1GNYA

Xylan-binding module cbm15
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
153
Chain Sequence
GNVVIEVDMANGWRGNASGSTSHSGITYSADGVTFAALGDGVGAVFDIARPTTLEDAVIAMVVNVSAEFKASEANLQIFAQLKEDWSKGEWDCLAGSSELTADTDLTLTCTIDEDDDKFNQTARDVQVGIQAKGTPAGTITIKSVTITLAQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Family 15 Carbohydrate-Binding Module in Complex with Xylopentaose: Evidence that Xylan Binds in an Approximate Three-Fold Helical Conformation
pubmed doi rcsb
source organism Pseudomonas cellulosa
molecule tags Carbohydrate-binding module
molecule keywords XYLANASE 10C
total genus 30
structure length 153
sequence length 153
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gnyA00
2J1AA 2VCBA 4LPLA 1OD3A 2Y6KA 3THCA 4AG4A 3VD7A 3MBWA 1PMJX 2CDOA 3ACGA 4MGSA 1O8PA 5CZKA 4DEVA 4BXSV 4MADA 4D0QA 3GGLA 5JUVA 2W9XA 1JYWA 2EIBA 4XUTA 2E26A 4MO3M 4UAPA 1XPWA 1JZ5A 1ULOA 4QDSA 1JI6A 2W5FA 2J7MA 3WSOA 3C7OA 5IFTA 4DXTA 1IQDC 4DXRA 1BHGA 4ARXA 1W9TA 5DN2A 3T2PA 3K77A 3T0DA 4XURA 1DLCA 1PX3A 2JDAA 2Z4FA 1RYYA 2J1SA 2VL4A 2W92A 3NQHA 5JMOA 3FHQA 4BK5A 3A23A 2LS6A 3IAQA 3LEIA 2QQMA 5DQ0A 2J1EA 3HNBM 1LNSA 1W8NA 1K42A 2J22A 3CMGA 3U37A 2BGPA 3CKHA 2Y6GA 3ABZA 2XOMA 3OG2A 3EB7A 1WCQA 4OMCA 4PT6A 5JXJA 3WNLA 3HNYM 3T2QA 3K46A 3D3AA 2VMEA 5C70A 4M4RA 4QB6A 2EIDA 2E32A 1OF4A 3I2JA 5EJZB 4A45A 4A6OA 3EYPA 1K45A 3LQCA 5EJ1B 4LQRA 2RVAA 3E1F1 1TG7A 1CX1A 2Y6JA 3DYPA 4YPJA 2YFUA 4KWUA 5LA0A 1NUKA 3I2HA 3NNGA 2VTFA 3SEEA 2YFZA 2ZEXA 3SKVA 1UXXX 1EUTA 3C8XA 2HLEA 4CUBA 2DDUA 2VZVA 2QQOA 3W5MA 2DCJA 4P5YA 3IIIA 2C26A 4RYDA 4W8JA 4QB1A 2YC4A 2WAAA 4JHZA 2VQUA 3UESA 1KEXA 2HYXA 2WO3A 4JKLA 1HN1A 1H6YA 2X10A 3GM8A 2B9VA 2WUHA 3IDAA 2JE8A 2VZUA 1JU4A 3I3DA 2X05A 4W50A 3OGSA 3LPFA 4QX1A 2YB7A 2VZ3A 4CVUA 3HJRA 3WF3A 2WQ8A 3ACIA 2XONA 1DP0A 1F4HA 3CIHA 3WF1A 4QB2A 4QX3A 1UY2A 1SHWB 4OUEA 2Y64A 4LHSA 2Y8KA 3K4DA 3GDBA 5HPOA 2WO2A 2W1WA 3HOBA 1US2A 2QQJA 3MUY1 2ZEWA 1KGYA 5I0DA 1UYYA 4KI5M 1JZ6A 3T09A 3LEGA 4GWIA 2W46A 3DYMA 4XVHA 5LA2A 3CZJA 1UY1A 1W9WA 1XC6A 3C7GA 1W9SA 2X09A 1GQPA 5JXIA 3WF2A 4P00B 1TVGA 2J1UA 1GNYA 3FL7A 1W8OA 3WF0A 5JXHA 1GU3A 4CU9A 3NJXA 1UXZA 4JKMA 2OKXA 2BBAA 4OYUA 2WZ8A 3GXUA 3OBAA 3DYOA 3IAPA 3P6BA 2J1RA 5JXGA 4QDQA 1CZSA 4ARYA 2DCKA 3JXSA 1K12A 2WN2A 2XQXA 4AAXA 2QBXA 2BZDA 1PX4A 2PQSA 3K75B 4TXWA 1UY4A 1K3IA 1NX9A 4TTGA 4A41A 3WNNA 3A22A 3ACHA 3HN3A 1EUUA 2VZRA 4ET7A 2VMDA 1W99A 2ZEZA 3FHAA 4JX0A 5EIYB 4A4AA 1UY0A 5IYYA 1UY3A 4DXSA 2W1SA 2E31A 2VZTA 2WAOA 2VZOA 4CU6A 2VC9A 2VCAA 4QDRA 4RN5A 2VR4A 4UOJA 4ZY9A 4UI9L 2QQKA 2QQNA 2W1UA 4QPWA 3ECQA 2W94A 1SG3A 4JKKA 5G04L 1T2XA 4BJ0A 2WZEA 2VMFA 2CDPA 2Y6LA 4Z2AA 4A42A 4ZZ5A 2BGOA 3K4ZA 2ZXQA 4W4ZA 3LE0A 2WN3A 3I2FA 3VDCA 3WNKA 1O8SA 1XNTA 2W87A 5IJRA 3WNOA 1PMHX 5HXMA 3VD5A 4DUWA 3F2ZA 1CZTA 3HNMA 3SKJE 4CUCA 3I3EA 2RJ2A 2VMCA 1I5PA 5C71A 3PUIA 2ID4A 2C9KA 4KMQA 3HEIA 1GUIA 3MV11 3I97A 4HG6B 1JZ7A 3AC0A 1JZ2A 1JYVA 1P8JA 3I2KA 2ORXA 2VO5A 3C7FA 4A3ZA 5J1XA 4OMDA 2WO1A 3W5NA 5B4XA 1WKYA 1L7RA 3PUHA 1UYXA 3FN9A 1CIYA 3OGVA 4MGQA 4DUVA 3WF4A 1UMIA 4DEQA 2RV9A 2VZSA 4ZZ8A 1JYXA 3OB8A 5F7UA 4BK4A 3C7HA 1OF3A 2V5DA 3CQOA 3K4AA 3WNMA 1GOHA 4QAWA 2C4XA 2R7EB 3ETPA 4BDVB 2E33A 2VCCA 3NJVA 4IUGA 4L0PA 2J1TA 3MUZ1 4CUAA 5G05L 3C7EA 4XUQA 2YG0A 2V4VA 4CU8A 3OEAA 2WYSA 3VD9A 1R64A 2QQIA 3BGAA 3DECA 2VZPA 1JU3A 2W91A 2WABA 3A21A 5FUIA 4XUPA 3WEZA 2KD7A 5CYYA 2VJXA 3I2IA 3ACFA 4GWJA 3I2GA 3OGRA 4CU7A 2VZ1A 1H6XA 2ZEYA 4LKSA 2B4KA 1OH4A 5A1AA 4XUOA 4M4PA 2JD9A 2VQTA 3NRUA 4ZXEA 5LA1A 1JYNA 1CZVA 3THDA 3LPGA 4E8CA 4FI9A 2W1QA 3VDBA 2Y6HA 1GOGA 2XHNA 3IB3A 1US3A 4A44A 4QX0A 3VD3A 3VDAA 5C7GA 3WQBA 4D8MA 2WDBA 2W95A 1OT5A 1JHJA 3T08A 5JR2A 1D7PM 2EIEA 3LEKA 1J83A 3VD4A 4DUXA 1ULPA 1XNAA 5DPNA 2W3JA 4P02B 1GOFA 4QX2A 1UX7A 5IHRA 3UETA 4XUNA 1YQ2A 3T0AA 1J84A 2WBKA 1JZ8A 1L7QA 1NAEA 5B4NA 2BERA 3CDZB 5DMYA 2VZQA 1NKGA 2LW8A 2EICA 4PF1A 5IFPA 2QQLA 1DYOA 4E8DA 2W47A 1UYZA 4PQQA 1GMMA 3T0BA 4XZUG 1W0NA 2ORZA 3UNPA 2YC2A 1F4AA 1MPXA 1O59A 3WNPA 3J7HA 4P08A 3HPNA 2L9LA 5LCWL 3MO4A 3T2OA 2VOTA 3MV01 1JZ3A 4GZ9A 3I3BA 2JKXA 2J1VA 1JZ4A 3OEBA 1UZ0A 1UMHA 1SDDB 2V72A 3CZUA 3P1IA 4MOAA 2VM9A 1UWWA 3SEPA 4OZOA 3BN6A 3A7QA 3ZM8A
chains in the Genus database with same CATH superfamily
1QH7A 2Y6KA 3THCA 2IFRA 4AG4A 4C90A 4AI1A 3SLIA 2ZMKA 4OQ9A 3SCHA 5L9VA 3B9IA 1K5JA 3ZYFA 2CDOA 2RR12 3ACGA 1RUG1 3WW1A 2UU8A 4Q1PA 5CZKA 4AWDA 5C5TA 5HCAA 2D6NA 4X8PA 5JWPA 4SBVA 4UBGA 3BTXA 3NV3A 3PL0A 3WDXA 1W6NA 4FQ4A 3GGLA 4AR2A 3N7JA 3T1MA 5FYMA 1GKBA 4JCKA 3Q8BA 4U2AA 4XUTA 5SV8A 3FMGA 4AFAA 5FYIA 1REDA 2E26A 4FP3A 2Y60A 4OI4A 4UAPA 1NXD1 1FAYA 1ULOA 2EALA 5FREA 2WNEA 1FX5A 1JI6A 4XJ8A 5BNOC 3C7OA 1VBA1 3NVCA 4DQAA 2VMGA 1LULA 1GP6A 4HKWA 1UMZA 3O1UA 2ZJCA 4K6BA 1CWPA 1O7FA 5AFEA 5FZ9A 2ZHNA 1NCRA 3QH7A 2A6VA 2PHUA 4H14A 3U1XA 4CEWC 1DLCA 5KXDA 4D6RA 3URFA 2JDAA 1Q8QA 3MW2A 1CN1A 1IPJA 3FHQA 1BZWA 4BK5A 2XKPA 1OUXA 4EQVA 1XE0A 2LS6A 1GANA 3IAQA 1ULDA 3OBRA 4LLOA 4DPNA 3I3MA 2RS51 1UYPA 3VBOB 5GLVA 3RWNA 4MYEA 1DQ6A 1IGOA 3KS7A 2AEZA 3MIEA 1VBB2 3VBRB 2EVXA 1O5LA 1S0BA 2J22A 3CMGA 3U37A 5A6QA 2BGPA 3CKHA 4XJWA 3TYJA 4RS5B 4CXYA 1W6QA 2JJ6A 3ZDSA 1AYM3 2GALA 4BISA 2R042 4ASLA 5H9RA 4GKXA 5EFUA 1PO22 2BTVC 3I8TA 3EB7A 3POJA 1NOVA 5C33A 2AH2A 1N3QA 1YFYA 1A3KA 4PT6A 4QPIB 2JDNA 3N7KA 1JN2P 1NT0A 3HNYM 1POV0 2PHFA 3K46A 3T2QA 4D7TA 3KT4A 5JZGB 5C70A 1WW6A 1CQ9A 2VPVA 4M4RA 2ENRA 3N7MA 5JSOA 1POQA 2A70A 3LDKA 3NNJA 4H55A 2D6OX 1ZRDA 2CU5A 4QX7A 5JI7A 1BJQA 1OF4A 1H30A 1QH6A 4XBLA 1ENQA 1HKDA 1EP0A 1MS8A 2GN3A 5LK7B 4WM8A 4IEWA 2A73B 5EZWA 5EJ1B 1GWLA 3DF0A 3T30A 5DUXA 3E1F1 2BWCA 1HRV3 3JD71 1AR62 4HPKA 1KITA 2Y6JA 1B35C 5FJHA 2EA7A 1HW5A 3CBNA 1YFWA 1VR3A 3MLKA 1LGCA 3M3OA 4LJHA 4NAMA 1QIQA 1KS5A 2WT1A 3KCYA 3NO8A 3NNGA 4LE3A 2A6WA 4Z92B 4AQ2A 4YZ4A 4CDXA 1GZTA 1GZWA 4RGKA 1ZRRA 2RS33 2W68A 4WBBA 3LKJA 2UY8A 2ZX2A 4QWNA 2YFZA 2ZEXA 4Y22A 5FKCA 5LBFA 5KXEA 2ZHKA 4ASMB 4AQSA 1UXXX 3C8XA 1WD3A 2BUKA 2VBBA 1JYXA 2B8MA 5FZOB 2G4IA 1OA2A 2IXKA 1RVF3 2WNVC 5FZ6A 3TOJA 1O3SA 1YC61 5JAXA 2C6SA 4Q4X3 2C26A 3EQEA 1QXJA 3UGGA 2VQUA 1R1A2 2YUEA 4QPGC 1U5XA 1I1EA 1KEXA 5FZ8A 3OJBA 1DQ1A 5C5UA 3ILFA 3O12A 1TME1 4E2QA 3DKWA 1HN1A 2CGNA 2MHFA 2X10A 1V9U1 1ONAA 3GM8A 1E5SA 4JGZA 4Q4Y1 2WUHA 2BOIA 5C3RA 2JIJA 2ZX0A 2VZUA 5JSPA 2ZZQA 4N9IA 1X8MA 2XG3A 3I59B 2QQPA 1W6OA 5L7OB 5FFOC 4LKDA 3RQ0A 3ZXFA 2XQRA 4PIZA 3RG0A 4W50A 4E4DX 1DGRN 1IPKA 3DEMA 4QX1A 1J1TA 1SBEA 3EMRA 3HJRA 3WF3A 3ACIA 1XJAA 5F1RA 4WZCA 3LEMA 4IGPA 5DZEA 5FY7A 3RPQA 1A78A 1WW7A 1LJ7A 2JWPA 1AJOA 1D4M1 4NROA 4XQWA 5DAVA 5LY2A 4AF9A 3BODA 4PIXA 5A3NA 2D98A 3MIHA 4OUEA 2ZGSA 4UFIA 3ST7A 5ACA3 4LHSA 2Y8KA 1ALYA 1COV1 1LGBA 2E9QA 2I07B 1H8TB 2ETEA 3GDBA 4DINB 2FD8A 3QACA 1BBT3 1FMD1 4XMAA 3ZYIB 3AP7A 1REEA 3PUQA 1LOEA 3IDCB 1SFYA 2GSYA 2AACA 3TBDA 2QZ3A 4QGNA 4RS5A 4HSJA 4AE2A 1UYYA 3CJIB 5JOYA 2PELA 2FCTA 4LLFA 1RUOA 4OHVA 1GP4A 4J1WA 1R081 3RZKA 5LA2A 2GH2A 3CZJA 3RYRA 5J36A 1RUI1 2W08A 2VTXJ 1QXPA 4MUVA 2XBO1 2ZGKA 1XC6A 2ZKNA 4XAEA 2X09A 1GQPA 4I2OA 2ET1A 2GU9A 1N1VA 5LBCA 4LULA 4P00B 3WQ7A 4TSVA 2HH9A 3RI8A 2LROA 1KRIA 4WM7C 4GB31 4JV4A 3BTAA 2VUDA 2Z42A 1VBD1 1ZNPA 3A0KA 3WF0A 2ZOEB 3Q8FA 3P5BA 4Q4W2 3B3QE 2CHHA 4N90A 5JXHA 2PHWA 4OCTA 4OHZA 4CU9A 5KWRA 2D97A 3NJXA 4JKMA 2OKXA 2VECA 1M4WA 3USUA 2BBAA 2GH8A 1COV3 1NLQA 1R092 3SMHA 2GNBA 1OQDA 5HV4A 2OUJA 3OBAA 2BFUL 3O0WA 5FZ1A 2H0VA 2J1RA 3PVEA 1QOSA 1GICA 2VW0A 4LE4A 2YPDA 3C3VA 4R9AA 2DCKA 2VOWA 1SLBA 3JXSA 3C2UA 3MEPA 2WN2A 1DLLA 4QQPA 5AVPA 2VNOA 4YVSC 1PX4A 4QX5A 5FYTA 1XU1A 2JG9B 3HQUA 3MFCA 2LTNA 3N3HA 1KJLA 3RFRA 3NMBA 1SQ4A 1MZEA 4TXWA 3RSJA 1UY4A 2BNOA 5FYUA 3WCRA 4XW3A 4NIAA 4BLJA 5BNOA 3N9OA 1V6NA 5FZGA 5FP3A 5FZAA 2P37A 5EJ3A 5CEHA 1ASJ1 4A41A 4QPGB 5FO9B 4BWOA 3VBSA 3A22A 3HN3A 3OOXA 4E2SA 1CAVB 2GMPA 2GMEA 4K1ZA 3RZHA 3WY6A 4Y20A 1SFPA 1W99A 2OA2A 3SHRA 2ZEZA 2A6ZA 1ULCA 1OQEA 3PURA 4A4AA 4ZONA 3B00A 4PHZA 4S2FA 5IYYA 2CAVA 1XU2A 1UZVA 2D5HA 4Q4W1 4Q8LA 2EF6A 1G8WA 2VC9A 2VZOA 4CDWB 1KS4A 1QNWA 3IMMA 1X50A 2DFBA 5A7NA 3LFMA 5DUVA 1OOPA 5FY4A 4BQ3A 2R6QA 5A7QA 2W1UA 1JOBA 1DCSA 1HRV2 5FZFA 3VLBB 5BNOB 4NWVA 4HVRA 1U5ZA 4KG8A 1SG3A 5T5LA 3GJAA 2JDHA 1ULFA 2DVAA 1ND2A 1NQDA 5FJKA 2VMFA 4QXBA 1RUI2 2FHRA 3UKTA 3TN91 2XB6C 4GH4B 5JIUA 1VBE3 2BOJA 4COWA 4OLLA 1FATA 5KXBA 2XHKA 3ZMOA 3KCXA 4CP9A 1ENRA 1O8SA 2AEYA 2N7GA 3JUUA 3GNEA 5IJRA 2P5BA 5A6YA 2HWE1 2Z69A 1PMHX 1H2NA 2MEV2 2R0HA 2R16A 3AP4A 1YFUA 4RHV3 2Q8OA 2JICA 2YPJA 3HNMA 3N9NA 3U78A 3J4UH 3V64A 1Z7S2 2VMCA 3ENRA 5KHKA 2QQVA 2X5IA 4Z1VA 3E5XA 4LBKA 4WM7B 2ZX3A 1AL23 4XETA 4LUMA 4XYXA 5HI0A 4I0BA 1H2MA 5EHDA 1W6NB 4A7YA 1OSGA 1AF9A 1P8JA 4E4HA 1YLLA 1CAVA 4AHXA 3WR0A 4XIOA 1MR5A 2VO5A 1X9TA 1S1AA 1SDWA 1ZBA2 5FQ0B 2P3YA 4FPYA 3VBUA 4NVPA 1GR3A 1L7RA 3ZFEB 5GLUA 5AC91 2EXHA 4W65A 5F8PA 3RVHA 1W8UA 1UYXA 4DB5A 4JVAA 4CDWA 2WNVA 1VBB3 4UW5A 1LODA 1Q8OA 1VAVA 1UMIA 3QBQA 4DEQA 5C4WC 2RV9A 2C0ZA 2JG9C 3HWJA 4P9IA 4Z82A 5DABA 4YW6A 3AFGA 3KGLA 4AEJA 1OF3A 2NLRA 3T3YA 3ZYRA 2PFWA 1XNBA 2OX0A 2HEYF 1GOHA 3K4AA 3MLJA 4FPEA 4GJZA 1QDOA 5GZDA 3USSA 4MHRA 3ZMNA 2DCZA 2VMHA 3LSEA 4BDVB 3NV2A 1G9DA 5FUPA 4XFAA 4HOOA 4F83A 5KR7A 4UFKA 2YG0A 4XUQA 2V4VA 3GBWA 4CU8A 2WYSA 1V6JA 3VD9A 1R64A 5IVCA 1R1ZA 2W52A 3ZFGA 1H1IA 1JW6A 2CWMA 4NPMA 1JU3A 2F4LA 4NHYA 3THTA 3UGFA 3VZOA 1XSRA 3PU8A 1CIWA 4XUPA 4D3WA 5CYYA 4KGGA 1ZBE1 3ACFA 4XABA 1RUG3 2EAAA 2SLIA 1F35A 2WA3A 1RC6A 3ES4A 3OGRA 4OFGA 3I7DA 3O14A 5FPAA 4AEDC 2JG8A 4MV2A 4XUOA 3KV9A 3MIFA 3BCWA 1RUI3 5C8WA 1LRHA 1YO8A 4JTNA 4CYDA 1CZVA 4WM7A 4IV1C 3KF5A 1EAH1 3PU3A 4QGLA 5C3QA 1OXCA 1HB1A 2Z79A 3GCWA 4FQZA 4HKOA 4I09A 5JIAA 5L73A 3VKLA 5CVRA 1MVQA 1ZBE2 2VQAA 4QX0A 1OC1A 4RQPB 3DV8A 3VDAA 4H2AA 4XIKA 5FQ0A 3EHKA 1RUH3 3VBSC 1AR83 4AQTA 3DXTA 4BXFA 3JB8A 2GZWA 4LOSA 1JHJA 3BALA 5M0TA 1D7PM 3JBG3 1RUE2 2FDGA 1K5MC 2FMDA 1KD7A 2HEWF 2EXIA 3H1YA 3GBGA 2WWSA 5KBFA 1ULPA 2GC1A 3AP5A 1GP5A 4BOWA 2DCYA 5F9TA 5B2GB 1QJY2 1YQCA 4JHTA 5FP7A 3SH3A 2LRPA 2HWE3 1V0AA 2C9AA 2W3JA 3CU7A 1DIWA 3MYXA 3LCPA 3TAYA 1GOFA 1AR63 3V0BB 2MPFA 3H50A 3MICA 1UX7A 2ZGRA 5IHRA 3K3NA 1JHNA 4AFBA 2A3WA 5FOBB 4BQ1A 1W2AX 2X53S 3CHXA 4XUNA 2Q1FA 5LEKA 1AR81 1DZRA 1S0JA 1J84A 5FTTC 1RUJ1 1GSLA 1KDMA 1HV0A 1WCUA 2WBKA 1AZDA 4RHV2 3HBKA 4V1PA 5DAPA 2XKOA 4XACA 3ZKUA 1S0IA 1UZZA 5AC93 5I8TA 4CU7A 3S5AA 2XBO2 4Z07A 2ZMLA 2XL7A 2XWBB 4PF1A 4M00A 5FPLA 3ZX7A 3VV1A 2RDQA 3D6EA 4Q4W3 1IHMA 3M8LA 3VZMA 1UYZA 5F37A 2VOXA 5FYZA 2Q30A 3FBMA 4GAZA 2ORZA 4XZUG 4XC9A 3WNPA 3POYA 4K8RB 4K20A 4MGTA 4FPOB 4P08A 4B29A 3G7DA 4XXPA 3HPNA 3SXWA 4YZ2A 4JC1A 2Y0OA 2L9LA 5T3NA 5HV0A 3MO4A 3EJKA 3PVBB 3MV01 1WZXA 1JZ3A 1D4M2 1OD5A 1PM4A 2XXZA 3FLRA 2ZZJA 5FBZA 3VBFC 3M70A 4Y4RA 4N53A 3WP6A 1RUC2 1EAH3 2UWCA 2E51A 2LM3A 1YUDA 1WMDA 4N7UA 1UMHA 3ZXLA 3P1IA 4URAA 1IG0A 1PNGA 2VM9A 3KCCA 4P9XA 4R9CA 5F5QA 4F3JA 1UX6A 4X8NA 1CX4A 2D44A 2DCJA 1ENXA 3A7QA 1QWRA 4QXHA 4XF1A 1GNHA 3HT2A 1VBE1 5K7PA 3S30A 1OD3A 4I02A 4GALA 1J58A 2WINB 4XDPA 5A80A 5C6CA 1PMJX 1J1LA 4TZDA 4AFDA 1NQJA 2Y33A 2BJSA 1PGSA 3L2HA 1O8PA 2ZGUA 2RM21 1BCXA 3LA2A 1Z0HA 3NKTA 1V6LA 1YJLA 5EXOA 4B4PA 4BXSV 3DPRA 4AEDB 3BTYA 2PAEA 3S6PA 2KR2A 4YGCA 2WNUB 1GYKA 4Y3OA 5JUVA 1H0BA 2EIBA 2WT0A 5A7WB 2FDFA 2ZGQA 1WLTA 3FHIB 4MO3M 4HT1T 1XPWA 2GNDA 4BMBA 5A3MA 4F8AA 1GZ9A 1X7NA 1AR71 2W5FA 4N8MA 3VBHA 3VKFC 2WC2A 4BM8A 2BV4A 5J98B 3WQ0A 4FAHA 3O1TA 1Y4WA 3VN4A 4AAPA 4Y33A 2OQ7A 5FV3A 2Y34A 1YJKA 4UF0B 1QXRA 4HXCA 1W9TA 4RL7A 2ZX4A 3S7EA 4FAGA 4RQPC 3TNQA 2D3SA 3CO2A 3PJYA 3T2PA 1N1TA 3M3IA 1VBC1 4QXKA 4ES8A 4XZPA 2D43A 3J8F2 4XURA 1A8DA 3LA7A 1KFXL 4QT6A 1ND3C 2D3RA 2R32A 2Z4FA 5DAQA 2J1SA 3E6BA 1AR61 4IESA 3ZDVA 5JMOA 1FT9A 4WVVA 3VBRA 2NN8A 1TME2 5F3IA 2GC3A 1EAH2 4N43A 4OI1A 1LNSA 5FK7A 4CP1A 1JYTA 2CGOA 5IVFA 4XJ9A 5A6ZA 1W8NA 4FPHA 1OUSA 1XE8A 1SCSA 1Y9GA 4S2GA 1UIJA 3ETQA 5FOJB 1SLCA 5BNPB 4FPLA 1RMU3 3ABZA 3NNMA 5FYCA 1RUF1 2JE7A 4AGGA 4CTEA 2XJSA 1PGW2 3E6CC 1RJ7A 1CAUA 2ZPXA 4OMCA 4FPGA 4CCMA 2CYFA 2RS12 1UOGA 3V0AA 5JXJA 1PHMA 1RMU2 4KWKA 2ZHLA 4EROA 2QUOA 4CDQB 1R082 1AX0A 1W3VA 4LTAA 5LBEA 3IT8A 1LU2A 3OY8B 1RUD2 2YHJA 4UFJA 1IPSA 3SC7X 2DUPA 5I8SA 4FTSA 2DBIA 3KF3A 1LCLA 2LUWA 1IOAA 1XXNA 1CONA 5F3GA 1Q3EA 4ZS3A 2BYVE 1TG7A 3ZO0B 5L36A 4K7JA 4B1LA 2O0OA 4QMAA 4N53B 5H9PA 1QJFA 1YI9A 3J8F3 4BQWA 5LY1A 5T52A 4A3XA 4MHUA 5D8AA 5FZIA 1NUKA 4CCDA 3RJ2X 3O5SA 1FOD2 1NXMA 5FZ0A 1EPWA 5LRRA 2RDNA 4NUBA 2P3KA 3TB0A 3M3EA 1H8VA 4O9EA 2BDRA 4JZRA 3PVNA 2C1FA 4KNCA 3A4UA 1QJU2 4G3YC 4QGMA 3SCFA 2HBUA 1HRI1 1Y9MA 2JKBA 2WL1A 3H8OA 2JX9A 4QQLA 5DAWA 3T4HB 3FLPA 1WW4A 4CCLA 4L97A 4DIQA 4CUBA 1OFSA 2VTXA 4OUSA 2YGLA 2DURA 4Q4Y2 4UFMA 5A1LA 4XJZA 2FDKA 2CWSA 3VDDA 1G9AA 4CCKA 1Z7S1 3IIIA 1JODA 4RYDA 4QB1A 5C9AA 1VBB1 4JHZA 1Y9QA 3HAGA 4QPYA 3R6SA 4KH9A 4LO5B 3UKNA 3WDTA 3ACLA 3U0ZA 3RZMA 1GFF2 3J26N 1MS3A 4LBQA 4YW1A 1BQPA 4BQ5A 3IDAA 4W6WA 3O1MA 3B02A 3ZSEA 4N43C 3I3DA 3FLTA 4X6QB 1DF0A 4R9BA 3WINE 4O65A 4AHWA 2X05A 3MGUA 4PI2A 2XJTA 5FIXA 3NV1A 4AVTA 1TEIA 4O9GA 4LHNA 3PTYA 5DUUA 1AUYA 3H1WA 5EP9A 5FY8A 3B7MA 3VZLA 1UCXA 2GP5A 2OZJA 3OGSA 4JDMA 3BUCA 4CVUA 1RUC3 2WQ8A 4C8DA 1M06G 5FZEA 1O5UA 1XOYA 4IEYA 5CKMA 2QZ2A 1KJRA 1ZM1A 3CIHA 4QB2A 3WF1A 4AVCA 3AKQA 3M4FA 4FT8A 5C8CB 3BTZA 1AR93 1UY2A 3RZGA 2WIIB 4BCUA 5HPOA 2Q8CA 3MI8A 1IKPA 2JXAA 4BIOA 3WUDA 3HOBA 4XJAA 5J37A 3OGJA 3WHTA 3DKQA 5FYYA 1GQHA 1GNZA 3ZFGC 3MUY1 4B4QA 4YM3A 2XJQA 1W8WA 2DCTA 4DRRA 1KGYA 5FMCA 2VVEA 4ONUA 2YMZA 5AVAA 1OLME 3MLLA 3KQ4B 4KI5M 5GJ6A 1RUJ3 1JZ6A 4NIDA 4YM2A 4ORFA 2WWUA 4ISQA 1U0AA 3DYMA 4AYUA 5DG1A 2V5YA 3THPA 1ZREA 3UT0A 4LBOA 1W9WA 2Q4SA 2RS11 1W9SA 2UYBA 2WZPP 1OOPB 4D94A 1PGL1 2Y6FA 5AFBA 2PHDA 2J1UA 5T5PA 5CIRA 4RA0A 1W2TA 1MZ5A 1RUJ2 2F6BA 4CCEA 4O7XA 4QXCA 3R4SA 2EAKA 2GMMA 2Y0IA 1UIKA 3VZNA 2DU0A 1XNCA 1NY72 2MEV3 1WCSA 3OSDA 5JSRA 4Y1UA 1IS5A 3WG2A 3E5UA 5FZMA 4BQXA 1YCIA 4YVWA 2C24A 2WZ8A 1RTVA 3GXUA 1DYPA 3S57A 2WZR1 2DVFA 1UU4A 1W9FA 2OUHA 4WM8C 2BWAA 5FY5A 1UKRA 1UQXA 3VL8A 1O4YA 1VBE2 1VE0A 1X8EA 5JXGA 1LHNA 5BV6A 2HYKA 4IEUA 2UURA 1K12A 4FBFA 4PQ9A 4AAXA 2KA3A 1PVC2 3KVBA 2BZDA 3GF6A 2ARCA 5J3UA 5FZOA 1W6MB 3LIGA 5CB7A 1OFNA 2WNOA 1D4VB 4FXGB 4HETA 4LO6B 2ZGLA 3K75B 4GIQA 4XHXA 3SITA 3MIBA 3LFIA 1B35B 2AREA 3DUIA 1XSQA 3LWCA 5GKAC 5FZLA 5KHIA 1PIV2 4QKFA 1QJU3 4NRQA 4Y1XA 1NX9A 1PK6C 4Q4X1 4COVA 3WNNA 2GNTA 2JDZA 4YVWC 4P9WA 1FOD3 2ILMA 1EUUA 2IXCA 2HWD2 4ET7A 4U36A 2VUCA 1UU5A 2QCSB 2WFF2 2TBVA 3HBZA 3I59A 2RM22 3BPZA 1JOJA 1NG0A 1PZ7A 3D4KA 4IXLA 1UY3A 1G9BA 1O3RA 3LOBA 1HQWA 4Q0QA 2E31A 3S5QA 4CU6A 4RR3A 2R062 4KG0A 3ZFFA 4DO0A 4RN5A 5C8CA 4YW5A 2VUJA 2FZ2A 4DNYA 4GB33 1SBFA 1COV2 2VNVA 2ZHMA 4MX3A 4ZU7A 3SH4A 2R30A 5BNPC 5I91A 5CG8A 3AX4A 5G04L 4P9LA 4BJ0A 3J7LA 2WZEA 4AL9A 1F8VA 3RDIA 1RXGA 5K9YA 4M3CF 4A42A 1UPSA 1FOD1 1C8M2 3OD0A 3LE0A 4W4ZA 5A33B 5IAXA 5L19A 3ZFGB 3F95A 5F5AA 2DUOA 3BOWA 3ZN4A 2P3JA 3VKNA 4W6YA 3WNKA 1W6PA 2FMYA 2OT7A 2K9ZA 3RGBA 1VIWB 4P9YA 4NHMA 4YW3A 2E7AA 2WFPA 2W87A 5LASA 4MXWB 4W6XA 1JH5A 1O91A 5GZEA 3ZKYA 3ZXJA 5HXMA 1XYNA 4EWEA 2D6MA 1PMIA 2K2SA 4GWNA 4ES9A 1JUIA 3F2ZA 4XJUA 2ARXA 1TMF2 4CUCA 3I3EA 4Q2FA 3WG3A 2RJ2A 1ND3B 2G19A 3AYEA 5C71A 3ATGA 5JVVA 1RHI2 2WQZC 3PUIA 1QMJA 3WOGA 1RMU1 2YC0A 5FZ7A 1ZBA3 3BIEA 3FFZA 4M0HA 4YG3A 5D8AC 1JZ2A 1OA4A 1STMA 3AP9A 5JMCA 1MEC2 3I2KA 2DTWA 5LBBA 1QJU1 2CV6A 1RUF2 2RS31 4ASKA 4DMIA 5JR7B 1RIRA 3IIAA 2H6BA 4NN0A 4TLFA 1TME3 4IW3A 1FPN3 1SCRA 3OPWA 4M0NA 4NJ4A 2HWF3 4XFGA 4Q27A 3OGVA 1W8FA 1C8M3 1G9CA 4K8FA 4RR3B 2BNNA 4AK3A 3LF7A 3WF4A 5BNNC 4HMZA 3OD4A 4XE9A 3WUCA 1L7LA 4M01A 4CP2A 1QU0A 1UKGA 4ZZ8A 3OB8A 3ZPYA 4BK4A 2ZGPA 3C7HA 4Y5SA 4YFZA 1T6GC 2EIGA 2V5DA 4CDQC 1MACA 4QAWA 3ES1A 5ABJA 3ETPA 3FWEA 2V4AA 3H7YA 4HONA 2RG4A 3NJVA 1RUD1 2RJLA 3H8UA 1VMJA 4IUGA 4LXLA 3IWZA 5FWJA 1ZZCA 1DZQA 3I54A 3TN92 3IPVA 4IEPA 3HD8B 4C0HA 5CISA 3WV6A 3NNLA 2WABA 1J59A 3A21A 2XR4A 3JBG1 1AR72 5FUIA 3VHNA 3WEZA 2KD7A 2BVBA 4FFIA 1AR91 1N3OA 5KHGA 1G7YA 1TMF3 5GALA 5TSWA 2XJPA 4NIIA 5BY5A 3ITQA 4GWJA 3JD73 1UOBA 1LKNA 1PZ9A 5E1RA 1GQGA 4LKSA 3WZ1A 4IGQA 4LEJA 1XYPA 1YHFA 5A1AA 2XH6A 1SLTA 2VQTA 1O6UA 4ZXEA 3VHOA 4B4RA 2E7QA 4V2VA 3RZLA 5IW0A 2DTYA 2R49A 4XMIA 3N9MA 1VJ2A 4MXVA 5I0SA 1NE6A 1WUVA 3AMNA 2DYCA 3LPGA 3OYWB 2WLQA 3WDUA 4E8CA 4ZS2A 4E4SA 2KXLA 2QQWA 1GOGA 4UXAA 2XHNA 5IK8A 2RS32 1H9PA 2ZMNA 4GH4A 2BBVA 1US3A 2CTVA 1S0DA 2NPIA 4HPKB 1XYOA 3WQBA 1HRI2 1YIPA 1RL3A 2RJKA 2YROA 3OF1A 4NE9A 3I2DA 4XEZA 2EXKA 4LMFA 5A6XA 3FUQA 2VXJA 5FK8A 1VRH2 4BZ4A 3ILRA 2DF7A 3DPRC 1J83A 1TMF1 4MXWA 3AZWA 1GZWB 4R4XA 1C5HA 4HK9A 3AL6A 2HWC3 4YM0A 3VD4A 3ZSMA 4DUXA 3WDVA 4LOTA 3GZAA 4Q5OA 3ME2A 5C8CC 1O4TA 3HN1A 4CPBD 1RXFA 2HWF2 3KWVA 5APAA 3A0NA 3R05A 3OPZA 1S0FA 4HLTA 4LIUA 4V2WA 3RZZA 5A3LA 1DYKA 5FO8B 1WGPA 1OBNA 5DXDA 1OLRA 3FJSA 1W2NA 5AC92 3UETA 1ZZBA 1H1MA 5J7MA 5FYVA 1YFXA 2MNGA 3H7JA 1PO13 4LT5A 2FDJA 4QHZA 2DFCA 2RS13 2XLGA 4NPLA 5I0UA 3WW3A 1NYWA 3MIGA 1KDKA 1VALA 1JZ8A 3ZN6A 3KV5A 2ZAAA 3N36A 4PCRA 1RHI3 1IG3A 1MQTB 1LESA 1HJGA 2OYZA 3NJYA 1NKGA 1Y3TA 3J9SA 4QKBA 5IFPA 2QQLA 5A3OA 1GWMA 1AR82 1JMUB 1Y43B 2A71A 3ALQA 4HN0A 1ZA7A 4UT5A 4AEKA 2BPA2 3S7IA 1W9YA 4IEVA 1F5JA 4PQQA 1WBLA 1GMMA 1A8MA 4LBLA 2BFUS 1AL21 3RWKX 5F2WA 3UNPA 3V65A 2ARAA 4Y24A 4N7IA 3Q8CA 1ZX5A 1BVP1 2UY9A 4K21A 4XCAA 3J7HA 3IMNA 4AVSA 4CEWA 5H9QA 4YFWA 4CRQA 1PVXA 4AVAA 5L9BA 1B35A 2JD4A 3NWKA 2PLV3 5LATA 2VOTA 3IPVB 2Q8EA 2PHXA 5HCHA 3B01A 4QKDA 5IVYA 1VBC2 4Q4V1 1LENA 4GZ9A 3I3BA 3BU0A 5GZCA 4Q0SA 2JKXA 1JZ4A 3HT1A 4HL0A 2ZA9A 4EN7B 3OEBA 5JLVA 2JECA 5IVVA 4NIGA 3CZUA 1XNDA 1C28A 2WT2A 1X36A 4Y20B 3ZYPA 2JG8B 2VQ0A 1IS6A 5T50A 3SEPA 3ZN5A 5FLJA 3DL3A 2NZ9A 2YYOA 1BXHA 3ZM8A 1HB3A 3BKZA 3QD6A 3FFQA 1LECA 4LPLA 2F17A 1LTEA 3WQ1A 3MBWA 1NLRA 1TZOA 1VRH3 4S2HA 3FBYA 2VW1A 1FI2A 2XJVA 4XHBA 1G6NA 2J42A 4DEVA 1ST8A 2B5HA 4MADA 1EYBA 4P9GA 3VHPA 5KXCA 2PHRA 2PTMA 1PK6B 4ZKTB 3T1LA 4AVBA 2NP0A 3HIFA 3ZN6B 3IZOA 4YVWB 2W9XA 1S0GA 5E89A 5FPUA 4FXKB 2FDIA 4RS5C 5FZBA 2CGPA 4PLNA 4PIYA 3NV4A 2VY0A 3P3PA 4C1WA 1VB4A 2ZGNA 2J7MA 5A3TA 4LK7A 2A3YA 5D8AB 4DXRA 1BHGA 1S55A 1RUC1 1HJFA 3Q8EA 1ZZ6A 1YNAA 3KSCA 5DN2A 3LGRA 1JS9A 2ADDA 3VBOC 3K77A 1UOJA 4YW4A 1HB4A 4CEYB 5EPAA 4Y22B 2YZ4A 5KHHA 3FX3A 1UZWA 4UW6A 4PLMA 4ITCA 1MS0A 1WMXA 2YGMA 3AKPA 2A6XA 1DFQA 1MS5A 5F5CA 1BK1A 5ANQA 2QQMA 5DQ0A 3LSDA 1K5MB 1YI7A 4PLOA 4CA9A 4Q26A 4AI0A 4RSUA 2K0GA 3PMEA 4QPIC 2YU1A 3K3OA 5GZGA 3QOPA 1HV1A 1QDCA 2E63A 5FCCA 5FMOS 4FSJA 1BKZA 4JRAA 4Q1RA 1NZIA 5FP4A 2Z5WA 3P3NA 2PQQA 3RRDA 3RI9A 3POIA 5CFCA 2XOMA 3ZOIA 3OG2A 5FUNA 4EN6B 5JCTA 1WCQA 3MW3A 1LOAA 2O8OA 5BUVA 2FQPA 4QM8A 3VBRC 4HN1A 1OQ1A 2R041 1SZBA 3M2MA 4IV1A 3WNLA 1ZZ9A 3B69A 4BB3A 3PJQA 2VMEA 3OPTA 1DGWA 1RHI1 4M3CE 4XDOA 3OCPA 5FZCA 2OPWA 4QB6A 4CE8A 4LIVA 4PBOA 4FPJA 1Q8PA 4CSWA 5A33A 3I2JA 2PN5A 4A45A 4GQ7A 2P2KA 1R083 2TEPA 2HWE2 4EZ4A 4QHOA 1QJY3 5F5IA 1OURA 1NZCA 3I3QA 1CX1A 4AGRA 4CDXB 3DYPA 1BLZA 5FZ4A 4YPJA 3VBFA 5E8AA 3KM5A 1W0OA 2BGCA 3BYWA 4WVMA 1J3QA 2VTFA 5GLWA 3H42B 1LOBA 1SMVA 2XDVA 3E97A 3SEEA 3VZKA 3ZXDA 1H4GA 1QOOA 4CXXA 3SKVA 3ZPOA 2DVDA 5FPVA 1C57A 1EUTA 1SPPB 3LZZA 1WD4A 3GJBA 2HLEA 2BW8A 5JZGC 4BQYA 3WCSA 3DPRB 3JD72 4LHLA 3PLQA 2DDUA 4PDWC 2VZVA 2QQOA 5IAVA 5C9AB 2YV8A 3W5MA 2QNKA 5CFCC 4CP0A 4W8JA 2B9UA 5LEJA 2YC4A 2HWC2 4I3PA 1ODMA 1SBDA 2QQUA 3IDBB 2RR13 3UESA 3IM0A 3AKRA 1D2QA 2WO3A 1W90A 3U10A 4D7YA 3APBA 5EQUA 1H6YA 2WNVB 5JOXA 2B9VA 2E6VA 2IXLA 2ZAHA 1ZZ7A 1H9WA 1AXZA 2A1XA 2WSUA 1IKQA 1QHDA 1LHWA 1CAWA 1PIV3 4Q4X2 5E16A 5FMBA 4FTEA 1UD1A 5IVEA 4IEQA 1D2SA 1VBC3 1WCKA 2RMU2 4IETA 4P9JA 4XBQA 5FBJA 3RYPA 3VL9A 3LPFA 2YB7A 2VZ3A 1W6OB 2WFF3 3H3LA 2P4EA 3MFAA 5L7OA 1HQNA 1AHSA 1VMHA 4FP2A 5H9SA 3BPSA 1NCRC 4QX3A 4YVSA 4QM9A 1PM7A 4ISRA 3UJOA 4QU2A 1F9KA 3K4DA 2PA7A 3AK0A 2RS52 2WO2A 1W8TA 3VZJA 5IK7A 3H8RA 4KQ7A 5FXVA 1US2A 1RUD3 2ZCWA 3H1MA 2QQJA 2GDFA 1EV12 3OBTA 4FVVA 5IUQA 5I0DA 4WVMB 1HXS3 3WP5A 4IEZA 3J8F1 4F7ZA 1SLIA 1O3QA 1W03A 2W46A 4GWIA 2G1MA 2WO7A 5A7OA 5J48A 4XVHA 5KHJA 1LAJA 1UY1A 1H2LA 1SPPA 5A3PA 1AX1A 1ULGA 2PMWB 4JAAA 4Y1ZA 2WS93 3WF2A 5T5OA 4GXLA 1TVGA 5IVBA 1ACCA 2IVJA 3ZR6A 1QKQA 2X5IB 1E57A 3L2YA 1GNYA 3CL1A 3M1HA 3NNFA 4QKNA 4RFRB 2R072 2SBAA 3WW4A 4ZXKA 4HSLA 2OVUA 4OHXA 1MVEA 2OQ6A 4PF5A 4A7ZA 1PO23 3ZSLA 1Z7S3 2AC1A 3AMQA 4XQ4A 1RITA 5DDJ1 2HEVF 1AYM1 5I0TA 4Q0PA 4L99A 5ACA1 2AGSA 3DYOA 3IAPA 5A70A 1KFUL 3EBRA 3VDDC 2BEOA 5F32A 2NM1A 4QDQA 2FBEA 4FFGA 4MGIE 1CESA 2IC1A 1DBNA 3OUHA 1GBGA 2YBPA 1MEC3 2BNMA 4JTOA 5C4WB 1UPIA 4TN7A 4PBPA 4Y26A 2B42B 3OUJA 3H9AA 5IWFA 5LWBA 2B46X 2HJIA 1EPZA 4XF0A 4NWWA 1BMV2 5T54A 4GA9A 5FPXA 4D7SA 4XOGA 1YWKA 1RUE3 2R0FA 1BEV1 4XXAA 1GWKA 1JUHA 4MVTA 2RHPA 1S2KA 4AI3A 4UFLA 4TTGA 4G4FA 4CDWC 3O1PA 2I74A 4AW7A 5EV7A 4GKYA 4ATFA 2R061 4LO8A 4IE0A 4C0BA 2V09A 4IEXA 4BPZA 5HCBA 1MZFA 3B5LB 4LNVA 2E53A 4LO7A 1N3PA 5DAXA 1UY0A 1UU6A 2HWB1 3VBHB 1W6QB 4MGKE 2VZTA 2WAOA 1KQRA 1BYHA 2P3IA 3ZYJB 1QF3A 2TUNA 4QDRA 1FMD2 1U5YA 1X82A 2P17A 2VW2A 3D82A 4UOJA 4ZY9A 4UI9L 2QQKA 1ASJ2 3ZFFC 2QQNA 4CDUB 4TWTA 5FO7B 4AVVA 2I2SA 4QPWA 1DGRA 5JZGA 2W94A 1QQP2 3LDBA 4DY3A 2ZX1A 4QQOA 4LUKA 1URXA 2B7YA 4E27A 2CDPA 4Z2AA 4UFHA 4ZZ5A 2BGOA 3K4ZA 1LEMA 2R063 1N1YA 4YNIA 4LHKA 2G9GA 1OHFA 1C1FA 3ILNA 3UGHA 2ATFA 3AMHA 4K3UA 4B3NA 4BQ4A 1JBCA 4OULA 1WLWA 5GLZA 5A7SA 4WV8A 1AYN1 4CCOA 1AJKA 1PO12 5D1IA 4JQTA 3WNOA 3UJQA 3L9JT 1POV3 4KL1A 5DG2A 4JQRA 5BNPA 2XUEA 5F39A 3VD5A 4GH4C 4DUWA 1CVNA 2VUAA 3AMMA 1LB2A 1CZTA 3ZVXA 3SKJE 1RUF3 5CBLA 5K8SA 2FZ1A 4BYYA 2JIGA 3E6DA 2X5IC 1VP6A 3K48A 3UYJA 3FUOA 2BU9A 5T55A 3GCXA 4HG6B 3DN7A 3AC0A 4O61A 3AFKA 4MSVA 2R1DA 4KWLA 1PO21 1W2UA 2ORXA 1ZRCA 1OPMA 5LK5A 3GHNA 4YZ1A 3KHCA 5FY1A 2JDYA 1W2OA 1VBD3 1WMFA 1WKYA 4XF4A 2ZS6B 1LOGA 4FOYA 3PUHA 5FXZA 3ZXEA 2VNGA 1ODNA 4L8QA 4CCJA 4LKEA 1W04A 4JGZB 2Q8DA 4QPIA 3VUOA 3OTFA 1H2KA 3KV4A 5IK4A 2AENA 2F4PA 5JDBA 3POWA 4K9SA 2PHLA 2ZGOA 4EJRA 1BBT2 2JG9A 1D0GA 2XGXA 2VZSA 5C4WA 4AI2A 5C3PA 3JU9A 4IV3C 2IZWA 1OVSA 4YZ3A 3WNMA 3RZJA 4XTMA 1EV13 1VAKA 2JDUA 2R7EB 1HDKA 2ET7A 3CNAA 2VCCA 3ELNA 4IE4A 1UW8A 4YGBA 3ZXGA 3VKOA 1AXYA 2AZ5A 4L0PA 5CU1A 2B45X 3W58A 4WM8B 2FCVA 3WG1A 4CUAA 3AXEA 2QQIA 3BGAA 3DECA 2X8KA 1XNKA 3NAPB 3M7AA 4CCNA 5LW9A 2VJXA 3PHMA 4DXZA 1UN1A 2PHTA 4EYUA 1YIFA 2WZR3 2VZ1A 3ZFEC 3TEYA 1CJDA 3O1OA 2A7AA 4QU1A 1KXGA 1OH4A 2B4KA 3GZEA 1X9PA 4QQHA 4IE7A 2VOKA 1RINA 1L3JA 3DXUA 3NRUA 4M4PA 5FZKA 4C1XA 3WG4A 5LA1A 2JB4A 3ZFFB 4CDUC 1JYNA 3TEWA 1RUG2 3KZ4C 3OGGA 3M3CA 4YM1A 5DUWA 4CDQA 1JYIA 4Y1VA 1DU3D 5A32B 4JRLA 4PDWB 4YGDA 4B1MA 3I2OA 1V9U3 2O1QA 2Y6HA 4KMQA 3VDBA 3IB3A 3ZIXA 1JYCA 5BXXA 4Q0VA 1FMD3 3TRSB 4A44A 3VD3A 2VOVA 4J6GA 3UL2A 5C7GA 1DGLA 4CEWB 4D69A 4Q4V3 4D8MA 2IWGB 3JZVA 3AMPA 4HBNA 1W3XA 1ZA4A 3EXUA 4IE5A 5CNAA 3WNXA 4HVQA 4NPRA 1BMV1 4BA6A 1DQ2A 1OT5A 2R073 3AZXA 3WT3A 1ND2C 2WWJA 4I01A 5JR2A 3H3UA 1T6BX 3KB5A 5FKBA 2EIEA 3SCGA 1RVF1 1WMEA 3LEKA 3VB9A 4XBNA 5F3CA 4YG6A 1QQP1 1YXWA 4LR4A 2ZTNA 2MEV1 3IBMA 2OZ6A 3KD4A 4J25A 3HR9A 3IKWA 4R4ZA 4EV0A 2W0XA 1FYUA 4P02B 1F5FA 3VDDB 3I49A 1OH3A 1HXS2 4QX2A 2HWB2 3AYAA 3O0XA 1DQ4A 2RR11 1H8TA 3N9LA 4AEDA 3E5QA 2HWD1 2TNFA 1ENSA 1YQ2A 4FOQA 5IT6A 1WA4A 4XFHA 2WR9A 4BQ2A 3MHZA 4AGVA 4EWDA 4OQ8A 1O3TA 3JQWA 1LEDA 1W8HA 1NAEA 3VBSB 1RUNA 2BERA 5FY9A 5FZDA 4XCBA 1JXNA 4R52A 2HKXA 4AOCA 1APNA 3RJRA 4QPGA 3CDZB 3AKTA 4COZA 1F31A 2VZQA 3GBFA 2LW8A 4YYOA 2VXRA 3W21A 4UW4A 1QJX3 4LITA 5LZ6A 4FCAA 5LRSA 4LBQD 1NLSA 4Q0UA 1PVC1 1HQLA 4NHKA 3T0BA 3GZUC 4PDWA 2XVKA 4C91A 5F3EA 3VGIA 5FMOL 3TWIA 5BYNA 1MPXA 1EV11 4HVOA 4CZSA 2QTWB 4FPFA 4WVZA 3WD5A 3K2OA 3O7OA 1W39A 3KMHA 1AYN2 1QJY1 3AYDA 4IDZA 1RUH1 3POEA 2YU2A 3OY8A 1NCQC 3LOIA 3MZHA 5K4LA 5F6LB 2W39A 2W2IA 1ASJ3 4RQPA 3T2OA 1SACA 3DGTA 3R4UA 2XVLA 5CKNA 4RD7A 4LORA 1NA1B 1RUE1 5HXVA 3W9AA 1NY71 2J1VA 2DBNA 2P34A 4YARA 5E6HA 3O0VA 2D5FA 3N7LA 4H7LA 4N53C 4AFCA 3MDPA 1UZ0A 3KT1A 1HN0A 5F2SA 1SDDB 1WWYA 1W05A 1JTZX 4J1XA 1UWWA 3CEWA 1U12A 4DS0A 2I45A 1TNRA 4JGYB 4OZOA 3INAA 1SEFA 2ZGMA 5FDBA 1HB2A 1VPHA 1YQ6A 2J1AA 2VCBA 4UBHA 4IV1B 4IV3A 3POSA 1AXKA 1YQ5A 2D40A 4RFT0 5ERLA 3VD7A 2QJVA 2R1BA 1AR73 2EXJA 4Q8KA 2VVDA 3N4MA 2Q1ZB 5FP9A 4MGSA 3FZ3A 5F6KA 2OS2A 5JPNB 3Q9OA 3MF6A 5J96B 3AVRA 3KQRA 4D0QA 1CAXB 4A7KA 1V6IA 5E88A 4YW7A 4QHBA 5FPBA 3VBUC 1JYWA 3N9QA 2FDHA 3QCWA 4GB32 4MZUA 1TE1B 1OKQA 3BOPA 4L2NA 2H6CA 4N9HA 5FYSA 3AVSA 1JZ5A 4AXOA 2NMOA 4QDSA 1DQ5A 2XJUA 3UK9A 3WSOA 2RDRA 5IFTA 4LA3A 4DXTA 1IQDC 1RVF2 4EN0A 4ARXA 4AZZA 2O14A 4MGZE 5C3SA 3TN93 2HWD3 4AFMA 3T0DA 3X29B 4FTBA 1FPN2 1QGLA 2Q1MA 1PX3A 3V0BA 2QKDA 1ZVFA 2A75A 1R1A3 1VB2A 1RYYA 5ABJC 1ND2B 2VL4A 2W92A 3NQHA 4IERA 4JGZC 2HWF1 2WKKA 3ZYGA 4AI9A 3A23A 3VKMA 2P6CA 2G9FA 3LAGA 3LEIA 4YW2A 2J1EA 4XDQA 3HNBM 4XFFA 3BVCA 2NYYA 2R043 3B94A 3KGZA 4KBZA 4AEMA 5BNNA 5IATA 2WNUC 5CA6A 1K42A 1G86A 4D6QA 3ROUA 4EN8B 2XWJB 2UWAA 4NRPA 2Y6GA 1XE7A 4HKLA 2R071 1ZBA1 5A1FA 5FR3A 3JCIA 5A3UA 5JOWA 2A5ZA 1J3RA 3ZIWA 1ZYBA 1ULEA 1QJX1 2JE9A 1C1LA 4RHV1 3WDWA 3M3QA 1GLHA 4Y4YA 1POV1 3V56A 1OOPC 3D3AA 1XBFA 5ANNA 3SISA 1I3HA 5FMDA 3FC0A 2ES3A 2VAUA 4BHPA 1R1A1 4HFSA 4DFSA 5K0UC 3NJZA 2BP6A 2EIDA 4I3GA 5LA9A 2E32A 1LU1A 2NQYA 2A6YA 4XQDA 2B39A 2IFWA 3UV9A 2VNRA 5EJZB 4A6OA 4GMP0 4YVSB 2RMU3 2VULA 1K45A 2HBTA 1UO9A 3EYPA 3LQCA 4LQRA 3VBFB 1CR7A 2P6HA 2RVAA 3ZFEA 3ZLIA 5FZ3A 4HK8A 2OXBA 1AR92 1ZBE3 1CGPA 3NAPA 2CL2A 1C8NA 1Q56A 2YFUA 4KWUA 1UZYA 5LA0A 1A34A 2CY6A 4RGAA 3AB0A 3U4SA 3N9PA 3I2HA 3POFA 1DG6A 1NCQB 4H7MA 4URTA 1LHOA 3JB4C 1PNFA 1WLDA 4NHXA 4AHZA 3POBA 4FPKA 1ZRFA 1CJPA 2C5DA 4XPVA 4IV3B 5FYHA 5FZHA 1E5IA 3NSTA 2GAUA 1CPNA 4OUMA 3ASIA 1PGW1 1RJ8A 4XFBA 5FLHA 1XB9A 1QNYA 1N1SA 1W6MA 4FFFA 2D6PA 3Q8AA 4LBMA 2YXSA 3RNSA 4LK6A 4N43B 3VBUB 4P5YA 5DDJ3 5A7WA 3TEZA 1E5HA 2JG8C 4I30A 4S2DA 3RMXA 3MPBA 2WAAA 4QD2A 3NAPC 4LBQB 3CF6E 1XRUA 2QDNA 3AXDA 2HYXA 1CAWB 1I6XA 1VRBA 2ZKLA 4JKLA 4ZHNA 4CUGA 2CSGA 4TYSA 4CCCA 3B93A 2VCMA 3LD8A 2JE8A 3QLQA 1JU4A 4DRVA 3AKSA 1MEC1 2WS91 4E4ZA 5K0UA 3AM2A 4R8HA 2XJRA 1V70A 3GYDA 5ABJB 2WJSA 1QY4A 3LA3A 3D0SA 2XONA 1DP0A 3WLUA 3ON7A 1F4HA 4COYA 1K5MA 1S0EA 5FP8A 1PVC3 1LGNA 2ARBA 1FXZA 1SHWB 1RB8G 1F2NA 2Y64A 1AX2A 2W1WA 2VVFA 2ZEWA 4CP9B 1QEXA 4FPCA 2DVGA 1AL22 1TNFA 4G9SB 4EE2A 1DDLA 2KM2A 4COUA 4L92A 1A6CA 1DHKB 3T09A 4L11A 3BU7A 3LEGA 1MS4A 4IEOA 5EYXA 5FXWA 3BI3A 2QE3A 2JENA 2D7FA 4B7EA 2WLPA 1UAIA 2XL9A 3C7GA 3LIHA 3H3ZA 5JXIA 3ZXKA 4YGEA 5A32A 3PUAA 4YRDA 4BH9A 1BEV3 5CFDB 1UNBA 1U5IA 2VE1A 1QOTA 1YEWA 2XLFA 5EYYA 3AJZA 2Z2SB 3ZR5A 3FL7A 5GZFA 1W8OA 2D6LX 3N35A 4BE3A 4JGYC 2PAKA 5BPXA 2WA4A 1FNYA 4BMEA 4XAAA 5CAZA 3ZYBA 1GU3A 1W28A 3R4DB 1UXZA 2BVVA 1LHVA 2HWB3 1LOCA 1LOFC 1ZRIA 2VBDA 4OYUA 1OI6A 4UWDA 4D6SA 2XPJA 4NOTA 2G9ZA 3CJXA 2LALA 1PK6A 4NHLA 4FFHA 3DCQA 5A7PA 2D3PA 1PZ8A 3P6BA 5FPZA 4WZFA 5K0UB 1WBFA 4AQ6A 4NO4A 2YY1A 1G9FA 4X6RB 1TQ5A 1CZSA 1OPOA 2OPKA 2ZBJA 3W20A 1NCQA 4ARYA 5ACA2 1FV2A 4DOUA 1PIV1 5I93A 5L9RA 2XQXA 4M3CB 1NE4A 2VG9A 4LKFA 5DDJ2 2QBXA 3IN9A 3LB9A 4FOVA 4EZHA 3T4VA 2Q5TA 3KHBA 3MW4A 2RS53 2PQSA 2QFEA 2PAMA 5JI9A 3ORJA 1Z78A 2Y26A 4IQPA 1MS9A 4GULA 5DZFA 4XFCA 1UL9A 3ZSJA 3JQXA 4CDXC 1WW5A 3WXPA 3CLPA 2UYAA 4AHYA 4EN9B 1K3IA 1HRV1 3AP6A 1MQTA 3B9CA 2VGDA 2PLV1 1WLCA 3WP3A 2ERFA 1NA1C 3ACHA 3AZZA 4NMIA 4ATEA 4RGGA 1V9U2 2BQPA 3RMYA 5KC5A 2VZRA 4LO4B 2PYTA 3GHMA 1X33A 2VMDA 3NKGA 4XILA 4NIHA 4CPBA 1DQ0A 3BIWE 3FHAA 3PMSA 1FNZA 4JX0A 5EIYB 1IS4A 4OI0A 1AL0G 1DZTA 2BRTA 1IZ3A 1Q8SA 3IDEA 5C9AC 4DXSA 3SNMA 1HRI3 2X29A 1WA6X 2V73A 2W1SA 4BLIA 5BNQA 3PUSA 4OHYA 2VCAA 3LDRA 5DZGA 2VH9A 3FE5A 2VR4A 5CFCB 2RM23 3NW4A 2DU1A 2PLV2 4XF3A 3U4XA 3ECQA 1W06A 1SFNA 4JKKA 1T2XA 1H1AA 1BK0A 1VRH1 4GD4A 1QJEA 2XBO3 2Y6LA 2YBSA 3GALA 2ZXQA 2WN3A 4GMP3 3I2FA 3TNPB 3VDCA 2Q0AA 2RMU1 2YDEA 1N47A 1W8ZA 4OHWA 2DVBA 2YBKA 3K51A 4NR1A 3PVOA 1HXS1 2WS92 1QJZA 3MIDA 2XUMA 3KV6A 2CAUA 5C3OA 4UF0A 1I5ZA 3HVDA 3SH5A 3O1VA 1XNTA 3NL1A 2VU9A 4LA2A 5D2AA 3POGA 2GP3A 1UOFA 3U14A 1BBT1 1I9RA 2WYFA 1NCRB 1OLMA 2O8QA 2ZABA 5FRAA 3MF9A 1R091 1C3HA 3PNAA 2HWC1 5J09A 2DUQA 5CFDC 1D4M3 1I5PA 4P5HA 3OYWA 4KWJA 5CFDA 1VBD2 3HMYA 4JDNA 2ID4A 1VBA3 1OA3A 1HX6A 2C9KA 3OUIA 4KGQA 3HEIA 1GUIA 3AYCA 1OKOA 3I97A 2IXIA 3MV11 1Q43A 4ZU4A 4A6SA 1CAXA 4E9KA 4K40A 1JZ7A 5JOZA 1QJX2 4QQ2A 2JB8A 1JYVA 3JBG2 4IGOA 1XQNA 4MH0E 2WQ4A 5HBAA 3WHUA 1W0PA 4AI8A 1YYNA 1S2EA 2ADEA 3C7FA 4ZPIA 4A3ZA 5J1XA 1CD3G 4OMDA 1AYN3 5SV5A 2E7TA 3U11A 1OVPA 2WO1A 4MLOA 4JDOA 4NRMA 5B4XA 3TEXA 3W5NA 5GLTA 3UKVA 4INDA 3FN9A 1CIYA 4B7KA 4MGQA 4DUVA 3H8XA 1S4CA 2H0BA 3VHRA 5IVJA 4TLGA 1V6KA 2ZGTA 4M3CA 5A3WA 5F7UA 1OLQA 1PO11 5CADA 2QDRA 3S0MA 1YRZA 1IS3A 2A3XA 3CQOA 2C4XA 5EWSA 2E33A 4OVEA 1FPN1 4RR3C 3O1RA 2J1TA 3MUZ1 3AJYA 3EO6A 3C7EA 3J7MA 5G05L 1SLLA 4PJYA 4EWAA 5BNNB 2GC2A 3OEAA 3MPPG 3OBZA 5CKQA 1RGSA 1QQP3 2VZPA 4HZFA 4MGYE 2W91A 3WVJA 3PTRB 1V00A 4MG2A 4P14A 1SLAA 2AYHA 1B09A 1IQAA 2PXJA 1AVBA 1CAUB 3I2IA 4PI0A 1HLCA 1LOFA 4DZGA 3I2GA 2IXHA 1H6XA 2GC0A 1VMFA 3QH6A 2ZEYA 3CJIA 3D8CA 4KBBA 1FV3A 3AZYA 4E2GA 1WCDJ 3RYKA 2JD9A 5FWEA 5L7OC 2K46A 3KVAA 4CDUA 3PIJA 2RE9A 2OIIA 1ND3A 3H0OA 2VBPA 5HCFA 3THDA 3WDYA 4YZ5A 4FI9A 1JOPA 3I4IA 2W1QA 2OW4A 2CNAA 2VMIA 4XF9A 2DWRA 4L9BA 3VBHC 1DGWX 4IE6A 4YWAA 4GMP1 4FO9A 4OI2A 5CG9A 1NA1A 4I0AA 2WDBA 2W95A 2WNUA 3AZVA 5T5JA 1MQTC 4NAOA 5IK5A 2D6KA 1LHUA 1OMIA 3SQOA 2AUYA 5D21A 4LBNA 3R0RA 3T08A 3U07A 3USUB 4CXWA 4BIFA 3WP4A 4FOWA 4META 1Y7BA 1EY2A 4Y1YA 1BVVA 4HANA 3ZSKA 2DV9A 4JGYA 1MZ6A 1R093 1XNAA 2GN7A 4XTPA 2QVSB 4CEYC 2IVIB 4BU2A 5GM0A 5DPNA 1LR5A 2WZR2 2ZACA 4CEYA 5FY0A 1V6OA 4QX8A 1AYM2 4B8EA 1D0HA 1YQ8A 5KC6A 4IL7A 2WFF1 1ZZ8A 4YSFA 4H3WA 3VBOA 3BB6A 3KLSA 3PIGA 4A2UA 3T0AA 3GZTB 1VBA2 3PDQA 4Z2WA 1L7QA 1S2BA 4YLZA 5B4NA 3O1SA 5LB6A 3ZXAC 4R9DA 5I0RA 4KU7A 4Z8BA 5DMYA 3AL5A 1F15A 2EICA 1J3PA 5I8YA 1DYOA 3KT7A 3U75A 4E8DA 5FLIA 2W47A 3G6JB 4Y5TA 4KU8A 1GZCA 2JDPA 2Y38A 4Q4V2 3D5OA 4YG0A 1CPMA 3J7NA 3V0AB 1E5RA 1H8TC 5FXXA 4GJYA 1S0CA 2WRAA 4XFIA 4GWMA 1W0NA 5FYBA 2YC2A 1F4AA 1O59A 2VD7A 3RS6A 1RUH2 1VLNA 2JDKA 4SLIA 3T2TA 1C5IA 1V6MA 2P1BA 3D0JA 4Y5Z0 3CJIC 4OZXA 2D93A 3HQRA 2JDMA 4K1YA 3WX5A 4UYBA 2FCUA 5FAXA 2XVGA 5LCWL 3WW2A 1C4RA 4Q29A 5JPMB 1Q8VA 1BEV2 1H4HA 1GV9A 4ZU5A 1O4ZA 2IUWA 1C8M1 2JEMA 4Q4Y3 3HQXA 4DY5A 2RDSA 4LBJA 2NMNA 3W59A 2GNMA 2WSVA 2XMLA 2XLAA 5ISLA 4WVWA 2V72A 4MOAA 1UF2C 1HIXA 2IXJA 4UW3A 1VAMA 1W6PB 1MS1A 1Q5OA 1REFA 3BN6A 1PGL2 2UWBA 4I0WB 2AR6A 3ZYHA
chains in the Genus database with same CATH topology
2J1AA 2VCBA 4LPLA 1OD3A 2Y6KA 3THCA 4AG4A 3VD7A 3MBWA 1PMJX 2CDOA 3ACGA 4MGSA 1O8PA 5CZKA 4DEVA 4BXSV 4MADA 4D0QA 3GGLA 5JUVA 2W9XA 1JYWA 2EIBA 4XUTA 2E26A 4MO3M 4UAPA 1XPWA 1JZ5A 1ULOA 4QDSA 1JI6A 2W5FA 2J7MA 3WSOA 3C7OA 5IFTA 4DXTA 1IQDC 4DXRA 1BHGA 4ARXA 1W9TA 5DN2A 3T2PA 3K77A 3T0DA 4XURA 1DLCA 1PX3A 2JDAA 2Z4FA 1RYYA 2J1SA 2VL4A 2W92A 3NQHA 5JMOA 3FHQA 4BK5A 3A23A 2LS6A 3IAQA 3LEIA 2QQMA 5DQ0A 2J1EA 3HNBM 1LNSA 1W8NA 1K42A 2J22A 3CMGA 3U37A 2BGPA 3CKHA 2Y6GA 3ABZA 2XOMA 3OG2A 3EB7A 1WCQA 4OMCA 4PT6A 5JXJA 3WNLA 3HNYM 3T2QA 3K46A 3D3AA 2VMEA 5C70A 4M4RA 4QB6A 2EIDA 2E32A 1OF4A 3I2JA 5EJZB 4A45A 4A6OA 3EYPA 1K45A 3LQCA 5EJ1B 4LQRA 2RVAA 3E1F1 1TG7A 1CX1A 2Y6JA 3DYPA 4YPJA 2YFUA 4KWUA 5LA0A 1NUKA 3I2HA 3NNGA 2VTFA 3SEEA 2YFZA 2ZEXA 3SKVA 1UXXX 1EUTA 3C8XA 2HLEA 4CUBA 2DDUA 2VZVA 2QQOA 3W5MA 2DCJA 4P5YA 3IIIA 2C26A 4RYDA 4W8JA 4QB1A 2YC4A 2WAAA 4JHZA 2VQUA 3UESA 1KEXA 2HYXA 2WO3A 4JKLA 1HN1A 1H6YA 2X10A 3GM8A 2B9VA 2WUHA 3IDAA 2JE8A 2VZUA 1JU4A 3I3DA 2X05A 4W50A 3OGSA 3LPFA 4QX1A 2YB7A 2VZ3A 4CVUA 3HJRA 3WF3A 2WQ8A 3ACIA 2XONA 1DP0A 1F4HA 3CIHA 3WF1A 4QB2A 4QX3A 1UY2A 1SHWB 4OUEA 2Y64A 4LHSA 2Y8KA 3K4DA 3GDBA 5HPOA 2WO2A 2W1WA 3HOBA 1US2A 2QQJA 3MUY1 2ZEWA 1KGYA 5I0DA 1UYYA 4KI5M 1JZ6A 3T09A 3LEGA 4GWIA 2W46A 3DYMA 4XVHA 5LA2A 3CZJA 1UY1A 1W9WA 1XC6A 3C7GA 1W9SA 2X09A 1GQPA 5JXIA 3WF2A 4P00B 1TVGA 2J1UA 1GNYA 3FL7A 1W8OA 3WF0A 5JXHA 1GU3A 4CU9A 3NJXA 1UXZA 4JKMA 2OKXA 2BBAA 4OYUA 2WZ8A 3GXUA 3OBAA 3DYOA 3IAPA 3P6BA 2J1RA 5JXGA 4QDQA 1CZSA 4ARYA 2DCKA 3JXSA 1K12A 2WN2A 2XQXA 4AAXA 2QBXA 2BZDA 1PX4A 2PQSA 3K75B 4TXWA 1UY4A 1K3IA 1NX9A 4TTGA 4A41A 3WNNA 3A22A 3ACHA 3HN3A 1EUUA 2VZRA 4ET7A 2VMDA 1W99A 2ZEZA 3FHAA 4JX0A 5EIYB 4A4AA 1UY0A 5IYYA 1UY3A 4DXSA 2W1SA 2E31A 2VZTA 2WAOA 2VZOA 4CU6A 2VC9A 2VCAA 4QDRA 4RN5A 2VR4A 4UOJA 4ZY9A 4UI9L 2QQKA 2QQNA 2W1UA 4QPWA 3ECQA 2W94A 1SG3A 4JKKA 5G04L 1T2XA 4BJ0A 2WZEA 2VMFA 2CDPA 2Y6LA 4Z2AA 4A42A 4ZZ5A 2BGOA 3K4ZA 2ZXQA 4W4ZA 3LE0A 2WN3A 3I2FA 3VDCA 3WNKA 1O8SA 1XNTA 2W87A 5IJRA 3WNOA 1PMHX 5HXMA 3VD5A 4DUWA 3F2ZA 1CZTA 3HNMA 3SKJE 4CUCA 3I3EA 2RJ2A 2VMCA 1I5PA 5C71A 3PUIA 2ID4A 2C9KA 4KMQA 3HEIA 1GUIA 3MV11 3I97A 4HG6B 1JZ7A 3AC0A 1JZ2A 1JYVA 1P8JA 3I2KA 2ORXA 2VO5A 3C7FA 4A3ZA 5J1XA 4OMDA 2WO1A 3W5NA 5B4XA 1WKYA 1L7RA 3PUHA 1UYXA 3FN9A 1CIYA 3OGVA 4MGQA 4DUVA 3WF4A 1UMIA 4DEQA 2RV9A 2VZSA 4ZZ8A 1JYXA 3OB8A 5F7UA 4BK4A 3C7HA 1OF3A 2V5DA 3CQOA 3K4AA 3WNMA 1GOHA 4QAWA 2C4XA 2R7EB 3ETPA 4BDVB 2E33A 2VCCA 3NJVA 4IUGA 4L0PA 2J1TA 3MUZ1 4CUAA 5G05L 3C7EA 4XUQA 2YG0A 2V4VA 4CU8A 3OEAA 2WYSA 3VD9A 1R64A 2QQIA 3BGAA 3DECA 2VZPA 1JU3A 2W91A 2WABA 3A21A 5FUIA 4XUPA 3WEZA 2KD7A 5CYYA 2VJXA 3I2IA 3ACFA 4GWJA 3I2GA 3OGRA 4CU7A 2VZ1A 1H6XA 2ZEYA 4LKSA 2B4KA 1OH4A 5A1AA 4XUOA 4M4PA 2JD9A 2VQTA 3NRUA 4ZXEA 5LA1A 1JYNA 1CZVA 3THDA 3LPGA 4E8CA 4FI9A 2W1QA 3VDBA 2Y6HA 1GOGA 2XHNA 3IB3A 1US3A 4A44A 4QX0A 3VD3A 3VDAA 5C7GA 3WQBA 4D8MA 2WDBA 2W95A 1OT5A 1JHJA 3T08A 5JR2A 1D7PM 2EIEA 3LEKA 1J83A 3VD4A 4DUXA 1ULPA 1XNAA 5DPNA 2W3JA 4P02B 1GOFA 4QX2A 1UX7A 5IHRA 3UETA 4XUNA 1YQ2A 3T0AA 1J84A 2WBKA 1JZ8A 1L7QA 1NAEA 5B4NA 2BERA 3CDZB 5DMYA 2VZQA 1NKGA 2LW8A 2EICA 4PF1A 5IFPA 2QQLA 1DYOA 4E8DA 2W47A 1UYZA 4PQQA 1GMMA 3T0BA 4XZUG 1W0NA 2ORZA 3UNPA 2YC2A 1F4AA 1MPXA 1O59A 3WNPA 3J7HA 4P08A 3HPNA 2L9LA 5LCWL 3MO4A 3T2OA 2VOTA 3MV01 1JZ3A 4GZ9A 3I3BA 2JKXA 2J1VA 1JZ4A 3OEBA 1UZ0A 1UMHA 1SDDB 2V72A 3CZUA 3P1IA 4MOAA 2VM9A 1UWWA 3SEPA 4OZOA 3BN6A 3A7QA 3ZM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1A A;  2VCB A;  4LPL A;  1OD3 A;  2Y6K A;  3THC A;  4AG4 A;  3VD7 A;  3MBW A;  1PMJ X;  2CDO A;  3ACG A;  4MGS A;  1O8P A;  5CZK A;  4DEV A;  4BXS V;  4MAD A;  4D0Q A;  3GGL A;  5JUV A;  2W9X A;  1JYW A;  2EIB A;  4XUT A;  2E26 A;  4MO3 M;  4UAP A;  1XPW A;  1JZ5 A;  1ULO A;  4QDS A;  1JI6 A;  2W5F A;  2J7M A;  3WSO A;  3C7O A;  5IFT A;  4DXT A;  1IQD C;  4DXR A;  1BHG A;  4ARX A;  1W9T A;  5DN2 A;  3T2P A;  3K77 A;  3T0D A;  4XUR A;  1DLC A;  1PX3 A;  2JDA A;  2Z4F A;  1RYY A;  2J1S A;  2VL4 A;  2W92 A;  3NQH A;  5JMO A;  3FHQ A;  4BK5 A;  3A23 A;  2LS6 A;  3IAQ A;  3LEI A;  2QQM A;  5DQ0 A;  2J1E A;  3HNB M;  1LNS A;  1W8N A;  1K42 A;  2J22 A;  3CMG A;  3U37 A;  2BGP A;  3CKH A;  2Y6G A;  3ABZ A;  2XOM A;  3OG2 A;  3EB7 A;  1WCQ A;  4OMC A;  4PT6 A;  5JXJ A;  3WNL A;  3HNY M;  3T2Q A;  3K46 A;  3D3A A;  2VME A;  5C70 A;  4M4R A;  4QB6 A;  2EID A;  2E32 A;  1OF4 A;  3I2J A;  5EJZ B;  4A45 A;  4A6O A;  3EYP A;  1K45 A;  3LQC A;  5EJ1 B;  4LQR A;  2RVA A;  3E1F 1;  1TG7 A;  1CX1 A;  2Y6J A;  3DYP A;  4YPJ A;  2YFU A;  4KWU A;  5LA0 A;  1NUK A;  3I2H A;  3NNG A;  2VTF A;  3SEE A;  2YFZ A;  2ZEX A;  3SKV A;  1UXX X;  1EUT A;  3C8X A;  2HLE A;  4CUB A;  2DDU A;  2VZV A;  2QQO A;  3W5M A;  2DCJ A;  4P5Y A;  3III A;  2C26 A;  4RYD A;  4W8J A;  4QB1 A;  2YC4 A;  2WAA A;  4JHZ A;  2VQU A;  3UES A;  1KEX A;  2HYX A;  2WO3 A;  4JKL A;  1HN1 A;  1H6Y A;  2X10 A;  3GM8 A;  2B9V A;  2WUH A;  3IDA A;  2JE8 A;  2VZU A;  1JU4 A;  3I3D A;  2X05 A;  4W50 A;  3OGS A;  3LPF A;  4QX1 A;  2YB7 A;  2VZ3 A;  4CVU A;  3HJR A;  3WF3 A;  2WQ8 A;  3ACI A;  2XON A;  1DP0 A;  1F4H A;  3CIH A;  3WF1 A;  4QB2 A;  4QX3 A;  1UY2 A;  1SHW B;  4OUE A;  2Y64 A;  4LHS A;  2Y8K A;  3K4D A;  3GDB A;  5HPO A;  2WO2 A;  2W1W A;  3HOB A;  1US2 A;  2QQJ A;  3MUY 1;  2ZEW A;  1KGY A;  5I0D A;  1UYY A;  4KI5 M;  1JZ6 A;  3T09 A;  3LEG A;  4GWI A;  2W46 A;  3DYM A;  4XVH A;  5LA2 A;  3CZJ A;  1UY1 A;  1W9W A;  1XC6 A;  3C7G A;  1W9S A;  2X09 A;  1GQP A;  5JXI A;  3WF2 A;  4P00 B;  1TVG A;  2J1U A;  1GNY A;  3FL7 A;  1W8O A;  3WF0 A;  5JXH A;  1GU3 A;  4CU9 A;  3NJX A;  1UXZ A;  4JKM A;  2OKX A;  2BBA A;  4OYU A;  2WZ8 A;  3GXU A;  3OBA A;  3DYO A;  3IAP A;  3P6B A;  2J1R A;  5JXG A;  4QDQ A;  1CZS A;  4ARY A;  2DCK A;  3JXS A;  1K12 A;  2WN2 A;  2XQX A;  4AAX A;  2QBX A;  2BZD A;  1PX4 A;  2PQS A;  3K75 B;  4TXW A;  1UY4 A;  1K3I A;  1NX9 A;  4TTG A;  4A41 A;  3WNN A;  3A22 A;  3ACH A;  3HN3 A;  1EUU A;  2VZR A;  4ET7 A;  2VMD A;  1W99 A;  2ZEZ A;  3FHA A;  4JX0 A;  5EIY B;  4A4A A;  1UY0 A;  5IYY A;  1UY3 A;  4DXS A;  2W1S A;  2E31 A;  2VZT A;  2WAO A;  2VZO A;  4CU6 A;  2VC9 A;  2VCA A;  4QDR A;  4RN5 A;  2VR4 A;  4UOJ A;  4ZY9 A;  4UI9 L;  2QQK A;  2QQN A;  2W1U A;  4QPW A;  3ECQ A;  2W94 A;  1SG3 A;  4JKK A;  5G04 L;  1T2X A;  4BJ0 A;  2WZE A;  2VMF A;  2CDP A;  2Y6L A;  4Z2A A;  4A42 A;  4ZZ5 A;  2BGO A;  3K4Z A;  2ZXQ A;  4W4Z A;  3LE0 A;  2WN3 A;  3I2F A;  3VDC A;  3WNK A;  1O8S A;  1XNT A;  2W87 A;  5IJR A;  3WNO A;  1PMH X;  5HXM A;  3VD5 A;  4DUW A;  3F2Z A;  1CZT A;  3HNM A;  3SKJ E;  4CUC A;  3I3E A;  2RJ2 A;  2VMC A;  1I5P A;  5C71 A;  3PUI A;  2ID4 A;  2C9K A;  4KMQ A;  3HEI A;  1GUI A;  3MV1 1;  3I97 A;  4HG6 B;  1JZ7 A;  3AC0 A;  1JZ2 A;  1JYV A;  1P8J A;  3I2K A;  2ORX A;  2VO5 A;  3C7F A;  4A3Z A;  5J1X A;  4OMD A;  2WO1 A;  3W5N A;  5B4X A;  1WKY A;  1L7R A;  3PUH A;  1UYX A;  3FN9 A;  1CIY A;  3OGV A;  4MGQ A;  4DUV A;  3WF4 A;  1UMI A;  4DEQ A;  2RV9 A;  2VZS A;  4ZZ8 A;  1JYX A;  3OB8 A;  5F7U A;  4BK4 A;  3C7H A;  1OF3 A;  2V5D A;  3CQO A;  3K4A A;  3WNM A;  1GOH A;  4QAW A;  2C4X A;  2R7E B;  3ETP A;  4BDV B;  2E33 A;  2VCC A;  3NJV A;  4IUG A;  4L0P A;  2J1T A;  3MUZ 1;  4CUA A;  5G05 L;  3C7E A;  4XUQ A;  2YG0 A;  2V4V A;  4CU8 A;  3OEA A;  2WYS A;  3VD9 A;  1R64 A;  2QQI A;  3BGA A;  3DEC A;  2VZP A;  1JU3 A;  2W91 A;  2WAB A;  3A21 A;  5FUI A;  4XUP A;  3WEZ A;  2KD7 A;  5CYY A;  2VJX A;  3I2I A;  3ACF A;  4GWJ A;  3I2G A;  3OGR A;  4CU7 A;  2VZ1 A;  1H6X A;  2ZEY A;  4LKS A;  2B4K A;  1OH4 A;  5A1A A;  4XUO A;  4M4P A;  2JD9 A;  2VQT A;  3NRU A;  4ZXE A;  5LA1 A;  1JYN A;  1CZV A;  3THD A;  3LPG A;  4E8C A;  4FI9 A;  2W1Q A;  3VDB A;  2Y6H A;  1GOG A;  2XHN A;  3IB3 A;  1US3 A;  4A44 A;  4QX0 A;  3VD3 A;  3VDA A;  5C7G A;  3WQB A;  4D8M A;  2WDB A;  2W95 A;  1OT5 A;  1JHJ A;  3T08 A;  5JR2 A;  1D7P M;  2EIE A;  3LEK A;  1J83 A;  3VD4 A;  4DUX A;  1ULP A;  1XNA A;  5DPN A;  2W3J A;  4P02 B;  1GOF A;  4QX2 A;  1UX7 A;  5IHR A;  3UET A;  4XUN A;  1YQ2 A;  3T0A A;  1J84 A;  2WBK A;  1JZ8 A;  1L7Q A;  1NAE A;  5B4N A;  2BER A;  3CDZ B;  5DMY A;  2VZQ A;  1NKG A;  2LW8 A;  2EIC A;  4PF1 A;  5IFP A;  2QQL A;  1DYO A;  4E8D A;  2W47 A;  1UYZ A;  4PQQ A;  1GMM A;  3T0B A;  4XZU G;  1W0N A;  2ORZ A;  3UNP A;  2YC2 A;  1F4A A;  1MPX A;  1O59 A;  3WNP A;  3J7H A;  4P08 A;  3HPN A;  2L9L A;  5LCW L;  3MO4 A;  3T2O A;  2VOT A;  3MV0 1;  1JZ3 A;  4GZ9 A;  3I3B A;  2JKX A;  2J1V A;  1JZ4 A;  3OEB A;  1UZ0 A;  1UMH A;  1SDD B;  2V72 A;  3CZU A;  3P1I A;  4MOA A;  2VM9 A;  1UWW A;  3SEP A;  4OZO A;  3BN6 A;  3A7Q A;  3ZM8 A; 
#chains in the Genus database with same CATH topology
 1QH7 A;  2Y6K A;  3THC A;  2IFR A;  4AG4 A;  4C90 A;  4AI1 A;  3SLI A;  2ZMK A;  4OQ9 A;  3SCH A;  5L9V A;  3B9I A;  1K5J A;  3ZYF A;  2CDO A;  2RR1 2;  3ACG A;  1RUG 1;  3WW1 A;  2UU8 A;  4Q1P A;  5CZK A;  4AWD A;  5C5T A;  5HCA A;  2D6N A;  4X8P A;  5JWP A;  4SBV A;  4UBG A;  3BTX A;  3NV3 A;  3PL0 A;  3WDX A;  1W6N A;  4FQ4 A;  3GGL A;  4AR2 A;  3N7J A;  3T1M A;  5FYM A;  1GKB A;  4JCK A;  3Q8B A;  4U2A A;  4XUT A;  5SV8 A;  3FMG A;  4AFA A;  5FYI A;  1RED A;  2E26 A;  4FP3 A;  2Y60 A;  4OI4 A;  4UAP A;  1NXD 1;  1FAY A;  1ULO A;  2EAL A;  5FRE A;  2WNE A;  1FX5 A;  1JI6 A;  4XJ8 A;  5BNO C;  3C7O A;  1VBA 1;  3NVC A;  4DQA A;  2VMG A;  1LUL A;  1GP6 A;  4HKW A;  1UMZ A;  3O1U A;  2ZJC A;  4K6B A;  1CWP A;  1O7F A;  5AFE A;  5FZ9 A;  2ZHN A;  1NCR A;  3QH7 A;  2A6V A;  2PHU A;  4H14 A;  3U1X A;  4CEW C;  1DLC A;  5KXD A;  4D6R A;  3URF A;  2JDA A;  1Q8Q A;  3MW2 A;  1CN1 A;  1IPJ A;  3FHQ A;  1BZW A;  4BK5 A;  2XKP A;  1OUX A;  4EQV A;  1XE0 A;  2LS6 A;  1GAN A;  3IAQ A;  1ULD A;  3OBR A;  4LLO A;  4DPN A;  3I3M A;  2RS5 1;  1UYP A;  3VBO B;  5GLV A;  3RWN A;  4MYE A;  1DQ6 A;  1IGO A;  3KS7 A;  2AEZ A;  3MIE A;  1VBB 2;  3VBR B;  2EVX A;  1O5L A;  1S0B A;  2J22 A;  3CMG A;  3U37 A;  5A6Q A;  2BGP A;  3CKH A;  4XJW A;  3TYJ A;  4RS5 B;  4CXY A;  1W6Q A;  2JJ6 A;  3ZDS A;  1AYM 3;  2GAL A;  4BIS A;  2R04 2;  4ASL A;  5H9R A;  4GKX A;  5EFU A;  1PO2 2;  2BTV C;  3I8T A;  3EB7 A;  3POJ A;  1NOV A;  5C33 A;  2AH2 A;  1N3Q A;  1YFY A;  1A3K A;  4PT6 A;  4QPI B;  2JDN A;  3N7K A;  1JN2 P;  1NT0 A;  3HNY M;  1POV 0;  2PHF A;  3K46 A;  3T2Q A;  4D7T A;  3KT4 A;  5JZG B;  5C70 A;  1WW6 A;  1CQ9 A;  2VPV A;  4M4R A;  2ENR A;  3N7M A;  5JSO A;  1POQ A;  2A70 A;  3LDK A;  3NNJ A;  4H55 A;  2D6O X;  1ZRD A;  2CU5 A;  4QX7 A;  5JI7 A;  1BJQ A;  1OF4 A;  1H30 A;  1QH6 A;  4XBL A;  1ENQ A;  1HKD A;  1EP0 A;  1MS8 A;  2GN3 A;  5LK7 B;  4WM8 A;  4IEW A;  2A73 B;  5EZW A;  5EJ1 B;  1GWL A;  3DF0 A;  3T30 A;  5DUX A;  3E1F 1;  2BWC A;  1HRV 3;  3JD7 1;  1AR6 2;  4HPK A;  1KIT A;  2Y6J A;  1B35 C;  5FJH A;  2EA7 A;  1HW5 A;  3CBN A;  1YFW A;  1VR3 A;  3MLK A;  1LGC A;  3M3O A;  4LJH A;  4NAM A;  1QIQ A;  1KS5 A;  2WT1 A;  3KCY A;  3NO8 A;  3NNG A;  4LE3 A;  2A6W A;  4Z92 B;  4AQ2 A;  4YZ4 A;  4CDX A;  1GZT A;  1GZW A;  4RGK A;  1ZRR A;  2RS3 3;  2W68 A;  4WBB A;  3LKJ A;  2UY8 A;  2ZX2 A;  4QWN A;  2YFZ A;  2ZEX A;  4Y22 A;  5FKC A;  5LBF A;  5KXE A;  2ZHK A;  4ASM B;  4AQS A;  1UXX X;  3C8X A;  1WD3 A;  2BUK A;  2VBB A;  1JYX A;  2B8M A;  5FZO B;  2G4I A;  1OA2 A;  2IXK A;  1RVF 3;  2WNV C;  5FZ6 A;  3TOJ A;  1O3S A;  1YC6 1;  5JAX A;  2C6S A;  4Q4X 3;  2C26 A;  3EQE A;  1QXJ A;  3UGG A;  2VQU A;  1R1A 2;  2YUE A;  4QPG C;  1U5X A;  1I1E A;  1KEX A;  5FZ8 A;  3OJB A;  1DQ1 A;  5C5U A;  3ILF A;  3O12 A;  1TME 1;  4E2Q A;  3DKW A;  1HN1 A;  2CGN A;  2MHF A;  2X10 A;  1V9U 1;  1ONA A;  3GM8 A;  1E5S A;  4JGZ A;  4Q4Y 1;  2WUH A;  2BOI A;  5C3R A;  2JIJ A;  2ZX0 A;  2VZU A;  5JSP A;  2ZZQ A;  4N9I A;  1X8M A;  2XG3 A;  3I59 B;  2QQP A;  1W6O A;  5L7O B;  5FFO C;  4LKD A;  3RQ0 A;  3ZXF A;  2XQR A;  4PIZ A;  3RG0 A;  4W50 A;  4E4D X;  1DGR N;  1IPK A;  3DEM A;  4QX1 A;  1J1T A;  1SBE A;  3EMR A;  3HJR A;  3WF3 A;  3ACI A;  1XJA A;  5F1R A;  4WZC A;  3LEM A;  4IGP A;  5DZE A;  5FY7 A;  3RPQ A;  1A78 A;  1WW7 A;  1LJ7 A;  2JWP A;  1AJO A;  1D4M 1;  4NRO A;  4XQW A;  5DAV A;  5LY2 A;  4AF9 A;  3BOD A;  4PIX A;  5A3N A;  2D98 A;  3MIH A;  4OUE A;  2ZGS A;  4UFI A;  3ST7 A;  5ACA 3;  4LHS A;  2Y8K A;  1ALY A;  1COV 1;  1LGB A;  2E9Q A;  2I07 B;  1H8T B;  2ETE A;  3GDB A;  4DIN B;  2FD8 A;  3QAC A;  1BBT 3;  1FMD 1;  4XMA A;  3ZYI B;  3AP7 A;  1REE A;  3PUQ A;  1LOE A;  3IDC B;  1SFY A;  2GSY A;  2AAC A;  3TBD A;  2QZ3 A;  4QGN A;  4RS5 A;  4HSJ A;  4AE2 A;  1UYY A;  3CJI B;  5JOY A;  2PEL A;  2FCT A;  4LLF A;  1RUO A;  4OHV A;  1GP4 A;  4J1W A;  1R08 1;  3RZK A;  5LA2 A;  2GH2 A;  3CZJ A;  3RYR A;  5J36 A;  1RUI 1;  2W08 A;  2VTX J;  1QXP A;  4MUV A;  2XBO 1;  2ZGK A;  1XC6 A;  2ZKN A;  4XAE A;  2X09 A;  1GQP A;  4I2O A;  2ET1 A;  2GU9 A;  1N1V A;  5LBC A;  4LUL A;  4P00 B;  3WQ7 A;  4TSV A;  2HH9 A;  3RI8 A;  2LRO A;  1KRI A;  4WM7 C;  4GB3 1;  4JV4 A;  3BTA A;  2VUD A;  2Z42 A;  1VBD 1;  1ZNP A;  3A0K A;  3WF0 A;  2ZOE B;  3Q8F A;  3P5B A;  4Q4W 2;  3B3Q E;  2CHH A;  4N90 A;  5JXH A;  2PHW A;  4OCT A;  4OHZ A;  4CU9 A;  5KWR A;  2D97 A;  3NJX A;  4JKM A;  2OKX A;  2VEC A;  1M4W A;  3USU A;  2BBA A;  2GH8 A;  1COV 3;  1NLQ A;  1R09 2;  3SMH A;  2GNB A;  1OQD A;  5HV4 A;  2OUJ A;  3OBA A;  2BFU L;  3O0W A;  5FZ1 A;  2H0V A;  2J1R A;  3PVE A;  1QOS A;  1GIC A;  2VW0 A;  4LE4 A;  2YPD A;  3C3V A;  4R9A A;  2DCK A;  2VOW A;  1SLB A;  3JXS A;  3C2U A;  3MEP A;  2WN2 A;  1DLL A;  4QQP A;  5AVP A;  2VNO A;  4YVS C;  1PX4 A;  4QX5 A;  5FYT A;  1XU1 A;  2JG9 B;  3HQU A;  3MFC A;  2LTN A;  3N3H A;  1KJL A;  3RFR A;  3NMB A;  1SQ4 A;  1MZE A;  4TXW A;  3RSJ A;  1UY4 A;  2BNO A;  5FYU A;  3WCR A;  4XW3 A;  4NIA A;  4BLJ A;  5BNO A;  3N9O A;  1V6N A;  5FZG A;  5FP3 A;  5FZA A;  2P37 A;  5EJ3 A;  5CEH A;  1ASJ 1;  4A41 A;  4QPG B;  5FO9 B;  4BWO A;  3VBS A;  3A22 A;  3HN3 A;  3OOX A;  4E2S A;  1CAV B;  2GMP A;  2GME A;  4K1Z A;  3RZH A;  3WY6 A;  4Y20 A;  1SFP A;  1W99 A;  2OA2 A;  3SHR A;  2ZEZ A;  2A6Z A;  1ULC A;  1OQE A;  3PUR A;  4A4A A;  4ZON A;  3B00 A;  4PHZ A;  4S2F A;  5IYY A;  2CAV A;  1XU2 A;  1UZV A;  2D5H A;  4Q4W 1;  4Q8L A;  2EF6 A;  1G8W A;  2VC9 A;  2VZO A;  4CDW B;  1KS4 A;  1QNW A;  3IMM A;  1X50 A;  2DFB A;  5A7N A;  3LFM A;  5DUV A;  1OOP A;  5FY4 A;  4BQ3 A;  2R6Q A;  5A7Q A;  2W1U A;  1JOB A;  1DCS A;  1HRV 2;  5FZF A;  3VLB B;  5BNO B;  4NWV A;  4HVR A;  1U5Z A;  4KG8 A;  1SG3 A;  5T5L A;  3GJA A;  2JDH A;  1ULF A;  2DVA A;  1ND2 A;  1NQD A;  5FJK A;  2VMF A;  4QXB A;  1RUI 2;  2FHR A;  3UKT A;  3TN9 1;  2XB6 C;  4GH4 B;  5JIU A;  1VBE 3;  2BOJ A;  4COW A;  4OLL A;  1FAT A;  5KXB A;  2XHK A;  3ZMO A;  3KCX A;  4CP9 A;  1ENR A;  1O8S A;  2AEY A;  2N7G A;  3JUU A;  3GNE A;  5IJR A;  2P5B A;  5A6Y A;  2HWE 1;  2Z69 A;  1PMH X;  1H2N A;  2MEV 2;  2R0H A;  2R16 A;  3AP4 A;  1YFU A;  4RHV 3;  2Q8O A;  2JIC A;  2YPJ A;  3HNM A;  3N9N A;  3U78 A;  3J4U H;  3V64 A;  1Z7S 2;  2VMC A;  3ENR A;  5KHK A;  2QQV A;  2X5I A;  4Z1V A;  3E5X A;  4LBK A;  4WM7 B;  2ZX3 A;  1AL2 3;  4XET A;  4LUM A;  4XYX A;  5HI0 A;  4I0B A;  1H2M A;  5EHD A;  1W6N B;  4A7Y A;  1OSG A;  1AF9 A;  1P8J A;  4E4H A;  1YLL A;  1CAV A;  4AHX A;  3WR0 A;  4XIO A;  1MR5 A;  2VO5 A;  1X9T A;  1S1A A;  1SDW A;  1ZBA 2;  5FQ0 B;  2P3Y A;  4FPY A;  3VBU A;  4NVP A;  1GR3 A;  1L7R A;  3ZFE B;  5GLU A;  5AC9 1;  2EXH A;  4W65 A;  5F8P A;  3RVH A;  1W8U A;  1UYX A;  4DB5 A;  4JVA A;  4CDW A;  2WNV A;  1VBB 3;  4UW5 A;  1LOD A;  1Q8O A;  1VAV A;  1UMI A;  3QBQ A;  4DEQ A;  5C4W C;  2RV9 A;  2C0Z A;  2JG9 C;  3HWJ A;  4P9I A;  4Z82 A;  5DAB A;  4YW6 A;  3AFG A;  3KGL A;  4AEJ A;  1OF3 A;  2NLR A;  3T3Y A;  3ZYR A;  2PFW A;  1XNB A;  2OX0 A;  2HEY F;  1GOH A;  3K4A A;  3MLJ A;  4FPE A;  4GJZ A;  1QDO A;  5GZD A;  3USS A;  4MHR A;  3ZMN A;  2DCZ A;  2VMH A;  3LSE A;  4BDV B;  3NV2 A;  1G9D A;  5FUP A;  4XFA A;  4HOO A;  4F83 A;  5KR7 A;  4UFK A;  2YG0 A;  4XUQ A;  2V4V A;  3GBW A;  4CU8 A;  2WYS A;  1V6J A;  3VD9 A;  1R64 A;  5IVC A;  1R1Z A;  2W52 A;  3ZFG A;  1H1I A;  1JW6 A;  2CWM A;  4NPM A;  1JU3 A;  2F4L A;  4NHY A;  3THT A;  3UGF A;  3VZO A;  1XSR A;  3PU8 A;  1CIW A;  4XUP A;  4D3W A;  5CYY A;  4KGG A;  1ZBE 1;  3ACF A;  4XAB A;  1RUG 3;  2EAA A;  2SLI A;  1F35 A;  2WA3 A;  1RC6 A;  3ES4 A;  3OGR A;  4OFG A;  3I7D A;  3O14 A;  5FPA A;  4AED C;  2JG8 A;  4MV2 A;  4XUO A;  3KV9 A;  3MIF A;  3BCW A;  1RUI 3;  5C8W A;  1LRH A;  1YO8 A;  4JTN A;  4CYD A;  1CZV A;  4WM7 A;  4IV1 C;  3KF5 A;  1EAH 1;  3PU3 A;  4QGL A;  5C3Q A;  1OXC A;  1HB1 A;  2Z79 A;  3GCW A;  4FQZ A;  4HKO A;  4I09 A;  5JIA A;  5L73 A;  3VKL A;  5CVR A;  1MVQ A;  1ZBE 2;  2VQA A;  4QX0 A;  1OC1 A;  4RQP B;  3DV8 A;  3VDA A;  4H2A A;  4XIK A;  5FQ0 A;  3EHK A;  1RUH 3;  3VBS C;  1AR8 3;  4AQT A;  3DXT A;  4BXF A;  3JB8 A;  2GZW A;  4LOS A;  1JHJ A;  3BAL A;  5M0T A;  1D7P M;  3JBG 3;  1RUE 2;  2FDG A;  1K5M C;  2FMD A;  1KD7 A;  2HEW F;  2EXI A;  3H1Y A;  3GBG A;  2WWS A;  5KBF A;  1ULP A;  2GC1 A;  3AP5 A;  1GP5 A;  4BOW A;  2DCY A;  5F9T A;  5B2G B;  1QJY 2;  1YQC A;  4JHT A;  5FP7 A;  3SH3 A;  2LRP A;  2HWE 3;  1V0A A;  2C9A A;  2W3J A;  3CU7 A;  1DIW A;  3MYX A;  3LCP A;  3TAY A;  1GOF A;  1AR6 3;  3V0B B;  2MPF A;  3H50 A;  3MIC A;  1UX7 A;  2ZGR A;  5IHR A;  3K3N A;  1JHN A;  4AFB A;  2A3W A;  5FOB B;  4BQ1 A;  1W2A X;  2X53 S;  3CHX A;  4XUN A;  2Q1F A;  5LEK A;  1AR8 1;  1DZR A;  1S0J A;  1J84 A;  5FTT C;  1RUJ 1;  1GSL A;  1KDM A;  1HV0 A;  1WCU A;  2WBK A;  1AZD A;  4RHV 2;  3HBK A;  4V1P A;  5DAP A;  2XKO A;  4XAC A;  3ZKU A;  1S0I A;  1UZZ A;  5AC9 3;  5I8T A;  4CU7 A;  3S5A A;  2XBO 2;  4Z07 A;  2ZML A;  2XL7 A;  2XWB B;  4PF1 A;  4M00 A;  5FPL A;  3ZX7 A;  3VV1 A;  2RDQ A;  3D6E A;  4Q4W 3;  1IHM A;  3M8L A;  3VZM A;  1UYZ A;  5F37 A;  2VOX A;  5FYZ A;  2Q30 A;  3FBM A;  4GAZ A;  2ORZ A;  4XZU G;  4XC9 A;  3WNP A;  3POY A;  4K8R B;  4K20 A;  4MGT A;  4FPO B;  4P08 A;  4B29 A;  3G7D A;  4XXP A;  3HPN A;  3SXW A;  4YZ2 A;  4JC1 A;  2Y0O A;  2L9L A;  5T3N A;  5HV0 A;  3MO4 A;  3EJK A;  3PVB B;  3MV0 1;  1WZX A;  1JZ3 A;  1D4M 2;  1OD5 A;  1PM4 A;  2XXZ A;  3FLR A;  2ZZJ A;  5FBZ A;  3VBF C;  3M70 A;  4Y4R A;  4N53 A;  3WP6 A;  1RUC 2;  1EAH 3;  2UWC A;  2E51 A;  2LM3 A;  1YUD A;  1WMD A;  4N7U A;  1UMH A;  3ZXL A;  3P1I A;  4URA A;  1IG0 A;  1PNG A;  2VM9 A;  3KCC A;  4P9X A;  4R9C A;  5F5Q A;  4F3J A;  1UX6 A;  4X8N A;  1CX4 A;  2D44 A;  2DCJ A;  1ENX A;  3A7Q A;  1QWR A;  4QXH A;  4XF1 A;  1GNH A;  3HT2 A;  1VBE 1;  5K7P A;  3S30 A;  1OD3 A;  4I02 A;  4GAL A;  1J58 A;  2WIN B;  4XDP A;  5A80 A;  5C6C A;  1PMJ X;  1J1L A;  4TZD A;  4AFD A;  1NQJ A;  2Y33 A;  2BJS A;  1PGS A;  3L2H A;  1O8P A;  2ZGU A;  2RM2 1;  1BCX A;  3LA2 A;  1Z0H A;  3NKT A;  1V6L A;  1YJL A;  5EXO A;  4B4P A;  4BXS V;  3DPR A;  4AED B;  3BTY A;  2PAE A;  3S6P A;  2KR2 A;  4YGC A;  2WNU B;  1GYK A;  4Y3O A;  5JUV A;  1H0B A;  2EIB A;  2WT0 A;  5A7W B;  2FDF A;  2ZGQ A;  1WLT A;  3FHI B;  4MO3 M;  4HT1 T;  1XPW A;  2GND A;  4BMB A;  5A3M A;  4F8A A;  1GZ9 A;  1X7N A;  1AR7 1;  2W5F A;  4N8M A;  3VBH A;  3VKF C;  2WC2 A;  4BM8 A;  2BV4 A;  5J98 B;  3WQ0 A;  4FAH A;  3O1T A;  1Y4W A;  3VN4 A;  4AAP A;  4Y33 A;  2OQ7 A;  5FV3 A;  2Y34 A;  1YJK A;  4UF0 B;  1QXR A;  4HXC A;  1W9T A;  4RL7 A;  2ZX4 A;  3S7E A;  4FAG A;  4RQP C;  3TNQ A;  2D3S A;  3CO2 A;  3PJY A;  3T2P A;  1N1T A;  3M3I A;  1VBC 1;  4QXK A;  4ES8 A;  4XZP A;  2D43 A;  3J8F 2;  4XUR A;  1A8D A;  3LA7 A;  1KFX L;  4QT6 A;  1ND3 C;  2D3R A;  2R32 A;  2Z4F A;  5DAQ A;  2J1S A;  3E6B A;  1AR6 1;  4IES A;  3ZDV A;  5JMO A;  1FT9 A;  4WVV A;  3VBR A;  2NN8 A;  1TME 2;  5F3I A;  2GC3 A;  1EAH 2;  4N43 A;  4OI1 A;  1LNS A;  5FK7 A;  4CP1 A;  1JYT A;  2CGO A;  5IVF A;  4XJ9 A;  5A6Z A;  1W8N A;  4FPH A;  1OUS A;  1XE8 A;  1SCS A;  1Y9G A;  4S2G A;  1UIJ A;  3ETQ A;  5FOJ B;  1SLC A;  5BNP B;  4FPL A;  1RMU 3;  3ABZ A;  3NNM A;  5FYC A;  1RUF 1;  2JE7 A;  4AGG A;  4CTE A;  2XJS A;  1PGW 2;  3E6C C;  1RJ7 A;  1CAU A;  2ZPX A;  4OMC A;  4FPG A;  4CCM A;  2CYF A;  2RS1 2;  1UOG A;  3V0A A;  5JXJ A;  1PHM A;  1RMU 2;  4KWK A;  2ZHL A;  4ERO A;  2QUO A;  4CDQ B;  1R08 2;  1AX0 A;  1W3V A;  4LTA A;  5LBE A;  3IT8 A;  1LU2 A;  3OY8 B;  1RUD 2;  2YHJ A;  4UFJ A;  1IPS A;  3SC7 X;  2DUP A;  5I8S A;  4FTS A;  2DBI A;  3KF3 A;  1LCL A;  2LUW A;  1IOA A;  1XXN A;  1CON A;  5F3G A;  1Q3E A;  4ZS3 A;  2BYV E;  1TG7 A;  3ZO0 B;  5L36 A;  4K7J A;  4B1L A;  2O0O A;  4QMA A;  4N53 B;  5H9P A;  1QJF A;  1YI9 A;  3J8F 3;  4BQW A;  5LY1 A;  5T52 A;  4A3X A;  4MHU A;  5D8A A;  5FZI A;  1NUK A;  4CCD A;  3RJ2 X;  3O5S A;  1FOD 2;  1NXM A;  5FZ0 A;  1EPW A;  5LRR A;  2RDN A;  4NUB A;  2P3K A;  3TB0 A;  3M3E A;  1H8V A;  4O9E A;  2BDR A;  4JZR A;  3PVN A;  2C1F A;  4KNC A;  3A4U A;  1QJU 2;  4G3Y C;  4QGM A;  3SCF A;  2HBU A;  1HRI 1;  1Y9M A;  2JKB A;  2WL1 A;  3H8O A;  2JX9 A;  4QQL A;  5DAW A;  3T4H B;  3FLP A;  1WW4 A;  4CCL A;  4L97 A;  4DIQ A;  4CUB A;  1OFS A;  2VTX A;  4OUS A;  2YGL A;  2DUR A;  4Q4Y 2;  4UFM A;  5A1L A;  4XJZ A;  2FDK A;  2CWS A;  3VDD A;  1G9A A;  4CCK A;  1Z7S 1;  3III A;  1JOD A;  4RYD A;  4QB1 A;  5C9A A;  1VBB 1;  4JHZ A;  1Y9Q A;  3HAG A;  4QPY A;  3R6S A;  4KH9 A;  4LO5 B;  3UKN A;  3WDT A;  3ACL A;  3U0Z A;  3RZM A;  1GFF 2;  3J26 N;  1MS3 A;  4LBQ A;  4YW1 A;  1BQP A;  4BQ5 A;  3IDA A;  4W6W A;  3O1M A;  3B02 A;  3ZSE A;  4N43 C;  3I3D A;  3FLT A;  4X6Q B;  1DF0 A;  4R9B A;  3WIN E;  4O65 A;  4AHW A;  2X05 A;  3MGU A;  4PI2 A;  2XJT A;  5FIX A;  3NV1 A;  4AVT A;  1TEI A;  4O9G A;  4LHN A;  3PTY A;  5DUU A;  1AUY A;  3H1W A;  5EP9 A;  5FY8 A;  3B7M A;  3VZL A;  1UCX A;  2GP5 A;  2OZJ A;  3OGS A;  4JDM A;  3BUC A;  4CVU A;  1RUC 3;  2WQ8 A;  4C8D A;  1M06 G;  5FZE A;  1O5U A;  1XOY A;  4IEY A;  5CKM A;  2QZ2 A;  1KJR A;  1ZM1 A;  3CIH A;  4QB2 A;  3WF1 A;  4AVC A;  3AKQ A;  3M4F A;  4FT8 A;  5C8C B;  3BTZ A;  1AR9 3;  1UY2 A;  3RZG A;  2WII B;  4BCU A;  5HPO A;  2Q8C A;  3MI8 A;  1IKP A;  2JXA A;  4BIO A;  3WUD A;  3HOB A;  4XJA A;  5J37 A;  3OGJ A;  3WHT A;  3DKQ A;  5FYY A;  1GQH A;  1GNZ A;  3ZFG C;  3MUY 1;  4B4Q A;  4YM3 A;  2XJQ A;  1W8W A;  2DCT A;  4DRR A;  1KGY A;  5FMC A;  2VVE A;  4ONU A;  2YMZ A;  5AVA A;  1OLM E;  3MLL A;  3KQ4 B;  4KI5 M;  5GJ6 A;  1RUJ 3;  1JZ6 A;  4NID A;  4YM2 A;  4ORF A;  2WWU A;  4ISQ A;  1U0A A;  3DYM A;  4AYU A;  5DG1 A;  2V5Y A;  3THP A;  1ZRE A;  3UT0 A;  4LBO A;  1W9W A;  2Q4S A;  2RS1 1;  1W9S A;  2UYB A;  2WZP P;  1OOP B;  4D94 A;  1PGL 1;  2Y6F A;  5AFB A;  2PHD A;  2J1U A;  5T5P A;  5CIR A;  4RA0 A;  1W2T A;  1MZ5 A;  1RUJ 2;  2F6B A;  4CCE A;  4O7X A;  4QXC A;  3R4S A;  2EAK A;  2GMM A;  2Y0I A;  1UIK A;  3VZN A;  2DU0 A;  1XNC A;  1NY7 2;  2MEV 3;  1WCS A;  3OSD A;  5JSR A;  4Y1U A;  1IS5 A;  3WG2 A;  3E5U A;  5FZM A;  4BQX A;  1YCI A;  4YVW A;  2C24 A;  2WZ8 A;  1RTV A;  3GXU A;  1DYP A;  3S57 A;  2WZR 1;  2DVF A;  1UU4 A;  1W9F A;  2OUH A;  4WM8 C;  2BWA A;  5FY5 A;  1UKR A;  1UQX A;  3VL8 A;  1O4Y A;  1VBE 2;  1VE0 A;  1X8E A;  5JXG A;  1LHN A;  5BV6 A;  2HYK A;  4IEU A;  2UUR A;  1K12 A;  4FBF A;  4PQ9 A;  4AAX A;  2KA3 A;  1PVC 2;  3KVB A;  2BZD A;  3GF6 A;  2ARC A;  5J3U A;  5FZO A;  1W6M B;  3LIG A;  5CB7 A;  1OFN A;  2WNO A;  1D4V B;  4FXG B;  4HET A;  4LO6 B;  2ZGL A;  3K75 B;  4GIQ A;  4XHX A;  3SIT A;  3MIB A;  3LFI A;  1B35 B;  2ARE A;  3DUI A;  1XSQ A;  3LWC A;  5GKA C;  5FZL A;  5KHI A;  1PIV 2;  4QKF A;  1QJU 3;  4NRQ A;  4Y1X A;  1NX9 A;  1PK6 C;  4Q4X 1;  4COV A;  3WNN A;  2GNT A;  2JDZ A;  4YVW C;  4P9W A;  1FOD 3;  2ILM A;  1EUU A;  2IXC A;  2HWD 2;  4ET7 A;  4U36 A;  2VUC A;  1UU5 A;  2QCS B;  2WFF 2;  2TBV A;  3HBZ A;  3I59 A;  2RM2 2;  3BPZ A;  1JOJ A;  1NG0 A;  1PZ7 A;  3D4K A;  4IXL A;  1UY3 A;  1G9B A;  1O3R A;  3LOB A;  1HQW A;  4Q0Q A;  2E31 A;  3S5Q A;  4CU6 A;  4RR3 A;  2R06 2;  4KG0 A;  3ZFF A;  4DO0 A;  4RN5 A;  5C8C A;  4YW5 A;  2VUJ A;  2FZ2 A;  4DNY A;  4GB3 3;  1SBF A;  1COV 2;  2VNV A;  2ZHM A;  4MX3 A;  4ZU7 A;  3SH4 A;  2R30 A;  5BNP C;  5I91 A;  5CG8 A;  3AX4 A;  5G04 L;  4P9L A;  4BJ0 A;  3J7L A;  2WZE A;  4AL9 A;  1F8V A;  3RDI A;  1RXG A;  5K9Y A;  4M3C F;  4A42 A;  1UPS A;  1FOD 1;  1C8M 2;  3OD0 A;  3LE0 A;  4W4Z A;  5A33 B;  5IAX A;  5L19 A;  3ZFG B;  3F95 A;  5F5A A;  2DUO A;  3BOW A;  3ZN4 A;  2P3J A;  3VKN A;  4W6Y A;  3WNK A;  1W6P A;  2FMY A;  2OT7 A;  2K9Z A;  3RGB A;  1VIW B;  4P9Y A;  4NHM A;  4YW3 A;  2E7A A;  2WFP A;  2W87 A;  5LAS A;  4MXW B;  4W6X A;  1JH5 A;  1O91 A;  5GZE A;  3ZKY A;  3ZXJ A;  5HXM A;  1XYN A;  4EWE A;  2D6M A;  1PMI A;  2K2S A;  4GWN A;  4ES9 A;  1JUI A;  3F2Z A;  4XJU A;  2ARX A;  1TMF 2;  4CUC A;  3I3E A;  4Q2F A;  3WG3 A;  2RJ2 A;  1ND3 B;  2G19 A;  3AYE A;  5C71 A;  3ATG A;  5JVV A;  1RHI 2;  2WQZ C;  3PUI A;  1QMJ A;  3WOG A;  1RMU 1;  2YC0 A;  5FZ7 A;  1ZBA 3;  3BIE A;  3FFZ A;  4M0H A;  4YG3 A;  5D8A C;  1JZ2 A;  1OA4 A;  1STM A;  3AP9 A;  5JMC A;  1MEC 2;  3I2K A;  2DTW A;  5LBB A;  1QJU 1;  2CV6 A;  1RUF 2;  2RS3 1;  4ASK A;  4DMI A;  5JR7 B;  1RIR A;  3IIA A;  2H6B A;  4NN0 A;  4TLF A;  1TME 3;  4IW3 A;  1FPN 3;  1SCR A;  3OPW A;  4M0N A;  4NJ4 A;  2HWF 3;  4XFG A;  4Q27 A;  3OGV A;  1W8F A;  1C8M 3;  1G9C A;  4K8F A;  4RR3 B;  2BNN A;  4AK3 A;  3LF7 A;  3WF4 A;  5BNN C;  4HMZ A;  3OD4 A;  4XE9 A;  3WUC A;  1L7L A;  4M01 A;  4CP2 A;  1QU0 A;  1UKG A;  4ZZ8 A;  3OB8 A;  3ZPY A;  4BK4 A;  2ZGP A;  3C7H A;  4Y5S A;  4YFZ A;  1T6G C;  2EIG A;  2V5D A;  4CDQ C;  1MAC A;  4QAW A;  3ES1 A;  5ABJ A;  3ETP A;  3FWE A;  2V4A A;  3H7Y A;  4HON A;  2RG4 A;  3NJV A;  1RUD 1;  2RJL A;  3H8U A;  1VMJ A;  4IUG A;  4LXL A;  3IWZ A;  5FWJ A;  1ZZC A;  1DZQ A;  3I54 A;  3TN9 2;  3IPV A;  4IEP A;  3HD8 B;  4C0H A;  5CIS A;  3WV6 A;  3NNL A;  2WAB A;  1J59 A;  3A21 A;  2XR4 A;  3JBG 1;  1AR7 2;  5FUI A;  3VHN A;  3WEZ A;  2KD7 A;  2BVB A;  4FFI A;  1AR9 1;  1N3O A;  5KHG A;  1G7Y A;  1TMF 3;  5GAL A;  5TSW A;  2XJP A;  4NII A;  5BY5 A;  3ITQ A;  4GWJ A;  3JD7 3;  1UOB A;  1LKN A;  1PZ9 A;  5E1R A;  1GQG A;  4LKS A;  3WZ1 A;  4IGQ A;  4LEJ A;  1XYP A;  1YHF A;  5A1A A;  2XH6 A;  1SLT A;  2VQT A;  1O6U A;  4ZXE A;  3VHO A;  4B4R A;  2E7Q A;  4V2V A;  3RZL A;  5IW0 A;  2DTY A;  2R49 A;  4XMI A;  3N9M A;  1VJ2 A;  4MXV A;  5I0S A;  1NE6 A;  1WUV A;  3AMN A;  2DYC A;  3LPG A;  3OYW B;  2WLQ A;  3WDU A;  4E8C A;  4ZS2 A;  4E4S A;  2KXL A;  2QQW A;  1GOG A;  4UXA A;  2XHN A;  5IK8 A;  2RS3 2;  1H9P A;  2ZMN A;  4GH4 A;  2BBV A;  1US3 A;  2CTV A;  1S0D A;  2NPI A;  4HPK B;  1XYO A;  3WQB A;  1HRI 2;  1YIP A;  1RL3 A;  2RJK A;  2YRO A;  3OF1 A;  4NE9 A;  3I2D A;  4XEZ A;  2EXK A;  4LMF A;  5A6X A;  3FUQ A;  2VXJ A;  5FK8 A;  1VRH 2;  4BZ4 A;  3ILR A;  2DF7 A;  3DPR C;  1J83 A;  1TMF 1;  4MXW A;  3AZW A;  1GZW B;  4R4X A;  1C5H A;  4HK9 A;  3AL6 A;  2HWC 3;  4YM0 A;  3VD4 A;  3ZSM A;  4DUX A;  3WDV A;  4LOT A;  3GZA A;  4Q5O A;  3ME2 A;  5C8C C;  1O4T A;  3HN1 A;  4CPB D;  1RXF A;  2HWF 2;  3KWV A;  5APA A;  3A0N A;  3R05 A;  3OPZ A;  1S0F A;  4HLT A;  4LIU A;  4V2W A;  3RZZ A;  5A3L A;  1DYK A;  5FO8 B;  1WGP A;  1OBN A;  5DXD A;  1OLR A;  3FJS A;  1W2N A;  5AC9 2;  3UET A;  1ZZB A;  1H1M A;  5J7M A;  5FYV A;  1YFX A;  2MNG A;  3H7J A;  1PO1 3;  4LT5 A;  2FDJ A;  4QHZ A;  2DFC A;  2RS1 3;  2XLG A;  4NPL A;  5I0U A;  3WW3 A;  1NYW A;  3MIG A;  1KDK A;  1VAL A;  1JZ8 A;  3ZN6 A;  3KV5 A;  2ZAA A;  3N36 A;  4PCR A;  1RHI 3;  1IG3 A;  1MQT B;  1LES A;  1HJG A;  2OYZ A;  3NJY A;  1NKG A;  1Y3T A;  3J9S A;  4QKB A;  5IFP A;  2QQL A;  5A3O A;  1GWM A;  1AR8 2;  1JMU B;  1Y43 B;  2A71 A;  3ALQ A;  4HN0 A;  1ZA7 A;  4UT5 A;  4AEK A;  2BPA 2;  3S7I A;  1W9Y A;  4IEV A;  1F5J A;  4PQQ A;  1WBL A;  1GMM A;  1A8M A;  4LBL A;  2BFU S;  1AL2 1;  3RWK X;  5F2W A;  3UNP A;  3V65 A;  2ARA A;  4Y24 A;  4N7I A;  3Q8C A;  1ZX5 A;  1BVP 1;  2UY9 A;  4K21 A;  4XCA A;  3J7H A;  3IMN A;  4AVS A;  4CEW A;  5H9Q A;  4YFW A;  4CRQ A;  1PVX A;  4AVA A;  5L9B A;  1B35 A;  2JD4 A;  3NWK A;  2PLV 3;  5LAT A;  2VOT A;  3IPV B;  2Q8E A;  2PHX A;  5HCH A;  3B01 A;  4QKD A;  5IVY A;  1VBC 2;  4Q4V 1;  1LEN A;  4GZ9 A;  3I3B A;  3BU0 A;  5GZC A;  4Q0S A;  2JKX A;  1JZ4 A;  3HT1 A;  4HL0 A;  2ZA9 A;  4EN7 B;  3OEB A;  5JLV A;  2JEC A;  5IVV A;  4NIG A;  3CZU A;  1XND A;  1C28 A;  2WT2 A;  1X36 A;  4Y20 B;  3ZYP A;  2JG8 B;  2VQ0 A;  1IS6 A;  5T50 A;  3SEP A;  3ZN5 A;  5FLJ A;  3DL3 A;  2NZ9 A;  2YYO A;  1BXH A;  3ZM8 A;  1HB3 A;  3BKZ A;  3QD6 A;  3FFQ A;  1LEC A;  4LPL A;  2F17 A;  1LTE A;  3WQ1 A;  3MBW A;  1NLR A;  1TZO A;  1VRH 3;  4S2H A;  3FBY A;  2VW1 A;  1FI2 A;  2XJV A;  4XHB A;  1G6N A;  2J42 A;  4DEV A;  1ST8 A;  2B5H A;  4MAD A;  1EYB A;  4P9G A;  3VHP A;  5KXC A;  2PHR A;  2PTM A;  1PK6 B;  4ZKT B;  3T1L A;  4AVB A;  2NP0 A;  3HIF A;  3ZN6 B;  3IZO A;  4YVW B;  2W9X A;  1S0G A;  5E89 A;  5FPU A;  4FXK B;  2FDI A;  4RS5 C;  5FZB A;  2CGP A;  4PLN A;  4PIY A;  3NV4 A;  2VY0 A;  3P3P A;  4C1W A;  1VB4 A;  2ZGN A;  2J7M A;  5A3T A;  4LK7 A;  2A3Y A;  5D8A B;  4DXR A;  1BHG A;  1S55 A;  1RUC 1;  1HJF A;  3Q8E A;  1ZZ6 A;  1YNA A;  3KSC A;  5DN2 A;  3LGR A;  1JS9 A;  2ADD A;  3VBO C;  3K77 A;  1UOJ A;  4YW4 A;  1HB4 A;  4CEY B;  5EPA A;  4Y22 B;  2YZ4 A;  5KHH A;  3FX3 A;  1UZW A;  4UW6 A;  4PLM A;  4ITC A;  1MS0 A;  1WMX A;  2YGM A;  3AKP A;  2A6X A;  1DFQ A;  1MS5 A;  5F5C A;  1BK1 A;  5ANQ A;  2QQM A;  5DQ0 A;  3LSD A;  1K5M B;  1YI7 A;  4PLO A;  4CA9 A;  4Q26 A;  4AI0 A;  4RSU A;  2K0G A;  3PME A;  4QPI C;  2YU1 A;  3K3O A;  5GZG A;  3QOP A;  1HV1 A;  1QDC A;  2E63 A;  5FCC A;  5FMO S;  4FSJ A;  1BKZ A;  4JRA A;  4Q1R A;  1NZI A;  5FP4 A;  2Z5W A;  3P3N A;  2PQQ A;  3RRD A;  3RI9 A;  3POI A;  5CFC A;  2XOM A;  3ZOI A;  3OG2 A;  5FUN A;  4EN6 B;  5JCT A;  1WCQ A;  3MW3 A;  1LOA A;  2O8O A;  5BUV A;  2FQP A;  4QM8 A;  3VBR C;  4HN1 A;  1OQ1 A;  2R04 1;  1SZB A;  3M2M A;  4IV1 A;  3WNL A;  1ZZ9 A;  3B69 A;  4BB3 A;  3PJQ A;  2VME A;  3OPT A;  1DGW A;  1RHI 1;  4M3C E;  4XDO A;  3OCP A;  5FZC A;  2OPW A;  4QB6 A;  4CE8 A;  4LIV A;  4PBO A;  4FPJ A;  1Q8P A;  4CSW A;  5A33 A;  3I2J A;  2PN5 A;  4A45 A;  4GQ7 A;  2P2K A;  1R08 3;  2TEP A;  2HWE 2;  4EZ4 A;  4QHO A;  1QJY 3;  5F5I A;  1OUR A;  1NZC A;  3I3Q A;  1CX1 A;  4AGR A;  4CDX B;  3DYP A;  1BLZ A;  5FZ4 A;  4YPJ A;  3VBF A;  5E8A A;  3KM5 A;  1W0O A;  2BGC A;  3BYW A;  4WVM A;  1J3Q A;  2VTF A;  5GLW A;  3H42 B;  1LOB A;  1SMV A;  2XDV A;  3E97 A;  3SEE A;  3VZK A;  3ZXD A;  1H4G A;  1QOO A;  4CXX A;  3SKV A;  3ZPO A;  2DVD A;  5FPV A;  1C57 A;  1EUT A;  1SPP B;  3LZZ A;  1WD4 A;  3GJB A;  2HLE A;  2BW8 A;  5JZG C;  4BQY A;  3WCS A;  3DPR B;  3JD7 2;  4LHL A;  3PLQ A;  2DDU A;  4PDW C;  2VZV A;  2QQO A;  5IAV A;  5C9A B;  2YV8 A;  3W5M A;  2QNK A;  5CFC C;  4CP0 A;  4W8J A;  2B9U A;  5LEJ A;  2YC4 A;  2HWC 2;  4I3P A;  1ODM A;  1SBD A;  2QQU A;  3IDB B;  2RR1 3;  3UES A;  3IM0 A;  3AKR A;  1D2Q A;  2WO3 A;  1W90 A;  3U10 A;  4D7Y A;  3APB A;  5EQU A;  1H6Y A;  2WNV B;  5JOX A;  2B9V A;  2E6V A;  2IXL A;  2ZAH A;  1ZZ7 A;  1H9W A;  1AXZ A;  2A1X A;  2WSU A;  1IKQ A;  1QHD A;  1LHW A;  1CAW A;  1PIV 3;  4Q4X 2;  5E16 A;  5FMB A;  4FTE A;  1UD1 A;  5IVE A;  4IEQ A;  1D2S A;  1VBC 3;  1WCK A;  2RMU 2;  4IET A;  4P9J A;  4XBQ A;  5FBJ A;  3RYP A;  3VL9 A;  3LPF A;  2YB7 A;  2VZ3 A;  1W6O B;  2WFF 3;  3H3L A;  2P4E A;  3MFA A;  5L7O A;  1HQN A;  1AHS A;  1VMH A;  4FP2 A;  5H9S A;  3BPS A;  1NCR C;  4QX3 A;  4YVS A;  4QM9 A;  1PM7 A;  4ISR A;  3UJO A;  4QU2 A;  1F9K A;  3K4D A;  2PA7 A;  3AK0 A;  2RS5 2;  2WO2 A;  1W8T A;  3VZJ A;  5IK7 A;  3H8R A;  4KQ7 A;  5FXV A;  1US2 A;  1RUD 3;  2ZCW A;  3H1M A;  2QQJ A;  2GDF A;  1EV1 2;  3OBT A;  4FVV A;  5IUQ A;  5I0D A;  4WVM B;  1HXS 3;  3WP5 A;  4IEZ A;  3J8F 1;  4F7Z A;  1SLI A;  1O3Q A;  1W03 A;  2W46 A;  4GWI A;  2G1M A;  2WO7 A;  5A7O A;  5J48 A;  4XVH A;  5KHJ A;  1LAJ A;  1UY1 A;  1H2L A;  1SPP A;  5A3P A;  1AX1 A;  1ULG A;  2PMW B;  4JAA A;  4Y1Z A;  2WS9 3;  3WF2 A;  5T5O A;  4GXL A;  1TVG A;  5IVB A;  1ACC A;  2IVJ A;  3ZR6 A;  1QKQ A;  2X5I B;  1E57 A;  3L2Y A;  1GNY A;  3CL1 A;  3M1H A;  3NNF A;  4QKN A;  4RFR B;  2R07 2;  2SBA A;  3WW4 A;  4ZXK A;  4HSL A;  2OVU A;  4OHX A;  1MVE A;  2OQ6 A;  4PF5 A;  4A7Z A;  1PO2 3;  3ZSL A;  1Z7S 3;  2AC1 A;  3AMQ A;  4XQ4 A;  1RIT A;  5DDJ 1;  2HEV F;  1AYM 1;  5I0T A;  4Q0P A;  4L99 A;  5ACA 1;  2AGS A;  3DYO A;  3IAP A;  5A70 A;  1KFU L;  3EBR A;  3VDD C;  2BEO A;  5F32 A;  2NM1 A;  4QDQ A;  2FBE A;  4FFG A;  4MGI E;  1CES A;  2IC1 A;  1DBN A;  3OUH A;  1GBG A;  2YBP A;  1MEC 3;  2BNM A;  4JTO A;  5C4W B;  1UPI A;  4TN7 A;  4PBP A;  4Y26 A;  2B42 B;  3OUJ A;  3H9A A;  5IWF A;  5LWB A;  2B46 X;  2HJI A;  1EPZ A;  4XF0 A;  4NWW A;  1BMV 2;  5T54 A;  4GA9 A;  5FPX A;  4D7S A;  4XOG A;  1YWK A;  1RUE 3;  2R0F A;  1BEV 1;  4XXA A;  1GWK A;  1JUH A;  4MVT A;  2RHP A;  1S2K A;  4AI3 A;  4UFL A;  4TTG A;  4G4F A;  4CDW C;  3O1P A;  2I74 A;  4AW7 A;  5EV7 A;  4GKY A;  4ATF A;  2R06 1;  4LO8 A;  4IE0 A;  4C0B A;  2V09 A;  4IEX A;  4BPZ A;  5HCB A;  1MZF A;  3B5L B;  4LNV A;  2E53 A;  4LO7 A;  1N3P A;  5DAX A;  1UY0 A;  1UU6 A;  2HWB 1;  3VBH B;  1W6Q B;  4MGK E;  2VZT A;  2WAO A;  1KQR A;  1BYH A;  2P3I A;  3ZYJ B;  1QF3 A;  2TUN A;  4QDR A;  1FMD 2;  1U5Y A;  1X82 A;  2P17 A;  2VW2 A;  3D82 A;  4UOJ A;  4ZY9 A;  4UI9 L;  2QQK A;  1ASJ 2;  3ZFF C;  2QQN A;  4CDU B;  4TWT A;  5FO7 B;  4AVV A;  2I2S A;  4QPW A;  1DGR A;  5JZG A;  2W94 A;  1QQP 2;  3LDB A;  4DY3 A;  2ZX1 A;  4QQO A;  4LUK A;  1URX A;  2B7Y A;  4E27 A;  2CDP A;  4Z2A A;  4UFH A;  4ZZ5 A;  2BGO A;  3K4Z A;  1LEM A;  2R06 3;  1N1Y A;  4YNI A;  4LHK A;  2G9G A;  1OHF A;  1C1F A;  3ILN A;  3UGH A;  2ATF A;  3AMH A;  4K3U A;  4B3N A;  4BQ4 A;  1JBC A;  4OUL A;  1WLW A;  5GLZ A;  5A7S A;  4WV8 A;  1AYN 1;  4CCO A;  1AJK A;  1PO1 2;  5D1I A;  4JQT A;  3WNO A;  3UJQ A;  3L9J T;  1POV 3;  4KL1 A;  5DG2 A;  4JQR A;  5BNP A;  2XUE A;  5F39 A;  3VD5 A;  4GH4 C;  4DUW A;  1CVN A;  2VUA A;  3AMM A;  1LB2 A;  1CZT A;  3ZVX A;  3SKJ E;  1RUF 3;  5CBL A;  5K8S A;  2FZ1 A;  4BYY A;  2JIG A;  3E6D A;  2X5I C;  1VP6 A;  3K48 A;  3UYJ A;  3FUO A;  2BU9 A;  5T55 A;  3GCX A;  4HG6 B;  3DN7 A;  3AC0 A;  4O61 A;  3AFK A;  4MSV A;  2R1D A;  4KWL A;  1PO2 1;  1W2U A;  2ORX A;  1ZRC A;  1OPM A;  5LK5 A;  3GHN A;  4YZ1 A;  3KHC A;  5FY1 A;  2JDY A;  1W2O A;  1VBD 3;  1WMF A;  1WKY A;  4XF4 A;  2ZS6 B;  1LOG A;  4FOY A;  3PUH A;  5FXZ A;  3ZXE A;  2VNG A;  1ODN A;  4L8Q A;  4CCJ A;  4LKE A;  1W04 A;  4JGZ B;  2Q8D A;  4QPI A;  3VUO A;  3OTF A;  1H2K A;  3KV4 A;  5IK4 A;  2AEN A;  2F4P A;  5JDB A;  3POW A;  4K9S A;  2PHL A;  2ZGO A;  4EJR A;  1BBT 2;  2JG9 A;  1D0G A;  2XGX A;  2VZS A;  5C4W A;  4AI2 A;  5C3P A;  3JU9 A;  4IV3 C;  2IZW A;  1OVS A;  4YZ3 A;  3WNM A;  3RZJ A;  4XTM A;  1EV1 3;  1VAK A;  2JDU A;  2R7E B;  1HDK A;  2ET7 A;  3CNA A;  2VCC A;  3ELN A;  4IE4 A;  1UW8 A;  4YGB A;  3ZXG A;  3VKO A;  1AXY A;  2AZ5 A;  4L0P A;  5CU1 A;  2B45 X;  3W58 A;  4WM8 B;  2FCV A;  3WG1 A;  4CUA A;  3AXE A;  2QQI A;  3BGA A;  3DEC A;  2X8K A;  1XNK A;  3NAP B;  3M7A A;  4CCN A;  5LW9 A;  2VJX A;  3PHM A;  4DXZ A;  1UN1 A;  2PHT A;  4EYU A;  1YIF A;  2WZR 3;  2VZ1 A;  3ZFE C;  3TEY A;  1CJD A;  3O1O A;  2A7A A;  4QU1 A;  1KXG A;  1OH4 A;  2B4K A;  3GZE A;  1X9P A;  4QQH A;  4IE7 A;  2VOK A;  1RIN A;  1L3J A;  3DXU A;  3NRU A;  4M4P A;  5FZK A;  4C1X A;  3WG4 A;  5LA1 A;  2JB4 A;  3ZFF B;  4CDU C;  1JYN A;  3TEW A;  1RUG 2;  3KZ4 C;  3OGG A;  3M3C A;  4YM1 A;  5DUW A;  4CDQ A;  1JYI A;  4Y1V A;  1DU3 D;  5A32 B;  4JRL A;  4PDW B;  4YGD A;  4B1M A;  3I2O A;  1V9U 3;  2O1Q A;  2Y6H A;  4KMQ A;  3VDB A;  3IB3 A;  3ZIX A;  1JYC A;  5BXX A;  4Q0V A;  1FMD 3;  3TRS B;  4A44 A;  3VD3 A;  2VOV A;  4J6G A;  3UL2 A;  5C7G A;  1DGL A;  4CEW B;  4D69 A;  4Q4V 3;  4D8M A;  2IWG B;  3JZV A;  3AMP A;  4HBN A;  1W3X A;  1ZA4 A;  3EXU A;  4IE5 A;  5CNA A;  3WNX A;  4HVQ A;  4NPR A;  1BMV 1;  4BA6 A;  1DQ2 A;  1OT5 A;  2R07 3;  3AZX A;  3WT3 A;  1ND2 C;  2WWJ A;  4I01 A;  5JR2 A;  3H3U A;  1T6B X;  3KB5 A;  5FKB A;  2EIE A;  3SCG A;  1RVF 1;  1WME A;  3LEK A;  3VB9 A;  4XBN A;  5F3C A;  4YG6 A;  1QQP 1;  1YXW A;  4LR4 A;  2ZTN A;  2MEV 1;  3IBM A;  2OZ6 A;  3KD4 A;  4J25 A;  3HR9 A;  3IKW A;  4R4Z A;  4EV0 A;  2W0X A;  1FYU A;  4P02 B;  1F5F A;  3VDD B;  3I49 A;  1OH3 A;  1HXS 2;  4QX2 A;  2HWB 2;  3AYA A;  3O0X A;  1DQ4 A;  2RR1 1;  1H8T A;  3N9L A;  4AED A;  3E5Q A;  2HWD 1;  2TNF A;  1ENS A;  1YQ2 A;  4FOQ A;  5IT6 A;  1WA4 A;  4XFH A;  2WR9 A;  4BQ2 A;  3MHZ A;  4AGV A;  4EWD A;  4OQ8 A;  1O3T A;  3JQW A;  1LED A;  1W8H A;  1NAE A;  3VBS B;  1RUN A;  2BER A;  5FY9 A;  5FZD A;  4XCB A;  1JXN A;  4R52 A;  2HKX A;  4AOC A;  1APN A;  3RJR A;  4QPG A;  3CDZ B;  3AKT A;  4COZ A;  1F31 A;  2VZQ A;  3GBF A;  2LW8 A;  4YYO A;  2VXR A;  3W21 A;  4UW4 A;  1QJX 3;  4LIT A;  5LZ6 A;  4FCA A;  5LRS A;  4LBQ D;  1NLS A;  4Q0U A;  1PVC 1;  1HQL A;  4NHK A;  3T0B A;  3GZU C;  4PDW A;  2XVK A;  4C91 A;  5F3E A;  3VGI A;  5FMO L;  3TWI A;  5BYN A;  1MPX A;  1EV1 1;  4HVO A;  4CZS A;  2QTW B;  4FPF A;  4WVZ A;  3WD5 A;  3K2O A;  3O7O A;  1W39 A;  3KMH A;  1AYN 2;  1QJY 1;  3AYD A;  4IDZ A;  1RUH 1;  3POE A;  2YU2 A;  3OY8 A;  1NCQ C;  3LOI A;  3MZH A;  5K4L A;  5F6L B;  2W39 A;  2W2I A;  1ASJ 3;  4RQP A;  3T2O A;  1SAC A;  3DGT A;  3R4U A;  2XVL A;  5CKN A;  4RD7 A;  4LOR A;  1NA1 B;  1RUE 1;  5HXV A;  3W9A A;  1NY7 1;  2J1V A;  2DBN A;  2P34 A;  4YAR A;  5E6H A;  3O0V A;  2D5F A;  3N7L A;  4H7L A;  4N53 C;  4AFC A;  3MDP A;  1UZ0 A;  3KT1 A;  1HN0 A;  5F2S A;  1SDD B;  1WWY A;  1W05 A;  1JTZ X;  4J1X A;  1UWW A;  3CEW A;  1U12 A;  4DS0 A;  2I45 A;  1TNR A;  4JGY B;  4OZO A;  3INA A;  1SEF A;  2ZGM A;  5FDB A;  1HB2 A;  1VPH A;  1YQ6 A;  2J1A A;  2VCB A;  4UBH A;  4IV1 B;  4IV3 A;  3POS A;  1AXK A;  1YQ5 A;  2D40 A;  4RFT 0;  5ERL A;  3VD7 A;  2QJV A;  2R1B A;  1AR7 3;  2EXJ A;  4Q8K A;  2VVD A;  3N4M A;  2Q1Z B;  5FP9 A;  4MGS A;  3FZ3 A;  5F6K A;  2OS2 A;  5JPN B;  3Q9O A;  3MF6 A;  5J96 B;  3AVR A;  3KQR A;  4D0Q A;  1CAX B;  4A7K A;  1V6I A;  5E88 A;  4YW7 A;  4QHB A;  5FPB A;  3VBU C;  1JYW A;  3N9Q A;  2FDH A;  3QCW A;  4GB3 2;  4MZU A;  1TE1 B;  1OKQ A;  3BOP A;  4L2N A;  2H6C A;  4N9H A;  5FYS A;  3AVS A;  1JZ5 A;  4AXO A;  2NMO A;  4QDS A;  1DQ5 A;  2XJU A;  3UK9 A;  3WSO A;  2RDR A;  5IFT A;  4LA3 A;  4DXT A;  1IQD C;  1RVF 2;  4EN0 A;  4ARX A;  4AZZ A;  2O14 A;  4MGZ E;  5C3S A;  3TN9 3;  2HWD 3;  4AFM A;  3T0D A;  3X29 B;  4FTB A;  1FPN 2;  1QGL A;  2Q1M A;  1PX3 A;  3V0B A;  2QKD A;  1ZVF A;  2A75 A;  1R1A 3;  1VB2 A;  1RYY A;  5ABJ C;  1ND2 B;  2VL4 A;  2W92 A;  3NQH A;  4IER A;  4JGZ C;  2HWF 1;  2WKK A;  3ZYG A;  4AI9 A;  3A23 A;  3VKM A;  2P6C A;  2G9F A;  3LAG A;  3LEI A;  4YW2 A;  2J1E A;  4XDQ A;  3HNB M;  4XFF A;  3BVC A;  2NYY A;  2R04 3;  3B94 A;  3KGZ A;  4KBZ A;  4AEM A;  5BNN A;  5IAT A;  2WNU C;  5CA6 A;  1K42 A;  1G86 A;  4D6Q A;  3ROU A;  4EN8 B;  2XWJ B;  2UWA A;  4NRP A;  2Y6G A;  1XE7 A;  4HKL A;  2R07 1;  1ZBA 1;  5A1F A;  5FR3 A;  3JCI A;  5A3U A;  5JOW A;  2A5Z A;  1J3R A;  3ZIW A;  1ZYB A;  1ULE A;  1QJX 1;  2JE9 A;  1C1L A;  4RHV 1;  3WDW A;  3M3Q A;  1GLH A;  4Y4Y A;  1POV 1;  3V56 A;  1OOP C;  3D3A A;  1XBF A;  5ANN A;  3SIS A;  1I3H A;  5FMD A;  3FC0 A;  2ES3 A;  2VAU A;  4BHP A;  1R1A 1;  4HFS A;  4DFS A;  5K0U C;  3NJZ A;  2BP6 A;  2EID A;  4I3G A;  5LA9 A;  2E32 A;  1LU1 A;  2NQY A;  2A6Y A;  4XQD A;  2B39 A;  2IFW A;  3UV9 A;  2VNR A;  5EJZ B;  4A6O A;  4GMP 0;  4YVS B;  2RMU 3;  2VUL A;  1K45 A;  2HBT A;  1UO9 A;  3EYP A;  3LQC A;  4LQR A;  3VBF B;  1CR7 A;  2P6H A;  2RVA A;  3ZFE A;  3ZLI A;  5FZ3 A;  4HK8 A;  2OXB A;  1AR9 2;  1ZBE 3;  1CGP A;  3NAP A;  2CL2 A;  1C8N A;  1Q56 A;  2YFU A;  4KWU A;  1UZY A;  5LA0 A;  1A34 A;  2CY6 A;  4RGA A;  3AB0 A;  3U4S A;  3N9P A;  3I2H A;  3POF A;  1DG6 A;  1NCQ B;  4H7M A;  4URT A;  1LHO A;  3JB4 C;  1PNF A;  1WLD A;  4NHX A;  4AHZ A;  3POB A;  4FPK A;  1ZRF A;  1CJP A;  2C5D A;  4XPV A;  4IV3 B;  5FYH A;  5FZH A;  1E5I A;  3NST A;  2GAU A;  1CPN A;  4OUM A;  3ASI A;  1PGW 1;  1RJ8 A;  4XFB A;  5FLH A;  1XB9 A;  1QNY A;  1N1S A;  1W6M A;  4FFF A;  2D6P A;  3Q8A A;  4LBM A;  2YXS A;  3RNS A;  4LK6 A;  4N43 B;  3VBU B;  4P5Y A;  5DDJ 3;  5A7W A;  3TEZ A;  1E5H A;  2JG8 C;  4I30 A;  4S2D A;  3RMX A;  3MPB A;  2WAA A;  4QD2 A;  3NAP C;  4LBQ B;  3CF6 E;  1XRU A;  2QDN A;  3AXD A;  2HYX A;  1CAW B;  1I6X A;  1VRB A;  2ZKL A;  4JKL A;  4ZHN A;  4CUG A;  2CSG A;  4TYS A;  4CCC A;  3B93 A;  2VCM A;  3LD8 A;  2JE8 A;  3QLQ A;  1JU4 A;  4DRV A;  3AKS A;  1MEC 1;  2WS9 1;  4E4Z A;  5K0U A;  3AM2 A;  4R8H A;  2XJR A;  1V70 A;  3GYD A;  5ABJ B;  2WJS A;  1QY4 A;  3LA3 A;  3D0S A;  2XON A;  1DP0 A;  3WLU A;  3ON7 A;  1F4H A;  4COY A;  1K5M A;  1S0E A;  5FP8 A;  1PVC 3;  1LGN A;  2ARB A;  1FXZ A;  1SHW B;  1RB8 G;  1F2N A;  2Y64 A;  1AX2 A;  2W1W A;  2VVF A;  2ZEW A;  4CP9 B;  1QEX A;  4FPC A;  2DVG A;  1AL2 2;  1TNF A;  4G9S B;  4EE2 A;  1DDL A;  2KM2 A;  4COU A;  4L92 A;  1A6C A;  1DHK B;  3T09 A;  4L11 A;  3BU7 A;  3LEG A;  1MS4 A;  4IEO A;  5EYX A;  5FXW A;  3BI3 A;  2QE3 A;  2JEN A;  2D7F A;  4B7E A;  2WLP A;  1UAI A;  2XL9 A;  3C7G A;  3LIH A;  3H3Z A;  5JXI A;  3ZXK A;  4YGE A;  5A32 A;  3PUA A;  4YRD A;  4BH9 A;  1BEV 3;  5CFD B;  1UNB A;  1U5I A;  2VE1 A;  1QOT A;  1YEW A;  2XLF A;  5EYY A;  3AJZ A;  2Z2S B;  3ZR5 A;  3FL7 A;  5GZF A;  1W8O A;  2D6L X;  3N35 A;  4BE3 A;  4JGY C;  2PAK A;  5BPX A;  2WA4 A;  1FNY A;  4BME A;  4XAA A;  5CAZ A;  3ZYB A;  1GU3 A;  1W28 A;  3R4D B;  1UXZ A;  2BVV A;  1LHV A;  2HWB 3;  1LOC A;  1LOF C;  1ZRI A;  2VBD A;  4OYU A;  1OI6 A;  4UWD A;  4D6S A;  2XPJ A;  4NOT A;  2G9Z A;  3CJX A;  2LAL A;  1PK6 A;  4NHL A;  4FFH A;  3DCQ A;  5A7P A;  2D3P A;  1PZ8 A;  3P6B A;  5FPZ A;  4WZF A;  5K0U B;  1WBF A;  4AQ6 A;  4NO4 A;  2YY1 A;  1G9F A;  4X6R B;  1TQ5 A;  1CZS A;  1OPO A;  2OPK A;  2ZBJ A;  3W20 A;  1NCQ A;  4ARY A;  5ACA 2;  1FV2 A;  4DOU A;  1PIV 1;  5I93 A;  5L9R A;  2XQX A;  4M3C B;  1NE4 A;  2VG9 A;  4LKF A;  5DDJ 2;  2QBX A;  3IN9 A;  3LB9 A;  4FOV A;  4EZH A;  3T4V A;  2Q5T A;  3KHB A;  3MW4 A;  2RS5 3;  2PQS A;  2QFE A;  2PAM A;  5JI9 A;  3ORJ A;  1Z78 A;  2Y26 A;  4IQP A;  1MS9 A;  4GUL A;  5DZF A;  4XFC A;  1UL9 A;  3ZSJ A;  3JQX A;  4CDX C;  1WW5 A;  3WXP A;  3CLP A;  2UYA A;  4AHY A;  4EN9 B;  1K3I A;  1HRV 1;  3AP6 A;  1MQT A;  3B9C A;  2VGD A;  2PLV 1;  1WLC A;  3WP3 A;  2ERF A;  1NA1 C;  3ACH A;  3AZZ A;  4NMI A;  4ATE A;  4RGG A;  1V9U 2;  2BQP A;  3RMY A;  5KC5 A;  2VZR A;  4LO4 B;  2PYT A;  3GHM A;  1X33 A;  2VMD A;  3NKG A;  4XIL A;  4NIH A;  4CPB A;  1DQ0 A;  3BIW E;  3FHA A;  3PMS A;  1FNZ A;  4JX0 A;  5EIY B;  1IS4 A;  4OI0 A;  1AL0 G;  1DZT A;  2BRT A;  1IZ3 A;  1Q8S A;  3IDE A;  5C9A C;  4DXS A;  3SNM A;  1HRI 3;  2X29 A;  1WA6 X;  2V73 A;  2W1S A;  4BLI A;  5BNQ A;  3PUS A;  4OHY A;  2VCA A;  3LDR A;  5DZG A;  2VH9 A;  3FE5 A;  2VR4 A;  5CFC B;  2RM2 3;  3NW4 A;  2DU1 A;  2PLV 2;  4XF3 A;  3U4X A;  3ECQ A;  1W06 A;  1SFN A;  4JKK A;  1T2X A;  1H1A A;  1BK0 A;  1VRH 1;  4GD4 A;  1QJE A;  2XBO 3;  2Y6L A;  2YBS A;  3GAL A;  2ZXQ A;  2WN3 A;  4GMP 3;  3I2F A;  3TNP B;  3VDC A;  2Q0A A;  2RMU 1;  2YDE A;  1N47 A;  1W8Z A;  4OHW A;  2DVB A;  2YBK A;  3K51 A;  4NR1 A;  3PVO A;  1HXS 1;  2WS9 2;  1QJZ A;  3MID A;  2XUM A;  3KV6 A;  2CAU A;  5C3O A;  4UF0 A;  1I5Z A;  3HVD A;  3SH5 A;  3O1V A;  1XNT A;  3NL1 A;  2VU9 A;  4LA2 A;  5D2A A;  3POG A;  2GP3 A;  1UOF A;  3U14 A;  1BBT 1;  1I9R A;  2WYF A;  1NCR B;  1OLM A;  2O8Q A;  2ZAB A;  5FRA A;  3MF9 A;  1R09 1;  1C3H A;  3PNA A;  2HWC 1;  5J09 A;  2DUQ A;  5CFD C;  1D4M 3;  1I5P A;  4P5H A;  3OYW A;  4KWJ A;  5CFD A;  1VBD 2;  3HMY A;  4JDN A;  2ID4 A;  1VBA 3;  1OA3 A;  1HX6 A;  2C9K A;  3OUI A;  4KGQ A;  3HEI A;  1GUI A;  3AYC A;  1OKO A;  3I97 A;  2IXI A;  3MV1 1;  1Q43 A;  4ZU4 A;  4A6S A;  1CAX A;  4E9K A;  4K40 A;  1JZ7 A;  5JOZ A;  1QJX 2;  4QQ2 A;  2JB8 A;  1JYV A;  3JBG 2;  4IGO A;  1XQN A;  4MH0 E;  2WQ4 A;  5HBA A;  3WHU A;  1W0P A;  4AI8 A;  1YYN A;  1S2E A;  2ADE A;  3C7F A;  4ZPI A;  4A3Z A;  5J1X A;  1CD3 G;  4OMD A;  1AYN 3;  5SV5 A;  2E7T A;  3U11 A;  1OVP A;  2WO1 A;  4MLO A;  4JDO A;  4NRM A;  5B4X A;  3TEX A;  3W5N A;  5GLT A;  3UKV A;  4IND A;  3FN9 A;  1CIY A;  4B7K A;  4MGQ A;  4DUV A;  3H8X A;  1S4C A;  2H0B A;  3VHR A;  5IVJ A;  4TLG A;  1V6K A;  2ZGT A;  4M3C A;  5A3W A;  5F7U A;  1OLQ A;  1PO1 1;  5CAD A;  2QDR A;  3S0M A;  1YRZ A;  1IS3 A;  2A3X A;  3CQO A;  2C4X A;  5EWS A;  2E33 A;  4OVE A;  1FPN 1;  4RR3 C;  3O1R A;  2J1T A;  3MUZ 1;  3AJY A;  3EO6 A;  3C7E A;  3J7M A;  5G05 L;  1SLL A;  4PJY A;  4EWA A;  5BNN B;  2GC2 A;  3OEA A;  3MPP G;  3OBZ A;  5CKQ A;  1RGS A;  1QQP 3;  2VZP A;  4HZF A;  4MGY E;  2W91 A;  3WVJ A;  3PTR B;  1V00 A;  4MG2 A;  4P14 A;  1SLA A;  2AYH A;  1B09 A;  1IQA A;  2PXJ A;  1AVB A;  1CAU B;  3I2I A;  4PI0 A;  1HLC A;  1LOF A;  4DZG A;  3I2G A;  2IXH A;  1H6X A;  2GC0 A;  1VMF A;  3QH6 A;  2ZEY A;  3CJI A;  3D8C A;  4KBB A;  1FV3 A;  3AZY A;  4E2G A;  1WCD J;  3RYK A;  2JD9 A;  5FWE A;  5L7O C;  2K46 A;  3KVA A;  4CDU A;  3PIJ A;  2RE9 A;  2OII A;  1ND3 A;  3H0O A;  2VBP A;  5HCF A;  3THD A;  3WDY A;  4YZ5 A;  4FI9 A;  1JOP A;  3I4I A;  2W1Q A;  2OW4 A;  2CNA A;  2VMI A;  4XF9 A;  2DWR A;  4L9B A;  3VBH C;  1DGW X;  4IE6 A;  4YWA A;  4GMP 1;  4FO9 A;  4OI2 A;  5CG9 A;  1NA1 A;  4I0A A;  2WDB A;  2W95 A;  2WNU A;  3AZV A;  5T5J A;  1MQT C;  4NAO A;  5IK5 A;  2D6K A;  1LHU A;  1OMI A;  3SQO A;  2AUY A;  5D21 A;  4LBN A;  3R0R A;  3T08 A;  3U07 A;  3USU B;  4CXW A;  4BIF A;  3WP4 A;  4FOW A;  4MET A;  1Y7B A;  1EY2 A;  4Y1Y A;  1BVV A;  4HAN A;  3ZSK A;  2DV9 A;  4JGY A;  1MZ6 A;  1R09 3;  1XNA A;  2GN7 A;  4XTP A;  2QVS B;  4CEY C;  2IVI B;  4BU2 A;  5GM0 A;  5DPN A;  1LR5 A;  2WZR 2;  2ZAC A;  4CEY A;  5FY0 A;  1V6O A;  4QX8 A;  1AYM 2;  4B8E A;  1D0H A;  1YQ8 A;  5KC6 A;  4IL7 A;  2WFF 1;  1ZZ8 A;  4YSF A;  4H3W A;  3VBO A;  3BB6 A;  3KLS A;  3PIG A;  4A2U A;  3T0A A;  3GZT B;  1VBA 2;  3PDQ A;  4Z2W A;  1L7Q A;  1S2B A;  4YLZ A;  5B4N A;  3O1S A;  5LB6 A;  3ZXA C;  4R9D A;  5I0R A;  4KU7 A;  4Z8B A;  5DMY A;  3AL5 A;  1F15 A;  2EIC A;  1J3P A;  5I8Y A;  1DYO A;  3KT7 A;  3U75 A;  4E8D A;  5FLI A;  2W47 A;  3G6J B;  4Y5T A;  4KU8 A;  1GZC A;  2JDP A;  2Y38 A;  4Q4V 2;  3D5O A;  4YG0 A;  1CPM A;  3J7N A;  3V0A B;  1E5R A;  1H8T C;  5FXX A;  4GJY A;  1S0C A;  2WRA A;  4XFI A;  4GWM A;  1W0N A;  5FYB A;  2YC2 A;  1F4A A;  1O59 A;  2VD7 A;  3RS6 A;  1RUH 2;  1VLN A;  2JDK A;  4SLI A;  3T2T A;  1C5I A;  1V6M A;  2P1B A;  3D0J A;  4Y5Z 0;  3CJI C;  4OZX A;  2D93 A;  3HQR A;  2JDM A;  4K1Y A;  3WX5 A;  4UYB A;  2FCU A;  5FAX A;  2XVG A;  5LCW L;  3WW2 A;  1C4R A;  4Q29 A;  5JPM B;  1Q8V A;  1BEV 2;  1H4H A;  1GV9 A;  4ZU5 A;  1O4Z A;  2IUW A;  1C8M 1;  2JEM A;  4Q4Y 3;  3HQX A;  4DY5 A;  2RDS A;  4LBJ A;  2NMN A;  3W59 A;  2GNM A;  2WSV A;  2XML A;  2XLA A;  5ISL A;  4WVW A;  2V72 A;  4MOA A;  1UF2 C;  1HIX A;  2IXJ A;  4UW3 A;  1VAM A;  1W6P B;  1MS1 A;  1Q5O A;  1REF A;  3BN6 A;  1PGL 2;  2UWB A;  4I0W B;  2AR6 A;  3ZYH A; 
#chains in the Genus database with same CATH homology
 2J1A A;  2VCB A;  4LPL A;  1OD3 A;  2Y6K A;  3THC A;  4AG4 A;  3VD7 A;  3MBW A;  1PMJ X;  2CDO A;  3ACG A;  4MGS A;  1O8P A;  5CZK A;  4DEV A;  4BXS V;  4MAD A;  4D0Q A;  3GGL A;  5JUV A;  2W9X A;  1JYW A;  2EIB A;  4XUT A;  2E26 A;  4MO3 M;  4UAP A;  1XPW A;  1JZ5 A;  1ULO A;  4QDS A;  1JI6 A;  2W5F A;  2J7M A;  3WSO A;  3C7O A;  5IFT A;  4DXT A;  1IQD C;  4DXR A;  1BHG A;  4ARX A;  1W9T A;  5DN2 A;  3T2P A;  3K77 A;  3T0D A;  4XUR A;  1DLC A;  1PX3 A;  2JDA A;  2Z4F A;  1RYY A;  2J1S A;  2VL4 A;  2W92 A;  3NQH A;  5JMO A;  3FHQ A;  4BK5 A;  3A23 A;  2LS6 A;  3IAQ A;  3LEI A;  2QQM A;  5DQ0 A;  2J1E A;  3HNB M;  1LNS A;  1W8N A;  1K42 A;  2J22 A;  3CMG A;  3U37 A;  2BGP A;  3CKH A;  2Y6G A;  3ABZ A;  2XOM A;  3OG2 A;  3EB7 A;  1WCQ A;  4OMC A;  4PT6 A;  5JXJ A;  3WNL A;  3HNY M;  3T2Q A;  3K46 A;  3D3A A;  2VME A;  5C70 A;  4M4R A;  4QB6 A;  2EID A;  2E32 A;  1OF4 A;  3I2J A;  5EJZ B;  4A45 A;  4A6O A;  3EYP A;  1K45 A;  3LQC A;  5EJ1 B;  4LQR A;  2RVA A;  3E1F 1;  1TG7 A;  1CX1 A;  2Y6J A;  3DYP A;  4YPJ A;  2YFU A;  4KWU A;  5LA0 A;  1NUK A;  3I2H A;  3NNG A;  2VTF A;  3SEE A;  2YFZ A;  2ZEX A;  3SKV A;  1UXX X;  1EUT A;  3C8X A;  2HLE A;  4CUB A;  2DDU A;  2VZV A;  2QQO A;  3W5M A;  2DCJ A;  4P5Y A;  3III A;  2C26 A;  4RYD A;  4W8J A;  4QB1 A;  2YC4 A;  2WAA A;  4JHZ A;  2VQU A;  3UES A;  1KEX A;  2HYX A;  2WO3 A;  4JKL A;  1HN1 A;  1H6Y A;  2X10 A;  3GM8 A;  2B9V A;  2WUH A;  3IDA A;  2JE8 A;  2VZU A;  1JU4 A;  3I3D A;  2X05 A;  4W50 A;  3OGS A;  3LPF A;  4QX1 A;  2YB7 A;  2VZ3 A;  4CVU A;  3HJR A;  3WF3 A;  2WQ8 A;  3ACI A;  2XON A;  1DP0 A;  1F4H A;  3CIH A;  3WF1 A;  4QB2 A;  4QX3 A;  1UY2 A;  1SHW B;  4OUE A;  2Y64 A;  4LHS A;  2Y8K A;  3K4D A;  3GDB A;  5HPO A;  2WO2 A;  2W1W A;  3HOB A;  1US2 A;  2QQJ A;  3MUY 1;  2ZEW A;  1KGY A;  5I0D A;  1UYY A;  4KI5 M;  1JZ6 A;  3T09 A;  3LEG A;  4GWI A;  2W46 A;  3DYM A;  4XVH A;  5LA2 A;  3CZJ A;  1UY1 A;  1W9W A;  1XC6 A;  3C7G A;  1W9S A;  2X09 A;  1GQP A;  5JXI A;  3WF2 A;  4P00 B;  1TVG A;  2J1U A;  1GNY A;  3FL7 A;  1W8O A;  3WF0 A;  5JXH A;  1GU3 A;  4CU9 A;  3NJX A;  1UXZ A;  4JKM A;  2OKX A;  2BBA A;  4OYU A;  2WZ8 A;  3GXU A;  3OBA A;  3DYO A;  3IAP A;  3P6B A;  2J1R A;  5JXG A;  4QDQ A;  1CZS A;  4ARY A;  2DCK A;  3JXS A;  1K12 A;  2WN2 A;  2XQX A;  4AAX A;  2QBX A;  2BZD A;  1PX4 A;  2PQS A;  3K75 B;  4TXW A;  1UY4 A;  1K3I A;  1NX9 A;  4TTG A;  4A41 A;  3WNN A;  3A22 A;  3ACH A;  3HN3 A;  1EUU A;  2VZR A;  4ET7 A;  2VMD A;  1W99 A;  2ZEZ A;  3FHA A;  4JX0 A;  5EIY B;  4A4A A;  1UY0 A;  5IYY A;  1UY3 A;  4DXS A;  2W1S A;  2E31 A;  2VZT A;  2WAO A;  2VZO A;  4CU6 A;  2VC9 A;  2VCA A;  4QDR A;  4RN5 A;  2VR4 A;  4UOJ A;  4ZY9 A;  4UI9 L;  2QQK A;  2QQN A;  2W1U A;  4QPW A;  3ECQ A;  2W94 A;  1SG3 A;  4JKK A;  5G04 L;  1T2X A;  4BJ0 A;  2WZE A;  2VMF A;  2CDP A;  2Y6L A;  4Z2A A;  4A42 A;  4ZZ5 A;  2BGO A;  3K4Z A;  2ZXQ A;  4W4Z A;  3LE0 A;  2WN3 A;  3I2F A;  3VDC A;  3WNK A;  1O8S A;  1XNT A;  2W87 A;  5IJR A;  3WNO A;  1PMH X;  5HXM A;  3VD5 A;  4DUW A;  3F2Z A;  1CZT A;  3HNM A;  3SKJ E;  4CUC A;  3I3E A;  2RJ2 A;  2VMC A;  1I5P A;  5C71 A;  3PUI A;  2ID4 A;  2C9K A;  4KMQ A;  3HEI A;  1GUI A;  3MV1 1;  3I97 A;  4HG6 B;  1JZ7 A;  3AC0 A;  1JZ2 A;  1JYV A;  1P8J A;  3I2K A;  2ORX A;  2VO5 A;  3C7F A;  4A3Z A;  5J1X A;  4OMD A;  2WO1 A;  3W5N A;  5B4X A;  1WKY A;  1L7R A;  3PUH A;  1UYX A;  3FN9 A;  1CIY A;  3OGV A;  4MGQ A;  4DUV A;  3WF4 A;  1UMI A;  4DEQ A;  2RV9 A;  2VZS A;  4ZZ8 A;  1JYX A;  3OB8 A;  5F7U A;  4BK4 A;  3C7H A;  1OF3 A;  2V5D A;  3CQO A;  3K4A A;  3WNM A;  1GOH A;  4QAW A;  2C4X A;  2R7E B;  3ETP A;  4BDV B;  2E33 A;  2VCC A;  3NJV A;  4IUG A;  4L0P A;  2J1T A;  3MUZ 1;  4CUA A;  5G05 L;  3C7E A;  4XUQ A;  2YG0 A;  2V4V A;  4CU8 A;  3OEA A;  2WYS A;  3VD9 A;  1R64 A;  2QQI A;  3BGA A;  3DEC A;  2VZP A;  1JU3 A;  2W91 A;  2WAB A;  3A21 A;  5FUI A;  4XUP A;  3WEZ A;  2KD7 A;  5CYY A;  2VJX A;  3I2I A;  3ACF A;  4GWJ A;  3I2G A;  3OGR A;  4CU7 A;  2VZ1 A;  1H6X A;  2ZEY A;  4LKS A;  2B4K A;  1OH4 A;  5A1A A;  4XUO A;  4M4P A;  2JD9 A;  2VQT A;  3NRU A;  4ZXE A;  5LA1 A;  1JYN A;  1CZV A;  3THD A;  3LPG A;  4E8C A;  4FI9 A;  2W1Q A;  3VDB A;  2Y6H A;  1GOG A;  2XHN A;  3IB3 A;  1US3 A;  4A44 A;  4QX0 A;  3VD3 A;  3VDA A;  5C7G A;  3WQB A;  4D8M A;  2WDB A;  2W95 A;  1OT5 A;  1JHJ A;  3T08 A;  5JR2 A;  1D7P M;  2EIE A;  3LEK A;  1J83 A;  3VD4 A;  4DUX A;  1ULP A;  1XNA A;  5DPN A;  2W3J A;  4P02 B;  1GOF A;  4QX2 A;  1UX7 A;  5IHR A;  3UET A;  4XUN A;  1YQ2 A;  3T0A A;  1J84 A;  2WBK A;  1JZ8 A;  1L7Q A;  1NAE A;  5B4N A;  2BER A;  3CDZ B;  5DMY A;  2VZQ A;  1NKG A;  2LW8 A;  2EIC A;  4PF1 A;  5IFP A;  2QQL A;  1DYO A;  4E8D A;  2W47 A;  1UYZ A;  4PQQ A;  1GMM A;  3T0B A;  4XZU G;  1W0N A;  2ORZ A;  3UNP A;  2YC2 A;  1F4A A;  1MPX A;  1O59 A;  3WNP A;  3J7H A;  4P08 A;  3HPN A;  2L9L A;  5LCW L;  3MO4 A;  3T2O A;  2VOT A;  3MV0 1;  1JZ3 A;  4GZ9 A;  3I3B A;  2JKX A;  2J1V A;  1JZ4 A;  3OEB A;  1UZ0 A;  1UMH A;  1SDD B;  2V72 A;  3CZU A;  3P1I A;  4MOA A;  2VM9 A;  1UWW A;  3SEP A;  4OZO A;  3BN6 A;  3A7Q A;  3ZM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...