4LA3A

Crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
TLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELALTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insight into bacterial cleavage of oceanic dimethylsulfoniopropionate into dimethyl sulfide
pubmed doi rcsb
source organism Silicibacter lacuscaerulensis
molecule tags Lyase
molecule keywords Dimethylsulphoniopropionate (DMSP) lyase DddQ
total genus 54
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4la3A00
5K8SA 4DINB 1ZZ6A 2Q30A 5JSRA 2K0GA 4IEQA 3ACLA 4I3PA 2UY8A 5JAXA 1X8MA 2UYAA 4AVCA 5T3NA 1NE6A 1H1MA 2PHLA 3GYDA 2IC1A 5KHHA 1OI6A 4Q0UA 3H3ZA 3RYPA 1NXMA 2Q0AA 2GC1A 4Q0VA 1YUDA 3FFQA 4HVOA 3S7EA 4MX3A 4H7LA 2D5HA 3CO2A 3H7YA 4HLTA 1UIKA 2IXKA 3KGLA 4JV4A 2C0ZA 1Y3TA 3EHKA 4E2GA 4XFIA 4QM9A 4YNIA 4UBHA 1I6XA 2XLAA 1G6NA 1CAUB 2N7GA 3CL1A 3IDBB 3H8UA 5KHIA 4E2SA 2ATFA 1ZREA 2XKPA 1CAWB 1FI2A 1YFYA 5FLJA 3SCFA 4XFCA 4MGYE 1YFUA 4EV0A 3QACA 3USSA 1UW8A 4I2OA 2PFWA 3NKTA 4BYYA 1RGSA 4XF4A 1FXZA 3MPBA 3LA3A 2IXJA 3M70A 3FJSA 4JTNA 4HVRA 3ROUA 1ZZCA 3RYKA 3LWCA 3PNAA 4QGMA 3H1MA 1VP6A 4KU7A 3MDPA 1O4TA 4MGKE 4YARA 3WW2A 1O3QA 4X6RB 2F4PA 4I02A 5J7MA 2HJIA 4IEXA 4XFFA 4LULA 2XHKA 3E5QA 4D7TA 3BALA 2BYVE 1O3RA 3HIFA 4YRDA 5LRSA 1NZCA 5KHKA 3UKVA 4PIZA 4XFBA 1V70A 3JZVA 3NL1A 4Z82A 2QJVA 4AXOA 2GC0A 3IBMA 3E6BA 3OGJA 2PAEA 3S7IA 3DKWA 2OZ6A 5FLHA 1ZZ7A 4LA2A 4D7SA 1J3RA 4XF9A 1O3SA 3CJXA 4QMAA 4AVAA 3CEWA 3HT2A 3H7JA 4LLOA 1PMIA 5JCTA 4IEYA 4QX5A 1XE8A 2PQQA 4I0AA 4AQ6A 4QM8A 2PHDA 1EPZA 4J1WA 4PIYA 1NYWA 4AVBA 2CAVA 3OD0A 4EWEA 4IEOA 2IXCA 4IEPA 1CAXA 5I0SA 1DZRA 3L2HA 1HW5A 4O9GA 4KWJA 4YSFA 2Y0OA 3RDIA 1ZZBA 3ZDSA 5FQ0A 5I91A 2VQAA 1LR5A 4MZUA 1SQ4A 3I59B 2BNOA 1IPKA 5EZWA 1GQGA 1UPIA 4J1XA 1EYBA 1CX4A 2ETEA 2IXIA 5J3UA 2WC2A 3H9AA 4A2UA 2QNKA 3EJKA 3EQEA 3E6CC 2D40A 5KBFA 5FCCA 5C6CA 2QVSB 4OLLA 1L3JA 3MYXA 3NVCA 2MHFA 4BH9A 2XL9A 1J3PA 2GU9A 2ZCWA 2CV6A 4LUMA 2CAUA 1X8EA 1Q43A 4MGIE 1PM7A 4MUVA 2XLGA 1ZNPA 3H3UA 4BHPA 3SCGA 3CF6E 2O1QA 3LOIA 2Z2SB 2BNNA 3M3IA 4WZCA 4META 1IPJA 4IETA 2UY9A 3R6SA 4ONUA 3WW4A 1CAUA 1O5LA 2GC2A 4B29A 1Q3EA 3BB6A 4XFHA 3OF1A 3KCCA 3HT1A 3H1YA 4X6QB 2CGPA 4N9HA 5F1RA 1RC6A 3I7DA 1U12A 1ZRCA 1OFNA 2OA2A 4ZU4A 1CAVA 3FHIB 4O9EA 4XF0A 2PAKA 2B9UA 2GH2A 3KSCA 2GZWA 4HZFA 2PYTA 3I59A 1UIJA 1I5ZA 4HN1A 3IIAA 1CAVB 2MNGA 1YLLA 3WW1A 5I0RA 1CAWA 4XFAA 4JVAA 2ZKLA 3BU7A 3ST7A 4TLFA 3H50A 4IEZA 2B5HA 3IWZA 4R8HA 4LTAA 1J1LA 1ZRFA 2BNMA 4MV2A 3OTFA 4MGZE 1WLTA 3DN7A 5I0TA 4PJYA 1Y9QA 5BUVA 1TQ5A 3IDCB 2H6BA 4FBFA 5CU1A 4P9GA 1FT9A 1YFXA 4JTOA 3U0ZA 4XF1A 3MZHA 5D1IA 1RTVA 2IXHA 3FX3A 5I8TA 2Q1ZB 3SXWA 3SMHA 3C3VA 2GC3A 4OFGA 5I8SA 2IXLA 2OYZA 5HI0A 1OD5A 5CVRA 4E2QA 5LEKA 1XRUA 3ELNA 1EP0A 5I0UA 1DGWA 3LA2A 4PIXA 4IESA 2OPKA 3HQXA 3RYRA 1ZRRA 4HBNA 2V09A 3CLPA 2BEOA 4XF3A 4AQ2A 2VPVA 3U10A 5FPXA 5C8WA 3BCWA 5FPZA 4FAHA 3ES4A 4Z07A 5CADA 1DGRA 3KMHA 2EAAA 4QGNA 5FLIA 4KU8A 1ZZ9A 5E1RA 1EY2A 3NJZA 3QOPA 1GQHA 2D93A 3FE5A 5LRRA 5BY5A 1O5UA 1ZVFA 1UD1A 4K8FA 3E5UA 1J58A 4F8AA 1WGPA 5KHJA 1UCXA 5JSOA 2H0VA 1ZRDA 4ORFA 2H6CA 1CGPA 3GBFA 4UBGA 4L11A 4F7ZA 3RNSA 4NVPA 5LEJA 3VHRA 5BV6A 4WBBA 2B8MA 1DZTA 4HSLA 3U11A 2EVXA 4IEWA 3S0MA 1QWRA 1X7NA 1NE4A 1J59A 4XETA 2D5FA 1RUNA 2GAUA 4HMZA 4KL1A 4KWKA 4L2NA 1H1IA 1OMIA 5AVPA 4UXAA 5KHGA 3I54A 3BPZA 5BPXA 4LA3A 3UKTA 4BIFA 4HSJA 4FAGA 1ZX5A 2O8QA 5I93A 4IERA 4R52A 4HN0A 5BXXA 3WW3A 1LB2A 2WFPA 2XL7A 4RD7A 4Q0PA 1YWKA 1RUOA 4FT8A 2PTMA 1QXJA 4I01A 1XE7A 4EWAA 4QGLA 4CYDA 5EFUA 3NW4A 2XKOA 1CAXB 4ZU5A 1RL3A 4Q0SA 3ES1A 2HKXA 1SFNA 2UYBA 3SHRA 1O3TA 2OZJA 3KGZA 4IEUA 4N9IA 3FZ3A 3H1WA 2P17A 3UKNA 3LZZA 1YFWA 5FDBA 4KWLA 1LRHA 3PVBB 3D0SA 2BGCA 2VECA 2EA7A 4LUKA 5I8YA 1VR3A 1ZZ8A 5E16A 4EWDA 1YHFA 3O14A 3DV8A 2ET1A 1QXRA 4LEJA 2FQPA 2I45A 2K9ZA 3LAGA 3TNPB 1Q5OA 4WVZA 1JUHA 5JR7B 2MPFA 3TNQA 3D0JA 4XFGA 4Q29A 3RPQA 3NSTA 1WA4A 3DL3A 2QCSB 2XGXA 1LKNA 4ZU7A 2KXLA 1X82A 1J3QA 3LA7A 4GULA 3EBRA 4I09A 2ET7A 3N4MA 1QY4A 3E6DA 1SEFA 4Q0QA 2Q4SA 3E5XA 5J48A 2XLFA 2PAMA 4MH0E 2QDRA 3E97A 3FWEA 3SCHA 4YYOA 4I0BA 3EO6A 3OCPA 5FQ0B 5JSPA 2E9QA 4QXKA 2DCTA 2PA7A 4XEZA 4EROA 2FMYA 3RZZA 3ETQA 3D82A 3PLQA 3B02A 1O7FA 3G7DA 4HVQA 1VJ2A 2Z69A 4IEVA
chains in the Genus database with same CATH superfamily
4Q4W1 3RZMA 1ZZ6A 3MLJA 4OQ8A 1US3A 3CHXA 1K5MC 3GBWA 3POFA 3ACLA 3NWKA 3VZKA 5JPMB 1YNAA 2WNEA 3LIGA 1IPSA 2UYAA 1NE6A 1H1MA 2PHLA 5KHHA 2A6WA 5KWRA 5JR2A 5M0TA 1ZA7A 1LOGA 1SDWA 3DKQA 1RUC2 2BV4A 1VBB2 2D3RA 1K5JA 1AL23 4CCNA 1OKOA 1YUDA 4Q0VA 1IQDC 3BUCA 4PLOA 5ANNA 4A7ZA 4H7LA 2D5HA 3ME2A 1YQCA 3CO2A 5IVVA 4YW5A 1WCSA 1LODA 3H7YA 2X5IC 4HLTA 4IW3A 1PO22 3C7EA 1G9AA 1KQRA 1V9U3 5LW9A 4DFSA 3AFGA 1AL22 1K12A 3AVSA 4O7XA 1Y3TA 2R0HA 5B4NA 1MQTC 4XFIA 2R072 1RUH1 3R05A 1WUVA 2UU8A 4LJHA 1A8DA 1G6NA 2P3JA 4MADA 1UY2A 5EYXA 3ENRA 1XNDA 2BDRA 3Q8AA 1CAWB 4UI9L 2NLRA 3ZR5A 4CEYA 3IM0A 4MGYE 4MXWB 3K77A 4OI1A 4H14A 1W06A 3MEPA 5FP7A 5CEHA 1VMJA 5CNAA 5C3QA 2PFWA 4PQ9A 2W95A 3NKTA 2Q8DA 5CFCB 2YYOA 1NXD1 2ZGQA 4E8CA 1DQ5A 1ST8A 4N7IA 3B9CA 1AYM1 2HWE1 3D8CA 2CYFA 1PK6C 2A7AA 1W8FA 2V5DA 3ABZA 3H42B 3OYWA 5JOXA 3LA3A 2IXJA 4AGVA 4BE3A 5JXJA 1AR82 3FJSA 4CDQC 3A4UA 1ZBE3 5FPBA 2PLV2 1IS3A 1OH4A 1H0BA 4YM1A 3VZOA 3VBRB 1APNA 3SC7X 3KLSA 4SBVA 2C1FA 1D4M3 1AX0A 2DFBA 3VKNA 1W6NB 1ULOA 3AFKA 3CZJA 1AXYA 1G9BA 3MDPA 1O4TA 2E7TA 3BVCA 1RUD1 1O3QA 1BEV3 4C90A 1RVF1 1W2UA 3R4DB 4NN0A 3VN4A 5IFPA 2WRAA 3E5QA 3U78A 4CCLA 1DBNA 4QHBA 3T09A 4NIHA 2P3KA 5A3UA 1UYPA 2E31A 4LXLA 4JAAA 1HJFA 4YM2A 2ARAA 3POYA 3GXUA 5FP8A 5FKCA 3WG3A 3FBYA 4GAZA 1MR5A 4XFBA 4IL7A 1V70A 4Y26A 3HNBM 3VD4A 3OEBA 3ECQA 1D4M2 3Q8CA 1WZXA 3JQXA 1D7PM 1DZQA 4XJUA 1W9FA 1W8WA 4UF0B 3OGJA 4CDWA 3GDBA 1OH3A 1QF3A 5IVJA 3RYPA 5LCWL 4P02B 3QCWA 4LA2A 2VXJA 4QAWA 1O3SA 4NHMA 4CEWB 5T5PA 5FZ4A 1RUI3 4AVAA 1UL9A 2VNGA 2W1WA 2ZGPA 3MW2A 3OBTA 3VKOA 2MEV3 4QPIC 2DF7A 5FXXA 2JG9A 4MHUA 4JKKA 3KCXA 4P14A 3ZN6B 4V2WA 1POV0 2CY6A 4IQPA 5CKNA 4I0AA 5FTTC 1U5IA 2GP3A 1NAEA 4NPMA 3VKFC 4Z2AA 3AKSA 1EPZA 5FOBB 1PGW1 5C33A 3BTZA 4XXAA 4CSWA 2JDKA 1HRI2 4OVEA 2VZVA 4AVBA 3RRDA 1RHI3 4FPHA 5FAXA 5BNNB 4XIOA 4SLIA 2IXCA 4IEPA 1CAXA 1QU0A 4WVMA 1MPXA 2W46A 4NHKA 4KWJA 2R32A 5IJRA 4AK3A 2C4XA 5CAZA 1WMFA 4LK6A 3RDIA 4BQ4A 4XAAA 5GZDA 4MXVA 1HQWA 1W0PA 2OXBA 2QBXA 5A70A 5FQ0A 3SEPA 3OUJA 3DCQA 2H0BA 3WF2A 5JZGA 1LR5A 4ZZ8A 5IAXA 4IUGA 2YZ4A 1Q8VA 2JB8A 1UZVA 3AYDA 3I59B 4CXXA 1WLDA 1YQ8A 5F6KA 4XMAA 5CB7A 2EAKA 2ETEA 4BWOA 1OLMA 2WNUA 1XOYA 1RHI2 4GB32 1UX6A 4CEWC 3TEWA 1TMF3 2WC2A 3UETA 4EE2A 1RUD2 3EQEA 1U5YA 5EV7A 2JXAA 1MVEA 5FCCA 5IVYA 3C2UA 2QVSB 4HL0A 5C6CA 5F2SA 3URFA 4FSJA 3FHAA 4OLLA 1L3JA 2GDFA 2WFF3 4H3WA 3WUCA 4AQTA 1IQAA 2MHFA 5FXWA 1W6OA 5FZ6A 3OUIA 4XTPA 4GB33 2GU9A 3ITQA 5KXDA 2J1TA 1MEC3 3HWJA 3RWKX 2P3YA 2ARBA 5C70A 3KT4A 4EQVA 5F3EA 2Q8EA 4Q4X3 1WW6A 5T5LA 3WQBA 3AZXA 3JU9A 1LOCA 4ES9A 4JDMA 4XUOA 2GALA 3SNMA 5EJZB 1Y9MA 2Y0IA 3LKJA 5FMOS 1C8M3 4FTSA 4QX1A 1UZWA 2VE1A 5D2AA 1GMMA 3DYMA 4BHPA 4AHZA 1QQP3 3KHCA 2BW8A 4JRLA 4NIAA 2O1QA 4FI9A 5IYYA 4JQTA 3M3IA 4WZCA 5APAA 4CPBA 3S57A 4I3GA 2CHHA 2F17A 1DYPA 2UY9A 5JWPA 3RZLA 3MLLA 1N1SA 3N9OA 5L73A 5JOYA 3H8XA 2GMPA 2BU9A 1O5LA 1W8NA 2GC2A 1K3IA 1OPMA 4QX8A 1LULA 5FZ9A 2VXRA 4YZ2A 1S0CA 3K46A 1VMFA 3KM5A 4GH4B 1GZCA 5CFCC 1ZBA1 1VBE2 5JZGC 2VUDA 3T2OA 5A6ZA 3U4XA 2HWB1 3BN6A 3JBG1 2CGPA 4DS0A 2W87A 2C9AA 4N9HA 4P9YA 1RC6A 1SLAA 3USUA 5SV5A 1U12A 2Y38A 3U37A 4O65A 5GZCA 2YFZA 3H3LA 2E26A 3PUAA 1OFNA 3PU8A 4LOSA 2W1UA 1JOPA 4WM8A 5AC91 3WCSA 3VUOA 3CDZB 4XF0A 4ZZ5A 2MEV1 5D8AA 4U36A 3O1TA 1OFSA 2A70A 1LOEA 1VLNA 1CJPA 1XB9A 2WO7A 4AHYA 4E4ZA 1UOBA 4M4RA 1LGCA 1AYN1 1DG6A 3DXUA 4HKOA 4LBNA 4TXWA 3ZKUA 3MICA 4AFMA 4Y20B 5GLVA 1YLLA 3WDVA 3GJAA 2HEWF 3LB9A 3OOXA 4XFAA 2R071 2E33A 1FPN3 2X5IA 2OW4A 2Y33A 3KVBA 4JVAA 4COWA 4UAPA 1AJKA 1KD7A 2HWF2 4QXCA 4TLFA 1IG3A 2VMEA 2XR4A 4IEZA 4ASKA 3IWZA 3ZFEA 4M00A 4DO0A 4XOGA 4IXLA 1LNSA 4HANA 4IV1A 4GZ9A 4LTAA 2WO2A 3A0KA 4R8HA 2J1VA 5A33A 3AKRA 3IZOA 5IWFA 2UWAA 4JGZC 3C7HA 2AUYA 1RUD3 2ERFA 4JC1A 3WDTA 4PLMA 5L9RA 2PQSA 4MGSA 1TQ5A 2V4VA 3UYJA 5BUVA 4LITA 4FBFA 4A4AA 1WCKA 1HB4A 4B7KA 1ZBE2 4QQLA 1FMD2 1D2SA 4Y5Z0 3HQRA 2J1EA 3ZDVA 4D6SA 3U0ZA 3HJRA 3RI8A 4Y1ZA 4QPIB 2LUWA 3OBRA 4EZHA 2FD8A 1F5FA 3N35A 2WZR1 3FX3A 1R093 3R4UA 3WQ0A 5I8TA 3AZZA 2CWSA 4XDQA 5DUUA 2Q1ZB 2ZMLA 1YEWA 2D98A 5K7PA 3Q8BA 1A3KA 1VBC3 5FV3A 3DEMA 4Z8BA 2GC3A 4CP0A 1ASJ2 1V6NA 1V9U1 1QOSA 4XC9A 1T6BX 2CSGA 4LLFA 2J1SA 2R062 1H2MA 3KS7A 4CDUA 4NAMA 4TSVA 3IT8A 5CVRA 1HRI1 4BISA 1ND3A 3TN91 1BVP1 2VUJA 4CUGA 3PDQA 1AX1A 3E1F1 1WA6X 1X9PA 3VBOC 4AEDB 2KA3A 1RXGA 2A3YA 3ZN4A 3M7AA 3S30A 3IDEA 4HG6B 3NV2A 1EP0A 4DUVA 3LA2A 4PIXA 1PNGA 4RFT0 1CONA 1UZYA 4K40A 1TE1B 3D6EA 5ANQA 3ZXEA 1Q8PA 2P37A 1ZRRA 2JIGA 4M4PA 2ZAAA 2V09A 2JWPA 1AX2A 3CLPA 3P1IA 5A3TA 3I4IA 1PVC3 3AMNA 2R063 5C9AB 2Y60A 4W65A 2JG8C 3U10A 1QJU3 3BCWA 2VMFA 2HWB3 5FPZA 4GXLA 5C8WA 3BTXA 1XNBA 1E5SA 1SBDA 4Z07A 3W59A 2ZGMA 2RJ2A 2LM3A 5FLIA 1E5IA 4UFHA 5GALA 3ILRA 1NG0A 1Z7S2 1MZEA 1EY2A 2RG4A 3NJZA 2VL4A 3QOPA 1GQHA 4LOTA 1AJOA 4CCOA 3WNOA 2D93A 3FE5A 3THTA 1OLME 1XSRA 3K4AA 1ZVFA 1IS5A 2ENRA 1ENQA 4RGGA 3VHNA 3E5UA 4ZKTB 2ZKNA 2VZ3A 1J58A 2W92A 1WGPA 3GF6A 3KQRA 3NAPC 4W4ZA 3RMXA 4B1LA 3ATGA 2WZ8A 3IDAA 4BU2A 1AXZA 2FCUA 2R042 4UBGA 1C3HA 1QHDA 3WDUA 2NZ9A 4RYDA 1C1FA 2VAUA 4YW2A 4NVPA 5FZ3A 4NIIA 1V6LA 3BIWE 1MS4A 1O8SA 2I2SA 5FXVA 5C4WA 4HSLA 5EP9A 3AC0A 4E8DA 2J22A 5T50A 3VBHA 4DPNA 1YYNA 4KWUA 1PGL1 5GLWA 3G6JB 3SEEA 4YG6A 3OSDA 2RE9A 3S6PA 3U07A 4N43B 5FYVA 1C28A 2GAUA 2V5YA 1HDKA 2YC4A 1OMIA 4RR3C 1JYIA 5CFDC 4QKFA 4Y20A 2PHFA 1BZWA 5GLZA 4QT6A 4CCJA 1NY71 3VBSA 4V2VA 4BIFA 4BMEA 5FO8B 3BPSA 3AZYA 1E5RA 2DYCA 4MGQA 1XXNA 2O8QA 4XBQA 1XNKA 3AL6A 4JGYC 3AVRA 5FZ7A 4IERA 4Q4Y2 4HN0A 4R52A 2VOTA 3UL2A 4LORA 2WSUA 1UNBA 1SLBA 5DZGA 4FT8A 2JDZA 4HPKA 5F39A 1S2KA 2DURA 5A33B 5IT6A 4I01A 2ZMNA 3QD6A 1F4HA 4LBLA 5FZFA 3BTYA 1A8MA 3AKTA 3NW4A 1UF2C 2OS2A 3LSDA 5A6XA 5LA0A 2IUWA 3WINE 2NM1A 5J09A 2UYBA 3WDXA 3M2MA 1QNYA 2JDHA 1O3TA 1OA3A 1SLIA 3GCWA 1PGW2 3PMSA 4Q4X1 1F2NA 1ND2C 3BGAA 1GKBA 4UW3A 1M4WA 1LU1A 3HQUA 4CU7A 5FDBA 2ILMA 3NNLA 1LRHA 3GHMA 1WCDJ 4Q27A 4WM7A 5JXGA 2PLV1 1PVC1 1ZZ8A 2XQRA 5E16A 4BQ2A 3O14A 4CEYB 5BNOA 2JDPA 4S2GA 2FQPA 5C5UA 4JHZA 3LAGA 5L36A 3CJIC 4M3CF 5A7NA 2BTVC 1JUHA 2X09A 5C3SA 3RZKA 1PZ9A 4EN0A 3SISA 4OI2A 4QWNA 3D0JA 4XUPA 4B1MA 2YHJA 1AR91 5J37A 3NSTA 1PGSA 3DL3A 5F32A 2XGXA 3AP9A 4AOCA 2VUAA 2WSVA 3AJZA 2VNOA 2X10A 4BK5A 3POEA 4NHLA 5F5IA 3AYAA 4XCAA 4COVA 3WNKA 1DQ6A 3LA7A 4L99A 4D8MA 5G04L 1W9TA 1CZTA 1JXNA 3AYCA 1PVC2 5C4WC 1QY4A 2VMIA 4K6BA 1O8PA 4AQSA 1PHMA 4L97A 2ZX2A 5FZ0A 2XLFA 3IB3A 4AGGA 5DDJ3 3ZXLA 3MLKA 2QDRA 2FBEA 4ZY9A 2A5ZA 4QDRA 1R083 2A71A 2WA3A 3ZLIA 2FDJA 1GNYA 1VALA 3WG4A 3FLTA 3KZ4C 3LE0A 4XQ4A 4YZ1A 5AFEA 4I0BA 4WZFA 5JOZA 3EYPA 5JSPA 1Y43B 3WEZA 1RUF2 2DCTA 2FHRA 1KDKA 5FZGA 3ZSJA 3V0AB 3VD3A 4UW5A 4FPJA 1GZ9A 4QB2A 5ACA1 4M01A 3WHUA 4GWJA 1W8OA 4YGBA 1QQP2 1LENA 3FL7A 1PX4A 5F3CA 4ZS3A 3POGA 1UXZA 1LU2A 3N7KA 3O1VA 2Z69A 4QM8A 5BPXA 1I1EA 1CJDA 4CDXB 3ILNA 1GNZA 2K0GA 1OBNA 3LCPA 2WNVC 3SKJE 1MACA 3OY8B 1ASJ3 5FBZA 2E7AA 5C5TA 1F8VA 1X8MA 3TOJA 2LROA 1ONAA 2DU0A 2JE9A 4AVCA 5ISLA 5CYYA 2DBNA 1REFA 1VB2A 1OI6A 4AF9A 4Y1YA 5DAVA 2D3PA 5T55A 3O1RA 1DQ0A 2ZGTA 3AMHA 5JVVA 2ID4A 1UKGA 1WLCA 2Q0AA 4IE5A 5FMBA 2GC1A 2GNDA 1J1TA 1WW5A 2VNRA 1K45A 4HVOA 4OUSA 3S7EA 3WVJA 4FXKB 4OQ9A 1MS1A 1QH6A 4OMCA 1AL21 2I07B 4YGDA 1VAKA 5ABJA 3ZFGA 4CEYC 4BQYA 3OPTA 1FYUA 2JE7A 3VDAA 4FOYA 3N9MA 3HR9A 4NPRA 2WAAA 2LALA 4XBNA 4JDNA 3T30A 2XB6C 4YNIA 4UBHA 5A3MA 2XLAA 1CIYA 1CAUB 1OF3A 3CL1A 3IDBB 3H8UA 4J6GA 1YJLA 5HXVA 2VUCA 1LCLA 5A7PA 5A7WA 2O8OA 1YFYA 3SCFA 3CIHA 2D6LX 3MW4A 3PVNA 4LNVA 1HB3A 3Q8EA 1PZ7A 4EV0A 1YC61 5K0UA 1HN0A 1VMHA 1O4YA 1LEDA 4P9XA 2YFUA 4FO9A 2R7EB 4XACA 2XOMA 4AFCA 5FZLA 3LEMA 4XF4A 2VZSA 2XDVA 3M3QA 4XABA 5D8AB 1PIV2 3MPBA 2WJSA 2YGMA 2WLPA 4PI2A 4A44A 2VD7A 2DTWA 3AL5A 3VBRC 4LBMA 1TMF2 2BQPA 4YLZA 1JZ3A 2RR13 2ZX0A 3M1HA 4B4QA 3ROUA 1ZZCA 2VNVA 2FMDA 3LWCA 3AX4A 4K3UA 1D0GA 1GOHA 4CPBD 2VVFA 3I3MA 2A3XA 1S2BA 2QQPA 2ZHMA 3MI8A 4LR4A 2D43A 4KU7A 3O5SA 1SFPA 1Z0HA 2W91A 3PUSA 4IV3B 3WW2A 4X6RB 2F4PA 2WN3A 2AR6A 5J7MA 2HJIA 4IEXA 4K9SA 1S0JA 1PVXA 4QX7A 5C7GA 2V4AA 1OUSA 3NMBA 3JD71 4LIVA 2IFRA 2WUHA 4IV1C 3BALA 1NA1C 2BYVE 1GQPA 5K9YA 1QJU1 1A6CA 3AYEA 3W20A 4Q1PA 1NZCA 2P4EA 2CTVA 1G8WA 5IAVA 3ZSLA 3O1PA 2EIBA 1AYM3 1LESA 4YG0A 4Z82A 1WBFA 1CPNA 2QJVA 4PDWA 3CJIA 2Q5TA 1AR63 3EB7A 2J1UA 3S7IA 1W8HA 4A7YA 5FUPA 1NCQB 2BGOA 1RUJ2 1TME3 2DVFA 1FOD2 4MHRA 4D7SA 4XZUG 3PIGA 5JI9A 1VRBA 2TUNA 3NNFA 4YGEA 5IVEA 4KG8A 2JD4A 3LDBA 4AVTA 3C7OA 3HT2A 5GKAC 5A3OA 3VBSB 4ET7A 4LLOA 1PMIA 2HLEA 3PU3A 4TYSA 4ATEA 4DXTA 2VH9A 1JZ7A 2RM21 4MLOA 1RUJ3 1TME2 4UWDA 3WG1A 5ACA2 1RB8G 1GOGA 3ZOIA 2A6VA 2LS6A 2BRTA 5H9PA 4Q4X2 4IE4A 2VZRA 1WCQA 4J1WA 1U5XA 1KS5A 2MEV2 1NYWA 4GMP1 5FYSA 5AC92 4S2HA 4YVWB 3POJA 4C8DA 1XC6A 4JKLA 4R9CA 4EWEA 4BLIA 4M3CB 5I0SA 2ORZA 2WQ4A 5FZKA 3ZFEB 5FP3A 4YSFA 2Y0OA 2AYHA 3KHBA 1JBCA 2YGLA 5FWJA 4UFJA 1ZZBA 2E51A 4L8QA 1OQ1A 4XUQA 5I91A 3UGHA 1QMJA 2VQAA 4MZUA 3MV11 4FQ4A 1V6KA 2BNOA 1F35A 1POV1 3BOPA 1GQGA 1OKQA 1JMUB 4J1XA 5EZWA 5C3PA 4QQHA 5DAQA 2WNUC 3CZUA 4YW6A 2FDKA 1VB4A 1NZIA 5FXZA 2RS51 2VW1A 3H9AA 4OI4A 4A2UA 2QNKA 3EJKA 3NV3A 5FWEA 2D40A 4BJ0A 1QOTA 4YVSA 4CUCA 2XUEA 2ZGKA 4NIDA 4BOWA 5B2GB 1FMD3 2XL9A 4XQDA 2RS52 2VVEA 2RVAA 1LOFC 2R16A 1RHI1 2ZCWA 4IV1B 5GJ6A 2BWAA 2CV6A 4PCRA 1OXCA 1BLZA 2AACA 1Q43A 2D6MA 4N53C 1UU6A 2PHRA 1S0EA 2VZTA 1PM7A 4RS5C 4LBKA 1DFQA 1HRV1 4C0HA 1BK0A 5DQ0A 3DPRA 4RFRB 2D6NA 4TZDA 2HWC2 1SPPB 1TZOA 4GMP0 5I0DA 2RM23 3CF6E 4D6QA 3B93A 1UXXX 3AP6A 5FPVA 3I3QA 4M3CE 4QQ2A 5DDJ1 3P3PA 3WG2A 3B3QE 2BNNA 2EIGA 4TWTA 4QKNA 1IPJA 1V9U2 4IETA 4W6WA 5A3NA 3FN9A 1O4ZA 1UU5A 3R6SA 4E9KA 4LO8A 4QKBA 3POBA 5K4LA 3VBUB 5BNOC 1QEXA 2LTNA 1Q3EA 2XMLA 4XFHA 5DABA 5FZEA 4AEKA 4LO6B 2RDRA 3KCCA 3VBFB 4CCMA 3HT1A 1AR61 1DGLA 3FUOA 1V6MA 2VCMA 3LEGA 4Q4V2 1IOAA 3BIEA 1ZRCA 2VO5A 2G9FA 2JG9C 1N3PA 4NPLA 1LHOA 4ZU4A 1S0DA 4O9EA 2PAKA 1LOBA 2WINB 2PHXA 2QDNA 1PO23 4XVHA 3LOBA 3CKHA 3AJYA 5F37A 1CPMA 4HZFA 4CUBA 2PYTA 1XNTA 3ZN6A 3PVEA 3MIEA 2ARXA 1VRH2 4DNYA 1XU2A 2RJLA 3IIAA 3ORJA 4CCEA 4R4XA 4A7KA 3M3CA 4IV3C 1V6OA 2RS32 1CAWA 1IKPA 4FPOB 3VHPA 4HKWA 4I30A 2PHWA 4CDUC 1CZVA 4H55A 1SLCA 1W6NA 3NNMA 4JCKA 1WMXA 3ST7A 1DYKA 1U0AA 2R061 2DCKA 4BLJA 1C57A 5AVAA 2B5HA 2HWD1 5ABJB 1G9FA 3LSEA 2D7FA 1W6PA 2W47A 1ENRA 3JB8A 3WF3A 1ZRFA 3JBG3 3PL0A 2R041 2BNMA 5EYYA 1WW7A 4CE8A 2ZPXA 1QH7A 1US2A 3OTFA 1WLTA 3DN7A 1RUE3 5F2WA 1ULCA 1Y9QA 2VMGA 1A78A 3GZEA 4G3YC 4DEVA 1T6GC 2QQJA 5T52A 1YI7A 1XPWA 1L7QA 2GN3A 4P9GA 1K42A 2RDQA 3PJYA 4JQRA 1GWLA 1YFXA 2E32A 4FFGA 5A7WB 3D3AA 5C9AC 5KXCA 1AR81 4JTOA 4NAOA 3D5OA 3ZMOA 4CZSA 1OF4A 3ZXKA 1W3XA 2XVLA 2B7YA 4IE7A 3U14A 3W5MA 3SXWA 4ES8A 1FPN1 3RS6A 1JOBA 2CL2A 2QUOA 1MQTA 3C3VA 3I2IA 1VRH1 1HN1A 2AH2A 4LKFA 4PQQA 4XQWA 3TRSB 4N43A 5FY5A 1W0OA 3VD5A 1TNRA 2YROA 4Y1UA 2DVDA 1OD5A 1CESA 5GLTA 2HWE2 1FPN2 3N36A 1DQ4A 5DAWA 3HOBA 4P9JA 2BGPA 1XRUA 1DGWA 5A3WA 4BQ5A 4FCAA 2HWB2 4IESA 3GZAA 4G4FA 5FK8A 1YCIA 2RS12 1W0NA 3OB8A 3RI9A 2WO3A 5D8AC 1HXS1 1W05A 4HBNA 4YZ4A 2F6BA 3I2OA 4NIGA 2CGNA 5FYIA 2BEOA 1FOD3 2VQTA 5FPLA 4NHYA 5GZFA 2WZPP 4A6OA 4CXWA 2FDGA 3I2KA 4AQ2A 2VULA 3C8XA 3CNAA 2XUMA 5CADA 5LY2A 2EAAA 3THDA 4AG4A 4KBBA 4OHYA 5FYMA 4LHNA 1NCRB 4P9LA 1SFYA 3C7FA 2OX0A 3ZPYA 3HN3A 3NAPB 4C0BA 1PO21 1LTEA 4AGRA 5T54A 1URXA 4XPVA 1UD1A 4EYUA 1H6XA 3X29B 5FY9A 1D0HA 1YIFA 1BVVA 1MVQA 1AF9A 4AI9A 4OZXA 5KHJA 5JSOA 1KEXA 2H0VA 1R1A3 2VR4A 4ORFA 4BQWA 4DB5A 2HH9A 3GBFA 4WM7B 4OCTA 5CKQA 2E7QA 2ZJCA 3K3OA 5FO9B 4AHXA 4HONA 4CU9A 5FYBA 1JYWA 4L11A 4NJ4A 4F7ZA 4BK4A 1C8M2 4AVVA 3T0DA 2BBAA 2W94A 2YMZA 3VHRA 4AEJA 4B8EA 1WMDA 4K20A 2DDUA 5DXDA 5FYTA 2WYFA 5HBAA 4Q4Y3 3S0MA 5FFOC 4ASMB 2W1QA 3WQ7A 4BDVB 1QJFA 4YFZA 2ZS6B 1X7NA 1RMU1 1J59A 4QPGA 4XUTA 2D5FA 4AL9A 4CDWB 5FZCA 1AYN2 1R1A2 2WT0A 3A23A 4BIOA 1RUNA 4MOAA 3OGRA 2LW8A 1L7LA 1DCSA 1VBB1 4EJRA 5KHGA 5KC5A 3V0BA 1NT0A 5ERLA 4GALA 4XYXA 1AR83 1S55A 5FMDA 3ZXFA 2XPJA 2HYKA 1VE0A 3O7OA 3PIJA 1S0BA 4HSJA 4Y5TA 3TAYA 5HCAA 1M06G 1BBT2 3VBOB 5BXXA 2JKBA 4AEDC 4Q0PA 2KR2A 1YWKA 4OUMA 2F4LA 2PTMA 1DHKB 2VW0A 1COV2 1TEIA 3AMPA 5EFUA 4NRMA 4JRAA 1R1ZA 3AMQA 4QXBA 4OHZA 4CDUB 1MS0A 1RL3A 1W9YA 1SCRA 2Z5WA 3LF7A 5JI7A 1YJKA 3APBA 2HKXA 1EUUA 1ZBE1 3B94A 1ULEA 4N53A 3HN1A 4W8JA 5GLUA 3ZFGB 2OZJA 1RUC3 5IVFA 4LMFA 4IEUA 1IS6A 3AP4A 3PTYA 5EJ3A 3WF4A 4ZPIA 3VLBB 5BNPB 2TBVA 4S2FA 3FLPA 4AWDA 3H1WA 4YPJA 4CP2A 1HQNA 1XSQA 4ITCA 1S0FA 2QKDA 2Y8KA 5FY0A 5F8PA 4D7YA 2JD9A 1OURA 1EV12 2VTFA 1RMU2 1XJAA 1EAH1 2JDAA 5FMOL 1W3VA 2VECA 5LBEA 2EA7A 3MF6A 4LUKA 3WX5A 1IKQA 3VBRA 4N7UA 4DRRA 3AKQA 3UNPA 2BP6A 1W6MA 4NROA 1SZBA 2J1AA 3DV8A 2XH6A 4LEJA 5F6LB 3MIDA 3RQ0A 1UYYA 4FFFA 4WVZA 1MS5A 5JR7B 4QQPA 2R0FA 2MPFA 2LRPA 1H2NA 4J25A 2WQZC 2P2KA 3AZWA 1UOFA 2CU5A 1G7YA 2ZGOA 1PZ8A 4XUNA 4NWWA 3EXUA 4Q29A 1UKRA 3T0AA 1WA4A 4DUXA 5KXBA 5A1LA 2IFWA 4F3JA 3PUHA 4Y33A 2KXLA 4LHSA 1LHUA 1J3QA 4IE0A 1UYZA 3HNMA 2Z4FA 4GWNA 3EBRA 1OOPB 3PJQA 3T1LA 2RDSA 3MGUA 1PO13 4URTA 3WLUA 2K46A 2Q4SA 1VBD2 2PAMA 2A6ZA 1BQPA 3WUDA 1C5IA 1VBC1 3Q8FA 5FYYA 4FPCA 1WBLA 1JW6A 4NRPA 5LZ6A 2OT7A 4WVVA 3WY6A 2Q8OA 2RJKA 3JD73 2QQIA 1YQ6A 2J42A 3FBMA 4X8PA 1GLHA 1U5ZA 2PHUA 4Y3OA 1N1VA 3IMMA 5HCFA 3UJOA 4L0PA 2VW2A 1SBEA 2GH8A 2Q1FA 4L92A 2G9GA 4KI5M 4LE4A 3WOGA 1XYPA 1W28A 2ZEYA 3BU0A 4Q4W3 3D82A 3PLQA 5C8CC 4DY5A 2HBTA 3G7DA 1REEA 4B7EA 4HVQA 1VJ2A 4IEVA 2HWD2 2FCVA 2EALA 4CP9A 4DINB 2YBSA 2Q30A 5JIAA 3N9PA 4A6SA 2YBPA 4XJAA 2DUPA 4IEQA 2XJVA 4KGGA 3VL8A 4YVSB 3ZXGA 1H2LA 4I3PA 2UY8A 2YC0A 2CWMA 4Y22B 5A1FA 4PBOA 1W8UA 3ZYGA 1NLRA 1ASJ1 4Z92B 5T3NA 2D6KA 3WF0A 3SH3A 3T4HB 2UURA 3WXPA 3H3ZA 4D0QA 1UAIA 4ARYA 1QJX1 3POIA 5JZGB 4GKXA 4P5HA 4V1PA 1PO12 4MX3A 2RM22 2ZABA 2WFF1 5KXEA 2FZ2A 2PELA 1ZRIA 1QJY1 1QIQA 1ENXA 4GB31 1UIKA 2OVUA 3VL9A 2TEPA 2BFUL 3DUIA 4GWIA 1JYCA 2W08A 3CJIB 2XVKA 5JIUA 5FPUA 3KF5A 2IXKA 2R043 4JV4A 2C0ZA 2Y6JA 3WCRA 3EHKA 4E2GA 4QPYA 4OMDA 1PIV3 1UMZA 5DZFA 3VDDB 2WS92 4DXSA 1I6XA 3LFMA 1JH5A 4CDWC 2VZOA 3HVDA 4GJYA 1QJEA 1ZREA 4LO7A 3K51A 2J7MA 1ULDA 3BTAA 3B69A 4PHZA 1RUF1 1KFUL 4UFMA 1KJLA 3USSA 1UW8A 4AYUA 4I2OA 4EN8B 3B9IA 1D2QA 3M8LA 1PM4A 1BEV2 1C1LA 1RGSA 4NRQA 4YG3A 1FXZA 5FPAA 3V0AA 2ZX1A 3ZPOA 1CZSA 1YXWA 2C24A 2ZOEB 5FZOA 4JTNA 4LQRA 3LQCA 4XMIA 3ACGA 4GD4A 3T3YA 3RYKA 1YQ2A 3QH7A 4UW4A 1W90A 1W8ZA 3H1MA 3K4ZA 2WFF2 2HEVF 1UO9A 3J7LA 3ZFGC 1GZWB 2VCAA 4UYBA 4QX2A 3HMYA 4OHWA 1OPOA 1YO8A 4YARA 4Q4V1 1NKGA 1AYN3 4QQOA 1AR92 3OGSA 2QFEA 2WR9A 1H4GA 5H9SA 4LULA 1BEV1 2XHKA 4D7TA 1YQ5A 1OLRA 1RUE2 2OQ7A 1RUI2 3T2PA 2QQOA 2JB4A 1YI9A 4BZ4A 2BZDA 1O3RA 1W04A 1EV13 3WZ1A 5LRSA 4R9DA 5FZBA 3UKVA 1GU3A 4PIZA 3ACHA 1RUC1 3WDYA 3JZVA 3M3EA 3NL1A 3RZHA 3W5NA 1DP0A 5FZ8A 1MZ5A 5GZGA 3SQOA 1ZM1A 3ZFFA 2VOXA 4AXOA 5JMOA 1RUG1 3IBMA 4Q5OA 1V0AA 1W03A 3OYWB 3IPVA 2PAEA 2AEYA 3DKWA 4HOOA 4DOUA 3VBSC 1ZZ7A 2G19A 1EAH3 1J3RA 4PF5A 4QMAA 4ASLA 4QHOA 3CEWA 2AENA 3VV1A 1DQ2A 2VGDA 2Z79A 5DMYA 3MFAA 1ODNA 3OGVA 1N3OA 5JCTA 1IGOA 1DGRN 2E6VA 3NNGA 4IEYA 4QX5A 1XE8A 4XJ9A 2W9XA 3GNEA 3I3BA 1V6JA 4CP1A 4AQ6A 3TEXA 2X8KA 5A80A 2Q8CA 3I2DA 2BVVA 2WS93 3T2QA 4CA9A 4Q1RA 3C7GA 2WN2A 3NJXA 3ZDSA 4Q4Y1 1DIWA 1N3QA 2CAVA 2B39A 2P1BA 2VMHA 3A22A 4PT6A 5IHRA 1ACCA 1XNCA 5F3GA 3PUQA 1JZ8A 2XBO3 4O61A 1HLCA 1MS3A 5F3IA 1LEMA 3LPGA 4TN7A 3ZFFC 3L2HA 1HW5A 4O9GA 4YW4A 3M4FA 2Y64A 4YVSC 1UZZA 4LHLA 2BUKA 5KR7A 4GIQA 2RDNA 1DYOA 1LJ7A 4AE2A 1JYXA 1Q8SA 1GP4A 3JCIA 5FMCA 1VAVA 3FLRA 2VZPA 1NLSA 3KV5A 4LO5B 3ILFA 4HT1T 5LBFA 4AHWA 3AB0A 4XIKA 1UPIA 2VTXA 1EYBA 2VQUA 1CX4A 2IXIA 4AAXA 2L9LA 2W39A 2ZEWA 3MIHA 5FOJB 5J3UA 5CG9A 4HK8A 4NWVA 5DUVA 1EV11 2AZ5A 2WZR3 4N8MA 5CBLA 2RV9A 3E6CC 2YY1A 3P3NA 5FYCA 2DWRA 1XYOA 3J8F1 3MIBA 3NJYA 4FPYA 2JG8A 3MYXA 3PHMA 2WWSA 4RHV1 5JPNB 1VBD1 3CU7A 1J3PA 1KITA 1ND2A 5CFDB 4PLNA 4RGAA 2DU1A 2W52A 2VZ1A 2CAUA 2W5FA 4NUBA 1X8EA 4RQPA 4MGIE 1QJY2 3RZGA 5BNNA 1TVGA 1BKZA 4M0HA 3SH4A 4RGKA 1HB2A 1UY1A 1S4CA 2QZ3A 5FJKA 4MUVA 1COV1 2XLGA 3VBOA 1ODMA 4GA9A 3VBUA 4U2AA 1HRV3 2ZEXA 1Y9GA 5EHDA 4CDXC 2W68A 3SCGA 2OUHA 4Q8LA 3LOIA 3VBUC 5BNOB 2WL1A 1MS9A 2C9KA 4META 5FIXA 1AR71 2JKXA 5FYZA 1OA4A 4ONUA 3SLIA 3WNMA 2JDNA 2JIJA 1CAUA 5LA2A 3V0BB 4B29A 4RQPC 5CG8A 1RJ8A 4P5YA 4MG2A 2XBO1 3OF1A 3VKLA 1RUG3 3TB0A 3K3NA 4IGOA 1WKYA 2CDOA 2R49A 1XU1A 4X6QB 4LBQB 3WP5A 4XDPA 2JG8B 3SITA 5T5JA 2EF6A 4QB6A 3DF0A 3PUIA 4QU1A 5C4WB 2Y34A 3WQ1A 3I7DA 4Z1VA 5F1RA 3AXEA 3VD7A 1Y7BA 4YVWC 1CAVA 2GSYA 3BODA 5FKBA 1PMHX 3VBFA 3AP7A 2GH2A 1PO11 4CU6A 2BWCA 2PXJA 2VOKA 2Y6KA 3ZYIB 3HBZA 3P6BA 3J7MA 2QZ2A 3B01A 1UIJA 2J1RA 4XHBA 1JYVA 4XE9A 3RFRA 1SMVA 3MW3A 3UGFA 4FFHA 1AHSA 1H9PA 1FV2A 1K5MB 2HWC1 4R9AA 2FDHA 1VBE3 2DVBA 2NYYA 4QX3A 5K0UC 5BNPA 5HPOA 3BOWA 4KQ7A 1B35A 3ZVXA 4YW1A 1NQJA 3GZTB 3N7LA 4MSVA 4W6XA 3KT7A 1W9WA 3MIGA 4XHXA 2ZKLA 4M3CA 2ZX3A 2SBAA 3R0RA 2XWJB 3U1XA 3VBHC 1LGBA 4HFSA 3UJQA 4AI0A 4C91A 5L7OA 3ON7A 1BHGA 1CWPA 1J1LA 4HPKB 4RSUA 4GH4A 5DUWA 2QQKA 4NR1A 4RHV2 2DVGA 4CTEA 3F95A 1PK6B 5CZKA 5FZAA 2GN7A 4XCBA 4PJYA 3IDCB 1R64A 4LKSA 2ZA9A 1FT9A 1RUE1 4ISRA 2XG3A 2FDFA 3ACIA 3BI3A 3VB9A 3N3HA 3NV1A 5A32B 2D3SA 1Z7S1 3MZHA 4IGPA 4XF1A 5D1IA 1MS8A 1RTVA 1QJX3 3HD8B 2XJSA 4HKLA 1OT5A 2VY0A 2XJPA 4MYEA 2BOIA 4Q2FA 1BK1A 2VJXA 3WP3A 1WLWA 1OOPA 2EIDA 2VCCA 3IKWA 3TN92 4CP9B 3WP6A 1QXPA 4K21A 4CVUA 2OKXA 1JZ6A 1VPHA 2B4KA 2JICA 1UMHA 1UN1A 1PMJX 3PTRB 4P08A 1CIWA 2OYZA 1X9TA 5HI0A 1G9DA 4ISQA 4P00B 4TLGA 5L7OB 4UFIA 4A42A 3V64A 2HYXA 5LEKA 3RZJA 3KV4A 2ZGUA 3W21A 3O0WA 4AR2A 3FHQA 1UWWA 1ZYBA 1W9SA 2SLIA 3F2ZA 3ELNA 2KD7A 5F9TA 4BXFA 1UU4A 1F31A 5J98B 3MFCA 4LE3A 1VBA1 1PX3A 1SLLA 2CGOA 1UMIA 4KMQA 1YRZA 2WNVA 3NJVA 3ZIXA 3ZXAC 1EAH2 4KNCA 3VDCA 5FR3A 1UPSA 1CD3G 3NRUA 5H9RA 3DGTA 5FPXA 4OI0A 4INDA 3B7MA 3LEIA 4D6RA 2W1SA 3ALQA 3ES4A 5LATA 3UV9A 4ZXEA 2RS11 2XJUA 3T4VA 4KU8A 2UWBA 1LHNA 5IVBA 2WLQA 5FZDA 2VU9A 2D6PA 2W3JA 1IG0A 3SH5A 5LRRA 3CMGA 5BY5A 1O5UA 1H2KA 4H7MA 4COYA 4YVWA 4FTEA 5FP9A 1LAJA 2FDIA 4F83A 1WW4A 2XJRA 3O0XA 5AC93 3O1UA 1FAYA 4F8AA 2BPA2 1ZRDA 2H6CA 5FREA 1POQA 2B9VA 5CIRA 1Y4WA 4AEDA 4NHXA 2O0OA 1SG3A 4AI1A 3PVOA 1W2NA 1GP6A 3RNSA 5LEJA 3AZVA 5F7UA 1WD3A 2UWCA 2WA4A 4RHV3 5FZIA 5BV6A 3KVAA 5HV4A 2B8MA 1HIXA 4KG0A 1DZTA 4QU2A 2QTWB 1W6PB 1O6UA 2R1DA 2PHTA 4Y5SA 4EN6B 4AEMA 1MQTB 3WNPA 1QWRA 2QQUA 2Q1MA 5IK5A 1NE4A 1RVF2 4XETA 1R082 4QPGC 3UESA 5EQUA 3TWIA 1IZ3A 4KL1A 2XVGA 2CDPA 2YPDA 1SACA 4OUEA 5AVPA 1QJX2 2WBKA 3I54A 4UXAA 3BPZA 5H9QA 4C1XA 5BNNC 5CFCA 1PGL2 3MF9A 3UKTA 1OLQA 3D4KA 4FOWA 1VAMA 4YM0A 2WO1A 5DAXA 1ZX5A 4LO4B 4FAGA 5I93A 5E89A 2JENA 1W8TA 2FZ1A 1W2TA 1RUG2 1J84A 3ZSMA 1QJZA 2AREA 2EXJA 3GM8A 4FP2A 4DRVA 2XL7A 2WAOA 4RD7A 1W6QB 5F5AA 3ZXDA 4CCCA 4FVVA 1DDLA 2E63A 4ARXA 1H8VA 2VZUA 3ZFFB 3ZYPA 2WS91 1WCUA 1HRV2 1NLQA 1QXJA 2NMNA 2VBBA 1STMA 2WT2A 2JX9A 1AR93 1FX5A 1V6IA 3AMMA 4AFDA 3INAA 4CYDA 2YDEA 5J96B 1F15A 2BJSA 2XKOA 2ZTNA 4YZ5A 1UY3A 3OJBA 3ES1A 2RS33 1SLTA 1KFXL 1SFNA 1NCRA 2HEYF 3NV4A 1RMU3 3MV01 5CFDA 5A6YA 3KGZA 1ENSA 3VBHB 3HBKA 4YGCA 2QQMA 1RIRA 4IE6A 4R9BA 3FZ3A 4QD2A 5IUQA 3ZYRA 1AVBA 3UKNA 3N9LA 3ZR6A 1UX7A 3LZZA 2KM2A 4AFAA 4JGYA 4KWLA 3A0NA 1W2AX 4Q4V3 1LOAA 3PVBB 2D97A 1BYHA 1AR62 1RUF3 3NQHA 5CKMA 3FFZA 1KRIA 3N7MA 1S1AA 4CDQA 2FCTA 4Y24A 2DCZA 2ARCA 4B3NA 1SCSA 2YU2A 2ET1A 4NO4A 1JU4A 1S0GA 2I45A 3TNPB 2IWGB 3MHZA 1Q5OA 2HWD3 4UFLA 1IHMA 2WT1A 2VBDA 1V00A 2WYSA 2JDUA 1EPWA 5DDJ2 5EIYB 4XFGA 2A73B 4FQZA 1BMV2 2A6YA 4RS5B 3NAPA 3CQOA 2QQVA 5FZMA 1UOJA 4FOQA 1NQDA 4XBLA 2P3IA 5FZOB 5C3RA 1HRI3 5BNQA 4MVTA 3KT1A 4GULA 3TYJA 5HXMA 2WNUB 3KF3A 4I09A 2ET7A 4W50A 3LPFA 4ZS2A 5EJ1B 4DIQA 3N4MA 1Q56A 3E6DA 1SEFA 3ETPA 3E5XA 4R4ZA 2ZXQA 3VHOA 3WF1A 1WMEA 3E97A 3SCHA 4YYOA 1FATA 4FPLA 1KXGA 2DUQA 3J7NA 3WNNA 1OHFA 1W39A 2EXKA 4NE9A 3A7QA 1LECA 4TTGA 4ZHNA 3T0BA 4DXZA 3EO6A 5FQ0B 2Y6GA 4COZA 2E9QA 2X29A 2PA7A 1H9WA 3MUY1 1QDCA 4EROA 1XQNA 1JI6A 4OHVA 2Y6FA 3VGIA 1TNFA 3OPZA 5JXHA 2CNAA 3FC0A 3B02A 1RINA 2PN5A 1J83A 4YFWA 2B42B 3WP4A 3ZYJB 4AI3A 2W0XA 4DXRA 3DECA 4XW3A 5K8SA 2JE8A 5JSRA 3KWVA 1JU3A 2WQ8A 1JZ5A 4IGQA 4HETA 2A75A 5K0UB 5JAXA 4PBPA 2QE3A 2ZX4A 1DU3D 1FV3A 2BVBA 4URAA 2YBKA 2AEZA 2RMU2 2IC1A 1XBFA 3GYDA 3P5BA 4Q0UA 1TG7A 4UW6A 3V56A 5A32A 2VCBA 1W2OA 1F9KA 1CQ9A 1UY0A 1NXMA 4OHXA 3K4DA 2C5DA 1ND3C 5C71A 3FFQA 5LWBA 4Y22A 3VDDA 1IS4A 3GBGA 4BMBA 1VBD3 4WM8B 2JDYA 3NO8A 3H8OA 2DFCA 2VVDA 3VDDC 3LD8A 5ACA3 2YPJA 3ZSKA 4UF0A 5JXIA 3KGLA 5J1XA 2WWUA 5HCBA 5L9BA 3VKMA 4QM9A 4EN9B 3I2JA 1HJGA 3J8F2 2YV8A 4AFBA 4GWMA 1BJQA 2N7GA 5KHIA 5LBBA 1ZA4A 4KH9A 3HEIA 4E2SA 3KQ4B 3ZFEC 2ATFA 2VQ0A 2XKPA 3DXTA 1FI2A 3KCYA 5FLJA 5DUXA 4FTBA 2NMOA 3ZYFA 4AVSA 4Y4YA 4XFCA 5E88A 4Q8KA 1YFUA 2NQYA 2YUEA 4BXSV 5DPNA 3QACA 2WWJA 3RJRA 1GZTA 4WV8A 4AI2A 1AXKA 1L7RA 2PMWB 5ABJC 5FY8A 4GQ7A 3LDRA 4FP3A 3DYOA 4BYYA 2A1XA 3NKGA 3AK0A 2IVIB 1PK6A 5EWSA 3H8RA 1MZFA 1OQEA 4JGZB 5SV8A 1FNZA 3M3OA 4JDOA 4YW7A 3M70A 2G9ZA 3T1MA 4JX0A 5DG1A 2DCYA 4HVRA 1W6OB 3RWNA 5CISA 5FZ1A 3L2YA 5LA9A 4H2AA 4ZONA 4WM8C 1PNFA 3PNAA 2RHPA 4DZGA 4XJWA 3B5LB 2HWF3 4QGMA 3GGLA 4CDQB 3PURA 3KB5A 4N43C 1VP6A 3DPRC 4E27A 1RUH2 1XE0A 3S5QA 1DGWX 3TBDA 5BNPC 3AP5A 3I2HA 3JBG2 4MGKE 5D21A 1DLCA 4I02A 1ZBA2 4HXCA 1JZ2A 5F5QA 1HX6A 1C5HA 1AR73 1QOOA 2EXIA 4XFFA 5JDBA 3RMYA 1GR3A 4DUWA 3W58A 1GOFA 1LOFA 2E53A 4GMP3 2ZGRA 3HIFA 4YRDA 1JYNA 4BPZA 5JOWA 5KHKA 2ZHNA 1LGNA 1NUKA 4YZ3A 1R091 1GP5A 4GJZA 4Q26A 2ZEZA 1I5PA 1G86A 4M0NA 2DVAA 1RUH3 4RQPB 2XHNA 4FPEA 2GC0A 2P6CA 2RMU3 5A7OA 2XQXA 3E6BA 3MO4A 1DQ1A 3RJ2X 4BQ1A 2OZ6A 5FLHA 2WNOA 2V72A 4XF9A 1OVSA 2GMMA 3CJXA 3IN9A 2C26A 5FYHA 4HK9A 5C9AA 3O1MA 3H7JA 2VOWA 2ZMKA 5DAPA 2R6QA 2WABA 2XJQA 3H0OA 1ALYA 2RS53 1EUTA 2WKKA 1XYNA 4MXWA 3WHTA 2PQQA 1H4HA 4IV3A 4IDZA 4CEWA 3I2GA 3THCA 4AI8A 1NCRC 2PHDA 2YC2A 1UY4A 3T08A 3K2OA 4PIYA 2Y6LA 5FUIA 1GBGA 1SBFA 3LIHA 2EICA 1JZ4A 1X36A 3GJBA 3OD0A 2Y26A 1GWMA 4IEOA 5EXOA 2BBVA 2X53S 4MGTA 1DZRA 4PDWC 3OBZA 3USUB 2VC9A 3ZSEA 3L9JT 1H8TC 1X33A 4DQAA 1D4M1 5FY4A 1JHNA 1KGYA 5A7SA 3I3EA 2TNFA 4RA0A 2WZR2 1QQP1 2ADEA 1BBT1 4LKEA 4MO3M 3J4UH 5IW0A 1SQ4A 1OVPA 1IPKA 1HQLA 3UGGA 1YIPA 4Z2WA 2GMEA 1OQDA 5IK8A 1POV3 5JLVA 3WT3A 4COUA 1RUJ1 5IATA 2IVJA 2HWC3 5KBFA 1KDMA 2DBIA 3LEKA 2OQ6A 4LIUA 4QHZA 2X05A 4A3XA 3NVCA 2RS13 4BH9A 3I49A 1CGPA 2ZAHA 4N53B 5G05L 1H30A 2RMU1 4DEQA 3SKVA 1FMD1 1RITA 3GHNA 3HAGA 1HXS2 3N9QA 3NNJA 2WZEA 4LUMA 4RS5A 5L9VA 3OD4A 3UT0A 2WDBA 1X50A 2VMDA 3FUQA 4Y4RA 3POSA 1QJU2 2B45X 4JKMA 1C8NA 5LB6A 5LBCA 1FNYA 4A45A 4A3ZA 1CR7A 2B46X 1ZNPA 3TEYA 3U4SA 3H3UA 4RR3A 1XNAA 1COV3 1OD3A 1RXFA 1ULGA 1ULPA 1H1AA 2QQWA 2NN8A 5A6QA 2ZBJA 1QNWA 3R4SA 5DN2A 2Z2SB 4XDOA 1DF0A 5E6HA 5A3LA 5F5CA 4D94A 3J9SA 5DG2A 3WW4A 1KS4A 3OEAA 2NP0A 4QPWA 4CCDA 2A3WA 3BB6A 3J8F3 4E4HA 1MZ6A 5BYNA 3H1YA 1I9RA 3IPVB 3QH6A 2JECA 4OULA 2EXHA 2RR11 2DV9A 3U75A 1LHVA 4D69A 1F4AA 2AC1A 5LASA 1SDDB 2OA2A 1BBT3 2ORXA 3FHIB 5FK7A 4YWAA 3K48A 1T2XA 4BQ3A 2B9UA 3ZIWA 5JMCA 4P9IA 3KSCA 1QDOA 2IZWA 2JG9B 2GZWA 4NOTA 2RR12 2XONA 4CU8A 5B4XA 2JJ6A 1Q8QA 3I59A 3OY8A 1JOJA 3Q9OA 3WD5A 5KC6A 1I5ZA 4HN1A 1JS9A 4EN7B 1S0IA 3DPRB 1AYM2 2WNVB 3N7JA 4Y1XA 3OUHA 1CAVB 2MNGA 4B4RA 1GWKA 3WW1A 5I0RA 2DCJA 3WNLA 1GYKA 3DYPA 1RYYA 1GZWA 4YW3A 4QXHA 5LY1A 1VRH3 3BU7A 2D6OX 1NX9A 3H50A 5HV0A 4CRQA 1GFF2 2P34A 1WD4A 1JN2P 2RS31 2C6SA 2EIEA 1ND2B 3POWA 4LK7A 4BQXA 3ZM8A 4GH4C 3CBNA 3LDKA 2X5IB 4MV2A 2BFUS 4MGZE 2OUJA 1TME1 5FUNA 5I0TA 3OPWA 1KJRA 2V73A 4LBQD 3BKZA 2XWBB 2H6BA 1RUI1 5CU1A 1DLLA 2ZZJA 3JD72 1B35C 2P6HA 3RVHA 2DUOA 2R30A 4K1YA 3ZX7A 1MEC2 4D3WA 4FFIA 1FOD1 1N47A 1JODA 2W2IA 3OBAA 3O1OA 2IXHA 3WSOA 2GP5A 4Y1VA 5C8CB 1GNHA 4YM3A 1HKDA 4XURA 1JYTA 3VZNA 3SMHA 1JUIA 5L7OC 4E4DX 5GM0A 4KGQA 4CUAA 4OFGA 4BCUA 1AR72 3O12A 5I8SA 2IXLA 4LKDA 5LK5A 3GALA 4G9SB 1QKQA 4E2QA 3MPPG 2VOVA 3ZYBA 1CX1A 5C3OA 2ZHKA 3PMEA 5I0UA 3O1SA 5A1AA 1UYXA 3I8TA 2OPKA 2VZQA 1O91A 3HQXA 4XXPA 3EMRA 4DY3A 3RYRA 1VBA3 1K5MA 1Z7S3 1HXS3 4XF3A 3MUZ1 1JTZX 3GCXA 4FPGA 4CDXA 2VPVA 3V65A 2XJTA 1JHJA 4QPGB 4FAHA 4FPFA 5HCHA 4LBQA 2HWE3 3RSJA 1DGRA 5GZEA 3K75B 4W6YA 3KMHA 4QGNA 4LBOA 1P8JA 2G4IA 1ZZ9A 2ZGSA 5E1RA 1MEC1 5C8CA 4FPKA 1AL0G 3S5AA 4OZOA 3WNXA 5EPAA 3IAPA 5FY1A 4CXYA 2HWF1 2VTXJ 2JEMA 2K2SA 3RGBA 4WM7C 4K8FA 3ZXJA 4CCKA 3VD9A 4LPLA 1C8M1 3MIFA 1UCXA 1RJ7A 3LFIA 5LK7B 1NOVA 4X8NA 4P9WA 1BMV1 4EZ4A 4KBZA 3VDBA 3FMGA 4XJZA 4FOVA 2I74A 1OOPC 2O14A 3JQWA 3QBQA 3I97A 2ZGLA 2Y6HA 3T2TA 4ZXKA 1S2EA 4N90A 3ZKYA 1OUXA 5CA6A 3OG2A 1QGLA 4WBBA 5FO7B 3U11A 1LHWA 1Z78A 3ZO0B 1QJY3 2EVXA 5A3PA 4IEWA 1REDA 2ZZQA 5IVCA 4QDQA 1VBA2 1BCXA 3LGRA 5TSWA 1VBB3 1UZ0A 1O59A 2R1BA 1D4VB 4HMZA 4KWKA 1PIV1 5E8AA 2ADDA 4L2NA 1GICA 3AXDA 1H1IA 2P5BA 4QKDA 1SHWB 4A41A 5IK4A 1W6QA 3JUUA 4NMIA 1C4RA 3WR0A 3JXSA 3VZMA 4LA3A 2ZGNA 4XZPA 3ZMNA 3JB4C 2A6XA 3J26N 5IFTA 3GZUC 1W6MB 1VBC2 2HBUA 2PLV3 3WV6A 3W9AA 4K1ZA 4LT5A 1GV9A 1B09A 5FJHA 5FP4A 4AZZA 2XXZA 1NY72 1HB1A 1Q8OA 3IAQA 4GKYA 1HV0A 2WFPA 4XILA 3WW3A 4BA6A 1LB2A 5T5OA 1ULFA 1N1TA 1RVF3 2OIIA 5FZHA 4OYUA 1RUOA 3MBWA 4PDWB 1GSLA 4PI0A 1H6YA 1XE7A 4FXGB 4EWAA 1H8TB 4QGLA 2GNBA 1AUYA 2JDMA 1CAXB 4WVMB 3ASIA 1NCQA 4ZU5A 5A7QA 1NCQC 3KD4A 4Q0SA 3KV9A 2ZHLA 1VIWB 1ND3B 4WVWA 3SHRA 5LA1A 1OSGA 4UT5A 2ES3A 2VG9A 3VBFC 3HPNA 2ZACA 2D44A 3I3DA 2NPIA 1B35B 4N9IA 2P17A 3VZLA 1YFWA 4S2DA 5FYUA 3ZN5A 1VBE1 3D0SA 2BGCA 2OPWA 4RR3B 4L9BA 4UOJA 1NA1B 4AW7A 1SPPA 1HV1A 5I8YA 1VR3A 4XTMA 3THPA 1TMF1 3J7HA 4JZRA 4EWDA 1YHFA 4LBJA 4QX0A 4B4PA 4DMIA 5IK7A 1QXRA 5FBJA 1F5JA 2K9ZA 4C1WA 1G9CA 5J36A 4JGYB 1OC1A 4I0WB 3TEZA 3TNQA 4K7JA 2YB7A 3B00A 3O0VA 2VBPA 1E57A 2QQNA 3RPQA 5FRAA 2QCSB 3BYWA 2WIIB 5DZEA 1H8TA 3IMNA 1A34A 1WWYA 2QQLA 1LKNA 2VMCA 4JHTA 4QPIA 1BXHA 4ZU7A 3I2FA 4ATFA 4QB1A 1X82A 4RL7A 1OA2A 3TN93 2Z42A 4QDSA 1I3HA 5L19A 2G1MA 4Q4W2 2VM9A 3WDWA 1W99A 4Q0QA 5J48A 1GUIA 2BERA 5JUVA 3N9NA 1R1A1 3A21A 1R081 4MH0E 4BB3A 4RN5A 4K8RB 5AFBA 3FWEA 1UQXA 2XBO2 4UFKA 1NA1A 1UOGA 1CVNA 3AKPA 4XJ8A 2AGSA 3ACFA 4LHKA 2R073 1GANA 3VZJA 3RG0A 3OCPA 2DTYA 2GNTA 2GNMA 2YG0A 3KV6A 4PF1A 1E5HA 3OGGA 4QXKA 1N1YA 2YU1A 4JGZA 1ZBA3 3QLQA 4XAEA 4XEZA 4E4SA 2FMYA 3RZZA 4AAPA 2BOJA 3ETQA 5FY7A 3HNYM 1CN1A 3IIIA 2YXSA 3ZYHA 4BM8A 1O7FA 3UK9A 1AZDA 1R092 3AM2A
chains in the Genus database with same CATH topology
4Q4W1 1ZZ6A 3MLJA 1K5MC 3GBWA 3ACLA 3NWKA 3VZKA 5JPMB 1YNAA 2WNEA 2UYAA 1NE6A 1H1MA 2PHLA 5KHHA 2A6WA 5KWRA 1LOGA 1SDWA 1RUC2 2D3RA 1VBB2 1AL23 4Q0VA 1YUDA 4PLOA 4A7ZA 4H7LA 2D5HA 3ME2A 3CO2A 4YW5A 1WCSA 1LODA 3H7YA 2X5IC 4HLTA 1PO22 1G9AA 1KQRA 1V9U3 4DFSA 3AFGA 1AL22 1Y3TA 2R0HA 1MQTC 4XFIA 2R072 1RUH1 3R05A 1WUVA 2UU8A 1A8DA 1G6NA 2P3JA 5EYXA 3ENRA 1XNDA 1CAWB 2NLRA 4CEYA 3IM0A 4MGYE 4MXWB 4OI1A 4H14A 3MEPA 5CNAA 2PFWA 4PQ9A 3NKTA 5CFCB 2YYOA 1NXD1 2ZGQA 1DQ5A 4N7IA 3B9CA 1AYM1 2HWE1 3D8CA 2CYFA 1PK6C 2A7AA 3OYWA 5JOXA 3LA3A 2IXJA 4AGVA 4BE3A 1AR82 3FJSA 4CDQC 3A4UA 1ZBE3 2PLV2 1IS3A 1H0BA 4YM1A 3VZOA 3VBRB 1APNA 3KLSA 4SBVA 2C1FA 1D4M3 1AX0A 2DFBA 3VKNA 1W6NB 3AFKA 1AXYA 1G9BA 3MDPA 1O4TA 2E7TA 1RUD1 1O3QA 1BEV3 4C90A 1RVF1 1W2UA 3R4DB 4NN0A 3VN4A 3E5QA 1DBNA 4QHBA 2P3KA 4JAAA 4YM2A 3POYA 3WG3A 3FBYA 1MR5A 4XFBA 4IL7A 1V70A 4Y26A 3ECQA 1D4M2 3JQXA 1DZQA 4XJUA 3OGJA 4CDWA 1QF3A 3QCWA 4LA2A 1O3SA 4NHMA 4CEWB 5T5PA 1RUI3 4AVAA 1UL9A 2VNGA 2ZGPA 3MW2A 3OBTA 3VKOA 2MEV3 4QPIC 2DF7A 2JG9A 3KCXA 4P14A 3ZN6B 1POV0 2CY6A 4IQPA 4I0AA 5FTTC 1U5IA 3VKFC 3AKSA 1EPZA 5FOBB 1PGW1 5C33A 4XXAA 1HRI2 4OVEA 4AVBA 3RRDA 1RHI3 4FPHA 5FAXA 5BNNB 4XIOA 4SLIA 2IXCA 4IEPA 1CAXA 1QU0A 4WVMA 4NHKA 4KWJA 2R32A 4AK3A 5CAZA 1WMFA 3RDIA 5GZDA 4MXVA 1HQWA 1W0PA 5FQ0A 2H0BA 5JZGA 1LR5A 2YZ4A 1Q8VA 3I59B 3AYDA 1WLDA 5F6KA 4XMAA 5CB7A 2EAKA 2ETEA 4BWOA 2WNUA 1RHI2 4GB32 1UX6A 4CEWC 1TMF3 2WC2A 1RUD2 3EQEA 1U5YA 5EV7A 2JXAA 1MVEA 5FCCA 5C6CA 3C2UA 2QVSB 4HL0A 4FSJA 3URFA 4OLLA 1L3JA 2GDFA 2WFF3 4H3WA 3WUCA 4AQTA 1IQAA 2MHFA 1W6OA 4XTPA 4GB33 2GU9A 5KXDA 1MEC3 3HWJA 2ARBA 3KT4A 4Q4X3 1WW6A 5T5LA 3AZXA 3JU9A 1LOCA 4ES9A 4JDMA 3SNMA 2GALA 2Y0IA 3LKJA 5FMOS 1C8M3 4FTSA 4BHPA 4AHZA 1QQP3 2BW8A 4JRLA 2O1QA 3M3IA 4WZCA 4I3GA 1DYPA 2UY9A 5JWPA 3MLLA 1N1SA 5L73A 5JOYA 2GMPA 1O5LA 2GC2A 1OPMA 1LULA 2VXRA 4YZ2A 1S0CA 3KM5A 4GH4B 1GZCA 5CFCC 1ZBA1 1VBE2 5JZGC 3U4XA 2HWB1 2CGPA 3JBG1 4DS0A 2C9AA 4N9HA 4P9YA 1RC6A 1SLAA 3USUA 5SV5A 1U12A 2Y38A 5GZCA 4WM8A 1OFNA 5AC91 3VUOA 3WCSA 4XF0A 2MEV1 5D8AA 4U36A 1OFSA 2A70A 1LOEA 1VLNA 1CJPA 4E4ZA 4AHYA 1LGCA 1AYN1 1DG6A 4HKOA 4LBNA 3MICA 4AFMA 4Y20B 5GLVA 1YLLA 3WDVA 2HEWF 3LB9A 4XFAA 2R071 1FPN3 2X5IA 2OW4A 4JVAA 4COWA 1AJKA 1KD7A 2HWF2 4TLFA 4IEZA 3IWZA 3ZFEA 4M00A 4XOGA 4IXLA 4R8HA 4HANA 4IV1A 4LTAA 3A0KA 5A33A 3AKRA 2UWAA 4JGZC 2AUYA 1RUD3 2ERFA 4JC1A 3WDTA 4PLMA 5BUVA 1TQ5A 4FBFA 1WCKA 4B7KA 1ZBE2 4QQLA 1FMD2 1D2SA 4Y5Z0 3U0ZA 3RI8A 4Y1ZA 4QPIB 2LUWA 3OBRA 1F5FA 3N35A 2WZR1 3FX3A 1R093 3R4UA 3WQ0A 5I8TA 3AZZA 2CWSA 4XDQA 5DUUA 2Q1ZB 2ZMLA 2D98A 5K7PA 1A3KA 1VBC3 4Z8BA 2GC3A 4CP0A 1ASJ2 1V6NA 1V9U1 1QOSA 4LLFA 2R062 1H2MA 3KS7A 4CDUA 4TSVA 3IT8A 5CVRA 1HRI1 1ND3A 3TN91 1BVP1 2VUJA 1AX1A 3VBOC 4AEDB 2KA3A 3ZN4A 2A3YA 3M7AA 3S30A 3IDEA 3NV2A 1EP0A 3LA2A 4PIXA 1PNGA 4RFT0 1CONA 1UZYA 4K40A 1TE1B 3D6EA 3ZXEA 1Q8PA 2P37A 1ZRRA 2ZAAA 2V09A 1AX2A 3CLPA 3I4IA 1PVC3 3AMNA 2R063 5C9AB 4W65A 2JG8C 3U10A 1QJU3 3BCWA 5FPZA 2HWB3 5C8WA 4GXLA 1XNBA 1SBDA 4Z07A 3W59A 2ZGMA 2LM3A 5FLIA 5GALA 3ILRA 1NG0A 1Z7S2 1MZEA 1EY2A 3NJZA 3QOPA 1GQHA 1AJOA 2D93A 3FE5A 3THTA 1ZVFA 1IS5A 2ENRA 1ENQA 4RGGA 3VHNA 3E5UA 4ZKTB 2ZKNA 3KQRA 1J58A 3GF6A 1WGPA 3NAPC 3RMXA 3ATGA 1AXZA 2R042 4UBGA 1C3HA 1QHDA 3WDUA 2NZ9A 1C1FA 4YW2A 4NVPA 1V6LA 3BIWE 1MS4A 2I2SA 5C4WA 4HSLA 5T50A 3VBHA 4DPNA 1YYNA 1PGL1 5GLWA 3G6JB 4YG6A 2RE9A 3S6PA 3U07A 4N43B 1C28A 2GAUA 2V5YA 1HDKA 1OMIA 4RR3C 1JYIA 5CFDC 4Y20A 2PHFA 1BZWA 5GLZA 4QT6A 1NY71 3VBSA 4BMEA 4BIFA 5FO8B 3AZYA 2DYCA 1XXNA 2O8QA 4XBQA 1XNKA 4JGYC 4IERA 4Q4Y2 4HN0A 4R52A 3UL2A 2WSUA 1SLBA 5DZGA 4FT8A 2JDZA 4HPKA 1S2KA 2DURA 5A33B 5IT6A 4I01A 2ZMNA 3QD6A 4LBLA 1A8MA 3AKTA 3NW4A 1UF2C 3LSDA 3WINE 2NM1A 5J09A 2UYBA 3WDXA 3M2MA 1QNYA 1O3TA 1OA3A 1SLIA 1PGW2 3PMSA 4Q4X1 1F2NA 1ND2C 1GKBA 4UW3A 1M4WA 1LU1A 5FDBA 2ILMA 1LRHA 3GHMA 1WCDJ 4Q27A 4WM7A 2PLV1 1PVC1 1ZZ8A 5E16A 3O14A 4CEYB 5BNOA 4S2GA 2FQPA 3LAGA 5L36A 3CJIC 4M3CF 2BTVC 1JUHA 1PZ9A 4EN0A 3SISA 4OI2A 3D0JA 2YHJA 1AR91 5J37A 3NSTA 1PGSA 3DL3A 2XGXA 3AP9A 2VUAA 2WSVA 3AJZA 2VNOA 4NHLA 3AYAA 4COVA 1DQ6A 3LA7A 4L99A 1JXNA 3AYCA 1PVC2 5C4WC 1QY4A 2VMIA 4K6BA 4AQSA 1PHMA 4L97A 2ZX2A 2XLFA 4AGGA 5DDJ3 3ZXLA 3MLKA 2QDRA 2FBEA 2A5ZA 1R083 2A71A 2WA3A 1VALA 4YZ1A 3WG4A 3FLTA 3KZ4C 4XQ4A 5AFEA 4I0BA 4WZFA 5JOZA 5JSPA 1Y43B 1RUF2 2DCTA 2FHRA 1KDKA 3ZSJA 3V0AB 4UW5A 4FPJA 1GZ9A 5ACA1 4M01A 3WHUA 4YGBA 1QQP2 1LENA 1LU2A 3N7KA 2Z69A 4QM8A 5BPXA 1I1EA 1CJDA 4CDXB 3ILNA 1GNZA 2K0GA 3LCPA 2WNVC 1MACA 3OY8B 1ASJ3 5FBZA 2E7AA 1F8VA 1X8MA 3TOJA 1ONAA 2DU0A 2JE9A 4AVCA 1REFA 1VB2A 1OI6A 4AF9A 4Y1YA 2D3PA 5T55A 1DQ0A 2ZGTA 3AMHA 5JVVA 3RYPA 1UKGA 1WLCA 2Q0AA 2GC1A 2GNDA 1J1TA 1WW5A 2VNRA 4HVOA 4OUSA 3S7EA 3WVJA 4FXKB 1MS1A 1QH6A 4YGDA 1AL21 2I07B 5ABJA 1VAKA 3ZFGA 4CEYC 1FYUA 2JE7A 4FOYA 3HR9A 4NPRA 2LALA 4XBNA 4JDNA 2XB6C 4YNIA 4UBHA 5A3MA 2XLAA 1CAUB 3IDBB 3CL1A 4J6GA 3H8UA 5HXVA 1YJLA 1LCLA 2O8OA 1YFYA 3SCFA 2D6LX 3MW4A 3PVNA 4LNVA 1PZ7A 4EV0A 5K0UA 1O4YA 1LEDA 4P9XA 4FO9A 4AFCA 4XF4A 5D8AB 3M3QA 1PIV2 3MPBA 2YGMA 2WJSA 2WLPA 2DTWA 3VBRC 4LBMA 1TMF2 2BQPA 4YLZA 2RR13 2ZX0A 3M1HA 4B4QA 3ROUA 1ZZCA 2FMDA 3LWCA 3AX4A 4K3UA 1D0GA 2VVFA 2A3XA 1S2BA 2QQPA 2ZHMA 3MI8A 4LR4A 2D43A 4KU7A 3O5SA 1Z0HA 4IV3B 3WW2A 4X6RB 2F4PA 2AR6A 5J7MA 2HJIA 4IEXA 4K9SA 1S0JA 1PVXA 3JD71 2IFRA 4IV1C 3BALA 1NA1C 2BYVE 5K9YA 1QJU1 1A6CA 3AYEA 4Q1PA 1NZCA 2CTVA 1G8WA 3ZSLA 1AYM3 1LESA 4YG0A 4Z82A 1WBFA 1CPNA 2QJVA 4PDWA 3CJIA 2Q5TA 1AR63 3S7IA 4A7YA 1NCQB 1RUJ2 1TME3 2DVFA 1FOD2 4D7SA 5JI9A 2TUNA 4YGEA 4KG8A 2JD4A 4AVTA 3HT2A 5GKAC 3VBSB 4LLOA 1PMIA 4TYSA 4ATEA 2VH9A 2RM21 4MLOA 1RUJ3 1TME2 3WG1A 5ACA2 1RB8G 2A6VA 5H9PA 4Q4X2 4J1WA 1U5XA 1KS5A 2MEV2 1NYWA 4GMP1 5AC92 4S2HA 4YVWB 4R9CA 4EWEA 4BLIA 4M3CB 5I0SA 2WQ4A 3ZFEB 4YSFA 2Y0OA 2AYHA 1JBCA 2YGLA 1ZZBA 2E51A 4L8QA 1OQ1A 5I91A 1QMJA 2VQAA 4MZUA 4FQ4A 1V6KA 2BNOA 1POV1 3BOPA 1GQGA 1OKQA 4J1XA 5EZWA 4QQHA 2WNUC 1VB4A 2RS51 2VW1A 3H9AA 4OI4A 4A2UA 2QNKA 3EJKA 3NV3A 2D40A 1QOTA 4YVSA 2ZGKA 4BOWA 5B2GB 1FMD3 2XL9A 4XQDA 2RS52 2VVEA 2ZCWA 1LOFC 2R16A 1RHI1 4IV1B 5GJ6A 2BWAA 2CV6A 4PCRA 1Q43A 2D6MA 4N53C 1UU6A 2PHRA 1S0EA 1PM7A 4RS5C 4LBKA 1DFQA 1HRV1 4C0HA 3DPRA 2D6NA 4TZDA 2HWC2 4GMP0 2RM23 3CF6E 3B93A 3AP6A 4M3CE 4QQ2A 5DDJ1 3P3PA 3WG2A 3B3QE 2BNNA 2EIGA 4TWTA 1IPJA 1V9U2 4IETA 4W6WA 1O4ZA 1UU5A 3R6SA 4E9KA 4LO8A 3VBUB 5BNOC 2LTNA 1Q3EA 4XFHA 4AEKA 4LO6B 3KCCA 3VBFB 3HT1A 1AR61 1DGLA 3FUOA 1V6MA 4Q4V2 1IOAA 1ZRCA 2G9FA 2JG9C 1N3PA 1LHOA 4ZU4A 1S0DA 4O9EA 2PAKA 1LOBA 2WINB 2PHXA 2QDNA 1PO23 3LOBA 3AJYA 1CPMA 4HZFA 2PYTA 3ZN6A 3PVEA 3MIEA 2ARXA 1VRH2 4DNYA 1XU2A 2RJLA 3IIAA 4R4XA 4A7KA 3M3CA 4IV3C 1V6OA 2RS32 1CAWA 1IKPA 4FPOB 3VHPA 4HKWA 4I30A 2PHWA 4CDUC 4H55A 1SLCA 1W6NA 4JCKA 3ST7A 1DYKA 1U0AA 2R061 2DCKA 4BLJA 1C57A 5AVAA 2B5HA 2HWD1 5ABJB 1G9FA 3LSEA 2D7FA 1W6PA 1ENRA 3JB8A 1ZRFA 3JBG3 2R041 2BNMA 5EYYA 1WW7A 2ZPXA 1QH7A 3OTFA 1WLTA 3DN7A 1RUE3 1ULCA 1Y9QA 2VMGA 1A78A 4G3YC 1T6GC 5T52A 1YI7A 2GN3A 4P9GA 3PJYA 4JQRA 1YFXA 5C9AC 5KXCA 1AR81 4JTOA 3D5OA 3ZMOA 4CZSA 3ZXKA 2XVLA 2B7YA 3SXWA 4ES8A 1FPN1 3RS6A 2QUOA 2CL2A 1MQTA 3C3VA 1VRH1 2AH2A 4XQWA 3TRSB 4N43A 1W0OA 1TNRA 2YROA 4Y1UA 2DVDA 1OD5A 1CESA 5GLTA 2HWE2 1FPN2 3N36A 1DQ4A 4P9JA 1XRUA 1DGWA 4FCAA 2HWB2 4IESA 3GZAA 4G4FA 1YCIA 2RS12 3RI9A 5D8AC 1HXS1 4YZ4A 4HBNA 2F6BA 2CGNA 2BEOA 1FOD3 5GZFA 2WZPP 4AQ2A 2VULA 3CNAA 2XUMA 5CADA 2EAAA 4AG4A 4KBBA 4OHYA 4LHNA 1NCRB 4P9LA 1SFYA 3ZPYA 3NAPB 4C0BA 1PO21 1LTEA 4AGRA 5T54A 1URXA 4XPVA 1UD1A 3X29B 1D0HA 1YIFA 1BVVA 1MVQA 1AF9A 4OZXA 5KHJA 5JSOA 2H0VA 1R1A3 4DB5A 4ORFA 1CGPA 3GBFA 4WM7B 2E7QA 2ZJCA 5FO9B 4AHXA 4L11A 4F7ZA 1C8M2 4AVVA 4B8EA 2YMZA 3VHRA 4AEJA 1WMDA 4K20A 5DXDA 5HBAA 4Q4Y3 3S0MA 5FFOC 4ASMB 3WQ7A 4YFZA 2ZS6B 1X7NA 1RMU1 1J59A 4QPGA 2D5FA 4CDWB 1AYN2 1R1A2 2WT0A 4BIOA 1RUNA 1VBB1 4EJRA 5KHGA 3V0BA 5KC5A 4GALA 4XYXA 1AR83 1S55A 3ZXFA 2XPJA 2HYKA 3O7OA 4HSJA 1S0BA 3TAYA 5HCAA 1M06G 1BBT2 3VBOB 5BXXA 2JKBA 4AEDC 4Q0PA 4OUMA 1YWKA 2PTMA 1DHKB 2VW0A 1COV2 1TEIA 3AMPA 5EFUA 4JRAA 3AMQA 1R1ZA 4OHZA 4CDUB 1MS0A 1RL3A 5JI7A 1SCRA 2Z5WA 1YJKA 3APBA 2HKXA 3B94A 1ZBE1 1ULEA 4N53A 3HN1A 5GLUA 3ZFGB 2OZJA 1RUC3 4IEUA 1IS6A 3AP4A 3PTYA 5EJ3A 5BNPB 3VLBB 2TBVA 4S2FA 3FLPA 4AWDA 3H1WA 4CP2A 1HQNA 4ITCA 1S0FA 2QKDA 4D7YA 1EV12 1RMU2 1EAH1 5FMOL 2VECA 3WX5A 2EA7A 3MF6A 4LUKA 1IKQA 3VBRA 4N7UA 4DRRA 3AKQA 1W6MA 3DV8A 2XH6A 4LEJA 5F6LB 3MIDA 3RQ0A 4WVZA 1MS5A 5JR7B 4QQPA 2R0FA 2MPFA 1H2NA 2WQZC 2P2KA 3AZWA 1G7YA 2ZGOA 1PZ8A 4NWWA 3EXUA 4Q29A 1UKRA 1WA4A 5KXBA 2IFWA 4F3JA 2KXLA 1LHUA 1J3QA 4GWNA 3EBRA 1OOPB 3PJQA 3T1LA 3MGUA 1PO13 4URTA 3WLUA 2Q4SA 1VBD2 2PAMA 2A6ZA 1BQPA 3WUDA 1C5IA 1VBC1 4FPCA 1WBLA 1JW6A 4WVVA 3WY6A 2Q8OA 2RJKA 3JD73 5HCFA 3FBMA 4X8PA 1GLHA 1U5ZA 2PHUA 3UJOA 1N1VA 2VW2A 1SBEA 2GH8A 4L92A 2G9GA 4LE4A 3WOGA 1XYPA 4Q4W3 3D82A 3PLQA 5C8CC 4DY5A 3G7DA 1REEA 4B7EA 4HVQA 1VJ2A 4IEVA 2HWD2 2EALA 4DINB 2Q30A 5JIAA 4XJAA 2DUPA 4IEQA 2XJVA 4KGGA 3VL8A 4YVSB 3ZXGA 1H2LA 4I3PA 2UY8A 2YC0A 2CWMA 4Y22B 4PBOA 3ZYGA 1NLRA 1ASJ1 4Z92B 5T3NA 2D6KA 3SH3A 2UURA 3WXPA 3H3ZA 1UAIA 1QJX1 5JZGB 4GKXA 4P5HA 4V1PA 1PO12 4MX3A 2RM22 2ZABA 2WFF1 5KXEA 2FZ2A 2PELA 1QJY1 1ENXA 4GB31 1UIKA 2OVUA 3VL9A 2TEPA 2BFUL 3DUIA 5JIUA 1JYCA 2W08A 3CJIB 2XVKA 2IXKA 2R043 4JV4A 2C0ZA 3WCRA 3EHKA 4E2GA 4QPYA 1PIV3 1UMZA 5DZFA 3VDDB 2WS92 1I6XA 1JH5A 4CDWC 1ZREA 4LO7A 3K51A 1ULDA 3BTAA 3B69A 1RUF1 1KFUL 1KJLA 3USSA 1UW8A 4AYUA 4I2OA 4EN8B 3B9IA 1D2QA 3M8LA 1BEV2 1C1LA 1RGSA 4YG3A 1FXZA 3V0AA 2ZX1A 1YXWA 2ZOEB 4JTNA 4XMIA 3RYKA 3QH7A 4UW4A 3H1MA 2WFF2 2HEVF 3ZFGC 1GZWB 3HMYA 4OHWA 1OPOA 1YO8A 4YARA 4Q4V1 1AYN3 4QQOA 1AR92 2QFEA 1H4GA 5H9SA 4LULA 1BEV1 2XHKA 4D7TA 1OLRA 1RUE2 1RUI2 1YI9A 4BZ4A 1O3RA 1EV13 3WZ1A 5LRSA 4R9DA 3UKVA 4PIZA 3WDYA 1RUC1 3JZVA 3M3EA 3NL1A 1MZ5A 5GZGA 1ZM1A 3ZFFA 2VOXA 4AXOA 1RUG1 3IBMA 3OYWB 3IPVA 2PAEA 3DKWA 4DOUA 3VBSC 1ZZ7A 1EAH3 1J3RA 4PF5A 4QMAA 4ASLA 3CEWA 2AENA 3VV1A 1DQ2A 2VGDA 2Z79A 3MFAA 1N3OA 5JCTA 1IGOA 1DGRN 2E6VA 4IEYA 4QX5A 4XJ9A