4LA3A

Crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
TLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELALTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethylsulphoniopropionate (DMSP) lyase DddQ
publication title Molecular insight into bacterial cleavage of oceanic dimethylsulfoniopropionate into dimethyl sulfide
pubmed doi rcsb
source organism Silicibacter lacuscaerulensis
molecule tags Lyase
total genus 54
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4la3A00
1DZRA 2PA7A 4HSLA 4MZUA 3SCGA 2H6BA 4N9IA 1RUNA 3EHKA 5I93A 4XFFA 4HZFA 4HMZA 4XF1A 2D93A 2VQAA 4EWEA 1X8EA 2V09A 1ZRFA 2PAKA 1SEFA 3RYRA 5E1RA 2GZWA 4JVAA 2D5FA 5FPZA 4FAHA 4ONUA 3USSA 2IXCA 2CAVA 1WGPA 4GULA 4MV2A 4P9GA 4RD7A 1TQ5A 4ZU5A 4L11A 5C6CA 2GC2A 1ZX5A 2VECA 2EA7A 3LA7A 3H1MA 4ORFA 3R6SA 4XF0A 3EBRA 4IEUA 1J3QA 2CGPA 1WA4A 2HKXA 3E5UA 4OLLA 3NSTA 3OCPA 3RDIA 5I91A 5J3UA 3ST7A 4F7ZA 4O9EA 4BHPA 2UYBA 3OF1A 1RC6A 1CAVB 3RPQA 4MH0E 1LB2A 3QOPA 1CAWB 4QGMA 2EAAA 2K9ZA 1I5ZA 4HBNA 2BEOA 1Y3TA 1EP0A 3RYKA 5FLJA 1YHFA 3D0SA 3D82A 4LUKA 4XFAA 3G7DA 3LWCA 5JAXA 4QGNA 1J1LA 3BALA 3ES1A 4H7LA 3H8UA 3LAGA 3FFQA 1QXRA 1Q3EA 4KU8A 4PIXA 1HW5A 4FT8A 1CGPA 1SQ4A 1FI2A 3CJXA 4E2QA 1ZZ7A 3L2HA 3SCHA 3SXWA 2BNOA 4D7SA 5FQ0A 4IEVA 1X7NA 3GBFA 5BV6A 1CX4A 2Y0OA 4XFHA 4DINB 3DV8A 4N9HA 5I8TA 1ZZ6A 3WW3A 3ES4A 5I0RA 1QY4A 4EV0A 5D1IA 3CLPA 1J3RA 4JV4A 4HN0A 3I59A 1O4TA 3LOIA 5AVPA 4YSFA 1X8MA 3DKWA 4JTNA 5LEKA 1V70A 4J1WA 2O1QA 2ZKLA 4Q0UA 4F8AA 5I0UA 2F4PA 2BNMA 3ROUA 1OI6A 1JUHA 3M3IA 3NVCA 3NJZA 3D0JA 4LTAA 2OYZA 2IXKA 3OGJA 5CU1A 4I2OA 4PJYA 1H1IA 3E6DA 2GU9A 2Q30A 4UBHA 4LUMA 2IXIA 5FCCA 4QM9A 3CO2A 3FX3A 4R52A 5BY5A 1RUOA 1CAXA 5FDBA 4HVQA 2BNNA 1RL3A 4QMAA 1O3QA 5CADA 4IEYA 2Q1ZB 2N7GA 2O8QA 3WW2A 2IXJA 2GC0A 3BB6A 4YARA 3IIAA 2GC1A 1YLLA 1RGSA 2H0VA 4I01A 1YUDA 2OPKA 4QM8A 4I0AA 2MHFA 3JZVA 2GAUA 2FQPA 4X6RB 1UD1A 4QGLA 4B29A 3SMHA 4XF9A 1ZREA 3IDCB 2HJIA 4LULA 4AVAA 2XL7A 2C0ZA 1I6XA 4AVBA 5J7MA 3I7DA 1QXJA 4XFGA 3B02A 4KWJA 3FJSA 4MGYE 4META 1DGWA 4KL1A 3ELNA 4O9GA 1ZZCA 4IETA 4OFGA 3UKVA 4I0BA 2XLFA 3ZDSA 3RYPA 1ZZ8A 3ACLA 2QJVA 5JSOA 1O3RA 4EWDA 3KMHA 1EYBA 3TNQA 1UPIA 4D7TA 4ZU7A 4MGKE 1YWKA 5LRRA 1OMIA 2ATFA 1QWRA 5KHHA 5FLIA 5FQ0B 4LEJA 3HT1A 2OZ6A 4WBBA 4I02A 3KGLA 5I0SA 2UYAA 5JCTA 1ZZ9A 3FE5A 3UKTA 1Q43A 4WZCA 3KGZA 5LRSA 3OTFA 4Z82A 1J3PA 5FPXA 5LEJA 3RZZA 2MPFA 3UKNA 4E2GA 3M70A 4IEOA 1UIKA 2PYTA 2Z2SB 4L2NA 2XLAA 1OD5A 2I45A 1VR3A 1O5LA 3QACA 2XHKA 4X6QB 2IXLA 4MGZE 4XF4A 1OFNA 3LZZA 2ETEA 2Q4SA 4HSJA 3SHRA 5F1RA 4Q0VA 1H1MA 5BXXA 5FLHA 4Q0QA 1Q5OA 3BU7A 1EY2A 1FXZA 2IXHA 5T3NA 2XLGA 3E6BA 2DCTA 1CAXB 1ZZBA 3MPBA 3S7IA 2PFWA 4Q29A 1LKNA 1NZCA 1PM7A 3WW1A 3CL1A 2CAUA 1J58A 1GQGA 3CF6E 1ZRRA 3H3UA 5E16A 5EZWA 3NKTA 2MNGA 2PTMA 3H1YA 1UIJA 2XKPA 3EQEA 4IEWA 4AXOA 4LLOA 1CAUA 1NXMA 3FZ3A 4YNIA 3KSCA 2QCSB 4IEPA 4UXAA 5KBFA 2H6CA 4AQ6A 5HI0A 1YFWA 3U0ZA 2ET1A 5C8WA 3H1WA 4XEZA 1L3JA 3N4MA 3FHIB 1YFUA 1G6NA 4BYYA 1NE6A 4XF3A 2QDRA 3E97A 3H9AA 1GQHA 3LA2A 4EROA 4XFCA 4PIZA 2OZJA 3U11A 2Z69A 1VJ2A 3H7JA 2EVXA 1O5UA 2XGXA 1IPKA 2FMYA 2PAMA 4JTOA 2CV6A 4FAGA 5KHKA 2BYVE 3TNPB 2E9QA 1EPZA 1RTVA 3S0MA 3OD0A 4LA3A 1UCXA 3NW4A 5JR7B 1NYWA 2OA2A 4MUVA 1XE8A 1ZVFA 2GH2A 4BIFA 2WFPA 2QVSB 3MDPA 3HT2A 3H3ZA 2PHLA 4ZU4A 1VP6A 2UY9A 3MZHA 4KWKA 2K0GA 3IBMA 3O14A 4HVRA 5JSPA 4TLFA 3E5QA 4XFIA 4XFBA 1ZRDA 3FWEA 4R8HA 3BPZA 3E6CC 2PHDA 2ET7A 3U10A 2QNKA 3BCWA 3H50A 4QX5A 2GC3A 1YFYA 3C3VA 3I59B 4AVCA 5I8SA 4IEZA 4YYOA 2VPVA 1DGRA 1NE4A 4HLTA 4E2SA 4YRDA 3IWZA 3SCFA 1PMIA 5BUVA 4K8FA 1O3SA 1Y9QA 1ZNPA 4J1XA 3MYXA 4NVPA 2Q0AA 4QXKA 1CAVA 2PAEA 3HQXA 1CAWA 1ZRCA 1WLTA 4KWLA 3HIFA 4IEQA 2UY8A 5KHIA 2B9UA 3DL3A 5K8SA 3KCCA 4CYDA 1DZTA 2PQQA 4UBGA 3NL1A 3PNAA 4XETA 2BGCA 2B8MA 1SFNA 1CAUB 5J48A 5KHJA 3S7EA 1XE7A 4IERA 3CEWA 4Q0PA 5CVRA 4FBFA 1XRUA 5KHGA 1U12A 1X82A 5I0TA 3EO6A 3DN7A 3GYDA 4BH9A 1J59A 4MGIE 4I3PA 3ETQA 3LA3A 2IC1A 3VHRA 4Z07A 4LA2A 4AQ2A 3I54A 1O7FA 4IEXA 4HN1A 5I8YA 1FT9A 3PVBB 2D40A 3EJKA 2D5HA 1YFXA 2WC2A 3E5XA 3H7YA 3IDBB 4IESA 2XKOA 4HVOA 4A2UA 2KXLA 1LR5A 1UW8A 4EWAA 5JSRA 2XL9A 3WW4A 4MX3A 4PIYA 4Q0SA 4KU7A 3RNSA 1O3TA 5EFUA 2P17A 5BPXA 1LRHA 4I09A 1IPJA 2ZCWA 3PLQA 2B5HA 4WVZA
chains in the Genus database with same CATH superfamily
5F8PA 4D8MA 2PA7A 1SFYA 4QU1A 3HBKA 3VKOA 2RDNA 2G1MA 4LHKA 4N9IA 3EHKA 1KRIA 5F3GA 5C3SA 5C9AC 4XF1A 1GP5A 4JGYC 5F37A 3ZR5A 3RGBA 4XQ4A 5C8CA 4CDWB 1D2SA 4OUMA 2WNUC 1PIV1 1PGL1 1AXZA 3OGSA 4JKMA 2VW1A 4Q4V3 4YVSC 4C1XA 4B4QA 2GZWA 4NPLA 5A3PA 1F9KA 4QKFA 4MVTA 1QQP3 1W6QA 2D6OX 4KI5M 4MOAA 4FTBA 2V5YA 4GMP1 4XHXA 5GLWA 5FPZA 1WLDA 1CJDA 2BZDA 1UYXA 1QH6A 4HKOA 1GWLA 3AJZA 2VY0A 4DXZA 3VBFB 1WGPA 4P9GA 2RS51 3AP7A 5CFCC 1NZIA 5DDJ3 2BV4A 4PCRA 5FYVA 1W6NA 1R083 4IE0A 1F2NA 2TEPA 3EBRA 4XF0A 3R6SA 3CJIA 4JDNA 1T6BX 1G9BA 1GP6A 1UU6A 1YXWA 3VZOA 3BTZA 4QDRA 5HPOA 4YW5A 3AP5A 3NSTA 5DZEA 3KLSA 3OGGA 4DPNA 2WFF2 1HXS3 4WV8A 4QPWA 4RA0A 4BDVB 5JOYA 1CJPA 4F3JA 5L9BA 4TYSA 2XJTA 1Z78A 4XBNA 3MFCA 3RPQA 1LB2A 2WAAA 2ADEA 4CP1A 2VCAA 3FLRA 3QOPA 4N53B 4QKNA 5FZ6A 4AG4A 4AI1A 4HPKA 3WHUA 5FXXA 2R072 4AVVA 4HBNA 4LBQD 3VKLA 4O61A 1Y3TA 5D8AB 4JDMA 2WFF1 4QDQA 5F5IA 1TME1 3Q8FA 1W28A 3RQ0A 2GP3A 1X9PA 3RYKA 3ZXGA 5FLJA 1DGLA 2XR4A 3D0SA 5A70A 1CN1A 5IW0A 4BQ5A 5KXCA 1ALYA 3DPRA 3VZNA 4AW7A 2R071 1KD7A 2VMFA 4D6SA 3AZWA 5IUQA 3H42B 2ID4A 3UJOA 4LQRA 1XE0A 1J1LA 2CNAA 3QCWA 3TRSB 4FP3A 3MV11 4H7LA 5F3IA 3LAGA 3AMMA 4CEYC 1JYXA 3FFQA 5DQ0A 1MVQA 3R0RA 1Q3EA 2J1TA 1LGBA 4LBMA 5L9RA 4CDXA 2IWGB 3O12A 4NHXA 1U0AA 2X10A 4ARYA 2ARXA 4BXFA 4LKEA 3CIHA 3CU7A 3JUUA 3GBFA 3A0NA 4J25A 2Q8CA 2PELA 2C1FA 3DV8A 1F8VA 3A0KA 3ES4A 3GHMA 1RHI2 1UO9A 4FI9A 1J3RA 2ZAAA 3P3NA 4LOSA 1UXZA 3SEEA 3AVRA 1UKRA 3MICA 4XUOA 2WO2A 2BWCA 2JD4A 5FAXA 1L7LA 1W9YA 4NN0A 3PTYA 3GF6A 4B7KA 3HNMA 3WG1A 5C8CC 2VNRA 4XBLA 5TSWA 1RHI1 3VBOC 4LO7A 5F2SA 1AR73 2VZTA 1V70A 1GP4A 2RG4A 4YM0A 4TZDA 3ZFGB 2UURA 2FDKA 3B3QE 3OBZA 2O1QA 2Q5TA 5FPUA 4I30A 3JB8A 5HV0A 4Q0UA 4F8AA 1RUF3 2BNMA 1OI6A 4QAWA 2DWRA 2XWJB 3ZIWA 2ZGUA 3M3IA 2BGPA 1OBNA 3NJZA 2GH8A 2R1DA 2RMU2 1UZVA 3D0JA 5K0UA 2W08A 2ZPXA 3ZFEB 3B7MA 4CU9A 2GNDA 3WNNA 3IAQA 4XVHA 1ENXA 3ATGA 5CKNA 1YRZA 1QU0A 4PJYA 2QQVA 3FHQA 5FREA 2DVDA 1SLIA 3TEXA 2GU9A 3ZMOA 5FCCA 2EXIA 1ULFA 4M00A 4A42A 2RR12 1JZ8A 3ZYBA 3ZYJB 1GU3A 1ONAA 2BVVA 2QZ3A 3FX3A 2E7QA 3MUY1 4R9BA 4R52A 1PK6B 3JBG2 2ARAA 1NLSA 2RMU1 3W21A 1RUC1 3GZAA 3VKNA 1RUOA 2HWC1 4MXWB 4HVQA 1VB4A 4QMAA 4ZZ8A 5IYYA 3WOGA 2N7GA 3VB9A 2O8QA 2E51A 1UWWA 2ZX2A 4XJWA 2OKXA 4FFGA 5A3LA 1ULDA 1MR5A 2RR11 4AQTA 3FLTA 3BYWA 3KT7A 3VDAA 3PIGA 3JBG1 2PHXA 2PLV2 3C8XA 1LESA 1UZYA 4FXGB 3JZVA 1WMEA 3NNGA 4WM8A 2GAUA 5FZ7A 2FQPA 1RINA 3KS7A 4CZSA 5F5QA 4BISA 1LHNA 3K51A 4RYDA 4RFT0 4OHYA 4YVWB 3VBSA 3PDQA 5FY0A 4B29A 1KDKA 2JDZA 2VZUA 1DU3D 3FL7A 2HJIA 3IDCB 2Y38A 4N43B 1KS5A 3ZSLA 3CZJA 2PLV1 3INAA 2Z79A 3I2DA 3I4IA 4DEQA 2PN5A 2WO3A 3MW2A 4XFGA 3P1IA 4CP2A 3HOBA 4KWJA 1PX3A 1RMU3 2WZR2 2NQYA 2VZSA 4KBZA 3FJSA 3C7EA 3T09A 3PJQA 3ENRA 3T2QA 4PQQA 2G4IA 4YM2A 4DMIA 3Q8AA 5DAPA 1ZZCA 4IETA 1WWYA 1UY1A 5DAWA 1GOFA 4FO9A 3BTYA 4AEJA 2XJQA 1COV3 3Q9OA 5KXBA 4GWMA 2BERA 3MIFA 2VVFA 4GA9A 2JDAA 1JS9A 1C3HA 2WZR1 1MVEA 5GZEA 1US2A 3RYPA 2ARCA 3SKJE 3UETA 3TEZA 2WNVA 3PU8A 1WLCA 3T4VA 5JSOA 2F6BA 1CZSA 2XBO1 1B35A 1H8TA 2QTWB 2VZVA 3ZM8A 4C1WA 4D7TA 5LRRA 5A6XA 5L9VA 2ZMKA 2VBDA 1Y4WA 2RS33 2JG9B 5KHHA 3SITA 4A7KA 4S2FA 1MZFA 1DQ6A 2C4XA 3KVBA 4LEJA 4RGGA 5FLIA 1PGW2 3HT1A 1I5PA 3T3YA 3FLPA 1LAJA 1VPHA 3KGLA 1WD3A 2UYAA 2ERFA 2VUCA 1PO12 1W6MB 3C7OA 3LSEA 4OI4A 3NAPC 1VRH1 3T2PA 3UKTA 3AXDA 4WZCA 2WQZC 5CYYA 4BQXA 5DMYA 1J3PA 1YO8A 3ACIA 5FYCA 2GALA 4V2VA 1XNDA 4XIKA 3F95A 5FPXA 1NT0A 1A3KA 4IDZA 3IMNA 5A3OA 2DUQA 3FN9A 4IGPA 1PHMA 3M70A 4PLNA 5FWEA 1A34A 2ZGSA 4QQLA 4U36A 1T6GC 1X9TA 2BOIA 2WNOA 2XLAA 3DGTA 2B45X 1OD5A 2I45A 2VUJA 4DY5A 1WBLA 2WO7A 4GXLA 4CU6A 1S1AA 3UJQA 2W39A 1X33A 2QQUA 4CXWA 2J1UA 5JWPA 3LFMA 3A21A 3J8F2 2VG9A 1EV13 2NZ9A 1PVXA 1DQ2A 4V1PA 2WYSA 1GQPA 3JQXA 5L7OB 2FMDA 1NCQC 3KQRA 2R0FA 5FZGA 3GGLA 3JCIA 1JXNA 4PHZA 5CIRA 4FPHA 4KH9A 4Q0QA 1Q5OA 3J8F1 5LA9A 4FSJA 3JU9A 4P02B 5IK7A 3ZXDA 1I3HA 1PVC3 2DCTA 3OBAA 1PM4A 3VKFC 2YC0A 3N9LA 1FV3A 5BNOA 3O0WA 1MS3A 1REFA 1HB4A 1KJRA 1PM7A 1DGWX 2JB8A 3M3QA 3LDRA 1GQGA 1QHDA 2DDUA 3CF6E 2B7YA 5E16A 3ZPOA 4BOWA 5C33A 5EZWA 3V0BB 1UNBA 5EWSA 3WSOA 1TMF2 1UIJA 2EF6A 4YW3A 4LXLA 4QX3A 3WF1A 5IK5A 5CNAA 4C91A 1QJY3 1CAUA 2W9XA 4A7YA 2HWE2 3FZ3A 3IPVA 1O4ZA 2JX9A 1RUH2 2XJSA 3THDA 1JZ3A 5A7QA 1IG0A 1UYPA 4UXAA 5KBFA 2CGOA 1KXGA 3K48A 1PZ7A 1TMF1 4GH4B 5G05L 5ACA3 3U0ZA 3UESA 2VZ1A 4P9YA 3WDUA 4HG6B 2R30A 2HWE1 4QDSA 3JQWA 4IV1A 1RUH1 2WZEA 1VE0A 3GHNA 3ZMNA 5I0DA 1ZRIA 2ZJCA 4XF3A 2I2SA 2VE1A 3AX4A 4HK9A 4IE5A 2VW2A 4V2WA 2Y6GA 3ZSJA 4EROA 4CU8A 4XFCA 4BXSV 3B5LB 1AF9A 2ZHNA 3U11A 5IATA 1NCRB 1VJ2A 2Y60A 3N35A 3OYWA 4XJAA 5ANQA 2EVXA 2UWAA 1IPKA 2WIIB 2FMYA 1IZ3A 2PAMA 2VJXA 4S2HA 5A1FA 5E6HA 4DRVA 5H9SA 1JW6A 5KR7A 1EPWA 2CV6A 1O8SA 3L2YA 1GNYA 4RFRB 2QQMA 2HEWF 1RTVA 5J36A 2JWPA 4YW2A 3L9JT 1UCXA 2VMGA 5BYNA 1X50A 4Q2FA 2OA2A 1QNYA 4MUVA 4Q4X2 4AE2A 1XE8A 3H8RA 1LOCA 4GALA 2RJ2A 4K7JA 4Y20A 3OY8B 4UF0B 3ZFFA 3MDPA 1SG3A 3H3ZA 1BBT2 1AYN1 1V6LA 4ZU4A 4IE7A 2P3JA 3ZN4A 1FPN3 1QGLA 3MIEA 2QZ2A 2UY9A 1V6MA 4KWKA 1EAH1 1HRV2 3IDEA 2ZABA 1W9SA 3IBMA 4Q4X1 1RUD3 3HNYM 2EICA 3VHPA 4QPGB 4XZUG 2W1SA 4XABA 3N3HA 4XE9A 4LBOA 1BBT1 4FPJA 1RUG3 2UWCA 1HKDA 5ABJA 3AL5A 4YGDA 1QJU3 3AKSA 3HMYA 3WT3A 3BODA 5JMOA 1HRV1 3VBHA 2OUJA 1JU3A 1H30A 2G9FA 1ZBE2 3WNLA 3GNEA 1YFYA 3C3VA 1DQ1A 4NE9A 5I8SA 4IEZA 3RMXA 4WM7C 3M3OA 3NWKA 2EXJA 1R092 2WWSA 1UAIA 3CZUA 3POIA 4YM1A 3WDWA 4MGTA 1S0FA 4E2SA 1BK0A 4KMQA 4LIVA 3BTXA 4FPCA 1WA6X 2HWF1 1O3SA 5AC91 3I8TA 5HV4A 1UOGA 3DYMA 1VBC3 1ZBE1 2VTXJ 1W0NA 4HKWA 3MYXA 3WQBA 3U4XA 5LWBA 4NVPA 5F5AA 1ZM1A 4RR3A 4A45A 2WWJA 1R091 2Z4FA 1RUE3 1OLMA 2MEV2 2X8KA 2QFEA 3ON7A 3HIFA 1QNWA 1ZYBA 1IS6A 2BFUL 2UY8A 4BCUA 2B9UA 3DL3A 3R4SA 1APNA 1GZWB 3VBRB 1WW6A 5L7OC 1FAYA 3VD4A 4K3UA 4RHV2 1IGOA 4XOGA 4U2AA 1MZ6A 2MEV1 4Y1ZA 5CBLA 3O1RA 1AR82 1D0GA 4IERA 2W1QA 2GMMA 3KD4A 1FOD3 2VOVA 1SFPA 1XRUA 1UPSA 5DUWA 3ZKUA 4WVMA 5BNNA 5HBAA 5KHGA 1OFSA 5I0TA 1SDDB 1NOVA 3GYDA 4LE4A 4BH9A 1J59A 1V9U2 4P9LA 4XDOA 1AR93 4MGIE 4I3PA 1W6PB 1AR81 4Y3OA 3ZXAC 5E8AA 3ETQA 4ZHNA 1VB2A 2YPDA 4MLOA 1GSLA 3G6JB 2IC1A 3VHRA 3DCQA 2FZ1A 1LULA 3KT4A 4C0BA 2Q8DA 3KF3A 3I54A 1Y7BA 3ZXJA 3A4UA 4CRQA 2TBVA 3PVBB 4RS5A 3ZXFA 5G04L 5J98B 2DYCA 2ZGRA 3H7YA 4G3YC 4JRAA 2ADDA 1RITA 4JHZA 5D2AA 1LR5A 4WVVA 1UW8A 3PHMA 3MIBA 3APBA 1W2NA 2XL9A 2OQ6A 1PNFA 1YIPA 2QUOA 5LA0A 4KU7A 4NAMA 2RDRA 2X5IA 1POQA 4QB6A 1WBFA 1GZ9A 4AL9A 3KHBA 4I09A 1LOBA 3N9NA 3RWNA 3D6EA 1QDOA 4BQ1A 3UGGA 4TXWA 1DZRA 1PO23 5HCBA 3SCGA 5FZ1A 1RUNA 4YG0A 2J7MA 4OMDA 2ZX1A 3AVSA 3B69A 4HZFA 3MI8A 2VQAA 5FUIA 1X8EA 2NMOA 4XMIA 2JENA 2W5FA 5JZGB 3MW4A 2HWB2 3LKJA 4W6WA 2V73A 2ZGLA 4NRPA 4AEDB 2Y8KA 1N3OA 3HQRA 4FOWA 2ZA9A 2GP5A 1OKQA 4LR4A 2XB6C 3K46A 3ASIA 3ZDVA 4XTMA 2PHUA 3OBTA 3WQ7A 2FCVA 4NO4A 4UW3A 3WEZA 1CWPA 2ZHKA 2BW8A 3GBWA 4HL0A 2RHPA 1CZVA 4ONUA 1OQDA 2YG0A 3UNPA 2IXCA 4XDQA 4ZU5A 4CE8A 1TQ5A 1UY0A 2LALA 4RQPB 4B4RA 1OF3A 3W5NA 1SLBA 2ZBJA 2EA7A 3LA7A 2KD7A 1PMJX 3LQCA 2EAKA 4IEUA 3U1XA 5FZMA 1WA4A 4MGSA 3E5UA 4OLLA 1DZQA 4R4XA 4UW6A 3RDIA 3ITQA 2J42A 2IFWA 2E26A 4HXCA 2VOXA 1Z0HA 4PI0A 4UFKA 3RVHA 1C8M1 1N47A 2YU2A 4BQ4A 4BHPA 1CAVB 1E5RA 4HOOA 5EJ1B 4Q8LA 3N9OA 5FYZA 2DF7A 2R0HA 3MV01 4ARXA 1W2AX 5C9AA 1I5ZA 5BNQA 1S0DA 4LITA 4JGYA 5A32B 1BK1A 1BLZA 3ZYIB 3MIGA 3W5MA 4L97A 1AYM1 1K5MB 2WNUA 3FHAA 4GD4A 4M0HA 3SH5A 4AHZA 1NA1C 5ISLA 1OUXA 4NOTA 4YVSA 3WDYA 2NN8A 2RJLA 2WYFA 1JYWA 4FPOB 4DIQA 3NMBA 3PMSA 1S0BA 2VMIA 1O8PA 1PIV3 4XQDA 3D5OA 4LMFA 1W0PA 1JUIA 3VDBA 4AK3A 3I2GA 1MQTC 2YFZA 5C4WB 2ZACA 3BALA 4Q4Y2 1WMFA 4GMP3 3H8UA 4QPIB 5BNPC 5CFCA 2AC1A 3R4UA 4XPVA 5IVBA 5A1AA 2JKXA 3WZ1A 1RB8G 1CQ9A 4FT8A 1SQ4A 3CJXA 2RS53 4RN5A 4YGBA 2C24A 1JZ4A 5EQUA 3SCHA 3SXWA 1GANA 4GWIA 4Q27A 4IEVA 4TLGA 5BV6A 1CX4A 1W8OA 1CPNA 1W03A 4XFHA 3I3DA 5T55A 3RMYA 3SH4A 1R1A1 5FY9A 5HCFA 2EXKA 4CDUC 5I8TA 1ZZ6A 3GXUA 5DZGA 1XB9A 1VAVA 1XU1A 2P3KA 3CLPA 5E88A 2ZKNA 1JYNA 3ORJA 4XC9A 2FDIA 4YZ4A 4PBOA 4AI8A 3LPFA 5F6LB 4HN0A 5CFDB 1SPPB 3KV9A 1SDWA 2YC2A 5FMDA 2Y26A 3PURA 4ZKTB 3VDDB 4H2AA 3LOIA 4TN7A 5LB6A 4DNYA 2W3JA 1XNTA 3IDAA 1X8MA 4JGZB 4DO0A 1Q8OA 5A6QA 3DKWA 2WABA 1TME3 2WL1A 3B93A 3NKGA 3O1PA 5FMOS 2R062 5CISA 1W3VA 2ZKLA 4YGEA 4CEYA 5I0UA 4N8MA 4OI1A 1HLCA 4OYUA 4QX0A 2PMWB 2BPA2 5B2GB 1UZZA 3POGA 1XNKA 4MADA 4YLZA 4GMP0 5CU1A 4I2OA 3VBUB 4COYA 1GLHA 3U78A 1BKZA 5JXGA 5FXWA 2VTXA 5T50A 4UBHA 3WP5A 4YM3A 3N7LA 1W6QB 1ZBA2 1LU2A 3WG2A 5BY5A 4IV3C 5GM0A 2W94A 1O6UA 5FP4A 2BNNA 1RL3A 4FPFA 4COVA 1JYIA 2YBSA 5FYIA 4K1YA 2JKBA 3KWVA 3GZTB 5CB7A 2B39A 2JE9A 2XQXA 3BB6A 4IE4A 1WLWA 3LOBA 1W6NB 4XAEA 4YARA 2VZQA 3WF3A 1ZBA1 3I2HA 2B9VA 4HKLA 4Y33A 5H9RA 2H0VA 3VBOA 2OPKA 4IE6A 5A7OA 1DP0A 4NROA 5A33A 1WW5A 1AVBA 1RHI3 4K40A 1LOGA 2Q1MA 1ZA4A 2WT0A 3PJYA 4LULA 1JYCA 3D3AA 2AREA 3POBA 3QH6A 4HPKB 3TB0A 4M4PA 3ZX7A 1G9DA 5DXDA 1OOPC 3FUQA 2BTVC 1AL22 5J7MA 3KV6A 4UFIA 3W20A 2WJSA 3B02A 4PLMA 1I1EA 2I74A 3H0OA 1C1LA 1DGWA 3NO8A 5A7PA 1LNSA 1WCKA 1OXCA 2ZS6B 3RJ2X 1ND3C 2VZ3A 4MG2A 4O9GA 3DPRB 4GWNA 3O0VA 3BI3A 1K12A 4AAXA 1AL21 4CTEA 1AUYA 2LROA 2G9GA 2X09A 4GKYA 5LK7B 4SLIA 4OHZA 3CNAA 1RUC3 1O3RA 2YY1A 2HWC3 2R16A 2H0BA 2RM22 4CDXB 1OQ1A 5T5JA 4E27A 1EYBA 3TNQA 1W9TA 4ZU7A 4MGKE 1YWKA 1YQCA 3T30A 4ATEA 1OMIA 1TNFA 1NAEA 3DF0A 1AR63 3AP9A 1W39A 3ZVXA 1CR7A 1QEXA 5T5PA 3JBG3 3UV9A 5I0SA 1OLQA 1VMFA 1ZZ9A 2RM21 4QX2A 3WLUA 4Y24A 2QQKA 1A8MA 1TG7A 3WR0A 1LECA 1MS4A 1QJX2 3KVAA 3RFRA 3WDVA 5EPAA 5LRSA 4Z82A 4Y1VA 5JVVA 4H55A 2IFRA 4PI2A 1GNZA 3M4FA 3DXTA 1DQ5A 3HR9A 3TN92 1YQ2A 2VH9A 4JQTA 1TE1B 3BUCA 1P8JA 2PLV3 4CEWC 2MPFA 4HETA 4E2GA 1QJX1 1JMUB 4KWUA 2WS93 5A80A 4Y22B 3UT0A 4YFZA 1UIKA 1UXXX 3GJAA 4CUGA 4P14A 2SBAA 1UZWA 2A6VA 3FBYA 1LODA 3MF9A 4L2NA 2CL2A 2L9LA 3MUZ1 3TN91 3VN4A 1VR3A 2VM9A 3NRUA 1VRBA 1GICA 4OZOA 4X6QB 2YYOA 4OI2A 1GUIA 4ZPIA 2JG8B 1G9AA 1TVGA 5JIAA 4CDQC 1S2EA 1XU2A 1YC61 1OFNA 3T1LA 4A44A 2UU8A 5FMCA 2WZR3 3GBGA 4AI2A 1LENA 5JOZA 3OOXA 3AZZA 1UY2A 2XBO3 5F1RA 3ZXEA 4EQVA 4Q0VA 1HN0A 3BVCA 1M06G 2BOJA 2WRAA 1H6YA 1KFXL 1HDKA 4CDUA 5GZFA 4Q4V2 2YFUA 3NAPA 2WA4A 2CWSA 2Y6KA 2IXHA 4QX1A 2XLGA 5FZ0A 5KXDA 4A6SA 1QQP2 2CGNA 4AHYA 5JXJA 5DPNA 3MPBA 5E89A 4HONA 4NIHA 1OC1A 1VBD2 2FD8A 1VRH3 3AP6A 3POFA 4HFSA 4NHMA 3OD4A 2IUWA 5LATA 4MXVA 2BFUS 2JICA 5LW9A 4Y4RA 3H3UA 3AFGA 2VXJA 4FFFA 2DBNA 4FOVA 2MNGA 2R49A 3VBUC 4YZ5A 1QQP1 3H1YA 2XKPA 1RUJ3 4WM8B 3EQEA 4IEWA 1VBD1 4LLOA 4MYEA 2XXZA 3NJYA 2VVDA 4BB3A 2O0OA 1S0IA 4YNIA 3U37A 2YB7A 3VBSB 4LT5A 1HXS2 2NMNA 3IKWA 4GWJA 5FZLA 1VIWB 5CKMA 3WINE 1UU5A 1KJLA 4IEPA 4YVWC 3ZSMA 5FP9A 3RZGA 3RI9A 4AAPA 5HI0A 3VD9A 2P5BA 3KV4A 3S6PA 5F5CA 2XVLA 3B9CA 1SBFA 2YROA 3I97A 1NCQA 2JB4A 4XEZA 5AVAA 1XYPA 3FHIB 2BBAA 4CDWC 1YFUA 5F3CA 5IHRA 5FZAA 4DUXA 1UOFA 1S0JA 1NE6A 4DOUA 2FHRA 3WP6A 3H9AA 2HBUA 3KF5A 1LTEA 2CYFA 2E33A 4M01A 3ACGA 1YEWA 3J8F3 1QF3A 3I2IA 4QD2A 1SLTA 2WNVB 1UX7A 3HJRA 2ZGTA 5DG1A 3KZ4C 4AGGA 4Z1VA 2FDGA 1K42A 4QQOA 1B35B 1H8TB 3MFAA 1AZDA 3VBFC 5KWRA 4RL7A 2B42B 5JPMB 1QH7A 2NM1A 2KM2A 1YQ5A 4IL7A 4JC1A 2BYVE 4KG8A 3TNPB 4AQSA 1GOHA 4LA3A 5FZOA 3NW4A 1H2KA 4FTSA 1H9WA 1NYWA 4BQWA 4LBKA 4P9XA 2JIGA 4QHBA 1BCXA 1ZVFA 2GN7A 2C26A 2GH2A 2E32A 4MXWA 3ZYHA 3SQOA 4BIFA 2VBBA 1WW7A 4XIOA 4P08A 1V6KA 3HT2A 3WNPA 2PHLA 1FV2A 1VP6A 3AK0A 4N53C 3OEBA 4D69A 2VW0A 3I49A 3J9SA 2OVUA 3LF7A 3WV6A 3NNJA 1AHSA 1ENRA 4YFWA 2ZGMA 4P5YA 4XHBA 1W06A 5D8AC 5FZFA 1D4M3 4UFMA 2GNBA 3EYPA 5JSPA 2HWE3 4D7YA 2YGMA 4XFBA 3OGVA 1UN1A 5FYHA 1RUH3 1AR72 3MGUA 2JE7A 1LOFA 1ULGA 1AX1A 3POJA 1CX1A 3WNKA 3I3QA 2ET7A 1H2MA 3OPTA 2QNKA 2XQRA 4AF9A 3H50A 5FZHA 5JDBA 1VAKA 2GC3A 1JHNA 2XHNA 5FY7A 3VL9A 4XURA 1RUF2 2JDHA 2VMEA 1PGW1 4CPBA 3I59B 1MS8A 1UKGA 1F4AA 1AR71 1PO11 2BJSA 2V4VA 2VBPA 5FZ9A 4BM8A 4CP9B 3ALQA 4HLTA 5F3EA 4CSWA 5KC6A 1UOJA 4BMBA 1PMIA 1U5ZA 1UY3A 2ZTNA 3S57A 3UL2A 3ETPA 5F7UA 1ODMA 1HIXA 4J1XA 2D6NA 2PHTA 2AACA 3ZR6A 5JOWA 4OULA 4XYXA 2Q0AA 4Z8BA 5F9TA 5IK4A 1SBEA 4AFCA 4TTGA 3J4UH 3ZYPA 1FNYA 2JG8C 1CAWA 2OW4A 2WINB 5LY2A 2RS12 3J7LA 1ASJ3 4PF5A 4KWLA 2R1BA 4AR2A 3WG4A 2GMEA 1KDMA 4WVWA 4LIUA 1AYN3 2FBEA 2WWUA 3KCCA 3PUQA 5FZ3A 4CYDA 2PQQA 2Y34A 2RDQA 1EAH3 4M3CB 2BGCA 2EIBA 4XETA 2PHWA 4P9WA 1CAUB 3RSJA 1S2BA 3WP4A 5A7NA 1QJFA 1KITA 3IPVB 1W6MA 2RS11 1XE7A 5KXEA 3POEA 1GNHA 4SBVA 5IJRA 4LORA 3ZFGC 2CU5A 5JPNB 1BBT3 4KG0A 4B3NA 4FBFA 3CQOA 2VOWA 1U12A 2C6SA 5FZ4A 5FYYA 2DFCA 1HRV3 1D0HA 2P4EA 2WN2A 2IVJA 4WM7A 3MF6A 1JOBA 2QQPA 2A3XA 4QKBA 2ZZQA 2VNOA 4GKXA 4IV1B 3ZFEC 3RZMA 1RMU2 1FMD2 1LGCA 1L7RA 5FWJA 4LA2A 4DY3A 3ACHA 4FTEA 1A8DA 4DQAA 5KC5A 1JU4A 1KGYA 4HN1A 2HWF3 1PK6C 1JI6A 3K4DA 3OYWB 5FZKA 1COV2 5AC93 1E57A 4QHOA 1ZBE3 1S4CA 3EJKA 2D5HA 1A78A 1FMD1 4BA6A 3IDBB 4IESA 4M4RA 3LDBA 4AEMA 5GLUA 4A2UA 1R093 1HRI2 2ZHMA 1VBB3 2ZGNA 1YJLA 1SMVA 3AZXA 3MLLA 3UK9A 4AHXA 5L7OA 3VL8A 4MX3A 1OA4A 4MSVA 4Q0SA 4HT1T 4LJHA 2WSUA 4CCKA 1COV1 4NUBA 1O3TA 5F2WA 2ES3A 4F83A 4K21A 4AZZA 1LRHA 3WD5A 1IPJA 4S2DA 1ODNA 1LOFC 3ZFFB 4Y20B 4MZUA 1HRI1 4HSLA 2E53A 4N43C 3EXUA 4W6YA 5LBEA 5IWFA 5I93A 3T0DA 3B01A 4O7XA 3T08A 3VD5A 4RSUA 4NWWA 4IQPA 3V0BA 3NV1A 5FO9B 5DUVA 3P6BA 2W1WA 3O1VA 1SEFA 3RYRA 4O65A 1V0AA 4Q26A 2CHHA 4LHSA 5E1RA 4YZ2A 4NIDA 1AR83 4NPRA 2D5FA 2YBKA 1LHVA 5EP9A 3AP4A 2WUHA 4Y1UA 5ABJB 4R9CA 4FAHA 3LFIA 1R64A 4MV2A 4RD7A 5FPVA 5C6CA 4L11A 4XUQA 5FYMA 2GC2A 5IVJA 4PDWB 4B7EA 3AMPA 3H1MA 2WZ8A 4R4ZA 4XUNA 2VC9A 1J3QA 2ZMLA 4EZHA 5JI9A 4UFHA 3K3NA 3M2MA 4EJRA 3AB0A 2HKXA 3T2TA 2PXJA 2JG9C 1IQDC 3S5AA 5I91A 5JXIA 1AX2A 3N9PA 1DF0A 5C7GA 1W9WA 4HK8A 5FR3A 1RYYA 3O0XA 5IFTA 2RV9A 2UYBA 3LSDA 1RC6A 1UY4A 5DUUA 4MH0E 2ZZJA 2ZEZA 4QGMA 4CUCA 3EMRA 2ZGQA 2EAAA 2K9ZA 2J1RA 4GJZA 1HV0A 2BEOA 1Q8SA 3WP3A 3MIHA 1EP0A 4YW7A 4KGQA 4QX8A 4XTPA 1GBGA 4D0QA 3VD3A 2QBXA 2VCMA 1H0BA 1YHFA 2P1BA 3JXSA 3D82A 5K9YA 4L99A 4LUKA 4XFAA 1JZ2A 3WXPA 5JAXA 1TNRA 4K8RB 1QJY2 4Y1XA 3FUOA 1PMHX 1SCRA 4BZ4A 1JN2P 4DUVA 4UF0A 1DCSA 2LW8A 5BNNB 1DFQA 4FPEA 3O1MA 1ACCA 1VBE3 2Y6JA 1QXRA 3WDTA 3QD6A 4KU8A 4UW5A 2DUOA 1HW5A 2VTFA 4G4FA 3LIGA 1WW4A 2IVIB 4FPGA 5J96B 1LOEA 1FI2A 5ACA2 5FPAA 2WA3A 1DYOA 1ZZ7A 4Q5OA 4E2QA 5GLVA 1Z7S2 5FYSA 3O1SA 5A6YA 1JBCA 3BKZA 2BNOA 5FQ0A 5FBZA 1X7NA 2LS6A 4A4AA 2QQOA 1OQEA 4R9AA 4Y1YA 2QQJA 1DIWA 5F39A 2ZEXA 2P2KA 1UX6A 1ND2B 1VMHA 4N9HA 3V0AB 2Y6FA 1B09A 4RS5B 2C5DA 3CKHA 4EV0A 3KHCA 2PHRA 5D1IA 3IN9A 1C8M3 4ISQA 1Z7S1 4NMIA 4LNVA 4JV4A 1C28A 5CKQA 4XJ9A 1C57A 2XJUA 4QKDA 2A3WA 1O4TA 4P9JA 1NA1A 2A1XA 1V6IA 4RHV1 4E8DA 1CGPA 1BQPA 4QQ2A 4YSFA 1PX4A 1J1TA 2X5IB 1AYM3 1NQJA 2HYKA 3FFZA 4N7IA 2XJRA 4JTNA 2JECA 3JD73 5LEKA 4J1WA 1MQTA 1W0OA 1G8WA 5LA2A 4H14A 1DYPA 1V9U1 1ULOA 3BOWA 3HWJA 2XDVA 4ASLA 4BU2A 1RUI3 5BNPA 4E8CA 2XONA 1IQAA 3PVNA 3ROUA 5L36A 4E4SA 3HPNA 3Q8BA 1JUHA 3TYJA 3I2KA 5GZGA 2D6LX 3NVCA 3WY6A 2XJVA 3THPA 3WG3A 5JIUA 1V6NA 4GH4C 2OYZA 2IXKA 3OGJA 4YZ1A 1G86A 2VGDA 1LHOA 1OPOA 4QHZA 1H1IA 1YNAA 3H3LA 1V6OA 4FPKA 4XUPA 2IXIA 1RUD2 1GWMA 4ITCA 1CIYA 4AI3A 5FZCA 3LD8A 1I9RA 2V72A 2EIGA 2J1AA 1W8HA 5J09A 4Y5SA 1CAXA 5FDBA 2HWD3 1E5SA 4AI0A 2DUPA 1O3QA 1C4RA 1H8VA 1R1A3 2Q1ZB 4IEYA 1QJU2 1VBA2 5GZDA 5CADA 1NCRC 3BIWE 3CMGA 3B00A 2LTNA 1MEC2 1KEXA 2IXJA 1RUD1 2GC0A 3ZXLA 4RGKA 3OUJA 4XMAA 3T4HB 2HBTA 2V4AA 3KV5A 4JQRA 3IIAA 4CCJA 3WF4A 2BWAA 3U07A 1YLLA 1RGSA 5LASA 3ZYGA 4I01A 1YUDA 5L19A 3R05A 2MHFA 1RJ7A 4W8JA 1KQRA 3H8OA 1QJU1 1VBA1 1H4GA 4X6RB 5GLZA 5T52A 4GB33 5A3TA 4ASKA 1QJEA 1MEC1 2RVAA 1WMXA 1D2QA 2A71A 3SNMA 3N7KA 1VBC2 4XF9A 1ST8A 4AVAA 1REEA 2HWB1 5FUNA 2C0ZA 3ME2A 5C9AB 1I6XA 2GNMA 4JGYB 5EYYA 4QPYA 4DS0A 4UAPA 2WNUB 4LHLA 3R4DB 4D94A 4PDWC 4YG3A 2Q8EA 5JLVA 3LB9A 5AFEA 4MGYE 4META 4YVSB 3KCYA 2WO1A 1NY72 4KL1A 2R6QA 5A7WB 3RI8A 5LCWL 2QQWA 2UWBA 3K77A 4QPGC 2TNFA 3ZO0B 1LHUA 4IV3A 3TWIA 1NQDA 4L92A 3WCRA 4NAOA 3HN3A 3UKVA 2J1EA 1POV1 3VUOA 4I0BA 4Z2WA 1BHGA 4OHWA 2AH2A 4K20A 4PBPA 5DABA 1SLCA 5DAQA 1ZZ8A 1JH5A 1W2UA 2D98A 3ACLA 4TWTA 3VHNA 2QJVA 1HQLA 5CFCB 3CDZB 4EWDA 2GDFA 1BMV2 3KMHA 1S0CA 4MO3M 2VOKA 1LEDA 4DXRA 1X36A 2EIEA 4JAAA 1UPIA 4MGQA 3F2ZA 3IT8A 2CDPA 4I0WB 4GJYA 1QWRA 2YUEA 1F31A 1Q8PA 3AYAA 5LY1A 1MS0A 1AR92 1VALA 2W46A 3N7JA 2ZX3A 5APAA 5FZIA 3VKMA 1VAMA 3ILNA 5C3PA 5FYBA 1BXHA 1W6OA 3D4KA 3FE5A 1W2OA 1XBFA 1UMHA 1Q43A 3AKQA 5C5UA 3Q8EA 4OVEA 2DTYA 1QIQA 1H4HA 2YZ4A 2I07B 1OOPA 1AR91 1ULCA 1ZREA 2D97A 2QQIA 1LJ7A 5DAVA 3RZZA 5LEJA 3RRDA 4XAAA 4BQYA 4CCMA 4OHVA 4CXYA 3KB5A 4AVTA 5H9PA 1ND3A 4LLFA 4A7ZA 3MIDA 1GV9A 2YXSA 4Q4Y1 3VBRC 2PYTA 4D3WA 4DXTA 2TUNA 4ZZ5A 5K7PA 4B4PA 2YV8A 4Q8KA 2DCYA 2W92A 1OPMA 1XNCA 3A22A 4AFAA 1O5LA 2DTWA 2E7AA 2XHKA 1W8UA 3ZN6A 2D3PA 4CEYB 1ND2C 2W1UA 2JDMA 3OB8A 1AL23 4MGZE 2JDYA 5FYUA 4BK4A 5DZFA 1PO22 3MBWA 5EJZB 1NG0A 1AJKA 2ETEA 4HSJA 2BRTA 4A3ZA 1SBDA 1YI7A 1NUKA 1S0EA 2P3IA 3PVOA 4URAA 2JDNA 3T0BA 3P5BA 1H1MA 2HEYF 5BXXA 2WFF3 3O1UA 3USUA 5FLHA 3SEPA 4QB2A 4EN0A 2B46X 1CESA 3BU7A 3QLQA 1FXZA 1OH3A 5C3OA 1U5YA 1RVF2 1XSQA 3A23A 5T3NA 4IGOA 5HXVA 3BTAA 4K1ZA 1ZZBA 2ARBA 3S7IA 2R073 4A41A 1LKNA 3K4AA 1NZCA 5A3UA 2Z42A 3WW1A 3CL1A 4CEWA 2CAUA 1GKBA 1J58A 2WN3A 5LA1A 5GALA 1ZRRA 5C8CB 3FC0A 1STMA 1RVF1 3NKTA 3VBOB 1IKPA 4AEKA 3OPZA 3C7FA 2R061 2VNGA 1Y43B 2FCUA 5A33B 4NHLA 4K9SA 4W65A 4AFDA 2VMCA 4IGQA 1QJX3 1RXGA 1DBNA 1AX0A 3KSCA 3M3CA 4CDQA 2BU9A 2D6PA 3DUIA 2DCZA 3TN93 2DU0A 2H6CA 3C7GA 1PNGA 1YI9A 1GOGA 4AQ6A 1UYYA 1SPPA 4ZY9A 2ET1A 1WCQA 4H7MA 3H1WA 5EJ3A 3CJIB 4C0HA 1L3JA 3N4MA 1MS9A 5FZ8A 3OUIA 1WCSA 3HVDA 4JKLA 4E4ZA 5JZGC 1XJAA 2FDFA 5ERLA 4DZGA 4AEDC 1SCSA 2DU1A 4QU2A 3FBMA 2QDRA 3E97A 4LBQA 4QXCA 1GQHA 3LA2A 3MLKA 1PIV2 3VGIA 3N36A 3VZLA 1HQNA 3H7JA 1WMDA 2W68A 3K4ZA 2DVFA 2KR2A 1O5UA 5F32A 5FK8A 2XGXA 5B4NA 1Q8VA 1W90A 4FPYA 1H2NA 1FATA 3VD7A 3AZYA 4RQPC 4EE2A 2NP0A 1QJZA 4UT5A 3VBUA 3AJYA 3AYEA 2BVBA 1CONA 3MW3A 2RS52 4C8DA 1JYTA 1BEV2 5CZKA 1HJGA 2E7TA 3SKVA 2XPJA 4NHYA 1VBD3 5HXMA 2A6YA 4YVWA 1YCIA 3ZKYA 3BIEA 4OCTA 1YJKA 2RMU3 4R9DA 3MEPA 1BEV1 2CWMA 3MHZA 3MZHA 3KM5A 2K0GA 4CDWA 5L73A 1K5MC 4BMEA 1KFUL 2RR13 4FOYA 3SISA 1RXFA 4NWVA 3RZLA 1JYVA 1W2TA 1UOBA 4TLFA 3E5QA 4XFIA 1ZRDA 3FWEA 5FJKA 1EUTA 1TME2 2YMZA 3WNMA 4DEVA 1C5HA 2PHDA 3AMNA 4FOQA 4Y4YA 1GYKA 3E6CC 3I3BA 1OH4A 3BCWA 5JI7A 1W8ZA 2EIDA 2GSYA 4P9IA 2D3SA 5C4WC 3VBFA 1OHFA 1DDLA 4PLOA 4QPIC 3VHOA 2J1VA 3MPPG 5HCHA 3W58A 1DYKA 2XUMA 2VPVA 4LO6B 4EYUA 4INDA 1DLLA 4OZXA 4LE3A 4QWNA 3V64A 2BGOA 3T1MA 3SCFA 1F5FA 4K8FA 3I3EA 5FPBA 5IAVA 3WUCA 3ABZA 4CDUB 3NAPB 3AKRA 4XZPA 1ZNPA 2R042 3N9QA 3GALA 2VO5A 4D6RA 4Q4W2 2EXHA 1D4VB 2A6ZA 1PGSA 2QQNA 2VU9A 2WLQA 1OSGA 4M3CF 1GZTA 1OT5A 4N53A 4QQPA 3K75B 1OKOA 3AL6A 2W87A 4NHKA 4BQ3A 4COWA 5K0UB 1PZ8A 2VNVA 5CFDC 1J84A 3RZKA 5D8AA 2R041 2LRPA 3ILFA 2VQ0A 4Q1PA 1BYHA 4XJUA 3VDDC 5CEHA 2Y33A 4Q4W1 1DZTA 2A6XA 5LBFA 2DURA 3NL1A 3PNAA 2G19A 1WCUA 2B8MA 4LK7A 1SFNA 1T2XA 1LOAA 4FQ4A 4JGZC 3OEAA 4KGGA 3W9AA 3ACFA 5F6KA 5FIXA 2CSGA 5GJ6A 3CEWA 1CVNA 1OD3A 1SZBA 3VZMA 2HH9A 2JEMA 2OIIA 2ZMNA 4UOJA 2VL4A 2ZGKA 4XXPA 2JXAA 1UU4A 1X82A 2XOMA 3NJXA 1UMZA 3HQUA 3EO6A 2OX0A 3DN7A 2DCJA 1IS3A 1HJFA 1VLNA 4Q4V1 1HV1A 1GR3A 1NCQB 5IK8A 1VMJA 4QQHA 5DDJ2 3ZSKA 2E63A 4CCOA 1R082 2WBKA 5B4XA 2OXBA 3LA3A 3HBZA 4BLIA 4Y22A 1PO13 4X8NA 4DFSA 3ECQA 3WNOA 1XQNA 4AQ2A 2QDNA 1H6XA 2YBPA 3GZUC 4NIIA 3THCA 4UWDA 4CCEA 1C1FA 4IEXA 1U5IA 5I8YA 1FT9A 2JG8A 5DDJ1 4LPLA 1R081 2D40A 3AFKA 1HB3A 2VR4A 4UFJA 1YFXA 4FPLA 4Y5TA 2XKOA 5CAZA 1RUC2 4HVOA 2F4LA 5FKBA 2A5ZA 2HWC2 2KXLA 4XDPA 4ES8A 4EWAA 2VQTA 2PHFA 5JSRA 3WW4A 1DQ0A 1IG3A 3CJIC 3HAGA 1HXS1 3RNSA 3HD8B 5FZOB 4BPZA 5IVYA 1AR62 1BZWA 3AKTA 3LGRA 5A1LA 4CA9A 2A75A 4QXBA 3WF0A 3ZFGA 3OG2A 2CTVA 4GIQA 2RS13 3THTA 3PVEA 5FP7A 2H6BA 2VZPA 2D6MA 5ANNA 2AZ5A 1AR61 4XFFA 4HMZA 4EWEA 2D93A 4GAZA 5JR2A 3IMMA 1NLRA 3NQHA 4XUTA 5FV3A 3ZFEA 3ZXKA 2V09A 5EV7A 1ZRFA 2PAKA 1JODA 1OUSA 2WQ4A 1WKYA 5J1XA 5FO8B 4AOCA 2JDPA 1FNZA 5IVEA 3BGAA 4AFBA 5J37A 1NKGA 2WS92 4JVAA 2Y0IA 3FMGA 2OQ7A 4C90A 1OA3A 2FZ2A 4EN6B 3DPRC 1PK6A 4AWDA 4YWAA 1UYZA 2D3RA 4FQZA 5JOXA 5M0TA 1CPMA 5FP8A 4CCNA 4ZS3A 3USSA 2CAVA 4GULA 3VLBB 1XYOA 5CG9A 4DB5A 1US3A 3DYPA 2WDBA 2P37A 1ZX5A 5FZEA 5T5LA 2LM3A 3K3OA 2CDOA 2VECA 2B4KA 2WS91 2X53S 4OMCA 4ORFA 3GCWA 4XW3A 4CDXC 1FMD3 1S2KA 3PTRB 1TMF3 2CGPA 5IVVA 5EXOA 5C3RA 1G9CA 1NX9A 2YGLA 2XBO2 1DG6A 2AEZA 3OCPA 1JZ7A 5J3UA 3ST7A 4F7ZA 1W8TA 2XG3A 3N7MA 4D6QA 2RE9A 5FZBA 4EZ4A 4O9EA 1QMJA 2VOTA 2ZEWA 4CCDA 1IS5A 3OF1A 3VZJA 1NLQA 4N43A 1CAWB 3NJVA 4A3XA 5JMCA 5LBCA 1VRH2 1HRI3 1BJQA 3B94A 2JDUA 5FY5A 4KNCA 1U5XA 1Y9MA 4BIOA 2Y6HA 4JHTA 1OA2A 5FRAA 2HLEA 4LHNA 1GFF2 3PIJA 2XUEA 3G7DA 1RUJ2 3LWCA 3X29B 1RUF1 3QBQA 2VZRA 4FFIA 1G9FA 2VUDA 4QGNA 4NPMA 5IVCA 1WZXA 4E4HA 5DAXA 3ES1A 4RGAA 4AVSA 3NV2A 2R7EB 5A3MA 5BNOB 3OBRA 4I3GA 1DLCA 2W95A 1OF4A 4PIXA 3D8CA 4WM7B 2ILMA 4HANA 3RJRA 2ZAHA 4ISRA 3U75A 1EUUA 1RUJ1 1K3IA 2VCCA 3DXUA 5K0UC 1QOSA 3O1TA 3RZHA 1DQ4A 4W50A 1SACA 1IOAA 3L2HA 2JG9A 5EYXA 1HN1A 5DG2A 4D7SA 3ILRA 4Q4X3 2Y0OA 5CG8A 1H2LA 3AXEA 3DEMA 3IIIA 3CBNA 4L9BA 4DINB 3AKPA 3WW3A 5FMOL 4ZXKA 2C9AA 5I0RA 1QY4A 1YQ6A 1DHKB 3M3EA 1IKQA 5DN2A 2J22A 2Y6LA 4OQ8A 2P34A 1YIFA 5T5OA 1D7PM 3I59A 1S0GA 5FOBB 1JHJA 3SLIA 4ES9A 3IB3A 3DECA 4CP9A 5AVPA 5FXVA 2KA3A 4XACA 2OUHA 2JD9A 3LEGA 4AHWA 2ZGPA 4YW1A 1LEMA 4S2GA 1LGNA 2VD7A 4WM8C 4Y26A 4CPBD 2BBVA 5CA6A 5LZ6A 1XOYA 2XVKA 4J6GA 4DXSA 1AXYA 1FYUA 3VBSC 3C2UA 4QT6A 2F4PA 2GMPA 1KS4A 1JOJA 4LK6A 1RMU1 4EN9B 3WCSA 3AM2A 3IZOA 1ENQA 4LTAA 4BJ0A 1OVPA 5FP3A 1IHMA 2NYYA 2WAOA 2D44A 5LBBA 2OT7A 3E6DA 3MO4A 3T2OA 2Q30A 4N90A 4LUMA 5T54A 2RS32 2XJPA 4M3CA 4QM9A 3CO2A 4NJ4A 3ZIXA 3IAPA 1D4M2 2FDHA 5SV5A 3GZEA 4JRLA 4AGRA 4P00B 3IM0A 1GWKA 3I2FA 5FTTC 4CVUA 4CCCA 2K2SA 2ZGOA 4COZA 3AYDA 4XXAA 2MEV3 1SHWB 1N1SA 1F4HA 2XVGA 1XNBA 2JE8A 3ZPYA 3WW2A 1QXPA 2DVBA 2RS31 2WNVC 4OI0A 3KCXA 1Z7S3 1D4M1 1B35C 1H8TC 1NXD1 1RIRA 2GC1A 4QX7A 4M3CE 2W0XA 5H9QA 4QM8A 4LOTA 4I0AA 4RHV3 1K45A 3POWA 3AZVA 2D7FA 1J83A 1IS4A 1MZEA 1MS1A 3TOJA 3RZJA 4E9KA 1UD1A 3K2OA 2BUKA 4UFLA 5C71A 1IPSA 4QGLA 2VMDA 3SMHA 3TAYA 3VBHB 4JZRA 1DGRN 2NPIA 2XL7A 4YZ3A 5JXHA 1W8NA 4QB1A 1V9U3 3W59A 4AVBA 4GH4A 5C70A 1BVP1 3I7DA 1QXJA 2AR6A 1QDCA 1EV12 3LCPA 1ASJ2 1OLRA 1A6CA 4Z92B 1ENSA 3OJBA 3VDCA 3AMQA 3ELNA 3H8XA 3I2OA 1AYN2 2E6VA 5EIYB 4LBLA 3Q8CA 1XXNA 5FY4A 3ZLIA 1EAH2 1WUVA 1YYNA 2ZEYA 4MHUA 4OFGA 1CZTA 2QE3A 4B1LA 2BDRA 4JCKA 3OGRA 2NLRA 2XLFA 5EHDA 1EV11 2JDKA 1ASJ1 4RR3B 1PVC2 2Z5WA 1NCRA 2VCBA 3S30A 3WQ1A 3ZDSA 4AGVA 4E4DX 4BE3A 4XJZA 5GLTA 5A7SA 3A7QA 2ORXA 2HEVF 2ATFA 1L7QA 4TSVA 4K6BA 5FYTA 3O1OA 2Q8OA 2WQ8A 4PQ9A 5FQ0B 3LEMA 3WUDA 1LCLA 1PVC1 2OZ6A 2OS2A 4WBBA 1N3QA 4I02A 1FX5A 5JCTA 2QQLA 3SH3A 3M1HA 1ZA7A 2ENRA 4NR1A 1VBA3 2P6CA 2LUWA 1QOTA 2Q1FA 1HB2A 3KGZA 1JZ5A 3OTFA 1W3XA 1MEC3 2HWF2 3OY8A 5FPLA 5GZCA 4WVMB 5AC92 4ZS2A 3E1F1 2XH6A 4JX0A 5BNOC 5IFPA 4NRMA 1NA1B 2HWB3 4PDWA 3URFA 4OUEA 3CHXA 5FXZA 4FP2A 4BQ2A 1XPWA 1OURA 1QJY1 5FK7A 1UQXA 3UKNA 4CUBA 1MACA 2WLPA 4B8EA 1VBB2 4QPGA 3WDXA 1O59A 4IEOA 5FY1A 3S5QA 4BWOA 1HB1A 2Z2SB 2VAUA 4OUSA 1E5HA 2E31A 1N1TA 1M4WA 4XCAA 1MQTB 2V5DA 3LIHA 3LPGA 3QACA 3TEWA 4LBNA 4MHRA 3UYJA 1QKQA 4ATFA 5BNPB 2DV9A 1XYNA 1GZCA 4EN7B 5ACA1 2IZWA 3I3MA 2IXLA 1POV3 4KBBA 4XF4A 3LZZA 1VBB1 3WX5A 2Q4SA 5C5TA 3POSA 2VUAA 3LEKA 3RWKX 4NIAA 3SHRA 1QOOA 5FMBA 3SC7X 2VXRA 4NIGA 4B1MA 3WNXA 4IV1C 2BQPA 4ZONA 2QKDA 4JKKA 3WVJA 4W4ZA 1H9PA 3NNMA 4ASMB 1XSRA 2YHJA 3O7OA 5DUXA 1EY2A 2FCTA 2YDEA 4L8QA 3E6BA 3KQ4B 1CAXB 4BK5A 1OLME 1N3PA 2O8OA 2WR9A 2PFWA 2ZHLA 3NV3A 4LO5B 4Q29A 5AFBA 4IUGA 3LEIA 1REDA 1CIWA 5FZDA 4YPJA 4YW6A 3WQ0A 1WCDJ 1URXA 4OQ9A 1UMIA 1V6JA 2YU1A 4LKFA 3KT1A 3BU0A 5SV8A 3PUSA 1FPN2 2W47A 1TEIA 1ULEA 3AYCA 4FXKB 3GM8A 1GZWA 2PTMA 3VBRA 2WKKA 1F35A 1W8FA 2BP6A 2DVAA 4UI9L 4CCLA 4AXOA 5K4LA 2D6KA 3UGHA 3OSDA 1NXMA 4Q4Y3 3V0AA 1ND2A 2VVEA 1RUG2 4LKDA 1FPN1 2QCSB 3P3PA 5IT6A 4URTA 3ZFFC 3V56A 1YFWA 1C5IA 4CP0A 1POV0 2A3YA 5C8WA 2W91A 2JJ6A 1W6PA 4LKSA 1RUG1 1G6NA 5A6ZA 3N9MA 4G9SB 2ORZA 4BYYA 4ZXEA 4IV3B 3J7NA 1AJOA 1Q8QA 5FOJB 3O5SA 4OHXA 1H1AA 4LO4B 5FBJA 1LU1A 4PIZA 5FY8A 2OZJA 2DCKA 3C7HA 2Z69A 1V00A 5FKCA 5ABJC 1HX6A 4JDOA 3GDBA 1W05A 3NNFA 4GQ7A 4H3WA 5FJHA 1Y9GA 1WD4A 4YG6A 1JOPA 3VBHC 4Z2AA 1RUE2 3T0AA 1VBE2 2YC4A 4JTOA 2VQUA 2VULA 4AI9A 2Y64A 1W99A 4FAGA 3PUHA 1C8NA 5KHKA 4EN8B 1VBC1 2E9QA 1EPZA 3S0MA 3OD0A 4COUA 2AYHA 1RVF3 1UF2C 5JR7B 4WZFA 1W04A 2DFBA 2HYXA 1W6OB 2P6HA 2R063 3BPSA 1RUE1 4Y5Z0 1VBE1 3J26N 3NV4A 1O91A 2R32A 2WFPA 3VV1A 1PZ9A 2QVSB 3HEIA 3OUHA 1JZ6A 1OOPB 2JIJA 3ZOIA 5D21A 4RR3C 5A3NA 1FOD2 1NY71 3QH7A 1OVSA 1JTZX 5GKAC 2AGSA 1C8M2 2W2IA 3J7MA 5JZGA 1HQWA 1ND3B 2D43A 1S55A 3MLJA 3O14A 4FFHA 4GZ9A 4HVRA 2ZXQA 1AXKA 4KQ7A 4AEDA 1ZBA3 4P5HA 4W6XA 1W8WA 3ZN5A 1AYM2 1FOD1 1BMV1 4R8HA 4CU7A 2SLIA 1YQ8A 3BPZA 3JD72 2EALA 3ZN6B 3BOPA 1MPXA 3U10A 1MZ5A 4LBJA 4XJ8A 4A6OA 3ZYRA 4QX5A 1LHWA 2WT2A 1RUI2 5LK5A 3I2JA 2XWBB 4IW3A 2CY6A 4BLJA 5BNNC 1K5JA 4RQPA 4AVCA 4ET7A 3AC0A 4PF1A 2OPWA 4YYOA 3WF2A 3VZKA 4AFMA 1DGRA 2GN3A 1XNAA 3JD71 3UGFA 1NE4A 1Q56A 5A7WA 2WZPP 4DUWA 4YRDA 1SLLA 3IWZA 3USUB 5BUVA 2O14A 3B9IA 4FCAA 1Y9QA 4XBQA 1RUI1 5JUVA 2A6WA 2XMLA 1AL0G 3LE0A 3M7AA 4CXXA 3PUIA 1CD3G 4QXKA 4CUAA 1CAVA 5HCAA 2PAEA 2J1SA 2HWD2 3HQXA 4RS5C 4XQWA 5C3QA 1BVVA 1R1A2 2C9KA 1ZRCA 5FUPA 4NRQA 2AENA 3TBDA 1WLTA 4PT6A 4LO8A 4CEWB 2X05A 1UL9A 5A32A 2VMHA 2G9ZA 4IEQA 4AYUA 5KHIA 2ZX4A 1K5MA 1N1VA 3TEYA 2WT1A 2RJKA 4Q1RA 5K8SA 2YPJA 3GJBA 4XCBA 1BEV3 2AUYA 3PU3A 5IVFA 4UBGA 3OPWA 2A70A 2ZX0A 3ZYFA 2WSVA 4YW4A 2HWD1 2X5IC 3EB7A 1PO21 5J48A 2W52A 4YGCA 3S7EA 5KHJA 4XILA 1F15A 4GB32 1SLAA 4Q0PA 5CVRA 4CDQB 5C4WA 2A7AA 1MS5A 3M8LA 2RM23 3RS6A 4QPIA 5FFOC 3JB4C 2GNTA 3PMEA 2VZOA 2WNEA 1E5IA 3U14A 4GB31 3POYA 2A73B 4N7UA 1G7YA 1XC6A 1N1YA 4X8PA 1R1ZA 2DVGA 4IXLA 1O4YA 4Z07A 3RG0A 2DBIA 3DKQA 5FO7B 4LBQB 5IAXA 2P3YA 1O7FA 4M0NA 3V65A 2K46A 3ZSEA 5A3WA 3WHTA 3DYOA 2WC2A 1W9FA 1ULPA 3E5XA 4DRRA 5CFDA 3AMHA 2AEYA 3BN6A 3HN1A 1UZ0A 1F5JA 3VDDA 4QXHA 2FDJA 4PIYA 2ZOEB 2RDSA 1GMMA 3HNBM 3LDKA 3PL0A 2R043 4JGZA 2P17A 5EFUA 3GCXA 3J7HA 4UW4A 2F17A 1RJ8A 3NNLA 5BPXA 4Q4W3 2ZCWA 3PLQA 2PQSA 4FVVA 2B5HA 4WVZA 1PGL2 4L0PA 2X29A 1TZOA 4UYBA 3U4SA 3PUAA
chains in the Genus database with same CATH topology
2PA7A 1SFYA 3VKOA 4LHKA 4N9IA 3EHKA 1KRIA 5C9AC 4XF1A 4JGYC 4XQ4A 5C8CA 4CDWB 1D2SA 4OUMA 2WNUC 1PIV1 1PGL1 1AXZA 4Q4V3 2VW1A 4YVSC 4C1XA 4B4QA 2GZWA 1F9KA 4MVTA 1QQP3 1W6QA 2D6OX 4FTBA 2V5YA 4GMP1 4XHXA 5GLWA 5FPZA 1WLDA 1CJDA 1QH6A 4HKOA 3AJZA 2VY0A 4DXZA 3VBFB 1WGPA 4P9GA 2RS51 3AP7A 5CFCC 5DDJ3 4PCRA 1W6NA 1R083 1F2NA 2TEPA 3EBRA 4XF0A 3R6SA 3CJIA 4JDNA 1G9BA 1UU6A 1YXWA 3VZOA 4YW5A 3AP5A 3NSTA 5DZEA 3KLSA 3OGGA 4DPNA 2WFF2 1HXS3 4WV8A 4RA0A 5JOYA 1CJPA 4F3JA 4TYSA 2XJTA 1Z78A 4XBNA 3MFCA 3RPQA 1LB2A 4CP1A 3QOPA 3FLRA 4N53B 4AG4A 1DDLA 4AI1A 4HPKA 3WHUA 2R072 4AVVA 4HBNA 4LBQD 3VKLA 1Y3TA 5D8AB 4JDMA 2WFF1 1TME1 3RQ0A 3RYKA 3ZXGA 5FLJA 1DGLA 3D0SA 1CN1A 5KXCA 1ALYA 3DPRA 3VZNA 4AW7A 2R071 1KD7A 3AZWA 5IUQA 3UJOA 1J1LA 2CNAA 3QCWA 3TRSB 4FP3A 4H7LA 3LAGA 3AMMA 4CEYC 3FFQA 1MVQA 3R0RA 1Q3EA 1LGBA 4LBMA 4CDXA 2IWGB 3O12A 1U0AA 2ARXA 3CU7A 3JUUA 3GBFA 3A0NA 2PELA 2C1FA 3DV8A 1F8VA 3A0KA 3ES4A 3GHMA 1RHI2 1J3RA 2ZAAA 3P3NA 1UKRA 3MICA 2BWCA 2JD4A 5FAXA 4NN0A 3PTYA 3GF6A 4B7KA 3WG1A 5C8CC 2VNRA 4XBLA 5TSWA 1RHI1 3VBOC 4LO7A 1AR73 1V70A 4YM0A 4TZDA 3ZFGB 2UURA 3B3QE 2O1QA 2Q5TA 4I30A 3JB8A 4Q0UA 4F8AA 1RUF3 2BNMA 1OI6A 2DWRA 2XWJB 3ZIWA 2ZGUA 3M3IA 5K0UA 3NJZA 2GH8A 2R1DA 2RMU2 3D0JA 2W08A 2ZPXA 3ZFEB 3B7MA 2GNDA 1ENXA 3ATGA 1YRZA 1QU0A 4PJYA 5FREA 2DVDA 1SLIA 2GU9A 3ZMOA 5FCCA 2EXIA 1ULFA 4M00A 2RR12 3ZYJB 1ONAA 2BVVA 2QZ3A 3FX3A 2E7QA 4R9BA 4R52A 1PK6B 3JBG2 1NLSA 2RMU1 1RUOA 1RUC1 3GZAA 3VKNA 2HWC1 4MXWB 4HVQA 1VB4A 4QMAA 3WOGA 2N7GA 2O8QA 2E51A 2ZX2A 4XJWA 5A3LA 1ULDA 1MR5A 2RR11 4AQTA 3FLTA 3KT7A 3JBG1 2PHXA 2PLV2 1LESA 1UZYA 4FXGB 3JZVA 1WMEA 4WM8A 2GAUA 2FQPA 1RINA 3KS7A 4CZSA 5F5QA 1LHNA 3K51A 4RFT0 3VBSA 4B29A 1KDKA 2JDZA 4N43B 1DU3D 3IDCB 2HJIA 3ZSLA 2Y38A 4YZ5A 1KS5A 1ZREA 2PLV1 3INAA 2Z79A 3I2DA 3I4IA 2PN5A 3MW2A 4XFGA 4CP2A 4KWJA 1RMU3 2WZR2 2NQYA 3FJSA 3PJQA 3ENRA 2G4IA 4YM2A 4DMIA 1ZZCA 4IETA 4FO9A 4AEJA 2XJQA 1COV3 3Q9OA 5KXBA 4GWMA 3MIFA 2VVFA 4GA9A 1C3HA 2WZR1 1MVEA 5GZEA 3RYPA 2WNVA 5JSOA 1WLCA 2F6BA 2XBO1 1B35A 1H8TA 4C1WA 4D7TA 5LRRA 2ZMKA 2RS33 2JG9B 5KHHA 3SITA 4A7KA 4S2FA 1MZFA 1DQ6A 5FLIA 4RGGA 4LEJA 1PGW2 3HT1A 3FLPA 3KGLA 1WD3A 2UYAA 2ERFA 3LSEA 1PO12 1W6MB 4OI4A 4CDUC 3NAPC 1VRH1 3UKTA 3AXDA 4WZCA 2WQZC 1J3PA 1YO8A 2GALA 1XNDA 4XIKA 5FPXA 1A3KA 3IMNA 2DUQA 1PHMA 3M70A 4PLNA 2ZGSA 4QQLA 4U36A 1T6GC 2XLAA 3DGTA 2B45X 1OD5A 2I45A 2VUJA 4DY5A 1WBLA 4GXLA 1S1AA 3UJQA 2W39A 1X33A 5JWPA 3J8F2 2VG9A 1EV13 2NZ9A 1PVXA 1DQ2A 4V1PA 3JQXA 5L7OB 2FMDA 1NCQC 3KQRA 2R0FA 3JCIA 1JXNA 5CIRA 4FPHA 4KH9A 4Q0QA 1Q5OA 3J8F1 4FSJA 3JU9A 5IK7A 3ZXDA 1I3HA 1PVC3 2DCTA 3VKFC 2YC0A 1FV3A 5BNOA 3O0WA 1MS3A 1REFA 1PM7A 1KJRA 1DGWX 3M3QA 1GQGA 1QHDA 3CF6E 2B7YA 5E16A 4BOWA 5C33A 5EZWA 3V0BB 5EWSA 1TMF2 1UIJA 2EF6A 4YW3A 5IK5A 5CNAA 4C91A 1QJY3 1CAUA 4A7YA 2HWE2 3FZ3A 3IPVA 1O4ZA 2JX9A 1RUH2 2XJSA 4UXAA 5KBFA 2CGOA 1KXGA 3K48A 1PZ7A 1TMF1 4GH4B 5ACA3 3U0ZA 4P9YA 3WDUA 2R30A 2HWE1 3JQWA 4IV1A 1RUH1 3GHNA 3ZMNA 2ZJCA 4XF3A 2I2SA 3AX4A 4HK9A 2VW2A 3ZSJA 4EROA 4XFCA 3B5LB 1AF9A 2ZHNA 3U11A 1NCRB 1VJ2A 3N35A 3OYWA 4XJAA 2EVXA 2UWAA 1IPKA 2WIIB 2FMYA 1IZ3A 2PAMA 4S2HA 4DRVA 5H9SA 1JW6A 1EPWA 2CV6A 3L2YA 2HEWF 1RTVA 5J36A 4YW2A 3L9JT 1UCXA 2VMGA 5BYNA 1X50A 4Q2FA 2OA2A 1QNYA 4MUVA 4Q4X2 4AE2A 1XE8A 1LOCA 4GALA 4K7JA 4Y20A 3OY8B 3ZFFA 3MDPA 3H3ZA 1BBT2 1AYN1 1V6LA 4ZU4A 3ZN4A 2P3JA 1FPN3 1QGLA 3MIEA 2QZ2A 2UY9A 1V6MA 4KWKA 1EAH1 1HRV2 3IDEA 2ZABA 3IBMA 4Q4X1 1RUD3 3VHPA 4QPGB 3N3HA 4XE9A 4LBOA 1BBT1 4FPJA 1RUG3 2UWCA 1HKDA 5ABJA 4YGDA 1QJU3 3AKSA 3HMYA 3WT3A 3BODA 1HRV1 3VBHA 2OUJA 1H30A 2G9FA 1ZBE2 3GNEA 1YFYA 3C3VA 1DQ1A 5I8SA 4IEZA 3RMXA 4WM7C 3M3OA 3NWKA 2EXJA 1R092 2WWSA 1UAIA 4YM1A 3WDWA 1S0FA 4E2SA 4FPCA 2HWF1 1O3SA 5AC91 3I8TA 1VBC3 1ZBE1 4HKWA 3MYXA 3U4XA 4NVPA 1ZM1A 4RR3A 1R091 1RUE3 2MEV2 2X8KA 2QFEA 3HIFA 1QNWA 1ZYBA 1IS6A 2BFUL 2UY8A 4BCUA 2B9UA 3DL3A 3R4SA 1APNA 1GZWB 3VBRB 1WW6A 5L7OC 1FAYA 4K3UA 4RHV2 1IGOA 4XOGA 4U2AA 1MZ6A 2MEV1 4Y1ZA 5CBLA 1AR82 1D0GA 4IERA 2GMMA 3KD4A 1FOD3 2VOVA 1XRUA 5DUWA 1UPSA 5BNNA 5KHGA 4WVMA 5HBAA 1OFSA 5I0TA 1NOVA 3GYDA 4LE4A 4BH9A 1J59A 1V9U2 4P9LA 1AR93 4MGIE 4I3PA 1W6PB 1AR81 3ZXAC 5E8AA 3ETQA 1VB2A 4MLOA 1GSLA 3G6JB 2IC1A 3VHRA 2FZ1A 1LULA 3KT4A 4C0BA 3I54A 1Y7BA 3ZXJA 3A4UA 4CRQA 2TBVA 3PVBB 4RS5A 3ZXFA 5J98B 2DYCA 2ZGRA 3H7YA 4G3YC 4JRAA 1RITA 1LR5A 4WVVA 1UW8A 3PHMA 3MIBA 3APBA 2XL9A 1PNFA 1YIPA 2QUOA 4KU7A 2X5IA 1WBFA 1GZ9A 4I09A 1LOBA 3RWNA 3D6EA 1QDOA 4BQ1A 1DZRA 1PO23 5HCBA 3SCGA 1RUNA 4YG0A 2ZX1A 3B69A 4HZFA 3MI8A 2VQAA 1X8EA 2NMOA 4XMIA 2JENA 5JZGB 3MW4A 2HWB2 3LKJA 4W6WA 2V73A 2ZGLA 4AEDB 1N3OA 4FOWA 2ZA9A 1OKQA 4LR4A 2XB6C 3ASIA 4XTMA 2PHUA 3OBTA 3WQ7A 4NO4A 4UW3A 2ZHKA 2BW8A 3GBWA 4HL0A 2RHPA 4ONUA 1OQDA 2IXCA 4XDQA 4ZU5A 1TQ5A 2LALA 4RQPB 4B4RA 1SLBA 2ZBJA 2EA7A 3LA7A 2EAKA 4IEUA 1WA4A 3E5UA 4OLLA 1DZQA 4R4XA 4UW6A 3RDIA 2IFWA 2VOXA 1Z0HA 1C8M1 1N47A 4BHPA 1CAVB 4Q8LA 2DF7A 2R0HA 5C9AA 1I5ZA 5BNQA 1S0DA 4JGYA 5A32B 1BK1A 3ZYIB 3MIGA 4L97A 1AYM1 1K5MB 2WNUA 4AHZA 3SH5A 4M0HA 1NA1C 4NOTA 4YVSA 3WDYA 2NN8A 2RJLA 4FPOB 3PMSA 1S0BA 2VMIA 1PIV3 4XQDA 3D5OA 1W0PA 1JUIA 4AK3A 5C4WB 1MQTC 2ZACA 3BALA 4Q4Y2 1WMFA 4GMP3 3H8UA 4QPIB 5BNPC 5CFCA 3R4UA 4XPVA 3WZ1A 1RB8G 1CQ9A 4FT8A 1SQ4A 3CJXA 2RS53 4YGBA 3SCHA 3SXWA 1GANA 4Q27A 4IEVA 5BV6A 1CX4A 1CPNA 4XFHA 5T55A 3RMYA 3SH4A 1R1A1 5HCFA 2EXKA 5I8TA 1ZZ6A 5DZGA 1VAVA 1XU1A 2P3KA 3CLPA 5E88A 2ZKNA 4YZ4A 4PBOA 4AI8A 5F6LB 5CFDB 4HN0A 1SDWA 2Y26A 4ZKTB 3VDDB 3LOIA 4DNYA 1X8MA 4JGZB 1Q8OA 3DKWA 1TME3 2WL1A 3B93A 3NKGA 5FMOS 2R062 2ZKLA 4YGEA 4CEYA 5I0UA 4OI1A 1HLCA 5B2GB 1UZZA 1XNKA 4YLZA 4GMP0 5CU1A 4I2OA 3VBUB 4COYA 1GLHA 1BKZA 5T50A 4UBHA 3WP5A 4YM3A 3N7LA 1W6QB 1ZBA2 1LU2A 3WG2A 5BY5A 4IV3C 5GM0A 2BNNA 1RL3A 4FPFA 4COVA 1JYIA 4K1YA 2JKBA 3GZTB 5CB7A 2B39A 2JE9A 3BB6A 3LOBA 1WLWA 1W6NB 4YARA 1ZBA1 4HKLA 5H9RA 2H0VA 3VBOA 2OPKA 5A33A 1WW5A 1AVBA 1RHI3 4K40A 1LOGA 2Q1MA 1ZA4A 2WT0A 3PJYA 4LULA 1JYCA 4HPKB 2AREA 3QH6A 3TB0A 3ZX7A 1G9DA 5DXDA 1OOPC 3FUQA 2BTVC 1AL22 5J7MA 2WJSA 3B02A 4PLMA 1I1EA 2I74A 3H0OA 1C1LA 1DGWA 3NO8A 1WCKA 2ZS6B 3RJ2X 1ND3C 4O9GA 3DPRB 4GWNA 3O0VA 1AL21 4CTEA 1AUYA 2G9GA 4GKYA 5LK7B 4SLIA 4OHZA 3CNAA 1RUC3 1O3RA 2YY1A 2HWC3 2R16A 2H0BA 2RM22 4CDXB 1OQ1A 5T5JA 4E27A 1EYBA 3TNQA 4ZU7A 4MGKE 1YWKA 4ATEA 1OMIA 1TNFA 3DF0A 1AR63 3AP9A 1W39A 3ZVXA 1CR7A 5T5PA 3UV9A 3JBG3 5I0SA 1OLQA 1ZZ9A 2RM21 3WLUA 4Y24A 1A8MA 3WR0A 1LECA 1MS4A 1QJX2 3WDVA 5LRSA 4Z82A 4Y1VA 5JVVA 4H55A 2IFRA 1GNZA 3M4FA 1DQ5A 3HR9A 3TN92 2VH9A 1TE1B 2PLV3 4CEWC 2MPFA 4HETA 4E2GA 1QJX1 2WS93 4Y22B 4YFZA 1UIKA 4P14A 2SBAA 2A6VA 3FBYA 1LODA 3MF9A 4L2NA 2CL2A 3TN91 3VN4A 1VR3A 1GICA 4X6QB 2YYOA 4OI2A 1G9AA 2JG8B 5JIAA 4CDQC 1XU2A 1OFNA 3T1LA 2UU8A 2WZR3 3GBGA 4AI2A 1LENA 5JOZA 3AZZA 2XBO3 5F1RA 3ZXEA 4Q0VA 1M06G 1KFXL 1HDKA 4CDUA 5GZFA 4Q4V2 3NAPA 2WA4A 2CWSA 2IXHA 2XLGA 5KXDA 1QQP2 2CGNA 4AHYA 3MPBA 5E89A 1VBD2 1VRH3 3AP6A 4HFSA 4NHMA 3OD4A 4MXVA 2BFUS 2JICA 3H3UA 3AFGA 4FOVA 2MNGA 2R49A 3VBUC 1QQP1 3H1YA 2XKPA 1RUJ3 4WM8B 3EQEA 4IEWA 1VBD1 4LLOA 4MYEA 2VVDA 2O0OA 1S0IA 4YNIA 3VBSB 4LT5A 1HXS2 2NMNA 3IKWA 1VIWB 3WINE 1UU5A 1KJLA 4IEPA 4YVWC 3ZSMA 3RI9A 5HI0A 3S6PA 2XVLA 3B9CA 1SBFA 2YROA 1NCQA 4XEZA 5AVAA 1XYPA 3FHIB 4CDWC 1YFUA 1S0JA 1NE6A 4DOUA 2FHRA 3WP6A 3H9AA 1LTEA 2CYFA 4M01A 3J8F3 1QF3A 4QD2A 1SLTA 2WNVB 5DG1A 2ZGTA 4AGGA 3KZ4C 4Z1VA 4QQOA 1B35B 1H8TB 3MFAA 1AZDA 3VBFC 5KWRA 4RL7A 2B42B 5JPMB 1QH7A 2NM1A 2KM2A 4IL7A 4JC1A 4AQSA 2BYVE 4KG8A 3TNPB 4LA3A 3NW4A 1H2KA 4FTSA 1H9WA 1NYWA 4LBKA 4P9XA 4QHBA 1BCXA 1ZVFA 2GN7A 2GH2A 4MXWA 4BIFA 4XIOA 1WW7A 1V6KA 3HT2A 2PHLA 1FV2A 1VP6A 3AK0A 4N53C 4D69A 2VW0A 3J9SA 2OVUA 3WV6A 1AHSA 1ENRA 4YFWA 2ZGMA 4XHBA 5D8AC 1D4M3 2GNBA 5JSPA 2HWE3 4D7YA 2YGMA 4XFBA 1UN1A 1RUH3 1AR72 3MGUA 2JE7A 1LOFA 1ULGA 1AX1A 2ET7A 1H2MA 2QNKA 4AF9A 3H50A 5JDBA 1VAKA 2GC3A 1JHNA 3VL9A 1RUF2 1PGW1 3I59B 1MS8A 1UKGA 1PO11 1AR71 4BM8A 3ALQA 4HLTA 5KC6A 4BMBA 1PMIA 1U5ZA 2ZTNA 3UL2A 1HIXA 4J1XA 2D6NA 2PHTA 5JOWA 4OULA 4XYXA 2Q0AA 4Z8BA 5F9TA 5IK4A 1SBEA 4AFCA 3J4UH 3ZYPA 1FNYA 2JG8C 1CAWA 2OW4A 2WINB 2RS12 1ASJ3 4PF5A 4KWLA 2R1BA 3WG4A 2GMEA 1KDMA 4WVWA 1AYN3 2FBEA 3KCCA 4CYDA 2PQQA 4M3CB 1EAH3 4XETA 2BGCA 2PHWA 4P9WA 1CAUB 3RSJA 1S2BA 3WP4A 1KITA 3IPVB 1W6MA 2RS11 1XE7A 5KXEA 1GNHA 4SBVA 3ZFGC 5JPNB 1BBT3 4KG0A 4B3NA 4FBFA 2VOWA 1U12A 2DFCA 1HRV3 1D0HA 4WM7A 3MF6A 2QQPA 2A3XA 2ZZQA 2VNOA 4GKXA 4IV1B 3ZFEC 1RMU2 1FMD2 1LGCA 4LA2A 4DY3A 4FTEA 1A8DA 4DQAA 5KC5A 4HN1A 2HWF3 1PK6C 3OYWB 5AC93 1COV2 1E57A 1ZBE3 3EJKA 2D5HA 1A78A 1FMD1 4BA6A 3IDBB 4IESA 4AEMA 5GLUA 4A2UA 1R093 1HRI2 2ZHMA 1VBB3 2ZGNA 1YJLA 1SMVA 3AZXA 3MLLA 3UK9A 4AHXA 5L7OA 3VL8A 4MX3A 1OA4A 4MSVA 4Q0SA 4HT1T 2WSUA 1COV1 1O3TA 2ES3A 4F83A 4K21A 1LRHA 3WD5A 1IPJA 4S2DA 1LOFC 3ZFFB 4Y20B 4MZUA 1HRI1 4HSLA 2E53A 4N43C 3EXUA 4W6YA 5I93A 3B01A 4RSUA 4NWWA 4IQPA 3V0BA 3NV1A 5FO9B 5DUVA 1SEFA 3RYRA 4Q26A 5E1RA 4YZ2A 1AR83 4NPRA 2D5FA 1LHVA 3AP4A 4Y1UA 5ABJB 4R9CA 4FAHA 4MV2A 4RD7A 5C6CA 4L11A 2GC2A 4PDWB 4B7EA 3AMPA 3H1MA 4R4ZA 1J3QA 2ZMLA 5JI9A 3M2MA 4EJRA 3AB0A 2HKXA 3T2TA 2JG9C 5I91A 1AX2A 1DF0A 4HK8A 3O0XA 2UYBA 3LSDA 1RC6A 5DUUA 4MH0E 2ZZJA 4QGMA 2ZGQA 2EAAA 2K9ZA 1HV0A 2BEOA 1Q8SA 3WP3A 3MIHA 1EP0A 4KGQA 4XTPA 1GBGA 1H0BA 1YHFA 5K9YA 3D82A 4L99A 4LUKA 4XFAA 3WXPA 5JAXA 1TNRA 4Y1XA 1QJY2 3FUOA 1SCRA 4BZ4A 1JN2P 5BNNB 1DFQA 4FPEA 1VBE3 3WDTA 1QXRA 3QD6A 4KU8A 4UW5A 2DUOA 1HW5A 4G4FA 5J96B 1WW4A 4FPGA 1LOEA 1FI2A 5ACA2 4E2QA 2WA3A 1ZZ7A 5GLVA 1Z7S2 1JBCA 2BNOA 5FQ0A 5FBZA 1X7NA 4R9AA 1OQEA 4Y1YA 1DIWA 2P2KA 1UX6A 1ND2B 4N9HA 3V0AB 1B09A 4RS5B 2C5DA 4EV0A 2PHRA 5D1IA 3IN9A 1C8M3 4ISQA 1Z7S1 4LNVA 4JV4A 1C28A 4XJ9A 1C57A 2XJUA 2A3WA 1O4TA 4P9JA 1NA1A 4RHV1 1V6IA 1BQPA 4QQ2A 4YSFA 1J1TA 2X5IB 1AYM3 1NQJA 2HYKA 3FFZA 4N7IA 2XJRA 4JTNA 2JECA 3JD73 5LEKA 4J1WA 1MQTA 1W0OA 1G8WA 4H14A 1DYPA 1V9U1 3BOWA 4ASLA 3HWJA 1RUI3 5BNPA 1IQAA 3PVNA 3ROUA 5L36A 4E4SA 3TYJA 1JUHA 5GZGA 2D6LX 3NVCA 3WY6A 2XJVA 3THPA 3WG3A 5JIUA 1V6NA 4GH4C 2OYZA 2IXKA 3OGJA 4YZ1A 1G86A