2DURA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+/man2-bound form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
251
structure length
251
Chain Sequence
SEHLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEENIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 60
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2durA01
3WV6A 4FP2A 1DQ4A 2YY1A 1N1SA 1V6OA 1IOAA 4F83A 1Q8OA 4OZXA 3V0BB 3I4IA 4M01A 4DRRA 2WNEA 1GKBA 3KQRA 1MS8A 2EXIA 1QU0A 3M3QA 3VKLA 2R0FA 1CESA 1SFYA 2XB6C 1WLDA 5KXCA 1ENQA 1F5FA 1W6PA 1V6KA 4I30A 4BLJA 2VW2A 1U0AA 4XHXA 2EALA 2DVBA 4P9XA 3WG1A 5T55A 1WBLA 2D6PA 3ILFA 1IKPA 1ZM1A 3JU9A 4XJZA 5H9PA 2AYHA 1S0DA 2ZGOA 4AVSA 3DGTA 3NV4A 4YZ2A 5HCAA 1Z0HA 1Q56A 2C9AA 4AWDA 3M3CA 1SBDA 5DG2A 2NMOA 3GALA 4LBKA 1G9AA 3N7JA 1SBEA 2H0BA 3M3OA 3O12A 3NV2A 2ZHLA 1W0OA 2Z42A 4YLZA 2PHRA 1CVNA 2GN3A 2ARXA 1VAMA 4PQ9A 5L73A 3ZXKA 4Q8KA 1BKZA 3N7LA 5HCFA 1I1EA 3V0BA 5GZEA 2YZ4A 2DYCA 2GNTA 3HR9A 3B01A 5H9QA 2JECA 2SLIA 2ZMNA 3SLIA 3MPPG 4XBNA 1DYPA 2GNDA 2PHFA 1IS6A 2DU1A 1A3KA 2ZGKA 2SBAA 1G9BA 4JCKA 1MS5A 3L2YA 1O4ZA 2GNMA 4XILA 1URXA 1LOBA 1YO8A 1IKQA 2E6VA 2ZGLA 1R1ZA 2WT2A 2ZGUA 3ATGA 3O0WA 1FV3A 1DIWA 2D3SA 2UWCA 3Q9OA 4YM0A 1WD3A 1V6IA 1Y7BA 4YGBA 2EXHA 3LCPA 4LBLA 5IUQA 1S0FA 3WLUA 2UWBA 2WT0A 4YZ5A 3LSEA 5F9TA 5T54A 1LU2A 1AVBA 4AYUA 5GJ6A 3WHTA 1SLAA 3BIWE 3N7KA 1N3QA 1YIFA 2NMNA 4LBQB 3ZXEA 5JMCA 1LU1A 1HLCA 1LHNA 3VUOA 2NM1A 2PHUA 3FLRA 1MZ6A 4SLIA 4NO4A 4AGVA 1JHNA 2C5DA 2YMZA 4Q1PA 1LGCA 1FNYA 3T1MA 4DPNA 1KRIA 1N1VA 4Y1VA 3WDXA 4RA0A 2AUYA 1WW7A 4YM1A 4BMBA 1ENSA 1MACA 1KITA 2JE9A 4FP3A 1S0IA 2A5ZA 1H9WA 3B00A 3SH4A 2ZGQA 1GYKA 2ZGRA 3D4KA 2E7TA 3WDTA 1LGNA 3KM5A 2JJ6A 3AXDA 2V5YA 2YXSA 4YZ3A 2AREA 4Y20B 2UU8A 3OGGA 4CTEA 5KXEA 4YG3A 3OBTA 4LBNA 1WW6A 1S0CA 3PVOA 1N47A 2P3KA 4XDQA 1V00A 2EIGA 5SV8A 2FHRA 1JW6A 4LBQA 2CYFA 2ZBJA 2ARBA 2DURA 1D2SA 3WCRA 4YFZA 1QDOA 2I2SA 5E8AA 5CBLA 1B09A 3WDUA 5IT6A 3TB0A 1QKQA 5T5LA 2PHXA 3AZYA 3ZSLA 1GBGA 3RG0A 1IS4A 1S0BA 4FOQA 1MS1A 4UW4A 3AX4A 1KDMA 2D3RA 4TYSA 2R1DA 3ZPYA 1EPWA 4C1WA 3O0VA 5DXDA 3W58A 3PVEA 1W0PA 1CIWA 2A71A 5DUXA 4XJAA 1S1AA 2OW4A 3MEPA 3ILNA 4GA9A 1G9FA 2DV9A 4GXLA 5F5QA 1C57A 1AF9A 3MW3A 3OYWB 2P37A 4Y20A 1GZCA 1UL9A 3FLPA 4Y1UA 1VIWB 5GLTA 1LGBA 5JDBA 1S0JA 4DFSA 1LOFC 4GWMA 4ATEA 2D44A 2GMEA 4KBBA 5DZEA 1LOAA 5FREA 3SNMA 3AYCA 1UZYA 1LCLA 1RITA 4PCRA 4XZPA 3UL2A 1ENRA 5CNAA 1SCSA 1IS3A 4Q8LA 1OQ1A 3AYEA 2G4IA 3ZYRA 4YGCA 3AP6A 4M3CE 1V6LA 3A0NA 1F9KA 5GZCA 4FPEA 4FPKA 4ISQA 2E53A 2LALA 3MW2A 4GALA 3ZSMA 3IN9A 4FPJA 4GKXA 1QNYA 3AYAA 1YI7A 2ZGTA 2OVUA 1FX5A 2OUJA 3TAYA 3WCSA 1RINA 1QGLA 2R0HA 3VKOA 3BOPA 3AP5A 1V6MA 1WUVA 1W6NB 4IQPA 1JXNA 3OPZA 2AR6A 3FUOA 3OYWA 1UPSA 3SH3A 2RHPA 5CAZA 3V0AB 5GLUA 4TZDA 1DQ5A 3VKNA 3M1HA 4MYEA 4FPYA 3AZZA 1WLCA 1DFQA 3M2MA 5DUUA 2GMPA 5DUVA 4FOWA 4AGRA 2JDZA 3AYDA 1ULFA 5IK4A 4PBPA 3VV1A 4FPGA 4ISRA 2CY6A 3AZVA 5GLZA 1MS4A 2GMMA 1N3PA 3LSDA 2A75A 4M00A 1J1TA 1WW5A 1UAIA 2VY0A 2TEPA 3RMYA 1IS5A 3O0XA 3RMXA 1G9CA 1WLWA 1V6JA 3RS6A 1ULGA 1LOFA 3RQ0A 5T5PA 1KJRA 3AJYA 4R9CA 1CN1A 3AK0A 2ZHKA 4K21A 3RRDA 4ASMB 2W39A 4FVVA 1DQ2A 4Q27A 1DHKB 2P34A 4YGDA 1HQLA 2NP0A 2AENA 1LHUA 3WOGA 1G7YA 3D5OA 1W6NA 2VXRA 4YZ4A 4YFWA 4XMIA 5GALA 1W6OB 4Q1RA 3O5SA 1GSLA 1KJLA 1ULDA 3OY8B 3WUDA 3V0AA 5DZFA 1AXZA 1VLNA 2A6YA 2DTWA 5GM0A 1OKQA 1Z78A 2VUAA 2DUQA 2R16A 3WG4A 1JYCA 3HN1A 4XBLA 2CL2A 2UWAA 3R4UA 1BJQA 1SACA 1DGLA 4XBQA 5KXBA 3ZSJA 3UJOA 3VKFC 4Y24A 1S0EA 3BODA 1FATA 1QOOA 2GALA 2A3YA 1C4RA 1UZZA 1LECA 1JYIA 4DRVA 5JOZA 1KDKA 2ZMKA 4UW6A 3FLTA 3QLQA 4CZSA 2ES3A 4XJ8A 1ZA4A 4YW1A 1DQ1A 1PZ7A 2GDFA 1VAVA 4GKYA 1DQ0A 1QOSA 3I8TA 2XG3A 2B7YA 3AP9A 1A78A 2VW1A 3R4SA 4JC1A 3NV3A 4LBMA 5GLVA 1SCRA 3PMEA 2EXKA 3WUCA 2A6XA 2HYKA 2FMDA 2ZGPA 2CWSA 4K1ZA 4BQ1A 1W6OA 1SLCA 5DZGA 4XYXA 4P14A 2CNAA 2JE7A 3OY8A 5EYXA 2PHTA 4C1XA 4XXPA 4YM2A 4YW5A 2AH2A 2A6WA 2YV8A 2WQZC 4XMAA 5CA6A 3SH5A 3V65A 3WHUA 4Y1YA 3NV1A 4FOYA 3ZSKA 2PHWA 2D6LX 2VH9A 2W08A 1F31A 2ZAAA 2A3XA 1DLLA 4UW3A 3BTAA 2JKBA 2YROA 4M3CB 4HANA 1CONA 1AJKA 1HKDA 3NWKA 3WVJA 1LOEA 2ZHMA 2W68A 2ENRA 4Y26A 1MR5A 3AP4A 5T5JA 3WG3A 5JOYA 2WT1A 2E7QA 4YW4A 3ASIA 2A70A 1SLIA 3D6EA 4WV8A 4FOVA 1JN2P 4R9BA 1RIRA 4R9DA 5JLVA 1O4YA 2AGSA 4L8QA 1LODA 2ZMLA 2VU9A 1LTEA 3RSJA 3ZXLA 2P3IA 3WZ1A 2ZGNA 4AVVA 4U36A 1VALA 3MW4A 1KQRA 5H9RA 4BPZA 1QNWA 3U4XA 3ENRA 1SLTA 4YG6A 1HQWA 1UKGA 4ATFA 3AXEA 2D43A 1WD4A 4K20A 4P9YA 1ONAA 1AXYA 1Q8QA 5GZFA 1AXKA 1NLSA 4WZFA 2DWRA 5E88A 4JRAA 4ITCA 4XJ9A 4NOTA 4XIKA 2ZACA 3AZXA 1AX0A 4ZKTB 4M3CA 2EXJA 1G8WA 2ZGSA 4XHBA 1WW4A 3WG2A 5GZGA 2DVDA 1NXD1 1AZDA 2DU0A 2P3JA 1Q8SA 4FQ4A 5T5OA 3DUIA 5GZDA 2D6MA 2DVGA 4Y22B 1YYNA 2WSUA 3IM0A 4XIOA 3AP7A 1GLHA 3AJZA 2DVAA 5E89A 3N7MA 1GANA 1GZWB 1G9DA 1BZWA 1PZ8A 4XJUA 4FPHA 3IMNA 3R05A 4WVWA 2ZZJA 2PELA 3POWA 2A7AA 2OUHA 2D6KA 2NN8A 2DUOA 3N3HA 4LBJA 5DUWA 4YM3A 3POYA 4ZXKA 1W6QB 5AVAA 3USUB 1V6NA 3WDWA 4H55A 4Q2FA 3ZYPA 4Z8BA 5IK7A 2Q5TA 1PZ9A 5LK5A 2D6NA 4DS0A 1I3HA 1LULA 5GLWA 1ULCA 3VKMA 5KXDA 3AZWA 1DYKA 3ILRA 2CTVA 1H30A 2A6VA 1MVEA 2GN7A 4RL7A 1SLBA 3M3EA 4YW3A 4YZ1A 1MS9A 1MS3A 3CNAA 4XJWA 4Y22A 4Y1ZA 5T50A 3ZXFA 2D3PA 1YXWA 3C2UA 1GZWA 2VW0A 1OFSA 5H9SA 1N1YA 3B69A 4P9WA 3IPVB 1LHWA 1APNA 4Q26A 1DZQA 3UK9A 3WNXA 1QMJA 2R1BA 1LEMA 3N36A 4LBQD 5EWSA 1W6QA 3W59A 3USUA 3OBRA 4XXAA 5FRAA 3QCWA 1FNZA 1XQNA 4D69A 1X50A 5IK8A 3WDYA 1BXHA 2WSVA 4R9AA 1FYUA 2KM2A 2JD4A 1BYHA 1LENA 3GNEA 2ZKNA 1Q8VA 2A6ZA 3ZVXA 2DTYA 3T1LA 4W65A 3APBA 4U2AA 4WVVA 3A0KA 3IKWA 1UN1A 2DVFA 1JOJA 3SITA 3JUUA 1N1TA 3FFZA 1GV9A 2W52A 4XTMA 4AVTA 4FPOB 1HDKA 1LESA 1MZ5A 1TEIA 2ZGMA 4LBOA 5IK5A 3UJQA 2LTNA 4XE9A 1LOCA 3HMYA 3B9CA 2E51A 5EYYA 4XOGA 1GNHA 1SBFA 5HCBA 1CQ9A 4HL0A 4K1YA 4BOWA 2D7FA 4AGGA 1UX6A 5JVVA 3IPVA 2EF6A 2NYYA 4BM8A 5JOWA 1FV2A 4CRQA 3AFKA 3V64A 1YRZA 1C1LA 4XTPA 1DQ6A 1QF3A 1W6MB 3FUQA 1CR7A 1GZ9A 5T52A 2WLQA 5CB7A 2V73A 1ULEA 1G86A 4BLIA 3SISA 2ZABA 1AJOA 3PJQA 3A4UA 4FPCA 4YW2A 3B3QE 4YG0A 1H9PA 2WJSA 2P2KA 2NZ9A 3INAA 5DG1A 1D0HA 1LJ7A 3T2TA 2WKKA 4YGEA 4FPFA 1DBNA 1LEDA 4UW5A 2R49A 2EAKA 4PBOA 3H0OA 5BYNA 1WBFA 2D6OX 2A3WA 5JOXA 2ZHNA 2GNBA 1LHOA 1MVQA 3N35A 4BMEA 1SLLA 1WCSA 4M3CF 4PF5A 1W6PB 5EXOA 3ZXJA 1QDCA 1UMZA 1BQPA 3FBYA 4FQZA 1A8DA 1AX2A 1Q8PA 1GNZA 2DUPA 1S0GA 1C1FA 2ERFA 1AX1A 4GWNA 2CWMA 4DQAA 1CPMA 1CJPA 4Y1XA 4FPLA 2ZA9A 1GICA 1LHVA 2UURA 3OJBA 1FAYA 1N3OA 1W6MA 3WDVA 1JUIA 3PVNA 2BQPA 1LOGA 1JBCA 3POSA 1QOTA 1MS0A 1CPNA
chains in the Genus database with same CATH superfamily
3EBRA 4Y5SA 3ZYGA 5CG8A 1N1SA 1V6OA 1TME1 4CUAA 4A3XA 5FWJA 2FCUA 2HWB3 3O14A 4OZXA 3I4IA 4P5YA 3WW4A 2BTVC 3N9LA 2VMGA 4RHV3 3VBRA 5FPXA 4Y33A 4AI1A 5C4WA 1OF3A 4N53C 3VKLA 4AF9A 1EAH1 4E4ZA 1ASJ1 1SFYA 1X9PA 2XB6C 2VTXJ 3MIFA 4WVMA 4XAEA 1RUH1 5FZOA 1NG0A 1V6KA 2BDRA 3LIGA 4LKEA 3VD5A 4IGPA 4CU8A 4K6BA 1GZTA 4BLJA 1U0AA 4BQ5A 4PQQA 2EALA 2DVBA 2JG9B 3Q8FA 4AR2A 3W5MA 5T55A 1TMF3 3ILFA 5DDJ2 1UOJA 1H1AA 1W0NA 1AR92 1YJLA 2F6BA 2ZGOA 3WSOA 3NV4A 2PAEA 1SQ4A 2JIJA 3BCWA 4DXSA 2Q8CA 1YFWA 1RUD2 4YZ2A 4RGAA 1Z0HA 2ILMA 2C9AA 4MHUA 5DG2A 5A1AA 1RUJ3 3J9SA 3K51A 3UKVA 5JXHA 3O12A 1D0GA 2LUWA 1UIKA 5CKNA 1HXS2 1RUI3 4QKFA 4PQ9A 1VAMA 4Q4W2 3ZXKA 4NIDA 1BKZA 2IFRA 3ZXDA 1Q3EA 2BGPA 4Z1VA 1H2MA 1MEC1 4DXRA 3TWIA 2VZUA 1OUXA 3HR9A 4CDQA 5C33A 4KWLA 1DGWA 2YDEA 1W8NA 2RMU2 3MPPG 4C90A 1IS6A 1NKGA 2VULA 3AKPA 3DPRA 3K2OA 3ZFFB 1D4M3 5FLIA 5KHHA 2D98A 1J83A 3MIGA 1OSGA 5JZGC 3O0WA 2OPWA 5FZ3A 2XBO1 2WT2A 3ATGA 1CAWB 3Q9OA 3ZDVA 4QXCA 3TRSB 4I2OA 1POV0 1UO9A 1Y7BA 2QVSB 3FWEA 3LCPA 4MGIE 4Q4Y1 4XACA 1S0FA 5IUQA 2UWBA 3WLUA 4AFDA 2J1VA 1G6NA 4XDOA 2VZSA 1AVBA 4CYDA 2BP6A 4IV3C 3DCQA 1N3QA 1OFNA 1Q5OA 1HLCA 2R073 3C8XA 3SCFA 1GOGA 1MZ6A 1RHI3 4SLIA 4LPLA 4PHZA 3WP3A 1S4CA 4Q1PA 3KVAA 3T1MA 3KF3A 4AGVA 1GR3A 1CX4A 1PK6A 1TG7A 1N1VA 2TUNA 1FPN2 3VGIA 1PGW1 2VVEA 2ZX2A 3I2HA 3DECA 1WW7A 1MQTB 3Q8AA 4XW3A 2HWF2 2JE9A 4FP3A 5KR7A 2A5ZA 3SH4A 4CDUC 4B7KA 1I5PA 2ZGRA 4N43B 1PO12 4NROA 2XLFA 2X05A 2E7TA 4CU7A 5ABJB 1RVF1 1LGNA 2XUMA 1QJZA 2JJ6A 2OZJA 3AXDA 4RR3B 3AM2A 3E5UA 2YXSA 2WWJA 4UAPA 4B4PA 2AREA 4PDWB 2UU8A 3NNMA 4C0HA 4XF1A 5JI9A 4S2DA 1HRV1 3ZFGC 4YG3A 1JHJA 4AHZA 3OBTA 4LBNA 4OHZA 2IXKA 4CXWA 4AI2A 5C5TA 1PNFA 1XYOA 4XDQA 4GWJA 3MFAA 5FYHA 1ZZ9A 2LRPA 5IW0A 3T30A 4XFIA 2XR4A 3GBFA 2QQVA 2ARBA 1ZNPA 1UOFA 3GF6A 1D2SA 2TNFA 2I2SA 1BEV3 4PIZA 5JSPA 1B09A 5BNPB 3IIIA 1QKQA 5T5LA 1JZ8A 1SZBA 4FOQA 2VCMA 2ZPXA 4LKFA 1W8FA 1UOBA 1R1A1 4IV3A 1VBA3 1EPWA 4C1WA 1IGOA 2QQLA 5DXDA 3U75A 4IW3A 1A8MA 1CIWA 3C7HA 4MG2A 1PIV2 4NPLA 1QY4A 5A7QA 2J7MA 5CYYA 1W8HA 2OW4A 3OPWA 3FL7A 1IPSA 3ILNA 2DV9A 2K0GA 1ULOA 3LFIA 4Q0PA 5B4NA 2WNVB 3CJXA 2B39A 1PGL1 2P37A 4Y20A 3KHBA 1QJU1 3FLPA 3LD8A 3CL1A 1S0JA 4LR4A 1LOFC 4GWMA 4LJHA 1VBB1 5HXVA 2Q30A 4OUEA 3RZZA 4XUQA 2WZEA 4ATEA 3A23A 4YSFA 1UZYA 2BRTA 5BXXA 5BNOB 5FPLA 3MBWA 4CDUA 1W28A 2Q0AA 3IMMA 1C5IA 2HBTA 1SCSA 3FN9A 3GBGA 5FKBA 5JIAA 1BBT2 3ZYRA 4CUCA 3A0NA 5FLHA 3WP5A 4FPKA 4ISQA 4IETA 1LR5A 1AUYA 2E53A 3AC0A 3MF9A 4GALA 1W03A 4IXLA 3RZMA 4GKXA 1JZ2A 1R093 3KV5A 5BNNC 3NSTA 1O8SA 3SKJE 5LEJA 1RINA 4EN7B 4JTOA 2R0HA 3VKOA 5IAVA 2ZOEB 4E8DA 1NAEA 2YU2A 5FIXA 1WUVA 1W6NB 3VHNA 1RUG2 3FUOA 3OYWA 4L9BA 4OHVA 3T2QA 3NAPB 5CAZA 2RHPA 5FUPA 2WYSA 5A32B 3EO6A 3VKNA 2F4PA 5DDJ1 1AR91 2R30A 4EV0A 5DUUA 3KT1A 4BK4A 2GMPA 4FOWA 4IV1C 5CKQA 1RUD1 4J1XA 1ULFA 1CAXA 4FPGA 3HNYM 1MS4A 1UU6A 1N3PA 1VBE1 4JGYC 4M00A 1J1LA 1WW5A 4WM8A 2PFWA 1H1IA 4NHMA 1LKNA 3E5QA 4CPBA 1HXS1 3LDRA 2YBPA 3M7AA 4LMFA 4O65A 1W8WA 4Q4W1 4RGKA 3ZFEC 4DXTA 2IZWA 5F8PA 1JYVA 1LOFA 3HT1A 1PHMA 1CN1A 3AK0A 2ZHKA 3RRDA 3WR0A 4ASMB 2W39A 5LWBA 1DQ2A 2RMU1 3ACLA 2GSYA 5CIRA 4HMZA 4JGZC 4QQLA 4QX1A 5SV5A 4YZ4A 5LRSA 3IDEA 3ZO0B 1NZCA 1OPOA 4QHOA 3WW1A 4Q1RA 2QQUA 2R063 5LK7B 4COWA 3OY8B 1JS9A 3WXPA 5IATA 4LO7A 3BPSA 1VLNA 5FQ0A 1XNKA 1FMD3 5FOJB 4XQ4A 2JDAA 1OKQA 1Z78A 5FDBA 2QZ2A 4BIOA 1JYCA 1H6XA 3H9AA 4XBLA 4FSJA 4XBQA 3ITQA 1SACA 1UW8A 3AL6A 4RSUA 1S2BA 5E16A 3VDDA 4UFLA 3BODA 3DXUA 1FATA 3OUHA 5C5UA 2GALA 1BCXA 2RS32 2A3YA 1CAVA 4DY3A 4CEYC 2ORZA 3MUZ1 1SDWA 3FLTA 2ES3A 3JD73 1RMU3 4YW1A 1FPN1 1ZA4A 4LOTA 1PZ7A 3ZR6A 1VAVA 3O1UA 4LEJA 3H8UA 3KF5A 4LXLA 5J98B 1RTVA 1A78A 2JDYA 1ALYA 2HWF1 2L9LA 1OA3A 2VECA 4AL9A 1SCRA 2EXKA 1W05A 3WUCA 4XPVA 4LO4B 5L9BA 2WIIB 1AL23 1PO11 2ZGPA 2C4XA 2WNUC 4CEWA 2JKXA 4P14A 2MEV3 1QQP3 2JICA 4XFBA 4YW5A 1IHMA 2A6WA 2ZEWA 5F32A 2RS12 3I54A 1AR82 3V65A 3WF3A 3WF2A 2DFCA 4YVSB 3MHZA 4JGZA 5G04L 3SEPA 4P08A 1OOPB 4YVWC 4DY5A 1K5JA 3BTAA 2JKBA 2DFBA 4AHWA 4B7EA 4MUVA 3ZYJB 5CFDA 2BZDA 3VN4A 1CONA 1AJKA 1HKDA 3NWKA 5F5IA 3VDCA 1LOEA 2ZHMA 3K48A 4IE6A 4Y26A 1ZRDA 2X09A 5FY8A 3NNGA 4XFGA 3CDZB 1RGSA 3S6PA 4AI9A 3TEZA 1PNGA 1SLIA 3D6EA 4WV8A 1W90A 2AZ5A 4R9BA 1UYPA 5JLVA 1ENXA 2IXCA 1PIV1 2Y0IA 3MO4A 4QM9A 4AQSA 1DF0A 1VRBA 1OD5A 3PURA 2ZCWA 3WZ1A 3M3IA 4FXKB 1UMHA 3MW4A 4BPZA 1HB4A 1QNWA 3U4XA 5FYYA 2XMLA 3B94A 4MGKE 3O1PA 1VRH3 4WZCA 2P6HA 5F1RA 3N9NA 4TSVA 1ONAA 1AXYA 4FBFA 4GB33 1JODA 5JWPA 2G1MA 1W2AX 2XQRA 2N7GA 5EHDA 5B4XA 1COV3 4IEXA 4E2SA 1O3SA 5JUVA 1AX0A 1XSRA 1BBT1 3FC0A 4HVQA 3M4FA 1NLRA 4G4FA 4M4RA 1TE1B 3NRUA 4XF4A 2VMHA 4ARYA 2XQXA 4GMP3 3O1VA 2W3JA 1Q8SA 4FQ4A 4GWIA 5T5OA 3VBSC 2Q8OA 2JDUA 2KA3A 4XIOA 3ZN6B 2DCJA 3AP7A 2DVAA 1JZ4A 1GANA 4AVCA 4PT6A 5J96B 2VCCA 1X8MA 1PM7A 1TME3 4XJUA 4MZUA 3ZN4A 1F8VA 1CZVA 4IEYA 3MV11 3TN92 2W1QA 3ZN5A 1RUG1 1LAJA 4GD4A 4M0NA 2HWC2 4D3WA 2KR2A 3S7IA 4YM3A 2HWE2 4N8MA 1KS5A 3I59A 3GYDA 4ZXKA 1OVSA 3O1SA 1W6QB 4OCTA 5C3PA 5FYIA 4PLOA 1EAH3 5IK7A 1ASJ3 2YGLA 4V2WA 1WZXA 5FMCA 3S30A 4JZRA 5FZHA 1RUH3 2Q5TA 2Y26A 5LK5A 2EVXA 2JG8C 1KFUL 4QHBA 4QPYA 5C9AC 3LB9A 1ULCA 4IE5A 4KWUA 4SBVA 4XFHA 3VKMA 4CDXB 2Y6HA 1YNAA 2V4VA 3DL3A 5FMDA 4DINB 2GN7A 1F4HA 2FCTA 4YZ1A 4XCBA 1J3QA 2FCVA 2VCBA 3VBUB 1UD1A 4Y22A 3Q8BA 4URTA 2EIEA 4Y1ZA 1NLQA 2D3PA 3ZXFA 4QX3A 1R082 4AXOA 2DBIA 2OXBA 3BALA 4CDWB 4JKLA 4CCJA 3CBNA 3WEZA 1QJX2 4NIGA 1ZRIA 4Q26A 5A80A 3ZIXA 3UK9A 1MEC3 5I91A 1REDA 2R1BA 2FDJA 3MIEA 4QDSA 3S0MA 4NAMA 1NCQA 3OBRA 5FR3A 1NT0A 4NE9A 4RN5A 4XF9A 3SCGA 2PAMA 3ETPA 1X50A 4L97A 4LITA 2BGOA 2KM2A 3OCPA 3GNEA 5LEKA 3SHRA 2XBO3 1EP0A 1UNBA 4AAPA 4CCEA 1EV12 3ZVXA 2OKXA 3AMPA 2RS31 3IAPA 4O7XA 4Q4Y3 1WMFA 3T1LA 3TBDA 4B1MA 2Y8KA 1UY1A 4Q29A 5C8CB 1K45A 2IFWA 2RR12 3JUUA 4BB3A 3LA7A 4W50A 5FY0A 4MVTA 1SHWB 3OEBA 1HDKA 4FPOB 3UGHA 2ZGMA 1FT9A 5JIUA 5FPUA 4CP9B 5EYYA 1LOCA 1GOHA 2E51A 4LUMA 4ZPIA 5C70A 1T6GC 3GJBA 3MIDA 1PVXA 2PHDA 2BEOA 3IPVA 2EF6A 4BM8A 1FV2A 2YBSA 2ZZQA 1WCKA 3V64A 4AFMA 1C1LA 4OYUA 1DQ6A 2IWGB 1WCDJ 1PO23 1ND2B 2ZX0A 4MXVA 4Z07A 5DMYA 2D93A 4BLIA 1AR81 5L7OC 3PJQA 1KXGA 1RVF3 2HJIA 3INAA 1CWPA 1D0HA 3RYRA 3J4UH 3DKQA 2WKKA 4QD2A 4QGLA 1HRV3 3NJVA 4XQDA 4ES8A 3VD4A 2RE9A 1LEDA 4AFBA 4FTSA 3VBRB 1OT5A 4FO9A 4AEDC 4NRMA 4PBOA 3PUSA 4XUTA 5C4WB 4J6GA 2WZR2 1PVC2 2A3WA 3VDBA 2XVLA 3ZYHA 4CP1A 1NY72 3FHQA 3N35A 4WVMB 5FZOB 5EXOA 1QDCA 2WQ4A 3FBYA 1Q8PA 4JHTA 1W8ZA 1AX1A 4GWNA 2CWMA 5LA9A 1CPMA 3CQOA 4NIIA 1YEWA 5AVPA 3NJXA 2DCZA 1W99A 1BMV2 5I0SA 1R1A3 2XLGA 4GZ9A 3WDVA 1V9U2 1JUIA 1O91A 1WA6X 4RFRB 3BVCA 5FZIA 2BQPA 3H8XA 4R8HA 1VMHA 5K7PA 3SQOA 1QOTA 4EZHA 1K42A 2C26A 1CPNA 5CG9A 2E32A 4FP2A 2BBVA 1RUE2 4KG8A 1Y4WA 3PIGA 4UBGA 2RJ2A 2YUEA 3HOBA 4ONUA 4CPBD 1SDDB 4XETA 4M01A 1QJU3 1RJ7A 1YQ5A 5J7MA 1UX7A 2WNEA 1JOPA 1GKBA 3KQRA 1MS8A 4CDQB 4I0WB 1VBB3 3I2OA 4FTEA 4AHYA 3M3QA 3ON7A 4E2GA 4LNVA 1S55A 3DPRB 4MADA 4Q5OA 5L7OA 2PYTA 1ENQA 1W6PA 4JX0A 2GC0A 1Y9QA 4I30A 1NA1A 3ZXGA 3J7HA 5FYTA 2VW2A 3KVBA 4Z2AA 4XHXA 3U14A 4B29A 4NWWA 1O5LA 1WBLA 4XJZA 3D0SA 1ZM1A 4WM7C 5H9PA 3LQCA 3CZUA 1S0DA 2WINB 3TN91 4EWAA 2P6CA 5FZ0A 2HWC1 5J37A 1NUKA 2WBKA 5FO9B 4XVHA 4QQPA 4DEVA 3LPFA 1UY2A 5FWEA 3M3CA 4LBKA 3GALA 1G9AA 3OOXA 4BQXA 5FZEA 3N7JA 3FX3A 4HBNA 4YLZA 1JYXA 1W0OA 4I0BA 1Y9GA 1UY4A 4YW6A 5CVRA 2GN3A 3VBOC 1PK6B 4YRDA 3V0BA 5D8AC 2XDVA 2QQPA 5DDJ3 1S2EA 4EQVA 1AR93 3NKTA 4HZFA 2XKOA 2JECA 4LT5A 2YPJA 4L99A 1DYPA 3OEAA 2GNDA 2DU1A 4CCLA 1A3KA 2R042 1RUD3 2SBAA 1H2KA 1E5RA 1MS5A 1TQ5A 3ACFA 3FE5A 5IVVA 1VBE3 1URXA 1LOBA 2ZGLA 2ZGUA 1R081 4UW5A 1R1ZA 1RMU1 5D21A 4HN1A 4ZS3A 2D3SA 3GHNA 2UWCA 4K40A 3AFGA 1HXS3 3WW2A 1DZTA 4Q4W3 3KZ4C 1QJX1 3GZEA 3LSEA 1YFYA 3RWNA 2BFUS 2Y6LA 2VMFA 3WHTA 3WQ7A 4AYUA 3BIWE 4NWVA 3TEWA 3N7KA 1YIFA 2VQAA 4BXSV 2NMNA 1W8OA 5JMCA 2RMU3 5EPAA 4H7MA 3OD0A 4N9HA 4AHXA 3VUOA 2NM1A 2PHUA 2ADDA 1BLZA 1QQP1 2J1TA 4NO4A 3E6CC 1WMEA 2YMZA 4I09A 4JV4A 3WNMA 4DPNA 2JEMA 3GCWA 4WM7A 3WDXA 1H8TC 3T0DA 1EV11 3JXSA 3LDKA 4RA0A 3VBUA 1HX6A 4IV3B 1PMJX 1PM4A 4DMIA 2IC1A 3CIHA 1H6YA 1MACA 4UT5A 1KITA 2RR11 3WINE 4MH0E 3NO8A 3WDTA 5FZBA 1J59A 4QGNA 1TNRA 2V5YA 4RQPA 4YZ3A 5F3EA 4QXHA 4Y20B 3LF7A 2VMIA 1AL0G 3OGGA 2VZVA 2BOIA 4CTEA 1WCUA 1REFA 5KXEA 3HQUA 1HW5A 3POGA 1FPN3 3PVOA 2P3KA 2LW8A 2PHLA 1V00A 3WT3A 4BQ3A 4B4QA 1T2XA 4CDUB 2ZBJA 1YJKA 2HWF3 3MFCA 2VMDA 3WCRA 4YFZA 1QDOA 5K4LA 1D2QA 1JMUB 1PO13 1W3XA 2WC2A 2WZ8A 2BWCA 5CBLA 2C9KA 2UYAA 5IT6A 2PHXA 3AZYA 4ZY9A 2H6CA 4UW4A 2HBUA 1MS1A 5KWRA 2B9VA 2D3RA 3UGFA 4ZZ5A 4D6RA 1BVP1 1L7RA 3O0VA 5FO8B 3KD4A 3T08A 2WZR1 1PVC1 3F2ZA 2WUHA 2VOKA 4XJAA 3AKTA 1NY71 4JDMA 5CADA 4GA9A 4GXLA 4TTGA 2Z2SB 5I0UA 1C57A 3OYWB 5LY2A 3T4VA 4XQWA 3MZHA 4P9JA 5J1XA 4BISA 5GLTA 1W9WA 2VVFA 1LGBA 1Z7S2 1BMV1 4NR1A 5EP9A 2V72A 1JZ7A 5FREA 1V9U1 3AYCA 3B02A 4LE3A 3RZHA 4PCRA 1CAXB 5EZWA 1PIV3 4UF0A 4OHYA 4Q8LA 4WM8B 3AYEA 4YGCA 1RUE1 2J42A 4QPGC 2IVJA 3PU3A 2Z4FA 1UYYA 4LK6A 3ZSMA 4LA3A 1YI7A 2ZGTA 1GP4A 3TAYA 3ZDSA 1QGLA 1OQEA 1RC6A 2PTMA 3AP5A 1XU2A 3LWCA 1FI2A 4HKLA 5LATA 3UKTA 2PQSA 2JDHA 2WABA 5FP4A 3BI3A 1OF4A 1BBT3 4JQRA 3PU8A 1DG6A 5F2WA 3RZLA 5FQ0B 1DQ5A 4OLLA 3TNPB 1YQ8A 1WLCA 4EWDA 3OPTA 1JYWA 2EA7A 4LHSA 1KFXL 1WGPA 5APAA 4AGRA 3AYDA 3FBMA 4IE0A 4PBPA 4C91A 2WNOA 2XJUA 3VDDB 1H8VA 1UAIA 3P1IA 1SFNA 2XH6A 3O0XA 1CAVB 4GULA 1G9CA 3PUQA 3RS6A 1RUG3 4QDQA 1KJRA 3DN7A 3K3OA 5FK8A 2I74A 3V56A 3DKWA 3NNFA 4K21A 1AYN2 4HKOA 3UV9A 1DHKB 2P34A 3SC7X 5FZMA 2R041 2AENA 1LHUA 1XOYA 2BYVE 3IDBB 3VHPA 1YC61 1UWWA 3D5OA 4RFT0 2VXRA 4KQ7A 4ZU5A 3WNNA 4XF3A 4A3ZA 1TNFA 4N53A 3LEGA 3KWVA 3RWKX 4CEWB 2AACA 3DF0A 3I2IA 4XABA 4X8PA 5GM0A 2E7AA 3PTRB 2VUAA 1OD3A 5EFUA 3T09A 2OS2A 3LA2A 2W92A 3HN1A 2VR4A 2CL2A 1BJQA 3Q8EA 5AC92 1ZA7A 4JGZB 4Z2WA 3ZSJA 2WS92 3UJOA 5KXBA 1XNBA 2FDHA 4NHYA 5FUIA 2VZQA 3FZ3A 5LBFA 4RS5C 3OBAA 3O1MA 3HVDA 5CFDB 4BQWA 4D6QA 1PO21 3DEMA 1PMHX 3FFQA 4QXKA 4P02B 4DRVA 1KDKA 4UW6A 2WAAA 4CZSA 1CZTA 3EQEA 4XJ8A 4DEQA 2GDFA 4MGQA 2X5IC 2WR9A 3KLSA 3I8TA 1QOSA 2XG3A 2B7YA 3AP9A 5D1IA 3HBKA 3J7NA 1QHDA 4JC1A 3NV3A 1ZZBA 4BYYA 5FCCA 5HI0A 1H1MA 1T6BX 3FMGA 3PMEA 4A7ZA 1CIYA 1NCRC 2DCKA 5FYCA 2CWSA 4QX0A 3OUJA 3HBZA 4F3JA 4M4PA 3DYMA 5DZGA 2RS33 4XYXA 2JE7A 2FDIA 5IHRA 4V1PA 4XXPA 5L9RA 4YM2A 1SFPA 2AH2A 4KL1A 5JZGA 2WAOA 5CA6A 3WHUA 4Y1YA 3NV1A 5LBEA 2D6LX 2W08A 4ES9A 2ZAAA 1W9TA 4PLMA 1DLLA 1QWRA 4C8DA 2PA7A 2JDMA 3ZMNA 1ZRCA 4AI0A 1W8UA 3ZYBA 2ZTNA 4BK5A 5I8TA 3WG3A 5JOYA 2VBBA 2WO2A 4CA9A 2WT1A 1HRI2 2E33A 3QBQA 4R52A 1DU3D 3C7GA 5F5CA 5A33A 1NX9A 1HV0A 2E9QA 3IIAA 4LIVA 4XEZA 4RYDA 1AR83 3QH6A 4CCNA 4LUKA 1O4YA 2VC9A 1OLMA 5A7WA 3WF1A 4L8QA 3I2DA 2XUEA 2VZOA 4URAA 1CZSA 2Y38A 2V5DA 2VZ1A 5FKCA 3RSJA 2HWD2 2P3IA 4P9IA 3ZKYA 2ZGNA 4E4SA 5A3TA 2P17A 2VM9A 4QPIC 3T4HB 4ATFA 2VZTA 3WX5A 3I59B 3AXEA 3NJZA 2X5IA 4LK7A 1WD4A 1O3TA 1Z7S1 1I6XA 1YI9A 4K20A 3HEIA 4QX2A 5E1RA 5GZFA 5FJKA 3ZFGA 2BNNA 5DAXA 3GXUA 4JRAA 2BNOA 4ITCA 4XIKA 5EJ3A 3GM8A 3UETA 4ZKTB 3I3EA 3RJRA 3GZAA 4M3CA 2OT7A 4UOJA 3VLBB 1QXPA 4CXYA 5IVYA 4FFFA 2Q8EA 3S5AA 2B9UA 1NXD1 2DU0A 2X29A 2YHJA 4DO0A 5ANQA 4R4XA 5GZDA 2D6MA 2FQPA 4Y22B 4CCOA 1GLHA 2QFEA 4ZONA 1YCIA 1NYWA 1G9DA 2P4EA 4GMP0 2XLAA 1U5XA 1YIPA 4N7UA 2ZZJA 1RXGA 3POWA 2F17A 3NQHA 3HD8B 1U12A 2NN8A 2DUOA 4Q0VA 4G3YC 3WNKA 2D40A 4QB1A 1NCQB 4XUPA 4Z8BA 4ET7A 4I3PA 4NIAA 4DUWA 3WY6A 3PUAA 4H14A 2D6NA 3ST7A 1I3HA 4NRQA 4DNYA 1OURA 3ZFFC 1GP6A 1K5MC 4QPIA 3ILRA 1J84A 2VUCA 4BWOA 2A6VA 4ZS2A 3TN93 4RL7A 4LULA 3U78A 2YU1A 2HWC3 2W0XA 1F5JA 3IBMA 4NPRA 4BE3A 2E63A 2WL1A 3CNAA 4A41A 1B35C 1BK1A 2IXHA 2FZ1A 4ASKA 1AYN1 4QHZA 1YXWA 1DDLA 4DIQA 2JG8B 5A7SA 2JENA 1DGRN 5E6HA 1SG3A 1N1YA 4KNCA 3IPVB 1LHWA 2R7EB 5BNNA 1APNA 1DZQA 4QX5A 4AQ6A 4BXFA 4AEKA 3W5NA 3WF0A 2H0VA 2PLV2 2R32A 2DCYA 1LEMA 3ABZA 3N36A 5EWSA 3T3YA 3ZIWA 3USUA 4BA6A 3VBFC 2WA3A 5C3OA 4D7TA 1MZFA 3IDCB 5AC91 2XJPA 4AZZA 3S5QA 1MQTC 1R083 3P5BA 4IERA 2QQJA 3J7MA 4IEWA 4CU6A 4IV1A 4QU2A 1RUC2 1QJX3 3BN6A 3IKWA 4N43C 5D2AA 5ABJC 4QWNA 4JGYA 1N1TA 1YLLA 3CZJA 2AEZA 1TEIA 4OZOA 2Y6GA 4LLFA 3UJQA 4Y4YA 3ZFEA 1GNHA 1SBFA 5A1FA 4K1YA 4Q4X2 2D7FA 2CHHA 3LA3A 5JVVA 1K5MA 4DUXA 5JOWA 4QQOA 1X8EA 1EV13 2VOWA 1E57A 1O59A 2K9ZA 3FUQA 4GAZA 4XTPA 1W04A 3GBWA 5A7OA 1QXJA 3R0RA 3N4MA 3IAQA 1K3IA 5T52A 5BNPC 2MPFA 2V73A 3HQXA 2RR13 4JKKA 5CB7A 3SKVA 1B35A 1VBA2 1RL3A 4NJ4A 5FZAA 4J25A 3POIA 2ZABA 4YNIA 4YW2A 3SISA 4D7SA 4BJ0A 1HJGA 5A3NA 3B3QE 2JB4A 2C1FA 3W21A 3D8CA 5I0RA 5K0UC 4YGEA 4FPFA 2BW8A 3OSDA 2QQNA 2Z5WA 2VGDA 2EAKA 5FO7B 3H0OA 5BYNA 1E5HA 1WBFA 5FBZA 5JR7B 2WNVC 4OUSA 1JI6A 4HK8A 5JOXA 1HRI1 3VL8A 5HV4A 4K7JA 3VBFA 3WNPA 4E27A 1LHOA 5L7OB 1SLLA 1WCSA 4M3CF 2VZRA 1W6PB 1XNCA 3ZXJA 1O3RA 4CEYA 1W06A 1GUIA 1NA1B 4DFSA 2X53S 1BQPA 4FQZA 4XFCA 1AX2A 4Q4V2 1GNZA 3K4AA 2DUPA 1S0GA 3MLJA 4O61A 2Y6JA 5BNOC 1OI6A 2WO3A 1W2OA 2HWD1 1H4GA 4FPLA 4HT1T 4KGGA 4WBBA 4Y1XA 2GC3A 2YB7A 1LHVA 2UURA 1W6MA 2KD7A 3PVNA 1LOGA 1UMIA 2VMCA 2WNUA 3POSA 2WZR3 2XL7A 1PVC3 4IL7A 1ZZCA 1PX4A 1AR72 2VD7A 2XHNA 5I8YA 5JPMB 4W6YA 3ZMOA 3BUCA 4HLTA 4B3NA 1Q8OA 5AFBA 3V0BB 2OYZA 1OQDA 3KMHA 4A6OA 5FP8A 3MICA 2FDGA 4YVWA 2EXIA 4ZXEA 2K2SA 4AEJA 2XPJA 4R4ZA 4KU8A 1V9U3 2VNGA 3NAPC 3U0ZA 1YQ6A 1IG0A 5AFEA 3ME2A 5KXCA 1F5FA 1HJFA 2W46A 3HPNA 2ZXQA 2J1SA 4HPKA 4I0AA 5T3NA 1D4VB 1RUE3 1JOBA 4P9XA 3K46A 3LEIA 5K0UA 5CFCC 2ZAHA 1VBC2 3JU9A 4FTBA 3B5LB 2DBNA 4PF1A 4ZHNA 1JH5A 4CUBA 3I7DA 1O6UA 3E6BA 1Q56A 2Y33A 2J1EA 1SBDA 2NMOA 4COYA 2VQ0A 1LNSA 4E4HA 1WA4A 2G9ZA 3UESA 1SBEA 3M3OA 4E8CA 3NV2A 2ZHLA 2Z42A 3PNAA 5G05L 5LA2A 4BDVB 1CVNA 5L73A 1F4AA 2ARXA 3G6JB 4Q8KA 4WM7B 5FBJA 5HCFA 3I49A 2VZ3A 5GZEA 5FYUA 2YZ4A 2CGNA 1HB3A 1NXMA 4LA2A 3T0AA 5IVFA 2GNTA 2FBEA 4BQYA 2SLIA 2ZMNA 5A3WA 3HQRA 4XBNA 4DUVA 3O1TA 1FMD2 2ZGKA 1VBD2 3PLQA 4JCKA 4HG6B 3L2YA 3QH7A 4S2FA 1IQAA 2P3YA 2BPA2 4XILA 2E6VA 1QEXA 2LROA 3O5SA 4RQPB 4HSJA 1A34A 1DIWA 2PXJA 2V4AA 4YM0A 2QBXA 1V6IA 3VBSA 4META 2EXHA 5GKAC 2YG0A 5F9TA 5FY9A 1LU2A 2ZX4A 1D7PM 1NQJA 5I93A 2LM3A 2QJVA 4OUMA 2W1SA 1SLAA 2B4KA 4AI3A 2PLV1 1ODMA 5I0DA 5HPOA 3EYPA 1UYXA 3OGVA 1LHNA 2BOJA 5FP7A 5JMOA 2R043 3FLRA 2CDOA 5KC6A 3J8F2 3VD7A 5FXVA 1JHNA 1PX3A 2C5DA 3BTZA 1FNYA 2Y34A 4YW7A 1X9TA 5CFCA 1M06G 1ZYBA 3LOIA 1UZ0A 1JZ6A 2Q1FA 3HJRA 1RUC1 1V70A 4P9LA 4P00B 2RJKA 2JG8A 1ENSA 3N9OA 4BMBA 3GJAA 3BTXA 5C9AA 1S0IA 2CSGA 2WWSA 1H9WA 3MLKA 3B00A 3VB9A 1O5UA 3NW4A 1WWYA 4JHZA 1RUF2 4OI4A 3KM5A 2Y6KA 4B1LA 3I3MA 3NKGA 3KSCA 5F39A 2D5HA 1P8JA 2B45X 4Q4X1 1YUDA 4K9SA 4YVSC 2RS11 2C6SA 1OOPC 3VZOA 5EV7A 3BYWA 3KGLA 1ST8A 5L36A 1EY2A 4Q0QA 2FHRA 3RI9A 1XPWA 4LBQA 1GOFA 2CYFA 2RVAA 3KT4A 3NVCA 1UY0A 3KB5A 4O9GA 3W9AA 4DXZA 3H3UA 4UF0B 5FTTC 3RI8A 3QOPA 3E5XA 5E8AA 4NHLA 4QB2A 1ZRFA 3MF6A 1OHFA 4BU2A 3TB0A 3JBG2 3RG0A 5FPAA 4QKDA 2O8QA 5FFOC 4AFCA 1UYZA 4HVRA 1NOVA 3W58A 1W0PA 4GQ7A 3VZJA 2A71A 2GZWA 3ACGA 1S1AA 2WFPA 1OLME 3K77A 2VTXA 1G9FA 3MEPA 2FDKA 2JDKA 5F5QA 1MZEA 1AF9A 1VMJA 2WDBA 1FOD2 3MW3A 4NHXA 4LKDA 4Q4V1 4QKNA 4V2VA 3VHOA 1UZVA 1GZCA 1UL9A 5LBBA 4Y1UA 5DPNA 5F3GA 3ALQA 5JDBA 1VB4A 2QQIA 1DP0A 1OLRA 2D44A 1H2NA 4KBBA 1LOAA 3SNMA 5LY1A 2ZX1A 1A6CA 3BIEA 1LCLA 4XZPA 3R4DB 5DN2A 4EN6B 1ENRA 1AR71 5DABA 1IS3A 3GCXA 1HIXA 4D0QA 4M3CE 5FMOL 5GZCA 4FPEA 5F6LB 4D8MA 3HAGA 3MW2A 3SCHA 1QJEA 2O1QA 4XUOA 4EROA 3ZYIB 4FPJA 2G19A 1QNYA 1Z7S3 2TBVA 2CU5A 4KBZA 2OVUA 1FX5A 1X82A 3WCSA 4X6RB 1UXXX 4B4RA 3BOPA 3Q8CA 3AKRA 3VHRA 1ZREA 2XOMA 4O9EA 5DQ0A 4AEDA 2YYOA 3VD9A 1JXNA 3OPZA 2YPDA 4N53B 2VQTA 1UPSA 2GAUA 2HWE1 3GDBA 5A7NA 3SH3A 1YQCA 2VTFA 5GLUA 4TZDA 5FXWA 3M1HA 1US2A 1VBC1 2NQYA 4FPYA 2O0OA 5CKMA 3ZYFA 2J1UA 3LEMA 3AZZA 2E26A 4J1WA 2B8MA 1HN0A 1SMVA 1POV1 2W94A 1JYTA 4CDXC 4F7ZA 3ZR5A 5IK4A 3VV1A 5GLZA 1ODNA 2CY6A 3AZVA 4ISRA 1SPPA 1GWKA 2FD8A 1J1TA 3S7EA 3F95A 3SMHA 2TEPA 3RMYA 1IS5A 2F4LA 3RMXA 2VUJA 1V6JA 4CCMA 4LKSA 3ZPOA 2YC2A 2QDNA 3CJIC 3LFMA 5T5PA 4PI0A 1J3RA 1VAKA 1EPZA 2WFF2 5EIYB 2KXLA 4FVVA 4YPJA 1H0BA 2NP0A 4XURA 3EJKA 5IYYA 1VBD1 4B8EA 3WOGA 1G7YA 4KH9A 2RDRA 5FPVA 4YFWA 4QU1A 5FZ7A 3P3NA 3IB3A 1GSLA 1ULDA 2UY8A 4FFIA 4CP0A 3V0AA 4A42A 1IZ3A 3B7MA 1OH3A 3URFA 2RDQA 2DTWA 1WMXA 2VNVA 5JZGB 2R16A 2XJRA 5FP3A 2GC2A 1AYN3 3VKFC 2OX0A 3H50A 1S0EA 5C8CC 1ND3C 1L3JA 1QIQA 4Q0UA 4S2HA 4E9KA 1E5IA 3J8F1 4UBHA 3UKNA 4IUGA 5BPXA 2VAUA 2JD9A 1JYIA 4HONA 4NIHA 2EICA 2QQWA 3WP4A 4AK3A 1DYOA 3R6SA 4QT6A 4GKYA 5A33B 1DQ0A 5C3RA 5FZ4A 1DZRA 3VBOA 2VOTA 3TNQA 4OI0A 2VW1A 5JSOA 3GHMA 5IFPA 5D8AA 5GLVA 2DCTA 3J26N 5A7WB 5AC93 2A6XA 2WS93 2ATFA 1ND2C 1RUF1 1ZBE2 4K1ZA 5FYSA 2XKPA 3H8RA 1W6OA 1SLCA 3WF4A 2BJSA 4C1XA 4EN9B 5A6YA 5FY1A 3VD3A 3GZTB 2X5IB 4OHWA 2YV8A 1ZVFA 4UFHA 5FXXA 3SH5A 2ARAA 4NPMA 4FOYA 4OQ9A 1GNYA 4LHKA 3ZFGB 2VH9A 2A3XA 3VBRC 1RUNA 1X33A 3JZVA 4IEQA 4UW3A 2VUDA 5IVBA 1RUOA 5C4WC 2VCAA 1XBFA 4M3CB 1TVGA 4HANA 4QAWA 4Q0SA 4CSWA 3WVJA 3N9MA 3VZNA 2W68A 1ZBA2 2ENRA 1MR5A 3JBG1 4G9SB 5T5JA 2E7QA 1C5HA 3HWJA 4YW4A 3VBHC 4ZU7A 3ASIA 3DV8A 3E6DA 3H42B 1GQHA 4LHNA 4FOVA 1JN2P 1RIRA 2VG9A 3ACHA 1H8TA 5I0TA 4H2AA 3BOWA 3THTA 1ND3A 4EN8B 1AHSA 2PQQA 3ORJA 4HETA 5C7GA 1LODA 5FZGA 2ZS6B 2ZMLA 2VU9A 1LTEA 2HYXA 3MIBA 2WO7A 3U37A 1YFUA 4AVVA 4U36A 4HOOA 3PJYA 5H9RA 1PMIA 3O1OA 2JX9A 1FOD1 1IQDC 1NE6A 1SLTA 2IXIA 2W1WA 5L9VA 4OFGA 2D43A 3E97A 5IWFA 2E31A 1HRI3 1I9RA 3D3AA 5FV3A 2DDUA 3LAGA 3AB0A 1AXKA 1VBB2 3VZMA 4WZFA 2DWRA 5E88A 3J7LA 4CDQC 4XJ9A 4NOTA 3AZXA 3A21A 1GP5A 3ETQA 4QPIB 2HWD3 4CEWC 4LIUA 3D0JA 5FJHA 1VMFA 2ZGSA 4K8RB 1WW4A 4XHBA 3PIJA 2DVDA 2D97A 3CLPA 2QE3A 2QQKA 2WSUA 3N7MA 4HN0A 2JE8A 2QCSB 1OH4A 1QH7A 1PZ8A 2XVKA 3B9IA 5ACA2 3IMNA 2HH9A 3R05A 5BNNB 4CE8A 3AVRA 3CU7A 2A7AA 3KS7A 1TZOA 3N3HA 4LBJA 3VZKA 1O3QA 4MGZE 3VBHA 2RM22 5AVAA 3U10A 3USUB 1PK6C 5J48A 3WDWA 1YQ2A 4H55A 4Q2FA 3ZYPA 3RDIA 1AYM2 4OQ8A 1PZ9A 1CJDA 1JU3A 4OMDA 3LEKA 4DS0A 1LULA 1JZ3A 3PUIA 5GLWA 2A73B 4IV1B 5KXDA 1VBE2 3AZWA 1DYKA 1O4TA 1MVEA 3SXWA 1KEXA 3VZLA 4JGYB 1SLBA 3M3EA 2OQ6A 4YW3A 1XYPA 1MS3A 4MXWA 3OUIA 4EYUA 5KBFA 4AI8A 2P1BA 2VQUA 4LORA 4QPGA 4JTNA 3ZFEB 2WFF1 2WA4A 1CX1A 1AR62 1GZWA 4A2UA 2VW0A 1OFSA 2JDPA 1QH6A 2VZPA 5H9SA 3ROUA 3TEXA 1K5MB 3PHMA 1HB1A 3AVSA 2BV4A 3WNOA 1GWMA 1QMJA 2RDSA 1HN1A 1E5SA 3OG2A 5A6ZA 4LBQD 4XF0A 4ZU4A 1H2LA 3MV01 1YHFA 5FRAA 3W59A 4AQTA 1F15A 1B35B 2XJTA 3KGZA 5IK8A 1XXNA 1BXHA 2WSVA 4X8NA 1QJY2 1XJAA 1FYUA 4KWKA 4R9AA 2JD4A 4LO5B 4A45A 2YBKA 4COVA 3ZOIA 5IVCA 1Y9MA 5KHGA 1Q8VA 2A6ZA 4XFFA 2XL9A 5EQUA 4W65A 4WVZA 3APBA 1DGWX 4U2AA 3K75B 4DZGA 1JOJA 2D5FA 3SITA 4JQTA 5HXMA 1GV9A 4XTMA 4AVTA 1W9SA 2PLV3 3VBFB 1MZ5A 3ZSEA 4LBOA 5LASA 4ARXA 3JQWA 5CZKA 4XE9A 3HMYA 3WNLA 3B9CA 4CEYB 5A3UA 4XOGA 5DAPA 5HCBA 4HL0A 4BOWA 1BHGA 1RJ8A 4AGGA 5F3CA 5JPNB 3I3DA 3ZKUA 5B2GB 1UXZA 2RS52 5KC5A 1ZBE1 3T2PA 1YRZA 1RUC3 1QF3A 1W6MB 3A7QA 4MLOA 1GZ9A 4KMQA 2WLQA 4YARA 5LBCA 5F3IA 2WNUB 4GH4C 1C8M2 1AJOA 1C3HA 2BGCA 3A4UA 4FPCA 3UNPA 2B46X 4YG0A 2WJSA 2P2KA 3JCIA 3I97A 4QX7A 5A70A 4GJZA 4Q4X3 3T2TA 1W9YA 4YYOA 2RS13 5A3PA 1YWKA 1W3VA 2R49A 2UYBA 4YVWB 4AEMA 1ZBA1 4RS5A 3AKQA 3KCYA 4Y5Z0 2GNBA 1MVQA 4QKBA 5J36A 4PF5A 5LZ6A 4KGQA 4DB5A 3RPQA 3QD6A 3MUY1 3L9JT 1UMZA 1XYNA 3POEA 4IEOA 1A8DA 4HPKB 5C3SA 2HWB2 2Y6FA 4F8AA 1KGYA 3FJSA 5KHKA 3UT0A 3POJA 5K0UB 2IXLA 2CGOA 4RHV2 4COUA 1OLQA 2ZA9A 4MX3A 5BUVA 3MYXA 5HCHA 1GICA 2W87A 3NNJA 1FAYA 1N3OA 4WM8C 3HIFA 1NCRA 2C0ZA 3FHAA 3WD5A 1CAUA 3I2GA 1JBCA 1UY3A 2J1AA 2W2IA 2VBPA 3WQ1A 2QTWB 5FUNA 2JDNA 4LQRA 3WV6A 5CEHA 1DQ4A 2YY1A 3LIHA 3EHKA 3IT8A 1FXZA 1IOAA 3FHIB 1TMF2 2QNKA 5LB6A 2HEVF 3U1XA 4F83A 4XCAA 4Q4V3 2IXJA 1OXCA 2JG9C 4UYBA 4Y5TA 3RFRA 4BCUA 4DRRA 3RZJA 4P9GA 3AMNA 4FAGA 1UZWA 2FDFA 3I2KA 4L92A 1QU0A 1OC1A 1XE0A 1F2NA 3BTYA 3BPZA 1RUJ2 1HV1A 3H7JA 4GH4A 4EE2A 2R0FA 2XHKA 1CESA 3HNBM 1WLDA 1WMDA 5TSWA 5JAXA 3H7YA 3OGJA 4OHXA 4LHLA 4TXWA 1AR73 1RUI2 2AC1A 2CAVA 2ZJCA 1BK0A 5M0TA 3WG1A 3VBSB 4LO8A 2XGXA 2D6PA 2I07B 5ACA1 1IKPA 3D82A 4PIXA 5JCTA 2LS6A 2AYHA 4AVSA 5JXIA 5LA0A 3VDDC 3DGTA 3G7DA 3KV9A 1Y3TA 2Q1ZB 4I02A 4E4DX 1XU1A 2X8KA 2QQOA 3DXTA 1W2NA 1D4M2 4QGMA 5HCAA 4AWDA 3PL0A 4KWJA 2RM21 5F5AA 5BNQA 1MPXA 2BU9A 2VPVA 2H0BA 3I2FA 4ORFA 4RD7A 1AYM1 3K4ZA 3BGAA 2PHRA 4COZA 1GQGA 1UCXA 1U5ZA 2HWE3 5CFCB 3N7LA 1I1EA 3I2JA 1GMMA 4AAXA 2ET1A 3H1WA 2QZ3A 4TLGA 2DYCA 1VBC3 4KU7A 3B01A 5H9QA 3SLIA 4INDA 4LTAA 5C9AB 1QXRA 2PHFA 1POV3 2R072 1G9BA 1RHI2 4NVPA 1O4ZA 4IEPA 2GNMA 3U11A 4AQ2A 4A4AA 1CGPA 3WP6A 1OUSA 1YO8A 1IKQA 1AR61 2ZEZA 1FV3A 1S2KA 1LRHA 2JG9A 1WD3A 4YGBA 4LOSA 3LPGA 1ULPA 4LBLA 1V0AA 2WT0A 4YZ5A 1R64A 5T54A 2BVBA 1WCQA 2CV6A 5CISA 5GJ6A 3H1MA 3OGSA 4IGOA 2WS91 3AMHA 3N9PA 5CFDC 3C7OA 4LBQB 3ZXEA 5FZFA 4JRLA 1LU1A 5KHIA 1VP6A 1VBD3 4AW7A 1IG3A 3KCCA 4NN0A 1QJY1 5FK7A 4AE2A 3BU0A 4RR3C 1LGCA 2CGPA 4IEUA 5F2SA 4I01A 5FZDA 5J3UA 1KRIA 4PDWC 4Y1VA 1VJ2A 1XNAA 4N7IA 5FXZA 2B42B 2H6BA 4Z82A 3VL9A 2AUYA 1L7LA 3C7EA 4YM1A 5BV6A 2ZEYA 3P3PA 4BQ4A 4EN0A 4AG4A 3ZFFA 1YFXA 2ZGQA 1GYKA 4UWDA 1BEV2 2VJXA 3D4KA 4FI9A 4FXGB 2WWUA 1CAWA 3J8F3 3LGRA 2PAKA 1Y43B 1WKYA 2RS51 4QQHA 3EXUA 1WW6A 4OI2A 1EUUA 1S0CA 1N47A 2GP3A 1W9FA 3NMBA 4BIFA 5SV8A 2EIGA 5K8SA 2YC0A 2VOXA 1JW6A 3AMMA 4W8JA 3H3LA 2EIBA 2DURA 2O14A 1C8M1 4OMCA 1NQDA 3PUHA 1F35A 1RUF3 3WDUA 4PIYA 4CCDA 3L2HA 3ZSLA 1JZ5A 1GBGA 1IS4A 1S0BA 1O7FA 3O7OA 2XJSA 3AX4A 1KDMA 2GH2A 4TYSA 2R1DA 3ZPYA 1DCSA 2MHFA 1MQTA 2ID4A 3PVEA 1XE8A 4BQ2A 4KI5M 3MIHA 5DUXA 4HK9A 2W95A 4PJYA 3BKZA 4UFIA 2OIIA 5ABJA 4N43A 1ACCA 5FY7A 1EYBA 4AEDB 4EWEA 2CAUA 1UQXA 4JDOA 4RR3A 3LDBA 4TLFA 1KD7A 2HWB1 3B93A 4S2GA 4PDWA 1VIWB 4EZ4A 3JBG3 5DAQA 3MGUA 4RHV1 1R092 2GMEA 4JKMA 4MGSA 4D94A 1W39A 2VNOA 5DZEA 5A6QA 3AL5A 4OULA 5FZLA 4QQ2A 5BY5A 1RITA 3UL2A 4UXAA 2YC4A 5ISLA 2WN2A 3WW3A 1SPPB 5CNAA 5FMBA 2J1RA 1OQ1A 5FAXA 2G4IA 1U5YA 4AFAA 3AP6A 5BNPA 1V6LA 1F9KA 1TMF1 1FOD3 4W6WA 3PVBB 2LALA 3TOJA 3TYJA 5F37A 3ES4A 4L2NA 4MOAA 3RZKA 5C8WA 3IN9A 3NL1A 4JAAA 3AYAA 3ZLIA 5FZ8A 4CXXA 3MI8A 2OUJA 4UFJA 5LA1A 1RUJ1 3IDAA 1V6MA 3THCA 3MDPA 4AOCA 4IQPA 4BH9A 4QB6A 4QMAA 5LRRA 2AR6A 1NCQC 1RUI1 2J22A 2WNVA 2QDRA 4LLOA 4MV2A 2VBDA 2ZX3A 1REEA 5HBAA 3V0AB 5FZ6A 4X6QB 4MYEA 3JQXA 4XAAA 4CCCA 1DLCA 1DFQA 3M2MA 1VR3A 4W4ZA 4MGYE 5DUVA 2JDZA 2P5BA 5BNOA 1D4M1 4JVAA 4QDRA 4IE4A 1HQNA 2ZKLA 2GMMA 3GGLA 3LSDA 4M0HA 2A75A 4TN7A 5IVJA 3EMRA 3RYPA 2VY0A 2R062 2UY9A 2PMWB 2WLPA 5JR2A 1SEFA 1WLWA 5A1LA 3CMGA 1JU4A 1XC6A 2BERA 3POFA 1ULGA 3RQ0A 1ZRRA 3VDAA 5A3MA 2JXAA 3AJYA 4GJYA 1NE4A 4R9CA 1ZX5A 3VBOB 2JWPA 1K12A 1US3A 4Q27A 3HN3A 2R071 4YGDA 5D8AB 1HQLA 3CF6E 2XWJB 2NLRA 1RHI1 1W6NA 5FPZA 4XC9A 3THDA 4XMIA 5GALA 3UYJA 1W6OB 3H3ZA 3X29B 3NAPA 3T0BA 4UFKA 1KJLA 5FYBA 3WUDA 4CUGA 3JD72 1RMU2 5DZFA 1AXZA 2A6YA 3CJIB 5A32A 4BHPA 5HV0A 1J3PA 1OPMA 4QXBA 2DUQA 2Y64A 3WG4A 4P5HA 3ZXAC 4EJRA 5C71A 2QUOA 2UWAA 3R4UA 1DGLA 1L7QA 2WFF3 3M8LA 1AL22 4Y24A 1KS4A 1UIJA 1QOOA 1CD3G 2JIGA 3KV4A 1C4RA 2MEV2 1UZZA 1LECA 1QQP2 3BU7A 5J09A 5JOZA 2ZMKA 2GH8A 3K3NA 4N9IA 3T2OA 3QLQA 4GIQA 4JDNA 1JUHA 4MGTA 4LO6B 1DQ1A 1UKRA 4E2QA 3R4SA 3WQ0A 4QPWA 1H8TB 4LBMA 5F6KA 1ZZ8A 2BNMA 1ND3B 2BWAA 3S57A 4NMIA 2HYKA 3EB7A 1BEV1 2FMDA 5F7UA 3HNMA 4FFHA 4BQ1A 1JTZX 2WRAA 5LCWL 4CCKA 4MHRA 3LE0A 2VNRA 5EYXA 2CNAA 3OY8A 4Y3OA 2PHTA 3M70A 1C28A 1VBA1 2HEWF 1GQPA 1UU5A 2XVGA 2WQZC 2HLEA 4XMAA 3ZSKA 1RYYA 4OI1A 5EJ1B 2PHWA 4XDPA 1F31A 4W6XA 2A1XA 2VOVA 4TWTA 5FP9A 1XNTA 2BFUL 2YROA 5FOBB 1LB2A 4A44A 2Q1MA 1ZBE3 3MPBA 1VRH2 2O8OA 1C8NA 1NA1C 3RVHA 3KCXA 3AP4A 4UI9L 3PDQA 3AMQA 5FYZA 4GB32 4IEVA 2OZ6A 3OD4A 4A7YA 3A22A 2A70A 4K3UA 4CP2A 3SEEA 5L19A 1XNDA 3K4DA 1QJFA 3POBA 2AEYA 2G9GA 4R9DA 1COV2 3RYKA 3DYOA 3PMSA 2AGSA 3NJYA 2HEYF 2Q4SA 5C3QA 1J58A 1OA2A 1STMA 3KV6A 4QX8A 3ZXLA 2W9XA 5FY5A 3H8OA 2IVIB 1VALA 5JI7A 1KQRA 1XE7A 3OF1A 4PLNA 4ZZ8A 3ENRA 1X7NA 1W8TA 4YG6A 1HQWA 1UKGA 3P6BA 1OMIA 4BZ4A 2VMEA 3BB6A 5A7PA 1ZBA3 3VBHB 4P9YA 1R091 2EIDA 2XJQA 1Q8QA 2YGMA 4C0BA 3RJ2X 5LW9A 4HKWA 4YVSA 1GWLA 1NLSA 4RGGA 4K8FA 1TME2 3LOBA 1OOPA 4IGQA 1RB8G 2ZACA 4FT8A 2RG4A 1XSQA 2XWBB 2Y60A 1EUTA 2VO5A 2EXJA 4KG0A 4A7KA 4IE7A 3HT2A 1G8WA 3CO2A 2NPIA 2RDNA 5ANNA 3WG2A 5GZGA 1AZDA 2P3JA 3C7FA 3KT7A 4NHKA 1EAH2 1ASJ2 4MXWB 3DUIA 4Y4RA 1RUH2 4QPGB 4XUNA 2DVGA 1YYNA 3IM0A 5DAWA 3AJZA 3LKJA 3KQ4B 5E89A 3GZUC 1GZWB 3RNSA 3W20A 1BZWA 2Y0OA 3ACIA 5IJRA 4FPHA 4WVWA 5FZ9A 2PELA 1W2UA 2OUHA 4MO3M 2D6KA 5A3LA 5DUWA 4AVBA 3POYA 1IPJA 3U4SA 4IESA 4XFAA 1V6NA 1OVPA 2MNGA 3VBUC 5IVEA 4I3GA 2Z69A 5JXGA 4Z92B 4CDWC 2OPKA 2Q8DA 2VXJA 4H3WA 3ELNA 1MEC2 2R061 3I3BA 2VVDA 5ACA3 3NNLA 2CTVA 2RJLA 1H30A 2X10A 1FMD1 3CHXA 4FCAA 1PGSA 1OA4A 1O8PA 4RQPC 5K9YA 1MS9A 4OVEA 3AKSA 3LZZA 5FYVA 4HFSA 5FZKA 4XJWA 1Q43A 2RM23 5T50A 3ZN6A 3C2UA 2B5HA 2XBO2 2ET7A 1AYM3 2OQ7A 4N90A 4Q4Y2 3B69A 4P9WA 1UPIA 2C24A 2QQMA 4AVAA 3OB8A 3WNXA 3UGGA 4DOUA 2WO1A 3JD71 1DGRA 1UU4A 2GP5A 3H1YA 4NUBA 2XJVA 2V09A 2W1UA 3ZX7A 1GFF2 1W6QA 2WQ8A 4XXAA 2XONA 3QCWA 1FNZA 1XQNA 1NZIA 2HKXA 2BUKA 3N9QA 3WDYA 4A6SA 4D69A 4FAHA 3THPA 1UF2C 5FLJA 1BYHA 1LENA 1XB9A 3MLLA 1AR63 1AL21 1X36A 2ZKNA 2FMYA 3IZOA 3PTYA 2WZPP 2DTYA 4CDXA 2QKDA 4NRPA 1PGW2 2G9FA 2JB8A 4WVVA 2MEV1 3A0KA 5C6CA 3RZGA 1VPHA 1UN1A 2DVFA 1PO22 4HSLA 2ETEA 4UFMA 4IEZA 1VB2A 5FPBA 1ZZ6A 3ES1A 3U07A 4RS5B 3FFZA 2W52A 3JB4C 1LESA 1M4WA 2CDPA 2EAAA 4LE4A 5ERLA 5IK5A 3RGBA 4YWAA 2LTNA 2BVVA 1RVF2 2OA2A 2GU9A 5I8SA 2XXZA 1HB2A 5CU1A 5JSRA 3CJIA 1CQ9A 1RXFA 4HXCA 4CDWA 1QJY3 2DF7A 4ASLA 2ADEA 1UX6A 1HRV2 2BBAA 2NYYA 4QM8A 2GC1A 4L0PA 4CRQA 3AFKA 4D7YA 2ORXA 3CEWA 1CR7A 2W91A 1NCRB 3IWZA 2FZ2A 1CAUB 2W47A 5DAVA 5FMOS 3WQBA 5IFTA 1ULEA 1OKOA 4XZUG 1G86A 2VE1A 1IPKA 5FZCA 3C3VA 2YFUA 5IAXA 4CVUA 3I3QA 1UOGA 1H9PA 2I45A 5FYMA 2NZ9A 1XRUA 4H7LA 5DG1A 3ZM8A 2VL4A 1LJ7A 4FFGA 3O1RA 4HVOA 1R1A2 2PN5A 2RS53 1DBNA 2ARCA 1VRH1 1GU3A 5C8CA 2Z79A 3CKHA 4NAOA 1OBNA 2D6OX 4GH4B 5KHJA 2ZHNA 4GB31 1H4HA 4CU9A 3E1F1 4BMEA 5EJZB 1JYNA 3QACA 4CP9A 2RV9A 2WN3A 1C8M3 1W2TA 1PGL2 1COV1 2R6QA 4L11A 3KHCA 4IDZA 2WYFA 1I5ZA 1ZZ7A 1C1FA 2ERFA 1QJU2 4DQAA 1CJPA 3OBZA 1VE0A 2K46A 3OGRA 1WLTA 5FY4A 3DYPA 1U5IA 3ECQA 3OJBA 2W5FA 2ZEXA 5FZ1A 4GMP1 4MSVA 3USSA 3TEYA 1BVVA 1ND2A 3JB8A 5JXJA 1POQA 2YFZA 2IUWA 4PI2A 3DPRC 5A3OA 5A6XA 1MS0A 3OTFA 4D6SA
chains in the Genus database with same CATH topology
3EBRA 3ZYGA 5CG8A 1N1SA 1V6OA 1TME1 4A3XA 2HWB3 3O14A 4OZXA 3I4IA 3WW4A 2BTVC 2VMGA 4RHV3 3VBRA 5FPXA 4AI1A 5C4WA 4N53C 3VKLA 4AF9A 1EAH1 4E4ZA 1ASJ1 1SFYA 2XB6C 3MIFA 4WVMA 1RUH1 1NG0A 1V6KA 4K6BA 4BLJA 1U0AA 2EALA 2DVBA 2JG9B 5T55A 1TMF3 3ILFA 5DDJ2 1H1AA 1AR92 1YJLA 2F6BA 2ZGOA 3NV4A 2PAEA 1SQ4A 3BCWA 1YFWA 1RUD2 4YZ2A 4RGAA 1Z0HA 2ILMA 2C9AA 5DG2A 1RUJ3 3J9SA 3K51A 3UKVA 3O12A 1D0GA 2LUWA 1UIKA 1HXS2 1RUI3 4PQ9A 1VAMA 4Q4W2 3ZXKA 1BKZA 2IFRA 3ZXDA 1Q3EA 4Z1VA 1H2MA 1MEC1 3TWIA 3HR9A 4CDQA 5C33A 4KWLA 1DGWA 2YDEA 2RMU2 3MPPG 4C90A 1IS6A 2VULA 3AKPA 3DPRA 3ZFFB 1D4M3 5FLIA 5KHHA 2D98A 3MIGA 1OSGA 5JZGC 3O0WA 2XBO1 2WT2A 3ATGA 1CAWB 3Q9OA 4I2OA 3TRSB 1POV0 1Y7BA 2QVSB 3FWEA 4MGIE 3LCPA 4Q4Y1 3WLUA 5IUQA 1S0FA 2UWBA 4AFDA 1G6NA 1AVBA 4CYDA 4IV3C 1N3QA 1OFNA 1Q5OA 1HLCA 2R073 3SCFA 1MZ6A 1RHI3 4SLIA 3WP3A 4AGVA 4Q1PA 3T1MA 1GR3A 1CX4A 1PK6A 1N1VA 2TUNA 1FPN2 3VGIA 1PGW1 2VVEA 2ZX2A 1WW7A 1MQTB 4XW3A 2HWF2 2JE9A 4FP3A 2A5ZA 3SH4A 4CDUC 4B7KA 2ZGRA 5ABJB 4N43B 1PO12 2XLFA 2E7TA 1RVF1 1LGNA 2XUMA 1QJZA 2JJ6A 2OZJA 3AXDA 4RR3B 3AM2A 3E5UA 2YXSA 4B4PA 2AREA 4PDWB 2UU8A 4C0HA 4XF1A 5JI9A 4S2DA 1HRV1 3ZFGC 4YG3A 4AHZA 3OBTA 4LBNA 4OHZA 2IXKA 4AI2A 1PNFA 1XYOA 4XDQA 3MFAA 1ZZ9A 4XFIA 3GBFA 2ARBA 1ZNPA 3GF6A 1D2SA 2TNFA 2I2SA 1BEV3 4PIZA 5JSPA 1B09A 5BNPB 1QKQA 5T5LA 4FOQA 2ZPXA 1R1A1 4IV3A 1VBA3 1EPWA 4C1WA 1IGOA 5DXDA 1A8MA 1CIWA 1PIV2 1QY4A 2OW4A 3ILNA 2DV9A 2K0GA 4Q0PA 2WNVB 3CJXA 2B39A 1PGL1 2P37A 4Y20A 1QJU1 3FLPA 3CL1A 1S0JA 4LR4A 1LOFC 4GWMA 5HXVA 1VBB1 3RZZA 2Q30A 4ATEA 4DFSA 4YSFA 1UZYA 5BXXA 5BNOB 4CDUA 2Q0AA 1C5IA 1SCSA 3GBGA 5JIAA 1BBT2 3ZYRA 3A0NA 5FLHA 3WP5A 4FPKA 4ISQA 4IETA 1LR5A 1AUYA 2E53A 3MF9A 4GALA 4IXLA 4GKXA 1R093 5BNNC 3NSTA 5LEJA 1RINA 4EN7B 4JTOA 2R0HA 3VKOA 2ZOEB 1WUVA 1W6NB 3VHNA 1RUG2 3FUOA 3OYWA 4L9BA 4OHVA 3NAPB 5CAZA 2RHPA 5A32B 3EO6A 3VKNA 2F4PA 5DDJ1 1AR91 2R30A 4EV0A 5DUUA 3KT1A 2GMPA 4FOWA 4IV1C 1RUD1 4J1XA 1ULFA 1CAXA 4FPGA 1MS4A 1UU6A 1N3PA 1VBE1 4JGYC 4M00A 1J1LA 1WW5A 4WM8A 2PFWA 1H1IA 4NHMA 1LKNA 3E5QA 1HXS1 3M7AA 4Q4W1 3ZFEC 4CEWC 2IZWA 1LOFA 3HT1A 1PHMA 1CN1A 3AK0A 2ZHKA 3RRDA 3WR0A 4ASMB 2W39A 1DQ2A 2RMU1 3ACLA 2GSYA 5CIRA 4HMZA 4JGZC 4QQLA 5SV5A 4YZ4A 5LRSA 3IDEA 3ZO0B 1NZCA 1OPOA 3WW1A 5LK7B 4Q1RA 2R063 4COWA 3OY8B 3WXPA 4LO7A 5FQ0A 1VLNA 1XNKA 1FMD3 5FOJB 4XQ4A 1OKQA 1Z78A 5FDBA 2QZ2A 4BIOA 1JYCA 4XBLA 3H9AA 4FSJA 4XBQA 1SACA 1UW8A 4RSUA 1S2BA 5E16A 3VDDA 3BODA 1FATA 2GALA 1BCXA 2RS32 2A3YA 1CAVA 4DY3A 4CEYC 1SDWA 3FLTA 2ES3A 3JD73 1RMU3 4YW1A 1FPN1 1ZA4A 1PZ7A 1VAVA 4LEJA 3H8UA 5J98B 1RTVA 1A78A 1ALYA 2HWF1 1OA3A 2VECA 1SCRA 2EXKA 3WUCA 4XPVA 4LO4B 2WIIB 1AL23 1PO11 2ZGPA 2WNUC 4CEWA 4P14A 2MEV3 1QQP3 2JICA 4XFBA 4YW5A 1IHMA 2A6WA 2RS12 3I54A 1AR82 3V65A 2DFCA 4YVSB 4JGZA 1OOPB 4YVWC 4DY5A 3BTAA 2JKBA 2DFBA 4AHWA 4B7EA 4MUVA 3ZYJB 5CFDA 3VN4A 1CONA 1AJKA 1HKDA 3NWKA 1ZRDA 1LOEA 2ZHMA 3K48A 4Y26A 4XFGA 3S6PA 1RGSA 1PNGA 1SLIA 3D6EA 4WV8A 2AZ5A 4R9BA 5JLVA 2IXCA 1ENXA 1PIV1 2Y0IA 4QM9A 4AQSA 1DF0A 1OD5A 2ZCWA 3WZ1A 3M3IA 4FXKB 3MW4A 4BPZA 1QNWA 3U4XA 3B94A 4MGKE 1VRH3 4WZCA 5F1RA 4TSVA 4FBFA 1ONAA 1AXYA 5JWPA 4GB33 2N7GA 1COV3 4IEXA 4E2SA 1O3SA 1AX0A 1BBT1 3FC0A 4HVQA 3M4FA 1NLRA 4G4FA 1TE1B 4XF4A 2VMHA 4GMP3 1Q8SA 4FQ4A 5T5OA 3VBSC 2Q8OA 2KA3A 4XIOA 3ZN6B 2DCJA 3AP7A 2DVAA 1GANA 4AVCA 5J96B 1X8MA 1PM7A 1TME3 4XJUA 4MZUA 3ZN4A 1F8VA 4IEYA 3TN92 3ZN5A 1RUG1 4M0NA 2HWC2 4D3WA 3S7IA 4YM3A 2HWE2 1KS5A 3I59A 3GYDA 4ZXKA 1W6QB 4PLOA 1EAH3 5IK7A 1ASJ3 2YGLA 3S30A 1RUH3 2Q5TA 2Y26A 5LK5A 2EVXA 2JG8C 1KFUL 4QHBA 4QPYA 5C9AC 3LB9A 1ULCA 4SBVA 4XFHA 3VKMA 4DB5A 4CDXB 1YNAA 3DL3A 4DINB 2GN7A 4YZ1A 1J3QA 3VBUB 1UD1A 4Y22A 4URTA 4Y1ZA 3ZXFA 2D3PA 1R082 4AXOA 3BALA 4CDWB 1QJX2 4Q26A 3ZIXA 3UK9A 1MEC3 5I91A 1REDA 2R1BA 3MIEA 3S0MA 1NCQA 3OBRA 4XF9A 3SCGA 2PAMA 1X50A 4L97A 2KM2A 3OCPA 3GNEA 5LEKA 3SHRA 2XBO3 1EP0A 1EV12 3ZVXA 3AMPA 2RS31 4Q4Y3 3T1LA 3TBDA 1WMFA 4Q29A 5C8CB 2IFWA 2RR12 3JUUA 3LA7A 4MVTA 4FPOB 1HDKA 2ZGMA 1FT9A 5JIUA 5EYYA 1LOCA 2E51A 4LUMA 1T6GC 3MIDA 1PVXA 2PHDA 2BEOA 3IPVA 2EF6A 4BM8A 1FV2A 2ZZQA 1WCKA 3V64A 4AFMA 1C1LA 1DQ6A 2IWGB 1WCDJ 1PO23 1ND2B 2ZX0A 4MXVA 4Z07A 2D93A 4BLIA 1AR81 5L7OC 3PJQA 1KXGA 1RVF3 2HJIA 3INAA 1D0HA 3RYRA 3J4UH 2WKKA 4QD2A 4QGLA 1HRV3 4XQDA 4ES8A 2RE9A 1LEDA 4AFBA 4FTSA 3VBRB 4FO9A 4AEDC 4PBOA 5C4WB 4J6GA 2WZR2 1PVC2 2A3WA 2XVLA 4CP1A 1NY72 3N35A 4WVMB 5EXOA 1QDCA 2WQ4A 3FBYA 1Q8PA 1AX1A 4GWNA 2CWMA 1CPMA 5AVPA 2DCZA 1BMV2 5I0SA 1R1A3 2XLGA 3WDVA 1V9U2 1JUIA 1O91A 2BQPA 4R8HA 5K7PA 1QOTA 1CPNA 5CG9A 4FP2A 2BBVA 1RUE2 4KG8A 4UBGA 2YUEA 4ONUA 4XETA 4M01A 1QJU3 1RJ7A 5J7MA 2WNEA 1GKBA 3KQRA 1MS8A 4CDQB 4I0WB 1VBB3 4FTEA 4AHYA 3M3QA 4E2GA 4LNVA 1S55A 3DPRB 5L7OA 2PYTA 1ENQA 1W6PA 2GC0A 1Y9QA 4I30A 1NA1A 3ZXGA 2VW2A 4XHXA 4B29A 4NWWA 1O5LA 1WBLA 4XJZA 3D0SA 1ZM1A 4WM7C 5H9PA 1S0DA 2WINB 3TN91 4EWAA 5J37A 2HWC1 5FO9B 4QQPA 3M3CA 4LBKA 3GALA 1G9AA 3N7JA 3FX3A 4HBNA 4YLZA 1W0OA 4I0BA 5CVRA 2GN3A 3VBOC 1PK6B 4YRDA 3V0BA 5D8AC 2QQPA 5DDJ3 1AR93 3NKTA 4HZFA 2XKOA 2JECA 4LT5A 2YPJA 4L99A 1DYPA 2GNDA 2DU1A 1A3KA 2R042 1RUD3 2SBAA 1H2KA 1MS5A 1TQ5A 3FE5A 1VBE3 1URXA 1LOBA 2ZGLA 2ZGUA 1R081 4UW5A 1R1ZA 1RMU1 4HN1A 2D3SA 3GHNA 2UWCA 4K40A 3AFGA 1HXS3 3WW2A 1DZTA 4Q4W3 3KZ4C 1QJX1 3LSEA 1YFYA 3RWNA 2BFUS 4AYUA 3WHTA 3WQ7A 3BIWE 4NWVA 3N7KA 1YIFA 2VQAA 2NMNA 5JMCA 2RMU3 4H7MA 3OD0A 4N9HA 4AHXA 3VUOA 2NM1A 2PHUA 1QQP1 3E6CC 4NO4A 1WMEA 2YMZA 4I09A 4JV4A 4DPNA 2JEMA 4WM7A 3WDXA 1H8TC 1EV11 4RA0A 3VBUA 1HX6A 4IV3B 4DMIA 2IC1A 1MACA 1KITA 2RR11 3WINE 4MH0E 3NO8A 3WDTA 1J59A 4QGNA 1TNRA 2V5YA 4RQPA 4YZ3A 4Y20B 2VMIA 1AL0G 3OGGA 4CTEA 5KXEA 1REFA 1HW5A 1FPN3 3PVOA 2P3KA 2PHLA 1V00A 3WT3A 4B4QA 4CDUB 2ZBJA 1YJKA 2HWF3 3MFCA 3WCRA 4YFZA 1QDOA 1D2QA 1PO13 2WC2A 5CBLA 2BWCA 2UYAA 5IT6A 2PHXA 3AZYA 2H6CA 4UW4A 1MS1A 5KWRA 2D3RA 1BVP1 5FO8B 3O0VA 3KD4A 2WZR1 1PVC1 2VOKA 4XJAA 3AKTA 1NY71 4JDMA 5CADA 4GA9A 4GXLA 2Z2SB 5I0UA 1C57A 3OYWB 4XQWA 3MZHA 4P9JA 5GLTA 2VVFA 1LGBA 1Z7S2 1BMV1 4NR1A 5FREA 1V9U1 3AYCA 3B02A 4LE3A 4PCRA 1CAXB 5EZWA 1PIV3 4OHYA 4Q8LA 4WM8B 3AYEA 4YGCA 1RUE1 4QPGC 3ZSMA 4LA3A 1YI7A 2ZGTA 3TAYA 3ZDSA 1QGLA 1OQEA 1RC6A 2PTMA 3AP5A 1XU2A 3LWCA 1FI2A 4HKLA 3UKTA 1BBT3 4JQRA 1DG6A 5FQ0B 1DQ5A 4OLLA 3TNPB 1WLCA 4EWDA 2EA7A 1KFXL 1WGPA 4AGRA 3AYDA 3FBMA 4PBPA 4C91A 2XJUA 3VDDB 1H8VA 1UAIA 1SFNA 2XH6A 3O0XA 1CAVB 4GULA 1G9CA 3RS6A 1RUG3 1KJRA 3DN7A 2I74A 3V56A 3DKWA 4K21A 1AYN2 4HKOA 3UV9A 1DHKB 2P34A 2R041 2AENA 1LHUA 2BYVE 3IDBB 3VHPA 3D5OA 4RFT0 2VXRA 4KQ7A 4ZU5A 4XF3A 1TNFA 4N53A 4CEWB 3DF0A 4X8PA 5GM0A 2E7AA 2VUAA 5EFUA 3LA2A 3HN1A 2CL2A 1BJQA 5AC92 4JGZB 4Z2WA 5KXBA 3ZSJA 2WS92 3UJOA 1XNBA 3FZ3A 4RS5C 5CFDB 1PO21 3FFQA 4QXKA 4DRVA 1KDKA 4UW6A 4CZSA 3EQEA 4XJ8A 2GDFA 2X5IC 3KLSA 3I8TA 1QOSA 2XG3A 2B7YA 3AP9A 5D1IA 1QHDA 4JC1A 3NV3A 1ZZBA 4BYYA 5FCCA 5HI0A 1H1MA 3FMGA 3PMEA 4A7ZA 1NCRC 2DCKA 2CWSA 3HBZA 4F3JA 5DZGA 2RS33 4XYXA 2JE7A 4V1PA 4XXPA 4YM2A 2AH2A 4KL1A 5JZGA 5CA6A 3WHUA 4Y1YA 3NV1A 2D6LX 2W08A 4ES9A 2ZAAA 4PLMA 1DLLA 1QWRA 2PA7A 3ZMNA 1ZRCA 4AI0A 5I8TA 2ZTNA 3WG3A 5JOYA 2WT1A 1HRI2 3QBQA 4R52A 1DU3D 5A33A 2E9QA 1HV0A 3IIAA 4XEZA 1AR83 3QH6A 4LUKA 1O4YA 4L8QA 3I2DA 2Y38A 3RSJA 2HWD2 2P3IA 4P9IA 4E4SA 2ZGNA 2P17A 4QPIC 4ATFA 3WX5A 3I59B 3AXEA 3NJZA 2X5IA 1WD4A 1O3TA 1Z7S1 1I6XA 1YI9A 4K20A 5E1RA 5GZFA 3ZFGA 2BNNA 4JRAA 2BNOA 4ITCA 4XIKA 5EJ3A 4ZKTB 3RJRA 3GZAA 4M3CA 3VLBB 1QXPA 2B9UA 1NXD1 2DU0A 2X29A 2YHJA 4R4XA 5GZDA 2D6MA 2FQPA 4Y22B 1GLHA 2QFEA 1YCIA 1NYWA 1G9DA 4GMP0 2XLAA 1U5XA 1YIPA 4N7UA 2ZZJA 3POWA 3HD8B 1U12A 2NN8A 2DUOA 4Q0VA 4G3YC 2D40A 1NCQB 4Z8BA 4I3PA 3WY6A 4H14A 2D6NA 3ST7A 1I3HA 4DNYA