3ITQA

Crystal structure of a prolyl 4-hydroxylase from bacillus anthracis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
198
Chain Sequence
KEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLADVNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolyl 4-hydroxylase, alpha subunit domain protein
publication title Crystal structure of prolyl 4-hydroxylase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 57
structure length 198
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3itqA01
3OUJA 2HBUA 5ERLA 5LB6A 3HQUA 5IAVA 3GZEA 3OBZA 4XCAA 5EQUA 3W21A 2JIJA 5LBBA 4IW3A 4Y5TA 5LBCA 2FCTA 4UWDA 4NHKA 4NHXA 2RDRA 4NMIA 4ZPIA 3OUHA 3NNJA 3MGUA 3NNLA 5LBEA 2HBTA 5HV0A 4XCBA 4XAAA 3HQRA 4NHYA 5IAXA 4KBZA 5LATA 4JZRA 5LA9A 2RG4A 5DAVA 2RDNA 3EMRA 5DAXA 5L9VA 4XC9A 3NNFA 2FCVA 4MHUA 5EPAA 5LBFA 2JIGA 2Y34A 3NNMA 5A3UA 3DKQA 3KT7A 4BQXA 5DAPA 2OPWA 2A1XA 4ZONA 2RDQA 2Y33A 4BQWA 4XACA 2V4AA 5L9BA 5L9RA 4NHMA 5C5UA 3KT4A 5DAQA 5DAWA 3W20A 5C5TA 3ITQA 3BVCA 5M0TA 5HV4A 2RDSA 5EP9A 4BQYA 2FCUA 4Q5OA 4NAOA 3GJBA 3KT1A 4MHRA 4Y5SA 3GJAA 4XABA 2G19A 5LASA 3OUIA 3PL0A 4NHLA 4J25A 2G1MA 5IATA
chains in the Genus database with same CATH superfamily
1OKOA 2X29A 2XG3A 1JYNA 5A6XA 2P4EA 1D4M2 2DDUA 2JX9A 5H9SA 4COYA 3WDWA 2RS33 2OS2A 4FTBA 3KF3A 4QU1A 1RUF3 5F3EA 1UY3A 2QDRA 5CFCA 4RHV3 1DZQA 1PO23 2ZHNA 4BYYA 5GALA 2XL9A 2UYAA 4NPLA 4L92A 3LAGA 5CVRA 4XBNA 4AI1A 1LR5A 4AEDC 5LY2A 2WZPP 2ZZQA 1UYXA 1VBA1 4CDUC 3TEZA 1YEWA 5FZ4A 3U11A 1JOJA 1W0NA 3QCWA 4YVSB 2DCYA 3LA7A 1UY2A 3W5NA 2JB4A 1UZ0A 1RUE2 5F5QA 4QKFA 4E2SA 3QOPA 1DYOA 1TG7A 3MYXA 1QU0A 5JWPA 1KS5A 5F2WA 2DVAA 4FSJA 5K0UA 3VKOA 2NYYA 3RS6A 3I2DA 3LKJA 3WSOA 4O61A 4Q8LA 2PN5A 4RFT0 1OVPA 5HV0A 4F3JA 2BTVC 3NAPA 1ZBE3 1SDDB 4LE3A 4Q2FA 4QX7A 4ATFA 1F9KA 5JOZA 1R093 2FBEA 2GH8A 2HEYF 3ZIXA 3MBWA 4M3CB 1POV1 5DUVA 3EO6A 2GNMA 3CKHA 1GU3A 2JG9B 4YG3A 3WVJA 2GP5A 4ZKTB 4CDXA 2KD7A 3WP5A 3AZYA 1LKNA 3BYWA 5J1XA 2VMFA 4QX2A 3ZXFA 3MW4A 3NKTA 1D4VB 2RDNA 5FUNA 3M3OA 5L9VA 1ASJ1 5A3WA 3AYDA 2FCVA 5LBFA 2GP3A 3VDAA 5FRAA 3VZNA 2Q1MA 4WM8C 1UW8A 5DZGA 4NROA 2E9QA 2XUMA 4FCAA 1VBD3 3NQHA 1VE0A 3MV01 3SH4A 1VBE2 2QQVA 2VG9A 3Q9OA 3WCRA 5L36A 1WMXA 4PIXA 1KRIA 1B35C 1NCQC 1XU1A 2GH2A 2X5IB 1UF2C 4WBBA 4LT5A 4N53C 1QDOA 5T54A 4GMP3 4DRRA 1CONA 2RHPA 4DY3A 5CIRA 3HPNA 2Z5WA 4R4ZA 3MLJA 2CV6A 1UX7A 1GOFA 3G6JB 4PDWC 4TLGA 2VQUA 5DDJ3 1QNYA 3SH3A 4B7EA 1CZVA 3VD5A 1UD1A 3ZFFC 2RM22 5IVFA 1MVQA 1MQTC 4MUVA 1REEA 2R0FA 3ZFGA 3PIGA 4RGKA 4YWAA 4BXSV 2WUHA 1OLQA 1O3TA 4CCDA 2ARXA 1QOSA 2G9FA 4XFAA 1PIV1 2FMDA 1NQJA 3HNYM 4Q0SA 4MGKE 1OPOA 2CY6A 3ATGA 4D6QA 4R9BA 4QKDA 2W87A 1GZCA 1NCRB 5E16A 4L99A 4RR3B 1RUH2 3VD7A 4BQYA 5F39A 2ZGUA 4BOWA 2C26A 3IAPA 2XUEA 3AJZA 3NSTA 3ZXAC 5AVPA 1KITA 4E8CA 3O1PA 3T2OA 1JUIA 1VBC1 2P3IA 2VBBA 2XJSA 2BQPA 5LASA 1OLME 1SZBA 4PI2A 4XJWA 1YQCA 2AH2A 2LW8A 3DCQA 1K5MC 3ORJA 5IATA 1OI6A 1QXRA 2IFRA 3M3EA 2OT7A 4IEXA 3TN93 3BU0A 4QM9A 1XYNA 4ZS2A 2D6KA 5HXVA 5D1IA 3K51A 1XYOA 4I0AA 1FOD3 2JG9A 1VRH2 2VOKA 3OJBA 4IV1A 4P08A 2HWF3 4IQPA 4E2QA 5FFOC 4LEJA 3CJXA 5FYIA 4KNCA 3RQ0A 2YYOA 3ZR5A 5ABJC 2JE9A 1FX5A 1I9RA 4JKKA 2OIIA 1LHUA 3B9IA 1X36A 5EJ1B 2EAAA 4LBQA 2PHUA 3ZPOA 4Y1UA 4LHNA 2VAUA 3WF0A 3G7DA 4GWNA 2JG8B 1FATA 3I3BA 4XF0A 1AR72 2WABA 3OGVA 3MIBA 1LGCA 2W0XA 1ULFA 2CNAA 4QPGC 2ZGOA 3LEKA 2HKXA 2YG0A 3KVBA 4NJ4A 1DGWX 1TE1B 1GFF2 4E2GA 4EZHA 5HBAA 3RYRA 2ZAAA 4I3PA 3AJYA 1EV13 1LTEA 1NE6A 1RUC1 1JN2P 5EYXA 5C3OA 2P5BA 4M0HA 3N9QA 4EN8B 2VTXJ 2GN7A 5FBJA 5FMBA 3A4UA 1O59A 2DV9A 5T5LA 4NIIA 1C4RA 2JD9A 2A70A 2ZX2A 1J3QA 2RMU3 3T0AA 3RVHA 1YQ8A 4HVRA 1GWKA 3KV6A 3VBOB 3SEPA 3BCWA 4Y33A 1MZ5A 1RTVA 2E7AA 2W68A 3HN1A 2WO3A 3LWCA 1BVVA 4QHOA 1OHFA 4FAGA 1FI2A 1NLQA 3J8F2 4ORFA 2VZQA 5CKMA 5JSRA 3M2MA 2Y34A 4XYXA 1UY0A 4ZS3A 3BPSA 4BB3A 3NL1A 1Y7BA 4FFIA 3KD4A 1U5IA 4IV3A 5FXWA 4XHXA 3IIIA 1IS5A 1KGYA 1RUJ3 2AYHA 2RS12 4LUMA 5FOJB 2AEYA 4XOGA 1S0BA 1AZDA 2HWD2 1IHMA 4AFCA 5IVCA 2H0BA 2VW2A 1J3RA 3RDIA 4Y4RA 1E5IA 3HWJA 1CGPA 3VDDC 4OMCA 2PYTA 3I3QA 4BQ2A 4CPBD 3PTRB 4KU8A 1HLCA 5A33A 1GZTA 1OOPB 5C5UA 5JSPA 1YI7A 4GXLA 1ZREA 1LJ7A 1CAWA 4BE3A 1SBDA 4LKEA 3W20A 4ES9A 1QJEA 2VMCA 3IDEA 1VLNA 4ASMB 2I45A 1XNBA 2QTWB 3I3MA 1N1VA 1PMHX 5EP9A 2FHRA 4ONUA 5GZFA 4FFGA 1GUIA 2X53S 4TYSA 1RUD3 3CQOA 2WA3A 2AGSA 2D3PA 1UPSA 2YGMA 2C1FA 4FPCA 4UT5A 5FPAA 1VIWB 5T52A 1ZA4A 2Y38A 1AL23 2Y26A 2WFF1 1DGLA 2DFBA 2HH9A 1GR3A 5BNPC 1PO12 1H1MA 2D7FA 2WZR2 3KWVA 4KBBA 1XJAA 3ES4A 3THPA 4RA0A 1L7QA 2VW0A 2ZX3A 4L8QA 4UYBA 1STMA 4BH9A 2HWB2 3ZFEC 2ZMNA 3KGLA 5LRRA 4LITA 4XCAA 2FDIA 3U37A 4BCUA 3K4AA 4OFGA 3AXEA 2JIJA 2W3JA 4RS5B 4Y5TA 3W5MA 3ZN4A 3WNNA 4QWNA 1QJY2 3TWIA 2JB8A 4Z07A 2XBO3 4OVEA 1PZ7A 5I93A 1UZYA 3DN7A 2RS51 1W05A 1MACA 4IE4A 2Q0AA 2YHJA 5DUWA 1QJX1 1LOBA 1VALA 3RGBA 2CWMA 2XHKA 1Z7S2 3AKQA 3PUQA 4ARYA 5A1LA 1X50A 3IDAA 1CAUA 1KFXL 1NX9A 1D4M3 5KXCA 2EIBA 4E4DX 2ZAHA 3J4UH 4UF0A 3N9LA 5FWEA 5F2SA 4HMZA 1J1LA 1U5YA 4ASKA 3DUIA 4D94A 2P6CA 2A3YA 3AZZA 1HIXA 2VCAA 2ID4A 3VBHC 1RHI3 3A7QA 5FZ0A 1C8M2 3LDBA 1UOGA 2XVGA 3J7LA 3HNBM 1RJ8A 5BNOC 5HPOA 2WT0A 2X8KA 3JD73 4HN1A 1UZZA 2V09A 2WBKA 2BBVA 1W6PB 5EPAA 2W52A 5FZDA 3BUCA 1W99A 3WDXA 2VQ0A 4Q4X1 3AKPA 4DEQA 3X29B 2QBXA 4K8FA 3BODA 2PAEA 5IK5A 3CLPA 3DKQA 3BTZA 5FZ3A 1PMIA 2A1XA 1JODA 2R1DA 3OBAA 1W2OA 2QNKA 5A7PA 3RMXA 3VL9A 3LQCA 5FUPA 3T30A 3O1OA 1R081 2V5YA 4JGYB 3H7JA 1W8FA 2TUNA 4RD7A 4EJRA 1EUTA 5DUUA 4CDWB 4OI0A 3GZUC 2GMEA 5FP9A 1H2LA 4TSVA 1JYTA 4AEDA 2BPA2 2ZOEB 4XFIA 1XPWA 1UO9A 3WF3A 4BQ1A 4AHZA 4CDUA 1LGBA 2XQXA 5CFCC 1YUDA 1AF9A 2VZPA 3ZYHA 1UYYA 3MO4A 3OF1A 2VBPA 1ND3B 4RFRB 4WM7B 4JQRA 3KT4A 4KH9A 1NT0A 1ZX5A 3ZIWA 1YO8A 1VMJA 3R0RA 4QU2A 1XNDA 1QQP1 1VBE3 4LLOA 1BMV1 1BEV3 1F5JA 2CGNA 5FYZA 1Q5OA 5L7OB 2DU0A 4C8DA 5I8YA 1WGPA 3WEZA 1AR81 1ZZ6A 5JMOA 2QQUA 1BK1A 1C3HA 1DIWA 1UKGA 4KWKA 4DEVA 2A73B 5AC91 4OZXA 1W3VA 5K0UC 2QQIA 3AX4A 3E5UA 3FE5A 4EZ4A 3ACIA 3OUIA 2WS91 5J09A 1H8TC 4R9AA 3I59B 3NAPC 4HKWA 1XSRA 2WSVA 1E57A 5ERLA 2SLIA 5FP3A 1TME1 3MUZ1 3SHRA 4OUSA 4BM8A 1DGRN 1AJKA 1ZZ7A 2E51A 1V9U2 2GC0A 2RV9A 2W92A 2YU1A 4N90A 5FY9A 4NAMA 2GNTA 2XKPA 4NIHA 4MGQA 1JXNA 4QX1A 4YZ4A 5E6HA 2QDNA 4CDXC 2C9KA 3OGJA 3KCCA 4YW2A 1K45A 1RUH3 2IC1A 4Z2AA 1NAEA 3FUQA 2P3JA 5A80A 1U12A 4LE4A 4XUNA 1H4HA 2P37A 4JDMA 1W6PA 4IEYA 1B35A 1NCQA 5G05L 4GAZA 5T3NA 1GP4A 3URFA 3ZO0B 4XQDA 5T50A 5GLWA 1AR91 1SLIA 2AZ5A 4GJYA 5L73A 2O14A 5SV5A 1W6MB 2BDRA 3O7OA 4OZOA 4R8HA 4OHWA 2W9XA 5A3LA 5EV7A 1PIV2 4YVWB 4D6RA 5IK4A 1VJ2A 3MFCA 3ZFFA 5A6QA 1BVP1 1VRH3 3AZVA 3OY8A 5I8SA 4Q4Y3 2P17A 4UFLA 4NHYA 3N4MA 4CUGA 2E53A 4OCTA 4AR2A 1WWYA 1WLDA 1GKBA 3C2UA 5FZOA 4YARA 2VCBA 5C70A 1X9TA 1QJU1 2OQ7A 4YGCA 5FKBA 3VB9A 3ZFGC 1FPN3 4A3ZA 1VBC2 3NRUA 3ZN6A 1ULCA 5A32A 4ITCA 5JSOA 2ZMLA 3WUDA 1ND2B 5K7PA 1OQDA 2XGXA 5IHRA 1V6LA 4UBHA 5BUVA 3ILFA 4YVSC 4AOCA 4UXAA 1OPMA 1W8OA 4R9DA 5F5IA 2WT2A 3WW3A 1UNBA 4LKFA 3TAYA 2ZEXA 4CXYA 3GZTB 5DAPA 3H9AA 1UXXX 3AFKA 3OPTA 3T4VA 4Q0PA 5CEHA 1G9DA 3B00A 3MFAA 4GZ9A 4A2UA 1LU2A 2MEV3 4MGZE 2BVVA 4IE6A 3ZXLA 1MS3A 1PVC2 2ILMA 1YIFA 1SLLA 4LTAA 2R071 4GWJA 2I2SA 2VMDA 3N7MA 2ZGNA 4Q4W1 1HJFA 5L9BA 4AVBA 4HK8A 3VHOA 1F8VA 1WZXA 2E32A 3SCFA 1YRZA 4AEKA 3UYJA 1WCUA 3CL1A 1GOGA 4IV1C 2JG9C 3U10A 4AGRA 2XWBB 3QH6A 2ZGQA 1OMIA 2HWE2 5JIUA 2PHRA 2XONA 1DGRA 1RUC2 3I4IA 1GYKA 4F8AA 1Q56A 3SMHA 1UQXA 2YFZA 5FZGA 3S5AA 3BIEA 5FR3A 4QPGA 1NG0A 1VB4A 2RS13 2VNVA 2PELA 2HWD3 1SCRA 2GC1A 3AYCA 4NVPA 3B02A 5DG2A 5B4NA 5LW9A 1RUG1 3KV5A 2F17A 4COZA 1XB9A 4FFHA 4MHRA 4B1MA 5D8AB 3O1TA 2EICA 4UFHA 4QKBA 4CCLA 1DU3D 4XXPA 3PL0A 4NHLA 4QB1A 5FY5A 1J84A 4RGGA 2K9ZA 1ULOA 3K4DA 3LFMA 4IERA 4ZY9A 4HN0A 2HWC3 4QGLA 5JIAA 1ZBA2 4AVVA 5C8WA 5FV3A 2NN8A 2Q4SA 3IMNA 3ACGA 1NA1B 2QQWA 5F3CA 1Q8OA 5A1AA 4LOSA 3USUA 4NWWA 1FMD3 2JDZA 1JYWA 3GGLA 1RYYA 1ND2A 4LO8A 2ES3A 4KWUA 5JVVA 4CP2A 2VCCA 3V56A 1B09A 1AYM3 2JE7A 4HVQA 1TEIA 3LPGA 1NUKA 5DQ0A 1CD3G 3M3QA 2D93A 4TZDA 4NIDA 4UBGA 4HPKA 5C33A 2DBIA 4LUKA 1XC6A 3AB0A 1IZ3A 2HYKA 1EAH1 2IZWA 5DZFA 2Z2SB 4AI3A 3VDDA 2VECA 5D2AA 5FP7A 4DUWA 3WQ7A 1W6NB 3JCIA 5CU1A 5CKNA 4SLIA 3BTYA 2ZACA 4X6QB 5FYTA 1CR7A 2VZ3A 4FPGA 4BIOA 1QJZA 3WW2A 3T09A 3LOBA 1DYPA 1AR62 1R1ZA 3AP6A 3V65A 5LCWL 3C3VA 5KXDA 4DOUA 3SITA 2V72A 4O9EA 5LA9A 3BI3A 1UY4A 2CDOA 5DPNA 4MX3A 3MW2A 1IKPA 1JMUB 2WFF2 3TEXA 2ZHLA 5C4WB 2QQNA 2DYCA 1UZWA 4XJ8A 2VZ1A 2YBKA 1Z7S3 1BBT3 2R1BA 1K5JA 3VBUB 1HQWA 3E6CC 1XE8A 1OUXA 1F4AA 2R0HA 5JR7B 2G9ZA 3AYAA 3KMHA 2R6QA 3AKSA 4UI9L 1ZZ8A 5C3QA 2JECA 2JG8C 4LORA 4A4AA 2R041 5A7QA 4ISRA 2WLQA 3F2ZA 4KMQA 2OPWA 3VD3A 4AHYA 5IAXA 2VZOA 3N7LA 4YW5A 2JDMA 3FLRA 1GQPA 4YGEA 1C8M3 2ZABA 4MGIE 1SHWB 3N7KA 4ATEA 4Z2WA 3ZFEA 2ZX0A 4CCJA 1PNGA 2AENA 3T0DA 3M3IA 5E89A 4A6OA 1OQEA 4P9LA 2RS52 3CBNA 3KHCA 3UKTA 4CP0A 1GWLA 4M3CE 4ZZ8A 4YGBA 3JQXA 3VBOC 1YQ5A 4P9IA 2GN3A 2OVUA 4IEOA 1UY1A 2EIGA 2R32A 1HRI1 3SCHA 1ULDA 2XR4A 4WZFA 4CCMA 3H42B 1SFNA 5DAWA 4AW7A 5LWBA 2BFUS 1YFXA 2J1UA 4AVSA 4Z8BA 1CN1A 1W9YA 2YV8A 2NP0A 1SLCA 3TBDA 4RN5A 2E31A 3WZ1A 1J58A 2CU5A 2BW8A 1IS3A 3S7EA 2VJXA 4IESA 2L9LA 2A71A 1W6OB 3BTAA 1VAMA 2LRPA 5IVBA 3HOBA 1AXKA 1IG0A 2ZZJA 1YFWA 5BNNB 4FI9A 1MEC1 3VZMA 1TQ5A 2IXKA 4GQ7A 3DECA 3B01A 3WQBA 2VU9A 1HXS2 1RMU3 4N43B 3JXSA 1NY71 5GLVA 2QFEA 1GNYA 2Y0OA 3HT2A 4P9WA 4D0QA 1W6NA 3O1SA 1J59A 4MXWB 1KJRA 1BCXA 5I91A 1RVF2 3RZGA 1LB2A 5IAVA 3WR0A 3U75A 2VE1A 3VBFB 5C8CB 4Y1ZA 3ZOIA 4C0BA 4EQVA 1WW7A 1DG6A 1ENQA 2ORXA 1M4WA 3D8CA 3DPRB 2N7GA 5KHHA 2ZBJA 3POWA 4B4PA 5J48A 1G7YA 2D6LX 3ZXDA 2PTMA 3PMSA 3RSJA 4GB31 2WR9A 4QHZA 1FT9A 1APNA 1XXNA 4J1WA 4B3NA 4XW3A 1WW4A 2VTFA 2UU8A 3FZ3A 3IM0A 2XKOA 5IVJA 2R061 3HT1A 2NMOA 4WVMB 4CEYB 5CG8A 3HAGA 3M3CA 4DXTA 5LRSA 3ACFA 1V9U3 1LECA 1OA2A 3VBSA 1LENA 2BERA 4E4SA 1QQP2 1YJLA 1DYKA 2GDFA 3NJXA 1H4GA 4YZ1A 5EIYB 4UW5A 2DBNA 2ZEYA 2XLFA 1X7NA 3RJ2X 2Y60A 3C7EA 1AR82 5F32A 5FXZA 1AJOA 1AYN1 2V5DA 5FYHA 5JXHA 1TMF1 4FXKB 4Q4V3 5AC92 1COV1 2JE8A 2E6VA 4AVTA 4BU2A 2ZKNA 1OC1A 3LDKA 4LPLA 4KU7A 4XFGA 5JAXA 2B46X 1YQ6A 3EMRA 3OEAA 2B42B 4RS5C 3WG1A 1PZ8A 2XWJB 4GH4A 5A3OA 4HT1T 3UV9A 2QJVA 4AI2A 5KXEA 3ACHA 1V6NA 2O8OA 4MHUA 2Z79A 3Q8EA 3NNMA 1JZ4A 2X05A 1XE0A 3AXDA 3LD8A 2IXJA 3AVRA 3PVOA 2C5DA 3HBKA 4Y3OA 4BISA 2OXBA 5FQ0A 2PLV2 1H8TA 3T2QA 3KT7A 3WDVA 2PQSA 4FPYA 4Y24A 1UOBA 1JZ2A 1BXHA 1WMDA 1W8WA 4P02B 1NZCA 2JENA 4CDQA 5AFEA 1SBFA 1W8HA 5CFDA 3VBRB 2QQPA 4XURA 4IGQA 4URAA 5A70A 1W0PA 3ON7A 5FK8A 2W1WA 2VZUA 4MXWA 4I3GA 1EY2A 2H6CA 5L19A 1AR92 2C9AA 1BK0A 2Q8DA 1N1TA 1HB1A 4Y1VA 3SEEA 4DMIA 5C7GA 1IG3A 4PLNA 2JDNA 3HEIA 2NLRA 1NLSA 1RUI1 4N7IA 3WNMA 4PLOA 2OPKA 1W39A 4NRQA 5G04L 2Y6JA 1UU5A 1F35A 3O14A 4GMP0 2QQLA 4XZUG 4XTMA 2A7AA 2YBSA 2ZPXA 3ITQA 4D7SA 4ES8A 4OQ9A 3WUCA 4DXRA 5LEKA 4XXAA 3OG2A 5H9RA 4JTNA 3U07A 1PVC3 4XMIA 2JDYA 1UCXA 4LBLA 4NAOA 2EF6A 4MOAA 1N1YA 1RB8G 4XFHA 3HBZA 5IJRA 4UOJA 3NNGA 1XNKA 2WAOA 2WNVB 4QKNA 2D6PA 3D0SA 5GLUA 3U78A 4BHPA 3OCPA 4CEWB 3GCXA 1DGWA 3E1F1 1NYWA 4CDWC 2ZHMA 2HWE3 2RS31 3L2HA 4CPBA 3AFGA 4XF1A 2GC3A 4AGGA 5C3RA 1RUF1 2ERFA 2GALA 4RHV1 1ONAA 1PO21 2EVXA 2EXIA 2VNGA 1W2NA 2RJLA 3POSA 1OSGA 2D6OX 4YVSA 1V6KA 1ZVFA 1XNCA 3ZSEA 1WLTA 4HSJA 1HRV2 1ND3C 2UURA 2ZGSA 4WM7C 5LK5A 2EIEA 4YLZA 1X33A 5FY1A 3WW4A 5FPXA 3M8LA 2WNEA 4LIUA 5GZGA 3WNPA 1MS8A 4Q4W2 5KBFA 4K20A 4J6GA 3BB6A 3NV2A 2W47A 4JQTA 5L7OC 4NO4A 1SQ4A 4NMIA 3BOWA 1VBB2 4ZPIA 2AACA 1CPNA 3B3QE 3RZKA 2W08A 3VKMA 1HN1A 4Y1YA 3VUOA 4ZU5A 4XPVA 3WX5A 4COUA 3NV1A 5AFBA 3RWNA 1ZBA3 1ZBE1 4M3CA 4K21A 4XAAA 1W2TA 4FPHA 3FBYA 1O5UA 1R091 2A3XA 4AQTA 3VZOA 2BP6A 5FWJA 4UFJA 1L7LA 5ISLA 1LGNA 1W04A 3ZSLA 2XDVA 2GNDA 2UY8A 2YU2A 3AL5A 3GHMA 3PUIA 4ASLA 3WG4A 3H50A 2LM3A 1SMVA 2B4KA 4OI4A 4PJYA 4TXWA 5JOYA 1Z0HA 3K4ZA 2FZ2A 1JZ5A 4R4XA 5FY4A 5A3NA 3OBTA 2V4VA 1VBD1 2X5IA 2XB6C 4A7ZA 4WVZA 3B93A 1TNFA 5DG1A 2VBDA 1OVSA 3PJQA 2D97A 3ZVXA 4P9XA 1C28A 3LDRA 1DZRA 1ULEA 2A6VA 2CHHA 4LJHA 1SLAA 4UFMA 3NV4A 4NWVA 3KVAA 5FMOS 1U0AA 2CAVA 4GMP1 1DLLA 3ECQA 4BDVB 1AR63 2VMIA 4YVWC 1IQAA 2ARCA 2GC2A 2JXAA 4CU6A 2CTVA 2Y6KA 5DDJ1 4MSVA 4LNVA 1W6QB 1JZ7A 1C57A 4YM2A 1Y43B 1AHSA 2WQ4A 4PT6A 2LROA 1QEXA 3H8UA 2C0ZA 2CAUA 5FZEA 4QXKA 2E63A 3KQ4B 1R1A2 3O12A 3AK0A 2Q30A 4LULA 1DP0A 4N7UA 3LZZA 4NHMA 4QX5A 2KXLA 1EAH2 2YDEA 3WT3A 2X10A 1JBCA 2BZDA 5DAQA 4O7XA 1NCRA 4X8PA 4RR3A 4X6RB 2ATFA 3D82A 3PDQA 1ND2C 1QDCA 2GZWA 3IT8A 4FQZA 5T5PA 4IDZA 2W95A 3RG0A 3JBG3 1A78A 4NRMA 3S7IA 3ZMOA 4EWDA 1RUOA 4B4QA 2JDKA 2XQRA 5A3TA 4K9SA 1SDWA 2J1TA 3C8XA 4Y4YA 2G9GA 3DV8A 3GJAA 4HANA 5JDBA 1A6CA 5FP8A 3B94A 4XJZA 3I2HA 3TNQA 5FMCA 5JXJA 3VKFC 2BRTA 2G1MA 2LALA 4LXLA 1F4HA 1E5HA 2TEPA 2XJQA 3TYJA 1IPKA 3TN91 4GALA 1OA4A 4IGPA 5D21A 1OD3A 5ANQA 2WO2A 1V6IA 4FPFA 3KV4A 2X09A 2R042 1FOD1 4Q29A 4AEJA 3OBZA 1CAVB 2VZVA 2HWF1 4XIOA 5J7MA 2F6BA 4D7TA 4C91A 2J1EA 3WY6A 4C1WA 4CXXA 5LBBA 4C90A 5JI7A 5E8AA 4A3XA 4BA6A 4KWLA 2UWBA 4DUVA 2A6ZA 3P3NA 1PGL2 2ZMKA 2D5HA 4LK6A 5EZWA 2JG8A 2WO7A 4HSLA 4RQPB 2WRAA 1H30A 1GZ9A 3J7MA 4QD2A 1Y9QA 5A6ZA 3N9MA 1FAYA 1HXS3 5A6YA 4CU8A 3VDBA 1VP6A 1YHFA 2XOMA 5EYYA 1CAXB 4OI1A 2YFUA 1FXZA 5ACA3 2D3SA 3AMQA 3NNJA 2QVSB 2OQ6A 1PGW2 1C5IA 4YSFA 1RVF3 3MPBA 1EV11 2R16A 3S6PA 2RR13 5T55A 2VMEA 4XDOA 4M3CF 1J1TA 3UNPA 4PCRA 3VBOA 3B69A 5JMCA 3ZYJB 3H1MA 4I01A 3VLBB 3BKZA 2RMU1 4AHWA 5F1RA 3CO2A 1QXJA 2HYXA 1IQDC 1X9PA 1S0GA 4QXCA 4A45A 4PI0A 5LATA 4QB6A 2EA7A 4TTGA 3WQ0A 1W8UA 4COWA 1GNHA 1MS0A 3L9JT 5A1FA 2QQKA 1OA3A 1REDA 1H2NA 1XOYA 3O5SA 3SNMA 1EPZA 2NQYA 4N9IA 1GV9A 3SC7X 4CP9B 2ORZA 2XVLA 4IEPA 3NMBA 3WP3A 2W1UA 3FHIB 3ETPA 1OKQA 3EJKA 1MVEA 4N9HA 1NLRA 2WWSA 1G8WA 4AVAA 1PK6B 3HMYA 2WFPA 1RUJ1 3GM8A 4FPLA 4XETA 2DUOA 1GICA 2WYSA 4PQQA 3GXUA 1CX4A 3WDYA 4CSWA 4O9GA 2FDKA 1GP5A 4L9BA 2CSGA 1UAIA 4BQWA 1UOJA 2E7QA 4QM8A 1U5XA 4OQ8A 4HZFA 3Q8AA 1RUE3 2UYBA 3OPWA 3V0BB 1HQLA 1OOPA 5L9RA 5KHKA 1YWKA 4AFMA 1ULPA 4P9GA 1W0OA 3I7DA 1YYNA 1LHVA 3OPZA 1CAVA 3AMNA 5JR2A 2DWRA 2R49A 2PLV3 5C4WC 1M06G 4E4ZA 1WMEA 3EB7A 4XQ4A 4Q27A 3UJQA 4LA2A 5HV4A 3U0ZA 1I5PA 1TVGA 3V0AB 5T5JA 3VBUC 1RUD1 1MS4A 5TSWA 1SPPB 3I54A 5FZCA 1AYN2 1Q8VA 1VBA2 2O8QA 2YBPA 4WM8B 4XF9A 3MIEA 3M7AA 3NJZA 2VUCA 3AMHA 4FPEA 3ZYIB 2YPJA 5FLIA 4NPMA 1RGSA 2G19A 1AL21 5JZGB 3D5OA 3VBSC 3VL8A 4LHSA 3M70A 3AL6A 4HOOA 4XIKA 3N3HA 5FLJA 2FCTA 5H9QA 5A7WB 1YCIA 1XQNA 2WINB 4N53B 2VM9A 1BYHA 3MI8A 1ZM1A 3QBQA 3WQ1A 2ZX4A 4AK3A 3KGZA 5FJKA 1VAKA 3DL3A 4HKLA 3MHZA 1D2SA 3HVDA 3POGA 5EXOA 1W9SA 3VV1A 4RS5A 3CJIB 4PDWB 5F7UA 3LIHA 4E8DA 5C9AB 1HB2A 3B9CA 4JRAA 3VDCA 5FZBA 2JJ6A 3CEWA 4XDPA 3W21A 3I2IA 1MQTB 3RMYA 1ZRDA 3CHXA 3ASIA 4GH4C 3JU9A 2BWCA 1IKQA 3MLLA 3GBGA 5I8TA 5IT6A 1RC6A 2XBO1 2PHWA 4UWDA 3OYWB 3POEA 3PU3A 2DF7A 1QH6A 1KQRA 4FPKA 1D7PM 1CPMA 3K3OA 4QPIB 2RM23 4YZ3A 1ASJ2 1O91A 5BY5A 3AKTA 4AAPA 3UL2A 1D4M1 2WNUB 1XRUA 4QMAA 4CDQC 2VQAA 1ZZCA 3S30A 3D6EA 5CFDC 1WA6X 4XCBA 1Q8QA 5FZFA 1PM4A 4DPNA 4FOYA 4XAEA 1O5LA 1F2NA 4JHTA 4QX0A 1HRV3 5B4XA 3CMGA 1RHI1 1REFA 3V0BA 1K5MB 2OZ6A 2P6HA 2YXSA 4JGZB 3U14A 4XQWA 1GZWB 5FJHA 4IE7A 4CVUA 3N7JA 4JZRA 3VBFC 3ZKUA 1ZYBA 4FQ4A 5E1RA 3U1XA 3ZN5A 5C8CC 5F5CA 1G9BA 2FDFA 2RG4A 4CU9A 4BMBA 5CB7A 2K2SA 3DEMA 2BU9A 3DPRC 2EIDA 3JD71 4RL7A 1JOBA 4XZPA 5FZ6A 1MS5A 1D0GA 4JVAA 3NNFA 3RJRA 1VBB3 4ZHNA 2JDPA 3ZSJA 2J1RA 3UGGA 5CA6A 3GNEA 1RUF2 2ADDA 4XTPA 2VCMA 4RHV2 1HV0A 5F3GA 1PO22 3RNSA 4OHXA 4KGQA 4MG2A 4MGTA 3K3NA 4JGYA 4K40A 3R4SA 2IXHA 2D98A 4ZZ5A 5J96B 4CDWA 3K77A 3O1VA 2Q8OA 3BPZA 4LBJA 3I2JA 5FYVA 4FPOB 1W90A 5BV6A 1SFPA 2Y0IA 2WQZC 3CDZB 2YY1A 3POFA 4LBNA 4MH0E 1HB4A 5FYBA 3RFRA 1HJGA 4SBVA 3O1MA 3Q8BA 3C7OA 3SISA 4W6YA 1H0BA 1YFYA 1KDMA 1ND3A 2B9VA 2VZRA 3GALA 4WM7A 1JZ3A 1AR73 3H8OA 1QOOA 2AC1A 3RZZA 4DXSA 1IPJA 4BLIA 1IPSA 4FTEA 2ZXQA 4BK5A 3WDUA 4AI0A 1YIPA 1JTZX 4P14A 2XJVA 4V2WA 2IXLA 2ZJCA 1W03A 1O8PA 1ZBE2 1VBE1 4R52A 1ACCA 1R64A 1BEV1 4MO3M 4XFBA 4ARXA 4PF1A 3ZM8A 4EWAA 2C6SA 2XH6A 4HG6B 3U4SA 5HXMA 3NWKA 1WCDJ 4QDRA 4AI9A 1RUNA 3RYPA 4UW3A 5A7NA 1UYPA 4XFFA 1JUHA 2WT1A 3MUY1 1FYUA 1UL9A 1YC61 3UKNA 3VGIA 3T0BA 5C71A 2Q5TA 1ZRFA 1S0DA 4AEMA 4GKYA 4DUXA 2VY0A 3MIDA 3PVEA 1W8ZA 3I59A 4LBMA 1PGSA 5FYUA 2YPDA 1KFUL 2BWAA 2JKXA 5FMDA 1H6XA 3A21A 4QQLA 2TNFA 1K12A 3KM5A 1ALYA 5LEJA 3I97A 3OUJA 2DFCA 3J8F3 4LA3A 1CVNA 2ET1A 5FY0A 2P34A 1XNTA 2VC9A 3FL7A 3J26N 3RI8A 3CZJA 1VBD2 4JCKA 3BN6A 3HQUA 1WBLA 1RL3A 2JKBA 1QF3A 3O0VA 1GQGA 4G3YC 2Y6LA 3PUSA 5FXXA 1LOEA 3ROUA 3ZSMA 4AFDA 5E88A 1SLBA 1OUSA 1RUH1 1UMIA 2Z42A 2ZGTA 3M1HA 2J42A 1RINA 2ZEWA 3PUAA 4GWIA 1PZ9A 1HV1A 4Y1XA 4EROA 5B2GB 4DRVA 2R30A 1ZRIA 4P00B 2JEMA 1G6NA 4QPWA 1E5SA 4NE9A 5C6CA 2D6MA 3HIFA 1W6MA 2X5IC 4I09A 2VUJA 5I0TA 4YVWA 2VXJA 2IVJA 4YZ2A 1KDKA 2ET7A 2PAMA 3OUHA 4B4RA 3MGUA 1T6GC 2BFUL 3PHMA 4K6BA 4TLFA 2IVIB 1CESA 3SH5A 2WNVC 2QKDA 4IGOA 2VD7A 1VRH1 4LO5B 4CEWC 2FMYA 3DXTA 3OSDA 4Q4Y1 1S0FA 2ARAA 1XNAA 5JCTA 4YFZA 3MIGA 2IUWA 4IEQA 1KS4A 1JS9A 4UFKA 5BNPB 4X8NA 2DUPA 4L97A 3UK9A 2ZS6B 4ZU4A 5JLVA 1J83A 4META 5F6KA 3I8TA 3JB8A 1FPN1 3LCPA 3WLUA 4YFWA 2WC2A 3D3AA 4LKDA 1NCRC 3RZLA 4Y22B 1FNYA 1G9CA 4RR3C 2VMGA 4YG0A 3N36A 4QQPA 1S0EA 2XLAA 4C1XA 4ET7A 3AMMA 4YYOA 2J1VA 5F6LB 1DQ4A 1PO13 2RE9A 2WQ8A 3A0KA 2WZR3 2W2IA 2BNMA 4YG6A 4O65A 4CP1A 1IS4A 4YPJA 2FD8A 5FUIA 3J7HA 2HWB3 1JU3A 2EXHA 3K2OA 4OLLA 4DY5A 2QQJA 3T1LA 4AFAA 5CG9A 1NE4A 2MEV1 1VB2A 1PMJX 3UGHA 5LA2A 2D5FA 3TNPB 4F7ZA 1QJY3 4BJ0A 4QQOA 1SG3A 4XACA 1EYBA 3C7FA 3OD0A 5I0SA 4QQHA 3A0NA 2D3RA 3LEMA 1UX6A 4GIQA 3I2FA 4GD4A 2BGOA 3P6BA 1O3QA 4IXLA 2A5ZA 5JXGA 2JDAA 1JU4A 4QB2A 2VO5A 2Q8EA 3IZOA 5F8PA 2HEWF 5BNOB 5FZ7A 5M0TA 2KA3A 2RS11 5F3IA 1T6BX 2VTXA 2VNRA 1ENSA 2HWD1 3IPVB 3FHAA 3O1RA 5D8AA 4L0PA 4Y20B 1AXZA 1Y9MA 4Q5OA 4XBLA 1MPXA 5FYYA 3GJBA 2Q8CA 1A8DA 1MZFA 3WXPA 1O3RA 2FQPA 4IEUA 1U5ZA 4INDA 4A7KA 1UXZA 2BUKA 4AXOA 3PTYA 1MZ6A 1HQNA 2ZKLA 1QJX2 3IN9A 1W9WA 4GJZA 4DNYA 3UT0A 1NA1A 3FN9A 1GNZA 2HWC1 2YUEA 5FZIA 5J3UA 4AQSA 1DF0A 2H6BA 3DKWA 1UMHA 1RUJ2 2ZGPA 3NO8A 2WN2A 2PHTA 3WDTA 3SKVA 1G9AA 4WVWA 3FFZA 1FMD1 1SLTA 3OBRA 4XJ9A 4OULA 5EWSA 4HFSA 1MZEA 1Q3EA 1VBA3 2OUHA 2UWAA 2VPVA 4QXBA 1F15A 1BJQA 1POQA 1AYM1 4MZUA 2WSUA 4L11A 1H9PA 4NHKA 4C0HA 1H1AA 3JZVA 1PX4A 4HKOA 3W59A 3LPFA 3I2GA 4LKSA 1GANA 4FXGB 4DS0A 3EHKA 3RRDA 5KWRA 2HEVF 1RITA 4M00A 2BOIA 2XL7A 4FFFA 1S1AA 1ODNA 4Q4X2 1DZTA 3VD4A 3R4DB 3VKLA 5KXBA 3CZUA 1OT5A 2B7YA 4NOTA 1LEMA 5K0UB 2DVBA 2PXJA 1WLCA 4RYDA 3RWKX 3HQRA 5DUXA 1F31A 5FTTC 4LIVA 3DYPA 4I2OA 5DMYA 2PHFA 2WKKA 3NAPB 1OOPC 4M01A 1POV3 1R082 1JHJA 3ZMNA 3H3LA 2PA7A 3OD4A 5C4WA 2VMHA 5EHDA 1BLZA 2XPJA 4LO6B 4QAWA 1CIYA 4FT8A 4YW4A 5A7SA 1AL22 3ZKYA 5JOWA 3VBUA 2LUWA 5IFPA 1ZA7A 4HBNA 2YZ4A 3POJA 2O1QA 1Z7S1 1BBT1 1ASJ3 2IFWA 1JYCA 5FY8A 2RJ2A 4LO4B 4OI2A 4XUQA 5CYYA 5FXVA 1N3OA 1UIKA 5HCFA 2Y6FA 4P5HA 3IPVA 2LTNA 3I3DA 5FPLA 2IWGB 3WOGA 1BMV2 3FFQA 4BQXA 3MLKA 1LU1A 4DB5A 2SBAA 4G9SB 3EQEA 1SACA 1N3QA 4DXZA 4H7MA 1C8M1 5C3PA 4OHVA 1S4CA 3FLPA 2HLEA 5IVEA 3ALQA 3ZYFA 4EN9B 2BBAA 3ZX7A 3W58A 1EPWA 3W9AA 2WDBA 4DZGA 1PHMA 3LA3A 4AI8A 1L7RA 3MF9A 4CUAA 2WS92 3T3YA 1C8NA 4YW1A 2J22A 3CNAA 5F5AA 3ZDSA 1V6JA 3PIJA 2ARBA 1TME2 2A6WA 2RVAA 2Y6HA 3GZAA 4I0BA 3R6SA 4NIGA 2DVGA 1KJLA 1PIV3 3PVBB 5C5TA 3N9NA 3VKNA 3ZFGB 5JXIA 3ILRA 1W6OA 2DVDA 1DHKB 4Z1VA 5FOBB 3LOIA 1RHI2 4BPZA 3AZXA 2EAKA 1NXMA 5BNNA 1CZTA 4H55A 5DZEA 4N43A 1W8TA 1NXD1 1PK6C 1LOAA 1X82A 3WINE 1ZRRA 1VBC3 2JICA 3HNMA 3JD72 4EWEA 4KQ7A 1O3SA 1UYZA 3RPQA 1H9WA 5FREA 1RMU1 2BJSA 3GF6A 2B45X 4HVOA 3ACLA 1CIWA 1S0JA 2BEOA 2DCZA 3S5QA 1DQ2A 1LODA 5BXXA 2ZHKA 1DQ1A 3VBFA 4BLJA 3AM2A 5C8CA 3FLTA 1HDKA 5FBZA 5FY7A 4H7LA 1OURA 3DPRA 3SKJE 3LSEA 4PIYA 2WAAA 1Q8SA 3LEIA 3GZEA 4BMEA 3RZHA 4KWJA 5FMOL 2VOVA 3PLQA 1QWRA 1UIJA 1W9TA 1S0CA 4COVA 1XSQA 4LBKA 4XILA 3PURA 4IV1B 3VHNA 5I0RA 1EUUA 1RXGA 3P3PA 2GNBA 5K9YA 2VULA 3ABZA 1QJU2 3OOXA 2YGLA 4WVMA 4CEYA 4JKMA 4EN6B 4FBFA 1OFNA 2RDRA 3ZXKA 3GHNA 3AKRA 1KEXA 4LBQB 3E97A 1D2QA 4JGYC 5FCCA 1C1LA 1V9U1 3RZMA 4F83A 1GQHA 4GULA 1DDLA 5LBEA 1QJFA 3TEYA 3IDBB 3ZLIA 4CZSA 5JZGC 1RUC3 1BEV2 5GZDA 3ZYRA 3H8RA 3ETQA 2MNGA 1O4TA 4JTOA 3WF2A 2DCJA 4BWOA 1I1EA 1VAVA 4D3WA 1W2AX 1YJKA 4Q4V1 2F4LA 2FDJA 3CJIC 2ETEA 2R072 2RJKA 2WLPA 4JDOA 4WV8A 2Q1FA 3ME2A 3MIHA 1QGLA 4L2NA 5EFUA 4JX0A 5C9AC 3MDPA 1W2UA 4PF5A 2PHLA 1S2EA 2DU1A 4LHLA 4LHKA 1BKZA 4XC9A 1OFSA 3MV11 4YW7A 4D69A 3THCA 3TB0A 1V70A 2JIGA 3UKVA 3T2PA 3VHRA 4CYDA 3S0MA 1IS6A 3GBWA 3CF6E 4PLMA 2BVBA 5GLZA 1JZ8A 2OYZA 1UU4A 5JUVA 2VOXA 5BPXA 4QPIC 5AVAA 3E5QA 3ZYGA 3VBRA 3EXUA 1IOAA 3QH7A 3LF7A 3WP4A 1V0AA 2CDPA 3PVNA 2VUAA 2BYVE 2WNUC 4HETA 3OGRA 4IV3B 4XBQA 3POYA 5CISA 5FZAA 2B39A 1A8MA 3AC0A 2OUJA 3FUOA 3PNAA 1RUG2 4P9YA 1YNAA 2VXRA 2VW1A 2VOTA 1ZRCA 4FP3A 1V00A 5GZCA 5GLTA 2D40A 4FVVA 3D4KA 5KC5A 3P1IA 4JGZC 1G9FA 1AX2A 4PQ9A 4DIQA 3RZJA 2VR4A 3UESA 1OLRA 5BYNA 5J36A 1KD7A 3AVSA 1G86A 2CYFA 3WHUA 1LNSA 4CUCA 3E6BA 1WUVA 5A33B 4A44A 4Q4Y2 4D7YA 4Y26A 4G4FA 1CAWB 5KC6A 2TBVA 4XJUA 1WKYA 1SFYA 1PVC1 1DQ0A 4CCOA 2WNVA 1LOFC 3LGRA 2C24A 3DYMA 1FPN2 1HKDA 3HQXA 4ISQA 1CQ9A 4CEWA 2QZ3A 2PHXA 2NM1A 2P3YA 4EN7B 1ZZ9A 5FZ9A 1E5RA 2WFF3 3Q8CA 3HR9A 4NR1A 2W39A 2OA2A 1LOGA 2MHFA 4J25A 3RYKA 1X8EA 3UGFA 4AVCA 1PVXA 1V6MA 2HWE1 4JV4A 2GMMA 2EALA 2WZ8A 4U2AA 4OMDA 4QGMA 2MEV2 4Q8KA 2NMNA 3KZ4C 2WA4A 4FOQA 2XLGA 2NPIA 3NW4A 5CBLA 5IFTA 3P5BA 5FZ8A 4M4RA 1TZOA 5LBCA 4AGVA 3WG3A 1OBNA 3MF6A 1HW5A 2KR2A 1Y4WA 2PHDA 2C4XA 3I2OA 4Q26A 4NHXA 2RS53 3BALA 4DQAA 4YRDA 2WN3A 2IXIA 1QJX3 3A22A 1GLHA 2J1AA 3ZXEA 1YQ2A 1LULA 1AUYA 3AZWA 1QNWA 1AX1A 3NNLA 4W6XA 4CU7A 1WCQA 5FZHA 2XXZA 2HBTA 1ZBA1 1BZWA 1CAUB 2VNOA 5FO8B 4MADA 3C7GA 1DBNA 4W4ZA 4XUTA 4CCCA 4OHYA 1H8VA 2AR6A 4UF0B 3NJYA 2D6NA 4P5YA 5IYYA 3S57A 4K7JA 1LHOA 5FYCA 4CCNA 3CU7A 3KS7A 3LA2A 4AF9A 3H7YA 3IWZA 5T5OA 5LA1A 1L3JA 5BNQA 2W46A 2Z4FA 5FAXA 1X8MA 1SBEA 2UY9A 2VZTA 1XYPA 2WNOA 3N35A 3WNLA 5SV8A 3PJYA 5HI0A 2YROA 4BK4A 4Q4X3 1HRI2 4KG0A 2HWC2 1QIQA 1TNRA 2I07B 3Q8FA 2G4IA 4NUBA 5D8AC 1I5ZA 3WHTA 2PFWA 3KLSA 1K42A 2GAUA 4RSUA 4K1ZA 1FMD2 2VH9A 3FWEA 4ZONA 4AZZA 1W6QA 1N1SA 4S2GA 1R083 4FOWA 4GWMA 4WVVA 2VOWA 1AR61 3BOPA 4M4PA 3IKWA 2QUOA 4OYUA 1AYM2 2PAKA 1MEC2 1GMMA 2BNNA 3FMGA 5H9PA 1NA1C 2Z69A 1QY4A 2YC2A 2ZEZA 4MLOA 5DN2A 1I3HA 1NY72 1PNFA 1ZNPA 3KV9A 1ST8A 1AXYA 5LZ6A 4AEDB 1QH7A 4Y5Z0 3EBRA 4CDUB 2O0OA 2A6YA 3ZYBA 4BQ4A 5C3SA 3ZPYA 3A23A 2MPFA 1QQP3 5FZMA 2ENRA 3L2YA 3GYDA 4RGAA 3ZR6A 2ZGRA 5IVVA 2HJIA 3JBG1 2YB7A 2KM2A 3POIA 4LBQD 3KF5A 3VZJA 4YNIA 4AAXA 1AR83 2VVFA 4GB32 1JYVA 4CCEA 1K3IA 5AC93 3PUHA 4XF4A 4XABA 4YM0A 1O4ZA 5FLHA 3K75B 2WS93 4Q0UA 1BBT2 5FO7B 3AYEA 2OX0A 4A7YA 4E27A 2DTWA 2HBUA 2R062 4J1XA 3ST7A 1TME3 1JW6A 4LO7A 2XVKA 2WJSA 2VZSA 2D44A 4HL0A 4TN7A 4V2VA 5EJ3A 2QQOA 2WO1A 4JHZA 5JPNB 5FPZA 3V64A 4H2AA 1XE7A 1T2XA 3B5LB 4E4HA 4EYUA 3KQRA 5HCAA 4RQPA 1OH4A 1RXFA 1W3XA 2P2KA 3I2KA 2W94A 3AP5A 4MGYE 4W50A 1TMF2 4ZU7A 2BNOA 1HB3A 3VD9A 3K48A 1COV2 1NZIA 4PBOA 1AL0G 1DLCA 1CAXA 3AMPA 2LS6A 3VHPA 5IVYA 4ZXEA 1VRBA 1HXS1 1H1IA 5CKQA 2I74A 4HXCA 3T1MA 1AR93 3GCWA 5I0UA 1B35B 1NCQB 4AQ2A 1CJDA 5ACA1 3LB9A 4QHBA 4IE5A 1RVF1 4LOTA 1OLMA 2WYFA 2RR11 2W1SA 1SCSA 1A3KA 3ZXGA 1ENXA 2XJPA 4IEWA 1UMZA 5L7OA 3NJVA 3NVCA 3ZFFB 1KXGA 1URXA 3ELNA 1GSLA 3QD6A 4S2HA 1OH3A 1JHNA 4JAAA 3OY8B 5A3MA 2A3WA 2YC0A 4KBZA 2JDHA 3H0OA 1QJU3 3R4UA 2W91A 1Y9GA 3WCSA 4CP9A 2E7TA 5FZOB 4TWTA 2FDHA 4OHZA 1C1FA 1RMU2 3O0WA 4B29A 1SEFA 5A32B 4B1LA 4KI5M 2CWSA 2WL1A 3H1WA 3NV3A 4IE0A 3ZN6B 3LFIA 1EP0A 1PK6A 2ZTNA 1RUI2 4XHBA 4QQ2A 3MPPG 3WF4A 3DYOA 5BNNC 3BTXA 1YI9A 4NIAA 3SCGA 2PMWB 3TEWA 2XHNA 4CE8A 1FV3A 3ILNA 3ZYPA 4N43C 4NRPA 2VUDA 3DF0A 3JQWA 4MV2A 1DFQA 2Y8KA 1FV2A 3E5XA 1Q8PA 4EE2A 4XVHA 3JUUA 1LHNA 5J37A 2JWPA 5LA0A 3MEPA 1O6UA 3FJSA 2R073 5F9TA 2H0VA 1RUE1 3IAQA 3BGAA 4KL1A 4P9JA 4Q4W3 1W8NA 3IBMA 4ZXKA 5IWFA 5KHGA 1WLWA 1LRHA 1H2KA 2ZGLA 1V6OA 3H1YA 3GDBA 4CRQA 1WD3A 4MYEA 2GU9A 1BQPA 3ZXJA 4AG4A 1GP6A 5DABA 2NZ9A 5ABJB 2RS32 1Q43A 4QDQA 3V0AA 4U36A 3FC0A 2PLV1 1GWMA 3WNKA 4KGGA 1SPPA 4QPYA 1FNZA 1UZVA 1OF3A 2J7MA 3IIAA 3M4FA 4WM8A 3AP4A 1DQ5A 2RDSA 4YM1A 3T4HB 3VN4A 3H3UA 4CEYC 1H2MA 4BIFA 5A7OA 4K3UA 4K1YA 4Q4V2 3AP9A 3OTFA 3OEBA 3LE0A 4QPGB 4XE9A 5JZGA 1RUG3 3WG2A 3KT1A 5A7WA 1NOVA 4Y5SA 4N53A 3DXUA 2FDGA 2A6XA 4A42A 1VMHA 4IEVA 4XFCA 1HX6A 1UPIA 2CGOA 1BHGA 3CJIA 4PDWA 4AE2A 3F95A 3EYPA 5C9AA 2DURA 1VPHA 2DUQA 2ZX1A 4JRLA 4I02A 2P3KA 3KSCA 1MQTA 2XJUA 3LIGA 2BGPA 2CGPA 4JC1A 3I49A 1UN1A 4JDNA 4YGDA 4DFSA 1N47A 4W65A 5EQUA 1R092 2ZA9A 3WV6A 3TOJA 5CZKA 5FZLA 5FO9B 3OYWA 4I0WB 5IW0A 4QPIA 3USUB 1LAJA 2XMLA 1UOFA 1CZSA 2PQQA 4EV0A 1XBFA 4A41A 2WNUA 4OUEA 5FDBA 4I30A 2RM21 2VGDA 1R1A3 1A34A 1NKGA 1QXPA 2BV4A 3VBRC 3LEGA 4S2DA 1H6YA 1QOTA 5CAZA 1EAH3 1NQDA 3KHBA 4HPKB 3JB4C 1WA4A 3UJOA 4YM3A 1K5MA 3E6DA 3K46A 3DGTA 4JGZA 5A3PA 4UAPA 3N9PA 1GZWA 3PU8A 3VDDB 3MIFA 3WNXA 5CADA 2GMPA 4UW6A 1HRV1 1JYXA 4GKXA 2QCSB 2EXKA 4NN0A 4R9CA 1ZZBA 4PHZA 5JPMB 3ZSKA 1PM7A 3VZLA 1S2KA 2VVEA 4IETA 5DDJ2 4LQRA 5FYMA 1HN0A 4HLTA 1GOHA 4UW4A 5ABJA 3IMMA 1RJ7A 4QXHA 5DAXA 1YFUA 1P8JA 1LOFA 1VBB1 2AREA 4HK9A 4AWDA 3HD8B 1O7FA 2XJTA 3CIHA 3FBMA 4Q0QA 3WD5A 1WW6A 2VQTA 4UFIA 2WWJA 4V1PA 1OXCA 3IDCB 2GSYA 2FZ1A 1JZ6A 1O8SA 4QDSA 2R043 4Z92B 2BGCA 4BZ4A 4K8RB 1DQ6A 4YZ5A 3T08A 1JOPA 3N9OA 1W06A 5EJZB 2K0GA 5KR7A 2RDQA 2Y33A 5J98B 4E9KA 2BOJA 3UETA 3OGSA 1ENRA 3OGGA 2V4AA 5GZEA 4PIZA 1LOCA 1W9FA 3ZFEB 5APAA 4MVTA 2YMZA 2DTYA 4XEZA 1AR71 3MW3A 3SQOA 3O1UA 1J3PA 1UU6A 5IUQA 4DINB 5K4LA 3TN92 4LR4A 5FPUA 1HRI3 4FPJA 1MS9A 4BXFA 4Q1RA 3FX3A 3PMEA 1WBFA 3ENRA 1FOD2 3H8XA 1VMFA 2HWF2 4WZCA 4Z82A 2QE3A 1WMFA 1CJPA 1O4YA 5IK8A 1CX1A 5FKCA 5LY1A 3TRSB 4AHXA 3LSDA 2DVFA 5FYSA 2J1SA 2DCKA 3HJRA 4XUPA 1UWWA 1MEC3 1S0IA 4Q1PA 5CNAA 4XDQA 4D6SA 1CWPA 4IUGA 1QHDA 3H3ZA 4OUMA 4IV3C 1R1A1 3KB5A 3THDA 1VR3A 4A6SA 3J8F1 3WF1A 1US2A 5HCBA 2OW4A 2W1QA 3POBA 4W6WA 3WNOA 4AL9A 5KHIA 3VBHB 4IEZA 1OD5A 5LB6A 1EV12 3AP7A 1JH5A 3GBFA 3J7NA 2QQMA 5FZKA 5FZ1A 4IW3A 1C5HA 1LCLA 4FAHA 2CL2A 2RMU2 1Y3TA 1WCSA 4CCKA 4GB33 1LHWA 4M0NA 5DXDA 4YW6A 5HCHA 1ULGA 4BQ3A 4H14A 4XUOA 4AFBA 2OZJA 4B7KA 2Q1ZB 1D0HA 5JOXA 3IB3A 4JKLA 2R063 5FPBA 3T2TA 3VZKA 1AVBA 2ADEA 1DCSA 1GBGA 4W8JA 2V73A 3BU7A 2K46A 2YC4A 5BNPA 2UWCA 5FP4A 1YLLA 1UKRA 3SLIA 3VBSB 3JBG2 1QKQA 1XU2A 3RI9A 5CFCB 1PGL1 1S55A 2JD4A 2F4PA 1AYN3 2AEZA 4XF3A 5IK7A 1TMF3 2ZGMA 3J9SA 4URTA 4XJAA 4N8MA 4Y22A 3U4XA 1YXWA 1COV3 1S2BA 5FK7A 2VL4A 1Z78A 4S2FA 1WD4A 4H3WA 4PBPA 5DAVA 4KG8A 3SXWA 4MGSA 1N3PA 3NKGA 4CA9A 2B8MA 4QX8A 3ES1A 3INAA 4QX3A 2OKXA 2ZGKA 1PO11 1PGW1 1OF4A 5I0DA 2WZR1 4GH4B 2E33A 4CTEA 1IGOA 5LK7B 5FPVA 5A3UA 3FHQA 2EXJA 1POV0 5FIXA 2HWB1 1WW5A 2QZ2A 5ANNA 1JI6A 3O0XA 1US3A 4LBOA 5FQ0B 4CXWA 1PX3A 2P1BA 1W28A 3I3EA 1LEDA 1H8TB 4Q0VA 1RUD2 2IXCA 5GJ6A 3BIWE 4DO0A 4EN0A 1RIRA 4IL7A 1QJY1 5GM0A 3MZHA 4QGNA 4CDQB 4LLFA 3QACA 1ODMA 4XMAA 4B8EA 2D43A 5KHJA 2A75A 1F5FA 5CFDB 3R05A 3VBHA 2JDUA 2B9UA 1QMJA 4YW3A 4LMFA 4CDXB 3USSA 3WP6A 5ACA2 4BQ5A 2Y64A 2AUYA 4HONA 5BNOA 1LESA 1RUI3 4GA9A 4LK7A 2Y6GA 4RQPC 3THTA 2RR12 2ZCWA 3B7MA 4FP2A 4NPRA 4AYUA 2WWUA 2E26A 3KCXA 4QT6A 5JI9A 3BVCA 4Y20A 1OQ1A 1MR5A 5K8SA 4AQ6A 5F37A 4FTSA 2W5FA 4FO9A 2R7EB 1JYIA 2FCUA 3WW1A 4CUBA 1AX0A 2B5HA 3APBA 2DCTA 3D0JA 3ZDVA 2WZEA 3KCYA 3OB8A 3MICA 4FOVA 4D8MA 2XBO2 3C7HA 5GKAC 3HN3A 1MS1A 2WIIB 2XJRA 1WCKA 3QLQA 4MXVA 2VVDA 1I6XA
chains in the Genus database with same CATH topology
3OUJA 2HBUA 5ERLA 5LB6A 3HQUA 5IAVA 3GZEA 3OBZA 4XCAA 5EQUA 3W21A 2JIJA 5LBBA 4IW3A 4Y5TA 5LBCA 2FCTA 4UWDA 4NHKA 4NHXA 2RDRA 4NMIA 4ZPIA 3OUHA 3NNJA 3MGUA 3NNLA 5LBEA 2HBTA 5HV0A 4XCBA 4XAAA 3HQRA 4NHYA 5IAXA 4KBZA 5LATA 4JZRA 5LA9A 2RG4A 5DAVA 2RDNA 3EMRA 5DAXA 5L9VA 4XC9A 3NNFA 2FCVA 4MHUA 5EPAA 5LBFA 2JIGA 2Y34A 3NNMA 5A3UA 3DKQA 3KT7A 4BQXA 5DAPA 2OPWA 2A1XA 4ZONA 2RDQA 2Y33A 4BQWA 4XACA 2V4AA 5L9BA 5L9RA 4NHMA 5C5UA 3KT4A 5DAQA 5DAWA 3W20A 5C5TA 3ITQA 3BVCA 5M0TA 5HV4A 2RDSA 5EP9A 4BQYA 2FCUA 4Q5OA 4NAOA 3GJBA 3KT1A 4MHRA 4Y5SA 3GJAA 4XABA 2G19A 5LASA 3OUIA 3PL0A 4NHLA 4J25A 2G1MA 5IATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUJ A;  2HBU A;  5ERL A;  5LB6 A;  3HQU A;  5IAV A;  3GZE A;  3OBZ A;  4XCA A;  5EQU A;  3W21 A;  2JIJ A;  5LBB A;  4IW3 A;  4Y5T A;  5LBC A;  2FCT A;  4UWD A;  4NHK A;  4NHX A;  2RDR A;  4NMI A;  4ZPI A;  3OUH A;  3NNJ A;  3MGU A;  3NNL A;  5LBE A;  2HBT A;  5HV0 A;  4XCB A;  4XAA A;  3HQR A;  4NHY A;  5IAX A;  4KBZ A;  5LAT A;  4JZR A;  5LA9 A;  2RG4 A;  5DAV A;  2RDN A;  3EMR A;  5DAX A;  5L9V A;  4XC9 A;  3NNF A;  2FCV A;  4MHU A;  5EPA A;  5LBF A;  2JIG A;  2Y34 A;  3NNM A;  5A3U A;  3DKQ A;  3KT7 A;  4BQX A;  5DAP A;  2OPW A;  2A1X A;  4ZON A;  2RDQ A;  2Y33 A;  4BQW A;  4XAC A;  2V4A A;  5L9B A;  5L9R A;  4NHM A;  5C5U A;  3KT4 A;  5DAQ A;  5DAW A;  3W20 A;  5C5T A;  3ITQ A;  3BVC A;  5M0T A;  5HV4 A;  2RDS A;  5EP9 A;  4BQY A;  2FCU A;  4Q5O A;  4NAO A;  3GJB A;  3KT1 A;  4MHR A;  4Y5S A;  3GJA A;  4XAB A;  2G19 A;  5LAS A;  3OUI A;  3PL0 A;  4NHL A;  4J25 A;  2G1M A;  5IAT A; 
#chains in the Genus database with same CATH topology
 1OKO A;  2X29 A;  2XG3 A;  1JYN A;  5A6X A;  2P4E A;  1D4M 2;  2DDU A;  2JX9 A;  5H9S A;  4COY A;  3WDW A;  2RS3 3;  2OS2 A;  4FTB A;  3KF3 A;  4QU1 A;  1RUF 3;  5F3E A;  1UY3 A;  2QDR A;  5CFC A;  4RHV 3;  1DZQ A;  1PO2 3;  2ZHN A;  4BYY A;  5GAL A;  2XL9 A;  2UYA A;  4NPL A;  4L92 A;  3LAG A;  5CVR A;  4XBN A;  4AI1 A;  1LR5 A;  4AED C;  5LY2 A;  2WZP P;  2ZZQ A;  1UYX A;  1VBA 1;  4CDU C;  3TEZ A;  1YEW A;  5FZ4 A;  3U11 A;  1JOJ A;  1W0N A;  3QCW A;  4YVS B;  2DCY A;  3LA7 A;  1UY2 A;  3W5N A;  2JB4 A;  1UZ0 A;  1RUE 2;  5F5Q A;  4QKF A;  4E2S A;  3QOP A;  1DYO A;  1TG7 A;  3MYX A;  1QU0 A;  5JWP A;  1KS5 A;  5F2W A;  2DVA A;  4FSJ A;  5K0U A;  3VKO A;  2NYY A;  3RS6 A;  3I2D A;  3LKJ A;  3WSO A;  4O61 A;  4Q8L A;  2PN5 A;  4RFT 0;  1OVP A;  5HV0 A;  4F3J A;  2BTV C;  3NAP A;  1ZBE 3;  1SDD B;  4LE3 A;  4Q2F A;  4QX7 A;  4ATF A;  1F9K A;  5JOZ A;  1R09 3;  2FBE A;  2GH8 A;  2HEY F;  3ZIX A;  3MBW A;  4M3C B;  1POV 1;  5DUV A;  3EO6 A;  2GNM A;  3CKH A;  1GU3 A;  2JG9 B;  4YG3 A;  3WVJ A;  2GP5 A;  4ZKT B;  4CDX A;  2KD7 A;  3WP5 A;  3AZY A;  1LKN A;  3BYW A;  5J1X A;  2VMF A;  4QX2 A;  3ZXF A;  3MW4 A;  3NKT A;  1D4V B;  2RDN A;  5FUN A;  3M3O A;  5L9V A;  1ASJ 1;  5A3W A;  3AYD A;  2FCV A;  5LBF A;  2GP3 A;  3VDA A;  5FRA A;  3VZN A;  2Q1M A;  4WM8 C;  1UW8 A;  5DZG A;  4NRO A;  2E9Q A;  2XUM A;  4FCA A;  1VBD 3;  3NQH A;  1VE0 A;  3MV0 1;  3SH4 A;  1VBE 2;  2QQV A;  2VG9 A;  3Q9O A;  3WCR A;  5L36 A;  1WMX A;  4PIX A;  1KRI A;  1B35 C;  1NCQ C;  1XU1 A;  2GH2 A;  2X5I B;  1UF2 C;  4WBB A;  4LT5 A;  4N53 C;  1QDO A;  5T54 A;  4GMP 3;  4DRR A;  1CON A;  2RHP A;  4DY3 A;  5CIR A;  3HPN A;  2Z5W A;  4R4Z A;  3MLJ A;  2CV6 A;  1UX7 A;  1GOF A;  3G6J B;  4PDW C;  4TLG A;  2VQU A;  5DDJ 3;  1QNY A;  3SH3 A;  4B7E A;  1CZV A;  3VD5 A;  1UD1 A;  3ZFF C;  2RM2 2;  5IVF A;  1MVQ A;  1MQT C;  4MUV A;  1REE A;  2R0F A;  3ZFG A;  3PIG A;  4RGK A;  4YWA A;  4BXS V;  2WUH A;  1OLQ A;  1O3T A;  4CCD A;  2ARX A;  1QOS A;  2G9F A;  4XFA A;  1PIV 1;  2FMD A;  1NQJ A;  3HNY M;  4Q0S A;  4MGK E;  1OPO A;  2CY6 A;  3ATG A;  4D6Q A;  4R9B A;  4QKD A;  2W87 A;  1GZC A;  1NCR B;  5E16 A;  4L99 A;  4RR3 B;  1RUH 2;  3VD7 A;  4BQY A;  5F39 A;  2ZGU A;  4BOW A;  2C26 A;  3IAP A;  2XUE A;  3AJZ A;  3NST A;  3ZXA C;  5AVP A;  1KIT A;  4E8C A;  3O1P A;  3T2O A;  1JUI A;  1VBC 1;  2P3I A;  2VBB A;  2XJS A;  2BQP A;  5LAS A;  1OLM E;  1SZB A;  4PI2 A;  4XJW A;  1YQC A;  2AH2 A;  2LW8 A;  3DCQ A;  1K5M C;  3ORJ A;  5IAT A;  1OI6 A;  1QXR A;  2IFR A;  3M3E A;  2OT7 A;  4IEX A;  3TN9 3;  3BU0 A;  4QM9 A;  1XYN A;  4ZS2 A;  2D6K A;  5HXV A;  5D1I A;  3K51 A;  1XYO A;  4I0A A;  1FOD 3;  2JG9 A;  1VRH 2;  2VOK A;  3OJB A;  4IV1 A;  4P08 A;  2HWF 3;  4IQP A;  4E2Q A;  5FFO C;  4LEJ A;  3CJX A;  5FYI A;  4KNC A;  3RQ0 A;  2YYO A;  3ZR5 A;  5ABJ C;  2JE9 A;  1FX5 A;  1I9R A;  4JKK A;  2OII A;  1LHU A;  3B9I A;  1X36 A;  5EJ1 B;  2EAA A;  4LBQ A;  2PHU A;  3ZPO A;  4Y1U A;  4LHN A;  2VAU A;  3WF0 A;  3G7D A;  4GWN A;  2JG8 B;  1FAT A;  3I3B A;  4XF0 A;  1AR7 2;  2WAB A;  3OGV A;  3MIB A;  1LGC A;  2W0X A;  1ULF A;  2CNA A;  4QPG C;  2ZGO A;  3LEK A;  2HKX A;  2YG0 A;  3KVB A;  4NJ4 A;  1DGW X;  1TE1 B;  1GFF 2;  4E2G A;  4EZH A;  5HBA A;  3RYR A;  2ZAA A;  4I3P A;  3AJY A;  1EV1 3;  1LTE A;  1NE6 A;  1RUC 1;  1JN2 P;  5EYX A;  5C3O A;  2P5B A;  4M0H A;  3N9Q A;  4EN8 B;  2VTX J;  2GN7 A;  5FBJ A;  5FMB A;  3A4U A;  1O59 A;  2DV9 A;  5T5L A;  4NII A;  1C4R A;  2JD9 A;  2A70 A;  2ZX2 A;  1J3Q A;  2RMU 3;  3T0A A;  3RVH A;  1YQ8 A;  4HVR A;  1GWK A;  3KV6 A;  3VBO B;  3SEP A;  3BCW A;  4Y33 A;  1MZ5 A;  1RTV A;  2E7A A;  2W68 A;  3HN1 A;  2WO3 A;  3LWC A;  1BVV A;  4QHO A;  1OHF A;  4FAG A;  1FI2 A;  1NLQ A;  3J8F 2;  4ORF A;  2VZQ A;  5CKM A;  5JSR A;  3M2M A;  2Y34 A;  4XYX A;  1UY0 A;  4ZS3 A;  3BPS A;  4BB3 A;  3NL1 A;  1Y7B A;  4FFI A;  3KD4 A;  1U5I A;  4IV3 A;  5FXW A;  4XHX A;  3III A;  1IS5 A;  1KGY A;  1RUJ 3;  2AYH A;  2RS1 2;  4LUM A;  5FOJ B;  2AEY A;  4XOG A;  1S0B A;  1AZD A;  2HWD 2;  1IHM A;  4AFC A;  5IVC A;  2H0B A;  2VW2 A;  1J3R A;  3RDI A;  4Y4R A;  1E5I A;  3HWJ A;  1CGP A;  3VDD C;  4OMC A;  2PYT A;  3I3Q A;  4BQ2 A;  4CPB D;  3PTR B;  4KU8 A;  1HLC A;  5A33 A;  1GZT A;  1OOP B;  5C5U A;  5JSP A;  1YI7 A;  4GXL A;  1ZRE A;  1LJ7 A;  1CAW A;  4BE3 A;  1SBD A;  4LKE A;  3W20 A;  4ES9 A;  1QJE A;  2VMC A;  3IDE A;  1VLN A;  4ASM B;  2I45 A;  1XNB A;  2QTW B;  3I3M A;  1N1V A;  1PMH X;  5EP9 A;  2FHR A;  4ONU A;  5GZF A;  4FFG A;  1GUI A;  2X53 S;  4TYS A;  1RUD 3;  3CQO A;  2WA3 A;  2AGS A;  2D3P A;  1UPS A;  2YGM A;  2C1F A;  4FPC A;  4UT5 A;  5FPA A;  1VIW B;  5T52 A;  1ZA4 A;  2Y38 A;  1AL2 3;  2Y26 A;  2WFF 1;  1DGL A;  2DFB A;  2HH9 A;  1GR3 A;  5BNP C;  1PO1 2;  1H1M A;  2D7F A;  2WZR 2;  3KWV A;  4KBB A;  1XJA A;  3ES4 A;  3THP A;  4RA0 A;  1L7Q A;  2VW0 A;  2ZX3 A;  4L8Q A;  4UYB A;  1STM A;  4BH9 A;  2HWB 2;  3ZFE C;  2ZMN A;  3KGL A;  5LRR A;  4LIT A;  4XCA A;  2FDI A;  3U37 A;  4BCU A;  3K4A A;  4OFG A;  3AXE A;  2JIJ A;  2W3J A;  4RS5 B;  4Y5T A;  3W5M A;  3ZN4 A;  3WNN A;  4QWN A;  1QJY 2;  3TWI A;  2JB8 A;  4Z07 A;  2XBO 3;  4OVE A;  1PZ7 A;  5I93 A;  1UZY A;  3DN7 A;  2RS5 1;  1W05 A;  1MAC A;  4IE4 A;  2Q0A A;  2YHJ A;  5DUW A;  1QJX 1;  1LOB A;  1VAL A;  3RGB A;  2CWM A;  2XHK A;  1Z7S 2;  3AKQ A;  3PUQ A;  4ARY A;  5A1L A;  1X50 A;  3IDA A;  1CAU A;  1KFX L;  1NX9 A;  1D4M 3;  5KXC A;  2EIB A;  4E4D X;  2ZAH A;  3J4U H;  4UF0 A;  3N9L A;  5FWE A;  5F2S A;  4HMZ A;  1J1L A;  1U5Y A;  4ASK A;  3DUI A;  4D94 A;  2P6C A;  2A3Y A;  3AZZ A;  1HIX A;  2VCA A;  2ID4 A;  3VBH C;  1RHI 3;  3A7Q A;  5FZ0 A;  1C8M 2;  3LDB A;  1UOG A;  2XVG A;  3J7L A;  3HNB M;  1RJ8 A;  5BNO C;  5HPO A;  2WT0 A;  2X8K A;  3JD7 3;  4HN1 A;  1UZZ A;  2V09 A;  2WBK A;  2BBV A;  1W6P B;  5EPA A;  2W52 A;  5FZD A;  3BUC A;  1W99 A;  3WDX A;  2VQ0 A;  4Q4X 1;  3AKP A;  4DEQ A;  3X29 B;  2QBX A;  4K8F A;  3BOD A;  2PAE A;  5IK5 A;  3CLP A;  3DKQ A;  3BTZ A;  5FZ3 A;  1PMI A;  2A1X A;  1JOD A;  2R1D A;  3OBA A;  1W2O A;  2QNK A;  5A7P A;  3RMX A;  3VL9 A;  3LQC A;  5FUP A;  3T30 A;  3O1O A;  1R08 1;  2V5Y A;  4JGY B;  3H7J A;  1W8F A;  2TUN A;  4RD7 A;  4EJR A;  1EUT A;  5DUU A;  4CDW B;  4OI0 A;  3GZU C;  2GME A;  5FP9 A;  1H2L A;  4TSV A;  1JYT A;  4AED A;  2BPA 2;  2ZOE B;  4XFI A;  1XPW A;  1UO9 A;  3WF3 A;  4BQ1 A;  4AHZ A;  4CDU A;  1LGB A;  2XQX A;  5CFC C;  1YUD A;  1AF9 A;  2VZP A;  3ZYH A;  1UYY A;  3MO4 A;  3OF1 A;  2VBP A;  1ND3 B;  4RFR B;  4WM7 B;  4JQR A;  3KT4 A;  4KH9 A;  1NT0 A;  1ZX5 A;  3ZIW A;  1YO8 A;  1VMJ A;  3R0R A;  4QU2 A;  1XND A;  1QQP 1;  1VBE 3;  4LLO A;  1BMV 1;  1BEV 3;  1F5J A;  2CGN A;  5FYZ A;  1Q5O A;  5L7O B;  2DU0 A;  4C8D A;  5I8Y A;  1WGP A;  3WEZ A;  1AR8 1;  1ZZ6 A;  5JMO A;  2QQU A;  1BK1 A;  1C3H A;  1DIW A;  1UKG A;  4KWK A;  4DEV A;  2A73 B;  5AC9 1;  4OZX A;  1W3V A;  5K0U C;  2QQI A;  3AX4 A;  3E5U A;  3FE5 A;  4EZ4 A;  3ACI A;  3OUI A;  2WS9 1;  5J09 A;  1H8T C;  4R9A A;  3I59 B;  3NAP C;  4HKW A;  1XSR A;  2WSV A;  1E57 A;  5ERL A;  2SLI A;  5FP3 A;  1TME 1;  3MUZ 1;  3SHR A;  4OUS A;  4BM8 A;  1DGR N;  1AJK A;  1ZZ7 A;  2E51 A;  1V9U 2;  2GC0 A;  2RV9 A;  2W92 A;  2YU1 A;  4N90 A;  5FY9 A;  4NAM A;  2GNT A;  2XKP A;  4NIH A;  4MGQ A;  1JXN A;  4QX1 A;  4YZ4 A;  5E6H A;  2QDN A;  4CDX C;  2C9K A;  3OGJ A;  3KCC A;  4YW2 A;  1K45 A;  1RUH 3;  2IC1 A;  4Z2A A;  1NAE A;  3FUQ A;  2P3J A;  5A80 A;  1U12 A;  4LE4 A;  4XUN A;  1H4H A;  2P37 A;  4JDM A;  1W6P A;  4IEY A;  1B35 A;  1NCQ A;  5G05 L;  4GAZ A;  5T3N A;  1GP4 A;  3URF A;  3ZO0 B;  4XQD A;  5T50 A;  5GLW A;  1AR9 1;  1SLI A;  2AZ5 A;  4GJY A;  5L73 A;  2O14 A;  5SV5 A;  1W6M B;  2BDR A;  3O7O A;  4OZO A;  4R8H A;  4OHW A;  2W9X A;  5A3L A;  5EV7 A;  1PIV 2;  4YVW B;  4D6R A;  5IK4 A;  1VJ2 A;  3MFC A;  3ZFF A;  5A6Q A;  1BVP 1;  1VRH 3;  3AZV A;  3OY8 A;  5I8S A;  4Q4Y 3;  2P17 A;  4UFL A;  4NHY A;  3N4M A;  4CUG A;  2E53 A;  4OCT A;  4AR2 A;  1WWY A;  1WLD A;  1GKB A;  3C2U A;  5FZO A;  4YAR A;  2VCB A;  5C70 A;  1X9T A;  1QJU 1;  2OQ7 A;  4YGC A;  5FKB A;  3VB9 A;  3ZFG C;  1FPN 3;  4A3Z A;  1VBC 2;  3NRU A;  3ZN6 A;  1ULC A;  5A32 A;  4ITC A;  5JSO A;  2ZML A;  3WUD A;  1ND2 B;  5K7P A;  1OQD A;  2XGX A;  5IHR A;  1V6L A;  4UBH A;  5BUV A;  3ILF A;  4YVS C;  4AOC A;  4UXA A;  1OPM A;  1W8O A;  4R9D A;  5F5I A;  2WT2 A;  3WW3 A;  1UNB A;  4LKF A;  3TAY A;  2ZEX A;  4CXY A;  3GZT B;  5DAP A;  3H9A A;  1UXX X;  3AFK A;  3OPT A;  3T4V A;  4Q0P A;  5CEH A;  1G9D A;  3B00 A;  3MFA A;  4GZ9 A;  4A2U A;  1LU2 A;  2MEV 3;  4MGZ E;  2BVV A;  4IE6 A;  3ZXL A;  1MS3 A;  1PVC 2;  2ILM A;  1YIF A;  1SLL A;  4LTA A;  2R07 1;  4GWJ A;  2I2S A;  2VMD A;  3N7M A;  2ZGN A;  4Q4W 1;  1HJF A;  5L9B A;  4AVB A;  4HK8 A;  3VHO A;  1F8V A;  1WZX A;  2E32 A;  3SCF A;  1YRZ A;  4AEK A;  3UYJ A;  1WCU A;  3CL1 A;  1GOG A;  4IV1 C;  2JG9 C;  3U10 A;  4AGR A;  2XWB B;  3QH6 A;  2ZGQ A;  1OMI A;  2HWE 2;  5JIU A;  2PHR A;  2XON A;  1DGR A;  1RUC 2;  3I4I A;  1GYK A;  4F8A A;  1Q56 A;  3SMH A;  1UQX A;  2YFZ A;  5FZG A;  3S5A A;  3BIE A;  5FR3 A;  4QPG A;  1NG0 A;  1VB4 A;  2RS1 3;  2VNV A;  2PEL A;  2HWD 3;  1SCR A;  2GC1 A;  3AYC A;  4NVP A;  3B02 A;  5DG2 A;  5B4N A;  5LW9 A;  1RUG 1;  3KV5 A;  2F17 A;  4COZ A;  1XB9 A;  4FFH A;  4MHR A;  4B1M A;  5D8A B;  3O1T A;  2EIC A;  4UFH A;  4QKB A;  4CCL A;  1DU3 D;  4XXP A;  3PL0 A;  4NHL A;  4QB1 A;  5FY5 A;  1J84 A;  4RGG A;  2K9Z A;  1ULO A;  3K4D A;  3LFM A;  4IER A;  4ZY9 A;  4HN0 A;  2HWC 3;  4QGL A;  5JIA A;  1ZBA 2;  4AVV A;  5C8W A;  5FV3 A;  2NN8 A;  2Q4S A;  3IMN A;  3ACG A;  1NA1 B;  2QQW A;  5F3C A;  1Q8O A;  5A1A A;  4LOS A;  3USU A;  4NWW A;  1FMD 3;  2JDZ A;  1JYW A;  3GGL A;  1RYY A;  1ND2 A;  4LO8 A;  2ES3 A;  4KWU A;  5JVV A;  4CP2 A;  2VCC A;  3V56 A;  1B09 A;  1AYM 3;  2JE7 A;  4HVQ A;  1TEI A;  3LPG A;  1NUK A;  5DQ0 A;  1CD3 G;  3M3Q A;  2D93 A;  4TZD A;  4NID A;  4UBG A;  4HPK A;  5C33 A;  2DBI A;  4LUK A;  1XC6 A;  3AB0 A;  1IZ3 A;  2HYK A;  1EAH 1;  2IZW A;  5DZF A;  2Z2S B;  4AI3 A;  3VDD A;  2VEC A;  5D2A A;  5FP7 A;  4DUW A;  3WQ7 A;  1W6N B;  3JCI A;  5CU1 A;  5CKN A;  4SLI A;  3BTY A;  2ZAC A;  4X6Q B;  5FYT A;  1CR7 A;  2VZ3 A;  4FPG A;  4BIO A;  1QJZ A;  3WW2 A;  3T09 A;  3LOB A;  1DYP A;  1AR6 2;  1R1Z A;  3AP6 A;  3V65 A;  5LCW L;  3C3V A;  5KXD A;  4DOU A;  3SIT A;  2V72 A;  4O9E A;  5LA9 A;  3BI3 A;  1UY4 A;  2CDO A;  5DPN A;  4MX3 A;  3MW2 A;  1IKP A;  1JMU B;  2WFF 2;  3TEX A;  2ZHL A;  5C4W B;  2QQN A;  2DYC A;  1UZW A;  4XJ8 A;  2VZ1 A;  2YBK A;  1Z7S 3;  1BBT 3;  2R1B A;  1K5J A;  3VBU B;  1HQW A;  3E6C C;  1XE8 A;  1OUX A;  1F4A A;  2R0H A;  5JR7 B;  2G9Z A;  3AYA A;  3KMH A;  2R6Q A;  3AKS A;  4UI9 L;  1ZZ8 A;  5C3Q A;  2JEC A;  2JG8 C;  4LOR A;  4A4A A;  2R04 1;  5A7Q A;  4ISR A;  2WLQ A;  3F2Z A;  4KMQ A;  2OPW A;  3VD3 A;  4AHY A;  5IAX A;  2VZO A;  3N7L A;  4YW5 A;  2JDM A;  3FLR A;  1GQP A;  4YGE A;  1C8M 3;  2ZAB A;  4MGI E;  1SHW B;  3N7K A;  4ATE A;  4Z2W A;  3ZFE A;  2ZX0 A;  4CCJ A;  1PNG A;  2AEN A;  3T0D A;  3M3I A;  5E89 A;  4A6O A;  1OQE A;  4P9L A;  2RS5 2;  3CBN A;  3KHC A;  3UKT A;  4CP0 A;  1GWL A;  4M3C E;  4ZZ8 A;  4YGB A;  3JQX A;  3VBO C;  1YQ5 A;  4P9I A;  2GN3 A;  2OVU A;  4IEO A;  1UY1 A;  2EIG A;  2R32 A;  1HRI 1;  3SCH A;  1ULD A;  2XR4 A;  4WZF A;  4CCM A;  3H42 B;  1SFN A;  5DAW A;  4AW7 A;  5LWB A;  2BFU S;  1YFX A;  2J1U A;  4AVS A;  4Z8B A;  1CN1 A;  1W9Y A;  2YV8 A;  2NP0 A;  1SLC A;  3TBD A;  4RN5 A;  2E31 A;  3WZ1 A;  1J58 A;  2CU5 A;  2BW8 A;  1IS3 A;  3S7E A;  2VJX A;  4IES A;  2L9L A;  2A71 A;  1W6O B;  3BTA A;  1VAM A;  2LRP A;  5IVB A;  3HOB A;  1AXK A;  1IG0 A;  2ZZJ A;  1YFW A;  5BNN B;  4FI9 A;  1MEC 1;  3VZM A;  1TQ5 A;  2IXK A;  4GQ7 A;  3DEC A;  3B01 A;  3WQB A;  2VU9 A;  1HXS 2;  1RMU 3;  4N43 B;  3JXS A;  1NY7 1;  5GLV A;  2QFE A;  1GNY A;  2Y0O A;  3HT2 A;  4P9W A;  4D0Q A;  1W6N A;  3O1S A;  1J59 A;  4MXW B;  1KJR A;  1BCX A;  5I91 A;  1RVF 2;  3RZG A;  1LB2 A;  5IAV A;  3WR0 A;  3U75 A;  2VE1 A;  3VBF B;  5C8C B;  4Y1Z A;  3ZOI A;  4C0B A;  4EQV A;  1WW7 A;  1DG6 A;  1ENQ A;  2ORX A;  1M4W A;  3D8C A;  3DPR B;  2N7G A;  5KHH A;  2ZBJ A;  3POW A;  4B4P A;  5J48 A;  1G7Y A;  2D6L X;  3ZXD A;  2PTM A;  3PMS A;  3RSJ A;  4GB3 1;  2WR9 A;  4QHZ A;  1FT9 A;  1APN A;  1XXN A;  4J1W A;  4B3N A;  4XW3 A;  1WW4 A;  2VTF A;  2UU8 A;  3FZ3 A;  3IM0 A;  2XKO A;  5IVJ A;  2R06 1;  3HT1 A;  2NMO A;  4WVM B;  4CEY B;  5CG8 A;  3HAG A;  3M3C A;  4DXT A;  5LRS A;  3ACF A;  1V9U 3;  1LEC A;  1OA2 A;  3VBS A;  1LEN A;  2BER A;  4E4S A;  1QQP 2;  1YJL A;  1DYK A;  2GDF A;  3NJX A;  1H4G A;  4YZ1 A;  5EIY B;  4UW5 A;  2DBN A;  2ZEY A;  2XLF A;  1X7N A;  3RJ2 X;  2Y60 A;  3C7E A;  1AR8 2;  5F32 A;  5FXZ A;  1AJO A;  1AYN 1;  2V5D A;  5FYH A;  5JXH A;  1TMF 1;  4FXK B;  4Q4V 3;  5AC9 2;  1COV 1;  2JE8 A;  2E6V A;  4AVT A;  4BU2 A;  2ZKN A;  1OC1 A;  3LDK A;  4LPL A;  4KU7 A;  4XFG A;  5JAX A;  2B46 X;  1YQ6 A;  3EMR A;  3OEA A;  2B42 B;  4RS5 C;  3WG1 A;  1PZ8 A;  2XWJ B;  4GH4 A;  5A3O A;  4HT1 T;  3UV9 A;  2QJV A;  4AI2 A;  5KXE A;  3ACH A;  1V6N A;  2O8O A;  4MHU A;  2Z79 A;  3Q8E A;  3NNM A;  1JZ4 A;  2X05 A;  1XE0 A;  3AXD A;  3LD8 A;  2IXJ A;  3AVR A;  3PVO A;  2C5D A;  3HBK A;  4Y3O A;  4BIS A;  2OXB A;  5FQ0 A;  2PLV 2;  1H8T A;  3T2Q A;  3KT7 A;  3WDV A;  2PQS A;  4FPY A;  4Y24 A;  1UOB A;  1JZ2 A;  1BXH A;  1WMD A;  1W8W A;  4P02 B;  1NZC A;  2JEN A;  4CDQ A;  5AFE A;  1SBF A;  1W8H A;  5CFD A;  3VBR B;  2QQP A;  4XUR A;  4IGQ A;  4URA A;  5A70 A;  1W0P A;  3ON7 A;  5FK8 A;  2W1W A;  2VZU A;  4MXW A;  4I3G A;  1EY2 A;  2H6C A;  5L19 A;  1AR9 2;  2C9A A;  1BK0 A;  2Q8D A;  1N1T A;  1HB1 A;  4Y1V A;  3SEE A;  4DMI A;  5C7G A;  1IG3 A;  4PLN A;  2JDN A;  3HEI A;  2NLR A;  1NLS A;  1RUI 1;  4N7I A;  3WNM A;  4PLO A;  2OPK A;  1W39 A;  4NRQ A;  5G04 L;  2Y6J A;  1UU5 A;  1F35 A;  3O14 A;  4GMP 0;  2QQL A;  4XZU G;  4XTM A;  2A7A A;  2YBS A;  2ZPX A;  3ITQ A;  4D7S A;  4ES8 A;  4OQ9 A;  3WUC A;  4DXR A;  5LEK A;  4XXA A;  3OG2 A;  5H9R A;  4JTN A;  3U07 A;  1PVC 3;  4XMI A;  2JDY A;  1UCX A;  4LBL A;  4NAO A;  2EF6 A;  4MOA A;  1N1Y A;  1RB8 G;  4XFH A;  3HBZ A;  5IJR A;  4UOJ A;  3NNG A;  1XNK A;  2WAO A;  2WNV B;  4QKN A;  2D6P A;  3D0S A;  5GLU A;  3U78 A;  4BHP A;  3OCP A;  4CEW B;  3GCX A;  1DGW A;  3E1F 1;  1NYW A;  4CDW C;  2ZHM A;  2HWE 3;  2RS3 1;  3L2H A;  4CPB A;  3AFG A;  4XF1 A;  2GC3 A;  4AGG A;  5C3R A;  1RUF 1;  2ERF A;  2GAL A;  4RHV 1;  1ONA A;  1PO2 1;  2EVX A;  2EXI A;  2VNG A;  1W2N A;  2RJL A;  3POS A;  1OSG A;  2D6O X;  4YVS A;  1V6K A;  1ZVF A;  1XNC A;  3ZSE A;  1WLT A;  4HSJ A;  1HRV 2;  1ND3 C;  2UUR A;  2ZGS A;  4WM7 C;  5LK5 A;  2EIE A;  4YLZ A;  1X33 A;  5FY1 A;  3WW4 A;  5FPX A;  3M8L A;  2WNE A;  4LIU A;  5GZG A;  3WNP A;  1MS8 A;  4Q4W 2;  5KBF A;  4K20 A;  4J6G A;  3BB6 A;  3NV2 A;  2W47 A;  4JQT A;  5L7O C;  4NO4 A;  1SQ4 A;  4NMI A;  3BOW A;  1VBB 2;  4ZPI A;  2AAC A;  1CPN A;  3B3Q E;  3RZK A;  2W08 A;  3VKM A;  1HN1 A;  4Y1Y A;  3VUO A;  4ZU5 A;  4XPV A;  3WX5 A;  4COU A;  3NV1 A;  5AFB A;  3RWN A;  1ZBA 3;  1ZBE 1;  4M3C A;  4K21 A;  4XAA A;  1W2T A;  4FPH A;  3FBY A;  1O5U A;  1R09 1;  2A3X A;  4AQT A;  3VZO A;  2BP6 A;  5FWJ A;  4UFJ A;  1L7L A;  5ISL A;  1LGN A;  1W04 A;  3ZSL A;  2XDV A;  2GND A;  2UY8 A;  2YU2 A;  3AL5 A;  3GHM A;  3PUI A;  4ASL A;  3WG4 A;  3H50 A;  2LM3 A;  1SMV A;  2B4K A;  4OI4 A;  4PJY A;  4TXW A;  5JOY A;  1Z0H A;  3K4Z A;  2FZ2 A;  1JZ5 A;  4R4X A;  5FY4 A;  5A3N A;  3OBT A;  2V4V A;  1VBD 1;  2X5I A;  2XB6 C;  4A7Z A;  4WVZ A;  3B93 A;  1TNF A;  5DG1 A;  2VBD A;  1OVS A;  3PJQ A;  2D97 A;  3ZVX A;  4P9X A;  1C28 A;  3LDR A;  1DZR A;  1ULE A;  2A6V A;  2CHH A;  4LJH A;  1SLA A;  4UFM A;  3NV4 A;  4NWV A;  3KVA A;  5FMO S;  1U0A A;  2CAV A;  4GMP 1;  1DLL A;  3ECQ A;  4BDV B;  1AR6 3;  2VMI A;  4YVW C;  1IQA A;  2ARC A;  2GC2 A;  2JXA A;  4CU6 A;  2CTV A;  2Y6K A;  5DDJ 1;  4MSV A;  4LNV A;  1W6Q B;  1JZ7 A;  1C57 A;  4YM2 A;  1Y43 B;  1AHS A;  2WQ4 A;  4PT6 A;  2LRO A;  1QEX A;  3H8U A;  2C0Z A;  2CAU A;  5FZE A;  4QXK A;  2E63 A;  3KQ4 B;  1R1A 2;  3O12 A;  3AK0 A;  2Q30 A;  4LUL A;  1DP0 A;  4N7U A;  3LZZ A;  4NHM A;  4QX5 A;  2KXL A;  1EAH 2;  2YDE A;  3WT3 A;  2X10 A;  1JBC A;  2BZD A;  5DAQ A;  4O7X A;  1NCR A;  4X8P A;  4RR3 A;  4X6R B;  2ATF A;  3D82 A;  3PDQ A;  1ND2 C;  1QDC A;  2GZW A;  3IT8 A;  4FQZ A;  5T5P A;  4IDZ A;  2W95 A;  3RG0 A;  3JBG 3;  1A78 A;  4NRM A;  3S7I A;  3ZMO A;  4EWD A;  1RUO A;  4B4Q A;  2JDK A;  2XQR A;  5A3T A;  4K9S A;  1SDW A;  2J1T A;  3C8X A;  4Y4Y A;  2G9G A;  3DV8 A;  3GJA A;  4HAN A;  5JDB A;  1A6C A;  5FP8 A;  3B94 A;  4XJZ A;  3I2H A;  3TNQ A;  5FMC A;  5JXJ A;  3VKF C;  2BRT A;  2G1M A;  2LAL A;  4LXL A;  1F4H A;  1E5H A;  2TEP A;  2XJQ A;  3TYJ A;  1IPK A;  3TN9 1;  4GAL A;  1OA4 A;  4IGP A;  5D21 A;  1OD3 A;  5ANQ A;  2WO2 A;  1V6I A;  4FPF A;  3KV4 A;  2X09 A;  2R04 2;  1FOD 1;  4Q29 A;  4AEJ A;  3OBZ A;  1CAV B;  2VZV A;  2HWF 1;  4XIO A;  5J7M A;  2F6B A;  4D7T A;  4C91 A;  2J1E A;  3WY6 A;  4C1W A;  4CXX A;  5LBB A;  4C90 A;  5JI7 A;  5E8A A;  4A3X A;  4BA6 A;  4KWL A;  2UWB A;  4DUV A;  2A6Z A;  3P3N A;  1PGL 2;  2ZMK A;  2D5H A;  4LK6 A;  5EZW A;  2JG8 A;  2WO7 A;  4HSL A;  4RQP B;  2WRA A;  1H30 A;  1GZ9 A;  3J7M A;  4QD2 A;  1Y9Q A;  5A6Z A;  3N9M A;  1FAY A;  1HXS 3;  5A6Y A;  4CU8 A;  3VDB A;  1VP6 A;  1YHF A;  2XOM A;  5EYY A;  1CAX B;  4OI1 A;  2YFU A;  1FXZ A;  5ACA 3;  2D3S A;  3AMQ A;  3NNJ A;  2QVS B;  2OQ6 A;  1PGW 2;  1C5I A;  4YSF A;  1RVF 3;  3MPB A;  1EV1 1;  2R16 A;  3S6P A;  2RR1 3;  5T55 A;  2VME A;  4XDO A;  4M3C F;  1J1T A;  3UNP A;  4PCR A;  3VBO A;  3B69 A;  5JMC A;  3ZYJ B;  3H1M A;  4I01 A;  3VLB B;  3BKZ A;  2RMU 1;  4AHW A;  5F1R A;  3CO2 A;  1QXJ A;  2HYX A;  1IQD C;  1X9P A;  1S0G A;  4QXC A;  4A45 A;  4PI0 A;  5LAT A;  4QB6 A;  2EA7 A;  4TTG A;  3WQ0 A;  1W8U A;  4COW A;  1GNH A;  1MS0 A;  3L9J T;  5A1F A;  2QQK A;  1OA3 A;  1RED A;  1H2N A;  1XOY A;  3O5S A;  3SNM A;  1EPZ A;  2NQY A;  4N9I A;  1GV9 A;  3SC7 X;  4CP9 B;  2ORZ A;  2XVL A;  4IEP A;  3NMB A;  3WP3 A;  2W1U A;  3FHI B;  3ETP A;  1OKQ A;  3EJK A;  1MVE A;  4N9H A;  1NLR A;  2WWS A;  1G8W A;  4AVA A;  1PK6 B;  3HMY A;  2WFP A;  1RUJ 1;  3GM8 A;  4FPL A;  4XET A;  2DUO A;  1GIC A;  2WYS A;  4PQQ A;  3GXU A;  1CX4 A;  3WDY A;  4CSW A;  4O9G A;  2FDK A;  1GP5 A;  4L9B A;  2CSG A;  1UAI A;  4BQW A;  1UOJ A;  2E7Q A;  4QM8 A;  1U5X A;  4OQ8 A;  4HZF A;  3Q8A A;  1RUE 3;  2UYB A;  3OPW A;  3V0B B;  1HQL A;  1OOP A;  5L9R A;  5KHK A;  1YWK A;  4AFM A;  1ULP A;  4P9G A;  1W0O A;  3I7D A;  1YYN A;  1LHV A;  3OPZ A;  1CAV A;  3AMN A;  5JR2 A;  2DWR A;  2R49 A;  2PLV 3;  5C4W C;  1M06 G;  4E4Z A;  1WME A;  3EB7 A;  4XQ4 A;  4Q27 A;  3UJQ A;  4LA2 A;  5HV4 A;  3U0Z A;  1I5P A;  1TVG A;  3V0A B;  5T5J A;  3VBU C;  1RUD 1;  1MS4 A;  5TSW A;  1SPP B;  3I54 A;  5FZC A;  1AYN 2;  1Q8V A;  1VBA 2;  2O8Q A;  2YBP A;  4WM8 B;  4XF9 A;  3MIE A;  3M7A A;  3NJZ A;  2VUC A;  3AMH A;  4FPE A;  3ZYI B;  2YPJ A;  5FLI A;  4NPM A;  1RGS A;  2G19 A;  1AL2 1;  5JZG B;  3D5O A;  3VBS C;  3VL8 A;  4LHS A;  3M70 A;  3AL6 A;  4HOO A;  4XIK A;  3N3H A;  5FLJ A;  2FCT A;  5H9Q A;  5A7W B;  1YCI A;  1XQN A;  2WIN B;  4N53 B;  2VM9 A;  1BYH A;  3MI8 A;  1ZM1 A;  3QBQ A;  3WQ1 A;  2ZX4 A;  4AK3 A;  3KGZ A;  5FJK A;  1VAK A;  3DL3 A;  4HKL A;  3MHZ A;  1D2S A;  3HVD A;  3POG A;  5EXO A;  1W9S A;  3VV1 A;  4RS5 A;  3CJI B;  4PDW B;  5F7U A;  3LIH A;  4E8D A;  5C9A B;  1HB2 A;  3B9C A;  4JRA A;  3VDC A;  5FZB A;  2JJ6 A;  3CEW A;  4XDP A;  3W21 A;  3I2I A;  1MQT B;  3RMY A;  1ZRD A;  3CHX A;  3ASI A;  4GH4 C;  3JU9 A;  2BWC A;  1IKQ A;  3MLL A;  3GBG A;  5I8T A;  5IT6 A;  1RC6 A;  2XBO 1;  2PHW A;  4UWD A;  3OYW B;  3POE A;  3PU3 A;  2DF7 A;  1QH6 A;  1KQR A;  4FPK A;  1D7P M;  1CPM A;  3K3O A;  4QPI B;  2RM2 3;  4YZ3 A;  1ASJ 2;  1O91 A;  5BY5 A;  3AKT A;  4AAP A;  3UL2 A;  1D4M 1;  2WNU B;  1XRU A;  4QMA A;  4CDQ C;  2VQA A;  1ZZC A;  3S30 A;  3D6E A;  5CFD C;  1WA6 X;  4XCB A;  1Q8Q A;  5FZF A;  1PM4 A;  4DPN A;  4FOY A;  4XAE A;  1O5L A;  1F2N A;  4JHT A;  4QX0 A;  1HRV 3;  5B4X A;  3CMG A;  1RHI 1;  1REF A;  3V0B A;  1K5M B;  2OZ6 A;  2P6H A;  2YXS A;  4JGZ B;  3U14 A;  4XQW A;  1GZW B;  5FJH A;  4IE7 A;  4CVU A;  3N7J A;  4JZR A;  3VBF C;  3ZKU A;  1ZYB A;  4FQ4 A;  5E1R A;  3U1X A;  3ZN5 A;  5C8C C;  5F5C A;  1G9B A;  2FDF A;  2RG4 A;  4CU9 A;  4BMB A;  5CB7 A;  2K2S A;  3DEM A;  2BU9 A;  3DPR C;  2EID A;  3JD7 1;  4RL7 A;  1JOB A;  4XZP A;  5FZ6 A;  1MS5 A;  1D0G A;  4JVA A;  3NNF A;  3RJR A;  1VBB 3;  4ZHN A;  2JDP A;  3ZSJ A;  2J1R A;  3UGG A;  5CA6 A;  3GNE A;  1RUF 2;  2ADD A;  4XTP A;  2VCM A;  4RHV 2;  1HV0 A;  5F3G A;  1PO2 2;  3RNS A;  4OHX A;  4KGQ A;  4MG2 A;  4MGT A;  3K3N A;  4JGY A;  4K40 A;  3R4S A;  2IXH A;  2D98 A;  4ZZ5 A;  5J96 B;  4CDW A;  3K77 A;  3O1V A;  2Q8O A;  3BPZ A;  4LBJ A;  3I2J A;  5FYV A;  4FPO B;  1W90 A;  5BV6 A;  1SFP A;  2Y0I A;  2WQZ C;  3CDZ B;  2YY1 A;  3POF A;  4LBN A;  4MH0 E;  1HB4 A;  5FYB A;  3RFR A;  1HJG A;  4SBV A;  3O1M A;  3Q8B A;  3C7O A;  3SIS A;  4W6Y A;  1H0B A;  1YFY A;  1KDM A;  1ND3 A;  2B9V A;  2VZR A;  3GAL A;  4WM7 A;  1JZ3 A;  1AR7 3;  3H8O A;  1QOO A;  2AC1 A;  3RZZ A;  4DXS A;  1IPJ A;  4BLI A;  1IPS A;  4FTE A;  2ZXQ A;  4BK5 A;  3WDU A;  4AI0 A;  1YIP A;  1JTZ X;  4P14 A;  2XJV A;  4V2W A;  2IXL A;  2ZJC A;  1W03 A;  1O8P A;  1ZBE 2;  1VBE 1;  4R52 A;  1ACC A;  1R64 A;  1BEV 1;  4MO3 M;  4XFB A;  4ARX A;  4PF1 A;  3ZM8 A;  4EWA A;  2C6S A;  2XH6 A;  4HG6 B;  3U4S A;  5HXM A;  3NWK A;  1WCD J;  4QDR A;  4AI9 A;  1RUN A;  3RYP A;  4UW3 A;  5A7N A;  1UYP A;  4XFF A;  1JUH A;  2WT1 A;  3MUY 1;  1FYU A;  1UL9 A;  1YC6 1;  3UKN A;  3VGI A;  3T0B A;  5C71 A;  2Q5T A;  1ZRF A;  1S0D A;  4AEM A;  4GKY A;  4DUX A;  2VY0 A;  3MID A;  3PVE A;  1W8Z A;  3I59 A;  4LBM A;  1PGS A;  5FYU A;  2YPD A;  1KFU L;  2BWA A;  2JKX A;  5FMD A;  1H6X A;  3A21 A;  4QQL A;  2TNF A;  1K12 A;  3KM5 A;  1ALY A;  5LEJ A;  3I97 A;  3OUJ A;  2DFC A;  3J8F 3;  4LA3 A;  1CVN A;  2ET1 A;  5FY0 A;  2P34 A;  1XNT A;  2VC9 A;  3FL7 A;  3J26 N;  3RI8 A;  3CZJ A;  1VBD 2;  4JCK A;  3BN6 A;  3HQU A;  1WBL A;  1RL3 A;  2JKB A;  1QF3 A;  3O0V A;  1GQG A;  4G3Y C;  2Y6L A;  3PUS A;  5FXX A;  1LOE A;  3ROU A;  3ZSM A;  4AFD A;  5E88 A;  1SLB A;  1OUS A;  1RUH 1;  1UMI A;  2Z42 A;  2ZGT A;  3M1H A;  2J42 A;  1RIN A;  2ZEW A;  3PUA A;  4GWI A;  1PZ9 A;  1HV1 A;  4Y1X A;  4ERO A;  5B2G B;  4DRV A;  2R30 A;  1ZRI A;  4P00 B;  2JEM A;  1G6N A;  4QPW A;  1E5S A;  4NE9 A;  5C6C A;  2D6M A;  3HIF A;  1W6M A;  2X5I C;  4I09 A;  2VUJ A;  5I0T A;  4YVW A;  2VXJ A;  2IVJ A;  4YZ2 A;  1KDK A;  2ET7 A;  2PAM A;  3OUH A;  4B4R A;  3MGU A;  1T6G C;  2BFU L;  3PHM A;  4K6B A;  4TLF A;  2IVI B;  1CES A;  3SH5 A;  2WNV C;  2QKD A;  4IGO A;  2VD7 A;  1VRH 1;  4LO5 B;  4CEW C;  2FMY A;  3DXT A;  3OSD A;  4Q4Y 1;  1S0F A;  2ARA A;  1XNA A;  5JCT A;  4YFZ A;  3MIG A;  2IUW A;  4IEQ A;  1KS4 A;  1JS9 A;  4UFK A;  5BNP B;  4X8N A;  2DUP A;  4L97 A;  3UK9 A;  2ZS6 B;  4ZU4 A;  5JLV A;  1J83 A;  4MET A;  5F6K A;  3I8T A;  3JB8 A;  1FPN 1;  3LCP A;  3WLU A;  4YFW A;  2WC2 A;  3D3A A;  4LKD A;  1NCR C;  3RZL A;  4Y22 B;  1FNY A;  1G9C A;  4RR3 C;  2VMG A;  4YG0 A;  3N36 A;  4QQP A;  1S0E A;  2XLA A;  4C1X A;  4ET7 A;  3AMM A;  4YYO A;  2J1V A;  5F6L B;  1DQ4 A;  1PO1 3;  2RE9 A;  2WQ8 A;  3A0K A;  2WZR 3;  2W2I A;  2BNM A;  4YG6 A;  4O65 A;  4CP1 A;  1IS4 A;  4YPJ A;  2FD8 A;  5FUI A;  3J7H A;  2HWB 3;  1JU3 A;  2EXH A;  3K2O A;  4OLL A;  4DY5 A;  2QQJ A;  3T1L A;  4AFA A;  5CG9 A;  1NE4 A;  2MEV 1;  1VB2 A;  1PMJ X;  3UGH A;  5LA2 A;  2D5F A;  3TNP B;  4F7Z A;  1QJY 3;  4BJ0 A;  4QQO A;  1SG3 A;  4XAC A;  1EYB A;  3C7F A;  3OD0 A;  5I0S A;  4QQH A;  3A0N A;  2D3R A;  3LEM A;  1UX6 A;  4GIQ A;  3I2F A;  4GD4 A;  2BGO A;  3P6B A;  1O3Q A;  4IXL A;  2A5Z A;  5JXG A;  2JDA A;  1JU4 A;  4QB2 A;  2VO5 A;  2Q8E A;  3IZO A;  5F8P A;  2HEW F;  5BNO B;  5FZ7 A;  5M0T A;  2KA3 A;  2RS1 1;  5F3I A;  1T6B X;  2VTX A;  2VNR A;  1ENS A;  2HWD 1;  3IPV B;  3FHA A;  3O1R A;  5D8A A;  4L0P A;  4Y20 B;  1AXZ A;  1Y9M A;  4Q5O A;  4XBL A;  1MPX A;  5FYY A;  3GJB A;  2Q8C A;  1A8D A;  1MZF A;  3WXP A;  1O3R A;  2FQP A;  4IEU A;  1U5Z A;  4IND A;  4A7K A;  1UXZ A;  2BUK A;  4AXO A;  3PTY A;  1MZ6 A;  1HQN A;  2ZKL A;  1QJX 2;  3IN9 A;  1W9W A;  4GJZ A;  4DNY A;  3UT0 A;  1NA1 A;  3FN9 A;  1GNZ A;  2HWC 1;  2YUE A;  5FZI A;  5J3U A;  4AQS A;  1DF0 A;  2H6B A;  3DKW A;  1UMH A;  1RUJ 2;  2ZGP A;  3NO8 A;  2WN2 A;  2PHT A;  3WDT A;  3SKV A;  1G9A A;  4WVW A;  3FFZ A;  1FMD 1;  1SLT A;  3OBR A;  4XJ9 A;  4OUL A;  5EWS A;  4HFS A;  1MZE A;  1Q3E A;  1VBA 3;  2OUH A;  2UWA A;  2VPV A;  4QXB A;  1F15 A;  1BJQ A;  1POQ A;  1AYM 1;  4MZU A;  2WSU A;  4L11 A;  1H9P A;  4NHK A;  4C0H A;  1H1A A;  3JZV A;  1PX4 A;  4HKO A;  3W59 A;  3LPF A;  3I2G A;  4LKS A;  1GAN A;  4FXG B;  4DS0 A;  3EHK A;  3RRD A;  5KWR A;  2HEV F;  1RIT A;  4M00 A;  2BOI A;  2XL7 A;  4FFF A;  1S1A A;  1ODN A;  4Q4X 2;  1DZT A;  3VD4 A;  3R4D B;  3VKL A;  5KXB A;  3CZU A;  1OT5 A;  2B7Y A;  4NOT A;  1LEM A;  5K0U B;  2DVB A;  2PXJ A;  1WLC A;  4RYD A;  3RWK X;  3HQR A;  5DUX A;  1F31 A;  5FTT C;  4LIV A;  3DYP A;  4I2O A;  5DMY A;  2PHF A;  2WKK A;  3NAP B;  1OOP C;  4M01 A;  1POV 3;  1R08 2;  1JHJ A;  3ZMN A;  3H3L A;  2PA7 A;  3OD4 A;  5C4W A;  2VMH A;  5EHD A;  1BLZ A;  2XPJ A;  4LO6 B;  4QAW A;  1CIY A;  4FT8 A;  4YW4 A;  5A7S A;  1AL2 2;  3ZKY A;  5JOW A;  3VBU A;  2LUW A;  5IFP A;  1ZA7 A;  4HBN A;  2YZ4 A;  3POJ A;  2O1Q A;  1Z7S 1;  1BBT 1;  1ASJ 3;  2IFW A;  1JYC A;  5FY8 A;  2RJ2 A;  4LO4 B;  4OI2 A;  4XUQ A;  5CYY A;  5FXV A;  1N3O A;  1UIK A;  5HCF A;  2Y6F A;  4P5H A;  3IPV A;  2LTN A;  3I3D A;  5FPL A;  2IWG B;  3WOG A;  1BMV 2;  3FFQ A;  4BQX A;  3MLK A;  1LU1 A;  4DB5 A;  2SBA A;  4G9S B;  3EQE A;  1SAC A;  1N3Q A;  4DXZ A;  4H7M A;  1C8M 1;  5C3P A;  4OHV A;  1S4C A;  3FLP A;  2HLE A;  5IVE A;  3ALQ A;  3ZYF A;  4EN9 B;  2BBA A;  3ZX7 A;  3W58 A;  1EPW A;  3W9A A;  2WDB A;  4DZG A;  1PHM A;  3LA3 A;  4AI8 A;  1L7R A;  3MF9 A;  4CUA A;  2WS9 2;  3T3Y A;  1C8N A;  4YW1 A;  2J22 A;  3CNA A;  5F5A A;  3ZDS A;  1V6J A;  3PIJ A;  2ARB A;  1TME 2;  2A6W A;  2RVA A;  2Y6H A;  3GZA A;  4I0B A;  3R6S A;  4NIG A;  2DVG A;  1KJL A;  1PIV 3;  3PVB B;  5C5T A;  3N9N A;  3VKN A;  3ZFG B;  5JXI A;  3ILR A;  1W6O A;  2DVD A;  1DHK B;  4Z1V A;  5FOB B;  3LOI A;  1RHI 2;  4BPZ A;  3AZX A;  2EAK A;  1NXM A;  5BNN A;  1CZT A;  4H55 A;  5DZE A;  4N43 A;  1W8T A;  1NXD 1;  1PK6 C;  1LOA A;  1X82 A;  3WIN E;  1ZRR A;  1VBC 3;  2JIC A;  3HNM A;  3JD7 2;  4EWE A;  4KQ7 A;  1O3S A;  1UYZ A;  3RPQ A;  1H9W A;  5FRE A;  1RMU 1;  2BJS A;  3GF6 A;  2B45 X;  4HVO A;  3ACL A;  1CIW A;  1S0J A;  2BEO A;  2DCZ A;  3S5Q A;  1DQ2 A;  1LOD A;  5BXX A;  2ZHK A;  1DQ1 A;  3VBF A;  4BLJ A;  3AM2 A;  5C8C A;  3FLT A;  1HDK A;  5FBZ A;  5FY7 A;  4H7L A;  1OUR A;  3DPR A;  3SKJ E;  3LSE A;  4PIY A;  2WAA A;  1Q8S A;  3LEI A;  3GZE A;  4BME A;  3RZH A;  4KWJ A;  5FMO L;  2VOV A;  3PLQ A;  1QWR A;  1UIJ A;  1W9T A;  1S0C A;  4COV A;  1XSQ A;  4LBK A;  4XIL A;  3PUR A;  4IV1 B;  3VHN A;  5I0R A;  1EUU A;  1RXG A;  3P3P A;  2GNB A;  5K9Y A;  2VUL A;  3ABZ A;  1QJU 2;  3OOX A;  2YGL A;  4WVM A;  4CEY A;  4JKM A;  4EN6 B;  4FBF A;  1OFN A;  2RDR A;  3ZXK A;  3GHN A;  3AKR A;  1KEX A;  4LBQ B;  3E97 A;  1D2Q A;  4JGY C;  5FCC A;  1C1L A;  1V9U 1;  3RZM A;  4F83 A;  1GQH A;  4GUL A;  1DDL A;  5LBE A;  1QJF A;  3TEY A;  3IDB B;  3ZLI A;  4CZS A;  5JZG C;  1RUC 3;  1BEV 2;  5GZD A;  3ZYR A;  3H8R A;  3ETQ A;  2MNG A;  1O4T A;  4JTO A;  3WF2 A;  2DCJ A;  4BWO A;  1I1E A;  1VAV A;  4D3W A;  1W2A X;  1YJK A;  4Q4V 1;  2F4L A;  2FDJ A;  3CJI C;  2ETE A;  2R07 2;  2RJK A;  2WLP A;  4JDO A;  4WV8 A;  2Q1F A;  3ME2 A;  3MIH A;  1QGL A;  4L2N A;  5EFU A;  4JX0 A;  5C9A C;  3MDP A;  1W2U A;  4PF5 A;  2PHL A;  1S2E A;  2DU1 A;  4LHL A;  4LHK A;  1BKZ A;  4XC9 A;  1OFS A;  3MV1 1;  4YW7 A;  4D69 A;  3THC A;  3TB0 A;  1V70 A;  2JIG A;  3UKV A;  3T2P A;  3VHR A;  4CYD A;  3S0M A;  1IS6 A;  3GBW A;  3CF6 E;  4PLM A;  2BVB A;  5GLZ A;  1JZ8 A;  2OYZ A;  1UU4 A;  5JUV A;  2VOX A;  5BPX A;  4QPI C;  5AVA A;  3E5Q A;  3ZYG A;  3VBR A;  3EXU A;  1IOA A;  3QH7 A;  3LF7 A;  3WP4 A;  1V0A A;  2CDP A;  3PVN A;  2VUA A;  2BYV E;  2WNU C;  4HET A;  3OGR A;  4IV3 B;  4XBQ A;  3POY A;  5CIS A;  5FZA A;  2B39 A;  1A8M A;  3AC0 A;  2OUJ A;  3FUO A;  3PNA A;  1RUG 2;  4P9Y A;  1YNA A;  2VXR A;  2VW1 A;  2VOT A;  1ZRC A;  4FP3 A;  1V00 A;  5GZC A;  5GLT A;  2D40 A;  4FVV A;  3D4K A;  5KC5 A;  3P1I A;  4JGZ C;  1G9F A;  1AX2 A;  4PQ9 A;  4DIQ A;  3RZJ A;  2VR4 A;  3UES A;  1OLR A;  5BYN A;  5J36 A;  1KD7 A;  3AVS A;  1G86 A;  2CYF A;  3WHU A;  1LNS A;  4CUC A;  3E6B A;  1WUV A;  5A33 B;  4A44 A;  4Q4Y 2;  4D7Y A;  4Y26 A;  4G4F A;  1CAW B;  5KC6 A;  2TBV A;  4XJU A;  1WKY A;  1SFY A;  1PVC 1;  1DQ0 A;  4CCO A;  2WNV A;  1LOF C;  3LGR A;  2C24 A;  3DYM A;  1FPN 2;  1HKD A;  3HQX A;  4ISQ A;  1CQ9 A;  4CEW A;  2QZ3 A;  2PHX A;  2NM1 A;  2P3Y A;  4EN7 B;  1ZZ9 A;  5FZ9 A;  1E5R A;  2WFF 3;  3Q8C A;  3HR9 A;  4NR1 A;  2W39 A;  2OA2 A;  1LOG A;  2MHF A;  4J25 A;  3RYK A;  1X8E A;  3UGF A;  4AVC A;  1PVX A;  1V6M A;  2HWE 1;  4JV4 A;  2GMM A;  2EAL A;  2WZ8 A;  4U2A A;  4OMD A;  4QGM A;  2MEV 2;  4Q8K A;  2NMN A;  3KZ4 C;  2WA4 A;  4FOQ A;  2XLG A;  2NPI A;  3NW4 A;  5CBL A;  5IFT A;  3P5B A;  5FZ8 A;  4M4R A;  1TZO A;  5LBC A;  4AGV A;  3WG3 A;  1OBN A;  3MF6 A;  1HW5 A;  2KR2 A;  1Y4W A;  2PHD A;  2C4X A;  3I2O A;  4Q26 A;  4NHX A;  2RS5 3;  3BAL A;  4DQA A;  4YRD A;  2WN3 A;  2IXI A;  1QJX 3;  3A22 A;  1GLH A;  2J1A A;  3ZXE A;  1YQ2 A;  1LUL A;  1AUY A;  3AZW A;  1QNW A;  1AX1 A;  3NNL A;  4W6X A;  4CU7 A;  1WCQ A;  5FZH A;  2XXZ A;  2HBT A;  1ZBA 1;  1BZW A;  1CAU B;  2VNO A;  5FO8 B;  4MAD A;  3C7G A;  1DBN A;  4W4Z A;  4XUT A;  4CCC A;  4OHY A;  1H8V A;  2AR6 A;  4UF0 B;  3NJY A;  2D6N A;  4P5Y A;  5IYY A;  3S57 A;  4K7J A;  1LHO A;  5FYC A;  4CCN A;  3CU7 A;  3KS7 A;  3LA2 A;  4AF9 A;  3H7Y A;  3IWZ A;  5T5O A;  5LA1 A;  1L3J A;  5BNQ A;  2W46 A;  2Z4F A;  5FAX A;  1X8M A;  1SBE A;  2UY9 A;  2VZT A;  1XYP A;  2WNO A;  3N35 A;  3WNL A;  5SV8 A;  3PJY A;  5HI0 A;  2YRO A;  4BK4 A;  4Q4X 3;  1HRI 2;  4KG0 A;  2HWC 2;  1QIQ A;  1TNR A;  2I07 B;  3Q8F A;  2G4I A;  4NUB A;  5D8A C;  1I5Z A;  3WHT A;  2PFW A;  3KLS A;  1K42 A;  2GAU A;  4RSU A;  4K1Z A;  1FMD 2;  2VH9 A;  3FWE A;  4ZON A;  4AZZ A;  1W6Q A;  1N1S A;  4S2G A;  1R08 3;  4FOW A;  4GWM A;  4WVV A;  2VOW A;  1AR6 1;  3BOP A;  4M4P A;  3IKW A;  2QUO A;  4OYU A;  1AYM 2;  2PAK A;  1MEC 2;  1GMM A;  2BNN A;  3FMG A;  5H9P A;  1NA1 C;  2Z69 A;  1QY4 A;  2YC2 A;  2ZEZ A;  4MLO A;  5DN2 A;  1I3H A;  1NY7 2;  1PNF A;  1ZNP A;  3KV9 A;  1ST8 A;  1AXY A;  5LZ6 A;  4AED B;  1QH7 A;  4Y5Z 0;  3EBR A;  4CDU B;  2O0O A;  2A6Y A;  3ZYB A;  4BQ4 A;  5C3S A;  3ZPY A;  3A23 A;  2MPF A;  1QQP 3;  5FZM A;  2ENR A;  3L2Y A;  3GYD A;  4RGA A;  3ZR6 A;  2ZGR A;  5IVV A;  2HJI A;  3JBG 1;  2YB7 A;  2KM2 A;  3POI A;  4LBQ D;  3KF5 A;  3VZJ A;  4YNI A;  4AAX A;  1AR8 3;  2VVF A;  4GB3 2;  1JYV A;  4CCE A;  1K3I A;  5AC9 3;  3PUH A;  4XF4 A;  4XAB A;  4YM0 A;  1O4Z A;  5FLH A;  3K75 B;  2WS9 3;  4Q0U A;  1BBT 2;  5FO7 B;  3AYE A;  2OX0 A;  4A7Y A;  4E27 A;  2DTW A;  2HBU A;  2R06 2;  4J1X A;  3ST7 A;  1TME 3;  1JW6 A;  4LO7 A;  2XVK A;  2WJS A;  2VZS A;  2D44 A;  4HL0 A;  4TN7 A;  4V2V A;  5EJ3 A;  2QQO A;  2WO1 A;  4JHZ A;  5JPN B;  5FPZ A;  3V64 A;  4H2A A;  1XE7 A;  1T2X A;  3B5L B;  4E4H A;  4EYU A;  3KQR A;  5HCA A;  4RQP A;  1OH4 A;  1RXF A;  1W3X A;  2P2K A;  3I2K A;  2W94 A;  3AP5 A;  4MGY E;  4W50 A;  1TMF 2;  4ZU7 A;  2BNO A;  1HB3 A;  3VD9 A;  3K48 A;  1COV 2;  1NZI A;  4PBO A;  1AL0 G;  1DLC A;  1CAX A;  3AMP A;  2LS6 A;  3VHP A;  5IVY A;  4ZXE A;  1VRB A;  1HXS 1;  1H1I A;  5CKQ A;  2I74 A;  4HXC A;  3T1M A;  1AR9 3;  3GCW A;  5I0U A;  1B35 B;  1NCQ B;  4AQ2 A;  1CJD A;  5ACA 1;  3LB9 A;  4QHB A;  4IE5 A;  1RVF 1;  4LOT A;  1OLM A;  2WYF A;  2RR1 1;  2W1S A;  1SCS A;  1A3K A;  3ZXG A;  1ENX A;  2XJP A;  4IEW A;  1UMZ A;  5L7O A;  3NJV A;  3NVC A;  3ZFF B;  1KXG A;  1URX A;  3ELN A;  1GSL A;  3QD6 A;  4S2H A;  1OH3 A;  1JHN A;  4JAA A;  3OY8 B;  5A3M A;  2A3W A;  2YC0 A;  4KBZ A;  2JDH A;  3H0O A;  1QJU 3;  3R4U A;  2W91 A;  1Y9G A;  3WCS A;  4CP9 A;  2E7T A;  5FZO B;  4TWT A;  2FDH A;  4OHZ A;  1C1F A;  1RMU 2;  3O0W A;  4B29 A;  1SEF A;  5A32 B;  4B1L A;  4KI5 M;  2CWS A;  2WL1 A;  3H1W A;  3NV3 A;  4IE0 A;  3ZN6 B;  3LFI A;  1EP0 A;  1PK6 A;  2ZTN A;  1RUI 2;  4XHB A;  4QQ2 A;  3MPP G;  3WF4 A;  3DYO A;  5BNN C;  3BTX A;  1YI9 A;  4NIA A;  3SCG A;  2PMW B;  3TEW A;  2XHN A;  4CE8 A;  1FV3 A;  3ILN A;  3ZYP A;  4N43 C;  4NRP A;  2VUD A;  3DF0 A;  3JQW A;  4MV2 A;  1DFQ A;  2Y8K A;  1FV2 A;  3E5X A;  1Q8P A;  4EE2 A;  4XVH A;  3JUU A;  1LHN A;  5J37 A;  2JWP A;  5LA0 A;  3MEP A;  1O6U A;  3FJS A;  2R07 3;  5F9T A;  2H0V A;  1RUE 1;  3IAQ A;  3BGA A;  4KL1 A;  4P9J A;  4Q4W 3;  1W8N A;  3IBM A;  4ZXK A;  5IWF A;  5KHG A;  1WLW A;  1LRH A;  1H2K A;  2ZGL A;  1V6O A;  3H1Y A;  3GDB A;  4CRQ A;  1WD3 A;  4MYE A;  2GU9 A;  1BQP A;  3ZXJ A;  4AG4 A;  1GP6 A;  5DAB A;  2NZ9 A;  5ABJ B;  2RS3 2;  1Q43 A;  4QDQ A;  3V0A A;  4U36 A;  3FC0 A;  2PLV 1;  1GWM A;  3WNK A;  4KGG A;  1SPP A;  4QPY A;  1FNZ A;  1UZV A;  1OF3 A;  2J7M A;  3IIA A;  3M4F A;  4WM8 A;  3AP4 A;  1DQ5 A;  2RDS A;  4YM1 A;  3T4H B;  3VN4 A;  3H3U A;  4CEY C;  1H2M A;  4BIF A;  5A7O A;  4K3U A;  4K1Y A;  4Q4V 2;  3AP9 A;  3OTF A;  3OEB A;  3LE0 A;  4QPG B;  4XE9 A;  5JZG A;  1RUG 3;  3WG2 A;  3KT1 A;  5A7W A;  1NOV A;  4Y5S A;  4N53 A;  3DXU A;  2FDG A;  2A6X A;  4A42 A;  1VMH A;  4IEV A;  4XFC A;  1HX6 A;  1UPI A;  2CGO A;  1BHG A;  3CJI A;  4PDW A;  4AE2 A;  3F95 A;  3EYP A;  5C9A A;  2DUR A;  1VPH A;  2DUQ A;  2ZX1 A;  4JRL A;  4I02 A;  2P3K A;  3KSC A;  1MQT A;  2XJU A;  3LIG A;  2BGP A;  2CGP A;  4JC1 A;  3I49 A;  1UN1 A;  4JDN A;  4YGD A;  4DFS A;  1N47 A;  4W65 A;  5EQU A;  1R09 2;  2ZA9 A;  3WV6 A;  3TOJ A;  5CZK A;  5FZL A;  5FO9 B;  3OYW A;  4I0W B;  5IW0 A;  4QPI A;  3USU B;  1LAJ A;  2XML A;  1UOF A;  1CZS A;  2PQQ A;  4EV0 A;  1XBF A;  4A41 A;  2WNU A;  4OUE A;  5FDB A;  4I30 A;  2RM2 1;  2VGD A;  1R1A 3;  1A34 A;  1NKG A;  1QXP A;  2BV4 A;  3VBR C;  3LEG A;  4S2D A;  1H6Y A;  1QOT A;  5CAZ A;  1EAH 3;  1NQD A;  3KHB A;  4HPK B;  3JB4 C;  1WA4 A;  3UJO A;  4YM3 A;  1K5M A;  3E6D A;  3K46 A;  3DGT A;  4JGZ A;  5A3P A;  4UAP A;  3N9P A;  1GZW A;  3PU8 A;  3VDD B;  3MIF A;  3WNX A;  5CAD A;  2GMP A;  4UW6 A;  1HRV 1;  1JYX A;  4GKX A;  2QCS B;  2EXK A;  4NN0 A;  4R9C A;  1ZZB A;  4PHZ A;  5JPM B;  3ZSK A;  1PM7 A;  3VZL A;  1S2K A;  2VVE A;  4IET A;  5DDJ 2;  4LQR A;  5FYM A;  1HN0 A;  4HLT A;  1GOH A;  4UW4 A;  5ABJ A;  3IMM A;  1RJ7 A;  4QXH A;  5DAX A;  1YFU A;  1P8J A;  1LOF A;  1VBB 1;  2ARE A;  4HK9 A;  4AWD A;  3HD8 B;  1O7F A;  2XJT A;  3CIH A;  3FBM A;  4Q0Q A;  3WD5 A;  1WW6 A;  2VQT A;  4UFI A;  2WWJ A;  4V1P A;  1OXC A;  3IDC B;  2GSY A;  2FZ1 A;  1JZ6 A;  1O8S A;  4QDS A;  2R04 3;  4Z92 B;  2BGC A;  4BZ4 A;  4K8R B;  1DQ6 A;  4YZ5 A;  3T08 A;  1JOP A;  3N9O A;  1W06 A;  5EJZ B;  2K0G A;  5KR7 A;  2RDQ A;  2Y33 A;  5J98 B;  4E9K A;  2BOJ A;  3UET A;  3OGS A;  1ENR A;  3OGG A;  2V4A A;  5GZE A;  4PIZ A;  1LOC A;  1W9F A;  3ZFE B;  5APA A;  4MVT A;  2YMZ A;  2DTY A;  4XEZ A;  1AR7 1;  3MW3 A;  3SQO A;  3O1U A;  1J3P A;  1UU6 A;  5IUQ A;  4DIN B;  5K4L A;  3TN9 2;  4LR4 A;  5FPU A;  1HRI 3;  4FPJ A;  1MS9 A;  4BXF A;  4Q1R A;  3FX3 A;  3PME A;  1WBF A;  3ENR A;  1FOD 2;  3H8X A;  1VMF A;  2HWF 2;  4WZC A;  4Z82 A;  2QE3 A;  1WMF A;  1CJP A;  1O4Y A;  5IK8 A;  1CX1 A;  5FKC A;  5LY1 A;  3TRS B;  4AHX A;  3LSD A;  2DVF A;  5FYS A;  2J1S A;  2DCK A;  3HJR A;  4XUP A;  1UWW A;  1MEC 3;  1S0I A;  4Q1P A;  5CNA A;  4XDQ A;  4D6S A;  1CWP A;  4IUG A;  1QHD A;  3H3Z A;  4OUM A;  4IV3 C;  1R1A 1;  3KB5 A;  3THD A;  1VR3 A;  4A6S A;  3J8F 1;  3WF1 A;  1US2 A;  5HCB A;  2OW4 A;  2W1Q A;  3POB A;  4W6W A;  3WNO A;  4AL9 A;  5KHI A;  3VBH B;  4IEZ A;  1OD5 A;  5LB6 A;  1EV1 2;  3AP7 A;  1JH5 A;  3GBF A;  3J7N A;  2QQM A;  5FZK A;  5FZ1 A;  4IW3 A;  1C5H A;  1LCL A;  4FAH A;  2CL2 A;  2RMU 2;  1Y3T A;  1WCS A;  4CCK A;  4GB3 3;  1LHW A;  4M0N A;  5DXD A;  4YW6 A;  5HCH A;  1ULG A;  4BQ3 A;  4H14 A;  4XUO A;  4AFB A;  2OZJ A;  4B7K A;  2Q1Z B;  1D0H A;  5JOX A;  3IB3 A;  4JKL A;  2R06 3;  5FPB A;  3T2T A;  3VZK A;  1AVB A;  2ADE A;  1DCS A;  1GBG A;  4W8J A;  2V73 A;  3BU7 A;  2K46 A;  2YC4 A;  5BNP A;  2UWC A;  5FP4 A;  1YLL A;  1UKR A;  3SLI A;  3VBS B;  3JBG 2;  1QKQ A;  1XU2 A;  3RI9 A;  5CFC B;  1PGL 1;  1S55 A;  2JD4 A;  2F4P A;  1AYN 3;  2AEZ A;  4XF3 A;  5IK7 A;  1TMF 3;  2ZGM A;  3J9S A;  4URT A;  4XJA A;  4N8M A;  4Y22 A;  3U4X A;  1YXW A;  1COV 3;  1S2B A;  5FK7 A;  2VL4 A;  1Z78 A;  4S2F A;  1WD4 A;  4H3W A;  4PBP A;  5DAV A;  4KG8 A;  3SXW A;  4MGS A;  1N3P A;  3NKG A;  4CA9 A;  2B8M A;  4QX8 A;  3ES1 A;  3INA A;  4QX3 A;  2OKX A;  2ZGK A;  1PO1 1;  1PGW 1;  1OF4 A;  5I0D A;  2WZR 1;  4GH4 B;  2E33 A;  4CTE A;  1IGO A;  5LK7 B;  5FPV A;  5A3U A;  3FHQ A;  2EXJ A;  1POV 0;  5FIX A;  2HWB 1;  1WW5 A;  2QZ2 A;  5ANN A;  1JI6 A;  3O0X A;  1US3 A;  4LBO A;  5FQ0 B;  4CXW A;  1PX3 A;  2P1B A;  1W28 A;  3I3E A;  1LED A;  1H8T B;  4Q0V A;  1RUD 2;  2IXC A;  5GJ6 A;  3BIW E;  4DO0 A;  4EN0 A;  1RIR A;  4IL7 A;  1QJY 1;  5GM0 A;  3MZH A;  4QGN A;  4CDQ B;  4LLF A;  3QAC A;  1ODM A;  4XMA A;  4B8E A;  2D43 A;  5KHJ A;  2A75 A;  1F5F A;  5CFD B;  3R05 A;  3VBH A;  2JDU A;  2B9U A;  1QMJ A;  4YW3 A;  4LMF A;  4CDX B;  3USS A;  3WP6 A;  5ACA 2;  4BQ5 A;  2Y64 A;  2AUY A;  4HON A;  5BNO A;  1LES A;  1RUI 3;  4GA9 A;  4LK7 A;  2Y6G A;  4RQP C;  3THT A;  2RR1 2;  2ZCW A;  3B7M A;  4FP2 A;  4NPR A;  4AYU A;  2WWU A;  2E26 A;  3KCX A;  4QT6 A;  5JI9 A;  3BVC A;  4Y20 A;  1OQ1 A;  1MR5 A;  5K8S A;  4AQ6 A;  5F37 A;  4FTS A;  2W5F A;  4FO9 A;  2R7E B;  1JYI A;  2FCU A;  3WW1 A;  4CUB A;  1AX0 A;  2B5H A;  3APB A;  2DCT A;  3D0J A;  3ZDV A;  2WZE A;  3KCY A;  3OB8 A;  3MIC A;  4FOV A;  4D8M A;  2XBO 2;  3C7H A;  5GKA C;  3HN3 A;  1MS1 A;  2WII B;  2XJR A;  1WCK A;  3QLQ A;  4MXV A;  2VVD A;  1I6X A; 
#chains in the Genus database with same CATH homology
 3OUJ A;  2HBU A;  5ERL A;  5LB6 A;  3HQU A;  5IAV A;  3GZE A;  3OBZ A;  4XCA A;  5EQU A;  3W21 A;  2JIJ A;  5LBB A;  4IW3 A;  4Y5T A;  5LBC A;  2FCT A;  4UWD A;  4NHK A;  4NHX A;  2RDR A;  4NMI A;  4ZPI A;  3OUH A;  3NNJ A;  3MGU A;  3NNL A;  5LBE A;  2HBT A;  5HV0 A;  4XCB A;  4XAA A;  3HQR A;  4NHY A;  5IAX A;  4KBZ A;  5LAT A;  4JZR A;  5LA9 A;  2RG4 A;  5DAV A;  2RDN A;  3EMR A;  5DAX A;  5L9V A;  4XC9 A;  3NNF A;  2FCV A;  4MHU A;  5EPA A;  5LBF A;  2JIG A;  2Y34 A;  3NNM A;  5A3U A;  3DKQ A;  3KT7 A;  4BQX A;  5DAP A;  2OPW A;  2A1X A;  4ZON A;  2RDQ A;  2Y33 A;  4BQW A;  4XAC A;  2V4A A;  5L9B A;  5L9R A;  4NHM A;  5C5U A;  3KT4 A;  5DAQ A;  5DAW A;  3W20 A;  5C5T A;  3ITQ A;  3BVC A;  5M0T A;  5HV4 A;  2RDS A;  5EP9 A;  4BQY A;  2FCU A;  4Q5O A;  4NAO A;  3GJB A;  3KT1 A;  4MHR A;  4Y5S A;  3GJA A;  4XAB A;  2G19 A;  5LAS A;  3OUI A;  3PL0 A;  4NHL A;  4J25 A;  2G1M A;  5IAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...