3OUIA

Phd2-r717 with 40787422
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
190
Chain Sequence
PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 56
structure length 190
sequence length 204
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouiA00
2RDQA 4XCAA 4ZPIA 5L9RA 2HBUA 4Q5OA 4ZONA 4NAOA 5LBEA 4NHYA 5DAWA 3NNJA 5LB6A 2A1XA 2RG4A 3OUJA 5LBBA 5C5UA 2RDNA 3W20A 5L9VA 3HQRA 2RDSA 3DKQA 4JZRA 3GJBA 2HBTA 5HV4A 2RDRA 3NNLA 3GZEA 4XCBA 5EP9A 4NHXA 5LBFA 4BQWA 5EPAA 4NHMA 4XABA 3HQUA 4UWDA 5DAVA 4BQYA 5DAQA 4XAAA 5C5TA 4J25A 5HV0A 4MHUA 2FCTA 4XACA 2OPWA 4Y5SA 3OUHA 4NHLA 3OUIA 5LA9A 3PL0A 3BVCA 3MGUA 5LASA 4BQXA 4Y5TA 3NNFA 5IATA 3NNMA 3KT4A 4NMIA 5M0TA 2Y34A 4NHKA 3KT1A 2G1MA 5A3UA 5IAVA 2V4AA 5LATA 4KBZA 5LBCA 2FCUA 3GJAA 4IW3A 3ITQA 2JIGA 4XC9A 5EQUA 5ERLA 5DAPA 2JIJA 5DAXA 2G19A 3W21A 2FCVA 2Y33A 3EMRA 5IAXA 4MHRA 3KT7A 5L9BA 3OBZA
chains in the Genus database with same CATH superfamily
3ZFEA 2RDQA 3IPVA 3FMGA 5FXWA 3TYJA 4QPGB 1YWKA 1BJQA 1LOFC 5KXDA 1CESA 2EALA 3VD9A 3O1SA 3IBMA 3KV9A 2MPFA 2W1UA 4B1MA 5LBEA 2DUPA 2IWGB 2R1DA 5JXIA 5KXCA 4YSFA 1FOD2 1ND3B 1XXNA 4S2HA 4XFCA 3O7OA 4Q0PA 2BNMA 3TBDA 2ZGQA 3VBHC 1H8TC 5A3LA 1JYTA 2EXKA 2VD7A 1ALYA 4YZ3A 1UMHA 5LBBA 1V6JA 2VNRA 4I3PA 5JVVA 2WO7A 3O1VA 2WBKA 3MYXA 2P17A 1AR72 1FX5A 1VBA2 2ENRA 2PELA 3LD8A 4GJYA 1LR5A 4JRAA 1IPJA 5EZWA 5FFOC 4AZZA 4DRVA 2RR12 1CX4A 3Q8EA 3PURA 2VZRA 3NV4A 1DCSA 1W0OA 1QOOA 3K4DA 3N7LA 4RL7A 1L7RA 3UJOA 2Q30A 3VBUC 5HV4A 1OF4A 2VCCA 3EB7A 5G05L 1RUH2 2P3IA 4NHXA 1LODA 3IKWA 5CZKA 1RUG3 1STMA 3B94A 4FPFA 3OG2A 4JKLA 4XQ4A 2E26A 3DEMA 3POIA 2A71A 2G9FA 2VTXA 4LKEA 2AYHA 1PO21 5KHJA 4YM2A 1WW7A 4H7MA 1XJAA 5HXMA 4AVAA 1AJKA 4GJZA 4XJZA 2P6HA 4Q4V3 2DUOA 1QXPA 2BOIA 1NZIA 2VVDA 3ZKUA 1ZRDA 2XMLA 4LMFA 4DOUA 4PDWC 4AEDB 4EWDA 1CPNA 4UF0A 3ZYHA 3OOXA 3WHUA 3OGGA 2WN2A 1WCSA 3KV5A 3ZXFA 5FWJA 5F7UA 4NWVA 1OLRA 2WABA 4QXCA 3VDDB 5IK4A 5C3QA 3NJYA 2I07B 4K9SA 3C7FA 1TMF3 5LASA 2QQJA 3CLPA 4N9IA 1E57A 1W06A 1ULOA 4EN7B 1GKBA 1MZFA 2JICA 3HMYA 4QXBA 3ALQA 3VBHA 3NNMA 1WKYA 1PGSA 5BV6A 5M0TA 2WNUC 3N9PA 1LGCA 1GU3A 2ZJCA 1CZSA 2ZZJA 1TQ5A 4Q4W2 4EQVA 2R6QA 2W2IA 1PNGA 4Q4Y2 1VAVA 3E6DA 4Z92B 1H2KA 2HEWF 2VZ3A 3BALA 4X6QB 2AC1A 2IC1A 1MS5A 3H3ZA 3J9SA 1TE1B 4WM7C 3T08A 4HZFA 5C9AB 3ZYPA 5F5AA 3ORJA 4I09A 1V9U3 3ZFEB 3IPVB 1UXZA 4K1ZA 4NPMA 2ZHKA 4TXWA 1OKOA 5J96B 4GIQA 1HXS1 3BOPA 4O9GA 3ACFA 2WLPA 1GOGA 2VZ1A 4E4HA 2C4XA 2W1WA 3H1MA 3KV4A 3T1MA 4ZZ5A 4GXLA 1SEFA 3A21A 3P3PA 1PIV1 2VECA 4RFRB 1AYM1 3AP6A 3H50A 1Y9GA 3E6BA 1WZXA 3ACIA 4D7TA 2WFF1 3ZXEA 4AQTA 2QDNA 4OVEA 1O3SA 3C7HA 2HWC3 5A3MA 1R1A1 1S0FA 2R072 3K3OA 3JBG2 3M8LA 1XE8A 4HN1A 5FXXA 1LCLA 1HN1A 4Q5OA 2B39A 3CU7A 3WW1A 4CXYA 3SH3A 3ZYIB 3OCPA 2VBDA 1WCQA 3PUQA 3N3HA 2XB6C 2VMIA 1XSRA 3ZDSA 2RJLA 5FUIA 1VAKA 1CGPA 5FO7B 4E2SA 2FMDA 4IE7A 3AVRA 2IXKA 4X8PA 4ARYA 4GD4A 3V0AB 5SV5A 4D6SA 2DVFA 2PLV2 2NP0A 1JHNA 1CAXA 4YVWB 2WNVA 1C1FA 4WZFA 1YQ8A 3HN3A 5FTTC 4XUOA 5JAXA 5A3OA 3HNBM 2FQPA 1EAH1 2FDJA 3HQRA 4HK8A 4EN8B 1O3RA 4RS5A 3WV6A 4DIQA 5GZDA 4JZRA 1MVEA 3AJYA 2W68A 3GJBA 5J36A 1JYIA 3I2KA 1JZ4A 1OFNA 1QJU1 3GZEA 1HRV1 1OD3A 2FDIA 1ONAA 2TBVA 2HWE3 1NLQA 3G7DA 3HN1A 3P1IA 4NOTA 2ZX1A 2XWJB 3PDQA 5LBFA 3BGAA 5IVYA 3M4FA 3ZFFC 1KGYA 4QHZA 1RITA 2B4KA 5F2SA 1HB4A 3IDAA 5A3WA 3WQ1A 2E31A 5C5TA 3I3QA 1JN2P 3OBRA 3RZKA 3HEIA 5F5CA 3QCWA 3RI9A 4A42A 1R64A 2OA2A 1EV13 1NA1C 1PO11 1M4WA 1W6OA 3M3CA 3ZKYA 4FT8A 1JODA 3POWA 1IS3A 2OQ7A 2GU9A 4XETA 3KHCA 1AR83 2A6XA 3UKVA 2WL1A 2ZHLA 1QJY2 1CIYA 5LWBA 3GCXA 1S0EA 2GC1A 1DGRA 2YFUA 1QQP2 4IUGA 4P5YA 5A7QA 4COZA 5CFCA 1XYOA 1UY2A 1UOJA 4XF9A 2PQQA 5FZ6A 1ZNPA 1W9TA 5GLWA 3KS7A 2ZGTA 1PGW1 1CWPA 1NE6A 2GP3A 3VBRC 3HBZA 3OGVA 3Q8CA 1ULGA 3QACA 4O9EA 5E1RA 5F3GA 3WNKA 2AR6A 1G9DA 1O4TA 2VZTA 3IMMA 5FZGA 5GKAC 1U12A 4CXXA 1RUI2 3NSTA 2AREA 5FWEA 2XQRA 4KBZA 3AZWA 2BU9A 1W3XA 3E5QA 3NWKA 3QH7A 1D2QA 4LEJA 5K0UC 2VY0A 4XE9A 1LOCA 1WA4A 3E5UA 4DMIA 2D7FA 4FPKA 1PHMA 4QQ2A 5T54A 5HCFA 4YGEA 4QPWA 1JW6A 2XUEA 1LKNA 4FSJA 3WG1A 2XVLA 4H14A 1SCRA 4AI3A 3CMGA 4P08A 1VRH1 5FYHA 1NAEA 4KWJA 3K2OA 1OI6A 4ISRA 3JQWA 4M00A 5KBFA 1NY71 4N7UA 4I02A 2ZX2A 2E9QA 4PI0A 4CDWC 3ROUA 4YW5A 1RUE3 5A6YA 3VKOA 1MEC2 3OSDA 2BBVA 5BPXA 3IWZA 4LQRA 3BIEA 4CYDA 3GBWA 4N8MA 1GOHA 4K8RB 4X8NA 4MHRA 2QQOA 2RM21 2EXHA 2VW1A 1PK6A 1PMJX 1UD1A 1T2XA 3PTYA 4CCEA 4XBNA 4F7ZA 1CAXB 2ORXA 3GXUA 1N3OA 2WNVB 3ZXGA 1QDOA 5IK7A 2BBAA 4LLFA 5FY9A 1VBE3 1RHI3 4NPRA 2W9XA 3RWNA 3BU0A 4RS5B 3VKNA 1JUHA 3I2DA 3DXUA 1VP6A 2X53S 5J3UA 1GYKA 2K46A 2HEVF 2WKKA 4COUA 3WF1A 4YM3A 4NIAA 3URFA 1OLMA 2YPJA 1CAUB 1OUXA 4W6XA 5KHHA 2ZGOA 2WZR3 3U11A 5IVVA 2W95A 5C71A 4JDNA 4C0HA 4LK7A 4XXPA 2PHRA 5I0DA 2ZGKA 2C5DA 5FY8A 4RQPC 4HMZA 5FZBA 1BVP1 3R0RA 5CFDB 1S55A 4N9HA 1CJDA 3ZSKA 5IVCA 3U1XA 5AC91 3AB0A 4PQQA 5A3PA 2R0FA 3TN91 2Y8KA 1LHOA 1N1VA 5HCAA 2GNBA 1MZ5A 1W6QA 2R041 3AL6A 1W6OB 4R9AA 1RUD3 2G9ZA 5ABJC 1MS8A 2W1QA 4YRDA 5C8WA 1QDCA 3OJBA 2YYOA 2ZMLA 4GWIA 4YM1A 4DXZA 4LO7A 3ZSJA 2A70A 1VBC2 1UU5A 1XE0A 3D3AA 1SDWA 1GR3A 1ENXA 1F2NA 2GC3A 2V73A 4UWDA 4YWAA 1KJLA 2YU2A 2WS91 3P6BA 3D4KA 4QXKA 4CPBD 5IVEA 1NXD1 4MLOA 2JDPA 5CFCB 1UCXA 4WV8A 3WQBA 3G6JB 4UFKA 4XMIA 4PLMA 3OYWA 2VVFA 4XDPA 4EE2A 1K45A 4LHLA 3IT8A 1WCDJ 2GNTA 2XWBB 3DN7A 3RYRA 3WLUA 3ZSEA 1G9FA 2XOMA 4Y5SA 1DQ6A 2W5FA 1DGLA 1FMD1 1HQWA 1UY3A 3FWEA 4CDXC 1RUOA 4A2UA 1O3TA 4RD7A 2HH9A 4Y26A 1H0BA 4EN0A 3PU8A 1W8OA 5L73A 4M3CA 4GULA 3NNFA 5IATA 1MQTC 2QVSB 1IQDC 5FZDA 5LA2A 4BQ4A 5IHRA 4CDUC 4YYOA 4Y22B 4CCCA 2VR4A 4ES8A 5KC5A 3S7EA 1VMFA 2X09A 4HXCA 4GH4B 1KJRA 2JEMA 2QQPA 1LU1A 2A6VA 3NAPA 4BMBA 2XHKA 1AR61 3DYMA 3PLQA 4FPGA 1Y3TA 3L2HA 1JYVA 3W9AA 5F2WA 1NCRA 5C8CA 4RHV2 4CZSA 5DG2A 4OUSA 1RUG2 1PK6B 1BMV1 2FCUA 2K2SA 3PJQA 3PUSA 4TN7A 1WW6A 5GZCA 1W8WA 2VO5A 4UFIA 1EY2A 2JECA 2O14A 4HK9A 1JYNA 3VHRA 4PBPA 1MR5A 3K75B 3O5SA 4N43A 4PBOA 3C8XA 3GBGA 4FTSA 1CN1A 2QDRA 5HBAA 2DVDA 5C4WC 2JDYA 4OQ9A 3AJZA 1FV2A 2DVBA 4IV1A 2RS11 4XDOA 5KHKA 3HT2A 1Y7BA 5I8TA 3PIJA 1IS5A 1OKQA 4CDXA 3PUHA 2A5ZA 2JDUA 1TMF2 3JQXA 3OPZA 4MGIE 1UOGA 4ASKA 4CE8A 4CUBA 4DFSA 2EIGA 1UIJA 1Z7S3 1B35C 3SXWA 3VV1A 1GP5A 3RWKX 3Q8BA 4LXLA 1W6QB 5F6KA 2E7TA 1TNRA 1XNKA 1D7PM 1QXRA 1RUH3 3B3QE 4UFMA 3TRSB 3AKTA 1UX6A 1WD4A 2DTWA 4GZ9A 4CCNA 3EBRA 4QKNA 3WDYA 4IERA 4ES9A 4NRMA 3HJRA 4C1XA 2HWB1 3HOBA 3JD72 4QHOA 4PQ9A 4QX1A 2XBO3 3S7IA 1AL21 2RDNA 2VE1A 3KGZA 4DNYA 4CEWC 1ZBA1 2A6ZA 4YW2A 4A7YA 4LUKA 1FYUA 4UFJA 3LIHA 4QM9A 1I9RA 3MV11 3TEWA 3LOBA 1XC6A 1V9U2 4TSVA 1Y9MA 4TWTA 3CBNA 1SFPA 3OYWB 1AL0G 2C6SA 4LKDA 1XYNA 3O1PA 3AYEA 4BIFA 1GV9A 1AR93 1UAIA 3CDZB 4Y1YA 3WP3A 5BNOC 1DU3D 3SCFA 4INDA 5FZMA 5JMCA 1TME1 1UQXA 5GM0A 4IE4A 3HQUA 3EJKA 5F8PA 4ZU5A 2HWD1 3ZFGC 5FZ3A 2EVXA 4R4ZA 5KHIA 1JOBA 1XRUA 4M3CB 3T1LA 4K40A 4TZDA 3ZX7A 1G9CA 3H8RA 4OCTA 2NYYA 4YGBA 2HWC2 3ILFA 4AI9A 1GZTA 3R6SA 2JDMA 4BCUA 3SQOA 3UESA 5E8AA 5AFEA 3H42B 4GMP3 4U36A 1ODMA 1XU1A 3NAPB 3UL2A 3MIDA 3DXTA 1ACCA 3SMHA 4NHLA 4BE3A 4DUVA 2WC2A 4XQWA 1NCRB 5C8CB 4GQ7A 2D44A 2HWF1 2NMNA 4J1WA 1KITA 3BVCA 4XIOA 1S0IA 3ETPA 2FZ1A 5LZ6A 1DQ0A 1NCQC 1FI2A 4V2WA 1IKQA 1H2LA 3NNGA 2Q8CA 1FPN3 3WZ1A 1DYKA 1NZCA 4G9SB 4YVSC 1RUF1 1TEIA 2O1QA 2B45X 5IAVA 3LB9A 2ORZA 1Q43A 1SBDA 1RMU1 4PLOA 1WUVA 4OHZA 3MW4A 3KZ4C 4N43B 4O65A 4XF0A 4CCMA 1YRZA 2OT7A 4HKOA 5JIAA 1OD5A 2UU8A 4A3XA 2FMYA 2X8KA 4AQ2A 5A7NA 5C3OA 1I3HA 2ARCA 2HWE2 3AKRA 4MZUA 5CISA 1SBEA 2C26A 2NM1A 4IV1B 4XFIA 1HJFA 1YFWA 4LBJA 1US2A 2QQNA 5FZ9A 4YFWA 5FYTA 2JG8C 2ZKLA 5DAPA 3PTRB 2MEV1 3POYA 4P9LA 1UU4A 4L92A 1H9WA 2D98A 2BJSA 4Y1UA 1EV12 1W2UA 2Q8DA 4AG4A 2QQIA 3SKJE 2PHDA 1HW5A 1UYZA 4A3ZA 1IPKA 5JR7B 1AR82 3N35A 4QPGC 1JU4A 5ACA3 4XCAA 2QBXA 4YZ2A 2B9VA 5FV3A 5FYMA 1UOBA 1A34A 2WR9A 2LM3A 5LA1A 1ND3C 4NAOA 2XDVA 4MYEA 1QU0A 1GZCA 3SKVA 1GP6A 4QHBA 4AFDA 2ZZQA 3WHTA 4HL0A 4HSJA 4P9GA 3KF3A 4HVRA 4A44A 1RIRA 3NW4A 2QFEA 2W91A 1ZBE3 3W58A 3POGA 3DYPA 1R091 4XYXA 1HQNA 1NT0A 3IIAA 3KLSA 4ZXKA 5E16A 3EYPA 4QDQA 4P14A 3ZOIA 3CJIA 4B4QA 4HKWA 2PAKA 1JZ5A 3RZMA 1UZWA 4QKBA 1C8M1 1JUIA 1R083 1ULPA 2ZGPA 3MIBA 5FO8B 5LK7B 4AE2A 4UW4A 3MF6A 5FMOL 3T2TA 4XIKA 1KDMA 4HVQA 4JRLA 1OLME 2FHRA 4KBBA 2JDNA 4UXAA 1OVSA 4UW6A 1QMJA 1VMHA 5H9PA 2E32A 4IV3B 1RUE2 2XPJA 5FUPA 3N4MA 1IGOA 1QJY3 2FBEA 2O8QA 2P4EA 4GMP0 3LOIA 4I0AA 4N53A 3ZLIA 2IVIB 2R061 4XBQA 2VTXJ 2BQPA 1I5ZA 1U5XA 3M3OA 3NKTA 2ZAAA 1RYYA 5EXOA 2PAMA 1VLNA 2PHFA 2TUNA 3UETA 4JGYA 4AEDC 2WO1A 4AVBA 2WYFA 2XL9A 3HVDA 1F35A 2VMDA 2VMEA 1VBE2 2VQAA 3H8UA 1RHI2 4Z07A 1RVF1 4AI0A 4CUCA 4LIUA 3VDDC 1G7YA 4IXLA 2XVKA 2YHJA 2ZPXA 3JB4C 3CZUA 1E5IA 1NLRA 4OI1A 1KXGA 5FXZA 1GWMA 4IGOA 3MGUA 3UV9A 4PJYA 4R9BA 1D2SA 1Q8OA 1HRV2 2P6CA 2WZR2 2ZGRA 3NJXA 1H6YA 2B9UA 2XJQA 4G4FA 3PVEA 2C9KA 2CGNA 1HJGA 1VBB1 2QCSB 2A73B 2WRAA 5T55A 4A7ZA 2X29A 1WLCA 2Y34A 4LBQD 4AGGA 1GNZA 4YM0A 2RS33 1HDKA 2WIIB 3QH6A 1LOBA 3AXDA 1GQGA 2DV9A 3B02A 4NIIA 1RUJ1 3WCRA 4QAWA 3MHZA 3GF6A 4L8QA 2EA7A 1D0HA 1RUD2 4OUMA 2A7AA 5F3EA 3U78A 5C9AC 1OHFA 3I4IA 5F5QA 3IZOA 2V5YA 2X10A 3CEWA 3ZFEC 2JKXA 3GJAA 2WAAA 3BODA 3LA3A 4QDSA 4QX2A 4A7KA 3GNEA 1LGBA 5JOZA 1YCIA 4E8CA 3OGSA 2B42B 1MS9A 4CUAA 4NUBA 1BK1A 1ZRFA 1W8ZA 4Q4X1 5B4NA 1AX0A 1O6UA 1UNBA 1C3HA 4YNIA 1ASJ1 1PGL2 4RGKA 1WLWA 1QH6A 5DDJ1 3VL9A 2VCMA 1T6GC 1RUC2 3OEBA 5FZFA 1OXCA 5IAXA 3V0BA 1BXHA 4PT6A 5FKCA 1QF3A 3MIFA 1MPXA 1PVC3 2JD9A 2VZSA 2QUOA 4D7YA 1W6MA 2SLIA 3CJIB 2W92A 1W2NA 1V6OA 2HBUA 2OUHA 4Q4V1 3S5QA 3QLQA 1G8WA 3ZMOA 1GZWA 4ORFA 3NV3A 1W0PA 1LB2A 1PM4A 1YIPA 4JQTA 5FO9B 3LAGA 1SLCA 4IEOA 4TLFA 1COV1 1EP0A 5FZAA 1O59A 4KMQA 2WQZC 2XJRA 2Y64A 1JZ8A 4YVWC 2JJ6A 1K5MA 4N53B 1W8TA 2PHUA 2AUYA 3HBKA 3HAGA 5GLZA 5DZFA 3AMMA 5BXXA 3W5MA 4S2DA 4Z2AA 3AMNA 1FAYA 4JGYB 4OQ8A 3BN6A 5EJZB 3OTFA 4MOAA 4GB33 4XCBA 3V65A 1RL3A 1AYN1 1VB2A 3P3NA 5DUUA 5AVPA 4MX3A 2EIEA 3ZIXA 1KS5A 1D4M1 4BQWA 4AEKA 3FHIB 4W8JA 1AXKA 1HV1A 1QY4A 3R4SA 4PCRA 4QXHA 4OMCA 2BVVA 4FPHA 4R9CA 2DCJA 3H7YA 5B4XA 3SNMA 3T2PA 1W9WA 1ZZ6A 2XL7A 3VDBA 4I0BA 4EJRA 2NN8A 1AX2A 3Q9OA 3RFRA 1LECA 2VBBA 3RJRA 2VNOA 1JH5A 4LUMA 2PHLA 4DZGA 4C8DA 4OHWA 1BEV1 5E89A 5T5LA 2D6LX 3WF4A 3ZSLA 3VHOA 5A3TA 4JHZA 4MXVA 1Z7S2 5JSOA 1AUYA 1QJX1 5IW0A 2Q1MA 4TYSA 5AC92 3POFA 5FBJA 1HB2A 4AFCA 5LA9A 4CP0A 1I5PA 1IG0A 4RHV3 4OYUA 3CL1A 2RS51 3S57A 1WBLA 1QHDA 2EF6A 3WG4A 3FC0A 3AKQA 3V0AA 1OUSA 3LZZA 3VZKA 2OXBA 3E97A 4LORA 2XBO2 4YVWA 4IEWA 4J1XA 5LY2A 3AYAA 4KWLA 4COYA 1F5JA 4CU7A 3ES4A 3WCSA 3WF3A 4JTNA 5GALA 1Q8QA 2ERFA 3THDA 2OPKA 2RE9A 4QKFA 3O1MA 1MZEA 4LO5B 1AR92 3V0BB 1HRI3 5LBCA 1QNYA 2ZACA 2OYZA 4XHXA 4QPYA 4FFHA 5A70A 1W6MB 4CP2A 1ULFA 3NRUA 5FZ7A 3A4UA 5I0TA 2ZGNA 2G9GA 3SEPA 1Q3EA 1SLAA 3VZNA 3GM8A 5FYZA 4BQ3A 2BFUS 1GZWB 3AFGA 2IFRA 3LF7A 4MG2A 2ZBJA 2J1UA 1QGLA 2ZKNA 4D6RA 4FO9A 1POV3 5D8AA 3AP7A 2DCKA 4JDOA 3RI8A 3F2ZA 2BDRA 2NPIA 3M7AA 2WNVC 2KA3A 4QT6A 1K5MB 4Q27A 2P5BA 3JD73 3K3NA 3WW2A 2W0XA 3WVJA 2GH2A 4ZPIA 4RS5C 1T6BX 2NQYA 3DECA 3RVHA 3ZXKA 2B7YA 3PNAA 3JU9A 1C4RA 1UY1A 3CZJA 5APAA 4BK4A 2WSUA 4XOGA 2Y6FA 3OPTA 1FPN2 5DZEA 2EIDA 4A6SA 1O5LA 2DBIA 1YI7A 3A0KA 4I30A 3NNJA 4C90A 3W5NA 1DGRN 3DKWA 2V72A 2JB4A 5H9RA 2AENA 5IFTA 4V1PA 1URXA 5CFDC 1R1ZA 3SH4A 1A8DA 2QQMA 2DF7A 4H3WA 3ZN5A 3IDEA 4Y1XA 4PF5A 1NOVA 4P00B 3RDIA 3FE5A 4XURA 1VAMA 1OA2A 3CF6E 4HKLA 3WF0A 1VPHA 4AGRA 4LIVA 2RDRA 3WDXA 2YU1A 2RS12 2Y6LA 1FV3A 2Y6HA 3GZTB 1N1YA 1OFSA 4AK3A 5A6XA 1UY4A 3NV1A 2BGOA 2BTVC 4AYUA 5F9TA 4H7LA 3T3YA 5A1AA 1WD3A 3KQ4B 4LNVA 5CG9A 3VZLA 2WQ4A 4XABA 1SLTA 2X5IB 3O0VA 1ZYBA 4ATEA 5CFCC 2PFWA 1PZ9A 2CNAA 4LHSA 2UURA 3PMSA 2YPDA 3FLTA 1UO9A 4FPOB 5CKMA 1DZRA 4M01A 4MHUA 2IZWA 2OW4A 5FJKA 2VTFA 5ACA2 1XE7A 1ENRA 4AFBA 1PO23 1RXFA 1W04A 5I8YA 1NG0A 4NIHA 4DS0A 4LKFA 5FR3A 2QQLA 5CVRA 3FX3A 3RG0A 2XJVA 3RZZA 4OFGA 4BDVB 1OH3A 2YC0A 2CY6A 2ET1A 3PL0A 4CPBA 4CTEA 4EV0A 5FQ0A 1F31A 2XHNA 4YW4A 5IYYA 1CAUA 3AZZA 2GMMA 4HOOA 4ITCA 4QX0A 4RGAA 4Q2FA 4AHYA 5BNPA 1H2NA 1ZZ7A 1ZBE2 3VBFA 4GWJA 2WJSA 2WSVA 3PJYA 5JOWA 5SV8A 4OI4A 4NHKA 1VBD1 5CFDA 4JAAA 4XUNA 3H3UA 3DL3A 4LOTA 1BBT1 1R082 2D40A 1PZ8A 3ELNA 1W28A 4WVVA 5D8AB 1WW5A 1YUDA 3FHAA 4ET7A 1PK6C 3WW4A 5L36A 5ANNA 3LPGA 4CRQA 3THCA 5JZGA 2YUEA 1OA3A 1POV0 3PUAA 3WNOA 3AZYA 3ITQA 2E53A 3OEAA 5JDBA 2VM9A 2B5HA 2RMU1 1G6NA 1ST8A 4B8EA 3BTYA 1FNYA 4DINB 3OD0A 4V2VA 4QPIA 1JYCA 2D43A 3IDBB 5A1LA 5FK8A 1U5YA 1W9SA 1UIKA 4Q29A 5I91A 4XW3A 3ME2A 3I2FA 4G3YC 5L19A 1V70A 4A41A 3T0AA 3J8F1 1HXS3 1LHNA 5LK5A 4ZS2A 3OB8A 4XEZA 5L9BA 2FDFA 2QJVA 3C2UA 2GMEA 4MGKE 4CEYA 2E6VA 2WDBA 1UN1A 3KMHA 2IVJA 4L0PA 4EN6B 1A78A 1IHMA 1SHWB 2WFF3 2UYBA 5JSPA 2CWSA 4CCJA 4CXWA 3WT3A 4FI9A 2LTNA 5GLVA 1R1A3 3WY6A 4Y22A 3HPNA 5EFUA 1PNFA 2WNEA 2XLAA 4AHZA 4LA2A 2ETEA 2RS32 4GH4A 3KB5A 4FVVA 3CIHA 1TNFA 4MGZE 4Y33A 4I01A 2VAUA 1WMXA 3C7EA 1W8FA 2MEV2 4BB3A 2RJKA 5I93A 2VQ0A 3I3EA 1J83A 1X9TA 2BP6A 1W05A 4E4SA 5L9VA 1X33A 1U0AA 4PDWB 1MS4A 1EUTA 1UX7A 2OS2A 3I54A 4M0NA 3ILRA 4OHXA 4MSVA 3AYDA 2QKDA 1DFQA 3ASIA 1NKGA 1GMMA 1VALA 1NXMA 3AFKA 4XAEA 3TEYA 1IKPA 1WCKA 1KEXA 1EAH3 4W6WA 2X05A 3U10A 3LDBA 3WDTA 3T2QA 5FQ0B 4KWUA 4BQYA 3MIHA 1IS4A 1V6LA 2VNVA 2YC4A 4YW7A 1QJU3 4IESA 1HRV3 1UMZA 2VGDA 2J42A 5FPAA 3THTA 5BNPB 2Y0IA 3ZYJB 3VBFB 2XKOA 3NL1A 2UWAA 2BV4A 1PVC2 2XVGA 1MS0A 5LEJA 2B46X 5FZIA 2DTYA 3NAPC 4XACA 2DDUA 2AH2A 2VPVA 2W47A 2Y60A 4KH9A 5JPNB 1ZA4A 4IGPA 4LHNA 2I2SA 5FY4A 1DQ5A 2VL4A 3N9NA 1CX1A 1NCRC 3VKLA 1FOD1 5C8CC 2D6KA 3RMYA 4DXRA 3A22A 1X7NA 4HG6B 1OF3A 2UY8A 2W52A 1UYXA 2VXRA 4JVAA 4RA0A 3UYJA 3V64A 1N1SA 5JZGB 4HFSA 3K46A 2HKXA 1QJFA 5C3SA 1LOGA 2JDZA 4SLIA 4HPKA 2OUJA 3K51A 4GKYA 4FOYA 4NMIA 3VZOA 1AR71 1VBA1 4FFGA 4Y1VA 3FFZA 3D5OA 3I49A 2RR11 3KT1A 2YC2A 4X6RB 5GLUA 4N43C 4QPIB 4ZKTB 1DQ2A 3MBWA 5JOXA 4BH9A 5A6QA 4GA9A 1AXZA 1BHGA 1RUH1 1G86A 3LEGA 4GB32 4JKKA 1RUC3 4ZY9A 4IEUA 3WUCA 2W3JA 1SPPA 4IV1C 2VG9A 4QQPA 1O4ZA 5FZHA 4LKSA 4YARA 1O7FA 3VD7A 4ZU7A 2LRPA 1WBFA 4OMDA 4CEYB 2JIGA 1DDLA 2JE9A 3SEEA 2ZGUA 2VMCA 2E51A 2BNOA 4Q1PA 5FP4A 4CCOA 1POQA 3ON7A 4UBHA 2A6WA 3OY8B 5ISLA 3CKHA 1WLDA 2J1VA 2ZX4A 4M4RA 2HEYF 4M4PA 3GDBA 4LPLA 4XBLA 2W87A 4ATFA 2DBNA 1VRH3 3FHQA 4DPNA 3FBYA 2Z4FA 3JXSA 1LU2A 1DIWA 4KU7A 4PIYA 1LESA 4QMAA 3T30A 4LBLA 2JD4A 4JQRA 1C1LA 3WQ0A 5C3PA 2CSGA 1L7QA 3ABZA 5IT6A 3N9MA 1UKGA 1NQJA 2JDKA 4W6YA 2GALA 4QX8A 1BK0A 2GDFA 2RM23 1UZ0A 2CDOA 2ZOEB 1ZRCA 1IG3A 3VZJA 4TLGA 4FTBA 4Q4W1 1H4HA 4LJHA 4Q4Y1 4LO6B 4WZCA 5FRAA 2D6OX 3MZHA 1SQ4A 4BWOA 1SLBA 3OD4A 5CEHA 1HRI2 4FPJA 2ZEXA 5AFBA 4OHYA 4FPCA 1CD3G 4W65A 1NA1B 3N7MA 3DPRA 2J1RA 2ZGSA 3I8TA 1H6XA 4Y5Z0 2VOXA 3HR9A 3FLRA 3IAQA 2IXJA 5DZGA 4AHXA 1APNA 1IS6A 2ID4A 2YZ4A 4IV3C 3RPQA 2VVEA 4LHKA 3UKNA 4JV4A 2MHFA 1MACA 3BI3A 2BOJA 5AC93 3TN93 1Q8PA 3M3EA 3SCGA 2EAAA 2R043 1YHFA 5FXVA 4YW6A 1QXJA 4AVSA 2ET7A 3POJA 1KS4A 4A6OA 5FPXA 1Q5OA 1BCXA 1Y9QA 4LULA 2R071 4HPKB 2R16A 3RNSA 1ZVFA 2D3RA 3VBRB 5C7GA 3IIIA 3JBG1 1IOAA 4FAGA 3WNXA 5CG8A 5JI7A 4W4ZA 1S0CA 4WBBA 4YW3A 1UYYA 5FZOA 1S0DA 3ATGA 3IAPA 4Q26A 4FXGB 3RZJA 3GZAA 3KVAA 1MVQA 3TWIA 5FZLA 3BKZA 3USSA 1SPPB 3GYDA 2R7EB 1F4AA 1LEDA 2YBKA 4Y5TA 4QB2A 3ACHA 4S2GA 3JZVA 2XXZA 2PLV1 4PLNA 2DYCA 1LEMA 1FMD3 5CB7A 4EZHA 5DN2A 4R8HA 3ZXDA 1DP0A 2V4VA 3RRDA 4BPZA 5A3UA 2BGCA 4DEVA 2I45A 3V56A 4BYYA 1S0GA 1RB8G 3BOWA 1EPWA 1X9PA 2LS6A 1HX6A 4FCAA 2OZ6A 3RYPA 1OC1A 2WUHA 4FPYA 3VKFC 2WWUA 2LUWA 3FZ3A 5FCCA 4IV3A 1PM7A 5C33A 5F37A 1JOPA 1UF2C 1AR63 1HIXA 4UW3A 1BKZA 4MUVA 4NO4A 3E6CC 4XC9A 2VMFA 4K8FA 1OPMA 5DABA 2WFPA 1VB4A 2JIJA 1KFXL 4Y20A 3LCPA 3POBA 1WLTA 1B09A 3O1RA 2GN7A 5ANQA 1PO22 4URAA 5IWFA 3WINE 2YB7A 5FZCA 5A7OA 1N3PA 1H1MA 2DWRA 1U5IA 1C57A 2IFWA 2F17A 1YQCA 2E63A 2ZHMA 3MI8A 3CJIC 3MIGA 3VDCA 4Z82A 2E7AA 4YW1A 2UWCA 1UU6A 4WM8B 4YPJA 1G9BA 1KDKA 4UFHA 2YBSA 4P5HA 1QQP1 4E2GA 2Y6KA 3DPRB 4ISQA 4CVUA 3ZSMA 4B4PA 1W0NA 4OI0A 1V6MA 2K9ZA 2RS13 5DAWA 1K12A 1XU2A 3HD8B 2D3PA 2JXAA 3MO4A 1OMIA 4UBGA 4COVA 3PVOA 1CAWA 2YV8A 4N53C 1RUI1 1QIQA 3MEPA 4YZ5A 2SBAA 4XHBA 4F8AA 3WDUA 1AX1A 1CR7A 2Q1ZB 5C5UA 5GLTA 5EYYA 4JGYC 4KL1A 5CYYA 2VU9A 3PHMA 3KGLA 1DZTA 1OOPA 1FT9A 4KU8A 2HBTA 1UL9A 3FN9A 2DUQA 4BXSV 4DY5A 2HWB3 2JB8A 4EROA 3UGFA 1G9AA 3HWJA 4LO8A 1AL23 4NR1A 5FZOB 4S2FA 5A80A 1SDDB 1ZBA3 2XGXA 1J84A 3ENRA 3ZXLA 4Y24A 5JXGA 1MEC1 5J98B 1YFUA 5KC6A 4NHMA 5DAVA 4FQZA 1MQTB 3ZYFA 4EWEA 3MV01 3POSA 2F4PA 1DHKB 5FPZA 4D6QA 2CYFA 4L9BA 1HXS2 2A75A 2WO3A 3ETQA 1ZREA 1TME3 4YG0A 2C0ZA 2PMWB 2BEOA 4JCKA 2GMPA 2QQVA 1PIV2 2HWD3 4DO0A 1AYM2 1N3QA 1O5UA 2OPWA 4XFFA 3U0ZA 4DUXA 3ZN4A 4YLZA 2WFF2 4RN5A 3L2YA 1R1A2 1K3IA 1P8JA 2VW2A 2YGLA 3MIEA 4BOWA 1C28A 4WVMB 3BTAA 3AZXA 2YMZA 4AEMA 4AR2A 1Q8SA 3LFIA 1JMUB 2VOWA 4Y20B 2BRTA 3M3QA 5DG1A 2V4AA 1K42A 2OZJA 5FZ8A 4XJUA 2JDAA 4FOVA 5A32A 4P9JA 1H2MA 2JG9A 3MLJA 1QJEA 4UAPA 5HXVA 3THPA 5FPLA 3KQRA 5T52A 1RUF3 5T5OA 3BPSA 5KXEA 1VBC1 3AL5A 2VZQA 4JGZA 1EAH2 3EO6A 2PYTA 1W03A 3E1F1 1YI9A 1LHUA 1RMU3 2GH8A 3U75A 1JZ7A 1SZBA 1B35B 5JLVA 4NAMA 1WMDA 2QQUA 5EQUA 3B7MA 1VR3A 3VBOB 4N90A 1QJU2 2GNMA 3WG2A 4AI8A 1J3QA 2G19A 1YEWA 3MW2A 1DYPA 3HNYM 4PIXA 3LDKA 3S0MA 2FCVA 4QX3A 3EMRA 4HANA 2OX0A 4ASMB 4XJ8A 1K5MC 1CAWB 3CJXA 3M3IA 1TG7A 2A3YA 2WT0A 1SACA 4HVOA 4CDQA 2MEV3 2VOTA 4JX0A 3ZIWA 3I2GA 5L9RA 1XSQA 1JZ3A 1O8PA 1YJKA 1PO12 3JCIA 4M3CE 3VN4A 2VQUA 5J48A 1OOPB 3WEZA 1IZ3A 2PHTA 1UOFA 1BYHA 4QGLA 5A3NA 1O3QA 1DLLA 3VBSB 3POEA 1IQAA 1EPZA 2A1XA 2RMU2 2RG4A 1MS3A 2Y6JA 2Z69A 3OUJA 4QKDA 3ZMNA 5BNNA 5FREA 4NROA 2CHHA 3I2IA 4MADA 5A33B 4UI9L 3LFMA 5FZEA 3NJVA 2Z42A 1ZZ8A 5J37A 3A0NA 4Q1RA 5EYXA 1MS1A 1RUG1 3UKTA 1PGW2 1ZX5A 5HCBA 2ARXA 2CTVA 2FDHA 3FJSA 2FDGA 2WA3A 3BTXA 4RR3A 3J8F2 4CCLA 3WP5A 5EP9A 1R093 5FJHA 3Q8AA 2VNGA 5FYYA 4AXOA 5KWRA 1LENA 1X82A 2Y38A 4E9KA 1DG6A 1RTVA 4OUEA 1YYNA 4MGQA 1O4YA 1C8M3 5FYBA 4AOCA 3LEMA 4CU9A 3DGTA 4KG8A 1VRH2 4LOSA 2BWAA 1HQLA 4LBOA 4LITA 4XAAA 4I3GA 2WT1A 5DAQA 1YIFA 4BM8A 1NY72 2WA4A 4OZXA 4Y1ZA 3RSJA 1ND2A 1PMIA 1XNAA 5FLIA 2QZ3A 2ES3A 1TMF1 2FCTA 4D8MA 1GNYA 2R063 2VC9A 3FBMA 3J7LA 4YGCA 5FLHA 3RJ2X 5KR7A 5A32B 2YBPA 2RM22 4M0HA 1VJ2A 4NE9A 2JG9B 5LRSA 2JENA 5K7PA 3ZO0B 5F39A 3GBFA 1E5SA 3GHMA 2CWMA 4IEXA 3PUIA 4JGZB 2WAOA 5HI0A 2K0GA 4Z8BA 4QQHA 2P3KA 3JD71 1ENSA 4DEQA 2VQTA 1J3RA 5D21A 5H9QA 3KD4A 4ZXEA 4XFAA 3U14A 2JWPA 3J26N 1J1LA 5EIYB 1V9U1 2Q4SA 3PMEA 2YDEA 5D8AC 4FXKB 1W3VA 4ZU4A 3NVCA 1LOAA 2JX9A 2XONA 5FYIA 2BGPA 3VD4A 1S0JA 1ZZCA 4LE3A 5CKNA 1VBB3 3J7HA 5C70A 4IE0A 4QGMA 1H1AA 4JDMA 4CDQB 4AW7A 3WG3A 1L3JA 1YQ6A 1OH4A 3WP4A 5KXBA 2D6NA 5JCTA 4IETA 2VOVA 4FPEA 1RUJ3 1YJLA 3TN92 4Q8KA 5J1XA 4OZOA 2R042 2BNNA 1U5ZA 2X5IA 3MF9A 3MICA 1UXXX 1DLCA 4Z2WA 2HWC1 4KGQA 4XJWA 1NE4A 5DAXA 3DCQA 1O8SA 3DUIA 4AFAA 1NLSA 1W6NA 4TTGA 3LSEA 2VMHA 3W21A 2AACA 3D82A 5G04L 4XTPA 2ZABA 2WS92 5K4LA 1JI6A 3BB6A 5BNNB 1RJ8A 2WZ8A 4Q4X3 3KT7A 3AK0A 4PHZA 5IJRA 1ASJ3 4IEQA 4E4DX 5L7OA 4R4XA 5DDJ3 4Y4RA 5F5IA 2D97A 4FFIA 1JZ2A 2J1EA 4EYUA 4AVCA 3O1UA 1ULEA 2ZHNA 5EHDA 4K1YA 3FFQA 4RR3B 4L11A 2H0VA 4AWDA 4DB5A 1FMD2 3E5XA 3TOJA 4BIOA 2O8OA 3BCWA 3WX5A 2H0BA 4LE4A 4NIGA 4FOQA 4DXTA 5A7PA 1JYWA 2C9AA 2R0HA 2A6YA 5FZKA 4K6BA 2PAEA 2HWE1 3BTZA 3I3MA 4UW5A 2D6MA 1COV3 1XNDA 1ND2B 1UYPA 4NRPA 1VMJA 3RS6A 1LOFA 1WMFA 4Z1VA 4F3JA 1AR62 4YG3A 4XZPA 2C1FA 4CP9A 3LQCA 3VLBB 4IEYA 4CU8A 1LGNA 1GBGA 4XUPA 2WN3A 4QQLA 4AF9A 4CCDA 5LCWL 1H1IA 5LW9A 4FP2A 1DYOA 4K7JA 3ZYGA 4IQPA 1BMV2 5FYVA 4XJAA 1H8TA 1EV11 4IDZA 1Q56A 3JB8A 5BNPC 3M2MA 3A7QA 3I3DA 3VBFC 1ZRIA 3WXPA 1AYN3 1AR81 1AJOA 2EXIA 4I0WB 4IL7A 3MFAA 2XKPA 1D4M3 2H6CA 1J1TA 5JSRA 4UOJA 3VBUA 5FMDA 1YNAA 4XPVA 1PVXA 3RYKA 4ZZ8A 4Y3OA 5JZGC 1DF0A 3M1HA 1BEV3 3J4UH 3VDAA 4E8DA 5LY1A 1SLIA 4D69A 1SFNA 2O0OA 1RUNA 5T5PA 1N1TA 2D5FA 1QJX3 3D0SA 2Q0AA 3KSCA 4LBNA 4BHPA 3ZVXA 3MDPA 3FUOA 1GLHA 1H30A 3AKSA 4IGQA 4QPIC 3VD5A 3RZGA 2DVAA 1UY0A 1Z0HA 3QOPA 4PDWA 1W6NB 3GALA 2RS53 4GWMA 2ZX3A 4JHTA 1S2KA 4XZUG 5FOJB 2F6BA 4EZ4A 4IEVA 2HWB2 3LIGA 3C3VA 1CAVA 3O14A 3O1TA 1AL22 1HKDA 3AP9A 3AMQA 1ZBA2 4K21A 1RUE1 3O0WA 4CEYC 4QX7A 1UPIA 3KCYA 2B8MA 1YLLA 2W46A 1I6XA 2WQ8A 1CZTA 3SHRA 5F32A 5L7OB 3IB3A 3LWCA 4GALA 1C8NA 3BU7A 1ULDA 3D0JA 3HQXA 5ERLA 1FNZA 3DF0A 3U37A 2P34A 1GFF2 2W08A 3MPBA 1QOTA 2WNUA 3LKJA 1TME2 3NKGA 1VBE1 4HONA 4GH4C 1RHI1 1W9YA 3ACGA 1AXYA 2BERA 2HWD2 4BZ4A 2DFCA 3MUY1 1H8VA 5FY1A 3JUUA 2BW8A 3WUDA 1A3KA 1YFYA 3LPFA 5CAZA 4LBKA 3GHNA 4WM7A 3AP4A 1QJZA 4BK5A 1W2OA 2WYSA 4YG6A 4UF0B 1LHVA 2NLRA 2WZR1 1CZVA 4C1WA 2BPA2 4D0QA 3K48A 5JOYA 4NRQA 4LT5A 4CP9B 1CQ9A 3WDWA 1GUIA 2GAUA 4XQDA 3ZR5A 2YROA 3DYOA 4BQ5A 3L9JT 2HWF2 3I2HA 5FK7A 4I2OA 1XB9A 3KCXA 4AAPA 5A7WA 3O12A 1REEA 3AC0A 1H8TB 3VBHB 2BWCA 2ARBA 1RUD1 3KM5A 1ZZ9A 3IN9A 1A8MA 3LE0A 1D0GA 2BVBA 2EICA 2ZA9A 5FPUA 3UGHA 4DQAA 3I2OA 1CPMA 1N47A 1RUF2 2R49A 1YQ5A 3AVSA 4XFBA 2RDSA 2VZUA 4MGYE 3DKQA 4JTOA 4AEJA 3N7KA 1RMU2 4P9YA 1PIV3 4ARXA 4EWAA 1AYM3 2NZ9A 5CIRA 3VBUB 1OLQA 2BFUL 1S4CA 1W8NA 4SBVA 1UW8A 5AVAA 3N9OA 3OY8A 4E27A 1JXNA 2J22A 3ILNA 5JIUA 1PGL1 1W2TA 4HETA 4P9IA 3LGRA 4ONUA 1ODNA 3ZPOA 1RUC1 3NJZA 1JS9A 2KR2A 2PHXA 2RV9A 4CA9A 4LO4B 2ZMKA 3RQ0A 2ZGMA 5BYNA 4HT1T 1CONA 5HV0A 4QB6A 4HBNA 5I0SA 4XF3A 3B5LB 3KHBA 3WD5A 5C3RA 1C5HA 1DQ4A 1W2AX 2QTWB 2VUDA 3BIWE 3H0OA 5JUVA 4XDQA 4WVZA 3GCWA 2ZGLA 3TAYA 1H9PA 1JOJA 2W1SA 4B29A 5F3CA 2JDHA 5DUWA 2IXHA 3B9IA 5FZ1A 1MZ6A 4OHVA 4FAHA 1J3PA 4UFLA 1CAVB 3B9CA 4Q0SA 2Q1FA 2D93A 1LTEA 3C7GA 4OULA 4LLOA 3I59A 5CU1A 3WP6A 3ZFFA 1X8MA 2UY9A 2P3JA 1QEXA 2W94A 2J1TA 2RVAA 2XLFA 1J59A 1HB3A 4QDRA 4P02B 2GNDA 1RJ7A 5HCHA 5JR2A 2IXLA 2PA7A 2XJPA 2LALA 2VUAA 2G1MA 3FUQA 2QNKA 1NA1A 2WNUB 4L97A 1W8UA 4MGSA 5FIXA 3SITA 1YC61 2VJXA 5LRRA 3N7JA 2VXJA 1R092 3LEKA 1D4VB 1OBNA 1WWYA 2JKBA 2P3YA 3R4DB 3ZXJA 1XYPA 2DU0A 5F6LB 1VBD3 3IMNA 4AAXA 2WO2A 1W99A 4NIDA 4B7KA 5FMCA 3X29B 1C8M2 4WM7B 1BBT3 2EIBA 4KWKA 5DPNA 5FZ4A 2OVUA 1LOEA 2XR4A 1PO13 4BA6A 2AZ5A 4RYDA 5JMOA 2VCAA 1OURA 2VOKA 1JU3A 3VBRA 4GAZA 3D8CA 1AHSA 2J7MA 3SH5A 5FKBA 3M70A 1Z7S1 2R062 2RMU3 5A7WB 3ST7A 3OGJA 5K0UA 4BISA 4WM8C 1XNTA 4DY3A 2GN3A 2ZEZA 4KGGA 1XPWA 1GOFA 1F15A 4GKXA 3DV8A 1XBFA 5FYSA 5FDBA 4AI2A 3DPRC 2OIIA 2P37A 2OKXA 3RGBA 4AI1A 2DCZA 4XVHA 1RVF2 2VZPA 5GZGA 5EWSA 1PX4A 1J58A 3EXUA 4PIZA 3CHXA 3J8F3 3LA7A 2XBO1 1SFYA 4NHYA 4CDWA 2V09A 3WSOA 2ZAHA 4BU2A 4MXWA 1Y4WA 3O1OA 3SLIA 3LDRA 5LB6A 5FY0A 4P9WA 1UWWA 4QQOA 4FFFA 4LA3A 4AL9A 1TZOA 4KI5M 5FP9A 1Y43B 1EYBA 3B69A 3CNAA 1CJPA 3J7NA 1AR91 3K4AA 4IE5A 1VBB2 2XJUA 1QKQA 4FPLA 1WW4A 2Z2SB 5GZFA 1UZZA 2WZEA 2P1BA 5GZEA 3B00A 1BLZA 5A6ZA 4MV2A 4C91A 1M06G 1YQ2A 1RUJ2 1SLLA 3NNLA 3S30A 3TNPB 3PU3A 3INAA 4A4AA 1RINA 2PQSA 2FDKA 3AMPA 3VHNA 2DCYA 3EHKA 4QU2A 2MNGA 4B3NA 4FQ4A 3F95A 4OI2A 2TEPA 1A6CA 1W9FA 4OLLA 3ZFFB 2ADEA 2VH9A 2WLQA 3I59B 3MW3A 4GMP1 4Y4YA 2VUJA 3UT0A 3WNMA 3NV2A 3ZR6A 3RMXA 5JI9A 5B2GB 4Q0UA 3S5AA 4RQPA 1V6KA 1VRBA 2EAKA 4Q4X2 4QM8A 2OQ6A 3VB9A 3VD3A 1AZDA 2BUKA 1ASJ2 2PXJA 4WM8A 5DDJ2 3OBTA 2QQWA 2VZOA 4HSLA 3I2JA 2QE3A 3ZYBA 4XUQA 5ABJA 4COWA 3AM2A 1FPN1 1EUUA 4FP3A 4QD2A 1GQPA 4U2AA 1GZ9A 5IUQA 1C5IA 4Q0QA 3TNQA 3VZMA 5DQ0A 3IDCB 1LRHA 1XQNA 4NN0A 3VGIA 1W90A 4AQSA 1US3A 5IVFA 4XF1A 2KXLA 3ECQA 5I0UA 4Q4V2 2FD8A 3C7OA 1E5HA 1S2BA 3H1YA 1FOD3 4XMAA 4LR4A 3KT4A 1UPSA 5CA6A 3SISA 4IE6A 4B1LA 5DMYA 5IVJA 5DUXA 2D6PA 4MO3M 1BVVA 1COV2 4M3CF 3MLKA 2QQKA 1V6IA 5FY5A 4CU6A 3I7DA 1QNWA 3LSDA 2XUMA 1FATA 3AMHA 2D3SA 5H9SA 1AR73 1VBA3 2WS93 3WNPA 3PVBB 5K0UB 2RR13 3EQEA 4LTAA 5EJ3A 3VBOC 5FMOS 2RJ2A 5F1RA 2BZDA 1MQTA 4IEZA 1BQPA 3GZUC 4NPLA 4D7SA 4CDUA 1JYXA 1AYN2 4BXFA 5JPMB 4FBFA 4AFMA 1W6PA 2YXSA 5ACA1 4CDWB 3B01A 1D4M2 2H6BA 1X50A 1PZ7A 2WWSA 2CU5A 1ZRRA 4HLTA 4MXWB 1OA4A 2WT2A 4EN9B 5A7SA 1ENQA 3TB0A 3AZVA 4B7EA 2IXCA 3QD6A 1ULCA 3KVBA 3ZDVA 4UT5A 3WDVA 5BNQA 2PTMA 2A3XA 1GANA 3GGLA 3T2OA 2R1BA 1OVPA 4CSWA 3S6PA 3APBA 1BEV2 1OOPC 4F83A 5TSWA 5I0RA 3H7JA 2G4IA 1LHWA 1ZBE1 4JC1A 4WVMA 1DQ1A 4QU1A 5JXHA 3KF5A 1QJX2 4LBQA 4N7IA 3VBSC 1YO8A 2Q5TA 4AVVA 2VBPA 5T50A 5K8SA 1GNHA 1HV0A 1R081 2CV6A 1FXZA 2L9LA 3O0XA 2VCBA 4Q8LA 3ZN6A 3K4ZA 2FZ2A 5CADA 1REDA 1SMVA 2RS52 2JE7A 2LW8A 4QGNA 5E6HA 5C4WA 4BJ0A 2Y0OA 3MPPG 3NO8A 5T5JA 3R4UA 5IK8A 5LEKA 3AXEA 1GICA 3TEXA 2IXIA 4RQPB 2ZXQA 3U4XA 2GC2A 4JKMA 1UZVA 1QJY1 4GWNA 4Q4W3 1RXGA 2GP5A 4Q4Y3 5CNAA 4YZ1A 2UYAA 3PVNA 1B35A 4R9DA 2DURA 4B4RA 5IK5A 1HLCA 3VBOA 4CP1A 4RSUA 5ABJB 3BUCA 4XUTA 4KG0A 3U07A 5FBZA 4NVPA 2Y26A 2HYKA 3RZHA 4UYBA 3CQOA 3QBQA 5FMBA 1F4HA 4J25A 5GJ6A 2F4LA 3A23A 4CEWA 5DXDA 1SCSA 1LAJA 2RHPA 1OQEA 3AKPA 3P5BA 2ZTNA 5I8SA 2R32A 2AEYA 5F3IA 3K77A 4PI2A 3TEZA 1VIWB 5FYCA 1NYWA 2JG9C 4XF4A 3D6EA 5BNOA 3ACLA 4XXAA 1REFA 2R073 1KQRA 3OUHA 3OUIA 4KQ7A 4NWWA 3ZPYA 3KWVA 4E4ZA 2W39A 3JBG3 1S1AA 4XFGA 4CDXB 4JGZC 5A1FA 1CIWA 1LULA 2RS31 4WVWA 3VBSA 2DCTA 3ZFGA 1UZYA 4W50A 2TNFA 4AVTA 3ZM8A 2HLEA 4K20A 4O7XA 2I74A 3VUOA 5J7MA 1GQHA 3MLLA 5A33A 2WINB 4XFHA 1WA6X 2ILMA 2XJTA 4CDUB 2ATFA 5E88A 5FUNA 3T4VA 1ZM1A 4H2AA 1KRIA 1F8VA 1W6PB 2N7GA 3NQHA 3SC7X 2IUWA 2PLV3 5D1IA 4Q0VA 1JBCA 1LNSA 4NJ4A 4CDQC 3W59A 4J6GA 4XTMA 2VMGA 3VL8A 4MH0E 2KD7A 3AX4A 4R52A 5FY7A 1X36A 1QWRA 3UK9A 3WNNA 2XLGA 2CAUA 3N9QA 3IM0A 1F9KA 1GSLA 1NCQA 2XG3A 4MGTA 5J09A 2Z79A 2GC0A 5FOBB 3FL7A 2Q8EA 2GSYA 1PVC1 3UJQA 4AHWA 4BQ1A 1SG3A 5D2AA 4YVSA 1DGWA 3OPWA 4LBQB 3USUA 2CDPA 1HB1A 1NX9A 5BNNC 2HWF3 3ZN6B 2UWBA 2YGMA 3WQ7A 3MFCA 5BUVA 4C0BA 5LA0A 3UNPA 1IPSA 1DZQA 3OBAA 3UGGA 3R05A 1OT5A 2ZX0A 1OPOA 2DVGA 2XJSA 4LBMA 4YGDA 3VKMA 4BLIA 5C4WB 3OBZA 4A45A 2CAVA 5IFPA 2XH6A 3N36A 4H55A 4AGVA 1QH7A 4RR3C 5FZ0A 4PF1A 3WR0A 2Z5WA 3J7MA 4ZONA 2KM2A 5FPVA 3T0BA 2JG8A 2BYVE 1Q8VA 1YXWA 1NUKA 2ARAA 2NMOA 2WWJA 2PN5A 2YFZA 4HN0A 4QWNA 4BLJA 1KFUL 1W8HA 2VUCA 1XNCA 1QQP3 2E33A 1K5JA 1UKRA 5C6CA 4GB31 4BQ2A 3I3BA 2D5HA 3N9LA 1L7LA 2EXJA 5EJ1B 1VE0A 1H4GA 1ND2C 1OQ1A 1SBFA 2JE8A 4QPGA 4O61A 4YZ4A 5EV7A 3W20A 3FLPA 4XILA 4BMEA 1V00A 1VBD2 2XQXA 4FOWA 4CEWB 2ZEWA 1V6NA 1WCUA 3WOGA 2V5DA 1BBT2 5FAXA 1RUI3 4URTA 2Q8OA 3VHPA 4IEPA 3CO2A 1ND3A 4YFZA 1OSGA 1ZA7A 2GZWA 3RZLA 1JZ6A 5K9YA 3H1WA 2Y6GA 2A3WA 2CGOA 2VW0A 5BNOB 1GWKA 5EPAA 1ZZBA 1UMIA 2CL2A 1HN0A 2J1SA 3HT1A 3ES1A 1JHJA 2HJIA 4D94A 4RFT0 5FYUA 3SCHA 1LJ7A 3ZFGB 4ASLA 4LK6A 4DRRA 1PX3A 3T09A 4L99A 3BPZA 3WW3A 4DXSA 2ZEYA 1O91A 2R30A 1MEC3 1F5FA 3WNLA 2C24A 3AP5A 4FTEA 4RHV1 1QOSA 5CKQA 2WNOA 3OF1A 3MUZ1 2CGPA 1KD7A 4P9XA 3LEIA 5FP7A 2LROA 4E2QA 4MVTA 1CVNA 3KV6A 3H8OA 4CCKA 4K3UA 4QB1A 4CUGA 3NMBA 5KHGA 2AGSA 1RC6A 1PMHX 1XNBA 4RGGA 4AQ6A 2YY1A 4BQXA 5IVBA 1NQDA 1YFXA 3BYWA 1AF9A 1GWLA 2X5IC 2AEZA 2YG0A 1DGWX 3H8XA 5DUVA 1NCQB 1X8EA 4XJ9A 1HRI1 2VULA 1TVGA 1W39A 4AEDA 3H9AA 5FPBA 5FLJA 4YVSB 3T4HB 2DU1A 3USUB 4D3WA 2QZ2A 5LATA 4META 3VDDA 3H3LA 1I1EA 4DUWA 2ADDA 2P2KA 4ZS3A 2DFBA 2ZMNA 1V0AA 1GP4A 1S2EA 5BY5A 2ZCWA 1DBNA 4KNCA 1JTZX 3PIGA 4IW3A 5L7OC 4QX5A 1WGPA 3T0DA 1Z78A 1POV1 1BZWA 2HYXA 2E7QA 5FP3A 1WMEA 3WF2A 3AYCA 1OQDA 1S0BA 2PHWA 1RVF3 3ZYRA 1AVBA 2ZS6B 2J1AA 3LA2A 2JG8B 3U4SA 5FP8A 3B93A 5T3NA 1VBC3 1E5RA 1XOYA 3Q8FA 3I97A 4L2NA 2WZPP 5HPOA 3OGRA 1RGSA 2Y33A 3HNMA 3ZXAC 5CBLA 3HIFA 5JWPA 5JXJA 5C9AA 4ZHNA 2VZVA 3KCCA
chains in the Genus database with same CATH topology
2RDQA 4XCAA 4ZPIA 5L9RA 2HBUA 4Q5OA 4ZONA 4NAOA 5LBEA 4NHYA 5DAWA 3NNJA 5LB6A 2A1XA 2RG4A 3OUJA 5LBBA 5C5UA 2RDNA 3W20A 5L9VA 3HQRA 2RDSA 3DKQA 4JZRA 3GJBA 2HBTA 5HV4A 2RDRA 3NNLA 3GZEA 4XCBA 5EP9A 4NHXA 5LBFA 4BQWA 5EPAA 4NHMA 4XABA 3HQUA 4UWDA 5DAVA 4BQYA 5DAQA 4XAAA 5C5TA 4J25A 5HV0A 4MHUA 2FCTA 4XACA 2OPWA 4Y5SA 3OUHA 4NHLA 3OUIA 5LA9A 3PL0A 3BVCA 3MGUA 5LASA 4BQXA 4Y5TA 3NNFA 5IATA 3NNMA 3KT4A 4NMIA 5M0TA 2Y34A 4NHKA 3KT1A 2G1MA 5A3UA 5IAVA 2V4AA 5LATA 4KBZA 5LBCA 2FCUA 3GJAA 4IW3A 3ITQA 2JIGA 4XC9A 5EQUA 5ERLA 5DAPA 2JIJA 5DAXA 2G19A 3W21A 2FCVA 2Y33A 3EMRA 5IAXA 4MHRA 3KT7A 5L9BA 3OBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDQ A;  4XCA A;  4ZPI A;  5L9R A;  2HBU A;  4Q5O A;  4ZON A;  4NAO A;  5LBE A;  4NHY A;  5DAW A;  3NNJ A;  5LB6 A;  2A1X A;  2RG4 A;  3OUJ A;  5LBB A;  5C5U A;  2RDN A;  3W20 A;  5L9V A;  3HQR A;  2RDS A;  3DKQ A;  4JZR A;  3GJB A;  2HBT A;  5HV4 A;  2RDR A;  3NNL A;  3GZE A;  4XCB A;  5EP9 A;  4NHX A;  5LBF A;  4BQW A;  5EPA A;  4NHM A;  4XAB A;  3HQU A;  4UWD A;  5DAV A;  4BQY A;  5DAQ A;  4XAA A;  5C5T A;  4J25 A;  5HV0 A;  4MHU A;  2FCT A;  4XAC A;  2OPW A;  4Y5S A;  3OUH A;  4NHL A;  3OUI A;  5LA9 A;  3PL0 A;  3BVC A;  3MGU A;  5LAS A;  4BQX A;  4Y5T A;  3NNF A;  5IAT A;  3NNM A;  3KT4 A;  4NMI A;  5M0T A;  2Y34 A;  4NHK A;  3KT1 A;  2G1M A;  5A3U A;  5IAV A;  2V4A A;  5LAT A;  4KBZ A;  5LBC A;  2FCU A;  3GJA A;  4IW3 A;  3ITQ A;  2JIG A;  4XC9 A;  5EQU A;  5ERL A;  5DAP A;  2JIJ A;  5DAX A;  2G19 A;  3W21 A;  2FCV A;  2Y33 A;  3EMR A;  5IAX A;  4MHR A;  3KT7 A;  5L9B A;  3OBZ A; 
#chains in the Genus database with same CATH topology
 3ZFE A;  2RDQ A;  3IPV A;  3FMG A;  5FXW A;  3TYJ A;  4QPG B;  1YWK A;  1BJQ A;  1LOF C;  5KXD A;  1CES A;  2EAL A;  3VD9 A;  3O1S A;  3IBM A;  3KV9 A;  2MPF A;  2W1U A;  4B1M A;  5LBE A;  2DUP A;  2IWG B;  2R1D A;  5JXI A;  5KXC A;  4YSF A;  1FOD 2;  1ND3 B;  1XXN A;  4S2H A;  4XFC A;  3O7O A;  4Q0P A;  2BNM A;  3TBD A;  2ZGQ A;  3VBH C;  1H8T C;  5A3L A;  1JYT A;  2EXK A;  2VD7 A;  1ALY A;  4YZ3 A;  1UMH A;  5LBB A;  1V6J A;  2VNR A;  4I3P A;  5JVV A;  2WO7 A;  3O1V A;  2WBK A;  3MYX A;  2P17 A;  1AR7 2;  1FX5 A;  1VBA 2;  2ENR A;  2PEL A;  3LD8 A;  4GJY A;  1LR5 A;  4JRA A;  1IPJ A;  5EZW A;  5FFO C;  4AZZ A;  4DRV A;  2RR1 2;  1CX4 A;  3Q8E A;  3PUR A;  2VZR A;  3NV4 A;  1DCS A;  1W0O A;  1QOO A;  3K4D A;  3N7L A;  4RL7 A;  1L7R A;  3UJO A;  2Q30 A;  3VBU C;  5HV4 A;  1OF4 A;  2VCC A;  3EB7 A;  5G05 L;  1RUH 2;  2P3I A;  4NHX A;  1LOD A;  3IKW A;  5CZK A;  1RUG 3;  1STM A;  3B94 A;  4FPF A;  3OG2 A;  4JKL A;  4XQ4 A;  2E26 A;  3DEM A;  3POI A;  2A71 A;  2G9F A;  2VTX A;  4LKE A;  2AYH A;  1PO2 1;  5KHJ A;  4YM2 A;  1WW7 A;  4H7M A;  1XJA A;  5HXM A;  4AVA A;  1AJK A;  4GJZ A;  4XJZ A;  2P6H A;  4Q4V 3;  2DUO A;  1QXP A;  2BOI A;  1NZI A;  2VVD A;  3ZKU A;  1ZRD A;  2XML A;  4LMF A;  4DOU A;  4PDW C;  4AED B;  4EWD A;  1CPN A;  4UF0 A;  3ZYH A;  3OOX A;  3WHU A;  3OGG A;  2WN2 A;  1WCS A;  3KV5 A;  3ZXF A;  5FWJ A;  5F7U A;  4NWV A;  1OLR A;  2WAB A;  4QXC A;  3VDD B;  5IK4 A;  5C3Q A;  3NJY A;  2I07 B;  4K9S A;  3C7F A;  1TMF 3;  5LAS A;  2QQJ A;  3CLP A;  4N9I A;  1E57 A;  1W06 A;  1ULO A;  4EN7 B;  1GKB A;  1MZF A;  2JIC A;  3HMY A;  4QXB A;  3ALQ A;  3VBH A;  3NNM A;  1WKY A;  1PGS A;  5BV6 A;  5M0T A;  2WNU C;  3N9P A;  1LGC A;  1GU3 A;  2ZJC A;  1CZS A;  2ZZJ A;  1TQ5 A;  4Q4W 2;  4EQV A;  2R6Q A;  2W2I A;  1PNG A;  4Q4Y 2;  1VAV A;  3E6D A;  4Z92 B;  1H2K A;  2HEW F;  2VZ3 A;  3BAL A;  4X6Q B;  2AC1 A;  2IC1 A;  1MS5 A;  3H3Z A;  3J9S A;  1TE1 B;  4WM7 C;  3T08 A;  4HZF A;  5C9A B;  3ZYP A;  5F5A A;  3ORJ A;  4I09 A;  1V9U 3;  3ZFE B;  3IPV B;  1UXZ A;  4K1Z A;  4NPM A;  2ZHK A;  4TXW A;  1OKO A;  5J96 B;  4GIQ A;  1HXS 1;  3BOP A;  4O9G A;  3ACF A;  2WLP A;  1GOG A;  2VZ1 A;  4E4H A;  2C4X A;  2W1W A;  3H1M A;  3KV4 A;  3T1M A;  4ZZ5 A;  4GXL A;  1SEF A;  3A21 A;  3P3P A;  1PIV 1;  2VEC A;  4RFR B;  1AYM 1;  3AP6 A;  3H50 A;  1Y9G A;  3E6B A;  1WZX A;  3ACI A;  4D7T A;  2WFF 1;  3ZXE A;  4AQT A;  2QDN A;  4OVE A;  1O3S A;  3C7H A;  2HWC 3;  5A3M A;  1R1A 1;  1S0F A;  2R07 2;  3K3O A;  3JBG 2;  3M8L A;  1XE8 A;  4HN1 A;  5FXX A;  1LCL A;  1HN1 A;  4Q5O A;  2B39 A;  3CU7 A;  3WW1 A;  4CXY A;  3SH3 A;  3ZYI B;  3OCP A;  2VBD A;  1WCQ A;  3PUQ A;  3N3H A;  2XB6 C;  2VMI A;  1XSR A;  3ZDS A;  2RJL A;  5FUI A;  1VAK A;  1CGP A;  5FO7 B;  4E2S A;  2FMD A;  4IE7 A;  3AVR A;  2IXK A;  4X8P A;  4ARY A;  4GD4 A;  3V0A B;  5SV5 A;  4D6S A;  2DVF A;  2PLV 2;  2NP0 A;  1JHN A;  1CAX A;  4YVW B;  2WNV A;  1C1F A;  4WZF A;  1YQ8 A;  3HN3 A;  5FTT C;  4XUO A;  5JAX A;  5A3O A;  3HNB M;  2FQP A;  1EAH 1;  2FDJ A;  3HQR A;  4HK8 A;  4EN8 B;  1O3R A;  4RS5 A;  3WV6 A;  4DIQ A;  5GZD A;  4JZR A;  1MVE A;  3AJY A;  2W68 A;  3GJB A;  5J36 A;  1JYI A;  3I2K A;  1JZ4 A;  1OFN A;  1QJU 1;  3GZE A;  1HRV 1;  1OD3 A;  2FDI A;  1ONA A;  2TBV A;  2HWE 3;  1NLQ A;  3G7D A;  3HN1 A;  3P1I A;  4NOT A;  2ZX1 A;  2XWJ B;  3PDQ A;  5LBF A;  3BGA A;  5IVY A;  3M4F A;  3ZFF C;  1KGY A;  4QHZ A;  1RIT A;  2B4K A;  5F2S A;  1HB4 A;  3IDA A;  5A3W A;  3WQ1 A;  2E31 A;  5C5T A;  3I3Q A;  1JN2 P;  3OBR A;  3RZK A;  3HEI A;  5F5C A;  3QCW A;  3RI9 A;  4A42 A;  1R64 A;  2OA2 A;  1EV1 3;  1NA1 C;  1PO1 1;  1M4W A;  1W6O A;  3M3C A;  3ZKY A;  4FT8 A;  1JOD A;  3POW A;  1IS3 A;  2OQ7 A;  2GU9 A;  4XET A;  3KHC A;  1AR8 3;  2A6X A;  3UKV A;  2WL1 A;  2ZHL A;  1QJY 2;  1CIY A;  5LWB A;  3GCX A;  1S0E A;  2GC1 A;  1DGR A;  2YFU A;  1QQP 2;  4IUG A;  4P5Y A;  5A7Q A;  4COZ A;  5CFC A;  1XYO A;  1UY2 A;  1UOJ A;  4XF9 A;  2PQQ A;  5FZ6 A;  1ZNP A;  1W9T A;  5GLW A;  3KS7 A;  2ZGT A;  1PGW 1;  1CWP A;  1NE6 A;  2GP3 A;  3VBR C;  3HBZ A;  3OGV A;  3Q8C A;  1ULG A;  3QAC A;  4O9E A;  5E1R A;  5F3G A;  3WNK A;  2AR6 A;  1G9D A;  1O4T A;  2VZT A;  3IMM A;  5FZG A;  5GKA C;  1U12 A;  4CXX A;  1RUI 2;  3NST A;  2ARE A;  5FWE A;  2XQR A;  4KBZ A;  3AZW A;  2BU9 A;  1W3X A;  3E5Q A;  3NWK A;  3QH7 A;  1D2Q A;  4LEJ A;  5K0U C;  2VY0 A;  4XE9 A;  1LOC A;  1WA4 A;  3E5U A;  4DMI A;  2D7F A;  4FPK A;  1PHM A;  4QQ2 A;  5T54 A;  5HCF A;  4YGE A;  4QPW A;  1JW6 A;  2XUE A;  1LKN A;  4FSJ A;  3WG1 A;  2XVL A;  4H14 A;  1SCR A;  4AI3 A;  3CMG A;  4P08 A;  1VRH 1;  5FYH A;  1NAE A;  4KWJ A;  3K2O A;  1OI6 A;  4ISR A;  3JQW A;  4M00 A;  5KBF A;  1NY7 1;  4N7U A;  4I02 A;  2ZX2 A;  2E9Q A;  4PI0 A;  4CDW C;  3ROU A;  4YW5 A;  1RUE 3;  5A6Y A;  3VKO A;  1MEC 2;  3OSD A;  2BBV A;  5BPX A;  3IWZ A;  4LQR A;  3BIE A;  4CYD A;  3GBW A;  4N8M A;  1GOH A;  4K8R B;  4X8N A;  4MHR A;  2QQO A;  2RM2 1;  2EXH A;  2VW1 A;  1PK6 A;  1PMJ X;  1UD1 A;  1T2X A;  3PTY A;  4CCE A;  4XBN A;  4F7Z A;  1CAX B;  2ORX A;  3GXU A;  1N3O A;  2WNV B;  3ZXG A;  1QDO A;  5IK7 A;  2BBA A;  4LLF A;  5FY9 A;  1VBE 3;  1RHI 3;  4NPR A;  2W9X A;  3RWN A;  3BU0 A;  4RS5 B;  3VKN A;  1JUH A;  3I2D A;  3DXU A;  1VP6 A;  2X53 S;  5J3U A;  1GYK A;  2K46 A;  2HEV F;  2WKK A;  4COU A;  3WF1 A;  4YM3 A;  4NIA A;  3URF A;  1OLM A;  2YPJ A;  1CAU B;  1OUX A;  4W6X A;  5KHH A;  2ZGO A;  2WZR 3;  3U11 A;  5IVV A;  2W95 A;  5C71 A;  4JDN A;  4C0H A;  4LK7 A;  4XXP A;  2PHR A;  5I0D A;  2ZGK A;  2C5D A;  5FY8 A;  4RQP C;  4HMZ A;  5FZB A;  1BVP 1;  3R0R A;  5CFD B;  1S55 A;  4N9H A;  1CJD A;  3ZSK A;  5IVC A;  3U1X A;  5AC9 1;  3AB0 A;  4PQQ A;  5A3P A;  2R0F A;  3TN9 1;  2Y8K A;  1LHO A;  1N1V A;  5HCA A;  2GNB A;  1MZ5 A;  1W6Q A;  2R04 1;  3AL6 A;  1W6O B;  4R9A A;  1RUD 3;  2G9Z A;  5ABJ C;  1MS8 A;  2W1Q A;  4YRD A;  5C8W A;  1QDC A;  3OJB A;  2YYO A;  2ZML A;  4GWI A;  4YM1 A;  4DXZ A;  4LO7 A;  3ZSJ A;  2A70 A;  1VBC 2;  1UU5 A;  1XE0 A;  3D3A A;  1SDW A;  1GR3 A;  1ENX A;  1F2N A;  2GC3 A;  2V73 A;  4UWD A;  4YWA A;  1KJL A;  2YU2 A;  2WS9 1;  3P6B A;  3D4K A;  4QXK A;  4CPB D;  5IVE A;  1NXD 1;  4MLO A;  2JDP A;  5CFC B;  1UCX A;  4WV8 A;  3WQB A;  3G6J B;  4UFK A;  4XMI A;  4PLM A;  3OYW A;  2VVF A;  4XDP A;  4EE2 A;  1K45 A;  4LHL A;  3IT8 A;  1WCD J;  2GNT A;  2XWB B;  3DN7 A;  3RYR A;  3WLU A;  3ZSE A;  1G9F A;  2XOM A;  4Y5S A;  1DQ6 A;  2W5F A;  1DGL A;  1FMD 1;  1HQW A;  1UY3 A;  3FWE A;  4CDX C;  1RUO A;  4A2U A;  1O3T A;  4RD7 A;  2HH9 A;  4Y26 A;  1H0B A;  4EN0 A;  3PU8 A;  1W8O A;  5L73 A;  4M3C A;  4GUL A;  3NNF A;  5IAT A;  1MQT C;  2QVS B;  1IQD C;  5FZD A;  5LA2 A;  4BQ4 A;  5IHR A;  4CDU C;  4YYO A;  4Y22 B;  4CCC A;  2VR4 A;  4ES8 A;  5KC5 A;  3S7E A;  1VMF A;  2X09 A;  4HXC A;  4GH4 B;  1KJR A;  2JEM A;  2QQP A;  1LU1 A;  2A6V A;  3NAP A;  4BMB A;  2XHK A;  1AR6 1;  3DYM A;  3PLQ A;  4FPG A;  1Y3T A;  3L2H A;  1JYV A;  3W9A A;  5F2W A;  1NCR A;  5C8C A;  4RHV 2;  4CZS A;  5DG2 A;  4OUS A;  1RUG 2;  1PK6 B;  1BMV 1;  2FCU A;  2K2S A;  3PJQ A;  3PUS A;  4TN7 A;  1WW6 A;  5GZC A;  1W8W A;  2VO5 A;  4UFI A;  1EY2 A;  2JEC A;  2O14 A;  4HK9 A;  1JYN A;  3VHR A;  4PBP A;  1MR5 A;  3K75 B;  3O5S A;  4N43 A;  4PBO A;  3C8X A;  3GBG A;  4FTS A;  1CN1 A;  2QDR A;  5HBA A;  2DVD A;  5C4W C;  2JDY A;  4OQ9 A;  3AJZ A;  1FV2 A;  2DVB A;  4IV1 A;  2RS1 1;  4XDO A;  5KHK A;  3HT2 A;  1Y7B A;  5I8T A;  3PIJ A;  1IS5 A;  1OKQ A;  4CDX A;  3PUH A;  2A5Z A;  2JDU A;  1TMF 2;  3JQX A;  3OPZ A;  4MGI E;  1UOG A;  4ASK A;  4CE8 A;  4CUB A;  4DFS A;  2EIG A;  1UIJ A;  1Z7S 3;  1B35 C;  3SXW A;  3VV1 A;  1GP5 A;  3RWK X;  3Q8B A;  4LXL A;  1W6Q B;  5F6K A;  2E7T A;  1TNR A;  1XNK A;  1D7P M;  1QXR A;  1RUH 3;  3B3Q E;  4UFM A;  3TRS B;  3AKT A;  1UX6 A;  1WD4 A;  2DTW A;  4GZ9 A;  4CCN A;  3EBR A;  4QKN A;  3WDY A;  4IER A;  4ES9 A;  4NRM A;  3HJR A;  4C1X A;  2HWB 1;  3HOB A;  3JD7 2;  4QHO A;  4PQ9 A;  4QX1 A;  2XBO 3;  3S7I A;  1AL2 1;  2RDN A;  2VE1 A;  3KGZ A;  4DNY A;  4CEW C;  1ZBA 1;  2A6Z A;  4YW2 A;  4A7Y A;  4LUK A;  1FYU A;  4UFJ A;  3LIH A;  4QM9 A;  1I9R A;  3MV1 1;  3TEW A;  3LOB A;  1XC6 A;  1V9U 2;  4TSV A;  1Y9M A;  4TWT A;  3CBN A;  1SFP A;  3OYW B;  1AL0 G;  2C6S A;  4LKD A;  1XYN A;  3O1P A;  3AYE A;  4BIF A;  1GV9 A;  1AR9 3;  1UAI A;  3CDZ B;  4Y1Y A;  3WP3 A;  5BNO C;  1DU3 D;  3SCF A;  4IND A;  5FZM A;  5JMC A;  1TME 1;  1UQX A;  5GM0 A;  4IE4 A;  3HQU A;  3EJK A;  5F8P A;  4ZU5 A;  2HWD 1;  3ZFG C;  5FZ3 A;  2EVX A;  4R4Z A;  5KHI A;  1JOB A;  1XRU A;  4M3C B;  3T1L A;  4K40 A;  4TZD A;  3ZX7 A;  1G9C A;  3H8R A;  4OCT A;  2NYY A;  4YGB A;  2HWC 2;  3ILF A;  4AI9 A;  1GZT A;  3R6S A;  2JDM A;  4BCU A;  3SQO A;  3UES A;  5E8A A;  5AFE A;  3H42 B;  4GMP 3;  4U36 A;  1ODM A;  1XU1 A;  3NAP B;  3UL2 A;  3MID A;  3DXT A;  1ACC A;  3SMH A;  4NHL A;  4BE3 A;  4DUV A;  2WC2 A;  4XQW A;  1NCR B;  5C8C B;  4GQ7 A;  2D44 A;  2HWF 1;  2NMN A;  4J1W A;  1KIT A;  3BVC A;  4XIO A;  1S0I A;  3ETP A;  2FZ1 A;  5LZ6 A;  1DQ0 A;  1NCQ C;  1FI2 A;  4V2W A;  1IKQ A;  1H2L A;  3NNG A;  2Q8C A;  1FPN 3;  3WZ1 A;  1DYK A;  1NZC A;  4G9S B;  4YVS C;  1RUF 1;  1TEI A;  2O1Q A;  2B45 X;  5IAV A;  3LB9 A;  2ORZ A;  1Q43 A;  1SBD A;  1RMU 1;  4PLO A;  1WUV A;  4OHZ A;  3MW4 A;  3KZ4 C;  4N43 B;  4O65 A;  4XF0 A;  4CCM A;  1YRZ A;  2OT7 A;  4HKO A;  5JIA A;  1OD5 A;  2UU8 A;  4A3X A;  2FMY A;  2X8K A;  4AQ2 A;  5A7N A;  5C3O A;  1I3H A;  2ARC A;  2HWE 2;  3AKR A;  4MZU A;  5CIS A;  1SBE A;  2C26 A;  2NM1 A;  4IV1 B;  4XFI A;  1HJF A;  1YFW A;  4LBJ A;  1US2 A;  2QQN A;  5FZ9 A;  4YFW A;  5FYT A;  2JG8 C;  2ZKL A;  5DAP A;  3PTR B;  2MEV 1;  3POY A;  4P9L A;  1UU4 A;  4L92 A;  1H9W A;  2D98 A;  2BJS A;  4Y1U A;  1EV1 2;  1W2U A;  2Q8D A;  4AG4 A;  2QQI A;  3SKJ E;  2PHD A;  1HW5 A;  1UYZ A;  4A3Z A;  1IPK A;  5JR7 B;  1AR8 2;  3N35 A;  4QPG C;  1JU4 A;  5ACA 3;  4XCA A;  2QBX A;  4YZ2 A;  2B9V A;  5FV3 A;  5FYM A;  1UOB A;  1A34 A;  2WR9 A;  2LM3 A;  5LA1 A;  1ND3 C;  4NAO A;  2XDV A;  4MYE A;  1QU0 A;  1GZC A;  3SKV A;  1GP6 A;  4QHB A;  4AFD A;  2ZZQ A;  3WHT A;  4HL0 A;  4HSJ A;  4P9G A;  3KF3 A;  4HVR A;  4A44 A;  1RIR A;  3NW4 A;  2QFE A;  2W91 A;  1ZBE 3;  3W58 A;  3POG A;  3DYP A;  1R09 1;  4XYX A;  1HQN A;  1NT0 A;  3IIA A;  3KLS A;  4ZXK A;  5E16 A;  3EYP A;  4QDQ A;  4P14 A;  3ZOI A;  3CJI A;  4B4Q A;  4HKW A;  2PAK A;  1JZ5 A;  3RZM A;  1UZW A;  4QKB A;  1C8M 1;  1JUI A;  1R08 3;  1ULP A;  2ZGP A;  3MIB A;  5FO8 B;  5LK7 B;  4AE2 A;  4UW4 A;  3MF6 A;  5FMO L;  3T2T A;  4XIK A;  1KDM A;  4HVQ A;  4JRL A;  1OLM E;  2FHR A;  4KBB A;  2JDN A;  4UXA A;  1OVS A;  4UW6 A;  1QMJ A;  1VMH A;  5H9P A;  2E32 A;  4IV3 B;  1RUE 2;  2XPJ A;  5FUP A;  3N4M A;  1IGO A;  1QJY 3;  2FBE A;  2O8Q A;  2P4E A;  4GMP 0;  3LOI A;  4I0A A;  4N53 A;  3ZLI A;  2IVI B;  2R06 1;  4XBQ A;  2VTX J;  2BQP A;  1I5Z A;  1U5X A;  3M3O A;  3NKT A;  2ZAA A;  1RYY A;  5EXO A;  2PAM A;  1VLN A;  2PHF A;  2TUN A;  3UET A;  4JGY A;  4AED C;  2WO1 A;  4AVB A;  2WYF A;  2XL9 A;  3HVD A;  1F35 A;  2VMD A;  2VME A;  1VBE 2;  2VQA A;  3H8U A;  1RHI 2;  4Z07 A;  1RVF 1;  4AI0 A;  4CUC A;  4LIU A;  3VDD C;  1G7Y A;  4IXL A;  2XVK A;  2YHJ A;  2ZPX A;  3JB4 C;  3CZU A;  1E5I A;  1NLR A;  4OI1 A;  1KXG A;  5FXZ A;  1GWM A;  4IGO A;  3MGU A;  3UV9 A;  4PJY A;  4R9B A;  1D2S A;  1Q8O A;  1HRV 2;  2P6C A;  2WZR 2;  2ZGR A;  3NJX A;  1H6Y A;  2B9U A;  2XJQ A;  4G4F A;  3PVE A;  2C9K A;  2CGN A;  1HJG A;  1VBB 1;  2QCS B;  2A73 B;  2WRA A;  5T55 A;  4A7Z A;  2X29 A;  1WLC A;  2Y34 A;  4LBQ D;  4AGG A;  1GNZ A;  4YM0 A;  2RS3 3;  1HDK A;  2WII B;  3QH6 A;  1LOB A;  3AXD A;  1GQG A;  2DV9 A;  3B02 A;  4NII A;  1RUJ 1;  3WCR A;  4QAW A;  3MHZ A;  3GF6 A;  4L8Q A;  2EA7 A;  1D0H A;  1RUD 2;  4OUM A;  2A7A A;  5F3E A;  3U78 A;  5C9A C;  1OHF A;  3I4I A;  5F5Q A;  3IZO A;  2V5Y A;  2X10 A;  3CEW A;  3ZFE C;  2JKX A;  3GJA A;  2WAA A;  3BOD A;  3LA3 A;  4QDS A;  4QX2 A;  4A7K A;  3GNE A;  1LGB A;  5JOZ A;  1YCI A;  4E8C A;  3OGS A;  2B42 B;  1MS9 A;  4CUA A;  4NUB A;  1BK1 A;  1ZRF A;  1W8Z A;  4Q4X 1;  5B4N A;  1AX0 A;  1O6U A;  1UNB A;  1C3H A;  4YNI A;  1ASJ 1;  1PGL 2;  4RGK A;  1WLW A;  1QH6 A;  5DDJ 1;  3VL9 A;  2VCM A;  1T6G C;  1RUC 2;  3OEB A;  5FZF A;  1OXC A;  5IAX A;  3V0B A;  1BXH A;  4PT6 A;  5FKC A;  1QF3 A;  3MIF A;  1MPX A;  1PVC 3;  2JD9 A;  2VZS A;  2QUO A;  4D7Y A;  1W6M A;  2SLI A;  3CJI B;  2W92 A;  1W2N A;  1V6O A;  2HBU A;  2OUH A;  4Q4V 1;  3S5Q A;  3QLQ A;  1G8W A;  3ZMO A;  1GZW A;  4ORF A;  3NV3 A;  1W0P A;  1LB2 A;  1PM4 A;  1YIP A;  4JQT A;  5FO9 B;  3LAG A;  1SLC A;  4IEO A;  4TLF A;  1COV 1;  1EP0 A;  5FZA A;  1O59 A;  4KMQ A;  2WQZ C;  2XJR A;  2Y64 A;  1JZ8 A;  4YVW C;  2JJ6 A;  1K5M A;  4N53 B;  1W8T A;  2PHU A;  2AUY A;  3HBK A;  3HAG A;  5GLZ A;  5DZF A;  3AMM A;  5BXX A;  3W5M A;  4S2D A;  4Z2A A;  3AMN A;  1FAY A;  4JGY B;  4OQ8 A;  3BN6 A;  5EJZ B;  3OTF A;  4MOA A;  4GB3 3;  4XCB A;  3V65 A;  1RL3 A;  1AYN 1;  1VB2 A;  3P3N A;  5DUU A;  5AVP A;  4MX3 A;  2EIE A;  3ZIX A;  1KS5 A;  1D4M 1;  4BQW A;  4AEK A;  3FHI B;  4W8J A;  1AXK A;  1HV1 A;  1QY4 A;  3R4S A;  4PCR A;  4QXH A;  4OMC A;  2BVV A;  4FPH A;  4R9C A;  2DCJ A;  3H7Y A;  5B4X A;  3SNM A;  3T2P A;  1W9W A;  1ZZ6 A;  2XL7 A;  3VDB A;  4I0B A;  4EJR A;  2NN8 A;  1AX2 A;  3Q9O A;  3RFR A;  1LEC A;  2VBB A;  3RJR A;  2VNO A;  1JH5 A;  4LUM A;  2PHL A;  4DZG A;  4C8D A;  4OHW A;  1BEV 1;  5E89 A;  5T5L A;  2D6L X;  3WF4 A;  3ZSL A;  3VHO A;  5A3T A;  4JHZ A;  4MXV A;  1Z7S 2;  5JSO A;  1AUY A;  1QJX 1;  5IW0 A;  2Q1M A;  4TYS A;  5AC9 2;  3POF A;  5FBJ A;  1HB2 A;  4AFC A;  5LA9 A;  4CP0 A;  1I5P A;  1IG0 A;  4RHV 3;  4OYU A;  3CL1 A;  2RS5 1;  3S57 A;  1WBL A;  1QHD A;  2EF6 A;  3WG4 A;  3FC0 A;  3AKQ A;  3V0A A;  1OUS A;  3LZZ A;  3VZK A;  2OXB A;  3E97 A;  4LOR A;  2XBO 2;  4YVW A;  4IEW A;  4J1X A;  5LY2 A;  3AYA A;  4KWL A;  4COY A;  1F5J A;  4CU7 A;  3ES4 A;  3WCS A;  3WF3 A;  4JTN A;  5GAL A;  1Q8Q A;  2ERF A;  3THD A;  2OPK A;  2RE9 A;  4QKF A;  3O1M A;  1MZE A;  4LO5 B;  1AR9 2;  3V0B B;  1HRI 3;  5LBC A;  1QNY A;  2ZAC A;  2OYZ A;  4XHX A;  4QPY A;  4FFH A;  5A70 A;  1W6M B;  4CP2 A;  1ULF A;  3NRU A;  5FZ7 A;  3A4U A;  5I0T A;  2ZGN A;  2G9G A;  3SEP A;  1Q3E A;  1SLA A;  3VZN A;  3GM8 A;  5FYZ A;  4BQ3 A;  2BFU S;  1GZW B;  3AFG A;  2IFR A;  3LF7 A;  4MG2 A;  2ZBJ A;  2J1U A;  1QGL A;  2ZKN A;  4D6R A;  4FO9 A;  1POV 3;  5D8A A;  3AP7 A;  2DCK A;  4JDO A;  3RI8 A;  3F2Z A;  2BDR A;  2NPI A;  3M7A A;  2WNV C;  2KA3 A;  4QT6 A;  1K5M B;  4Q27 A;  2P5B A;  3JD7 3;  3K3N A;  3WW2 A;  2W0X A;  3WVJ A;  2GH2 A;  4ZPI A;  4RS5 C;  1T6B X;  2NQY A;  3DEC A;  3RVH A;  3ZXK A;  2B7Y A;  3PNA A;  3JU9 A;  1C4R A;  1UY1 A;  3CZJ A;  5APA A;  4BK4 A;  2WSU A;  4XOG A;  2Y6F A;  3OPT A;  1FPN 2;  5DZE A;  2EID A;  4A6S A;  1O5L A;  2DBI A;  1YI7 A;  3A0K A;  4I30 A;  3NNJ A;  4C90 A;  3W5N A;  1DGR N;  3DKW A;  2V72 A;  2JB4 A;  5H9R A;  2AEN A;  5IFT A;  4V1P A;  1URX A;  5CFD C;  1R1Z A;  3SH4 A;  1A8D A;  2QQM A;  2DF7 A;  4H3W A;  3ZN5 A;  3IDE A;  4Y1X A;  4PF5 A;  1NOV A;  4P00 B;  3RDI A;  3FE5 A;  4XUR A;  1VAM A;  1OA2 A;  3CF6 E;  4HKL A;  3WF0 A;  1VPH A;  4AGR A;  4LIV A;  2RDR A;  3WDX A;  2YU1 A;  2RS1 2;  2Y6L A;  1FV3 A;  2Y6H A;  3GZT B;  1N1Y A;  1OFS A;  4AK3 A;  5A6X A;  1UY4 A;  3NV1 A;  2BGO A;  2BTV C;  4AYU A;  5F9T A;  4H7L A;  3T3Y A;  5A1A A;  1WD3 A;  3KQ4 B;  4LNV A;  5CG9 A;  3VZL A;  2WQ4 A;  4XAB A;  1SLT A;  2X5I B;  3O0V A;  1ZYB A;  4ATE A;  5CFC C;  2PFW A;  1PZ9 A;  2CNA A;  4LHS A;  2UUR A;  3PMS A;  2YPD A;  3FLT A;  1UO9 A;  4FPO B;  5CKM A;  1DZR A;  4M01 A;  4MHU A;  2IZW A;  2OW4 A;  5FJK A;  2VTF A;  5ACA 2;  1XE7 A;  1ENR A;  4AFB A;  1PO2 3;  1RXF A;  1W04 A;  5I8Y A;  1NG0 A;  4NIH A;  4DS0 A;  4LKF A;  5FR3 A;  2QQL A;  5CVR A;  3FX3 A;  3RG0 A;  2XJV A;  3RZZ A;  4OFG A;  4BDV B;  1OH3 A;  2YC0 A;  2CY6 A;  2ET1 A;  3PL0 A;  4CPB A;  4CTE A;  4EV0 A;  5FQ0 A;  1F31 A;  2XHN A;  4YW4 A;  5IYY A;  1CAU A;  3AZZ A;  2GMM A;  4HOO A;  4ITC A;  4QX0 A;  4RGA A;  4Q2F A;  4AHY A;  5BNP A;  1H2N A;  1ZZ7 A;  1ZBE 2;  3VBF A;  4GWJ A;  2WJS A;  2WSV A;  3PJY A;  5JOW A;  5SV8 A;  4OI4 A;  4NHK A;  1VBD 1;  5CFD A;  4JAA A;  4XUN A;  3H3U A;  3DL3 A;  4LOT A;  1BBT 1;  1R08 2;  2D40 A;  1PZ8 A;  3ELN A;  1W28 A;  4WVV A;  5D8A B;  1WW5 A;  1YUD A;  3FHA A;  4ET7 A;  1PK6 C;  3WW4 A;  5L36 A;  5ANN A;  3LPG A;  4CRQ A;  3THC A;  5JZG A;  2YUE A;  1OA3 A;  1POV 0;  3PUA A;  3WNO A;  3AZY A;  3ITQ A;  2E53 A;  3OEA A;  5JDB A;  2VM9 A;  2B5H A;  2RMU 1;  1G6N A;  1ST8 A;  4B8E A;  3BTY A;  1FNY A;  4DIN B;  3OD0 A;  4V2V A;  4QPI A;  1JYC A;  2D43 A;  3IDB B;  5A1L A;  5FK8 A;  1U5Y A;  1W9S A;  1UIK A;  4Q29 A;  5I91 A;  4XW3 A;  3ME2 A;  3I2F A;  4G3Y C;  5L19 A;  1V70 A;  4A41 A;  3T0A A;  3J8F 1;  1HXS 3;  1LHN A;  5LK5 A;  4ZS2 A;  3OB8 A;  4XEZ A;  5L9B A;  2FDF A;  2QJV A;  3C2U A;  2GME A;  4MGK E;  4CEY A;  2E6V A;  2WDB A;  1UN1 A;  3KMH A;  2IVJ A;  4L0P A;  4EN6 B;  1A78 A;  1IHM A;  1SHW B;  2WFF 3;  2UYB A;  5JSP A;  2CWS A;  4CCJ A;  4CXW A;  3WT3 A;  4FI9 A;  2LTN A;  5GLV A;  1R1A 3;  3WY6 A;  4Y22 A;  3HPN A;  5EFU A;  1PNF A;  2WNE A;  2XLA A;  4AHZ A;  4LA2 A;  2ETE A;  2RS3 2;  4GH4 A;  3KB5 A;  4FVV A;  3CIH A;  1TNF A;  4MGZ E;  4Y33 A;  4I01 A;  2VAU A;  1WMX A;  3C7E A;  1W8F A;  2MEV 2;  4BB3 A;  2RJK A;  5I93 A;  2VQ0 A;  3I3E A;  1J83 A;  1X9T A;  2BP6 A;  1W05 A;  4E4S A;  5L9V A;  1X33 A;  1U0A A;  4PDW B;  1MS4 A;  1EUT A;  1UX7 A;  2OS2 A;  3I54 A;  4M0N A;  3ILR A;  4OHX A;  4MSV A;  3AYD A;  2QKD A;  1DFQ A;  3ASI A;  1NKG A;  1GMM A;  1VAL A;  1NXM A;  3AFK A;  4XAE A;  3TEY A;  1IKP A;  1WCK A;  1KEX A;  1EAH 3;  4W6W A;  2X05 A;  3U10 A;  3LDB A;  3WDT A;  3T2Q A;  5FQ0 B;  4KWU A;  4BQY A;  3MIH A;  1IS4 A;  1V6L A;  2VNV A;  2YC4 A;  4YW7 A;  1QJU 3;  4IES A;  1HRV 3;  1UMZ A;  2VGD A;  2J42 A;  5FPA A;  3THT A;  5BNP B;  2Y0I A;  3ZYJ B;  3VBF B;  2XKO A;  3NL1 A;  2UWA A;  2BV4 A;  1PVC 2;  2XVG A;  1MS0 A;  5LEJ A;  2B46 X;  5FZI A;  2DTY A;  3NAP C;  4XAC A;  2DDU A;  2AH2 A;  2VPV A;  2W47 A;  2Y60 A;  4KH9 A;  5JPN B;  1ZA4 A;  4IGP A;  4LHN A;  2I2S A;  5FY4 A;  1DQ5 A;  2VL4 A;  3N9N A;  1CX1 A;  1NCR C;  3VKL A;  1FOD 1;  5C8C C;  2D6K A;  3RMY A;  4DXR A;  3A22 A;  1X7N A;  4HG6 B;  1OF3 A;  2UY8 A;  2W52 A;  1UYX A;  2VXR A;  4JVA A;  4RA0 A;  3UYJ A;  3V64 A;  1N1S A;  5JZG B;  4HFS A;  3K46 A;  2HKX A;  1QJF A;  5C3S A;  1LOG A;  2JDZ A;  4SLI A;  4HPK A;  2OUJ A;  3K51 A;  4GKY A;  4FOY A;  4NMI A;  3VZO A;  1AR7 1;  1VBA 1;  4FFG A;  4Y1V A;  3FFZ A;  3D5O A;  3I49 A;  2RR1 1;  3KT1 A;  2YC2 A;  4X6R B;  5GLU A;  4N43 C;  4QPI B;  4ZKT B;  1DQ2 A;  3MBW A;  5JOX A;  4BH9 A;  5A6Q A;  4GA9 A;  1AXZ A;  1BHG A;  1RUH 1;  1G86 A;  3LEG A;  4GB3 2;  4JKK A;  1RUC 3;  4ZY9 A;  4IEU A;  3WUC A;  2W3J A;  1SPP A;  4IV1 C;  2VG9 A;  4QQP A;  1O4Z A;  5FZH A;  4LKS A;  4YAR A;  1O7F A;  3VD7 A;  4ZU7 A;  2LRP A;  1WBF A;  4OMD A;  4CEY B;  2JIG A;  1DDL A;  2JE9 A;  3SEE A;  2ZGU A;  2VMC A;  2E51 A;  2BNO A;  4Q1P A;  5FP4 A;  4CCO A;  1POQ A;  3ON7 A;  4UBH A;  2A6W A;  3OY8 B;  5ISL A;  3CKH A;  1WLD A;  2J1V A;  2ZX4 A;  4M4R A;  2HEY F;  4M4P A;  3GDB A;  4LPL A;  4XBL A;  2W87 A;  4ATF A;  2DBN A;  1VRH 3;  3FHQ A;  4DPN A;  3FBY A;  2Z4F A;  3JXS A;  1LU2 A;  1DIW A;  4KU7 A;  4PIY A;  1LES A;  4QMA A;  3T30 A;  4LBL A;  2JD4 A;  4JQR A;  1C1L A;  3WQ0 A;  5C3P A;  2CSG A;  1L7Q A;  3ABZ A;  5IT6 A;  3N9M A;  1UKG A;  1NQJ A;  2JDK A;  4W6Y A;  2GAL A;  4QX8 A;  1BK0 A;  2GDF A;  2RM2 3;  1UZ0 A;  2CDO A;  2ZOE B;  1ZRC A;  1IG3 A;  3VZJ A;  4TLG A;  4FTB A;  4Q4W 1;  1H4H A;  4LJH A;  4Q4Y 1;  4LO6 B;  4WZC A;  5FRA A;  2D6O X;  3MZH A;  1SQ4 A;  4BWO A;  1SLB A;  3OD4 A;  5CEH A;  1HRI 2;  4FPJ A;  2ZEX A;  5AFB A;  4OHY A;  4FPC A;  1CD3 G;  4W65 A;  1NA1 B;  3N7M A;  3DPR A;  2J1R A;  2ZGS A;  3I8T A;  1H6X A;  4Y5Z 0;  2VOX A;  3HR9 A;  3FLR A;  3IAQ A;  2IXJ A;  5DZG A;  4AHX A;  1APN A;  1IS6 A;  2ID4 A;  2YZ4 A;  4IV3 C;  3RPQ A;  2VVE A;  4LHK A;  3UKN A;  4JV4 A;  2MHF A;  1MAC A;  3BI3 A;  2BOJ A;  5AC9 3;  3TN9 3;  1Q8P A;  3M3E A;  3SCG A;  2EAA A;  2R04 3;  1YHF A;  5FXV A;  4YW6 A;  1QXJ A;  4AVS A;  2ET7 A;  3POJ A;  1KS4 A;  4A6O A;  5FPX A;  1Q5O A;  1BCX A;  1Y9Q A;  4LUL A;  2R07 1;  4HPK B;  2R16 A;  3RNS A;  1ZVF A;  2D3R A;  3VBR B;  5C7G A;  3III A;  3JBG 1;  1IOA A;  4FAG A;  3WNX A;  5CG8 A;  5JI7 A;  4W4Z A;  1S0C A;  4WBB A;  4YW3 A;  1UYY A;  5FZO A;  1S0D A;  3ATG A;  3IAP A;  4Q26 A;  4FXG B;  3RZJ A;  3GZA A;  3KVA A;  1MVQ A;  3TWI A;  5FZL A;  3BKZ A;  3USS A;  1SPP B;  3GYD A;  2R7E B;  1F4A A;  1LED A;  2YBK A;  4Y5T A;  4QB2 A;  3ACH A;  4S2G A;  3JZV A;  2XXZ A;  2PLV 1;  4PLN A;  2DYC A;  1LEM A;  1FMD 3;  5CB7 A;  4EZH A;  5DN2 A;  4R8H A;  3ZXD A;  1DP0 A;  2V4V A;  3RRD A;  4BPZ A;  5A3U A;  2BGC A;  4DEV A;  2I45 A;  3V56 A;  4BYY A;  1S0G A;  1RB8 G;  3BOW A;  1EPW A;  1X9P A;  2LS6 A;  1HX6 A;  4FCA A;  2OZ6 A;  3RYP A;  1OC1 A;  2WUH A;  4FPY A;  3VKF C;  2WWU A;  2LUW A;  3FZ3 A;  5FCC A;  4IV3 A;  1PM7 A;  5C33 A;  5F37 A;  1JOP A;  1UF2 C;  1AR6 3;  1HIX A;  4UW3 A;  1BKZ A;  4MUV A;  4NO4 A;  3E6C C;  4XC9 A;  2VMF A;  4K8F A;  1OPM A;  5DAB A;  2WFP A;  1VB4 A;  2JIJ A;  1KFX L;  4Y20 A;  3LCP A;  3POB A;  1WLT A;  1B09 A;  3O1R A;  2GN7 A;  5ANQ A;  1PO2 2;  4URA A;  5IWF A;  3WIN E;  2YB7 A;  5FZC A;  5A7O A;  1N3P A;  1H1M A;  2DWR A;  1U5I A;  1C57 A;  2IFW A;  2F17 A;  1YQC A;  2E63 A;  2ZHM A;  3MI8 A;  3CJI C;  3MIG A;  3VDC A;  4Z82 A;  2E7A A;  4YW1 A;  2UWC A;  1UU6 A;  4WM8 B;  4YPJ A;  1G9B A;  1KDK A;  4UFH A;  2YBS A;  4P5H A;  1QQP 1;  4E2G A;  2Y6K A;  3DPR B;  4ISQ A;  4CVU A;  3ZSM A;  4B4P A;  1W0N A;  4OI0 A;  1V6M A;  2K9Z A;  2RS1 3;  5DAW A;  1K12 A;  1XU2 A;  3HD8 B;  2D3P A;  2JXA A;  3MO4 A;  1OMI A;  4UBG A;  4COV A;  3PVO A;  1CAW A;  2YV8 A;  4N53 C;  1RUI 1;  1QIQ A;  3MEP A;  4YZ5 A;  2SBA A;  4XHB A;  4F8A A;  3WDU A;  1AX1 A;  1CR7 A;  2Q1Z B;  5C5U A;  5GLT A;  5EYY A;  4JGY C;  4KL1 A;  5CYY A;  2VU9 A;  3PHM A;  3KGL A;  1DZT A;  1OOP A;  1FT9 A;  4KU8 A;  2HBT A;  1UL9 A;  3FN9 A;  2DUQ A;  4BXS V;  4DY5 A;  2HWB 3;  2JB8 A;  4ERO A;  3UGF A;  1G9A A;  3HWJ A;  4LO8 A;  1AL2 3;  4NR1 A;  5FZO B;  4S2F A;  5A80 A;  1SDD B;  1ZBA 3;  2XGX A;  1J84 A;  3ENR A;  3ZXL A;  4Y24 A;  5JXG A;  1MEC 1;  5J98 B;  1YFU A;  5KC6 A;  4NHM A;  5DAV A;  4FQZ A;  1MQT B;  3ZYF A;  4EWE A;  3MV0 1;  3POS A;  2F4P A;  1DHK B;  5FPZ A;  4D6Q A;  2CYF A;  4L9B A;  1HXS 2;  2A75 A;  2WO3 A;  3ETQ A;  1ZRE A;  1TME 3;  4YG0 A;  2C0Z A;  2PMW B;  2BEO A;  4JCK A;  2GMP A;  2QQV A;  1PIV 2;  2HWD 3;  4DO0 A;  1AYM 2;  1N3Q A;  1O5U A;  2OPW A;  4XFF A;  3U0Z A;  4DUX A;  3ZN4 A;  4YLZ A;  2WFF 2;  4RN5 A;  3L2Y A;  1R1A 2;  1K3I A;  1P8J A;  2VW2 A;  2YGL A;  3MIE A;  4BOW A;  1C28 A;  4WVM B;  3BTA A;  3AZX A;  2YMZ A;  4AEM A;  4AR2 A;  1Q8S A;  3LFI A;  1JMU B;  2VOW A;  4Y20 B;  2BRT A;  3M3Q A;  5DG1 A;  2V4A A;  1K42 A;  2OZJ A;  5FZ8 A;  4XJU A;  2JDA A;  4FOV A;  5A32 A;  4P9J A;  1H2M A;  2JG9 A;  3MLJ A;  1QJE A;  4UAP A;  5HXV A;  3THP A;  5FPL A;  3KQR A;  5T52 A;  1RUF 3;  5T5O A;  3BPS A;  5KXE A;  1VBC 1;  3AL5 A;  2VZQ A;  4JGZ A;  1EAH 2;  3EO6 A;  2PYT A;  1W03 A;  3E1F 1;  1YI9 A;  1LHU A;  1RMU 3;  2GH8 A;  3U75 A;  1JZ7 A;  1SZB A;  1B35 B;  5JLV A;  4NAM A;  1WMD A;  2QQU A;  5EQU A;  3B7M A;  1VR3 A;  3VBO B;  4N90 A;  1QJU 2;  2GNM A;  3WG2 A;  4AI8 A;  1J3Q A;  2G19 A;  1YEW A;  3MW2 A;  1DYP A;  3HNY M;  4PIX A;  3LDK A;  3S0M A;  2FCV A;  4QX3 A;  3EMR A;  4HAN A;  2OX0 A;  4ASM B;  4XJ8 A;  1K5M C;  1CAW B;  3CJX A;  3M3I A;  1TG7 A;  2A3Y A;  2WT0 A;  1SAC A;  4HVO A;  4CDQ A;  2MEV 3;  2VOT A;  4JX0 A;  3ZIW A;  3I2G A;  5L9R A;  1XSQ A;  1JZ3 A;  1O8P A;  1YJK A;  1PO1 2;  3JCI A;  4M3C E;  3VN4 A;  2VQU A;  5J48 A;  1OOP B;  3WEZ A;  1IZ3 A;  2PHT A;  1UOF A;  1BYH A;  4QGL A;  5A3N A;  1O3Q A;  1DLL A;  3VBS B;  3POE A;  1IQA A;  1EPZ A;  2A1X A;  2RMU 2;  2RG4 A;  1MS3 A;  2Y6J A;  2Z69 A;  3OUJ A;  4QKD A;  3ZMN A;  5BNN A;  5FRE A;  4NRO A;  2CHH A;  3I2I A;  4MAD A;  5A33 B;  4UI9 L;  3LFM A;  5FZE A;  3NJV A;  2Z42 A;  1ZZ8 A;  5J37 A;  3A0N A;  4Q1R A;  5EYX A;  1MS1 A;  1RUG 1;  3UKT A;  1PGW 2;  1ZX5 A;  5HCB A;  2ARX A;  2CTV A;  2FDH A;  3FJS A;  2FDG A;  2WA3 A;  3BTX A;  4RR3 A;  3J8F 2;  4CCL A;  3WP5 A;  5EP9 A;  1R09 3;  5FJH A;  3Q8A A;  2VNG A;  5FYY A;  4AXO A;  5KWR A;  1LEN A;  1X82 A;  2Y38 A;  4E9K A;  1DG6 A;  1RTV A;  4OUE A;  1YYN A;  4MGQ A;  1O4Y A;  1C8M 3;  5FYB A;  4AOC A;  3LEM A;  4CU9 A;  3DGT A;  4KG8 A;  1VRH 2;  4LOS A;  2BWA A;  1HQL A;  4LBO A;  4LIT A;  4XAA A;  4I3G A;  2WT1 A;  5DAQ A;  1YIF A;  4BM8 A;  1NY7 2;  2WA4 A;  4OZX A;  4Y1Z A;  3RSJ A;  1ND2 A;  1PMI A;  1XNA A;  5FLI A;  2QZ3 A;  2ES3 A;  1TMF 1;  2FCT A;  4D8M A;  1GNY A;  2R06 3;  2VC9 A;  3FBM A;  3J7L A;  4YGC A;  5FLH A;  3RJ2 X;  5KR7 A;  5A32 B;  2YBP A;  2RM2 2;  4M0H A;  1VJ2 A;  4NE9 A;  2JG9 B;  5LRS A;  2JEN A;  5K7P A;  3ZO0 B;  5F39 A;  3GBF A;  1E5S A;  3GHM A;  2CWM A;  4IEX A;  3PUI A;  4JGZ B;  2WAO A;  5HI0 A;  2K0G A;  4Z8B A;  4QQH A;  2P3K A;  3JD7 1;  1ENS A;  4DEQ A;  2VQT A;  1J3R A;  5D21 A;  5H9Q A;  3KD4 A;  4ZXE A;  4XFA A;  3U14 A;  2JWP A;  3J26 N;  1J1L A;  5EIY B;  1V9U 1;  2Q4S A;  3PME A;  2YDE A;  5D8A C;  4FXK B;  1W3V A;  4ZU4 A;  3NVC A;  1LOA A;  2JX9 A;  2XON A;  5FYI A;  2BGP A;  3VD4 A;  1S0J A;  1ZZC A;  4LE3 A;  5CKN A;  1VBB 3;  3J7H A;  5C70 A;  4IE0 A;  4QGM A;  1H1A A;  4JDM A;  4CDQ B;  4AW7 A;  3WG3 A;  1L3J A;  1YQ6 A;  1OH4 A;  3WP4 A;  5KXB A;  2D6N A;  5JCT A;  4IET A;  2VOV A;  4FPE A;  1RUJ 3;  1YJL A;  3TN9 2;  4Q8K A;  5J1X A;  4OZO A;  2R04 2;  2BNN A;  1U5Z A;  2X5I A;  3MF9 A;  3MIC A;  1UXX X;  1DLC A;  4Z2W A;  2HWC 1;  4KGQ A;  4XJW A;  1NE4 A;  5DAX A;  3DCQ A;  1O8S A;  3DUI A;  4AFA A;  1NLS A;  1W6N A;  4TTG A;  3LSE A;  2VMH A;  3W21 A;  2AAC A;  3D82 A;  5G04 L;  4XTP A;  2ZAB A;  2WS9 2;  5K4L A;  1JI6 A;  3BB6 A;  5BNN B;  1RJ8 A;  2WZ8 A;  4Q4X 3;  3KT7 A;  3AK0 A;  4PHZ A;  5IJR A;  1ASJ 3;  4IEQ A;  4E4D X;  5L7O A;  4R4X A;  5DDJ 3;  4Y4R A;  5F5I A;  2D97 A;  4FFI A;  1JZ2 A;  2J1E A;  4EYU A;  4AVC A;  3O1U A;  1ULE A;  2ZHN A;  5EHD A;  4K1Y A;  3FFQ A;  4RR3 B;  4L11 A;  2H0V A;  4AWD A;  4DB5 A;  1FMD 2;  3E5X A;  3TOJ A;  4BIO A;  2O8O A;  3BCW A;  3WX5 A;  2H0B A;  4LE4 A;  4NIG A;  4FOQ A;  4DXT A;  5A7P A;  1JYW A;  2C9A A;  2R0H A;  2A6Y A;  5FZK A;  4K6B A;  2PAE A;  2HWE 1;  3BTZ A;  3I3M A;  4UW5 A;  2D6M A;  1COV 3;  1XND A;  1ND2 B;  1UYP A;  4NRP A;  1VMJ A;  3RS6 A;  1LOF A;  1WMF A;  4Z1V A;  4F3J A;  1AR6 2;  4YG3 A;  4XZP A;  2C1F A;  4CP9 A;  3LQC A;  3VLB B;  4IEY A;  4CU8 A;  1LGN A;  1GBG A;  4XUP A;  2WN3 A;  4QQL A;  4AF9 A;  4CCD A;  5LCW L;  1H1I A;  5LW9 A;  4FP2 A;  1DYO A;  4K7J A;  3ZYG A;  4IQP A;  1BMV 2;  5FYV A;  4XJA A;  1H8T A;  1EV1 1;  4IDZ A;  1Q56 A;  3JB8 A;  5BNP C;  3M2M A;  3A7Q A;  3I3D A;  3VBF C;  1ZRI A;  3WXP A;  1AYN 3;  1AR8 1;  1AJO A;  2EXI A;  4I0W B;  4IL7 A;  3MFA A;  2XKP A;  1D4M 3;  2H6C A;  1J1T A;  5JSR A;  4UOJ A;  3VBU A;  5FMD A;  1YNA A;  4XPV A;  1PVX A;  3RYK A;  4ZZ8 A;  4Y3O A;  5JZG C;  1DF0 A;  3M1H A;  1BEV 3;  3J4U H;  3VDA A;  4E8D A;  5LY1 A;  1SLI A;  4D69 A;  1SFN A;  2O0O A;  1RUN A;  5T5P A;  1N1T A;  2D5F A;  1QJX 3;  3D0S A;  2Q0A A;  3KSC A;  4LBN A;  4BHP A;  3ZVX A;  3MDP A;  3FUO A;  1GLH A;  1H30 A;  3AKS A;  4IGQ A;  4QPI C;  3VD5 A;  3RZG A;  2DVA A;  1UY0 A;  1Z0H A;  3QOP A;  4PDW A;  1W6N B;  3GAL A;  2RS5 3;  4GWM A;  2ZX3 A;  4JHT A;  1S2K A;  4XZU G;  5FOJ B;  2F6B A;  4EZ4 A;  4IEV A;  2HWB 2;  3LIG A;  3C3V A;  1CAV A;  3O14 A;  3O1T A;  1AL2 2;  1HKD A;  3AP9 A;  3AMQ A;  1ZBA 2;  4K21 A;  1RUE 1;  3O0W A;  4CEY C;  4QX7 A;  1UPI A;  3KCY A;  2B8M A;  1YLL A;  2W46 A;  1I6X A;  2WQ8 A;  1CZT A;  3SHR A;  5F32 A;  5L7O B;  3IB3 A;  3LWC A;  4GAL A;  1C8N A;  3BU7 A;  1ULD A;  3D0J A;  3HQX A;  5ERL A;  1FNZ A;  3DF0 A;  3U37 A;  2P34 A;  1GFF 2;  2W08 A;  3MPB A;  1QOT A;  2WNU A;  3LKJ A;  1TME 2;  3NKG A;  1VBE 1;  4HON A;  4GH4 C;  1RHI 1;  1W9Y A;  3ACG A;  1AXY A;  2BER A;  2HWD 2;  4BZ4 A;  2DFC A;  3MUY 1;  1H8V A;  5FY1 A;  3JUU A;  2BW8 A;  3WUD A;  1A3K A;  1YFY A;  3LPF A;  5CAZ A;  4LBK A;  3GHN A;  4WM7 A;  3AP4 A;  1QJZ A;  4BK5 A;  1W2O A;  2WYS A;  4YG6 A;  4UF0 B;  1LHV A;  2NLR A;  2WZR 1;  1CZV A;  4C1W A;  2BPA 2;  4D0Q A;  3K48 A;  5JOY A;  4NRQ A;  4LT5 A;  4CP9 B;  1CQ9 A;  3WDW A;  1GUI A;  2GAU A;  4XQD A;  3ZR5 A;  2YRO A;  3DYO A;  4BQ5 A;  3L9J T;  2HWF 2;  3I2H A;  5FK7 A;  4I2O A;  1XB9 A;  3KCX A;  4AAP A;  5A7W A;  3O12 A;  1REE A;  3AC0 A;  1H8T B;  3VBH B;  2BWC A;  2ARB A;  1RUD 1;  3KM5 A;  1ZZ9 A;  3IN9 A;  1A8M A;  3LE0 A;  1D0G A;  2BVB A;  2EIC A;  2ZA9 A;  5FPU A;  3UGH A;  4DQA A;  3I2O A;  1CPM A;  1N47 A;  1RUF 2;  2R49 A;  1YQ5 A;  3AVS A;  4XFB A;  2RDS A;  2VZU A;  4MGY E;  3DKQ A;  4JTO A;  4AEJ A;  3N7K A;  1RMU 2;  4P9Y A;  1PIV 3;  4ARX A;  4EWA A;  1AYM 3;  2NZ9 A;  5CIR A;  3VBU B;  1OLQ A;  2BFU L;  1S4C A;  1W8N A;  4SBV A;  1UW8 A;  5AVA A;  3N9O A;  3OY8 A;  4E27 A;  1JXN A;  2J22 A;  3ILN A;  5JIU A;  1PGL 1;  1W2T A;  4HET A;  4P9I A;  3LGR A;  4ONU A;  1ODN A;  3ZPO A;  1RUC 1;  3NJZ A;  1JS9 A;  2KR2 A;  2PHX A;  2RV9 A;  4CA9 A;  4LO4 B;  2ZMK A;  3RQ0 A;  2ZGM A;  5BYN A;  4HT1 T;  1CON A;  5HV0 A;  4QB6 A;  4HBN A;  5I0S A;  4XF3 A;  3B5L B;  3KHB A;  3WD5 A;  5C3R A;  1C5H A;  1DQ4 A;  1W2A X;  2QTW B;  2VUD A;  3BIW E;  3H0O A;  5JUV A;  4XDQ A;  4WVZ A;  3GCW A;  2ZGL A;  3TAY A;  1H9P A;  1JOJ A;  2W1S A;  4B29 A;  5F3C A;  2JDH A;  5DUW A;  2IXH A;  3B9I A;  5FZ1 A;  1MZ6 A;  4OHV A;  4FAH A;  1J3P A;  4UFL A;  1CAV B;  3B9C A;  4Q0S A;  2Q1F A;  2D93 A;  1LTE A;  3C7G A;  4OUL A;  4LLO A;  3I59 A;  5CU1 A;  3WP6 A;  3ZFF A;  1X8M A;  2UY9 A;  2P3J A;  1QEX A;  2W94 A;  2J1T A;  2RVA A;  2XLF A;  1J59 A;  1HB3 A;  4QDR A;  4P02 B;  2GND A;  1RJ7 A;  5HCH A;  5JR2 A;  2IXL A;  2PA7 A;  2XJP A;  2LAL A;  2VUA A;  2G1M A;  3FUQ A;  2QNK A;  1NA1 A;  2WNU B;  4L97 A;  1W8U A;  4MGS A;  5FIX A;  3SIT A;  1YC6 1;  2VJX A;  5LRR A;  3N7J A;  2VXJ A;  1R09 2;  3LEK A;  1D4V B;  1OBN A;  1WWY A;  2JKB A;  2P3Y A;  3R4D B;  3ZXJ A;  1XYP A;  2DU0 A;  5F6L B;  1VBD 3;  3IMN A;  4AAX A;  2WO2 A;  1W99 A;  4NID A;  4B7K A;  5FMC A;  3X29 B;  1C8M 2;  4WM7 B;  1BBT 3;  2EIB A;  4KWK A;  5DPN A;  5FZ4 A;  2OVU A;  1LOE A;  2XR4 A;  1PO1 3;  4BA6 A;  2AZ5 A;  4RYD A;  5JMO A;  2VCA A;  1OUR A;  2VOK A;  1JU3 A;  3VBR A;  4GAZ A;  3D8C A;  1AHS A;  2J7M A;  3SH5 A;  5FKB A;  3M70 A;  1Z7S 1;  2R06 2;  2RMU 3;  5A7W B;  3ST7 A;  3OGJ A;  5K0U A;  4BIS A;  4WM8 C;  1XNT A;  4DY3 A;  2GN3 A;  2ZEZ A;  4KGG A;  1XPW A;  1GOF A;  1F15 A;  4GKX A;  3DV8 A;  1XBF A;  5FYS A;  5FDB A;  4AI2 A;  3DPR C;  2OII A;  2P37 A;  2OKX A;  3RGB A;  4AI1 A;  2DCZ A;  4XVH A;  1RVF 2;  2VZP A;  5GZG A;  5EWS A;  1PX4 A;  1J58 A;  3EXU A;  4PIZ A;  3CHX A;  3J8F 3;  3LA7 A;  2XBO 1;  1SFY A;  4NHY A;  4CDW A;  2V09 A;  3WSO A;  2ZAH A;  4BU2 A;  4MXW A;  1Y4W A;  3O1O A;  3SLI A;  3LDR A;  5LB6 A;  5FY0 A;  4P9W A;  1UWW A;  4QQO A;  4FFF A;  4LA3 A;  4AL9 A;  1TZO A;  4KI5 M;  5FP9 A;  1Y43 B;  1EYB A;  3B69 A;  3CNA A;  1CJP A;  3J7N A;  1AR9 1;  3K4A A;  4IE5 A;  1VBB 2;  2XJU A;  1QKQ A;  4FPL A;  1WW4 A;  2Z2S B;  5GZF A;  1UZZ A;  2WZE A;  2P1B A;  5GZE A;  3B00 A;  1BLZ A;  5A6Z A;  4MV2 A;  4C91 A;  1M06 G;  1YQ2 A;  1RUJ 2;  1SLL A;  3NNL A;  3S30 A;  3TNP B;  3PU3 A;  3INA A;  4A4A A;  1RIN A;  2PQS A;  2FDK A;  3AMP A;  3VHN A;  2DCY A;  3EHK A;  4QU2 A;  2MNG A;  4B3N A;  4FQ4 A;  3F95 A;  4OI2 A;  2TEP A;  1A6C A;  1W9F A;  4OLL A;  3ZFF B;  2ADE A;  2VH9 A;  2WLQ A;  3I59 B;  3MW3 A;  4GMP 1;  4Y4Y A;  2VUJ A;  3UT0 A;  3WNM A;  3NV2 A;  3ZR6 A;  3RMX A;  5JI9 A;  5B2G B;  4Q0U A;  3S5A A;  4RQP A;  1V6K A;  1VRB A;  2EAK A;  4Q4X 2;  4QM8 A;  2OQ6 A;  3VB9 A;  3VD3 A;  1AZD A;  2BUK A;  1ASJ 2;  2PXJ A;  4WM8 A;  5DDJ 2;  3OBT A;  2QQW A;  2VZO A;  4HSL A;  3I2J A;  2QE3 A;  3ZYB A;  4XUQ A;  5ABJ A;  4COW A;  3AM2 A;  1FPN 1;  1EUU A;  4FP3 A;  4QD2 A;  1GQP A;  4U2A A;  1GZ9 A;  5IUQ A;  1C5I A;  4Q0Q A;  3TNQ A;  3VZM A;  5DQ0 A;  3IDC B;  1LRH A;  1XQN A;  4NN0 A;  3VGI A;  1W90 A;  4AQS A;  1US3 A;  5IVF A;  4XF1 A;  2KXL A;  3ECQ A;  5I0U A;  4Q4V 2;  2FD8 A;  3C7O A;  1E5H A;  1S2B A;  3H1Y A;  1FOD 3;  4XMA A;  4LR4 A;  3KT4 A;  1UPS A;  5CA6 A;  3SIS A;  4IE6 A;  4B1L A;  5DMY A;  5IVJ A;  5DUX A;  2D6P A;  4MO3 M;  1BVV A;  1COV 2;  4M3C F;  3MLK A;  2QQK A;  1V6I A;  5FY5 A;  4CU6 A;  3I7D A;  1QNW A;  3LSD A;  2XUM A;  1FAT A;  3AMH A;  2D3S A;  5H9S A;  1AR7 3;  1VBA 3;  2WS9 3;  3WNP A;  3PVB B;  5K0U B;  2RR1 3;  3EQE A;  4LTA A;  5EJ3 A;  3VBO C;  5FMO S;  2RJ2 A;  5F1R A;  2BZD A;  1MQT A;  4IEZ A;  1BQP A;  3GZU C;  4NPL A;  4D7S A;  4CDU A;  1JYX A;  1AYN 2;  4BXF A;  5JPM B;  4FBF A;  4AFM A;  1W6P A;  2YXS A;  5ACA 1;  4CDW B;  3B01 A;  1D4M 2;  2H6B A;  1X50 A;  1PZ7 A;  2WWS A;  2CU5 A;  1ZRR A;  4HLT A;  4MXW B;  1OA4 A;  2WT2 A;  4EN9 B;  5A7S A;  1ENQ A;  3TB0 A;  3AZV A;  4B7E A;  2IXC A;  3QD6 A;  1ULC A;  3KVB A;  3ZDV A;  4UT5 A;  3WDV A;  5BNQ A;  2PTM A;  2A3X A;  1GAN A;  3GGL A;  3T2O A;  2R1B A;  1OVP A;  4CSW A;  3S6P A;  3APB A;  1BEV 2;  1OOP C;  4F83 A;  5TSW A;  5I0R A;  3H7J A;  2G4I A;  1LHW A;  1ZBE 1;  4JC1 A;  4WVM A;  1DQ1 A;  4QU1 A;  5JXH A;  3KF5 A;  1QJX 2;  4LBQ A;  4N7I A;  3VBS C;  1YO8 A;  2Q5T A;  4AVV A;  2VBP A;  5T50 A;  5K8S A;  1GNH A;  1HV0 A;  1R08 1;  2CV6 A;  1FXZ A;  2L9L A;  3O0X A;  2VCB A;  4Q8L A;  3ZN6 A;  3K4Z A;  2FZ2 A;  5CAD A;  1RED A;  1SMV A;  2RS5 2;  2JE7 A;  2LW8 A;  4QGN A;  5E6H A;  5C4W A;  4BJ0 A;  2Y0O A;  3MPP G;  3NO8 A;  5T5J A;  3R4U A;  5IK8 A;  5LEK A;  3AXE A;  1GIC A;  3TEX A;  2IXI A;  4RQP B;  2ZXQ A;  3U4X A;  2GC2 A;  4JKM A;  1UZV A;  1QJY 1;  4GWN A;  4Q4W 3;  1RXG A;  2GP5 A;  4Q4Y 3;  5CNA A;  4YZ1 A;  2UYA A;  3PVN A;  1B35 A;  4R9D A;  2DUR A;  4B4R A;  5IK5 A;  1HLC A;  3VBO A;  4CP1 A;  4RSU A;  5ABJ B;  3BUC A;  4XUT A;  4KG0 A;  3U07 A;  5FBZ A;  4NVP A;  2Y26 A;  2HYK A;  3RZH A;  4UYB A;  3CQO A;  3QBQ A;  5FMB A;  1F4H A;  4J25 A;  5GJ6 A;  2F4L A;  3A23 A;  4CEW A;  5DXD A;  1SCS A;  1LAJ A;  2RHP A;  1OQE A;  3AKP A;  3P5B A;  2ZTN A;  5I8S A;  2R32 A;  2AEY A;  5F3I A;  3K77 A;  4PI2 A;  3TEZ A;  1VIW B;  5FYC A;  1NYW A;  2JG9 C;  4XF4 A;  3D6E A;  5BNO A;  3ACL A;  4XXA A;  1REF A;  2R07 3;  1KQR A;  3OUH A;  3OUI A;  4KQ7 A;  4NWW A;  3ZPY A;  3KWV A;  4E4Z A;  2W39 A;  3JBG 3;  1S1A A;  4XFG A;  4CDX B;  4JGZ C;  5A1F A;  1CIW A;  1LUL A;  2RS3 1;  4WVW A;  3VBS A;  2DCT A;  3ZFG A;  1UZY A;  4W50 A;  2TNF A;  4AVT A;  3ZM8 A;  2HLE A;  4K20 A;  4O7X A;  2I74 A;  3VUO A;  5J7M A;  1GQH A;  3MLL A;  5A33 A;  2WIN B;  4XFH A;  1WA6 X;  2ILM A;  2XJT A;  4CDU B;  2ATF A;  5E88 A;  5FUN A;  3T4V A;  1ZM1 A;  4H2A A;  1KRI A;  1F8V A;  1W6P B;  2N7G A;  3NQH A;  3SC7 X;  2IUW A;  2PLV 3;  5D1I A;  4Q0V A;  1JBC A;  1LNS A;  4NJ4 A;  4CDQ C;  3W59 A;  4J6G A;  4XTM A;  2VMG A;  3VL8 A;  4MH0 E;  2KD7 A;  3AX4 A;  4R52 A;  5FY7 A;  1X36 A;  1QWR A;  3UK9 A;  3WNN A;  2XLG A;  2CAU A;  3N9Q A;  3IM0 A;  1F9K A;  1GSL A;  1NCQ A;  2XG3 A;  4MGT A;  5J09 A;  2Z79 A;  2GC0 A;  5FOB B;  3FL7 A;  2Q8E A;  2GSY A;  1PVC 1;  3UJQ A;  4AHW A;  4BQ1 A;  1SG3 A;  5D2A A;  4YVS A;  1DGW A;  3OPW A;  4LBQ B;  3USU A;  2CDP A;  1HB1 A;  1NX9 A;  5BNN C;  2HWF 3;  3ZN6 B;  2UWB A;  2YGM A;  3WQ7 A;  3MFC A;  5BUV A;  4C0B A;  5LA0 A;  3UNP A;  1IPS A;  1DZQ A;  3OBA A;  3UGG A;  3R05 A;  1OT5 A;  2ZX0 A;  1OPO A;  2DVG A;  2XJS A;  4LBM A;  4YGD A;  3VKM A;  4BLI A;  5C4W B;  3OBZ A;  4A45 A;  2CAV A;  5IFP A;  2XH6 A;  3N36 A;  4H55 A;  4AGV A;  1QH7 A;  4RR3 C;  5FZ0 A;  4PF1 A;  3WR0 A;  2Z5W A;  3J7M A;  4ZON A;  2KM2 A;  5FPV A;  3T0B A;  2JG8 A;  2BYV E;  1Q8V A;  1YXW A;  1NUK A;  2ARA A;  2NMO A;  2WWJ A;  2PN5 A;  2YFZ A;  4HN0 A;  4QWN A;  4BLJ A;  1KFU L;  1W8H A;  2VUC A;  1XNC A;  1QQP 3;  2E33 A;  1K5J A;  1UKR A;  5C6C A;  4GB3 1;  4BQ2 A;  3I3B A;  2D5H A;  3N9L A;  1L7L A;  2EXJ A;  5EJ1 B;  1VE0 A;  1H4G A;  1ND2 C;  1OQ1 A;  1SBF A;  2JE8 A;  4QPG A;  4O61 A;  4YZ4 A;  5EV7 A;  3W20 A;  3FLP A;  4XIL A;  4BME A;  1V00 A;  1VBD 2;  2XQX A;  4FOW A;  4CEW B;  2ZEW A;  1V6N A;  1WCU A;  3WOG A;  2V5D A;  1BBT 2;  5FAX A;  1RUI 3;  4URT A;  2Q8O A;  3VHP A;  4IEP A;  3CO2 A;  1ND3 A;  4YFZ A;  1OSG A;  1ZA7 A;  2GZW A;  3RZL A;  1JZ6 A;  5K9Y A;  3H1W A;  2Y6G A;  2A3W A;  2CGO A;  2VW0 A;  5BNO B;  1GWK A;  5EPA A;  1ZZB A;  1UMI A;  2CL2 A;  1HN0 A;  2J1S A;  3HT1 A;  3ES1 A;  1JHJ A;  2HJI A;  4D94 A;  4RFT 0;  5FYU A;  3SCH A;  1LJ7 A;  3ZFG B;  4ASL A;  4LK6 A;  4DRR A;  1PX3 A;  3T09 A;  4L99 A;  3BPZ A;  3WW3 A;  4DXS A;  2ZEY A;  1O91 A;  2R30 A;  1MEC 3;  1F5F A;  3WNL A;  2C24 A;  3AP5 A;  4FTE A;  4RHV 1;  1QOS A;  5CKQ A;  2WNO A;  3OF1 A;  3MUZ 1;  2CGP A;  1KD7 A;  4P9X A;  3LEI A;  5FP7 A;  2LRO A;  4E2Q A;  4MVT A;  1CVN A;  3KV6 A;  3H8O A;  4CCK A;  4K3U A;  4QB1 A;  4CUG A;  3NMB A;  5KHG A;  2AGS A;  1RC6 A;  1PMH X;  1XNB A;  4RGG A;  4AQ6 A;  2YY1 A;  4BQX A;  5IVB A;  1NQD A;  1YFX A;  3BYW A;  1AF9 A;  1GWL A;  2X5I C;  2AEZ A;  2YG0 A;  1DGW X;  3H8X A;  5DUV A;  1NCQ B;  1X8E A;  4XJ9 A;  1HRI 1;  2VUL A;  1TVG A;  1W39 A;  4AED A;  3H9A A;  5FPB A;  5FLJ A;  4YVS B;  3T4H B;  2DU1 A;  3USU B;  4D3W A;  2QZ2 A;  5LAT A;  4MET A;  3VDD A;  3H3L A;  1I1E A;  4DUW A;  2ADD A;  2P2K A;  4ZS3 A;  2DFB A;  2ZMN A;  1V0A A;  1GP4 A;  1S2E A;  5BY5 A;  2ZCW A;  1DBN A;  4KNC A;  1JTZ X;  3PIG A;  4IW3 A;  5L7O C;  4QX5 A;  1WGP A;  3T0D A;  1Z78 A;  1POV 1;  1BZW A;  2HYX A;  2E7Q A;  5FP3 A;  1WME A;  3WF2 A;  3AYC A;  1OQD A;  1S0B A;  2PHW A;  1RVF 3;  3ZYR A;  1AVB A;  2ZS6 B;  2J1A A;  3LA2 A;  2JG8 B;  3U4S A;  5FP8 A;  3B93 A;  5T3N A;  1VBC 3;  1E5R A;  1XOY A;  3Q8F A;  3I97 A;  4L2N A;  2WZP P;  5HPO A;  3OGR A;  1RGS A;  2Y33 A;  3HNM A;  3ZXA C;  5CBL A;  3HIF A;  5JWP A;  5JXJ A;  5C9A A;  4ZHN A;  2VZV A;  3KCC A; 
#chains in the Genus database with same CATH homology
 2RDQ A;  4XCA A;  4ZPI A;  5L9R A;  2HBU A;  4Q5O A;  4ZON A;  4NAO A;  5LBE A;  4NHY A;  5DAW A;  3NNJ A;  5LB6 A;  2A1X A;  2RG4 A;  3OUJ A;  5LBB A;  5C5U A;  2RDN A;  3W20 A;  5L9V A;  3HQR A;  2RDS A;  3DKQ A;  4JZR A;  3GJB A;  2HBT A;  5HV4 A;  2RDR A;  3NNL A;  3GZE A;  4XCB A;  5EP9 A;  4NHX A;  5LBF A;  4BQW A;  5EPA A;  4NHM A;  4XAB A;  3HQU A;  4UWD A;  5DAV A;  4BQY A;  5DAQ A;  4XAA A;  5C5T A;  4J25 A;  5HV0 A;  4MHU A;  2FCT A;  4XAC A;  2OPW A;  4Y5S A;  3OUH A;  4NHL A;  3OUI A;  5LA9 A;  3PL0 A;  3BVC A;  3MGU A;  5LAS A;  4BQX A;  4Y5T A;  3NNF A;  5IAT A;  3NNM A;  3KT4 A;  4NMI A;  5M0T A;  2Y34 A;  4NHK A;  3KT1 A;  2G1M A;  5A3U A;  5IAV A;  2V4A A;  5LAT A;  4KBZ A;  5LBC A;  2FCU A;  3GJA A;  4IW3 A;  3ITQ A;  2JIG A;  4XC9 A;  5EQU A;  5ERL A;  5DAP A;  2JIJ A;  5DAX A;  2G19 A;  3W21 A;  2FCV A;  2Y33 A;  3EMR A;  5IAX A;  4MHR A;  3KT7 A;  5L9B A;  3OBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...