3ITQA

Crystal structure of a prolyl 4-hydroxylase from bacillus anthracis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
198
Chain Sequence
KEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLADVNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of prolyl 4-hydroxylase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
molecule keywords Prolyl 4-hydroxylase, alpha subunit domain protein
total genus 57
structure length 198
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3itqA01
3BVCA 5LBFA 3NNMA 5LBEA 4ZONA 3EMRA 2OPWA 2G19A 4BQWA 3ITQA 5LA9A 4MHUA 5DAVA 4ZPIA 5C5TA 5IAXA 4J25A 4NMIA 3GJAA 5L9RA 5DAQA 5ERLA 5LATA 3W20A 5HV0A 2A1XA 5EPAA 4BQYA 3GJBA 4XACA 2RG4A 5L9VA 2RDNA 3GZEA 5C5UA 3NNFA 4XABA 4Y5SA 5LB6A 2Y33A 3PL0A 5EQUA 4NHMA 2RDRA 4BQXA 3NNLA 4IW3A 4NHLA 5IATA 3KT7A 4NHKA 2JIGA 5M0TA 2Y34A 5HV4A 4XAAA 2FCUA 2RDQA 4NHYA 3KT1A 3OUJA 4Y5TA 3HQUA 5LASA 3MGUA 3KT4A 3OBZA 5IAVA 4XCAA 5DAXA 3OUHA 3HQRA 4KBZA 4NAOA 3W21A 2G1MA 4Q5OA 2RDSA 3OUIA 2V4AA 5DAWA 4UWDA 2HBUA 5LBBA 3NNJA 4JZRA 2FCTA 5A3UA 5LBCA 4XC9A 5DAPA 4MHRA 2HBTA 5EP9A 2JIJA 4NHXA 3DKQA 4XCBA 5L9BA 2FCVA
chains in the Genus database with same CATH superfamily
4IV1A 2W95A 5FYSA 1REDA 1T6GC 5C8WA 4NRPA 2ADDA 1HRV1 3ZN5A 2W9XA 2HWE1 2OW4A 1ZZ6A 1W04A 2P1BA 3N7MA 3FUQA 3IPVA 4UFMA 4WM8A 4XF3A 2B42B 3N9LA 4IGOA 2J22A 4CEYC 1XC6A 1K5MA 2A3YA 4HOOA 1VRH3 3LAGA 1J3PA 1JYVA 1TNFA 5T54A 3OPWA 1ULFA 1H9WA 5LATA 5FO7B 1QNWA 2ZEYA 4QB6A 3W5NA 5FZHA 3LA2A 2AEZA 2MEV3 3A0KA 3MIBA 1H4HA 5FMBA 1OC1A 1FYUA 3GHMA 4W50A 2TBVA 2ET1A 1NZCA 2PHRA 3WLUA 5A33B 4IE4A 4Y1VA 1QOOA 1VMHA 4Y4RA 1XU2A 4AR2A 1OQ1A 2RMU3 4PF1A 5AFEA 2YC4A 1K42A 2JG8C 3USUA 1PK6B 2XHKA 3UK9A 5CYYA 2HWB3 1LNSA 2VZRA 1UU6A 4AI0A 2HWF2 5KHJA 2VTXJ 2QCSB 4MGQA 3SLIA 3VDDB 3BOWA 2FBEA 1NG0A 3HR9A 5BNNC 3P3PA 4WM7C 2PN5A 1GNZA 1DP0A 3OGGA 4LPLA 1LU2A 2ARBA 2LRPA 3O1OA 3KHCA 1GBGA 2R1BA 2E26A 1W6NB 2V4VA 2OUHA 2D44A 2VAUA 3N9NA 1RUH2 4IXLA 4YGDA 1UWWA 1K5MC 2VMGA 3AZXA 3Q8AA 3SEEA 5C8CB 2OUJA 4AHXA 1YQCA 2WNVC 2VVDA 4QM8A 4EYUA 3U10A 2XH6A 2XJQA 4WVZA 2ZA9A 4MX3A 2D93A 2WUHA 5ABJA 2JDUA 1O4YA 4ATFA 2R063 2C24A 2GC1A 3MF6A 4RQPA 5FWEA 2VMCA 1EV11 1JZ3A 3OB8A 1UKGA 5C3PA 4AQTA 5A1LA 5I91A 1ND2A 3B94A 4W8JA 4RS5C 3LFMA 3KM5A 4IV3C 3TOJA 3NV2A 1YO8A 3PVEA 2RVAA 1WCUA 4YNIA 3ABZA 3K4AA 5T5PA 3U11A 1IKQA 3ES1A 4R4ZA 5J1XA 5HXVA 3TNPB 3MF9A 1JYXA 2LS6A 5FMOL 1F9KA 5A3TA 1LULA 5C33A 1Z7S1 2FZ1A 4NAMA 3KHBA 5FZAA 5I8SA 3LQCA 4YZ2A 2HWD3 5C3RA 1QH7A 2ZMKA 2V4AA 1VBA1 4HANA 2BW8A 2WC2A 2W3JA 2Y6GA 1V9U1 3N9OA 3HEIA 4UT5A 2E63A 5D8AA 5JXGA 3E5XA 2DFCA 3E6DA 2HWE2 2K46A 3MLKA 3WCSA 3E6CC 1NCRC 1GZTA 1HQWA 1W0OA 1UN1A 2QTWB 3SCGA 2VNRA 3MYXA 2P17A 5IHRA 3DXTA 4PHZA 4YVWC 4BK5A 1JZ7A 4Y5Z0 1F15A 5IVVA 3UETA 2VJXA 4M4PA 1F4HA 3VBHB 1ENXA 4XZPA 2FHRA 1H8TA 1A6CA 5KXBA 4QQPA 4NPMA 3SEPA 1U5XA 4N43A 1YIPA 5C3SA 2JE8A 2XPJA 3ZMNA 1S0GA 3ZR5A 3BKZA 1YLLA 4NO4A 5L36A 3OTFA 1UF2C 2B39A 4YM1A 3THTA 5DN2A 5GLTA 4BH9A 1WW5A 2QQJA 5IVEA 1A8MA 1ZZ7A 1ALYA 4S2HA 4QKDA 2R061 4CEYA 1EV13 4EZ4A 4LMFA 3AVRA 5C5TA 2A3WA 2A6XA 3VDCA 5C8CA 5FZ7A 3SHRA 2WT0A 5F1RA 2GNBA 2CU5A 4ZHNA 1HN1A 5H9SA 3ZXLA 3WW1A 5EPAA 4KMQA 4YVSC 3PMSA 1MACA 1W6QB 3ZFGC 3IAQA 4BLIA 5BXXA 4XDQA 4JGYA 2CGPA 1JYTA 2ZX1A 3B7MA 4GKXA 4AYUA 1CR7A 3RJRA 1CAVB 4XBQA 4A41A 2AGSA 3PL0A 4QX0A 3KB5A 1AL0G 4QU2A 1OI6A 3JD73 5EQUA 3SMHA 4QGMA 1H8TC 1N1VA 5J3UA 2JDMA 4C90A 1KFUL 2K2SA 3VKNA 3WY6A 1LOCA 1VBC3 3AB0A 4MO3M 4RD7A 1FPN2 1VRH1 1A8DA 1S0CA 4N53A 4DXSA 2WR9A 2WFF1 4WM7A 1RUD3 1RUH1 2QQUA 3ETPA 1DZQA 2FQPA 4Q0PA 1CAWB 1JZ2A 3T1LA 1XYPA 2WDBA 4C1XA 5BNOB 2RM22 1S1AA 4IGPA 4OCTA 4GA9A 4YW7A 2PYTA 5BY5A 2PMWB 5FO9B 1AJKA 4XAAA 5FREA 3P6BA 4AAXA 1S0FA 4OUSA 1TMF3 4P9GA 3BI3A 4Y5TA 3MPBA 2GSYA 2ZZJA 2VZPA 3MGUA 5FYZA 1IG3A 4D7SA 3JB8A 1U5ZA 3CJIA 4OZXA 3ZOIA 1U12A 1LCLA 3I3DA 1AR63 1PHMA 1LHOA 4AI3A 3GBFA 2PQSA 5FY1A 3MV01 3CDZB 4IV1B 4YARA 3I2OA 1ZZBA 4H14A 3IIAA 4BYYA 2DWRA 1WCQA 1W2AX 4P9WA 3J7NA 1GQHA 2JX9A 2JKBA 5C3QA 3WF0A 4Y22A 1OVPA 5DDJ2 1UCXA 2EXHA 1UNBA 2I45A 4YVWB 2YU2A 4Z1VA 3WDTA 2HEWF 3B3QE 5IJRA 4COUA 4HETA 1JOJA 2PLV2 3C7EA 5C9AC 1ZBE3 1ZNPA 2JDPA 1G86A 3ZFFC 3VBRB 1RHI2 1NOVA 1S0BA 3LD8A 5FYMA 2DFBA 2ZEZA 4SBVA 1LEDA 5EJ1B 2XJVA 3W9AA 2OKXA 2OZ6A 1YCIA 2W94A 1QJX1 2ZX3A 1CIWA 5DQ0A 1H8VA 4QX3A 2DVDA 1ZX5A 1LHWA 2NPIA 5DUXA 3TBDA 1YYNA 4I09A 5FK8A 1O5UA 1FMD1 4JV4A 2XG3A 4XMAA 3VBFA 2DCZA 4XJAA 4XCBA 3U4XA 3V0AB 3NV1A 4FQ4A 1BCXA 5A7NA 1EPWA 1QXJA 2A6ZA 4CXYA 5T5LA 4RS5B 1RVF2 3AP6A 1F2NA 4QGLA 5EJZB 1ZBE1 5FZ4A 4WM8C 1MZ5A 2RR11 2W68A 5K9YA 4MGKE 2YGMA 4HVOA 3MBWA 4JHZA 2ORXA 2R32A 1W8FA 3LEMA 2PHWA 3PIJA 4C1WA 4EV0A 4HVQA 1C57A 4FSJA 3HIFA 5FUPA 3E6BA 1HV1A 1EUUA 1QY4A 2CGNA 3RPQA 5BNPC 2YG0A 2AH2A 1XU1A 4LEJA 3M2MA 1AYM1 3ACHA 3BPZA 3VUOA 4LA2A 2GN3A 4QQHA 1E5IA 1V6LA 3AP9A 3G6JB 3NKTA 1HRI3 3GZEA 4HG6B 3VBSA 1J58A 2QDRA 5CKNA 4XXAA 4EROA 2ZGOA 5AC92 2VUAA 3FMGA 3D6EA 3VDDC 4AI1A 4F83A 1QH6A 1W06A 4N9IA 1C3HA 1EAH2 1RJ7A 1Q8PA 1VBC1 2QZ3A 1C1FA 1S2KA 3PVNA 4CDQC 4JGZC 2VMEA 2OYZA 3JQXA 4PCRA 1WWYA 4QPWA 1IKPA 3H3UA 2JJ6A 3NSTA 1CGPA 4KQ7A 3WNXA 1ONAA 5GJ6A 3BTYA 4L97A 4K40A 1VBD1 4H7MA 4CDWC 4QQOA 4OQ8A 1JOPA 3JD72 5F6LB 3ZYJB 3QBQA 2X29A 2TUNA 4QT6A 4RSUA 2D6OX 3WF3A 2PHFA 3HJRA 5KWRA 1BVVA 3OUJA 1VBC2 2P3YA 1SLAA 2WZR1 3U4SA 3T0AA 2BDRA 4V1PA 4Q4X3 3T2QA 3WVJA 2FDFA 2Y8KA 1G9AA 2GH8A 4X8PA 4KNCA 4K1YA 3VZNA 4BE3A 1YHFA 3BODA 5IK8A 1PVC2 4QPGA 4W6XA 1OOPC 3DKWA 4XOGA 3IN9A 3WDWA 4B4PA 5HBAA 2XLFA 2ET7A 2VY0A 4AF9A 3ELNA 1WLTA 2CDPA 4I01A 4YW1A 3VL8A 5LA0A 4XHXA 1AYM2 3QH7A 4Y3OA 4EWEA 5LZ6A 2ZKNA 2NP0A 3VD7A 4LQRA 4XIKA 3J9SA 2DVFA 4XBNA 3ZSEA 4LJHA 2NN8A 5GALA 3WG3A 3W58A 2HYKA 3APBA 2NZ9A 3NWKA 4FPKA 4XUNA 1SMVA 3WG4A 3O0VA 2VL4A 4AXOA 2XHNA 1SLIA 3ZSJA 1Y7BA 5JMCA 4FQZA 1QJU3 2VW1A 3IKWA 4GB31 4PBPA 5FV3A 2VMDA 5JIAA 4M4RA 5FY0A 3POYA 4EN6B 1KXGA 1D2QA 1KGYA 1JODA 1YQ6A 3HBKA 3KQRA 4L92A 3WNPA 1PMJX 1DCSA 4Y22B 3I8TA 3PUAA 4HFSA 1H0BA 2ZHMA 1GZWB 4XJWA 1DU3D 3O1TA 3KV6A 2WQ4A 5CG8A 4YZ4A 2BPA2 4MADA 3JXSA 2WFPA 3ZXKA 4BM8A 3N9MA 2W47A 1PIV1 4Q1PA 4Z82A 1Q56A 3C7OA 3S7EA 4BISA 5A3WA 3WW4A 3BUCA 4BU2A 4QHOA 3NJYA 4HKOA 2B46X 4FAHA 4A7YA 4XQDA 5FXZA 5LK5A 4RR3C 1JHJA 4Q4Y2 3DPRB 4GMP3 2BV4A 3E97A 1IS6A 2IVIB 3WQ1A 4XUTA 2WS91 3AYDA 1AR82 2YBSA 4IERA 1UYZA 2MNGA 3DN7A 4XHBA 4MGYE 1CZVA 2WIIB 4Q0VA 2H0VA 3MEPA 3J8F2 3S7IA 2XQXA 5G04L 5FZ1A 1QQP2 4TSVA 4JGYC 4YG3A 1VIWB 4L0PA 5EYYA 3WF2A 5CFCA 1ASJ2 3ASIA 3RRDA 4AEDA 4COYA 5JCTA 2EXKA 3S5AA 3B9CA 2ZZQA 1SPPB 5LY2A 2EALA 3OPTA 4CDUC 1NKGA 3N3HA 1IS3A 1T6BX 1UD1A 1WLCA 1X9PA 2XL7A 2Y0OA 2QDNA 1PO22 4IE6A 4MXWB 5BUVA 3WW3A 3MUZ1 1PK6A 1GNHA 4UFLA 1RINA 5FLHA 4FAGA 1SBFA 2WKKA 2XJUA 1D0GA 1TEIA 4FPCA 5JXHA 2VUJA 4OFGA 5FZGA 2ARXA 3JD71 1KJRA 2BERA 1OLMA 1J3QA 1FV3A 2TEPA 2G4IA 4HN0A 4PLOA 1NAEA 1UMIA 3POFA 1PZ7A 1WD3A 4OHZA 2HWF3 4FCAA 1ULDA 4FVVA 4YGBA 5FJHA 3AKQA 5HCBA 3I2GA 3UYJA 4QWNA 1J3RA 3Q9OA 5F6KA 5A6YA 2B9VA 1C5HA 4XF4A 1JTZX 3VBOC 4WM8B 1URXA 1AHSA 3GALA 1WLDA 2ILMA 1CVNA 3M3EA 4FOWA 2IVJA 2W1UA 1AL23 1LR5A 3D4KA 4LULA 2QQKA 1HRV3 2JE7A 3ZIXA 3THPA 2VPVA 4Z07A 4JDNA 1X50A 4LTAA 5FTTC 2EA7A 1R082 1WD4A 3L9JT 3OY8B 4Q4V1 4DEVA 1OKOA 4S2GA 4R52A 1W8HA 4AHYA 3JUUA 5KXEA 1K12A 4AEKA 4XUPA 2O1QA 1NE6A 2RS12 2WAAA 1REEA 1US2A 3FL7A 1POV1 3RGBA 2VUCA 3ZFGA 1N3QA 2X8KA 3I2IA 5BPXA 4XC9A 3HMYA 1OD3A 3DECA 1W2TA 3EXUA 3OD0A 1NXMA 1OT5A 4LXLA 5D8AB 3SISA 4E9KA 5A7QA 4ZZ8A 4M3CA 4QXBA 4TWTA 1LKNA 4LO7A 1FMD2 4BWOA 2P3IA 4JAAA 1UYPA 5CB7A 3ZN6A 3VBUB 3VDAA 5FY9A 2WN3A 1KEXA 4YZ1A 1DQ2A 2VNGA 3U78A 2Y6LA 4IV1C 3NNMA 4CDWB 2NM1A 3RG0A 4Y1XA 2P3KA 1MS4A 1OUXA 4I0BA 1H4GA 2JDHA 3GZUC 2WZ8A 1POV0 4NVPA 2L9LA 4ES8A 4UI9L 3WHUA 4QGNA 1H6YA 1RUJ3 3NJXA 5FMDA 3T09A 2VR4A 1LTEA 3A0NA 4CU7A 3RYRA 1DGLA 2BOIA 4G9SB 4D8MA 1W90A 3RMXA 2BWAA 3WDXA 2Y26A 5GZFA 3WP3A 1ZBE2 3CKHA 1PVXA 2EF6A 3R4DB 3SITA 3BTAA 3BN6A 4GB32 4LE4A 1NUKA 3HBZA 1PZ8A 5E1RA 3CZJA 2NLRA 4KG8A 3RSJA 1UIJA 4AEDC 3ME2A 1NT0A 2WO3A 4M00A 5JUVA 5FYIA 3VKOA 4E4DX 5T50A 3B69A 5J7MA 1G9BA 5FZDA 4CUBA 1FAYA 2J1EA 4ISRA 2VQ0A 5D21A 3KVAA 4LBKA 1LOEA 1GICA 3OGSA 4MSVA 3NJVA 2VW0A 3NQHA 2C5DA 4QHZA 3MV11 4HVRA 4YW5A 3CF6E 3PJYA 4A2UA 3FUOA 4W65A 4FO9A 3ZYPA 4CPBD 3WP6A 2HWE3 1XNCA 3B02A 4OUEA 1GANA 4SLIA 2CSGA 1V9U2 4YM3A 1BBT1 3T08A 1B35A 1X82A 2DCKA 2ZPXA 4ZXKA 1LJ7A 3WZ1A 4BQ1A 4NRMA 1TNRA 1U5IA 1VRH2 3O0WA 2VCCA 3ZIWA 5M0TA 4YFZA 3LOIA 5IK4A 1RUG3 1DYPA 1JZ8A 3I59A 2XWBB 1DQ6A 4QM9A 5EFUA 2ZEXA 2WN2A 3N36A 1R1A2 1U5YA 2E51A 3I3EA 1NZIA 5JI7A 4D0QA 2XVKA 4CEWC 3GF6A 2XBO2 1RXFA 4DMIA 5JDBA 3C7FA 3BU0A 1ND3A 3HQRA 4OHWA 4O9EA 1EP0A 4D94A 5CKQA 5I0UA 1N3PA 5DZEA 5FPZA 3X29B 1XRUA 3T30A 3WG1A 1ZZCA 1AXKA 1AF9A 4Q4V2 2CWMA 1HXS2 2VOVA 2X09A 3LB9A 1EAH3 2RDSA 1PO21 5LY1A 1YC61 1ULGA 4PBOA 1LOFA 1KDKA 5I0RA 4M01A 1WW7A 2OQ6A 4JVAA 4NWVA 4LKDA 4AFBA 5JSPA 1XE8A 3L2YA 5GLUA 3DCQA 4BXFA 4I2OA 3AFKA 2VTFA 4Q4W3 5A3OA 1GNYA 4YYOA 1ULCA 4A45A 2CWSA 3RZMA 1ZBA1 3FLPA 1HRV2 2EICA 4YFWA 3RZJA 1MZFA 4IEUA 1C8M2 4AEJA 1OSGA 3ZXJA 1CX1A 3ALQA 1LHNA 3AYEA 4RN5A 1W2OA 4FPFA 1GSLA 2AZ5A 2B7YA 4IEOA 5ANNA 5F5AA 5FO8B 5I8YA 3LCPA 3T1MA 1CX4A 2WO7A 3KD4A 4MXWA 2ES3A 1BMV2 4O61A 4GWNA 3PVBB 1W0NA 1NQJA 4V2VA 1W6PA 5DABA 4ISQA 3VBRA 1J84A 1CQ9A 5D1IA 5LBFA 5BNOC 4YZ3A 5F9TA 3DYOA 4AVSA 3Q8FA 3F2ZA 2IXIA 1QWRA 5FY5A 3H7JA 5CA6A 1E5RA 1OVSA 4D3WA 1AYM3 1XJAA 4JHTA 3PTRB 4GXLA 2ETEA 2CHHA 5FAXA 3S30A 1XOYA 4ZU4A 3GCWA 2YBPA 4A6SA 1Z78A 3CEWA 3SH3A 2AACA 3ZSLA 3S6PA 1PGL1 4K20A 3I2DA 2UWCA 3GJAA 5L9RA 3VKLA 4ARYA 4LK7A 4EN8B 5C8CC 4DRVA 1UY2A 2BOJA 2DURA 2VUDA 4QDSA 4BDVB 3HNYM 4UFIA 4XFBA 1AR62 3IDBB 3BTZA 2Z42A 3LPGA 4A3ZA 2W1SA 1S0JA 4Y5SA 5CU1A 4BXSV 1Y43B 4XJZA 3I97A 4COZA 5JAXA 1Q8OA 1UU4A 4XQWA 1DLLA 2C1FA 2VQTA 1JH5A 2VNOA 4GD4A 5LWBA 3UESA 1CWPA 4EN9B 3I59B 4BOWA 2YV8A 1O7FA 5EWSA 2VZUA 2WNVB 3OGJA 3P1IA 1PK6C 4IDZA 4XF9A 4A6OA 2X05A 4OZOA 4YLZA 5E6HA 3M70A 5BNOA 1NA1A 5SV5A 1RUF1 3EB7A 1BBT2 1X8EA 3RZGA 5F3EA 1H2NA 5JXIA 4QB1A 5IYYA 1PGW2 1X8MA 2VXJA 3E1F1 1GP4A 5F39A 4LO8A 3VZOA 1KDMA 4BPZA 3RVHA 2QQOA 5FOBB 4NHKA 3UJQA 1QOTA 4L8QA 5FPBA 2WNVA 4M0NA 4B29A 3HOBA 1VPHA 4XJUA 5FPUA 1QJX3 4IEXA 5FZIA 2GNDA 4FFGA 3WNLA 5IVBA 5H9RA 5JR2A 2W08A 1JMUB 2ARAA 2RM21 2YPDA 4KU8A 1M4WA 1PO11 1YFWA 5DAXA 3TEXA 3O14A 4E8DA 1VAMA 3V0BA 4LK6A 1RVF3 5CVRA 3ZXGA 2P34A 3D8CA 3ZYRA 4AFAA 2F4PA 3RJ2X 3VD3A 4PQ9A 4QPGB 1SLBA 1N1SA 4E2QA 2G1MA 1BZWA 2BUKA 2EVXA 1HB4A 2ZAHA 2XJRA 2R30A 3LE0A 4K1ZA 2O8OA 3B01A 4PF5A 1S2EA 1R1A3 1SDDB 4DZGA 4EZHA 4JTOA 5A7WB 5A1FA 2ZXQA 3AZVA 4DY5A 4URAA 3TEWA 1OA4A 3AYCA 2CY6A 5FZ3A 3ZSKA 1W8WA 2VBPA 1YI7A 4DRRA 5KR7A 4I3PA 2WSVA 5FZOA 5L9VA 2BGCA 4FFIA 4LNVA 1W9FA 1ZZ9A 3AX4A 5A7SA 2EIEA 4N43B 4I30A 3K3NA 4LKFA 2G9ZA 3KGZA 3OBRA 1QGLA 1S0DA 4MLOA 4QPYA 1W6OB 4LIVA 3LSEA 2GC0A 2Y0IA 4NHXA 5HCHA 5APAA 3DKQA 3FHIB 4C8DA 5L9BA 5IFPA 1M06G 2CDOA 4OI0A 3BB6A 1JYIA 3UGFA 1DBNA 1AR93 3FHQA 3H1YA 3OGRA 4PDWC 3U07A 2YHJA 3H8OA 1GR3A 1OXCA 2IXHA 4KBBA 1HIXA 4JX0A 3RS6A 3OF1A 3V65A 1CJDA 3H8XA 4CCCA 2YFZA 3MUY1 4AL9A 1SFPA 1LOGA 1SEFA 4MHUA 1GOGA 2WWSA 1BEV3 4Y1ZA 5F8PA 3WSOA 5KBFA 3W20A 1QF3A 2BJSA 1UL9A 1CESA 1UQXA 4QX1A 3T2TA 2VCMA 5J98B 5A6QA 5JPMB 3H8RA 2WYSA 1OQEA 1XNTA 2C9AA 2UY8A 5DG1A 4C0BA 1NY71 4YW6A 1OURA 1SG3A 1RHI3 1XNKA 1YFYA 1IZ3A 1ULPA 1AR91 1RUD2 2JXAA 2H6CA 3BPSA 3NNFA 2RS53 4XABA 2BRTA 5CIRA 3S57A 2DU0A 5JXJA 2QE3A 1DLCA 1T2XA 3N9QA 4KG0A 3FX3A 5A7OA 4Y1YA 3VLBB 4LOTA 1FMD3 3IMNA 3HN3A 4QXCA 1O91A 4NIHA 3VBFB 2HWD2 3WNOA 4LHSA 3LEKA 2QZ2A 3D0SA 3VHOA 3PLQA 2O8QA 3VN4A 4CDXA 1SCSA 1ASJ3 1LESA 2JDYA 1DZTA 1WW6A 5KC6A 1D4M1 3OEAA 3VKMA 1VBE3 1IPSA 4OULA 2D6PA 3KV4A 1V6KA 2VOKA 2QQMA 4UBGA 4CDWA 1W3XA 1O3QA 4QKNA 2PAKA 3OSDA 2DU1A 3C7HA 4R9CA 4D6RA 1AUYA 2KA3A 5CBLA 2BBVA 3MLLA 4A4AA 1AX2A 4LO5B 2DUPA 3MI8A 2KXLA 4FOYA 4GWJA 2J1RA 2Z5WA 4IE0A 5EV7A 1GQGA 1DHKB 2R1DA 1JHNA 1C8M1 2ZX4A 1GUIA 5DZFA 3T4VA 3WQ7A 1BBT3 4V2WA 4P9LA 2KM2A 4CEWA 1NCQC 1HJFA 1WMEA 4EE2A 5L7OB 2OS2A 2AYHA 3ACLA 3WV6A 1HRI2 1DGWA 2GP5A 3THCA 2ZGTA 4BK4A 2JDAA 4KBZA 1VBE1 5FPVA 5FIXA 4XJ9A 2SLIA 4FTSA 2Y38A 5E8AA 1R091 1CIYA 4K8RB 1JYWA 1UPIA 4NIIA 4QKBA 2UWBA 5K0UC 2GH2A 1CPNA 4L9BA 2PA7A 2J1AA 2VBBA 1BKZA 3DPRA 3PU8A 4Q4Y1 2GNTA 3RZZA 4CDXC 4QDQA 1K45A 2RS51 1S0IA 3TWIA 2OT7A 2QKDA 2FDGA 5LBBA 4BHPA 3AXEA 4XXPA 2EAAA 2VZOA 3MIEA 2GC2A 1W9SA 2P37A 5C9AB 4GH4B 3ECQA 1RUE2 1VR3A 1ZZ8A 2BWCA 1CZSA 3HWJA 1R083 2ZBJA 4FT8A 2NMOA 4QQ2A 5LA1A 1GOFA 1R1ZA 1C28A 4AVTA 3QCWA 3BYWA 2VMHA 5DUVA 4CCLA 2Q8DA 3LKJA 4PLMA 4Q27A 4WVMB 4PJYA 4FOVA 3QACA 5FKCA 1FPN3 5JZGB 4R4XA 5EIYB 1PVC3 1VE0A 3LDBA 5IVCA 4YG0A 2BQPA 1QIQA 3URFA 2H0BA 4FXKB 1CPMA 1UKRA 2XJSA 5JPNB 4ZS3A 4AE2A 2XUMA 2UURA 2XKOA 1O59A 2HWF1 4MGZE 1AZDA 3QH6A 2OPKA 4N7UA 1TMF2 3H3ZA 4LBJA 1VBB2 1MS8A 3H0OA 4GULA 1H2MA 4Q8KA 2A1XA 3C8XA 3AP7A 3B93A 4FTBA 1WBLA 1GKBA 4OVEA 2WZPP 2Q1FA 2Y64A 4LBLA 2VCAA 3I54A 1GU3A 3VBSC 2LALA 4P9YA 5C5UA 1TME2 3I3MA 3VD9A 2D5HA 3KSCA 2Y33A 4CCNA 5FMCA 5FYCA 1H2KA 5F32A 4KWJA 1PGL2 3WP4A 2RMU1 3PIGA 1W8TA 1XNDA 4CDQA 1H8TB 4B8EA 4K9SA 4NIGA 5FY8A 3AMMA 3VL9A 3IDCB 4Y33A 4FOQA 2FMYA 3LGRA 3ZDVA 3A22A 2IC1A 5ACA3 4LLOA 4DOUA 4HPKA 4IESA 3AJYA 5F5QA 1PIV3 1VRBA 1YWKA 3UKVA 2WNUA 4FPLA 4WBBA 4YG6A 3T0DA 3NJZA 5EHDA 2VZ3A 2VCBA 2JIGA 1FOD1 2WLQA 5CNAA 1UZ0A 1YIFA 4META 5C4WA 1SACA 4Z92B 3ORJA 2Y34A 4DIQA 3EBRA 2ZMNA 2VE1A 3CMGA 5ANQA 4P9XA 1PNFA 1RL3A 4XFHA 1SFYA 5I8TA 3HD8B 4DINB 4P00B 4AGRA 4E4ZA 3MICA 1LECA 4UFJA 3OBZA 4E4HA 3WNNA 3ZO0B 4A44A 5J37A 3VBOA 3M3OA 2VMFA 2RS11 4INDA 4LORA 3F95A 2VECA 1ZA4A 4PT6A 2ERFA 2ZGRA 3AJZA 4LBQB 4XFCA 3OYWA 2YMZA 2VU9A 3IDAA 3JZVA 3SH4A 5FP4A 3SNMA 3RQ0A 2W91A 2X5IB 3IM0A 3J26N 5FBJA 1BHGA 1AYN3 3AMPA 2FDIA 3I49A 5BNNA 4J6GA 4HZFA 3USSA 1RUC1 4K7JA 2QQWA 1X36A 1YNAA 3FZ3A 3I2KA 4U2AA 3V56A 4TLGA 3N7KA 3FLRA 4CTEA 1Q8SA 2HJIA 1QMJA 2XBO1 1QQP1 2FCTA 1W6NA 1NE4A 1AVBA 2P6HA 5J96B 3K4DA 3KCXA 2A75A 2E6VA 2JE9A 2MHFA 2QJVA 5EYXA 4AAPA 3ZYBA 1I5ZA 3LOBA 5D2AA 1GQPA 3POSA 5FP9A 3ZSMA 1DGRN 1GZWA 3UKTA 2HEYF 4FPGA 1PGSA 3O0XA 5ABJC 3VDDA 4CE8A 3OJBA 2BP6A 2ZGPA 3LZZA 4NR1A 3KCYA 1DQ5A 1LEMA 4P9IA 4IEWA 4XUOA 1HW5A 1A3KA 3UV9A 1AR83 2DV9A 3IB3A 4NWWA 5A70A 2QVSB 3RI9A 4LR4A 4BMEA 4BA6A 1S0EA 2ZOEB 2WINB 2BFUS 4HKWA 4IEPA 1QJEA 1QQP3 4Z8BA 1DGWX 1O8PA 1I3HA 1W03A 4IE7A 2F4LA 5A80A 4CDXB 3WF1A 5LA9A 2FDHA 5DZGA 4WVMA 4YW3A 2BU9A 4ZPIA 4IEYA 2EIBA 3WHTA 3ES4A 2ZCWA 4NJ4A 1SPPA 1UU5A 4XVHA 3WDVA 4AEDB 1SBDA 1K5MB 4BQYA 2KD7A 1POV3 1D0HA 4XACA 2JG9A 2Y6FA 1Q5OA 1VAKA 5FZFA 1GP6A 1GWMA 2RDNA 4KGQA 1PO12 3JB4C 2ZGNA 3NW4A 5FZMA 1CJPA 1UMZA 5LB6A 2WS93 1JI6A 2AC1A 4LKEA 4P9JA 4YM2A 5LCWL 1MVQA 4MGIE 2Y6KA 4FP2A 4TN7A 3CU7A 5EZWA 1HXS3 4RA0A 4N8MA 5FYTA 4YWAA 2BYVE 2N7GA 3N7JA 3R4SA 3C2UA 3HAGA 4LUKA 3UT0A 2V09A 2JG8B 1STMA 3FBYA 2VM9A 4Q1RA 4ZZ5A 4FXGB 1RUI2 1LB2A 1W8ZA 1Z0HA 1OLME 4RFT0 5F2SA 2D97A 4IEZA 2D3PA 3SCFA 3ZXAC 4XDOA 4B4RA 2PAMA 1COV3 2C6SA 4A42A 1QJU2 1Q43A 3ZM8A 3KT7A 4WM7B 4BIOA 1UX7A 2Q30A 1V6OA 4OUMA 1WCSA 2OIIA 4N53B 4QX7A 4BQ2A 4NPRA 3AMHA 2JD4A 5DDJ1 1TQ5A 3NMBA 2XXZA 4ARXA 5HCFA 2WZR2 2FD8A 1J83A 1HXS1 3AKPA 3LFIA 3CNAA 2IWGB 4XDPA 5C4WB 2YZ4A 1NCQA 2MPFA 4MGSA 4P02B 1CAVA 1CN1A 5C6CA 3IZOA 3OUHA 5GKAC 4GZ9A 4JGYB 4CU6A 1UZVA 2RS52 4AGGA 3ACGA 4UFKA 4A7ZA 5FZOB 1UXXX 5GZCA 2EAKA 2B9UA 4CCMA 1N47A 2YY1A 5IVJA 4BB3A 2HLEA 2XL9A 4RR3A 2YGLA 1OLRA 3I2HA 2D98A 1LOFC 2LUWA 2ZX0A 3DPRC 4UOJA 3DL3A 2HWC3 3ZXDA 1PMHX 4CEYB 2ATFA 1RMU1 4NN0A 1LU1A 4COWA 1MS0A 4LT5A 2QNKA 3AVSA 3ZPOA 2VZ1A 3KGLA 3H1MA 2OQ7A 2ZGUA 4QKFA 1NY72 1OA3A 1F35A 2ZHNA 1RUI1 2EXIA 3WD5A 2WFF3 4ZS2A 1TZOA 2D6LX 1S4CA 1ZRRA 4ASLA 2YROA 3TN93 2B5HA 3AMQA 4DQAA 3O1SA 2PTMA 4N90A 3PUSA 5FPLA 2D6MA 3T3YA 4WVWA 4M0HA 3I2JA 4GWIA 5K0UB 3SCHA 4XFGA 3VBHA 1COV1 3CJIC 4YW4A 2PFWA 2FCVA 4LHLA 5FCCA 4NOTA 3BIWE 1F5FA 4P14A 1GP5A 3VBOB 5H9QA 3AZWA 1NCQB 1IG0A 4AOCA 3EMRA 1E5SA 2Q4SA 2QQIA 2RJ2A 4AVVA 4XFAA 4BQWA 2G9FA 3VZKA 1H30A 4OI4A 1OBNA 2C0ZA 1EAH1 1UO9A 1PZ9A 5FDBA 2UY9A 2W52A 2XMLA 2E7QA 3BCWA 4EQVA 5IAXA 2D3RA 4K3UA 2D5FA 2D6KA 1QJX2 2QBXA 2A70A 4I3GA 1AR73 3POIA 1AR92 1RUD1 5DPNA 2V5DA 3LIHA 3WEZA 4HBNA 4HONA 5CEHA 1JS9A 4M3CF 1J1TA 4X8NA 5K4LA 4HPKB 1YFUA 4TLFA 5G05L 4KWLA 1X7NA 3CL1A 2NYYA 1RUE3 3JU9A 5C70A 1MS1A 1ST8A 5CFDC 4AQSA 1W8UA 2P5BA 1VBA3 1TMF1 4XTMA 1H1IA 4CU9A 3O7OA 1QNYA 4ZU5A 2WQZC 5GZEA 1DGRA 4CDUB 5JSOA 5FZKA 4A3XA 1WA4A 3NNLA 2YC2A 3K77A 2Q0AA 1UOFA 4G3YC 3U14A 2DCYA 1H2LA 4R8HA 4AZZA 3POEA 4OYUA 3UJOA 4B1LA 1OKQA 4UW4A 2WO2A 5GZGA 2I2SA 1NYWA 1NCRA 2BVBA 3MW2A 1L7RA 1GOHA 3LIGA 5L73A 3RWNA 3K48A 3AMNA 5HV4A 2GMEA 1Y4WA 1KD7A 2PHLA 4PIZA 5A3NA 4O7XA 3O1PA 5E89A 3JCIA 3ZYGA 2B8MA 2NMNA 2K0GA 3OPZA 2LM3A 1WKYA 3L2HA 1ZREA 2Q1ZB 3H42B 4N43C 2BFUL 3QLQA 1I9RA 1HLCA 2Y6JA 4XW3A 5IW0A 4KGGA 1ND3C 2D3SA 4Y26A 1TME3 1WLWA 3A7QA 2QQPA 4GJYA 5FXXA 2XB6C 4DUVA 4Q26A 2BGPA 4BQ4A 1IS5A 2HWD1 2PELA 2RV9A 3B5LB 5FUNA 4UXAA 3ZMOA 5J09A 3EJKA 4Q8LA 4B4QA 4EWAA 3CLPA 3OUIA 4JGZA 4UW5A 3T0BA 1FT9A 2R16A 4UF0B 1HJGA 2J1VA 4DFSA 5ACA2 5FR3A 1GZ9A 1W3VA 3J7LA 4QB2A 1PIV2 3T2OA 3OG2A 2JICA 1AR61 1OUSA 3WR0A 1XXNA 2DCJA 1HKDA 1BJQA 4XAEA 4LBNA 2V5YA 1W9WA 2WWUA 2I74A 5A3LA 1ZRDA 1RUC3 2VO5A 4DEQA 2HBTA 2VOXA 2X5IA 3WQ0A 2VOTA 1APNA 1Y9QA 5F2WA 4CP9A 5A32B 2A6YA 3U75A 3Q8BA 4RGKA 3KWVA 2CTVA 3K3OA 2ZAAA 3E5UA 5I0TA 3AP5A 2R072 1OH3A 3DF0A 2PHDA 3N9PA 3DYMA 1B35B 2P3JA 2WFF2 3J8F3 2ZHLA 4LA3A 4UYBA 4QX8A 4R9DA 5TSWA 5I93A 5JSRA 1V9U3 3BALA 5I0DA 4N9HA 4DXTA 5DMYA 1W6PB 4UW3A 3IDEA 2J1TA 4JQRA 1ULEA 1X9TA 4Q29A 5FXWA 5A6XA 4CXXA 4NMIA 4HLTA 4CCKA 2AENA 2JDKA 4AEMA 2BNNA 5FZBA 2DVGA 1A34A 1UIKA 2C4XA 3EO6A 4L11A 4QPIB 1MEC2 3H7YA 2XVLA 3GJBA 5JMOA 3AZYA 4NPLA 2TNFA 3G7DA 5FZCA 4QXHA 2RJLA 5HXMA 1ZA7A 4H2AA 5ACA1 4AW7A 4CDQB 2BNOA 3QOPA 1YFXA 4FPJA 1Y9GA 1O8SA 1R093 1DF0A 3KF3A 3WG2A 3GCXA 2IXJA 2VW2A 4FPOB 2OXBA 4GMP0 2PHXA 1GMMA 1NA1C 1UYXA 1AL21 5FLIA 2VXRA 3JQWA 3IT8A 3AL6A 1KFXL 2GU9A 1IHMA 3OBTA 3UL2A 3HT1A 4CU8A 3V0BB 2W1WA 4OHXA 3J4UH 3PMEA 2AREA 3CQOA 4COVA 3KCCA 4UFHA 1J1LA 3PHMA 1P8JA 4AFCA 3K4ZA 5DUWA 3VKFC 2XR4A 1HN0A 4BZ4A 2VZQA 3R6SA 4CCDA 1ENSA 1MZEA 3O5SA 3SQOA 1BMV1 2WZEA 1R081 2W92A 4J1WA 3KT1A 1UY1A 3PUHA 3ROUA 4BLJA 4CVUA 5GLZA 1YQ5A 2HYXA 3EYPA 3M4FA 2AUYA 2XWJB 1ODNA 4OQ9A 4KU7A 1EY2A 1RHI1 4GMP1 5IAVA 2K9ZA 2ZGSA 2CGOA 1QJU1 4XCAA 5T52A 2XQRA 3RFRA 1TME1 1OA2A 3RZKA 3HPNA 2UU8A 4GALA 1PVC1 2VGDA 2XONA 4UBHA 4ITCA 4WVVA 1GV9A 2DCTA 3ZFGB 4XUQA 5JZGA 2C26A 4YVSB 3PVOA 4MZUA 3RNSA 5KC5A 1O6UA 1MEC1 4TZDA 3GBGA 2WNOA 3W21A 2BGOA 4JKLA 2RS33 4LKSA 3WT3A 1D2SA 1OMIA 1JYCA 3PJQA 5E88A 5A32A 5K0UA 3GZAA 3HQXA 1LOBA 1PNGA 4UW6A 3KQ4B 1VBB3 4HT1T 1H1MA 5K7PA 4KL1A 3ZKUA 1DYOA 2RR12 3FHAA 3Q8EA 4JZRA 4RHV3 1BK0A 2Z79A 1PX3A 4FFFA 3ACFA 1EUTA 1RXGA 5LBCA 3N7LA 2ZMLA 5T55A 4YZ5A 1QJY3 4S2FA 1R1A1 5KHIA 4RQPB 4F3JA 2ZGQA 3NNGA 2I07B 3NAPA 4UF0A 2VH9A 3HN1A 1VLNA 3GHNA 2C9KA 4ONUA 4MGTA 1VB2A 2A7AA 4YM0A 4EWDA 5FPXA 1KITA 2R043 1JYNA 2YYOA 1WMXA 2R0FA 5HPOA 1Q8VA 1EYBA 1BEV2 1IPJA 1UY0A 3BVCA 3GGLA 3FJSA 1S55A 3ILNA 1UOJA 5FOJB 4IL7A 2XDVA 2FZ2A 3AM2A 4PDWA 5CAZA 4CEWB 1C4RA 4AHWA 2CAUA 4GB33 4FTEA 4WV8A 2VTXA 2IXLA 5GZDA 1V0AA 2VD7A 1DDLA 4P5YA 1BLZA 4CCEA 4PIXA 3VBUA 1GWLA 4GIQA 3FWEA 5DAVA 5LEJA 5H9PA 4Z2AA 3S0MA 5BV6A 4DUWA 4A7KA 2WQ8A 3PUQA 1W6MB 1W2UA 3SKJE 2DF7A 5IVFA 2Y60A 2GAUA 5AFBA 1MQTA 1NLRA 2Z2SB 4AFMA 2QFEA 3I2FA 3NL1A 2ZX2A 1D4VB 1SLCA 3E5QA 3NV3A 3OCPA 3GZTB 1C5IA 1L7QA 3VGIA 1GZCA 2R071 3QD6A 1BXHA 1W28A 3ZKYA 3AC0A 5FK7A 1BEV1 3LEIA 4CRQA 3HNMA 5AVPA 2F6BA 3W5MA 1SBEA 2JG8A 2VQAA 3N4MA 2RDRA 1H6XA 5IT6A 1W9TA 2GP3A 4HMZA 3M3QA 3SXWA 2IUWA 1CAXA 1K5JA 4YPJA 5LRSA 5CKMA 4JRLA 1RUE1 1UYYA 4MVTA 2X10A 4R9AA 4IGQA 5F5CA 4H7LA 2O14A 2WT2A 4DXZA 4TYSA 1VBD3 4NHLA 2CL2A 1ZYBA 2W87A 4LBMA 5FXVA 3FFQA 1SQ4A 2E7TA 2XBO3 5FZLA 5CISA 5IATA 2W46A 1Y3TA 4LHNA 1UOBA 2HWB2 3A23A 1EV12 3N35A 4FI9A 3VBUC 1QJFA 2QUOA 4DPNA 5F7UA 1G9DA 4GKYA 4XIOA 2CV6A 4RGAA 2GALA 5JOXA 1DQ4A 3MIFA 4S2DA 1UMHA 1TG7A 3FN9A 1CAUB 1W39A 1XPWA 4XFIA 1D7PM 2Q8CA 4RQPC 1J59A 4AVAA 2D43A 1CAWA 5CADA 3O1MA 2RHPA 4XE9A 3RI8A 2V72A 2BEOA 4LUMA 4PIYA 3ZDSA 2Y6HA 1IOAA 1FV2A 1HB2A 2YU1A 3POBA 4IV3A 1MQTB 1US3A 2W39A 3KV5A 4HN1A 5JZGC 3TEYA 2NQYA 5FMOS 1RMU3 2GDFA 1VBA2 5LA2A 2Z4FA 5C3OA 3I3BA 3M1HA 3KF5A 2WBKA 3DUIA 4N7IA 1OH4A 4XETA 4CP1A 4XTPA 3ZYIB 4CUAA 4D6SA 3HT2A 2BVVA 2YBKA 4XPVA 1LAJA 2ZGMA 3WQBA 4AK3A 1QHDA 2DUOA 2WA3A 1QDCA 2MEV2 1NCRB 4ORFA 2HBUA 4CA9A 2B4KA 1MPXA 4P5HA 1B35C 3WDYA 1ZBA3 1UY3A 2B45X 5DAPA 4YSFA 3S5QA 3Q8CA 4Z2WA 1HB1A 2WT1A 4NROA 5F5IA 1XB9A 2VMIA 2ZEWA 2J42A 4WZCA 4CDUA 1O5LA 5F37A 1QOSA 3OEBA 3MFCA 4XMIA 2JIJA 2EIDA 1LHUA 2WA4A 2HKXA 2HWB1 4PI2A 2WSUA 3AFGA 4RHV2 4DUXA 2H6BA 1O3SA 3D5OA 2GC3A 4NIAA 3ZFEA 1KS5A 2G9GA 4BQ3A 2QQNA 1ZRFA 3PUIA 4CCJA 4C91A 2Z69A 3R05A 1NLQA 2JWPA 4QD2A 4F8AA 2W2IA 3H1WA 4QPIA 1NQDA 3LEGA 4XZUG 3UKNA 4CP2A 5L7OC 5KXCA 2AEYA 1DZRA 1MR5A 2UYAA 2G19A 3JBG2 3K75B 4RYDA 5F3IA 4RHV1 1GWKA 3MFAA 4W6YA 3ZN6B 2R042 2Q5TA 4K21A 1UPSA 5DDJ3 1LGNA 4J25A 5HV0A 3MDPA 4LE3A 2R062 1I1EA 4B3NA 2A5ZA 1UZYA 2FDKA 2QQLA 3LPFA 4QXKA 2PLV3 4KWUA 3ZX7A 1VP6A 2ADEA 2DTWA 1F4AA 1V6IA 2RG4A 3B9IA 1OOPB 3KMHA 3RMYA 4QMAA 1G7YA 4PI0A 1BK1A 4DS0A 3ZR6A 2O0OA 1JOBA 2XLAA 2WO1A 1RUC2 4IE5A 4MG2A 2A73B 5FBZA 1KRIA 5LEKA 4Y4YA 4CP9B 1KQRA 1IS4A 1QU0A 4IETA 3VBFC 1AR72 1I6XA 1VMJA 3WNMA 1Z7S3 4BQXA 1HV0A 1V6JA 2YB7A 5JOWA 2YC0A 3JBG1 2J7MA 1QDOA 2XVGA 1C8NA 1GLHA 2FMDA 3CO2A 2JDZA 3IWZA 5AVAA 5FZEA 3SC7X 3VZJA 4BMBA 1JU3A 4AHZA 5KHHA 4Y20B 3GYDA 2DVAA 5IFTA 3U0ZA 1PM7A 1WA6X 5FYVA 2XGXA 3WX5A 3AKSA 4OMDA 2X53S 4QQLA 3TAYA 4AQ2A 2F17A 1PO23 4JRAA 4E2SA 3OBAA 2FCUA 2ZHKA 4NHYA 1HDKA 4OI1A 2EIGA 1WGPA 4AI2A 2W0XA 5GM0A 5JOYA 2QQVA 3PTYA 2WNEA 3POGA 3RZHA 1FOD3 1MZ6A 2RM23 1RTVA 1LGBA 3PDQA 4JC1A 3TNQA 1PO13 1DYKA 2DBIA 3DEMA 3AXDA 3WUDA 1H1AA 3AKRA 5FY7A 4B7EA 5ISLA 4FP3A 1W9YA 3PURA 3C3VA 4FFHA 2WLPA 3KV9A 2YPJA 1OF3A 1OFSA 5FP3A 1R092 3M8LA 2UYBA 1MS5A 4XJ8A 4Y24A 1OHFA 1MVEA 1NX9A 3IIIA 5IK5A 3CBNA 1TE1B 4MV2A 4W4ZA 3ZYFA 3ZXEA 3ZXFA 1UX6A 1ULOA 1YQ2A 2ZJCA 4K6BA 2PHUA 4BIFA 3NVCA 4CP0A 4GH4A 1KS4A 1RC6A 2VZSA 4LHKA 1O3TA 5A3UA 3LDKA 2PQQA 2ZACA 4QX5A 1LOAA 1FPN1 2PXJA 2ZS6B 3NRUA 5A3PA 5IVYA 5EP9A 4AG4A 5EXOA 3AKTA 4DXRA 3NKGA 5FP7A 4J1XA 3NV4A 1OPOA 5B4XA 2A6VA 1NLSA 1IPKA 4GAZA 4MUVA 4LLFA 1PX4A 2LW8A 3OYWB 4EJRA 4QPGC 3ZFEC 4H3WA 1W8OA 1W8NA 3GM8A 4BJ0A 1JZ5A 3J7HA 3ZFFB 2ARCA 2JG9B 5IWFA 2KR2A 1N3OA 2DDUA 3AZZA 5JIUA 2JECA 2XOMA 1YRZA 3O12A 1LENA 2OPWA 1BQPA 1RGSA 4L2NA 3ILRA 5EJ3A 4XQ4A 5FYHA 3INAA 2R0HA 1XNAA 3A4UA 4FPEA 2DBNA 4JGZB 4MXVA 4Q0QA 4BCUA 1YEWA 5C4WC 1ZRCA 3WDUA 4KH9A 3LSDA 2RMU2 3AYAA 2YUEA 3WINE 3MLJA 3GNEA 4XYXA 2DYCA 5BNPA 5DAQA 3IAPA 3A21A 2A71A 2JD9A 3ACIA 5CFDB 2VOWA 5LW9A 4I0WB 1BVP1 2ZABA 2VVFA 4ZY9A 3FC0A 2XJTA 1L3JA 3VZMA 1RUI3 5B4NA 5I0SA 5FQ0B 3KS7A 3OOXA 4HSLA 1C1LA 1W6QA 3BU7A 2R6QA 5CFDA 3TN92 1COV2 5A7PA 3DYPA 1JUIA 5BNPB 2E33A 3WUCA 4NHMA 1JXNA 2VZVA 1SHWB 3FFZA 2IZWA 1WMFA 2AR6A 5KHKA 1AYN2 5T5JA 3VD5A 3MO4A 4JKKA 3THDA 4N53C 2D7FA 3DXUA 1VB4A 4U36A 2VQUA 1RVF1 1VAVA 4YGCA 3ZYHA 2ZTNA 1F8VA 2IFRA 4LIUA 1D4M3 3CJXA 1VMFA 3VHRA 4O65A 3ATGA 4NIDA 4F7ZA 2GNMA 1E5HA 1SCRA 3I7DA 3CJIB 4Q4Y3 2OVUA 3MIDA 3I4IA 1IQAA 3MW4A 3WOGA 3TYJA 1AR71 4MH0E 3UGGA 2CNAA 2VC9A 1XE0A 1U0AA 1YUDA 1EPZA 1ZVFA 3PNAA 3VBRC 2PHTA 4LITA 3W59A 1I5PA 1JUHA 1W05A 3ST7A 4DO0A 1OOPA 3FLTA 1A78A 1XYNA 4ES9A 4X6RB 4DNYA 4R9BA 2BTVC 1W2NA 3RYKA 4OLLA 1WCKA 3J8F1 1F5JA 1RITA 1R64A 1FXZA 3DGTA 3AK0A 1JZ4A 1PMIA 1AX0A 2E53A 1CONA 1V70A 2UWAA 4HXCA 4M3CB 4C0HA 5DAWA 1SFNA 1N1YA 4HL0A 1FOD2 5FYYA 2A3XA 3GBWA 5C7GA 2WWJA 3M7AA 2WNUB 5C9AA 3O1VA 1MQTC 1AJOA 2R7EB 1G9FA 3NNJA 4ASKA 4CPBA 4TTGA 3ZFFA 4GJZA 2WABA 4ZU7A 4FPHA 4Q4V3 4MOAA 2W1QA 3OY8A 1B09A 2GMMA 2X5IC 3VDBA 1CZTA 4I0AA 4P08A 5GLWA 5A7WA 5ABJB 3RDIA 5FUIA 3U37A 3VBHC 4Q4W2 3BTXA 1JN2P 2D6NA 3R0RA 1JU4A 1ND2C 1XE7A 1FNZA 4BQ5A 3WP5A 1QJY2 4QAWA 2JENA 4Y20A 2JB4A 1C8M3 3BIEA 5CZKA 1AL22 2VBDA 5T3NA 5L7OA 1XSRA 1UZZA 2MEV1 4CXWA 4KWKA 3KLSA 1S2BA 2OZJA 1UY4A 5JR7B 4DB5A 1FI2A 1SLTA 2P6CA 3LA7A 4EN7B 1UOGA 4M3CE 2WZR3 3LF7A 5FPAA 5JI9A 3MHZA 5ERLA 3MPPG 3M3CA 1OD5A 1QXRA 5FQ0A 5A33A 2E9QA 4RFRB 4W6WA 1ZBA2 2A6WA 3POJA 4IV3B 4FBFA 2DUQA 1UZWA 5CFCC 3IBMA 3SKVA 3D82A 4NUBA 1UAIA 3HNBM 1WCDJ 1NA1B 3K46A 5DXDA 4XILA 3AP4A 4NE9A 1K3IA 1RJ8A 1FATA 2VULA 2CAVA 2ENRA 5KXDA 2RS31 2JDNA 3V64A 4LOSA 1N1TA 4TXWA 1O3RA 5FP8A 2XKPA 4LO6B 4URTA 1OF4A 2RE9A 3VB9A 4AVBA 1RUNA 4XF0A 1F31A 5CFCB 3VBSB 3ZPYA 1OQDA 1DIWA 1XSQA 3IPVB 5FZ9A 3LDRA 1QXPA 4QHBA 1ENQA 1DQ1A 1WBFA 1YJLA 2RR13 5BYNA 2VVEA 4I02A 3EQEA 4AI9A 1ND2B 5LK7B 4ZXEA 3C7GA 1KJLA 4YRDA 5LRRA 2BBAA 4B1MA 4YGEA 5A6ZA 3MIGA 2P4EA 3HVDA 4CCOA 1ENRA 1RUJ2 2GZWA 1LRHA 1CAXB 2XUEA 4IUGA 2WAOA 4ET7A 2YFUA 3WW2A 4FPYA 2CYFA 1G6NA 3KZ4C 1V6MA 3I3QA 4LBQA 2JB8A 3KT4A 3RWKX 3UNPA 2WRAA 2BNMA 4CYDA 1HX6A 1HRI1 4L99A 4Q0SA 4QDRA 4HSJA 4RS5A 1ASJ1 1O4TA 2DTYA 4H55A 1NXD1 2HEVF 2HWC1 3CHXA 4D7YA 3MZHA 1SZBA 2YDEA 1IQDC 4QPIC 3V0AA 3U1XA 1BYHA 2EXJA 1RUF3 3D3AA 5AC93 4QU1A 1MS3A 2XLGA 4QX2A 3VHPA 2ZGLA 1LODA 1W6MA 2IFWA 4JTNA 4Q5OA 1AR81 1ACCA 2SBAA 1Z7S2 3DV8A 3LA3A 4LBQD 1W6OA 5FYUA 5L19A 1WZXA 1WW4A 3CIHA 2XJPA 3VHNA 3USUB 1O4ZA 4JDOA 5E16A 4PQQA 4UWDA 4ATEA 3TN91 3O1UA 2IXCA 4E2GA 4GH4C 1RUOA 5D8AC 4K8FA 4XFFA 5K8SA 1SLLA 2WYFA 1L7LA 3WXPA 2WNUC 5SV8A 3RYPA 2VZTA 5FLJA 1POQA 3OD4A 4AGVA 5T5OA 4ASMB 4OHVA 5DG2A 3EHKA 3P3NA 5C71A 4UAPA 3VV1A 1CAUA 3TEZA 4Q4W1 5HCAA 1H9PA 1E57A 1LGCA 4Q4X2 4Q4X1 4LBOA 1TVGA 4HK9A 3ZLIA 4AI8A 4E8CA 1YJKA 4Y1UA 5F3GA 1RIRA 1ODMA 4X6QB 1RYYA 1V6NA 1W0PA 2OA2A 3NAPB 1FX5A 1AXYA 4GWMA 4IQPA 4JKMA 4Q0UA 5F3CA 5CG9A 5GLVA 3TRSB 3ON7A 4Q2FA 3T2PA 1AXZA 4B7KA 5LBEA 1AX1A 2HH9A 1MEC3 1ND3B 4ZONA 4JDMA 4OHYA 4XEZA 2PLV1 5BNNB 1XBFA 4JQTA 3ITQA 1PM4A 2BZDA 3OGVA 2WS92 3H3LA 1XYOA 3WNKA 5FWJA 2WJSA 1OPMA 1QJZA 3MW3A 3K2OA 5FY4A 1W99A 2ID4A 5DUUA 5FYBA 2Q8EA 4O9GA 5FRAA 5FZ8A 2JEMA 4CSWA 4KI5M 4JCKA 4YVSA 4OMCA 1V00A 1QJY1 3JBG3 2WL1A 2ZGKA 4IEVA 4AVCA 3R4UA 5JOZA 1DG6A 1RMU2 1QEXA 2D40A 4OI2A 1JW6A 1OFNA 1RUH3 1VALA 3FE5A 1Y9MA 1WUVA 5B2GB 2P2KA 2R041 3ENRA 3ILFA 4AWDA 5JLVA 3FBMA 1UXZA 4EN0A 2Q1MA 2E32A 4IW3A 3T4HB 5FFOC 5J36A 1RUG1 3BGAA 2ZKLA 3B00A 4WZFA 3VZLA 1WMDA 2JKXA 2RS13 5JVVA 1OLQA 3K51A 3D0JA 4D6QA 1PGW1 4HK8A 2W5FA 3IMMA 3ZFEB 4D69A 3P5BA 4D7TA 1Q3EA 1YXWA 1HB3A 5IK7A 5BNQA 3SH5A 5FJKA 2VNVA 3H9AA 2J1SA 3H8UA 2RDQA 1AYN1 4RGGA 3WF4A 1CD3G 2ORZA 2J1UA 5HI0A 2FDJA 2RS32 4G4FA 3HQUA 4CUCA 2LTNA 1YQ8A 3CZUA 5LASA 5A3MA 1ZRIA 4RR3B 4E4SA 2YXSA 4MYEA 1SDWA 5KHGA 1VBE2 3ZVXA 2GN7A 2HWC2 4XURA 2JG9C 1GFF2 2R073 1XNBA 1ZM1A 1G8WA 1FNYA 4RL7A 3NO8A 4CUGA 3RZLA 1QKQA 2VG9A 4CZSA 5FZ6A 4NAOA 2GMPA 2DVBA 2RJKA 4NRQA 1RUG2 1DFQA 5FKBA 4PLNA 5JWPA 3AL5A 1RB8G 1IGOA 3POWA 3PU3A 5J48A 4YW2A 3H50A 1Q8QA 4IEQA 1X33A 1RUJ1 5A1AA 4HKLA 2Q8OA 3GXUA 2OX0A 1UW8A 1REFA 3LWCA 4DY3A 3VD4A 1YI9A 2V73A 1XQNA 4XF1A 3TB0A 1VBD2 2E7AA 1HQLA 1LHVA 3MIHA 3ZN4A 4XBLA 1D4M2 4PDWB 4ZKTB 1HQNA 1RUF2 5IUQA 3KVBA 3O1RA 3M3IA 4YVWA 4AFDA 2E31A 3J7MA 3NAPC 4MHRA 4E27A 1G9CA 1VJ2A 3UGHA 3WCRA 1VBB1 3ETQA 1JZ6A 1DQ0A 2LROA 1JBCA 4LO4B 2PAEA 1MS9A 2IXKA 5FZ0A 3BOPA 4AQ6A 4GQ7A 5AC91 3GDBA 1GYKA 2R49A
chains in the Genus database with same CATH topology
3BVCA 5LBFA 3NNMA 5LBEA 4ZONA 3EMRA 2OPWA 2G19A 4BQWA 3ITQA 5LA9A 4MHUA 5DAVA 4ZPIA 5C5TA 5IAXA 4J25A 4NMIA 3GJAA 5L9RA 5DAQA 5ERLA 5LATA 3W20A 5HV0A 2A1XA 5EPAA 4BQYA 3GJBA 4XACA 2RG4A 5L9VA 2RDNA 3GZEA 5C5UA 3NNFA 4XABA 4Y5SA 5LB6A 2Y33A 3PL0A 5EQUA 4NHMA 2RDRA 4BQXA 3NNLA 4IW3A 4NHLA 5IATA 3KT7A 4NHKA 2JIGA 5M0TA 2Y34A 5HV4A 4XAAA 2FCUA 2RDQA 4NHYA 3KT1A 3OUJA 4Y5TA 3HQUA 5LASA 3MGUA 3KT4A 3OBZA 5IAVA 4XCAA 5DAXA 3OUHA 3HQRA 4KBZA 4NAOA 3W21A 2G1MA 4Q5OA 2RDSA 3OUIA 2V4AA 5DAWA 4UWDA 2HBUA 5LBBA 3NNJA 4JZRA 2FCTA 5A3UA 5LBCA 4XC9A 5DAPA 4MHRA 2HBTA 5EP9A 2JIJA 4NHXA 3DKQA 4XCBA 5L9BA 2FCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BVC A;  5LBF A;  3NNM A;  5LBE A;  4ZON A;  3EMR A;  2OPW A;  2G19 A;  4BQW A;  3ITQ A;  5LA9 A;  4MHU A;  5DAV A;  4ZPI A;  5C5T A;  5IAX A;  4J25 A;  4NMI A;  3GJA A;  5L9R A;  5DAQ A;  5ERL A;  5LAT A;  3W20 A;  5HV0 A;  2A1X A;  5EPA A;  4BQY A;  3GJB A;  4XAC A;  2RG4 A;  5L9V A;  2RDN A;  3GZE A;  5C5U A;  3NNF A;  4XAB A;  4Y5S A;  5LB6 A;  2Y33 A;  3PL0 A;  5EQU A;  4NHM A;  2RDR A;  4BQX A;  3NNL A;  4IW3 A;  4NHL A;  5IAT A;  3KT7 A;  4NHK A;  2JIG A;  5M0T A;  2Y34 A;  5HV4 A;  4XAA A;  2FCU A;  2RDQ A;  4NHY A;  3KT1 A;  3OUJ A;  4Y5T A;  3HQU A;  5LAS A;  3MGU A;  3KT4 A;  3OBZ A;  5IAV A;  4XCA A;  5DAX A;  3OUH A;  3HQR A;  4KBZ A;  4NAO A;  3W21 A;  2G1M A;  4Q5O A;  2RDS A;  3OUI A;  2V4A A;  5DAW A;  4UWD A;  2HBU A;  5LBB A;  3NNJ A;  4JZR A;  2FCT A;  5A3U A;  5LBC A;  4XC9 A;  5DAP A;  4MHR A;  2HBT A;  5EP9 A;  2JIJ A;  4NHX A;  3DKQ A;  4XCB A;  5L9B A;  2FCV A; 
#chains in the Genus database with same CATH topology
 4IV1 A;  2W95 A;  5FYS A;  1RED A;  1T6G C;  5C8W A;  4NRP A;  2ADD A;  1HRV 1;  3ZN5 A;  2W9X A;  2HWE 1;  2OW4 A;  1ZZ6 A;  1W04 A;  2P1B A;  3N7M A;  3FUQ A;  3IPV A;  4UFM A;  4WM8 A;  4XF3 A;  2B42 B;  3N9L A;  4IGO A;  2J22 A;  4CEY C;  1XC6 A;  1K5M A;  2A3Y A;  4HOO A;  1VRH 3;  3LAG A;  1J3P A;  1JYV A;  1TNF A;  5T54 A;  3OPW A;  1ULF A;  1H9W A;  5LAT A;  5FO7 B;  1QNW A;  2ZEY A;  4QB6 A;  3W5N A;  5FZH A;  3LA2 A;  2AEZ A;  2MEV 3;  3A0K A;  3MIB A;  1H4H A;  5FMB A;  1OC1 A;  1FYU A;  3GHM A;  4W50 A;  2TBV A;  2ET1 A;  1NZC A;  2PHR A;  3WLU A;  5A33 B;  4IE4 A;  4Y1V A;  1QOO A;  1VMH A;  4Y4R A;  1XU2 A;  4AR2 A;  1OQ1 A;  2RMU 3;  4PF1 A;  5AFE A;  2YC4 A;  1K42 A;  2JG8 C;  3USU A;  1PK6 B;  2XHK A;  3UK9 A;  5CYY A;  2HWB 3;  1LNS A;  2VZR A;  1UU6 A;  4AI0 A;  2HWF 2;  5KHJ A;  2VTX J;  2QCS B;  4MGQ A;  3SLI A;  3VDD B;  3BOW A;  2FBE A;  1NG0 A;  3HR9 A;  5BNN C;  3P3P A;  4WM7 C;  2PN5 A;  1GNZ A;  1DP0 A;  3OGG A;  4LPL A;  1LU2 A;  2ARB A;  2LRP A;  3O1O A;  3KHC A;  1GBG A;  2R1B A;  2E26 A;  1W6N B;  2V4V A;  2OUH A;  2D44 A;  2VAU A;  3N9N A;  1RUH 2;  4IXL A;  4YGD A;  1UWW A;  1K5M C;  2VMG A;  3AZX A;  3Q8A A;  3SEE A;  5C8C B;  2OUJ A;  4AHX A;  1YQC A;  2WNV C;  2VVD A;  4QM8 A;  4EYU A;  3U10 A;  2XH6 A;  2XJQ A;  4WVZ A;  2ZA9 A;  4MX3 A;  2D93 A;  2WUH A;  5ABJ A;  2JDU A;  1O4Y A;  4ATF A;  2R06 3;  2C24 A;  2GC1 A;  3MF6 A;  4RQP A;  5FWE A;  2VMC A;  1EV1 1;  1JZ3 A;  3OB8 A;  1UKG A;  5C3P A;  4AQT A;  5A1L A;  5I91 A;  1ND2 A;  3B94 A;  4W8J A;  4RS5 C;  3LFM A;  3KM5 A;  4IV3 C;  3TOJ A;  3NV2 A;  1YO8 A;  3PVE A;  2RVA A;  1WCU A;  4YNI A;  3ABZ A;  3K4A A;  5T5P A;  3U11 A;  1IKQ A;  3ES1 A;  4R4Z A;  5J1X A;  5HXV A;  3TNP B;  3MF9 A;  1JYX A;  2LS6 A;  5FMO L;  1F9K A;  5A3T A;  1LUL A;  5C33 A;  1Z7S 1;  2FZ1 A;  4NAM A;  3KHB A;  5FZA A;  5I8S A;  3LQC A;  4YZ2 A;  2HWD 3;  5C3R A;  1QH7 A;  2ZMK A;  2V4A A;  1VBA 1;  4HAN A;  2BW8 A;  2WC2 A;  2W3J A;  2Y6G A;  1V9U 1;  3N9O A;  3HEI A;  4UT5 A;  2E63 A;  5D8A A;  5JXG A;  3E5X A;  2DFC A;  3E6D A;  2HWE 2;  2K46 A;  3MLK A;  3WCS A;  3E6C C;  1NCR C;  1GZT A;  1HQW A;  1W0O A;  1UN1 A;  2QTW B;  3SCG A;  2VNR A;  3MYX A;  2P17 A;  5IHR A;  3DXT A;  4PHZ A;  4YVW C;  4BK5 A;  1JZ7 A;  4Y5Z 0;  1F15 A;  5IVV A;  3UET A;  2VJX A;  4M4P A;  1F4H A;  3VBH B;  1ENX A;  4XZP A;  2FHR A;  1H8T A;  1A6C A;  5KXB A;  4QQP A;  4NPM A;  3SEP A;  1U5X A;  4N43 A;  1YIP A;  5C3S A;  2JE8 A;  2XPJ A;  3ZMN A;  1S0G A;  3ZR5 A;  3BKZ A;  1YLL A;  4NO4 A;  5L36 A;  3OTF A;  1UF2 C;  2B39 A;  4YM1 A;  3THT A;  5DN2 A;  5GLT A;  4BH9 A;  1WW5 A;  2QQJ A;  5IVE A;  1A8M A;  1ZZ7 A;  1ALY A;  4S2H A;  4QKD A;  2R06 1;  4CEY A;  1EV1 3;  4EZ4 A;  4LMF A;  3AVR A;  5C5T A;  2A3W A;  2A6X A;  3VDC A;  5C8C A;  5FZ7 A;  3SHR A;  2WT0 A;  5F1R A;  2GNB A;  2CU5 A;  4ZHN A;  1HN1 A;  5H9S A;  3ZXL A;  3WW1 A;  5EPA A;  4KMQ A;  4YVS C;  3PMS A;  1MAC A;  1W6Q B;  3ZFG C;  3IAQ A;  4BLI A;  5BXX A;  4XDQ A;  4JGY A;  2CGP A;  1JYT A;  2ZX1 A;  3B7M A;  4GKX A;  4AYU A;  1CR7 A;  3RJR A;  1CAV B;  4XBQ A;  4A41 A;  2AGS A;  3PL0 A;  4QX0 A;  3KB5 A;  1AL0 G;  4QU2 A;  1OI6 A;  3JD7 3;  5EQU A;  3SMH A;  4QGM A;  1H8T C;  1N1V A;  5J3U A;  2JDM A;  4C90 A;  1KFU L;  2K2S A;  3VKN A;  3WY6 A;  1LOC A;  1VBC 3;  3AB0 A;  4MO3 M;  4RD7 A;  1FPN 2;  1VRH 1;  1A8D A;  1S0C A;  4N53 A;  4DXS A;  2WR9 A;  2WFF 1;  4WM7 A;  1RUD 3;  1RUH 1;  2QQU A;  3ETP A;  1DZQ A;  2FQP A;  4Q0P A;  1CAW B;  1JZ2 A;  3T1L A;  1XYP A;  2WDB A;  4C1X A;  5BNO B;  2RM2 2;  1S1A A;  4IGP A;  4OCT A;  4GA9 A;  4YW7 A;  2PYT A;  5BY5 A;  2PMW B;  5FO9 B;  1AJK A;  4XAA A;  5FRE A;  3P6B A;  4AAX A;  1S0F A;  4OUS A;  1TMF 3;  4P9G A;  3BI3 A;  4Y5T A;  3MPB A;  2GSY A;  2ZZJ A;  2VZP A;  3MGU A;  5FYZ A;  1IG3 A;  4D7S A;  3JB8 A;  1U5Z A;  3CJI A;  4OZX A;  3ZOI A;  1U12 A;  1LCL A;  3I3D A;  1AR6 3;  1PHM A;  1LHO A;  4AI3 A;  3GBF A;  2PQS A;  5FY1 A;  3MV0 1;  3CDZ B;  4IV1 B;  4YAR A;  3I2O A;  1ZZB A;  4H14 A;  3IIA A;  4BYY A;  2DWR A;  1WCQ A;  1W2A X;  4P9W A;  3J7N A;  1GQH A;  2JX9 A;  2JKB A;  5C3Q A;  3WF0 A;  4Y22 A;  1OVP A;  5DDJ 2;  1UCX A;  2EXH A;  1UNB A;  2I45 A;  4YVW B;  2YU2 A;  4Z1V A;  3WDT A;  2HEW F;  3B3Q E;  5IJR A;  4COU A;  4HET A;  1JOJ A;  2PLV 2;  3C7E A;  5C9A C;  1ZBE 3;  1ZNP A;  2JDP A;  1G86 A;  3ZFF C;  3VBR B;  1RHI 2;  1NOV A;  1S0B A;  3LD8 A;  5FYM A;  2DFB A;  2ZEZ A;  4SBV A;  1LED A;  5EJ1 B;  2XJV A;  3W9A A;  2OKX A;  2OZ6 A;  1YCI A;  2W94 A;  1QJX 1;  2ZX3 A;  1CIW A;  5DQ0 A;  1H8V A;  4QX3 A;  2DVD A;  1ZX5 A;  1LHW A;  2NPI A;  5DUX A;  3TBD A;  1YYN A;  4I09 A;  5FK8 A;  1O5U A;  1FMD 1;  4JV4 A;  2XG3 A;  4XMA A;  3VBF A;  2DCZ A;  4XJA A;  4XCB A;  3U4X A;  3V0A B;  3NV1 A;  4FQ4 A;  1BCX A;  5A7N A;  1EPW A;  1QXJ A;  2A6Z A;  4CXY A;  5T5L A;  4RS5 B;  1RVF 2;  3AP6 A;  1F2N A;  4QGL A;  5EJZ B;  1ZBE 1;  5FZ4 A;  4WM8 C;  1MZ5 A;  2RR1 1;  2W68 A;  5K9Y A;  4MGK E;  2YGM A;  4HVO A;  3MBW A;  4JHZ A;  2ORX A;  2R32 A;  1W8F A;  3LEM A;  2PHW A;  3PIJ A;  4C1W A;  4EV0 A;  4HVQ A;  1C57 A;  4FSJ A;  3HIF A;  5FUP A;  3E6B A;  1HV1 A;  1EUU A;  1QY4 A;  2CGN A;  3RPQ A;  5BNP C;  2YG0 A;  2AH2 A;  1XU1 A;  4LEJ A;  3M2M A;  1AYM 1;  3ACH A;  3BPZ A;  3VUO A;  4LA2 A;  2GN3 A;  4QQH A;  1E5I A;  1V6L A;  3AP9 A;  3G6J B;  3NKT A;  1HRI 3;  3GZE A;  4HG6 B;  3VBS A;  1J58 A;  2QDR A;  5CKN A;  4XXA A;  4ERO A;  2ZGO A;  5AC9 2;  2VUA A;  3FMG A;  3D6E A;  3VDD C;  4AI1 A;  4F83 A;  1QH6 A;  1W06 A;  4N9I A;  1C3H A;  1EAH 2;  1RJ7 A;  1Q8P A;  1VBC 1;  2QZ3 A;  1C1F A;  1S2K A;  3PVN A;  4CDQ C;  4JGZ C;  2VME A;  2OYZ A;  3JQX A;  4PCR A;  1WWY A;  4QPW A;  1IKP A;  3H3U A;  2JJ6 A;  3NST A;  1CGP A;  4KQ7 A;  3WNX A;  1ONA A;  5GJ6 A;  3BTY A;  4L97 A;  4K40 A;  1VBD 1;  4H7M A;  4CDW C;  4QQO A;  4OQ8 A;  1JOP A;  3JD7 2;  5F6L B;  3ZYJ B;  3QBQ A;  2X29 A;  2TUN A;  4QT6 A;  4RSU A;  2D6O X;  3WF3 A;  2PHF A;  3HJR A;  5KWR A;  1BVV A;  3OUJ A;  1VBC 2;  2P3Y A;  1SLA A;  2WZR 1;  3U4S A;  3T0A A;  2BDR A;  4V1P A;  4Q4X 3;  3T2Q A;  3WVJ A;  2FDF A;  2Y8K A;  1G9A A;  2GH8 A;  4X8P A;  4KNC A;  4K1Y A;  3VZN A;  4BE3 A;  1YHF A;  3BOD A;  5IK8 A;  1PVC 2;  4QPG A;  4W6X A;  1OOP C;  3DKW A;  4XOG A;  3IN9 A;  3WDW A;  4B4P A;  5HBA A;  2XLF A;  2ET7 A;  2VY0 A;  4AF9 A;  3ELN A;  1WLT A;  2CDP A;  4I01 A;  4YW1 A;  3VL8 A;  5LA0 A;  4XHX A;  1AYM 2;  3QH7 A;  4Y3O A;  4EWE A;  5LZ6 A;  2ZKN A;  2NP0 A;  3VD7 A;  4LQR A;  4XIK A;  3J9S A;  2DVF A;  4XBN A;  3ZSE A;  4LJH A;  2NN8 A;  5GAL A;  3WG3 A;  3W58 A;  2HYK A;  3APB A;  2NZ9 A;  3NWK A;  4FPK A;  4XUN A;  1SMV A;  3WG4 A;  3O0V A;  2VL4 A;  4AXO A;  2XHN A;  1SLI A;  3ZSJ A;  1Y7B A;  5JMC A;  4FQZ A;  1QJU 3;  2VW1 A;  3IKW A;  4GB3 1;  4PBP A;  5FV3 A;  2VMD A;  5JIA A;  4M4R A;  5FY0 A;  3POY A;  4EN6 B;  1KXG A;  1D2Q A;  1KGY A;  1JOD A;  1YQ6 A;  3HBK A;  3KQR A;  4L92 A;  3WNP A;  1PMJ X;  1DCS A;  4Y22 B;  3I8T A;  3PUA A;  4HFS A;  1H0B A;  2ZHM A;  1GZW B;  4XJW A;  1DU3 D;  3O1T A;  3KV6 A;  2WQ4 A;  5CG8 A;  4YZ4 A;  2BPA 2;  4MAD A;  3JXS A;  2WFP A;  3ZXK A;  4BM8 A;  3N9M A;  2W47 A;  1PIV 1;  4Q1P A;  4Z82 A;  1Q56 A;  3C7O A;  3S7E A;  4BIS A;  5A3W A;  3WW4 A;  3BUC A;  4BU2 A;  4QHO A;  3NJY A;  4HKO A;  2B46 X;  4FAH A;  4A7Y A;  4XQD A;  5FXZ A;  5LK5 A;  4RR3 C;  1JHJ A;  4Q4Y 2;  3DPR B;  4GMP 3;  2BV4 A;  3E97 A;  1IS6 A;  2IVI B;  3WQ1 A;  4XUT A;  2WS9 1;  3AYD A;  1AR8 2;  2YBS A;  4IER A;  1UYZ A;  2MNG A;  3DN7 A;  4XHB A;  4MGY E;  1CZV A;  2WII B;  4Q0V A;  2H0V A;  3MEP A;  3J8F 2;  3S7I A;  2XQX A;  5G04 L;  5FZ1 A;  1QQP 2;  4TSV A;  4JGY C;  4YG3 A;  1VIW B;  4L0P A;  5EYY A;  3WF2 A;  5CFC A;  1ASJ 2;  3ASI A;  3RRD A;  4AED A;  4COY A;  5JCT A;  2EXK A;  3S5A A;  3B9C A;  2ZZQ A;  1SPP B;  5LY2 A;  2EAL A;  3OPT A;  4CDU C;  1NKG A;  3N3H A;  1IS3 A;  1T6B X;  1UD1 A;  1WLC A;  1X9P A;  2XL7 A;  2Y0O A;  2QDN A;  1PO2 2;  4IE6 A;  4MXW B;  5BUV A;  3WW3 A;  3MUZ 1;  1PK6 A;  1GNH A;  4UFL A;  1RIN A;  5FLH A;  4FAG A;  1SBF A;  2WKK A;  2XJU A;  1D0G A;  1TEI A;  4FPC A;  5JXH A;  2VUJ A;  4OFG A;  5FZG A;  2ARX A;  3JD7 1;  1KJR A;  2BER A;  1OLM A;  1J3Q A;  1FV3 A;  2TEP A;  2G4I A;  4HN0 A;  4PLO A;  1NAE A;  1UMI A;  3POF A;  1PZ7 A;  1WD3 A;  4OHZ A;  2HWF 3;  4FCA A;  1ULD A;  4FVV A;  4YGB A;  5FJH A;  3AKQ A;  5HCB A;  3I2G A;  3UYJ A;  4QWN A;  1J3R A;  3Q9O A;  5F6K A;  5A6Y A;  2B9V A;  1C5H A;  4XF4 A;  1JTZ X;  3VBO C;  4WM8 B;  1URX A;  1AHS A;  3GAL A;  1WLD A;  2ILM A;  1CVN A;  3M3E A;  4FOW A;  2IVJ A;  2W1U A;  1AL2 3;  1LR5 A;  3D4K A;  4LUL A;  2QQK A;  1HRV 3;  2JE7 A;  3ZIX A;  3THP A;  2VPV A;  4Z07 A;  4JDN A;  1X50 A;  4LTA A;  5FTT C;  2EA7 A;  1R08 2;  1WD4 A;  3L9J T;  3OY8 B;  4Q4V 1;  4DEV A;  1OKO A;  4S2G A;  4R52 A;  1W8H A;  4AHY A;  3JUU A;  5KXE A;  1K12 A;  4AEK A;  4XUP A;  2O1Q A;  1NE6 A;  2RS1 2;  2WAA A;  1REE A;  1US2 A;  3FL7 A;  1POV 1;  3RGB A;  2VUC A;  3ZFG A;  1N3Q A;  2X8K A;  3I2I A;  5BPX A;  4XC9 A;  3HMY A;  1OD3 A;  3DEC A;  1W2T A;  3EXU A;  3OD0 A;  1NXM A;  1OT5 A;  4LXL A;  5D8A B;  3SIS A;  4E9K A;  5A7Q A;  4ZZ8 A;  4M3C A;  4QXB A;  4TWT A;  1LKN A;  4LO7 A;  1FMD 2;  4BWO A;  2P3I A;  4JAA A;  1UYP A;  5CB7 A;  3ZN6 A;  3VBU B;  3VDA A;  5FY9 A;  2WN3 A;  1KEX A;  4YZ1 A;  1DQ2 A;  2VNG A;  3U78 A;  2Y6L A;  4IV1 C;  3NNM A;  4CDW B;  2NM1 A;  3RG0 A;  4Y1X A;  2P3K A;  1MS4 A;  1OUX A;  4I0B A;  1H4G A;  2JDH A;  3GZU C;  2WZ8 A;  1POV 0;  4NVP A;  2L9L A;  4ES8 A;  4UI9 L;  3WHU A;  4QGN A;  1H6Y A;  1RUJ 3;  3NJX A;  5FMD A;  3T09 A;  2VR4 A;  1LTE A;  3A0N A;  4CU7 A;  3RYR A;  1DGL A;  2BOI A;  4G9S B;  4D8M A;  1W90 A;  3RMX A;  2BWA A;  3WDX A;  2Y26 A;  5GZF A;  3WP3 A;  1ZBE 2;  3CKH A;  1PVX A;  2EF6 A;  3R4D B;  3SIT A;  3BTA A;  3BN6 A;  4GB3 2;  4LE4 A;  1NUK A;  3HBZ A;  1PZ8 A;  5E1R A;  3CZJ A;  2NLR A;  4KG8 A;  3RSJ A;  1UIJ A;  4AED C;  3ME2 A;  1NT0 A;  2WO3 A;  4M00 A;  5JUV A;  5FYI A;  3VKO A;  4E4D X;  5T50 A;  3B69 A;  5J7M A;  1G9B A;  5FZD A;  4CUB A;  1FAY A;  2J1E A;  4ISR A;  2VQ0 A;  5D21 A;  3KVA A;  4LBK A;  1LOE A;  1GIC A;  3OGS A;  4MSV A;  3NJV A;  2VW0 A;  3NQH A;  2C5D A;  4QHZ A;  3MV1 1;  4HVR A;  4YW5 A;  3CF6 E;  3PJY A;  4A2U A;  3FUO A;  4W65 A;  4FO9 A;  3ZYP A;  4CPB D;  3WP6 A;  2HWE 3;  1XNC A;  3B02 A;  4OUE A;  1GAN A;  4SLI A;  2CSG A;  1V9U 2;  4YM3 A;  1BBT 1;  3T08 A;  1B35 A;  1X82 A;  2DCK A;  2ZPX A;  4ZXK A;  1LJ7 A;  3WZ1 A;  4BQ1 A;  4NRM A;  1TNR A;  1U5I A;  1VRH 2;  3O0W A;  2VCC A;  3ZIW A;  5M0T A;  4YFZ A;  3LOI A;  5IK4 A;  1RUG 3;  1DYP A;  1JZ8 A;  3I59 A;  2XWB B;  1DQ6 A;  4QM9 A;  5EFU A;  2ZEX A;  2WN2 A;  3N36 A;  1R1A 2;  1U5Y A;  2E51 A;  3I3E A;  1NZI A;  5JI7 A;  4D0Q A;  2XVK A;  4CEW C;  3GF6 A;  2XBO 2;  1RXF A;  4DMI A;  5JDB A;  3C7F A;  3BU0 A;  1ND3 A;  3HQR A;  4OHW A;  4O9E A;  1EP0 A;  4D94 A;  5CKQ A;  5I0U A;  1N3P A;  5DZE A;  5FPZ A;  3X29 B;  1XRU A;  3T30 A;  3WG1 A;  1ZZC A;  1AXK A;  1AF9 A;  4Q4V 2;  2CWM A;  1HXS 2;  2VOV A;  2X09 A;  3LB9 A;  1EAH 3;  2RDS A;  1PO2 1;  5LY1 A;  1YC6 1;  1ULG A;  4PBO A;  1LOF A;  1KDK A;  5I0R A;  4M01 A;  1WW7 A;  2OQ6 A;  4JVA A;  4NWV A;  4LKD A;  4AFB A;  5JSP A;  1XE8 A;  3L2Y A;  5GLU A;  3DCQ A;  4BXF A;  4I2O A;  3AFK A;  2VTF A;  4Q4W 3;  5A3O A;  1GNY A;  4YYO A;  1ULC A;  4A45 A;  2CWS A;  3RZM A;  1ZBA 1;  3FLP A;  1HRV 2;  2EIC A;  4YFW A;  3RZJ A;  1MZF A;  4IEU A;  1C8M 2;  4AEJ A;  1OSG A;  3ZXJ A;  1CX1 A;  3ALQ A;  1LHN A;  3AYE A;  4RN5 A;  1W2O A;  4FPF A;  1GSL A;  2AZ5 A;  2B7Y A;  4IEO A;  5ANN A;  5F5A A;  5FO8 B;  5I8Y A;  3LCP A;  3T1M A;  1CX4 A;  2WO7 A;  3KD4 A;  4MXW A;  2ES3 A;  1BMV 2;  4O61 A;  4GWN A;  3PVB B;  1W0N A;  1NQJ A;  4V2V A;  1W6P A;  5DAB A;  4ISQ A;  3VBR A;  1J84 A;  1CQ9 A;  5D1I A;  5LBF A;  5BNO C;  4YZ3 A;  5F9T A;  3DYO A;  4AVS A;  3Q8F A;  3F2Z A;  2IXI A;  1QWR A;  5FY5 A;  3H7J A;  5CA6 A;  1E5R A;  1OVS A;  4D3W A;  1AYM 3;  1XJA A;  4JHT A;  3PTR B;  4GXL A;  2ETE A;  2CHH A;  5FAX A;  3S30 A;  1XOY A;  4ZU4 A;  3GCW A;  2YBP A;  4A6S A;  1Z78 A;  3CEW A;  3SH3 A;  2AAC A;  3ZSL A;  3S6P A;  1PGL 1;  4K20 A;  3I2D A;  2UWC A;  3GJA A;  5L9R A;  3VKL A;  4ARY A;  4LK7 A;  4EN8 B;  5C8C C;  4DRV A;  1UY2 A;  2BOJ A;  2DUR A;  2VUD A;  4QDS A;  4BDV B;  3HNY M;  4UFI A;  4XFB A;  1AR6 2;  3IDB B;  3BTZ A;  2Z42 A;  3LPG A;  4A3Z A;  2W1S A;  1S0J A;  4Y5S A;  5CU1 A;  4BXS V;  1Y43 B;  4XJZ A;  3I97 A;  4COZ A;  5JAX A;  1Q8O A;  1UU4 A;  4XQW A;  1DLL A;  2C1F A;  2VQT A;  1JH5 A;  2VNO A;  4GD4 A;  5LWB A;  3UES A;  1CWP A;  4EN9 B;  3I59 B;  4BOW A;  2YV8 A;  1O7F A;  5EWS A;  2VZU A;  2WNV B;  3OGJ A;  3P1I A;  1PK6 C;  4IDZ A;  4XF9 A;  4A6O A;  2X05 A;  4OZO A;  4YLZ A;  5E6H A;  3M70 A;  5BNO A;  1NA1 A;  5SV5 A;  1RUF 1;  3EB7 A;  1BBT 2;  1X8E A;  3RZG A;  5F3E A;  1H2N A;  5JXI A;  4QB1 A;  5IYY A;  1PGW 2;  1X8M A;  2VXJ A;  3E1F 1;  1GP4 A;  5F39 A;  4LO8 A;  3VZO A;  1KDM A;  4BPZ A;  3RVH A;  2QQO A;  5FOB B;  4NHK A;  3UJQ A;  1QOT A;  4L8Q A;  5FPB A;  2WNV A;  4M0N A;  4B29 A;  3HOB A;  1VPH A;  4XJU A;  5FPU A;  1QJX 3;  4IEX A;  5FZI A;  2GND A;  4FFG A;  3WNL A;  5IVB A;  5H9R A;  5JR2 A;  2W08 A;  1JMU B;  2ARA A;  2RM2 1;  2YPD A;  4KU8 A;  1M4W A;  1PO1 1;  1YFW A;  5DAX A;  3TEX A;  3O14 A;  4E8D A;  1VAM A;  3V0B A;  4LK6 A;  1RVF 3;  5CVR A;  3ZXG A;  2P34 A;  3D8C A;  3ZYR A;  4AFA A;  2F4P A;  3RJ2 X;  3VD3 A;  4PQ9 A;  4QPG B;  1SLB A;  1N1S A;  4E2Q A;  2G1M A;  1BZW A;  2BUK A;  2EVX A;  1HB4 A;  2ZAH A;  2XJR A;  2R30 A;  3LE0 A;  4K1Z A;  2O8O A;  3B01 A;  4PF5 A;  1S2E A;  1R1A 3;  1SDD B;  4DZG A;  4EZH A;  4JTO A;  5A7W B;  5A1F A;  2ZXQ A;  3AZV A;  4DY5 A;  4URA A;  3TEW A;  1OA4 A;  3AYC A;  2CY6 A;  5FZ3 A;  3ZSK A;  1W8W A;  2VBP A;  1YI7 A;  4DRR A;  5KR7 A;  4I3P A;  2WSV A;  5FZO A;  5L9V A;  2BGC A;  4FFI A;  4LNV A;  1W9F A;  1ZZ9 A;  3AX4 A;  5A7S A;  2EIE A;  4N43 B;  4I30 A;  3K3N A;  4LKF A;  2G9Z A;  3KGZ A;  3OBR A;  1QGL A;  1S0D A;  4MLO A;  4QPY A;  1W6O B;  4LIV A;  3LSE A;  2GC0 A;  2Y0I A;  4NHX A;  5HCH A;  5APA A;  3DKQ A;  3FHI B;  4C8D A;  5L9B A;  5IFP A;  1M06 G;  2CDO A;  4OI0 A;  3BB6 A;  1JYI A;  3UGF A;  1DBN A;  1AR9 3;  3FHQ A;  3H1Y A;  3OGR A;  4PDW C;  3U07 A;  2YHJ A;  3H8O A;  1GR3 A;  1OXC A;  2IXH A;  4KBB A;  1HIX A;  4JX0 A;  3RS6 A;  3OF1 A;  3V65 A;  1CJD A;  3H8X A;  4CCC A;  2YFZ A;  3MUY 1;  4AL9 A;  1SFP A;  1LOG A;  1SEF A;  4MHU A;  1GOG A;  2WWS A;  1BEV 3;  4Y1Z A;  5F8P A;  3WSO A;  5KBF A;  3W20 A;  1QF3 A;  2BJS A;  1UL9 A;  1CES A;  1UQX A;  4QX1 A;  3T2T A;  2VCM A;  5J98 B;  5A6Q A;  5JPM B;  3H8R A;  2WYS A;  1OQE A;  1XNT A;  2C9A A;  2UY8 A;  5DG1 A;  4C0B A;  1NY7 1;  4YW6 A;  1OUR A;  1SG3 A;  1RHI 3;  1XNK A;  1YFY A;  1IZ3 A;  1ULP A;  1AR9 1;  1RUD 2;  2JXA A;  2H6C A;  3BPS A;  3NNF A;  2RS5 3;  4XAB A;  2BRT A;  5CIR A;  3S57 A;  2DU0 A;  5JXJ A;  2QE3 A;  1DLC A;  1T2X A;  3N9Q A;  4KG0 A;  3FX3 A;  5A7O A;  4Y1Y A;  3VLB B;  4LOT A;  1FMD 3;  3IMN A;  3HN3 A;  4QXC A;  1O91 A;  4NIH A;  3VBF B;  2HWD 2;  3WNO A;  4LHS A;  3LEK A;  2QZ2 A;  3D0S A;  3VHO A;  3PLQ A;  2O8Q A;  3VN4 A;  4CDX A;  1SCS A;  1ASJ 3;  1LES A;  2JDY A;  1DZT A;  1WW6 A;  5KC6 A;  1D4M 1;  3OEA A;  3VKM A;  1VBE 3;  1IPS A;  4OUL A;  2D6P A;  3KV4 A;  1V6K A;  2VOK A;  2QQM A;  4UBG A;  4CDW A;  1W3X A;  1O3Q A;  4QKN A;  2PAK A;  3OSD A;  2DU1 A;  3C7H A;  4R9C A;  4D6R A;  1AUY A;  2KA3 A;  5CBL A;  2BBV A;  3MLL A;  4A4A A;  1AX2 A;  4LO5 B;  2DUP A;  3MI8 A;  2KXL A;  4FOY A;  4GWJ A;  2J1R A;  2Z5W A;  4IE0 A;  5EV7 A;  1GQG A;  1DHK B;  2R1D A;  1JHN A;  1C8M 1;  2ZX4 A;  1GUI A;  5DZF A;  3T4V A;  3WQ7 A;  1BBT 3;  4V2W A;  4P9L A;  2KM2 A;  4CEW A;  1NCQ C;  1HJF A;  1WME A;  4EE2 A;  5L7O B;  2OS2 A;  2AYH A;  3ACL A;  3WV6 A;  1HRI 2;  1DGW A;  2GP5 A;  3THC A;  2ZGT A;  4BK4 A;  2JDA A;  4KBZ A;  1VBE 1;  5FPV A;  5FIX A;  4XJ9 A;  2SLI A;  4FTS A;  2Y38 A;  5E8A A;  1R09 1;  1CIY A;  4K8R B;  1JYW A;  1UPI A;  4NII A;  4QKB A;  2UWB A;  5K0U C;  2GH2 A;  1CPN A;  4L9B A;  2PA7 A;  2J1A A;  2VBB A;  1BKZ A;  3DPR A;  3PU8 A;  4Q4Y 1;  2GNT A;  3RZZ A;  4CDX C;  4QDQ A;  1K45 A;  2RS5 1;  1S0I A;  3TWI A;  2OT7 A;  2QKD A;  2FDG A;  5LBB A;  4BHP A;  3AXE A;  4XXP A;  2EAA A;  2VZO A;  3MIE A;  2GC2 A;  1W9S A;  2P37 A;  5C9A B;  4GH4 B;  3ECQ A;  1RUE 2;  1VR3 A;  1ZZ8 A;  2BWC A;  1CZS A;  3HWJ A;  1R08 3;  2ZBJ A;  4FT8 A;  2NMO A;  4QQ2 A;  5LA1 A;  1GOF A;  1R1Z A;  1C28 A;  4AVT A;  3QCW A;  3BYW A;  2VMH A;  5DUV A;  4CCL A;  2Q8D A;  3LKJ A;  4PLM A;  4Q27 A;  4WVM B;  4PJY A;  4FOV A;  3QAC A;  5FKC A;  1FPN 3;  5JZG B;  4R4X A;  5EIY B;  1PVC 3;  1VE0 A;  3LDB A;  5IVC A;  4YG0 A;  2BQP A;  1QIQ A;  3URF A;  2H0B A;  4FXK B;  1CPM A;  1UKR A;  2XJS A;  5JPN B;  4ZS3 A;  4AE2 A;  2XUM A;  2UUR A;  2XKO A;  1O59 A;  2HWF 1;  4MGZ E;  1AZD A;  3QH6 A;  2OPK A;  4N7U A;  1TMF 2;  3H3Z A;  4LBJ A;  1VBB 2;  1MS8 A;  3H0O A;  4GUL A;  1H2M A;  4Q8K A;  2A1X A;  3C8X A;  3AP7 A;  3B93 A;  4FTB A;  1WBL A;  1GKB A;  4OVE A;  2WZP P;  2Q1F A;  2Y64 A;  4LBL A;  2VCA A;  3I54 A;  1GU3 A;  3VBS C;  2LAL A;  4P9Y A;  5C5U A;  1TME 2;  3I3M A;  3VD9 A;  2D5H A;  3KSC A;  2Y33 A;  4CCN A;  5FMC A;  5FYC A;  1H2K A;  5F32 A;  4KWJ A;  1PGL 2;  3WP4 A;  2RMU 1;  3PIG A;  1W8T A;  1XND A;  4CDQ A;  1H8T B;  4B8E A;  4K9S A;  4NIG A;  5FY8 A;  3AMM A;  3VL9 A;  3IDC B;  4Y33 A;  4FOQ A;  2FMY A;  3LGR A;  3ZDV A;  3A22 A;  2IC1 A;  5ACA 3;  4LLO A;  4DOU A;  4HPK A;  4IES A;  3AJY A;  5F5Q A;  1PIV 3;  1VRB A;  1YWK A;  3UKV A;  2WNU A;  4FPL A;  4WBB A;  4YG6 A;  3T0D A;  3NJZ A;  5EHD A;  2VZ3 A;  2VCB A;  2JIG A;  1FOD 1;  2WLQ A;  5CNA A;  1UZ0 A;  1YIF A;  4MET A;  5C4W A;  1SAC A;  4Z92 B;  3ORJ A;  2Y34 A;  4DIQ A;  3EBR A;  2ZMN A;  2VE1 A;  3CMG A;  5ANQ A;  4P9X A;  1PNF A;  1RL3 A;  4XFH A;  1SFY A;  5I8T A;  3HD8 B;  4DIN B;  4P00 B;  4AGR A;  4E4Z A;  3MIC A;  1LEC A;  4UFJ A;  3OBZ A;  4E4H A;  3WNN A;  3ZO0 B;  4A44 A;  5J37 A;  3VBO A;  3M3O A;  2VMF A;  2RS1 1;  4IND A;  4LOR A;  3F95 A;  2VEC A;  1ZA4 A;  4PT6 A;  2ERF A;  2ZGR A;  3AJZ A;  4LBQ B;  4XFC A;  3OYW A;  2YMZ A;  2VU9 A;  3IDA A;  3JZV A;  3SH4 A;  5FP4 A;  3SNM A;  3RQ0 A;  2W91 A;  2X5I B;  3IM0 A;  3J26 N;  5FBJ A;  1BHG A;  1AYN 3;  3AMP A;  2FDI A;  3I49 A;  5BNN A;  4J6G A;  4HZF A;  3USS A;  1RUC 1;  4K7J A;  2QQW A;  1X36 A;  1YNA A;  3FZ3 A;  3I2K A;  4U2A A;  3V56 A;  4TLG A;  3N7K A;  3FLR A;  4CTE A;  1Q8S A;  2HJI A;  1QMJ A;  2XBO 1;  1QQP 1;  2FCT A;  1W6N A;  1NE4 A;  1AVB A;  2P6H A;  5J96 B;  3K4D A;  3KCX A;  2A75 A;  2E6V A;  2JE9 A;  2MHF A;  2QJV A;  5EYX A;  4AAP A;  3ZYB A;  1I5Z A;  3LOB A;  5D2A A;  1GQP A;  3POS A;  5FP9 A;  3ZSM A;  1DGR N;  1GZW A;  3UKT A;  2HEY F;  4FPG A;  1PGS A;  3O0X A;  5ABJ C;  3VDD A;  4CE8 A;  3OJB A;  2BP6 A;  2ZGP A;  3LZZ A;  4NR1 A;  3KCY A;  1DQ5 A;  1LEM A;  4P9I A;  4IEW A;  4XUO A;  1HW5 A;  1A3K A;  3UV9 A;  1AR8 3;  2DV9 A;  3IB3 A;  4NWW A;  5A70 A;  2QVS B;  3RI9 A;  4LR4 A;  4BME A;  4BA6 A;  1S0E A;  2ZOE B;  2WIN B;  2BFU S;  4HKW A;  4IEP A;  1QJE A;  1QQP 3;  4Z8B A;  1DGW X;  1O8P A;  1I3H A;  1W03 A;  4IE7 A;  2F4L A;  5A80 A;  4CDX B;  3WF1 A;  5LA9 A;  2FDH A;  5DZG A;  4WVM A;  4YW3 A;  2BU9 A;  4ZPI A;  4IEY A;  2EIB A;  3WHT A;  3ES4 A;  2ZCW A;  4NJ4 A;  1SPP A;  1UU5 A;  4XVH A;  3WDV A;  4AED B;  1SBD A;  1K5M B;  4BQY A;  2KD7 A;  1POV 3;  1D0H A;  4XAC A;  2JG9 A;  2Y6F A;  1Q5O A;  1VAK A;  5FZF A;  1GP6 A;  1GWM A;  2RDN A;  4KGQ A;  1PO1 2;  3JB4 C;  2ZGN A;  3NW4 A;  5FZM A;  1CJP A;  1UMZ A;  5LB6 A;  2WS9 3;  1JI6 A;  2AC1 A;  4LKE A;  4P9J A;  4YM2 A;  5LCW L;  1MVQ A;  4MGI E;  2Y6K A;  4FP2 A;  4TN7 A;  3CU7 A;  5EZW A;  1HXS 3;  4RA0 A;  4N8M A;  5FYT A;  4YWA A;  2BYV E;  2N7G A;  3N7J A;  3R4S A;  3C2U A;  3HAG A;  4LUK A;  3UT0 A;  2V09 A;  2JG8 B;  1STM A;  3FBY A;  2VM9 A;  4Q1R A;  4ZZ5 A;  4FXG B;  1RUI 2;  1LB2 A;  1W8Z A;  1Z0H A;  1OLM E;  4RFT 0;  5F2S A;  2D97 A;  4IEZ A;  2D3P A;  3SCF A;  3ZXA C;  4XDO A;  4B4R A;  2PAM A;  1COV 3;  2C6S A;  4A42 A;  1QJU 2;  1Q43 A;  3ZM8 A;  3KT7 A;  4WM7 B;  4BIO A;  1UX7 A;  2Q30 A;  1V6O A;  4OUM A;  1WCS A;  2OII A;  4N53 B;  4QX7 A;  4BQ2 A;  4NPR A;  3AMH A;  2JD4 A;  5DDJ 1;  1TQ5 A;  3NMB A;  2XXZ A;  4ARX A;  5HCF A;  2WZR 2;  2FD8 A;  1J83 A;  1HXS 1;  3AKP A;  3LFI A;  3CNA A;  2IWG B;  4XDP A;  5C4W B;  2YZ4 A;  1NCQ A;  2MPF A;  4MGS A;  4P02 B;  1CAV A;  1CN1 A;  5C6C A;  3IZO A;  3OUH A;  5GKA C;  4GZ9 A;  4JGY B;  4CU6 A;  1UZV A;  2RS5 2;  4AGG A;  3ACG A;  4UFK A;  4A7Z A;  5FZO B;  1UXX X;  5GZC A;  2EAK A;  2B9U A;  4CCM A;  1N47 A;  2YY1 A;  5IVJ A;  4BB3 A;  2HLE A;  2XL9 A;  4RR3 A;  2YGL A;  1OLR A;  3I2H A;  2D98 A;  1LOF C;  2LUW A;  2ZX0 A;  3DPR C;  4UOJ A;  3DL3 A;  2HWC 3;  3ZXD A;  1PMH X;  4CEY B;  2ATF A;  1RMU 1;  4NN0 A;  1LU1 A;  4COW A;  1MS0 A;  4LT5 A;  2QNK A;  3AVS A;  3ZPO A;  2VZ1 A;  3KGL A;  3H1M A;  2OQ7 A;  2ZGU A;  4QKF A;  1NY7 2;  1OA3 A;  1F35 A;  2ZHN A;  1RUI 1;  2EXI A;  3WD5 A;  2WFF 3;  4ZS2 A;  1TZO A;  2D6L X;  1S4C A;  1ZRR A;  4ASL A;  2YRO A;  3TN9 3;  2B5H A;  3AMQ A;  4DQA A;  3O1S A;  2PTM A;  4N90 A;  3PUS A;  5FPL A;  2D6M A;  3T3Y A;  4WVW A;  4M0H A;  3I2J A;  4GWI A;  5K0U B;  3SCH A;  4XFG A;  3VBH A;  1COV 1;  3CJI C;  4YW4 A;  2PFW A;  2FCV A;  4LHL A;  5FCC A;  4NOT A;  3BIW E;  1F5F A;  4P14 A;  1GP5 A;  3VBO B;  5H9Q A;  3AZW A;  1NCQ B;  1IG0 A;  4AOC A;  3EMR A;  1E5S A;  2Q4S A;  2QQI A;  2RJ2 A;  4AVV A;  4XFA A;  4BQW A;  2G9F A;  3VZK A;  1H30 A;  4OI4 A;  1OBN A;  2C0Z A;  1EAH 1;  1UO9 A;  1PZ9 A;  5FDB A;  2UY9 A;  2W52 A;  2XML A;  2E7Q A;  3BCW A;  4EQV A;  5IAX A;  2D3R A;  4K3U A;  2D5F A;  2D6K A;  1QJX 2;  2QBX A;  2A70 A;  4I3G A;  1AR7 3;  3POI A;  1AR9 2;  1RUD 1;  5DPN A;  2V5D A;  3LIH A;  3WEZ A;  4HBN A;  4HON A;  5CEH A;  1JS9 A;  4M3C F;  1J1T A;  4X8N A;  5K4L A;  4HPK B;  1YFU A;  4TLF A;  5G05 L;  4KWL A;  1X7N A;  3CL1 A;  2NYY A;  1RUE 3;  3JU9 A;  5C70 A;  1MS1 A;  1ST8 A;  5CFD C;  4AQS A;  1W8U A;  2P5B A;  1VBA 3;  1TMF 1;  4XTM A;  1H1I A;  4CU9 A;  3O7O A;  1QNY A;  4ZU5 A;  2WQZ C;  5GZE A;  1DGR A;  4CDU B;  5JSO A;  5FZK A;  4A3X A;  1WA4 A;  3NNL A;  2YC2 A;  3K77 A;  2Q0A A;  1UOF A;  4G3Y C;  3U14 A;  2DCY A;  1H2L A;  4R8H A;  4AZZ A;  3POE A;  4OYU A;  3UJO A;  4B1L A;  1OKQ A;  4UW4 A;  2WO2 A;  5GZG A;  2I2S A;  1NYW A;  1NCR A;  2BVB A;  3MW2 A;  1L7R A;  1GOH A;  3LIG A;  5L73 A;  3RWN A;  3K48 A;  3AMN A;  5HV4 A;  2GME A;  1Y4W A;  1KD7 A;  2PHL A;  4PIZ A;  5A3N A;  4O7X A;  3O1P A;  5E89 A;  3JCI A;  3ZYG A;  2B8M A;  2NMN A;  2K0G A;  3OPZ A;  2LM3 A;  1WKY A;  3L2H A;  1ZRE A;  2Q1Z B;  3H42 B;  4N43 C;  2BFU L;  3QLQ A;  1I9R A;  1HLC A;  2Y6J A;  4XW3 A;  5IW0 A;  4KGG A;  1ND3 C;  2D3S A;  4Y26 A;  1TME 3;  1WLW A;  3A7Q A;  2QQP A;  4GJY A;  5FXX A;  2XB6 C;  4DUV A;  4Q26 A;  2BGP A;  4BQ4 A;  1IS5 A;  2HWD 1;  2PEL A;  2RV9 A;  3B5L B;  5FUN A;  4UXA A;  3ZMO A;  5J09 A;  3EJK A;  4Q8L A;  4B4Q A;  4EWA A;  3CLP A;  3OUI A;  4JGZ A;  4UW5 A;  3T0B A;  1FT9 A;  2R16 A;  4UF0 B;  1HJG A;  2J1V A;  4DFS A;  5ACA 2;  5FR3 A;  1GZ9 A;  1W3V A;  3J7L A;  4QB2 A;  1PIV 2;  3T2O A;  3OG2 A;  2JIC A;  1AR6 1;  1OUS A;  3WR0 A;  1XXN A;  2DCJ A;  1HKD A;  1BJQ A;  4XAE A;  4LBN A;  2V5Y A;  1W9W A;  2WWU A;  2I74 A;  5A3L A;  1ZRD A;  1RUC 3;  2VO5 A;  4DEQ A;  2HBT A;  2VOX A;  2X5I A;  3WQ0 A;  2VOT A;  1APN A;  1Y9Q A;  5F2W A;  4CP9 A;  5A32 B;  2A6Y A;  3U75 A;  3Q8B A;  4RGK A;  3KWV A;  2CTV A;  3K3O A;  2ZAA A;  3E5U A;  5I0T A;  3AP5 A;  2R07 2;  1OH3 A;  3DF0 A;  2PHD A;  3N9P A;  3DYM A;  1B35 B;  2P3J A;  2WFF 2;  3J8F 3;  2ZHL A;  4LA3 A;  4UYB A;  4QX8 A;  4R9D A;  5TSW A;  5I93 A;  5JSR A;  1V9U 3;  3BAL A;  5I0D A;  4N9H A;  4DXT A;  5DMY A;  1W6P B;  4UW3 A;  3IDE A;  2J1T A;  4JQR A;  1ULE A;  1X9T A;  4Q29 A;  5FXW A;  5A6X A;  4CXX A;  4NMI A;  4HLT A;  4CCK A;  2AEN A;  2JDK A;  4AEM A;  2BNN A;  5FZB A;  2DVG A;  1A34 A;  1UIK A;  2C4X A;  3EO6 A;  4L11 A;  4QPI B;  1MEC 2;  3H7Y A;  2XVL A;  3GJB A;  5JMO A;  3AZY A;  4NPL A;  2TNF A;  3G7D A;  5FZC A;  4QXH A;  2RJL A;  5HXM A;  1ZA7 A;  4H2A A;  5ACA 1;  4AW7 A;  4CDQ B;  2BNO A;  3QOP A;  1YFX A;  4FPJ A;  1Y9G A;  1O8S A;  1R09 3;  1DF0 A;  3KF3 A;  3WG2 A;  3GCX A;  2IXJ A;  2VW2 A;  4FPO B;  2OXB A;  4GMP 0;  2PHX A;  1GMM A;  1NA1 C;  1UYX A;  1AL2 1;  5FLI A;  2VXR A;  3JQW A;  3IT8 A;  3AL6 A;  1KFX L;  2GU9 A;  1IHM A;  3OBT A;  3UL2 A;  3HT1 A;  4CU8 A;  3V0B B;  2W1W A;  4OHX A;  3J4U H;  3PME A;  2ARE A;  3CQO A;  4COV A;  3KCC A;  4UFH A;  1J1L A;  3PHM A;  1P8J A;  4AFC A;  3K4Z A;  5DUW A;  3VKF C;  2XR4 A;  1HN0 A;  4BZ4 A;  2VZQ A;  3R6S A;  4CCD A;  1ENS A;  1MZE A;  3O5S A;  3SQO A;  1BMV 1;  2WZE A;  1R08 1;  2W92 A;  4J1W A;  3KT1 A;  1UY1 A;  3PUH A;  3ROU A;  4BLJ A;  4CVU A;  5GLZ A;  1YQ5 A;  2HYX A;  3EYP A;  3M4F A;  2AUY A;  2XWJ B;  1ODN A;  4OQ9 A;  4KU7 A;  1EY2 A;  1RHI 1;  4GMP 1;  5IAV A;  2K9Z A;  2ZGS A;  2CGO A;  1QJU 1;  4XCA A;  5T52 A;  2XQR A;  3RFR A;  1TME 1;  1OA2 A;  3RZK A;  3HPN A;  2UU8 A;  4GAL A;  1PVC 1;  2VGD A;  2XON A;  4UBH A;  4ITC A;  4WVV A;  1GV9 A;  2DCT A;  3ZFG B;  4XUQ A;  5JZG A;  2C26 A;  4YVS B;  3PVO A;  4MZU A;  3RNS A;  5KC5 A;  1O6U A;  1MEC 1;  4TZD A;  3GBG A;  2WNO A;  3W21 A;  2BGO A;  4JKL A;  2RS3 3;  4LKS A;  3WT3 A;  1D2S A;  1OMI A;  1JYC A;  3PJQ A;  5E88 A;  5A32 A;  5K0U A;  3GZA A;  3HQX A;  1LOB A;  1PNG A;  4UW6 A;  3KQ4 B;  1VBB 3;  4HT1 T;  1H1M A;  5K7P A;  4KL1 A;  3ZKU A;  1DYO A;  2RR1 2;  3FHA A;  3Q8E A;  4JZR A;  4RHV 3;  1BK0 A;  2Z79 A;  1PX3 A;  4FFF A;  3ACF A;  1EUT A;  1RXG A;  5LBC A;  3N7L A;  2ZML A;  5T55 A;  4YZ5 A;  1QJY 3;  4S2F A;  1R1A 1;  5KHI A;  4RQP B;  4F3J A;  2ZGQ A;  3NNG A;  2I07 B;  3NAP A;  4UF0 A;  2VH9 A;  3HN1 A;  1VLN A;  3GHN A;  2C9K A;  4ONU A;  4MGT A;  1VB2 A;  2A7A A;  4YM0 A;  4EWD A;  5FPX A;  1KIT A;  2R04 3;  1JYN A;  2YYO A;  1WMX A;  2R0F A;  5HPO A;  1Q8V A;  1EYB A;  1BEV 2;  1IPJ A;  1UY0 A;  3BVC A;  3GGL A;  3FJS A;  1S55 A;  3ILN A;  1UOJ A;  5FOJ B;  4IL7 A;  2XDV A;  2FZ2 A;  3AM2 A;  4PDW A;  5CAZ A;  4CEW B;  1C4R A;  4AHW A;  2CAU A;  4GB3 3;  4FTE A;  4WV8 A;  2VTX A;  2IXL A;  5GZD A;  1V0A A;  2VD7 A;  1DDL A;  4P5Y A;  1BLZ A;  4CCE A;  4PIX A;  3VBU A;  1GWL A;  4GIQ A;  3FWE A;  5DAV A;  5LEJ A;  5H9P A;  4Z2A A;  3S0M A;  5BV6 A;  4DUW A;  4A7K A;  2WQ8 A;  3PUQ A;  1W6M B;  1W2U A;  3SKJ E;  2DF7 A;  5IVF A;  2Y60 A;  2GAU A;  5AFB A;  1MQT A;  1NLR A;  2Z2S B;  4AFM A;  2QFE A;  3I2F A;  3NL1 A;  2ZX2 A;  1D4V B;  1SLC A;  3E5Q A;  3NV3 A;  3OCP A;  3GZT B;  1C5I A;  1L7Q A;  3VGI A;  1GZC A;  2R07 1;  3QD6 A;  1BXH A;  1W28 A;  3ZKY A;  3AC0 A;  5FK7 A;  1BEV 1;  3LEI A;  4CRQ A;  3HNM A;  5AVP A;  2F6B A;  3W5M A;  1SBE A;  2JG8 A;  2VQA A;  3N4M A;  2RDR A;  1H6X A;  5IT6 A;  1W9T A;  2GP3 A;  4HMZ A;  3M3Q A;  3SXW A;  2IUW A;  1CAX A;  1K5J A;  4YPJ A;  5LRS A;  5CKM A;  4JRL A;  1RUE 1;  1UYY A;  4MVT A;  2X10 A;  4R9A A;  4IGQ A;  5F5C A;  4H7L A;  2O14 A;  2WT2 A;  4DXZ A;  4TYS A;  1VBD 3;  4NHL A;  2CL2 A;  1ZYB A;  2W87 A;  4LBM A;  5FXV A;  3FFQ A;  1SQ4 A;  2E7T A;  2XBO 3;  5FZL A;  5CIS A;  5IAT A;  2W46 A;  1Y3T A;  4LHN A;  1UOB A;  2HWB 2;  3A23 A;  1EV1 2;  3N35 A;  4FI9 A;  3VBU C;  1QJF A;  2QUO A;  4DPN A;  5F7U A;  1G9D A;  4GKY A;  4XIO A;  2CV6 A;  4RGA A;  2GAL A;  5JOX A;  1DQ4 A;  3MIF A;  4S2D A;  1UMH A;  1TG7 A;  3FN9 A;  1CAU B;  1W39 A;  1XPW A;  4XFI A;  1D7P M;  2Q8C A;  4RQP C;  1J59 A;  4AVA A;  2D43 A;  1CAW A;  5CAD A;  3O1M A;  2RHP A;  4XE9 A;  3RI8 A;  2V72 A;  2BEO A;  4LUM A;  4PIY A;  3ZDS A;  2Y6H A;  1IOA A;  1FV2 A;  1HB2 A;  2YU1 A;  3POB A;  4IV3 A;  1MQT B;  1US3 A;  2W39 A;  3KV5 A;  4HN1 A;  5JZG C;  3TEY A;  2NQY A;  5FMO S;  1RMU 3;  2GDF A;  1VBA 2;  5LA2 A;  2Z4F A;  5C3O A;  3I3B A;  3M1H A;  3KF5 A;  2WBK A;  3DUI A;  4N7I A;  1OH4 A;  4XET A;  4CP1 A;  4XTP A;  3ZYI B;  4CUA A;  4D6S A;  3HT2 A;  2BVV A;  2YBK A;  4XPV A;  1LAJ A;  2ZGM A;  3WQB A;  4AK3 A;  1QHD A;  2DUO A;  2WA3 A;  1QDC A;  2MEV 2;  1NCR B;  4ORF A;  2HBU A;  4CA9 A;  2B4K A;  1MPX A;  4P5H A;  1B35 C;  3WDY A;  1ZBA 3;  1UY3 A;  2B45 X;  5DAP A;  4YSF A;  3S5Q A;  3Q8C A;  4Z2W A;  1HB1 A;  2WT1 A;  4NRO A;  5F5I A;  1XB9 A;  2VMI A;  2ZEW A;  2J42 A;  4WZC A;  4CDU A;  1O5L A;  5F37 A;  1QOS A;  3OEB A;  3MFC A;  4XMI A;  2JIJ A;  2EID A;  1LHU A;  2WA4 A;  2HKX A;  2HWB 1;  4PI2 A;  2WSU A;  3AFG A;  4RHV 2;  4DUX A;  2H6B A;  1O3S A;  3D5O A;  2GC3 A;  4NIA A;  3ZFE A;  1KS5 A;  2G9G A;  4BQ3 A;  2QQN A;  1ZRF A;  3PUI A;  4CCJ A;  4C91 A;  2Z69 A;  3R05 A;  1NLQ A;  2JWP A;  4QD2 A;  4F8A A;  2W2I A;  3H1W A;  4QPI A;  1NQD A;  3LEG A;  4XZU G;  3UKN A;  4CP2 A;  5L7O C;  5KXC A;  2AEY A;  1DZR A;  1MR5 A;  2UYA A;  2G19 A;  3JBG 2;  3K75 B;  4RYD A;  5F3I A;  4RHV 1;  1GWK A;  3MFA A;  4W6Y A;  3ZN6 B;  2R04 2;  2Q5T A;  4K21 A;  1UPS A;  5DDJ 3;  1LGN A;  4J25 A;  5HV0 A;  3MDP A;  4LE3 A;  2R06 2;  1I1E A;  4B3N A;  2A5Z A;  1UZY A;  2FDK A;  2QQL A;  3LPF A;  4QXK A;  2PLV 3;  4KWU A;  3ZX7 A;  1VP6 A;  2ADE A;  2DTW A;  1F4A A;  1V6I A;  2RG4 A;  3B9I A;  1OOP B;  3KMH A;  3RMY A;  4QMA A;  1G7Y A;  4PI0 A;  1BK1 A;  4DS0 A;  3ZR6 A;  2O0O A;  1JOB A;  2XLA A;  2WO1 A;  1RUC 2;  4IE5 A;  4MG2 A;  2A73 B;  5FBZ A;  1KRI A;  5LEK A;  4Y4Y A;  4CP9 B;  1KQR A;  1IS4 A;  1QU0 A;  4IET A;  3VBF C;  1AR7 2;  1I6X A;  1VMJ A;  3WNM A;  1Z7S 3;  4BQX A;  1HV0 A;  1V6J A;  2YB7 A;  5JOW A;  2YC0 A;  3JBG 1;  2J7M A;  1QDO A;  2XVG A;  1C8N A;  1GLH A;  2FMD A;  3CO2 A;  2JDZ A;  3IWZ A;  5AVA A;  5FZE A;  3SC7 X;  3VZJ A;  4BMB A;  1JU3 A;  4AHZ A;  5KHH A;  4Y20 B;  3GYD A;  2DVA A;  5IFT A;  3U0Z A;  1PM7 A;  1WA6 X;  5FYV A;  2XGX A;  3WX5 A;  3AKS A;  4OMD A;  2X53 S;  4QQL A;  3TAY A;  4AQ2 A;  2F17 A;  1PO2 3;  4JRA A;  4E2S A;  3OBA A;  2FCU A;  2ZHK A;  4NHY A;  1HDK A;  4OI1 A;  2EIG A;  1WGP A;  4AI2 A;  2W0X A;  5GM0 A;  5JOY A;  2QQV A;  3PTY A;  2WNE A;  3POG A;  3RZH A;  1FOD 3;  1MZ6 A;  2RM2 3;  1RTV A;  1LGB A;  3PDQ A;  4JC1 A;  3TNQ A;  1PO1 3;  1DYK A;  2DBI A;  3DEM A;  3AXD A;  3WUD A;  1H1A A;  3AKR A;  5FY7 A;  4B7E A;  5ISL A;  4FP3 A;  1W9Y A;  3PUR A;  3C3V A;  4FFH A;  2WLP A;  3KV9 A;  2YPJ A;  1OF3 A;  1OFS A;  5FP3 A;  1R09 2;  3M8L A;  2UYB A;  1MS5 A;  4XJ8 A;  4Y24 A;  1OHF A;  1MVE A;  1NX9 A;  3III A;  5IK5 A;  3CBN A;  1TE1 B;  4MV2 A;  4W4Z A;  3ZYF A;  3ZXE A;  3ZXF A;  1UX6 A;  1ULO A;  1YQ2 A;  2ZJC A;  4K6B A;  2PHU A;  4BIF A;  3NVC A;  4CP0 A;  4GH4 A;  1KS4 A;  1RC6 A;  2VZS A;  4LHK A;  1O3T A;  5A3U A;  3LDK A;  2PQQ A;  2ZAC A;  4QX5 A;  1LOA A;  1FPN 1;  2PXJ A;  2ZS6 B;  3NRU A;  5A3P A;  5IVY A;  5EP9 A;  4AG4 A;  5EXO A;  3AKT A;  4DXR A;  3NKG A;  5FP7 A;  4J1X A;  3NV4 A;  1OPO A;  5B4X A;  2A6V A;  1NLS A;  1IPK A;  4GAZ A;  4MUV A;  4LLF A;  1PX4 A;  2LW8 A;  3OYW B;  4EJR A;  4QPG C;  3ZFE C;  4H3W A;  1W8O A;  1W8N A;  3GM8 A;  4BJ0 A;  1JZ5 A;  3J7H A;  3ZFF B;  2ARC A;  2JG9 B;  5IWF A;  2KR2 A;  1N3O A;  2DDU A;  3AZZ A;  5JIU A;  2JEC A;  2XOM A;  1YRZ A;  3O12 A;  1LEN A;  2OPW A;  1BQP A;  1RGS A;  4L2N A;  3ILR A;  5EJ3 A;  4XQ4 A;  5FYH A;  3INA A;  2R0H A;  1XNA A;  3A4U A;  4FPE A;  2DBN A;  4JGZ B;  4MXV A;  4Q0Q A;  4BCU A;  1YEW A;  5C4W C;  1ZRC A;  3WDU A;  4KH9 A;  3LSD A;  2RMU 2;  3AYA A;  2YUE A;  3WIN E;  3MLJ A;  3GNE A;  4XYX A;  2DYC A;  5BNP A;  5DAQ A;  3IAP A;  3A21 A;  2A71 A;  2JD9 A;  3ACI A;  5CFD B;  2VOW A;  5LW9 A;  4I0W B;  1BVP 1;  2ZAB A;  2VVF A;  4ZY9 A;  3FC0 A;  2XJT A;  1L3J A;  3VZM A;  1RUI 3;  5B4N A;  5I0S A;  5FQ0 B;  3KS7 A;  3OOX A;  4HSL A;  1C1L A;  1W6Q A;  3BU7 A;  2R6Q A;  5CFD A;  3TN9 2;  1COV 2;  5A7P A;  3DYP A;  1JUI A;  5BNP B;  2E33 A;  3WUC A;  4NHM A;  1JXN A;  2VZV A;  1SHW B;  3FFZ A;  2IZW A;  1WMF A;  2AR6 A;  5KHK A;  1AYN 2;  5T5J A;  3VD5 A;  3MO4 A;  4JKK A;  3THD A;  4N53 C;  2D7F A;  3DXU A;  1VB4 A;  4U36 A;  2VQU A;  1RVF 1;  1VAV A;  4YGC A;  3ZYH A;  2ZTN A;  1F8V A;  2IFR A;  4LIU A;  1D4M 3;  3CJX A;  1VMF A;  3VHR A;  4O65 A;  3ATG A;  4NID A;  4F7Z A;  2GNM A;  1E5H A;  1SCR A;  3I7D A;  3CJI B;  4Q4Y 3;  2OVU A;  3MID A;  3I4I A;  1IQA A;  3MW4 A;  3WOG A;  3TYJ A;  1AR7 1;  4MH0 E;  3UGG A;  2CNA A;  2VC9 A;  1XE0 A;  1U0A A;  1YUD A;  1EPZ A;  1ZVF A;  3PNA A;  3VBR C;  2PHT A;  4LIT A;  3W59 A;  1I5P A;  1JUH A;  1W05 A;  3ST7 A;  4DO0 A;  1OOP A;  3FLT A;  1A78 A;  1XYN A;  4ES9 A;  4X6R B;  4DNY A;  4R9B A;  2BTV C;  1W2N A;  3RYK A;  4OLL A;  1WCK A;  3J8F 1;  1F5J A;  1RIT A;  1R64 A;  1FXZ A;  3DGT A;  3AK0 A;  1JZ4 A;  1PMI A;  1AX0 A;  2E53 A;  1CON A;  1V70 A;  2UWA A;  4HXC A;  4M3C B;  4C0H A;  5DAW A;  1SFN A;  1N1Y A;  4HL0 A;  1FOD 2;  5FYY A;  2A3X A;  3GBW A;  5C7G A;  2WWJ A;  3M7A A;  2WNU B;  5C9A A;  3O1V A;  1MQT C;  1AJO A;  2R7E B;  1G9F A;  3NNJ A;  4ASK A;  4CPB A;  4TTG A;  3ZFF A;  4GJZ A;  2WAB A;  4ZU7 A;  4FPH A;  4Q4V 3;  4MOA A;  2W1Q A;  3OY8 A;  1B09 A;  2GMM A;  2X5I C;  3VDB A;  1CZT A;  4I0A A;  4P08 A;  5GLW A;  5A7W A;  5ABJ B;  3RDI A;  5FUI A;  3U37 A;  3VBH C;  4Q4W 2;  3BTX A;  1JN2 P;  2D6N A;  3R0R A;  1JU4 A;  1ND2 C;  1XE7 A;  1FNZ A;  4BQ5 A;  3WP5 A;  1QJY 2;  4QAW A;  2JEN A;  4Y20 A;  2JB4 A;  1C8M 3;  3BIE A;  5CZK A;  1AL2 2;  2VBD A;  5T3N A;  5L7O A;  1XSR A;  1UZZ A;  2MEV 1;  4CXW A;  4KWK A;  3KLS A;  1S2B A;  2OZJ A;  1UY4 A;  5JR7 B;  4DB5 A;  1FI2 A;  1SLT A;  2P6C A;  3LA7 A;  4EN7 B;  1UOG A;  4M3C E;  2WZR 3;  3LF7 A;  5FPA A;  5JI9 A;  3MHZ A;  5ERL A;  3MPP G;  3M3C A;  1OD5 A;  1QXR A;  5FQ0 A;  5A33 A;  2E9Q A;  4RFR B;  4W6W A;  1ZBA 2;  2A6W A;  3POJ A;  4IV3 B;  4FBF A;  2DUQ A;  1UZW A;  5CFC C;  3IBM A;  3SKV A;  3D82 A;  4NUB A;  1UAI A;  3HNB M;  1WCD J;  1NA1 B;  3K46 A;  5DXD A;  4XIL A;  3AP4 A;  4NE9 A;  1K3I A;  1RJ8 A;  1FAT A;  2VUL A;  2CAV A;  2ENR A;  5KXD A;  2RS3 1;  2JDN A;  3V64 A;  4LOS A;  1N1T A;  4TXW A;  1O3R A;  5FP8 A;  2XKP A;  4LO6 B;  4URT A;  1OF4 A;  2RE9 A;  3VB9 A;  4AVB A;  1RUN A;  4XF0 A;  1F31 A;  5CFC B;  3VBS B;  3ZPY A;  1OQD A;  1DIW A;  1XSQ A;  3IPV B;  5FZ9 A;  3LDR A;  1QXP A;  4QHB A;  1ENQ A;  1DQ1 A;  1WBF A;  1YJL A;  2RR1 3;  5BYN A;  2VVE A;  4I02 A;  3EQE A;  4AI9 A;  1ND2 B;  5LK7 B;  4ZXE A;  3C7G A;  1KJL A;  4YRD A;  5LRR A;  2BBA A;  4B1M A;  4YGE A;  5A6Z A;  3MIG A;  2P4E A;  3HVD A;  4CCO A;  1ENR A;  1RUJ 2;  2GZW A;  1LRH A;  1CAX B;  2XUE A;  4IUG A;  2WAO A;  4ET7 A;  2YFU A;  3WW2 A;  4FPY A;  2CYF A;  1G6N A;  3KZ4 C;  1V6M A;  3I3Q A;  4LBQ A;  2JB8 A;  3KT4 A;  3RWK X;  3UNP A;  2WRA A;  2BNM A;  4CYD A;  1HX6 A;  1HRI 1;  4L99 A;  4Q0S A;  4QDR A;  4HSJ A;  4RS5 A;  1ASJ 1;  1O4T A;  2DTY A;  4H55 A;  1NXD 1;  2HEV F;  2HWC 1;  3CHX A;  4D7Y A;  3MZH A;  1SZB A;  2YDE A;  1IQD C;  4QPI C;  3V0A A;  3U1X A;  1BYH A;  2EXJ A;  1RUF 3;  3D3A A;  5AC9 3;  4QU1 A;  1MS3 A;  2XLG A;  4QX2 A;  3VHP A;  2ZGL A;  1LOD A;  1W6M A;  2IFW A;  4JTN A;  4Q5O A;  1AR8 1;  1ACC A;  2SBA A;  1Z7S 2;  3DV8 A;  3LA3 A;  4LBQ D;  1W6O A;  5FYU A;  5L19 A;  1WZX A;  1WW4 A;  3CIH A;  2XJP A;  3VHN A;  3USU B;  1O4Z A;  4JDO A;  5E16 A;  4PQQ A;  4UWD A;  4ATE A;  3TN9 1;  3O1U A;  2IXC A;  4E2G A;  4GH4 C;  1RUO A;  5D8A C;  4K8F A;  4XFF A;  5K8S A;  1SLL A;  2WYF A;  1L7L A;  3WXP A;  2WNU C;  5SV8 A;  3RYP A;  2VZT A;  5FLJ A;  1POQ A;  3OD4 A;  4AGV A;  5T5O A;  4ASM B;  4OHV A;  5DG2 A;  3EHK A;  3P3N A;  5C71 A;  4UAP A;  3VV1 A;  1CAU A;  3TEZ A;  4Q4W 1;  5HCA A;  1H9P A;  1E57 A;  1LGC A;  4Q4X 2;  4Q4X 1;  4LBO A;  1TVG A;  4HK9 A;  3ZLI A;  4AI8 A;  4E8C A;  1YJK A;  4Y1U A;  5F3G A;  1RIR A;  1ODM A;  4X6Q B;  1RYY A;  1V6N A;  1W0P A;  2OA2 A;  3NAP B;  1FX5 A;  1AXY A;  4GWM A;  4IQP A;  4JKM A;  4Q0U A;  5F3C A;  5CG9 A;  5GLV A;  3TRS B;  3ON7 A;  4Q2F A;  3T2P A;  1AXZ A;  4B7K A;  5LBE A;  1AX1 A;  2HH9 A;  1MEC 3;  1ND3 B;  4ZON A;  4JDM A;  4OHY A;  4XEZ A;  2PLV 1;  5BNN B;  1XBF A;  4JQT A;  3ITQ A;  1PM4 A;  2BZD A;  3OGV A;  2WS9 2;  3H3L A;  1XYO A;  3WNK A;  5FWJ A;  2WJS A;  1OPM A;  1QJZ A;  3MW3 A;  3K2O A;  5FY4 A;  1W99 A;  2ID4 A;  5DUU A;  5FYB A;  2Q8E A;  4O9G A;  5FRA A;  5FZ8 A;  2JEM A;  4CSW A;  4KI5 M;  4JCK A;  4YVS A;  4OMC A;  1V00 A;  1QJY 1;  3JBG 3;  2WL1 A;  2ZGK A;  4IEV A;  4AVC A;  3R4U A;  5JOZ A;  1DG6 A;  1RMU 2;  1QEX A;  2D40 A;  4OI2 A;  1JW6 A;  1OFN A;  1RUH 3;  1VAL A;  3FE5 A;  1Y9M A;  1WUV A;  5B2G B;  2P2K A;  2R04 1;  3ENR A;  3ILF A;  4AWD A;  5JLV A;  3FBM A;  1UXZ A;  4EN0 A;  2Q1M A;  2E32 A;  4IW3 A;  3T4H B;  5FFO C;  5J36 A;  1RUG 1;  3BGA A;  2ZKL A;  3B00 A;  4WZF A;  3VZL A;  1WMD A;  2JKX A;  2RS1 3;  5JVV A;  1OLQ A;  3K51 A;  3D0J A;  4D6Q A;  1PGW 1;  4HK8 A;  2W5F A;  3IMM A;  3ZFE B;  4D69 A;  3P5B A;  4D7T A;  1Q3E A;  1YXW A;  1HB3 A;  5IK7 A;  5BNQ A;  3SH5 A;  5FJK A;  2VNV A;  3H9A A;  2J1S A;  3H8U A;  2RDQ A;  1AYN 1;  4RGG A;  3WF4 A;  1CD3 G;  2ORZ A;  2J1U A;  5HI0 A;  2FDJ A;  2RS3 2;  4G4F A;  3HQU A;  4CUC A;  2LTN A;  1YQ8 A;  3CZU A;  5LAS A;  5A3M A;  1ZRI A;  4RR3 B;  4E4S A;  2YXS A;  4MYE A;  1SDW A;  5KHG A;  1VBE 2;  3ZVX A;  2GN7 A;  2HWC 2;  4XUR A;  2JG9 C;  1GFF 2;  2R07 3;  1XNB A;  1ZM1 A;  1G8W A;  1FNY A;  4RL7 A;  3NO8 A;  4CUG A;  3RZL A;  1QKQ A;  2VG9 A;  4CZS A;  5FZ6 A;  4NAO A;  2GMP A;  2DVB A;  2RJK A;  4NRQ A;  1RUG 2;  1DFQ A;  5FKB A;  4PLN A;  5JWP A;  3AL5 A;  1RB8 G;  1IGO A;  3POW A;  3PU3 A;  5J48 A;  4YW2 A;  3H50 A;  1Q8Q A;  4IEQ A;  1X33 A;  1RUJ 1;  5A1A A;  4HKL A;  2Q8O A;  3GXU A;  2OX0 A;  1UW8 A;  1REF A;  3LWC A;  4DY3 A;  3VD4 A;  1YI9 A;  2V73 A;  1XQN A;  4XF1 A;  3TB0 A;  1VBD 2;  2E7A A;  1HQL A;  1LHV A;  3MIH A;  3ZN4 A;  4XBL A;  1D4M 2;  4PDW B;  4ZKT B;  1HQN A;  1RUF 2;  5IUQ A;  3KVB A;  3O1R A;  3M3I A;  4YVW A;  4AFD A;  2E31 A;  3J7M A;  3NAP C;  4MHR A;  4E27 A;  1G9C A;  1VJ2 A;  3UGH A;  3WCR A;  1VBB 1;  3ETQ A;  1JZ6 A;  1DQ0 A;  2LRO A;  1JBC A;  4LO4 B;  2PAE A;  1MS9 A;  2IXK A;  5FZ0 A;  3BOP A;  4AQ6 A;  4GQ7 A;  5AC9 1;  3GDB A;  1GYK A;  2R49 A; 
#chains in the Genus database with same CATH homology
 3BVC A;  5LBF A;  3NNM A;  5LBE A;  4ZON A;  3EMR A;  2OPW A;  2G19 A;  4BQW A;  3ITQ A;  5LA9 A;  4MHU A;  5DAV A;  4ZPI A;  5C5T A;  5IAX A;  4J25 A;  4NMI A;  3GJA A;  5L9R A;  5DAQ A;  5ERL A;  5LAT A;  3W20 A;  5HV0 A;  2A1X A;  5EPA A;  4BQY A;  3GJB A;  4XAC A;  2RG4 A;  5L9V A;  2RDN A;  3GZE A;  5C5U A;  3NNF A;  4XAB A;  4Y5S A;  5LB6 A;  2Y33 A;  3PL0 A;  5EQU A;  4NHM A;  2RDR A;  4BQX A;  3NNL A;  4IW3 A;  4NHL A;  5IAT A;  3KT7 A;  4NHK A;  2JIG A;  5M0T A;  2Y34 A;  5HV4 A;  4XAA A;  2FCU A;  2RDQ A;  4NHY A;  3KT1 A;  3OUJ A;  4Y5T A;  3HQU A;  5LAS A;  3MGU A;  3KT4 A;  3OBZ A;  5IAV A;  4XCA A;  5DAX A;  3OUH A;  3HQR A;  4KBZ A;  4NAO A;  3W21 A;  2G1M A;  4Q5O A;  2RDS A;  3OUI A;  2V4A A;  5DAW A;  4UWD A;  2HBU A;  5LBB A;  3NNJ A;  4JZR A;  2FCT A;  5A3U A;  5LBC A;  4XC9 A;  5DAP A;  4MHR A;  2HBT A;  5EP9 A;  2JIJ A;  4NHX A;  3DKQ A;  4XCB A;  5L9B A;  2FCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...