2AENA

Crystal structure of the rotavirus strain ds-1 vp8* core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
164
Chain Sequence
TVEPVLDGPYQPTTFKPPNDYWLLISSNTNGVVYESTNNNDFWTAVIAVEPHVSQTNRQYILFGENKQFNVENNSDKWKFFEMFKGSSQGDFSNRRTLTSSNRLVGMLKYGGRVWTFHGETPRATTDSSNTADLNNISIIIHSEFYIIPRSQESKCNEYINNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Outer capsid protein VP4, VP8* core
publication title High-resolution molecular and antigen structure of the VP8* core of a sialic acid-independent human rotavirus strain
pubmed doi rcsb
source organism Human rotavirus a
total genus 45
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2aenA01
3FBYA 1YIFA 2A3WA 4UW5A 4OZXA 3WNXA 2WT0A 4NOTA 2P34A 3AXDA 4FQ4A 3FLTA 4RL7A 4FOWA 4YW4A 2UWAA 5F5QA 4YG6A 1MS3A 3AZVA 1IKQA 2XB6C 2C5DA 4JC1A 3N7JA 1D0HA 1SBEA 2VY0A 2W68A 1SLAA 4XHXA 3M3CA 3SH3A 1WUVA 1UPSA 4FPLA 1LHWA 4XBNA 1AXYA 4P9XA 4GALA 5JMCA 3O0WA 2AUYA 1GNHA 2DVBA 4Y22A 2ZHKA 5E8AA 1GZ9A 3RRDA 4Q27A 2D44A 1S0JA 1IOAA 4BOWA 1N3QA 1FNYA 3B69A 2AH2A 4BQ1A 1W6OA 3ZXLA 1LULA 3BODA 1QKQA 2UURA 1GZWA 2GN7A 2ZGLA 2H0BA 2VH9A 1DQ6A 3RMYA 1JXNA 1LOGA 5EYYA 1V6IA 1S0GA 3NV3A 2BQPA 4HANA 4FPEA 2YXSA 1H30A 1GICA 3MW2A 4XXAA 1VLNA 1G7YA 3A0NA 1V6NA 2WSVA 4YG0A 3USUA 2WQZC 4M3CF 5BYNA 1LHVA 1WW7A 2V73A 4BLIA 2VW2A 4LBQB 2ZGNA 3WDXA 1ENRA 3R05A 1CQ9A 3TAYA 5CBLA 5GLVA 5EXOA 1KJLA 4KBBA 3ATGA 5SV8A 3OGGA 1G86A 1WBLA 3WDWA 4DRVA 4ITCA 5IK7A 5T55A 4Y22B 3O0XA 5GLZA 3T2TA 1YI7A 2WSUA 5DUVA 1WLDA 3H0OA 3RMXA 3A0KA 5KXCA 1MS8A 3RG0A 1W6PA 4ATEA 2E6VA 1LOAA 2GALA 2UWBA 2ZMNA 1AVBA 1FNZA 1Q56A 3QCWA 3OPZA 3T1LA 1RITA 3SITA 1DQ4A 4LBOA 2D6OX 2PHUA 2R0FA 2DVDA 4P14A 4XE9A 4XTMA 2D3PA 4YW5A 5GLUA 5JOYA 1DYKA 1LECA 3WHTA 2ZGQA 2Q5TA 4C1XA 3CNAA 3N7LA 1JN2P 4FPHA 1J1TA 1WW5A 5H9RA 3USUB 3PVOA 3NV2A 1WD3A 2B7YA 2ZGMA 4XJ9A 4FQZA 2DUOA 3VKMA 2HYKA 2ZGOA 2ZGUA 5GZDA 3INAA 2A6YA 1UZYA 4FP3A 4MYEA 1Y7BA 3AXEA 1LHUA 2OW4A 1G9CA 3SNMA 4XJAA 3VV1A 2DUPA 4JCKA 3LSDA 2UWCA 2WJSA 2D6KA 5T54A 4YFZA 1VAVA 2SLIA 2P3KA 1QMJA 1LHNA 1W0PA 4YGDA 4Z8BA 3FUOA 3TB0A 1FYUA 4Q1PA 2P37A 5GALA 5DG2A 5CA6A 1W6PB 2A5ZA 1N1SA 1O4ZA 3VKLA 3M3QA 3D5OA 3WLUA 2ARBA 2ZMLA 3ZXJA 4BM8A 1JUIA 1R1ZA 2P3IA 1CPMA 3AYDA 2PHXA 4FPYA 1LGBA 3OBTA 2EAKA 3DGTA 4XHBA 3IPVA 1H9WA 5GZFA 1JYIA 1UAIA 1V6KA 4L8QA 2DVFA 1QNYA 2JDZA 3SISA 1LENA 4U36A 1QOOA 1S1AA 1FAYA 1EPWA 1GBGA 4YZ1A 1FATA 2CWSA 1HQWA 2ZACA 1Q8VA 1C1FA 3N7KA 3ZXKA 1LOEA 5IK4A 1ULFA 1N1VA 3ZSMA 3ZPYA 2GNBA 4WVVA 3ZSKA 1LESA 2EALA 3AP9A 2OVUA 2NM1A 2ZMKA 3B01A 4YFWA 3WDYA 2NMNA 4IQPA 1I3HA 1LGCA 3RSJA 1W6MB 3M3OA 2NMOA 3WG4A 4AVSA 4LBQA 1HDKA 2ZHLA 1X50A 1WLWA 4U2AA 2P3JA 3WG3A 1CR7A 2DU1A 4XMIA 2YMZA 1KITA 4K1YA 2OUHA 2AGSA 4AGVA 2E51A 4PBPA 1QGLA 3SLIA 4YZ4A 1N3OA 2EIGA 5FREA 3IN9A 1VAMA 1AX1A 3IPVB 5E89A 2A3XA 1AXKA 1FX5A 2ZA9A 2V5YA 5JOZA 1MS0A 4RA0A 1UL9A 3B9CA 1PZ8A 4Q2FA 2R0HA 1S0DA 4YG3A 1KRIA 2A6XA 2A3YA 4AVTA 1QDOA 3NV1A 1Q8PA 4XJ8A 3UJQA 1Q8OA 4K1ZA 1JHNA 1Q8SA 2D3SA 4Y1XA 3PVNA 4BLJA 2A6ZA 1G9AA 4TZDA 1A78A 2A70A 1GSLA 1Z78A 1CPNA 4FPJA 1CN1A 2CWMA 4BMBA 4DQAA 2NYYA 4FPGA 2TEPA 1MS1A 2EXHA 1CESA 4ISRA 2ZHMA 1G9BA 1D2SA 2JJ6A 4M3CA 3M2MA 3ZSLA 3ASIA 4YW3A 5DUUA 1N1YA 4LBKA 1WW4A 4AWDA 2AYHA 2E7TA 4YLZA 1YO8A 4WVWA 4AVVA 3OBRA 1UKGA 3OYWA 4FOVA 2ZHNA 4XBQA 2WT2A 5CAZA 2GNMA 3IM0A 2R49A 1F5FA 4FOYA 4YW1A 1DHKB 2D3RA 4PQ9A 4AGRA 2NP0A 1ENSA 3AP4A 2W39A 1DQ1A 1XQNA 4XZPA 5GZEA 4JRAA 3DUIA 4DS0A 3V0BA 3VKFC 3WG1A 3I4IA 1V6OA 2JKBA 2RHPA 4K21A 3NWKA 4SLIA 3RS6A 2E53A 4D69A 2CYFA 4XMAA 1WW6A 1NXD1 2CNAA 1SLLA 3POSA 3JU9A 5IK8A 2D6NA 2DUQA 5KXBA 1OQ1A 1MS4A 2JE9A 4FP2A 4PBOA 3HR9A 3R4UA 4YZ2A 5KXEA 1IS5A 2OUJA 1UMZA 1MVEA 2WLQA 3WZ1A 4YGCA 1QNWA 1ULGA 2A75A 4M3CB 2WNEA 5F9TA 1HLCA 2VU9A 2EXJA 3AJYA 2NZ9A 4WV8A 1Z0HA 4XYXA 1DZQA 2ZGKA 3NV4A 1AXZA 1CONA 1N1TA 4Q26A 2D6MA 1DQ0A 3ENRA 1LGNA 3AP7A 4Q8KA 3AK0A 1BZWA 1LEDA 2ZABA 3O5SA 2EF6A 3OYWB 1IKPA 2JECA 4YZ5A 1BXHA 2ARXA 4R9CA 1W0OA 1W6MA 2DTWA 1LODA 2R1DA 5GLWA 2A6VA 4YGEA 3R4SA 1C1LA 3V0BB 3POYA 1GLHA 4XXPA 2GMEA 4XDQA 1W6NB 2EXIA 3VKOA 3D4KA 3WV6A 1A3KA 1ONAA 1SCSA 1N3PA 5IUQA 1ENQA 3FUQA 3RQ0A 3WUDA 2ZGPA 1W6QB 3GALA 2GNDA 1SFYA 3T1MA 1CJPA 5CNAA 1F31A 1KQRA 3QLQA 5DG1A 4XJUA 1JOJA 4PF5A 2GN3A 3WUCA 4PCRA 3UL2A 3WOGA 3O0VA 1A8DA 3WG2A 3AZWA 5HCAA 4GWNA 3N7MA 5DZFA 3WCSA 5T5PA 1MACA 1U0AA 4AYUA 2VXRA 2ZZJA 4Y1UA 2DYCA 1AX2A 2FHRA 2D6PA 3POWA 3V0AA 3WHUA 2GDFA 1LCLA 3N35A 2PHWA 2DVGA 3LSEA 4ASMB 4FPFA 2D7FA 2W08A 2E7QA 2YZ4A 2A71A 1WCSA 3VKNA 1DQ5A 1G8WA 1V6JA 2AREA 3KQRA 1DIWA 3PMEA 3BOPA 1KJRA 2ZGTA 3W58A 4K20A 1H9PA 1WD4A 5FRAA 4R9BA 1ZM1A 1RINA 3N36A 4ZKTB 2DTYA 4P9YA 2G4IA 1KDKA 2I2SA 4CRQA 3W59A 1GANA 3BTAA 3AYEA 4FPKA 4GWMA 1SCRA 2YY1A 1VIWB 3SH4A 5JOWA 2DVAA 2PHRA 4GKYA 1LOFC 4R9DA 1AX0A 1S0IA 4XILA 5CB7A 1SLIA 1Q8QA 4FPCA 3MPPG 2C9AA 4FOQA 2ZAAA 4TYSA 1SLBA 1SBDA 2VW0A 1QOTA 5T5OA 5DXDA 4GA9A 2KM2A 3UK9A 1LOFA 4XJZA 2WKKA 3AYCA 3BIWE 4ATFA 5JDBA 4HL0A 1BYHA 3FFZA 1V6MA 1LJ7A 4F83A 5T52A 2ZGRA 1YXWA 3V0AB 4UW3A 4GKXA 3U4XA 2PHFA 2ZKNA 1LOCA 1AJOA 2A6WA 3V64A 1MR5A 1IS3A 3AZXA 2NN8A 1B09A 4UW6A 1SLTA 3ILNA 4M00A 4R9AA 3L2YA 3MW3A 4XOGA 1GNZA 3O12A 1QF3A 1CIWA 1GZCA 1BQPA 2PHTA 3IMNA 4LBMA 4Y20A 4Y26A 5DUWA 5T5JA 5T50A 1CVNA 1UN1A 4WZFA 5JLVA 1I1EA 1YYNA 1JYCA 1NLSA 1LOBA 3PVEA 1FV3A 1SBFA 1SLCA 2SBAA 1WLCA 4LBLA 2CY6A 3N3HA 4LBJA 2R16A 3V65A 1LU1A 3A4UA 4Q8LA 3ZYPA 3ZXEA 1OKQA 3APBA 1O4YA 1LHOA 1QOSA 5DZEA 3OY8A 1DFQA 4YM1A 3WCRA 1MS9A 4YM3A 4LBQD 4GXLA 1W6NA 3ZYRA 4YGBA 5GZGA 4Y1YA 3MW4A 5KXDA 5LK5A 1APNA 5EYXA 1G9FA 1AJKA 1IS6A 1DYPA 2UU8A 3ZVXA 3UJOA 1W6QA 4AGGA 1V6LA 3AZZA 5GLTA 1C57A 3Q9OA 2GMMA 5H9QA 1BKZA 1C4RA 4CTEA 1MZ5A 1OFSA 1UZZA 1ZA4A 5IK5A 5GZCA 3ZSJA 2LALA 1GYKA 3AJZA 4W65A 4FPOB 2JD4A 2YV8A 4ZXKA 3AP5A 1MVQA 2A7AA 2CTVA 1W6OB 1DLLA 1LU2A 2ERFA 1LEMA 5T5LA 4Q1RA 2D6LX 4Y20B 2PELA 1DGLA 1HKDA 3AFKA 1PZ9A 1GZWB 1MS5A 2ENRA 3ILRA 2LTNA 1HQLA 1PZ7A 4H55A 5L73A 4P9WA 5JOXA 2VUAA 1SACA 5AVAA 4DFSA 1JBCA 1LTEA 2ES3A 4Y1VA 1ULDA 2Z42A 3C2UA 5HCBA 3MEPA 2WT1A 3ILFA 2JE7A 3FLRA 1JW6A 3OY8B 5DUXA 4BMEA 3WDUA 4YM2A 3ZXFA 2ZBJA 4CZSA 3KM5A 1QU0A 4XIKA 3WDTA 1DQ2A 2W52A 4Y1ZA 2D43A 1G9DA 4XTPA 2VW1A 3I8TA 3OJBA 1S0EA 3D6EA 4YW2A 1BJQA 2CL2A 1ULEA 1URXA 4XIOA 4M01A 3SH5A 4DPNA 2AR6A 1N47A 4C1WA 4ISQA 2DWRA 2DV9A 3AYAA 3VUOA 4DRRA 2GMPA 1VALA 4LBNA 3WVJA 5DZGA 1MZ6A 2P2KA 5EWSA 3FLPA 1V00A 2FMDA 4NO4A 3GNEA 1KDMA 1FV2A 2EXKA 4M3CE 2ZGSA 1S0BA 5JVVA 1YRZA 5HCFA 2XG3A 1S0CA 1GV9A 1F9KA 3JUUA 4BPZA 5GM0A 2YROA 3HN1A 2GNTA 1UX6A 1WBFA 1RIRA 3M3EA 4YZ3A 3PJQA 4Y24A 1ULCA 2AENA 4XJWA 2DURA 1GKBA 5H9PA 1DBNA 3AP6A 5H9SA 1IS4A 4XBLA 4I30A 3LCPA 1AZDA 3WDVA 5IT6A 4YM0A 3AZYA 5GJ6A 2DU0A 4UW4A 3AX4A 1QDCA 3HMYA 4FVVA 3M1HA 3B00A 2R1BA 5E88A 3IKWA 3B3QE 1AF9A 1S0FA 1TEIA
chains in the Genus database with same CATH superfamily
1OLMA 3OCPA 1C8NA 4GH4C 1QJX1 4NOTA 3AXDA 4FQ4A 3ROUA 2J1TA 5K0UA 2ZX0A 1PHMA 1UY1A 2VC9A 4AFMA 1AR83 3N7JA 1SBEA 2W68A 1JZ2A 4OI1A 3CL1A 2NP0A 3AMPA 2Y64A 2QUOA 4P9XA 5BPXA 5A70A 5JMCA 4Z2WA 4LO8A 5DABA 2WZR1 4GMP1 5AFEA 3OBAA 5FPBA 5E8AA 4AI3A 1KD7A 3NJXA 1N3QA 1FNYA 3M7AA 4BOWA 4QPGC 3ZFGA 1RXFA 3WQ1A 2RDNA 3KQ4B 3MIDA 4SBVA 1SDDB 5F39A 2XHKA 3WNKA 1IPJA 5FK7A 2GN7A 2WBKA 2ZGLA 4MH0E 2WYSA 4CDWC 2V09A 1AYN3 2OPKA 2K9ZA 1LOGA 3KV6A 3RYKA 3SCHA 1V6IA 1S0GA 2QKDA 2WWSA 2VZPA 2BQPA 4YSFA 1ZBE1 2YXSA 4CA9A 2RJLA 1VLNA 3DN7A 3U1XA 3A0NA 5ABJB 1V6NA 2WSVA 4C0BA 1R092 4IV1C 1UY0A 2HEYF 1LHVA 1BBT3 1WW7A 3LPGA 5J37A 5CFDB 2VUJA 3UETA 1NOVA 2WO7A 4BLIA 2VW2A 5JXGA 4XZUG 4OHXA 3WDXA 3KHCA 3LF7A 1MZFA 2OKXA 1J83A 3UT0A 3U4SA 1R1A1 4IGPA 3HOBA 1Y3TA 4DUWA 4B4RA 2JDHA 5J36A 1UY4A 3WDWA 2JWPA 4QX2A 5FOJB 2VECA 2OT7A 1YI7A 2WSUA 3T2TA 1WLDA 3H0OA 2XQRA 5D2AA 3VZNA 4DY3A 3RG0A 2Q8OA 5KXCA 3O7OA 1KS5A 1W6PA 5LEJA 2YPDA 1NCQA 3JB4C 1AVBA 2HWF2 5A1LA 3OPZA 3ZX7A 4IERA 4LBOA 1H6YA 2BDRA 2WFF3 4S2DA 2D3PA 3H7JA 4QPGB 4DXTA 2ZX4A 1OQEA 1A8MA 1VR3A 2WRAA 4MVTA 4UFLA 1ASJ1 1OD3A 3ZYJB 3RJRA 3D8CA 2TNFA 1JN2P 3J8F2 5BNPC 3NRUA 5C9AB 3USUB 4DXRA 1OD5A 2JD9A 3QACA 2BFUS 3U0ZA 4FQZA 3IDBB 2ZGOA 1RUG3 1RUH3 5SV5A 4UWDA 4Z82A 3I7DA 3WQ0A 2OW4A 3OG2A 2J1EA 5JPNB 1G9CA 4FAGA 2N7GA 2IXCA 3VV1A 4IV1B 5FJHA 4CCMA 2Q1MA 5HXMA 4JGZA 2B8MA 2W9XA 2O8OA 4LEJA 1PO11 4Z2AA 2XBO2 4QU1A 3MFAA 1XE8A 4PLOA 1NYWA 3TB0A 3URFA 3VBFB 5FZGA 2P37A 1ST8A 4Q4W1 3RI8A 4CXYA 4XFGA 2JG8A 5CA6A 3MI8A 1V9U3 4BM8A 1YJKA 1RUF3 2ZMLA 4HLTA 4XUQA 4BQ4A 1JOBA 4M0NA 3AYDA 2PHXA 4FPYA 1MEC2 4RN5A 1LGBA 1TME3 5C3SA 3OBTA 1PGW2 2EAKA 4WM8A 2Y6HA 1JU3A 2LUWA 1RJ8A 4AHYA 4CYDA 1YWKA 1AR62 1QNYA 1MZEA 1E5IA 2X53S 3L2HA 4XUNA 5JMOA 1LENA 4U36A 4KU8A 5A3WA 1S1AA 3VHPA 4COVA 2VZTA 1BMV2 1GBGA 3IAPA 1FATA 1FXZA 2CWSA 3LDBA 4QQ2A 3WW3A 4EJRA 1Q8VA 3I2KA 3CJIC 5IK4A 1IHMA 4DXSA 3JD71 3KT4A 1GWMA 1N1VA 1AL23 4WVVA 5FZBA 3ZSKA 3ZSMA 1HRV3 1LESA 2EALA 2QQMA 5J96B 1QJY2 5JZGB 5EJZB 4D7TA 5BNPB 3PUSA 3B01A 1NE4A 4CVUA 2BGCA 4G4FA 4RYDA 4DEQA 1LGCA 3H7YA 4FFHA 4XQDA 1NXMA 1VJ2A 1YHFA 1NX9A 4P08A 4CCDA 3TEZA 1VBA1 1W6MB 2NMOA 3M3OA 3THDA 4AVSA 3H3ZA 2ZHLA 1X50A 2TUNA 1H2NA 3WG3A 5LY1A 2DU1A 4XMIA 2C4XA 1QJFA 1XSQA 2ZTNA 2E51A 1RMU2 3ZLIA 4Q4V3 5C3QA 2RJ2A 1VMJA 1VPHA 1VE0A 1WZXA 1OUXA 1PGSA 2EIGA 3CHXA 2P4EA 3NQHA 4K8RB 1UQXA 3IPVB 4I2OA 4BIFA 4MUVA 2EIBA 1AXKA 1EV12 1FX5A 4QD2A 4RGKA 3PDQA 4V2VA 5BNOB 1UL9A 4INDA 2NPIA 5BNNA 1BVP1 3JQXA 4AVTA 4DUXA 1XYOA 4L97A 1QDOA 3SMHA 2O1QA 4QX3A 3BTZA 1CX1A 3DYPA 2D3SA 2RS52 1W99A 1OPOA 2A6ZA 5FKBA 1A78A 1XOYA 5J48A 1GSLA 3CQOA 3LD8A 1CPNA 4FPJA 4KNCA 4PIXA 1XBFA 3W9AA 1QJU1 3NJVA 3CEWA 3IDEA 4XDOA 1V70A 3CJIB 3Q8AA 3VDDA 2ZHMA 5C5TA 1YFUA 2JJ6A 1H1AA 3ASIA 4YW3A 3K3NA 1N1YA 2C0ZA 3ZFEA 3GGLA 4LBKA 1AR82 4IV3B 3U10A 3TWIA 1I9RA 4DIQA 4WVWA 1I5ZA 3OBRA 4Q29A 4CCKA 3CDZB 4D8MA 4NRPA 2NLRA 3DXTA 2FCVA 1YUDA 4WZCA 4QX7A 2D3RA 2VE1A 3GBGA 1AR73 2W39A 2RDQA 2XLGA 4DS0A 3D82A 1W3XA 2ZX1A 3C8XA 3WX5A 1V6OA 3A22A 2KD7A 4K21A 4SLIA 3AFGA 2E53A 4LLOA 4BYYA 5AFBA 1DU3D 2CNAA 3UKVA 3OD0A 2ORZA 2ZEXA 3AL5A 3V65A 3BTXA 1AYN2 1UOGA 5FMOS 1MS4A 3JBG2 4FP2A 4UF0B 4PBOA 4Y5Z0 1H8TA 5KXEA 4YZ2A 5J98B 5KR7A 4H7LA 4F3JA 4HG6B 4XFAA 3AM2A 3WF1A 2FCUA 3VD7A 3WZ1A 4KWJA 1NKGA 2A75A 4M3CB 5FYVA 2IXKA 2WNUC 1HLCA 2VU9A 3P6BA 2G9GA 2CU5A 2HWE3 4NROA 4IDZA 1UMHA 4Q26A 2VULA 1LGNA 1BZWA 2W0XA 4KWLA 2ZABA 5IW0A 1RUE3 3LOIA 2JECA 3OYWB 2JDAA 5C8CC 3CKHA 4YZ5A 1PVC3 2OZ6A 2DTWA 3WXPA 4PI2A 2CAUA 4K40A 2E32A 2A6VA 1Y43B 1LRHA 3FBMA 3V0BB 5DDJ1 3H8OA 1UYXA 4JHTA 4XXPA 1WA4A 4K9SA 2VNOA 2J1SA 4N43A 1A3KA 4CDQA 1H4HA 5FYCA 5HI0A 1JTZX 4QGLA 3QBQA 2ZGPA 2EA7A 3MV11 3OEAA 2WFF2 2XVGA 1OUSA 3EO6A 3OGSA 4DZGA 4E4ZA 5CNAA 1F31A 3ABZA 3THPA 2IXHA 3WUCA 4PF5A 2GN3A 3SQOA 5AC93 2J42A 3B7MA 3VBSA 3WOGA 2D5HA 4QQPA 3WEZA 4C91A 5IAXA 4XUTA 1HB1A 1A8DA 4ZONA 1OPMA 1L7RA 1XC6A 2HEWF 5DZFA 5T5PA 1AHSA 3CIHA 3OD4A 4AYUA 3RZMA 2VXRA 2VNRA 2GC3A 2ID4A 4D6QA 5B4NA 4P9GA 1CGPA 2VOKA 5CFCA 3IWZA 1W05A 3TBDA 3NKGA 2WNUB 3ORJA 4IL7A 4QPIA 4CCJA 2KR2A 3HT1A 1DIWA 3BOPA 4Q0SA 1AR92 5A7PA 1Y9QA 1RHI3 5FRAA 1RINA 2BNNA 4N7UA 3VBRA 3ZN4A 4AI8A 2PYTA 1VRH1 1KDKA 1AYM1 5HPOA 4A44A 2VCAA 1RUF2 3BTAA 4XCAA 4DMIA 3ECQA 2WO3A 4LUKA 5FV3A 2YY1A 1TME2 2W1SA 2BNOA 3LA2A 3ZFFA 5IWFA 2YC2A 4P5YA 2W46A 3UV9A 4G9SB 2ZAAA 1BEV1 3QH6A 1D4M1 4A6SA 3NL1A 1QOTA 4GB33 4W8JA 1O5UA 4LORA 4S2FA 1RUC2 1JUHA 4BIOA 2WKKA 1C8M1 4ATFA 2ZCWA 2BUKA 3ES4A 2ZJCA 3FFZA 4UBHA 1K5MA 3RZJA 1NQDA 5F5CA 1CZTA 1AL22 2HBUA 4JGYC 5FTTC 2XQXA 1HRV2 1PNFA 4IGOA 4QX0A 4CPBD 2JEMA 5FZCA 1AJOA 1FPN3 2B46X 3V64A 1O8SA 3I2IA 4P9LA 4R9AA 5K4LA 3RZKA 3NNFA 4RHV1 1CIWA 4LBMA 4Y20A 4I0AA 1O8PA 4WZFA 1YYNA 2OA2A 1TE1B 3VZMA 3MIHA 3F2ZA 4WVMB 4XEZA 2CY6A 3VDCA 2XWJB 2BWCA 5HCHA 4Q0VA 4IE7A 1R081 1UYPA 2CV6A 4KU7A 3ETQA 4L2NA 5FQ0B 3A4UA 2WINB 1W8HA 3GM8A 1RTVA 3WF4A 3CBNA 5DZEA 5FIXA 2GSYA 4PI0A 1TMF3 2PAEA 4JHZA 3VDDC 5DAQA 1QWRA 3VZJA 1O6UA 5GZGA 1E5SA 3HPNA 4MO3M 4E4SA 5KXDA 3VZKA 3ZYFA 1BCXA 5LK5A 1APNA 4QX8A 1AJKA 4N9IA 1DYPA 1W6QA 3WF3A 1DG6A 3AZZA 3LA7A 5GLTA 1WLTA 1U5YA 2GMMA 2OQ6A 1AL0G 2ZEZA 4HMZA 1OFSA 3AKQA 1FMD1 4KBZA 2GZWA 5IK5A 2P6CA 3DECA 2RS13 1D4VB 2WA3A 4DOUA 3IBMA 3AJZA 5FCCA 2QQLA 2WQ8A 3TN93 3EXUA 4JRLA 3ZFGB 1J58A 5T5LA 2FDJA 4EZ4A 4R4ZA 1MS5A 3ILRA 2LTNA 2VVFA 2BU9A 4I09A 5LRSA 5A7OA 5A6QA 2BBAA 5A6ZA 1JBCA 1RUH1 3U11A 3OUJA 1ULDA 3OSDA 1DGWX 3C2UA 3MEPA 1AR72 1W3VA 4CCNA 1U5IA 4YM2A 4XPVA 2ZBJA 4YYOA 5LEKA 1QU0A 4XIKA 3WDTA 1DQ2A 3AKPA 4Y1ZA 2E26A 5A7QA 4AFAA 5F8PA 3PU8A 2VW1A 4UFMA 2BW8A 1S0EA 4LA3A 4B3NA 2BERA 1JZ3A 4A3ZA 4JDMA 2PN5A 4XIOA 1OURA 4AEDC 3GCXA 4NWWA 1HW5A 3RPQA 2JG8C 4ISQA 3WINE 1V9U1 4TN7A 4YPJA 3VUOA 5FZDA 2F4LA 4N8MA 1F5JA 1MZ6A 5L7OC 3O14A 2WZEA 1JMUB 4NO4A 4MOAA 1KDMA 3ZDSA 2EXKA 5IHRA 4IEUA 4ONUA 1EAH1 3IZOA 5I91A 4CCOA 1NCQB 5JVVA 1YRZA 1W8TA 3HBZA 5HCFA 5ACA1 2Z5WA 1S0CA 5TSWA 4AFBA 3O1OA 1CAXA 3VBUA 2B39A 4AG4A 4BXFA 4YARA 5JIUA 2YROA 1OH3A 2IUWA 2VAUA 3AMHA 1WBFA 3HN1A 2QJVA 1HXS2 4BHPA 3M3EA 2VQUA 2J1AA 1RUE2 4GULA 4CDXC 5JXHA 2VCMA 1ULCA 1PVC2 1ODNA 2DCJA 1NAEA 2WAOA 1YEWA 3T2OA 1DBNA 5H9SA 2WR9A 3FX3A 2YDEA 4E8DA 5HV4A 3NNMA 1PO23 5IT6A 4XF0A 5GJ6A 5C4WA 4KWKA 1UWWA 4RQPA 1ZRFA 5L36A 3IKWA 3OGRA 3B94A 2EICA 1S0FA 1R093 1YIFA 4DY5A 5FPXA 4BQ3A 2WT0A 2P34A 1RUI1 1OA4A 5AC92 4YW4A 3FL7A 2UWAA 3I3MA 3ACFA 5F5QA 5FMBA 1A34A 4YG6A 1MS3A 2UY8A 3AZVA 3MUZ1 3AB0A 4CP1A 4AEDB 1SEFA 3CO2A 1D0HA 3AC0A 1J3QA 2JG8B 1POQA 3H3LA 1SQ4A 3M3CA 3SH3A 2XHNA 4FPLA 2G1MA 2VMFA 2JICA 1IPKA 3LA3A 4KMQA 4YVSC 1VRBA 3LEKA 2F4PA 4GALA 3X29B 1ZRCA 1QJEA 1XNDA 3RRDA 1GZ9A 1VP6A 1Z7S3 4WM8B 2D44A 5LATA 1S0JA 1IOAA 2RVAA 3K51A 3O1RA 4GIQA 5BY5A 1W0NA 2HWF3 4CP9A 3E6CC 3ZXLA 4OYUA 3WW2A 1LULA 1FOD1 2K46A 1QKQA 3ME2A 4OHWA 1GZWA 2VH9A 1XPWA 5LY2A 4CDXB 5A6YA 3CMGA 1JXNA 2VD7A 3WP6A 5FUNA 2Q8DA 4HANA 4J25A 4OI0A 3J8F3 1G7YA 1QIQA 1O3QA 1Q43A 1F2NA 4YG0A 2Q8EA 1JZ7A 5BYNA 1WMDA 1STMA 2V73A 3B9IA 4GB32 3VD5A 2Z79A 1OI6A 5FP9A 4H3WA 4OUMA 4Q5OA 3TAYA 5GLVA 5EXOA 5FWJA 1J3PA 2VZUA 3ATGA 2XLFA 4IEOA 2VTFA 3P1IA 3UYJA 4QKDA 3ZYBA 5FZAA 1NY71 3OGGA 1G86A 3MBWA 5FZKA 1F8VA 2FDGA 4Y22B 3O0XA 5GLZA 2RM21 1YQCA 3S5QA 2CGPA 4NE9A 3RMXA 4NIGA 3C7EA 2Q0AA 2E6VA 2UWBA 5BNNB 4NIIA 2WIIB 4YVWA 4YW7A 1MEC3 5D1IA 4UFKA 3FMGA 5FXVA 3TNQA 5FY8A 4A42A 2YFZA 2QFEA 2XJUA 5LBBA 3DL3A 2DVDA 1WMEA 3KLSA 3ZYIB 1RVF2 4JKKA 1LECA 3WHTA 2ZGQA 3WP4A 1NCRC 2Q5TA 4LMFA 3N7LA 2HWE1 3RYPA 1JYWA 1VBB2 1B35A 4CU6A 5H9RA 4MHUA 3PVOA 1PIV1 2VQTA 1TMF2 4Y33A 2XR4A 2ZGUA 3DEMA 4Y5SA 5GZDA 1NZCA 1HN1A 3AKSA 1ZBE2 1UZYA 1QJY3 5IAVA 3ZFEB 4AK3A 5A32A 3MZHA 1JOPA 4CXWA 1YQ5A 4HZFA 4XJAA 3KSCA 4JCKA 2C26A 2UWCA 2WJSA 5JIAA 2Q8CA 5T54A 4YFZA 2YG0A 1UO9A 2E7AA 1VB2A 1YCIA 1ULOA 2J1UA 1W0PA 3GZEA 4YGDA 2RS12 4Q1PA 2EIDA 2R061 2P3YA 1POV1 3KZ4C 4PIYA 5GALA 5D8AA 2JDUA 2A5ZA 2BEOA 3M3QA 3D5OA 4HN0A 2ARBA 1RMU3 4M4RA 4AEKA 3H42B 4OCTA 1EY2A 5IVBA 1JUIA 2W91A 1W2AX 4AHWA 3K2OA 4K3UA 1XNKA 4NUBA 4B29A 5CVRA 4ZS2A 4CDUA 1XNAA 4JKMA 2R072 3WNLA 3DGTA 2V72A 1GQPA 1R64A 1EV13 5EFUA 5GZFA 1V6KA 2JG9C 4L8QA 3A7QA 2JDZA 1ENXA 5I0RA 4PLNA 4BE3A 4NHXA 1CIYA 4YZ1A 2J1RA 1QXJA 2ZACA 2QQIA 3LFMA 5JSRA 3BIEA 1C1FA 4ES8A 3UKTA 2HYXA 3MIGA 5A1FA 3E6BA 2ZEYA 1CX4A 4URTA 3ZPYA 2JB8A 1HV1A 3AP9A 3VBHA 5KWRA 5LB6A 5LCWL 3W20A 1F15A 2WS93 4IQPA 4WM7A 3EBRA 1DF0A 1QEXA 2ORXA 3H8UA 2RR13 3OUHA 4G3YC 3VBRC 4HVQA 5G04L 4W4ZA 3CZUA 5A3PA 4PHZA 3ETPA 3SEEA 4LBQA 1UOJA 1QJZA 4QQLA 1WLWA 2XMLA 2FDIA 1XE7A 2YMZA 2W87A 1BVVA 2OUHA 2QQWA 1UU4A 4JVAA 5FPZA 1OBNA 3ZMOA 1O4TA 3M4FA 4JZRA 4N43B 4CDQB 5F2WA 1RUJ1 4AVBA 1VAMA 3WT3A 3HJRA 4ASKA 1O7FA 2A3XA 1POV0 3O1VA 2Y34A 4UFHA 4AQTA 2QQPA 4W6WA 4QXKA 3VBSB 1L7LA 4Q2FA 3I59A 3NW4A 1ND2C 1S0DA 1PMHX 2A6XA 1I5PA 2A3YA 3LIHA 4PDWA 4X6QB 3VLBB 1PNGA 4XABA 3MYXA 4PJYA 5C9AC 1S4CA 1FPN1 4HK9A 3RI9A 5LASA 3JBG3 1PO22 3UJQA 2JG9B 4K1ZA 2VBBA 2IC1A 4ZZ5A 4RR3C 2A70A 4BMBA 1CN1A 2CWMA 3P3PA 4MLOA 4COZA 1ND3A 2NYYA 4FPGA 3HIFA 4DQAA 3G6JB 4D7SA 4ISRA 4AW7A 2FDFA 2YFUA 3N9LA 3M2MA 4FI9A 4QHZA 4BB3A 4R52A 1TNFA 4JDOA 3SC7X 2E9QA 3BKZA 4YRDA 1TQ5A 1YI9A 1WW4A 3WNPA 4AWDA 3HVDA 4RGGA 4LOTA 3VD9A 3VBRB 4YLZA 1UXXX 3VBFC 5FO7B 4LO4B 4BZ4A 1YO8A 4D3WA 2GC1A 4AVVA 1E5HA 3IB3A 5FY9A 4FOVA 1VBA2 4XBQA 3S6PA 1YQ8A 5CAZA 2GNMA 3IM0A 4BU2A 3G7DA 1F5FA 1YQ6A 4MSVA 4RS5A 3ZFFB 4N90A 2FCTA 1F35A 1WCUA 1Z7S2 5GZEA 4CU9A 1FI2A 1JYXA 5ERLA 2YGLA 1KGYA 4D69A 3RS6A 2CYFA 2HWC1 1WW6A 2YYOA 4XMAA 4DINB 1DDLA 3WP3A 1SLLA 4AFDA 4QAWA 1PK6C 2D6NA 4ARXA 4GMP0 4PIZA 4LIVA 1C3HA 3KVBA 1OA3A 2VUDA 3FJSA 3K48A 1QXRA 2DFCA 3R4UA 3H1MA 1ND2B 2O14A 2OUJA 4NPRA 1UMZA 5FYSA 3TN91 5JZGC 1X36A 1ZZ7A 2DCTA 1MVEA 5FBJA 4QXCA 2VG9A 2GC2A 2RMU1 3RDIA 1QNWA 1ULGA 1JZ5A 2WNEA 5F9TA 4RR3B 3POEA 2XPJA 4GJZA 2XUEA 4HXCA 2CDPA 3NV4A 1QJU2 1N1TA 1GR3A 2HWD3 1DQ0A 3M70A 4KH9A 4AQSA 2F17A 4Q8KA 1LEDA 2RS32 3BB6A 1KFUL 2EF6A 3LDKA 1IKPA 4P00B 3NKTA 1BXHA 2ARXA 4AAPA 2W95A 4MGYE 1LODA 2MHFA 1AR93 2R1DA 4NIDA 5GLWA 4YGEA 3R4SA 4HKLA 1GNYA 1HRI1 1S2EA 2GMEA 5FPAA 3LGRA 5BNOC 3E97A 4NN0A 5FP7A 3KHBA 3MIBA 4B4PA 5IUQA 3RWKX 1ENQA 3FUQA 3DPRC 3WUDA 3WR0A 3I3EA 5FZ1A 5FZIA 1W6QB 2GNDA 1SFYA 4A6OA 1KQRA 5DG1A 2ILMA 4XJUA 2H6BA 4PCRA 1RUC3 2VPVA 4OI4A 4RD7A 4UT5A 4HN1A 1PK6B 5FZOB 3N7MA 4Y5TA 1QXPA 1YC61 4LK6A 2ZZJA 4N7IA 4Y1UA 5FUIA 4AF9A 1GZTA 3POWA 3TEYA 3V0AA 2OIIA 4A2UA 4HOOA 5C33A 4CEWA 2PHWA 4ZXEA 4IV3C 4ASMB 5FZ9A 1GOGA 1ZRRA 2E7QA 2YZ4A 1CD3G 3C3VA 4H14A 1WCSA 5E1RA 1ZX5A 1G8WA 1XU1A 3H8RA 2AREA 3ELNA 2ZGTA 1ZNPA 4I01A 3V56A 4TTGA 1UXZA 5EIYB 4ZKTB 2WABA 2Q30A 2WUHA 2I2SA 3KB5A 4CRQA 1R091 1XYPA 2X8KA 3AMNA 3K46A 3BVCA 5FYTA 1PVXA 1VBE2 2BPA2 1IQDC 4LJHA 1E57A 3USSA 3AYEA 1EP0A 4CUBA 1SCRA 4EWAA 5JPMB 1YQ2A 5FREA 3SH4A 2GU9A 5JOWA 2DVAA 2PHRA 4GKYA 4JAAA 3MF9A 1AX0A 4XILA 4QXBA 5FYZA 1RL3A 4B7EA 5DAXA 3N9MA 1Q8QA 3J26N 4FPCA 4FOQA 5FY5A 4TYSA 4D6RA 1EPZA 1SBDA 3LQCA 5T5OA 2QZ3A 2KM2A 4CP0A 1W8NA 3DPRB 3WW4A 3WY6A 1M4WA 1LOFA 4XJZA 3F95A 4NHMA 1V0AA 1UCXA 1W8WA 3AYCA 4AHXA 2QQKA 1NG0A 4HL0A 1BYHA 3K77A 4NHKA 5LBCA 1YXWA 2CHHA 4UW3A 1CAXB 5KHKA 3VBUB 3I2DA 2A6WA 1F4AA 1MR5A 2WS92 2WDBA 3O1SA 4FTBA 1IS3A 3DYMA 2NN8A 4LT5A 2RR12 3T0DA 4Q4X1 3L2YA 4XFFA 5FLHA 1L7QA 2UYAA 4COYA 1QF3A 1BQPA 3IMNA 2PQQA 4Y26A 3FHQA 3KGZA 5DUWA 1CVNA 1UN1A 4ASLA 3QH7A 1GWKA 4L0PA 1JYCA 1NLSA 1SFPA 3PVEA 5JI7A 2SBAA 3VBOA 2RDRA 2R16A 2YC0A 2JDNA 2O8QA 2XUMA 4CXXA 2VQ0A 4Q8LA 1VBC2 3ZYPA 4QGNA 2G9FA 3BALA 3ZXEA 5C6CA 4FO9A 1O4YA 5A33B 1QOSA 4FTSA 1AYM2 3WCRA 3OY8A 3CF6E 2X5IC 5LW9A 1JZ4A 5IVJA 5FPLA 4YM3A 4TLGA 1KEXA 5A3MA 1COV3 1ZZBA 2WNVC 3UGHA 3ZYRA 4WBBA 3MV01 3S30A 3FHIB 4Y1YA 1L3JA 4Y3OA 1QH7A 2XBO1 1CAUA 4TSVA 1G9FA 2R7EB 3OB8A 5A3OA 1PGL1 4AGGA 4L11A 5FKCA 1C57A 4GZ9A 5H9QA 1BKZA 1HJFA 4UBGA 5KHJA 1UZZA 4XF1A 2XJRA 1W9SA 1W9FA 2V4AA 3N9QA 5GZCA 1MEC1 2VNGA 2J22A 1GYKA 1C8M2 1RUD2 3KVAA 1PGW1 2JD4A 2YV8A 1MVQA 2QDNA 3NVCA 1VB4A 2B4KA 2ERFA 1AR61 1LEMA 2PLV2 4Q1RA 1VBD2 2GAUA 5FMDA 3AFKA 4DUVA 2DBNA 1GZWB 2FDHA 4QKFA 3LWCA 5JSOA 1BMV1 2WL1A 1B35C 4H2AA 1HXS3 1HQLA 4H55A 5C3OA 2HKXA 4AE2A 2G19A 3KMHA 3UKNA 4RHV2 4C90A 5EQUA 2BOIA 3GHNA 2BP6A 4M0HA 1CAWA 3WP5A 2JDKA 1CJDA 4Y1VA 4AI9A 5FYHA 3ILFA 4QHOA 2V5DA 3HQXA 2DCKA 3DV8A 5DUXA 4BMEA 1WA6X 4QKBA 3WDUA 4CZSA 3S5AA 3PIJA 4IEVA 3MLJA 2D43A 1G9DA 1XU2A 1DLCA 5C5UA 5LA9A 3OJBA 1BJQA 2CL2A 1ZZ6A 4BJ0A 4O9GA 3SH5A 4M01A 2X5IB 4EV0A 2AR6A 3I2HA 1W39A 4QHBA 3MDPA 2WNVB 2ZOEB 4R4XA 5A3NA 3AYAA 3NMBA 3ST7A 4EWEA 3PVBB 2GMPA 4KQ7A 1GP6A 5DZGA 2D40A 5EWSA 4CDUC 1TG7A 1V00A 2HLEA 3S7EA 3GNEA 4M3CE 5DMYA 1S0BA 4DEVA 5FBZA 3E5XA 1UU6A 3JXSA 2HWB2 3PUAA 4YVWB 3OGVA 4D6SA 4NIAA 2HWD2 2WWJA 1OOPA 3P5BA 1QQP1 5E6HA 5FZ4A 4Y24A 2AENA 4GWIA 2RS51 2PHDA 2VMIA 5H9PA 3AP6A 5I0SA 1B35B 4OQ9A 1IS4A 4XBLA 2FZ2A 4I30A 2VNVA 2ZZQA 3WDVA 3KT7A 4OULA 3PJYA 4CCCA 3AX4A 1ULPA 3EQEA 3AL6A 3M1HA 5E88A 5A32B 5K0UC 5FPUA 1RGSA 5LK7B 1AR81 2I74A 4MADA 5ABJA 2GNBA 4UI9L 3FBYA 5FYUA 2A3WA 4FXKB 4M4PA 2FDKA 4LO7A 1Y9GA 3SHRA 5CFDA 4XDPA 4XF3A 2VZQA 4LTAA 1IKQA 2XB6C 2D5FA 4XFHA 2C5DA 2C9KA 2ZX3A 4IE4A 1NLRA 4LE4A 2VY0A 1QJX3 3RZGA 4GH4A 1UIKA 1UX7A 4CUAA 4LQRA 2XL7A 3E1F1 3VD3A 5A7SA 1XE0A 3BI3A 2XJSA 5F37A 1AXYA 2A1XA 3I2JA 3ZFGC 2ZX2A 3PU3A 4CDUB 4LUMA 3O0WA 2AUYA 1GNHA 2YBKA 4MHRA 2DVBA 4PDWC 5FZHA 3RJ2X 3WF0A 5I8YA 4Q27A 1CWPA 3SEPA 1AYN1 3B02A 4BQ1A 4OHZA 1C28A 3ZM8A 3DF0A 3N9NA 1XSRA 2XGXA 5IFPA 3RMYA 2VCBA 4COUA 3MPBA 4AQ2A 1RVF3 4QPGA 4O9EA 2JB4A 1BBT1 5FXXA 4EN7B 5A3UA 3VBHB 4FPEA 5C71A 1H30A 1GICA 3MW2A 4XXAA 1VBB3 3T3YA 3NNJA 4RGAA 3I2OA 4CDWA 3USUA 2XL9A 5FR3A 3B93A 1IQAA 2WYFA 5K0UB 1ZBE3 4LBQB 5KHHA 4BH9A 1ENRA 5J3UA 3T4HB 3CLPA 3R05A 1CQ9A 1MQTA 5CBLA 4IV1A 3ES1A 3PHMA 5BV6A 2GP3A 4KBBA 4LHLA 5BXXA 5SV8A 1OSGA 4KGGA 1NCQC 1DGRN 3WNNA 1WBLA 4XFCA 2KXLA 4J1WA 5IK7A 4JTOA 4A4AA 2K0GA 2YC4A 5DUVA 2VOXA 1BHGA 3A0KA 1MS8A 1R1A3 2WFF1 3GYDA 3N9PA 4XF4A 2GALA 3T1LA 1FNZA 5FFOC 1HX6A 4OHVA 4LR4A 1RITA 3SITA 4PDWB 4MXWA 4NMIA 2R073 5G05L 3ZR5A 3UGGA 4P14A 2R0FA 4XTMA 4BQYA 2VJXA 4BK5A 4IETA 2LM3A 5GLUA 1DYKA 4KL1A 5JR2A 2D93A 1RUG1 3UGFA 1FOD2 3CNAA 3H3UA 4XCBA 4C1XA 1ND3B 5JR7B 2MEV2 4E2SA 5EHDA 1OLME 1ZRIA 4JGZC 3VKMA 3LKJA 2VMGA 5A3LA 1COV2 2VMHA 2MPFA 3INAA 4ZHNA 2R32A 4MYEA 3S0MA 3AXEA 1AR91 1KXGA 1LHUA 5BNPA 1T6BX 3PTYA 5IVCA 1JU4A 3RYRA 3LOBA 1A6CA 5CU1A 2W3JA 2DF7A 1VMFA 1VAVA 3NJZA 3PUQA 1RUF1 3ZIWA 4TWTA 2WA4A 1IPSA 4BISA 3Q8FA 3KD4A 1FYUA 1TME1 4L9BA 1ZBA2 4MX3A 1JI6A 1W6PB 1N1SA 2ZAHA 4WM8C 3ZXJA 3WLUA 4LA2A 2LS6A 2BWAA 1PO13 3FWEA 3VL8A 3POBA 1CPMA 1OF4A 3PURA 2WAAA 2RM22 5C70A 2PAMA 1RUC1 2JDMA 4Q4W3 2B9UA 5JXJA 3HEIA 4XHBA 3HN3A 3IPVA 3MLKA 1H9WA 2R042 4A7YA 5L9VA 1JYIA 1UAIA 2VXJA 3SISA 1AL21 1HV0A 1HRV1 1QOOA 4Z07A 1FAYA 2BVBA 2E31A 1EPWA 4RFT0 4Q4Y2 4CEWC 3RZHA 1W2OA 1HQWA 2G9ZA 2IVIB 3ACLA 3ZXKA 1LOEA 2AC1A 5LWBA 5FZ6A 3BPZA 3C7FA 1W8FA 1GOFA 2DFBA 3IMMA 4MGIE 2WZPP 1GWLA 3ZKUA 1IZ3A 2OVUA 4DO0A 5CADA 4YFWA 3WDYA 4RFRB 3AVRA 1US3A 2ATFA 2NMNA 4W6XA 1I3HA 3CJIA 3JD73 4JGZB 3T4VA 5FOBB 4HBNA 3BCWA 3B5LB 3IAQA 1W8OA 2VUCA 3KCXA 4FBFA 3WG4A 1UYYA 1W2UA 4Q4V1 3IIIA 1DYOA 4P9JA 4LIUA 3O1PA 4KWUA 3GZUC 4U2AA 2P3JA 1CR7A 1XB9A 1UIJA 4QM8A 1KITA 4K1YA 3SCGA 3IIAA 2AGSA 4AGVA 1VBA3 1PM7A 1YFWA 1UW8A 1CAVA 3SKVA 1OMIA 1WWYA 1N3OA 5BNNC 1F4HA 1IGOA 2HJIA 2IZWA 2VCCA 3MGUA 3IN9A 5F5AA 3BTYA 3WQ7A 1FT9A 4KGQA 4X8PA 5JOZA 1MS0A 1UY3A 3B9CA 4RA0A 2XWBB 1O5LA 3LIGA 1KRIA 2XVLA 5ANQA 2J7MA 2RV9A 3NV1A 4BDVB 3J7NA 2BJSA 3MICA 1W8ZA 4XJ8A 3HQUA 1Q8OA 3OGJA 1JHNA 1Q8SA 3BGAA 4QU2A 4Y1XA 4BLJA 4UF0A 4YW6A 5F3EA 3HWJA 4TZDA 3ZFEC 1YIPA 4CEWB 3VHNA 2L9LA 2XDVA 2CGNA 4ZU7A 4R8HA 1MS1A 2EXHA 1CESA 3FHAA 1D2SA 4M3CA 2JX9A 1QY4A 5DUUA 4UXAA 4A7ZA 1QJU3 3LAGA 2BVVA 1UZWA 2C6SA 2XH6A 2ADEA 2ARCA 2AYHA 2E7TA 2RS33 3EB7A 1AR71 1OKOA 3CU7A 1QJX2 4MGKE 1UKGA 3HD8B 3OYWA 3ZIXA 2ETEA 2ZHNA 4XUOA 2WT2A 2DCZA 2R49A 4FXGB 4IW3A 2XLAA 2LROA 5DN2A 3TOJA 1K3IA 4DNYA 3V0BA 2NQYA 4CCEA 3S57A 3I3DA 2H6CA 3I4IA 4W50A 5FY1A 3HNBM 2Z2SB 2WQ4A 1X9TA 1H8TC 2RHPA 3HNMA 1GOHA 4OZOA 5CKNA 2WNOA 5FWEA 4Q0UA 2GP5A 1NXD1 1RC6A 2WZR2 3R4DB 3DYOA 3FC0A 3JU9A 2XJTA 1WMFA 1ALYA 1AUYA 2DUQA 1OQ1A 2VBDA 3AKTA 1T2XA 3POIA 4QX1A 3RVHA 3D0SA 2BV4A 3VDDB 1UU5A 3JQWA 1RUE1 3M3IA 1H4GA 2W1WA 3H1YA 4QT6A 4K6BA 1PVC1 4WV8A 2ZGKA 4F83A 4UAPA 1ZZ8A 4LKDA 2D6MA 3ENRA 1EUUA 1W04A 2IXJA 4NVPA 5F7UA 2I07B 1OC1A 3VBOB 1HB4A 5DAWA 2BGOA 4EN8B 1W0OA 2Y0IA 4CSWA 4N43C 3I2GA 4CDQC 3K4DA 1VAKA 3ZN5A 2VOWA 1TNRA 2OXBA 3LPFA 4BQWA 1HQNA 1R1A2 5C8CA 2QBXA 1W8UA 3Q8EA 2Y0OA 4XDQA 2EXIA 1VBE3 5F2SA 4B4QA 3VBSC 5LBEA 5AC91 3LEGA 1GUIA 1CAUB 1SPPA 5DDJ3 2FD8A 2FQPA 1G6NA 4HVRA 4IEYA 3GALA 4FTEA 3NNGA 1JYTA 1CJPA 5F6KA 1H8TB 1JOJA 4JKLA 1HN0A 1REFA 1VMHA 2ZEWA 2HWC2 4HETA 2VZ3A 5CFCC 1S55A 2EIEA 5HV0A 1J84A 3AZWA 3WG2A 4F7ZA 4IEWA 3WCSA 5HCAA 4AHZA 1D7PM 1MACA 1U0AA 5F5IA 2DYCA 1AX2A 4QPIC 1ASJ2 2D6PA 5FLJA 4HKOA 2IXLA 3IDCB 2GDFA 3GBWA 3N35A 3VB9A 2DVGA 3WD5A 1RHI1 3POFA 4FPFA 4DXZA 2AEZA 4CUCA 2W08A 2XJVA 2A71A 2DDUA 4J6GA 4QB2A 3ZYHA 3VKNA 3EMRA 3KQRA 3PMEA 4E4HA 3EYPA 1KJRA 1SMVA 3W58A 5A80A 4K20A 1WD4A 5KBFA 4R9BA 3T08A 4XAAA 4OVEA 5L9BA 3SXWA 1Q3EA 5HXVA 3ZFFC 2DTYA 1HB3A 2G4IA 3QD6A 3W59A 1GANA 1O3TA 3T2PA 2VQAA 1PO12 2ZS6B 1W9TA 3T0AA 4GB31 4FPKA 3TEWA 5FQ0A 2VVDA 1VBC3 1VIWB 4I0BA 1IG0A 4NHLA 4EROA 5IATA 4Q4W2 1VRH3 1AYM3 1HRI2 1SLIA 5CB7A 1K5MC 1SLBA 2DCYA 2VW0A 1HIXA 1PMJX 4GQ7A 1SFNA 5DXDA 5FP8A 5FDBA 3VDBA 3PLQA 5FY7A 2QQUA 2WN3A 3BIWE 5JDBA 3ZR6A 1BEV3 1D4M3 1V6MA 1LJ7A 5IJRA 5FXZA 2ZGRA 2OQ7A 2QQJA 4N53A 5CFCB 4Z92B 2WC2A 4LPLA 5CEHA 2ZKNA 5LRRA 1C8M3 1RUD3 4IEXA 1OOPB 5L9RA 3AMMA 3JD72 1RYYA 1SLTA 3ILNA 5IVYA 4OQ8A 4GJYA 3ZOIA 4QPIB 4JGYA 1RVF1 4XOGA 2Q4SA 2PLV3 1QHDA 1GNZA 1UOBA 1VBD3 3K75B 3O12A 3Q8CA 1GZCA 5APAA 3ZN6A 1I1EA 2GH2A 2H0VA 1VBB1 2VMCA 1TZOA 1FV3A 3I3QA 2W92A 1WLCA 1TMF1 4LBLA 3N3HA 1GP4A 4RHV3 2UYBA 4Q0PA 4LO5B 3K3OA 2PAKA 3U07A 1YJLA 5ANNA 1W28A 5FY4A 1NA1A 3APBA 4CPBA 1LHOA 4I3PA 4O61A 3WF2A 1MQTC 4I3GA 4O7XA 3M8LA 5F1RA 1OLQA 5IFTA 1MS9A 1X82A 5B2GB 2JIGA 1GU3A 1R083 1W6NA 2BYVE 4GXLA 4OLLA 4AL9A 4YGBA 2W2IA 5CIRA 3MW4A 2AACA 2VMEA 5LA2A 5EYXA 2GH8A 4BK4A 5J7MA 2RS11 2A73B 2VZSA 3ZVXA 2UU8A 4FT8A 4GH4B 3RGBA 1V6LA 1K5MB 1XNCA 4E27A 4QDRA 4CTEA 4E8CA 3WQBA 1MZ5A 4K8FA 4MGQA 2XJQA 3TNPB 1DZTA 2LALA 3ZSJA 2R071 3I49A 2ZXQA 4ZXKA 3RZZA 3AP5A 2BZDA 1BK1A 1DLLA 1LU2A 2HWB3 1ZYBA 1FMD3 4IESA 2D6LX 4Y20B 2LW8A 4LK7A 1J1LA 1J3RA 1HKDA 3ALQA 1PZ9A 2I45A 1ZREA 5BUVA 4QB1A 4P9WA 4Q4X2 5JOXA 4UFIA 1H0BA 2QQOA 4QDSA 4FSJA 4BWOA 1OFNA 2VBPA 4LKEA 5FY0A 1LTEA 2ES3A 4GD4A 1E5RA 5F3IA 2Y6KA 2YU1A 2WT1A 2YBSA 4CDWB 2JE7A 1WMXA 1JW6A 1LAJA 1YNAA 2QNKA 3ZXFA 2Y6FA 3KM5A 3C7GA 2AEYA 2W52A 4Q0QA 5I8SA 3R6SA 4XTPA 5J09A 1H2LA 1NE6A 3I8TA 3TEXA 4YW2A 3VD4A 3D6EA 2IVJA 2BNMA 1MQTB 1ULEA 4NRQA 1NLQA 4ZY9A 4DPNA 1N47A 2Q1FA 3JCIA 4GAZA 4OFGA 3WNOA 2D97A 3KCCA 2DV9A 1UKRA 4DRRA 4LBNA 1HJGA 4P9IA 1H2MA 1Y4WA 3VBUC 4L92A 4E2GA 3VHRA 4ZZ8A 4AEDA 2FMDA 1PGL2 4I0WB 2K2SA 2XXZA 3KT1A 2XG3A 1LKNA 1GV9A 1F9KA 1ZVFA 2HH9A 4JTNA 3CZJA 4BPZA 1XYNA 5GM0A 4CE8A 4MXWB 3U78A 4D94A 5L7OA 2GNTA 1UX6A 2VVEA 4LKFA 1W2TA 5D21A 5AVPA 4BQ5A 1EAH3 1JYVA 4YZ3A 4DB5A 3THCA 5ACA3 3BYWA 1P8JA 1PO21 3VHOA 5C4WC 1GKBA 1C5IA 4XUPA 4RQPC 5FZMA 3ZKYA 2YUEA 3I54A 1OLRA 4XFIA 4CDXA 5BNQA 3LE0A 1AZDA 4EE2A 2EVXA 3E6DA 5I8TA 4YM0A 3HNYM 4J1XA 5CKQA 4UW4A 2ET7A 4FVVA 4ORFA 3B00A 4XQWA 3AKRA 5DDJ2 1O91A 1AF9A 3NAPA 3LFIA 4NJ4A 3GCWA 1JZ8A 1NZIA 4UW5A 4OZXA 4XURA 3WNXA 4RL7A 2TBVA 3FLTA 4FOWA 5C3PA 4P02B 3BPSA 5FAXA 1U12A 4ARYA 5J1XA 5C3RA 2B42B 4JC1A 4QQOA 3GZTB 1SLAA 4Y4RA 1Z7S1 4XHXA 4B1LA 4BXSV 1RUI3 2X29A 1WUVA 1UPSA 4EZHA 1LHWA 3MHZA 4XW3A 4XBNA 2ET1A 4HSLA 4NR1A 2HWF1 3GZAA 1W9YA 4LHNA 3KV4A 3ZO0B 2JDPA 2WLPA 5JXIA 4Y22A 3LB9A 2ZHKA 4IUGA 4LXLA 1OA2A 1OT5A 2JXAA 1SHWB 2QQNA 2VGDA 4QDQA 3B69A 2AH2A 4QB6A 4LE3A 1W6OA 1X7NA 4YVSA 2Y33A 1OXCA 5I0TA 2XOMA 3BODA 2UURA 3VZOA 3J8F1 2H0BA 1OVPA 1DQ6A 1QQP2 3OUIA 4A41A 3TYJA 4CEYA 3N4MA 5EYYA 5C4WB 2JKXA 4UYBA 2VZ1A 1PM4A 2YHJA 3NV3A 4RQPB 5B4XA 5CISA 1FOD3 3BN6A 5A7NA 2P1BA 5IVEA 2W94A 1YFXA 2MEV3 3KWVA 4HKWA 4NPLA 2VR4A 1XXNA 1VRH2 3T0BA 4AI1A 3ZDVA 4MGTA 1Y9MA 2RS31 2WQZC 3EHKA 3NNLA 1EYBA 4M3CF 4AOCA 3LDRA 4F8AA 4OUSA 2QTWB 3IT8A 4LLFA 3GJBA 2ZGNA 4KG0A 2KA3A 4FCAA 5F3GA 4A7KA 1SG3A 4X6RB 1KJLA 2IFWA 1BEV2 1D4M2 3ZSEA 1US2A 3KV9A 4QXHA 5K7PA 1CAVB 5I0DA 4YVWC 4DRVA 4ITCA 2X09A 5T55A 2P5BA 1ZBA3 4AFCA 4H7MA 4Y4YA 3FE5A 4K7JA 4ATEA 3N9OA 4AI2A 1LOAA 4AQ6A 4CP9B 2ZMNA 1GMMA 1ACCA 1Q56A 3QCWA 1O3SA 5FYYA 2IXIA 1DQ4A 2RM23 2XONA 1RJ7A 4CU7A 4KG8A 2P6HA 2D6OX 5I93A 2PHUA 4HPKA 4XE9A 2R043 2RJKA 1K45A 4YW5A 4QQHA 5JOYA 2Y60A 1O3RA 5EPAA 1XJAA 4PQQA 4QWNA 5EZWA 1QJY1 4XAEA 4FPHA 1ZZCA 4Q4Y3 1J1TA 4LHKA 1WW5A 3THTA 5LA0A 2BOJA 3KF3A 3NV2A 1WD3A 2B7YA 2ZGMA 4XJ9A 2DUOA 1BBT2 1DP0A 2HYKA 1R082 3D0JA 5A7WA 1NCRA 2A6YA 1W03A 2J1VA 4FP3A 4E9KA 4NRMA 1Y7BA 1MPXA 2JDYA 2F6BA 2QZ2A 2VTXA 3SNMA 4JQTA 4AVCA 2BTVC 3VN4A 1PIV3 2DUPA 5I0UA 2WWUA 4CCLA 5A1AA 5FO8B 3LSDA 5D8AC 1H1IA 2VTXJ 3WNMA 2D6KA 2SLIA 2P3KA 1RMU1 1QMJA 3JZVA 1VBE1 3OF1A 4QPWA 1LHNA 4Z8BA 3PL0A 3FUOA 1EUTA 2OS2A 3KCYA 3NO8A 4AR2A 3C7OA 5FZLA 5DG2A 1O4ZA 3RNSA 3VKLA 4JV4A 5F6LB 2VL4A 1EV11 3ZYGA 1FMD2 1R1ZA 2AZ5A 2P3IA 4A3XA 3ZXDA 2BGPA 3BU7A 1JS9A 1X8EA 2R063 1POV3 5IVVA 3TRSB 1GQGA 2CAVA 4N9HA 1PX3A 1PX4A 2Z69A 2DVFA 1DGWA 3HAGA 2O0OA 5LBFA 4QMAA 3VBHC 1OVSA 1YFYA 3O1MA 2RG4A 4QPYA 1D0GA 2WS91 3MIFA 3H50A 3N7KA 3AVSA 1UD1A 4WM7C 1ULFA 2RR11 2JG9A 3I2FA 3PUHA 4CUGA 4CP2A 1RUG2 1RUH2 2B5HA 3I3BA 1WKYA 2PHLA 2NM1A 2ZMKA 4TLFA 5K9YA 3J4UH 5C7GA 3PIGA 1I6XA 3RSJA 3I97A 1UZ0A 2VMDA 1GQHA 2X10A 3MIEA 4PLMA 2Y6LA 1WCDJ 1UNBA 1HDKA 1U5XA 3DXUA 5HBAA 4AVAA 1REDA 3GHMA 3ACHA 1VBC1 4E4DX 3J9SA 5D8AB 4EN6B 2IFRA 5C8CB 1V9U2 4PBPA 1QGLA 4XFBA 3SLIA 4YZ4A 4A45A 5FPVA 2VOVA 1SPPB 2X05A 5JAXA 3H8XA 3VGIA 1DZRA 2BFUL 1AX1A 3J7HA 1EAH2 3AMQA 5E89A 2D98A 4ZU5A 5ACA2 3JBG1 1OH4A 3ITQA 3MFCA 2ZA9A 2V5YA 3GXUA 5CG8A 1PZ8A 1RUJ3 2R0HA 3QOPA 4FFIA 4N53C 1S2BA 4OI2A 4XVHA 2WZR3 4GMP3 4YG3A 1ND3C 4FFGA 3O1UA 3GJAA 1WGPA 4RSUA 1RUD1 2IWGB 1Q8PA 2B45X 3C7HA 3PVNA 4CU8A 4LITA 1Z78A 1ND2A 1W2NA 1XNTA 2PLV1 1VBD1 5CKMA 1WCQA 5K8SA 2TEPA 2E33A 3OEBA 4WM7B 2VOTA 5C9AA 5ISLA 3SKJE 2W1UA 2CGOA 4ZU4A 4ET7A 3VL9A 1G9BA 3U75A 1C5HA 2JIJA 3ZSLA 3ZXAC 4PF1A 4FAHA 4RR3A 3GF6A 3EJKA 4BQ2A 1CZSA 2WZ8A 4QM9A 2PA7A 4V2WA 4ZPIA 4C0HA 4RS5C 2XKOA 5FYBA 3O1TA 1NA1C 4MZUA 1RUI2 3OPTA 3MF6A 3U37A 4Q4V2 4EN9B 4KI5M 2Y38A 4FOYA 2WO1A 3CJXA 5DPNA 4YW1A 3T30A 1DHKB 4AI0A 4PQ9A 1UZVA 3IDAA 4AGRA 4LHSA 3VBFA 1ENSA 2CSGA 3AP4A 1DQ1A 1XQNA 4XZPA 5IYYA 4JRAA 3DUIA 3VKFC 5JSPA 3WG1A 3J7MA 2C24A 4BA6A 3RFRA 2JKBA 2WFPA 2FZ1A 3KV5A 4BQXA 3NWKA 3I59B 4V1PA 1GP5A 1CZVA 1X8MA 5FZ7A 5JUVA 4D0QA 2ZPXA 3POSA 4E2QA 1UPIA 5IK8A 3HT2A 5KXBA 3PTRB 3NSTA 2Z4FA 2JE9A 1JODA 3HR9A 4N53B 1IS5A 2HWC3 4AZZA 2HWB1 2RDSA 2FBEA 1Q5OA 4XC9A 1PK6A 2HWD1 4D7YA 2WLQA 2C1FA 4QX5A 4YGCA 5EP9A 5FZOA 2V4VA 2HEVF 2YB7A 4JGYB 2EXJA 3AJYA 2NZ9A 1ASJ3 4OMDA 1TVGA 1Z0HA 4XYXA 3U14A 5JZGA 1DZQA 1AXZA 1CONA 4URAA 3KF5A 3ZN6B 3AP7A 2RMU3 2GC0A 3AK0A 4FFFA 3O5SA 2VZVA 4UOJA 4R9CA 1W6MA 1UYZA 2JE8A 4NAOA 4RS5B 5CG9A 4QKNA 1G9AA 1C1LA 1NA1B 3POYA 2WO2A 1BK0A 2B9VA 1RUNA 3ZMNA 5FZ0A 1GLHA 2CDOA 3JB8A 1W6NB 1NY72 3VKOA 3D4KA 3WV6A 3OOXA 1ONAA 1YLLA 5EV7A 1SCSA 1N3PA 5C8WA 1K42A 2WN2A 2YGMA 4HONA 3RQ0A 1HRI3 1JH5A 4XF9A 1OQDA 3PNAA 3T1MA 4GWJA 3QLQA 1H1MA 1H8VA 5BNOA 3UL2A 2XKPA 2P17A 3ZPOA 3O0VA 2HBTA 1KS4A 3ACGA 3DPRA 1NUKA 4GWNA 5FLIA 2QQVA 3LZZA 5GKAC 2OYZA 4EQVA 2QVSB 3MUY1 4AXOA 4HVOA 2VM9A 3A21A 3E5UA 1NT0A 3UESA 4BCUA 2FHRA 3WHUA 1LNSA 2HWE2 1LCLA 1ZRDA 3LSEA 1PIV2 3PMSA 2D7FA 3A23A 1PMIA 1KFXL 3DCQA 5FZFA 5FZEA 1DQ5A 1V6JA 1SZBA 5FJKA 1LR5A 2Q1ZB 2R30A 4NHYA 1H9PA 4YNIA 1X9PA 4B7KA 4IV3A 4MXVA 1ZM1A 3N36A 4NWVA 3W5MA 3NAPC 1ZA7A 5FMOL 4P9YA 2OX0A 4B8EA 1REEA 3GBFA 1O59A 3H1WA 4MV2A 2PTMA 4NAMA 4GWMA 3PUIA 3FZ3A 5CZKA 2DBIA 4MGZE 3W5NA 1IG3A 2R062 4R9DA 1LOFC 4LO6B 5A3TA 1S0IA 3DKWA 5A33A 2YPJA 4QGMA 4S2HA 2YU2A 2C9AA 3MPPG 1K12A 1W9WA 5KC5A 4AEMA 3LEMA 3OBZA 4GA9A 2EAAA 5FP4A 2ZKLA 3UK9A 5LZ6A 5DAPA 1T6GC 5FO9B 4HT1T 4NPMA 5A6XA 3VZLA 5L19A 3FFQA 3UNPA 1WCKA 5T52A 2QE3A 3SCFA 3V0AB 4GKXA 4HFSA 3U4XA 1X33A 2PHFA 5L7OB 2BRTA 5LA1A 5F3CA 1LOCA 2XVKA 1SDWA 5FZ8A 4UW6A 3AZXA 1B09A 2Y6JA 3VBOC 2ADDA 4M00A 3ACIA 2YBPA 3MW3A 1H2KA 5FUPA 4CEYC 4S2GA 3DKQA 3BU0A 4TXWA 2PHTA 5T5JA 5T50A 4IE5A 1RHI2 3HQRA 5JLVA 2OPWA 4MG2A 2LRPA 2MEV1 5KHIA 1LOBA 3KS7A 1SBFA 4Q4X3 1SLCA 4LNVA 3T09A 3RZLA 4NIHA 1UOFA 2UY9A 4LBJA 1COV1 1LU1A 2QCSB 4JDNA 4LOSA 1K5JA 1J59A 3KGLA 1UY2A 3NAPB 1OKQA 2JENA 3OTFA 4PT6A 4META 2MNGA 1RUOA 1DFQA 1OHFA 4LKSA 4YM1A 3K4AA 5FXWA 4IE0A 4LBQD 4P5HA 1U5ZA 1RUJ2 1JHJA 1M06G 4HK8A 3MLLA 4OUEA 4XETA 1IS6A 5F32A 2BBVA 1ZBA1 2X5IA 3UJOA 1GFF2 2Y26A 4IE6A 4AAXA 3Q9OA 1QH6A 2RE9A 2WNVA 1C4RA 5FK8A 3LEIA 4AEJA 2ARAA 4B1MA 3POGA 1ZA4A 2XBO3 5FYMA 5FZ3A 5M0TA 1FPN2 3H9AA 4EN0A 4W65A 4FPOB 2PXJA 1HXS1 2VZRA 1RB8G 1W06A 2A7AA 1XRUA 2R041 1DCSA 1W6OB 2CTVA 5E16A 4YVSB 2PELA 1DGLA 4YWAA 2ENRA 4Q4Y1 1JZ6A 2PMWB 1PZ7A 5L73A 2WNUA 4CEYB 2VUAA 3R0RA 3WSOA 1AR63 1SACA 2XJPA 5AVAA 4DFSA 3HBKA 1LB2A 3POJA 3T2QA 5JI9A 4Z1VA 4MGSA 4JX0A 2Z42A 4JQRA 4XACA 5HCBA 2VZOA 3WW1A 3FLRA 1BLZA 2W1QA 3OY8B 3D3AA 2VO5A 5JWPA 5FP3A 4UFJA 5DAVA 2R6QA 4ZS3A 1S2KA 3BOWA 4COWA 4C8DA 2FMYA 2Y6GA 1URXA 3NJYA 2PQSA 2Y8KA 1ZZ9A 5FYIA 2E63A 2DWRA 3S7IA 4C1WA 4EYUA 3J7LA 4OHYA 3VDAA 4IEQA 1UMIA 1VALA 4IEPA 4O65A 2P2KA 2W5FA 3WVJA 1ODMA 3FLPA 4I02A 4IEZA 4X8NA 5T3NA 5IVFA 3W21A 5EJ1B 1FV2A 1OOPC 3GDBA 4HSJA 2ZGSA 5KHGA 3BUCA 1D2QA 1UF2C 4LULA 3TN92 3ZXGA 1XNBA 3K4ZA 3JUUA 4WVZA 2W47A 4EWDA 3P3NA 1NQJA 1OF3A 2RMU2 1DGRA 4HPKB 3FN9A 1RIRA 3MO4A 1H6XA 5JCTA 3PJQA 4XJWA 3RWNA 1JYNA 2DURA 1CAWB 2PFWA 4L99A 4OMCA 4IGQA 1QQP3 2OZJA 2QDRA 5ABJC 3LCPA 3OPWA 4ES9A 3L9JT 3AZYA 4WVMA 2RS53 2DU0A 3Q8BA 5CYYA 1NCRB 5A7WB 1QDCA 3HMYA 5KC6A 4IXLA 1RXGA 2R1BA 5CFDC 5DQ0A 3B3QE 3ON7A 4XQ4A 5FMCA 3E5QA 1HB2A 5EJ3A 1W90A 4W6YA 1TEIA
chains in the Genus database with same CATH topology
3OCPA 1C8NA 4GH4C 1QJX1 4NOTA 3AXDA 4FQ4A 3ROUA 5K0UA 2ZX0A 1PHMA 4AFMA 1AR83 3N7JA 1SBEA 2W68A 4OI1A 3CL1A 3AMPA 2QUOA 4P9XA 5BPXA 5JMCA 4Z2WA 4LO8A 2WZR1 4GMP1 5AFEA 4AI3A 5E8AA 1KD7A 4BOWA 1N3QA 1FNYA 3M7AA 4QPGC 3ZFGA 3WQ1A 3MIDA 4SBVA 2XHKA 1IPJA 2GN7A 2ZGLA 4MH0E 4CDWC 2V09A 1AYN3 2OPKA 2K9ZA 1LOGA 3RYKA 3SCHA 1V6IA 1S0GA 2QKDA 2WWSA 2BQPA 4YSFA 1ZBE1 2YXSA 2RJLA 1VLNA 3DN7A 3A0NA 5ABJB 1V6NA 2WSVA 4C0BA 1R092 4IV1C 2HEYF 1LHVA 1BBT3 1WW7A 5J37A 5CFDB 2VUJA 1NOVA 4BLIA 2VW2A 3WDXA 4OHXA 1MZFA 1R1A1 1Y3TA 4B4RA 5J36A 3WDWA 5FOJB 2VECA 3T2TA 1YI7A 2WSUA 1WLDA 3H0OA 3VZNA 5KXCA 4DY3A 3RG0A 2Q8OA 3O7OA 1KS5A 1W6PA 5LEJA 1NCQA 3JB4C 1AVBA 2HWF2 3OPZA 3ZX7A 4IERA 4LBOA 2WFF3 4S2DA 2D3PA 3H7JA 4QPGB 2ZX4A 1OQEA 1A8MA 1VR3A 4MVTA 1ASJ1 3ZYJB 3RJRA 3D8CA 2TNFA 1JN2P 3J8F2 5BNPC 5C9AB 3USUB 1OD5A 3QACA 2BFUS 3U0ZA 4FQZA 3IDBB 2ZGOA 1RUG3 1RUH3 5SV5A 4Z82A 3I7DA 3WQ0A 2OW4A 5JPNB 1G9CA 4FAGA 2N7GA 2IXCA 3VV1A 4IV1B 2Q1MA 4JGZA 2B8MA 2O8OA 4LEJA 1PO11 2XBO2 3MFAA 1XE8A 4PLOA 1NYWA 3TB0A 3VBFB 2P37A 4Q4W1 3RI8A 4XFGA 2JG8A 5CA6A 3MI8A 1V9U3 4BM8A 1YJKA 1RUF3 2ZMLA 4HLTA 4M0NA 3AYDA 2PHXA 4FPYA 1MEC2 1LGBA 1TME3 3OBTA 1PGW2 2EAKA 4WM8A 4AHYA 2LUWA 1RJ8A 4CYDA 1YWKA 1AR62 1QNYA 1MZEA 3L2HA 2X53S 1LENA 4U36A 4KU8A 4COVA 1S1AA 3VHPA 1BMV2 1GBGA 3WW3A 1FATA 1FXZA 2CWSA 4EJRA 4QQ2A 1Q8VA 3CJIC 5IK4A 1IHMA 3JD71 3KT4A 1N1VA 3ZSMA 1AL23 4WVVA 3ZSKA 5J96B 1LESA 1HRV3 2EALA 5JZGB 1QJY2 4D7TA 5BNPB 3B01A 1NE4A 2BGCA 4G4FA 1LGCA 3H7YA 4XQDA 1NXMA 1VJ2A 1YHFA 1VBA1 1W6MB 2NMOA 3M3OA 4AVSA 3H3ZA 2ZHLA 1X50A 2TUNA 1H2NA 3WG3A 2DU1A 4XMIA 2ZTNA 2E51A 1RMU2 4Q4V3 2EIGA 5FREA 3ZYIB 1PGSA 3IPVB 4I2OA 4BIFA 4MUVA 1AXKA 1EV12 1FX5A 4QD2A 5BNOB 5BNNA 1UL9A 4INDA 2NPIA 1BVP1 3JQXA 4AVTA 1XYOA 4L97A 1QDOA 3SMHA 2O1QA 2D3SA 2RS52 2A6ZA 1OPOA 1A78A 5J48A 1GSLA 4FPJA 4KNCA 1CPNA 3W9AA 4PIXA 1QJU1 3CEWA 3IDEA 1V70A 3CJIB 3VDDA 2ZHMA 1YFUA 2JJ6A 1H1AA 3ASIA 4YW3A 1N1YA 2C0ZA 3ZFEA 4LBKA 1AR82 4IV3B 3U10A 3TWIA 1I9RA 4WVWA 1I5ZA 3OBRA 4Q29A 2NLRA 1YUDA 4WZCA 2D3RA 3GBGA 1AR73 2W39A 2XLGA 4DS0A 3D82A 2ZX1A 3WX5A 1V6OA 4K21A 4SLIA 3AFGA 2E53A 4LLOA 4BYYA 5AFBA 1DU3D 2CNAA 3UKVA 3OD0A 1AYN2 5FMOS 1MS4A 3JBG2 4FP2A 4PBOA 4Y5Z0 1H8TA 5KXEA 4YZ2A 5J98B 4H7LA 4F3JA 4XFAA 3AM2A 3WZ1A 4KWJA 2A75A 4M3CB 2IXKA 2WNUC 1HLCA 2VU9A 2G9GA 2HWE3 4Q26A 2VULA 1LGNA 1BZWA 2W0XA 4KWLA 2ZABA 1RUE3 3LOIA 2JECA 3OYWB 5C8CC 4YZ5A 1PVC3 2OZ6A 2DTWA 3WXPA 2CAUA 4K40A 2A6VA 1Y43B 1LRHA 3FBMA 3V0BB 5DDJ1 4XXPA 1WA4A 4K9SA 2VNOA 4N43A 1A3KA 4CDQA 1H4HA 5HI0A 1JTZX 4QGLA 3QBQA 2ZGPA 2EA7A 2WFF2 2XVGA 4E4ZA 3EO6A 4DZGA 5CNAA 1F31A 3THPA 2IXHA 3WUCA 4PF5A 2GN3A 5AC93 3B7MA 3VBSA 3WOGA 2D5HA 4QQPA 4C91A 1A8DA 1OPMA 2HEWF 5DZFA 5T5PA 1AHSA 3OD4A 4AYUA 2VXRA 2VNRA 2GC3A 4P9GA 1CGPA 2VOKA 5CFCA 3IWZA 3TBDA 3NKGA 2WNUB 4IL7A 4QPIA 3HT1A 1DIWA 3BOPA 4Q0SA 1AR92 1Y9QA 1RHI3 5FRAA 1RINA 2BNNA 4N7UA 3VBRA 3ZN4A 4AI8A 2PYTA 1VRH1 1KDKA 1AYM1 1RUF2 3BTAA 4DMIA 3ECQA 4LUKA 2YY1A 1TME2 2BNOA 3LA2A 3ZFFA 3UV9A 4G9SB 2ZAAA 1BEV1 3QH6A 1D4M1 3NL1A 1QOTA 4GB33 1O5UA 4S2FA 1RUC2 1JUHA 4BIOA 2WKKA 1C8M1 4ATFA 2ZCWA 2BUKA 3ES4A 2ZJCA 3FFZA 4UBHA 1K5MA 1NQDA 5FTTC 4JGYC 1AL22 1HRV2 1PNFA 2JEMA 1AJOA 1FPN3 2B46X 3V64A 4P9LA 4R9AA 4RHV1 1CIWA 4LBMA 4Y20A 4I0AA 4WZFA 1YYNA 2OA2A 1TE1B 3VZMA 3MIHA 4WVMB 4XEZA 2CY6A 2XWJB 2BWCA 4Q0VA 3URFA 1R081 2CV6A 4KU7A 3V65A 3ETQA 4L2NA 5FQ0B 3A4UA 2WINB 1RTVA 5DZEA 2GSYA 1TMF3 2PAEA 1QWRA 3VZJA 5GZGA 4E4SA 5KXDA 3VZKA 1BCXA 5LK5A 1APNA 1AJKA 4N9IA 1DYPA 1W6QA 1DG6A 3AZZA 3LA7A 5GLTA 1WLTA 1U5YA 2GMMA 1AL0G 4HMZA 1OFSA 3AKQA 1FMD1 2GZWA 5IK5A 2RS13 1D4VB 2WA3A 4DOUA 3IBMA 3AJZA 5FCCA 3TN93 3EXUA 4JRLA 3ZFGB 1J58A 5T5LA 4R4ZA 1MS5A 3ILRA 2LTNA 2VVFA 5LRSA 4I09A 1JBCA 1RUH1 3U11A 1ULDA 1DGWX 3C2UA 3MEPA 1AR72 1U5IA 4YM2A 4XPVA 2ZBJA 4YYOA 5LEKA 1QU0A 4XIKA 3WDTA 1DQ2A 3AKPA 4Y1ZA 4AFAA 2VW1A 2BW8A 1S0EA 4LA3A 4B3NA 4JDMA 2PN5A 4XIOA 4AEDC 4NWWA 1HW5A 3RPQA 2JG8C 4ISQA 3WINE 1V9U1 3VUOA 1F5JA 1MZ6A 5L7OC 3O14A 4NO4A 3ZDSA 1KDMA 2EXKA 4IEUA 4ONUA 1EAH1 5I91A 1NCQB 5JVVA 1YRZA 3HBZA 5HCFA 5ACA1 2Z5WA 1S0CA 5TSWA 4AFBA 1CAXA 3VBUA 2B39A 4AG4A 4YARA 5JIUA 2YROA 3HN1A 3AMHA 1WBFA 2QJVA 1HXS2 4BHPA 3M3EA 4CDXC 4GULA 1RUE2 1ULCA 1PVC2 2DCJA 1DBNA 5H9SA 3FX3A 2YDEA 1PO23 5IT6A 4XF0A 5GJ6A 5C4WA 4KWKA 4RQPA 1ZRFA 5L36A 3IKWA 3B94A 1S0FA 1R093 1YIFA 4DY5A 5FPXA 2WT0A 2P34A 1RUI1 1OA4A 5AC92 4YW4A 2UWAA 5F5QA 4YG6A 1MS3A 2UY8A 3AZVA 3AB0A 4CP1A 4AEDB 1SEFA 3CO2A 1D0HA 1J3QA 2JG8B 1SQ4A 3M3CA 3SH3A 4FPLA 2JICA 1IPKA 3LA3A 4YVSC 3X29B 4GALA 2F4PA 1ZRCA 1XNDA 3RRDA 1GZ9A 1VP6A 1Z7S3 4WM8B 2D44A 1S0JA 1IOAA 3K51A 4GIQA 5BY5A 2HWF3 3E6CC 3ZXLA 3WW2A 1LULA 1FOD1 1QKQA 3ME2A 4OHWA 1GZWA 2VH9A 4CDXB 1JXNA 3WP6A 4HANA 4OI0A 3J8F3 1G7YA 1O3QA 1Q43A 1F2NA 4YG0A 5BYNA 1WMDA 2V73A 3B9IA 4GB32 2Z79A 1OI6A 4H3WA 4OUMA 3TAYA 5GLVA 5EXOA 1J3PA 3ATGA 2XLFA 4IEOA 1NY71 3OGGA 1G86A 1F8VA 4Y22B 3O0XA 5GLZA 2RM21 2CGPA 3RMXA 2Q0AA 2E6VA 2UWBA 5BNNB 2WIIB 4YVWA 1MEC3 5D1IA 3FMGA 3TNQA 2QFEA 2XJUA 3DL3A 2DVDA 1WMEA 3KLSA 1RVF2 1LECA 3WHTA 2ZGQA 3WP4A 1NCRC 2Q5TA 3N7LA 2HWE1 3RYPA 1VBB2 1B35A 5H9RA 3PVOA 1PIV1 1TMF2 2ZGUA 5GZDA 1NZCA 3AKSA 4AK3A 1ZBE2 1UZYA 1QJY3 3ZFEB 5A32A 3MZHA 4HZFA 4XJAA 3KSCA 4JCKA 2UWCA 2WJSA 5JIAA 5T54A 4YFZA 2E7AA 1VB2A 1YCIA 4YGDA 1W0PA 2RS12 4Q1PA 2R061 3KZ4C 1POV1 4PIYA 5GALA 5D8AA 2A5ZA 2BEOA 3M3QA 3D5OA 4HN0A 2ARBA 1RMU3 4AEKA 1EY2A 1JUIA 4AHWA 4B29A 4K3UA 1XNKA 4CDUA 5CVRA 2R072 3DGTA 5EFUA 5GZFA 1EV13 1V6KA 2JG9C 4L8QA 2JDZA 1ENXA 5I0RA 4PLNA 4BE3A 4YZ1A 1QXJA 2ZACA 5JSRA 1C1FA 4ES8A 3UKTA 3MIGA 3E6BA 1CX4A 4URTA 3ZPYA 1HV1A 3AP9A 3VBHA 5KWRA 2WS93 4IQPA 4WM7A 3EBRA 1DF0A 3VBRC 3H8UA 2RR13 4G3YC 4HVQA 4LBQA 1QJZA 4QQLA 1WLWA 1XE7A 2YMZA 1BVVA 2OUHA 4JVAA 1UU4A 5FPZA 3ZMOA 1O4TA 3M4FA 4N43B 4CDQB 1RUJ1 4AVBA 1VAMA 3WT3A 1O7FA 2A3XA 1POV0 2QQPA 4AQTA 4W6WA 4QXKA 3VBSB 4Q2FA 3I59A 3NW4A 1ND2C 1S0DA 2A6XA 2A3YA 4PDWA 4X6QB 3VLBB 1PNGA 3MYXA 4PJYA 5C9AC 1FPN1 4HK9A 3RI9A 3JBG3 1PO22 3UJQA 2JG9B 4K1ZA 2IC1A 4RR3C 2A70A 4BMBA 1CN1A 2CWMA 3P3PA 4MLOA 4COZA 1ND3A 2NYYA 4FPGA 3HIFA 4DQAA 3G6JB 4D7SA 4ISRA 4AW7A 3M2MA 4R52A 1TNFA 4JDOA 2E9QA 4YRDA 1TQ5A 1YI9A 1WW4A 4AWDA 4RGGA 3VBRB 4YLZA 3VBFC 4BZ4A 5FO7B 4LO4B 1YO8A 4D3WA 2GC1A 4AVVA 4FOVA 1VBA2 4XBQA 3S6PA 5CAZA 2GNMA 3IM0A 3G7DA 1F5FA 4MSVA 4RS5A 3ZFFB 4N90A 5GZEA 1Z7S2 1FI2A 2YGLA 4D69A 3RS6A 2CYFA 2HWC1 1WW6A 2YYOA 4XMAA 4DINB 1DDLA 3WP3A 1SLLA 4AFDA 1PK6C 2D6NA 4GMP0 4PIZA 1C3HA 1OA3A 3FJSA 3K48A 1QXRA 2DFCA 3R4UA 3H1MA 1ND2B 4NPRA 2OUJA 3TN91 1UMZA 5JZGC 1X36A 1ZZ7A 2DCTA 1MVEA 2VG9A 2GC2A 2RMU1 3RDIA 1QNWA 1ULGA 2WNEA 5F9TA 4RR3B 2XPJA 3NV4A 1QJU2 1N1TA 1GR3A 2HWD3 1DQ0A 3M70A 4KH9A 4AQSA 4Q8KA 1LEDA 2RS32 3BB6A 1KFUL 2EF6A 1IKPA 3NKTA 1BXHA 2ARXA 4MGYE 1LODA 2MHFA 1AR93 2R1DA 5GLWA 4YGEA 3R4SA 4HKLA 1HRI1 2GMEA 3LGRA 5BNOC 3E97A 4NN0A 3MIBA 4B4PA 5IUQA 1ENQA 3FUQA 3DPRC 3WUDA 3WR0A 1W6QB 2GNDA 1SFYA 1KQRA 5DG1A 2ILMA 4XJUA 2H6BA 4PCRA 1RUC3 2VPVA 4OI4A 4RD7A 4HN1A 1PK6B 3N7MA 1QXPA 2ZZJA 4N7IA 4Y1UA 4AF9A 3POWA 3V0AA 2OIIA 4A2UA 5C33A 4CEWA 2PHWA 4IV3C 4ASMB 1ZRRA 2E7QA 2YZ4A 1CD3G 3C3VA 4H14A 1WCSA 5E1RA 1ZX5A 1G8WA 1XU1A 2AREA 3ELNA 2ZGTA 1ZNPA 4I01A 3V56A 4ZKTB 2Q30A 2I2SA 3KB5A 4CRQA 1R091 1XYPA 2X8KA 3AMNA 2BPA2 1PVXA 1VBE2 4EWAA 1E57A 3USSA 3AYEA 1EP0A 5JPMB 1SCRA 3SH4A 2GU9A 5JOWA 2DVAA 2PHRA 4GKYA 4JAAA 3MF9A 1AX0A 4XILA 1RL3A 4B7EA 1Q8QA 3J26N 4FPCA 4FOQA 4TYSA 1EPZA 1SBDA 5T5OA 2QZ3A 2KM2A 4CP0A 3DPRB 3WW4A 3WY6A 1M4WA 1LOFA 4XJZA 4NHMA 4AHXA 1UCXA 3AYCA 1NG0A 4HL0A 1BYHA 4NHKA 1YXWA 4UW3A 1CAXB 5KHKA 3VBUB 3I2DA 2A6WA 1MR5A 2WS92 4FTBA 1IS3A 2NN8A 4LT5A 2RR12 4Q4X1 3L2YA 4XFFA 5FLHA 2UYAA 4COYA