3ITQA

Crystal structure of a prolyl 4-hydroxylase from bacillus anthracis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
198
Chain Sequence
KEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLADVNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Prolyl 4-hydroxylase, alpha subunit domain protein
publication title Crystal structure of prolyl 4-hydroxylase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis str.
total genus 57
structure length 198
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3itqA01
3PL0A 4NHMA 3OBZA 3GJBA 4NHYA 4J25A 4BQXA 3KT1A 4NMIA 5LBCA 5ERLA 5IAXA 5HV4A 5EP9A 5LA9A 2RDRA 4XACA 4IW3A 2G1MA 4XAAA 5DAWA 2RDNA 3OUHA 2HBTA 2Y33A 5IAVA 5C5TA 4ZONA 5C5UA 3GJAA 4KBZA 5IATA 5M0TA 2HBUA 4BQYA 3NNJA 2V4AA 3GZEA 4NHXA 3EMRA 2OPWA 3KT7A 3NNMA 5L9VA 3NNLA 2JIJA 4XCAA 5DAXA 4XABA 4Y5TA 5EQUA 3OUJA 5LASA 5HV0A 5L9BA 4Y5SA 4XC9A 3W20A 3KT4A 3MGUA 4JZRA 4NHLA 2Y34A 4ZPIA 2JIGA 4Q5OA 2FCVA 3BVCA 4NHKA 3W21A 5L9RA 5LBFA 5LATA 3DKQA 4MHRA 4MHUA 3NNFA 2RDSA 2FCUA 3ITQA 4UWDA 2G19A 3HQRA 5DAQA 2FCTA 5A3UA 2RG4A 5LB6A 2A1XA 5DAVA 3OUIA 5LBEA 5EPAA 4XCBA 2RDQA 4BQWA 5LBBA 5DAPA 3HQUA 4NAOA
chains in the Genus database with same CATH superfamily
4NRPA 4KMQA 2QQVA 5LRRA 1PZ7A 1IHMA 5GLTA 2VTXA 3DECA 3R4SA 4RS5B 1XNDA 5GZFA 3VBRA 2A75A 5JSRA 2VW0A 1RUF2 1UY1A 1B09A 2J1EA 2PHXA 1AR81 2ID4A 4ARYA 4LT5A 2VZSA 2EA7A 2VMEA 3POWA 1ASJ2 3V0AB 4BQ1A 4AVAA 2GP3A 4XACA 5F37A 4FTEA 1RUG3 3RYKA 3MLLA 1OKOA 2RMU3 3LSDA 1DHKB 4XAAA 3B00A 4YW1A 1UMIA 2YFUA 2RDNA 1JHJA 1SDDB 3SEEA 1ZZCA 4RR3A 5IVCA 2XLFA 3RZLA 2H0VA 3URFA 3WHUA 3ZOIA 4HN0A 2BOIA 4LTAA 4ISQA 2OQ6A 1Q43A 2WA3A 5F3GA 3ZFFB 4L2NA 5HBAA 1F31A 3P3PA 2BFUL 1ODNA 4ZXEA 1G6NA 1BQPA 3S5QA 3NO8A 4P14A 4EZ4A 3NMBA 4DINB 3JB4C 5LCWL 4BQYA 2VNGA 2C26A 1S0JA 1VBD2 2JKBA 2WS93 3NV4A 1WD3A 1HQNA 3LEMA 1MS9A 1YFUA 1OF4A 1CZTA 3S7IA 4AR2A 2WWSA 4LA3A 2QQUA 5I8YA 2XG3A 3KD4A 2D6NA 4Y26A 1ENSA 5FK7A 2VOVA 4HG6B 1VB2A 2F6BA 4LR4A 4Z82A 5IJRA 1CR7A 2GNBA 1CZSA 1XU2A 1UOBA 4EWAA 2NM1A 2ES3A 4XUQA 4NE9A 2LALA 5EQUA 2GMEA 3AP6A 1AR83 3DEMA 3ZN6B 1R1A2 5DN2A 1KQRA 3ORJA 1GZWB 3LIHA 1VB4A 4QX0A 1HV1A 4I01A 1LGCA 3VBUB 1PZ8A 4GMP0 1XE7A 4CXYA 3JZVA 4YFZA 1JUIA 3PVBB 1KFXL 5J37A 2A5ZA 3WF1A 2EIDA 4XJ8A 4Q2FA 4XMAA 2P3IA 2WJSA 5IVVA 1PHMA 2IXKA 2WO2A 4N43C 1OA4A 1ZRRA 4XHBA 1SPPB 1DU3D 2GU9A 2DFCA 4BCUA 2HYXA 1BZWA 3W58A 1W8ZA 3WW2A 2VXRA 2CAUA 4AI9A 3MPPG 1WLCA 2Q1MA 3VB9A 2R7EB 3ZMOA 2CGNA 2BZDA 5CYYA 2R041 5DMYA 2JG8B 4A7KA 2GZWA 1IS5A 4MOAA 4M0HA 4MXWB 1KFUL 2XLGA 1U12A 4AXOA 2XQRA 3KVBA 2EIGA 4EN0A 3ZFGC 4JGYA 4I3GA 3THPA 3VL8A 2EXKA 5F5AA 1F8VA 4M0NA 1NX9A 1FYUA 1ZA7A 5FZMA 3K46A 4YM1A 1S0DA 1NLSA 2GNMA 3OG2A 1PGL2 5FKCA 4KNCA 4AEJA 4IV1A 1OT5A 2DCZA 3USUA 4Y1YA 2AGSA 2LS6A 4HSLA 3ZXJA 3VHPA 3AMNA 1XPWA 2ZMNA 4DIQA 1KJLA 4GH4C 1AJKA 2XPJA 3VKOA 1C3HA 4E4ZA 2BBAA 3M3IA 1YYNA 4JDOA 2XR4A 4ZS2A 1GUIA 3NRUA 5E89A 4EROA 4F7ZA 3RZMA 5BYNA 5C9AB 1RGSA 2CGPA 1V6IA 4I3PA 5G05L 1AR62 1VBA1 2A3XA 3LA7A 4JRAA 1POV0 1WCKA 4TWTA 3VZOA 1N3OA 4ASLA 3OPTA 4CCMA 1YUDA 1IZ3A 1Z78A 3EXUA 3U11A 2GALA 2G9GA 2YUEA 1AX1A 3JD72 5KXBA 1LENA 4C1WA 1W2OA 4LNVA 1RJ7A 5FAXA 4LPLA 2VBPA 1AYM1 4RD7A 2X29A 4V1PA 3HT2A 4O65A 3N9OA 1E5HA 1J1LA 1Q3EA 2R062 2R043 4GMP1 1FMD1 3RYPA 3WCSA 5HPOA 5C5TA 1LOEA 3MZHA 1JYTA 4AFCA 1J59A 2W91A 2JDZA 1PO21 1DZQA 4BMBA 3AP9A 5FZIA 1MZFA 4FPJA 4XJ9A 4B8EA 2ZZQA 3OGGA 2K0GA 1QOTA 4CCOA 1LGNA 1RMU1 2V4AA 2HYKA 1LOGA 2BBVA 4CZSA 4LBQA 2V73A 4NHXA 4AI3A 5D8AC 2HLEA 1CAUA 2KXLA 4XMIA 5A7WB 3O1TA 5L9VA 5JWPA 4ET7A 1X9TA 3RVHA 1YQ5A 4DY5A 3OY8A 5JZGB 1XSRA 3H9AA 5DPNA 2NP0A 1OFNA 3QBQA 1SFYA 5H9PA 4XABA 5D2AA 5JOYA 1W9WA 1W03A 5BNPC 2E51A 2ARXA 1OPOA 3RWNA 5JOWA 1G86A 4Y1XA 1HX6A 1ND2B 5CB7A 4AVVA 1NA1B 4Y1ZA 1VBA3 1O8PA 1BBT2 1HQWA 4A44A 3N9LA 4W50A 4GZ9A 3LEIA 3N7LA 3SHRA 4P02B 5LA1A 1LEMA 1HLCA 4IXLA 2RHPA 4XJWA 1C57A 1URXA 3CMGA 4QPGC 2BV4A 1UWWA 1AYM3 1CPNA 1H30A 2OKXA 3ZPYA 1GZTA 5FQ0B 4GMP3 2OX0A 1FMD3 4WVMA 4YRDA 4AEMA 1I1EA 3BB6A 3FJSA 5LW9A 3UESA 4YZ1A 3B9IA 3KVAA 5FO7B 2WNOA 1PO23 5I0UA 4CUBA 3IWZA 3VBHB 2NZ9A 3CJXA 3DPRC 4CCNA 2A71A 1JZ2A 2P2KA 4OLLA 4OHVA 4DEQA 1SDWA 1GV9A 1GZ9A 1PX3A 1RMU3 2UYAA 2VZUA 3OBTA 3T3YA 1LHNA 1POV1 3ZSLA 1A3KA 1TZOA 1S0BA 3POFA 4Y33A 3RMYA 4CU6A 1JUHA 1AL0G 4WM8B 1H2KA 4CP0A 4DXSA 1BCXA 4FI9A 1DQ4A 3IPVA 1V9U2 3I2DA 4Y4RA 5AFEA 1FNYA 4YVWC 1FT9A 2VOXA 3BYWA 4CDQB 2VUJA 1A78A 5FO8B 4HSJA 1XNTA 1H8TB 1EAH1 1MQTA 3PUIA 3IN9A 4PLMA 3CBNA 4QQOA 5FP8A 5JOZA 3U78A 4BQ4A 1TNRA 3Q9OA 5A3PA 1UNBA 1ENRA 2JDHA 4FCAA 4OHXA 4QPIB 5LBBA 4PDWB 3WNNA 4EN8B 4NOTA 5SV5A 1ZZ7A 2QTWB 1OF3A 4LO4B 5F8PA 2J7MA 3TEYA 1YXWA 1ZBA2 3TN92 4NHYA 4QGLA 2SBAA 4HPKA 4YGDA 1AR71 4QM8A 4O61A 4W6XA 1RHI2 5BXXA 1PX4A 1ZM1A 1CX1A 1YJKA 3MIBA 1OOPA 5JSOA 1ODMA 4LK7A 4GB32 1IKPA 1KS5A 3C7HA 2E32A 2FZ1A 4Q4V2 1GNYA 2JXAA 1QXRA 1AYN2 5EV7A 4BB3A 1UOFA 5K0UB 1SHWB 3POSA 4AAXA 5BNNA 3MYXA 1DLCA 1POV3 1UO9A 4LHSA 4XYXA 1DGWX 2HWC2 2HWB2 3IDBB 2H6BA 4LBKA 2C9KA 1ZZBA 5FP7A 1WW5A 1LOCA 3A23A 4OZOA 5CFDC 1OH4A 1UX7A 1W3XA 4AVSA 3I2OA 3Q8EA 3RI9A 4AWDA 4Q0UA 4COZA 1EAH3 3JB8A 1C8NA 2GSYA 3DKWA 4YVSB 3WP5A 1UY3A 3ACLA 1DQ0A 3AVRA 2JWPA 2BQPA 2WABA 4JTOA 1DLLA 4KU7A 1DZTA 1VRH1 4RA0A 2Q8EA 3VBSA 5JCTA 4LIUA 3N9PA 4GULA 3E1F1 3NWKA 4TLFA 4XXPA 1HDKA 5E16A 1W3VA 3TB0A 2MEV1 1C8M1 2Z79A 2P3JA 1AR73 4MGZE 2BGOA 5IVFA 4TYSA 4XETA 4DUWA 1C1LA 5KHIA 1W05A 3KGZA 5GZCA 2ZTNA 2RS11 4URTA 5A1FA 1NCRB 2VD7A 2JG9A 4OYUA 4UT5A 4Y5SA 4Z07A 3PUQA 2OQ7A 2VZ3A 2WL1A 3AKRA 4IEOA 2H6CA 1XJAA 4XF9A 4CCCA 3SH4A 1UYXA 4IDZA 3MGUA 4JGZA 3WDTA 5JVVA 4DXRA 2VMIA 5FMDA 2ZKLA 4IEYA 4OI1A 2VBDA 2VW1A 2WNUA 3N9NA 5FP4A 3THDA 4YSFA 2FDGA 5FXWA 3SLIA 1K45A 4JTNA 4PBPA 1LHUA 2JIGA 3AFGA 1OD5A 1UYPA 1DYPA 3WX5A 5C8CA 3ZSJA 4AYUA 5BNQA 1H4GA 1CAVB 4Q0VA 4LBJA 3J26N 4UYBA 5CIRA 2Y6LA 3UJQA 4MHUA 1AX0A 4S2HA 4EZHA 3MV11 1VRH3 1SLIA 4QX7A 5GZGA 2FCUA 4QKBA 5A6YA 4UW6A 5FZDA 3SXWA 1ZNPA 1FOD1 2WC2A 3NKTA 1XYOA 4RHV1 4OHYA 1ZZ8A 3WY6A 3OEAA 4QGMA 2MEV3 1C8M3 1RUI1 2D5HA 4CEYC 1BLZA 1OA2A 2OW4A 2WZEA 3H42B 4GALA 3UJOA 1NCQB 4D6QA 5DUVA 3BKZA 1YNAA 3J7HA 2VQTA 1XQNA 5JXJA 2VUCA 2RS13 1OH3A 5FXXA 2A70A 1UD1A 5DAPA 4E8DA 2XJVA 4M3CB 3ZDSA 2HEWF 4DXZA 3RMXA 2PHFA 5HXVA 4PQ9A 3J8F3 4L9BA 4MGYE 3SKJE 4QWNA 3TNQA 1XE8A 4Q8KA 2K2SA 4AGVA 5FYMA 2A6YA 3VZMA 4Y1UA 4CCDA 4CXXA 4LOSA 3WVJA 5FPLA 3N9QA 3AKSA 3CEWA 4I30A 4XBNA 4XUTA 3POEA 1WCDJ 4N53B 2IXLA 4Q0SA 3ZYBA 3UYJA 4ISRA 3FFZA 4HOOA 4KWKA 5D1IA 2WWJA 2JECA 4WM7B 2ZMKA 5FBJA 4JDMA 4LE3A 4LITA 4B1MA 1Q8VA 4OHWA 4M01A 2Q8OA 1KS4A 4RHV3 3OGJA 2PAEA 3FBMA 4XE9A 1RUI3 2DWRA 2O14A 4N43B 4LJHA 4CP9B 4KH9A 4D7YA 3VBUC 1QJFA 2WSUA 3GF6A 2WN3A 3IB3A 2VW2A 3TOJA 1HW5A 5JI9A 2KD7A 4LKDA 4CEWA 1DG6A 2ZPXA 4CPBA 1QMJA 2WQ8A 3ZLIA 4BU2A 2DVFA 1MVEA 2DTYA 1WW6A 5C7GA 1ZRDA 2FBEA 3ON7A 5A3TA 3RZZA 1G9CA 1W0OA 3EMRA 3GZTB 1WGPA 1POQA 2AUYA 4R4ZA 1HRV1 4GWNA 5ACA1 2Z69A 1XXNA 2XJQA 1YFXA 3MFCA 2OYZA 1U5XA 2PFWA 2VZOA 3ZFGB 2ZGLA 1UZYA 4IE0A 1DQ1A 1SLLA 4JKKA 1YQ2A 2RJ2A 1UY2A 2VVEA 1LOBA 1RUJ1 2W2IA 5FZ1A 5BPXA 5L9BA 3LE0A 5J3UA 1J84A 1PM7A 1RUC2 2VOTA 4Q1PA 4QHBA 1SG3A 1Z0HA 2I74A 2ARBA 5FR3A 3JBG1 4N90A 5FY9A 4XBLA 3IM0A 3MLKA 4IEVA 4NUBA 4XF0A 5FZHA 4QPWA 1EY2A 2Y60A 3LA3A 4HL0A 2VMCA 2QCSB 4GH4B 1RUE2 3MF6A 3IDCB 1WMEA 4Q4X2 1LHOA 1UPIA 1MACA 5CG8A 2XUMA 2P5BA 4C0HA 2DVAA 4HT1T 2ARCA 4P5YA 1H6XA 4XUPA 1NYWA 1DBNA 3B9CA 3QCWA 3CLPA 5A70A 3WNOA 4W8JA 5LZ6A 1GYKA 3ZKUA 5C4WA 5J48A 4D7SA 1PM4A 2AZ5A 3ETQA 3HBZA 1V6NA 2A3WA 3MW4A 3NAPB 4LKEA 5GLWA 2B46X 1Y7BA 1JN2P 2JEMA 5AVAA 5FYBA 2ZABA 3BOWA 3ZFEB 3GM8A 3D0JA 1EPWA 3ITQA 4OFGA 1HRV3 2BWCA 5FKBA 2R072 5ACA3 3V0BB 2XMLA 1RITA 3ZXLA 1FATA 2L9LA 4ZU4A 3VBFC 5FZBA 5TSWA 3B02A 2OZ6A 3PMSA 1AL21 1DF0A 3FBYA 3PUHA 5DG2A 1F4AA 5LBEA 1LU2A 5IVYA 3MW3A 1RUJ3 3ES4A 1SFNA 2DBNA 1R092 2ZHNA 4PIYA 4LO8A 4FFGA 3JBG3 3HQUA 1JOJA 1K5MC 3IZOA 1I3HA 1ONAA 1HXS1 3JQWA 2QNKA 4L0PA 3WF4A 3RS6A 1RIRA 5A6XA 4FP2A 5FYZA 5BNOC 4FFHA 1HB4A 4GIQA 4V2WA 1U0AA 2BYVE 4A4AA 1ULPA 3DYPA 1QNYA 2VUAA 4XHXA 1AVBA 3T4VA 4HBNA 5FXVA 1XYNA 2ZCWA 1SLTA 2NQYA 2QQJA 1ND3B 3JUUA 4EYUA 2BUKA 3Q8CA 5JZGC 2R1DA 3OGRA 2A73B 2YZ4A 3D5OA 4IW3A 3VKLA 1VPHA 2WNVC 5KC6A 1LB2A 1QU0A 2DUPA 3AYCA 1UAIA 4JQRA 4LULA 1A8DA 2RJKA 4XW3A 4BH9A 5JXGA 1ND2C 3K3NA 1LR5A 1I9RA 2C4XA 2LTNA 2RR11 1RXFA 1TME2 4B29A 2XVKA 4ZZ8A 2X5IC 2IWGB 4OZXA 3WQ7A 1AL23 1GICA 4YFWA 1D0HA 1IPSA 3PUAA 1REFA 3O1PA 3ZR6A 1A34A 5LY2A 1VAKA 3NNJA 4LBOA 5T5LA 2JDMA 1UQXA 4Y20B 5CA6A 1HXS3 2A6ZA 2VGDA 3VBHC 2AEYA 1F4HA 2JIJA 4XCAA 3HNBM 3BTZA 3PJQA 2R0HA 4JHTA 4XIOA 3ZYRA 1O5LA 1AF9A 1BXHA 2MNGA 1J58A 3HBKA 3H1MA 3FLRA 4CDWB 2Y6JA 1O91A 2XWBB 3JXSA 3SMHA 4HK9A 2P34A 1VBB2 5APAA 1VRBA 2BNMA 2AENA 2W1QA 2WA4A 1DCSA 3ZYJB 1QQP1 1SMVA 2XBO1 1KGYA 5FZAA 4B1LA 4CDQC 1QY4A 4CDXC 4NRMA 1KEXA 1IPJA 4JKMA 3M1HA 2RJLA 2UYBA 5HI0A 4PF5A 4XDPA 4RS5A 1ZZ6A 1RUNA 4QDQA 1GKBA 3CHXA 3PURA 1E5RA 2GC0A 4R9BA 3LZZA 5J98B 3ZSMA 5FDBA 1BMV1 1QWRA 2VZTA 4PDWC 2FDKA 3HEIA 1UY0A 3LOBA 4C8DA 2IXCA 2VJXA 3ZO0B 3T1LA 3N4MA 2LRPA 2RR13 4NHKA 3BTAA 2BPA2 5HCAA 1ULGA 1PZ9A 1M06G 2DCKA 4ES9A 4Q4W2 2X09A 2V09A 1NQDA 1OQEA 1Q8OA 2PAMA 1W28A 2FMYA 2Q5TA 3DKQA 3M7AA 4QKFA 3X29B 5A6ZA 4UAPA 1V6MA 4LQRA 3LF7A 4IEUA 3WNPA 2ATFA 3DN7A 4NIGA 3C7OA 5JIAA 3ZFFA 5CFDB 1VBE2 2EALA 4YW6A 3WNXA 1SLBA 3N35A 1QEXA 2XWJB 3H8OA 2Y8KA 3GBGA 3WW4A 1SQ4A 3IIIA 2HWD2 3AZVA 3I59A 5FPUA 2XKPA 3P5BA 3W5NA 4MGSA 1VBC1 1FPN2 1PK6A 3T2OA 1MVQA 4OI2A 5F32A 2XOMA 1QQP3 4BQ5A 2XBO3 4ATFA 3A4UA 3E5QA 4NHMA 1YHFA 4LKSA 4P9XA 1QDCA 2E26A 4LUKA 4URAA 2VXJA 2WFF2 4YVSC 5FZLA 4P5HA 4OI4A 5L73A 4J25A 4BOWA 4H3WA 4GD4A 3RG0A 2PLV2 5I0TA 2YBPA 2D3PA 4YW3A 4AFAA 2F4PA 2JKXA 5FIXA 4EN9B 4GQ7A 5GM0A 3LCPA 5JPNB 3ZN6A 1CD3G 1YQ8A 5CADA 2UURA 4Q0PA 1GQGA 4MUVA 5T55A 1UL9A 1JTZX 4CTEA 3W9AA 1ZA4A 4RGGA 2V5YA 5L19A 3RYRA 2VNRA 4BIFA 2VG9A 4COUA 4AFBA 3VZJA 4LHNA 1F5JA 1Y9QA 3OUHA 4XJAA 2GMMA 1OLMA 2EICA 1NCRC 4XDOA 1WMDA 2Y33A 2D40A 1W6OA 3T2QA 2WIIB 1W6QB 1DP0A 2DVBA 4R9AA 1RUG2 4JHZA 1W90A 3ZPOA 3NKGA 1SPPA 2RMU2 1S4CA 4M3CF 2VR4A 4FXGB 3AKTA 3MPBA 5FY0A 3HNYM 4DB5A 2BJSA 3NV3A 3OGVA 3OB8A 3KHCA 5M0TA 2ZXQA 3GHMA 4HVQA 2CAVA 3NJYA 4QU1A 3ZN4A 4IGOA 4IGPA 3VHOA 3NVCA 4U2AA 1GBGA 3UNPA 3SNMA 2ZEWA 1COV1 3NNMA 2VMGA 4XUOA 1O59A 2JG8A 4CEYB 1ZYBA 4XPVA 4OMCA 1B35A 5CNAA 5GLUA 3ZM8A 4MXWA 1H2NA 2I07B 2D3RA 5KXEA 5A32B 1G7YA 1RUD1 4I0AA 2W87A 2WS92 1OXCA 4R8HA 1LAJA 2Y38A 1H1AA 4YG6A 1FNZA 2PHLA 5IFPA 3CZJA 1TMF1 3J7NA 1WBLA 4UW4A 1MS0A 2JDUA 3HMYA 3M3QA 5FY5A 3ZDVA 1KDMA 2ILMA 5IUQA 5IK8A 1NCQC 2GP5A 5KR7A 2TEPA 1VBD1 1PNGA 5HCFA 3FWEA 1VMFA 4IESA 2WZR3 1OQ1A 3KV9A 1H9WA 3AP5A 1AR82 2D5FA 3GCWA 2GN7A 5FZEA 4L92A 5JDBA 2Y34A 1KD7A 5GLVA 3BU7A 2DF7A 1N1YA 4JAAA 2W5FA 4Q5OA 5C9AA 2J1RA 3WP6A 1W9FA 2ZMLA 3HWJA 4W6YA 2WKKA 3A0KA 1AX2A 4HN1A 4RL7A 5LATA 5CU1A 3UKVA 5GJ6A 1AUYA 2ETEA 1ZX5A 5IK4A 3AP7A 4KWLA 1W8OA 3LD8A 2Z42A 3NL1A 4IV3A 1S1AA 1VR3A 2E7QA 3POYA 4YARA 1BVVA 4N53C 1S0IA 3O1VA 1COV3 5C8WA 1NY72 2VTXJ 1HRI1 4D0QA 2WZPP 3WDVA 5A3LA 3K51A 1UX6A 1ENQA 3DV8A 3Q8FA 1SZBA 1RUD3 4XFGA 3C8XA 4WM7C 3ACHA 3IDEA 2YY1A 5CEHA 4OI0A 1JI6A 1W6PA 2D6OX 4XFCA 1TMF3 4CDUC 2UY9A 2BRTA 4E4DX 5KHKA 1CWPA 3KZ4C 5A7WA 5J96B 4OULA 2WO7A 2XHNA 5SV8A 1ZBE2 3U0ZA 1S2EA 3LFIA 4NAOA 3AZYA 4QXKA 1JZ7A 2ZEXA 5FLIA 3PDQA 3ZN5A 1X8EA 3I97A 1YC61 1RL3A 1XC6A 4LBLA 3VD9A 2V4VA 3SCGA 4G3YC 5JOXA 1KITA 1X7NA 2DU1A 4UOJA 4TZDA 3ALQA 5JAXA 2ZX1A 2ZS6B 4FVVA 1NA1A 2QQPA 4INDA 1WW7A 2ZZJA 4MYEA 5E1RA 3OBRA 1CJPA 2DTWA 4BDVB 5IK7A 1HIXA 4UFHA 3F2ZA 5JMCA 3IIAA 2QVSB 3VBRB 1LKNA 2QE3A 3HN3A 1NT0A 5DDJ1 3OPWA 5FQ0A 4L8QA 4QDSA 1HRI3 2BP6A 1S2BA 4UFIA 3M2MA 2MPFA 3QH7A 5C5UA 3GJAA 1D4M1 1O8SA 4MGQA 3S6PA 4YNIA 4R9DA 4ONUA 4AFMA 4HKLA 1MZ5A 4UFKA 4CXWA 4DS0A 1UZWA 2R042 3ZXEA 1IQAA 2ZGSA 2ZHKA 4XFAA 1IGOA 4WM8A 5FZ6A 3DYOA 1SBEA 1H2MA 3PVEA 4DFSA 1FV3A 4D6RA 4EE2A 3LSEA 4JVAA 2PTMA 2IXHA 4O7XA 3VBFB 5F6LB 1RUOA 1NZCA 2Y6GA 3NAPC 4E4HA 5FMCA 3BTXA 4B3NA 1FXZA 1H8TA 4MG2A 3ZFEC 2WFPA 2J1VA 3WNKA 1TE1B 4COVA 1XNCA 4YWAA 4I0WB 1RJ8A 4QPIA 1OLRA 2WWUA 3OEBA 5EIYB 1EUTA 1K5MB 1T6BX 1SFPA 2WO1A 5ABJC 4QQ2A 5KHHA 1GU3A 4AEDA 2BEOA 1CAXB 1W2TA 5BNOB 5F2SA 3V56A 1O4YA 3G6JB 3I3DA 2A3YA 1BEV2 1U5ZA 4IEXA 1UN1A 1VBA2 3IT8A 4J1XA 5DDJ3 1RUH1 4ZS3A 4WVZA 4AHXA 4YGBA 5KXCA 3M8LA 3N7KA 4FBFA 3W21A 4DPNA 1Y3TA 3KQRA 1HB3A 1D4M3 4LHLA 5LY1A 2LW8A 1WMFA 2AREA 4BISA 2J1SA 2QFEA 1AYM2 1YQCA 2WNVB 5K0UA 4A7YA 4IE5A 1RC6A 2BGPA 1WWYA 2E31A 3NNFA 1YO8A 1US2A 3RRDA 3V65A 3WEZA 2YFZA 4RQPA 1ULFA 5EJ1B 5FYHA 3ZX7A 3A0NA 1OLME 1PO22 1ND3C 1PGW1 1QJY1 4W4ZA 1C28A 3WNMA 1T2XA 2X5IB 1JOPA 2WT2A 1RMU2 1UCXA 1R1ZA 2VOWA 1W0PA 2WT1A 3EJKA 2PHRA 1JZ6A 1SBDA 1N47A 3BU0A 2E7AA 4N9IA 4XCBA 1UOJA 4FQZA 4LA2A 1GNHA 4UFLA 1NG0A 1OHFA 4BQWA 4D69A 3HQXA 3PVOA 2DVDA 4ASKA 4YYOA 4FPCA 3FZ3A 2B5HA 2R32A 2VPVA 3PTYA 1W6MB 5C3PA 5C3QA 2O8QA 3WG2A 4XF1A 3VL9A 4X6QB 3LDRA 1CIWA 5FYTA 4Z2AA 5CFCA 4QX1A 2C5DA 2D44A 4JGYB 1RUH3 3L2HA 4QX8A 4Y22A 4K3UA 1QIQA 3KT1A 5FY8A 2Y6HA 3AMHA 1BKZA 4PIXA 4YZ3A 1IG0A 5EP9A 2OIIA 3GBWA 1F5FA 2PYTA 4LK6A 2ZAAA 4KQ7A 2GNDA 4CDXB 3AJZA 2OA2A 3RI8A 2XXZA 3USUB 4CDWC 3VZLA 3NJZA 4NIHA 4JC1A 3FX3A 1J3PA 3EYPA 3RJRA 3TEXA 1QJY3 1LOFC 4QXBA 5FXZA 5KXDA 3PU8A 1UKRA 4S2DA 2C0ZA 1PIV1 1QJX1 2ERFA 5A3WA 3N7MA 1O7FA 5FYIA 5L7OC 3NV2A 3ES1A 4ITCA 1GZCA 5DG1A 3ABZA 3SISA 4LBQD 2HBUA 4XOGA 1CPMA 2FDHA 3K4DA 4AQTA 4KGQA 4C1XA 3GGLA 1OKQA 4MADA 1WBFA 1XNBA 5JMOA 1R64A 2AR6A 5J09A 3ST7A 3KT7A 1C5IA 5H9QA 3RFRA 3CQOA 1EAH2 3I4IA 4R9CA 1CAWB 3ZXKA 3FC0A 2H0BA 2QQLA 3ECQA 3IMNA 2P1BA 2CGOA 4P9JA 1HKDA 2KR2A 3EHKA 4BXSV 3MBWA 5FREA 1EUUA 2XL7A 3M3OA 4LBQB 4P9WA 3E6BA 2Y0OA 4QD2A 1AR72 1D0GA 1LESA 3OY8B 1W9TA 3GDBA 2JJ6A 1LJ7A 1L7QA 4PCRA 1F9KA 3U14A 1SEFA 3I2IA 3BPZA 3H7JA 5K7PA 2R6QA 5FWJA 1QNWA 1S55A 4XBQA 4QX3A 3RDIA 1GWKA 1JZ3A 1PIV3 1QJX3 4MV2A 1GFF2 2KM2A 3ME2A 4PI2A 4IE4A 3O0WA 3ILRA 4HETA 4CU9A 2FDJA 2DUOA 3AX4A 4GKYA 2IXJA 3GZAA 3PJYA 2WLQA 1WMXA 2G19A 5A33B 3FL7A 1UZ0A 4WVMB 4ZY9A 3SCHA 1FI2A 4N43A 4CP9A 1JMUB 1C5HA 1PVC1 2VMDA 3VDDC 4RSUA 4XUNA 1OC1A 4Q1RA 3HPNA 4YGCA 1F15A 2QZ3A 3CNAA 2RS32 3KQ4B 5FZOB 2MEV2 4HLTA 4A7ZA 1C8M2 3BUCA 1W2NA 1XNKA 2ZX2A 4BWOA 2R49A 1TVGA 2C9AA 3PVNA 1RXGA 1L3JA 3IPVB 4MGKE 3KB5A 3WXPA 5FZCA 5FWEA 3B5LB 2RS12 2TBVA 4B4QA 4AVBA 3ZFGA 4XFIA 1MQTB 2OUHA 4BQXA 4AK3A 3P1IA 2HKXA 4DZGA 2HWF2 3B7MA 3HVDA 3J8F2 3ZYHA 2VCCA 1Y43B 5ANNA 1IS6A 2Q1FA 4OQ9A 2GN3A 4DNYA 4ZHNA 4YG3A 1RVF2 3OYWA 3HOBA 3CJIA 4K21A 1ZREA 5JPMB 1TG7A 2UWCA 4GH4A 4HPKB 4PIZA 2RM21 5DQ0A 3ZXAC 3O1UA 3K75B 1AXKA 4BYYA 3D3AA 2BVVA 3SCFA 3HJRA 2WBKA 1QDOA 3H1YA 4DRVA 3E5UA 3WG1A 4ZONA 1IG3A 2HWE1 1PVC3 3AYAA 1L7LA 1BYHA 3I54A 3QD6A 1S0EA 3FLTA 1EYBA 4E2QA 2D6KA 5IT6A 1UMHA 5CAZA 2P37A 1QJU2 4RHV2 5F3CA 2F17A 4DUXA 3NV1A 1RUI2 3AVSA 2VOKA 2SLIA 1NQJA 4AHYA 4ZZ5A 4NVPA 2VCBA 2GC2A 3KF5A 2ENRA 5CKMA 3V0BA 5B4XA 2BOJA 4H55A 4E9KA 2CDOA 2EIEA 3PNAA 2YGMA 2Y6KA 5T5OA 2LM3A 4A41A 1YFYA 1YJLA 4U36A 1XYPA 4C90A 3S57A 2VL4A 1XOYA 3AZZA 1FOD3 2V72A 1UYZA 4CDUB 3BCWA 2CWSA 5D8AA 4B4RA 2ZACA 4FOWA 4QDRA 1FAYA 2W1SA 4QQHA 5E88A 4MGTA 3RWKX 3WF3A 1MS3A 2P6HA 4GJZA 4YW7A 4Q4Y2 1WCQA 4ORFA 1GOGA 3AZWA 2Y64A 1NXMA 5BNPA 1NE6A 2RM23 3D6EA 1GQHA 4FAGA 4NHLA 1QXPA 4ZKTB 1VJ2A 3VBOA 2HEYF 5B4NA 1L7RA 1D7PM 1TQ5A 3MV01 2XUEA 3ACFA 5H9RA 4A3XA 2WUHA 2PHUA 5FY7A 3GALA 2C6SA 2HWE3 4WV8A 4EV0A 1IS4A 4IERA 4Y3OA 1ENXA 1XRUA 2FMDA 4MZUA 5F5CA 1AJOA 3AM2A 3D4KA 4P9IA 1O3QA 3T2PA 4QPGA 3ILNA 3VD5A 2VVDA 2WYFA 2WNUB 1H0BA 3WV6A 2Q8DA 2OUJA 2P3YA 3I8TA 1HN0A 2D6MA 2EIBA 4MLOA 1RUE1 3IAPA 2VZPA 2QQMA 3FE5A 1XNAA 4NO4A 2WYSA 3MI8A 5CZKA 5LB6A 4R4XA 4OHZA 4FQ4A 3UKTA 5A3UA 5JI7A 3DPRA 3NSTA 2O8OA 2D43A 1LULA 1N3QA 1CZVA 4GJYA 2VM9A 2XVLA 3VBRC 1QKQA 2HH9A 1NAEA 3RSJA 1HRV2 2W52A 5ACA2 4XQ4A 2A6VA 2XJPA 5FPBA 4MO3M 4K1ZA 3TBDA 2R1BA 4AHZA 1DDLA 4FFIA 4H7LA 2J1TA 2Y0IA 4TN7A 1LHWA 5IVBA 3ACGA 4XZUG 2XVGA 1X50A 3VN4A 4YVWA 3O14A 4FTBA 3GJBA 4MSVA 1RUJ2 4UBHA 3KV6A 1PMIA 4KU8A 5A7QA 4RR3C 1DQ5A 3JBG2 2RV9A 1OD3A 3ZYIB 2WZ8A 4GWMA 4XJUA 4AEKA 1MEC1 1PMHX 5HV4A 2PXJA 3WW3A 3WSOA 2YDEA 1DQ2A 5K4LA 5ABJB 4CP1A 1MS5A 4FOVA 4Z2WA 4KG0A 4CUCA 4YW5A 4UW5A 4BE3A 3I2GA 4UF0B 3AMPA 2QKDA 4D8MA 2XJRA 2WO3A 3FHAA 5CBLA 4WBBA 1QHDA 4YM0A 5JR7B 3E5XA 3R0RA 5FZFA 1RUE3 3WR0A 5C3OA 2EXIA 4FPOB 1GANA 5FO9B 2XQXA 4FO9A 2AACA 2G9ZA 4CPBD 1XE0A 1GQPA 2UWAA 5AC91 4HXCA 4F83A 4LO5B 3S7EA 3MIEA 3SH3A 4G9SB 3T09A 2XL9A 1CJDA 5A7NA 5FYUA 1Z7S1 3WLUA 4AFDA 4PF1A 4KWJA 5I8SA 3OCPA 4QQPA 1XSQA 4H2AA 1UPSA 2RS51 3CO2A 3KMHA 4CCKA 4V2VA 5CFDA 5T54A 5I0SA 2VMFA 3NNLA 4Z92B 2JICA 5FOJB 5FMOL 1QH6A 4TSVA 2ZBJA 4PBOA 1ZRIA 1K12A 3BODA 3UGFA 5CKNA 5FYVA 3H3LA 4KGGA 4CEWB 4AAPA 2I2SA 3ZXGA 2X53S 3AP4A 3I2JA 3LOIA 4QAWA 4E4SA 4CCLA 1HXS2 2YV8A 2CV6A 2ZGKA 3J4UH 1MEC3 3LEKA 1X33A 5T5PA 1PO11 3K3OA 2X10A 4AQ6A 5T3NA 4IL7A 3C3VA 3W20A 1X82A 2YGLA 3L9JT 3NJXA 3UKNA 2XB6C 2JDKA 5FUPA 4FPYA 2VAUA 3AFKA 4BMEA 3DCQA 4ZPIA 4GWJA 4LORA 3MO4A 1O5UA 3R05A 5J36A 1QOSA 2XGXA 2NYYA 4QB6A 5FPVA 4AQ2A 5AC93 4AE2A 4XTMA 4ZXKA 3ZSEA 4A6OA 1W06A 3N7JA 4JGYC 3BIWE 1QOOA 2CTVA 2DUQA 3LEGA 1Z7S3 3K48A 4FOQA 4RFRB 2RR12 1UXXX 1CESA 3I2HA 4PQQA 5IVJA 2NLRA 2RS53 4FPLA 1W6QA 2VNVA 1W6NB 4RFT0 2TNFA 4FPEA 4IV1C 4YPJA 5L7OB 3P6BA 3D82A 3PIJA 1X36A 5DAVA 1PMJX 5C4WB 3TNPB 4XTPA 2WLPA 3MDPA 2VUDA 5J1XA 1RB8G 4MX3A 1U5YA 1UOGA 3B69A 5EPAA 2IVJA 1WZXA 4LBMA 3LDKA 1MS1A 5JXHA 1PO13 1OI6A 4D6SA 3V0AA 4K20A 1EV11 1UKGA 2HJIA 3WG3A 2W3JA 3C2UA 1AR91 1J3RA 2A6WA 4CEYA 3WNLA 1GR3A 5L36A 5LWBA 4RGAA 5A32A 1DZRA 3MUY1 4UFJA 2QQIA 1R081 2VC9A 4OUMA 5EYXA 3PHMA 1QQP2 4QXCA 5EZWA 2XBO2 4NMIA 4F3JA 1BVP1 4XAEA 3GNEA 1JZ8A 5FJKA 4UXAA 4HONA 2RDRA 2ZA9A 3R4DB 5FK8A 4D7TA 3A7QA 1BMV2 2Q0AA 3B94A 4PHZA 4UFMA 1WLWA 4W6WA 5FY1A 2BTVC 3J7MA 1SCSA 2YC2A 1C4RA 2OVUA 3H7YA 5I0DA 1A8MA 5IYYA 1YLLA 3KF3A 1W99A 1RINA 2Z2SB 2UU8A 1YIPA 2J1UA 2FD8A 3VKFC 1N1SA 1Q8QA 4FFFA 5BY5A 2YBKA 4FP3A 4AI8A 1G8WA 3OJBA 2EAAA 2W94A 3VD4A 2TUNA 1KJRA 2WR9A 2CU5A 3P3NA 4HK8A 3QH6A 3UGGA 3GZEA 3M3CA 2VCMA 2ORXA 3DXUA 1EV13 1D2QA 1GZWA 4Q8LA 1AR93 1GSLA 3VBUA 5IFTA 3H3ZA 4K9SA 1G9BA 2WSVA 1VE0A 3VDDB 2YC4A 1R083 5GZDA 4KI5M 3WDUA 3BPSA 4NN0A 1N3PA 4IETA 3AB0A 2ET1A 4LLFA 1O6UA 3AXDA 2X8KA 1WLTA 4UW3A 3AMQA 1Y4WA 3O1SA 3EO6A 4Q29A 5DUWA 3TEWA 2EF6A 2ADEA 3SEPA 5EJZB 2PHDA 2YBSA 1RUF1 1DYKA 3U07A 1OMIA 3UGHA 3I3BA 3AKQA 1MPXA 2Q30A 1JYIA 2DCJA 2VU9A 4PLOA 1ASJ1 1VBC3 3LB9A 2JDNA 2VQAA 3APBA 1O3TA 2B45X 3WDYA 3B01A 5E8AA 4P9GA 5FYYA 3T2TA 2BW8A 2JENA 2WZR2 2D93A 2DDUA 3FHQA 2C1FA 5EWSA 3U4SA 3WQ1A 2K9ZA 4KBBA 3QACA 1OUSA 1MQTC 1QF3A 4H14A 4P08A 4FTSA 2D6PA 1NUKA 3OOXA 4NPLA 4LO6B 1DQ6A 3G7DA 2IC1A 3M3EA 4L99A 1LTEA 5DAQA 4BIOA 5FZ8A 2FCTA 2VNOA 5F7UA 1HN1A 1UU4A 3SITA 4F8AA 4I0BA 4AVTA 4LXLA 1V00A 1NZIA 2E53A 1UIKA 3UL2A 5FPZA 3I49A 1COV2 3T0AA 3WDWA 4XFHA 1VAMA 1QJEA 1W2AX 3RZGA 1GLHA 1O3RA 1OOPC 2ZHMA 5FZ9A 3EBRA 1RUD2 1DGWA 3LDBA 2JE7A 3R4UA 1RUF3 1OVPA 3K77A 4LIVA 4P9YA 5F6KA 4J6GA 5HCHA 2DCYA 1S0CA 3VBFA 1PNFA 1BJQA 1R1A1 3U1XA 4I09A 5BNNC 1ASJ3 2W08A 4QXHA 1NY71 3H8UA 1TMF2 4IEWA 4KG8A 2XJTA 4YM2A 5KHGA 3I59B 4AI0A 2JB4A 4FXKB 5LBCA 1LRHA 4BLJA 1REEA 2D98A 3MHZA 5CISA 1OQDA 3WOGA 1JU4A 1PK6B 1UY4A 5DUXA 4B4PA 5C3RA 4IEQA 1K5MA 2JDPA 1SLAA 4OMDA 3CZUA 4HZFA 5IW0A 3THCA 2WT0A 1DGRN 2BGCA 4HMZA 3ASIA 1O3SA 2E33A 1CVNA 1CAXA 1NOVA 1TEIA 3I2KA 3VDCA 5DAWA 5EYYA 5BNOA 2O1QA 5FOBB 1ZBE1 5EHDA 3DL3A 3MUZ1 4NRQA 5CKQA 3WINE 5JIUA 3UETA 1OSGA 3E97A 2AYHA 3VBSC 5CVRA 1SCRA 3I3MA 4YZ2A 4Q27A 4TLGA 2D97A 4FT8A 1VBD3 2D7FA 4C0BA 4DY3A 5JZGA 4LO7A 2B8MA 2ZAHA 3CKHA 2YXSA 3GHNA 1S2KA 4B7EA 1GWMA 5IATA 2XH6A 2WNVA 3BGAA 3GYDA 3H1WA 1VMJA 3O7OA 2CYFA 5F5IA 2R0FA 5LA0A 5FY4A 3FHIB 4H7MA 1HRI2 2YPJA 1ND2A 2EVXA 2XLAA 4BHPA 3HD8B 2CWMA 2OPWA 3TRSB 2JG9C 5FCCA 1WW4A 5F3EA 1W6OB 4M4RA 2E7TA 4YLZA 1JYXA 2ZJCA 2QQNA 3WUDA 2WINB 1R1A3 1W8WA 3ATGA 2W92A 2X5IA 5DAXA 4PJYA 3O1MA 4IGQA 4JGZC 1PGL1 4N8MA 1UMZA 2Q4SA 3NW4A 2WNUC 5HV0A 2DFBA 4PT6A 3MLJA 5C8CC 5DZGA 3H3UA 3DUIA 1IQDC 2WQZC 3HNMA 2DURA 4BM8A 3TEZA 3GZUC 5FTTC 3M4FA 3VBHA 1H9PA 2P6CA 3HT1A 1YI7A 4XQDA 5A80A 1B35B 3HAGA 1AR61 1W6MA 3H8RA 2OS2A 2N7GA 1ZBE3 3WCRA 3DYMA 4RR3B 4JZRA 1DGRA 1HJFA 3JD71 5C33A 3KV4A 5FZ3A 3O1RA 4CU7A 3VKMA 5L9RA 1VP6A 4CP2A 1OURA 2IVIB 1IKQA 5FMBA 1GOFA 4CDQA 4CDXA 1MZ6A 2R061 5FMOS 4LKFA 4AGGA 4S2GA 5DDJ2 1ZRFA 3V64A 1JYCA 3CJIC 3A22A 2BVBA 5HCBA 2XKOA 2AC1A 1OUXA 5F5QA 5DXDA 4ASMB 4PDWA 3WF0A 4BLIA 1D4M2 4EWDA 3IDAA 4AZZA 1HB1A 4OUEA 3VUOA 2BDRA 2ZEZA 1BEV1 3GBFA 4SLIA 5A7SA 3RQ0A 3TYJA 2RG4A 3O5SA 4Q26A 2GC3A 4K8FA 4RN5A 4DO0A 2ZGPA 1EPZA 2QQKA 1OA3A 1E5IA 1MS8A 3LKJA 4QX5A 2YU1A 1JH5A 5FV3A 4ARXA 3LWCA 4EWEA 3ZYFA 3AXEA 4IV3B 4G4FA 5IWFA 4AVCA 2WDBA 2DBIA 2P17A 3PL0A 1I5ZA 1LOAA 4M00A 4YGEA 1AR63 1CAWA 1UZVA 2B7YA 3JU9A 3OBZA 4K7JA 3WP3A 1BBT1 1UZZA 1FMD2 3QLQA 1JZ5A 1RTVA 3ROUA 5A3NA 5HXMA 3F95A 3KLSA 2VTFA 5GLZA 3VLBB 3JD73 3ZYGA 4NROA 1ULOA 1W6PB 5FBZA 5FLJA 4AI2A 4CA9A 4BQ3A 4CRQA 5IAXA 3VGIA 5LA9A 4OQ8A 1GMMA 2VZVA 2R063 3FLPA 4IE6A 1REDA 4IUGA 4CEWC 2B9VA 1RUH2 1V6OA 1I6XA 1J83A 2WAAA 4YVSA 3T1MA 3JCIA 1PVXA 4CVUA 4CU8A 4KWUA 1KXGA 2D6LX 3ELNA 4QM9A 3LFMA 4DEVA 4E2SA 1YIFA 5A7OA 4QB1A 5FP9A 2E6VA 2RE9A 3DXTA 3S30A 3C7EA 3VBOC 4PLNA 3OPZA 4AHWA 1WCUA 2Q8CA 3WD5A 3EQEA 1BEV3 3MIHA 4YW2A 1YEWA 5FJHA 1OVSA 3CU7A 5J7MA 1Y9GA 3T30A 3CIHA 1QGLA 3BALA 1V9U1 3IMMA 2XDVA 4I2OA 3VZNA 1PGW2 1F35A 1QJY2 2J42A 4W65A 4X8PA 1NCRA 1ZVFA 3O12A 4MVTA 2ZX3A 4XURA 2ZKNA 5G04L 1UF2C 5A33A 2QQOA 1N1VA 3ILFA 2J22A 5K8SA 4IV1B 4J1WA 4LMFA 4WZFA 2ZHLA 2VQ0A 1BBT3 2B4KA 4O9EA 2V5DA 3T08A 4LHKA 3C7GA 4NJ4A 1CGPA 4XVHA 1ZBA1 3TN91 3OUJA 5GKAC 2BNOA 3OTFA 4LLOA 5FZOA 2ZGUA 4XDQA 3OBAA 2YC0A 4A42A 5JLVA 1JHNA 4JDNA 2ZGQA 5AVPA 1SLCA 1RHI1 1Q5OA 3MICA 1WUVA 4X6RB 1YFWA 1CAVA 1BK0A 2E63A 4COYA 2YROA 3KT4A 3U37A 5C4WC 2OZJA 2YYOA 5ISLA 3N9MA 4GB31 2GH8A 1GWLA 4K8RB 4Q4V1 2O0OA 3PUSA 4L97A 2YB7A 4XF4A 3ZKYA 1AYN1 2DYCA 2MHFA 3KSCA 5LK7B 3DGTA 4GWIA 2VH9A 3PMEA 1NXD1 5A6QA 1NLRA 3DF0A 4LUMA 4P00B 4QHZA 4AQSA 2HWC1 2AEZA 4CCEA 2HWB1 2ZGMA 2G9FA 1NCQA 4HANA 1UXZA 3AK0A 3K4ZA 4XFBA 2RVAA 5ANQA 5FP3A 4FPGA 5LBFA 5T5JA 2YU2A 1V9U3 4AEDB 4BPZA 2W95A 4HVOA 4AOCA 4MHRA 4JQTA 3KV5A 2PQQA 4NAMA 1X8MA 1J3QA 1BK1A 1PIV2 1Q8SA 1LGBA 1AZDA 1QJX2 2PHTA 3INAA 3MF9A 2B39A 3WP4A 4M3CA 1CAUB 4UWDA 1V6KA 3SH5A 1UW8A 2QQWA 3U75A 4CUGA 1W39A 4Q0QA 4XIKA 1C1FA 3TWIA 3OF1A 3UV9A 2UWBA 1Q8PA 3RJ2X 1V0AA 3OGSA 2AH2A 4YM3A 2EXHA 3UT0A 1ZBA3 4Y5Z0 3TN93 4WVVA 1KRIA 1GP6A 1ULEA 1WLDA 1W2UA 4A6SA 3BTYA 4RQPB 4N53A 2JDYA 1DGLA 1RHI3 4A45A 5EJ3A 3MIFA 4GB33 1MR5A 3RZJA 4UI9L 2OXBA 4Q4V3 1W9YA 4WM7A 1NE4A 2W1UA 1AYN3 3VKNA 2JD4A 2VECA 3WDXA 4YG0A 3AYEA 1JW6A 5F2WA 2X05A 2Y6FA 4CDUA 1S0FA 2HWC3 2J1AA 3J7LA 2HWB3 5KWRA 1ZRCA 1SBFA 1YWKA 2WRAA 4XQWA 2G4IA 4GXLA 1VRH2 2RS31 4D3WA 2BNNA 1UIJA 2NMNA 2K46A 4S2FA 5FZ4A 2VE1A 4BK4A 3VDBA 2FZ2A 4GA9A 2IXIA 2ZX0A 5CFCB 2CSGA 5JSPA 1H1IA 2GAUA 2LUWA 3FMGA 4XJZA 2WAOA 4TXWA 1SACA 2JB8A 2VCAA 4Y22B 3ZXDA 4K6BA 3VD7A 1IPKA 2FQPA 1V6LA 3D8CA 5E6HA 1AXZA 1YI9A 4L11A 4ES8A 2GC1A 5FZ0A 2A6XA 3JQXA 2IUWA 4KBZA 2GH2A 4QX2A 2HWF1 1OFSA 3J8F1 2BFUS 4IE7A 3EB7A 5JXIA 1YRZA 2Z5WA 3ZXFA 1DFQA 1E5SA 1RVF1 2BU9A 5GZEA 4EN7B 3MEPA 3BIEA 3U4XA 1PVC2 4TTGA 1LEDA 1ZZ9A 3NQHA 1WKYA 2VZ1A 1K42A 1MS4A 2C24A 5DZEA 2IFRA 4RS5C 4WZCA 2YMZA 4XEZA 5H9SA 1PGSA 3VDAA 3Q8AA 5D21A 5KBFA 3KCXA 3SQOA 3H50A 4X8NA 1CONA 2VBBA 3M70A 1OOPB 4NPMA 3D0SA 1Y9MA 4I02A 2WNEA 4Y24A 1QJU1 4XF3A 1TNFA 2RS33 1H2LA 4XC9A 3RGBA 2DV9A 5T52A 3NNGA 1YQ6A 1QXJA 4LBNA 3NAPA 1FOD2 4NPRA 3T4HB 4BJ0A 1AHSA 2Y26A 4DMIA 5BNNB 3A21A 3WHTA 2JE9A 4BZ4A 2CNAA 3I3QA 5GALA 3ZFEA 3ZIXA 5LEKA 3LPGA 3CF6E 2ZX4A 4JRLA 5DZFA 3POIA 5F9TA 3RZHA 1JYNA 4C91A 4K40A 2W9XA 3ZFFC 5C6CA 1XB9A 1VALA 4D94A 1JS9A 3LIGA 3PIGA 5LEJA 5IK5A 1HQLA 5A3MA 5ABJA 2PQSA 2HWF3 3ZYPA 2ADDA 2NMOA 2RM22 2YHJA 3LQCA 3RPQA 2ZGTA 3AC0A 4LE4A 4UF0A 2PN5A 3VD3A 1E57A 1RVF3 2CDPA 1UYYA 3LA2A 5DUUA 3VBSB 3HN1A 1LHVA 4NR1A 2HWE2 1PK6C 4YZ4A 3WUCA 5FUIA 4Y1VA 3IAQA 4Q4Y1 5FYSA 3S5AA 3HQRA 5C71A 4OVEA 5FFOC 1T6GC 1F2NA 1CQ9A 2CY6A 2XHKA 1K3IA 3FN9A 5A3OA 1VLNA 2VULA 3ZMNA 3J9SA 3I3EA 2CL2A 1U5IA 4NIAA 3ZVXA 4EQVA 4EJRA 1FX5A 1ND3A 2JG9B 1DIWA 2VMHA 1QJU3 1OLQA 3SKVA 5LA2A 4MXVA 5F3IA 3WT3A 1ALYA 1RUC1 2FDIA 4JGZB 1ST8A 1W8HA 5FPXA 5I8TA 4E27A 1UU5A 3LGRA 1OPMA 3H8XA 3AKPA 3VV1A 2LROA 3K2OA 2VO5A 1M4WA 1ACCA 4MH0E 5C8CB 3KGLA 3L2YA 3BN6A 4K1YA 5L7OA 2PHWA 2Z4FA 2XONA 3W5MA 4Q4X1 1JODA 4NWWA 1KDKA 2UY8A 5BV6A 5FYCA 1VAVA 1G9AA 2FDFA 2G1MA 1GP5A 1W0NA 1VIWB 4XFFA 3GCXA 2ZGNA 1G9DA 3KCYA 3POJA 5I91A 2I45A 4Y20A 4Q4Y3 4CUAA 5FUNA 3VZKA 5IAVA 2JG8C 2EAKA 4DOUA 3WF2A 3HR9A 1B35C 5EFUA 4XILA 4HFSA 4QQLA 4AW7A 1G9FA 1V6JA 1N1TA 2R071 1WD4A 2GNTA 3OYWB 3CJIB 4CDWA 2QUOA 1JZ4A 1JBCA 2QZ2A 1MZEA 5LRSA 2DCTA 1D4VB 1JOBA 2B9UA 4BA6A 2PMWB 2KA3A 3USSA 1LOFA 4CSWA 4IEZA 4M3CE 1W6NA 2GDFA 3VHNA 3UK9A 1RUC3 1R091 2P3KA 5KC5A 4KL1A 4E8CA 5A1LA 2ET7A 5JR2A 3OD0A 4AL9A 2JX9A 4Y5TA 4LEJA 3KWVA 2DVGA 4ZU5A 5LASA 2NN8A 2ZGRA 4FAHA 3R6SA 1NKGA 3AYDA 3WZ1A 5C9AC 3WG4A 2ORZA 4DUVA 3BI3A 3ZIWA 5C70A 4Q4X3 3K4AA 4JCKA 4GKXA 3TAYA 5BUVA 3POGA 1CN1A 2IZWA 2JD9A 3Q8BA 4N7UA 3MW2A 4QU2A 4Z8BA 4ATEA 1JU3A 3CDZB 5B2GB 2ZGOA 5T50A 4BXFA 5FLHA 3B3QE 1MEC2 3I7DA 4IV3C 5IHRA 4YZ5A 3AL6A 4FSJA 1W04A 3AJYA 1GOHA 3BOPA 4N7IA 4COWA 1AL22 1CX4A 3MIDA 4GAZA 1ULCA 1WCSA 1DYOA 2E9QA 5D8AB 5KHJA 3AZXA 1LODA 1GP4A 1D2SA 2R073 4XXAA 2Q1ZB 3LAGA 1J1TA 1TME1 3H0OA 4QMAA 1JYWA 2OT7A 1HV0A 3HIFA 2YPDA 1FV2A 1LNSA 3FFQA 3ENRA 3PU3A 3W59A 5BNPB 1US3A 3VBOB 4AI1A 3THTA 5AC92 1LU1A 4IEPA 2DU0A 1R093 4FPFA 3KHBA 4IQPA 1X9PA 4JV4A 1NLQA 1Z7S2 3S0MA 3NJVA 1GNZA 2RS52 1RYYA 2B42B 4R52A 4B7KA 4QPGB 3O0VA 1NA1C 2R30A 2CHHA 2R16A 1JXNA 3OSDA 4NIDA 1VBB1 2VQUA 4A2UA 1S0GA 2FHRA 1CIYA 2ARAA 5FZKA 3VDDA 4EN6B 3DPRB 4NIIA 1LCLA 5FZGA 3E6CC 3FUQA 2VVFA 5A1AA 4HKOA 2VY0A 1PO12 4BQ2A 3MIGA 5ERLA 3CL1A 1P8JA 2YG0A 1H6YA 3ZR5A 4HVRA 4QPYA 4CCJA 3T0BA 3FUOA 4QHOA 2A7AA 2W46A 4QKNA 3QOPA 1TME3 4RGKA 4YVWB 3O0XA 1Q56A 3RNSA 4XZPA 4Q4W1 4AGRA 2D3SA 2HBTA 1W8NA 2BWAA 2W0XA 4WM8C 2QDRA 1AXYA 3N36A 4AG4A 1H4HA 3POBA 3T0DA 5CG9A 1W8TA 2W39A 4E2GA 4DRRA 2VZRA 3O1OA 1A6CA 3ZSKA 4PI0A 4NWVA 2JE8A 1EP0A 1VBE1 4QB2A 4QT6A 4Z1VA 1APNA 1H8TC 3OD4A 1UU6A 4JKLA 1XU1A 2QBXA 1HJGA 3PLQA 2XJSA 2WQ4A 1IOAA 4QPIC 2HWD1 4DQAA 5DABA 1IS3A 3I2FA 5F1RA 1VBB3 1W8FA 1FPN1 2W68A 1V70A 3IBMA 4AEDC 5K9YA 1STMA 2OPKA 1QH7A 5F39A 4BK5A 3LPFA 5AFBA 1QJZA 1I5PA 4OUSA 1BHGA 1EV12 2WFF1 2HEVF 2XJUA 3B93A 1AR92 2QJVA 2PAKA 3ETPA 3VHRA 4META 2PLV1 4RYDA 2QDNA 5C3SA 4FPHA 1R082 1VMHA 2PELA 3PTRB 4YW4A 4ZU7A 5K0UC 2VZQA 4CE8A 3KS7A 2NPIA 5JUVA 5I0RA 5A7PA 1WA4A 4Q4W3 4SBVA 4WVWA 4FPKA 1WA6X 4RQPC 3N3HA 3AMMA 4OCTA 3WW1A 3E6DA 1H1MA 2FCVA 3BVCA 4M4PA 4MGIE 1O4ZA 4DXTA 4Y4YA 1OBNA 4QGNA 5LK5A 2ZEYA 1VBC2 1O4TA 1VBE3 2EXJA 4CYDA 1ULDA 1RUG1 5FZ7A 2JDAA 3WQBA 3IKWA 2RMU1 3RZKA 2RDSA 5FPAA 5IVEA 5FRAA 1HB2A 4LOTA 1H8VA 4JX0A 4AF9A 1K5JA 2HWD3 4O9GA 4A3ZA 4QKDA 2GMPA 5EXOA 3SC7X 1YCIA 1FPN3 3KCCA 3GXUA 5I93A 4N9HA 2A1XA 2IFWA 4HKWA 3AL5A 5CFCC 3MFAA 4UBGA 1JYVA 1W9SA 3WQ0A 2BERA 3OUIA 1LECA 2WFF3 2W47A 4FOYA 2WZR1 2RDQA 2W1WA 2WS91 2ZOEB 3ACIA 2PA7A 2PLV3 3KM5A 3U10A 2WN2A 1XBFA 2P4EA 1W8UA 2F4LA 4P9LA 3C7FA
chains in the Genus database with same CATH topology
3PL0A 4NHMA 3OBZA 3GJBA 4NHYA 4J25A 4BQXA 3KT1A 4NMIA 5LBCA 5ERLA 5IAXA 5HV4A 5EP9A 5LA9A 2RDRA 4XACA 4IW3A 2G1MA 4XAAA 5DAWA 2RDNA 3OUHA 2HBTA 2Y33A 5IAVA 5C5TA 4ZONA 5C5UA 3GJAA 4KBZA 5IATA 5M0TA 2HBUA 4BQYA 3NNJA 2V4AA 3GZEA 4NHXA 3EMRA 2OPWA 3KT7A 3NNMA 5L9VA 3NNLA 2JIJA 4XCAA 5DAXA 4XABA 4Y5TA 5EQUA 3OUJA 5LASA 5HV0A 5L9BA 4Y5SA 4XC9A 3W20A 3KT4A 3MGUA 4JZRA 4NHLA 2Y34A 4ZPIA 2JIGA 4Q5OA 2FCVA 3BVCA 4NHKA 3W21A 5L9RA 5LBFA 5LATA 3DKQA 4MHRA 4MHUA 3NNFA 2RDSA 2FCUA 3ITQA 4UWDA 2G19A 3HQRA 5DAQA 2FCTA 5A3UA 2RG4A 5LB6A 2A1XA 5DAVA 3OUIA 5LBEA 5EPAA 4XCBA 2RDQA 4BQWA 5LBBA 5DAPA 3HQUA 4NAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PL0 A;  4NHM A;  3OBZ A;  3GJB A;  4NHY A;  4J25 A;  4BQX A;  3KT1 A;  4NMI A;  5LBC A;  5ERL A;  5IAX A;  5HV4 A;  5EP9 A;  5LA9 A;  2RDR A;  4XAC A;  4IW3 A;  2G1M A;  4XAA A;  5DAW A;  2RDN A;  3OUH A;  2HBT A;  2Y33 A;  5IAV A;  5C5T A;  4ZON A;  5C5U A;  3GJA A;  4KBZ A;  5IAT A;  5M0T A;  2HBU A;  4BQY A;  3NNJ A;  2V4A A;  3GZE A;  4NHX A;  3EMR A;  2OPW A;  3KT7 A;  3NNM A;  5L9V A;  3NNL A;  2JIJ A;  4XCA A;  5DAX A;  4XAB A;  4Y5T A;  5EQU A;  3OUJ A;  5LAS A;  5HV0 A;  5L9B A;  4Y5S A;  4XC9 A;  3W20 A;  3KT4 A;  3MGU A;  4JZR A;  4NHL A;  2Y34 A;  4ZPI A;  2JIG A;  4Q5O A;  2FCV A;  3BVC A;  4NHK A;  3W21 A;  5L9R A;  5LBF A;  5LAT A;  3DKQ A;  4MHR A;  4MHU A;  3NNF A;  2RDS A;  2FCU A;  3ITQ A;  4UWD A;  2G19 A;  3HQR A;  5DAQ A;  2FCT A;  5A3U A;  2RG4 A;  5LB6 A;  2A1X A;  5DAV A;  3OUI A;  5LBE A;  5EPA A;  4XCB A;  2RDQ A;  4BQW A;  5LBB A;  5DAP A;  3HQU A;  4NAO A; 
#chains in the Genus database with same CATH topology
 4NRP A;  4KMQ A;  2QQV A;  5LRR A;  1PZ7 A;  1IHM A;  5GLT A;  2VTX A;  3DEC A;  3R4S A;  4RS5 B;  1XND A;  5GZF A;  3VBR A;  2A75 A;  5JSR A;  2VW0 A;  1RUF 2;  1UY1 A;  1B09 A;  2J1E A;  2PHX A;  1AR8 1;  2ID4 A;  4ARY A;  4LT5 A;  2VZS A;  2EA7 A;  2VME A;  3POW A;  1ASJ 2;  3V0A B;  4BQ1 A;  4AVA A;  2GP3 A;  4XAC A;  5F37 A;  4FTE A;  1RUG 3;  3RYK A;  3MLL A;  1OKO A;  2RMU 3;  3LSD A;  1DHK B;  4XAA A;  3B00 A;  4YW1 A;  1UMI A;  2YFU A;  2RDN A;  1JHJ A;  1SDD B;  3SEE A;  1ZZC A;  4RR3 A;  5IVC A;  2XLF A;  3RZL A;  2H0V A;  3URF A;  3WHU A;  3ZOI A;  4HN0 A;  2BOI A;  4LTA A;  4ISQ A;  2OQ6 A;  1Q43 A;  2WA3 A;  5F3G A;  3ZFF B;  4L2N A;  5HBA A;  1F31 A;  3P3P A;  2BFU L;  1ODN A;  4ZXE A;  1G6N A;  1BQP A;  3S5Q A;  3NO8 A;  4P14 A;  4EZ4 A;  3NMB A;  4DIN B;  3JB4 C;  5LCW L;  4BQY A;  2VNG A;  2C26 A;  1S0J A;  1VBD 2;  2JKB A;  2WS9 3;  3NV4 A;  1WD3 A;  1HQN A;  3LEM A;  1MS9 A;  1YFU A;  1OF4 A;  1CZT A;  3S7I A;  4AR2 A;  2WWS A;  4LA3 A;  2QQU A;  5I8Y A;  2XG3 A;  3KD4 A;  2D6N A;  4Y26 A;  1ENS A;  5FK7 A;  2VOV A;  4HG6 B;  1VB2 A;  2F6B A;  4LR4 A;  4Z82 A;  5IJR A;  1CR7 A;  2GNB A;  1CZS A;  1XU2 A;  1UOB A;  4EWA A;  2NM1 A;  2ES3 A;  4XUQ A;  4NE9 A;  2LAL A;  5EQU A;  2GME A;  3AP6 A;  1AR8 3;  3DEM A;  3ZN6 B;  1R1A 2;  5DN2 A;  1KQR A;  3ORJ A;  1GZW B;  3LIH A;  1VB4 A;  4QX0 A;  1HV1 A;  4I01 A;  1LGC A;  3VBU B;  1PZ8 A;  4GMP 0;  1XE7 A;  4CXY A;  3JZV A;  4YFZ A;  1JUI A;  3PVB B;  1KFX L;  5J37 A;  2A5Z A;  3WF1 A;  2EID A;  4XJ8 A;  4Q2F A;  4XMA A;  2P3I A;  2WJS A;  5IVV A;  1PHM A;  2IXK A;  2WO2 A;  4N43 C;  1OA4 A;  1ZRR A;  4XHB A;  1SPP B;  1DU3 D;  2GU9 A;  2DFC A;  4BCU A;  2HYX A;  1BZW A;  3W58 A;  1W8Z A;  3WW2 A;  2VXR A;  2CAU A;  4AI9 A;  3MPP G;  1WLC A;  2Q1M A;  3VB9 A;  2R7E B;  3ZMO A;  2CGN A;  2BZD A;  5CYY A;  2R04 1;  5DMY A;  2JG8 B;  4A7K A;  2GZW A;  1IS5 A;  4MOA A;  4M0H A;  4MXW B;  1KFU L;  2XLG A;  1U12 A;  4AXO A;  2XQR A;  3KVB A;  2EIG A;  4EN0 A;  3ZFG C;  4JGY A;  4I3G A;  3THP A;  3VL8 A;  2EXK A;  5F5A A;  1F8V A;  4M0N A;  1NX9 A;  1FYU A;  1ZA7 A;  5FZM A;  3K46 A;  4YM1 A;  1S0D A;  1NLS A;  2GNM A;  3OG2 A;  1PGL 2;  5FKC A;  4KNC A;  4AEJ A;  4IV1 A;  1OT5 A;  2DCZ A;  3USU A;  4Y1Y A;  2AGS A;  2LS6 A;  4HSL A;  3ZXJ A;  3VHP A;  3AMN A;  1XPW A;  2ZMN A;  4DIQ A;  1KJL A;  4GH4 C;  1AJK A;  2XPJ A;  3VKO A;  1C3H A;  4E4Z A;  2BBA A;  3M3I A;  1YYN A;  4JDO A;  2XR4 A;  4ZS2 A;  1GUI A;  3NRU A;  5E89 A;  4ERO A;  4F7Z A;  3RZM A;  5BYN A;  5C9A B;  1RGS A;  2CGP A;  1V6I A;  4I3P A;  5G05 L;  1AR6 2;  1VBA 1;  2A3X A;  3LA7 A;  4JRA A;  1POV 0;  1WCK A;  4TWT A;  3VZO A;  1N3O A;  4ASL A;  3OPT A;  4CCM A;  1YUD A;  1IZ3 A;  1Z78 A;  3EXU A;  3U11 A;  2GAL A;  2G9G A;  2YUE A;  1AX1 A;  3JD7 2;  5KXB A;  1LEN A;  4C1W A;  1W2O A;  4LNV A;  1RJ7 A;  5FAX A;  4LPL A;  2VBP A;  1AYM 1;  4RD7 A;  2X29 A;  4V1P A;  3HT2 A;  4O65 A;  3N9O A;  1E5H A;  1J1L A;  1Q3E A;  2R06 2;  2R04 3;  4GMP 1;  1FMD 1;  3RYP A;  3WCS A;  5HPO A;  5C5T A;  1LOE A;  3MZH A;  1JYT A;  4AFC A;  1J59 A;  2W91 A;  2JDZ A;  1PO2 1;  1DZQ A;  4BMB A;  3AP9 A;  5FZI A;  1MZF A;  4FPJ A;  4XJ9 A;  4B8E A;  2ZZQ A;  3OGG A;  2K0G A;  1QOT A;  4CCO A;  1LGN A;  1RMU 1;  2V4A A;  2HYK A;  1LOG A;  2BBV A;  4CZS A;  4LBQ A;  2V73 A;  4NHX A;  4AI3 A;  5D8A C;  2HLE A;  1CAU A;  2KXL A;  4XMI A;  5A7W B;  3O1T A;  5L9V A;  5JWP A;  4ET7 A;  1X9T A;  3RVH A;  1YQ5 A;  4DY5 A;  3OY8 A;  5JZG B;  1XSR A;  3H9A A;  5DPN A;  2NP0 A;  1OFN A;  3QBQ A;  1SFY A;  5H9P A;  4XAB A;  5D2A A;  5JOY A;  1W9W A;  1W03 A;  5BNP C;  2E51 A;  2ARX A;  1OPO A;  3RWN A;  5JOW A;  1G86 A;  4Y1X A;  1HX6 A;  1ND2 B;  5CB7 A;  4AVV A;  1NA1 B;  4Y1Z A;  1VBA 3;  1O8P A;  1BBT 2;  1HQW A;  4A44 A;  3N9L A;  4W50 A;  4GZ9 A;  3LEI A;  3N7L A;  3SHR A;  4P02 B;  5LA1 A;  1LEM A;  1HLC A;  4IXL A;  2RHP A;  4XJW A;  1C57 A;  1URX A;  3CMG A;  4QPG C;  2BV4 A;  1UWW A;  1AYM 3;  1CPN A;  1H30 A;  2OKX A;  3ZPY A;  1GZT A;  5FQ0 B;  4GMP 3;  2OX0 A;  1FMD 3;  4WVM A;  4YRD A;  4AEM A;  1I1E A;  3BB6 A;  3FJS A;  5LW9 A;  3UES A;  4YZ1 A;  3B9I A;  3KVA A;  5FO7 B;  2WNO A;  1PO2 3;  5I0U A;  4CUB A;  3IWZ A;  3VBH B;  2NZ9 A;  3CJX A;  3DPR C;  4CCN A;  2A71 A;  1JZ2 A;  2P2K A;  4OLL A;  4OHV A;  4DEQ A;  1SDW A;  1GV9 A;  1GZ9 A;  1PX3 A;  1RMU 3;  2UYA A;  2VZU A;  3OBT A;  3T3Y A;  1LHN A;  1POV 1;  3ZSL A;  1A3K A;  1TZO A;  1S0B A;  3POF A;  4Y33 A;  3RMY A;  4CU6 A;  1JUH A;  1AL0 G;  4WM8 B;  1H2K A;  4CP0 A;  4DXS A;  1BCX A;  4FI9 A;  1DQ4 A;  3IPV A;  1V9U 2;  3I2D A;  4Y4R A;  5AFE A;  1FNY A;  4YVW C;  1FT9 A;  2VOX A;  3BYW A;  4CDQ B;  2VUJ A;  1A78 A;  5FO8 B;  4HSJ A;  1XNT A;  1H8T B;  1EAH 1;  1MQT A;  3PUI A;  3IN9 A;  4PLM A;  3CBN A;  4QQO A;  5FP8 A;  5JOZ A;  3U78 A;  4BQ4 A;  1TNR A;  3Q9O A;  5A3P A;  1UNB A;  1ENR A;  2JDH A;  4FCA A;  4OHX A;  4QPI B;  5LBB A;  4PDW B;  3WNN A;  4EN8 B;  4NOT A;  5SV5 A;  1ZZ7 A;  2QTW B;  1OF3 A;  4LO4 B;  5F8P A;  2J7M A;  3TEY A;  1YXW A;  1ZBA 2;  3TN9 2;  4NHY A;  4QGL A;  2SBA A;  4HPK A;  4YGD A;  1AR7 1;  4QM8 A;  4O61 A;  4W6X A;  1RHI 2;  5BXX A;  1PX4 A;  1ZM1 A;  1CX1 A;  1YJK A;  3MIB A;  1OOP A;  5JSO A;  1ODM A;  4LK7 A;  4GB3 2;  1IKP A;  1KS5 A;  3C7H A;  2E32 A;  2FZ1 A;  4Q4V 2;  1GNY A;  2JXA A;  1QXR A;  1AYN 2;  5EV7 A;  4BB3 A;  1UOF A;  5K0U B;  1SHW B;  3POS A;  4AAX A;  5BNN A;  3MYX A;  1DLC A;  1POV 3;  1UO9 A;  4LHS A;  4XYX A;  1DGW X;  2HWC 2;  2HWB 2;  3IDB B;  2H6B A;  4LBK A;  2C9K A;  1ZZB A;  5FP7 A;  1WW5 A;  1LOC A;  3A23 A;  4OZO A;  5CFD C;  1OH4 A;  1UX7 A;  1W3X A;  4AVS A;  3I2O A;  3Q8E A;  3RI9 A;  4AWD A;  4Q0U A;  4COZ A;  1EAH 3;  3JB8 A;  1C8N A;  2GSY A;  3DKW A;  4YVS B;  3WP5 A;  1UY3 A;  3ACL A;  1DQ0 A;  3AVR A;  2JWP A;  2BQP A;  2WAB A;  4JTO A;  1DLL A;  4KU7 A;  1DZT A;  1VRH 1;  4RA0 A;  2Q8E A;  3VBS A;  5JCT A;  4LIU A;  3N9P A;  4GUL A;  3E1F 1;  3NWK A;  4TLF A;  4XXP A;  1HDK A;  5E16 A;  1W3V A;  3TB0 A;  2MEV 1;  1C8M 1;  2Z79 A;  2P3J A;  1AR7 3;  4MGZ E;  2BGO A;  5IVF A;  4TYS A;  4XET A;  4DUW A;  1C1L A;  5KHI A;  1W05 A;  3KGZ A;  5GZC A;  2ZTN A;  2RS1 1;  4URT A;  5A1F A;  1NCR B;  2VD7 A;  2JG9 A;  4OYU A;  4UT5 A;  4Y5S A;  4Z07 A;  3PUQ A;  2OQ7 A;  2VZ3 A;  2WL1 A;  3AKR A;  4IEO A;  2H6C A;  1XJA A;  4XF9 A;  4CCC A;  3SH4 A;  1UYX A;  4IDZ A;  3MGU A;  4JGZ A;  3WDT A;  5JVV A;  4DXR A;  2VMI A;  5FMD A;  2ZKL A;  4IEY A;  4OI1 A;  2VBD A;  2VW1 A;  2WNU A;  3N9N A;  5FP4 A;  3THD A;  4YSF A;  2FDG A;  5FXW A;  3SLI A;  1K45 A;  4JTN A;  4PBP A;  1LHU A;  2JIG A;  3AFG A;  1OD5 A;  1UYP A;  1DYP A;  3WX5 A;  5C8C A;  3ZSJ A;  4AYU A;  5BNQ A;  1H4G A;  1CAV B;  4Q0V A;  4LBJ A;  3J26 N;  4UYB A;  5CIR A;  2Y6L A;  3UJQ A;  4MHU A;  1AX0 A;  4S2H A;  4EZH A;  3MV1 1;  1VRH 3;  1SLI A;  4QX7 A;  5GZG A;  2FCU A;  4QKB A;  5A6Y A;  4UW6 A;  5FZD A;  3SXW A;  1ZNP A;  1FOD 1;  2WC2 A;  3NKT A;  1XYO A;  4RHV 1;  4OHY A;  1ZZ8 A;  3WY6 A;  3OEA A;  4QGM A;  2MEV 3;  1C8M 3;  1RUI 1;  2D5H A;  4CEY C;  1BLZ A;  1OA2 A;  2OW4 A;  2WZE A;  3H42 B;  4GAL A;  3UJO A;  1NCQ B;  4D6Q A;  5DUV A;  3BKZ A;  1YNA A;  3J7H A;  2VQT A;  1XQN A;  5JXJ A;  2VUC A;  2RS1 3;  1OH3 A;  5FXX A;  2A70 A;  1UD1 A;  5DAP A;  4E8D A;  2XJV A;  4M3C B;  3ZDS A;  2HEW F;  4DXZ A;  3RMX A;  2PHF A;  5HXV A;  4PQ9 A;  3J8F 3;  4L9B A;  4MGY E;  3SKJ E;  4QWN A;  3TNQ A;  1XE8 A;  4Q8K A;  2K2S A;  4AGV A;  5FYM A;  2A6Y A;  3VZM A;  4Y1U A;  4CCD A;  4CXX A;  4LOS A;  3WVJ A;  5FPL A;  3N9Q A;  3AKS A;  3CEW A;  4I30 A;  4XBN A;  4XUT A;  3POE A;  1WCD J;  4N53 B;  2IXL A;  4Q0S A;  3ZYB A;  3UYJ A;  4ISR A;  3FFZ A;  4HOO A;  4KWK A;  5D1I A;  2WWJ A;  2JEC A;  4WM7 B;  2ZMK A;  5FBJ A;  4JDM A;  4LE3 A;  4LIT A;  4B1M A;  1Q8V A;  4OHW A;  4M01 A;  2Q8O A;  1KS4 A;  4RHV 3;  3OGJ A;  2PAE A;  3FBM A;  4XE9 A;  1RUI 3;  2DWR A;  2O14 A;  4N43 B;  4LJH A;  4CP9 B;  4KH9 A;  4D7Y A;  3VBU C;  1QJF A;  2WSU A;  3GF6 A;  2WN3 A;  3IB3 A;  2VW2 A;  3TOJ A;  1HW5 A;  5JI9 A;  2KD7 A;  4LKD A;  4CEW A;  1DG6 A;  2ZPX A;  4CPB A;  1QMJ A;  2WQ8 A;  3ZLI A;  4BU2 A;  2DVF A;  1MVE A;  2DTY A;  1WW6 A;  5C7G A;  1ZRD A;  2FBE A;  3ON7 A;  5A3T A;  3RZZ A;  1G9C A;  1W0O A;  3EMR A;  3GZT B;  1WGP A;  1POQ A;  2AUY A;  4R4Z A;  1HRV 1;  4GWN A;  5ACA 1;  2Z69 A;  1XXN A;  2XJQ A;  1YFX A;  3MFC A;  2OYZ A;  1U5X A;  2PFW A;  2VZO A;  3ZFG B;  2ZGL A;  1UZY A;  4IE0 A;  1DQ1 A;  1SLL A;  4JKK A;  1YQ2 A;  2RJ2 A;  1UY2 A;  2VVE A;  1LOB A;  1RUJ 1;  2W2I A;  5FZ1 A;  5BPX A;  5L9B A;  3LE0 A;  5J3U A;  1J84 A;  1PM7 A;  1RUC 2;  2VOT A;  4Q1P A;  4QHB A;  1SG3 A;  1Z0H A;  2I74 A;  2ARB A;  5FR3 A;  3JBG 1;  4N90 A;  5FY9 A;  4XBL A;  3IM0 A;  3MLK A;  4IEV A;  4NUB A;  4XF0 A;  5FZH A;  4QPW A;  1EY2 A;  2Y60 A;  3LA3 A;  4HL0 A;  2VMC A;  2QCS B;  4GH4 B;  1RUE 2;  3MF6 A;  3IDC B;  1WME A;  4Q4X 2;  1LHO A;  1UPI A;  1MAC A;  5CG8 A;  2XUM A;  2P5B A;  4C0H A;  2DVA A;  4HT1 T;  2ARC A;  4P5Y A;  1H6X A;  4XUP A;  1NYW A;  1DBN A;  3B9C A;  3QCW A;  3CLP A;  5A70 A;  3WNO A;  4W8J A;  5LZ6 A;  1GYK A;  3ZKU A;  5C4W A;  5J48 A;  4D7S A;  1PM4 A;  2AZ5 A;  3ETQ A;  3HBZ A;  1V6N A;  2A3W A;  3MW4 A;  3NAP B;  4LKE A;  5GLW A;  2B46 X;  1Y7B A;  1JN2 P;  2JEM A;  5AVA A;  5FYB A;  2ZAB A;  3BOW A;  3ZFE B;  3GM8 A;  3D0J A;  1EPW A;  3ITQ A;  4OFG A;  1HRV 3;  2BWC A;  5FKB A;  2R07 2;  5ACA 3;  3V0B B;  2XML A;  1RIT A;  3ZXL A;  1FAT A;  2L9L A;  4ZU4 A;  3VBF C;  5FZB A;  5TSW A;  3B02 A;  2OZ6 A;  3PMS A;  1AL2 1;  1DF0 A;  3FBY A;  3PUH A;  5DG2 A;  1F4A A;  5LBE A;  1LU2 A;  5IVY A;  3MW3 A;  1RUJ 3;  3ES4 A;  1SFN A;  2DBN A;  1R09 2;  2ZHN A;  4PIY A;  4LO8 A;  4FFG A;  3JBG 3;  3HQU A;  1JOJ A;  1K5M C;  3IZO A;  1I3H A;  1ONA A;  1HXS 1;  3JQW A;  2QNK A;  4L0P A;  3WF4 A;  3RS6 A;  1RIR A;  5A6X A;  4FP2 A;  5FYZ A;  5BNO C;  4FFH A;  1HB4 A;  4GIQ A;  4V2W A;  1U0A A;  2BYV E;  4A4A A;  1ULP A;  3DYP A;  1QNY A;  2VUA A;  4XHX A;  1AVB A;  3T4V A;  4HBN A;  5FXV A;  1XYN A;  2ZCW A;  1SLT A;  2NQY A;  2QQJ A;  1ND3 B;  3JUU A;  4EYU A;  2BUK A;  3Q8C A;  5JZG C;  2R1D A;  3OGR A;  2A73 B;  2YZ4 A;  3D5O A;  4IW3 A;  3VKL A;  1VPH A;  2WNV C;  5KC6 A;  1LB2 A;  1QU0 A;  2DUP A;  3AYC A;  1UAI A;  4JQR A;  4LUL A;  1A8D A;  2RJK A;  4XW3 A;  4BH9 A;  5JXG A;  1ND2 C;  3K3N A;  1LR5 A;  1I9R A;  2C4X A;  2LTN A;  2RR1 1;  1RXF A;  1TME 2;  4B29 A;  2XVK A;  4ZZ8 A;  2X5I C;  2IWG B;  4OZX A;  3WQ7 A;  1AL2 3;  1GIC A;  4YFW A;  1D0H A;  1IPS A;  3PUA A;  1REF A;  3O1P A;  3ZR6 A;  1A34 A;  5LY2 A;  1VAK A;  3NNJ A;  4LBO A;  5T5L A;  2JDM A;  1UQX A;  4Y20 B;  5CA6 A;  1HXS 3;  2A6Z A;  2VGD A;  3VBH C;  2AEY A;  1F4H A;  2JIJ A;  4XCA A;  3HNB M;  3BTZ A;  3PJQ A;  2R0H A;  4JHT A;  4XIO A;  3ZYR A;  1O5L A;  1AF9 A;  1BXH A;  2MNG A;  1J58 A;  3HBK A;  3H1M A;  3FLR A;  4CDW B;  2Y6J A;  1O91 A;  2XWB B;  3JXS A;  3SMH A;  4HK9 A;  2P34 A;  1VBB 2;  5APA A;  1VRB A;  2BNM A;  2AEN A;  2W1Q A;  2WA4 A;  1DCS A;  3ZYJ B;  1QQP 1;  1SMV A;  2XBO 1;  1KGY A;  5FZA A;  4B1L A;  4CDQ C;  1QY4 A;  4CDX C;  4NRM A;  1KEX A;  1IPJ A;  4JKM A;  3M1H A;  2RJL A;  2UYB A;  5HI0 A;  4PF5 A;  4XDP A;  4RS5 A;  1ZZ6 A;  1RUN A;  4QDQ A;  1GKB A;  3CHX A;  3PUR A;  1E5R A;  2GC0 A;  4R9B A;  3LZZ A;  5J98 B;  3ZSM A;  5FDB A;  1BMV 1;  1QWR A;  2VZT A;  4PDW C;  2FDK A;  3HEI A;  1UY0 A;  3LOB A;  4C8D A;  2IXC A;  2VJX A;  3ZO0 B;  3T1L A;  3N4M A;  2LRP A;  2RR1 3;  4NHK A;  3BTA A;  2BPA 2;  5HCA A;  1ULG A;  1PZ9 A;  1M06 G;  2DCK A;  4ES9 A;  4Q4W 2;  2X09 A;  2V09 A;  1NQD A;  1OQE A;  1Q8O A;  2PAM A;  1W28 A;  2FMY A;  2Q5T A;  3DKQ A;  3M7A A;  4QKF A;  3X29 B;  5A6Z A;  4UAP A;  1V6M A;  4LQR A;  3LF7 A;  4IEU A;  3WNP A;  2ATF A;  3DN7 A;  4NIG A;  3C7O A;  5JIA A;  3ZFF A;  5CFD B;  1VBE 2;  2EAL A;  4YW6 A;  3WNX A;  1SLB A;  3N35 A;  1QEX A;  2XWJ B;  3H8O A;  2Y8K A;  3GBG A;  3WW4 A;  1SQ4 A;  3III A;  2HWD 2;  3AZV A;  3I59 A;  5FPU A;  2XKP A;  3P5B A;  3W5N A;  4MGS A;  1VBC 1;  1FPN 2;  1PK6 A;  3T2O A;  1MVQ A;  4OI2 A;  5F32 A;  2XOM A;  1QQP 3;  4BQ5 A;  2XBO 3;  4ATF A;  3A4U A;  3E5Q A;  4NHM A;  1YHF A;  4LKS A;  4P9X A;  1QDC A;  2E26 A;  4LUK A;  4URA A;  2VXJ A;  2WFF 2;  4YVS C;  5FZL A;  4P5H A;  4OI4 A;  5L73 A;  4J25 A;  4BOW A;  4H3W A;  4GD4 A;  3RG0 A;  2PLV 2;  5I0T A;  2YBP A;  2D3P A;  4YW3 A;  4AFA A;  2F4P A;  2JKX A;  5FIX A;  4EN9 B;  4GQ7 A;  5GM0 A;  3LCP A;  5JPN B;  3ZN6 A;  1CD3 G;  1YQ8 A;  5CAD A;  2UUR A;  4Q0P A;  1GQG A;  4MUV A;  5T55 A;  1UL9 A;  1JTZ X;  4CTE A;  3W9A A;  1ZA4 A;  4RGG A;  2V5Y A;  5L19 A;  3RYR A;  2VNR A;  4BIF A;  2VG9 A;  4COU A;  4AFB A;  3VZJ A;  4LHN A;  1F5J A;  1Y9Q A;  3OUH A;  4XJA A;  2GMM A;  1OLM A;  2EIC A;  1NCR C;  4XDO A;  1WMD A;  2Y33 A;  2D40 A;  1W6O A;  3T2Q A;  2WII B;  1W6Q B;  1DP0 A;  2DVB A;  4R9A A;  1RUG 2;  4JHZ A;  1W90 A;  3ZPO A;  3NKG A;  1SPP A;  2RMU 2;  1S4C A;  4M3C F;  2VR4 A;  4FXG B;  3AKT A;  3MPB A;  5FY0 A;  3HNY M;  4DB5 A;  2BJS A;  3NV3 A;  3OGV A;  3OB8 A;  3KHC A;  5M0T A;  2ZXQ A;  3GHM A;  4HVQ A;  2CAV A;  3NJY A;  4QU1 A;  3ZN4 A;  4IGO A;  4IGP A;  3VHO A;  3NVC A;  4U2A A;  1GBG A;  3UNP A;  3SNM A;  2ZEW A;  1COV 1;  3NNM A;  2VMG A;  4XUO A;  1O59 A;  2JG8 A;  4CEY B;  1ZYB A;  4XPV A;  4OMC A;  1B35 A;  5CNA A;  5GLU A;  3ZM8 A;  4MXW A;  1H2N A;  2I07 B;  2D3R A;  5KXE A;  5A32 B;  1G7Y A;  1RUD 1;  4I0A A;  2W87 A;  2WS9 2;  1OXC A;  4R8H A;  1LAJ A;  2Y38 A;  1H1A A;  4YG6 A;  1FNZ A;  2PHL A;  5IFP A;  3CZJ A;  1TMF 1;  3J7N A;  1WBL A;  4UW4 A;  1MS0 A;  2JDU A;  3HMY A;  3M3Q A;  5FY5 A;  3ZDV A;  1KDM A;  2ILM A;  5IUQ A;  5IK8 A;  1NCQ C;  2GP5 A;  5KR7 A;  2TEP A;  1VBD 1;  1PNG A;  5HCF A;  3FWE A;  1VMF A;  4IES A;  2WZR 3;  1OQ1 A;  3KV9 A;  1H9W A;  3AP5 A;  1AR8 2;  2D5F A;  3GCW A;  2GN7 A;  5FZE A;  4L92 A;  5JDB A;  2Y34 A;  1KD7 A;  5GLV A;  3BU7 A;  2DF7 A;  1N1Y A;  4JAA A;  2W5F A;  4Q5O A;  5C9A A;  2J1R A;  3WP6 A;  1W9F A;  2ZML A;  3HWJ A;  4W6Y A;  2WKK A;  3A0K A;  1AX2 A;  4HN1 A;  4RL7 A;  5LAT A;  5CU1 A;  3UKV A;  5GJ6 A;  1AUY A;  2ETE A;  1ZX5 A;  5IK4 A;  3AP7 A;  4KWL A;  1W8O A;  3LD8 A;  2Z42 A;  3NL1 A;  4IV3 A;  1S1A A;  1VR3 A;  2E7Q A;  3POY A;  4YAR A;  1BVV A;  4N53 C;  1S0I A;  3O1V A;  1COV 3;  5C8W A;  1NY7 2;  2VTX J;  1HRI 1;  4D0Q A;  2WZP P;  3WDV A;  5A3L A;  3K51 A;  1UX6 A;  1ENQ A;  3DV8 A;  3Q8F A;  1SZB A;  1RUD 3;  4XFG A;  3C8X A;  4WM7 C;  3ACH A;  3IDE A;  2YY1 A;  5CEH A;  4OI0 A;  1JI6 A;  1W6P A;  2D6O X;  4XFC A;  1TMF 3;  4CDU C;  2UY9 A;  2BRT A;  4E4D X;  5KHK A;  1CWP A;  3KZ4 C;  5A7W A;  5J96 B;  4OUL A;  2WO7 A;  2XHN A;  5SV8 A;  1ZBE 2;  3U0Z A;  1S2E A;  3LFI A;  4NAO A;  3AZY A;  4QXK A;  1JZ7 A;  2ZEX A;  5FLI A;  3PDQ A;  3ZN5 A;  1X8E A;  3I97 A;  1YC6 1;  1RL3 A;  1XC6 A;  4LBL A;  3VD9 A;  2V4V A;  3SCG A;  4G3Y C;  5JOX A;  1KIT A;  1X7N A;  2DU1 A;  4UOJ A;  4TZD A;  3ALQ A;  5JAX A;  2ZX1 A;  2ZS6 B;  4FVV A;  1NA1 A;  2QQP A;  4IND A;  1WW7 A;  2ZZJ A;  4MYE A;  5E1R A;  3OBR A;  1CJP A;  2DTW A;  4BDV B;  5IK7 A;  1HIX A;  4UFH A;  3F2Z A;  5JMC A;  3IIA A;  2QVS B;  3VBR B;  1LKN A;  2QE3 A;  3HN3 A;  1NT0 A;  5DDJ 1;  3OPW A;  5FQ0 A;  4L8Q A;  4QDS A;  1HRI 3;  2BP6 A;  1S2B A;  4UFI A;  3M2M A;  2MPF A;  3QH7 A;  5C5U A;  3GJA A;  1D4M 1;  1O8S A;  4MGQ A;  3S6P A;  4YNI A;  4R9D A;  4ONU A;  4AFM A;  4HKL A;  1MZ5 A;  4UFK A;  4CXW A;  4DS0 A;  1UZW A;  2R04 2;  3ZXE A;  1IQA A;  2ZGS A;  2ZHK A;  4XFA A;  1IGO A;  4WM8 A;  5FZ6 A;  3DYO A;  1SBE A;  1H2M A;  3PVE A;  4DFS A;  1FV3 A;  4D6R A;  4EE2 A;  3LSE A;  4JVA A;  2PTM A;  2IXH A;  4O7X A;  3VBF B;  5F6L B;  1RUO A;  1NZC A;  2Y6G A;  3NAP C;  4E4H A;  5FMC A;  3BTX A;  4B3N A;  1FXZ A;  1H8T A;  4MG2 A;  3ZFE C;  2WFP A;  2J1V A;  3WNK A;  1TE1 B;  4COV A;  1XNC A;  4YWA A;  4I0W B;  1RJ8 A;  4QPI A;  1OLR A;  2WWU A;  3OEB A;  5EIY B;  1EUT A;  1K5M B;  1T6B X;  1SFP A;  2WO1 A;  5ABJ C;  4QQ2 A;  5KHH A;  1GU3 A;  4AED A;  2BEO A;  1CAX B;  1W2T A;  5BNO B;  5F2S A;  3V56 A;  1O4Y A;  3G6J B;  3I3D A;  2A3Y A;  1BEV 2;  1U5Z A;  4IEX A;  1UN1 A;  1VBA 2;  3IT8 A;  4J1X A;  5DDJ 3;  1RUH 1;  4ZS3 A;  4WVZ A;  4AHX A;  4YGB A;  5KXC A;  3M8L A;  3N7K A;  4FBF A;  3W21 A;  4DPN A;  1Y3T A;  3KQR A;  1HB3 A;  1D4M 3;  4LHL A;  5LY1 A;  2LW8 A;  1WMF A;  2ARE A;  4BIS A;  2J1S A;  2QFE A;  1AYM 2;  1YQC A;  2WNV B;  5K0U A;  4A7Y A;  4IE5 A;  1RC6 A;  2BGP A;  1WWY A;  2E31 A;  3NNF A;  1YO8 A;  1US2 A;  3RRD A;  3V65 A;  3WEZ A;  2YFZ A;  4RQP A;  1ULF A;  5EJ1 B;  5FYH A;  3ZX7 A;  3A0N A;  1OLM E;  1PO2 2;  1ND3 C;  1PGW 1;  1QJY 1;  4W4Z A;  1C28 A;  3WNM A;  1T2X A;  2X5I B;  1JOP A;  2WT2 A;  1RMU 2;  1UCX A;  1R1Z A;  2VOW A;  1W0P A;  2WT1 A;  3EJK A;  2PHR A;  1JZ6 A;  1SBD A;  1N47 A;  3BU0 A;  2E7A A;  4N9I A;  4XCB A;  1UOJ A;  4FQZ A;  4LA2 A;  1GNH A;  4UFL A;  1NG0 A;  1OHF A;  4BQW A;  4D69 A;  3HQX A;  3PVO A;  2DVD A;  4ASK A;  4YYO A;  4FPC A;  3FZ3 A;  2B5H A;  2R32 A;  2VPV A;  3PTY A;  1W6M B;  5C3P A;  5C3Q A;  2O8Q A;  3WG2 A;  4XF1 A;  3VL9 A;  4X6Q B;  3LDR A;  1CIW A;  5FYT A;  4Z2A A;  5CFC A;  4QX1 A;  2C5D A;  2D44 A;  4JGY B;  1RUH 3;  3L2H A;  4QX8 A;  4Y22 A;  4K3U A;  1QIQ A;  3KT1 A;  5FY8 A;  2Y6H A;  3AMH A;  1BKZ A;  4PIX A;  4YZ3 A;  1IG0 A;  5EP9 A;  2OII A;  3GBW A;  1F5F A;  2PYT A;  4LK6 A;  2ZAA A;  4KQ7 A;  2GND A;  4CDX B;  3AJZ A;  2OA2 A;  3RI8 A;  2XXZ A;  3USU B;  4CDW C;  3VZL A;  3NJZ A;  4NIH A;  4JC1 A;  3FX3 A;  1J3P A;  3EYP A;  3RJR A;  3TEX A;  1QJY 3;  1LOF C;  4QXB A;  5FXZ A;  5KXD A;  3PU8 A;  1UKR A;  4S2D A;  2C0Z A;  1PIV 1;  1QJX 1;  2ERF A;  5A3W A;  3N7M A;  1O7F A;  5FYI A;  5L7O C;  3NV2 A;  3ES1 A;  4ITC A;  1GZC A;  5DG1 A;  3ABZ A;  3SIS A;  4LBQ D;  2HBU A;  4XOG A;  1CPM A;  2FDH A;  3K4D A;  4AQT A;  4KGQ A;  4C1X A;  3GGL A;  1OKQ A;  4MAD A;  1WBF A;  1XNB A;  5JMO A;  1R64 A;  2AR6 A;  5J09 A;  3ST7 A;  3KT7 A;  1C5I A;  5H9Q A;  3RFR A;  3CQO A;  1EAH 2;  3I4I A;  4R9C A;  1CAW B;  3ZXK A;  3FC0 A;  2H0B A;  2QQL A;  3ECQ A;  3IMN A;  2P1B A;  2CGO A;  4P9J A;  1HKD A;  2KR2 A;  3EHK A;  4BXS V;  3MBW A;  5FRE A;  1EUU A;  2XL7 A;  3M3O A;  4LBQ B;  4P9W A;  3E6B A;  2Y0O A;  4QD2 A;  1AR7 2;  1D0G A;  1LES A;  3OY8 B;  1W9T A;  3GDB A;  2JJ6 A;  1LJ7 A;  1L7Q A;  4PCR A;  1F9K A;  3U14 A;  1SEF A;  3I2I A;  3BPZ A;  3H7J A;  5K7P A;  2R6Q A;  5FWJ A;  1QNW A;  1S55 A;  4XBQ A;  4QX3 A;  3RDI A;  1GWK A;  1JZ3 A;  1PIV 3;  1QJX 3;  4MV2 A;  1GFF 2;  2KM2 A;  3ME2 A;  4PI2 A;  4IE4 A;  3O0W A;  3ILR A;  4HET A;  4CU9 A;  2FDJ A;  2DUO A;  3AX4 A;  4GKY A;  2IXJ A;  3GZA A;  3PJY A;  2WLQ A;  1WMX A;  2G19 A;  5A33 B;  3FL7 A;  1UZ0 A;  4WVM B;  4ZY9 A;  3SCH A;  1FI2 A;  4N43 A;  4CP9 A;  1JMU B;  1C5H A;  1PVC 1;  2VMD A;  3VDD C;  4RSU A;  4XUN A;  1OC1 A;  4Q1R A;  3HPN A;  4YGC A;  1F15 A;  2QZ3 A;  3CNA A;  2RS3 2;  3KQ4 B;  5FZO B;  2MEV 2;  4HLT A;  4A7Z A;  1C8M 2;  3BUC A;  1W2N A;  1XNK A;  2ZX2 A;  4BWO A;  2R49 A;  1TVG A;  2C9A A;  3PVN A;  1RXG A;  1L3J A;  3IPV B;  4MGK E;  3KB5 A;  3WXP A;  5FZC A;  5FWE A;  3B5L B;  2RS1 2;  2TBV A;  4B4Q A;  4AVB A;  3ZFG A;  4XFI A;  1MQT B;  2OUH A;  4BQX A;  4AK3 A;  3P1I A;  2HKX A;  4DZG A;  2HWF 2;  3B7M A;  3HVD A;  3J8F 2;  3ZYH A;  2VCC A;  1Y43 B;  5ANN A;  1IS6 A;  2Q1F A;  4OQ9 A;  2GN3 A;  4DNY A;  4ZHN A;  4YG3 A;  1RVF 2;  3OYW A;  3HOB A;  3CJI A;  4K21 A;  1ZRE A;  5JPM B;  1TG7 A;  2UWC A;  4GH4 A;  4HPK B;  4PIZ A;  2RM2 1;  5DQ0 A;  3ZXA C;  3O1U A;  3K75 B;  1AXK A;  4BYY A;  3D3A A;  2BVV A;  3SCF A;  3HJR A;  2WBK A;  1QDO A;  3H1Y A;  4DRV A;  3E5U A;  3WG1 A;  4ZON A;  1IG3 A;  2HWE 1;  1PVC 3;  3AYA A;  1L7L A;  1BYH A;  3I54 A;  3QD6 A;  1S0E A;  3FLT A;  1EYB A;  4E2Q A;  2D6K A;  5IT6 A;  1UMH A;  5CAZ A;  2P37 A;  1QJU 2;  4RHV 2;  5F3C A;  2F17 A;  4DUX A;  3NV1 A;  1RUI 2;  3AVS A;  2VOK A;  2SLI A;  1NQJ A;  4AHY A;  4ZZ5 A;  4NVP A;  2VCB A;  2GC2 A;  3KF5 A;  2ENR A;  5CKM A;  3V0B A;  5B4X A;  2BOJ A;  4H55 A;  4E9K A;  2CDO A;  2EIE A;  3PNA A;  2YGM A;  2Y6K A;  5T5O A;  2LM3 A;  4A41 A;  1YFY A;  1YJL A;  4U36 A;  1XYP A;  4C90 A;  3S57 A;  2VL4 A;  1XOY A;  3AZZ A;  1FOD 3;  2V72 A;  1UYZ A;  4CDU B;  3BCW A;  2CWS A;  5D8A A;  4B4R A;  2ZAC A;  4FOW A;  4QDR A;  1FAY A;  2W1S A;  4QQH A;  5E88 A;  4MGT A;  3RWK X;  3WF3 A;  1MS3 A;  2P6H A;  4GJZ A;  4YW7 A;  4Q4Y 2;  1WCQ A;  4ORF A;  1GOG A;  3AZW A;  2Y64 A;  1NXM A;  5BNP A;  1NE6 A;  2RM2 3;  3D6E A;  1GQH A;  4FAG A;  4NHL A;  1QXP A;  4ZKT B;  1VJ2 A;  3VBO A;  2HEY F;  5B4N A;  1L7R A;  1D7P M;  1TQ5 A;  3MV0 1;  2XUE A;  3ACF A;  5H9R A;  4A3X A;  2WUH A;  2PHU A;  5FY7 A;  3GAL A;  2C6S A;  2HWE 3;  4WV8 A;  4EV0 A;  1IS4 A;  4IER A;  4Y3O A;  1ENX A;  1XRU A;  2FMD A;  4MZU A;  5F5C A;  1AJO A;  3AM2 A;  3D4K A;  4P9I A;  1O3Q A;  3T2P A;  4QPG A;  3ILN A;  3VD5 A;  2VVD A;  2WYF A;  2WNU B;  1H0B A;  3WV6 A;  2Q8D A;  2OUJ A;  2P3Y A;  3I8T A;  1HN0 A;  2D6M A;  2EIB A;  4MLO A;  1RUE 1;  3IAP A;  2VZP A;  2QQM A;  3FE5 A;  1XNA A;  4NO4 A;  2WYS A;  3MI8 A;  5CZK A;  5LB6 A;  4R4X A;  4OHZ A;  4FQ4 A;  3UKT A;  5A3U A;  5JI7 A;  3DPR A;  3NST A;  2O8O A;  2D43 A;  1LUL A;  1N3Q A;  1CZV A;  4GJY A;  2VM9 A;  2XVL A;  3VBR C;  1QKQ A;  2HH9 A;  1NAE A;  3RSJ A;  1HRV 2;  2W52 A;  5ACA 2;  4XQ4 A;  2A6V A;  2XJP A;  5FPB A;  4MO3 M;  4K1Z A;  3TBD A;  2R1B A;  4AHZ A;  1DDL A;  4FFI A;  4H7L A;  2J1T A;  2Y0I A;  4TN7 A;  1LHW A;  5IVB A;  3ACG A;  4XZU G;  2XVG A;  1X50 A;  3VN4 A;  4YVW A;  3O14 A;  4FTB A;  3GJB A;  4MSV A;  1RUJ 2;  4UBH A;  3KV6 A;  1PMI A;  4KU8 A;  5A7Q A;  4RR3 C;  1DQ5 A;  3JBG 2;  2RV9 A;  1OD3 A;  3ZYI B;  2WZ8 A;  4GWM A;  4XJU A;  4AEK A;  1MEC 1;  1PMH X;  5HV4 A;  2PXJ A;  3WW3 A;  3WSO A;  2YDE A;  1DQ2 A;  5K4L A;  5ABJ B;  4CP1 A;  1MS5 A;  4FOV A;  4Z2W A;  4KG0 A;  4CUC A;  4YW5 A;  4UW5 A;  4BE3 A;  3I2G A;  4UF0 B;  3AMP A;  2QKD A;  4D8M A;  2XJR A;  2WO3 A;  3FHA A;  5CBL A;  4WBB A;  1QHD A;  4YM0 A;  5JR7 B;  3E5X A;  3R0R A;  5FZF A;  1RUE 3;  3WR0 A;  5C3O A;  2EXI A;  4FPO B;  1GAN A;  5FO9 B;  2XQX A;  4FO9 A;  2AAC A;  2G9Z A;  4CPB D;  1XE0 A;  1GQP A;  2UWA A;  5AC9 1;  4HXC A;  4F83 A;  4LO5 B;  3S7E A;  3MIE A;  3SH3 A;  4G9S B;  3T09 A;  2XL9 A;  1CJD A;  5A7N A;  5FYU A;  1Z7S 1;  3WLU A;  4AFD A;  4PF1 A;  4KWJ A;  5I8S A;  3OCP A;  4QQP A;  1XSQ A;  4H2A A;  1UPS A;  2RS5 1;  3CO2 A;  3KMH A;  4CCK A;  4V2V A;  5CFD A;  5T54 A;  5I0S A;  2VMF A;  3NNL A;  4Z92 B;  2JIC A;  5FOJ B;  5FMO L;  1QH6 A;  4TSV A;  2ZBJ A;  4PBO A;  1ZRI A;  1K12 A;  3BOD A;  3UGF A;  5CKN A;  5FYV A;  3H3L A;  4KGG A;  4CEW B;  4AAP A;  2I2S A;  3ZXG A;  2X53 S;  3AP4 A;  3I2J A;  3LOI A;  4QAW A;  4E4S A;  4CCL A;  1HXS 2;  2YV8 A;  2CV6 A;  2ZGK A;  3J4U H;  1MEC 3;  3LEK A;  1X33 A;  5T5P A;  1PO1 1;  3K3O A;  2X10 A;  4AQ6 A;  5T3N A;  4IL7 A;  3C3V A;  3W20 A;  1X82 A;  2YGL A;  3L9J T;  3NJX A;  3UKN A;  2XB6 C;  2JDK A;  5FUP A;  4FPY A;  2VAU A;  3AFK A;  4BME A;  3DCQ A;  4ZPI A;  4GWJ A;  4LOR A;  3MO4 A;  1O5U A;  3R05 A;  5J36 A;  1QOS A;  2XGX A;  2NYY A;  4QB6 A;  5FPV A;  4AQ2 A;  5AC9 3;  4AE2 A;  4XTM A;  4ZXK A;  3ZSE A;  4A6O A;  1W06 A;  3N7J A;  4JGY C;  3BIW E;  1QOO A;  2CTV A;  2DUQ A;  3LEG A;  1Z7S 3;  3K48 A;  4FOQ A;  4RFR B;  2RR1 2;  1UXX X;  1CES A;  3I2H A;  4PQQ A;  5IVJ A;  2NLR A;  2RS5 3;  4FPL A;  1W6Q A;  2VNV A;  1W6N B;  4RFT 0;  2TNF A;  4FPE A;  4IV1 C;  4YPJ A;  5L7O B;  3P6B A;  3D82 A;  3PIJ A;  1X36 A;  5DAV A;  1PMJ X;  5C4W B;  3TNP B;  4XTP A;  2WLP A;  3MDP A;  2VUD A;  5J1X A;  1RB8 G;  4MX3 A;  1U5Y A;  1UOG A;  3B69 A;  5EPA A;  2IVJ A;  1WZX A;  4LBM A;  3LDK A;  1MS1 A;  5JXH A;  1PO1 3;  1OI6 A;  4D6S A;  3V0A A;  4K20 A;  1EV1 1;  1UKG A;  2HJI A;  3WG3 A;  2W3J A;  3C2U A;  1AR9 1;  1J3R A;  2A6W A;  4CEY A;  3WNL A;  1GR3 A;  5L36 A;  5LWB A;  4RGA A;  5A32 A;  1DZR A;  3MUY 1;  4UFJ A;  2QQI A;  1R08 1;  2VC9 A;  4OUM A;  5EYX A;  3PHM A;  1QQP 2;  4QXC A;  5EZW A;  2XBO 2;  4NMI A;  4F3J A;  1BVP 1;  4XAE A;  3GNE A;  1JZ8 A;  5FJK A;  4UXA A;  4HON A;  2RDR A;  2ZA9 A;  3R4D B;  5FK8 A;  4D7T A;  3A7Q A;  1BMV 2;  2Q0A A;  3B94 A;  4PHZ A;  4UFM A;  1WLW A;  4W6W A;  5FY1 A;  2BTV C;  3J7M A;  1SCS A;  2YC2 A;  1C4R A;  2OVU A;  3H7Y A;  5I0D A;  1A8M A;  5IYY A;  1YLL A;  3KF3 A;  1W99 A;  1RIN A;  2Z2S B;  2UU8 A;  1YIP A;  2J1U A;  2FD8 A;  3VKF C;  1N1S A;  1Q8Q A;  4FFF A;  5BY5 A;  2YBK A;  4FP3 A;  4AI8 A;  1G8W A;  3OJB A;  2EAA A;  2W94 A;  3VD4 A;  2TUN A;  1KJR A;  2WR9 A;  2CU5 A;  3P3N A;  4HK8 A;  3QH6 A;  3UGG A;  3GZE A;  3M3C A;  2VCM A;  2ORX A;  3DXU A;  1EV1 3;  1D2Q A;  1GZW A;  4Q8L A;  1AR9 3;  1GSL A;  3VBU A;  5IFT A;  3H3Z A;  4K9S A;  1G9B A;  2WSV A;  1VE0 A;  3VDD B;  2YC4 A;  1R08 3;  5GZD A;  4KI5 M;  3WDU A;  3BPS A;  4NN0 A;  1N3P A;  4IET A;  3AB0 A;  2ET1 A;  4LLF A;  1O6U A;  3AXD A;  2X8K A;  1WLT A;  4UW3 A;  3AMQ A;  1Y4W A;  3O1S A;  3EO6 A;  4Q29 A;  5DUW A;  3TEW A;  2EF6 A;  2ADE A;  3SEP A;  5EJZ B;  2PHD A;  2YBS A;  1RUF 1;  1DYK A;  3U07 A;  1OMI A;  3UGH A;  3I3B A;  3AKQ A;  1MPX A;  2Q30 A;  1JYI A;  2DCJ A;  2VU9 A;  4PLO A;  1ASJ 1;  1VBC 3;  3LB9 A;  2JDN A;  2VQA A;  3APB A;  1O3T A;  2B45 X;  3WDY A;  3B01 A;  5E8A A;  4P9G A;  5FYY A;  3T2T A;  2BW8 A;  2JEN A;  2WZR 2;  2D93 A;  2DDU A;  3FHQ A;  2C1F A;  5EWS A;  3U4S A;  3WQ1 A;  2K9Z A;  4KBB A;  3QAC A;  1OUS A;  1MQT C;  1QF3 A;  4H14 A;  4P08 A;  4FTS A;  2D6P A;  1NUK A;  3OOX A;  4NPL A;  4LO6 B;  1DQ6 A;  3G7D A;  2IC1 A;  3M3E A;  4L99 A;  1LTE A;  5DAQ A;  4BIO A;  5FZ8 A;  2FCT A;  2VNO A;  5F7U A;  1HN1 A;  1UU4 A;  3SIT A;  4F8A A;  4I0B A;  4AVT A;  4LXL A;  1V00 A;  1NZI A;  2E53 A;  1UIK A;  3UL2 A;  5FPZ A;  3I49 A;  1COV 2;  3T0A A;  3WDW A;  4XFH A;  1VAM A;  1QJE A;  1W2A X;  3RZG A;  1GLH A;  1O3R A;  1OOP C;  2ZHM A;  5FZ9 A;  3EBR A;  1RUD 2;  1DGW A;  3LDB A;  2JE7 A;  3R4U A;  1RUF 3;  1OVP A;  3K77 A;  4LIV A;  4P9Y A;  5F6K A;  4J6G A;  5HCH A;  2DCY A;  1S0C A;  3VBF A;  1PNF A;  1BJQ A;  1R1A 1;  3U1X A;  4I09 A;  5BNN C;  1ASJ 3;  2W08 A;  4QXH A;  1NY7 1;  3H8U A;  1TMF 2;  4IEW A;  4KG8 A;  2XJT A;  4YM2 A;  5KHG A;  3I59 B;  4AI0 A;  2JB4 A;  4FXK B;  5LBC A;  1LRH A;  4BLJ A;  1REE A;  2D98 A;  3MHZ A;  5CIS A;  1OQD A;  3WOG A;  1JU4 A;  1PK6 B;  1UY4 A;  5DUX A;  4B4P A;  5C3R A;  4IEQ A;  1K5M A;  2JDP A;  1SLA A;  4OMD A;  3CZU A;  4HZF A;  5IW0 A;  3THC A;  2WT0 A;  1DGR N;  2BGC A;  4HMZ A;  3ASI A;  1O3S A;  2E33 A;  1CVN A;  1CAX A;  1NOV A;  1TEI A;  3I2K A;  3VDC A;  5DAW A;  5EYY A;  5BNO A;  2O1Q A;  5FOB B;  1ZBE 1;  5EHD A;  3DL3 A;  3MUZ 1;  4NRQ A;  5CKQ A;  3WIN E;  5JIU A;  3UET A;  1OSG A;  3E97 A;  2AYH A;  3VBS C;  5CVR A;  1SCR A;  3I3M A;  4YZ2 A;  4Q27 A;  4TLG A;  2D97 A;  4FT8 A;  1VBD 3;  2D7F A;  4C0B A;  4DY3 A;  5JZG A;  4LO7 A;  2B8M A;  2ZAH A;  3CKH A;  2YXS A;  3GHN A;  1S2K A;  4B7E A;  1GWM A;  5IAT A;  2XH6 A;  2WNV A;  3BGA A;  3GYD A;  3H1W A;  1VMJ A;  3O7O A;  2CYF A;  5F5I A;  2R0F A;  5LA0 A;  5FY4 A;  3FHI B;  4H7M A;  1HRI 2;  2YPJ A;  1ND2 A;  2EVX A;  2XLA A;  4BHP A;  3HD8 B;  2CWM A;  2OPW A;  3TRS B;  2JG9 C;  5FCC A;  1WW4 A;  5F3E A;  1W6O B;  4M4R A;  2E7T A;  4YLZ A;  1JYX A;  2ZJC A;  2QQN A;  3WUD A;  2WIN B;  1R1A 3;  1W8W A;  3ATG A;  2W92 A;  2X5I A;  5DAX A;  4PJY A;  3O1M A;  4IGQ A;  4JGZ C;  1PGL 1;  4N8M A;  1UMZ A;  2Q4S A;  3NW4 A;  2WNU C;  5HV0 A;  2DFB A;  4PT6 A;  3MLJ A;  5C8C C;  5DZG A;  3H3U A;  3DUI A;  1IQD C;  2WQZ C;  3HNM A;  2DUR A;  4BM8 A;  3TEZ A;  3GZU C;  5FTT C;  3M4F A;  3VBH A;  1H9P A;  2P6C A;  3HT1 A;  1YI7 A;  4XQD A;  5A80 A;  1B35 B;  3HAG A;  1AR6 1;  1W6M A;  3H8R A;  2OS2 A;  2N7G A;  1ZBE 3;  3WCR A;  3DYM A;  4RR3 B;  4JZR A;  1DGR A;  1HJF A;  3JD7 1;  5C33 A;  3KV4 A;  5FZ3 A;  3O1R A;  4CU7 A;  3VKM A;  5L9R A;  1VP6 A;  4CP2 A;  1OUR A;  2IVI B;  1IKQ A;  5FMB A;  1GOF A;  4CDQ A;  4CDX A;  1MZ6 A;  2R06 1;  5FMO S;  4LKF A;  4AGG A;  4S2G A;  5DDJ 2;  1ZRF A;  3V64 A;  1JYC A;  3CJI C;  3A22 A;  2BVB A;  5HCB A;  2XKO A;  2AC1 A;  1OUX A;  5F5Q A;  5DXD A;  4ASM B;  4PDW A;  3WF0 A;  4BLI A;  1D4M 2;  4EWD A;  3IDA A;  4AZZ A;  1HB1 A;  4OUE A;  3VUO A;  2BDR A;  2ZEZ A;  1BEV 1;  3GBF A;  4SLI A;  5A7S A;  3RQ0 A;  3TYJ A;  2RG4 A;  3O5S A;  4Q26 A;  2GC3 A;  4K8F A;  4RN5 A;  4DO0 A;  2ZGP A;  1EPZ A;  2QQK A;  1OA3 A;  1E5I A;  1MS8 A;  3LKJ A;  4QX5 A;  2YU1 A;  1JH5 A;  5FV3 A;  4ARX A;  3LWC A;  4EWE A;  3ZYF A;  3AXE A;  4IV3 B;  4G4F A;  5IWF A;  4AVC A;  2WDB A;  2DBI A;  2P17 A;  3PL0 A;  1I5Z A;  1LOA A;  4M00 A;  4YGE A;  1AR6 3;  1CAW A;  1UZV A;  2B7Y A;  3JU9 A;  3OBZ A;  4K7J A;  3WP3 A;  1BBT 1;  1UZZ A;  1FMD 2;  3QLQ A;  1JZ5 A;  1RTV A;  3ROU A;  5A3N A;  5HXM A;  3F95 A;  3KLS A;  2VTF A;  5GLZ A;  3VLB B;  3JD7 3;  3ZYG A;  4NRO A;  1ULO A;  1W6P B;  5FBZ A;  5FLJ A;  4AI2 A;  4CA9 A;  4BQ3 A;  4CRQ A;  5IAX A;  3VGI A;  5LA9 A;  4OQ8 A;  1GMM A;  2VZV A;  2R06 3;  3FLP A;  4IE6 A;  1RED A;  4IUG A;  4CEW C;  2B9V A;  1RUH 2;  1V6O A;  1I6X A;  1J83 A;  2WAA A;  4YVS A;  3T1M A;  3JCI A;  1PVX A;  4CVU A;  4CU8 A;  4KWU A;  1KXG A;  2D6L X;  3ELN A;  4QM9 A;  3LFM A;  4DEV A;  4E2S A;  1YIF A;  5A7O A;  4QB1 A;  5FP9 A;  2E6V A;  2RE9 A;  3DXT A;  3S30 A;  3C7E A;  3VBO C;  4PLN A;  3OPZ A;  4AHW A;  1WCU A;  2Q8C A;  3WD5 A;  3EQE A;  1BEV 3;  3MIH A;  4YW2 A;  1YEW A;  5FJH A;  1OVS A;  3CU7 A;  5J7M A;  1Y9G A;  3T30 A;  3CIH A;  1QGL A;  3BAL A;  1V9U 1;  3IMM A;  2XDV A;  4I2O A;  3VZN A;  1PGW 2;  1F35 A;  1QJY 2;  2J42 A;  4W65 A;  4X8P A;  1NCR A;  1ZVF A;  3O12 A;  4MVT A;  2ZX3 A;  4XUR A;  2ZKN A;  5G04 L;  1UF2 C;  5A33 A;  2QQO A;  1N1V A;  3ILF A;  2J22 A;  5K8S A;  4IV1 B;  4J1W A;  4LMF A;  4WZF A;  2ZHL A;  2VQ0 A;  1BBT 3;  2B4K A;  4O9E A;  2V5D A;  3T08 A;  4LHK A;  3C7G A;  4NJ4 A;  1CGP A;  4XVH A;  1ZBA 1;  3TN9 1;  3OUJ A;  5GKA C;  2BNO A;  3OTF A;  4LLO A;  5FZO A;  2ZGU A;  4XDQ A;  3OBA A;  2YC0 A;  4A42 A;  5JLV A;  1JHN A;  4JDN A;  2ZGQ A;  5AVP A;  1SLC A;  1RHI 1;  1Q5O A;  3MIC A;  1WUV A;  4X6R B;  1YFW A;  1CAV A;  1BK0 A;  2E63 A;  4COY A;  2YRO A;  3KT4 A;  3U37 A;  5C4W C;  2OZJ A;  2YYO A;  5ISL A;  3N9M A;  4GB3 1;  2GH8 A;  1GWL A;  4K8R B;  4Q4V 1;  2O0O A;  3PUS A;  4L97 A;  2YB7 A;  4XF4 A;  3ZKY A;  1AYN 1;  2DYC A;  2MHF A;  3KSC A;  5LK7 B;  3DGT A;  4GWI A;  2VH9 A;  3PME A;  1NXD 1;  5A6Q A;  1NLR A;  3DF0 A;  4LUM A;  4P00 B;  4QHZ A;  4AQS A;  2HWC 1;  2AEZ A;  4CCE A;  2HWB 1;  2ZGM A;  2G9F A;  1NCQ A;  4HAN A;  1UXZ A;  3AK0 A;  3K4Z A;  4XFB A;  2RVA A;  5ANQ A;  5FP3 A;  4FPG A;  5LBF A;  5T5J A;  2YU2 A;  1V9U 3;  4AED B;  4BPZ A;  2W95 A;  4HVO A;  4AOC A;  4MHR A;  4JQT A;  3KV5 A;  2PQQ A;  4NAM A;  1X8M A;  1J3Q A;  1BK1 A;  1PIV 2;  1Q8S A;  1LGB A;  1AZD A;  1QJX 2;  2PHT A;  3INA A;  3MF9 A;  2B39 A;  3WP4 A;  4M3C A;  1CAU B;  4UWD A;  1V6K A;  3SH5 A;  1UW8 A;  2QQW A;  3U75 A;  4CUG A;  1W39 A;  4Q0Q A;  4XIK A;  1C1F A;  3TWI A;  3OF1 A;  3UV9 A;  2UWB A;  1Q8P A;  3RJ2 X;  1V0A A;  3OGS A;  2AH2 A;  4YM3 A;  2EXH A;  3UT0 A;  1ZBA 3;  4Y5Z 0;  3TN9 3;  4WVV A;  1KRI A;  1GP6 A;  1ULE A;  1WLD A;  1W2U A;  4A6S A;  3BTY A;  4RQP B;  4N53 A;  2JDY A;  1DGL A;  1RHI 3;  4A45 A;  5EJ3 A;  3MIF A;  4GB3 3;  1MR5 A;  3RZJ A;  4UI9 L;  2OXB A;  4Q4V 3;  1W9Y A;  4WM7 A;  1NE4 A;  2W1U A;  1AYN 3;  3VKN A;  2JD4 A;  2VEC A;  3WDX A;  4YG0 A;  3AYE A;  1JW6 A;  5F2W A;  2X05 A;  2Y6F A;  4CDU A;  1S0F A;  2HWC 3;  2J1A A;  3J7L A;  2HWB 3;  5KWR A;  1ZRC A;  1SBF A;  1YWK A;  2WRA A;  4XQW A;  2G4I A;  4GXL A;  1VRH 2;  2RS3 1;  4D3W A;  2BNN A;  1UIJ A;  2NMN A;  2K46 A;  4S2F A;  5FZ4 A;  2VE1 A;  4BK4 A;  3VDB A;  2FZ2 A;  4GA9 A;  2IXI A;  2ZX0 A;  5CFC B;  2CSG A;  5JSP A;  1H1I A;  2GAU A;  2LUW A;  3FMG A;  4XJZ A;  2WAO A;  4TXW A;  1SAC A;  2JB8 A;  2VCA A;  4Y22 B;  3ZXD A;  4K6B A;  3VD7 A;  1IPK A;  2FQP A;  1V6L A;  3D8C A;  5E6H A;  1AXZ A;  1YI9 A;  4L11 A;  4ES8 A;  2GC1 A;  5FZ0 A;  2A6X A;  3JQX A;  2IUW A;  4KBZ A;  2GH2 A;  4QX2 A;  2HWF 1;  1OFS A;  3J8F 1;  2BFU S;  4IE7 A;  3EB7 A;  5JXI A;  1YRZ A;  2Z5W A;  3ZXF A;  1DFQ A;  1E5S A;  1RVF 1;  2BU9 A;  5GZE A;  4EN7 B;  3MEP A;  3BIE A;  3U4X A;  1PVC 2;  4TTG A;  1LED A;  1ZZ9 A;  3NQH A;  1WKY A;  2VZ1 A;  1K42 A;  1MS4 A;  2C24 A;  5DZE A;  2IFR A;  4RS5 C;  4WZC A;  2YMZ A;  4XEZ A;  5H9S A;  1PGS A;  3VDA A;  3Q8A A;  5D21 A;  5KBF A;  3KCX A;  3SQO A;  3H50 A;  4X8N A;  1CON A;  2VBB A;  3M70 A;  1OOP B;  4NPM A;  3D0S A;  1Y9M A;  4I02 A;  2WNE A;  4Y24 A;  1QJU 1;  4XF3 A;  1TNF A;  2RS3 3;  1H2L A;  4XC9 A;  3RGB A;  2DV9 A;  5T52 A;  3NNG A;  1YQ6 A;  1QXJ A;  4LBN A;  3NAP A;  1FOD 2;  4NPR A;  3T4H B;  4BJ0 A;  1AHS A;  2Y26 A;  4DMI A;  5BNN B;  3A21 A;  3WHT A;  2JE9 A;  4BZ4 A;  2CNA A;  3I3Q A;  5GAL A;  3ZFE A;  3ZIX A;  5LEK A;  3LPG A;  3CF6 E;  2ZX4 A;  4JRL A;  5DZF A;  3POI A;  5F9T A;  3RZH A;  1JYN A;  4C91 A;  4K40 A;  2W9X A;  3ZFF C;  5C6C A;  1XB9 A;  1VAL A;  4D94 A;  1JS9 A;  3LIG A;  3PIG A;  5LEJ A;  5IK5 A;  1HQL A;  5A3M A;  5ABJ A;  2PQS A;  2HWF 3;  3ZYP A;  2ADD A;  2NMO A;  2RM2 2;  2YHJ A;  3LQC A;  3RPQ A;  2ZGT A;  3AC0 A;  4LE4 A;  4UF0 A;  2PN5 A;  3VD3 A;  1E57 A;  1RVF 3;  2CDP A;  1UYY A;  3LA2 A;  5DUU A;  3VBS B;  3HN1 A;  1LHV A;  4NR1 A;  2HWE 2;  1PK6 C;  4YZ4 A;  3WUC A;  5FUI A;  4Y1V A;  3IAQ A;  4Q4Y 1;  5FYS A;  3S5A A;  3HQR A;  5C71 A;  4OVE A;  5FFO C;  1T6G C;  1F2N A;  1CQ9 A;  2CY6 A;  2XHK A;  1K3I A;  3FN9 A;  5A3O A;  1VLN A;  2VUL A;  3ZMN A;  3J9S A;  3I3E A;  2CL2 A;  1U5I A;  4NIA A;  3ZVX A;  4EQV A;  4EJR A;  1FX5 A;  1ND3 A;  2JG9 B;  1DIW A;  2VMH A;  1QJU 3;  1OLQ A;  3SKV A;  5LA2 A;  4MXV A;  5F3I A;  3WT3 A;  1ALY A;  1RUC 1;  2FDI A;  4JGZ B;  1ST8 A;  1W8H A;  5FPX A;  5I8T A;  4E27 A;  1UU5 A;  3LGR A;  1OPM A;  3H8X A;  3AKP A;  3VV1 A;  2LRO A;  3K2O A;  2VO5 A;  1M4W A;  1ACC A;  4MH0 E;  5C8C B;  3KGL A;  3L2Y A;  3BN6 A;  4K1Y A;  5L7O A;  2PHW A;  2Z4F A;  2XON A;  3W5M A;  4Q4X 1;  1JOD A;  4NWW A;  1KDK A;  2UY8 A;  5BV6 A;  5FYC A;  1VAV A;  1G9A A;  2FDF A;  2G1M A;  1GP5 A;  1W0N A;  1VIW B;  4XFF A;  3GCX A;  2ZGN A;  1G9D A;  3KCY A;  3POJ A;  5I91 A;  2I45 A;  4Y20 A;  4Q4Y 3;  4CUA A;  5FUN A;  3VZK A;  5IAV A;  2JG8 C;  2EAK A;  4DOU A;  3WF2 A;  3HR9 A;  1B35 C;  5EFU A;  4XIL A;  4HFS A;  4QQL A;  4AW7 A;  1G9F A;  1V6J A;  1N1T A;  2R07 1;  1WD4 A;  2GNT A;  3OYW B;  3CJI B;  4CDW A;  2QUO A;  1JZ4 A;  1JBC A;  2QZ2 A;  1MZE A;  5LRS A;  2DCT A;  1D4V B;  1JOB A;  2B9U A;  4BA6 A;  2PMW B;  2KA3 A;  3USS A;  1LOF A;  4CSW A;  4IEZ A;  4M3C E;  1W6N A;  2GDF A;  3VHN A;  3UK9 A;  1RUC 3;  1R09 1;  2P3K A;  5KC5 A;  4KL1 A;  4E8C A;  5A1L A;  2ET7 A;  5JR2 A;  3OD0 A;  4AL9 A;  2JX9 A;  4Y5T A;  4LEJ A;  3KWV A;  2DVG A;  4ZU5 A;  5LAS A;  2NN8 A;  2ZGR A;  4FAH A;  3R6S A;  1NKG A;  3AYD A;  3WZ1 A;  5C9A C;  3WG4 A;  2ORZ A;  4DUV A;  3BI3 A;  3ZIW A;  5C70 A;  4Q4X 3;  3K4A A;  4JCK A;  4GKX A;  3TAY A;  5BUV A;  3POG A;  1CN1 A;  2IZW A;  2JD9 A;  3Q8B A;  4N7U A;  3MW2 A;  4QU2 A;  4Z8B A;  4ATE A;  1JU3 A;  3CDZ B;  5B2G B;  2ZGO A;  5T50 A;  4BXF A;  5FLH A;  3B3Q E;  1MEC 2;  3I7D A;  4IV3 C;  5IHR A;  4YZ5 A;  3AL6 A;  4FSJ A;  1W04 A;  3AJY A;  1GOH A;  3BOP A;  4N7I A;  4COW A;  1AL2 2;  1CX4 A;  3MID A;  4GAZ A;  1ULC A;  1WCS A;  1DYO A;  2E9Q A;  5D8A B;  5KHJ A;  3AZX A;  1LOD A;  1GP4 A;  1D2S A;  2R07 3;  4XXA A;  2Q1Z B;  3LAG A;  1J1T A;  1TME 1;  3H0O A;  4QMA A;  1JYW A;  2OT7 A;  1HV0 A;  3HIF A;  2YPD A;  1FV2 A;  1LNS A;  3FFQ A;  3ENR A;  3PU3 A;  3W59 A;  5BNP B;  1US3 A;  3VBO B;  4AI1 A;  3THT A;  5AC9 2;  1LU1 A;  4IEP A;  2DU0 A;  1R09 3;  4FPF A;  3KHB A;  4IQP A;  1X9P A;  4JV4 A;  1NLQ A;  1Z7S 2;  3S0M A;  3NJV A;  1GNZ A;  2RS5 2;  1RYY A;  2B42 B;  4R52 A;  4B7K A;  4QPG B;  3O0V A;  1NA1 C;  2R30 A;  2CHH A;  2R16 A;  1JXN A;  3OSD A;  4NID A;  1VBB 1;  2VQU A;  4A2U A;  1S0G A;  2FHR A;  1CIY A;  2ARA A;  5FZK A;  3VDD A;  4EN6 B;  3DPR B;  4NII A;  1LCL A;  5FZG A;  3E6C C;  3FUQ A;  2VVF A;  5A1A A;  4HKO A;  2VY0 A;  1PO1 2;  4BQ2 A;  3MIG A;  5ERL A;  3CL1 A;  1P8J A;  2YG0 A;  1H6Y A;  3ZR5 A;  4HVR A;  4QPY A;  4CCJ A;  3T0B A;  3FUO A;  4QHO A;  2A7A A;  2W46 A;  4QKN A;  3QOP A;  1TME 3;  4RGK A;  4YVW B;  3O0X A;  1Q56 A;  3RNS A;  4XZP A;  4Q4W 1;  4AGR A;  2D3S A;  2HBT A;  1W8N A;  2BWA A;  2W0X A;  4WM8 C;  2QDR A;  1AXY A;  3N36 A;  4AG4 A;  1H4H A;  3POB A;  3T0D A;  5CG9 A;  1W8T A;  2W39 A;  4E2G A;  4DRR A;  2VZR A;  3O1O A;  1A6C A;  3ZSK A;  4PI0 A;  4NWV A;  2JE8 A;  1EP0 A;  1VBE 1;  4QB2 A;  4QT6 A;  4Z1V A;  1APN A;  1H8T C;  3OD4 A;  1UU6 A;  4JKL A;  1XU1 A;  2QBX A;  1HJG A;  3PLQ A;  2XJS A;  2WQ4 A;  1IOA A;  4QPI C;  2HWD 1;  4DQA A;  5DAB A;  1IS3 A;  3I2F A;  5F1R A;  1VBB 3;  1W8F A;  1FPN 1;  2W68 A;  1V70 A;  3IBM A;  4AED C;  5K9Y A;  1STM A;  2OPK A;  1QH7 A;  5F39 A;  4BK5 A;  3LPF A;  5AFB A;  1QJZ A;  1I5P A;  4OUS A;  1BHG A;  1EV1 2;  2WFF 1;  2HEV F;  2XJU A;  3B93 A;  1AR9 2;  2QJV A;  2PAK A;  3ETP A;  3VHR A;  4MET A;  2PLV 1;  4RYD A;  2QDN A;  5C3S A;  4FPH A;  1R08 2;  1VMH A;  2PEL A;  3PTR B;  4YW4 A;  4ZU7 A;  5K0U C;  2VZQ A;  4CE8 A;  3KS7 A;  2NPI A;  5JUV A;  5I0R A;  5A7P A;  1WA4 A;  4Q4W 3;  4SBV A;  4WVW A;  4FPK A;  1WA6 X;  4RQP C;  3N3H A;  3AMM A;  4OCT A;  3WW1 A;  3E6D A;  1H1M A;  2FCV A;  3BVC A;  4M4P A;  4MGI E;  1O4Z A;  4DXT A;  4Y4Y A;  1OBN A;  4QGN A;  5LK5 A;  2ZEY A;  1VBC 2;  1O4T A;  1VBE 3;  2EXJ A;  4CYD A;  1ULD A;  1RUG 1;  5FZ7 A;  2JDA A;  3WQB A;  3IKW A;  2RMU 1;  3RZK A;  2RDS A;  5FPA A;  5IVE A;  5FRA A;  1HB2 A;  4LOT A;  1H8V A;  4JX0 A;  4AF9 A;  1K5J A;  2HWD 3;  4O9G A;  4A3Z A;  4QKD A;  2GMP A;  5EXO A;  3SC7 X;  1YCI A;  1FPN 3;  3KCC A;  3GXU A;  5I93 A;  4N9H A;  2A1X A;  2IFW A;  4HKW A;  3AL5 A;  5CFC C;  3MFA A;  4UBG A;  1JYV A;  1W9S A;  3WQ0 A;  2BER A;  3OUI A;  1LEC A;  2WFF 3;  2W47 A;  4FOY A;  2WZR 1;  2RDQ A;  2W1W A;  2WS9 1;  2ZOE B;  3ACI A;  2PA7 A;  2PLV 3;  3KM5 A;  3U10 A;  2WN2 A;  1XBF A;  2P4E A;  1W8U A;  2F4L A;  4P9L A;  3C7F A; 
#chains in the Genus database with same CATH homology
 3PL0 A;  4NHM A;  3OBZ A;  3GJB A;  4NHY A;  4J25 A;  4BQX A;  3KT1 A;  4NMI A;  5LBC A;  5ERL A;  5IAX A;  5HV4 A;  5EP9 A;  5LA9 A;  2RDR A;  4XAC A;  4IW3 A;  2G1M A;  4XAA A;  5DAW A;  2RDN A;  3OUH A;  2HBT A;  2Y33 A;  5IAV A;  5C5T A;  4ZON A;  5C5U A;  3GJA A;  4KBZ A;  5IAT A;  5M0T A;  2HBU A;  4BQY A;  3NNJ A;  2V4A A;  3GZE A;  4NHX A;  3EMR A;  2OPW A;  3KT7 A;  3NNM A;  5L9V A;  3NNL A;  2JIJ A;  4XCA A;  5DAX A;  4XAB A;  4Y5T A;  5EQU A;  3OUJ A;  5LAS A;  5HV0 A;  5L9B A;  4Y5S A;  4XC9 A;  3W20 A;  3KT4 A;  3MGU A;  4JZR A;  4NHL A;  2Y34 A;  4ZPI A;  2JIG A;  4Q5O A;  2FCV A;  3BVC A;  4NHK A;  3W21 A;  5L9R A;  5LBF A;  5LAT A;  3DKQ A;  4MHR A;  4MHU A;  3NNF A;  2RDS A;  2FCU A;  3ITQ A;  4UWD A;  2G19 A;  3HQR A;  5DAQ A;  2FCT A;  5A3U A;  2RG4 A;  5LB6 A;  2A1X A;  5DAV A;  3OUI A;  5LBE A;  5EPA A;  4XCB A;  2RDQ A;  4BQW A;  5LBB A;  5DAP A;  3HQU A;  4NAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...