2DYCA

Crystal structure of the n-terminal domain of mouse galectin-4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
147
structure length
147
Chain Sequence
YNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Crystal structure of the N-terminal domain of mouse galectin-4
rcsb
source organism Mus musculus
total genus 24
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dycA00
1PZ7A 4NOTA 2DUPA 2HYKA 2A3YA 1NLSA 1QNYA 3WUCA 1LGCA 3AP7A 3T2TA 1H9WA 5GJ6A 4L8QA 1CN1A 3WUDA 3N7LA 3IN9A 3AZVA 2R1BA 2A6VA 3M3CA 4XXAA 1MS5A 2AH2A 4XYXA 4R9CA 3IPVA 1W6MA 1R1ZA 1UMZA 4FPJA 4YZ4A 4K20A 2ES3A 2NM1A 3L2YA 3R05A 2Z42A 1H9PA 3AXDA 3I8TA 5JOZA 5T5OA 1S0CA 2DTWA 1GNZA 1WW7A 4YW5A 1ULCA 1N3PA 1DGLA 2NMOA 3ZSJA 1WUVA 2EXHA 2PHUA 1UL9A 1UZZA 2ARBA 4AVSA 2A3WA 2ZGQA 5KXBA 3BIWE 3SITA 1MVQA 3INAA 3WDUA 1V6OA 4PF5A 1N1VA 1V6IA 4FPCA 3TAYA 4FPYA 1CPMA 3BTAA 1FATA 2WSUA 2VXRA 1AVBA 1YIFA 3MW3A 3AZYA 4CTEA 5KXCA 1LEDA 3NV1A 3MW2A 1WLCA 1G9BA 1SCRA 3PVOA 2E7QA 3KQRA 2FHRA 1LHNA 1MZ6A 1URXA 4P14A 2VY0A 3O12A 1IS6A 3AJYA 3B00A 1BYHA 1B09A 4BQ1A 4YFWA 1LESA 3N7JA 1AXKA 2WNEA 3IMNA 3B01A 4YM1A 4YZ1A 1RIRA 1Y7BA 2DVAA 3WZ1A 2P3JA 1JN2P 3IM0A 2WT2A 4CZSA 1AXZA 2VUAA 5EWSA 1YRZA 2SLIA 2NZ9A 3GNEA 1JUIA 2CY6A 5DXDA 3JUUA 4YGBA 5GALA 4XIKA 2OUJA 1DHKB 1ZA4A 2WT1A 3USUA 5JMCA 2A71A 1N3OA 4FPOB 4XIOA 5T5LA 5F9TA 1QU0A 5JOWA 1BQPA 5IK5A 2Q5TA 4FPHA 2A75A 1VLNA 2ZKNA 4FOWA 2DURA 1DFQA 3IKWA 4Y22A 2AYHA 3HMYA 1G7YA 1KRIA 4DS0A 3SH3A 3I4IA 2ZMKA 2P3IA 2DVGA 2PELA 4AYUA 2ZGNA 3R4SA 4PBPA 1IS3A 1WD4A 3Q9OA 2WKKA 3OYWB 5KXDA 3M3OA 1MS4A 1SLAA 3VV1A 1FAYA 1SFYA 1G9AA 1ULEA 2ZHNA 4I30A 1TEIA 4WVVA 4Q26A 2LTNA 4PCRA 1XQNA 2BQPA 5T5JA 1SLBA 3AYAA 4FVVA 1LHUA 1FNZA 5DG1A 3AZZA 3RMYA 3KM5A 4Q1RA 2EIGA 3V65A 2R1DA 3OBRA 1WBLA 1A3KA 4GALA 1SBDA 3WDWA 1AX1A 2UWCA 2CYFA 5CAZA 3AYDA 1X50A 2GNMA 4FP3A 1D2SA 1GZCA 1AJKA 4LBNA 1HQWA 2GMPA 1G9DA 1UX6A 3TB0A 2R16A 1G8WA 1SBEA 1IS4A 2R49A 2A3XA 3D4KA 1LENA 1C1LA 3O0VA 4XXPA 2ZHMA 4Y1UA 5GLTA 4YZ2A 4P9XA 2ZACA 4XJUA 1MS1A 1UPSA 4YGEA 2NYYA 5T54A 1KDMA 2JE7A 2DWRA 1FV3A 1N3QA 3T1LA 3WDXA 1HKDA 5GZCA 3IPVB 1W6MB 1GZ9A 1SLCA 4H55A 3UJOA 3PVNA 1YYNA 1YI7A 2ARXA 2ZMLA 3VKLA 4YGCA 3MEPA 4XILA 3ZXJA 2A6WA 1CONA 4XHBA 3FLPA 1LGNA 1ONAA 4Y1ZA 1RINA 4K21A 3ENRA 1W0PA 3R4UA 1DLLA 5H9RA 4XOGA 2VW0A 2FMDA 1GBGA 4WVWA 3A0KA 1IOAA 1VAVA 1JXNA 4Z8BA 2G4IA 1MS0A 3WCRA 3D6EA 4XBLA 3WOGA 1D0HA 3WHTA 2GMMA 1U0AA 1W0OA 4Q27A 5IK7A 1NXD1 4XMAA 4BLIA 3VKMA 3POSA 4XJ9A 4M01A 4PBOA 1LEMA 1KITA 1YXWA 2DUOA 2GNDA 3SH5A 1V6LA 3H0OA 1LJ7A 2ZGRA 4XJ8A 1UZYA 3NV2A 3FLTA 1FV2A 2JDZA 1LOAA 4P9YA 4YGDA 2EXIA 3VKFC 3WNXA 4C1XA 1VALA 1LOEA 1LHOA 1AF9A 4YM0A 4DPNA 4YM2A 1QOTA 4AWDA 1QNWA 1DQ1A 1VIWB 4LBLA 3RRDA 1AZDA 1QDCA 4K1ZA 2GN3A 4SLIA 3SNMA 3W58A 4M00A 2P37A 3WDYA 3M1HA 1ENQA 2AREA 1AJOA 3AYEA 5IK4A 2JJ6A 3FLRA 1DYKA 1Z78A 2ERFA 4LBQA 1LOBA 3USUB 2DYCA 4LBOA 2JE9A 2ZGLA 2EALA 3ILRA 3WDTA 1N1TA 3AYCA 1RITA 1ZM1A 4D69A 1GKBA 3N36A 4MYEA 1C57A 2ZHLA 1HDKA 3PVEA 3VKOA 2XG3A 1ENSA 4DQAA 3ZYRA 5JOXA 4Y22B 1CIWA 2R0HA 4M3CA 1ENRA 3RSJA 4UW3A 4GXLA 1W6PA 4KBBA 2D6KA 1CR7A 2W39A 2NP0A 3ZXLA 2WSVA 5E8AA 2AENA 3JU9A 5DUVA 1QMJA 1GZWA 1W6OA 2D6NA 1Q8PA 1S0FA 2R0FA 3D5OA 4XMIA 1HLCA 3RS6A 1MR5A 3SLIA 3NWKA 3WG4A 5CNAA 5HCAA 1GNHA 1ULDA 3ILNA 2PHTA 4XE9A 2RHPA 3HN1A 3OJBA 3UL2A 3WG1A 5BYNA 2E51A 3WG3A 3AZXA 4JC1A 1APNA 5JDBA 2W08A 4FQZA 5IUQA 1DQ2A 2CL2A 3ZXEA 2D6PA 3AP5A 4YLZA 3LSDA 1W6NA 4GWMA 3ZSLA 1FYUA 1FX5A 2GDFA 3NV4A 4JRAA 2ENRA 4Q8KA 1V6NA 4YFZA 1N47A 5H9QA 3VUOA 1CQ9A 1LTEA 1LULA 1W6QA 3RG0A 2WQZC 1JOJA 2A6ZA 4BMEA 4DRVA 1C1FA 1UN1A 5JOYA 4FPFA 2WT0A 1BKZA 5GLUA 3CNAA 4ZXKA 1QF3A 3BOPA 1WLWA 4YG6A 4XTPA 1LODA 2YXSA 4Y20A 3ZXFA 3N35A 1H30A 1YO8A 5T50A 4Y1YA 3M3QA 4ATFA 1VAMA 5GZGA 4Q8LA 2E6VA 1QDOA 1ULFA 1Q8VA 2WLQA 4YZ3A 4FOYA 1V6MA 3C2UA 3POYA 4U36A 1S0IA 4U2AA 4WZFA 5T55A 2VW2A 2ZAAA 4FPLA 2W52A 1CESA 3FUQA 1GYKA 4R9DA 3O0WA 1LU1A 2EXKA 2UWBA 1OQ1A 2ZGTA 2PHRA 4LBJA 2V5YA 3FUOA 1V6JA 4XJAA 5LK5A 4Y1VA 1V00A 2H0BA 4XJWA 1MVEA 2GALA 2YV8A 4WV8A 1DZQA 1MS3A 1ULGA 4NO4A 5EYYA 3PMEA 3WV6A 1AXYA 5FREA 2CWMA 1CJPA 1OFSA 1LOCA 3AP9A 4BMBA 1G86A 3B3QE 1JYIA 4YW1A 1PZ8A 2D43A 1SLIA 4CRQA 3N3HA 3LSEA 5DG2A 2GN7A 1DBNA 2LALA 5JLVA 2OUHA 3BODA 1DYPA 2DVFA 1GLHA 2EF6A 1AX2A 2NMNA 2V73A 2OVUA 4P9WA 4YW2A 4TYSA 3ZXKA 4XDQA 1I3HA 1S0DA 3NV3A 2VW1A 5T5PA 1LOFC 1LCLA 2ZA9A 3OBTA 1SLLA 3POWA 5H9SA 1DQ4A 2EAKA 1WCSA 3V0AA 2JECA 3ATGA 3HR9A 5HCFA 3AXEA 5GZEA 4FPEA 3WDVA 3ZSKA 1LECA 4GWNA 1Q8SA 2CNAA 3WLUA 1LU2A 4XHXA 4XZPA 1V6KA 1S0EA 2ZGKA 4LBQD 1JBCA 5DZFA 1IS5A 3SISA 4K1YA 4ZKTB 2ZGPA 3VKNA 1I1EA 2ZBJA 3FFZA 4LBQB 5GZDA 2TEPA 2GNTA 1S0GA 1WBFA 3M2MA 4XBQA 5DZEA 5DZGA 3A0NA 1QGLA 2A7AA 3LCPA 1MACA 3FBYA 3V0BA 1C4RA 1CVNA 3WCSA 2ZGSA 1CPNA 2AR6A 3B69A 4GKXA 2DV9A 3ZYPA 4M3CB 2P34A 2UWAA 1A78A 5CA6A 2OW4A 2ZGMA 1W6PB 1BXHA 2DVDA 3OY8A 4ITCA 1UAIA 1QOOA 5E88A 4YZ5A 2YMZA 1GZWB 1SLTA 1W6OB 3PJQA 4GA9A 3O0XA 4UW5A 2ZMNA 4ISRA 2YY1A 1WLDA 1LOFA 1WW6A 1IKPA 4HL0A 4R9BA 4BLJA 2D6MA 2CTVA 3APBA 3UK9A 3WVJA 4AGVA 4AVVA 4FOVA 3MPPG 4Y1XA 2ZGUA 5EXOA 2P2KA 2XB6C 1WW5A 2CWSA 2E7TA 2ZGOA 4W65A 4Y26A 3WG2A 1F9KA 4BPZA 5SV8A 1W6NB 1A8DA 2GMEA 3AP6A 4XTMA 1LGBA 1G9FA 5DUXA 3M3EA 3RMXA 3U4XA 5L73A 2ZHKA 3AFKA 2I2SA 1W6QB 3GALA 4M3CF 3AP4A 4ASMB 5CB7A 4XBNA 2KM2A 4GKYA 1N1YA 1EPWA 2ZZJA 1PZ9A 4F83A 3O5SA 3N7MA 4Q2FA 1S1AA 5CBLA 4LBMA 1BZWA 4C1WA 3OGGA 1LHWA 1S0JA 4PQ9A 3W59A 1J1TA 4AVTA 1G9CA 2D44A 2A70A 2ZABA 2B7YA 4Y20B 3AZWA 5H9PA 2JKBA 4FP2A 1AX0A 4ATEA 4RL7A 1SACA 2A6XA 1BJQA 2D3PA 1DQ5A 3DUIA 2GNBA 2UU8A 4HANA 4FPKA 1UKGA 4AGGA 3AK0A 4ISQA 4FQ4A 2D3RA 3QCWA 5DUUA 1HQLA 1MS8A 5GLVA 3RQ0A 2PHWA 1LOGA 4FPGA 5GZFA 3ZSMA 5FRAA 4YM3A 5IT6A 1QKQA 2WJSA 4IQPA 1Z0HA 2PHXA 4DRRA 2P3KA 1F31A 1QOSA 2DU1A 2DU0A 5AVAA 5JVVA 2DVBA 1MZ5A 1GANA 2DTYA 2NN8A 2A6YA 5F5QA 4DFSA 2D3SA 4RA0A 3V64A 4BOWA 2A5ZA 1FNYA 2VH9A 1KJRA 1GV9A 2D6OX 3N7KA 1Q56A 5GM0A 5DUWA 1DQ0A 1F5FA 1JW6A 1KQRA 1JHNA 3AJZA 5KXEA 2AUYA 3ZPYA 4LBKA 3OPZA 2DUQA 1LHVA 1DQ6A 4JCKA 1GICA 2SBAA 2VU9A 1WD3A 3OYWA 4OZXA 2JD4A 4UW6A 1OKQA 1SCSA 1N1SA 3V0AB 1SBFA 3ASIA 4XJZA 2YZ4A 5HCBA 3ILFA 3AX4A 2PHFA 4BM8A 4Q1PA 3T1MA 2UURA 2E53A 4FOQA 5EYXA 4YG0A 5IK8A 1O4YA 3B9CA 1O4ZA 4YG3A 1MS9A 5GLWA 3QLQA 4YW4A 1S0BA 3MW4A 1DIWA 2D6LX 1JYCA 4M3CE 2EXJA 2W68A 4YW3A 1IKQA 2D7FA 2C9AA 3UJQA 5GLZA 3V0BB 3WHUA 5E89A 1Q8OA 1Q8QA 3ZVXA 2YROA 1KDKA 2C5DA 3A4UA 3DGTA 4AGRA 4TZDA 4UW4A 1GSLA 5T52A 4Y24A 3OY8B 3SH4A 2AGSA 1KJLA 1WW4A 4R9AA
chains in the Genus database with same CATH superfamily
1NLSA 1QNYA 1UWWA 4YNIA 3I2JA 3AP7A 2QCSB 3T2TA 5IVEA 1GWLA 4FTBA 1NCRA 4LHKA 3SCFA 3VD7A 5C3SA 4L8QA 3T0DA 1CN1A 3IN9A 3FJSA 2R1BA 4HKLA 5I93A 2AH2A 3HT2A 2I07B 3RJRA 2E26A 1W6MA 1YI9A 4D6RA 1ND3C 1UMZA 2KA3A 3UNPA 2X8KA 1W8FA 4YZ4A 2ES3A 2VE1A 2F4LA 3U1XA 3OF1A 1SHWB 1XC6A 1VRBA 3VN4A 2VVFA 3MO4A 4QQOA 3ZN6A 4CDXB 2DTWA 1SDWA 1UZVA 5FPZA 4E4SA 2J1AA 1STMA 2Y34A 5FZGA 4XFBA 1N3PA 3ZN4A 4TWTA 2C6SA 1UYPA 2A3WA 1MVQA 3NO8A 1V6OA 2HWD3 2X10A 4FPCA 3TAYA 3CEWA 2QDRA 2KXLA 5AVPA 4B4QA 4CP9B 2VXRA 2VR4A 3PL0A 4QPWA 4LE4A 2XMLA 1LEDA 1W8OA 1H2NA 2VQUA 4QX8A 3HQXA 1IQAA 4LKEA 3PUQA 1TME3 4X8PA 2FDGA 4WVMB 5FWJA 3USSA 2B9VA 1C5HA 1PNGA 1SG3A 4P14A 3I3EA 4LEJA 1VBC3 5A32A 1ND2A 1BYHA 1B09A 3WT3A 2NQYA 1ND3A 3N7JA 2WFF3 1XRUA 4W4ZA 2OX0A 4A7ZA 1OOPC 2NPIA 4XVHA 2D5FA 4B29A 2WZ8A 5FYYA 4YZ1A 5HBAA 4JHTA 4Q0SA 2P3JA 2P1BA 1CJDA 2WT2A 3IM0A 5A1FA 5K9YA 1AXZA 2JKXA 2PQSA 2QTWB 1CX1A 2Y0OA 1JUIA 2CY6A 5AFBA 2R30A 1UF2C 1DHKB 2H6BA 5JMCA 1N3OA 3CZUA 1IPSA 1BQPA 2AEYA 5IK5A 3NNFA 3I2OA 1RMU2 3HQUA 5F3EA 4EN0A 5F1RA 1NE6A 1XNCA 3S5QA 2QJVA 4LORA 5C5UA 4DUWA 1FPN2 3MF9A 1C8M1 4Y22A 1GMMA 2BNNA 3F2ZA 1QJY3 1KRIA 1QJU3 3K51A 3SH3A 2EIDA 5JZGC 2P3IA 4YARA 2HBTA 1C28A 3HNMA 1GQPA 1VBB3 5A7OA 1XYPA 2XLFA 2WKKA 2JDHA 3OYWB 3PMSA 5ACA2 3M3OA 1MS4A 1SLAA 3VV1A 1FAYA 1SFYA 2QQKA 2W9XA 2HWF1 5IFTA 1W9FA 2JEMA 1PM4A 3M70A 4A44A 2LTNA 5FMBA 1O6UA 1SPPB 3I7DA 1SLBA 3OG2A 3OEBA 3HVDA 1COV1 5FPLA 1EYBA 4GH4B 4Q1RA 4K8RB 3I3MA 1OOPA 4G4FA 3GXUA 4XDOA 1E5SA 3ABZA 4B4PA 1CAXA 2CGNA 3KWVA 1QH6A 3WDWA 3ZYBA 1AX1A 3WSOA 2HWE2 2PXJA 1X50A 3HPNA 1GZCA 2QVSB 3IDEA 3W21A 4RGGA 2GMPA 5FQ0A 1UX6A 1G9DA 3TB0A 1ALYA 4RR3B 1IG0A 3ES4A 1SBEA 1HXS3 5D8AC 2E31A 2VMHA 2P6CA 5DDJ3 4N8MA 1UOFA 3LD8A 3SQOA 4I02A 4Q4V3 5EZWA 4KL1A 4Y1UA 5GLTA 1IPJA 2ZOEB 4AHYA 3AVRA 3TNQA 5JZGA 4YGEA 3SCHA 5FZ7A 4JTNA 3VD4A 1D7PM 5T54A 1HIXA 4W6XA 3IZOA 1RUI1 4PT6A 5FK8A 1HKDA 4JDMA 3A23A 2VZVA 3HBZA 4Q0PA 1FOD3 2R062 1YI7A 2ZMLA 3LA3A 4OUMA 4W50A 1HN0A 5DAXA 1YQCA 3RZZA 4RFRB 5JLVA 1L7QA 4XILA 2A6WA 1OH4A 1CONA 3FLPA 4MVTA 3J7MA 2YGLA 1CD3G 1RINA 1QJX2 3HJRA 4QX7A 1ODNA 2GC2A 2BU9A 4LMFA 5FY0A 4I09A 1RUJ2 5FZ3A 3ENRA 5IVFA 5JSRA 3R4UA 1DLLA 5FZCA 4G3YC 2VW0A 1GBGA 3VBUC 4RFT0 3A0KA 3VBFC 1VAVA 3H3UA 1OLQA 3RYRA 3VZOA 4OHWA 3WHTA 4JKLA 1YQ8A 4Q27A 4OI1A 4AW7A 1NXD1 4XMAA 3THTA 3VKMA 5D8AA 3WY6A 2ORXA 3AM2A 4LHSA 2WO7A 4M01A 3UGGA 1VR3A 1W0NA 1KITA 1YXWA 1RVF3 3ES1A 3EXUA 3SH5A 4MZUA 5L7OC 1BVVA 1LJ7A 4ZU5A 5DAWA 5FV3A 1HRV1 4LHLA 5BNNA 1OA2A 1V70A 2RM23 4N90A 4META 4XUPA 3T2QA 3RWKX 3WQ1A 4A7KA 3UV9A 2FDJA 1H8TB 4P9YA 3ZDSA 3JD71 4OMCA 4FFIA 4NHMA 4NROA 4XCBA 3E97A 1RB8G 3W9AA 1UO9A 2FDKA 1ASJ3 4LO7A 4YM0A 1JZ8A 5F5AA 1X8MA 1XE8A 1W03A 4DPNA 1QOTA 2NLRA 3JBG1 1UZ0A 4LBLA 3HAGA 3ZO0B 3FZ3A 3RRDA 4Q4W1 2BPA2 1AZDA 4QU2A 2O1QA 1JOPA 3M1HA 1I6XA 2AREA 4TSVA 5EQUA 5EIYB 3VBUA 3LGRA 1Z78A 1ZBA1 2ERFA 3U78A 3VBFA 3RPQA 2E63A 4DO0A 5F7UA 4LIUA 4XQ4A 5F6KA 3U0ZA 3AYCA 2WN3A 3IT8A 4D69A 2Q0AA 2VCBA 2VZRA 3B7MA 3H7YA 4MYEA 1F5JA 2GH8A 2VOXA 2XG3A 3GHNA 3VKOA 3KSCA 2J42A 3EB7A 2PAEA 3TNPB 1Y9GA 4LKSA 4GXLA 4KBBA 2NP0A 1AR92 1VE0A 1TMF1 4KI5M 3ELNA 5E8AA 5FMOS 3CL1A 4QHOA 1V9U2 5JXGA 4NRPA 5HCAA 1DZRA 3WG4A 4UFJA 1ZBE2 3N9OA 3ON7A 4LKDA 4LNVA 4Q5OA 1ULDA 1ULPA 5CNAA 5FPVA 5C5TA 2GC3A 4OFGA 4CDUC 1MZFA 1AR71 1VRH1 4GB33 5JPMB 2E51A 4FTEA 5CVRA 1BLZA 4YYOA 3MZHA 4QB1A 4QQHA 2W08A 3MGUA 5HXVA 4YLZA 5C9AC 3ZSLA 3O1OA 1OH3A 1QIQA 4QQ2A 5LASA 3T0AA 3B9IA 3PIGA 1N47A 3AMPA 1CQ9A 4DY3A 2CHHA 1J1LA 1PIV3 4DRVA 5I0RA 1DCSA 5E1RA 1C1FA 4DUVA 1POV3 3QBQA 5JOYA 4FPFA 4N43B 4IGPA 5FMOL 5GLUA 4QPGC 3CNAA 4ZXKA 3GCWA 1RUC1 1WLWA 2WQ8A 1FXZA 4QX1A 4XTPA 1EP0A 5FYBA 4AI2A 2WYFA 5G05L 4JGZB 1HJFA 3ZXFA 4AHXA 4HFSA 1H30A 3OSDA 3M3QA 1HQNA 3NJVA 1VAMA 3LAGA 4A6OA 5GZGA 2RJKA 1QDOA 2VMGA 1Q8VA 2C1FA 4FOYA 4CDQA 2F17A 3POYA 2WO1A 1VP6A 4U36A 1UQXA 4WZFA 1B35A 4AEDB 5C6CA 4LE3A 2ZAAA 4FPLA 1L7RA 1QQP3 4AI0A 2ZX3A 1VBE1 2ATFA 2IXCA 3O0WA 4OVEA 4NMIA 3I2DA 1DZTA 4OYUA 4W6WA 3VBRC 4ASKA 5C9AA 4ZU4A 4INDA 1V00A 1UIKA 4WM7B 3D8CA 2IVJA 2WWJA 3ST7A 4WV8A 1CIYA 1CZVA 1ULGA 4PDWB 1AXYA 3WW2A 1OFSA 4QPGA 5FY4A 1EPZA 1EV11 4YW1A 2OXBA 2VPVA 3N3HA 1EUTA 3LSEA 1W06A 1XU1A 2CAUA 1DYPA 3O1UA 2R041 1HN1A 1X9PA 2RS31 4YVWB 4XDQA 5A7NA 4AI8A 1OT5A 1AYM2 1QXPA 3HD8B 4NRMA 1PGW1 1PO11 3OBTA 5F3CA 5J3UA 4EWDA 2MPFA 1J83A 1LR5A 1WCSA 3V0AA 3M7AA 4QXHA 2WNOA 4JQTA 2D93A 2JG9B 3C7GA 3V56A 1POV0 4HKOA 3WLUA 3K3OA 3TWIA 1UY3A 4XZPA 1V6KA 1RHI3 1NCQC 3DPRC 3VZMA 3CU7A 1JBCA 3SISA 4AVCA 1JODA 4K1YA 3ZIXA 3RYKA 2ZBJA 2VZ3A 2DFBA 4QM8A 3KV6A 4XBQA 4NWVA 3ZX7A 5FYZA 3LKJA 2XJPA 5DZGA 3URFA 4CDWB 1WGPA 1G6NA 1MACA 4B8EA 2B39A 4E2QA 4DEVA 1CVNA 2RDRA 4K6BA 3WQ7A 5BNQA 5EJ1B 1EY2A 4AAXA 4S2FA 1A78A 2VNRA 1W6PB 2DVDA 5F2SA 5ABJC 1UMIA 5TSWA 5E88A 4XUOA 4AFDA 3MDPA 1C8M2 2YPDA 3KGLA 3I2FA 3NMBA 3I2GA 1XNAA 4HOOA 2VMCA 4L11A 4I0WB 5C8CC 4BCUA 1PO21 2WZEA 1WW6A 2IC1A 4FXKB 4R9BA 5FLIA 2B42B 2D6MA 3APBA 3WINE 4BLJA 4LIVA 1NA1C 4EJRA 3N9NA 3BKZA 2FDHA 2ZGUA 4GJZA 4PJYA 3GBFA 3THDA 3ZM8A 2HWF2 4EN8B 2MHFA 3WF0A 5BY5A 4CDQC 1OKOA 4BU2A 1ZRDA 5CKNA 1WCQA 2BOJA 3I3BA 3TOJA 3VBOC 1XU2A 3RMXA 3M3EA 3WD5A 3GZAA 4KWKA 1ZX5A 5LBFA 1O3SA 2BV4A 4M3CF 4ASMB 3WNLA 3AKTA 2HH9A 3VBHC 2HWC2 3H1MA 4LLFA 2VNOA 1N1YA 3L2HA 5A7WB 4Q4Y1 4IE0A 1YJKA 3J8F1 1BZWA 1COV3 4C1WA 5C3OA 4OUSA 1J1TA 3JQWA 4LR4A 2Y6JA 2ZABA 3HOBA 4IV1B 2LS6A 4MSVA 5ABJA 4MV2A 2JKBA 1R083 4FP2A 4QX0A 2QNKA 4RL7A 1SACA 1JZ4A 4TTGA 5T3NA 5SV5A 3JB8A 2KR2A 3E6CC 4AOCA 2JE8A 4FPKA 5C8CA 4LK7A 4KWJA 5DAVA 1SMVA 2H6CA 3ZMOA 1US2A 1RUI2 2LUWA 1NA1A 4XFIA 5FPBA 3VBSC 1HQLA 2DBIA 5FAXA 3WX5A 4E8CA 3RQ0A 1RUNA 3KGZA 2VTFA 1LOGA 2V09A 2YPJA 3KF5A 2ZEZA 3ZSMA 4YM3A 3T30A 2ARAA 2BFUL 1QKQA 1WMXA 1Z7S3 2GH2A 1HV1A 2Q30A 2PHXA 3C7EA 3VBOA 3O1TA 2P3KA 4OI0A 4Q0QA 1QOSA 4LLOA 2FD8A 4HPKA 2XJSA 2BNOA 2DVBA 4LT5A 1HB4A 5BUVA 2VTXJ 2RMU2 3VBHA 4CCMA 3ZXAC 4ES8A 2QQLA 3WW4A 4BQYA 2A5ZA 3PU8A 3ZFFC 4UFIA 3AFGA 3ZMNA 5KBFA 5GM0A 2VQTA 3MIGA 2WO3A 5FK7A 4BJ0A 1DQ0A 1F5FA 1JW6A 3AJZA 1VPHA 4HXCA 4QKNA 3VDDB 5FMDA 2DUQA 1JOBA 3H8OA 4V2WA 3BIEA 1FMD3 1DQ6A 2DCZA 3H1YA 4WM8C 5A80A 4XC9A 3VL8A 2VU9A 4PLOA 4RD7A 1FT9A 1AL21 2VMFA 1N1SA 1PMHX 3THPA 3VDAA 5BNPC 2YZ4A 5FZ4A 5HCBA 5J7MA 1KS5A 4JHZA 1W9YA 2PHFA 4BM8A 4FOQA 2EAAA 1O91A 2RS13 3CJIA 5FPXA 3B9CA 1O4ZA 2B4KA 3T4HB 5K4LA 1HRV3 3VHRA 2HWB1 2WABA 3KQ4B 3MW4A 3POEA 4Q4W2 4JRLA 3LE0A 4KNCA 3WF1A 5GLZA 1J58A 3JD73 3WHUA 4AQ2A 3FX3A 2YG0A 3LB9A 4IV3C 2XBO3 4ZS3A 2C5DA 3A4UA 4KG0A 4AVBA 5CFCC 2VOKA 5FP8A 1OC1A 1J3RA 5KC5A 1JMUB 1ZZBA 4Y24A 4V2VA 3JBG3 2YGMA 3ZFFA 3OY8B 2RR11 3SH4A 1LB2A 4NIHA 1WW4A 4R9AA 1PZ7A 4UFLA 2GP3A 2HYKA 5IW0A 4FSJA 2PFWA 3WUCA 1LGCA 4COWA 3VHOA 3WQBA 3DYOA 4OLLA 1ZBA3 4EN9B 4WM8A 4OZOA 1TMF2 2FCUA 1NQJA 2O0OA 3AZVA 1K5JA 3M3CA 2PLV3 1MS5A 4V1PA 4YRDA 4R9CA 2BBVA 3IPVA 5FBJA 1BCXA 4JDOA 4CCKA 5BNPA 2Q1MA 3Q8CA 4XF3A 3NKTA 4ORFA 4CPBD 1H9PA 3BU7A 3AXDA 3PIJA 4MGSA 5T5OA 3LEKA 3PJYA 4J25A 4PI0A 1OF3A 3K48A 4MGQA 3KCYA 4YW5A 1PVXA 1ULCA 4A3XA 1DGLA 2NMOA 2QQVA 3Q8BA 1WUVA 2W5FA 3FHQA 3C3VA 4NAMA 3RGBA 5C7GA 5LCWL 4IV3A 4NPLA 4IEYA 3MUY1 2ZGQA 2YC2A 3ZYIB 5A3PA 5JXJA 1AR73 1VRH3 3BIWE 2JICA 3E6BA 3INAA 3WDUA 5KXBA 5EHDA 4N53B 3ZIWA 4KH9A 1V6IA 4MXWA 1WLTA 3EO6A 1W3XA 1FATA 3AL5A 5LZ6A 3BCWA 3VZLA 2W94A 1RUC2 1UU6A 4ES9A 1UMHA 1XE7A 2W87A 4IEOA 1CAVB 3J26N 5FJKA 4FAGA 2VC9A 5FDBA 3KHCA 2QDNA 1X7NA 5JR7B 1OVPA 4QX5A 1URXA 3K2OA 5B2GB 4XF4A 1BVP1 5HCHA 2UY8A 2MEV3 2X09A 1HB3A 2XOMA 5LWBA 1VB4A 3HT1A 4XUQA 4QT6A 1WKYA 1JHJA 3ZKUA 3GDBA 5EP9A 1DGWX 1HW5A 3B01A 3IMNA 3POFA 2WA3A 4EN7B 2VNGA 4URAA 1RIRA 5IWFA 1K5MB 4JAAA 4X6RB 5FZIA 1JN2P 1KGYA 3EYPA 4CZSA 2GC1A 2VUAA 1AR61 5KHHA 3ZFEB 1VMFA 2SLIA 2NZ9A 3GNEA 4XFAA 5GALA 4RS5C 3JUUA 5DXDA 2FQPA 1JS9A 4RQPB 2K0GA 2WNUA 3USUA 1R1A2 3NAPB 4FPOB 5FP7A 1AR82 4BIFA 1UKRA 2A75A 2ZKNA 4BQ3A 2XQRA 1UXXX 1WMDA 1DFQA 5HI0A 1VBE3 4NHYA 4I01A 4E2SA 3I4IA 4BQ4A 2DVGA 1GNYA 3MIBA 4N7IA 4AYUA 2E9QA 4PBPA 3WP3A 3Q9OA 4UF0B 5JPNB 3U11A 4NR1A 4RYDA 2R042 2RS32 4YVSB 1U5ZA 4L9BA 3KVBA 2YB7A 2ZHNA 4I30A 1TEIA 1W9TA 2QQUA 4WVVA 1PGW2 2XH6A 4LUKA 5T5JA 5C3QA 1PO12 4GQ7A 1EV13 5DG1A 3RMYA 5BNOC 3OUIA 2OYZA 1V9U1 1AL0G 2R1DA 3OBRA 1WBLA 1VBA1 3A22A 4DZGA 1QJFA 4PI2A 2TNFA 5JI9A 2CYFA 4NAOA 4Q4X3 4FP3A 1WMEA 4QXBA 1AJKA 4LBNA 4RS5A 1RUG1 2QUOA 1Y9QA 3RI9A 2JWPA 1E5IA 1TNFA 1EAH3 4QQPA 1G8WA 3AMQA 4XDPA 2ZKLA 4XQDA 2XL9A 1LENA 1C1LA 3QH7A 3E1F1 2ZHMA 1O3TA 3GJAA 2RDSA 4P9XA 5FUPA 4XJUA 2WC2A 4AQTA 2VJXA 3VGIA 1UPSA 2B46X 1NCRB 4QHZA 1LNSA 3DF0A 3K4DA 1KDMA 2WNVC 1D4M3 2J22A 1PK6C 1UYZA 1N3QA 4LO4B 3T1LA 5GZCA 2BGCA 2XJRA 1W6MB 4H55A 3TN91 3UJOA 3PVNA 2IVIB 3LDBA 4P02B 4LTAA 3THCA 1M06G 3VKLA 5F5CA 4XW3A 3MEPA 4FFFA 4Y5SA 1A8MA 1H2KA 4XHBA 4KU7A 1ONAA 1XNTA 3BPSA 4Y1ZA 3ZN6B 3FFQA 4K21A 4CEYC 2GZWA 4Z2WA 3IMMA 4XOGA 1R091 1J3PA 4WVWA 4M0HA 1S2KA 3LEGA 1IOAA 1JXNA 1PO23 5A7QA 2G4IA 4Z8BA 1JH5A 3D6EA 4JKMA 3WCRA 3WOGA 1GFF2 1LKNA 1U0AA 1W0OA 2BP6A 5FZOA 2R073 3GGLA 4QGNA 5IK7A 5DN2A 3POSA 2GC0A 1W8ZA 4IERA 1L7LA 1XSQA 2YC4A 4Q4Y2 2GNDA 3H0OA 3J8F2 5C33A 3MIFA 4MGTA 1RJ8A 4XJ8A 3NV2A 4A4AA 4L99A 1NUKA 4M4PA 2WNVA 1PNFA 3N9MA 1Y43B 1PK6A 5A6QA 5A32B 1ND2B 3SCGA 2DBNA 1ND3B 4GMP1 3MLJA 2HEWF 1O59A 1T6BX 1LHOA 2Y6KA 2ET1A 2OQ7A 1JZ5A 3MIEA 2PYTA 3PUSA 3RZHA 3T4VA 3X29B 4ZPIA 2YU1A 1AYM1 4CEYA 4M00A 1W8UA 1MPXA 2P37A 3AYEA 4OMDA 4A2UA 2JJ6A 5IK4A 1OUXA 4JQRA 4AQ6A 2RV9A 1GP6A 4LBOA 2JE9A 2ZGLA 4MXVA 3WDTA 2RG4A 4BIOA 5KHGA 1RITA 1ZM1A 2VXJA 3L9JT 1GKBA 4RHV1 3MV01 1HDKA 1I5PA 3ZYRA 4I3PA 3SMHA 5JOXA 4CUAA 4Y22B 1CIWA 4M3CA 1KXGA 4MADA 2D6KA 2W39A 5A3LA 2WSVA 2XWJB 2AENA 2X29A 3VD5A 3KD4A 2ZEYA 1GZWA 4XMIA 3D5OA 1JU4A 3S7EA 1KS4A 1RUF1 3RS6A 3SLIA 3TBDA 2X5IC 3NWKA 2H0VA 3U07A 1DYOA 2G1MA 3K4ZA 4Q0VA 5I0SA 2ARCA 4SBVA 3UL2A 2G9FA 3UYJA 4CE8A 5BYNA 4P00B 4BQWA 4RSUA 1H6XA 1AL22 1OOPB 3HN3A 1EUUA 4BQXA 3U37A 2XXZA 3D3AA 1CAXB 4HN1A 5FO7B 5IUQA 4BDVB 5L19A 1S2EA 3R4DB 3C8XA 3LSDA 5IVCA 4QMAA 2ZEXA 2BW8A 2AACA 2ENRA 2CAVA 1BBT2 1VAKA 2YU2A 4R8HA 4AG4A 3CIHA 1RMU3 4Q8KA 3VUOA 1W6QA 5FQ0B 2HWB2 3P5BA 4BMEA 1ULOA 2EVXA 1FPN3 1UN1A 1W39A 2Y8KA 3RZLA 4CUBA 1QF3A 4AL9A 1O3QA 4YG6A 2BNMA 2PAKA 5FMCA 5JZGB 1OLMA 1L3JA 5ACA3 1CAWA 3MPBA 4A42A 3O1RA 2HWC1 4Y20A 3N35A 2RR12 3DV8A 3WXPA 1YO8A 4NN0A 4Y1YA 5EV7A 4ATFA 2ZCWA 2ADEA 4LA3A 2E6VA 4Q8LA 3H8RA 2X5IA 3BB6A 4YZ3A 3AKRA 3C2UA 3C7FA 3MFAA 2FDFA 1S0IA 5T55A 4OULA 2V5DA 4QU1A 2WZR2 4W8JA 5K7PA 4AFAA 4ASLA 1WWYA 4EN6B 1CESA 2QQNA 2VUDA 5JSOA 3HNYM 2P4EA 1GYKA 2YYOA 2HWE3 4R9DA 4P9GA 1F2NA 4OI2A 3NQHA 4H2AA 1P8JA 2PHRA 2V5YA 4D6QA 3H7JA 3FUOA 3KMHA 2UYAA 4XJAA 2IXJA 2H0BA 1PHMA 3JCIA 4Q29A 2P5BA 4XJWA 5M0TA 5LW9A 3J9SA 2QQJA 1RUOA 2V4VA 1DZQA 2JENA 4KQ7A 5D8AB 1NQDA 3PMEA 3BN6A 3S57A 1GQHA 2G9GA 1CJPA 2XVKA 3AP9A 1REFA 1G86A 3K75B 2BVVA 4BMBA 3K77A 4IGOA 1JYIA 1PZ8A 1UU4A 2JDNA 4CRQA 1BEV1 5BNNB 4NIGA 1ZRIA 4UFMA 5C4WC 5FOBB 3ACLA 2DVFA 1GLHA 2EF6A 2NMNA 2RMU1 2V73A 4YW2A 3ZXKA 2WS91 4TYSA 1RUH1 3GCXA 2C9KA 5FFOC 5AC91 2R063 4EWEA 3ETPA 5T5PA 3IDAA 1K3IA 5FYVA 4HONA 5KC6A 4LA2A 1X33A 1OPOA 4Y4YA 1YQ6A 1PVC1 1IGOA 3VD9A 3VLBB 2VZSA 5FY7A 1QJX3 2JECA 2FZ1A 4IL7A 3C7OA 1RUJ3 1NY71 3Q8EA 4FPEA 2IZWA 3NJZA 1LU2A 5A1AA 1OQEA 2ZX1A 5F2WA 1GOGA 1S0EA 3VZKA 3FMGA 5A3TA 3VBUB 3OCPA 4DEQA 4JZRA 3VBFB 2GNTA 1S0GA 1O3RA 3IIAA 3ZYHA 2Z69A 4MUVA 3A0NA 1CZTA 5I0TA 1AR62 3WCSA 5F5IA 1VMHA 4GULA 4GKXA 2DV9A 4UXAA 4Q0UA 4DY5A 1LRHA 4GWJA 1E5RA 1QOOA 1YQ5A 5C4WA 3GZEA 4I0AA 3WNPA 4GA9A 1SLTA 3OGSA 1KFUL 1OHFA 2BERA 2ZMNA 3BU0A 1H1IA 2YY1A 4XFHA 4PIZA 3WVJA 5L9BA 4AVVA 3MPPG 3KT7A 5JIUA 2WN2A 5DAQA 5FP4A 3CJXA 2P2KA 2ZTNA 5CG9A 2ZGOA 4HVQA 3WG2A 1W05A 2UY9A 1F9KA 4BPZA 2JG8C 4KG8A 5L7OA 3SKVA 4HSLA 1G9FA 3U4XA 1ENXA 3DXTA 5J96B 2ZHKA 1QJZA 5AFEA 4ZZ5A 1VBA2 2YFZA 3LWCA 4XAEA 4X8NA 5CB7A 1JZ3A 3UT0A 4P9IA 1NYWA 3LA7A 5FY9A 1PZ9A 4F83A 5FKBA 1ZYBA 1S1AA 1UU5A 5FYUA 1RUG2 1AR93 4LBMA 3OGGA 2PHDA 2CV6A 1V9U3 2F4PA 4CXYA 5LEKA 2ZX2A 1AX0A 1UOJA 1ZBE3 3WNMA 1CWPA 2D3PA 4HANA 3T0BA 2QFEA 4CDQB 5KHKA 3HEIA 5FZDA 2Y33A 2XVLA 3AK0A 1B35B 4ISQA 2D3RA 3CMGA 3GM8A 1MS8A 4H7MA 2VVDA 3BI3A 3HBKA 3TN92 2PHWA 3HWJA 4AEKA 5J37A 2KD7A 5FRAA 2JG8A 2WJSA 5C9AB 3A7QA 5LY1A 5LBBA 4AHWA 1AUYA 1BMV2 5FCCA 2DU0A 5JVVA 1MZ5A 4I0BA 1GANA 1PGSA 3E5QA 5F5QA 5CFDC 1R092 4RA0A 2Q8DA 4CDUA 1O4TA 4CP2A 4QPGB 1JU3A 2VH9A 3RZMA 1GV9A 2JIGA 1MEC1 4NRQA 4OI4A 1J84A 3LPGA 4CXWA 5LATA 1XOYA 3FN9A 2CSGA 4M4RA 3NL1A 5KXEA 1QHDA 4L2NA 2OKXA 4MH0E 2XJVA 3KV5A 3ZPYA 3ZSEA 1R1A1 2O8OA 4RGAA 3NSTA 1AR81 3ROUA 3MF6A 3ZFGC 2SBAA 4WM7C 4OZXA 4WZCA 4BISA 1VBD1 3JB4C 1W28A 3V0AB 3O1PA 2GU9A 3DKWA 3FHAA 3ASIA 1RTVA 4PDWC 5IYYA 3H50A 3ILFA 3PVBB 2RJ2A 2UURA 2E53A 3H3LA 1O4YA 1U5YA 4YG3A 5FXWA 1MS9A 1DG6A 3QLQA 4YW4A 1S0BA 3B94A 2D6LX 3CQOA 4QM9A 5ANNA 3N9QA 5DQ0A 5BV6A 1ACCA 1XB9A 3TYJA 4YVWC 2EIEA 1Q8OA 1QXRA 4XPVA 5CFDA 2HEVF 4BK4A 1KDKA 5A70A 1QWRA 5FZ9A 3DGTA 2JDAA 3UESA 5T52A 1GSLA 3AC0A 2F6BA 4RHV2 4DXTA 3I59A 5DAPA 2JG9C 1I5ZA 4MHRA 1GUIA 1HRI2 2DUPA 1AYM3 3JZVA 1CGPA 3IB3A 4JTOA 1TZOA 3VBRA 1D2QA 2ETEA 4OQ8A 4ZONA 3SEPA 2VAUA 2DCKA 5GJ6A 3HQRA 4H7LA 4AVAA 4DNYA 3ZR5A 2HYXA 4IE7A 4IETA 5FXXA 3WUDA 3ZFGA 4XXAA 1OVSA 4XYXA 2W1QA 1RUF2 4ARXA 1R1ZA 1H4GA 2XONA 4K20A 2BJSA 2Z42A 5CEHA 3I8TA 5JOZA 4Z92B 1S0CA 4XEZA 4MGIE 3TEYA 3P3NA 1GNZA 5LRSA 1WW7A 5L36A 4MO3M 5J36A 1W9WA 1QEXA 3ZSJA 2EXHA 4EWAA 3NNMA 3RDIA 3E5XA 1UZZA 4AVSA 2J1VA 4TLFA 4PF5A 1N1VA 1RUD2 2J1UA 3TRSB 1ZZ7A 5D21A 1C8M3 5ABJB 3KF3A 4EE2A 4XETA 2WSUA 1NCQA 1AVBA 1YIFA 1T6GC 2YDEA 3DPRA 3KV4A 3CKHA 1R64A 4HG6B 3WF4A 3EHKA 4CTEA 3MW2A 1WLCA 2TBVA 2WR9A 3WW1A 1SCRA 5C8CB 1G9BA 3KQRA 2BFUS 4BYYA 2HWF3 5A3OA 4B1LA 1NA1B 2VY0A 3OBZA 1RXGA 3O12A 3AJYA 4XFFA 4YSFA 1YLLA 4YFWA 4BQ2A 4HVOA 3VD3A 1UY4A 4CP0A 1AXKA 4CU9A 3ACFA 2WNEA 3LFMA 4GMP0 5IATA 2DFCA 4QB2A 4YM1A 1RJ7A 3VBOB 3T08A 5K0UC 3SHRA 5FY1A 1Y7BA 3QACA 4IV1C 1YFYA 2HWC3 3PUHA 4HPKB 4XZUG 4CUCA 1WCDJ 2BGOA 2G19A 2QBXA 2D98A 1YRZA 1J3QA 2Q8CA 3WQ0A 3VBHB 3TEXA 4AEJA 4NE9A 3ZR6A 4YGBA 3T2PA 3N9PA 2YBSA 2OUJA 4QPIC 3UETA 3S5AA 2J7MA 5C3PA 2A71A 1XYOA 5F9TA 5T5LA 1QU0A 4L92A 1QXJA 2Q5TA 1E5HA 1YIPA 4FPHA 3I49A 2DCYA 2HWD1 1GOFA 4DINB 4R4XA 3IKWA 3H9AA 5EJZB 3HMYA 1G7YA 2ZJCA 4J1XA 4IE5A 4DS0A 1AYN2 1WA6X 2ZMKA 2PELA 4IEXA 2VG9A 4DXZA 2ZGNA 3R4SA 3RZKA 4QB6A 1WD4A 3R6SA 1BEV2 1RUI3 1TME1 3PTYA 3KT1A 4IXLA 3S6PA 4LO5B 5FZAA 1MQTC 2LW8A 2WS92 5AC92 1RUH2 1G9AA 1OPMA 5IVBA 2BGPA 1S55A 1VBC1 1BK1A 4PCRA 4UFHA 3AYAA 2RDNA 2WFF1 4FVVA 2IUWA 3CJIB 3GBGA 1PVC2 1PX4A 4HSJA 4LUMA 4UYBA 5FXVA 4CSWA 3EJKA 1WA4A 5K0UA 1ZNPA 1NY72 3BTYA 4GALA 2RMU3 3FHIB 2R7EB 1SQ4A 4NIAA 1PGL1 2UWCA 4QPIA 4B3NA 1GZTA 1ODMA 2R16A 3VBSA 4MGKE 2R49A 4KGGA 3ZFFB 1W04A 3D4KA 4ARYA 1DP0A 2Q8OA 3RFRA 4XXPA 2VCCA 4NIDA 1BBT1 1XNDA 3MYXA 4OQ9A 1QJU1 2XDVA 1MS1A 1W2TA 5F8PA 1YJLA 4P9JA 1VBB1 4WM8B 1ZVFA 4HT1T 2JE7A 2BTVC 2K9ZA 3IPVB 1MQTA 1RGSA 1SLCA 2Y38A 2W47A 5BNPB 1Q5OA 4C90A 1KEXA 3N4MA 4YGCA 3NNGA 3OPWA 4P08A 2D97A 4Q4W3 1DGRA 5FO9B 1W0PA 2HJIA 2O14A 2JD9A 3POGA 2FMDA 2WZR1 3WNKA 4IV3B 5A6XA 1D0HA 2XQXA 2GMMA 2OPKA 1NXMA 2Y6GA 1HXS1 3J7NA 4MXWB 4XJ9A 3U10A 4CEWC 4PBOA 5LK7B 5CYYA 1LEMA 4YW6A 3VL9A 4Q4V1 2WAOA 3DL3A 1C8NA 5HV4A 2ZGRA 4XF0A 1TMF3 3U14A 1UZYA 3ACIA 3LIGA 3TEWA 1K45A 5FUNA 3FLTA 2WWUA 4FT8A 3O1MA 2VBBA 2PQQA 4LULA 5FJHA 5EPAA 1JZ7A 2EXIA 3VKFC 5CFCA 1VALA 4GZ9A 4O9GA 1LOEA 1AF9A 2D40A 2VM9A 3POJA 4YM2A 1JYVA 4B7EA 1DQ1A 1PX3A 1VIWB 1S4CA 3WP4A 4CYDA 3OD0A 4FXGB 2FCTA 1RUE2 3SKJE 2BWAA 2W1WA 4X6QB 4PQQA 4C8DA 2Z5WA 5A3MA 4K1ZA 4SLIA 3PU3A 5JUVA 3RZGA 4O7XA 1OD5A 1AJOA 3FLRA 1W2AX 4LXLA 5C70A 4LBQA 2WNUB 5FTTC 3USUB 2DYCA 2FMYA 2VO5A 3KCCA 3ILRA 4I2OA 2VGDA 2J1SA 4HMZA 2N7GA 2QZ3A 2Z79A 1RUC3 3NKGA 2IXHA 4CEWA 1UD1A 1UY0A 4L97A 4UW3A 1RVF1 1MEC2 3CDZB 1TQ5A 3ZXLA 5CU1A 1K5MC 3JU9A 4CPBA 1NOVA 2J1RA 1QMJA 3MIDA 4QKBA 4D6SA 2D6NA 1W6OA 1Q8PA 3O1SA 1XBFA 5JCTA 1NKGA 1HLCA 1JZ2A 1MR5A 4XAAA 4BE3A 1OQDA 4IUGA 1XPWA 1KD7A 5D1IA 4RQPC 5IVJA 2RHPA 2XHNA 2QKDA 2ZX0A 3WG1A 3WG3A 5LRRA 2WINB 1VBD2 3AZXA 3OEAA 4K8FA 5JXIA 2YBPA 5JDBA 1HB2A 3M3IA 1DQ2A 2CL2A 2D6PA 3AP5A 3CF6E 1W6NA 1FYUA 4D7YA 1FX5A 1H4HA 1CX4A 1R1A3 2B5HA 2GDFA 2VD7A 3NV4A 4JGYC 4JRAA 4K7JA 1AR83 4OHXA 4GAZA 4LQRA 4RS5B 1LULA 3OUHA 4QGLA 3MLLA 4LO8A 1ZZ9A 2A6ZA 2I74A 3AMHA 5A33A 2Y64A 3IIIA 1BKZA 2BEOA 5A7SA 3KCXA 3BOPA 1DLCA 3OGJA 1C3HA 4Y33A 2YXSA 2VUJA 2R043 2RS33 2VOTA 5T50A 1H2MA 2XUMA 4LOSA 2FBEA 2Y26A 3CBNA 4A41A 2WLQA 1PO13 2WUHA 1DDLA 4IEWA 2FCVA 3I2IA 5JXHA 4GB31 4IEUA 4JV4A 4NPRA 1U5IA 3DCQA 5C3RA 2OQ6A 2WDBA 4FBFA 3JQXA 3I2KA 2UWBA 1OQ1A 2ZGTA 4IDZA 1T2XA 4LBJA 4COVA 4CXXA 3UGFA 2QQMA 3ITQA 5LK5A 5A6ZA 1W90A 4JGYA 1NCRC 2WO2A 4NWWA 5CISA 2XLGA 2VUCA 3NNLA 5D2AA 5FZOB 3I54A 3IAQA 2GALA 1PIV1 2YV8A 3TEZA 1MS3A 1NG0A 4NO4A 5EYYA 3WV6A 4XABA 2CWMA 1LOCA 1XJAA 4ZZ8A 3UKVA 3B3QE 1BMV1 3W5MA 4CP1A 3FE5A 2D43A 1SLIA 4MLOA 5BNOA 5DMYA 4CU7A 2JB4A 2GN7A 5DG2A 1RC6A 1X9TA 2DF7A 2RJLA 5APAA 3BODA 2C26A 4UI9L 5JIAA 1AX2A 4P9WA 2OVUA 1UYXA 2WNVB 1YCIA 1PK6B 3NV3A 1C5IA 2Q1FA 1LOFC 4CU8A 3H8UA 4GJYA 4N9HA 4P5YA 1SLLA 3NRUA 3POWA 3S7IA 2FDIA 3NNJA 5H9SA 1DQ4A 2EAKA 5EFUA 1JYNA 1Q3EA 3ATGA 2QQOA 3CZJA 1SFNA 3AXEA 5GZEA 5HCFA 3WDVA 1LECA 3RYPA 1OFNA 1Q8SA 1H8VA 4CEYB 1IQDC 4LKFA 4NVPA 2LM3A 5J1XA 4F8AA 5I8SA 2VMEA 1CAUA 4CDXC 4ZKTB 4MG2A 1ZZ8A 3VKNA 3KT4A 3FFZA 5GZDA 1YHFA 3M2MA 4ZXEA 4QKDA 4EROA 3PUIA 2BZDA 1QGLA 2A7AA 3LCPA 5FYIA 4NIIA 3FBYA 1GWMA 1D0GA 4Q4Y3 4COUA 1MZEA 4DMIA 1ND2C 4CVUA 3V0BA 2WFPA 2WBKA 3B69A 3J8F3 3JXSA 3ZYPA 3ZPOA 4M3CB 5FY8A 1W8WA 2UWAA 2WL1A 3FC0A 4HZFA 1BXHA 4IGQA 1YFWA 1GQGA 4BWOA 1H1AA 1U5XA 1XXNA 2HWD2 4I3GA 4HK9A 4YZ5A 4GWIA 1GZWB 4FCAA 2ZXQA 2P6HA 3O0XA 1YFXA 2XGXA 3BTXA 1NX9A 1ZZCA 4G9SB 5FZEA 3GYDA 1IKPA 1LOFA 4HL0A 2IFRA 5IJRA 5I8YA 5FP9A 2Y60A 1OLME 4AGVA 2EICA 1TME2 3IAPA 2WZPP 4K40A 5B4XA 1HRI1 4D7TA 3H3ZA 5EXOA 2XB6C 4AEMA 1WW5A 2W92A 4R4ZA 4CCJA 4Y26A 3MUZ1 2XJTA 4NHKA 1VBC2 1PMJX 1OA4A 1WCUA 5SV8A 3VZJA 4B4RA 5KR7A 2GMEA 2Y6LA 2WFF2 3AP6A 4QX2A 4XTMA 1LGBA 1RHI1 1SDDB 2VQAA 4IW3A 2BDRA 5DUXA 4CDXA 3VDBA 1F35A 5IVVA 3AFKA 3UGHA 1VJ2A 1W6QB 2W95A 3GALA 5FPUA 1W8HA 5LBCA 3VB9A 5FYTA 4AFBA 4CUGA 4XBNA 2KM2A 2Z4FA 3AMNA 4GKYA 1PGL2 1EPWA 1XNKA 3U4SA 2ZZJA 4FFHA 4P5HA 3O5SA 3N7MA 4Q2FA 4BZ4A 4DXSA 2W3JA 4PLMA 3W5NA 4J6GA 2MNGA 4C0BA 1S0JA 3W59A 1O5UA 4AVTA 1CAWB 2JXAA 1G9CA 3OGVA 2W1UA 4Y20B 3M8LA 4FTSA 1H0BA 3AL6A 4MGYE 2Q1ZB 4CP9A 3Q8AA 4K3UA 3DYPA 3I3DA 1QJY2 2X5IB 1QJU2 3DUIA 3H42B 4OCTA 2CU5A 3LOBA 4WVMA 4NUBA 1RUD1 1UKGA 5FY5A 4AGGA 1OD3A 1AL23 1VBB2 2JIJA 2ZEWA 4FQ4A 3F95A 4QPYA 1O5LA 4OHZA 4WBBA 1DGWA 1Y3TA 4EZ4A 5GZFA 1NT0A 1OA3A 4GH4C 4BA6A 4DOUA 1BBT3 2XLAA 4IQPA 4XFGA 4DRRA 2HWB3 1F31A 3LIHA 4BHPA 1DU3D 2DU1A 4JX0A 5AVAA 2QE3A 3KZ4C 2J1TA 4XUTA 4F3JA 5I91A 2RS51 4QDRA 5FZMA 4DFSA 2IXKA 3G7DA 5CIRA 2B8MA 1H2LA 5F39A 4BOWA 4RR3C 1W9SA 3O14A 2C4XA 4MX3A 4ET7A 2D6OX 2RR13 3I97A 3ZN5A 1W99A 3LA2A 3MV11 4H14A 5HXMA 1HXS2 5DUWA 3U75A 1PMIA 5DDJ2 1KQRA 2WYSA 1R081 2YBKA 3VDCA 4Q4V2 4LBKA 3RWNA 2ZX4A 3GJBA 1LHVA 3FWEA 2R6QA 4CA9A 3MFCA 3LOIA 4XACA 2WZR3 4YWAA 3OYWA 1WD3A 1TNRA 2JD4A 5F37A 4UW6A 3WW3A 2W0XA 1SCSA 2Q8EA 4KWUA 1SBFA 2B9UA 2XJQA 3ZKYA 1AYN1 4TN7A 4UBHA 2W91A 4A45A 1SPPA 4Q1PA 1TG7A 3GHMA 1FOD2 1UOBA 4GH4A 1Z7S1 2V4AA 5BNNC 4XQWA 1UY2A 4AAPA 2HEYF 1DIWA 3NJYA 3PUAA 2EXJA 2W68A 2Z2SB 3EBRA 1IKQA 2D7FA 2C9AA 4NHXA 4YW3A 3UJQA 3WNOA 4UBGA 5FZHA 1Q8QA 2YROA 2ZS6B 1UPIA 4LHNA 3DKQA 2CGPA 4AGRA 4RR3A 4TZDA 3ZLIA 1WZXA 4HETA 2BWCA 4UW4A 5FZ8A 3BALA 3KV9A 3ZDVA 4IEVA 2AGSA 1KJLA 5KHJA 5C4WB 4NOTA 2A3YA 4CU6A 1H9WA 1X8EA 2WQ4A 1RVF2 1FMD1 4A7YA 1NLRA 2BYVE 5FIXA 1JTZX 1SEFA 1QH7A 5FZKA 1H8TC 3N7LA 2ADDA 5FLHA 2A6VA 2RM22 1Y9MA 2OIIA 2PAMA 2VOVA 3H8XA 4FPJA 2QQIA 2NM1A 3L2YA 2VNVA 3B93A 3R05A 4QQLA 4COYA 5L7OB 2P17A 2EA7A 4IEQA 2RS11 1ASJ2 2PN5A 4JKKA 3G6JB 3HNBM 4QDSA 3S30A 4YW7A 1AR63 1U12A 4H3WA 1OUSA 2PHUA 1K42A 3AKQA 1UL9A 2ARBA 2L9LA 2XBO1 3AB0A 1UZWA 1WCKA 3SITA 2XWBB 3WEZA 4FO9A 4FPYA 1CPMA 1UOGA 3BTAA 5LEJA 3MW3A 3AZYA 4D8MA 3NV1A 2VTXA 3IBMA 4A3ZA 3PVOA 1IHMA 2E7QA 2ZPXA 2FHRA 3OUJA 1LHNA 1MZ6A 2QQWA 1H8TA 2XUEA 4PHZA 2PLV1 4W6YA 1IS6A 3B00A 4BQ1A 1VMJA 1LESA 2HLEA 3FL7A 3ZXDA 2JG8B 3BGAA 5CKMA 4Z1VA 5B4NA 2ORZA 4GB32 3ZXGA 4B1MA 1JZ6A 1VBA3 2DVAA 1HX6A 3OGRA 5F6LB 3WZ1A 2I45A 5HV0A 3A21A 3RVHA 3EMRA 5EWSA 2VCMA 2VQ0A 1RUG3 4XIKA 3H1WA 2E33A 2WT1A 1ZA4A 4CDUB 5F32A 5JOWA 4XIOA 3P6BA 2V72A 2A73B 4HKWA 4HN0A 3LDRA 3LFIA 5LA1A 1HV0A 1B35C 1RUE1 1VLNA 3CO2A 2K2SA 3EQEA 3ETQA 4FOWA 2DURA 1PIV2 2GAUA 4MHUA 1GP4A 2AYHA 4Y5Z0 2GSYA 3POBA 2OPWA 3PURA 5IFPA 4JGZC 5LBEA 1IS3A 2WA4A 4BB3A 3QOPA 1CZSA 4AHZA 1H1MA 4K9SA 1UY1A 4GD4A 2X53S 3D0JA 5KXDA 2VZPA 3BUCA 4XURA 3TN93 3WP5A 4QX3A 1ULEA 5EJ3A 5JSPA 4ZY9A 1JYXA 4Q26A 2MEV1 1UCXA 4LO6B 1XNBA 2QZ2A 1XQNA 2BQPA 2LROA 4BXSV 4AEDC 1LHUA 1A6CA 1FNZA 4O65A 3AZZA 4PF1A 3KM5A 3KS7A 4D7SA 1JI6A 2UYBA 5BPXA 1KFXL 2C0ZA 1GP5A 2EIGA 3PDQA 4ZS2A 3V65A 5K8SA 2WWSA 1A3KA 2HKXA 1QQP2 1R093 1SBDA 2LRPA 2JB8A 3C7HA 3PLQA 3AYDA 2BOIA 2WIIB 2GNMA 3P3PA 5CAZA 1D2SA 4UOJA 4AI3A 5CFDB 1HQWA 3OPTA 4JVAA 4PLNA 2VBPA 4QXCA 5L9RA 4EV0A 1IS4A 1F4AA 3I3QA 2A3XA 3O0VA 4N43A 1X82A 3I59B 3B5LB 1RXFA 1US3A 1V0AA 4PIXA 4YZ2A 2XPJA 2ZACA 3VBRB 4BXFA 5G04L 5FKCA 2NYYA 3NW4A 4JGZA 2QQPA 4AFMA 1F15A 3ZFGB 2DWRA 1FV3A 3WDXA 4LK6A 5FYHA 1GZ9A 3O7OA 3CLPA 4GMP3 4KMQA 1YYNA 3R0RA 2ARXA 4CCNA 4CCOA 4AEDA 5CADA 2IFWA 2W2IA 3DXUA 3ZXJA 5GKAC 1LGNA 5J98B 1JYWA 2XKOA 1E57A 4S2GA 1NAEA 3ZYFA 5H9RA 3MBWA 4E4HA 2VL4A 2R32A 4UAPA 3VHPA 3WF2A 1RHI2 3SEEA 4Q4X1 4WVZA 1MS0A 4WM7A 4XBLA 5FYMA 4RHV3 4CDWC 5FXZA 1EAH1 2JDUA 4BLIA 1HRI3 1OXCA 4PDWA 3B02A 3KLSA 2DUOA 5I0DA 3T09A 3D0SA 1NCQB 1V6LA 3DPRB 4LOTA 4URTA 2VZ1A 4N7UA 4ZU7A 5C71A 3MICA 3DYMA 1RUF3 5FLJA 4YVWA 1FV2A 1D4M1 2JDZA 1LOAA 4KWLA 2E7AA 2JDYA 2VULA 1OF4A 4YGDA 3RI8A 3WNXA 2HBUA 4XF1A 4COZA 4C1XA 1A34A 1W8TA 4IEPA 5CZKA 1RL3A 1QNWA 4AWDA 1YWKA 5CKQA 3LEMA 2JG9A 4Z07A 1RYYA 2JDPA 4GIQA 4RGKA 5FZ1A 1YEWA 1QDCA 2W1SA 3SNMA 2GN3A 2YC0A 3W58A 3WDYA 2Y0IA 1ENQA 4AR2A 4E9KA 5J48A 5JWPA 1DYKA 1LOBA 4E27A 4QHBA 4XF9A 1RUD3 2EALA 1N1TA 2RE9A 4BQ5A 4CDWA 3N36A 2R071 1C57A 2RS52 1I9RA 2ZHLA 3PVEA 4DQAA 1ENSA 4N9IA 4AQSA 3LZZA 2R0HA 3K4AA 1ENRA 3RSJA 3LPFA 1DGRN 4CCDA 1W6PA 1WMFA 2AZ5A 1CR7A 2VECA 4MOAA 4ONUA 1COV2 2BBAA 4EQVA 1Q43A 2XHKA 1VB2A 4TLGA 4C91A 5DUVA 4D0QA 5FBZA 1S0FA 1Y4WA 1GOHA 2R0FA 1R082 2RS53 2DDUA 5LY2A 1GNHA 1H6YA 5ISLA 1J59A 3ILNA 2PHTA 4XE9A 1IZ3A 2VZQA 3HN1A 3OJBA 4D3WA 5C8WA 1O8SA 2PTMA 4BH9A 4JC1A 2VMIA 1APNA 3J7LA 3ORJA 1HB1A 2PMWB 5K0UB 2CGOA 4FQZA 3W20A 3ZXEA 2VMDA 4AI9A 2TUNA 4XCAA 2PHLA 4Y4RA 1YUDA 4GWMA 2D5HA 5FUIA 1YC61 1V6NA 1Z7S2 5H9QA 5I0UA 4YFZA 4QPIB 1NZIA 1LTEA 5A1LA 3NJXA 5FZ6A 2OZJA 3RG0A 4AXOA 5ERLA 2WQZC 1JOJA 4NPMA 2FZ2A 1OSGA 3VBSB 2BUKA 2XKPA 5ANQA 2WT0A 4ZHNA 5A7WA 3RNSA 1AYN3 4XUNA 1XE0A 1GU3A 2IWGB 3CJIC 1BEV3 4PIYA 1NLQA 1LODA 5KXCA 3WF3A 4IV1A 3VDDC 2WS93 5AC93 1RUH3 2G9ZA 4HVRA 1FI2A 1MQTB 1ULFA 3MI8A 4QWNA 1OBNA 5IAVA 5FOJB 1S2BA 1V6MA 2ZZQA 3BTZA 1PVC3 1FMD2 2VZOA 3KHBA 3OD4A 4AZZA 4E4DX 4U2AA 2VW2A 4YPJA 2B45X 3GZTB 2W52A 5FWEA 3FUQA 3J7HA 4HLTA 3SXWA 3NVCA 1QJY1 3BVCA 1OMIA 4E8DA 1LU1A 2EXKA 4UT5A 2RDQA 4Y5TA 3ACGA 4RN5A 2RS12 1V6JA 5IVYA 4Z2AA 2OZ6A 4Y1VA 2VZUA 5BXXA 1RMU1 1HRV2 1F4HA 1ZRFA 2ID4A 1MVEA 4P9LA 1O8PA 1OI6A 1UIJA 1D4VB 4AF9A 1FPN1 4HBNA 4QD2A 1QY4A 5FREA 2AEZA 1UYYA 3JD72 3QD6A 1HJGA 1W8NA 2VVEA 2XBO2 3J4UH 1AHSA 4S2HA 3LF7A 3OTFA 1ZZ6A 1DBNA 1OURA 2LALA 4IEZA 5ACA1 2OUHA 5FR3A 4F7ZA 5HPOA 2YUEA 2GP5A 3VDDA 1JYTA 3JBG2 3K46A 5DABA 3RJ2X 2IXLA 1I3HA 1S0DA 2Y6HA 3BOWA 2VW1A 3FBMA 4KGQA 4QXKA 3DECA 1LCLA 2ZA9A 2ET7A 4NHLA 5CFCB 1YNAA 1ZBA2 4CCEA 4D94A 5DDJ1 2BVBA 5E16A 3HR9A 2P3YA 2O8QA 2PLV2 3ZSKA 4GWNA 2CNAA 3OOXA 3M4FA 3BYWA 3ACHA 1UXZA 2ZAHA 4XHXA 2HWE1 1DF0A 2IXIA 4KBZA 2ZGKA 1QJEA 3OB8A 4LBQD 1IS5A 5DZFA 2ZGPA 1I1EA 4LBQB 2X05A 4Y3OA 2TEPA 1ZA7A 2RVAA 1WBFA 3O1VA 3MIHA 5DZEA 1F8VA 4DB5A 4DIQA 2WLPA 1C4RA 1FOD1 2BRTA 2ZGSA 3BPZA 2J1EA 1CPNA 4MGZE 4O9EA 2AR6A 5JI7A 4NJ4A 2JDMA 4CEWB 4E2GA 2P34A 3DN7A 5CA6A 4N53C 2OW4A 2ZGMA 4LPLA 4QKFA 3P1IA 5F3IA 1ZRCA 4IE4A 1IG3A 1AR72 1VRH2 3OY8A 4ITCA 1UAIA 3AVSA 2XL7A 3LEIA 3T3YA 2YMZA 3PJQA 1W6OB 4AFCA 4J1WA 4UW5A 1PM7A 4ISRA 2XR4A 2R061 4O61A 4S2DA 1WLDA 3UKNA 2CTVA 2WNUC 3UK9A 2CDPA 4FOVA 5LA9A 5KHIA 3ZYJB 4Y1XA 5IHRA 1RUE3 3IWZA 1QJX1 2CWSA 3VZNA 2E7TA 5LB6A 4W65A 3AMMA 1RUJ1 4IESA 2OS2A 2MEV2 5L9VA 1W6NB 1A8DA 1UNBA 1W2OA 3PHMA 4HK8A 5L73A 2WAAA 3GF6A 4UWDA 4UFKA 5FYCA 2RM21 4EYUA 3ECQA 2I2SA 5CG8A 4FI9A 3S0MA 3E5UA 1SFPA 3AP4A 3ZFEC 2CDOA 1YQ2A 3PTRB 1W2UA 5A33B 1XYNA 1TVGA 3NAPC 5LA2A 5CBLA 1ASJ1 3E6DA 3ME2A 5FYSA 1REDA 3LDKA 3IDCB 4OUEA 1MEC3 4TXWA 5FZ0A 4EZHA 5LA0A 1LHWA 4PQ9A 4N53A 5DPNA 3ZYGA 2EIBA 1ST8A 2A70A 1UW8A 2D44A 1UX7A 2B7YA 3AZWA 4N43C 4XFCA 4R52A 5H9PA 4QGMA 3VHNA 4ATEA 5FPAA 3DEMA 2A6XA 1BJQA 5IAXA 1TE1B 2DCJA 4OHYA 1VBE2 3OBAA 2VCAA 1DQ5A 3GBWA 1CAVA 2GNBA 2OT7A 2UU8A 1BHGA 3HIFA 3I2HA 4AK3A 1LAJA 2AC1A 2JDKA 2PA7A 5A3NA 1VBD3 4YVSC 1JUHA 1GR3A 1W3VA 1M4WA 1ZRRA 3QCWA 5DUUA 3SC7X 5GLVA 4IE6A 1POQA 3T2OA 3GZUC 4FPGA 3AKPA 5IT6A 4A6SA 1Z0HA 2W46A 4QAWA 3KVAA 2E32A 1EV12 1BK0A 1K5MA 4JDNA 4JGYB 2WRAA 1SZBA 3WR0A 4QDQA 1IPKA 1ZREA 2OA2A 3ZFEA 2DTYA 2NN8A 2A6YA 1W2NA 5J09A 3MLKA 3PNAA 2D3SA 4B7KA 5JAXA 3RZJA 2YFUA 4RQPA 3V64A 3NAPA 4Q4X2 1FNYA 3KB5A 3N9LA 2JX9A 1GWKA 1KJRA 1AR91 3K3NA 3AKSA 5FP3A 2DCTA 4FAHA 5BNOB 2XJUA 1EAH2 1Q56A 3N7KA 5A3WA 2XVGA 5FZFA 4DXRA 1JHNA 1OLRA 3LQCA 2AUYA 4L0PA 5A7PA 4LJHA 5KWRA 1O7FA 1ZBE1 3OPZA 4M0NA 4OHVA 2Q4SA 1REEA 4JCKA 5I8TA 4UF0A 3IDBB 1GICA 4Z82A 4FFGA 4DUXA 2Y6FA 3ALQA 1POV1 4YVSA 4BK5A 1OKQA 1NE4A 1D4M2 1NZCA 4XJZA 4AI1A 4E4ZA 1YFUA 2YHJA 3AX4A 3UKTA 4C0HA 4CCLA 3T1MA 5IK8A 5EYXA 5FO8B 4YG0A 3MHZA 5FZLA 1CAUB 3POIA 5JMOA 5A6YA 5GLWA 1XSRA 3Q8FA 5E6HA 3WNNA 1JYCA 1X36A 4M3CE 2VOWA 5A3UA 5F3GA 3V0BB 5E89A 1K12A 4LITA 3ZVXA 2C24A 4CCCA 3WP6A 2VZTA 2VBDA 3CHXA 3QH6A 1PO22 2K46A 2ILMA 3ZOIA 4KU8A 1QQP1 5FZBA 2A1XA 2R072 4AE2A 5JR2A 3D82A
chains in the Genus database with same CATH topology
1NLSA 1QNYA 4YNIA 3AP7A 2QCSB 3T2TA 4FTBA 1NCRA 4LHKA 3SCFA 4L8QA 1CN1A 3IN9A 3FJSA 2R1BA 4HKLA 5I93A 2AH2A 3HT2A 2I07B 3RJRA 1W6MA 1YI9A 1ND3C 1UMZA 2KA3A 2X8KA 4YZ4A 2ES3A 3OF1A 3VN4A 2VVFA 3ZN6A 4QQOA 4CDXB 2DTWA 1SDWA 5FPZA 4E4SA 4XFBA 1N3PA 3ZN4A 4TWTA 2A3WA 1MVQA 3NO8A 1V6OA 2HWD3 4FPCA 3TAYA 3CEWA 2QDRA 2KXLA 5AVPA 4B4QA 2VXRA 4LE4A 1LEDA 1H2NA 3HQXA 1IQAA 1TME3 4X8PA 4WVMB 3USSA 1C5HA 1PNGA 4P14A 4LEJA 1VBC3 5A32A 1ND2A 1BYHA 1B09A 3WT3A 2NQYA 1ND3A 3N7JA 2WFF3 1XRUA 4A7ZA 1OOPC 2NPIA 5HBAA 2D5FA 4B29A 4YZ1A 4Q0SA 2P3JA 3IM0A 1CJDA 2WT2A 5K9YA 1AXZA 2Y0OA 1JUIA 2CY6A 5AFBA 2R30A 1UF2C 1DHKB 2H6BA 5JMCA 1N3OA 1BQPA 5IK5A 1RMU2 4EN0A 5F1RA 1NE6A 1XNCA 2QJVA 1FPN2 3MF9A 1C8M1 4Y22A 2BNNA 1QJY3 1KRIA 1QJU3 3K51A 3SH3A 5JZGC 2P3IA 4YARA 1C28A 1VBB3 1XYPA 2XLFA 2WKKA 3OYWB 3PMSA 5ACA2 3M3OA 1MS4A 1SLAA 3VV1A 1FAYA 1SFYA 2HWF1 2JEMA 3M70A 2LTNA 3I7DA 1SLBA 1COV1 1EYBA 4GH4B 4Q1RA 1OOPA 4G4FA 4B4PA 1CAXA 2CGNA 1QH6A 3WDWA 1AX1A 2HWE2 1X50A 1GZCA 2QVSB 3IDEA 4RGGA 2GMPA 5FQ0A 1UX6A 1G9DA 3TB0A 1ALYA 4RR3B 3ES4A 1SBEA 1HXS3 5D8AC 2VMHA 5DDJ3 4I02A 4Q4V3 5EZWA 4KL1A 4Y1UA 5GLTA 1IPJA 2ZOEB 4AHYA 3TNQA 5JZGA 4YGEA 3SCHA 4JTNA 5T54A 1HIXA 4W6XA 1RUI1 1HKDA 4JDMA 3HBZA 4Q0PA 1FOD3 2R062 1YI7A 2ZMLA 3LA3A 4OUMA 3RZZA 4XILA 2A6WA 1CONA 3FLPA 4MVTA 2YGLA 1CD3G 1RINA 1QJX2 2GC2A 4I09A 1RUJ2 5JSRA 3ENRA 3R4UA 1DLLA 4G3YC 2VW0A 1GBGA 3VBUC 4RFT0 3A0KA 3VBFC 1VAVA 3H3UA 1OLQA 3RYRA 3VZOA 4OHWA 3WHTA 4Q27A 4OI1A 4AW7A 1NXD1 4XMAA 3THTA 3VKMA 5D8AA 3WY6A 3AM2A 4M01A 1VR3A 1KITA 1YXWA 1RVF3 3ES1A 3EXUA 3SH5A 4MZUA 5L7OC 1BVVA 1LJ7A 4ZU5A 1HRV1 4LHLA 5BNNA 1OA2A 1V70A 2RM23 4N90A 4META 4A7KA 3WQ1A 3UV9A 1H8TB 4P9YA 3ZDSA 3JD71 4NHMA 3E97A 1RB8G 3W9AA 1ASJ3 4LO7A 4YM0A 1X8MA 1XE8A 4DPNA 1QOTA 2NLRA 3JBG1 4LBLA 3HAGA 3ZO0B 3FZ3A 3RRDA 4Q4W1 2BPA2 1AZDA 4QU2A 2O1QA 3M1HA 1I6XA 2AREA 4TSVA 3VBUA 3LGRA 1Z78A 1ZBA1 2ERFA 3VBFA 3RPQA 2E63A 4XQ4A 5F6KA 3U0ZA 3AYCA 3IT8A 4D69A 2Q0AA 3B7MA 3H7YA 4MYEA 1F5JA 2GH8A 2VOXA 2XG3A 3GHNA 3VKOA 3KSCA 2PAEA 3TNPB 4GXLA 4KBBA 2NP0A 1AR92 1TMF1 3ELNA 5E8AA 5FMOS 3CL1A 1V9U2 5HCAA 1DZRA 3WG4A 1ZBE2 5CNAA 4LNVA 4CDQC 1ULDA 2GC3A 4OFGA 4CDUC 1MZFA 1AR71 1VRH1 4GB33 5JPMB 2E51A 4FTEA 5CVRA 4YYOA 3MZHA 4QQHA 2W08A 3MGUA 5HXVA 4YLZA 5C9AC 3ZSLA 4QQ2A 3B9IA 1N47A 3AMPA 1CQ9A 4DY3A 4DRVA 1J1LA 1PIV3 5I0RA 5E1RA 1C1FA 1POV3 3QBQA 5JOYA 4FPFA 4N43B 5FMOL 5GLUA 4QPGC 3CNAA 4ZXKA 1RUC1 1WLWA 1FXZA 4XTPA 1EP0A 4AI2A 4JGZB 4AHXA 3ZXFA 4HFSA 1H30A 3M3QA 1HQNA 1VAMA 3LAGA 5GZGA 2RJKA 1QDOA 2VMGA 1Q8VA 2C1FA 4FOYA 4CDQA 3POYA 4U36A 1VP6A 4WZFA 1B35A 4AEDB 5C6CA 4LE3A 2ZAAA 4FPLA 1QQP3 4AI0A 2ZX3A 1VBE1 2ATFA 2IXCA 3O0WA 4OVEA 3I2DA 1DZTA 4W6WA 3VBRC 5C9AA 4ZU4A 4INDA 1V00A 1UIKA 4WM7B 3D8CA 3ST7A 4WV8A 4PDWB 1ULGA 1AXYA 3WW2A 1OFSA 4QPGA 1EPZA 1EV11 4YW1A 2VPVA 3N3HA 3LSEA 1XU1A 2CAUA 1DYPA 2R041 2RS31 4YVWB 4XDQA 4AI8A 3HD8B 1AYM2 1QXPA 1PGW1 1PO11 3OBTA 5J3UA 4EWDA 2MPFA 1LR5A 1WCSA 3V0AA 3M7AA 2D93A 2JG9B 3V56A 1POV0 4HKOA 3WLUA 3TWIA 4XZPA 1V6KA 1RHI3 1NCQC 3DPRC 3VZMA 3CU7A 1JBCA 3SISA 4AVCA 3ZIXA 4K1YA 3RYKA 2ZBJA 4QM8A 2DFBA 4XBQA 4NWVA 3ZX7A 3LKJA 2XJPA 5DZGA 3URFA 4CDWB 1WGPA 1G6NA 1MACA 4B8EA 2B39A 4E2QA 1CVNA 4K6BA 3WQ7A 5BNQA 1EY2A 4S2FA 1A78A 2VNRA 1W6PB 2DVDA 5ABJC 5TSWA 5E88A 4AFDA 3MDPA 1C8M2 3KGLA 5C8CC 4L11A 4I0WB 4BCUA 1PO21 4FXKB 1WW6A 2IC1A 4R9BA 5FLIA 2B42B 2D6MA 3APBA 3WINE 4BLJA 4EJRA 1NA1C 2ZGUA 4PJYA 3GBFA 4EN8B 2HWF2 2MHFA 5BY5A 1ZRDA 3TOJA 3VBOC 1XU2A 3RMXA 3M3EA 3WD5A 3GZAA 4KWKA 1ZX5A 1O3SA 4M3CF 4ASMB 3AKTA 3VBHC 2HWC2 3H1MA 4LLFA 2VNOA 1N1YA 3L2HA 4Q4Y1 1YJKA 3J8F1 1BZWA 1COV3 4C1WA 4OUSA 1J1TA 3JQWA 4LR4A 2ZABA 4IV1B 4MSVA 5ABJA 4MV2A 2JKBA 1R083 4FP2A 2QNKA 4RL7A 1SACA 5T3NA 3JB8A 3E6CC 5C8CA 4FPKA 4KWJA 1SMVA 2H6CA 3ZMOA 1RUI2 2LUWA 1NA1A 4XFIA 3WX5A 3VBSC 1HQLA 5FAXA 3RQ0A 1RUNA 3KGZA 1LOGA 2V09A 2YPJA 3ZSMA 4YM3A 2BFUL 1QKQA 2GH2A 1Z7S3 2Q30A 1HV1A 2PHXA 3VBOA 2P3KA 4OI0A 4Q0QA 1QOSA 4LLOA 4HPKA 2XJSA 2BNOA 2DVBA 4LT5A 5BUVA 2RMU2 3VBHA 3ZXAC 4ES8A 2A5ZA 3ZFFC 3AFGA 3ZMNA 5KBFA 5GM0A 3MIGA 1DQ0A 1F5FA 1JW6A 3AJZA 3VDDB 2DUQA 1FMD3 1DQ6A 2DCZA 3H1YA 4WM8C 3VL8A 2VU9A 4PLOA 4RD7A 1FT9A 1AL21 1N1SA 3THPA 5BNPC 2YZ4A 5HCBA 5J7MA 1KS5A 2PHFA 4BM8A 4FOQA 2EAAA 1O91A 2RS13 3CJIA 5FPXA 3B9CA 1O4ZA 1HRV3 3VHRA 2HWB1 3MW4A 4Q4W2 4JRLA 4KNCA 5GLZA 1J58A 3JD73 3WHUA 4AQ2A 3FX3A 3LB9A 4IV3C 2XBO3 2C5DA 3A4UA 4KG0A 4AVBA 5CFCC 2VOKA 1J3RA 5KC5A 1ZZBA 3ZFFA 4Y24A 3JBG3 2YGMA 3OY8B 2RR11 3SH4A 1LB2A 1WW4A 4R9AA 1PZ7A 2HYKA 4FSJA 2PFWA 3WUCA 1LGCA 4COWA 3VHOA 4OLLA 1ZBA3 4EN9B 4WM8A 1TMF2 1NQJA 2O0OA 3AZVA 3M3CA 2PLV3 1MS5A 4V1PA 4YRDA 4R9CA 2BBVA 3IPVA 1BCXA 4JDOA 5BNPA 2Q1MA 4XF3A 3NKTA 4ORFA 1H9PA 3BU7A 3AXDA 5T5OA 3PJYA 3K48A 3KCYA 4YW5A 1PVXA 1ULCA 4A3XA 1DGLA 2NMOA 1WUVA 3C3VA 4IV3A 4IEYA 2ZGQA 3ZYIB 5KXBA 1AR73 1VRH3 3BIWE 2JICA 3E6BA 3INAA 3WDUA 4N53B 3ZIWA 4KH9A 1V6IA 4MXWA 1WLTA 3EO6A 1FATA 3BCWA 3VZLA 1RUC2 1UU6A 4ES9A 1XE7A 5FDBA 4IEOA 1CAVB 3J26N 4FAGA 2QDNA 1X7NA 5JR7B 4QX5A 1URXA 5B2GB 4XF4A 1BVP1 2UY8A 2MEV3 1VB4A 3HT1A 4QT6A 1DGWX 1HW5A 3B01A 3IMNA 4EN7B 2WA3A 2VNGA 1RIRA 1K5MB 4JAAA 4X6RB 1JN2P 4CZSA 2GC1A 2VUAA 1AR61 5KHHA 3ZFEB 2SLIA 2NZ9A 3GNEA 4XFAA 5GALA 4RS5C 3JUUA 5DXDA 2FQPA 4RQPB 2K0GA 2WNUA 3USUA 1R1A2 3NAPB 4FPOB 1AR82 4BIFA 1UKRA 2A75A 2ZKNA 1WMDA 1DFQA 5HI0A 1VBE3 4I01A 4E2SA 3I4IA 2DVGA 3MIBA 4N7IA 4AYUA 2E9QA 4PBPA 3WP3A 3Q9OA 5JPNB 3U11A 4NR1A 2R042 2RS32 4YVSB 1U5ZA 4L9BA 2ZHNA 4I30A 1TEIA 4WVVA 1PGW2 2XH6A 4LUKA 5T5JA 1PO12 4GQ7A 1EV13 5DG1A 3RMYA 5BNOC 2OYZA 1V9U1 1AL0G 2R1DA 3OBRA 1WBLA 1VBA1 4DZGA 2TNFA 5JI9A 2CYFA 4Q4X3 4FP3A 1WMEA 1AJKA 4LBNA 4RS5A 1RUG1 2QUOA 1Y9QA 3RI9A 1TNFA 4QQPA 1EAH3 1G8WA 3AMQA 2ZKLA 4XQDA 2XL9A 1LENA 1C1LA 3QH7A 2ZHMA 1O3TA 4P9XA 4XJUA 2WC2A 4AQTA 3VGIA 1UPSA 2B46X 1NCRB 3DF0A 1KDMA 2WNVC 1D4M3 1PK6C 4LO4B 1N3QA 3T1LA 5GZCA 2BGCA 2XJRA 1W6MB 4H55A 3TN91 3UJOA 3PVNA 1M06G 4LTAA 3VKLA 4XW3A 3MEPA 1A8MA 1H2KA 4XHBA 4KU7A 1ONAA 4Y1ZA 3ZN6B 3FFQA 4K21A 4CEYC 2GZWA 4Z2WA 4XOGA 1R091 1J3PA 4WVWA 4M0HA 1S2KA 1IOAA 1JXNA 1PO23 4Z8BA 2G4IA 1JH5A 3D6EA 3WCRA 3WOGA 1GFF2 1LKNA 1U0AA 1W0OA 2R073 4QGNA 5IK7A 3POSA 2GC0A 4IERA 4Q4Y2 2GNDA 3H0OA 3J8F2 5C33A 3MIFA 1RJ8A 4XJ8A 3NV2A 4L99A 2WNVA 1PNFA 1Y43B 1PK6A 5A32B 1ND2B 3SCGA 1ND3B 4GMP1 3MLJA 2HEWF 1LHOA 2ET1A 3MIEA 2PYTA 3X29B 1AYM1 4CEYA 4M00A 2P37A 3AYEA 4A2UA 2JJ6A 5IK4A 4JQRA 4AQ6A 4LBOA 2JE9A 2ZGLA 4MXVA 3WDTA 4BIOA 5KHGA 1RITA 1ZM1A 3L9JT 1GKBA 4RHV1 1HDKA 3ZYRA 4I3PA 3SMHA 5JOXA 4Y22B 1CIWA 4M3CA 1KXGA 2D6KA 2W39A 5A3LA 2WSVA 2XWJB 2AENA 2X29A 3KD4A 1GZWA 4XMIA 3D5OA 3TBDA 3S7EA 1KS4A 1RUF1 3RS6A 3SLIA 2X5IC 3NWKA 2H0VA 3U07A 4Q0VA 5I0SA 3UL2A 4SBVA 2G9FA 5BYNA 4RSUA 1AL22 1OOPB 1CAXB 4HN1A 5FO7B 5IUQA 5L19A 3R4DB 3LSDA 4QMAA 2BW8A 4AG4A 2ENRA 2CAVA 1BBT2 1VAKA 4R8HA 4Q8KA 3VUOA 1RMU3 1W6QA 5FQ0B 2HWB2 4BMEA 2EVXA 1FPN3 1UN1A 1W39A 1QF3A 1O3QA 4YG6A 2BNMA 2PAKA 5JZGB 5ACA3 1L3JA 1CAWA 3MPBA 2HWC1 4Y20A 3N35A 2RR12 3DV8A 3WXPA 1YO8A 4NN0A 4Y1YA 5EV7A 4ATFA 2ZCWA 4LA3A 2E6VA 4Q8LA 2X5IA 3BB6A 4YZ3A 3AKRA 3C2UA 3MFAA 1S0IA 5T55A 4OULA 2WZR2 5K7PA 4AFAA 4ASLA 4EN6B 1CESA 5JSOA 1GYKA 2YYOA 2HWE3 4R9DA 4P9GA 1F2NA 4OI2A 2PHRA 2V5YA 3H7JA 3FUOA 3KMHA 2UYAA 4XJAA 2IXJA 2H0BA 1PHMA 3JCIA 4Q29A 4XJWA 3J9SA 1RUOA 1DZQA 2JENA 4KQ7A 5D8AB 1NQDA 3PMEA 1GQHA 2G9GA 1CJPA 2XVKA 3AP9A 1REFA 1G86A 4BMBA 2BVVA 1JYIA 1PZ8A 1UU4A 4CRQA 1BEV1 5BNNB 5C4WC 5FOBB 3ACLA 2DVFA 1GLHA 2EF6A 2NMNA 2RMU1 2V73A 4YW2A 3ZXKA 2WS91 4TYSA 1RUH1 5FFOC 5AC91 3S0MA 2R063 4EWEA 5T5PA 5KC6A 4LA2A 1X33A 1OPOA 4Y4YA 1PVC1 1IGOA 3VLBB 1QJX3 2JECA 2FZ1A 4IL7A 1RUJ3 1NY71 4FPEA 2IZWA 3NJZA 1LU2A 1OQEA 2ZX1A 1S0EA 3VZKA