3OUIA

Phd2-r717 with 40787422
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
190
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 190
sequence length 204
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouiA00
4XABA 5DAQA 5DAWA 4NHMA 3DKQA 4XC9A 4Y5TA 5DAVA 3OUJA 5LBFA 4BQXA 4XAAA 2V4AA 5EPAA 3OUHA 3NNLA 2RG4A 5L9BA 4XCBA 5IATA 4ZONA 2OPWA 5C5UA 5IAXA 5L9VA 4XACA 5LA9A 2FCVA 4J25A 4BQWA 2RDRA 4NHYA 3NNJA 2HBUA 5DAXA 2RDQA 3GZEA 5ERLA 2Y34A 4UWDA 4BQYA 4NHLA 3GJBA 3GJAA 5A3UA 2JIGA 2FCUA 3W21A 5M0TA 4NAOA 2G19A 4NHKA 5LBCA 3MGUA 3KT1A 5LASA 4MHRA 3W20A 5DAPA 3OBZA 5LBEA 2RDNA 2HBTA 2A1XA 5C5TA 3BVCA 2FCTA 3EMRA 2RDSA 5LATA 4Q5OA 4ZPIA 5HV4A 4IW3A 2JIJA 2G1MA 3ITQA 2Y33A 3HQRA 5HV0A 3KT7A 5LBBA 5EP9A 3HQUA 4JZRA 4NHXA 3OUIA 3PL0A 3NNFA 4Y5SA 4KBZA 4MHUA 5EQUA 3KT4A 5LB6A 3NNMA 4XCAA 5IAVA 5L9RA 4NMIA
chains in the Genus database with same CATH superfamily
5A33B 1E5HA 4XABA 2QFEA 3TNQA 5DAWA 4R52A 1Q8SA 2BQPA 3KS7A 5ANQA 2B45X 3M3EA 1OUSA 4JVAA 4OHZA 2VTFA 1UF2C 1ST8A 1X8EA 1VBA3 3ELNA 4LIUA 3GZUC 1YNAA 3LB9A 4FPCA 4LMFA 4DO0A 3MIBA 3ZYIB 2JICA 3C7OA 3O7OA 1RUG3 5FZMA 1J59A 4CP0A 3PJYA 1W8WA 4ZY9A 3S30A 2P2KA 5LEKA 2IC1A 1N1TA 3H42B 1RVF2 3OJBA 4D7YA 4IESA 3VB9A 2FCVA 3OGGA 4BMEA 4IE0A 4KWLA 3POBA 3I8TA 2GMMA 1LHVA 1W9YA 1J83A 2CGPA 1HRV1 4HSLA 3ZXDA 5FZ4A 1ODMA 2WZR1 5FZDA 3PU8A 5BNOA 4F83A 3SKJE 2DFCA 1G9CA 1OFSA 1RUG2 2HWD3 4UWDA 5FWEA 5BNNB 4R9CA 4PIYA 4MX3A 2PYTA 2E53A 2BEOA 2VZUA 2ZZQA 2BZDA 2WA3A 1YI7A 3PTRB 1W3XA 3I3QA 5B4NA 1RUC1 1CVNA 3PMEA 4O7XA 5C8WA 4BIFA 3N9OA 5F5QA 4K6BA 3OY8A 4UF0A 1WW5A 3KT1A 2IVIB 5FZ9A 4XFIA 1LCLA 2BWAA 3A0KA 3JXSA 3U14A 4XJUA 2ZX0A 1LU2A 2RV9A 4OZOA 3OBZA 1AVBA 4IEQA 4IV3B 3NAPC 4WM8A 1XE7A 4Q4W2 2LW8A 4Q26A 3RJRA 2HWD2 4XAEA 2WQ8A 2B8MA 1FPN3 5C5TA 5T5LA 2B9UA 1SMVA 2RJLA 1VRBA 1ASJ2 1RUI1 1KDKA 1ZZ7A 3ZXLA 2LM3A 2R071 3O1TA 3WHTA 4P9WA 2BFUS 5C3QA 1ENRA 1NA1A 2DVFA 3HOBA 4YVWA 2ARCA 2LS6A 2ZGMA 1WA6X 4O61A 1UN1A 1ND3C 2D6NA 4XMAA 5FY4A 5CG8A 1UZ0A 2ATFA 3HQRA 2BGCA 3HWJA 4AEMA 3SNMA 1A8MA 4HFSA 1R092 4DY5A 2W0XA 3K3NA 1B35B 1ZX5A 4A6SA 3M1HA 4DUWA 3B94A 1NXD1 2ORXA 3BPSA 1BBT3 2VBPA 3O12A 1TNRA 4JQTA 5BPXA 5C3OA 1LEMA 1JHJA 1Z7S3 2VOKA 4A3ZA 2IXKA 4OQ9A 4BH9A 5LB6A 4BPZA 4XIOA 3LD8A 4LBQD 5J48A 2W2IA 3H8OA 3W5MA 2IFWA 5D1IA 4R9DA 5L7OC 2HWE1 1NA1C 3E1F1 4P9LA 3ZFGB 4B4PA 4Y20A 3VBSB 2GNBA 1UZZA 2JDNA 4CDQB 4QGMA 4HL0A 2JD9A 1MZ5A 1CR7A 5JOWA 2JG9A 4OMDA 1UY4A 4GMP1 4LTAA 1NXMA 4P5HA 4YW1A 1IS6A 5C8CB 2JDYA 5IWFA 3UT0A 5CFDB 3CJIB 4L0PA 2P4EA 4Q0UA 5H9SA 4P14A 2GN7A 4LOSA 1I1EA 5K4LA 1DGRA 2V4AA 3AMQA 1RUJ3 5FBZA 3C7EA 4XJWA 5A1AA 2OIIA 1XNDA 2WDBA 4XUPA 4YZ2A 4E2QA 1HQNA 4N9HA 2R0HA 5ACA3 3KVBA 2NLRA 2WLPA 1S0FA 1OQDA 2EVXA 5A1FA 5GKAC 3IIAA 3POFA 1APNA 4PLMA 4YGEA 2J1EA 3KGZA 4DINB 1CAXB 2WN2A 4HSJA 5JOXA 1XJAA 1PVC3 4AHWA 3N4MA 2XLAA 4D3WA 1GZCA 4K1ZA 1BEV1 3K2OA 3K4AA 4BQWA 3DPRB 1U0AA 1W8ZA 3C7HA 3ZPOA 1RUF2 3RZHA 1FXZA 1TMF2 3J8F3 1BCXA 3LDKA 3N9QA 4I30A 4MYEA 4UW3A 3M2MA 4MUVA 1JU3A 2J1VA 2ZMLA 4Q4Y2 1Y9QA 1OUXA 1AR83 2D5FA 3THTA 5ISLA 5LK7B 1AJKA 5K7PA 1R1A1 4BQYA 2PHWA 2JG8B 3DV8A 1QJU1 4I3PA 3PUSA 4AK3A 4ASLA 5JMOA 4N53A 3J9SA 2FCUA 5F6KA 5FIXA 1AYN1 3WDYA 2CWMA 3AXEA 1LOBA 1Q8VA 2YB7A 4PQQA 5A32A 5FWJA 3FHIB 3BI3A 4LBMA 3ZFEA 1RGSA 3ACLA 3NSTA 3USUB 4QPGC 1REEA 2RMU2 1O59A 1PGW1 3AK0A 4HBNA 4Y1UA 1SBFA 4YW6A 3TNPB 3N36A 4AI1A 1UMHA 4K1YA 1AJOA 4XBNA 2WT0A 4PCRA 5I8SA 2XUMA 4JRAA 3HT2A 4URTA 1JN2P 2NZ9A 4IE6A 3H3ZA 5IVJA 1AR82 5GLUA 1V6MA 4EYUA 4P9YA 3VZJA 4BIOA 2G9GA 3U78A 1ULPA 1JU4A 1UXZA 2W68A 3JUUA 4JGYA 4N7IA 3LSDA 1F5FA 4MXWB 1SEFA 5DMYA 2BV4A 2D93A 4W6YA 3ATGA 4KH9A 3ITQA 1W8UA 4XETA 1QIQA 4QQOA 3CZJA 1OVPA 4RQPB 1RHI3 4CYDA 5DN2A 5CFCB 4DZGA 1ULGA 1POV1 4QD2A 1TME2 4MSVA 4FOQA 3NNFA 4Y5SA 5AVPA 2VO5A 4NRPA 3BALA 2AR6A 4ONUA 1LR5A 5LWBA 4RGGA 4CU7A 1FAYA 2V4VA 3N9MA 1W9SA 1VB4A 3CIHA 3GM8A 5TSWA 2F6BA 1UY0A 3LDRA 2VZSA 1F4AA 5FDBA 3THDA 5DUWA 3POGA 2VMCA 4ES9A 5FMOS 5FUPA 2VCAA 3SCGA 5L9RA 1G8WA 1RHI2 2GDFA 3VV1A 5CA6A 4RHV1 5FYBA 2D6KA 4CUCA 1QJY2 4LKFA 1Q8QA 2TUNA 1RMU3 1ZZ8A 2D6PA 3RYKA 4GAZA 3GCWA 5FOBB 4UI9L 5BNPB 1VLNA 1RVF1 2PA7A 3QH7A 5GALA 2EIBA 4BU2A 1YFXA 3MW4A 2Q8DA 2B42B 5DZEA 4PDWA 3INAA 2YBSA 3HQXA 3NRUA 1LECA 1W39A 1VBD3 2MHFA 3OBAA 4GWNA 1O8PA 4YVSA 5C7GA 2OW4A 3LA2A 3K75B 1WD3A 5L9BA 4ZU7A 1US2A 1MS4A 3AZZA 3I3DA 3ALQA 1EPWA 4Y1VA 2DCKA 4SBVA 3CL1A 4JKKA 1RMU2 3MDPA 1UX7A 3ZYPA 4I0BA 4D7TA 2VC9A 4XILA 2Q8CA 4YYOA 4HOOA 4XACA 4BXSV 2DYCA 3JU9A 2YC4A 2XVLA 4ZU4A 4GMP0 1DG6A 3I2FA 5F2SA 5LZ6A 3D5OA 1OA2A 4Q4V3 4AEJA 3WQ0A 3BN6A 4E4HA 1NE4A 3CMGA 1L7QA 4H14A 4NE9A 1WGPA 3T1MA 1HKDA 3T2QA 4YARA 5A3LA 3MPBA 2A71A 2WZ8A 4XUNA 3KQRA 3ZN6B 1HX6A 2XMLA 4S2FA 3U11A 1P8JA 1SZBA 5FXWA 1D4M3 1OT5A 2N7GA 1JOBA 2BP6A 2OXBA 2G19A 4WVWA 5FXZA 5GLZA 4EWDA 4Y1ZA 1ASJ1 1O4TA 4ZZ5A 2KM2A 4N8MA 4X8PA 5JMCA 1X7NA 1NQJA 1KGYA 3K48A 5LASA 1JW6A 5DAPA 2VJXA 1MPXA 3GF6A 2GMPA 5CKQA 3IDAA 5CNAA 2ES3A 4UFMA 4CA9A 4MG2A 3TWIA 5A6YA 1MEC2 4EN6B 4AFDA 2XONA 2ZEXA 4LO6B 2Q1ZB 5C9AA 1JYIA 1Q56A 3LQCA 5DQ0A 3TB0A 4LO8A 4XBQA 4Y26A 3PJQA 1AR91 2NMNA 4Q5OA 1AXKA 1UZVA 1C3HA 1OOPA 1Q8OA 1K12A 4JHZA 4NPMA 2WS92 5FREA 3VDAA 2WJSA 3V0AB 2JENA 2ZACA 3MFAA 3KSCA 1PZ8A 2DCJA 3WNKA 3FUOA 2CY6A 3H8XA 2Y64A 3ORJA 4BISA 4D6SA 5AFEA 1GYKA 2RS12 1IKQA 2LALA 3B3QE 2Y60A 2VW1A 2XBO2 1U5XA 4AI2A 3I49A 1CAVB 2Q30A 3OGRA 3AMNA 4XCAA 3QOPA 3MPPG 4XFGA 1LHUA 1AX1A 2JDKA 2X53S 2XVGA 3CZUA 4AE2A 2KR2A 1V6KA 1RUD3 2BU9A 3DN7A 4CEYB 4JDOA 1H1MA 1MS3A 3I59B 4N43A 5FZ3A 1F31A 3VKMA 1QOSA 5FLHA 1ZRDA 2WSUA 3LIGA 2ZHNA 2PLV3 2CTVA 4TN7A 4EN9B 3UNPA 2QNKA 4N90A 1MS9A 3MUZ1 3AFKA 1GOFA 5A6XA 2JJ6A 3AP7A 1H9WA 3LEGA 1DGRN 4XAAA 3WG3A 1OHFA 5GZCA 1VRH2 1QF3A 3JD73 1W9TA 5A3TA 2OYZA 5A7WB 1GZWB 2WFF1 1RUF1 5E88A 1JUHA 1UCXA 1TMF1 2ZHKA 2JE7A 3MYXA 1V6JA 3ON7A 4WVMB 1K5MA 2R7EB 3ZXJA 4DRVA 2QKDA 5I0DA 2HWC3 1HRI3 3U07A 4Q4Y1 2BNNA 4XF1A 2P3JA 5H9PA 4XFHA 4GH4B 3ZOIA 1GKBA 4QPIC 5T54A 4AGGA 2VM9A 3A7QA 1RC6A 3B5LB 3QBQA 2WNVB 1VBB2 4GB31 3B93A 4XF3A 4YZ4A 3WW2A 5IVBA 3U4XA 2UY8A 5C5UA 3H8RA 3GBWA 2Y6FA 5AFBA 2PHXA 4IEVA 3P3NA 1V70A 2RDRA 1RINA 1S2KA 3PUAA 1QJEA 2E33A 2VZQA 3LZZA 5FP8A 4ORFA 4QPYA 1IG0A 2WWSA 4RR3C 3UETA 1LGCA 3MIGA 5LCWL 2UURA 1PNFA 1WBLA 1GMMA 1BYHA 3A22A 1XC6A 3H3LA 4KQ7A 2MEV2 1FMD1 1DYKA 1OKQA 4GKXA 4QXBA 1HRI2 2XUEA 3G7DA 1PO21 2W5FA 2ZXQA 4C0HA 2FBEA 5BY5A 3ZXEA 3N3HA 4LE4A 3PURA 2VD7A 1F9KA 1ND2A 3LGRA 3NJYA 4LJHA 4AI0A 4E2SA 5M0TA 3UL2A 2ZGKA 1OFNA 1CQ9A 2P34A 3WCSA 1CJPA 1MR5A 2FD8A 4LLOA 3VZMA 3VBUA 3NV3A 1GP6A 1REFA 4P9XA 1MQTB 4PT6A 5FCCA 2WC2A 2VMHA 2DCTA 2C9AA 2RS32 2XJPA 3M7AA 5FZ1A 2PAEA 2JB4A 5LBEA 4RSUA 2VNOA 1JYVA 4OYUA 1JZ8A 3A23A 1W8TA 2GC2A 1TME1 2EIGA 4XXPA 2XQRA 2WRAA 1X50A 4CCEA 1C57A 2JKXA 4CDXA 2W46A 2R6QA 2NYYA 1CIWA 4OQ8A 4M3CE 3UV9A 1XSQA 3T1LA 4EWAA 1V6IA 1A6CA 1HW5A 2ZS6B 4D0QA 5IVFA 3HVDA 2NMOA 3QD6A 2RS52 3IB3A 5CVRA 5H9QA 1A8DA 1JMUB 1HRV3 1S0JA 2D3SA 2PN5A 3FZ3A 4AEDB 4AZZA 5JPNB 1SLCA 1NCRB 1K3IA 2D6OX 1QJY1 4EN8B 4DXTA 3UKVA 2WO7A 4OI0A 2HH9A 4L9BA 4CPBD 2E7TA 3WG1A 5FPBA 3KLSA 2W1WA 5KXCA 2V72A 3ZIWA 4YG6A 1US3A 2YFUA 2WINB 2YMZA 2GP5A 4KU7A 5KXDA 4AVBA 1OF3A 4XUTA 3WP6A 5A7SA 3E5XA 5J7MA 3LCPA 3I3BA 1GICA 1EUUA 2QQNA 3RZGA 2VXRA 4NHMA 2HEVF 1UY1A 4UW4A 1W9FA 1OMIA 5LY2A 3RMXA 2ZOEB 5DAVA 3B7MA 5EJ3A 3VL8A 4GWJA 4IV1A 1YUDA 4S2HA 4FPKA 4M4PA 2Y6KA 4MV2A 4AF9A 2XJUA 4RFT0 3U75A 3D8CA 2R073 4OHXA 3ZR6A 2VTXA 2YDEA 2EXJA 5LA0A 1AZDA 2QDNA 4DPNA 1RITA 3ACIA 1PGSA 4LIVA 2HYXA 3WCRA 4F8AA 3SMHA 2OUHA 2XL7A 3UGHA 1RUE3 2ZX4A 4KG0A 3FBYA 2DVBA 1Q3EA 2JDHA 3S6PA 2YUEA 1S55A 5FPAA 4YZ1A 4FPEA 1G9FA 4GULA 4PI2A 3WQ7A 1IG3A 4SLIA 3VKNA 2VQ0A 5F1RA 3LAGA 3ZYRA 4FQZA 5FQ0A 1PGL1 1H6YA 3POJA 2ORZA 4INDA 4W50A 4HKOA 3FLPA 5DDJ3 4AQ2A 3TEZA 1AR72 2HWE3 5FZGA 4CEWA 3GZEA 4RGAA 4QHZA 1H4HA 3KZ4C 2A75A 4I3GA 2RM21 3NJZA 3SITA 3ZSLA 3R4DB 2ZZJA 4FBFA 1O8SA 2VUDA 4DEQA 3H1WA 3OBTA 2X5IC 3GZAA 3K3OA 3B01A 4GMP3 1OA3A 5BNOB 4BQ3A 5EIYB 1RUH1 3BOWA 4Q4X2 2EIDA 1GBGA 1C8M3 2BVVA 5FZEA 1IS4A 5LBCA 3QLQA 4X8NA 1U5IA 4HMZA 1WLDA 4LO5B 2FDIA 1TZOA 3AVRA 2EXHA 1PX3A 4L2NA 4OHVA 1MACA 1JHNA 4FPYA 4Q27A 1H6XA 1KJRA 1YJKA 5FPZA 5FLIA 5DDJ2 3ZKUA 4DUXA 1J3QA 2RDNA 3OY8B 4UF0B 2FDFA 1HQWA 3WZ1A 4XFBA 1QY4A 1FOD3 3OEAA 1WCUA 1XNAA 1YQ5A 2R1DA 2E31A 5D21A 3S5AA 2RS11 1L7LA 5A7QA 3VDCA 2Y0OA 5CIRA 3ZXKA 1ZRFA 2XBO1 4WM8B 4XJ8A 3WNOA 4ZPIA 2ZGQA 4XZPA 1WCDJ 4A4AA 3CKHA 3GHNA 2G1MA 3O1SA 2VMGA 1VAVA 3T09A 5A3NA 1SG3A 4UFKA 4UW6A 4E4ZA 1H8TA 4LEJA 1IZ3A 4IEPA 5EJZB 3SISA 5HXVA 5AC91 5HCAA 1W8HA 1ACCA 2ET7A 2ZHLA 1NA1B 4YVWB 5JDBA 3RSJA 1BLZA 3PL0A 2FDGA 5D8AA 1R1A3 4IGQA 1QJU3 1AR63 4ZS3A 1IPSA 2EA7A 4MHUA 3VBOC 3VBRC 1COV1 5EQUA 2WNOA 3HR9A 5DUUA 4MADA 4V2WA 4UOJA 3VDDA 3U4SA 4E2GA 1W3VA 3J7HA 1PM4A 3KGLA 1HB2A 1IGOA 2HEWF 2ZABA 4HZFA 4JGZA 4C8DA 5JSOA 3WY6A 3E5QA 4Z82A 1OI6A 3AKPA 3O0XA 4CCKA 4M01A 3ZYBA 3LPFA 4Q1RA 1SQ4A 3ZYJB 4AVAA 2BERA 2ZAAA 4GZ9A 1X9PA 5F5AA 1JOJA 2GN3A 3RZLA 1BMV1 3OBRA 4YM0A 4LPLA 2P3YA 3OF1A 2A3XA 4Q29A 1UYYA 3L2YA 4P08A 2XGXA 4NOTA 4QKBA 4Y20B 3T2OA 2C0ZA 1AR62 3ZMOA 1HXS2 2JG9B 1UL9A 1L7RA 5GM0A 5LK5A 2DU1A 5KHGA 5JR2A 3AL5A 2HLEA 2PHUA 5JXHA 2GMEA 3UGFA 1CPMA 1F2NA 2J1TA 2QDRA 3FHAA 5EJ1B 1N3QA 4FXGB 2ARAA 2MEV1 2B5HA 1KITA 4HPKA 2VL4A 1VE0A 3AX4A 4A7KA 4LULA 5L19A 5I8YA 1DGLA 4XQDA 4DFSA 2DUPA 3VKOA 3KQ4B 5L9VA 1ONAA 4FPGA 4XVHA 1ZBE2 2D3PA 4N9IA 3DYPA 3PHMA 1XQNA 5KC5A 2Q1MA 5FZHA 3RGBA 4CP2A 2TBVA 1YQ8A 3ZSEA 3RZMA 1C28A 4RS5C 4R9AA 3TN91 5JZGC 1H30A 1CAUA 1UYZA 2C26A 5E1RA 1JZ3A 2ZHMA 5ABJC 1S0DA 3ZR5A 3A4UA 3DYOA 4YW7A 3H0OA 1LODA 1R081 1N3PA 3M70A 4RHV3 5KHKA 5JIAA 2BFUL 4M0NA 3D3AA 3W9AA 3AKTA 1Y9MA 3NV4A 4NAOA 1YQ6A 3CEWA 3J7MA 4NHKA 1SDWA 2Q1FA 2VVEA 1TG7A 3H7JA 1V9U1 2Z42A 3GBFA 2V73A 4UBHA 3MBWA 4N53B 2W95A 3ILNA 4FSJA 3FWEA 5A32B 2XL9A 5K0UC 5I91A 1QNWA 1VBA2 2WT2A 3VBFC 3ZFEB 4NVPA 2XKPA 1Y4WA 2CYFA 1VBE3 1R64A 4LQRA 2W1QA 2D3RA 3UESA 1L3JA 3NAPA 4MOAA 3VL9A 1BQPA 4MGTA 2PELA 4MXVA 4D6RA 1NCQC 2Y6GA 3E6DA 5FBJA 3N9PA 3HD8B 2RDSA 1YIPA 2WN3A 4EWEA 4B1LA 2J7MA 5EYYA 3ZFFC 1OQEA 4JGYB 4MLOA 3FN9A 1GLHA 1ND3A 1HN1A 3NMBA 5EP9A 3GZTB 3G6JB 4QX5A 5EV7A 1SLLA 4IXLA 4BB3A 1IKPA 5I0SA 3RWNA 4BMBA 4AWDA 1ZZ9A 1C4RA 2GC1A 2W9XA 2C4XA 3MIHA 1QJX1 4FP2A 3O1OA 2VNRA 4XW3A 1LOFC 4AAPA 3EB7A 1NLQA 3VD9A 3PUHA 3RDIA 4IGPA 2BNOA 3GGLA 3VD5A 3AKQA 4RD7A 1GR3A 1O4ZA 4JKLA 4FFGA 3APBA 4CDUA 1NX9A 4WM7C 4B1MA 1OD5A 2LRPA 3ACHA 4YM3A 4WZCA 3WG4A 2QUOA 2YBPA 2VULA 1O6UA 1O3SA 4NMIA 5L7OA 1PK6C 4EJRA 2CU5A 1DLLA 3POWA 3WF0A 4BLIA 2EIEA 4D6QA 3DKQA 3MLJA 2R041 1WD4A 2IUWA 2Q8EA 3FX3A 4Y5TA 4MH0E 4DNYA 1NLRA 2FMDA 3R4UA 2A7AA 5F3IA 5HCBA 4GIQA 4CCLA 2PHLA 1LKNA 1VB2A 4Z1VA 3LIHA 5FY7A 5DPNA 1FPN2 3K46A 1AR93 4C1XA 4Q0QA 3HN3A 3VHNA 5FXVA 3ETPA 1BJQA 1UPIA 2W92A 4CDUC 1NE6A 1G9DA 3Q8FA 4Y33A 4PDWB 2WUHA 2WZEA 2AENA 4YW5A 2RJ2A 3NW4A 4PLNA 4YVSB 3LDBA 2YROA 3ACFA 1X9TA 1EP0A 1AYM1 3LA7A 1ZM1A 1QJZA 2WKKA 2Q8OA 2QCSB 4Q4X1 2ZKLA 4KNCA 4ATFA 2E7QA 4BQ1A 2WO1A 2DURA 1LOGA 5IVYA 3SCFA 4CVUA 5FZ6A 1BBT2 1S0CA 3KMHA 3H1YA 3NV1A 1SLTA 3O1UA 1Z7S2 2HWF1 3T0DA 2RR11 1LGNA 4QHBA 5FZKA 2G4IA 2ID4A 4QDSA 4QX8A 2PFWA 1XOYA 1GOGA 4BJ0A 2JDMA 2YYOA 5KHIA 3WNMA 1AL23 5LW9A 1UU6A 1PHMA 2GNMA 3GXUA 2YU1A 4QU1A 3RWKX 2OA2A 2YG0A 1C5IA 1UOFA 2A3WA 3RPQA 1XE8A 2A73B 3C3VA 3R05A 1UD1A 2XVKA 1EAH1 2ETEA 4QPGA 3HAGA 2YPDA 2WFF3 3VBHC 3I97A 1VMFA 3WDTA 3WHUA 3RQ0A 5A3PA 4ASKA 3IAQA 2W39A 1RUJ2 4LBJA 5JIUA 5A3OA 1AL22 1ZRRA 1ULCA 3AZVA 1DU3D 5A7OA 3T0BA 4JRLA 3HPNA 1MVEA 1ZBA1 1GV9A 4OLLA 3WQBA 5FMOL 4GB33 4OZXA 5ACA2 4LT5A 2ARXA 2VOWA 3MW3A 2HWB3 4E4DX 2D6MA 4FPOB 1PVC2 2Y33A 5ANNA 4AVVA 5C9AB 1WKYA 1OLME 1S4CA 2PHFA 3THPA 4FTBA 4PQ9A 3J26N 5LBBA 1VBC1 2HJIA 3OYWA 1PM7A 5FO7B 2IZWA 4NHXA 3J8F2 3OOXA 4QXHA 4MGKE 4TLGA 1W99A 1OOPB 2XWJB 4A44A 4XEZA 1PO23 2VY0A 2WNUB 3NKTA 5C33A 1JYNA 3QCWA 2GH2A 2CGNA 5HPOA 1DZQA 2WWUA 2LUWA 4M3CA 5FY1A 2V5YA 3PUIA 4ZXEA 5CYYA 1UXXX 4BM8A 1ENSA 1HXS1 4FOVA 2HWB2 2R063 4TSVA 1A34A 2ZGUA 5I8TA 4ET7A 5FMCA 3BU7A 4BCUA 1WW6A 3PU3A 4FFHA 5FYTA 5FYSA 4PIXA 3OGSA 5BV6A 2GALA 4LBQA 3UKNA 1OSGA 5CEHA 1DQ2A 1NAEA 4B8EA 1V6LA 3OUJA 4A2UA 3ZVXA 1IPJA 1I6XA 4N43B 4H7MA 2BOJA 4W6WA 4OULA 4HKWA 2ZMKA 4MGYE 2O8OA 3FLRA 4QX2A 4CRQA 1V0AA 1UW8A 2P37A 4CXYA 2OS2A 3JBG3 4H3WA 3NNLA 4HT1T 4C91A 4COYA 5FMBA 4RYDA 5APAA 2PQQA 3TAYA 1HDKA 5IATA 2NP0A 4IL7A 1QMJA 3WF1A 3IWZA 1K5MB 3IDEA 5F3GA 4A45A 1JTZX 3LOBA 2QQWA 2UY9A 3WVJA 1S1AA 4H55A 3RZJA 4AQSA 4IQPA 2Z79A 1PZ9A 3PUQA 2YBKA 3JB4C 3AYAA 1UMIA 4EQVA 4NHYA 1ODNA 3D82A 2PHRA 4QB1A 1PIV3 2VBDA 4CUGA 2ZEWA 2B9VA 2RHPA 1WMXA 1E5SA 5FZFA 4KI5M 5I0RA 1DGWX 4KMQA 1QXRA 1A78A 1LENA 4GXLA 3AP6A 3KD4A 4JTNA 3SH3A 1ZA7A 1N47A 1Y9GA 2XDVA 4LXLA 1ZZ6A 2DU0A 2NM1A 2ZGTA 1PO13 1GZTA 3BODA 4IUGA 1RUG1 2VCCA 4IV3C 2XLGA 2P17A 3DCQA 3VHPA 3GBGA 2NQYA 1YEWA 3IZOA 4O65A 4FO9A 5F9TA 1ND2B 3IAPA 2AH2A 4B7EA 1S0GA 4NRQA 3VBUB 2DCZA 1VBD2 2DVGA 2OQ6A 3AVSA 3M8LA 4XYXA 2VAUA 1CZTA 3KV5A 1SPPA 1S0EA 5J96B 2VZTA 3I54A 3POYA 4GWIA 2A1XA 1WUVA 2Y26A 1MS5A 4IERA 3LEKA 3N7MA 2R49A 2NPIA 1B35C 1DYPA 2WIIB 3WV6A 4Q4W1 1DYOA 1NUKA 1XU2A 5HV4A 2HWD1 3OD4A 2W87A 5F8PA 4YFZA 3ZMNA 2JDPA 3URFA 3OGVA 1UMZA 4CDXB 1UIJA 2YFZA 4L97A 5FO9B 3H8UA 4Q0VA 3HQUA 1RTVA 4OI2A 3T30A 1KDMA 4BXFA 3V0BA 4AVTA 3V64A 4BWOA 4BE3A 5KC6A 4Q4V2 1EV13 3NV2A 2A6WA 1W8OA 2OX0A 1W90A 4ARXA 2EXIA 4CDQC 3ZFGC 4NJ4A 1R091 1JI6A 2BVBA 3VBSC 3LFIA 1RYYA 1D7PM 4Z07A 2WA4A 1Q43A 3RZZA 3T2TA 3WOGA 4OVEA 4HLTA 5A6ZA 1OBNA 2QJVA 1MZ6A 3IN9A 5C8CC 1S0BA 5LRRA 4Y24A 3M3IA 1D4M2 1F15A 5CFDC 3CJIC 4DXZA 1FPN1 1PX4A 2AUYA 4I02A 4IETA 1XNKA 5IYYA 5EXOA 4ARYA 4QQHA 1D0HA 1VP6A 4LORA 2JE9A 3MUY1 2VE1A 3VZKA 4QDQA 4ISRA 4QKDA 2Y38A 1QQP3 2H6CA 2QQPA 2O14A 4YW2A 3CJXA 2UU8A 5LA2A 5CZKA 2IXJA 3LEMA 3AYDA 2SBAA 5FV3A 5IK5A 1SLBA 4OUEA 3RVHA 1SFPA 1BBT1 5DZGA 3ZYFA 5EPAA 5GLWA 4JQRA 4LKEA 3NWKA 1FX5A 1Z7S1 2QQOA 4IV1B 1Q8PA 2RJKA 1WWYA 3DPRC 1U12A 3T3YA 2CGOA 3AC0A 2OKXA 5IK7A 2F17A 3RJ2X 5AC93 1GUIA 2QQMA 4QPIA 5FPLA 4META 3O1PA 1QQP2 3DGTA 2ZGNA 1VMHA 2VOVA 5LA9A 4GQ7A 1DFQA 2VQTA 1W9WA 2JG8C 5F37A 1QKQA 3VD7A 4LBLA 3Q8BA 3ZXFA 1SACA 1UYPA 3SEPA 1QNYA 1RIRA 1BXHA 4K8RB 3JQWA 5FYYA 4C90A 3MW2A 1CONA 1E57A 1K42A 4RR3A 5FZ8A 1GZ9A 1POV0 5IFPA 3J4UH 3VDBA 2GP3A 4I09A 3L2HA 5FQ0B 4OI1A 5ERLA 1BKZA 4TYSA 4YSFA 3N7JA 4HN0A 1RUD2 4FTSA 1YIFA 1HB1A 2O1QA 4YWAA 3O1RA 4PIZA 4Q2FA 3PVNA 5F39A 1O3TA 5JCTA 1I5ZA 2VOXA 4CEWB 5ACA1 2YY1A 5IT6A 3PVOA 3S57A 5CADA 2X8KA 1NQDA 4X6RB 2PLV2 1YCIA 2VUCA 5FYCA 3WUCA 1OXCA 4XOGA 1KFUL 1UZYA 2J22A 1PVC1 4BLJA 5F5IA 3CBNA 3JD72 1W6OA 1NY72 5A7PA 5JAXA 2RMU1 4DUVA 3DF0A 2DTWA 2IXLA 2BUKA 2W1UA 4RQPC 2W47A 3DECA 5DG2A 2HWC2 5CFCC 2ZAHA 3ACGA 3V65A 4LO4B 2XLFA 5A3WA 1ENQA 4DS0A 5IK4A 1AR81 1STMA 2FCTA 1DCSA 2R1BA 2YZ4A 4IEUA 4KL1A 5LRSA 3AP4A 3OCPA 1YQ2A 3AJZA 1YFUA 3ZSJA 5C3SA 5F2WA 3AMHA 4XFCA 4ZU5A 4AGVA 4Z8BA 1N1YA 5DG1A 5KWRA 1PVXA 2FQPA 1GWKA 3WNNA 2R16A 1WLTA 5FY8A 3RS6A 2Q4SA 3TN93 4R4ZA 4AGRA 1GP4A 1NT0A 2ZX2A 2AREA 5T5JA 2C6SA 3NJVA 1OKOA 4PJYA 3ZN4A 2FDHA 1R083 1H8TB 1OLRA 4G4FA 3OD0A 4FOYA 4X6QB 4UW5A 3FUQA 4AI9A 4LHKA 4I0WB 4MGIE 2QZ3A 1JXNA 4YZ5A 4EE2A 4FPHA 5G04L 3KV4A 1JYWA 5JVVA 1SLIA 5D8AB 2VG9A 4OUSA 4Q0PA 1Z0HA 5BNPC 1RB8G 4YG3A 4YW4A 1W2NA 4XF0A 4YW3A 5C70A 4Q8KA 2VR4A 3B69A 3R4SA 3VDDB 4B7KA 5AC92 3TEYA 1BVP1 5DAQA 1JYCA 4JGZB 5F5CA 3I2GA 2MNGA 4XTMA 3ZYHA 4Q8LA 5F3CA 3GHMA 1RJ7A 4XC9A 2ILMA 2WZR3 1RHI1 4BDVB 1WZXA 3KB5A 1U5YA 4OUMA 2IXHA 3S7IA 5IVEA 5DABA 2PHTA 3BYWA 1OPOA 3MEPA 4V2VA 4YRDA 4CTEA 1ALYA 3M3CA 4PHZA 3WSOA 2AEYA 5E89A 1UQXA 4PLOA 3ME2A 3MO4A 3POEA 4I0AA 1QWRA 4K21A 1I5PA 2AYHA 2RG4A 1KS4A 2Y6LA 1RUC3 3CQOA 3TBDA 3OSDA 4IE7A 1VALA 4LNVA 3WW4A 1DQ1A 4CUAA 3D0SA 3P6BA 2WO2A 3JQXA 1J1TA 2K46A 3A0NA 3JCIA 1RUNA 1HRV2 4C1WA 1QJX3 1CJDA 4NUBA 3M3OA 4HPKB 1M4WA 2RE9A 1CZVA 1ULOA 3S0MA 2D40A 3MF9A 2ZX1A 4CU8A 1RMU1 5FZLA 1DQ4A 1Q5OA 1JZ4A 2JE8A 4XMIA 2PAKA 1YXWA 1RUI3 2CHHA 3ZKYA 2L9LA 4QQ2A 4UFLA 3O1VA 2RDQA 4UAPA 3B00A 4YM1A 2KD7A 2GNTA 1LB2A 3RMYA 1K5JA 1UOJA 1VBD1 1KD7A 2WAAA 2FZ2A 4AL9A 1CAUB 1E5IA 4U36A 1IQDC 2X5IA 2CL2A 3UKTA 4COVA 5FZBA 4QGLA 1IOAA 1JS9A 4NIGA 3GYDA 5FKBA 3HNYM 2E26A 3HN1A 4BQ2A 4COUA 3TEXA 4JDMA 4MHRA 2WLQA 4XHXA 1UZWA 4J6GA 2I45A 4W6XA 2JDZA 4DQAA 5KBFA 1CGPA 3F95A 3C2UA 3HIFA 1YWKA 2R072 3BKZA 2D44A 2YV8A 4B4QA 2XJSA 3HT1A 4OI4A 1W8FA 1BHGA 1N3OA 4K3UA 5EZWA 2DCYA 3SKVA 3BVCA 5FYVA 1AYM3 1RUE2 4L99A 3EMRA 3DXUA 4XQ4A 4DY3A 1DQ0A 1DZRA 1O5UA 2K0GA 1MEC1 3AKRA 4OHWA 5GZFA 2IXCA 3NAPB 1LAJA 2VZ3A 4HK9A 3FFZA 1TVGA 3I2DA 5FZOA 4AI8A 2ZGRA 2BDRA 3AJYA 4I2OA 1C1FA 1E5RA 1ZA4A 2PHDA 3IPVA 3WUDA 4KU8A 2HWF3 1AHSA 3QACA 5C71A 4QB2A 3O0VA 4BQ5A 4XXAA 3T4HB 2VW0A 3ETQA 1XYOA 4FP3A 5FZ0A 2WS91 4RN5A 2JD4A 1ND3B 4CEYC 3IDCB 2C1FA 2I74A 2HWE2 3WF3A 1FNYA 4FXKB 4IEXA 4QX1A 5JUVA 3VBOA 1WMFA 3VBRA 4O9GA 2VNGA 5A1LA 3NNMA 5JOZA 1IPKA 1QDCA 1W04A 1OLMA 3AYCA 2DBIA 4EN0A 3E97A 1LHNA 1C8M2 1EAH3 4IDZA 4A6OA 1BEV3 3W59A 4AHZA 4CPBA 4JX0A 3WF4A 1UAIA 5KR7A 2JKBA 1WLCA 5JLVA 4CDUB 4LK7A 4W65A 3D0JA 1DZTA 4S2DA 2ZBJA 2BGOA 2CSGA 4UFHA 4LK6A 4Y1YA 2QE3A 4ATEA 5L7OB 2X09A 1KJLA 4GH4C 1ZBA3 3OG2A 1NLSA 3TEWA 1XB9A 5C3PA 1FOD2 2B7YA 4RFRB 2WNVC 1WCQA 4QX7A 4E8CA 5IVCA 1S2BA 2W52A 1YQCA 1AYN3 2WNEA 5A70A 3WEZA 2BGPA 2ZTNA 4ZHNA 2CDOA 5IVVA 1XYPA 2DWRA 1VRH1 2EAAA 1NZIA 4BK4A 1W2TA 4LO7A 5IHRA 1VBC3 5AVAA 3JB8A 4CU9A 1JH5A 2QQVA 3BIEA 4CDWA 3M3QA 4LA3A 4UFIA 5FYUA 1W8NA 4G9SB 4NIDA 1C1LA 2XKOA 1RXFA 2G9ZA 4J25A 1W6QA 1W6NA 5FP9A 5FPVA 3VKLA 1D2QA 1W6PA 2GC0A 5CKMA 4AVCA 2WZPP 2VOTA 4CCDA 1YFWA 4YLZA 4A42A 2R30A 1LHWA 1O4YA 1R1A2 1VBB1 2K2SA 1QJU2 2C24A 3B9IA 1SFYA 3NNJA 4OFGA 4QQLA 2EAKA 3T08A 1DF0A 2ZGSA 2YHJA 4RS5A 4XBLA 4FT8A 4Y4YA 5JZGA 3HJRA 2QVSB 2VQUA 3K51A 1D0GA 1HB4A 2KXLA 1KXGA 2PAMA 4BHPA 1ZREA 4M3CF 3P5BA 2FHRA 3N9LA 5ABJA 1WW7A 1MQTC 5E8AA 3OGJA 2CAUA 4QHOA 3KWVA 3IMNA 1FV2A 2JWPA 3O0WA 1MVQA 2OUJA 4AEDA 4FVVA 3ABZA 4GD4A 4CDWC 1JYTA 1ZZCA 1W0OA 1HRI1 4CSWA 4XZUG 1SBDA 3KCXA 1POV3 1XPWA 3BTAA 1TE1B 4IEZA 2VXJA 4XURA 4YG0A 4TZDA 2Q0AA 2C9KA 3BUCA 5L36A 1K45A 1I3HA 1F35A 3TOJA 4EZ4A 3W20A 4ZXKA 2Q5TA 5K0UA 1UIKA 1UU4A 4WV8A 3SHRA 4CP9A 3VBFA 3HMYA 1JOPA 2YPJA 2WAOA 4QPGB 2EALA 1DLCA 2ZKNA 4JC1A 2RS31 3UJQA 4IEOA 4KG8A 3DL3A 1X82A 1UOGA 1URXA 2BNMA 1NCQA 2YU2A 4AEDC 4BA6A 4ZZ8A 2A3YA 1HIXA 1NCRC 1T2XA 2E51A 5C4WA 4CCMA 4CXXA 3BTYA 2PXJA 1YHFA 4E8DA 4C0BA 1H4GA 3WINE 2XQXA 5FP7A 1RVF3 4QT6A 3ZFFA 2WBKA 3AZXA 4Y4RA 5HV0A 5F7UA 3BIWE 4Y5Z0 4QU2A 5F3EA 4AVSA 1XBFA 1QH7A 3HNBM 3KHCA 1VMJA 3FC0A 5JSPA 2O0OA 2RS51 1UKGA 1FT9A 4K8FA 1O91A 1EY2A 1O3RA 3OYWB 2ZJCA 1LOFA 1N1SA 2ZPXA 4XUQA 1YLLA 1ZRCA 1J3PA 2OZ6A 4RHV2 3R6SA 3SCHA 2JEMA 3D4KA 4D94A 1UPSA 1UU5A 1R1ZA 4AHXA 4KGQA 5C4WC 3BTXA 4QM8A 4FOWA 1V6NA 2IXIA 1ULEA 4WM7A 4M3CB 3LSEA 4NIHA 3W58A 5J98B 1REDA 2OPKA 1WBFA 1PK6A 2E63A 2YC0A 2O8QA 3Q8CA 3T4VA 4HANA 3RYRA 4EV0A 2W3JA 5T55A 5EHDA 3FJSA 3QH6A 1QOOA 1SFNA 3WNXA 3WW3A 1LESA 3I2OA 2BYVE 2HKXA 4HK8A 1W2UA 4MZUA 1VBE2 4LBNA 4NR1A 4QM9A 4BQXA 4Z2WA 3N7LA 1W2OA 1YI9A 2Y0IA 4LBQB 4KBBA 4TXWA 4NO4A 3WX5A 1LGBA 4Q4W3 1KQRA 1LOCA 5E6HA 4F3JA 4QB6A 4EZHA 1GFF2 5JXIA 3DXTA 1ASJ3 3D6EA 5FKCA 5J3UA 5JWPA 4FPLA 4R9BA 2D7FA 3LEIA 1CD3G 4E9KA 3AZWA 4R4XA 5HCHA 3F2ZA 3VUOA 1VAMA 1OLQA 1R093 2VCBA 1TNFA 5JXJA 2R32A 2VZRA 5KXEA 2DV9A 3RFRA 3IT8A 5BNOC 1CX1A 3ES4A 2XJVA 3EYPA 3OPTA 2UWAA 4Z2AA 1ZNPA 1JZ7A 3FHQA 4FCAA 3JZVA 3B02A 4GALA 3ZXGA 2VMDA 4FAGA 2Z5WA 4CCOA 2LTNA 3DUIA 3OB8A 1I9RA 3GJAA 3WG2A 3AMMA 2W91A 5FJHA 4AFBA 4CXWA 5CB7A 1ULFA 1AR71 2P1BA 1AX2A 1M06G 3MLLA 1QEXA 3MICA 3ZX7A 1W6MA 3MGUA 5FZIA 2YC2A 4AFMA 1RUE1 3ZPYA 2WO3A 4Z92B 1AF9A 1QXJA 1S2EA 2UYBA 1LEDA 4DXSA 1XSRA 3KF5A 4AAXA 4WM8C 3AYEA 4O9EA 1PMJX 4HONA 3CNAA 1HJFA 4YZ3A 5SV8A 4NIIA 3VBHA 3H50A 4AR2A 5HI0A 5BXXA 1O7FA 1AR92 5FLJA 3H7YA 4Y22A 4XHBA 3ES1A 4UYBA 2D6LX 4DMIA 1WMEA 5DDJ1 5J36A 3FL7A 3KV6A 4WVVA 5EFUA 4YVWC 5LATA 4WZFA 5A6QA 1GWMA 2GSYA 1SPPB 5A80A 1LHOA 2MPFA 5JSRA 3V56A 1JODA 3NNGA 3POSA 1EUTA 1C8M1 2ARBA 2Y8KA 3MIFA 1AL0G 2ERFA 4HG6B 4JZRA 5CISA 3LWCA 4LBKA 1SCSA 4CCCA 1RUF3 3MF6A 4P9IA 4UT5A 1TMF3 1CAWA 4RGKA 5FY5A 3SQOA 3ST7A 1LU1A 5KXBA 4AW7A 1T6BX 4D8MA 4QWNA 2XJRA 1G86A 1XNCA 3H1MA 4FPFA 4H7LA 4Q4Y3 1FNZA 3KT4A 1VPHA 4GKYA 4FAHA 3V0BB 4CP1A 5A33A 3C7FA 4L92A 4XTPA 1FOD1 1OQ1A 2DTYA 3RYPA 4ZKTB 1SDDB 2A70A 1V00A 3WDVA 4IE4A 1LULA 2JG9C 1SBEA 1LNSA 4D7SA 4YNIA 3AZYA 4FFFA 3WP4A 3FMGA 4LHLA 1DBNA 1JYXA 1ZYBA 4AG4A 2RMU3 2JECA 2CWSA 2WFF2 4QXKA 1QHDA 2YGMA 2XXZA 5I0TA 1OH4A 3R0RA 1FMD3 4TLFA 2BOIA 2VMIA 3OTFA 4HVOA 5A7NA 1H1IA 1BK0A 2ZA9A 5F6LB 2VVDA 2TNFA 2VU9A 3EO6A 2JDAA 3OUHA 4GB32 5FYIA 2WSVA 4QX0A 3WDWA 1AR61 1F5JA 1S0IA 2V5DA 4GJYA 2UWBA 4XCBA 3SH4A 4KWKA 1MZEA 5FYMA 3I3MA 3KM5A 4RL7A 3SH5A 4ZONA 1AX0A 5GZDA 5T50A 1BVVA 2A6ZA 3X29B 1PNGA 2GU9A 2OPWA 2VZVA 3UJOA 4DEVA 2ZEZA 4V1PA 2EF6A 2X29A 3GCXA 1CPNA 1V6OA 2PTMA 1FMD2 2VZOA 4XFAA 3ZIXA 4N7UA 3VD4A 3LE0A 3LKJA 3TYJA 3Q8EA 4QPIB 1PO22 1C8NA 2VH9A 2AC1A 1TME3 5EWSA 5BNNA 5JI9A 1GP5A 5FO8B 1MS1A 1YJLA 1ZBE1 2VPVA 5CG9A 1A3KA 5LA1A 2XWBB 4NAMA 2D43A 2R062 1PZ7A 2Y34A 5FK8A 3I2HA 4N53C 4NHLA 2B4KA 1J58A 4F7ZA 2E6VA 3IMMA 4RR3B 1ENXA 1J84A 2J1UA 3IKWA 4IEWA 3ZFEC 2WL1A 2YGLA 1DIWA 5DUXA 1J3RA 1FATA 1YFYA 3AB0A 4IV3A 4TWTA 1CX4A 1H2NA 2K9ZA 2DFBA 1QJY3 4CCJA 1G7YA 3KF3A 5DXDA 4JKMA 2QZ2A 3NVCA 5BNNC 5KHHA 1G6NA 4M00A 2IFRA 3BCWA 1WMDA 3NJXA 3I2KA 5FYHA 4YGDA 3E6CC 2HEYF 4HETA 2A6XA 4DRRA 1HQLA 4JGYC 1UYXA 3JBG2 2EXKA 1W06A 2ZMNA 1VBA1 2ZX3A 4R8HA 1W6OB 5I0UA 2H0VA 3KHBA 4AFAA 3LPGA 1B35A 2NN8A 3S7EA 2FZ1A 4LUKA 4XPVA 1H8VA 1XYNA 3U37A 2OQ7A 2ZGPA 3EHKA 4EROA 4M4RA 4XF4A 1W0PA 3WQ1A 3KT7A 3PMSA 3RRDA 4QX3A 1GANA 2VUJA 1UO9A 5FTTC 1H9PA 1QH6A 2WQ4A 1CZSA 1PIV2 2E9QA 3IM0A 2JXAA 1GU3A 4LHNA 2CDPA 2E7AA 2XHNA 3WLUA 4A41A 1X8MA 2Z69A 1TEIA 3ZFGA 4CDQA 5IK8A 3VBSA 3WT3A 3CU7A 5FPUA 3A21A 4OCTA 3T2PA 1VBE1 4ZS2A 1AXYA 3L9JT 1G9AA 1OC1A 3I3EA 2Z2SB 1PO12 4LUMA 3SEEA 4BQ4A 5C8CA 1CIYA 5CFDA 4ITCA 3CJIA 3ZN5A 3ZO0B 3U1XA 2QQJA 3DKWA 5CBLA 2DBNA 1JZ2A 5FR3A 3I2JA 4HVQA 1UKRA 4WBBA 3VZOA 2QQKA 1ULDA 3HNMA 3WNPA 4PDWC 3MIEA 1KFXL 4P00B 4QAWA 1MS8A 2RVAA 4YVSC 2RM23 4J1XA 4UXAA 5HCFA 1MEC3 2BRTA 3NL1A 4K20A 4DB5A 1CAXA 1RUH3 4TTGA 4P9JA 4YGCA 5LEJA 1VR3A 3O1MA 4P02B 3VZLA 3N7KA 1LTEA 1IHMA 3ILFA 4XDQA 1OF4A 3DPRA 4GA9A 4A3XA 3J7LA 1PGL2 1GNYA 2CAVA 1RJ8A 4LOTA 4AEKA 4QKNA 1JBCA 5FUNA 1HV1A 2WT1A 1J1LA 3ZXAC 2WABA 5JR7B 2WS93 3BB6A 4IGOA 4Q1PA 5FYZA 4URAA 4IEYA 1EV12 1HJGA 2KA3A 3RG0A 3WP5A 1KEXA 3CF6E 2RM22 4LKSA 2CV6A 2JG8A 3C7GA 4NN0A 2RS13 2TEPA 3CHXA 5IW0A 1RUH2 3ZM8A 1POQA 1W05A 1H0BA 2XBO3 4HXCA 4IE5A 1PMHX 1XXNA 1GOHA 4XFFA 3ZLIA 2FDJA 1CESA 2JB8A 4GJZA 3USUA 3ZSMA 3GJBA 3I4IA 3K4ZA 5E16A 3GNEA 5BYNA 2ENRA 2WR9A 3NQHA 1GNHA 5FP4A 1X33A 2WFPA 2WNUA 4FQ4A 4MO3M 3RI8A 3PTYA 3BTZA 2UWCA 4QDRA 2Z4FA 3VD3A 3EJKA 2VCMA 5T3NA 4AFCA 1XU1A 4XIKA 2C5DA 2X5IB 3RZKA 3OEBA 4FPJA 4JAAA 5H9RA 1UY2A 1COV3 4L8QA 2PQSA 2W1SA 1YYNA 4MXWA 2HBTA 3K77A 5CKNA 5C9AC 1N1VA 1VRH3 4HVRA 1HN0A 5J09A 2P6HA 1VJ2A 2XR4A 1CWPA 3NO8A 4RQPA 3VLBB 2VVFA 4NWWA 1H1AA 2QBXA 3I7DA 5T5PA 3RI9A 4Q0SA 4XUOA 3U10A 5CFCA 1RUJ1 2VQAA 2VZPA 2EICA 3AP5A 3OPWA 4H2AA 1AL21 4IW3A 3RNSA 1OOPC 1D2SA 2ET1A 4B4RA 3ECQA 2WNUC 3CLPA 1SLAA 5GZGA 1KRIA 4HKLA 4P9GA 1VBB3 4JCKA 3UK9A 1OURA 4ASMB 5IJRA 3W5NA 4FI9A 1RUOA 4QMAA 1COV2 1SCRA 1GQGA 3OUIA 4CUBA 4KBZA 5FZOB 2G9FA 1WW4A 3T0AA 4B3NA 3IPVB 2VECA 3P3PA 2HYKA 2OZJA 3AP9A 3J8F1 3FBMA 2E32A 2MEV3 3I2IA 4CCNA 1G9BA 2XJQA 3FLTA 5IFTA 1BMV2 4XDPA 2X05A 1QXPA 2VUAA 5FY9A 5BNPA 2ADDA 1GWLA 1LOAA 3USSA 2ZEYA 4N43C 3VHRA 4OHYA 3VBOB 2DUQA 3VBRB 4XJAA 1BK1A 3FE5A 4JHTA 4Y3OA 3FFQA 2HWB1 1IS3A 1XE0A 2IWGB 1ZVFA 2JDUA 4ISQA 4XE9A 5FRAA 1FV3A 3DYMA 4PI0A 1QGLA 3AFGA 1W2AX 4DOUA 1WA4A 5K8SA 2WWJA 1O5LA 2PMWB 4WVZA 3CO2A 3PIJA 4JV4A 2B46X 4CU6A 2RS33 5T5OA 1Z78A 4BOWA 5HBAA 1FI2A 2VMFA 3MIDA 1H2KA 1K5MC 3LOIA 4AOCA 1DHKB 1ZRIA 2ZGLA 3BPZA 4JTOA 3VZNA 3THCA 1DDLA 1ZZBA 3SXWA 1QU0A 3WF2A 4B29A 4PF5A 1RL3A 1V9U3 3P1IA 4M0HA 3VHOA 2R061 5C6CA 5EYXA 1UY3A 1TQ5A 5KHJA 4S2GA 4CE8A 2J1AA 5BUVA 1YO8A 3TN92 2V09A 5DZFA 3SC7X 3ZDVA 5K9YA 3MFCA 2RS53 4NPLA 4E4SA 3PDQA 1BZWA 4A7YA 3BGAA 4LITA 1XNBA 1XNTA 4XJZA 4CDWB 1FYUA 1DQ5A 1R082 1UX6A 3KV9A 3PVEA 3VGIA 3ZN6A 4COZA 5DAXA 2QTWB 1WLWA 2XPJA 2W08A 2DUOA 1W6NB 1NZCA 1W6QB 1EYBA 1KS5A 1W6PB 4QPWA 3E5UA 2Y6JA 3IBMA 3PVBB 5A3MA 1MS0A 2DVAA 2JX9A 1WCKA 5SV5A 3PLQA 1V9U2 1ND2C 3LFMA 5A3UA 1Y43B 3MZHA 4RS5B 3H3UA 2BBVA 2JIGA 3WW1A 5JZGB 3JBG1 1HLCA 4MVTA 4GWMA 1JUIA 5B4XA 3KCYA 2XB6C 3VBUC 2P5BA 3WDXA 3UYJA 5ABJB 4KGGA 4OMCA 2VNVA 2WZR2 2XH6A 3LF7A 2QQUA 2D98A 3GALA 3NKGA 3EQEA 2AZ5A 5FK7A 2QQIA 4BK5A 2DDUA 2B39A 3MHZA 3Q8AA 2XG3A 4LKDA 3ZSKA 4CDXC 1W03A 1PMIA 4P5YA 5FFOC 2BPA2 1PIV1 2CNAA 1RUC2 1GQPA 2GAUA 3V0AA 4QXCA 1GNZA 3PNAA 5K0UB 4NPRA 2AGSA 3IDBB 5FZCA 4CP9B 1JZ5A 1UWWA 3VBFB 2D97A 5FMDA 2GNDA 5C3RA 2JIJA 2GH8A 5B2GB 2R043 1YC61 5T52A 1U5ZA 3M4FA 3AL6A 1QJX2 1Y7BA 1RXGA 2F4LA 2I07B 3K4DA 2A6YA 1NCQB 1PO11 2VTXJ 3ZYGA 4NIAA 5L73A 5C4WB 4LLFA 2A5ZA 2J1SA 3KCCA 3AM2A 5FPXA 1CAVA 1OA4A 1B09A 1OVSA 5GLTA 5IUQA 4LA2A 2YXSA 2AACA 3E6BA 3AXDA 3ZFFB 4NWVA 1RUI2 4W4ZA 1IS5A 3WP3A 4EN7B 1C5HA 1VIWB 3VKFC 3U0ZA 1LJ7A 4CEYA 2P3IA 2UYAA 4COWA 5FJKA 1AR73 4Q4V1 3I59A 2GC3A 3Q9OA 5FP3A 2X10A 3O14A 2VZ1A 4AXOA 2R042 2D5HA 1UOBA 2BTVC 4CZSA 1T6GC 4Q4X3 4DIQA 3WNLA 5CAZA 2Y6HA 1F8VA 4UFJA 1DGWA 2WYFA 5J1XA 2I2SA 2FMYA 4FTEA 1D4M1 5A7WA 1GZWA 4L11A 2VMEA 1XRUA 1X36A 2RR13 3LA3A 4FFIA 4IV1C 4WM7B 1GSLA 4PF1A 4WVMA 2OT7A 5JI7A 5BNQA 1W28A 4MGQA 2OVUA 5LBFA 1PK6B 5FAXA 4GH4A 2BWCA 2P3KA 1EV11 3MI8A 5D2AA 3AKSA 5LY1A 2WNVA 1D4VB 4K7JA 4HN1A 4YFWA 5JPMB 1AYM2 5F32A 2WYSA 3IIIA 4BZ4A 3HBKA 5FZ7A 1W0NA 4E27A 3N35A 1QJFA 4MGSA 3WD5A 4QQPA 1HV0A 2BW8A 1JZ6A 2VBBA 4PBOA 5IAXA 2SLIA 2HWF2 4NRMA 2RR12 1DP0A 4MGZE 3EBRA 3B9CA 1VAKA 2ADEA 4XQWA 2P6CA 5FZAA 1QQP1 2HBUA 3MV11 4YM2A 1YRZA 4NROA 2A6VA 2XOMA 3WDUA 4CEWC 2J42A 2QQLA 3N9NA 3O5SA 5DUVA 1QDOA 1CN1A 5FOJB 2J1RA 4YGBA 1NG0A 3ROUA 1SHWB 2DVDA 1GQHA 5CU1A 5GZEA 5HXMA 2H6BA 1EAH2 1MQTA 4AQ6A 1BEV2 5I93A 2H0BA 1Y3TA 4LR4A 3W21A 3BU0A 2VW2A 2FDKA 4XF9A 4D69A 1OH3A 4J1WA 4A7ZA 2BJSA 1EPZA 4U2AA 3KVAA 4LHSA 1QOTA 1O3QA 5JXGA 1RUD1 3MLKA 2XHKA 1NKGA 3PIGA 1UNBA 2VGDA 4I01A 5GJ6A 4W8JA 2ZCWA 1ZBA2 4ES8A 1W6MB 3UGGA 1AUYA 2IVJA 2PLV1 1HXS3 3TRSB 3CDZB 1OPMA 3OPZA 3WR0A 3WXPA 4KWUA 4XDOA 2DF7A 1AYN2 3ENRA 4K40A 3HBZA 1HB3A 4XJ9A 4JDNA 4AQTA 2GZWA 4UBGA 3JD71 3VBHB 1NY71 1DQ6A 1VBC2 1PGW2 1IQAA 5FUIA 1OD3A 1WCSA 4Y22B 1NCRA 1LOEA 4LE3A 1H8TC 1H2MA 3BOPA 2HWC1 1F4HA 3AMPA 2WQZC 3ASIA 3J7NA 5FXXA 1LRHA 4RA0A 1ZBE3 3C8XA 2ZGOA 4QGNA 4DXRA 1NYWA 5D8AC 3S5QA 4YPJA 4AYUA 5J37A 2W94A 1NOVA 4PBPA 4QKFA 3DEMA 2LROA 2F4PA 3SLIA 5JOYA 2R0FA 3VDDC 3POIA 3EXUA 4JGZC 4AI3A 2BBAA 4K9SA 4KWJA 2AEZA 3ILRA 4LBOA 1CAWB 3GDBA 3MV01 5FY0A 5IAVA 3H9AA 4BYYA 4G3YC 1AXZA 4Y1XA 1H2LA 2XJTA 3HEIA 5GLVA 4AHYA 1MZFA 5G05L 3ZDSA 3VN4A
chains in the Genus database with same CATH topology
4XABA 5DAQA 5DAWA 4NHMA 3DKQA 4XC9A 4Y5TA 5DAVA 3OUJA 5LBFA 4BQXA 4XAAA 2V4AA 5EPAA 3OUHA 3NNLA 2RG4A 5L9BA 4XCBA 5IATA 4ZONA 2OPWA 5C5UA 5IAXA 5L9VA 4XACA 5LA9A 2FCVA 4J25A 4BQWA 2RDRA 4NHYA 3NNJA 2HBUA 5DAXA 2RDQA 3GZEA 5ERLA 2Y34A 4UWDA 4BQYA 4NHLA 3GJBA 3GJAA 5A3UA 2JIGA 2FCUA 3W21A 5M0TA 4NAOA 2G19A 4NHKA 5LBCA 3MGUA 3KT1A 5LASA 4MHRA 3W20A 5DAPA 3OBZA 5LBEA 2RDNA 2HBTA 2A1XA 5C5TA 3BVCA 2FCTA 3EMRA 2RDSA 5LATA 4Q5OA 4ZPIA 5HV4A 4IW3A 2JIJA 2G1MA 3ITQA 2Y33A 3HQRA 5HV0A 3KT7A 5LBBA 5EP9A 3HQUA 4JZRA 4NHXA 3OUIA 3PL0A 3NNFA 4Y5SA 4KBZA 4MHUA 5EQUA 3KT4A 5LB6A 3NNMA 4XCAA 5IAVA 5L9RA 4NMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAB A;  5DAQ A;  5DAW A;  4NHM A;  3DKQ A;  4XC9 A;  4Y5T A;  5DAV A;  3OUJ A;  5LBF A;  4BQX A;  4XAA A;  2V4A A;  5EPA A;  3OUH A;  3NNL A;  2RG4 A;  5L9B A;  4XCB A;  5IAT A;  4ZON A;  2OPW A;  5C5U A;  5IAX A;  5L9V A;  4XAC A;  5LA9 A;  2FCV A;  4J25 A;  4BQW A;  2RDR A;  4NHY A;  3NNJ A;  2HBU A;  5DAX A;  2RDQ A;  3GZE A;  5ERL A;  2Y34 A;  4UWD A;  4BQY A;  4NHL A;  3GJB A;  3GJA A;  5A3U A;  2JIG A;  2FCU A;  3W21 A;  5M0T A;  4NAO A;  2G19 A;  4NHK A;  5LBC A;  3MGU A;  3KT1 A;  5LAS A;  4MHR A;  3W20 A;  5DAP A;  3OBZ A;  5LBE A;  2RDN A;  2HBT A;  2A1X A;  5C5T A;  3BVC A;  2FCT A;  3EMR A;  2RDS A;  5LAT A;  4Q5O A;  4ZPI A;  5HV4 A;  4IW3 A;  2JIJ A;  2G1M A;  3ITQ A;  2Y33 A;  3HQR A;  5HV0 A;  3KT7 A;  5LBB A;  5EP9 A;  3HQU A;  4JZR A;  4NHX A;  3OUI A;  3PL0 A;  3NNF A;  4Y5S A;  4KBZ A;  4MHU A;  5EQU A;  3KT4 A;  5LB6 A;  3NNM A;  4XCA A;  5IAV A;  5L9R A;  4NMI A; 
#chains in the Genus database with same CATH topology
 5A33 B;  1E5H A;  4XAB A;  2QFE A;  3TNQ A;  5DAW A;  4R52 A;  1Q8S A;  2BQP A;  3KS7 A;  5ANQ A;  2B45 X;  3M3E A;  1OUS A;  4JVA A;  4OHZ A;  2VTF A;  1UF2 C;  1ST8 A;  1X8E A;  1VBA 3;  3ELN A;  4LIU A;  3GZU C;  1YNA A;  3LB9 A;  4FPC A;  4LMF A;  4DO0 A;  3MIB A;  3ZYI B;  2JIC A;  3C7O A;  3O7O A;  1RUG 3;  5FZM A;  1J59 A;  4CP0 A;  3PJY A;  1W8W A;  4ZY9 A;  3S30 A;  2P2K A;  5LEK A;  2IC1 A;  1N1T A;  3H42 B;  1RVF 2;  3OJB A;  4D7Y A;  4IES A;  3VB9 A;  2FCV A;  3OGG A;  4BME A;  4IE0 A;  4KWL A;  3POB A;  3I8T A;  2GMM A;  1LHV A;  1W9Y A;  1J83 A;  2CGP A;  1HRV 1;  4HSL A;  3ZXD A;  5FZ4 A;  1ODM A;  2WZR 1;  5FZD A;  3PU8 A;  5BNO A;  4F83 A;  3SKJ E;  2DFC A;  1G9C A;  1OFS A;  1RUG 2;  2HWD 3;  4UWD A;  5FWE A;  5BNN B;  4R9C A;  4PIY A;  4MX3 A;  2PYT A;  2E53 A;  2BEO A;  2VZU A;  2ZZQ A;  2BZD A;  2WA3 A;  1YI7 A;  3PTR B;  1W3X A;  3I3Q A;  5B4N A;  1RUC 1;  1CVN A;  3PME A;  4O7X A;  5C8W A;  4BIF A;  3N9O A;  5F5Q A;  4K6B A;  3OY8 A;  4UF0 A;  1WW5 A;  3KT1 A;  2IVI B;  5FZ9 A;  4XFI A;  1LCL A;  2BWA A;  3A0K A;  3JXS A;  3U14 A;  4XJU A;  2ZX0 A;  1LU2 A;  2RV9 A;  4OZO A;  3OBZ A;  1AVB A;  4IEQ A;  4IV3 B;  3NAP C;  4WM8 A;  1XE7 A;  4Q4W 2;  2LW8 A;  4Q26 A;  3RJR A;  2HWD 2;  4XAE A;  2WQ8 A;  2B8M A;  1FPN 3;  5C5T A;  5T5L A;  2B9U A;  1SMV A;  2RJL A;  1VRB A;  1ASJ 2;  1RUI 1;  1KDK A;  1ZZ7 A;  3ZXL A;  2LM3 A;  2R07 1;  3O1T A;  3WHT A;  4P9W A;  2BFU S;  5C3Q A;  1ENR A;  1NA1 A;  2DVF A;  3HOB A;  4YVW A;  2ARC A;  2LS6 A;  2ZGM A;  1WA6 X;  4O61 A;  1UN1 A;  1ND3 C;  2D6N A;  4XMA A;  5FY4 A;  5CG8 A;  1UZ0 A;  2ATF A;  3HQR A;  2BGC A;  3HWJ A;  4AEM A;  3SNM A;  1A8M A;  4HFS A;  1R09 2;  4DY5 A;  2W0X A;  3K3N A;  1B35 B;  1ZX5 A;  4A6S A;  3M1H A;  4DUW A;  3B94 A;  1NXD 1;  2ORX A;  3BPS A;  1BBT 3;  2VBP A;  3O12 A;  1TNR A;  4JQT A;  5BPX A;  5C3O A;  1LEM A;  1JHJ A;  1Z7S 3;  2VOK A;  4A3Z A;  2IXK A;  4OQ9 A;  4BH9 A;  5LB6 A;  4BPZ A;  4XIO A;  3LD8 A;  4LBQ D;  5J48 A;  2W2I A;  3H8O A;  3W5M A;  2IFW A;  5D1I A;  4R9D A;  5L7O C;  2HWE 1;  1NA1 C;  3E1F 1;  4P9L A;  3ZFG B;  4B4P A;  4Y20 A;  3VBS B;  2GNB A;  1UZZ A;  2JDN A;  4CDQ B;  4QGM A;  4HL0 A;  2JD9 A;  1MZ5 A;  1CR7 A;  5JOW A;  2JG9 A;  4OMD A;  1UY4 A;  4GMP 1;  4LTA A;  1NXM A;  4P5H A;  4YW1 A;  1IS6 A;  5C8C B;  2JDY A;  5IWF A;  3UT0 A;  5CFD B;  3CJI B;  4L0P A;  2P4E A;  4Q0U A;  5H9S A;  4P14 A;  2GN7 A;  4LOS A;  1I1E A;  5K4L A;  1DGR A;  2V4A A;  3AMQ A;  1RUJ 3;  5FBZ A;  3C7E A;  4XJW A;  5A1A A;  2OII A;  1XND A;  2WDB A;  4XUP A;  4YZ2 A;  4E2Q A;  1HQN A;  4N9H A;  2R0H A;  5ACA 3;  3KVB A;  2NLR A;  2WLP A;  1S0F A;  1OQD A;  2EVX A;  5A1F A;  5GKA C;  3IIA A;  3POF A;  1APN A;  4PLM A;  4YGE A;  2J1E A;  3KGZ A;  4DIN B;  1CAX B;  2WN2 A;  4HSJ A;  5JOX A;  1XJA A;  1PVC 3;  4AHW A;  3N4M A;  2XLA A;  4D3W A;  1GZC A;  4K1Z A;  1BEV 1;  3K2O A;  3K4A A;  4BQW A;  3DPR B;  1U0A A;  1W8Z A;  3C7H A;  3ZPO A;  1RUF 2;  3RZH A;  1FXZ A;  1TMF 2;  3J8F 3;  1BCX A;  3LDK A;  3N9Q A;  4I30 A;  4MYE A;  4UW3 A;  3M2M A;  4MUV A;  1JU3 A;  2J1V A;  2ZML A;  4Q4Y 2;  1Y9Q A;  1OUX A;  1AR8 3;  2D5F A;  3THT A;  5ISL A;  5LK7 B;  1AJK A;  5K7P A;  1R1A 1;  4BQY A;  2PHW A;  2JG8 B;  3DV8 A;  1QJU 1;  4I3P A;  3PUS A;  4AK3 A;  4ASL A;  5JMO A;  4N53 A;  3J9S A;  2FCU A;  5F6K A;  5FIX A;  1AYN 1;  3WDY A;  2CWM A;  3AXE A;  1LOB A;  1Q8V A;  2YB7 A;  4PQQ A;  5A32 A;  5FWJ A;  3FHI B;  3BI3 A;  4LBM A;  3ZFE A;  1RGS A;  3ACL A;  3NST A;  3USU B;  4QPG C;  1REE A;  2RMU 2;  1O59 A;  1PGW 1;  3AK0 A;  4HBN A;  4Y1U A;  1SBF A;  4YW6 A;  3TNP B;  3N36 A;  4AI1 A;  1UMH A;  4K1Y A;  1AJO A;  4XBN A;  2WT0 A;  4PCR A;  5I8S A;  2XUM A;  4JRA A;  3HT2 A;  4URT A;  1JN2 P;  2NZ9 A;  4IE6 A;  3H3Z A;  5IVJ A;  1AR8 2;  5GLU A;  1V6M A;  4EYU A;  4P9Y A;  3VZJ A;  4BIO A;  2G9G A;  3U78 A;  1ULP A;  1JU4 A;  1UXZ A;  2W68 A;  3JUU A;  4JGY A;  4N7I A;  3LSD A;  1F5F A;  4MXW B;  1SEF A;  5DMY A;  2BV4 A;  2D93 A;  4W6Y A;  3ATG A;  4KH9 A;  3ITQ A;  1W8U A;  4XET A;  1QIQ A;  4QQO A;  3CZJ A;  1OVP A;  4RQP B;  1RHI 3;  4CYD A;  5DN2 A;  5CFC B;  4DZG A;  1ULG A;  1POV 1;  4QD2 A;  1TME 2;  4MSV A;  4FOQ A;  3NNF A;  4Y5S A;  5AVP A;  2VO5 A;  4NRP A;  3BAL A;  2AR6 A;  4ONU A;  1LR5 A;  5LWB A;  4RGG A;  4CU7 A;  1FAY A;  2V4V A;  3N9M A;  1W9S A;  1VB4 A;  3CIH A;  3GM8 A;  5TSW A;  2F6B A;  1UY0 A;  3LDR A;  2VZS A;  1F4A A;  5FDB A;  3THD A;  5DUW A;  3POG A;  2VMC A;  4ES9 A;  5FMO S;  5FUP A;  2VCA A;  3SCG A;  5L9R A;  1G8W A;  1RHI 2;  2GDF A;  3VV1 A;  5CA6 A;  4RHV 1;  5FYB A;  2D6K A;  4CUC A;  1QJY 2;  4LKF A;  1Q8Q A;  2TUN A;  1RMU 3;  1ZZ8 A;  2D6P A;  3RYK A;  4GAZ A;  3GCW A;  5FOB B;  4UI9 L;  5BNP B;  1VLN A;  1RVF 1;  2PA7 A;  3QH7 A;  5GAL A;  2EIB A;  4BU2 A;  1YFX A;  3MW4 A;  2Q8D A;  2B42 B;  5DZE A;  4PDW A;  3INA A;  2YBS A;  3HQX A;  3NRU A;  1LEC A;  1W39 A;  1VBD 3;  2MHF A;  3OBA A;  4GWN A;  1O8P A;  4YVS A;  5C7G A;  2OW4 A;  3LA2 A;  3K75 B;  1WD3 A;  5L9B A;  4ZU7 A;  1US2 A;  1MS4 A;  3AZZ A;  3I3D A;  3ALQ A;  1EPW A;  4Y1V A;  2DCK A;  4SBV A;  3CL1 A;  4JKK A;  1RMU 2;  3MDP A;  1UX7 A;  3ZYP A;  4I0B A;  4D7T A;  2VC9 A;  4XIL A;  2Q8C A;  4YYO A;  4HOO A;  4XAC A;  4BXS V;  2DYC A;  3JU9 A;  2YC4 A;  2XVL A;  4ZU4 A;  4GMP 0;  1DG6 A;  3I2F A;  5F2S A;  5LZ6 A;  3D5O A;  1OA2 A;  4Q4V 3;  4AEJ A;  3WQ0 A;  3BN6 A;  4E4H A;  1NE4 A;  3CMG A;  1L7Q A;  4H14 A;  4NE9 A;  1WGP A;  3T1M A;  1HKD A;  3T2Q A;  4YAR A;  5A3L A;  3MPB A;  2A71 A;  2WZ8 A;  4XUN A;  3KQR A;  3ZN6 B;  1HX6 A;  2XML A;  4S2F A;  3U11 A;  1P8J A;  1SZB A;  5FXW A;  1D4M 3;  1OT5 A;  2N7G A;  1JOB A;  2BP6 A;  2OXB A;  2G19 A;  4WVW A;  5FXZ A;  5GLZ A;  4EWD A;  4Y1Z A;  1ASJ 1;  1O4T A;  4ZZ5 A;  2KM2 A;  4N8M A;  4X8P A;  5JMC A;  1X7N A;  1NQJ A;  1KGY A;  3K48 A;  5LAS A;  1JW6 A;  5DAP A;  2VJX A;  1MPX A;  3GF6 A;  2GMP A;  5CKQ A;  3IDA A;  5CNA A;  2ES3 A;  4UFM A;  4CA9 A;  4MG2 A;  3TWI A;  5A6Y A;  1MEC 2;  4EN6 B;  4AFD A;  2XON A;  2ZEX A;  4LO6 B;  2Q1Z B;  5C9A A;  1JYI A;  1Q56 A;  3LQC A;  5DQ0 A;  3TB0 A;  4LO8 A;  4XBQ A;  4Y26 A;  3PJQ A;  1AR9 1;  2NMN A;  4Q5O A;  1AXK A;  1UZV A;  1C3H A;  1OOP A;  1Q8O A;  1K12 A;  4JHZ A;  4NPM A;  2WS9 2;  5FRE A;  3VDA A;  2WJS A;  3V0A B;  2JEN A;  2ZAC A;  3MFA A;  3KSC A;  1PZ8 A;  2DCJ A;  3WNK A;  3FUO A;  2CY6 A;  3H8X A;  2Y64 A;  3ORJ A;  4BIS A;  4D6S A;  5AFE A;  1GYK A;  2RS1 2;  1IKQ A;  2LAL A;  3B3Q E;  2Y60 A;  2VW1 A;  2XBO 2;  1U5X A;  4AI2 A;  3I49 A;  1CAV B;  2Q30 A;  3OGR A;  3AMN A;  4XCA A;  3QOP A;  3MPP G;  4XFG A;  1LHU A;  1AX1 A;  2JDK A;  2X53 S;  2XVG A;  3CZU A;  4AE2 A;  2KR2 A;  1V6K A;  1RUD 3;  2BU9 A;  3DN7 A;  4CEY B;  4JDO A;  1H1M A;  1MS3 A;  3I59 B;  4N43 A;  5FZ3 A;  1F31 A;  3VKM A;  1QOS A;  5FLH A;  1ZRD A;  2WSU A;  3LIG A;  2ZHN A;  2PLV 3;  2CTV A;  4TN7 A;  4EN9 B;  3UNP A;  2QNK A;  4N90 A;  1MS9 A;  3MUZ 1;  3AFK A;  1GOF A;  5A6X A;  2JJ6 A;  3AP7 A;  1H9W A;  3LEG A;  1DGR N;  4XAA A;  3WG3 A;  1OHF A;  5GZC A;  1VRH 2;  1QF3 A;  3JD7 3;  1W9T A;  5A3T A;  2OYZ A;  5A7W B;  1GZW B;  2WFF 1;  1RUF 1;  5E88 A;  1JUH A;  1UCX A;  1TMF 1;  2ZHK A;  2JE7 A;  3MYX A;  1V6J A;  3ON7 A;  4WVM B;  1K5M A;  2R7E B;  3ZXJ A;  4DRV A;  2QKD A;  5I0D A;  2HWC 3;  1HRI 3;  3U07 A;  4Q4Y 1;  2BNN A;  4XF1 A;  2P3J A;  5H9P A;  4XFH A;  4GH4 B;  3ZOI A;  1GKB A;  4QPI C;  5T54 A;  4AGG A;  2VM9 A;  3A7Q A;  1RC6 A;  3B5L B;  3QBQ A;  2WNV B;  1VBB 2;  4GB3 1;  3B93 A;  4XF3 A;  4YZ4 A;  3WW2 A;  5IVB A;  3U4X A;  2UY8 A;  5C5U A;  3H8R A;  3GBW A;  2Y6F A;  5AFB A;  2PHX A;  4IEV A;  3P3N A;  1V70 A;  2RDR A;  1RIN A;  1S2K A;  3PUA A;  1QJE A;  2E33 A;  2VZQ A;  3LZZ A;  5FP8 A;  4ORF A;  4QPY A;  1IG0 A;  2WWS A;  4RR3 C;  3UET A;  1LGC A;  3MIG A;  5LCW L;  2UUR A;  1PNF A;  1WBL A;  1GMM A;  1BYH A;  3A22 A;  1XC6 A;  3H3L A;  4KQ7 A;  2MEV 2;  1FMD 1;  1DYK A;  1OKQ A;  4GKX A;  4QXB A;  1HRI 2;  2XUE A;  3G7D A;  1PO2 1;  2W5F A;  2ZXQ A;  4C0H A;  2FBE A;  5BY5 A;  3ZXE A;  3N3H A;  4LE4 A;  3PUR A;  2VD7 A;  1F9K A;  1ND2 A;  3LGR A;  3NJY A;  4LJH A;  4AI0 A;  4E2S A;  5M0T A;  3UL2 A;  2ZGK A;  1OFN A;  1CQ9 A;  2P34 A;  3WCS A;  1CJP A;  1MR5 A;  2FD8 A;  4LLO A;  3VZM A;  3VBU A;  3NV3 A;  1GP6 A;  1REF A;  4P9X A;  1MQT B;  4PT6 A;  5FCC A;  2WC2 A;  2VMH A;  2DCT A;  2C9A A;  2RS3 2;  2XJP A;  3M7A A;  5FZ1 A;  2PAE A;  2JB4 A;  5LBE A;  4RSU A;  2VNO A;  1JYV A;  4OYU A;  1JZ8 A;  3A23 A;  1W8T A;  2GC2 A;  1TME 1;  2EIG A;  4XXP A;  2XQR A;  2WRA A;  1X50 A;  4CCE A;  1C57 A;  2JKX A;  4CDX A;  2W46 A;  2R6Q A;  2NYY A;  1CIW A;  4OQ8 A;  4M3C E;  3UV9 A;  1XSQ A;  3T1L A;  4EWA A;  1V6I A;  1A6C A;  1HW5 A;  2ZS6 B;  4D0Q A;  5IVF A;  3HVD A;  2NMO A;  3QD6 A;  2RS5 2;  3IB3 A;  5CVR A;  5H9Q A;  1A8D A;  1JMU B;  1HRV 3;  1S0J A;  2D3S A;  2PN5 A;  3FZ3 A;  4AED B;  4AZZ A;  5JPN B;  1SLC A;  1NCR B;  1K3I A;  2D6O X;  1QJY 1;  4EN8 B;  4DXT A;  3UKV A;  2WO7 A;  4OI0 A;  2HH9 A;  4L9B A;  4CPB D;  2E7T A;  3WG1 A;  5FPB A;  3KLS A;  2W1W A;  5KXC A;  2V72 A;  3ZIW A;  4YG6 A;  1US3 A;  2YFU A;  2WIN B;  2YMZ A;  2GP5 A;  4KU7 A;  5KXD A;  4AVB A;  1OF3 A;  4XUT A;  3WP6 A;  5A7S A;  3E5X A;  5J7M A;  3LCP A;  3I3B A;  1GIC A;  1EUU A;  2QQN A;  3RZG A;  2VXR A;  4NHM A;  2HEV F;  1UY1 A;  4UW4 A;  1W9F A;  1OMI A;  5LY2 A;  3RMX A;  2ZOE B;  5DAV A;  3B7M A;  5EJ3 A;  3VL8 A;  4GWJ A;  4IV1 A;  1YUD A;  4S2H A;  4FPK A;  4M4P A;  2Y6K A;  4MV2 A;  4AF9 A;  2XJU A;  4RFT 0;  3U75 A;  3D8C A;  2R07 3;  4OHX A;  3ZR6 A;  2VTX A;  2YDE A;  2EXJ A;  5LA0 A;  1AZD A;  2QDN A;  4DPN A;  1RIT A;  3ACI A;  1PGS A;  4LIV A;  2HYX A;  3WCR A;  4F8A A;  3SMH A;  2OUH A;  2XL7 A;  3UGH A;  1RUE 3;  2ZX4 A;  4KG0 A;  3FBY A;  2DVB A;  1Q3E A;  2JDH A;  3S6P A;  2YUE A;  1S55 A;  5FPA A;  4YZ1 A;  4FPE A;  1G9F A;  4GUL A;  4PI2 A;  3WQ7 A;  1IG3 A;  4SLI A;  3VKN A;  2VQ0 A;  5F1R A;  3LAG A;  3ZYR A;  4FQZ A;  5FQ0 A;  1PGL 1;  1H6Y A;  3POJ A;  2ORZ A;  4IND A;  4W50 A;  4HKO A;  3FLP A;  5DDJ 3;  4AQ2 A;  3TEZ A;  1AR7 2;  2HWE 3;  5FZG A;  4CEW A;  3GZE A;  4RGA A;  4QHZ A;  1H4H A;  3KZ4 C;  2A75 A;  4I3G A;  2RM2 1;  3NJZ A;  3SIT A;  3ZSL A;  3R4D B;  2ZZJ A;  4FBF A;  1O8S A;  2VUD A;  4DEQ A;  3H1W A;  3OBT A;  2X5I C;  3GZA A;  3K3O A;  3B01 A;  4GMP 3;  1OA3 A;  5BNO B;  4BQ3 A;  5EIY B;  1RUH 1;  3BOW A;  4Q4X 2;  2EID A;  1GBG A;  1C8M 3;  2BVV A;  5FZE A;  1IS4 A;  5LBC A;  3QLQ A;  4X8N A;  1U5I A;  4HMZ A;  1WLD A;  4LO5 B;  2FDI A;  1TZO A;  3AVR A;  2EXH A;  1PX3 A;  4L2N A;  4OHV A;  1MAC A;  1JHN A;  4FPY A;  4Q27 A;  1H6X A;  1KJR A;  1YJK A;  5FPZ A;  5FLI A;  5DDJ 2;  3ZKU A;  4DUX A;  1J3Q A;  2RDN A;  3OY8 B;  4UF0 B;  2FDF A;  1HQW A;  3WZ1 A;  4XFB A;  1QY4 A;  1FOD 3;  3OEA A;  1WCU A;  1XNA A;  1YQ5 A;  2R1D A;  2E31 A;  5D21 A;  3S5A A;  2RS1 1;  1L7L A;  5A7Q A;  3VDC A;  2Y0O A;  5CIR A;  3ZXK A;  1ZRF A;  2XBO 1;  4WM8 B;  4XJ8 A;  3WNO A;  4ZPI A;  2ZGQ A;  4XZP A;  1WCD J;  4A4A A;  3CKH A;  3GHN A;  2G1M A;  3O1S A;  2VMG A;  1VAV A;  3T09 A;  5A3N A;  1SG3 A;  4UFK A;  4UW6 A;  4E4Z A;  1H8T A;  4LEJ A;  1IZ3 A;  4IEP A;  5EJZ B;  3SIS A;  5HXV A;  5AC9 1;  5HCA A;  1W8H A;  1ACC A;  2ET7 A;  2ZHL A;  1NA1 B;  4YVW B;  5JDB A;  3RSJ A;  1BLZ A;  3PL0 A;  2FDG A;  5D8A A;  1R1A 3;  4IGQ A;  1QJU 3;  1AR6 3;  4ZS3 A;  1IPS A;  2EA7 A;  4MHU A;  3VBO C;  3VBR C;  1COV 1;  5EQU A;  2WNO A;  3HR9 A;  5DUU A;  4MAD A;  4V2W A;  4UOJ A;  3VDD A;  3U4S A;  4E2G A;  1W3V A;  3J7H A;  1PM4 A;  3KGL A;  1HB2 A;  1IGO A;  2HEW F;  2ZAB A;  4HZF A;  4JGZ A;  4C8D A;  5JSO A;  3WY6 A;  3E5Q A;  4Z82 A;  1OI6 A;  3AKP A;  3O0X A;  4CCK A;  4M01 A;  3ZYB A;  3LPF A;  4Q1R A;  1SQ4 A;  3ZYJ B;  4AVA A;  2BER A;  2ZAA A;  4GZ9 A;  1X9P A;  5F5A A;  1JOJ A;  2GN3 A;  3RZL A;  1BMV 1;  3OBR A;  4YM0 A;  4LPL A;  2P3Y A;  3OF1 A;  2A3X A;  4Q29 A;  1UYY A;  3L2Y A;  4P08 A;  2XGX A;  4NOT A;  4QKB A;  4Y20 B;  3T2O A;  2C0Z A;  1AR6 2;  3ZMO A;  1HXS 2;  2JG9 B;  1UL9 A;  1L7R A;  5GM0 A;  5LK5 A;  2DU1 A;  5KHG A;  5JR2 A;  3AL5 A;  2HLE A;  2PHU A;  5JXH A;  2GME A;  3UGF A;  1CPM A;  1F2N A;  2J1T A;  2QDR A;  3FHA A;  5EJ1 B;  1N3Q A;  4FXG B;  2ARA A;  2MEV 1;  2B5H A;  1KIT A;  4HPK A;  2VL4 A;  1VE0 A;  3AX4 A;  4A7K A;  4LUL A;  5L19 A;  5I8Y A;  1DGL A;  4XQD A;  4DFS A;  2DUP A;  3VKO A;  3KQ4 B;  5L9V A;  1ONA A;  4FPG A;  4XVH A;  1ZBE 2;  2D3P A;  4N9I A;  3DYP A;  3PHM A;  1XQN A;  5KC5 A;  2Q1M A;  5FZH A;  3RGB A;  4CP2 A;  2TBV A;  1YQ8 A;  3ZSE A;  3RZM A;  1C28 A;  4RS5 C;  4R9A A;  3TN9 1;  5JZG C;  1H30 A;  1CAU A;  1UYZ A;  2C26 A;  5E1R A;  1JZ3 A;  2ZHM A;  5ABJ C;  1S0D A;  3ZR5 A;  3A4U A;  3DYO A;  4YW7 A;  3H0O A;  1LOD A;  1R08 1;  1N3P A;  3M70 A;  4RHV 3;  5KHK A;  5JIA A;  2BFU L;  4M0N A;  3D3A A;  3W9A A;  3AKT A;  1Y9M A;  3NV4 A;  4NAO A;  1YQ6 A;  3CEW A;  3J7M A;  4NHK A;  1SDW A;  2Q1F A;  2VVE A;  1TG7 A;  3H7J A;  1V9U 1;  2Z42 A;  3GBF A;  2V73 A;  4UBH A;  3MBW A;  4N53 B;  2W95 A;  3ILN A;  4FSJ A;  3FWE A;  5A32 B;  2XL9 A;  5K0U C;  5I91 A;  1QNW A;  1VBA 2;  2WT2 A;  3VBF C;  3ZFE B;  4NVP A;  2XKP A;  1Y4W A;  2CYF A;  1VBE 3;  1R64 A;  4LQR A;  2W1Q A;  2D3R A;  3UES A;  1L3J A;  3NAP A;  4MOA A;  3VL9 A;  1BQP A;  4MGT A;  2PEL A;  4MXV A;  4D6R A;  1NCQ C;  2Y6G A;  3E6D A;  5FBJ A;  3N9P A;  3HD8 B;  2RDS A;  1YIP A;  2WN3 A;  4EWE A;  4B1L A;  2J7M A;  5EYY A;  3ZFF C;  1OQE A;  4JGY B;  4MLO A;  3FN9 A;  1GLH A;  1ND3 A;  1HN1 A;  3NMB A;  5EP9 A;  3GZT B;  3G6J B;  4QX5 A;  5EV7 A;  1SLL A;  4IXL A;  4BB3 A;  1IKP A;  5I0S A;  3RWN A;  4BMB A;  4AWD A;  1ZZ9 A;  1C4R A;  2GC1 A;  2W9X A;  2C4X A;  3MIH A;  1QJX 1;  4FP2 A;  3O1O A;  2VNR A;  4XW3 A;  1LOF C;  4AAP A;  3EB7 A;  1NLQ A;  3VD9 A;  3PUH A;  3RDI A;  4IGP A;  2BNO A;  3GGL A;  3VD5 A;  3AKQ A;  4RD7 A;  1GR3 A;  1O4Z A;  4JKL A;  4FFG A;  3APB A;  4CDU A;  1NX9 A;  4WM7 C;  4B1M A;  1OD5 A;  2LRP A;  3ACH A;  4YM3 A;  4WZC A;  3WG4 A;  2QUO A;  2YBP A;  2VUL A;  1O6U A;  1O3S A;  4NMI A;  5L7O A;  1PK6 C;  4EJR A;  2CU5 A;  1DLL A;  3POW A;  3WF0 A;  4BLI A;  2EIE A;  4D6Q A;  3DKQ A;  3MLJ A;  2R04 1;  1WD4 A;  2IUW A;  2Q8E A;  3FX3 A;  4Y5T A;  4MH0 E;  4DNY A;  1NLR A;  2FMD A;  3R4U A;  2A7A A;  5F3I A;  5HCB A;  4GIQ A;  4CCL A;  2PHL A;  1LKN A;  1VB2 A;  4Z1V A;  3LIH A;  5FY7 A;  5DPN A;  1FPN 2;  3K46 A;  1AR9 3;  4C1X A;  4Q0Q A;  3HN3 A;  3VHN A;  5FXV A;  3ETP A;  1BJQ A;  1UPI A;  2W92 A;  4CDU C;  1NE6 A;  1G9D A;  3Q8F A;  4Y33 A;  4PDW B;  2WUH A;  2WZE A;  2AEN A;  4YW5 A;  2RJ2 A;  3NW4 A;  4PLN A;  4YVS B;  3LDB A;  2YRO A;  3ACF A;  1X9T A;  1EP0 A;  1AYM 1;  3LA7 A;  1ZM1 A;  1QJZ A;  2WKK A;  2Q8O A;  2QCS B;  4Q4X 1;  2ZKL A;  4KNC A;  4ATF A;  2E7Q A;  4BQ1 A;  2WO1 A;  2DUR A;  1LOG A;  5IVY A;  3SCF A;  4CVU A;  5FZ6 A;  1BBT 2;  1S0C A;  3KMH A;  3H1Y A;  3NV1 A;  1SLT A;  3O1U A;  1Z7S 2;  2HWF 1;  3T0D A;  2RR1 1;  1LGN A;  4QHB A;  5FZK A;  2G4I A;  2ID4 A;  4QDS A;  4QX8 A;  2PFW A;  1XOY A;  1GOG A;  4BJ0 A;  2JDM A;  2YYO A;  5KHI A;  3WNM A;  1AL2 3;  5LW9 A;  1UU6 A;  1PHM A;  2GNM A;  3GXU A;  2YU1 A;  4QU1 A;  3RWK X;  2OA2 A;  2YG0 A;  1C5I A;  1UOF A;  2A3W A;  3RPQ A;  1XE8 A;  2A73 B;  3C3V A;  3R05 A;  1UD1 A;  2XVK A;  1EAH 1;  2ETE A;  4QPG A;  3HAG A;  2YPD A;  2WFF 3;  3VBH C;  3I97 A;  1VMF A;  3WDT A;  3WHU A;  3RQ0 A;  5A3P A;  4ASK A;  3IAQ A;  2W39 A;  1RUJ 2;  4LBJ A;  5JIU A;  5A3O A;  1AL2 2;  1ZRR A;  1ULC A;  3AZV A;  1DU3 D;  5A7O A;  3T0B A;  4JRL A;  3HPN A;  1MVE A;  1ZBA 1;  1GV9 A;  4OLL A;  3WQB A;  5FMO L;  4GB3 3;  4OZX A;  5ACA 2;  4LT5 A;  2ARX A;  2VOW A;  3MW3 A;  2HWB 3;  4E4D X;  2D6M A;  4FPO B;  1PVC 2;  2Y33 A;  5ANN A;  4AVV A;  5C9A B;  1WKY A;  1OLM E;  1S4C A;  2PHF A;  3THP A;  4FTB A;  4PQ9 A;  3J26 N;  5LBB A;  1VBC 1;  2HJI A;  3OYW A;  1PM7 A;  5FO7 B;  2IZW A;  4NHX A;  3J8F 2;  3OOX A;  4QXH A;  4MGK E;  4TLG A;  1W99 A;  1OOP B;  2XWJ B;  4A44 A;  4XEZ A;  1PO2 3;  2VY0 A;  2WNU B;  3NKT A;  5C33 A;  1JYN A;  3QCW A;  2GH2 A;  2CGN A;  5HPO A;  1DZQ A;  2WWU A;  2LUW A;  4M3C A;  5FY1 A;  2V5Y A;  3PUI A;  4ZXE A;  5CYY A;  1UXX X;  4BM8 A;  1ENS A;  1HXS 1;  4FOV A;  2HWB 2;  2R06 3;  4TSV A;  1A34 A;  2ZGU A;  5I8T A;  4ET7 A;  5FMC A;  3BU7 A;  4BCU A;  1WW6 A;  3PU3 A;  4FFH A;  5FYT A;  5FYS A;  4PIX A;  3OGS A;  5BV6 A;  2GAL A;  4LBQ A;  3UKN A;  1OSG A;  5CEH A;  1DQ2 A;  1NAE A;  4B8E A;  1V6L A;  3OUJ A;  4A2U A;  3ZVX A;  1IPJ A;  1I6X A;  4N43 B;  4H7M A;  2BOJ A;  4W6W A;  4OUL A;  4HKW A;  2ZMK A;  4MGY E;  2O8O A;  3FLR A;  4QX2 A;  4CRQ A;  1V0A A;  1UW8 A;  2P37 A;  4CXY A;  2OS2 A;  3JBG 3;  4H3W A;  3NNL A;  4HT1 T;  4C91 A;  4COY A;  5FMB A;  4RYD A;  5APA A;  2PQQ A;  3TAY A;  1HDK A;  5IAT A;  2NP0 A;  4IL7 A;  1QMJ A;  3WF1 A;  3IWZ A;  1K5M B;  3IDE A;  5F3G A;  4A45 A;  1JTZ X;  3LOB A;  2QQW A;  2UY9 A;  3WVJ A;  1S1A A;  4H55 A;  3RZJ A;  4AQS A;  4IQP A;  2Z79 A;  1PZ9 A;  3PUQ A;  2YBK A;  3JB4 C;  3AYA A;  1UMI A;  4EQV A;  4NHY A;  1ODN A;  3D82 A;  2PHR A;  4QB1 A;  1PIV 3;  2VBD A;  4CUG A;  2ZEW A;  2B9V A;  2RHP A;  1WMX A;  1E5S A;  5FZF A;  4KI5 M;  5I0R A;  1DGW X;  4KMQ A;  1QXR A;  1A78 A;  1LEN A;  4GXL A;  3AP6 A;  3KD4 A;  4JTN A;  3SH3 A;  1ZA7 A;  1N47 A;  1Y9G A;  2XDV A;  4LXL A;  1ZZ6 A;  2DU0 A;  2NM1 A;  2ZGT A;  1PO1 3;  1GZT A;  3BOD A;  4IUG A;  1RUG 1;  2VCC A;  4IV3 C;  2XLG A;  2P17 A;  3DCQ A;  3VHP A;  3GBG A;  2NQY A;  1YEW A;  3IZO A;  4O65 A;  4FO9 A;  5F9T A;  1ND2 B;  3IAP A;  2AH2 A;  4B7E A;  1S0G A;  4NRQ A;  3VBU B;  2DCZ A;  1VBD 2;  2DVG A;  2OQ6 A;  3AVS A;  3M8L A;  4XYX A;  2VAU A;  1CZT A;  3KV5 A;  1SPP A;  1S0E A;  5J96 B;  2VZT A;  3I54 A;  3POY A;  4GWI A;  2A1X A;  1WUV A;  2Y26 A;  1MS5 A;  4IER A;  3LEK A;  3N7M A;  2R49 A;  2NPI A;  1B35 C;  1DYP A;  2WII B;  3WV6 A;  4Q4W 1;  1DYO A;  1NUK A;  1XU2 A;  5HV4 A;  2HWD 1;  3OD4 A;  2W87 A;  5F8P A;  4YFZ A;  3ZMN A;  2JDP A;  3URF A;  3OGV A;  1UMZ A;  4CDX B;  1UIJ A;  2YFZ A;  4L97 A;  5FO9 B;  3H8U A;  4Q0V A;  3HQU A;  1RTV A;  4OI2 A;  3T30 A;  1KDM A;  4BXF A;  3V0B A;  4AVT A;  3V64 A;  4BWO A;  4BE3 A;  5KC6 A;  4Q4V 2;  1EV1 3;  3NV2 A;  2A6W A;  1W8O A;  2OX0 A;  1W90 A;  4ARX A;  2EXI A;  4CDQ C;  3ZFG C;  4NJ4 A;  1R09 1;  1JI6 A;  2BVB A;  3VBS C;  3LFI A;  1RYY A;  1D7P M;  4Z07 A;  2WA4 A;  1Q43 A;  3RZZ A;  3T2T A;  3WOG A;  4OVE A;  4HLT A;  5A6Z A;  1OBN A;  2QJV A;  1MZ6 A;  3IN9 A;  5C8C C;  1S0B A;  5LRR A;  4Y24 A;  3M3I A;  1D4M 2;  1F15 A;  5CFD C;  3CJI C;  4DXZ A;  1FPN 1;  1PX4 A;  2AUY A;  4I02 A;  4IET A;  1XNK A;  5IYY A;  5EXO A;  4ARY A;  4QQH A;  1D0H A;  1VP6 A;  4LOR A;  2JE9 A;  3MUY 1;  2VE1 A;  3VZK A;  4QDQ A;  4ISR A;  4QKD A;  2Y38 A;  1QQP 3;  2H6C A;  2QQP A;  2O14 A;  4YW2 A;  3CJX A;  2UU8 A;  5LA2 A;  5CZK A;  2IXJ A;  3LEM A;  3AYD A;  2SBA A;  5FV3 A;  5IK5 A;  1SLB A;  4OUE A;  3RVH A;  1SFP A;  1BBT 1;  5DZG A;  3ZYF A;  5EPA A;  5GLW A;  4JQR A;  4LKE A;  3NWK A;  1FX5 A;  1Z7S 1;  2QQO A;  4IV1 B;  1Q8P A;  2RJK A;  1WWY A;  3DPR C;  1U12 A;  3T3Y A;  2CGO A;  3AC0 A;  2OKX A;  5IK7 A;  2F17 A;  3RJ2 X;  5AC9 3;  1GUI A;  2QQM A;  4QPI A;  5FPL A;  4MET A;  3O1P A;  1QQP 2;  3DGT A;  2ZGN A;  1VMH A;  2VOV A;  5LA9 A;  4GQ7 A;  1DFQ A;  2VQT A;  1W9W A;  2JG8 C;  5F37 A;  1QKQ A;  3VD7 A;  4LBL A;  3Q8B A;  3ZXF A;  1SAC A;  1UYP A;  3SEP A;  1QNY A;  1RIR A;  1BXH A;  4K8R B;  3JQW A;  5FYY A;  4C90 A;  3MW2 A;  1CON A;  1E57 A;  1K42 A;  4RR3 A;  5FZ8 A;  1GZ9 A;  1POV 0;  5IFP A;  3J4U H;  3VDB A;  2GP3 A;  4I09 A;  3L2H A;  5FQ0 B;  4OI1 A;  5ERL A;  1BKZ A;  4TYS A;  4YSF A;  3N7J A;  4HN0 A;  1RUD 2;  4FTS A;  1YIF A;  1HB1 A;  2O1Q A;  4YWA A;  3O1R A;  4PIZ A;  4Q2F A;  3PVN A;  5F39 A;  1O3T A;  5JCT A;  1I5Z A;  2VOX A;  4CEW B;  5ACA 1;  2YY1 A;  5IT6 A;  3PVO A;  3S57 A;  5CAD A;  2X8K A;  1NQD A;  4X6R B;  2PLV 2;  1YCI A;  2VUC A;  5FYC A;  3WUC A;  1OXC A;  4XOG A;  1KFU L;  1UZY A;  2J22 A;  1PVC 1;  4BLJ A;  5F5I A;  3CBN A;  3JD7 2;  1W6O A;  1NY7 2;  5A7P A;  5JAX A;  2RMU 1;  4DUV A;  3DF0 A;  2DTW A;  2IXL A;  2BUK A;  2W1U A;  4RQP C;  2W47 A;  3DEC A;  5DG2 A;  2HWC 2;  5CFC C;  2ZAH A;  3ACG A;  3V65 A;  4LO4 B;  2XLF A;  5A3W A;  1ENQ A;  4DS0 A;  5IK4 A;  1AR8 1;  1STM A;  2FCT A;  1DCS A;  2R1B A;  2YZ4 A;  4IEU A;  4KL1 A;  5LRS A;  3AP4 A;  3OCP A;  1YQ2 A;  3AJZ A;  1YFU A;  3ZSJ A;  5C3S A;  5F2W A;  3AMH A;  4XFC A;  4ZU5 A;  4AGV A;  4Z8B A;  1N1Y A;  5DG1 A;  5KWR A;  1PVX A;  2FQP A;  1GWK A;  3WNN A;  2R16 A;  1WLT A;  5FY8 A;  3RS6 A;  2Q4S A;  3TN9 3;  4R4Z A;  4AGR A;  1GP4 A;  1NT0 A;  2ZX2 A;  2ARE A;  5T5J A;  2C6S A;  3NJV A;  1OKO A;  4PJY A;  3ZN4 A;  2FDH A;  1R08 3;  1H8T B;  1OLR A;  4G4F A;  3OD0 A;  4FOY A;  4X6Q B;  4UW5 A;  3FUQ A;  4AI9 A;  4LHK A;  4I0W B;  4MGI E;  2QZ3 A;  1JXN A;  4YZ5 A;  4EE2 A;  4FPH A;  5G04 L;  3KV4 A;  1JYW A;  5JVV A;  1SLI A;  5D8A B;  2VG9 A;  4OUS A;  4Q0P A;  1Z0H A;  5BNP C;  1RB8 G;  4YG3 A;  4YW4 A;  1W2N A;  4XF0 A;  4YW3 A;  5C70 A;  4Q8K A;  2VR4 A;  3B69 A;  3R4S A;  3VDD B;  4B7K A;  5AC9 2;  3TEY A;  1BVP 1;  5DAQ A;  1JYC A;  4JGZ B;  5F5C A;  3I2G A;  2MNG A;  4XTM A;  3ZYH A;  4Q8L A;  5F3C A;  3GHM A;  1RJ7 A;  4XC9 A;  2ILM A;  2WZR 3;  1RHI 1;  4BDV B;  1WZX A;  3KB5 A;  1U5Y A;  4OUM A;  2IXH A;  3S7I A;  5IVE A;  5DAB A;  2PHT A;  3BYW A;  1OPO A;  3MEP A;  4V2V A;  4YRD A;  4CTE A;  1ALY A;  3M3C A;  4PHZ A;  3WSO A;  2AEY A;  5E89 A;  1UQX A;  4PLO A;  3ME2 A;  3MO4 A;  3POE A;  4I0A A;  1QWR A;  4K21 A;  1I5P A;  2AYH A;  2RG4 A;  1KS4 A;  2Y6L A;  1RUC 3;  3CQO A;  3TBD A;  3OSD A;  4IE7 A;  1VAL A;  4LNV A;  3WW4 A;  1DQ1 A;  4CUA A;  3D0S A;  3P6B A;  2WO2 A;  3JQX A;  1J1T A;  2K46 A;  3A0N A;  3JCI A;  1RUN A;  1HRV 2;  4C1W A;  1QJX 3;  1CJD A;  4NUB A;  3M3O A;  4HPK B;  1M4W A;  2RE9 A;  1CZV A;  1ULO A;  3S0M A;  2D40 A;  3MF9 A;  2ZX1 A;  4CU8 A;  1RMU 1;  5FZL A;  1DQ4 A;  1Q5O A;  1JZ4 A;  2JE8 A;  4XMI A;  2PAK A;  1YXW A;  1RUI 3;  2CHH A;  3ZKY A;  2L9L A;  4QQ2 A;  4UFL A;  3O1V A;  2RDQ A;  4UAP A;  3B00 A;  4YM1 A;  2KD7 A;  2GNT A;  1LB2 A;  3RMY A;  1K5J A;  1UOJ A;  1VBD 1;  1KD7 A;  2WAA A;  2FZ2 A;  4AL9 A;  1CAU B;  1E5I A;  4U36 A;  1IQD C;  2X5I A;  2CL2 A;  3UKT A;  4COV A;  5FZB A;  4QGL A;  1IOA A;  1JS9 A;  4NIG A;  3GYD A;  5FKB A;  3HNY M;  2E26 A;  3HN1 A;  4BQ2 A;  4COU A;  3TEX A;  4JDM A;  4MHR A;  2WLQ A;  4XHX A;  1UZW A;  4J6G A;  2I45 A;  4W6X A;  2JDZ A;  4DQA A;  5KBF A;  1CGP A;  3F95 A;  3C2U A;  3HIF A;  1YWK A;  2R07 2;  3BKZ A;  2D44 A;  2YV8 A;  4B4Q A;  2XJS A;  3HT1 A;  4OI4 A;  1W8F A;  1BHG A;  1N3O A;  4K3U A;  5EZW A;  2DCY A;  3SKV A;  3BVC A;  5FYV A;  1AYM 3;  1RUE 2;  4L99 A;  3EMR A;  3DXU A;  4XQ4 A;  4DY3 A;  1DQ0 A;  1DZR A;  1O5U A;  2K0G A;  1MEC 1;  3AKR A;  4OHW A;  5GZF A;  2IXC A;  3NAP B;  1LAJ A;  2VZ3 A;  4HK9 A;  3FFZ A;  1TVG A;  3I2D A;  5FZO A;  4AI8 A;  2ZGR A;  2BDR A;  3AJY A;  4I2O A;  1C1F A;  1E5R A;  1ZA4 A;  2PHD A;  3IPV A;  3WUD A;  4KU8 A;  2HWF 3;  1AHS A;  3QAC A;  5C71 A;  4QB2 A;  3O0V A;  4BQ5 A;  4XXA A;  3T4H B;  2VW0 A;  3ETQ A;  1XYO A;  4FP3 A;  5FZ0 A;  2WS9 1;  4RN5 A;  2JD4 A;  1ND3 B;  4CEY C;  3IDC B;  2C1F A;  2I74 A;  2HWE 2;  3WF3 A;  1FNY A;  4FXK B;  4IEX A;  4QX1 A;  5JUV A;  3VBO A;  1WMF A;  3VBR A;  4O9G A;  2VNG A;  5A1L A;  3NNM A;  5JOZ A;  1IPK A;  1QDC A;  1W04 A;  1OLM A;  3AYC A;  2DBI A;  4EN0 A;  3E97 A;  1LHN A;  1C8M 2;  1EAH 3;  4IDZ A;  4A6O A;  1BEV 3;  3W59 A;  4AHZ A;  4CPB A;  4JX0 A;  3WF4 A;  1UAI A;  5KR7 A;  2JKB A;  1WLC A;  5JLV A;  4CDU B;  4LK7 A;  4W65 A;  3D0J A;  1DZT A;  4S2D A;  2ZBJ A;  2BGO A;  2CSG A;  4UFH A;  4LK6 A;  4Y1Y A;  2QE3 A;  4ATE A;  5L7O B;  2X09 A;  1KJL A;  4GH4 C;  1ZBA 3;  3OG2 A;  1NLS A;  3TEW A;  1XB9 A;  5C3P A;  1FOD 2;  2B7Y A;  4RFR B;  2WNV C;  1WCQ A;  4QX7 A;  4E8C A;  5IVC A;  1S2B A;  2W52 A;  1YQC A;  1AYN 3;  2WNE A;  5A70 A;  3WEZ A;  2BGP A;  2ZTN A;  4ZHN A;  2CDO A;  5IVV A;  1XYP A;  2DWR A;  1VRH 1;  2EAA A;  1NZI A;  4BK4 A;  1W2T A;  4LO7 A;  5IHR A;  1VBC 3;  5AVA A;  3JB8 A;  4CU9 A;  1JH5 A;  2QQV A;  3BIE A;  4CDW A;  3M3Q A;  4LA3 A;  4UFI A;  5FYU A;  1W8N A;  4G9S B;  4NID A;  1C1L A;  2XKO A;  1RXF A;  2G9Z A;  4J25 A;  1W6Q A;  1W6N A;  5FP9 A;  5FPV A;  3VKL A;  1D2Q A;  1W6P A;  2GC0 A;  5CKM A;  4AVC A;  2WZP P;  2VOT A;  4CCD A;  1YFW A;  4YLZ A;  4A42 A;  2R30 A;  1LHW A;  1O4Y A;  1R1A 2;  1VBB 1;  2K2S A;  1QJU 2;  2C24 A;  3B9I A;  1SFY A;  3NNJ A;  4OFG A;  4QQL A;  2EAK A;  3T08 A;  1DF0 A;  2ZGS A;  2YHJ A;  4RS5 A;  4XBL A;  4FT8 A;  4Y4Y A;  5JZG A;  3HJR A;  2QVS B;  2VQU A;  3K51 A;  1D0G A;  1HB4 A;  2KXL A;  1KXG A;  2PAM A;  4BHP A;  1ZRE A;  4M3C F;  3P5B A;  2FHR A;  3N9L A;  5ABJ A;  1WW7 A;  1MQT C;  5E8A A;  3OGJ A;  2CAU A;  4QHO A;  3KWV A;  3IMN A;  1FV2 A;  2JWP A;  3O0W A;  1MVQ A;  2OUJ A;  4AED A;  4FVV A;  3ABZ A;  4GD4 A;  4CDW C;  1JYT A;  1ZZC A;  1W0O A;  1HRI 1;  4CSW A;  4XZU G;  1SBD A;  3KCX A;  1POV 3;  1XPW A;  3BTA A;  1TE1 B;  4IEZ A;  2VXJ A;  4XUR A;  4YG0 A;  4TZD A;  2Q0A A;  2C9K A;  3BUC A;  5L36 A;  1K45 A;  1I3H A;  1F35 A;  3TOJ A;  4EZ4 A;  3W20 A;  4ZXK A;  2Q5T A;  5K0U A;  1UIK A;  1UU4 A;  4WV8 A;  3SHR A;  4CP9 A;  3VBF A;  3HMY A;  1JOP A;  2YPJ A;  2WAO A;  4QPG B;  2EAL A;  1DLC A;  2ZKN A;  4JC1 A;  2RS3 1;  3UJQ A;  4IEO A;  4KG8 A;  3DL3 A;  1X82 A;  1UOG A;  1URX A;  2BNM A;  1NCQ A;  2YU2 A;  4AED C;  4BA6 A;  4ZZ8 A;  2A3Y A;  1HIX A;  1NCR C;  1T2X A;  2E51 A;  5C4W A;  4CCM A;  4CXX A;  3BTY A;  2PXJ A;  1YHF A;  4E8D A;  4C0B A;  1H4G A;  3WIN E;  2XQX A;  5FP7 A;  1RVF 3;  4QT6 A;  3ZFF A;  2WBK A;  3AZX A;  4Y4R A;  5HV0 A;  5F7U A;  3BIW E;  4Y5Z 0;  4QU2 A;  5F3E A;  4AVS A;  1XBF A;  1QH7 A;  3HNB M;  3KHC A;  1VMJ A;  3FC0 A;  5JSP A;  2O0O A;  2RS5 1;  1UKG A;  1FT9 A;  4K8F A;  1O91 A;  1EY2 A;  1O3R A;  3OYW B;  2ZJC A;  1LOF A;  1N1S A;  2ZPX A;  4XUQ A;  1YLL A;  1ZRC A;  1J3P A;  2OZ6 A;  4RHV 2;  3R6S A;  3SCH A;  2JEM A;  3D4K A;  4D94 A;  1UPS A;  1UU5 A;  1R1Z A;  4AHX A;  4KGQ A;  5C4W C;  3BTX A;  4QM8 A;  4FOW A;  1V6N A;  2IXI A;  1ULE A;  4WM7 A;  4M3C B;  3LSE A;  4NIH A;  3W58 A;  5J98 B;  1RED A;  2OPK A;  1WBF A;  1PK6 A;  2E63 A;  2YC0 A;  2O8Q A;  3Q8C A;  3T4V A;  4HAN A;  3RYR A;  4EV0 A;  2W3J A;  5T55 A;  5EHD A;  3FJS A;  3QH6 A;  1QOO A;  1SFN A;  3WNX A;  3WW3 A;  1LES A;  3I2O A;  2BYV E;  2HKX A;  4HK8 A;  1W2U A;  4MZU A;  1VBE 2;  4LBN A;  4NR1 A;  4QM9 A;  4BQX A;  4Z2W A;  3N7L A;  1W2O A;  1YI9 A;  2Y0I A;  4LBQ B;  4KBB A;  4TXW A;  4NO4 A;  3WX5 A;  1LGB A;  4Q4W 3;  1KQR A;  1LOC A;  5E6H A;  4F3J A;  4QB6 A;  4EZH A;  1GFF 2;  5JXI A;  3DXT A;  1ASJ 3;  3D6E A;  5FKC A;  5J3U A;  5JWP A;  4FPL A;  4R9B A;  2D7F A;  3LEI A;  1CD3 G;  4E9K A;  3AZW A;  4R4X A;  5HCH A;  3F2Z A;  3VUO A;  1VAM A;  1OLQ A;  1R09 3;  2VCB A;  1TNF A;  5JXJ A;  2R32 A;  2VZR A;  5KXE A;  2DV9 A;  3RFR A;  3IT8 A;  5BNO C;  1CX1 A;  3ES4 A;  2XJV A;  3EYP A;  3OPT A;  2UWA A;  4Z2A A;  1ZNP A;  1JZ7 A;  3FHQ A;  4FCA A;  3JZV A;  3B02 A;  4GAL A;  3ZXG A;  2VMD A;  4FAG A;  2Z5W A;  4CCO A;  2LTN A;  3DUI A;  3OB8 A;  1I9R A;  3GJA A;  3WG2 A;  3AMM A;  2W91 A;  5FJH A;  4AFB A;  4CXW A;  5CB7 A;  1ULF A;  1AR7 1;  2P1B A;  1AX2 A;  1M06 G;  3MLL A;  1QEX A;  3MIC A;  3ZX7 A;  1W6M A;  3MGU A;  5FZI A;  2YC2 A;  4AFM A;  1RUE 1;  3ZPY A;  2WO3 A;  4Z92 B;  1AF9 A;  1QXJ A;  1S2E A;  2UYB A;  1LED A;  4DXS A;  1XSR A;  3KF5 A;  4AAX A;  4WM8 C;  3AYE A;  4O9E A;  1PMJ X;  4HON A;  3CNA A;  1HJF A;  4YZ3 A;  5SV8 A;  4NII A;  3VBH A;  3H50 A;  4AR2 A;  5HI0 A;  5BXX A;  1O7F A;  1AR9 2;  5FLJ A;  3H7Y A;  4Y22 A;  4XHB A;  3ES1 A;  4UYB A;  2D6L X;  4DMI A;  1WME A;  5DDJ 1;  5J36 A;  3FL7 A;  3KV6 A;  4WVV A;  5EFU A;  4YVW C;  5LAT A;  4WZF A;  5A6Q A;  1GWM A;  2GSY A;  1SPP B;  5A80 A;  1LHO A;  2MPF A;  5JSR A;  3V56 A;  1JOD A;  3NNG A;  3POS A;  1EUT A;  1C8M 1;  2ARB A;  2Y8K A;  3MIF A;  1AL0 G;  2ERF A;  4HG6 B;  4JZR A;  5CIS A;  3LWC A;  4LBK A;  1SCS A;  4CCC A;  1RUF 3;  3MF6 A;  4P9I A;  4UT5 A;  1TMF 3;  1CAW A;  4RGK A;  5FY5 A;  3SQO A;  3ST7 A;  1LU1 A;  5KXB A;  4AW7 A;  1T6B X;  4D8M A;  4QWN A;  2XJR A;  1G86 A;  1XNC A;  3H1M A;  4FPF A;  4H7L A;  4Q4Y 3;  1FNZ A;  3KT4 A;  1VPH A;  4GKY A;  4FAH A;  3V0B B;  4CP1 A;  5A33 A;  3C7F A;  4L92 A;  4XTP A;  1FOD 1;  1OQ1 A;  2DTY A;  3RYP A;  4ZKT B;  1SDD B;  2A70 A;  1V00 A;  3WDV A;  4IE4 A;  1LUL A;  2JG9 C;  1SBE A;  1LNS A;  4D7S A;  4YNI A;  3AZY A;  4FFF A;  3WP4 A;  3FMG A;  4LHL A;  1DBN A;  1JYX A;  1ZYB A;  4AG4 A;  2RMU 3;  2JEC A;  2CWS A;  2WFF 2;  4QXK A;  1QHD A;  2YGM A;  2XXZ A;  5I0T A;  1OH4 A;  3R0R A;  1FMD 3;  4TLF A;  2BOI A;  2VMI A;  3OTF A;  4HVO A;  5A7N A;  1H1I A;  1BK0 A;  2ZA9 A;  5F6L B;  2VVD A;  2TNF A;  2VU9 A;  3EO6 A;  2JDA A;  3OUH A;  4GB3 2;  5FYI A;  2WSV A;  4QX0 A;  3WDW A;  1AR6 1;  1F5J A;  1S0I A;  2V5D A;  4GJY A;  2UWB A;  4XCB A;  3SH4 A;  4KWK A;  1MZE A;  5FYM A;  3I3M A;  3KM5 A;  4RL7 A;  3SH5 A;  4ZON A;  1AX0 A;  5GZD A;  5T50 A;  1BVV A;  2A6Z A;  3X29 B;  1PNG A;  2GU9 A;  2OPW A;  2VZV A;  3UJO A;  4DEV A;  2ZEZ A;  4V1P A;  2EF6 A;  2X29 A;  3GCX A;  1CPN A;  1V6O A;  2PTM A;  1FMD 2;  2VZO A;  4XFA A;  3ZIX A;  4N7U A;  3VD4 A;  3LE0 A;  3LKJ A;  3TYJ A;  3Q8E A;  4QPI B;  1PO2 2;  1C8N A;  2VH9 A;  2AC1 A;  1TME 3;  5EWS A;  5BNN A;  5JI9 A;  1GP5 A;  5FO8 B;  1MS1 A;  1YJL A;  1ZBE 1;  2VPV A;  5CG9 A;  1A3K A;  5LA1 A;  2XWB B;  4NAM A;  2D43 A;  2R06 2;  1PZ7 A;  2Y34 A;  5FK8 A;  3I2H A;  4N53 C;  4NHL A;  2B4K A;  1J58 A;  4F7Z A;  2E6V A;  3IMM A;  4RR3 B;  1ENX A;  1J84 A;  2J1U A;  3IKW A;  4IEW A;  3ZFE C;  2WL1 A;  2YGL A;  1DIW A;  5DUX A;  1J3R A;  1FAT A;  1YFY A;  3AB0 A;  4IV3 A;  4TWT A;  1CX4 A;  1H2N A;  2K9Z A;  2DFB A;  1QJY 3;  4CCJ A;  1G7Y A;  3KF3 A;  5DXD A;  4JKM A;  2QZ2 A;  3NVC A;  5BNN C;  5KHH A;  1G6N A;  4M00 A;  2IFR A;  3BCW A;  1WMD A;  3NJX A;  3I2K A;  5FYH A;  4YGD A;  3E6C C;  2HEY F;  4HET A;  2A6X A;  4DRR A;  1HQL A;  4JGY C;  1UYX A;  3JBG 2;  2EXK A;  1W06 A;  2ZMN A;  1VBA 1;  2ZX3 A;  4R8H A;  1W6O B;  5I0U A;  2H0V A;  3KHB A;  4AFA A;  3LPG A;  1B35 A;  2NN8 A;  3S7E A;  2FZ1 A;  4LUK A;  4XPV A;  1H8V A;  1XYN A;  3U37 A;  2OQ7 A;  2ZGP A;  3EHK A;  4ERO A;  4M4R A;  4XF4 A;  1W0P A;  3WQ1 A;  3KT7 A;  3PMS A;  3RRD A;  4QX3 A;  1GAN A;  2VUJ A;  1UO9 A;  5FTT C;  1H9P A;  1QH6 A;  2WQ4 A;  1CZS A;  1PIV 2;  2E9Q A;  3IM0 A;  2JXA A;  1GU3 A;  4LHN A;  2CDP A;  2E7A A;  2XHN A;  3WLU A;  4A41 A;  1X8M A;  2Z69 A;  1TEI A;  3ZFG A;  4CDQ A;  5IK8 A;  3VBS A;  3WT3 A;  3CU7 A;  5FPU A;  3A21 A;  4OCT A;  3T2P A;  1VBE 1;  4ZS2 A;  1AXY A;  3L9J T;  1G9A A;  1OC1 A;  3I3E A;  2Z2S B;  1PO1 2;  4LUM A;  3SEE A;  4BQ4 A;  5C8C A;  1CIY A;  5CFD A;  4ITC A;  3CJI A;  3ZN5 A;  3ZO0 B;  3U1X A;  2QQJ A;  3DKW A;  5CBL A;  2DBN A;  1JZ2 A;  5FR3 A;  3I2J A;  4HVQ A;  1UKR A;  4WBB A;  3VZO A;  2QQK A;  1ULD A;  3HNM A;  3WNP A;  4PDW C;  3MIE A;  1KFX L;  4P00 B;  4QAW A;  1MS8 A;  2RVA A;  4YVS C;  2RM2 3;  4J1X A;  4UXA A;  5HCF A;  1MEC 3;  2BRT A;  3NL1 A;  4K20 A;  4DB5 A;  1CAX A;  1RUH 3;  4TTG A;  4P9J A;  4YGC A;  5LEJ A;  1VR3 A;  3O1M A;  4P02 B;  3VZL A;  3N7K A;  1LTE A;  1IHM A;  3ILF A;  4XDQ A;  1OF4 A;  3DPR A;  4GA9 A;  4A3X A;  3J7L A;  1PGL 2;  1GNY A;  2CAV A;  1RJ8 A;  4LOT A;  4AEK A;  4QKN A;  1JBC A;  5FUN A;  1HV1 A;  2WT1 A;  1J1L A;  3ZXA C;  2WAB A;  5JR7 B;  2WS9 3;  3BB6 A;  4IGO A;  4Q1P A;  5FYZ A;  4URA A;  4IEY A;  1EV1 2;  1HJG A;  2KA3 A;  3RG0 A;  3WP5 A;  1KEX A;  3CF6 E;  2RM2 2;  4LKS A;  2CV6 A;  2JG8 A;  3C7G A;  4NN0 A;  2RS1 3;  2TEP A;  3CHX A;  5IW0 A;  1RUH 2;  3ZM8 A;  1POQ A;  1W05 A;  1H0B A;  2XBO 3;  4HXC A;  4IE5 A;  1PMH X;  1XXN A;  1GOH A;  4XFF A;  3ZLI A;  2FDJ A;  1CES A;  2JB8 A;  4GJZ A;  3USU A;  3ZSM A;  3GJB A;  3I4I A;  3K4Z A;  5E16 A;  3GNE A;  5BYN A;  2ENR A;  2WR9 A;  3NQH A;  1GNH A;  5FP4 A;  1X33 A;  2WFP A;  2WNU A;  4FQ4 A;  4MO3 M;  3RI8 A;  3PTY A;  3BTZ A;  2UWC A;  4QDR A;  2Z4F A;  3VD3 A;  3EJK A;  2VCM A;  5T3N A;  4AFC A;  1XU1 A;  4XIK A;  2C5D A;  2X5I B;  3RZK A;  3OEB A;  4FPJ A;  4JAA A;  5H9R A;  1UY2 A;  1COV 3;  4L8Q A;  2PQS A;  2W1S A;  1YYN A;  4MXW A;  2HBT A;  3K77 A;  5CKN A;  5C9A C;  1N1V A;  1VRH 3;  4HVR A;  1HN0 A;  5J09 A;  2P6H A;  1VJ2 A;  2XR4 A;  1CWP A;  3NO8 A;  4RQP A;  3VLB B;  2VVF A;  4NWW A;  1H1A A;  2QBX A;  3I7D A;  5T5P A;  3RI9 A;  4Q0S A;  4XUO A;  3U10 A;  5CFC A;  1RUJ 1;  2VQA A;  2VZP A;  2EIC A;  3AP5 A;  3OPW A;  4H2A A;  1AL2 1;  4IW3 A;  3RNS A;  1OOP C;  1D2S A;  2ET1 A;  4B4R A;  3ECQ A;  2WNU C;  3CLP A;  1SLA A;  5GZG A;  1KRI A;  4HKL A;  4P9G A;  1VBB 3;  4JCK A;  3UK9 A;  1OUR A;  4ASM B;  5IJR A;  3W5N A;  4FI9 A;  1RUO A;  4QMA A;  1COV 2;  1SCR A;  1GQG A;  3OUI A;  4CUB A;  4KBZ A;  5FZO B;  2G9F A;  1WW4 A;  3T0A A;  4B3N A;  3IPV B;  2VEC A;  3P3P A;  2HYK A;  2OZJ A;  3AP9 A;  3J8F 1;  3FBM A;  2E32 A;  2MEV 3;  3I2I A;  4CCN A;  1G9B A;  2XJQ A;  3FLT A;  5IFT A;  1BMV 2;  4XDP A;  2X05 A;  1QXP A;  2VUA A;  5FY9 A;  5BNP A;  2ADD A;  1GWL A;  1LOA A;  3USS A;  2ZEY A;  4N43 C;  3VHR A;  4OHY A;  3VBO B;  2DUQ A;  3VBR B;  4XJA A;  1BK1 A;  3FE5 A;  4JHT A;  4Y3O A;  3FFQ A;  2HWB 1;  1IS3 A;  1XE0 A;  2IWG B;  1ZVF A;  2JDU A;  4ISQ A;  4XE9 A;  5FRA A;  1FV3 A;  3DYM A;  4PI0 A;  1QGL A;  3AFG A;  1W2A X;  4DOU A;  1WA4 A;  5K8S A;  2WWJ A;  1O5L A;  2PMW B;  4WVZ A;  3CO2 A;  3PIJ A;  4JV4 A;  2B46 X;  4CU6 A;  2RS3 3;  5T5O A;  1Z78 A;  4BOW A;  5HBA A;  1FI2 A;  2VMF A;  3MID A;  1H2K A;  1K5M C;  3LOI A;  4AOC A;  1DHK B;  1ZRI A;  2ZGL A;  3BPZ A;  4JTO A;  3VZN A;  3THC A;  1DDL A;  1ZZB A;  3SXW A;  1QU0 A;  3WF2 A;  4B29 A;  4PF5 A;  1RL3 A;  1V9U 3;  3P1I A;  4M0H A;  3VHO A;  2R06 1;  5C6C A;  5EYX A;  1UY3 A;  1TQ5 A;  5KHJ A;  4S2G A;  4CE8 A;  2J1A A;  5BUV A;  1YO8 A;  3TN9 2;  2V09 A;  5DZF A;  3SC7 X;  3ZDV A;  5K9Y A;  3MFC A;  2RS5 3;  4NPL A;  4E4S A;  3PDQ A;  1BZW A;  4A7Y A;  3BGA A;  4LIT A;  1XNB A;  1XNT A;  4XJZ A;  4CDW B;  1FYU A;  1DQ5 A;  1R08 2;  1UX6 A;  3KV9 A;  3PVE A;  3VGI A;  3ZN6 A;  4COZ A;  5DAX A;  2QTW B;  1WLW A;  2XPJ A;  2W08 A;  2DUO A;  1W6N B;  1NZC A;  1W6Q B;  1EYB A;  1KS5 A;  1W6P B;  4QPW A;  3E5U A;  2Y6J A;  3IBM A;  3PVB B;  5A3M A;  1MS0 A;  2DVA A;  2JX9 A;  1WCK A;  5SV5 A;  3PLQ A;  1V9U 2;  1ND2 C;  3LFM A;  5A3U A;  1Y43 B;  3MZH A;  4RS5 B;  3H3U A;  2BBV A;  2JIG A;  3WW1 A;  5JZG B;  3JBG 1;  1HLC A;  4MVT A;  4GWM A;  1JUI A;  5B4X A;  3KCY A;  2XB6 C;  3VBU C;  2P5B A;  3WDX A;  3UYJ A;  5ABJ B;  4KGG A;  4OMC A;  2VNV A;  2WZR 2;  2XH6 A;  3LF7 A;  2QQU A;  2D98 A;  3GAL A;  3NKG A;  3EQE A;  2AZ5 A;  5FK7 A;  2QQI A;  4BK5 A;  2DDU A;  2B39 A;  3MHZ A;  3Q8A A;  2XG3 A;  4LKD A;  3ZSK A;  4CDX C;  1W03 A;  1PMI A;  4P5Y A;  5FFO C;  2BPA 2;  1PIV 1;  2CNA A;  1RUC 2;  1GQP A;  2GAU A;  3V0A A;  4QXC A;  1GNZ A;  3PNA A;  5K0U B;  4NPR A;  2AGS A;  3IDB B;  5FZC A;  4CP9 B;  1JZ5 A;  1UWW A;  3VBF B;  2D97 A;  5FMD A;  2GND A;  5C3R A;  2JIJ A;  2GH8 A;  5B2G B;  2R04 3;  1YC6 1;  5T52 A;  1U5Z A;  3M4F A;  3AL6 A;  1QJX 2;  1Y7B A;  1RXG A;  2F4L A;  2I07 B;  3K4D A;  2A6Y A;  1NCQ B;  1PO1 1;  2VTX J;  3ZYG A;  4NIA A;  5L73 A;  5C4W B;  4LLF A;  2A5Z A;  2J1S A;  3KCC A;  3AM2 A;  5FPX A;  1CAV A;  1OA4 A;  1B09 A;  1OVS A;  5GLT A;  5IUQ A;  4LA2 A;  2YXS A;  2AAC A;  3E6B A;  3AXD A;  3ZFF B;  4NWV A;  1RUI 2;  4W4Z A;  1IS5 A;  3WP3 A;  4EN7 B;  1C5H A;  1VIW B;  3VKF C;  3U0Z A;  1LJ7 A;  4CEY A;  2P3I A;  2UYA A;  4COW A;  5FJK A;  1AR7 3;  4Q4V 1;  3I59 A;  2GC3 A;  3Q9O A;  5FP3 A;  2X10 A;  3O14 A;  2VZ1 A;  4AXO A;  2R04 2;  2D5H A;  1UOB A;  2BTV C;  4CZS A;  1T6G C;  4Q4X 3;  4DIQ A;  3WNL A;  5CAZ A;  2Y6H A;  1F8V A;  4UFJ A;  1DGW A;  2WYF A;  5J1X A;  2I2S A;  2FMY A;  4FTE A;  1D4M 1;  5A7W A;  1GZW A;  4L11 A;  2VME A;  1XRU A;  1X36 A;  2RR1 3;  3LA3 A;  4FFI A;  4IV1 C;  4WM7 B;  1GSL A;  4PF1 A;  4WVM A;  2OT7 A;  5JI7 A;  5BNQ A;  1W28 A;  4MGQ A;  2OVU A;  5LBF A;  1PK6 B;  5FAX A;  4GH4 A;  2BWC A;  2P3K A;  1EV1 1;  3MI8 A;  5D2A A;  3AKS A;  5LY1 A;  2WNV A;  1D4V B;  4K7J A;  4HN1 A;  4YFW A;  5JPM B;  1AYM 2;  5F32 A;  2WYS A;  3III A;  4BZ4 A;  3HBK A;  5FZ7 A;  1W0N A;  4E27 A;  3N35 A;  1QJF A;  4MGS A;  3WD5 A;  4QQP A;  1HV0 A;  2BW8 A;  1JZ6 A;  2VBB A;  4PBO A;  5IAX A;  2SLI A;  2HWF 2;  4NRM A;  2RR1 2;  1DP0 A;  4MGZ E;  3EBR A;  3B9C A;  1VAK A;  2ADE A;  4XQW A;  2P6C A;  5FZA A;  1QQP 1;  2HBU A;  3MV1 1;  4YM2 A;  1YRZ A;  4NRO A;  2A6V A;  2XOM A;  3WDU A;  4CEW C;  2J42 A;  2QQL A;  3N9N A;  3O5S A;  5DUV A;  1QDO A;  1CN1 A;  5FOJ B;  2J1R A;  4YGB A;  1NG0 A;  3ROU A;  1SHW B;  2DVD A;  1GQH A;  5CU1 A;  5GZE A;  5HXM A;  2H6B A;  1EAH 2;  1MQT A;  4AQ6 A;  1BEV 2;  5I93 A;  2H0B A;  1Y3T A;  4LR4 A;  3W21 A;  3BU0 A;  2VW2 A;  2FDK A;  4XF9 A;  4D69 A;  1OH3 A;  4J1W A;  4A7Z A;  2BJS A;  1EPZ A;  4U2A A;  3KVA A;  4LHS A;  1QOT A;  1O3Q A;  5JXG A;  1RUD 1;  3MLK A;  2XHK A;  1NKG A;  3PIG A;  1UNB A;  2VGD A;  4I01 A;  5GJ6 A;  4W8J A;  2ZCW A;  1ZBA 2;  4ES8 A;  1W6M B;  3UGG A;  1AUY A;  2IVJ A;  2PLV 1;  1HXS 3;  3TRS B;  3CDZ B;  1OPM A;  3OPZ A;  3WR0 A;  3WXP A;  4KWU A;  4XDO A;  2DF7 A;  1AYN 2;  3ENR A;  4K40 A;  3HBZ A;  1HB3 A;  4XJ9 A;  4JDN A;  4AQT A;  2GZW A;  4UBG A;  3JD7 1;  3VBH B;  1NY7 1;  1DQ6 A;  1VBC 2;  1PGW 2;  1IQA A;  5FUI A;  1OD3 A;  1WCS A;  4Y22 B;  1NCR A;  1LOE A;  4LE3 A;  1H8T C;  1H2M A;  3BOP A;  2HWC 1;  1F4H A;  3AMP A;  2WQZ C;  3ASI A;  3J7N A;  5FXX A;  1LRH A;  4RA0 A;  1ZBE 3;  3C8X A;  2ZGO A;  4QGN A;  4DXR A;  1NYW A;  5D8A C;  3S5Q A;  4YPJ A;  4AYU A;  5J37 A;  2W94 A;  1NOV A;  4PBP A;  4QKF A;  3DEM A;  2LRO A;  2F4P A;  3SLI A;  5JOY A;  2R0F A;  3VDD C;  3POI A;  3EXU A;  4JGZ C;  4AI3 A;  2BBA A;  4K9S A;  4KWJ A;  2AEZ A;  3ILR A;  4LBO A;  1CAW B;  3GDB A;  3MV0 1;  5FY0 A;  5IAV A;  3H9A A;  4BYY A;  4G3Y C;  1AXZ A;  4Y1X A;  1H2L A;  2XJT A;  3HEI A;  5GLV A;  4AHY A;  1MZF A;  5G05 L;  3ZDS A;  3VN4 A; 
#chains in the Genus database with same CATH homology
 4XAB A;  5DAQ A;  5DAW A;  4NHM A;  3DKQ A;  4XC9 A;  4Y5T A;  5DAV A;  3OUJ A;  5LBF A;  4BQX A;  4XAA A;  2V4A A;  5EPA A;  3OUH A;  3NNL A;  2RG4 A;  5L9B A;  4XCB A;  5IAT A;  4ZON A;  2OPW A;  5C5U A;  5IAX A;  5L9V A;  4XAC A;  5LA9 A;  2FCV A;  4J25 A;  4BQW A;  2RDR A;  4NHY A;  3NNJ A;  2HBU A;  5DAX A;  2RDQ A;  3GZE A;  5ERL A;  2Y34 A;  4UWD A;  4BQY A;  4NHL A;  3GJB A;  3GJA A;  5A3U A;  2JIG A;  2FCU A;  3W21 A;  5M0T A;  4NAO A;  2G19 A;  4NHK A;  5LBC A;  3MGU A;  3KT1 A;  5LAS A;  4MHR A;  3W20 A;  5DAP A;  3OBZ A;  5LBE A;  2RDN A;  2HBT A;  2A1X A;  5C5T A;  3BVC A;  2FCT A;  3EMR A;  2RDS A;  5LAT A;  4Q5O A;  4ZPI A;  5HV4 A;  4IW3 A;  2JIJ A;  2G1M A;  3ITQ A;  2Y33 A;  3HQR A;  5HV0 A;  3KT7 A;  5LBB A;  5EP9 A;  3HQU A;  4JZR A;  4NHX A;  3OUI A;  3PL0 A;  3NNF A;  4Y5S A;  4KBZ A;  4MHU A;  5EQU A;  3KT4 A;  5LB6 A;  3NNM A;  4XCA A;  5IAV A;  5L9R A;  4NMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...