2DYCA

Crystal structure of the n-terminal domain of mouse galectin-4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
147
structure length
147
Chain Sequence
YNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Crystal structure of the N-terminal domain of mouse galectin-4
rcsb
source organism Mus musculus
molecule tags Sugar binding protein
total genus 24
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dycA00
3AXDA 1RIRA 2ZGQA 2ZAAA 3B9CA 3OPZA 2ZA9A 1IS4A 1C4RA 4UW5A 1QKQA 2PHTA 1W6OA 3VKNA 2JJ6A 4YZ2A 4DQAA 3WHUA 1WBFA 1UZYA 4XHXA 5T54A 3ZXJA 1C1LA 1N3PA 1UKGA 1GZ9A 3AZVA 2ZGNA 3A0KA 5HCFA 4TZDA 1ENRA 4YM0A 1F31A 3ZSKA 2AREA 1MS8A 4XJ9A 4XJAA 1IS5A 4YLZA 5DUWA 1LJ7A 3V0AB 2R1BA 2E53A 1ULDA 2AH2A 3BODA 4Y1YA 3L2YA 4YG6A 1IS3A 3N7KA 4YG3A 3SH5A 2JE9A 1HQLA 1YRZA 4WVVA 5EYYA 2WNEA 4XE9A 1ENQA 3WG1A 3BOPA 3AXEA 2CL2A 1MS5A 3HMYA 1S0CA 3OY8A 1Z0HA 2R49A 3O0VA 1ULEA 1W6PA 2ZGSA 3RG0A 4UW6A 3VKLA 2NZ9A 2OVUA 2R1DA 2D7FA 1QU0A 5JMCA 2E51A 2PHXA 3APBA 4M3CE 1RITA 1SLBA 1LHOA 2DU0A 3IKWA 3INAA 3AFKA 4D69A 5KXBA 1W6OB 3A0NA 4YZ3A 4YW1A 1Y7BA 3D4KA 3M1HA 3M3OA 3UJOA 3W58A 2WQZC 4AYUA 4YZ1A 5T5PA 4ASMB 4C1XA 5JOYA 1V6LA 1SLLA 4FPOB 1IKQA 5GJ6A 2JD4A 3DUIA 2CYFA 2GN7A 3D5OA 4XBLA 1D2SA 2DUPA 3WNXA 2VW1A 1MS9A 5GLTA 2A3YA 4K1YA 2D44A 5SV8A 2DUQA 1WD4A 1IKPA 3AP6A 1BQPA 2ES3A 2ZGMA 3WG4A 3NV4A 3FBYA 2D3SA 4YGCA 2GMPA 2AUYA 2VXRA 3OY8B 3RQ0A 1S0IA 2D6KA 4L8QA 4XJ8A 1KITA 1N3QA 1O4ZA 1C57A 1GNHA 1UX6A 3N35A 3FLRA 4GALA 4KBBA 4M00A 4YW2A 1A3KA 1CVNA 2GN3A 2E7QA 2A6ZA 1MS0A 4M3CA 1LOBA 4R9CA 1UZZA 5IK8A 1QMJA 1JYCA 2JE7A 1V6IA 2ZGUA 4FPEA 2GNTA 2VY0A 1YYNA 2D6LX 1WW5A 1Q8OA 3NWKA 2D6PA 1Q8VA 2ZMNA 2AGSA 1AX0A 3USUA 2ZHLA 3ILRA 3SISA 2A3WA 5GM0A 3PVEA 3ZXFA 1S0GA 3V65A 2OW4A 1LULA 2DVBA 5T52A 4DRVA 1AX2A 4JC1A 1JW6A 1S0DA 3ZXLA 1TEIA 4CZSA 2R0FA 1AX1A 2NN8A 1WUVA 4Q1PA 2A71A 3A4UA 3POWA 5IK5A 3FUOA 4ITCA 2ZHNA 3PMEA 4Y1UA 4PF5A 1C1FA 2ZGPA 4FP3A 1WBLA 1MZ6A 1N1SA 1G9FA 1W0PA 1JBCA 1WW4A 3POSA 3PJQA 3WDUA 1QOOA 1ENSA 2A6VA 2EIGA 4FVVA 4JCKA 4P9YA 1QGLA 1UMZA 4RA0A 3QCWA 2E7TA 3O0XA 2SBAA 4PBOA 2D6NA 3MW4A 4XIKA 1HDKA 3LSEA 4FPJA 4DRRA 3M2MA 4Q8KA 5CA6A 3AZYA 4GWNA 3IN9A 1MS4A 1N1YA 1OFSA 2W52A 3N7JA 4BLJA 1XQNA 1CESA 2H0BA 3OGGA 1APNA 2EAKA 4Y1XA 2BQPA 3O5SA 2DVGA 4K21A 1YI7A 3I8TA 4ZXKA 1OKQA 4BMEA 1DBNA 2HYKA 2KM2A 5JDBA 3U4XA 5JVVA 5IUQA 3AYEA 5JOXA 1DQ0A 5GZCA 4LBMA 4K1ZA 3MW2A 5DG2A 3SH4A 1AXZA 1I3HA 1QOSA 5T50A 1OQ1A 1LENA 3SLIA 1UN1A 4CTEA 1DQ2A 3W59A 3TAYA 1AXYA 2DTYA 2Z42A 1JHNA 1CPMA 4XDQA 5GZFA 3ZXKA 3N3HA 1LGCA 3ILFA 2NYYA 3M3CA 1SLCA 4HL0A 4WVWA 4Y20B 1MS1A 1FAYA 3FLTA 3Q9OA 2AYHA 3ZYPA 3AZZA 3AYDA 2V73A 1W6NB 2D6OX 5DZEA 4AVSA 4AWDA 5IT6A 5DZFA 4XYXA 2ZGKA 2WT1A 3DGTA 1KDKA 4BPZA 2ARBA 1FX5A 2YXSA 3T1MA 1MR5A 4JRAA 3WZ1A 4NOTA 4YW4A 5CAZA 1G9BA 4FOQA 5E89A 4ZKTB 3AYAA 2XB6C 1KRIA 1LOCA 4WV8A 2P34A 2TEPA 4AGGA 4XBQA 1BKZA 3OYWB 3JU9A 3MEPA 1KDMA 3PVOA 4Q2FA 2DTWA 1A8DA 3UL2A 1G7YA 3VKOA 2CWMA 1AZDA 5CNAA 1V6KA 2C9AA 1GZWA 1QOTA 1WLDA 4I30A 4LBOA 2XG3A 5GZDA 5T5LA 4UW4A 5DUUA 5GLUA 1FNYA 1LHWA 2WT2A 4YZ4A 2WT0A 4XJZA 1S0JA 1S0BA 5H9QA 1BYHA 4H55A 1I1EA 1WCSA 3ZSLA 3ZXEA 1DZQA 2UWCA 5H9RA 1JYIA 1H9PA 1JUIA 1LHUA 2GALA 4Q1RA 4U2AA 2E6VA 1FNZA 4IQPA 5GALA 3UK9A 1S0EA 5F9TA 3WV6A 3N7MA 1G8WA 3M3EA 4FPLA 5BYNA 4LBQD 2B7YA 4DS0A 2DUOA 1N1TA 3VKFC 3I4IA 2P3JA 5DZGA 1HKDA 1PZ7A 3NV2A 2GNMA 2PHWA 3RMXA 2P3IA 2ARXA 2D6MA 1N3OA 1HLCA 4SLIA 3NV1A 4YG0A 4FOVA 3RS6A 1Q56A 1GZWB 4Y24A 2ZGTA 5GLWA 4XZPA 2VUAA 1SBFA 1Q8PA 2CTVA 3OBRA 1R1ZA 3AK0A 3R05A 2UURA 2WSVA 3AP9A 2JKBA 2GMMA 2ZHMA 5FREA 1CR7A 1DQ4A 1VLNA 3O0WA 4P14A 3AZWA 4YGEA 3SH3A 3ASIA 4YGDA 4XOGA 2VH9A 1GKBA 1AJOA 1GYKA 1WLWA 4AVVA 1GNZA 1GBGA 2DYCA 3D6EA 1CONA 3ZPYA 1AXKA 1UL9A 2ZACA 1LOFC 3O12A 1BXHA 1H30A 4XTPA 2A6XA 1PZ9A 1FV2A 1W0OA 2A5ZA 5L73A 3AZXA 4Y1ZA 1YO8A 1SBDA 4ISQA 4U36A 1LU1A 4FPCA 5HCBA 4PBPA 1N47A 3NV3A 3ZSJA 3VKMA 1FATA 1LODA 2VW0A 4UW3A 1LECA 4Y20A 3MW3A 5E88A 3MPPG 1SACA 1W6MB 2ZMLA 3AP7A 1W6NA 5CBLA 2V5YA 2DV9A 2DWRA 3SITA 1DYPA 1JOJA 1WW6A 2D3RA 4XJUA 3N7LA 4GXLA 3RMYA 1BJQA 2G4IA 1MVQA 3LCPA 1KJRA 1LEMA 1RINA 2ENRA 4HANA 4Q27A 4RL7A 4YFZA 2VU9A 3WDYA 4M3CF 3WVJA 2VW2A 1JXNA 4DFSA 1CIWA 4XXPA 4GKYA 2EXHA 3H0OA 5KXCA 3JUUA 4Q26A 3IM0A 4TYSA 3VV1A 3ZVXA 1HQWA 3ZYRA 2R16A 1DQ6A 2DURA 3LSDA 4GKXA 5KXDA 3OYWA 1G9CA 1DFQA 2ZGLA 2A75A 2P37A 3WHTA 1GLHA 1LGBA 4LBNA 4OZXA 3WDXA 4AGRA 2FMDA 3OBTA 2AR6A 3AJYA 1AJKA 3BTAA 3AP4A 2A70A 2FHRA 2WLQA 2DVAA 2Q5TA 1SBEA 5F5QA 3FUQA 1LOAA 1BZWA 2AENA 1SLTA 2CWSA 5DXDA 2DU1A 1FYUA 2D43A 2OUJA 5EWSA 1QDOA 2YROA 2SLIA 3PVNA 4BM8A 2GNBA 4MYEA 2PHUA 5H9PA 1F5FA 1ULGA 1V6JA 2NMOA 2UWBA 1LOEA 2ZBJA 1URXA 4FPYA 1KJLA 4XHBA 1AVBA 4Y1VA 3RRDA 1CQ9A 4Q8LA 3ENRA 1QF3A 1JN2P 2DVFA 3WDVA 4BMBA 5T55A 5KXEA 4Y22B 4LBQB 4C1WA 1MVEA 1VAVA 1Q8QA 5EXOA 2JDZA 3C2UA 5LK5A 1ZM1A 1LEDA 4ISRA 2EXJA 3QLQA 3T1LA 1V6NA 5T5OA 1G86A 3WCRA 4YW5A 2OUHA 4FOWA 4Y26A 5HCAA 4PQ9A 4BLIA 1DYKA 4FPHA 4PCRA 1GV9A 1S0FA 2PHFA 3ZSMA 3CNAA 1SCSA 3ATGA 3WLUA 3B01A 4YM1A 4CRQA 1Z78A 1H9WA 2EXIA 4ATEA 4AVTA 3VUOA 1FV3A 3IPVA 1DLLA 1ULFA 1O4YA 1SLIA 1AF9A 1LOFA 3AP5A 1SCRA 4NO4A 4P9WA 5H9SA 3R4UA 1IOAA 1DHKB 4LBJA 5FRAA 1LGNA 5AVAA 4YM2A 1N1VA 2YMZA 1UAIA 1MZ5A 2R0HA 4FQZA 2A6WA 1DIWA 1NLSA 1QNYA 4K20A 2NM1A 3WDTA 1WLCA 5JLVA 2GDFA 3GNEA 3HR9A 4YM3A 3HN1A 4XIOA 3AYCA 3WG3A 5GZGA 2NP0A 1B09A 3BIWE 1UPSA 2PHRA 4GA9A 1W6PB 2PELA 1NXD1 3RSJA 2EF6A 3TB0A 1D0HA 1ONAA 2RHPA 2YV8A 2ZHKA 1W6MA 1G9DA 5IK4A 3UJQA 4Z8BA 1U0AA 4GWMA 5IK7A 2CNAA 4DPNA 1LCLA 2EXKA 1ZA4A 1A78A 3IPVB 1IS6A 2WKKA 4XILA 1WW7A 4W65A 3FFZA 4P9XA 1V00A 1GSLA 2JECA 2LTNA 4BQ1A 5JOZA 3OJBA 3V0BA 1PZ8A 1W6QA 1DGLA 5GLVA 1MS3A 2ZKNA 4LBLA 2A3XA 3WUCA 5DUVA 2UU8A 2W39A 4XMAA 1DQ1A 1WD3A 3KM5A 2LALA 2W08A 3IMNA 3WDWA 3WCSA 2YY1A 1MACA 1VALA 4YFWA 2ERFA 2YZ4A 4R9BA 4M01A 2WJSA 3B00A 4LBKA 2I2SA 1CJPA 2W68A 1GANA 5EYXA 3T2TA 1G9AA 2EALA 2NMNA 3R4SA 3B69A 2A6YA 1QDCA 2UWAA 1YIFA 3WOGA 2CY6A 2P3KA 1VAMA 4FOYA 2GMEA 1LHVA 4ATFA 4YGBA 3WG2A 4M3CB 1CN1A 1LOGA 2DVDA 3AJZA 3POYA 1KQRA 4R9DA 4XXAA 4AGVA 4YZ5A 5CB7A 1LTEA 3AX4A 1GZCA 1ULCA 4FP2A 3B3QE 3V0BB 2WSUA 4XBNA 1W6QB 1Q8SA 2GNDA 5T5JA 5DUXA 1CPNA 2A7AA 3N36A 5GZEA 4XMIA 1QNWA 3V64A 1LESA 5JOWA 2ZZJA 3USUB 1X50A 3WUDA 4FQ4A 4FPKA 1V6OA 4Y22A 3SNMA 1S1AA 4LBQA 1EPWA 2C5DA 3V0AA 4BOWA 1SFYA 2ZGRA 2ZMKA 1VIWB 4FPFA 5DG1A 4YW3A 1SLAA 3FLPA 3M3QA 1V6MA 4XJWA 3ILNA 4F83A 3GALA 4WZFA 1DQ5A 2ZGOA 5GLZA 1GICA 1LHNA 2ZABA 2P2KA 1LU2A 1J1TA 2D3PA 4R9AA 4XTMA 3KQRA 4FPGA 1F9KA 5E8AA 1YXWA
chains in the Genus database with same CATH superfamily
2Y26A 3AXDA 1RIRA 3NSTA 5EPAA 5K4LA 4IEXA 1KXGA 3OUJA 4QB2A 5KR7A 1QKQA 2PHTA 3WSOA 1XXNA 2R7EB 3NQHA 1IG0A 2VVEA 3I3DA 1TNFA 2JJ6A 5IVYA 1NZIA 3WHUA 1REEA 1WBFA 2X29A 3C7GA 4DQAA 1O91A 5I0UA 1C1LA 2WNUC 4NHXA 1GZ9A 1DCSA 2ZGNA 2YFUA 4COZA 4MGQA 1QJY3 4NPMA 2R042 2ZKLA 1AL23 2AREA 2DCZA 1H8TB 5CISA 5DUWA 3V0AB 1LJ7A 1MZEA 4W6YA 2AH2A 4HXCA 4PHZA 3BODA 4RS5A 1PGL1 5IAVA 3VDAA 4YG3A 4OHVA 2XXZA 4WVVA 2JEMA 1OOPA 1ZZ6A 2WNEA 2VZQA 1UIJA 4XACA 1UY3A 4RQPA 1VMJA 3HMYA 1G6NA 3OY8A 1W6PA 2WINB 3EHKA 4UW6A 1IPJA 5A7PA 2QQMA 4XURA 3BB6A 3VKLA 4N7IA 1HB3A 3MLKA 1QJY1 1SLBA 3U10A 1C5HA 4BQWA 1AL21 3AFKA 4NROA 5CZKA 1W28A 3CJIC 4ZU7A 2XUEA 1Y7BA 3M3OA 1OVPA 4YW1A 4YZ1A 5IVVA 4CEWA 5T5PA 1QJY2 4C1XA 3EB7A 4BDVB 3WX5A 1AL22 1SLLA 1V6LA 1VP6A 1IKQA 2Y60A 1XSQA 4FPOB 4LR4A 1CAWA 4UXAA 2CYFA 5HBAA 1JZ2A 1D2SA 3WNXA 4MGZE 5CEHA 1R64A 4Y3OA 1CX4A 3HBKA 5SV8A 3O1RA 1XNBA 3AP6A 5FO7B 5A7QA 3CIHA 3VBRB 4N43C 3ETPA 3E5UA 4YGCA 4QX8A 2QDNA 1GFF2 1OSGA 2GMPA 4D94A 2QCSB 3RQ0A 1U5ZA 4CCLA 2D5FA 1NAEA 1S2KA 1RXFA 1C57A 3O14A 4GB33 4GALA 3WQ7A 4YW2A 4HKLA 1A3KA 3ZFFC 1CVNA 2GN3A 3HT1A 4XVHA 3DPRC 1MS0A 3BTXA 1UZZA 1X9TA 3ZXDA 2ZGUA 2HWF3 4OI1A 1W06A 2JG9A 1FMD3 4I3GA 4BA6A 3H3UA 4PLNA 5JUVA 3VBFC 3P3PA 4JKKA 1AX0A 1JS9A 3USUA 4PQQA 5IW0A 3I97A 3PVEA 1S0GA 3GHMA 5T52A 1AX2A 4JC1A 4RFT0 3ZIXA 3NJYA 2R30A 2YU1A 1XNDA 1GZTA 1TEIA 1EV13 4NMIA 4GB32 2NN8A 4CU8A 2A71A 2WC2A 3G7DA 4TLGA 3POWA 1VRBA 5FMBA 4IV1C 2HWB1 2YGLA 2W95A 5IK5A 4Y1UA 4I01A 4PF5A 2JENA 2ZGPA 2VUJA 1WBLA 1FMD1 2WS93 2YGMA 3MIBA 5DAQA 1MZ6A 2J22A 1W99A 1G9FA 4E4DX 2BRTA 2HWF2 3M4FA 5F2SA 2X05A 4BWOA 3ACHA 4JQRA 4FVVA 1FMD2 4JCKA 2GSYA 1HXS1 4QXBA 3UGHA 3BIEA 1JODA 3O0XA 3OBZA 1PO13 3MW4A 4CUCA 2ZXQA 1EV11 3LAGA 5J3UA 4YPJA 3QH6A 5FZ7A 2Q1ZB 2RS33 1N1YA 3IN9A 1EV12 4GD4A 4BLJA 1H8TA 1K42A 5DQ0A 2WZR3 1VMFA 3H50A 4ZPIA 4I0WB 1WZXA 4ZXKA 2WS92 1DBNA 2HYKA 2KM2A 4CA9A 5JDBA 4JGYC 1RB8G 2DCKA 2VNRA 4LBMA 2CGPA 1PK6C 1PO11 1XC6A 1W2NA 3EMRA 3OD4A 3KHBA 5K0UA 1UD1A 1RTVA 3VBHA 3WNKA 4JGZA 4QX0A 1VBA3 5LASA 4A44A 5L9VA 5FPZA 2BBAA 1PO12 1LENA 2VQUA 5JI9A 2OS2A 5FJHA 1S4CA 2G1MA 3TAYA 3WW4A 3WXPA 5ABJB 2DTYA 5DAPA 1DP0A 1IGOA 1H6XA 3VL8A 3ZXKA 2EVXA 4D6QA 2RS32 2RDQA 2NYYA 4E4ZA 1SLCA 2HBUA 3LPGA 3Q9OA 1QJZA 5FAXA 2WZR2 2AYHA 4OMDA 2QQOA 2V73A 1W6NB 4LXLA 4AVSA 3I3MA 1MQTB 2ZGKA 5FJKA 3LA2A 3GZUC 5D1IA 4CPBA 1VBA1 3QBQA 4IE7A 4O9EA 2LUWA 4UFKA 1PVXA 4QU1A 1BBT3 5JMOA 4N9HA 3LF7A 1MR5A 2W3JA 3IZOA 3LWCA 4NOTA 3WZ1A 4RGKA 2J1TA 1VBA2 4QB6A 3W9AA 1G9BA 4XF4A 3QOPA 5FZ4A 1ODNA 4FOQA 5ISLA 5A33B 5E89A 4P02B 3IAPA 2P4EA 3KLSA 4LOSA 5JXJA 1AR73 5FYMA 4AZZA 3T30A 4LLFA 1BKZA 4BXSV 2H6BA 3HQXA 4Q2FA 3PVOA 3Q8FA 3VD7A 2X10A 2C4XA 2WABA 3ES1A 1AR63 2OQ7A 4GZ9A 3VKOA 4EZ4A 3ELNA 4NIIA 1BBT1 1AZDA 2CWMA 5IFTA 1K45A 3JZVA 2ZTNA 5FKCA 4QQHA 4HKWA 1WLDA 4P08A 2V72A 4MHUA 4LHLA 1VPHA 5FP8A 4MZUA 3GF6A 2N7GA 1AR71 1S0BA 1GNYA 1YNAA 5FXZA 1JYIA 5H9RA 2X8KA 3WP6A 1AR72 2VZRA 1JUIA 5GALA 2WO3A 2E6VA 1FNZA 1XE7A 2QUOA 3WP5A 1S0EA 1AR61 4PDWA 3M3EA 4FPLA 4UF0B 5FXXA 2IC1A 2WNVA 2MPFA 5FOBB 4AAPA 1NA1C 2GC2A 1VBE2 1AR62 4I0AA 1S55A 1TME3 2PHWA 3KV6A 4XFGA 2P3IA 2ARXA 1KS4A 1N3OA 4CCDA 5BNNC 4SLIA 1XE0A 2WQ8A 4IERA 1H2MA 2JB4A 4FOVA 1O7FA 5E6HA 1W8FA 1WA4A 3ORJA 5F37A 3LIHA 1WMEA 4Y24A 4MSVA 2IWGB 4XUOA 3RFRA 1R1ZA 3AK0A 1RGSA 1UYYA 3E5XA 4XABA 3ST7A 5HI0A 2VZVA 2ZHMA 1RL3A 3K4DA 1OLME 1DQ4A 4KWLA 4CUGA 2X53S 4P14A 4YGEA 5FZHA 4D7SA 1JU3A 1KD7A 2VMHA 4QPGC 2VAUA 5LB6A 4JHTA 2VH9A 1GKBA 1JZ3A 1AJOA 2L9LA 4AVVA 3H8UA 1GNZA 1H2KA 2X5IC 1TME2 4LO7A 3D6EA 1CONA 4A4AA 3S0MA 3BALA 1UL9A 3J26N 3AMPA 4CP9A 1QJU3 3O12A 1H30A 3IDCB 1QJX1 2A6XA 4Y5Z0 4AL9A 5FZLA 5L73A 1W90A 1W0OA 2AEZA 3C7EA 5I8SA 4OQ8A 5BUVA 2BPA2 1XSRA 1YO8A 4ISQA 5F6KA 3HJRA 4FPCA 2BU9A 4IEOA 4WZCA 4CUBA 4CU6A 1ZYBA 1CX1A 3A22A 3J7HA 2VW0A 3NRUA 5IYYA 3BUCA 3MW3A 5E88A 3MPPG 1SACA 1UKRA 3R0RA 2FD8A 3P6BA 4WM8C 3VL9A 1DU3D 2ZEWA 2XONA 4FT8A 3EBRA 3AP7A 5L7OC 1W6NA 5CBLA 1OT5A 3RDIA 3SITA 4QX7A 1ND2C 1JOJA 1WW6A 5A1FA 2CAVA 2BBVA 4GXLA 4QHZA 1BJQA 4Q27A 1MVQA 3LCPA 5C4WB 3RZJA 4HN0A 4RL7A 3RYPA 4NIDA 5FPBA 1QJU2 4M3CF 4XCBA 1CZTA 1RUG3 2C1FA 4GKYA 2W1WA 3H0OA 5A33A 4ARXA 3CEWA 4TYSA 4CVUA 3TN91 1HQWA 3ZYRA 2QZ3A 5EFUA 3UESA 1H1AA 2Y34A 2ZGLA 2A75A 2OQ6A 5IFPA 4YNIA 4OZXA 1K5MC 1RVF3 1NE4A 3DKQA 3JCIA 4LIUA 3T3YA 4OULA 5CFDC 3PHMA 4P9GA 4ZZ5A 5FPXA 5JSOA 1PHMA 4CCMA 1RUG1 1SBEA 4YVSC 3FUQA 4BIOA 4E4SA 1HN1A 2QVSB 4BK4A 3I49A 1FYUA 2YROA 3HT2A 2GNBA 4Z07A 1JYXA 4Y5SA 5H9PA 1RHI2 3I2GA 5DDJ2 2HKXA 1LOEA 1RUC3 1W8WA 3I59B 4XHBA 5FUNA 3LA3A 4XFHA 1X7NA 5LBCA 3KT7A 3POEA 3MIEA 4IGOA 4UF0A 4LMFA 2DVFA 1DG6A 1RVF2 4XDPA 4K8FA 5T55A 4BMBA 5KXEA 2EA7A 5IWFA 4AEDB 4LBQB 2YFZA 5FZ6A 5EXOA 3JB4C 1WCDJ 2Q8OA 3C2UA 3HQRA 5LK5A 5EIYB 1ZRDA 4ISRA 2EXJA 1BLZA 4L11A 5T5OA 2WO1A 4CDWC 5C9AB 1LAJA 2OUHA 4XF0A 3CMGA 1K3IA 1GOFA 4FOWA 2RE9A 3LFIA 3N9NA 4NWWA 4Y26A 1RUC1 3U1XA 3SHRA 4AEMA 4FFIA 5DPNA 3VZMA 2VNOA 2XBO3 3B93A 4I02A 3SCHA 5FZCA 2VECA 3ZSMA 5A6QA 1RUC2 1XNTA 1BMV1 3LEIA 1SCSA 2Y38A 3U0ZA 2K2SA 2G19A 1O3QA 2PLV1 1BMV2 4AVTA 3ACGA 3IPVA 1NA1B 5FTTC 1DLLA 1PM4A 1SLIA 4P9WA 5FDBA 1SCRA 1JYVA 1OH4A 3WNOA 4J1XA 3THDA 2Q8CA 3WNLA 4KL1A 3L9JT 4S2FA 1VJ2A 2XBO1 2Z79A 2YMZA 3CLPA 4ORFA 1UAIA 1VRH2 1WCQA 3H1MA 4FQZA 3KZ4C 5HPOA 5DN2A 5HCHA 1XYNA 2WZ8A 1WLCA 2LW8A 2XBO2 1QXPA 3LGRA 4MGIE 3AYCA 2RJ2A 4A7KA 3CDZB 5FYUA 3O1SA 1B09A 3BIWE 2UYBA 3BN6A 3RVHA 1WGPA 2GC3A 4AI2A 2PELA 2YHJA 1GP4A 1NXD1 3BYWA 4M0HA 1UOJA 4RQPC 2ZHKA 3POJA 1G9DA 4UI9L 2WO2A 4Z8BA 4FTEA 2B9VA 1OD5A 1GQPA 1LCLA 5C4WA 2FDIA 4EE2A 2IXJA 4EQVA 5CU1A 4W6XA 1IS6A 2VPVA 3GYDA 2WKKA 3LD8A 4W65A 1H1IA 3FFZA 1V00A 2DBNA 4CEWC 4LQRA 2WAOA 1R1A3 4XZUG 5FQ0A 3TYJA 1DGLA 2PAMA 5FY7A 5GLVA 3S5QA 5A1AA 3H8RA 2W39A 3KM5A 5FR3A 2XLAA 3GZEA 3VB9A 1KEXA 4LITA 2LALA 2W08A 4V1PA 4C0BA 3JB8A 3ZR6A 4YARA 4CCKA 2YY1A 1MACA 3VD9A 2ZZQA 1EUTA 1UW8A 2I2SA 1R092 3U75A 4E4HA 4CP2A 2EALA 4CDUB 4ZS2A 2OA2A 1W04A 2A6YA 3C3VA 3WNMA 1YIFA 1VAMA 1H1MA 1UXZA 3NAPB 1SQ4A 3P5BA 3DXTA 4YGBA 3WP4A 3W21A 3WG2A 4DB5A 1CN1A 1OBNA 1R1A2 2W92A 1CZSA 4LIVA 3KSCA 4R9DA 5J7MA 5JAXA 5KHGA 1LTEA 3TEWA 3IIAA 1ACCA 1QWRA 5A3LA 2WSUA 3H3ZA 4AEJA 1W6QB 1PX4A 3HVDA 3PIJA 4QDSA 2A7AA 2WFPA 1W0NA 3FC0A 3OGRA 4XMIA 2Y0OA 4O9GA 5GZEA 4XAEA 4Q0UA 3U78A 2JG9C 2OXBA 5BNPC 4FQ4A 1PO23 2IXIA 4XFIA 4AG4A 3PUQA 2ADDA 1S1AA 4LBQA 4MOAA 2DFCA 3AMMA 4QXKA 4Z92B 4BQ5A 1IPSA 1WMFA 2IZWA 4XJWA 3H1WA 3GALA 2QZ2A 3NNFA 5GLZA 3TEYA 2ZABA 4HPKA 1J1TA 4H3WA 4MGSA 3ZN5A 2FDHA 1GWLA 3RYKA 1F9KA 1OFSA 4KBZA 2XJRA 1MEC3 4QPIB 2QDRA 3K3NA 1GQHA 3B9CA 1PO21 4AE2A 4YW7A 1IS4A 1OKOA 1BK1A 4QWNA 3O1TA 1C4RA 1UCXA 2WZPP 1JZ6A 2LS6A 1W6OA 2JDHA 4B29A 2XHKA 2MEV1 3KT1A 4XUNA 3WQBA 2VOKA 1UZYA 1ASJ3 3Q8BA 4XHXA 3ZXJA 1UKGA 2BZDA 1ZX5A 3BPZA 1UZ0A 4OUSA 4RSUA 1ENRA 3LEGA 5HCFA 1GWMA 3ZSKA 4AOCA 2WNOA 2XUMA 4UT5A 1QIQA 1H4HA 4BYYA 1C8M1 1MS8A 2PHDA 1IS5A 4XJAA 3TEZA 2E53A 4NHMA 1ULDA 4URAA 5LY1A 3MZHA 4BQYA 1H8TC 1JUHA 3IMMA 1W9SA 1H0BA 4Y4YA 1HQLA 1YRZA 5EYYA 2R6QA 1EAH3 2ATFA 4B4RA 1ENQA 3QH7A 3BOPA 3K4AA 5C3PA 1MEC2 1MS5A 5LEJA 1K5JA 3AL5A 1TQ5A 4NRPA 5I0SA 1Z0HA 1FOD3 3RG0A 4DNYA 1DF0A 4KWKA 3I7DA 1Q5OA 1JZ8A 2NZ9A 2OVUA 3T4HB 2D7FA 1OD3A 4LKEA 5JMCA 3APBA 2PHXA 1RUI3 3C7HA 1RITA 1LHOA 4ZZ8A 1ASJ2 2JX9A 4MXVA 1PX3A 4D69A 4IV3B 4HLTA 3A0NA 3ZN6B 4G3YC 3TWIA 4URTA 2WQZC 3FFQA 4ASMB 5JOYA 3AMQA 2RV9A 3VN4A 2NPIA 1IG3A 4IE6A 1JI6A 3MHZA 4NVPA 5IVFA 5JXHA 3RZMA 2VW1A 4L9BA 1XRUA 2HJIA 4BCUA 2A3YA 3KCCA 4RS5B 1EAH2 2MHFA 2VBPA 4D7TA 4P9JA 3ETQA 1COV1 1X36A 2Z5WA 4OI4A 3NW4A 1O5LA 1OOPB 1RUI1 1FOD2 3WG4A 3OTFA 4EWEA 5J96B 4XETA 3N9QA 4RQPB 2PYTA 3WF0A 4KG0A 3SKJE 5I93A 1Q3EA 3OY8B 3VBRC 1CWPA 1PM7A 2AC1A 1ENXA 1WWYA 1KITA 1N3QA 4XFBA 3MICA 1X8EA 2YC2A 3JXSA 3N35A 1SPPB 3OGVA 4GAZA 3D82A 3LPFA 1RUH3 3NAPA 2RS51 1JMUB 1SEFA 4CEWB 1KFXL 1YQCA 3URFA 5IK8A 1QMJA 1JYCA 4PF1A 3GZTB 1CAWB 5IATA 2GNTA 2VY0A 3PUAA 3ITQA 1YYNA 5I8YA 3LDRA 1WW5A 5KHKA 3RZLA 3IDAA 4CU9A 2AGSA 5DAXA 1UXXX 5FXWA 3VGIA 1W8HA 4QU2A 3K77A 4MXWB 2OW4A 1LULA 2DVBA 3V65A 5JCTA 3ECQA 2YBSA 1RUH1 4EN7B 1S0DA 2DF7A 4XF9A 3ZXLA 5BXXA 2XGXA 2BWAA 4LLOA 1WUVA 4IEZA 4Q1PA 1RUH2 3A4UA 4KQ7A 3FUOA 4BQXA 2ZHNA 3PMEA 2QKDA 3UKNA 1HW5A 1N1SA 3PJQA 3WDUA 1FPN2 5CVRA 3GDBA 4L97A 1QXJA 5FUIA 3HAGA 2A6VA 5AC93 4KU8A 2BOIA 4P9YA 5FZDA 3QCWA 2E7TA 2SBAA 5E1RA 1W8UA 4ET7A 2HWE3 3C8XA 4JKLA 1HDKA 4META 1DZTA 3LSEA 3SQOA 1UYPA 3NKTA 3KV9A 2JG8A 3M2MA 2O8QA 1AUYA 1BEV1 3AZYA 3N7JA 4C90A 3JD71 1W8NA 4Q5OA 4YWAA 2Q1FA 1YI7A 2E7AA 4MGYE 4R52A 3U4XA 3DL3A 5FXVA 3GBFA 1HB2A 4HVRA 2WN3A 1DQ0A 3CHXA 4OLLA 5FZ1A 5GZCA 1UMHA 4BQ2A 4AHXA 4LO4B 4K1ZA 5AC92 2HWE1 1L7LA 4RN5A 1QOSA 1OQ1A 3J7MA 3RZHA 3E6BA 1HB1A 1DQ2A 2VZUA 1AXYA 2RR13 2Z42A 3DCQA 3J7LA 4IV3A 5GZFA 3ZN6A 4OFGA 2E32A 3ILFA 4MX3A 1YQ8A 2QQNA 2QQKA 2TBVA 5ABJC 3VZKA 1WMDA 4NUBA 1SMVA 4RGAA 5FMCA 3IDBB 4AWDA 3PLQA 3DGTA 2JDMA 2O1QA 2ARBA 4Q4W3 1RUF1 2YXSA 3THTA 4F8AA 1D4M3 1MQTC 4PT6A 1T6BX 1QH6A 2LM3A 4YW4A 2RR11 3V56A 1PGL2 2JDUA 1YIPA 3FHQA 4HMZA 5K0UB 3MIGA 3VZLA 4ZKTB 3VBHB 2CDPA 2XB6C 3AYAA 4JGZB 5CYYA 2RR12 5C8WA 1KRIA 2TEPA 5FYZA 3ZO0B 5C5TA 4CCJA 1ND3B 1SPPA 2Z69A 3JU9A 1KDMA 2C9KA 2HEYF 2B8MA 3EJKA 2DTWA 2VVFA 3VBOB 4FXKB 2G9ZA 1RC6A 1O3SA 5IVEA 4LO5B 3UL2A 1G7YA 4CU7A 4Q4W1 5F3GA 1ZVFA 3VDDA 2XMLA 1D4M1 1V6KA 2C9AA 2CDOA 4GH4A 4BZ4A 5FZFA 5LCWL 2KXLA 4I30A 1ZBA1 5T5LA 3BI3A 3VZNA 1D4M2 5DUUA 5GLUA 2FDFA 4YZ4A 1O8SA 1YC61 1S0JA 5H9QA 4DUXA 4MXWA 3WEZA 4H55A 4AEKA 1DZQA 2YU2A 1OUXA 4NWVA 1YI9A 4J6GA 4QKFA 1HV1A 4HK9A 4QAWA 4XQWA 4IQPA 3OF1A 5J36A 3KS7A 4LBQD 2B7YA 5F6LB 4DXSA 1N1TA 3I4IA 2P3JA 4RHV3 1W2OA 5DZGA 2QNKA 3HQUA 3NV2A 4LKDA 2GNMA 1P8JA 2FDJA 2J1AA 5F3EA 4CDXB 1GMMA 5FWJA 5JPNB 1X82A 4KGGA 1EY2A 2XL9A 4PIYA 1Q56A 3ZIWA 3VZJA 3ZLIA 2HWB3 5GLWA 2ZGTA 4MO3M 2CTVA 3OBRA 2UURA 3GHNA 2EAAA 3F2ZA 2GMMA 1CR7A 5F39A 1US2A 5A6XA 1HXS3 3O0WA 2JE8A 5JIAA 5BPXA 3ZM8A 4RHV1 3ASIA 2W1UA 3T08A 5FP7A 4YYOA 5FYCA 4AAXA 1VR3A 4PDWB 3D3AA 3WNPA 3RJRA 4COYA 3LE0A 2WNVB 3S7IA 1HV0A 4CCOA 4D0QA 4YSFA 5JR2A 4LT5A 1BXHA 2H6CA 1NQDA 2HWB2 3AVSA 2A5ZA 5BNOA 1AR83 2ZEXA 2C26A 2XKPA 4QX2A 4U36A 4EN9B 2F4LA 1J83A 5HCBA 5L19A 2P5BA 1L7RA 1CAXB 1PVC3 5A7WB 1FATA 2WRAA 2VTXJ 3HNMA 3VD3A 5FZ9A 1LECA 1HXS2 1UZVA 1YCIA 4V2VA 1YFXA 4N7UA 2J1UA 1UF2C 2V5YA 2VMCA 3L2HA 4ZXEA 1SFPA 1NY71 1OLMA 4INDA 2DCJA 4OVEA 4XJUA 4A7ZA 3RMYA 2G4IA 3SNMA 5I0RA 1LEMA 1RINA 1AR81 4YFZA 2Y6GA 1NOVA 5LRRA 3MO4A 3WVJA 5CFCB 4Y5TA 3ZFGA 4DOUA 1GOGA 1JXNA 5C4WC 1HJGA 1CIWA 1PVC1 4XXPA 4CP9B 2BUKA 2CGOA 2EXHA 3MF6A 1OF3A 5KXCA 2Y6HA 5F8PA 1DZRA 1YQ6A 3HNBM 2VOVA 4WM7B 3VV1A 3ACLA 4I2OA 2DURA 2IFWA 2UY9A 1UNBA 1NE6A 1UY1A 2VZPA 3NO8A 4GKXA 3U14A 1ND3A 4Z1VA 3WHTA 2JDYA 3JBG1 1JYNA 4MADA 1NLQA 1LGBA 2QQVA 4IL7A 3H7YA 4LBNA 1V70A 3VBOA 4AI1A 5F5AA 3ZYJB 2JDNA 1GWKA 2XR4A 4LA2A 2RMU1 1NQJA 1ZZCA 4OMCA 5KWRA 2P3YA 1LOAA 2HEWF 3J7NA 2CWSA 4H7LA 1D0GA 4QKDA 2NLRA 2OUJA 3C7FA 1QDOA 3AKRA 1A6CA 2OIIA 1PMJX 1U5YA 1F5FA 2E9QA 1BVP1 2ZBJA 2VQ0A 4FPYA 2YDEA 1AVBA 3EQEA 1Y43B 2C0ZA 2GAUA 2BERA 2VMGA 4Q8LA 1VBB3 2YUEA 2YPJA 5FMOS 4A6OA 2W46A 4HVQA 2RVAA 2ARCA 3FHIB 4CDXA 2QFEA 3ACFA 3AMHA 3WR0A 2YC4A 4AEDC 1ZM1A 1LEDA 2BNNA 3QLQA 3WCRA 2O14A 1F4HA 4KU7A 1QEXA 1OA2A 1LKNA 2VG9A 4PQ9A 1DYKA 1BBT2 3B94A 4BLIA 2CSGA 5C9AC 4JQTA 2BGCA 3BPSA 4GJZA 4JVAA 4Q0SA 2FCUA 3SCFA 1GV9A 1VBB1 5ACA1 3GJBA 3ATGA 3WLUA 3B01A 2PN5A 4CRQA 1NZCA 3T2OA 2VUCA 4XCAA 3LA7A 1FV3A 1YQ5A 4DO0A 1ULFA 3AKTA 3AP5A 3B9IA 1LOFA 5CKMA 5J48A 3J9SA 2D5HA 4X8PA 5DAWA 5FRAA 3GJAA 5G05L 5FPUA 4JDNA 4YM2A 2J1VA 4QPYA 2IFRA 5EZWA 1N1VA 4BU2A 5A3TA 2XVLA 3ZMOA 3KHCA 2XWBB 2NM1A 3MGUA 3WDTA 5JLVA 2GDFA 1BHGA 3GNEA 3UETA 4YM3A 4XIOA 1CAXA 5KHHA 5A7WA 3ZN4A 4AHYA 3OUIA 5LW9A 4Y4RA 4GA9A 1QJX3 5A80A 4OI0A 2J42A 2W91A 2VULA 4UWDA 3WF2A 3O1OA 2DBIA 2YV8A 1OLRA 5FZKA 5FFOC 3UJQA 4CUAA 1LB2A 1Y9GA 2PA7A 4GWMA 4B4PA 1C5IA 5SV5A 4A2UA 2WWSA 2A1XA 4DPNA 5K8SA 1ZREA 1L7QA 3IPVB 4OHXA 4UYBA 4XILA 5CFCA 4HZFA 2YYOA 4B7KA 1GSLA 4LPLA 1UY0A 1PZ8A 5C8CA 4O7XA 1YHFA 1XYOA 3DEMA 2A3XA 2PHLA 4WM7A 5DUVA 5LBFA 3WUCA 1J3QA 1E5RA 1I9RA 1WD3A 2IXCA 2Q30A 1QJX2 4KG8A 4LUMA 3SEEA 3UT0A 4NIAA 4AVAA 3GXUA 1TNRA 3PNAA 5IAXA 3RZKA 1HRI3 2YZ4A 2LRPA 4R9BA 2WJSA 3KMHA 3B00A 3AL6A 3AKQA 3KD4A 4EWDA 5A3PA 1A8MA 4RR3B 3TN93 4J1WA 5EYXA 3T2TA 4G4FA 4NJ4A 4AHZA 3POFA 3B69A 5K7PA 2WO7A 2CY6A 4V2WA 5B2GB 5JXGA 4CDUC 3I2HA 3WD5A 1W05A 3JQXA 1NXMA 4N53B 1UOBA 3AJZA 4E2SA 3NAPC 5CB7A 4A3ZA 1ULCA 1AYM1 4FP2A 3B3QE 3KVAA 2XKOA 4XBNA 2QQPA 1HRI1 2RDRA 5FQ0B 4A3XA 1VB2A 4IXLA 1D2QA 1QNWA 4L99A 3WW2A 5JOWA 1HRI2 1UOGA 1X50A 2RG4A 1POV3 3M8LA 2YC0A 2VL4A 3IB3A 4BB3A 3TN92 3LKJA 4QDQA 1EPWA 2ZCWA 2C5DA 4XQDA 4XQ4A 2TUNA 2LROA 2ZMKA 1VIWB 3PL0A 4QHBA 3M3QA 4OUMA 3VBUB 1V6MA 4ASLA 4ES9A 3ILNA 5FZAA 2FZ1A 2VNGA 4AI9A 5AFBA 4A6SA 2ZGOA 4HETA 3QD6A 5JWPA 1KGYA 2BVVA 4JAAA 2RM21 4FPGA 4DXZA 2ZX2A 5LZ6A 5E8AA 3Q8CA 1RUG2 1R083 3B02A 2ZGQA 2ZAAA 1POV1 3OPZA 1J84A 3IIIA 1UOFA 1DGRN 4HN1A 4QDRA 4QPIC 4GMP3 2B42B 4IEYA 3KVBA 1A34A 1X8MA 1RUOA 5D21A 5JSRA 1N3PA 4LHKA 1Y4WA 3JQWA 1YQ2A 2XJQA 4QQOA 4TZDA 5EHDA 1F31A 5FO9B 2PLV3 4XJ9A 4CE8A 4YLZA 1OA3A 5KBFA 1NCRB 3PTRB 4Y1YA 1R081 1US3A 5LA2A 3SH5A 3M7AA 1H8VA 3HOBA 1LRHA 4JKMA 3WG1A 3I2JA 1R082 4GMP1 4HPKB 4TXWA 4B8EA 5KC6A 1S0CA 3O0VA 5IJRA 1GR3A 4UFLA 3RNSA 3ZFFA 2BWCA 2R063 1QU0A 1YWKA 2ID4A 2R1DA 5L36A 1FXZA 2E51A 4M3CE 3N4MA 3ON7A 3VHNA 5KXBA 1W6OB 3NVCA 3D4KA 3M1HA 3UJOA 2XLGA 4WVMB 3MIDA 1ULPA 4IV3C 2PLV2 1F8VA 1UQXA 4RFRB 3IT8A 5F1RA 2DUPA 3E6CC 2AZ5A 1MS9A 3THCA 2VCAA 4XEZA 4BHPA 3P1IA 3OSDA 3ZYBA 2DUQA 3I2OA 5DMYA 5JIUA 2R061 1BQPA 1Y3TA 3NV4A 1SG3A 1VBC1 3FBYA 3FHAA 4RS5C 5EQUA 4DZGA 4YVWB 2WYSA 1E5HA 4O61A 2R062 3LIGA 2VXRA 1SZBA 1OOPC 3HD8B 4RR3A 5LA1A 5JSPA 1S0IA 4XJ8A 2VMIA 5C3SA 1O4ZA 1XYPA 3C7OA 2EIEA 1LNSA 4W50A 1UX6A 2IXKA 3HN3A 3FLRA 4M00A 4PLMA 1REDA 1W8TA 3GCXA 4LJHA 1RUD1 1QY4A 3ALQA 4N90A 2A6ZA 4N53A 5EJ3A 1UY2A 4Q4Y1 4P5YA 1LOBA 4R9CA 5D2AA 1YFUA 4FPEA 4B1LA 2J7MA 4CPBD 3RZZA 4AHWA 3OEBA 1Q8OA 1O6UA 2WFF1 5HXVA 3WY6A 4EV0A 1Q8VA 2ZMNA 1PGW1 3WW1A 5FP3A 3ILRA 2VCCA 3SISA 3ZXFA 1DGWA 4DRVA 3POGA 3ZFEB 4K40A 3EXUA 2XDVA 2VO5A 5IVJA 1JW6A 3ABZA 4JGYA 3RYRA 1I5PA 4NHLA 2IVJA 5K9YA 3VBUA 2R0FA 4UFHA 1AX1A 3I3QA 2BNMA 1OQEA 2BW8A 4EJRA 4FP3A 2ZX3A 1UU5A 3LEKA 1CGPA 2JXAA 1WW4A 1ZZ8A 3POSA 3RGBA 1DGRA 1ENSA 3NNGA 1YLLA 5IVCA 1W39A 1QGLA 4HSJA 3KB5A 4NN0A 4BISA 2XH6A 4RA0A 4J25A 4F3JA 4PBOA 4QXHA 4DUVA 5LA9A 2CU5A 3MI8A 4FPJA 3SEPA 5CA6A 3OG2A 5B4NA 3FZ3A 4GWNA 2KA3A 4XUTA 3PMSA 1CESA 4XFAA 3KCYA 5LWBA 2H0BA 1OVSA 2HYXA 2MEV3 3OGGA 1NCRA 1OLQA 4MV2A 3O5SA 2DVGA 4K21A 3I8TA 2DCYA 4HBNA 1OKQA 4BMEA 2XJTA 4UBGA 5IUQA 3AYEA 5JOXA 3ZYIB 4M4RA 1C8M3 2BOJA 5G04L 3MW2A 4JZRA 3SH4A 2R071 1WA6X 4Z2AA 4IEQA 3SLIA 5FLJA 1UN1A 4CTEA 4XDQA 1JHNA 4XDOA 4OI2A 2G9FA 1PO22 3Q8EA 4WVMA 2GZWA 3M3CA 4HL0A 4WVWA 5C33A 3FLTA 2JG8B 3IBMA 2MEV2 1J1LA 4UFJA 3J4UH 4C91A 4NIGA 1XBFA 3AZZA 3AYDA 4QHOA 5DZEA 2C24A 5F32A 1WCKA 3E6DA 1O5UA 1I5ZA 2P6CA 3H1YA 5DZFA 4XYXA 2WT1A 4Q0VA 1KDKA 1PGSA 1C8M2 4HK8A 5T3NA 1H2NA 4FSJA 1Q43A 4JTNA 4Q4X1 2GC0A 4HVOA 4EN8B 1XNAA 2AACA 4AR2A 4YVWA 5CAZA 5I91A 1QJEA 3PUHA 3KCXA 1UWWA 2PQQA 1W3VA 4WV8A 1COV3 4AGGA 4Y33A 5K0UC 3OYWB 2XJPA 3VBHC 4JGZC 2E63A 3KGZA 3OGSA 1ND3C 2OYZA 4IE4A 4CXWA 3VBOC 3H42B 1GZWA 1V9U3 5I8TA 3UGGA 2XG3A 4M0NA 3CQOA 3FMGA 2RS53 4I0BA 4CCCA 1CD3G 2VZSA 1LHWA 1AR93 5FY8A 2WT2A 1E5IA 1KS5A 4QD2A 4QPGA 3WF1A 2WT0A 5F3CA 3H8XA 2HWD3 1OXCA 1I1EA 1WCSA 3BVCA 3ZFEA 3EO6A 1H9PA 1COV2 2X5IA 3UNPA 1LHUA 4Q1RA 1RUI2 3UK9A 3ES4A 3N7MA 1O3TA 4DS0A 2DUOA 2ZX0A 1V9U1 1W9WA 1PZ7A 4FAHA 1STMA 2VBDA 3AKPA 2IUWA 1AR91 1HLCA 1V9U2 2ZJCA 3VDDB 2HWD1 4CDXC 3RS6A 2B45X 3RZGA 2RS52 3DYPA 4GH4B 1SFNA 3AMNA 1EYBA 1AR92 3ZOIA 4XZPA 4AI8A 2VUAA 1SBFA 1Q8PA 3GBWA 4XUPA 2HWD2 3O1PA 3W5NA 3I54A 3W5MA 2B39A 3T4VA 1ND2A 1JH5A 1VLNA 1XU1A 2WWJA 5BV6A 5FLIA 1GP6A 3MLLA 4TWTA 1NCQB 1PMIA 4YGDA 4FFGA 2WWUA 5C7GA 1HX6A 1CJDA 1JU4A 3J8F1 4FTSA 1MZFA 1GBGA 2MNGA 2ZPXA 2DYCA 5FMOL 1BEV3 3BU7A 1AXKA 1TZOA 2ZACA 4XAAA 4PDWC 3VBSB 5FKBA 3JD73 5BNQA 4S2GA 2VC9A 1LOFC 3RJ2X 4XTPA 2WNVC 4AQSA 1IPKA 1W8ZA 2Y6KA 3ZMNA 1UU4A 5JZGB 3POBA 1QXRA 3D8CA 4QM8A 1SBDA 1LU1A 3NJZA 3NV3A 1YFWA 1IZ3A 4UW3A 5DAVA 3IAQA 4QX3A 4ASKA 1DDLA 3N9OA 5D8AB 2XOMA 5FZEA 4LK6A 1OH3A 1W6MB 5FZOA 2ZMLA 4ZU5A 2ET1A 1RJ7A 4FXGB 4MH0E 2H0VA 1UU6A 4E2GA 5A3MA 1DYPA 2O0OA 4FFHA 1BEV2 4LE3A 2XQXA 3U37A 3H8OA 5KHJA 2RS13 3A23A 4HANA 4QKBA 3JD72 5F2WA 2VU9A 2BGPA 3S7EA 1LR5A 3U07A 2VW2A 3WDYA 1F35A 1NUKA 2WZEA 3ME2A 4GIQA 5CFCC 5EP9A 4Q26A 4FAGA 4LE4A 3ZVXA 2EIBA 2FCTA 5BNOB 1JZ5A 2R16A 1DQ6A 1RUF3 5A3WA 3LSDA 3ZXGA 2VQTA 3OYWA 4AFCA 2HWE2 3I2FA 4LO8A 4YW6A 4WM7C 5JXIA 1G9CA 4HFSA 4CDQB 5C3QA 5FPLA 2WR9A 1ODMA 3UGFA 4ARYA 1GLHA 5LATA 3WDXA 1K12A 1QH7A 2RS11 1UO9A 3T0DA 3K51A 3OBTA 3G6JB 3WP3A 4A42A 1AJKA 2B46X 3BTAA 4IE0A 3O1VA 2A70A 2Z2SB 2FHRA 2QE3A 2WLQA 3DYOA 2RS12 5F5QA 1H4GA 1HQNA 1ZBE3 2F17A 3PTYA 2AENA 2A73B 4D6RA 1SLTA 4JV4A 4R4XA 5DXDA 2B9UA 2DU1A 1NT0A 5FY0A 5L9BA 5EWSA 3VD5A 5M0TA 2SLIA 2V4AA 4BM8A 2OPKA 4MYEA 3ZFGB 4AFAA 3NNJA 2PHUA 3SC7X 3T2PA 4HONA 1ULGA 1UPIA 4Q0QA 3PUSA 1ZBA3 4ES8A 1RUF2 3BU0A 5F3IA 2Y64A 2OZ6A 3NNMA 4IESA 1PMHX 1CQ9A 1POQA 2I74A 1QF3A 2R041 3RRDA 4A41A 3MV01 1CIYA 1JN2P 4OUEA 2PAKA 4Z2WA 2W9XA 4BXFA 1BK0A 2C6SA 2UYAA 2VOXA 1UY4A 1MVEA 1D4VB 1VAVA 1ZBE1 3FN9A 2GC1A 2JDZA 4LUKA 5FY5A 5I0DA 1ZBE2 4K8RB 3T1LA 1V6NA 1G86A 4YW5A 4NAOA 3RPQA 1AL0G 1S2BA 1ZA7A 4Q4W2 5HCAA 4L92A 3TEXA 2W2IA 1DGWX 2ILMA 1XNKA 4UBHA 2QQIA 3MYXA 3ZKYA 1O59A 1PNGA 1ZBA2 1Z7S3 4BQ3A 2JD9A 3PU3A 1NCQA 4YM1A 4DINB 1Z78A 1H9WA 2EXIA 4ATEA 3VUOA 4CP1A 4N8MA 4NIHA 4Q29A 1O4YA 4S2DA 2QQJA 2D98A 2XWJB 3MUZ1 4NO4A 2GP3A 2WA4A 3R4UA 5FZGA 1IOAA 3RWNA 3PDQA 3R4DB 4KGQA 4WBBA 5FCCA 3VBSA 1JYTA 1OA4A 4XFFA 5CG8A 3I2KA 5FZMA 2BV4A 5FMDA 3WT3A 5JZGA 2R0HA 4IE5A 5FWEA 4GQ7A 1DIWA 1QNYA 1Z7S1 3MDPA 3U4SA 4B7EA 4CXYA 1JHJA 2P17A 3HR9A 4AK3A 3WG3A 5LEKA 1V0AA 3T0BA 1DYOA 1UYZA 2Y0IA 1Z7S2 4P9IA 3UKTA 4PLOA 4QGNA 2PHRA 4CCEA 4AVCA 5IHRA 5D8AA 3H9AA 2EF6A 5CADA 3LQCA 1ONAA 3TB0A 4MUVA 3U11A 2ZS6B 1W6MA 3POIA 5IK4A 4JHZA 4K6BA 1U0AA 3S6PA 2AEYA 3OPWA 2CNAA 3RI8A 2VBBA 4NRQA 2EXKA 1REFA 1A78A 1ZA4A 1XPWA 4RHV2 4E8CA 3FWEA 1EUUA 2YBKA 2O8OA 1WW7A 1ST8A 3DXUA 4P9XA 2Y8KA 2JECA 2LTNA 2XJSA 5JOZA 3OJBA 3V0BA 1NKGA 5LBBA 2W1QA 5BNPA 1MS3A 2HWC3 2ZKNA 4X8NA 1HJFA 1NLRA 2WUHA 5FYIA 5A32A 2UU8A 1DQ1A 3KF3A 3MV11 3M3IA 5LA0A 3IMNA 4CDQA 4LNVA 2QBXA 3P3NA 3WCSA 3WDWA 4GB31 1VALA 3FE5A 3K3OA 3MF9A 3K46A 4LO6B 1B35A 4LBKA 3DF0A 4CEYB 2K0GA 4DXTA 5B4XA 4CXXA 2NMNA 3I3EA 3R4SA 2BVBA 4COVA 4RR3C 2HWF1 1WKYA 1QDCA 2ADEA 2JB8A 3GCWA 3JBG3 4DUWA 4KI5M 5HV4A 2P3KA 3LOBA 2HWC1 2JIGA 4KMQA 1RXGA 2VZ1A 4M3CB 1ZRRA 4YZ5A 1LOGA 1BVVA 4XXAA 5A7NA 4W6WA 2RMU3 4LEJA 1NY72 1QJFA 2HWC2 3X29B 1RUJ3 1CZVA 3IDEA 1YEWA 4IEUA 4N53C 5C8CB 1UX7A 1AR82 4JRLA 4COWA 5T5JA 4LULA 3VDBA 4MGKE 4MLOA 1CPNA 4PI2A 3V64A 1LESA 1PVC2 2ZZJA 1O4TA 2VMEA 1OUSA 3WUDA 1WMXA 1HN0A 4FPKA 4QQPA 1JZ4A 2PFWA 3WQ1A 2WS91 1M06G 3V0AA 1YJKA 2ZGRA 4QT6A 1ZNPA 3CU7A 5DG1A 4YW3A 3EYPA 2FZ2A 3AM2A 3JBG2 4F83A 4LKFA 4WZFA 2J1SA 1W2TA 2W47A 1SDDB 1RUJ1 1LHNA 2VM9A 3LDBA 4NPRA 2P2KA 3VBUC 1WCUA 4B1MA 1LU2A 1QQP3 2EICA 4QKNA 2D3PA 3ZXAC 4RYDA 2RMU2 3KQRA 1RUJ2 2XJVA 2YPDA 4EN0A 1AHSA 2YB7A 2FQPA 3OCPA 1XNCA 4GJYA 3RI9A 4AXOA 3RWKX 2ZA9A 4GULA 4KWUA 2RS31 4TTGA 4UW5A 3TNPB 2WNUB 4K9SA 3VKNA 2PMWB 2BFUS 2WZR1 4YZ2A 3NMBA 5FZ8A 5T54A 4AQ2A 2K9ZA 5ACA3 3AZVA 3A0KA 2JDPA 2OPWA 3B5LB 1GUIA 3KGLA 4QMAA 4YM0A 5FZ0A 5J1XA 1QQP1 2WYFA 4BK5A 3HWJA 5JR7B 5TSWA 4MG2A 4LTAA 2VD7A 4G9SB 2R1BA 2PXJA 4YG6A 4IEWA 3L2YA 1IS3A 1QQP2 3N7KA 3VHPA 3KF5A 2JE9A 3VBRA 3NL1A 2ZOEB 4HKOA 1NCRC 4XE9A 3AXEA 2CL2A 3PUIA 5APAA 4F7ZA 2R49A 2WBKA 2GP5A 1ULEA 2WL1A 2ZGSA 2VE1A 1J3PA 5A7OA 3WW3A 3CJIB 2W5FA 3PJYA 3SXWA 3O1MA 2DU0A 3INAA 3IKWA 1VBB2 1OI6A 4XF1A 2P6HA 4MVTA 5ACA2 3DN7A 4YZ3A 3W58A 4AYUA 3BOWA 1GQGA 1VBE3 2V09A 5GJ6A 2JD4A 1W9TA 1NYWA 3GGLA 2XVGA 2BP6A 3DUIA 5LK7B 2VQAA 2GN7A 3D5OA 3E97A 4WVZA 4XBLA 2WIIB 1JOPA 4QQ2A 4KWJA 5GLTA 2FDKA 4K1YA 4N43B 2D44A 2FDGA 2GH8A 5FYHA 1D7PM 3I3BA 2VZTA 3N9PA 3VZOA 1WD4A 1IKPA 1UYXA 5FYYA 2ES3A 3ACIA 2ZGMA 4GWJA 5J37A 4ZHNA 2D93A 4OCTA 4TN7A 2Y6JA 2D3SA 3AB0A 5J98B 2ZEZA 2AUYA 3D0JA 4CEYA 3S5AA 1XE8A 2D6KA 4L8QA 1VBE1 4HSLA 4YVWC 2GU9A 3ZFFB 5FOJB 5FYTA 4LKSA 4N9IA 1E5SA 1GNHA 2TNFA 1OPOA 3DPRB 3LB9A 4IGQA 4KBBA 2HBTA 2RJLA 4QB1A 1W9YA 4B3NA 3CF6E 2E7QA 3HIFA 3ZDVA 4M3CA 1YFYA 3GZAA 2WAAA 1J59A 4IDZA 5C6CA 4UFIA 2JE7A 1V6IA 1O3RA 3VBFB 5DABA 2D6LX 2QQLA 2Y6LA 3UKVA 4BQ4A 1IHMA 2ET7A 3NWKA 1F5JA 2D6PA 2DDUA 4DIQA 4H2AA 1PNFA 2XQRA 2ZHLA 3TNQA 4E8DA 3ZYGA 2A3WA 5GM0A 4AQTA 4NE9A 2PTMA 3NJVA 1AYM3 1XOYA 5EJ1B 2V5DA 4ZY9A 3TOJA 4D3WA 1TME1 4IV1B 5FZIA 2DCTA 4CZSA 3ZFEC 4DEQA 4PJYA 2E31A 2FMYA 5CG9A 1JOBA 4ITCA 3KWVA 4AF9A 1CAVB 1C1FA 2XHNA 5J09A 1W0PA 1JBCA 1FI2A 1QOOA 2EIGA 2XL7A 5FZ3A 3IWZA 1W9FA 4QX5A 2ZX1A 4AQ6A 1UMZA 5ABJA 4PIZA 1ULOA 2VOWA 2WNUA 5F5CA 2D6NA 2RM23 4C0HA 3I2IA 3ROUA 5AVPA 5I0TA 1AYM2 4AFBA 4XIKA 4QXCA 2ZEYA 1MPXA 4W8JA 4DRRA 3S30A 4Q8KA 1RUE3 3DECA 1MS4A 1XB9A 2Q0AA 2W52A 2PQSA 5F5IA 1XQNA 1H2LA 1RUNA 1QJU1 1F4AA 4JGYB 1APNA 1MQTA 2EAKA 2G9GA 2BQPA 4Y1XA 2JDKA 4ZS3A 4OHZA 3BTYA 3HPNA 1BCXA 1PK6B 1Y9QA 1O8PA 5JVVA 3TBDA 2F6BA 2BEOA 2ETEA 2CGNA 2IXHA 2HEVF 5FV3A 5FY9A 1ZRFA 2VCMA 2OZJA 3USSA 4LORA 3ZPOA 3A21A 5DG2A 1AXZA 4B4QA 1I3HA 1U12A 1X33A 5C3RA 1FT9A 1RHI3 3CJIA 5DDJ3 3MPBA 2VOTA 5T50A 5HV0A 1RUE1 2RM22 2UY8A 2VNVA 2JIJA 3CBNA 4LOTA 3S57A 2WLPA 3LEMA 4NRMA 4I09A 3W59A 1CPMA 1TMF3 3A7QA 2ORXA 1RUE2 3N3HA 1LGCA 1W8OA 4Y20B 3H7JA 4L0PA 4NPLA 1MS1A 2QJVA 1FAYA 1JTZX 2VZ3A 5CKNA 4OHWA 2ORZA 3ZYPA 5IT6A 2D6OX 2HH9A 1GU3A 2JG8C 4BE3A 4BH9A 2X09A 4N43A 1JZ7A 1RHI1 4IEPA 3PU8A 4NHYA 5DDJ1 4BPZA 1FX5A 3CZUA 4NHKA 3T1MA 4UFMA 4JRAA 1OQDA 2CHHA 3NNLA 4S2HA 5FP9A 4O65A 3PURA 1TMF1 2KR2A 5JPMB 1RVF1 3VHRA 3TRSB 2VJXA 1F15A 3MFCA 1LOCA 3HEIA 4M4PA 2P34A 2W1SA 3O1UA 1TMF2 4XBQA 1M4WA 3F95A 3N9MA 4JDOA 3DPRA 4K3UA 1POV0 1H6YA 1VBC3 3MEPA 3ZDSA 5A7SA 3CL1A 2WA3A 1A8DA 1ZZ9A 5A3OA 4DXRA 2VMFA 4CYDA 1W2AX 5L9RA 5CNAA 3LOIA 3KQ4B 3M70A 5ANQA 5FBJA 3VBFA 1QOTA 1VRH3 2VMDA 4LBOA 5KC5A 2CAUA 1EPZA 4UAPA 5FYBA 5GZDA 1RUD3 2IXLA 4UW4A 5FPVA 1FNYA 4E2QA 4Q4Y3 4FI9A 4BJ0A 2VGDA 4XJZA 1T6GC 5FUPA 5JI7A 2YG0A 4RGGA 1VAKA 4Q0PA 1BYHA 5FK8A 5A3NA 5KHIA 4XUQA 3ZSLA 3ZXEA 3OPTA 2UWCA 2OT7A 3FL7A 4FCAA 2WFF3 2GALA 2FBEA 4GMP0 4IV1A 2J1EA 4K7JA 4U2AA 5FLHA 1VBC2 5F9TA 3WV6A 1G8WA 5BYNA 2QQUA 4QGMA 2J1RA 3WQ0A 2RDNA 2XVKA 3VKFC 4JDMA 2Q8DA 3W20A 1UMIA 1VRH1 1CAVA 4EZHA 5BNNB 1HKDA 1E57A 2VZOA 1YUDA 3ZYHA 3RMXA 4EN6B 1F2NA 1U5IA 2RDSA 4W4ZA 2D6MA 4HOOA 3NV1A 4YG0A 1RUD2 3HBZA 1GZWB 4P9LA 3K2OA 4Q4Y2 4Z82A 3VDDC 2FCVA 3R05A 4ONUA 3VDCA 2WSVA 4GH4C 3NKGA 3AP9A 1UIKA 2JKBA 4JX0A 4QPWA 4COUA 4QPGB 2Y6FA 5FREA 4E27A 2WFF2 1ZZBA 3MIFA 1PGW2 3AZWA 1R093 3SH3A 4KH9A 2X5IB 4XOGA 3OB8A 1TG7A 1NCQC 1GYKA 1TE1B 1WLWA 2KD7A 3AKSA 1PK6A 2B5HA 3MFAA 4HT1T 3ZPYA 4LHSA 1J58A 5LRSA 1TVGA 1VB4A 2WDBA 3THPA 4L2NA 3CJXA 3VBSC 1PZ9A 1FV2A 1WLTA 4FFFA 3AZXA 4Y1ZA 3UV9A 3LDKA 5C3OA 4A7YA 4PBPA 1N47A 1R091 1W3XA 3ZX7A 5JZGC 5ERLA 3ZSJA 3VKMA 1LODA 4WM8B 3KV4A 4Y20A 2R073 4XW3A 1X9PA 5L7OB 1CAUB 2BTVC 3VHOA 4EYUA 3HNYM 1ND2B 3NJXA 4AI0A 4DY5A 1W2UA 5D8AC 1R1A1 5LY2A 2DV9A 2DWRA 3OUHA 1C3HA 3WF4A 2D3RA 3FX3A 1I6XA 1RMU3 3N7LA 4OZOA 3DYMA 1S2EA 2I07B 4MGTA 1HRV3 1KJRA 2ENRA 4QGLA 5FO8B 2VUDA 5ANNA 4RD7A 4DY3A 1JYWA 4DFSA 3BCWA 5FYSA 1OPMA 1YJLA 4EWAA 1HB4A 3I59A 3SKVA 3VD4A 2I45A 3B7MA 3JUUA 3VLBB 1GOHA 1W03A 3IM0A 5FK7A 2JWPA 5KXDA 1K5MB 3WINE 2E26A 2JKXA 4Q4X3 5CFDB 1DFQA 4CCNA 2R072 5EV7A 5BNOC 2P37A 4AEDA 1L3JA 1RMU1 4BIFA 1SHWB 4AGRA 1HRV1 4CDQC 2FMDA 3T09A 2Y33A 4YVSB 1J3RA 2AR6A 4FTBA 5C9AA 3AJYA 3MIHA 5EJZB 3AP4A 1B35C 1RMU2 5FZOB 4NR1A 4D7YA 2DVAA 1HRV2 2Q5TA 1BZWA 5E16A 3ZKUA 1U5XA 2D43A 3PVNA 3WF3A 5A3UA 3FBMA 3SCGA 1DLCA 1PIV3 2NMOA 2ARAA 1V6JA 2OX0A 2UWBA 1URXA 1KJLA 3ZFGC 1GP5A 4Q4X2 5FY1A 1XJAA 4Y1VA 1NA1A 1ZZ7A 4A45A 3ZYFA 3ENRA 2BJSA 3WDVA 2Q1MA 4Y22B 1EP0A 3O7OA 5BNNA 1Y9MA 3CO2A 2RJKA 4C1WA 4ZONA 4CDWB 1Q8QA 4XFCA 4C8DA 4AFDA 2BNOA 4IW3A 3OBAA 4XC9A 1MEC1 4QX1A 2QTWB 1PIV1 2R32A 4QM9A 5F7UA 4P5HA 4EROA 4PIXA 4HG6B 2QQWA 3H3LA 4FPHA 4H7MA 4R8HA 1PIV2 1UZWA 3BTZA 1ASJ1 4PCRA 2PHFA 1S0FA 3DV8A 3KV5A 2VCBA 5CKQA 2D97A 3ZR5A 3CNAA 4OQ9A 4KNCA 3GM8A 5FIXA 3PVBB 1NX9A 1XU2A 4IGPA 4P00B 1RJ8A 3AC0A 3R6SA 5A6YA 1AF9A 3PIGA 3MBWA 5H9SA 2VTXA 3I2DA 1DHKB 2XLFA 4LBJA 1LGNA 3OGJA 5AVAA 1EAH1 1ZRIA 1ZRCA 3OOXA 3Q8AA 1FOD1 2V4VA 3J8F3 4D8MA 2D40A 1MZ5A 3E5QA 5C71A 2A6WA 2BYVE 1NLSA 4FO9A 2Z4FA 4K20A 2W94A 2PAEA 4QQLA 3BKZA 3HN1A 4IEVA 4FBFA 4WM8A 1C8NA 2ZAHA 3T0AA 5GZGA 2NP0A 1UPSA 4Q4V3 3ZSEA 2CV6A 1W6PB 3FJSA 5L7OA 1CAUA 4PI0A 3RSJA 2JDAA 4R4ZA 4LA3A 1D0HA 2RHPA 3QACA 4CDUA 2NQYA 3K4ZA 4AI3A 1C28A 2YBPA 4SBVA 3GBGA 3MUY1 4X6RB 1IQAA 1VE0A 4NAMA 1OMIA 1VBD3 3K48A 5FBZA 2BFUL 5IK7A 1QHDA 2WN2A 3LFMA 5FYVA 4E9KA 2OKXA 5GKAC 4GWIA 4IUGA 3K75B 4BQ1A 5A6ZA 1FPN3 3J8F2 4AFMA 2DFBA 3D0SA 2XPJA 1W6QA 3N9LA 4Q4V1 1OURA 2EIDA 4LBLA 3E1F1 2WQ4A 4YRDA 3DKWA 4XMAA 1OF4A 5FP4A 1K5MA 4Q4V2 1RYYA 5CFDA 2W0XA 2VTFA 5HXMA 4UOJA 4YFWA 1OC1A 1VBD1 2ERFA 3MLJA 4M01A 3AVRA 2ZX4A 1CJPA 3T2QA 2W68A 1SDWA 1GANA 4TSVA 2IVIB 4YVSA 4AVBA 1G9AA 1OHFA 5A1LA 1VBD2 2HLEA 3OD0A 2Q8EA 4CEYC 1FPN1 5IVBA 2UWAA 1HIXA 2BDRA 2XJUA 4LHNA 4JTOA 5FPAA 4FOYA 1IQDC 4XF3A 1AYN3 3WOGA 2GMEA 1LHVA 1VMHA 2E33A 2BGOA 3BGAA 4ATFA 4CSWA 2DVDA 3POYA 1KQRA 4QPIA 3CKHA 4AGVA 5BY5A 2W87A 3AX4A 4DMIA 1GZCA 3KT4A 1NG0A 3WNNA 3V0BB 1Q8SA 2GNDA 2JG9B 1ALYA 2GH2A 5DUXA 4I3PA 5BNPB 1OFNA 2P1BA 3N36A 5A70A 4H14A 5AFEA 3OEAA 4AW7A 2VXJA 5A32B 5C8CC 3USUB 1V6OA 4Y22A 4LK7A 3LZZA 1KFUL 2Q4SA 3AFGA 2B4KA 4X6QB 4TLFA 1AYN1 4CDWA 4BOWA 1SFYA 1B35B 4FPFA 4MHRA 4IETA 1SLAA 3FLPA 2R043 4XPVA 4D6SA 4CP0A 4OYUA 3CZJA 1AYN2 5AC91 1DQ5A 2JICA 3UYJA 4DEVA 1GICA 5CIRA 4OHYA 5LBEA 4ZU4A 2VVDA 5FZBA 3SMHA 2K46A 2VR4A 4R9AA 1T2XA 4XTMA 5C5UA 5FY4A 5C70A 2F4PA 1YXWA
chains in the Genus database with same CATH topology
2Y26A 3AXDA 1RIRA 3NSTA 4IEXA 1KXGA 1QKQA 2PHTA 1XXNA 2VVEA 1TNFA 2JJ6A 4DQAA 3WHUA 1REEA 1WBFA 2X29A 1O91A 5I0UA 1C1LA 2WNUC 1GZ9A 2ZGNA 4COZA 1QJY3 2R042 2ZKLA 1AL23 2AREA 2DCZA 1H8TB 5DUWA 3V0AB 1LJ7A 1MZEA 4W6YA 2AH2A 1PGL1 4RS5A 3BODA 4YG3A 4OHVA 4WVVA 2JEMA 1OOPA 1ZZ6A 2WNEA 1UIJA 4RQPA 3HMYA 1G6NA 3OY8A 1W6PA 2WINB 3EHKA 4UW6A 1IPJA 3VKLA 3BB6A 4N7IA 3MLKA 1QJY1 1SLBA 3U10A 1C5HA 1AL21 3AFKA 3CJIC 4ZU7A 4YW1A 1Y7BA 3M3OA 4YZ1A 4CEWA 5T5PA 1QJY2 4C1XA 3WX5A 1AL22 1SLLA 1V6LA 1VP6A 1IKQA 4FPOB 4LR4A 1CAWA 4UXAA 2CYFA 5HBAA 1D2SA 3WNXA 4MGZE 1CX4A 5SV8A 1XNBA 3AP6A 5FO7B 3VBRB 4N43C 3E5UA 4YGCA 2QDNA 1GFF2 1OSGA 2GMPA 4D94A 2QCSB 3RQ0A 1U5ZA 2D5FA 1S2KA 3O14A 1C57A 4GB33 4GALA 3WQ7A 4YW2A 4HKLA 1A3KA 3ZFFC 1CVNA 2GN3A 3HT1A 3DPRC 1MS0A 1UZZA 3ZXDA 2ZGUA 2HWF3 4OI1A 2JG9A 1FMD3 4I3GA 4BA6A 3H3UA 4PLNA 3VBFC 3P3PA 1AX0A 3USUA 3PVEA 1S0GA 3GHMA 5T52A 1AX2A 4JC1A 4RFT0 3ZIXA 2R30A 1XNDA 1TEIA 1EV13 4GB32 2NN8A 2A71A 2WC2A 3G7DA 3POWA 4IV1C 2HWB1 2YGLA 5IK5A 4Y1UA 4I01A 4PF5A 2JENA 2ZGPA 2VUJA 1WBLA 1FMD1 2WS93 2YGMA 3MIBA 1MZ6A 1G9FA 4E4DX 3M4FA 2HWF2 4BWOA 4JQRA 4FVVA 1FMD2 4JCKA 2GSYA 1HXS1 3O0XA 1PO13 3MW4A 1EV11 3LAGA 5J3UA 3QH6A 2Q1ZB 2RS33 1N1YA 3IN9A 1EV12 4BLJA 1H8TA 2WZR3 3H50A 4I0WB 4ZXKA 2WS92 1DBNA 2HYKA 2KM2A 5JDBA 4JGYC 1RB8G 2DCKA 2VNRA 4LBMA 2CGPA 1PK6C 1PO11 3OD4A 5K0UA 1UD1A 1RTVA 3VBHA 4JGZA 1VBA3 5FPZA 5JI9A 1PO12 1LENA 3TAYA 3WW4A 3WXPA 5ABJB 2DTYA 1IGOA 3VL8A 3ZXKA 2EVXA 2RS32 2NYYA 4E4ZA 1SLCA 3Q9OA 1QJZA 5FAXA 2WZR2 2AYHA 2V73A 1W6NB 4AVSA 1MQTB 2ZGKA 3LA2A 3GZUC 5D1IA 1VBA1 3QBQA 4O9EA 2LUWA 1PVXA 1BBT3 4N9HA 1MR5A 3WZ1A 3LWCA 4NOTA 3W9AA 1VBA2 1G9BA 4XF4A 3QOPA 4FOQA 5A33B 5E89A 3KLSA 1AR73 4LLFA 1BKZA 2H6BA 3HQXA 4Q2FA 3PVOA 3ES1A 1AR63 3VKOA 3ELNA 1BBT1 1AZDA 2CWMA 3JZVA 2ZTNA 4QQHA 4HKWA 1WLDA 4LHLA 4MZUA 3GF6A 2N7GA 1AR71 1S0BA 1YNAA 1JYIA 5H9RA 2X8KA 3WP6A 1AR72 1JUIA 5GALA 2E6VA 1FNZA 1XE7A 2QUOA 3WP5A 1S0EA 1AR61 4PDWA 3M3EA 4FPLA 2IC1A 2WNVA 2MPFA 5FOBB 1NA1C 2GC2A 1VBE2 1AR62 4I0AA 1S55A 1TME3 2PHWA 4XFGA 2P3IA 2ARXA 1KS4A 1N3OA 5BNNC 4SLIA 4IERA 1H2MA 4FOVA 1O7FA 1WA4A 1WMEA 4Y24A 4MSVA 2IWGB 1R1ZA 3AK0A 1RGSA 3E5XA 3ST7A 5HI0A 2ZHMA 1RL3A 1DQ4A 4KWLA 2X53S 4P14A 4YGEA 4D7SA 1KD7A 2VMHA 4QPGC 2VH9A 1GKBA 1AJOA 4AVVA 3H8UA 1GNZA 1H2KA 2X5IC 1TME2 4LO7A 3D6EA 1CONA 3S0MA 3BALA 1UL9A 3J26N 3AMPA 1QJU3 3O12A 1H30A 3IDCB 1QJX1 2A6XA 4Y5Z0 5L73A 1W0OA 5I8SA 2BPA2 5BUVA 1YO8A 4ISQA 5F6KA 4FPCA 4IEOA 4WZCA 1ZYBA 2VW0A 3MW3A 5E88A 3MPPG 1SACA 1UKRA 3R0RA 3VL9A 4WM8C 1DU3D 4FT8A 3EBRA 3AP7A 5L7OC 1W6NA 5CBLA 3RDIA 3SITA 1ND2C 1JOJA 1WW6A 2BBVA 2CAVA 4GXLA 1BJQA 4Q27A 1MVQA 3LCPA 5C4WB 4HN0A 4RL7A 3RYPA 1QJU2 4M3CF 1RUG3 2C1FA 4GKYA 3H0OA 5A33A 3CEWA 4TYSA 3TN91 1HQWA 3ZYRA 2QZ3A 5EFUA 1H1AA 2ZGLA 2A75A 4YNIA 4OZXA 1K5MC 1RVF3 1NE4A 3JCIA 5CFDC 4OULA 3PHMA 4P9GA 5FPXA 5JSOA 1PHMA 1RUG1 1SBEA 4YVSC 3FUQA 4BIOA 4E4SA 2QVSB 1FYUA 2YROA 3HT2A 2GNBA 4Z07A 5H9PA 1RHI2 5DDJ2 1LOEA 1RUC3 2HKXA 3I59B 4XHBA 3LA3A 4XFHA 1X7NA 3KT7A 3MIEA 2DVFA 1DG6A 1RVF2 4BMBA 4K8FA 5T55A 5KXEA 2EA7A 4AEDB 4LBQB 5EXOA 3JB4C 1WCDJ 2Q8OA 3C2UA 5LK5A 1ZRDA 4ISRA 2EXJA 4L11A 4CDWC 5T5OA 5C9AB 2OUHA 4XF0A 4FOWA 4Y26A 4NWWA 2RE9A 4AEMA 1RUC1 3SHRA 3VZMA 2VNOA 2XBO3 3B93A 4I02A 3SCHA 2VECA 3ZSMA 1RUC2 1BMV1 1SCSA 2Y38A 3U0ZA 2K2SA 1O3QA 2PLV1 1BMV2 4AVTA 3IPVA 5FTTC 1NA1B 1DLLA 4P9WA 1SLIA 5FDBA 1SCRA 4J1XA 4KL1A 3L9JT 4S2FA 1VJ2A 2XBO1 2Z79A 2YMZA 3CLPA 4ORFA 1UAIA 1VRH2 3H1MA 4FQZA 3KZ4C 1XYNA 1WLCA 2XBO2 1QXPA 3LGRA 4MGIE 3AYCA 4A7KA 1B09A 3BIWE 2UYBA 1WGPA 2GC3A 4AI2A 2PELA 2YHJA 1NXD1 4M0HA 4RQPC 2ZHKA 1G9DA 4Z8BA 4FTEA 1OD5A 1LCLA 5C4WA 2IXJA 5CU1A 4W6XA 1IS6A 2VPVA 3GYDA 2WKKA 4W65A 1H1IA 3FFZA 1V00A 4CEWC 1R1A3 5FQ0A 3TYJA 1DGLA 2PAMA 5GLVA 2W39A 3KM5A 2XLAA 4C0BA 2LALA 2W08A 4V1PA 3JB8A 4YARA 2YY1A 1MACA 2ZZQA 1UW8A 2I2SA 1R092 4CP2A 2EALA 4CDUB 2OA2A 2A6YA 3C3VA 1YIFA 1VAMA 1H1MA 3NAPB 1SQ4A 4YGBA 3WP4A 3WG2A 4DB5A 1CN1A 1R1A2 4R9DA 5J7MA 5KHGA 3KSCA 5JAXA 1LTEA 3IIAA 1QWRA 5A3LA 2WSUA 3H3ZA 4AEJA 1W6QB 2A7AA 2WFPA 3FC0A 5GZEA 4XMIA 2Y0OA 4O9GA 4Q0UA 2JG9C 5BNPC 4FQ4A 1PO23 2IXIA 4XFIA 4AG4A 1S1AA 4LBQA 2DFCA 3AMMA 4QXKA 4Z92B 1WMFA 2IZWA 4XJWA 3H1WA 3GALA 2QZ2A 5GLZA 2ZABA 4HPKA 1J1TA 4H3WA 3ZN5A 3RYKA 1F9KA 1OFSA 2XJRA 1MEC3 4QPIB 2QDRA 1GQHA 3B9CA 1PO21 4AE2A 1IS4A 1BK1A 1C4RA 1UCXA 2WZPP 1W6OA 4B29A 2XHKA 2MEV1 3KT1A 2VOKA 1UZYA 1ASJ3 4XHXA 3ZXJA 1UKGA 1ZX5A 3BPZA 4OUSA 4RSUA 5HCFA 1ENRA 3ZSKA 2XUMA 4BYYA 1H4HA 1C8M1 1MS8A 2PHDA 1IS5A 4XJAA 2E53A 4NHMA 1ULDA 3MZHA 1H8TC 1JUHA 1H0BA 4Y4YA 1HQLA 1YRZA 5EYYA 2R6QA 1EAH3 2ATFA 4B4RA 1ENQA 3QH7A 3BOPA 5LEJA 1MEC2 1MS5A 1TQ5A 5I0SA 1Z0HA 1FOD3 3RG0A 4DNYA 1DF0A 4KWKA 3I7DA 1Q5OA 2NZ9A 2OVUA 2D7FA 5JMCA 3APBA 2PHXA 1RUI3 1RITA 1LHOA 1ASJ2 2JX9A 4MXVA 4D69A 4IV3B 4HLTA 3A0NA 3ZN6B 4G3YC 3TWIA 4URTA 2WQZC 3FFQA 4ASMB 5JOYA 3AMQA 3VN4A 2NPIA 4NVPA 2VW1A 4L9BA 1XRUA 2HJIA 4BCUA 2A3YA 3KCCA 4RS5B 1EAH2 2MHFA 4D7TA 4P9JA 3ETQA 1COV1 1X36A 2Z5WA 4OI4A 3NW4A 1O5LA 1OOPB 1RUI1 1FOD2 3WG4A 3OTFA 4EWEA 5J96B 4XETA 4RQPB 2PYTA 5I93A 4KG0A 1Q3EA 3OY8B 3VBRC 1PM7A 1ENXA 1KITA 1N3QA 4XFBA 3MICA 1X8EA 3N35A 3D82A 1RUH3 3NAPA 2RS51 1SEFA 4CEWB 1KFXL 3URFA 5IK8A 1QMJA 1JYCA 3GZTB 1CAWB 2GNTA 2VY0A 1YYNA 5I8YA 1WW5A 5KHKA 2AGSA 3VGIA 4QU2A 4MXWB 2OW4A 1LULA 2DVBA 3V65A 5JCTA 3ECQA 1RUH1 4EN7B 1S0DA 2DF7A 4XF9A 3ZXLA 5BXXA 2XGXA 2BWAA 4LLOA 1WUVA 4IEZA 4Q1PA 1RUH2 3A4UA 4KQ7A 3FUOA 2ZHNA 3PMEA 2QKDA 3UKNA 1HW5A 1N1SA 3PJQA 3WDUA 1FPN2 5CVRA 4L97A 1QXJA 3HAGA 2A6VA 5AC93 4KU8A 4P9YA 3QCWA 2E7TA 2SBAA 5E1RA 2HWE3 1HDKA 4META 1DZTA 3LSEA 3NKTA 2JG8A 3M2MA 2O8QA 1AUYA 1BEV1 3AZYA 3N7JA 4C90A 3JD71 1YI7A 2E7AA 4MGYE 4R52A 3U4XA 3DL3A 3GBFA 4HVRA 1DQ0A 4OLLA 5GZCA 4AHXA 4LO4B 4K1ZA 5AC92 2HWE1 1QOSA 1OQ1A 3E6BA 1DQ2A 1AXYA 2RR13 2Z42A 4IV3A 3ZN6A 5GZFA 4OFGA 3ILFA 4MX3A 5ABJC 2TBVA 3VZKA 1WMDA 1SMVA 4RGAA 3IDBB 4AWDA 3PLQA 3DGTA 2O1QA 2ARBA 4Q4W3 1RUF1 2YXSA 3THTA 4F8AA 1D4M3 1MQTC 2LM3A 1QH6A 1PGL2 4YW4A 2RR11 3V56A 1YIPA 4HMZA 5K0UB 3MIGA 3VZLA 4ZKTB 3VBHB 3AYAA 2XB6C 4JGZB 5C8WA 1KRIA 2RR12 2TEPA 3ZO0B 1ND3B 2Z69A 3JU9A 1KDMA 2HEYF 3EJKA 2B8MA 2DTWA 2VVFA 3VBOB 4FXKB 1RC6A 1O3SA 4LO5B 3UL2A 1G7YA 4Q4W1 3VDDA 1ZVFA 1D4M1 1V6KA 2C9AA 4GH4A 4BZ4A 2KXLA 4I30A 1ZBA1 5T5LA 3VZNA 1D4M2 5DUUA 5GLUA 4YZ4A 1S0JA 5H9QA 4MXWA 4H55A 4AEKA 1DZQA 4NWVA 1YI9A 4J6GA 1HV1A 4HK9A 4XQWA 4IQPA 3OF1A 5J36A 3KS7A 4LBQD 2B7YA 5F6LB 1N1TA 3I4IA 2P3JA 4RHV3 5DZGA 2QNKA 3NV2A 2GNMA 4CDXB 5JPNB 1X82A 4KGGA 1EY2A 2XL9A 4PIYA 1Q56A 3ZIWA 3VZJA 2HWB3 5GLWA 2ZGTA 2CTVA 3OBRA 2UURA 3GHNA 2EAAA 2GMMA 1CR7A 1HXS3 3O0WA 5JIAA 5BPXA 4RHV1 3ASIA 4YYOA 1VR3A 4PDWB 3RJRA 4COYA 2WNVB 3S7IA 1HV0A 4YSFA 4LT5A 1BXHA 2H6CA 1NQDA 2HWB2 2A5ZA 5BNOA 1AR83 2XKPA 4U36A 4EN9B 5HCBA 5L19A 1CAXB 1PVC3 1FATA 1LECA 1HXS2 1YCIA 1YFXA 4N7UA 1UF2C 2V5YA 3L2HA 1NY71 4INDA 4A7ZA 2DCJA 4OVEA 4XJUA 5I0RA 3RMYA 2G4IA 3SNMA 1LEMA 1RINA 1AR81 4YFZA 1NOVA 5LRRA 5CFCB 3WVJA 3ZFGA 4DOUA 5C4WC 1JXNA 1PVC1 1CIWA 4XXPA 2BUKA 2CGOA 2EXHA 3MF6A 5KXCA 1DZRA 4WM7B 2VOVA 3VV1A 3ACLA 2DURA 2IFWA 2UY9A 1NE6A 4GKXA 3NO8A 1ND3A 4Z1VA 3WHTA 3JBG1 1LGBA 4IL7A 4LBNA 3H7YA 3VBOA 1V70A 4AI1A 3ZYJB 4LA2A 2RMU1 1NQJA 1ZZCA 5KWRA 1LOAA 2HEWF 2CWSA 4H7LA 1D0GA 2NLRA 2OUJA 1QDOA 3AKRA 1A6CA 2OIIA 1U5YA 1F5FA 2E9QA 1BVP1 2ZBJA 2VQ0A 4FPYA 2YDEA 1AVBA 3EQEA 1Y43B 2C0ZA 2GAUA 2VMGA 4Q8LA 1VBB3 2YUEA 2YPJA 5FMOS 4HVQA 3FHIB 4CDXA 2QFEA 3AMHA 3WR0A 4AEDC 1ZM1A 1LEDA 2BNNA 3QLQA 3WCRA 4KU7A 1OA2A 1LKNA 2VG9A 4PQ9A 1DYKA 1BBT2 3B94A 4BLIA 5C9AC 2BGCA 4JVAA 4Q0SA 3SCFA 1GV9A 1VBB1 5ACA1 3ATGA 3WLUA 3B01A 2PN5A 4CRQA 1NZCA 3LA7A 1FV3A 1ULFA 3AKTA 3AP5A 3B9IA 1LOFA 5J48A