3OUIA

Phd2-r717 with 40787422
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
190
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 56
structure length 190
sequence length 204
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouiA00
5L9BA 3GZEA 3MGUA 4MHUA 4XABA 5DAWA 4NHKA 5EP9A 3NNJA 5LATA 2FCVA 4Y5TA 3W21A 2JIGA 2Y33A 4NHLA 5LBCA 5IAVA 4Q5OA 2FCUA 3NNLA 3OBZA 2HBUA 4NHYA 5C5TA 3HQRA 4NHXA 5EPAA 2JIJA 4MHRA 5EQUA 2OPWA 5DAPA 4NHMA 3KT1A 5LASA 2G19A 5LB6A 4IW3A 5C5UA 5L9VA 4UWDA 3GJAA 4NMIA 5LA9A 3PL0A 3GJBA 3NNFA 2HBTA 2RDRA 4NAOA 3BVCA 3OUIA 2G1MA 2RG4A 3ITQA 4XC9A 3OUHA 2A1XA 5ERLA 4BQYA 4XCAA 3EMRA 4BQXA 2Y34A 4XCBA 5DAVA 4ZPIA 3NNMA 4KBZA 5LBBA 5HV0A 2FCTA 5M0TA 3HQUA 3KT4A 5LBFA 4BQWA 4Y5SA 4XACA 2V4AA 5L9RA 4J25A 3W20A 3KT7A 5IAXA 3OUJA 4JZRA 2RDQA 2RDSA 3DKQA 5LBEA 4ZONA 5HV4A 4XAAA 5DAXA 2RDNA 5DAQA 5A3UA 5IATA
chains in the Genus database with same CATH superfamily
1PO23 2XOMA 3I2HA 2K46A 5F7UA 2YHJA 1PMHX 4CXXA 3EYPA 4FFFA 3D82A 5G05L 5T52A 3HBZA 1BJQA 3N9LA 4XJ8A 2B9UA 4F8AA 4V2VA 3NV2A 1NY71 5A7SA 2XWJB 1UY3A 4LO6B 4P08A 1WMDA 2RR11 4MGTA 1F5FA 3ZFFA 3GCXA 3PUSA 2R041 3TNPB 4OHWA 4CCOA 1WWYA 5IK5A 4BQ2A 5EXOA 2XUEA 4KWLA 3WY6A 5FXWA 5C4WC 4JQRA 4L92A 4XHBA 5CKQA 3USUB 3VBOA 4JDNA 1C8M3 3AMNA 3MV11 4XF3A 3VGIA 2CTVA 1OKQA 2WN3A 2C0ZA 3B94A 3OY8A 3VBRA 2VUCA 3WCSA 3WG4A 5L7OA 1IS5A 2J1TA 4LKDA 2JDYA 3GHNA 1VBE1 4KBBA 2W47A 4R9DA 4KG8A 1NCRB 2BBAA 3J7LA 3RDIA 3RZHA 1ZREA 2DCJA 2XLFA 2VNRA 2DCKA 4YNIA 4HONA 3V0BA 1GNHA 3RJRA 1DGWX 1ENXA 3T4VA 3HT1A 4AR2A 4C1WA 1PM7A 2JJ6A 4UFKA 4L0PA 4DEQA 3TEYA 4XUPA 1HRV3 4EN7B 1RHI2 5F5AA 1E5IA 1HRI3 3CLPA 5CFCC 4YG3A 1ND2B 4M3CF 2BDRA 4NWWA 1S0BA 2ZACA 3DN7A 3KM5A 4N7UA 1SMVA 1UZ0A 4WVVA 3GM8A 3WUDA 4F7ZA 3NMBA 5A32B 2EAAA 2QQNA 2BW8A 2RR13 4DUWA 1CJPA 2MPFA 4NAOA 3RS6A 2R043 3BVCA 3V0AB 1HV1A 2NMOA 5J7MA 3QH7A 2UWAA 2HWD2 3LIGA 4MADA 4L11A 2JB4A 4IE4A 3OUIA 3QBQA 4ET7A 4D69A 5BNPB 3D5OA 2E51A 2EXKA 4XC9A 2EXHA 1D0HA 4QM9A 2A1XA 4Y4RA 3ZFEC 1SLCA 2WABA 1UIJA 3IMMA 5A33A 5CA6A 3C8XA 1JUIA 1RIRA 3POFA 4IEVA 4LBKA 1YI9A 1VBC1 5D8AA 3KD4A 1OA3A 5DUUA 1PZ8A 2VQTA 3RQ0A 4LITA 1GV9A 1TVGA 4QB6A 4TLGA 1VALA 2CYFA 1JMUB 1SFNA 1ULGA 3LEKA 2JDNA 4LO8A 2WNEA 1X9PA 1ENSA 1HLCA 1L3JA 4O65A 2NQYA 4IE5A 4OHVA 2QJVA 1VAVA 4G4FA 3VDDB 2JXAA 2WKKA 3WNLA 2FQPA 2QQKA 5FZLA 4EE2A 2DBNA 1EY2A 3POEA 2KD7A 1WMXA 1NE6A 4FBFA 2CGOA 2G9GA 5L73A 3E6CC 4CEYB 5KXEA 3KVBA 1L7QA 4LIVA 1BK1A 3C7HA 4TXWA 5LEJA 1VBB3 1UX6A 1MZEA 4FPCA 4N53B 3WR0A 5A3LA 2D43A 4RL7A 3MYXA 3ZYPA 1UU6A 4U2AA 5C71A 1W6QB 2C26A 5GJ6A 4CP9B 1PVC2 5J36A 5FZ9A 2W68A 4ES9A 3CJIC 1QY4A 5BNNA 2VOTA 3BTZA 2BPA2 2AEZA 1UIKA 2PHUA 4YW7A 1DQ4A 5T55A 4B4RA 3AM2A 3ABZA 3MIEA 5JR2A 1NA1B 1PIV3 1XU1A 2V09A 1RUF2 2R073 1I1EA 3ECQA 3UV9A 1AX1A 1H4GA 1AR72 2H6CA 1WLCA 4GA9A 5FZAA 2H6BA 2IXHA 4F3JA 3E5QA 4AVSA 1TMF3 3IKWA 3P5BA 1H6XA 3WNKA 1YJLA 4UW3A 1TMF2 2JDKA 1LHOA 4KGGA 1ZNPA 2GMPA 2J7MA 1WBFA 2ZPXA 5LA2A 5C7GA 5FZOB 5HCAA 2JDZA 1KFXL 3JUUA 3LEGA 1Z7S2 4H7MA 4N7IA 5IFPA 3KV5A 4PQQA 5GM0A 5J1XA 1XBFA 4ZY9A 2WBKA 1R1A1 2HBUA 2VVEA 1GOHA 3LA7A 1F35A 1K5MB 4JKKA 5CAZA 4AVVA 4YW6A 5FUPA 4CXWA 4FAGA 4Q27A 2HYKA 3CJXA 3HD8B 1KEXA 1W28A 4M4PA 5FK8A 1EAH3 5DQ0A 5D8AB 3OG2A 1W9WA 2OXBA 3MF6A 2RS31 4NE9A 4XFGA 2VULA 3KMHA 1MZFA 1R082 1XC6A 5G04L 3POIA 3S0MA 3ORJA 3WF4A 3PTRB 5IYYA 2JG9C 1WCUA 4IV3C 3M3QA 4AFMA 4S2FA 3ZIXA 4FSJA 2C4XA 1LESA 2VZQA 4INDA 5T5JA 3IDCB 2DTYA 4LBMA 3UNPA 1DGRN 1EYBA 4PLNA 3ZXAC 1I5PA 4OZOA 1RUJ3 1VBD3 1AX0A 2E31A 1GWKA 1PGW2 1YO8A 2PXJA 1LOGA 2FZ1A 1CZSA 3AKRA 1SBDA 5FPBA 3RVHA 4XXPA 1AR61 2EVXA 2VZRA 3HPNA 3JBG2 1ZVFA 3ZYGA 5CFDC 1J58A 2VJXA 4CYDA 1X7NA 5FRAA 5FV3A 2D40A 4P14A 1Q3EA 2BFUL 2PHLA 1FATA 4I0WB 3BYWA 2PHTA 3GBWA 5F9TA 3CU7A 1V9U2 2EAKA 2R7EB 3WD5A 4KG0A 4XYXA 3A22A 2BBVA 1EV12 3WT3A 1Q8VA 5DZFA 1AL23 4UYBA 4AHXA 1X50A 3GZAA 1XPWA 3S5AA 1JZ3A 4IGOA 4YZ5A 2P6CA 1ZRRA 5KBFA 2AEYA 2RMU1 2ZX3A 3VBHC 3NNMA 1CAWA 4AEMA 3ZN6A 1G9AA 5K9YA 1DFQA 1GZTA 1ND2C 1AL0G 3LSDA 4P02B 3ZKUA 3VZOA 1HN1A 3UJOA 5DDJ2 3H3ZA 3LE0A 5KHKA 1H8VA 2WR9A 2WIIB 5I0TA 3WG2A 1D4VB 4YSFA 2E7AA 1CAVB 2O8OA 3T09A 2D3PA 3UYJA 1RL3A 4EZ4A 1QQP3 2WQ8A 3H8UA 2PA7A 3IPVB 3T3YA 4Y5SA 3ZPOA 5C3RA 4PBOA 2UY9A 4LQRA 4E9KA 3VZNA 3ETQA 4RGKA 5FPLA 1PNFA 4AE2A 3SHRA 3R6SA 5A33B 5JXGA 1BZWA 2WT2A 5D2AA 2WLPA 1KD7A 4MXWB 3LA3A 1I3HA 4Y1UA 3ALQA 3ZYJB 3M3EA 2OYZA 4JTOA 5LBEA 4XZUG 5KXBA 4IV3A 2ERFA 4FPKA 5DAXA 1W0PA 1RUI3 3PMSA 2Q8OA 2ARXA 5DUXA 1RUI2 2P3YA 4OYUA 2XVLA 3SQOA 1Q56A 4ZS2A 4FQ4A 3ZXKA 2WNUA 4BWOA 2MNGA 3OYWB 2GC2A 5EP9A 2VY0A 4U36A 4FOQA 4RYDA 4AGGA 3S7IA 5C3SA 1S0JA 1E5RA 3V64A 5FMOL 2JG9B 4HL0A 2V73A 1AHSA 1XNCA 2D6MA 1QGLA 1S0GA 4HSLA 4JDMA 4B4QA 3KQRA 4NHLA 1YXWA 5FKCA 5ACA1 1FI2A 4WM8A 1RGSA 4K8FA 1QIQA 3FMGA 1H8TC 4IEPA 5AVAA 3U4XA 1UOJA 1OOPC 4BK4A 1GZWB 1LOEA 1QJU2 4BHPA 1OLMA 3QCWA 1G7YA 4Z82A 3KT1A 4A3XA 4Z8BA 2P34A 1F2NA 5JI9A 2JKBA 4HETA 1UY1A 2XL7A 1APNA 4EWDA 3JQXA 3VZKA 1WCDJ 1MS8A 3OB8A 4GWJA 5BXXA 1A78A 3ZR6A 5T5LA 3U4SA 2WJSA 3ZVXA 4QPIB 1ZRCA 5FYSA 2ZGLA 2W1QA 2JDPA 4OHXA 4LR4A 1FXZA 1LNSA 3U11A 1DQ0A 2HWB2 3UJQA 1DP0A 3ZX7A 3E6DA 3LA2A 1REDA 2LM3A 3LF7A 2ZOEB 2AYHA 1L7RA 1A3KA 2RG4A 4FVVA 3AZZA 1QJX2 1QJY2 1YCIA 3T30A 2X10A 4YZ1A 4WZFA 4NWVA 4EN9B 2PAEA 1RTVA 3DGTA 1HB4A 5FY4A 3S57A 2QQUA 1TQ5A 1W39A 3E1F1 2VM9A 5GZCA 1ALYA 2WZR3 2GMEA 2CAUA 4GALA 1CESA 1DGWA 3LPFA 1ZZBA 3RYKA 3VBHA 5FMBA 2GC0A 2ZGTA 2OZJA 4YM2A 1AYN1 3IMNA 1YFYA 3MIHA 4QX5A 3BB6A 3JXSA 4CDXA 4FTSA 2WINB 5C8CA 2DVGA 1RUD2 4HZFA 3VZMA 2ZCWA 5LY2A 2XGXA 4OI0A 4JGYA 1YNAA 2B46X 1OQ1A 4B1LA 3T08A 2O14A 3KT7A 3L2HA 2OPKA 5FYYA 2DVBA 1P8JA 3J8F1 1O91A 2F6BA 4ASMB 4GXLA 1Y9GA 5FP9A 3I3MA 4QKDA 5FZGA 3LDBA 3O1MA 1TNFA 1RXGA 1JYCA 4XAAA 2F4PA 3CDZB 4LO5B 2E26A 4Q0QA 3LOBA 2K2SA 4KNCA 1PIV2 1RUC1 1ZZ7A 1WMFA 2BGPA 3QACA 2J42A 4FP2A 4GB33 3THPA 4FTBA 3F2ZA 1W8UA 1VLNA 2CSGA 5JAXA 3VKLA 5LZ6A 1C8M2 3ZOIA 1LOFA 3CZJA 1E5HA 3WDVA 4Q0SA 4QM8A 1CONA 1VMHA 2OIIA 1AR83 5EHDA 3QLQA 1S2KA 2HEWF 2E7QA 2FMYA 5A7OA 4BXSV 5I0SA 3LB9A 3ATGA 5GALA 1AX2A 1NLQA 2W2IA 4J6GA 1NCRA 1NXD1 1JU4A 2RS13 4DMIA 4PDWC 4FPHA 1ZZ8A 1R092 2W5FA 1QDOA 2Z4FA 4QX2A 4RR3C 3THTA 1U5IA 2A73B 1F8VA 5GLUA 4FTEA 5BPXA 1SLAA 2VMEA 1RUNA 3C7EA 2YFZA 3PVOA 5KXCA 4Y22B 1ULCA 4IV1A 1Q43A 1RUG2 4CPBD 2WQZC 2ZX1A 2B5HA 1QH7A 3AMPA 1ULOA 2YG0A 4AI2A 4LK7A 3QOPA 1O4ZA 3C3VA 3HNYM 4V1PA 1OQDA 1QH6A 3W5NA 3N7KA 5ABJC 2VZTA 4XEZA 4Q4W2 5JOZA 2FD8A 4DQAA 2EXJA 1FMD3 2VQAA 4LLFA 1NQJA 1AZDA 2XG3A 1IS6A 1RUF3 3OSDA 3PL0A 2X29A 2X5IC 1W2OA 1N1SA 4XJZA 1WD4A 5KXDA 4JGZC 2LS6A 4WVMB 4CEYA 4CCEA 2IXKA 2XL9A 3HR9A 1MVEA 4LK6A 5FAXA 3CIHA 2Q8EA 3VBFA 4XFFA 4YM1A 3IIIA 3ZXJA 5F2SA 3N7MA 3BALA 4XCAA 5B2GB 1V9U3 3VV1A 1GLHA 1OLQA 3WZ1A 5FPUA 5JIAA 1PO13 1AYM3 1MS9A 1W9SA 3H1WA 5TSWA 2D44A 1BBT1 2WFF1 1NAEA 1STMA 3I2DA 3NQHA 1JZ6A 2NP0A 2VUDA 1ZA7A 2JDMA 1LEDA 2XMLA 3AKTA 2ZAHA 2W95A 1GUIA 2ZEXA 1KJRA 3N4MA 2Y6JA 3KT4A 4ISRA 5DG2A 1CN1A 1GP6A 2WRAA 1D2SA 2RS12 2RVAA 3JD72 3JU9A 3MPBA 4NR1A 1OD5A 2AREA 5LA0A 1D4M3 5F8PA 4QDRA 3MZHA 3WNMA 2VQ0A 2C6SA 4EZHA 4BE3A 1OI6A 1QJZA 5B4XA 1H1AA 3M1HA 4IV1C 4RGGA 1OH3A 1VB4A 3ZXEA 1N1TA 1DF0A 4QXHA 5DMYA 1FV3A 1CR7A 1JBCA 2AH2A 3MW3A 2RDQA 1UO9A 2QDRA 4Y20B 4ZONA 5HV4A 1SCSA 3CNAA 4A3ZA 2G9ZA 2TEPA 1VBA1 4CRQA 2HEYF 2ZKNA 5JOYA 2P1BA 2FDHA 1Y4WA 1W2AX 3M70A 1ONAA 2PHFA 1J3QA 2A3WA 4MZUA 1YIFA 1O4TA 1S2BA 3RYPA 1DCSA 4Y5TA 5T54A 2VECA 1OA2A 2XR4A 1RUJ1 1VBD1 3V65A 2D6NA 2WFPA 2VOKA 2QQOA 4PBPA 2WZR1 1AR81 4W8JA 2Z2SB 1A8MA 1PO11 2VAUA 4P9GA 5A6XA 3ASIA 1DGLA 3VD7A 4QPIC 1BBT3 2WFF3 4S2GA 4CCJA 4NHYA 5IFTA 5SV8A 5C5TA 5CYYA 2C5DA 4CDWB 3IIAA 3NVCA 4AWDA 1GOFA 3KV6A 2VW1A 3FWEA 1B35B 3JB8A 1XE0A 4BQ3A 3HAGA 2VL4A 1W6MB 1UOGA 3OBTA 2ADDA 4I09A 1LOFC 4YM0A 5EPAA 4BA6A 2XJPA 1UMIA 3I59B 4LLOA 3A0NA 4M00A 3OBRA 3TN92 4IE7A 5LB6A 3WP5A 5FOBB 4C91A 1LCLA 4E2QA 4Y1YA 4IW3A 5FQ0B 5FWJA 4CDUA 4EYUA 1VBB2 4X6QB 1AVBA 1W9TA 3ZLIA 4P9IA 4AFCA 4Y1VA 4YYOA 2HWF3 4I0AA 1FMD1 3PLQA 1HX6A 3BOWA 4NOTA 3ACHA 4NMIA 3E97A 1D4M2 3Q9OA 5LA9A 3RI8A 1HQNA 1OOPA 1MQTC 2EIGA 1U5ZA 2BVBA 4Y5Z0 4PIZA 4YG0A 2VZSA 1YEWA 5FMCA 3ZXDA 2UYAA 1GQPA 3R05A 4MX3A 4HOOA 1XOYA 1UOFA 1WCKA 2HWB3 1NA1C 2R16A 4QX0A 5FPVA 4K21A 3SKVA 4EN6B 4FOYA 4RQPB 4FPLA 4Z2AA 1UN1A 2O8QA 1FNYA 2HWC3 2BNOA 1F31A 3MIBA 1JS9A 3SEPA 1VMJA 2DF7A 3EBRA 2YBPA 2AC1A 1UNBA 3NSTA 5E8AA 2FDFA 5IVBA 4COVA 2GAUA 3THCA 3DKWA 4QKFA 2D5FA 4D7TA 1CAVA 1EUTA 2ET7A 5DAVA 5A7PA 4MV2A 4AZZA 4D94A 3ON7A 2MEV2 3ZYBA 4IEOA 3AZYA 1NX9A 4UFJA 2J1VA 4K3UA 5HV0A 2ZTNA 1OLME 2VCBA 3VDAA 1LHVA 1YYNA 2EIDA 1WMEA 1OHFA 1G9BA 1RVF1 3VBFC 4K8RB 1COV2 2XJTA 4WBBA 5L9RA 3HQXA 1PGL1 1RHI3 2VW0A 4CU7A 3J8F3 3OPTA 5DN2A 5KHGA 3B3QE 3LEMA 5FTTC 1XRUA 2WO2A 3EXUA 2QTWB 4V2WA 1XU2A 4Q4V3 1OF4A 2BQPA 1ND3A 3I4IA 5F1RA 4Q4X2 5FZ7A 3DKQA 2E7TA 4I30A 1YQ8A 3I8TA 1F9KA 3UK9A 2GP3A 1QQP1 3ACLA 3RSJA 1WKYA 4LKEA 4RHV1 1H2KA 2W52A 4COWA 2ZZQA 4ZS3A 1XXNA 5FZDA 1OFSA 2VMFA 4R4XA 4I3PA 3RNSA 1ZBE1 1JZ8A 4LKSA 4G3YC 2PHXA 3K3OA 3NWKA 2D3RA 1S0IA 3F95A 1LEMA 1WD3A 4AVBA 3NNJA 5FLIA 1DQ2A 5CKNA 1XYOA 3K48A 5LATA 1C5HA 3H42B 1LHWA 4P5YA 5IW0A 1VPHA 3AXDA 3KGZA 3LGRA 4JQTA 2OS2A 4NUBA 3H1MA 4CDQA 5K8SA 2AGSA 5C8WA 4GH4C 3AC0A 4PF1A 3AZXA 2YDEA 1RB8G 2UY8A 2Q0AA 3FN9A 4A6SA 4XBNA 2AACA 1LR5A 4OHZA 1U12A 1YLLA 1ASJ1 1E57A 1UYPA 2A70A 3HQRA 3MLKA 4KI5M 4XVHA 1W99A 5CIRA 5F3EA 4E4ZA 3OD0A 3KF5A 4DXTA 4D6RA 4XBLA 2GDFA 1AR91 1YC61 3CO2A 3I59A 3RZKA 3HNBM 5BYNA 2IZWA 3RPQA 1HXS1 2XQXA 4QWNA 5LCWL 5IVYA 3RRDA 3IT8A 4OCTA 2HWF1 2VE1A 4IEYA 5C70A 4R52A 3AMMA 4CDQB 2QQMA 5LY1A 4GAZA 3N7JA 2HYXA 3HN3A 4URAA 3H7YA 4PF5A 3VLBB 5FR3A 3EO6A 4JCKA 2DFCA 1HKDA 1VP6A 3BPSA 1NLSA 1F15A 3FE5A 3NAPA 3POGA 1CPNA 4NROA 4WM7B 2Q8DA 3I2IA 3TOJA 4AVAA 5AC92 5IK4A 4FQZA 4PI2A 4QKNA 3ZFGB 3ZYHA 1GZCA 4AXOA 3W58A 4J1WA 1TE1B 4CPBA 1JYWA 2JX9A 3WP6A 3AJZA 4RFT0 5H9QA 2PN5A 2WWJA 2HWC2 4QPGA 5J96B 5JCTA 4GB31 2GNBA 2DU1A 3D8CA 4QX3A 1BLZA 1S1AA 4GKYA 4N8MA 3T4HB 3SNMA 4MGIE 1NZIA 4B1MA 5C6CA 2VOWA 3BIWE 4PI0A 3HN1A 1YRZA 4LT5A 1OD3A 1RUE2 2VTFA 2WZEA 2BGCA 2Y34A 2FHRA 1N3OA 4YZ4A 4XCBA 4FPYA 5ACA3 5CFDA 1RMU2 3UGHA 1ASJ3 1JODA 3K46A 4GZ9A 4N53A 5FDBA 5FY5A 4Q0UA 5CG9A 2PLV1 4UT5A 2Y64A 3PDQA 4FCAA 3ZPYA 3B01A 1CZTA 2Y6GA 4META 2PLV3 4FI9A 2KXLA 1BEV2 4QU2A 5F32A 5FBJA 3SH5A 2F4LA 5B4NA 4QDSA 5IT6A 1C5IA 4JGYB 1MS3A 4BQWA 4XACA 1O6UA 4D6QA 4C90A 1SG3A 1BMV2 4N90A 1UOBA 4OFGA 1W8OA 4XFIA 3NRUA 4FFGA 1MQTA 5A7QA 5JIUA 1BCXA 1JH5A 2E6VA 3WG3A 1JYXA 1UKGA 4Q4Y2 4Q4V1 4HK9A 4DXRA 3HBKA 1I5ZA 2RJ2A 4RHV3 2W9XA 1W8HA 2JKXA 5A3UA 4DPNA 3GYDA 5CFCA 3KGLA 1BK0A 3U07A 4A7KA 4A7ZA 3ETPA 2R072 3B02A 3QH6A 4DIQA 3JBG3 3SH3A 3ZMNA 4E4HA 2EIBA 5DAWA 3VKOA 1XQNA 1R1ZA 2W1WA 3AFGA 1JZ5A 3ZSKA 2LW8A 1T2XA 1IPSA 3RYRA 1WA4A 2JIGA 2L9LA 2ZX4A 1Q8PA 3FLPA 3ZYRA 3N3HA 4S2HA 4ZU5A 1W3XA 2R0FA 4DUXA 1Z0HA 5D1IA 1JN2P 5CEHA 4CCMA 2HWE2 5F5QA 2FCUA 4CXYA 3DXUA 2AR6A 1POV0 1CAUB 4P9LA 3WF2A 1ND3B 3VDCA 3DYMA 2BWCA 2ZA9A 4XUOA 3EHKA 1ZA4A 2W0XA 5BNNB 2R061 4XXAA 1EAH2 1GWMA 4GJZA 5EJZB 2KR2A 3NNGA 5FYCA 3WEZA 4BIFA 1OOPB 4CUAA 1SDDB 4E4SA 3IDEA 1S0DA 2VCMA 4FFHA 1PZ9A 4XFAA 4IE0A 2B8MA 2RV9A 1GZWA 3ZYIB 1WW6A 2WYSA 1DQ5A 4K9SA 4ZKTB 1K45A 1W6PA 4AAXA 1V6NA 2XUMA 4AVTA 1MS4A 2WN2A 4GMP1 1JOJA 4M4RA 1FV2A 1NYWA 5JVVA 3PHMA 1AL22 4XF1A 2GN3A 3VUOA 1XJAA 3SITA 4MGSA 3BUCA 2VMHA 2OKXA 1AR73 3MFAA 1ODMA 2C9AA 2OVUA 3O14A 4Z1VA 1NY72 3ITQA 3RZLA 1H2NA 2RR12 3P1IA 5ANNA 2IXLA 2X09A 4BQYA 2SLIA 2XHNA 5HPOA 1OBNA 1C28A 4WVWA 2Z42A 4MG2A 2IWGB 3BCWA 4GKXA 4AK3A 1NT0A 1S4CA 2YC2A 1HW5A 4CCNA 1DIWA 4UW6A 4A45A 3NJYA 2WL1A 4KMQA 2RE9A 1KFUL 4AI9A 2OUJA 3LIHA 1JYTA 2C9KA 3O0XA 3GGLA 1CQ9A 3KCCA 4OQ8A 5FMOS 4M3CA 4WZCA 2AENA 1A6CA 1YI7A 1WZXA 5FP8A 1UU5A 2D3SA 4W6YA 3VBSA 3I97A 4EQVA 2EIEA 1W9YA 2PAMA 4DS0A 3CL1A 4QHOA 3UKNA 1JYNA 3EJKA 1OVSA 5D21A 3UGFA 4GWIA 4CP0A 2CGPA 2XBO1 2BFUS 2Q30A 3THDA 4QX8A 1QXJA 1QU0A 2Y38A 3DEMA 4YW1A 4D7YA 1YHFA 2DV9A 2HEVF 4PQ9A 2XPJA 5FMDA 3T2PA 1CAWB 5T50A 1SZBA 1QOTA 2MHFA 1PO22 4Y33A 3ZXGA 4NIDA 1ZM1A 1JZ7A 2HWE3 1J83A 1PVXA 4QXCA 4TLFA 2WNVA 1GNZA 4UFHA 4BOWA 2K9ZA 1UYXA 3HMYA 2JDUA 3IB3A 1MEC2 3A21A 4QU1A 2XVKA 1FNZA 1KS5A 1X8MA 1VBC2 5FXXA 1H9PA 3WNOA 4XW3A 1Z7S3 4KWKA 4OZXA 1CAUA 4Q5OA 2CL2A 2Y6LA 1AYM1 1SBFA 1RYYA 3FUOA 1OUXA 1O4YA 2D98A 4NN0A 1TME2 1DQ1A 3CHXA 3ROUA 4K40A 2VMGA 2Q8CA 4WVMA 4LBQA 4XFCA 4D6SA 3RZGA 3SKJE 1W6OB 1IPJA 2OQ7A 1ND3C 4HLTA 5LASA 5DXDA 1C8NA 1W0NA 1OA4A 3PU3A 1WLDA 5FPZA 3ILNA 1D2QA 4YARA 2VNGA 4BQ1A 4ASKA 4JVAA 4KU8A 4PIYA 2I74A 1OF3A 1ACCA 3I54A 3O1UA 3WLUA 2NN8A 2CHHA 4UWDA 2VUAA 2XLGA 3GJAA 5FLHA 4R9BA 4KWJA 4QQOA 2JECA 3WW3A 4MOAA 3D6EA 2Q1FA 3ZXLA 4XUNA 4COYA 3GJBA 3H3UA 3WP3A 2YPDA 4DRVA 3NNFA 1HRV1 2B42B 2RDRA 1ENRA 1G6NA 1RUF1 4LE3A 1NG0A 4AYUA 1H2MA 5FZBA 4IEWA 4UAPA 2WLQA 1AR71 1EP0A 1YFUA 3T0AA 3E5XA 4LO7A 4XPVA 4AGVA 2HH9A 3H1YA 3KV4A 5FYUA 3IAPA 2YPJA 4AEDA 3POYA 1VBA3 1W2UA 4LE4A 1CD3G 3P3NA 4JHTA 1W04A 2VVFA 3K75B 3WW1A 1GNYA 4UOJA 4Q26A 3FLRA 1GOGA 4E8DA 3GXUA 4IEZA 2WQ4A 4MO3M 3VN4A 2ZMLA 4AFDA 1NE4A 2W94A 3MV01 4WV8A 5F6LB 3LAGA 4UFLA 2WNVB 2VH9A 1NA1A 1O8PA 2ZHKA 3CJIB 4MUVA 1WW5A 5AVPA 1GU3A 4LEJA 1ST8A 4M0HA 5FXVA 5LBBA 5FO8B 3AP7A 4L97A 3MUZ1 4Z92B 2RS33 3HQUA 2GH2A 3JQWA 2RS32 2UU8A 1RUH3 1H9WA 2PHDA 3ZFEA 2JD9A 3K2OA 5GZDA 2O1QA 3OY8B 3NAPB 2XXZA 3VBRB 3W59A 4BZ4A 2IFWA 2CV6A 1V70A 3LDRA 4TZDA 2DTWA 2XJRA 3TEZA 2VPVA 2RS51 2WT1A 2LRPA 1CIWA 1QHDA 5CZKA 2WA4A 4UXAA 2RS53 4BPZA 1HJGA 4FAHA 3B00A 2F17A 4JZRA 4ZHNA 1ULEA 1MVQA 5C33A 4MYEA 5HBAA 3J26N 1DZQA 3C7OA 5IK7A 4HANA 1N1YA 1RVF3 4N9IA 5A6ZA 1PGW1 2DVFA 3FC0A 4KL1A 4PDWA 4RR3B 4YVWC 2HKXA 1IS4A 1D0GA 2D6KA 4IDZA 5JXJA 2YBSA 1VAMA 1G9CA 3JBG1 5FYBA 4LIUA 4I02A 4Q1RA 4HVOA 5FZMA 1NLRA 5DUWA 2W08A 4NHKA 1BKZA 4CCCA 1YFWA 5BNOB 5D8AC 4NRQA 1D7PM 4UBGA 3R4UA 4Y1XA 4C1XA 5JXHA 5IVFA 1DBNA 1GYKA 2ORZA 3N9NA 5T5OA 4JHZA 5FZ0A 1EV11 2Q1MA 2IXJA 2YC0A 1JU3A 3B9CA 2ZAAA 3NJXA 2B45X 3JCIA 4YZ2A 2ZGMA 3AL6A 4N43C 2TUNA 4YGEA 4CEWB 1U5XA 4TSVA 2NLRA 5FXZA 4AI8A 3NNLA 3CBNA 3OBZA 2RMU2 4OMDA 1NOVA 4GJYA 4ZXKA 1M4WA 1BVP1 3I3EA 3CEWA 1XNKA 2GH8A 3C7GA 5F2WA 3AMQA 2OT7A 3MIGA 4J1XA 3SC7X 1MQTB 2A3YA 1BVVA 1FOD3 4OMCA 3WQ0A 2VZ3A 1UW8A 1H1MA 1NZCA 4CVUA 5FP3A 1W90A 2ZHLA 1FOD1 4ZXEA 1H1IA 1T6GC 2P17A 1WCSA 3PVEA 1W6PB 5FQ0A 1ZBA2 2X53S 4XF9A 5C3QA 2ZGSA 4Q4Y3 2XDVA 3TWIA 1LENA 3VD3A 2GNMA 2JE8A 1RUOA 4UFMA 4AW7A 4CA9A 2ARCA 2AZ5A 3DYPA 2WNVC 3Q8BA 4LORA 1NUKA 4OQ9A 3VBHB 4BMBA 4LJHA 3NL1A 1H2LA 4CEWC 4QPYA 4XDPA 1LOCA 1MZ6A 3NV1A 1PHMA 1UU4A 4COZA 4LOTA 1YIPA 4X8NA 4HG6B 2PELA 3USUA 3VD5A 2PQQA 2EXIA 4TYSA 3M3OA 4BCUA 3N35A 4COUA 1ZBE3 2Y26A 1QXRA 4EJRA 4XMIA 2NMNA 2WAOA 4Q4W3 1C1LA 2ATFA 1URXA 5A1LA 1F4AA 2O0OA 4M01A 3DCQA 3VB9A 4HXCA 2V72A 4Y1ZA 5L19A 5JLVA 3OPZA 1RUE3 1UL9A 2RM22 5A3NA 2GU9A 5LWBA 4P9XA 2WNUC 1LTEA 4XIKA 2YYOA 4JGZA 4KBZA 4CP2A 1J1TA 1DGRA 2VZOA 5AC91 3PUAA 2FCTA 4JKLA 1FX5A 5JSOA 4W6XA 3DPRC 2R1DA 3RZZA 4A7YA 3KSCA 4RS5B 2CNAA 4E4DX 1AF9A 1GICA 5HI0A 2Y0OA 3ZN6B 5F3IA 4AEDB 3NV4A 2V4AA 4YGDA 4B8EA 1VRH2 1YQ5A 2X05A 3WV6A 1FAYA 4ATFA 1IG3A 2GSYA 4AQ6A 4DO0A 2DUQA 1ZRFA 3VBOB 3I3BA 1CX4A 1HB2A 1T6BX 1XSQA 2EF6A 2VZUA 4UF0A 2XB6C 4CU6A 3D0JA 5FFOC 2KA3A 1XYNA 2ZABA 3VBOC 2ZMKA 3OTFA 2CAVA 4JX0A 2RHPA 1AR63 4OUSA 4UBHA 1H4HA 5FZ1A 3ZN5A 4HVQA 5IHRA 5L9BA 2ZEYA 4CCDA 4IEXA 1SPPB 5J09A 3U37A 4CDWC 1UX7A 5C9AC 1GANA 2WS92 1OKOA 3OYWA 3U78A 1QJX1 1QJY1 3AVSA 1UMHA 3M4FA 2BV4A 5FY0A 4HFSA 1W8ZA 4GD4A 1QMJA 2YGLA 2D97A 1B35A 4YRDA 1H8TB 1SLTA 1W05A 3SCHA 3U1XA 1M06G 3FLTA 3AKQA 1OFNA 1Q8QA 1VBC3 4QB1A 2YU1A 4GWMA 4LHLA 5HCBA 1TEIA 1HQWA 3VBUC 4YW4A 1FPN2 3LPGA 3MICA 4Y3OA 1SACA 2A7AA 5IWFA 4DY5A 4MGKE 4IL7A 3LEIA 1AYN2 1IKPA 2UWCA 3Q8EA 4O9GA 1O3QA 3L2YA 1W8WA 1UWWA 3OGJA 1RUH1 4QX7A 2Y0IA 1HRI1 4M3CE 4AEJA 1HDKA 2R6QA 3E5UA 2YC4A 5FPAA 5I0DA 4RA0A 3T2QA 3ZSMA 1GFF2 4AI3A 1RUD1 3WF1A 4GMP3 3RWNA 4NPLA 3AYEA 1RINA 4CDQC 2DUOA 1ZRDA 3DPRB 4RSUA 4CDXC 3AYCA 4IV1B 5F5CA 3GZUC 4LUMA 5GZEA 1MPXA 2XJVA 5FJKA 5J48A 4AL9A 3W5MA 3B9IA 3J8F2 4YVWA 3P6BA 1SFPA 3VKMA 2JWPA 3RGBA 4DOUA 4A41A 5C8CC 2WDBA 1V6JA 2PFWA 2QZ3A 2ILMA 1GP5A 3LSEA 3VDDA 2BYVE 2XJQA 3WCRA 2H0VA 2WUHA 1PIV1 1RUC2 3H50A 2OUHA 3ZFEB 2FZ2A 2NPIA 5KR7A 3VBRC 3AB0A 5KC5A 5FZKA 3MPPG 3OEBA 1GQHA 5CISA 1UPSA 3BTYA 3WQBA 2P3KA 4XUQA 2GC3A 1B09A 2FDKA 2ID4A 3OUHA 3WDYA 2DBIA 1Q8OA 1J59A 2R042 4AFBA 2YY1A 2VBPA 5EWSA 2WSVA 3O7OA 4ISQA 3WINE 2GMMA 2A6YA 1H30A 1IOAA 1SFYA 2GN7A 5E16A 4OI4A 3VKFC 3U0ZA 1JW6A 4I0BA 2WAAA 1LOAA 2Q1ZB 3M3CA 1VBE2 1CIYA 2OA2A 2WYFA 5FYMA 1UXZA 2C1FA 2V4VA 4CP1A 3NW4A 3I3QA 1R091 3PUHA 2YFUA 4RFRB 3MFCA 2EICA 4TN7A 2W46A 2I2SA 1BHGA 5FIXA 5DUVA 4MXWA 3O1RA 1U0AA 2YROA 5GLZA 4P5HA 1XYPA 2VR4A 3KCYA 1RUG1 3A23A 1RHI1 4B29A 4LPLA 4BISA 1G86A 4QQ2A 3W20A 5LW9A 4NIGA 4OVEA 3PURA 1WW4A 2Z5WA 3ENRA 4CDXB 1CZVA 5A6YA 3J9SA 1SLIA 3VDBA 2BJSA 3NO8A 2CWSA 3MDPA 1AUYA 3OUJA 2DUPA 2VGDA 4Q4W1 3SCGA 3MLJA 4AI1A 2PAKA 1VMFA 5A3WA 3WP4A 1V6KA 4AQ2A 1H0BA 1YUDA 1SHWB 5IATA 5HXMA 3LFIA 3N9MA 4HKLA 5FZOA 3WHTA 3RI9A 3Q8CA 3GZEA 1BXHA 2G4IA 5FY9A 2HWD1 1O8SA 4DNYA 1ZRIA 4E2SA 1OVPA 4UFIA 1SLLA 3T0BA 4XABA 4HN0A 3AKPA 4PCRA 3TRSB 2FBEA 4DXZA 2OX0A 3R4DB 4Q4X3 4WVZA 3UKTA 5A32A 2P4EA 4W65A 2FCVA 5FZ4A 4YFZA 2ARBA 3ZFFB 2P6HA 5IJRA 1QF3A 2BUKA 4LUKA 1IGOA 5FY7A 4H2AA 3CF6E 3SEEA 4YW5A 3UETA 1S55A 2Y33A 2P3JA 3FX3A 3NJZA 5CKMA 3MLLA 1OURA 5E1RA 3ES4A 3OGSA 1NQDA 1COV3 4H3WA 3NAPC 4L9BA 2V5DA 5JR7B 5JZGC 5KC6A 3BI3A 5ABJA 1AJOA 2ZXQA 4IUGA 4Y20A 2P37A 1QWRA 4R8HA 2QFEA 5JWPA 2CU5A 3GHMA 1PK6C 1DZTA 1Q8SA 2QQJA 4QPGB 4QQHA 3ZXFA 5EQUA 4JGYC 5A3PA 1K5MC 1L7LA 2J1UA 4XF4A 4OHYA 2RS11 5FCCA 2QNKA 1Y7BA 4FOWA 1Y43B 1BEV3 3FHAA 4YPJA 3VHOA 3O1SA 3UESA 1S2EA 2VW2A 4LXLA 4BLJA 1KQRA 2ZMNA 5L9VA 1O5UA 1VRH3 4N53C 3Q8AA 4KWUA 5GLWA 5A7WB 3DUIA 4XTMA 3AP9A 2BGOA 4OUEA 1PVC1 4A6OA 2VCCA 1RUD3 1QXPA 2W39A 4W6WA 1W6NA 4RS5C 3ACIA 2I45A 1S0FA 3UKVA 3IPVA 3FHQA 1RUC3 3PVBB 2HBTA 2JENA 2YBKA 1CJDA 4QHBA 3VDDC 4NAMA 3VHNA 4HT1T 5HCHA 4CU8A 3VZLA 4M3CB 3WDWA 3O1VA 1CX1A 3WVJA 1POV1 3AP5A 3TYJA 1LGBA 2JE9A 1TMF1 5I0RA 5I93A 1KS4A 1CPMA 1DYOA 3HJRA 4EWEA 3ZN4A 2FMDA 4LTAA 4XF0A 4K1ZA 3VL8A 1IPKA 3T2TA 5BY5A 3V56A 4Q29A 4LBQB 1Z7S1 1AR82 3EMRA 4EN0A 2ARAA 1PO12 4WM7C 3MF9A 2WC2A 3GF6A 2A71A 1R1A2 4IERA 4ZPIA 5H9RA 5H9SA 5I8SA 3VHPA 1ODNA 4KH9A 3ES1A 1DDLA 2J1EA 4Q2FA 4AHYA 2AUYA 4LBLA 5IUQA 2WSUA 3VL9A 1ND2A 1JOPA 3KHBA 5FZ3A 1QJU3 4HVRA 1W0OA 1LULA 1O5LA 1OPMA 1UY0A 5I91A 4KQ7A 1HB1A 3DYOA 2D93A 3WNPA 1R081 1UZVA 4IGQA 4QPIA 4XJAA 2QQLA 5AC93 1UD1A 5LBFA 1HB3A 1ULDA 5JI7A 2IUWA 5JSRA 3BTXA 2G9FA 4J25A 4YGCA 3JZVA 4A44A 1VBB1 2CY6A 2VTXA 3PUIA 4L2NA 4QPWA 5IAXA 3T2OA 2XJUA 4JRLA 5A80A 3I7DA 4ATEA 1A8DA 1MACA 1JTZX 3TAYA 1EPZA 1D4M1 1I6XA 3L9JT 5C9AB 5GLVA 4GH4A 4XDOA 4BQ4A 1W8TA 1GR3A 2RDNA 1ZYBA 4CCKA 3OBAA 3VZJA 1RC6A 2R49A 2K0GA 1AR62 4QQPA 4AI0A 3ZM8A 3G7DA 1UXXX 3P3PA 2WNOA 5HXVA 5A3TA 1US2A 3QD6A 2BNNA 2JDAA 2ZGNA 4YWAA 5DABA 1V9U1 3B93A 1HQLA 1K5MA 2R0HA 3INAA 5F5IA 5EJ1B 5FYHA 3OPWA 3ZFFC 2LTNA 2P5BA 3WQ1A 5FP7A 3HT2A 5F6KA 4NIAA 5CVRA 1PMJX 1JYVA 1MZ5A 1KDMA 2QQVA 3KWVA 4NIHA 5IAVA 3VHRA 4XFHA 2ZKLA 1YQCA 1OC1A 4ZZ8A 2MEV1 5CU1A 4SLIA 3RWKX 3AFKA 5APAA 2RJKA 2CDPA 2JB8A 2BEOA 1PM4A 3OOXA 4XZPA 1QKQA 2DVAA 3SH4A 4TTGA 2Z69A 3ZKYA 1AJKA 5DDJ1 5E88A 2GP5A 3HOBA 3NKGA 3IM0A 4RQPA 5DG1A 4MHRA 4CEWA 3ZO0B 1LAJA 5LK7B 5DDJ3 3O0VA 1LECA 3VBFB 3IN9A 3TBDA 4NPRA 2BRTA 2PQSA 1AXYA 2GZWA 1AXKA 1LODA 2WNUB 4P9YA 4KU7A 4P00B 4N43A 4OI2A 1COV1 1H6YA 1UMZA 1UZZA 4HBNA 5C3OA 3KS7A 5A1AA 2QQPA 4L8QA 3CKHA 4UI9L 2UWBA 3RMXA 3ZSEA 1PGL2 4DZGA 1SEFA 3PJQA 5LK5A 5DPNA 2VG9A 4JTNA 1CAXA 1WCQA 1VRBA 2R30A 5FK7A 3Q8FA 1E5SA 2W1SA 3NKTA 4Y22A 4Q4X1 1Q5OA 3A7QA 1JOBA 3FHIB 3S7EA 4K7JA 3LZZA 5BV6A 1F4HA 2E63A 2IFRA 5FUIA 3I2KA 3J7HA 3AP6A 3MEPA 1AXZA 1RUI1 1GWLA 1Z78A 2WO7A 3O0WA 5KHIA 4Q1PA 1O3RA 4CSWA 3GZTB 4YVWB 4BIOA 2RJLA 2JDHA 4XILA 4ARXA 2J1SA 1W6MA 4HK8A 3LOIA 1QDCA 4LHNA 4PLMA 1DLCA 1MS1A 1ENQA 4FP3A 1XB9A 3EB7A 4QXBA 1R1A3 1FT9A 2P2KA 5FYIA 3UL2A 4BJ0A 3DPRA 1WBLA 4LBOA 2H0BA 5EV7A 1JXNA 1YJKA 1K12A 2A5ZA 3POBA 4MVTA 3A0KA 3T1LA 3WF0A 1IG0A 5HCFA 1UZWA 1UZYA 2ZEWA 5JPNB 2BU9A 4QAWA 1MS5A 5ACA2 2LALA 5E6HA 2P3IA 3OD4A 5EYXA 4K1YA 2IVJA 4DFSA 4UW5A 3MIFA 3R0RA 5CNAA 4BQ5A 2NM1A 1XNAA 3TB0A 4LHSA 4CUCA 3CJIA 4DY3A 5BNNC 1WLTA 1V6IA 3NJVA 4JKMA 1XNDA 2ZHNA 1IS3A 2VUJA 4G9SB 4PIXA 3PJYA 1NCRC 4SBVA 1G9DA 4CP9A 4GMP0 1QJU1 3V0AA 3J7MA 2DCZA 1IZ3A 3MW4A 1DG6A 4FPFA 2YGMA 2ADEA 4K20A 4C8DA 5FO9B 3TN93 2VXJA 4QD2A 3ACGA 4ARYA 3C2UA 3O1TA 4E8CA 3PU8A 5LRRA 2DCYA 1X9TA 4D3WA 2Z79A 4XQ4A 5K0UB 1PGSA 2HWF2 3I49A 4OULA 2ZX0A 1R083 2QVSB 2ZGPA 3FL7A 4OUMA 2QQWA 3RMYA 3S5QA 3K51A 1UPIA 3MIDA 3I2FA 2VNOA 2VO5A 2XKPA 3M8LA 4ORFA 4URTA 5BNOA 5K0UC 1U5YA 5ABJB 2KM2A 5FZEA 4AOCA 1LOBA 2SBAA 2XBO3 1C3HA 3AZVA 3BPZA 4XURA 4BMEA 3M2MA 5BUVA 2HWB1 3T0DA 1GP4A 1C57A 1MS0A 1Y9MA 4GULA 2VQUA 1VR3A 3M7AA 4HPKB 4TWTA 4UF0B 2JG8A 2Y60A 2HWC1 2VZPA 4GB32 4I01A 1W6NB 2Y6KA 5C8CB 4IETA 2JEMA 5I8YA 1UF2C 4FXKB 5JSPA 2ZGUA 4LBJA 4D8MA 1X36A 1XNTA 2B39A 1WA6X 4CTEA 4CZSA 5EYYA 4AHWA 3TEXA 3USSA 5FY8A 3VD4A 4I3GA 2MEV3 3N9PA 1R64A 4NRPA 1OPOA 5AFBA 2B4KA 1RMU1 5A1FA 3RJ2X 4LKFA 2J1AA 3MUY1 1SQ4A 3IDAA 1J3PA 2ZGQA 4JC1A 4H14A 3NV3A 3ZR5A 4NHXA 4IE6A 5FZCA 1VAKA 3MO4A 3WDTA 3AYDA 5IVJA 2BERA 4K6BA 1W2NA 5DAPA 5LRSA 4NHMA 1BEV1 2G19A 2WO3A 3TEWA 1VJ2A 3B5LB 5JOWA 5C4WA 3RG0A 3PNAA 5GKAC 4BYYA 2D6OX 2W87A 3N9OA 1C4RA 1BMV1 5CB7A 3FFZA 3BU0A 1K3IA 1KJLA 4AEDC 1H8TA 1REEA 1EPWA 1SLBA 3AJYA 1OLRA 3B69A 4Q4V2 5SV5A 3DECA 3OGRA 4XMAA 1PK6A 5JZGA 2XONA 1G8WA 1V6LA 3CZUA 1LRHA 4R9CA 1O3TA 2HWD3 2D6PA 4MGZE 3CMGA 4QXKA 2GNTA 2RM23 3KHCA 4IESA 5JOXA 4AQSA 4F83A 4DUVA 4P9WA 2CWMA 1C8M1 4D0QA 4DRRA 5I8TA 2VNVA 4LBNA 2XLAA 2Q5TA 4FPJA 4HKWA 5ERLA 2E32A 4R9AA 1VBE3 5CBLA 4YGBA 4CDUB 1OXCA 3IDBB 2DCTA 4HPKA 1VB2A 4XTPA 2A75A 1LGNA 3ME2A 1C1FA 2FDIA 5BNPA 1US3A 1FYUA 2VMCA 4A4AA 4BM8A 3H7JA 3D3AA 4UW4A 4MGYE 1JZ2A 3LWCA 1TME3 2JG9A 1QOOA 2FDGA 2DDUA 3G6JB 4IGPA 2VC9A 4IQPA 1LB2A 2CGNA 4YVSB 1W03A 3N7LA 5FYZA 3WDUA 3H8RA 4YM3A 3AXEA 4C0HA 5JPMB 1NKGA 2WA3A 4HMZA 2ZGOA 2JG8C 5CG8A 1KDKA 5F3GA 2GC1A 3BN6A 4CUGA 3OCPA 3PUQA 1YFXA 5JMCA 3M3IA 3AX4A 3LQCA 1JI6A 1R093 3ACFA 1KXGA 2XWBB 1PZ7A 4AHZA 3HEIA 4YZ3A 4ZU7A 2YZ4A 4NVPA 5L7OC 3WG1A 3ZSJA 1LGCA 4QGMA 2R1BA 1RUG3 1SBEA 2R32A 3DF0A 2DU0A 5FZFA 1PNGA 1LKNA 2LUWA 2W3JA 3WSOA 1AL21 3O1OA 4NRMA 1V00A 2JG8B 1IQAA 3DV8A 3J7NA 4JDOA 4N9HA 2QZ2A 1GZ9A 1RITA 2VZ1A 3H9AA 4YVSC 5IVEA 5K7PA 1NCQB 3RFRA 4B4PA 4XOGA 3WW2A 5A6QA 1IHMA 2X8KA 1N1VA 1WUVA 3WQ7A 4Z2WA 1DZRA 1LHUA 4FOVA 2JE7A 4Q8KA 1RJ8A 4O9EA 1OH4A 3ST7A 2IXIA 5K0UA 5AFEA 5BNOC 3HNMA 2W91A 2ZZJA 4LULA 2WWUA 3MBWA 4E27A 3RZJA 1BBT2 2WFF2 3VBSB 1UY2A 3GBFA 1YQ2A 4IEQA 2ZS6B 3FUQA 4I2OA 1YQ6A 4FO9A 3OGGA 4QQLA 1W8FA 1CWPA 4EN8B 2JIJA 4GIQA 5EFUA 4Q0PA 2N7GA 1KGYA 2VBBA 2YXSA 2TNFA 2Q4SA 1PX3A 3T1MA 2HJIA 3U10A 1GMMA 3ILRA 3JD71 4GWNA 4OI1A 4AF9A 1O3SA 1IQDC 2VOVA 1ZZ9A 4N43B 5C5UA 2XH6A 2BNMA 3ZFGA 2XBO2 3LFMA 4BB3A 4JRAA 3FBYA 5EZWA 3AMHA 3JB4C 2R063 3K3NA 1W9FA 1TG7A 1S0CA 5FBZA 1HIXA 2ZGKA 5A70A 3RZMA 1GQGA 4MSVA 4QGLA 5T5PA 1ZBA3 4ASLA 4QDQA 1VBA2 4CCLA 5T3NA 3UGGA 2NYYA 4M0NA 1DLLA 1BYHA 3WDXA 1SCRA 5LA1A 1DYKA 1PO21 4ITCA 5JXIA 3X29B 2Y6HA 2TBVA 3VBUB 3LCPA 4W4ZA 1JYIA 4B7KA 3LDKA 1Y3TA 2VU9A 3K4DA 3MW2A 2Y8KA 4Z07A 3MHZA 1RUJ2 1VBD2 1MEC1 5FZ8A 4D7SA 5KHJA 4LA3A 1K42A 4LNVA 4NIIA 2WZR2 4XBQA 3SXWA 4NO4A 4BQXA 1LU2A 4FFIA 2X5IA 2VMIA 5F37A 3MI8A 2ZBJA 1NXMA 1AYM2 1J84A 2WZPP 2VBDA 2IC1A 2IXCA 1ULPA 1NCQA 4DEVA 1QJX3 1QJY3 3KCXA 1TME1 3SLIA 5FWEA 2XVGA 1XNBA 2QKDA 3IBMA 4BK5A 1B35C 1EUUA 3K77A 3VD9A 2A6XA 1CVNA 4RS5A 4LMFA 1QNWA 1RXFA 4PLOA 4BU2A 2J1RA 2ZGRA 5BNQA 4DINB 3TN91 4R4ZA 3KB5A 1POQA 2XKOA 5FYTA 1DU3D 1XE7A 1LJ7A 3AL5A 1AYN3 1JHJA 4LO4B 4LBQD 3K4AA 4CU9A 4BH9A 1W6QA 3WNNA 1J3RA 3IWZA 2DWRA 3K4ZA 3UT0A 1N47A 4C0BA 1QNYA 1PX4A 2A6ZA 2BOIA 3AKSA 5EIYB 4CEYC 4JAAA 1FMD2 1Y9QA 2D5HA 4LHKA 3KLSA 2YV8A 5FJHA 5FZHA 3HWJA 2XHKA 1RJ7A 4GQ7A 5DAQA 1HRV2 3FFQA 1SDWA 1VE0A 5J98B 1PMIA 2UURA 2XJSA 4JV4A 4YFWA 4FT8A 2IVIB 3GCWA 3GBGA 1UY4A 3VBSC 3GALA 2JD4A 5FUNA 5BNPC 4AVCA 4XETA 1W3VA 3WOGA 1POV3 1ZX5A 3BGAA 4W50A 2YMZA 1QOSA 1UAIA 3O12A 4GH4B 1X33A 4RN5A 4YLZA 1K5JA 4YG6A 1MEC3 3PMEA 3ELNA 3HIFA 1N3QA 2J22A 3WXPA 4XAEA 3SMHA 3ZDVA 2VZVA 1O59A 4QT6A 5JDBA 3AP4A 3H0OA 2ZEZA 4AGRA 2BWAA 3KQ4B 3VBUA 4NJ4A 3AYAA 1HXS3 2EALA 3ILFA 4ONUA 5EJ3A 2QQIA 3ZYFA 1AR93 2UYBA 1W2TA 4QB2A 5DZGA 3SISA 4MLOA 4XHXA 4O61A 3OF1A 1CGPA 4PHZA 3URFA 4Q8LA 3JD73 1I9RA 2QDNA 5DZEA 1RVF2 2QE3A 3DXTA 2Y6FA 4QKBA 5CFDB 5H9PA 2E53A 1PK6B 4QPGC 2ETEA 4MXVA 4XIOA 3U14A 1KITA 3ZMOA 5JZGB 5CFCB 5ISLA 5KWRA 2RS52 5J3UA 1DYPA 3GDBA 5A7NA 3I2GA 4ZU4A 1JUHA 3LKJA 2ES3A 4XJUA 2VCAA 3FZ3A 2E9QA 2YU2A 2BTVC 4XQWA 2YUEA 2ET1A 3KV9A 5F39A 3WNXA 1QQP2 1J1LA 2QCSB 1GBGA 3IZOA 3PIJA 3TNQA 4B3NA 4RHV2 3H8XA 3N36A 2VOXA 4IXLA 1ZBE2 2VVDA 3R4SA 3BKZA 5A3MA 3IAQA 2DVDA 3O5SA 2A6VA 1QJEA 5L7OB 3V0BB 5K4LA 4X6RB 3POWA 3D4KA 4FPEA 2VTXJ 3POSA 5FZIA 3W9AA 4PDWB 4RR3A 2W92A 2X5IB 3VKNA 4CUBA 4FPOB 1O7FA 3O1PA 3PIGA 2BVVA 4AG4A 5C9AA 2GNDA 2PMWB 3WHUA 2DURA 5IVVA 2A6WA 1TNRA 5J37A 1ASJ2 4XJ9A 3OEAA 1WLWA 5M0TA 3PVNA 3AK0A 5IVCA 4PT6A 1N3PA 1FOD2 3AVRA 5E89A 4WM8B 1AR92 1ZBA1 2DYCA 2WZ8A 1BQPA 2A3XA 2RMU3 4S2DA 1HXS2 4ZZ5A 3ZIWA 1YWKA 3PTYA 5CADA 1UYZA 1UYYA 3I2JA 1NCQC 2QUOA 4H55A 4QHZA 3APBA 4Y26A 5LEKA 3H3LA 3HVDA 1QEXA 4Y4YA 2ZX2A 3KF3A 1OQEA 4QX1A 5FYVA 4AQTA 4XJWA 2C24A 2OQ6A 2QBXA 2ZJCA 3MGUA 2ZHMA 1HN0A 3BU7A 4YW3A 2PHRA 4A2UA 4XDQA 3BODA 4MHUA 2LROA 3LD8A 2WWSA 5F3CA 2WS93 3ZDSA 5GLTA 3DL3A 3WX5A 2ORXA 3W21A 1X8EA 4LOSA 5FO7B 3FBMA 3J4UH 2BZDA 4DB5A 2B7YA 4A42A 1ULFA 2VD7A 3KZ4C 3WUCA 1RUE1 1V6MA 1ZZCA 5LBCA 1TZOA 4CE8A 4YW2A 4QMAA 2RM21 4FXGB 1W8NA 1LU1A 2I07B 1OT5A 5FZ6A 1UKRA 3E6BA 2ENRA 3WW4A 2XQRA 1GSLA 3D0SA 2VMDA 4BXFA 4XE9A 1V6OA 2PLV2 5A7WA 4ES8A 4B7EA 1EV13 2D6LX 3I2OA 2OPWA 4X8PA 5FKBA 5FY1A 4RD7A 1W6OA 4NPMA 4RGAA 4OLLA 3BTAA 3SCFA 2GALA 5L36A 1X82A 3AZWA 1RMU3 1XE8A 1VRH1 1W06A 2HLEA 4CDUC 1ZZ6A 3I3DA 5A3OA 1CAXB 1HV0A 4IEUA 4EROA 4H7LA 2FDJA 2PTMA 4Q4Y1 1UQXA 3FJSA 4DXSA 4AFAA 4RQPC 3GNEA 4KGQA 4EV0A 4FPGA 4WM7A 5JMOA 1XSRA 4AAPA 3ZSLA 2DFBA 4BDVB 1VIWB 2R071 3H8OA 3EQEA 2V5YA 2OW4A 5ANQA 1F5JA 1WW7A 4P9JA 4PJYA 5C3PA 2G1MA 2OZ6A 2WS91 4EWAA 2VXRA 4Y24A 1LHNA 2D7FA 3OJBA 1UCXA 4XFBA 4XQDA 1DQ6A 4HSJA 1JZ4A 3WF3A 1OUSA 2E33A 1SPPA 2CDOA 4HKOA 4LA2A 4O7XA 4QGNA 5FP4A 2WO1A 1OSGA 2HWE1 1FPN3 3N9QA 1A34A 2PYTA 2BOJA 4MH0E 3KVAA 2JICA 3B7MA 1JHNA 1FPN1 2PHWA 5GZFA 5GZGA 1REFA 3BIEA 1DHKB 3A4UA 3ZFGC 5FOJB 1V0AA 1RUH2 4Q0VA 2YB7A 1S0EA 1HRI2 2EA7A 3POJA 5FREA 5JUVA 1HJFA 2R062 1WGPA 1EAH1 2NZ9A 2W1UA 4WM8C 1KRIA 2BP6A 4CDWA 4E2GA 3OGVA 4L99A 4AEKA 4MGQA 2WT0A 1MR5A 4YVSA 1G9FA 1IKQA 5FPXA 1GKBA 3U75A 3S30A 4HN1A 4XUTA 4IV3B 2RDSA 2B9VA 5FLJA 3CQOA 3BOPA 5I0UA 3S6PA 5KHHA 5C4WB 1QJFA 4JGZB 3C7FA 1PVC3 4BLIA 1OMIA 5IK8A
chains in the Genus database with same CATH topology
5L9BA 3GZEA 3MGUA 4MHUA 4XABA 5DAWA 4NHKA 5EP9A 3NNJA 5LATA 2FCVA 4Y5TA 3W21A 2JIGA 2Y33A 4NHLA 5LBCA 5IAVA 4Q5OA 2FCUA 3NNLA 3OBZA 2HBUA 4NHYA 5C5TA 3HQRA 4NHXA 5EPAA 2JIJA 4MHRA 5EQUA 2OPWA 5DAPA 4NHMA 3KT1A 5LASA 2G19A 5LB6A 4IW3A 5C5UA 5L9VA 4UWDA 3GJAA 4NMIA 5LA9A 3PL0A 3GJBA 3NNFA 2HBTA 2RDRA 4NAOA 3BVCA 3OUIA 2G1MA 2RG4A 3ITQA 4XC9A 3OUHA 2A1XA 5ERLA 4BQYA 4XCAA 3EMRA 4BQXA 2Y34A 4XCBA 5DAVA 4ZPIA 3NNMA 4KBZA 5LBBA 5HV0A 2FCTA 5M0TA 3HQUA 3KT4A 5LBFA 4BQWA 4Y5SA 4XACA 2V4AA 5L9RA 4J25A 3W20A 3KT7A 5IAXA 3OUJA 4JZRA 2RDQA 2RDSA 3DKQA 5LBEA 4ZONA 5HV4A 4XAAA 5DAXA 2RDNA 5DAQA 5A3UA 5IATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L9B A;  3GZE A;  3MGU A;  4MHU A;  4XAB A;  5DAW A;  4NHK A;  5EP9 A;  3NNJ A;  5LAT A;  2FCV A;  4Y5T A;  3W21 A;  2JIG A;  2Y33 A;  4NHL A;  5LBC A;  5IAV A;  4Q5O A;  2FCU A;  3NNL A;  3OBZ A;  2HBU A;  4NHY A;  5C5T A;  3HQR A;  4NHX A;  5EPA A;  2JIJ A;  4MHR A;  5EQU A;  2OPW A;  5DAP A;  4NHM A;  3KT1 A;  5LAS A;  2G19 A;  5LB6 A;  4IW3 A;  5C5U A;  5L9V A;  4UWD A;  3GJA A;  4NMI A;  5LA9 A;  3PL0 A;  3GJB A;  3NNF A;  2HBT A;  2RDR A;  4NAO A;  3BVC A;  3OUI A;  2G1M A;  2RG4 A;  3ITQ A;  4XC9 A;  3OUH A;  2A1X A;  5ERL A;  4BQY A;  4XCA A;  3EMR A;  4BQX A;  2Y34 A;  4XCB A;  5DAV A;  4ZPI A;  3NNM A;  4KBZ A;  5LBB A;  5HV0 A;  2FCT A;  5M0T A;  3HQU A;  3KT4 A;  5LBF A;  4BQW A;  4Y5S A;  4XAC A;  2V4A A;  5L9R A;  4J25 A;  3W20 A;  3KT7 A;  5IAX A;  3OUJ A;  4JZR A;  2RDQ A;  2RDS A;  3DKQ A;  5LBE A;  4ZON A;  5HV4 A;  4XAA A;  5DAX A;  2RDN A;  5DAQ A;  5A3U A;  5IAT A; 
#chains in the Genus database with same CATH topology
 1PO2 3;  2XOM A;  3I2H A;  2K46 A;  5F7U A;  2YHJ A;  1PMH X;  4CXX A;  3EYP A;  4FFF A;  3D82 A;  5G05 L;  5T52 A;  3HBZ A;  1BJQ A;  3N9L A;  4XJ8 A;  2B9U A;  4F8A A;  4V2V A;  3NV2 A;  1NY7 1;  5A7S A;  2XWJ B;  1UY3 A;  4LO6 B;  4P08 A;  1WMD A;  2RR1 1;  4MGT A;  1F5F A;  3ZFF A;  3GCX A;  3PUS A;  2R04 1;  3TNP B;  4OHW A;  4CCO A;  1WWY A;  5IK5 A;  4BQ2 A;  5EXO A;  2XUE A;  4KWL A;  3WY6 A;  5FXW A;  5C4W C;  4JQR A;  4L92 A;  4XHB A;  5CKQ A;  3USU B;  3VBO A;  4JDN A;  1C8M 3;  3AMN A;  3MV1 1;  4XF3 A;  3VGI A;  2CTV A;  1OKQ A;  2WN3 A;  2C0Z A;  3B94 A;  3OY8 A;  3VBR A;  2VUC A;  3WCS A;  3WG4 A;  5L7O A;  1IS5 A;  2J1T A;  4LKD A;  2JDY A;  3GHN A;  1VBE 1;  4KBB A;  2W47 A;  4R9D A;  4KG8 A;  1NCR B;  2BBA A;  3J7L A;  3RDI A;  3RZH A;  1ZRE A;  2DCJ A;  2XLF A;  2VNR A;  2DCK A;  4YNI A;  4HON A;  3V0B A;  1GNH A;  3RJR A;  1DGW X;  1ENX A;  3T4V A;  3HT1 A;  4AR2 A;  4C1W A;  1PM7 A;  2JJ6 A;  4UFK A;  4L0P A;  4DEQ A;  3TEY A;  4XUP A;  1HRV 3;  4EN7 B;  1RHI 2;  5F5A A;  1E5I A;  1HRI 3;  3CLP A;  5CFC C;  4YG3 A;  1ND2 B;  4M3C F;  2BDR A;  4NWW A;  1S0B A;  2ZAC A;  3DN7 A;  3KM5 A;  4N7U A;  1SMV A;  1UZ0 A;  4WVV A;  3GM8 A;  3WUD A;  4F7Z A;  3NMB A;  5A32 B;  2EAA A;  2QQN A;  2BW8 A;  2RR1 3;  4DUW A;  1CJP A;  2MPF A;  4NAO A;  3RS6 A;  2R04 3;  3BVC A;  3V0A B;  1HV1 A;  2NMO A;  5J7M A;  3QH7 A;  2UWA A;  2HWD 2;  3LIG A;  4MAD A;  4L11 A;  2JB4 A;  4IE4 A;  3OUI A;  3QBQ A;  4ET7 A;  4D69 A;  5BNP B;  3D5O A;  2E51 A;  2EXK A;  4XC9 A;  2EXH A;  1D0H A;  4QM9 A;  2A1X A;  4Y4R A;  3ZFE C;  1SLC A;  2WAB A;  1UIJ A;  3IMM A;  5A33 A;  5CA6 A;  3C8X A;  1JUI A;  1RIR A;  3POF A;  4IEV A;  4LBK A;  1YI9 A;  1VBC 1;  5D8A A;  3KD4 A;  1OA3 A;  5DUU A;  1PZ8 A;  2VQT A;  3RQ0 A;  4LIT A;  1GV9 A;  1TVG A;  4QB6 A;  4TLG A;  1VAL A;  2CYF A;  1JMU B;  1SFN A;  1ULG A;  3LEK A;  2JDN A;  4LO8 A;  2WNE A;  1X9P A;  1ENS A;  1HLC A;  1L3J A;  4O65 A;  2NQY A;  4IE5 A;  4OHV A;  2QJV A;  1VAV A;  4G4F A;  3VDD B;  2JXA A;  2WKK A;  3WNL A;  2FQP A;  2QQK A;  5FZL A;  4EE2 A;  2DBN A;  1EY2 A;  3POE A;  2KD7 A;  1WMX A;  1NE6 A;  4FBF A;  2CGO A;  2G9G A;  5L73 A;  3E6C C;  4CEY B;  5KXE A;  3KVB A;  1L7Q A;  4LIV A;  1BK1 A;  3C7H A;  4TXW A;  5LEJ A;  1VBB 3;  1UX6 A;  1MZE A;  4FPC A;  4N53 B;  3WR0 A;  5A3L A;  2D43 A;  4RL7 A;  3MYX A;  3ZYP A;  1UU6 A;  4U2A A;  5C71 A;  1W6Q B;  2C26 A;  5GJ6 A;  4CP9 B;  1PVC 2;  5J36 A;  5FZ9 A;  2W68 A;  4ES9 A;  3CJI C;  1QY4 A;  5BNN A;  2VOT A;  3BTZ A;  2BPA 2;  2AEZ A;  1UIK A;  2PHU A;  4YW7 A;  1DQ4 A;  5T55 A;  4B4R A;  3AM2 A;  3ABZ A;  3MIE A;  5JR2 A;  1NA1 B;  1PIV 3;  1XU1 A;  2V09 A;  1RUF 2;  2R07 3;  1I1E A;  3ECQ A;  3UV9 A;  1AX1 A;  1H4G A;  1AR7 2;  2H6C A;  1WLC A;  4GA9 A;  5FZA A;  2H6B A;  2IXH A;  4F3J A;  3E5Q A;  4AVS A;  1TMF 3;  3IKW A;  3P5B A;  1H6X A;  3WNK A;  1YJL A;  4UW3 A;  1TMF 2;  2JDK A;  1LHO A;  4KGG A;  1ZNP A;  2GMP A;  2J7M A;  1WBF A;  2ZPX A;  5LA2 A;  5C7G A;  5FZO B;  5HCA A;  2JDZ A;  1KFX L;  3JUU A;  3LEG A;  1Z7S 2;  4H7M A;  4N7I A;  5IFP A;  3KV5 A;  4PQQ A;  5GM0 A;  5J1X A;  1XBF A;  4ZY9 A;  2WBK A;  1R1A 1;  2HBU A;  2VVE A;  1GOH A;  3LA7 A;  1F35 A;  1K5M B;  4JKK A;  5CAZ A;  4AVV A;  4YW6 A;  5FUP A;  4CXW A;  4FAG A;  4Q27 A;  2HYK A;  3CJX A;  3HD8 B;  1KEX A;  1W28 A;  4M4P A;  5FK8 A;  1EAH 3;  5DQ0 A;  5D8A B;  3OG2 A;  1W9W A;  2OXB A;  3MF6 A;  2RS3 1;  4NE9 A;  4XFG A;  2VUL A;  3KMH A;  1MZF A;  1R08 2;  1XC6 A;  5G04 L;  3POI A;  3S0M A;  3ORJ A;  3WF4 A;  3PTR B;  5IYY A;  2JG9 C;  1WCU A;  4IV3 C;  3M3Q A;  4AFM A;  4S2F A;  3ZIX A;  4FSJ A;  2C4X A;  1LES A;  2VZQ A;  4IND A;  5T5J A;  3IDC B;  2DTY A;  4LBM A;  3UNP A;  1DGR N;  1EYB A;  4PLN A;  3ZXA C;  1I5P A;  4OZO A;  1RUJ 3;  1VBD 3;  1AX0 A;  2E31 A;  1GWK A;  1PGW 2;  1YO8 A;  2PXJ A;  1LOG A;  2FZ1 A;  1CZS A;  3AKR A;  1SBD A;  5FPB A;  3RVH A;  4XXP A;  1AR6 1;  2EVX A;  2VZR A;  3HPN A;  3JBG 2;  1ZVF A;  3ZYG A;  5CFD C;  1J58 A;  2VJX A;  4CYD A;  1X7N A;  5FRA A;  5FV3 A;  2D40 A;  4P14 A;  1Q3E A;  2BFU L;  2PHL A;  1FAT A;  4I0W B;  3BYW A;  2PHT A;  3GBW A;  5F9T A;  3CU7 A;  1V9U 2;  2EAK A;  2R7E B;  3WD5 A;  4KG0 A;  4XYX A;  3A22 A;  2BBV A;  1EV1 2;  3WT3 A;  1Q8V A;  5DZF A;  1AL2 3;  4UYB A;  4AHX A;  1X50 A;  3GZA A;  1XPW A;  3S5A A;  1JZ3 A;  4IGO A;  4YZ5 A;  2P6C A;  1ZRR A;  5KBF A;  2AEY A;  2RMU 1;  2ZX3 A;  3VBH C;  3NNM A;  1CAW A;  4AEM A;  3ZN6 A;  1G9A A;  5K9Y A;  1DFQ A;  1GZT A;  1ND2 C;  1AL0 G;  3LSD A;  4P02 B;  3ZKU A;  3VZO A;  1HN1 A;  3UJO A;  5DDJ 2;  3H3Z A;  3LE0 A;  5KHK A;  1H8V A;  2WR9 A;  2WII B;  5I0T A;  3WG2 A;  1D4V B;  4YSF A;  2E7A A;  1CAV B;  2O8O A;  3T09 A;  2D3P A;  3UYJ A;  1RL3 A;  4EZ4 A;  1QQP 3;  2WQ8 A;  3H8U A;  2PA7 A;  3IPV B;  3T3Y A;  4Y5S A;  3ZPO A;  5C3R A;  4PBO A;  2UY9 A;  4LQR A;  4E9K A;  3VZN A;  3ETQ A;  4RGK A;  5FPL A;  1PNF A;  4AE2 A;  3SHR A;  3R6S A;  5A33 B;  5JXG A;  1BZW A;  2WT2 A;  5D2A A;  2WLP A;  1KD7 A;  4MXW B;  3LA3 A;  1I3H A;  4Y1U A;  3ALQ A;  3ZYJ B;  3M3E A;  2OYZ A;  4JTO A;  5LBE A;  4XZU G;  5KXB A;  4IV3 A;  2ERF A;  4FPK A;  5DAX A;  1W0P A;  1RUI 3;  3PMS A;  2Q8O A;  2ARX A;  5DUX A;  1RUI 2;  2P3Y A;  4OYU A;  2XVL A;  3SQO A;  1Q56 A;  4ZS2 A;  4FQ4 A;  3ZXK A;  2WNU A;  4BWO A;  2MNG A;  3OYW B;  2GC2 A;  5EP9 A;  2VY0 A;  4U36 A;  4FOQ A;  4RYD A;  4AGG A;  3S7I A;  5C3S A;  1S0J A;  1E5R A;  3V64 A;  5FMO L;  2JG9 B;  4HL0 A;  2V73 A;  1AHS A;  1XNC A;  2D6M A;  1QGL A;  1S0G A;  4HSL A;  4JDM A;  4B4Q A;  3KQR A;  4NHL A;  1YXW A;  5FKC A;  5ACA 1;  1FI2 A;  4WM8 A;  1RGS A;  4K8F A;  1QIQ A;  3FMG A;  1H8T C;  4IEP A;  5AVA A;  3U4X A;  1UOJ A;  1OOP C;  4BK4 A;  1GZW B;  1LOE A;  1QJU 2;  4BHP A;  1OLM A;  3QCW A;  1G7Y A;  4Z82 A;  3KT1 A;  4A3X A;  4Z8B A;  2P34 A;  1F2N A;  5JI9 A;  2JKB A;  4HET A;  1UY1 A;  2XL7 A;  1APN A;  4EWD A;  3JQX A;  3VZK A;  1WCD J;  1MS8 A;  3OB8 A;  4GWJ A;  5BXX A;  1A78 A;  3ZR6 A;  5T5L A;  3U4S A;  2WJS A;  3ZVX A;  4QPI B;  1ZRC A;  5FYS A;  2ZGL A;  2W1Q A;  2JDP A;  4OHX A;  4LR4 A;  1FXZ A;  1LNS A;  3U11 A;  1DQ0 A;  2HWB 2;  3UJQ A;  1DP0 A;  3ZX7 A;  3E6D A;  3LA2 A;  1RED A;  2LM3 A;  3LF7 A;  2ZOE B;  2AYH A;  1L7R A;  1A3K A;  2RG4 A;  4FVV A;  3AZZ A;  1QJX 2;  1QJY 2;  1YCI A;  3T30 A;  2X10 A;  4YZ1 A;  4WZF A;  4NWV A;  4EN9 B;  2PAE A;  1RTV A;  3DGT A;  1HB4 A;  5FY4 A;  3S57 A;  2QQU A;  1TQ5 A;  1W39 A;  3E1F 1;  2VM9 A;  5GZC A;  1ALY A;  2WZR 3;  2GME A;  2CAU A;  4GAL A;  1CES A;  1DGW A;  3LPF A;  1ZZB A;  3RYK A;  3VBH A;  5FMB A;  2GC0 A;  2ZGT A;  2OZJ A;  4YM2 A;  1AYN 1;  3IMN A;  1YFY A;  3MIH A;  4QX5 A;  3BB6 A;  3JXS A;  4CDX A;  4FTS A;  2WIN B;  5C8C A;  2DVG A;  1RUD 2;  4HZF A;  3VZM A;  2ZCW A;  5LY2 A;  2XGX A;  4OI0 A;  4JGY A;  1YNA A;  2B46 X;  1OQ1 A;  4B1L A;  3T08 A;  2O14 A;  3KT7 A;  3L2H A;  2OPK A;  5FYY A;  2DVB A;  1P8J A;  3J8F 1;  1O91 A;  2F6B A;  4ASM B;  4GXL A;  1Y9G A;  5FP9 A;  3I3M A;  4QKD A;  5FZG A;  3LDB A;  3O1M A;  1TNF A;  1RXG A;  1JYC A;  4XAA A;  2F4P A;  3CDZ B;  4LO5 B;  2E26 A;  4Q0Q A;  3LOB A;  2K2S A;  4KNC A;  1PIV 2;  1RUC 1;  1ZZ7 A;  1WMF A;  2BGP A;  3QAC A;  2J42 A;  4FP2 A;  4GB3 3;  3THP A;  4FTB A;  3F2Z A;  1W8U A;  1VLN A;  2CSG A;  5JAX A;  3VKL A;  5LZ6 A;  1C8M 2;  3ZOI A;  1LOF A;  3CZJ A;  1E5H A;  3WDV A;  4Q0S A;  4QM8 A;  1CON A;  1VMH A;  2OII A;  1AR8 3;  5EHD A;  3QLQ A;  1S2K A;  2HEW F;  2E7Q A;  2FMY A;  5A7O A;  4BXS V;  5I0S A;  3LB9 A;  3ATG A;  5GAL A;  1AX2 A;  1NLQ A;  2W2I A;  4J6G A;  1NCR A;  1NXD 1;  1JU4 A;  2RS1 3;  4DMI A;  4PDW C;  4FPH A;  1ZZ8 A;  1R09 2;  2W5F A;  1QDO A;  2Z4F A;  4QX2 A;  4RR3 C;  3THT A;  1U5I A;  2A73 B;  1F8V A;  5GLU A;  4FTE A;  5BPX A;  1SLA A;  2VME A;  1RUN A;  3C7E A;  2YFZ A;  3PVO A;  5KXC A;  4Y22 B;  1ULC A;  4IV1 A;  1Q43 A;  1RUG 2;  4CPB D;  2WQZ C;  2ZX1 A;  2B5H A;  1QH7 A;  3AMP A;  1ULO A;  2YG0 A;  4AI2 A;  4LK7 A;  3QOP A;  1O4Z A;  3C3V A;  3HNY M;  4V1P A;  1OQD A;  1QH6 A;  3W5N A;  3N7K A;  5ABJ C;  2VZT A;  4XEZ A;  4Q4W 2;  5JOZ A;  2FD8 A;  4DQA A;  2EXJ A;  1FMD 3;  2VQA A;  4LLF A;  1NQJ A;  1AZD A;  2XG3 A;  1IS6 A;  1RUF 3;  3OSD A;  3PL0 A;  2X29 A;  2X5I C;  1W2O A;  1N1S A;  4XJZ A;  1WD4 A;  5KXD A;  4JGZ C;  2LS6 A;  4WVM B;  4CEY A;  4CCE A;  2IXK A;  2XL9 A;  3HR9 A;  1MVE A;  4LK6 A;  5FAX A;  3CIH A;  2Q8E A;  3VBF A;  4XFF A;  4YM1 A;  3III A;  3ZXJ A;  5F2S A;  3N7M A;  3BAL A;  4XCA A;  5B2G B;  1V9U 3;  3VV1 A;  1GLH A;  1OLQ A;  3WZ1 A;  5FPU A;  5JIA A;  1PO1 3;  1AYM 3;  1MS9 A;  1W9S A;  3H1W A;  5TSW A;  2D44 A;  1BBT 1;  2WFF 1;  1NAE A;  1STM A;  3I2D A;  3NQH A;  1JZ6 A;  2NP0 A;  2VUD A;  1ZA7 A;  2JDM A;  1LED A;  2XML A;  3AKT A;  2ZAH A;  2W95 A;  1GUI A;  2ZEX A;  1KJR A;  3N4M A;  2Y6J A;  3KT4 A;  4ISR A;  5DG2 A;  1CN1 A;  1GP6 A;  2WRA A;  1D2S A;  2RS1 2;  2RVA A;  3JD7 2;  3JU9 A;  3MPB A;  4NR1 A;  1OD5 A;  2ARE A;  5LA0 A;  1D4M 3;  5F8P A;  4QDR A;  3MZH A;  3WNM A;  2VQ0 A;  2C6S A;  4EZH A;  4BE3 A;  1OI6 A;  1QJZ A;  5B4X A;  1H1A A;  3M1H A;  4IV1 C;  4RGG A;  1OH3 A;  1VB4 A;  3ZXE A;  1N1T A;  1DF0 A;  4QXH A;  5DMY A;  1FV3 A;  1CR7 A;  1JBC A;  2AH2 A;  3MW3 A;  2RDQ A;  1UO9 A;  2QDR A;  4Y20 B;  4ZON A;  5HV4 A;  1SCS A;  3CNA A;  4A3Z A;  2G9Z A;  2TEP A;  1VBA 1;  4CRQ A;  2HEY F;  2ZKN A;  5JOY A;  2P1B A;  2FDH A;  1Y4W A;  1W2A X;  3M70 A;  1ONA A;  2PHF A;  1J3Q A;  2A3W A;  4MZU A;  1YIF A;  1O4T A;  1S2B A;  3RYP A;  1DCS A;  4Y5T A;  5T54 A;  2VEC A;  1OA2 A;  2XR4 A;  1RUJ 1;  1VBD 1;  3V65 A;  2D6N A;  2WFP A;  2VOK A;  2QQO A;  4PBP A;  2WZR 1;  1AR8 1;  4W8J A;  2Z2S B;  1A8M A;  1PO1 1;  2VAU A;  4P9G A;  5A6X A;  3ASI A;  1DGL A;  3VD7 A;  4QPI C;  1BBT 3;  2WFF 3;  4S2G A;  4CCJ A;  4NHY A;  5IFT A;  5SV8 A;  5C5T A;  5CYY A;  2C5D A;  4CDW B;  3IIA A;  3NVC A;  4AWD A;  1GOF A;  3KV6 A;  2VW1 A;  3FWE A;  1B35 B;  3JB8 A;  1XE0 A;  4BQ3 A;  3HAG A;  2VL4 A;  1W6M B;  1UOG A;  3OBT A;  2ADD A;  4I09 A;  1LOF C;  4YM0 A;  5EPA A;  4BA6 A;  2XJP A;  1UMI A;  3I59 B;  4LLO A;  3A0N A;  4M00 A;  3OBR A;  3TN9 2;  4IE7 A;  5LB6 A;  3WP5 A;  5FOB B;  4C91 A;  1LCL A;  4E2Q A;  4Y1Y A;  4IW3 A;  5FQ0 B;  5FWJ A;  4CDU A;  4EYU A;  1VBB 2;  4X6Q B;  1AVB A;  1W9T A;  3ZLI A;  4P9I A;  4AFC A;  4Y1V A;  4YYO A;  2HWF 3;  4I0A A;  1FMD 1;  3PLQ A;  1HX6 A;  3BOW A;  4NOT A;  3ACH A;  4NMI A;  3E97 A;  1D4M 2;  3Q9O A;  5LA9 A;  3RI8 A;  1HQN A;  1OOP A;  1MQT C;  2EIG A;  1U5Z A;  2BVB A;  4Y5Z 0;  4PIZ A;  4YG0 A;  2VZS A;  1YEW A;  5FMC A;  3ZXD A;  2UYA A;  1GQP A;  3R05 A;  4MX3 A;  4HOO A;  1XOY A;  1UOF A;  1WCK A;  2HWB 3;  1NA1 C;  2R16 A;  4QX0 A;  5FPV A;  4K21 A;  3SKV A;  4EN6 B;  4FOY A;  4RQP B;  4FPL A;  4Z2A A;  1UN1 A;  2O8Q A;  1FNY A;  2HWC 3;  2BNO A;  1F31 A;  3MIB A;  1JS9 A;  3SEP A;  1VMJ A;  2DF7 A;  3EBR A;  2YBP A;  2AC1 A;  1UNB A;  3NST A;  5E8A A;  2FDF A;  5IVB A;  4COV A;  2GAU A;  3THC A;  3DKW A;  4QKF A;  2D5F A;  4D7T A;  1CAV A;  1EUT A;  2ET7 A;  5DAV A;  5A7P A;  4MV2 A;  4AZZ A;  4D94 A;  3ON7 A;  2MEV 2;  3ZYB A;  4IEO A;  3AZY A;  1NX9 A;  4UFJ A;  2J1V A;  4K3U A;  5HV0 A;  2ZTN A;  1OLM E;  2VCB A;  3VDA A;  1LHV A;  1YYN A;  2EID A;  1WME A;  1OHF A;  1G9B A;  1RVF 1;  3VBF C;  4K8R B;  1COV 2;  2XJT A;  4WBB A;  5L9R A;  3HQX A;  1PGL 1;  1RHI 3;  2VW0 A;  4CU7 A;  3J8F 3;  3OPT A;  5DN2 A;  5KHG A;  3B3Q E;  3LEM A;  5FTT C;  1XRU A;  2WO2 A;  3EXU A;  2QTW B;  4V2W A;  1XU2 A;  4Q4V 3;  1OF4 A;  2BQP A;  1ND3 A;  3I4I A;  5F1R A;  4Q4X 2;  5FZ7 A;  3DKQ A;  2E7T A;  4I30 A;  1YQ8 A;  3I8T A;  1F9K A;  3UK9 A;  2GP3 A;  1QQP 1;  3ACL A;  3RSJ A;  1WKY A;  4LKE A;  4RHV 1;  1H2K A;  2W52 A;  4COW A;  2ZZQ A;  4ZS3 A;  1XXN A;  5FZD A;  1OFS A;  2VMF A;  4R4X A;  4I3P A;  3RNS A;  1ZBE 1;  1JZ8 A;  4LKS A;  4G3Y C;  2PHX A;  3K3O A;  3NWK A;  2D3R A;  1S0I A;  3F95 A;  1LEM A;  1WD3 A;  4AVB A;  3NNJ A;  5FLI A;  1DQ2 A;  5CKN A;  1XYO A;  3K48 A;  5LAT A;  1C5H A;  3H42 B;  1LHW A;  4P5Y A;  5IW0 A;  1VPH A;  3AXD A;  3KGZ A;  3LGR A;  4JQT A;  2OS2 A;  4NUB A;  3H1M A;  4CDQ A;  5K8S A;  2AGS A;  5C8W A;  4GH4 C;  3AC0 A;  4PF1 A;  3AZX A;  2YDE A;  1RB8 G;  2UY8 A;  2Q0A A;  3FN9 A;  4A6S A;  4XBN A;  2AAC A;  1LR5 A;  4OHZ A;  1U12 A;  1YLL A;  1ASJ 1;  1E57 A;  1UYP A;  2A70 A;  3HQR A;  3MLK A;  4KI5 M;  4XVH A;  1W99 A;  5CIR A;  5F3E A;  4E4Z A;  3OD0 A;  3KF5 A;  4DXT A;  4D6R A;  4XBL A;  2GDF A;  1AR9 1;  1YC6 1;  3CO2 A;  3I59 A;  3RZK A;  3HNB M;  5BYN A;  2IZW A;  3RPQ A;  1HXS 1;  2XQX A;  4QWN A;  5LCW L;  5IVY A;  3RRD A;  3IT8 A;  4OCT A;  2HWF 1;  2VE1 A;  4IEY A;  5C70 A;  4R52 A;  3AMM A;  4CDQ B;  2QQM A;  5LY1 A;  4GAZ A;  3N7J A;  2HYX A;  3HN3 A;  4URA A;  3H7Y A;  4PF5 A;  3VLB B;  5FR3 A;  3EO6 A;  4JCK A;  2DFC A;  1HKD A;  1VP6 A;  3BPS A;  1NLS A;  1F15 A;  3FE5 A;  3NAP A;  3POG A;  1CPN A;  4NRO A;  4WM7 B;  2Q8D A;  3I2I A;  3TOJ A;  4AVA A;  5AC9 2;  5IK4 A;  4FQZ A;  4PI2 A;  4QKN A;  3ZFG B;  3ZYH A;  1GZC A;  4AXO A;  3W58 A;  4J1W A;  1TE1 B;  4CPB A;  1JYW A;  2JX9 A;  3WP6 A;  3AJZ A;  4RFT 0;  5H9Q A;  2PN5 A;  2WWJ A;  2HWC 2;  4QPG A;  5J96 B;  5JCT A;  4GB3 1;  2GNB A;  2DU1 A;  3D8C A;  4QX3 A;  1BLZ A;  1S1A A;  4GKY A;  4N8M A;  3T4H B;  3SNM A;  4MGI E;  1NZI A;  4B1M A;  5C6C A;  2VOW A;  3BIW E;  4PI0 A;  3HN1 A;  1YRZ A;  4LT5 A;  1OD3 A;  1RUE 2;  2VTF A;  2WZE A;  2BGC A;  2Y34 A;  2FHR A;  1N3O A;  4YZ4 A;  4XCB A;  4FPY A;  5ACA 3;  5CFD A;  1RMU 2;  3UGH A;  1ASJ 3;  1JOD A;  3K46 A;  4GZ9 A;  4N53 A;  5FDB A;  5FY5 A;  4Q0U A;  5CG9 A;  2PLV 1;  4UT5 A;  2Y64 A;  3PDQ A;  4FCA A;  3ZPY A;  3B01 A;  1CZT A;  2Y6G A;  4MET A;  2PLV 3;  4FI9 A;  2KXL A;  1BEV 2;  4QU2 A;  5F32 A;  5FBJ A;  3SH5 A;  2F4L A;  5B4N A;  4QDS A;  5IT6 A;  1C5I A;  4JGY B;  1MS3 A;  4BQW A;  4XAC A;  1O6U A;  4D6Q A;  4C90 A;  1SG3 A;  1BMV 2;  4N90 A;  1UOB A;  4OFG A;  1W8O A;  4XFI A;  3NRU A;  4FFG A;  1MQT A;  5A7Q A;  5JIU A;  1BCX A;  1JH5 A;  2E6V A;  3WG3 A;  1JYX A;  1UKG A;  4Q4Y 2;  4Q4V 1;  4HK9 A;  4DXR A;  3HBK A;  1I5Z A;  2RJ2 A;  4RHV 3;  2W9X A;  1W8H A;  2JKX A;  5A3U A;  4DPN A;  3GYD A;  5CFC A;  3KGL A;  1BK0 A;  3U07 A;  4A7K A;  4A7Z A;  3ETP A;  2R07 2;  3B02 A;  3QH6 A;  4DIQ A;  3JBG 3;  3SH3 A;  3ZMN A;  4E4H A;  2EIB A;  5DAW A;  3VKO A;  1XQN A;  1R1Z A;  2W1W A;  3AFG A;  1JZ5 A;  3ZSK A;  2LW8 A;  1T2X A;  1IPS A;  3RYR A;  1WA4 A;  2JIG A;  2L9L A;  2ZX4 A;  1Q8P A;  3FLP A;  3ZYR A;  3N3H A;  4S2H A;  4ZU5 A;  1W3X A;  2R0F A;  4DUX A;  1Z0H A;  5D1I A;  1JN2 P;  5CEH A;  4CCM A;  2HWE 2;  5F5Q A;  2FCU A;  4CXY A;  3DXU A;  2AR6 A;  1POV 0;  1CAU B;  4P9L A;  3WF2 A;  1ND3 B;  3VDC A;  3DYM A;  2BWC A;  2ZA9 A;  4XUO A;  3EHK A;  1ZA4 A;  2W0X A;  5BNN B;  2R06 1;  4XXA A;  1EAH 2;  1GWM A;  4GJZ A;  5EJZ B;  2KR2 A;  3NNG A;  5FYC A;  3WEZ A;  4BIF A;  1OOP B;  4CUA A;  1SDD B;  4E4S A;  3IDE A;  1S0D A;  2VCM A;  4FFH A;  1PZ9 A;  4XFA A;  4IE0 A;  2B8M A;  2RV9 A;  1GZW A;  3ZYI B;  1WW6 A;  2WYS A;  1DQ5 A;  4K9S A;  4ZKT B;  1K45 A;  1W6P A;  4AAX A;  1V6N A;  2XUM A;  4AVT A;  1MS4 A;  2WN2 A;  4GMP 1;  1JOJ A;  4M4R A;  1FV2 A;  1NYW A;  5JVV A;  3PHM A;  1AL2 2;  4XF1 A;  2GN3 A;  3VUO A;  1XJA A;  3SIT A;  4MGS A;  3BUC A;  2VMH A;  2OKX A;  1AR7 3;  3MFA A;  1ODM A;  2C9A A;  2OVU A;  3O14 A;  4Z1V A;  1NY7 2;  3ITQ A;  3RZL A;  1H2N A;  2RR1 2;  3P1I A;  5ANN A;  2IXL A;  2X09 A;  4BQY A;  2SLI A;  2XHN A;  5HPO A;  1OBN A;  1C28 A;  4WVW A;  2Z42 A;  4MG2 A;  2IWG B;  3BCW A;  4GKX A;  4AK3 A;  1NT0 A;  1S4C A;  2YC2 A;  1HW5 A;  4CCN A;  1DIW A;  4UW6 A;  4A45 A;  3NJY A;  2WL1 A;  4KMQ A;  2RE9 A;  1KFU L;  4AI9 A;  2OUJ A;  3LIH A;  1JYT A;  2C9K A;  3O0X A;  3GGL A;  1CQ9 A;  3KCC A;  4OQ8 A;  5FMO S;  4M3C A;  4WZC A;  2AEN A;  1A6C A;  1YI7 A;  1WZX A;  5FP8 A;  1UU5 A;  2D3S A;  4W6Y A;  3VBS A;  3I97 A;  4EQV A;  2EIE A;  1W9Y A;  2PAM A;  4DS0 A;  3CL1 A;  4QHO A;  3UKN A;  1JYN A;  3EJK A;  1OVS A;  5D21 A;  3UGF A;  4GWI A;  4CP0 A;  2CGP A;  2XBO 1;  2BFU S;  2Q30 A;  3THD A;  4QX8 A;  1QXJ A;  1QU0 A;  2Y38 A;  3DEM A;  4YW1 A;  4D7Y A;  1YHF A;  2DV9 A;  2HEV F;  4PQ9 A;  2XPJ A;  5FMD A;  3T2P A;  1CAW B;  5T50 A;  1SZB A;  1QOT A;  2MHF A;  1PO2 2;  4Y33 A;  3ZXG A;  4NID A;  1ZM1 A;  1JZ7 A;  2HWE 3;  1J83 A;  1PVX A;  4QXC A;  4TLF A;  2WNV A;  1GNZ A;  4UFH A;  4BOW A;  2K9Z A;  1UYX A;  3HMY A;  2JDU A;  3IB3 A;  1MEC 2;  3A21 A;  4QU1 A;  2XVK A;  1FNZ A;  1KS5 A;  1X8M A;  1VBC 2;  5FXX A;  1H9P A;  3WNO A;  4XW3 A;  1Z7S 3;  4KWK A;  4OZX A;  1CAU A;  4Q5O A;  2CL2 A;  2Y6L A;  1AYM 1;  1SBF A;  1RYY A;  3FUO A;  1OUX A;  1O4Y A;  2D98 A;  4NN0 A;  1TME 2;  1DQ1 A;  3CHX A;  3ROU A;  4K40 A;  2VMG A;  2Q8C A;  4WVM A;  4LBQ A;  4XFC A;  4D6S A;  3RZG A;  3SKJ E;  1W6O B;  1IPJ A;  2OQ7 A;  1ND3 C;  4HLT A;  5LAS A;  5DXD A;  1C8N A;  1W0N A;  1OA4 A;  3PU3 A;  1WLD A;  5FPZ A;  3ILN A;  1D2Q A;  4YAR A;  2VNG A;  4BQ1 A;  4ASK A;  4JVA A;  4KU8 A;  4PIY A;  2I74 A;  1OF3 A;  1ACC A;  3I54 A;  3O1U A;  3WLU A;  2NN8 A;  2CHH A;  4UWD A;  2VUA A;  2XLG A;  3GJA A;  5FLH A;  4R9B A;  4KWJ A;  4QQO A;  2JEC A;  3WW3 A;  4MOA A;  3D6E A;  2Q1F A;  3ZXL A;  4XUN A;  4COY A;  3GJB A;  3H3U A;  3WP3 A;  2YPD A;  4DRV A;  3NNF A;  1HRV 1;  2B42 B;  2RDR A;  1ENR A;  1G6N A;  1RUF 1;  4LE3 A;  1NG0 A;  4AYU A;  1H2M A;  5FZB A;  4IEW A;  4UAP A;  2WLQ A;  1AR7 1;  1EP0 A;  1YFU A;  3T0A A;  3E5X A;  4LO7 A;  4XPV A;  4AGV A;  2HH9 A;  3H1Y A;  3KV4 A;  5FYU A;  3IAP A;  2YPJ A;  4AED A;  3POY A;  1VBA 3;  1W2U A;  4LE4 A;  1CD3 G;  3P3N A;  4JHT A;  1W04 A;  2VVF A;  3K75 B;  3WW1 A;  1GNY A;  4UOJ A;  4Q26 A;  3FLR A;  1GOG A;  4E8D A;  3GXU A;  4IEZ A;  2WQ4 A;  4MO3 M;  3VN4 A;  2ZML A;  4AFD A;  1NE4 A;  2W94 A;  3MV0 1;  4WV8 A;  5F6L B;  3LAG A;  4UFL A;  2WNV B;  2VH9 A;  1NA1 A;  1O8P A;  2ZHK A;  3CJI B;  4MUV A;  1WW5 A;  5AVP A;  1GU3 A;  4LEJ A;  1ST8 A;  4M0H A;  5FXV A;  5LBB A;  5FO8 B;  3AP7 A;  4L97 A;  3MUZ 1;  4Z92 B;  2RS3 3;  3HQU A;  2GH2 A;  3JQW A;  2RS3 2;  2UU8 A;  1RUH 3;  1H9W A;  2PHD A;  3ZFE A;  2JD9 A;  3K2O A;  5GZD A;  2O1Q A;  3OY8 B;  3NAP B;  2XXZ A;  3VBR B;  3W59 A;  4BZ4 A;  2IFW A;  2CV6 A;  1V70 A;  3LDR A;  4TZD A;  2DTW A;  2XJR A;  3TEZ A;  2VPV A;  2RS5 1;  2WT1 A;  2LRP A;  1CIW A;  1QHD A;  5CZK A;  2WA4 A;  4UXA A;  2RS5 3;  4BPZ A;  1HJG A;  4FAH A;  3B00 A;  2F17 A;  4JZR A;  4ZHN A;  1ULE A;  1MVQ A;  5C33 A;  4MYE A;  5HBA A;  3J26 N;  1DZQ A;  3C7O A;  5IK7 A;  4HAN A;  1N1Y A;  1RVF 3;  4N9I A;  5A6Z A;  1PGW 1;  2DVF A;  3FC0 A;  4KL1 A;  4PDW A;  4RR3 B;  4YVW C;  2HKX A;  1IS4 A;  1D0G A;  2D6K A;  4IDZ A;  5JXJ A;  2YBS A;  1VAM A;  1G9C A;  3JBG 1;  5FYB A;  4LIU A;  4I02 A;  4Q1R A;  4HVO A;  5FZM A;  1NLR A;  5DUW A;  2W08 A;  4NHK A;  1BKZ A;  4CCC A;  1YFW A;  5BNO B;  5D8A C;  4NRQ A;  1D7P M;  4UBG A;  3R4U A;  4Y1X A;  4C1X A;  5JXH A;  5IVF A;  1DBN A;  1GYK A;  2ORZ A;  3N9N A;  5T5O A;  4JHZ A;  5FZ0 A;  1EV1 1;  2Q1M A;  2IXJ A;  2YC0 A;  1JU3 A;  3B9C A;  2ZAA A;  3NJX A;  2B45 X;  3JCI A;  4YZ2 A;  2ZGM A;  3AL6 A;  4N43 C;  2TUN A;  4YGE A;  4CEW B;  1U5X A;  4TSV A;  2NLR A;  5FXZ A;  4AI8 A;  3NNL A;  3CBN A;  3OBZ A;  2RMU 2;  4OMD A;  1NOV A;  4GJY A;  4ZXK A;  1M4W A;  1BVP 1;  3I3E A;  3CEW A;  1XNK A;  2GH8 A;  3C7G A;  5F2W A;  3AMQ A;  2OT7 A;  3MIG A;  4J1X A;  3SC7 X;  1MQT B;  2A3Y A;  1BVV A;  1FOD 3;  4OMC A;  3WQ0 A;  2VZ3 A;  1UW8 A;  1H1M A;  1NZC A;  4CVU A;  5FP3 A;  1W90 A;  2ZHL A;  1FOD 1;  4ZXE A;  1H1I A;  1T6G C;  2P17 A;  1WCS A;  3PVE A;  1W6P B;  5FQ0 A;  1ZBA 2;  2X53 S;  4XF9 A;  5C3Q A;  2ZGS A;  4Q4Y 3;  2XDV A;  3TWI A;  1LEN A;  3VD3 A;  2GNM A;  2JE8 A;  1RUO A;  4UFM A;  4AW7 A;  4CA9 A;  2ARC A;  2AZ5 A;  3DYP A;  2WNV C;  3Q8B A;  4LOR A;  1NUK A;  4OQ9 A;  3VBH B;  4BMB A;  4LJH A;  3NL1 A;  1H2L A;  4CEW C;  4QPY A;  4XDP A;  1LOC A;  1MZ6 A;  3NV1 A;  1PHM A;  1UU4 A;  4COZ A;  4LOT A;  1YIP A;  4X8N A;  4HG6 B;  2PEL A;  3USU A;  3VD5 A;  2PQQ A;  2EXI A;  4TYS A;  3M3O A;  4BCU A;  3N35 A;  4COU A;  1ZBE 3;  2Y26 A;  1QXR A;  4EJR A;  4XMI A;  2NMN A;  2WAO A;  4Q4W 3;  1C1L A;  2ATF A;  1URX A;  5A1L A;  1F4A A;  2O0O A;  4M01 A;  3DCQ A;  3VB9 A;  4HXC A;  2V72 A;  4Y1Z A;  5L19 A;  5JLV A;  3OPZ A;  1RUE 3;  1UL9 A;  2RM2 2;  5A3N A;  2GU9 A;  5LWB A;  4P9X A;  2WNU C;  1LTE A;  4XIK A;  2YYO A;  4JGZ A;  4KBZ A;  4CP2 A;  1J1T A;  1DGR A;  2VZO A;  5AC9 1;  3PUA A;  2FCT A;  4JKL A;  1FX5 A;  5JSO A;  4W6X A;  3DPR C;  2R1D A;  3RZZ A;  4A7Y A;  3KSC A;  4RS5 B;  2CNA A;  4E4D X;  1AF9 A;  1GIC A;  5HI0 A;  2Y0O A;  3ZN6 B;  5F3I A;  4AED B;  3NV4 A;  2V4A A;  4YGD A;  4B8E A;  1VRH 2;  1YQ5 A;  2X05 A;  3WV6 A;  1FAY A;  4ATF A;  1IG3 A;  2GSY A;  4AQ6 A;  4DO0 A;  2DUQ A;  1ZRF A;  3VBO B;  3I3B A;  1CX4 A;  1HB2 A;  1T6B X;  1XSQ A;  2EF6 A;  2VZU A;  4UF0 A;  2XB6 C;  4CU6 A;  3D0J A;  5FFO C;  2KA3 A;  1XYN A;  2ZAB A;  3VBO C;  2ZMK A;  3OTF A;  2CAV A;  4JX0 A;  2RHP A;  1AR6 3;  4OUS A;  4UBH A;  1H4H A;  5FZ1 A;  3ZN5 A;  4HVQ A;  5IHR A;  5L9B A;  2ZEY A;  4CCD A;  4IEX A;  1SPP B;  5J09 A;  3U37 A;  4CDW C;  1UX7 A;  5C9A C;  1GAN A;  2WS9 2;  1OKO A;  3OYW A;  3U78 A;  1QJX 1;  1QJY 1;  3AVS A;  1UMH A;  3M4F A;  2BV4 A;  5FY0 A;  4HFS A;  1W8Z A;  4GD4 A;  1QMJ A;  2YGL A;  2D97 A;  1B35 A;  4YRD A;  1H8T B;  1SLT A;  1W05 A;  3SCH A;  3U1X A;  1M06 G;  3FLT A;  3AKQ A;  1OFN A;  1Q8Q A;  1VBC 3;  4QB1 A;  2YU1 A;  4GWM A;  4LHL A;  5HCB A;  1TEI A;  1HQW A;  3VBU C;  4YW4 A;  1FPN 2;  3LPG A;  3MIC A;  4Y3O A;  1SAC A;  2A7A A;  5IWF A;  4DY5 A;  4MGK E;  4IL7 A;  3LEI A;  1AYN 2;  1IKP A;  2UWC A;  3Q8E A;  4O9G A;  1O3Q A;  3L2Y A;  1W8W A;  1UWW A;  3OGJ A;  1RUH 1;  4QX7 A;  2Y0I A;  1HRI 1;  4M3C E;  4AEJ A;  1HDK A;  2R6Q A;  3E5U A;  2YC4 A;  5FPA A;  5I0D A;  4RA0 A;  3T2Q A;  3ZSM A;  1GFF 2;  4AI3 A;  1RUD 1;  3WF1 A;  4GMP 3;  3RWN A;  4NPL A;  3AYE A;  1RIN A;  4CDQ C;  2DUO A;  1ZRD A;  3DPR B;  4RSU A;  4CDX C;  3AYC A;  4IV1 B;  5F5C A;  3GZU C;  4LUM A;  5GZE A;  1MPX A;  2XJV A;  5FJK A;  5J48 A;  4AL9 A;  3W5M A;  3B9I A;  3J8F 2;  4YVW A;  3P6B A;  1SFP A;  3VKM A;  2JWP A;  3RGB A;  4DOU A;  4A41 A;  5C8C C;  2WDB A;  1V6J A;  2PFW A;  2QZ3 A;  2ILM A;  1GP5 A;  3LSE A;  3VDD A;  2BYV E;  2XJQ A;  3WCR A;  2H0V A;  2WUH A;  1PIV 1;  1RUC 2;  3H50 A;  2OUH A;  3ZFE B;  2FZ2 A;  2NPI A;  5KR7 A;  3VBR C;  3AB0 A;  5KC5 A;  5FZK A;  3MPP G;  3OEB A;  1GQH A;  5CIS A;  1UPS A;  3BTY A;  3WQB A;  2P3K A;  4XUQ A;  2GC3 A;  1B09 A;  2FDK A;  2ID4 A;  3OUH A;  3WDY A;  2DBI A;  1Q8O A;  1J59 A;  2R04 2;  4AFB A;  2YY1 A;  2VBP A;  5EWS A;  2WSV A;  3O7O A;  4ISQ A;  3WIN E;  2GMM A;  2A6Y A;  1H30 A;  1IOA A;  1SFY A;  2GN7 A;  5E16 A;  4OI4 A;  3VKF C;  3U0Z A;  1JW6 A;  4I0B A;  2WAA A;  1LOA A;  2Q1Z B;  3M3C A;  1VBE 2;  1CIY A;  2OA2 A;  2WYF A;  5FYM A;  1UXZ A;  2C1F A;  2V4V A;  4CP1 A;  3NW4 A;  3I3Q A;  1R09 1;  3PUH A;  2YFU A;  4RFR B;  3MFC A;  2EIC A;  4TN7 A;  2W46 A;  2I2S A;  1BHG A;  5FIX A;  5DUV A;  4MXW A;  3O1R A;  1U0A A;  2YRO A;  5GLZ A;  4P5H A;  1XYP A;  2VR4 A;  3KCY A;  1RUG 1;  3A23 A;  1RHI 1;  4B29 A;  4LPL A;  4BIS A;  1G86 A;  4QQ2 A;  3W20 A;  5LW9 A;  4NIG A;  4OVE A;  3PUR A;  1WW4 A;  2Z5W A;  3ENR A;  4CDX B;  1CZV A;  5A6Y A;  3J9S A;  1SLI A;  3VDB A;  2BJS A;  3NO8 A;  2CWS A;  3MDP A;  1AUY A;  3OUJ A;  2DUP A;  2VGD A;  4Q4W 1;  3SCG A;  3MLJ A;  4AI1 A;  2PAK A;  1VMF A;  5A3W A;  3WP4 A;  1V6K A;  4AQ2 A;  1H0B A;  1YUD A;  1SHW B;  5IAT A;  5HXM A;  3LFI A;  3N9M A;  4HKL A;  5FZO A;  3WHT A;  3RI9 A;  3Q8C A;  3GZE A;  1BXH A;  2G4I A;  5FY9 A;  2HWD 1;  1O8S A;  4DNY A;  1ZRI A;  4E2S A;  1OVP A;  4UFI A;  1SLL A;  3T0B A;  4XAB A;  4HN0 A;  3AKP A;  4PCR A;  3TRS B;  2FBE A;  4DXZ A;  2OX0 A;  3R4D B;  4Q4X 3;  4WVZ A;  3UKT A;  5A32 A;  2P4E A;  4W65 A;  2FCV A;  5FZ4 A;  4YFZ A;  2ARB A;  3ZFF B;  2P6H A;  5IJR A;  1QF3 A;  2BUK A;  4LUK A;  1IGO A;  5FY7 A;  4H2A A;  3CF6 E;  3SEE A;  4YW5 A;  3UET A;  1S55 A;  2Y33 A;  2P3J A;  3FX3 A;  3NJZ A;  5CKM A;  3MLL A;  1OUR A;  5E1R A;  3ES4 A;  3OGS A;  1NQD A;  1COV 3;  4H3W A;  3NAP C;  4L9B A;  2V5D A;  5JR7 B;  5JZG C;  5KC6 A;  3BI3 A;  5ABJ A;  1AJO A;  2ZXQ A;  4IUG A;  4Y20 A;  2P37 A;  1QWR A;  4R8H A;  2QFE A;  5JWP A;  2CU5 A;  3GHM A;  1PK6 C;  1DZT A;  1Q8S A;  2QQJ A;  4QPG B;  4QQH A;  3ZXF A;  5EQU A;  4JGY C;  5A3P A;  1K5M C;  1L7L A;  2J1U A;  4XF4 A;  4OHY A;  2RS1 1;  5FCC A;  2QNK A;  1Y7B A;  4FOW A;  1Y43 B;  1BEV 3;  3FHA A;  4YPJ A;  3VHO A;  3O1S A;  3UES A;  1S2E A;  2VW2 A;  4LXL A;  4BLJ A;  1KQR A;  2ZMN A;  5L9V A;  1O5U A;  1VRH 3;  4N53 C;  3Q8A A;  4KWU A;  5GLW A;  5A7W B;  3DUI A;  4XTM A;  3AP9 A;  2BGO A;  4OUE A;  1PVC 1;  4A6O A;  2VCC A;  1RUD 3;  1QXP A;  2W39 A;  4W6W A;  1W6N A;  4RS5 C;  3ACI A;  2I45 A;  1S0F A;  3UKV A;  3IPV A;  3FHQ A;  1RUC 3;  3PVB B;  2HBT A;  2JEN A;  2YBK A;  1CJD A;  4QHB A;  3VDD C;  4NAM A;  3VHN A;  4HT1 T;  5HCH A;  4CU8 A;  3VZL A;  4M3C B;  3WDW A;  3O1V A;  1CX1 A;  3WVJ A;  1POV 1;  3AP5 A;  3TYJ A;  1LGB A;  2JE9 A;  1TMF 1;  5I0R A;  5I93 A;  1KS4 A;  1CPM A;  1DYO A;  3HJR A;  4EWE A;  3ZN4 A;  2FMD A;  4LTA A;  4XF0 A;  4K1Z A;  3VL8 A;  1IPK A;  3T2T A;  5BY5 A;  3V56 A;  4Q29 A;  4LBQ B;  1Z7S 1;  1AR8 2;  3EMR A;  4EN0 A;  2ARA A;  1PO1 2;  4WM7 C;  3MF9 A;  2WC2 A;  3GF6 A;  2A71 A;  1R1A 2;  4IER A;  4ZPI A;  5H9R A;  5H9S A;  5I8S A;  3VHP A;  1ODN A;  4KH9 A;  3ES1 A;  1DDL A;  2J1E A;  4Q2F A;  4AHY A;  2AUY A;  4LBL A;  5IUQ A;  2WSU A;  3VL9 A;  1ND2 A;  1JOP A;  3KHB A;  5FZ3 A;  1QJU 3;  4HVR A;  1W0O A;  1LUL A;  1O5L A;  1OPM A;  1UY0 A;  5I91 A;  4KQ7 A;  1HB1 A;  3DYO A;  2D93 A;  3WNP A;  1R08 1;  1UZV A;  4IGQ A;  4QPI A;  4XJA A;  2QQL A;  5AC9 3;  1UD1 A;  5LBF A;  1HB3 A;  1ULD A;  5JI7 A;  2IUW A;  5JSR A;  3BTX A;  2G9F A;  4J25 A;  4YGC A;  3JZV A;  4A44 A;  1VBB 1;  2CY6 A;  2VTX A;  3PUI A;  4L2N A;  4QPW A;  5IAX A;  3T2O A;  2XJU A;  4JRL A;  5A80 A;  3I7D A;  4ATE A;  1A8D A;  1MAC A;  1JTZ X;  3TAY A;  1EPZ A;  1D4M 1;  1I6X A;  3L9J T;  5C9A B;  5GLV A;  4GH4 A;  4XDO A;  4BQ4 A;  1W8T A;  1GR3 A;  2RDN A;  1ZYB A;  4CCK A;  3OBA A;  3VZJ A;  1RC6 A;  2R49 A;  2K0G A;  1AR6 2;  4QQP A;  4AI0 A;  3ZM8 A;  3G7D A;  1UXX X;  3P3P A;  2WNO A;  5HXV A;  5A3T A;  1US2 A;  3QD6 A;  2BNN A;  2JDA A;  2ZGN A;  4YWA A;  5DAB A;  1V9U 1;  3B93 A;  1HQL A;  1K5M A;  2R0H A;  3INA A;  5F5I A;  5EJ1 B;  5FYH A;  3OPW A;  3ZFF C;  2LTN A;  2P5B A;  3WQ1 A;  5FP7 A;  3HT2 A;  5F6K A;  4NIA A;  5CVR A;  1PMJ X;  1JYV A;  1MZ5 A;  1KDM A;  2QQV A;  3KWV A;  4NIH A;  5IAV A;  3VHR A;  4XFH A;  2ZKL A;  1YQC A;  1OC1 A;  4ZZ8 A;  2MEV 1;  5CU1 A;  4SLI A;  3RWK X;  3AFK A;  5APA A;  2RJK A;  2CDP A;  2JB8 A;  2BEO A;  1PM4 A;  3OOX A;  4XZP A;  1QKQ A;  2DVA A;  3SH4 A;  4TTG A;  2Z69 A;  3ZKY A;  1AJK A;  5DDJ 1;  5E88 A;  2GP5 A;  3HOB A;  3NKG A;  3IM0 A;  4RQP A;  5DG1 A;  4MHR A;  4CEW A;  3ZO0 B;  1LAJ A;  5LK7 B;  5DDJ 3;  3O0V A;  1LEC A;  3VBF B;  3IN9 A;  3TBD A;  4NPR A;  2BRT A;  2PQS A;  1AXY A;  2GZW A;  1AXK A;  1LOD A;  2WNU B;  4P9Y A;  4KU7 A;  4P00 B;  4N43 A;  4OI2 A;  1COV 1;  1H6Y A;  1UMZ A;  1UZZ A;  4HBN A;  5C3O A;  3KS7 A;  5A1A A;  2QQP A;  4L8Q A;  3CKH A;  4UI9 L;  2UWB A;  3RMX A;  3ZSE A;  1PGL 2;  4DZG A;  1SEF A;  3PJQ A;  5LK5 A;  5DPN A;  2VG9 A;  4JTN A;  1CAX A;  1WCQ A;  1VRB A;  2R30 A;  5FK7 A;  3Q8F A;  1E5S A;  2W1S A;  3NKT A;  4Y22 A;  4Q4X 1;  1Q5O A;  3A7Q A;  1JOB A;  3FHI B;  3S7E A;  4K7J A;  3LZZ A;  5BV6 A;  1F4H A;  2E63 A;  2IFR A;  5FUI A;  3I2K A;  3J7H A;  3AP6 A;  3MEP A;  1AXZ A;  1RUI 1;  1GWL A;  1Z78 A;  2WO7 A;  3O0W A;  5KHI A;  4Q1P A;  1O3R A;  4CSW A;  3GZT B;  4YVW B;  4BIO A;  2RJL A;  2JDH A;  4XIL A;  4ARX A;  2J1S A;  1W6M A;  4HK8 A;  3LOI A;  1QDC A;  4LHN A;  4PLM A;  1DLC A;  1MS1 A;  1ENQ A;  4FP3 A;  1XB9 A;  3EB7 A;  4QXB A;  1R1A 3;  1FT9 A;  2P2K A;  5FYI A;  3UL2 A;  4BJ0 A;  3DPR A;  1WBL A;  4LBO A;  2H0B A;  5EV7 A;  1JXN A;  1YJK A;  1K12 A;  2A5Z A;  3POB A;  4MVT A;  3A0K A;  3T1L A;  3WF0 A;  1IG0 A;  5HCF A;  1UZW A;  1UZY A;  2ZEW A;  5JPN B;  2BU9 A;  4QAW A;  1MS5 A;  5ACA 2;  2LAL A;  5E6H A;  2P3I A;  3OD4 A;  5EYX A;  4K1Y A;  2IVJ A;  4DFS A;  4UW5 A;  3MIF A;  3R0R A;  5CNA A;  4BQ5 A;  2NM1 A;  1XNA A;  3TB0 A;  4LHS A;  4CUC A;  3CJI A;  4DY3 A;  5BNN C;  1WLT A;  1V6I A;  3NJV A;  4JKM A;  1XND A;  2ZHN A;  1IS3 A;  2VUJ A;  4G9S B;  4PIX A;  3PJY A;  1NCR C;  4SBV A;  1G9D A;  4CP9 A;  4GMP 0;  1QJU 1;  3V0A A;  3J7M A;  2DCZ A;  1IZ3 A;  3MW4 A;  1DG6 A;  4FPF A;  2YGM A;  2ADE A;  4K20 A;  4C8D A;  5FO9 B;  3TN9 3;  2VXJ A;  4QD2 A;  3ACG A;  4ARY A;  3C2U A;  3O1T A;  4E8C A;  3PU8 A;  5LRR A;  2DCY A;  1X9T A;  4D3W A;  2Z79 A;  4XQ4 A;  5K0U B;  1PGS A;  2HWF 2;  3I49 A;  4OUL A;  2ZX0 A;  1R08 3;  2QVS B;  2ZGP A;  3FL7 A;  4OUM A;  2QQW A;  3RMY A;  3S5Q A;  3K51 A;  1UPI A;  3MID A;  3I2F A;  2VNO A;  2VO5 A;  2XKP A;  3M8L A;  4ORF A;  4URT A;  5BNO A;  5K0U C;  1U5Y A;  5ABJ B;  2KM2 A;  5FZE A;  4AOC A;  1LOB A;  2SBA A;  2XBO 3;  1C3H A;  3AZV A;  3BPZ A;  4XUR A;  4BME A;  3M2M A;  5BUV A;  2HWB 1;  3T0D A;  1GP4 A;  1C57 A;  1MS0 A;  1Y9M A;  4GUL A;  2VQU A;  1VR3 A;  3M7A A;  4HPK B;  4TWT A;  4UF0 B;  2JG8 A;  2Y60 A;  2HWC 1;  2VZP A;  4GB3 2;  4I01 A;  1W6N B;  2Y6K A;  5C8C B;  4IET A;  2JEM A;  5I8Y A;  1UF2 C;  4FXK B;  5JSP A;  2ZGU A;  4LBJ A;  4D8M A;  1X36 A;  1XNT A;  2B39 A;  1WA6 X;  4CTE A;  4CZS A;  5EYY A;  4AHW A;  3TEX A;  3USS A;  5FY8 A;  3VD4 A;  4I3G A;  2MEV 3;  3N9P A;  1R64 A;  4NRP A;  1OPO A;  5AFB A;  2B4K A;  1RMU 1;  5A1F A;  3RJ2 X;  4LKF A;  2J1A A;  3MUY 1;  1SQ4 A;  3IDA A;  1J3P A;  2ZGQ A;  4JC1 A;  4H14 A;  3NV3 A;  3ZR5 A;  4NHX A;  4IE6 A;  5FZC A;  1VAK A;  3MO4 A;  3WDT A;  3AYD A;  5IVJ A;  2BER A;  4K6B A;  1W2N A;  5DAP A;  5LRS A;  4NHM A;  1BEV 1;  2G19 A;  2WO3 A;  3TEW A;  1VJ2 A;  3B5L B;  5JOW A;  5C4W A;  3RG0 A;  3PNA A;  5GKA C;  4BYY A;  2D6O X;  2W87 A;  3N9O A;  1C4R A;  1BMV 1;  5CB7 A;  3FFZ A;  3BU0 A;  1K3I A;  1KJL A;  4AED C;  1H8T A;  1REE A;  1EPW A;  1SLB A;  3AJY A;  1OLR A;  3B69 A;  4Q4V 2;  5SV5 A;  3DEC A;  3OGR A;  4XMA A;  1PK6 A;  5JZG A;  2XON A;  1G8W A;  1V6L A;  3CZU A;  1LRH A;  4R9C A;  1O3T A;  2HWD 3;  2D6P A;  4MGZ E;  3CMG A;  4QXK A;  2GNT A;  2RM2 3;  3KHC A;  4IES A;  5JOX A;  4AQS A;  4F83 A;  4DUV A;  4P9W A;  2CWM A;  1C8M 1;  4D0Q A;  4DRR A;  5I8T A;  2VNV A;  4LBN A;  2XLA A;  2Q5T A;  4FPJ A;  4HKW A;  5ERL A;  2E32 A;  4R9A A;  1VBE 3;  5CBL A;  4YGB A;  4CDU B;  1OXC A;  3IDB B;  2DCT A;  4HPK A;  1VB2 A;  4XTP A;  2A75 A;  1LGN A;  3ME2 A;  1C1F A;  2FDI A;  5BNP A;  1US3 A;  1FYU A;  2VMC A;  4A4A A;  4BM8 A;  3H7J A;  3D3A A;  4UW4 A;  4MGY E;  1JZ2 A;  3LWC A;  1TME 3;  2JG9 A;  1QOO A;  2FDG A;  2DDU A;  3G6J B;  4IGP A;  2VC9 A;  4IQP A;  1LB2 A;  2CGN A;  4YVS B;  1W03 A;  3N7L A;  5FYZ A;  3WDU A;  3H8R A;  4YM3 A;  3AXE A;  4C0H A;  5JPM B;  1NKG A;  2WA3 A;  4HMZ A;  2ZGO A;  2JG8 C;  5CG8 A;  1KDK A;  5F3G A;  2GC1 A;  3BN6 A;  4CUG A;  3OCP A;  3PUQ A;  1YFX A;  5JMC A;  3M3I A;  3AX4 A;  3LQC A;  1JI6 A;  1R09 3;  3ACF A;  1KXG A;  2XWB B;  1PZ7 A;  4AHZ A;  3HEI A;  4YZ3 A;  4ZU7 A;  2YZ4 A;  4NVP A;  5L7O C;  3WG1 A;  3ZSJ A;  1LGC A;  4QGM A;  2R1B A;  1RUG 3;  1SBE A;  2R32 A;  3DF0 A;  2DU0 A;  5FZF A;  1PNG A;  1LKN A;  2LUW A;  2W3J A;  3WSO A;  1AL2 1;  3O1O A;  4NRM A;  1V00 A;  2JG8 B;  1IQA A;  3DV8 A;  3J7N A;  4JDO A;  4N9H A;  2QZ2 A;  1GZ9 A;  1RIT A;  2VZ1 A;  3H9A A;  4YVS C;  5IVE A;  5K7P A;  1NCQ B;  3RFR A;  4B4P A;  4XOG A;  3WW2 A;  5A6Q A;  1IHM A;  2X8K A;  1N1V A;  1WUV A;  3WQ7 A;  4Z2W A;  1DZR A;  1LHU A;  4FOV A;  2JE7 A;  4Q8K A;  1RJ8 A;  4O9E A;  1OH4 A;  3ST7 A;  2IXI A;  5K0U A;  5AFE A;  5BNO C;  3HNM A;  2W91 A;  2ZZJ A;  4LUL A;  2WWU A;  3MBW A;  4E27 A;  3RZJ A;  1BBT 2;  2WFF 2;  3VBS B;  1UY2 A;  3GBF A;  1YQ2 A;  4IEQ A;  2ZS6 B;  3FUQ A;  4I2O A;  1YQ6 A;  4FO9 A;  3OGG A;  4QQL A;  1W8F A;  1CWP A;  4EN8 B;  2JIJ A;  4GIQ A;  5EFU A;  4Q0P A;  2N7G A;  1KGY A;  2VBB A;  2YXS A;  2TNF A;  2Q4S A;  1PX3 A;  3T1M A;  2HJI A;  3U10 A;  1GMM A;  3ILR A;  3JD7 1;  4GWN A;  4OI1 A;  4AF9 A;  1O3S A;  1IQD C;  2VOV A;  1ZZ9 A;  4N43 B;  5C5U A;  2XH6 A;  2BNM A;  3ZFG A;  2XBO 2;  3LFM A;  4BB3 A;  4JRA A;  3FBY A;  5EZW A;  3AMH A;  3JB4 C;  2R06 3;  3K3N A;  1W9F A;  1TG7 A;  1S0C A;  5FBZ A;  1HIX A;  2ZGK A;  5A70 A;  3RZM A;  1GQG A;  4MSV A;  4QGL A;  5T5P A;  1ZBA 3;  4ASL A;  4QDQ A;  1VBA 2;  4CCL A;  5T3N A;  3UGG A;  2NYY A;  4M0N A;  1DLL A;  1BYH A;  3WDX A;  1SCR A;  5LA1 A;  1DYK A;  1PO2 1;  4ITC A;  5JXI A;  3X29 B;  2Y6H A;  2TBV A;  3VBU B;  3LCP A;  4W4Z A;  1JYI A;  4B7K A;  3LDK A;  1Y3T A;  2VU9 A;  3K4D A;  3MW2 A;  2Y8K A;  4Z07 A;  3MHZ A;  1RUJ 2;  1VBD 2;  1MEC 1;  5FZ8 A;  4D7S A;  5KHJ A;  4LA3 A;  1K42 A;  4LNV A;  4NII A;  2WZR 2;  4XBQ A;  3SXW A;  4NO4 A;  4BQX A;  1LU2 A;  4FFI A;  2X5I A;  2VMI A;  5F37 A;  3MI8 A;  2ZBJ A;  1NXM A;  1AYM 2;  1J84 A;  2WZP P;  2VBD A;  2IC1 A;  2IXC A;  1ULP A;  1NCQ A;  4DEV A;  1QJX 3;  1QJY 3;  3KCX A;  1TME 1;  3SLI A;  5FWE A;  2XVG A;  1XNB A;  2QKD A;  3IBM A;  4BK5 A;  1B35 C;  1EUU A;  3K77 A;  3VD9 A;  2A6X A;  1CVN A;  4RS5 A;  4LMF A;  1QNW A;  1RXF A;  4PLO A;  4BU2 A;  2J1R A;  2ZGR A;  5BNQ A;  4DIN B;  3TN9 1;  4R4Z A;  3KB5 A;  1POQ A;  2XKO A;  5FYT A;  1DU3 D;  1XE7 A;  1LJ7 A;  3AL5 A;  1AYN 3;  1JHJ A;  4LO4 B;  4LBQ D;  3K4A A;  4CU9 A;  4BH9 A;  1W6Q A;  3WNN A;  1J3R A;  3IWZ A;  2DWR A;  3K4Z A;  3UT0 A;  1N47 A;  4C0B A;  1QNY A;  1PX4 A;  2A6Z A;  2BOI A;  3AKS A;  5EIY B;  4CEY C;  4JAA A;  1FMD 2;  1Y9Q A;  2D5H A;  4LHK A;  3KLS A;  2YV8 A;  5FJH A;  5FZH A;  3HWJ A;  2XHK A;  1RJ7 A;  4GQ7 A;  5DAQ A;  1HRV 2;  3FFQ A;  1SDW A;  1VE0 A;  5J98 B;  1PMI A;  2UUR A;  2XJS A;  4JV4 A;  4YFW A;  4FT8 A;  2IVI B;  3GCW A;  3GBG A;  1UY4 A;  3VBS C;  3GAL A;  2JD4 A;  5FUN A;  5BNP C;  4AVC A;  4XET A;  1W3V A;  3WOG A;  1POV 3;  1ZX5 A;  3BGA A;  4W50 A;  2YMZ A;  1QOS A;  1UAI A;  3O12 A;  4GH4 B;  1X33 A;  4RN5 A;  4YLZ A;  1K5J A;  4YG6 A;  1MEC 3;  3PME A;  3ELN A;  3HIF A;  1N3Q A;  2J22 A;  3WXP A;  4XAE A;  3SMH A;  3ZDV A;  2VZV A;  1O59 A;  4QT6 A;  5JDB A;  3AP4 A;  3H0O A;  2ZEZ A;  4AGR A;  2BWA A;  3KQ4 B;  3VBU A;  4NJ4 A;  3AYA A;  1HXS 3;  2EAL A;  3ILF A;  4ONU A;  5EJ3 A;  2QQI A;  3ZYF A;  1AR9 3;  2UYB A;  1W2T A;  4QB2 A;  5DZG A;  3SIS A;  4MLO A;  4XHX A;  4O61 A;  3OF1 A;  1CGP A;  4PHZ A;  3URF A;  4Q8L A;  3JD7 3;  1I9R A;  2QDN A;  5DZE A;  1RVF 2;  2QE3 A;  3DXT A;  2Y6F A;  4QKB A;  5CFD B;  5H9P A;  2E53 A;  1PK6 B;  4QPG C;  2ETE A;  4MXV A;  4XIO A;  3U14 A;  1KIT A;  3ZMO A;  5JZG B;  5CFC B;  5ISL A;  5KWR A;  2RS5 2;  5J3U A;  1DYP A;  3GDB A;  5A7N A;  3I2G A;  4ZU4 A;  1JUH A;  3LKJ A;  2ES3 A;  4XJU A;  2VCA A;  3FZ3 A;  2E9Q A;  2YU2 A;  2BTV C;  4XQW A;  2YUE A;  2ET1 A;  3KV9 A;  5F39 A;  3WNX A;  1QQP 2;  1J1L A;  2QCS B;  1GBG A;  3IZO A;  3PIJ A;  3TNQ A;  4B3N A;  4RHV 2;  3H8X A;  3N36 A;  2VOX A;  4IXL A;  1ZBE 2;  2VVD A;  3R4S A;  3BKZ A;  5A3M A;  3IAQ A;  2DVD A;  3O5S A;  2A6V A;  1QJE A;  5L7O B;  3V0B B;  5K4L A;  4X6R B;  3POW A;  3D4K A;  4FPE A;  2VTX J;  3POS A;  5FZI A;  3W9A A;  4PDW B;  4RR3 A;  2W92 A;  2X5I B;  3VKN A;  4CUB A;  4FPO B;  1O7F A;  3O1P A;  3PIG A;  2BVV A;  4AG4 A;  5C9A A;  2GND A;  2PMW B;  3WHU A;  2DUR A;  5IVV A;  2A6W A;  1TNR A;  5J37 A;  1ASJ 2;  4XJ9 A;  3OEA A;  1WLW A;  5M0T A;  3PVN A;  3AK0 A;  5IVC A;  4PT6 A;  1N3P A;  1FOD 2;  3AVR A;  5E89 A;  4WM8 B;  1AR9 2;  1ZBA 1;  2DYC A;  2WZ8 A;  1BQP A;  2A3X A;  2RMU 3;  4S2D A;  1HXS 2;  4ZZ5 A;  3ZIW A;  1YWK A;  3PTY A;  5CAD A;  1UYZ A;  1UYY A;  3I2J A;  1NCQ C;  2QUO A;  4H55 A;  4QHZ A;  3APB A;  4Y26 A;  5LEK A;  3H3L A;  3HVD A;  1QEX A;  4Y4Y A;  2ZX2 A;  3KF3 A;  1OQE A;  4QX1 A;  5FYV A;  4AQT A;  4XJW A;  2C24 A;  2OQ6 A;  2QBX A;  2ZJC A;  3MGU A;  2ZHM A;  1HN0 A;  3BU7 A;  4YW3 A;  2PHR A;  4A2U A;  4XDQ A;  3BOD A;  4MHU A;  2LRO A;  3LD8 A;  2WWS A;  5F3C A;  2WS9 3;  3ZDS A;  5GLT A;  3DL3 A;  3WX5 A;  2ORX A;  3W21 A;  1X8E A;  4LOS A;  5FO7 B;  3FBM A;  3J4U H;  2BZD A;  4DB5 A;  2B7Y A;  4A42 A;  1ULF A;  2VD7 A;  3KZ4 C;  3WUC A;  1RUE 1;  1V6M A;  1ZZC A;  5LBC A;  1TZO A;  4CE8 A;  4YW2 A;  4QMA A;  2RM2 1;  4FXG B;  1W8N A;  1LU1 A;  2I07 B;  1OT5 A;  5FZ6 A;  1UKR A;  3E6B A;  2ENR A;  3WW4 A;  2XQR A;  1GSL A;  3D0S A;  2VMD A;  4BXF A;  4XE9 A;  1V6O A;  2PLV 2;  5A7W A;  4ES8 A;  4B7E A;  1EV1 3;  2D6L X;  3I2O A;  2OPW A;  4X8P A;  5FKB A;  5FY1 A;  4RD7 A;  1W6O A;  4NPM A;  4RGA A;  4OLL A;  3BTA A;  3SCF A;  2GAL A;  5L36 A;  1X82 A;  3AZW A;  1RMU 3;  1XE8 A;  1VRH 1;  1W06 A;  2HLE A;  4CDU C;  1ZZ6 A;  3I3D A;  5A3O A;  1CAX B;  1HV0 A;  4IEU A;  4ERO A;  4H7L A;  2FDJ A;  2PTM A;  4Q4Y 1;  1UQX A;  3FJS A;  4DXS A;  4AFA A;  4RQP C;  3GNE A;  4KGQ A;  4EV0 A;  4FPG A;  4WM7 A;  5JMO A;  1XSR A;  4AAP A;  3ZSL A;  2DFB A;  4BDV B;  1VIW B;  2R07 1;  3H8O A;  3EQE A;  2V5Y A;  2OW4 A;  5ANQ A;  1F5J A;  1WW7 A;  4P9J A;  4PJY A;  5C3P A;  2G1M A;  2OZ6 A;  2WS9 1;  4EWA A;  2VXR A;  4Y24 A;  1LHN A;  2D7F A;  3OJB A;  1UCX A;  4XFB A;  4XQD A;  1DQ6 A;  4HSJ A;  1JZ4 A;  3WF3 A;  1OUS A;  2E33 A;  1SPP A;  2CDO A;  4HKO A;  4LA2 A;  4O7X A;  4QGN A;  5FP4 A;  2WO1 A;  1OSG A;  2HWE 1;  1FPN 3;  3N9Q A;  1A34 A;  2PYT A;  2BOJ A;  4MH0 E;  3KVA A;  2JIC A;  3B7M A;  1JHN A;  1FPN 1;  2PHW A;  5GZF A;  5GZG A;  1REF A;  3BIE A;  1DHK B;  3A4U A;  3ZFG C;  5FOJ B;  1V0A A;  1RUH 2;  4Q0V A;  2YB7 A;  1S0E A;  1HRI 2;  2EA7 A;  3POJ A;  5FRE A;  5JUV A;  1HJF A;  2R06 2;  1WGP A;  1EAH 1;  2NZ9 A;  2W1U A;  4WM8 C;  1KRI A;  2BP6 A;  4CDW A;  4E2G A;  3OGV A;  4L99 A;  4AEK A;  4MGQ A;  2WT0 A;  1MR5 A;  4YVS A;  1G9F A;  1IKQ A;  5FPX A;  1GKB A;  3U75 A;  3S30 A;  4HN1 A;  4XUT A;  4IV3 B;  2RDS A;  2B9V A;  5FLJ A;  3CQO A;  3BOP A;  5I0U A;  3S6P A;  5KHH A;  5C4W B;  1QJF A;  4JGZ B;  3C7F A;  1PVC 3;  4BLI A;  1OMI A;  5IK8 A; 
#chains in the Genus database with same CATH homology
 5L9B A;  3GZE A;  3MGU A;  4MHU A;  4XAB A;  5DAW A;  4NHK A;  5EP9 A;  3NNJ A;  5LAT A;  2FCV A;  4Y5T A;  3W21 A;  2JIG A;  2Y33 A;  4NHL A;  5LBC A;  5IAV A;  4Q5O A;  2FCU A;  3NNL A;  3OBZ A;  2HBU A;  4NHY A;  5C5T A;  3HQR A;  4NHX A;  5EPA A;  2JIJ A;  4MHR A;  5EQU A;  2OPW A;  5DAP A;  4NHM A;  3KT1 A;  5LAS A;  2G19 A;  5LB6 A;  4IW3 A;  5C5U A;  5L9V A;  4UWD A;  3GJA A;  4NMI A;  5LA9 A;  3PL0 A;  3GJB A;  3NNF A;  2HBT A;  2RDR A;  4NAO A;  3BVC A;  3OUI A;  2G1M A;  2RG4 A;  3ITQ A;  4XC9 A;  3OUH A;  2A1X A;  5ERL A;  4BQY A;  4XCA A;  3EMR A;  4BQX A;  2Y34 A;  4XCB A;  5DAV A;  4ZPI A;  3NNM A;  4KBZ A;  5LBB A;  5HV0 A;  2FCT A;  5M0T A;  3HQU A;  3KT4 A;  5LBF A;  4BQW A;  4Y5S A;  4XAC A;  2V4A A;  5L9R A;  4J25 A;  3W20 A;  3KT7 A;  5IAX A;  3OUJ A;  4JZR A;  2RDQ A;  2RDS A;  3DKQ A;  5LBE A;  4ZON A;  5HV4 A;  4XAA A;  5DAX A;  2RDN A;  5DAQ A;  5A3U A;  5IAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...