3OUIA

Phd2-r717 with 40787422
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
190
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 56
structure length 190
sequence length 204
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouiA00
4Y5TA 5L9VA 2RG4A 5LBCA 5IATA 3KT1A 3MGUA 5LBEA 3NNMA 5HV4A 5EQUA 2RDSA 5DAPA 4NHXA 2Y34A 3KT7A 5LATA 3EMRA 4J25A 2G19A 2RDNA 2OPWA 2FCUA 3GZEA 5EPAA 3OBZA 5C5UA 4XC9A 3W20A 3BVCA 2Y33A 5ERLA 4BQXA 4KBZA 4JZRA 2FCVA 5A3UA 5IAVA 3GJBA 3OUIA 4XCAA 3OUJA 2HBUA 5DAQA 2G1MA 5IAXA 5L9RA 4BQYA 3HQRA 5L9BA 5DAVA 4NMIA 2HBTA 3PL0A 4ZONA 5LBFA 3NNLA 3GJAA 5DAXA 5LBBA 4Q5OA 4UWDA 4XABA 2RDRA 2RDQA 5DAWA 2FCTA 5LA9A 5M0TA 5HV0A 4XAAA 4NHYA 4ZPIA 4NAOA 4IW3A 3OUHA 4MHRA 3NNJA 2JIJA 4MHUA 4Y5SA 3HQUA 3KT4A 5LB6A 4NHKA 4XACA 4NHLA 5LASA 4XCBA 3NNFA 3ITQA 3W21A 4BQWA 2A1XA 2JIGA 2V4AA 4NHMA 3DKQA 5C5TA 5EP9A
chains in the Genus database with same CATH superfamily
3HJRA 4LKFA 1D2QA 1J1TA 4PHZA 1ULGA 1YFXA 1U5YA 1Q8OA 2XBO1 3J4UH 3HMYA 3PTYA 4GB33 3ZFGA 5C7GA 1H0BA 4QM9A 4ZU5A 3T0AA 4DRVA 1NA1C 1U5XA 4QX5A 3UYJA 5FXWA 2YYOA 3MO4A 2RMU3 3NSTA 3KT7A 5IYYA 3PIJA 4Y3OA 2Y64A 3LPGA 4DY5A 1J59A 2NM1A 2W9XA 3A22A 1DYOA 2GMEA 5LA0A 3TNQA 1L7QA 2P4EA 2BNMA 2P3YA 2J1VA 1UZ0A 3BTXA 1RUH3 4MV2A 4C90A 1WMEA 4ZXKA 3HNBM 3ZN6A 4IV3C 5FJKA 3AKRA 2RS31 2KXLA 1QJX1 4P9WA 4KWKA 3RDIA 4AVTA 2RM22 4MGQA 1GP6A 1X33A 2B9VA 2ENRA 4CCJA 2TEPA 3D0SA 3V0AA 4N7IA 2XOMA 4A45A 3LA7A 2EA7A 1TQ5A 5DG1A 4NPRA 1RMU3 2C0ZA 3KHBA 1VBD1 5FZGA 5EIYB 3FL7A 1G7YA 2Y60A 2ZBJA 3FUOA 1V9U1 2Q1MA 4IE0A 2YFUA 1AR73 1SLIA 1NLQA 3J8F3 4JQRA 3WUCA 4UI9L 4DEQA 4U36A 5J7MA 4LK7A 1UW8A 5DPNA 2NYYA 4E2QA 3DYPA 4L11A 1KFXL 5CYYA 4EN9B 1V6OA 3NWKA 4CCCA 5BYNA 3C7OA 2QUOA 3GJAA 1YJKA 4YW4A 1ODNA 4DUVA 3VZNA 2Y38A 4HN0A 5DDJ3 1W0OA 3WY6A 2ZEWA 3POJA 4IV1C 2PAMA 2GC2A 1HRV3 3VDBA 1DZRA 4DXRA 2WWJA 4DNYA 1TE1B 2WFF2 2WZEA 3GCWA 3URFA 4CZSA 3THTA 5IUQA 2BGPA 1MQTB 3ES4A 1RVF1 2A3XA 4GMP3 3IN9A 3LEKA 1ULOA 2DVAA 3ZIWA 5FY4A 1XPWA 3GYDA 4B29A 1X9PA 4M01A 4UF0B 5FPZA 2ET1A 5F7UA 3JD73 2W94A 3S5AA 2D6KA 4FAGA 4IEWA 1W2TA 2GZWA 2JDZA 1AR83 1DQ5A 2ZKNA 3BPSA 1BK1A 4HVOA 5AC91 3OJBA 1PK6A 1A8DA 5IVEA 1AX2A 4V2WA 1REEA 3VDAA 1V00A 5LZ6A 1AUYA 2WR9A 2JIJA 5A3LA 3KB5A 3SNMA 1N3OA 5LASA 3R4SA 1J1LA 1W8NA 2D40A 4XJAA 5EJZB 5FY9A 1GOHA 1VBC1 1QGLA 3WG4A 4HT1T 4QHBA 1UQXA 3KCCA 4HPKB 1U5ZA 4OI4A 3ZN4A 4GIQA 3SCHA 1OC1A 2O1QA 3MPBA 1ENQA 3HIFA 4RSUA 1C5IA 3R0RA 3H50A 3S6PA 2JICA 3TN92 4COWA 1GP5A 5HPOA 4Y1VA 4WVWA 4TSVA 2I74A 1AXZA 3MBWA 4RGKA 5L9VA 3GBWA 1PZ9A 1PMIA 2MEV2 4P9YA 4YG0A 3THDA 1TZOA 4AHWA 4UFKA 2XLGA 5IK5A 4D6SA 2WZ8A 1SHWB 1HN1A 2VULA 1AYM2 1ULFA 5J3UA 2JEMA 4AVVA 4AI2A 2P3IA 1RUG3 1W9FA 5C3QA 1QJFA 3J9SA 4ARYA 4HG6B 1HRI1 3LGRA 4QX0A 1LAJA 2Q8OA 4K21A 2UY8A 3ZXEA 5H9PA 4AG4A 4M0HA 1GQPA 1XJAA 2XWBB 5FZFA 1O8SA 4IEVA 3I97A 2W2IA 3U4SA 4JGYB 4C1WA 1NOVA 3HOBA 4EZ4A 1XE7A 4A7KA 4AHXA 2WLQA 3MZHA 2H6BA 4LKEA 4OHYA 4AAPA 3JB8A 3AYEA 3NKGA 4Y20A 5LEKA 5C6CA 1LOAA 2X05A 1DDLA 2Q8EA 1POV3 3KVBA 4L99A 4XJ8A 4AW7A 2D43A 1FPN3 4TN7A 5F6KA 1DCSA 1UZVA 4COUA 3JUUA 2DVDA 1UZZA 5GZGA 1UNBA 1UOFA 3BIEA 4CTEA 4OMCA 3ZYPA 3C7FA 1AF9A 4OHWA 5K0UA 1BBT2 3POYA 5FTTC 3LE0A 2WAOA 4LNVA 4A3ZA 4YARA 3ZFEB 2VGDA 3WQ1A 3NW4A 1A78A 4UBGA 4IESA 5D21A 3F95A 2DBIA 4YZ3A 1UYPA 4MGTA 2Z5WA 4J1XA 4MOAA 4BWOA 1AR63 4ZONA 1N1VA 5KHJA 4LT5A 1OA2A 2EXKA 5F1RA 1C3HA 1D0HA 4UBHA 5D8AB 4CP1A 3UKNA 1WCSA 1RXGA 4RR3B 3VZMA 2QQUA 4BXFA 4DO0A 1VMHA 2JDKA 3I2DA 4KL1A 5FZOA 5F37A 3E97A 3LF7A 2VZPA 3GNEA 3W9AA 3I4IA 1DQ6A 1S55A 5FZIA 4OVEA 1AR93 2XJRA 5ANQA 5FYZA 5CFCA 1X8MA 1QXJA 3PHMA 4LKSA 4CUCA 4RQPB 2PFWA 3LSDA 2RDRA 1OLRA 1DGLA 4XPVA 4LO4B 3HAGA 3MW2A 5JUVA 3RYPA 5FMDA 1YQ8A 4RGGA 1RUC3 5LW9A 2WQ8A 2VBBA 3Q9OA 3VBOB 2XJTA 4XJ9A 4N43B 1OLMA 1S0JA 1UU4A 4CDQC 1D0GA 2E51A 2CSGA 2IFRA 4XVHA 2D6NA 3UGFA 3O1SA 1SACA 2OW4A 1SFNA 3WDVA 2RS11 3ZIXA 1UXZA 3M7AA 1AL21 4E9KA 5CKQA 1COV1 3OGVA 1XC6A 4FP3A 3I7DA 1RITA 5JIAA 2A71A 3AZVA 1UN1A 3PUHA 4LXLA 4BQWA 1WW5A 3ZYIB 4D6RA 2BV4A 1JYIA 1GZTA 4GAZA 4Q1RA 4A7ZA 2VR4A 3KV9A 3K75B 2IXIA 2GH2A 1KEXA 4QD2A 5TSWA 4JKKA 5C9AC 1AYN1 1ZA4A 5JZGC 1A34A 1POQA 5C5TA 4Q4V3 3V56A 1OMIA 5IVJA 5H9RA 3RZJA 1G6NA 2J42A 3CJIC 3ZPOA 4CEWA 4CDXB 4EQVA 1V6KA 5A1AA 5BNPC 1IPKA 2F17A 1OFSA 1NX9A 2WNUB 1NG0A 2QJVA 1O91A 1OHFA 3B94A 5HI0A 5IFPA 2PAKA 3A4UA 3PUQA 5JI7A 4ZZ5A 1OD5A 4LIVA 1K5MC 4LLFA 3LA3A 5FKCA 3VBHB 3ZYGA 4KG8A 4N53C 1UZWA 3EMRA 4Q1PA 2WNVC 1TG7A 4PQ9A 1RMU1 3D82A 4XZPA 4QQ2A 4CCLA 4Y26A 2VY0A 2LTNA 5CISA 4G4FA 3AKPA 3WF0A 4WM7A 2FCUA 3GZEA 3J8F1 1F9KA 2W3JA 4GWJA 1JMUB 4UFLA 3V65A 1UAIA 2KD7A 2OS2A 3E5XA 1PIV3 4L92A 5FCCA 4F8AA 2GMMA 3KF5A 4M3CE 4Q0VA 1Q56A 3OPWA 3VDCA 4IEZA 1GWLA 2VZTA 5AFEA 3HVDA 4BQXA 4G3YC 5FREA 1YQ6A 4LITA 5FP3A 1VP6A 3KQRA 4EZHA 3AMPA 4JGZA 4YGDA 4JHTA 4Q0QA 2ZGOA 1CN1A 4QKNA 3PMSA 1LR5A 1HRV1 4XCAA 3BN6A 1C57A 1OF4A 1UY2A 3FZ3A 4FT8A 1CX4A 2YBSA 4B4PA 3I2KA 2BRTA 2WABA 3SCGA 5KHKA 2VCMA 4OQ9A 4AI0A 3EB7A 4KMQA 5DMYA 1MVEA 4JTOA 1BXHA 4QXKA 1Z78A 4MO3M 3UJOA 4D8MA 2OKXA 2H6CA 4QXCA 2XJUA 3N9MA 2XLFA 1UL9A 3PL0A 1YQ5A 2XKOA 2YUEA 3HBZA 3JD71 4NMIA 4Q0SA 5LBFA 4Q4Y3 4H3WA 3ZSEA 5C8CA 2P5BA 2NQYA 4KWUA 2ORZA 3WZ1A 4OI0A 2BFUS 1AR81 3K4ZA 3LEIA 2PLV2 4AWDA 5BNNB 1JZ6A 1GANA 2VZUA 5ABJB 1UKRA 3T4HB 3I3EA 5T5LA 2ZX0A 5FZKA 3ZXAC 4W50A 5GM0A 3D4KA 2WFF1 4QPGA 3WF2A 2W1SA 1MEC2 2W47A 4QPIC 1ZM1A 3ZDSA 3ZYHA 4EWEA 1YO8A 4E2SA 4YZ1A 3K2OA 3EHKA 2BDRA 1ENSA 2FCTA 5FP7A 4Q2FA 2WNEA 1DF0A 4AQ2A 4UW3A 3CIHA 1JUHA 1ZVFA 3H8XA 4W8JA 1AL0G 4LBJA 4ZS3A 2NLRA 1JZ5A 1QOOA 3TRSB 4BLIA 2VH9A 1SBDA 3B00A 4I0BA 4Y24A 4IETA 4XDPA 5LRSA 1H1AA 2IVJA 3ZFFC 1P8JA 2NN8A 2OQ7A 2WYFA 3ABZA 4XOGA 5FZLA 5SV8A 3A0NA 1VBE2 1ULPA 3DCQA 3WDTA 5IK8A 1IG3A 1DIWA 2XJQA 3WLUA 4AEKA 2ZGUA 1X82A 3PJQA 4IE6A 3NRUA 2JE9A 4ET7A 3S5QA 2RHPA 1RUE3 4OHZA 2G9ZA 3U10A 1R093 1DLCA 3B93A 3JBG2 3TNPB 5CG9A 3ITQA 1GQGA 1CAVB 4W6XA 1RUG1 4XF9A 2BERA 3SLIA 3IT8A 4CEYC 4CDUA 5FP8A 1IQAA 1XOYA 2P2KA 1WGPA 3VBRB 3VDDC 3I59B 1S0EA 4V2VA 2C9AA 3OY8B 2E6VA 3RJRA 1JZ2A 3CLPA 3U0ZA 1EPZA 1RTVA 1LHUA 2DCJA 3UJQA 3VN4A 2MEV1 4XDQA 3FBMA 5LBCA 1O8PA 2PHLA 4NWWA 3SISA 3POSA 1S0FA 2ZEYA 5HCBA 2B5HA 2XXZA 4LA2A 1XYPA 1OA4A 1U5IA 2QVSB 3C2UA 4MGZE 2OT7A 4RS5A 5A3TA 3RZKA 4W6WA 4YZ4A 5FWEA 2Z69A 4CVUA 5BV6A 4Z07A 4AOCA 3PUSA 2W0XA 1MPXA 5C4WB 4MVTA 1HQLA 4NPMA 4I2OA 2CAVA 1XBFA 4LBQD 1HN0A 3R4UA 4R9CA 3LAGA 4RA0A 4AQ6A 5IT6A 4S2GA 5C70A 3N4MA 3M3EA 5C8WA 4JZRA 2FCVA 1OVPA 4IGPA 3A21A 4WM8B 4XQDA 3NQHA 1W8WA 3JQXA 4LBQA 1QDCA 3JQWA 1OD3A 2Y6GA 3LCPA 2NP0A 2Q8CA 2ZACA 2GU9A 2GP5A 1SLAA 3ALQA 3O5SA 3U1XA 3CEWA 2DTWA 4P08A 1W05A 1KDKA 1BBT1 3P1IA 4M0NA 4PDWA 4UFMA 3U75A 3I8TA 2Y0OA 5FIXA 1H4HA 4OHXA 4HMZA 5CFDB 5FUPA 4GH4A 1OUXA 1JODA 1XYOA 4I3GA 2BW8A 2DVGA 1AX1A 4XBLA 2BU9A 4QAWA 4NIIA 2VXRA 3VGIA 3SKVA 4AI3A 4FPKA 5F5QA 1VE0A 2JD9A 3BKZA 1A6CA 4Q29A 1S4CA 4QX1A 2BYVE 2DUOA 2XBO3 5FYCA 5C33A 1IOAA 1BCXA 3MW4A 4RHV3 4Y1ZA 4PIYA 4IL7A 4XEZA 1SMVA 2EXJA 2BNNA 2GNMA 1W2UA 4XFCA 1OUSA 5JWPA 2FQPA 2JX9A 2YGLA 5L7OB 3RYKA 4UWDA 2V4VA 4FOWA 4AGRA 2X29A 4Y4RA 1YCIA 4QDQA 1RIRA 5FZ4A 3D3AA 1FV3A 1LRHA 4MZUA 4NE9A 4YVSB 2O8QA 4LK6A 4P9GA 4K20A 1KDMA 3OGJA 5FXZA 1QJEA 1QQP2 1YFYA 2HWE3 1NKGA 1QJX3 1RHI2 2AEYA 1PX3A 3ZO0B 4RD7A 2EIEA 5JAXA 3ZXLA 4E8DA 1NYWA 3AJZA 2VUJA 3AMQA 1JHJA 1IS6A 3MI8A 4UFHA 1REFA 4XAAA 1KGYA 5J36A 1AHSA 3U78A 1JOBA 4NIAA 1NCRB 3O1OA 2N7GA 3AM2A 3H1MA 2W1QA 2JG9C 1GP4A 3RJ2X 2HJIA 4MLOA 1JTZX 2ZKLA 3IKWA 4MGSA 1V9U3 2KA3A 4UXAA 4N8MA 2XGXA 2VAUA 3ACIA 2PHWA 2ZOEB 5FZ9A 1EYBA 1QIQA 3TAYA 3PVEA 1L7RA 3POFA 4I02A 2GP3A 3V0BB 3ZOIA 3HEIA 3RZGA 3LSEA 4H7MA 4YRDA 3ZSMA 3VD9A 2C9KA 2ZZJA 3N9OA 2BWCA 1PIV1 5EP9A 3R6SA 3LIGA 3VBUA 4A4AA 1ZBE2 4KGQA 1CX1A 4RN5A 1PZ7A 1J83A 1PM4A 3KVAA 3A7QA 4IEQA 4E27A 5JSRA 3KCXA 1NA1A 2A5ZA 4YVWB 3C7GA 2O0OA 1PO22 1I5PA 2G4IA 3O1MA 3BU0A 4AEDB 4CP9B 1VAVA 1DGRN 2D98A 3G6JB 3S57A 3O0WA 4YWAA 2EIDA 1RVF3 2ZGMA 4FAHA 4X6RB 3MLLA 4N90A 4AI9A 2WAAA 5AVPA 3VD4A 1KRIA 4IV3A 4RFRB 1UIJA 2EVXA 3NAPC 5FYYA 1LODA 3W5NA 3MIGA 3POBA 2K9ZA 5FYVA 1FOD2 1NE6A 1NY72 2CYFA 3MIFA 3NV1A 2C26A 3WCRA 1GNHA 3DPRC 1H2LA 3NO8A 5AC93 3ACGA 1B35C 2E7AA 2JDPA 4AI8A 1W6MA 1W2OA 4Q4Y1 5A6YA 5D8AC 3T1MA 3O1RA 3GHMA 4K8RB 1G9CA 3RQ0A 3VBFC 1IG0A 3AFKA 2EAKA 4CCEA 2DCZA 1VBC3 4KQ7A 2I45A 1W90A 1VALA 3AKQA 2MNGA 1H9PA 4XFIA 3K3NA 1W39A 2ZX4A 5L9RA 1HV0A 2KR2A 3TEWA 4CPBD 5CNAA 5EYYA 5A33A 4XIOA 5L9BA 4XURA 1SBEA 1SLBA 3FN9A 3J7HA 4JKMA 1AXKA 3VZLA 4IV1A 2PLV1 4Q4X2 5LBBA 3WHTA 5KBFA 2J7MA 3WOGA 2XJPA 4NIDA 4FOQA 4BISA 1OA3A 3PVBB 5FZ3A 2NZ9A 1HJGA 2A73B 4K3UA 1N1SA 4XIKA 4C91A 5BY5A 1MEC1 3PTRB 4K7JA 4AI1A 1UMIA 5FOBB 2ZGSA 3IDAA 5FLJA 4E4ZA 5GLZA 1Y43B 1JU3A 1R091 2QKDA 1BEV3 5BUVA 2RS52 2IXCA 2BBAA 2R043 4JAAA 1KD7A 3USSA 4H2AA 4ZU7A 3IB3A 1I6XA 1K45A 1NCQB 3S30A 1W6PB 4HBNA 4Q4W2 2JE7A 4WBBA 3DF0A 5IVYA 3RMYA 2WS92 1JUIA 1UU6A 2ADEA 1LECA 5FY1A 4NHYA 1XYNA 2W52A 2X5IB 3KLSA 4ASLA 4LJHA 2O14A 3DPRB 1FMD3 1NE4A 1QMJA 4ZS2A 5FMBA 2RV9A 4IEOA 3NNJA 5FQ0B 3H9AA 1XSQA 5LB6A 2XL7A 2DWRA 5FPVA 1OQDA 3JBG1 1H1MA 1G86A 3IMMA 4LUKA 1SG3A 3DYMA 3W21A 2VQ0A 1GWMA 1WCKA 2P3KA 4QQLA 4CU6A 4DZGA 4LHKA 1UU5A 2LM3A 2R0HA 4KNCA 3PNAA 1QNWA 5FJHA 1HXS3 3GM8A 1XE0A 1VRH2 5LA2A 3WNKA 1NAEA 1WW6A 1QOTA 4LIUA 2AH2A 3LWCA 5GJ6A 2PHRA 3HR9A 4CU9A 2VMCA 3GBFA 1LOGA 5DUUA 1JZ3A 3AL5A 4DS0A 4QQPA 3WW3A 2CNAA 2DU0A 4HKWA 1YLLA 2XONA 1GZWA 3FBYA 4HL0A 4IEYA 3QH6A 4QKFA 4QXHA 5F3CA 4A44A 4B3NA 4I0AA 2A75A 4M4RA 4NN0A 5IWFA 1OOPB 3KZ4C 4EN6B 5B4NA 2HWB3 5FZ6A 1AJOA 3AVRA 4QHZA 1ASJ2 1DZTA 1VRH3 1CJPA 2DCYA 3DEMA 3OPZA 4BYYA 2ETEA 2F4PA 2QQOA 4DOUA 2EXHA 3N7JA 4EN7B 3SH3A 2WWUA 4MH0E 3AB0A 1JYCA 4Y22A 1LEDA 4JCKA 1RB8G 1UX7A 1RUI3 3M3CA 1H6YA 5J1XA 2BNOA 3LDRA 1ULEA 3Q8FA 5IAVA 3MIDA 4RHV1 4XETA 4A41A 4QKBA 3U37A 2RS13 4M00A 4PI0A 1AL23 1ST8A 4CU8A 1MQTC 1COV3 5FY7A 2Q5TA 2Y8KA 3KD4A 1VIWB 3JU9A 1PM7A 2LROA 2XHKA 3AYAA 4LBKA 3RYRA 1W6QB 3CMGA 4QGLA 3FFZA 4G9SB 3JB4C 4BK5A 1RJ8A 3VD3A 3FFQA 4P9XA 4B4QA 4CSWA 1AYN3 1J3PA 1EUUA 3M2MA 4FPCA 2HWE1 1CAWA 3E5QA 4EE2A 1OKOA 1N3PA 3O7OA 3PIGA 3NJVA 4LE3A 3UETA 3P3PA 2Y0IA 2XVGA 4LHLA 5BNOB 2NMOA 2UY9A 4Z82A 5L19A 3PURA 5EYXA 1YI7A 1YWKA 4BQ2A 5FOJB 4XABA 3ECQA 5T5PA 4NJ4A 5J96B 3I2HA 1Q8QA 2X53S 1MS4A 4LORA 1OXCA 1MVQA 3AKSA 1CGPA 2D6PA 4QXBA 2JKXA 3TEYA 2VW2A 4DINB 3AL6A 3ZYRA 1NLSA 1QQP1 2XL9A 4CDQA 4CE8A 5IW0A 4BQ3A 1ND2B 2A6XA 4FSJA 3J7LA 5LA1A 3WV6A 1H6XA 1GV9A 2D3RA 4A42A 2RM23 2HLEA 3AP7A 3LD8A 1QNYA 5CU1A 5A1LA 4I09A 4UW6A 1O6UA 4XFBA 4MXWA 3KGZA 1OF3A 2UWBA 1ULCA 2BTVC 2IWGB 2ZX1A 3CHXA 1ZYBA 3E6BA 3EO6A 3OUHA 4XQ4A 5KXCA 2JJ6A 2IUWA 3CJXA 2XHNA 4NHKA 4BMEA 1EUTA 3NV3A 5T5JA 3DKWA 3AZWA 2O8OA 4XCBA 1KS4A 3UESA 4D7SA 1JOPA 4FI9A 4JGYC 2YBPA 2P6CA 5C9AA 2DURA 5JZGA 2BP6A 2B8MA 2FDHA 4LULA 3KWVA 1Q3EA 4M3CA 2WRAA 4UYBA 2WSUA 2OYZA 1ZBE1 2ORXA 3CJIA 3O0XA 5BNPA 2PQQA 4XZUG 2VW0A 2VBPA 2NMNA 4Q26A 4QKDA 4ONUA 4PIXA 5A32B 4EN8B 4AK3A 2JDUA 1PO21 2R30A 3MGUA 1W8FA 3SEPA 1K5MA 3ILFA 2GNTA 5EQUA 1UD1A 5FFOC 2BVVA 2ZHMA 1NLRA 2WFF3 3N9QA 4N53A 4CYDA 2WNVA 5LATA 2GH8A 5FZAA 4Y1XA 3ZFEC 4IERA 2ZEZA 2ZJCA 1G9FA 1V6JA 3POEA 2BUKA 3N35A 4QB1A 3TEXA 3USUB 2WDBA 1US3A 2JDHA 4LLOA 2WKKA 5FWJA 4KWJA 2ZAHA 3HPNA 1FOD1 4GJYA 1NY71 4H55A 4HKLA 3IAPA 1QXPA 1W6OB 1XNCA 2VBDA 1UYYA 2Y33A 3K3OA 4NR1A 4RR3C 1O5UA 5EZWA 2MPFA 2WJSA 4XUNA 1W2NA 4LHSA 5LEJA 1ND3B 2OXBA 3OGRA 4TYSA 4UFIA 4TXWA 4ZU4A 2FDKA 5K8SA 2R1DA 2ZMLA 5E16A 1JS9A 2JG8B 3WR0A 3CZJA 3W5MA 2RR12 3OEAA 2PHTA 2ZGRA 1CAUA 1O3QA 4RQPC 5A70A 1NQJA 1PVC2 2AENA 1RUJ2 1DQ1A 1XQNA 1WCUA 3FMGA 2PXJA 4QWNA 1V6NA 3N9NA 4S2FA 3VBOC 1WLWA 1QEXA 1BEV1 4N43C 4X8NA 2R041 3O12A 3M3OA 5A7WB 4L2NA 3E5UA 4FPOB 1CIYA 4KI5M 2VUCA 2LUWA 4R9DA 4A6OA 3TN93 5JXJA 5A6ZA 2D97A 4P5HA 1GUIA 2FBEA 5DAVA 4PLNA 2IXLA 3AZYA 4YGCA 3ZSJA 2XLAA 2VL4A 1DGWA 1HIXA 2AYHA 4P5YA 3ZX7A 2MEV3 1UKGA 4QQOA 2GAUA 4OZXA 4Q4X1 5A80A 2CV6A 1ZRIA 4HLTA 4GKYA 1RXFA 2DUQA 3GZAA 1AYM3 4QPIA 1FMD1 3GGLA 3HQXA 1AXYA 4LQRA 4XMIA 1HQWA 1RINA 1TNFA 3H3ZA 2Q30A 3T1LA 5T5OA 1CAXB 2HEYF 4PIZA 2R062 4WVMB 1Q8VA 1JZ4A 4UOJA 4P9IA 3RSJA 4P14A 4RL7A 4E4DX 1H8TB 2QBXA 4OCTA 1HV1A 4XXAA 3H8UA 5GLUA 4CDXC 1HXS1 3I54A 4XJUA 2WS91 3ZFFA 2WNUC 1ACCA 3N36A 1HQNA 4MG2A 1XNBA 1CPNA 4Q8LA 4DUWA 5JR7B 2OUHA 1VBA2 2XH6A 3VBHC 4BLJA 2ZGQA 4DEVA 2R16A 2X10A 5BNQA 4PCRA 3AX4A 4ISQA 1TEIA 4HANA 1TMF2 1LESA 3D6EA 3EXUA 3N9LA 4HOOA 4LOTA 4XF4A 5EV7A 1F8VA 4NAMA 4XACA 3OOXA 4GULA 4XAEA 2QDRA 2WL1A 5ACA2 2ET7A 1BBT3 2GALA 3CZUA 4CEYA 4R9AA 2RVAA 4OFGA 1W8HA 3ETQA 3ZSKA 2HWB1 4B1LA 2XMLA 3T08A 4BHPA 2HWF2 1LULA 2IZWA 2VVFA 1PX4A 1IKQA 1VRH1 1JH5A 2E33A 3VDDA 2W1UA 1SFYA 1E5SA 5KHIA 4HONA 2VQAA 1RUI1 1Z0HA 4FQ4A 4NRMA 1Y9GA 4GMP0 1H2KA 3P5BA 3PJYA 5IATA 3MYXA 4K40A 4AFCA 5HV4A 1PGW2 1V6LA 4S2HA 4RGAA 3U07A 2Y34A 1SPPB 3ZXFA 4IQPA 4JRLA 2GC3A 3M3QA 3OYWA 3VZOA 1W9WA 2G19A 3CKHA 1O3RA 4BPZA 2FMYA 1ASJ1 1CQ9A 2VTXJ 2CTVA 4TWTA 2C5DA 2EIBA 1UXXX 4QX7A 1FNZA 2ZX2A 2Y6LA 4YGBA 1GLHA 1QF3A 3FJSA 1IS5A 1D2SA 3KSCA 5CKMA 5BNNC 1IPJA 2AUYA 5CEHA 2BEOA 1SLLA 2QQJA 5ABJC 3VKMA 4HK9A 2VOTA 5H9QA 1H4GA 1UY3A 3J7NA 1MZ5A 2V09A 3DYOA 3LDKA 5I8SA 4YSFA 5DN2A 4SLIA 4HXCA 1ZRFA 3MF9A 3UL2A 1IHMA 4R9BA 1N1YA 2CDOA 3ZFGB 2OZ6A 4LBOA 4X6QB 3UKTA 4CXYA 1PO12 1LHWA 1Y3TA 1GMMA 2YPJA 3BALA 2ZGTA 3AZZA 3WF3A 3ST7A 1OURA 4CCMA 4YVWA 1GWKA 4PJYA 2HEWF 2WZPP 2VOVA 2XJVA 1EPWA 1UYZA 4HSJA 5JCTA 1O3TA 3SC7X 2CGPA 3ZN6B 1V0AA 2RM21 2CAUA 3B7MA 2WO2A 4ITCA 2CL2A 4DXTA 3DL3A 3ZKUA 4XYXA 5I0UA 4PBPA 2CY6A 3B01A 4MGKE 4LR4A 1OQ1A 2WINB 1QJY2 2JD4A 3H7YA 3MUY1 2DVBA 4FOYA 3V0AB 1ZBA2 2X09A 4AVCA 4ZKTB 3VKLA 4KWLA 3AYCA 5ANNA 4HVRA 1J84A 4AQTA 1WCQA 1WUVA 4P02B 3VBRC 3WG1A 4COVA 1POV0 4BZ4A 5M0TA 1FAYA 4H14A 2Y26A 3PUIA 1CESA 2Z79A 2WWSA 3OB8A 2K46A 1Y9MA 3BU7A 3MEPA 5A1FA 2XUMA 4DIQA 4Z8BA 2XWJB 2YHJA 3AVSA 3FUQA 3THPA 4Q0UA 3SHRA 1L7LA 5A7SA 4QX8A 2HWD2 4ZPIA 3UNPA 2FDFA 2JG9A 4LKDA 2YC2A 2PHUA 2Q0AA 2A6WA 4YNIA 1ZBA3 3ZXJA 3QD6A 2VMFA 1Q8SA 2ZXQA 3T2PA 4CCDA 3QH7A 1QU0A 4OQ8A 2PTMA 3PVOA 2E7TA 4GALA 3NNFA 3AXEA 5C4WC 2W46A 4GWNA 1DGWX 3POIA 4OHVA 1YJLA 1ZZ7A 1I9RA 1JBCA 1JI6A 2GDFA 3O1PA 3IDBB 1Q43A 4I0WB 3ZM8A 5JOXA 5FMOL 2XPJA 2B42B 4IGOA 5FMCA 3IAQA 1JZ7A 5FYTA 1N3QA 2GN3A 2Y6FA 3W59A 4QHOA 2W5FA 4C8DA 5CAZA 4WM8C 3HWJA 2DVFA 4LBMA 4YFZA 1WA6X 2PLV3 2UWAA 4P9JA 3VLBB 1S2EA 2PHXA 5C3SA 2JB8A 2VQTA 1ZNPA 4AE2A 2H0VA 1MEC3 3LPFA 5E6HA 5LY1A 1CPMA 3IPVA 1PK6B 1RUNA 1XU2A 1YUDA 2YC4A 5CFDC 1J58A 2RDNA 2ZCWA 4DFSA 2ZX3A 4MX3A 3NAPA 3OSDA 3NNGA 5CG8A 3OBZA 1O4YA 2UURA 2PA7A 5HCAA 1V6IA 3BI3A 4AFBA 3B9IA 1XNKA 3LQCA 3APBA 3DPRA 3FX3A 3TN91 1ZX5A 2OQ6A 4PLOA 3TBDA 2YROA 1B35A 4QMAA 1VBE3 4DXZA 1KXGA 5L7OC 1W9TA 3MIEA 2C1FA 1Z7S2 1QDOA 2YB7A 4TLGA 2ZGLA 3GJBA 2RR11 4YG6A 3VBFA 3LA2A 1N1TA 5DZGA 1EV12 1PVC1 1AYM1 4UW4A 4XBQA 3TYJA 1RUJ1 4YVSC 1QY4A 3JBG3 3B3QE 5I91A 3LKJA 2ZHNA 1HW5A 4BJ0A 1AZDA 1R1ZA 1G8WA 3M8LA 2HWC2 1UMZA 4YM1A 1W28A 4I01A 5I0DA 3OPTA 5GZDA 1JHNA 3WVJA 1R082 4GXLA 2GNBA 3IDCB 4XE9A 1K3IA 4R8HA 4TTGA 3NVCA 1OPOA 1SDDB 3FLTA 4XFGA 4AEJA 1W8ZA 4XFAA 4XHXA 4LBLA 1WBFA 5FUIA 1JYNA 1NCRC 1HB4A 1NQDA 4B7KA 3B9CA 1OOPA 3WG2A 3HBKA 5JOZA 1H9WA 1DYKA 4YW5A 5LWBA 4Y4YA 1W6NB 2P37A 2VZSA 3FHAA 4Q5OA 1ZRCA 2OVUA 4Y20B 3UGGA 3N7MA 5F3IA 3MIBA 1F31A 4BA6A 2P1BA 3ON7A 5JXHA 3AMNA 5JLVA 3Q8EA 3RWNA 2HEVF 2R061 1UOBA 2FD8A 1SCSA 3PDQA 3E1F1 1AVBA 1UIKA 1UF2C 4L0PA 1KFUL 4LMFA 3AYDA 5K0UB 3LFIA 3VKOA 1OH4A 4YVWC 2WBKA 1HX6A 2YMZA 2CHHA 1VBA1 3VBSB 3S0MA 1S0DA 1YFWA 1QXRA 4AEDC 1V70A 2CWMA 4NAOA 1WWYA 1XNAA 3ZR5A 1YIFA 4A2UA 4BXSV 3ORJA 5CVRA 4Y5SA 1RGSA 3HT2A 5JOYA 5FZBA 4GKXA 3C8XA 2VU9A 5ACA1 4N7UA 5FZOB 4D69A 3CQOA 2TBVA 4JKLA 2ZZQA 1NXMA 4K8FA 3BODA 2WO7A 4FFIA 4P9LA 4QX3A 3VUOA 4HETA 1JYWA 3O1VA 2DDUA 1HJFA 2V73A 5CFCB 5BPXA 2Z4FA 2WC2A 2RS32 3BTAA 3L2YA 1PGL2 1O4TA 4X8PA 4AFMA 4F3JA 1WW4A 2ZS6B 4DMIA 5FZDA 2UYBA 5FDBA 3RZZA 5A6QA 5EXOA 3WD5A 2SLIA 5FY5A 1X9TA 4EN0A 1YXWA 1UPIA 4YW2A 1UOJA 2Z2SB 5F9TA 5KC6A 4AXOA 1ENRA 1GNYA 3KF3A 1US2A 5FPBA 5G05L 4GWIA 4BH9A 2GC0A 1VBD2 2XVKA 3DECA 4AL9A 4AFDA 3ZN5A 4BB3A 3DXTA 5KXBA 4AF9A 2YV8A 5D2AA 4C0BA 4CCOA 5T50A 4KU7A 4PT6A 4DUXA 1D4M2 1KS5A 2RJKA 3LFMA 3VHNA 4OUMA 3I3MA 1QQP3 2VOKA 1RHI3 4W6YA 4ZY9A 1URXA 2ZGKA 3LB9A 2ERFA 2VE1A 3RI9A 4XMAA 2J1RA 4ISRA 3C7EA 1G9BA 5DG2A 4KBZA 1MZ6A 3FHQA 4FTEA 3VD5A 4M4PA 5KC5A 2VZVA 5IFTA 1MQTA 2ARBA 1WCDJ 5I8TA 1VAMA 2ZABA 3E6DA 3H42B 4XF0A 4CEWB 3SH5A 5B4XA 2VG9A 3L2HA 5FBZA 1RUF2 4MSVA 2VNRA 5FRAA 1LOFC 1NCQC 1PO11 2GSYA 2A7AA 2VUDA 2A3YA 4UF0A 3KMHA 2WZR2 4BQYA 5KHHA 5A7OA 4Y5Z0 1QHDA 4LBNA 2YBKA 1ZBE3 4WM7B 3MDPA 5FYBA 4D3WA 4D7TA 1DBNA 2X5IC 3KS7A 4PI2A 3NJXA 1LHOA 3OCPA 5CADA 1JU4A 3MUZ1 4URTA 5E88A 1PO23 1WMXA 3SKJE 1HB2A 3ACHA 1S0IA 4HPKA 2VZOA 3ASIA 4DPNA 4FFFA 1GZ9A 3DV8A 3USUA 1YEWA 1FX5A 4FPYA 2VTFA 5IVCA 2PELA 2YFZA 1ZBA1 2WO1A 4HKOA 2MHFA 4JGZB 3FC0A 1NXD1 3OD0A 4XUTA 3AP9A 4YYOA 3KGLA 2RJLA 1W99A 2QE3A 5FY0A 4CCNA 2WNOA 5JIUA 1VBB2 1FOD3 3MV11 5A3NA 3PU3A 1DG6A 1BKZA 3TEZA 4FPFA 4FQZA 3QLQA 4O9EA 4AVSA 2E31A 3QCWA 1GZCA 2BOIA 2GMPA 4FPJA 5FYHA 1CZSA 1RUD2 2HWD1 1BVVA 1QOSA 2CDPA 1V6MA 2QQLA 3T2QA 1OOPC 5H9SA 4CPBA 1U0AA 4J1WA 3A23A 4MHUA 3RG0A 2A3WA 5C8CB 3KT4A 1JOJA 4FOVA 3OTFA 4FXGB 1S0BA 3UT0A 1C8M2 4SBVA 5LCWL 5FPLA 5FZ1A 1EAH2 2DCTA 4OI2A 5A7PA 5LRRA 4D6QA 2OA2A 4JGYA 2ZA9A 1HRI2 4YPJA 3ZYJB 3BUCA 4GJZA 4QPGB 1E5IA 4XF3A 2V4AA 4U2AA 2XB6C 4LOSA 4EV0A 2VD7A 2JKBA 3IDEA 1F35A 1APNA 4GWMA 4BIFA 4EJRA 4OUEA 1BVP1 4Q4X3 5J98B 3WCSA 4L9BA 1VBE1 3I3DA 1PHMA 4JC1A 5FZ8A 3VL8A 5BXXA 5F3GA 2RDSA 3T4VA 1UWWA 2E26A 2IVIB 5FPUA 2D93A 3PLQA 3WP5A 3ZFEA 2X8KA 2RS53 3SCFA 4CUAA 3PMEA 2LALA 5FLHA 1FI2A 4QGNA 2XQXA 5A7QA 1IS4A 4O61A 3RZMA 4WZCA 4ZZ8A 1HDKA 2R072 5CZKA 3J26N 4Q4W3 5D8AA 4RR3A 4Q8KA 3SH4A 2WS93 4XJWA 3K51A 4CDUB 5FYMA 4HZFA 3DN7A 3DXUA 1WLDA 1DLLA 3OD4A 4OMDA 1VPHA 5BNOC 2A6VA 4CDWB 2WQZC 4FVVA 5EHDA 1TME2 1Z7S1 3RWKX 3G7DA 4B8EA 5F5CA 3M4FA 4E2GA 4QU2A 1H2NA 2EICA 4RQPA 4AGVA 1FNYA 2VTXA 5HCHA 4IUGA 3ZMNA 2ARAA 2OIIA 4C0HA 5K4LA 2EALA 2QQPA 2HBUA 3NL1A 1QJU2 3VBOA 3AFGA 4N43A 3NJYA 2GN7A 3LZZA 1XRUA 1ND2C 2R7EB 3W58A 1JYXA 3ZKYA 3BTYA 4RS5B 2BVBA 4WVZA 1CJDA 3L9JT 2WT2A 5IVVA 3WQ0A 2C24A 5F5AA 1DU3D 3FLRA 2A70A 2CWSA 1UZYA 1RYYA 1X8EA 2VC9A 2UU8A 3H8OA 2VECA 4GB32 3ZXKA 3RFRA 4HVQA 5KR7A 1F4HA 1ODMA 5DUWA 2C4XA 4PQQA 1JXNA 2RMU2 1OBNA 3KQ4B 3UV9A 2V72A 4PLMA 3GF6A 1MACA 1JN2P 1XNDA 1KQRA 1XB9A 2VUAA 3HNYM 1ASJ3 4LBQB 2VMIA 2K0GA 4P00B 3RVHA 2DFBA 5JPNB 3ILNA 1G9DA 2W87A 1RUH2 2AREA 3WQ7A 4CDXA 2IXHA 5FR3A 1JYVA 1K42A 4JDOA 1W9YA 4PDWB 2DTYA 2WNUA 3RZLA 4LEJA 2BJSA 3ENRA 4GA9A 3I2IA 4GH4B 3VBHA 4COZA 1LGCA 1WKYA 4YG3A 2WT0A 4YFWA 5IHRA 4OZOA 1M4WA 2J1AA 4LUMA 3QOPA 3I3QA 4IGQA 4MADA 1A3KA 5F2WA 1WLCA 1ZZ9A 3PU8A 1TNRA 5CKNA 1RMU2 5A3WA 4PF1A 3WEZA 1Y9QA 3O0VA 1UY4A 3DGTA 1W8OA 4XXPA 1AR72 1DHKB 4HFSA 1BQPA 3AZXA 3J8F2 4ASMB 4ATEA 4AYUA 5D1IA 2XKPA 2IC1A 2QQMA 4LO8A 4AHZA 1OFNA 3AMMA 1PGL1 1RHI1 1ND3C 3DKQA 1HLCA 2R6QA 2QZ2A 3N9PA 2JG8C 1FXZA 1GNZA 4QPYA 4Y5TA 5C3RA 3VKNA 3C3VA 2RG4A 2J22A 3KT1A 5DDJ2 1SBFA 4BMBA 2PMWB 4BOWA 1HRV2 4NO4A 4XHBA 4NHXA 5A3OA 1PMJX 5L73A 1W2AX 4E4SA 4QDSA 3WUDA 1I5ZA 4PBOA 1SFPA 5K7PA 3TB0A 2ZAAA 1K12A 1OVSA 1D4M1 1IGOA 2HKXA 2OPWA 3IIAA 5EPAA 3AK0A 3TWIA 4XFHA 2FDGA 3QACA 2JWPA 4I30A 3GCXA 2UYAA 2F4LA 2JXAA 5BNNA 2EIGA 3JD72 4BCUA 3QBQA 3AP6A 5ABJA 2YG0A 1H30A 5GZFA 3U4XA 1FV2A 3VB9A 1AR82 1LEMA 1YQCA 3VBUB 4JDMA 2BGOA 5FO8B 2B39A 1WLTA 1W3VA 3MHZA 2VZQA 5DABA 3M1HA 1AX0A 3DUIA 4O65A 4J6GA 1NA1B 1RUF1 3I2JA 3JZVA 3VD7A 5FPAA 4CCKA 1H8TC 1UY0A 1WD3A 3D5OA 1ZZBA 1HKDA 4KG0A 1K5JA 1UCXA 4A3XA 3EYPA 1OKQA 2ZTNA 4HN1A 2VCCA 2WZR1 1PGSA 1MS0A 5I0RA 3M3IA 4QB2A 2HBTA 2Q1ZB 4IV3B 4A7YA 1MS8A 3NNLA 1GR3A 5FZHA 1MZFA 1PZ8A 5DUXA 3O14A 2FZ2A 2XQRA 1CAVA 2ZMKA 5J09A 4W4ZA 1W6MB 1LGNA 4D7YA 2IXKA 4XILA 1KITA 2VCAA 1RUG2 2OX0A 3LIHA 2RDQA 3O1UA 3UGHA 4IEUA 3VBRA 3I59A 4FTSA 3OY8A 1VBB1 4YM2A 3WP4A 3WQBA 3GZUC 5FPXA 3WNLA 3RZHA 2JE8A 3WINE 3ZYBA 4NUBA 5A33B 1RUD1 5B2GB 1O3SA 2RR13 2TUNA 4UAPA 4JVAA 2UWCA 1S2BA 4MHRA 5I0TA 3WDXA 1GQHA 1PVC3 4CXWA 1Q5OA 1RUJ3 1IPSA 1HB1A 2Y6KA 4Z1VA 2DYCA 1FPN2 4IV1B 1C8M1 1VB2A 5G04L 5C4WA 1EAH1 2VMHA 1ZRDA 2ZEXA 4YLZA 1SQ4A 1GFF2 5IJRA 4BQ4A 2JB4A 2RS51 3LEMA 4BQ1A 1W0NA 1QKQA 3I49A 2JIGA 1OLQA 2VZRA 4EYUA 5HXVA 4NPLA 4NHMA 3M70A 4TZDA 5FLIA 3T3YA 2DCKA 3NJZA 2WN3A 4Q4W1 1EP0A 1ZZCA 5F6LB 5FZ0A 1W6NA 4LO7A 4WM8A 4WZFA 2F6BA 1F5FA 5E1RA 3F2ZA 1AR62 4AGGA 4OLLA 1XE8A 1Y7BA 1CVNA 3MLJA 4UT5A 3ZFGC 4WV8A 2VMEA 5LBEA 2VOXA 4META 1L3JA 3O1TA 2ZPXA 4Q27A 5DAPA 5FXVA 2QTWB 4ZXEA 3ZDVA 2WQ4A 2BFUL 3H3UA 1W8UA 2FZ1A 4NRQA 4CA9A 1PMHX 5CFDA 1AR92 2JECA 4XTMA 5IVFA 1JYTA 2ZMNA 1XU1A 4IXLA 2DU1A 2R063 1S0CA 1FT9A 1VMFA 3MPPG 2J1UA 1BLZA 1CZTA 2R071 2WYSA 2XVLA 3AXDA 3H1YA 1GSLA 2PN5A 1DZQA 3VBSA 4AVBA 5HCFA 3AMHA 4YM0A 1RUC2 4D94A 1F4AA 1LHNA 2DV9A 3BTZA 1X7NA 3POWA 2D6OX 1JZ8A 5L7OA 1OH3A 1VBA3 3BYWA 2BBVA 1TME1 2XG3A 3X29B 4BU2A 5I0SA 1C1LA 2ZGNA 3WF4A 1R1A2 2AC1A 3Q8AA 1TMF3 1IZ3A 5F32A 2PAEA 4YVSA 2HYXA 1GOFA 1KJRA 4ARXA 2EXIA 2AZ5A 5ACA3 5K9YA 2WFPA 4CRQA 2A6YA 4IE4A 3D0JA 1E5RA 1QJU1 3EJKA 3SXWA 1GZWB 5CB7A 1F2NA 2G1MA 2BWAA 3BOWA 3CO2A 3WF1A 3IMNA 2HWF3 5C3PA 3IWZA 2Q8DA 5KHGA 1S1AA 1LNSA 2IXJA 3HNMA 3T0BA 5KXDA 2W1WA 2H0BA 5JXGA 1BZWA 1VB4A 3ATGA 1NCRA 5C3OA 5JXIA 2VMGA 1B09A 4Q4V2 5FZEA 1R1A3 1LJ7A 1C5HA 4GB31 1PVXA 1SDWA 2YU2A 4Y22B 1SCRA 5F8PA 2ZHLA 4MXVA 3RPQA 3I2FA 1YRZA 3ZVXA 5FO7B 2JDYA 3WP3A 3KV4A 1VAKA 2VJXA 4MGIE 4UFJA 3HN3A 4XBNA 2RMU1 2K2SA 4CUGA 1GOGA 1CZVA 1LCLA 1GU3A 2YU1A 3V0BA 2CGNA 2R1BA 2B4KA 3A0KA 3R4DB 2J1SA 4CXXA 3NV2A 4AQSA 2WLPA 5LK5A 2DF7A 1RUH1 1ALYA 2LRPA 4QM8A 2W39A 2NPIA 4BDVB 1ENXA 1PIV2 1VMJA 4YGEA 4Z2WA 5HV0A 4ORFA 3KV6A 2IFWA 4RFT0 5HXMA 4YW3A 3SEEA 5CA6A 2FDJA 5SV5A 1VJ2A 3WNXA 4AEDA 4CP9A 2XJSA 2YDEA 1CAWB 5GALA 4CU7A 4R4XA 4GD4A 1PK6C 3T30A 2VO5A 3MICA 3POGA 5AVAA 5LK7B 3RRDA 5GKAC 1XSRA 3HQUA 3K46A 2G9GA 1UOGA 1SLTA 3RNSA 4ZHNA 1LU2A 1PO13 2HH9A 2QNKA 1SEFA 3CBNA 1NZCA 1BMV2 3GXUA 2ILMA 5FYSA 1AR71 3CNAA 5EWSA 3K4AA 3H7JA 2J1EA 2VZ3A 4IE5A 2Y6JA 4QU1A 3UK9A 2D6MA 3KHCA 3PVNA 3RMXA 5JI9A 2QCSB 4JTNA 5FK8A 1DQ2A 1YFUA 4CDQB 3T2TA 2G9FA 1D4VB 3N7LA 4LE4A 4Q4Y2 4XF1A 5A7NA 4V1PA 4ASKA 5DDJ1 1CWPA 1FATA 1E5HA 2W68A 3OBRA 4KH9A 2W91A 1H2MA 3H0OA 1QJY3 4MXWB 5LY2A 2D6LX 4MUVA 1CONA 2LS6A 3LDBA 4K6BA 5JVVA 2B45X 2VCBA 3B02A 5JPMB 4NIHA 3CDZB 4GMP1 4QT6A 1EY2A 5E89A 3VV1A 2AEZA 3B69A 4IEPA 3IIIA 4Q0PA 1LENA 5C5UA 2B46X 1DP0A 2JDNA 4FXKB 3BVCA 1OQEA 3OGGA 4XC9A 3WDWA 4YZ5A 5C9AB 5IVBA 5JZGB 3VHOA 1RL3A 5ERLA 3BB6A 3WDUA 3ZXDA 2HWD3 4M3CB 5A3UA 1X50A 2ATFA 3GBGA 4BK4A 4AAXA 2RE9A 3CJIB 4LTAA 5BNPB 2VVEA 4DY3A 4O7XA 3WX5A 1LOFA 1NCQA 3S7EA 1RUE2 3ACFA 1W6PA 1K5MB 3U14A 1R092 3H3LA 5GLWA 4Z2AA 5IK4A 5IK7A 3MW3A 4N53B 3WNMA 2WNVB 4XUQA 2V5DA 3TOJA 5K0UC 1C8NA 3T2OA 3UKVA 4WVVA 1QJZA 1RC6A 1WMFA 3D8CA 3EQEA 4COYA 3NMBA 1YQ2A 1SZBA 3I3BA 3ZXGA 2X5IA 3ES1A 3VBSC 2PYTA 2FHRA 3IM0A 5F2SA 2DUPA 1F5JA 1N47A 4Y1UA 2B9UA 2L9LA 5CBLA 4N9HA 5FQ0A 5DAXA 4NOTA 1CIWA 3V64A 2QQVA 5DQ0A 3GALA 4QDRA 1Y4WA 2ES3A 1UY1A 2B7YA 2JDMA 2WSVA 5F39A 3K48A 4RYDA 1OI6A 1W3XA 3OBTA 4NRPA 4AR2A 4NIGA 4H7LA 5CFCC 3EBRA 2VVDA 2OZJA 1CAUB 1KJLA 5J37A 2Z42A 1YYNA 2YC0A 3ETPA 4QGMA 2QZ3A 4KGGA 3ZYFA 1YNAA 4YW6A 5LA9A 4YM3A 3VZJA 3BGAA 4CDWA 2WO3A 2E63A 2VMDA 4MGYE 2ARXA 5A6XA 1WD4A 5FBJA 4JV4A 4BE3A 5FYIA 1Z7S3 2XR4A 4IE7A 5T3NA 1VR3A 3AC0A 5L36A 2HYKA 3H1WA 1EV13 1ONAA 1POV1 1UPSA 3JCIA 4N9IA 4LHNA 1REDA 1W8TA 1FPN1 1RJ7A 4ES8A 2HWC3 4LPLA 4OYUA 2ADDA 1UMHA 2ID4A 2W08A 4QPIB 3RS6A 3WW4A 4D0QA 5KXEA 1LTEA 4QB6A 2C6SA 3BOPA 5F3EA 1T6GC 4Z92B 1R083 1T6BX 4GZ9A 3LEGA 1VRBA 4LA3A 5GLVA 3WDYA 3BIWE 5A3MA 1OLME 2PQSA 5F5IA 4IEXA 4JQTA 2WN2A 1NT0A 2KM2A 3VKFC 4FFGA 1AR61 1U12A 4R4ZA 4YW1A 2XBO2 1Q8PA 4B7EA 4CEWC 3GDBA 5FY8A 3ROUA 4RHV2 1W6QA 2Q1FA 3NNMA 3ZFFB 5JMCA 4Y1YA 3AP4A 5T54A 5KWRA 4XTPA 1MS9A 2P34A 1TMF1 1WA4A 3LOIA 3AJYA 4FCAA 3U11A 4E8CA 1AR91 2P6HA 5DZFA 1X36A 4IDZA 4GQ7A 4XJZA 1AJKA 1J3RA 1ZA7A 2ZGPA 1WBLA 2QQIA 1LKNA 1A8MA 1ZRRA 4FBFA 1MS3A 4B4RA 3MFCA 3HN1A 4A6SA 2VPVA 4WM7C 5FKBA 1LB2A 2HWF1 2WT1A 1RUC1 4CEYB 2HWE2 5FYUA 4QQHA 1DGRA 1ZZ8A 1OT5A 1J3QA 1QJX2 4CP0A 2D3SA 4HK8A 4CUBA 3N7KA 5BNOA 3GHNA 2P3JA 2D5FA 1XNTA 1LOEA 1BHGA 3VDDB 5EFUA 1W9SA 1F15A 5J48A 1R1A1 1O7FA 1QH6A 2E32A 3ELNA 3FHIB 1S0GA 3OEBA 4JHZA 4K9SA 2D7FA 1YI9A 4AFAA 1ULDA 3WNOA 4JGZC 1MS1A 1PGW1 5JSOA 3IZOA 1S2KA 4BIOA 5JOWA 4YZ2A 4NWVA 5T55A 1G9AA 4OUSA 2TNFA 5FMOS 1V9U2 3HD8B 5FV3A 5FXXA 1OPMA 3T09A 1ND2A 2GC1A 3VZKA 2P17A 4FP2A 1DQ0A 4JRAA 2D44A 3OYWB 3SITA 4C1XA 2RS33 1C28A 5HBAA 3HQRA 2R32A 4JX0A 4OULA 2QQWA 2VOWA 1DYPA 4XUOA 2LW8A 5FZCA 4JDNA 4Q4V1 3ZPYA 3E6CC 3OGSA 2QFEA 2FDIA 2R49A 2YGMA 3FLPA 5I93A 3LOBA 2BGCA 4INDA 4L97A 1NZIA 2JDAA 5C8CC 2QDNA 1UX6A 3WW1A 4NROA 5FK7A 3VHRA 1VBD3 4R52A 4W65A 2AR6A 4QPGC 3ZLIA 4F83A 3I2OA 1GBGA 2CU5A 4M3CF 1C4RA 1D4M3 1DQ4A 1RVF2 3FE5A 5DAWA 2D3PA 5E8AA 4AVAA 1D7PM 1MS5A 3NV4A 4F7ZA 1WMDA 3MLKA 1ZZ6A 4AEMA 4E4HA 5EJ1B 2OUJA 1W03A 5FP9A 4ES9A 5A32A 1M06G 1CR7A 5DZEA 1XXNA 2V5YA 3AP5A 3JXSA 1IS3A 2QQNA 3WSOA 1LGBA 3BPZA 5APAA 5EJ3A 3ZR6A 2Y6HA 1QH7A 4O9GA 1RUOA 1W06A 5AC92 3WP6A 4FTBA 4DB5A 3K77A 2R0FA 1I1EA 1RUF3 1WW7A 1LHVA 1JW6A 2I07B 1QJY1 2A6ZA 4DQAA 1BMV1 3Q8BA 1VBC2 2YY1A 1PNFA 4KU8A 3P6BA 1UYXA 3PUAA 4Y33A 1W6OA 2WZR3 2WA3A 3OBAA 3VHPA 1R64A 4XW3A 3THCA 4CDUC 2BPA2 4K1ZA 4NVPA 3ME2A 4B1MA 3S7IA 1ND3A 4URAA 4FPGA 5DUVA 4KBBA 4CDWC 4EROA 2JG8A 4DXSA 3WT3A 4QPWA 3K4DA 1ZREA 1LOBA 4BQ5A 2D5HA 3T0DA 2WA4A 2J1TA 3KCYA 2ZHKA 1STMA 5GLTA 4EWDA 1GYKA 4TLFA 1HB3A 2CGOA 2QQKA 4CP2A 2ARCA 3WW2A 1W0PA 1PNGA 5FZ7A 4UW5A 1WZXA 1C1FA 4J25A 5A7WA 1FYUA 2I2SA 3P3NA 3MFAA 1GKBA 2JG9B 4RS5C 5CIRA 2OPKA 3MIHA 2BOJA 1BEV2 5GZEA 2XDVA 3RI8A 5DXDA 2R042 5FP4A 3RGBA 3WG3A 1VBB3 5I8YA 5FO9B 2YXSA 2W92A 2DFCA 2AACA 3WHUA 2BZDA 3W20A 3KV5A 1BK0A 5JMOA 4XQWA 4MYEA 2W95A 5GZCA 3J7MA 1YC61 1RUD3 3R05A 2FMDA 3MV01 1T2XA 3CL1A 1I3HA 2RJ2A 2EAAA 4QX2A 2E9QA 2VNGA 2E53A 1CAXA 1W04A 3OUIA 1FMD2 1CD3G 1O5LA 1C8M3 4WVMA 5FAXA 2BQPA 4HSLA 1EAH3 1H8TA 1RUE1 2PHFA 3OUJA 4FPEA 5DAQA 5FUNA 2JENA 1HRI3 4XUPA 4OI1A 3B5LB 3WXPA 3NKTA 3I2GA 5IAXA 1MR5A 3IPVB 2SBAA 4PDWC 2VXJA 1MZEA 3HT1A 3ILRA 4LO6B 2PHDA 4GH4C 4AHYA 2VQUA 1HXS2 3SMHA 3MF6A 2DBNA 3NAPB 4FFHA 4S2DA 5AFBA 2VNOA 3FWEA 4FPHA 1NUKA 4PF5A 5T52A 3SQOA 1H1IA 4LO5B 5ISLA 3CU7A 3ZMOA 1B35B 3VL9A 1EV11 1BYHA 2WIIB 2E7QA 4YW7A 1TVGA 1DFQA 2YZ4A 1QWRA 2WUHA 3VBFB 5FZMA 1SLCA 2EF6A 2HWC1 3INAA 5A3PA 2R073 1OSGA 2HWB2 1GICA 4K1YA 4AZZA 3CF6E 4I3PA 3C7HA 1YIPA 1R081 2XUEA 3ACLA 3WNPA 4EWAA 4BM8A 4FPLA 1O4ZA 4XFFA 2YPDA 3GZTB 1IQDC 2GNDA 1RUI2 3WNNA 1TME3 3BCWA 2AGSA 3N3HA 1SPPA 3OF1A 1VLNA 2VNVA 4XDOA 5JR2A 3H8RA 2VW1A 4IW3A 1E57A 1BJQA 1IKPA 2RS12 1LOCA 1AL22 5C71A 1O59A 2VM9A 4L8QA 4NHLA 1COV2 1QJU3 3OG2A 4ATFA 2A1XA 1UO9A 3AKTA 5JSPA 1YHFA 2VZ1A 3KM5A 2Q4SA 1AYN2 1H8VA 1LU1A 3IBMA 5JDBA 4FO9A 3Q8CA 4DRRA 3ZSLA 3VBUC
chains in the Genus database with same CATH topology
4Y5TA 5L9VA 2RG4A 5LBCA 5IATA 3KT1A 3MGUA 5LBEA 3NNMA 5HV4A 5EQUA 2RDSA 5DAPA 4NHXA 2Y34A 3KT7A 5LATA 3EMRA 4J25A 2G19A 2RDNA 2OPWA 2FCUA 3GZEA 5EPAA 3OBZA 5C5UA 4XC9A 3W20A 3BVCA 2Y33A 5ERLA 4BQXA 4KBZA 4JZRA 2FCVA 5A3UA 5IAVA 3GJBA 3OUIA 4XCAA 3OUJA 2HBUA 5DAQA 2G1MA 5IAXA 5L9RA 4BQYA 3HQRA 5L9BA 5DAVA 4NMIA 2HBTA 3PL0A 4ZONA 5LBFA 3NNLA 3GJAA 5DAXA 5LBBA 4Q5OA 4UWDA 4XABA 2RDRA 2RDQA 5DAWA 2FCTA 5LA9A 5M0TA 5HV0A 4XAAA 4NHYA 4ZPIA 4NAOA 4IW3A 3OUHA 4MHRA 3NNJA 2JIJA 4MHUA 4Y5SA 3HQUA 3KT4A 5LB6A 4NHKA 4XACA 4NHLA 5LASA 4XCBA 3NNFA 3ITQA 3W21A 4BQWA 2A1XA 2JIGA 2V4AA 4NHMA 3DKQA 5C5TA 5EP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5T A;  5L9V A;  2RG4 A;  5LBC A;  5IAT A;  3KT1 A;  3MGU A;  5LBE A;  3NNM A;  5HV4 A;  5EQU A;  2RDS A;  5DAP A;  4NHX A;  2Y34 A;  3KT7 A;  5LAT A;  3EMR A;  4J25 A;  2G19 A;  2RDN A;  2OPW A;  2FCU A;  3GZE A;  5EPA A;  3OBZ A;  5C5U A;  4XC9 A;  3W20 A;  3BVC A;  2Y33 A;  5ERL A;  4BQX A;  4KBZ A;  4JZR A;  2FCV A;  5A3U A;  5IAV A;  3GJB A;  3OUI A;  4XCA A;  3OUJ A;  2HBU A;  5DAQ A;  2G1M A;  5IAX A;  5L9R A;  4BQY A;  3HQR A;  5L9B A;  5DAV A;  4NMI A;  2HBT A;  3PL0 A;  4ZON A;  5LBF A;  3NNL A;  3GJA A;  5DAX A;  5LBB A;  4Q5O A;  4UWD A;  4XAB A;  2RDR A;  2RDQ A;  5DAW A;  2FCT A;  5LA9 A;  5M0T A;  5HV0 A;  4XAA A;  4NHY A;  4ZPI A;  4NAO A;  4IW3 A;  3OUH A;  4MHR A;  3NNJ A;  2JIJ A;  4MHU A;  4Y5S A;  3HQU A;  3KT4 A;  5LB6 A;  4NHK A;  4XAC A;  4NHL A;  5LAS A;  4XCB A;  3NNF A;  3ITQ A;  3W21 A;  4BQW A;  2A1X A;  2JIG A;  2V4A A;  4NHM A;  3DKQ A;  5C5T A;  5EP9 A; 
#chains in the Genus database with same CATH topology
 3HJR A;  4LKF A;  1D2Q A;  1J1T A;  4PHZ A;  1ULG A;  1YFX A;  1U5Y A;  1Q8O A;  2XBO 1;  3J4U H;  3HMY A;  3PTY A;  4GB3 3;  3ZFG A;  5C7G A;  1H0B A;  4QM9 A;  4ZU5 A;  3T0A A;  4DRV A;  1NA1 C;  1U5X A;  4QX5 A;  3UYJ A;  5FXW A;  2YYO A;  3MO4 A;  2RMU 3;  3NST A;  3KT7 A;  5IYY A;  3PIJ A;  4Y3O A;  2Y64 A;  3LPG A;  4DY5 A;  1J59 A;  2NM1 A;  2W9X A;  3A22 A;  1DYO A;  2GME A;  5LA0 A;  3TNQ A;  1L7Q A;  2P4E A;  2BNM A;  2P3Y A;  2J1V A;  1UZ0 A;  3BTX A;  1RUH 3;  4MV2 A;  4C90 A;  1WME A;  4ZXK A;  3HNB M;  3ZN6 A;  4IV3 C;  5FJK A;  3AKR A;  2RS3 1;  2KXL A;  1QJX 1;  4P9W A;  4KWK A;  3RDI A;  4AVT A;  2RM2 2;  4MGQ A;  1GP6 A;  1X33 A;  2B9V A;  2ENR A;  4CCJ A;  2TEP A;  3D0S A;  3V0A A;  4N7I A;  2XOM A;  4A45 A;  3LA7 A;  2EA7 A;  1TQ5 A;  5DG1 A;  4NPR A;  1RMU 3;  2C0Z A;  3KHB A;  1VBD 1;  5FZG A;  5EIY B;  3FL7 A;  1G7Y A;  2Y60 A;  2ZBJ A;  3FUO A;  1V9U 1;  2Q1M A;  4IE0 A;  2YFU A;  1AR7 3;  1SLI A;  1NLQ A;  3J8F 3;  4JQR A;  3WUC A;  4UI9 L;  4DEQ A;  4U36 A;  5J7M A;  4LK7 A;  1UW8 A;  5DPN A;  2NYY A;  4E2Q A;  3DYP A;  4L11 A;  1KFX L;  5CYY A;  4EN9 B;  1V6O A;  3NWK A;  4CCC A;  5BYN A;  3C7O A;  2QUO A;  3GJA A;  1YJK A;  4YW4 A;  1ODN A;  4DUV A;  3VZN A;  2Y38 A;  4HN0 A;  5DDJ 3;  1W0O A;  3WY6 A;  2ZEW A;  3POJ A;  4IV1 C;  2PAM A;  2GC2 A;  1HRV 3;  3VDB A;  1DZR A;  4DXR A;  2WWJ A;  4DNY A;  1TE1 B;  2WFF 2;  2WZE A;  3GCW A;  3URF A;  4CZS A;  3THT A;  5IUQ A;  2BGP A;  1MQT B;  3ES4 A;  1RVF 1;  2A3X A;  4GMP 3;  3IN9 A;  3LEK A;  1ULO A;  2DVA A;  3ZIW A;  5FY4 A;  1XPW A;  3GYD A;  4B29 A;  1X9P A;  4M01 A;  4UF0 B;  5FPZ A;  2ET1 A;  5F7U A;  3JD7 3;  2W94 A;  3S5A A;  2D6K A;  4FAG A;  4IEW A;  1W2T A;  2GZW A;  2JDZ A;  1AR8 3;  1DQ5 A;  2ZKN A;  3BPS A;  1BK1 A;  4HVO A;  5AC9 1;  3OJB A;  1PK6 A;  1A8D A;  5IVE A;  1AX2 A;  4V2W A;  1REE A;  3VDA A;  1V00 A;  5LZ6 A;  1AUY A;  2WR9 A;  2JIJ A;  5A3L A;  3KB5 A;  3SNM A;  1N3O A;  5LAS A;  3R4S A;  1J1L A;  1W8N A;  2D40 A;  4XJA A;  5EJZ B;  5FY9 A;  1GOH A;  1VBC 1;  1QGL A;  3WG4 A;  4HT1 T;  4QHB A;  1UQX A;  3KCC A;  4HPK B;  1U5Z A;  4OI4 A;  3ZN4 A;  4GIQ A;  3SCH A;  1OC1 A;  2O1Q A;  3MPB A;  1ENQ A;  3HIF A;  4RSU A;  1C5I A;  3R0R A;  3H50 A;  3S6P A;  2JIC A;  3TN9 2;  4COW A;  1GP5 A;  5HPO A;  4Y1V A;  4WVW A;  4TSV A;  2I74 A;  1AXZ A;  3MBW A;  4RGK A;  5L9V A;  3GBW A;  1PZ9 A;  1PMI A;  2MEV 2;  4P9Y A;  4YG0 A;  3THD A;  1TZO A;  4AHW A;  4UFK A;  2XLG A;  5IK5 A;  4D6S A;  2WZ8 A;  1SHW B;  1HN1 A;  2VUL A;  1AYM 2;  1ULF A;  5J3U A;  2JEM A;  4AVV A;  4AI2 A;  2P3I A;  1RUG 3;  1W9F A;  5C3Q A;  1QJF A;  3J9S A;  4ARY A;  4HG6 B;  1HRI 1;  3LGR A;  4QX0 A;  1LAJ A;  2Q8O A;  4K21 A;  2UY8 A;  3ZXE A;  5H9P A;  4AG4 A;  4M0H A;  1GQP A;  1XJA A;  2XWB B;  5FZF A;  1O8S A;  4IEV A;  3I97 A;  2W2I A;  3U4S A;  4JGY B;  4C1W A;  1NOV A;  3HOB A;  4EZ4 A;  1XE7 A;  4A7K A;  4AHX A;  2WLQ A;  3MZH A;  2H6B A;  4LKE A;  4OHY A;  4AAP A;  3JB8 A;  3AYE A;  3NKG A;  4Y20 A;  5LEK A;  5C6C A;  1LOA A;  2X05 A;  1DDL A;  2Q8E A;  1POV 3;  3KVB A;  4L99 A;  4XJ8 A;  4AW7 A;  2D43 A;  1FPN 3;  4TN7 A;  5F6K A;  1DCS A;  1UZV A;  4COU A;  3JUU A;  2DVD A;  1UZZ A;  5GZG A;  1UNB A;  1UOF A;  3BIE A;  4CTE A;  4OMC A;  3ZYP A;  3C7F A;  1AF9 A;  4OHW A;  5K0U A;  1BBT 2;  3POY A;  5FTT C;  3LE0 A;  2WAO A;  4LNV A;  4A3Z A;  4YAR A;  3ZFE B;  2VGD A;  3WQ1 A;  3NW4 A;  1A78 A;  4UBG A;  4IES A;  5D21 A;  3F95 A;  2DBI A;  4YZ3 A;  1UYP A;  4MGT A;  2Z5W A;  4J1X A;  4MOA A;  4BWO A;  1AR6 3;  4ZON A;  1N1V A;  5KHJ A;  4LT5 A;  1OA2 A;  2EXK A;  5F1R A;  1C3H A;  1D0H A;  4UBH A;  5D8A B;  4CP1 A;  3UKN A;  1WCS A;  1RXG A;  4RR3 B;  3VZM A;  2QQU A;  4BXF A;  4DO0 A;  1VMH A;  2JDK A;  3I2D A;  4KL1 A;  5FZO A;  5F37 A;  3E97 A;  3LF7 A;  2VZP A;  3GNE A;  3W9A A;  3I4I A;  1DQ6 A;  1S55 A;  5FZI A;  4OVE A;  1AR9 3;  2XJR A;  5ANQ A;  5FYZ A;  5CFC A;  1X8M A;  1QXJ A;  3PHM A;  4LKS A;  4CUC A;  4RQP B;  2PFW A;  3LSD A;  2RDR A;  1OLR A;  1DGL A;  4XPV A;  4LO4 B;  3HAG A;  3MW2 A;  5JUV A;  3RYP A;  5FMD A;  1YQ8 A;  4RGG A;  1RUC 3;  5LW9 A;  2WQ8 A;  2VBB A;  3Q9O A;  3VBO B;  2XJT A;  4XJ9 A;  4N43 B;  1OLM A;  1S0J A;  1UU4 A;  4CDQ C;  1D0G A;  2E51 A;  2CSG A;  2IFR A;  4XVH A;  2D6N A;  3UGF A;  3O1S A;  1SAC A;  2OW4 A;  1SFN A;  3WDV A;  2RS1 1;  3ZIX A;  1UXZ A;  3M7A A;  1AL2 1;  4E9K A;  5CKQ A;  1COV 1;  3OGV A;  1XC6 A;  4FP3 A;  3I7D A;  1RIT A;  5JIA A;  2A71 A;  3AZV A;  1UN1 A;  3PUH A;  4LXL A;  4BQW A;  1WW5 A;  3ZYI B;  4D6R A;  2BV4 A;  1JYI A;  1GZT A;  4GAZ A;  4Q1R A;  4A7Z A;  2VR4 A;  3KV9 A;  3K75 B;  2IXI A;  2GH2 A;  1KEX A;  4QD2 A;  5TSW A;  4JKK A;  5C9A C;  1AYN 1;  1ZA4 A;  5JZG C;  1A34 A;  1POQ A;  5C5T A;  4Q4V 3;  3V56 A;  1OMI A;  5IVJ A;  5H9R A;  3RZJ A;  1G6N A;  2J42 A;  3CJI C;  3ZPO A;  4CEW A;  4CDX B;  4EQV A;  1V6K A;  5A1A A;  5BNP C;  1IPK A;  2F17 A;  1OFS A;  1NX9 A;  2WNU B;  1NG0 A;  2QJV A;  1O91 A;  1OHF A;  3B94 A;  5HI0 A;  5IFP A;  2PAK A;  3A4U A;  3PUQ A;  5JI7 A;  4ZZ5 A;  1OD5 A;  4LIV A;  1K5M C;  4LLF A;  3LA3 A;  5FKC A;  3VBH B;  3ZYG A;  4KG8 A;  4N53 C;  1UZW A;  3EMR A;  4Q1P A;  2WNV C;  1TG7 A;  4PQ9 A;  1RMU 1;  3D82 A;  4XZP A;  4QQ2 A;  4CCL A;  4Y26 A;  2VY0 A;  2LTN A;  5CIS A;  4G4F A;  3AKP A;  3WF0 A;  4WM7 A;  2FCU A;  3GZE A;  3J8F 1;  1F9K A;  2W3J A;  4GWJ A;  1JMU B;  4UFL A;  3V65 A;  1UAI A;  2KD7 A;  2OS2 A;  3E5X A;  1PIV 3;  4L92 A;  5FCC A;  4F8A A;  2GMM A;  3KF5 A;  4M3C E;  4Q0V A;  1Q56 A;  3OPW A;  3VDC A;  4IEZ A;  1GWL A;  2VZT A;  5AFE A;  3HVD A;  4BQX A;  4G3Y C;  5FRE A;  1YQ6 A;  4LIT A;  5FP3 A;  1VP6 A;  3KQR A;  4EZH A;  3AMP A;  4JGZ A;  4YGD A;  4JHT A;  4Q0Q A;  2ZGO A;  1CN1 A;  4QKN A;  3PMS A;  1LR5 A;  1HRV 1;  4XCA A;  3BN6 A;  1C57 A;  1OF4 A;  1UY2 A;  3FZ3 A;  4FT8 A;  1CX4 A;  2YBS A;  4B4P A;  3I2K A;  2BRT A;  2WAB A;  3SCG A;  5KHK A;  2VCM A;  4OQ9 A;  4AI0 A;  3EB7 A;  4KMQ A;  5DMY A;  1MVE A;  4JTO A;  1BXH A;  4QXK A;  1Z78 A;  4MO3 M;  3UJO A;  4D8M A;  2OKX A;  2H6C A;  4QXC A;  2XJU A;  3N9M A;  2XLF A;  1UL9 A;  3PL0 A;  1YQ5 A;  2XKO A;  2YUE A;  3HBZ A;  3JD7 1;  4NMI A;  4Q0S A;  5LBF A;  4Q4Y 3;  4H3W A;  3ZSE A;  5C8C A;  2P5B A;  2NQY A;  4KWU A;  2ORZ A;  3WZ1 A;  4OI0 A;  2BFU S;  1AR8 1;  3K4Z A;  3LEI A;  2PLV 2;  4AWD A;  5BNN B;  1JZ6 A;  1GAN A;  2VZU A;  5ABJ B;  1UKR A;  3T4H B;  3I3E A;  5T5L A;  2ZX0 A;  5FZK A;  3ZXA C;  4W50 A;  5GM0 A;  3D4K A;  2WFF 1;  4QPG A;  3WF2 A;  2W1S A;  1MEC 2;  2W47 A;  4QPI C;  1ZM1 A;  3ZDS A;  3ZYH A;  4EWE A;  1YO8 A;  4E2S A;  4YZ1 A;  3K2O A;  3EHK A;  2BDR A;  1ENS A;  2FCT A;  5FP7 A;  4Q2F A;  2WNE A;  1DF0 A;  4AQ2 A;  4UW3 A;  3CIH A;  1JUH A;  1ZVF A;  3H8X A;  4W8J A;  1AL0 G;  4LBJ A;  4ZS3 A;  2NLR A;  1JZ5 A;  1QOO A;  3TRS B;  4BLI A;  2VH9 A;  1SBD A;  3B00 A;  4I0B A;  4Y24 A;  4IET A;  4XDP A;  5LRS A;  1H1A A;  2IVJ A;  3ZFF C;  1P8J A;  2NN8 A;  2OQ7 A;  2WYF A;  3ABZ A;  4XOG A;  5FZL A;  5SV8 A;  3A0N A;  1VBE 2;  1ULP A;  3DCQ A;  3WDT A;  5IK8 A;  1IG3 A;  1DIW A;  2XJQ A;  3WLU A;  4AEK A;  2ZGU A;  1X82 A;  3PJQ A;  4IE6 A;  3NRU A;  2JE9 A;  4ET7 A;  3S5Q A;  2RHP A;  1RUE 3;  4OHZ A;  2G9Z A;  3U10 A;  1R09 3;  1DLC A;  3B93 A;  3JBG 2;  3TNP B;  5CG9 A;  3ITQ A;  1GQG A;  1CAV B;  4W6X A;  1RUG 1;  4XF9 A;  2BER A;  3SLI A;  3IT8 A;  4CEY C;  4CDU A;  5FP8 A;  1IQA A;  1XOY A;  2P2K A;  1WGP A;  3VBR B;  3VDD C;  3I59 B;  1S0E A;  4V2V A;  2C9A A;  3OY8 B;  2E6V A;  3RJR A;  1JZ2 A;  3CLP A;  3U0Z A;  1EPZ A;  1RTV A;  1LHU A;  2DCJ A;  3UJQ A;  3VN4 A;  2MEV 1;  4XDQ A;  3FBM A;  5LBC A;  1O8P A;  2PHL A;  4NWW A;  3SIS A;  3POS A;  1S0F A;  2ZEY A;  5HCB A;  2B5H A;  2XXZ A;  4LA2 A;  1XYP A;  1OA4 A;  1U5I A;  2QVS B;  3C2U A;  4MGZ E;  2OT7 A;  4RS5 A;  5A3T A;  3RZK A;  4W6W A;  4YZ4 A;  5FWE A;  2Z69 A;  4CVU A;  5BV6 A;  4Z07 A;  4AOC A;  3PUS A;  2W0X A;  1MPX A;  5C4W B;  4MVT A;  1HQL A;  4NPM A;  4I2O A;  2CAV A;  1XBF A;  4LBQ D;  1HN0 A;  3R4U A;  4R9C A;  3LAG A;  4RA0 A;  4AQ6 A;  5IT6 A;  4S2G A;  5C70 A;  3N4M A;  3M3E A;  5C8W A;  4JZR A;  2FCV A;  1OVP A;  4IGP A;  3A21 A;  4WM8 B;  4XQD A;  3NQH A;  1W8W A;  3JQX A;  4LBQ A;  1QDC A;  3JQW A;  1OD3 A;  2Y6G A;  3LCP A;  2NP0 A;  2Q8C A;  2ZAC A;  2GU9 A;  2GP5 A;  1SLA A;  3ALQ A;  3O5S A;  3U1X A;  3CEW A;  2DTW A;  4P08 A;  1W05 A;  1KDK A;  1BBT 1;  3P1I A;  4M0N A;  4PDW A;  4UFM A;  3U75 A;  3I8T A;  2Y0O A;  5FIX A;  1H4H A;  4OHX A;  4HMZ A;  5CFD B;  5FUP A;  4GH4 A;  1OUX A;  1JOD A;  1XYO A;  4I3G A;  2BW8 A;  2DVG A;  1AX1 A;  4XBL A;  2BU9 A;  4QAW A;  4NII A;  2VXR A;  3VGI A;  3SKV A;  4AI3 A;  4FPK A;  5F5Q A;  1VE0 A;  2JD9 A;  3BKZ A;  1A6C A;  4Q29 A;  1S4C A;  4QX1 A;  2BYV E;  2DUO A;  2XBO 3;  5FYC A;  5C33 A;  1IOA A;  1BCX A;  3MW4 A;  4RHV 3;  4Y1Z A;  4PIY A;  4IL7 A;  4XEZ A;  1SMV A;  2EXJ A;  2BNN A;  2GNM A;  1W2U A;  4XFC A;  1OUS A;  5JWP A;  2FQP A;  2JX9 A;  2YGL A;  5L7O B;  3RYK A;  4UWD A;  2V4V A;  4FOW A;  4AGR A;  2X29 A;  4Y4R A;  1YCI A;  4QDQ A;  1RIR A;  5FZ4 A;  3D3A A;  1FV3 A;  1LRH A;  4MZU A;  4NE9 A;  4YVS B;  2O8Q A;  4LK6 A;  4P9G A;  4K20 A;  1KDM A;  3OGJ A;  5FXZ A;  1QJE A;  1QQP 2;  1YFY A;  2HWE 3;  1NKG A;  1QJX 3;  1RHI 2;  2AEY A;  1PX3 A;  3ZO0 B;  4RD7 A;  2EIE A;  5JAX A;  3ZXL A;  4E8D A;  1NYW A;  3AJZ A;  2VUJ A;  3AMQ A;  1JHJ A;  1IS6 A;  3MI8 A;  4UFH A;  1REF A;  4XAA A;  1KGY A;  5J36 A;  1AHS A;  3U78 A;  1JOB A;  4NIA A;  1NCR B;  3O1O A;  2N7G A;  3AM2 A;  3H1M A;  2W1Q A;  2JG9 C;  1GP4 A;  3RJ2 X;  2HJI A;  4MLO A;  1JTZ X;  2ZKL A;  3IKW A;  4MGS A;  1V9U 3;  2KA3 A;  4UXA A;  4N8M A;  2XGX A;  2VAU A;  3ACI A;  2PHW A;  2ZOE B;  5FZ9 A;  1EYB A;  1QIQ A;  3TAY A;  3PVE A;  1L7R A;  3POF A;  4I02 A;  2GP3 A;  3V0B B;  3ZOI A;  3HEI A;  3RZG A;  3LSE A;  4H7M A;  4YRD A;  3ZSM A;  3VD9 A;  2C9K A;  2ZZJ A;  3N9O A;  2BWC A;  1PIV 1;  5EP9 A;  3R6S A;  3LIG A;  3VBU A;  4A4A A;  1ZBE 2;  4KGQ A;  1CX1 A;  4RN5 A;  1PZ7 A;  1J83 A;  1PM4 A;  3KVA A;  3A7Q A;  4IEQ A;  4E27 A;  5JSR A;  3KCX A;  1NA1 A;  2A5Z A;  4YVW B;  3C7G A;  2O0O A;  1PO2 2;  1I5P A;  2G4I A;  3O1M A;  3BU0 A;  4AED B;  4CP9 B;  1VAV A;  1DGR N;  2D98 A;  3G6J B;  3S57 A;  3O0W A;  4YWA A;  2EID A;  1RVF 3;  2ZGM A;  4FAH A;  4X6R B;  3MLL A;  4N90 A;  4AI9 A;  2WAA A;  5AVP A;  3VD4 A;  1KRI A;  4IV3 A;  4RFR B;  1UIJ A;  2EVX A;  3NAP C;  5FYY A;  1LOD A;  3W5N A;  3MIG A;  3POB A;  2K9Z A;  5FYV A;  1FOD 2;  1NE6 A;  1NY7 2;  2CYF A;  3MIF A;  3NV1 A;  2C26 A;  3WCR A;  1GNH A;  3DPR C;  1H2L A;  3NO8 A;  5AC9 3;  3ACG A;  1B35 C;  2E7A A;  2JDP A;  4AI8 A;  1W6M A;  1W2O A;  4Q4Y 1;  5A6Y A;  5D8A C;  3T1M A;  3O1R A;  3GHM A;  4K8R B;  1G9C A;  3RQ0 A;  3VBF C;  1IG0 A;  3AFK A;  2EAK A;  4CCE A;  2DCZ A;  1VBC 3;  4KQ7 A;  2I45 A;  1W90 A;  1VAL A;  3AKQ A;  2MNG A;  1H9P A;  4XFI A;  3K3N A;  1W39 A;  2ZX4 A;  5L9R A;  1HV0 A;  2KR2 A;  3TEW A;  4CPB D;  5CNA A;  5EYY A;  5A33 A;  4XIO A;  5L9B A;  4XUR A;  1SBE A;  1SLB A;  3FN9 A;  3J7H A;  4JKM A;  1AXK A;  3VZL A;  4IV1 A;  2PLV 1;  4Q4X 2;  5LBB A;  3WHT A;  5KBF A;  2J7M A;  3WOG A;  2XJP A;  4NID A;  4FOQ A;  4BIS A;  1OA3 A;  3PVB B;  5FZ3 A;  2NZ9 A;  1HJG A;  2A73 B;  4K3U A;  1N1S A;  4XIK A;  4C91 A;  5BY5 A;  1MEC 1;  3PTR B;  4K7J A;  4AI1 A;  1UMI A;  5FOB B;  2ZGS A;  3IDA A;  5FLJ A;  4E4Z A;  5GLZ A;  1Y43 B;  1JU3 A;  1R09 1;  2QKD A;  1BEV 3;  5BUV A;  2RS5 2;  2IXC A;  2BBA A;  2R04 3;  4JAA A;  1KD7 A;  3USS A;  4H2A A;  4ZU7 A;  3IB3 A;  1I6X A;  1K45 A;  1NCQ B;  3S30 A;  1W6P B;  4HBN A;  4Q4W 2;  2JE7 A;  4WBB A;  3DF0 A;  5IVY A;  3RMY A;  2WS9 2;  1JUI A;  1UU6 A;  2ADE A;  1LEC A;  5FY1 A;  4NHY A;  1XYN A;  2W52 A;  2X5I B;  3KLS A;  4ASL A;  4LJH A;  2O14 A;  3DPR B;  1FMD 3;  1NE4 A;  1QMJ A;  4ZS2 A;  5FMB A;  2RV9 A;  4IEO A;  3NNJ A;  5FQ0 B;  3H9A A;  1XSQ A;  5LB6 A;  2XL7 A;  2DWR A;  5FPV A;  1OQD A;  3JBG 1;  1H1M A;  1G86 A;  3IMM A;  4LUK A;  1SG3 A;  3DYM A;  3W21 A;  2VQ0 A;  1GWM A;  1WCK A;  2P3K A;  4QQL A;  4CU6 A;  4DZG A;  4LHK A;  1UU5 A;  2LM3 A;  2R0H A;  4KNC A;  3PNA A;  1QNW A;  5FJH A;  1HXS 3;  3GM8 A;  1XE0 A;  1VRH 2;  5LA2 A;  3WNK A;  1NAE A;  1WW6 A;  1QOT A;  4LIU A;  2AH2 A;  3LWC A;  5GJ6 A;  2PHR A;  3HR9 A;  4CU9 A;  2VMC A;  3GBF A;  1LOG A;  5DUU A;  1JZ3 A;  3AL5 A;  4DS0 A;  4QQP A;  3WW3 A;  2CNA A;  2DU0 A;  4HKW A;  1YLL A;  2XON A;  1GZW A;  3FBY A;  4HL0 A;  4IEY A;  3QH6 A;  4QKF A;  4QXH A;  5F3C A;  4A44 A;  4B3N A;  4I0A A;  2A75 A;  4M4R A;  4NN0 A;  5IWF A;  1OOP B;  3KZ4 C;  4EN6 B;  5B4N A;  2HWB 3;  5FZ6 A;  1AJO A;  3AVR A;  4QHZ A;  1ASJ 2;  1DZT A;  1VRH 3;  1CJP A;  2DCY A;  3DEM A;  3OPZ A;  4BYY A;  2ETE A;  2F4P A;  2QQO A;  4DOU A;  2EXH A;  3N7J A;  4EN7 B;  3SH3 A;  2WWU A;  4MH0 E;  3AB0 A;  1JYC A;  4Y22 A;  1LED A;  4JCK A;  1RB8 G;  1UX7 A;  1RUI 3;  3M3C A;  1H6Y A;  5J1X A;  2BNO A;  3LDR A;  1ULE A;  3Q8F A;  5IAV A;  3MID A;  4RHV 1;  4XET A;  4A41 A;  4QKB A;  3U37 A;  2RS1 3;  4M00 A;  4PI0 A;  1AL2 3;  1ST8 A;  4CU8 A;  1MQT C;  1COV 3;  5FY7 A;  2Q5T A;  2Y8K A;  3KD4 A;  1VIW B;  3JU9 A;  1PM7 A;  2LRO A;  2XHK A;  3AYA A;  4LBK A;  3RYR A;  1W6Q B;  3CMG A;  4QGL A;  3FFZ A;  4G9S B;  3JB4 C;  4BK5 A;  1RJ8 A;  3VD3 A;  3FFQ A;  4P9X A;  4B4Q A;  4CSW A;  1AYN 3;  1J3P A;  1EUU A;  3M2M A;  4FPC A;  2HWE 1;  1CAW A;  3E5Q A;  4EE2 A;  1OKO A;  1N3P A;  3O7O A;  3PIG A;  3NJV A;  4LE3 A;  3UET A;  3P3P A;  2Y0I A;  2XVG A;  4LHL A;  5BNO B;  2NMO A;  2UY9 A;  4Z82 A;  5L19 A;  3PUR A;  5EYX A;  1YI7 A;  1YWK A;  4BQ2 A;  5FOJ B;  4XAB A;  3ECQ A;  5T5P A;  4NJ4 A;  5J96 B;  3I2H A;  1Q8Q A;  2X53 S;  1MS4 A;  4LOR A;  1OXC A;  1MVQ A;  3AKS A;  1CGP A;  2D6P A;  4QXB A;  2JKX A;  3TEY A;  2VW2 A;  4DIN B;  3AL6 A;  3ZYR A;  1NLS A;  1QQP 1;  2XL9 A;  4CDQ A;  4CE8 A;  5IW0 A;  4BQ3 A;  1ND2 B;  2A6X A;  4FSJ A;  3J7L A;  5LA1 A;  3WV6 A;  1H6X A;  1GV9 A;  2D3R A;  4A42 A;  2RM2 3;  2HLE A;  3AP7 A;  3LD8 A;  1QNY A;  5CU1 A;  5A1L A;  4I09 A;  4UW6 A;  1O6U A;  4XFB A;  4MXW A;  3KGZ A;  1OF3 A;  2UWB A;  1ULC A;  2BTV C;  2IWG B;  2ZX1 A;  3CHX A;  1ZYB A;  3E6B A;  3EO6 A;  3OUH A;  4XQ4 A;  5KXC A;  2JJ6 A;  2IUW A;  3CJX A;  2XHN A;  4NHK A;  4BME A;  1EUT A;  3NV3 A;  5T5J A;  3DKW A;  3AZW A;  2O8O A;  4XCB A;  1KS4 A;  3UES A;  4D7S A;  1JOP A;  4FI9 A;  4JGY C;  2YBP A;  2P6C A;  5C9A A;  2DUR A;  5JZG A;  2BP6 A;  2B8M A;  2FDH A;  4LUL A;  3KWV A;  1Q3E A;  4M3C A;  2WRA A;  4UYB A;  2WSU A;  2OYZ A;  1ZBE 1;  2ORX A;  3CJI A;  3O0X A;  5BNP A;  2PQQ A;  4XZU G;  2VW0 A;  2VBP A;  2NMN A;  4Q26 A;  4QKD A;  4ONU A;  4PIX A;  5A32 B;  4EN8 B;  4AK3 A;  2JDU A;  1PO2 1;  2R30 A;  3MGU A;  1W8F A;  3SEP A;  1K5M A;  3ILF A;  2GNT A;  5EQU A;  1UD1 A;  5FFO C;  2BVV A;  2ZHM A;  1NLR A;  2WFF 3;  3N9Q A;  4N53 A;  4CYD A;  2WNV A;  5LAT A;  2GH8 A;  5FZA A;  4Y1X A;  3ZFE C;  4IER A;  2ZEZ A;  2ZJC A;  1G9F A;  1V6J A;  3POE A;  2BUK A;  3N35 A;  4QB1 A;  3TEX A;  3USU B;  2WDB A;  1US3 A;  2JDH A;  4LLO A;  2WKK A;  5FWJ A;  4KWJ A;  2ZAH A;  3HPN A;  1FOD 1;  4GJY A;  1NY7 1;  4H55 A;  4HKL A;  3IAP A;  1QXP A;  1W6O B;  1XNC A;  2VBD A;  1UYY A;  2Y33 A;  3K3O A;  4NR1 A;  4RR3 C;  1O5U A;  5EZW A;  2MPF A;  2WJS A;  4XUN A;  1W2N A;  4LHS A;  5LEJ A;  1ND3 B;  2OXB A;  3OGR A;  4TYS A;  4UFI A;  4TXW A;  4ZU4 A;  2FDK A;  5K8S A;  2R1D A;  2ZML A;  5E16 A;  1JS9 A;  2JG8 B;  3WR0 A;  3CZJ A;  3W5M A;  2RR1 2;  3OEA A;  2PHT A;  2ZGR A;  1CAU A;  1O3Q A;  4RQP C;  5A70 A;  1NQJ A;  1PVC 2;  2AEN A;  1RUJ 2;  1DQ1 A;  1XQN A;  1WCU A;  3FMG A;  2PXJ A;  4QWN A;  1V6N A;  3N9N A;  4S2F A;  3VBO C;  1WLW A;  1QEX A;  1BEV 1;  4N43 C;  4X8N A;  2R04 1;  3O12 A;  3M3O A;  5A7W B;  4L2N A;  3E5U A;  4FPO B;  1CIY A;  4KI5 M;  2VUC A;  2LUW A;  4R9D A;  4A6O A;  3TN9 3;  5JXJ A;  5A6Z A;  2D97 A;  4P5H A;  1GUI A;  2FBE A;  5DAV A;  4PLN A;  2IXL A;  3AZY A;  4YGC A;  3ZSJ A;  2XLA A;  2VL4 A;  1DGW A;  1HIX A;  2AYH A;  4P5Y A;  3ZX7 A;  2MEV 3;  1UKG A;  4QQO A;  2GAU A;  4OZX A;  4Q4X 1;  5A80 A;  2CV6 A;  1ZRI A;  4HLT A;  4GKY A;  1RXF A;  2DUQ A;  3GZA A;  1AYM 3;  4QPI A;  1FMD 1;  3GGL A;  3HQX A;  1AXY A;  4LQR A;  4XMI A;  1HQW A;  1RIN A;  1TNF A;  3H3Z A;  2Q30 A;  3T1L A;  5T5O A;  1CAX B;  2HEY F;  4PIZ A;  2R06 2;  4WVM B;  1Q8V A;  1JZ4 A;  4UOJ A;  4P9I A;  3RSJ A;  4P14 A;  4RL7 A;  4E4D X;  1H8T B;  2QBX A;  4OCT A;  1HV1 A;  4XXA A;  3H8U A;  5GLU A;  4CDX C;  1HXS 1;  3I54 A;  4XJU A;  2WS9 1;  3ZFF A;  2WNU C;  1ACC A;  3N36 A;  1HQN A;  4MG2 A;  1XNB A;  1CPN A;  4Q8L A;  4DUW A;  5JR7 B;  2OUH A;  1VBA 2;  2XH6 A;  3VBH C;  4BLJ A;  2ZGQ A;  4DEV A;  2R16 A;  2X10 A;  5BNQ A;  4PCR A;  3AX4 A;  4ISQ A;  1TEI A;  4HAN A;  1TMF 2;  1LES A;  3D6E A;  3EXU A;  3N9L A;  4HOO A;  4LOT A;  4XF4 A;  5EV7 A;  1F8V A;  4NAM A;  4XAC A;  3OOX A;  4GUL A;  4XAE A;  2QDR A;  2WL1 A;  5ACA 2;  2ET7 A;  1BBT 3;  2GAL A;  3CZU A;  4CEY A;  4R9A A;  2RVA A;  4OFG A;  1W8H A;  3ETQ A;  3ZSK A;  2HWB 1;  4B1L A;  2XML A;  3T08 A;  4BHP A;  2HWF 2;  1LUL A;  2IZW A;  2VVF A;  1PX4 A;  1IKQ A;  1VRH 1;  1JH5 A;  2E33 A;  3VDD A;  2W1U A;  1SFY A;  1E5S A;  5KHI A;  4HON A;  2VQA A;  1RUI 1;  1Z0H A;  4FQ4 A;  4NRM A;  1Y9G A;  4GMP 0;  1H2K A;  3P5B A;  3PJY A;  5IAT A;  3MYX A;  4K40 A;  4AFC A;  5HV4 A;  1PGW 2;  1V6L A;  4S2H A;  4RGA A;  3U07 A;  2Y34 A;  1SPP B;  3ZXF A;  4IQP A;  4JRL A;  2GC3 A;  3M3Q A;  3OYW A;  3VZO A;  1W9W A;  2G19 A;  3CKH A;  1O3R A;  4BPZ A;  2FMY A;  1ASJ 1;  1CQ9 A;  2VTX J;  2CTV A;  4TWT A;  2C5D A;  2EIB A;  1UXX X;  4QX7 A;  1FNZ A;  2ZX2 A;  2Y6L A;  4YGB A;  1GLH A;  1QF3 A;  3FJS A;  1IS5 A;  1D2S A;  3KSC A;  5CKM A;  5BNN C;  1IPJ A;  2AUY A;  5CEH A;  2BEO A;  1SLL A;  2QQJ A;  5ABJ C;  3VKM A;  4HK9 A;  2VOT A;  5H9Q A;  1H4G A;  1UY3 A;  3J7N A;  1MZ5 A;  2V09 A;  3DYO A;  3LDK A;  5I8S A;  4YSF A;  5DN2 A;  4SLI A;  4HXC A;  1ZRF A;  3MF9 A;  3UL2 A;  1IHM A;  4R9B A;  1N1Y A;  2CDO A;  3ZFG B;  2OZ6 A;  4LBO A;  4X6Q B;  3UKT A;  4CXY A;  1PO1 2;  1LHW A;  1Y3T A;  1GMM A;  2YPJ A;  3BAL A;  2ZGT A;  3AZZ A;  3WF3 A;  3ST7 A;  1OUR A;  4CCM A;  4YVW A;  1GWK A;  4PJY A;  2HEW F;  2WZP P;  2VOV A;  2XJV A;  1EPW A;  1UYZ A;  4HSJ A;  5JCT A;  1O3T A;  3SC7 X;  2CGP A;  3ZN6 B;  1V0A A;  2RM2 1;  2CAU A;  3B7M A;  2WO2 A;  4ITC A;  2CL2 A;  4DXT A;  3DL3 A;  3ZKU A;  4XYX A;  5I0U A;  4PBP A;  2CY6 A;  3B01 A;  4MGK E;  4LR4 A;  1OQ1 A;  2WIN B;  1QJY 2;  2JD4 A;  3H7Y A;  3MUY 1;  2DVB A;  4FOY A;  3V0A B;  1ZBA 2;  2X09 A;  4AVC A;  4ZKT B;  3VKL A;  4KWL A;  3AYC A;  5ANN A;  4HVR A;  1J84 A;  4AQT A;  1WCQ A;  1WUV A;  4P02 B;  3VBR C;  3WG1 A;  4COV A;  1POV 0;  4BZ4 A;  5M0T A;  1FAY A;  4H14 A;  2Y26 A;  3PUI A;  1CES A;  2Z79 A;  2WWS A;  3OB8 A;  2K46 A;  1Y9M A;  3BU7 A;  3MEP A;  5A1F A;  2XUM A;  4DIQ A;  4Z8B A;  2XWJ B;  2YHJ A;  3AVS A;  3FUQ A;  3THP A;  4Q0U A;  3SHR A;  1L7L A;  5A7S A;  4QX8 A;  2HWD 2;  4ZPI A;  3UNP A;  2FDF A;  2JG9 A;  4LKD A;  2YC2 A;  2PHU A;  2Q0A A;  2A6W A;  4YNI A;  1ZBA 3;  3ZXJ A;  3QD6 A;  2VMF A;  1Q8S A;  2ZXQ A;  3T2P A;  4CCD A;  3QH7 A;  1QU0 A;  4OQ8 A;  2PTM A;  3PVO A;  2E7T A;  4GAL A;  3NNF A;  3AXE A;  5C4W C;  2W46 A;  4GWN A;  1DGW X;  3POI A;  4OHV A;  1YJL A;  1ZZ7 A;  1I9R A;  1JBC A;  1JI6 A;  2GDF A;  3O1P A;  3IDB B;  1Q43 A;  4I0W B;  3ZM8 A;  5JOX A;  5FMO L;  2XPJ A;  2B42 B;  4IGO A;  5FMC A;  3IAQ A;  1JZ7 A;  5FYT A;  1N3Q A;  2GN3 A;  2Y6F A;  3W59 A;  4QHO A;  2W5F A;  4C8D A;  5CAZ A;  4WM8 C;  3HWJ A;  2DVF A;  4LBM A;  4YFZ A;  1WA6 X;  2PLV 3;  2UWA A;  4P9J A;  3VLB B;  1S2E A;  2PHX A;  5C3S A;  2JB8 A;  2VQT A;  1ZNP A;  4AE2 A;  2H0V A;  1MEC 3;  3LPF A;  5E6H A;  5LY1 A;  1CPM A;  3IPV A;  1PK6 B;  1RUN A;  1XU2 A;  1YUD A;  2YC4 A;  5CFD C;  1J58 A;  2RDN A;  2ZCW A;  4DFS A;  2ZX3 A;  4MX3 A;  3NAP A;  3OSD A;  3NNG A;  5CG8 A;  3OBZ A;  1O4Y A;  2UUR A;  2PA7 A;  5HCA A;  1V6I A;  3BI3 A;  4AFB A;  3B9I A;  1XNK A;  3LQC A;  3APB A;  3DPR A;  3FX3 A;  3TN9 1;  1ZX5 A;  2OQ6 A;  4PLO A;  3TBD A;  2YRO A;  1B35 A;  4QMA A;  1VBE 3;  4DXZ A;  1KXG A;  5L7O C;  1W9T A;  3MIE A;  2C1F A;  1Z7S 2;  1QDO A;  2YB7 A;  4TLG A;  2ZGL A;  3GJB A;  2RR1 1;  4YG6 A;  3VBF A;  3LA2 A;  1N1T A;  5DZG A;  1EV1 2;  1PVC 1;  1AYM 1;  4UW4 A;  4XBQ A;  3TYJ A;  1RUJ 1;  4YVS C;  1QY4 A;  3JBG 3;  3B3Q E;  5I91 A;  3LKJ A;  2ZHN A;  1HW5 A;  4BJ0 A;  1AZD A;  1R1Z A;  1G8W A;  3M8L A;  2HWC 2;  1UMZ A;  4YM1 A;  1W28 A;  4I01 A;  5I0D A;  3OPT A;  5GZD A;  1JHN A;  3WVJ A;  1R08 2;  4GXL A;  2GNB A;  3IDC B;  4XE9 A;  1K3I A;  4R8H A;  4TTG A;  3NVC A;  1OPO A;  1SDD B;  3FLT A;  4XFG A;  4AEJ A;  1W8Z A;  4XFA A;  4XHX A;  4LBL A;  1WBF A;  5FUI A;  1JYN A;  1NCR C;  1HB4 A;  1NQD A;  4B7K A;  3B9C A;  1OOP A;  3WG2 A;  3HBK A;  5JOZ A;  1H9W A;  1DYK A;  4YW5 A;  5LWB A;  4Y4Y A;  1W6N B;  2P37 A;  2VZS A;  3FHA A;  4Q5O A;  1ZRC A;  2OVU A;  4Y20 B;  3UGG A;  3N7M A;  5F3I A;  3MIB A;  1F31 A;  4BA6 A;  2P1B A;  3ON7 A;  5JXH A;  3AMN A;  5JLV A;  3Q8E A;  3RWN A;  2HEV F;  2R06 1;  1UOB A;  2FD8 A;  1SCS A;  3PDQ A;  3E1F 1;  1AVB A;  1UIK A;  1UF2 C;  4L0P A;  1KFU L;  4LMF A;  3AYD A;  5K0U B;  3LFI A;  3VKO A;  1OH4 A;  4YVW C;  2WBK A;  1HX6 A;  2YMZ A;  2CHH A;  1VBA 1;  3VBS B;  3S0M A;  1S0D A;  1YFW A;  1QXR A;  4AED C;  1V70 A;  2CWM A;  4NAO A;  1WWY A;  1XNA A;  3ZR5 A;  1YIF A;  4A2U A;  4BXS V;  3ORJ A;  5CVR A;  4Y5S A;  1RGS A;  3HT2 A;  5JOY A;  5FZB A;  4GKX A;  3C8X A;  2VU9 A;  5ACA 1;  4N7U A;  5FZO B;  4D69 A;  3CQO A;  2TBV A;  4JKL A;  2ZZQ A;  1NXM A;  4K8F A;  3BOD A;  2WO7 A;  4FFI A;  4P9L A;  4QX3 A;  3VUO A;  4HET A;  1JYW A;  3O1V A;  2DDU A;  1HJF A;  2V73 A;  5CFC B;  5BPX A;  2Z4F A;  2WC2 A;  2RS3 2;  3BTA A;  3L2Y A;  1PGL 2;  1O4T A;  4X8P A;  4AFM A;  4F3J A;  1WW4 A;  2ZS6 B;  4DMI A;  5FZD A;  2UYB A;  5FDB A;  3RZZ A;  5A6Q A;  5EXO A;  3WD5 A;  2SLI A;  5FY5 A;  1X9T A;  4EN0 A;  1YXW A;  1UPI A;  4YW2 A;  1UOJ A;  2Z2S B;  5F9T A;  5KC6 A;  4AXO A;  1ENR A;  1GNY A;  3KF3 A;  1US2 A;  5FPB A;  5G05 L;  4GWI A;  4BH9 A;  2GC0 A;  1VBD 2;  2XVK A;  3DEC A;  4AL9 A;  4AFD A;  3ZN5 A;  4BB3 A;  3DXT A;  5KXB A;  4AF9 A;  2YV8 A;  5D2A A;  4C0B A;  4CCO A;  5T50 A;  4KU7 A;  4PT6 A;  4DUX A;  1D4M 2;  1KS5 A;  2RJK A;  3LFM A;  3VHN A;  4OUM A;  3I3M A;  1QQP 3;  2VOK A;  1RHI 3;  4W6Y A;  4ZY9 A;  1URX A;  2ZGK A;  3LB9 A;  2ERF A;  2VE1 A;  3RI9 A;  4XMA A;  2J1R A;  4ISR A;  3C7E A;  1G9B A;  5DG2 A;  4KBZ A;  1MZ6 A;  3FHQ A;  4FTE A;  3VD5 A;  4M4P A;  5KC5 A;  2VZV A;  5IFT A;  1MQT A;  2ARB A;  1WCD J;  5I8T A;  1VAM A;  2ZAB A;  3E6D A;  3H42 B;  4XF0 A;  4CEW B;  3SH5 A;  5B4X A;  2VG9 A;  3L2H A;  5FBZ A;  1RUF 2;  4MSV A;  2VNR A;  5FRA A;  1LOF C;  1NCQ C;  1PO1 1;  2GSY A;  2A7A A;  2VUD A;  2A3Y A;  4UF0 A;  3KMH A;  2WZR 2;  4BQY A;  5KHH A;  5A7O A;  4Y5Z 0;  1QHD A;  4LBN A;  2YBK A;  1ZBE 3;  4WM7 B;  3MDP A;  5FYB A;  4D3W A;  4D7T A;  1DBN A;  2X5I C;  3KS7 A;  4PI2 A;  3NJX A;  1LHO A;  3OCP A;  5CAD A;  1JU4 A;  3MUZ 1;  4URT A;  5E88 A;  1PO2 3;  1WMX A;  3SKJ E;  1HB2 A;  3ACH A;  1S0I A;  4HPK A;  2VZO A;  3ASI A;  4DPN A;  4FFF A;  1GZ9 A;  3DV8 A;  3USU A;  1YEW A;  1FX5 A;  4FPY A;  2VTF A;  5IVC A;  2PEL A;  2YFZ A;  1ZBA 1;  2WO1 A;  4HKO A;  2MHF A;  4JGZ B;  3FC0 A;  1NXD 1;  3OD0 A;  4XUT A;  3AP9 A;  4YYO A;  3KGL A;  2RJL A;  1W99 A;  2QE3 A;  5FY0 A;  4CCN A;  2WNO A;  5JIU A;  1VBB 2;  1FOD 3;  3MV1 1;  5A3N A;  3PU3 A;  1DG6 A;  1BKZ A;  3TEZ A;  4FPF A;  4FQZ A;  3QLQ A;  4O9E A;  4AVS A;  2E31 A;  3QCW A;  1GZC A;  2BOI A;  2GMP A;  4FPJ A;  5FYH A;  1CZS A;  1RUD 2;  2HWD 1;  1BVV A;  1QOS A;  2CDP A;  1V6M A;  2QQL A;  3T2Q A;  1OOP C;  5H9S A;  4CPB A;  1U0A A;  4J1W A;  3A23 A;  4MHU A;  3RG0 A;  2A3W A;  5C8C B;  3KT4 A;  1JOJ A;  4FOV A;  3OTF A;  4FXG B;  1S0B A;  3UT0 A;  1C8M 2;  4SBV A;  5LCW L;  5FPL A;  5FZ1 A;  1EAH 2;  2DCT A;  4OI2 A;  5A7P A;  5LRR A;  4D6Q A;  2OA2 A;  4JGY A;  2ZA9 A;  1HRI 2;  4YPJ A;  3ZYJ B;  3BUC A;  4GJZ A;  4QPG B;  1E5I A;  4XF3 A;  2V4A A;  4U2A A;  2XB6 C;  4LOS A;  4EV0 A;  2VD7 A;  2JKB A;  3IDE A;  1F35 A;  1APN A;  4GWM A;  4BIF A;  4EJR A;  4OUE A;  1BVP 1;  4Q4X 3;  5J98 B;  3WCS A;  4L9B A;  1VBE 1;  3I3D A;  1PHM A;  4JC1 A;  5FZ8 A;  3VL8 A;  5BXX A;  5F3G A;  2RDS A;  3T4V A;  1UWW A;  2E26 A;  2IVI B;  5FPU A;  2D93 A;  3PLQ A;  3WP5 A;  3ZFE A;  2X8K A;  2RS5 3;  3SCF A;  4CUA A;  3PME A;  2LAL A;  5FLH A;  1FI2 A;  4QGN A;  2XQX A;  5A7Q A;  1IS4 A;  4O61 A;  3RZM A;  4WZC A;  4ZZ8 A;  1HDK A;  2R07 2;  5CZK A;  3J26 N;  4Q4W 3;  5D8A A;  4RR3 A;  4Q8K A;  3SH4 A;  2WS9 3;  4XJW A;  3K51 A;  4CDU B;  5FYM A;  4HZF A;  3DN7 A;  3DXU A;  1WLD A;  1DLL A;  3OD4 A;  4OMD A;  1VPH A;  5BNO C;  2A6V A;  4CDW B;  2WQZ C;  4FVV A;  5EHD A;  1TME 2;  1Z7S 1;  3RWK X;  3G7D A;  4B8E A;  5F5C A;  3M4F A;  4E2G A;  4QU2 A;  1H2N A;  2EIC A;  4RQP A;  4AGV A;  1FNY A;  2VTX A;  5HCH A;  4IUG A;  3ZMN A;  2ARA A;  2OII A;  4C0H A;  5K4L A;  2EAL A;  2QQP A;  2HBU A;  3NL1 A;  1QJU 2;  3VBO A;  3AFG A;  4N43 A;  3NJY A;  2GN7 A;  3LZZ A;  1XRU A;  1ND2 C;  2R7E B;  3W58 A;  1JYX A;  3ZKY A;  3BTY A;  4RS5 B;  2BVB A;  4WVZ A;  1CJD A;  3L9J T;  2WT2 A;  5IVV A;  3WQ0 A;  2C24 A;  5F5A A;  1DU3 D;  3FLR A;  2A70 A;  2CWS A;  1UZY A;  1RYY A;  1X8E A;  2VC9 A;  2UU8 A;  3H8O A;  2VEC A;  4GB3 2;  3ZXK A;  3RFR A;  4HVQ A;  5KR7 A;  1F4H A;  1ODM A;  5DUW A;  2C4X A;  4PQQ A;  1JXN A;  2RMU 2;  1OBN A;  3KQ4 B;  3UV9 A;  2V72 A;  4PLM A;  3GF6 A;  1MAC A;  1JN2 P;  1XND A;  1KQR A;  1XB9 A;  2VUA A;  3HNY M;  1ASJ 3;  4LBQ B;  2VMI A;  2K0G A;  4P00 B;  3RVH A;  2DFB A;  5JPN B;  3ILN A;  1G9D A;  2W87 A;  1RUH 2;  2ARE A;  3WQ7 A;  4CDX A;  2IXH A;  5FR3 A;  1JYV A;  1K42 A;  4JDO A;  1W9Y A;  4PDW B;  2DTY A;  2WNU A;  3RZL A;  4LEJ A;  2BJS A;  3ENR A;  4GA9 A;  3I2I A;  4GH4 B;  3VBH A;  4COZ A;  1LGC A;  1WKY A;  4YG3 A;  2WT0 A;  4YFW A;  5IHR A;  4OZO A;  1M4W A;  2J1A A;  4LUM A;  3QOP A;  3I3Q A;  4IGQ A;  4MAD A;  1A3K A;  5F2W A;  1WLC A;  1ZZ9 A;  3PU8 A;  1TNR A;  5CKN A;  1RMU 2;  5A3W A;  4PF1 A;  3WEZ A;  1Y9Q A;  3O0V A;  1UY4 A;  3DGT A;  1W8O A;  4XXP A;  1AR7 2;  1DHK B;  4HFS A;  1BQP A;  3AZX A;  3J8F 2;  4ASM B;  4ATE A;  4AYU A;  5D1I A;  2XKP A;  2IC1 A;  2QQM A;  4LO8 A;  4AHZ A;  1OFN A;  3AMM A;  1PGL 1;  1RHI 1;  1ND3 C;  3DKQ A;  1HLC A;  2R6Q A;  2QZ2 A;  3N9P A;  2JG8 C;  1FXZ A;  1GNZ A;  4QPY A;  4Y5T A;  5C3R A;  3VKN A;  3C3V A;  2RG4 A;  2J22 A;  3KT1 A;  5DDJ 2;  1SBF A;  4BMB A;  2PMW B;  4BOW A;  1HRV 2;  4NO4 A;  4XHB A;  4NHX A;  5A3O A;  1PMJ X;  5L73 A;  1W2A X;  4E4S A;  4QDS A;  3WUD A;  1I5Z A;  4PBO A;  1SFP A;  5K7P A;  3TB0 A;  2ZAA A;  1K12 A;  1OVS A;  1D4M 1;  1IGO A;  2HKX A;  2OPW A;  3IIA A;  5EPA A;  3AK0 A;  3TWI A;  4XFH A;  2FDG A;  3QAC A;  2JWP A;  4I30 A;  3GCX A;  2UYA A;  2F4L A;  2JXA A;  5BNN A;  2EIG A;  3JD7 2;  4BCU A;  3QBQ A;  3AP6 A;  5ABJ A;  2YG0 A;  1H30 A;  5GZF A;  3U4X A;  1FV2 A;  3VB9 A;  1AR8 2;  1LEM A;  1YQC A;  3VBU B;  4JDM A;  2BGO A;  5FO8 B;  2B39 A;  1WLT A;  1W3V A;  3MHZ A;  2VZQ A;  5DAB A;  3M1H A;  1AX0 A;  3DUI A;  4O65 A;  4J6G A;  1NA1 B;  1RUF 1;  3I2J A;  3JZV A;  3VD7 A;  5FPA A;  4CCK A;  1H8T C;  1UY0 A;  1WD3 A;  3D5O A;  1ZZB A;  1HKD A;  4KG0 A;  1K5J A;  1UCX A;  4A3X A;  3EYP A;  1OKQ A;  2ZTN A;  4HN1 A;  2VCC A;  2WZR 1;  1PGS A;  1MS0 A;  5I0R A;  3M3I A;  4QB2 A;  2HBT A;  2Q1Z B;  4IV3 B;  4A7Y A;  1MS8 A;  3NNL A;  1GR3 A;  5FZH A;  1MZF A;  1PZ8 A;  5DUX A;  3O14 A;  2FZ2 A;  2XQR A;  1CAV A;  2ZMK A;  5J09 A;  4W4Z A;  1W6M B;  1LGN A;  4D7Y A;  2IXK A;  4XIL A;  1KIT A;  2VCA A;  1RUG 2;  2OX0 A;  3LIH A;  2RDQ A;  3O1U A;  3UGH A;  4IEU A;  3VBR A;  3I59 A;  4FTS A;  3OY8 A;  1VBB 1;  4YM2 A;  3WP4 A;  3WQB A;  3GZU C;  5FPX A;  3WNL A;  3RZH A;  2JE8 A;  3WIN E;  3ZYB A;  4NUB A;  5A33 B;  1RUD 1;  5B2G B;  1O3S A;  2RR1 3;  2TUN A;  4UAP A;  4JVA A;  2UWC A;  1S2B A;  4MHR A;  5I0T A;  3WDX A;  1GQH A;  1PVC 3;  4CXW A;  1Q5O A;  1RUJ 3;  1IPS A;  1HB1 A;  2Y6K A;  4Z1V A;  2DYC A;  1FPN 2;  4IV1 B;  1C8M 1;  1VB2 A;  5G04 L;  5C4W A;  1EAH 1;  2VMH A;  1ZRD A;  2ZEX A;  4YLZ A;  1SQ4 A;  1GFF 2;  5IJR A;  4BQ4 A;  2JB4 A;  2RS5 1;  3LEM A;  4BQ1 A;  1W0N A;  1QKQ A;  3I49 A;  2JIG A;  1OLQ A;  2VZR A;  4EYU A;  5HXV A;  4NPL A;  4NHM A;  3M70 A;  4TZD A;  5FLI A;  3T3Y A;  2DCK A;  3NJZ A;  2WN3 A;  4Q4W 1;  1EP0 A;  1ZZC A;  5F6L B;  5FZ0 A;  1W6N A;  4LO7 A;  4WM8 A;  4WZF A;  2F6B A;  1F5F A;  5E1R A;  3F2Z A;  1AR6 2;  4AGG A;  4OLL A;  1XE8 A;  1Y7B A;  1CVN A;  3MLJ A;  4UT5 A;  3ZFG C;  4WV8 A;  2VME A;  5LBE A;  2VOX A;  4MET A;  1L3J A;  3O1T A;  2ZPX A;  4Q27 A;  5DAP A;  5FXV A;  2QTW B;  4ZXE A;  3ZDV A;  2WQ4 A;  2BFU L;  3H3U A;  1W8U A;  2FZ1 A;  4NRQ A;  4CA9 A;  1PMH X;  5CFD A;  1AR9 2;  2JEC A;  4XTM A;  5IVF A;  1JYT A;  2ZMN A;  1XU1 A;  4IXL A;  2DU1 A;  2R06 3;  1S0C A;  1FT9 A;  1VMF A;  3MPP G;  2J1U A;  1BLZ A;  1CZT A;  2R07 1;  2WYS A;  2XVL A;  3AXD A;  3H1Y A;  1GSL A;  2PN5 A;  1DZQ A;  3VBS A;  4AVB A;  5HCF A;  3AMH A;  4YM0 A;  1RUC 2;  4D94 A;  1F4A A;  1LHN A;  2DV9 A;  3BTZ A;  1X7N A;  3POW A;  2D6O X;  1JZ8 A;  5L7O A;  1OH3 A;  1VBA 3;  3BYW A;  2BBV A;  1TME 1;  2XG3 A;  3X29 B;  4BU2 A;  5I0S A;  1C1L A;  2ZGN A;  3WF4 A;  1R1A 2;  2AC1 A;  3Q8A A;  1TMF 3;  1IZ3 A;  5F32 A;  2PAE A;  4YVS A;  2HYX A;  1GOF A;  1KJR A;  4ARX A;  2EXI A;  2AZ5 A;  5ACA 3;  5K9Y A;  2WFP A;  4CRQ A;  2A6Y A;  4IE4 A;  3D0J A;  1E5R A;  1QJU 1;  3EJK A;  3SXW A;  1GZW B;  5CB7 A;  1F2N A;  2G1M A;  2BWA A;  3BOW A;  3CO2 A;  3WF1 A;  3IMN A;  2HWF 3;  5C3P A;  3IWZ A;  2Q8D A;  5KHG A;  1S1A A;  1LNS A;  2IXJ A;  3HNM A;  3T0B A;  5KXD A;  2W1W A;  2H0B A;  5JXG A;  1BZW A;  1VB4 A;  3ATG A;  1NCR A;  5C3O A;  5JXI A;  2VMG A;  1B09 A;  4Q4V 2;  5FZE A;  1R1A 3;  1LJ7 A;  1C5H A;  4GB3 1;  1PVX A;  1SDW A;  2YU2 A;  4Y22 B;  1SCR A;  5F8P A;  2ZHL A;  4MXV A;  3RPQ A;  3I2F A;  1YRZ A;  3ZVX A;  5FO7 B;  2JDY A;  3WP3 A;  3KV4 A;  1VAK A;  2VJX A;  4MGI E;  4UFJ A;  3HN3 A;  4XBN A;  2RMU 1;  2K2S A;  4CUG A;  1GOG A;  1CZV A;  1LCL A;  1GU3 A;  2YU1 A;  3V0B A;  2CGN A;  2R1B A;  2B4K A;  3A0K A;  3R4D B;  2J1S A;  4CXX A;  3NV2 A;  4AQS A;  2WLP A;  5LK5 A;  2DF7 A;  1RUH 1;  1ALY A;  2LRP A;  4QM8 A;  2W39 A;  2NPI A;  4BDV B;  1ENX A;  1PIV 2;  1VMJ A;  4YGE A;  4Z2W A;  5HV0 A;  4ORF A;  3KV6 A;  2IFW A;  4RFT 0;  5HXM A;  4YW3 A;  3SEE A;  5CA6 A;  2FDJ A;  5SV5 A;  1VJ2 A;  3WNX A;  4AED A;  4CP9 A;  2XJS A;  2YDE A;  1CAW B;  5GAL A;  4CU7 A;  4R4X A;  4GD4 A;  1PK6 C;  3T30 A;  2VO5 A;  3MIC A;  3POG A;  5AVA A;  5LK7 B;  3RRD A;  5GKA C;  1XSR A;  3HQU A;  3K46 A;  2G9G A;  1UOG A;  1SLT A;  3RNS A;  4ZHN A;  1LU2 A;  1PO1 3;  2HH9 A;  2QNK A;  1SEF A;  3CBN A;  1NZC A;  1BMV 2;  3GXU A;  2ILM A;  5FYS A;  1AR7 1;  3CNA A;  5EWS A;  3K4A A;  3H7J A;  2J1E A;  2VZ3 A;  4IE5 A;  2Y6J A;  4QU1 A;  3UK9 A;  2D6M A;  3KHC A;  3PVN A;  3RMX A;  5JI9 A;  2QCS B;  4JTN A;  5FK8 A;  1DQ2 A;  1YFU A;  4CDQ B;  3T2T A;  2G9F A;  1D4V B;  3N7L A;  4LE4 A;  4Q4Y 2;  4XF1 A;  5A7N A;  4V1P A;  4ASK A;  5DDJ 1;  1CWP A;  1FAT A;  1E5H A;  2W68 A;  3OBR A;  4KH9 A;  2W91 A;  1H2M A;  3H0O A;  1QJY 3;  4MXW B;  5LY2 A;  2D6L X;  4MUV A;  1CON A;  2LS6 A;  3LDB A;  4K6B A;  5JVV A;  2B45 X;  2VCB A;  3B02 A;  5JPM B;  4NIH A;  3CDZ B;  4GMP 1;  4QT6 A;  1EY2 A;  5E89 A;  3VV1 A;  2AEZ A;  3B69 A;  4IEP A;  3III A;  4Q0P A;  1LEN A;  5C5U A;  2B46 X;  1DP0 A;  2JDN A;  4FXK B;  3BVC A;  1OQE A;  3OGG A;  4XC9 A;  3WDW A;  4YZ5 A;  5C9A B;  5IVB A;  5JZG B;  3VHO A;  1RL3 A;  5ERL A;  3BB6 A;  3WDU A;  3ZXD A;  2HWD 3;  4M3C B;  5A3U A;  1X50 A;  2ATF A;  3GBG A;  4BK4 A;  4AAX A;  2RE9 A;  3CJI B;  4LTA A;  5BNP B;  2VVE A;  4DY3 A;  4O7X A;  3WX5 A;  1LOF A;  1NCQ A;  3S7E A;  1RUE 2;  3ACF A;  1W6P A;  1K5M B;  3U14 A;  1R09 2;  3H3L A;  5GLW A;  4Z2A A;  5IK4 A;  5IK7 A;  3MW3 A;  4N53 B;  3WNM A;  2WNV B;  4XUQ A;  2V5D A;  3TOJ A;  5K0U C;  1C8N A;  3T2O A;  3UKV A;  4WVV A;  1QJZ A;  1RC6 A;  1WMF A;  3D8C A;  3EQE A;  4COY A;  3NMB A;  1YQ2 A;  1SZB A;  3I3B A;  3ZXG A;  2X5I A;  3ES1 A;  3VBS C;  2PYT A;  2FHR A;  3IM0 A;  5F2S A;  2DUP A;  1F5J A;  1N47 A;  4Y1U A;  2B9U A;  2L9L A;  5CBL A;  4N9H A;  5FQ0 A;  5DAX A;  4NOT A;  1CIW A;  3V64 A;  2QQV A;  5DQ0 A;  3GAL A;  4QDR A;  1Y4W A;  2ES3 A;  1UY1 A;  2B7Y A;  2JDM A;  2WSV A;  5F39 A;  3K48 A;  4RYD A;  1OI6 A;  1W3X A;  3OBT A;  4NRP A;  4AR2 A;  4NIG A;  4H7L A;  5CFC C;  3EBR A;  2VVD A;  2OZJ A;  1CAU B;  1KJL A;  5J37 A;  2Z42 A;  1YYN A;  2YC0 A;  3ETP A;  4QGM A;  2QZ3 A;  4KGG A;  3ZYF A;  1YNA A;  4YW6 A;  5LA9 A;  4YM3 A;  3VZJ A;  3BGA A;  4CDW A;  2WO3 A;  2E63 A;  2VMD A;  4MGY E;  2ARX A;  5A6X A;  1WD4 A;  5FBJ A;  4JV4 A;  4BE3 A;  5FYI A;  1Z7S 3;  2XR4 A;  4IE7 A;  5T3N A;  1VR3 A;  3AC0 A;  5L36 A;  2HYK A;  3H1W A;  1EV1 3;  1ONA A;  1POV 1;  1UPS A;  3JCI A;  4N9I A;  4LHN A;  1RED A;  1W8T A;  1FPN 1;  1RJ7 A;  4ES8 A;  2HWC 3;  4LPL A;  4OYU A;  2ADD A;  1UMH A;  2ID4 A;  2W08 A;  4QPI B;  3RS6 A;  3WW4 A;  4D0Q A;  5KXE A;  1LTE A;  4QB6 A;  2C6S A;  3BOP A;  5F3E A;  1T6G C;  4Z92 B;  1R08 3;  1T6B X;  4GZ9 A;  3LEG A;  1VRB A;  4LA3 A;  5GLV A;  3WDY A;  3BIW E;  5A3M A;  1OLM E;  2PQS A;  5F5I A;  4IEX A;  4JQT A;  2WN2 A;  1NT0 A;  2KM2 A;  3VKF C;  4FFG A;  1AR6 1;  1U12 A;  4R4Z A;  4YW1 A;  2XBO 2;  1Q8P A;  4B7E A;  4CEW C;  3GDB A;  5FY8 A;  3ROU A;  4RHV 2;  1W6Q A;  2Q1F A;  3NNM A;  3ZFF B;  5JMC A;  4Y1Y A;  3AP4 A;  5T54 A;  5KWR A;  4XTP A;  1MS9 A;  2P34 A;  1TMF 1;  1WA4 A;  3LOI A;  3AJY A;  4FCA A;  3U11 A;  4E8C A;  1AR9 1;  2P6H A;  5DZF A;  1X36 A;  4IDZ A;  4GQ7 A;  4XJZ A;  1AJK A;  1J3R A;  1ZA7 A;  2ZGP A;  1WBL A;  2QQI A;  1LKN A;  1A8M A;  1ZRR A;  4FBF A;  1MS3 A;  4B4R A;  3MFC A;  3HN1 A;  4A6S A;  2VPV A;  4WM7 C;  5FKB A;  1LB2 A;  2HWF 1;  2WT1 A;  1RUC 1;  4CEY B;  2HWE 2;  5FYU A;  4QQH A;  1DGR A;  1ZZ8 A;  1OT5 A;  1J3Q A;  1QJX 2;  4CP0 A;  2D3S A;  4HK8 A;  4CUB A;  3N7K A;  5BNO A;  3GHN A;  2P3J A;  2D5F A;  1XNT A;  1LOE A;  1BHG A;  3VDD B;  5EFU A;  1W9S A;  1F15 A;  5J48 A;  1R1A 1;  1O7F A;  1QH6 A;  2E32 A;  3ELN A;  3FHI B;  1S0G A;  3OEB A;  4JHZ A;  4K9S A;  2D7F A;  1YI9 A;  4AFA A;  1ULD A;  3WNO A;  4JGZ C;  1MS1 A;  1PGW 1;  5JSO A;  3IZO A;  1S2K A;  4BIO A;  5JOW A;  4YZ2 A;  4NWV A;  5T55 A;  1G9A A;  4OUS A;  2TNF A;  5FMO S;  1V9U 2;  3HD8 B;  5FV3 A;  5FXX A;  1OPM A;  3T09 A;  1ND2 A;  2GC1 A;  3VZK A;  2P17 A;  4FP2 A;  1DQ0 A;  4JRA A;  2D44 A;  3OYW B;  3SIT A;  4C1X A;  2RS3 3;  1C28 A;  5HBA A;  3HQR A;  2R32 A;  4JX0 A;  4OUL A;  2QQW A;  2VOW A;  1DYP A;  4XUO A;  2LW8 A;  5FZC A;  4JDN A;  4Q4V 1;  3ZPY A;  3E6C C;  3OGS A;  2QFE A;  2FDI A;  2R49 A;  2YGM A;  3FLP A;  5I93 A;  3LOB A;  2BGC A;  4IND A;  4L97 A;  1NZI A;  2JDA A;  5C8C C;  2QDN A;  1UX6 A;  3WW1 A;  4NRO A;  5FK7 A;  3VHR A;  1VBD 3;  4R52 A;  4W65 A;  2AR6 A;  4QPG C;  3ZLI A;  4F83 A;  3I2O A;  1GBG A;  2CU5 A;  4M3C F;  1C4R A;  1D4M 3;  1DQ4 A;  1RVF 2;  3FE5 A;  5DAW A;  2D3P A;  5E8A A;  4AVA A;  1D7P M;  1MS5 A;  3NV4 A;  4F7Z A;  1WMD A;  3MLK A;  1ZZ6 A;  4AEM A;  4E4H A;  5EJ1 B;  2OUJ A;  1W03 A;  5FP9 A;  4ES9 A;  5A32 A;  1M06 G;  1CR7 A;  5DZE A;  1XXN A;  2V5Y A;  3AP5 A;  3JXS A;  1IS3 A;  2QQN A;  3WSO A;  1LGB A;  3BPZ A;  5APA A;  5EJ3 A;  3ZR6 A;  2Y6H A;  1QH7 A;  4O9G A;  1RUO A;  1W06 A;  5AC9 2;  3WP6 A;  4FTB A;  4DB5 A;  3K77 A;  2R0F A;  1I1E A;  1RUF 3;  1WW7 A;  1LHV A;  1JW6 A;  2I07 B;  1QJY 1;  2A6Z A;  4DQA A;  1BMV 1;  3Q8B A;  1VBC 2;  2YY1 A;  1PNF A;  4KU8 A;  3P6B A;  1UYX A;  3PUA A;  4Y33 A;  1W6O A;  2WZR 3;  2WA3 A;  3OBA A;  3VHP A;  1R64 A;  4XW3 A;  3THC A;  4CDU C;  2BPA 2;  4K1Z A;  4NVP A;  3ME2 A;  4B1M A;  3S7I A;  1ND3 A;  4URA A;  4FPG A;  5DUV A;  4KBB A;  4CDW C;  4ERO A;  2JG8 A;  4DXS A;  3WT3 A;  4QPW A;  3K4D A;  1ZRE A;  1LOB A;  4BQ5 A;  2D5H A;  3T0D A;  2WA4 A;  2J1T A;  3KCY A;  2ZHK A;  1STM A;  5GLT A;  4EWD A;  1GYK A;  4TLF A;  1HB3 A;  2CGO A;  2QQK A;  4CP2 A;  2ARC A;  3WW2 A;  1W0P A;  1PNG A;  5FZ7 A;  4UW5 A;  1WZX A;  1C1F A;  4J25 A;  5A7W A;  1FYU A;  2I2S A;  3P3N A;  3MFA A;  1GKB A;  2JG9 B;  4RS5 C;  5CIR A;  2OPK A;  3MIH A;  2BOJ A;  1BEV 2;  5GZE A;  2XDV A;  3RI8 A;  5DXD A;  2R04 2;  5FP4 A;  3RGB A;  3WG3 A;  1VBB 3;  5I8Y A;  5FO9 B;  2YXS A;  2W92 A;  2DFC A;  2AAC A;  3WHU A;  2BZD A;  3W20 A;  3KV5 A;  1BK0 A;  5JMO A;  4XQW A;  4MYE A;  2W95 A;  5GZC A;  3J7M A;  1YC6 1;  1RUD 3;  3R05 A;  2FMD A;  3MV0 1;  1T2X A;  3CL1 A;  1I3H A;  2RJ2 A;  2EAA A;  4QX2 A;  2E9Q A;  2VNG A;  2E53 A;  1CAX A;  1W04 A;  3OUI A;  1FMD 2;  1CD3 G;  1O5L A;  1C8M 3;  4WVM A;  5FAX A;  2BQP A;  4HSL A;  1EAH 3;  1H8T A;  1RUE 1;  2PHF A;  3OUJ A;  4FPE A;  5DAQ A;  5FUN A;  2JEN A;  1HRI 3;  4XUP A;  4OI1 A;  3B5L B;  3WXP A;  3NKT A;  3I2G A;  5IAX A;  1MR5 A;  3IPV B;  2SBA A;  4PDW C;  2VXJ A;  1MZE A;  3HT1 A;  3ILR A;  4LO6 B;  2PHD A;  4GH4 C;  4AHY A;  2VQU A;  1HXS 2;  3SMH A;  3MF6 A;  2DBN A;  3NAP B;  4FFH A;  4S2D A;  5AFB A;  2VNO A;  3FWE A;  4FPH A;  1NUK A;  4PF5 A;  5T52 A;  3SQO A;  1H1I A;  4LO5 B;  5ISL A;  3CU7 A;  3ZMO A;  1B35 B;  3VL9 A;  1EV1 1;  1BYH A;  2WII B;  2E7Q A;  4YW7 A;  1TVG A;  1DFQ A;  2YZ4 A;  1QWR A;  2WUH A;  3VBF B;  5FZM A;  1SLC A;  2EF6 A;  2HWC 1;  3INA A;  5A3P A;  2R07 3;  1OSG A;  2HWB 2;  1GIC A;  4K1Y A;  4AZZ A;  3CF6 E;  4I3P A;  3C7H A;  1YIP A;  1R08 1;  2XUE A;  3ACL A;  3WNP A;  4EWA A;  4BM8 A;  4FPL A;  1O4Z A;  4XFF A;  2YPD A;  3GZT B;  1IQD C;  2GND A;  1RUI 2;  3WNN A;  1TME 3;  3BCW A;  2AGS A;  3N3H A;  1SPP A;  3OF1 A;  1VLN A;  2VNV A;  4XDO A;  5JR2 A;  3H8R A;  2VW1 A;  4IW3 A;  1E57 A;  1BJQ A;  1IKP A;  2RS1 2;  1LOC A;  1AL2 2;  5C71 A;  1O59 A;  2VM9 A;  4L8Q A;  4NHL A;  1COV 2;  1QJU 3;  3OG2 A;  4ATF A;  2A1X A;  1UO9 A;  3AKT A;  5JSP A;  1YHF A;  2VZ1 A;  3KM5 A;  2Q4S A;  1AYN 2;  1H8V A;  1LU1 A;  3IBM A;  5JDB A;  4FO9 A;  3Q8C A;  4DRR A;  3ZSL A;  3VBU C; 
#chains in the Genus database with same CATH homology
 4Y5T A;  5L9V A;  2RG4 A;  5LBC A;  5IAT A;  3KT1 A;  3MGU A;  5LBE A;  3NNM A;  5HV4 A;  5EQU A;  2RDS A;  5DAP A;  4NHX A;  2Y34 A;  3KT7 A;  5LAT A;  3EMR A;  4J25 A;  2G19 A;  2RDN A;  2OPW A;  2FCU A;  3GZE A;  5EPA A;  3OBZ A;  5C5U A;  4XC9 A;  3W20 A;  3BVC A;  2Y33 A;  5ERL A;  4BQX A;  4KBZ A;  4JZR A;  2FCV A;  5A3U A;  5IAV A;  3GJB A;  3OUI A;  4XCA A;  3OUJ A;  2HBU A;  5DAQ A;  2G1M A;  5IAX A;  5L9R A;  4BQY A;  3HQR A;  5L9B A;  5DAV A;  4NMI A;  2HBT A;  3PL0 A;  4ZON A;  5LBF A;  3NNL A;  3GJA A;  5DAX A;  5LBB A;  4Q5O A;  4UWD A;  4XAB A;  2RDR A;  2RDQ A;  5DAW A;  2FCT A;  5LA9 A;  5M0T A;  5HV0 A;  4XAA A;  4NHY A;  4ZPI A;  4NAO A;  4IW3 A;  3OUH A;  4MHR A;  3NNJ A;  2JIJ A;  4MHU A;  4Y5S A;  3HQU A;  3KT4 A;  5LB6 A;  4NHK A;  4XAC A;  4NHL A;  5LAS A;  4XCB A;  3NNF A;  3ITQ A;  3W21 A;  4BQW A;  2A1X A;  2JIG A;  2V4A A;  4NHM A;  3DKQ A;  5C5T A;  5EP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...