOA 1V6OA 1JOPA 5FZHA 3LA7A 4AAPA 1ZRIA 3K77A 1GMMA 3HEIA 2DTWA 2FMYA 2MEV1 1OMIA 1DYOA 1ENQA 5FPZA 5ACA2 1YQCA 3I3MA 5EYXA 4FXKB 4UXAA 4E4ZA 5H9SA 2P3YA 5FP7A 2E31A 4XHBA 4ZHNA 2RS53 4QM8A 2NYYA 4BDVB 1WD4A 4LNVA 1W6QB 1MVEA 4EN9B 5HPOA 5JOXA 2QQKA 2RG4A 1X9PA 4XCAA 3ITQA 1VBE1 4Q4X3 4UFHA 4QPWA 1W9WA 1MZEA 2ZAHA 1GICA 4UW6A 4J1XA 4IESA 1W0OA 1BVVA 5F32A 1TMF2 2R063 5FQ0A 4K9SA 5KXEA 1J58A 5FQ0B 4Q4Y1 2OXBA 4C90A 3LIHA 3OUIA 2V5YA 3JQWA 5KXCA 2VJXA 5DAWA 2VNRA 3USUA 5IW0A 2NP0A 4BXSV 4OZOA 5FZOA 3FX3A 5F6LB 1VE0A 2CAVA 3BN6A 2RS12 2EXJA 4WVMA 1H9WA 3LAGA 3VBRA 1DDLA 1DZRA 4WVMB 2WNOA 5EJ3A 2C9AA 1UYZA 2E26A 4I0WB 1HN1A 2Y64A 1W9TA 5DZGA 2VVEA 4LK7A 3ZSKA 3W20A 1AR62 4QB2A 4ORFA 5LWBA 1ODNA 4K3UA 3CHXA 3B93A 1CAVA 2WKKA 5CFDC 1F9KA 3DF0A 3MPBA 3VHOA 2G9FA 4BYYA 2LM3A 4TN7A 5JI9A 1ULEA 1E5SA 3WNMA 3NV4A 3H42B 3M3OA 1AZDA 2VVFA 1E5RA 2R49A 3NNJA 4WM7C 4Y4RA 1ENXA 1ZRFA 1ZNPA 4BJ0A 2BVBA 2XL9A 3TEWA 5I0DA 1FPN2 1LEDA 1OPMA 1NUKA 4FPEA 1MS9A 1X7NA 4CDXC 2OZJA 5IYYA 1FOD1 4BOWA 2CWSA 4L92A 2R043 4LIUA 1QU0A 1K3IA 3KSCA 3GZAA 5LBBA 1UY0A 1AX1A 3FLRA 3PDQA 1R1ZA 4GJZA 4IEYA 1R093 3KGZA 3VN4A 4J25A 2WNUB 3ZX7A 1W8OA 2B45X 3OEBA 1W8HA 5LA9A 2W94A 2K0GA 1NCRB 1OA3A 3D3AA 3L2YA 2GH8A 5GLWA 4HK8A 4BQ5A 4M01A 4NWVA 1QJX2 5BYNA 3OBTA 4WVVA 1ASJ1 1L7LA 1E57A 3PNAA 3V64A 5IK7A 4HONA 1HRI3 1SPPB 2ZX3A 1KEXA 3J26N 2IVJA 3OPZA 3K4DA 1CAUB 2ILMA 4K8FA 5FUPA 3J4UH 3AJZA 3Q9OA 1G7YA 1H8TA 1BEV1 1Q8VA 2RDSA 3LEIA 3K51A 3VL8A 3WP3A 4G4FA 2AZ5A 2Y33A 2ARAA 1LULA 4IEWA 5IHRA 1HV1A 1RUI1 2ZS6B 1AX0A 3SQOA 1H0BA 1V9U3 2WZR1 3AMQA 2UYAA 4N7UA 4BMEA 2P3JA 1WCKA 1SBFA 3AKSA 1JTZX 2W52A 1QJY2 1XE7A 2R071 1FT9A 4UW3A 3L2HA 3RZGA 3TEYA 2XDVA 1W2OA 1BBT3 4LXLA 4MGIE 4XF3A 1H9PA 3ZFEA 3E97A 5F1RA 2E63A 1ONAA 2GNTA 2LALA 4FPYA 1QKQA 1EV13 2EXIA 2RMU1 4IE7A 5D8AB 3JD71 4E8DA 5FOJB 1PX3A 2A73B 3ZIWA 4AI0A 2Z5WA 2ZCWA 1RTVA 2QQMA 4GALA 1YUDA 2Q0AA 1S55A 3AP9A 5BNOB 4QPIA 2Q1ZB 1RUG3 3AP4A 4QKBA 2FDGA 1AHSA 3NL1A 4PQ9A 4Q4W1 2WN3A 2RR11 3ZFGC 1SLTA 1YFUA 4QX1A 2VMIA 3CJIB 1OT5A 4U2AA 1R081 4L8QA 5FZDA 3ZN5A 5IK4A 3RVHA 2HWE3 5CKQA 1H1AA 1FATA 2GMPA 1PGW1 1DQ6A 4QU1A 4ZKTB 1W6PB 2VOXA 2TBVA 1LOBA 4MXVA 3A21A 4UW5A 4Q4V2 2HEVF 2W1WA 2ZX0A 3PUQA 4FOWA 1AVBA 2IXKA 3WF2A 1HXS2 4A41A 4C8DA 3WF4A 5FZ6A 4J1WA 4IEZA 4UFJA 4MHRA 2BERA 2PAMA 3WCSA 5FZ8A 1OD3A 3WDTA 4XQ4A 1KRIA 3AFKA 1HW5A 3ACIA 4IEOA 1W6OB 1AL22 1LHUA 5GJ6A 2ZEZA 4Y4YA 1HX6A 1RUF2 3IIAA 2QQWA 4M0HA 5IVVA 3VDCA 1RUD2 5CA6A 3POYA 1ZZ9A 1ZZ7A 4GKYA 1TEIA 3ACGA 1GU3A 4QAWA 3JU9A 2VMFA 3RRDA 1O6UA 3OBRA 1I9RA 2W1QA 3EO6A 4HKWA 5IT6A 4Y1YA 2WSUA 2P6CA 1UU6A 1YI9A 5BNPB 3LFIA 1G9CA 2YHJA 1PIV3 5DUWA 2JKXA 3AZZA 3OPTA 5FPVA 1KS4A 3LWCA 5BV6A 4XJUA 5C3QA 1WCDJ 1RMU1 3I2FA 4ATEA 4KU7A 5IFTA 1CPMA 3B5LB 5FZFA 4M3CB 2CGOA 3AYDA 4CPBD 2VG9A 2IUWA 2ZABA 3MV01 3FC0A 5L7OC 5JI7A 1RYYA 3O1MA 4JKLA 1K5MC 4HN0A 4I3GA 1YQ8A 4CU8A 4LO7A 3ROUA 2WFPA 1OPOA 3ZLIA 1QQP1 3OD0A 3GCWA 3B01A 4Y22A 3KT1A 4RQPA 4ZONA 3T2QA 1X36A 3J8F2 4JV4A 5CVRA 5F5CA 3T1MA 2E33A 3WY6A 3M4FA 1B35A 1SQ4A 1PO11 4L99A 4FXGB 3E5UA 1NKGA 4MV2A 1PVXA 3WT3A 4IEUA 2FDJA 2W68A 4CCLA 1PMJX 4AFDA 2SLIA 2QQVA 4LPLA 1UU4A 2NN8A 2VZOA 2Q1FA 3WX5A 1RUC2 1O8PA 4CPBA 3IBMA 4EJRA 2RM22 1D7PM 2WWUA 1V6MA 5JZGA 3KV5A 1LU2A 1UOBA 1GOGA 5CZKA 3SCHA 1R1A3 3D4KA 2QQOA 1JBCA 1HV0A 2ZGKA 4KBZA 4CVUA 2ETEA 4UYBA 1S0CA 4CUBA 4I02A 3VZMA 2FDHA 2NLRA 1PGSA 2WNVC 4Q8LA 3JUUA 5I0UA 5EZWA 4BLIA 3POFA 5K0UA 3U78A 3WG2A 4TLFA 5C9AC 3VBFC 3NW4A 4M3CF 5A7WB 1QMJA 1Y7BA 1S2KA 1BVP1 1UZVA 3VBUA 4HVOA 5BPXA 1W28A 4UFKA 5AC93 2OA2A 4LOSA 1DZQA 3C7GA 4JAAA 3DYOA 2B4KA 1AF9A 4YVWC 5ACA1 2YUEA 2WUHA 1DG6A 2YU2A 1WZXA 3AX4A 4EN7B 2B7YA 4YGEA 4YM2A 1Y4WA 3VDDA 3I2DA 4YNIA 4DXTA 1UL9A 5FYCA 2DF7A 1CR7A 4LEJA 1WLWA 3MDPA 2ZZJA 2HJIA 4LUKA 1W2TA 4LHKA 1JZ7A 1RGSA 2HWF1 4E2SA 3JQXA 5LK7B 1GUIA 2AYHA 2BZDA 3NJVA 1EAH3 5FZ0A 2FDIA 5FPUA 3R4DB 3WP5A 2WAOA 4PIYA 4NIGA 2XJPA 2JDKA 4AI1A 4LBNA 3A22A 4BIFA 3HQUA 3RSJA 1VRBA 2YC4A 1IKPA 1C8M2 2B9UA 5FK8A 1JS9A 5FREA 2HLEA 3MW4A 2RS11 4AVSA 1HB4A 1ZZCA 3U11A 5JXJA 3FHIB 1OBNA 2KA3A 4IV3B 3LD8A 1KITA 4CTEA 4FT8A 1Q8OA 4JGZC 4FFHA 4AEDA 4R52A 1V6JA 1REDA 2O8OA 5KBFA 3BI3A 1FNZA 5FP9A 1Z7S2 1BMV1 3BTAA 5C3OA 5ABJA 1GSLA 5C8CC 1S2BA 4DS0A 3POIA 1UY1A 2OUJA 3VHPA 3HJRA 4EWDA 5BUVA 2Z79A 5F3GA 5ANNA 3ZFFB 1OVPA 1Z78A 4I30A 4QX5A 4UBHA 1UY2A 2Y6KA 4RHV2 4BH9A 5EIYB 5IVBA 4YG6A 2KXLA 1GOFA 2DBIA 4LT5A 2XUMA 1AYN1 1W6NB 1OUSA 1PZ9A 1GFF2 1QDOA 2LUWA 4IW3A 1FPN1 1UKGA 1ZZBA 3MW2A 2RS52 3RMXA 1LTEA 1IPKA 1UYYA 1S0BA 2RJLA 1RUE3 4LA2A 4MHUA 5I91A 3U07A 1EYBA 4NHMA 2XPJA 1SFYA 4XTPA 4HOOA 4ZZ5A 1EUTA 4XC9A 3I59A 3AZVA 1CD3G 1OLQA 2HWC3 1LHVA 1COV3 1YRZA 1FI2A 5DAQA 5GALA 2VECA 1HB2A 2UU8A 4CDUA 4Y24A 4PLMA 4HVQA 2R7EB 3TEZA 1BYHA 1OA4A 2DU0A 4FQ4A 3KHCA 1VR3A 1BHGA 1VBE2 1VP6A 2VNGA 4KGQA 5AVPA 1C5IA 4HXCA 1OOPA 4XJWA 4XCBA 1AR71 2C9KA 2VMHA 2VZ1A 3BGAA 3GHNA 3GF6A 2V4VA 2AEZA 4QGLA 5GZGA 2W3JA 4AYUA 1GKBA 2XJTA 3E5XA 4TWTA 4YVSA 5DMYA 4Q4Y2 1JYWA 4LE3A 4XE9A 4RS5B 1ZBE3 4EN6B 1MACA 3S6PA 2WC2A 2ZZQA 3WV6A 5M0TA 3I7DA 2E9QA 3WUCA 5A33B 1W8WA 5FY5A 1K5JA 3VZNA 1ZVFA 3AMHA 4QB6A 4XFBA 1QJY1 1NG0A 3DXUA 2R1DA 3WNXA 1JYTA 4CU7A 1AR91 3HNBM 1OH4A 4F7ZA 3VD7A 2MHFA 5KXDA 1PZ8A 2D97A 1Y43B 5CISA 1YCIA 5A7PA 2ZGLA 1NCQC 2D6OX 1ND2A 4C0BA 2VQ0A 2A1XA 3PJQA 3SEEA 4CDWB 3CIHA 4PHZA 4BPZA 1ULGA 1NE4A 3KV4A 4P00B 1G8WA 4A42A 2O14A 2YBSA 3ZYJB 4NR1A 5A3OA 1PM7A 3FHQA 2R042 5L73A 4Q26A 3T0BA 3MGUA 1W8ZA 1C28A 1QIQA 1G9AA 4KNCA 3F95A 4GWIA 4WZFA 4ES8A 3AL5A 4W50A 4GH4A 3ENRA 2AREA 3ACHA 3O0WA 2VMEA 4GH4B 5CIRA 4EWAA 2WNUC 3RS6A 3H8RA 2ZHKA 4CE8A 4UFMA 3TN91 3JB4C 4LBJA 2JDHA 1NCRC 1VB2A 5IAVA 3I2JA 1WW4A 4Q4V1 2J1TA 1ODMA 4QKDA 2DU1A 2JE8A 4D0QA 2W08A 5F37A 3WP6A 4R9DA 4OZXA 3DKQA 4LKFA 1DGWX 2W5FA 4UF0B 5T55A 3UGFA 3KVBA 1GBGA 3PUHA 3U10A 2VOVA 1MVQA 1QJU1 1AL21 1I5ZA 1YYNA 3BYWA 2X10A 3IIIA 1WBLA 3M1HA 2X5IB 3PL0A 1DQ4A 1L7QA 2LROA 1V9U2 2QUOA 2L9LA 3DPRA 3O1RA 5FBJA 5KR7A 1GNHA 3ZYHA 1APNA 3DPRB 2KD7A 4AL9A 4EROA 3C3VA 1OQ1A 4FPCA 5LA2A 1C4RA 3TYJA 3ASIA 1J84A 1E5HA 1BEV2 1U12A 3IDBB 5JVVA 1WA6X 3FUQA 4UT5A 2DCKA 3VHNA 4OHWA 4IGOA 1RUI2 4UW4A 3UNPA 5C8WA 1KXGA 3KWVA 5HCAA 1UD1A 1YFYA 2WS91 4PBOA 4QQ2A 5GLZA 2DVBA 2XLFA 5D8AC 1STMA 2VUJA 3G7DA 5FAXA 3I8TA 4P9YA 3AB0A 1QEXA 4LHLA 3PMSA 1A8DA 3O14A 2VZQA 4QDQA 5BNOC 2RMU2 3JD72 2XWJB 5A6YA 4FOVA 4LK6A 2ZMNA 1BZWA 4MSVA 3SMHA 4CDQC 4I09A 3QH6A 3VZLA 3PIJA 3CBNA 4V2WA 1XSQA 2JWPA 3PJYA 2HWE2 4L97A 4BA6A 3RGBA 1H2MA 3CJIC 1V6IA 3TOJA 2KR2A 4Y3OA 4Q4W2 1W8NA 3HIFA 2D6MA 2RR12 3HQXA 5DXDA 1O91A 4LBLA 2EAAA 5SV8A 2OIIA 4NIAA 4LTAA 1HQLA 4AHWA 3KT7A 4NIIA 4XFAA 2R16A 3GM8A 5FLHA 3T4VA 1UN1A 5JPMB 1G9FA 3ETPA 2BNNA 4LE4A 2PQSA 2D43A 2ORZA 2RVAA 3MF6A 5IK8A 3LOBA 3T2TA 2WLPA 4LITA 5LBEA 2PHFA 5T3NA 4ZS3A 5A70A 1FX5A 2LTNA 1XE8A 4M0NA 5C7GA 5FCCA 3IMMA 5FPAA 5FXZA 3EJKA 5DDJ3 1OSGA 5T50A 5F9TA 5DAXA 4OHYA 4I3PA 4CXXA 2DUPA 3ZSEA 1JHNA 3ZVXA 3RFRA 3T0DA 4XF1A 5LA1A 4INDA 4KMQA 3GBWA 3HQRA 2EVXA 5A32B 3VBHB 4IV1B 3UETA 1AJKA 1PIV2 4GB31 3V65A 1JHJA 2XVGA 2BWCA 1ALYA 3KZ4C 5FZAA 3URFA 5BNPC 2EXHA 1MZ6A 2ZGQA 2VD7A 1S0DA 4XAAA 4E2GA 2VZUA 3CMGA 2E6VA 4FQZA 5F6KA 4ZXEA 1JN2P 1QJEA 1RXGA 5C3RA 3AKPA 3ZN6A 4JQRA 3WW4A 1A3KA 1D4M3 3MIBA 3ZN6B 5A3TA 4FPFA 5F3EA 4L9BA 1O7FA 1OLRA 4ES9A 1ND3B 4DO0A 1X33A 1YC61 2R30A 3P1IA 1LEMA 4PBPA 3BVCA 4Y26A 1PHMA 4N53A 4JGYB 5EJZB 5FYYA 2WZPP 3SHRA 5FUNA 3BKZA 5JSPA 4N53B 1H2NA 3U1XA 1VAMA 4CU9A 1F5JA 3AJYA 2G9GA 2PXJA 5CB7A 3ZKUA 4RR3B 2BOIA 3JCIA 3KCCA 4B8EA 1JZ5A 2YBKA 3N3HA 2ZMKA 1JZ8A 3LEMA 3ECQA 2ZHLA 4AI3A 2QQLA 4Y5TA 5GKAC 4K6BA 4KBBA 3LFMA 4YM3A 1A78A 1CVNA 3U14A 5J3UA 4FOYA 1GNYA 5CADA 4AI8A 1GYKA 1MEC3 2XOMA 3W59A 2CU5A 3SISA 4BZ4A 1SBEA 3C2UA 3NV2A 3T30A 2GNBA 4ZPIA 3H8OA 1RVF3 1YI7A 2Q4SA 2JG9B 3HWJA 5FUIA 1WGPA 5IUQA 3VV1A 3AP7A 4RGKA 3W58A 1U5XA 4N9IA 2CTVA 3SNMA 3TWIA 1POQA 3THTA 4FTBA 1D0GA 3AKRA 1A8MA 2WWJA 1VRH1 5GZEA 5J09A 5EFUA 1SFPA 3MZHA 2SBAA 3MIGA 3S7IA 3FBYA 1CIWA 3PVOA 2AUYA 1NZIA 2LW8A 3Q8AA 4FSJA 2D3PA 2WYFA 5F3IA 2A6WA 3WZ1A 2YV8A 3ZSJA 4ARYA 1E5IA 2VW2A 4Q0VA 3NV1A 3SKJE 3VKLA 2AGSA 5AC92 4B4RA 2A70A 1VMJA 3H9AA 2J42A 3BB6A 4IGQA 3J7MA 2ZOEB 2PHXA 5T5JA 1DF0A 3RZHA 1C3HA 1KS5A 1WUVA 3VBOA 3NJZA 3AXDA 4ZY9A 3X29B 3VHRA 2RS51 1MZ5A 4WVWA 1DBNA 4CEWA 1HJFA 2ZGMA 2XR4A 4LULA 4D7SA 4A4AA 4CEWB 1AR82 1HN0A 3SCFA 1VAKA 2GNDA 3WINE 1G9DA 3CLPA 2XUEA 4Q4X1 4NMIA 5HI0A 1MS5A 1LHWA 1QXPA 2GP3A 3AYEA 3E6BA 2YPJA 4CCMA 1EAH2 2R061 3B00A 4NPLA 4GMP0 2KM2A 4PCRA 3ZXGA 3IMNA 4OUSA 4GKXA 2W1UA 2PLV3 4E27A 4COUA 4JKMA 5DQ0A 1T6BX 2ES3A 5IK5A 5GZCA 3OOXA 3ZDSA 2HWF2 5FFOC 3A0KA 2ADEA 4XBQA 2W46A 2VUCA 3GJAA 1REFA 2HWD3 3KT4A 2XG3A 2BGOA 4NRQA 4P9WA 4A3XA 5LASA 1DGWA 1M06G 3IWZA 2YB7A 3OD4A 2IXCA 5FDBA 1IQAA 5CFCA 3NO8A 4IV3C 3IM0A 2ZX1A 3CEWA 2RE9A 3USUB 3ZXJA 4UAPA 3OBAA 5FZOB 3FMGA 4OUMA 3AFGA 1DP0A 1W99A 4JX0A 4MUVA 5G05L 5JSRA 5K9YA 1Q43A 3VBRB 4WM8A 5F2SA 4QQHA 2WNEA 2IC1A 2PHRA 1T2XA 3ZXLA 1QNYA 3AZXA 4M3CE 5FMDA 1HDKA 3ZFFC 1VAVA 4TZDA 1VBC3 1BMV2 4B7KA 4BQYA 3O1SA 2VAUA 1NLRA 5C5UA 1Y9MA 4BK5A 3B69A 3MICA 3SC7X 1CAVB 1A6CA 1QOSA 1GANA 2YBPA 4PIZA 4QQOA 1W0PA 4TSVA 2EAKA 3CDZB 3KD4A 5EWSA 2ERFA 1DU3D 3FE5A 2R041 2JENA 3HR9A 3MFCA 1LAJA 3BOWA 2Y6JA 4NO4A 3GDBA 1JYVA 1T6GC 1K42A 1JZ6A 1AYN2 2H6BA 2WT0A 4XF0A 3N9NA 2HWC2 3I2OA 2I74A 2GC0A 2DVFA 3LKJA 5JOYA 2WA4A 1MS3A 5D2AA 3RG0A 4S2DA 4N7IA 2YGLA 3WF0A 4OQ8A 4I2OA 3I3QA 4RFT0 4MOAA 1S4CA 1BJQA 2TEPA 3LE0A 4EE2A 1LOFA 3WDUA 4P5HA 3KVAA 1JMUB 2VZVA 3HT2A 4GMP3 2VNOA 2YXSA 3ZXFA 3J7LA 4DB5A 4URAA 4A44A 1HRI1 2CL2A 2RJ2A 2V72A 2WINB 3MW3A 4IE5A 3B9CA 5LY2A 1AYM3 4CCKA 2A3XA 2BU9A 2A6VA 2PHWA 1IQDC 3OBZA 4FPOB 4WBBA 3S5QA 1XU2A 3WF3A 4XZPA 5KHHA 4ASMB 2E7AA 1YJLA 1XBFA 4MZUA 2FCVA 5A7SA 3HBKA 5FYZA 4MYEA 4BISA 1AR72 1V9U1 4RS5C 2Q1MA 2YFZA 4META 3ZN4A 2FCTA 4QKNA 2JG8C 5FKCA 1GP4A 1N47A 3BIEA 3N7KA 1LU1A 4RFRB 1BBT1 1N3QA 1V6NA 1NE6A 1H8TB 3K46A 5EXOA 3ZR5A 4LJHA 1PMHX 5FO8B 5FK7A 5T5LA 1EV11 3HVDA 4KH9A 3SH4A 4GQ7A 2BGPA 2PELA 1LHNA 3AKQA 1R64A 1AR92 3WXPA 2HEYF 2XWBB 3D5OA 2GALA 2XHKA 3CQOA 4CDWC 2D6KA 1RUG1 4G3YC 3ZFEB 2JDAA 3IDAA 5AFEA 2A5ZA 1JYNA 5A7QA 1FAYA 4XMAA 2ZHNA 4B1LA 2GC3A 3DGTA 1RL3A 5IWFA 3UGGA 3ZYIB 4FPHA 1J1LA 2P3KA 3LOIA 4RSUA 5GM0A 4QPIB 2HWE1 2D40A 1WWYA 1Y3TA 4PIXA 3ZO0B 4BLJA 1ZBA3 5T5OA 1CJPA 5FZLA 1FMD3 4IXLA 2EIBA 2IWGB 3U0ZA 2VMCA 4LLFA 4FOQA 5I8TA 4CUGA 4UI9L 3JB8A 2K46A
chains in the Genus database with same CATH topology
2DFCA 1GZWA 4XFIA 5KHGA 3NKGA 4K20A 1GZWB 3D82A 2FBEA 3ALQA 2JJ6A 2XLGA 2OZ6A 3TN92 1I1EA 4HANA 1GNZA 1QF3A 1QGLA 2HYKA 4AGVA 3SCGA 4C1XA 3AZWA 1UU5A 3D0SA 1YFWA 2X5IC 2EXKA 4AXOA 2I2SA 1CN1A 4PDWC 3PMEA 4RA0A 3M7AA 1Q5OA 5BNNA 1HRV3 1QJU2 3TNQA 4AQ6A 5T52A 1H4HA 2JEMA 1LGNA 4HBNA 1PIV1 4OI0A 4LA3A 2ZJCA 4XF9A 2EALA 2OW4A 3WP4A 2D44A 1PGL2 1ZRDA 4AQ2A 5CBLA 1KDKA 1AXZA 2D5HA 4X8NA 1S0FA 1ULFA 2WS92 4W65A 2QNKA 5JOZA 1LOGA 4QPGA 2XB6C 4DNYA 5C4WA 2PA7A 4ZU5A 4W6WA 1O4TA 2WSVA 4Z92B 4L2NA 1VBB3 1PVC3 3JBG3 4HMZA 1UIKA 1X8EA 3UKTA 3BU7A 2CGPA 2GU9A 2RHPA 1KFXL 1TME2 1EPZA 3M70A 4AFCA 1NQJA 1NY72 2DV9A 1DYPA 4KU8A 3D6EA 4RQPB 4XJAA 4Y22B 5EYYA 2Q8OA 4QXKA 2FQPA 1POV0 1RUH3 1B35B 5F5QA 3GALA 2K2SA 4KG8A 5DZEA 2PQQA 1RJ8A 4CP1A 1SACA 1R1A1 4N43A 4HSJA 3VBSA 4YM0A 2D93A 1EY2A 4N43B 4ZU7A 1RMU3 1TNFA 3KLSA 1H1MA 2W39A 1S0IA 3HN1A 1Z0HA 5JZGB 1RHI3 1PO23 1S0JA 1VB4A 3VBHC 4AW7A 3QOPA 4IV1C 4Y20A 4W6XA 1KQRA 1PK6A 1OQEA 3B9IA 3RWNA 2A75A 2ZBJA 3ZXEA 1I6XA 1MQTA 1AL0G 1QQP3 1HQWA 2WT1A 4GB32 4D69A 5AC91 5HBAA 4LHNA 2JD4A 5K0UB 4Q1RA 3ZPYA 1UIJA 1PO13 1XNDA 1QJZA 1RC6A 1ND3C 5B2GB 2AR6A 2GC1A 4JGYC 2WJSA 3VBUB 4Q2FA 1NZCA 3KCYA 4CEYC 3IDEA 1GQGA 1AR81 1WBFA 4MXWA 4XFCA 3POSA 4QQLA 1TNRA 4MXWB 4RR3C 3V0AA 1NA1A 3ETQA 1EAH1 1BK1A 2ZGPA 3VDDB 4Z1VA 2X29A 1Q8QA 3M8LA 2B39A 1VIWB 2ARXA 5L36A 3LZZA 1JXNA 3DL3A 4F83A 3I4IA 1SCSA 4Z82A 4A7ZA 1POV3 4AHZA 1YWKA 3NAPA 5H9RA 3JZVA 1RVF2 4CZSA 4P9GA 4D7YA 3NAPB 2PHDA 2OYZA 3M3QA 3VKNA 5I0TA 2JG9C 5BY5A 4FO9A 2XL7A 5C6CA 1SCRA 4R4ZA 1DGLA 1IZ3A 5FTTC 3KGLA 3N35A 5ACA3 3FFQA 4EN0A 4LLOA 3WG3A 2ZA9A 5JLVA 1XNBA 1X8MA 4K21A 1VRH2 2JX9A 1WLCA 4BE3A 4XBNA 1O3SA 3DN7A 3HAGA 4JRLA 5I8YA 3CL1A 3WLUA 1WW7A 5ABJB 2E53A 3QBQA 3S7EA 3VZJA 1TMF3 2UWBA 4AGGA 1NYWA 1B09A 3EBRA 4CYDA 3MPPG 1F31A 2HWC1 2NPIA 1FYUA 5FO7B 3ZIXA 1COV1 1VBA3 1J3PA 3N4MA 2RS13 1OFSA 4AFAA 2BGCA 4FPGA 4NPRA 3GNEA 2BVVA 4Q4X2 4DPNA 2XVKA 3EXUA 1G6NA 2YDEA 3I59B 4H7MA 1W2UA 1ZYBA 1AR63 4E9KA 2DWRA 5CFDA 4XJ9A 2R062 3OF1A 5J98B 2R6QA 4XBLA 2BWAA 4CDUB 3MIEA 4OHZA 4AVAA 1ZBE1 4WM7A 4DINB 3FZ3A 3M3EA 2DCTA 1OOPB 2P3IA 2Y0OA 1CAWA 3N36A 4IETA 3HMYA 2XJVA 4HN1A 1WD3A 3NVCA 4CDXA 3UJQA 4XQDA 2ZTNA 4FP2A 4YVSB 4CDXB 2GZWA 1REEA 5FO9B 2JDZA 2BTVC 3VBRC 5KHKA 2NMOA 4GIQA 3EHKA 3O7OA 2WWSA 1C1FA 2DYCA 1VBC2 3BCWA 1OKQA 4PLNA 1CAXA 5GZDA 1V00A 4KL1A 1J3QA 1L3JA 2YMZA 3R4UA 4YSFA 1RUJ3 2WA3A 1ZREA 2VMGA 2HWB3 4J6GA 1QJX3 3ZSMA 3H8UA 1ND2B 1QOTA 2F6BA 1MS8A 3UKVA 5LEJA 2BYVE 2I45A 4N90A 5JR7B 2ET7A 4YRDA 5E1RA 3M2MA 2ZGNA 3ILRA 3UKNA 4FAHA 1R092 3AK0A 4JDOA 4IEQA 1MS4A 5HXVA 2TNFA 4B4QA 1O4YA 2VULA 2EIGA 4Y5Z0 3MFAA 1ULDA 4XYXA 3N7JA 2XKPA 4AVCA 2EA7A 4ONUA 1HRI2 2H0BA 2XJSA 3A4UA 4XMIA 4OI1A 3H1MA 4YZ2A 1RITA 2A6XA 3WQ1A 3M3IA 1SBDA 4AFMA 4YARA 3NSTA 3ZFGA 4XILA 4AEDB 1H8TC 4RL7A 3K48A 5BXXA 2DUOA 3QLQA 1WCSA 1IS4A 4HK9A 1BBT2 3PVBB 4R8HA 1PGL1 1TQ5A 3RJ2X 3MIFA 5C33A 3QACA 4OULA 3H3ZA 1EV12 3ZFEC 2D3SA 4JC1A 2YGMA 3AXEA 1PZ7A 4MGYE 2X8KA 4QMAA 4XFHA 5FBZA 1RUG2 4Q0PA 4RD7A 1HXS3 5GLTA 2RS33 2QZ3A 3O12A 3MI8A 4MH0E 2I07B 2P2KA 5AVAA 4QPIC 4AGRA 2BW8A 3NWKA 3LA3A 3ILNA 1AL23 1SLAA 1RUF3 1JUHA 3ATGA 4YZ3A 2XBO3 1U5ZA 4C0HA 3RMYA 4A2UA 1GQHA 1TME1 5KC5A 4YG0A 1RUD3 3MYXA 3WVJA 4DFSA 1NY71 1M4WA 2QZ2A 4CRQA 2IXHA 4FTSA 4P9IA 3IDCB 5KC6A 1SFNA 5I93A 5DDJ1 5K8SA 2BNMA 3FWEA 3H7YA 4LO4B 2DVGA 4GWMA 3AM2A 2G4IA 2X53S 4QU2A 1HRV2 4COZA 1VLNA 5L7OA 4YZ4A 2H0VA 1K5MA 2DFBA 1BCXA 3ACLA 1QOOA 4LO6B 4D7TA 1FNYA 1LECA 2XJQA 3G6JB 1D4M1 1DFQA 2NMNA 1N1YA 3AP6A 3J8F3 1XYNA 1LJ7A 1WW5A 2DTYA 4JDNA 2YZ4A 2VQAA 1S0GA 3P3PA 1RUC3 1VBB2 1CESA 4YFZA 1ZRCA 2RM23 4ITCA 2UURA 1AXYA 2WNVA 1XRUA 2AENA 1CONA 3MEPA 1TE1B 2A6ZA 4QQPA 4AVVA 1RINA 3BALA 1IS6A 5C9AA 1UKRA 3VBFA 3WDYA 1OA2A 2MNGA 3TRSB 1RUH2 5EV7A 4RQPC 4YGBA 4QPYA 3TAYA 3AKTA 3GBFA 1MEC1 4LUMA 1B35C 1HKDA 2N7GA 1PNGA 1RVF1 1WA4A 3WQ0A 1AXKA 1SLIA 1Q8SA 2VUAA 1S0EA 4IEXA 3ZYPA 2QDNA 4RGGA 1F2NA 1GR3A 3MF9A 4YZ1A 1ULCA 4YVWA 1PO22 1C1LA 1R1A2 1YXWA 1VBD3 4R9AA 5JZGC 4DQAA 4MX3A 3OTFA 4URTA 1GLHA 2CNAA 4Z8BA 3AZYA 4Q29A 1JYIA 4AQTA 1NXMA 1VALA 5K0UC 3UK9A 2E51A 1MS0A 5CAZA 2WFF3 5T5PA 3KMHA 1LHOA 4AG4A 2IFRA 3VKMA 4XXAA 2JE9A 3H50A 4HPKA 3D8CA 3VBUC 4AE2A 1OI6A 4A7YA 5JSOA 3V0BA 1LCLA 3WR0A 2PFWA 4Q0QA 5DUVA 1ZA4A 3FJSA 2BNOA 3OCPA 3VBOB 1ZM1A 2V73A 1FV3A 4KG0A 4DZGA 1C8M3 1WMEA 4Y1VA 4JGZA 2VGDA 4GULA 5L19A 3VDDC 4DRRA 2PTMA 4L11A 2JECA 3IN9A 3O5SA 3MLLA 3VUOA 5GLUA 3R6SA 5C8CA 1HQNA 4GWNA 3FUOA 3CU7A 2HWD1 5KHIA 2ENRA 2XJRA 1UPSA 1YIFA 1IKQA 1Z7S3 1V6LA 2D98A 1JOJA 2GAUA 2NM1A 1D2QA 3DKWA 2DCYA 5JMCA 1NQDA 3WG1A 3RZZA 2QJVA 2XVLA 1QHDA 4RHV3 2YY1A 1DZTA 1XYOA 4Q8KA 3GHMA 2DCJA 3RYPA 5JIUA 2XJUA 3WG4A 4P9LA 5LRSA 1SLCA 1W6QA 2VW1A 2GN7A 5CFCB 5JAXA 3E6DA 3IKWA 2MEV3 1VBC1 3KQRA 1C5HA 3WDXA 1SLLA 2PYTA 2YC0A 2DVAA 2YROA 4ISQA 2UWCA 5LEKA 4WM8B 4B3NA 5ABJC 1XNCA 1O5UA 3RYRA 4Q0UA 1VBE3 4YGCA 4YZ5A 4HZFA 3WD5A 1H8VA 1VBA2 2VOWA 1RUE2 1LRHA 1O3QA 1RIRA 2GC2A 4Q4Y3 4AK3A 4DXZA 2MPFA 3VKOA 4GMP1 1R091 3RNSA 2P34A 1AUYA 3VZKA 4B7EA 1C57A 2A3WA 1COV2 1X82A 2GN3A 4AF9A 4LR4A 1AYM1 2GDFA 1ZRRA 4F3JA 1QXRA 1NCQA 1Q56A 4DRVA 1NCQB 4CDUC 4ZU4A 1EP0A 2Y0IA 2NQYA 3BOPA 2BPA2 1OOPC 1RJ7A 2O1QA 4YGDA 4IEPA 4IL7A 1ZBE2 2B46X 2R0FA 1YNAA 2ZGOA 5CNAA 2CWMA 4YVSC 2ZGUA 4E4SA 5AFBA 1DGRA 3ZXDA 5LK5A 3RI9A 4NWWA 3ZYGA 1UMZA 4ATFA 2WNUA 4COYA 4NOTA 3V56A 1MR5A 3ES1A 1NCRA 3RDIA 4C1WA 4JTNA 2VH9A 3SXWA 1FOD3 1RUJ2 4EN8B 1RB8G 1DLLA 2BUKA 2HWB2 2XGXA 3OGJA 3O0VA 3OGGA 2R0HA 1ND2C 4I0BA 1CAUA 4HKOA 4ASLA 1ZBA1 4Z07A 4BHPA 2ZMLA 1FMD1 1YLLA 4OHXA 4MGKE 2R32A 4AHYA 1ASJ3 1HIXA 3P3NA 2D6NA 3RJRA 3SITA 2B5HA 1I3HA 3U4XA 4LO5B 3FLTA 3LSDA 4GH4C 5J96B 2FZ2A 1BEV3 1DYKA 2UY9A 1U5YA 5D8AA 5GZFA 2YYOA 1VJ2A 1RUI3 1FXZA 2WZR3 4YW2A 3CO2A 4TYSA 1NOVA 4BMBA 2R073 3MLKA 5BNOA 4E2QA 2GNMA 2WT2A 4AVBA 1GZ9A 1HRV1 1LOAA 1DQ2A 1N1VA 3H1WA 4SBVA 3WUDA 3NKTA 2VY0A 4AWDA 1YJKA 4DMIA 4CDQA 2RMU3 3QCWA 3JD73 3TBDA 4DOUA 1CGPA 4CDQB 3QH7A 4IERA 1NXD1 4AEDC 4XIKA 3DPRC 4HVRA 3WHTA 3CJIA 3WW3A 4FCAA 4H14A 5BNNB 1CPNA 1WMFA 2P37A 1W6PA 2QCSB 2UYBA 4WZCA 3UV9A 5KWRA 4Q4W3 4QHBA 4AEMA 1UW8A 2RR13 4X6RB 5SV5A 4E4DX 4YW1A 1R083 2RS32 3PVNA 4QGNA 1QXJA 1YO8A 3H3UA 2ET1A 4NHKA 1W6OA 2CGNA 2ZGRA 4YM1A 1VBB1 4OFGA 5FRAA 3SNMA 1PVC1 2WIIB 3JBG1 2IXLA 4S2HA 4UBGA 3PHMA 2XBO2 4QPGB 1IOAA 4CP0A 5C4WB 3AYCA 3ILFA 4M00A 2D5FA 2O8QA 1X50A 4EV0A 1JUIA 3A0NA 3INAA 2WLQA 4R9CA 4A7KA 4C91A 5BNPA 1RUH1 1RUOA 3ZMNA 2Q5TA 2HKXA 2F4PA 2Z2SB 5JPNB 3APBA 3GBGA 2C5DA 5DUXA 5H9QA 3FLPA 2VVDA 4LBKA 4M3CA 4AQSA 1QNWA 4Q0SA 1AJOA 2OPKA 1WLDA 4JTOA 2BEOA 1J3RA 3PLQA 2O0OA 1RHI1 1PO21 2V09A 3QD6A 5DDJ2 2WL1A 2ZX2A 4FPKA 4G9SB 4XFGA 4PF5A 1LENA 1V70A 4MGZE 4KQ7A 4K7JA 4XXPA 3VBSB 3VLBB 3VGIA 4N9HA 3ZSLA 2VOKA 4ISRA 1IPJA 1FV2A 2DVDA 2ARBA 5FOBB 4XPVA 1IS5A 2A71A 1N1TA 4Y20B 3WW2A 1PK6B 1JH5A 1OFNA 1DIWA 2VPVA 3ZXKA 3EQEA 1D4M2 2RJKA 1MQTB 5I8SA 3E5QA 1AX2A 2GH2A 3R05A 1DGRN 4KGGA 3B02A 3T1LA 1DQ5A 3S0MA 1LESA 1N1SA 1LOCA 2Z42A 5FLJA 4N53C 3R4SA 3AMMA 2C0ZA 1UX6A 3OY8A 1LGCA 5J7MA 3OY8B 3V0AB 5HCFA 3RI8A 3AMPA 1NA1B 3ZXAC 1POV1 4YW3A 5JCTA 5J37A 1S1AA 4YW5A 2JE7A 4Y1ZA 2W0XA 1MEC2 2PN5A 3J9SA 1VBD2 4BWOA 1CJDA 1ZZ6A 2PHUA 3WDVA 4XQWA 1QH7A 3UL2A 4FP3A 2UWAA 4K40A 4WV8A 1WMDA 1UPIA 4YYOA 4BIOA 3FFZA 4B29A 3PVEA 4HFSA 2WQ4A 1AR83 5JIAA 4JDMA 1F5FA 2WFF2 4AEJA 2CV6A 1Q3EA 2JICA 2GMMA 1KJRA 1PMIA 2CY6A 2D7FA 1QWRA 2ZACA 3NV3A 1TMF1 2AH2A 3THPA 3HD8B 4Y1XA 3HBZA 3CNAA 5DG2A 5KHJA 2HWF3 5E8AA 1VBA1 1RUE1 3VBOC 4IV3A 1JYCA 4CEWC 2A7AA 4HETA 1XQNA 4QT6A 2QQPA 1XXNA 4P9XA 2NZ9A 4XTMA 1AR61 3AP5A 4OI4A 1O3TA 2HEWF 1QY4A 1ENRA 2CYFA 2GMEA 3DV8A 4KWJA 4W6YA 5TSWA 3ZYRA 2PLV2 2UY8A 3S30A 3KM5A 3ZFFA 2ZHMA 2DURA 4XEZA 1Y9QA 3I54A 3R0RA 4H7LA 1O4ZA 5DUUA 1H1IA 2HWD2 3ME2A 3WW1A 5I0SA 5J36A 1W6NA 4HT1T 2ZX4A 4P14A 5CFDB 4LBOA 5J48A 1WLTA 1DQ0A 2IZWA 1URXA 4H55A 4RGAA 1SMVA 1UZYA 1ZX5A 3FBMA 4WM7B 5E16A 2MEV2 4XOGA 5CFCC 1CAWB 2QE3A 2TUNA 3W9AA 5FMOS 3BODA 1AYN3 1W39A 3GYDA 5H9PA 4XJZA 1J1TA 1FPN3 2DUQA 4GA9A 4XFFA 1WW6A 2ZAAA 3USSA 4AHXA 1SDWA 1RUJ1 4WM8C 2HWB1 4P9JA 1QJX1 3H7JA 1XU1A 1PNFA 4LBMA 2DCZA 3M3CA 1CAXB 1ENSA 4F8AA 4FAGA 4IEVA 4RS5A 4B4PA 5GLVA 4PLOA 2A3YA 3SLIA 2JG8A 5A33A 1YFXA 2JG8B 4X6QB 5KXBA 1AR73 1C8NA 2FHRA 3OJBA 5K7PA 5FLIA 2PHLA 3MLJA 4XF4A 4O9GA 5JDBA 1J59A 2QFEA 3CF6E 1O5LA 1LOFC 1Q8PA 2C1FA 1AYM2 4CDWA 4QM9A 3WCRA 5FPXA 1QJY3 2PAKA 1AR93 4BM8A 2ATFA 4O9EA 1BKZA 4SLIA 3GZUC 5CU1A 1G86A 2R1BA 4JVAA 4PJYA 4QD2A 1OHFA 4HL0A 5I0RA 1UF2C 2VXRA 3O0XA 4OI2A 3WOGA 3UJOA 5FMOL 3ZMOA 2JXAA 4JRAA 2K9ZA 1FOD2 3ZFGB 2Y38A 1UZZA 4S2FA 1KJLA 3TB0A 4NN0A 3KS7A 2E7QA 1HXS1 2RS31 1H2KA 2P17A 1RUNA 5D1IA 3PTYA 3TN93 4X8PA 1GZCA 4ZXKA 4DY5A 2X5IA 2IFWA 1ASJ2 4Q4V3 4XHXA 3ES4A 2BFUS 4PDWA 5DZFA 1RUF1 1LGBA 4MVTA 2Y26A 2XBO1 4PDWB 5E88A 1ZBA2 1RUD1 3WDWA 1FMD2 2ZPXA 2VU9A 4V1PA 1KD7A 1QJU3 3BPZA 3WQ7A 2WZR2 4XJ8A 1ZZ8A 4XIOA 1IGOA 2JKBA 3N7MA 2R072 1NLSA 3VKFC 1D0HA 2ZGSA 2EF6A 1G9BA 1MS1A 3LA2A 1SLBA 3L9JT 1LB2A 3H1YA 1V6KA 2WS93 2B8MA 4BQ1A 3AYAA 3H0OA 4I01A 4HLTA 4I0AA 4DY3A 3LSEA 1XNKA 4COVA 5L7OB 5BNNC 3TNPB 2OVUA 3J8F1 1K5MB 1SEFA 3CJXA 2D3RA 4WVZA 2IXJA 2PHTA 3DUIA 3BIWE 3WHUA 1R082 1YHFA 4YLZA 3B3QE 5DG1A 4R4XA 4D94A 1EPWA 1PGW2 1TME3 3SH5A 1D4VB 4FPJA 3LCPA 2BBVA 4AI2A 1LODA 1RUC1 2RM21 3RQ0A 4KWKA 2E7TA 1H4GA 1BXHA 4XDQA 2WQZC 4KWLA 4NHLA 2Q30A 2XKOA 2BFUL 3B7MA 3SH3A 1D2SA 4QGMA 4QPGC 4U36A 2ZKLA 1DHKB 5C4WC 1LR5A 1BQPA 2QKDA 3VBHA 1PVC2 5A32A 5JOWA 3JBG2 3KB5A 4FVVA 4IV1A 1N3PA 3D0JA 2FMDA 1F8VA 3RYKA 4Z2WA 2WNVB 4H3WA 1UAIA 3RPQA 5BNQA 2ZGTA 2Z69A 4K1YA 2D6LX 5C9AB 4HSLA 2QVSB 2XH6A 3VBFB 4K1ZA 4MLOA 3HT1A 3GZTB 2PAEA 2A6YA 1ND3A 1QDCA 3IPVA 4GB33 4JCKA 3POWA 1VBD1 5A3LA 1LKNA 3KCXA 3IPVB 5CG8A 3LB9A 2VW0A 4LO8A 4JGYA 1RMU2 4CEYA 1JW6A 4D3WA 4N43C 5HCBA 3VBSC 4CEYB 3MIHA 3MIDA 1QH6A 4EWEA 1HLCA 1RHI2 4RR3A 5A3MA 3OYWA 4YVWB 3E6CC 1OD5A 1CX4A 3OYWB 4LBQD 4Q1PA 2OUHA 4COWA 2WFF1 1KFUL 4OVEA 4HKLA 4CP2A 1YIPA 4XW3A 2IXIA 1W6MA 4AEKA 1LOEA 1DQ1A 1PK6C 4YW4A 1O3RA 1W6MB 1QQP2<