2AENA

Crystal structure of the rotavirus strain ds-1 vp8* core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
164
Chain Sequence
TVEPVLDGPYQPTTFKPPNDYWLLISSNTNGVVYESTNNNDFWTAVIAVEPHVSQTNRQYILFGENKQFNVENNSDKWKFFEMFKGSSQGDFSNRRTLTSSNRLVGMLKYGGRVWTFHGETPRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer capsid protein VP4, VP8* core
publication title High-resolution molecular and antigen structure of the VP8* core of a sialic acid-independent human rotavirus strain
pubmed doi rcsb
source organism Human rotavirus a
molecule tags Viral protein
total genus 45
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2aenA01
4YZ1A 3N7MA 2EAKA 5IK8A 2B7YA 4YGBA 1ENRA 1LOFA 1JYIA 1GLHA 1D0HA 1FNYA 2AREA 1DHKB 1QF3A 4BM8A 3I8TA 5T54A 1QNWA 1BXHA 3POWA 2DVDA 2EXHA 4XOGA 4Q2FA 1LEMA 2NMOA 1G9BA 1S0FA 2WSUA 1B09A 4M3CF 4XIOA 4FPLA 2UU8A 4FOYA 1BJQA 1FV3A 3AJYA 1LENA 2VW2A 2A3WA 1JYCA 1QMJA 1V6IA 3MW3A 1CPMA 4ASMB 4ATEA 4XIKA 4Y1YA 2R49A 1AZDA 2A5ZA 1Q8PA 2R0HA 3IPVA 4XILA 3W58A 2XB6C 4FPKA 4XHXA 1FYUA 3ILRA 4BQ1A 1AVBA 3WDTA 1SLAA 2RHPA 1WW6A 2ZGQA 5HCBA 3TB0A 3AP9A 2ZMKA 1PZ8A 2DUQA 1GV9A 4FQZA 1X50A 4UW5A 4XXPA 1NXD1 3N7JA 5DUXA 3AYAA 2JECA 4LBLA 4XDQA 1QKQA 1V00A 3UL2A 2I2SA 2DV9A 2Z42A 5KXCA 4TYSA 4YZ5A 2AYHA 5DZGA 2DTWA 1DQ5A 3WDYA 4YLZA 1A3KA 2ZGNA 3FBYA 2ZMLA 3WDUA 2ZBJA 1O4ZA 2D3SA 2ZGTA 4BMEA 2JE7A 4FP2A 4BLJA 2OUJA 3WUDA 4XHBA 4C1WA 2ZGLA 5KXBA 5DUVA 5JMCA 3L2YA 4GWMA 4YM1A 2DVBA 1N47A 4R9BA 1N1TA 3MEPA 5GZEA 1G9AA 4LBQA 5IK5A 2ZZJA 2A75A 4P9XA 1FATA 2VUAA 1LHVA 3WNXA 2A6ZA 1CPNA 5HCAA 3JU9A 1QGLA 1MVEA 1SCRA 3MW4A 2GNTA 3VKNA 2D6OX 3RQ0A 1AXKA 3OYWB 2JKBA 3V0BB 3VKFC 5DUWA 1SBEA 4YM2A 1IS6A 3B3QE 2BQPA 3WV6A 1DYKA 2D6NA 1YXWA 5T5PA 2C9AA 1GKBA 1F31A 2VXRA 4K20A 1CVNA 2WT1A 1W6QB 1F9KA 1FAYA 4XJZA 1AXZA 4XJAA 3UK9A 2WQZC 2ZGOA 1JUIA 2JD4A 4YGDA 1RITA 2D43A 4R9CA 1V6NA 4NOTA 2E7QA 4XXAA 4GA9A 1OFSA 4R9DA 3N3HA 4BLIA 2ENRA 3FLPA 5GLWA 1GNZA 3BODA 4XJWA 1CQ9A 1S0BA 1CONA 2JJ6A 4Y24A 1DBNA 2A3YA 2ZGSA 2ZHNA 5CB7A 1IKQA 4F83A 1MS8A 2GNBA 4ZKTB 4YM3A 2A70A 2ZGRA 1MR5A 1Q8VA 4AGRA 1HQWA 1XQNA 4C1XA 1Z0HA 4P9YA 3SH3A 1CN1A 1S0GA 3D5OA 2EF6A 1MS5A 2DYCA 1SACA 2GMPA 5GLTA 5IT6A 3GNEA 2JDZA 1LHNA 1LESA 3PJQA 4JCKA 3NWKA 3ZSMA 1Z78A 4CRQA 2D3PA 3NV1A 5JOYA 1MS9A 1W6NB 1N3QA 1GNHA 1W6OB 2D6KA 5DG2A 5KXEA 1GICA 4M00A 2AENA 3WDWA 1N1SA 5H9PA 3OJBA 2G4IA 1BZWA 2GNDA 1V6OA 4FQ4A 4LBNA 3VKMA 3ZVXA 4TZDA 1V6JA 1LGNA 1A8DA 3O5SA 3WDVA 4YGCA 1G8WA 2E51A 2SLIA 4SLIA 3RSJA 1QDOA 1RINA 3U4XA 3FFZA 1HKDA 4GKXA 4XJ8A 1DQ2A 1OKQA 2FHRA 4YG0A 3IM0A 1CJPA 2PELA 3FLRA 2ZHLA 1LHUA 3CNAA 2WKKA 4PQ9A 2DVFA 4MYEA 3N7KA 3T2TA 4FPOB 2R1BA 1RIRA 2AUYA 5GLVA 1PZ9A 3O12A 2ES3A 1Q8QA 3AXDA 3LCPA 5GM0A 4DFSA 2D6LX 4K1ZA 2CYFA 4DRRA 1SLIA 4XZPA 4YW4A 2NYYA 1DLLA 3V65A 3WDXA 2GDFA 3Q9OA 1S0DA 1LJ7A 5FRAA 1URXA 1UN1A 1WUVA 3T1LA 1TEIA 3OYWA 3POSA 4Q26A 3V0BA 2PHWA 1KRIA 5IUQA 3AP7A 3WG1A 5H9SA 2E53A 4AGVA 3R05A 4FP3A 1MS1A 1GZWB 4XMAA 4JC1A 2GALA 1LU2A 4GXLA 4NO4A 1FV2A 1LCLA 1WW5A 3AZZA 3WHTA 1W6PA 1W6QA 2YZ4A 4YZ2A 1YRZA 2E7TA 1VAVA 4Q8KA 1C1FA 2D44A 1AX0A 1KQRA 1VIWB 1WW7A 3ZYPA 4Y26A 3POYA 5GLZA 2P3KA 1GZCA 1LOCA 1QNYA 3WCSA 3UJQA 2R0FA 3ZXEA 1WLDA 4Q1RA 1QOSA 4LBQD 4D69A 1DFQA 2V5YA 3RMXA 2KM2A 5DZFA 3M3OA 3LSEA 2P3IA 3APBA 4AYUA 3FLTA 2CWSA 2A3XA 4LBKA 3M3EA 2PHXA 4BPZA 1AJKA 1MS3A 5IK4A 1ULEA 2VW1A 2TEPA 4ATFA 2NP0A 3N36A 4JRAA 1MS0A 2PHRA 3MPPG 1GSLA 1LEDA 1W6NA 3OBRA 4XE9A 1W6OA 1CR7A 3AXEA 1SLTA 2OVUA 3AZWA 2D6MA 4FOQA 4Y22B 5EYYA 1WBFA 1ENQA 1UPSA 3ZPYA 3FUQA 1UL9A 1QOTA 2C5DA 4YFZA 1VALA 2V73A 4XJ9A 3ZSKA 3KM5A 1SLLA 4WZFA 1S0JA 1F5FA 1UMZA 5AVAA 5JLVA 1HLCA 1W6PB 4M01A 1DYPA 3AZXA 2EALA 1Q8OA 1QDCA 1WLWA 4RA0A 1ZM1A 2WT0A 3B9CA 2AR6A 1IS4A 2OW4A 3LSDA 4UW6A 5GZDA 2A6YA 1SCSA 2YXSA 3AFKA 5JDBA 1ULCA 3NV4A 4LBJA 2WSVA 4WVWA 5GLUA 4UW3A 4DPNA 1A78A 3WG3A 3V0AB 1UKGA 3AP5A 4PBPA 3KQRA 4FVVA 3QLQA 5F9TA 1S0IA 3OY8B 5LK5A 1UAIA 5CNAA 4YW2A 1LGCA 1BQPA 1UX6A 4AWDA 2NMNA 1KJRA 1OQ1A 2UURA 5JOZA 1ULGA 1IS3A 2VW0A 4GKYA 5T5LA 3M3CA 4HL0A 1DIWA 2A7AA 1V6MA 5EXOA 1MS4A 3B69A 1G7YA 2GN7A 4Y20B 3AYEA 4P9WA 1FX5A 1DQ6A 2VU9A 1H30A 3M1HA 2ZGMA 1LOBA 1GZWA 1SLBA 4M3CE 4YG3A 1AX2A 3PVEA 4FPYA 1WCSA 1ZA4A 2R16A 5L73A 2ARBA 3A0KA 2A6VA 4XBQA 1LHOA 4Y1UA 3VKOA 2P37A 2OUHA 4ISRA 1CESA 2YY1A 2ZHMA 3HMYA 5CA6A 2GMMA 2A71A 5JVVA 2AH2A 2CL2A 1U0AA 5CBLA 3VKLA 3ZYRA 3BOPA 3M2MA 2DUPA 1ULFA 4YW5A 3SH4A 1V6LA 2NN8A 4PBOA 3INAA 3A0NA 2DVAA 4XJUA 1UZYA 2HYKA 2UWBA 1W6MB 3D4KA 1UZZA 2P2KA 4FPFA 3N7LA 2PHUA 3O0WA 1N3PA 1S0EA 3QCWA 1S0CA 3OPZA 4PF5A 4XTPA 3ILFA 3WVJA 3DUIA 4HANA 3AP6A 3N35A 3WOGA 2YMZA 3WUCA 3MW2A 3WG2A 3SITA 2A6XA 3PMEA 1WD4A 2ZGPA 2R1DA 4Y1VA 2PHTA 5DUUA 3RS6A 3ZSJA 1AJOA 4M3CA 1W0OA 1YIFA 5KXDA 1IOAA 1MVQA 3AJZA 3AYDA 2WJSA 1LOEA 1LOAA 3PVOA 1JBCA 2JE9A 4ITCA 1HQLA 4RL7A 4Y22A 2H0BA 1G9CA 3IN9A 3AZYA 3WZ1A 3B01A 4AVTA 2ZA9A 1LOFC 4XBLA 1LTEA 4YG6A 4I30A 1WD3A 2D6PA 2WT2A 2VH9A 5GALA 1ULDA 4YGEA 1KDKA 1BKZA 1SLCA 1JXNA 1YI7A 2LALA 4OZXA 2E6VA 4YW1A 3VV1A 2ZHKA 4WV8A 4AVSA 4Y1XA 4DS0A 2CNAA 5SV8A 5T5OA 3R4SA 2YV8A 4W65A 1C57A 2LTNA 3IMNA 4XMIA 4Q27A 2AGSA 3B00A 4Y1ZA 4YW3A 4PCRA 4YM0A 1N1YA 3I4IA 5GZCA 2ZGKA 4R9AA 3V0AA 2W39A 1VAMA 1JHNA 1SBFA 3UJOA 1LU1A 5FREA 3AYCA 1GYKA 3OY8A 4DRVA 2CY6A 2DVGA 5H9RA 3IKWA 4Q1PA 2EXIA 3AZVA 3BIWE 3RRDA 2EXJA 1LECA 3AX4A 2SBAA 3HN1A 4ZXKA 1O4YA 1QU0A 4IQPA 4K1YA 5JOWA 3AK0A 2WNEA 1BYHA 2XG3A 5T50A 1IKPA 4M3CB 1R1ZA 4ISQA 1G86A 4Y20A 1LGBA 3VUOA 1ENSA 4KBBA 2DTYA 1KITA 4UW4A 1CIWA 1Y7BA 1YYNA 2FMDA 5IK7A 2ZACA 4CZSA 3ASIA 1WW4A 3T1MA 2D7FA 5EWSA 4XBNA 4U2AA 4LBMA 3ZXKA 1S1AA 2ZAAA 1FNZA 4WVVA 1N3OA 1VLNA 2W68A 5HCFA 4FPJA 2NM1A 1SFYA 1DQ1A 3ZXJA 1D2SA 2WLQA 4BOWA 5DG1A 3H0OA 1GANA 2P3JA 3WG4A 4XYXA 3GALA 3D6EA 3RG0A 1AXYA 1W0PA 2GNMA 3C2UA 1W6MA 3SNMA 5F5QA 3IPVB 1C4RA 1ONAA 1DQ4A 3ZSLA 3AP4A 1J1TA 4AVVA 4P14A 3R4UA 1V6KA 1C1LA 1EPWA 2EXKA 4Q8LA 2CTVA 1I3HA 2PHFA 1JW6A 2GN3A 2UWAA 5JOXA 1N1VA 2ZABA 5H9QA 1DGLA 3WCRA 3USUA 4FOVA 1AX1A 1DZQA 1APNA 2D3RA 4FPEA 5GZGA 1SBDA 3SLIA 4AGGA 1H9PA 2EIGA 3W59A 1KDMA 5CAZA 4Z8BA 1I1EA 2A6WA 2W52A 2DU0A 3O0VA 5E89A 3O0XA 1AF9A 3FUOA 4BMBA 3PVNA 4YZ3A 4H55A 1YO8A 3BTAA 1PZ7A 3ZXLA 2GMEA 1QOOA 1WBLA 2ZGUA 3DGTA 1LULA 3SISA 3V64A 4YFWA 1GZ9A 2W08A 2ARXA 2UWCA 1GBGA 4XTMA 2CWMA 4GWNA 3M3QA 5T52A 1LODA 2ERFA 2VY0A 3WLUA 2DUOA 2DURA 3ENRA 4LBQB 1Q56A 1LOGA 1DQ0A 3A4UA 5T55A 1MACA 5BYNA 3RMYA 3ZXFA 5DZEA 4FPCA 5T5JA 1G9DA 1JOJA 1WLCA 1KJLA 2DU1A 3NV3A 3OGGA 4FOWA 5GZFA 3NV2A 3WHUA 4U36A 4DQAA 3SH5A 3JUUA 1Q8SA 1H9WA 3HR9A 5GJ6A 5DXDA 2NZ9A 3TAYA 4LBOA 1NLSA 4YZ4A 3USUB 4FPHA 4GALA 1LHWA 4L8QA 1IS5A 5E88A 1HDKA 1MZ6A 5EYXA 1MZ5A 2DWRA 2ZMNA 1G9FA 2YROA 4K21A 3ILNA 5E8AA 2P34A 4CTEA 1JN2P 3ATGA 3OBTA 4FPGA 2ZKNA 2Q5TA
chains in the Genus database with same CATH superfamily
4Q0UA 4YZ1A 1BBT3 2P17A 1NKGA 2CU5A 2VZTA 4PF1A 5E6HA 2JD9A 4YGBA 3TRSB 4JGZA 4AEDA 5IVJA 1LOFA 5HXVA 3H3ZA 1NX9A 5IFPA 2X10A 4JGZC 2HH9A 5KC6A 1ZBE3 2W1UA 5T54A 1QNWA 3GBGA 3POWA 1XNCA 4MXWB 4XUTA 2QJVA 4L97A 4XOGA 1G9BA 1W9SA 3H8RA 1W05A 2WSUA 1RUJ2 2J1UA 2W2IA 1KXGA 1PGSA 5FP3A 4UFMA 4NVPA 2XJTA 4PIYA 3HEIA 2HBTA 4ZZ5A 3OB8A 4IGQA 5K0UC 1RVF1 1OA2A 5C5UA 2RS13 3MW3A 5HCAA 4FFHA 4YVWA 4ATEA 1C5IA 2R7EB 4ASKA 5C70A 5A7WB 4XILA 1MZEA 3KCXA 1HXS3 2C0ZA 3VBHB 2YC2A 4E2GA 3B7MA 2XLAA 4XHXA 5FZ6A 3ILRA 4BQ1A 1AVBA 5FO9B 2XWJB 3GBFA 2WS91 1F4HA 1VMJA 2DCKA 1W9FA 3OUIA 4OI4A 1NQJA 2XVGA 2DBIA 3AP9A 2RDQA 2ZMKA 1PZ8A 2DUQA 2HJIA 1SPPA 1X50A 2QFEA 4XXPA 5DUXA 2JECA 1QJX2 5E1RA 4E8CA 3OGJA 4CU8A 4YZ5A 2VG9A 3WDYA 1A3KA 3NO8A 3ABZA 3ZXDA 3IDEA 3AKQA 3UT0A 5G05L 1GWLA 2ZBJA 1O4ZA 4DY5A 2D3SA 4ES8A 4CCLA 2ZGTA 3EHKA 1S2BA 2JE7A 4LKEA 1Q5OA 4Q0SA 2OUJA 1C8M1 2P1BA 1G6NA 1VBC1 2VCMA 3I3QA 3Q8AA 3DXTA 4QX8A 4XHBA 3L2YA 4CCKA 2Y0IA 5KXBA 1N47A 4R9BA 3PDQA 1NY71 2R071 3GM8A 5I8YA 2G9FA 2Z4FA 3RJ2X 5C9AB 2A75A 3J4UH 1FATA 2D97A 1LHVA 2A6ZA 2HWD3 1OLMA 3MW4A 5JSPA 1H8VA 2GNTA 1H4GA 1ULPA 2D6OX 2G19A 4HN0A 1L7RA 1LR5A 3OYWB 4YW6A 5C8WA 3VKFC 5DUWA 1IHMA 4O9EA 1TNRA 4YM2A 3VL9A 5F1RA 2HWC2 3I59B 3B3QE 2BQPA 2W94A 1Y3TA 1YJKA 1DYKA 3HPNA 5FXWA 3THDA 3VD3A 1YXWA 3JB8A 1GKBA 4AFDA 1UYYA 3LWCA 4CCOA 1CVNA 2BDRA 3ST7A 4ORFA 1FAYA 4XJZA 3UK9A 1VBD3 3CIHA 4QDRA 4IEUA 1VBA1 5JPNB 4R9CA 3W20A 2E7QA 5EIYB 4XXAA 4Q4X2 1JUHA 5IFTA 1V9U3 4MLOA 3ZFFA 4BLIA 1ENXA 5CZKA 2QQUA 3FLPA 4GIQA 4AFAA 1AR92 3AC0A 4P9JA 1GNZA 5GLWA 4PHZA 1S0BA 2JJ6A 1CONA 5A3TA 3QD6A 2FDKA 1CX4A 2L9LA 3UNPA 4DEVA 1VBE1 2VBPA 2VZVA 2XJQA 5D8AB 2PXJA 3AL5A 4C1XA 3RZMA 2FCVA 3AB0A 1Z0HA 3DEMA 3PUAA 4LA3A 5FY8A 3UETA 3KT1A 3USSA 1S0GA 3ZDSA 1BMV1 2MHFA 2Y64A 5D21A 1MS5A 3QH6A 1ZBA1 4IEOA 2GMPA 5I0RA 1LESA 4AEJA 4GB31 5F5AA 5JIAA 2BUKA 1Z78A 3WNNA 4CRQA 2WQ8A 4OI0A 1W6NB 3RZKA 4Z1VA 4QGNA 1GNHA 3CLPA 2ORXA 1C3HA 2FDJA 2RE9A 5H9PA 4FQ4A 5BNPA 1W9TA 2R042 1H2MA 1V6JA 1LGNA 2R063 3O5SA 4IEWA 4NHLA 2SLIA 4YGCA 4Z2AA 5BNPC 2OS2A 3T0AA 4BQ4A 2NPIA 3NNMA 4N53B 3U4XA 1F4AA 1VBB2 3WP6A 3FFZA 5C8CA 1R1A1 4J1XA 4GKXA 3WNLA 2E32A 1SZBA 1OKQA 2JX9A 4K7JA 1CJPA 1ZZ6A 5LY2A 2WFF1 3AKPA 2ZHLA 3S30A 1O59A 1XSRA 4PQ9A 5CIRA 2WC2A 1OVSA 2H6CA 3T2TA 2Q8DA 2CDOA 1RIRA 2AUYA 1L3JA 2Y60A 4AFCA 4CXXA 4BQ2A 2ES3A 3AVSA 1GU3A 1W90A 5GM0A 2RM21 4CYDA 3WQ1A 4DFSA 1W9YA 5F8PA 1IPKA 1S4CA 5BNQA 4YW4A 1Y4WA 3ZFGB 4CDQA 4CXWA 1CAVB 3T08A 5JUVA 4QB6A 4QM9A 4BXSV 3WDXA 4BA6A 1QXRA 1K5MC 3Q9OA 1FT9A 4Y4RA 4OZOA 3NAPB 1UY4A 4D6SA 1UN1A 4OHZA 4BHPA 1SDDB 4LO4B 1TEIA 3POSA 4DB5A 2D40A 5IUQA 5HV4A 3WG1A 2YFUA 1GUIA 2EIBA 5BNOB 5DAQA 2VO5A 1QQP1 2BFUS 1Z7S1 3J7HA 4GWIA 4DXRA 2B4KA 4AGVA 1YQ2A 1W3XA 1AR72 1U5YA 2VCCA 1K45A 1PO12 1RUE1 4JC1A 4MZUA 4O61A 4GXLA 4QXBA 1FV2A 4BZ4A 2R6QA 2W3JA 1W6PA 1W6QA 3VZOA 2YZ4A 4YZ2A 3ROUA 1TZOA 1YRZA 2X05A 3ZN4A 2RV9A 4AXOA 1BEV2 3NKGA 1KQRA 2RR12 3MIGA 3ZYPA 4H2AA 4L9BA 4Q4X3 2P3KA 1GZCA 4MSVA 1QNYA 5K9YA 4GH4B 1AR93 3Q8BA 2K9ZA 3ZXEA 1CAUB 1GQHA 2J1SA 4E8DA 2Q30A 3RMXA 3FFQA 5DZFA 3LSEA 3HVDA 2QTWB 4WM7C 3APBA 1AUYA 3LPGA 1W2AX 2E31A 4KI5M 3WF3A 1AR61 3WNPA 4A2UA 3VBOA 4YVSA 2A3XA 3M3EA 1UY3A 2PHXA 3VBOC 2QQIA 4YVSC 3NJVA 4Y5SA 3BPSA 5DAXA 4TXWA 2HWF3 5L9RA 4HONA 1NCRA 3H8UA 4B7KA 4MHUA 4NIDA 4K8FA 1MS0A 3U11A 1NCRC 2Y6GA 5DAVA 1GSLA 2WL1A 5EYYA 1SLTA 2K0GA 3AZWA 2D6MA 2WZPP 3ZPYA 1UL9A 1QOTA 4MADA 4WZFA 4D94A 4UI9L 1PIV2 3TOJA 2DCTA 2I45A 3T2OA 1O4TA 1NE6A 1CAWA 3U4SA 1VBB3 1NG0A 2EALA 2UY9A 3AZXA 3HN3A 1XBFA 2IXHA 4RA0A 2FDGA 4DEQA 3WF1A 1IS4A 1ZBE1 2JDHA 4AE2A 4KH9A 5GZDA 2BBVA 2GC0A 4PDWA 1O3RA 2A6YA 2X09A 5JDBA 3ME2A 3NV4A 1OQDA 2XBO3 2WSVA 3BVCA 2PFWA 2YU2A 4PDWC 2TBVA 5GLUA 3ZR5A 2VL4A 3DKQA 1D7PM 1HJFA 3RVHA 4JGYA 3AP5A 3KQRA 3QLQA 4OHVA 5L19A 1S0IA 5LWBA 3ACGA 1UAIA 2RS11 5CNAA 1MEC3 1UPIA 3BTXA 1BQPA 1HB4A 2V72A 5A3UA 4L99A 4CEWA 3PLQA 1HXS1 2PLV2 1OQ1A 5I93A 4QD2A 3ZYGA 2LS6A 3UGFA 4GKYA 2A7AA 2EA7A 5EXOA 1MS4A 4MO3M 1G7YA 2BGCA 2GN7A 5KHIA 4LO8A 5TSWA 3K51A 2KA3A 4QXKA 4M3CE 4YG3A 3VBFA 2Q1MA 4FPYA 4XACA 2R16A 4COUA 2A6VA 3VBSB 2OUHA 4WVMB 4BK4A 5F5IA 3JCIA 1HV0A 5CA6A 3E6DA 3G6JB 3N9OA 3I2GA 5CBLA 3VKLA 4NHMA 5K4LA 4FT8A 3M2MA 4MXVA 2QKDA 4UFLA 4IEXA 4C0HA 3INAA 3RGBA 3A0NA 2DVAA 2HYKA 2JB8A 5LEKA 3IBMA 1UZZA 2D93A 2JDNA 1UD1A 1XU1A 3AM2A 4BISA 3AKSA 2VPVA 2PHUA 4P00B 1JYXA 2OXBA 1TVGA 2DFBA 1JZ4A 3DUIA 3N35A 2QDRA 2WAAA 2A1XA 2OQ7A 2YMZA 3MW2A 3WOGA 2VE1A 3H50A 4NAMA 5DDJ2 2PHTA 3RS6A 2XUMA 2VGDA 4WBBA 5A3MA 1W2UA 1W0OA 1YIFA 1W04A 1IOAA 1LRHA 1MVQA 3AYDA 2JDMA 3NNFA 1W3VA 4ITCA 4Y22A 2H0BA 2WINB 5EJ1B 5FOJB 5JSOA 4CXYA 3AZYA 3N9MA 1JU4A 5KHJA 3NKTA 1V9U1 4XBLA 2IXCA 1WD3A 3FMGA 3RYRA 2D6PA 2PAKA 1KDKA 4LHNA 4TLFA 3ZXGA 1NCQA 5FZ1A 4YW1A 4XFHA 2GP5A 4WV8A 4KU7A 4AVSA 2HBUA 2W91A 3PUQA 4DS0A 4L2NA 3DECA 1OH3A 3EB7A 4E4SA 3MUZ1 4NIIA 2YV8A 4W65A 2QQPA 1TE1B 3HD8B 4XQ4A 5FP7A 5FZ3A 4CDUB 2DFCA 4KWKA 4PCRA 4YM0A 4YW3A 5IVYA 5FYUA 2W39A 1JHNA 5J48A 4UF0A 1VPHA 3LQCA 5H9RA 5ABJC 4CPBD 2EXIA 2RS53 4HETA 3BUCA 1JZ8A 1QU0A 2DF7A 3U75A 3NRUA 4N90A 4Y20A 3VUOA 3O1UA 1ENSA 1XE0A 4CPBA 3M7AA 1I5ZA 3GZEA 3MIFA 4ZHNA 3MYXA 5IVEA 1OSGA 3ASIA 2GC1A 5FYHA 3T1MA 3EYPA 5CFCA 3E6BA 4XBNA 4BQ5A 3LF7A 3CJIC 4LK7A 3U1XA 4PLOA 4DUVA 2W1SA 5FO8B 1SFYA 1XNBA 2WWUA 3C3VA 3ZXJA 3PTRB 4Q4Y1 3VDCA 4CU6A 5LA0A 5BNNA 3VLBB 4EWAA 4NPLA 3RPQA 3O1VA 3VL8A 3RZLA 5BNNC 3WG4A 3TNQA 1MQTB 2WA3A 3ETPA 4BIFA 4LITA 1VRH3 5I91A 1S2EA 2W5FA 4GULA 2GNMA 3TEYA 1W6MA 1ONAA 4AHYA 1DQ4A 2JG9B 3AP4A 3EMRA 3CU7A 3FC0A 3N9LA 4A7YA 4YARA 1EPWA 5JZGB 2CTVA 4RS5A 1O8SA 5ANQA 5DMYA 1JW6A 2GN3A 3IAPA 4ZS2A 3U14A 3ZO0B 1QWRA 3FX3A 1UCXA 2W9XA 4RGAA 4RS5C 5FZHA 3VD7A 3RDIA 4AI1A 5F5CA 5JI7A 2D3RA 2ZOEB 1QH7A 3NJZA 5DDJ3 5GZGA 2CAVA 5C71A 4HLTA 1KDMA 5FPBA 1I1EA 2C6SA 3HOBA 2DU0A 4EN0A 4JQTA 2PA7A 4H55A 3H8XA 3BGAA 4A42A 2Y6JA 1ZREA 1SQ4A 2DCYA 1PZ7A 1K5JA 1Y9GA 1R64A 4UBGA 3KVAA 3MBWA 5FOBB 3MPBA 3K2OA 1OMIA 2UWCA 4KL1A 2CWMA 1JI6A 5FYVA 4G3YC 5SV5A 1LODA 2FDHA 1RUG2 2VY0A 3WLUA 1PX4A 2DURA 4LOTA 2BPA2 1UO9A 4XFFA 2B39A 1XJAA 5LRRA 1UIKA 3O1OA 3HQUA 4MV2A 3S6PA 4AVBA 5BYNA 3KMHA 5EPAA 5J7MA 4XETA 1OUSA 2O8OA 1OOPB 2HWF1 3CHXA 3T2QA 2FD8A 4FOWA 4HPKA 4UXAA 3OGGA 5J98B 4A41A 4AQ6A 3WHUA 4DQAA 4B29A 4COWA 4CCJA 1H9WA 3ZYJB 5L7OA 3BTZA 5GJ6A 5DXDA 1O3SA 2WO3A 3USUB 5L7OC 2WFF2 1IS5A 1RUC3 1HDKA 3VHNA 2ZMNA 4JV4A 2YROA 1J3RA 4K21A 2BNOA 4QDSA 4CTEA 1SDWA 2WO7A 3ATGA 1H2KA 3OBTA 4NROA 4QPIA 2ARAA 3A21A 4LO5B 3N7MA 5IK8A 3KV9A 4IV3B 3DPRB 2B7YA 3OD4A 1CGPA 1XC6A 1GLHA 5A32B 4IERA 4MGZE 3H42B 5CKNA 2QBXA 5AC92 4OULA 1JS9A 4XCBA 2XBO1 4Q2FA 2NMOA 2WZEA 3H7YA 1D4M2 4S2HA 3VBRB 5D2AA 1TNFA 4XIOA 4FPLA 1AYM3 2VZ1A 3KF5A 1R082 4OMDA 4ZY9A 1YWKA 1W8FA 4RR3B 1O91A 4CCDA 4KWUA 5C9AC 1MEC1 1LENA 5FZIA 4BCUA 1B35A 2V4VA 2XDVA 1D4VB 4ASMB 3J7NA 1CPMA 1PVC1 4XIKA 1H1IA 2R49A 4J6GA 5LATA 1Q8PA 2R0HA 3ZN6B 2XB6C 2VC9A 4FPKA 2XVKA 4FI9A 1FYUA 5ACA2 4CDXA 1OLME 5JR7B 1TMF3 4UOJA 3CZUA 3LFMA 3NNGA 4IV1B 2RHPA 3TNPB 1Y9MA 4CDXC 1YEWA 5HCBA 3TB0A 3I3DA 4UW5A 4FQZA 1F8VA 3OOXA 3ACLA 2VNVA 3O1RA 1NXD1 3N7JA 2D5FA 4LBLA 2J1EA 1FMD3 4JX0A 4Q4V1 2I2SA 2DV9A 5FZ8A 2JENA 1PK6A 2AYHA 2X5IB 3O1TA 4YLZA 2WNUA 2ZMLA 3P3NA 4MGYE 4NRPA 1OBNA 2H0VA 2YPJA 4C90A 2WNUC 4KG8A 1RUNA 4NIGA 1BVVA 3R4DB 4KMQA 2VMFA 4FP2A 1RXGA 2KXLA 4DIQA 1PO22 4KQ7A 1E5SA 4C1WA 5FQ0A 1RMU3 1GOGA 5JMCA 5D8AC 4JHTA 2XUEA 2DVBA 2VNGA 2XXZA 1COV2 1RUG3 2Q8OA 4EN9B 1G9AA 2OZJA 4LBQA 1EYBA 3H1MA 4D3WA 5FO7B 1UIJA 5FPAA 4ZZ8A 1CPNA 3JU9A 4O7XA 1OI6A 4AVCA 3SMHA 3ECQA 2WO1A 1H2NA 1SBEA 1OVPA 1D0GA 3N9PA 4XFBA 3GBWA 4M4PA 4NIHA 1CX1A 1JOBA 3VHRA 1V0AA 3DN7A 4LE4A 3ITQA 3BKZA 5FKBA 2VUJA 3E5XA 3JBG2 1AXZA 1H1MA 2WQZC 4WM8B 5I8TA 3NMBA 1IZ3A 1D2QA 5FZAA 1NE4A 4JTNA 1UZVA 1XE8A 1WMFA 1AL23 1YCIA 3LOIA 1RHI2 4AFBA 1YC61 2ZGSA 2A3YA 1MZFA 4ZONA 4F83A 1MS8A 2GNBA 4YM3A 2A70A 2HWB2 4X6QB 3KVBA 1Q8VA 5I0DA 4A6OA 4AFMA 2XOMA 1W2OA 1OLQA 2YHJA 1US3A 2FZ1A 4DXZA 1CN1A 3W5NA 5EHDA 2ZKLA 3POJA 5GLTA 5IT6A 5C33A 1LHNA 1IGOA 3NWKA 1HV1A 5FY7A 1QH6A 1QEXA 1ASJ3 1ZYBA 5FP9A 2RS51 2VVDA 2WFPA 4RGGA 5C3PA 2D6KA 5FZ0A 5IVFA 2P6CA 5DG2A 1GICA 1RUI3 1RXFA 3FN9A 5FMDA 2ARCA 3VKMA 2XJSA 1PNFA 2LW8A 1UYZA 3PIJA 1RINA 4GZ9A 2ADDA 1ZRDA 2WZR3 5BV6A 4QPGA 1HRV3 1IQAA 3PU3A 3AMQA 1DQ2A 3WT3A 2FHRA 5FXXA 4CUGA 3D0JA 4QPGC 1OLRA 1W8WA 1YHFA 3IM0A 2BOIA 3DYMA 3OF1A 4LQRA 4N7UA 4DO0A 5B4XA 1LHUA 2MEV1 4K9SA 2WKKA 4GH4C 1CAUA 3N7KA 3GZUC 4FPOB 3BCWA 2R1BA 5F32A 4MGQA 3GDBA 2ZXQA 3UGGA 5GLVA 4CEYB 1CZSA 1PO23 1PZ9A 5F3EA 3OUJA 1TG7A 4D8MA 3LCPA 4DOUA 1VRH1 4IE5A 1UOJA 2D6LX 4PI0A 5A7NA 1DGRA 1AYN3 1RYYA 2NYYA 2ET1A 2PQSA 3JD71 2RMU1 3V65A 4LHLA 5K0UA 3VD9A 2OPKA 1URXA 1WUVA 3SCHA 4Q0PA 1UU4A 3O1PA 5A1FA 3V0BA 2PHWA 1XB9A 2XGXA 4C91A 1F35A 2QZ3A 1XYNA 3VZMA 2E53A 4UFIA 4H7LA 4W4ZA 1HRI3 1GZWB 4XMAA 5HI0A 5FJHA 2I07B 3WHTA 1ZNPA 3IMMA 1T6BX 1QY4A 1QJFA 2E7TA 4Q8KA 5C4WB 2D44A 2P5BA 3HBZA 3THTA 2CSGA 1VIWB 3IB3A 4QX0A 4ZXEA 2RDSA 4LTAA 3BALA 1K12A 2KR2A 5GLZA 3MICA 3PJYA 4FCAA 5AFBA 4QU1A 1GNYA 5F6KA 3VDDB 2O0OA 3GCXA 5HV0A 1DFQA 1QJU3 2V5YA 5A3WA 3DCQA 2HWB3 4RFRB 3SQOA 1VMHA 5EV7A 3BOWA 3FLTA 3LFIA 2B9VA 2NQYA 5GKAC 2FDFA 5FIXA 2VMEA 4HBNA 1POV0 2O14A 4MUVA 4PIZA 3ZM8A 2XLGA 1VMFA 4P9GA 1ULEA 3ALQA 1GMMA 3HNMA 3SKJE 3K77A 1VE0A 2WNVB 1QJY2 4XCAA 3N36A 2QQKA 1NYWA 3MPPG 5A1LA 1W03A 3OBRA 1W6OA 3RWKX 1RUC1 4LPLA 1CR7A 3KS7A 3ZMOA 4AI8A 3E5QA 4XAAA 1WBFA 1ZX5A 2C5DA 2EICA 1VALA 2XR4A 4OHYA 3KM5A 3K3NA 3OGSA 4YSFA 1S0JA 2GZWA 4J25A 1WLTA 1LKNA 4XQDA 4HSLA 1HLCA 5FLJA 5L9BA 4IEPA 5JI9A 2Z5WA 1DYPA 4XABA 1DGRN 5FZOB 5J3UA 1WLWA 2R30A 3WNOA 5FYMA 3ZMNA 3VZJA 1SHWB 2GC3A 2OW4A 1FOD3 2ZX2A 1NLRA 1SCSA 1PNGA 3AFKA 3AKTA 2IVJA 4HVRA 1VB4A 1AYM1 4DPNA 1A78A 2VR4A 3N9QA 3PMSA 3V0AB 4OQ8A 5F9TA 4PBPA 2X29A 3PURA 4MH0E 4QAWA 5FPUA 1JODA 3OY8B 2CHHA 4YW2A 5EZWA 1JZ7A 3D8CA 1WCQA 1RUJ3 3I7DA 2VM9A 4JDMA 4V2WA 3I2KA 4A7ZA 4CUBA 1UW8A 5KBFA 1ULGA 2Y0OA 3HIFA 3M3CA 4LEJA 1DIWA 1TMF1 2YBKA 3FBMA 1WCDJ 4P9WA 5F37A 1SG3A 3CEWA 4XUQA 5LBBA 1XXNA 1XNAA 4I02A 4IGPA 2PMWB 1RUH2 4IE6A 3I3MA 1M06G 3M1HA 1FMD1 2ZGMA 1EUTA 1Q3EA 3DYOA 3HJRA 4XFAA 3WP3A 5LA1A 3PVEA 3HQXA 3NNLA 1FPN1 4BU2A 1WCSA 3A0KA 3SEEA 1ND3A 3I97A 1ND2B 3GZTB 3MFAA 4W6XA 4Y1UA 4CUCA 5JCTA 5FPZA 4D6RA 4ISRA 4CP9B 1ND3C 2GMMA 1QJX3 2ATFA 4CDWB 3T0DA 2CL2A 4ASLA 5CADA 1RMU1 3OCPA 5FXZA 5HBAA 2QQOA 1W8ZA 3IIAA 3SH4A 5EJ3A 2NN8A 4FFIA 4PBOA 4DMIA 4XJUA 4P9LA 1NA1B 3LA2A 2UYAA 3KF3A 4MVTA 3RI8A 1PGW1 4GMP1 4I0BA 3LGRA 3O0WA 4IESA 2HWE1 1POV3 3OPZA 3WVJA 4HANA 1KGYA 3WG2A 4Y3OA 1GP4A 2A6XA 4GJYA 1K5MA 2ZGPA 3PMEA 1JHJA 4IXLA 3WNKA 1TME2 4BYYA 4JHZA 1A34A 1ODMA 1KEXA 1LOAA 1JBCA 4DXSA 3S0MA 4M0NA 1KFXL 2GH2A 2WUHA 3MI8A 3POEA 4RL7A 1RUF2 3IN9A 5FPLA 5FYTA 2HWC3 2W95A 3ZX7A 4PLMA 3WZ1A 3B01A 4AVTA 1SFNA 2BV4A 2ZA9A 4R4ZA 5DAPA 1AL21 4YG6A 4I30A 4AQ2A 1Y9QA 2OQ6A 1EAH2 1ULDA 2W87A 2WA4A 1BKZA 2Y26A 1NT0A 1YQ5A 3R0RA 4XZUG 2V4AA 4B1MA 4N43A 2E6VA 2ZHKA 4G4FA 4I01A 4P5HA 5IYYA 4A45A 4N43C 3VBUA 5SV8A 5T5OA 5IVCA 1HW5A 2BWAA 1C57A 1R092 3IMNA 3KCYA 5EFUA 3VBUC 3KT7A 2AGSA 2VOKA 3K75B 2ZX0A 3ZFEB 2X53S 5CFDB 2JG9A 4META 4WM7A 3K3OA 1VAMA 5D1IA 1XSQA 4TSVA 5LBEA 4CCNA 1LU1A 2JG9C 2GSYA 4UBHA 4URTA 4KU8A 1ASJ1 2J1AA 4BH9A 4D0QA 2DVGA 2YUEA 4Q1PA 4H3WA 3LPFA 3DF0A 4FXKB 3RRDA 1RUI1 4D7SA 1WWYA 5JWPA 4IQPA 4K1YA 5JOWA 3AK0A 2JG8A 2XG3A 3I49A 1IKPA 3A7QA 1ODNA 1J59A 3W9AA 3T4HB 5FWJA 2JG8C 4OUSA 4FTEA 2WZR1 1AR81 1KITA 4QQHA 4CUAA 1CIWA 1HRV1 4AEDB 1RJ7A 4X6RB 1Y7BA 3OPTA 4JGZB 3W21A 1DGWA 1C28A 5LZ6A 4KWLA 3QOPA 1X8EA 2R043 3GXUA 1WCUA 3ZDVA 3GYDA 4EV0A 2D98A 3C8XA 3AMMA 4E9KA 1BBT1 2C1FA 4XF9A 3I2IA 1N3OA 1VLNA 1UWWA 4NRQA 3CF6E 1NZIA 4XAEA 1DG6A 3WEZA 4L92A 1W2NA 2RDRA 2XJVA 1OPOA 2ADEA 4M4RA 4FTBA 1AL0G 3H0OA 1T6GC 3J9SA 4UFKA 3KV6A 3VB9A 3FJSA 2YYOA 1WZXA 1AYN1 4GD4A 2Q1ZB 2BVVA 4YVWB 3HT2A 3C2UA 3SNMA 3ZSLA 1AHSA 4P14A 2EXKA 1V6KA 1C1LA 1OA3A 2EAAA 4QQ2A 1I3HA 3MLLA 1UNBA 2ZEWA 3IDAA 1X7NA 4NWVA 4RGKA 2UWAA 4RQPB 1IPSA 4QHZA 5JOXA 1EV12 2ZABA 2OYZA 1RUOA 3WQBA 3USUA 4FOVA 2JWPA 1OHFA 1YNAA 1AX1A 3SCFA 1DZQA 4HT1T 1APNA 4B7EA 5AFEA 5FBZA 1RUD2 2WN3A 1HRI1 1TME3 2YDEA 5CAZA 1VB2A 1SPPB 1NZCA 3ELNA 3UESA 5DPNA 5LB6A 3O0VA 2ILMA 5FDBA 3FUOA 4BMBA 4MGIE 1UXXX 4S2FA 1RUF3 3OD0A 3OUHA 1XNKA 1CD3G 2RS32 4HKWA 1H4HA 2ET7A 4HMZA 2AEZA 3A23A 4J1WA 3I2HA 3ZXLA 1AR73 3J8F2 4IEZA 1PO13 4RHV2 1LULA 1REFA 3SISA 4YFWA 2ETEA 1GZ9A 3IAQA 3H9AA 3OBAA 2W08A 4WVZA 1ACCA 1S2KA 2E33A 3B5LB 3LZZA 1BEV3 1QJU1 3ETQA 2RR13 4YRDA 1K3IA 4Q4W2 1Q56A 4GQ7A 4A3ZA 2WAOA 1DQ0A 4GWJA 4AAXA 1W2TA 3OGVA 3VGIA 4CCCA 3MUY1 4LO7A 3FHIB 3RYPA 1CAXA 1DF0A 5DZEA 1J1LA 3KHBA 2Q1FA 3KZ4C 4YWAA 3T3YA 1WMEA 1KJLA 5GZFA 3NV2A 3P6BA 1JH5A 2HWD1 3SH5A 1BHGA 5DAWA 3TN92 1XYPA 3HR9A 2NZ9A 2B42B 4LBOA 1QHDA 3K46A 4GALA 4NUBA 2XH6A 5A33A 2LUWA 3X29B 4IV1C 2DWRA 1L7LA 4QM8A 3ILNA 5E8AA 2P34A 2Q0AA 3VDAA 1PGL1 4XFIA 5FKCA 4FPGA 4DINB 1VRBA 3ZFFB 3HT1A 3IWZA 4LO6B 2EAKA 3EO6A 3SXWA 1VBD1 4BQWA 2X5IC 1ZA7A 4LKFA 1ENRA 1F15A 1LB2A 3MIBA 4OLLA 1D0HA 1ZZBA 1FOD1 4JDNA 1FNYA 2ID4A 3JD72 1PIV3 1QF3A 3I8TA 4BM8A 1E5HA 2OZ6A 1BXHA 2DVDA 2EXHA 4CP0A 1H6YA 2Y34A 3B02A 1S0FA 4BIOA 5FP8A 4QX2A 1SEFA 1RVF2 2ZJCA 5FXVA 3RWNA 1VP6A 4M3CF 4UYBA 5FZMA 3WF2A 4FOYA 1UYPA 2J7MA 1C8NA 1X82A 3KSCA 3AJYA 4XF0A 2VW2A 2A3WA 3KGZA 3LIGA 5BPXA 4AI3A 5IJRA 1JYCA 1QMJA 1RUJ1 1V6IA 4ZU7A 4Y1YA 1AZDA 2A5ZA 3IPVA 3VHPA 2WS92 1F5JA 2IFWA 4P08A 4QGLA 5F39A 4JVAA 5ABJA 2Y6HA 1EV13 3T2PA 1QXJA 2WIIB 2XONA 4COZA 4URAA 1W8OA 5FY1A 3E6CC 1PM7A 2VCBA 1SLAA 3WDTA 2ZGQA 1WW6A 2ORZA 2PLV3 3OG2A 4I09A 5C8CB 3MDPA 3U37A 2JDAA 2HKXA 2ZEXA 4WM8C 1UMIA 2ZCWA 3AYAA 3MV01 4XDQA 5IWFA 1V00A 4WZCA 2R061 2Z42A 5KXCA 4TYSA 5I0UA 2DCZA 5DZGA 1A8MA 1DQ5A 5FFOC 3WXPA 4CCMA 2ZGNA 3FBYA 1C8M2 4OQ9A 3PL0A 1VBC2 2RS33 3WDUA 3WW3A 5BY5A 1IQDC 3J8F3 4F7ZA 1NY72 2R072 2VAUA 1CIYA 3TEWA 1YQ6A 5A1AA 3CJIA 4AEKA 4BLJA 3WUDA 3ES4A 2ZGLA 2TUNA 5DUVA 3I2OA 1ZZ8A 2QCSB 4LUKA 3Q8EA 4B1LA 2VMDA 1N1TA 3MEPA 4IEQA 4Q4W3 5IAVA 2XQRA 5GZEA 5IK5A 2ZZJA 4CDQB 1H0BA 4QHBA 3WNXA 1POV1 4OFGA 1DP0A 1H8TA 2B45X 1GQGA 2VMGA 1SCRA 1REDA 2VULA 3OTFA 3VKNA 4K3UA 4EN6B 1H8TC 1AXKA 2JB4A 2F4PA 1BVP1 4EQVA 1IS6A 2JICA 3WV6A 2IXJA 5IATA 2OX0A 5A3OA 1DCSA 1W8NA 5DQ0A 1VBA2 2WRAA 3OEAA 1F31A 2VXRA 1S55A 4K20A 4V2VA 1W6QB 5FV3A 5ERLA 3B9IA 5F7UA 2HWC1 2PN5A 5CG9A 4XJAA 5LASA 1OFNA 1JUIA 4CP1A 2JD4A 1RITA 2D43A 2JKXA 3RI9A 5EQUA 4GA9A 4R9DA 1VBE2 3T09A 4Q29A 3I2FA 3BODA 4XJWA 1CQ9A 4IEVA 5CB7A 1BMV2 3RFRA 1IKQA 4Q4X1 4CEYA 4ZKTB 1ZBA2 2ZGRA 4RD7A 1QJZA 1MR5A 1AR91 4MXWA 3T4VA 1HQWA 1XQNA 4CEYC 4GB32 2HYXA 4OMCA 4P9YA 4QX5A 4YVSB 3SH3A 1RVF3 2E9QA 2EF6A 2YC4A 3KB5A 2VD7A 2HEYF 3WP4A 5FZBA 3ZXAC 1H6XA 1NCRB 3PJQA 2RJ2A 1E57A 1DZRA 3NV1A 3R6SA 1MPXA 1MS9A 2MPFA 4LIUA 5K8SA 4R4XA 3GZAA 5A7WA 1EY2A 4AAPA 5KXEA 2AENA 2DDUA 3VBHA 3WDWA 1N1SA 4K6BA 3OJBA 1R1A2 4LBNA 3MIEA 3VBHC 4JDOA 2V09A 2BTVC 2VQ0A 2ZPXA 4MG2A 3M4FA 4EE2A 2Z2SB 3VN4A 1G8WA 2E51A 4A3XA 5JSRA 4SLIA 1CAWB 1QDOA 5FLIA 4I0WB 5BNPB 3RZHA 2QVSB 5C4WC 2VNOA 3LDKA 2R041 4A7KA 2GC2A 4XJ8A 5FPXA 1DZTA 3OBZA 2BW8A 1ZZCA 1O3TA 2PELA 4PDWB 1C8M3 1VBB1 2QQMA 1VBC3 3CNAA 1DYOA 1BCXA 2RM22 1RC6A 4N9IA 3NJYA 4RN5A 4XFGA 5F2SA 3TEZA 5ISLA 4KG0A 4JGYB 4ET7A 3Q8CA 3MIHA 2JDKA 1J3PA 2EIDA 1JOPA 3PU8A 4JAAA 4K1ZA 4QX1A 2CYFA 4LOSA 2BWCA 1SLIA 4CEWB 5LW9A 2PAMA 5C9AA 1I5PA 2QQLA 2RJLA 4L0PA 5EJZB 1GOHA 5I8SA 1QQP2 1Z7S2 2XL9A 5FRAA 4BXFA 2OIIA 4MOAA 3N9NA 3C7EA 1RUE2 3OYWA 4Q26A 5LBFA 1ST8A 3I59A 4OUMA 3WQ0A 2Z69A 3ZKYA 1MS1A 3ACHA 5C3SA 3VBFB 2JIJA 3KD4A 4NO4A 1LCLA 2GP3A 3K4AA 4NHXA 5E16A 1C1FA 1J84A 1AR71 4YYOA 1PO11 1WW7A 5FZ7A 4B4PA 4Y26A 3CQOA 3JQWA 1LOCA 3FL7A 3PUSA 2VVEA 3PVBB 4N8MA 3WCSA 2AEYA 4AW7A 2R0FA 1BEV1 2H6BA 1AR62 2WQ4A 3WX5A 1J58A 1WLDA 4Z82A 3LAGA 1CJDA 1WKYA 2J22A 2XWBB 4LBQD 3VD4A 3J7MA 2VVFA 2KM2A 3M3OA 4PI2A 4ZPIA 1HB1A 5HPOA 3VZNA 5D8AA 5FBJA 2CWSA 5I0TA 1JZ2A 3IIIA 4LBKA 3C7FA 4XF3A 4BPZA 4N9HA 1AJKA 4XPVA 4JRLA 2VW1A 2TEPA 2YU1A 4HSJA 1YQCA 1JZ3A 2EVXA 2B9UA 4E4ZA 1HN0A 3EBRA 4JRAA 2F17A 1ZZ7A 1LEDA 1W6NA 2VZ3A 3BYWA 4XE9A 3JQXA 3AXEA 4FOQA 2OVUA 4Y22B 4QKDA 1UU6A 1UPSA 2TNFA 2CGPA 1WMXA 4XJ9A 3ZSKA 1R1A3 5CKMA 1GWMA 1SLLA 2P4EA 1HJGA 1KD7A 2RDNA 2Y8KA 3ZIXA 1F5FA 1ZBE2 5AVAA 3CZJA 4A4AA 5JLVA 2WFF3 4N53A 4Q0QA 2O1QA 1Q8OA 1NCQB 4LIVA 1NOVA 4N53C 5EP9A 4HXCA 2AR6A 1PIV1 4P02B 3KGLA 1YIPA 4YW7A 1RL3A 4UW6A 2E26A 2JIGA 3OGRA 2YXSA 3MZHA 5KHGA 2F6BA 5A7OA 2RS12 3WP5A 5FYSA 1NA1A 3D3AA 4L11A 4LJHA 2VJXA 4UW3A 4NWWA 3WG3A 3P3PA 1NA1C 1HXS2 4FVVA 4AQSA 5AC93 4UF0B 5LK5A 1LGCA 3C7GA 1D4M3 1HQNA 5C3OA 5F3IA 3ZFGA 1KJRA 1CAVA 4QGMA 1R083 3MLJA 3SCGA 1QQP3 2FQPA 1Z7S3 2VW0A 2ZTNA 4Q0VA 2C9KA 3NAPA 4HL0A 1E5IA 3ZFGC 4AG4A 1V6MA 2FDIA 1RUE3 3KV5A 5IVVA 3NAPC 4Y20B 3AYEA 4LORA 2XHKA 1DQ6A 5BNOA 2C24A 3PNAA 4D6QA 2VZOA 3LOBA 5BNOC 1SLBA 4W8JA 1AX2A 5ACA3 3UKVA 3WW1A 5CFCB 1HB2A 5A3PA 1XNDA 2BJSA 4QKFA 4XBQA 1LHOA 4W50A 2XL7A 3VKOA 2P37A 2Q8CA 3HQRA 3HMYA 4C8DA 4P5YA 3KCCA 2BBAA 1XPWA 2VNRA 1T2XA 4KGQA 4DZGA 2QDNA 4GH4A 3KWVA 3BOPA 3ZYRA 2DUPA 1AR63 2YGMA 1O5UA 5A6QA 2BGOA 2D5HA 3EQEA 2BP6A 1O3QA 5FMOL 1K42A 3LEIA 3WNMA 1UZYA 3D4KA 3S5QA 1W6MB 2OKXA 1XYOA 2P2KA 4FPFA 3SC7X 3F95A 5FYZA 3U78A 1JTZX 1N3PA 1S0EA 4XTPA 1S0CA 3ILFA 3KQ4B 3WUCA 3UKNA 1COV3 4QQOA 1IPJA 3M8LA 1FI2A 2R1DA 3D0SA 2XQXA 3ZSJA 4BQYA 5B4NA 3BN6A 1AJOA 5J1XA 4QKNA 5B2GB 3VHOA 3CDZB 3AJZA 1YLLA 3GHMA 2VCAA 3PVOA 1V9U2 1ZRIA 5DDJ1 2AC1A 3UKTA 1VJ2A 4XURA 3E1F1 3PUHA 3HNYM 4HZFA 4AEDC 3LDRA 4EN8B 1LOFC 2B5HA 4XFCA 1LTEA 5A3LA 5G04L 5J09A 4LHKA 2WT2A 3H3UA 5GALA 5C7GA 5FZKA 2ZZQA 4GJZA 3JBG3 1YI7A 2LALA 4OZXA 2Q4SA 2VQAA 1ZRFA 4OHXA 2CNAA 1I6XA 5JXJA 3NJXA 3R4SA 2VTFA 3M70A 1QJEA 2VZQA 1RHI3 1JZ6A 5CG8A 3N4MA 3B00A 4Y1ZA 3URFA 1N1YA 4KNCA 4O65A 1STMA 2VOWA 2XLFA 4YVWC 1V70A 4HPKB 3UJOA 4RSUA 3W5MA 3FHQA 4RQPA 3T0BA 3WY6A 4LNVA 2CY6A 3CBNA 3GHNA 4NIAA 4RQPC 5L7OB 2R062 4G9SB 3AZVA 4S2DA 5LA9A 1O7FA 2JDUA 2EXJA 2BYVE 1LECA 2SBAA 4HG6B 3POFA 1O4YA 4ZXKA 4I3PA 2QZ2A 2RVAA 2WNEA 2PAEA 5T50A 4F3JA 4M3CB 3U0ZA 4N7IA 3NL1A 4ISQA 1PMHX 2G1MA 3PIGA 5A3NA 4QPIB 2GAUA 4LT5A 2DTYA 4UW4A 3LEKA 1YYNA 2FMDA 3J7LA 4M0HA 2NLRA 1XRUA 4CZSA 4FAHA 3AVRA 2D7FA 1PMJX 4Q4Y2 3RZGA 1RJ8A 2BGPA 3HAGA 4OHWA 4U2AA 3MGUA 1FNZA 2ZX3A 4WVVA 4DY3A 2W68A 5HCFA 4RYDA 3CKHA 4MGSA 4FPJA 4WVMA 3VBSA 4I2OA 1W8HA 1W0NA 1YFYA 4JKMA 1D2SA 3VBSC 4BOWA 1DLCA 1H1AA 5KHKA 5DG1A 4PIXA 2ZEZA 4AL9A 1GANA 4BWOA 4ZU5A 1B35B 3DXUA 4IDZA 3GALA 3D6EA 4XYXA 4QB1A 5FMCA 3RG0A 2Y6LA 5F5QA 1C4RA 4AVVA 1J1TA 1GWKA 4NPRA 3R4UA 3RZZA 3H1WA 4EWDA 2DCJA 2CV6A 4Z92B 1VAKA 5H9QA 1DGLA 4CDXB 4MX3A 1OD3A 3NNJA 4FPEA 3SKVA 4AVAA 5IW0A 1H9PA 2EIGA 1UMHA 3IZOA 2BU9A 1HB3A 4LKSA 2A6WA 3W59A 4Z8BA 4XQWA 5E89A 1CZTA 4OCTA 1YJLA 3PVNA 1PK6B 1GZTA 1GR3A 4IE7A 2WNUB 3WQ7A 3ZFFC 1Y43B 2JEMA 2P3YA 1WBLA 2FCTA 2ZGUA 3HWJA 3AMPA 2JDYA 2VZRA 4QMAA 2ARXA 2Z79A 1GBGA 5FQ0B 5LRSA 4GWNA 4XDOA 1QXPA 4NHKA 3M3QA 2JE8A 1HX6A 3ON7A 4LBQB 3ZYIB 2HWF2 2MNGA 2BZDA 5T55A 2VUDA 4JKLA 5F2WA 4AZZA 4BJ0A 3I3BA 4NR1A 4CDUA 1RUG1 4QPWA 3H3LA 4IW3A 1W28A 2J1VA 4CDUC 5FZ9A 1G9DA 2DU1A 3QACA 3NV3A 4QX3A 2RG4A 4U36A 3JUUA 1Q8SA 2ZS6B 1GP6A 2PYTA 5JXIA 2JDPA 1JU3A 1NLSA 3TAYA 5L36A 3RZJA 4YZ4A 2VTXJ 1W8UA 1LHWA 4L8QA 5E88A 2J1RA 1MZ5A 2O8QA 4EWEA 1E5RA 2ZEYA 1QJY3 5C6CA 3UYJA 5C8CC 3O1SA 1VR3A 2WZ8A 1UZ0A 2ZKNA 5FPVA 2Q5TA 1NUKA 2C4XA 4E4HA 2FMYA 5BXXA 2XBO2 3ZPOA 1YFWA 4MHRA 2WR9A 4Q4Y3 3ZOIA 5C3QA 2AREA 5JPMB 1DHKB 1DDLA 4EROA 1OF3A 2YBSA 1OT5A 4CA9A 1LEMA 1MEC2 3OEBA 4C0BA 3C7HA 1US2A 5CYYA 1BK1A 1U12A 1B09A 4R8HA 1PVC2 2UU8A 4D7TA 5AC91 1BJQA 1FV3A 4XDPA 1OXCA 4CDQC 2JXAA 1MQTA 3MFCA 1D4M1 1EP0A 1JYTA 2X8KA 1YUDA 1MQTC 1WA4A 4ZS3A 4TWTA 3NW4A 1R081 5M0TA 5JZGA 3W58A 1DGWX 3ACFA 3TBDA 3WINE 5JZGC 3ZLIA 3LKJA 1RGSA 3VDBA 3IDCB 3PHMA 4Q4V2 5A7PA 3WR0A 3LA3A 2LROA 4HFSA 2FCUA 2K2SA 3LB9A 3Q8FA 5APAA 4AEMA 3S57A 2YGLA 1GV9A 4QPGB 4B4RA 1U5IA 2CGNA 5ACA1 3UL2A 2WNOA 4FXGB 2CAUA 1DU3D 2VOTA 1QKQA 5IHRA 3JXSA 3PTYA 1UX7A 1XOYA 2DTWA 4Y33A 3MV11 2XKOA 1O8PA 2BERA 1RUH3 3DL3A 4COYA 4BMEA 2WO2A 2B46X 1OQEA 2IC1A 1PHMA 4GWMA 4LK6A 4X8NA 3L9JT 4YM1A 4NHYA 1JZ5A 5DABA 2WN2A 3S7EA 2OA2A 4JTOA 4QT6A 1PO21 4P9XA 4NE9A 2VUAA 4LLFA 5K0UB 1QGLA 1MVEA 2UYBA 4NN0A 1COV1 1PMIA 2VBBA 1OUXA 2VUCA 3CL1A 3RQ0A 4INDA 4E4DX 2JKBA 3V0BB 2LRPA 2QQNA 1OOPA 4QWNA 2XJRA 3ZYHA 5L9VA 1A6CA 1OOPC 5A80A 1O5LA 2D6NA 2C26A 5HXMA 5T5PA 2B8MA 2C9AA 1POQA 1SFPA 1P8JA 1ZRRA 4KWJA 3KHCA 2WT1A 1HN1A 2V5DA 4LXLA 4AI9A 1F9KA 3MF9A 2ZGOA 4EN7B 1W99A 4A6SA 5LEJA 4YGDA 1V6NA 4NOTA 3L2HA 2YBPA 2IXLA 2BOJA 5FZ4A 1OFSA 2AACA 3JBG1 3N3HA 5HCHA 2ENRA 2E7AA 2OT7A 3DPRA 4IV3A 4CP2A 5K7PA 4XC9A 1FXZA 1RB8G 4Y24A 4IV3C 1DBNA 2BNNA 2ZHNA 3DPRC 5A32A 3BTYA 1JMUB 4UT5A 3ORJA 4COVA 3DYPA 4JGYC 1RHI1 2VMIA 4AGRA 4EJRA 4NJ4A 1EAH3 3I3EA 4JZRA 4IL7A 4Y5Z0 3VBRA 3D5OA 4OI1A 1XNTA 2DYCA 2RS52 1PVC3 1SACA 3VBRC 1OC1A 2HWB1 2YPDA 3GNEA 2JDZA 4CEWC 4RR3A 3BPZA 3HNBM 5FLHA 3S5AA 1F2NA 2VQUA 4I0AA 4JCKA 3ZSMA 2WABA 1R093 3ZYBA 4B4QA 4NPMA 4RFT0 2D3PA 4RR3C 4F8AA 5JOYA 1N3QA 1W6OB 2Y33A 2ZAHA 5FUNA 4K8RB 4FO9A 3POBA 3ZN6A 4LHSA 4FSJA 4M00A 2GH8A 1YQ8A 5BUVA 2G4IA 1BZWA 2GNDA 1V6OA 4LLOA 3ZVXA 3I2DA 4TZDA 2QQJA 4Q4V3 3VBFC 1A8DA 3WDVA 1QIQA 4IV1A 2QQWA 1JYWA 1J3QA 3RSJA 2MEV2 1HKDA 1UY1A 4YG0A 4AR2A 5FCCA 3K4ZA 4IEYA 1WCKA 3FLRA 2X5IA 2R32A 5CEHA 4UFHA 5FY5A 2VQTA 3SEPA 1VRH2 5KC5A 2DVFA 3AMHA 2ZX1A 4MYEA 5J36A 5KHHA 3BB6A 4DUWA 4ES9A 4OUEA 4XVHA 4CVUA 3TYJA 1OPMA 4QKBA 5LY1A 3O12A 5DN2A 1Q8QA 3AXDA 2RMU2 3S7IA 3ZN5A 4Z2WA 5A70A 2BRTA 5FR3A 2Q8EA 5J96B 2QUOA 2XPJA 2W1WA 3O14A 4DRRA 1OA4A 4XZPA 1EPZA 3J26N 1DLLA 3RYKA 2GDFA 4AI0A 1NLQA 1S0DA 1LJ7A 2XVLA 3D82A 3T1LA 4Y5TA 2IZWA 2KD7A 5C3RA 3K48A 2IFRA 3P1IA 1PX3A 3RNSA 2IVIB 3AP7A 4PLNA 4HK8A 1KRIA 5H9SA 1UYXA 2UY8A 3R05A 4FP3A 3NVCA 2W46A 2Y6KA 5A7SA 1L7QA 2GALA 3IT8A 1LU2A 4UFJA 4OI2A 3AZZA 1IG0A 1WW5A 5FZCA 2PHLA 3A22A 4B8EA 1I9RA 3LEMA 2K46A 1ND3B 1VAVA 1X9PA 1RUD3 4WM8A 4QXHA 1AX0A 1NCQC 2XJPA 1OH4A 3POYA 2PHDA 2OPWA 5CVRA 1X36A 2XMLA 4EZ4A 3UJQA 4JQRA 1M4WA 3ACIA 4FTSA 3GF6A 5FTTC 3EXUA 4Q1RA 1QOSA 3GJAA 4D69A 1QJX1 4R52A 1YFXA 1GFF2 4RHV3 5JR2A 2P3IA 1UY0A 4AYUA 4V1PA 5F3GA 4QDQA 1X9TA 2ZX4A 5FZGA 5I0SA 1GOFA 3THCA 4W6WA 1MS3A 5IK4A 1SMVA 1RUC2 2P6HA 4HK9A 5T3NA 1K5MB 1LAJA 4ATFA 2NP0A 5FMOS 2VZSA 3CO2A 2PHRA 3U07A 5A6XA 4BE3A 2W92A 1PVXA 3QBQA 2QE3A 1BK0A 3WSOA 5JIUA 4AI2A 4HOOA 2XJUA 1ENQA 3FUQA 1QJY1 1TQ5A 4CSWA 1U5ZA 4YFZA 2HEWF 2V73A 4ONUA 1OF4A 2VMHA 3WW4A 3TN93 2VZUA 3AMNA 1J83A 1ZRCA 1OKOA 1UMZA 3WW2A 5CFCC 2W1QA 1W6PB 2YC0A 4M01A 2IWGB 1QDCA 2MEV3 3ZIWA 4QXCA 3WF0A 4N43B 1ZM1A 2WT0A 3FWEA 2WDBA 3B9CA 4QX7A 4CU9A 1AYM2 5CU1A 2LM3A 3EJKA 3LSDA 3VBUB 3ZYFA 2FZ2A 4E2QA 3DV8A 4AHZA 3H7JA 4BB3A 4Y4YA 5IVBA 1ULCA 4LBJA 1BLZA 4WVWA 4BK5A 4OVEA 5FK8A 3U10A 4WM7B 1UKGA 2VECA 3JD73 4UWDA 2RMU3 2GU9A 4H14A 4NMIA 1UX6A 4DUXA 3VBOB 5FJKA 1TMF2 2BFUL 1W8TA 1KS5A 4AWDA 2NMNA 4DNYA 4P9IA 2XHNA 3E5UA 2UURA 3MF6A 3LIHA 5JOZA 3DKWA 5T5LA 1IS3A 2JG8B 4QHOA 4DXTA 4NRMA 1FMD2 4XEZA 4PQQA 3B69A 3RJRA 1FPN2 1FX5A 2BVBA 3ES1A 2WS93 1XU2A 2VU9A 4KGGA 4IETA 2PTMA 1H30A 4LA2A 3P5BA 4Q5OA 1LOBA 1GZWA 1WA6X 3T30A 5FY9A 4AQTA 4MGTA 3FHAA 3M3IA 4S2GA 3LDBA 3OSDA 1ZA4A 5L73A 2ARBA 5C5TA 1KS4A 1RMU2 1ZZ9A 2E63A 2IUWA 2WWJA 5A7QA 1RUH1 5C4WA 4FAGA 4FBFA 1PM4A 1CESA 2YY1A 2ZHMA 4KBZA 4QPYA 5JXGA 1WGPA 1Q43A 2A71A 2J1TA 4H7MA 4QQPA 5JVVA 2AH2A 5FMBA 1U0AA 2YFZA 1PGW2 2VOVA 3VDDA 1ULFA 4YW5A 4CCEA 2HWE2 2VXJA 1V6LA 2G9ZA 4GMP0 4HVQA 3V56A 4LUMA 3VDDC 4XUOA 2UWBA 3VZLA 1H2LA 4LMFA 1OD5A 2R073 4CE8A 5FAXA 4IE0A 5JXHA 5FZFA 1YFUA 3N7LA 4ZU4A 3QCWA 3B94A 4TTGA 4PF5A 5FWEA 4LR4A 1JYNA 5FYCA 3AP6A 3O1MA 2EIEA 3SITA 1WD4A 2BEOA 5FUIA 4Y1VA 4E2SA 1W39A 2HLEA 2WNVA 1CZVA 2AZ5A 4M3CA 5DUUA 2FBEA 4YPJA 1UZWA 3TWIA 2XKPA 5KXDA 4HKOA 5LK7B 2WNVC 2N7GA 2WJSA 1LOEA 4IUGA 1W9WA 3ZR6A 1AL22 2JE9A 1HQLA 3PUIA 4QPIC 1G9CA 4AHXA 1OURA 1TME1 4LKDA 4HN1A 3OPWA 4AHWA 2F4LA 2IXKA 1UOGA 1VBA3 4W6YA 2VBDA 5ANNA 2PQQA 1RUF1 2VH9A 3MIDA 4YGEA 1EUUA 5FYBA 1SLCA 5FZOA 3E97A 4PJYA 4QQLA 1JXNA 1UKRA 3F2ZA 4X8PA 3VV1A 1RTVA 4JKKA 3UGHA 4Y1XA 4XUNA 1EAH1 3O7OA 2YG0A 5IAXA 1VBE3 2LTNA 4XMIA 1ASJ2 4Q27A 4QB2A 1B35C 1CAXB 2RR11 2HEVF 4AOCA 3QH7A 3I4IA 2WYFA 5GZCA 2ZGKA 4PT6A 4R9AA 3V0AA 5LCWL 1HIXA 2Y6FA 1SBFA 1ZBA3 2WYSA 1RUI2 3ZSEA 1WMDA 2I74A 4ARYA 1UY2A 5FREA 1R091 3AYCA 4EZHA 1GYKA 3OY8A 4DRVA 5CISA 3BIEA 3AL6A 3I54A 4GB33 1UU5A 3IKWA 4BDVB 2IXIA 2VZPA 3BIWE 3LEGA 4BQ3A 5FP4A 3KLSA 5FZLA 1CWPA 3AX4A 3HN1A 5A33B 2WZR2 1AR82 4AK3A 1HRV2 5FY4A 1BYHA 3CJXA 4ARXA 3NQHA 1R1ZA 1ALYA 1G86A 1LGBA 1FPN3 3K4DA 4LE3A 2CGOA 4KBBA 2W47A 2WWSA 5FK7A 1BBT2 1PK6C 2QQVA 2VMCA 3BI3A 5IK7A 4IE4A 2ZACA 3TEXA 3ZKUA 1WW4A 2QNKA 5EWSA 3ZXKA 4LBMA 1S1AA 4IGOA 2ZAAA 2WLPA 1W06A 3KT4A 1ND2A 3MLKA 1UXZA 2NM1A 4XF1A 1X33A 3H1YA 4CP9A 5FY0A 1DQ1A 1AYN2 1ND2C 2A73B 4E27A 5FYIA 3FE5A 2WLQA 1NQDA 5FZEA 4CDWA 4XUPA 3MHZA 5A6YA 4MGKE 5F6LB 5LBCA 4GMP3 4CDWC 3BU7A 2P3JA 4D7YA 2VTXA 4EYUA 2HWE3 3WD5A 1UOBA 4NAOA 2RM23 1AXYA 1W0PA 3KV4A 4UAPA 2CDPA 5KR7A 4GAZA 3IPVB 4YNIA 1IG3A 1JYIA 2RJKA 4Q8LA 1YI9A 1HRI2 4I3GA 4HVOA 2PHFA 4FFGA 5ABJB 3HBKA 1N1VA 2DBNA 3AFGA 3WCRA 3JZVA 1SBDA 3SLIA 4AGGA 2W52A 3IDBB 1EV11 3BU0A 3LD8A 4CU7A 3THPA 3O0XA 1AF9A 4YZ3A 2PLV1 1RUD1 5JMOA 1YO8A 3AKRA 3BTAA 3FZ3A 4QU2A 5FYYA 1X8MA 3LE0A 1REEA 3GJBA 3LA7A 3POIA 3GGLA 3NSTA 2GMEA 4SBVA 4XW3A 4B3NA 1QJU2 1QOOA 1LNSA 1O6UA 3B93A 3DGTA 1UOFA 1GQPA 5AVPA 5JAXA 3V64A 3CJIB 1JYVA 4K40A 5F3CA 1GP5A 3VD5A 4O9GA 4XTMA 2RS31 4A44A 3SHRA 5T52A 3J8F1 2ERFA 4XF4A 4Z07A 3H8OA 2DUOA 2VOXA 3ENRA 4RHV1 1UF2C 4TLGA 3UV9A 1LOGA 5BNNB 1NAEA 1XE7A 3A4UA 4AF9A 5A6ZA 1MACA 1H8TB 3WF4A 2YB7A 3VZKA 2HWD2 3RMYA 2J42A 3ZXFA 3CMGA 4FPCA 3I2JA 2W0XA 1UQXA 2WBKA 4Q4W1 4TN7A 5CFDA 5T5JA 3ZFEA 1NXMA 5FZDA 3MO4A 3ZFEC 1JOJA 1WLCA 1ZVFA 5CFDC 4BQXA 3JB4C 4FFFA 1C5HA 4RS5B 1KFUL 5CKQA 1PGL2 5FUPA 3G7DA 3POGA 4HKLA 4FPHA 3C7OA 5J37A 1ULOA 1AR83 1MZ6A 5EYXA 3GCWA 1VBD2 1G9FA 3TN91 1U5XA 4OYUA 5KWRA 1JN2P 2Y38A 2BNMA 1FOD2 2G9GA 5LA2A 4LULA
chains in the Genus database with same CATH topology
4Q0UA 4YZ1A 1BBT3 2P17A 4AEDA 3TRSB 4YGBA 4JGZA 1LOFA 5HXVA 3H3ZA 4JGZC 5KC6A 1ZBE3 5T54A 1QNWA 3GBGA 3POWA 1XNCA 4MXWB 2QJVA 4L97A 4XOGA 1G9BA 2WSUA 1RUJ2 1KXGA 1PGSA 4NVPA 2XJTA 4PIYA 5K0UC 1RVF1 1OA2A 2RS13 3MW3A 5HCAA 4YVWA 4ATEA 1C5IA 4XILA 1MZEA 3KCXA 1HXS3 2C0ZA 3VBHB 4E2GA 3B7MA 2XLAA 4XHXA 3ILRA 4BQ1A 1AVBA 5FO9B 2XWJB 3GBFA 2WS91 2DCKA 4OI4A 1NQJA 2XVGA 3AP9A 2ZMKA 1PZ8A 2DUQA 2HJIA 1X50A 2QFEA 4XXPA 5DUXA 2JECA 1QJX2 5E1RA 3OGJA 4YZ5A 2VG9A 3WDYA 1A3KA 3NO8A 3ZXDA 3IDEA 3AKQA 2ZBJA 1O4ZA 4DY5A 2D3SA 4ES8A 2ZGTA 3EHKA 1S2BA 2JE7A 1Q5OA 4Q0SA 2OUJA 1C8M1 1G6NA 1VBC1 4XHBA 5KXBA 3L2YA 2Y0IA 1N47A 4R9BA 1NY71 2R071 5I8YA 2G9FA 3RJ2X 5C9AB 2A75A 3J4UH 1FATA 2D97A 1LHVA 2A6ZA 2HWD3 5JSPA 3MW4A 1H8VA 2GNTA 1H4GA 2D6OX 4HN0A 3OYWB 1LR5A 5C8WA 3VKFC 5DUWA 1IHMA 4O9EA 1TNRA 4YM2A 3VL9A 5F1RA 2HWC2 3I59B 3B3QE 2BQPA 1Y3TA 1YJKA 1DYKA 1YXWA 3JB8A 1GKBA 4AFDA 3LWCA 1CVNA 3ST7A 4ORFA 1FAYA 4XJZA 3UK9A 1VBD3 4IEUA 1VBA1 5JPNB 4R9CA 2E7QA 4XXAA 4Q4X2 1JUHA 1V9U3 4MLOA 3ZFFA 4BLIA 1ENXA 4GIQA 3FLPA 4AFAA 1AR92 4P9JA 1GNZA 5GLWA 1S0BA 2JJ6A 1CONA 3QD6A 1CX4A 1VBE1 2XJQA 5D8AB 4C1XA 3AB0A 1Z0HA 4LA3A 3KT1A 3USSA 1S0GA 3ZDSA 1BMV1 2MHFA 1MS5A 3QH6A 1ZBA1 4IEOA 2GMPA 5I0RA 1LESA 4AEJA 4GB31 5JIAA 2BUKA 1Z78A 4CRQA 4OI0A 1W6NB 4Z1VA 4QGNA 1GNHA 3CLPA 1C3HA 2RE9A 5H9PA 4FQ4A 5BNPA 2R042 1H2MA 1V6JA 1LGNA 2R063 3O5SA 4IEWA 4NHLA 2SLIA 4YGCA 5BNPC 2NPIA 4N53B 3U4XA 1VBB2 3WP6A 3FFZA 5C8CA 1R1A1 4J1XA 4GKXA 1OKQA 2JX9A 4K7JA 1CJPA 1ZZ6A 2WFF1 3AKPA 2ZHLA 3S30A 4PQ9A 5CIRA 2WC2A 2H6CA 3T2TA 1RIRA 2AUYA 1L3JA 4AFCA 2ES3A 5GM0A 2RM21 4CYDA 3WQ1A 4DFSA 1IPKA 5BNQA 4YW4A 3ZFGB 4CDQA 1CAVB 4QM9A 3WDXA 4BA6A 1QXRA 1K5MC 3Q9OA 1FT9A 3NAPB 1UN1A 4OHZA 4BHPA 4LO4B 1TEIA 3POSA 4DB5A 2D40A 5IUQA 3WG1A 5BNOB 1QQP1 2BFUS 1Z7S1 4AGVA 1AR72 1U5YA 4MZUA 5I8TA 1PO12 1RUE1 4JC1A 4GXLA 1FV2A 4BZ4A 2R6QA 1W6PA 1W6QA 3VZOA 2YZ4A 4YZ2A 3ROUA 1YRZA 3ZN4A 4AXOA 1BEV2 3NKGA 1KQRA 2RR12 3MIGA 3ZYPA 4L9BA 4Q4X3 2P3KA 1GZCA 4MSVA 1QNYA 5K9YA 4GH4B 1AR93 2K9ZA 3ZXEA 1CAUB 1GQHA 2Q30A 3RMXA 3FFQA 5DZFA 3LSEA 4WM7C 3APBA 1AUYA 1AR61 4A2UA 3VBOA 4YVSA 2A3XA 3M3EA 2PHXA 3VBOC 4YVSC 2HWF3 1NCRA 3H8UA 4B7KA 4K8FA 1MS0A 3U11A 1NCRC 1GSLA 2WL1A 5EYYA 1SLTA 2K0GA 3AZWA 2D6MA 2WZPP 3ZPYA 1UL9A 1QOTA 4WZFA 4D94A 1PIV2 3TOJA 2DCTA 2I45A 1O4TA 1NE6A 1CAWA 1VBB3 1NG0A 2UY9A 2EALA 3AZXA 2IXHA 4RA0A 1IS4A 1ZBE1 4AE2A 4KH9A 5GZDA 2BBVA 2GC0A 4PDWA 1O3RA 2A6YA 5JDBA 3ME2A 3NV4A 1OQDA 2XBO3 2WSVA 4PDWC 2PFWA 5GLUA 2TBVA 4JGYA 3AP5A 3KQRA 3QLQA 4OHVA 5L19A 1S0IA 1UAIA 2RS11 5CNAA 1MEC3 1UPIA 1BQPA 4L99A 4CEWA 3PLQA 1HXS1 2PLV2 1OQ1A 5I93A 4QD2A 3ZYGA 4GKYA 2A7AA 2EA7A 5EXOA 1MS4A 1G7YA 2BGCA 2GN7A 5KHIA 4LO8A 5TSWA 3K51A 2KA3A 4QXKA 4M3CE 4YG3A 3VBFA 2Q1MA 4FPYA 2R16A 4COUA 2A6VA 3VBSB 2OUHA 4WVMB 3JCIA 1HV0A 5CA6A 3E6DA 3G6JB 5CBLA 3VKLA 4NHMA 4FT8A 3M2MA 4MXVA 2QKDA 4IEXA 4C0HA 3INAA 3A0NA 2DVAA 2HYKA 5LEKA 3IBMA 1UZZA 2D93A 3AM2A 1UD1A 1XU1A 3AKSA 2VPVA 2PHUA 2DFBA 3DUIA 3N35A 2QDRA 3WOGA 2YMZA 3MW2A 3H50A 5DDJ2 2PHTA 3RS6A 2XUMA 2VGDA 4WBBA 5A3MA 1W2UA 1W0OA 1YIFA 1IOAA 1LRHA 1MVQA 3AYDA 4ITCA 4Y22A 2H0BA 2WINB 5FOJB 5JSOA 3AZYA 5KHJA 3NKTA 1V9U1 4XBLA 2IXCA 1WD3A 3FMGA 3RYRA 2D6PA 2PAKA 1KDKA 4LHNA 4TLFA 3ZXGA 1NCQA 4YW1A 4XFHA 4WV8A 4KU7A 4AVSA 4DS0A 4L2NA 4E4SA 2YV8A 4W65A 2QQPA 1TE1B 3HD8B 4XQ4A 4CDUB 2DFCA 4KWKA 4PCRA 4YM0A 4YW3A 2W39A 1JHNA 5J48A 5H9RA 5ABJC 2EXIA 2RS53 4HETA 1QU0A 2DF7A 4N90A 4Y20A 3VUOA 1ENSA 3M7AA 1I5ZA 3MIFA 3MYXA 1OSGA 3ASIA 2GC1A 3T1MA 5CFCA 3E6BA 4XBNA 3CJIC 4PLOA 5FO8B 1SFYA 1XNBA 3C3VA 3ZXJA 4Q4Y1 5BNNA 3VLBB 4EWAA 3RPQA 3VL8A 5BNNC 3WG4A 3TNQA 1MQTB 2WA3A 4BIFA 1VRH3 5I91A 4GULA 2GNMA 1W6MA 1ONAA 4AHYA 1DQ4A 2JG9B 3AP4A 3CU7A 4A7YA 3FC0A 4YARA 5JZGB 1EPWA 2CTVA 4RS5A 1JW6A 2GN3A 3ZO0B 1QWRA 3FX3A 1UCXA 4RS5C 4RGAA 3RDIA 4AI1A 5JI7A 5GZGA 2D3RA 2ZOEB 1QH7A 3NJZA 5DDJ3 2CAVA 4HLTA 1KDMA 1I1EA 2DU0A 4EN0A 2PA7A 4H55A 1ZREA 1SQ4A 2DCYA 1PZ7A 4UBGA 5FOBB 3MPBA 1OMIA 2UWCA 4KL1A 2CWMA 5SV5A 4G3YC 1LODA 1RUG2 2VY0A 3WLUA 2DURA 2BPA2 4XFFA 2B39A 5LRRA 1UIKA 4MV2A 3S6PA 4AVBA 5BYNA 3KMHA 5J7MA 4XETA 2O8OA 1OOPB 2HWF1 4FOWA 4HPKA 4UXAA 3OGGA 5J98B 4AQ6A 3WHUA 4DQAA 4B29A 4COWA 1H9WA 3ZYJB 5L7OA 5GJ6A 5DXDA 1O3SA 3USUB 5L7OC 2WFF2 1IS5A 1RUC3 1HDKA 3VHNA 2ZMNA 4JV4A 2YROA 1J3RA 4K21A 2BNOA 4CTEA 1SDWA 3ATGA 3OBTA 1H2KA 4QPIA 4LO5B 3N7MA 5IK8A 4IV3B 3DPRB 2B7YA 3OD4A 1CGPA 1GLHA 5A32B 4IERA 4MGZE 5AC92 4OULA 2XBO1 4Q2FA 2NMOA 3H7YA 4S2HA 1D4M2 3VBRB 1TNFA 4XIOA 4FPLA 1AYM3 1R082 5C9AC 1YWKA 4RR3B 1O91A 1MEC1 1LENA 4BCUA 1B35A 1D4VB 4ASMB 1CPMA 1PVC1 4XIKA 1H1IA 2R49A 4J6GA 1Q8PA 2R0HA 3ZN6B 2XB6C 4FPKA 2XVKA 1FYUA 5ACA2 4CDXA 5JR7B 1TMF3 4IV1B 2RHPA 3TNPB 4CDXC 5HCBA 3TB0A 4UW5A 4FQZA 1F8VA 3ACLA 1NXD1 3N7JA 2D5FA 4LBLA 1FMD3 4Q4V1 2I2SA 2DV9A 2JENA 1PK6A 2AYHA 2X5IB 4YLZA 2WNUA 2ZMLA 3P3NA 4MGYE 2H0VA 2YPJA 4C90A 2WNUC 4KG8A 1RUNA 1BVVA 3R4DB 4FP2A 2KXLA 1PO22 4KQ7A 5FQ0A 4C1WA 1RMU3 5JMCA 5D8AC 2Q8OA 2DVBA 2VNGA 1COV2 1RUG3 4EN9B 1G9AA 2OZJA 4LBQA 1EYBA 3H1MA 4D3WA 5FO7B 1UIJA 1CPNA 3JU9A 1OI6A 4AVCA 3SMHA 3ECQA 1H2NA 1SBEA 1D0GA 4XFBA 3GBWA 3VHRA 3DN7A 4LE4A 2VUJA 3E5XA 3JBG2 1AXZA 1H1MA 2WQZC 4WM8B 1IZ3A 1D2QA 1NE4A 4JTNA 1XE8A 1WMFA 1AL23 1YCIA 3LOIA 1RHI2 4AFBA 2ZGSA 2A3YA 1MZFA 4F83A 1MS8A 2GNBA 4YM3A 2A70A 2HWB2 4X6QB 1Q8VA 4AFMA 1OLQA 2YHJA 2FZ1A 4DXZA 1CN1A 2ZKLA 5GLTA 5IT6A 5C33A 1LHNA 1IGOA 3NWKA 1HV1A 1QH6A 1ASJ3 1ZYBA 2RS51 2VVDA 2WFPA 4RGGA 2D6KA 5DG2A 1GICA 1RUI3 3VKMA 2XJSA 1PNFA 1RINA 1ZRDA 2WZR3 5BV6A 4QPGA 1HRV3 1IQAA 3AMQA 1DQ2A 3WT3A 2FHRA 3D0JA 4QPGC 1OLRA 3IM0A 1YHFA 3OF1A 4N7UA 1LHUA 2MEV1 4K9SA 2WKKA 4GH4C 1CAUA 3N7KA 3GZUC 4FPOB 3BCWA 2R1BA 5GLVA 4CEYB 1PO23 1PZ9A 3LCPA 4DOUA 1VRH1 2D6LX 1DGRA 1AYN3 2NYYA 2ET1A 3JD71 2RMU1 3V65A 4LHLA 5K0UA 2OPKA 1URXA 1WUVA 3SCHA 4Q0PA 1UU4A 3V0BA 2PHWA 2XGXA 4C91A 2QZ3A 1XYNA 3VZMA 2E53A 4H7LA 1HRI3 1GZWB 4XMAA 5HI0A 2I07B 3WHTA 1ZNPA 1QY4A 2E7TA 4Q8KA 5C4WB 2D44A 3HBZA 3THTA 1VIWB 4LTAA 3BALA 5GLZA 3MICA 3PJYA 4FCAA 5AFBA 3VDDB 5F6KA 2O0OA 1DFQA 1QJU3 2V5YA 2HWB3 5EV7A 3BOWA 3FLTA 2NQYA 5GKAC 4HBNA 1POV0 4PIZA 4MUVA 2XLGA 4P9GA 1ULEA 3ALQA 2WNVB 1QJY2 3N36A 1NYWA 3MPPG 3OBRA 1W6OA 1RUC1 3ZMOA 1CR7A 3KS7A 4AI8A 3E5QA 1WBFA 1ZX5A 2C5DA 4OHYA 1VALA 3KM5A 4YSFA 1S0JA 2GZWA 1WLTA 1LKNA 4XQDA 4HSLA 1HLCA 5FLJA 5JI9A 4IEPA 2Z5WA 1DYPA 5J3UA 1DGRN 1WLWA 2R30A 3ZMNA 3VZJA 2GC3A 2OW4A 1FOD3 2ZX2A 1NLRA 1SCSA 1PNGA 3AFKA 3AKTA 4HVRA 1VB4A 1AYM1 4DPNA 1A78A 3PMSA 3V0AB 5F9TA 4PBPA 2X29A 4MH0E 3OY8B 4YW2A 5EZWA 3D8CA 1RUJ3 3I7DA 4JDMA 4A7ZA 1UW8A 5KBFA 1ULGA 2Y0OA 3HIFA 3M3CA 4LEJA 1DIWA 1TMF1 3FBMA 1WCDJ 4P9WA 3CEWA 1XXNA 4I02A 1RUH2 1M06G 3M1HA 1FMD1 2ZGMA 1Q3EA 4XFAA 3WP3A 3PVEA 3HQXA 1FPN1 1WCSA 3A0KA 1ND3A 4W6XA 1ND2B 3GZTB 3MFAA 4Y1UA 5JCTA 5FPZA 4ISRA 1ND3C 2GMMA 1QJX3 2ATFA 4CDWB 2CL2A 4ASLA 5CADA 1RMU1 3OCPA 5HBAA 3IIAA 3SH4A 5EJ3A 2NN8A 4PBOA 4DMIA 4XJUA 4P9LA 1NA1B 3LA2A 2UYAA 4MVTA 3RI8A 1PGW1 4GMP1 4I0BA 3LGRA 3O0WA 4IESA 2HWE1 1POV3 3OPZA 3WVJA 4HANA 3WG2A 2A6XA 1K5MA 2ZGPA 3PMEA 4IXLA 1TME2 4BYYA 1LOAA 1JBCA 3S0MA 4M0NA 1KFXL 2GH2A 3MI8A 4RL7A 1RUF2 3IN9A 2HWC3 3ZX7A 4PLMA 3WZ1A 3B01A 4AVTA 1SFNA 2ZA9A 4R4ZA 1AL21 4YG6A 4I30A 4AQ2A 1Y9QA 1EAH2 1ULDA 2WA4A 1BKZA 2Y26A 3R0RA 4N43A 2E6VA 2ZHKA 4G4FA 4I01A 4P5HA 4N43C 3VBUA 5SV8A 5T5OA 1HW5A 2BWAA 1C57A 1R092 3IMNA 3KCYA 5EFUA 3VBUC 3KT7A 2AGSA 2VOKA 2ZX0A 3ZFEB 2X53S 5CFDB 2JG9A 4META 4WM7A 1VAMA 5D1IA 4TSVA 1LU1A 2JG9C 2GSYA 4UBHA 4URTA 4KU8A 1ASJ1 4BH9A 2DVGA 2YUEA 4Q1PA 4H3WA 4FXKB 3DF0A 3RRDA 1RUI1 4D7SA 5JWPA 4IQPA 4K1YA 5JOWA 3AK0A 2JG8A 2XG3A 1IKPA 1J59A 3W9AA 2JG8C 4OUSA 4FTEA 2WZR1 1AR81 1KITA 4QQHA 1CIWA 1HRV1