2DURA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+/man2-bound form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
251
structure length
251
Chain Sequence
SEHLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEENIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Protein transport
molecule keywords Vesicular integral-membrane protein VIP36
total genus 60
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2durA01
2PHFA 5SV8A 4FPJA 3W58A 2D3SA 4P9XA 3W59A 3ZXLA 2EXKA 1F5FA 1FAYA 1LULA 2D3RA 2ZGTA 2A5ZA 3B9CA 3N3HA 2CWMA 3OJBA 4YGEA 1CESA 1LEMA 2DUQA 3AP4A 2ZGNA 5DUUA 4XTMA 5H9PA 5GZGA 3INAA 3WZ1A 2OW4A 1QDOA 2OUHA 4PCRA 1Z78A 1LGNA 3OBTA 1UMZA 3WLUA 3ASIA 2JD4A 3NV4A 5T55A 2WNEA 4WV8A 3MEPA 4FPOB 2ARBA 3PJQA 2VU9A 3B00A 3HMYA 2EXJA 4NOTA 1V6OA 1N3QA 1SBFA 2SBAA 2PHXA 4YM0A 4WVVA 5GZDA 1SCSA 4BM8A 1CONA 2P3JA 2R0FA 1W6PA 2AGSA 3NV1A 2GNMA 4PQ9A 1ENSA 3L2YA 1QDCA 1AVBA 2GMEA 2EALA 5H9SA 1BQPA 3MPPG 2ZGMA 2R0HA 4Y20B 3ZXEA 1S0DA 2C9AA 1QGLA 1N3OA 2LALA 2SLIA 5E8AA 5GLZA 1W0OA 3ZYPA 2ZGPA 1G8WA 2CY6A 2A7AA 3B69A 5E88A 1KRIA 2YROA 4XJAA 4FP2A 4FPKA 1ULEA 4DRRA 1V6LA 1DQ5A 2DURA 2NM1A 4BLIA 2ENRA 3V0AA 4XIOA 1UX6A 3TAYA 4UW6A 2JJ6A 2OUJA 1W6NA 4Q2FA 2DU1A 5CB7A 1LCLA 3VKNA 4XHXA 2WSUA 4Y26A 3RRDA 1CR7A 4Y1UA 1WBFA 1WW7A 2ZAAA 2DV9A 2XG3A 2A3YA 4YW3A 3VKMA 3IMNA 3SISA 3WG2A 1AX0A 1LOGA 3USUB 1C57A 3WCRA 1N1VA 4DPNA 1QF3A 4HL0A 4BPZA 5H9QA 1GZWA 1HQLA 4FPHA 2DTYA 5JOYA 4YM3A 2LTNA 4CZSA 5DUVA 1AX1A 2NZ9A 3LSDA 3SH3A 5T5PA 1S0IA 4FPYA 1BXHA 1ULCA 2A6VA 1H9PA 2GALA 2NMNA 1HLCA 2W39A 2XB6C 4YZ2A 4M01A 1DQ6A 3OY8A 2Z42A 2UWAA 2HYKA 1IOAA 1MVQA 1LU1A 3USUA 5JOZA 4P9YA 4WZFA 4YZ5A 4Q8LA 5GZCA 1FYUA 2R1DA 3U4XA 1SLLA 3QLQA 4Y1YA 3FFZA 1A8DA 5JMCA 1W6QB 3WNXA 1S0EA 2ZHMA 4Q1PA 4C1XA 3N7JA 5CA6A 1PZ7A 3D5OA 4R9AA 3A4UA 3C2UA 4XYXA 1LHNA 2EIGA 3POYA 3M1HA 3AFKA 3VKLA 3OPZA 4FPEA 3PMEA 4XILA 1W0PA 2D6KA 4LBMA 5IUQA 1W6OA 2OVUA 1YIFA 2DTWA 5T5JA 2DVAA 1APNA 1MVEA 2DVFA 3IM0A 1VIWB 3O0VA 3OBRA 4LBJA 1DLLA 1ULGA 1V6KA 3QCWA 3IPVB 5FREA 1CIWA 4M3CB 1W6MB 5F5QA 1MS4A 3RMYA 2CTVA 4JRAA 1LOFC 2VH9A 4D69A 5L73A 3BTAA 2W08A 3D4KA 3AXEA 3V0BA 2GMPA 4AWDA 1DFQA 3IKWA 2GMMA 4M3CA 5CBLA 2A6WA 4Y1VA 1W6NB 5E89A 2ZGRA 2ZGSA 1OFSA 4TYSA 5KXCA 1YO8A 1G9CA 4YW5A 4GALA 4CTEA 4XHBA 1UKGA 1VALA 3MW4A 1TEIA 2WSVA 1LGCA 3AJYA 2A6YA 4JCKA 3WDYA 4XXPA 2UU8A 3ZSLA 2ES3A 1BZWA 1S0JA 4XJZA 3B01A 2WT0A 3WCSA 4BMBA 4LBNA 3WG4A 1UZYA 2ARXA 4LBQA 5T5OA 1G9BA 5GZFA 1SLTA 1DYKA 3ZSJA 5EYYA 1LESA 1KJLA 2FHRA 1MS1A 1F31A 2ZGUA 3VUOA 1ZA4A 2PHWA 3I4IA 2G4IA 3SNMA 1N47A 1D2SA 3AP9A 1SLAA 3O0XA 1FNYA 3UJOA 2P3IA 4FPCA 1ENRA 3D6EA 2ZMNA 4XOGA 4GKYA 5IK5A 4XBNA 4PBPA 1VAVA 1PZ8A 4XE9A 4DRVA 2TEPA 1R1ZA 3M2MA 1JOJA 1UL9A 1CQ9A 4FOWA 4XDQA 3WVJA 1JUIA 1S1AA 1GNZA 3GALA 5GLUA 1G9AA 3N7KA 4K1ZA 2E53A 2EF6A 2YY1A 3N7MA 2UWBA 1MS5A 1GV9A 4I30A 2CWSA 2ZKNA 4Y22A 3AZXA 5IK8A 3WDVA 4AGGA 1HKDA 1MZ6A 1WD3A 3POWA 4FQZA 5HCBA 3RMXA 1QU0A 1RITA 3OYWA 3V0BB 1AJOA 1H9WA 1URXA 2A70A 1MS3A 4P9WA 3ZXFA 1MR5A 1W6MA 3AK0A 3V65A 3AP5A 1XQNA 4ZXKA 3UK9A 3Q9OA 1AXKA 1ONAA 1CN1A 1HQWA 5H9RA 3T1MA 1D0HA 2PHTA 2VW1A 4R9DA 3M3QA 5DUXA 5EWSA 2D6MA 4Y22B 4M3CE 1OKQA 4LBOA 1SLIA 4CRQA 1G86A 3DUIA 1WUVA 4FQ4A 3LCPA 1LOAA 1ZM1A 4LBKA 1KJRA 1JBCA 1YRZA 1QNYA 2D43A 2UWCA 2ZGOA 5KXDA 1KITA 5GALA 1V6MA 3WUDA 3ILNA 1GANA 2E7TA 1DHKB 1MS9A 1YYNA 3WDUA 1GZWB 3M3CA 2A75A 1N1SA 2CYFA 3N36A 5EXOA 4YW1A 1DQ4A 5GLVA 3HR9A 1LEDA 2I2SA 4RL7A 5AVAA 2RHPA 3APBA 1UAIA 1KDMA 1FV3A 2ZHLA 5DXDA 2W52A 2A3WA 4R9BA 3WG1A 3AJZA 2E51A 3AYDA 5JOWA 1C1LA 4XBQA 2DVGA 3A0NA 2AH2A 2DWRA 3NV3A 2ZHKA 3T2TA 1QOTA 1PZ9A 4L8QA 3R4UA 1Y7BA 2DYCA 1S0BA 4K1YA 3JU9A 4Y1XA 2DUPA 3ZXJA 1JW6A 5EYXA 5KXBA 3V0AB 4LBQD 3RS6A 2DU0A 2UURA 4XJWA 4Q8KA 2JDZA 1DBNA 3FLTA 5KXEA 2E7QA 2GN3A 3SH4A 4XMAA 1GBGA 1SLCA 2P37A 1QKQA 2JECA 3AYCA 4BMEA 3B3QE 1BKZA 1SLBA 1LODA 1MS0A 1WLWA 2R1BA 4GA9A 4LBLA 3ZVXA 4YZ4A 2H0BA 3PVNA 3BODA 1N3PA 1QOOA 3ZYRA 2W68A 1AF9A 1X50A 4FOYA 4W65A 1DGLA 2D6PA 4FOQA 3FUQA 2P3KA 1MACA 2EXHA 4XJ9A 3AZWA 1SFYA 1QOSA 3PVEA 1Q8QA 2D6NA 1DZQA 5BYNA 4R9CA 1B09A 3N7LA 4FPGA 2AYHA 1WCSA 4ISRA 2A71A 5JDBA 4KBBA 1AXYA 1WW4A 1GKBA 2WT1A 4UW4A 1HDKA 4ATEA 4JC1A 3DGTA 4Q27A 1IKQA 4YFZA 3ZSMA 2ZBJA 5T5LA 1V6JA 3FBYA 5CNAA 2ZGKA 1FATA 2D44A 2CL2A 4NO4A 4XIKA 3SITA 4YZ1A 1CPNA 2VY0A 3ATGA 1W6PB 1Q8SA 2VW2A 1FNZA 3LSEA 2AUYA 3BIWE 4XJ8A 3ENRA 3RQ0A 1J1TA 5CAZA 1RIRA 2PHRA 2A6ZA 4GWMA 4HANA 2GNTA 2D6LX 1LHVA 1A3KA 2ZGLA 1Q8VA 1WBLA 1DQ2A 4SLIA 1F9KA 1Z0HA 2V5YA 2Q5TA 1C1FA 4YW2A 5DG1A 3FLPA 2D3PA 2WT2A 4PBOA 4BOWA 1A78A 4YFWA 1KDKA 4XMIA 1MZ5A 1I1EA 4K21A 2KM2A 3OGGA 2DVBA 4AVSA 3V64A 1LOCA 5IK4A 4ZKTB 1GZ9A 4YG0A 4AGVA 4RA0A 1BYHA 2PHUA 3OYWB 2WKKA 5GZEA 2YZ4A 3NWKA 1Q56A 3R4SA 5T50A 1QNWA 1IS4A 1KQRA 3VKFC 3UL2A 1LOBA 1WLCA 1UZZA 1BJQA 4FPLA 3O0WA 1NXD1 3AP6A 4YGBA 3WOGA 1G9DA 1GSLA 1UPSA 1GLHA 1V6IA 2D6OX 4Y20A 1QMJA 3AYEA 3IN9A 4GKXA 4YM1A 1WLDA 3WG3A 5F9TA 1LHUA 4YM2A 4AVTA 2ERFA 5DZFA 3WV6A 4DQAA 3AZZA 4ASMB 2R16A 2ZACA 3ZSKA 2BQPA 2ZZJA 4Z8BA 3WDTA 2DVDA 1ULFA 2NMOA 1GICA 1DQ0A 2ZA9A 3H0OA 2GDFA 2YMZA 5FRAA 4XJUA 1CJPA 3MW3A 3M3OA 3AX4A 1I3HA 2DUOA 3AXDA 3N35A 1SBDA 5DUWA 3O5SA 2AENA 4WVWA 1YI7A 5DZGA 2PELA 1O4YA 1O4ZA 2GNBA 2YV8A 1LJ7A 3AZVA 1FV2A 1S0CA 5GJ6A 4FOVA 3WHUA 1JHNA 4Y1ZA 3VKOA 3ILRA 1JYIA 1IS3A 5GLTA 2C5DA 3M3EA 2GNDA 4U2AA 1CPMA 1IS5A 1SBEA 4AGRA 4AVVA 1G7YA 3ZXKA 2NYYA 1Q8PA 1GYKA 1LGBA 1DIWA 4OZXA 1LOFA 2A3XA 3A0KA 2ZMKA 1LOEA 2R49A 2D7FA 3CNAA 3GNEA 1MS8A 1SACA 4FPFA 3R05A 4YW4A 4BQ1A 5JVVA 1EPWA 3RG0A 5GLWA 1GZCA 4YGDA 5HCAA 1V6NA 1LECA 1NLSA 2P2KA 2ZGQA 5T52A 2NP0A 1WW5A 4PF5A 3ILFA 2JE9A 1N1YA 5T54A 1GNHA 1U0AA 1H30A 3O12A 4GXLA 3RSJA 4FVVA 3WDXA 1JN2P 2WQZC 1V00A 2ZABA 1Q8OA 1RINA 5JLVA 3KM5A 4FP3A 1N1TA 1OQ1A 1LHOA 3AYAA 4YLZA 1FX5A 4TZDA 1WD4A 4C1WA 3UJQA 4XBLA 1C4RA 2B7YA 1UN1A 4ITCA 4XTPA 1CVNA 4IQPA 1G9FA 1VAMA 1ENQA 1DYPA 2VUAA 1AZDA 3WHTA 2ZHNA 3AP7A 4YGCA 5GM0A 1S0GA 2ZMLA 1S0FA 4YG6A 5HCFA 4XZPA 4AYUA 2VXRA 5DZEA 3T1LA 2V73A 4MYEA 1LHWA 2JE7A 4F83A 3MW2A 1AJKA 3PVOA 3IPVA 2A6XA 5IK7A 2AREA 5DG2A 2WLQA 2E6VA 3OY8B 1SCRA 1W6OB 4H55A 1DQ1A 1W6QA 3SLIA 4LBQB 1VLNA 4XXAA 3BOPA 1IKPA 1AXZA 4UW5A 3WDWA 3KQRA 4M3CF 2FMDA 3POSA 4ISQA 4Q1RA 3ZPYA 4Y24A 4M00A 2GN7A 3JUUA 2AR6A 2P34A 2EAKA 3AZYA 3FLRA 1ULDA 4GWNA 3WUCA 2NN8A 4ATFA 4YZ3A 5JOXA 1JXNA 2EXIA 3I8TA 4P14A 4K20A 2YXSA 3FUOA 1LENA 3VV1A 2CNAA 2JKBA 2VW0A 3SH5A 4DFSA 2WJSA 3HN1A 3NV2A 5LK5A 1IS6A 1JYCA 1WW6A 4BLJA 4UW3A 4DS0A 1LU2A 3TB0A 4Q26A 4U36A 4YG3A 5IT6A 1YXWA 1LTEA 1AX2A
chains in the Genus database with same CATH superfamily
5SV8A 3W58A 4XF0A 1J59A 1H1MA 2D3SA 3J26N 4FCAA 3W59A 5IAVA 3KQ4B 1W9SA 4IEXA 1UYXA 1PGW2 2GP5A 2D3RA 5JXGA 4YGEA 1CESA 3AP4A 2DUQA 1PNGA 4QQOA 3VD9A 1M06G 1E5SA 3PTRB 5F6LB 2EVXA 4QWNA 4XUQA 2Q1ZB 4UF0B 2OUHA 4XF4A 3RWNA 3ASIA 4Y5Z0 4OQ8A 4PI2A 3RZKA 1C5HA 1OH3A 1UU6A 1O59A 5C3OA 1PGL1 4IE5A 3H8UA 3N9PA 4CDWC 2ZX0A 4OMCA 2RS12 3PUQA 1HN1A 4H2AA 4CUAA 4CDUA 2PHXA 5GZDA 1RUC1 3O1UA 1ULPA 1W2UA 2P3JA 1TME1 1RUC2 4LO7A 4XAAA 1UYZA 4AFMA 4JVAA 3L2YA 4K8RB 1QDCA 1BVP1 3AM2A 3ZXAC 5H9SA 4NIAA 2CDPA 3S57A 1RTVA 4IEZA 3MFCA 4IE4A 4XCBA 3ME2A 2LALA 1ND2C 5FZOA 4EWAA 1GWKA 4Z2WA 5A7NA 1VB2A 1W0OA 4YNIA 2CY6A 3J4UH 5EFUA 3GM8A 4MH0E 4WZCA 2QCSB 3WP6A 5LY1A 1W9TA 4FPKA 1V6LA 3I97A 1H1AA 1AYN3 1GOHA 2NM1A 2Y33A 1JS9A 1PX3A 3V0AA 4DIQA 2A73B 2JDYA 3DPRA 5LBFA 4IXLA 2VOVA 1UCXA 2PTMA 4CU8A 1LAJA 2XBO3 4K40A 4XHXA 4A44A 1CR7A 4QDRA 3QH7A 4LORA 3O14A 4C90A 3ZX7A 1W9FA 3D0JA 3PIJA 5A3OA 2W1WA 4NPRA 2HLEA 5F5AA 4DZGA 3S5AA 5FLJA 5J7MA 2BFUL 1C57A 1MPXA 1QF3A 2IFWA 4JV4A 4OUMA 4RFRB 4B4QA 1RUJ3 4QX8A 3I2FA 1REEA 4LOTA 1HRI1 4MOAA 1FPN1 2RVAA 1OKOA 2W95A 4K3UA 2NZ9A 5CVRA 5D1IA 5T5PA 1PIV2 4FPYA 5DZEA 4MZUA 2GALA 2W39A 1W3XA 4XDPA 4HKOA 3U07A 4COWA 1VRH3 2RM21 2RG4A 3EQEA 3BTYA 3OY8A 3ZIWA 3NAPC 5CZKA 1EV12 3HBZA 3DXUA 5FY7A 2O8QA 4UXAA 2KD7A 2ZX2A 4JKKA 4Q8LA 1FYUA 2R1DA 1ODNA 3NNJA 3MIGA 3ZN4A 2ADEA 4ZZ5A 4OUSA 1AL21 1UMIA 3WNXA 5JMCA 1IPSA 4MGYE 5FO7B 1UY2A 4Q1PA 5D21A 5CA6A 2BERA 3D5OA 4LTAA 3A4UA 4R9AA 5B2GB 5J3UA 1RUNA 2EIGA 3POYA 5D8AB 3AFKA 3GZAA 4FPEA 4BQ3A 1UOJA 3PMEA 1IPJA 4XILA 4BB3A 5C6CA 4QX0A 5IUQA 2YFUA 4O7XA 4AG4A 1YIFA 1OUXA 3NAPB 5FP4A 3RJ2X 3EXUA 3ROUA 3ZMNA 5T5JA 4Q0PA 4S2GA 1C28A 3VBHA 1MVEA 4QHOA 3WNKA 4LBJA 3T0DA 5FREA 1KGYA 1RMU1 3IPVB 5KHGA 1JZ8A 4M3CB 3KT1A 3POFA 4A7KA 1QWRA 3M70A 4LO4B 3MI8A 4OHVA 4J1WA 2ZTNA 4D69A 2WO2A 4EJRA 3P6BA 3V0BA 2VG9A 2YC2A 2ZX4A 4WBBA 5J98B 3NNGA 1EUTA 2BP6A 1KS5A 2R042 4PLOA 2ZGRA 5FYVA 1MZFA 1OFSA 5B4XA 4XQDA 5C4WA 2XHKA 5KXCA 1G9CA 1UYYA 1RMU3 4EYUA 3L9JT 4NROA 1QHDA 3FHAA 5FYSA 1OSGA 4PQQA 4W8JA 1AR62 4JGZC 5FUIA 1TEIA 3AJYA 4JCKA 3THTA 1LRHA 4LNVA 1DGRN 3VBOA 3WDYA 3WF1A 4GJYA 5HPOA 1PMJX 2ES3A 4BMBA 3WCSA 5J36A 4FXKB 1ND3B 3RZMA 4XF3A 5LCWL 3MFAA 3WG4A 1RUI3 1RYYA 4N43B 4QXCA 1LESA 4A2UA 1AR82 1O8SA 2K9ZA 2OQ6A 4HPKB 1ASJ2 1MS1A 4MHUA 4GWJA 3P3PA 2HKXA 3JQXA 2PHDA 1N47A 4NR1A 3O0XA 3WQ7A 3POJA 2C26A 2XUEA 4HK8A 3D6EA 2ZMNA 3VGIA 4XOGA 5F39A 3T2QA 3PL0A 1F35A 1Q5OA 1R1ZA 3ITQA 4ZPIA 3H1YA 3WW1A 2HBTA 1O3TA 4MGQA 5FOBB 1S1AA 2XJUA 3NKGA 4ZS3A 3WNMA 1O5LA 3SQOA 3N7MA 5HCHA 3ST7A 3RYPA 1QQP1 1CAVB 3UV9A 1XYNA 2ZKNA 4QQHA 4CSWA 2XKPA 4RR3C 3AZXA 2VVEA 4BWOA 3JBG3 5FXZA 2FDJA 5FKCA 4INDA 3POWA 1UIKA 1JYXA 5AFBA 3KGZA 3B7MA 3O1PA 3V0BB 3MLLA 1MS3A 4LO6B 3ZXFA 1XYPA 5I0SA 2L9LA 4LA2A 3V65A 4NIGA 3D0SA 2E9QA 4NHYA 3HVDA 5H9RA 1CN1A 4IE0A 1D0HA 3K75B 4QAWA 3VHRA 2VW1A 5LA9A 5IFPA 2D6MA 4Y22B 3I2OA 4LBOA 1SLIA 4CRQA 2WFF1 4YVWB 4ZY9A 2KR2A 4JDNA 1ZM1A 2ZGOA 4Q4V1 4RHV3 5L9VA 2R072 4AF9A 1OA4A 4B4RA 1VBC1 1WMXA 2DFBA 5C3PA 1GZWB 4LXLA 5JXHA 2QVSB 4P02B 3KLSA 1N1SA 1JZ4A 5FTTC 1DQ4A 2VZSA 5C5TA 3UYJA 4JQRA 4RL7A 2FDIA 2RHPA 1U5YA 4OQ9A 1JZ2A 2DCYA 5FPXA 1KDMA 1ALYA 3PUHA 5DXDA 4R9BA 2H0VA 5IW0A 3AJZA 2VULA 2WAOA 3KV5A 1ZRRA 2AH2A 2DWRA 3CZJA 3NV3A 2HEYF 4S2FA 3RWKX 1Y7BA 3UETA 4QX3A 4JZRA 3OUIA 4K1YA 2PYTA 3ZXJA 1ZX5A 4KGGA 5KXBA 1SDDB 3PU8A 5FMOL 2WA4A 1RUD1 2UURA 5J37A 5KXEA 3MICA 2V5DA 4QKFA 1CZSA 4EN7B 2GN3A 3ACLA 1RUG3 5F5IA 2YGLA 4FI9A 5FAXA 2IXKA 4BE3A 4CCOA 1R1A3 3N9QA 1JZ3A 3O1TA 1CIYA 2W1SA 2P37A 2E7AA 1JOBA 3B3QE 1BKZA 3JQWA 1LODA 1MS0A 2R1BA 4UFIA 1ZZ7A 4A41A 5JR2A 1ZA7A 2OX0A 5CU1A 3BODA 3OCPA 3ZYRA 5FBJA 1AF9A 1WMFA 1X50A 2YYOA 3EBRA 2WYFA 2P1BA 3PIGA 3T3YA 4KL1A 4OUEA 1NUKA 2GC0A 2Q0AA 4NMIA 1W8NA 3AZWA 3PJYA 5DN2A 3EYPA 1VAKA 3IIIA 4Q0VA 3SCGA 1B09A 1BHGA 3SKVA 4LE3A 5A7OA 4ISRA 2A71A 1MQTA 4GWIA 2DF7A 4I0WB 4CDQA 3UNPA 1GKBA 1EUUA 2LM3A 2XVLA 4JC1A 4YFZA 2BGCA 4ZU5A 1GU3A 3RI9A 2CAUA 3F95A 5FPLA 5T5LA 1V6JA 3FBYA 2JG9C 4IEVA 1FATA 1EV11 2HWC3 4HKLA 1O3RA 2CL2A 4JKLA 4BYYA 1CGPA 2B8MA 2VY0A 3OD4A 5JSOA 2QBXA 2VW2A 4RHV2 3VHNA 1QY4A 3FX3A 1H8VA 4XFAA 4CU7A 2VECA 1K3IA 2RMU2 1J1TA 5C4WB 5CAZA 3I3QA 1HXS3 2J1UA 1SHWB 4GD4A 1LHVA 1COV1 1Q8VA 1NAEA 1WBLA 3DL3A 1F9KA 2Q5TA 1J84A 2D98A 4JDMA 4RQPB 5DPNA 4YW2A 4ZXEA 3KT4A 5FLHA 1O7FA 1KDKA 3OBAA 2Q8EA 4QHZA 2Q8CA 4LHNA 4K21A 4XDOA 4AVCA 5I91A 2ZXQA 3UKNA 4UFKA 1LOCA 1T6BX 2QQLA 1O4TA 4NHXA 1MEC1 3VBFA 1X33A 1VBB2 2HEWF 4OZOA 5T50A 4E4HA 5C33A 1D4M2 1HXS1 1UOBA 3VBUC 1GWLA 1UZZA 1US2A 5FZEA 5BPXA 1DYOA 4XPVA 4YGBA 1XOYA 1UPSA 1GLHA 2HWF1 2VMCA 4Y20A 1QMJA 3AYEA 1ZBE1 5C8CB 5CFDC 4OFGA 1IZ3A 4GKXA 3MYXA 3U14A 1TMF3 3WSOA 1YNAA 2BBAA 3OGVA 1DP0A 2PA7A 3GDBA 1PO12 4AVBA 3KZ4C 3FBMA 2WNVA 2R16A 3MUY1 3OUHA 1H4GA 2PLV3 3KVAA 1M4WA 2NMOA 1DQ0A 3VDDC 3H0OA 1W04A 5FRAA 3WW3A 4YVWA 4DOUA 1CJPA 4CDUC 5LEJA 5FPAA 2J42A 2ETEA 4X6RB 1IPKA 3N35A 4JKMA 5DUWA 3RYRA 4E8DA 2PAMA 1YI7A 3JD71 5C3RA 2QTWB 1RGSA 5DDJ3 4MXWA 1JHNA 4IV3C 3VKOA 4A42A 1JI6A 2W46A 1VBC2 3OGSA 1OLME 2R071 4H14A 1SBEA 2AEZA 3DECA 5B4NA 1W9YA 3ZXKA 1DF0A 3OPTA 1W06A 2OPKA 4AEDC 5A3LA 2VJXA 3S7EA 1DIWA 4COVA 4OZXA 3A0KA 3NKTA 2OXBA 5FZ4A 5FPVA 1H2LA 1LOEA 5FYUA 4GZ9A 1H2KA 4XVHA 1UX7A 1JOPA 1EPWA 2VMHA 5GLWA 4JX0A 3BU7A 2P2KA 2XJPA 4BQ2A 2NP0A 1WW5A 2VZOA 4PF5A 1ZBA2 1BLZA 4N90A 3O12A 1BK1A 2QQWA 5LBBA 1W8UA 3M7AA 1FXZA 1RVF2 1AHSA 1BCXA 1VPHA 1JN2P 1RUG1 2RDQA 4P9GA 2WQZC 4WM7B 1POV1 5CYYA 2ZABA 4G4FA 1AYM3 3CL1A 5DMYA 1N1TA 3AYAA 3WT3A 4AI0A 4LMFA 5A6ZA 4C1WA 4FAGA 3LWCA 1QJX2 1J1LA 3UJQA 1C4RA 1AR73 1VBE2 1NY71 1G9FA 4IQPA 3T0BA 5FFOC 2VUAA 3I2DA 2HWB2 2WLPA 2PAKA 2CDOA 1KEXA 5A80A 3RPQA 1F5JA 3DV8A 4M4PA 5IVJA 1XE7A 2ZMLA 1S0FA 5ISLA 5FP9A 2VR4A 4HLTA 2V73A 4MYEA 1AYN1 4HKWA 3VBOB 1HB1A 1AJKA 1V9U2 2LUWA 3NNFA 1AYM1 2ZEWA 5DG2A 1VBC3 3B9IA 1W6OB 4FBFA 2VZVA 4F7ZA 1W6QA 2J22A 3I3MA 4JDOA 3AFGA 3CJXA 3WX5A 1VLNA 2Y64A 4MHRA 3BOPA 3LDRA 3VBUB 1IKPA 1OI6A 4UW5A 1OF3A 5DAPA 3W20A 3KQRA 3WDWA 3CBNA 1K5MC 2FMDA 2YBPA 3BOWA 3IDEA 3POSA 4ISQA 4Q1RA 4SBVA 1G6NA 1ULOA 2YPDA 3JUUA 4M00A 1OHFA 4BK5A 2IFRA 1MEC2 2Q4SA 3WUCA 5BNPC 2ORXA 2HWD2 2NN8A 1PMIA 3VZOA 1JUHA 1QXPA 1GQHA 3N9NA 4N7IA 1X8EA 3FUOA 4LHKA 4LUMA 3SMHA 4MX3A 3VZLA 2G9GA 3SH5A 4DFSA 4OHYA 3HN1A 4AEDA 5FDBA 5C4WC 4QB6A 2R041 3GBWA 3RZHA 5IT6A 2VMDA 4D7YA 5JR7B 4L0PA 1LTEA 1AX2A 1W90A 2RMU1 3DXTA 2VMIA 3H3UA 3MIFA 2EXKA 2IXJA 2VNOA 1XNKA 1F5FA 4Q4W2 1COV2 4RYDA 4EN6B 1PO13 2A5ZA 3TN91 4NN0A 2XPJA 2CWMA 2EIDA 4GQ7A 4A3ZA 5GZGA 4XW3A 4KGQA 2WNOA 4Y5TA 4UFLA 5H9PA 1QDOA 4PCRA 1PX4A 1LGNA 1PIV1 1Z78A 4EE2A 3OBTA 1UMZA 3LFIA 4RHV1 2AEYA 5F32A 1XNDA 4B1LA 5KC6A 1ZZCA 2V72A 3A22A 4B7KA 4OHWA 2WNEA 4Q4W1 4N53C 4B4PA 1NZIA 3TEZA 1UQXA 1RUF2 1AR91 3B00A 3HMYA 5BY5A 1V6OA 1WA6X 2W9XA 4KBZA 1N3QA 2RE9A 1CAXA 4NWWA 4QDQA 4KG0A 3LFMA 3IMMA 3NJXA 4KNCA 4BM8A 3U0ZA 1CONA 1W6PA 2XL7A 3NV1A 4YVWC 4EZHA 1J3QA 2B46X 2GMEA 2Z5WA 4CCLA 2VVDA 2R0HA 1S0DA 2WINB 5FO9B 1QIQA 4I09A 3ZSEA 1BVVA 1GQPA 3GZEA 3B69A 4QPIC 1OF4A 3IAQA 1NXMA 2YROA 3GCWA 3AMMA 3MV01 4URAA 2IWGB 3SXWA 4LJHA 2R063 4IL7A 4OVEA 4BH9A 4DRRA 5FY8A 2DURA 1FI2A 1OD3A 2ENRA 3BKZA 2XWBB 5A6QA 1YFUA 5CKNA 3IDAA 4IV3B 4NHLA 2JEMA 4UFHA 1UIJA 1I5ZA 2JJ6A 2OUJA 3TAYA 2DU1A 2TUNA 1LCLA 3VKNA 4E4ZA 1GFF2 3RZLA 4GAZA 4QPGB 4BK4A 5DAWA 3QBQA 2XG3A 2VGDA 3U4SA 5FBZA 3KB5A 2FZ2A 3W21A 1W8TA 3HIFA 3IMNA 1WMDA 2VUCA 3OD0A 1U5XA 3KT7A 4Q4X1 2HWB3 5A7SA 2AC1A 4PIZA 1PM7A 1AX0A 2XQXA 3HOBA 3N9OA 3MV11 1GP5A 4XFFA 5JZGA 4HL0A 1GZWA 4FPHA 2DTYA 3WW4A 2UYBA 4YM3A 2HWB1 4NHMA 3I2IA 3E5XA 4CZSA 1AX1A 4BDVB 1S0IA 1VBE1 1BXHA 1ULCA 2NMNA 2OA2A 3AKSA 2XB6C 1HLCA 3MO4A 2IXLA 4M01A 1DQ6A 1R64A 4V2VA 2IXCA 2WFF2 2Z42A 1GOFA 2BFUS 2MEV3 2LRPA 3AMHA 4IERA 4V1PA 3WP4A 4RQPA 1IOAA 2BU9A 1LU1A 3DPRC 1VRBA 3KMHA 4P00B 4Y4RA 3USUA 4BU2A 5JOZA 4P9YA 4YZ5A 3LDBA 1F4AA 3KSCA 2F4PA 3JBG1 3QLQA 3U4XA 3FFZA 1A8DA 2FQPA 1W6QB 5DAVA 5C8WA 1AYM2 3H7YA 4P9IA 4C1XA 2BGPA 4AQSA 2WUHA 1LHNA 1SFNA 3M1HA 4I0BA 2GC1A 1UZWA 1FMD2 2X09A 3N9LA 4R4ZA 3VKLA 2VZTA 1YJKA 5BXXA 1W0PA 5DDJ2 2VC9A 5C70A 1JODA 1W6OA 1E5HA 5FYYA 3VDBA 1FT9A 1QXJA 5FZ9A 3O0VA 1APNA 1NY72 2FDFA 1VIWB 3OBRA 5FXVA 3VZKA 1DLLA 1V6KA 1IQAA 1YIPA 2CU5A 2JDAA 2YB7A 3FHIB 3IDCB 4K6BA 4P9LA 4DO0A 1DZTA 1I5PA 2YC4A 1W6MB 1XE8A 2CTVA 2G1MA 3FJSA 3NAPA 4G9SB 4M0HA 5ANQA 5FY1A 1ND3C 2VUDA 5LW9A 2VH9A 4B3NA 4LIUA 3H8RA 2JX9A 2Q1MA 3BTAA 2YU1A 4CEYB 4DMIA 3TEXA 4AWDA 5CBLA 2YGMA 1W6NB 1YQ5A 2OT7A 2ZGSA 1VE0A 3N4MA 2GC3A 2WZ8A 4B7EA 3E1F1 4OI2A 5I0TA 2Y6GA 1YC61 1PO11 3VZMA 2QQPA 3AVSA 4RR3B 3I3BA 1RHI2 4CTEA 4AHYA 3U37A 4J1XA 4XHBA 1UKGA 4YYOA 2RS52 1VALA 5I8YA 5LRRA 2HWF2 4NE9A 4B1MA 4UT5A 5ACA1 4E2GA 1ZZ6A 1S0JA 5IYYA 4H7MA 5A7WA 2QQOA 3BTZA 5DQ0A 3LAGA 1UZYA 2WNUA 4CEYC 4PJYA 4K9SA 1YEWA 1G9BA 1DYKA 1FPN3 2BV4A 5EYYA 1S2EA 4OLLA 3RFRA 3SCHA 3UGFA 1AR83 5HXMA 5FIXA 4AHWA 3PUAA 3OGRA 1D2SA 3AP9A 1FNYA 5K9YA 2QFEA 3K4AA 4XZUG 3E97A 5FZBA 2WAAA 4GKYA 5FYCA 4XBNA 3VB9A 3R6SA 1OA2A 2TEPA 1ND2A 4FOWA 3POEA 2MNGA 1YI9A 3ACFA 4QPGC 2XR4A 1GMMA 2DBIA 3CJIB 4KWKA 1RMU2 1VJ2A 1GQGA 5FUPA 2C9KA 5ERLA 2UWBA 2MPFA 5BNOA 1OLRA 3C7OA 1W99A 1W28A 1OLQA 4OCTA 5FO8B 4Y22A 4ZS2A 5IK8A 2R043 3HAGA 4KH9A 4A7ZA 1MZ6A 2VZ3A 2VQAA 2XLAA 4FQZA 5FQ0B 2BPA2 5IVCA 1QU0A 1FOD3 3WW2A 1JHJA 4A3XA 2R6QA 3DYPA 4YVSB 5IJRA 4HK9A 4JRLA 1KFUL 1OOPC 1H9WA 2A70A 4QPYA 5FPUA 1JYNA 2QZ3A 3VDDA 5A32A 1V0AA 1TNFA 1MR5A 5FYBA 3NMBA 4FSJA 4CP0A 2E26A 1AXKA 3T1MA 4LK7A 2FCVA 2OQ7A 4R9DA 2WABA 3LE0A 3ZO0B 5DUXA 5FXXA 4LT5A 1OKQA 3OGJA 4CEWC 5IVEA 1G86A 2ZX3A 1YJLA 1BEV2 2RV9A 3H42B 4LBKA 1KJRA 1ZRIA 1OLMA 2D43A 3ZYIB 3ILNA 3S30A 2WWUA 1ZZBA 4LHLA 1PVC2 3S6PA 2WRAA 4D8MA 1MS9A 1YYNA 5LWBA 5CG9A 2RM22 1QJZA 4JGYA 2A75A 3ZFGB 1HV0A 5EXOA 2QE3A 5GLVA 1LEDA 4RQPC 5AVAA 5FZ3A 3WP3A 1HRI2 2FCUA 3AL6A 1UAIA 2ZHLA 3S5QA 3PDQA 2RS51 1CAVA 1RUD2 4CDWA 4DEVA 2YUEA 2VMEA 3MUZ1 4C8DA 5FP7A 5JOWA 2DVGA 2QJVA 4KWLA 4PT6A 1ZZ9A 2QQJA 3T2TA 2WZR2 1PZ9A 3R4UA 2VCAA 1WKYA 1WMEA 1ZBE3 2GH8A 3I54A 3MDPA 1S0BA 4IEWA 4CDXB 5F7UA 4BIFA 1HRV3 4P08A 4KI5M 4Y1XA 1JW6A 5KHKA 5EYXA 4XETA 3V0AB 3JB4C 4AQ2A 4NRMA 4XJWA 2YHJA 4D94A 3FLTA 2G19A 2CGPA 5JMOA 3WQ0A 3SH4A 2MHFA 3HD8B 4GB33 4XMAA 1SLCA 4BMEA 2JECA 4MGZE 5CIRA 2LW8A 1EV13 2JB4A 5FZOB 4GA9A 1VP6A 3I2JA 2H0BA 5E16A 2Y26A 2ID4A 3VBHC 1N3PA 1QOOA 3AKTA 4MGSA 3S7IA 4D7TA 3K2OA 5LASA 4P9JA 4FOYA 4W65A 4CPBD 3KHCA 2XHNA 1J83A 4IEUA 4FOQA 5DDJ1 2VM9A 3HPNA 5J09A 1LNSA 2R073 2Y34A 1ZZ8A 3ON7A 4AHXA 3H8XA 3JD73 3N7LA 4Y5SA 4FT8A 2XQRA 4HBNA 2WS91 3B94A 3BTXA 2WT1A 2MEV1 3ES4A 3DGTA 3RI8A 3LD8A 3VBRB 1H0BA 4L92A 3ZSMA 4TLGA 3AC0A 1O3SA 3T30A 5ACA3 2RS33 4WM8A 1PGL2 3I2KA 3SITA 1W8OA 4QPIA 4XIKA 5FK8A 3ZFFB 3VBSC 5FYMA 3O1OA 1IG0A 1Z7S2 3SHRA 5CFDA 3WY6A 2GC2A 3DYOA 3ZIXA 1YCIA 3LSEA 1UOFA 4L9BA 5FPBA 3RDIA 2JDNA 4XJ8A 4BZ4A 1PGSA 2F6BA 3RQ0A 4HN0A 5AC93 2A6ZA 4GWMA 4HANA 2GNTA 2WO1A 1YHFA 1RXFA 1DQ2A 4IV1B 4SLIA 1Z0HA 3ZDSA 3RZJA 2O1QA 5ABJB 1C1FA 4ASKA 4MVTA 5DG1A 4BOWA 4ZU7A 2WT2A 1OH4A 3WQBA 3ZYGA 4YFWA 5FZKA 5M0TA 1A8MA 5D8AA 2KM2A 2XKOA 3LPFA 5FMOS 3V64A 2DBNA 4HVRA 1JMUB 3T0AA 4FTBA 2P6CA 4ZKTB 4AI9A 4RA0A 3WF0A 1BYHA 4KU7A 2WKKA 2BWAA 2YZ4A 1DLCA 5GZEA 5FR3A 3NWKA 3GF6A 1QNWA 3VKFC 1PO21 1LOBA 1CX1A 2JE8A 1BJQA 4LKEA 1HJFA 1NXD1 1UPIA 3WOGA 1GSLA 1G9DA 2YBKA 2R32A 5F3CA 2JENA 1UY4A 3LEIA 4LE4A 4B29A 3WG3A 5F9TA 2QDRA 5A33B 4XQWA 4NWVA 3SC7X 3FN9A 5DZFA 3WNPA 4AVTA 1R091 5LBEA 4GB32 3Q8BA 1H8TA 3ZSKA 1HQNA 1XC6A 2ZZJA 5SV5A 4MLOA 3IAPA 3WDTA 4Z8BA 5CKQA 2GDFA 1K42A 2YMZA 3UKVA 3VD3A 3ZYHA 5I0RA 3M3OA 3CKHA 4BJ0A 4E4DX 3AX4A 1OVSA 1I3HA 3K3NA 5CG8A 3O5SA 2W0XA 3MPBA 2VO5A 5DZGA 1AR81 2PELA 5FZCA 5C9AA 3AZVA 1H2MA 2VNVA 3C7FA 2WYSA 3C7GA 4YWAA 1QJU1 2BUKA 4Y1ZA 3ILRA 1WGPA 4LQRA 1GP6A 3UGGA 5GLTA 1U5IA 5CFCA 5JWPA 3M3EA 1X82A 4CVUA 2X5IA 1CPMA 4OHXA 5F3IA 5FLIA 4EQVA 1G7YA 2NYYA 4HPKA 1POV0 2VCBA 4P5YA 4D0QA 5FZ1A 5F37A 2A3XA 4L11A 4LULA 2W92A 1GNYA 4L99A 3GNEA 4NVPA 2C24A 2D7FA 1MS8A 5I0UA 1R093 1EP0A 3R05A 4PIXA 5JVVA 3RG0A 5HCAA 4YGDA 1V6NA 1OOPB 1NLSA 2QKDA 1WLTA 4YVSC 3KV6A 3ILFA 5FCCA 4EV0A 1GNHA 3MF6A 2HJIA 2ZJCA 4LK6A 1UF2C 3WDXA 5BNNC 1HB2A 1V00A 2DCZA 3AMNA 3AL5A 2B9UA 1RINA 4FP3A 2Y0IA 4LOSA 4YLZA 2PFWA 3FL7A 3HT2A 1NT0A 1NA1A 1UN1A 3HQXA 3PLQA 4HOOA 1K5MB 2X5IB 3WHTA 3O1RA 1UZ0A 5L7OB 1TQ5A 4QX5A 4FFGA 2ZHNA 4CEYA 1ZVFA 3GZUC 4CYDA 2JG8A 4YGCA 1S0GA 2C4XA 1BBT2 3U1XA 5A3PA 1IHMA 4QT6A 4XZPA 2X10A 4GH4A 2VXRA 5FZFA 4AYUA 3BIEA 2X29A 4IEYA 3GXUA 2PQSA 1MQTC 3MW2A 4CDQC 4N43C 4F83A 4C0BA 1UY3A 4W4ZA 4GB31 4DY3A 2A6XA 3EO6A 3A7QA 1RUI1 1T2XA 2Z79A 2WLQA 2E6VA 3ECQA 1SCRA 3ZDVA 5AC92 2BJSA 1H1IA 3I7DA 2HYXA 3SLIA 3H3ZA 2ORZA 3NVCA 5F2WA 3LGRA 4XXAA 5JPMB 2DCJA 1AXZA 4CCKA 2ZCWA 3AKPA 4M3CF 3KCYA 5K7PA 1RHI3 3ZPYA 1CZVA 3J7NA 4Y24A 2VQ0A 5A3TA 3DKQA 4YW7A 3J7LA 5IATA 2P34A 2EAKA 4X8NA 1OUSA 3AZYA 1X9TA 1ULDA 3ZYBA 4AEJA 5HV4A 2XLGA 1FPN2 4AEKA 3JB8A 4ATFA 3E6DA 2O8OA 2TNFA 2XL9A 1JXNA 2EXIA 3GJBA 4FO9A 4K20A 3T08A 4E27A 2P17A 2J1EA 1LENA 1OPOA 2JKBA 1NYWA 2VW0A 5IVBA 5FMDA 5K4LA 1Z7S3 5FMCA 2Y8KA 2W3JA 1IS6A 1JYCA 5LK5A 4Q4Y1 3U75A 1TME2 2CGNA 1O3QA 1WWYA 4AW7A 2C1FA 5EIYB 4U36A 2XJQA 2VD7A 1X7NA 1QJEA 5IVFA 2PHFA 3LDKA 3MF9A 1SPPA 5JIAA 3R0RA 1RUH2 3ZXLA 2Y38A 3BN6A 2OPWA 4IESA 1FAYA 3N3HA 4QQPA 3WXPA 1SQ4A 3OJBA 4J25A 4QPWA 1LEMA 3LIHA 5F5CA 4XTMA 4IGPA 5LRSA 3GBFA 1CAWA 4MUVA 2OW4A 1QJY1 3V56A 4A45A 3VBFC 3WLUA 1CJDA 1AR63 1Z7S1 3AMQA 2LS6A 4AQ6A 2CSGA 1DGWX 2WNVC 3MEPA 2ARBA 3PJQA 4Q0QA 1BK0A 1QJY3 1V70A 2VU9A 2VNRA 3MIHA 3ZKYA 5BNPB 3VBSB 4S2HA 1SBFA 4KG8A 2SBAA 4UFJA 3KD4A 2B39A 4QX7A 3TOJA 4D6SA 1SCSA 2X8KA 5JXJA 2R0FA 2AGSA 2GNMA 4AXOA 2WL1A 4PQ9A 3C8XA 2XBO1 2RS11 3T4VA 1AVBA 4QXBA 5JZGC 1SFPA 1OFNA 2EALA 1JH5A 4FFFA 3LEGA 3FWEA 4MSVA 3HNBM 2C9AA 3M3IA 3MIEA 4EN0A 1N3OA 3VHPA 4CP9B 3G7DA 3ZYPA 3CHXA 5E88A 2A7AA 3FC0A 2R30A 1ZBE2 5GKAC 1BMV2 4S2DA 3W9AA 5APAA 3CDZB 4RR3A 1DQ5A 4UOJA 3K46A 4MXVA 3RYKA 1U5ZA 4XIOA 1UX6A 5KBFA 2ZEYA 4UW6A 1W6NA 1YQCA 1VR3A 2WSUA 1J3RA 4Y26A 2W1QA 3MLJA 5L9RA 4LKSA 3RRDA 5D8AC 1NCQB 4Y1UA 3UGHA 2RM23 3TYJA 1WCUA 1WW7A 2JDPA 4EROA 2DV9A 2A3YA 4COZA 3ETPA 5LZ6A 3VD5A 2XXZA 3VKMA 4CCJA 4Q4Y2 3NW4A 2WZEA 3OF1A 3WG2A 2GZWA 3ZFEA 3Q8CA 1LOGA 5JI9A 2FZ1A 4DPNA 1LKNA 1AR92 5EPAA 5H9QA 4IGOA 2WZPP 4IEOA 1HQLA 4E2SA 3N9MA 5TSWA 3P5BA 2K2SA 2EIEA 5FZIA 3H1MA 1PIV3 2ILMA 2CV6A 3NJYA 4NHKA 3SH3A 4AAXA 3E6BA 1WCKA 2RS31 3M8LA 2JG9A 1BEV1 4XAEA 1MQTB 4CDQB 5LB6A 4W50A 3ZXDA 1MVQA 4O9GA 2I74A 3KF5A 4GH4C 5JSRA 5C71A 4CDUB 3BVCA 2P4EA 3G6JB 4HONA 5EJZB 1SLLA 2GU9A 4Y1YA 4TTGA 5JXIA 4KQ7A 3MLKA 1S0EA 4JGYB 3D82A 4OHZA 5BUVA 2IZWA 3ZN6B 4KMQA 3X29B 4XF1A 2XJVA 2BDRA 2D97A 1P8JA 4OULA 4ZHNA 3EMRA 4IEPA 5KHIA 3ZFFC 1VBA2 4DXTA 1RUJ1 1VBD1 2EAAA 5L19A 2D6KA 3ORJA 3WNLA 5CFCC 1D7PM 2WQ4A 4Q5OA 2OVUA 2ZKLA 1R082 2DTWA 3VHOA 1FOD1 4LO5B 2DVAA 2DVFA 4ORFA 4A4AA 5IHRA 1D2QA 3QCWA 1VBD3 2VOKA 1VBA1 3EB7A 1UO9A 4PIYA 5K0UC 3D3AA 2XJRA 3Q8EA 4JRAA 4UBHA 1LOFC 5BNPA 1F8VA 4IDZA 3JZVA 1JYWA 4XURA 2W08A 3D4KA 2GMPA 4XCAA 1S2BA 1DFQA 3IKWA 4M3CA 1I9RA 1QEXA 1HB3A 2WQ8A 1H8TC 4Y1VA 4RD7A 3CJIC 1E57A 1V9U1 4QB1A 5E89A 3EJKA 1PK6C 4HZFA 4IE7A 5EQUA 1C8M2 2RS53 2OS2A 2XJTA 1YO8A 4GALA 3NO8A 3I59A 4AQTA 2HBUA 5C9AC 4COUA 3VBSA 5EZWA 1HX6A 3MW4A 2WSVA 1LGCA 1W2NA 2VL4A 3H3LA 5FY4A 1GUIA 5A3UA 3ZSLA 4OI0A 4XJZA 5F2SA 4DXZA 5I8TA 4ARYA 2WT0A 4TSVA 3FHQA 4LBNA 4Q4Y3 2RDNA 5FY9A 5C5UA 1O6UA 2ARXA 2X53S 5T5OA 4AE2A 4IV3A 1SLTA 2HWC2 5JCTA 1AL0G 4HG6B 1X8MA 1KJLA 2QQIA 2FHRA 1XBFA 1A34A 3OTFA 3HJRA 1X9PA 2VQTA 2VBPA 2ZGUA 3DKWA 1ZA4A 2PHWA 2Y6FA 1SLAA 4XFGA 4XQ4A 2P3IA 3ABZA 4X8PA 2OZJA 3JXSA 4GJZA 4DRVA 1VAVA 5EJ3A 4XE9A 3VDCA 5LEKA 3M2MA 1JOJA 1AR72 1CQ9A 1R092 1VBE3 3WVJA 2F17A 4E4SA 1GNZA 4RSUA 4ET7A 3N7KA 3B02A 5E6HA 2FDGA 4LR4A 2E53A 2EF6A 2YY1A 1Q43A 2DFCA 2VOXA 5FOJB 4D6QA 1JZ6A 4I30A 1BMV1 1UOGA 2EIBA 2CWSA 3ZR6A 3LQCA 5I8SA 2LROA 4QU2A 3B5LB 2HWE2 2R7EB 3DPRB 3OB8A 4XEZA 3ZMOA 1JU4A 3POBA 3LB9A 3WDVA 3ETQA 4AGGA 2NQYA 1NCQC 2JDKA 1S4CA 4UBGA 5FKBA 2BYVE 1F2NA 1HKDA 4QHBA 5F3EA 3RMXA 2WNUC 3BCWA 2B9VA 4BQ5A 1RITA 2MEV2 1RUG2 1B35C 3TRSB 2JG8B 3VD4A 1URXA 4QKBA 3T2OA 4P9WA 3UKTA 1W6MA 4AI3A 5I0DA 2VBBA 1H6XA 3BALA 1XQNA 2J1RA 1AR71 3KCXA 3PUSA 1ONAA 1YUDA 1HQWA 3Q9OA 4HMZA 5F3GA 3PUIA 1OXCA 2PHTA 3VZNA 4Q29A 4Q4V3 1RVF3 2VZQA 4AI1A 4M3CE 2PLV1 3TBDA 2ADDA 5EV7A 2V4AA 1WUVA 5BV6A 2ZX1A 3ELNA 3LCPA 4RS5B 2BGOA 1JBCA 1YRZA 1QNYA 2UWCA 3NRUA 1KITA 1US3A 5GALA 1UXZA 3WUDA 2X5IC 4N9IA 4A6OA 1ODMA 3K51A 4QX1A 5L7OA 1DHKB 2XONA 3FFQA 5A6YA 4AFAA 4JGZB 1Q3EA 4YW1A 1UNBA 4UYBA 4N53A 2I2SA 4QQLA 4J6GA 1FV3A 1EAH1 3E6CC 2A3WA 2YDEA 3THDA 2E51A 1C1LA 4XBQA 3A0NA 2VBDA 2ZHKA 3BU0A 2ZS6B 2PHLA 2DYCA 3R4DB 1RUH3 1C8M1 2VZ1A 1MZEA 1REFA 2OYZA 2VNGA 1JU3A 3DN7A 4LBQD 5AVPA 3J8F2 1D4M3 3IBMA 1H4HA 5JIUA 2Z4FA 4EN8B 2RR12 3BYWA 3DYMA 3HNYM 1UY1A 5JZGB 3MZHA 1H2NA 5L7OC 5BNNA 1QKQA 3AYCA 3RZGA 5LATA 3HT1A 1VBA3 3ZVXA 3VDAA 3OSDA 2JG8C 4YZ4A 3ZFEB 1OMIA 3WF3A 5CFCB 1DCSA 1NE4A 5C9AB 4CDXA 5KR7A 1ZRDA 1DGLA 1NCQA 1SDWA 1VBD2 2D6PA 3FUQA 4XF9A 2GH2A 2W2IA 4AVAA 2VXJA 4XJ9A 1VBB3 4HETA 1SFYA 3NSTA 1QOSA 3J7HA 1Q8QA 4Y3OA 3ZKUA 3LZZA 5BYNA 4R9CA 1WCQA 1DGWA 2ET7A 3K77A 4NIDA 1RUE1 1O5UA 4FPGA 1BBT1 1SG3A 3SEEA 3L2HA 4KBBA 5JDBA 1HB4A 1WW4A 3ES1A 3OPWA 3ZXGA 4JHTA 4ATEA 2HWD3 2JXAA 5A1AA 1EYBA 3ACIA 5FP8A 2JICA 3HN3A 3RZZA 2ZBJA 4M4RA 5EP9A 1ASJ3 4MO3M 4Z07A 2Y6HA 2YG0A 4MG2A 1CAXB 2J1SA 2ZGKA 3CQOA 4DINB 5FZLA 4LKDA 4CUBA 3J9SA 3U11A 4NO4A 1NQDA 2WR9A 1CPNA 4YZ1A 3H1WA 2BZDA 1J58A 1W6PB 1Q8SA 3TN92 4C91A 3B93A 2VPVA 5F6KA 2AUYA 5FUNA 1ZRFA 2BOJA 3ENRA 4DXRA 2W47A 4HSLA 1RIRA 1RUE3 1X36A 2PHRA 4FFHA 3IWZA 2D6LX 4XFIA 2FDHA 5A32B 3LPGA 4Q4X3 3VDDB 2V5YA 4E9KA 3FLPA 2VZPA 4PBOA 2BNNA 1A78A 4QPGA 4TXWA 3PU3A 4PI0A 4TWTA 1MZ5A 1W8ZA 2NPIA 4XUNA 1A6CA 3ZFFA 1I1EA 2NLRA 1PNFA 2ZEXA 3OGGA 1NCRB 4MV2A 3M4FA 1NKGA 4ASLA 4XUPA 1GZ9A 2QQNA 2HWD1 2ZAHA 4O9EA 4YG0A 3OYWB 1PK6B 2JIGA 4G3YC 5IWFA 3QACA 1VB4A 3KV9A 3R4SA 3KWVA 2TBVA 4B8EA 1KQRA 3CU7A 1DU3D 1V9U3 3UL2A 1QJU3 3PNAA 3VBRA 1V6IA 4C0HA 2D6OX 4FTSA 4V2WA 4XUTA 1RXGA 1PM4A 2YBSA 1ND3A 1YQ2A 4YM1A 1WLDA 1ZBA3 1RHI1 3PHMA 2IVIB 3WV6A 4LA3A 4XUOA 4DNYA 1R1A2 4BHPA 2W5FA 3GZTB 4W6XA 4N8MA 4R4XA 2DVDA 1ULFA 3BPZA 3ZYFA 1GICA 3KVBA 3K4DA 5FZ0A 3DEMA 2BEOA 4EWEA 1KXGA 2P6HA 2VCCA 2DUOA 3AXDA 2WA3A 2Y6LA 3NNMA 1ZNPA 2AENA 4PLMA 4BXSV 1O4YA 4NRPA 4W6WA 2O0OA 1O4ZA 2GNBA 1FV2A 4XACA 5GJ6A 4BQWA 3ACHA 3JCIA 2C6SA 4P5HA 2C5DA 4NPMA 4U2AA 2WO7A 4GMP3 4HXCA 4WVMB 1IS5A 3C7HA 4AK3A 4NIHA 1QJY2 4AVVA 3T2PA 1RVF1 2JDMA 2RDRA 4RGAA 2WO3A 4IE6A 1LOFA 4TN7A 1K45A 1PGW1 3TNPB 4HSJA 4BQYA 2ZZQA 2PLV2 4GMP1 4N43A 1SACA 2IVJA 5F8PA 3KCCA 4BQ1A 4Q0UA 3W5MA 1GZTA 1GZCA 4AEDB 1K5JA 1GWMA 1KFXL 2ZGQA 5T52A 4CP2A 2K0GA 4AFDA 1NX9A 4CDWB 3JBG2 5T54A 1H30A 4FXGB 2JDHA 1SMVA 1CZTA 1NA1B 4WVMA 3T09A 5FZ7A 1F4HA 1WZXA 4RFT0 5FY5A 2XVGA 2JIJA 2GAUA 3ZFEC 1OQEA 4H7LA 1Q8OA 3KM5A 2QQUA 3Q8FA 2BNMA 1TME3 3MIDA 4XBLA 4ITCA 5LY2A 1GP4A 1VAMA 4Y33A 2DDUA 1OPMA 3CF6E 3JD72 1DYPA 2Y60A 4IV1C 5FZ6A 3VBUA 4EN9B 4Z92B 2UY8A 3AP7A 4QGMA 5GM0A 3BUCA 2JKXA 5HCFA 1D0GA 4L2NA 3T1LA 1QXRA 1UXXX 4CEWB 3SCFA 3PVOA 1GR3A 1O8PA 1R1A1 1BBT3 1VMJA 3IPVA 2ZEZA 3VL8A 2AREA 5JPNB 3WINE 1RUI2 2RJKA 4H55A 2XWJB 2O14A 4LBQB 2Y6JA 4WM8C 1OURA 1CWPA 1UKRA 2P3YA 2W87A 3IDBB 2HWC1 4YSFA 3TNQA 1J3PA 3FMGA 1JYTA 2Q1FA 4UWDA 5BNQA 4E8CA 1ZYBA 5ABJA 5FQ0A 4WM7C 2AR6A 4DY5A 1YQ8A 4I3PA 1HRV2 3FLRA 4AOCA 3BB6A 4GWNA 2OZ6A 4CU6A 5FWJA 1NOVA 3PURA 4YZ3A 1D4VB 4P14A 2XDVA 3I8TA 4YRDA 1D4M1 1HXS2 5FP3A 1AR93 2YXSA 3VV1A 2CNAA 2VCMA 3I2HA 1W2OA 4XC9A 3CJIA 2WJSA 4OMDA 5K0UA 3NV2A 2XUMA 1UU5A 1GOGA 2WZR1 4LEJA 4WM8B 4BLJA 1L7RA 1NE6A 3NNLA 4UW3A 4DS0A 2W94A 2CHHA 4R8HA 2J1AA 5EJ1B 5FJHA 4K7JA 4Q26A 1PVC3 1YWKA 1L7QA 4FPJA 4P9XA 5FWEA 2Z69A 3VBOC 1YFYA 1JZ7A 1YQ6A 3C3VA 1LULA 2ZGTA 3H7JA 3B9CA 3KGLA 5DAXA 3LOIA 4FFIA 5FJKA 3PMSA 1W05A 3A21A 3POIA 1PVC1 2ZGNA 3CMGA 5DUUA 1RUD3 1TVGA 3INAA 3WZ1A 3LEKA 1L7LA 4N53B 4CU9A 2Q8OA 3WNNA 5A7PA 1HRI3 3LF7A 2JD4A 3NV4A 2E63A 3OG2A 3ZPOA 1STMA 5T55A 1QJU2 2C0ZA 1PVXA 4WV8A 4FPOB 3H9AA 3HEIA 2CGOA 4UF0A 2EXJA 1TE1B 1XRUA 4NOTA 1RUE2 4RS5A 4CCEA 2RDSA 1RL3A 2IUWA 4NAMA 2JB8A 5JAXA 3C7EA 1XB9A 4YM0A 4WVVA 4NIIA 4JHZA 1ACCA 3TN93 4GH4B 1NLRA 1ENSA 2K46A 3ACGA 2OIIA 2WC2A 2DCTA 3RNSA 1BQPA 3MPPG 2ZGMA 4Y20B 1W9WA 3ZXEA 1RUF1 5C8CA 1KS4A 4DUXA 2VQUA 1QGLA 4KWUA 1DDLA 3I3EA 2PQQA 2SLIA 5E8AA 1H6YA 3VZJA 5GLZA 2ZGPA 1G8WA 3P3NA 4N9HA 4QGNA 4ES8A 4QGLA 1SEFA 5CISA 1KRIA 5FY0A 4XJAA 4FP2A 3HNMA 1K5MA 1ULEA 4CCDA 2RR11 3AB0A 3KF3A 4Z2AA 1UWWA 4BLIA 5ABJC 4AL9A 1W03A 4NRQA 1UD1A 5A7QA 2X05A 4Q2FA 4PLNA 5CB7A 4LHSA 1OOPA 4AR2A 2XBO2 3E5QA 4XFBA 1WBFA 4GIQA 4PF1A 3SEPA 2ZAAA 4CP9A 4JAAA 4YW3A 5G05L 3SISA 5AFEA 2G9FA 3VL9A 1AYN2 4F8AA 3USUB 4X6QB 3WCRA 1N1VA 1TZOA 4JTOA 4BPZA 2XJSA 2RR13 3LA2A 2FD8A 4XFCA 3LA3A 4CP1A 1CD3G 5JOYA 3U78A 4HN1A 1Y9MA 4AI2A 2P5BA 1F15A 2LTNA 5K8SA 5DUVA 5ACA2 3LSDA 3MIBA 1HRV1 1Y4WA 2IC1A 1B35B 2A6VA 1H9PA 4YZ2A 5FZAA 3H8OA 4BXFA 3WF2A 2UWAA 1IG3A 2HYKA 4WZFA 2HWF3 5GZCA 5EHDA 3VBHB 3I59B 3IB3A 1W8FA 2VVFA 4UFMA 4RS5C 4LLFA 2ZHMA 1VMHA 1W0NA 1PZ7A 3N7JA 3C2UA 2J1VA 4XYXA 3UESA 4D6RA 2FDKA 3OPZA 5KWRA 1W39A 3S0MA 3Q8AA 4LBMA 1ST8A 4OI4A 2RS13 1FMD3 1JTZX 4WM7A 4ES9A 4WVZA 4LUKA 1MEC3 1VMFA 3IM0A 4QD2A 5FYTA 1ULGA 4QM8A 2EICA 1RUOA 3FE5A 1CIWA 2IXHA 2Y0OA 3GYDA 1C3HA 3MHZA 4A7YA 5F1RA 3OBZA 4I01A 1FMD1 1MS4A 5F5QA 3RMYA 2VOTA 4MGKE 4O61A 2QZ2A 1XXNA 5L73A 2WZR3 4LITA 4IUGA 4PDWB 3AXEA 4YPJA 3THPA 5IVYA 2GMMA 4BCUA 2A6WA 5JSPA 1PO23 5FK7A 2HWE3 5E1RA 3NQHA 4CA9A 3ZN6A 1LB2A 5FYHA 2VZRA 3WQ1A 1W3VA 4TYSA 3HQRA 4COYA 4YW5A 4LO8A 5C7GA 4CXYA 4CUGA 2ATFA 3TEYA 5FXWA 4DXSA 2A6YA 2I45A 1NA1C 3POGA 3ZM8A 4K8FA 4XXPA 2UU8A 2Q8DA 1NZCA 3KV4A 4Q0SA 4QQ2A 1BZWA 1BEV3 2ZPXA 3B01A 4AFBA 1ND2B 5A1LA 3NJZA 2BVVA 4LBQA 2XH6A 2FBEA 4PDWC 4QPIB 5GZFA 4HT1T 3ZSJA 2J7MA 1B35A 3KHBA 1O91A 2W1UA 5FZGA 4LLOA 5LK7B 2WWSA 1F31A 2Q30A 2ARAA 2QNKA 4MADA 4E2QA 3VUOA 2FCTA 4HVQA 3I4IA 2G4IA 5FPZA 2VZUA 3SNMA 3UJOA 4ARXA 1UU4A 2BTVC 2BBVA 4FPCA 1W8WA 1ENRA 3KS7A 1ZREA 3IIAA 4UAPA 3MBWA 2UY9A 5IK5A 4A6SA 4IEQA 4PBPA 1PZ8A 1YFWA 5A7WB 1UL9A 2FMYA 1XSQA 2I07B 4XDQA 3O1SA 1JUIA 2E31A 1DG6A 5IVVA 3GALA 5GLUA 4F3JA 1G9AA 4YARA 1S2KA 4K1ZA 4QMAA 1XYOA 5DAQA 1L3JA 3ZFGC 5J48A 1MS5A 1GV9A 4QDSA 5HI0A 4RN5A 2BVBA 4OI1A 2GSYA 1RUJ2 2JWPA 1C5IA 4JTNA 1VBB1 2VOWA 1FOD2 1WD3A 5HCBA 1R081 1HN0A 2WFPA 4HFSA 2H6CA 5D2AA 4DB5A 3OYWA 2D40A 1AJOA 1XNBA 2ARCA 5CKMA 1RUF3 1VRH2 3HQUA 3AK0A 4I0AA 3AP5A 4ZXKA 3UK9A 5FZDA 4PHZA 4D3WA 4MGTA 5LBCA 1YLLA 5C3SA 4ZU4A 2QDNA 2VMGA 1OC1A 3GHNA 3M3QA 3TWIA 5EWSA 2R061 1AL22 2RJLA 4HVOA 3DUIA 1KD7A 4FQ4A 2WWJA 1C8NA 2WDBA 1LOAA 1NLQA 3ALQA 3ZFGA 1AUYA 5KXDA 3K3OA 1V6MA 2IXIA 2J1TA 3MGUA 1NQJA 3E5UA 4RGGA 5A3WA 1PMHX 1GANA 5KHJA 2BOIA 2E7TA 4NUBA 2WN2A 3WDUA 4L97A 2VTXJ 3M3CA 2AZ5A 2PXJA 2RS32 2CYFA 3N36A 2RJ2A 3FZ3A 4DUWA 1OQDA 3HR9A 1NG0A 4W6YA 2Z2SB 3APBA 1R083 1HW5A 2UYAA 2W52A 1RUC3 3J8F1 4M0NA 3WG1A 5KC5A 4AAPA 5L36A 3AYDA 4BA6A 1OT5A 2PAEA 3VLBB 3F2ZA 2VAUA 3CEWA 1HV1A 4Q4W3 1QOTA 2VMFA 4L8QA 4ZZ8A 1W8HA 2N7GA 3JU9A 2DUPA 1CAUA 2W91A 4YVSA 3QD6A 5CADA 4QM9A 3RS6A 3QOPA 2DU0A 4BQXA 3LEMA 1RC6A 4Q8KA 2JDZA 1DBNA 3T4HB 2YFZA 1LR5A 2E7QA 4META 5G04L 1GBGA 3BGAA 1NCRC 1IGOA 4MXWB 4LBLA 1SLBA 1WLWA 2V09A 4AFCA 5BNOC 3PVNA 3K4ZA 4Q4V2 1RJ8A 5FZMA 3WR0A 2W68A 4CCMA 1Y43B 2ET1A 5A3MA 4LPLA 3DF0A 2PMWB 4QU1A 2XVKA 2YPJA 4IV1A 1E5IA 2P3KA 1MACA 3IT8A 2EXHA 4Y4YA 2WBKA 3RVHA 1XU2A 2A1XA 2BRTA 2QQMA 2D6NA 3PVEA 1CAWB 1DZQA 2WNVB 5ANNA 5HBAA 5BNNB 1UMHA 5FZHA 5JI7A 1QQP3 2AYHA 1WCSA 2VTFA 4XABA 2WFF3 2WN3A 1AXYA 3AKRA 4DEQA 4UW4A 4DUVA 1HDKA 1EAH2 2B5HA 4JQTA 1IKQA 2QQVA 4Q27A 2BWCA 3GCXA 1Y9GA 4CEWA 3PVBB 5CNAA 4Z82A 1UW8A 1OA3A 3WP5A 5CEHA 4AHZA 1QJX1 3GHMA 2D44A 1XJAA 2WNUB 3I3DA 4JGZA 3ATGA 2EA7A 3VBRC 3CLPA 4FAHA 1REDA 1Y3TA 1FNZA 1QQP2 2B4KA 1SPPB 4KU8A 3BIWE 3NL1A 5LA2A 3OOXA 2JD9A 4IGQA 4JGYC 1XSRA 5IAXA 3VBFB 1A3KA 1ZBA1 2ZGLA 3IZOA 1YFXA 2WS92 4MGIE 1RUH1 4XFHA 2D3PA 1K12A 3ZYJB 3OUJA 3ZN5A 2DCKA 5L9BA 4XMIA 1POQA 4URTA 2ZOEB 3BPSA 4Q4X2 3CIHA 4I3GA 1WA4A 4CPBA 3HWJA 5A70A 4LKFA 3UT0A 2DVBA 3WD5A 5HXVA 4AVSA 4R52A 2BNOA 4QXHA 3RJRA 2B45X 3WF4A 5IK4A 3USSA 4H3WA 4AGVA 4KWJA 1DZRA 1IQDC 2PHUA 3VN4A 4CXXA 1POV3 3ZR5A 1TNRA 1Q56A 1RB8G 3LKJA 4BISA 1IS4A 2YU2A 1EY2A 2V4VA 1WLCA 2HWE1 3H50A 3WNOA 2YC0A 3EHKA 4FPLA 3O0WA 2PN5A 3AP6A 1UZVA 3A23A 1C8M3 4AI8A 3LOBA 1AR61 2JG9B 3OEBA 3NJVA 3IN9A 3P1IA 1QH7A 1LHUA 2XGXA 2H6BA 4YM2A 5T3NA 2ERFA 2WIIB 5AC91 4DQAA 5HV0A 3AZZA 2AACA 2D5FA 2R062 4NJ4A 3AMPA 4QXKA 4OYUA 3VD7A 2ZACA 4ASMB 4I2OA 2BQPA 3RGBA 2VUJA 2ZA9A 5JUVA 1XNAA 3AVRA 4BQ4A 4CUCA 4XJUA 1VRH1 2F4LA 3MW3A 3I49A 1H8TB 1SBDA 1ASJ1 4AZZA 4WVWA 1PHMA 4GMP0 3O1MA 1EPZA 2YV8A 1LJ7A 4LIVA 1S0CA 1I6XA 4FOVA 5C8CC 2E32A 1ENXA 1TMF2 3WHUA 1JYIA 5A6XA 2KA3A 5FZ8A 1IS3A 1W2TA 1AL23 3GGLA 3GJAA 3ZLIA 2GNDA 3TEWA 4CXWA 2BW8A 3CZUA 3THCA 1U12A 4AGRA 4Z1VA 3J8F3 4IW3A 1Q8PA 1GYKA 2D93A 1XE0A 1LGBA 1W2AX 1HIXA 1UYPA 5LA1A 2ZMKA 1HJGA 2R49A 1E5RA 3CNAA 5A1FA 4QX2A 2E33A 4FPFA 2RMU3 1XNTA 5FMBA 4YW4A 3URFA 5K0UB 4NAOA 4EWDA 1LECA 1XPWA 3I2GA 1COV3 2JE9A 1N1YA 1U0AA 4GXLA 3RSJA 4FVVA 3ZOIA 2XMLA 3O7OA 4RGKA 1PK6A 3HBKA 4O65A 5BNOB 4N7UA 5A3NA 1OBNA 3BI3A 1QH6A 4I02A 5JLVA 1OQ1A 2Y6KA 1LHOA 4TZDA 3LA7A 1FX5A 1NCRA 1WD4A 5J1XA 4ONUA 1CX4A 2B7YA 1Y9QA 5FYIA 4XTPA 1CVNA 1ENQA 1SZBA 2D5HA 2HEVF 1AZDA 2GP3A 1TMF1 2G9ZA 2KXLA 3OEAA 4PDWA 5FYZA 5A33A 1T6GC 5I93A 4YG6A 4ZONA 2CAVA 2QQKA 3QH6A 4QB2A 3SKJE 4CDXC 1XNCA 1UY0A 1LHWA 2JE7A 3U10A 3GBGA 5LA0A 5FV3A 2WS93 4YW6A 4CE8A 2B42B 2JDUA 5IK7A 3K48A 3WEZA 3OY8B 2XLFA 4AEMA 1JYVA 4NPLA 4QKNA 1DQ1A 4EZ4A 1RJ7A 3O1VA 1DGRA 4IETA 4UI9L 1JZ5A 3D8CA 1CAUB 2QUOA 1QJX3 2HH9A 1ZRCA 4GULA 3DCQA 1XU1A 5KHHA 1TG7A 3LIGA 1QJFA 2GN7A 1S55A 4CCNA 4D7SA 4CCCA 4TLFA 3W5NA 3CO2A 1EAH3 5JOXA 2OKXA 2VE1A 1PO22 1OVPA 5DABA 3PTYA 5CFDB 5J96B 5IFTA 3AKQA 1OD5A 1WW6A 1WCDJ 5C3QA 1LU2A 2VTXA 4BIOA 3TB0A 4FTEA 3J7MA 2XOMA 4YG3A 4QKDA 1YXWA
chains in the Genus database with same CATH topology
5SV8A 3W58A 4XF0A 1J59A 1H1MA 2D3SA 3J26N 4FCAA 3W59A 4IEXA 1PGW2 2D3RA 4YGEA 1CESA 3AP4A 2DUQA 1PNGA 4QQOA 1M06G 5F6LB 2EVXA 2Q1ZB 4XF4A 2OUHA 3RWNA 3ASIA 4Y5Z0 1C5HA 1UU6A 1PGL1 3H8UA 4CDWC 2ZX0A 2RS12 4CDUA 2PHXA 5GZDA 1RUC1 1W2UA 2P3JA 1TME1 1RUC2 4LO7A 4AFMA 4JVAA 3L2YA 1QDCA 1BVP1 3AM2A 3ZXAC 5H9SA 1RTVA 4IEZA 3MFCA 3ME2A 2LALA 1ND2C 4EWAA 4Z2WA 1VB2A 1W0OA 4YNIA 2CY6A 3J4UH 5EFUA 4MH0E 4WZCA 2QCSB 3WP6A 4FPKA 1V6LA 1H1AA 1AYN3 2NM1A 3V0AA 2A73B 3DPRA 4IXLA 2VOVA 1UCXA 2PTMA 2XBO3 4K40A 4XHXA 1CR7A 3QH7A 3O14A 4C90A 3ZX7A 3D0JA 4NPRA 4DZGA 5FLJA 5J7MA 2BFUL 1C57A 1QF3A 2IFWA 4JV4A 4OUMA 4B4QA 1RUJ3 1REEA 1HRI1 1FPN1 4K3UA 5CVRA 2NZ9A 5D1IA 5T5PA 1PIV2 4FPYA 5DZEA 4MZUA 2GALA 2W39A 3U07A 4HKOA 4COWA 1VRH3 2RM21 3EQEA 3OY8A 3ZIWA 3NAPC 1EV12 3HBZA 2O8QA 4UXAA 2ZX2A 4Q8LA 1FYUA 2R1DA 3ZN4A 3MIGA 4OUSA 1AL21 3WNXA 5JMCA 4MGYE 5FO7B 4Q1PA 5CA6A 4LTAA 3D5OA 4R9AA 3A4UA 5B2GB 5J3UA 1RUNA 2EIGA 3POYA 5D8AB 3AFKA 3GZAA 4FPEA 3PMEA 1IPJA 4XILA 5C6CA 5IUQA 4AG4A 1YIFA 3NAPB 3RJ2X 3ROUA 3EXUA 3ZMNA 5T5JA 4Q0PA 4S2GA 1C28A 3VBHA 1MVEA 4LBJA 5FREA 1RMU1 3IPVB 5KHGA 4M3CB 3KT1A 4A7KA 1QWRA 3M70A 4LO4B 3MI8A 4OHVA 4J1WA 2ZTNA 4D69A 4EJRA 3V0BA 2VG9A 2ZX4A 4WBBA 5J98B 1KS5A 2R042 4PLOA 2ZGRA 1MZFA 1OFSA 4XQDA 5C4WA 2XHKA 5KXCA 1G9CA 1RMU3 3L9JT 1QHDA 1OSGA 1AR62 4JGZC 1TEIA 3AJYA 4JCKA 3THTA 1LRHA 4LNVA 1DGRN 3VBOA 3WDYA 2ES3A 4BMBA 3WCSA 5J36A 4FXKB 1ND3B 4XF3A 3MFAA 3WG4A 1RUI3 4N43B 1LESA 4A2UA 1AR82 2K9ZA 4HPKB 1ASJ2 1MS1A 3P3PA 2HKXA 3JQXA 2PHDA 1N47A 4NR1A 3O0XA 3WQ7A 4HK8A 3D6EA 2ZMNA 3VGIA 4XOGA 1Q5OA 1R1ZA 3WW1A 3H1YA 1O3TA 5FOBB 1S1AA 2XJUA 3NKGA 1O5LA 3N7MA 3ST7A 3RYPA 1QQP1 1CAVB 3UV9A 1XYNA 2ZKNA 4QQHA 2XKPA 4RR3C 3AZXA 2VVEA 4BWOA 3JBG3 4INDA 3POWA 1UIKA 5AFBA 3KGZA 3B7MA 3V0BB 3MLLA 1MS3A 4LO6B 3ZXFA 1XYPA 5I0SA 4LA2A 3V65A 3D0SA 2E9QA 5H9RA 1CN1A 1D0HA 3VHRA 2VW1A 2D6MA 4Y22B 4LBOA 1SLIA 4CRQA 2WFF1 4YVWB 4JDNA 1ZM1A 2ZGOA 4Q4V1 4RHV3 2R072 4AF9A 1OA4A 4B4RA 1VBC1 2DFBA 1GZWB 2QVSB 3KLSA 1N1SA 5FTTC 1DQ4A 4JQRA 4RL7A 2RHPA 1U5YA 2DCYA 5FPXA 1KDMA 1ALYA 5DXDA 4R9BA 2H0VA 3AJZA 2VULA 1ZRRA 2AH2A 2DWRA 3NV3A 2HEYF 4S2FA 1Y7BA 4K1YA 2PYTA 3ZXJA 1ZX5A 4KGGA 5KXBA 5FMOL 2WA4A 1RUD1 2UURA 5J37A 5KXEA 3MICA 4EN7B 2GN3A 3ACLA 1RUG3 2YGLA 5FAXA 2IXKA 4BE3A 1R1A3 2P37A 2E7AA 3B3QE 1BKZA 3JQWA 1LODA 1MS0A 2R1BA 1ZZ7A 5CU1A 3BODA 3OCPA 3ZYRA 1AF9A 1WMFA 1X50A 2YYOA 3EBRA 4KL1A 2Q0AA 2GC0A 3AZWA 3PJYA 1VAKA 4Q0VA 3SCGA 1B09A 4LE3A 4ISRA 2A71A 1MQTA 4I0WB 2DF7A 4CDQA 1GKBA 2LM3A 2XVLA 4JC1A 4YFZA 2BGCA 4ZU5A 3RI9A 2CAUA 5T5LA 1V6JA 3FBYA 2JG9C 4IEVA 1FATA 1EV11 2HWC3 4HKLA 1O3RA 2CL2A 4BYYA 1CGPA 2B8MA 2VY0A 3OD4A 5JSOA 2VW2A 4RHV2 3VHNA 1QY4A 3FX3A 1H8VA 4XFAA 2VECA 2RMU2 1J1TA 5C4WB 5CAZA 1HXS3 1LHVA 1COV1 1Q8VA 1WBLA 3DL3A 1F9KA 2Q5TA 2D98A 4JDMA 4RQPB 4YW2A 3KT4A 5FLHA 1O7FA 1KDKA 4LHNA 4K21A 4AVCA 5I91A 3UKNA 1LOCA 1O4TA 1MEC1 3VBFA 1X33A 1VBB2 2HEWF 5C33A 5T50A 1D4M2 1HXS1 3VBUC 1UZZA 5BPXA 4XPVA 4YGBA 2HWF1 1UPSA 1GLHA 4Y20A 1QMJA 3AYEA 1ZBE1 5C8CB 5CFDC 4OFGA 1IZ3A 4GKXA 3MYXA 1TMF3 1YNAA 2PA7A 1PO12 4AVBA 3KZ4C 3FBMA 2WNVA 2R16A 1H4GA 2PLV3 1M4WA 2NMOA 1DQ0A 3VDDC 3H0OA 5FRAA 3WW3A 4YVWA 4DOUA 1CJPA 4CDUC 5LEJA 2ETEA 4X6RB 1IPKA 3N35A 5DUWA 3RYRA 2PAMA 1YI7A 3JD71 1RGSA 5DDJ3 4MXWA 1JHNA 4IV3C 3VKOA 1VBC2 2R071 4H14A 1SBEA 3ZXKA 1DF0A 2OPKA 4AEDC 5A3LA 3S7EA 1DIWA 4COVA 4OZXA 3A0KA 3NKTA 1H2LA 1LOEA 1H2KA 1EPWA 2VMHA 5GLWA 3BU7A 2P2KA 2XJPA 2NP0A 1WW5A 4PF5A 1ZBA2 4N90A 3O12A 1BK1A 3M7AA 1FXZA 1RVF2 1AHSA 1BCXA 1JN2P 1RUG1 4P9GA 2WQZC 4WM7B 1POV1 2ZABA 4G4FA 1AYM3 3CL1A 1N1TA 3AYAA 3WT3A 4AI0A 4C1WA 4FAGA 3LWCA 1QJX2 1J1LA 3UJQA 1C4RA 1AR73 1VBE2 1NY71 1G9FA 4IQPA 5FFOC 2VUAA 3I2DA 2HWB2 2WLPA 2PAKA 3RPQA 1F5JA 3DV8A 1XE7A 2ZMLA 1S0FA 4HLTA 2V73A 4MYEA 1AYN1 4HKWA 3VBOB 1AJKA 1V9U2 2LUWA 1AYM1 5DG2A 1VBC3 3B9IA 1W6OB 4FBFA 4F7ZA 1W6QA 4JDOA 3AFGA 3CJXA 3WX5A 1VLNA 3BOPA 3VBUB 1IKPA 1OI6A 4UW5A 3WDWA 3KQRA 1K5MC 2FMDA 3BOWA 3IDEA 3POSA 4ISQA 4Q1RA 4SBVA 1G6NA 4M00A 3JUUA 1OHFA 2IFRA 1MEC2 2Q4SA 3WUCA 5BNPC 2HWD2 2NN8A 1PMIA 3VZOA 1JUHA 1QXPA 1GQHA 4N7IA 1X8EA 3FUOA 4LHKA 4LUMA 3SMHA 4MX3A 3VZLA 2G9GA 3SH5A 4DFSA 4OHYA 3HN1A 4AEDA 5FDBA 5C4WC 2R041 3GBWA 5IT6A 4D7YA 5JR7B 1LTEA 1AX2A 2RMU1 2VMIA 3H3UA 3MIFA 2EXKA 2IXJA 2VNOA 1XNKA 1F5FA 4Q4W2 1COV2 4EN6B 1PO13 2A5ZA 3TN91 4NN0A 2XPJA 2CWMA 4GQ7A 5GZGA 4XW3A 4KGQA 5H9PA 1QDOA 4PCRA 1Z78A 1LGNA 1PIV1 3OBTA 1UMZA 4RHV1 1XNDA 5KC6A 1ZZCA 4B7KA 4OHWA 2WNEA 4Q4W1 4N53C 4B4PA 1RUF2 1AR91 3B00A 3HMYA 5BY5A 1V6OA 1N3QA 2RE9A 1CAXA 4NWWA 4KG0A 4KNCA 4BM8A 3U0ZA 1CONA 1W6PA 2XL7A 3NV1A 4YVWC 1J3QA 2B46X 2GMEA 2Z5WA 2VVDA 2R0HA 1S0DA 2WINB 5FO9B 4I09A 3ZSEA 1BVVA 3B69A 4QPIC 1NXMA 2YROA 3AMMA 2IWGB 3SXWA 2R063 4IL7A 4OVEA 4BH9A 4DRRA 2DURA 1FI2A 2ENRA 2XWBB 1YFUA 4IV3B 4NHLA 2JEMA 3TAYA 1UIJA 1I5ZA 2JJ6A 2OUJA 4E4ZA 2DU1A 2TUNA 1LCLA 3VKNA 5FOJB 1GFF2 4QPGB 3QBQA 2XG3A 2VGDA 5FBZA 3KB5A 2FZ2A 3HIFA 3IMNA 1WMDA 3OD0A 4Q4X1 1U5XA 3KT7A 2HWB3 4PIZA 1PM7A 1AX0A 4XFFA 5JZGA 4HL0A 1GZWA 4FPHA 2DTYA 3WW4A 2UYBA 4YM3A 2HWB1 4NHMA 4CZSA 3E5XA 1AX1A 1S0IA 1VBE1 1BXHA 1ULCA 2NMNA 2OA2A 3AKSA 2XB6C 1HLCA 2IXLA 4M01A 1DQ6A 2IXCA 2WFF2 2Z42A 2BFUS 2MEV3 3WP4A 4IERA 3AMHA 4V1PA 4RQPA 1IOAA 3KMHA 1LU1A 3DPRC 3USUA 5JOZA 4P9YA 4YZ5A 3KSCA 2F4PA 3JBG1 3QLQA 3U4XA 3FFZA 1A8DA 2FQPA 1W6QB 5C8WA 1AYM2 3H7YA 4P9IA 4C1XA 4AQSA 1LHNA 1SFNA 3M1HA 4I0BA 2GC1A 4R4ZA 1FMD2 3VKLA 1YJKA 5BXXA 1W0PA 5DDJ2 1W6OA 1FT9A 1QXJA 3O0VA 1APNA 1NY72 1VIWB 3OBRA 3VZKA 4B8EA 1DLLA 1V6KA 1IQAA 1YIPA 3FHIB 4K6BA 4P9LA 3IDCB 1DZTA 1W6MB 1XE8A 2CTVA 3FJSA 3NAPA 4M0HA 4G9SB 1ND3C 2VH9A 4B3NA 2JX9A 2Q1MA 3BTAA 4DMIA 4CEYB 4AWDA 5CBLA 2YGMA 1W6NB 2ZGSA 3N4MA 2GC3A 4B7EA 4OI2A 5I0TA 1PO11 3VZMA 2QQPA 4RR3B 1RHI2 4CTEA 4AHYA 4J1XA 4XHBA 1UKGA 4YYOA 2RS52 1VALA 5I8YA 5LRRA 2HWF2 5ACA1 4E2GA 1ZZ6A 1S0JA 4H7MA 3LAGA 1UZYA 2WNUA 4CEYC 4PJYA 4K9SA 1G9BA 1DYKA 1FPN3 5EYYA 4OLLA 3SCHA 1AR83 4AHWA 1D2SA 3AP9A 1FNYA 5K9YA 2QFEA 3E97A 4GKYA 4XBNA 3R6SA 1OA2A 2TEPA 1ND2A 4FOWA 2MNGA 1YI9A 4QPGC 3CJIB 4KWKA 1RMU2 1VJ2A 1GQGA 2UWBA 2MPFA 5BNOA 1OLRA 1OLQA 5FO8B 4Y22A 5IK8A 2R043 3HAGA 4KH9A 4A7ZA 1MZ6A 2BPA2 2VQAA 2XLAA 4FQZA 5FQ0B 1QU0A 1FOD3 3WW2A 4A3XA 2R6QA 4YVSB 4HK9A 4JRLA 1KFUL 1OOPC 1H9WA 2A70A 4QPYA 2QZ3A 3VDDA 5A32A 1TNFA 1MR5A 4FSJA 4CP0A 1AXKA 3T1MA 4R9DA 3ZO0B 5DUXA 4LT5A 1OKQA 3OGJA 4CEWC 1G86A 2ZX3A 1YJLA 1BEV2 4LBKA 1KJRA 2D43A 3ZYIB 3ILNA 3S30A 1ZZBA 4LHLA 1PVC2 3S6PA 1MS9A 1YYNA 5CG9A 2RM22 1QJZA 4JGYA 2A75A 3ZFGB 1HV0A 5EXOA 2QE3A 5GLVA 1LEDA 4RQPC 5AVAA 3WP3A 1HRI2 1UAIA 2ZHLA 2RS51 1CAVA 1RUD2 4CDWA 2YUEA 5JOWA 2DVGA 2QJVA 4KWLA 1ZZ9A 3T2TA 2WZR2 1PZ9A 3R4UA 1WMEA 1ZBE3 2GH8A 3MDPA 3I54A 4IEWA 1S0BA 4CDXB 4BIFA 1HRV3 4Y1XA 5KHKA 1JW6A 5EYXA 4XETA 3V0AB 3JB4C 4AQ2A 4XJWA 2YHJA 4D94A 3FLTA 2CGPA 3WQ0A 3SH4A 2MHFA 3HD8B 4GB33 4XMAA 1SLCA 4BMEA 2JECA 4MGZE 5CIRA 1EV13 4GA9A 1VP6A 2H0BA 5E16A 2Y26A 3VBHC 1N3PA 1QOOA 3AKTA 3S7IA 4D7TA 4P9JA 4FOYA 4W65A 4IEUA 4FOQA 5DDJ1 5J09A 2R073 1ZZ8A 4AHXA 3JD73 3N7LA 4FT8A 4HBNA 2WS91 3B94A 2WT1A 2MEV1 3ES4A 3DGTA 3RI8A 3VBRB 1H0BA 4L92A 3ZSMA 1O3SA 5ACA3 2RS33 4WM8A 1PGL2 3SITA 4QPIA 4XIKA 3ZFFB 3VBSC 1Z7S2 3SHRA 5CFDA 3WY6A 2GC2A 3ZIXA 1YCIA 3LSEA 4L9BA 3RDIA 4BZ4A 4XJ8A 1PGSA 2F6BA 3RQ0A 4HN0A 5AC93 2A6ZA 4GWMA 4HANA 2GNTA 1YHFA 1DQ2A 4IV1B 4SLIA 1Z0HA 3ZDSA 2O1QA 5ABJB 1C1FA 4MVTA 5DG1A 4BOWA 4ZU7A 2WT2A 3ZYGA 4YFWA 1A8MA 5D8AA 2KM2A 2XKOA 5FMOS 3V64A 4HVRA 4FTBA 4ZKTB 4RA0A 1BYHA 4KU7A 2WKKA 2BWAA 2YZ4A 5GZEA 3NWKA 3GF6A 1QNWA 3VKFC 1PO21 1LOBA 1BJQA 1NXD1 1UPIA 3WOGA 1GSLA 1G9DA 2R32A 2JENA 4LE4A 4B29A 3WG3A 5F9TA 2QDRA 5A33B 4XQWA <