3ITQA

Crystal structure of a prolyl 4-hydroxylase from bacillus anthracis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
198
Chain Sequence
b'KEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLADVNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolyl 4-hydroxylase, alpha subunit domain protein
publication title Crystal structure of prolyl 4-hydroxylase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 57
structure length 198
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3itqA01
5EP9A 5L9RA 3KT7A 2RDRA 4NHMA 5EPAA 3NNFA 3PL0A 4J25A 5LBBA 2JIJA 4Y5TA 2FCVA 5IAXA 2Y34A 2HBUA 5EQUA 4ZPIA 2JIGA 2A1XA 3W20A 2OPWA 5A3UA 3GJBA 2FCUA 5L9BA 5LATA 4BQXA 3NNMA 3GJAA 4NHKA 5LB6A 3EMRA 4XCAA 3HQRA 4NHXA 3OUHA 4ZONA 3MGUA 4XABA 5DAXA 2RDNA 3DKQA 2G19A 5IAVA 3ITQA 4NHYA 4XCBA 3NNLA 4NMIA 5C5TA 3KT1A 3W21A 2RDSA 5ERLA 2V4AA 2RG4A 3OUJA 2FCTA 4XC9A 3OBZA 4MHRA 5DAPA 3BVCA 4BQWA 5HV0A 5LBFA 4KBZA 5HV4A 5LASA 2G1MA 4NHLA 4MHUA 5L9VA 2Y33A 4BQYA 4IW3A 3OUIA 4JZRA 5LBEA 5LBCA 5M0TA 3GZEA 5LA9A 2RDQA 4NAOA 3KT4A 4XACA 4XAAA 3NNJA 4UWDA 5C5UA 5IATA 4Y5SA 4Q5OA 3HQUA 5DAWA 2HBTA 5DAVA 5DAQA
chains in the Genus database with same CATH superfamily
4U36A 2VTXJ 4XJAA 5LWBA 1RINA 3ETQA 4XAEA 4XVHA 1AX1A 1MZEA 3KM5A 4E4HA 4UT5A 4JHZA 3OEAA 1GOHA 3R4UA 3H8RA 1JYWA 2NQYA 1G9BA 2VZSA 1PK6A 1L7RA 3ZIXA 3GCXA 4Z2AA 4BA6A 1DZQA 4I02A 4Y22B 3ABZA 4IEOA 4QM8A 4GJZA 5CYYA 3ZSEA 2VL4A 1LB2A 3SCHA 1EPWA 3LCPA 5A7QA 1CGPA 5FO7B 1SCRA 2R1BA 3EXUA 4Y24A 4E2QA 2JDAA 3QBQA 3PU8A 1VLNA 1DQ5A 2IXKA 3GALA 5JXJA 4CP2A 1Q8PA 1NXMA 3B9IA 1HDKA 4YGCA 1KD7A 1CAVB 2PXJA 3MW3A 5F2WA 3POFA 2WQ8A 3BB6A 4GXLA 3QH6A 1DDLA 3U1XA 3N9LA 2XQRA 3VZJA 4CP9A 1FNZA 5FOJB 4QPGC 1RUD1 3BOPA 5DUWA 5LATA 5GZFA 5IVFA 1GMMA 2N7GA 1BKZA 4N53B 4QT6A 3OD4A 4QX1A 1Y9QA 3N9NA 4RGGA 1H2KA 4MGZE 3ZXEA 4CCLA 4CUGA 3D4KA 3TEYA 3P5BA 4CXWA 2HWB3 3RG0A 2YGMA 3KVBA 3IDBB 5C9AA 1JZ7A 1GP5A 5FZ3A 3WDTA 2ZGTA 4O65A 5FO9B 3NVCA 2JKXA 2WYFA 1OVPA 5KHIA 1M4WA 3KV6A 2J42A 4IGQA 3ETPA 5K0UA 1NKGA 2DCTA 5CB7A 4NIIA 4XBNA 3LDBA 4AGVA 3UGHA 3WP4A 3BTAA 2VW0A 2Q8DA 4BISA 4Q4W2 4D6QA 2ZGOA 5FYMA 1PMJX 1DQ0A 3BGAA 2HWB1 3RZHA 3ZYHA 1US2A 3UYJA 1VBC3 3ZPYA 2ZMKA 2WZR2 3KHBA 1QOTA 5J36A 1O4TA 3WNKA 5LA1A 4KWKA 1ZRFA 1UL9A 5BNNA 4P9WA 5FPVA 4FCAA 2E6VA 1RHI2 4ITCA 2WNVB 4AYUA 1TME2 3DKWA 4P08A 5LK7B 3TRSB 5FY7A 4N9HA 3HJRA 4XZPA 1VMHA 3OGRA 3S7IA 3WHUA 2W5FA 1GU3A 4ARXA 4F7ZA 5BNPC 1BJQA 1VBC1 4DEVA 3J7MA 5ACA2 3IBMA 1RC6A 2Y33A 5FXZA 5C4WA 2IFRA 3N7JA 1OLMA 3HNYM 5F6KA 3JU9A 3LQCA 4RHV3 3PHMA 4OHYA 3BU7A 3DEMA 1FT9A 2XJQA 4CU6A 5I0SA 2DVAA 2BGCA 4LBQA 4EZ4A 5GZGA 1W0PA 3VDDC 3KS7A 4YM0A 2XONA 5I0DA 3GM8A 3MIFA 5G04L 3M3QA 4OZOA 5D21A 2BW8A 2VTFA 5JDBA 1K5MA 1LTEA 5KC6A 1HLCA 4D0QA 3LWCA 2ZHKA 1GYKA 1OF4A 5DAVA 2Q0AA 2C9KA 3ZN6B 4AI2A 4XMAA 4EN9B 3H8XA 4YSFA 1R093 4RHV1 2IUWA 3KV4A 3LEIA 3FE5A 3ACHA 2WINB 3FFZA 3LD8A 2YFUA 1STMA 3A22A 2I2SA 3O1SA 3O1MA 2HJIA 4GH4A 4Z1VA 5IWFA 3N9OA 2LROA 3CQOA 4GJYA 2UYBA 3SH5A 2Y64A 4XIOA 2J22A 3OY8A 4RS5C 1POV0 1R082 3HBKA 4YM2A 5FZOB 1S0BA 2E7AA 2VZOA 1VBA2 5DXDA 4UBHA 1R091 1F15A 4IV3B 1I9RA 2CGPA 3V0BA 4COUA 4WBBA 4I0WB 1RUH3 4JGZC 3FUOA 2GP3A 2P3YA 4GMP0 2A3XA 2WDBA 4DIQA 5FY8A 1AYM2 2A6VA 5JMOA 4M3CB 1K42A 4DNYA 2J1AA 3J8F3 2LW8A 1W8FA 1GV9A 5DZEA 1JYCA 5F5IA 1J1LA 4QHOA 4EYUA 1XXNA 3M70A 4AW7A 5FQ0A 5DZGA 2EXKA 3H0OA 3PVEA 4R4XA 4OMDA 2ZAAA 2R043 1DHKB 1RUH1 2JG8B 5FIXA 1W2AX 2XL9A 5IK8A 1H4GA 1XYPA 1HJGA 1QH7A 3ZVXA 2BVBA 1H6YA 1DGRA 2RDNA 3GBGA 4XXPA 3J8F1 4M3CE 4MGTA 3V0AB 3VKOA 4ZU7A 2OW4A 1DYPA 2JDNA 5BNPA 1UOFA 2OA2A 4LBQD 1VRH1 4I3PA 2FDJA 2UWAA 5JSRA 1M06G 2R073 4QB6A 4AXOA 1H6XA 5IVBA 3MICA 3OSDA 2D5FA 4HZFA 2R041 1XQNA 4I2OA 2ET7A 1JUHA 1FMD2 2VZ1A 3KV9A 4YGDA 4JCKA 4ZKTB 5C3QA 5C3RA 3ZDSA 1C5IA 3KVAA 4GWNA 4GULA 1JU3A 1D4M3 1W9WA 3CNAA 1UO9A 3VDDA 4AFDA 2ZCWA 2PYTA 2OYZA 5JLVA 3TWIA 2XGXA 3HR9A 2R071 3L9JT 4C1XA 4KBZA 5HV4A 3RQ0A 4CUCA 4IUGA 4EZHA 3I2FA 4FPJA 1TG7A 3OYWA 1W03A 4MHUA 1W06A 4MVTA 4OHXA 5DMYA 4R52A 3PVBB 4IQPA 4LT5A 5GLWA 3RRDA 4Q27A 2PMWB 2YC0A 1D4M1 1HRI2 4ET7A 2TUNA 2DWRA 4CSWA 2BQPA 4S2GA 3FHQA 1Y3TA 4XW3A 1PK6B 1PZ7A 1LRHA 1RXFA 4E2SA 3QD6A 4A4AA 1PM4A 5J37A 1WGPA 5DABA 4MXVA 3O0XA 3HOBA 4XJ8A 2VO5A 3BU0A 3UETA 3K3OA 4HK9A 1YQCA 3ES4A 4Q5OA 4HOOA 1PO11 1GP6A 2SBAA 3AJZA 3AP9A 2R0FA 4JGZA 1X8MA 4H7LA 4UW3A 1H0BA 2QFEA 1B35C 2ARXA 4OI4A 1NAEA 1ULOA 3ZSJA 1C8M2 4WZCA 4CP9B 3IPVA 1GWMA 2ZEWA 4QQLA 5CFCA 3PL0A 3VB9A 2C24A 5F37A 2WAAA 4PQQA 1JOPA 1SDDB 3P3NA 5JR7B 2XG3A 2GSYA 2JWPA 4FPKA 5F2SA 2DVBA 3I2IA 3NSTA 5FZGA 1YYNA 4GALA 4LNVA 1Q8QA 3PUIA 1CN1A 2Z4FA 2EIEA 5C9AB 2YBSA 1ZBE3 3P3PA 2MHFA 2XVKA 4AEKA 4XE9A 5FPXA 1PM7A 4PDWC 4YW3A 3WEZA 5L19A 1Y43B 5EV7A 3MV01 4PLMA 1RUD2 2VCAA 4A7KA 2CHHA 1OLRA 3N9PA 4JRAA 4FFHA 4DRVA 3T3YA 1QNWA 1VBE2 3GJBA 1GWLA 2PTMA 3AB0A 3N7MA 2B45X 3NNMA 4ZU4A 2BNNA 4ES9A 4IEPA 4NRMA 2W95A 2ZPXA 5EIYB 1BMV2 3T2QA 4LIVA 3T4VA 3VZOA 3WSOA 1JOBA 1ZBE1 5GLUA 1VB2A 3LIGA 1VPHA 3FHIB 1PGW1 3TYJA 3CF6E 1HX6A 3MLKA 5KWRA 1HV1A 4XQWA 3ZYIB 5FP8A 3TN93 2P37A 1GNHA 5H9RA 2JDYA 1NQDA 2PHDA 2D7FA 3LA3A 3MF6A 4CZSA 4C0HA 5BNNB 1OPOA 2XWJB 3ZDVA 3UJOA 1LHNA 4MGIE 2J1UA 3N35A 5CNAA 5AVAA 5A7NA 4UYBA 1A8MA 2WABA 3CJXA 4R9AA 1PGL1 4XJUA 3DGTA 3LSDA 3HNBM 4KG0A 1S0CA 3I2DA 4JGYC 1CAUA 1UIKA 4NHYA 1X82A 2PAEA 2EIGA 4H55A 4Q4Y3 3SNMA 2NMNA 4XTMA 3MIGA 5K4LA 4X8NA 5C5TA 2ENRA 5GZDA 3AP6A 5SV5A 1FOD2 3TN91 2A6XA 4JTNA 1WMFA 3UV9A 3WDXA 4IERA 1X8EA 4NAMA 4QMAA 2DBNA 4FXGB 4IESA 2XJSA 2J1VA 4OI2A 1BVVA 1REFA 1SLAA 3POIA 3USSA 2KM2A 4LBQB 2FDHA 4UFLA 3AKTA 4AHWA 3MW4A 5BY5A 2HWF3 2DFBA 5CA6A 4BQWA 3HN3A 3D5OA 1VBC2 1UZYA 2MNGA 4Q4Y1 4W4ZA 3AMPA 4LHLA 3C7EA 3FJSA 5LY2A 2GNMA 3VL8A 4YLZA 2QQJA 4C8DA 3LOBA 1KFUL 5FFOC 2NMOA 3HVDA 3TEZA 3RWNA 4QPGB 3DXUA 4HVOA 1W04A 1CWPA 2IVIB 1UWWA 3NL1A 4L97A 3NMBA 4N90A 1TNRA 4GH4B 5FZ7A 2JDKA 1ULPA 2BFUS 2HWF1 2WN3A 1WCDJ 2VG9A 5HXVA 5FZCA 1J83A 2PLV3 1IKPA 2LM3A 3OY8B 3C2UA 4K40A 4ZS3A 1RMU1 5LRRA 2X10A 4LORA 4PDWA 2GMPA 2FDGA 1HXS1 2JDZA 4HMZA 5BYNA 4LO8A 1XU2A 3W9AA 4P9LA 4RHV2 1CAXB 2Y6KA 2YC4A 3ES1A 1YQ2A 4HN0A 3UL2A 3O1RA 1PVC2 1HB4A 3AMHA 1UX6A 3AFGA 3I2GA 4YRDA 3AMNA 3LEMA 4FOYA 5FY4A 5CEHA 5FJKA 3O1VA 1RUE3 1PX3A 4RR3C 1AYN1 3ZSKA 1DGWA 2PLV1 3KWVA 3ROUA 1ZREA 3ZYPA 2JDMA 2FHRA 3RJRA 3E5XA 1IS6A 3I2KA 1Y9MA 3D0SA 3MLLA 1Y7BA 1DU3D 2YBKA 5FQ0B 2Z42A 4LEJA 5T5JA 2FDKA 1R092 1SQ4A 3PJQA 5IUQA 1DQ4A 2E7QA 5LA2A 3DXTA 2VMEA 4HONA 4LKEA 3M2MA 4QX2A 2XB6C 3IT8A 5KC5A 4QPIC 1OQEA 3NAPC 1IPSA 1HRV3 1JODA 4AI8A 4BIOA 2HBUA 1RUE1 5EQUA 5EHDA 2C1FA 5KHKA 4AVTA 3BIEA 1W6QA 5IK5A 1XB9A 2YG0A 1BEV3 4B4RA 5BNPB 1YNAA 5JSOA 1XNAA 1NCRA 1Z78A 1LEMA 1F4AA 4Z2WA 3POEA 2ORZA 4ZXEA 2WLPA 3C3VA 1CJPA 3EYPA 3VZKA 5FUIA 1LR5A 1XYNA 4LA3A 4FTEA 2B9UA 2ZX2A 4XQ4A 4RA0A 1HRV1 2VAUA 2QQWA 2B39A 3O1PA 4HANA 4ZONA 3JZVA 3VBSA 2YPDA 3VDDB 2VOVA 4AI3A 4E9KA 1Q56A 5DAXA 1KRIA 4TTGA 3K2OA 1AX0A 4ZXKA 3LEGA 4FFIA 5HI0A 1VRH2 1V9U1 1O59A 2XUEA 4YNIA 4DINB 3P1IA 1OH4A 1PO23 2GP5A 4QKBA 1UY1A 1BK1A 4XUTA 1DP0A 3OYWB 4IEVA 4AG4A 5FDBA 5I8TA 5JXIA 5A3LA 2W68A 4FFFA 3CZUA 4A7ZA 1VBB1 5D8AC 3KQRA 3MIHA 3RSJA 3TOJA 4B7EA 1AR82 3F95A 4QGLA 2Q1FA 4AAXA 2Q8OA 4ZZ5A 4CXYA 3VKNA 3MIDA 1EAH3 4XF9A 3RZMA 4AFCA 2R072 5FJHA 1G7YA 2D3SA 1WWYA 1PO21 1LGBA 3GGLA 1US3A 2H0VA 4XUPA 2W94A 3O7OA 4AHXA 1CQ9A 1DGRN 1V70A 2QQNA 5LBFA 2ZKNA 4NWVA 4X8PA 5LASA 1ZZ9A 4QX8A 1HQWA 2WYSA 1YWKA 3NJYA 4JGZB 4LE4A 4XOGA 1G9FA 2V09A 3SQOA 3EB7A 1IKQA 3MV11 1S2KA 1CONA 4DY5A 1DLCA 1HQLA 1V6MA 2D6PA 2W87A 3H9AA 5K7PA 4QX3A 1QOSA 1EUUA 3IPVB 3HPNA 1OKQA 4KU7A 1EAH1 4JZRA 4YZ3A 1LJ7A 3OBRA 4NUBA 4Q4V3 2VQUA 1DQ2A 4QD2A 5JXGA 3U11A 3CJIC 2GMMA 1OA2A 1VAVA 3NJZA 2RDQA 1NA1C 3ZR6A 1PO12 2E7TA 3J7LA 4XFAA 4XACA 4CPBA 1E5IA 1JU4A 1AR61 2HWE3 1YQ8A 2RS32 3NNJA 4JDOA 5LK5A 2R0HA 4EN6B 1A6CA 4RQPC 2GAUA 2P3JA 4LK7A 2ZBJA 4Y5SA 1JTZX 5I8SA 4FSJA 4BLIA 4DFSA 5IK4A 4L0PA 2WNEA 1AL23 4LR4A 5EP9A 1NE4A 1GR3A 4NR1A 1VMFA 3MW2A 4Q4V1 1PVXA 1Q3EA 4XF4A 1QXRA 4R9BA 5DQ0A 3QCWA 1SG3A 5IVEA 4EN8B 2WO3A 4V2WA 4EE2A 2CY6A 2HWE1 1JHNA 3HAGA 4JDMA 1KJLA 3TB0A 1JYNA 4OUMA 3UJQA 4QGMA 4H3WA 3LA7A 2AENA 1U5ZA 1XE0A 4GB32 4IXLA 2PQSA 1ZA4A 2E26A 3IM0A 1TEIA 1YUDA 3GDBA 4PCRA 1GZTA 2X5IC 3PUAA 1HN0A 3D8CA 3I49A 2CTVA 4IEQA 2JIGA 2CDPA 1BBT3 1Z7S3 3KGZA 4KBBA 4J6GA 2GC1A 3B94A 4J1XA 2DUPA 3C7OA 3KCCA 4Z07A 1MS1A 1SMVA 1ZBE2 4G3YC 1CAUB 3ZXDA 1UF2C 2J1TA 5ABJC 3UNPA 1PGW2 3U78A 4Y1ZA 1F8VA 4FPCA 1N3QA 3INAA 4XFBA 3U75A 5FPAA 1J59A 4D6SA 1BBT1 3POYA 4XABA 1FNYA 3BOWA 4S2DA 1OURA 4AFBA 4AHZA 1K45A 1PGL2 1C28A 1DQ6A 5JPMB 5CVRA 2WO2A 3DYOA 2FDIA 2KD7A 1Q43A 2G19A 4YW4A 3NKTA 3DYPA 4CUBA 1MZ5A 3JXSA 1B35B 2ES3A 4D7YA 4CPBD 5FYCA 2HWC3 4CUAA 2EAKA 5AFEA 4A44A 2ZA9A 2WFPA 2VM9A 1BK0A 2VVDA 1GFF2 5FUNA 2C0ZA 2O1QA 2WO1A 4IE0A 1NE6A 1YFYA 4KH9A 1H8TC 3ZXGA 1NA1A 1QNYA 3URFA 4QQPA 4NIAA 3OUJA 2FCTA 3VHNA 5HBAA 5D1IA 2VGDA 4HXCA 4FO9A 4RQPA 3T4HB 4XF0A 4PDWB 3ZXKA 2XMLA 3ZPOA 2MEV1 1SEFA 2G9GA 1ODMA 4MX3A 4MGQA 2IXLA 4ZU5A 3KZ4C 4W50A 1O8PA 1NOVA 2Y6JA 3OEBA 1GQGA 4M3CA 1R1A3 1OD3A 5LZ6A 4PF1A 1IOAA 3WV6A 3TNPB 2RS13 1F4HA 1FYUA 4Q0VA 1H2MA 2W1WA 1UQXA 2X29A 4IEWA 5FXWA 1JS9A 2PN5A 4A7YA 1B09A 2ARCA 4W65A 4YW5A 1ASJ3 1CX4A 1REEA 1S1AA 2HEYF 3N36A 3VL9A 3B00A 5L7OC 4B7KA 1J3RA 1RMU2 4Q2FA 2VBPA 4QKFA 3H50A 5DDJ2 1HXS2 1W2TA 1YRZA 2JG8A 3WHTA 2AZ5A 2H0BA 2Y6GA 1RB8G 1DGLA 1IS4A 4UWDA 3HMYA 1R64A 1W8NA 1R1A1 4E4DX 3WD5A 3UGGA 2VNRA 2WT1A 2X5IA 1XNKA 2QQPA 1Q5OA 1S2EA 2B5HA 4YVWC 4P5YA 1ZZ8A 3VZLA 3AL5A 2OIIA 3CU7A 3VD5A 4AK3A 4URAA 1PIV3 1AYN2 4AAPA 4Q1PA 1PHMA 4F8AA 4COZA 5FP4A 1XBFA 2W46A 5FZ6A 3VBRC 2ATFA 4J25A 2OS2A 2VR4A 4A41A 5ABJA 1QHDA 4AVVA 1QJU2 3C8XA 1DGWX 2V72A 4N7UA 1UYXA 4QQ2A 3VBUA 3Q8FA 1RVF3 4XJZA 1A78A 4BLJA 1VMJA 1YHFA 5FMOL 1W2NA 3CLPA 2ETEA 5FXXA 3WP3A 4L11A 1F9KA 5HCHA 1S0FA 2EA7A 3HNMA 4YPJA 1UOBA 2WNOA 1EUTA 5A1LA 3AM2A 4E27A 1TZOA 1W8ZA 4E4ZA 5C70A 1W39A 2Z79A 5F3GA 1AXZA 3RYKA 1XU1A 2GC0A 2IFWA 5GM0A 3BALA 1ND3C 5A3TA 4GA9A 1NUKA 2R063 5FP3A 4GWMA 2V73A 3B93A 3EMRA 4K3UA 4XCAA 2OZ6A 3ZSLA 2E33A 1H8TA 4CDWC 1RUC3 3MDPA 3S6PA 2OVUA 5CAZA 1V6NA 4NN0A 1GZCA 4XEZA 2TBVA 4AEDC 1V9U2 4LBMA 2VZRA 2ZEYA 3WQBA 3GZAA 4IE4A 4P9JA 5T3NA 1JYVA 5GZEA 5JPNB 3ZYJB 1KDMA 1MEC3 2W52A 2UY9A 3WX5A 5FYHA 4AQ2A 4LHKA 2DDUA 1G9CA 2HEVF 1VBB2 4O61A 2WZPP 3AYEA 2PFWA 2CNAA 3IIIA 1PZ8A 2WL1A 1RTVA 2DU0A 5FXVA 4PIXA 4RR3B 3FMGA 2BTVC 1UAIA 1HB1A 4JDNA 1NLSA 2VPVA 4XURA 1YFUA 4QKDA 2X05A 4O9GA 3RMYA 3BYWA 1D0GA 4XFFA 3WDVA 5JIUA 2FMYA 1SFNA 1WMDA 4NPLA 1MEC1 2BYVE 2VNOA 4YW7A 4BJ0A 2PHWA 3AFKA 1ZRCA 1WZXA 5FPLA 1QF3A 3ILRA 1XRUA 2NM1A 3M3EA 4QPIB 2AYHA 4XFCA 4YVWA 5FP9A 5FP7A 3NAPB 3KF3A 4M4RA 2WJSA 1K12A 1WW5A 3ZO0B 5J48A 5JR2A 5ANQA 5FLHA 4NHLA 2EAAA 1W05A 4NO4A 4QHZA 4AQ6A 1EAH2 4TSVA 2CAUA 2ERFA 3WVJA 4DB5A 4W8JA 2I07B 2VVEA 1N3PA 1CZSA 5DG2A 4YG3A 4DXTA 2CGNA 5M0TA 5AC93 1AR62 1W90A 1O3TA 2NP0A 3AVRA 2E51A 4LULA 5F5CA 4AOCA 1CZTA 4ISRA 5HPOA 2ZOEB 3M3IA 2HYKA 4S2FA 3SKVA 4UW4A 3ILNA 2Y6HA 2VMGA 1MR5A 1ND2C 1LESA 1O3QA 2OKXA 2NN8A 2HBTA 3W5MA 1OOPC 1ZBA3 1WCQA 1GUIA 1WD3A 3AL6A 1PGSA 4CCCA 5SV8A 1MS5A 1YIFA 2RR12 4UFHA 5JZGC 4GQ7A 2DUQA 2LUWA 3VDBA 4NHMA 2Z69A 4JKMA 4QHBA 4D7TA 3K46A 2DU1A 5L73A 1ZNPA 2VC9A 2VMHA 4Y5TA 1JBCA 1T6BX 1QGLA 2B42B 2P3KA 5FLIA 3RZZA 3T2TA 5C3SA 4DUXA 2ZKLA 3ENRA 5FZIA 4L2NA 3O0VA 4CEWC 4MH0E 2IXIA 2ZZQA 4CCOA 4AEDA 1ULDA 1GP4A 4IE5A 1RUG3 4JQRA 2Y60A 1MVEA 2FD8A 1X50A 4Q8KA 1RUF3 4KGGA 4DY3A 5CFDC 4A45A 1VRBA 3IKWA 1AJKA 3ZIWA 2AEZA 2MPFA 4JKLA 5A3UA 3WNPA 4YYOA 1WD4A 1VAKA 2D6OX 4QPGA 4Y26A 3TNQA 5JCTA 1YXWA 2VMDA 1BVP1 1OFSA 5A7PA 4META 2QZ3A 4M0NA 2WNUC 4CEYC 3B01A 3PTYA 1WBLA 3L2HA 5KHHA 1ULEA 1D0HA 2GNDA 1MQTC 2FMDA 4AL9A 1BBT2 2NLRA 5JWPA 1W6MA 3WW3A 1QJZA 2E31A 3CJIB 4LUKA 2O14A 3U10A 1NT0A 4OULA 3T09A 1NA1B 2WAOA 3UK9A 4ZZ8A 2WN2A 3O1UA 1VR3A 1WCKA 5A33A 3FLPA 1YLLA 3WQ7A 4DXSA 1CAXA 4RQPB 5DN2A 2VMFA 3MUZ1 1PNFA 2VZQA 4AI0A 1I5ZA 1LCLA 2YUEA 2XLAA 2ZMLA 3LIHA 3VZMA 1WLCA 2QNKA 3SITA 4CP1A 1PMHX 1I3HA 1SHWB 2BP6A 3MFCA 3WP6A 4YZ2A 3HBZA 3MLJA 1UKRA 5FYZA 3WCRA 1VE0A 1FAYA 1WA6X 4AQSA 1YFWA 3MBWA 4COYA 2Y26A 3K4DA 3T2OA 1YEWA 1OH3A 2V4AA 2VH9A 3T0BA 1OQDA 4Z92B 1AR93 2RG4A 3RWKX 2BERA 2MEV2 3OBZA 1O7FA 2VJXA 2A6YA 5FZ0A 1ND2A 5H9QA 3WQ0A 1OOPA 4FP2A 1FX5A 3L2YA 2RM22 3HD8B 1POQA 1RUJ3 2TEPA 2X5IB 2ZMNA 3E5UA 1SDWA 2AEYA 1OQ1A 4HT1T 4UFJA 3WF4A 2XL7A 2IWGB 3DV8A 2E9QA 4PIZA 2VZTA 2XBO3 3ACLA 4ASLA 5L9VA 3VZNA 5B2GB 5T52A 3CZJA 2W0XA 4WVZA 3TBDA 4I0BA 4GD4A 3HT1A 2OQ7A 4Q4X3 2VZPA 5LBCA 5GKAC 5ABJB 2BZDA 2A3WA 4YW6A 4LHSA 1OA3A 3AYDA 3W5NA 1R1A2 2W47A 4Q0QA 5F3CA 2XLGA 3VBUB 5FZAA 3VD9A 1CAWA 3VD7A 4IV1C 1QJY3 2C5DA 2VECA 3HQUA 2XBO1 2A6ZA 5CFDA 2VOTA 2IVJA 3Q8EA 4IL7A 5FYYA 1LU1A 1Z0HA 4QPYA 3UKVA 1X36A 3S30A 1MZFA 2QQUA 5A32A 4YZ4A 4Q4X1 1QJFA 1H1MA 1UNBA 3K4ZA 3O0WA 2Y6LA 2HWD2 1PMIA 4WM8C 3KB5A 4R9CA 1NXD1 2WNUA 3I54A 4FXKB 3GF6A 3FZ3A 3FFQA 1MQTA 4CE8A 4MG2A 2K0GA 1QJY1 4ORFA 5FK7A 1WKYA 2YDEA 4FT8A 5BV6A 1EV12 1H8TB 2IXCA 4IGPA 1CPNA 1LOCA 2WS92 4RS5A 5FMDA 2H6CA 1RXGA 2P17A 2VNGA 4CCNA 4KU8A 4OUSA 4L99A 4YVSC 3RGBA 1LENA 4ATFA 3USUA 4L8QA 4V2VA 4ZPIA 2DVDA 3ZXAC 3NJVA 1FATA 2OUHA 3O1TA 1G8WA 5F9TA 3ZN5A 4MO3M 2CWSA 4LUMA 3MFAA 2WRAA 4AWDA 2Z2SB 2YC2A 4XFHA 1K5JA 1ENXA 3VKMA 1L7LA 4BQXA 4COVA 1CIYA 3F2ZA 3C7HA 3JD73 2Q4SA 1CX1A 1MPXA 3LSEA 2BBAA 4GWJA 4JQTA 3AZZA 4QU2A 4A3XA 1WUVA 5L7OB 3IDEA 3I3EA 4G9SB 1QWRA 4OHWA 1F35A 3R4SA 3A7QA 4DMIA 1S0DA 4XQDA 1NY71 1WMEA 3LEKA 1JZ5A 1W99A 1W6NA 4QB1A 2C4XA 2GN7A 4YZ1A 1GICA 1UU6A 2ZGKA 3APBA 4CP0A 1J58A 4ARYA 5FYSA 4OUEA 4YVWB 2AUYA 3JD71 5APAA 1WCUA 3FUQA 4D6RA 1UU5A 3A21A 4ZY9A 4LKSA 2JKBA 1W9YA 4PI0A 1CESA 5JAXA 1X33A 3WDUA 4NIGA 3U07A 2K46A 5A80A 2XXZA 3LPFA 3WR0A 2OT7A 2QKDA 1MEC2 1NCQC 2VCBA 3T08A 4BQ4A 3O12A 4MGYE 4RD7A 4FTBA 3MF9A 4IV1A 2PELA 4MUVA 4IGOA 4AQTA 4EWDA 5GLZA 1QJEA 5IFTA 3AKPA 3RI9A 4B4QA 4LO7A 4LKFA 4DXZA 3AZVA 1WCSA 3IAQA 4AVAA 2VZ3A 1GSLA 3Q8AA 2JD4A 5H9SA 2OUJA 5FYUA 3H3LA 1LNSA 2HWB2 3VBFC 2LALA 2X8KA 3D3AA 4WM8A 4R9DA 3VHRA 4AF9A 3VD4A 1SLBA 2QQLA 3UGFA 5FOBB 4AFAA 4D7SA 5FPUA 4UI9L 5FKCA 2RHPA 4MOAA 5BUVA 3WF3A 3GHMA 4CDWB 5C3OA 5KXCA 4XHBA 5EYXA 3ASIA 1G6NA 4BB3A 1PZ9A 1AXKA 2ZGPA 1IS5A 1QH6A 4R8HA 4YVSA 4AEDB 4D8MA 1JH5A 2DCYA 3N9QA 5GLVA 3P6BA 4QB2A 4O9EA 1ODNA 1JN2P 3H8UA 4UFMA 2B9VA 1CJDA 4C90A 4OI0A 4Q0PA 3KT7A 2TNFA 1U12A 4IE6A 2QDNA 3DN7A 1B35A 4LK6A 2H6BA 5I8YA 1V0AA 2WSUA 1G86A 5EPAA 1LAJA 1LOBA 4J1WA 4V1PA 2AC1A 5JIAA 4LPLA 3SMHA 1XNBA 1ZRRA 4LMFA 3D0JA 1JYXA 1S0JA 3CMGA 4EWAA 5F8PA 2G9ZA 1S2BA 4CU7A 2RS53 1VBD3 3KV5A 1W6MB 5F32A 3PIGA 3WNLA 3ZSMA 5FY9A 4WV8A 5A33B 4EROA 1UZZA 1ZM1A 2DBIA 1AF9A 2CAVA 1T6GC 1H30A 1O5LA 4A3ZA 1BXHA 2BFUL 2YGLA 4PF5A 2A70A 2FCUA 1G9AA 5DPNA 3M3CA 3MHZA 2RS51 1LOAA 1YC61 1X9TA 4FAHA 1VBD1 4HKWA 3QH7A 3VDCA 4BM8A 1JW6A 5EJZB 3WDWA 5B4XA 4ES8A 3G6JB 2DTWA 5IFPA 1IPKA 3LFMA 1NCQA 5I0UA 3OOXA 1ENRA 4OI1A 3LDKA 1FXZA 4OHZA 4YFZA 3J26N 3BI3A 4M01A 3AMQA 1OF3A 3NJXA 1TNFA 5FZHA 1C8NA 2WA4A 3T1MA 1ND2B 2JENA 3I59B 2Q1ZB 1UY3A 4CDUC 1ZZ6A 2ZACA 3J4UH 1OOPB 1QQP3 4C91A 4E4SA 1IPJA 2Y8KA 1K3IA 4KWLA 4ASKA 5JZGB 2VOKA 3WF1A 2XVLA 4DUVA 3CO2A 1ZA7A 4JGYA 4BQ5A 4F3JA 1JZ8A 4XDQA 3RZJA 3KHCA 4YW1A 3K51A 4QDSA 4N43C 3FHAA 2D6LX 2RDSA 4OQ9A 2W1QA 3WP5A 1RUH2 4FQZA 4DQAA 4Y1XA 2D6NA 1IG3A 5E16A 3S7EA 4QQHA 4Q0UA 4FBFA 3QLQA 4BQ3A 3EHKA 4CEWB 1D4VB 1HQNA 1Y9GA 1QQP1 3RJ2X 1N1VA 2ZEZA 2WQ4A 3H7YA 5CZKA 5FYVA 2BPA2 3J8F2 4P9YA 1CAWB 3IDCB 4C0BA 2ADEA 1BEV1 3KMHA 4QDQA 2VBDA 3SKJE 3MYXA 3VBOC 2BRTA 3BTXA 1KS4A 1UYZA 3DYMA 4BMBA 5A3PA 4S2HA 5CFDB 2D43A 2F17A 3ZFEC 1I1EA 3WQ1A 5A32B 2R042 1EYBA 3OG2A 1QDOA 3ZKUA 2YROA 3DPRC 3ME2A 3OTFA 4NIDA 4PT6A 1XC6A 2F6BA 3ATGA 2WNUB 2GU9A 4QXBA 1UMHA 1MQTB 2GH2A 1MS9A 4NAOA 1UMZA 2CWMA 4BQ2A 2L9LA 4M4PA 3M8LA 2VQAA 4RS5B 1UPSA 3OF1A 4HL0A 5F1RA 5KHGA 3UKNA 4HLTA 3QACA 1H2LA 3I4IA 4MGKE 3ST7A 2XWBB 3USUB 1JYIA 1GOFA 1WLDA 5H9PA 4AGRA 2B46X 4FTSA 4CCJA 1AZDA 2Q30A 1D4M2 4PHZA 3ZMOA 2GC3A 4BMEA 4LXLA 2OQ6A 4XTPA 4I01A 1LHOA 2WQZC 4K7JA 4RR3A 4WVWA 5LBBA 4BWOA 5FO8B 2JIJA 5J98B 4KL1A 3DL3A 1DZRA 3K75B 5CIRA 1EP0A 3M1HA 1POV3 4OQ8A 3S5AA 2BNMA 3AZYA 5IAXA 2NYYA 1V6JA 1W8HA 4Q4W3 4Q29A 5T54A 1UCXA 4LHNA 4IEXA 2XOMA 2PHTA 1XJAA 4BXFA 1W9TA 1LHWA 3PMEA 1UD1A 2BGOA 1W6NB 3VUOA 4QPIA 1LGNA 4Y1YA 3WOGA 3NV3A 4GMP3 4GIQA 3NAPA 4CDUA 1HKDA 2ZGMA 4QX7A 3RDIA 2A1XA 2WZR3 2BV4A 3AZWA 1DLLA 1UYYA 1E5SA 2ARAA 3A0KA 3I97A 5A7WA 3LB9A 3PJYA 5L9BA 2GH8A 2ZGNA 3HN1A 1RHI3 1JHJA 3IMMA 1POV1 1CZVA 4P5HA 1TME3 1W6PA 4Q4W1 4LO6B 5HCAA 4KI5M 4UF0A 4N43A 1LOGA 1BZWA 2A7AA 1GZWA 2RV9A 1C1LA 1FV2A 1NY72 3H1WA 3K3NA 2EF6A 3D82A 4XUOA 1O3SA 3KF5A 2ZX0A 5BNOC 1MZ6A 1COV3 2WC2A 2NPIA 2VW1A 4HG6B 2QJVA 1AL21 4AI1A 3OGVA 1R1ZA 4IV1B 1KXGA 4YM3A 4BQ1A 1YI9A 5C3PA 3VBOA 1RHI1 4MZUA 3AZXA 2VTXA 4UW6A 4URTA 3ZFEA 1J3QA 1TME1 3UKTA 5FRAA 1WBFA 5FZBA 1ZX5A 3JB8A 3THCA 1OA4A 2DFCA 4NMIA 3THPA 4BE3A 3DPRA 3QOPA 4C1WA 3BUCA 3KT1A 4WM8B 4BDVB 1COV1 4JRLA 1ZZCA 3FLRA 4OZXA 3WF0A 5D8AA 3M3OA 5J96B 2W39A 4BPZA 1MS4A 5EWSA 3WG3A 3AKRA 2HKXA 4Q8LA 2ORXA 1H1AA 2QBXA 1O4ZA 2GDFA 4LTAA 2ZX3A 1O3RA 4RGKA 2Z5WA 5EFUA 5FZ1A 4EN7B 2XPJA 1Z7S1 3Q9OA 2AREA 4XJ9A 4MADA 1IQAA 4YVSB 1DYKA 4HSJA 3E6BA 1CVNA 3ZYGA 5HV0A 1Y4WA 1EPZA 4WM7C 2NZ9A 4A2UA 4XDOA 1AX2A 5IVCA 5FZLA 3R05A 1R083 2D98A 3MPPG 3VD3A 2EXJA 3H1YA 3BODA 3OGJA 2R1DA 2YBPA 1VBA3 3TN92 1PX4A 3LA2A 3MPBA 4IW3A 4RGAA 3RZKA 5LBEA 4E8DA 1JZ6A 5CG9A 4K21A 1OLQA 2LS6A 2GZWA 1XNCA 2IC1A 2HYXA 1AYM3 3GZEA 3OPZA 1RIRA 5A7SA 3CJIA 1YJLA 1IHMA 1A3KA 2DCZA 4YM1A 1W0NA 1C3HA 4LOTA 4AVCA 2WIIB 4Q4Y2 1R081 5FZMA 3BTYA 3WW4A 3E6DA 5A6XA 3H7JA 1S0GA 2QQKA 2YYOA 1P8JA 1S4CA 2HWC1 4QPWA 3K4AA 2JJ6A 2VULA 1C4RA 3WF2A 4BZ4A 1QDCA 2A3YA 4HSLA 4IEZA 3ALQA 2GN3A 2B7YA 4Y20A 2HWF2 1PK6C 3DF0A 3S0MA 1SPPA 3POGA 4CCDA 2VNVA 4RFT0 4Z82A 1U0AA 3I8TA 2XJTA 2J7MA 3B69A 3NV4A 1ENQA 4O7XA 5BNOA 1NCQB 3SCFA 4UOJA 2HLEA 2XHNA 5E89A 1H9WA 2WFF3 4GWIA 4QAWA 3AVSA 3H8OA 2P1BA 3GZTB 3JQWA 1UZWA 2DUOA 2XJVA 5J3UA 1FMD3 1GOGA 1VALA 4FPYA 4LE3A 4XDPA 4XETA 2W91A 4Y1UA 3IIAA 1Q8VA 2RS11 1H1IA 2XR4A 1MS8A 2YZ4A 2P34A 3WNXA 1NZCA 4XF1A 2PLV2 1ASJ1 1MVQA 2ZGLA 3MO4A 1ZRDA 2VBBA 1UZ0A 4JGYB 4HK8A 4NRQA 4Y5Z0 5CBLA 2WFF1 1MS3A 1OI6A 5J7MA 4F83A 2GNTA 3NRUA 3WUCA 1YIPA 4I3GA 1SBDA 3GBWA 2BWAA 1OFNA 5FWEA 3THTA 5FY5A 1HRI3 4YARA 1RUE2 3WNNA 1DIWA 2PAMA 1PIV1 2VOXA 3I2JA 2BDRA 4LBNA 4Y33A 1W9FA 1JI6A 3I2HA 4KWJA 5FPBA 5K0UC 4WM7A 2Y38A 4DXRA 1LHVA 2VW2A 4HVRA 1VJ2A 2VOWA 1E57A 1SACA 5FMOS 1GQPA 4MSVA 5FZ9A 2DVFA 4JTOA 1EY2A 2EIDA 3BPSA 4FPHA 3NNLA 4K8FA 5IVJA 5F5AA 4COWA 5JI7A 3E97A 3ZYBA 2AH2A 5KHJA 3CBNA 1RVF1 1DFQA 3W59A 1PNGA 2I45A 1UZVA 1HRV2 4G4FA 4HFSA 1DYOA 1QQP2 5ERLA 3VBHC 1ULCA 2EXIA 2XJRA 2YMZA 4XHXA 1OT5A 4DUWA 5F7UA 3AC0A 3LE0A 1C8M3 5FPZA 1BEV2 4L9BA 2LTNA 4OCTA 3VHPA 3WINE 1QXJA 4WVVA 4A42A 1JZ4A 1A8DA 2E63A 2ET1A 4PIYA 1GQHA 2CU5A 2BWCA 5L36A 2QE3A 1W8UA 1C1FA 3JQXA 3K48A 3OD0A 3LPGA 4K6BA 1W28A 2CSGA 4QXHA 4QKNA 2OX0A 3AKSA 2R061 4P9IA 4YGBA 2QQVA 4R4ZA 5JXHA 1MACA 2UY8A 3H3UA 3POJA 5C4WC 2Y0OA 3RPQA 4UFIA 1RUC1 1H4HA 1C8M1 1N3OA 2R30A 1DG6A 1AXYA 1RUD3 4B1MA 4WZFA 5L7OA 3OGSA 4P02B 1DQ1A 1VBE3 1W3VA 2P2KA 3SH4A 1PO22 4BU2A 2VE1A 2YV8A 4XAAA 2WKKA 2FQPA 1OC1A 5C5UA 5KXEA 1K5MC 2JDUA 1SLIA 3FC0A 1HW5A 3AP4A 4H2AA 1OHFA 1SLLA 4L92A 3LFIA 4IETA 5DAQA 4LO5B 4AVSA 2BVVA 4CDUB 4EJRA 4X6QB 1TE1B 3HWJA 5A7WB 2YPJA 4HBNA 1O4YA 1TMF3 2ZTNA 4PBPA 3ACGA 5BNQA 5IJRA 3NNFA 1FPN3 1DCSA 1ULGA 3IB3A 3VBRA 2GALA 1VBE1 1OUXA 4MV2A 2Y6FA 3OPTA 4GH4C 2WA3A 1W6PB 4KWUA 4JKKA 3N7LA 1UPIA 2FCVA 4N43B 4UF0B 4P9GA 4ASMB 4B4PA 1BMV1 1GZWB 3CIHA 1BHGA 1UW8A 4YGEA 3ZXFA 1N1SA 1KDKA 2ZHLA 5A3MA 4FI9A 5CISA 2Q8EA 2QCSB 2PA7A 1NQJA 1AHSA 1HB3A 3MI8A 2VUCA 2WWSA 2BEOA 2WBKA 1FOD3 2ZS6B 1N1YA 1TMF1 2D97A 4I30A 5F3EA 4B3NA 2Y34A 4CVUA 1FPN1 2RJKA 4HVQA 1IZ3A 1H8VA 1QU0A 4Q4V2 1W2OA 3VBOB 1GNZA 1RL3A 1GWKA 3ZFEB 4LBLA 4TXWA 3JBG3 3IMNA 2QTWB 3ZR5A 2O0OA 5AC91 2HWE2 4GKXA 1ND3A 2D93A 2JB8A 4KNCA 3DPRB 3SCGA 4BH9A 5DUXA 5LB6A 3VBHA 3JUUA 3V56A 5D8AB 2A73B 1FOD1 1UIJA 1AL22 4CDWA 2PHUA 1UXXX 3LAGA 3E5QA 4HN1A 4Y3OA 3ZYRA 1F31A 1ZBA1 1SBEA 3OUHA 4AFMA 5DG1A 4E8CA 3SISA 3Q8CA 4QXCA 1QJX3 2VUAA 3JBG1 5A7OA 3WNMA 3DKQA 4QGNA 4FPFA 1O8SA 1SCSA 3EBRA 4XILA 4AR2A 2K2SA 4CU8A 5DUVA 2VCMA 2JG9C 3PTRB 4JVAA 4NOTA 3WG2A 4JHTA 2P5BA 1CIWA 1HJFA 1COV2 3J7HA 1SLTA 4HPKA 5HCFA 1YQ5A 3GXUA 2J1SA 1ZZ7A 1KITA 2EXHA 4UXAA 3SC7X 1JZ3A 1PVC3 2BGPA 5A6QA 3T2PA 5CKQA 1RUG1 1QJX1 5A6YA 3WDYA 1Z7S2 4N9IA 3RYPA 1V6LA 2CGOA 3DCQA 2QUOA 1RUF1 5EZWA 5K9YA 1JZ2A 2YB7A 4MHRA 4CXXA 3AX4A 4YW2A 1FV3A 2BJSA 2ZABA 5FAXA 1F5JA 4NJ4A 1NG0A 3AK0A 4WVMA 2EIBA 3TAYA 1PVC1 4JV4A 4YG0A 2K9ZA 1XYOA 3PLQA 4HKOA 4N8MA 4Y1VA 5A1AA 2HH9A 4K8RB 3WW2A 5KBFA 4BQYA 1QKQA 5J09A 2RJLA 4UFKA 3CHXA 2GC2A 4Y20B 4OHVA 1SPPB 3PURA 3POBA 4FQ4A 3RI8A 2YU2A 3I7DA 3NQHA 4GZ9A 2Q8CA 4CCMA 1J84A 3A4UA 1O6UA 5BNOB 2XKPA 3U4XA 3A23A 4XF3A 2HWC2 2JECA 2G9FA 4RL7A 3I59A 2VCCA 3IAPA 3N7KA 3HQXA 3I3DA 2E53A 4MYEA 4AZZA 3KCYA 4BK4A 1UKGA 1OKOA 2YXSA 5L9RA 5JZGA 3ZLIA 2R7EB 4XXAA 2VZVA 2WWJA 1J1TA 5CFCC 2RMU3 1AR73 1RYYA 1TQ5A 2DYCA 3MUY1 2XHKA 5ISLA 4CDQC 1VRH3 5GALA 3T30A 4YZ5A 1AR91 5F5QA 5JVVA 3NV2A 4LBOA 3WLUA 1JMUB 2DCJA 5FMBA 4ATEA 4OVEA 1WMXA 4CEWA 4D69A 1HB2A 1YJKA 4MXWA 3IWZA 1RUJ1 2F4PA 1W6OA 4FFGA 2ZHMA 4Q26A 2RS12 5D2AA 5C8CC 2A6WA 1AR83 1NZIA 3ELNA 3V64A 2RMU1 1AR71 1ASJ2 1D7PM 3LKJA 1IQDC 4M3CF 3W20A 5C7GA 2KR2A 4Q1RA 4WM7B 3RVHA 2JG9A 4CDXC 4B1LA 1W0OA 4SBVA 4TYSA 2WFF2 3BPZA 4YFWA 5JOXA 1YO8A 1KGYA 3B02A 4I09A 2KA3A 4XZUG 5IK7A 5JMCA 3ZFFC 5IVYA 3S57A 4K20A 3CL1A 4CEYA 5LRSA 2VY0A 1LOEA 1E5RA 1XSRA 1LU2A 2WT2A 1F5FA 3AP5A 1VIWB 5LW9A 2R49A 1AR81 2J1RA 1PIV2 1REDA 1LKNA 4NHXA 2JE7A 4TWTA 1VAMA 2I74A 4BIFA 4KGQA 3J9SA 3LGRA 2ZJCA 1V6KA 2VQ0A 2KXLA 5GZCA 3N4MA 2YFZA 1CD3G 2D40A 1X7NA 1HIXA 4M00A 3WZ1A 1CPMA 4ZS2A 1UXZA 1PO13 2W3JA 3GCWA 3ITQA 3IDAA 1RVF2 3LDRA 2RS33 4DZGA 4Y4RA 1WLWA 2VMIA 5JI9A 4QX5A 3BKZA 2ZZJA 1RUI3 2QZ2A 3OBTA 2DV9A 3ZX7A 2JX9A 2G4IA 3W21A 5IVVA 3LOIA 5FZDA 2PHFA 1WLTA 4CTEA 3AXDA 2WLQA 2C6SA 3AMMA 3SEPA 4E2GA 3O1OA 3FX3A 1T2XA 5I0TA 4AHYA 4XC9A 4EWEA 4OFGA 1L7QA 3SXWA 1D2QA 5DAPA 4JAAA 2D3PA 3H3ZA 4W6YA 4BK5A 4OMCA 2R062 4IE7A 2RS31 2GMEA 4AEJA 4EN0A 1NLRA 1J3PA 1RUI1 5AFBA 2XLFA 3PNAA 1RUC2 2WO7A 3BN6A 4GB33 1UOGA 3IN9A 3EO6A 2IZWA 5DZFA 5I0RA 3U0ZA 4FAGA 2F4LA 4M0HA 4N7IA 4P14A 1OVSA 3VBRB 1SFYA 4CDQA 5T5LA 3ECQA 4LLFA 4MLOA 3V65A 3A0NA 3NNGA 1L3JA 5A1FA 1APNA 3FWEA 4BXSV 4XPVA 2BU9A 2OZJA 2LRPA 2E32A 2WR9A 1TVGA 4MGSA 3ACIA 5EXOA 3WT3A 3OPWA 5C8CA 4GB31 5DAWA 4QU1A 2FDFA 1BQPA 2OXBA 1YFXA 1OD5A 1O91A 5A3NA 5LCWL 1V6IA 3OBAA 5K0UB 1OMIA 1XPWA 4CDXA 5FTTC 4CCKA 1UYPA 4IDZA 4PI2A 4QXKA 5FBZA 1AL0G 3ZXJA 5IYYA 1N1TA 2QQOA 1I5PA 3GYDA 3ZFFA 1JXNA 1GNYA 5E88A 1ND3B 2ZXQA 5I93A 1AUYA 3WNOA 1A34A 1ACCA 3NW4A 5E6HA 3VBHB 3ZXLA 3CEWA 5E1RA 1H9PA 2W1UA 3HT2A 4EQVA 1TMF2 2RJ2A 1DF0A 1FPN2 1XNDA 4JX0A 4KQ7A 1KQRA 2QQMA 3SH3A 4UW5A 3ZKYA 1OXCA 1ST8A 2EALA 1YQ6A 1GKBA 1LODA 4Y4YA 3ZOIA 3AJYA 5AC92 4DOUA 3IZOA 2R6QA 3RFRA 3SLIA 1BLZA 1NCRC 5CKNA 2AACA 3MEPA 4YG6A 4NRPA 4HPKB 5C4WB 2BNOA 3S5QA 1ZBA2 3DUIA 4B8EA 2GNBA 2UWCA 2R16A 5A6ZA 5A3OA 4PQ9A 4FPGA 4XJWA 3HQRA 3ZFGC 3JBG2 1WW7A 2Y0IA 3ZMNA 3VBSC 3EJKA 5ANNA 5J1XA 4AGGA 3WG1A 1NLQA 2VUJA 3R6SA 2W08A 4BHPA 1K5MB 4FOQA 2XJUA 2VMCA 5K8SA 1RMU3 5FYTA 4P00B 5DDJ3 1HXS3 4SLIA 2JDHA 3WCSA 2V4VA 5JSPA 4WVMB 1OLME 4XCBA 4H14A 4FPEA 4QX0A 1IGOA 1ZZBA 4B29A 2P3IA 1RUG2 1QJX2 3NV1A 4AVBA 1X9PA 4CRQA 1QEXA 1RUF2 1SBFA 2OPKA 4CU9A 5LA0A 4CYDA 1AYN3 1CR7A 1UY4A 1OBNA 2AR6A 2XQXA 2A75A 3VHOA 4PLNA 1QXPA 3BIWE 1UX7A 5DDJ1 5GLTA 2IXJA 1SZBA 4TLGA 4AI9A 1W8TA 4LJHA 3VKLA 1QJU3 3V0BB 3WY6A 2DF7A 1XE8A 2ARBA 3VLBB 3OGGA 3T0AA 2ZEXA 2G1MA 3GBFA 1C57A 3GZUC 2VQTA 2YHJA 1XSQA 3VBFA 5C8WA 5C6CA 3Q8BA 4N53C 5C33A 2V5YA 5FZEA 1AVBA 3I3QA 4FP3A 3FBMA 2D44A 3I2OA 1KFXL 1VB4A 4NROA 5LA9A 3E1F1 3PU3A 1KJRA 1QOOA 2C9AA 1QJU1 3KT4A 5FREA 5FZKA 3NO8A 3H1MA 3FBYA 1V00A 2VUDA 3PUQA 4MXWB 1KEXA 1W2UA 1W6OB 5T50A 2W2IA 2XH6A 2HEWF 1XNTA 3RYRA 3PUSA 3MZHA 5B4NA 3JCIA 1HN1A 4NPRA 3ZYFA 2BBVA 2D6MA 2WZEA 1XOYA 3B3QE 2V5DA 3HIFA 4IEYA 4XFGA 5KXDA 2JG9B 1V9U3 2P6HA 1W8WA 5GJ6A 1AR92 3RZGA 3BTZA 2UYAA 4BCUA 1WW6A 2PQQA 2IXHA 3K77A 3UT0A 1YI7A 4NPMA 4CEYB 1RUJ2 3AKQA 1U5YA 5F3IA 4XFIA 3T0DA 5FYBA 3CKHA 4K9SA 5BPXA 3ILFA 2PHLA 2XVGA 1VBB3 3ZFGA 5FWJA 2R32A 2XBO2 5BXXA 3R4DB 2RMU2 1AR72 2WNVC 2XKOA 2ZGRA 4FOVA 3AXEA 1RUNA 2VZUA 3I3BA 1UU4A 3E6CC 4Q4X2 4RFRB 4CCEA 3U37A 1LULA 1W9SA 2B8MA 2PAKA 3ACFA 3RZLA 1BCXA 3X29B 1S55A 3PUHA 4K1ZA 4BYYA 1UOJA 1W8OA 4I0AA 1UN1A 2W1SA 1SLCA 1IS3A 2FZ1A 1N47A 3VDAA 1QJY2 5A3WA 3NKGA 1AJOA 1OUSA 2ZX4A 4Y22A 1URXA 3N3HA 2D6KA 3PDQA 5FYIA 5LEKA 3TEWA 1WA4A 4XMIA 5KXBA 3J7NA 4UBGA 5JOWA 1LEDA 3MGUA 3ON7A 5F39A 4DO0A 4LKDA 5CADA 3NWKA 1CAVA 1QY4A 3LF7A 1G9DA 5CG8A 3M4FA 5EJ1B 2BOJA 3GNEA 2FBEA 1AR63 2DURA 2YU1A 3M7AA 4RN5A 1LOFC 3B5LB 3KQ4B 5DUUA 3SHRA 3TEXA 5IAVA 3VKFC 3DECA 2UURA 2P6CA 3O5SA 3KGLA 2P4EA 4LOSA 2J1EA 2UU8A 4KG8A 4N53A 1GLHA 4CA9A 5CFCB 1JOJA 4INDA 5IW0A 2RR13 2JDPA 2XDVA 3C7GA 4CDQB 1HV0A 4W6WA 2D5HA 2CYFA 2ILMA 4FPLA 1QMJA 3T1LA 3KSCA 2JXAA 5JOZA 2ZGQA 5ACA3 4GMP1 4D94A 3KLSA 2O8OA 4IV3C 2WZR1 4QDRA 1RUI2 5CU1A 4DPNA 4OYUA 3HEIA 3OCPA 1UMIA 1WW4A 3N9MA 3D6EA 2VXRA 2EVXA 3JD72 1W3XA 5FBJA 3ZM8A 3FL7A 2XUMA 1KS5A 3WXPA 5C8CB 4XIKA 1RJ7A 2O8QA 3G7DA 3PVNA 3U4SA 2ADDA 2QQIA 2VD7A 4H7MA 1LECA 4IEUA 4NWWA 5FKBA 4AEMA 2RR11 3U14A 4YWAA 3EQEA 4CDXB 3AYAA 5FY0A 4LBJA 5A70A 1DBNA 2RE9A 3CDZB 3OB8A 2CL2A 3R0RA 2DCKA 4QQOA 5G05L 5ACA1 5FK8A 3ZFFB 4GAZA 4FPOB 2JD9A 5FZ8A 1U5XA 2JE9A 2VXJA 4LO4B 4LA2A 2JG8C 5FMCA 3C7FA 3SEEA 2WZ8A 4K1YA 3FN9A 1D2SA 2WNVA 4HETA 1NYWA 1Q8SA 4FVVA 4Q0SA 4KMQA 4NVPA 5IT6A 5JOYA 2RDRA 2PHXA 2XJPA 4PBOA 4X6RB 4QWNA 3WW1A 4XBQA 1C5HA 3THDA 2AGSA 1DZTA 1JUIA 4U2AA 1LHUA 3PVOA 2PHRA 5T5PA 3WUDA 2JICA 4QM9A 1GBGA 3GHNA 2CV6A 1Q8OA 5LY1A 2B4KA 5FY1A 3VBUC 2JE8A 1F2NA 3MIEA 5C71A 1FI2A 4RSUA 5HCBA 4XUNA 2RVAA 4Z8BA 4TLFA 1ZVFA 2QDRA 4NE9A 3B7MA 2BOIA 4TN7A 2X09A 3ORJA 5FZFA 1I6XA 1BYHA 1OSGA 5JUVA 3ZN6A 2EICA 5EYYA 1O5UA 1VBA1 2Q1MA 3AYCA 1LOFA 1ULFA 2W9XA 2OPWA 3RS6A 2X53S 1RGSA 3OJBA 4JC1A 3RMXA 1NX9A 1ZYBA 2MEV3 5E8AA 1AYM1 3W58A 1UY0A 5I91A 4OLLA 2RM23 3GJAA 4NHKA 2ZX1A 2A5ZA 4XBLA 1JYTA 3I3MA 2UWBA 4DS0A 5FZOA 5F6LB 1YCIA 2WSVA 4LITA 4LLOA 3AP7A 4BOWA 2ID4A 4IV3A 1QIQA 4AE2A 5FR3A 2BUKA 4DEQA 2Q5TA 2WWUA 3PIJA 4NIHA 1OPMA 4D3WA 3H42B 2DTYA 4P9XA 3ZN4A 3VGIA 3JB4C 2RM21 1RITA 1GANA 2RS52 1VBD2 4LBKA 3UESA 2VVFA 2YY1A 4PJYA 5AVPA 2ZHNA 5LEJA 2JEMA 1UY2A 1ALYA 1LGCA 2W92A 1V6OA 3PMSA 3VBFB 5FUPA 3B9CA 4EV0A 1ONAA 5FCCA 1U5IA 2WUHA 5CKMA 3VV1A 5HXMA 4DRRA 2CDOA 3KCXA 4FOWA 3BCWA 2VU9A 5C9AC 1FMD1 1XE7A 2HWD3 2FZ2A 1RUOA 3BVCA 4A6OA 3LZZA 1ENSA 3VN4A 3V0AA 1IG0A 3POSA 4W6XA 5EJ3A 2QVSB 1EV13 2ZGUA 1W6QB 2WS93 1GZ9A 3POWA 1VP6A 1RJ8A 5T55A 5FV3A 4TZDA 1NCRB 3O14A 5T5OA 4A6SA 1S0IA 3FLTA 2C26A 4XYXA 3OUIA 2HWD1 5IHRA 4ZHNA 4LQRA 3MIBA 3RNSA 4UAPA 2ZAHA 1ZRIA 4GKYA 5KR7A 2A71A 4ISQA 4HKLA 1HRI1 4ONUA 2JB4A 4XUQA 3WG4A 1H2NA 3ZFGB 5FZ4A 2ZGSA 3KD4A 5BNNC 3VBSB 5IATA 1EV11 4LIUA 1E5HA 2WS91 4PLOA 2WT0A 2SLIA 5TSWA 1SFPA 2D3RA 1MS0A 4RYDA 5FLJA 1S0EA 2DVGA
chains in the Genus database with same CATH topology
5EP9A 5L9RA 3KT7A 2RDRA 4NHMA 5EPAA 3NNFA 3PL0A 4J25A 5LBBA 2JIJA 4Y5TA 2FCVA 5IAXA 2Y34A 2HBUA 5EQUA 4ZPIA 2JIGA 2A1XA 3W20A 2OPWA 5A3UA 3GJBA 2FCUA 5L9BA 5LATA 4BQXA 3NNMA 3GJAA 4NHKA 5LB6A 3EMRA 4XCAA 3HQRA 4NHXA 3OUHA 4ZONA 3MGUA 4XABA 5DAXA 2RDNA 3DKQA 2G19A 5IAVA 3ITQA 4NHYA 4XCBA 3NNLA 4NMIA 5C5TA 3KT1A 3W21A 2RDSA 5ERLA 2V4AA 2RG4A 3OUJA 2FCTA 4XC9A 3OBZA 4MHRA 5DAPA 3BVCA 4BQWA 5HV0A 5LBFA 4KBZA 5HV4A 5LASA 2G1MA 4NHLA 4MHUA 5L9VA 2Y33A 4BQYA 4IW3A 3OUIA 4JZRA 5LBEA 5LBCA 5M0TA 3GZEA 5LA9A 2RDQA 4NAOA 3KT4A 4XACA 4XAAA 3NNJA 4UWDA 5C5UA 5IATA 4Y5SA 4Q5OA 3HQUA 5DAWA 2HBTA 5DAVA 5DAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EP9 A;  5L9R A;  3KT7 A;  2RDR A;  4NHM A;  5EPA A;  3NNF A;  3PL0 A;  4J25 A;  5LBB A;  2JIJ A;  4Y5T A;  2FCV A;  5IAX A;  2Y34 A;  2HBU A;  5EQU A;  4ZPI A;  2JIG A;  2A1X A;  3W20 A;  2OPW A;  5A3U A;  3GJB A;  2FCU A;  5L9B A;  5LAT A;  4BQX A;  3NNM A;  3GJA A;  4NHK A;  5LB6 A;  3EMR A;  4XCA A;  3HQR A;  4NHX A;  3OUH A;  4ZON A;  3MGU A;  4XAB A;  5DAX A;  2RDN A;  3DKQ A;  2G19 A;  5IAV A;  3ITQ A;  4NHY A;  4XCB A;  3NNL A;  4NMI A;  5C5T A;  3KT1 A;  3W21 A;  2RDS A;  5ERL A;  2V4A A;  2RG4 A;  3OUJ A;  2FCT A;  4XC9 A;  3OBZ A;  4MHR A;  5DAP A;  3BVC A;  4BQW A;  5HV0 A;  5LBF A;  4KBZ A;  5HV4 A;  5LAS A;  2G1M A;  4NHL A;  4MHU A;  5L9V A;  2Y33 A;  4BQY A;  4IW3 A;  3OUI A;  4JZR A;  5LBE A;  5LBC A;  5M0T A;  3GZE A;  5LA9 A;  2RDQ A;  4NAO A;  3KT4 A;  4XAC A;  4XAA A;  3NNJ A;  4UWD A;  5C5U A;  5IAT A;  4Y5S A;  4Q5O A;  3HQU A;  5DAW A;  2HBT A;  5DAV A;  5DAQ A; 
#chains in the Genus database with same CATH topology
 4U36 A;  2VTX J;  4XJA A;  5LWB A;  1RIN A;  3ETQ A;  4XAE A;  4XVH A;  1AX1 A;  1MZE A;  3KM5 A;  4E4H A;  4UT5 A;  4JHZ A;  3OEA A;  1GOH A;  3R4U A;  3H8R A;  1JYW A;  2NQY A;  1G9B A;  2VZS A;  1PK6 A;  1L7R A;  3ZIX A;  3GCX A;  4Z2A A;  4BA6 A;  1DZQ A;  4I02 A;  4Y22 B;  3ABZ A;  4IEO A;  4QM8 A;  4GJZ A;  5CYY A;  3ZSE A;  2VL4 A;  1LB2 A;  3SCH A;  1EPW A;  3LCP A;  5A7Q A;  1CGP A;  5FO7 B;  1SCR A;  2R1B A;  3EXU A;  4Y24 A;  4E2Q A;  2JDA A;  3QBQ A;  3PU8 A;  1VLN A;  1DQ5 A;  2IXK A;  3GAL A;  5JXJ A;  4CP2 A;  1Q8P A;  1NXM A;  3B9I A;  1HDK A;  4YGC A;  1KD7 A;  1CAV B;  2PXJ A;  3MW3 A;  5F2W A;  3POF A;  2WQ8 A;  3BB6 A;  4GXL A;  3QH6 A;  1DDL A;  3U1X A;  3N9L A;  2XQR A;  3VZJ A;  4CP9 A;  1FNZ A;  5FOJ B;  4QPG C;  1RUD 1;  3BOP A;  5DUW A;  5LAT A;  5GZF A;  5IVF A;  1GMM A;  2N7G A;  1BKZ A;  4N53 B;  4QT6 A;  3OD4 A;  4QX1 A;  1Y9Q A;  3N9N A;  4RGG A;  1H2K A;  4MGZ E;  3ZXE A;  4CCL A;  4CUG A;  3D4K A;  3TEY A;  3P5B A;  4CXW A;  2HWB 3;  3RG0 A;  2YGM A;  3KVB A;  3IDB B;  5C9A A;  1JZ7 A;  1GP5 A;  5FZ3 A;  3WDT A;  2ZGT A;  4O65 A;  5FO9 B;  3NVC A;  2JKX A;  2WYF A;  1OVP A;  5KHI A;  1M4W A;  3KV6 A;  2J42 A;  4IGQ A;  3ETP A;  5K0U A;  1NKG A;  2DCT A;  5CB7 A;  4NII A;  4XBN A;  3LDB A;  4AGV A;  3UGH A;  3WP4 A;  3BTA A;  2VW0 A;  2Q8D A;  4BIS A;  4Q4W 2;  4D6Q A;  2ZGO A;  5FYM A;  1PMJ X;  1DQ0 A;  3BGA A;  2HWB 1;  3RZH A;  3ZYH A;  1US2 A;  3UYJ A;  1VBC 3;  3ZPY A;  2ZMK A;  2WZR 2;  3KHB A;  1QOT A;  5J36 A;  1O4T A;  3WNK A;  5LA1 A;  4KWK A;  1ZRF A;  1UL9 A;  5BNN A;  4P9W A;  5FPV A;  4FCA A;  2E6V A;  1RHI 2;  4ITC A;  2WNV B;  4AYU A;  1TME 2;  3DKW A;  4P08 A;  5LK7 B;  3TRS B;  5FY7 A;  4N9H A;  3HJR A;  4XZP A;  1VMH A;  3OGR A;  3S7I A;  3WHU A;  2W5F A;  1GU3 A;  4ARX A;  4F7Z A;  5BNP C;  1BJQ A;  1VBC 1;  4DEV A;  3J7M A;  5ACA 2;  3IBM A;  1RC6 A;  2Y33 A;  5FXZ A;  5C4W A;  2IFR A;  3N7J A;  1OLM A;  3HNY M;  5F6K A;  3JU9 A;  3LQC A;  4RHV 3;  3PHM A;  4OHY A;  3BU7 A;  3DEM A;  1FT9 A;  2XJQ A;  4CU6 A;  5I0S A;  2DVA A;  2BGC A;  4LBQ A;  4EZ4 A;  5GZG A;  1W0P A;  3VDD C;  3KS7 A;  4YM0 A;  2XON A;  5I0D A;  3GM8 A;  3MIF A;  5G04 L;  3M3Q A;  4OZO A;  5D21 A;  2BW8 A;  2VTF A;  5JDB A;  1K5M A;  1LTE A;  5KC6 A;  1HLC A;  4D0Q A;  3LWC A;  2ZHK A;  1GYK A;  1OF4 A;  5DAV A;  2Q0A A;  2C9K A;  3ZN6 B;  4AI2 A;  4XMA A;  4EN9 B;  3H8X A;  4YSF A;  1R09 3;  4RHV 1;  2IUW A;  3KV4 A;  3LEI A;  3FE5 A;  3ACH A;  2WIN B;  3FFZ A;  3LD8 A;  2YFU A;  1STM A;  3A22 A;  2I2S A;  3O1S A;  3O1M A;  2HJI A;  4GH4 A;  4Z1V A;  5IWF A;  3N9O A;  2LRO A;  3CQO A;  4GJY A;  2UYB A;  3SH5 A;  2Y64 A;  4XIO A;  2J22 A;  3OY8 A;  4RS5 C;  1POV 0;  1R08 2;  3HBK A;  4YM2 A;  5FZO B;  1S0B A;  2E7A A;  2VZO A;  1VBA 2;  5DXD A;  4UBH A;  1R09 1;  1F15 A;  4IV3 B;  1I9R A;  2CGP A;  3V0B A;  4COU A;  4WBB A;  4I0W B;  1RUH 3;  4JGZ C;  3FUO A;  2GP3 A;  2P3Y A;  4GMP 0;  2A3X A;  2WDB A;  4DIQ A;  5FY8 A;  1AYM 2;  2A6V A;  5JMO A;  4M3C B;  1K42 A;  4DNY A;  2J1A A;  3J8F 3;  2LW8 A;  1W8F A;  1GV9 A;  5DZE A;  1JYC A;  5F5I A;  1J1L A;  4QHO A;  4EYU A;  1XXN A;  3M70 A;  4AW7 A;  5FQ0 A;  5DZG A;  2EXK A;  3H0O A;  3PVE A;  4R4X A;  4OMD A;  2ZAA A;  2R04 3;  1DHK B;  1RUH 1;  2JG8 B;  5FIX A;  1W2A X;  2XL9 A;  5IK8 A;  1H4G A;  1XYP A;  1HJG A;  1QH7 A;  3ZVX A;  2BVB A;  1H6Y A;  1DGR A;  2RDN A;  3GBG A;  4XXP A;  3J8F 1;  4M3C E;  4MGT A;  3V0A B;  3VKO A;  4ZU7 A;  2OW4 A;  1DYP A;  2JDN A;  5BNP A;  1UOF A;  2OA2 A;  4LBQ D;  1VRH 1;  4I3P A;  2FDJ A;  2UWA A;  5JSR A;  1M06 G;  2R07 3;  4QB6 A;  4AXO A;  1H6X A;  5IVB A;  3MIC A;  3OSD A;  2D5F A;  4HZF A;  2R04 1;  1XQN A;  4I2O A;  2ET7 A;  1JUH A;  1FMD 2;  2VZ1 A;  3KV9 A;  4YGD A;  4JCK A;  4ZKT B;  5C3Q A;  5C3R A;  3ZDS A;  1C5I A;  3KVA A;  4GWN A;  4GUL A;  1JU3 A;  1D4M 3;  1W9W A;  3CNA A;  1UO9 A;  3VDD A;  4AFD A;  2ZCW A;  2PYT A;  2OYZ A;  5JLV A;  3TWI A;  2XGX A;  3HR9 A;  2R07 1;  3L9J T;  4C1X A;  4KBZ A;  5HV4 A;  3RQ0 A;  4CUC A;  4IUG A;  4EZH A;  3I2F A;  4FPJ A;  1TG7 A;  3OYW A;  1W03 A;  4MHU A;  1W06 A;  4MVT A;  4OHX A;  5DMY A;  4R52 A;  3PVB B;  4IQP A;  4LT5 A;  5GLW A;  3RRD A;  4Q27 A;  2PMW B;  2YC0 A;  1D4M 1;  1HRI 2;  4ET7 A;  2TUN A;  2DWR A;  4CSW A;  2BQP A;  4S2G A;  3FHQ A;  1Y3T A;  4XW3 A;  1PK6 B;  1PZ7 A;  1LRH A;  1RXF A;  4E2S A;  3QD6 A;  4A4A A;  1PM4 A;  5J37 A;  1WGP A;  5DAB A;  4MXV A;  3O0X A;  3HOB A;  4XJ8 A;  2VO5 A;  3BU0 A;  3UET A;  3K3O A;  4HK9 A;  1YQC A;  3ES4 A;  4Q5O A;  4HOO A;  1PO1 1;  1GP6 A;  2SBA A;  3AJZ A;  3AP9 A;  2R0F A;  4JGZ A;  1X8M A;  4H7L A;  4UW3 A;  1H0B A;  2QFE A;  1B35 C;  2ARX A;  4OI4 A;  1NAE A;  1ULO A;  3ZSJ A;  1C8M 2;  4WZC A;  4CP9 B;  3IPV A;  1GWM A;  2ZEW A;  4QQL A;  5CFC A;  3PL0 A;  3VB9 A;  2C24 A;  5F37 A;  2WAA A;  4PQQ A;  1JOP A;  1SDD B;  3P3N A;  5JR7 B;  2XG3 A;  2GSY A;  2JWP A;  4FPK A;  5F2S A;  2DVB A;  3I2I A;  3NST A;  5FZG A;  1YYN A;  4GAL A;  4LNV A;  1Q8Q A;  3PUI A;  1CN1 A;  2Z4F A;  2EIE A;  5C9A B;  2YBS A;  1ZBE 3;  3P3P A;  2MHF A;  2XVK A;  4AEK A;  4XE9 A;  5FPX A;  1PM7 A;  4PDW C;  4YW3 A;  3WEZ A;  5L19 A;  1Y43 B;  5EV7 A;  3MV0 1;  4PLM A;  1RUD 2;  2VCA A;  4A7K A;  2CHH A;  1OLR A;  3N9P A;  4JRA A;  4FFH A;  4DRV A;  3T3Y A;  1QNW A;  1VBE 2;  3GJB A;  1GWL A;  2PTM A;  3AB0 A;  3N7M A;  2B45 X;  3NNM A;  4ZU4 A;  2BNN A;  4ES9 A;  4IEP A;  4NRM A;  2W95 A;  2ZPX A;  5EIY B;  1BMV 2;  3T2Q A;  4LIV A;  3T4V A;  3VZO A;  3WSO A;  1JOB A;  1ZBE 1;  5GLU A;  1VB2 A;  3LIG A;  1VPH A;  3FHI B;  1PGW 1;  3TYJ A;  3CF6 E;  1HX6 A;  3MLK A;  5KWR A;  1HV1 A;  4XQW A;  3ZYI B;  5FP8 A;  3TN9 3;  2P37 A;  1GNH A;  5H9R A;  2JDY A;  1NQD A;  2PHD A;  2D7F A;  3LA3 A;  3MF6 A;  4CZS A;  4C0H A;  5BNN B;  1OPO A;  2XWJ B;  3ZDV A;  3UJO A;  1LHN A;  4MGI E;  2J1U A;  3N35 A;  5CNA A;  5AVA A;  5A7N A;  4UYB A;  1A8M A;  2WAB A;  3CJX A;  4R9A A;  1PGL 1;  4XJU A;  3DGT A;  3LSD A;  3HNB M;  4KG0 A;  1S0C A;  3I2D A;  4JGY C;  1CAU A;  1UIK A;  4NHY A;  1X82 A;  2PAE A;  2EIG A;  4H55 A;  4Q4Y 3;  3SNM A;  2NMN A;  4XTM A;  3MIG A;  5K4L A;  4X8N A;  5C5T A;  2ENR A;  5GZD A;  3AP6 A;  5SV5 A;  1FOD 2;  3TN9 1;  2A6X A;  4JTN A;  1WMF A;  3UV9 A;  3WDX A;  4IER A;  1X8E A;  4NAM A;  4QMA A;  2DBN A;  4FXG B;  4IES A;  2XJS A;  2J1V A;  4OI2 A;  1BVV A;  1REF A;  1SLA A;  3POI A;  3USS A;  2KM2 A;  4LBQ B;  2FDH A;  4UFL A;  3AKT A;  4AHW A;  3MW4 A;  5BY5 A;  2HWF 3;  2DFB A;  5CA6 A;  4BQW A;  3HN3 A;  3D5O A;  1VBC 2;  1UZY A;  2MNG A;  4Q4Y 1;  4W4Z A;  3AMP A;  4LHL A;  3C7E A;  3FJS A;  5LY2 A;  2GNM A;  3VL8 A;  4YLZ A;  2QQJ A;  4C8D A;  3LOB A;  1KFU L;  5FFO C;  2NMO A;  3HVD A;  3TEZ A;  3RWN A;  4QPG B;  3DXU A;  4HVO A;  1W04 A;  1CWP A;  2IVI B;  1UWW A;  3NL1 A;  4L97 A;  3NMB A;  4N90 A;  1TNR A;  4GH4 B;  5FZ7 A;  2JDK A;  1ULP A;  2BFU S;  2HWF 1;  2WN3 A;  1WCD J;  2VG9 A;  5HXV A;  5FZC A;  1J83 A;  2PLV 3;  1IKP A;  2LM3 A;  3OY8 B;  3C2U A;  4K40 A;  4ZS3 A;  1RMU 1;  5LRR A;  2X10 A;  4LOR A;  4PDW A;  2GMP A;  2FDG A;  1HXS 1;  2JDZ A;  4HMZ A;  5BYN A;  4LO8 A;  1XU2 A;  3W9A A;  4P9L A;  4RHV 2;  1CAX B;  2Y6K A;  2YC4 A;  3ES1 A;  1YQ2 A;  4HN0 A;  3UL2 A;  3O1R A;  1PVC 2;  1HB4 A;  3AMH A;  1UX6 A;  3AFG A;  3I2G A;  4YRD A;  3AMN A;  3LEM A;  4FOY A;  5FY4 A;  5CEH A;  5FJK A;  3O1V A;  1RUE 3;  1PX3 A;  4RR3 C;  1AYN 1;  3ZSK A;  1DGW A;  2PLV 1;  3KWV A;  3ROU A;  1ZRE A;  3ZYP A;  2JDM A;  2FHR A;  3RJR A;  3E5X A;  1IS6 A;  3I2K A;  1Y9M A;  3D0S A;  3MLL A;  1Y7B A;  1DU3 D;  2YBK A;  5FQ0 B;  2Z42 A;  4LEJ A;  5T5J A;  2FDK A;  1R09 2;  1SQ4 A;  3PJQ A;  5IUQ A;  1DQ4 A;  2E7Q A;  5LA2 A;  3DXT A;  2VME A;  4HON A;  4LKE A;  3M2M A;  4QX2 A;  2XB6 C;  3IT8 A;  5KC5 A;  4QPI C;  1OQE A;  3NAP C;  1IPS A;  1HRV 3;  1JOD A;  4AI8 A;  4BIO A;  2HBU A;  1RUE 1;  5EQU A;  5EHD A;  2C1F A;  5KHK A;  4AVT A;  3BIE A;  1W6Q A;  5IK5 A;  1XB9 A;  2YG0 A;  1BEV 3;  4B4R A;  5BNP B;  1YNA A;  5JSO A;  1XNA A;  1NCR A;  1Z78 A;  1LEM A;  1F4A A;  4Z2W A;  3POE A;  2ORZ A;  4ZXE A;  2WLP A;  3C3V A;  1CJP A;  3EYP A;  3VZK A;  5FUI A;  1LR5 A;  1XYN A;  4LA3 A;  4FTE A;  2B9U A;  2ZX2 A;  4XQ4 A;  4RA0 A;  1HRV 1;  2VAU A;  2QQW A;  2B39 A;  3O1P A;  4HAN A;  4ZON A;  3JZV A;  3VBS A;  2YPD A;  3VDD B;  2VOV A;  4AI3 A;  4E9K A;  1Q56 A;  5DAX A;  1KRI A;  4TTG A;  3K2O A;  1AX0 A;  4ZXK A;  3LEG A;  4FFI A;  5HI0 A;  1VRH 2;  1V9U 1;  1O59 A;  2XUE A;  4YNI A;  4DIN B;  3P1I A;  1OH4 A;  1PO2 3;  2GP5 A;  4QKB A;  1UY1 A;  1BK1 A;  4XUT A;  1DP0 A;  3OYW B;  4IEV A;  4AG4 A;  5FDB A;  5I8T A;  5JXI A;  5A3L A;  2W68 A;  4FFF A;  3CZU A;  4A7Z A;  1VBB 1;  5D8A C;  3KQR A;  3MIH A;  3RSJ A;  3TOJ A;  4B7E A;  1AR8 2;  3F95 A;  4QGL A;  2Q1F A;  4AAX A;  2Q8O A;  4ZZ5 A;  4CXY A;  3VKN A;  3MID A;  1EAH 3;  4XF9 A;  3RZM A;  4AFC A;  2R07 2;  5FJH A;  1G7Y A;  2D3S A;  1WWY A;  1PO2 1;  1LGB A;  3GGL A;  1US3 A;  2H0V A;  4XUP A;  2W94 A;  3O7O A;  4AHX A;  1CQ9 A;  1DGR N;  1V70 A;  2QQN A;  5LBF A;  2ZKN A;  4NWV A;  4X8P A;  5LAS A;  1ZZ9 A;  4QX8 A;  1HQW A;  2WYS A;  1YWK A;  3NJY A;  4JGZ B;  4LE4 A;  4XOG A;  1G9F A;  2V09 A;  3SQO A;  3EB7 A;  1IKQ A;  3MV1 1;  1S2K A;  1CON A;  4DY5 A;  1DLC A;  1HQL A;  1V6M A;  2D6P A;  2W87 A;  3H9A A;  5K7P A;  4QX3 A;  1QOS A;  1EUU A;  3IPV B;  3HPN A;  1OKQ A;  4KU7 A;  1EAH 1;  4JZR A;  4YZ3 A;  1LJ7 A;  3OBR A;  4NUB A;  4Q4V 3;  2VQU A;  1DQ2 A;  4QD2 A;  5JXG A;  3U11 A;  3CJI C;  2GMM A;  1OA2 A;  1VAV A;  3NJZ A;  2RDQ A;  1NA1 C;  3ZR6 A;  1PO1 2;  2E7T A;  3J7L A;  4XFA A;  4XAC A;  4CPB A;  1E5I A;  1JU4 A;  1AR6 1;  2HWE 3;  1YQ8 A;  2RS3 2;  3NNJ A;  4JDO A;  5LK5 A;  2R0H A;  4EN6 B;  1A6C A;  4RQP C;  2GAU A;  2P3J A;  4LK7 A;  2ZBJ A;  4Y5S A;  1JTZ X;  5I8S A;  4FSJ A;  4BLI A;  4DFS A;  5IK4 A;  4L0P A;  2WNE A;  1AL2 3;  4LR4 A;  5EP9 A;  1NE4 A;  1GR3 A;  4NR1 A;  1VMF A;  3MW2 A;  4Q4V 1;  1PVX A;  1Q3E A;  4XF4 A;  1QXR A;  4R9B A;  5DQ0 A;  3QCW A;  1SG3 A;  5IVE A;  4EN8 B;  2WO3 A;  4V2W A;  4EE2 A;  2CY6 A;  2HWE 1;  1JHN A;  3HAG A;  4JDM A;  1KJL A;  3TB0 A;  1JYN A;  4OUM A;  3UJQ A;  4QGM A;  4H3W A;  3LA7 A;  2AEN A;  1U5Z A;  1XE0 A;  4GB3 2;  4IXL A;  2PQS A;  1ZA4 A;  2E26 A;  3IM0 A;  1TEI A;  1YUD A;  3GDB A;  4PCR A;  1GZT A;  2X5I C;  3PUA A;  1HN0 A;  3D8C A;  3I49 A;  2CTV A;  4IEQ A;  2JIG A;  2CDP A;  1BBT 3;  1Z7S 3;  3KGZ A;  4KBB A;  4J6G A;  2GC1 A;  3B94 A;  4J1X A;  2DUP A;  3C7O A;  3KCC A;  4Z07 A;  1MS1 A;  1SMV A;  1ZBE 2;  4G3Y C;  1CAU B;  3ZXD A;  1UF2 C;  2J1T A;  5ABJ C;  3UNP A;  1PGW 2;  3U78 A;  4Y1Z A;  1F8V A;  4FPC A;  1N3Q A;  3INA A;  4XFB A;  3U75 A;  5FPA A;  1J59 A;  4D6S A;  1BBT 1;  3POY A;  4XAB A;  1FNY A;  3BOW A;  4S2D A;  1OUR A;  4AFB A;  4AHZ A;  1K45 A;  1PGL 2;  1C28 A;  1DQ6 A;  5JPM B;  5CVR A;  2WO2 A;  3DYO A;  2FDI A;  2KD7 A;  1Q43 A;  2G19 A;  4YW4 A;  3NKT A;  3DYP A;  4CUB A;  1MZ5 A;  3JXS A;  1B35 B;  2ES3 A;  4D7Y A;  4CPB D;  5FYC A;  2HWC 3;  4CUA A;  2EAK A;  5AFE A;  4A44 A;  2ZA9 A;  2WFP A;  2VM9 A;  1BK0 A;  2VVD A;  1GFF 2;  5FUN A;  2C0Z A;  2O1Q A;  2WO1 A;  4IE0 A;  1NE6 A;  1YFY A;  4KH9 A;  1H8T C;  3ZXG A;  1NA1 A;  1QNY A;  3URF A;  4QQP A;  4NIA A;  3OUJ A;  2FCT A;  3VHN A;  5HBA A;  5D1I A;  2VGD A;  4HXC A;  4FO9 A;  4RQP A;  3T4H B;  4XF0 A;  4PDW B;  3ZXK A;  2XML A;  3ZPO A;  2MEV 1;  1SEF A;  2G9G A;  1ODM A;  4MX3 A;  4MGQ A;  2IXL A;  4ZU5 A;  3KZ4 C;  4W50 A;  1O8P A;  1NOV A;  2Y6J A;  3OEB A;  1GQG A;  4M3C A;  1R1A 3;  1OD3 A;  5LZ6 A;  4PF1 A;  1IOA A;  3WV6 A;  3TNP B;  2RS1 3;  1F4H A;  1FYU A;  4Q0V A;  1H2M A;  2W1W A;  1UQX A;  2X29 A;  4IEW A;  5FXW A;  1JS9 A;  2PN5 A;  4A7Y A;  1B09 A;  2ARC A;  4W65 A;  4YW5 A;  1ASJ 3;  1CX4 A;  1REE A;  1S1A A;  2HEY F;  3N36 A;  3VL9 A;  3B00 A;  5L7O C;  4B7K A;  1J3R A;  1RMU 2;  4Q2F A;  2VBP A;  4QKF A;  3H50 A;  5DDJ 2;  1HXS 2;  1W2T A;  1YRZ A;  2JG8 A;  3WHT A;  2AZ5 A;  2H0B A;  2Y6G A;  1RB8 G;  1DGL A;  1IS4 A;  4UWD A;  3HMY A;  1R64 A;  1W8N A;  1R1A 1;  4E4D X;  3WD5 A;  3UGG A;  2VNR A;  2WT1 A;  2X5I A;  1XNK A;  2QQP A;  1Q5O A;  1S2E A;  2B5H A;  4YVW C;  4P5Y A;  1ZZ8 A;  3VZL A;  3AL5 A;  2OII A;  3CU7 A;  3VD5 A;  4AK3 A;  4URA A;  1PIV 3;  1AYN 2;  4AAP A;  4Q1P A;  1PHM A;  4F8A A;  4COZ A;  5FP4 A;  1XBF A;  2W46 A;  5FZ6 A;  3VBR C;  2ATF A;  4J25 A;  2OS2 A;  2VR4 A;  4A41 A;  5ABJ A;  1QHD A;  4AVV A;  1QJU 2;  3C8X A;  1DGW X;  2V72 A;  4N7U A;  1UYX A;  4QQ2 A;  3VBU A;  3Q8F A;  1RVF 3;  4XJZ A;  1A78 A;  4BLJ A;  1VMJ A;  1YHF A;  5FMO L;  1W2N A;  3CLP A;  2ETE A;  5FXX A;  3WP3 A;  4L11 A;  1F9K A;  5HCH A;  1S0F A;  2EA7 A;  3HNM A;  4YPJ A;  1UOB A;  2WNO A;  1EUT A;  5A1L A;  3AM2 A;  4E27 A;  1TZO A;  1W8Z A;  4E4Z A;  5C70 A;  1W39 A;  2Z79 A;  5F3G A;  1AXZ A;  3RYK A;  1XU1 A;  2GC0 A;  2IFW A;  5GM0 A;  3BAL A;  1ND3 C;  5A3T A;  4GA9 A;  1NUK A;  2R06 3;  5FP3 A;  4GWM A;  2V73 A;  3B93 A;  3EMR A;  4K3U A;  4XCA A;  2OZ6 A;  3ZSL A;  2E33 A;  1H8T A;  4CDW C;  1RUC 3;  3MDP A;  3S6P A;  2OVU A;  5CAZ A;  1V6N A;  4NN0 A;  1GZC A;  4XEZ A;  2TBV A;  4AED C;  1V9U 2;  4LBM A;  2VZR A;  2ZEY A;  3WQB A;  3GZA A;  4IE4 A;  4P9J A;  5T3N A;  1JYV A;  5GZE A;  5JPN B;  3ZYJ B;  1KDM A;  1MEC 3;  2W52 A;  2UY9 A;  3WX5 A;  5FYH A;  4AQ2 A;  4LHK A;  2DDU A;  1G9C A;  2HEV F;  1VBB 2;  4O61 A;  2WZP P;  3AYE A;  2PFW A;  2CNA A;  3III A;  1PZ8 A;  2WL1 A;  1RTV A;  2DU0 A;  5FXV A;  4PIX A;  4RR3 B;  3FMG A;  2BTV C;  1UAI A;  1HB1 A;  4JDN A;  1NLS A;  2VPV A;  4XUR A;  1YFU A;  4QKD A;  2X05 A;  4O9G A;  3RMY A;  3BYW A;  1D0G A;  4XFF A;  3WDV A;  5JIU A;  2FMY A;  1SFN A;  1WMD A;  4NPL A;  1MEC 1;  2BYV E;  2VNO A;  4YW7 A;  4BJ0 A;  2PHW A;  3AFK A;  1ZRC A;  1WZX A;  5FPL A;  1QF3 A;  3ILR A;  1XRU A;  2NM1 A;  3M3E A;  4QPI B;  2AYH A;  4XFC A;  4YVW A;  5FP9 A;  5FP7 A;  3NAP B;  3KF3 A;  4M4R A;  2WJS A;  1K12 A;  1WW5 A;  3ZO0 B;  5J48 A;  5JR2 A;  5ANQ A;  5FLH A;  4NHL A;  2EAA A;  1W05 A;  4NO4 A;  4QHZ A;  4AQ6 A;  1EAH 2;  4TSV A;  2CAU A;  2ERF A;  3WVJ A;  4DB5 A;  4W8J A;  2I07 B;  2VVE A;  1N3P A;  1CZS A;  5DG2 A;  4YG3 A;  4DXT A;  2CGN A;  5M0T A;  5AC9 3;  1AR6 2;  1W90 A;  1O3T A;  2NP0 A;  3AVR A;  2E51 A;  4LUL A;  5F5C A;  4AOC A;  1CZT A;  4ISR A;  5HPO A;  2ZOE B;  3M3I A;  2HYK A;  4S2F A;  3SKV A;  4UW4 A;  3ILN A;  2Y6H A;  2VMG A;  1MR5 A;  1ND2 C;  1LES A;  1O3Q A;  2OKX A;  2NN8 A;  2HBT A;  3W5M A;  1OOP C;  1ZBA 3;  1WCQ A;  1GUI A;  1WD3 A;  3AL6 A;  1PGS A;  4CCC A;  5SV8 A;  1MS5 A;  1YIF A;  2RR1 2;  4UFH A;  5JZG C;  4GQ7 A;  2DUQ A;  2LUW A;  3VDB A;  4NHM A;  2Z69 A;  4JKM A;  4QHB A;  4D7T A;  3K46 A;  2DU1 A;  5L73 A;  1ZNP A;  2VC9 A;  2VMH A;  4Y5T A;  1JBC A;  1T6B X;  1QGL A;  2B42 B;  2P3K A;  5FLI A;  3RZZ A;  3T2T A;  5C3S A;  4DUX A;  2ZKL A;  3ENR A;  5FZI A;  4L2N A;  3O0V A;  4CEW C;  4MH0 E;  2IXI A;  2ZZQ A;  4CCO A;  4AED A;  1ULD A;  1GP4 A;  4IE5 A;  1RUG 3;  4JQR A;  2Y60 A;  1MVE A;  2FD8 A;  1X50 A;  4Q8K A;  1RUF 3;  4KGG A;  4DY3 A;  5CFD C;  4A45 A;  1VRB A;  3IKW A;  1AJK A;  3ZIW A;  2AEZ A;  2MPF A;  4JKL A;  5A3U A;  3WNP A;  4YYO A;  1WD4 A;  1VAK A;  2D6O X;  4QPG A;  4Y26 A;  3TNQ A;  5JCT A;  1YXW A;  2VMD A;  1BVP 1;  1OFS A;  5A7P A;  4MET A;  2QZ3 A;  4M0N A;  2WNU C;  4CEY C;  3B01 A;  3PTY A;  1WBL A;  3L2H A;  5KHH A;  1ULE A;  1D0H A;  2GND A;  1MQT C;  2FMD A;  4AL9 A;  1BBT 2;  2NLR A;  5JWP A;  1W6M A;  3WW3 A;  1QJZ A;  2E31 A;  3CJI B;  4LUK A;  2O14 A;  3U10 A;  1NT0 A;  4OUL A;  3T09 A;  1NA1 B;  2WAO A;  3UK9 A;  4ZZ8 A;  2WN2 A;  3O1U A;  1VR3 A;  1WCK A;  5A33 A;  3FLP A;  1YLL A;  3WQ7 A;  4DXS A;  1CAX A;  4RQP B;  5DN2 A;  2VMF A;  3MUZ 1;  1PNF A;  2VZQ A;  4AI0 A;  1I5Z A;  1LCL A;  2YUE A;  2XLA A;  2ZML A;  3LIH A;  3VZM A;  1WLC A;  2QNK A;  3SIT A;  4CP1 A;  1PMH X;  1I3H A;  1SHW B;  2BP6 A;  3MFC A;  3WP6 A;  4YZ2 A;  3HBZ A;  3MLJ A;  1UKR A;  5FYZ A;  3WCR A;  1VE0 A;  1FAY A;  1WA6 X;  4AQS A;  1YFW A;  3MBW A;  4COY A;  2Y26 A;  3K4D A;  3T2O A;  1YEW A;  1OH3 A;  2V4A A;  2VH9 A;  3T0B A;  1OQD A;  4Z92 B;  1AR9 3;  2RG4 A;  3RWK X;  2BER A;  2MEV 2;  3OBZ A;  1O7F A;  2VJX A;  2A6Y A;  5FZ0 A;  1ND2 A;  5H9Q A;  3WQ0 A;  1OOP A;  4FP2 A;  1FX5 A;  3L2Y A;  2RM2 2;  3HD8 B;  1POQ A;  1RUJ 3;  2TEP A;  2X5I B;  2ZMN A;  3E5U A;  1SDW A;  2AEY A;  1OQ1 A;  4HT1 T;  4UFJ A;  3WF4 A;  2XL7 A;  2IWG B;  3DV8 A;  2E9Q A;  4PIZ A;  2VZT A;  2XBO 3;  3ACL A;  4ASL A;  5L9V A;  3VZN A;  5B2G B;  5T52 A;  3CZJ A;  2W0X A;  4WVZ A;  3TBD A;  4I0B A;  4GD4 A;  3HT1 A;  2OQ7 A;  4Q4X 3;  2VZP A;  5LBC A;  5GKA C;  5ABJ B;  2BZD A;  2A3W A;  4YW6 A;  4LHS A;  1OA3 A;  3AYD A;  3W5N A;  1R1A 2;  2W47 A;  4Q0Q A;  5F3C A;  2XLG A;  3VBU B;  5FZA A;  3VD9 A;  1CAW A;  3VD7 A;  4IV1 C;  1QJY 3;  2C5D A;  2VEC A;  3HQU A;  2XBO 1;  2A6Z A;  5CFD A;  2VOT A;  2IVJ A;  3Q8E A;  4IL7 A;  5FYY A;  1LU1 A;  1Z0H A;  4QPY A;  3UKV A;  1X36 A;  3S30 A;  1MZF A;  2QQU A;  5A32 A;  4YZ4 A;  4Q4X 1;  1QJF A;  1H1M A;  1UNB A;  3K4Z A;  3O0W A;  2Y6L A;  2HWD 2;  1PMI A;  4WM8 C;  3KB5 A;  4R9C A;  1NXD 1;  2WNU A;  3I54 A;  4FXK B;  3GF6 A;  3FZ3 A;  3FFQ A;  1MQT A;  4CE8 A;  4MG2 A;  2K0G A;  1QJY 1;  4ORF A;  5FK7 A;  1WKY A;  2YDE A;  4FT8 A;  5BV6 A;  1EV1 2;  1H8T B;  2IXC A;  4IGP A;  1CPN A;  1LOC A;  2WS9 2;  4RS5 A;  5FMD A;  2H6C A;  1RXG A;  2P17 A;  2VNG A;  4CCN A;  4KU8 A;  4OUS A;  4L99 A;  4YVS C;  3RGB A;  1LEN A;  4ATF A;  3USU A;  4L8Q A;  4V2V A;  4ZPI A;  2DVD A;  3ZXA C;  3NJV A;  1FAT A;  2OUH A;  3O1T A;  1G8W A;  5F9T A;  3ZN5 A;  4MO3 M;  2CWS A;  4LUM A;  3MFA A;  2WRA A;  4AWD A;  2Z2S B;  2YC2 A;  4XFH A;  1K5J A;  1ENX A;  3VKM A;  1L7L A;  4BQX A;  4COV A;  1CIY A;  3F2Z A;  3C7H A;  3JD7 3;  2Q4S A;  1CX1 A;  1MPX A;  3LSE A;  2BBA A;  4GWJ A;  4JQT A;  3AZZ A;  4QU2 A;  4A3X A;  1WUV A;  5L7O B;  3IDE A;  3I3E A;  4G9S B;  1QWR A;  4OHW A;  1F35 A;  3R4S A;  3A7Q A;  4DMI A;  1S0D A;  4XQD A;  1NY7 1;  1WME A;  3LEK A;  1JZ5 A;  1W99 A;  1W6N A;  4QB1 A;  2C4X A;  2GN7 A;  4YZ1 A;  1GIC A;  1UU6 A;  2ZGK A;  3APB A;  4CP0 A;  1J58 A;  4ARY A;  5FYS A;  4OUE A;  4YVW B;  2AUY A;  3JD7 1;  5APA A;  1WCU A;  3FUQ A;  4D6R A;  1UU5 A;  3A21 A;  4ZY9 A;  4LKS A;  2JKB A;  1W9Y A;  4PI0 A;  1CES A;  5JAX A;  1X33 A;  3WDU A;  4NIG A;  3U07 A;  2K46 A;  5A80 A;  2XXZ A;  3LPF A;  3WR0 A;  2OT7 A;  2QKD A;  1MEC 2;  1NCQ C;  2VCB A;  3T08 A;  4BQ4 A;  3O12 A;  4MGY E;  4RD7 A;  4FTB A;  3MF9 A;  4IV1 A;  2PEL A;  4MUV A;  4IGO A;  4AQT A;  4EWD A;  5GLZ A;  1QJE A;  5IFT A;  3AKP A;  3RI9 A;  4B4Q A;  4LO7 A;  4LKF A;  4DXZ A;  3AZV A;  1WCS A;  3IAQ A;  4AVA A;  2VZ3 A;  1GSL A;  3Q8A A;  2JD4 A;  5H9S A;  2OUJ A;  5FYU A;  3H3L A;  1LNS A;  2HWB 2;  3VBF C;  2LAL A;  2X8K A;  3D3A A;  4WM8 A;  4R9D A;  3VHR A;  4AF9 A;  3VD4 A;  1SLB A;  2QQL A;  3UGF A;  5FOB B;  4AFA A;  4D7S A;  5FPU A;  4UI9 L;  5FKC A;  2RHP A;  4MOA A;  5BUV A;  3WF3 A;  3GHM A;  4CDW B;  5C3O A;  5KXC A;  4XHB A;  5EYX A;  3ASI A;  1G6N A;  4BB3 A;  1PZ9 A;  1AXK A;  2ZGP A;  1IS5 A;  1QH6 A;  4R8H A;  4YVS A;  4AED B;  4D8M A;  1JH5 A;  2DCY A;  3N9Q A;  5GLV A;  3P6B A;  4QB2 A;  4O9E A;  1ODN A;  1JN2 P;  3H8U A;  4UFM A;  2B9V A;  1CJD A;  4C90 A;  4OI0 A;  4Q0P A;  3KT7 A;  2TNF A;  1U12 A;  4IE6 A;  2QDN A;  3DN7 A;  1B35 A;  4LK6 A;  2H6B A;  5I8Y A;  1V0A A;  2WSU A;  1G86 A;  5EPA A;  1LAJ A;  1LOB A;  4J1W A;  4V1P A;  2AC1 A;  5JIA A;  4LPL A;  3SMH A;  1XNB A;  1ZRR A;  4LMF A;  3D0J A;  1JYX A;  1S0J A;  3CMG A;  4EWA A;  5F8P A;  2G9Z A;  1S2B A;  4CU7 A;  2RS5 3;  1VBD 3;  3KV5 A;  1W6M B;  5F32 A;  3PIG A;  3WNL A;  3ZSM A;  5FY9 A;  4WV8 A;  5A33 B;  4ERO A;  1UZZ A;  1ZM1 A;  2DBI A;  1AF9 A;  2CAV A;  1T6G C;  1H30 A;  1O5L A;  4A3Z A;  1BXH A;  2BFU L;  2YGL A;  4PF5 A;  2A70 A;  2FCU A;  1G9A A;  5DPN A;  3M3C A;  3MHZ A;  2RS5 1;  1LOA A;  1YC6 1;  1X9T A;  4FAH A;  1VBD 1;  4HKW A;  3QH7 A;  3VDC A;  4BM8 A;  1JW6 A;  5EJZ B;  3WDW A;  5B4X A;  4ES8 A;  3G6J B;  2DTW A;  5IFP A;  1IPK A;  3LFM A;  1NCQ A;  5I0U A;  3OOX A;  1ENR A;  4OI1 A;  3LDK A;  1FXZ A;  4OHZ A;  4YFZ A;  3J26 N;  3BI3 A;  4M01 A;  3AMQ A;  1OF3 A;  3NJX A;  1TNF A;  5FZH A;  1C8N A;  2WA4 A;  3T1M A;  1ND2 B;  2JEN A;  3I59 B;  2Q1Z B;  1UY3 A;  4CDU C;  1ZZ6 A;  2ZAC A;  3J4U H;  1OOP B;  1QQP 3;  4C91 A;  4E4S A;  1IPJ A;  2Y8K A;  1K3I A;  4KWL A;  4ASK A;  5JZG B;  2VOK A;  3WF1 A;  2XVL A;  4DUV A;  3CO2 A;  1ZA7 A;  4JGY A;  4BQ5 A;  4F3J A;  1JZ8 A;  4XDQ A;  3RZJ A;  3KHC A;  4YW1 A;  3K51 A;  4QDS A;  4N43 C;  3FHA A;  2D6L X;  2RDS A;  4OQ9 A;  2W1Q A;  3WP5 A;  1RUH 2;  4FQZ A;  4DQA A;  4Y1X A;  2D6N A;  1IG3 A;  5E16 A;  3S7E A;  4QQH A;  4Q0U A;  4FBF A;  3QLQ A;  4BQ3 A;  3EHK A;  4CEW B;  1D4V B;  1HQN A;  1Y9G A;  1QQP 1;  3RJ2 X;  1N1V A;  2ZEZ A;  2WQ4 A;  3H7Y A;  5CZK A;  5FYV A;  2BPA 2;  3J8F 2;  4P9Y A;  1CAW B;  3IDC B;  4C0B A;  2ADE A;  1BEV 1;  3KMH A;  4QDQ A;  2VBD A;  3SKJ E;  3MYX A;  3VBO C;  2BRT A;  3BTX A;  1KS4 A;  1UYZ A;  3DYM A;  4BMB A;  5A3P A;  4S2H A;  5CFD B;  2D43 A;  2F17 A;  3ZFE C;  1I1E A;  3WQ1 A;  5A32 B;  2R04 2;  1EYB A;  3OG2 A;  1QDO A;  3ZKU A;  2YRO A;  3DPR C;  3ME2 A;  3OTF A;  4NID A;  4PT6 A;  1XC6 A;  2F6B A;  3ATG A;  2WNU B;  2GU9 A;  4QXB A;  1UMH A;  1MQT B;  2GH2 A;  1MS9 A;  4NAO A;  1UMZ A;  2CWM A;  4BQ2 A;  2L9L A;  4M4P A;  3M8L A;  2VQA A;  4RS5 B;  1UPS A;  3OF1 A;  4HL0 A;  5F1R A;  5KHG A;  3UKN A;  4HLT A;  3QAC A;  1H2L A;  3I4I A;  4MGK E;  3ST7 A;  2XWB B;  3USU B;  1JYI A;  1GOF A;  1WLD A;  5H9P A;  4AGR A;  2B46 X;  4FTS A;  4CCJ A;  1AZD A;  2Q30 A;  1D4M 2;  4PHZ A;  3ZMO A;  2GC3 A;  4BME A;  4LXL A;  2OQ6 A;  4XTP A;  4I01 A;  1LHO A;  2WQZ C;  4K7J A;  4RR3 A;  4WVW A;  5LBB A;  4BWO A;  5FO8 B;  2JIJ A;  5J98 B;  4KL1 A;  3DL3 A;  1DZR A;  3K75 B;  5CIR A;  1EP0 A;  3M1H A;  1POV 3;  4OQ8 A;  3S5A A;  2BNM A;  3AZY A;  5IAX A;  2NYY A;  1V6J A;  1W8H A;  4Q4W 3;  4Q29 A;  5T54 A;  1UCX A;  4LHN A;  4IEX A;  2XOM A;  2PHT A;  1XJA A;  4BXF A;  1W9T A;  1LHW A;  3PME A;  1UD1 A;  2BGO A;  1W6N B;  3VUO A;  4QPI A;  1LGN A;  4Y1Y A;  3WOG A;  3NV3 A;  4GMP 3;  4GIQ A;  3NAP A;  4CDU A;  1HKD A;  2ZGM A;  4QX7 A;  3RDI A;  2A1X A;  2WZR 3;  2BV4 A;  3AZW A;  1DLL A;  1UYY A;  1E5S A;  2ARA A;  3A0K A;  3I97 A;  5A7W A;  3LB9 A;  3PJY A;  5L9B A;  2GH8 A;  2ZGN A;  3HN1 A;  1RHI 3;  1JHJ A;  3IMM A;  1POV 1;  1CZV A;  4P5H A;  1TME 3;  1W6P A;  4Q4W 1;  4LO6 B;  5HCA A;  4KI5 M;  4UF0 A;  4N43 A;  1LOG A;  1BZW A;  2A7A A;  1GZW A;  2RV9 A;  1C1L A;  1FV2 A;  1NY7 2;  3H1W A;  3K3N A;  2EF6 A;  3D82 A;  4XUO A;  1O3S A;  3KF5 A;  2ZX0 A;  5BNO C;  1MZ6 A;  1COV 3;  2WC2 A;  2NPI A;  2VW1 A;  4HG6 B;  2QJV A;  1AL2 1;  4AI1 A;  3OGV A;  1R1Z A;  4IV1 B;  1KXG A;  4YM3 A;  4BQ1 A;  1YI9 A;  5C3P A;  3VBO A;  1RHI 1;  4MZU A;  3AZX A;  2VTX A;  4UW6 A;  4URT A;  3ZFE A;  1J3Q A;  1TME 1;  3UKT A;  5FRA A;  1WBF A;  5FZB A;  1ZX5 A;  3JB8 A;  3THC A;  1OA4 A;  2DFC A;  4NMI A;  3THP A;  4BE3 A;  3DPR A;  3QOP A;  4C1W A;  3BUC A;  3KT1 A;  4WM8 B;  4BDV B;  1COV 1;  4JRL A;  1ZZC A;  3FLR A;  4OZX A;  3WF0 A;  5D8A A;  3M3O A;  5J96 B;  2W39 A;  4BPZ A;  1MS4 A;  5EWS A;  3WG3 A;  3AKR A;  2HKX A;  4Q8L A;  2ORX A;  1H1A A;  2QBX A;  1O4Z A;  2GDF A;  4LTA A;  2ZX3 A;  1O3R A;  4RGK A;  2Z5W A;  5EFU A;  5FZ1 A;  4EN7 B;  2XPJ A;  1Z7S 1;  3Q9O A;  2ARE A;  4XJ9 A;  4MAD A;  1IQA A;  4YVS B;  1DYK A;  4HSJ A;  3E6B A;  1CVN A;  3ZYG A;  5HV0 A;  1Y4W A;  1EPZ A;  4WM7 C;  2NZ9 A;  4A2U A;  4XDO A;  1AX2 A;  5IVC A;  5FZL A;  3R05 A;  1R08 3;  2D98 A;  3MPP G;  3VD3 A;  2EXJ A;  3H1Y A;  3BOD A;  3OGJ A;  2R1D A;  2YBP A;  1VBA 3;  3TN9 2;  1PX4 A;  3LA2 A;  3MPB A;  4IW3 A;  4RGA A;  3RZK A;  5LBE A;  4E8D A;  1JZ6 A;  5CG9 A;  4K21 A;  1OLQ A;  2LS6 A;  2GZW A;  1XNC A;  2IC1 A;  2HYX A;  1AYM 3;  3GZE A;  3OPZ A;  1RIR A;  5A7S A;  3CJI A;  1YJL A;  1IHM A;  1A3K A;  2DCZ A;  4YM1 A;  1W0N A;  1C3H A;  4LOT A;  4AVC A;  2WII B;  4Q4Y 2;  1R08 1;  5FZM A;  3BTY A;  3WW4 A;  3E6D A;  5A6X A;  3H7J A;  1S0G A;  2QQK A;  2YYO A;  1P8J A;  1S4C A;  2HWC 1;  4QPW A;  3K4A A;  2JJ6 A;  2VUL A;  1C4R A;  3WF2 A;  4BZ4 A;  1QDC A;  2A3Y A;  4HSL A;  4IEZ A;  3ALQ A;  2GN3 A;  2B7Y A;  4Y20 A;  2HWF 2;  1PK6 C;  3DF0 A;  3S0M A;  1SPP A;  3POG A;  4CCD A;  2VNV A;  4RFT 0;  4Z82 A;  1U0A A;  3I8T A;  2XJT A;  2J7M A;  3B69 A;  3NV4 A;  1ENQ A;  4O7X A;  5BNO A;  1NCQ B;  3SCF A;  4UOJ A;  2HLE A;  2XHN A;  5E89 A;  1H9W A;  2WFF 3;  4GWI A;  4QAW A;  3AVS A;  3H8O A;  2P1B A;  3GZT B;  3JQW A;  1UZW A;  2DUO A;  2XJV A;  5J3U A;  1FMD 3;  1GOG A;  1VAL A;  4FPY A;  4LE3 A;  4XDP A;  4XET A;  2W91 A;  4Y1U A;  3IIA A;  1Q8V A;  2RS1 1;  1H1I A;  2XR4 A;  1MS8 A;  2YZ4 A;  2P34 A;  3WNX A;  1NZC A;  4XF1 A;  2PLV 2;  1ASJ 1;  1MVQ A;  2ZGL A;  3MO4 A;  1ZRD A;  2VBB A;  1UZ0 A;  4JGY B;  4HK8 A;  4NRQ A;  4Y5Z 0;  5CBL A;  2WFF 1;  1MS3 A;  1OI6 A;  5J7M A;  4F83 A;  2GNT A;  3NRU A;  3WUC A;  1YIP A;  4I3G A;  1SBD A;  3GBW A;  2BWA A;  1OFN A;  5FWE A;  3THT A;  5FY5 A;  1HRI 3;  4YAR A;  1RUE 2;  3WNN A;  1DIW A;  2PAM A;  1PIV 1;  2VOX A;  3I2J A;  2BDR A;  4LBN A;  4Y33 A;  1W9F A;  1JI6 A;  3I2H A;  4KWJ A;  5FPB A;  5K0U C;  4WM7 A;  2Y38 A;  4DXR A;  1LHV A;  2VW2 A;  4HVR A;  1VJ2 A;  2VOW A;  1E57 A;  1SAC A;  5FMO S;  1GQP A;  4MSV A;  5FZ9 A;  2DVF A;  4JTO A;  1EY2 A;  2EID A;  3BPS A;  4FPH A;  3NNL A;  4K8F A;  5IVJ A;  5F5A A;  4COW A;  5JI7 A;  3E97 A;  3ZYB A;  2AH2 A;  5KHJ A;  3CBN A;  1RVF 1;  1DFQ A;  3W59 A;  1PNG A;  2I45 A;  1UZV A;  1HRV 2;  4G4F A;  4HFS A;  1DYO A;  1QQP 2;  5ERL A;  3VBH C;  1ULC A;  2EXI A;  2XJR A;  2YMZ A;  4XHX A;  1OT5 A;  4DUW A;  5F7U A;  3AC0 A;  3LE0 A;  1C8M 3;  5FPZ A;  1BEV 2;  4L9B A;  2LTN A;  4OCT A;  3VHP A;  3WIN E;  1QXJ A;  4WVV A;  4A42 A;  1JZ4 A;  1A8D A;  2E63 A;  2ET1 A;  4PIY A;  1GQH A;  2CU5 A;  2BWC A;  5L36 A;  2QE3 A;  1W8U A;  1C1F A;  3JQX A;  3K48 A;  3OD0 A;  3LPG A;  4K6B A;  1W28 A;  2CSG A;  4QXH A;  4QKN A;  2OX0 A;  3AKS A;  2R06 1;  4P9I A;  4YGB A;  2QQV A;  4R4Z A;  5JXH A;  1MAC A;  2UY8 A;  3H3U A;  3POJ A;  5C4W C;  2Y0O A;  3RPQ A;  4UFI A;  1RUC 1;  1H4H A;  1C8M 1;  1N3O A;  2R30 A;  1DG6 A;  1AXY A;  1RUD 3;  4B1M A;  4WZF A;  5L7O A;  3OGS A;  4P02 B;  1DQ1 A;  1VBE 3;  1W3V A;  2P2K A;  3SH4 A;  1PO2 2;  4BU2 A;  2VE1 A;  2YV8 A;  4XAA A;  2WKK A;  2FQP A;  1OC1 A;  5C5U A;  5KXE A;  1K5M C;  2JDU A;  1SLI A;  3FC0 A;  1HW5 A;  3AP4 A;  4H2A A;  1OHF A;  1SLL A;  4L92 A;  3LFI A;  4IET A;  5DAQ A;  4LO5 B;  4AVS A;  2BVV A;  4CDU B;  4EJR A;  4X6Q B;  1TE1 B;  3HWJ A;  5A7W B;  2YPJ A;  4HBN A;  1O4Y A;  1TMF 3;  2ZTN A;  4PBP A;  3ACG A;  5BNQ A;  5IJR A;  3NNF A;  1FPN 3;  1DCS A;  1ULG A;  3IB3 A;  3VBR A;  2GAL A;  1VBE 1;  1OUX A;  4MV2 A;  2Y6F A;  3OPT A;  4GH4 C;  2WA3 A;  1W6P B;  4KWU A;  4JKK A;  3N7L A;  1UPI A;  2FCV A;  4N43 B;  4UF0 B;  4P9G A;  4ASM B;  4B4P A;  1BMV 1;  1GZW B;  3CIH A;  1BHG A;  1UW8 A;  4YGE A;  3ZXF A;  1N1S A;  1KDK A;  2ZHL A;  5A3M A;  4FI9 A;  5CIS A;  2Q8E A;  2QCS B;  2PA7 A;  1NQJ A;  1AHS A;  1HB3 A;  3MI8 A;  2VUC A;  2WWS A;  2BEO A;  2WBK A;  1FOD 3;  2ZS6 B;  1N1Y A;  1TMF 1;  2D97 A;  4I30 A;  5F3E A;  4B3N A;  2Y34 A;  4CVU A;  1FPN 1;  2RJK A;  4HVQ A;  1IZ3 A;  1H8V A;  1QU0 A;  4Q4V 2;  1W2O A;  3VBO B;  1GNZ A;  1RL3 A;  1GWK A;  3ZFE B;  4LBL A;  4TXW A;  3JBG 3;  3IMN A;  2QTW B;  3ZR5 A;  2O0O A;  5AC9 1;  2HWE 2;  4GKX A;  1ND3 A;  2D93 A;  2JB8 A;  4KNC A;  3DPR B;  3SCG A;  4BH9 A;  5DUX A;  5LB6 A;  3VBH A;  3JUU A;  3V56 A;  5D8A B;  2A73 B;  1FOD 1;  1UIJ A;  1AL2 2;  4CDW A;  2PHU A;  1UXX X;  3LAG A;  3E5Q A;  4HN1 A;  4Y3O A;  3ZYR A;  1F31 A;  1ZBA 1;  1SBE A;  3OUH A;  4AFM A;  5DG1 A;  4E8C A;  3SIS A;  3Q8C A;  4QXC A;  1QJX 3;  2VUA A;  3JBG 1;  5A7O A;  3WNM A;  3DKQ A;  4QGN A;  4FPF A;  1O8S A;  1SCS A;  3EBR A;  4XIL A;  4AR2 A;  2K2S A;  4CU8 A;  5DUV A;  2VCM A;  2JG9 C;  3PTR B;  4JVA A;  4NOT A;  3WG2 A;  4JHT A;  2P5B A;  1CIW A;  1HJF A;  1COV 2;  3J7H A;  1SLT A;  4HPK A;  5HCF A;  1YQ5 A;  3GXU A;  2J1S A;  1ZZ7 A;  1KIT A;  2EXH A;  4UXA A;  3SC7 X;  1JZ3 A;  1PVC 3;  2BGP A;  5A6Q A;  3T2P A;  5CKQ A;  1RUG 1;  1QJX 1;  5A6Y A;  3WDY A;  1Z7S 2;  4N9I A;  3RYP A;  1V6L A;  2CGO A;  3DCQ A;  2QUO A;  1RUF 1;  5EZW A;  5K9Y A;  1JZ2 A;  2YB7 A;  4MHR A;  4CXX A;  3AX4 A;  4YW2 A;  1FV3 A;  2BJS A;  2ZAB A;  5FAX A;  1F5J A;  4NJ4 A;  1NG0 A;  3AK0 A;  4WVM A;  2EIB A;  3TAY A;  1PVC 1;  4JV4 A;  4YG0 A;  2K9Z A;  1XYO A;  3PLQ A;  4HKO A;  4N8M A;  4Y1V A;  5A1A A;  2HH9 A;  4K8R B;  3WW2 A;  5KBF A;  4BQY A;  1QKQ A;  5J09 A;  2RJL A;  4UFK A;  3CHX A;  2GC2 A;  4Y20 B;  4OHV A;  1SPP B;  3PUR A;  3POB A;  4FQ4 A;  3RI8 A;  2YU2 A;  3I7D A;  3NQH A;  4GZ9 A;  2Q8C A;  4CCM A;  1J84 A;  3A4U A;  1O6U A;  5BNO B;  2XKP A;  3U4X A;  3A23 A;  4XF3 A;  2HWC 2;  2JEC A;  2G9F A;  4RL7 A;  3I59 A;  2VCC A;  3IAP A;  3N7K A;  3HQX A;  3I3D A;  2E53 A;  4MYE A;  4AZZ A;  3KCY A;  4BK4 A;  1UKG A;  1OKO A;  2YXS A;  5L9R A;  5JZG A;  3ZLI A;  2R7E B;  4XXA A;  2VZV A;  2WWJ A;  1J1T A;  5CFC C;  2RMU 3;  1AR7 3;  1RYY A;  1TQ5 A;  2DYC A;  3MUY 1;  2XHK A;  5ISL A;  4CDQ C;  1VRH 3;  5GAL A;  3T30 A;  4YZ5 A;  1AR9 1;  5F5Q A;  5JVV A;  3NV2 A;  4LBO A;  3WLU A;  1JMU B;  2DCJ A;  5FMB A;  4ATE A;  4OVE A;  1WMX A;  4CEW A;  4D69 A;  1HB2 A;  1YJK A;  4MXW A;  3IWZ A;  1RUJ 1;  2F4P A;  1W6O A;  4FFG A;  2ZHM A;  4Q26 A;  2RS1 2;  5D2A A;  5C8C C;  2A6W A;  1AR8 3;  1NZI A;  3ELN A;  3V64 A;  2RMU 1;  1AR7 1;  1ASJ 2;  1D7P M;  3LKJ A;  1IQD C;  4M3C F;  3W20 A;  5C7G A;  2KR2 A;  4Q1R A;  4WM7 B;  3RVH A;  2JG9 A;  4CDX C;  4B1L A;  1W0O A;  4SBV A;  4TYS A;  2WFF 2;  3BPZ A;  4YFW A;  5JOX A;  1YO8 A;  1KGY A;  3B02 A;  4I09 A;  2KA3 A;  4XZU G;  5IK7 A;  5JMC A;  3ZFF C;  5IVY A;  3S57 A;  4K20 A;  3CL1 A;  4CEY A;  5LRS A;  2VY0 A;  1LOE A;  1E5R A;  1XSR A;  1LU2 A;  2WT2 A;  1F5F A;  3AP5 A;  1VIW B;  5LW9 A;  2R49 A;  1AR8 1;  2J1R A;  1PIV 2;  1RED A;  1LKN A;  4NHX A;  2JE7 A;  4TWT A;  1VAM A;  2I74 A;  4BIF A;  4KGQ A;  3J9S A;  3LGR A;  2ZJC A;  1V6K A;  2VQ0 A;  2KXL A;  5GZC A;  3N4M A;  2YFZ A;  1CD3 G;  2D40 A;  1X7N A;  1HIX A;  4M00 A;  3WZ1 A;  1CPM A;  4ZS2 A;  1UXZ A;  1PO1 3;  2W3J A;  3GCW A;  3ITQ A;  3IDA A;  1RVF 2;  3LDR A;  2RS3 3;  4DZG A;  4Y4R A;  1WLW A;  2VMI A;  5JI9 A;  4QX5 A;  3BKZ A;  2ZZJ A;  1RUI 3;  2QZ2 A;  3OBT A;  2DV9 A;  3ZX7 A;  2JX9 A;  2G4I A;  3W21 A;  5IVV A;  3LOI A;  5FZD A;  2PHF A;  1WLT A;  4CTE A;  3AXD A;  2WLQ A;  2C6S A;  3AMM A;  3SEP A;  4E2G A;  3O1O A;  3FX3 A;  1T2X A;  5I0T A;  4AHY A;  4XC9 A;  4EWE A;  4OFG A;  1L7Q A;  3SXW A;  1D2Q A;  5DAP A;  4JAA A;  2D3P A;  3H3Z A;  4W6Y A;  4BK5 A;  4OMC A;  2R06 2;  4IE7 A;  2RS3 1;  2GME A;  4AEJ A;  4EN0 A;  1NLR A;  1J3P A;  1RUI 1;  5AFB A;  2XLF A;  3PNA A;  1RUC 2;  2WO7 A;  3BN6 A;  4GB3 3;  1UOG A;  3IN9 A;  3EO6 A;  2IZW A;  5DZF A;  5I0R A;  3U0Z A;  4FAG A;  2F4L A;  4M0H A;  4N7I A;  4P14 A;  1OVS A;  3VBR B;  1SFY A;  4CDQ A;  5T5L A;  3ECQ A;  4LLF A;  4MLO A;  3V65 A;  3A0N A;  3NNG A;  1L3J A;  5A1F A;  1APN A;  3FWE A;  4BXS V;  4XPV A;  2BU9 A;  2OZJ A;  2LRP A;  2E32 A;  2WR9 A;  1TVG A;  4MGS A;  3ACI A;  5EXO A;  3WT3 A;  3OPW A;  5C8C A;  4GB3 1;  5DAW A;  4QU1 A;  2FDF A;  1BQP A;  2OXB A;  1YFX A;  1OD5 A;  1O91 A;  5A3N A;  5LCW L;  1V6I A;  3OBA A;  5K0U B;  1OMI A;  1XPW A;  4CDX A;  5FTT C;  4CCK A;  1UYP A;  4IDZ A;  4PI2 A;  4QXK A;  5FBZ A;  1AL0 G;  3ZXJ A;  5IYY A;  1N1T A;  2QQO A;  1I5P A;  3GYD A;  3ZFF A;  1JXN A;  1GNY A;  5E88 A;  1ND3 B;  2ZXQ A;  5I93 A;  1AUY A;  3WNO A;  1A34 A;  1ACC A;  3NW4 A;  5E6H A;  3VBH B;  3ZXL A;  3CEW A;  5E1R A;  1H9P A;  2W1U A;  3HT2 A;  4EQV A;  1TMF 2;  2RJ2 A;  1DF0 A;  1FPN 2;  1XND A;  4JX0 A;  4KQ7 A;  1KQR A;  2QQM A;  3SH3 A;  4UW5 A;  3ZKY A;  1OXC A;  1ST8 A;  2EAL A;  1YQ6 A;  1GKB A;  1LOD A;  4Y4Y A;  3ZOI A;  3AJY A;  5AC9 2;  4DOU A;  3IZO A;  2R6Q A;  3RFR A;  3SLI A;  1BLZ A;  1NCR C;  5CKN A;  2AAC A;  3MEP A;  4YG6 A;  4NRP A;  4HPK B;  5C4W B;  2BNO A;  3S5Q A;  1ZBA 2;  3DUI A;  4B8E A;  2GNB A;  2UWC A;  2R16 A;  5A6Z A;  5A3O A;  4PQ9 A;  4FPG A;  4XJW A;  3HQR A;  3ZFG C;  3JBG 2;  1WW7 A;  2Y0I A;  3ZMN A;  3VBS C;  3EJK A;  5ANN A;  5J1X A;  4AGG A;  3WG1 A;  1NLQ A;  2VUJ A;  3R6S A;  2W08 A;  4BHP A;  1K5M B;  4FOQ A;  2XJU A;  2VMC A;  5K8S A;  1RMU 3;  5FYT A;  4P00 B;  5DDJ 3;  1HXS 3;  4SLI A;  2JDH A;  3WCS A;  2V4V A;  5JSP A;  4WVM B;  1OLM E;  4XCB A;  4H14 A;  4FPE A;  4QX0 A;  1IGO A;  1ZZB A;  4B29 A;  2P3I A;  1RUG 2;  1QJX 2;  3NV1 A;  4AVB A;  1X9P A;  4CRQ A;  1QEX A;  1RUF 2;  1SBF A;  2OPK A;  4CU9 A;  5LA0 A;  4CYD A;  1AYN 3;  1CR7 A;  1UY4 A;  1OBN A;  2AR6 A;  2XQX A;  2A75 A;  3VHO A;  4PLN A;  1QXP A;  3BIW E;  1UX7 A;  5DDJ 1;  5GLT A;  2IXJ A;  1SZB A;  4TLG A;  4AI9 A;  1W8T A;  4LJH A;  3VKL A;  1QJU 3;  3V0B B;  3WY6 A;  2DF7 A;  1XE8 A;  2ARB A;  3VLB B;  3OGG A;  3T0A A;  2ZEX A;  2G1M A;  3GBF A;  1C57 A;  3GZU C;  2VQT A;  2YHJ A;  1XSQ A;  3VBF A;  5C8W A;  5C6C A;  3Q8B A;  4N53 C;  5C33 A;  2V5Y A;  5FZE A;  1AVB A;  3I3Q A;  4FP3 A;  3FBM A;  2D44 A;  3I2O A;  1KFX L;  1VB4 A;  4NRO A;  5LA9 A;  3E1F 1;  3PU3 A;  1KJR A;  1QOO A;  2C9A A;  1QJU 1;  3KT4 A;  5FRE A;  5FZK A;  3NO8 A;  3H1M A;  3FBY A;  1V00 A;  2VUD A;  3PUQ A;  4MXW B;  1KEX A;  1W2U A;  1W6O B;  5T50 A;  2W2I A;  2XH6 A;  2HEW F;  1XNT A;  3RYR A;  3PUS A;  3MZH A;  5B4N A;  3JCI A;  1HN1 A;  4NPR A;  3ZYF A;  2BBV A;  2D6M A;  2WZE A;  1XOY A;  3B3Q E;  2V5D A;  3HIF A;  4IEY A;  4XFG A;  5KXD A;  2JG9 B;  1V9U 3;  2P6H A;  1W8W A;  5GJ6 A;  1AR9 2;  3RZG A;  3BTZ A;  2UYA A;  4BCU A;  1WW6 A;  2PQQ A;  2IXH A;  3K77 A;  3UT0 A;  1YI7 A;  4NPM A;  4CEY B;  1RUJ 2;  3AKQ A;  1U5Y A;  5F3I A;  4XFI A;  3T0D A;  5FYB A;  3CKH A;  4K9S A;  5BPX A;  3ILF A;  2PHL A;  2XVG A;  1VBB 3;  3ZFG A;  5FWJ A;  2R32 A;  2XBO 2;  5BXX A;  3R4D B;  2RMU 2;  1AR7 2;  2WNV C;  2XKO A;  2ZGR A;  4FOV A;  3AXE A;  1RUN A;  2VZU A;  3I3B A;  1UU4 A;  3E6C C;  4Q4X 2;  4RFR B;  4CCE A;  3U37 A;  1LUL A;  1W9S A;  2B8M A;  2PAK A;  3ACF A;  3RZL A;  1BCX A;  3X29 B;  1S55 A;  3PUH A;  4K1Z A;  4BYY A;  1UOJ A;  1W8O A;  4I0A A;  1UN1 A;  2W1S A;  1SLC A;  1IS3 A;  2FZ1 A;  1N47 A;  3VDA A;  1QJY 2;  5A3W A;  3NKG A;  1AJO A;  1OUS A;  2ZX4 A;  4Y22 A;  1URX A;  3N3H A;  2D6K A;  3PDQ A;  5FYI A;  5LEK A;  3TEW A;  1WA4 A;  4XMI A;  5KXB A;  3J7N A;  4UBG A;  5JOW A;  1LED A;  3MGU A;  3ON7 A;  5F39 A;  4DO0 A;  4LKD A;  5CAD A;  3NWK A;  1CAV A;  1QY4 A;  3LF7 A;  1G9D A;  5CG8 A;  3M4F A;  5EJ1 B;  2BOJ A;  3GNE A;  2FBE A;  1AR6 3;  2DUR A;  2YU1 A;  3M7A A;  4RN5 A;  1LOF C;  3B5L B;  3KQ4 B;  5DUU A;  3SHR A;  3TEX A;  5IAV A;  3VKF C;  3DEC A;  2UUR A;  2P6C A;  3O5S A;  3KGL A;  2P4E A;  4LOS A;  2J1E A;  2UU8 A;  4KG8 A;  4N53 A;  1GLH A;  4CA9 A;  5CFC B;  1JOJ A;  4IND A;  5IW0 A;  2RR1 3;  2JDP A;  2XDV A;  3C7G A;  4CDQ B;  1HV0 A;  4W6W A;  2D5H A;  2CYF A;  2ILM A;  4FPL A;  1QMJ A;  3T1L A;  3KSC A;  2JXA A;  5JOZ A;  2ZGQ A;  5ACA 3;  4GMP 1;  4D94 A;  3KLS A;  2O8O A;  4IV3 C;  2WZR 1;  4QDR A;  1RUI 2;  5CU1 A;  4DPN A;  4OYU A;  3HEI A;  3OCP A;  1UMI A;  1WW4 A;  3N9M A;  3D6E A;  2VXR A;  2EVX A;  3JD7 2;  1W3X A;  5FBJ A;  3ZM8 A;  3FL7 A;  2XUM A;  1KS5 A;  3WXP A;  5C8C B;  4XIK A;  1RJ7 A;  2O8Q A;  3G7D A;  3PVN A;  3U4S A;  2ADD A;  2QQI A;  2VD7 A;  4H7M A;  1LEC A;  4IEU A;  4NWW A;  5FKB A;  4AEM A;  2RR1 1;  3U14 A;  4YWA A;  3EQE A;  4CDX B;  3AYA A;  5FY0 A;  4LBJ A;  5A70 A;  1DBN A;  2RE9 A;  3CDZ B;  3OB8 A;  2CL2 A;  3R0R A;  2DCK A;  4QQO A;  5G05 L;  5ACA 1;  5FK8 A;  3ZFF B;  4GAZ A;  4FPO B;  2JD9 A;  5FZ8 A;  1U5X A;  2JE9 A;  2VXJ A;  4LO4 B;  4LA2 A;  2JG8 C;  5FMC A;  3C7F A;  3SEE A;  2WZ8 A;  4K1Y A;  3FN9 A;  1D2S A;  2WNV A;  4HET A;  1NYW A;  1Q8S A;  4FVV A;  4Q0S A;  4KMQ A;  4NVP A;  5IT6 A;  5JOY A;  2RDR A;  2PHX A;  2XJP A;  4PBO A;  4X6R B;  4QWN A;  3WW1 A;  4XBQ A;  1C5H A;  3THD A;  2AGS A;  1DZT A;  1JUI A;  4U2A A;  1LHU A;  3PVO A;  2PHR A;  5T5P A;  3WUD A;  2JIC A;  4QM9 A;  1GBG A;  3GHN A;  2CV6 A;  1Q8O A;  5LY1 A;  2B4K A;  5FY1 A;  3VBU C;  2JE8 A;  1F2N A;  3MIE A;  5C71 A;  1FI2 A;  4RSU A;  5HCB A;  4XUN A;  2RVA A;  4Z8B A;  4TLF A;  1ZVF A;  2QDR A;  4NE9 A;  3B7M A;  2BOI A;  4TN7 A;  2X09 A;  3ORJ A;  5FZF A;  1I6X A;  1BYH A;  1OSG A;  5JUV A;  3ZN6 A;  2EIC A;  5EYY A;  1O5U A;  1VBA 1;  2Q1M A;  3AYC A;  1LOF A;  1ULF A;  2W9X A;  2OPW A;  3RS6 A;  2X53 S;  1RGS A;  3OJB A;  4JC1 A;  3RMX A;  1NX9 A;  1ZYB A;  2MEV 3;  5E8A A;  1AYM 1;  3W58 A;  1UY0 A;  5I91 A;  4OLL A;  2RM2 3;  3GJA A;  4NHK A;  2ZX1 A;  2A5Z A;  4XBL A;  1JYT A;  3I3M A;  2UWB A;  4DS0 A;  5FZO A;  5F6L B;  1YCI A;  2WSV A;  4LIT A;  4LLO A;  3AP7 A;  4BOW A;  2ID4 A;  4IV3 A;  1QIQ A;  4AE2 A;  5FR3 A;  2BUK A;  4DEQ A;  2Q5T A;  2WWU A;  3PIJ A;  4NIH A;  1OPM A;  4D3W A;  3H42 B;  2DTY A;  4P9X A;  3ZN4 A;  3VGI A;  3JB4 C;  2RM2 1;  1RIT A;  1GAN A;  2RS5 2;  1VBD 2;  4LBK A;  3UES A;  2VVF A;  2YY1 A;  4PJY A;  5AVP A;  2ZHN A;  5LEJ A;  2JEM A;  1UY2 A;  1ALY A;  1LGC A;  2W92 A;  1V6O A;  3PMS A;  3VBF B;  5FUP A;  3B9C A;  4EV0 A;  1ONA A;  5FCC A;  1U5I A;  2WUH A;  5CKM A;  3VV1 A;  5HXM A;  4DRR A;  2CDO A;  3KCX A;  4FOW A;  3BCW A;  2VU9 A;  5C9A C;  1FMD 1;  1XE7 A;  2HWD 3;  2FZ2 A;  1RUO A;  3BVC A;  4A6O A;  3LZZ A;  1ENS A;  3VN4 A;  3V0A A;  1IG0 A;  3POS A;  4W6X A;  5EJ3 A;  2QVS B;  1EV1 3;  2ZGU A;  1W6Q B;  2WS9 3;  1GZ9 A;  3POW A;  1VP6 A;  1RJ8 A;  5T55 A;  5FV3 A;  4TZD A;  1NCR B;  3O14 A;  5T5O A;  4A6S A;  1S0I A;  3FLT A;  2C26 A;  4XYX A;  3OUI A;  2HWD 1;  5IHR A;  4ZHN A;  4LQR A;  3MIB A;  3RNS A;  4UAP A;  2ZAH A;  1ZRI A;  4GKY A;  5KR7 A;  2A71 A;  4ISQ A;  4HKL A;  1HRI 1;  4ONU A;  2JB4 A;  4XUQ A;  3WG4 A;  1H2N A;  3ZFG B;  5FZ4 A;  2ZGS A;  3KD4 A;  5BNN C;  3VBS B;  5IAT A;  1EV1 1;  4LIU A;  1E5H A;  2WS9 1;  4PLO A;  2WT0 A;  2SLI A;  5TSW A;  1SFP A;  2D3R A;  1MS0 A;  4RYD A;  5FLJ A;  1S0E A;  2DVG A; 
#chains in the Genus database with same CATH homology
 5EP9 A;  5L9R A;  3KT7 A;  2RDR A;  4NHM A;  5EPA A;  3NNF A;  3PL0 A;  4J25 A;  5LBB A;  2JIJ A;  4Y5T A;  2FCV A;  5IAX A;  2Y34 A;  2HBU A;  5EQU A;  4ZPI A;  2JIG A;  2A1X A;  3W20 A;  2OPW A;  5A3U A;  3GJB A;  2FCU A;  5L9B A;  5LAT A;  4BQX A;  3NNM A;  3GJA A;  4NHK A;  5LB6 A;  3EMR A;  4XCA A;  3HQR A;  4NHX A;  3OUH A;  4ZON A;  3MGU A;  4XAB A;  5DAX A;  2RDN A;  3DKQ A;  2G19 A;  5IAV A;  3ITQ A;  4NHY A;  4XCB A;  3NNL A;  4NMI A;  5C5T A;  3KT1 A;  3W21 A;  2RDS A;  5ERL A;  2V4A A;  2RG4 A;  3OUJ A;  2FCT A;  4XC9 A;  3OBZ A;  4MHR A;  5DAP A;  3BVC A;  4BQW A;  5HV0 A;  5LBF A;  4KBZ A;  5HV4 A;  5LAS A;  2G1M A;  4NHL A;  4MHU A;  5L9V A;  2Y33 A;  4BQY A;  4IW3 A;  3OUI A;  4JZR A;  5LBE A;  5LBC A;  5M0T A;  3GZE A;  5LA9 A;  2RDQ A;  4NAO A;  3KT4 A;  4XAC A;  4XAA A;  3NNJ A;  4UWD A;  5C5U A;  5IAT A;  4Y5S A;  4Q5O A;  3HQU A;  5DAW A;  2HBT A;  5DAV A;  5DAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...