4IV1B

Crystal structure of recombinant foot-and-mouth-disease virus a22 empty capsid
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
DRILTTRNGHTTSTTQSSVGVTYGYSTQEDHVSGPNTSGLETRVVQAERFFKKHLFDWTPDKAFGHLEKLELPTDHKGVYGHLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFTPREKYQLTLFPHQFISPRTNMTAHIVVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTNTVSAGQIKVYANIAPTHVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
total genus 46
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv1B00
1RUH3 2VQ0A 1RUG2 5AC92 2WS92 1RB8G 4Q4Y1 1MEC3 2RMU3 1RUJ1 1VAKA 3NAPB 3VBRB 5BNOB 4Q4X2 1PGL2 4RFT0 1V9U1 2X5IA 1ZBA3 2X5IC 1W39A 1NA1B 1BBT2 1QJY3 3ZXAC 4CEYA 1RUE1 1R082 5ACA3 5A32A 3NAPA 4CEYC 4RHV1 2R042 3NAPC 4PDWA 2HWC1 1A6CA 2RR12 1PIV1 1NA1A 1FOD3 4PDWC 1VBB3 1M06G 1X33A 1ASJ2 2RM23 1NA1C 1OHFA 3J8F1 1COV3 1AYM1 1BEV2 2HWC2 3JD72 2RS53 1NY71 4IV3B 4Y4YA 5L7OB 1VBC1 1HXS3 1RHI3 2XBO2 3TN91 3HAGA 1E57A 4YVSC 1TME3 1C8M3 1NY72 5CFDB 1NOVA 3TN92 1AR63 5DDJ3 1HRV3 2PLV3 3FBMA 4FTBA 1R092 1DDLA 1MQTC 5FMOL 3ZFFC 4Q4W3 5CFDA 1RUG3 5AC93 2WS93 4QPGA 5CFDC 2FZ1A 4JGZB 5ABJA 4WM7A 4QPGC 5D8AB 4WM8A 4CEWB 4Q4X3 5ABJC 3VDDA 2BFUL 4WM7C 5FOJB 4WM8C 4YVWB 1Z7S1 1AR72 3VDDC 2XPJA 5GKAC 1QJX2 4JGZA 1BBT3 3VBHA 1ZBE1 1AR93 5D8AA 1R083 1RUD1 2RS33 3IDEA 5CFCB 4JGZC 3VBHC 1VRH1 2R043 4YVWA 3DPRB 2RR13 5A33B 1AR81 1FPN1 2BUKA 4YVWC 5C9AA 1ASJ3 1VBD2 4BCUA 5C9AC 5JZGC 1RVF3 4CDQA 1BEV3 3JD73 5A33A 2R061 4RQPB 4CDQC 2WWSA 2XBO3 1HX6A 4IV1B 1EAH2 4Y5Z0 1RUI2 3VBFB 1VBE1 1QJU3 1F8VA 1PO13 1BMV2 4CDWB 2BFUS 4GMP1 4FSJA 1TMF2 4GB31 1FMD1 2WZR2 1HRI1 2HWD2 2HWE2 1PVC1 1R093 1RUC1 1VBE2 3VBFA 3VBFC 1X36A 4N53B 4NWWA 5BNPA 1PVC2 1RUC2 5K0UB 1POV1 5BNNB 5BNPC 4Q4V1 4Q4Y2 5J96B 1AYN1 4N53A 4EJRA 1AR73 1RUJ2 4SBVA 1D4M3 1QJX3 5C4WB 3VBRA 5BNOA 1K5MB 2RS13 1AL23 1V9U2 5K0UA 1RMU1 3VBRC 5BNOC 1RUE2 5C4WA 4RHV2 3JBG1 1RMU2 1VBD3 2WFF1 3ZFGB 1PIV2 2HWF1 4FTSA 3J8F2 1PO23 3VBOB 1AYM2 4RS5B 1VBA1 3ZFGA 1EAH3 2R071 4IV3A 1RUI3 1RUF3 1VBC2 5L7OA 3ZFGC 1ND2B 1QQP1 4IV3C 2ZAHA 5L7OC 1TMF3 4RS5A 1EV11 2R072 2WZR3 1H8TB 2GSYA 2HWB3 2HWD3 2HWE3 4RS5C 4GH4B 2WLPA 1QQP2 1R1A3 1ND2A 1ND2C 2MEV1 4AEDB 1EV12 1RUH1 1MEC1 2RMU1 4Q4Y3 2MEV2 4CDXB 4AEDA 1RUH2 1RUJ3 3VBUB 1ZBA1 2DF7A 4CEWA 1B35B 1V9U3 5D8AC 1Z7S2 1QJY1 2RMU2 4N43B 1PGW1 4CEWC 4Z92B 5ACA1 1ZBE2 1RUE3 1RUD2 3VBUA 1F2NA 5CFCA 2GH8A 4RHV3 1B35A 1VRH2 1NCQB 1FOD1 1PGW2 1VBB1 4N43A 5CFCC 2HWC3 1B35C 3DPRA 4RR3B 1PIV3 1AR82 1FPN2 2RM21 4QPIB 4CDUB 1COV1 1CD3G 3DPRC 3S6PA 3J8F3 2RS51 4JGYB 1FOD2 1NCQA 1AYM3 1HXS1 1RHI1 2R062 1NCQC 4LLFA 4QPIA 4RQPA 1VBC3 4QPIC 1TME1 2IZWA 3TN93 4RQPC 1C8M1 4IV1A 3ZFEB 2ZZQA 1AR61 4IV1C 1VB2A 5DDJ1 1HRV1 2PLV1 2TBVA 4GB32 4CDWA 1NCRB 5C8CB 1TME2 1C8M2 1FMD2 1HRI2 4CDWC 4Q4W1 5J98B 1OPOA 4GMP0 1AR62 1RUG1 5AC91 2WS91 2PLV2 1HQNA 4Q4W2 4Q4X1 4N53C 2X5IB 1CJDA 1PGL1 1ND3B 1C8NA 1OOPB 5BNNA 4Q4V2 1AYN2 5K0UC 1BBT1 4CEYB 1Z7S3 5BNNC 1AR91 5A32B 1POV0 1R081 2RS31 1ZBE3 1K5MA 1ND3A 2R041 4PDWB 2Y26A 1RUD3 1AL0G 1OOPA 5C4WC 2RR11 1K5MC 1ND3C 1VRH3 1AR92 1IHMA 1OOPC 2RS32 1ASJ1 1AR83 1FPN3 3JBG2 3JB4C 1RVF1 1BEV1 3JD71 2WFF2 2HWF2 4YVSB 2R063 2XBO1 1RVF2 3VBOA 1VBA2 1QJU1 1PO11 3VBOC 1VBE3 4YVSA 1MQTB 3ZFFB 4GMP3 4GB33 1R091 3VBSB 1FMD3 1QJU2 1PO12 1HRI3 1H8TA 1PVC3 1RUC3 4GH4A 4QPGB 1H8TC 1MQTA 4GH4C 3ZFFA 5ABJB 4WM7B 2ZTNA 4NWVA 3VBSA 3JB8A 4WM8B 3VDDB 4AEDC 3VBSC 1MEC2 1POV3 1AR71 4Q4V3 1AYN3 1D4M1 1QJX1 3VBHB 4CDXA 2RS11 1AL21 1AUYA 1ZBA2 3M8LA 5LK7B 4CDXC 1QJY2 1RMU3 3VBUC 1D4M2 5ACA2 2FZ2A 1SMVA 5C9AB 2RS12 1AL22 4N43C 5JZGB 1VBD1 1NG0A 3JBG3 4CDQB 2BBVA 1VBB2 3CJIB 2WFF3 2RM22 4RR3A 1PO21 5JZGA 2HWF3 1COV2 4CDUA 4RR3C 4FTEA 2RS52 4CDUC 4JGYA 1EAH1 1RUI1 1RUF1 1VBA3 1VB4A 1HXS2 3CJIA 1RHI2 4JGYC 2R073 5FMOS 1PO22 3CJIC 1BMV1 1TMF1 1QQP3 2BPA2 1WCDJ 2WZR1 2HWB1 1RUF2 1QJZA 2HWD1 2HWE1 3LOBA 1EV13 1R1A1 3ZFEA 5DDJ2 1HRV2 3ZFEC 1NCRA 5C8CA 2HWB2 5BNPB 2QQPA 2MEV3 1GFF2 1NCRC 5C8CC 1R1A2
chains in the Genus database with same CATH superfamily
4RD7A 3WQ7A 3ZR6A 4O9GA 4PJYA 4QT6A 4Q0PA 3S5AA 2OW4A 1OKOA 2Y60A 4M3CA 4IE5A 4MADA 4HK9A 4QGMA 2ZGUA 2E53A 3NAPB 5BNOB 4UFIA 5T54A 5FYTA 3RS6A 4LK6A 5FZ9A 5LRSA 4XJAA 1O8PA 1CAXB 3H8XA 3KQ4B 2XVKA 4KI5M 2JE8A 3I2IA 4TLGA 4CEYA 4CUBA 1RUE1 1R082 2GP3A 4S2GA 5A32A 5EV7A 4BOWA 1AVBA 3FHIB 1QOOA 3O1SA 3IIIA 3N9QA 3MUZ1 4XFHA 4AVAA 3AZVA 4FO9A 3WVJA 4PDWA 1W2AX 4E4ZA 2WBKA 5A70A 2RR12 1A6CA 5F3CA 3VKOA 1PIV1 5K9YA 3WNMA 3LDKA 1W6NB 1M06G 1YRZA 4QD2A 3UJOA 1NA1C 3KV5A 3OF1A 4J1WA 1YFXA 2ARXA 4KG8A 4EZ4A 3MIBA 1BEV2 3T4VA 4QX2A 1WCUA 3AJYA 1RJ8A 4Z1VA 3KV6A 4H14A 4JKMA 4YW3A 1TNRA 4META 4Y20B 2IWGB 2BGOA 5FYBA 2VU9A 4N90A 1GWMA 1MR5A 3KLSA 4AVCA 5C3RA 2XJVA 1H2MA 5FWJA 1NXMA 2VZQA 2MNGA 1MS8A 1SLBA 4JTNA 3WW4A 4KNCA 1DP0A 2VUCA 2E6VA 3JZVA 3KCCA 4JDOA 2JDZA 4AQSA 2AREA 3WNKA 1UZZA 3CU7A 1OQEA 3N9NA 3N9OA 2D6PA 1GNZA 1OSGA 4FTBA 4WVVA 4PF1A 1DDLA 3IAPA 1FI2A 5CZKA 4AK3A 2FDIA 3MFAA 4Q4W3 3K2OA 4HANA 5JUVA 3LIHA 3NW4A 1RUG3 2H6CA 3LWCA 3T2PA 1BQPA 2VXRA 4ZZ8A 3ZX7A 2V72A 5CIRA 5CFDC 4XILA 3H1MA 1S0DA 2GC1A 4COUA 5ABJA 4QPGC 4OHYA 2VZ3A 4DEQA 4Q4X3 4D69A 5K7PA 1UL9A 1LOAA 5DG1A 3M3QA 3WCRA 5KBFA 4EE2A 3VDDC 1CIWA 2V4VA 5CAZA 1C5IA 2QDNA 3PVBB 4H7LA 4MXVA 2EAAA 3GF6A 4JGZA 4ES9A 5D8AA 5KXCA 4FPHA 1W6PA 3IDEA 3NSTA 3THTA 1MACA 5BYNA 1VRH1 3K51A 1YIPA 1UOGA 1KJLA 3MICA 4XPVA 3T08A 4RL7A 4I0WB 4MGTA 3CZUA 1FPN1 2BUKA 2DCZA 4YVWC 3N9PA 4B1LA 2AEZA 1DFQA 2AENA 5D2AA 2GP5A 2ZACA 1OF4A 1POQA 5C9AC 1J58A 4UI9L 4U2AA 4CCDA 3T2OA 1CX1A 1LOEA 2R30A 1XU2A 1SEFA 5A33A 2VCAA 3I3QA 3I8TA 1STMA 1ZYBA 3WLUA 4LLOA 1Y7BA 4CDQC 1MS0A 4LO6B 3QOPA 1MS9A 2XBO3 4N7IA 3RMXA 5JPMB 2GMPA 4DIQA 4QB2A 5DAPA 4BE3A 5L19A 3LA2A 3ZXGA 1CR7A 3VBFB 1YO8A 4DS0A 2LROA 3AXEA 3B7MA 4JQRA 3VV1A 4BH9A 4ARYA 2UWCA 2JIJA 5FXXA 5FUNA 2Y6JA 4GB31 5A3PA 3Q8BA 3DF0A 3FFZA 5F1RA 4QDRA 1BKZA 4OLLA 4N8MA 4FPJA 2XONA 2FD8A 1R093 1VBE2 2JDHA 3MIDA 5E8AA 4W4ZA 4CZSA 1W0PA 1W8NA 1IKQA 3NV1A 4UW4A 1ZREA 1OBNA 2W08A 5LBCA 2P3JA 4N53B 1OA4A 1N47A 1XNKA 2W3JA 2Q8EA 3WW1A 3AP5A 3JQXA 4XIOA 2E26A 2VZOA 4NWWA 1PVC2 4OVEA 4PBPA 1UY0A 4AI0A 1U5ZA 1UW8A 3DECA 3PVEA 3ZYJB 1W2TA 4Q4V1 1V6JA 1V6MA 3MDPA 4J25A 4NAOA 4XABA 2HKXA 4YGDA 4BM8A 1HDKA 4GZ9A 1WMEA 1RUJ2 5FZFA 4Y1ZA 1BK0A 3RWNA 3BU0A 5C4WB 1QJX3 1Q43A 2IFWA 3POWA 5TSWA 1W2OA 1C4RA 5K0UA 1AL23 1PMIA 3KD4A 5IK5A 4A7YA 3K3NA 5BNOC 1N3PA 3KWVA 4HSLA 1UZYA 4RFRB 4A4AA 4KBZA 4UFHA 1UYPA 3DYOA 3WW3A 3NNFA 4URTA 2ZXQA 4YG6A 2ZGKA 2P2KA 4DO0A 5KHIA 5FO7B 1RC6A 2YV8A 3JBG1 3WOGA 4TTGA 2FCTA 4DUWA 5FO9B 5LA9A 2CDOA 2OYZA 3ZIXA 1DYPA 4D7TA 2HWF1 1X8MA 1OURA 3I2HA 3J8F2 1IOAA 1IPKA 2SLIA 4M3CE 4BQWA 2GC3A 3TEXA 3VBOB 2X53S 3H9AA 3FLPA 4DQAA 4XHBA 3ETQA 4RS5B 3HD8B 3AP4A 3GGLA 3AFGA 2R071 4A3ZA 2XWJB 1L7QA 4IV3A 1O3SA 3BN6A 3OD4A 3MF6A 2DVFA 4BLIA 1C1FA 2O8OA 4LHNA 2CAVA 2QZ2A 1EV11 5LY2A 5F5AA 3AMHA 3OPWA 3T1MA 4NO4A 4BMBA 4BQ1A 4BXFA 3FZ3A 1VIWB 2HWE3 3PTYA 4LULA 2WLPA 4PQQA 4K8FA 1QQP2 3SH5A 1QY4A 3Q8FA 5G04L 1ND2A 5F32A 3OEBA 4GXLA 4H55A 2QQWA 4DMIA 2MEV1 2XJPA 4HKWA 5FPVA 2VGDA 1OLQA 5F6KA 2ADDA 4NPMA 3BTYA 1JZ3A 1NZCA 3K4AA 3HIFA 4NPRA 3I3DA 1CQ9A 4G4FA 3DCQA 2W47A 2ZJCA 1VLNA 3I97A 1LHWA 1XB9A 4DINB 4XW3A 2VZSA 3POIA 3V56A 4AEDA 2EAKA 5LW9A 3U1XA 2VOVA 4XF9A 2QVSB 4CEWA 5A6QA 2A7AA 1B35B 2FDGA 1V9U3 2RMU2 2UWAA 2JG8C 1XRUA 3M3CA 5FZ7A 5FZHA 1C28A 3WF4A 3VB9A 1OVSA 1ZBE2 2JKXA 3E97A 4BHPA 2YC0A 1WMXA 2R6QA 4Y5TA 3ON7A 2GH8A 1XNCA 3J4UH 4XFCA 4F7ZA 5IFPA 3IDBB 1GYKA 2PAKA 4FPKA 4JQTA 2BNNA 3M4FA 1PGW2 4N43A 3WDVA 3BPZA 4C1WA 4YRDA 2WQ8A 2NYYA 4RR3B 2OXBA 2WZPP 4DNYA 3JUUA 4XBLA 4AG4A 1UZVA 2RJLA 5GLZA 3UETA 3R05A 3S6PA 3J7MA 2R49A 3POGA 4ASKA 5JXIA 1D2QA 4X8PA 3PMSA 1YQCA 4CXWA 1PM4A 3QCWA 3WQ1A 1JZ5A 5FR3A 2OPWA 4RQPA 2PHDA 5ERLA 5F9TA 1SPPA 5A6XA 4QPIC 2IZWA 3AXDA 2VZ1A 4IV1A 1GICA 3HN1A 4XTPA 2YPDA 4AEJA 1L7RA 1MVQA 2ZGQA 4WZFA 1JYIA 2DUQA 1W8FA 2ZZQA 3ZSKA 4A3XA 1Y4WA 2YFUA 4XXAA 3APBA 3FJSA 2J1VA 2BU9A 2EIGA 2V4AA 3N7LA 2VZRA 1NCRB 1TNFA 1UXXX 4P14A 3VL9A 4S2HA 1S0IA 4Q4W1 4HK8A 4ZXKA 1QH7A 4Y24A 1O8SA 4I30A 4Q2FA 1JZ4A 1RUG1 1ENRA 2VZPA 2P3IA 1GQHA 2Y64A 3RVHA 4UT5A 2PYTA 1U5XA 3CO2A 4CU6A 1F4AA 2F6BA 1H4HA 2E31A 1EUUA 5LA1A 4URAA 4M4PA 4CP0A 1RXGA 4Q4X1 4AGVA 4N53C 2H0BA 2X5IB 4FPLA 4ZU7A 5J7MA 1ND3B 2VQTA 3N4MA 5BNNA 3RQ0A 4IE4A 4GULA 1AYN2 3NL1A 1A8DA 1SG3A 1UD1A 1H0BA 1K12A 2A6ZA 2D97A 3QD6A 5FK8A 4KU8A 1N1VA 4YW1A 1OFSA 2IFRA 5CADA 2W1QA 1W6QB 2BOIA 1OOPA 3H7JA 5C4WC 1ZZ8A 2ETEA 5FYMA 4JRAA 1Q8QA 5IJRA 4OULA 3O1RA 4FQ4A 3LPGA 5IVFA 1LHOA 1AR83 4YSFA 3AL6A 4WVMB 1YJKA 3LFMA 4OCTA 1ONAA 2I45A 1UKRA 4XJZA 2DTWA 3O7OA 2Y6LA 5JWPA 3I3MA 2WFF2 4LKFA 3DN7A 2ZEWA 4B4RA 3QH7A 1XQNA 4UBGA 4YVSB 3WINE 2R063 2C9KA 1IG0A 1CPMA 1LKNA 1DZRA 1FT9A 1S0FA 2I07B 2XBO1 3HOBA 4Q8LA 1CAVA 1RVF2 2EXHA 5A1LA 1VBA2 2P17A 1JZ7A 3HBZA 2XL9A 3VBOC 4P9IA 1OH3A 2EIDA 3HEIA 2VULA 2NM1A 2VR4A 4BQYA 1H2LA 2JDAA 4IEOA 3PJYA 5L36A 1RUOA 4XF4A 5DAWA 1QXJA 4GMP3 1LENA 4BYYA 3S0MA 1R091 2XVLA 3I2KA 4KMQA 3VBSB 4W50A 4AF9A 1QJU2 3O1MA 3B01A 1HRI3 1RUC3 2Y0IA 2WIIB 3I2OA 1JN2P 1KQRA 1QF3A 3B94A 3ACGA 4D8MA 5FBZA 2XLGA 4IEYA 3BTZA 1GR3A 2XHKA 5FZKA 3HT1A 5A3MA 4NWVA 3JB8A 4WM8B 1SLIA 2F4PA 3H0OA 1MEC2 4BZ4A 4FFIA 2EA7A 4F8AA 3ZYPA 2JWPA 4BDVB 2VMFA 3USSA 3KM5A 1QJX1 2CWMA 3LDRA 1J84A 3VBHB 3ZXEA 4YM3A 2H6BA 1HV1A 1AL21 1AUYA 3WXPA 5F6LB 1ZBA2 1W9SA 3M8LA 4UYBA 3FN9A 1OMIA 1YI7A 3ZM8A 3HR9A 1YCIA 2C9AA 1PGSA 3AVRA 1C57A 3PU8A 4QGLA 4C0BA 5FTTC 4L9BA 1YHFA 5JXGA 4XUQA 2WRAA 1H2KA 1ST8A 3DUIA 3A4UA 4XCAA 2VMDA 3B5LB 4IEZA 3GNEA 2VH9A 4JDMA 3WNOA 4K40A 4K6BA 4LIVA 5A3NA 1VBB2 1SLAA 4AFAA 3AKQA 3IMMA 1WWYA 3C2UA 3LA7A 4K20A 4MX3A 5EFUA 2ZX2A 2O8QA 1COV2 3D5OA 3LA3A 4CDUA 4XQWA 1YQ8A 4RR3C 1DQ5A 2XWBB 4CU8A 4ES8A 4MGKE 2VUJA 2JG9B 1HXS2 1SQ4A 2O0OA 4DEVA 3C7FA 1JZ6A 3W58A 1PO22 2D6MA 1S0JA 2DWRA 5AFEA 5HBAA 4L11A 3RNSA 5C7GA 4JAAA 5B2GB 1BMV1 3KZ4C 5J09A 5IFTA 5JSRA 1MS1A 2LUWA 3M1HA 1YYNA 1WCDJ 5EJ3A 1RUF2 4R52A 2HWE1 3VKLA 1KS5A 3MIEA 1FNZA 4AGGA 2DBIA 4UFKA 3OYWB 1UMZA 3OGGA 5DDJ2 1O5LA 3ZFEA 1JYCA 1WLWA 4P5YA 1VR3A 5KHJA 2OUJA 5C3SA 3WW2A 4P00B 4YZ1A 4JZRA 3K3OA 2WNVA 3G6JB 5BNPB 5HV0A 4QU1A 1NCRC 1RUH3 3GZTB 5E89A 4NRPA 4YW5A 5FXZA 1RB8G 1GZTA 4AI9A 2BQPA 2WN3A 3UL2A 4E27A 3KT4A 3IDAA 5FPBA 4OQ9A 1HQLA 3VBRB 1V6LA 3OY8B 4Q0VA 3ZN6A 4AQ2A 2VM9A 4CTEA 1PGL2 3HBKA 4RFT0 1V9U1 1WD3A 1PK6A 4WZCA 2ZX4A 4FP2A 2SBAA 4LO4B 2E32A 4BK4A 3ZLIA 2X5IC 1UF2C 1W39A 2DV9A 1NA1B 4QB1A 1QJY3 3NNLA 2RVAA 1KFUL 4ORFA 2FBEA 3NAPA 2PELA 4L97A 1E5HA 4HT1T 3H42B 2IXJA 3RPQA 1PNGA 5CBLA 1G9CA 3AJZA 2A6YA 2BTVC 2R042 4S2DA 1CAXA 2XOMA 3NJXA 2NN8A 4GALA 2HLEA 2HEYF 1FOD3 4MG2A 4IGPA 4LOTA 4R9DA 1ASJ2 1BZWA 1UZ0A 4LBMA 2VE1A 1H1AA 4LBOA 3R6SA 2C6SA 1UO9A 2DU0A 2E63A 1MS4A 5BXXA 1LOCA 4NPLA 2ZGSA 4UXAA 3JD72 1TQ5A 5JI9A 2RDSA 3OG2A 1JW6A 4Y4YA 1A78A 2YC4A 2XUMA 1UIJA 3J7HA 5HCHA 3H7YA 2PXJA 1RHI3 2PQQA 4FT8A 1QXPA 4AFBA 1YXWA 4MH0E 4YVSC 3H3ZA 1OFNA 4OUSA 3HQUA 4OHWA 1XU1A 4NMIA 1C8M3 3I3BA 5FZOB 1SBDA 3V0BA 4XBQA 5CFDB 4I01A 4Y20A 1PX3A 5D21A 5F5QA 4YZ4A 4GKXA 1AR63 5FQ0A 2JX9A 2A6XA 4W8JA 1HRV3 4AZZA 2PLV3 1XPWA 1EPZA 1MZ5A 2D7FA 3ACFA 5GLVA 1X9TA 3LB9A 4XMIA 3HJRA 3KT7A 3HVDA 1Q8SA 4JV4A 3W20A 5ISLA 5FZAA 1V00A 2VVDA 1OLRA 3TEWA 3PIGA 1IG3A 5FZ0A 1SDDB 2A70A 5D1IA 5KR7A 3H8OA 3H3LA 1QNWA 3ASIA 3OJBA 3W9AA 4WM7A 5EXOA 2VJXA 2XJTA 2ZGOA 3GJBA 3AKPA 2E7QA 4WM8C 4YVWB 5CA6A 4QPYA 5T3NA 1AR72 3ELNA 2Y34A 4I3GA 4ISQA 3IPVA 2XPJA 5GKAC 1LOGA 3SCHA 4PHZA 2P6CA 1W3XA 4NVPA 1R083 2RS33 4PBOA 1LCLA 5FYCA 5CFCB 3VBHC 4DRVA 4FAHA 1OI6A 3WG4A 4CPBD 4WBBA 3AZYA 5GM0A 4HN1A 4YW2A 4P9LA 2RR13 1EP0A 1LHUA 1QWRA 4LO8A 4XUOA 2YUEA 5H9SA 3SCGA 1AR81 1LOFC 3AMMA 3GZAA 3VHRA 4V2VA 5DMYA 3B3QE 5F8PA 4P9JA 5GLTA 2ZKLA 4XUNA 4QDSA 3PURA 2YG0A 4FPGA 4HZFA 1BEV3 2EXIA 3T1LA 2R061 2W91A 4NHYA 1A3KA 1S1AA 3BOPA 1U5IA 5JXHA 4GAZA 3EBRA 2WWSA 1XE0A 2WYSA 1E5SA 1A34A 1SDWA 4BU2A 1EAH2 5JR7B 3ZKYA 2VC9A 2IC1A 2X09A 1RUI2 3NJVA 4LBNA 1BYHA 3AKSA 5I8SA 1PO13 2K46A 2VMCA 2JG9C 4PI2A 4GMP1 4CDWB 1TMF2 5FUPA 1O5UA 1CAUA 4LBQA 4BQXA 4R9BA 1Q5OA 3RRDA 2WZR2 1LAJA 1QJEA 1HRI1 1RUC1 3VBFA 3B93A 3THPA 2C5DA 2Q8CA 4OUEA 5H9PA 1O91A 2XB6C 1H9WA 1DGWA 3U07A 5A3TA 1JOBA 1GUIA 4HVRA 5F3IA 5T52A 4D6RA 5EZWA 1S2BA 5GZCA 4OI4A 1V6KA 2ENRA 3BI3A 4AVTA 1LHNA 2GDFA 2OZJA 2RDNA 5A3OA 4AAXA 3ZOIA 3I54A 2ILMA 4OMCA 1J83A 4LA2A 5BNPC 5FYIA 5A7QA 4Q4Y2 5CNAA 4OI2A 4Q8KA 1PHMA 3IWZA 2OA2A 2WT2A 4N53A 3SHRA 2QJVA 1GP4A 1JTZX 1GQPA 3J7NA 4SBVA 4AHWA 3RZJA 3MUY1 1VE0A 1D4M3 4CP2A 4XFAA 4HVQA 4MXWB 1GZWA 1WD4A 3WDTA 5C71A 3VBRC 2VCCA 1QH6A 3ZMOA 1H6XA 1GWKA 4YG0A 1AXKA 1S0CA 3KSCA 2ZZJA 1NQDA 1UOBA 2B42B 2QQOA 3TEYA 2WQZC 2DCTA 4XUPA 1ULPA 5C4WA 4LXLA 4R4XA 4RHV2 1C3HA 2Z4FA 1VMHA 2VTXA 5FY0A 3WUCA 5LBFA 3KV9A 4R4ZA 1JYWA 2WKKA 1J59A 4XDOA 1X50A 2O14A 4XVHA 1FXZA 2VTFA 2Q8DA 1PZ8A 4GJYA 3O5SA 4CP9B 1VAMA 2QNKA 2WZ8A 4NROA 1NXD1 2B7YA 3WR0A 1U5YA 3H1YA 1AYM2 4LORA 1UU5A 3FE5A 1W2NA 5E16A 5C6CA 2G9FA 1ZX5A 1XC6A 1VRBA 4P9WA 4HKLA 1VBC2 3EB7A 4XAAA 1LESA 5J36A 2NPIA 3C7HA 2I74A 3ZFGC 1YQ5A 2X8KA 4TWTA 5L7OA 1W03A 2ZAHA 1W04A 2WNUA 5FY9A 4WVZA 4O9EA 5LY1A 1JZ8A 2WJSA 4YG3A 4RS5A 5GZGA 1RUNA 4PLMA 4AYUA 1WLDA 2R072 1W6OB 1Z0HA 1H8TB 1RTVA 2HWB3 2ZGNA 4JKLA 4KWJA 3AVSA 4X6RB 4AHYA 4GH4B 4LO7A 5DQ0A 1NX9A 1R1A3 3DXUA 3AB0A 1W9TA 3I2FA 1DHKB 1RITA 3IDCB 3PUQA 2CWSA 1YIFA 4I09A 1W2UA 4LR4A 1UXZA 4LBJA 4P9GA 2GC0A 1EV12 2QDRA 5DXDA 5H9RA 1RUH1 1VMJA 5EYXA 1GMMA 4E9KA 2JG8B 5CVRA 4PQ9A 1K45A 2P34A 4GJZA 2HBUA 2W0XA 1OD5A 3MGUA 1NE4A 3ILFA 4Q1PA 2FCVA 2BOJA 2MEV2 4DY3A 3PUSA 5LASA 4IEWA 3SXWA 3SMHA 1RUJ3 5KC6A 4QHOA 2DF7A 3D82A 2JB8A 1UX7A 3RMYA 1TG7A 1QJY1 1Z7S2 3H1WA 3RFRA 2C0ZA 4IE6A 4Z92B 4QAWA 1JYVA 3KGLA 4NUBA 2DCJA 2VNVA 4XDQA 1HW5A 4CP1A 1EYBA 1RUD2 2VW0A 2WDBA 2G1MA 2CU5A 2ZMKA 4EROA 1KFXL 2LRPA 5FP4A 2VMHA 4QXCA 1B35A 2QQJA 4XJUA 4BA6A 1FOD1 2OT7A 2JE7A 4PI0A 1MS3A 5HXMA 5CFCC 2VW1A 2HWC3 4FOVA 3DPRA 1D2SA 3MEPA 4QPIB 3MBWA 3DYMA 1BK1A 2VOWA 1VMFA 2DUPA 1UY4A 1CD3G 4AVBA 1T2XA 2E7AA 1OUSA 3SNMA 3GCXA 3J8F3 4HL0A 4LTAA 3GBWA 2DVGA 1UY2A 4YZ5A 4E4SA 4AL9A 1RHI1 4IUGA 1D0GA 1NCQC 4LLFA 2JICA 1RGSA 4FAGA 2OKXA 4HFSA 2XDVA 1DF0A 4FFFA 3M3OA 3ORJA 3POFA 5EJZB 5FY4A 3TN93 1C8M1 5FPLA 4RGAA 4LT5A 4OYUA 4UBHA 4O65A 2WR9A 5C70A 2TNFA 1AR61 1OVPA 2UY9A 1HRV1 2PLV1 3SH4A 4AFDA 3PLQA 4E2GA 1FMD2 5E6HA 3AYDA 4CUGA 4BMEA 2NMNA 2CAUA 4CDWC 3WCSA 2WO3A 2FMYA 4QB6A 5JVVA 1ZZ7A 5KC5A 2VMIA 3DXTA 3ECQA 5BV6A 2A6WA 1HN1A 1IQAA 4O61A 5CG8A 1REEA 4M3CB 5GZDA 3ILRA 3VUOA 1IPSA 4KL1A 3NV3A 2C4XA 4Q4W2 1GLHA 1HB4A 1CJDA 3UGGA 5I91A 3W5NA 4NJ4A 4QKFA 1Y9QA 2QQMA 3T09A 4XEZA 3I7DA 5I0TA 2YB7A 1ENQA 4J6GA 4NHMA 2VNRA 4CEYB 5IVVA 1R1ZA 2VY0A 3K4ZA 5FREA 2EICA 1POV0 1R081 2RS31 5EPAA 5GLUA 5A32B 4A41A 4BJ0A 4IESA 2BW8A 1ZBE3 1CZTA 2YROA 1SLLA 1K5MA 1ND3A 3FX3A 3GHNA 4PDWB 2W92A 4EN6B 5G05L 1CWPA 1AL0G 1O4ZA 2XKOA 1JS9A 2RR11 3NWKA 2WFPA 1I1EA 5LBEA 3BTXA 4NE9A 3OGSA 3URFA 2QKDA 3N7JA 2NP0A 1URXA 5BUVA 2IXIA 2KXLA 4K7JA 2AGSA 2IVIB 4IGQA 1BEV1 3U37A 1FNYA 4QQ2A 1YC61 2VZVA 5ANQA 1RJ7A 4OZOA 2OZ6A 4K1YA 1W99A 1ODMA 2D44A 1H9PA 4AOCA 3BUCA 1W9FA 5A3WA 5DZEA 1NQJA 3CNAA 3E6BA 2VQUA 1XJAA 4EN8B 5JMCA 1LGNA 5JIUA 3KT1A 1DLCA 1PO11 2BNMA 3AYEA 3LSEA 4H2AA 3DYPA 2VCBA 1V70A 3ACIA 3SITA 4EWEA 4EQVA 1VP6A 4YVSA 1ZA7A 2XQRA 4KWUA 5HXVA 4W6WA 5IATA 4QXBA 1CJPA 1ZNPA 2WL1A 4QM8A 3LEGA 3A0KA 4PLOA 3I4IA 3W21A 5HPOA 3GBFA 5FLJA 4YWAA 3Q8EA 4IETA 2XLFA 2E51A 1NLQA 2D3SA 1XNTA 4Y22A 1SLTA 4ARXA 3VKMA 2WO2A 1MPXA 5DAXA 1H8TC 3WF3A 1LB2A 3UV9A 5EWSA 4GH4C 2W39A 5ABJB 1DG6A 4AI1A 2JB4A 1OF3A 2ZTNA 3VBSA 2B4KA 2NZ9A 4QKBA 3UT0A 3LE0A 4W6YA 5F3GA 4N9IA 4NAMA 2PHTA 5F5IA 4Q29A 5KHGA 3RZHA 2JD4A 2VECA 2P3KA 3KQRA 4MGYE 1AYN3 1D4M1 3CIHA 3B02A 1KGYA 4CDXA 3WNLA 1V6IA 2FDHA 5CB7A 4XFFA 2YU2A 3ZFGB 4HN0A 3TB0A 2JECA 3VGIA 5LK7B 3SKJE 1IS5A 2IXCA 2VQAA 2A3YA 5DPNA 1KDMA 1RMU3 3UKNA 4EWAA 4MGSA 1E5IA 5ACA2 1MS5A 1JYNA 2FZ2A 1JOJA 1QDCA 4XIKA 5A6ZA 1AL22 2BBAA 5JZGB 2DYCA 1JYTA 1JODA 2AH2A 2YY1A 4QKDA 1W9YA 3LSDA 3ZSLA 2Y38A 3C7GA 4XACA 1WCSA 1US2A 2CSGA 4JVAA 2CTVA 4LHKA 3WDWA 1LOFA 4QX1A 3TOJA 3UGHA 2BBVA 5JPNB 4NRQA 4MUVA 3H3UA 2WFF3 1W6MA 1NZIA 2RM22 3IKWA 5LCWL 3BGAA 4K21A 3POBA 5IK7A 2O1QA 5FZDA 3OBTA 3SQOA 4WVWA 2DVBA 2RS52 2P3YA 4JGYA 2WNOA 2UU8A 2W94A 2ZABA 3JXSA 4HPKA 1VBA3 1AX1A 3IM0A 4LBLA 2YC2A 4MYEA 4CXXA 4X8NA 4CU9A 5FZ6A 3PVOA 5FMOS 3J9SA 3O1VA 4TYSA 5FO8B 3CJIC 3WZ1A 2JJ6A 3K75B 2BPA2 1VJ2A 5FK7A 1PVXA 5ANNA 1WA6X 1AXYA 1CVNA 5A1AA 3X29B 2HWB1 4CA9A 2AACA 2YGMA 1QJZA 1IZ3A 1ZZBA 5DUXA 2R16A 5A1FA 3LOBA 1R1A1 1QU0A 4B4PA 1ZM1A 2WNEA 1TE1B 3C8XA 2Y8KA 4RSUA 1BXHA 2A73B 1WW4A 4MGQA 3NNGA 3AM2A 1GNHA 2WLQA 5C8CA 1NE6A 1KDKA 1S0BA 2QQPA 2XJSA 1LULA 1W8HA 4FCAA 2VQ0A 3OYWA 1MZEA 2ZGRA 4AVVA 1T6GC 5AC92 3IT8A 2WS92 3IBMA 5FMCA 4Q0SA 1NKGA 4YM1A 1MEC3 4R9AA 2JXAA 1KEXA 1UCXA 2A6VA 2JDYA 1RUJ1 1VAKA 2P6HA 2Q4SA 4COYA 3FLRA 3AMQA 3AMPA 3PL0A 2PHLA 3I49A 1HB3A 1W9WA 4B4QA 1ZBA3 1XNDA 3K77A 5BY5A 4DUXA 1BVVA 4YFZA 4BQ4A 1BBT2 4GWMA 5C3QA 3H8RA 3LZZA 5FYVA 2B5HA 1NUKA 4GD4A 3OY8A 4CEYC 4FOYA 4GKYA 4LK7A 4YW7A 1LR5A 3WHTA 4DUVA 3HNBM 4S2FA 1W8ZA 2HWC1 5T5LA 1YQ6A 3D4KA 1NA1A 2FCUA 5A7NA 2B46X 1VBB3 3P3PA 3QH6A 4NOTA 4PDWC 4TSVA 3ZXFA 1X33A 2VBBA 4RGKA 2ZS6B 5M0TA 4AI2A 1OHFA 3J8F1 2ZOEB 3S57A 4LPLA 1COV3 2WT1A 3MO4A 1LU1A 2V73A 5CEHA 5JCTA 2DURA 5IVEA 2Z79A 1NY71 2BJSA 4IV3B 1DGRA 5GLWA 4AHXA 1YI9A 4HOOA 2ET7A 5E88A 1HXS3 3O0XA 2EIEA 2VW2A 1CZSA 2G4IA 2CV6A 3TN91 3AMNA 2JENA 1P8JA 3RSJA 3AKTA 3HAGA 3UKVA 1F35A 2GZWA 1TME3 1OC1A 4XZPA 3KHCA 3W59A 5C3PA 2TUNA 4XUTA 1UY1A 2CY6A 5DAQA 5DDJ3 5GJ6A 3ALQA 3FBMA 5FP3A 3N35A 3GCWA 4P9YA 5FPXA 2D40A 2C1FA 3RWKX 2ZX1A 2XGXA 4XETA 2PQSA 5CFDA 2KA3A 2HEWF 2XJQA 1DGRN 3N3HA 5CKMA 2IXKA 2QBXA 3P6BA 4QPGA 1XSQA 4ZS3A 3PIJA 3OGVA 2ZAAA 3NNMA 2BVBA 2AYHA 5J37A 2CYFA 3FLTA 4D6QA 5C3OA 3UYJA 4CEWB 2B9VA 3NRUA 4KG0A 5ABJC 2BWAA 3VDDA 3CLPA 5I93A 4R9CA 1XYOA 3WF2A 1JYXA 3BALA 2B9UA 5A7SA 1W0NA 3RDIA 1H30A 1PMJX 2BVVA 4YM0A 1ZBE1 2E7TA 1AR93 2PAMA 4EWDA 1SZBA 2EF6A 3U4XA 2FDKA 3MPBA 4JGZC 2W1WA 2JIGA 5IWFA 2QQKA 2GNDA 1WLCA 2JDPA 2R043 3LQCA 4YVWA 1GQGA 4ZZ5A 1CGPA 4DXRA 4I0BA 3TWIA 4UFLA 1LECA 5C9AA 5IYYA 1PNFA 3HPNA 3ZR5A 1ULFA 4A44A 1ZA4A 1ASJ3 3OUJA 3LFIA 4GWIA 2JDUA 1VBD2 3MW3A 3S30A 4BCUA 3WY6A 5JZGC 1JMUB 4ONUA 2Q1MA 3L2HA 3V64A 3WSOA 4CDQA 5CISA 1I3HA 4FI9A 3JD73 4DRRA 3QACA 3VL8A 1L3JA 4RQPB 3ZYFA 4M0NA 3FFQA 4IDZA 2LALA 5T55A 4KH9A 5JLVA 3HQXA 3M3IA 4K9SA 1S0EA 4IV1B 4Y5Z0 4C1XA 4E2SA 5C5TA 2J1SA 5FZCA 2PHRA 4CCLA 5CKNA 3OUIA 3PJQA 3E5XA 1F8VA 4FOWA 5JOWA 3DKWA 1LTEA 4FOQA 1HB2A 4NIAA 1REFA 4XF3A 1UZWA 1R64A 2VAUA 5LRRA 3ABZA 3ZYBA 4LO5B 3USUB 1UU6A 2HWD2 3AP7A 3CMGA 2AEYA 3Q9OA 1XOYA 3BOWA 4PIXA 1JXNA 4UFJA 1MVEA 4UWDA 1X36A 2CGNA 3PDQA 4B1MA 3RZLA 4AQTA 5FZ3A 3WEZA 4IXLA 2QTWB 1OA3A 1RUC2 4BQ3A 1ZZ9A 1LOBA 5BNNB 1X7NA 1YEWA 1ZRCA 2XQXA 1AYN1 2VZTA 3NV4A 2DBNA 2RHPA 4TN7A 4LOSA 4EJRA 1AR73 5FZMA 1ALYA 4UOJA 1UYZA 1DLLA 2WQ4A 5FY7A 4RYDA 4D7SA 5BNOA 1AHSA 2RS13 2J22A 3VKFC 2RJ2A 1UOFA 1RMU1 1WZXA 5A3LA 5FBJA 2K0GA 4W6XA 3RZZA 1LEMA 2XHNA 2Y6GA 3MFCA 4LHSA 1FAYA 4QGNA 4AI8A 5A7PA 1RUE2 3OEAA 5C8WA 2DCKA 1BCXA 2D6KA 4HKOA 5F2WA 3LEIA 3MIGA 4MXWA 4AWDA 1BVP1 1OXCA 2WT0A 5FLHA 3M3EA 3BIWE 4QWNA 4D3WA 3D0SA 4FVVA 2WFF1 2KM2A 1DGLA 1LRHA 1PIV2 2UYAA 3EYPA 2CNAA 3KHBA 4FPFA 5EP9A 5FYHA 4TZDA 4NR1A 1W6NA 2RDQA 4B7KA 3VD3A 3A0NA 3PTRB 1CAVB 3QBQA 4EYUA 1AJOA 4BLJA 5JOZA 3VDBA 1LJ7A 2VG9A 3ZXLA 4KGGA 5F5CA 2D5FA 2P1BA 3AX4A 3B69A 1I6XA 1VBA1 3FUOA 3Q8AA 1G9AA 2HH9A 2WZEA 3O0WA 4XBNA 2OPKA 1EAH3 1YFYA 1RUI3 4ZU5A 2D6OX 4H3WA 3N7KA 2ARCA 4IV3C 1DU3D 4XJWA 4CP9A 2WYFA 4LUKA 3JQWA 4EN0A 4A6OA 1TMF3 2YBPA 3U4SA 3E1F1 3INAA 4H7MA 3A22A 4QX7A 4A2UA 4EZHA 3LEMA 4AAPA 2WZR3 4AGRA 4FXGB 4GQ7A 2R7EB 2C24A 1QJFA 1O7FA 3M70A 2Y6HA 5FXVA 2PN5A 1XYPA 2YXSA 4B8EA 1LGBA 1JU3A 3EJKA 2AC1A 1PZ7A 1BLZA 1ND2C 5LK5A 5FY5A 1ZRRA 2W95A 2VVFA 4DY5A 3NNJA 4XF1A 1O3RA 4LIUA 1ENSA 1D7PM 1MEC1 1W8WA 1SHWB 2BRTA 1Q8PA 1RL3A 2ZA9A 4Q4Y3 1H1IA 3B00A 2P4EA 3KCYA 1RUH2 3KMHA 3A23A 2KR2A 2X10A 1Z78A 1ZBA1 3VBUB 1GSLA 2JG8A 4CVUA 2ZHKA 5FKBA 4INDA 4CUAA 2CHHA 4LNVA 1V6NA 4COZA 4CCCA 4EV0A 4CEWC 3NKGA 2D43A 4OI0A 3RYKA 2J42A 1DYKA 1O3TA 2PA7A 1DQ6A 3MLKA 2AUYA 3A7QA 4QQOA 5JR2A 3FWEA 4HLTA 1ULCA 1UKGA 2G9GA 2LW8A 4RHV3 1VRH2 2GNBA 3VD5A 3ZXDA 1NCQB 1UMHA 2PTMA 1VBB1 2J7MA 2VOXA 4A7ZA 5HV4A 2D6LX 4FFGA 1GNYA 1WBLA 3D0JA 1FPN2 2XUEA 4QQLA 4OZXA 2JEMA 5SV8A 2PFWA 1COV1 2Q5TA 3NVCA 4CDUB 1WA4A 4RN5A 1LODA 3OB8A 4YW4A 4LITA 5EHDA 4KGQA 1GZ9A 5F2SA 1FOD2 3MLLA 3OBZA 4FPYA 1D4VB 2Z5WA 4ISRA 4CUCA 1AYM3 2YDEA 3NV2A 1HXS1 3E6DA 4C0HA 3PUIA 3IN9A 5FY1A 4J1XA 5LA2A 1W06A 2J1TA 4QPIA 5CYYA 5B4NA 2V5YA 2DUOA 3NJZA 4NHKA 4Y1UA 3RZGA 4M01A 1VBC3 5EIYB 1KS4A 1TME1 2HEVF 4N7UA 1H1MA 4RQPC 4ZHNA 3K4DA 1J3RA 4IL7A 2J1EA 4U36A 3ZFEB 2RJKA 4IV1C 4Q27A 4PF5A 5DDJ1 4Z82A 1LU2A 1GZCA 3TAYA 4EN7B 4GB32 3BPSA 4XOGA 4NIHA 4M4RA 1C8M2 1I5PA 4AXOA 1NLSA 5I8YA 4R8HA 2DCYA 3BYWA 4AFCA 3D3AA 3PU3A 1NAEA 1M4WA 4OHXA 4GWJA 2DDUA 5J98B 1JH5A 1OPOA 1IQDC 1AR62 4UF0B 3O0VA 2D93A 2PLV2 2ADEA 2ZGPA 1F9KA 2BWCA 1XE7A 5A6YA 4BIFA 1DYOA 3U14A 2BEOA 3BODA 5IK8A 1F15A 1MZFA 5FZBA 1HQNA 1Y3TA 2PHUA 5FZLA 3TNPB 2Q30A 1J3QA 3JCIA 1PGL1 2KD7A 1GBGA 1PK6B 1C8NA 1FATA 4XE9A 1F4HA 2PMWB 4CXYA 4CCOA 3HWJA 4Q4V2 4XZUG 2ZBJA 1RINA 1UY3A 4HSJA 3UESA 4AVSA 4BIOA 1Z7S3 1UWWA 3SCFA 1AR91 4LBKA 5BNNC 4LA3A 2G19A 4MHRA 1GP6A 3CHXA 4UAPA 3FBYA 2Q0AA 4RGGA 1W0OA 1YQ2A 2R041 1RUD3 4XC9A 3WG3A 2ID4A 3B9IA 1OH4A 4XMAA 3PUAA 4QHZA 2ZPXA 5DAVA 3SKVA 1IHMA 2Z42A 2VNGA 1OOPC 3I59B 4JTOA 2D3RA 2RS32 3AP9A 2ZHLA 3ZN5A 5I0SA 3BIEA 1ASJ1 2PAEA 3JBG2 2VZUA 1CONA 2MPFA 3JB4C 3ZSEA 2XVGA 2VBPA 1XSRA 3WP4A 1GOFA 2A71A 1W3VA 3JD71 4C91A 2WN2A 3N9LA 4FPCA 1HQWA 1PM7A 2HWF2 4UFMA 1DQ4A 1I5ZA 1N1YA 5FJKA 1O3QA 1ENXA 1YJLA 3RYRA 4CCEA 3VBOA 3U78A 4B29A 4PT6A 1QEXA 3V0BB 3W5MA 1SLCA 1CAWB 4YLZA 1VBE3 2HJIA 1VALA 4L2NA 2G9ZA 1CX4A 4MVTA 5FQ0B 2ZX3A 5FLIA 4Q5OA 3U11A 4BISA 1MQTB 3EQEA 3ZFFB 2LTNA 3EXUA 5KXDA 5JI7A 2XKPA 4D7YA 1FMD3 2QQLA 1PO12 1PVC3 1S2EA 5IUQA 3KV4A 2ARBA 5FMDA 2EALA 1O4TA 2VMEA 4FPOB 3ENRA 2ZGLA 2EIBA 2D6NA 2QCSB 4WM7B 5CU1A 4Y1XA 5T5PA 5LEJA 3HQRA 4QPWA 4CCMA 3BTAA 2WUHA 3BB6A 2BDRA 1POV3 2YMZA 5GZEA 3ZYIB 2HYXA 3E6CC 1AR71 5A80A 1JHJA 3IPVB 2DVAA 4QXKA 4Y5SA 2R0FA 2ZEZA 1XE8A 4IEQA 3OGRA 5K4LA 4QQPA 3TYJA 1VPHA 2IUWA 2YBSA 2RS11 3R0RA 4LMFA 2VL4A 4Y4RA 2JDKA 4IGOA 1WW5A 3VD9A 1C1LA 1US3A 3FHQA 2XXZA 1REDA 3R4DB 1QOSA 3VBUC 2F17A 1D4M2 5I0RA 5FUIA 2Y6KA 2ZX0A 3ZDVA 4FQZA 3OUHA 4EN9B 1SFYA 1YFUA 2Z2SB 4MGIE 5L9RA 4BQ5A 5FPUA 2XL7A 3WP5A 2CGPA 3ZPOA 2ZEYA 2R0HA 3CJIB 3LGRA 1G7YA 3LDBA 4RR3A 1ULDA 2QFEA 4LBQD 5A7WB 1ULOA 5JZGA 2FHRA 2J1UA 2GMMA 2JD9A 1KRIA 3MV11 4Q0QA 1N1SA 1QXRA 4CDUC 1EAH1 3D8CA 3MI8A 4Z2WA 1RUI1 3VDAA 4Y1VA 3SEEA 4KWKA 1V6OA 3F2ZA 1L7LA 3UGFA 4AW7A 3ME2A 3KGZA 4P5HA 5EYYA 2W46A 1Q3EA 5FP8A 3UKTA 5JOXA 3I2DA 4NIGA 1TMF1 1CAUB 1QQP3 4K1ZA 2TEPA 2W9XA 4LBQB 4AEKA 2WZR1 3O14A 3VZLA 2A3WA 1HIXA 1H4GA 1Y9MA 5HCFA 1N3OA 2RE9A 3AKRA 4QQHA 3WG1A 2C26A 4YW6A 4P9XA 4A42A 3VZJA 5FDBA 3VZNA 2YBKA 1S4CA 2PHXA 3WNXA 1JZ2A 1WMDA 2PHWA 3ZFEC 1KXGA 1NCRA 1K3IA 3CL1A 4LKDA 5SV5A 2HWB2 4YNIA 2UURA 1SFPA 1R1A2 4PCRA 2WNVC 1ULEA 1RUG2 3MW4A 1QKQA 1WGPA 2QQVA 4Q4Y1 3HT2A 2IXHA 1G9DA 1KITA 4D94A 4Z8BA 2RMU3 3ACHA 1NYWA 5AVAA 2W5FA 3IZOA 4Q4X2 1GZWB 4ET7A 2V5DA 1ACCA 2X5IA 3KVAA 5A7OA 4CRQA 1JU4A 5T5JA 1Q8VA 5CKQA 1OD3A 4ZKTB 3RZMA 1PK6C 4XQDA 4HG6B 4KBBA 2WAOA 3ZXAC 3CDZB 5ACA3 2OS2A 1J1LA 3T30A 4AFMA 4G3YC 1AX2A 1DQ1A 4OUMA 4RHV1 4LEJA 3NAPC 5BPXA 5C33A 5A3UA 1W6QA 4X6QB 3POEA 5EJ1B 1Q8OA 1K42A 1OA2A 4ATEA 2J1AA 3CF6E 1NT0A 5FKCA 1J3PA 5APAA 1T6BX 4BXSV 2GN3A 5FYZA 3VHOA 2RM23 1SBFA 4DOUA 4OI1A 4OQ8A 1ZRDA 4WVMA 4Q1RA 1AYM1 4JRLA 2HWC2 2R1BA 5KHKA 1JOPA 2YPJA 2RS53 5FYYA 2RG4A 3PHMA 3THCA 3RJRA 5FOBB 5L7OB 1VBC1 3C3VA 4IEUA 3WV6A 4E4DX 1UMIA 3M7AA 2UWBA 3KF5A 3GXUA 2XBO2 1EPWA 2NLRA 2Y33A 2WNUB 2XLAA 3E5QA 3F95A 2E9QA 3V65A 1E57A 1FV3A 2FQPA 1FV2A 3AP6A 1NY72 2Y0OA 3DV8A 3PUHA 4FFHA 5FRAA 1AJKA 3TBDA 4ZXEA 1NOVA 1PZ9A 4BB3A 5I8TA 4JX0A 3J26N 4FP3A 4ZPIA 4BQ2A 3OPTA 3GDBA 4MGZE 3TN92 3ZMNA 4GIQA 4ZY9A 4C90A 4DFSA 4IEXA 3O1OA 2QQUA 1R092 1XBFA 2XMLA 4ASMB 5JAXA 4Z07A 2QZ3A 4A7KA 1MQTC 4K3UA 5FMOL 3ZFFC 4XCBA 1O4YA 1WBFA 1WCKA 2EXJA 4V1PA 4MSVA 2Y6FA 3PVNA 4D6SA 4NHLA 4XQ4A 1A8MA 4QHBA 5FZIA 2A3XA 5AC93 4Q0UA 2WS93 1ZRFA 2FZ1A 5CG9A 4JGZB 1ZZCA 2OIIA 2ERFA 4YFWA 4YGEA 3RYPA 4QKNA 3NKTA 4LJHA 3EO6A 5D8AB 4WM8A 1W6PB 4HXCA 3IAQA 5FCCA 3TNQA 2ZCWA 4XYXA 4BPZA 4XF0A 1ZRIA 2BFUL 4WM7C 5FOJB 1W8UA 4Q26A 1Z7S1 4AEMA 2A1XA 2DVDA 3POYA 5I0DA 1OQDA 5F7UA 1K5JA 3RJ2X 1QJX2 4KWLA 1B09A 3AL5A 1BBT3 3VBHA 2V09A 3VHPA 4B7EA 1RUD1 3AC0A 3RZKA 1GOGA 5FMBA 4C8DA 4XAEA 1S2KA 4PIZA 1W28A 1GU3A 2ATFA 2R32A 3THDA 1WW6A 3DPRB 3ES1A 3T2QA 2ES3A 5A33B 1RYYA 5F39A 2ZHNA 3P1IA 5E1RA 4LKEA 3HNMA 4DXZA 4NN0A 5KXBA 2JE9A 2P37A 3CBNA 1UQXA 4TXWA 4E4HA 1RVF3 2A5ZA 2CL2A 4KQ7A 1WMFA 1AXZA 1UIKA 3N36A 1H8VA 1Q56A 3KB5A 2BGCA 4AHZA 2DU1A 3WDUA 3T2TA 3VN4A 4K8RB 3VZKA 1J1TA 2DFBA 2IVJA 1XXNA 3Q8CA 1HX6A 1Y43B 1LNSA 4XFIA 3OD0A 4OMDA 1LHVA 3ZO0B 4P08A 4Z2AA 1VBE1 2OQ6A 2JG9A 2RDRA 4L0PA 3TRSB 2J1RA 3VHNA 3BU7A 1QJU3 3GALA 5FIXA 2HYKA 3OCPA 1V0AA 1PX4A 4JKKA 2BFUS 4FSJA 1BMV2 4F83A 1JUHA 5JIAA 5IVJA 2VMGA 1FMD1 1U12A 3ITQA 1S55A 2UY8A 4MZUA 2W68A 2YGLA 2HWE2 3O1PA 1CESA 1PVC1 1W8OA 3O12A 1OUXA 3OGJA 4PLNA 2D98A 4IEVA 3O1UA 2ORXA 3IIAA 3WDYA 5FP7A 3VBFC 5FZ1A 4ZU4A 5L9BA 2YU1A 2VXJA 4XFGA 4Y33A 2VUAA 5DABA 2W2IA 3GM8A 3USUA 1PMHX 4COWA 5BNPA 5K0UB 1GWLA 2VD7A 1POV1 1G9FA 1HN0A 1YWKA 3H8UA 4Y3OA 3VZMA 4D0QA 3ZSJA 5J96B 4LQRA 1HKDA 4M0HA 2X29A 1BHGA 2D3PA 4LE3A 1LEDA 5FAXA 5LEKA 3WT3A 3VBRA 3AYCA 5KXEA 2ZEXA 2YFZA 3LEKA 1K5MB 1V9U2 5F37A 2B45X 4BK5A 2ET1A 3O1TA 3ZPYA 1HV0A 1YFWA 3U10A 3GYDA 3LD8A 4I2OA 4IERA 4QX5A 3WQBA 3WHUA 1XNBA 1IS6A 3AYAA 4YZ2A 5K8SA 4AR2A 4LUMA 4TLFA 3BKZA 2OVUA 3N9MA 4OFGA 1RMU2 5FXWA 1JI6A 1KJRA 4F3JA 3AZZA 5IAVA 4IEPA 1VBD3 3ZDSA 1FYUA 2DTYA 2Q1FA 2GMEA 5IVCA 3C7OA 1DQ0A 1YNAA 2OUHA 4FBFA 5J3UA 4ATFA 3KS7A 5FZ4A 4FTSA 4IQPA 4QMAA 5FY8A 4W65A 1EUTA 4CCKA 1GANA 4CYDA 3RGBA 3WP3A 1PO23 2VOTA 4L92A 3S7IA 3T3YA 5JXJA 2FDJA 1UN1A 4RA0A 3T0DA 1RIRA 3MIFA 3ZFGA 3B9CA 4CSWA 3UJQA 2YZ4A 1G86A 3FC0A 4CU7A 1RUF3 2OQ7A 3MW2A 2OX0A 1CPNA 1ND2B 1QQP1 4DPNA 1G8WA 4IE0A 4DZGA 3MHZA 4A45A 3V0AA 2CDPA 3SH3A 4MV2A 4AQ6A 5L7OC 3SC7X 3IB3A 1UOJA 3ATGA 4NRMA 2VCMA 2QE3A 5IK4A 1AZDA 4XTMA 4QX3A 3N7MA 1HJGA 3LCPA 1SCRA 2WNUC 1XNAA 2GSYA 5KHHA 5FZOA 5JOYA 5IAXA 2GH2A 2HWD3 3MIHA 4RS5C 3QLQA 4UW5A 1ZVFA 4Y22B 3WF0A 2BNOA 3ZXKA 5T50A 5F3EA 5DZFA 1TZOA 2XH6A 3S5QA 1F31A 2K9ZA 4JHZA 1JUIA 4Y26A 3ZN4A 3ZYRA 1JBCA 3WUDA 5DG2A 4Y1YA 1DQ2A 4MLOA 1U0AA 4UW6A 3S7EA 3OOXA 3T4HB 2WO1A 3ZKUA 4AEDB 2WWUA 5FJHA 2I2SA 1BJQA 2VTXJ 4JHTA 4XJ8A 5FZ8A 4YPJA 4DXTA 2Z69A 2EXKA 2RMU1 2W87A 1OPMA 4M00A 4I0AA 1ULGA 4CDXB 5GZFA 4I3PA 2WA4A 5IW0A 3OBRA 3OBAA 3LIGA 3R4UA 3WDXA 4CCNA 2GNTA 2WO7A 3I2GA 3H50A 2P5BA 2K2SA 2QQIA 3WX5A 2FMDA 4BWOA 3MV01 4N43B 5D8AC 1PGW1 1UX6A 2N7GA 3K46A 2VNOA 5DUUA 5ACA1 5FZGA 3A21A 3VZOA 1O6UA 2VOKA 2A75A 3MF9A 3MYXA 3VD4A 4YYOA 1W8TA 1RUE3 2WC2A 4V2WA 5FYSA 3WG2A 3VBUA 2JKBA 3D6EA 1F2NA 1LGCA 3VDCA 5CFCA 1OLMA 5C5UA 3E5UA 1IS4A 4OHVA 4ZS2A 1W6MB 1YUDA 2VPVA 1AX0A 1B35C 3DKQA 1PIV3 1AR82 2RM21 4XFBA 3HNYM 1F5JA 3V0AB 5J1XA 1Y9GA 3DGTA 1SPPB 3DPRC 5KWRA 5LB6A 3BVCA 2L9LA 2RS51 4JGYB 1WCQA 5FPZA 4HPKB 1HB1A 1NCQA 4GWNA 3FHAA 5B4XA 4CPBA 2R062 4L8QA 1QDOA 4M3CF 1DZQA 4E8CA 3MLJA 4YGBA 2FDFA 1FX5A 3ST7A 3OTFA 5FWEA 3ZYGA 3K48A 1AF9A 2WABA 3FMGA 1N3QA 2QQNA 2W1SA 2YYOA 2ZMLA 3ACLA 4YM2A 1QMJA 1QGLA 1X82A 3ZVXA 3LOIA 2JDNA 4XURA 1KD7A 1VB2A 1N1TA 2TBVA 3GJAA 4YZ3A 4CDWA 1EY2A 1TME2 5DUWA 5C8CB 1X8EA 3AZXA 2ORZA 5IHRA 3ZXJA 1HRI2 2VUDA 4SLIA 1QHDA 3VD7A 4AI3A 4ITCA 3EHKA 3SEPA 4GMP0 5FPAA 5AC91 3R4SA 2WS91 2E33A 2DFCA 1W90A 4LE4A 1WLTA 4NHXA 3VKNA 5JMOA 1IGOA 3WNNA 3WF1A 4B3NA 1WUVA 3ES4A 4JCKA 2MHFA 5LWBA 4KU7A 2YHJA 4UF0A 2ZMNA 1OOPB 1RXFA 4OHZA 4G9SB 4QDQA 1DIWA 5K0UC 3KCXA 3LKJA 1BBT1 3POJA 3KVBA 3UNPA 1OT5A 3T0AA 4FPEA 3P3NA 4P02B 3CEWA 1ZZ6A 2JDMA 2Y26A 3J7LA 3OPZA 3HMYA 1UNBA 3L2YA 4QXHA 1UPIA 2NMOA 1K5MC 1ND3C 1VRH3 5FV3A 3RG0A 5J48A 4MHUA 1AR92 4XHXA 2AZ5A 2WSVA 1DZTA 1WW7A 4E8DA 2CGOA 5LA0A 5FZEA 1FPN3 1MZ6A 1YLLA 2EVXA 2WSUA 4NIIA 3ZSMA 2ZGMA 3CZJA 1QNYA 3DL3A 4COVA 2XR4A 2X05A 1RVF1 2LM3A 2H0VA 3P5BA 1HLCA 2XJRA 1SCSA 4HBNA 1O59A 2GU9A 4YARA 1XYNA 3NO8A 3SLIA 3I59A 1ODNA 4QX8A 4CE8A 3L9JT 5HCAA 3WP6A 2WINB 1CZVA 2GNMA 3JU9A 2WWJA 4UW3A 2VBDA 4GA9A 4NIDA 3LAGA 3WD5A 2ZHMA 1SACA 2WAAA 1C5HA 1TVGA 3EMRA 5FP9A 1QJU1 1IKPA 2XG3A 1GKBA 2Q8OA 3M2MA 1QIQA 3MPPG 3FL7A 3RI8A 3WNPA 3LF7A 5DZGA 4IW3A 4DXSA 1F5FA 3I3EA 2XJUA 2IXLA 3UK9A 2ZKNA 4AE2A 3NQHA 3PNAA 1NLRA 4E2QA 4GB33 2F4LA 3MZHA 3HN3A 1UU4A 1H6YA 5I0UA 4QX0A 3NMBA 3GZEA 1W6OA 1HJFA 1H8TA 2BERA 1CAWA 4LHLA 2W52A 3TEZA 4GH4A 5EQUA 2NQYA 5H9QA 5T5OA 3ZIWA 4QPGB 2B8MA 4WV8A 4JC1A 1CN1A 1MQTA 4XJ9A 4A6SA 3DEMA 3GZUC 3ZFFA 1UPSA 1UYXA 1IS3A 2VO5A 4YGCA 3VDDB 3GBGA 1SBEA 1VAVA 1S0GA 1TEIA 3VBSC 3VLBB 4PIYA 4AEDC 5JSOA 2BGPA 1QOTA 4Q4V3 3T0BA 1DCSA 4MO3M 1GV9A 5JSPA 2AR6A 1APNA 2B39A 3AFKA 1I9RA 5L73A 3AZWA 4I02A 4HONA 4QM9A 5BNQA 3CJXA 2ARAA 4CDXC 3U0ZA 4LKSA 5HI0A 1WKYA 1G9BA 2HBTA 3PMEA 5DN2A 4CCJA 1QJY2 4DB5A 3CQOA 1G6NA 2BZDA 1SMVA 2GN7A 5IVYA 2RS12 5C9AB 2Q1ZB 3LPFA 4N43C 1OKQA 1JHNA 1UYYA 2BYVE 3RI9A 1DGWX 3BCWA 5JDBA 3NJYA 1VBD1 1E5RA 1NG0A 1DBNA 3JBG3 4CDQB 3SISA 4MOAA 3CKHA 5FFOC 5AFBA 2GAUA 5LATA 3I2JA 1PO21 5DUVA 2HWF3 4IE7A 4JDNA 1D0HA 2UYBA 2W1UA 4N9HA 5LBBA 3AK0A 5FYUA 2PHFA 3OSDA 5HCBA 3POSA 3ZYHA 4FTEA 3FUQA 4FXKB 2D5HA 1RUF1 1VB4A 3CJIA 5AVPA 5IVBA 3IMNA 1SFNA 2GC2A 1GOHA 1RHI2 1GP5A 1X9PA 2R073 3KF3A 4JGYC 4O7XA 4XXPA 2QUOA 2BP6A 1H2NA 2BV4A 4HETA 2ZGTA 5A7WA 5LZ6A 3GHMA 4HMZA 4QU2A 4HVOA 2WNVB 2HWD1 1UAIA 2VVEA 3U75A 5GALA 1EV13 2WA3A 2LS6A 1OLME 2GALA 1OQ1A 3C7EA 3G7DA 1HRV2 4ZONA 3ILNA 3WQ0A 1W05A 4XDPA 5IT6A 2R1DA 4ASLA 5L9VA 1IPJA 2RV9A 4L99A 3ZN6B 2MEV3 1GFF2 5C8CC 3ROUA 1CIYA 3ETPA
chains in the Genus database with same CATH topology
4RD7A 3WQ7A 4O9GA 4PJYA 4QT6A 4Q0PA 2OW4A 4M3CA 4HK9A 4QGMA 2ZGUA 2E53A 3NAPB 5BNOB 5T54A 3RS6A 5LRSA 4XJAA 1CAXB 2XVKA 4CEYA 1RUE1 1R082 4S2GA 5A32A 5EV7A 4BOWA 1AVBA 3FHIB 1QOOA 4XFHA 3AZVA 4FO9A 3WVJA 4PDWA 4E4ZA 2RR12 1A6CA 3VKOA 1PIV1 5K9YA 1W6NB 1M06G 1YRZA 4QD2A 3UJOA 1NA1C 3OF1A 4J1WA 1YFXA 2ARXA 4KG8A 3MIBA 1BEV2 3AJYA 1RJ8A 4Z1VA 4H14A 1TNRA 4META 4Y20B 2IWGB 2VU9A 4N90A 1MR5A 3KLSA 4AVCA 2XJVA 1H2MA 1NXMA 2MNGA 1MS8A 1SLBA 4JTNA 3WW4A 4KNCA 3JZVA 2E6VA 3KCCA 4JDOA 2JDZA 4AQSA 2AREA 1UZZA 3CU7A 1OQEA 2D6PA 1GNZA 1OSGA 4FTBA 4WVVA 1DDLA 1FI2A 4AK3A 3MFAA 4Q4W3 4HANA 3NW4A 1RUG3 2H6CA 3LWCA 1BQPA 2VXRA 3ZX7A 5CFDC 5CIRA 4XILA 3H1MA 1S0DA 2GC1A 4COUA 5ABJA 4QPGC 4OHYA 4Q4X3 4D69A 5K7PA 1UL9A 1LOAA 5DG1A 3M3QA 3WCRA 5KBFA 3VDDC 1CIWA 5CAZA 1C5IA 2QDNA 3PVBB 4H7LA 4MXVA 2EAAA 3GF6A 4JGZA 4ES9A 5D8AA 5KXCA 4FPHA 1W6PA 3IDEA 3NSTA 3THTA 1MACA 5BYNA 1VRH1 3K51A 1YIPA 3MICA 1KJLA 4XPVA 4RL7A 4I0WB 1FPN1 2BUKA 2DCZA 4YVWC 1DFQA 2AENA 2ZACA 5C9AC 1J58A 4U2AA 1LOEA 2R30A 1XU2A 1SEFA 5A33A 3I8TA 3WLUA 1ZYBA 4LLOA 1Y7BA 4CDQC 1MS0A 4LO6B 3QOPA 1MS9A 2XBO3 4N7IA 3RMXA 5JPMB 2GMPA 4BE3A 5L19A 3LA2A 3ZXGA 1CR7A 3VBFB 1YO8A 4DS0A 3AXEA 3B7MA 4JQRA 3VV1A 4BH9A 2UWCA 4GB31 3DF0A 3FFZA 5F1RA 1BKZA 4OLLA 4FPJA 1R093 1VBE2 3MIDA 5E8AA 4CZSA 1W0PA 1IKQA 3NV1A 4UW4A 1ZREA 2W08A 2P3JA 4N53B 1OA4A 1N47A 1XNKA 3WW1A 3AP5A 3JQXA 4XIOA 4NWWA 1PVC2 4OVEA 4PBPA 4AI0A 1U5ZA 1UW8A 3ZYJB 3PVEA 4Q4V1 1V6JA 1V6MA 3MDPA 4YGDA 2HKXA 4BM8A 1HDKA 1WMEA 1RUJ2 4Y1ZA 3RWNA 5C4WB 1QJX3 1Q43A 2IFWA 3POWA 5TSWA 1C4RA 5K0UA 1AL23 1PMIA 3KD4A 4A7YA 5BNOC 1N3PA 4HSLA 1UZYA 3WW3A 4URTA 4YG6A 2ZGKA 2P2KA 5KHIA 5FO7B 1RC6A 2YV8A 3JBG1 3WOGA 5FO9B 2OYZA 3ZIXA 1DYPA 4D7TA 2HWF1 1X8MA 3J8F2 1IOAA 1IPKA 2SLIA 4M3CE 2GC3A 3VBOB 2X53S 3H9AA 3FLPA 4DQAA 4XHBA 3ETQA 4RS5B 3HD8B 3AP4A 3AFGA 2R071 2XWJB 4IV3A 1O3SA 3OD4A 3MF6A 2DVFA 4BLIA 1C1FA 2O8OA 4LHNA 2CAVA 2QZ2A 1EV11 3T1MA 3AMHA 4NO4A 4BQ1A 3FZ3A 1VIWB 2HWE3 3PTYA 4LULA 2WLPA 4K8FA 1QQP2 3SH5A 1QY4A 1ND2A 4GXLA 4H55A 4DMIA 2XJPA 2MEV1 4HKWA 2VGDA 1OLQA 5F6KA 1NZCA 3HIFA 4NPRA 1CQ9A 4G4FA 2ZJCA 1VLNA 1LHWA 4DINB 4XW3A 3V56A 4AEDA 2EAKA 2VOVA 4XF9A 2QVSB 4CEWA 2A7AA 1B35B 1V9U3 2RMU2 2UWAA 2JG8C 1XRUA 3M3CA 1C28A 1ZBE2 3E97A 4BHPA 2YC0A 2R6QA 2GH8A 1XNCA 3J4UH 4XFCA 4F7ZA 3IDBB 1GYKA 2PAKA 4FPKA 2BNNA 3M4FA 1PGW2 4N43A 3WDVA 3BPZA 4C1WA 4YRDA 2NYYA 4RR3B 2WZPP 4DNYA 3JUUA 4XBLA 4AG4A 2RJLA 5GLZA 3R05A 3S6PA 2R49A 1D2QA 4X8PA 3PMSA 3QCWA 3WQ1A 4RQPA 2PHDA 5F9TA 4QPIC 2IZWA 3AXDA 4IV1A 1GICA 3HN1A 4XTPA 4AEJA 1MVQA 2ZGQA 4WZFA 1JYIA 2DUQA 2ZZQA 3ZSKA 4A3XA 4XXAA 3APBA 3FJSA 2EIGA 3N7LA 4P14A 1NCRB 1TNFA 3VL9A 4S2HA 1S0IA 4Q4W1 4HK8A 4ZXKA 1QH7A 4Y24A 4I30A 4Q2FA 1RUG1 1ENRA 2P3IA 1GQHA 2PYTA 1U5XA 3CO2A 2F6BA 1H4HA 4CP0A 4Q4X1 4AGVA 4N53C 2H0BA 2X5IB 4FPLA 4ZU7A 5J7MA 1ND3B 3N4MA 5BNNA 3RQ0A 4GULA 1AYN2 3NL1A 1A8DA 1UD1A 1H0BA 2A6ZA 2D97A 3QD6A 4KU8A 1N1VA 4YW1A 1OFSA 2IFRA 5CADA 1W6QB 1OOPA 3H7JA 5C4WC 1ZZ8A 2ETEA 4JRAA 1Q8QA 4OULA 4FQ4A 1LHOA 1AR83 4YSFA 4WVMB 1YJKA 1ONAA 1UKRA 2I45A 4XJZA 2DTWA 3O7OA 5JWPA 2WFF2 3DN7A 4B4RA 3QH7A 1XQNA 4UBGA 4YVSB 3WINE 2R063 1CPMA 1LKNA 1DZRA 1FT9A 1S0FA 2I07B 2XBO1 4Q8LA 1CAVA 1RVF2 2EXHA 1VBA2 2P17A 3HBZA 2XL9A 3VBOC 4P9IA 2VULA 2NM1A 1H2LA 4IEOA 3PJYA 5L36A 1RUOA 4XF4A 1QXJA 4GMP3 1LENA 4BYYA 3S0MA 1R091 2XVLA 3VBSB 4AF9A 1QJU2 3B01A 1HRI3 1RUC3 2Y0IA 2WIIB 1JN2P 1KQRA 1QF3A 3B94A 5FBZA 2XLGA 4IEYA 1GR3A 2XHKA 3HT1A 5A3MA 4NWVA 3JB8A 4WM8B 1SLIA 2F4PA 3H0OA 1MEC2 4BZ4A 2EA7A 4F8AA 3ZYPA 3USSA 3KM5A 1QJX1 2CWMA 3VBHB 3ZXEA 4YM3A 2H6BA 1HV1A 1AL21 1AUYA 3WXPA 5F6LB 1ZBA2 3M8LA 1OMIA 1YI7A 3HR9A 1YCIA 2C9AA 1PGSA 4QGLA 1C57A 4C0BA 5FTTC 4L9BA 1YHFA 1H2KA 3DUIA 3A4UA 3B5LB 4IEZA 3GNEA 2VH9A 4JDMA 4K40A 4K6BA 1VBB2 1SLAA 4AFAA 3AKQA 3C2UA 3LA7A 4K20A 4MX3A 5EFUA 2ZX2A 2O8QA 1COV2 3D5OA 3LA3A 4CDUA 4XQWA 4RR3C 1DQ5A 2XWBB 4ES8A 4MGKE 2VUJA 2JG9B 1HXS2 1SQ4A 2O0OA 3W58A 1PO22 2D6MA 1S0JA 2DWRA 5AFEA 5HBAA 4L11A 3RNSA 1BMV1 4JAAA 5B2GB 3KZ4C 5J09A 5JSRA 1MS1A 2LUWA 3M1HA 1YYNA 1WCDJ 5EJ3A 1RUF2 4R52A 2HWE1 3VKLA 1KS5A 3MIEA 1FNZA 4AGGA 3OYWB 1UMZA 3OGGA 5DDJ2 1O5LA 3ZFEA 1JYCA 1WLWA 1VR3A 5KHJA 2OUJA 3WW2A 4YZ1A 2WNVA 3G6JB 5BNPB 1NCRC 1RUH3 3GZTB 5E89A 4YW5A 1RB8G 2BQPA 3UL2A 4E27A 3KT4A 1HQLA 3VBRB 1V6LA 3OY8B 4Q0VA 3ZN6A 4AQ2A 1PGL2 4CTEA 4RFT0 1V9U1 1WD3A 1PK6A 4WZCA 2ZX4A 4FP2A 2SBAA 4LO4B 2X5IC 1UF2C 1W39A 2DV9A 1NA1B 1QJY3 1KFUL 4ORFA 2FBEA 3NAPA 2PELA 4L97A 4HT1T 3RPQA 1G9CA 2IXJA 5CBLA 1PNGA 3AJZA 2A6YA 2BTVC 2R042 4S2DA 1CAXA 2NN8A 4GALA 2HEYF 1FOD3 4R9DA 1ASJ2 1BZWA 4LBMA 1H1AA 4LBOA 3R6SA 2DU0A 2E63A 1MS4A 5BXXA 1LOCA 2ZGSA 4UXAA 3JD72 1TQ5A 5JI9A 1JW6A 4Y4YA 1A78A 2XUMA 1UIJA 3H7YA 4FT8A 1RHI3 2PQQA 4AFBA 1QXPA 1YXWA 4MH0E 4YVSC 3H3ZA 1OFNA 4OUSA 4OHWA 1XU1A 1C8M3 1SBDA 3V0BA 4XBQA 5CFDB 4I01A 4Y20A 5F5QA 4YZ4A 4GKXA 1AR63 5FQ0A 2JX9A 2A6XA 1HRV3 2PLV3 1EPZA 1MZ5A 2D7FA 5GLVA 3LB9A 4XMIA 3KT7A 1Q8SA 4JV4A 1V00A 2VVDA 1OLRA 2A70A 5D1IA 1QNWA 3ASIA 3OJBA 3W9AA 4WM7A 5EXOA 2XJTA 2ZGOA 3AKPA 2E7QA 4WM8C 4YVWB 5CA6A 4QPYA 5T3NA 1AR72 3ELNA 4I3GA 4ISQA 3IPVA 2XPJA 5GKAC 1LOGA 3SCHA 4NVPA 1R083 2RS33 4PBOA 1LCLA 5CFCB 3VBHC 4DRVA 4FAHA 1OI6A 3WG4A 4WBBA 3AZYA 5GM0A 4HN1A 4YW2A 4P9LA 2RR13 1EP0A 1LHUA 1QWRA 4LO8A 5H9SA 3SCGA 1AR81 1LOFC 3AMMA 3GZAA 3VHRA 3B3QE 4P9JA 5GLTA 2ZKLA 4FPGA 4HZFA 1BEV3 2EXIA 3T1LA 2R061 1A3KA 1S1AA 3BOPA 1U5IA 3EBRA 2WWSA 1SDWA 1EAH2 5JR7B 2IC1A 1RUI2 4LBNA 1BYHA 3AKSA 5I8SA 1PO13 2JG9C 4CDWB 4GMP1 1TMF2 1O5UA 1CAUA 4LBQA 4R9BA 1Q5OA 3RRDA 2WZR2 1HRI1 1RUC1 3VBFA 3B93A 3THPA 2C5DA 5H9PA 1O91A 2XB6C 1DGWA 1H9WA 3U07A 4HVRA 5T52A 5GZCA 5EZWA 1S2BA 4OI4A 1V6KA 2ENRA 4AVTA 1LHNA 2GDFA 2OZJA 3I54A 2ILMA 5BNPC 4LA2A 4Q4Y2 5CNAA 4OI2A 4Q8KA 1PHMA 3IWZA 2OA2A 2WT2A 4N53A 3SHRA 2QJVA 1JTZX 4AHWA 4SBVA 1D4M3 4CP2A 4XFAA 4HVQA 4MXWB 1GZWA 1WD4A 3WDTA 3VBRC 1QH6A 3ZMOA 4YG0A 1AXKA 1S0CA 3KSCA 2ZZJA 1NQDA 2B42B 2WQZC 2DCTA 5C4WA 4R4XA 4RHV2 1C3HA 3WUCA 4R4ZA 2WKKA 1J59A 1X50A 1FXZA 1PZ8A 3O5SA 1VAMA 2QNKA 1NXD1 2B7YA 3WR0A 1U5YA 3H1YA 1AYM2 1UU5A 3FE5A 5E16A 5C6CA 2G9FA 1ZX5A 5J36A 4P9WA 4HKLA 1VBC2 1LESA 5L7OA 2NPIA 3ZFGC 2I74A 2X8KA 4TWTA 2ZAHA 2WNUA 4WVZA 4O9EA 2WJSA 4YG3A 4RS5A 5GZGA 1RUNA 4PLMA 4AYUA 2R072 1WLDA 1W6OB 1Z0HA 1H8TB 1RTVA 2HWB3 2ZGNA 4KWJA 4X6RB 4AHYA 4GH4B 4LO7A 1R1A3 3AB0A 3IDCB 1DHKB 1RITA 2CWSA 1YIFA 4I09A 1W2UA 4LR4A 4LBJA 4P9GA 2GC0A 1EV12 2QDRA 5DXDA 5H9RA 1RUH1 5EYXA 4E9KA 2JG8B 5CVRA 4PQ9A 2P34A 2W0XA 1OD5A 3MGUA 1NE4A 3ILFA 4Q1PA 2MEV2 4DY3A 4IEWA 3SXWA 3SMHA 1RUJ3 5KC6A 2DF7A 3D82A 3RMYA 1Z7S2 1QJY1 3H1WA 2C0ZA 4Z92B 3KGLA 2DCJA 4XDQA 1HW5A 4CP1A 1EYBA 1RUD2 2VW0A 2ZMKA 4EROA 1KFXL 2VMHA 1B35A 4XJUA 4BA6A 1FOD1 2JE7A 1MS3A 5CFCC 2VW1A 2HWC3 4FOVA 3DPRA 1D2SA 3MEPA 4QPIB 1BK1A 2VOWA 2DUPA 1CD3G 4AVBA 2E7AA 3SNMA 3J8F3 4HL0A 4LTAA 3GBWA 2DVGA 4YZ5A 4E4SA 1RHI1 1D0GA 1NCQC 4LLFA 2JICA 1RGSA 4FAGA 4HFSA 1DF0A 3M3OA 3TN93 1C8M1 4RGAA 4LT5A 4UBHA 2TNFA 1AR61 2UY9A 1HRV1 2PLV1 3SH4A 4AFDA 3PLQA 4E2GA 1FMD2 3AYDA 4BMEA 2NMNA 2CAUA 4CDWC 3WCSA 2FMYA 5JVVA 1ZZ7A 5KC5A 2VMIA 3ECQA 5BV6A 2A6WA 1IQAA 5CG8A 1REEA 4M3CB 5GZDA 3ILRA 3VUOA 4KL1A 3NV3A 4Q4W2 1GLHA 1CJDA 5I91A 1Y9QA 4XEZA 3I7DA 5I0TA 1ENQA 4J6GA 4NHMA 2VNRA 4CEYB 1R1ZA 2VY0A 5GLUA 5FREA 5A32B 1POV0 1R081 2RS31 4IESA 2BW8A 1ZBE3 2YROA 3FX3A 1SLLA 1K5MA 1ND3A 3GHNA 4EN6B 4PDWB 1AL0G 1O4ZA 2XKOA 2RR11 3NWKA 2WFPA 1I1EA 3URFA 2QKDA 3N7JA 2NP0A 1URXA 5BUVA 2IXIA 2KXLA 4K7JA 2AGSA 1BEV1 1FNYA 4QQ2A 1RJ7A 2OZ6A 4K1YA 2D44A 1H9PA 5DZEA 1NQJA 3CNAA 3E6BA 4EN8B 5JMCA 1LGNA 5JIUA 3KT1A 2BNMA 1PO11 3AYEA 3LSEA 3SITA 1V70A 4EWEA 1VP6A 4YVSA 5HXVA 4W6WA 1CJPA 1ZNPA 2WL1A 4QM8A 3A0KA 4PLOA 3I4IA 3GBFA 5FLJA 4IETA 2XLFA 2D3SA 2E51A 4Y22A 1SLTA 3VKMA 1H8TC 1LB2A 3UV9A 5EWSA 4GH4C 2W39A 5ABJB 1DG6A 4AI1A 2ZTNA 3VBSA 2NZ9A 4W6YA 4N9IA 2PHTA 4Q29A 5KHGA 2JD4A 2VECA 2P3KA 3KQRA 4MGYE 1AYN3 1D4M1 3B02A 4CDXA 1V6IA 5CB7A 4XFFA 4HN0A 3TB0A 2JECA 3VGIA 5LK7B 1IS5A 2IXCA 2VQAA 2A3YA 1KDMA 1RMU3 3UKNA 4EWAA 5ACA2 1MS5A 2FZ2A 1JOJA 1QDCA 4XIKA 1AL22 5JZGB 2DYCA 2AH2A 2YY1A 4ATFA 3ZSLA 3LSDA 2Y38A 1WCSA 4JVAA 2CTVA 4LHKA 3WDWA 1LOFA 3TOJA 2BBVA 5JPNB 4MUVA 3H3UA 2WFF3 1W6MA 2RM22 3IKWA 4K21A 5IK7A 2O1QA 3OBTA 4WVWA 2DVBA 2RS52 4JGYA 2UU8A 4HPKA 2ZABA 3V64A 3ZPYA 1VBA3 1AX1A 3IM0A 4LBLA 4MYEA 4X8NA 3PVOA 5FMOS 3J9SA 4TYSA 5FO8B 3CJIC 3WZ1A 2JJ6A 2BPA2 1VJ2A 1PVXA 1AXYA 1CVNA 3X29B 2HWB1 2YGMA 1QJZA 1IZ3A 1ZZBA 5DUXA 2R16A 3LOBA 1R1A1 1QU0A 4B4PA 1ZM1A 2WNEA 1TE1B 4RSUA 1BXHA 2A73B 1WW4A 3AM2A 1GNHA 2WLQA 5C8CA 1NE6A 1KDKA 1S0BA 2QQPA 2XJSA 1LULA 4FCAA 2VQ0A 3OYWA 1MZEA 2ZGRA 4AVVA 1T6GC 5AC92 3IT8A 2WS92 3IBMA 4Q0SA 4YM1A 1MEC3 4R9AA 2JXAA 1UCXA 2A6VA 1RUJ1 1VAKA 2Q4SA 4COYA 3FLRA 3AMQA 3AMPA 2PHLA 4B4QA 1ZBA3 1XNDA 5BY5A 1BVVA 4YFZA 1BBT2 4GWMA 3LZZA 2B5HA 3OY8A 4CEYC 4FOYA 4GKYA 1LR5A 3WHTA 4S2FA 2HWC1 5T5LA 3D4KA 1NA1A 2B46X 1VBB3 3P3PA 3QH6A 4NOTA 4PDWC 4TSVA 3ZXFA 1X33A 2ZS6B 4AI2A 1OHFA 3J8F1 2ZOEB 1COV3 2WT1A 5JCTA 1LU1A 2V73A 2DURA 2Z79A 1NY71 4IV3B 5GLWA 1DGRA 4AHXA 1YI9A 2ET7A 5E88A 1HXS3 3O0XA 2VW2A 2G4IA 3TN91 2CV6A 3AMNA 2JENA 3RSJA 3AKTA 3HAGA 3UKVA 2GZWA 1TME3 4XZPA 3W59A 2TUNA 2CY6A 5DDJ3 5GJ6A 3ALQA 3FBMA 3N35A 4P9YA 5FPXA 2D40A 2C1FA 2ZX1A 2XGXA 4XETA 5CFDA 2KA3A 2HEWF 2XJQA 1DGRN 3N3HA 2IXKA 4QPGA 2ZAAA 2BVBA 2AYHA 5J37A 2CYFA 3FLTA 4CEWB 4KG0A 5ABJC 2BWAA 3VDDA 3CLPA 5I93A 4R9CA 1XYOA 3BALA 2B9UA 3RDIA 1H30A 2BVVA 4YM0A 1ZBE1 2E7TA 1AR93 2PAMA 4EWDA 2EF6A 3U4XA 3MPBA 4JGZC 2GNDA 1WLCA 2R043 4YVWA 1GQGA 1CGPA 4I0BA 3TWIA 1LECA 5C9AA 1PNFA 1ULFA 1ZA4A 1ASJ3 1VBD2 3MW3A 3S30A 4BCUA 3WY6A 5JZGC 4ONUA 2Q1MA 3L2HA 4CDQA 1I3HA 4DRRA 3JD73 3QACA 3VL8A 1L3JA 4RQPB 4M0NA 3FFQA 2LALA 5T55A 4KH9A 5JLVA 3HQXA 3M3IA 4K9SA 1S0EA 4IV1B 4Y5Z0 4C1XA 4E2SA 2PHRA 3PJQA 1F8VA 3E5XA 4FOWA 5JOWA 3DKWA 1LTEA 4FOQA 1REFA 4XF3A 5LRRA 4LO5B 3USUB 1UU6A 2HWD2 3AP7A 3Q9OA 3BOWA 4PIXA 1JXNA 1MVEA 1X36A 2CGNA 4AQTA 4IXLA 1OA3A 1RUC2 1ZZ9A 1LOBA 5BNNB 1X7NA 1ZRCA 1AYN1 3NV4A 2RHPA 4EJRA 1AR73 1ALYA 4D7SA 1DLLA 2WQ4A 5BNOA 1AHSA 2RS13 3VKFC 1RMU1 5A3LA 2K0GA 4W6XA 3RZZA 1LEMA 3MFCA 4QGNA 1FAYA 4AI8A 1RUE2 5C8WA 2DCKA 1BCXA 2D6KA 4HKOA 4AWDA 3MIGA 4MXWA 1BVP1 2WT0A 5FLHA 3M3EA 3BIWE 4D3WA 3D0SA 4FVVA 2WFF1 2KM2A 1DGLA 1LRHA 1PIV2 2UYAA 4FPFA 2CNAA 3ZFGB 5IK5A 4TZDA 4NR1A 1W6NA 4B7KA