2DURA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+/man2-bound form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
251
structure length
251
Chain Sequence
b'SEHLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEENIDWTKIEPSVNFLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicular integral-membrane protein VIP36
molecule tags Protein transport
source organism Canis lupus familiaris
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
total genus 60
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2durA01
4PBPA 1D0HA 4FOQA 1DGLA 5JMCA 5E89A 3O0WA 2OW4A 1LOGA 3A0NA 4Y1UA 5CB7A 3KM5A 2ZHMA 1W6NB 2ZA9A 2EXJA 5IT6A 4FQZA 3H0OA 1DQ5A 1N1YA 3ILRA 1FYUA 1UX6A 3WOGA 1S0DA 1WLDA 4FPEA 4YGCA 4UW5A 2PELA 1MS3A 2V73A 5L73A 1CIWA 1WLCA 1F5FA 1H9WA 3UJQA 2EXIA 4LBQA 1GNHA 2ZMNA 2NN8A 2ES3A 3GALA 1HQWA 2AH2A 4M01A 5T5OA 3NV2A 2P2KA 2A6VA 3V0AB 1N1TA 1W6NA 2C9AA 4Y1VA 2DUOA 3WDUA 3AJYA 4K1ZA 4XMAA 5T50A 1G9DA 2DV9A 2WKKA 2DUPA 1QF3A 2AUYA 2OUHA 1N3PA 3LSEA 2SBAA 3UJOA 4BM8A 1PZ8A 4GKYA 4XJAA 2EALA 3RMXA 3ENRA 1CR7A 1SCRA 1APNA 5JOXA 2EIGA 2ZACA 1A78A 2WQZC 1A8DA 1GYKA 3ZSJA 1C57A 2D3RA 4DFSA 2CWSA 3OBTA 3WHUA 4Y1XA 2E7QA 1DQ2A 3SNMA 1ENQA 5LK5A 3WNXA 5EWSA 4ATFA 2DU0A 3HR9A 1GZWA 4TYSA 1AJOA 3LSDA 4JC1A 1UN1A 5DUXA 4CZSA 2ZGPA 1WLWA 1MS1A 1CN1A 3IM0A 2VW1A 3T1MA 1W6PB 1UKGA 3WV6A 2A71A 4M3CF 1O4ZA 1U0AA 1LULA 3A4UA 5CAZA 4FPGA 2YY1A 4YW5A 4FPJA 2P3IA 3APBA 3W59A 4XHXA 1MVEA 3AYAA 1WBFA 3M3EA 2E51A 1DIWA 1CPMA 4GA9A 2GNDA 2GMEA 3BODA 4DS0A 2YMZA 1YYNA 1LJ7A 2UWCA 4FPOB 4K21A 1LCLA 1AF9A 1S0JA 2YROA 4FPKA 5HCFA 1DFQA 2JE7A 3ZYPA 1NLSA 5T54A 2GMPA 1WUVA 1A3KA 2NM1A 2D6PA 4YW1A 4FPFA 3WVJA 1N3OA 4GALA 1FX5A 2E6VA 5T5JA 2CL2A 1ULEA 1DQ4A 1AX1A 1DYPA 4JCKA 1DLLA 3WDYA 1MS9A 5CNAA 3OBRA 3UL2A 3AP7A 5IK4A 5GZGA 3USUA 1WW7A 3SH4A 3L2YA 5T5PA 3AZYA 4L8QA 4TZDA 5SV8A 5EYXA 1WD4A 2VXRA 2DTYA 1AXKA 2JD4A 4LBQB 4M00A 3SH3A 4YFZA 2R0FA 1ZM1A 4YZ5A 1ULGA 4W65A 5JOZA 2R1BA 2ERFA 1QOTA 1FNZA 3B01A 1V6KA 2ARXA 1BZWA 4XBQA 3N7KA 2GMMA 3MEPA 3SITA 4RA0A 1MS4A 3HN1A 5T52A 1JYCA 4P9WA 4DRRA 3MPPG 4ISRA 4YM1A 4DRVA 1AX2A 3ILFA 1QDOA 2YZ4A 3SISA 4KBBA 3A0KA 1W6QA 1DZQA 3TAYA 3ZXJA 2A75A 3AFKA 4FVVA 2UWAA 1N1VA 4K20A 1HDKA 2WLQA 2ZHNA 4JRAA 4AGVA 2D3PA 1W6PA 3PMEA 2A70A 3NV4A 3WG3A 5GZCA 3ZXEA 2D7FA 2OUJA 3AXDA 1Q8QA 2HYKA 1S0FA 1UMZA 1V6IA 3O0XA 2TEPA 2H0BA 2VW0A 3IN9A 1IS6A 2ZZJA 2GN3A 2CYFA 2DVBA 2YXSA 1VALA 1Q8OA 2B7YA 4DPNA 1QMJA 1SBFA 2PHXA 3AXEA 4SLIA 3OYWA 3IKWA 1WBLA 3ZSKA 4Y20B 1JHNA 3MW2A 4XXPA 1BJQA 1LECA 3B3QE 3QLQA 3R4UA 3FBYA 1QNWA 3OY8A 2ZMLA 1AVBA 3FUQA 1NXD1 2WNEA 2WSVA 3WHTA 1HKDA 3OGGA 1MS8A 1LHNA 2WSUA 1Q8PA 4YW2A 2ZGKA 1H30A 4YG0A 5DUUA 4XBNA 2D6OX 1FV3A 3I4IA 5DUWA 3AZWA 4BOWA 2WJSA 5IUQA 3V0AA 2WT2A 1BYHA 5HCAA 5GLTA 4XZPA 2Q5TA 2A6YA 1JOJA 1S0CA 1OQ1A 5FREA 1Y7BA 2JJ6A 1KRIA 1S0BA 2CWMA 3OJBA 4XHBA 1JUIA 4FPHA 4FOWA 1Q56A 2JKBA 3OPZA 4Q8LA 1JN2P 3BTAA 5DXDA 2DVFA 1FAYA 1W6MB 1HLCA 2R49A 1W6MA 3PVEA 4WVVA 1GZ9A 1WW5A 3FLRA 2ZGLA 3QCWA 1KITA 3B00A 2EXHA 2JDZA 2CNAA 1CVNA 3O0VA 2PHRA 5KXCA 1KJLA 2D6MA 1IOAA 1IS4A 1IS3A 1LGBA 2ZGNA 1LTEA 4NO4A 2P34A 3POWA 3WG1A 1B09A 2NZ9A 1WCSA 1JBCA 2DTWA 2PHFA 4FOVA 3USUB 3VKLA 3ZSMA 4M3CB 2FMDA 3AX4A 3NV3A 4HL0A 1C1FA 3ZVXA 2AENA 4FQ4A 3VKFC 1VLNA 2UU8A 2ZGOA 4AYUA 1C4RA 2ZGRA 1R1ZA 5H9SA 3WCRA 2GALA 1IKQA 3JUUA 1YI7A 5H9PA 3OY8B 1MZ5A 1GNZA 1RIRA 4P9XA 2VU9A 3WG4A 1FNYA 4FPYA 4YM2A 4YZ4A 2PHTA 2W68A 5GJ6A 3GNEA 1SLTA 4BMEA 1S1AA 4AVTA 5F9TA 4GWNA 4XJ8A 4BLJA 2A7AA 3WUDA 1UAIA 2Z42A 4AGGA 5GZFA 4FPLA 5JOWA 1UZYA 1AX0A 1EPWA 4HANA 1CESA 1GKBA 3WCSA 1H9PA 3N7LA 4YGDA 1SFYA 4RL7A 3C2UA 1CPNA 1LHWA 1O4YA 1YXWA 2NP0A 1G7YA 3SH5A 4R9DA 2DURA 2VW2A 3T2TA 3N7MA 4ZXKA 3AP4A 1DBNA 2DYCA 1D2SA 3AYEA 1W6OB 4UW3A 3N35A 3AJZA 1DQ6A 2ZAAA 2WT1A 3FLTA 4XMIA 5IK5A 4XOGA 1FATA 1KJRA 1LU1A 1JYIA 1LODA 3FLPA 5H9QA 4F83A 1GZWB 5H9RA 1BQPA 2SLIA 4LBMA 3R05A 4YW4A 3ZPYA 2ZGSA 4XDQA 1LGNA 2NMOA 4Q2FA 1GLHA 3ZXLA 5CA6A 3M2MA 1DYKA 3BIWE 5EYYA 5GALA 4ASMB 4FPCA 1LOFC 3DGTA 5BYNA 1BKZA 1I3HA 5JOYA 1ULCA 1XQNA 1WW4A 2R0HA 1VAMA 3LCPA 5T5LA 1V6MA 3VKOA 2R16A 4R9AA 1MVQA 1V6JA 1W0OA 1CJPA 2W39A 1N3QA 1V00A 3IMNA 4XTMA 4Y22B 4CTEA 2GNMA 4BLIA 4Y1ZA 1IS5A 2A3XA 3M1HA 4Y26A 4P9YA 1SLAA 1W6QB 2EXKA 2ZGTA 1F9KA 1FV2A 2ZHLA 4LBOA 2NMNA 1CONA 4P14A 3N7JA 2P3JA 4LBJA 4LBKA 4C1XA 1ENSA 3ZSLA 1PZ9A 4UW6A 2AGSA 3ZXFA 1MS0A 2D3SA 3D4KA 4Y22A 5GZEA 5GLVA 5FRAA 1W0PA 2D6NA 3AP6A 1WW6A 3INAA 4R9CA 4XJWA 3RSJA 5JLVA 2A3YA 1UZZA 4XJUA 4YG3A 1SLBA 4K1YA 5E88A 3V64A 3VUOA 4YZ3A 2VY0A 1V6LA 3WDVA 4YM3A 5IK7A 4Y1YA 1G86A 1OFSA 5GZDA 2ARBA 4WV8A 1LESA 3WDXA 1AXZA 3M3QA 5DG2A 4LBQD 3PVNA 1GICA 4XJ9A 2BQPA 1DQ1A 2AYHA 2VUAA 5T55A 3Q9OA 2P3KA 1SBDA 2DVDA 4WVWA 3NV1A 2D6KA 1X50A 3W58A 5KXEA 3AZVA 1QOOA 1GBGA 2OVUA 4GKXA 3O5SA 1Z0HA 3TB0A 4BMBA 1S0GA 4DQAA 1PZ7A 2ZGMA 1VIWB 4Q8KA 1Q8SA 4WZFA 2LTNA 1LHUA 4C1WA 1QOSA 1G9AA 1ENRA 4CRQA 3D6EA 2GNTA 4Q1PA 4UW4A 3SLIA 3VV1A 1G9FA 2EAKA 3AP5A 3NWKA 1VAVA 1SCSA 3FFZA 4XILA 1LU2A 1V6OA 1MZ6A 3N3HA 3M3OA 1GZCA 1LGCA 3ZXKA 5DZGA 1QNYA 3AYCA 4PBOA 4YGBA 4YZ2A 4YG6A 2R1DA 2WT0A 1LOCA 4H55A 3JU9A 4FP3A 5JVVA 1LHVA 4U36A 3DUIA 1S0EA 5IK8A 1C1LA 1LEMA 3IPVB 4FOYA 3D5OA 4PQ9A 1QDCA 1S0IA 5AVAA 3UK9A 1AZDA 1RITA 2ZABA 2UURA 2EF6A 2G4IA 4Q26A 1F31A 3MW4A 1QKQA 3AP9A 4XTPA 3VKMA 3WDTA 5DG1A 4YM0A 1Z78A 2ZHKA 1CQ9A 4M3CA 4AWDA 2DVGA 3AZXA 4AVVA 4BQ1A 1ONAA 3POSA 5GLUA 3V0BB 3PVOA 4XIOA 1LOBA 1N47A 3V0BA 1MACA 3RG0A 2CTVA 1ULFA 2XB6C 4BPZA 2ZGUA 3O12A 4D69A 3ATGA 2LALA 2VH9A 3N36A 1LOEA 2A6WA 3B69A 4U2AA 4MYEA 1HQLA 1KDMA 5JDBA 2NYYA 5GLZA 2ZGQA 3IPVA 2A6ZA 1YRZA 4YW3A 2JE9A 4Q1RA 4PF5A 5DZEA 1LEDA 5DUVA 3T1LA 2E7TA 2ZKNA 5GM0A 3WUCA 1YO8A 4ISQA 2W52A 2DVAA 2DWRA 2GDFA 2XG3A 1AXYA 4Y24A 3RS6A 1GV9A 2A3WA 3I8TA 3RRDA 1W6OA 4FP2A 1URXA 5KXBA 3AYDA 4YZ1A 1I1EA 1SLLA 4XJZA 1OKQA 3WG2A 1YIFA 1JW6A 1GSLA 1LOAA 2A6XA 2AREA 4YLZA 4Q27A 1MR5A 3BOPA 3MW3A 1RINA 4NOTA 4IQPA 2YV8A 1QU0A 5KXDA 1N1SA 2KM2A 4YGEA 1JXNA 2RHPA 2ZBJA 2DUQA 1Q8VA 2AR6A 4XXAA 3POYA 2GN7A 3KQRA 2PHUA 1KDKA 2D43A 3PJQA 1TEIA 2CY6A 4Y20A 5E8AA 1BXHA 1DQ0A 5F5QA 4AVSA 1QGLA 4GWMA 4XIKA 4LBLA 2D44A 1J1TA 2C5DA 1SBEA 1V6NA 1LHOA 4Z8BA 3WDWA 1SLCA 4R9BA 1ULDA 5HCBA 1LENA 2UWBA 4LBNA 3AZZA 1AJKA 5GLWA 1GANA 3ZYRA 3ILNA 1KQRA 3V65A 5CBLA 2GNBA 2DU1A 4ZKTB 2E53A 1G9BA 1ZA4A 4XYXA 3RMYA 4GXLA 2JECA 4XE9A 3CNAA 4ATEA 2ZMKA 3OYWB 1WD3A 4AGRA 3VKNA 1G8WA 2FHRA 4I30A 4OZXA 2W08A 4PCRA 2V5YA 3M3CA 1DHKB 1SLIA 4XBLA 3WLUA 5EXOA 3ASIA 4ITCA 1UL9A 2I2SA 1SACA 1G9CA 3R4SA 2ENRA 1MS5A 3U4XA 4YFWA 2PHWA 2A5ZA 4M3CE 3WZ1A 2D6LX 2P37A 3RQ0A 3FUOA 3B9CA 1LOFA 5DZFA 1UPSA 3HMYA 1IKPA 3AK0A
chains in the Genus database with same CATH superfamily
3IDAA 1NOVA 4PBPA 3OG2A 2CV6A 4FOQA 4M0NA 1DGLA 5B4XA 4CVUA 3NJZA 2DFBA 2FCTA 4HKWA 3HN3A 1REEA 4UF0B 4V2VA 1W6NB 2JB4A 3H8UA 4ASKA 5IT6A 4XURA 4XFIA 2YBSA 1JUHA 4RN5A 3ILRA 2HBUA 1UX6A 4JRLA 4QHOA 1S0DA 1WLDA 4FXKB 3GBWA 4Y4RA 4YGCA 3SCHA 1MS3A 4DZGA 5FK8A 3D8CA 4GQ7A 2VUDA 2XBO3 3UJQA 1ZNPA 3I2FA 1I9RA 5CZKA 2C1FA 2J1RA 1K12A 5T5OA 3NV2A 2P2KA 2QZ2A 3V0AB 1N1TA 1W6NA 2C9AA 1VB2A 5T50A 5CFCA 4TTGA 3Q8CA 4JGZC 3UJOA 1T6GC 1PZ8A 5FTTC 4XJAA 3RMXA 4Q4W3 1WCDJ 4ZU4A 2FQPA 1QQP1 2G9FA 2EIGA 2JWPA 2VVFA 2ZACA 3OGSA 4CDXB 2BGCA 4IESA 3O1SA 1HX6A 1YIPA 4QXKA 3AM2A 1PMIA 1NQDA 3PMSA 4TLFA 4CCCA 5A1AA 2YB7A 4ZZ8A 1JZ6A 1JYXA 4UBHA 1QJFA 4UF0A 3WNXA 5EWSA 1P8JA 2VVEA 4CDXC 3TN91 3RZLA 1RUI3 3SKJE 2B39A 1CAXB 1QQP2 1UN1A 4BDVB 4JKLA 4QDRA 2D5FA 4CZSA 3KF5A 3N9MA 4CXYA 1MS1A 1NCQB 3B94A 3T2PA 1PO12 2XUEA 1W6PB 3LEIA 5FIXA 3ZOIA 3P5BA 1RUOA 4M3CF 2BEOA 3H8OA 2QKDA 4ZHNA 1U0AA 4HK9A 4OUMA 1DLCA 4LO5B 3CU7A 3K4DA 2JXAA 5K0UB 3EYPA 3APBA 3W59A 1NE6A 4XHXA 5LASA 3BPSA 1S55A 2G1MA 1DIWA 3VBFA 5F3GA 4GA9A 2XBO2 4CDUA 1PO13 3BODA 2YMZA 5L9BA 4JKMA 1PVC2 1R083 4MGSA 2WZPP 4B4RA 1DGRA 3LWCA 5FYUA 1UXZA 3HBZA 1DFQA 4CU8A 1KEXA 3MLLA 1A3KA 2BERA 3OEAA 4FPFA 3WVJA 2QUOA 4GALA 4MO3M 2I45A 4XFFA 2V4VA 2GP5A 4N7UA 3MFCA 4KWUA 1DYPA 1L3JA 2VR4A 1GP4A 1MS9A 1O3QA 4ONUA 3USUA 3L2YA 4KU7A 3M8LA 3EQEA 1W9YA 5L7OB 4DUXA 2VXRA 3I3EA 1AYM1 1AXKA 2JD4A 4P9LA 4DUVA 3SH3A 4QPGB 1TMF1 3OTFA 1ZM1A 2P6HA 3FWEA 4RHV3 2D40A 1OHFA 3FMGA 1RYYA 4Q4W1 3B01A 1SPPA 1BZWA 3EJKA 4RA0A 5C4WA 3RFRA 2Y6KA 3RNSA 3C7OA 1ND2A 1D4M1 1D4M3 3AMHA 4P9WA 4QT6A 5F3CA 3CQOA 1AX2A 3QH7A 2IXKA 1QDOA 1SZBA 1XE8A 2YZ4A 1CX1A 3A0KA 3MFAA 1RVF1 2ZEWA 1BCXA 5FJKA 4MUVA 4BQ4A 2CU5A 1N1VA 4GAZA 1HDKA 5A3PA 2VMCA 2ZHNA 4COWA 4AGVA 3PMEA 2BYVE 2VZUA 2D7FA 2P1BA 3LA3A 2XVKA 4JHTA 1V6IA 3O0XA 4YVSB 5FY7A 2P17A 5FYSA 3IN9A 3T0AA 5DABA 2GN3A 1JMUB 2BOIA 5A32B 4NRQA 1VALA 3CHXA 5LB6A 4KNCA 2ZEXA 1HW5A 1LNSA 4UXAA 5EJ3A 5CU1A 3QOPA 1REDA 1K42A 1DGRN 4SLIA 3OYWA 4V1PA 3IKWA 2NLRA 3E5QA 4Y20B 1JHNA 4COVA 4J6GA 3BYWA 1XB9A 2OS2A 4AK3A 4B4QA 1AR83 4KQ7A 3QLQA 4JGZA 5BNNB 2WAAA 3W5MA 3OY8A 2JG8B 3WNLA 3NO8A 2IVJA 2R073 3LQCA 4XUPA 3H8XA 4QXCA 4IXLA 1ND2B 3AKTA 4OFGA 4DEQA 1FXZA 2ZGKA 1FV3A 1Z7S1 3I4IA 1O59A 3LGRA 2WT2A 3L9JT 1JZ8A 3PJYA 1BYHA 2WINB 3T2OA 4QWNA 1MZFA 2WO3A 2ZX1A 3GJBA 1WKYA 1CWPA 1YQ5A 2LW8A 2HJIA 2JJ6A 3W5NA 3T0BA 5FUNA 3MF6A 5C4WC 1KRIA 4YVSA 5FY9A 4LNVA 1UCXA 1JUIA 4FPHA 4LK7A 2W91A 4JKKA 1STMA 4QPWA 4AHYA 1EY2A 5FY1A 3RDIA 5C4WB 3E5XA 1W6MA 4KI5M 3WINE 3RZHA 4JTOA 2ZGLA 1J58A 1KITA 1PNFA 1OLME 3G6JB 2WYFA 2P3YA 4YPJA 1TNFA 3C7EA 4CDQC 1UY3A 4QB6A 1AR92 3VBFC 1OQEA 3TOJA 5B2GB 3E97A 1HRI2 2VECA 4XAAA 1JBCA 2XONA 4FOVA 3USUB 4MVTA 2YGLA 1UF2C 3ZKYA 3OSDA 1R1A2 2J1AA 3VZLA 2VBDA 1W0NA 3ZLIA 1F4AA 3ZVXA 3VKFC 1VLNA 1UYPA 2ZGOA 1F2NA 2HLEA 1JU3A 3CZUA 5H9SA 2QDRA 4XDOA 2GALA 1Z7S3 1IKQA 1VBB1 5C3PA 4Q0PA 1AYN3 3CL1A 2ARAA 4UI9L 3PVBB 4CDQB 4FPYA 2B9UA 2YG0A 2IZWA 1QJY2 2W68A 4YSFA 3GNEA 2CHHA 4MXWA 1S1AA 3TEYA 5D1IA 1UAIA 2XLFA 4NIGA 2WN2A 5LA9A 4CEWB 3PTYA 5A3LA 1YQ6A 2PXJA 5FMBA 5I0TA 5A3MA 4D6QA 5A1FA 2WFF1 1CESA 3KQ4B 3K77A 4IEWA 3WCSA 4RL7A 3C2UA 4LHNA 4PI2A 3PHMA 1OSGA 1H4GA 2IWGB 1GMMA 4Q4Y1 5D2AA 4DO0A 1D2QA 1RMU2 4LIUA 5FZCA 3UESA 4E4HA 2ZX4A 1Z7S2 3AP4A 4NR1A 1CZVA 4UW3A 4MH0E 2C4XA 1OUSA 2WT1A 3J8F2 1KJRA 2VZ3A 4FTBA 1C28A 3NAPA 3MV01 1I5ZA 3NJXA 5H9QA 4F83A 4H14A 3KGZA 4L99A 2SLIA 1M4WA 2Q8OA 3WW3A 3KCCA 3LEMA 3HQUA 4YRDA 3DKQA 5ACA3 5CA6A 1DYKA 4NWVA 3VN4A 2Z79A 4OHXA 5FZ8A 3U37A 1HQNA 3CJXA 4YWAA 5BYNA 1EP0A 4CCMA 5CFCC 5JOYA 5CIRA 4YYOA 1UOBA 3ZX7A 3BKZA 4KBZA 2R16A 4R9AA 5A1LA 1V6JA 4IE6A 3RGBA 5F2WA 4XTMA 2QQUA 4FSJA 1CD3G 4IEPA 1K5MB 2GNMA 3K3OA 1RUJ3 4N8MA 4KU8A 4LA2A 3SC7X 5JI9A 2K0GA 2WNVB 4Y26A 4GB31 1YFYA 4EJRA 2VOXA 3VDAA 3WR0A 3NRUA 4A41A 1HRI3 2EAAA 5FR3A 1FV2A 2ZHLA 3VDBA 2V5DA 4P14A 4XFHA 3ACHA 3H1MA 1RVF2 2X29A 2AGSA 3C3VA 4OI0A 2CGPA 2W3JA 3ZFGC 3I3QA 5GLVA 2N7GA 2D6NA 4CUAA 4XJUA 4K1YA 5E88A 5KR7A 3OUJA 4E2GA 3WDVA 1UU4A 1ZRIA 5IK7A 1HB4A 1OFSA 5L36A 1OA4A 1CAWB 1C5HA 1OUXA 1PGL2 5FZGA 1PGSA 1QIQA 1JI6A 2IFRA 3VBOB 5HCHA 3OGRA 5JZGB 5L7OC 2VUAA 3DN7A 4I01A 5T55A 4A4AA 2P3KA 1V0AA 1KFXL 4WVWA 3NV1A 3HQXA 5KXEA 4RGAA 1QOOA 2XOMA 4W4ZA 3HPNA 1V70A 1ASJ3 1W2UA 1Z0HA 4ES8A 3FJSA 4GULA 3WNPA 1UY2A 1YQ2A 5F6LB 1VIWB 3VGIA 4O61A 3VD7A 4Q8KA 4EV0A 4CXXA 4BK4A 4QKBA 1DZTA 1MEC3 2QJVA 5BY5A 1UY4A 4AEDC 1SDWA 1ENRA 2GNTA 3U10A 3SLIA 1FMD2 4FFFA 2VXJA 4HMZA 3AKRA 4AEMA 5DPNA 3CJIC 1GWMA 1WMDA 3VBSA 1WA4A 1W2AX 3M3OA 4NUBA 5C3RA 2RM23 1PX3A 2R061 2Y38A 1QNYA 1SHWB 5A80A 1RVF3 4URAA 2XH6A 1LOCA 2G9GA 2JG9A 2HEVF 1LHVA 5J98B 4QU2A 4RR3C 1C1LA 1LEMA 1VBA3 3U14A 1ZZ9A 5AVAA 1UD1A 3UK9A 2R062 4XUTA 1RITA 2QE3A 5BNOC 3ON7A 2VBBA 1POV1 5ACA1 1SG3A 1X36A 2UURA 5EPAA 1AR91 1XU1A 1F31A 1QKQA 3FHIB 3LDBA 4O9EA 3SEEA 4CEWA 5I8YA 1C3HA 4AWDA 2QFEA 1GWKA 2ZHKA 1ODNA 4IV1A 3BI3A 4CEYA 4KWJA 1ONAA 5GLUA 5L19A 1N47A 1MACA 3AC0A 4IE5A 4JDMA 1NG0A 5FMOS 4FAGA 1PMHX 5LBEA 1NY71 1RUD2 2ZAHA 3ATGA 4D69A 1YHFA 1RUG1 2VH9A 4NPRA 1OQDA 4U2AA 4MYEA 2VNOA 5GLZA 1XC6A 3IPVA 3H7JA 1K3IA 1YRZA 2JE9A 2BNOA 4Q1RA 4YW3A 2EIDA 1LEDA 3T1LA 5GM0A 2HYXA 2VL4A 2Y8KA 3NNGA 1XNDA 4RS5C 3E6BA 4HPKB 1GV9A 2A3WA 1YLLA 2ZXQA 2W1SA 1QWRA 3QACA 4AI8A 4AEDA 1OLMA 4FP2A 3WT3A 4F7ZA 5KXBA 2HWE1 5K4LA 5A6YA 1IG0A 4NPMA 1OKQA 1PHMA 2A6XA 1K5JA 1LOAA 1QH6A 1UPIA 2IVIB 3N9LA 4OMCA 3DXUA 3PU8A 4JGYA 5FZMA 1MR5A 2FCVA 1XNTA 2W94A 5EQUA 1C8M1 4NOTA 1JS9A 2Y6LA 4RFT0 2PLV2 2OQ7A 4YGEA 1EAH2 3GCXA 1JXNA 5C9AA 1DG6A 2DUQA 4RQPB 2XLGA 2AR6A 4XXAA 3UYJA 5BNPB 3KQRA 3POJA 4EROA 1J1LA 2F17A 5HPOA 2F4LA 3DYPA 4LO7A 5DDJ2 4AL9A 3PJQA 1TEIA 4Y20A 5E8AA 3RYPA 2LS6A 3I3DA 1RUI1 1DF0A 1M06G 3VBHA 5A33B 1SBEA 2JDNA 5A33A 1X33A 1V6NA 3GHNA 3VBHB 4COYA 3QD6A 1LHOA 2WWSA 2C0ZA 5GKAC 4Z8BA 3T4HB 1JHJA 5CYYA 2D98A 5EV7A 5M0TA 3WX5A 4MLOA 4LBNA 5C8CC 1AJKA 1J3RA 5F3EA 5GLWA 1QQP3 2BWCA 5ABJA 3GHMA 4Q4X2 3J26N 3I97A 4YVWB 4XYXA 3RMYA 2E9QA 4GXLA 4XE9A 5JPMB 1D4M2 1FMD3 1OD5A 1QXPA 2JX9A 3OYWB 4CCEA 1KS5A 2RJ2A 2W08A 3GZAA 5FZ7A 1XSQA 4PCRA 2V5YA 3FFQA 4B7KA 4QPIB 2E63A 4WM7B 4UT5A 5T3NA 4R52A 5HV0A 5JR7B 3JBG1 3AVSA 3O1TA 1LB2A 2VOKA 4OVEA 3JZVA 3EB7A 4BWOA 2RS31 4WM7C 1AR61 4BA6A 1HRV2 2HKXA 1ZBE1 4CDXA 2P37A 4NROA 3RQ0A 3FUOA 1KFUL 5FP8A 1Y9QA 1WLTA 4FPEA 3HNBM 1S2EA 3NMBA 3EHKA 3S57A 1D0HA 5FLIA 1KS4A 2JICA 2P4EA 3KM5A 4MGZE 2ZA9A 3S7IA 2WA4A 4CCJA 3H0OA 5DAXA 2MHFA 1N1YA 1U5XA 4IV1B 3WOGA 1VBD3 1R082 4UW5A 3IZOA 1TNRA 5L73A 2VUCA 1F5FA 3ZR6A 4GH4C 4P5HA 2R30A 5FZ0A 3DYOA 1NA1C 2WNVC 2VNGA 1RUF3 4Y1VA 1WZXA 1XNBA 2DUOA 3O7OA 4K1ZA 1VBC1 2DUPA 1QF3A 2WKKA 4FT8A 4Q0QA 3VBFB 4AFAA 2QDNA 2FDIA 3FHAA 3LSEA 4BM8A 4GKYA 4LKSA 2DF7A 3CDZB 4IE7A 1O8PA 5A3NA 5C70A 2OPWA 3CF6E 4IEYA 4CCKA 2WQZC 1OXCA 1ZZCA 3MIHA 4LKDA 4RHV1 1OVPA 3KT4A 1NCQA 4HG6B 2CWSA 3OBTA 4XCBA 4XC9A 3PL0A 4Y1XA 2HWB2 1DQ2A 1RUH1 2WZR3 3KSCA 1ENQA 5LK5A 4I2OA 3RYRA 4CDUB 4ATFA 2DU0A 3HR9A 1GZWA 4MG2A 2VJXA 3LFMA 4JC1A 2WN3A 1YFWA 5D8AC 5DUXA 3NJYA 3M7AA 4LJHA 3B02A 4Y5Z0 3Q8FA 3LD8A 1E5RA 1OLRA 1POV0 2JDPA 2A71A 1U5YA 4HLTA 4XFAA 1YEWA 1NT0A 4AQTA 3SCGA 1DGWX 2RS13 1RMU3 5A7SA 2P3IA 1GP6A 4HVOA 1XNCA 3LFIA 3AYAA 3AKPA 3M3EA 5FQ0B 4ARYA 2E51A 5KC5A 2QZ3A 2WNUB 1H8TB 2GNDA 5D8AB 2PHDA 4K8FA 4BXFA 4DS0A 3LB9A 1HJFA 3ZYGA 4S2GA 2AEYA 4KWLA 4GWJA 4K21A 4TXWA 1I6XA 3ZFFB 4FPKA 2YROA 1W28A 2VD7A 5T54A 1R091 3GJAA 2GMPA 1WUVA 2NM1A 5C71A 5L7OA 1N3OA 5C8CA 1FX5A 1W06A 4CUGA 4DNYA 1T2XA 3DPRA 3Q8EA 2CL2A 4NJ4A 4QPIA 2IXHA 4JCKA 1UOFA 2Y6FA 1RUG3 1RGSA 2CGNA 2J1VA 2YFUA 3AL5A 3AP7A 3OBRA 4JQRA 5CFCB 3NNLA 4LTAA 2D5HA 2RS12 5FZHA 4L8QA 4OI4A 3KV4A 4LKFA 4K9SA 1RJ8A 1GU3A 3NAPB 4BQXA 5C5UA 2DTYA 1H2LA 4BIOA 2VQ0A 4QB2A 4YZ5A 1ULGA 3OPTA 1AR93 4W65A 5JOZA 1RHI2 1ZBA2 2WS92 2ARXA 3CJIA 3BU7A 3I2IA 2WFF2 3T09A 3MEPA 3SHRA 5ISLA 1L7RA 3DKWA 1H2KA 4C91A 1OPOA 3MIFA 2WLPA 2Y0IA 1NUKA 1H8TA 1VAKA 3J7NA 3OF1A 1POQA 3ILFA 4G9SB 2O14A 4YM1A 3SISA 4KBBA 3VZJA 5CFDA 3WD5A 5C5TA 1W6QA 3GXUA 3U1XA 3TAYA 5LW9A 2A73B 1MQTA 1IQDC 3GGLA 1FPN3 3AFKA 2JDUA 4K20A 2VZPA 4LLFA 3BIEA 2YU2A 4AVBA 3WF4A 4JRAA 1W6PA 4ZPIA 3WG3A 1VBA2 5GZCA 1JODA 3AXDA 3BB6A 5CEHA 2HYKA 1HN0A 4Q4V1 5IAXA 5KBFA 1ND2C 1RTVA 2G9ZA 1UMZA 3NL1A 4S2FA 3RJRA 5IVFA 4KGQA 5FP3A 4Z2WA 3VZOA 2CYFA 3H3ZA 3ZIXA 1Y9GA 3CKHA 1Q8OA 3AFGA 4DPNA 3O1MA 1QMJA 1SEFA 1SBFA 1YC61 2DCZA 2R072 3K4AA 1A8MA 1IG3A 4QKNA 5CKMA 3I2OA 4LITA 1WBLA 2C24A 4MXWB 2WAOA 4O7XA 1PIV3 4XXPA 1BJQA 1LECA 1X9TA 1MEC2 5F5CA 1COV2 3FX3A 1UU5A 5IVCA 2ZMLA 1AVBA 2XJTA 3FE5A 5FZFA 3VBRA 1W8NA 3G7DA 1CAUA 3U07A 3VL9A 3WHTA 1KD7A 1HKDA 2VZVA 5C9AB 4EN9B 1Q8PA 2VPVA 4YG0A 2PAMA 5C8WA 3NNJA 2D6OX 1CAVB 2IXJA 3AZWA 1QH7A 4GJYA 4PJYA 1RMU1 5IUQA 3V0AA 1CIYA 5GLTA 4XZPA 3Q8BA 2A6YA 2FZ2A 4GJZA 3C8XA 1S0CA 3P1IA 3ZDVA 1FOD1 1Y7BA 3KS7A 3MLJA 3NJVA 2BRTA 2FBEA 4N53B 4KG8A 4NAOA 3QH6A 2JKXA 2MEV3 4RFRB 1Q56A 3TRSB 1AL23 2PLV3 1FAYA 1Y9MA 2JG8C 5BNPC 2BGPA 2VGDA 1W6MB 2XLAA 2BFUS 4JTNA 5FWEA 5FYBA 4WVMA 5CKQA 3BOWA 4XABA 1GZ9A 1WW5A 2DDUA 1RUH3 1NCRA 2VMFA 3ACFA 3FLRA 3LEGA 4AI1A 3VZMA 4C0BA 3B00A 3O1RA 2EXHA 4AFCA 2JDZA 1HXS2 1CVNA 3CEWA 3O0VA 1C8M2 1KJLA 3VBUB 1IS4A 2PLV1 2RMU2 2ZGNA 2DCYA 4Q0UA 2YHJA 3JQXA 5EJ1B 4NO4A 3POWA 2XKPA 3E6DA 4CDUC 3WG1A 1B09A 5F7UA 2RJKA 2NZ9A 3N9PA 1WCSA 1BMV1 4XFBA 2GP3A 1S4CA 3ZSMA 3H9AA 1VBC2 2FMDA 2XVLA 1I5PA 3NNFA 3NV3A 3RYKA 2VMGA 4HL0A 5C3SA 3K51A 4NHKA 2AENA 1VBC3 2JENA 5KHJA 4CU9A 1R1ZA 3WCRA 5EFUA 1TME1 2WZEA 5JIUA 3VDCA 1QXRA 2VO5A 3FBMA 4RS5B 1VRBA 1MZ5A 1NA1A 1W8HA 3OY8B 1BMV2 1RUJ2 2XR4A 2VU9A 3WG4A 4AHZA 2PHTA 5GJ6A 1NQJA 2PAKA 3RPQA 2WZ8A 1SLTA 3R4DB 3WF0A 1OOPB 4BLJA 1PVXA 3B93A 4EZ4A 1DDLA 4AEKA 3WUDA 3ABZA 2Z42A 1J3PA 4AGGA 3IIAA 1AX0A 1E5SA 1MQTB 1UZYA 4J1XA 2QNKA 2ET1A 1Q3EA 1UKRA 1WCUA 2H6CA 2V72A 3KHCA 1J84A 2ID4A 1BEV1 2XJVA 4Q4X3 4Q29A 4UWDA 1PVC1 1XE7A 1O4YA 2VQUA 4RQPC 2Z69A 2NP0A 4Z07A 2DURA 4QD2A 4X8NA 1H4HA 3T2TA 4G4FA 3KB5A 2VOVA 2Y64A 4AVCA 2DYCA 3AYEA 5FYIA 1TZOA 1AR63 2VCMA 4P9JA 3FHQA 3FLTA 4INDA 4M0HA 4P08A 4XOGA 3HOBA 4LHKA 1LU1A 2VOTA 1D7PM 2OT7A 4AI0A 4JAAA 3IBMA 3KMHA 3I2GA 2B45X 5FO7B 5A7WA 3ZXGA 2J1SA 3R05A 4E4SA 2QQMA 1CAVA 2EICA 4Y33A 4I02A 4LIVA 1JYNA 2HWD1 3P3PA 4K7JA 3LA7A 5ERLA 1W8TA 5EYYA 5GALA 4DY3A 2BVBA 1EAH3 3KVBA 1FMD1 4FPCA 3DGTA 4EZHA 1VPHA 3TNPB 2X53S 3CLPA 1I3HA 4JV4A 3NAPC 3UGFA 1ULCA 2R0HA 1ENXA 1VP6A 5T5LA 5FBZA 4DXZA 4CPBA 3EXUA 3VKOA 2RM21 4JHZA 5TSWA 4Z92B 4AFMA 2W39A 1N3QA 2E7AA 4CEYB 2YUEA 3ALQA 2C9KA 1GOGA 1R1A1 1XSRA 1IHMA 3AVRA 2VZ1A 1IS5A 3OGVA 3M1HA 5D8AA 5J1XA 1XYPA 1W9SA 4P9YA 1SLAA 4GH4B 4M4PA 4OHZA 4D7SA 5FLHA 1UYXA 4DXSA 5FP9A 4LBOA 1UOGA 4A45A 2JB8A 2VE1A 4XCAA 4LBJA 2VVDA 4OLLA 1ENSA 4C1XA 3MBWA 3ZSLA 2XMLA 3CIHA 3KD4A 3O1PA 4COUA 4NPLA 4HT1T 1MZEA 4HSJA 1MS0A 4Y22A 4YNIA 3K48A 3I59B 3AP6A 4XJWA 1WW6A 4R9CA 5A7WB 1XJAA 3RSJA 3WP6A 2A3YA 4YG3A 3ZYFA 4CXWA 3V64A 3MO4A 4YZ3A 2K46A 1C8M3 1IGOA 4PT6A 3S30A 1W3XA 5ANNA 1R081 2ARBA 4WV8A 1LESA 3LOIA 5DG2A 1H1AA 1OA2A 2ORZA 5FZEA 3ROUA 4XJ9A 5L9VA 4CDWA 1EV13 1HRV1 4XF1A 2WQ4A 3EBRA 2PHLA 3VD3A 4DUWA 5LY1A 2XHKA 2XQXA 3HQRA 4XZUG 3LEKA 1GBGA 1F35A 3HNYM 3TB0A 2ZKLA 1WA6X 1PZ7A 3JD73 5J96B 3AB0A 5LY2A 4WZFA 2AACA 4IEZA 5FLJA 2XUMA 3JXSA 3MDPA 1QOSA 1UX7A 2VCAA 4W50A 3LE0A 3GF6A 3P3NA 4CRQA 3D6EA 3JB4C 2FCUA 1G9FA 2WZR1 2EAKA 3RZGA 1VAVA 3U0ZA 3ORJA 5LZ6A 3TWIA 4Z1VA 4XILA 1LKNA 1PGW1 2WQ8A 2LM3A 1GZCA 1LGCA 4PDWC 4PBOA 4F3JA 4YZ2A 4XUNA 3NKGA 2B46X 5JSRA 4CP1A 3ACIA 2R1DA 4CSWA 3C7FA 1HN1A 4MX3A 4AF9A 2GC0A 2Y6HA 3NQHA 5JVVA 1AUYA 5J48A 1H6XA 1VBA1 3DUIA 5IK8A 4YVWC 4FOYA 4PQ9A 3LKJA 2W95A 3MUZ1 1AZDA 5EZWA 4BQ5A 5FYMA 2VC9A 2Z2SB 2XJPA 3CZJA 3ZFEA 2HH9A 2Q30A 3MW4A 5F37A 1PGL1 2YPDA 1UMIA 5DG1A 4M3CA 1CQ9A 2W9XA 4XPVA 2WA3A 3V0BB 1LOBA 3V0BA 3J7MA 3BTZA 2CTVA 4BZ4A 4N43B 3I54A 4KGGA 1EUTA 2XB6C 3SEPA 5EIYB 5FZDA 2BDRA 2XVGA 4HN0A 2R32A 1PO22 1JTZX 3A21A 2ET7A 3VLBB 5JDBA 2NYYA 2GC3A 1YJKA 2XHNA 2ZGQA 2A6ZA 1BEV3 2VUJA 5FXWA 2Q8DA 5LEKA 4LORA 2Q1ZB 4D94A 5F5AA 2E7TA 4HONA 1BBT3 2B8MA 2JDYA 2W52A 2GDFA 1VE0A 2DWRA 5A3OA 5AC93 4ASLA 3POGA 4GWIA 5C7GA 4LLOA 5AFEA 5IHRA 3H1WA 3H8RA 4LO6B 1PO21 4LMFA 3AYDA 1U12A 2Y33A 4IEVA 2IFWA 2HEYF 2ETEA 4XJZA 3VL8A 2GZWA 3WG2A 1FI2A 1GSLA 1JW6A 2RS32 1VRH3 3ZSEA 1HV1A 1RINA 4CDWC 2TNFA 4IQPA 4F8AA 2YV8A 1QU0A 3DYMA 5EP9A 4D7TA 2O0OA 1N1SA 2KM2A 3LIHA 4QHBA 4P9IA 3AMQA 2PQQA 2RHPA 4L2NA 1JZ7A 5BNPA 2OKXA 2X5IC 1FT9A 5ACA2 4JDNA 5FXXA 2IXLA 1KDKA 5KWRA 2CY6A 1BXHA 3THDA 1QGLA 4GWMA 3ZO0B 4EWDA 4XIKA 4LBLA 2Q0AA 2D44A 4FFGA 1UQXA 2BZDA 3WNNA 3H50A 3J8F3 2WDBA 4MZUA 3DPRB 3VDDB 1ND3C 3D82A 5FZ3A 1UYYA 1RC6A 4R9BA 3GBGA 5FOJB 4K8RB 3LA2A 1B35A 1RUF2 3WW2A 1AL21 1KQRA 1UY1A 2X05A 5CBLA 3ZFFA 2DU1A 4K3UA 4GZ9A 1ND3B 4XQDA 4RR3B 3E6CC 2MEV1 1VR3A 2BBAA 2JECA 4ATEA 1BEV2 2Y6JA 2ZMKA 2BW8A 1WD3A 2RR13 3VHRA 4AGRA 3VKNA 2FHRA 4I30A 4OZXA 4OQ8A 1GNYA 2VCCA 4CA9A 3M3CA 2HWD3 4MGQA 3H3UA 2EIEA 4IEQA 2Q8EA 4XBLA 1COV3 2LUWA 5EXOA 5FZAA 4ITCA 5IVBA 1CGPA 1UL9A 2WR9A 4YW7A 5KHIA 1G9CA 1VBE2 5ABJC 2QQLA 1H2MA 1HB3A 1K5MA 2HWE3 3R4SA 4QQLA 1MS5A 2R071 4XF3A 3U4XA 2XL7A 4Q0VA 1W39A 3J9SA 3MGUA 3WZ1A 3OBZA 1NE4A 2VQTA 2EIBA 1ULOA 4QKFA 3I2KA 3BU0A 1W2TA 1IKPA 3AK0A 3NNMA 4A44A 5EHDA 5G04L 2BGOA 2XGXA 2VNVA 4PDWA 3PUIA 2Q1MA 2Q8CA 5JMCA 3VDDA 5FPXA 4S2HA 1LOGA 2O8QA 5CB7A 5FMOL 2ZHMA 1PIV2 3CO2A 2OXBA 5JMOA 2PA7A 4I3GA 2RVAA 1NZIA 4YVWA 1FYUA 4M4RA 4QGLA 2PELA 3ZYHA 2WNUC 4RQPA 1CIWA 1RJ7A 1WLCA 2E33A 2XL9A 1H9WA 3VBHC 2FD8A 2EXIA 5FP7A 1GNHA 3GALA 3HIFA 2ES3A 5CFDB 1HQWA 2AH2A 4M01A 1IPSA 5APAA 3WW4A 4CEWC 5JPNB 1YQ8A 3BGAA 1J83A 2I74A 4HZFA 4XFGA 5FCCA 4N43C 1RHI3 1ZBA3 2VZOA 2WS93 5F5IA 3VHOA 4XMAA 5C33A 5KC6A 1POV3 1ZBE2 2DV9A 2Y26A 1F8VA 4PDWB 4IDZA 3WNMA 1G6NA 1WGPA 1N3PA 1FOD2 2QQNA 4WBBA 1L7QA 4JGYC 1K45A 4DXRA 2O1QA 3DPRC 3ENRA 2R6QA 4QX5A 1APNA 2BJSA 4QPIC 5IFTA 5IVJA 1QJU3 2J42A 1TMF3 1XU2A 4OYUA 5FZLA 3ACGA 3ZSJA 3SQOA 5IAVA 2AC1A 3HEIA 3MIBA 4K40A 1NZCA 4NMIA 3JQWA 5FPBA 1O5UA 1OOPC 5A32A 4OMDA 2WUHA 2ZGPA 4XACA 2JDAA 3IM0A 2VW1A 5IVYA 1H2NA 3T1MA 4CE8A 1FOD3 1GP5A 4DXTA 1UKGA 3N4MA 3WV6A 2ZJCA 4NRPA 5FPVA 5HV4A 4QPGA 2YY1A 1IZ3A 2VZRA 4YW5A 3V56A 3WF2A 5DDJ1 1EYBA 3Q8AA 4FPJA 3NVCA 1UW8A 1VRH1 1MVEA 3LF7A 4WM8C 1S2BA 2DCTA 4FO9A 1CPMA 1PO11 4MADA 1PO23 5JI7A 1HXS1 1YYNA 2GU9A 1LJ7A 2UWCA 3I3BA 4FPOB 4IL7A 5A7QA 5DDJ3 4RYDA 3ZKUA 5ABJB 1S0JA 2D93A 4RR3A 5DN2A 1PIV1 3ZYPA 1DGWA 1NLSA 2ZPXA 4XETA 4ZONA 5F3IA 3T08A 3T2QA 2D6PA 4YW1A 1ZZBA 3VHNA 4LXLA 1XPWA 1PK6B 2ZZQA 3B7MA 5T5JA 3BALA 1O3SA 1ULEA 1L7LA 5FMDA 4CP2A 1TG7A 1AYM2 3WDYA 1XRUA 5CNAA 4E2SA 4I3PA 1LAJA 5IK4A 1ZYBA 5GZGA 4PF1A 5J36A 1W2OA 3WSOA 5T5PA 4TZDA 2ZX3A 5EYXA 1ZX5A 1WD4A 4L11A 3RZJA 4B29A 5FY8A 4HBNA 4LBQB 4M00A 1VBE3 2O8OA 4LO8A 4YFZA 1RUG2 1CZSA 3ZPOA 4COZA 1NY72 1RUD1 1FNZA 2B42B 2ZEYA 3N7KA 4BYYA 3SITA 4CCLA 5F8PA 4QX7A 2YU1A 1UY0A 1YQCA 4DRRA 3MPPG 1GQHA 2NPIA 2J1EA 5IJRA 1BVVA 4DRVA 2BTVC 1VBD2 2VZTA 4LE3A 1DZQA 1NCQC 1W9FA 2D97A 1RUD3 4B1LA 3WXPA 1AL22 4XQ4A 1RUF1 5FKCA 5K9YA 1W99A 3BN6A 3ETPA 5I93A 2G19A 4IUGA 3KVAA 5HI0A 2OUJA 4BISA 4IGPA 2ZS6B 2PYTA 3VBUA 5CADA 4CYDA 2H0BA 2VW0A 1JOPA 3RI8A 1IS6A 2ZZJA 2YXSA 5IW0A 1PM4A 1CAXA 3RZKA 5C6CA 4GIQA 4TSVA 3TEWA 4LO4B 5LA2A 2WNVA 1O7FA 4D6RA 4N43A 2E32A 2PHXA 4L92A 1XE0A 2BUKA 2X8KA 1R093 4MGYE 4BK5A 2KR2A 3MW2A 4O9GA 1ST8A 2IUWA 3ZR5A 3R4UA 4IGOA 3FBYA 4QM9A 1O5LA 5KHKA 1UIKA 1WCQA 3KT1A 3LAGA 3FUQA 1NLRA 2RS33 4XUOA 4C0HA 5FO9B 2QVSB 1OH3A 2HWB1 4AW7A 1E5HA 4HK8A 4YW2A 1H30A 4Q5OA 4I0BA 5DUUA 5DUWA 5KHHA 4BOWA 4NIAA 3MIDA 4HETA 4KG0A 4QQOA 1JOJA 1Q5OA 1UNBA 3VBRB 3S6PA 1JYTA 2RG4A 4BJ0A 4AQ6A 4XHBA 1LR5A 2DCJA 1JZ5A 4D3WA 2WWJA 3N9NA 2XJSA 2RS53 3PLQA 4Q8LA 1VJ2A 3BVCA 5DXDA 2DVFA 2HWC2 3RI9A 5CFDC 3PU3A 4PIYA 4J1WA 1HRI1 2YBPA 1HLCA 2R49A 1E5IA 1W8UA 3PUQA 4WVVA 1JZ3A 1XNAA 3I2HA 3QCWA 1PK6A 5JXHA 4AXOA 3NSTA 2CNAA 1SDDB 2PHRA 2D6MA 4ZU7A 1LGBA 1IS3A 4HKLA 1OA3A 4R8HA 1LTEA 5LBCA 4OCTA 4QX8A 4OHVA 3MV11 1VRH2 4I09A 4FBFA 3LOBA 4E8CA 4LKEA 3PIJA 3AX4A 4MOAA 1GQPA 4NN0A 4A7ZA 4Q0SA 4DIQA 2OPKA 5IVVA 1K5MC 2UU8A 4PIZA 1HJGA 1C4RA 2WO7A 2ZGRA 3JCIA 3OD0A 1O3TA 4ZY9A 2FDHA 3JUUA 1YI7A 4H7LA 5H9PA 3THCA 1ZZ6A 4OULA 4P9XA 1JYVA 5LCWL 1DU3D 4YM2A 4DMIA 3HJRA 5A70A 4YZ4A 3N9OA 5FYVA 4AR2A 4MGTA 3I59A 3PTRB 4AVTA 4LQRA 1VBD1 4GWNA 5F9TA 2A7AA 4EN8B 3IDBB 4BH9A 4ES9A 5GZFA 2R042 4FPLA 4WZCA 3SKVA 4DY5A 1VMHA 4H3WA 4W8JA 4XF9A 1OVSA 3ST7A 1ZRRA 1H9PA 4YVSC 3EMRA 2DCKA 4ZS2A 1X7NA 3I2JA 1SFYA 3UGHA 4E4DX 1NCRB 4P5YA 4AHXA 1LHWA 3VBOA 5A3TA 1YXWA 2XXZA 1G7YA 3SH5A 4R9DA 3VBRC 5ANQA 3N7MA 2ADEA 3K3NA 1CAWA 1DBNA 2VZQA 4MSVA 1H8TC 4QPYA 5FYTA 1EV12 5LBFA 5A3UA 5IYYA 2QCSB 1DQ6A 2ZAAA 4O65A 5IK5A 3USSA 1FATA 4N53A 4ORFA 2JG9C 3RWKX 1OT5A 4HVRA 1UWWA 5H9RA 1PK6C 2H0VA 2YYOA 4TLGA 3KGLA 3SCFA 2ZGSA 4MHUA 1LGNA 2NMOA 3H7YA 4NVPA 4QQPA 4XDQA 3ZXLA 4D8MA 2R7EB 2JG9B 4EE2A 2HWF3 4ASMB 2FDKA 2WIIB 3J4UH 2WWUA 1OURA 2RR11 1LOFC 4HN1A 4QXHA 2CSGA 2CAUA 5FYCA 4QHZA 1TQ5A 4JGZB 3LCPA 3SMHA 1V6MA 3BCWA 5LWBA 1YWKA 1MVQA 1ZZ7A 2R063 1CJPA 1V00A 3IMNA 3IWZA 4CCDA 1NA1B 4Y1ZA 2A3XA 2HWE2 3MI8A 4PIXA 1W8FA 2BBVA 2BU9A 2J1UA 3OPWA 3ZFGB 1Y4WA 2NMNA 1CONA 3N7JA 1ZREA 2P3JA 1HV0A 4LBKA 1KXGA 5AFBA 2QQPA 3JD71 3HT2A 3ZXFA 4ZZ5A 3OUIA 3D4KA 5GZEA 1W2NA 4EN6B 1UZVA 3OD4A 3PNAA 5FRAA 1W03A 1OOPA 1W0PA 3H1YA 3INAA 3KV6A 4UYBA 5JLVA 5FFOC 1UZZA 3KV9A 2R041 3VUOA 2VY0A 2OX0A 5GZDA 3W9AA 3WDXA 3M3QA 4LOTA 4Z2AA 2QQVA 1YI9A 2HWB3 4K6BA 4EN0A 4AQ2A 1GICA 3GCWA 2BQPA 4BQYA 4C8DA 4FFHA 4EYUA 5JXJA 1TMF2 1DQ1A 3PUHA 4UFJA 4WM8A 3Q9OA 4OI1A 2DVDA 4R4XA 4B7EA 1SMVA 4X6RB 3KCXA 1X50A 3AL6A 3W58A 1JU4A 2W1UA 3JBG2 4B8EA 2UY8A 1RUE2 4GKXA 3O5SA 5EJZB 1U5ZA 2CDOA 1V9U2 1FPN2 2ZGMA 4RD7A 4W6XA 2LTNA 4AFBA 3PURA 2AZ5A 4C1WA 2BWAA 3OOXA 2XJUA 4IV3A 4Q1PA 3VV1A 5FZ6A 1AR72 3QBQA 3AP5A 3NWKA 5FUIA 5HBAA 3B9IA 1RUJ1 2Y34A 5A6QA 3O1OA 1V6OA 1JZ2A 3N3HA 4QM8A 1MPXA 3ZXKA 4TN7A 4HPKA 3AYCA 3ECQA 5DAWA 5DZGA 4YG6A 3RVHA 3FC0A 1F15A 2GSYA 2AEZA 2OQ6A 1BBT2 4FP3A 2Q1FA 3E1F1 1ASJ2 3ZN4A 1S0EA 4AOCA 1GOHA 4J25A 3IPVB 4E8DA 1S0IA 2X09A 4ZS3A 4CCOA 2EF6A 2G4IA 5BNNA 5HXVA 4XTPA 3WDTA 2W5FA 4YM0A 1Z78A 1VBE1 4NIDA 1AYM3 4IEOA 5BNOB 3POSA 3D0JA 3PVOA 1RUNA 3ES4A 4PQQA 2Z5WA 1JZ4A 1ULFA 2ZX2A 1CZTA 3HWJA 4BPZA 5JCTA 2JIGA 1ZRDA 3LDRA 3N36A 3VZKA 3ITQA 1QEXA 1DZRA 3B69A 4UFHA 4LUKA 4NHXA 2B5HA 1HQLA 2VULA 4A7YA 2MEV2 3OEBA 1XBFA 4IV1C 4PF5A 4I0WB 3ZYJB 4AZZA 4FTEA 1AYN2 3SXWA 4ISQA 2DBIA 3WQ1A 5CG8A 2XG3A 3A7QA 3NW4A 4HXCA 1NCRC 1R64A 5E1RA 1YFXA 2FDJA 3I8TA 3RRDA 2W46A 5JXIA 2NQYA 3K4ZA 1W6OA 1H1MA 4CUBA 5A6XA 3E5UA 4HFSA 4CU7A 5LA0A 2UY9A 4WVZA 3BTYA 1AYN1 1TME3 2YDEA 1ZZ8A 4OUEA 1COV1 1SQ4A 2V4AA 2W1QA 3BOPA 1RL3A 3CJIB 4MGIE 3ZDSA 1W04A 3MUY1 2QQJA 5LBBA 2GH8A 5C8CB 1RUC1 1XOYA 2ZBJA 1Q8VA 4LHSA 4MHRA 3LPFA 3K75B 3POYA 1YUDA 2XQRA 4Y4YA 4SBVA 2D43A 5JXGA 2VMIA 5AVPA 1DQ0A 3HBKA 4AVSA 3GYDA 3RJ2X 5BNNC 3DEMA 1OI6A 4Q4V2 4GB33 5FQ0A 3WDWA 1A34A 3J8F1 1SLCA 3BPZA 5HCBA 5F1RA 5I8TA 3AZZA 3ZYRA 4ET7A 1GANA 5JZGC 3BTXA 3V65A 3I2DA 3AMPA 2RS51 4P9GA 3OUHA 4B4PA 3CNAA 1JH5A 4JVAA 1AR73 4QMAA 4YW6A 5DMYA 4XF4A 4A6SA 1OFNA 4KMQA 5FDBA 5D21A 4NRMA 4B3NA 1WWYA 2VMDA 3R6SA 3W21A 1SLIA 4CEYC 5K0UA 1RHI1 1ZBA1 2WS91 3HT1A 2YPJA 5I8SA 4R4ZA 3WQBA 1UYZA 1QJY3 5FP4A 5BXXA 2KXLA 3ZN5A 3ZFFC 4Y3OA 2RS52 4CP9B 1EPZA 1GOFA 5BNOA 4L0PA 5BV6A 3AMNA 2YGMA 4YFWA 3WF1A 1OKOA 2A5ZA 3WF3A 4GB32 4QGMA 4CDWB 2W0XA 1HB1A 2WNOA 1T6BX 3J7HA 5F32A 2D6LX 4XUQA 5FY4A 3UETA 4IEUA 4P00B 4D0QA 4QDQA 1HIXA 4Q4Y3 5DZFA 3ZMOA 3HMYA 3WLUA 5C9AC 2OIIA 4UFIA 3TEZA 2XPJA 4UBGA 3S5QA 5E89A 3TNQA 3O0WA 3THTA 3S0MA 2OW4A 3A0NA 4Y1UA 2X5IB 1OBNA 2X5IA 2EXJA 4FQZA 1J3QA 3DXTA 1DQ5A 1ODMA 2BFUL 2RJLA 2V73A 5JIAA 1BK0A 3N9QA 5C3OA 4LBQA 5DAQA 2K9ZA 2NN8A 2ZMNA 2A6VA 1GZTA 1FPN1 1F5JA 3VHPA 2WL1A 3WDUA 3AJYA 3P6BA 1G9DA 5JUVA 2AUYA 2OUHA 3POFA 3U75A 2RV9A 2DFCA 4C90A 2SBAA 4Q4Y2 2EALA 4GH4A 5JR2A 2QTWB 2QQKA 2ARCA 2BPA2 1CR7A 1SCRA 3MYXA 3T30A 4Z82A 5JAXA 5JOXA 4AAXA 1XXNA 1A78A 2JDKA 1A8DA 1GYKA 1GQGA 5K0UC 3FN9A 1C57A 2D3RA 2YC0A 4DFSA 1C5IA 3M70A 4QKDA 1OF4A 3WHUA 4E4ZA 5FWJA 2E7QA 3ACLA 1OC1A 3ZYIB 3SNMA 4UFMA 1NX9A 2VZSA 4TYSA 1AJOA 4RHV2 2J7MA 3PIGA 3ZXAC 1QJU2 2P5BA 3LSDA 3ZN6B 1A6CA 1MEC1 3IDCB 5BNQA 1RXGA 5A7OA 2MPFA 3WNOA 1WLWA 1TME2 3LIGA 5F6KA 1CN1A 3T0DA 1VMJA 3I49A 2P6CA 4IETA 1ASJ1 2LROA 1O4ZA 1D4VB 2VM9A 1UU6A 1YJLA 2PTMA 1LULA 1DYOA 5A3WA 3A4UA 5FV3A 5CAZA 4FPGA 4AI3A 2RMU3 2UYBA 5LK7B 1O6UA 2RE9A 3IT8A 3KCYA 5FJHA 4EN7B 1EV11 1HRV3 5JWPA 1WBFA 1HXS3 3T4VA 2RDSA 2GMEA 5J37A 3R0RA 1BLZA 3RZZA 3UKTA 1W3VA 3ZYBA 2MNGA 4A6OA 3VD5A 1LCLA 5SV5A 2XWJB 1AF9A 3F95A 2WC2A 1AR81 1QY4A 5HCFA 2JE7A 2ATFA 4BCUA 5DQ0A 4KL1A 2JG8A 4DOUA 2CAVA 4Q4W2 3TBDA 3DL3A 5FZ4A 4FXGB 5FMCA 3ZFEC 2E6VA 3D0SA 4QU1A 2GC2A 2RDQA 3C7GA 1DQ4A 2YC2A 4OHYA 1AX1A 2I07B 1DLLA 4IE0A 4LK6A 2JD9A 2JIJA 3UL2A 2J22A 4LUMA 2IC1A 3O1UA 1WW7A 3SH4A 3AZYA 2W47A 5FYYA 5IWFA 2WBKA 5SV8A 4BQ3A 5IFPA 3O1VA 1R1A3 3CMGA 4NAMA 3MHZA 1Q43A 2R0FA 3DECA 1US2A 1RUI2 4GD4A 2VG9A 1JYWA 2R1BA 4XF0A 1H6YA 2ERFA 2XKOA 3ES1A 1QOTA 2VNRA 1XNKA 1V6KA 3JB8A 4KWKA 3DF0A 3L2HA 4XBQA 5E6HA 4FTSA 2GMMA 5FY5A 4CDQA 3TEXA 1QJX3 1OD3A 1MS4A 3HN1A 4XVHA 1JYCA 2QQOA 5T52A 1OPMA 4ISRA 1EAH1 1W90A 4AG4A 1QJX1 4X6QB 3VZNA 4ARXA 1ZA7A 1RB8G 4CPBD 3ZXJA 1QXJA 1UOJA 2A75A 2ZTNA 4FVVA 2UWAA 3B5LB 4WVMB 1OMIA 4AI9A 3AKQA 3VDDC 3WP5A 2FZ1A 2WLQA 5FPUA 1H1IA 2D3PA 4E2QA 2A70A 3NV4A 2H6BA 2XBO1 3ZXEA 1Q8QA 4NWWA 1S0FA 3I3MA 5JSPA 2V09A 2FDGA 1PM7A 2TEPA 1W9WA 4FAHA 3WEZA 4N7IA 4W6WA 5AC92 2DVBA 4QB1A 1CAUB 3EO6A 3GZUC 2B7YA 5CKNA 5FK7A 4KH9A 4QX2A 4H2AA 3AXEA 3FZ3A 4AEJA 3ZSKA 3AKSA 4HVQA 4QDSA 3OBAA 3B3QE 3GZTB 3H3LA 4N90A 4QAWA 1QNWA 2JDMA 2KD7A 5FYZA 1NXD1 2E31A 2WNEA 2Q4SA 2WSVA 2PFWA 2C26A 1RUH2 1MS8A 2PMWB 1LHNA 2WSUA 3GM8A 3OGGA 3POBA 1W05A 4GMP3 3JBG3 1NYWA 1QJY1 3MLKA 2BOJA 4XBNA 4B1MA 2WJSA 2RS11 2W92A 4RSUA 1V9U3 4UFLA 5FZKA 5HCAA 1ACCA 3GBFA 4FCAA 2Q5TA 2ADDA 2A1XA 1OLQA 4OUSA 4GMP0 1OQ1A 5FREA 4BB3A 4PLMA 1S0BA 2CWMA 2WRAA 3OJBA 1S2KA 4FOWA 2JKBA 1UO9A 3OPZA 5G05L 3I7DA 1JN2P 4OI2A 2YFZA 4IE4A 2VBPA 3BTAA 4A3XA 2GC1A 3WQ7A 3KT7A 1WMFA 4W6YA 4H7MA 5J7MA 4CP9A 4CU6A 3PVEA 4RS5A 4D6SA 3BUCA 2VTXA 4PLOA 1X9PA 4QPGC 4CCNA 5I0DA 1DCSA 5LRRA 2BNNA 4UOJA 3ZFGA 3S5AA 5CG9A 5FYHA 5KXCA 4A2UA 1IOAA 4BXSV 1X8MA 1XYNA 1D0GA 1KGYA 2P34A 4I0AA 1PNGA 4URTA 3T3YA 1QHDA 2DTWA 1VMFA 2PHFA 4TWTA 3VKLA 4AQSA 5B4NA 4M3CB 3OB8A 4META 1O3RA 4MV2A 4NE9A 5JZGA 1MQTC 1LRHA 2BP6A 1C1FA 5FPAA 2RDRA 4FQ4A 4ZU5A 3ZFEB 3ZN6A 1NLQA 2OA2A 4NHYA 4AYUA 3WQ0A 2VMHA 4DB5A 4IERA 3UT0A 4QXBA 5J09A 3THPA 2ZCWA 1ZRCA 4Y5TA 1GNZA 1RIRA 1WCKA 3H42B 1ZVFA 1FNYA 2OZJA 2VTXJ 3KLSA 4LOSA 3DV8A 4BMEA 3HVDA 3MPBA 4QX1A 2HWF2 2K2SA 1TE1B 2WO2A 4XJ8A 3WW1A 4IW3A 1B35B 2HEWF 5FZ1A 2ORXA 5JOWA 1EPWA 3ZXDA 1HB2A 1ALYA 1PVC3 2CGOA 4HANA 1GFF2 1GKBA 3N7LA 4YGDA 3K46A 2WFF3 1CPNA 2YC4A 3UV9A 5FO8B 1PMJX 4QX0A 2VW2A 1QJZA 1RXFA 4ZXKA 2IXCA 4QGNA 1D2SA 1W6OB 2EA7A 2JDHA 3A22A 3N35A 3AJZA 1TVGA 4Q4V3 4XMIA 1IQAA 1E57A 5IVEA 1JYIA 1LODA 4UFKA 4BU2A 5BPXA 3FLPA 4LHLA 4PLNA 3URFA 5BUVA 5E16A 1GZWB 1BQPA 4LBMA 2TBVA 2B4KA 2OZ6A 1YFUA 4OZOA 4N9IA 4YW4A 2RDNA 2Y60A 3IAQA 4OHWA 4Q2FA 4XDPA 1GLHA 3ZPYA 4D7YA 3M2MA 3BIWE 4EWEA 3U11A 3VBUC 1R092 2WZR2 1AR71 3ELNA 3IIIA 5I91A 2BVVA 5FZOB 2WO1A 1BKZA 4BQWA 3PUAA 4QQHA 1XYOA 1JOBA 1RUE3 1WW4A 1VAMA 1XQNA 1VBB2 2HBTA 2QBXA 1NXMA 4JQTA 1W0OA 2QQWA 4LR4A 4HSLA 4A7KA 1NKGA 2Y6GA 4JDOA 3IMMA 2PQSA 4LA3A 1BVP1 4Y22B 4CTEA 4BLIA 3VBSC 5IATA 1YNAA 5FZIA 2ZOEB 1W8ZA 4FI9A 1AR62 1W6QB 5FZOA 2JE8A 2EXKA 1UZWA 2ZGTA 1F9KA 1US3A 2RM22 3ETQA 2FDFA 2F6BA 3VB9A 4DEVA 4A42A 1X8EA 1UZ0A 1PZ9A 4UW6A 4DINB 4Y5SA 2D3SA 1YCIA 3DCQA 2TUNA 4LULA 4XW3A 1VB4A 3M4FA 5I0RA 1RUC3 2CDPA 2UYAA 5L9RA 4BE3A 1SFPA 4JZRA 5LA1A 1SLBA 4UAPA 1J59A 2HWC1 1QJX2 2QQIA 5FPZA 1V6LA 1BHGA 4YM3A 3OGJA 5LEJA 2E26A 5F39A 3HAGA 4XAEA 4Y1YA 1G86A 4E9KA 1X82A 1AXZA 4IV3B 3K2OA 4XFCA 4LBQD 4HKOA 3PVNA 3ZIWA 2IXIA 5CISA 5JSOA 2AYHA 3U4SA 1ULPA 4G3YC 3X29B 3WNKA 3GDBA 1SBDA 3POIA 3UGGA 2D6KA 3GZEA 4PI0A 2C6SA 4RGKA 3AZVA 1BBT1 2OVUA 2VAUA 3MIGA 4BMBA 1W9TA 1W8OA 1S0GA 5FBJA 1Y3TA 4DQAA 1Q8SA 4NHMA 1GWLA 5DAPA 2FMYA 1LHUA 4E27A 4N53C 1BK1A 3MIEA 1G9AA 5C3QA 3TN93 1F4HA 4IEXA 4P02B 4UW4A 1O8SA 1OF3A 2RR12 2WFPA 4EWAA 3VBOC 1SCSA 3TN92 3FFZA 1LU2A 4OQ9A 3UKVA 1MZ6A 3FL7A 3MF9A 2Z4FA 5FAXA 4YGBA 4ZXEA 3CBNA 1O4TA 5FXZA 4EQVA 2WT0A 1RUE1 1NAEA 4PHZA 1CJDA 3OCPA 1UXXX 4H55A 3JU9A 1B35C 1QJEA 4AI2A 2W87A 4U36A 3ME2A 4BIFA 1OH4A 3D5OA 4L97A 1QDCA 4AHWA 3MZHA 3D3AA 5FZBA 1IPJA 5I0SA 1WMXA 5CVRA 2ZABA 1PGW2 4WM7A 3IDEA 4Q26A 3AP9A 3VKMA 4BQ1A 2DVGA 3AZXA 5F2SA 3WP3A 4AVVA 1AL0G 4XIOA 5FZ9A 5A6ZA 2J1TA 3RG0A 5K7PA 3HD8B 4XQWA 3KHBA 4JX0A 2ZGUA 3WY6A 3O12A 2LALA 3U78A 2XJRA 3KWVA 4LE4A 1LOEA 1RUC2 2A6WA 1H8VA 2VCBA 5A7NA 4FFIA 5HXMA 1KDMA 2WYSA 4AFDA 1U5IA 4AE2A 2L9LA 4Q4X1 4NIIA 3WP4A 3LDKA 5LATA 5J3UA 5DZEA 2XWBB 4NIHA 3A23A 4V2WA 5DUVA 1Y43B 2YBKA 2ZKNA 3W20A 3WUCA 1YO8A 3KF3A 3ZMNA 1AHSA 3RS6A 2DVAA 4Y24A 3POEA 1AXYA 5LRSA 1ZBE3 1C8NA 2VMEA 3ZM8A 4N9HA 2BNMA 4AEDB 3O14A 2VOWA 4MXVA 3VD9A 1URXA 1I1EA 4YZ1A 2Y0OA 4AAPA 4IGQA 1SLLA 5KHGA 1YIFA 4HOOA 4YARA 1VBB3 2AREA 4YLZA 2W1WA 4Q27A 2RMU1 5FY0A 3MW3A 2DBNA 4JGYB 1AR82 1SPPB 3J7LA 2R043 2XJQA 2HWC3 2ZEZA 4QQ2A 1CX4A 1ND3A 3JD72 5KXDA 5FUPA 4A3ZA 1PX4A 4L9BA 3VD4A 3UNPA 2F4PA 1O91A 1DP0A 3S7EA 2ILMA 2GN7A 5K8SA 4XEZA 2PHUA 3PUSA 2PAEA 3NKTA 4WM8B 2WABA 4CP0A 2KA3A 1UMHA 5F5QA 3KZ4C 2B9VA 3LZZA 4RGGA 1J1TA 2C5DA 3LPGA 3M3IA 5FKBA 2PN5A 2GAUA 2GH2A 2WNUA 4CUCA 3IB3A 1ULDA 3F2ZA 2LRPA 1LENA 2UWBA 2ZX0A 5A7PA 1SFNA 4LEJA 1QJU1 3HNMA 2VQAA 1H0BA 3ILNA 5I0UA 2GNBA 4ZKTB 2E53A 1UIJA 1IPKA 1G9BA 1ZA4A 4LPLA 2VTFA 5FOBB 2HWD2 3PDQA 3IAPA 1G8WA 2HWF1 3VBSB 1DHKB 2X10A 1V9U1 4X8PA 3RWNA 4NHLA 3ASIA 4S2DA 1EUUA 2XDVA 1GR3A 1W8WA 2I2SA 5DAVA 1SACA 3TYJA 1ZRFA 4GMP1 3RZMA 2BV4A 2ENRA 4BQ2A 2OYZA 5FPLA 2EVXA 3UKNA 2JEMA 3MICA 4MGKE 3C7HA 2PHWA 1WMEA 2W2IA 3AMMA 4IV3C 1REFA 4QX3A 4M3CE 3KV5A 5FXVA 4BHPA 4LT5A 3B9CA 1GUIA 1LOFA 5AC91 1UPSA 4AVAA
chains in the Genus database with same CATH topology
4PBPA 1NOVA 2CV6A 4FOQA 4M0NA 1DGLA 3NJZA 2DFBA 4HKWA 1REEA 1W6NB 3H8UA 5IT6A 4XFIA 1JUHA 3ILRA 1UX6A 4JRLA 3SCHA 1S0DA 1WLDA 4FXKB 3GBWA 4YGCA 4DZGA 1MS3A 3D8CA 4GQ7A 2XBO3 3UJQA 1ZNPA 1I9RA 2C1FA 5T5OA 3NV2A 2P2KA 2QZ2A 3V0AB 1N1TA 1W6NA 2C9AA 1VB2A 5T50A 5CFCA 4JGZC 3UJOA 1T6GC 1PZ8A 5FTTC 4XJAA 3RMXA 4Q4W3 1WCDJ 4ZU4A 2FQPA 1QQP1 2G9FA 2EIGA 2ZACA 2VVFA 4CDXB 2BGCA 4IESA 1HX6A 1YIPA 4QXKA 3AM2A 1PMIA 1NQDA 3PMSA 4TLFA 4UBHA 3WNXA 5EWSA 2VVEA 4CDXC 3TN91 1RUI3 2B39A 1CAXB 1QQP2 1UN1A 2D5FA 4CZSA 1MS1A 1NCQB 3B94A 1PO12 1W6PB 1RUOA 4M3CF 2BEOA 2QKDA 1U0AA 4HK9A 4OUMA 4LO5B 3CU7A 2JXAA 5K0UB 3APBA 3W59A 1NE6A 4XHXA 1S55A 1DIWA 3VBFA 4GA9A 2XBO2 4CDUA 1PO13 3BODA 2YMZA 1PVC2 1R083 2WZPP 4B4RA 1DGRA 3LWCA 3HBZA 1DFQA 3MLLA 1A3KA 4FPFA 3WVJA 2QUOA 4GALA 2I45A 4XFFA 4N7UA 3MFCA 1DYPA 1L3JA 1MS9A 1O3QA 4ONUA 3USUA 3L2YA 4KU7A 3M8LA 3EQEA 5L7OB 2VXRA 1AYM1 1AXKA 2JD4A 4P9LA 3SH3A 4QPGB 1TMF1 3OTFA 1ZM1A 3FWEA 4RHV3 2D40A 1OHFA 3FMGA 4Q4W1 3B01A 1BZWA 3EJKA 4RA0A 5C4WA 3RNSA 1ND2A 1D4M1 1D4M3 3AMHA 4P9WA 4QT6A 1AX2A 3QH7A 2IXKA 1QDOA 2YZ4A 1XE8A 3A0KA 3MFAA 1RVF1 1BCXA 4MUVA 1N1VA 1HDKA 2ZHNA 4COWA 4AGVA 3PMEA 2BYVE 2D7FA 3LA3A 2XVKA 1V6IA 3O0XA 4YVSB 2P17A 3IN9A 2GN3A 5A32B 1VALA 4KNCA 5EJ3A 1HW5A 4UXAA 5CU1A 3QOPA 1REDA 1DGRN 4SLIA 3OYWA 4V1PA 3IKWA 2NLRA 3E5QA 4Y20B 1JHNA 4COVA 4J6GA 4AK3A 4B4QA 1AR83 4KQ7A 3QLQA 4JGZA 5BNNB 3OY8A 2JG8B 3NO8A 2R073 4IXLA 1ND2B 3AKTA 4OFGA 1FXZA 2ZGKA 1FV3A 1Z7S1 3I4IA 3LGRA 2WT2A 3L9JT 3PJYA 1BYHA 2WINB 1MZFA 2ZX1A 2HJIA 2JJ6A 1KRIA 5C4WC 3MF6A 4YVSA 4LNVA 1UCXA 1JUIA 4FPHA 4AHYA 1EY2A 3RDIA 5C4WB 3E5XA 1W6MA 3WINE 4JTOA 2ZGLA 1J58A 1KITA 1PNFA 3G6JB 1TNFA 4CDQC 1AR92 3VBFC 1OQEA 3TOJA 5B2GB 3E97A 1HRI2 2VECA 1JBCA 4FOVA 3USUB 4MVTA 2YGLA 1UF2C 1R1A2 3VZLA 3ZVXA 3VKFC 1VLNA 2ZGOA 1F2NA 5H9SA 2QDRA 2GALA 1Z7S3 1IKQA 1VBB1 4Q0PA 1AYN3 3CL1A 3PVBB 4CDQB 4FPYA 2B9UA 2IZWA 1QJY2 2W68A 4YSFA 3GNEA 4MXWA 1S1AA 5D1IA 1UAIA 2XLFA 4CEWB 3PTYA 5A3LA 5I0TA 5A3MA 2WFF1 1CESA 4IEWA 3WCSA 4RL7A 3C2UA 4LHNA 3PHMA 1OSGA 1H4GA 2IWGB 4Q4Y1 1D2QA 1RMU2 2ZX4A 1Z7S2 3AP4A 4NR1A 4UW3A 4MH0E 2WT1A 3J8F2 1KJRA 4FTBA 1C28A 3NAPA 1I5ZA 4F83A 5H9QA 4H14A 3KGZA 4L99A 2SLIA 1M4WA 2Q8OA 3WW3A 3KCCA 4YRDA 5ACA3 5CA6A 1DYKA 4NWVA 3VN4A 2Z79A 4OHXA 1HQNA 3CJXA 5BYNA 1EP0A 5CFCC 5JOYA 5CIRA 4YYOA 3ZX7A 2R16A 4R9AA 1V6JA 4XTMA 4FSJA 1CD3G 4IEPA 1K5MB 2GNMA 1RUJ3 4KU8A 4LA2A 5JI9A 2K0GA 2WNVB 4Y26A 4GB31 1YFYA 4EJRA 2VOXA 3WR0A 1HRI3 2EAAA 1FV2A 2ZHLA 4XFHA 4P14A 3H1MA 1RVF2 2X29A 2AGSA 3C3VA 4OI0A 2CGPA 3ZFGC 5GLVA 2N7GA 2D6NA 4XJUA 4K1YA 5E88A 4E2GA 3WDVA 1UU4A 5IK7A 1OFSA 5L36A 1OA4A 1CAWB 1C5HA 1PGL2 1PGSA 2IFRA 3VBOB 5JZGB 5L7OC 2VUAA 3DN7A 4I01A 5T55A 2P3KA 1KFXL 4WVWA 3NV1A 3HQXA 5KXEA 4RGAA 1QOOA 1V70A 1ASJ3 1W2UA 1Z0HA 4ES8A 3FJSA 4GULA 5F6LB 3VGIA 4Q8KA 1VIWB 4EV0A 5BY5A 1DZTA 1MEC3 2QJVA 4AEDC 1SDWA 1ENRA 2GNTA 3U10A 3SLIA 1FMD2 4HMZA 3AKRA 4AEMA 3CJIC 3VBSA 1WMDA 1WA4A 3M3OA 2RM23 2R061 2Y38A 1QNYA 1RVF3 2XH6A 1LOCA 2G9GA 2JG9A 2HEVF 1LHVA 5J98B 4QU2A 4RR3C 1C1LA 1LEMA 1VBA3 1ZZ9A 5AVAA 1UD1A 3UK9A 2R062 1RITA 2QE3A 5BNOC 1POV1 5ACA1 1X36A 2UURA 1AR91 1XU1A 1F31A 1QKQA 3FHIB 4O9EA 4CEWA 5I8YA 1C3HA 4AWDA 2QFEA 2ZHKA 4IV1A 4CEYA 4KWJA 1ONAA 5GLUA 5L19A 1N47A 1MACA 4JDMA 1NG0A 5FMOS 4FAGA 1NY71 1RUD2 2ZAHA 3ATGA 4D69A 1YHFA 1RUG1 2VH9A 4NPRA 1OQDA 4U2AA 4MYEA 2VNOA 5GLZA 3IPVA 3H7JA 1YRZA 4YW3A 2JE9A 2BNOA 4Q1RA 1LEDA 3T1LA 5GM0A 1XNDA 4RS5C 3E6BA 4HPKB 1GV9A 2A3WA 1YLLA 3QACA 1QWRA 4AI8A 4AEDA 4F7ZA 4FP2A 3WT3A 5KXBA 2HWE1 1OKQA 1PHMA 2A6XA 1LOAA 1QH6A 1UPIA 4JGYA 1MR5A 1C8M1 4NOTA 4RFT0 2PLV2 4YGEA 1EAH2 5C9AA 1JXNA 1DG6A 2DUQA 4RQPB 2XLGA 2AR6A 4XXAA 5BNPB 3KQRA 4EROA 1J1LA 4LO7A 5DDJ2 3PJQA 1TEIA 4Y20A 5E8AA 3RYPA 1RUI1 1DF0A 1M06G 3VBHA 5A33B 1SBEA 5A33A 3VBHB 1X33A 1V6NA 3GHNA 4COYA 3QD6A 1LHOA 2WWSA 2C0ZA 5GKAC 4Z8BA 5EV7A 2D98A 3WX5A 4MLOA 4LBNA 5C8CC 1AJKA 1J3RA 5GLWA 1QQP3 2BWCA 5ABJA 3GHMA 4Q4X2 3J26N 4YVWB 4XYXA 3RMYA 2E9QA 4GXLA 4XE9A 5JPMB 1D4M2 1FMD3 1OD5A 1QXPA 2JX9A 3OYWB 1KS5A 3GZAA 2W08A 4PCRA 2V5YA 3FFQA 4B7KA 4QPIB 2E63A 4WM7B 5T3NA 4R52A 5JR7B 3JBG1 1LB2A 2VOKA 4OVEA 3JZVA 4BWOA 2RS31 4WM7C 1AR61 4BA6A 1HRV2 2HKXA 1ZBE1 4CDXA 2P37A 3RQ0A 3FUOA 1KFUL 1Y9QA 1WLTA 4FPEA 3EHKA 1D0HA 5FLIA 1KS4A 2JICA 3KM5A 4MGZE 2ZA9A 3S7IA 2WA4A 3H0OA 2MHFA 1N1YA 1U5XA 4IV1B 3WOGA 1VBD3 1R082 4UW5A 1TNRA 5L73A 1F5FA 4GH4C 4P5HA 2R30A 1NA1C 2WNVC 2VNGA 1RUF3 4Y1VA 1XNBA 2DUOA 3O7OA 4K1ZA 1VBC1 2DUPA 1QF3A 2WKKA 4FT8A 4Q0QA 3VBFB 4AFAA 2QDNA 3LSEA 4BM8A 4GKYA 2DF7A 3CF6E 4IEYA 2WQZC 4RHV1 1ZZCA 3MIHA 3KT4A 1NCQA 2CWSA 3OBTA 4Y1XA 2HWB2 1DQ2A 1RUH1 2WZR3 3KSCA 1ENQA 5LK5A 4I2OA 3RYRA 4CDUB 4ATFA 2DU0A 3HR9A 1GZWA 4JC1A 1YFWA 5D8AC 5DUXA 3M7AA 3B02A 4Y5Z0 1OLRA 1POV0 2A71A 1U5YA 4HLTA 4XFAA 4AQTA 3SCGA 1DGWX 2RS13 1RMU3 2P3IA 4HVOA 1XNCA 3AYAA 3AKPA 3M3EA 5FQ0B 5KC5A 2E51A 2QZ3A 2WNUB 1H8TB 2GNDA 5D8AB 2PHDA 4K8FA 4DS0A 3LB9A 3ZYGA 4S2GA 4KWLA 4K21A 1I6XA 3ZFFB 4FPKA 2YROA 5T54A 1R091 2GMPA 1WUVA 2NM1A 5L7OA 1N3OA 5C8CA 1FX5A 4DNYA 3DPRA 2CL2A 4QPIA 2IXHA 4JCKA 1RUG3 1RGSA 2CGNA 3OBRA 4JQRA 3AP7A 5CFCB 4LTAA 2D5HA 2RS12 4L8QA 4OI4A 4K9SA 1RJ8A 3NAPB 2DTYA 1H2LA 4BIOA 2VQ0A 4YZ5A 1ULGA 1AR93 4W65A 5JOZA 1RHI2 1ZBA2 2WS92 2ARXA 3CJIA 3BU7A 2WFF2 3MEPA 3SHRA 3DKWA 1H2KA 4C91A 1OPOA 3MIFA 2WLPA 2Y0IA 3OF1A 1H8TA 1VAKA 4G9SB 4YM1A 3ILFA 3SISA 3VZJA 3WD5A 4KBBA 5CFDA 1W6QA 3TAYA 2A73B 1MQTA 1FPN3 3AFKA 4K20A 4LLFA 4AVBA 4JRAA 1W6PA 3WG3A 1VBA2 5GZCA 3AXDA 3BB6A 2HYKA 4Q4V1 5KBFA 1ND2C 1RTVA 1UMZA 3NL1A 4S2FA 3RJRA 4KGQA 4Z2WA 3VZOA 2CYFA 3H3ZA 3ZIXA 1Q8OA 3AFGA 4DPNA 1QMJA 1SEFA 1SBFA 2R072 2DCZA 1A8MA 1WBLA 4MXWB 1PIV3 4XXPA 1BJQA 1LECA 1MEC2 1COV2 3FX3A 1UU5A 2ZMLA 1AVBA 2XJTA 3FE5A 3VBRA 3G7DA 3U07A 1CAUA 3VL9A 3WHTA 1KD7A 1HKDA 5C9AB 4EN9B 1Q8PA 2VPVA 4YG0A 2PAMA 5C8WA 2D6OX 1CAVB 2IXJA 3AZWA 1QH7A 4PJYA 5IUQA 1RMU1 3V0AA 5GLTA 4XZPA 2A6YA 2FZ2A 1S0CA 1FOD1 1Y7BA 3KS7A 3MLJA 2FBEA 4N53B 4KG8A 3QH6A 2MEV3 1Q56A 3TRSB 1AL23 2PLV3 1FAYA 2JG8C 5BNPC 2XLAA 2VGDA 1W6MB 5SV5A 2BFUS 4JTNA 4WVMA 3BOWA 1GZ9A 1WW5A 1RUH3 1NCRA 3FLRA 4AI1A 4C0BA 3VZMA 3B00A 2EXHA 4AFCA 2JDZA 1HXS2 1CVNA 3CEWA 3O0VA 1C8M2 1KJLA 3VBUB 1IS4A 2PLV1 2RMU2 2ZGNA 2DCYA 4Q0UA 2YHJA 3JQXA 4NO4A 3POWA 2XKPA 3E6DA 4CDUC 3WG1A 1B09A 1BMV1 2RJKA 2NZ9A 1WCSA 3ZSMA 3H9AA 1VBC2 2FMDA 2XVLA 3RYKA 3NV3A 2VMGA 4HL0A 3K51A 4NHKA 2AENA 1VBC3 2JENA 5KHJA 1R1ZA 3WCRA 5EFUA 1TME1 5JIUA 1QXRA 3FBMA 4RS5B 3OY8B 1MZ5A 1NA1A 1BMV2 1RUJ2 2VU9A 3WG4A 4AHZA 2PHTA 5GJ6A 1NQJA 2PAKA 3RPQA 1SLTA 3R4DB 1OOPB 4BLJA 1PVXA 3B93A 1DDLA 4AEKA 3WUDA 2Z42A 1J3PA 4AGGA 3IIAA 1MQTB 1AX0A 1UZYA 4J1XA 2QNKA 1Q3EA 2ET1A 1UKRA 2H6CA 1BEV1 2XJVA 4Q4X3 4Q29A 1PVC1 1XE7A 1O4YA 4RQPC 2Z69A 2NP0A 4Z07A 2DURA 4QD2A 4X8NA 1H4HA 3T2TA 4G4FA 3KB5A 2VOVA 4AVCA 2DYCA 3AYEA 1AR63 4P9JA 4INDA 3FLTA 4M0HA 4XOGA 4LHKA 1LU1A 4AI0A 4JAAA 3IBMA 3KMHA 5FO7B 2B45X 3ZXGA 3R05A 4E4SA 1CAVA 4I02A 2HWD1 3P3PA 4K7JA 3LA7A 5EYYA 5GALA 4DY3A 2BVBA 1EAH3 1FMD1 4FPCA 3DGTA 3TNPB 2X53S 3CLPA 1I3HA 4JV4A 3NAPC 1ULCA 2R0HA 1ENXA 1VP6A 5T5LA 5FBZA 4DXZA 3EXUA 3VKOA 2RM21 5TSWA 4Z92B 4AFMA 2W39A 1N3QA 2E7AA 4CEYB 2YUEA 3ALQA 1R1A1 1IHMA 1IS5A 3M1HA 5D8AA 1XYPA 4P9YA 4OHZA 1SLAA 4GH4B 4D7SA 5FLHA 4LBOA 4LBJA 2VVDA 4OLLA 1ENSA 4C1XA 3ZSLA 3KD4A 4COUA 4HT1T 1MZEA 4HSJA 1MS0A 4Y22A 4YNIA 3K48A 3I59B 3AP6A 4XJWA 1WW6A 4R9CA 3RSJA 3WP6A 2A3YA 4YG3A 3V64A 4YZ3A 1C8M3 1IGOA 3S30A 1R081 2ARBA 4WV8A 1LESA 3LOIA 5DG2A 1H1AA 1OA2A 3ROUA 4XJ9A 4CDWA 1EV13 1HRV1 4XF1A 2WQ4A 3EBRA 2PHLA 2XHKA 1GBGA 3TB0A 2ZKLA 1PZ7A 3JD73 5J96B 3AB0A 4WZFA 4IEZA 5FLJA 2XUMA 3MDPA 1QOSA 3GF6A 3P3NA