1GNYA

Xylan-binding module cbm15
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
153
Chain Sequence
b'GNVVIEVDMANGWRGNASGSTSHSGITYSADGVTFAALGDGVGAVFDIARPTTLEDAVIAMVVNVSAEFKASEANLQIFAQLKEDWSKGEWDCLAGSSELTADTDLTLTCTIDEDDDKFNQTARDVQVGIQAKGTPAGTITIKSVTITLAQEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE 10C
molecule tags Carbohydrate-binding module
source organism Pseudomonas cellulosa
publication title Structure of a Family 15 Carbohydrate-Binding Module in Complex with Xylopentaose: Evidence that Xylan Binds in an Approximate Three-Fold Helical Conformation
pubmed doi rcsb
total genus 30
structure length 153
sequence length 153
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gnyA00
1XC6A 3I97A 1UY0A 2BBAA 3HJRA 4OMDA 4E8CA 4P02B 5IHRA 5DQ0A 4OZOA 4UI9L 1OH4A 1GUIA 3LPGA 1W8NA 1NAEA 2WO3A 5EJ1B 1CIYA 3SKJE 3T2OA 4A45A 4A44A 2J7MA 4D0QA 4LHSA 4D8MA 1XPWA 3I2FA 3T09A 4CU9A 3K46A 4XUPA 4XUNA 2VMDA 2VZTA 1UZ0A 1UXZA 2W95A 3NJXA 3C7FA 4UAPA 2XONA 2ZEZA 2ZEWA 1WKYA 4CU7A 5JXGA 2ZEYA 1SG3A 3C7EA 4PF1A 4LPLA 3WSOA 4HG6B 2J22A 3GDBA 4QX0A 1UY4A 4DXTA 2EIEA 2VZUA 5LA0A 3A23A 4BJ0A 2EIDA 1TVGA 2WZ8A 3J7HA 1UY1A 4E8DA 2PQSA 4XUTA 1KGYA 2J1UA 2WO2A 2J1EA 3OB8A 3K75B 2VZPA 3HNBM 5JXIA 4M4PA 2CDOA 1CZVA 2VCBA 2R7EB 5C70A 1OF4A 3MUY1 2J1TA 1JZ7A 1NKGA 1UY3A 1JZ3A 4W4ZA 1PX3A 1MPXA 4RYDA 4ZY9A 3MV01 3FL7A 4BDVB 3W5MA 3FN9A 4Z2AA 3ECQA 2VOTA 3WF1A 3VD3A 3OEAA 1OT5A 3CIHA 5EIYB 1GNYA 3FHQA 3F2ZA 2X10A 2DCJA 3A7QA 3GXUA 4IUGA 1W0NA 3ZM8A 2BERA 1JHJA 4XVHA 5G04L 1W9SA 4QDRA 5G05L 3C8XA 2VQTA 4UOJA 1L7QA 2QQLA 3ACIA 2BZDA 4M4RA 2YFZA 2E33A 4ZZ5A 5LA1A 2V5DA 2WAOA 1J84A 3K77A 3HEIA 2QBXA 2W3JA 1UYZA 4ZZ8A 5HPOA 3HPNA 1SHWB 2WYSA 2YC4A 3HNYM 5FUIA 3CZUA 1F4HA 4W50A 1GOHA 1EUUA 2VC9A 3LE0A 3JXSA 3THDA 3MUZ1 1UXXX 3BN6A 4TXWA 4GWJA 2YC2A 4CUAA 2VCCA 1JYWA 3K4DA 1UYYA 1JZ6A 3C7OA 3MV11 3T2QA 3T0BA 3WF3A 1BHGA 1I5PA 1NX9A 3A21A 4CU8A 1JU4A 1UY2A 3HOBA 2VMCA 1US3A 2Y6LA 3OG2A 5DMYA 1GOFA 2VMFA 2WZEA 2VJXA 3NJVA 1H6XA 2W94A 2JD9A 3WNKA 5CYYA 4P00B 3I2HA 1HN1A 3VDBA 2C4XA 2BGPA 3WF4A 3SEPA 1SDDB 3T0DA 4QAWA 1DYOA 2VO5A 2WDBA 4XURA 2QQNA 1UYXA 5JMOA 4CU6A 3CMGA 2W1WA 2YG0A 4KI5M 2E26A 3DYPA 1CZSA 2W47A 2VM9A 5J1XA 3I2KA 1LNSA 4ET7A 2W5FA 4YPJA 2VZ1A 5IJRA 2WN3A 1CZTA 4JKKA 3C7GA 4XZUG 3T08A 1W9WA 3FHAA 3SEEA 4DEQA 2VZVA 2KD7A 4JKMA 1RYYA 1WCQA 2V4VA 1ULPA 2RVAA 5LCWL 2VZ3A 1K12A 3ETPA 1JU3A 4MO3M 3UESA 2W46A 4AAXA 3LQCA 3E1F1 3C7HA 1JYNA 1JI6A 2WN2A 2JE8A 2WBKA 2J1SA 3K4AA 3GM8A 3ACGA 4JHZA 4OYUA 3WNPA 2XOMA 3IB3A 1EUTA 3I2GA 4QB6A 2JDAA 4A4AA 2QQJA 3WEZA 3T0AA 4QDSA 2RV9A 3W5NA 2J1VA 4OMCA 1O8SA 1IQDC 2Y8KA 3WQBA 1W9TA 1JZ4A 1F4AA 3MBWA 2WABA 1GQPA 2EIBA 2V72A 2W9XA 2E31A 1UMIA 2W87A 2ORXA 3LEIA 2YB7A 4XUOA 2Y6JA 4KMQA 3LPFA 2ORZA 5IFPA 2B9VA 4QPWA 4BK5A 1UX7A 4LQRA 3VDCA 1JZ8A 4DEVA 3WNOA 3IDAA 3LEGA 2VL4A 3NNGA 4A3ZA 5JXJA 2W91A 3DYOA 1XNTA 3I2IA 1GOGA 2E32A 1JZ5A 5HXMA 4QB1A 2WQ8A 2X09A 1US2A 4MOAA 1OF3A 2VMEA 2CDPA 5CZKA 3OGVA 4KWUA 4ARYA 2YFUA 1UMHA 2JKXA 4XUQA 2Y6HA 4JX0A 2Z4FA 4PQQA 5JR2A 4GZ9A 5LA2A 3NRUA 4P5YA 2Y6GA 2C9KA 2WAAA 1PX4A 4W8JA 4LKSA 1K3IA 1R64A 3MO4A 3WNLA 1L7RA 1JZ2A 4DXSA 1OD3A 1J83A 5DN2A 2ID4A 4CUCA 2QQKA 3A22A 2WUHA 2VZOA 2VCAA 3T2PA 2VTFA 2J1RA 2RJ2A 3EYPA 3UETA 1DLCA 5IYYA 1K42A 5DPNA 4MGSA 3WF0A 3ACFA 3THCA 1UWWA 2QQIA 4DXRA 3LEKA 2ZEXA 2Y6KA 4QX1A 3WNMA 4BK4A 2J1AA 3U37A 3WF2A 3ABZA 2W92A 2LS6A 2VZSA 4MADA 1O8PA 4QX3A 1O59A 3EB7A 4ZXEA 1KEXA 4AG4A 4L0PA 2VQUA 1H6YA 3CQOA 4CVUA 1PMJX 2VR4A 4CUBA 5C71A 3UNPA 3DYMA 5C7GA 2L9LA 1T2XA 2HLEA 3PUHA 4A6OA 4OUEA 4RN5A 3BGAA 2VZQA 3ACHA 2BGOA 3OBAA 3VD7A 4FI9A 3AC0A 3OEBA 3K4ZA 1GU3A 4DUWA 5JXHA 1YQ2A 4TTGA 2DCKA 2XQXA 5B4NA 1P8JA 2QQMA 5JUVA 3DECA 2LW8A 3I3DA 3P6BA 3VD5A 3CKHA 4ARXA 2C26A 4QB2A 1JYXA 1W8OA 3P1IA 3D3AA 5A1AA 3IAQA 3VDAA 2VZRA 4PT6A 4DUVA 4JKLA 5I0DA 4BXSV 3WNNA 1W99A 3CZJA 4MGQA 5IFTA 2DDUA 3IIIA 4QDQA 4DUXA 3VD4A 2X05A 2W1QA 2EICA 1TG7A 3CDZB 4A42A 3I3EA 3GGLA 1PMHX 5B4XA 3IAPA 5F7UA 3OGSA 3PUIA 3NQHA 2HYXA 3VD9A 3OGRA 2WO1A 4P08A 2W1UA 4A41A 4GWIA 3HNMA 2W1SA 5EJZB 1D7PM 4QX2A 2ZXQA 1CX1A 2QQOA 1NUKA 1GMMA 1DP0A 3I3BA 1ULOA 2Y64A 1K45A 1XNAA 2XHNA 2OKXA 2B4KA 3SKVA 3I2JA 1JYVA 3HN3A
chains in the Genus database with same CATH superfamily
2D5HA 3I54A 2GAUA 3MF9A 1U5XA 2BBAA 3CLPA 4QKNA 1QJU2 1BBT1 1XQNA 5JCTA 3LA3A 1LOGA 1RUF3 2ENRA 5IHRA 1AR61 1RXFA 3WQ0A 4RHV2 5L36A 3B93A 4E4SA 3R6SA 1RHI3 2R32A 4LIUA 3SKJE 1VE0A 1C8M1 3JD72 4A45A 2K2SA 4QU1A 2UY9A 1VAVA 1W05A 4BQ4A 1PGW1 2B45X 2PHDA 1VBD2 3VHRA 4FPOB 5J09A 2JDMA 2LRPA 2VMIA 5E8AA 3T09A 1BVVA 3WR0A 4IEVA 4E4ZA 3K46A 4XUPA 5FYIA 1SPPB 2HH9A 4AK3A 4NMIA 1UZ0A 1WWYA 3NV3A 3AJZA 1ZZ9A 3MLLA 5A1FA 5DUWA 1OQEA 4UAPA 5FZ9A 4IQPA 1POQA 2AR6A 2BYVE 1NCQC 3OPTA 4JVAA 3I49A 5SV5A 3E6BA 3TN92 2ZEWA 3WP6A 3RYRA 2XVGA 5FP8A 3PTRB 1X9TA 4QPGB 1HB2A 4K1YA 2X53S 2XBO1 5A1LA 3B00A 5FWJA 4JTOA 1N1YA 3GJAA 4GWNA 4LPLA 2IC1A 5C6CA 1QJU1 5FXXA 1SCSA 1ZRFA 2ZMLA 3VZOA 2GSYA 2JENA 3MIGA 5LA0A 3ZYRA 4HVQA 4BJ0A 2BFUS 2EIDA 1D4M2 1TMF1 5JWPA 4BU2A 4WM7B 3J7HA 3B3QE 5CFDA 2WNVC 3GBFA 1RHI1 4JGZA 2ZKLA 1AL21 1HXS2 5BNNC 5A7WA 3FC0A 3ZXLA 1KFUL 4LHKA 4Q4V3 4LBLA 4FTBA 3VKFC 5BPXA 3PMEA 1A8MA 5FFOC 3VBFC 2GN3A 1UIKA 5FPUA 4CDUB 1RINA 3ZFEA 1OVSA 2OX0A 4KH9A 1F5JA 2OUJA 4RFRB 2Z79A 4Q4X3 5FZMA 4B1MA 4TZDA 1IQAA 1UMZA 1NY71 4NHYA 5H9RA 3ZMNA 1SACA 1NKGA 1UY3A 1IPKA 1LB2A 5GZCA 5D2AA 2ZGTA 1V6NA 5DG1A 1MPXA 3E97A 1D4VB 3MF6A 4L11A 3MV01 2JJ6A 3WUCA 1YRZA 5A6XA 4RSUA 3ZKUA 3FN9A 4AGGA 5GLZA 3ECQA 4TN7A 2VOTA 1OMIA 2FMYA 3VD3A 3CIHA 4QXKA 5KXDA 3B69A 4CP9B 4NIHA 4L9BA 2DCJA 5JPNB 3FLTA 1AX0A 2A6WA 4L2NA 4MHUA 4P5HA 4GALA 2XH6A 2WO7A 1LKNA 2BERA 2ZOEB 1ZA7A 1CGPA 1VMJA 3KT7A 1JHJA 4Y26A 3ZPYA 1QIQA 3POJA 5LRSA 1VALA 4MSVA 1MVQA 4FOVA 2IFWA 1VBD1 5C4WA 3NL1A 3OPZA 4COWA 1ZZ7A 3DL3A 3WDUA 1ASJ3 3ACIA 2B42B 3GZUC 3CJIA 3VDDB 1TE1B 4M4RA 3MZHA 2V4AA 1YYNA 2D6OX 2WAOA 1KS5A 2ZA9A 3GZTB 3FFQA 3USUA 1BEV2 4A7ZA 2W0XA 2N7GA 5HPOA 2KM2A 3GF6A 5CNAA 1SHWB 3ILRA 1A8DA 3BOPA 4CCKA 3BPZA 1GZCA 1UW8A 2VC9A 2ZHNA 1MZ6A 3LE0A 2BWAA 1MQTC 1IPJA 4MLOA 1NYWA 5FOJB 1UXXX 4XW3A 5A33A 1XJAA 3BN6A 2YC2A 2ZGQA 1U5ZA 4LBQD 4QPIC 4XJ9A 5FZ8A 3MIBA 2BWCA 1DQ4A 2ZGOA 3WZ1A 1ENXA 5LB6A 5JPMB 1W8FA 2FDKA 4MGIE 1ULGA 3C7OA 1OBNA 1H8TC 3ELNA 3T2QA 4E2GA 4RHV3 3W58A 3WF3A 1JN2P 1I5PA 1Y9QA 2D3SA 3ENRA 4FFHA 2BNNA 1NX9A 1IGOA 1X36A 3GALA 4CU8A 2WFPA 2VMCA 4WVZA 4IL7A 5JZGB 2Y6LA 3Q9OA 3H9AA 4Y1YA 3W9AA 5ABJB 1HKDA 5FAXA 4CPBD 4CRQA 4I02A 4OLLA 3WP5A 1DG6A 4LHNA 3NJVA 3N7JA 1F15A 5FZGA 4P9LA 5FZ1A 3V0AA 4Q29A 3SITA 2MEV3 3QBQA 1NLQA 2JD9A 3B01A 2DUOA 2OT7A 4L97A 4N90A 1BCXA 2ZX0A 1FOD2 1EV12 1YWKA 2HWE1 3I2HA 1ZBE3 4IGPA 2R043 2BGPA 2C9AA 2WJSA 2JKBA 4AFCA 3B9CA 2GC3A 1AF9A 2JIGA 5HBAA 4URAA 4JCKA 5J48A 2VY0A 3IDEA 2Q4SA 5KHHA 1TME2 3J8F3 1YO8A 5C4WC 1KITA 1UCXA 4CU6A 1R092 3SH3A 3LB9A 2GMMA 4FAHA 2YG0A 2DVDA 2JX9A 2JDZA 2K46A 4DO0A 2ARCA 2W47A 2XVKA 4IV1B 1Z7S2 5F5AA 2RG4A 4QPIB 1LNSA 2I74A 4AOCA 3O1SA 2XJRA 3ZYGA 3JUUA 4IETA 4AI3A 1GR3A 2UYBA 3VBRC 2R042 4YM1A 1UZYA 4LO4B 4XMAA 3ASIA 2QQVA 3EHKA 4IEXA 3VBHC 1OKOA 4C1XA 1ULDA 3OD0A 1ZYBA 4XZUG 5A6QA 3PJYA 2RDQA 3WW1A 2XR4A 3KV4A 4HANA 1PM4A 3IPVA 5DAWA 1HB3A 4X6RB 1H9WA 2YY1A 1OA2A 1W2NA 2JDHA 2YC0A 4IEQA 2KD7A 2WA3A 3SNMA 1RYYA 1WCQA 4OHYA 1N3QA 3JQXA 4FPLA 5LCWL 2QZ3A 4LOSA 2WQZC 1JU3A 1H2NA 2A75A 2BVBA 3RJ2X 2W46A 2ZZQA 5FY8A 4NPMA 2LROA 3MYXA 2XDVA 1RUJ1 3LQCA 4AFBA 4IV3A 1WBLA 3CU7A 3E1F1 3C7HA 4Q8LA 4XFIA 5I91A 1JI6A 1JYNA 4DRRA 3VKNA 2FBEA 2WBKA 2J1SA 4AXOA 2E7AA 4FQZA 4HN0A 2ARXA 3H1MA 1DF0A 2C5DA 3L2YA 4YFWA 4YRDA 4CEWA 3ZFEB 1VR3A 1EUTA 1S2BA 4WM7C 5IVVA 3AYDA 2YBPA 3I2GA 3M70A 4QB6A 2JDAA 2O8OA 4A4AA 2JICA 5JI7A 3ZFGB 4CCJA 1AYM2 1DGWA 3HQUA 4OMCA 2P37A 2RM22 5T5LA 1UD1A 1IQDC 2QCSB 3AZYA 2FQPA 4GWMA 3WW2A 4CDQA 3TWIA 2F4PA 2VE1A 3MBWA 4RR3C 4TYSA 1REFA 5FXWA 4OHXA 5DABA 2QQUA 5DAPA 4YYOA 3HBZA 5K9YA 4GMP0 2EIBA 1S0EA 1XXNA 4BQXA 3HT2A 4YGDA 3U4SA 3ORJA 1DDLA 1IKPA 1H8VA 4R52A 1NCRA 5SV8A 2B9VA 2WS93 1PO21 4QPWA 5EQUA 5BNPB 4H7LA 4BK5A 1CAUA 3N7LA 4XJAA 3VDCA 3MHZA 5ACA1 1W03A 2NMOA 4J6GA 5I8SA 4DEVA 3GNEA 1Z0HA 1DYPA 3KCYA 4KL1A 5IK4A 3IDAA 3PVNA 5FY4A 1JYIA 2WNVB 3LIHA 5GZEA 2VL4A 1HRI3 5T5JA 3HIFA 1RUJ3 4A3ZA 5C3PA 3J9SA 5JXJA 1OOPB 1JOBA 5HXMA 1CPNA 3N36A 3NO8A 2VVDA 2D6LX 2VXRA 3O14A 2ZHLA 4BMEA 4FAGA 1RUG2 1RMU2 4QWNA 4AQSA 5LK5A 4ES8A 4RFT0 1IS6A 3T4HB 3URFA 1GICA 2FCVA 1GV9A 4XETA 5JOXA 4WZFA 4D94A 1NY72 5F37A 5FZBA 1QJY2 2VECA 2A6YA 4IW3A 4W6WA 1I5ZA 1JYTA 2JKXA 2Y26A 3I2OA 3JCIA 5FO8B 4PBPA 2XJVA 2Y6HA 1MZ5A 4QQ2A 4PQQA 5JR2A 4CPBA 4GH4C 1E5RA 5C9AC 3FHIB 3V0AB 3RNSA 1SBFA 3MDPA 4JDMA 5FBJA 5LA2A 3I59A 3FE5A 2D43A 5FYBA 1GFF2 1UL9A 3M7AA 4AGVA 5BNOC 4N53A 4UBGA 4W65A 5GLVA 3WDWA 5FV3A 1PVC2 2R16A 1Q3EA 2WWJA 3FJSA 1WW4A 2AEZA 4LKSA 4YZ4A 3MO4A 5FCCA 4AI8A 3I2DA 1L7RA 4Q4V1 5C3OA 5FYSA 1X9PA 2BQPA 3DPRC 2AZ5A 3JD73 4X8PA 2WA4A 4H14A 4CEYC 2G9GA 2WNUB 5FP4A 5EJ3A 3ZYBA 4TLFA 5AC92 2HWB3 4NRQA 3T2PA 2VCAA 5FJHA 1VRBA 2PELA 2VTFA 4K40A 5LASA 3N4MA 1C4RA 5FOBB 4E2SA 1KJLA 4ATFA 2A70A 1CAVA 3OY8B 3CJXA 2FD8A 3ZYHA 1K42A 4FOWA 1YNAA 1B35A 4AEKA 3UYJA 4MGSA 5BV6A 5KC6A 1O3RA 1SBEA 1YIFA 3WVJA 4J25A 1UWWA 1C57A 3ILNA 4QMAA 4RGKA 4WM8A 1KQRA 5A7WB 1NCRC 4XFCA 2XVLA 3WNMA 1C1LA 2HWC2 1OHFA 2RM21 2W92A 3ABZA 4KU8A 5GKAC 3WF2A 5HCHA 4MADA 3AKSA 1DGWX 1FPN3 4BB3A 1CAVB 5DDJ3 3EB7A 1W6NB 1AR72 2ERFA 1HRV2 1SDWA 1B35B 2H0BA 4ZXEA 1RUE2 3AMHA 2KR2A 2I07B 2RDNA 4CVUA 3I8TA 4CUBA 4NHKA 5DG2A 1BJQA 1QEXA 5C7GA 2HEYF 4A6OA 1EY2A 1NOVA 1MZEA 3OBTA 4XEZA 1ND2B 3G6JB 4QM8A 1V9U3 3VLBB 4NROA 1VBE1 1HDKA 2D3RA 5DZEA 5FO9B 2BGOA 4OUMA 1IG3A 3V0BA 1LHOA 3M8LA 4Q8KA 3SC7X 2HWF3 2RS11 4JHTA 1GQHA 1YQ2A 5T5OA 5JXHA 3BI3A 4TTGA 1NCQA 2DCKA 1P8JA 4QKFA 2DTWA 5A33B 3I3DA 5JZGC 2VTXA 3VD5A 3KF5A 3OCPA 4PCRA 1ND3A 3ATGA 3WHTA 4FT8A 2PAEA 3LCPA 2DU0A 1W8OA 3P1IA 1NLSA 2GC0A 2ZGNA 3D3AA 3U1XA 1Y3TA 1Q8OA 3FUQA 5A3MA 4M3CF 1BK1A 1UPIA 2UU8A 1CAXA 2VZRA 5LY1A 3HR9A 3MEPA 4BQWA 2B5HA 1OXCA 4BXSV 1VBB3 2VXJA 4AL9A 3VBUA 3WNNA 3B02A 2Z42A 4CE8A 3ZYFA 5IFTA 3J26N 3RZHA 4Y5TA 4MGZE 4CYDA 1NT0A 4JQTA 3KWVA 2ZMKA 1F9KA 4NIIA 3WCSA 1JH5A 4AF9A 4ATEA 4CP2A 2EICA 4Q0UA 1TG7A 1VB2A 5FP7A 3OJBA 1PGL1 4ZPIA 3DUIA 3LWCA 2VOKA 1QXRA 2J42A 4IV1C 5F7UA 3OGSA 2H6CA 1VBB2 2HWD1 3PU3A 4WVMA 1LESA 2D44A 1WW6A 3QACA 4COYA 4DB5A 2SBAA 4GJZA 2EALA 5K0UC 3PU8A 3HNMA 2QE3A 4YVWC 1KXGA 3WUDA 2W1SA 5EP9A 2R063 1R1A2 4QX2A 4OI1A 4ZKTB 4Q4Y2 2WT1A 2ZXQA 3H7YA 2MEV2 2P17A 5AVAA 1GMMA 1DP0A 4MXWA 2E63A 1VRH3 1ULFA 1FX5A 1QOSA 1EV13 3VZKA 4DIQA 3O1TA 4WVMB 3RZLA 4DINB 1O3TA 1DLLA 3MIDA 5FREA 3SKVA 1BQPA 5K7PA 2DUQA 2EAAA 4INDA 4Y22A 2EVXA 2CAVA 5D1IA 1W9YA 1I6XA 1DYKA 2P6CA 3AK0A 4JTNA 3HJRA 4KBZA 5IVYA 4LO8A 4FPKA 2GC1A 4CDUA 4CCNA 4XYXA 5CG8A 5DAQA 2ZZJA 1N1TA 2LUWA 4EN6B 2PLV3 4AAPA 5L73A 4UI9L 3R4UA 1C5HA 1GUIA 1OH4A 1Q56A 1V6IA 1I9RA 1S0CA 2JG9B 3T30A 1APNA 4NUBA 3ZFFC 3IIAA 1LTEA 5IVFA 3RMYA 4A44A 1FYUA 2J7MA 3KVAA 1SFPA 2OW4A 4ASKA 2XQRA 1PIV3 1AJKA 1RXGA 1S2EA 2AYHA 3IDCB 3SISA 3PUSA 3ZXGA 4CU9A 2VZTA 3O7OA 4B1LA 2JG9A 1XB9A 3MLJA 2YYOA 2QDNA 4YM2A 1G7YA 2DUPA 1G9CA 5F8PA 1LULA 3ZIXA 5FZ7A 2P3IA 1K5MB 2R061 1F2NA 4LKEA 3LZZA 5FZFA 4F7ZA 1URXA 4QHBA 3J7LA 5B2GB 4IE6A 3KSCA 5CEHA 1UOFA 3F95A 1LGBA 1NG0A 1RUF2 1NE4A 2DTYA 2JDKA 1BBT2 2ZACA 2ZCWA 3S6PA 4UW5A 4A6SA 5LK7B 4AWDA 2HEWF 2R1BA 4IV1A 4A7YA 3OBZA 3ZPOA 3C7EA 4PF1A 3VHOA 1QNYA 2RS33 1UZWA 3IDBB 2YGLA 1FV3A 1WZXA 1KS4A 3QCWA 4K3UA 1QJX3 4PHZA 4QKDA 5BY5A 2QKDA 4Q4W1 1TNRA 3D82A 4Y3OA 1AJOA 3NKGA 1JUIA 1JODA 2WZR3 1HIXA 3K3NA 3OYWB 1L7LA 2ZHKA 5DAXA 1W8ZA 1AR63 2D3PA 4DY3A 5KHJA 3JB4C 1UU6A 1R091 1PVC3 3DXTA 4KWLA 3ZDSA 4BISA 2VTXJ 5J36A 3NAPA 3PL0A 3PIJA 4BLIA 3POFA 1C28A 3OB8A 3KCXA 5A7OA 2VMGA 1NCQB 2VZPA 5FPVA 1ULEA 3LSDA 4Y1ZA 5JIAA 2GN7A 4LBJA 4EQVA 3MIEA 1AR92 2QUOA 3MIFA 3ZYPA 4M0NA 3KB5A 2WFF1 1FMD3 1OURA 4YVSA 1UU4A 1YC61 3RYPA 1RUNA 1FT9A 2D7FA 5ABJC 4UXAA 4YG3A 5A7NA 2GMEA 2J1TA 1JS9A 4LLOA 1XYOA 5JVVA 4YZ5A 2PAMA 5FUNA 1IS3A 3AFGA 4CCEA 1PX3A 1JYCA 1ZNPA 4LBOA 2X29A 3DPRB 4LO6B 4META 1YLLA 3ZN4A 4CCMA 5CFCB 1QF3A 3FL7A 3WDXA 1QQP1 5JIUA 3RWKX 1HRV3 1ASJ2 5J37A 3T4VA 3OEAA 4XACA 2RMU1 1IS4A 1QU0A 1U5YA 3A7QA 2KA3A 4AHZA 2OA2A 4IUGA 4AHWA 1XYNA 3ZM8A 3DGTA 5BNNB 1QQP2 2YMZA 4XVHA 2A7AA 2ZGLA 3PJQA 5CFDB 5F3CA 3KD4A 1NA1B 5IK5A 1AL23 4JGZB 5A3TA 2VQTA 4UOJA 1L7QA 5FMDA 5TSWA 4OHZA 5KHIA 2QQLA 4YW4A 1IZ3A 4Q0VA 2DCZA 4ZZ5A 2AGSA 2V5DA 4PLMA 5A7PA 3X29B 1OA3A 2CV6A 1MS4A 2QQPA 1Q8PA 4RS5C 2W3JA 2IXCA 1SQ4A 5CIRA 2FCUA 2BNOA 4ZZ8A 5AFBA 3HPNA 4XFBA 2YC4A 2GALA 4CDWB 2YZ4A 1F4HA 5FZEA 1GOHA 1NQJA 3BYWA 1RUH3 3OGJA 3MUZ1 5FQ0B 1HXS3 4N43B 4CCDA 4CEWC 4CUAA 3S57A 3LOIA 5D21A 1HRV1 1UX6A 5LEKA 2BP6A 1JYWA 2DBIA 4WZCA 5FMCA 3OPWA 1UYYA 4GKXA 2YU2A 4QHZA 4XABA 3TNQA 4BWOA 1B09A 4FTEA 4R8HA 3RS6A 5GLTA 3TEXA 3MW2A 3O0WA 3RWNA 2XLGA 1NQDA 2VOVA 2ZAAA 4UWDA 5FJKA 1ZA4A 3PIGA 3JZVA 3POBA 4HSLA 5A3NA 4ZHNA 3AMNA 3D0SA 4Z82A 3R0RA 2RR13 1US3A 2CWSA 3R05A 1RUE3 1YI7A 3OG2A 5DMYA 2QVSB 1ZBE1 5K4LA 2GZWA 4LLFA 1BVP1 3WP4A 1HQNA 4SLIA 2JE7A 5A6ZA 2W94A 4B4RA 1RC6A 4BPZA 5FK7A 5KXBA 4Z92B 4I2OA 4YGEA 2WZPP 4LBMA 2V09A 3A4UA 1S2KA 4P00B 2VPVA 2ZBJA 3B94A 1W2AX 4XOGA 5EFUA 5EYYA 5FWEA 3RVHA 2C4XA 3USUB 2WS92 1WLWA 4NAMA 4H55A 1CAXB 3WF4A 1RVF3 2FDGA 3SEPA 2HWF1 1VBB1 2RS13 3T0DA 2D6PA 5K0UB 4QAWA 2VVFA 2H6BA 3RI8A 2PA7A 4IEUA 4A3XA 2ES3A 2E26A 3DYPA 4PIYA 3JQWA 4NRMA 3QOPA 1W6NA 1NLRA 1Y4WA 2VM9A 4DFSA 4MZUA 4QQLA 1RTVA 1M4WA 3I2KA 3IKWA 1JTZX 2WS91 2HBUA 5F5CA 2XJQA 3DN7A 5FZ4A 2VOXA 5BNPA 4NWWA 4YPJA 4C91A 4XTPA 3NNJA 1XE0A 3L9JT 2VZ1A 2WN3A 4U36A 5BNQA 5L7OC 1CZTA 2JB8A 3ZXKA 2HWD3 3C7GA 1I3HA 3BODA 2IZWA 2V5YA 3PURA 3L2HA 1LAJA 1GZWA 1KJRA 3FHAA 4FPJA 3SEEA 2QJVA 4XDPA 4X8NA 5F6LB 1LOEA 2Q8OA 4AFAA 1K5MC 1V00A 4Q5OA 5IK8A 5LATA 4XCBA 2VZVA 5D8AB 5APAA 1S1AA 4JKMA 4CSWA 3BTYA 3E5XA 2R072 5FLHA 3ZSEA 1K12A 1H1IA 3ETPA 2QDRA 4LOTA 4XF9A 2PMWB 1AYN2 1G6NA 5BNOB 2HWE3 4CUGA 4AAXA 2RDSA 1COV3 2XHKA 3ZFGA 2RE9A 1UKGA 4DZGA 1HJFA 1Q43A 1YFUA 2D40A 2WN2A 3P3PA 3Q8EA 2ZHMA 1QMJA 4LBKA 1VBE2 1OLMA 1QJX2 2R6QA 3M4FA 3GM8A 5EYXA 4OYUA 1CN1A 2Y0IA 4JHZA 3VBHA 2FDIA 3VBRB 2GNBA 2WRAA 2DF7A 2JE9A 1LOFC 2V73A 3CL1A 2ZAHA 2WZR2 3AZZA 1AHSA 3PVEA 3RZGA 2R0FA 3POEA 3ROUA 4N53B 3NWKA 1PZ9A 2RV9A 1OLQA 2VAUA 5J98B 3W5NA 2J1VA 4QGMA 4TSVA 3KQ4B 1E57A 2ZS6B 2WLQA 2Y8KA 2F17A 2IUWA 2B39A 4LUMA 1YJKA 1F4AA 3LFIA 3AZXA 4YW2A 3ZIWA 2WC2A 1HRI2 2XWBB 4Q0PA 1DQ0A 5BXXA 3UKNA 1ODNA 2ARAA 4BLJA 1TEIA 4C0BA 2MPFA 4LKDA 3CJIC 4XC9A 4OUSA 3UGHA 2W9XA 2E31A 3V64A 4AI2A 2W87A 3LEIA 1W2OA 3ETQA 1RUG1 2GP3A 2RHPA 2RS53 4KMQA 3ZX7A 2ORZA 4ZS2A 1CQ9A 4I30A 4RQPC 3V56A 4JGYA 5T5PA 3WNOA 3NMBA 1ZBA2 4N43A 1HV1A 3LF7A 3LEGA 5DDJ1 1CX4A 2W91A 2ETEA 3DYOA 4LEJA 2Q8CA 1XYPA 1QHDA 1GOGA 3I2IA 5IWFA 1JZ5A 4JZRA 3AP6A 4MHRA 4CDQC 2X09A 5KBFA 3LA7A 5A7SA 1RUD1 3IBMA 2IVJA 3VDDC 2IFRA 1XE7A 4QX7A 4Q0SA 1FAYA 2RS52 2WZR1 2RJLA 2ZGUA 2R062 3OGVA 1UPSA 4KWUA 4HXCA 2R0HA 4ARYA 3TN91 5DUVA 4NRPA 2P5BA 1O4ZA 3IPVB 3HWJA 1REDA 3N7KA 4GA9A 5FK8A 1O5LA 1LOBA 2WNEA 4C8DA 4YM3A 1PO22 4BA6A 4D69A 2PHUA 3GJBA 5C8CB 5HCAA 2BFUL 2WFF3 3AKRA 3QH6A 3RZKA 2JD4A 3AXEA 3NRUA 4GAZA 5KHKA 2HWB1 1OVPA 1ND3B 1TQ5A 2I2SA 3H8OA 4W8JA 1YEWA 1A6CA 5FY5A 3VBOC 4UBHA 3K51A 3M1HA 1JZ2A 1RHI2 2VBBA 3KV9A 2BVVA 1OD3A 4N9HA 4DXSA 1J83A 1YIPA 2ID4A 2VG9A 4CUCA 3A22A 1AXYA 1OOPC 2DWRA 4BH9A 1AX1A 2RJ2A 3UETA 5A6YA 2DVGA 3LD8A 1QXPA 4GB31 1GLHA 5FBZA 1RUD3 4FFFA 5CISA 5ISLA 3HD8B 1TME1 2IXHA 3ACFA 5FTTC 3THCA 5E6HA 2QQIA 2ZKNA 1Z7S3 3H1YA 2NLRA 1AX2A 3SH5A 2IWGB 4BK4A 3EBRA 3USSA 2PFWA 3TN93 3HT1A 3WXPA 3O1RA 1ND2A 4AZZA 4QX3A 4MGKE 3KQRA 5FY0A 5FZIA 4W6XA 5GM0A 1ALYA 4CDWC 4XFFA 1GZ9A 4FPHA 2WL1A 2VQUA 1O4YA 2RS31 3CQOA 4OI2A 1MR5A 2HBTA 2VR4A 1RUD2 1T6BX 1R082 2R49A 3DYMA 4XPVA 3UV9A 3UNPA 5A32A 1T2XA 3K2OA 4FXGB 1VRH1 4RN5A 4XJWA 2W08A 2WNUC 1Z78A 2FHRA 4KQ7A 2PYTA 4EN7B 3O1MA 1GQGA 3ACHA 3FBMA 3I4IA 2FDFA 4FBFA 4FPEA 4IE0A 4MV2A 4CDXB 1W6OB 1ZZBA 2WQ4A 4WVVA 3RGBA 2OIIA 3NAPB 2W68A 1RUH1 5IAVA 1COV2 5F3GA 2HWC3 1G8WA 4UW4A 1W6PB 2XQXA 5B4NA 1FOD3 4RGAA 2BBVA 5FQ0A 1DQ6A 4BOWA 3ME2A 5E89A 4MG2A 4LO7A 4OI4A 3CKHA 4ARXA 2YUEA 4CDXA 3RPQA 4DQAA 3SCFA 1RUC2 4IEOA 5JDBA 4HONA 4XAEA 5LW9A 1QNWA 1RUI2 2XWJB 3ON7A 4BQYA 1PGSA 4O7XA 1WCSA 4JKLA 5I0DA 4AHXA 4Z8BA 4HSJA 4AFMA 1UAIA 4IESA 1QDOA 3DPRA 4YGBA 4XFHA 5I0RA 4AI9A 4AVAA 3KHBA 3W20A 2HKXA 4ZU4A 2RS32 4QDQA 4AQ6A 2UY8A 1CVNA 4UFJA 4DUXA 2YROA 3VD4A 2OYZA 4F3JA 2DURA 4A42A 3I3EA 4PLNA 3MFCA 3IMNA 2JDPA 4IE5A 4AYUA 3E5UA 4TLGA 5KHGA 3OUJA 3VZMA 1DZQA 1AR62 3E6DA 2HYXA 2RR12 4HVRA 3VD9A 3OGRA 1WUVA 4JDOA 4P08A 2W1UA 1STMA 1Y9MA 2BNMA 3M3EA 3ZXFA 4GWIA 1WCKA 3AMQA 2D93A 5F3IA 5EHDA 4XDOA 1AXKA 2CGNA 3ZYIB 4YW7A 2VH9A 4IEYA 4FO9A 3ZXJA 1CX1A 3N35A 2NQYA 2QQOA 1U0AA 1J58A 1TNFA 3KF3A 4NVPA 4URTA 3FUOA 1FATA 4QHOA 5D8AC 5IK7A 2B4KA 4Y4YA 2G1MA 3M3OA 4PIXA 3THTA 1ZZ8A 1LGCA 1OI6A 1VP6A 4HKWA 1GWKA 1IKQA 3ZSKA 1XC6A 3I97A 1QDCA 1UY0A 5CVRA 3NV4A 4FOYA 5DAVA 5C8CA 4OMDA 3U4XA 3N9MA 1LHWA 4P02B 3VZLA 5A3PA 2VVEA 5JMCA 1IG0A 1LECA 5I0SA 1PIV1 1PMIA 1RITA 4NE9A 5FZOB 1UKRA 2WT0A 5H9QA 3E5QA 1SFYA 2GNDA 2VQAA 2ADEA 1W8UA 2EXJA 2WLPA 3H3UA 2NM1A 1W8NA 1OQDA 2JDNA 1NAEA 2WO3A 4GJYA 5EJ1B 2ZMNA 3H0OA 1OC1A 4CP9A 4D0QA 3KVBA 2IVIB 4D8MA 5CADA 4HL0A 1SLTA 1UU5A 1XPWA 4CA9A 3JBG2 1Y9GA 3ZSJA 1KRIA 4H7MA 2MEV1 1OQ1A 1QQP3 2B8MA 5E1RA 1M06G 1UXZA 2TNFA 2W95A 1MEC2 4GKYA 3KLSA 3C7FA 1H4HA 4KWKA 3RZMA 1AR82 4WVWA 1BXHA 4CTEA 1CAWA 4IEPA 2XONA 1VBA3 4K20A 4Q4V2 4AQTA 4KNCA 5F9TA 1CESA 2ZEZA 3LKJA 4FQ4A 1WKYA 4QPGC 1V0AA 4CU7A 3UK9A 5C8WA 1RUC1 4XQ4A 4NIAA 5JXGA 3RG0A 3VN4A 4ZU5A 4HK8A 1HQLA 4P9WA 4UW3A 3UKTA 2ZEYA 1SG3A 1DFQA 1D4M1 1TMF2 3GZEA 1RUI1 2DVBA 1NA1A 2Q1ZB 3MI8A 1YUDA 4PI2A 4BQ5A 4QX0A 1UY4A 1WA4A 2EIEA 2OPKA 2ZJCA 1W0OA 4DXTA 5K0UA 1XE8A 1EAH2 3NV2A 4CZSA 3A23A 4AHYA 1YCIA 4LJHA 2JG9C 2DVFA 3NJZA 2OXBA 4LTAA 5FXZA 3FBYA 4C0HA 2XUEA 4YVSB 2PQSA 1KGYA 2XXZA 1UOGA 3H3ZA 3RI9A 3VBFB 1PGL2 1Z7S1 2WO2A 2J1EA 3RMXA 1NXMA 2EA7A 4D7TA 2QQWA 1W6PA 3HNBM 4V1PA 3MLKA 3M3QA 1Q8SA 3VBHB 1AVBA 3D6EA 4EROA 2XLFA 3QLQA 3Q8AA 4ZU7A 3S7EA 1GP6A 2AEYA 1O3QA 4K7JA 3THPA 1R1A1 1WBFA 3Q8BA 5F1RA 4MXVA 5C70A 1OF4A 4IGOA 2AC1A 4LE4A 4Y5Z0 1JZ7A 3NV1A 1JZ3A 3N9OA 2Z2SB 2ATFA 5A32B 1CIWA 1X7NA 4PDWC 2HEVF 2QZ2A 3B5LB 2PN5A 3OUIA 2ZX3A 4BDVB 1D0GA 5FYTA 4CXWA 4ZONA 5CA6A 3SXWA 1UOBA 5KXCA 4EWDA 5C33A 5FRAA 1HN0A 3PUQA 3WF1A 1MZFA 1IS5A 2VW0A 2NP0A 4BQ2A 5IT6A 3TRSB 1S0GA 1UZZA 2CL2A 3U07A 3FHQA 3F2ZA 1AR81 2D6NA 3S7IA 3VBRA 1WMEA 1BK0A 5GLWA 1HV0A 1W8WA 1AR93 3GXUA 4O65A 4S2DA 1MS5A 1W0NA 4QPGA 1CJPA 3OD4A 5FLJA 4XF3A 2QFEA 4I09A 5G04L 1PK6A 2ZABA 1SZBA 2P3KA 2W39A 1K5MA 4QDRA 5G05L 1CAUB 1PO23 5GZGA 1RVF1 1VAMA 2VW2A 2QNKA 5IW0A 2BZDA 2X8KA 4OHVA 4NN0A 2VD7A 2X5IC 3D8CA 2YFZA 3ZMOA 5LY2A 2EIGA 4MYEA 1J84A 3K77A 4HETA 4XILA 3WX5A 1UIJA 4E2QA 1HRI1 4COVA 4H3WA 5AFEA 2WYSA 1YJLA 2JB4A 4QT6A 1O4TA 2UWBA 3CZUA 1PVC1 1QJU3 1OPMA 3THDA 3NAPC 4YLZA 4OFGA 3T1LA 4LO5B 2ZGKA 4JAAA 2G9FA 5ERLA 5K8SA 3RYKA 2H0VA 2WNOA 4TXWA 4GWJA 4UFIA 4WM7A 3BTAA 1MS3A 4QD2A 3O12A 1GWLA 1ZBA1 5I93A 4OVEA 2EF6A 3P3NA 5I0TA 1H8TB 2EXKA 4DNYA 2VNRA 5AC91 3TEWA 3OUHA 4Q4W2 1JZ6A 3JU9A 3ITQA 4FCAA 4E9KA 1VPHA 3NKTA 3JB8A 5FYUA 2VUAA 1G9FA 4B7EA 1FMD2 2FDJA 4KGQA 1BHGA 1S0BA 2Z69A 2WYFA 4Y5SA 5FZ6A 3SQOA 4RS5A 4AEJA 1KD7A 3HMYA 3HOBA 4OI0A 3DCQA 4JGZC 3PNAA 4LBQB 2W52A 5BNNA 4Q4X1 2VGDA 3WG3A 2ZGSA 4ES9A 2DU1A 4GH4A 2WZEA 4Y1XA 1W04A 2VJXA 1R083 2O14A 2WKKA 4Y20A 5FYCA 2XBO2 4AVBA 3AYEA 2RM23 4AVVA 4HPKB 4RS5B 4YW1A 2ILMA 4S2FA 1VBA2 5FMBA 4ZS3A 5CYYA 1PNGA 2EXIA 2WFF2 1HN1A 2Q1FA 5L19A 3KT1A 5T55A 4Q4Y3 5BUVA 4GQ7A 3RZJA 4LK6A 1W3VA 5ACA3 3I7DA 5C4WB 2DCYA 1GBGA 4NO4A 3VKLA 1SDDB 2YBSA 1F8VA 1DYOA 1ENQA 2WDBA 3VBUB 3H8XA 3H1WA 1D2QA 1BYHA 1UYXA 1V9U1 4R9DA 5FZKA 4D3WA 5JMOA 3CMGA 3MW3A 1W3XA 1W2TA 2JWPA 2XBO3 3ZO0B 2X5IA 4AI1A 2O8QA 3GZAA 1EAH3 4L92A 4Z07A 1GZWB 3EMRA 3LDKA 1WA6X 3OTFA 4GMP1 2PHTA 4OULA 2NYYA 3HAGA 1N1VA 1J3PA 1WW7A 1H2KA 3B7MA 4CDQB 5IVBA 4K1ZA 2R071 5FP9A 4UFLA 1DQ1A 4KG8A 2RMU2 1RIRA 2XG3A 5T3NA 4AEDC 1HJGA 1CD3G 1OD5A 4WV8A 5IJRA 2BOIA 2OZ6A 4PIZA 3B9IA 4IE4A 1W6QA 3ILFA 2JEMA 4JKKA 4M01A 1W9WA 4HOOA 4Q4X2 3T08A 5GJ6A 3POIA 1X50A 3J7NA 1N47A 1UF2C 3RRDA 3WINE 1VBE3 3V0BB 3O0XA 2AENA 1QJEA 4Y1UA 3ZN6A 2V4VA 4JDNA 4NPRA 2RVAA 2DCTA 1E5SA 3LEMA 2VZ3A 1QJFA 3PUAA 1KDKA 1JHNA 2WR9A 2P3JA 3FLRA 1DGRA 1FMD1 4GXLA 4UF0B 2G4IA 2HYKA 3UESA 3PLQA 1C3HA 1SPPA 3QH7A 5CKQA 1ZRCA 3KS7A 5LBEA 3WY6A 2JE8A 3O1VA 4IEWA 5FPZA 4QGLA 5AVPA 1AYM1 1XRUA 5IAXA 1S55A 2VMHA 2XKOA 3ACGA 1IHMA 2P6HA 4V2WA 4XE9A 1V6JA 4V2VA 4HMZA 3ES1A 2YGMA 1MS9A 1QOTA 3I59B 5FZLA 3ZR6A 2QQJA 1WW5A 4JRLA 2GNMA 2XB6C 4O9EA 3VKMA 3T0AA 5EZWA 3R4DB 5C3QA 2BU9A 1HW5A 1JZ4A 3VGIA 1LODA 2GH8A 2ET1A 4FVVA 1NE6A 4EV0A 4OQ8A 4IE7A 1SFNA 1AR73 1O6UA 1Q5OA 2OZJA 4IERA 4YZ2A 5FYYA 2ORXA 2YB7A 3GCXA 4XUOA 4EE2A 1V6KA 1WMFA 3EXUA 3LPFA 4FPCA 4DS0A 5IFPA 2A6ZA 4ZXKA 1W8HA 4XBLA 4WM8C 2BUKA 1GP4A 4Q2FA 3T3YA 2BEOA 4EZHA 5CU1A 5C9AA 1PM7A 4M0HA 1G9AA 1ENRA 1YQCA 4I3GA 3RFRA 5JR7B 3WDVA 4X6QB 2E32A 4EWAA 5BNOA 4LUKA 4QB1A 3AKPA 3UL2A 2WQ8A 5EWSA 1V9U2 4EZ4A 2A3YA 5L9VA 2Q1MA 4XMIA 4XTMA 1ZX5A 1OF3A 1X82A 4LXLA 2Q0AA 3VZNA 5FXVA 1OA4A 3POGA 5FZCA 2IXJA 2VMEA 5CZKA 4C1WA 4CEYA 1OLME 2YFUA 2JG8A 3WG4A 5DZFA 2UWAA 4BMBA 4BM8A 1MS1A 4DY5A 1D4M3 2XLAA 4M00A 1RUI3 3MPPG 4XUQA 4GH4B 4EWEA 4JX0A 2GP5A 5LRRA 4FTSA 4COUA 2Z4FA 2TUNA 4FPYA 1IPSA 1FOD1 2HWE2 3BU0A 4RQPB 3AVRA 4N43C 1SLAA 1HX6A 4CEWB 3O1OA 4R4XA 1XBFA 1WLCA 2OS2A 5HI0A 3TEZA 1LOFA 2AACA 2Y6GA 4UFKA 5F3EA 2WAAA 4FP2A 1PX4A 1D2SA 4XZPA 1FI2A 4QGNA 4QM9A 2YU1A 4FFGA 1N3PA 1RUG3 3UGGA 1V6LA 1UNBA 4QPYA 1NXD1 2OUHA 1W6MA 3V65A 2PTMA 5CFCA 5DN2A 1AYN1 3AP5A 5E16A 5CBLA 1QJY3 2JIJA 1HB1A 4LE3A 1W39A 1F35A 3ZFFB 4ET7A 3GYDA 5IYYA 1DLCA 2R041 2ZGMA 3VBOB 4RD7A 3JBG1 1MS8A 2XGXA 1BZWA 4P9JA 5DPNA 3H50A 1NCRB 2VBDA 3ALQA 3DEMA 2XJSA 3NJYA 1MEC3 4R9CA 3SHRA 3U78A 3WF0A 4B4QA 2ZGRA 3FMGA 4YFZA 2YXSA 4DXRA 1S4CA 2HWF2 2Y33A 2Y6KA 1DQ5A 4HPKA 2C6SA 4QX1A 2J1AA 2OQ7A 5GZFA 5DZGA 2FMDA 3J4UH 4K21A 4Q27A 3VHPA 2ADDA 2VZSA 2IXIA 1POV1 2OQ6A 3ZXAC 4LHLA 4CDUC 5L7OA 2CWMA 1KEXA 4BIOA 2DVAA 4AG4A 1BKZA 2CAUA 4P9IA 1YQ8A 5FY7A 3AFKA 2A73B 1ODMA 2BGCA 1OFNA 1PMJX 4AQ2A 3A0KA 1YXWA 1AL0G 1C8M2 1PZ7A 3JD71 2NZ9A 4KG0A 2HWB2 3PUHA 3NNMA 3HQRA 2UYAA 5A70A 1FV2A 4EJRA 3BGAA 2VZQA 1PGW2 5JOWA 3H8UA 3VBSC 4OQ9A 4JRAA 3OBAA 4M3CE 1LRHA 4FPGA 4DXZA 2Q30A 3VD7A 1ENSA 4LR4A 3S5AA 3O1PA 4IV3C 1BEV3 1PVXA 2PLV2 2BV4A 1GU3A 2XMLA 3OEBA 3VBFA 4DUWA 5ACA2 1RMU3 4XJ8A 3ZFEC 3MPBA 4CCLA 4NOTA 5C5TA 3FWEA 1WGPA 1ZBE2 5IUQA 1POV0 4U2AA 3D4KA 1W90A 5FZOA 4Y1VA 2Y6FA 2C26A 2ET7A 4I01A 4KBBA 1RVF2 2D5FA 5FKBA 3U0ZA 1GP5A 1EPZA 2UURA 2WIIB 3AKTA 3OY8A 5A1AA 1TME3 3J8F2 1BMV2 3BPSA 2FDHA 3DKWA 3VDAA 4D7YA 1EPWA 4XJUA 4PT6A 4YVWA 2QTWB 2WNUA 4UF0A 4AI0A 4JQRA 1W99A 5CFCC 1DCSA 4P9YA 3KHCA 1R1ZA 2DDUA 5FYMA 3AYCA 5ANNA 5T52A 3NNLA 4XF4A 1QH6A 1O5UA 5AC93 3CF6E 3AKQA 4BQ3A 4QQHA 3H42B 4R4ZA 3CDZB 3WT3A 3AX4A 5DXDA 3WHUA 1HXS1 4XAAA 4ASMB 2VUCA 1RUJ2 1RUOA 4RA0A 2EAKA 4CDXC 3IWZA 3NQHA 2Q8DA 3GBWA 3T1MA 4PQ9A 1QWRA 2A6VA 3IZOA 4P14A 2VUJA 3H7JA 3SCHA 3WQ7A 4YVSC 5LBCA 1D0HA 1ONAA 1XOYA 3AZVA 5E88A 1QGLA 5EJZB 1D7PM 4CCCA 3NNFA 5FP3A 4P9XA 1DIWA 1UZVA 4D6SA 2Q8EA 1L3JA 3C3VA 5F39A 3KV5A 5CFDC 4I0WB 2F6BA 1IOAA 1TZOA 1XNAA 2GNTA 1UO9A 2IXKA 2R1DA 2Y64A 3AP4A 3MGUA 2OKXA 3VB9A 3M3IA 5LBFA 4XBQA 1YI9A 3I2JA 3K3OA 3LFMA 3CBNA 1JYVA 4Q4Y1 4YM0A 2NN8A 1ZRRA 1BLZA 2OPWA 3FZ3A 1LU2A 1HQWA 3ZXDA 2HJIA 4UYBA 3N9NA 1SLBA 3LDRA 4E8CA 5C9AB 4KWJA 4Y20B 1W6QB 1VBC3 3BIWE 1J1LA 1HLCA 5FZ0A 2Y0OA 5T50A 3K48A 3KGZA 4N7IA 5DQ0A 2JXAA 1LHVA 2PHFA 4MUVA 4OZOA 2RR11 5EV7A 3VBSB 3LPGA 4Q0QA 1H8TA 3BOWA 4XF0A 1OLRA 2O0OA 2WT2A 1CIYA 1R081 1F31A 2RMU3 2WWSA 3CNAA 4FFIA 3T2OA 1ZM1A 4LHSA 4Q4W3 1CWPA 3AVSA 4B4PA 4BE3A 1DU3D 5A7QA 4O61A 4CEYB 2C24A 1RL3A 1WMDA 2DBNA 2VNVA 3I2FA 4HZFA 3AXDA 4ITCA 1YFYA 3S0MA 4XUNA 1EV11 2VMDA 4GD4A 2NMNA 3N9QA 4LKFA 1VBC2 4RL7A 4Y33A 4UW6A 3NJXA 4D7SA 1ZVFA 5J7MA 3CO2A 3GHMA 3HVDA 5FZAA 4C90A 3I3MA 2IXLA 1KDMA 3TBDA 1MVEA 1Q8QA 1W06A 5C8CC 3D5OA 3ST7A 5IVEA 5FMOL 2TBVA 5A3LA 4K9SA 3O1UA 1AR91 1QY4A 4EN8B 1CONA 1ND3C 4GB32 1EAH1 1CR7A 1DGLA 5GLUA 3BTZA 3DXUA 4LITA 5F6KA 2P3YA 3WD5A 4YW3A 1ND2C 3S5QA 4GULA 3WSOA 2Y34A 4HG6B 4UFMA 2J22A 4CDWA 3GDBA 4XBNA 4NJ4A 3KT4A 4AFDA 2VZUA 3O0VA 1PIV2 3KM5A 4O9GA 5C5UA 4AR2A 1TVGA 3RJRA 5FKCA 2WZ8A 2YBKA 1QXJA 3ZN5A 3TOJA 4FSJA 1VIWB 1J3RA 1UY1A 2VNGA 4E8DA 3LGRA 1NZIA 4XUTA 1MACA 1MEC1 2J1UA 4UFHA 1MQTA 5FMOS 5I8YA 3K75B 5JXIA 1H30A 4OCTA 4BXFA 1ZZCA 2BW8A 3P5BA 2BPA2 1BBT3 2GU9A 1Q8VA 2B7YA 1A3KA 1LOCA 1OUSA 4M4PA 4S2GA 4LMFA 1REEA 1FNZA 2CDOA 4AGRA 2HWD2 3EO6A 5JZGA 3WG2A 4XF1A 1GNHA 3UJQA 4YZ1A 1CZVA 1COV1 4BYYA 2A3WA 1JOPA 1LJ7A 2R7EB 2VCBA 1SLCA 2VQ0A 1S0DA 2HWC1 3LA2A 3GCWA 4RHV1 1EYBA 2BDRA 3MUY1 5HCBA 4EN9B 5JOZA 1H0BA 2CY6A 4W4ZA 4DPNA 4XFGA 2CGOA 4XXAA 3PVBB 5FR3A 3BALA 4RYDA 4ZY9A 4Z1VA 3MICA 4KGGA 3EJKA 1S0JA 3E6CC 4LBNA 3W5MA 1X8MA 5FPXA 4R9AA 3VL9A 1JUHA 4Z2AA 4XIOA 1RGSA 3VHNA 3GBGA 4ISRA 5KC5A 3SCGA 4Z2WA 1C1FA 1JOJA 5FPBA 1E5HA 1OT5A 3DKQA 1DHKB 5EIYB 1GNYA 2XJUA 4K8RB 1F5FA 4KU7A 4M3CB 2X10A 5BNPC 1VBA1 5FZHA 5KR7A 3APBA 4AEDB 1W2UA 3ZYJB 3N7MA 1NZCA 5CKNA 2E7QA 3WDTA 1XNCA 4QKBA 4QPIA 4AVTA 5ABJA 3BTXA 2CNAA 1W9SA 3U14A 1G9BA 1VLNA 5FY9A 3UGFA 2JDYA 4R9BA 1W6MB 4RR3A 1GYKA 5JSRA 1SBDA 4HBNA 3C8XA 4YVWB 1DBNA 2G19A 4JGYB 1OSGA 1NA1C 2CYFA 2WWUA 2PQQA 1TMF3 2E33A 5LA1A 5F2WA 5H9SA 4PDWB 4J1WA 3HEIA 3FX3A 5JSPA 5LA9A 2QBXA 1UYZA 1FXZA 1ULCA 1O3SA 1ACCA 1H4GA 4YSFA 2D6KA 5D8AA 3HNYM 3TB0A 4XQWA 2P34A 3WLUA 5F32A 5FUIA 3WQ1A 3AP9A 3LIGA 1QJX1 3NW4A 4W50A 1EUUA 4AVSA 5I8TA 1VB4A 2WSVA 3JXSA 4IGQA 1YQ5A 3KGLA 4HLTA 5HV0A 1PO12 3OGGA 2YDEA 4Y24A 3UJOA 2D6MA 4N9IA 1H2LA 2AREA 2P4EA 1AXZA 1T6GC 4COZA 1GANA 1PK6C 1ST8A 2JG8B 2VCCA 3MFAA 4YG6A 4IV3B 3AP7A 3C2UA 3K4DA 1V70A 2VU9A 3PMSA 3BVCA 5IVCA 1QKQA 1ZREA 3MV11 2PHXA 5GZDA 3T0BA 3ZN6B 3ZOIA 5JI9A 1W0PA 2ZX2A 3A21A 1JU4A 1UY2A 4CCOA 1GWMA 5CB7A 2Y60A 2F4LA 1RB8G 4B3NA 5CG9A 1WMXA 3OBRA 1GOFA 2VMFA 4YG0A 1LEDA 4QXBA 1C8M3 4QU2A 1AYM3 1QOOA 4LT5A 1H6XA 4RQPA 2RJKA 2YPDA 3KMHA 1OFSA 4QQPA 3HBKA 1AR83 4XXPA 3TNPB 1RJ8A 3WNKA 3VDBA 3VBOA 1YFWA 4GB33 3LOBA 4HN1A 3ZKYA 2NPIA 1PZ8A 3AJYA 1HB4A 3Q8FA 3AYAA 3KZ4C 1LEMA 4TWTA 5HV4A 4N7UA 5F2SA 2VO5A 4XURA 3VDDA 2QQNA 4NR1A 4OZXA 5L9RA 1RUF1 2W1WA 4KI5M 3I3QA 4I0AA 2KXLA 1AR71 1CZSA 4MXWB 4BQ1A 1DQ2A 5J1XA 2GC2A 1ZBA3 4OHWA 4IDZA 1LHNA 1PK6B 1WD3A 2AH2A 2D97A 1WCUA 1Y43B 2DFCA 2JG8C 2W5FA 5DUXA 5L9BA 3TAYA 3W21A 3N3HA 4FPFA 3OSDA 2E6VA 2XJPA 3UT0A 4YGCA 2B9UA 1SEFA 3HN1A 3ZVXA 2BRTA 2FZ2A 2XJTA 3RDIA 1QJZA 1EP0A 1N3OA 2VW1A 3MW4A 3OYWA 4NAOA 3VKOA 1H1MA 3S30A 5L7OB 4PLOA 3AM2A 5LBBA 1H9PA 2DYCA 4DEQA 3WDYA 3ZR5A 1R093 4S2HA 1LHUA 2ZGPA 1W6OA 2WINB 2Z5WA 4QX5A 5F5IA 2EXHA 3BB6A 2B46X 5FDBA 4DMIA 1ULPA 1SLIA 5C3SA 4P9GA 4HKLA 1XNKA 4MO3M 3UKVA 1R1A3 5IATA 3BKZA 3CEWA 4XIKA 1LGNA 3PDQA 1OOPA 3R4SA 3WV6A 1VMFA 1YHFA 1VRH2 4SBVA 1PO11 1LOAA 2UWCA 4YWAA 4MVTA 2ARBA 2E53A 3OOXA 3K4AA 1VBC1 1XNBA 4G3YC 4I3PA 3M2MA 2PAKA 3WNPA 1LENA 1RMU1 2XOMA 1XSQA 3IB3A 3N9PA 4N53C 2BOJA 1VJ2A 1PHMA 3WCRA 4LNVA 2XL9A 4QXHA 4LULA 5EXOA 4LBQA 4NWVA 3WOGA 3WEZA 4HK9A 4QDSA 1U5IA 3GHNA 1JBCA 3LAGA 4K6BA 5F5QA 4GMP3 4NHMA 1RUE1 1O8SA 4F8AA 3WQBA 1W9TA 2R073 3TEYA 1YFXA 2VCMA 2ZTNA 1RJ7A 5H9PA 5CAZA 3BUCA 1OPOA 3CJIB 4LA3A 1DZTA 2WABA 1QJY1 4L99A 2ZX1A 5FO7B 4BHPA 3J8F1 4IXLA 1AYN3 1O7FA 3POWA 5J3UA 3ES4A 4GIQA 1GQPA 4HVOA 4EYUA 2A3XA 2LALA 1LR5A 2V72A 2ZPXA 4A2UA 1UMIA 4BZ4A 2RDRA 2VULA 2K0GA 2Y6JA 4CP1A 3AZWA 5JLVA 1UQXA 4JV4A 1RUH2 1VBD3 1UX7A 1S0FA 4LQRA 2YHJA 1JZ8A 5LEJA 1WLDA 1AZDA 2RS12 5CKMA 1FPN1 2P1BA 4H2AA 3RQ0A 3WP3A 1J59A 2GMPA 5LWBA 1X33A 5FPAA 3DV8A 1G86A 3NNGA 4MGYE 3KCCA 4QXCA 4IEZA 1XNTA 1ZZ6A 5FYVA 3NSTA 1PO13 5T54A 2CTVA 4JC1A 3D0JA 4Y4RA 2CGPA 4WM8B 4NPLA 3WG1A 1US2A 4BIFA 4MOAA 4N8MA 3LDBA 3O5SA 1U12A 2A1XA 4DRVA 2A6XA 3IMMA 1A34A 2C0ZA 2CDPA 1OUXA 1UN1A 5FLIA 4AW7A 1UMHA 4XFAA 3IM0A 3J7MA 1CPMA 2A5ZA 5IVJA 1PNFA 1O91A 2PLV1 2LM3A 3FFZA 3VL8A 4JGYC 1V6OA 1DZRA 2VBPA 1B35C 1N1SA 2GH2A 1W9FA 2ZX4A 1BEV1 2CHHA 1A78A 4GZ9A 5A3UA 1RUC3 1WCDJ 1XU2A 4BCUA 4ISQA 1J1TA 2W2IA 3WW4A 3AMPA 4G9SB 3U11A 2CSGA 1H2MA 2PXJA 4QQOA 2GDFA 2Q5TA 4P5YA 5FY1A 1LCLA 1ZRIA 3BU7A 2C9KA 4L8QA 4MX3A 4NHLA 5DDJ2 4FP3A 4NIGA 1SLLA 1K3IA 1R64A 4FXKB 4B7KA 3WNLA 1SCRA 3VUOA 3INAA 1UYPA 3VV1A 1LU1A 4CXYA 5HXVA 2XUMA 5ANQA 2QQKA 1V6MA 4Q1RA 2WUHA 1ASJ1 1OKQA 5LZ6A 3ZLIA 2VZOA 1UOJA 4YW6A 4E4HA 2Y38A 4YW5A 3ZFGC 2J1RA 3EYPA 1W8TA 2VNOA 1POV3 3FLPA 1H1AA 5A80A 2TEPA 3IT8A 3WNXA 5A3OA 4YARA 5C3RA 2VOWA 5KXEA 2SLIA 3OF1A 1K5JA 3POYA 4UT5A 1KFXL 3MIHA 2WSUA 1W28A 3CHXA 3ZXEA 3LEKA 2ZEXA 3RSJA 1JXNA 2BTVC 3A0NA 4AEDA 4NHXA 5J96B 5M0TA 1WLTA 3U37A 5KWRA 4J1XA 2LS6A 2C1FA 4AE2A 1ZRDA 1O8PA 1O59A 2JDUA 5BYNA 4W6YA 4FOQA 2I45A 3AB0A 2E7TA 3N9LA 4RR3B 4CP0A 3Q8CA 4L0PA 4Y22B 4YNIA 5I0UA 3PHMA 2RS51 4ONUA 1AUYA 1H6YA 5FUPA 2CU5A 5JAXA 1XU1A 3EQEA 3DF0A 5C71A 1AL22 3LSEA 2L9LA 1QH7A 2HLEA 2K9ZA 2YPJA 4XQDA 4F83A 1XSRA 2AUYA 4OUEA 5JSOA 2P2KA 2VUDA 1SMVA 2BJSA 4ORFA 3VBUC 3QD6A 4NIDA 1Y7BA 5FZ3A 1FPN2 2XL7A 3KV6A 5FPLA 1S0IA 3RZZA 4FI9A 3AC0A 1MQTB 3U10A 3K4ZA 1MS0A 2YV8A 1I1EA 4Q1PA 4EN0A 1BMV1 2QQMA 4M3CA 3ZDVA 3DECA 5JUVA 2LW8A 3TYJA 2PHLA 3P6BA 1C5IA 4B8EA 4WBBA 4RGGA 4PI0A 4ASLA 3ZFFA 4QB2A 1JYXA 3W59A 3JBG3 3HQXA 4MGTA 3IAQA 3ZSMA 4K8FA 4DOUA 1WD4A 1JW6A 2MNGA 4QX8A 4DUVA 4LA2A 3AL6A 3U75A 2E9QA 2XKPA 1FNYA 3CZJA 4MGQA 4PBOA 4XHXA 4HT1T 2FCTA 3IIIA 4CXXA 4LK7A 5JOYA 4G4FA 3SMHA 2OVUA 2PHWA 2R30A 3H3LA 1YQ6A 1G9DA 4Q26A 2E51A 1J3QA 2MHFA 3POSA 4HKOA 1OH3A 4YZ3A 2X05A 1CAWB 2W1QA 4HFSA 4I0BA 1C8NA 3GGLA 5FZDA 1XNDA 1PMHX 4PF5A 5HCFA 1VMHA 3VZJA 2LTNA 5B4XA 3IAPA 2PHRA 1VAKA 5GALA 3PUIA 2D98A 1E5IA 4MH0E 5DUUA 4AVCA 2A71A 2WO1A 2XPJA 1X8EA 4D6RA 3SLIA 3AMMA 4A41A 3SH4A 2DFBA 3M3CA 4XCAA 2O1QA 4B29A 3BCWA 5EPAA 5FIXA 1GKBA 1CJDA 4E27A 4E4DX 4XDQA 4D6QA 4LORA 3H8RA 4AEMA 5FYHA 1GZTA 1NUKA 1GSLA 3PVOA 2X5IB 4PDWA 4XHBA 3I3BA 2WNVA 5A3WA 1ULOA 3T2TA 3NVCA 1K45A 2XHNA 1JMUB 4XJZA 3ACLA 3AL5A 3ZSLA 2FZ1A 4LIVA 4A7KA 3PTYA 2DV9A 5FYZA 2G9ZA 2JECA 4PJYA 3WW3A 1GNZA 3VBSA 3BIEA 3HN3A 3IN9A 1DGRN 3G7DA
chains in the Genus database with same CATH topology
1XC6A 3I97A 1UY0A 2BBAA 3HJRA 4OMDA 4E8CA 4P02B 5IHRA 5DQ0A 4OZOA 4UI9L 1OH4A 1GUIA 3LPGA 1W8NA 1NAEA 2WO3A 5EJ1B 1CIYA 3SKJE 3T2OA 4A45A 4A44A 2J7MA 4D0QA 4LHSA 4D8MA 1XPWA 3I2FA 3T09A 4CU9A 3K46A 4XUPA 4XUNA 2VMDA 2VZTA 1UZ0A 1UXZA 2W95A 3NJXA 3C7FA 4UAPA 2XONA 2ZEZA 2ZEWA 1WKYA 4CU7A 5JXGA 2ZEYA 1SG3A 3C7EA 4PF1A 4LPLA 3WSOA 4HG6B 2J22A 3GDBA 4QX0A 1UY4A 4DXTA 2EIEA 2VZUA 5LA0A 3A23A 4BJ0A 2EIDA 1TVGA 2WZ8A 3J7HA 1UY1A 4E8DA 2PQSA 4XUTA 1KGYA 2J1UA 2WO2A 2J1EA 3OB8A 3K75B 2VZPA 3HNBM 5JXIA 4M4PA 2CDOA 1CZVA 2VCBA 2R7EB 5C70A 1OF4A 3MUY1 2J1TA 1JZ7A 1NKGA 1UY3A 1JZ3A 4W4ZA 1PX3A 1MPXA 4RYDA 4ZY9A 3MV01 3FL7A 4BDVB 3W5MA 3FN9A 4Z2AA 3ECQA 2VOTA 3WF1A 3VD3A 3OEAA 1OT5A 3CIHA 5EIYB 1GNYA 3FHQA 3F2ZA 2X10A 2DCJA 3A7QA 3GXUA 4IUGA 1W0NA 3ZM8A 2BERA 1JHJA 4XVHA 5G04L 1W9SA 4QDRA 5G05L 3C8XA 2VQTA 4UOJA 1L7QA 2QQLA 3ACIA 2BZDA 4M4RA 2YFZA 2E33A 4ZZ5A 5LA1A 2V5DA 2WAOA 1J84A 3K77A 3HEIA 2QBXA 2W3JA 1UYZA 4ZZ8A 5HPOA 3HPNA 1SHWB 2WYSA 2YC4A 3HNYM 5FUIA 3CZUA 1F4HA 4W50A 1GOHA 1EUUA 2VC9A 3LE0A 3JXSA 3THDA 3MUZ1 1UXXX 3BN6A 4TXWA 4GWJA 2YC2A 4CUAA 2VCCA 1JYWA 3K4DA 1UYYA 1JZ6A 3C7OA 3MV11 3T2QA 3T0BA 3WF3A 1BHGA 1I5PA 1NX9A 3A21A 4CU8A 1JU4A 1UY2A 3HOBA 2VMCA 1US3A 2Y6LA 3OG2A 5DMYA 1GOFA 2VMFA 2WZEA 2VJXA 3NJVA 1H6XA 2W94A 2JD9A 3WNKA 5CYYA 4P00B 3I2HA 1HN1A 3VDBA 2C4XA 2BGPA 3WF4A 3SEPA 1SDDB 3T0DA 4QAWA 1DYOA 2VO5A 2WDBA 4XURA 2QQNA 1UYXA 5JMOA 4CU6A 3CMGA 2W1WA 2YG0A 4KI5M 2E26A 3DYPA 1CZSA 2W47A 2VM9A 5J1XA 3I2KA 1LNSA 4ET7A 2W5FA 4YPJA 2VZ1A 5IJRA 2WN3A 1CZTA 4JKKA 3C7GA 4XZUG 3T08A 1W9WA 3FHAA 3SEEA 4DEQA 2VZVA 2KD7A 4JKMA 1RYYA 1WCQA 2V4VA 1ULPA 2RVAA 5LCWL 2VZ3A 1K12A 3ETPA 1JU3A 4MO3M 3UESA 2W46A 4AAXA 3LQCA 3E1F1 3C7HA 1JYNA 1JI6A 2WN2A 2JE8A 2WBKA 2J1SA 3K4AA 3GM8A 3ACGA 4JHZA 4OYUA 3WNPA 2XOMA 3IB3A 1EUTA 3I2GA 4QB6A 2JDAA 4A4AA 2QQJA 3WEZA 3T0AA 4QDSA 2RV9A 3W5NA 2J1VA 4OMCA 1O8SA 1IQDC 2Y8KA 3WQBA 1W9TA 1JZ4A 1F4AA 3MBWA 2WABA 1GQPA 2EIBA 2V72A 2W9XA 2E31A 1UMIA 2W87A 2ORXA 3LEIA 2YB7A 4XUOA 2Y6JA 4KMQA 3LPFA 2ORZA 5IFPA 2B9VA 4QPWA 4BK5A 1UX7A 4LQRA 3VDCA 1JZ8A 4DEVA 3WNOA 3IDAA 3LEGA 2VL4A 3NNGA 4A3ZA 5JXJA 2W91A 3DYOA 1XNTA 3I2IA 1GOGA 2E32A 1JZ5A 5HXMA 4QB1A 2WQ8A 2X09A 1US2A 4MOAA 1OF3A 2VMEA 2CDPA 5CZKA 3OGVA 4KWUA 4ARYA 2YFUA 1UMHA 2JKXA 4XUQA 2Y6HA 4JX0A 2Z4FA 4PQQA 5JR2A 4GZ9A 5LA2A 3NRUA 4P5YA 2Y6GA 2C9KA 2WAAA 1PX4A 4W8JA 4LKSA 1K3IA 1R64A 3MO4A 3WNLA 1L7RA 1JZ2A 4DXSA 1OD3A 1J83A 5DN2A 2ID4A 4CUCA 2QQKA 3A22A 2WUHA 2VZOA 2VCAA 3T2PA 2VTFA 2J1RA 2RJ2A 3EYPA 3UETA 1DLCA 5IYYA 1K42A 5DPNA 4MGSA 3WF0A 3ACFA 3THCA 1UWWA 2QQIA 4DXRA 3LEKA 2ZEXA 2Y6KA 4QX1A 3WNMA 4BK4A 2J1AA 3U37A 3WF2A 3ABZA 2W92A 2LS6A 2VZSA 4MADA 1O8PA 4QX3A 1O59A 3EB7A 4ZXEA 1KEXA 4AG4A 4L0PA 2VQUA 1H6YA 3CQOA 4CVUA 1PMJX 2VR4A 4CUBA 5C71A 3UNPA 3DYMA 5C7GA 2L9LA 1T2XA 2HLEA 3PUHA 4A6OA 4OUEA 4RN5A 3BGAA 2VZQA 3ACHA 2BGOA 3OBAA 3VD7A 4FI9A 3AC0A 3OEBA 3K4ZA 1GU3A 4DUWA 5JXHA 1YQ2A 4TTGA 2DCKA 2XQXA 5B4NA 1P8JA 2QQMA 5JUVA 3DECA 2LW8A 3I3DA 3P6BA 3VD5A 3CKHA 4ARXA 2C26A 4QB2A 1JYXA 1W8OA 3P1IA 3D3AA 5A1AA 3IAQA 3VDAA 2VZRA 4PT6A 4DUVA 4JKLA 5I0DA 4BXSV 3WNNA 1W99A 3CZJA 4MGQA 5IFTA 2DDUA 3IIIA 4QDQA 4DUXA 3VD4A 2X05A 2W1QA 2EICA 1TG7A 3CDZB 4A42A 3I3EA 3GGLA 1PMHX 5B4XA 3IAPA 5F7UA 3OGSA 3PUIA 3NQHA 2HYXA 3VD9A 3OGRA 2WO1A 4P08A 2W1UA 4A41A 4GWIA 3HNMA 2W1SA 5EJZB 1D7PM 4QX2A 2ZXQA 1CX1A 2QQOA 1NUKA 1GMMA 1DP0A 3I3BA 1ULOA 2Y64A 1K45A 1XNAA 2XHNA 2OKXA 2B4KA 3SKVA 3I2JA 1JYVA 3HN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC6 A;  3I97 A;  1UY0 A;  2BBA A;  3HJR A;  4OMD A;  4E8C A;  4P02 B;  5IHR A;  5DQ0 A;  4OZO A;  4UI9 L;  1OH4 A;  1GUI A;  3LPG A;  1W8N A;  1NAE A;  2WO3 A;  5EJ1 B;  1CIY A;  3SKJ E;  3T2O A;  4A45 A;  4A44 A;  2J7M A;  4D0Q A;  4LHS A;  4D8M A;  1XPW A;  3I2F A;  3T09 A;  4CU9 A;  3K46 A;  4XUP A;  4XUN A;  2VMD A;  2VZT A;  1UZ0 A;  1UXZ A;  2W95 A;  3NJX A;  3C7F A;  4UAP A;  2XON A;  2ZEZ A;  2ZEW A;  1WKY A;  4CU7 A;  5JXG A;  2ZEY A;  1SG3 A;  3C7E A;  4PF1 A;  4LPL A;  3WSO A;  4HG6 B;  2J22 A;  3GDB A;  4QX0 A;  1UY4 A;  4DXT A;  2EIE A;  2VZU A;  5LA0 A;  3A23 A;  4BJ0 A;  2EID A;  1TVG A;  2WZ8 A;  3J7H A;  1UY1 A;  4E8D A;  2PQS A;  4XUT A;  1KGY A;  2J1U A;  2WO2 A;  2J1E A;  3OB8 A;  3K75 B;  2VZP A;  3HNB M;  5JXI A;  4M4P A;  2CDO A;  1CZV A;  2VCB A;  2R7E B;  5C70 A;  1OF4 A;  3MUY 1;  2J1T A;  1JZ7 A;  1NKG A;  1UY3 A;  1JZ3 A;  4W4Z A;  1PX3 A;  1MPX A;  4RYD A;  4ZY9 A;  3MV0 1;  3FL7 A;  4BDV B;  3W5M A;  3FN9 A;  4Z2A A;  3ECQ A;  2VOT A;  3WF1 A;  3VD3 A;  3OEA A;  1OT5 A;  3CIH A;  5EIY B;  1GNY A;  3FHQ A;  3F2Z A;  2X10 A;  2DCJ A;  3A7Q A;  3GXU A;  4IUG A;  1W0N A;  3ZM8 A;  2BER A;  1JHJ A;  4XVH A;  5G04 L;  1W9S A;  4QDR A;  5G05 L;  3C8X A;  2VQT A;  4UOJ A;  1L7Q A;  2QQL A;  3ACI A;  2BZD A;  4M4R A;  2YFZ A;  2E33 A;  4ZZ5 A;  5LA1 A;  2V5D A;  2WAO A;  1J84 A;  3K77 A;  3HEI A;  2QBX A;  2W3J A;  1UYZ A;  4ZZ8 A;  5HPO A;  3HPN A;  1SHW B;  2WYS A;  2YC4 A;  3HNY M;  5FUI A;  3CZU A;  1F4H A;  4W50 A;  1GOH A;  1EUU A;  2VC9 A;  3LE0 A;  3JXS A;  3THD A;  3MUZ 1;  1UXX X;  3BN6 A;  4TXW A;  4GWJ A;  2YC2 A;  4CUA A;  2VCC A;  1JYW A;  3K4D A;  1UYY A;  1JZ6 A;  3C7O A;  3MV1 1;  3T2Q A;  3T0B A;  3WF3 A;  1BHG A;  1I5P A;  1NX9 A;  3A21 A;  4CU8 A;  1JU4 A;  1UY2 A;  3HOB A;  2VMC A;  1US3 A;  2Y6L A;  3OG2 A;  5DMY A;  1GOF A;  2VMF A;  2WZE A;  2VJX A;  3NJV A;  1H6X A;  2W94 A;  2JD9 A;  3WNK A;  5CYY A;  4P00 B;  3I2H A;  1HN1 A;  3VDB A;  2C4X A;  2BGP A;  3WF4 A;  3SEP A;  1SDD B;  3T0D A;  4QAW A;  1DYO A;  2VO5 A;  2WDB A;  4XUR A;  2QQN A;  1UYX A;  5JMO A;  4CU6 A;  3CMG A;  2W1W A;  2YG0 A;  4KI5 M;  2E26 A;  3DYP A;  1CZS A;  2W47 A;  2VM9 A;  5J1X A;  3I2K A;  1LNS A;  4ET7 A;  2W5F A;  4YPJ A;  2VZ1 A;  5IJR A;  2WN3 A;  1CZT A;  4JKK A;  3C7G A;  4XZU G;  3T08 A;  1W9W A;  3FHA A;  3SEE A;  4DEQ A;  2VZV A;  2KD7 A;  4JKM A;  1RYY A;  1WCQ A;  2V4V A;  1ULP A;  2RVA A;  5LCW L;  2VZ3 A;  1K12 A;  3ETP A;  1JU3 A;  4MO3 M;  3UES A;  2W46 A;  4AAX A;  3LQC A;  3E1F 1;  3C7H A;  1JYN A;  1JI6 A;  2WN2 A;  2JE8 A;  2WBK A;  2J1S A;  3K4A A;  3GM8 A;  3ACG A;  4JHZ A;  4OYU A;  3WNP A;  2XOM A;  3IB3 A;  1EUT A;  3I2G A;  4QB6 A;  2JDA A;  4A4A A;  2QQJ A;  3WEZ A;  3T0A A;  4QDS A;  2RV9 A;  3W5N A;  2J1V A;  4OMC A;  1O8S A;  1IQD C;  2Y8K A;  3WQB A;  1W9T A;  1JZ4 A;  1F4A A;  3MBW A;  2WAB A;  1GQP A;  2EIB A;  2V72 A;  2W9X A;  2E31 A;  1UMI A;  2W87 A;  2ORX A;  3LEI A;  2YB7 A;  4XUO A;  2Y6J A;  4KMQ A;  3LPF A;  2ORZ A;  5IFP A;  2B9V A;  4QPW A;  4BK5 A;  1UX7 A;  4LQR A;  3VDC A;  1JZ8 A;  4DEV A;  3WNO A;  3IDA A;  3LEG A;  2VL4 A;  3NNG A;  4A3Z A;  5JXJ A;  2W91 A;  3DYO A;  1XNT A;  3I2I A;  1GOG A;  2E32 A;  1JZ5 A;  5HXM A;  4QB1 A;  2WQ8 A;  2X09 A;  1US2 A;  4MOA A;  1OF3 A;  2VME A;  2CDP A;  5CZK A;  3OGV A;  4KWU A;  4ARY A;  2YFU A;  1UMH A;  2JKX A;  4XUQ A;  2Y6H A;  4JX0 A;  2Z4F A;  4PQQ A;  5JR2 A;  4GZ9 A;  5LA2 A;  3NRU A;  4P5Y A;  2Y6G A;  2C9K A;  2WAA A;  1PX4 A;  4W8J A;  4LKS A;  1K3I A;  1R64 A;  3MO4 A;  3WNL A;  1L7R A;  1JZ2 A;  4DXS A;  1OD3 A;  1J83 A;  5DN2 A;  2ID4 A;  4CUC A;  2QQK A;  3A22 A;  2WUH A;  2VZO A;  2VCA A;  3T2P A;  2VTF A;  2J1R A;  2RJ2 A;  3EYP A;  3UET A;  1DLC A;  5IYY A;  1K42 A;  5DPN A;  4MGS A;  3WF0 A;  3ACF A;  3THC A;  1UWW A;  2QQI A;  4DXR A;  3LEK A;  2ZEX A;  2Y6K A;  4QX1 A;  3WNM A;  4BK4 A;  2J1A A;  3U37 A;  3WF2 A;  3ABZ A;  2W92 A;  2LS6 A;  2VZS A;  4MAD A;  1O8P A;  4QX3 A;  1O59 A;  3EB7 A;  4ZXE A;  1KEX A;  4AG4 A;  4L0P A;  2VQU A;  1H6Y A;  3CQO A;  4CVU A;  1PMJ X;  2VR4 A;  4CUB A;  5C71 A;  3UNP A;  3DYM A;  5C7G A;  2L9L A;  1T2X A;  2HLE A;  3PUH A;  4A6O A;  4OUE A;  4RN5 A;  3BGA A;  2VZQ A;  3ACH A;  2BGO A;  3OBA A;  3VD7 A;  4FI9 A;  3AC0 A;  3OEB A;  3K4Z A;  1GU3 A;  4DUW A;  5JXH A;  1YQ2 A;  4TTG A;  2DCK A;  2XQX A;  5B4N A;  1P8J A;  2QQM A;  5JUV A;  3DEC A;  2LW8 A;  3I3D A;  3P6B A;  3VD5 A;  3CKH A;  4ARX A;  2C26 A;  4QB2 A;  1JYX A;  1W8O A;  3P1I A;  3D3A A;  5A1A A;  3IAQ A;  3VDA A;  2VZR A;  4PT6 A;  4DUV A;  4JKL A;  5I0D A;  4BXS V;  3WNN A;  1W99 A;  3CZJ A;  4MGQ A;  5IFT A;  2DDU A;  3III A;  4QDQ A;  4DUX A;  3VD4 A;  2X05 A;  2W1Q A;  2EIC A;  1TG7 A;  3CDZ B;  4A42 A;  3I3E A;  3GGL A;  1PMH X;  5B4X A;  3IAP A;  5F7U A;  3OGS A;  3PUI A;  3NQH A;  2HYX A;  3VD9 A;  3OGR A;  2WO1 A;  4P08 A;  2W1U A;  4A41 A;  4GWI A;  3HNM A;  2W1S A;  5EJZ B;  1D7P M;  4QX2 A;  2ZXQ A;  1CX1 A;  2QQO A;  1NUK A;  1GMM A;  1DP0 A;  3I3B A;  1ULO A;  2Y64 A;  1K45 A;  1XNA A;  2XHN A;  2OKX A;  2B4K A;  3SKV A;  3I2J A;  1JYV A;  3HN3 A; 
#chains in the Genus database with same CATH topology
 2D5H A;  3I54 A;  2GAU A;  3MF9 A;  1U5X A;  2BBA A;  3CLP A;  4QKN A;  1QJU 2;  1BBT 1;  1XQN A;  5JCT A;  3LA3 A;  1LOG A;  1RUF 3;  2ENR A;  5IHR A;  1AR6 1;  1RXF A;  3WQ0 A;  4RHV 2;  5L36 A;  3B93 A;  4E4S A;  3R6S A;  1RHI 3;  2R32 A;  4LIU A;  3SKJ E;  1VE0 A;  1C8M 1;  3JD7 2;  4A45 A;  2K2S A;  4QU1 A;  2UY9 A;  1VAV A;  1W05 A;  4BQ4 A;  1PGW 1;  2B45 X;  2PHD A;  1VBD 2;  3VHR A;  4FPO B;  5J09 A;  2JDM A;  2LRP A;  2VMI A;  5E8A A;  3T09 A;  1BVV A;  3WR0 A;  4IEV A;  4E4Z A;  3K46 A;  4XUP A;  5FYI A;  1SPP B;  2HH9 A;  4AK3 A;  4NMI A;  1UZ0 A;  1WWY A;  3NV3 A;  3AJZ A;  1ZZ9 A;  3MLL A;  5A1F A;  5DUW A;  1OQE A;  4UAP A;  5FZ9 A;  4IQP A;  1POQ A;  2AR6 A;  2BYV E;  1NCQ C;  3OPT A;  4JVA A;  3I49 A;  5SV5 A;  3E6B A;  3TN9 2;  2ZEW A;  3WP6 A;  3RYR A;  2XVG A;  5FP8 A;  3PTR B;  1X9T A;  4QPG B;  1HB2 A;  4K1Y A;  2X53 S;  2XBO 1;  5A1L A;  3B00 A;  5FWJ A;  4JTO A;  1N1Y A;  3GJA A;  4GWN A;  4LPL A;  2IC1 A;  5C6C A;  1QJU 1;  5FXX A;  1SCS A;  1ZRF A;  2ZML A;  3VZO A;  2GSY A;  2JEN A;  3MIG A;  5LA0 A;  3ZYR A;  4HVQ A;  4BJ0 A;  2BFU S;  2EID A;  1D4M 2;  1TMF 1;  5JWP A;  4BU2 A;  4WM7 B;  3J7H A;  3B3Q E;  5CFD A;  2WNV C;  3GBF A;  1RHI 1;  4JGZ A;  2ZKL A;  1AL2 1;  1HXS 2;  5BNN C;  5A7W A;  3FC0 A;  3ZXL A;  1KFU L;  4LHK A;  4Q4V 3;  4LBL A;  4FTB A;  3VKF C;  5BPX A;  3PME A;  1A8M A;  5FFO C;  3VBF C;  2GN3 A;  1UIK A;  5FPU A;  4CDU B;  1RIN A;  3ZFE A;  1OVS A;  2OX0 A;  4KH9 A;  1F5J A;  2OUJ A;  4RFR B;  2Z79 A;  4Q4X 3;  5FZM A;  4B1M A;  4TZD A;  1IQA A;  1UMZ A;  1NY7 1;  4NHY A;  5H9R A;  3ZMN A;  1SAC A;  1NKG A;  1UY3 A;  1IPK A;  1LB2 A;  5GZC A;  5D2A A;  2ZGT A;  1V6N A;  5DG1 A;  1MPX A;  3E97 A;  1D4V B;  3MF6 A;  4L11 A;  3MV0 1;  2JJ6 A;  3WUC A;  1YRZ A;  5A6X A;  4RSU A;  3ZKU A;  3FN9 A;  4AGG A;  5GLZ A;  3ECQ A;  4TN7 A;  2VOT A;  1OMI A;  2FMY A;  3VD3 A;  3CIH A;  4QXK A;  5KXD A;  3B69 A;  4CP9 B;  4NIH A;  4L9B A;  2DCJ A;  5JPN B;  3FLT A;  1AX0 A;  2A6W A;  4L2N A;  4MHU A;  4P5H A;  4GAL A;  2XH6 A;  2WO7 A;  1LKN A;  2BER A;  2ZOE B;  1ZA7 A;  1CGP A;  1VMJ A;  3KT7 A;  1JHJ A;  4Y26 A;  3ZPY A;  1QIQ A;  3POJ A;  5LRS A;  1VAL A;  4MSV A;  1MVQ A;  4FOV A;  2IFW A;  1VBD 1;  5C4W A;  3NL1 A;  3OPZ A;  4COW A;  1ZZ7 A;  3DL3 A;  3WDU A;  1ASJ 3;  3ACI A;  2B42 B;  3GZU C;  3CJI A;  3VDD B;  1TE1 B;  4M4R A;  3MZH A;  2V4A A;  1YYN A;  2D6O X;  2WAO A;  1KS5 A;  2ZA9 A;  3GZT B;  3FFQ A;  3USU A;  1BEV 2;  4A7Z A;  2W0X A;  2N7G A;  5HPO A;  2KM2 A;  3GF6 A;  5CNA A;  1SHW B;  3ILR A;  1A8D A;  3BOP A;  4CCK A;  3BPZ A;  1GZC A;  1UW8 A;  2VC9 A;  2ZHN A;  1MZ6 A;  3LE0 A;  2BWA A;  1MQT C;  1IPJ A;  4MLO A;  1NYW A;  5FOJ B;  1UXX X;  4XW3 A;  5A33 A;  1XJA A;  3BN6 A;  2YC2 A;  2ZGQ A;  1U5Z A;  4LBQ D;  4QPI C;  4XJ9 A;  5FZ8 A;  3MIB A;  2BWC A;  1DQ4 A;  2ZGO A;  3WZ1 A;  1ENX A;  5LB6 A;  5JPM B;  1W8F A;  2FDK A;  4MGI E;  1ULG A;  3C7O A;  1OBN A;  1H8T C;  3ELN A;  3T2Q A;  4E2G A;  4RHV 3;  3W58 A;  3WF3 A;  1JN2 P;  1I5P A;  1Y9Q A;  2D3S A;  3ENR A;  4FFH A;  2BNN A;  1NX9 A;  1IGO A;  1X36 A;  3GAL A;  4CU8 A;  2WFP A;  2VMC A;  4WVZ A;  4IL7 A;  5JZG B;  2Y6L A;  3Q9O A;  3H9A A;  4Y1Y A;  3W9A A;  5ABJ B;  1HKD A;  5FAX A;  4CPB D;  4CRQ A;  4I02 A;  4OLL A;  3WP5 A;  1DG6 A;  4LHN A;  3NJV A;  3N7J A;  1F15 A;  5FZG A;  4P9L A;  5FZ1 A;  3V0A A;  4Q29 A;  3SIT A;  2MEV 3;  3QBQ A;  1NLQ A;  2JD9 A;  3B01 A;  2DUO A;  2OT7 A;  4L97 A;  4N90 A;  1BCX A;  2ZX0 A;  1FOD 2;  1EV1 2;  1YWK A;  2HWE 1;  3I2H A;  1ZBE 3;  4IGP A;  2R04 3;  2BGP A;  2C9A A;  2WJS A;  2JKB A;  4AFC A;  3B9C A;  2GC3 A;  1AF9 A;  2JIG A;  5HBA A;  4URA A;  4JCK A;  5J48 A;  2VY0 A;  3IDE A;  2Q4S A;  5KHH A;  1TME 2;  3J8F 3;  1YO8 A;  5C4W C;  1KIT A;  1UCX A;  4CU6 A;  1R09 2;  3SH3 A;  3LB9 A;  2GMM A;  4FAH A;  2YG0 A;  2DVD A;  2JX9 A;  2JDZ A;  2K46 A;  4DO0 A;  2ARC A;  2W47 A;  2XVK A;  4IV1 B;  1Z7S 2;  5F5A A;  2RG4 A;  4QPI B;  1LNS A;  2I74 A;  4AOC A;  3O1S A;  2XJR A;  3ZYG A;  3JUU A;  4IET A;  4AI3 A;  1GR3 A;  2UYB A;  3VBR C;  2R04 2;  4YM1 A;  1UZY A;  4LO4 B;  4XMA A;  3ASI A;  2QQV A;  3EHK A;  4IEX A;  3VBH C;  1OKO A;  4C1X A;  1ULD A;  3OD0 A;  1ZYB A;  4XZU G;  5A6Q A;  3PJY A;  2RDQ A;  3WW1 A;  2XR4 A;  3KV4 A;  4HAN A;  1PM4 A;  3IPV A;  5DAW A;  1HB3 A;  4X6R B;  1H9W A;  2YY1 A;  1OA2 A;  1W2N A;  2JDH A;  2YC0 A;  4IEQ A;  2KD7 A;  2WA3 A;  3SNM A;  1RYY A;  1WCQ A;  4OHY A;  1N3Q A;  3JQX A;  4FPL A;  5LCW L;  2QZ3 A;  4LOS A;  2WQZ C;  1JU3 A;  1H2N A;  2A75 A;  2BVB A;  3RJ2 X;  2W46 A;  2ZZQ A;  5FY8 A;  4NPM A;  2LRO A;  3MYX A;  2XDV A;  1RUJ 1;  3LQC A;  4AFB A;  4IV3 A;  1WBL A;  3CU7 A;  3E1F 1;  3C7H A;  4Q8L A;  4XFI A;  5I91 A;  1JI6 A;  1JYN A;  4DRR A;  3VKN A;  2FBE A;  2WBK A;  2J1S A;  4AXO A;  2E7A A;  4FQZ A;  4HN0 A;  2ARX A;  3H1M A;  1DF0 A;  2C5D A;  3L2Y A;  4YFW A;  4YRD A;  4CEW A;  3ZFE B;  1VR3 A;  1EUT A;  1S2B A;  4WM7 C;  5IVV A;  3AYD A;  2YBP A;  3I2G A;  3M70 A;  4QB6 A;  2JDA A;  2O8O A;  4A4A A;  2JIC A;  5JI7 A;  3ZFG B;  4CCJ A;  1AYM 2;  1DGW A;  3HQU A;  4OMC A;  2P37 A;  2RM2 2;  5T5L A;  1UD1 A;  1IQD C;  2QCS B;  3AZY A;  2FQP A;  4GWM A;  3WW2 A;  4CDQ A;  3TWI A;  2F4P A;  2VE1 A;  3MBW A;  4RR3 C;  4TYS A;  1REF A;  5FXW A;  4OHX A;  5DAB A;  2QQU A;  5DAP A;  4YYO A;  3HBZ A;  5K9Y A;  4GMP 0;  2EIB A;  1S0E A;  1XXN A;  4BQX A;  3HT2 A;  4YGD A;  3U4S A;  3ORJ A;  1DDL A;  1IKP A;  1H8V A;  4R52 A;  1NCR A;  5SV8 A;  2B9V A;  2WS9 3;  1PO2 1;  4QPW A;  5EQU A;  5BNP B;  4H7L A;  4BK5 A;  1CAU A;  3N7L A;  4XJA A;  3VDC A;  3MHZ A;  5ACA 1;  1W03 A;  2NMO A;  4J6G A;  5I8S A;  4DEV A;  3GNE A;  1Z0H A;  1DYP A;  3KCY A;  4KL1 A;  5IK4 A;  3IDA A;  3PVN A;  5FY4 A;  1JYI A;  2WNV B;  3LIH A;  5GZE A;  2VL4 A;  1HRI 3;  5T5J A;  3HIF A;  1RUJ 3;  4A3Z A;  5C3P A;  3J9S A;  5JXJ A;  1OOP B;  1JOB A;  5HXM A;  1CPN A;  3N36 A;  3NO8 A;  2VVD A;  2D6L X;  2VXR A;  3O14 A;  2ZHL A;  4BME A;  4FAG A;  1RUG 2;  1RMU 2;  4QWN A;  4AQS A;  5LK5 A;  4ES8 A;  4RFT 0;  1IS6 A;  3T4H B;  3URF A;  1GIC A;  2FCV A;  1GV9 A;  4XET A;  5JOX A;  4WZF A;  4D94 A;  1NY7 2;  5F37 A;  5FZB A;  1QJY 2;  2VEC A;  2A6Y A;  4IW3 A;  4W6W A;  1I5Z A;  1JYT A;  2JKX A;  2Y26 A;  3I2O A;  3JCI A;  5FO8 B;  4PBP A;  2XJV A;  2Y6H A;  1MZ5 A;  4QQ2 A;  4PQQ A;  5JR2 A;  4CPB A;  4GH4 C;  1E5R A;  5C9A C;  3FHI B;  3V0A B;  3RNS A;  1SBF A;  3MDP A;  4JDM A;  5FBJ A;  5LA2 A;  3I59 A;  3FE5 A;  2D43 A;  5FYB A;  1GFF 2;  1UL9 A;  3M7A A;  4AGV A;  5BNO C;  4N53 A;  4UBG A;  4W65 A;  5GLV A;  3WDW A;  5FV3 A;  1PVC 2;  2R16 A;  1Q3E A;  2WWJ A;  3FJS A;  1WW4 A;  2AEZ A;  4LKS A;  4YZ4 A;  3MO4 A;  5FCC A;  4AI8 A;  3I2D A;  1L7R A;  4Q4V 1;  5C3O A;  5FYS A;  1X9P A;  2BQP A;  3DPR C;  2AZ5 A;  3JD7 3;  4X8P A;  2WA4 A;  4H14 A;  4CEY C;  2G9G A;  2WNU B;  5FP4 A;  5EJ3 A;  3ZYB A;  4TLF A;  5AC9 2;  2HWB 3;  4NRQ A;  3T2P A;  2VCA A;  5FJH A;  1VRB A;  2PEL A;  2VTF A;  4K40 A;  5LAS A;  3N4M A;  1C4R A;  5FOB B;  4E2S A;  1KJL A;  4ATF A;  2A70 A;  1CAV A;  3OY8 B;  3CJX A;  2FD8 A;  3ZYH A;  1K42 A;  4FOW A;  1YNA A;  1B35 A;  4AEK A;  3UYJ A;  4MGS A;  5BV6 A;  5KC6 A;  1O3R A;  1SBE A;  1YIF A;  3WVJ A;  4J25 A;  1UWW A;  1C57 A;  3ILN A;  4QMA A;  4RGK A;  4WM8 A;  1KQR A;  5A7W B;  1NCR C;  4XFC A;  2XVL A;  3WNM A;  1C1L A;  2HWC 2;  1OHF A;  2RM2 1;  2W92 A;  3ABZ A;  4KU8 A;  5GKA C;  3WF2 A;  5HCH A;  4MAD A;  3AKS A;  1DGW X;  1FPN 3;  4BB3 A;  1CAV B;  5DDJ 3;  3EB7 A;  1W6N B;  1AR7 2;  2ERF A;  1HRV 2;  1SDW A;  1B35 B;  2H0B A;  4ZXE A;  1RUE 2;  3AMH A;  2KR2 A;  2I07 B;  2RDN A;  4CVU A;  3I8T A;  4CUB A;  4NHK A;  5DG2 A;  1BJQ A;  1QEX A;  5C7G A;  2HEY F;  4A6O A;  1EY2 A;  1NOV A;  1MZE A;  3OBT A;  4XEZ A;  1ND2 B;  3G6J B;  4QM8 A;  1V9U 3;  3VLB B;  4NRO A;  1VBE 1;  1HDK A;  2D3R A;  5DZE A;  5FO9 B;  2BGO A;  4OUM A;  1IG3 A;  3V0B A;  1LHO A;  3M8L A;  4Q8K A;  3SC7 X;  2HWF 3;  2RS1 1;  4JHT A;  1GQH A;  1YQ2 A;  5T5O A;  5JXH A;  3BI3 A;  4TTG A;  1NCQ A;  2DCK A;  1P8J A;  4QKF A;  2DTW A;  5A33 B;  3I3D A;  5JZG C;  2VTX A;  3VD5 A;  3KF5 A;  3OCP A;  4PCR A;  1ND3 A;  3ATG A;  3WHT A;  4FT8 A;  2PAE A;  3LCP A;  2DU0 A;  1W8O A;  3P1I A;  1NLS A;  2GC0 A;  2ZGN A;  3D3A A;  3U1X A;  1Y3T A;  1Q8O A;  3FUQ A;  5A3M A;  4M3C F;  1BK1 A;  1UPI A;  2UU8 A;  1CAX A;  2VZR A;  5LY1 A;  3HR9 A;  3MEP A;  4BQW A;  2B5H A;  1OXC A;  4BXS V;  1VBB 3;  2VXJ A;  4AL9 A;  3VBU A;  3WNN A;  3B02 A;  2Z42 A;  4CE8 A;  3ZYF A;  5IFT A;  3J26 N;  3RZH A;  4Y5T A;  4MGZ E;  4CYD A;  1NT0 A;  4JQT A;  3KWV A;  2ZMK A;  1F9K A;  4NII A;  3WCS A;  1JH5 A;  4AF9 A;  4ATE A;  4CP2 A;  2EIC A;  4Q0U A;  1TG7 A;  1VB2 A;  5FP7 A;  3OJB A;  1PGL 1;  4ZPI A;  3DUI A;  3LWC A;  2VOK A;  1QXR A;  2J42 A;  4IV1 C;  5F7U A;  3OGS A;  2H6C A;  1VBB 2;  2HWD 1;  3PU3 A;  4WVM A;  1LES A;  2D44 A;  1WW6 A;  3QAC A;  4COY A;  4DB5 A;  2SBA A;  4GJZ A;  2EAL A;  5K0U C;  3PU8 A;  3HNM A;  2QE3 A;  4YVW C;  1KXG A;  3WUD A;  2W1S A;  5EP9 A;  2R06 3;  1R1A 2;  4QX2 A;  4OI1 A;  4ZKT B;  4Q4Y 2;  2WT1 A;  2ZXQ A;  3H7Y A;  2MEV 2;  2P17 A;  5AVA A;  1GMM A;  1DP0 A;  4MXW A;  2E63 A;  1VRH 3;  1ULF A;  1FX5 A;  1QOS A;  1EV1 3;  3VZK A;  4DIQ A;  3O1T A;  4WVM B;  3RZL A;  4DIN B;  1O3T A;  1DLL A;  3MID A;  5FRE A;  3SKV A;  1BQP A;  5K7P A;  2DUQ A;  2EAA A;  4IND A;  4Y22 A;  2EVX A;  2CAV A;  5D1I A;  1W9Y A;  1I6X A;  1DYK A;  2P6C A;  3AK0 A;  4JTN A;  3HJR A;  4KBZ A;  5IVY A;  4LO8 A;  4FPK A;  2GC1 A;  4CDU A;  4CCN A;  4XYX A;  5CG8 A;  5DAQ A;  2ZZJ A;  1N1T A;  2LUW A;  4EN6 B;  2PLV 3;  4AAP A;  5L73 A;  4UI9 L;  3R4U A;  1C5H A;  1GUI A;  1OH4 A;  1Q56 A;  1V6I A;  1I9R A;  1S0C A;  2JG9 B;  3T30 A;  1APN A;  4NUB A;  3ZFF C;  3IIA A;  1LTE A;  5IVF A;  3RMY A;  4A44 A;  1FYU A;  2J7M A;  3KVA A;  1SFP A;  2OW4 A;  4ASK A;  2XQR A;  1PIV 3;  1AJK A;  1RXG A;  1S2E A;  2AYH A;  3IDC B;  3SIS A;  3PUS A;  3ZXG A;  4CU9 A;  2VZT A;  3O7O A;  4B1L A;  2JG9 A;  1XB9 A;  3MLJ A;  2YYO A;  2QDN A;  4YM2 A;  1G7Y A;  2DUP A;  1G9C A;  5F8P A;  1LUL A;  3ZIX A;  5FZ7 A;  2P3I A;  1K5M B;  2R06 1;  1F2N A;  4LKE A;  3LZZ A;  5FZF A;  4F7Z A;  1URX A;  4QHB A;  3J7L A;  5B2G B;  4IE6 A;  3KSC A;  5CEH A;  1UOF A;  3F95 A;  1LGB A;  1NG0 A;  1RUF 2;  1NE4 A;  2DTY A;  2JDK A;  1BBT 2;  2ZAC A;  2ZCW A;  3S6P A;  4UW5 A;  4A6S A;  5LK7 B;  4AWD A;  2HEW F;  2R1B A;  4IV1 A;  4A7Y A;  3OBZ A;  3ZPO A;  3C7E A;  4PF1 A;  3VHO A;  1QNY A;  2RS3 3;  1UZW A;  3IDB B;  2YGL A;  1FV3 A;  1WZX A;  1KS4 A;  3QCW A;  4K3U A;  1QJX 3;  4PHZ A;  4QKD A;  5BY5 A;  2QKD A;  4Q4W 1;  1TNR A;  3D82 A;  4Y3O A;  1AJO A;  3NKG A;  1JUI A;  1JOD A;  2WZR 3;  1HIX A;  3K3N A;  3OYW B;  1L7L A;  2ZHK A;  5DAX A;  1W8Z A;  1AR6 3;  2D3P A;  4DY3 A;  5KHJ A;  3JB4 C;  1UU6 A;  1R09 1;  1PVC 3;  3DXT A;  4KWL A;  3ZDS A;  4BIS A;  2VTX J;  5J36 A;  3NAP A;  3PL0 A;  3PIJ A;  4BLI A;  3POF A;  1C28 A;  3OB8 A;  3KCX A;  5A7O A;  2VMG A;  1NCQ B;  2VZP A;  5FPV A;  1ULE A;  3LSD A;  4Y1Z A;  5JIA A;  2GN7 A;  4LBJ A;  4EQV A;  3MIE A;  1AR9 2;  2QUO A;  3MIF A;  3ZYP A;  4M0N A;  3KB5 A;  2WFF 1;  1FMD 3;  1OUR A;  4YVS A;  1UU4 A;  1YC6 1;  3RYP A;  1RUN A;  1FT9 A;  2D7F A;  5ABJ C;  4UXA A;  4YG3 A;  5A7N A;  2GME A;  2J1T A;  1JS9 A;  4LLO A;  1XYO A;  5JVV A;  4YZ5 A;  2PAM A;  5FUN A;  1IS3 A;  3AFG A;  4CCE A;  1PX3 A;  1JYC A;  1ZNP A;  4LBO A;  2X29 A;  3DPR B;  4LO6 B;  4MET A;  1YLL A;  3ZN4 A;  4CCM A;  5CFC B;  1QF3 A;  3FL7 A;  3WDX A;  1QQP 1;  5JIU A;  3RWK X;  1HRV 3;  1ASJ 2;  5J37 A;  3T4V A;  3OEA A;  4XAC A;  2RMU 1;  1IS4 A;  1QU0 A;  1U5Y A;  3A7Q A;  2KA3 A;  4AHZ A;  2OA2 A;  4IUG A;  4AHW A;  1XYN A;  3ZM8 A;  3DGT A;  5BNN B;  1QQP 2;  2YMZ A;  4XVH A;  2A7A A;  2ZGL A;  3PJQ A;  5CFD B;  5F3C A;  3KD4 A;  1NA1 B;  5IK5 A;  1AL2 3;  4JGZ B;  5A3T A;  2VQT A;  4UOJ A;  1L7Q A;  5FMD A;  5TSW A;  4OHZ A;  5KHI A;  2QQL A;  4YW4 A;  1IZ3 A;  4Q0V A;  2DCZ A;  4ZZ5 A;  2AGS A;  2V5D A;  4PLM A;  5A7P A;  3X29 B;  1OA3 A;  2CV6 A;  1MS4 A;  2QQP A;  1Q8P A;  4RS5 C;  2W3J A;  2IXC A;  1SQ4 A;  5CIR A;  2FCU A;  2BNO A;  4ZZ8 A;  5AFB A;  3HPN A;  4XFB A;  2YC4 A;  2GAL A;  4CDW B;  2YZ4 A;  1F4H A;  5FZE A;  1GOH A;  1NQJ A;  3BYW A;  1RUH 3;  3OGJ A;  3MUZ 1;  5FQ0 B;  1HXS 3;  4N43 B;  4CCD A;  4CEW C;  4CUA A;  3S57 A;  3LOI A;  5D21 A;  1HRV 1;  1UX6 A;  5LEK A;  2BP6 A;  1JYW A;  2DBI A;  4WZC A;  5FMC A;  3OPW A;  1UYY A;  4GKX A;  2YU2 A;  4QHZ A;  4XAB A;  3TNQ A;  4BWO A;  1B09 A;  4FTE A;  4R8H A;  3RS6 A;  5GLT A;  3TEX A;  3MW2 A;  3O0W A;  3RWN A;  2XLG A;  1NQD A;  2VOV A;  2ZAA A;  4UWD A;  5FJK A;  1ZA4 A;  3PIG A;  3JZV A;  3POB A;  4HSL A;  5A3N A;  4ZHN A;  3AMN A;  3D0S A;  4Z82 A;  3R0R A;  2RR1 3;  1US3 A;  2CWS A;  3R05 A;  1RUE 3;  1YI7 A;  3OG2 A;  5DMY A;  2QVS B;  1ZBE 1;  5K4L A;  2GZW A;  4LLF A;  1BVP 1;  3WP4 A;  1HQN A;  4SLI A;  2JE7 A;  5A6Z A;  2W94 A;  4B4R A;  1RC6 A;  4BPZ A;  5FK7 A;  5KXB A;  4Z92 B;  4I2O A;  4YGE A;  2WZP P;  4LBM A;  2V09 A;  3A4U A;  1S2K A;  4P00 B;  2VPV A;  2ZBJ A;  3B94 A;  1W2A X;  4XOG A;  5EFU A;  5EYY A;  5FWE A;  3RVH A;  2C4X A;  3USU B;  2WS9 2;  1WLW A;  4NAM A;  4H55 A;  1CAX B;  3WF4 A;  1RVF 3;  2FDG A;  3SEP A;  2HWF 1;  1VBB 1;  2RS1 3;  3T0D A;  2D6P A;  5K0U B;  4QAW A;  2VVF A;  2H6B A;  3RI8 A;  2PA7 A;  4IEU A;  4A3X A;  2ES3 A;  2E26 A;  3DYP A;  4PIY A;  3JQW A;  4NRM A;  3QOP A;  1W6N A;  1NLR A;  1Y4W A;  2VM9 A;  4DFS A;  4MZU A;  4QQL A;  1RTV A;  1M4W A;  3I2K A;  3IKW A;  1JTZ X;  2WS9 1;  2HBU A;  5F5C A;  2XJQ A;  3DN7 A;  5FZ4 A;  2VOX A;  5BNP A;  4NWW A;  4YPJ A;  4C91 A;  4XTP A;  3NNJ A;  1XE0 A;  3L9J T;  2VZ1 A;  2WN3 A;  4U36 A;  5BNQ A;  5L7O C;  1CZT A;  2JB8 A;  3ZXK A;  2HWD 3;  3C7G A;  1I3H A;  3BOD A;  2IZW A;  2V5Y A;  3PUR A;  3L2H A;  1LAJ A;  1GZW A;  1KJR A;  3FHA A;  4FPJ A;  3SEE A;  2QJV A;  4XDP A;  4X8N A;  5F6L B;  1LOE A;  2Q8O A;  4AFA A;  1K5M C;  1V00 A;  4Q5O A;  5IK8 A;  5LAT A;  4XCB A;  2VZV A;  5D8A B;  5APA A;  1S1A A;  4JKM A;  4CSW A;  3BTY A;  3E5X A;  2R07 2;  5FLH A;  3ZSE A;  1K12 A;  1H1I A;  3ETP A;  2QDR A;  4LOT A;  4XF9 A;  2PMW B;  1AYN 2;  1G6N A;  5BNO B;  2HWE 3;  4CUG A;  4AAX A;  2RDS A;  1COV 3;  2XHK A;  3ZFG A;  2RE9 A;  1UKG A;  4DZG A;  1HJF A;  1Q43 A;  1YFU A;  2D40 A;  2WN2 A;  3P3P A;  3Q8E A;  2ZHM A;  1QMJ A;  4LBK A;  1VBE 2;  1OLM A;  1QJX 2;  2R6Q A;  3M4F A;  3GM8 A;  5EYX A;  4OYU A;  1CN1 A;  2Y0I A;  4JHZ A;  3VBH A;  2FDI A;  3VBR B;  2GNB A;  2WRA A;  2DF7 A;  2JE9 A;  1LOF C;  2V73 A;  3CL1 A;  2ZAH A;  2WZR 2;  3AZZ A;  1AHS A;  3PVE A;  3RZG A;  2R0F A;  3POE A;  3ROU A;  4N53 B;  3NWK A;  1PZ9 A;  2RV9 A;  1OLQ A;  2VAU A;  5J98 B;  3W5N A;  2J1V A;  4QGM A;  4TSV A;  3KQ4 B;  1E57 A;  2ZS6 B;  2WLQ A;  2Y8K A;  2F17 A;  2IUW A;  2B39 A;  4LUM A;  1YJK A;  1F4A A;  3LFI A;  3AZX A;  4YW2 A;  3ZIW A;  2WC2 A;  1HRI 2;  2XWB B;  4Q0P A;  1DQ0 A;  5BXX A;  3UKN A;  1ODN A;  2ARA A;  4BLJ A;  1TEI A;  4C0B A;  2MPF A;  4LKD A;  3CJI C;  4XC9 A;  4OUS A;  3UGH A;  2W9X A;  2E31 A;  3V64 A;  4AI2 A;  2W87 A;  3LEI A;  1W2O A;  3ETQ A;  1RUG 1;  2GP3 A;  2RHP A;  2RS5 3;  4KMQ A;  3ZX7 A;  2ORZ A;  4ZS2 A;  1CQ9 A;  4I30 A;  4RQP C;  3V56 A;  4JGY A;  5T5P A;  3WNO A;  3NMB A;  1ZBA 2;  4N43 A;  1HV1 A;  3LF7 A;  3LEG A;  5DDJ 1;  1CX4 A;  2W91 A;  2ETE A;  3DYO A;  4LEJ A;  2Q8C A;  1XYP A;  1QHD A;  1GOG A;  3I2I A;  5IWF A;  1JZ5 A;  4JZR A;  3AP6 A;  4MHR A;  4CDQ C;  2X09 A;  5KBF A;  3LA7 A;  5A7S A;  1RUD 1;  3IBM A;  2IVJ A;  3VDD C;  2IFR A;  1XE7 A;  4QX7 A;  4Q0S A;  1FAY A;  2RS5 2;  2WZR 1;  2RJL A;  2ZGU A;  2R06 2;  3OGV A;  1UPS A;  4KWU A;  4HXC A;  2R0H A;  4ARY A;  3TN9 1;  5DUV A;  4NRP A;  2P5B A;  1O4Z A;  3IPV B;  3HWJ A;  1RED A;  3N7K A;  4GA9 A;  5FK8 A;  1O5L A;  1LOB A;  2WNE A;  4C8D A;  4YM3 A;  1PO2 2;  4BA6 A;  4D69 A;  2PHU A;  3GJB A;  5C8C B;  5HCA A;  2BFU L;  2WFF 3;  3AKR A;  3QH6 A;  3RZK A;  2JD4 A;  3AXE A;  3NRU A;  4GAZ A;  5KHK A;  2HWB 1;  1OVP A;  1ND3 B;  1TQ5 A;  2I2S A;  3H8O A;  4W8J A;  1YEW A;  1A6C A;  5FY5 A;  3VBO C;  4UBH A;  3K51 A;  3M1H A;  1JZ2 A;  1RHI 2;  2VBB A;  3KV9 A;  2BVV A;  1OD3 A;  4N9H A;  4DXS A;  1J83 A;  1YIP A;  2ID4 A;  2VG9 A;  4CUC A;  3A22 A;  1AXY A;  1OOP C;  2DWR A;  4BH9 A;  1AX1 A;  2RJ2 A;  3UET A;  5A6Y A;  2DVG A;  3LD8 A;  1QXP A;  4GB3 1;  1GLH A;  5FBZ A;  1RUD 3;  4FFF A;  5CIS A;  5ISL A;  3HD8 B;  1TME 1;  2IXH A;  3ACF A;  5FTT C;  3THC A;  5E6H A;  2QQI A;  2ZKN A;  1Z7S 3;  3H1Y A;  2NLR A;  1AX2 A;  3SH5 A;  2IWG B;  4BK4 A;  3EBR A;  3USS A;  2PFW A;  3TN9 3;  3HT1 A;  3WXP A;  3O1R A;  1ND2 A;  4AZZ A;  4QX3 A;  4MGK E;  3KQR A;  5FY0 A;  5FZI A;  4W6X A;  5GM0 A;  1ALY A;  4CDW C;  4XFF A;  1GZ9 A;  4FPH A;  2WL1 A;  2VQU A;  1O4Y A;  2RS3 1;  3CQO A;  4OI2 A;  1MR5 A;  2HBT A;  2VR4 A;  1RUD 2;  1T6B X;  1R08 2;  2R49 A;  3DYM A;  4XPV A;  3UV9 A;  3UNP A;  5A32 A;  1T2X A;  3K2O A;  4FXG B;  1VRH 1;  4RN5 A;  4XJW A;  2W08 A;  2WNU C;  1Z78 A;  2FHR A;  4KQ7 A;  2PYT A;  4EN7 B;  3O1M A;  1GQG A;  3ACH A;  3FBM A;  3I4I A;  2FDF A;  4FBF A;  4FPE A;  4IE0 A;  4MV2 A;  4CDX B;  1W6O B;  1ZZB A;  2WQ4 A;  4WVV A;  3RGB A;  2OII A;  3NAP B;  2W68 A;  1RUH 1;  5IAV A;  1COV 2;  5F3G A;  2HWC 3;  1G8W A;  4UW4 A;  1W6P B;  2XQX A;  5B4N A;  1FOD 3;  4RGA A;  2BBV A;  5FQ0 A;  1DQ6 A;  4BOW A;  3ME2 A;  5E89 A;  4MG2 A;  4LO7 A;  4OI4 A;  3CKH A;  4ARX A;  2YUE A;  4CDX A;  3RPQ A;  4DQA A;  3SCF A;  1RUC 2;  4IEO A;  5JDB A;  4HON A;  4XAE A;  5LW9 A;  1QNW A;  1RUI 2;  2XWJ B;  3ON7 A;  4BQY A;  1PGS A;  4O7X A;  1WCS A;  4JKL A;  5I0D A;  4AHX A;  4Z8B A;  4HSJ A;  4AFM A;  1UAI A;  4IES A;  1QDO A;  3DPR A;  4YGB A;  4XFH A;  5I0R A;  4AI9 A;  4AVA A;  3KHB A;  3W20 A;  2HKX A;  4ZU4 A;  2RS3 2;  4QDQ A;  4AQ6 A;  2UY8 A;  1CVN A;  4UFJ A;  4DUX A;  2YRO A;  3VD4 A;  2OYZ A;  4F3J A;  2DUR A;  4A42 A;  3I3E A;  4PLN A;  3MFC A;  3IMN A;  2JDP A;  4IE5 A;  4AYU A;  3E5U A;  4TLG A;  5KHG A;  3OUJ A;  3VZM A;  1DZQ A;  1AR6 2;  3E6D A;  2HYX A;  2RR1 2;  4HVR A;  3VD9 A;  3OGR A;  1WUV A;  4JDO A;  4P08 A;  2W1U A;  1STM A;  1Y9M A;  2BNM A;  3M3E A;  3ZXF A;  4GWI A;  1WCK A;  3AMQ A;  2D93 A;  5F3I A;  5EHD A;  4XDO A;  1AXK A;  2CGN A;  3ZYI B;  4YW7 A;  2VH9 A;  4IEY A;  4FO9 A;  3ZXJ A;  1CX1 A;  3N35 A;  2NQY A;  2QQO A;  1U0A A;  1J58 A;  1TNF A;  3KF3 A;  4NVP A;  4URT A;  3FUO A;  1FAT A;  4QHO A;  5D8A C;  5IK7 A;  2B4K A;  4Y4Y A;  2G1M A;  3M3O A;  4PIX A;  3THT A;  1ZZ8 A;  1LGC A;  1OI6 A;  1VP6 A;  4HKW A;  1GWK A;  1IKQ A;  3ZSK A;  1XC6 A;  3I97 A;  1QDC A;  1UY0 A;  5CVR A;  3NV4 A;  4FOY A;  5DAV A;  5C8C A;  4OMD A;  3U4X A;  3N9M A;  1LHW A;  4P02 B;  3VZL A;  5A3P A;  2VVE A;  5JMC A;  1IG0 A;  1LEC A;  5I0S A;  1PIV 1;  1PMI A;  1RIT A;  4NE9 A;  5FZO B;  1UKR A;  2WT0 A;  5H9Q A;  3E5Q A;  1SFY A;  2GND A;  2VQA A;  2ADE A;  1W8U A;  2EXJ A;  2WLP A;  3H3U A;  2NM1 A;  1W8N A;  1OQD A;  2JDN A;  1NAE A;  2WO3 A;  4GJY A;  5EJ1 B;  2ZMN A;  3H0O A;  1OC1 A;  4CP9 A;  4D0Q A;  3KVB A;  2IVI B;  4D8M A;  5CAD A;  4HL0 A;  1SLT A;  1UU5 A;  1XPW A;  4CA9 A;  3JBG 2;  1Y9G A;  3ZSJ A;  1KRI A;  4H7M A;  2MEV 1;  1OQ1 A;  1QQP 3;  2B8M A;  5E1R A;  1M06 G;  1UXZ A;  2TNF A;  2W95 A;  1MEC 2;  4GKY A;  3KLS A;  3C7F A;  1H4H A;  4KWK A;  3RZM A;  1AR8 2;  4WVW A;  1BXH A;  4CTE A;  1CAW A;  4IEP A;  2XON A;  1VBA 3;  4K20 A;  4Q4V 2;  4AQT A;  4KNC A;  5F9T A;  1CES A;  2ZEZ A;  3LKJ A;  4FQ4 A;  1WKY A;  4QPG C;  1V0A A;  4CU7 A;  3UK9 A;  5C8W A;  1RUC 1;  4XQ4 A;  4NIA A;  5JXG A;  3RG0 A;  3VN4 A;  4ZU5 A;  4HK8 A;  1HQL A;  4P9W A;  4UW3 A;  3UKT A;  2ZEY A;  1SG3 A;  1DFQ A;  1D4M 1;  1TMF 2;  3GZE A;  1RUI 1;  2DVB A;  1NA1 A;  2Q1Z B;  3MI8 A;  1YUD A;  4PI2 A;  4BQ5 A;  4QX0 A;  1UY4 A;  1WA4 A;  2EIE A;  2OPK A;  2ZJC A;  1W0O A;  4DXT A;  5K0U A;  1XE8 A;  1EAH 2;  3NV2 A;  4CZS A;  3A23 A;  4AHY A;  1YCI A;  4LJH A;  2JG9 C;  2DVF A;  3NJZ A;  2OXB A;  4LTA A;  5FXZ A;  3FBY A;  4C0H A;  2XUE A;  4YVS B;  2PQS A;  1KGY A;  2XXZ A;  1UOG A;  3H3Z A;  3RI9 A;  3VBF B;  1PGL 2;  1Z7S 1;  2WO2 A;  2J1E A;  3RMX A;  1NXM A;  2EA7 A;  4D7T A;  2QQW A;  1W6P A;  3HNB M;  4V1P A;  3MLK A;  3M3Q A;  1Q8S A;  3VBH B;  1AVB A;  3D6E A;  4ERO A;  2XLF A;  3QLQ A;  3Q8A A;  4ZU7 A;  3S7E A;  1GP6 A;  2AEY A;  1O3Q A;  4K7J A;  3THP A;  1R1A 1;  1WBF A;  3Q8B A;  5F1R A;  4MXV A;  5C70 A;  1OF4 A;  4IGO A;  2AC1 A;  4LE4 A;  4Y5Z 0;  1JZ7 A;  3NV1 A;  1JZ3 A;  3N9O A;  2Z2S B;  2ATF A;  5A32 B;  1CIW A;  1X7N A;  4PDW C;  2HEV F;  2QZ2 A;  3B5L B;  2PN5 A;  3OUI A;  2ZX3 A;  4BDV B;  1D0G A;  5FYT A;  4CXW A;  4ZON A;  5CA6 A;  3SXW A;  1UOB A;  5KXC A;  4EWD A;  5C33 A;  5FRA A;  1HN0 A;  3PUQ A;  3WF1 A;  1MZF A;  1IS5 A;  2VW0 A;  2NP0 A;  4BQ2 A;  5IT6 A;  3TRS B;  1S0G A;  1UZZ A;  2CL2 A;  3U07 A;  3FHQ A;  3F2Z A;  1AR8 1;  2D6N A;  3S7I A;  3VBR A;  1WME A;  1BK0 A;  5GLW A;  1HV0 A;  1W8W A;  1AR9 3;  3GXU A;  4O65 A;  4S2D A;  1MS5 A;  1W0N A;  4QPG A;  1CJP A;  3OD4 A;  5FLJ A;  4XF3 A;  2QFE A;  4I09 A;  5G04 L;  1PK6 A;  2ZAB A;  1SZB A;  2P3K A;  2W39 A;  1K5M A;  4QDR A;  5G05 L;  1CAU B;  1PO2 3;  5GZG A;  1RVF 1;  1VAM A;  2VW2 A;  2QNK A;  5IW0 A;  2BZD A;  2X8K A;  4OHV A;  4NN0 A;  2VD7 A;  2X5I C;  3D8C A;  2YFZ A;  3ZMO A;  5LY2 A;  2EIG A;  4MYE A;  1J84 A;  3K77 A;  4HET A;  4XIL A;  3WX5 A;  1UIJ A;  4E2Q A;  1HRI 1;  4COV A;  4H3W A;  5AFE A;  2WYS A;  1YJL A;  2JB4 A;  4QT6 A;  1O4T A;  2UWB A;  3CZU A;  1PVC 1;  1QJU 3;  1OPM A;  3THD A;  3NAP C;  4YLZ A;  4OFG A;  3T1L A;  4LO5 B;  2ZGK A;  4JAA A;  2G9F A;  5ERL A;  5K8S A;  3RYK A;  2H0V A;  2WNO A;  4TXW A;  4GWJ A;  4UFI A;  4WM7 A;  3BTA A;  1MS3 A;  4QD2 A;  3O12 A;  1GWL A;  1ZBA 1;  5I93 A;  4OVE A;  2EF6 A;  3P3N A;  5I0T A;  1H8T B;  2EXK A;  4DNY A;  2VNR A;  5AC9 1;  3TEW A;  3OUH A;  4Q4W 2;  1JZ6 A;  3JU9 A;  3ITQ A;  4FCA A;  4E9K A;  1VPH A;  3NKT A;  3JB8 A;  5FYU A;  2VUA A;  1G9F A;  4B7E A;  1FMD 2;  2FDJ A;  4KGQ A;  1BHG A;  1S0B A;  2Z69 A;  2WYF A;  4Y5S A;  5FZ6 A;  3SQO A;  4RS5 A;  4AEJ A;  1KD7 A;  3HMY A;  3HOB A;  4OI0 A;  3DCQ A;  4JGZ C;  3PNA A;  4LBQ B;  2W52 A;  5BNN A;  4Q4X 1;  2VGD A;  3WG3 A;  2ZGS A;  4ES9 A;  2DU1 A;  4GH4 A;  2WZE A;  4Y1X A;  1W04 A;  2VJX A;  1R08 3;  2O14 A;  2WKK A;  4Y20 A;  5FYC A;  2XBO 2;  4AVB A;  3AYE A;  2RM2 3;  4AVV A;  4HPK B;  4RS5 B;  4YW1 A;  2ILM A;  4S2F A;  1VBA 2;  5FMB A;  4ZS3 A;  5CYY A;  1PNG A;  2EXI A;  2WFF 2;  1HN1 A;  2Q1F A;  5L19 A;  3KT1 A;  5T55 A;  4Q4Y 3;  5BUV A;  4GQ7 A;  3RZJ A;  4LK6 A;  1W3V A;  5ACA 3;  3I7D A;  5C4W B;  2DCY A;  1GBG A;  4NO4 A;  3VKL A;  1SDD B;  2YBS A;  1F8V A;  1DYO A;  1ENQ A;  2WDB A;  3VBU B;  3H8X A;  3H1W A;  1D2Q A;  1BYH A;  1UYX A;  1V9U 1;  4R9D A;  5FZK A;  4D3W A;  5JMO A;  3CMG A;  3MW3 A;  1W3X A;  1W2T A;  2JWP A;  2XBO 3;  3ZO0 B;  2X5I A;  4AI1 A;  2O8Q A;  3GZA A;  1EAH 3;  4L92 A;  4Z07 A;  1GZW B;  3EMR A;  3LDK A;  1WA6 X;  3OTF A;  4GMP 1;  2PHT A;  4OUL A;  2NYY A;  3HAG A;  1N1V A;  1J3P A;  1WW7 A;  1H2K A;  3B7M A;  4CDQ B;  5IVB A;  4K1Z A;  2R07 1;  5FP9 A;  4UFL A;  1DQ1 A;  4KG8 A;  2RMU 2;  1RIR A;  2XG3 A;  5T3N A;  4AED C;  1HJG A;  1CD3 G;  1OD5 A;  4WV8 A;  5IJR A;  2BOI A;  2OZ6 A;  4PIZ A;  3B9I A;  4IE4 A;  1W6Q A;  3ILF A;  2JEM A;  4JKK A;  4M01 A;  1W9W A;  4HOO A;  4Q4X 2;  3T08 A;  5GJ6 A;  3POI A;  1X50 A;  3J7N A;  1N47 A;  1UF2 C;  3RRD A;  3WIN E;  1VBE 3;  3V0B B;  3O0X A;  2AEN A;  1QJE A;  4Y1U A;  3ZN6 A;  2V4V A;  4JDN A;  4NPR A;  2RVA A;  2DCT A;  1E5S A;  3LEM A;  2VZ3 A;  1QJF A;  3PUA A;  1KDK A;  1JHN A;  2WR9 A;  2P3J A;  3FLR A;  1DGR A;  1FMD 1;  4GXL A;  4UF0 B;  2G4I A;  2HYK A;  3UES A;  3PLQ A;  1C3H A;  1SPP A;  3QH7 A;  5CKQ A;  1ZRC A;  3KS7 A;  5LBE A;  3WY6 A;  2JE8 A;  3O1V A;  4IEW A;  5FPZ A;  4QGL A;  5AVP A;  1AYM 1;  1XRU A;  5IAX A;  1S55 A;  2VMH A;  2XKO A;  3ACG A;  1IHM A;  2P6H A;  4V2W A;  4XE9 A;  1V6J A;  4V2V A;  4HMZ A;  3ES1 A;  2YGM A;  1MS9 A;  1QOT A;  3I59 B;  5FZL A;  3ZR6 A;  2QQJ A;  1WW5 A;  4JRL A;  2GNM A;  2XB6 C;  4O9E A;  3VKM A;  3T0A A;  5EZW A;  3R4D B;  5C3Q A;  2BU9 A;  1HW5 A;  1JZ4 A;  3VGI A;  1LOD A;  2GH8 A;  2ET1 A;  4FVV A;  1NE6 A;  4EV0 A;  4OQ8 A;  4IE7 A;  1SFN A;  1AR7 3;  1O6U A;  1Q5O A;  2OZJ A;  4IER A;  4YZ2 A;  5FYY A;  2ORX A;  2YB7 A;  3GCX A;  4XUO A;  4EE2 A;  1V6K A;  1WMF A;  3EXU A;  3LPF A;  4FPC A;  4DS0 A;  5IFP A;  2A6Z A;  4ZXK A;  1W8H A;  4XBL A;  4WM8 C;  2BUK A;  1GP4 A;  4Q2F A;  3T3Y A;  2BEO A;  4EZH A;  5CU1 A;  5C9A A;  1PM7 A;  4M0H A;  1G9A A;  1ENR A;  1YQC A;  4I3G A;  3RFR A;  5JR7 B;  3WDV A;  4X6Q B;  2E32 A;  4EWA A;  5BNO A;  4LUK A;  4QB1 A;  3AKP A;  3UL2 A;  2WQ8 A;  5EWS A;  1V9U 2;  4EZ4 A;  2A3Y A;  5L9V A;  2Q1M A;  4XMI A;  4XTM A;  1ZX5 A;  1OF3 A;  1X82 A;  4LXL A;  2Q0A A;  3VZN A;  5FXV A;  1OA4 A;  3POG A;  5FZC A;  2IXJ A;  2VME A;  5CZK A;  4C1W A;  4CEY A;  1OLM E;  2YFU A;  2JG8 A;  3WG4 A;  5DZF A;  2UWA A;  4BMB A;  4BM8 A;  1MS1 A;  4DY5 A;  1D4M 3;  2XLA A;  4M00 A;  1RUI 3;  3MPP G;  4XUQ A;  4GH4 B;  4EWE A;  4JX0 A;  2GP5 A;  5LRR A;  4FTS A;  4COU A;  2Z4F A;  2TUN A;  4FPY A;  1IPS A;  1FOD 1;  2HWE 2;  3BU0 A;  4RQP B;  3AVR A;  4N43 C;  1SLA A;  1HX6 A;  4CEW B;  3O1O A;  4R4X A;  1XBF A;  1WLC A;  2OS2 A;  5HI0 A;  3TEZ A;  1LOF A;  2AAC A;  2Y6G A;  4UFK A;  5F3E A;  2WAA A;  4FP2 A;  1PX4 A;  1D2S A;  4XZP A;  1FI2 A;  4QGN A;  4QM9 A;  2YU1 A;  4FFG A;  1N3P A;  1RUG 3;  3UGG A;  1V6L A;  1UNB A;  4QPY A;  1NXD 1;  2OUH A;  1W6M A;  3V65 A;  2PTM A;  5CFC A;  5DN2 A;  1AYN 1;  3AP5 A;  5E16 A;  5CBL A;  1QJY 3;  2JIJ A;  1HB1 A;  4LE3 A;  1W39 A;  1F35 A;  3ZFF B;  4ET7 A;  3GYD A;  5IYY A;  1DLC A;  2R04 1;  2ZGM A;  3VBO B;  4RD7 A;  3JBG 1;  1MS8 A;  2XGX A;  1BZW A;  4P9J A;  5DPN A;  3H50 A;  1NCR B;  2VBD A;  3ALQ A;  3DEM A;  2XJS A;  3NJY A;  1MEC 3;  4R9C A;  3SHR A;  3U78 A;  3WF0 A;  4B4Q A;  2ZGR A;  3FMG A;  4YFZ A;  2YXS A;  4DXR A;  1S4C A;  2HWF 2;  2Y33 A;  2Y6K A;  1DQ5 A;  4HPK A;  2C6S A;  4QX1 A;  2J1A A;  2OQ7 A;  5GZF A;  5DZG A;  2FMD A;  3J4U H;  4K21 A;  4Q27 A;  3VHP A;  2ADD A;  2VZS A;  2IXI A;  1POV 1;  2OQ6 A;  3ZXA C;  4LHL A;  4CDU C;  5L7O A;  2CWM A;  1KEX A;  4BIO A;  2DVA A;  4AG4 A;  1BKZ A;  2CAU A;  4P9I A;  1YQ8 A;  5FY7 A;  3AFK A;  2A73 B;  1ODM A;  2BGC A;  1OFN A;  1PMJ X;  4AQ2 A;  3A0K A;  1YXW A;  1AL0 G;  1C8M 2;  1PZ7 A;  3JD7 1;  2NZ9 A;  4KG0 A;  2HWB 2;  3PUH A;  3NNM A;  3HQR A;  2UYA A;  5A70 A;  1FV2 A;  4EJR A;  3BGA A;  2VZQ A;  1PGW 2;  5JOW A;  3H8U A;  3VBS C;  4OQ9 A;  4JRA A;  3OBA A;  4M3C E;  1LRH A;  4FPG A;  4DXZ A;  2Q30 A;  3VD7 A;  1ENS A;  4LR4 A;  3S5A A;  3O1P A;  4IV3 C;  1BEV 3;  1PVX A;  2PLV 2;  2BV4 A;  1GU3 A;  2XML A;  3OEB A;  3VBF A;  4DUW A;  5ACA 2;  1RMU 3;  4XJ8 A;  3ZFE C;  3MPB A;  4CCL A;  4NOT A;  5C5T A;  3FWE A;  1WGP A;  1ZBE 2;  5IUQ A;  1POV 0;  4U2A A;  3D4K A;  1W90 A;  5FZO A;  4Y1V A;  2Y6F A;  2C26 A;  2ET7 A;  4I01 A;  4KBB A;  1RVF 2;  2D5F A;  5FKB A;  3U0Z A;  1GP5 A;  1EPZ A;  2UUR A;  2WII B;  3AKT A;  3OY8 A;  5A1A A;  1TME 3;  3J8F 2;  1BMV 2;  3BPS A;  2FDH A;  3DKW A;  3VDA A;  4D7Y A;  1EPW A;  4XJU A;  4PT6 A;  4YVW A;  2QTW B;  2WNU A;  4UF0 A;  4AI0 A;  4JQR A;  1W99 A;  5CFC C;  1DCS A;  4P9Y A;  3KHC A;  1R1Z A;  2DDU A;  5FYM A;  3AYC A;  5ANN A;  5T52 A;  3NNL A;  4XF4 A;  1QH6 A;  1O5U A;  5AC9 3;  3CF6 E;  3AKQ A;  4BQ3 A;  4QQH A;  3H42 B;  4R4Z A;  3CDZ B;  3WT3 A;  3AX4 A;  5DXD A;  3WHU A;  1HXS 1;  4XAA A;  4ASM B;  2VUC A;  1RUJ 2;  1RUO A;  4RA0 A;  2EAK A;  4CDX C;  3IWZ A;  3NQH A;  2Q8D A;  3GBW A;  3T1M A;  4PQ9 A;  1QWR A;  2A6V A;  3IZO A;  4P14 A;  2VUJ A;  3H7J A;  3SCH A;  3WQ7 A;  4YVS C;  5LBC A;  1D0H A;  1ONA A;  1XOY A;  3AZV A;  5E88 A;  1QGL A;  5EJZ B;  1D7P M;  4CCC A;  3NNF A;  5FP3 A;  4P9X A;  1DIW A;  1UZV A;  4D6S A;  2Q8E A;  1L3J A;  3C3V A;  5F39 A;  3KV5 A;  5CFD C;  4I0W B;  2F6B A;  1IOA A;  1TZO A;  1XNA A;  2GNT A;  1UO9 A;  2IXK A;  2R1D A;  2Y64 A;  3AP4 A;  3MGU A;  2OKX A;  3VB9 A;  3M3I A;  5LBF A;  4XBQ A;  1YI9 A;  3I2J A;  3K3O A;  3LFM A;  3CBN A;  1JYV A;  4Q4Y 1;  4YM0 A;  2NN8 A;  1ZRR A;  1BLZ A;  2OPW A;  3FZ3 A;  1LU2 A;  1HQW A;  3ZXD A;  2HJI A;  4UYB A;  3N9N A;  1SLB A;  3LDR A;  4E8C A;  5C9A B;  4KWJ A;  4Y20 B;  1W6Q B;  1VBC 3;  3BIW E;  1J1L A;  1HLC A;  5FZ0 A;  2Y0O A;  5T50 A;  3K48 A;  3KGZ A;  4N7I A;  5DQ0 A;  2JXA A;  1LHV A;  2PHF A;  4MUV A;  4OZO A;  2RR1 1;  5EV7 A;  3VBS B;  3LPG A;  4Q0Q A;  1H8T A;  3BOW A;  4XF0 A;  1OLR A;  2O0O A;  2WT2 A;  1CIY A;  1R08 1;  1F31 A;  2RMU 3;  2WWS A;  3CNA A;  4FFI A;  3T2O A;  1ZM1 A;  4LHS A;  4Q4W 3;  1CWP A;  3AVS A;  4B4P A;  4BE3 A;  1DU3 D;  5A7Q A;  4O61 A;  4CEY B;  2C24 A;  1RL3 A;  1WMD A;  2DBN A;  2VNV A;  3I2F A;  4HZF A;  3AXD A;  4ITC A;  1YFY A;  3S0M A;  4XUN A;  1EV1 1;  2VMD A;  4GD4 A;  2NMN A;  3N9Q A;  4LKF A;  1VBC 2;  4RL7 A;  4Y33 A;  4UW6 A;  3NJX A;  4D7S A;  1ZVF A;  5J7M A;  3CO2 A;  3GHM A;  3HVD A;  5FZA A;  4C90 A;  3I3M A;  2IXL A;  1KDM A;  3TBD A;  1MVE A;  1Q8Q A;  1W06 A;  5C8C C;  3D5O A;  3ST7 A;  5IVE A;  5FMO L;  2TBV A;  5A3L A;  4K9S A;  3O1U A;  1AR9 1;  1QY4 A;  4EN8 B;  1CON A;  1ND3 C;  4GB3 2;  1EAH 1;  1CR7 A;  1DGL A;  5GLU A;  3BTZ A;  3DXU A;  4LIT A;  5F6K A;  2P3Y A;  3WD5 A;  4YW3 A;  1ND2 C;  3S5Q A;  4GUL A;  3WSO A;  2Y34 A;  4HG6 B;  4UFM A;  2J22 A;  4CDW A;  3GDB A;  4XBN A;  4NJ4 A;  3KT4 A;  4AFD A;  2VZU A;  3O0V A;  1PIV 2;  3KM5 A;  4O9G A;  5C5U A;  4AR2 A;  1TVG A;  3RJR A;  5FKC A;  2WZ8 A;  2YBK A;  1QXJ A;  3ZN5 A;  3TOJ A;  4FSJ A;  1VIW B;  1J3R A;  1UY1 A;  2VNG A;  4E8D A;  3LGR A;  1NZI A;  4XUT A;  1MAC A;  1MEC 1;  2J1U A;  4UFH A;  1MQT A;  5FMO S;  5I8Y A;  3K75 B;  5JXI A;  1H30 A;  4OCT A;  4BXF A;  1ZZC A;  2BW8 A;  3P5B A;  2BPA 2;  1BBT 3;  2GU9 A;  1Q8V A;  2B7Y A;  1A3K A;  1LOC A;  1OUS A;  4M4P A;  4S2G A;  4LMF A;  1REE A;  1FNZ A;  2CDO A;  4AGR A;  2HWD 2;  3EO6 A;  5JZG A;  3WG2 A;  4XF1 A;  1GNH A;  3UJQ A;  4YZ1 A;  1CZV A;  1COV 1;  4BYY A;  2A3W A;  1JOP A;  1LJ7 A;  2R7E B;  2VCB A;  1SLC A;  2VQ0 A;  1S0D A;  2HWC 1;  3LA2 A;  3GCW A;  4RHV 1;  1EYB A;  2BDR A;  3MUY 1;  5HCB A;  4EN9 B;  5JOZ A;  1H0B A;  2CY6 A;  4W4Z A;  4DPN A;  4XFG A;  2CGO A;  4XXA A;  3PVB B;  5FR3 A;  3BAL A;  4RYD A;  4ZY9 A;  4Z1V A;  3MIC A;  4KGG A;  3EJK A;  1S0J A;  3E6C C;  4LBN A;  3W5M A;  1X8M A;  5FPX A;  4R9A A;  3VL9 A;  1JUH A;  4Z2A A;  4XIO A;  1RGS A;  3VHN A;  3GBG A;  4ISR A;  5KC5 A;  3SCG A;  4Z2W A;  1C1F A;  1JOJ A;  5FPB A;  1E5H A;  1OT5 A;  3DKQ A;  1DHK B;  5EIY B;  1GNY A;  2XJU A;  4K8R B;  1F5F A;  4KU7 A;  4M3C B;  2X10 A;  5BNP C;  1VBA 1;  5FZH A;  5KR7 A;  3APB A;  4AED B;  1W2U A;  3ZYJ B;  3N7M A;  1NZC A;  5CKN A;  2E7Q A;  3WDT A;  1XNC A;  4QKB A;  4QPI A;  4AVT A;  5ABJ A;  3BTX A;  2CNA A;  1W9S A;  3U14 A;  1G9B A;  1VLN A;  5FY9 A;  3UGF A;  2JDY A;  4R9B A;  1W6M B;  4RR3 A;  1GYK A;  5JSR A;  1SBD A;  4HBN A;  3C8X A;  4YVW B;  1DBN A;  2G19 A;  4JGY B;  1OSG A;  1NA1 C;  2CYF A;  2WWU A;  2PQQ A;  1TMF 3;  2E33 A;  5LA1 A;  5F2W A;  5H9S A;  4PDW B;  4J1W A;  3HEI A;  3FX3 A;  5JSP A;  5LA9 A;  2QBX A;  1UYZ A;  1FXZ A;  1ULC A;  1O3S A;  1ACC A;  1H4G A;  4YSF A;  2D6K A;  5D8A A;  3HNY M;  3TB0 A;  4XQW A;  2P34 A;  3WLU A;  5F32 A;  5FUI A;  3WQ1 A;  3AP9 A;  3LIG A;  1QJX 1;  3NW4 A;  4W50 A;  1EUU A;  4AVS A;  5I8T A;  1VB4 A;  2WSV A;  3JXS A;  4IGQ A;  1YQ5 A;  3KGL A;  4HLT A;  5HV0 A;  1PO1 2;  3OGG A;  2YDE A;  4Y24 A;  3UJO A;  2D6M A;  4N9I A;  1H2L A;  2ARE A;  2P4E A;  1AXZ A;  1T6G C;  4COZ A;  1GAN A;  1PK6 C;  1ST8 A;  2JG8 B;  2VCC A;  3MFA A;  4YG6 A;  4IV3 B;  3AP7 A;  3C2U A;  3K4D A;  1V70 A;  2VU9 A;  3PMS A;  3BVC A;  5IVC A;  1QKQ A;  1ZRE A;  3MV1 1;  2PHX A;  5GZD A;  3T0B A;  3ZN6 B;  3ZOI A;  5JI9 A;  1W0P A;  2ZX2 A;  3A21 A;  1JU4 A;  1UY2 A;  4CCO A;  1GWM A;  5CB7 A;  2Y60 A;  2F4L A;  1RB8 G;  4B3N A;  5CG9 A;  1WMX A;  3OBR A;  1GOF A;  2VMF A;  4YG0 A;  1LED A;  4QXB A;  1C8M 3;  4QU2 A;  1AYM 3;  1QOO A;  4LT5 A;  1H6X A;  4RQP A;  2RJK A;  2YPD A;  3KMH A;  1OFS A;  4QQP A;  3HBK A;  1AR8 3;  4XXP A;  3TNP B;  1RJ8 A;  3WNK A;  3VDB A;  3VBO A;  1YFW A;  4GB3 3;  3LOB A;  4HN1 A;  3ZKY A;  2NPI A;  1PZ8 A;  3AJY A;  1HB4 A;  3Q8F A;  3AYA A;  3KZ4 C;  1LEM A;  4TWT A;  5HV4 A;  4N7U A;  5F2S A;  2VO5 A;  4XUR A;  3VDD A;  2QQN A;  4NR1 A;  4OZX A;  5L9R A;  1RUF 1;  2W1W A;  4KI5 M;  3I3Q A;  4I0A A;  2KXL A;  1AR7 1;  1CZS A;  4MXW B;  4BQ1 A;  1DQ2 A;  5J1X A;  2GC2 A;  1ZBA 3;  4OHW A;  4IDZ A;  1LHN A;  1PK6 B;  1WD3 A;  2AH2 A;  2D97 A;  1WCU A;  1Y43 B;  2DFC A;  2JG8 C;  2W5F A;  5DUX A;  5L9B A;  3TAY A;  3W21 A;  3N3H A;  4FPF A;  3OSD A;  2E6V A;  2XJP A;  3UT0 A;  4YGC A;  2B9U A;  1SEF A;  3HN1 A;  3ZVX A;  2BRT A;  2FZ2 A;  2XJT A;  3RDI A;  1QJZ A;  1EP0 A;  1N3O A;  2VW1 A;  3MW4 A;  3OYW A;  4NAO A;  3VKO A;  1H1M A;  3S30 A;  5L7O B;  4PLO A;  3AM2 A;  5LBB A;  1H9P A;  2DYC A;  4DEQ A;  3WDY A;  3ZR5 A;  1R09 3;  4S2H A;  1LHU A;  2ZGP A;  1W6O A;  2WIN B;  2Z5W A;  4QX5 A;  5F5I A;  2EXH A;  3BB6 A;  2B46 X;  5FDB A;  4DMI A;  1ULP A;  1SLI A;  5C3S A;  4P9G A;  4HKL A;  1XNK A;  4MO3 M;  3UKV A;  1R1A 3;  5IAT A;  3BKZ A;  3CEW A;  4XIK A;  1LGN A;  3PDQ A;  1OOP A;  3R4S A;  3WV6 A;  1VMF A;  1YHF A;  1VRH 2;  4SBV A;  1PO1 1;  1LOA A;  2UWC A;  4YWA A;  4MVT A;  2ARB A;  2E53 A;  3OOX A;  3K4A A;  1VBC 1;  1XNB A;  4G3Y C;  4I3P A;  3M2M A;  2PAK A;  3WNP A;  1LEN A;  1RMU 1;  2XOM A;  1XSQ A;  3IB3 A;  3N9P A;  4N53 C;  2BOJ A;  1VJ2 A;  1PHM A;  3WCR A;  4LNV A;  2XL9 A;  4QXH A;  4LUL A;  5EXO A;  4LBQ A;  4NWV A;  3WOG A;  3WEZ A;  4HK9 A;  4QDS A;  1U5I A;  3GHN A;  1JBC A;  3LAG A;  4K6B A;  5F5Q A;  4GMP 3;  4NHM A;  1RUE 1;  1O8S A;  4F8A A;  3WQB A;  1W9T A;  2R07 3;  3TEY A;  1YFX A;  2VCM A;  2ZTN A;  1RJ7 A;  5H9P A;  5CAZ A;  3BUC A;  1OPO A;  3CJI B;  4LA3 A;  1DZT A;  2WAB A;  1QJY 1;  4L99 A;  2ZX1 A;  5FO7 B;  4BHP A;  3J8F 1;  4IXL A;  1AYN 3;  1O7F A;  3POW A;  5J3U A;  3ES4 A;  4GIQ A;  1GQP A;  4HVO A;  4EYU A;  2A3X A;  2LAL A;  1LR5 A;  2V72 A;  2ZPX A;  4A2U A;  1UMI A;  4BZ4 A;  2RDR A;  2VUL A;  2K0G A;  2Y6J A;  4CP1 A;  3AZW A;  5JLV A;  1UQX A;  4JV4 A;  1RUH 2;  1VBD 3;  1UX7 A;  1S0F A;  4LQR A;  2YHJ A;  1JZ8 A;  5LEJ A;  1WLD A;  1AZD A;  2RS1 2;  5CKM A;  1FPN 1;  2P1B A;  4H2A A;  3RQ0 A;  3WP3 A;  1J59 A;  2GMP A;  5LWB A;  1X33 A;  5FPA A;  3DV8 A;  1G86 A;  3NNG A;  4MGY E;  3KCC A;  4QXC A;  4IEZ A;  1XNT A;  1ZZ6 A;  5FYV A;  3NST A;  1PO1 3;  5T54 A;  2CTV A;  4JC1 A;  3D0J A;  4Y4R A;  2CGP A;  4WM8 B;  4NPL A;  3WG1 A;  1US2 A;  4BIF A;  4MOA A;  4N8M A;  3LDB A;  3O5S A;  1U12 A;  2A1X A;  4DRV A;  2A6X A;  3IMM A;  1A34 A;  2C0Z A;  2CDP A;  1OUX A;  1UN1 A;  5FLI A;  4AW7 A;  1UMH A;  4XFA A;  3IM0 A;  3J7M A;  1CPM A;  2A5Z A;  5IVJ A;  1PNF A;  1O91 A;  2PLV 1;  2LM3 A;  3FFZ A;  3VL8 A;  4JGY C;  1V6O A;  1DZR A;  2VBP A;  1B35 C;  1N1S A;  2GH2 A;  1W9F A;  2ZX4 A;  1BEV 1;  2CHH A;  1A78 A;  4GZ9 A;  5A3U A;  1RUC 3;  1WCD J;  1XU2 A;  4BCU A;  4ISQ A;  1J1T A;  2W2I A;  3WW4 A;  3AMP A;  4G9S B;  3U11 A;  2CSG A;  1H2M A;  2PXJ A;  4QQO A;  2GDF A;  2Q5T A;  4P5Y A;  5FY1 A;  1LCL A;  1ZRI A;  3BU7 A;  2C9K A;  4L8Q A;  4MX3 A;  4NHL A;  5DDJ 2;  4FP3 A;  4NIG A;  1SLL A;  1K3I A;  1R64 A;  4FXK B;  4B7K A;  3WNL A;  1SCR A;  3VUO A;  3INA A;  1UYP A;  3VV1 A;  1LU1 A;  4CXY A;  5HXV A;  2XUM A;  5ANQ A;  2QQK A;  1V6M A;  4Q1R A;  2WUH A;  1ASJ 1;  1OKQ A;  5LZ6 A;  3ZLI A;  2VZO A;  1UOJ A;  4YW6 A;  4E4H A;  2Y38 A;  4YW5 A;  3ZFG C;  2J1R A;  3EYP A;  1W8T A;  2VNO A;  1POV 3;  3FLP A;  1H1A A;  5A80 A;  2TEP A;  3IT8 A;  3WNX A;  5A3O A;  4YAR A;  5C3R A;  2VOW A;  5KXE A;  2SLI A;  3OF1 A;  1K5J A;  3POY A;  4UT5 A;  1KFX L;  3MIH A;  2WSU A;  1W28 A;  3CHX A;  3ZXE A;  3LEK A;  2ZEX A;  3RSJ A;  1JXN A;  2BTV C;  3A0N A;  4AED A;  4NHX A;  5J96 B;  5M0T A;  1WLT A;  3U37 A;  5KWR A;  4J1X A;  2LS6 A;  2C1F A;  4AE2 A;  1ZRD A;  1O8P A;  1O59 A;  2JDU A;  5BYN A;  4W6Y A;  4FOQ A;  2I45 A;  3AB0 A;  2E7T A;  3N9L A;  4RR3 B;  4CP0 A;  3Q8C A;  4L0P A;  4Y22 B;  4YNI A;  5I0U A;  3PHM A;  2RS5 1;  4ONU A;  1AUY A;  1H6Y A;  5FUP A;  2CU5 A;  5JAX A;  1XU1 A;  3EQE A;  3DF0 A;  5C71 A;  1AL2 2;  3LSE A;  2L9L A;  1QH7 A;  2HLE A;  2K9Z A;  2YPJ A;  4XQD A;  4F83 A;  1XSR A;  2AUY A;  4OUE A;  5JSO A;  2P2K A;  2VUD A;  1SMV A;  2BJS A;  4ORF A;  3VBU C;  3QD6 A;  4NID A;  1Y7B A;  5FZ3 A;  1FPN 2;  2XL7 A;  3KV6 A;  5FPL A;  1S0I A;  3RZZ A;  4FI9 A;  3AC0 A;  1MQT B;  3U10 A;  3K4Z A;  1MS0 A;  2YV8 A;  1I1E A;  4Q1P A;  4EN0 A;  1BMV 1;  2QQM A;  4M3C A;  3ZDV A;  3DEC A;  5JUV A;  2LW8 A;  3TYJ A;  2PHL A;  3P6B A;  1C5I A;  4B8E A;  4WBB A;  4RGG A;  4PI0 A;  4ASL A;  3ZFF A;  4QB2 A;  1JYX A;  3W59 A;  3JBG 3;  3HQX A;  4MGT A;  3IAQ A;  3ZSM A;  4K8F A;  4DOU A;  1WD4 A;  1JW6 A;  2MNG A;  4QX8 A;  4DUV A;  4LA2 A;  3AL6 A;  3U75 A;  2E9Q A;  2XKP A;  1FNY A;  3CZJ A;  4MGQ A;  4PBO A;  4XHX A;  4HT1 T;  2FCT A;  3III A;  4CXX A;  4LK7 A;  5JOY A;  4G4F A;  3SMH A;  2OVU A;  2PHW A;  2R30 A;  3H3L A;  1YQ6 A;  1G9D A;  4Q26 A;  2E51 A;  1J3Q A;  2MHF A;  3POS A;  4HKO A;  1OH3 A;  4YZ3 A;  2X05 A;  1CAW B;  2W1Q A;  4HFS A;  4I0B A;  1C8N A;  3GGL A;  5FZD A;  1XND A;  1PMH X;  4PF5 A;  5HCF A;  1VMH A;  3VZJ A;  2LTN A;  5B4X A;  3IAP A;  2PHR A;  1VAK A;  5GAL A;  3PUI A;  2D98 A;  1E5I A;  4MH0 E;  5DUU A;  4AVC A;  2A71 A;  2WO1 A;  2XPJ A;  1X8E A;  4D6R A;  3SLI A;  3AMM A;  4A41 A;  3SH4 A;  2DFB A;  3M3C A;  4XCA A;  2O1Q A;  4B29 A;  3BCW A;  5EPA A;  5FIX A;  1GKB A;  1CJD A;  4E27 A;  4E4D X;  4XDQ A;  4D6Q A;  4LOR A;  3H8R A;  4AEM A;  5FYH A;  1GZT A;  1NUK A;  1GSL A;  3PVO A;  2X5I B;  4PDW A;  4XHB A;  3I3B A;  2WNV A;  5A3W A;  1ULO A;  3T2T A;  3NVC A;  1K45 A;  2XHN A;  1JMU B;  4XJZ A;  3ACL A;  3AL5 A;  3ZSL A;  2FZ1 A;  4LIV A;  4A7K A;  3PTY A;  2DV9 A;  5FYZ A;  2G9Z A;  2JEC A;  4PJY A;  3WW3 A;  1GNZ A;  3VBS A;  3BIE A;  3HN3 A;  3IN9 A;  1DGR N;  3G7D A; 
#chains in the Genus database with same CATH homology
 1XC6 A;  3I97 A;  1UY0 A;  2BBA A;  3HJR A;  4OMD A;  4E8C A;  4P02 B;  5IHR A;  5DQ0 A;  4OZO A;  4UI9 L;  1OH4 A;  1GUI A;  3LPG A;  1W8N A;  1NAE A;  2WO3 A;  5EJ1 B;  1CIY A;  3SKJ E;  3T2O A;  4A45 A;  4A44 A;  2J7M A;  4D0Q A;  4LHS A;  4D8M A;  1XPW A;  3I2F A;  3T09 A;  4CU9 A;  3K46 A;  4XUP A;  4XUN A;  2VMD A;  2VZT A;  1UZ0 A;  1UXZ A;  2W95 A;  3NJX A;  3C7F A;  4UAP A;  2XON A;  2ZEZ A;  2ZEW A;  1WKY A;  4CU7 A;  5JXG A;  2ZEY A;  1SG3 A;  3C7E A;  4PF1 A;  4LPL A;  3WSO A;  4HG6 B;  2J22 A;  3GDB A;  4QX0 A;  1UY4 A;  4DXT A;  2EIE A;  2VZU A;  5LA0 A;  3A23 A;  4BJ0 A;  2EID A;  1TVG A;  2WZ8 A;  3J7H A;  1UY1 A;  4E8D A;  2PQS A;  4XUT A;  1KGY A;  2J1U A;  2WO2 A;  2J1E A;  3OB8 A;  3K75 B;  2VZP A;  3HNB M;  5JXI A;  4M4P A;  2CDO A;  1CZV A;  2VCB A;  2R7E B;  5C70 A;  1OF4 A;  3MUY 1;  2J1T A;  1JZ7 A;  1NKG A;  1UY3 A;  1JZ3 A;  4W4Z A;  1PX3 A;  1MPX A;  4RYD A;  4ZY9 A;  3MV0 1;  3FL7 A;  4BDV B;  3W5M A;  3FN9 A;  4Z2A A;  3ECQ A;  2VOT A;  3WF1 A;  3VD3 A;  3OEA A;  1OT5 A;  3CIH A;  5EIY B;  1GNY A;  3FHQ A;  3F2Z A;  2X10 A;  2DCJ A;  3A7Q A;  3GXU A;  4IUG A;  1W0N A;  3ZM8 A;  2BER A;  1JHJ A;  4XVH A;  5G04 L;  1W9S A;  4QDR A;  5G05 L;  3C8X A;  2VQT A;  4UOJ A;  1L7Q A;  2QQL A;  3ACI A;  2BZD A;  4M4R A;  2YFZ A;  2E33 A;  4ZZ5 A;  5LA1 A;  2V5D A;  2WAO A;  1J84 A;  3K77 A;  3HEI A;  2QBX A;  2W3J A;  1UYZ A;  4ZZ8 A;  5HPO A;  3HPN A;  1SHW B;  2WYS A;  2YC4 A;  3HNY M;  5FUI A;  3CZU A;  1F4H A;  4W50 A;  1GOH A;  1EUU A;  2VC9 A;  3LE0 A;  3JXS A;  3THD A;  3MUZ 1;  1UXX X;  3BN6 A;  4TXW A;  4GWJ A;  2YC2 A;  4CUA A;  2VCC A;  1JYW A;  3K4D A;  1UYY A;  1JZ6 A;  3C7O A;  3MV1 1;  3T2Q A;  3T0B A;  3WF3 A;  1BHG A;  1I5P A;  1NX9 A;  3A21 A;  4CU8 A;  1JU4 A;  1UY2 A;  3HOB A;  2VMC A;  1US3 A;  2Y6L A;  3OG2 A;  5DMY A;  1GOF A;  2VMF A;  2WZE A;  2VJX A;  3NJV A;  1H6X A;  2W94 A;  2JD9 A;  3WNK A;  5CYY A;  4P00 B;  3I2H A;  1HN1 A;  3VDB A;  2C4X A;  2BGP A;  3WF4 A;  3SEP A;  1SDD B;  3T0D A;  4QAW A;  1DYO A;  2VO5 A;  2WDB A;  4XUR A;  2QQN A;  1UYX A;  5JMO A;  4CU6 A;  3CMG A;  2W1W A;  2YG0 A;  4KI5 M;  2E26 A;  3DYP A;  1CZS A;  2W47 A;  2VM9 A;  5J1X A;  3I2K A;  1LNS A;  4ET7 A;  2W5F A;  4YPJ A;  2VZ1 A;  5IJR A;  2WN3 A;  1CZT A;  4JKK A;  3C7G A;  4XZU G;  3T08 A;  1W9W A;  3FHA A;  3SEE A;  4DEQ A;  2VZV A;  2KD7 A;  4JKM A;  1RYY A;  1WCQ A;  2V4V A;  1ULP A;  2RVA A;  5LCW L;  2VZ3 A;  1K12 A;  3ETP A;  1JU3 A;  4MO3 M;  3UES A;  2W46 A;  4AAX A;  3LQC A;  3E1F 1;  3C7H A;  1JYN A;  1JI6 A;  2WN2 A;  2JE8 A;  2WBK A;  2J1S A;  3K4A A;  3GM8 A;  3ACG A;  4JHZ A;  4OYU A;  3WNP A;  2XOM A;  3IB3 A;  1EUT A;  3I2G A;  4QB6 A;  2JDA A;  4A4A A;  2QQJ A;  3WEZ A;  3T0A A;  4QDS A;  2RV9 A;  3W5N A;  2J1V A;  4OMC A;  1O8S A;  1IQD C;  2Y8K A;  3WQB A;  1W9T A;  1JZ4 A;  1F4A A;  3MBW A;  2WAB A;  1GQP A;  2EIB A;  2V72 A;  2W9X A;  2E31 A;  1UMI A;  2W87 A;  2ORX A;  3LEI A;  2YB7 A;  4XUO A;  2Y6J A;  4KMQ A;  3LPF A;  2ORZ A;  5IFP A;  2B9V A;  4QPW A;  4BK5 A;  1UX7 A;  4LQR A;  3VDC A;  1JZ8 A;  4DEV A;  3WNO A;  3IDA A;  3LEG A;  2VL4 A;  3NNG A;  4A3Z A;  5JXJ A;  2W91 A;  3DYO A;  1XNT A;  3I2I A;  1GOG A;  2E32 A;  1JZ5 A;  5HXM A;  4QB1 A;  2WQ8 A;  2X09 A;  1US2 A;  4MOA A;  1OF3 A;  2VME A;  2CDP A;  5CZK A;  3OGV A;  4KWU A;  4ARY A;  2YFU A;  1UMH A;  2JKX A;  4XUQ A;  2Y6H A;  4JX0 A;  2Z4F A;  4PQQ A;  5JR2 A;  4GZ9 A;  5LA2 A;  3NRU A;  4P5Y A;  2Y6G A;  2C9K A;  2WAA A;  1PX4 A;  4W8J A;  4LKS A;  1K3I A;  1R64 A;  3MO4 A;  3WNL A;  1L7R A;  1JZ2 A;  4DXS A;  1OD3 A;  1J83 A;  5DN2 A;  2ID4 A;  4CUC A;  2QQK A;  3A22 A;  2WUH A;  2VZO A;  2VCA A;  3T2P A;  2VTF A;  2J1R A;  2RJ2 A;  3EYP A;  3UET A;  1DLC A;  5IYY A;  1K42 A;  5DPN A;  4MGS A;  3WF0 A;  3ACF A;  3THC A;  1UWW A;  2QQI A;  4DXR A;  3LEK A;  2ZEX A;  2Y6K A;  4QX1 A;  3WNM A;  4BK4 A;  2J1A A;  3U37 A;  3WF2 A;  3ABZ A;  2W92 A;  2LS6 A;  2VZS A;  4MAD A;  1O8P A;  4QX3 A;  1O59 A;  3EB7 A;  4ZXE A;  1KEX A;  4AG4 A;  4L0P A;  2VQU A;  1H6Y A;  3CQO A;  4CVU A;  1PMJ X;  2VR4 A;  4CUB A;  5C71 A;  3UNP A;  3DYM A;  5C7G A;  2L9L A;  1T2X A;  2HLE A;  3PUH A;  4A6O A;  4OUE A;  4RN5 A;  3BGA A;  2VZQ A;  3ACH A;  2BGO A;  3OBA A;  3VD7 A;  4FI9 A;  3AC0 A;  3OEB A;  3K4Z A;  1GU3 A;  4DUW A;  5JXH A;  1YQ2 A;  4TTG A;  2DCK A;  2XQX A;  5B4N A;  1P8J A;  2QQM A;  5JUV A;  3DEC A;  2LW8 A;  3I3D A;  3P6B A;  3VD5 A;  3CKH A;  4ARX A;  2C26 A;  4QB2 A;  1JYX A;  1W8O A;  3P1I A;  3D3A A;  5A1A A;  3IAQ A;  3VDA A;  2VZR A;  4PT6 A;  4DUV A;  4JKL A;  5I0D A;  4BXS V;  3WNN A;  1W99 A;  3CZJ A;  4MGQ A;  5IFT A;  2DDU A;  3III A;  4QDQ A;  4DUX A;  3VD4 A;  2X05 A;  2W1Q A;  2EIC A;  1TG7 A;  3CDZ B;  4A42 A;  3I3E A;  3GGL A;  1PMH X;  5B4X A;  3IAP A;  5F7U A;  3OGS A;  3PUI A;  3NQH A;  2HYX A;  3VD9 A;  3OGR A;  2WO1 A;  4P08 A;  2W1U A;  4A41 A;  4GWI A;  3HNM A;  2W1S A;  5EJZ B;  1D7P M;  4QX2 A;  2ZXQ A;  1CX1 A;  2QQO A;  1NUK A;  1GMM A;  1DP0 A;  3I3B A;  1ULO A;  2Y64 A;  1K45 A;  1XNA A;  2XHN A;  2OKX A;  2B4K A;  3SKV A;  3I2J A;  1JYV A;  3HN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...