4YGCA

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
228
structure length
228
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
total genus 56
structure length 228
sequence length 228
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ygcA00
2A6WA 4NO4A 2P3JA 2W08A 1AXZA 3ZYPA 1GV9A 2R0FA 3WCSA 1IOAA 2ZGSA 3I8TA 4LBLA 4DS0A 1W6PB 4HANA 3AYCA 1LHNA 4LBMA 1N47A 4M3CE 1GNHA 1V6LA 1ULFA 4XIKA 2LALA 3RG0A 5JOWA 3RQ0A 4P14A 5HCAA 2ZMLA 4M01A 1ZA4A 5JLVA 1UZYA 1W6QA 4ATFA 2AR6A 1YI7A 1CN1A 2GN3A 1ONAA 3B69A 1A8DA 3BTAA 4YW1A 1G9FA 2A71A 2SLIA 5L73A 4H55A 4AGRA 3QCWA 2A75A 1FYUA 3ILNA 4YFWA 4Y26A 4WV8A 2A7AA 1DYKA 3ATGA 1PZ9A 2ZKNA 4Q26A 1QOTA 3WDVA 1LOBA 2VUAA 3D4KA 2PELA 1OKQA 1H9PA 4OZXA 1QNWA 2GALA 1MACA 1NXD1 1Q8SA 1WUVA 2UWBA 1V6JA 3GALA 3AJZA 3AZXA 4FPCA 4PBPA 3PJQA 1LHVA 5T5PA 1MZ6A 2HYKA 5JOYA 1KDMA 3TAYA 4XMIA 1X50A 2DTYA 2NM1A 1WD4A 3N7MA 2CL2A 3AZZA 4P9YA 3WZ1A 1DHKB 1DQ5A 1RITA 3AXDA 4M3CA 4YG6A 1S0CA 4R9DA 5GZCA 1S0DA 4F83A 3AYAA 3UJOA 2WNEA 1GICA 2ZGPA 4PCRA 5H9PA 5JMCA 3LSEA 1WLCA 4ISQA 1SACA 3O5SA 4RA0A 1DGLA 1W6MA 2A6ZA 1SLTA 3H0OA 5DG1A 5BYNA 3O0VA 1S0FA 2YY1A 1W6PA 5DUWA 4YZ5A 2ZABA 4XTPA 4UW4A 2VU9A 1CR7A 2DVGA 1DQ2A 1LOCA 4RL7A 2LTNA 4ATEA 2ERFA 4UW5A 1N3PA 1LECA 1WW6A 1KRIA 1MS5A 1BYHA 1MZ5A 1S0BA 4XBLA 3WG4A 4XJAA 5H9QA 1YO8A 2R1DA 1DFQA 1U0AA 3N7JA 1N1TA 4W65A 4YW4A 3RRDA 1LESA 2D44A 5IT6A 2D3RA 1SLIA 2GNTA 4YFZA 1AJOA 2JE9A 2ZZJA 3BOPA 4K20A 5JOXA 5DG2A 3OPZA 1D0HA 2WSUA 3PMEA 2A5ZA 3NV4A 2WQZC 4FP2A 3OBRA 4YW2A 2ES3A 3ZYRA 4AVVA 1CESA 4WZFA 4XILA 3L2YA 1G86A 4UW6A 4XYXA 3JU9A 4Y1ZA 4AVSA 5E89A 5JDBA 3IMNA 2XG3A 1SLCA 4YGDA 1JN2P 1YRZA 2PHXA 1PZ8A 3JUUA 1CVNA 2CTVA 2DU1A 2V5YA 1WLWA 3R4SA 4KBBA 3ZPYA 4FPKA 3U4XA 1UZZA 3HR9A 3I4IA 2VW0A 3ZSJA 4YZ4A 1FATA 1KJLA 2W68A 3V0AB 1LEMA 1JXNA 2SBAA 4FPYA 4D69A 3PVEA 1Q8VA 1JHNA 1WCSA 5CNAA 1ENRA 3D5OA 3R05A 3SNMA 1ENSA 4P9XA 4Q1RA 3VUOA 1N3OA 2GNDA 4YW5A 1SLAA 4YM1A 2ZGMA 4C1XA 2UURA 1N1SA 1W6OA 3NWKA 4LBKA 2EXKA 1AVBA 4SLIA 2DVFA 4BOWA 2AENA 2G4IA 4FOVA 1SCSA 5T5JA 3FLTA 3UL2A 3AXEA 4L8QA 5T52A 1QDOA 1RINA 1AJKA 2WLQA 1W6MB 4BM8A 1EPWA 2VW2A 2H0BA 2A6XA 1OQ1A 4FOQA 5IK4A 1GZ9A 1LENA 3RS6A 4R9BA 1MS8A 4YZ3A 3C2UA 3RMXA 1J1TA 1KJRA 3CNAA 4U2AA 3FBYA 4FPJA 2D3PA 1UKGA 5GZEA 1YXWA 3BODA 2FHRA 4Y22B 5GLTA 3POWA 1WBFA 2AYHA 5T5OA 3AP6A 2EALA 2TEPA 4ZXKA 5KXBA 4FPFA 2A3YA 5DUUA 5EWSA 1CQ9A 2E51A 2ZMKA 1GSLA 1F9KA 1UAIA 3AFKA 3APBA 3WVJA 1ULCA 3D6EA 3ZXFA 1LU1A 2ZA9A 1LGCA 3OYWB 1JUIA 1W0OA 2R1BA 4CZSA 4LBQD 3WUCA 1JYIA 2A3WA 2DUQA 1WD3A 3MPPG 1MS9A 4YW3A 3HMYA 3PVOA 3V0AA 4FP3A 4JRAA 1CIWA 4YM2A 4FVVA 2DU0A 5HCBA 3ASIA 5CA6A 5AVAA 4DQAA 2DURA 2I2SA 4XXAA 3WHTA 3ZXKA 4AGVA 2D3SA 3M3QA 3WDXA 2JECA 2NYYA 3NV1A 2GMPA 2GNBA 2ZACA 1LODA 1DQ0A 4YG0A 3AZWA 3GNEA 1H9WA 1H30A 3VKOA 2WT1A 1SLBA 4AGGA 2NZ9A 4GWNA 5KXEA 2GN7A 3ENRA 2NP0A 5EXOA 1A78A 3VV1A 3SLIA 2BQPA 2RHPA 1WBLA 2D6OX 4YZ1A 5FRAA 5JOZA 3MW3A 1SBFA 1V6IA 1VAVA 1VLNA 2ZGRA 4GWMA 4FOYA 4XMAA 1QNYA 3AP5A 4TYSA 2PHWA 1TEIA 2UWCA 3V0BB 4TZDA 1LOFC 3NV3A 4C1WA 4GKXA 5LK5A 2YXSA 4HL0A 1GBGA 3OJBA 4XJUA 5GZGA 1W6OB 4ISRA 2DV9A 4DRRA 1UMZA 1LOEA 4Y22A 1S0JA 1AZDA 1HQWA 1IKPA 1LOFA 4PBOA 4FPLA 5T54A 3SISA 4XXPA 3M3CA 1UN1A 2DVDA 1DIWA 4Y24A 1N1YA 1YIFA 4Q27A 3WDYA 1I3HA 2OUJA 2ZGUA 4LBOA 4CTEA 3WDUA 1AXYA 3UJQA 4Y1UA 5CBLA 2ZAAA 1A3KA 1S0GA 1NLSA 3ZSMA 3ZVXA 1WW7A 1Q56A 1G8WA 3Q9OA 5EYYA 3MW2A 2P2KA 1GLHA 2YZ4A 2E7TA 2UWAA 4U36A 1N3QA 3HN1A 1Z78A 3OYWA 3WNXA 5IK7A 1MVEA 1V6KA 1AX1A 3MW4A 4Q8KA 4MYEA 2WJSA 3BIWE 1CPNA 1KQRA 3WUDA 4Q8LA 1FV2A 2C9AA 1LEDA 1LULA 2ZGLA 2VXRA 1ULEA 1YYNA 4LBQA 3B9CA 2DYCA 2GNMA 3DGTA 5SV8A 1V6OA 1R1ZA 1QDCA 1QOSA 3N36A 2AREA 2DWRA 2P3KA 2D6MA 1VALA 3B01A 1G9DA 2A6VA 2EAKA 3INAA 4XDQA 3FLPA 2D6KA 3AZYA 1Q8QA 2JKBA 1C57A 3WOGA 1D2SA 4FOWA 2ZHLA 3A4UA 3ZSKA 4FPOB 4PQ9A 2JDZA 1BQPA 3R4UA 4XOGA 3M3OA 4Q2FA 1AX2A 4M3CF 2A3XA 2PHRA 2WSVA 3LSDA 2YMZA 3POYA 4LBJA 4FPEA 3V0BA 4BMEA 4Y1XA 1BZWA 4YLZA 5CB7A 1QKQA 3W58A 5T55A 1FNZA 1V6MA 2NMNA 3OBTA 4FPHA 4R9AA 2CY6A 2WT0A 4FQZA 4JC1A 1IS3A 1LCLA 1WW4A 5IUQA 1AX0A 1HKDA 1LJ7A 2UU8A 2D7FA 4K1ZA 1KITA 4XJ8A 3N3HA 5IK5A 3KQRA 1URXA 2OVUA 2ZGQA 3ZXLA 3LCPA 3WHUA 1DQ4A 1Y7BA 2NMOA 1Z0HA 2PHFA 3N7KA 4R9CA 5DZFA 4LBNA 1MS1A 5H9RA 5GJ6A 2A70A 1DBNA 1N1VA 1LOAA 1ENQA 1LHOA 1WW5A 4ITCA 1G9AA 4AWDA 2ZGTA 4Y1YA 1VAMA 1BJQA 1I1EA 4YM0A 1CJPA 5F9TA 1F31A 2NN8A 3ILRA 4XJWA 3M3EA 4Y20A 3USUB 3NV2A 1UPSA 4BPZA 1GZCA 1QOOA 4CRQA 3O0XA 4ZKTB 4AVTA 4DFSA 4BMBA 2XB6C 5IK8A 1PZ7A 4DRVA 1DQ6A 2DVAA 2Q5TA 2ZGKA 3WLUA 3WG2A 5GALA 1F5FA 4LBQB 2PHUA 2ARXA 3M2MA 1IS6A 2ZMNA 5FREA 2C5DA 5E88A 1CONA 1FAYA 3DUIA 3WG1A 3ZSLA 2A6YA 3A0NA 3AJYA 1SCRA 4YG3A 4JCKA 5GZDA 4XHXA 3AX4A 1O4ZA 2DUOA 2ZHKA 4FPGA 4Q1PA 1GZWB 1GANA 3T2TA 5HCFA 1W0PA 1BXHA 3IKWA 1MS3A 1RIRA 3WCRA 1C1LA 3N7LA 3TB0A 3IN9A 1QU0A 3POSA 2DVBA 4P9WA 5CAZA 2R49A 1SLLA 1SBDA 1SFYA 1WLDA 2P37A 3KM5A 3VKNA 1DLLA 1LHWA 3O12A 1S0IA 1DQ1A 1V00A 2D6PA 2D6NA 4YGCA 1HDKA 3IPVA 4XJ9A 2DUPA 3AP7A 3OY8B 1JOJA 4DPNA 1MS0A 2D6LX 4M00A 1S0EA 1G7YA 3ILFA 1UL9A 4YGBA 1W6NB 3IM0A 2EXIA 1MR5A 2GMEA 3FFZA 3WDWA 2EIGA 1CPMA 2ZGOA 2AUYA 1JYCA 2E6VA 4XJZA 4YM3A 2ENRA 1SBEA 3AP9A 3FLRA 1Q8PA 1HQLA 3WG3A 2ZBJA 1DYPA 2P34A 3USUA 1MVQA 1S1AA 2E53A 5GZFA 1JBCA 1GNZA 2E7QA 3SH3A 3VKLA 2FMDA 4XZPA 3T1MA 2CWSA 3O0WA 1FNYA 1LGNA 2W52A 1IS5A 1LTEA 2V73A 3AZVA 4XHBA 1HLCA 3ZXJA 4UW3A 1C1FA 4IQPA 3A0KA 5EYXA 2ARBA 4GALA 3N35A 4XBQA 4AYUA 1FV3A 1GKBA 4XE9A 3V64A 1FX5A 2OUHA 1MS4A 4Y20B 3VKFC 3FUQA 3RMYA 2YV8A 1UX6A 5DZEA 3WDTA 1KDKA 4Y1VA 5GLZA 1DZQA 3SH4A 4GA9A 4YZ2A 3AYEA 1Q8OA 2WT2A 3VKMA 1AXKA 1GZWA 1LHUA 2W39A 1LGBA 5DZGA 5KXDA 2GDFA 1ZM1A 2VY0A 1W6QB 2B7YA 2DTWA 1GYKA 5DUXA 3OGGA 5H9SA 1VIWB 2GMMA 2ZHNA 4BLJA 2R16A 3RSJA 5GLWA 4NOTA 1OFSA 2D43A 1C4RA 4K1YA 1V6NA 2JJ6A 2ZHMA 4Z8BA 2WKKA 2OW4A 2JD4A 2AH2A 5T50A 3SITA 3B3QE 3ZXEA 2CWMA 2VH9A 2KM2A 1QF3A 5F5QA 3WV6A 4WVVA 1XQNA 2Z42A 3OY8A 1G9BA 1O4YA 3V65A 1W6NA 5T5LA 2CYFA 1G9CA 1ULGA 2ZGNA 1IKQA 1BKZA 2PHTA 2R0HA 4GXLA 4XBNA 4BQ1A 1APNA 3B00A 4FQ4A 5GLUA 2EF6A 5E8AA 5DXDA 3AK0A 3PVNA 3FUOA 4XTMA 4K21A 4I30A 5GLVA 3SH5A 1IS4A 3QLQA 4YGEA 4XIOA 2JE7A 1AF9A 2VW1A 5JVVA 2AGSA 1LOGA 4PF5A 3IPVB 4ASMB 5DUVA 4GKYA 4M3CB 1QMJA 4BLIA 1B09A 2P3IA 3AYDA 1ULDA 3T1LA 3AP4A 3MEPA 3UK9A 5KXCA 2EXHA 2CNAA 1JW6A 1LU2A 3W59A 2YROA 3M1HA 2EXJA 1QGLA 5GM0A 4WVWA
chains in the Genus database with same CATH superfamily
2GH8A 4BDVB 4NO4A 4PIXA 1L7RA 5F3GA 1AR82 2CGNA 2W08A 3IZOA 3A21A 3WCSA 3I8TA 3LA3A 4DS0A 5A70A 4HANA 5K7PA 3BU0A 3M70A 3WP3A 3ZMNA 4Q4Y2 4M3CE 1UYPA 3RG0A 2LALA 5F6LB 3U37A 3ZDVA 3FX3A 4P14A 3MF9A 3MUY1 1UZYA 5FZ4A 2VOKA 2PA7A 2VCAA 3O1TA 1UCXA 1YI7A 3VBUA 1AR92 3H3LA 3SC7X 2Z79A 2NLRA 5FMOL 5F5AA 3SCGA 4YW1A 2XQRA 4UFKA 4AVAA 4DY3A 1I5PA 1HQNA 2AEYA 4HK8A 4AI9A 1NUKA 2A71A 2SLIA 3DPRC 1CAWB 1PGSA 4H55A 3KVAA 5JWPA 4WV8A 4Q4W1 2YU1A 1PZ9A 2OPKA 3I3DA 3PL0A 4Q26A 1LOBA 2VUAA 4MADA 3C7HA 1OKQA 1OHFA 1H9PA 3AMHA 4OZXA 4S2FA 2WWSA 2VBDA 5FZOA 3FHIB 2HWB3 4AQ2A 2XOMA 4NROA 3IIIA 5FZLA 1UY3A 1Y9QA 2JB8A 3GALA 3T0BA 1NE6A 2C6SA 5JOYA 2WZPP 3H3ZA 4MGIE 1JYXA 2R071 4QX8A 3IIAA 4J1WA 5J37A 2Z5WA 3UESA 3WZ1A 1ASJ3 3DECA 2XJTA 1XYOA 3B02A 2ARCA 4P08A 2BNOA 2AZ5A 1GICA 2ZX1A 3HNBM 5LY2A 3KGZA 2VCMA 4K3UA 1SZBA 1UU5A 3O1MA 2OQ7A 3LGRA 1PO22 3O5SA 5IVEA 3KT7A 3WNPA 1PO13 3OCPA 4QU2A 1OA3A 2W9XA 2WS91 3NKGA 4JGZA 3H1YA 4YZ5A 4UW4A 5FFOC 2VU9A 1CR7A 2DVGA 1JMUB 1ZZCA 4R8HA 1LOCA 3MIGA 4ZS2A 4RL7A 4ATEA 2RS11 4QT6A 1AR61 1N3PA 1KRIA 4QQHA 1MS5A 1DZTA 4XBLA 3IBMA 4KWUA 4ZONA 2R7EB 4UFHA 5FPLA 1YO8A 4WM7C 4IXLA 2KXLA 3H8XA 2FZ2A 1U0AA 1Y3TA 1NKGA 2D5FA 3VBHB 1IHMA 2V4VA 3ABZA 3ZFGC 5KHKA 2D44A 5LBEA 2RM23 3H50A 5IT6A 3UGFA 2D3RA 2EIEA 1AJOA 2IVIB 2BWAA 5DG2A 4N43B 4BQ2A 4IV3B 2WSUA 3PMEA 4O65A 1OF4A 4LK6A 4MX3A 5JIUA 4TTGA 3OBRA 2ES3A 2E9QA 3ZYJB 4YVWC 5LBCA 5DDJ1 3WF4A 3L2YA 3FWEA 1SG3A 1G86A 1OVSA 3LF7A 3NO8A 1PVC3 3B7MA 4GZ9A 1FPN2 3WNNA 3IMNA 4OMDA 1J1LA 4AVVA 1CVNA 2DU1A 4KWJA 5L9VA 4EN6B 3AKSA 4HN1A 3WEZA 4CDQB 4KL1A 4FPKA 3BKZA 1S2EA 1RUE3 2IFWA 3HR9A 2VMFA 1NG0A 3IT8A 2VW0A 3WINE 3ZSJA 5JZGB 5KHJA 3V0AB 1KD7A 3PVEA 5FQ0A 1JHNA 4B3NA 5K8SA 3D5OA 2K2SA 4P00B 4P9XA 5BNPB 3VUOA 1N3OA 1X33A 5ABJC 4N7UA 2VMIA 1AHSA 2BERA 3HJRA 3JZVA 5FZ3A 4A3ZA 1AVBA 3EXUA 2K46A 2VVEA 1RHI2 3PNAA 4FOVA 4NIDA 3SKJE 3BTXA 1VBA1 2YFZA 1F4AA 3UL2A 3AXEA 4LO7A 2DCJA 2XGXA 5F5IA 3K51A 1AJKA 5DQ0A 1COV1 2VW2A 2H0BA 1RUNA 4WVMB 3ZDSA 4HKLA 4MGSA 2R042 1BCXA 3I97A 1EPZA 4YZ3A 4QU1A 1MEC2 2QQPA 2QQMA 2Q4SA 3HVDA 5EIYB 5FZMA 2D3PA 4A6SA 4OULA 5GZEA 3MZHA 3BODA 1WBFA 2AYHA 3POIA 1RUF1 5FZHA 5EZWA 2CAUA 2TEPA 2VTXA 4XDPA 2A3YA 4GJZA 5EWSA 2R061 1REDA 5J3UA 3ZFEC 2MEV1 3AFKA 4Q5OA 5FWEA 4DNYA 4OMCA 1RXGA 1LU1A 4TN7A 1LGCA 4UFIA 1JUIA 1U5XA 4CZSA 4DUVA 1VRH2 3WUCA 5KC5A 2BP6A 4WM7B 2HWE1 4YW3A 1VBE1 1DF0A 3HNMA 3CJXA 3PVOA 5A6ZA 1MZEA 4BIFA 3V56A 2HWD1 5AVAA 4W50A 5F6KA 3CEWA 1C5IA 2IXLA 3ZXKA 2D3SA 3M3QA 3WDXA 4C8DA 2JECA 4RHV3 3NV1A 2GNBA 4JQRA 5FYIA 2MPFA 5ACA2 3DKWA 1H9WA 1RUJ2 4YVWB 3VKOA 2FDJA 3FHQA 3ZIWA 4UXAA 1GWMA 5KXEA 2GN7A 2W94A 3ENRA 4FAGA 2ADDA 4L0PA 2A73B 2NP0A 4RGGA 5FYMA 4O7XA 4DEQA 4W8JA 1WBLA 5FRAA 4JDMA 5JOZA 1VP6A 2IFRA 4O9GA 1VBB3 5FZGA 2IC1A 4GWMA 4FOYA 4B4RA 1QNYA 2G9GA 2QBXA 5IHRA 1TEIA 2QUOA 5JUVA 4EWEA 1UX7A 4C1WA 3K77A 2WABA 4GKXA 3B9IA 5LK5A 3R6SA 4XJUA 2QQWA 2WFF2 3BUCA 2XBO1 2YC0A 1L3JA 3GXUA 1FMD1 4CU7A 2QZ2A 1Y4WA 4PBOA 1AZDA 1OKOA 5ABJB 1LOFA 2PFWA 4KWLA 2BNMA 1K12A 1OBNA 3SISA 4XXPA 4EZ4A 2DVDA 3EO6A 4WM8A 1AR72 3WDYA 1VMFA 1YIFA 4IETA 3OGJA 4CTEA 1HN1A 1NCQC 3K4AA 3WDUA 4CXXA 5JSRA 1NQJA 1PMHX 1JZ2A 2JKXA 3D0JA 5FY7A 2RR11 1QJU3 2VBPA 4EYUA 4QDSA 1Q56A 2JDUA 1VBC2 2VZOA 3MI8A 3MW2A 3RZHA 3J8F2 2YZ4A 3HN1A 4IERA 1MVEA 3U07A 4MHRA 3J9SA 3HPNA 2C0ZA 3POEA 3CDZB 3ZYHA 3IDEA 4MYEA 3AMNA 4A42A 4C91A 4Q8KA 3S5AA 5LW9A 4AF9A 1CPNA 4XW3A 1KQRA 4LPLA 1A6CA 5FO7B 2H6CA 1ULEA 4LBQA 3FC0A 3I3EA 1D4VB 3DGTA 1RUC1 1V6OA 4HLTA 3N36A 2ZPXA 3OD0A 1PGW1 2AREA 3VBFA 2BGPA 3HEIA 4MH0E 3B01A 3GDBA 4PHZA 4Y4YA 1G9DA 5FY8A 3OPTA 5C8CC 3FLPA 3VBSA 4LIVA 3BOWA 3OB8A 1NA1B 2D98A 3WOGA 5K0UC 1XRUA 4YVSA 2OQ6A 4FOWA 2JEMA 2Y8KA 4FPOB 3R4UA 5IJRA 3M3OA 1NCRA 2VE1A 3KCXA 1Q43A 2IVJA 4A2UA 4BK4A 3O7OA 4Q4V2 1AYM2 4RGAA 5LRSA 1X8MA 4LBJA 1E5SA 2EVXA 1Y43B 4LO4B 4XDOA 4YLZA 4I0AA 3W58A 5IAXA 5T55A 4RFT0 1SPPB 4AFCA 3DXUA 1QJX1 3THDA 1NY72 4FQZA 4JC1A 4CEYC 1ODMA 3AMQA 3QACA 4LHSA 1IS3A 1WW4A 4OQ8A 1ALYA 4RS5C 3T0DA 2Y34A 2HWC3 2D7FA 4K1ZA 3RZZA 4EN8B 5FWJA 1NZIA 4ASKA 3TEYA 1K45A 4FXKB 4JHTA 3KQRA 4N53B 3WHUA 1Y7BA 3DF0A 4JQTA 1Z0HA 4QHZA 2KR2A 5GJ6A 1HV1A 3POFA 1JOPA 1PM4A 2RS53 1LHOA 1WW5A 1QIQA 2VZTA 4KGQA 4NN0A 4CSWA 2ID4A 4AWDA 4KG8A 4ZU5A 3HBKA 4W6YA 1OUSA 2X5IA 1CJPA 1WMEA 3UKNA 4BA6A 5FIXA 4N7IA 2V09A 3TOJA 4NHXA 1REFA 1GWKA 4MO3M 3M3EA 3GBGA 4PLMA 4BPZA 4CCOA 5HPOA 4EV0A 4LORA 3MUZ1 3IAPA 2G1MA 5FZ8A 5IATA 3WX5A 1GOHA 1OOPB 2XB6C 4K6BA 3POGA 5IK8A 3N9MA 4B8EA 4O61A 2Y38A 2Q5TA 4RR3B 3VL8A 2PHUA 2Y6GA 3M2MA 3PUHA 1J59A 4XQDA 5C7GA 3DUIA 3ZSLA 4YG3A 2W95A 4XHXA 2Q8DA 4DMIA 5F37A 4A3XA 2ZKLA 3T2TA 1GZWB 1GANA 4AVCA 5FUPA 2QDNA 2BRTA 1BEV2 1W0PA 5EFUA 5B4NA 4PDWA 3CLPA 3PIJA 4CCNA 3NJVA 5FOJB 3N7LA 1QQP3 2ZAHA 3IN9A 4G9SB 3KMHA 5J96B 2VQUA 2DVBA 4P9WA 3JBG3 2HWF3 4FFFA 2R49A 4RQPB 1J3RA 1B35B 1WLDA 4LO6B 1MQTC 4UYBA 2YC2A 1V00A 4KBZA 1XNBA 4YGCA 2VZQA 1R1A3 1HDKA 2P3YA 1IPSA 2DUPA 4AFDA 4MG2A 2J22A 1S0EA 1G7YA 4QX3A 4M4RA 1W2NA 4XAEA 2EXIA 4OVEA 1JYVA 2ZX0A 2WWJA 3I2DA 2ORXA 1PX3A 1UOJA 3ON7A 3LPFA 4X6QB 2ENRA 3AP9A 4XQ4A 1H8TB 4F7ZA 3KWVA 1JZ7A 1DYPA 1XNTA 1AYN3 1WA4A 2X53S 3GF6A 1S1AA 2E53A 2YUEA 3MFCA 2F4LA 3NKTA 3SH3A 2FCTA 2FMDA 4FT8A 1HB1A 3VD7A 1UWWA 3KSCA 1LGNA 4CU8A 2V73A 1EAH3 1ND2C 3ZXJA 3VBFC 2WYFA 3A0KA 4NIIA 5E1RA 4AYUA 1RB8G 1ZZBA 2JG8B 1IQAA 5BNOC 2XWJB 2OUHA 3MIDA 1MS4A 5FMBA 4E27A 1W0NA 2UY8A 4K40A 5FZ7A 2JG9A 3RMYA 2HBUA 3UT0A 3R0RA 2B8MA 1KDKA 4IE6A 2WR9A 4Z2AA 1JZ3A 1JTZX 3SXWA 2Y6HA 2WT2A 1VB2A 1AXKA 3VKMA 5C3RA 5FJHA 2QVSB 4MGQA 1ZM1A 2WQ8A 3U78A 3UV9A 5DUXA 4BLJA 3I2JA 5GLWA 1RVF2 1W90A 2D43A 5FPZA 3ORJA 4K1YA 5C4WB 1QXRA 2GP3A 4QXBA 3LFMA 2ZHMA 2WKKA 4Q29A 4QM8A 5J98B 2I45A 5FJKA 3MYXA 3B3QE 3ZXEA 4MGZE 4CCCA 1H1MA 2HWB1 1WCQA 4XCAA 4QPGB 3USSA 4NJ4A 1QF3A 3WNKA 3OY8A 1WMXA 3RZMA 1U12A 2ZTNA 1W6NA 4NRQA 2ZGNA 5E16A 2R0HA 3VBOA 4Q0UA 4A7KA 1APNA 2DCTA 3POJA 3H8UA 3I59A 5GLUA 2EF6A 1HXS2 4QPIB 4OQ9A 4K21A 1O7FA 1VJ2A 3ACIA 5GLVA 3QLQA 1TME2 3SH5A 1AF9A 5JVVA 2ET1A 4IEZA 4PQQA 3LOIA 2ADEA 1B09A 3AYDA 2PAEA 2VULA 3UNPA 2C24A 4PF1A 4AHXA 1NOVA 1WA6X 4OFGA 5KXCA 4E4SA 5FP4A 4BQYA 3LOBA 2BBVA 1PO11 1Q5OA 1UOBA 4QGMA 5FZ1A 2ZX4A 4E8DA 4YW7A 3JQXA 4ET7A 3WQBA 5I0RA 1UY1A 4LBLA 3NAPC 2EAAA 2VUCA 4LKDA 1LHNA 4LBMA 5LA1A 5BNOA 2VOWA 1HJFA 1X8EA 5C6CA 2D5HA 1GNHA 3H9AA 5D21A 4ZPIA 2YBPA 4XABA 5HCAA 5I0TA 5DAPA 2EIDA 3AVRA 1JUHA 4KH9A 1VE0A 2AR6A 4NMIA 5JXJA 3N9QA 3B69A 2PYTA 3HQXA 4QKBA 4QPWA 5J1XA 4ES8A 5L73A 2Y0IA 4TLGA 3QCWA 3MBWA 1NE4A 3ILNA 3LZZA 1CAXA 5EQUA 2R072 1XYNA 4CPBD 1REEA 4N9IA 3WQ1A 4CEWC 3WDVA 1PVC1 2PELA 1D2QA 1R092 4Z07A 2ORZA 2GALA 2VCBA 1VB4A 3K2OA 1WUVA 2UWBA 1GNYA 1YQ2A 2E32A 5J7MA 5T5PA 3U4SA 1RUE1 2WNUB 2HYKA 3RNSA 4XMIA 1X50A 3N4MA 2YPJA 4IL7A 5FCCA 4EN9B 1QJY3 3AZZA 1W04A 1DQ5A 1RITA 4M3CA 2ZJCA 5D8AB 5EPAA 2OIIA 1S0CA 2VR4A 2VZ3A 4R9DA 1S0DA 3AYAA 3UJOA 3ZSEA 4FCAA 5FR3A 1OH4A 5BNNB 1H1AA 2ZGPA 1UYZA 2O14A 4FO9A 4MZUA 5FUIA 4CDUB 3LSEA 2XL7A 5LA9A 1CAVB 1I9RA 4I0WB 2JDYA 4RA0A 2OZJA 2ET7A 2ZEXA 1DGLA 4A7ZA 4LE3A 1SLTA 4OYUA 4HVOA 3T2OA 5BUVA 4WVMA 1ZBA1 4A6OA 4JGYC 2KA3A 2GC2A 1W6PA 3GJBA 5DAVA 5FTTC 5FP8A 2ZABA 4XTPA 1H2NA 4IE4A 4BE3A 2Y6KA 5FYVA 3HT1A 4AL9A 4AEMA 4D8MA 4XFGA 5ANNA 3S30A 2LTNA 2FZ1A 4UW5A 4HXCA 3O1PA 1S0BA 3DKQA 4OHZA 4NPRA 4XJAA 4AHYA 1WCUA 3ES4A 3IWZA 3RRDA 1LESA 3IMMA 3VB9A 3ZFFB 1W8OA 3AL5A 5F1RA 1UMIA 4YFZA 1QY4A 3RI8A 4QKNA 2JE9A 1YQ8A 2ZZJA 3BOPA 4K20A 3U11A 2R043 1OA2A 2WNVB 2OYZA 4WM7A 1D0HA 3VDCA 1RUI2 1YQCA 2Y6LA 1QJEA 1ODNA 3J7MA 3ZFGA 2E7AA 2WQZC 4FP2A 5CFDB 3LE0A 4AVSA 3FMGA 2VECA 1RTVA 3JU9A 3LPGA 4Y1ZA 5E89A 5A7PA 3G6JB 4H7MA 5LWBA 5JDBA 4YGDA 4QXHA 1L7LA 1YRZA 3KGLA 1V70A 4DOUA 1WLWA 3R4SA 5C71A 3I3BA 4YVWA 1GWLA 3FBMA 3PUAA 1UYXA 2J1UA 2VNGA 2W68A 4HKOA 4RHV1 1LEMA 1BVVA 2SBAA 3OEAA 2IXJA 3NNMA 1Q8VA 3WQ7A 1DCSA 2YB7A 2J1RA 3JB8A 3S7IA 5LCWL 2VZUA 4YW5A 4B29A 2JDHA 2VCCA 3T2QA 4C1XA 2UURA 5D2AA 1NXMA 2EXKA 5ACA3 2DVFA 1VBB1 1SMVA 3VBHC 3LDKA 1RUJ3 1SCSA 2FDIA 5A80A 5A6XA 3A22A 5ABJA 2BVBA 4FBFA 4IEPA 1QWRA 4NWWA 1QDOA 2WLQA 4N43C 1W6MB 1GZTA 4IV3C 1EPWA 4X8NA 4JV4A 1W8FA 3TNPB 4MHUA 3MLLA 2R062 2E31A 2WLPA 4KU8A 1MS8A 2MEV2 3C2UA 4U2AA 3TRSB 4CU6A 4TSVA 1OXCA 4NWVA 2VJXA 1NQDA 2WFF3 4TXWA 3KLSA 3GCWA 2RDNA 4FFHA 1S2KA 3OF1A 4Y22B 1X9TA 1QJFA 1QJU1 4JGYB 2HWE2 1UF2C 3ZN6B 5L36A 4RN5A 1VBE2 2J42A 4CDQC 5KXBA 4FPFA 2VL4A 4N90A 2ZMKA 1GSLA 4E4HA 5C3QA 1UAIA 2RMU3 3APBA 4HVRA 3ZM8A 1AL22 3OPWA 5JZGC 1ULCA 2QQOA 3D6EA 4GQ7A 4MXWB 4QXCA 4Y33A 4DEVA 4H2AA 4P9IA 2R1BA 5HBAA 3VDDB 1VBC3 3QH6A 2A3WA 3WW1A 4G4FA 3MPPG 1MS9A 3P6BA 1KGYA 1ZBE2 5BNPC 3HMYA 2OKXA 1SHWB 3LKJA 1H2KA 3ZFEA 4CP0A 3JD73 4ZZ8A 2QQVA 4FP3A 4N9HA 1YC61 1CIWA 2K9ZA 2QQKA 5CA6A 4DQAA 2ZEYA 2I2SA 4Y5TA 3WHTA 2X05A 4AGVA 2YDEA 2VOXA 3FZ3A 2ZACA 2NPIA 1LODA 2P4EA 4CCKA 5FOBB 2OS2A 2VVDA 2VC9A 3ACFA 5EJZB 1H30A 3RZKA 1W2TA 4AEKA 4FTEA 1SPPA 2NZ9A 4GWNA 4NPMA 2O8QA 5I93A 4JVAA 5FZIA 1DGWA 5EXOA 3JCIA 2XJRA 2JD9A 2YGMA 2RHPA 4IEVA 3MW3A 4IUGA 5LATA 1ND3B 4KG0A 1W28A 2ZGRA 3MV01 3R4DB 2PHWA 2UWCA 3K3OA 3V0BB 4RD7A 1H8VA 3NV3A 4Q4V3 2YXSA 3E1F1 3MICA 3OJBA 5GZGA 2HWC1 4QX1A 5CEHA 3CIHA 1YUDA 3HAGA 3U10A 1H6YA 1S0JA 1IKPA 5T54A 1R082 1Z7S3 1VBD2 2Z69A 4XF9A 5IVJA 4Q27A 1UZVA 5L7OB 1A3KA 3CQOA 2P5BA 1NLSA 3ZSMA 4JKKA 1WW7A 3ZVXA 2RS51 5EYYA 2BU9A 4HSJA 2PN5A 4BQWA 3MIHA 2PAKA 2E7TA 3HOBA 4U36A 3OYWA 5FLJA 5J48A 1M06G 2LW8A 1V6KA 4FAHA 3NQHA 3LEMA 1TE1B 3OUJA 1NCQA 4IEQA 3RPQA 1TZOA 3IDCB 4Q4X3 1PIV2 1D7PM 3D82A 3ZIXA 1CJDA 1GQHA 2C9AA 4NPLA 1LULA 4BWOA 2ZGLA 4E2QA 2VXRA 2XJVA 4LOSA 1OMIA 3WW2A 1YJKA 2DYCA 2GNMA 3AKRA 4AOCA 5SV8A 1PNGA 5IW0A 3MDPA 1QDCA 1QOSA 3O1UA 4DB5A 2XVGA 3SCHA 3MGUA 2P3KA 3EHKA 4XFBA 1SFNA 5FXWA 2VTXJ 2EAKA 4AHZA 2ZX2A 3INAA 2D40A 3CMGA 1Q8QA 4PT6A 4OHXA 4W6WA 4F3JA 3I2FA 2F4PA 3DEMA 1JZ6A 3ST7A 3NL1A 3ZSKA 3MFAA 4PQ9A 2P1BA 1TMF2 4Q2FA 1GR3A 4C90A 4M3CF 3GZAA 1W9FA 3ETPA 5FYYA 4CCEA 5IAVA 3GHMA 4LE4A 4OI2A 4ONUA 4CA9A 4CXWA 5C8CA 3POYA 3VBSC 5K0UA 4IE5A 5CB7A 4BH9A 3RI9A 4ES9A 1BHGA 1ZZ6A 4AFAA 2PLV3 1QQP1 1FOD3 4R9AA 2CY6A 4ORFA 4A4AA 3NNGA 4PIYA 3JBG1 4IEUA 2HWF1 1AX0A 4UAPA 1UOFA 5I91A 4BIOA 1LJ7A 3I2HA 1JZ8A 1CAUA 1R1A1 2YPDA 2PAMA 1HB4A 1C5HA 1O3SA 2Z4FA 2QQUA 4UT5A 5A3UA 1WGPA 5FPXA 4CEYA 4XJ8A 1H8TA 2X09A 2EICA 5FDBA 4AI3A 3LCPA 1EV13 4L2NA 1K5MB 4RS5A 2NMOA 5F3CA 4R9CA 5A3LA 5DZFA 4LBNA 1S2BA 2H0VA 1N1VA 2HBTA 1LOAA 1W06A 4XFHA 4ARXA 4IV1B 3RJRA 1RUG3 3DV8A 3ZR5A 1G9AA 1AYN1 1XU1A 1VAMA 4P9LA 1EUUA 2CHHA 1W03A 1F31A 1HW5A 2QQNA 3P3PA 1NA1C 2WAOA 1EAH1 3DCQA 4Z82A 2NN8A 2WZEA 3ILRA 3DYOA 4KGGA 3BTZA 1CX1A 2I74A 1UD1A 2AACA 2X10A 1QOOA 3RYRA 4CRQA 2ZEWA 4DRVA 1QXJA 1DQ6A 5FPVA 2ZGKA 1TNFA 1O3RA 1F5FA 2EIBA 1RUD2 5JI7A 4DIQA 1YJLA 2C5DA 4QQLA 1CONA 1HX6A 3EJKA 3GZEA 3KF5A 4AQ6A 3TN93 2A6YA 3AJYA 5I8TA 2XHKA 3AX4A 1O4ZA 1RUH2 5F32A 2DUOA 1OFNA 2ZHKA 1S4CA 3PUSA 4EJRA 3BTYA 5HCFA 4E8CA 5G04L 1C3HA 4XURA 1UO9A 4N53C 3IKWA 1MS3A 4QX2A 4S2DA 4XF4A 1C1LA 1HRI2 1XXNA 3C7OA 3TB0A 1QU0A 1J3PA 4AI2A 2RDSA 3OSDA 5C9AB 2GC0A 2WUHA 5A7WB 5CAZA 3FN9A 5APAA 1SLLA 5LK7B 1RVF3 2CGPA 4CDXB 3THTA 1DLLA 1LHWA 5IWFA 5C3SA 2TNFA 4LR4A 1DQ1A 4KQ7A 4S2HA 4NHKA 4DXRA 3AB0A 1UXXX 3A7QA 4YGBA 4ZU7A 2JDKA 4AW7A 3T4HB 5CFCB 1MQTA 4CDWB 3WF0A 1JS9A 5F3IA 2AC1A 2AUYA 2BGOA 1HJGA 1JYCA 2E6VA 2IXHA 4XJZA 3LB9A 1OOPC 2BNNA 3CKHA 1D0GA 2P34A 3ZYIB 4F8AA 3BPZA 1MVQA 4GJYA 2VUDA 3USUA 2BUKA 4RR3C 3JQWA 1JBCA 1GNZA 1W2OA 2E7QA 5FYUA 4MVTA 4WVZA 3RYKA 4PJYA 3T1MA 3O0WA 1FNYA 4CCJA 1HRV2 1IS5A 1LTEA 3AZVA 3PVBB 4IE0A 1HLCA 4XHBA 3SCFA 4UW3A 1C1FA 3T4VA 4IQPA 3W5MA 1OT5A 4KI5M 4LXLA 2WWUA 4HG6B 3VZKA 3HBZA 2L9LA 4IEYA 1P8JA 3QH7A 4LLOA 4QQ2A 3WNLA 1QEXA 3V64A 1CZTA 4M0NA 3OBZA 5LEJA 3NVCA 4FXGB 4R52A 1ND2A 3HQUA 2B46X 2YV8A 1WZXA 1UX6A 2O1QA 1CWPA 2HJIA 2VGDA 1DZQA 2WO7A 4YZ2A 4KU7A 1LHUA 1ENXA 1U5ZA 1LGBA 3ETQA 2HWB2 4GMP0 1B35C 3LEIA 4RQPC 3WSOA 5KXDA 4L9BA 3RJ2X 2B7YA 2DTWA 1GYKA 3CZUA 5H9SA 4E4DX 1VIWB 2XONA 3RSJA 1V9U2 3EYPA 1OFSA 1C4RA 5A32A 1V6NA 5EHDA 3BVCA 2XJSA 2AH2A 3CZJA 3EQEA 3ZPOA 2ZS6B 5JPNB 1D4M2 5C3PA 1EYBA 2VMEA 2KM2A 5FP3A 3WNMA 1UZWA 3ITQA 1XQNA 1DZRA 2JICA 1G9BA 1ULOA 3VZOA 2FD8A 1OA4A 1H8TC 4COVA 4DXTA 5FZ9A 2W5FA 1ULGA 4XBNA 5FZOB 4QWNA 3ZKYA 4BISA 1ZZ7A 5BNNA 4OI4A 5DXDA 1QJY1 1R093 4Q0QA 1PO12 3FUOA 2QDRA 1CAVA 3BCWA 2ZXQA 4MOAA 4XIOA 5FKBA 5LA0A 3NW4A 2AGSA 1H0BA 3GZUC 4H14A 1LOGA 3DXTA 3IPVB 4LTAA 5DUVA 4OZOA 1WCKA 4UF0A 2G19A 4HOOA 1QMJA 2JG8C 4X6RB 4YPJA 2P3IA 4GB33 3P1IA 2B45X 2VPVA 1ULDA 4XFCA 1J58A 4D6SA 3IDBB 3ACGA 1NAEA 1JU3A 1JW6A 2CNAA 3BN6A 4BZ4A 1QGLA 2RS32 1UU4A 2YFUA 1XPWA 4P9JA 4NUBA 3ZYPA 1AUYA 4AHWA 2ZGSA 5FZAA 1PK6C 2WZR3 5KC6A 4JGZB 3I2OA 5DABA 3ZFFA 2BEOA 3T3YA 1N47A 2XVLA 1VAKA 3I2IA 4LA3A 4QD2A 4QB2A 5FZ6A 3RDIA 1PMJX 2Z2SB 3RQ0A 5C4WC 5JOWA 2VVFA 4M01A 3E97A 4LKEA 2BW8A 3I2GA 3NAPA 1W6QA 4JX0A 4P5HA 4ATFA 3B93A 3ECQA 5KHHA 1TG7A 4QPGC 1CN1A 1UIKA 1C28A 5C8WA 1LRHA 1XBFA 4UBHA 4BQXA 4B1LA 2R041 1A8DA 4IEXA 3BTAA 1GU3A 3X29B 3S0MA 2DFBA 5JAXA 1IPKA 1BBT3 2A75A 4G3YC 1RUE2 3KCCA 5CISA 1BLZA 4YFWA 5CZKA 1W8HA 4QPIC 1C8M2 4AEDB 4INDA 5F7UA 5JXGA 1F5JA 1QNWA 1CZSA 4QKDA 5C33A 2HKXA 2GSYA 1MACA 1RUI3 1V6JA 3AJZA 2B5HA 4IGQA 2O0OA 1OURA 4CUGA 4BHPA 1MZ6A 3AKTA 5JXIA 1UPIA 4OCTA 3TAYA 1H6XA 4CEWA 2DTYA 2GAUA 1ST8A 1ZVFA 2NM1A 4NAMA 5JPMB 3I3QA 4ARYA 1WD4A 3N7MA 1OC1A 1DHKB 2Q8OA 1ZBA2 3AXDA 3BU7A 4META 4CCMA 2VZSA 3AMMA 1YHFA 3ZXAC 2W1UA 5GZCA 4F83A 2CGOA 2WFPA 5FQ0B 5AC92 5H9PA 5B4XA 3N9OA 1BK1A 1WLCA 2JENA 3E5UA 4ISQA 3AC0A 3E5XA 5LA2A 2W91A 4AZZA 5ACA1 2E26A 1W6MA 2A6ZA 3H0OA 5DG1A 3BI3A 2JX9A 1RUJ1 3H7JA 3O0VA 2YY1A 4Q0SA 2LUWA 5SV5A 5DUWA 5FP7A 4V2WA 3DN7A 3TYJA 3MLKA 2JDPA 5HI0A 4BB3A 2RJLA 2ERFA 4XF0A 3CL1A 4JGYA 4COUA 1ZRFA 1XOYA 1LECA 4Z2WA 1BYHA 1MZ5A 3PIGA 4I02A 3U0ZA 1T6GC 5FMCA 1DFQA 1YEWA 2PQQA 1POV0 2Q30A 2WFF1 1ZRDA 1N1TA 2XWBB 1CX4A 1AR83 2B9VA 1IQDC 3M7AA 1CAWA 1C8NA 1YQ5A 2W3JA 3OGVA 1SLIA 3CJIB 4NAOA 2WYSA 4BQ3A 1SQ4A 4URAA 2WNUC 2QFEA 4Q4Y3 1WCDJ 2A5ZA 5A3WA 1JYWA 3KHCA 1PK6B 1VMJA 2RMU1 5BNQA 4LO8A 2VZRA 1RMU2 4YW2A 5A7SA 4GIQA 4LUKA 5K4LA 1CESA 2P17A 3C7FA 1ACCA 5D8AC 4RHV2 3OOXA 4XILA 1VBC1 3WW3A 2W46A 4UW6A 4LO5B 4XYXA 2XR4A 5B2GB 1AR93 3CF6E 3NRUA 1SLCA 5BNNC 3JD71 4CDUC 2J7MA 2PHXA 3JUUA 4KBBA 3ZPYA 2YBKA 1POQA 1AL23 2B4KA 1RJ7A 3U4XA 1UZZA 1O59A 3I4IA 4B4QA 3KV6A 1VPHA 4MGTA 1GMMA 1KJLA 1HB3A 2ZCWA 1ZBE3 2RE9A 5FY4A 1W8NA 5JSOA 2OT7A 1XE0A 2W1SA 2ZEZA 3O14A 5AFEA 1ASJ1 4D7YA 4OUMA 4HK9A 5FY1A 1ND3A 5FZKA 4M4PA 4Q1RA 2K0GA 4GWIA 1CGPA 2GNDA 1SEFA 1X36A 4YM1A 4DXZA 1CIYA 4QB6A 4D6RA 4SBVA 1ZREA 4D0QA 1RJ8A 4LBKA 1UKRA 2G4IA 3ACHA 4P9GA 5T5JA 3ZFFC 4Q4V1 1JYTA 3FLTA 4Y5Z0 4L8QA 5T52A 4JAAA 1RINA 2WNVC 1LNSA 4BM8A 2FDFA 3BPSA 3RFRA 3VBHA 1E5IA 1PO23 1OQ1A 4FOQA 5FZ0A 1GZ9A 1LENA 1UIJA 4QB1A 2CU5A 3RS6A 1Z7S1 4E2GA 2QKDA 3CNAA 1W99A 5CFDC 1CZVA 2WA4A 1OVPA 4EZHA 4N43A 4IV3A 3GYDA 5T5OA 2FHRA 4BU2A 4Q4W2 3E6BA 4YW6A 2RM21 4WM8B 1HB2A 2VQ0A 2ETEA 2GU9A 2OX0A 3KV9A 3L2HA 3LDRA 5FAXA 4NVPA 4ZY9A 5DUUA 5IVYA 5FPBA 1R083 4CE8A 2WZ8A 1VBD3 1F9KA 1OH3A 3ZR6A 1H2MA 4Q4X1 5C5UA 2XKOA 2RVAA 2ZA9A 4JDNA 5FKCA 1W0OA 4WZCA 4CDQA 1WMDA 3VHRA 4FSJA 4LNVA 1WD3A 3C8XA 2YU2A 5CADA 5IFTA 1ZNPA 5JZGA 1YIPA 2FQPA 2N7GA 4D94A 3MPBA 3V0AA 4XC9A 4JRAA 2IZWA 2Q0AA 1PIV3 4YYOA 5HCBA 3ASIA 2VNOA 3VN4A 2DURA 3PU3A 4YRDA 4B7KA 4CVUA 1E57A 5BNPA 1M4WA 3VHPA 2GMPA 3VDBA 4PIZA 4OI0A 1DQ0A 4YG0A 1FPN3 3GNEA 4JTOA 4LHNA 4XVHA 2VTFA 4EROA 1ZRIA 1SLBA 3PUQA 2WS92 3VBSB 4GULA 4KWKA 3KF3A 4K9SA 1DGRN 4YVSB 1O3QA 4XUPA 1ZA7A 1A78A 3EB7A 5J09A 2BQPA 1NCRB 4DXSA 2RS12 1TVGA 4NHYA 2VOTA 2WO2A 1SBFA 2PLV1 1V6IA 1FOD1 4UOJA 1AR62 1PVXA 3OEBA 1TMF3 2VO5A 3AP5A 3MIFA 5A3PA 1UYYA 5HXVA 4TZDA 4EN7B 1EUTA 4HL0A 1GBGA 3I7DA 1W6OB 4ISRA 4XAAA 2DV9A 5FPAA 5A1LA 2RS52 1OLME 5JCTA 1HQWA 1YCIA 2VOVA 4FPLA 5T3NA 3M3CA 5DPNA 1YFYA 1RHI3 1EV11 4LK7A 5IVBA 1US2A 4Y24A 3IAQA 3VDDC 4LBOA 4MSVA 4XQWA 2Q1FA 4Y1UA 4HFSA 4Y5SA 5CBLA 1FT9A 3VHOA 5DDJ2 3Q9OA 1RUG1 2P2KA 1GLHA 3KVBA 2XLFA 3GM8A 2UWAA 3GGLA 1N3QA 3FFQA 1Z78A 3WNXA 4BJ0A 1AX1A 3VHNA 1MEC3 4ZXEA 3BIWE 3H8RA 1GQGA 1GOGA 2XQXA 4AFBA 2X5IB 4S2GA 1YYNA 2VUJA 1O5UA 1JOBA 3UYJA 1YFUA 5I0SA 2MNGA 4BQ5A 5F2SA 2DWRA 3NMBA 4LEJA 2D6MA 1MZFA 1VALA 3E6CC 1LAJA 4D3WA 3WT3A 1JU4A 1ND3C 2A6VA 2QCSB 2D6KA 4CP2A 2JKBA 5A3NA 1VRH3 3ZX7A 1Q3EA 4B1MA 1J3QA 3TN91 2GC1A 5A7OA 3DL3A 3ROUA 4EQVA 1BQPA 2UY9A 4XOGA 4ZU4A 5FV3A 1AX2A 2VAUA 1OPOA 2A3XA 1VBA2 1OD3A 1YNAA 2FBEA 2WSVA 3LSDA 3PURA 4HPKB 5JSPA 1RUD3 2IXKA 4FPEA 1R1A2 3AVSA 3F95A 4FFGA 4BXSV 1MPXA 4QMAA 1COV2 1BZWA 3J4UH 4GMP3 3W9AA 2NMNA 3OBTA 3GZTB 4XETA 4XZUG 3SEPA 5L7OC 2WIIB 3RYPA 3RZJA 5D1IA 1RUH3 5FBJA 4QQPA 4PDWB 1LCLA 1RVF1 4WBBA 5IUQA 1OLQA 3LWCA 1XSQA 1HKDA 3WF1A 5IVCA 2Q1ZB 2UU8A 2J1AA 2VMHA 1RUF2 3J7LA 3POBA 2DCYA 5FP9A 3AMPA 3RVHA 4OHVA 1HRI3 2YGLA 3KB5A 1AYN2 2C26A 2VQTA 5FY5A 4LKSA 2LS6A 2OVUA 1OUXA 4QKFA 3Q8AA 5L9RA 4AVBA 3LIGA 2PHFA 3ALQA 3I2KA 2C9KA 5H9RA 1MS1A 4V2VA 1BMV1 2A70A 4HSLA 1GP6A 5FBZA 5I0UA 1ENQA 2DBNA 2JE8A 4ITCA 5KR7A 5L9BA 2QE3A 2WINB 1BJQA 1W2UA 2P6HA 2PHDA 3MO4A 5TSWA 1I1EA 5HCHA 4YM0A 5F9TA 3H3UA 3HT2A 3K3NA 3VBRC 1AR73 3MLJA 1RGSA 3KCYA 3K4DA 2XKPA 4XJWA 2HWD2 5LB6A 4IGPA 1WMFA 3SEEA 1GZCA 1OF3A 3HNYM 3O0XA 3J8F3 4ZKTB 3N9NA 4AVTA 4DFSA 4BMBA 1K42A 1NA1A 2BPA2 1PZ7A 1U5IA 4QHOA 1UW8A 1HRV3 4QX5A 1W05A 5GALA 3WG2A 3J26N 5K9YA 3Q8EA 2ARXA 2XL9A 3HQRA 5JR2A 1IS6A 2ZMNA 3AKPA 5FREA 3THPA 2IUWA 2JG9B 2VMCA 5A7QA 3A0NA 5EJ1B 4I01A 5CG9A 4JCKA 3NJYA 1XE8A 5GZDA 4HT1T 5LBFA 5A3MA 5FYTA 3NSTA 1T2XA 2XBO2 2VQAA 1BXHA 1NLQA 4BYYA 3THCA 1FMD2 1F15A 1RIRA 1K5MC 4XUNA 3WCRA 2W47A 3K48A 3W5NA 1YQ6A 4KMQA 3ZN4A 4B7EA 5I0DA 5F2WA 2BGCA 3WXPA 3TBDA 4M0HA 1V9U3 2QQIA 1SFYA 2P37A 4IV1C 3VKNA 4CYDA 3O12A 1AYM3 4N53A 1JZ5A 4AXOA 1S0IA 2D6NA 2RR12 1BVP1 3IPVA 3PLQA 4XJ9A 5F3EA 2VD7A 3AP7A 3OY8B 3E6DA 1D4M3 1MS0A 1R091 1US3A 2IWGB 2R6QA 2WBKA 2NQYA 2VXJA 4DPNA 1W6NB 3OBAA 5JXHA 1UY4A 2JDNA 4GH4C 4LULA 2GMEA 3WDWA 3FFZA 3VBOB 4COYA 5A3TA 3I59B 1SDWA 4XUOA 2VNVA 3GJAA 5FXVA 2ZGOA 2BYVE 4YM3A 1SBEA 2I07B 4GB31 1Q8PA 3T0AA 1HQLA 3LFIA 2ZBJA 3KQ4B 4COWA 4BXFA 2WN3A 4HMZA 1RUC2 2ATFA 5FYSA 3VKLA 4XZPA 1PGW2 5A33B 3MHZA 1GFF2 1GP5A 3I54A 1OOPA 1W8WA 4X8PA 5FYZA 3BGAA 1PNFA 2WZR1 5A6YA 4PI0A 4L97A 4URTA 4RR3A 4MGKE 1GKBA 1KFUL 5LASA 4AQSA 3RZGA 5FLIA 2OA2A 1W3XA 1FX5A 5FXZA 3TEXA 4QHBA 4Y20B 2RS33 4QQOA 3FUQA 3VKFC 3AL6A 2PQSA 5FK7A 4Y1VA 3WF3A 3WQ0A 3LIHA 4GA9A 4JTNA 1XSRA 3AYEA 1Q8OA 5FYCA 2D93A 2A1XA 3VBRB 5C9AC 1GZWA 3ME2A 4AEDA 4OUSA 1LKNA 5DZGA 1UU6A 4CDXC 5FO8B 3OG2A 2VY0A 1QJX2 4JKLA 5EJ3A 4XUQA 4Y4RA 1POV3 3OGGA 1BBT1 2MHFA 3OGSA 2R16A 4NOTA 4MXVA 1PGL1 2JJ6A 4Z8BA 5LY1A 2OW4A 3VGIA 4IEWA 5C3OA 1OSGA 4RQPA 1B35A 5CFCC 2WAAA 1QJY2 5EV7A 3SITA 1XU2A 4HVQA 1XNKA 3OUHA 4NR1A 3AM2A 4CDWC 3CU7A 4NHLA 1CAXB 1RUI1 2X8KA 4NIAA 2DF7A 1DP0A 5FXXA 5DMYA 3TWIA 1JI6A 3V65A 2CYFA 4XF3A 1C8M3 3DPRB 4BQ1A 2HH9A 4AG4A 1BEV3 5FYHA 3KHBA 3ZYFA 1W9WA 3AK0A 1CD3G 2GP5A 2WNOA 4XTMA 3T30A 2BZDA 2WQ4A 3UGHA 4I30A 4CP9B 2FDKA 4YGEA 1WKYA 2JE7A 1PX4A 1W2AX 3IDAA 3SMHA 1STMA 1K3IA 3RWNA 4YARA 4YSFA 3CHXA 4UWDA 2Y64A 4GKYA 4M3CB 4BLIA 2CDPA 5A3OA 2BBAA 3T1LA 3AP4A 3MEPA 3PTYA 4LKFA 2H6BA 1ZBA3 4QPYA 2EXHA 4K8FA 2HEVF 2YROA 3M1HA 2Q1MA 2BVVA 2EXJA 5DAWA 5GM0A 3J7NA 5LEKA 2FDHA 2JDMA 4WVWA 4AAPA 2A6WA 3SQOA 5JMOA 2JG8A 1QHDA 2P3JA 1QXPA 5AC93 1AXZA 4MGYE 1GV9A 2R0FA 3BALA 1I6XA 1IOAA 2C1FA 4GH4B 4A45A 1W6PB 4QM9A 3AYCA 2WL1A 2OPWA 1PHMA 2Y33A 5LBBA 3VBUC 2RJ2A 4XIKA 3C7GA 1V6LA 1ULFA 3CJIA 4AR2A 1OD5A 5IFPA 4MLOA 2ZMLA 1JODA 1UXZA 1ZA4A 2ZZQA 5JLVA 4A44A 1AR81 1PK6A 3U1XA 4D6QA 4Q0VA 2GN3A 1ONAA 3B5LB 5C4WA 4ZHNA 2TBVA 3WD5A 1G9FA 2YBSA 2RDRA 3AKQA 4Q4Y1 3ZYBA 2J1TA 4NHMA 4H3WA 4IE7A 4AGRA 5ISLA 1FYUA 1HIXA 1QH6A 4QPGA 4Y26A 2A7AA 2D97A 1DYKA 3ATGA 4HKWA 4Q4X2 2ZKNA 1RYYA 1QOTA 1O3TA 1RUOA 3D4KA 1AR91 3ZFGB 1GOFA 4ZZ5A 4AI8A 1O91A 1NT0A 1ZYBA 1NXD1 1Q8SA 3U75A 3K46A 4XFAA 3AZXA 4LA2A 1AL21 4QPIA 4FPCA 4PBPA 3PJQA 1LHVA 1RMU3 4XF1A 4L11A 4IEOA 1KDMA 3TNQA 4B4PA 4LOTA 1GQPA 3NJZA 1NX9A 4UI9L 4RGKA 4QX0A 4W6XA 5CKMA 1ZBE1 3FL7A 2CL2A 4P9YA 5C5TA 4DUXA 4YG6A 4P02B 1BK0A 1DYOA 2ILMA 2JIJA 1T6BX 4I09A 4A7YA 2WNEA 4JGZC 4PCRA 5JMCA 3S7EA 1HV0A 4FTBA 4COZA 1ZZ9A 3WR0A 1SACA 4LLFA 2XJUA 5DAXA 5F5CA 3WP4A 1HXS3 3E5QA 3LQCA 4IGOA 2J1VA 1ZRCA 5BYNA 2JB4A 1S0FA 1TME3 1E5HA 1X9PA 1W8UA 2FCUA 4NE9A 1DQ2A 2XUMA 2VMDA 3UGGA 4TLFA 3T08A 4YNIA 1PO21 2V5DA 2Y26A 3M4FA 3WW4A 2CV6A 3Q8BA 1WW6A 5JIAA 3WG4A 2FMYA 5H9QA 2RMU2 1Y9MA 4AEDC 1YLLA 2B9UA 1W3VA 2R1DA 4DO0A 3OGRA 3N7JA 1Y9GA 4C0BA 4W65A 4CCLA 4YW4A 2IXIA 4XUTA 4V1PA 5FZFA 4XCBA 1FXZA 2GNTA 2UYAA 5FK8A 3W21A 5FZBA 2G9FA 5JOXA 4QGLA 3O1SA 3ACLA 3JD72 3OPZA 5AFBA 2W2IA 1R081 3GBWA 4KNCA 1O6UA 1VBD1 5FMDA 3NV4A 1H4GA 3CBNA 5CU1A 1KEXA 2VZPA 5DN2A 3U14A 3O1VA 1W8TA 4TWTA 2GC3A 4RFRB 3VBUB 2XJQA 3ZYRA 4Q4W3 2WA3A 1OPMA 4RSUA 4WZFA 1A34A 5FZCA 4AEJA 1R64A 2WNUA 1GP4A 3GCXA 4FFIA 4CXYA 1ASJ2 2XG3A 1U5YA 1QJZA 1JN2P 4N8MA 1PZ8A 2W92A 2CTVA 2V5YA 4NRPA 2GZWA 4E4ZA 1UOGA 1PIV1 4I3PA 5D8AA 2W87A 3ZFEB 2R073 1SDDB 1J84A 4YZ4A 1FATA 2WN2A 3H7YA 3PU8A 1JXNA 4FPYA 4D69A 1O8PA 2VM9A 4CDUA 3GHNA 1FPN1 1WCSA 2XMLA 3ELNA 5CNAA 3WP5A 1ENRA 2LROA 3R05A 3SNMA 1ENSA 2XJPA 4PLNA 5HXMA 5KHGA 3H8OA 4I3GA 2BFUS 5DAQA 2DBIA 5G05L 1SLAA 4JZRA 5BXXA 5KBFA 1YFXA 3LAGA 2ZGMA 1G6NA 4W4ZA 3NWKA 1N1SA 1W6OA 5E6HA 1JYNA 5FZDA 1KXGA 4SLIA 2EA7A 3KD4A 3D8CA 2AENA 4BOWA 1ULPA 1TMF1 1Z7S2 1RL3A 3K75B 1ZX5A 2G9ZA 1TNRA 2WDBA 2WS93 3W20A 3S6PA 1WWYA 2HEYF 4J6GA 3WY6A 4XEZA 3CJIC 3ZMOA 4Y3OA 3ZO0B 4HETA 5KHIA 3VD5A 1O4TA 2RM22 4LHKA 1DG6A 2RS13 2A6XA 1AR63 5FY0A 5IK4A 4AK3A 4R9BA 3FE5A 1RHI1 5F8PA 1J1TA 1KJRA 4OHWA 4R4XA 3RMXA 5BV6A 3FBYA 3KV4A 4FPJA 1O8SA 1UKGA 3H1WA 2WNVA 2XVKA 1YXWA 3PJYA 5M0TA 5GLTA 3POWA 3AP6A 2EALA 3NNLA 1PVC2 2Y6JA 4Z1VA 1YI9A 1KFXL 4ZXKA 4MUVA 5CFDA 1CQ9A 2E51A 4K8RB 3KS7A 2XPJA 1NZCA 2VG9A 5CVRA 1MEC1 2B39A 1EY2A 2QJVA 3WVJA 3D0SA 4QGNA 3ZXFA 1O5LA 4OUEA 4P5YA 3OYWB 5IVVA 5CKQA 3C3VA 4HBNA 1A8MA 3B94A 4HONA 4LBQD 5DDJ3 3HD8B 2DCKA 1JYIA 1NCQB 2DUQA 5IVFA 2ARAA 1ZZ8A 3QD6A 1OLRA 3PDQA 4EWDA 2XLGA 2Y60A 4YM2A 4FVVA 2DU0A 2QNKA 3VD3A 3K4ZA 3M3IA 4HZFA 4XXAA 4HPKA 4Q0PA 4ZS3A 3UKTA 1VRH1 2NYYA 2PLV2 4CP1A 2PMWB 1FOD2 1X7NA 1UY0A 2JWPA 3AZWA 3LEGA 1W9YA 3T2PA 2FCVA 2XXZA 4PI2A 5LZ6A 1F4HA 2WT1A 4AGGA 1H1IA 2Y6FA 3Q8CA 4RYDA 5ERLA 5HV0A 1RUD1 3VV1A 2IXCA 2UYBA 3SLIA 2BOJA 5BPXA 4AE2A 2E33A 2D6OX 3MF6A 4GMP1 4H7LA 4YZ1A 1LB2A 2WO1A 5I8YA 1XE7A 1VAVA 1VLNA 3PUIA 4XMAA 4CUBA 5C8CB 4TYSA 3BYWA 1EV12 5K0UB 1LOFC 1RUH1 2OXBA 1VBA3 2V4AA 3S57A 4CUAA 2W1QA 1DGRA 4WM8C 5FPUA 2BJSA 5CG8A 4DRRA 1UMZA 3IB3A 3G7DA 1COV3 2DCZA 3LDBA 1RUG2 2C4XA 2LM3A 1LOEA 3J7HA 2HLEA 1HRI1 3ZYGA 1KS5A 5C70A 2TUNA 4Y22A 4YWAA 4XFFA 2PXJA 1UN1A 1CAUB 3ZN6A 1DIWA 1N1YA 4LQRA 1I3HA 2OUJA 2ZGUA 4HN0A 2FDGA 1AXYA 4BK5A 3UJQA 4CEYB 2ZAAA 2KD7A 1S0GA 1RUF3 2CDOA 4E2SA 3BIEA 1G8WA 3LA7A 2VNRA 4JKMA 4MXWA 3MIBA 2X29A 4RS5B 3WNOA 2YHJA 5IK7A 3NNFA 4LITA 2R063 3S5QA 1VMHA 3VDDA 4I2OA 2F6BA 2VBBA 2E63A 2MEV3 3DYMA 3MW4A 2DFCA 4LHLA 2WJSA 1AR71 5FY9A 1OI6A 5AVPA 5FMOS 4AI1A 3WUDA 4Q8LA 1FV2A 3SKVA 3L9JT 4D7TA 1LEDA 4AQTA 4DZGA 1YWKA 2HWE3 1XC6A 2AEZA 2W0XA 3B9CA 4LMFA 4XFIA 3TN92 1VBE3 3J8F1 4J25A 3RWKX 2J1EA 3ZXGA 4YVSC 1R1ZA 3SHRA 3NNJA 4QX7A 1HRV1 1JHJA 1NCRC 3LA2A 2BWCA 3I49A 2HWD3 3HWJA 3FJSA 4XDQA 3KZ4C 1XNDA 3M8LA 3AZYA 5BY5A 5FO9B 1OLMA 1C57A 1D2SA 2ZHLA 3VDAA 3A4UA 4A41A 1VBB2 2JDZA 3VZLA 1NYWA 3OTFA 2RG4A 2HYXA 2PHRA 2YC4A 2YMZA 4UBGA 1RC6A 1H4HA 5A1FA 3V0BA 1E5RA 2V72A 3RGBA 4BMEA 4Y1XA 4CPBA 4IW3A 1QKQA 4XACA 1FNZA 1KS4A 1V6MA 2RV9A 4FPHA 4DUWA 2WT0A 5F39A 2R30A 1DGWX 1V9U1 2ZOEB 4D7SA 4EN0A 3KT1A 3LEKA 1AYM1 1IG0A 2B42B 2XBO3 5CYYA 5CKNA 1BMV2 1JZ4A 1QJU2 1XJAA 1IPJA 1FMD3 3OD4A 1KITA 1XB9A 1D4M1 5L7OA 1UNBA 5LRRA 3N3HA 3QBQA 5IK5A 1URXA 2BTVC 2ZGQA 1NY71 3ZXLA 1DQ4A 4E9KA 4QDRA 1PM7A 3D3AA 2XUEA 2X5IC 2WC2A 3N7KA 3Q8FA 5A7NA 2QZ3A 4FTSA 2J1SA 4OLLA 1S55A 4NIHA 2RR13 1DBNA 3PMSA 4LIUA 5FYBA 5A33A 5IYYA 3H1MA 1MQTB 2O8OA 2ZGTA 4Y1YA 4QDQA 4GAZA 3KT4A 2VZVA 3MV11 3TEZA 5KWRA 5HV4A 4Y20A 1LR5A 3USUB 3NV2A 1UPSA 3ES1A 3HIFA 3P5BA 1OQDA 5FZEA 1RUC3 4UFMA 3VBRA 2Q8CA 3ZOIA 1GUIA 1F8VA 2RS31 4Z92B 1H2LA 2QQJA 1IZ3A 3VD4A 2QQLA 2DVAA 1XNAA 4CU9A 4DY5A 2Q8EA 3WLUA 5J36A 1J83A 4LBQB 5I8SA 2LRPA 4AI0A 5E88A 4MV2A 1XNCA 1DLCA 1FAYA 1ND2B 1UMHA 4NRMA 4PDWC 3WG1A 3VD9A 3VBFB 1WLTA 1SCRA 4EWAA 1POV1 2YYOA 5A1AA 1OQEA 1FI2A 4FPGA 4L92A 3GBFA 4Q1PA 4DINB 2Y0OA 5BNOB 5FLHA 4L99A 2HEWF 2HWC2 3WP6A 3HN3A 4QXKA 2ZX3A 1IG3A 2DDUA 3QOPA 1SFPA 3DPRA 3ZLIA 3F2ZA 3POSA 5A6QA 1QJX3 5A32B 2CSGA 5CIRA 3ZN5A 4CP9A 1SBDA 3KM5A 3C7EA 1AL0G 4K7JA 1C8M1 3EBRA 2D6PA 1EP0A 1K5MA 4GB32 4I0BA 1BEV1 1I5ZA 1JOJA 3T09A 1VR3A 2D6LX 2W1WA 4M00A 3ILFA 3LD8A 1UL9A 3O1RA 3PTRB 2BFUL 3IM0A 4AAXA 3I3MA 1MR5A 4IV1A 1NLRA 3TEWA 1DDLA 2EIGA 1CPMA 3VZNA 2XHNA 5EP9A 2WZR2 1YFWA 3FLRA 2JDAA 3ZKUA 3WG3A 4LT5A 2JIGA 3A23A 4IDZA 4GH4A 1PMIA 2PHLA 2WO3A 2JXAA 5GZFA 4UF0B 4NIGA 1K5JA 1VRBA 2CWSA 4UFLA 2W52A 4JDOA 1XYPA 4LUMA 4AFMA 5AC91 3PHMA 2JG9C 3RZLA 4QAWA 3OUIA 1L7QA 5EYXA 2ARBA 2VZ1A 4GALA 2P6CA 3N35A 2PTMA 4XBQA 4BQ4A 1FV3A 1F2NA 4XE9A 5FUNA 3JB4C 2F17A 4FI9A 1BBT2 3KV5A 2BDRA 5DZEA 3WDTA 3WF2A 1PGL2 2YG0A 5GLZA 3SH4A 4LJHA 1HN0A 3JXSA 2OZ6A 2RDQA 2W39A 2WRAA 3UKVA 1TQ5A 1QQP2 1V0AA 2XDVA 2GDFA 3N9LA 5JI9A 1X82A 3NAPB 1W6QB 3NJXA 3H42B 2ZHNA 2GMMA 3JBG2 2HWF2 1IGOA 4J1XA 4R4ZA 4CCDA 3VLBB 4EE2A 5C9AA 1RXFA 5A7WA 2JD4A 4C0HA 4IESA 5T50A 1JH5A 3VBOC 4CDXA 2CWMA 4BCUA 3VZMA 2VH9A 4ASLA 2BV4A 3AFGA 5F5QA 4WVVA 3WV6A 2Z42A 1O4YA 4O9EA 3EMRA 3O1OA 3P3NA 2GH2A 1RMU1 4XPVA 5T5LA 1G9CA 1UZ0A 5GKAC 4GXLA 1IKQA 1BKZA 1QH7A 2PHTA 1UQXA 3BB6A 3URFA 5CFCA 5ANQA 2XLAA 3B00A 4FQ4A 5JR7B 4CDWA 2RJKA 3MIEA 5E8AA 3ZXDA 3PVNA 2XH6A 3FHAA 2BOIA 1W9SA 1IS4A 4UFJA 4CEWB 4OHYA 3DYPA 2VW1A 1UY2A 4JHZA 1W8ZA 4PF5A 1DU3D 1EAH2 4ASMB 2R32A 1W9TA 1F35A 3N9PA 2VMGA 4GWJA 4GD4A 4PLOA 1HXS1 3UK9A 3UETA 4CUCA 5L19A 1W39A 1LU2A 3W59A 2QTWB 3VZJA 1ZRRA 4OI1A 1TME1 3VL9A 3CO2A 4JRLA 2CAVA
chains in the Genus database with same CATH topology
2GH8A 4NO4A 4PIXA 1AR82 2CGNA 2W08A 3WCSA 3I8TA 3LA3A 4DS0A 4HANA 5K7PA 3M70A 3WP3A 3ZMNA 4Q4Y2 4M3CE 3RG0A 2LALA 5F6LB 3FX3A 4P14A 3MF9A 1UZYA 2VOKA 2PA7A 1UCXA 1YI7A 3VBUA 1AR92 2Z79A 2NLRA 5FMOL 3SCGA 4YW1A 4AVAA 4DY3A 1HQNA 4HK8A 2A71A 2SLIA 3DPRC 1CAWB 1PGSA 4H55A 5JWPA 4WV8A 4Q4W1 1PZ9A 2OPKA 4Q26A 1LOBA 2VUAA 1OKQA 1OHFA 1H9PA 3AMHA 4OZXA 4S2FA 2WWSA 4AQ2A 3FHIB 2HWB3 1Y9QA 3GALA 1NE6A 5JOYA 2WZPP 3H3ZA 4MGIE 2R071 3IIAA 4J1WA 5J37A 2Z5WA 3WZ1A 1ASJ3 2XJTA 1XYOA 3B02A 2BNOA 2AZ5A 1GICA 2ZX1A 3KGZA 4K3UA 1UU5A 3LGRA 1PO22 3O5SA 3KT7A 1PO13 3OCPA 4QU2A 1OA3A 2WS91 3NKGA 4JGZA 3H1YA 4YZ5A 4UW4A 5FFOC 2VU9A 1CR7A 2DVGA 1ZZCA 4R8HA 1LOCA 3MIGA 4RL7A 4ATEA 2RS11 4QT6A 1AR61 1N3PA 1KRIA 4QQHA 1MS5A 1DZTA 4XBLA 3IBMA 1YO8A 4WM7C 4IXLA 2KXLA 2FZ2A 1U0AA 1Y3TA 2D5FA 3VBHB 1IHMA 5KHKA 3ZFGC 2D44A 5IT6A 2RM23 3H50A 2D3RA 1AJOA 2BWAA 5DG2A 4N43B 4IV3B 2WSUA 3PMEA 4MX3A 5JIUA 3OBRA 2ES3A 2E9QA 3ZYJB 4YVWC 5DDJ1 3L2YA 3FWEA 3NO8A 1G86A 1PVC3 3B7MA 1FPN2 3IMNA 1J1LA 4AVVA 1CVNA 2DU1A 4KWJA 4EN6B 3AKSA 4HN1A 4CDQB 4KL1A 4FPKA 3IT8A 1RUE3 2IFWA 3HR9A 1NG0A 2VW0A 3WINE 3ZSJA 5JZGB 5KHJA 3V0AB 1KD7A 3PVEA 5FQ0A 1JHNA 4B3NA 5K8SA 3D5OA 2K2SA 4P9XA 5BNPB 3VUOA 1N3OA 1X33A 5ABJC 4N7UA 2VMIA 1AHSA 3JZVA 1AVBA 3EXUA 2VVEA 1RHI2 3PNAA 4FOVA 1VBA1 3UL2A 3AXEA 4LO7A 2DCJA 2XGXA 3K51A 1AJKA 1COV1 2VW2A 2H0BA 1RUNA 4WVMB 3ZDSA 4HKLA 2R042 1BCXA 1EPZA 4YZ3A 1MEC2 2QQPA 2Q4SA 2D3PA 4OULA 5GZEA 3MZHA 3BODA 1WBFA 2AYHA 1RUF1 5EZWA 2CAUA 2TEPA 2A3YA 5EWSA 2R061 1REDA 5J3UA 3ZFEC 2MEV1 3AFKA 4DNYA 1LU1A 1LGCA 1JUIA 1U5XA 4CZSA 1VRH2 3WUCA 5KC5A 4WM7B 2HWE1 4YW3A 1VBE1 1DF0A 3CJXA 3PVOA 1MZEA 4BIFA 3V56A 2HWD1 5AVAA 5F6KA 3CEWA 1C5IA 2IXLA 3ZXKA 2D3SA 3M3QA 3WDXA 2JECA 4RHV3 3NV1A 2GNBA 4JQRA 2MPFA 5ACA2 3DKWA 1H9WA 1RUJ2 4YVWB 3VKOA 3ZIWA 4UXAA 5KXEA 2GN7A 3ENRA 4FAGA 2NP0A 2A73B 4RGGA 1WBLA 5FRAA 4JDMA 5JOZA 1VP6A 2IFRA 4O9GA 1VBB3 4B4RA 2IC1A 4GWMA 4FOYA 1QNYA 2G9GA 1TEIA 2QUOA 4EWEA 4C1WA 4GKXA 3B9IA 5LK5A 3R6SA 4XJUA 2WFF2 2XBO1 2YC0A 1L3JA 1FMD1 2QZ2A 4PBOA 1AZDA 5ABJB 1LOFA 2PFWA 4KWLA 2BNMA 3SISA 4XXPA 2DVDA 3EO6A 4WM8A 1AR72 3WDYA 1YIFA 4IETA 3OGJA 4CTEA 1NCQC 3WDUA 5JSRA 1NQJA 3D0JA 2RR11 1QJU3 1Q56A 1VBC2 3MI8A 3MW2A 3J8F2 2YZ4A 3HN1A 4IERA 1MVEA 3U07A 3J9SA 2C0ZA 4C91A 2CGPA 4Q8KA 3IDEA 4MYEA 3AMNA 4AF9A 1CPNA 4XW3A 1KQRA 1A6CA 5FO7B 2H6CA 1ULEA 4LBQA 3FC0A 1D4VB 3DGTA 1RUC1 1V6OA 4HLTA 3N36A 2ZPXA 3OD0A 1PGW1 2AREA 3VBFA 4MH0E 3B01A 4Y4YA 1G9DA 5C8CC 3FLPA 3VBSA 3BOWA 1NA1B 2D98A 3WOGA 5K0UC 1XRUA 4YVSA 4FOWA 2JEMA 4FPOB 3R4UA 3M3OA 1NCRA 3KCXA 1Q43A 4A2UA 3O7OA 4Q4V2 1AYM2 4RGAA 5LRSA 1X8MA 4LBJA 2EVXA 1Y43B 4LO4B 4YLZA 4I0AA 3W58A 5T55A 4RFT0 4AFCA 1QJX1 4CEYC 1NY72 4FQZA 4JC1A 3AMQA 3QACA 1IS3A 1WW4A 1ALYA 4RS5C 2HWC3 2D7FA 4K1ZA 3RZZA 4EN8B 4FXKB 3KQRA 4N53B 3WHUA 1Y7BA 3DF0A 1Z0HA 5GJ6A 1HV1A 2RS53 4NN0A 1LHOA 1WW5A 4KGQA 4AWDA 4KG8A 4ZU5A 4W6YA 2X5IA 1CJPA 1WMEA 3UKNA 4BA6A 4N7IA 2V09A 3TOJA 1REFA 3M3EA 3GBGA 4PLMA 4BPZA 4EV0A 3WX5A 1OOPB 2XB6C 4K6BA 5IK8A 4B8EA 2Y38A 2Q5TA 4RR3B 3VL8A 2PHUA 3M2MA 1J59A 4XQDA 3DUIA 3ZSLA 4YG3A 4XHXA 4DMIA 4A3XA 2ZKLA 3T2TA 1GZWB 1GANA 4AVCA 2QDNA 1BEV2 1W0PA 5EFUA 4PDWA 3CLPA 5FOJB 3N7LA 1QQP3 2ZAHA 3IN9A 4G9SB 3KMHA 5J96B 2DVBA 4P9WA 3JBG3 2HWF3 2R49A 4RQPB 1J3RA 1B35B 1WLDA 4LO6B 1MQTC 1V00A 4YGCA 1XNBA 1R1A3 1HDKA 4AFDA 2DUPA 1S0EA 1G7YA 2EXIA 4OVEA 2ZX0A 3I2DA 4X6QB 2ENRA 3AP9A 4XQ4A 1H8TB 4F7ZA 1DYPA 1AYN3 2X53S 1WA4A 3GF6A 1S1AA 2E53A 2YUEA 3MFCA 3NKTA 3SH3A 2FMDA 4FT8A 3KSCA 1LGNA 2V73A 1EAH3 1ND2C 3ZXJA 3VBFC 3A0KA 5E1RA 4AYUA 1RB8G 1ZZBA 2JG8B 1IQAA 5BNOC 2XWJB 2OUHA 3MIDA 1MS4A 4E27A 2UY8A 4K40A 3RMYA 2JG9A 3R0RA 2B8MA 1KDKA 1JTZX 3SXWA 2WT2A 1VB2A 1AXKA 3VKMA 2QVSB 1ZM1A 3UV9A 5DUXA 4BLJA 5GLWA 1RVF2 5FPZA 2D43A 4K1YA 5C4WB 1QXRA 2ZHMA 2WKKA 4Q29A 4QM8A 5J98B 2I45A 3MYXA 3B3QE 3ZXEA 4MGZE 1H1MA 2HWB1 4QPGB 3USSA 1QF3A 3OY8A 1U12A 2ZTNA 1W6NA 2ZGNA 5E16A 2R0HA 3VBOA 4Q0UA 4A7KA 1APNA 2DCTA 3H8UA 3I59A 5GLUA 2EF6A 1HXS2 4QPIB 4K21A 1O7FA 1VJ2A 5GLVA 3SH5A 3QLQA 1TME2 1AF9A 5JVVA 2ET1A 4IEZA 3LOIA 1B09A 3AYDA 2PAEA 2VULA 4AHXA 1NOVA 4OFGA 5KXCA 4E4SA 3LOBA 2BBVA 1PO11 1Q5OA 4QGMA 2ZX4A 3JQXA 5I0RA 4LBLA 3NAPC 2EAAA 1LHNA 4LBMA 2VOWA 1X8EA 5C6CA 2D5HA 1GNHA 3H9AA 5HCAA 5I0TA 1JUHA 4KH9A 2AR6A 3B69A 2PYTA 3HQXA 4ES8A 5L73A 2Y0IA 3QCWA 1NE4A 3ILNA 3LZZA 1CAXA 2R072 1XYNA 1REEA 4N9IA 3WQ1A 4CEWC 3WDVA 1PVC1 2PELA 1D2QA 1R092 4Z07A 2GALA 1VB4A 1WUVA 2UWBA 5J7MA 5T5PA 1RUE1 2WNUB 2HYKA 3RNSA 4XMIA 1X50A 3N4MA 2YPJA 4IL7A 5FCCA 4EN9B 1QJY3 3AZZA 1DQ5A 1RITA 4M3CA 2ZJCA 5D8AB 2OIIA 1S0CA 4R9DA 1S0DA 3AYAA 3UJOA 3ZSEA 4FCAA 5BNNB 1H1AA 2ZGPA 4MZUA 4FO9A 4CDUB 3LSEA 2XL7A 1CAVB 1I9RA 4I0WB 4RA0A 2OZJA 2ET7A 4A7ZA 1DGLA 5BUVA 4LE3A 1SLTA 4HVOA 4WVMA 1ZBA1 4JGYC 2KA3A 2GC2A 1W6PA 5FTTC 2ZABA 4XTPA 1H2NA 4BE3A 3HT1A 4AEMA 4XFGA 3S30A 2LTNA 2FZ1A 4UW5A 1S0BA 4OHZA 4NPRA 4XJAA 4AHYA 3ES4A 3IWZA 3RRDA 1LESA 3ZFFB 5F1RA 4YFZA 1QY4A 3RI8A 3U11A 2JE9A 2ZZJA 3BOPA 4K20A 2R043 1OA2A 2WNVB 2OYZA 4WM7A 1D0HA 1RUI2 3ZFGA 2E7AA 2WQZC 4FP2A 5CFDB 4AVSA 3FMGA 2VECA 1RTVA 3JU9A 4Y1ZA 5E89A 3G6JB 4H7MA 5JDBA 4YGDA 1YRZA 3KGLA 1V70A 4DOUA 1WLWA 3R4SA 4YVWA 3FBMA 2VNGA 2W68A 4HKOA 4RHV1 1LEMA 1BVVA 2SBAA 2IXJA 1Q8VA 3WQ7A 3JB8A 3S7IA 4YW5A 4B29A 4C1XA 2UURA 1NXMA 2EXKA 5ACA3 2DVFA 1VBB1 1SMVA 3VBHC 1RUJ3 1SCSA 5ABJA 2BVBA 4FBFA 4IEPA 1QWRA 4NWWA 1QDOA 2WLQA 4N43C 1W6MB 4IV3C 1EPWA 4X8NA 4JV4A 3TNPB 3MLLA 2R062 4KU8A 2WLPA 1MS8A 2MEV2 3C2UA 4U2AA 3TRSB 4TSVA 4NWVA 1NQDA 2WFF3 3KLSA 1S2KA 3OF1A 4Y22B 1QJU1 4JGYB 2HWE2 1UF2C 3ZN6B 5L36A 1VBE2 4CDQC 5KXBA 4FPFA 4N90A 2ZMKA 1GSLA 1UAIA 2RMU3 3APBA 4HVRA 5JZGC 1AL22 1ULCA 3D6EA 4GQ7A 4MXWB 4P9IA 2R1BA 5HBAA 3VDDB 1VBC3 3QH6A 2A3WA 3WW1A 4G4FA 3MPPG 1MS9A 1ZBE2 5BNPC 3HMYA 3ZFEA 3LKJA 4CP0A 1H2KA 3JD73 4FP3A 4N9HA 1CIWA 2K9ZA 5CA6A 4DQAA 2I2SA 3WHTA 4AGVA 2YDEA 2VOXA 3FZ3A 2ZACA 2NPIA 1LODA 5FOBB 2VVDA 1H30A 4AEKA 4FTEA 2NZ9A 4GWNA 2O8QA 5I93A 4JVAA 1DGWA 5EXOA 3JCIA 2XJRA 2YGMA 2RHPA 4IEVA 3MW3A 1ND3B 4KG0A 2ZGRA 3R4DB 2PHWA 2UWCA 3V0BB 4RD7A 1H8VA 3NV3A 4Q4V3 2YXSA 3MICA 3OJBA 5GZGA 2HWC1 1YUDA 3HAGA 3U10A 1S0JA 1IKPA 5T54A 1R082 1Z7S3 1VBD2 2Z69A 4XF9A 4Q27A 5L7OB 1A3KA 1NLSA 3ZSMA 3ZVXA 1WW7A 2RS51 5EYYA 4HSJA 2PN5A 3MIHA 2PAKA 2E7TA 4U36A 5FLJA 3OYWA 5J48A 1M06G 1V6KA 4FAHA 4IEQA 1TE1B 3RPQA 1NCQA 3IDCB 4Q4X3 1PIV2 3D82A 3ZIXA 1CJDA 1GQHA 2C9AA 1LULA 4BWOA 2ZGLA 4E2QA 2VXRA 2XJVA 1OMIA 3WW2A 1YJKA 2DYCA 2GNMA 3AKRA 5SV8A 1PNGA 3MDPA 1QDCA 1QOSA 4DB5A 2XVGA 3SCHA 3MGUA 2P3KA 3EHKA 4XFBA 1SFNA 2EAKA 4AHZA 2ZX2A 3INAA 2D40A 1Q8QA 4W6WA 4OHXA 4F3JA 2F4PA 3ST7A 3NL1A 3ZSKA 3MFAA 4PQ9A 1TMF2 4Q2FA 1GR3A 4C90A 4M3CF 3GZAA 3GHMA 4LE4A 4OI2A 4ONUA 5C8CA 3POYA 5K0UA 5CB7A 4BH9A 3RI9A 4ES9A 1ZZ6A 4AFAA 2PLV3 1QQP1 1FOD3 4R9AA 2CY6A 4ORFA 4PIYA 3JBG1 4IEUA 2HWF1 1AX0A 5I91A 4BIOA 1LJ7A 1CAUA 1R1A1 1O3SA 2PAMA 1C5HA 1WGPA 5FPXA 4CEYA 4XJ8A 1H8TA 5FDBA 4AI3A 3LCPA 1EV13 4L2NA 1K5MB 4RS5A 2NMOA 4R9CA 5A3LA 5DZFA 4LBNA 1S2BA 2H0VA 1N1VA 4XFHA 1LOAA 4IV1B 3RJRA 1RUG3 3DV8A 1G9AA 1AYN1 1XU1A 1VAMA 4P9LA 1F31A 1HW5A 3P3PA 1NA1C 1EAH1 4Z82A 2NN8A 3ILRA 4KGGA 2I74A 1UD1A 1QOOA 3RYRA 4CRQA 4DRVA 1QXJA 1DQ6A 2ZGKA 1TNFA 1O3RA 1F5FA 5JI7A 1RUD2 1YJLA 2C5DA 4QQLA 1CONA 1HX6A 3EJKA 4AQ6A 3TN93 2A6YA 3AJYA 5I8TA 2XHKA 3AX4A 1O4ZA 1RUH2 2DUOA 1OFNA 2ZHKA 4EJRA 5HCFA 1C3HA 4N53C 3IKWA 1MS3A 4S2DA 4XF4A 1C1LA 1HRI2 1XXNA 3TB0A 1QU0A 1J3PA 4AI2A 5C9AB 2GC0A 5CAZA 5LK7B 1SLLA 1RVF3 4CDXB 3THTA 1DLLA 1LHWA 2TNFA 4LR4A 1DQ1A 4KQ7A 4S2HA 4NHKA 3AB0A 4YGBA 4ZU7A 4AW7A 5CFCB 1MQTA 4CDWB 2AUYA 1JYCA 2E6VA 2IXHA 4XJZA 3LB9A 1OOPC 2BNNA 1D0GA 2P34A 3ZYIB 4F8AA 3BPZA