1GNYA

Xylan-binding module cbm15
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
153
Chain Sequence
b'GNVVIEVDMANGWRGNASGSTSHSGITYSADGVTFAALGDGVGAVFDIARPTTLEDAVIAMVVNVSAEFKASEANLQIFAQLKEDWSKGEWDCLAGSSELTADTDLTLTCTIDEDDDKFNQTARDVQVGIQAKGTPAGTITIKSVTITLAQEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE 10C
publication title Structure of a Family 15 Carbohydrate-Binding Module in Complex with Xylopentaose: Evidence that Xylan Binds in an Approximate Three-Fold Helical Conformation
pubmed doi rcsb
source organism Pseudomonas cellulosa
molecule tags Carbohydrate-binding module
total genus 30
structure length 153
sequence length 153
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gnyA00
3WNLA 1JU4A 1PMJX 2Y6JA 3NRUA 4DEQA 3NJXA 1NKGA 2RJ2A 5DMYA 3LQCA 3VD9A 2Y6GA 3FN9A 4W8JA 4OZOA 1JZ3A 5JXGA 2ZEXA 1UX7A 4A42A 3LEKA 2YC4A 3D3AA 1H6YA 1SHWB 3K4ZA 3C7OA 3VDAA 3OGSA 1UY1A 5I0DA 2V72A 2VZPA 3OB8A 4LHSA 2ZEWA 4OMCA 1OH4A 2VCBA 1JZ8A 4P08A 1H6XA 3MV01 3THCA 2Y6LA 4XUOA 2V5DA 3T2PA 2J1AA 3BGAA 3CDZB 2J7MA 2XQXA 3MBWA 3I2KA 3VDBA 1XC6A 3ECQA 3K77A 2X05A 1RYYA 3SEEA 4JKLA 2VMFA 2WABA 2YC2A 3SKJE 3ETPA 2W1WA 2PQSA 4QDRA 3T0BA 3MV11 2J1TA 3MUZ1 2CDPA 3SKVA 1PX3A 1SG3A 2ZEYA 1WCQA 4KMQA 2E26A 2J22A 2Y8KA 2CDOA 3WQBA 5J1XA 4A6OA 2VZRA 4QX0A 3WF4A 3P1IA 4YPJA 2OKXA 1CIYA 2W47A 1UY2A 2BBAA 1UMHA 2VM9A 3WF0A 2VCCA 5EIYB 3GGLA 3NNGA 4ET7A 3IDAA 1JHJA 4BK4A 1W99A 1DLCA 4FI9A 2W94A 3THDA 1UZ0A 4BJ0A 3VD4A 1EUUA 3NQHA 3WNKA 3OGRA 4MOAA 3I2JA 3HNMA 1JI6A 3DYPA 1UYYA 2VCAA 3GDBA 3WSOA 3CZJA 2X09A 2ID4A 2VZSA 4CU6A 2J1EA 2V4VA 3W5MA 1CX1A 1EUTA 3I3EA 2QBXA 1OT5A 3HEIA 1K12A 1GQPA 2W95A 3MUY1 1CZSA 1D7PM 3C7HA 3A23A 3LE0A 2W5FA 3OBAA 1JYNA 3C7EA 2XHNA 2EIEA 5DPNA 5CYYA 1NX9A 4BK5A 2VTFA 5JUVA 2DDUA 2WO3A 4E8CA 4M4RA 2DCKA 2QQJA 1NAEA 2VZOA 4JKKA 5G04L 2VOTA 2EIBA 2HLEA 2VMDA 4PF1A 3F2ZA 4DEVA 3OGVA 5IYYA 3VDCA 2VC9A 1JZ7A 2WYSA 3LPGA 2J1RA 4QDSA 4AAXA 4QDQA 4MADA 3IB3A 2WUHA 5IJRA 2YG0A 1GNYA 3ACGA 1GUIA 2C26A 5G05L 4CU9A 4W4ZA 2Y6HA 3DYOA 3HJRA 2ORZA 3AC0A 4IUGA 1JU3A 4DXTA 1R64A 2C9KA 3EB7A 3I97A 3T0DA 3J7HA 3C7GA 1JYWA 1OF4A 3UNPA 3WF3A 1TG7A 3ACIA 4ZXEA 4E8DA 4CU7A 4LKSA 4XUTA 1CZTA 3HNBM 1K3IA 2VO5A 1O8PA 4TTGA 4RYDA 1DYOA 3VD7A 3WNNA 1YQ2A 3DECA 2RV9A 3CKHA 4KI5M 2ZXQA 5F7UA 3HNYM 3T08A 2E33A 2W1SA 2W3JA 4TXWA 2QQMA 1W8NA 4DXSA 2RVAA 4ZZ5A 3IAPA 4GZ9A 4DXRA 3CMGA 5IHRA 3UETA 1OF3A 1US2A 4JHZA 4ARYA 3WNOA 4MO3M 1GOGA 1UMIA 1SDDB 2JKXA 3VD3A 3U37A 4P02B 1JYXA 1JZ2A 5JXHA 2XOMA 2KD7A 1PMHX 2L9LA 2JDAA 3HPNA 1JZ5A 5JMOA 1GU3A 2WBKA 3PUIA 3I2HA 2VJXA 5A1AA 3BN6A 2J1UA 5LA2A 2VMCA 2W92A 2BZDA 2VZQA 4ZZ8A 3HOBA 5EJ1B 2YFUA 3ZM8A 4QAWA 1GOFA 1NUKA 5C70A 5LA0A 3I2GA 4DUWA 1BHGA 3OEBA 1IQDC 1KGYA 3WF2A 4LQRA 2WDBA 3NJVA 2WO1A 2C4XA 1W0NA 3I3BA 4UI9L 2ORXA 1JZ4A 4PT6A 4GWIA 2W1UA 2W87A 4OYUA 5B4NA 4RN5A 2JE8A 3OG2A 3T2OA 4M4PA 2B4KA 3GM8A 2EICA 4CUAA 1UXXX 3LPFA 2WAOA 2WN3A 4UAPA 3A22A 3PUHA 3EYPA 5DQ0A 1K45A 4Z2AA 1O8SA 1UWWA 2VMEA 4D0QA 4CUCA 5C71A 3ABZA 1W8OA 1K42A 2R7EB 5JXJA 1KEXA 3WF1A 4QX3A 4JX0A 2QQIA 2W9XA 3ACHA 2WZEA 1L7RA 2J1VA 2X10A 4PQQA 3GXUA 2BERA 3IAQA 2WQ8A 4QB2A 3SEPA 4A45A 3K75B 1J83A 2B9VA 3OEAA 3HN3A 5LA1A 1XNAA 3K46A 2J1SA 1JZ6A 3T09A 4ZY9A 4QB1A 2QQOA 2VQTA 3K4AA 4GWJA 4QB6A 4CUBA 2HYXA 3FL7A 4A4AA 2BGOA 4MGQA 5IFPA 1GMMA 2ZEZA 2Z4FA 1JYVA 4LPLA 2W1QA 3LEGA 4P00B 5HPOA 3A7QA 2VR4A 2QQKA 2JD9A 3T2QA 3FHAA 4A3ZA 5JXIA 1XNTA 5FUIA 1ULPA 2VQUA 4D8MA 3I2FA 3WEZA 2VZTA 4QX1A 2YFZA 1GOHA 5C7GA 4XUNA 5CZKA 1UYXA 4BXSV 2DCJA 2QQNA 4OUEA 3T0AA 2VZVA 4A41A 4XURA 2QQLA 5DN2A 4MGSA 4CVUA 3A21A 2LW8A 3C8XA 2E31A 4AG4A 3ACFA 1W9WA 1F4AA 2Y64A 4L0PA 1W9SA 1LNSA 3JXSA 1CZVA 4KWUA 3IIIA 4XZUG 1O59A 2WO2A 1OD3A 4QX2A 1HN1A 2VZUA 1J84A 3VD5A 4A44A 2LS6A 2W91A 2VZ1A 1UY3A 1TVGA 3WNPA 4DUVA 2Y6KA 1MPXA 3I2IA 5IFTA 4CU8A 4UOJA 3CQOA 4P5YA 3CZUA 3FHQA 1W9TA 3CIHA 4HG6B 2EIDA 4XUQA 1US3A 1DP0A 3DYMA 3C7FA 3E1F1 1ULOA 1T2XA 4XUPA 2VZ3A 2WAAA 4XVHA 5HXMA 3W5NA 2BGPA 1UY4A 3WNMA 3LEIA 4ARXA 2W46A 4OMDA 2VL4A 4W50A 1WKYA 4DUXA 3P6BA 3K4DA 4QPWA 1L7QA 3MO4A 1F4HA 5EJZB 4BDVB 1I5PA 2YB7A 1PX4A 2WN2A 1P8JA 2E32A 5JR2A 1XPWA 4JKMA 3UESA 1UXZA 1UYZA 2XONA 3I3DA 5B4XA 1UY0A 5LCWL 2WZ8A
chains in the Genus database with same CATH superfamily
4EZ4A 1AR93 1LU2A 1OA4A 3NV2A 4PIYA 5A3NA 1ZREA 1LAJA 2Y6JA 4KQ7A 2R30A 5E6HA 5GLZA 3LKJA 3MEPA 2GH8A 1CAWB 4H2AA 1D4M1 4AVSA 3T2TA 1YWKA 4GH4A 4GB31 3O1SA 4OZOA 4MGKE 4A2UA 1NLRA 2XMLA 1IG0A 2DUPA 1CN1A 5BV6A 1RC6A 1RHI1 3R4SA 1Q43A 3FUOA 1AR91 3D3AA 4AEMA 2G9ZA 5FP3A 1YQ5A 4D94A 3AXEA 1UNBA 4QQHA 5FPAA 3LOIA 1V6IA 1GYKA 4FPCA 2PMWB 5D8AA 5C4WB 5L36A 4TLGA 3ZFFB 4IE0A 1HXS2 4MXWA 3W21A 5BNPB 5LY1A 2EXIA 3R4UA 4WBBA 3EO6A 1OH4A 1JZ8A 1LKNA 5FDBA 3KLSA 1HB3A 3W20A 4U36A 2V5DA 4SLIA 1UCXA 2HKXA 4YW4A 2RG4A 4OI1A 4LNVA 4IE4A 3VDBA 3BU0A 2YGMA 3VHPA 5CADA 1GZ9A 2Y34A 3ZYFA 1DQ1A 1XC6A 4LBMA 4A7ZA 3I49A 5LCWL 3M3IA 4RS5A 1UD1A 1O4ZA 3PVBB 3WZ1A 2V4AA 1HXS1 1RYYA 1RTVA 2D6MA 3G7DA 1WA4A 3MYXA 4FP3A 5D2AA 4CCNA 3POGA 4DO0A 4DIQA 3H50A 3MIGA 3UGGA 5A33A 2RMU3 1RMU3 3ETPA 4YG0A 2ZAAA 4QDRA 2XLGA 2D5FA 2PHWA 1FNZA 3O7OA 3OPZA 4XMAA 2OYZA 3AZVA 2PHFA 3MUZ1 2CDPA 1UOGA 3FX3A 3HBKA 2WNVB 1PVC3 1PX3A 1O3QA 4FP2A 1GZWB 4XF0A 2X5IB 1ND2B 5CA6A 4CDQB 1AX2A 4QKBA 1Y3TA 1UU6A 3H3ZA 1POV0 2Y8KA 1X33A 4JQRA 4Y24A 4Y33A 3BTYA 3H3UA 4FSJA 3ENRA 2Y26A 3PURA 1GQGA 2RMU1 2BRTA 1RMU1 2VZRA 4IEVA 4NN0A 4QX0A 4CP2A 3LOBA 2OKXA 1CIYA 1K5MA 1N1TA 2W47A 3B5LB 1ULDA 4M3CB 1XBFA 2VCCA 4AEDC 4AHXA 5I0TA 1LCLA 4BQYA 3MIFA 2XUEA 1MS5A 3GGLA 3NNGA 3O1UA 1VRBA 4BB3A 1N47A 1OOPC 5LEJA 1KDMA 4BK4A 1W99A 3DUIA 1OC1A 1DLCA 4FI9A 3B94A 1Q8VA 2W94A 1H4GA 1W2AX 4TSVA 5JI9A 2NZ9A 3S57A 2E7TA 3MLLA 4IEXA 4NWVA 5HI0A 2JICA 5DG1A 1EUUA 4MXVA 1OSGA 3I3QA 4Z8BA 4BOWA 1QKQA 3X29B 3OGRA 5F5AA 4HSJA 4AL9A 3HNMA 1XNBA 3VBUC 5L19A 3MZHA 4LO4B 1AXYA 3DYPA 2WLPA 4IEPA 4QKNA 2VVEA 1I5ZA 3WP3A 4XFHA 3U78A 3WSOA 5DAVA 4QQLA 2R043 1W8ZA 2X09A 3VZJA 3CLPA 4I01A 4CU6A 1KJLA 1W6QB 2BJSA 4P5HA 5E8AA 1CX1A 1DQ6A 3I3EA 4P9JA 4F83A 4YW2A 4DQAA 2GN7A 3L2YA 1LOGA 4IV1A 1W6MA 2QE3A 5JWPA 1K12A 2OIIA 2W95A 3KV5A 4NRQA 2XL7A 3U07A 2P4EA 1B09A 5HV0A 2R041 3MLKA 3LE0A 1XQNA 3OBAA 2A6WA 1QU0A 3DCQA 2YMZA 4ASLA 5BNOA 4NE9A 4D6QA 2FDJA 2CNAA 5EYXA 1S55A 4NR1A 1KD7A 4KL1A 2XBO3 4AI9A 3AP7A 3NV3A 1DIWA 1LGNA 4EJRA 1LEMA 3MF9A 1LR5A 1V6NA 2BYVE 4PI2A 1GP6A 4XIOA 1NAEA 1WCKA 3T4HB 4AQ6A 2ZS6B 1BLZA 2HLEA 2VMDA 4YSFA 3RSJA 2UWBA 2D3SA 4HKLA 1VRH3 1ZRRA 4XF9A 2YZ4A 2JE9A 2BEOA 5FTTC 4K8FA 1MS1A 1IOAA 1XU2A 2BW8A 2XBO1 1BEV3 3VDCA 2VC9A 2JDYA 3S5QA 5FMDA 5JVVA 1HRV2 2WYSA 1CAXB 2TEPA 1OLMA 1U5IA 4CCCA 3IB3A 5IJRA 5KHIA 3VDDC 1NCQC 4A7YA 4IGQA 4DRRA 3VBOB 3ACGA 4XEZA 3J9SA 1ENXA 1GUIA 1ULFA 5A7QA 4BU2A 4XIKA 5LRSA 4MVTA 3SISA 5IAXA 4W4ZA 4CDXB 1MQTC 4HFSA 1VRH1 1KRIA 4DMIA 2ORZA 1MS8A 3AC0A 5FK7A 3J7LA 3KF5A 1AXKA 1MZ5A 3BOPA 5CKMA 5KHJA 3H8OA 1BEV1 4N43A 3HQUA 4GXLA 3DV8A 1F35A 5APAA 5IVEA 2EIGA 4DXTA 1PGL1 1SACA 3POBA 2C9KA 3KT1A 1ULEA 4Y22A 3BPZA 3EB7A 2CGPA 4GMP3 2P1BA 3I97A 2ILMA 1OVPA 3USUA 1VBC2 3C7GA 1AX0A 2G4IA 5FQ0B 2WNEA 1HJFA 1UKGA 2GP3A 3WF3A 2ZX0A 1G9DA 3TEYA 4QKDA 2Q0AA 5K0UA 1WD4A 2RS32 3M7AA 4PJYA 4KU7A 1A8DA 1WW5A 3HNBM 4WM7C 3KHCA 1K3IA 1O8PA 4HPKA 3GYDA 5F2SA 3ZFGB 4RYDA 5IK5A 4G3YC 5A3PA 4C0BA 3PIJA 3VD7A 1QOSA 1F15A 4GMP1 2QQUA 2C5DA 2YHJA 3VL9A 4IETA 2Q5TA 4KI5M 1XE0A 4K9SA 3T08A 1NA1C 1MACA 2QKDA 3MI8A 2W3JA 1QJX2 1OFNA 2QQMA 4D7SA 4URAA 3IM0A 4DXSA 4GZ9A 3H1YA 1RUC3 1PIV2 3SCHA 5KXDA 5KXBA 2OW4A 3SH3A 5K8SA 4DXRA 4GJZA 4NPMA 1G9AA 1YLLA 3PHMA 4COWA 1KJRA 2J42A 1OF3A 3OPTA 4UT5A 3VBSA 3ZVXA 4EN6B 2NP0A 5HCBA 4ARYA 1DGWA 4EQVA 1H1MA 1UMIA 3U37A 4P02B 3CJIA 5D21A 1YC61 3LDKA 4QGLA 4C91A 5A6ZA 1TME1 2KD7A 3OF1A 2Y0IA 5GZGA 1I1EA 4IXLA 4JHTA 1JZ5A 1S4CA 1DQ2A 1YRZA 1RUC1 1WLWA 1GU3A 3B02A 2QQVA 4N7IA 3RYPA 3ILRA 2VJXA 3ZXFA 1RUE3 3PU8A 4QT6A 5FMBA 3WVJA 2JD4A 3EQEA 3BN6A 3PMSA 4DEVA 2XGXA 5AC92 3N9NA 2J1UA 1IPKA 2GDFA 4K3UA 2R32A 2QVSB 4QPIB 2VMCA 2GC2A 1W8FA 2VZQA 4BQ1A 2OUHA 1ZVFA 3HOBA 2LM3A 5EJ1B 3DGTA 1W04A 3J8F3 1ODMA 1NUKA 1FV2A 1C5HA 3M8LA 5FRAA 1RUD2 1WMFA 3N7JA 1NY71 3WF2A 3BTXA 4UW5A 1RUE1 4FVVA 4LQRA 3JUUA 1H8TB 4L97A 3NJVA 1ZRFA 4GMP0 1XNCA 1N3PA 2C4XA 4JZRA 3ZR6A 1W0NA 4ITCA 1G6NA 3HN1A 2W08A 1JW6A 3PJYA 2B46X 5FZ3A 4PDWC 1VBB2 1PGW1 4PT6A 5J96B 3IWZA 5B4NA 4WVZA 1I3HA 3AP4A 2VNVA 2Q1FA 5FAXA 1O5LA 5CFDB 2HWF3 4YYOA 3WDYA 3KZ4C 5BUVA 1V0AA 1VJ2A 1CR7A 2YUEA 4BIFA 3VUOA 4V1PA 4EWAA 1QJY2 1VP6A 5I91A 3LPFA 4UAPA 2HEWF 1RUI3 5FO9B 1PHMA 1LULA 3B9IA 3T30A 1W6OB 3LAGA 2BTVC 4BLIA 5ABJB 3I54A 3BB6A 3FFZA 4QHOA 4YZ3A 4HBNA 4Z2AA 5J36A 4YVWA 4HL0A 3RWNA 2VU9A 3VZLA 5K7PA 1AUYA 1W8OA 3HIFA 4Q4Y2 3S7EA 2HWF1 4NHMA 4SBVA 3VBHB 5BNQA 4KWKA 2ZMKA 2WS93 5CFCA 2NLRA 3CU7A 3WF1A 4IEUA 4JX0A 2QQIA 2X53S 4B4PA 5FYBA 4LO5B 1RUI1 2EVXA 2YYOA 2W9XA 4HVRA 5DUWA 1OMIA 1EV12 2Q1MA 3ACHA 3IPVB 4UFMA 2OZ6A 4GKYA 4YG3A 4CRQA 1L7RA 2VNGA 1WD3A 3IAQA 3ELNA 4A45A 3AYDA 5C4WC 4B7EA 3AKTA 1BCXA 3HN3A 3IKWA 1XNAA 2I07B 5FY1A 5BNPC 1D2QA 1QDOA 3FWEA 3VKNA 5BNNC 4Q8LA 2WS91 2YPJA 2VQTA 1W6PB 1L3JA 1RINA 3POSA 4XW3A 4XOGA 2VQAA 4UFIA 3BU7A 3VBFB 4Q29A 2BVVA 2GAUA 4LKFA 2VPVA 4CPBD 2ZEZA 2N7GA 4B1LA 1G9BA 1CAVA 2CSGA 1UIJA 4XXAA 3FJSA 1ASJ3 1RUOA 3A7QA 1BZWA 2JD9A 3FHAA 1JUHA 2ZGSA 1MVQA 1O4TA 2ZMLA 3L2HA 4RR3B 4YLZA 3C2UA 1ULPA 2CGOA 5FZ1A 2JX9A 1LECA 3POJA 4AW7A 2LUWA 2NQYA 4Q2FA 2WWUA 4Z92B 2VOWA 4BMEA 1BMV2 2HH9A 2NMOA 4RL7A 3FFQA 4A3XA 2YFZA 2HWE1 5C7GA 3ZDVA 5KHGA 2WSVA 1HRI3 1ASJ1 2WQ4A 2BVBA 2DCJA 2QQNA 2X5IC 3H7JA 2YBSA 1R1A2 2VZVA 4CDQC 5LEKA 4UFKA 4FPLA 5AVPA 1MEC2 3VN4A 1AXZA 4XDOA 2RE9A 3J26N 3SHRA 3U1XA 3TRSB 1JXNA 2LW8A 3AKRA 3ZFEB 3ALQA 1W06A 1GANA 2ZOEB 2GN3A 2EAAA 1AR82 1HN0A 1W9WA 4AE2A 2XWJB 3P5BA 1HRI1 1IS4A 3AMMA 3JXSA 3OTFA 4XJZA 1WMXA 2FCUA 1GWMA 2NMNA 5FYVA 2WL1A 2P6HA 3UL2A 2WT1A 4INDA 4XZUG 2YBPA 4OVEA 5DUVA 5BXXA 1O3TA 4OHVA 3KCYA 1FATA 4GWNA 4QX2A 4LLFA 2ZGRA 1KFUL 1J84A 2ENRA 4BXFA 4OHWA 4A44A 1G9FA 1PGSA 2BWAA 1UY3A 2LS6A 2W91A 3N3HA 3N7KA 2PQQA 4YW6A 3WNPA 3VHNA 1TMF3 3ZSKA 2Y6FA 3DN7A 3I2IA 4AVVA 5IFTA 1EPWA 3IDEA 1YQ6A 2Y33A 3CQOA 5LWBA 3ZN4A 3FHQA 4PI0A 1W9TA 2A1XA 3AXDA 2EIDA 4XACA 1D0GA 1RXFA 1LENA 1NT0A 3DYMA 3AYCA 3E1F1 5C5UA 3BODA 3JBG2 4XUPA 4META 4FAHA 2VZ3A 2R063 1EAH3 3BCWA 2WNUB 2A71A 1W9FA 3AYEA 4EZHA 2YC0A 3WOGA 1TMF1 5J48A 2HWC2 1RUJ2 4CZSA 4KGGA 1QF3A 2LROA 1IKQA 1VAKA 3H42B 2HEVF 1ULGA 3URFA 4AAPA 5CKNA 4YNIA 1DCSA 2VTXJ 3WR0A 2WWJA 4IL7A 4MX3A 4Q4V3 4COYA 1RVF2 5FYSA 5J98B 2DBIA 4LBQA 3P6BA 3E5QA 1M06G 2R061 4PHZA 1EAH1 1DU3D 4NPLA 2QJVA 4M00A 4N53A 1H2KA 1I5PA 3VKLA 1PX4A 3AMPA 3NWKA 1P8JA 3IDBB 1V9U2 2XONA 3I3DA 3VZOA 4JHZA 2ZJCA 5T54A 5IVBA 1HQWA 3AJYA 2UY9A 3EXUA 3USSA 1PMJX 4Q4V1 4CDUB 2BQPA 4Q4X2 4DEQA 1ST8A 3AM2A 3HD8B 5AVAA 5FZCA 2RJ2A 5DMYA 5JZGA 3PVEA 4FFFA 4Y20A 2ZGKA 3C3VA 2Q8CA 2PLV2 3FN9A 2AZ5A 4FPHA 4W8JA 1H0BA 2ES3A 3RNSA 1A34A 1AL22 5F8PA 2VULA 4HKOA 1W6NB 3WP4A 3AB0A 3LEKA 3OJBA 4QHZA 2FQPA 3VZKA 3WW2A 4P9IA 3P3NA 4WM7A 1SHWB 3K4ZA 1QHDA 3C7OA 4DB5A 1MZ6A 4AQSA 1MQTB 4CDWA 1NLSA 5EWSA 5A7WB 4AHZA 5I0DA 4XC9A 3POIA 4CE8A 4CCOA 5HXVA 2GNBA 3OB8A 4LHSA 2ZEWA 3KV9A 4LITA 4YW1A 2BFUL 3ZIWA 4ASKA 4F3JA 5J3UA 1ODNA 3U4XA 3ZXLA 3LCPA 1G9CA 1NA1A 5FO8B 2GC1A 4I09A 5A32B 2Y6LA 2VUCA 5DDJ2 2J7MA 3RJRA 1GP5A 3I2KA 2I45A 4OQ9A 4CTEA 3ZFGC 1NYWA 1PK6B 1RUG2 3GNEA 1E57A 3M3QA 1RJ8A 3JD72 3K77A 3MDPA 3VGIA 4XF4A 1SPPA 2JG9C 3ST7A 4JKLA 4ZHNA 2BWCA 2VMFA 1QNWA 1B35B 4BM8A 1LU1A 2CWMA 5FOJB 5LBFA 1J1LA 3FE5A 2PQSA 3ILNA 3T0BA 5DDJ1 3ZDSA 3NVCA 4U2AA 1W8TA 1UU5A 4M0HA 4Q4W2 3ZPYA 2FZ2A 3SKVA 2FMDA 3KV6A 1WLDA 3TEWA 3FHIB 4LR4A 2UWCA 1GLHA 4RSUA 1ZZ9A 4QPGB 2DVBA 3J7MA 1PO13 3LDRA 3GBFA 1W8UA 4AGRA 1FPN3 4OFGA 1WCQA 5HCHA 4LTAA 4KMQA 1CAUB 3BI3A 5DAQA 5TSWA 3H1WA 4FPKA 2Y0OA 3WQBA 4A6OA 5J1XA 4PLOA 1HIXA 2EF6A 3K3NA 5FZ7A 5T55A 1REEA 1UMHA 2VM9A 3LF7A 3WF0A 4DS0A 5FZAA 1QJU3 2XJQA 2JB8A 4KBBA 1YYNA 2GH2A 4ZS3A 3ZXGA 5EIYB 2RDNA 1KQRA 4TZDA 4FO9A 4ET7A 3IDAA 4ORFA 3OYWB 5DAPA 5EXOA 3WP5A 1PO11 4NHXA 3THDA 1FPN1 3LD8A 1O3SA 1ND3B 4PDWA 5C3SA 1UZ0A 3DPRB 4CEYB 4MV2A 4K1ZA 1BJQA 1BYHA 2DTYA 2GSYA 3NL1A 1UYPA 3WQ1A 4KWLA 4OHYA 1QJU1 1OXCA 4XFIA 3O1MA 1UYYA 5GZEA 2ZBJA 5FREA 1H8TC 4IW3A 3GDBA 1J59A 2ET7A 3S7IA 3EBRA 3WG3A 5C8CA 3CEWA 1ZRDA 3CZJA 1WMDA 1W3XA 2CU5A 2P5BA 1Y9GA 5AFEA 1T6BX 1UMZA 3RS6A 3WDTA 2OQ7A 1UOJA 2V4VA 4LK6A 4AI8A 3W5MA 1BVVA 1RUF2 2B7YA 2E7AA 4NRMA 4J1XA 1SLTA 3RZJA 1CAWA 3MUY1 3ETQA 3PL0A 3RYKA 5CFDC 5JOWA 1OPOA 3SXWA 1D4M2 1F9KA 5FXXA 2H0BA 4GB32 2R073 3UJQA 1V6OA 1CGPA 2JDHA 1JYNA 4AI1A 2P37A 2EIEA 1POV3 3QH7A 1RHI2 4YZ2A 4CP9A 1NX9A 4YGCA 1AR92 2VTFA 3AYAA 3ZR5A 3CHXA 3HVDA 1XYPA 2DDUA 1VMFA 2WO3A 4NROA 5C4WA 4E2GA 3VZMA 1NCRB 1OUXA 4W65A 3ZFFA 2QQJA 3VBHC 1NE6A 1QJFA 4FPGA 3KVAA 5FWJA 5I0SA 5IATA 4EN8B 4BPZA 3DEMA 2EIBA 2R071 4B3NA 2VBDA 1GFF2 4CCLA 4CEWB 5IAVA 5I8TA 4PF1A 3BTZA 4EWEA 1POV1 1LJ7A 1RL3A 1S0BA 2K0GA 3PUQA 4Q0QA 3JCIA 1RIRA 4ZXKA 4BLJA 5JPNB 1OPMA 4BQ4A 4GALA 4PBPA 2VOKA 4QDSA 2AREA 2PA7A 4MADA 2ZABA 3KB5A 1ZZ6A 1QJEA 4LBJA 2Z2SB 1VBA3 3UGHA 4LULA 2XG3A 2FMYA 4I30A 1FMD3 5EFUA 3VL8A 1OKQA 1M4WA 2E53A 1HB1A 5BNNB 4JV4A 3A4UA 2C26A 5FZ6A 5FZ8A 1DGRN 4CU9A 2E6VA 3HJRA 1WLCA 4W6XA 2IVIB 4QMAA 3Q8FA 1DBNA 2Z5WA 4K1YA 4IUGA 5CU1A 3VBFC 4EE2A 1CIWA 5FP8A 2F4PA 3BKZA 1PO23 2ARCA 2QDRA 4B4RA 4Q1PA 4AVCA 4BH9A 1JU3A 2WNVA 2W0XA 1S1AA 1VR3A 3PIGA 4M3CE 3TNPB 4IEZA 1GZWA 1VBA1 2TUNA 3DXUA 3B7MA 4BQ5A 4C8DA 1ND2A 1JYWA 1FMD1 1VMHA 4CDQA 5K4LA 1OF4A 4AFAA 2CHHA 1TG7A 1BVP1 3ACIA 3JB8A 4RR3C 4CU7A 4Y5Z0 1ZBE3 4QU1A 1YI7A 5IUQA 4NIDA 4XUTA 2C24A 3RRDA 4LJHA 2Z69A 5T52A 4O61A 4LORA 2V5YA 1VAMA 2RMU2 1RMU2 4KNCA 1PO21 3ME2A 1V00A 5FPZA 1LTEA 4TTGA 2FZ1A 2JDPA 4XPVA 2XB6C 2BBVA 1LOFC 3RZKA 3WNNA 4GAZA 1YFUA 2VOXA 2R1DA 2VMIA 4RQPB 4RGGA 4ATEA 5F7UA 1V6JA 4H7LA 4AVAA 4HZFA 2E33A 3PUSA 1ZBE1 4QXCA 2VECA 5ACA3 1W8NA 2ARAA 3A0KA 2RVAA 1AYM3 3N9MA 1QOTA 3HAGA 4HMZA 5D8AB 5HCFA 4I0AA 3ZFEC 3KF3A 2BUKA 5DXDA 2ZGOA 4MXWB 4ZKTB 5L9BA 2H6BA 1BKZA 3FLPA 2ERFA 3W59A 4MGIE 2BU9A 1W3VA 3TN93 3O1RA 5FY0A 5FBJA 1PVC1 1QXJA 4I3GA 5H9PA 2MPFA 2HWB3 4NUBA 1W6QA 3H7YA 5F3GA 1SDDB 2JKXA 2P3JA 1Z0HA 4PIXA 1WUVA 4F8AA 2NN8A 2V73A 5FY4A 5ACA1 5JXHA 1J1TA 2VNRA 5JSRA 1AYM1 5FPLA 4RS5B 2E9QA 4N7UA 5JMOA 1FXZA 2WBKA 3H9AA 3I2HA 1DZRA 3PUIA 4QXKA 5KHHA 1QQP3 2PHLA 3ZXEA 5FCCA 5A1AA 5IK8A 1PVXA 2RHPA 3AKQA 4XFFA 3TN91 1X9PA 4WZFA 5FKCA 4HT1T 4LE4A 1LHNA 2W92A 4MYEA 1OQEA 3K3OA 1REDA 2HWB1 3SC7X 3T1LA 2R042 4GWMA 2HEYF 1GOFA 5C70A 5C3QA 3LZZA 3RPQA 4COVA 4QM8A 5FY9A 1YJLA 1BHGA 2W68A 3R6SA 2WNUC 4YWAA 3V0AA 1QQP1 1FOD3 5CB7A 4XYXA 2WDBA 1H8VA 1R093 4IERA 3HT2A 4BMBA 4AQTA 2RS53 3J4UH 4GIQA 1FI2A 2OVUA 2ORXA 1JZ4A 3N35A 1K5MB 4LEJA 4PBOA 4AFBA 2W87A 2BNOA 5IVVA 1APNA 2WKKA 5EHDA 3RZGA 2JG8B 1YQ8A 2ZHKA 4YM3A 1YI9A 2XBO2 2B4KA 1S0EA 4MZUA 1COV3 5DAWA 3WDVA 2GC3A 1FOD1 2RM23 3NAPC 3VBOA 1R091 2C9AA 3FMGA 2RS51 3RDIA 2WZPP 1VALA 3E5UA 4CDXA 1XSRA 2XJPA 3NNMA 4X8PA 4XCAA 3QBQA 2B8MA 3O1VA 3I3MA 5LRRA 3OBRA 4CDUC 1VRH2 3ZYBA 1UWWA 2VMEA 5C71A 2DUOA 1A6CA 3GHMA 1BEV2 2XKPA 3V0BB 1COV1 3VKMA 1PGL2 3MF6A 1KEXA 2RM21 5FQ0A 4QX8A 3SQOA 5L7OA 4JGZC 3AZYA 4I02A 5KR7A 2BNMA 4AEKA 3D5OA 3RWKX 2WSUA 4IV1B 4CCMA 1E5SA 1W6MB 2IXLA 3AFKA 3UV9A 4RHV3 1YJKA 1AJKA 2AYHA 1N1YA 1DYKA 4Y1ZA 2JJ6A 3ZFGA 2WQ8A 4QB2A 4AR2A 1ULCA 2EA7A 4ISQA 1J83A 3LA3A 2K9ZA 3OEAA 5GZDA 4OHXA 1Q8OA 1G8WA 3FC0A 4ZY9A 4Y4YA 4QB1A 2EXJA 2XH6A 1H1AA 1RUNA 3R4DB 4YVSB 5HBAA 2ZA9A 3THTA 4E4DX 5BNOB 2WT2A 1E5HA 2XQRA 3ES4A 4IEYA 4QB6A 4CUBA 5GLUA 5C9AA 4RHV1 3LA7A 4AHWA 1N3OA 3U10A 3VB9A 4KWJA 2D6NA 3OUHA 4O65A 2AR6A 1PK6C 1EPZA 4XHBA 4NOTA 1VBE3 2FDHA 2Z4FA 2YGLA 5DABA 1ZBA3 1N1VA 3KMHA 3OPWA 3VV1A 5LA9A 4YM1A 4FOYA 2VR4A 3WG2A 2DTWA 1XYOA 3BYWA 4TN7A 3T2QA 2IUWA 3PJQA 3MICA 4YZ1A 1SBDA 1XNTA 4IQPA 1B35C 5FLHA 3T3YA 3KQ4B 2JG9B 3M2MA 2QQWA 3WDUA 4BWOA 3RMXA 3I2FA 3BIEA 1BK0A 4JDOA 3WEZA 1HKDA 2GP5A 3WQ0A 4C1WA 1TME2 1VBE1 4PLMA 3GCWA 4QX1A 2JKBA 2ZCWA 4UF0B 1ZBA1 4DFSA 4MGTA 3RVHA 1RUC2 4JGYB 4QPGC 2IVJA 1AF9A 1UYXA 3AMHA 2VXJA 4QPIA 3T0AA 3WD5A 4YW5A 3I2OA 1KS5A 3H8XA 1Q8PA 1AR63 3N9LA 1XNDA 4HONA 3KQRA 1ZZCA 4QQ2A 4XURA 3TNQA 1SCRA 4MGSA 4N43B 3A21A 4QXBA 3SCGA 3WV6A 2W52A 4AG4A 1NOVA 1SFYA 3UT0A 3ACFA 5IK4A 2XKOA 3AZWA 2AUYA 4HN1A 3WX5A 1W9YA 3BALA 2YU1A 1CESA 1NY72 1H8TA 2JXAA 1W9SA 1RUE2 2OX0A 1T6GC 2P3YA 4UW3A 4P9LA 4EN7B 1ND3C 1QNYA 4EWDA 3WNXA 1AR61 3ZN5A 5C3RA 3DPRC 4CEYC 1O59A 2WO2A 1OD3A 4FOQA 5JCTA 3IDCB 2BPA2 1BBT3 2QZ2A 1PGW2 1F5FA 2VZUA 3ACLA 5FZGA 1Z7S3 3ITQA 2ARXA 3N36A 1OLQA 1GSLA 1UAIA 4PLNA 4KU8A 3FLTA 5C3PA 1JS9A 1MPXA 4WM8A 1JN2P 4CP0A 4CU8A 3N7MA 2CYFA 4UOJA 4XETA 4P5YA 5KC6A 1XE8A 1CX4A 1FT9A 1W6OA 1ZA4A 5ABJA 2FDFA 3CIHA 5GJ6A 5FYUA 4JC1A 4XUQA 1BBT1 4NVPA 3ORJA 3C7FA 3J8F1 1Z7S1 3ZKUA 4YGEA 1ULOA 3JU9A 5JDBA 5HXMA 2WINB 2CAUA 3W5NA 3O0WA 3ZXJA 1UY4A 3WNMA 2HWF2 1W8WA 3PTYA 4ARXA 3GZAA 2W46A 4OMDA 2ZZJA 1RITA 3TAYA 2XR4A 1C8M3 5BYNA 1Q3EA 3IPVA 2VD7A 3NO8A 1RUI2 4BQXA 3CF6E 1FV3A 2G19A 2DUQA 4V2VA 4DUXA 3Q8CA 4ZPIA 1NCRC 5FZLA 3MO4A 3RZLA 1DG6A 4UXAA 3ZPOA 5JI7A 3EJKA 2RJLA 2GNDA 1U5YA 1XPWA 2Z79A 4NAOA 5LZ6A 1UYZA 4LKEA 4NAMA 5DZFA 1OHFA 2WS92 1J3QA 1AR73 4K21A 4S2GA 4CEWC 5CG9A 1C8M1 3LIGA 3OD4A 3WNLA 1Q5OA 4NIAA 4OZXA 3VBFA 1I6XA 1JU4A 2VVDA 3NRUA 1QJZA 2O0OA 1H30A 4P9YA 1H2NA 4LOTA 2OA2A 4K7JA 2R0FA 4IV3B 3VD9A 5EQUA 1AYN3 2RR13 4XHXA 4YZ5A 5A6XA 1JZ3A 1SLCA 2JECA 2OZJA 1MS3A 5JXGA 1OH3A 2I74A 2ZEXA 1UX7A 4A42A 1AR71 1XJAA 3GZUC 5F3EA 2VAUA 5FUNA 3PVOA 1LODA 1H6YA 5EP9A 3B01A 1DGRA 3VDAA 1NXMA 3AX4A 2C1FA 4HKWA 4ZU7A 4LHKA 3OGSA 1UY1A 5JAXA 1LOFA 2VZPA 5FY8A 1AYN1 1H9PA 2RR11 2AENA 2XJVA 2JENA 2HWE2 3JQXA 4AI2A 1ZRCA 1ASJ2 2VUAA 5DG2A 4MHRA 1C4RA 4CXWA 5AFBA 5L73A 4ZONA 5FZFA 3I59B 4YVWB 3THCA 1U0AA 2JIGA 3NV4A 3BGAA 2RS13 3CDZB 4LOSA 5CIRA 1TNFA 2WWSA 3MBWA 3ZFEA 3Q9OA 1PZ8A 4GH4C 5KXCA 5CFCB 1QY4A 3N9OA 4MSVA 5FY7A 3TWIA 3CBNA 2X05A 4RQPC 4XF3A 2FDGA 4TWTA 4AEDA 4M0NA 3MW4A 3ILFA 4BQ3A 1HRI2 1LB2A 1MS9A 1SLIA 2ETEA 1OOPA 1NZIA 2R0HA 3VHOA 2WABA 1LOCA 2YC2A 4WZCA 5FP9A 2ZKLA 3M4FA 2HWD3 2RS11 1S0IA 1ZYBA 5D8AC 1VPHA 1CPMA 2VBBA 3POWA 1C28A 5HCAA 2J1TA 4NJ4A 1PM7A 5FYCA 2D98A 2PXJA 1IS5A 1HB2A 1SG3A 5A7NA 2IXCA 2E51A 3VBUA 2PAKA 1ONAA 2XDVA 3JZVA 3W58A 1U12A 4OLLA 1JOJA 2E26A 2J22A 3H0OA 2P17A 1W03A 1JMUB 2HWD1 1SCSA 4LHLA 5JPMB 2UURA 2FHRA 3WF4A 4YPJA 1W0PA 2ZACA 4LUMA 1H2MA 1UY2A 4RS5C 1WBLA 1E5RA 5FP4A 1CWPA 2WNUA 3HMYA 1G86A 1PM4A 2B5HA 4H7MA 5DZEA 2VMGA 5FZBA 1GQHA 1JUIA 4MLOA 3B9CA 1TMF2 2ADDA 1N1SA 2JDKA 2HBTA 2WYFA 2KXLA 1IQAA 5JOYA 2E7QA 5ANNA 3IIAA 3RG0A 4LA3A 4JRLA 3LIHA 3NQHA 3LSEA 3WNKA 3K51A 4MOAA 1W8HA 2Y60A 4TYSA 2VBPA 4G4FA 3OY8A 1YNAA 5IVFA 4LO8A 4YFWA 1VB2A 2CTVA 2R062 1EAH2 2VCAA 4GULA 4OUSA 5GLVA 1F8VA 2XJRA 1VIWB 3UK9A 2XVKA 2IC1A 3TBDA 2ID4A 3ROUA 2VZSA 2EXKA 3KS7A 1TZOA 1ZA7A 1HW5A 2J1EA 1K5MC 1Y7BA 3OBTA 4MUVA 5FZ9A 2OPWA 4I2OA 3LDBA 2VW0A 2JG8C 4Q4V2 4UW6A 1C8NA 1GQPA 3MLJA 1AJOA 3ZX7A 2VUDA 4K40A 1CZSA 2XLFA 2Q30A 3N9PA 1D7PM 1RUH3 3ZYJB 5F6LB 3B69A 4NHLA 5IVCA 4AGGA 1ZZ7A 3A23A 2ZHLA 4LBQD 4H55A 4Q1RA 3TEXA 3VDDA 1NCQA 2W5FA 3B3QE 1X50A 2K2SA 3NAPB 3POEA 3JQWA 4XMIA 3INAA 5CYYA 1KDKA 2PAMA 1JYCA 4BK5A 4XTPA 5JUVA 1IS3A 1K5JA 1MQTA 2B9UA 5A7WA 4P14A 3D6EA 4M4RA 1YCIA 2QCSB 5FYZA 4DOUA 2R1BA 1OLRA 1RUH1 2VZOA 1XB9A 1YXWA 4JKKA 2QZ3A 5G04L 3RI8A 2PHDA 5FXVA 1O5UA 3OBZA 5A32A 4E2SA 3RGBA 1U5ZA 4UFHA 4IV1C 2GZWA 3F2ZA 4JGZB 2YBKA 4L8QA 3U75A 4CXYA 2A75A 5EZWA 3BVCA 5IYYA 3EMRA 3ZN6A 1H1IA 1S2EA 3U11A 1KFXL 4S2FA 5F3IA 1X8EA 2Q8OA 2P6CA 2Q1ZB 2ZGNA 1UIKA 3QH6A 4KG8A 4DRVA 1YFWA 4ES9A 4YVSC 1CQ9A 3IBMA 5BNOC 1JHNA 1LESA 3N7LA 2D93A 4EV0A 3QACA 3DYOA 1R083 3QD6A 4NHYA 4HK9A 3ZYHA 5FFOC 3GALA 1JODA 1TQ5A 2DCZA 3AL5A 4YZ4A 1X9TA 2DU0A 4YGDA 4BYYA 1ALYA 1VE0A 4L92A 1IS6A 3D8CA 5C8WA 2QTWB 1EYBA 4QPGA 1WCUA 3FLRA 1ZRIA 3T1MA 1YUDA 3UNPA 5KBFA 1LGCA 1V6KA 4ZXEA 1IHMA 4E8DA 4CCKA 5F32A 4BE3A 5FIXA 4KG0A 4N9HA 1A78A 1LHWA 1R081 1UW8A 2DF7A 1AX1A 4GJYA 4LIVA 5JOZA 2G9GA 4Y20B 3WW1A 4ATFA 2WZR3 2BOIA 4NRPA 5FV3A 2DV9A 1JTZX 1F31A 4J1WA 4WVVA 3D82A 1DYOA 1HQNA 1CVNA 4JGYC 1YQ2A 3W9AA 5A3UA 4MG2A 4O9EA 2IXIA 2WJSA 3CKHA 3DF0A 5L9RA 3HNYM 2W39A 3RZMA 1FNYA 1RUG3 1HJGA 2MEV3 4TLFA 1PO12 3UKNA 4CEYA 1IG3A 1FPN2 2KM2A 5F5IA 2Q8DA 4N43C 4Z82A 4E4HA 1J58A 4PCRA 5EV7A 4AFDA 2CV6A 4CDWB 3ZKYA 2KR2A 3VBRB 4Y1YA 1S0CA 3NW4A 2VW1A 1RGSA 3IAPA 1F5JA 2WZR1 3B93A 3NKGA 4Z07A 3ZYPA 5KHKA 2WC2A 2P3IA 1NLQA 3AVRA 4D3WA 1CONA 1QJU2 2C0ZA 5FMCA 1AHSA 3UETA 2VMHA 2UYAA 5FZIA 5K0UC 4I3PA 3T4VA 1US2A 2E63A 4M3CF 4Q4W3 3WNOA 5I8SA 1GOGA 2MEV1 1NQJA 3AZZA 2WR9A 4UW4A 4XF1A 5F9TA 1Z78A 4QXHA 2RDSA 2IZWA 4FQ4A 1IPSA 2JWPA 5FK8A 5EPAA 3LEMA 1SPPB 4S2HA 3U0ZA 1D4VB 2OT7A 4LMFA 2P2KA 5FY5A 5LA2A 1LOAA 1HLCA 4XXPA 5T5OA 4NO4A 3OD0A 1NQDA 2TNFA 3L9JT 3V65A 5CAZA 2DVFA 4QAWA 5LA0A 4Y26A 5DZGA 1I9RA 1VBD3 1V6LA 4GD4A 2QFEA 5FZ0A 2Q4SA 1DZQA 4DUWA 4FTBA 1YFYA 5FZDA 5FKBA 2ZGLA 1GV9A 3AMQA 3BTAA 3VBSC 3TOJA 3E97A 2PELA 5H9SA 4WVMB 4D69A 4P9GA 2GNTA 2WO1A 3O5SA 1WBFA 2ZMNA 3IT8A 4ZU4A 4QGNA 5FXZA 3U4SA 4V2WA 4UI9L 3IMNA 2R072 1ZX5A 4GWIA 4UBGA 4E4ZA 1VBD1 3ZXDA 1YO8A 2JE8A 2W2IA 1UZYA 1PNFA 3T2OA 4M4PA 1RXGA 3ZMNA 1EY2A 3WG4A 4R9BA 3GM8A 1IPJA 4Q5OA 1WZXA 4BZ4A 2ZKNA 4KGQA 4NWWA 1UXXX 2SLIA 5BNPA 5BNNA 2WAOA 2WN3A 3GZTB 3FZ3A 3VKOA 4LBKA 2MNGA 4FPOB 4BA6A 1JYIA 1O7FA 1LRHA 1YIPA 1U5XA 5DQ0A 1Y9MA 1K45A 2GALA 3ZXKA 3OUJA 4QPYA 4QQOA 1O8SA 3NNJA 4CUCA 3TB0A 2TBVA 3KT7A 4GB33 3ABZA 1K42A 4IV3C 4XAAA 4ZU5A 2OUJA 2R7EB 1UX6A 2WFF3 3BPSA 2DVDA 5T5LA 3ZM8A 2BFUS 5K9YA 1H4HA 3THPA 3FUQA 1VBA2 5IVYA 5JR7B 4QX3A 4NMIA 1FMD2 1ENSA 1Y4WA 2D6KA 5A6YA 3MHZA 2I2SA 2XL9A 2WZEA 4AWDA 3S5AA 5LBBA 1UPSA 5FZOB 4YGBA 4F7ZA 1GP4A 1DDLA 2X10A 1N3QA 2IFRA 1F2NA 3GXUA 3ZSLA 2FBEA 2NPIA 2ZZQA 3GJBA 4QQPA 4X6RB 5C5TA 5LA1A 1PO22 4AK3A 1JZ6A 3MIDA 4JVAA 2WFF1 4ISRA 2Y38A 4RQPA 4CCEA 1UZZA 1DYPA 3AP6A 1YHFA 2XXZA 4P9WA 4XJ8A 3K4AA 3WDWA 4GWJA 2MHFA 1IGOA 2PYTA 4YVWC 2X5IA 5FPVA 1S0DA 3V64A 3E5XA 3MIBA 4CP9B 4JTNA 1ZBE2 4DINB 1XOYA 2XVLA 3FL7A 1S2BA 4A4AA 2BGOA 2JIJA 3MFAA 5IFPA 1GMMA 1HXS3 2DVAA 4R52A 2IXKA 1AL0G 5CFCC 2BP6A 4FOWA 4LPLA 2XPJA 2W1QA 3LEGA 1QGLA 4P00B 4GH4B 4M3CA 1HDKA 5HPOA 4IE6A 1LHOA 2QQKA 3ZYRA 1EP0A 5FMOL 4XAEA 4DZGA 5JXIA 2FCVA 1E5IA 1PVC2 2RDQA 1LGBA 3M70A 2A7AA 5FO7B 4B1MA 2V09A 1Q56A 5LW9A 1W2UA 3MIHA 4AXOA 2XVGA 3CJXA 4LBNA 2EAKA 5ACA2 2ET1A 1DQ4A 1AYM2 3KWVA 1QXRA 3E6CC 5F5CA 4IE5A 4N9IA 5A7SA 4AOCA 2VH9A 3NV1A 3GZEA 4C90A 4XUNA 2VG9A 1W2OA 3KD4A 3LB9A 1SMVA 4FQZA 4OUEA 1OKOA 3MIEA 4LXLA 3ZSEA 1J3RA 1SBEA 1UOFA 3TN92 4W6WA 5L9VA 4BCUA 4H3WA 2HWB2 4D6RA 3AP5A 3VKFC 1FYUA 1GKBA 2O1QA 2WT0A 4MGYE 5KWRA 3C8XA 1QMJA 2FD8A 1Y43B 3SH5A 2E31A 1WW4A 2ZGUA 2LTNA 4LIUA 3ZO0B 4JCKA 1H2LA 1GR3A 3WUCA 4COUA 2XJUA 4OI4A 1QQP2 4QX7A 5C3OA 5FXWA 4KWUA 1FAYA 3IIIA 1PMIA 4HVQA 3UGFA 5A7PA 3WDXA 2AEZA 5A33B 1QXPA 4O7XA 5A1LA 1SBFA 2YROA 2JG8A 2A3XA 3VD5A 2VZ1A 4DNYA 4ZS2A 4RFRB 5FJKA 1X8MA 2HJIA 3HWJA 4DUVA 2O8OA 2Y6KA 3PUAA 3KVBA 4AGVA 1H9WA 1FOD2 4AEJA 2ZX3A 3ZIXA 1OBNA 4AI0A 3S6PA 4OQ8A 1R092 3WINE 1A8MA 1JOPA 2QDNA 2RS52 4HETA 4LK7A 4RA0A 3RI9A 3UJOA 1LHVA 5JIUA 1GZCA 4I0BA 2A3YA 2C6SA 3WCRA 4JDNA 2A5ZA 4AFMA 5SV8A 1UKRA 2GMPA 3AMNA 4QD2A 4I0WB 5A3WA 4XVHA 3V0BA 5FPXA 4N8MA 3WW4A 1RJ7A 2VNOA 2BGPA 4DY5A 4E2QA 3K48A 3I2DA 1CAXA 1COV2 3V56A 5LY2A 2DWRA 2RM22 2DCYA 4Q0VA 1GWKA 1ZZ8A 4IESA 2D40A 1GNZA 5F39A 3TEZA 2VW2A 1NE4A 2B45X 5FZHA 1ACCA 1O6UA 3HQRA 4LKDA 3K4DA 4QPWA 4LE3A 1L7QA 5EJZB 4BDVB 5FYIA 4FCAA 1YIFA 4YVSA 5JR2A 5A7OA 2GMEA 4JKMA 3UESA 5JMCA 2WLQA 5A3TA 4YM2A 1VB4A 5DUXA 3U14A 1QOOA 3LWCA 2WZ8A 3ZLIA 2CY6A 3I7DA 3GBWA 5T5JA 3NJXA 4S2DA 4ASMB 2PFWA 4RHV2 3V0AB 1NKGA 4E27A 1VAVA 3AKSA 5LATA 1OLME 4Q0SA 3LQCA 4YM0A 2Y6GA 5E88A 4AF9A 4XBQA 2BOJA 1GNHA 2A3WA 2ZGPA 3I4IA 4CA9A 1FX5A 2O8QA 2YC4A 3MW2A 4N90A 2JG9A 1ZNPA 3PNAA 4BQ2A 5CKQA 1HRV3 1V70A 1X36A 2D7FA 2VY0A 5SV5A 2WNOA 2ZX1A 1OQDA 4N53C 4UF0A 3SMHA 3POFA 3PMEA 2ZGQA 2V72A 1VBE2 2AGSA 4JGYA 5FMOS 4HXCA 1WW6A 4OMCA 4YW3A 1ZBA2 3K2OA 4FXKB 5A6QA 4XDPA 1W2NA 5JOXA 4PF5A 4QX5A 2VCBA 3FBYA 4A6SA 4P08A 4FTEA 1H6XA 3LSDA 3MV01 4JAAA 5IT6A 4XUOA 1VMJA 5E16A 3T2PA 2J1AA 2VUJA 4Y3OA 3UKVA 4BHPA 2ZAHA 2XQXA 4O9GA 4C0HA 5JZGC 1HRV1 5H9RA 5A3MA 2XJSA 2VVFA 1KXGA 3ECQA 4XFCA 1OD5A 1VBC3 5L7OB 1XRUA 1MS0A 3GCXA 4XFBA 5JLVA 1C1FA 1WA6X 2OPKA 2RS33 3F95A 4NHKA 3SEEA 1GZTA 4HK8A 5LK7B 3KCCA 3SKJE 5FYYA 4CDWC 1AR62 2BV4A 2W1WA 3OUIA 4Q0UA 4NIGA 3NKTA 3VBRC 3WW3A 5LBCA 3MV11 3ZOIA 1UZWA 4R8HA 5T5PA 1WMEA 2JB4A 2VOVA 2H0VA 5FPBA 3RJ2X 4FXGB 2IFWA 2DYCA 1VBC1 4XQ4A 4Y22B 4ONUA 2ZEYA 2WIIB 3Q8BA 2IWGB 3ZYIB 5I0RA 1QDCA 3USUB 2CWSA 1QJX3 1URXA 2D6OX 2RS31 5C9AB 4LBOA 2ARBA 1TME3 5FP7A 1Q8SA 5K0UB 2CDOA 3MFCA 3KGLA 4OI2A 5LASA 4K20A 1PIV3 3P1IA 1UQXA 1BBT2 2A73B 2BBAA 4HANA 4HPKB 4XJ9A 4AHYA 2QUOA 2EALA 1STMA 3J8F2 1Z7S2 2XLAA 2FDIA 3AJZA 3N4MA 3KT4A 1NZCA 1J3PA 5CFDA 1JHJA 4E9KA 4EN9B 1QJX1 4IEQA 5A1FA 3E6DA 1QEXA 4OCTA 2A6VA 1IKPA 3LFIA 4BJ0A 3VD4A 4Q0PA 1UL9A 3PLQA 1PIV1 3QCWA 2HBUA 1UU4A 3I2JA 2PHRA 5AC93 2ZGMA 1JI6A 4QHBA 1XSQA 4HN0A 4NPRA 4FPFA 4KH9A 3ATGA 4XJAA 4B8EA 3O14A 5GM0A 3VBHA 3VBSB 3A0NA 3AK0A 1W39A 3M3CA 1X82A 5FUPA 2FDKA 4UYBA 3ZSMA 2UYBA 3WHUA 1NG0A 3CJIB 1EUTA 1RUD3 1C8M2 2QBXA 4FPEA 1OT5A 3MW3A 4XQDA 5LBEA 5E89A 5A80A 3P3PA 4FBFA 3HEIA 4B29A 2H6CA 5AC91 2VQ0A 3LFMA 4IV3A 2A70A 5FZEA 4JTOA 3FBMA 2QQPA 4Q26A 3WUDA 5IK7A 3C7HA 3NNFA 4CCJA 1XE7A 4BISA 4FAGA 4CSWA 1VBB3 3QOPA 4A7KA 3ZXAC 5CEHA 3C7EA 1KS4A 3O12A 2XHNA 3N9QA 3S0MA 1W6PA 5DPNA 1AR72 1RUD1 3RZHA 2ADEA 2AEYA 4BIOA 1DZTA 2HYKA 4LA2A 1QH7A 4E8CA 4AVBA 5I8YA 3GBGA 1W2TA 3IZOA 1YQCA 5C8CC 1DF0A 2B42B 2DCKA 1CPNA 2VXRA 3AP9A 4FPYA 4LO7A 4WM8B 5T50A 1O91A 1JBCA 3WXPA 1QJY3 3H8RA 4EYUA 1AYN2 2RR12 4HLTA 1OA3A 2LALA 3AFGA 1VBB1 2VOTA 4MGZE 1HV0A 4CXXA 1MS4A 1S0FA 2PTMA 2IXJA 2ZX4A 3I59A 3PDQA 3PU3A 2DURA 4XABA 3TYJA 2YV8A 3OSDA 4QKFA 4XJWA 1JH5A 2PHXA 3OGVA 4RR3A 4D7TA 4DPNA 4OI0A 3HR9A 4URTA 2IXHA 4Q4Y3 1KITA 1JZ7A 4PIZA 4K6BA 4OUMA 3LPGA 2J1RA 4AAXA 1QH6A 4QDQA 2WUHA 2XJTA 3DXTA 4FFIA 1QJY1 4R9AA 2YG0A 2F17A 4UWDA 1CJPA 2DFCA 1GNYA 3ES1A 5FPUA 5FBZA 5I93A 1OURA 4XFAA 5FYTA 4R4XA 5CBLA 1EV13 4JQTA 3M3EA 5G05L 4EN0A 2Y6HA 3KCXA 2OS2A 1DQ5A 3D0SA 3PVNA 3ZFFC 4YARA 2RS12 2VGDA 5CVRA 2ZPXA 4Q4Y1 4R9DA 5FR3A 1R64A 4Y1VA 3GF6A 2DBNA 1PZ9A 2D3RA 1BQPA 1S0JA 1S0GA 3BIWE 3J7HA 4AI3A 3T0DA 4UBHA 1TE1B 1GWLA 5I0UA 5FJHA 2WA3A 1EV11 4XZPA 4CPBA 4LKSA 3HQXA 4Q8KA 3DKWA 2AH2A 1CZTA 2D6LX 3ZYGA 5BPXA 1POQA 5F3CA 2VO5A 2ZX2A 3H1MA 4MH0E 1O4YA 2FCTA 2HWD2 2HWE3 2JE7A 4RFT0 5DAXA 2D43A 5DUUA 5J7MA 5F1RA 4QWNA 1YEWA 1XYNA 2WRAA 4J25A 2A6XA 2ATFA 2SBAA 5ERLA 3RMYA 4QU2A 3WCSA 4HOOA 2GU9A 3DECA 2RV9A 3Q8AA 2WO7A 1GICA 2ZXQA 4Y4RA 3PTRB 1LOEA 4UFLA 4CUGA 4ES8A 4FFHA 1DLLA 1TNRA 3LA2A 4XJUA 1TEIA 2UU8A 5EYYA 2W1SA 4TXWA 4XE9A 1REFA 1XNKA 4RGKA 2WNVC 1AZDA 3WG1A 4NIHA 3SLIA 4EROA 4ZZ5A 4J6GA 4Y5TA 1RB8G 2XUMA 3M3OA 1XXNA 3UYJA 4Y1XA 1LOBA 5GLTA 1ND2C 3CMGA 3O0XA 2YPDA 1CAVB 1R1A3 1SDWA 5IHRA 4B7KA 3NNLA 2UWAA 2PN5A 3AL6A 1UOBA 1L7LA 2DCTA 2G9FA 5JSOA 1MEC3 3ASIA 4HVOA 3ON7A 4IDZA 4MO3M 3Q8EA 1LHUA 3G6JB 3VD3A 1JYXA 2AC1A 5A3LA 1JZ2A 3O1PA 4YW7A 4X6QB 3AZXA 2XOMA 4Q27A 1BMV1 5F5QA 1ZM1A 1AR83 1PMHX 2L9LA 3BOWA 1W05A 2WFPA 4FFGA 2WA4A 2JDAA 3E6BA 3HPNA 3MPBA 4QGMA 4QM9A 2ZTNA 5FYMA 4YRDA 3GHNA 2RDRA 4AEDB 2QNKA 2JDZA 3RQ0A 1R1A1 4GKXA 1PNGA 1OOPB 3HBZA 1MZEA 2BZDA 2PHUA 1MEC1 1DQ0A 2D44A 4ZZ8A 5F37A 1SLLA 3NAPA 5FZMA 1YFXA 2YFUA 5IW0A 1WWYA 3H8UA 2D3PA 4FPJA 2D6PA 3I2GA 3WHTA 1JOBA 3WLUA 2PHTA 4CCDA 1AR81 4FTSA 2Z42A 1Q8QA 3OEBA 1MR5A 3OOXA 4IE7A 5FYHA 1IQDC 1KGYA 3RFRA 3VBUB 2VTXA 4CDUA 1ENRA 3VHRA 5FWEA 5A70A 4XQWA 1HX6A 2NYYA 4L99A 4RD7A 2O14A 4R9CA 1D0HA 1A3KA 1RUH2 5FLJA 3VZNA 1DHKB 3O0VA 3I3BA 4AVTA 4XBNA 2A6ZA 3D0JA 1UPIA 3WT3A 1UZVA 4IGOA 2LRPA 4JGZA 1QWRA 4IEOA 3H3LA 2W1UA 1W6NA 1OVSA 2G1MA 2YY1A 3JBG3 2GC0A 4OYUA 4OHZA 4AFCA 4RN5A 3OGGA 5BY5A 4YG6A 3OG2A 4D6SA 2DFBA 2HWC3 4XTMA 1RUJ3 1DGWX 5FZKA 2EICA 1MVEA 3M1HA 5CNAA 3WP6A 4CUAA 1SFNA 4LT5A 1X7NA 2R49A 4B4QA 4C1XA 3KM5A 5GLWA 5ISLA 3HT1A 3A22A 3NJZA 3EYPA 3PUHA 4M01A 4Z1VA 1RVF3 2BGCA 2X29A 3R0RA 3KSCA 1C3HA 1SQ4A 3JBG1 1HB4A 3OY8B 4D0QA 1SFPA 2JEMA 4XBLA 1OQ1A 4NIIA 3NSTA 2HWC1 1RUJ1 2YU2A 1PK6A 4L9BA 1V9U3 2AACA 1WGPA 1UF2C 5JXJA 2EXHA 5GKAC 1G7YA 5J37A 2RJKA 5ANQA 1OA2A 2DVGA 2BDRA 4Q4X3 1RVF1 5CG8A 1C1LA 5LK5A 4CYDA 1B35A 2J1VA 1R082 4PQQA 2PAEA 2BERA 4IEWA 3SEPA 1W28A 3BUCA 3R05A 4LBQB 3SH4A 2PLV3 3K75B 2B9VA 3MPPG 3VBOC 3K46A 3I8TA 2J1SA 4CP1A 3D4KA 3T09A 1V9U1 2DU1A 3J7NA 2R6QA 1AL23 4FT8A 4N53B 1NCQB 1HQLA 2QQOA 4W6YA 3VDDB 1XU1A 4JDMA 1SLBA 4CDXC 2GNMA 1W0OA 2VE1A 4IGPA 2B39A 2HYXA 4H14A 1C57A 2CAVA 4K8RB 1VLNA 2YDEA 4Q4X1 5C33A 3VBRA 1CAUA 5F6KA 3CNAA 3DKQA 2F4LA 4HSLA 4MGQA 5KC5A 5E1RA 2PLV1 2KA3A 5JZGB 3JB4C 3IMMA 2CL2A 2WZR2 5L7OC 2D5HA 1JYVA 2CGNA 2Q8EA 3WY6A 2X8KA 1AL21 1W90A 1CJDA 1BXHA 3CO2A 1SZBA 4A3ZA 5JIAA 3OYWA 3ZMOA 3OCPA 5DDJ3 5FUIA 3APBA 2VCMA 3NJYA 3ZN6B 4MHUA 5JSPA 3NMBA 2MEV2 2VQUA 2XHKA 1ND3A 4BQWA 4D8MA 3O1OA 5IWFA 4WV8A 2GMMA 4WM7B 3UKTA 3DPRA 3RYRA 2VZTA 1V6MA 4RGAA 4OULA 1ENQA 1OI6A 3JD73 4COZA 3IN9A 1GOHA 2K46A 2D97A 5CZKA 4BXSV 3SITA 2R16A 5C6CA 1HV1A 1OUSA 4WVWA 5C9AC 1NA1B 1SLAA 2WQZC 4LUKA 4JRAA 3OGJA 4A41A 3KHBA 1JYTA 3SCFA 2QQLA 5DN2A 4CVUA 5EJ3A 1ZZBA 4Z2WA 1RUG1 4LLOA 4LO6B 1C5IA 1WCSA 4XILA 5LB6A 4AZZA 4R4ZA 1NXD1 1IZ3A 3JD71 3AVSA 3B00A 1F4AA 4XFGA 4WVMA 1Y9QA 4LBLA 2Y64A 4L0PA 5HV4A 1CD3G 4E4SA 1LNSA 5H9QA 3WQ7A 1CZVA 4L11A 4GQ7A 5KXEA 2ZHNA 5T3NA 4UFJA 4Q4W1 3ZSJA 4YFZA 1HN1A 4KBZA 1VBD2 2JDNA 1MZFA 5GZCA 4DXZA 2ZGTA 5GZFA 2OXBA 4X8NA 1TVGA 4QPIC 4XDQA 5IVJA 4FOVA 1UN1A 3POYA 1NCRA 1WW7A 2XWBB 5D1IA 2ZHMA 3CL1A 1BK1A 3GJAA 4AQ2A 4DY3A 5M0TA 1UO9A 5CISA 1R1ZA 4LHNA 5FOBB 3CZUA 4HG6B 3CJIC 2JDUA 4GA9A 1US3A 4XCBA 4CEWA 1OFSA 1DP0A 3AKPA 3QLQA 4AYUA 4D7YA 2P3KA 2A6YA 1DFQA 1T2XA 3S30A 4L2NA 4Y1UA 2WAAA 1SEFA 5J09A 1PZ7A 2NM1A 2JDMA 5F2WA 5FZ4A 1GBGA 3MGUA 3LEIA 5FLIA 5B2GB 3VLBB 2YXSA 2P34A 1O3RA 2VL4A 1QIQA 4W50A 1S2KA 2OQ6A 1RUF3 4PDWB 1LEDA 5FZOA 4G9SB 1D2SA 3KV4A 5A3OA 3LGRA 1DGLA 1WCDJ 1WKYA 2BNNA 4WM8C 3O1TA 2F6BA 1F4HA 1D4M3 3DL3A 1WLTA 3KGZA 2YB7A 2WN2A 2E32A 2UY8A 5ABJC 1AVBA 2WFF2 5C8CB 4Y5SA 1UXZA 4P9XA 5B4XA 3RZZA 3EHKA 3SNMA 5GALA 1UY0A 1RHI3 1RUF1 4PQ9A
chains in the Genus database with same CATH topology
3WNLA 1JU4A 1PMJX 2Y6JA 3NRUA 4DEQA 3NJXA 1NKGA 2RJ2A 5DMYA 3LQCA 3VD9A 2Y6GA 3FN9A 4W8JA 4OZOA 1JZ3A 5JXGA 2ZEXA 1UX7A 4A42A 3LEKA 2YC4A 3D3AA 1H6YA 1SHWB 3K4ZA 3C7OA 3VDAA 3OGSA 1UY1A 5I0DA 2V72A 2VZPA 3OB8A 4LHSA 2ZEWA 4OMCA 1OH4A 2VCBA 1JZ8A 4P08A 1H6XA 3MV01 3THCA 2Y6LA 4XUOA 2V5DA 3T2PA 2J1AA 3BGAA 3CDZB 2J7MA 2XQXA 3MBWA 3I2KA 3VDBA 1XC6A 3ECQA 3K77A 2X05A 1RYYA 3SEEA 4JKLA 2VMFA 2WABA 2YC2A 3SKJE 3ETPA 2W1WA 2PQSA 4QDRA 3T0BA 3MV11 2J1TA 3MUZ1 2CDPA 3SKVA 1PX3A 1SG3A 2ZEYA 1WCQA 4KMQA 2E26A 2J22A 2Y8KA 2CDOA 3WQBA 5J1XA 4A6OA 2VZRA 4QX0A 3WF4A 3P1IA 4YPJA 2OKXA 1CIYA 2W47A 1UY2A 2BBAA 1UMHA 2VM9A 3WF0A 2VCCA 5EIYB 3GGLA 3NNGA 4ET7A 3IDAA 1JHJA 4BK4A 1W99A 1DLCA 4FI9A 2W94A 3THDA 1UZ0A 4BJ0A 3VD4A 1EUUA 3NQHA 3WNKA 3OGRA 4MOAA 3I2JA 3HNMA 1JI6A 3DYPA 1UYYA 2VCAA 3GDBA 3WSOA 3CZJA 2X09A 2ID4A 2VZSA 4CU6A 2J1EA 2V4VA 3W5MA 1CX1A 1EUTA 3I3EA 2QBXA 1OT5A 3HEIA 1K12A 1GQPA 2W95A 3MUY1 1CZSA 1D7PM 3C7HA 3A23A 3LE0A 2W5FA 3OBAA 1JYNA 3C7EA 2XHNA 2EIEA 5DPNA 5CYYA 1NX9A 4BK5A 2VTFA 5JUVA 2DDUA 2WO3A 4E8CA 4M4RA 2DCKA 2QQJA 1NAEA 2VZOA 4JKKA 5G04L 2VOTA 2EIBA 2HLEA 2VMDA 4PF1A 3F2ZA 4DEVA 3OGVA 5IYYA 3VDCA 2VC9A 1JZ7A 2WYSA 3LPGA 2J1RA 4QDSA 4AAXA 4QDQA 4MADA 3IB3A 2WUHA 5IJRA 2YG0A 1GNYA 3ACGA 1GUIA 2C26A 5G05L 4CU9A 4W4ZA 2Y6HA 3DYOA 3HJRA 2ORZA 3AC0A 4IUGA 1JU3A 4DXTA 1R64A 2C9KA 3EB7A 3I97A 3T0DA 3J7HA 3C7GA 1JYWA 1OF4A 3UNPA 3WF3A 1TG7A 3ACIA 4ZXEA 4E8DA 4CU7A 4LKSA 4XUTA 1CZTA 3HNBM 1K3IA 2VO5A 1O8PA 4TTGA 4RYDA 1DYOA 3VD7A 3WNNA 1YQ2A 3DECA 2RV9A 3CKHA 4KI5M 2ZXQA 5F7UA 3HNYM 3T08A 2E33A 2W1SA 2W3JA 4TXWA 2QQMA 1W8NA 4DXSA 2RVAA 4ZZ5A 3IAPA 4GZ9A 4DXRA 3CMGA 5IHRA 3UETA 1OF3A 1US2A 4JHZA 4ARYA 3WNOA 4MO3M 1GOGA 1UMIA 1SDDB 2JKXA 3VD3A 3U37A 4P02B 1JYXA 1JZ2A 5JXHA 2XOMA 2KD7A 1PMHX 2L9LA 2JDAA 3HPNA 1JZ5A 5JMOA 1GU3A 2WBKA 3PUIA 3I2HA 2VJXA 5A1AA 3BN6A 2J1UA 5LA2A 2VMCA 2W92A 2BZDA 2VZQA 4ZZ8A 3HOBA 5EJ1B 2YFUA 3ZM8A 4QAWA 1GOFA 1NUKA 5C70A 5LA0A 3I2GA 4DUWA 1BHGA 3OEBA 1IQDC 1KGYA 3WF2A 4LQRA 2WDBA 3NJVA 2WO1A 2C4XA 1W0NA 3I3BA 4UI9L 2ORXA 1JZ4A 4PT6A 4GWIA 2W1UA 2W87A 4OYUA 5B4NA 4RN5A 2JE8A 3OG2A 3T2OA 4M4PA 2B4KA 3GM8A 2EICA 4CUAA 1UXXX 3LPFA 2WAOA 2WN3A 4UAPA 3A22A 3PUHA 3EYPA 5DQ0A 1K45A 4Z2AA 1O8SA 1UWWA 2VMEA 4D0QA 4CUCA 5C71A 3ABZA 1W8OA 1K42A 2R7EB 5JXJA 1KEXA 3WF1A 4QX3A 4JX0A 2QQIA 2W9XA 3ACHA 2WZEA 1L7RA 2J1VA 2X10A 4PQQA 3GXUA 2BERA 3IAQA 2WQ8A 4QB2A 3SEPA 4A45A 3K75B 1J83A 2B9VA 3OEAA 3HN3A 5LA1A 1XNAA 3K46A 2J1SA 1JZ6A 3T09A 4ZY9A 4QB1A 2QQOA 2VQTA 3K4AA 4GWJA 4QB6A 4CUBA 2HYXA 3FL7A 4A4AA 2BGOA 4MGQA 5IFPA 1GMMA 2ZEZA 2Z4FA 1JYVA 4LPLA 2W1QA 3LEGA 4P00B 5HPOA 3A7QA 2VR4A 2QQKA 2JD9A 3T2QA 3FHAA 4A3ZA 5JXIA 1XNTA 5FUIA 1ULPA 2VQUA 4D8MA 3I2FA 3WEZA 2VZTA 4QX1A 2YFZA 1GOHA 5C7GA 4XUNA 5CZKA 1UYXA 4BXSV 2DCJA 2QQNA 4OUEA 3T0AA 2VZVA 4A41A 4XURA 2QQLA 5DN2A 4MGSA 4CVUA 3A21A 2LW8A 3C8XA 2E31A 4AG4A 3ACFA 1W9WA 1F4AA 2Y64A 4L0PA 1W9SA 1LNSA 3JXSA 1CZVA 4KWUA 3IIIA 4XZUG 1O59A 2WO2A 1OD3A 4QX2A 1HN1A 2VZUA 1J84A 3VD5A 4A44A 2LS6A 2W91A 2VZ1A 1UY3A 1TVGA 3WNPA 4DUVA 2Y6KA 1MPXA 3I2IA 5IFTA 4CU8A 4UOJA 3CQOA 4P5YA 3CZUA 3FHQA 1W9TA 3CIHA 4HG6B 2EIDA 4XUQA 1US3A 1DP0A 3DYMA 3C7FA 3E1F1 1ULOA 1T2XA 4XUPA 2VZ3A 2WAAA 4XVHA 5HXMA 3W5NA 2BGPA 1UY4A 3WNMA 3LEIA 4ARXA 2W46A 4OMDA 2VL4A 4W50A 1WKYA 4DUXA 3P6BA 3K4DA 4QPWA 1L7QA 3MO4A 1F4HA 5EJZB 4BDVB 1I5PA 2YB7A 1PX4A 2WN2A 1P8JA 2E32A 5JR2A 1XPWA 4JKMA 3UESA 1UXZA 1UYZA 2XONA 3I3DA 5B4XA 1UY0A 5LCWL 2WZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNL A;  1JU4 A;  1PMJ X;  2Y6J A;  3NRU A;  4DEQ A;  3NJX A;  1NKG A;  2RJ2 A;  5DMY A;  3LQC A;  3VD9 A;  2Y6G A;  3FN9 A;  4W8J A;  4OZO A;  1JZ3 A;  5JXG A;  2ZEX A;  1UX7 A;  4A42 A;  3LEK A;  2YC4 A;  3D3A A;  1H6Y A;  1SHW B;  3K4Z A;  3C7O A;  3VDA A;  3OGS A;  1UY1 A;  5I0D A;  2V72 A;  2VZP A;  3OB8 A;  4LHS A;  2ZEW A;  4OMC A;  1OH4 A;  2VCB A;  1JZ8 A;  4P08 A;  1H6X A;  3MV0 1;  3THC A;  2Y6L A;  4XUO A;  2V5D A;  3T2P A;  2J1A A;  3BGA A;  3CDZ B;  2J7M A;  2XQX A;  3MBW A;  3I2K A;  3VDB A;  1XC6 A;  3ECQ A;  3K77 A;  2X05 A;  1RYY A;  3SEE A;  4JKL A;  2VMF A;  2WAB A;  2YC2 A;  3SKJ E;  3ETP A;  2W1W A;  2PQS A;  4QDR A;  3T0B A;  3MV1 1;  2J1T A;  3MUZ 1;  2CDP A;  3SKV A;  1PX3 A;  1SG3 A;  2ZEY A;  1WCQ A;  4KMQ A;  2E26 A;  2J22 A;  2Y8K A;  2CDO A;  3WQB A;  5J1X A;  4A6O A;  2VZR A;  4QX0 A;  3WF4 A;  3P1I A;  4YPJ A;  2OKX A;  1CIY A;  2W47 A;  1UY2 A;  2BBA A;  1UMH A;  2VM9 A;  3WF0 A;  2VCC A;  5EIY B;  3GGL A;  3NNG A;  4ET7 A;  3IDA A;  1JHJ A;  4BK4 A;  1W99 A;  1DLC A;  4FI9 A;  2W94 A;  3THD A;  1UZ0 A;  4BJ0 A;  3VD4 A;  1EUU A;  3NQH A;  3WNK A;  3OGR A;  4MOA A;  3I2J A;  3HNM A;  1JI6 A;  3DYP A;  1UYY A;  2VCA A;  3GDB A;  3WSO A;  3CZJ A;  2X09 A;  2ID4 A;  2VZS A;  4CU6 A;  2J1E A;  2V4V A;  3W5M A;  1CX1 A;  1EUT A;  3I3E A;  2QBX A;  1OT5 A;  3HEI A;  1K12 A;  1GQP A;  2W95 A;  3MUY 1;  1CZS A;  1D7P M;  3C7H A;  3A23 A;  3LE0 A;  2W5F A;  3OBA A;  1JYN A;  3C7E A;  2XHN A;  2EIE A;  5DPN A;  5CYY A;  1NX9 A;  4BK5 A;  2VTF A;  5JUV A;  2DDU A;  2WO3 A;  4E8C A;  4M4R A;  2DCK A;  2QQJ A;  1NAE A;  2VZO A;  4JKK A;  5G04 L;  2VOT A;  2EIB A;  2HLE A;  2VMD A;  4PF1 A;  3F2Z A;  4DEV A;  3OGV A;  5IYY A;  3VDC A;  2VC9 A;  1JZ7 A;  2WYS A;  3LPG A;  2J1R A;  4QDS A;  4AAX A;  4QDQ A;  4MAD A;  3IB3 A;  2WUH A;  5IJR A;  2YG0 A;  1GNY A;  3ACG A;  1GUI A;  2C26 A;  5G05 L;  4CU9 A;  4W4Z A;  2Y6H A;  3DYO A;  3HJR A;  2ORZ A;  3AC0 A;  4IUG A;  1JU3 A;  4DXT A;  1R64 A;  2C9K A;  3EB7 A;  3I97 A;  3T0D A;  3J7H A;  3C7G A;  1JYW A;  1OF4 A;  3UNP A;  3WF3 A;  1TG7 A;  3ACI A;  4ZXE A;  4E8D A;  4CU7 A;  4LKS A;  4XUT A;  1CZT A;  3HNB M;  1K3I A;  2VO5 A;  1O8P A;  4TTG A;  4RYD A;  1DYO A;  3VD7 A;  3WNN A;  1YQ2 A;  3DEC A;  2RV9 A;  3CKH A;  4KI5 M;  2ZXQ A;  5F7U A;  3HNY M;  3T08 A;  2E33 A;  2W1S A;  2W3J A;  4TXW A;  2QQM A;  1W8N A;  4DXS A;  2RVA A;  4ZZ5 A;  3IAP A;  4GZ9 A;  4DXR A;  3CMG A;  5IHR A;  3UET A;  1OF3 A;  1US2 A;  4JHZ A;  4ARY A;  3WNO A;  4MO3 M;  1GOG A;  1UMI A;  1SDD B;  2JKX A;  3VD3 A;  3U37 A;  4P02 B;  1JYX A;  1JZ2 A;  5JXH A;  2XOM A;  2KD7 A;  1PMH X;  2L9L A;  2JDA A;  3HPN A;  1JZ5 A;  5JMO A;  1GU3 A;  2WBK A;  3PUI A;  3I2H A;  2VJX A;  5A1A A;  3BN6 A;  2J1U A;  5LA2 A;  2VMC A;  2W92 A;  2BZD A;  2VZQ A;  4ZZ8 A;  3HOB A;  5EJ1 B;  2YFU A;  3ZM8 A;  4QAW A;  1GOF A;  1NUK A;  5C70 A;  5LA0 A;  3I2G A;  4DUW A;  1BHG A;  3OEB A;  1IQD C;  1KGY A;  3WF2 A;  4LQR A;  2WDB A;  3NJV A;  2WO1 A;  2C4X A;  1W0N A;  3I3B A;  4UI9 L;  2ORX A;  1JZ4 A;  4PT6 A;  4GWI A;  2W1U A;  2W87 A;  4OYU A;  5B4N A;  4RN5 A;  2JE8 A;  3OG2 A;  3T2O A;  4M4P A;  2B4K A;  3GM8 A;  2EIC A;  4CUA A;  1UXX X;  3LPF A;  2WAO A;  2WN3 A;  4UAP A;  3A22 A;  3PUH A;  3EYP A;  5DQ0 A;  1K45 A;  4Z2A A;  1O8S A;  1UWW A;  2VME A;  4D0Q A;  4CUC A;  5C71 A;  3ABZ A;  1W8O A;  1K42 A;  2R7E B;  5JXJ A;  1KEX A;  3WF1 A;  4QX3 A;  4JX0 A;  2QQI A;  2W9X A;  3ACH A;  2WZE A;  1L7R A;  2J1V A;  2X10 A;  4PQQ A;  3GXU A;  2BER A;  3IAQ A;  2WQ8 A;  4QB2 A;  3SEP A;  4A45 A;  3K75 B;  1J83 A;  2B9V A;  3OEA A;  3HN3 A;  5LA1 A;  1XNA A;  3K46 A;  2J1S A;  1JZ6 A;  3T09 A;  4ZY9 A;  4QB1 A;  2QQO A;  2VQT A;  3K4A A;  4GWJ A;  4QB6 A;  4CUB A;  2HYX A;  3FL7 A;  4A4A A;  2BGO A;  4MGQ A;  5IFP A;  1GMM A;  2ZEZ A;  2Z4F A;  1JYV A;  4LPL A;  2W1Q A;  3LEG A;  4P00 B;  5HPO A;  3A7Q A;  2VR4 A;  2QQK A;  2JD9 A;  3T2Q A;  3FHA A;  4A3Z A;  5JXI A;  1XNT A;  5FUI A;  1ULP A;  2VQU A;  4D8M A;  3I2F A;  3WEZ A;  2VZT A;  4QX1 A;  2YFZ A;  1GOH A;  5C7G A;  4XUN A;  5CZK A;  1UYX A;  4BXS V;  2DCJ A;  2QQN A;  4OUE A;  3T0A A;  2VZV A;  4A41 A;  4XUR A;  2QQL A;  5DN2 A;  4MGS A;  4CVU A;  3A21 A;  2LW8 A;  3C8X A;  2E31 A;  4AG4 A;  3ACF A;  1W9W A;  1F4A A;  2Y64 A;  4L0P A;  1W9S A;  1LNS A;  3JXS A;  1CZV A;  4KWU A;  3III A;  4XZU G;  1O59 A;  2WO2 A;  1OD3 A;  4QX2 A;  1HN1 A;  2VZU A;  1J84 A;  3VD5 A;  4A44 A;  2LS6 A;  2W91 A;  2VZ1 A;  1UY3 A;  1TVG A;  3WNP A;  4DUV A;  2Y6K A;  1MPX A;  3I2I A;  5IFT A;  4CU8 A;  4UOJ A;  3CQO A;  4P5Y A;  3CZU A;  3FHQ A;  1W9T A;  3CIH A;  4HG6 B;  2EID A;  4XUQ A;  1US3 A;  1DP0 A;  3DYM A;  3C7F A;  3E1F 1;  1ULO A;  1T2X A;  4XUP A;  2VZ3 A;  2WAA A;  4XVH A;  5HXM A;  3W5N A;  2BGP A;  1UY4 A;  3WNM A;  3LEI A;  4ARX A;  2W46 A;  4OMD A;  2VL4 A;  4W50 A;  1WKY A;  4DUX A;  3P6B A;  3K4D A;  4QPW A;  1L7Q A;  3MO4 A;  1F4H A;  5EJZ B;  4BDV B;  1I5P A;  2YB7 A;  1PX4 A;  2WN2 A;  1P8J A;  2E32 A;  5JR2 A;  1XPW A;  4JKM A;  3UES A;  1UXZ A;  1UYZ A;  2XON A;  3I3D A;  5B4X A;  1UY0 A;  5LCW L;  2WZ8 A; 
#chains in the Genus database with same CATH topology
 4EZ4 A;  1AR9 3;  1LU2 A;  1OA4 A;  3NV2 A;  4PIY A;  5A3N A;  1ZRE A;  1LAJ A;  2Y6J A;  4KQ7 A;  2R30 A;  5E6H A;  5GLZ A;  3LKJ A;  3MEP A;  2GH8 A;  1CAW B;  4H2A A;  1D4M 1;  4AVS A;  3T2T A;  1YWK A;  4GH4 A;  4GB3 1;  3O1S A;  4OZO A;  4MGK E;  4A2U A;  1NLR A;  2XML A;  1IG0 A;  2DUP A;  1CN1 A;  5BV6 A;  1RC6 A;  1RHI 1;  3R4S A;  1Q43 A;  3FUO A;  1AR9 1;  3D3A A;  4AEM A;  2G9Z A;  5FP3 A;  1YQ5 A;  4D94 A;  3AXE A;  1UNB A;  4QQH A;  5FPA A;  3LOI A;  1V6I A;  1GYK A;  4FPC A;  2PMW B;  5D8A A;  5C4W B;  5L36 A;  4TLG A;  3ZFF B;  4IE0 A;  1HXS 2;  4MXW A;  3W21 A;  5BNP B;  5LY1 A;  2EXI A;  3R4U A;  4WBB A;  3EO6 A;  1OH4 A;  1JZ8 A;  1LKN A;  5FDB A;  3KLS A;  1HB3 A;  3W20 A;  4U36 A;  2V5D A;  4SLI A;  1UCX A;  2HKX A;  4YW4 A;  2RG4 A;  4OI1 A;  4LNV A;  4IE4 A;  3VDB A;  3BU0 A;  2YGM A;  3VHP A;  5CAD A;  1GZ9 A;  2Y34 A;  3ZYF A;  1DQ1 A;  1XC6 A;  4LBM A;  4A7Z A;  3I49 A;  5LCW L;  3M3I A;  4RS5 A;  1UD1 A;  1O4Z A;  3PVB B;  3WZ1 A;  2V4A A;  1HXS 1;  1RYY A;  1RTV A;  2D6M A;  3G7D A;  1WA4 A;  3MYX A;  4FP3 A;  5D2A A;  4CCN A;  3POG A;  4DO0 A;  4DIQ A;  3H50 A;  3MIG A;  3UGG A;  5A33 A;  2RMU 3;  1RMU 3;  3ETP A;  4YG0 A;  2ZAA A;  4QDR A;  2XLG A;  2D5F A;  2PHW A;  1FNZ A;  3O7O A;  3OPZ A;  4XMA A;  2OYZ A;  3AZV A;  2PHF A;  3MUZ 1;  2CDP A;  1UOG A;  3FX3 A;  3HBK A;  2WNV B;  1PVC 3;  1PX3 A;  1O3Q A;  4FP2 A;  1GZW B;  4XF0 A;  2X5I B;  1ND2 B;  5CA6 A;  4CDQ B;  1AX2 A;  4QKB A;  1Y3T A;  1UU6 A;  3H3Z A;  1POV 0;  2Y8K A;  1X33 A;  4JQR A;  4Y24 A;  4Y33 A;  3BTY A;  3H3U A;  4FSJ A;  3ENR A;  2Y26 A;  3PUR A;  1GQG A;  2RMU 1;  2BRT A;  1RMU 1;  2VZR A;  4IEV A;  4NN0 A;  4QX0 A;  4CP2 A;  3LOB A;  2OKX A;  1CIY A;  1K5M A;  1N1T A;  2W47 A;  3B5L B;  1ULD A;  4M3C B;  1XBF A;  2VCC A;  4AED C;  4AHX A;  5I0T A;  1LCL A;  4BQY A;  3MIF A;  2XUE A;  1MS5 A;  3GGL A;  3NNG A;  3O1U A;  1VRB A;  4BB3 A;  1N47 A;  1OOP C;  5LEJ A;  1KDM A;  4BK4 A;  1W99 A;  3DUI A;  1OC1 A;  1DLC A;  4FI9 A;  3B94 A;  1Q8V A;  2W94 A;  1H4G A;  1W2A X;  4TSV A;  5JI9 A;  2NZ9 A;  3S57 A;  2E7T A;  3MLL A;  4IEX A;  4NWV A;  5HI0 A;  2JIC A;  5DG1 A;  1EUU A;  4MXV A;  1OSG A;  3I3Q A;  4Z8B A;  4BOW A;  1QKQ A;  3X29 B;  3OGR A;  5F5A A;  4HSJ A;  4AL9 A;  3HNM A;  1XNB A;  3VBU C;  5L19 A;  3MZH A;  4LO4 B;  1AXY A;  3DYP A;  2WLP A;  4IEP A;  4QKN A;  2VVE A;  1I5Z A;  3WP3 A;  4XFH A;  3U78 A;  3WSO A;  5DAV A;  4QQL A;  2R04 3;  1W8Z A;  2X09 A;  3VZJ A;  3CLP A;  4I01 A;  4CU6 A;  1KJL A;  1W6Q B;  2BJS A;  4P5H A;  5E8A A;  1CX1 A;  1DQ6 A;  3I3E A;  4P9J A;  4F83 A;  4YW2 A;  4DQA A;  2GN7 A;  3L2Y A;  1LOG A;  4IV1 A;  1W6M A;  2QE3 A;  5JWP A;  1K12 A;  2OII A;  2W95 A;  3KV5 A;  4NRQ A;  2XL7 A;  3U07 A;  2P4E A;  1B09 A;  5HV0 A;  2R04 1;  3MLK A;  3LE0 A;  1XQN A;  3OBA A;  2A6W A;  1QU0 A;  3DCQ A;  2YMZ A;  4ASL A;  5BNO A;  4NE9 A;  4D6Q A;  2FDJ A;  2CNA A;  5EYX A;  1S55 A;  4NR1 A;  1KD7 A;  4KL1 A;  2XBO 3;  4AI9 A;  3AP7 A;  3NV3 A;  1DIW A;  1LGN A;  4EJR A;  1LEM A;  3MF9 A;  1LR5 A;  1V6N A;  2BYV E;  4PI2 A;  1GP6 A;  4XIO A;  1NAE A;  1WCK A;  3T4H B;  4AQ6 A;  2ZS6 B;  1BLZ A;  2HLE A;  2VMD A;  4YSF A;  3RSJ A;  2UWB A;  2D3S A;  4HKL A;  1VRH 3;  1ZRR A;  4XF9 A;  2YZ4 A;  2JE9 A;  2BEO A;  5FTT C;  4K8F A;  1MS1 A;  1IOA A;  1XU2 A;  2BW8 A;  2XBO 1;  1BEV 3;  3VDC A;  2VC9 A;  2JDY A;  3S5Q A;  5FMD A;  5JVV A;  1HRV 2;  2WYS A;  1CAX B;  2TEP A;  1OLM A;  1U5I A;  4CCC A;  3IB3 A;  5IJR A;  5KHI A;  3VDD C;  1NCQ C;  4A7Y A;  4IGQ A;  4DRR A;  3VBO B;  3ACG A;  4XEZ A;  3J9S A;  1ENX A;  1GUI A;  1ULF A;  5A7Q A;  4BU2 A;  4XIK A;  5LRS A;  4MVT A;  3SIS A;  5IAX A;  4W4Z A;  4CDX B;  1MQT C;  4HFS A;  1VRH 1;  1KRI A;  4DMI A;  2ORZ A;  1MS8 A;  3AC0 A;  5FK7 A;  3J7L A;  3KF5 A;  1AXK A;  1MZ5 A;  3BOP A;  5CKM A;  5KHJ A;  3H8O A;  1BEV 1;  4N43 A;  3HQU A;  4GXL A;  3DV8 A;  1F35 A;  5APA A;  5IVE A;  2EIG A;  4DXT A;  1PGL 1;  1SAC A;  3POB A;  2C9K A;  3KT1 A;  1ULE A;  4Y22 A;  3BPZ A;  3EB7 A;  2CGP A;  4GMP 3;  2P1B A;  3I97 A;  2ILM A;  1OVP A;  3USU A;  1VBC 2;  3C7G A;  1AX0 A;  2G4I A;  5FQ0 B;  2WNE A;  1HJF A;  1UKG A;  2GP3 A;  3WF3 A;  2ZX0 A;  1G9D A;  3TEY A;  4QKD A;  2Q0A A;  5K0U A;  1WD4 A;  2RS3 2;  3M7A A;  4PJY A;  4KU7 A;  1A8D A;  1WW5 A;  3HNB M;  4WM7 C;  3KHC A;  1K3I A;  1O8P A;  4HPK A;  3GYD A;  5F2S A;  3ZFG B;  4RYD A;  5IK5 A;  4G3Y C;  5A3P A;  4C0B A;  3PIJ A;  3VD7 A;  1QOS A;  1F15 A;  4GMP 1;  2QQU A;  2C5D A;  2YHJ A;  3VL9 A;  4IET A;  2Q5T A;  4KI5 M;  1XE0 A;  4K9S A;  3T08 A;  1NA1 C;  1MAC A;  2QKD A;  3MI8 A;  2W3J A;  1QJX 2;  1OFN A;  2QQM A;  4D7S A;  4URA A;  3IM0 A;  4DXS A;  4GZ9 A;  3H1Y A;  1RUC 3;  1PIV 2;  3SCH A;  5KXD A;  5KXB A;  2OW4 A;  3SH3 A;  5K8S A;  4DXR A;  4GJZ A;  4NPM A;  1G9A A;  1YLL A;  3PHM A;  4COW A;  1KJR A;  2J42 A;  1OF3 A;  3OPT A;  4UT5 A;  3VBS A;  3ZVX A;  4EN6 B;  2NP0 A;  5HCB A;  4ARY A;  1DGW A;  4EQV A;  1H1M A;  1UMI A;  3U37 A;  4P02 B;  3CJI A;  5D21 A;  1YC6 1;  3LDK A;  4QGL A;  4C91 A;  5A6Z A;  1TME 1;  2KD7 A;  3OF1 A;  2Y0I A;  5GZG A;  1I1E A;  4IXL A;  4JHT A;  1JZ5 A;  1S4C A;  1DQ2 A;  1YRZ A;  1RUC 1;  1WLW A;  1GU3 A;  3B02 A;  2QQV A;  4N7I A;  3RYP A;  3ILR A;  2VJX A;  3ZXF A;  1RUE 3;  3PU8 A;  4QT6 A;  5FMB A;  3WVJ A;  2JD4 A;  3EQE A;  3BN6 A;  3PMS A;  4DEV A;  2XGX A;  5AC9 2;  3N9N A;  2J1U A;  1IPK A;  2GDF A;  4K3U A;  2R32 A;  2QVS B;  4QPI B;  2VMC A;  2GC2 A;  1W8F A;  2VZQ A;  4BQ1 A;  2OUH A;  1ZVF A;  3HOB A;  2LM3 A;  5EJ1 B;  3DGT A;  1W04 A;  3J8F 3;  1ODM A;  1NUK A;  1FV2 A;  1C5H A;  3M8L A;  5FRA A;  1RUD 2;  1WMF A;  3N7J A;  1NY7 1;  3WF2 A;  3BTX A;  4UW5 A;  1RUE 1;  4FVV A;  4LQR A;  3JUU A;  1H8T B;  4L97 A;  3NJV A;  1ZRF A;  4GMP 0;  1XNC A;  1N3P A;  2C4X A;  4JZR A;  3ZR6 A;  1W0N A;  4ITC A;  1G6N A;  3HN1 A;  2W08 A;  1JW6 A;  3PJY A;  2B46 X;  5FZ3 A;  4PDW C;  1VBB 2;  1PGW 1;  4PT6 A;  5J96 B;  3IWZ A;  5B4N A;  4WVZ A;  1I3H A;  3AP4 A;  2VNV A;  2Q1F A;  5FAX A;  1O5L A;  5CFD B;  2HWF 3;  4YYO A;  3WDY A;  3KZ4 C;  5BUV A;  1V0A A;  1VJ2 A;  1CR7 A;  2YUE A;  4BIF A;  3VUO A;  4V1P A;  4EWA A;  1QJY 2;  1VP6 A;  5I91 A;  3LPF A;  4UAP A;  2HEW F;  1RUI 3;  5FO9 B;  1PHM A;  1LUL A;  3B9I A;  3T30 A;  1W6O B;  3LAG A;  2BTV C;  4BLI A;  5ABJ B;  3I54 A;  3BB6 A;  3FFZ A;  4QHO A;  4YZ3 A;  4HBN A;  4Z2A A;  5J36 A;  4YVW A;  4HL0 A;  3RWN A;  2VU9 A;  3VZL A;  5K7P A;  1AUY A;  1W8O A;  3HIF A;  4Q4Y 2;  3S7E A;  2HWF 1;  4NHM A;  4SBV A;  3VBH B;  5BNQ A;  4KWK A;  2ZMK A;  2WS9 3;  5CFC A;  2NLR A;  3CU7 A;  3WF1 A;  4IEU A;  4JX0 A;  2QQI A;  2X53 S;  4B4P A;  5FYB A;  4LO5 B;  1RUI 1;  2EVX A;  2YYO A;  2W9X A;  4HVR A;  5DUW A;  1OMI A;  1EV1 2;  2Q1M A;  3ACH A;  3IPV B;  4UFM A;  2OZ6 A;  4GKY A;  4YG3 A;  4CRQ A;  1L7R A;  2VNG A;  1WD3 A;  3IAQ A;  3ELN A;  4A45 A;  3AYD A;  5C4W C;  4B7E A;  3AKT A;  1BCX A;  3HN3 A;  3IKW A;  1XNA A;  2I07 B;  5FY1 A;  5BNP C;  1D2Q A;  1QDO A;  3FWE A;  3VKN A;  5BNN C;  4Q8L A;  2WS9 1;  2YPJ A;  2VQT A;  1W6P B;  1L3J A;  1RIN A;  3POS A;  4XW3 A;  4XOG A;  2VQA A;  4UFI A;  3BU7 A;  3VBF B;  4Q29 A;  2BVV A;  2GAU A;  4LKF A;  2VPV A;  4CPB D;  2ZEZ A;  2N7G A;  4B1L A;  1G9B A;  1CAV A;  2CSG A;  1UIJ A;  4XXA A;  3FJS A;  1ASJ 3;  1RUO A;  3A7Q A;  1BZW A;  2JD9 A;  3FHA A;  1JUH A;  2ZGS A;  1MVQ A;  1O4T A;  2ZML A;  3L2H A;  4RR3 B;  4YLZ A;  3C2U A;  1ULP A;  2CGO A;  5FZ1 A;  2JX9 A;  1LEC A;  3POJ A;  4AW7 A;  2LUW A;  2NQY A;  4Q2F A;  2WWU A;  4Z92 B;  2VOW A;  4BME A;  1BMV 2;  2HH9 A;  2NMO A;  4RL7 A;  3FFQ A;  4A3X A;  2YFZ A;  2HWE 1;  5C7G A;  3ZDV A;  5KHG A;  2WSV A;  1HRI 3;  1ASJ 1;  2WQ4 A;  2BVB A;  2DCJ A;  2QQN A;  2X5I C;  3H7J A;  2YBS A;  1R1A 2;  2VZV A;  4CDQ C;  5LEK A;  4UFK A;  4FPL A;  5AVP A;  1MEC 2;  3VN4 A;  1AXZ A;  4XDO A;  2RE9 A;  3J26 N;  3SHR A;  3U1X A;  3TRS B;  1JXN A;  2LW8 A;  3AKR A;  3ZFE B;  3ALQ A;  1W06 A;  1GAN A;  2ZOE B;  2GN3 A;  2EAA A;  1AR8 2;  1HN0 A;  1W9W A;  4AE2 A;  2XWJ B;  3P5B A;  1HRI 1;  1IS4 A;  3AMM A;  3JXS A;  3OTF A;  4XJZ A;  1WMX A;  2FCU A;  1GWM A;  2NMN A;  5FYV A;  2WL1 A;  2P6H A;  3UL2 A;  2WT1 A;  4IND A;  4XZU G;  2YBP A;  4OVE A;  5DUV A;  5BXX A;  1O3T A;  4OHV A;  3KCY A;  1FAT A;  4GWN A;  4QX2 A;  4LLF A;  2ZGR A;  1KFU L;  1J84 A;  2ENR A;  4BXF A;  4OHW A;  4A44 A;  1G9F A;  1PGS A;  2BWA A;  1UY3 A;  2LS6 A;  2W91 A;  3N3H A;  3N7K A;  2PQQ A;  4YW6 A;  3WNP A;  3VHN A;  1TMF 3;  3ZSK A;  2Y6F A;  3DN7 A;  3I2I A;  4AVV A;  5IFT A;  1EPW A;  3IDE A;  1YQ6 A;  2Y33 A;  3CQO A;  5LWB A;  3ZN4 A;  3FHQ A;  4PI0 A;  1W9T A;  2A1X A;  3AXD A;  2EID A;  4XAC A;  1D0G A;  1RXF A;  1LEN A;  1NT0 A;  3DYM A;  3AYC A;  3E1F 1;  5C5U A;  3BOD A;  3JBG 2;  4XUP A;  4MET A;  4FAH A;  2VZ3 A;  2R06 3;  1EAH 3;  3BCW A;  2WNU B;  2A71 A;  1W9F A;  3AYE A;  4EZH A;  2YC0 A;  3WOG A;  1TMF 1;  5J48 A;  2HWC 2;  1RUJ 2;  4CZS A;  4KGG A;  1QF3 A;  2LRO A;  1IKQ A;  1VAK A;  3H42 B;  2HEV F;  1ULG A;  3URF A;  4AAP A;  5CKN A;  4YNI A;  1DCS A;  2VTX J;  3WR0 A;  2WWJ A;  4IL7 A;  4MX3 A;  4Q4V 3;  4COY A;  1RVF 2;  5FYS A;  5J98 B;  2DBI A;  4LBQ A;  3P6B A;  3E5Q A;  1M06 G;  2R06 1;  4PHZ A;  1EAH 1;  1DU3 D;  4NPL A;  2QJV A;  4M00 A;  4N53 A;  1H2K A;  1I5P A;  3VKL A;  1PX4 A;  3AMP A;  3NWK A;  1P8J A;  3IDB B;  1V9U 2;  2XON A;  3I3D A;  3VZO A;  4JHZ A;  2ZJC A;  5T54 A;  5IVB A;  1HQW A;  3AJY A;  2UY9 A;  3EXU A;  3USS A;  1PMJ X;  4Q4V 1;  4CDU B;  2BQP A;  4Q4X 2;  4DEQ A;  1ST8 A;  3AM2 A;  3HD8 B;  5AVA A;  5FZC A;  2RJ2 A;  5DMY A;  5JZG A;  3PVE A;  4FFF A;  4Y20 A;  2ZGK A;  3C3V A;  2Q8C A;  2PLV 2;  3FN9 A;  2AZ5 A;  4FPH A;  4W8J A;  1H0B A;  2ES3 A;  3RNS A;  1A34 A;  1AL2 2;  5F8P A;  2VUL A;  4HKO A;  1W6N B;  3WP4 A;  3AB0 A;  3LEK A;  3OJB A;  4QHZ A;  2FQP A;  3VZK A;  3WW2 A;  4P9I A;  3P3N A;  4WM7 A;  1SHW B;  3K4Z A;  1QHD A;  3C7O A;  4DB5 A;  1MZ6 A;  4AQS A;  1MQT B;  4CDW A;  1NLS A;  5EWS A;  5A7W B;  4AHZ A;  5I0D A;  4XC9 A;  3POI A;  4CE8 A;  4CCO A;  5HXV A;  2GNB A;  3OB8 A;  4LHS A;  2ZEW A;  3KV9 A;  4LIT A;  4YW1 A;  2BFU L;  3ZIW A;  4ASK A;  4F3J A;  5J3U A;  1ODN A;  3U4X A;  3ZXL A;  3LCP A;  1G9C A;  1NA1 A;  5FO8 B;  2GC1 A;  4I09 A;  5A32 B;  2Y6L A;  2VUC A;  5DDJ 2;  2J7M A;  3RJR A;  1GP5 A;  3I2K A;  2I45 A;  4OQ9 A;  4CTE A;  3ZFG C;  1NYW A;  1PK6 B;  1RUG 2;  3GNE A;  1E57 A;  3M3Q A;  1RJ8 A;  3JD7 2;  3K77 A;  3MDP A;  3VGI A;  4XF4 A;  1SPP A;  2JG9 C;  3ST7 A;  4JKL A;  4ZHN A;  2BWC A;  2VMF A;  1QNW A;  1B35 B;  4BM8 A;  1LU1 A;  2CWM A;  5FOJ B;  5LBF A;  1J1L A;  3FE5 A;  2PQS A;  3ILN A;  3T0B A;  5DDJ 1;  3ZDS A;  3NVC A;  4U2A A;  1W8T A;  1UU5 A;  4M0H A;  4Q4W 2;  3ZPY A;  2FZ2 A;  3SKV A;  2FMD A;  3KV6 A;  1WLD A;  3TEW A;  3FHI B;  4LR4 A;  2UWC A;  1GLH A;  4RSU A;  1ZZ9 A;  4QPG B;  2DVB A;  3J7M A;  1PO1 3;  3LDR A;  3GBF A;  1W8U A;  4AGR A;  1FPN 3;  4OFG A;  1WCQ A;  5HCH A;  4LTA A;  4KMQ A;  1CAU B;  3BI3 A;  5DAQ A;  5TSW A;  3H1W A;  4FPK A;  2Y0O A;  3WQB A;  4A6O A;  5J1X A;  4PLO A;  1HIX A;  2EF6 A;  3K3N A;  5FZ7 A;  5T55 A;  1REE A;  1UMH A;  2VM9 A;  3LF7 A;  3WF0 A;  4DS0 A;  5FZA A;  1QJU 3;  2XJQ A;  2JB8 A;  4KBB A;  1YYN A;  2GH2 A;  4ZS3 A;  3ZXG A;  5EIY B;  2RDN A;  1KQR A;  4TZD A;  4FO9 A;  4ET7 A;  3IDA A;  4ORF A;  3OYW B;  5DAP A;  5EXO A;  3WP5 A;  1PO1 1;  4NHX A;  3THD A;  1FPN 1;  3LD8 A;  1O3S A;  1ND3 B;  4PDW A;  5C3S A;  1UZ0 A;  3DPR B;  4CEY B;  4MV2 A;  4K1Z A;  1BJQ A;  1BYH A;  2DTY A;  2GSY A;  3NL1 A;  1UYP A;  3WQ1 A;  4KWL A;  4OHY A;  1QJU 1;  1OXC A;  4XFI A;  3O1M A;  1UYY A;  5GZE A;  2ZBJ A;  5FRE A;  1H8T C;  4IW3 A;  3GDB A;  1J59 A;  2ET7 A;  3S7I A;  3EBR A;  3WG3 A;  5C8C A;  3CEW A;  1ZRD A;  3CZJ A;  1WMD A;  1W3X A;  2CU5 A;  2P5B A;  1Y9G A;  5AFE A;  1T6B X;  1UMZ A;  3RS6 A;  3WDT A;  2OQ7 A;  1UOJ A;  2V4V A;  4LK6 A;  4AI8 A;  3W5M A;  1BVV A;  1RUF 2;  2B7Y A;  2E7A A;  4NRM A;  4J1X A;  1SLT A;  3RZJ A;  1CAW A;  3MUY 1;  3ETQ A;  3PL0 A;  3RYK A;  5CFD C;  5JOW A;  1OPO A;  3SXW A;  1D4M 2;  1F9K A;  5FXX A;  2H0B A;  4GB3 2;  2R07 3;  3UJQ A;  1V6O A;  1CGP A;  2JDH A;  1JYN A;  4AI1 A;  2P37 A;  2EIE A;  1POV 3;  3QH7 A;  1RHI 2;  4YZ2 A;  4CP9 A;  1NX9 A;  4YGC A;  1AR9 2;  2VTF A;  3AYA A;  3ZR5 A;  3CHX A;  3HVD A;  1XYP A;  2DDU A;  1VMF A;  2WO3 A;  4NRO A;  5C4W A;  4E2G A;  3VZM A;  1NCR B;  1OUX A;  4W65 A;  3ZFF A;  2QQJ A;  3VBH C;  1NE6 A;  1QJF A;  4FPG A;  3KVA A;  5FWJ A;  5I0S A;  5IAT A;  4EN8 B;  4BPZ A;  3DEM A;  2EIB A;  2R07 1;  4B3N A;  2VBD A;  1GFF 2;  4CCL A;  4CEW B;  5IAV A;  5I8T A;  4PF1 A;  3BTZ A;  4EWE A;  1POV 1;  1LJ7 A;  1RL3 A;  1S0B A;  2K0G A;  3PUQ A;  4Q0Q A;  3JCI A;  1RIR A;  4ZXK A;  4BLJ A;  5JPN B;  1OPM A;  4BQ4 A;  4GAL A;  4PBP A;  2VOK A;  4QDS A;  2ARE A;  2PA7 A;  4MAD A;  2ZAB A;  3KB5 A;  1ZZ6 A;  1QJE A;  4LBJ A;  2Z2S B;  1VBA 3;  3UGH A;  4LUL A;  2XG3 A;  2FMY A;  4I30 A;  1FMD 3;  5EFU A;  3VL8 A;  1OKQ A;  1M4W A;  2E53 A;  1HB1 A;  5BNN B;  4JV4 A;  3A4U A;  2C26 A;  5FZ6 A;  5FZ8 A;  1DGR N;  4CU9 A;  2E6V A;  3HJR A;  1WLC A;  4W6X A;  2IVI B;  4QMA A;  3Q8F A;  1DBN A;  2Z5W A;  4K1Y A;  4IUG A;  5CU1 A;  3VBF C;  4EE2 A;  1CIW A;  5FP8 A;  2F4P A;  3BKZ A;  1PO2 3;  2ARC A;  2QDR A;  4B4R A;  4Q1P A;  4AVC A;  4BH9 A;  1JU3 A;  2WNV A;  2W0X A;  1S1A A;  1VR3 A;  3PIG A;  4M3C E;  3TNP B;  4IEZ A;  1GZW A;  1VBA 1;  2TUN A;  3DXU A;  3B7M A;  4BQ5 A;  4C8D A;  1ND2 A;  1JYW A;  1FMD 1;  1VMH A;  4CDQ A;  5K4L A;  1OF4 A;  4AFA A;  2CHH A;  1TG7 A;  1BVP 1;  3ACI A;  3JB8 A;  4RR3 C;  4CU7 A;  4Y5Z 0;  1ZBE 3;  4QU1 A;  1YI7 A;  5IUQ A;  4NID A;  4XUT A;  2C24 A;  3RRD A;  4LJH A;  2Z69 A;  5T52 A;  4O61 A;  4LOR A;  2V5Y A;  1VAM A;  2RMU 2;  1RMU 2;  4KNC A;  1PO2 1;  3ME2 A;  1V00 A;  5FPZ A;  1LTE A;  4TTG A;  2FZ1 A;  2JDP A;  4XPV A;  2XB6 C;  2BBV A;  1LOF C;  3RZK A;  3WNN A;  4GAZ A;  1YFU A;  2VOX A;  2R1D A;  2VMI A;  4RQP B;  4RGG A;  4ATE A;  5F7U A;  1V6J A;  4H7L A;  4AVA A;  4HZF A;  2E33 A;  3PUS A;  1ZBE 1;  4QXC A;  2VEC A;  5ACA 3;  1W8N A;  2ARA A;  3A0K A;  2RVA A;  1AYM 3;  3N9M A;  1QOT A;  3HAG A;  4HMZ A;  5D8A B;  5HCF A;  4I0A A;  3ZFE C;  3KF3 A;  2BUK A;  5DXD A;  2ZGO A;  4MXW B;  4ZKT B;  5L9B A;  2H6B A;  1BKZ A;  3FLP A;  2ERF A;  3W59 A;  4MGI E;  2BU9 A;  1W3V A;  3TN9 3;  3O1R A;  5FY0 A;  5FBJ A;  1PVC 1;  1QXJ A;  4I3G A;  5H9P A;  2MPF A;  2HWB 3;  4NUB A;  1W6Q A;  3H7Y A;  5F3G A;  1SDD B;  2JKX A;  2P3J A;  1Z0H A;  4PIX A;  1WUV A;  4F8A A;  2NN8 A;  2V73 A;  5FY4 A;  5ACA 1;  5JXH A;  1J1T A;  2VNR A;  5JSR A;  1AYM 1;  5FPL A;  4RS5 B;  2E9Q A;  4N7U A;  5JMO A;  1FXZ A;  2WBK A;  3H9A A;  3I2H A;  1DZR A;  3PUI A;  4QXK A;  5KHH A;  1QQP 3;  2PHL A;  3ZXE A;  5FCC A;  5A1A A;  5IK8 A;  1PVX A;  2RHP A;  3AKQ A;  4XFF A;  3TN9 1;  1X9P A;  4WZF A;  5FKC A;  4HT1 T;  4LE4 A;  1LHN A;  2W92 A;  4MYE A;  1OQE A;  3K3O A;  1RED A;  2HWB 1;  3SC7 X;  3T1L A;  2R04 2;  4GWM A;  2HEY F;  1GOF A;  5C70 A;  5C3Q A;  3LZZ A;  3RPQ A;  4COV A;  4QM8 A;  5FY9 A;  1YJL A;  1BHG A;  2W68 A;  3R6S A;  2WNU C;  4YWA A;  3V0A A;  1QQP 1;  1FOD 3;  5CB7 A;  4XYX A;  2WDB A;  1H8V A;  1R09 3;  4IER A;  3HT2 A;  4BMB A;  4AQT A;  2RS5 3;  3J4U H;  4GIQ A;  1FI2 A;  2OVU A;  2ORX A;  1JZ4 A;  3N35 A;  1K5M B;  4LEJ A;  4PBO A;  4AFB A;  2W87 A;  2BNO A;  5IVV A;  1APN A;  2WKK A;  5EHD A;  3RZG A;  2JG8 B;  1YQ8 A;  2ZHK A;  4YM3 A;  1YI9 A;  2XBO 2;  2B4K A;  1S0E A;  4MZU A;  1COV 3;  5DAW A;  3WDV A;  2GC3 A;  1FOD 1;  2RM2 3;  3NAP C;  3VBO A;  1R09 1;  2C9A A;  3FMG A;  2RS5 1;  3RDI A;  2WZP P;  1VAL A;  3E5U A;  4CDX A;  1XSR A;  2XJP A;  3NNM A;  4X8P A;  4XCA A;  3QBQ A;  2B8M A;  3O1V A;  3I3M A;  5LRR A;  3OBR A;  4CDU C;  1VRH 2;  3ZYB A;  1UWW A;  2VME A;  5C71 A;  2DUO A;  1A6C A;  3GHM A;  1BEV 2;  2XKP A;  3V0B B;  1COV 1;  3VKM A;  1PGL 2;  3MF6 A;  1KEX A;  2RM2 1;  5FQ0 A;  4QX8 A;  3SQO A;  5L7O A;  4JGZ C;  3AZY A;  4I02 A;  5KR7 A;  2BNM A;  4AEK A;  3D5O A;  3RWK X;  2WSU A;  4IV1 B;  4CCM A;  1E5S A;  1W6M B;  2IXL A;  3AFK A;  3UV9 A;  4RHV 3;  1YJK A;  1AJK A;  2AYH A;  1N1Y A;  1DYK A;  4Y1Z A;  2JJ6 A;  3ZFG A;  2WQ8 A;  4QB2 A;  4AR2 A;  1ULC A;  2EA7 A;  4ISQ A;  1J83 A;  3LA3 A;  2K9Z A;  3OEA A;  5GZD A;  4OHX A;  1Q8O A;  1G8W A;  3FC0 A;  4ZY9 A;  4Y4Y A;  4QB1 A;  2EXJ A;  2XH6 A;  1H1A A;  1RUN A;  3R4D B;  4YVS B;  5HBA A;  2ZA9 A;  3THT A;  4E4D X;  5BNO B;  2WT2 A;  1E5H A;  2XQR A;  3ES4 A;  4IEY A;  4QB6 A;  4CUB A;  5GLU A;  5C9A A;  4RHV 1;  3LA7 A;  4AHW A;  1N3O A;  3U10 A;  3VB9 A;  4KWJ A;  2D6N A;  3OUH A;  4O65 A;  2AR6 A;  1PK6 C;  1EPZ A;  4XHB A;  4NOT A;  1VBE 3;  2FDH A;  2Z4F A;  2YGL A;  5DAB A;  1ZBA 3;  1N1V A;  3KMH A;  3OPW A;  3VV1 A;  5LA9 A;  4YM1 A;  4FOY A;  2VR4 A;  3WG2 A;  2DTW A;  1XYO A;  3BYW A;  4TN7 A;  3T2Q A;  2IUW A;  3PJQ A;  3MIC A;  4YZ1 A;  1SBD A;  1XNT A;  4IQP A;  1B35 C;  5FLH A;  3T3Y A;  3KQ4 B;  2JG9 B;  3M2M A;  2QQW A;  3WDU A;  4BWO A;  3RMX A;  3I2F A;  3BIE A;  1BK0 A;  4JDO A;  3WEZ A;  1HKD A;  2GP5 A;  3WQ0 A;  4C1W A;  1TME 2;  1VBE 1;  4PLM A;  3GCW A;  4QX1 A;  2JKB A;  2ZCW A;  4UF0 B;  1ZBA 1;  4DFS A;  4MGT A;  3RVH A;  1RUC 2;  4JGY B;  4QPG C;  2IVJ A;  1AF9 A;  1UYX A;  3AMH A;  2VXJ A;  4QPI A;  3T0A A;  3WD5 A;  4YW5 A;  3I2O A;  1KS5 A;  3H8X A;  1Q8P A;  1AR6 3;  3N9L A;  1XND A;  4HON A;  3KQR A;  1ZZC A;  4QQ2 A;  4XUR A;  3TNQ A;  1SCR A;  4MGS A;  4N43 B;  3A21 A;  4QXB A;  3SCG A;  3WV6 A;  2W52 A;  4AG4 A;  1NOV A;  1SFY A;  3UT0 A;  3ACF A;  5IK4 A;  2XKO A;  3AZW A;  2AUY A;  4HN1 A;  3WX5 A;  1W9Y A;  3BAL A;  2YU1 A;  1CES A;  1NY7 2;  1H8T A;  2JXA A;  1W9S A;  1RUE 2;  2OX0 A;  1T6G C;  2P3Y A;  4UW3 A;  4P9L A;  4EN7 B;  1ND3 C;  1QNY A;  4EWD A;  3WNX A;  1AR6 1;  3ZN5 A;  5C3R A;  3DPR C;  4CEY C;  1O59 A;  2WO2 A;  1OD3 A;  4FOQ A;  5JCT A;  3IDC B;  2BPA 2;  1BBT 3;  2QZ2 A;  1PGW 2;  1F5F A;  2VZU A;  3ACL A;  5FZG A;  1Z7S 3;  3ITQ A;  2ARX A;  3N36 A;  1OLQ A;  1GSL A;  1UAI A;  4PLN A;  4KU8 A;  3FLT A;  5C3P A;  1JS9 A;  1MPX A;  4WM8 A;  1JN2 P;  4CP0 A;  4CU8 A;  3N7M A;  2CYF A;  4UOJ A;  4XET A;  4P5Y A;  5KC6 A;  1XE8 A;  1CX4 A;  1FT9 A;  1W6O A;  1ZA4 A;  5ABJ A;  2FDF A;  3CIH A;  5GJ6 A;  5FYU A;  4JC1 A;  4XUQ A;  1BBT 1;  4NVP A;  3ORJ A;  3C7F A;  3J8F 1;  1Z7S 1;  3ZKU A;  4YGE A;  1ULO A;  3JU9 A;  5JDB A;  5HXM A;  2WIN B;  2CAU A;  3W5N A;  3O0W A;  3ZXJ A;  1UY4 A;  3WNM A;  2HWF 2;  1W8W A;  3PTY A;  4ARX A;  3GZA A;  2W46 A;  4OMD A;  2ZZJ A;  1RIT A;  3TAY A;  2XR4 A;  1C8M 3;  5BYN A;  1Q3E A;  3IPV A;  2VD7 A;  3NO8 A;  1RUI 2;  4BQX A;  3CF6 E;  1FV3 A;  2G19 A;  2DUQ A;  4V2V A;  4DUX A;  3Q8C A;  4ZPI A;  1NCR C;  5FZL A;  3MO4 A;  3RZL A;  1DG6 A;  4UXA A;  3ZPO A;  5JI7 A;  3EJK A;  2RJL A;  2GND A;  1U5Y A;  1XPW A;  2Z79 A;  4NAO A;  5LZ6 A;  1UYZ A;  4LKE A;  4NAM A;  5DZF A;  1OHF A;  2WS9 2;  1J3Q A;  1AR7 3;  4K21 A;  4S2G A;  4CEW C;  5CG9 A;  1C8M 1;  3LIG A;  3OD4 A;  3WNL A;  1Q5O A;  4NIA A;  4OZX A;  3VBF A;  1I6X A;  1JU4 A;  2VVD A;  3NRU A;  1QJZ A;  2O0O A;  1H30 A;  4P9Y A;  1H2N A;  4LOT A;  2OA2 A;  4K7J A;  2R0F A;  4IV3 B;  3VD9 A;  5EQU A;  1AYN 3;  2RR1 3;  4XHX A;  4YZ5 A;  5A6X A;  1JZ3 A;  1SLC A;  2JEC A;  2OZJ A;  1MS3 A;  5JXG A;  1OH3 A;  2I74 A;  2ZEX A;  1UX7 A;  4A42 A;  1AR7 1;  1XJA A;  3GZU C;  5F3E A;  2VAU A;  5FUN A;  3PVO A;  1LOD A;  1H6Y A;  5EP9 A;  3B01 A;  1DGR A;  3VDA A;  1NXM A;  3AX4 A;  2C1F A;  4HKW A;  4ZU7 A;  4LHK A;  3OGS A;  1UY1 A;  5JAX A;  1LOF A;  2VZP A;  5FY8 A;  1AYN 1;  1H9P A;  2RR1 1;  2AEN A;  2XJV A;  2JEN A;  2HWE 2;  3JQX A;  4AI2 A;  1ZRC A;  1ASJ 2;  2VUA A;  5DG2 A;  4MHR A;  1C4R A;  4CXW A;  5AFB A;  5L73 A;  4ZON A;  5FZF A;  3I59 B;  4YVW B;  3THC A;  1U0A A;  2JIG A;  3NV4 A;  3BGA A;  2RS1 3;  3CDZ B;  4LOS A;  5CIR A;  1TNF A;  2WWS A;  3MBW A;  3ZFE A;  3Q9O A;  1PZ8 A;  4GH4 C;  5KXC A;  5CFC B;  1QY4 A;  3N9O A;  4MSV A;  5FY7 A;  3TWI A;  3CBN A;  2X05 A;  4RQP C;  4XF3 A;  2FDG A;  4TWT A;  4AED A;  4M0N A;  3MW4 A;  3ILF A;  4BQ3 A;  1HRI 2;  1LB2 A;  1MS9 A;  1SLI A;  2ETE A;  1OOP A;  1NZI A;  2R0H A;  3VHO A;  2WAB A;  1LOC A;  2YC2 A;  4WZC A;  5FP9 A;  2ZKL A;  3M4F A;  2HWD 3;  2RS1 1;  1S0I A;  1ZYB A;  5D8A C;  1VPH A;  1CPM A;  2VBB A;  3POW A;  1C28 A;  5HCA A;  2J1T A;  4NJ4 A;  1PM7 A;  5FYC A;  2D98 A;  2PXJ A;  1IS5 A;  1HB2 A;  1SG3 A;  5A7N A;  2IXC A;  2E51 A;  3VBU A;  2PAK A;  1ONA A;  2XDV A;  3JZV A;  3W58 A;  1U12 A;  4OLL A;  1JOJ A;  2E26 A;  2J22 A;  3H0O A;  2P17 A;  1W03 A;  1JMU B;  2HWD 1;  1SCS A;  4LHL A;  5JPM B;  2UUR A;  2FHR A;  3WF4 A;  4YPJ A;  1W0P A;  2ZAC A;  4LUM A;  1H2M A;  1UY2 A;  4RS5 C;  1WBL A;  1E5R A;  5FP4 A;  1CWP A;  2WNU A;  3HMY A;  1G86 A;  1PM4 A;  2B5H A;  4H7M A;  5DZE A;  2VMG A;  5FZB A;  1GQH A;  1JUI A;  4MLO A;  3B9C A;  1TMF 2;  2ADD A;  1N1S A;  2JDK A;  2HBT A;  2WYF A;  2KXL A;  1IQA A;  5JOY A;  2E7Q A;  5ANN A;  3IIA A;  3RG0 A;  4LA3 A;  4JRL A;  3LIH A;  3NQH A;  3LSE A;  3WNK A;  3K51 A;  4MOA A;  1W8H A;  2Y60 A;  4TYS A;  2VBP A;  4G4F A;  3OY8 A;  1YNA A;  5IVF A;  4LO8 A;  4YFW A;  1VB2 A;  2CTV A;  2R06 2;  1EAH 2;  2VCA A;  4GUL A;  4OUS A;  5GLV A;  1F8V A;  2XJR A;  1VIW B;  3UK9 A;  2XVK A;  2IC1 A;  3TBD A;  2ID4 A;  3ROU A;  2VZS A;  2EXK A;  3KS7 A;  1TZO A;  1ZA7 A;  1HW5 A;  2J1E A;  1K5M C;  1Y7B A;  3OBT A;  4MUV A;  5FZ9 A;  2OPW A;  4I2O A;  3LDB A;  2VW0 A;  2JG8 C;  4Q4V 2;  4UW6 A;  1C8N A;  1GQP A;  3MLJ A;  1AJO A;  3ZX7 A;  2VUD A;  4K40 A;  1CZS A;  2XLF A;  2Q30 A;  3N9P A;  1D7P M;  1RUH 3;  3ZYJ B;  5F6L B;  3B69 A;  4NHL A;  5IVC A;  4AGG A;  1ZZ7 A;  3A23 A;  2ZHL A;  4LBQ D;  4H55 A;  4Q1R A;  3TEX A;  3VDD A;  1NCQ A;  2W5F A;  3B3Q E;  1X50 A;  2K2S A;  3NAP B;  3POE A;  3JQW A;  4XMI A;  3INA A;  5CYY A;  1KDK A;  2PAM A;  1JYC A;  4BK5 A;  4XTP A;  5JUV A;  1IS3 A;  1K5J A;  1MQT A;  2B9U A;  5A7W A;  4P14 A;  3D6E A;  4M4R A;  1YCI A;  2QCS B;  5FYZ A;  4DOU A;  2R1B A;  1OLR A;  1RUH 1;  2VZO A;  1XB9 A;  1YXW A;  4JKK A;  2QZ3 A;  5G04 L;  3RI8 A;  2PHD A;  5FXV A;  1O5U A;  3OBZ A;  5A32 A;  4E2S A;  3RGB A;  1U5Z A;  4UFH A;  4IV1 C;  2GZW A;  3F2Z A;  4JGZ B;  2YBK A;  4L8Q A;  3U75 A;  4CXY A;  2A75 A;  5EZW A;  3BVC A;  5IYY A;  3EMR A;  3ZN6 A;  1H1I A;  1S2E A;  3U11 A;  1KFX L;  4S2F A;  5F3I A;  1X8E A;  2Q8O A;  2P6C A;  2Q1Z B;  2ZGN A;  1UIK A;  3QH6 A;  4KG8 A;  4DRV A;  1YFW A;  4ES9 A;  4YVS C;  1CQ9 A;  3IBM A;  5BNO C;  1JHN A;  1LES A;  3N7L A;  2D93 A;  4EV0 A;  3QAC A;  3DYO A;  1R08 3;  3QD6 A;  4NHY A;  4HK9 A;  3ZYH A;  5FFO C;  3GAL A;  1JOD A;  1TQ5 A;  2DCZ A;  3AL5 A;  4YZ4 A;  1X9T A;  2DU0 A;  4YGD A;  4BYY A;  1ALY A;  1VE0 A;  4L92 A;  1IS6 A;  3D8C A;  5C8W A;  2QTW B;  1EYB A;  4QPG A;  1WCU A;  3FLR A;  1ZRI A;  3T1M A;  1YUD A;  3UNP A;  5KBF A;  1LGC A;  1V6K A;  4ZXE A;  1IHM A;  4E8D A;  4CCK A;  5F32 A;  4BE3 A;  5FIX A;  4KG0 A;  4N9H A;  1A78 A;  1LHW A;  1R08 1;  1UW8 A;  2DF7 A;  1AX1 A;  4GJY A;  4LIV A;  5JOZ A;  2G9G A;  4Y20 B;  3WW1 A;  4ATF A;  2WZR 3;  2BOI A;  4NRP A;  5FV3 A;  2DV9 A;  1JTZ X;  1F31 A;  4J1W A;  4WVV A;  3D82 A;  1DYO A;  1HQN A;  1CVN A;  4JGY C;  1YQ2 A;  3W9A A;  5A3U A;  4MG2 A;  4O9E A;  2IXI A;  2WJS A;  3CKH A;  3DF0 A;  5L9R A;  3HNY M;  2W39 A;  3RZM A;  1FNY A;  1RUG 3;  1HJG A;  2MEV 3;  4TLF A;  1PO1 2;  3UKN A;  4CEY A;  1IG3 A;  1FPN 2;  2KM2 A;  5F5I A;  2Q8D A;  4N43 C;  4Z82 A;  4E4H A;  1J58 A;  4PCR A;  5EV7 A;  4AFD A;  2CV6 A;  4CDW B;  3ZKY A;  2KR2 A;  3VBR B;  4Y1Y A;  1S0C A;  3NW4 A;  2VW1 A;  1RGS A;  3IAP A;  1F5J A;  2WZR 1;  3B93 A;  3NKG A;  4Z07 A;  3ZYP A;  5KHK A;  2WC2 A;  2P3I A;  1NLQ A;  3AVR A;  4D3W A;  1CON A;  1QJU 2;  2C0Z A;  5FMC A;  1AHS A;  3UET A;  2VMH A;  2UYA A;  5FZI A;  5K0U C;  4I3P A;  3T4V A;  1US2 A;  2E63 A;  4M3C F;  4Q4W 3;  3WNO A;  5I8S A;  1GOG A;  2MEV 1;  1NQJ A;  3AZZ A;  2WR9 A;  4UW4 A;  4XF1 A;  5F9T A;  1Z78 A;  4QXH A;  2RDS A;  2IZW A;  4FQ4 A;  1IPS A;  2JWP A;  5FK8 A;  5EPA A;  3LEM A;  1SPP B;  4S2H A;  3U0Z A;  1D4V B;  2OT7 A;  4LMF A;  2P2K A;  5FY5 A;  5LA2 A;  1LOA A;  1HLC A;  4XXP A;  5T5O A;  4NO4 A;  3OD0 A;  1NQD A;  2TNF A;  3L9J T;  3V65 A;  5CAZ A;  2DVF A;  4QAW A;  5LA0 A;  4Y26 A;  5DZG A;  1I9R A;  1VBD 3;  1V6L A;  4GD4 A;  2QFE A;  5FZ0 A;  2Q4S A;  1DZQ A;  4DUW A;  4FTB A;  1YFY A;  5FZD A;  5FKB A;  2ZGL A;  1GV9 A;  3AMQ A;  3BTA A;  3VBS C;  3TOJ A;  3E97 A;  2PEL A;  5H9S A;  4WVM B;  4D69 A;  4P9G A;  2GNT A;  2WO1 A;  3O5S A;  1WBF A;  2ZMN A;  3IT8 A;  4ZU4 A;  4QGN A;  5FXZ A;  3U4S A;  4V2W A;  4UI9 L;  3IMN A;  2R07 2;  1ZX5 A;  4GWI A;  4UBG A;  4E4Z A;  1VBD 1;  3ZXD A;  1YO8 A;  2JE8 A;  2W2I A;  1UZY A;  1PNF A;  3T2O A;  4M4P A;  1RXG A;  3ZMN A;  1EY2 A;  3WG4 A;  4R9B A;  3GM8 A;  1IPJ A;  4Q5O A;  1WZX A;  4BZ4 A;  2ZKN A;  4KGQ A;  4NWW A;  1UXX X;  2SLI A;  5BNP A;  5BNN A;  2WAO A;  2WN3 A;  3GZT B;  3FZ3 A;  3VKO A;  4LBK A;  2MNG A;  4FPO B;  4BA6 A;  1JYI A;  1O7F A;  1LRH A;  1YIP A;  1U5X A;  5DQ0 A;  1Y9M A;  1K45 A;  2GAL A;  3ZXK A;  3OUJ A;  4QPY A;  4QQO A;  1O8S A;  3NNJ A;  4CUC A;  3TB0 A;  2TBV A;  3KT7 A;  4GB3 3;  3ABZ A;  1K42 A;  4IV3 C;  4XAA A;  4ZU5 A;  2OUJ A;  2R7E B;  1UX6 A;  2WFF 3;  3BPS A;  2DVD A;  5T5L A;  3ZM8 A;  2BFU S;  5K9Y A;  1H4H A;  3THP A;  3FUQ A;  1VBA 2;  5IVY A;  5JR7 B;  4QX3 A;  4NMI A;  1FMD 2;  1ENS A;  1Y4W A;  2D6K A;  5A6Y A;  3MHZ A;  2I2S A;  2XL9 A;  2WZE A;  4AWD A;  3S5A A;  5LBB A;  1UPS A;  5FZO B;  4YGB A;  4F7Z A;  1GP4 A;  1DDL A;  2X10 A;  1N3Q A;  2IFR A;  1F2N A;  3GXU A;  3ZSL A;  2FBE A;  2NPI A;  2ZZQ A;  3GJB A;  4QQP A;  4X6R B;  5C5T A;  5LA1 A;  1PO2 2;  4AK3 A;  1JZ6 A;  3MID A;  4JVA A;  2WFF 1;  4ISR A;  2Y38 A;  4RQP A;  4CCE A;  1UZZ A;  1DYP A;  3AP6 A;  1YHF A;  2XXZ A;  4P9W A;  4XJ8 A;  3K4A A;  3WDW A;  4GWJ A;  2MHF A;  1IGO A;  2PYT A;  4YVW C;  2X5I A;  5FPV A;  1S0D A;  3V64 A;  3E5X A;  3MIB A;  4CP9 B;  4JTN A;  1ZBE 2;  4DIN B;  1XOY A;  2XVL A;  3FL7 A;  1S2B A;  4A4A A;  2BGO A;  2JIJ A;  3MFA A;  5IFP A;  1GMM A;  1HXS 3;  2DVA A;  4R52 A;  2IXK A;  1AL0 G;  5CFC C;  2BP6 A;  4FOW A;  4LPL A;  2XPJ A;  2W1Q A;  3LEG A;  1QGL A;  4P00 B;  4GH4 B;  4M3C A;  1HDK A;  5HPO A;  4IE6 A;  1LHO A;  2QQK A;  3ZYR A;  1EP0 A;  5FMO L;  4XAE A;  4DZG A;  5JXI A;  2FCV A;  1E5I A;  1PVC 2;  2RDQ A;  1LGB A;  3M70 A;  2A7A A;  5FO7 B;  4B1M A;  2V09 A;  1Q56 A;  5LW9 A;  1W2U A;  3MIH A;  4AXO A;  2XVG A;  3CJX A;  4LBN A;  2EAK A;  5ACA 2;  2ET1 A;  1DQ4 A;  1AYM 2;  3KWV A;  1QXR A;  3E6C C;  5F5C A;  4IE5 A;  4N9I A;  5A7S A;  4AOC A;  2VH9 A;  3NV1 A;  3GZE A;  4C90 A;  4XUN A;  2VG9 A;  1W2O A;  3KD4 A;  3LB9 A;  1SMV A;  4FQZ A;  4OUE A;  1OKO A;  3MIE A;  4LXL A;  3ZSE A;  1J3R A;  1SBE A;  1UOF A;  3TN9 2;  4W6W A;  5L9V A;  4BCU A;  4H3W A;  2HWB 2;  4D6R A;  3AP5 A;  3VKF C;  1FYU A;  1GKB A;  2O1Q A;  2WT0 A;  4MGY E;  5KWR A;  3C8X A;  1QMJ A;  2FD8 A;  1Y43 B;  3SH5 A;  2E31 A;  1WW4 A;  2ZGU A;  2LTN A;  4LIU A;  3ZO0 B;  4JCK A;  1H2L A;  1GR3 A;  3WUC A;  4COU A;  2XJU A;  4OI4 A;  1QQP 2;  4QX7 A;  5C3O A;  5FXW A;  4KWU A;  1FAY A;  3III A;  1PMI A;  4HVQ A;  3UGF A;  5A7P A;  3WDX A;  2AEZ A;  5A33 B;  1QXP A;  4O7X A;  5A1L A;  1SBF A;  2YRO A;  2JG8 A;  2A3X A;  3VD5 A;  2VZ1 A;  4DNY A;  4ZS2 A;  4RFR B;  5FJK A;  1X8M A;  2HJI A;  3HWJ A;  4DUV A;  2O8O A;  2Y6K A;  3PUA A;  3KVB A;  4AGV A;  1H9W A;  1FOD 2;  4AEJ A;  2ZX3 A;  3ZIX A;  1OBN A;  4AI0 A;  3S6P A;  4OQ8 A;  1R09 2;  3WIN E;  1A8M A;  1JOP A;  2QDN A;  2RS5 2;  4HET A;  4LK7 A;  4RA0 A;  3RI9 A;  3UJO A;  1LHV A;  5JIU A;  1GZC A;  4I0B A;  2A3Y A;  2C6S A;  3WCR A;  4JDN A;  2A5Z A;  4AFM A;  5SV8 A;  1UKR A;  2GMP A;  3AMN A;  4QD2 A;  4I0W B;  5A3W A;  4XVH A;  3V0B A;  5FPX A;  4N8M A;  3WW4 A;  1RJ7 A;  2VNO A;  2BGP A;  4DY5 A;  4E2Q A;  3K48 A;  3I2D A;  1CAX A;  1COV 2;  3V56 A;  5LY2 A;  2DWR A;  2RM2 2;  2DCY A;  4Q0V A;  1GWK A;  1ZZ8 A;  4IES A;  2D40 A;  1GNZ A;  5F39 A;  3TEZ A;  2VW2 A;  1NE4 A;  2B45 X;  5FZH A;  1ACC A;  1O6U A;  3HQR A;  4LKD A;  3K4D A;  4QPW A;  4LE3 A;  1L7Q A;  5EJZ B;  4BDV B;  5FYI A;  4FCA A;  1YIF A;  4YVS A;  5JR2 A;  5A7O A;  2GME A;  4JKM A;  3UES A;  5JMC A;  2WLQ A;  5A3T A;  4YM2 A;  1VB4 A;  5DUX A;  3U14 A;  1QOO A;  3LWC A;  2WZ8 A;  3ZLI A;  2CY6 A;  3I7D A;  3GBW A;  5T5J A;  3NJX A;  4S2D A;  4ASM B;  2PFW A;  4RHV 2;  3V0A B;  1NKG A;  4E27 A;  1VAV A;  3AKS A;  5LAT A;  1OLM E;  4Q0S A;  3LQC A;  4YM0 A;  2Y6G A;  5E88 A;  4AF9 A;  4XBQ A;  2BOJ A;  1GNH A;  2A3W A;  2ZGP A;  3I4I A;  4CA9 A;  1FX5 A;  2O8Q A;  2YC4 A;  3MW2 A;  4N90 A;  2JG9 A;  1ZNP A;  3PNA A;  4BQ2 A;  5CKQ A;  1HRV 3;  1V70 A;  1X36 A;  2D7F A;  2VY0 A;  5SV5 A;  2WNO A;  2ZX1 A;  1OQD A;  4N53 C;  4UF0 A;  3SMH A;  3POF A;  3PME A;  2ZGQ A;  2V72 A;  1VBE 2;  2AGS A;  4JGY A;  5FMO S;  4HXC A;  1WW6 A;  4OMC A;  4YW3 A;  1ZBA 2;  3K2O A;  4FXK B;  5A6Q A;  4XDP A;  1W2N A;  5JOX A;  4PF5 A;  4QX5 A;  2VCB A;  3FBY A;  4A6S A;  4P08 A;  4FTE A;  1H6X A;  3LSD A;  3MV0 1;  4JAA A;  5IT6 A;  4XUO A;  1VMJ A;  5E16 A;  3T2P A;  2J1A A;  2VUJ A;  4Y3O A;  3UKV A;  4BHP A;  2ZAH A;  2XQX A;  4O9G A;  4C0H A;  5JZG C;  1HRV 1;  5H9R A;  5A3M A;  2XJS A;  2VVF A;  1KXG A;  3ECQ A;  4XFC A;  1OD5 A;  1VBC 3;  5L7O B;  1XRU A;  1MS0 A;  3GCX A;  4XFB A;  5JLV A;  1C1F A;  1WA6 X;  2OPK A;  2RS3 3;  3F95 A;  4NHK A;  3SEE A;  1GZT A;  4HK8 A;  5LK7 B;  3KCC A;  3SKJ E;  5FYY A;  4CDW C;  1AR6 2;  2BV4 A;  2W1W A;  3OUI A;  4Q0U A;  4NIG A;  3NKT A;  3VBR C;  3WW3 A;  5LBC A;  3MV1 1;  3ZOI A;  1UZW A;  4R8H A;  5T5P A;  1WME A;  2JB4 A;  2VOV A;  2H0V A;  5FPB A;  3RJ2 X;  4FXG B;  2IFW A;  2DYC A;  1VBC 1;  4XQ4 A;  4Y22 B;  4ONU A;  2ZEY A;  2WII B;  3Q8B A;  2IWG B;  3ZYI B;  5I0R A;  1QDC A;  3USU B;  2CWS A;  1QJX 3;  1URX A;  2D6O X;  2RS3 1;  5C9A B;  4LBO A;  2ARB A;  1TME 3;  5FP7 A;  1Q8S A;  5K0U B;  2CDO A;  3MFC A;  3KGL A;  4OI2 A;  5LAS A;  4K20 A;  1PIV 3;  3P1I A;  1UQX A;  1BBT 2;  2A73 B;  2BBA A;  4HAN A;  4HPK B;  4XJ9 A;  4AHY A;  2QUO A;  2EAL A;  1STM A;  3J8F 2;  1Z7S 2;  2XLA A;  2FDI A;  3AJZ A;  3N4M A;  3KT4 A;  1NZC A;  1J3P A;  5CFD A;  1JHJ A;  4E9K A;  4EN9 B;  1QJX 1;  4IEQ A;  5A1F A;  3E6D A;  1QEX A;  4OCT A;  2A6V A;  1IKP A;  3LFI A;  4BJ0 A;  3VD4 A;  4Q0P A;  1UL9 A;  3PLQ A;  1PIV 1;  3QCW A;  2HBU A;  1UU4 A;  3I2J A;  2PHR A;  5AC9 3;  2ZGM A;  1JI6 A;  4QHB A;  1XSQ A;  4HN0 A;  4NPR A;  4FPF A;  4KH9 A;  3ATG A;  4XJA A;  4B8E A;  3O14 A;  5GM0 A;  3VBH A;  3VBS B;  3A0N A;  3AK0 A;  1W39 A;  3M3C A;  1X82 A;  5FUP A;  2FDK A;  4UYB A;  3ZSM A;  2UYB A;  3WHU A;  1NG0 A;  3CJI B;  1EUT A;  1RUD 3;  1C8M 2;  2QBX A;  4FPE A;  1OT5 A;  3MW3 A;  4XQD A;  5LBE A;  5E89 A;  5A80 A;  3P3P A;  4FBF A;  3HEI A;  4B29 A;  2H6C A;  5AC9 1;  2VQ0 A;  3LFM A;  4IV3 A;  2A70 A;  5FZE A;  4JTO A;  3FBM A;  2QQP A;  4Q26 A;  3WUD A;  5IK7 A;  3C7H A;  3NNF A;  4CCJ A;  1XE7 A;  4BIS A;  4FAG A;  4CSW A;  1VBB 3;  3QOP A;  4A7K A;  3ZXA C;  5CEH A;  3C7E A;  1KS4 A;  3O12 A;  2XHN A;  3N9Q A;  3S0M A;  1W6P A;  5DPN A;  1AR7 2;  1RUD 1;  3RZH A;  2ADE A;  2AEY A;  4BIO A;  1DZT A;  2HYK A;  4LA2 A;  1QH7 A;  4E8C A;  4AVB A;  5I8Y A;  3GBG A;  1W2T A;  3IZO A;  1YQC A;  5C8C C;  1DF0 A;  2B42 B;  2DCK A;  1CPN A;  2VXR A;  3AP9 A;  4FPY A;  4LO7 A;  4WM8 B;  5T50 A;  1O91 A;  1JBC A;  3WXP A;  1QJY 3;  3H8R A;  4EYU A;  1AYN 2;  2RR1 2;  4HLT A;  1OA3 A;  2LAL A;  3AFG A;  1VBB 1;  2VOT A;  4MGZ E;  1HV0 A;  4CXX A;  1MS4 A;  1S0F A;  2PTM A;  2IXJ A;  2ZX4 A;  3I59 A;  3PDQ A;  3PU3 A;  2DUR A;  4XAB A;  3TYJ A;  2YV8 A;  3OSD A;  4QKF A;  4XJW A;  1JH5 A;  2PHX A;  3OGV A;  4RR3 A;  4D7T A;  4DPN A;  4OI0 A;  3HR9 A;  4URT A;  2IXH A;  4Q4Y 3;  1KIT A;  1JZ7 A;  4PIZ A;  4K6B A;  4OUM A;  3LPG A;  2J1R A;  4AAX A;  1QH6 A;  4QDQ A;  2WUH A;  2XJT A;  3DXT A;  4FFI A;  1QJY 1;  4R9A A;  2YG0 A;  2F17 A;  4UWD A;  1CJP A;  2DFC A;  1GNY A;  3ES1 A;  5FPU A;  5FBZ A;  5I93 A;  1OUR A;  4XFA A;  5FYT A;  4R4X A;  5CBL A;  1EV1 3;  4JQT A;  3M3E A;  5G05 L;  4EN0 A;  2Y6H A;  3KCX A;  2OS2 A;  1DQ5 A;  3D0S A;  3PVN A;  3ZFF C;  4YAR A;  2RS1 2;  2VGD A;  5CVR A;  2ZPX A;  4Q4Y 1;  4R9D A;  5FR3 A;  1R64 A;  4Y1V A;  3GF6 A;  2DBN A;  1PZ9 A;  2D3R A;  1BQP A;  1S0J A;  1S0G A;  3BIW E;  3J7H A;  4AI3 A;  3T0D A;  4UBH A;  1TE1 B;  1GWL A;  5I0U A;  5FJH A;  2WA3 A;  1EV1 1;  4XZP A;  4CPB A;  4LKS A;  3HQX A;  4Q8K A;  3DKW A;  2AH2 A;  1CZT A;  2D6L X;  3ZYG A;  5BPX A;  1POQ A;  5F3C A;  2VO5 A;  2ZX2 A;  3H1M A;  4MH0 E;  1O4Y A;  2FCT A;  2HWD 2;  2HWE 3;  2JE7 A;  4RFT 0;  5DAX A;  2D43 A;  5DUU A;  5J7M A;  5F1R A;  4QWN A;  1YEW A;  1XYN A;  2WRA A;  4J25 A;  2A6X A;  2ATF A;  2SBA A;  5ERL A;  3RMY A;  4QU2 A;  3WCS A;  4HOO A;  2GU9 A;  3DEC A;  2RV9 A;  3Q8A A;  2WO7 A;  1GIC A;  2ZXQ A;  4Y4R A;  3PTR B;  1LOE A;  4UFL A;  4CUG A;  4ES8 A;  4FFH A;  1DLL A;  1TNR A;  3LA2 A;  4XJU A;  1TEI A;  2UU8 A;  5EYY A;  2W1S A;  4TXW A;  4XE9 A;  1REF A;  1XNK A;  4RGK A;  2WNV C;  1AZD A;  3WG1 A;  4NIH A;  3SLI A;  4ERO A;  4ZZ5 A;  4J6G A;  4Y5T A;  1RB8 G;  2XUM A;  3M3O A;  1XXN A;  3UYJ A;  4Y1X A;  1LOB A;  5GLT A;  1ND2 C;  3CMG A;  3O0X A;  2YPD A;  1CAV B;  1R1A 3;  1SDW A;  5IHR A;  4B7K A;  3NNL A;  2UWA A;  2PN5 A;  3AL6 A;  1UOB A;  1L7L A;  2DCT A;  2G9F A;  5JSO A;  1MEC 3;  3ASI A;  4HVO A;  3ON7 A;  4IDZ A;  4MO3 M;  3Q8E A;  1LHU A;  3G6J B;  3VD3 A;  1JYX A;  2AC1 A;  5A3L A;  1JZ2 A;  3O1P A;  4YW7 A;  4X6Q B;  3AZX A;  2XOM A;  4Q27 A;  1BMV 1;  5F5Q A;  1ZM1 A;  1AR8 3;  1PMH X;  2L9L A;  3BOW A;  1W05 A;  2WFP A;  4FFG A;  2WA4 A;  2JDA A;  3E6B A;  3HPN A;  3MPB A;  4QGM A;  4QM9 A;  2ZTN A;  5FYM A;  4YRD A;  3GHN A;  2RDR A;  4AED B;  2QNK A;  2JDZ A;  3RQ0 A;  1R1A 1;  4GKX A;  1PNG A;  1OOP B;  3HBZ A;  1MZE A;  2BZD A;  2PHU A;  1MEC 1;  1DQ0 A;  2D44 A;  4ZZ8 A;  5F37 A;  1SLL A;  3NAP A;  5FZM A;  1YFX A;  2YFU A;  5IW0 A;  1WWY A;  3H8U A;  2D3P A;  4FPJ A;  2D6P A;  3I2G A;  3WHT A;  1JOB A;  3WLU A;  2PHT A;  4CCD A;  1AR8 1;  4FTS A;  2Z42 A;  1Q8Q A;  3OEB A;  1MR5 A;  3OOX A;  4IE7 A;  5FYH A;  1IQD C;  1KGY A;  3RFR A;  3VBU B;  2VTX A;  4CDU A;  1ENR A;  3VHR A;  5FWE A;  5A70 A;  4XQW A;  1HX6 A;  2NYY A;  4L99 A;  4RD7 A;  2O14 A;  4R9C A;  1D0H A;  1A3K A;  1RUH 2;  5FLJ A;  3VZN A;  1DHK B;  3O0V A;  3I3B A;  4AVT A;  4XBN A;  2A6Z A;  3D0J A;  1UPI A;  3WT3 A;  1UZV A;  4IGO A;  2LRP A;  4JGZ A;  1QWR A;  4IEO A;  3H3L A;  2W1U A;  1W6N A;  1OVS A;  2G1M A;  2YY1 A;  3JBG 3;  2GC0 A;  4OYU A;  4OHZ A;  4AFC A;  4RN5 A;  3OGG A;  5BY5 A;  4YG6 A;  3OG2 A;  4D6S A;  2DFB A;  2HWC 3;  4XTM A;  1RUJ 3;  1DGW X;  5FZK A;  2EIC A;  1MVE A;  3M1H A;  5CNA A;  3WP6 A;  4CUA A;  1SFN A;  4LT5 A;  1X7N A;  2R49 A;  4B4Q A;  4C1X A;  3KM5 A;  5GLW A;  5ISL A;  3HT1 A;  3A22 A;  3NJZ A;  3EYP A;  3PUH A;  4M01 A;  4Z1V A;  1RVF 3;  2BGC A;  2X29 A;  3R0R A;  3KSC A;  1C3H A;  1SQ4 A;  3JBG 1;  1HB4 A;  3OY8 B;  4D0Q A;  1SFP A;  2JEM A;  4XBL A;  1OQ1 A;  4NII A;  3NST A;  2HWC 1;  1RUJ 1;  2YU2 A;  1PK6 A;  4L9B A;  1V9U 3;  2AAC A;  1WGP A;  1UF2 C;  5JXJ A;  2EXH A;  5GKA C;  1G7Y A;  5J37 A;  2RJK A;  5ANQ A;  1OA2 A;  2DVG A;  2BDR A;  4Q4X 3;  1RVF 1;  5CG8 A;  1C1L A;  5LK5 A;  4CYD A;  1B35 A;  2J1V A;  1R08 2;  4PQQ A;  2PAE A;  2BER A;  4IEW A;  3SEP A;  1W28 A;  3BUC A;  3R05 A;  4LBQ B;  3SH4 A;  2PLV 3;  3K75 B;  2B9V A;  3MPP G;  3VBO C;  3K46 A;  3I8T A;  2J1S A;  4CP1 A;  3D4K A;  3T09 A;  1V9U 1;  2DU1 A;  3J7N A;  2R6Q A;  1AL2 3;  4FT8 A;  4N53 B;  1NCQ B;  1HQL A;  2QQO A;  4W6Y A;  3VDD B;  1XU1 A;  4JDM A;  1SLB A;  4CDX C;  2GNM A;  1W0O A;  2VE1 A;  4IGP A;  2B39 A;  2HYX A;  4H14 A;  1C57 A;  2CAV A;  4K8R B;  1VLN A;  2YDE A;  4Q4X 1;  5C33 A;  3VBR A;  1CAU A;  5F6K A;  3CNA A;  3DKQ A;  2F4L A;  4HSL A;  4MGQ A;  5KC5 A;  5E1R A;  2PLV 1;  2KA3 A;  5JZG B;  3JB4 C;  3IMM A;  2CL2 A;  2WZR 2;  5L7O C;  2D5H A;  1JYV A;  2CGN A;  2Q8E A;  3WY6 A;  2X8K A;  1AL2 1;  1W90 A;  1CJD A;  1BXH A;  3CO2 A;  1SZB A;  4A3Z A;  5JIA A;  3OYW A;  3ZMO A;  3OCP A;  5DDJ 3;  5FUI A;  3APB A;  2VCM A;  3NJY A;  3ZN6 B;  4MHU A;  5JSP A;  3NMB A;  2MEV 2;  2VQU A;  2XHK A;  1ND3 A;  4BQW A;  4D8M A;  3O1O A;  5IWF A;  4WV8 A;  2GMM A;  4WM7 B;  3UKT A;  3DPR A;  3RYR A;  2VZT A;  1V6M A;  4RGA A;  4OUL A;  1ENQ A;  1OI6 A;  3JD7 3;  4COZ A;  3IN9 A;  1GOH A;  2K46 A;  2D97 A;  5CZK A;  4BXS V;  3SIT A;  2R16 A;  5C6C A;  1HV1 A;  1OUS A;  4WVW A;  5C9A C;  1NA1 B;  1SLA A;  2WQZ C;  4LUK A;  4JRA A;  3OGJ A;  4A41 A;  3KHB A;  1JYT A;  3SCF A;  2QQL A;  5DN2 A;  4CVU A;  5EJ3 A;  1ZZB A;  4Z2W A;  1RUG 1;  4LLO A;  4LO6 B;  1C5I A;  1WCS A;  4XIL A;  5LB6 A;  4AZZ A;  4R4Z A;  1NXD 1;  1IZ3 A;  3JD7 1;  3AVS A;  3B00 A;  1F4A A;  4XFG A;  4WVM A;  1Y9Q A;  4LBL A;  2Y64 A;  4L0P A;  5HV4 A;  1CD3 G;  4E4S A;  1LNS A;  5H9Q A;  3WQ7 A;  1CZV A;  4L11 A;  4GQ7 A;  5KXE A;  2ZHN A;  5T3N A;  4UFJ A;  4Q4W 1;  3ZSJ A;  4YFZ A;  1HN1 A;  4KBZ A;  1VBD 2;  2JDN A;  1MZF A;  5GZC A;  4DXZ A;  2ZGT A;  5GZF A;  2OXB A;  4X8N A;  1TVG A;  4QPI C;  4XDQ A;  5IVJ A;  4FOV A;  1UN1 A;  3POY A;  1NCR A;  1WW7 A;  2XWB B;  5D1I A;  2ZHM A;  3CL1 A;  1BK1 A;  3GJA A;  4AQ2 A;  4DY3 A;  5M0T A;  1UO9 A;  5CIS A;  1R1Z A;  4LHN A;  5FOB B;  3CZU A;  4HG6 B;  3CJI C;  2JDU A;  4GA9 A;  1US3 A;  4XCB A;  4CEW A;  1OFS A;  1DP0 A;  3AKP A;  3QLQ A;  4AYU A;  4D7Y A;  2P3K A;  2A6Y A;  1DFQ A;  1T2X A;  3S30 A;  4L2N A;  4Y1U A;  2WAA A;  1SEF A;  5J09 A;  1PZ7 A;  2NM1 A;  2JDM A;  5F2W A;  5FZ4 A;  1GBG A;  3MGU A;  3LEI A;  5FLI A;  5B2G B;  3VLB B;  2YXS A;  2P34 A;  1O3R A;  2VL4 A;  1QIQ A;  4W50 A;  1S2K A;  2OQ6 A;  1RUF 3;  4PDW B;  1LED A;  5FZO A;  4G9S B;  1D2S A;  3KV4 A;  5A3O A;  3LGR A;  1DGL A;  1WCD J;  1WKY A;  2BNN A;  4WM8 C;  3O1T A;  2F6B A;  1F4H A;  1D4M 3;  3DL3 A;  1WLT A;  3KGZ A;  2YB7 A;  2WN2 A;  2E32 A;  2UY8 A;  5ABJ C;  1AVB A;  2WFF 2;  5C8C B;  4Y5S A;  1UXZ A;  4P9X A;  5B4X A;  3RZZ A;  3EHK A;  3SNM A;  5GAL A;  1UY0 A;  1RHI 3;  1RUF 1;  4PQ9 A; 
#chains in the Genus database with same CATH homology
 3WNL A;  1JU4 A;  1PMJ X;  2Y6J A;  3NRU A;  4DEQ A;  3NJX A;  1NKG A;  2RJ2 A;  5DMY A;  3LQC A;  3VD9 A;  2Y6G A;  3FN9 A;  4W8J A;  4OZO A;  1JZ3 A;  5JXG A;  2ZEX A;  1UX7 A;  4A42 A;  3LEK A;  2YC4 A;  3D3A A;  1H6Y A;  1SHW B;  3K4Z A;  3C7O A;  3VDA A;  3OGS A;  1UY1 A;  5I0D A;  2V72 A;  2VZP A;  3OB8 A;  4LHS A;  2ZEW A;  4OMC A;  1OH4 A;  2VCB A;  1JZ8 A;  4P08 A;  1H6X A;  3MV0 1;  3THC A;  2Y6L A;  4XUO A;  2V5D A;  3T2P A;  2J1A A;  3BGA A;  3CDZ B;  2J7M A;  2XQX A;  3MBW A;  3I2K A;  3VDB A;  1XC6 A;  3ECQ A;  3K77 A;  2X05 A;  1RYY A;  3SEE A;  4JKL A;  2VMF A;  2WAB A;  2YC2 A;  3SKJ E;  3ETP A;  2W1W A;  2PQS A;  4QDR A;  3T0B A;  3MV1 1;  2J1T A;  3MUZ 1;  2CDP A;  3SKV A;  1PX3 A;  1SG3 A;  2ZEY A;  1WCQ A;  4KMQ A;  2E26 A;  2J22 A;  2Y8K A;  2CDO A;  3WQB A;  5J1X A;  4A6O A;  2VZR A;  4QX0 A;  3WF4 A;  3P1I A;  4YPJ A;  2OKX A;  1CIY A;  2W47 A;  1UY2 A;  2BBA A;  1UMH A;  2VM9 A;  3WF0 A;  2VCC A;  5EIY B;  3GGL A;  3NNG A;  4ET7 A;  3IDA A;  1JHJ A;  4BK4 A;  1W99 A;  1DLC A;  4FI9 A;  2W94 A;  3THD A;  1UZ0 A;  4BJ0 A;  3VD4 A;  1EUU A;  3NQH A;  3WNK A;  3OGR A;  4MOA A;  3I2J A;  3HNM A;  1JI6 A;  3DYP A;  1UYY A;  2VCA A;  3GDB A;  3WSO A;  3CZJ A;  2X09 A;  2ID4 A;  2VZS A;  4CU6 A;  2J1E A;  2V4V A;  3W5M A;  1CX1 A;  1EUT A;  3I3E A;  2QBX A;  1OT5 A;  3HEI A;  1K12 A;  1GQP A;  2W95 A;  3MUY 1;  1CZS A;  1D7P M;  3C7H A;  3A23 A;  3LE0 A;  2W5F A;  3OBA A;  1JYN A;  3C7E A;  2XHN A;  2EIE A;  5DPN A;  5CYY A;  1NX9 A;  4BK5 A;  2VTF A;  5JUV A;  2DDU A;  2WO3 A;  4E8C A;  4M4R A;  2DCK A;  2QQJ A;  1NAE A;  2VZO A;  4JKK A;  5G04 L;  2VOT A;  2EIB A;  2HLE A;  2VMD A;  4PF1 A;  3F2Z A;  4DEV A;  3OGV A;  5IYY A;  3VDC A;  2VC9 A;  1JZ7 A;  2WYS A;  3LPG A;  2J1R A;  4QDS A;  4AAX A;  4QDQ A;  4MAD A;  3IB3 A;  2WUH A;  5IJR A;  2YG0 A;  1GNY A;  3ACG A;  1GUI A;  2C26 A;  5G05 L;  4CU9 A;  4W4Z A;  2Y6H A;  3DYO A;  3HJR A;  2ORZ A;  3AC0 A;  4IUG A;  1JU3 A;  4DXT A;  1R64 A;  2C9K A;  3EB7 A;  3I97 A;  3T0D A;  3J7H A;  3C7G A;  1JYW A;  1OF4 A;  3UNP A;  3WF3 A;  1TG7 A;  3ACI A;  4ZXE A;  4E8D A;  4CU7 A;  4LKS A;  4XUT A;  1CZT A;  3HNB M;  1K3I A;  2VO5 A;  1O8P A;  4TTG A;  4RYD A;  1DYO A;  3VD7 A;  3WNN A;  1YQ2 A;  3DEC A;  2RV9 A;  3CKH A;  4KI5 M;  2ZXQ A;  5F7U A;  3HNY M;  3T08 A;  2E33 A;  2W1S A;  2W3J A;  4TXW A;  2QQM A;  1W8N A;  4DXS A;  2RVA A;  4ZZ5 A;  3IAP A;  4GZ9 A;  4DXR A;  3CMG A;  5IHR A;  3UET A;  1OF3 A;  1US2 A;  4JHZ A;  4ARY A;  3WNO A;  4MO3 M;  1GOG A;  1UMI A;  1SDD B;  2JKX A;  3VD3 A;  3U37 A;  4P02 B;  1JYX A;  1JZ2 A;  5JXH A;  2XOM A;  2KD7 A;  1PMH X;  2L9L A;  2JDA A;  3HPN A;  1JZ5 A;  5JMO A;  1GU3 A;  2WBK A;  3PUI A;  3I2H A;  2VJX A;  5A1A A;  3BN6 A;  2J1U A;  5LA2 A;  2VMC A;  2W92 A;  2BZD A;  2VZQ A;  4ZZ8 A;  3HOB A;  5EJ1 B;  2YFU A;  3ZM8 A;  4QAW A;  1GOF A;  1NUK A;  5C70 A;  5LA0 A;  3I2G A;  4DUW A;  1BHG A;  3OEB A;  1IQD C;  1KGY A;  3WF2 A;  4LQR A;  2WDB A;  3NJV A;  2WO1 A;  2C4X A;  1W0N A;  3I3B A;  4UI9 L;  2ORX A;  1JZ4 A;  4PT6 A;  4GWI A;  2W1U A;  2W87 A;  4OYU A;  5B4N A;  4RN5 A;  2JE8 A;  3OG2 A;  3T2O A;  4M4P A;  2B4K A;  3GM8 A;  2EIC A;  4CUA A;  1UXX X;  3LPF A;  2WAO A;  2WN3 A;  4UAP A;  3A22 A;  3PUH A;  3EYP A;  5DQ0 A;  1K45 A;  4Z2A A;  1O8S A;  1UWW A;  2VME A;  4D0Q A;  4CUC A;  5C71 A;  3ABZ A;  1W8O A;  1K42 A;  2R7E B;  5JXJ A;  1KEX A;  3WF1 A;  4QX3 A;  4JX0 A;  2QQI A;  2W9X A;  3ACH A;  2WZE A;  1L7R A;  2J1V A;  2X10 A;  4PQQ A;  3GXU A;  2BER A;  3IAQ A;  2WQ8 A;  4QB2 A;  3SEP A;  4A45 A;  3K75 B;  1J83 A;  2B9V A;  3OEA A;  3HN3 A;  5LA1 A;  1XNA A;  3K46 A;  2J1S A;  1JZ6 A;  3T09 A;  4ZY9 A;  4QB1 A;  2QQO A;  2VQT A;  3K4A A;  4GWJ A;  4QB6 A;  4CUB A;  2HYX A;  3FL7 A;  4A4A A;  2BGO A;  4MGQ A;  5IFP A;  1GMM A;  2ZEZ A;  2Z4F A;  1JYV A;  4LPL A;  2W1Q A;  3LEG A;  4P00 B;  5HPO A;  3A7Q A;  2VR4 A;  2QQK A;  2JD9 A;  3T2Q A;  3FHA A;  4A3Z A;  5JXI A;  1XNT A;  5FUI A;  1ULP A;  2VQU A;  4D8M A;  3I2F A;  3WEZ A;  2VZT A;  4QX1 A;  2YFZ A;  1GOH A;  5C7G A;  4XUN A;  5CZK A;  1UYX A;  4BXS V;  2DCJ A;  2QQN A;  4OUE A;  3T0A A;  2VZV A;  4A41 A;  4XUR A;  2QQL A;  5DN2 A;  4MGS A;  4CVU A;  3A21 A;  2LW8 A;  3C8X A;  2E31 A;  4AG4 A;  3ACF A;  1W9W A;  1F4A A;  2Y64 A;  4L0P A;  1W9S A;  1LNS A;  3JXS A;  1CZV A;  4KWU A;  3III A;  4XZU G;  1O59 A;  2WO2 A;  1OD3 A;  4QX2 A;  1HN1 A;  2VZU A;  1J84 A;  3VD5 A;  4A44 A;  2LS6 A;  2W91 A;  2VZ1 A;  1UY3 A;  1TVG A;  3WNP A;  4DUV A;  2Y6K A;  1MPX A;  3I2I A;  5IFT A;  4CU8 A;  4UOJ A;  3CQO A;  4P5Y A;  3CZU A;  3FHQ A;  1W9T A;  3CIH A;  4HG6 B;  2EID A;  4XUQ A;  1US3 A;  1DP0 A;  3DYM A;  3C7F A;  3E1F 1;  1ULO A;  1T2X A;  4XUP A;  2VZ3 A;  2WAA A;  4XVH A;  5HXM A;  3W5N A;  2BGP A;  1UY4 A;  3WNM A;  3LEI A;  4ARX A;  2W46 A;  4OMD A;  2VL4 A;  4W50 A;  1WKY A;  4DUX A;  3P6B A;  3K4D A;  4QPW A;  1L7Q A;  3MO4 A;  1F4H A;  5EJZ B;  4BDV B;  1I5P A;  2YB7 A;  1PX4 A;  2WN2 A;  1P8J A;  2E32 A;  5JR2 A;  1XPW A;  4JKM A;  3UES A;  1UXZ A;  1UYZ A;  2XON A;  3I3D A;  5B4X A;  1UY0 A;  5LCW L;  2WZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...