3OUIA

Phd2-r717 with 40787422
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
190
Chain Sequence
b'PALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 56
structure length 190
sequence length 204
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouiA00
3OUIA 3NNFA 5EQUA 3GZEA 2FCUA 5DAQA 5DAVA 2RDSA 5C5UA 5IAXA 4ZPIA 4NHXA 4XCBA 4NMIA 5L9BA 2RDNA 5DAPA 2V4AA 4Q5OA 5EPAA 2JIGA 2OPWA 3OUHA 4NHLA 4BQYA 3NNLA 2FCTA 5LA9A 4MHRA 2FCVA 3OUJA 3PL0A 4NHYA 5C5TA 5L9RA 5LBFA 4Y5SA 3OBZA 3NNJA 3KT1A 3KT7A 5LASA 3HQRA 5HV0A 5LBEA 5ERLA 3ITQA 5L9VA 2RG4A 2RDRA 4NHMA 5LBCA 4NHKA 4J25A 4XABA 2G19A 5DAWA 3GJAA 3W20A 4XAAA 3DKQA 4XACA 3GJBA 4KBZA 5LBBA 4IW3A 3W21A 5HV4A 3HQUA 3BVCA 3NNMA 5LATA 4XCAA 4XC9A 2Y33A 2HBUA 5LB6A 3EMRA 5IATA 3MGUA 5A3UA 4BQXA 2A1XA 4JZRA 2G1MA 5IAVA 5EP9A 4ZONA 2RDQA 4BQWA 2JIJA 5DAXA 4Y5TA 4NAOA 2HBTA 3KT4A 2Y34A 4MHUA 4UWDA 5M0TA
chains in the Genus database with same CATH superfamily
3N9MA 3DF0A 1FOD1 3S5QA 3AXDA 4COVA 1BBT2 4Z82A 3S57A 5L7OC 1R1A3 5ABJC 2ZMNA 1PO22 3DPRA 2D5FA 1MS1A 2QQPA 2XDVA 3LFMA 4IL7A 1M06G 1HRI2 5C9AC 3N9NA 4CCDA 1QH6A 4ET7A 4PLNA 1JBCA 3GDBA 4XVHA 4AAPA 4E4ZA 5C3OA 1N3OA 2YFUA 2WNVB 1SLIA 1PVC2 3FBMA 1SACA 1D4VB 2MEV3 2XLAA 3PUQA 3ZDVA 1FPN1 4BU2A 1OUXA 4KI5M 3RGBA 4Q8LA 5F2SA 3ZXGA 2ZPXA 4NAMA 4NHLA 3OBTA 1IZ3A 4BQYA 4WM8C 4R9BA 4N9HA 5H9PA 1W3VA 2CAVA 2VCAA 4KH9A 4BMBA 4CYDA 2CSGA 2ZX2A 3WLUA 4DXTA 5K7PA 3I2GA 3KCCA 1SLCA 3CQOA 2Y8KA 4CDXB 4DXRA 3ZM8A 2ZCWA 1LHOA 4PLMA 2KM2A 2EA7A 3E5QA 3MF6A 3VLBB 1URXA 4A3ZA 4AEDB 3A7QA 3NJXA 4B29A 4ZXKA 1G8WA 1H0BA 2OUJA 4FPLA 4A41A 4AGVA 2F4PA 5CFCB 3AJYA 2ZOEB 5H9QA 1QJZA 1S1AA 3L2YA 5F5AA 4DRVA 1X36A 3LOBA 4UF0A 3ZXEA 5L7OB 1O91A 3LSEA 4JGZB 5ABJB 1UKGA 1F5FA 4BXSV 1C8M3 4ZHNA 1XYOA 4AFBA 4M3CF 3S30A 5C9AB 1F35A 2EXKA 2O0OA 1AZDA 2Y6KA 4META 5A3PA 1ZA7A 3CMGA 1HJFA 5E1RA 1BEV1 5FO7B 1G9FA 1YEWA 1DGWA 5DUXA 3KCXA 5GLZA 1GMMA 3TYJA 3GZTB 2ETEA 2QQVA 2WN3A 4NIHA 2XJQA 3GYDA 3OB8A 5KHHA 2NZ9A 5JPNB 3POGA 3E5XA 4WM8B 5FCCA 1H9PA 3TAYA 4ASLA 1UMZA 2JECA 4M3CE 4RQPC 1LHNA 1VBE1 2P17A 2ZX4A 2XH6A 4GWIA 4LO4B 3AL5A 1OOPC 3PNAA 2RMU2 1V6MA 1QH7A 3U4XA 3ALQA 1PM7A 4XUOA 2ZAAA 1UU6A 3PUIA 1RINA 2XVKA 2B9VA 4MGYE 5EXOA 4DINB 2VVFA 5CG8A 2BNOA 1PVXA 4XAEA 2R6QA 1STMA 5FY0A 1CZTA 3A21A 5JOWA 4QM8A 1XNKA 1PO12 4BQWA 4YFZA 4AQTA 1HRV1 1JH5A 1ONAA 2ARXA 2IFWA 3HOBA 4KGQA 5FYSA 1MVQA 2RM22 4Y5TA 3DCQA 5CISA 1OLMA 2RHPA 1KRIA 5F6KA 2OA2A 1OT5A 3ECQA 3HN1A 4I0BA 1BJQA 3LGRA 5A7OA 1RUE2 5DPNA 3RG0A 1AR91 4DPNA 2KXLA 4OQ8A 2AYHA 1SCSA 1MQTC 1V9U3 2FD8A 5A1FA 2VMDA 1KFUL 1LGBA 1TNFA 3ZOIA 4J6GA 4KQ7A 1W6PA 4RQPB 5APAA 4RHV2 3JQWA 1RUF2 3TB0A 4A3XA 5LA0A 3O1TA 2CHHA 2ENRA 5DAPA 4ZU5A 4QKNA 5HXMA 1OOPB 4YW4A 4AHYA 5FPVA 2Q8EA 5A33A 4OLLA 1LOCA 2DURA 3J8F2 5F5CA 3WUDA 1YYNA 4R52A 4QPGA 1NLQA 4OI4A 3FUQA 4HG6B 1NCQC 2QQJA 1ALYA 2W3JA 3AYDA 4LOTA 5EYXA 2PHRA 3I2OA 1LCLA 3IN9A 4UFJA 3EQEA 2C5DA 4ONUA 3U4SA 5KHIA 2AACA 3B9IA 3HNBM 3OYWA 4GMP3 2Y26A 2E9QA 2XJUA 1RMU3 3OGSA 4NRQA 4AL9A 1D7PM 5DN2A 3VBFB 4MGZE 2EVXA 4GH4C 3BKZA 4NE9A 2AUYA 3CEWA 4XTPA 5H9RA 3LDRA 1R64A 2VMCA 1W6QA 4F8AA 5JSOA 1LJ7A 2BYVE 1AR82 1RXFA 3POEA 4QPIA 2JE9A 1X82A 2VTFA 4PF1A 3RWKX 1MQTB 2VMGA 2XKPA 3QD6A 3MW2A 1XRUA 3PVBB 1OH3A 2VM9A 3WCSA 2ZHLA 5I93A 5E16A 1SLLA 1W2AX 3RZKA 2ZHMA 5C4WA 3SMHA 4CUGA 1W8UA 5EV7A 2ZGKA 3V65A 1K45A 4IEQA 4LIUA 1I5PA 5IYYA 1VRBA 3OTFA 5BNQA 3LFIA 4OUSA 5JXJA 2GC0A 2V09A 1ZYBA 4CCOA 2VUJA 4GALA 4B1MA 5AC92 5IVCA 3KV9A 2GU9A 2RDRA 3G7DA 4A4AA 2EXJA 3AYEA 4DMIA 1QNYA 1OFNA 4XJ8A 3IKWA 5F2WA 5CFDA 1KDMA 4CPBD 3W5MA 3HBKA 2W1SA 1B09A 2GMPA 1NCQB 4M3CA 2OZJA 5K0UC 4LITA 2A6XA 4XXAA 4BHPA 2GALA 3A0KA 3D0JA 1Q5OA 3H8OA 1OBNA 3ZIWA 4XFBA 5E6HA 4FO9A 4D7SA 5GZCA 5T3NA 4AEMA 2VOXA 4L11A 3MW4A 3NNMA 4XMAA 1SDWA 1RUC2 2DVGA 1CZSA 4GH4B 3LDBA 2YMZA 2VUCA 1JYCA 5FXXA 2HWE2 4PT6A 4RGAA 5GLWA 1NY72 4LK6A 3AX4A 4YZ3A 3ZR6A 4P5YA 4PBOA 4Y5Z0 2QJVA 4GMP0 1WUVA 5J7MA 4WZFA 1QJY3 1W3XA 1W2UA 2OUHA 3APBA 1M4WA 2VOWA 5A6ZA 5IVFA 1AR72 3ZFEC 5JMCA 3WHUA 1UD1A 5K4LA 5BNNB 4RFT0 5ACA1 3KLSA 1HJGA 3POIA 5GLTA 4PI0A 4ITCA 3OPTA 2JENA 2VQUA 3M1HA 3A23A 3U07A 3I4IA 3HBZA 4ORFA 3RZZA 4U36A 3FUOA 1ULFA 2D6LX 2DFCA 4BA6A 4FAHA 2ZEXA 4YW2A 2VOKA 1ZRFA 4UI9L 4XTMA 4WVWA 4IEUA 1J3PA 2B42B 4FPHA 4AHZA 1J3QA 2GSYA 2WYFA 3OGVA 3W5NA 3TEYA 1FNZA 2R071 4JKMA 5K0UB 5FP4A 1ZBA2 3IZOA 3MIEA 3D8CA 4V2WA 4AI9A 5IAXA 2IXHA 5EZWA 2WZPP 3X29B 3J7NA 4Q1RA 3N35A 4DS0A 4FOYA 1BK0A 4NROA 1RUOA 2OQ7A 2YV8A 2PTMA 4B4PA 4M0HA 2R1BA 3VBUA 5E88A 4COWA 3UK9A 5G04L 3HAGA 5FPUA 3V0AB 2NN8A 2JDYA 1OKQA 2YGLA 1LR5A 1PO23 1J58A 4YARA 5I8YA 1QNWA 3RWNA 2XLGA 4ISQA 1HRI3 3N7LA 2FCVA 3ZO0B 3LCPA 2VBDA 2HWD1 2ZZJA 3ZFEB 2CTVA 1LULA 2TEPA 3AVRA 3OBZA 1BHGA 4Y22B 4OI0A 1D4M1 4AI2A 4CP9A 3RJRA 1PVC3 4UXAA 5A70A 2BVVA 1COV2 1RUJ2 3KT1A 1HB1A 3LIGA 3QLQA 3U0ZA 3MYXA 2ERFA 4TZDA 3VZKA 1APNA 1Z0HA 4XFIA 1FATA 2JG8A 1U5IA 3WQBA 4Q4Y1 3WCRA 1VMJA 2J1SA 2LUWA 3KB5A 2R062 3RYKA 2QZ2A 3N9LA 2EIDA 1SFPA 3OD0A 1AXZA 1K5MC 2WS92 5A7SA 1REFA 5FYUA 5CYYA 3K77A 4RFRB 1CQ9A 1JS9A 4E9KA 2VJXA 4YRDA 2WO1A 3AZVA 1UMHA 3HD8B 3ILNA 3OJBA 4H3WA 3VZLA 1G6NA 3JD71 4LHLA 4BCUA 3GZAA 4XABA 5F3IA 4AG4A 1S2EA 2QVSB 1E5IA 4I09A 4P5HA 1HXS1 2VO5A 4LE4A 3SH4A 5FWJA 2JEMA 3AB0A 4CEYC 4XAAA 2I74A 4L8QA 5FZ0A 4MGTA 1XNCA 1OMIA 2LTNA 1HB4A 4QM9A 2XR4A 3ACHA 3BIWE 3ZSMA 1AYM2 4Z07A 1IS5A 2XHKA 3BTXA 4QHOA 3K4AA 4GIQA 4Q4W1 3HQUA 2UWAA 1POV3 1G9BA 4OHZA 3DPRC 3H1YA 2R7EB 4PBPA 4L2NA 5FO9B 4CCMA 4BPZA 2GN3A 4PIXA 5F6LB 1HRV3 1Q8VA 1SG3A 1RUG2 4BLIA 4Q4X2 4YNIA 5IATA 4JRAA 1FYUA 1LGNA 4YPJA 2Q8CA 1PGW2 5FMCA 4LULA 4BQXA 1RHI2 2XB6C 1XC6A 2G1MA 2AREA 3AZXA 4EV0A 1PHMA 3ZVXA 1K42A 2CGOA 1XYNA 2Q0AA 1AR93 3PHMA 3FBYA 2VMHA 4JC1A 4KG0A 4XXPA 3KSCA 3WNKA 1S2KA 4N90A 1AL22 3ZXJA 1GYKA 2WLPA 2W47A 1DYPA 4HBNA 3U37A 4IEVA 3NV3A 2ORXA 3K75B 3WXPA 1C5IA 2DBIA 1UY3A 2J1UA 4MXWB 3RYPA 1CAVA 2A3WA 4N53C 4UT5A 3OUIA 5LY1A 2C0ZA 4XILA 4CEYB 1GSLA 4XW3A 1W6MA 3KV6A 5GKAC 5C5UA 3O1OA 3ZN6A 3SKJE 4D94A 4LTAA 1AYN1 2XGXA 2IC1A 4QHZA 1V6OA 4FPYA 4E8CA 2I07B 4ARXA 5F37A 3DPRB 5FQ0A 1CPMA 1NYWA 2UY8A 2WINB 3DKWA 1ULEA 2B46X 2VCBA 2YYOA 2ZEYA 3OUHA 4GWNA 3QH7A 2XVLA 3ZPYA 1GOHA 1W03A 3NJYA 4NO4A 1ULOA 3VL8A 1WLWA 5A6QA 4L0PA 1EAH2 5L73A 2IXKA 1OA4A 2YBKA 4EWAA 1ASJ3 1MVEA 3T0BA 4QWNA 4OUMA 4E2SA 1AX1A 3C8XA 1ND2C 1RGSA 5BY5A 2W1QA 3E5UA 4R9AA 4XJWA 4FBFA 1PIV1 4XUNA 2ADDA 2E7QA 4B7EA 4AQSA 1R1A1 2Q1ZB 2ZBJA 4JCKA 3VKMA 2ID4A 2XUMA 3R0RA 1OF3A 4AGRA 5EFUA 1UXZA 3O1VA 2IZWA 4F83A 4N53B 1JOBA 3RFRA 2ATFA 2BU9A 1DBNA 1US3A 3GCWA 4AK3A 5AVPA 2BERA 1VRH2 4GJYA 3WDXA 1DP0A 4HKOA 5FJHA 2B9UA 1HB2A 1TME2 4TLFA 5FZAA 4DY3A 1YQ5A 3I2HA 4UF0B 4XJ9A 2NMNA 5F9TA 4IUGA 1W9TA 1PGL1 2Z79A 1AR83 3JQXA 4J25A 5CEHA 1PNGA 3E97A 1QQP2 4O9GA 4K20A 4C90A 5F5IA 4YW6A 3I3DA 5IW0A 4XJAA 1CVNA 3AXEA 1HLCA 3M7AA 3P5BA 4XETA 2DUOA 3H7JA 1H2KA 3ST7A 3UKNA 3JXSA 1ULCA 1W9FA 3ZXLA 1LU2A 5FZMA 1ZZCA 2D7FA 1RUH2 4QXKA 3IDAA 1PZ8A 4RN5A 3VHNA 4BQ5A 1WKYA 1VJ2A 2YPJA 2R041 3PVEA 3BVCA 4COYA 1SHWB 3AM2A 3GNEA 3I2IA 5FY9A 1HW5A 1N3QA 1ZZBA 5CNAA 4Y1YA 4AAXA 2YC2A 2VQ0A 4E4SA 4IGOA 2JG9A 3N4MA 3EMRA 5A3OA 2Z69A 5ACA3 5A3UA 3UJOA 1OHFA 1C8M1 1YJKA 2WLQA 2ZHNA 4DRRA 2W87A 2RS11 2G9ZA 1Q43A 1YFUA 4CDWA 1DYOA 4QPGC 4LA3A 2Q8OA 2RS32 3KCYA 4YW7A 4COZA 3ELNA 2D40A 2ZGOA 5C3SA 4XOGA 2G4IA 5IK8A 4K9SA 1XB9A 3CNAA 5T5LA 4MHUA 3ZFFA 2R30A 4AVAA 1O6UA 1W6OA 3LZZA 4JQTA 4R9DA 4W6XA 4CCLA 3RZLA 1NT0A 2BWCA 3I2FA 3PLQA 5B4XA 1DGRA 1Q8PA 3I7DA 1LESA 3PVOA 3VBOA 3RJ2X 5EQUA 4QPIC 1AR73 2H0VA 1CESA 1H8VA 2UY9A 1AX2A 4XMIA 5KR7A 4FFGA 1IPSA 1CR7A 4LORA 3MDPA 2RDNA 3WDYA 2PMWB 5C3QA 3NMBA 1W8FA 2RVAA 3KQRA 5C4WC 3N9PA 1W8ZA 3LEGA 4Q27A 1W6PB 2GH2A 2BFUL 2YXSA 2PLV2 3C7OA 5FKBA 2QDRA 1S55A 2HWD3 5LA2A 4NIAA 3NNLA 1GQGA 1Q56A 2C26A 4AEJA 4AR2A 1H6XA 3POSA 2VZVA 4MV2A 4SLIA 2QE3A 2DYCA 1ZBA3 4YGDA 5A33B 5T5JA 1OXCA 3BTYA 5CFDC 4QPGB 4OUEA 4OZXA 3AJZA 2Y60A 2C6SA 1IS4A 5KWRA 2WZEA 2Z5WA 1YQ6A 1V9U1 4Q4Y3 5A6YA 3RQ0A 4GKXA 2WIIB 1ODMA 3JBG1 3AMHA 2VE1A 3WF0A 4C1XA 4RYDA 3OYWB 2X09A 2HYKA 3IBMA 3NV1A 3SLIA 2D3SA 3B5LB 3LDKA 2A75A 4Z92B 3O1UA 2RE9A 4A7KA 2KD7A 4AHWA 5A3TA 1JODA 1W6QB 1UOGA 2BGPA 4LK7A 3VB9A 3JD73 1RIRA 5FXWA 4AFDA 1GWKA 2YU1A 4QPIB 3D82A 3LQCA 4CDQA 3M70A 2A6YA 2WAOA 3CF6E 3WNOA 2BV4A 3PTYA 5L9VA 1WMXA 2DVAA 1ZZ6A 3IIIA 4E27A 5C4WB 4OMDA 2PAMA 3RMXA 1O3TA 4PDWA 2W5FA 2AEZA 3TN92 2YU2A 1JHNA 3MW3A 4LHSA 5LK5A 3ENRA 5FZ4A 3W20A 5FLIA 1LAJA 4F7ZA 1F31A 1W8TA 2YZ4A 1U5XA 1CONA 4PF5A 1CX4A 1JW6A 3C2UA 4HMZA 5FWEA 1UPIA 5C7GA 3U1XA 5CFDB 4OHYA 2BOJA 1VALA 2J22A 4MGIE 4RR3C 2WL1A 2D3RA 4K8FA 4M3CB 5I0UA 2BEOA 3RDIA 3AC0A 2HWC2 1GV9A 4L99A 4QDQA 3IDBB 1S0CA 4HKLA 3H1MA 5LB6A 4AVVA 2PFWA 2YBPA 2HYXA 1E5RA 5IFPA 1TMF3 4QQLA 2FDIA 4BWOA 1Y9QA 1QMJA 4HPKA 3VDCA 3OPZA 3P6BA 3FHIB 1RVF2 3VBUC 2RDQA 1AX0A 1NZIA 1XOYA 3ZYPA 1AYM3 3FMGA 2CL2A 2DVDA 1UCXA 4LIVA 4XBNA 1RJ7A 1R082 1K5JA 4FPOB 4MH0E 4QXCA 1RUNA 4P9YA 5EHDA 3C7GA 3JB4C 4PLOA 2WUHA 3DUIA 5CVRA 5CG9A 1AXYA 1V00A 1VIWB 2X5IA 4QDSA 4AZZA 4PIZA 4BYYA 5K8SA 3WF4A 1RJ8A 3EHKA 5B4NA 4FQ4A 1FV2A 2H6CA 4UFHA 4NIDA 3ES1A 3J7LA 1A8DA 2JDUA 4LO8A 2RDSA 4XUPA 3WOGA 4P9GA 1N1TA 3MLJA 1QXPA 1JTZX 2G9GA 3NJZA 1WLCA 2JG8C 1PK6A 2WFF2 1S2BA 1Y4WA 4I01A 1UW8A 1QJY1 1V6IA 1XJAA 1LTEA 4XF3A 4NIGA 2VNRA 1HV0A 1FOD2 1O5LA 2CY6A 2VCMA 1LHUA 2DFBA 3JU9A 4BIOA 4EN7B 5CAZA 4IQPA 3CIHA 1JU4A 1O4TA 2MPFA 2VW0A 3B00A 5IUQA 5AFEA 1LKNA 5LA9A 5CFCC 4G4FA 1PIV3 1W0NA 4W4ZA 1NA1A 1W39A 2VZRA 3VBUB 2P3JA 4CPBA 4AEKA 1VBC1 3WNMA 4JGZC 4Y5SA 5FR3A 3POYA 1CIYA 1QOSA 3AL6A 3UNPA 3VD4A 2P6HA 4H55A 1JZ2A 2X8KA 1DLLA 2PHLA 3AVSA 4M4RA 1SBEA 5GLUA 3MHZA 1GP5A 1ULDA 2GMEA 2SBAA 4GXLA 4A44A 3R4DB 1R092 4TWTA 4YYOA 3WDUA 4DQAA 4YW3A 4H2AA 1ZX5A 2LALA 4HK9A 1EPWA 4YFWA 3FZ3A 4QX1A 4XDOA 2JKBA 5JXIA 5BYNA 4CP9B 3MEPA 2ZAHA 1EAH3 1EV12 4BXFA 5LY2A 5FOBB 3I2JA 2E32A 5TSWA 1KD7A 2P5BA 5CB7A 1OQ1A 1PGSA 3M8LA 2JG8B 1YUDA 4N7UA 2WSVA 4OCTA 3SC7X 3K3OA 3RPQA 4GKYA 1KDKA 3LPGA 1YFWA 1BBT1 3CJIA 1JU3A 4KL1A 1PO21 2JDNA 4QX3A 2WZR2 3M2MA 4Q1PA 2BJSA 2R043 1HRI1 1KS4A 4INDA 3CU7A 3D5OA 3GJBA 4XEZA 3ZXDA 4OZOA 5JDBA 1C57A 3VBHA 3IDCB 2K0GA 4QMAA 2VW2A 4AF9A 2G9FA 3O14A 5JOYA 1PVC1 2VZ1A 1VRH3 2ORZA 4Y4RA 3UKVA 3T0DA 1MS0A 3O5SA 4HN0A 4JAAA 3TOJA 2CWSA 3P3PA 5CIRA 5T55A 2RS13 4Y4YA 5FMBA 5FZ7A 4HXCA 1DIWA 1XNAA 2XBO2 5IWFA 1YI9A 1U5ZA 1W8NA 1E5HA 1VBA2 3HJRA 3MGUA 3HWJA 3LSDA 4LBKA 1FI2A 4MXVA 2ARCA 4JVAA 3U10A 4Q29A 1RUI2 5T54A 3KVBA 2BZDA 1IG0A 1VBE2 4BK4A 4LE3A 3MBWA 3MO4A 1JYTA 2XWJB 1IOAA 4QU2A 4QXHA 1WLTA 2DBNA 4MSVA 3IT8A 3QACA 1NOVA 2QQUA 3MV01 1UY2A 5JPMB 1CGPA 5CKQA 2JB8A 5A7QA 1P8JA 1LEDA 1KEXA 2Y34A 3KT4A 3Q8FA 5JIAA 3VHOA 3NW4A 3PJQA 4NRPA 2EICA 2VG9A 2OZ6A 2VU9A 2WA3A 4CP0A 3UYJA 2TNFA 2PQSA 4LUMA 1L7QA 2WN2A 3MIFA 2HWB2 2Q8DA 1D2SA 1KJLA 1QJU2 3WUCA 4FTEA 2FHRA 2D5HA 1DQ1A 1POV1 2BNMA 2BDRA 1LB2A 2ET1A 4Y33A 2A5ZA 5DZEA 3VKFC 1GUIA 4NMIA 1OPMA 3N7KA 5L9BA 5FMDA 3WT3A 1CAVB 4NPLA 5IK4A 2NPIA 4Z1VA 3VBFC 4XDQA 1W99A 1MS5A 4R4XA 1W6MB 4WVMA 4DXSA 2FMDA 2XUEA 4RGGA 3MLKA 1F2NA 2IXCA 3ZN6B 1X9TA 2GNTA 3WF2A 4X8NA 4D6QA 1KITA 1SLAA 2FCTA 4FTSA 4NIIA 5I0RA 4YGBA 1MZ6A 1ZRIA 1DGLA 3OD4A 4FCAA 4OMCA 4A2UA 4MHRA 5FQ0B 2JDKA 2RMU1 2K46A 3JBG3 3POBA 1WMDA 4P08A 1GOFA 5FZKA 5GZGA 1H1MA 1LHVA 2JDHA 3C7FA 5L9RA 4FXGB 2ZGMA 1QF3A 4LHNA 3VDDA 2ZGRA 1NCRA 1YWKA 1JOJA 2VBBA 2E26A 5HPOA 5L19A 5T50A 3BUCA 2FDKA 2D6OX 1LU1A 2W9XA 3Q8AA 3PIJA 1GWMA 4DXZA 1VP6A 2W94A 3I2DA 2IFRA 1PO11 4IV1A 4ASMB 1CIWA 2ZGNA 4XBLA 3I97A 1JYNA 3ACGA 1O5UA 2B45X 2RM21 2XJTA 2JG9C 4FOQA 1YO8A 1FMD2 3KHBA 1XE7A 1VMHA 3B93A 3CL1A 4IGQA 3Q8BA 3O1RA 1RUE1 4MOAA 4BH9A 4CDWC 5FPBA 1V6JA 1DFQA 4HN1A 5EYYA 1RITA 3ZPOA 3R6SA 3FWEA 3MF9A 2XJRA 5DUWA 5F3CA 3I59A 5FYMA 4TTGA 2G19A 3NKGA 1I3HA 2R1DA 4C91A 3B01A 1ASJ1 3TEXA 1MS3A 4IEZA 4IE6A 3K4ZA 3ZFFC 3ZXKA 1RUF1 2Q1MA 5J37A 4UW3A 3ZSLA 2QDNA 4URAA 2RR12 2CWMA 4IETA 1O4YA 3S7IA 1TG7A 1DQ4A 3VBOC 1KGYA 2ILMA 2XQRA 2ZGLA 1WW4A 5BNNC 2WJSA 3J8F1 1H4HA 1RB8G 3TRSB 4LBOA 1WLDA 4FPCA 3VDAA 3ZYFA 3WP5A 5JXHA 3ZLIA 1PMJX 3L9JT 5BNPA 1U0AA 1ENSA 1HKDA 4BQ3A 1GFF2 4FFHA 4NUBA 1OQDA 3USSA 1Q3EA 2HWF3 5LK7B 1HQLA 1QWRA 1SZBA 1IHMA 5DG2A 2JG9B 4B1LA 3RZGA 2ZZQA 1C1LA 4Q0QA 2ARAA 2W1UA 1YQ8A 5AVAA 1AR81 3OG2A 2P6CA 3AYCA 3PMSA 1S0GA 2JDMA 1DZTA 3FFQA 2ZGSA 4LKEA 2RS52 4CDWB 3DYOA 4LLOA 5DDJ2 4AI3A 2VZTA 4F3JA 3ON7A 3ASIA 3VZOA 3CO2A 5M0TA 4PI2A 4HVQA 4FPGA 5JAXA 3ZKUA 3H9AA 1E57A 1WD4A 4TSVA 4JV4A 4DNYA 5LEKA 3MFAA 3U75A 3ZFFB 1WW7A 4TYSA 4YVSA 1W6OB 3UJQA 3H3LA 4NHXA 5F8PA 2ZKNA 1OQEA 2UYBA 4LLFA 5AC91 1R083 3VBOB 2A70A 4ATFA 2WO2A 4BB3A 4BIFA 4OI2A 2VNOA 4CDQC 1Z7S2 4CCEA 2R0HA 1VBC3 3LEIA 4JQRA 3OCPA 1Q8SA 4MGQA 4AQ6A 1XSQA 3BCWA 2ZX0A 1SFNA 2W68A 2CYFA 3VD9A 1MACA 5KBFA 4I0WB 3THPA 4PDWC 1CJPA 3OUJA 5I0SA 4MO3M 1RUC1 3WD5A 5FYIA 5A1AA 1W2OA 1ZA4A 4Q0SA 3E6BA 4N43A 3GXUA 2DCYA 4WV8A 2HWE1 1NY71 1O4ZA 2WFF3 3ROUA 2LM3A 4LMFA 2LW8A 2AEYA 1BK1A 3KVAA 4IV3A 4P9JA 2J1TA 3BOPA 1KS5A 2JICA 4CDUA 1AR71 4CXWA 4YZ2A 1JYVA 5LASA 1MS9A 3ZYHA 2P2KA 2IUWA 5HV0A 3BTZA 4QQOA 4FPFA 1BBT3 3T4HB 1QIQA 3GF6A 1Q8QA 1QDOA 2VR4A 3F95A 4NPMA 1JYWA 3KQ4B 2WQ4A 3ZYJB 4XBQA 4FP2A 4NWWA 4IE4A 1OD5A 4PJYA 5FXVA 5F7UA 2LRPA 2FBEA 3PVNA 3T3YA 5LBCA 1VB4A 4B4QA 1R093 4CDQB 2ET7A 5DAWA 2KA3A 4AI0A 3LAGA 4GULA 2OT7A 2PHXA 4IESA 1A34A 4OI1A 1DQ2A 1ZBA1 3DKQA 1EPZA 4HOOA 3WEZA 4LBQD 1LENA 4DIQA 3JZVA 4IDZA 1DYKA 5HV4A 3VD7A 1HX6A 2Q30A 2QBXA 2X05A 4PDWB 1NZCA 3WP4A 5C8CA 2X5IC 1UYZA 2YC0A 3FLRA 4XUQA 4BM8A 4XCAA 1W2NA 4QXBA 5KC5A 5FYCA 2DF7A 1UZWA 3H8UA 4MGKE 2DCJA 5BNOA 2CU5A 1PK6C 2EIGA 1OVPA 2B4KA 1OC1A 2WZR3 4WVZA 2DVBA 4K3UA 1BYHA 2VPVA 4MZUA 1WMEA 3SEPA 5EP9A 4ES8A 1G9AA 1TQ5A 2HEWF 4LBNA 4KG8A 3FX3A 2PXJA 4EWEA 2WWJA 3H3UA 2XPJA 1S0IA 1UYXA 1VBD2 1IQAA 4OYUA 2WKKA 1COV1 1RUJ1 2A73B 3LOIA 3NRUA 4HPKB 5CADA 3AZYA 3LD8A 1NA1C 3DXUA 1OUSA 1SFYA 1JMUB 3CZUA 2WBKA 3DN7A 4AEDA 3VHPA 3IAQA 2R061 4XUTA 1BLZA 1RUI3 3ETQA 3MUY1 2WS91 3KF5A 1WW6A 2E33A 4D7YA 1MPXA 2FZ1A 4URTA 2GN7A 2MHFA 2D6KA 3KMHA 4GQ7A 3VKNA 1JOPA 1BVP1 1MZFA 1RYYA 1YIPA 4NJ4A 2X5IB 4Q5OA 1UY0A 5A7WA 3USUA 1TMF1 3BU7A 2JDPA 2QNKA 5JI7A 1ULGA 2RMU3 4ZY9A 1ULPA 1AR62 5FRAA 5FZFA 1DHKB 1VMFA 4L92A 2ZMKA 1PK6B 1AYM1 1QJU3 4Q4V2 1VPHA 1W06A 2PN5A 3E1F1 3CJIC 2E31A 4QKBA 2QUOA 5C5TA 1GICA 3NV2A 2HH9A 2O8QA 1DG6A 2XVGA 5FZ9A 4GB32 1OH4A 4MGSA 2J7MA 5DQ0A 2OPKA 1PO13 3IM0A 3K46A 3O0VA 2XQXA 2YUEA 2YDEA 1RUG1 1L7LA 3M3CA 4Q4X1 3VBHC 1WCKA 2RM23 2VXRA 1NA1B 3BI3A 1QJX2 1XE0A 1PGW1 1W04A 3B9CA 1RHI1 2L9LA 2PAEA 1RUE3 1OFSA 2VNVA 2DTWA 5H9SA 3ZMOA 3UGHA 1AL21 2P3IA 1POV0 1UZZA 5LBEA 2ZACA 3S0MA 4XYXA 1T2XA 2B39A 1JZ6A 5FP3A 4EE2A 4YW1A 3AKQA 3RZMA 3QCWA 1JHJA 1H9WA 4RHV3 1FAYA 1QXRA 1DZQA 1GLHA 1R1A2 1RUF3 1WBLA 4CP2A 2QQLA 3MZHA 3VZJA 5C6CA 3AP7A 4O9EA 2ZJCA 5LWBA 3O1SA 4MUVA 4AXOA 4QB1A 4Z8BA 4FP3A 4XFGA 1F8VA 4CCCA 2XMLA 3J8F3 4JTOA 4NVPA 2MEV2 1UZ0A 1W0OA 1FMD3 3CJIB 3HIFA 3M3QA 4D6SA 3E6CC 1ODNA 3UGFA 3AKSA 4BE3A 4YSFA 5FPXA 2BQPA 1ND3A 4QD2A 3UKTA 1JZ4A 3SEEA 1HDKA 4ZS2A 5ANQA 3B3QE 3VBHB 2TUNA 4V1PA 4HLTA 3T2QA 1Y9MA 4UW4A 5JI9A 2BVBA 1UOFA 3ZKYA 5FDBA 1EAH1 4LR4A 3NNGA 2E7AA 1Y3TA 4BQ4A 2Y6GA 4HKWA 4E2GA 5JR2A 5ANNA 3ETPA 5FK7A 4FPJA 3KWVA 3VKLA 5DAXA 2PAKA 3CKHA 3GBWA 4IEPA 2VQAA 2BUKA 2D3PA 3HN3A 3ZN4A 1BQPA 1FXZA 5FV3A 1GWLA 3AMQA 5FREA 4CU8A 2P3KA 2QCSB 5LCWL 5FY7A 1QHDA 4M00A 4S2DA 5FBZA 4AFCA 5IK7A 4PQ9A 1GQPA 3VDDC 3DV8A 1IKQA 1NCRC 1UOJA 1WCQA 5AC93 5K9YA 4LBJA 1MQTA 2YB7A 3GZEA 2FCUA 1VRH1 3NV4A 3B69A 5DAQA 4ZS3A 5JSPA 1XNTA 1H8TA 2OXBA 2YPDA 3J7MA 4COUA 2E7TA 1SBFA 1C4RA 4HETA 3H0OA 2BGOA 4IV1C 3SCFA 2J42A 3OGJA 2W46A 2XL7A 2AH2A 4YG0A 1OURA 4DY5A 2WFPA 3TNQA 3BTAA 4LOSA 3AMMA 1QQP1 3GHNA 4EROA 4S2HA 1K12A 2H6BA 2XJVA 5GZDA 5FZ6A 3N7JA 4O61A 2PHFA 2VMEA 1RUC3 1LHWA 5FLHA 2SLIA 3VD5A 1UIJA 2NM1A 1RUH1 2HWE3 1VAKA 3ACFA 3FHQA 1OVSA 4RS5A 4ATEA 3WNXA 3I3BA 4WVMB 4OQ9A 2EAKA 2TBVA 3PMEA 2P3YA 4N7IA 3DECA 1RC6A 4UW5A 3WQ1A 2CNAA 4D69A 2JE8A 3T0AA 3M4FA 5FYYA 4AW7A 4DEQA 2VZQA 1AVBA 3LE0A 1Z7S3 1YJLA 4DUVA 5FZHA 3NVCA 3PUSA 4YW5A 3VDDB 3CZJA 1NCRB 4G3YC 4O65A 5DABA 3IIAA 5A1LA 3S5AA 3AFKA 1WW5A 3OGGA 4J1WA 2VTXJ 4QGMA 3VDBA 4Q26A 4DUWA 3LF7A 2ES3A 5LA1A 5FXZA 3NAPA 2ZS6B 3PU3A 2Q4SA 5BNPC 5BPXA 4D8MA 3DXTA 4I0AA 2ARBA 4IV1B 4L9BA 4PHZA 4UOJA 3BYWA 4EZ4A 4XPVA 1BMV2 3GBGA 4AQ2A 3CBNA 1AHSA 2Y6FA 2IVJA 5EWSA 4Y20A 3THTA 1JYXA 4XE9A 5IT6A 1GQHA 4UFLA 1KXGA 3C7HA 3GGLA 1IQDC 3HQXA 1XXNA 1QDCA 3A4UA 4LO5B 4LKFA 4K1ZA 4QX5A 1TVGA 3ZYIB 4A6OA 4ARYA 3NO8A 1S0BA 2ZGPA 2JDZA 3VN4A 2VMFA 4LT5A 1RUD2 1SPPA 3N3HA 4GZ9A 3W21A 4Z2WA 2JE7A 3I59B 4W6WA 1H1IA 4YG6A 3KHCA 3B02A 4E2QA 3IWZA 2CGNA 3UGGA 3VUOA 1NKGA 3VKOA 2VZOA 3ILFA 5T5PA 1W8OA 3OPWA 2GNMA 5C3PA 1HV1A 1W05A 3ES4A 3O0WA 2ZA9A 4I02A 1JZ5A 3V64A 4YM1A 5FPZA 3H7YA 1RMU2 4Q2FA 3KD4A 1COV3 1RUJ3 1UKRA 3FE5A 4QGLA 1WGPA 4B8EA 2WNUA 3NQHA 1K3IA 2QQIA 2JIJA 4TLGA 3POWA 2YG0A 2FDJA 3D6EA 3EXUA 4EN9B 2AC1A 4JTNA 2WR9A 2R063 3ZN5A 5BNPB 1J84A 4IGPA 4HONA 5FY5A 1IS3A 3RNSA 3URFA 2AENA 2WS93 1JUHA 1NXMA 3AP4A 1PMHX 5HI0A 2K2SA 1DZRA 5J98B 4EN8B 2Z2SB 5FAXA 2DV9A 4AI1A 3KGLA 5FMOS 1JI6A 2XONA 1S0JA 5FZ3A 5DUUA 3ABZA 5DMYA 3NNFA 3V56A 1EY2A 2W92A 5DAVA 4XDPA 4IV3C 4YZ4A 2EF6A 1UQXA 2WO7A 2EALA 5F5QA 1W9SA 2YBSA 1GOGA 3OBRA 4P00B 3T1MA 1MEC2 5FZ1A 4IE0A 1NE4A 2D44A 4CUAA 5C3RA 1MR5A 4HL0A 5FZ8A 2D43A 1A8MA 2RV9A 4YVWA 1KJRA 3WSOA 4XZUG 4K8RB 1LOFA 3BGAA 3TN91 2Y0OA 3ZXFA 4YVSB 2VVDA 2C1FA 2R32A 2N7GA 2HWF1 3AK0A 2NP0A 4XF4A 4ZXEA 5JVVA 1YCIA 5JOZA 2ZTNA 5IVBA 1RUG3 4Q4X3 4YLZA 2AZ5A 4YGCA 3AP9A 5FP9A 5A3MA 5J3UA 1S4CA 2WWSA 3HR9A 1XSRA 2GC3A 2OIIA 3UESA 2Y6HA 3I54A 2C9AA 3M3IA 5FUNA 1RHI3 5A3NA 2HWC1 3WW3A 3ZSKA 2VH9A 1YLLA 5GJ6A 1GP4A 5E89A 2BW8A 4D3WA 3IDEA 3K4DA 1UYYA 4IEWA 4FSJA 1BCXA 3AKPA 1ZBE2 1UWWA 1CD3G 3KM5A 1PM4A 1AL23 5C8CC 1WCUA 1BKZA 1U5YA 1IGOA 1WA6X 2A6ZA 4DO0A 3TEWA 4N43B 4AVCA 5C71A 3T2PA 1VBB2 4A7ZA 3WG4A 5FOJB 2BTVC 4P9XA 3WV6A 4Q4V3 3HQRA 1CWPA 2CGPA 3WY6A 1C5HA 3TEZA 2B5HA 1X7NA 1OKOA 1R081 1T6BX 3DYPA 3P1IA 4IV3B 4Z2AA 5BNOC 4CDUB 1OSGA 5D1IA 1N1SA 4W8JA 2EAAA 4KWKA 4FPEA 5J09A 3E6DA 3S7EA 1HQWA 1K5MA 2XXZA 1GZWA 2OS2A 2YROA 4ZU4A 5KXEA 1OD3A 2WC2A 2HKXA 2BPA2 4KNCA 1E5SA 1NG0A 1FPN2 3K48A 5A7PA 5HCHA 4QX0A 5FY1A 1QY4A 1YHFA 4XACA 3PTRB 3H42B 1DF0A 1MZEA 5LBBA 3OEAA 2ZGQA 1A78A 2WFF1 2YY1A 2VGDA 5EJ1B 5LZ6A 4WM7A 1FT9A 3NJVA 1GP6A 4QPWA 5E8AA 1FV3A 3J7HA 4A42A 1QEXA 2DCKA 3LEKA 1TEIA 1AJOA 1WWYA 2JX9A 3C3VA 4NOTA 1NUKA 1GNZA 1VAVA 3OOXA 5C8CB 3JUUA 2X29A 4Y24A 4ZKTB 1ZVFA 2QQOA 5FO8B 5JXGA 4CSWA 2A1XA 4JZRA 1G9DA 4ZONA 2JWPA 2FQPA 2WNEA 2EXHA 3VBSA 1FNYA 5A7NA 3U11A 1UAIA 5BNOB 5FZEA 4UFKA 4XQDA 2RJKA 4PCRA 3RYRA 2GDFA 1R091 3KZ4C 1F9KA 1ZRRA 4JRLA 1BEV2 4IE7A 4UWDA 2QQKA 3VBRA 4LA2A 4LHKA 4XFCA 4S2FA 1TME3 1UN1A 1IS6A 2VQTA 3WDTA 3V0BA 3VL9A 5IHRA 1ZM1A 2ZEWA 1EV11 4K40A 5FK8A 3IMNA 4GD4A 2DU1A 1QQP3 4LEJA 3I8TA 2V4VA 3FN9A 4N53A 4EJRA 1UOBA 3ZYGA 1EP0A 1D0HA 1CAUA 1ST8A 1W9WA 3D3AA 1TNRA 4WVVA 1PX3A 2OYZA 1IPKA 2IVIB 1RUH3 5EPAA 3T2TA 5IJRA 2WZR1 3I49A 4XHBA 1AXKA 2FDFA 4DEVA 1LOGA 3F2ZA 2GH8A 3MIBA 5HBAA 3GCXA 3UT0A 2A6VA 2DCZA 5LRRA 5A7WB 5SV8A 3USUB 3THCA 2JB4A 3MLLA 2D6MA 4P9IA 4ISRA 4DFSA 3PURA 1MS4A 2HEYF 5D8AA 1HRV2 1YNAA 1L7RA 1AL0G 2UURA 4LKSA 4LBQA 2XBO1 3UETA 5KXBA 2D93A 1US2A 4K21A 1H2MA 1OLRA 2JD9A 1ND2A 1VBA1 2RS33 2FDHA 2WO3A 1OF4A 4UW6A 3HVDA 1RUI1 5A32A 1ND3C 1AR92 1HN1A 3WW2A 2ZGUA 5D2AA 3IAPA 1ENQA 3UV9A 1CPNA 1H6YA 1R1ZA 3PUHA 4UFIA 3NL1A 2FMYA 2ZHKA 2VTXA 3AMPA 2PHWA 4B7KA 1DLCA 5ERLA 3ZX7A 4HK8A 5KHJA 3IB3A 3LEMA 5G05L 1W28A 1LOEA 2PA7A 1Y7BA 3MPPG 4IERA 4OVEA 4J1XA 4BDVB 2HWB1 5A3WA 2R16A 1YQ2A 3FHAA 1QJU1 1X8EA 3AP6A 4FT8A 4QQPA 5F39A 1PMIA 3TBDA 1UYPA 4LBMA 1LOAA 2V73A 3IPVA 4ASKA 1H1AA 2UU8A 4KBBA 4RL7A 2PLV3 5T5OA 2VUAA 1NQDA 2DUQA 4BQ2A 1HQNA 4ZU7A 2J1VA 2JXAA 3C7EA 5F3GA 1WA4A 3SQOA 3T08A 5L36A 5CA6A 2QTWB 2PELA 5LW9A 4CU6A 4EWDA 2HBUA 1H8TC 1UL9A 1XE8A 2GMMA 2R49A 1ASJ2 4CE8A 2UWBA 1JZ8A 4FOWA 5JIUA 1ND3B 2C24A 4KU7A 2W08A 3BODA 3I2KA 1HB3A 5C70A 4OULA 1RUD3 1FX5A 1BXHA 1F5JA 3MICA 4M0NA 4QHBA 3RZJA 3OSDA 1KQRA 2NYYA 4RHV1 4H7LA 4XFAA 3SITA 4D6RA 4XF1A 4BQ1A 4RS5C 1O3SA 3VV1A 1NAEA 2YC4A 1SLTA 1W6NA 1SEFA 1UMIA 1GR3A 4Y1VA 1ZREA 5FLJA 1NE6A 3FLPA 4MADA 1H30A 1J83A 5JCTA 2XL9A 2WT1A 2XWBB 1B35A 1S0EA 1FMD1 3OY8A 3SH5A 4NN0A 3VD3A 3TN93 2PQQA 5GZEA 1LRHA 1DDLA 1ZZ9A 3Q8EA 2OX0A 4XCBA 2O1QA 3THDA 3ZR5A 2DTYA 2V4AA 3EJKA 3HEIA 1D2QA 3RI8A 1GNYA 2JD4A 2P4EA 2VZUA 2JIGA 3VHRA 1HN0A 5FIXA 3NAPC 1H8TB 4I30A 2VCCA 5FY4A 3RMYA 4CEWA 4EN0A 2X10A 4AI8A 4JKKA 2GP3A 2HWC3 1C8NA 3DL3A 4H14A 2RR11 4A45A 4O7XA 4ES9A 2EIBA 1GZTA 5D21A 4UBGA 2PHDA 2Z42A 2XKOA 1PNFA 3PL0A 3WG2A 3ATGA 1MEC3 1I5ZA 1RVF3 3K51A 2DCTA 3NNJA 3WQ7A 4BZ4A 5ACA2 1WCDJ 5FPLA 1OA3A 3O12A 4RS5B 5FZOA 4OHXA 1NXD1 4QDRA 3I3MA 1QU0A 5JLVA 1N1VA 4BLJA 1N3PA 5DXDA 2ZABA 5J96B 1O59A 2HLEA 3K3NA 4NRMA 5IVVA 4YZ1A 2E63A 1MS8A 2LROA 5CZKA 1CAXA 4FAGA 1G9CA 5FZGA 2R072 5GLVA 3O1PA 1RTVA 5FP7A 1UXXX 3EBRA 3T30A 5JZGA 1QXJA 2RS51 2ZGTA 3RSJA 5DDJ1 1JN2P 1LOBA 4HZFA 1VR3A 2WNUC 2PYTA 4CVUA 2W0XA 4D7TA 3GHMA 2Q1FA 3ZYBA 1ZBE3 3ZIXA 1WZXA 2VULA 4UFMA 5J36A 1CAWA 1YFXA 3NAPB 3T1LA 2DWRA 1IKPA 2D6NA 2WRAA 5FFOC 4JGYA 1QOTA 1VBB3 1YRZA 4QX2A 3SISA 3CLPA 4OFGA 1FOD3 4BISA 2A3XA 4E8DA 3AKTA 3WNPA 5HXVA 2WT0A 4Y20B 4C0HA 3H8RA 4HFSA 4FFIA 4QKFA 5JWPA 2AGSA 2HWD2 1Z7S1 3ILRA 1F15A 1WBFA 4H7MA 1OI6A 5FYZA 1D4M2 1SPPB 4PIYA 4BOWA 5CU1A 4RR3A 5JSRA 3MFCA 3ZFGA 1FPN3 1DQ6A 1RXGA 1Y43B 4B3NA 4HVOA 5FKCA 2A3YA 4YM0A 4YVWC 1O8SA 3SNMA 2OQ6A 3WG3A 5HCFA 1XNBA 1LOFC 4KGGA 4TN7A 1S0FA 1VAMA 4Q4Y2 1VB2A 3BU0A 2V5YA 1QOOA 3MPBA 3PUAA 1YI7A 4JDNA 4NAOA 3GALA 2PHTA 2DUPA 2UWCA 3SCHA 4LUKA 3SHRA 3UL2A 1EV13 2XJSA 3WW1A 3DEMA 3LA7A 3IMMA 3HPNA 4QKDA 2WNUB 1DGRN 2IWGB 4Q0UA 4V2VA 4CXXA 2RJ2A 3EYPA 4XF0A 4XFFA 3JD72 5I91A 4GAZA 2A7AA 4D0QA 3BIEA 1NLSA 2WABA 2WNVA 2D6PA 1GZCA 4SBVA 3Q9OA 1HXS2 1JXNA 3ZSEA 1O3QA 3N7MA 1J3RA 1REEA 1ZRCA 1V70A 4X6RB 4X8PA 5FYBA 4R8HA 1IG3A 1QJFA 3MIDA 1SQ4A 4OHVA 5I0TA 4Q4W2 4AFMA 4JX0A 2WDBA 4Y3OA 2OPWA 5EJZB 3WF1A 3J9SA 4EYUA 1BEV3 2XOMA 2O14A 4CDXA 1YFYA 3SXWA 4YZ5A 3OGRA 4QQHA 1HIXA 4RGKA 3VGIA 2K9ZA 4FOVA 1C1FA 3W59A 3WR0A 3MV11 4MG2A 2ZX3A 2CV6A 2XBO3 3O7OA 3AYAA 4YVWB 1LGCA 5F32A 1VBA3 5EJ3A 3R4SA 4YGEA 4X6QB 5CFCA 4I3GA 1VBE3 3LB9A 4LJHA 4XZPA 1TZOA 1TMF2 2CDOA 5F3EA 1BZWA 2F6BA 1CN1A 1H2NA 2IXIA 4EZHA 5ABJA 4JGZA 4XJUA 5L7OA 1UIKA 5ISLA 1W0PA 1QJEA 5KC6A 2KR2A 2H0BA 5C9AA 4BJ0A 4EQVA 4KWUA 4WM7C 5FZLA 5GZFA 1LECA 2GC2A 1I6XA 1O8PA 3Q8CA 1X9PA 3AMNA 1J1TA 1UU4A 2WZ8A 3A0NA 1ZRDA 3U14A 1W90A 3MI8A 4HSJA 1ZNPA 3B94A 1VBD1 4JDMA 2XG3A 4IEYA 2HWB3 5DG1A 3ZMNA 4CCKA 5AFBA 4UBHA 3LKJA 4WM8A 3KGZA 1GU3A 3LA3A 4BMEA 2VW1A 3BB6A 2RG4A 2Y38A 1WD3A 2Z4FA 1AYN2 3VBSC 2VMIA 4NHMA 3WVJA 1UNBA 2I45A 3POJA 2XJPA 2YGMA 4QB6A 4JHTA 5CBLA 1LODA 3I3QA 5FBJA 2WQ8A 5FZIA 3U78A 4P9LA 3SKVA 3GJAA 3WX5A 4XHXA 5F1RA 1W9YA 4P14A 5C33A 1K5MB 1UX6A 1GZWB 2VOVA 1MZ5A 5SV5A 1V6NA 4W6YA 2YFZA 5FP8A 3VBRC 5FJKA 2Y6JA 5IVJA 1TE1B 2PHUA 1NLRA 4LNVA 4CA9A 5IK5A 4Q0VA 4U2AA 1NQJA 1RL3A 3PU8A 5FTTC 4LO7A 5A6XA 5FYHA 4XC9A 1AR61 5JMOA 5LRSA 2VNGA 3G6JB 4LO6B 2W91A 4XF9A 1PIV2 2A6WA 3POFA 4Q4V1 4S2GA 1YQCA 3ZXAC 1XU1A 2GZWA 3CDZB 3OBAA 4DB5A 1W8WA 4WM7B 4YWAA 4CXYA 4KWLA 1O3RA 3WP6A 3TWIA 4GB31 4KU8A 4JKLA 4KWJA 4AVTA 3LWCA 3RZHA 5BXXA 4N9IA 5GALA 1F4AA 1REDA 3KS7A 1I9RA 3AZWA 4Y1XA 5HCAA 2YHJA 3GM8A 1QJX1 3RVHA 5KXDA 3GBFA 4RQPA 4AE2A 1EYBA 3CHXA 5D8AC 4E4HA 3VBSB 3PDQA 3T4VA 2JDAA 2NLRA 2DVFA 3AZZA 1PGL2 1T6GC 1H4GA 4K7JA 4NPRA 1OOPA 2F17A 1UO9A 5KHGA 4ZZ5A 3KF3A 4P9WA 3HNMA 1N47A 2MNGA 3PJYA 4PQQA 5BUVA 1I1EA 4LXLA 1C3HA 1ZZ8A 3GZUC 5I0DA 2BRTA 3VBRB 5LEJA 2C4XA 3V0BB 3BPZA 1PX4A 2RJLA 4JDOA 3ACIA 3VZNA 3WW4A 4NWVA 2RR13 2R042 1GKBA 1UY4A 2W52A 2XHNA 4FVVA 5DZGA 3NSTA 4IXLA 3WNLA 1DGWX 3AP5A 3DYMA 2ZX1A 5I8SA 3VBFA 1CAUB 3ME2A 3H8XA 2MEV1 2ADEA 2VVEA 4K1YA 1A6CA 1AF9A 2QQWA 4FXKB 2BBAA 4MLOA 1SCRA 4Y1ZA 2VUDA 1C8M2 4A6SA 1QGLA 2VC9A 1PZ9A 4Q0PA 5FPAA 4CUBA 2RS12 1DQ5A 1H2LA 5I8TA 3L2HA 4CU9A 5A3LA 2VL4A 3O1MA 4C8DA 1V6LA 2VXJA 4IE5A 1TME1 3MUZ1 2ZXQA 3LPFA 1N1YA 5FUIA 3FLTA 4HT1T 3KT7A 1G86A 3T2OA 2P34A 3WDWA 2DU0A 5D8AB 2O8OA 4Y1UA 4B4RA 4GWJA 3W58A 2FZ2A 1IPJA 2RS53 2ZEZA 2W39A 4LBQB 2WA4A 5DDJ3 2VZPA 2Y0IA 1ND2B 1XQNA 4UYBA 1GANA 3D0SA 4QT6A 4C1WA 1S0DA 1W2TA 1QKQA 1JUIA 5IFTA 4HVRA 5A32B 4M4PA 3H3ZA 5FUPA 5FZBA 3ITQA 3HNYM 3RI9A 3WINE 3ZYRA 1NCQA 3N9OA 4FFFA 1GBGA 1YXWA 3JCIA 3BALA 3OF1A 2BGCA 3FJSA 4N8MA 2Y64A 4RD7A 4AYUA 2Y6LA 4QX7A 1UX7A 3LA2A 1VLNA 3FC0A 3QH6A 2VD7A 2A71A 1W8HA 2HJIA 1L3JA 3ZSJA 3WDVA 1DQ0A 1SBDA 5FZDA 3BOWA 2IXJA 2R0FA 4GWMA 4GH4A 4RA0A 3ORJA 5B2GB 1X50A 5C8WA 1JZ7A 3AKRA 2VZ3A 5FZCA 3M3OA 4WBBA 2E53A 3H50A 1VE0A 3OEBA 4MX3A 1WCSA 2VBPA 3WF3A 4IW3A 3K2OA 2CDPA 1EUTA 2QKDA 2R073 3KV4A 2RS31 4QB2A 4HANA 4AGGA 1B35C 4CCNA 3FFZA 3WHTA 3IPVB 2BWAA 4WZCA 1WMFA 4OHWA 2Y33A 5DUVA 3WNNA 5JUVA 1BVVA 5FMOL 2VAUA 3A22A 4LKDA 3TNPB 5BNNA 4AWDA 1V9U2 4XIOA 3J26N 3D4KA 3JBG2 2OKXA 2I2SA 4UAPA 2X53S 1ENXA 2B8MA 4L97A 4DUXA 1A3KA 4AOCA 1UY1A 3NKTA 5IAVA 4XQ4A 4BK5A 1Q8OA 2C9KA 1F4HA 2W2IA 4Y26A 4AFAA 5KHKA 4CEWC 1LEMA 2GC1A 3HT1A 4I3PA 1SLBA 2HBTA 2WWUA 4XQWA 4QX8A 5HCBA 2BNNA 3P3NA 5K0UA 4YM2A 2D98A 5T52A 1D4M3 1UZVA 3N36A 2QZ3A 3W9AA 4CRQA 2GAUA 3T09A 1UZYA 2D97A 2PLV1 5A80A 1Y9GA 5J1XA 4YVSC 3QBQA 2DDUA 4YG3A 3ZDSA 4AHXA 2FDGA 3PIGA 1O7FA 2VZSA 3WZ1A 1XNDA 1W6NB 5BV6A 2J1AA 5IVYA 1G7YA 4DOUA 1PZ7A 4QAWA 4ZPIA 4CUCA 1GNHA 3JB8A 4LBLA 3V0AA 1BMV1 2W1WA 2WT2A 1UU5A 1EUUA 5JR7B 1B35B 2WYSA 1AJKA 3OY8B 4XIKA 5J48A 3DGTA 4HSLA 1OA2A 4FI9A 2BP6A 2EXIA 4M01A 3ACLA 4GA9A 4AVBA 1ACCA 3J4UH 5GM0A 1GZ9A 3ZFEA 5JZGC 4EN6B 4CZSA 4Y22A 1RUD1 5DZFA 2BOIA 4RSUA 1NX9A 1HXS3 1U12A 2VECA 4N43C 2OW4A 5KXCA 4A7YA 1J1LA 1ENRA 4NHYA 1CJDA 5LBFA 4CEWB 4LPLA 3EB7A 2CAUA 4JGYC 4KMQA 2IXLA 1SMVA 4R9CA 3QOPA 4W65A 4XJZA 2GNBA 4FQZA 1J59A 3KV5A 3MIGA 1UPSA 1V0AA 4CDUC 4Q4W3 4R4ZA 3R4UA 3N9QA 3INAA 2ZMLA 4P02B 1XYPA 1VBD3 4GMP1 2QFEA 1RMU1 2HWF2 1ZZ7A 1YC61 1X8MA 4E4DX 4LQRA 2BFUS 2P1BA 4GJZA 2W95A 4XFHA 3RRDA 3CJXA 4MVTA 4NR1A 5CKMA 5FZOB 5FY8A 2E6VA 3ZFGC 2VOTA 1C28A 1SDDB 2P37A 3O0XA 4CTEA 4Q8KA 3BPSA 4AVSA 1JYIA 1V6KA 3SCGA 5JOXA 3H1WA 2GNDA 2WQZC 1Z78A 1OLQA 2F4LA 4NHKA 5FYTA 1CZVA 4QQ2A 4I2OA 3HT2A 2JKXA 4FPKA 4W50A 1QJY2 1CAXB 1JZ3A 3R05A 2V72A 3RS6A 1YIFA 5JZGB 2J1RA 1X33A 4KBZA 4MYEA 4CCJA 4YM3A 5EIYB 3B7MA 2B7YA 1AR63 2JJ6A 1MEC1 2J1EA 4QU1A 3SH3A 1RVF1 3VZMA 5IVEA 3FL7A 3WP3A 4ZZ8A 1XPWA 3MIHA 1XBFA 1CAWB 3S6PA 2WNVC 3WG1A 2Q5TA 2QQMA 4JGYB 1VBC2 2E51A 5LATA 4DZGA 4JHZA 1AYN3 2LS6A 2WAAA 2QQNA 4CP1A 3AFGA 4GB33 1DU3D 3M3EA 3BN6A 3NWKA 2HEVF 4FTBA 1CX1A 2XLFA 1UF2C 2GP5A 1XU2A 2NQYA 1POQA 2WNOA 4IEOA 1QJX3 3EO6A 3LIHA 5FYVA 2NMOA 4CDXC 2BBVA 1D0GA 4IEXA 4MXWA 4QGNA 2V5DA 4RR3B 3ZFGB 2ZKLA 1LNSA 1OLME 2EIEA 3HMYA 2WSUA 4XURA 1KFXL 1ZBE1 2OVUA 4C0BA 4CEYA 4AEDC 1DCSA 2UYAA 4TXWA 5CKNA 4G9SB 4K6BA 2VY0A 4QPYA 3I3EA 3WQ0A 4CU7A 2AR6A 1AUYA 1OPOA 1VBB1
chains in the Genus database with same CATH topology
3OUIA 3NNFA 5EQUA 3GZEA 2FCUA 5DAQA 5DAVA 2RDSA 5C5UA 5IAXA 4ZPIA 4NHXA 4XCBA 4NMIA 5L9BA 2RDNA 5DAPA 2V4AA 4Q5OA 5EPAA 2JIGA 2OPWA 3OUHA 4NHLA 4BQYA 3NNLA 2FCTA 5LA9A 4MHRA 2FCVA 3OUJA 3PL0A 4NHYA 5C5TA 5L9RA 5LBFA 4Y5SA 3OBZA 3NNJA 3KT1A 3KT7A 5LASA 3HQRA 5HV0A 5LBEA 5ERLA 3ITQA 5L9VA 2RG4A 2RDRA 4NHMA 5LBCA 4NHKA 4J25A 4XABA 2G19A 5DAWA 3GJAA 3W20A 4XAAA 3DKQA 4XACA 3GJBA 4KBZA 5LBBA 4IW3A 3W21A 5HV4A 3HQUA 3BVCA 3NNMA 5LATA 4XCAA 4XC9A 2Y33A 2HBUA 5LB6A 3EMRA 5IATA 3MGUA 5A3UA 4BQXA 2A1XA 4JZRA 2G1MA 5IAVA 5EP9A 4ZONA 2RDQA 4BQWA 2JIJA 5DAXA 4Y5TA 4NAOA 2HBTA 3KT4A 2Y34A 4MHUA 4UWDA 5M0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUI A;  3NNF A;  5EQU A;  3GZE A;  2FCU A;  5DAQ A;  5DAV A;  2RDS A;  5C5U A;  5IAX A;  4ZPI A;  4NHX A;  4XCB A;  4NMI A;  5L9B A;  2RDN A;  5DAP A;  2V4A A;  4Q5O A;  5EPA A;  2JIG A;  2OPW A;  3OUH A;  4NHL A;  4BQY A;  3NNL A;  2FCT A;  5LA9 A;  4MHR A;  2FCV A;  3OUJ A;  3PL0 A;  4NHY A;  5C5T A;  5L9R A;  5LBF A;  4Y5S A;  3OBZ A;  3NNJ A;  3KT1 A;  3KT7 A;  5LAS A;  3HQR A;  5HV0 A;  5LBE A;  5ERL A;  3ITQ A;  5L9V A;  2RG4 A;  2RDR A;  4NHM A;  5LBC A;  4NHK A;  4J25 A;  4XAB A;  2G19 A;  5DAW A;  3GJA A;  3W20 A;  4XAA A;  3DKQ A;  4XAC A;  3GJB A;  4KBZ A;  5LBB A;  4IW3 A;  3W21 A;  5HV4 A;  3HQU A;  3BVC A;  3NNM A;  5LAT A;  4XCA A;  4XC9 A;  2Y33 A;  2HBU A;  5LB6 A;  3EMR A;  5IAT A;  3MGU A;  5A3U A;  4BQX A;  2A1X A;  4JZR A;  2G1M A;  5IAV A;  5EP9 A;  4ZON A;  2RDQ A;  4BQW A;  2JIJ A;  5DAX A;  4Y5T A;  4NAO A;  2HBT A;  3KT4 A;  2Y34 A;  4MHU A;  4UWD A;  5M0T A; 
#chains in the Genus database with same CATH topology
 3N9M A;  3DF0 A;  1FOD 1;  3S5Q A;  3AXD A;  4COV A;  1BBT 2;  4Z82 A;  3S57 A;  5L7O C;  1R1A 3;  5ABJ C;  2ZMN A;  1PO2 2;  3DPR A;  2D5F A;  1MS1 A;  2QQP A;  2XDV A;  3LFM A;  4IL7 A;  1M06 G;  1HRI 2;  5C9A C;  3N9N A;  4CCD A;  1QH6 A;  4ET7 A;  4PLN A;  1JBC A;  3GDB A;  4XVH A;  4AAP A;  4E4Z A;  5C3O A;  1N3O A;  2YFU A;  2WNV B;  1SLI A;  1PVC 2;  3FBM A;  1SAC A;  1D4V B;  2MEV 3;  2XLA A;  3PUQ A;  3ZDV A;  1FPN 1;  4BU2 A;  1OUX A;  4KI5 M;  3RGB A;  4Q8L A;  5F2S A;  3ZXG A;  2ZPX A;  4NAM A;  4NHL A;  3OBT A;  1IZ3 A;  4BQY A;  4WM8 C;  4R9B A;  4N9H A;  5H9P A;  1W3V A;  2CAV A;  2VCA A;  4KH9 A;  4BMB A;  4CYD A;  2CSG A;  2ZX2 A;  3WLU A;  4DXT A;  5K7P A;  3I2G A;  3KCC A;  1SLC A;  3CQO A;  2Y8K A;  4CDX B;  4DXR A;  3ZM8 A;  2ZCW A;  1LHO A;  4PLM A;  2KM2 A;  2EA7 A;  3E5Q A;  3MF6 A;  3VLB B;  1URX A;  4A3Z A;  4AED B;  3A7Q A;  3NJX A;  4B29 A;  4ZXK A;  1G8W A;  1H0B A;  2OUJ A;  4FPL A;  4A41 A;  4AGV A;  2F4P A;  5CFC B;  3AJY A;  2ZOE B;  5H9Q A;  1QJZ A;  1S1A A;  3L2Y A;  5F5A A;  4DRV A;  1X36 A;  3LOB A;  4UF0 A;  3ZXE A;  5L7O B;  1O91 A;  3LSE A;  4JGZ B;  5ABJ B;  1UKG A;  1F5F A;  4BXS V;  1C8M 3;  4ZHN A;  1XYO A;  4AFB A;  4M3C F;  3S30 A;  5C9A B;  1F35 A;  2EXK A;  2O0O A;  1AZD A;  2Y6K A;  4MET A;  5A3P A;  1ZA7 A;  3CMG A;  1HJF A;  5E1R A;  1BEV 1;  5FO7 B;  1G9F A;  1YEW A;  1DGW A;  5DUX A;  3KCX A;  5GLZ A;  1GMM A;  3TYJ A;  3GZT B;  2ETE A;  2QQV A;  2WN3 A;  4NIH A;  2XJQ A;  3GYD A;  3OB8 A;  5KHH A;  2NZ9 A;  5JPN B;  3POG A;  3E5X A;  4WM8 B;  5FCC A;  1H9P A;  3TAY A;  4ASL A;  1UMZ A;  2JEC A;  4M3C E;  4RQP C;  1LHN A;  1VBE 1;  2P17 A;  2ZX4 A;  2XH6 A;  4GWI A;  4LO4 B;  3AL5 A;  1OOP C;  3PNA A;  2RMU 2;  1V6M A;  1QH7 A;  3U4X A;  3ALQ A;  1PM7 A;  4XUO A;  2ZAA A;  1UU6 A;  3PUI A;  1RIN A;  2XVK A;  2B9V A;  4MGY E;  5EXO A;  4DIN B;  2VVF A;  5CG8 A;  2BNO A;  1PVX A;  4XAE A;  2R6Q A;  1STM A;  5FY0 A;  1CZT A;  3A21 A;  5JOW A;  4QM8 A;  1XNK A;  1PO1 2;  4BQW A;  4YFZ A;  4AQT A;  1HRV 1;  1JH5 A;  1ONA A;  2ARX A;  2IFW A;  3HOB A;  4KGQ A;  5FYS A;  1MVQ A;  2RM2 2;  4Y5T A;  3DCQ A;  5CIS A;  1OLM A;  2RHP A;  1KRI A;  5F6K A;  2OA2 A;  1OT5 A;  3ECQ A;  3HN1 A;  4I0B A;  1BJQ A;  3LGR A;  5A7O A;  1RUE 2;  5DPN A;  3RG0 A;  1AR9 1;  4DPN A;  2KXL A;  4OQ8 A;  2AYH A;  1SCS A;  1MQT C;  1V9U 3;  2FD8 A;  5A1F A;  2VMD A;  1KFU L;  1LGB A;  1TNF A;  3ZOI A;  4J6G A;  4KQ7 A;  1W6P A;  4RQP B;  5APA A;  4RHV 2;  3JQW A;  1RUF 2;  3TB0 A;  4A3X A;  5LA0 A;  3O1T A;  2CHH A;  2ENR A;  5DAP A;  4ZU5 A;  4QKN A;  5HXM A;  1OOP B;  4YW4 A;  4AHY A;  5FPV A;  2Q8E A;  5A33 A;  4OLL A;  1LOC A;  2DUR A;  3J8F 2;  5F5C A;  3WUD A;  1YYN A;  4R52 A;  4QPG A;  1NLQ A;  4OI4 A;  3FUQ A;  4HG6 B;  1NCQ C;  2QQJ A;  1ALY A;  2W3J A;  3AYD A;  4LOT A;  5EYX A;  2PHR A;  3I2O A;  1LCL A;  3IN9 A;  4UFJ A;  3EQE A;  2C5D A;  4ONU A;  3U4S A;  5KHI A;  2AAC A;  3B9I A;  3HNB M;  3OYW A;  4GMP 3;  2Y26 A;  2E9Q A;  2XJU A;  1RMU 3;  3OGS A;  4NRQ A;  4AL9 A;  1D7P M;  5DN2 A;  3VBF B;  4MGZ E;  2EVX A;  4GH4 C;  3BKZ A;  4NE9 A;  2AUY A;  3CEW A;  4XTP A;  5H9R A;  3LDR A;  1R64 A;  2VMC A;  1W6Q A;  4F8A A;  5JSO A;  1LJ7 A;  2BYV E;  1AR8 2;  1RXF A;  3POE A;  4QPI A;  2JE9 A;  1X82 A;  2VTF A;  4PF1 A;  3RWK X;  1MQT B;  2VMG A;  2XKP A;  3QD6 A;  3MW2 A;  1XRU A;  3PVB B;  1OH3 A;  2VM9 A;  3WCS A;  2ZHL A;  5I93 A;  5E16 A;  1SLL A;  1W2A X;  3RZK A;  2ZHM A;  5C4W A;  3SMH A;  4CUG A;  1W8U A;  5EV7 A;  2ZGK A;  3V65 A;  1K45 A;  4IEQ A;  4LIU A;  1I5P A;  5IYY A;  1VRB A;  3OTF A;  5BNQ A;  3LFI A;  4OUS A;  5JXJ A;  2GC0 A;  2V09 A;  1ZYB A;  4CCO A;  2VUJ A;  4GAL A;  4B1M A;  5AC9 2;  5IVC A;  3KV9 A;  2GU9 A;  2RDR A;  3G7D A;  4A4A A;  2EXJ A;  3AYE A;  4DMI A;  1QNY A;  1OFN A;  4XJ8 A;  3IKW A;  5F2W A;  5CFD A;  1KDM A;  4CPB D;  3W5M A;  3HBK A;  2W1S A;  1B09 A;  2GMP A;  1NCQ B;  4M3C A;  2OZJ A;  5K0U C;  4LIT A;  2A6X A;  4XXA A;  4BHP A;  2GAL A;  3A0K A;  3D0J A;  1Q5O A;  3H8O A;  1OBN A;  3ZIW A;  4XFB A;  5E6H A;  4FO9 A;  4D7S A;  5GZC A;  5T3N A;  4AEM A;  2VOX A;  4L11 A;  3MW4 A;  3NNM A;  4XMA A;  1SDW A;  1RUC 2;  2DVG A;  1CZS A;  4GH4 B;  3LDB A;  2YMZ A;  2VUC A;  1JYC A;  5FXX A;  2HWE 2;  4PT6 A;  4RGA A;  5GLW A;  1NY7 2;  4LK6 A;  3AX4 A;  4YZ3 A;  3ZR6 A;  4P5Y A;  4PBO A;  4Y5Z 0;  2QJV A;  4GMP 0;  1WUV A;  5J7M A;  4WZF A;  1QJY 3;  1W3X A;  1W2U A;  2OUH A;  3APB A;  1M4W A;  2VOW A;  5A6Z A;  5IVF A;  1AR7 2;  3ZFE C;  5JMC A;  3WHU A;  1UD1 A;  5K4L A;  5BNN B;  4RFT 0;  5ACA 1;  3KLS A;  1HJG A;  3POI A;  5GLT A;  4PI0 A;  4ITC A;  3OPT A;  2JEN A;  2VQU A;  3M1H A;  3A23 A;  3U07 A;  3I4I A;  3HBZ A;  4ORF A;  3RZZ A;  4U36 A;  3FUO A;  1ULF A;  2D6L X;  2DFC A;  4BA6 A;  4FAH A;  2ZEX A;  4YW2 A;  2VOK A;  1ZRF A;  4UI9 L;  4XTM A;  4WVW A;  4IEU A;  1J3P A;  2B42 B;  4FPH A;  4AHZ A;  1J3Q A;  2GSY A;  2WYF A;  3OGV A;  3W5N A;  3TEY A;  1FNZ A;  2R07 1;  4JKM A;  5K0U B;  5FP4 A;  1ZBA 2;  3IZO A;  3MIE A;  3D8C A;  4V2W A;  4AI9 A;  5IAX A;  2IXH A;  5EZW A;  2WZP P;  3X29 B;  3J7N A;  4Q1R A;  3N35 A;  4DS0 A;  4FOY A;  1BK0 A;  4NRO A;  1RUO A;  2OQ7 A;  2YV8 A;  2PTM A;  4B4P A;  4M0H A;  2R1B A;  3VBU A;  5E88 A;  4COW A;  3UK9 A;  5G04 L;  3HAG A;  5FPU A;  3V0A B;  2NN8 A;  2JDY A;  1OKQ A;  2YGL A;  1LR5 A;  1PO2 3;  1J58 A;  4YAR A;  5I8Y A;  1QNW A;  3RWN A;  2XLG A;  4ISQ A;  1HRI 3;  3N7L A;  2FCV A;  3ZO0 B;  3LCP A;  2VBD A;  2HWD 1;  2ZZJ A;  3ZFE B;  2CTV A;  1LUL A;  2TEP A;  3AVR A;  3OBZ A;  1BHG A;  4Y22 B;  4OI0 A;  1D4M 1;  4AI2 A;  4CP9 A;  3RJR A;  1PVC 3;  4UXA A;  5A70 A;  2BVV A;  1COV 2;  1RUJ 2;  3KT1 A;  1HB1 A;  3LIG A;  3QLQ A;  3U0Z A;  3MYX A;  2ERF A;  4TZD A;  3VZK A;  1APN A;  1Z0H A;  4XFI A;  1FAT A;  2JG8 A;  1U5I A;  3WQB A;  4Q4Y 1;  3WCR A;  1VMJ A;  2J1S A;  2LUW A;  3KB5 A;  2R06 2;  3RYK A;  2QZ2 A;  3N9L A;  2EID A;  1SFP A;  3OD0 A;  1AXZ A;  1K5M C;  2WS9 2;  5A7S A;  1REF A;  5FYU A;  5CYY A;  3K77 A;  4RFR B;  1CQ9 A;  1JS9 A;  4E9K A;  2VJX A;  4YRD A;  2WO1 A;  3AZV A;  1UMH A;  3HD8 B;  3ILN A;  3OJB A;  4H3W A;  3VZL A;  1G6N A;  3JD7 1;  4LHL A;  4BCU A;  3GZA A;  4XAB A;  5F3I A;  4AG4 A;  1S2E A;  2QVS B;  1E5I A;  4I09 A;  4P5H A;  1HXS 1;  2VO5 A;  4LE4 A;  3SH4 A;  5FWJ A;  2JEM A;  3AB0 A;  4CEY C;  4XAA A;  2I74 A;  4L8Q A;  5FZ0 A;  4MGT A;  1XNC A;  1OMI A;  2LTN A;  1HB4 A;  4QM9 A;  2XR4 A;  3ACH A;  3BIW E;  3ZSM A;  1AYM 2;  4Z07 A;  1IS5 A;  2XHK A;  3BTX A;  4QHO A;  3K4A A;  4GIQ A;  4Q4W 1;  3HQU A;  2UWA A;  1POV 3;  1G9B A;  4OHZ A;  3DPR C;  3H1Y A;  2R7E B;  4PBP A;  4L2N A;  5FO9 B;  4CCM A;  4BPZ A;  2GN3 A;  4PIX A;  5F6L B;  1HRV 3;  1Q8V A;  1SG3 A;  1RUG 2;  4BLI A;  4Q4X 2;  4YNI A;  5IAT A;  4JRA A;  1FYU A;  1LGN A;  4YPJ A;  2Q8C A;  1PGW 2;  5FMC A;  4LUL A;  4BQX A;  1RHI 2;  2XB6 C;  1XC6 A;  2G1M A;  2ARE A;  3AZX A;  4EV0 A;  1PHM A;  3ZVX A;  1K42 A;  2CGO A;  1XYN A;  2Q0A A;  1AR9 3;  3PHM A;  3FBY A;  2VMH A;  4JC1 A;  4KG0 A;  4XXP A;  3KSC A;  3WNK A;  1S2K A;  4N90 A;  1AL2 2;  3ZXJ A;  1GYK A;  2WLP A;  2W47 A;  1DYP A;  4HBN A;  3U37 A;  4IEV A;  3NV3 A;  2ORX A;  3K75 B;  3WXP A;  1C5I A;  2DBI A;  1UY3 A;  2J1U A;  4MXW B;  3RYP A;  1CAV A;  2A3W A;  4N53 C;  4UT5 A;  3OUI A;  5LY1 A;  2C0Z A;  4XIL A;  4CEY B;  1GSL A;  4XW3 A;  1W6M A;  3KV6 A;  5GKA C;  5C5U A;  3O1O A;  3ZN6 A;  3SKJ E;  4D94 A;  4LTA A;  1AYN 1;  2XGX A;  2IC1 A;  4QHZ A;  1V6O A;  4FPY A;  4E8C A;  2I07 B;  4ARX A;  5F37 A;  3DPR B;  5FQ0 A;  1CPM A;  1NYW A;  2UY8 A;  2WIN B;  3DKW A;  1ULE A;  2B46 X;  2VCB A;  2YYO A;  2ZEY A;  3OUH A;  4GWN A;  3QH7 A;  2XVL A;  3ZPY A;  1GOH A;  1W03 A;  3NJY A;  4NO4 A;  1ULO A;  3VL8 A;  1WLW A;  5A6Q A;  4L0P A;  1EAH 2;  5L73 A;  2IXK A;  1OA4 A;  2YBK A;  4EWA A;  1ASJ 3;  1MVE A;  3T0B A;  4QWN A;  4OUM A;  4E2S A;  1AX1 A;  3C8X A;  1ND2 C;  1RGS A;  5BY5 A;  2W1Q A;  3E5U A;  4R9A A;  4XJW A;  4FBF A;  1PIV 1;  4XUN A;  2ADD A;  2E7Q A;  4B7E A;  4AQS A;  1R1A 1;  2Q1Z B;  2ZBJ A;  4JCK A;  3VKM A;  2ID4 A;  2XUM A;  3R0R A;  1OF3 A;  4AGR A;  5EFU A;  1UXZ A;  3O1V A;  2IZW A;  4F83 A;  4N53 B;  1JOB A;  3RFR A;  2ATF A;  2BU9 A;  1DBN A;  1US3 A;  3GCW A;  4AK3 A;  5AVP A;  2BER A;  1VRH 2;  4GJY A;  3WDX A;  1DP0 A;  4HKO A;  5FJH A;  2B9U A;  1HB2 A;  1TME 2;  4TLF A;  5FZA A;  4DY3 A;  1YQ5 A;  3I2H A;  4UF0 B;  4XJ9 A;  2NMN A;  5F9T A;  4IUG A;  1W9T A;  1PGL 1;  2Z79 A;  1AR8 3;  3JQX A;  4J25 A;  5CEH A;  1PNG A;  3E97 A;  1QQP 2;  4O9G A;  4K20 A;  4C90 A;  5F5I A;  4YW6 A;  3I3D A;  5IW0 A;  4XJA A;  1CVN A;  3AXE A;  1HLC A;  3M7A A;  3P5B A;  4XET A;  2DUO A;  3H7J A;  1H2K A;  3ST7 A;  3UKN A;  3JXS A;  1ULC A;  1W9F A;  3ZXL A;  1LU2 A;  5FZM A;  1ZZC A;  2D7F A;  1RUH 2;  4QXK A;  3IDA A;  1PZ8 A;  4RN5 A;  3VHN A;  4BQ5 A;  1WKY A;  1VJ2 A;  2YPJ A;  2R04 1;  3PVE A;  3BVC A;  4COY A;  1SHW B;  3AM2 A;  3GNE A;  3I2I A;  5FY9 A;  1HW5 A;  1N3Q A;  1ZZB A;  5CNA A;  4Y1Y A;  4AAX A;  2YC2 A;  2VQ0 A;  4E4S A;  4IGO A;  2JG9 A;  3N4M A;  3EMR A;  5A3O A;  2Z69 A;  5ACA 3;  5A3U A;  3UJO A;  1OHF A;  1C8M 1;  1YJK A;  2WLQ A;  2ZHN A;  4DRR A;  2W87 A;  2RS1 1;  2G9Z A;  1Q43 A;  1YFU A;  4CDW A;  1DYO A;  4QPG C;  4LA3 A;  2Q8O A;  2RS3 2;  3KCY A;  4YW7 A;  4COZ A;  3ELN A;  2D40 A;  2ZGO A;  5C3S A;  4XOG A;  2G4I A;  5IK8 A;  4K9S A;  1XB9 A;  3CNA A;  5T5L A;  4MHU A;  3ZFF A;  2R30 A;  4AVA A;  1O6U A;  1W6O A;  3LZZ A;  4JQT A;  4R9D A;  4W6X A;  4CCL A;  3RZL A;  1NT0 A;  2BWC A;  3I2F A;  3PLQ A;  5B4X A;  1DGR A;  1Q8P A;  3I7D A;  1LES A;  3PVO A;  3VBO A;  3RJ2 X;  5EQU A;  4QPI C;  1AR7 3;  2H0V A;  1CES A;  1H8V A;  2UY9 A;  1AX2 A;  4XMI A;  5KR7 A;  4FFG A;  1IPS A;  1CR7 A;  4LOR A;  3MDP A;  2RDN A;  3WDY A;  2PMW B;  5C3Q A;  3NMB A;  1W8F A;  2RVA A;  3KQR A;  5C4W C;  3N9P A;  1W8Z A;  3LEG A;  4Q27 A;  1W6P B;  2GH2 A;  2BFU L;  2YXS A;  2PLV 2;  3C7O A;  5FKB A;  2QDR A;  1S55 A;  2HWD 3;  5LA2 A;  4NIA A;  3NNL A;  1GQG A;  1Q56 A;  2C26 A;  4AEJ A;  4AR2 A;  1H6X A;  3POS A;  2VZV A;  4MV2 A;  4SLI A;  2QE3 A;  2DYC A;  1ZBA 3;  4YGD A;  5A33 B;  5T5J A;  1OXC A;  3BTY A;  5CFD C;  4QPG B;  4OUE A;  4OZX A;  3AJZ A;  2Y60 A;  2C6S A;  1IS4 A;  5KWR A;  2WZE A;  2Z5W A;  1YQ6 A;  1V9U 1;  4Q4Y 3;  5A6Y A;  3RQ0 A;  4GKX A;  2WII B;  1ODM A;  3JBG 1;  3AMH A;  2VE1 A;  3WF0 A;  4C1X A;  4RYD A;  3OYW B;  2X09 A;  2HYK A;  3IBM A;  3NV1 A;  3SLI A;  2D3S A;  3B5L B;  3LDK A;  2A75 A;  4Z92 B;  3O1U A;  2RE9 A;  4A7K A;  2KD7 A;  4AHW A;  5A3T A;  1JOD A;  1W6Q B;  1UOG A;  2BGP A;  4LK7 A;  3VB9 A;  3JD7 3;  1RIR A;  5FXW A;  4AFD A;  1GWK A;  2YU1 A;  4QPI B;  3D82 A;  3LQC A;  4CDQ A;  3M70 A;  2A6Y A;  2WAO A;  3CF6 E;  3WNO A;  2BV4 A;  3PTY A;  5L9V A;  1WMX A;  2DVA A;  1ZZ6 A;  3III A;  4E27 A;  5C4W B;  4OMD A;  2PAM A;  3RMX A;  1O3T A;  4PDW A;  2W5F A;  2AEZ A;  3TN9 2;  2YU2 A;  1JHN A;  3MW3 A;  4LHS A;  5LK5 A;  3ENR A;  5FZ4 A;  3W20 A;  5FLI A;  1LAJ A;  4F7Z A;  1F31 A;  1W8T A;  2YZ4 A;  1U5X A;  1CON A;  4PF5 A;  1CX4 A;  1JW6 A;  3C2U A;  4HMZ A;  5FWE A;  1UPI A;  5C7G A;  3U1X A;  5CFD B;  4OHY A;  2BOJ A;  1VAL A;  2J22 A;  4MGI E;  4RR3 C;  2WL1 A;  2D3R A;  4K8F A;  4M3C B;  5I0U A;  2BEO A;  3RDI A;  3AC0 A;  2HWC 2;  1GV9 A;  4L99 A;  4QDQ A;  3IDB B;  1S0C A;  4HKL A;  3H1M A;  5LB6 A;  4AVV A;  2PFW A;  2YBP A;  2HYX A;  1E5R A;  5IFP A;  1TMF 3;  4QQL A;  2FDI A;  4BWO A;  1Y9Q A;  1QMJ A;  4HPK A;  3VDC A;  3OPZ A;  3P6B A;  3FHI B;  1RVF 2;  3VBU C;  2RDQ A;  1AX0 A;  1NZI A;  1XOY A;  3ZYP A;  1AYM 3;  3FMG A;  2CL2 A;  2DVD A;  1UCX A;  4LIV A;  4XBN A;  1RJ7 A;  1R08 2;  1K5J A;  4FPO B;  4MH0 E;  4QXC A;  1RUN A;  4P9Y A;  5EHD A;  3C7G A;  3JB4 C;  4PLO A;  2WUH A;  3DUI A;  5CVR A;  5CG9 A;  1AXY A;  1V00 A;  1VIW B;  2X5I A;  4QDS A;  4AZZ A;  4PIZ A;  4BYY A;  5K8S A;  3WF4 A;  1RJ8 A;  3EHK A;  5B4N A;  4FQ4 A;  1FV2 A;  2H6C A;  4UFH A;  4NID A;  3ES1 A;  3J7L A;  1A8D A;  2JDU A;  4LO8 A;  2RDS A;  4XUP A;  3WOG A;  4P9G A;  1N1T A;  3MLJ A;  1QXP A;  1JTZ X;  2G9G A;  3NJZ A;  1WLC A;  2JG8 C;  1PK6 A;  2WFF 2;  1S2B A;  1Y4W A;  4I01 A;  1UW8 A;  1QJY 1;  1V6I A;  1XJA A;  1LTE A;  4XF3 A;  4NIG A;  2VNR A;  1HV0 A;  1FOD 2;  1O5L A;  2CY6 A;  2VCM A;  1LHU A;  2DFB A;  3JU9 A;  4BIO A;  4EN7 B;  5CAZ A;  4IQP A;  3CIH A;  1JU4 A;  1O4T A;  2MPF A;  2VW0 A;  3B00 A;  5IUQ A;  5AFE A;  1LKN A;  5LA9 A;  5CFC C;  4G4F A;  1PIV 3;  1W0N A;  4W4Z A;  1NA1 A;  1W39 A;  2VZR A;  3VBU B;  2P3J A;  4CPB A;  4AEK A;  1VBC 1;  3WNM A;  4JGZ C;  4Y5S A;  5FR3 A;  3POY A;  1CIY A;  1QOS A;  3AL6 A;  3UNP A;  3VD4 A;  2P6H A;  4H55 A;  1JZ2 A;  2X8K A;  1DLL A;  2PHL A;  3AVS A;  4M4R A;  1SBE A;  5GLU A;  3MHZ A;  1GP5 A;  1ULD A;  2GME A;  2SBA A;  4GXL A;  4A44 A;  3R4D B;  1R09 2;  4TWT A;  4YYO A;  3WDU A;  4DQA A;  4YW3 A;  4H2A A;  1ZX5 A;  2LAL A;  4HK9 A;  1EPW A;  4YFW A;  3FZ3 A;  4QX1 A;  4XDO A;  2JKB A;  5JXI A;  5BYN A;  4CP9 B;  3MEP A;  2ZAH A;  1EAH 3;  1EV1 2;  4BXF A;  5LY2 A;  5FOB B;  3I2J A;  2E32 A;  5TSW A;  1KD7 A;  2P5B A;  5CB7 A;  1OQ1 A;  1PGS A;  3M8L A;  2JG8 B;  1YUD A;  4N7U A;  2WSV A;  4OCT A;  3SC7 X;  3K3O A;  3RPQ A;  4GKY A;  1KDK A;  3LPG A;  1YFW A;  1BBT 1;  3CJI A;  1JU3 A;  4KL1 A;  1PO2 1;  2JDN A;  4QX3 A;  2WZR 2;  3M2M A;  4Q1P A;  2BJS A;  2R04 3;  1HRI 1;  1KS4 A;  4IND A;  3CU7 A;  3D5O A;  3GJB A;  4XEZ A;  3ZXD A;  4OZO A;  5JDB A;  1C57 A;  3VBH A;  3IDC B;  2K0G A;  4QMA A;  2VW2 A;  4AF9 A;  2G9F A;  3O14 A;  5JOY A;  1PVC 1;  2VZ1 A;  1VRH 3;  2ORZ A;  4Y4R A;  3UKV A;  3T0D A;  1MS0 A;  3O5S A;  4HN0 A;  4JAA A;  3TOJ A;  2CWS A;  3P3P A;  5CIR A;  5T55 A;  2RS1 3;  4Y4Y A;  5FMB A;  5FZ7 A;  4HXC A;  1DIW A;  1XNA A;  2XBO 2;  5IWF A;  1YI9 A;  1U5Z A;  1W8N A;  1E5H A;  1VBA 2;  3HJR A;  3MGU A;  3HWJ A;  3LSD A;  4LBK A;  1FI2 A;  4MXV A;  2ARC A;  4JVA A;  3U10 A;  4Q29 A;  1RUI 2;  5T54 A;  3KVB A;  2BZD A;  1IG0 A;  1VBE 2;  4BK4 A;  4LE3 A;  3MBW A;  3MO4 A;  1JYT A;  2XWJ B;  1IOA A;  4QU2 A;  4QXH A;  1WLT A;  2DBN A;  4MSV A;  3IT8 A;  3QAC A;  1NOV A;  2QQU A;  3MV0 1;  1UY2 A;  5JPM B;  1CGP A;  5CKQ A;  2JB8 A;  5A7Q A;  1P8J A;  1LED A;  1KEX A;  2Y34 A;  3KT4 A;  3Q8F A;  5JIA A;  3VHO A;  3NW4 A;  3PJQ A;  4NRP A;  2EIC A;  2VG9 A;  2OZ6 A;  2VU9 A;  2WA3 A;  4CP0 A;  3UYJ A;  2TNF A;  2PQS A;  4LUM A;  1L7Q A;  2WN2 A;  3MIF A;  2HWB 2;  2Q8D A;  1D2S A;  1KJL A;  1QJU 2;  3WUC A;  4FTE A;  2FHR A;  2D5H A;  1DQ1 A;  1POV 1;  2BNM A;  2BDR A;  1LB2 A;  2ET1 A;  4Y33 A;  2A5Z A;  5DZE A;  3VKF C;  1GUI A;  4NMI A;  1OPM A;  3N7K A;  5L9B A;  5FMD A;  3WT3 A;  1CAV B;  4NPL A;  5IK4 A;  2NPI A;  4Z1V A;  3VBF C;  4XDQ A;  1W99 A;  1MS5 A;  4R4X A;  1W6M B;  4WVM A;  4DXS A;  2FMD A;  2XUE A;  4RGG A;  3MLK A;  1F2N A;  2IXC A;  3ZN6 B;  1X9T A;  2GNT A;  3WF2 A;  4X8N A;  4D6Q A;  1KIT A;  1SLA A;  2FCT A;  4FTS A;  4NII A;  5I0R A;  4YGB A;  1MZ6 A;  1ZRI A;  1DGL A;  3OD4 A;  4FCA A;  4OMC A;  4A2U A;  4MHR A;  5FQ0 B;  2JDK A;  2RMU 1;  2K46 A;  3JBG 3;  3POB A;  1WMD A;  4P08 A;  1GOF A;  5FZK A;  5GZG A;  1H1M A;  1LHV A;  2JDH A;  3C7F A;  5L9R A;  4FXG B;  2ZGM A;  1QF3 A;  4LHN A;  3VDD A;  2ZGR A;  1NCR A;  1YWK A;  1JOJ A;  2VBB A;  2E26 A;  5HPO A;  5L19 A;  5T50 A;  3BUC A;  2FDK A;  2D6O X;  1LU1 A;  2W9X A;  3Q8A A;  3PIJ A;  1GWM A;  4DXZ A;  1VP6 A;  2W94 A;  3I2D A;  2IFR A;  1PO1 1;  4IV1 A;  4ASM B;  1CIW A;  2ZGN A;  4XBL A;  3I97 A;  1JYN A;  3ACG A;  1O5U A;  2B45 X;  2RM2 1;  2XJT A;  2JG9 C;  4FOQ A;  1YO8 A;  1FMD 2;  3KHB A;  1XE7 A;  1VMH A;  3B93 A;  3CL1 A;  4IGQ A;  3Q8B A;  3O1R A;  1RUE 1;  4MOA A;  4BH9 A;  4CDW C;  5FPB A;  1V6J A;  1DFQ A;  4HN1 A;  5EYY A;  1RIT A;  3ZPO A;  3R6S A;  3FWE A;  3MF9 A;  2XJR A;  5DUW A;  5F3C A;  3I59 A;  5FYM A;  4TTG A;  2G19 A;  3NKG A;  1I3H A;  2R1D A;  4C91 A;  3B01 A;  1ASJ 1;  3TEX A;  1MS3 A;  4IEZ A;  4IE6 A;  3K4Z A;  3ZFF C;  3ZXK A;  1RUF 1;  2Q1M A;  5J37 A;  4UW3 A;  3ZSL A;  2QDN A;  4URA A;  2RR1 2;  2CWM A;  4IET A;  1O4Y A;  3S7I A;  1TG7 A;  1DQ4 A;  3VBO C;  1KGY A;  2ILM A;  2XQR A;  2ZGL A;  1WW4 A;  5BNN C;  2WJS A;  3J8F 1;  1H4H A;  1RB8 G;  3TRS B;  4LBO A;  1WLD A;  4FPC A;  3VDA A;  3ZYF A;  3WP5 A;  5JXH A;  3ZLI A;  1PMJ X;  3L9J T;  5BNP A;  1U0A A;  1ENS A;  1HKD A;  4BQ3 A;  1GFF 2;  4FFH A;  4NUB A;  1OQD A;  3USS A;  1Q3E A;  2HWF 3;  5LK7 B;  1HQL A;  1QWR A;  1SZB A;  1IHM A;  5DG2 A;  2JG9 B;  4B1L A;  3RZG A;  2ZZQ A;  1C1L A;  4Q0Q A;  2ARA A;  2W1U A;  1YQ8 A;  5AVA A;  1AR8 1;  3OG2 A;  2P6C A;  3AYC A;  3PMS A;  1S0G A;  2JDM A;  1DZT A;  3FFQ A;  2ZGS A;  4LKE A;  2RS5 2;  4CDW B;  3DYO A;  4LLO A;  5DDJ 2;  4AI3 A;  2VZT A;  4F3J A;  3ON7 A;  3ASI A;  3VZO A;  3CO2 A;  5M0T A;  4PI2 A;  4HVQ A;  4FPG A;  5JAX A;  3ZKU A;  3H9A A;  1E57 A;  1WD4 A;  4TSV A;  4JV4 A;  4DNY A;  5LEK A;  3MFA A;  3U75 A;  3ZFF B;  1WW7 A;  4TYS A;  4YVS A;  1W6O B;  3UJQ A;  3H3L A;  4NHX A;  5F8P A;  2ZKN A;  1OQE A;  2UYB A;  4LLF A;  5AC9 1;  1R08 3;  3VBO B;  2A70 A;  4ATF A;  2WO2 A;  4BB3 A;  4BIF A;  4OI2 A;  2VNO A;  4CDQ C;  1Z7S 2;  4CCE A;  2R0H A;  1VBC 3;  3LEI A;  4JQR A;  3OCP A;  1Q8S A;  4MGQ A;  4AQ6 A;  1XSQ A;  3BCW A;  2ZX0 A;  1SFN A;  2W68 A;  2CYF A;  3VD9 A;  1MAC A;  5KBF A;  4I0W B;  3THP A;  4PDW C;  1CJP A;  3OUJ A;  5I0S A;  4MO3 M;  1RUC 1;  3WD5 A;  5FYI A;  5A1A A;  1W2O A;  1ZA4 A;  4Q0S A;  3E6B A;  4N43 A;  3GXU A;  2DCY A;  4WV8 A;  2HWE 1;  1NY7 1;  1O4Z A;  2WFF 3;  3ROU A;  2LM3 A;  4LMF A;  2LW8 A;  2AEY A;  1BK1 A;  3KVA A;  4IV3 A;  4P9J A;  2J1T A;  3BOP A;  1KS5 A;  2JIC A;  4CDU A;  1AR7 1;  4CXW A;  4YZ2 A;  1JYV A;  5LAS A;  1MS9 A;  3ZYH A;  2P2K A;  2IUW A;  5HV0 A;  3BTZ A;  4QQO A;  4FPF A;  1BBT 3;  3T4H B;  1QIQ A;  3GF6 A;  1Q8Q A;  1QDO A;  2VR4 A;  3F95 A;  4NPM A;  1JYW A;  3KQ4 B;  2WQ4 A;  3ZYJ B;  4XBQ A;  4FP2 A;  4NWW A;  4IE4 A;  1OD5 A;  4PJY A;  5FXV A;  5F7U A;  2LRP A;  2FBE A;  3PVN A;  3T3Y A;  5LBC A;  1VB4 A;  4B4Q A;  1R09 3;  4CDQ B;  2ET7 A;  5DAW A;  2KA3 A;  4AI0 A;  3LAG A;  4GUL A;  2OT7 A;  2PHX A;  4IES A;  1A34 A;  4OI1 A;  1DQ2 A;  1ZBA 1;  3DKQ A;  1EPZ A;  4HOO A;  3WEZ A;  4LBQ D;  1LEN A;  4DIQ A;  3JZV A;  4IDZ A;  1DYK A;  5HV4 A;  3VD7 A;  1HX6 A;  2Q30 A;  2QBX A;  2X05 A;  4PDW B;  1NZC A;  3WP4 A;  5C8C A;  2X5I C;  1UYZ A;  2YC0 A;  3FLR A;  4XUQ A;  4BM8 A;  4XCA A;  1W2N A;  4QXB A;  5KC5 A;  5FYC A;  2DF7 A;  1UZW A;  3H8U A;  4MGK E;  2DCJ A;  5BNO A;  2CU5 A;  1PK6 C;  2EIG A;  1OVP A;  2B4K A;  1OC1 A;  2WZR 3;  4WVZ A;  2DVB A;  4K3U A;  1BYH A;  2VPV A;  4MZU A;  1WME A;  3SEP A;  5EP9 A;  4ES8 A;  1G9A A;  1TQ5 A;  2HEW F;  4LBN A;  4KG8 A;  3FX3 A;  2PXJ A;  4EWE A;  2WWJ A;  3H3U A;  2XPJ A;  1S0I A;  1UYX A;  1VBD 2;  1IQA A;  4OYU A;  2WKK A;  1COV 1;  1RUJ 1;  2A73 B;  3LOI A;  3NRU A;  4HPK B;  5CAD A;  3AZY A;  3LD8 A;  1NA1 C;  3DXU A;  1OUS A;  1SFY A;  1JMU B;  3CZU A;  2WBK A;  3DN7 A;  4AED A;  3VHP A;  3IAQ A;  2R06 1;  4XUT A;  1BLZ A;  1RUI 3;  3ETQ A;  3MUY 1;  2WS9 1;  3KF5 A;  1WW6 A;  2E33 A;  4D7Y A;  1MPX A;  2FZ1 A;  4URT A;  2GN7 A;  2MHF A;  2D6K A;  3KMH A;  4GQ7 A;  3VKN A;  1JOP A;  1BVP 1;  1MZF A;  1RYY A;  1YIP A;  4NJ4 A;  2X5I B;  4Q5O A;  1UY0 A;  5A7W A;  3USU A;  1TMF 1;  3BU7 A;  2JDP A;  2QNK A;  5JI7 A;  1ULG A;  2RMU 3;  4ZY9 A;  1ULP A;  1AR6 2;  5FRA A;  5FZF A;  1DHK B;  1VMF A;  4L92 A;  2ZMK A;  1PK6 B;  1AYM 1;  1QJU 3;  4Q4V 2;  1VPH A;  1W06 A;  2PN5 A;  3E1F 1;  3CJI C;  2E31 A;  4QKB A;  2QUO A;  5C5T A;  1GIC A;  3NV2 A;  2HH9 A;  2O8Q A;  1DG6 A;  2XVG A;  5FZ9 A;  4GB3 2;  1OH4 A;  4MGS A;  2J7M A;  5DQ0 A;  2OPK A;  1PO1 3;  3IM0 A;  3K46 A;  3O0V A;  2XQX A;  2YUE A;  2YDE A;  1RUG 1;  1L7L A;  3M3C A;  4Q4X 1;  3VBH C;  1WCK A;  2RM2 3;  2VXR A;  1NA1 B;  3BI3 A;  1QJX 2;  1XE0 A;  1PGW 1;  1W04 A;  3B9C A;  1RHI 1;  2L9L A;  2PAE A;  1RUE 3;  1OFS A;  2VNV A;  2DTW A;  5H9S A;  3ZMO A;  3UGH A;  1AL2 1;  2P3I A;  1POV 0;  1UZZ A;  5LBE A;  2ZAC A;  3S0M A;  4XYX A;  1T2X A;  2B39 A;  1JZ6 A;  5FP3 A;  4EE2 A;  4YW1 A;  3AKQ A;  3RZM A;  3QCW A;  1JHJ A;  1H9W A;  4RHV 3;  1FAY A;  1QXR A;  1DZQ A;  1GLH A;  1R1A 2;  1RUF 3;  1WBL A;  4CP2 A;  2QQL A;  3MZH A;  3VZJ A;  5C6C A;  3AP7 A;  4O9E A;  2ZJC A;  5LWB A;  3O1S A;  4MUV A;  4AXO A;  4QB1 A;  4Z8B A;  4FP3 A;  4XFG A;  1F8V A;  4CCC A;  2XML A;  3J8F 3;  4JTO A;  4NVP A;  2MEV 2;  1UZ0 A;  1W0O A;  1FMD 3;  3CJI B;  3HIF A;  3M3Q A;  4D6S A;  3E6C C;  1ODN A;  3UGF A;  3AKS A;  4BE3 A;  4YSF A;  5FPX A;  2BQP A;  1ND3 A;  4QD2 A;  3UKT A;  1JZ4 A;  3SEE A;  1HDK A;  4ZS2 A;  5ANQ A;  3B3Q E;  3VBH B;  2TUN A;  4V1P A;  4HLT A;  3T2Q A;  1Y9M A;  4UW4 A;  5JI9 A;  2BVB A;  1UOF A;  3ZKY A;  5FDB A;  1EAH 1;  4LR4 A;  3NNG A;  2E7A A;  1Y3T A;  4BQ4 A;  2Y6G A;  4HKW A;  4E2G A;  5JR2 A;  5ANN A;  3ETP A;  5FK7 A;  4FPJ A;  3KWV A;  3VKL A;  5DAX A;  2PAK A;  3CKH A;  3GBW A;  4IEP A;  2VQA A;  2BUK A;  2D3P A;  3HN3 A;  3ZN4 A;  1BQP A;  1FXZ A;  5FV3 A;  1GWL A;  3AMQ A;  5FRE A;  4CU8 A;  2P3K A;  2QCS B;  5LCW L;  5FY7 A;  1QHD A;  4M00 A;  4S2D A;  5FBZ A;  4AFC A;  5IK7 A;  4PQ9 A;  1GQP A;  3VDD C;  3DV8 A;  1IKQ A;  1NCR C;  1UOJ A;  1WCQ A;  5AC9 3;  5K9Y A;  4LBJ A;  1MQT A;  2YB7 A;  3GZE A;  2FCU A;  1VRH 1;  3NV4 A;  3B69 A;  5DAQ A;  4ZS3 A;  5JSP A;  1XNT A;  1H8T A;  2OXB A;  2YPD A;  3J7M A;  4COU A;  2E7T A;  1SBF A;  1C4R A;  4HET A;  3H0O A;  2BGO A;  4IV1 C;  3SCF A;  2J42 A;  3OGJ A;  2W46 A;  2XL7 A;  2AH2 A;  4YG0 A;  1OUR A;  4DY5 A;  2WFP A;  3TNQ A;  3BTA A;  4LOS A;  3AMM A;  1QQP 1;  3GHN A;  4ERO A;  4S2H A;  1K12 A;  2H6B A;  2XJV A;  5GZD A;  5FZ6 A;  3N7J A;  4O61 A;  2PHF A;  2VME A;  1RUC 3;  1LHW A;  5FLH A;  2SLI A;  3VD5 A;  1UIJ A;  2NM1 A;  1RUH 1;  2HWE 3;  1VAK A;  3ACF A;  3FHQ A;  1OVS A;  4RS5 A;  4ATE A;  3WNX A;  3I3B A;  4WVM B;  4OQ9 A;  2EAK A;  2TBV A;  3PME A;  2P3Y A;  4N7I A;  3DEC A;  1RC6 A;  4UW5 A;  3WQ1 A;  2CNA A;  4D69 A;  2JE8 A;  3T0A A;  3M4F A;  5FYY A;  4AW7 A;  4DEQ A;  2VZQ A;  1AVB A;  3LE0 A;  1Z7S 3;  1YJL A;  4DUV A;  5FZH A;  3NVC A;  3PUS A;  4YW5 A;  3VDD B;  3CZJ A;  1NCR B;  4G3Y C;  4O65 A;  5DAB A;  3IIA A;  5A1L A;  3S5A A;  3AFK A;  1WW5 A;  3OGG A;  4J1W A;  2VTX J;  4QGM A;  3VDB A;  4Q26 A;  4DUW A;  3LF7 A;  2ES3 A;  5LA1 A;  5FXZ A;  3NAP A;  2ZS6 B;  3PU3 A;  2Q4S A;  5BNP C;  5BPX A;  4D8M A;  3DXT A;  4I0A A;  2ARB A;  4IV1 B;  4L9B A;  4PHZ A;  4UOJ A;  3BYW A;  4EZ4 A;  4XPV A;  1BMV 2;  3GBG A;  4AQ2 A;  3CBN A;  1AHS A;  2Y6F A;  2IVJ A;  5EWS A;  4Y20 A;  3THT A;  1JYX A;  4XE9 A;  5IT6 A;  1GQH A;  4UFL A;  1KXG A;  3C7H A;  3GGL A;  1IQD C;  3HQX A;  1XXN A;  1QDC A;  3A4U A;  4LO5 B;  4LKF A;  4K1Z A;  4QX5 A;  1TVG A;  3ZYI B;  4A6O A;  4ARY A;  3NO8 A;  1S0B A;  2ZGP A;  2JDZ A;  3VN4 A;  2VMF A;  4LT5 A;  1RUD 2;  1SPP A;  3N3H A;  4GZ9 A;  3W21 A;  4Z2W A;  2JE7 A;  3I59 B;  4W6W A;  1H1I A;  4YG6 A;  3KHC A;  3B02 A;  4E2Q A;  3IWZ A;  2CGN A;  3UGG A;  3VUO A;  1NKG A;  3VKO A;  2VZO A;  3ILF A;  5T5P A;  1W8O A;  3OPW A;  2GNM A;  5C3P A;  1HV1 A;  1W05 A;  3ES4 A;  3O0W A;  2ZA9 A;  4I02 A;  1JZ5 A;  3V64 A;  4YM1 A;  5FPZ A;  3H7Y A;  1RMU 2;  4Q2F A;  3KD4 A;  1COV 3;  1RUJ 3;  1UKR A;  3FE5 A;  4QGL A;  1WGP A;  4B8E A;  2WNU A;  3NQH A;  1K3I A;  2QQI A;  2JIJ A;  4TLG A;  3POW A;  2YG0 A;  2FDJ A;  3D6E A;  3EXU A;  4EN9 B;  2AC1 A;  4JTN A;  2WR9 A;  2R06 3;  3ZN5 A;  5BNP B;  1J84 A;  4IGP A;  4HON A;  5FY5 A;  1IS3 A;  3RNS A;  3URF A;  2AEN A;  2WS9 3;  1JUH A;  1NXM A;  3AP4 A;  1PMH X;  5HI0 A;  2K2S A;  1DZR A;  5J98 B;  4EN8 B;  2Z2S B;  5FAX A;  2DV9 A;  4AI1 A;  3KGL A;  5FMO S;  1JI6 A;  2XON A;  1S0J A;  5FZ3 A;  5DUU A;  3ABZ A;  5DMY A;  3NNF A;  3V56 A;  1EY2 A;  2W92 A;  5DAV A;  4XDP A;  4IV3 C;  4YZ4 A;  2EF6 A;  1UQX A;  2WO7 A;  2EAL A;  5F5Q A;  1W9S A;  2YBS A;  1GOG A;  3OBR A;  4P00 B;  3T1M A;  1MEC 2;  5FZ1 A;  4IE0 A;  1NE4 A;  2D44 A;  4CUA A;  5C3R A;  1MR5 A;  4HL0 A;  5FZ8 A;  2D43 A;  1A8M A;  2RV9 A;  4YVW A;  1KJR A;  3WSO A;  4XZU G;  4K8R B;  1LOF A;  3BGA A;  3TN9 1;  2Y0O A;  3ZXF A;  4YVS B;  2VVD A;  2C1F A;  2R32 A;  2N7G A;  2HWF 1;  3AK0 A;  2NP0 A;  4XF4 A;  4ZXE A;  5JVV A;  1YCI A;  5JOZ A;  2ZTN A;  5IVB A;  1RUG 3;  4Q4X 3;  4YLZ A;  2AZ5 A;  4YGC A;  3AP9 A;  5FP9 A;  5A3M A;  5J3U A;  1S4C A;  2WWS A;  3HR9 A;  1XSR A;  2GC3 A;  2OII A;  3UES A;  2Y6H A;  3I54 A;  2C9A A;  3M3I A;  5FUN A;  1RHI 3;  5A3N A;  2HWC 1;  3WW3 A;  3ZSK A;  2VH9 A;  1YLL A;  5GJ6 A;  1GP4 A;  5E89 A;  2BW8 A;  4D3W A;  3IDE A;  3K4D A;  1UYY A;  4IEW A;  4FSJ A;  1BCX A;  3AKP A;  1ZBE 2;  1UWW A;  1CD3 G;  3KM5 A;  1PM4 A;  1AL2 3;  5C8C C;  1WCU A;  1BKZ A;  1U5Y A;  1IGO A;  1WA6 X;  2A6Z A;  4DO0 A;  3TEW A;  4N43 B;  4AVC A;  5C71 A;  3T2P A;  1VBB 2;  4A7Z A;  3WG4 A;  5FOJ B;  2BTV C;  4P9X A;  3WV6 A;  4Q4V 3;  3HQR A;  1CWP A;  2CGP A;  3WY6 A;  1C5H A;  3TEZ A;  2B5H A;  1X7N A;  1OKO A;  1R08 1;  1T6B X;  3DYP A;  3P1I A;  4IV3 B;  4Z2A A;  5BNO C;  4CDU B;  1OSG A;  5D1I A;  1N1S A;  4W8J A;  2EAA A;  4KWK A;  4FPE A;  5J09 A;  3E6D A;  3S7E A;  1HQW A;  1K5M A;  2XXZ A;  1GZW A;  2OS2 A;  2YRO A;  4ZU4 A;  5KXE A;  1OD3 A;  2WC2 A;  2HKX A;  2BPA 2;  4KNC A;  1E5S A;  1NG0 A;  1FPN 2;  3K48 A;  5A7P A;  5HCH A;  4QX0 A;  5FY1 A;  1QY4 A;  1YHF A;  4XAC A;  3PTR B;  3H42 B;  1DF0 A;  1MZE A;  5LBB A;  3OEA A;  2ZGQ A;  1A78 A;  2WFF 1;  2YY1 A;  2VGD A;  5EJ1 B;  5LZ6 A;  4WM7 A;  1FT9 A;  3NJV A;  1GP6 A;  4QPW A;  5E8A A;  1FV3 A;  3J7H A;  4A42 A;  1QEX A;  2DCK A;  3LEK A;  1TEI A;  1AJO A;  1WWY A;  2JX9 A;  3C3V A;  4NOT A;  1NUK A;  1GNZ A;  1VAV A;  3OOX A;  5C8C B;  3JUU A;  2X29 A;  4Y24 A;  4ZKT B;  1ZVF A;  2QQO A;  5FO8 B;  5JXG A;  4CSW A;  2A1X A;  4JZR A;  1G9D A;  4ZON A;  2JWP A;  2FQP A;  2WNE A;  2EXH A;  3VBS A;  1FNY A;  5A7N A;  3U11 A;  1UAI A;  5BNO B;  5FZE A;  4UFK A;  4XQD A;  2RJK A;  4PCR A;  3RYR A;  2GDF A;  1R09 1;  3KZ4 C;  1F9K A;  1ZRR A;  4JRL A;  1BEV 2;  4IE7 A;  4UWD A;  2QQK A;  3VBR A;  4LA2 A;  4LHK A;  4XFC A;  4S2F A;  1TME 3;  1UN1 A;  1IS6 A;  2VQT A;  3WDT A;  3V0B A;  3VL9 A;  5IHR A;  1ZM1 A;  2ZEW A;  1EV1 1;  4K40 A;  5FK8 A;  3IMN A;  4GD4 A;  2DU1 A;  1QQP 3;  4LEJ A;  3I8T A;  2V4V A;  3FN9 A;  4N53 A;  4EJR A;  1UOB A;  3ZYG A;  1EP0 A;  1D0H A;  1CAU A;  1ST8 A;  1W9W A;  3D3A A;  1TNR A;  4WVV A;  1PX3 A;  2OYZ A;  1IPK A;  2IVI B;  1RUH 3;  5EPA A;  3T2T A;  5IJR A;  2WZR 1;  3I49 A;  4XHB A;  1AXK A;  2FDF A;  4DEV A;  1LOG A;  3F2Z A;  2GH8 A;  3MIB A;  5HBA A;  3GCX A;  3UT0 A;  2A6V A;  2DCZ A;  5LRR A;  5A7W B;  5SV8 A;  3USU B;  3THC A;  2JB4 A;  3MLL A;  2D6M A;  4P9I A;  4ISR A;  4DFS A;  3PUR A;  1MS4 A;  2HEY F;  5D8A A;  1HRV 2;  1YNA A;  1L7R A;  1AL0 G;  2UUR A;  4LKS A;  4LBQ A;  2XBO 1;  3UET A;  5KXB A;  2D93 A;  1US2 A;  4K21 A;  1H2M A;  1OLR A;  2JD9 A;  1ND2 A;  1VBA 1;  2RS3 3;  2FDH A;  2WO3 A;  1OF4 A;  4UW6 A;  3HVD A;  1RUI 1;  5A32 A;  1ND3 C;  1AR9 2;  1HN1 A;  3WW2 A;  2ZGU A;  5D2A A;  3IAP A;  1ENQ A;  3UV9 A;  1CPN A;  1H6Y A;  1R1Z A;  3PUH A;  4UFI A;  3NL1 A;  2FMY A;  2ZHK A;  2VTX A;  3AMP A;  2PHW A;  4B7K A;  1DLC A;  5ERL A;  3ZX7 A;  4HK8 A;  5KHJ A;  3IB3 A;  3LEM A;  5G05 L;  1W28 A;  1LOE A;  2PA7 A;  1Y7B A;  3MPP G;  4IER A;  4OVE A;  4J1X A;  4BDV B;  2HWB 1;  5A3W A;  2R16 A;  1YQ2 A;  3FHA A;  1QJU 1;  1X8E A;  3AP6 A;  4FT8 A;  4QQP A;  5F39 A;  1PMI A;  3TBD A;  1UYP A;  4LBM A;  1LOA A;  2V73 A;  3IPV A;  4ASK A;  1H1A A;  2UU8 A;  4KBB A;  4RL7 A;  2PLV 3;  5T5O A;  2VUA A;  1NQD A;  2DUQ A;  4BQ2 A;  1HQN A;  4ZU7 A;  2J1V A;  2JXA A;  3C7E A;  5F3G A;  1WA4 A;  3SQO A;  3T08 A;  5L36 A;  5CA6 A;  2QTW B;  2PEL A;  5LW9 A;  4CU6 A;  4EWD A;  2HBU A;  1H8T C;  1UL9 A;  1XE8 A;  2GMM A;  2R49 A;  1ASJ 2;  4CE8 A;  2UWB A;  1JZ8 A;  4FOW A;  5JIU A;  1ND3 B;  2C24 A;  4KU7 A;  2W08 A;  3BOD A;  3I2K A;  1HB3 A;  5C70 A;  4OUL A;  1RUD 3;  1FX5 A;  1BXH A;  1F5J A;  3MIC A;  4M0N A;  4QHB A;  3RZJ A;  3OSD A;  1KQR A;  2NYY A;  4RHV 1;  4H7L A;  4XFA A;  3SIT A;  4D6R A;  4XF1 A;  4BQ1 A;  4RS5 C;  1O3S A;  3VV1 A;  1NAE A;  2YC4 A;  1SLT A;  1W6N A;  1SEF A;  1UMI A;  1GR3 A;  4Y1V A;  1ZRE A;  5FLJ A;  1NE6 A;  3FLP A;  4MAD A;  1H30 A;  1J83 A;  5JCT A;  2XL9 A;  2WT1 A;  2XWB B;  1B35 A;  1S0E A;  1FMD 1;  3OY8 A;  3SH5 A;  4NN0 A;  3VD3 A;  3TN9 3;  2PQQ A;  5GZE A;  1LRH A;  1DDL A;  1ZZ9 A;  3Q8E A;  2OX0 A;  4XCB A;  2O1Q A;  3THD A;  3ZR5 A;  2DTY A;  2V4A A;  3EJK A;  3HEI A;  1D2Q A;  3RI8 A;  1GNY A;  2JD4 A;  2P4E A;  2VZU A;  2JIG A;  3VHR A;  1HN0 A;  5FIX A;  3NAP C;  1H8T B;  4I30 A;  2VCC A;  5FY4 A;  3RMY A;  4CEW A;  4EN0 A;  2X10 A;  4AI8 A;  4JKK A;  2GP3 A;  2HWC 3;  1C8N A;  3DL3 A;  4H14 A;  2RR1 1;  4A45 A;  4O7X A;  4ES9 A;  2EIB A;  1GZT A;  5D21 A;  4UBG A;  2PHD A;  2Z42 A;  2XKO A;  1PNF A;  3PL0 A;  3WG2 A;  3ATG A;  1MEC 3;  1I5Z A;  1RVF 3;  3K51 A;  2DCT A;  3NNJ A;  3WQ7 A;  4BZ4 A;  5ACA 2;  1WCD J;  5FPL A;  1OA3 A;  3O12 A;  4RS5 B;  5FZO A;  4OHX A;  1NXD 1;  4QDR A;  3I3M A;  1QU0 A;  5JLV A;  1N1V A;  4BLJ A;  1N3P A;  5DXD A;  2ZAB A;  5J96 B;  1O59 A;  2HLE A;  3K3N A;  4NRM A;  5IVV A;  4YZ1 A;  2E63 A;  1MS8 A;  2LRO A;  5CZK A;  1CAX A;  4FAG A;  1G9C A;  5FZG A;  2R07 2;  5GLV A;  3O1P A;  1RTV A;  5FP7 A;  1UXX X;  3EBR A;  3T30 A;  5JZG A;  1QXJ A;  2RS5 1;  2ZGT A;  3RSJ A;  5DDJ 1;  1JN2 P;  1LOB A;  4HZF A;  1VR3 A;  2WNU C;  2PYT A;  4CVU A;  2W0X A;  4D7T A;  3GHM A;  2Q1F A;  3ZYB A;  1ZBE 3;  3ZIX A;  1WZX A;  2VUL A;  4UFM A;  5J36 A;  1CAW A;  1YFX A;  3NAP B;  3T1L A;  2DWR A;  1IKP A;  2D6N A;  2WRA A;  5FFO C;  4JGY A;  1QOT A;  1VBB 3;  1YRZ A;  4QX2 A;  3SIS A;  3CLP A;  4OFG A;  1FOD 3;  4BIS A;  2A3X A;  4E8D A;  3AKT A;  3WNP A;  5HXV A;  2WT0 A;  4Y20 B;  4C0H A;  3H8R A;  4HFS A;  4FFI A;  4QKF A;  5JWP A;  2AGS A;  2HWD 2;  1Z7S 1;  3ILR A;  1F15 A;  1WBF A;  4H7M A;  1OI6 A;  5FYZ A;  1D4M 2;  1SPP B;  4PIY A;  4BOW A;  5CU1 A;  4RR3 A;  5JSR A;  3MFC A;  3ZFG A;  1FPN 3;  1DQ6 A;  1RXG A;  1Y43 B;  4B3N A;  4HVO A;  5FKC A;  2A3Y A;  4YM0 A;  4YVW C;  1O8S A;  3SNM A;  2OQ6 A;  3WG3 A;  5HCF A;  1XNB A;  1LOF C;  4KGG A;  4TN7 A;  1S0F A;  1VAM A;  4Q4Y 2;  1VB2 A;  3BU0 A;  2V5Y A;  1QOO A;  3MPB A;  3PUA A;  1YI7 A;  4JDN A;  4NAO A;  3GAL A;  2PHT A;  2DUP A;  2UWC A;  3SCH A;  4LUK A;  3SHR A;  3UL2 A;  1EV1 3;  2XJS A;  3WW1 A;  3DEM A;  3LA7 A;  3IMM A;  3HPN A;  4QKD A;  2WNU B;  1DGR N;  2IWG B;  4Q0U A;  4V2V A;  4CXX A;  2RJ2 A;  3EYP A;  4XF0 A;  4XFF A;  3JD7 2;  5I91 A;  4GAZ A;  2A7A A;  4D0Q A;  3BIE A;  1NLS A;  2WAB A;  2WNV A;  2D6P A;  1GZC A;  4SBV A;  3Q9O A;  1HXS 2;  1JXN A;  3ZSE A;  1O3Q A;  3N7M A;  1J3R A;  1REE A;  1ZRC A;  1V70 A;  4X6R B;  4X8P A;  5FYB A;  4R8H A;  1IG3 A;  1QJF A;  3MID A;  1SQ4 A;  4OHV A;  5I0T A;  4Q4W 2;  4AFM A;  4JX0 A;  2WDB A;  4Y3O A;  2OPW A;  5EJZ B;  3WF1 A;  3J9S A;  4EYU A;  1BEV 3;  2XOM A;  2O14 A;  4CDX A;  1YFY A;  3SXW A;  4YZ5 A;  3OGR A;  4QQH A;  1HIX A;  4RGK A;  3VGI A;  2K9Z A;  4FOV A;  1C1F A;  3W59 A;  3WR0 A;  3MV1 1;  4MG2 A;  2ZX3 A;  2CV6 A;  2XBO 3;  3O7O A;  3AYA A;  4YVW B;  1LGC A;  5F32 A;  1VBA 3;  5EJ3 A;  3R4S A;  4YGE A;  4X6Q B;  5CFC A;  4I3G A;  1VBE 3;  3LB9 A;  4LJH A;  4XZP A;  1TZO A;  1TMF 2;  2CDO A;  5F3E A;  1BZW A;  2F6B A;  1CN1 A;  1H2N A;  2IXI A;  4EZH A;  5ABJ A;  4JGZ A;  4XJU A;  5L7O A;  1UIK A;  5ISL A;  1W0P A;  1QJE A;  5KC6 A;  2KR2 A;  2H0B A;  5C9A A;  4BJ0 A;  4EQV A;  4KWU A;  4WM7 C;  5FZL A;  5GZF A;  1LEC A;  2GC2 A;  1I6X A;  1O8P A;  3Q8C A;  1X9P A;  3AMN A;  1J1T A;  1UU4 A;  2WZ8 A;  3A0N A;  1ZRD A;  3U14 A;  1W90 A;  3MI8 A;  4HSJ A;  1ZNP A;  3B94 A;  1VBD 1;  4JDM A;  2XG3 A;  4IEY A;  2HWB 3;  5DG1 A;  3ZMN A;  4CCK A;  5AFB A;  4UBH A;  3LKJ A;  4WM8 A;  3KGZ A;  1GU3 A;  3LA3 A;  4BME A;  2VW1 A;  3BB6 A;  2RG4 A;  2Y38 A;  1WD3 A;  2Z4F A;  1AYN 2;  3VBS C;  2VMI A;  4NHM A;  3WVJ A;  1UNB A;  2I45 A;  3POJ A;  2XJP A;  2YGM A;  4QB6 A;  4JHT A;  5CBL A;  1LOD A;  3I3Q A;  5FBJ A;  2WQ8 A;  5FZI A;  3U78 A;  4P9L A;  3SKV A;  3GJA A;  3WX5 A;  4XHX A;  5F1R A;  1W9Y A;  4P14 A;  5C33 A;  1K5M B;  1UX6 A;  1GZW B;  2VOV A;  1MZ5 A;  5SV5 A;  1V6N A;  4W6Y A;  2YFZ A;  5FP8 A;  3VBR C;  5FJK A;  2Y6J A;  5IVJ A;  1TE1 B;  2PHU A;  1NLR A;  4LNV A;  4CA9 A;  5IK5 A;  4Q0V A;  4U2A A;  1NQJ A;  1RL3 A;  3PU8 A;  5FTT C;  4LO7 A;  5A6X A;  5FYH A;  4XC9 A;  1AR6 1;  5JMO A;  5LRS A;  2VNG A;  3G6J B;  4LO6 B;  2W91 A;  4XF9 A;  1PIV 2;  2A6W A;  3POF A;  4Q4V 1;  4S2G A;  1YQC A;  3ZXA C;  1XU1 A;  2GZW A;  3CDZ B;  3OBA A;  4DB5 A;  1W8W A;  4WM7 B;  4YWA A;  4CXY A;  4KWL A;  1O3R A;  3WP6 A;  3TWI A;  4GB3 1;  4KU8 A;  4JKL A;  4KWJ A;  4AVT A;  3LWC A;  3RZH A;  5BXX A;  4N9I A;  5GAL A;  1F4A A;  1RED A;  3KS7 A;  1I9R A;  3AZW A;  4Y1X A;  5HCA A;  2YHJ A;  3GM8 A;  1QJX 1;  3RVH A;  5KXD A;  3GBF A;  4RQP A;  4AE2 A;  1EYB A;  3CHX A;  5D8A C;  4E4H A;  3VBS B;  3PDQ A;  3T4V A;  2JDA A;  2NLR A;  2DVF A;  3AZZ A;  1PGL 2;  1T6G C;  1H4G A;  4K7J A;  4NPR A;  1OOP A;  2F17 A;  1UO9 A;  5KHG A;  4ZZ5 A;  3KF3 A;  4P9W A;  3HNM A;  1N47 A;  2MNG A;  3PJY A;  4PQQ A;  5BUV A;  1I1E A;  4LXL A;  1C3H A;  1ZZ8 A;  3GZU C;  5I0D A;  2BRT A;  3VBR B;  5LEJ A;  2C4X A;  3V0B B;  3BPZ A;  1PX4 A;  2RJL A;  4JDO A;  3ACI A;  3VZN A;  3WW4 A;  4NWV A;  2RR1 3;  2R04 2;  1GKB A;  1UY4 A;  2W52 A;  2XHN A;  4FVV A;  5DZG A;  3NST A;  4IXL A;  3WNL A;  1DGW X;  3AP5 A;  3DYM A;  2ZX1 A;  5I8S A;  3VBF A;  1CAU B;  3ME2 A;  3H8X A;  2MEV 1;  2ADE A;  2VVE A;  4K1Y A;  1A6C A;  1AF9 A;  2QQW A;  4FXK B;  2BBA A;  4MLO A;  1SCR A;  4Y1Z A;  2VUD A;  1C8M 2;  4A6S A;  1QGL A;  2VC9 A;  1PZ9 A;  4Q0P A;  5FPA A;  4CUB A;  2RS1 2;  1DQ5 A;  1H2L A;  5I8T A;  3L2H A;  4CU9 A;  5A3L A;  2VL4 A;  3O1M A;  4C8D A;  1V6L A;  2VXJ A;  4IE5 A;  1TME 1;  3MUZ 1;  2ZXQ A;  3LPF A;  1N1Y A;  5FUI A;  3FLT A;  4HT1 T;  3KT7 A;  1G86 A;  3T2O A;  2P34 A;  3WDW A;  2DU0 A;  5D8A B;  2O8O A;  4Y1U A;  4B4R A;  4GWJ A;  3W58 A;  2FZ2 A;  1IPJ A;  2RS5 3;  2ZEZ A;  2W39 A;  4LBQ B;  2WA4 A;  5DDJ 3;  2VZP A;  2Y0I A;  1ND2 B;  1XQN A;  4UYB A;  1GAN A;  3D0S A;  4QT6 A;  4C1W A;  1S0D A;  1W2T A;  1QKQ A;  1JUI A;  5IFT A;  4HVR A;  5A32 B;  4M4P A;  3H3Z A;  5FUP A;  5FZB A;  3ITQ A;  3HNY M;  3RI9 A;  3WIN E;  3ZYR A;  1NCQ A;  3N9O A;  4FFF A;  1GBG A;  1YXW A;  3JCI A;  3BAL A;  3OF1 A;  2BGC A;  3FJS A;  4N8M A;  2Y64 A;  4RD7 A;  4AYU A;  2Y6L A;  4QX7 A;  1UX7 A;  3LA2 A;  1VLN A;  3FC0 A;  3QH6 A;  2VD7 A;  2A71 A;  1W8H A;  2HJI A;  1L3J A;  3ZSJ A;  3WDV A;  1DQ0 A;  1SBD A;  5FZD A;  3BOW A;  2IXJ A;  2R0F A;  4GWM A;  4GH4 A;  4RA0 A;  3ORJ A;  5B2G B;  1X50 A;  5C8W A;  1JZ7 A;  3AKR A;  2VZ3 A;  5FZC A;  3M3O A;  4WBB A;  2E53 A;  3H50 A;  1VE0 A;  3OEB A;  4MX3 A;  1WCS A;  2VBP A;  3WF3 A;  4IW3 A;  3K2O A;  2CDP A;  1EUT A;  2QKD A;  2R07 3;  3KV4 A;  2RS3 1;  4QB2 A;  4HAN A;  4AGG A;  1B35 C;  4CCN A;  3FFZ A;  3WHT A;  3IPV B;  2BWA A;  4WZC A;  1WMF A;  4OHW A;  2Y33 A;  5DUV A;  3WNN A;  5JUV A;  1BVV A;  5FMO L;  2VAU A;  3A22 A;  4LKD A;  3TNP B;  5BNN A;  4AWD A;  1V9U 2;  4XIO A;  3J26 N;  3D4K A;  3JBG 2;  2OKX A;  2I2S A;  4UAP A;  2X53 S;  1ENX A;  2B8M A;  4L97 A;  4DUX A;  1A3K A;  4AOC A;  1UY1 A;  3NKT A;  5IAV A;  4XQ4 A;  4BK5 A;  1Q8O A;  2C9K A;  1F4H A;  2W2I A;  4Y26 A;  4AFA A;  5KHK A;  4CEW C;  1LEM A;  2GC1 A;  3HT1 A;  4I3P A;  1SLB A;  2HBT A;  2WWU A;  4XQW A;  4QX8 A;  5HCB A;  2BNN A;  3P3N A;  5K0U A;  4YM2 A;  2D98 A;  5T52 A;  1D4M 3;  1UZV A;  3N36 A;  2QZ3 A;  3W9A A;  4CRQ A;  2GAU A;  3T09 A;  1UZY A;  2D97 A;  2PLV 1;  5A80 A;  1Y9G A;  5J1X A;  4YVS C;  3QBQ A;  2DDU A;  4YG3 A;  3ZDS A;  4AHX A;  2FDG A;  3PIG A;  1O7F A;  2VZS A;  3WZ1 A;  1XND A;  1W6N B;  5BV6 A;  2J1A A;  5IVY A;  1G7Y A;  4DOU A;  1PZ7 A;  4QAW A;  4ZPI A;  4CUC A;  1GNH A;  3JB8 A;  4LBL A;  3V0A A;  1BMV 1;  2W1W A;  2WT2 A;  1UU5 A;  1EUU A;  5JR7 B;  1B35 B;  2WYS A;  1AJK A;  3OY8 B;  4XIK A;  5J48 A;  3DGT A;  4HSL A;  1OA2 A;  4FI9 A;  2BP6 A;  2EXI A;  4M01 A;  3ACL A;  4GA9 A;  4AVB A;  1ACC A;  3J4U H;  5GM0 A;  1GZ9 A;  3ZFE A;  5JZG C;  4EN6 B;  4CZS A;  4Y22 A;  1RUD 1;  5DZF A;  2BOI A;  4RSU A;  1NX9 A;  1HXS 3;  1U12 A;  2VEC A;  4N43 C;  2OW4 A;  5KXC A;  4A7Y A;  1J1L A;  1ENR A;  4NHY A;  1CJD A;  5LBF A;  4CEW B;  4LPL A;  3EB7 A;  2CAU A;  4JGY C;  4KMQ A;  2IXL A;  1SMV A;  4R9C A;  3QOP A;  4W65 A;  4XJZ A;  2GNB A;  4FQZ A;  1J59 A;  3KV5 A;  3MIG A;  1UPS A;  1V0A A;  4CDU C;  4Q4W 3;  4R4Z A;  3R4U A;  3N9Q A;  3INA A;  2ZML A;  4P02 B;  1XYP A;  1VBD 3;  4GMP 1;  2QFE A;  1RMU 1;  2HWF 2;  1ZZ7 A;  1YC6 1;  1X8M A;  4E4D X;  4LQR A;  2BFU S;  2P1B A;  4GJZ A;  2W95 A;  4XFH A;  3RRD A;  3CJX A;  4MVT A;  4NR1 A;  5CKM A;  5FZO B;  5FY8 A;  2E6V A;  3ZFG C;  2VOT A;  1C28 A;  1SDD B;  2P37 A;  3O0X A;  4CTE A;  4Q8K A;  3BPS A;  4AVS A;  1JYI A;  1V6K A;  3SCG A;  5JOX A;  3H1W A;  2GND A;  2WQZ C;  1Z78 A;  1OLQ A;  2F4L A;  4NHK A;  5FYT A;  1CZV A;  4QQ2 A;  4I2O A;  3HT2 A;  2JKX A;  4FPK A;  4W50 A;  1QJY 2;  1CAX B;  1JZ3 A;  3R05 A;  2V72 A;  3RS6 A;  1YIF A;  5JZG B;  2J1R A;  1X33 A;  4KBZ A;  4MYE A;  4CCJ A;  4YM3 A;  5EIY B;  3B7M A;  2B7Y A;  1AR6 3;  2JJ6 A;  1MEC 1;  2J1E A;  4QU1 A;  3SH3 A;  1RVF 1;  3VZM A;  5IVE A;  3FL7 A;  3WP3 A;  4ZZ8 A;  1XPW A;  3MIH A;  1XBF A;  1CAW B;  3S6P A;  2WNV C;  3WG1 A;  2Q5T A;  2QQM A;  4JGY B;  1VBC 2;  2E51 A;  5LAT A;  4DZG A;  4JHZ A;  1AYN 3;  2LS6 A;  2WAA A;  2QQN A;  4CP1 A;  3AFG A;  4GB3 3;  1DU3 D;  3M3E A;  3BN6 A;  3NWK A;  2HEV F;  4FTB A;  1CX1 A;  2XLF A;  1UF2 C;  2GP5 A;  1XU2 A;  2NQY A;  1POQ A;  2WNO A;  4IEO A;  1QJX 3;  3EO6 A;  3LIH A;  5FYV A;  2NMO A;  4CDX C;  2BBV A;  1D0G A;  4IEX A;  4MXW A;  4QGN A;  2V5D A;  4RR3 B;  3ZFG B;  2ZKL A;  1LNS A;  1OLM E;  2EIE A;  3HMY A;  2WSU A;  4XUR A;  1KFX L;  1ZBE 1;  2OVU A;  4C0B A;  4CEY A;  4AED C;  1DCS A;  2UYA A;  4TXW A;  5CKN A;  4G9S B;  4K6B A;  2VY0 A;  4QPY A;  3I3E A;  3WQ0 A;  4CU7 A;  2AR6 A;  1AUY A;  1OPO A;  1VBB 1; 
#chains in the Genus database with same CATH homology
 3OUI A;  3NNF A;  5EQU A;  3GZE A;  2FCU A;  5DAQ A;  5DAV A;  2RDS A;  5C5U A;  5IAX A;  4ZPI A;  4NHX A;  4XCB A;  4NMI A;  5L9B A;  2RDN A;  5DAP A;  2V4A A;  4Q5O A;  5EPA A;  2JIG A;  2OPW A;  3OUH A;  4NHL A;  4BQY A;  3NNL A;  2FCT A;  5LA9 A;  4MHR A;  2FCV A;  3OUJ A;  3PL0 A;  4NHY A;  5C5T A;  5L9R A;  5LBF A;  4Y5S A;  3OBZ A;  3NNJ A;  3KT1 A;  3KT7 A;  5LAS A;  3HQR A;  5HV0 A;  5LBE A;  5ERL A;  3ITQ A;  5L9V A;  2RG4 A;  2RDR A;  4NHM A;  5LBC A;  4NHK A;  4J25 A;  4XAB A;  2G19 A;  5DAW A;  3GJA A;  3W20 A;  4XAA A;  3DKQ A;  4XAC A;  3GJB A;  4KBZ A;  5LBB A;  4IW3 A;  3W21 A;  5HV4 A;  3HQU A;  3BVC A;  3NNM A;  5LAT A;  4XCA A;  4XC9 A;  2Y33 A;  2HBU A;  5LB6 A;  3EMR A;  5IAT A;  3MGU A;  5A3U A;  4BQX A;  2A1X A;  4JZR A;  2G1M A;  5IAV A;  5EP9 A;  4ZON A;  2RDQ A;  4BQW A;  2JIJ A;  5DAX A;  4Y5T A;  4NAO A;  2HBT A;  3KT4 A;  2Y34 A;  4MHU A;  4UWD A;  5M0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...