5FZDA

Crystal structure of the catalytic domain of human jarid1b in complex with l-2-hydroxyglutarate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with L-2-Hydroxyglutarate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 145
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzdA01
4CCNA 3N9PA 4EZHA 5FP3A 4DO0A 5FV3A 5FZBA 4CCLA 5FZ6A 5FZ9A 2XDVA 5FJKA 4E4HA 5A7OA 4QX8A 4QX7A 5FZFA 3U4SA 3AVSA 5FYIA 5KR7A 4NUBA 4CCKA 5A1FA 3PU3A 3AVRA 4V2WA 4D6QA 4IGOA 5FZCA 5IVCA 4XDPA 5FY5A 5FZMA 2OT7A 4QXHA 3DXUA 5A3WA 3PUQA 5FXXA 2OX0A 5FZLA 4Y4RA 5FYHA 5FBJA 2XUEA 5IVEA 5FYZA 4C8DA 1VRBA 5FY7A 4LIVA 3LD8A 4D6SA 5FZ7A 4QXBA 5A7NA 4HOOA 2YBPA 3NJYA 4QWNA 3KV6A 5F2SA 5F5CA 5F3EA 5F5IA 3N9NA 5FJHA 4D6RA 4URAA 5FWJA 5FUPA 2GP3A 5FZKA 4Y3OA 5F39A 4BISA 5LW9A 4Y33A 5FP9A 2P5BA 5A7SA 4HONA 4CCJA 4UF0B 5FPLA 5FP7A 5FZ0A 2OS2A 5F3IA 2OQ6A 5FYSA 5IVJA 3AL5A 2VD7A 4CSWA 5A7WB 5FY0A 3N9OA 3ZPOA 3N9QA 5A3TA 5IVFA 2Q8DA 5FP8A 5FPBA 5IVVA 5FXVA 2YPDA 5FYUA 5CEHA 5FY4A 5IVYA 2XMLA 4AAPA 3PTRB 5FY8A 5FYVA 5LY2A 5ISLA 4XDOA 5FZ4A 3U78A 5FZOB 5IVBA 5FYMA 4QXCA 3AL6A 4GAZA 4BXFA 3N9LA 3KV4A 2WWUA 4DIQA 5F37A 3KV5A 4EZ4A 2GP5A 5FZ1A 5A80A 4BU2A 5FWEA 4LXLA 4LITA 5FYBA 4CCOA 5LWBA 5FYCA 5FPVA 5A7PA 2WWJA 3UYJA 3ZLIA 5A3NA 5FPUA 5FY9A 4ASKA 5FPAA 3KVAA 4TN7A 2Q8CA 3OPWA 3DXTA 3N9MA 5ANQA 2Q8EA 3K2OA 3K3NA 2OQ7A 5FYYA 5FZIA 4UF0A 5FZGA 3PUAA 3OPTA 3PUSA 5F2WA 3KVBA 5FZ8A 2YU2A 4CCMA 5F3CA 3KV9A 5F3GA 5IWFA 3PU8A 5A7WA 4GJYA 5F32A 5FP4A 4GJZA 5FY1A 2W2IA 5A3PA 2PXJA 3RVHA 5FZAA 5K4LA 5FYTA 4EYUA 2YU1A 5IW0A 5FZ3A 3PURA 5FXWA 5FUNA 4GD4A 3K3OA 5FZOA 5LY1A 4IGQA 2YBKA 4QU1A 3LDBA 4LIUA 5F5AA 4V2VA 5FZDA 5FXZA 5E6HA 4IGPA 2XXZA 5FZEA 5A7QA 4AI9A 3PDQA 2YBSA 5A1LA 4CUGA 5FZHA
chains in the Genus database with same CATH superfamily
2XLGA 4K21A 1DYKA 2VMDA 2P3YA 4Q4V3 2YC2A 4AWDA 2J22A 1RUC2 3FE5A 1LB2A 3A7QA 2WNOA 3DECA 5EFUA 3I2HA 1O3RA 1O4YA 3OF1A 3FFQA 2MHFA 5KBFA 5KR7A 1OMIA 2KA3A 5K0UB 2BVBA 3ZDVA 2R0FA 2R041 3IWZA 4PQQA 3MF9A 2GH2A 5A6XA 1F35A 1MS9A 1YI7A 2PLV2 3CKHA 3RYKA 4CXYA 4XFFA 1RUG1 1XJAA 5IUQA 1ZA7A 3SCHA 1SDDB 1LODA 3CL1A 3VL9A 5I0RA 3I4IA 4OMDA 4QXHA 2B9VA 3Q8FA 4AZZA 3K48A 3LIHA 1V6OA 1S4CA 4OI4A 4EN7B 1OLRA 1R092 2RHPA 4ATFA 1JYNA 3O7OA 5EJ3A 3MIFA 4LIVA 2C24A 4ZONA 5HCHA 5AC93 4JGZC 3VHNA 1K5MA 2HYKA 3KV6A 1UNBA 3H50A 1KQRA 4KU7A 4I3GA 1QQP3 3WHUA 4DPNA 4NHLA 5GZCA 5IATA 5IHRA 5LBCA 3VZNA 4BDVB 1OQDA 1V9U3 3WUCA 5M0TA 2ARCA 2QQVA 4OQ9A 2VMHA 3E6DA 1QDCA 4DQAA 1ZX5A 1OFSA 2PHRA 3KZ4C 4AOCA 3POGA 5HBAA 3OB8A 1AXKA 5GZDA 3NAPC 4BM8A 3AYAA 1FAYA 4IV3B 4G9SB 4Q0QA 1W04A 4AVVA 3CLPA 3MFCA 4JKKA 4KWKA 3N9QA 4XTPA 2VG9A 1Q56A 1SLLA 3GJAA 4A3XA 3VHOA 4CDXB 1DLLA 1BEV2 1POV1 2ETEA 4RS5A 4XUTA 3IAQA 1ONAA 3WCRA 4XF3A 3R4DB 2I74A 3VD7A 5BNPA 1WMDA 4XDOA 2RMU1 1E5IA 2WO2A 3USSA 1QH7A 3JBG2 3B94A 1YFYA 5TSWA 3WNMA 1ULGA 3BOPA 2P17A 5CFCA 2PMWB 4LITA 1VE0A 2D93A 2ARXA 3M1HA 3AMQA 2WWJA 4ARYA 3RJRA 2HWD3 3PIGA 1BVP1 3MPPG 3OEAA 1Q43A 5A3MA 2DVFA 2BOIA 3EO6A 3OBZA 1FOD2 3ASIA 3BB6A 3OPWA 3N9MA 3RSJA 4BK4A 4CCEA 3S57A 1RJ8A 1RINA 3UJOA 2ZGLA 4IEUA 1AUYA 2WNVC 5FMCA 1C8M3 2IWGB 3JQXA 2XHKA 4COVA 2K2SA 4E2GA 4OLLA 4K40A 1V6LA 2W87A 3HPNA 3AFGA 5C8CB 3FJSA 3GF6A 3V0AB 1NE4A 3T0DA 5F32A 3W20A 3UKVA 3HAGA 3J7NA 4WM7C 4E8DA 4KH9A 5K4LA 1COV1 4EROA 2WL1A 2E63A 1XOYA 3ILRA 4RD7A 4FOQA 2GNMA 3V0BB 1VBB1 4XXAA 3D6EA 1OH4A 2GN3A 4LA3A 1AR82 1RVF1 1YI9A 5T5OA 1VBD1 1G7YA 4AYUA 4FAGA 1GNHA 1DIWA 1H4GA 3Q8CA 5BNNC 2X5IA 2HEVF 3IMMA 1OVSA 1ZM1A 4IE7A 5A1LA 2ZBJA 2HEYF 1HV0A 1C1FA 2RDRA 2CL2A 2BJSA 2Y6LA 2ZX4A 2D5HA 4UW3A 2WS92 4YM0A 1AR92 4DRRA 3LEMA 1RUG3 4LO7A 4YW4A 3RI9A 3ZKYA 2ZEXA 3J7HA 2XBO1 3ETPA 2D3PA 1B35B 1NCRA 4K20A 4MGQA 4CCKA 3OBTA 3PU3A 4COWA 4QU2A 3ZN6B 4NIDA 2RVAA 4XBNA 1A34A 1JU4A 5IVCA 1UIKA 2IVJA 2A3YA 4NHXA 5LRSA 1NT0A 1X8MA 1MS1A 5DG2A 3S7IA 4JGYC 2DV9A 4CEYC 3ZFEA 1UMIA 3UT0A 1S0CA 1XNKA 3AKTA 1MZ6A 4OHXA 4XC9A 5A3WA 3J8F3 3S7EA 1U12A 1VMFA 4I30A 3UETA 1GZCA 2BU9A 4D7YA 4C8DA 1VRBA 3HQUA 5BXXA 1Q8SA 2C0ZA 3M70A 3ZSEA 1CAWB 1US2A 2WA3A 4UWDA 2VUAA 1OKOA 4FOWA 3RMXA 4EN6B 3AP9A 5FAXA 1AR72 1JZ3A 4R52A 4FPGA 1GUIA 2VNVA 3RZMA 1YXWA 1NY71 1ZZ7A 3FHIB 3JD73 5FJHA 4BMBA 2JX9A 4D6RA 1TME2 5FUPA 5ABJB 3FMGA 4TZDA 1D0GA 1XBFA 5DAVA 1WZXA 2GC1A 1W6QB 3LA7A 4MGKE 4P14A 1UZ0A 3UNPA 4AFAA 2E31A 3AL5A 4A2UA 4XETA 3ZR5A 2RDQA 3C7FA 4CSWA 2WUHA 1IS5A 1GNZA 2EALA 3NV3A 4JHTA 2VZSA 3WUDA 5FPBA 2QJVA 4QHOA 1OOPA 3KMHA 3RZKA 2DF7A 4MGYE 2RS51 3VHRA 1ZZ6A 1PNGA 3DN7A 4FXKB 3MW3A 4OULA 5FZOB 1AYM1 4QXCA 4AFMA 3DYMA 3H3LA 2WN3A 3O0XA 4GAZA 3GNEA 5AFEA 3LOIA 4PJYA 3I2DA 2UY9A 3CBNA 2HEWF 2ZX0A 3GDBA 4EZ4A 5FZ1A 4COZA 1LENA 1RGSA 2F4LA 2ZZJA 2VBPA 5T5JA 3JQWA 1PNFA 1GLHA 2VAUA 3RQ0A 1NXMA 1OLME 1BKZA 3DXTA 1QXRA 1GP6A 1S0JA 1F9KA 2EAAA 2EXJA 3EHKA 1MACA 5FOJB 5A3UA 2AEYA 1W8OA 1EV13 4RQPA 1V6MA 2L9LA 2E32A 2AACA 4GULA 2R32A 1RMU3 2HWE2 3H42B 5T3NA 1N1TA 3T2PA 1VBB3 1XXNA 2ADEA 4GWJA 2BNNA 1DBNA 1QJX2 1BCXA 2GALA 2Q0AA 2XJQA 1VBD3 1RUI3 4IUGA 3RVHA 4FPFA 3TNPB 3WVJA 1IQAA 3TN92 2XOMA 2LTNA 3CHXA 4Y24A 3TRSB 2W1QA 5A6YA 3GBFA 4PHZA 2WR9A 4LBQD 1E5HA 4NRMA 3BU0A 2B45X 3DCQA 1BQPA 5CA6A 2W0XA 5FXZA 2EXIA 5C3RA 5A7QA 1GP5A 1I9RA 3DUIA 4NIIA 3BKZA 5DZEA 4YZ1A 4YW1A 5J1XA 4AEKA 2JXAA 1XYPA 4PCRA 4Y22B 1PGL1 1IZ3A 1HRV3 2ET1A 3QACA 5T5PA 3BYWA 1GP4A 2VZOA 2WQZC 2DUQA 2DBIA 5A7OA 1F4AA 3WNXA 4YM1A 4Z07A 5FYIA 1XQNA 1FMD1 2W08A 4LKEA 2YDEA 4BYYA 3ZXLA 2FMDA 1LU1A 2SBAA 1JYVA 1N1YA 4I01A 4Y20A 3PUIA 1PO21 5HXMA 2JG9A 1WWYA 1ND2A 2AUYA 3ENRA 4OUSA 2WINB 1JBCA 4JCKA 1VBC2 5IYYA 4WM8A 1ZBE1 3D0JA 1O4ZA 1ZNPA 2IFRA 2VXRA 2WLQA 4RR3A 5AVAA 4BH9A 2XWBB 4CDUB 4DB5A 4MUVA 2VCBA 4IV3C 4RFT0 5IK5A 3WG3A 4XE9A 2W3JA 4A42A 4CDXC 2K0GA 2NZ9A 3GBWA 5FKCA 3ZSLA 4TTGA 2OW4A 5F3EA 4YFWA 3DPRB 1GZTA 4CP2A 1W2UA 2R0HA 4BQ4A 2KM2A 3HQXA 4UFKA 3H8UA 2ZGMA 4I3PA 1QJY1 4O9GA 3CNAA 4AQ6A 3VDDB 2KD7A 2WZR2 3GGLA 4LLFA 3VGIA 5C4WB 2A75A 4M00A 5FDBA 2DUOA 5FFOC 5IVJA 4X6RB 5DMYA 5C3QA 1DP0A 1PMIA 2WO7A 3PUHA 5D8AA 1W2AX 4QGMA 1H1MA 2EVXA 3POEA 1HRI3 5IK4A 1NA1C 5EZWA 3B93A 4N7UA 3N7KA 1AYM3 1V6NA 1NCQB 3VKOA 3VD5A 1QOTA 2CTVA 4QGNA 3LA2A 2CNAA 2RDSA 4QT6A 4PBPA 3TNQA 1R093 3OD0A 4FPJA 4AQTA 3VKFC 1VB2A 4AQ2A 2XQXA 2LW8A 4N53A 4HANA 4BE3A 1IS6A 5C71A 1RITA 2PAKA 4LO5B 1BLZA 1F4HA 3PTYA 4GH4C 4CCOA 1GZWB 1WKYA 4JVAA 3FLPA 4YVSC 3NVCA 4FI9A 1RUD1 4LBQA 5T52A 2E33A 3WXPA 1RUJ1 4G3YC 3W5MA 3A0KA 1S2KA 1C3HA 1XYOA 1DGRA 1RUF1 2QQNA 1CJPA 1GANA 3LZZA 3ZN6A 3ZYRA 3A21A 4D0QA 4QPIC 4QPGB 5FZ8A 1HB2A 5JXJA 3K75B 1N3OA 4CCMA 2C1FA 2VU9A 1PX3A 3NO8A 1J1LA 3NRUA 4BQYA 4W6XA 1US3A 4LULA 2XH6A 2WAAA 4CCCA 3VBOC 2A70A 3P1IA 4XIKA 3I54A 4EYUA 2IUWA 1B35C 3ZFFA 2RDNA 5FZ3A 3PURA 1VBE2 2G9ZA 5DDJ2 2JE9A 4H14A 4LOTA 2D3SA 1MR5A 2RS13 2NM1A 4AHWA 1UPIA 3M4FA 1F5FA 1WW5A 3PJQA 4C1XA 4XDQA 4E2SA 3MBWA 5FZEA 5DZFA 1CAUB 3J7LA 4C91A 1T2XA 4LK7A 1WD3A 3ATGA 3NNGA 4MH0E 5ACA2 4XFAA 3O1UA 1POQA 2P3IA 1RUH2 4MG2A 1LOFA 4WZFA 2VZQA 5IFTA 1OURA 3FHAA 1PO23 2CYFA 2XKPA 4NO4A 1PIV2 1UIJA 5A1FA 1KFXL 2WZ8A 1SLAA 4AHZA 4FQ4A 3RYRA 4LQRA 2RR12 3CJIC 1KITA 4FP3A 5FQ0B 2VUDA 4BJ0A 4QGLA 2RS33 2TBVA 3HWJA 2DTWA 2YROA 3NMBA 1ENXA 4GKYA 1BBT1 1TEIA 2GMEA 1UN1A 1J3PA 1LRHA 5EV7A 2BP6A 2JG8B 2DTYA 2Q1MA 4NAMA 2O1QA 2NN8A 4LTAA 3Q8BA 3SMHA 5FO8B 2OXBA 5HV4A 3CIHA 3DGTA 2WSVA 2WZEA 2RM21 5E1RA 4EJRA 1HKDA 4O61A 5LW9A 4GALA 1SLTA 1XU1A 4BK5A 4AGVA 4XJ8A 1QGLA 3IPVB 1HXS2 2AREA 1JYCA 2D98A 5KC5A 4JC1A 2LALA 4AQSA 1I6XA 1ENQA 1GZ9A 5FYSA 3VD3A 5GKAC 3PHMA 4N7IA 4INDA 1MQTB 5A7WB 2WT0A 4KBZA 1XC6A 3BIEA 1TQ5A 2Y0IA 2BZDA 1VBA1 3T4HB 5IVFA 1AYN3 5CBLA 2V73A 1AR62 3VBSC 1WD4A 2Y6GA 4QKNA 3S30A 1FV2A 1SBDA 4TXWA 3T09A 2Y6JA 4FVVA 3O5SA 5FO9B 5FY8A 5D21A 1G9AA 1PVXA 1DFQA 4PDWB 5KWRA 3I3MA 1D7PM 1FX5A 2Z69A 4ZZ8A 2GC2A 1FPN3 1SFNA 2AZ5A 1PGW1 1QMJA 4FXGB 2B46X 2BOJA 1RUJ3 1KS5A 3VBRB 1CAXB 1DLCA 1NQDA 4XF0A 4Y22A 3WX5A 3ZYIB 5IAXA 1BMV1 3H9AA 3WQBA 3POBA 5JOWA 2Q5TA 2QQWA 3LFIA 5A3NA 4DNYA 3P3PA 1LESA 3OEBA 2YHJA 5BNOC 5F7UA 1C5IA 3WDWA 3HT2A 5JI7A 4D8MA 2XWJB 5KXBA 2QDNA 4F8AA 1IS3A 4BA6A 2J1EA 1CR7A 2WQ8A 2VBDA 2P37A 2BNOA 2DBNA 3ZYBA 4YWAA 1ULEA 3IIAA 1K3IA 2VZ3A 2YU2A 1H6YA 3B00A 3HN3A 3JZVA 3KLSA 4TLGA 3VD4A 1VIWB 2RE9A 4QKFA 2YV8A 1MEC2 1SCSA 3O1TA 1W3XA 2BTVC 2FD8A 2R16A 1W8ZA 2H6BA 4GJZA 4AVTA 4JHZA 1AVBA 5B2GB 2TEPA 4B3NA 3RFRA 1QDOA 1V6JA 5FYTA 2W47A 3VZKA 4P9JA 2VR4A 1PVC2 5FLIA 4W6YA 3WQ1A 3WP5A 4LKDA 1XNBA 4LO4B 2Z2SB 3H3UA 4ASLA 1OF4A 4BOWA 1K5MB 2B42B 2P3KA 4QU1A 2N7GA 2WA4A 5H9RA 4AI9A 4YGBA 1A8DA 3SQOA 3G7DA 4FPLA 4XEZA 4OCTA 4CDUC 1ASJ2 4J6GA 5FV3A 1W39A 1UU5A 3J4UH 4V1PA 1Y9GA 4H7LA 4QX8A 4JDOA 5FZFA 2VQTA 5CYYA 3DPRC 3USUB 4MADA 4PIZA 4E27A 5JOYA 2HWE3 1UY2A 4V2WA 5FZCA 1XNCA 5FY5A 1FATA 4CEWC 1IHMA 2NQYA 4Y4YA 1QJX3 1YRZA 4RS5B 3VDDC 4XXPA 2A6ZA 2OT7A 5C4WC 5BNPB 4NMIA 3S5QA 2OX0A 3WNNA 2PHWA 1X82A 5DUVA 4OMCA 4CTEA 5BNQA 1GYKA 3AJYA 1JN2P 5L19A 5FY7A 1XRUA 2RM23 4B7EA 2QTWB 1C5HA 4UXAA 3KS7A 5CB7A 2FDIA 1EAH1 2YBPA 1NXD1 4YZ5A 4FPKA 5CFCB 5JPNB 2W68A 4HN1A 1NCQC 1XSRA 3FN9A 3WNKA 2RJ2A 3KQ4B 1UXZA 1QJU1 1UD1A 1V00A 2DCZA 4IL7A 1WW7A 4HETA 1W90A 1TVGA 1Y7BA 4Q4V1 4XJWA 3VBUC 4LBKA 4QHZA 4QQ2A 4QPGA 2NYYA 4ZS3A 3ZVXA 4DY5A 4Z1VA 4Q0UA 3IIIA 5SV5A 4UT5A 1VBA3 3W9AA 2WT1A 4EV0A 4UOJA 1AX1A 4NHKA 2GSYA 2XJPA 1WCUA 3ES4A 3FLRA 1REFA 2C4XA 4M01A 2GDFA 4M0HA 2G9FA 1WCQA 2DCYA 4CDWC 2JKXA 1OA3A 3ZFGA 1ACCA 1REEA 5BPXA 3P6BA 5FY4A 5JZGB 3ILFA 1I5ZA 2ZGKA 1Q8VA 2W1WA 1DQ0A 3CDZB 3RRDA 2HJIA 3UV9A 2WKKA 2E6VA 3KD4A 3B7MA 1KGYA 1JOPA 3I7DA 4XHBA 5AC91 4NE9A 4MVTA 4RHV2 4AI3A 3WP6A 1XSQA 5A80A 3ZXEA 4LXLA 2UURA 3ZXDA 5A7PA 1QQP1 2VPVA 2EIEA 2ZHLA 1FT9A 4SLIA 4QX2A 3OUIA 1ENRA 1F2NA 1OKQA 2G1MA 1V9U1 2P6CA 3PJYA 2HWF2 3LPGA 3MHZA 1OH3A 5FZGA 2LRPA 2WZR3 1AF9A 2Z4FA 1NCRB 3SEPA 3SEEA 5ANNA 2FDFA 3WP4A 3TEZA 1D4M1 3A4UA 4MO3M 4K9SA 1R1A2 1R082 2HWC1 5FLJA 3PLQA 2ERFA 4XPVA 3ZDSA 5FP4A 1LKNA 4HMZA 2R1BA 5FY1A 3ZFEB 5JMOA 3ACIA 3HNMA 2DUPA 4LBOA 3WNOA 4LHNA 1LGNA 4UFIA 4XF4A 1R64A 2GNTA 3AKPA 4P9WA 3ZX7A 5FCCA 3KHCA 3AYCA 3AKQA 4BQ1A 1COV2 5J48A 3HOBA 1KJLA 4IERA 4JV4A 4E9KA 2R063 3UJQA 1W8TA 3H8OA 2QQUA 1JYIA 1CIWA 4JAAA 1HJGA 3K51A 1QXJA 3JU9A 2HWD1 2ZKNA 3MIEA 2E7AA 3E6CC 5T55A 2YXSA 3K4AA 1JYWA 4ITCA 1Q5OA 4Q1PA 3QLQA 2I2SA 2V72A 3RGBA 3BPZA 4O9EA 4LLOA 1UOFA 3ZSKA 2WFF2 1UOJA 4Y5SA 2VOWA 2JIGA 1AXYA 4W6WA 5KXCA 1SG3A 2C9KA 1VAMA 3F2ZA 3X29B 1MS8A 1SHWB 1ST8A 3JB8A 4KNCA 4W4ZA 3UK9A 4LO8A 3VZJA 1W6NB 2QZ3A 1C8M1 1UMHA 3MZHA 3VHPA 1Q3EA 1QJZA 4XDPA 2LS6A 3ME2A 1H8TA 1OOPB 3DYPA 4UI9L 4PDWA 4Q4Y2 3ZXGA 2Y64A 1EAH3 4OZXA 1QJEA 3WEZA 1DGRN 1PHMA 4B1MA 3LDRA 5EYXA 2H6CA 4IV1A 1MQTC 1QJU3 3LD8A 2WLPA 1BK0A 1URXA 1XU2A 2CAVA 3FZ3A 1YIFA 4LBLA 3HR9A 4M3CA 5J36A 3AP5A 1GMMA 3KWVA 4A6OA 2QQIA 4IE0A 3WR0A 3VDBA 3HNYM 2ZEZA 3OY8A 2ZEWA 3WINE 1DGWX 4DINB 2R7EB 4M0NA 1RUH3 1A78A 4MHUA 5E16A 3WNPA 1JW6A 1LR5A 4TLFA 4AGGA 2P1BA 3ZYPA 2VO5A 2EAKA 2AH2A 1UY1A 4RQPB 5A6ZA 1M4WA 3HNBM 3PVOA 1JUIA 3CEWA 4FTEA 1SLCA 2IC1A 1YFWA 4B7KA 1GBGA 2PN5A 1BJQA 4YNIA 5A3TA 4DMIA 1PM7A 2JJ6A 2UYBA 4YG6A 1C57A 5CNAA 1AXZA 3IT8A 4N90A 4UW4A 2DYCA 2QQMA 2EA7A 4P9LA 5LY2A 3J8F1 3UKNA 3GHNA 3BTYA 2ARAA 1XE7A 2DURA 3POYA 3MIGA 4JGZA 5EYYA 4ZZ5A 5L7OC 3BUCA 3ACLA 3WG1A 1F31A 2RS52 2ZGOA 3O1SA 1LEDA 1QU0A 1UMZA 3L2HA 4S2DA 5FYBA 1TMF2 1DGWA 3K46A 1GOHA 3JD71 5EJZB 4NPRA 5FPAA 5I8YA 2QE3A 2E51A 4FCAA 4XQDA 2HWB3 2QUOA 1D4M3 3USUA 2NP0A 5JMCA 1K5MC 1HXS3 4XFBA 3LCPA 2MEV2 2W92A 4ORFA 4NVPA 2HWC3 3CJXA 1RTVA 4UF0A 2X10A 1LULA 4COYA 1EPWA 2YC0A 4AG4A 3TOJA 2WO1A 2GMPA 4QKBA 4Y20B 5CZKA 5DUWA 3A0NA 3MW2A 1LGBA 1J83A 5F3GA 2JG9B 3T2TA 4A6SA 4Q4W3 4Y1VA 1ND2B 4CU6A 1ND3A 4E8CA 1O5UA 1FI2A 4QPYA 4WM8B 3LE0A 3N35A 4DS0A 4RR3B 5BUVA 1F15A 1O6UA 4IEPA 3RJ2X 4J1XA 1YJLA 3D8CA 2YU1A 4Y1ZA 1IG0A 1UYZA 4AVAA 4LHSA 5GZGA 3K3OA 4XACA 3BGAA 4EWEA 3BU7A 4IGQA 4KI5M 5FIXA 3OCPA 1W6MA 4V2VA 5J37A 2GH8A 2XXZA 1VMHA 4RS5C 1PX4A 3FL7A 3GBGA 2PHTA 1PO12 2FCVA 2J1AA 1BK1A 2XGXA 3WZ1A 1H0BA 5BNPC 1ZRRA 2A7AA 5JXHA 1WBLA 1W9FA 2A73B 1S0GA 3V64A 3HBZA 4PF1A 1JYXA 1ALYA 4MHRA 4RA0A 4YVWA 1EV11 2FDKA 5D8AB 2Q8OA 3Q8EA 4MGTA 5C5TA 3CZJA 1LOEA 5JZGA 1RMU1 3POIA 3SCFA 3ABZA 2ZGPA 4YW3A 3EXUA 1MZFA 1W8NA 5FPZA 3WLUA 5DAXA 1IG3A 2CV6A 1RUI1 1HB3A 3B02A 5GM0A 5FXXA 2V4VA 1VP6A 3LA3A 4IDZA 3WF2A 2XLFA 2R6QA 3D0SA 1Z7S3 4L2NA 4ZU4A 4E2QA 4EQVA 5HCBA 4N53B 5DPNA 2YGLA 2Z5WA 1GFF2 4MX3A 4LKSA 5FZ7A 1TNRA 3B9CA 4FO9A 2J1RA 5JIUA 4R9DA 3M3OA 3N9NA 3TBDA 3WF3A 1U5IA 2VZUA 3GM8A 4LBQB 4LNVA 1W8WA 2VOKA 3SHRA 4E4SA 4OI0A 1ASJ3 1UZVA 4FOYA 2WYFA 1HRV1 5FMOL 2P5BA 5A7SA 3PNAA 3SKJE 5CADA 4L0PA 2X5IC 4Q4X2 2XR4A 4NHMA 4QQLA 5JIAA 1YUDA 2ID4A 4JKLA 1CX1A 2D6LX 1K12A 3QD6A 2VD7A 2ORXA 1QJY2 2KR2A 4WZCA 4NWWA 5F9TA 2W91A 3HT1A 4DRVA 2UWAA 3D4KA 2B4KA 1PMJX 2B8MA 2EIGA 2VW1A 5EIYB 2QVSB 2B7YA 2XVLA 1NCRC 2VXJA 2J1UA 4NHYA 5IVYA 3ZFFB 4CP9A 4AXOA 2QQLA 1QWRA 1EP0A 1DDLA 2JWPA 1X50A 4LPLA 2HBTA 1VALA 2CU5A 2VOVA 2W5FA 1SLBA 3AL6A 2YC4A 5LBBA 1W06A 1JODA 5DAPA 4XFCA 2R072 4NPLA 5FWEA 4R9AA 4KG0A 1QJFA 5T54A 2Y0OA 3NJZA 1OXCA 4XAEA 3RYPA 2OUHA 2QQJA 5F1RA 4TN7A 1RUC1 2OIIA 2D6PA 3B69A 1WCDJ 1W6NA 3Q8AA 5HCAA 1CVNA 3TEXA 2D6OX 3OPTA 3PUSA 5GLUA 5JLVA 3GCWA 3C7OA 5BYNA 1C1LA 1YCIA 1NQJA 5IK8A 1WLWA 3O1OA 1E57A 1KFUL 1WUVA 2C9AA 4OVEA 3LKJA 1X7NA 2PLV1 1HRI1 4PLMA 3OJBA 3UGFA 1RUE3 4DUWA 5JOZA 1OSGA 3DKQA 4GB32 1LHOA 2WABA 1OFNA 3AZWA 3N7LA 4PIYA 5DN2A 3OGSA 4YW5A 5L73A 3MV11 3WDVA 2ZGNA 1ULFA 1YQ6A 3KF5A 3I8TA 1YQ5A 5FXWA 1R091 3IBMA 4GD4A 3WF0A 4AEDA 1W6PA 1RHI3 2ZAHA 4HPKA 4PI2A 4RHV3 1OOPC 1DHKB 1GU3A 1QH6A 3H3ZA 4U2AA 3RMYA 4EZHA 1YFXA 1AHSA 4MLOA 3FWEA 1LJ7A 1CN1A 4I02A 4D7TA 2SLIA 1KXGA 1UOBA 2C26A 2P4EA 1D2SA 3THTA 3SCGA 1XNDA 3H1YA 1ODNA 4D3WA 2CY6A 4FTSA 3AVRA 3NV1A 4AE2A 3SITA 1IKQA 1CX4A 3QBQA 3E5XA 2VGDA 4IGOA 5K0UC 3OYWA 2PAMA 2A1XA 1NZCA 4QMAA 1J1TA 4QB2A 1BEV1 5FZMA 1UKGA 1HQLA 3PUQA 2VULA 4YW2A 3ZXAC 3ZIXA 3K77A 1NAEA 1SBFA 4P9GA 1UZWA 3S0MA 2VE1A 3HD8B 2WRAA 3VZLA 1KD7A 1FNZA 2RS11 1J58A 3MDPA 1BBT2 1QY4A 1W0PA 2G9GA 4IEXA 2A5ZA 3WDUA 5JXGA 4AEMA 2Y6FA 1RXGA 1N3QA 1W3VA 1X9TA 5DUUA 4Y3OA 4HVRA 1LAJA 5DAQA 4GKXA 1RB8G 2WFF3 2A6VA 3NW4A 4AVSA 1OQ1A 2PAEA 3HBKA 1W6OA 1SDWA 3MLKA 5LBEA 3MF6A 3O14A 3ROUA 3URFA 1ULDA 5JXIA 2PELA 3FX3A 3ZXFA 4Q4Y3 2DWRA 2ILMA 2ARBA 5CG8A 2RS31 4HVOA 4K6BA 1NLSA 3MUY1 3MV01 1DQ5A 1K45A 2B5HA 4JDNA 3VZOA 1MPXA 1H4HA 3R6SA 2VZ1A 2JICA 3UGHA 2PHXA 1UY3A 1FXZA 2JG9C 2P2KA 1AR81 2V09A 2AR6A 4ONUA 3N9LA 3WW1A 3PMEA 4EN0A 4XCAA 1RUC3 2JE7A 4WM8C 1ZBA2 4YGEA 3ZYHA 1Y43B 4RR3C 1OVPA 1PGW2 4OQ8A 4Y1XA 4IE4A 3M7AA 1OPMA 3O0WA 2DCJA 3NSTA 1IPJA 4QX5A 2DCTA 1PK6A 4XAAA 2WS91 4META 1SEFA 4K1ZA 2GNDA 2PLV3 3GCXA 4XF9A 3VLBB 4D7SA 4ZU7A 1EYBA 4MGZE 2HYXA 1NA1A 2DCKA 5KHKA 3GZTB 1VRH2 2JE8A 3U0ZA 1GQPA 2OZJA 2IXHA 4AFCA 1AYN1 3BI3A 1I5PA 4QHBA 5B4NA 5D2AA 5C8CC 3VD9A 2AENA 4ISQA 3GZAA 4CP1A 1JS9A 4CCDA 2HH9A 3BTXA 1O3SA 1W9YA 3RZLA 4FFGA 5D8AC 3NL1A 2VTXA 5EXOA 2MNGA 2YY1A 1FPN1 2UY8A 4GH4A 4K1YA 5B4XA 2BNMA 3W58A 2NMNA 1JZ4A 1VR3A 3EJKA 4YVSA 2ZJCA 1AR71 1TMF3 4CA9A 2EXHA 4LUMA 1HQNA 4H2AA 1X9PA 4XURA 1V6IA 1QOSA 1NG0A 5I91A 5JSPA 3ACFA 2BQPA 4LE4A 4LHLA 5A32B 1Z0HA 3EB7A 5FZBA 3WG2A 1YLLA 5FZ9A 3WF4A 4CCLA 5BV6A 4N53C 1ZRCA 1CGPA 3THDA 1Q8PA 4UYBA 1LNSA 4Q27A 3HEIA 5FMDA 4WVMA 4IETA 3M3IA 2ZCWA 3M3QA 1BEV3 1J84A 4BLIA 4QPWA 4CUBA 1SACA 2BUKA 2YGMA 4GXLA 4P9IA 3IZOA 3VBOA 1NUKA 3ZFGB 3RWNA 3JBG3 2FHRA 2D6KA 4I0WB 2Y8KA 3LB9A 4UFLA 3T1MA 2D97A 5A1AA 3MGUA 4MGIE 3AJZA 3MPBA 1CPMA 5DAWA 5EJ1B 2VL4A 4ZS2A 2BRTA 2R30A 2Y34A 4HOOA 1VLNA 2VQAA 2UWCA 2E9QA 1FOD3 3VKNA 2P6HA 4ZPIA 3SH3A 5CFDB 4AL9A 4NRPA 3FUOA 2VJXA 1W2TA 3AX4A 4URAA 3VUOA 1AL22 4O7XA 2ZEYA 4CDQB 1QKQA 5F8PA 2XPJA 2D44A 3AZZA 3ETQA 4JKMA 4M4RA 3WDYA 4YYOA 3RI8A 4CCJA 5ABJC 4HK9A 1MS0A 3AZVA 1DQ1A 1REDA 2E53A 2XONA 4Q4V2 4XJZA 1KEXA 3CJIA 1H1AA 1CONA 3I3BA 5JWPA 2JDPA 4WVWA 1L7RA 4KL1A 3SH4A 2HWE1 5E88A 1LOFC 2ZX3A 2H0VA 1VAVA 4BQ2A 2ZAAA 1QJX1 1AR83 1DYOA 2YPDA 3QH6A 4J1WA 4RGGA 4HBNA 4Z8BA 1GOFA 3D82A 5CEHA 5L9VA 2JIJA 3PTRB 1Y4WA 4JQTA 3TN91 3ZMOA 4LT5A 5FZ4A 3FHQA 5DABA 2IVIB 3E97A 4LMFA 5FYMA 5CISA 3WDXA 2E26A 2GZWA 1W0OA 3CU7A 4PIXA 3ZM8A 3BVCA 3HQRA 5JOXA 1L7LA 1G9CA 4N9HA 2WS93 1AR93 3RZZA 4ZHNA 3FFZA 4FAHA 3I2OA 1JHNA 5AC92 3AXEA 2ZXQA 1SLIA 3AZYA 4XTMA 4DXZA 2FMYA 1GWMA 4Q4X3 1AJKA 4KGGA 1WBFA 5FZIA 4N43A 2WNUB 1J3RA 3VBHA 4NRQA 1IGOA 1JHJA 1BXHA 3KV9A 2YMZA 1TG7A 3VBSA 2QCSB 4I0AA 4JQRA 2IXJA 3OG2A 4IESA 5IJRA 1H8TB 5GZEA 1MZEA 3DKWA 3AP4A 1G86A 2JDUA 3NKGA 1S55A 3S6PA 1F5JA 1SFYA 5J09A 2Z42A 4DEQA 4F3JA 4IV1B 1AR73 3WOGA 2W1SA 4CUCA 1TME3 2CWSA 4ZKTB 4M3CB 4IE6A 2YBKA 1JOBA 4LIUA 3VV1A 1GOGA 2ZA9A 2Y6HA 2R073 1W03A 2GN7A 2BFUS 5BNOA 1SPPA 2GU9A 4CP0A 3OY8B 4XIOA 3UGGA 1KJRA 2FQPA 3GYDA 4Q26A 1S2BA 2LROA 3RZGA 1MVEA 2XB6C 5C5UA 5C3OA 5FLHA 5JR7B 4QDQA 5KXEA 2HWD2 2PHUA 3ON7A 2WZR1 4ZU5A 1UKRA 4QX1A 3T4VA 4Z82A 1A6CA 3OBAA 1ZA4A 2WFPA 1GWKA 5HPOA 1BYHA 3B3QE 3RDIA 3AM2A 4ET7A 2OUJA 3B01A 4LO6B 4GB33 5KXDA 1C8M2 5LA9A 2HKXA 3R4UA 4GWIA 4JDMA 1G8WA 2OA2A 2QQKA 4YGDA 1A8MA 4M4PA 1ZRFA 2W52A 1ULCA 3JB4C 5FZLA 2FBEA 1LHUA 4JGZB 1M06G 3QH7A 3UL2A 3V65A 5FYZA 5IVEA 5FMBA 1UW8A 3DF0A 4D6SA 4P9XA 4NAOA 4AI1A 4N8MA 3AP7A 3VBFA 5APAA 1X8EA 5C8WA 3LEIA 2JD4A 3CO2A 3SKVA 3H1WA 2R061 1UF2C 4HFSA 4Y26A 4Q8LA 3K4ZA 4ATEA 4LEJA 4QAWA 2PQQA 4CVUA 3INAA 4LKFA 1TZOA 5LBFA 2GP3A 2IZWA 3GXUA 4QQPA 3N4MA 5F39A 4AAXA 2VMIA 3NAPB 4UF0B 4OHYA 4QM9A 2VVDA 5K8SA 4B8EA 2V5YA 4HZFA 2QZ2A 3U75A 2R042 4IEQA 3PMSA 1I1EA 4Y5Z0 2D3RA 3HMYA 2C6SA 1OA4A 4OI2A 4CEWA 2DU0A 3TN93 2GAUA 3R0RA 1ND3B 5BY5A 1RUG2 4EN9B 3D3AA 2CDPA 2JKBA 1QNWA 3LIGA 2PTMA 3THPA 5LASA 3PVNA 4Z92B 3GHMA 3MYXA 4ZY9A 4BZ4A 1WCKA 4AI2A 5LEKA 4QQOA 1JUHA 3E1F1 1IOAA 2WC2A 4AI0A 5C9AA 2VH9A 2VC9A 3POJA 4X8PA 4XABA 3NJXA 4FPEA 1IQDC 2PFWA 2WN2A 3BN6A 4S2HA 5DDJ1 3VKLA 4HVQA 4BXFA 1W6MB 2VQ0A 1RXFA 3J8F2 2FDHA 4XFHA 5A32A 3RPQA 5G05L 1Z78A 1MS4A 3AK0A 3SXWA 1O4TA 3KVAA 4UBHA 4LORA 2Y38A 1RUH1 1CAVB 2JDZA 1OA2A 4QKDA 3NQHA 1LECA 5ANQA 4L99A 3JD72 2ZKLA 3K3NA 1LU2A 1QHDA 1J3QA 2VOXA 5A33B 4YVWB 3RS6A 2J1TA 1VBC3 1F8VA 1U5YA 1DYPA 2X09A 4CDWA 5FOBB 4GJYA 4QPGC 1FV3A 5I93A 3H8XA 3OOXA 2X8KA 4SBVA 4H3WA 5KHHA 2FDGA 4XFIA 1UYXA 4XHXA 1H30A 4DUVA 5FZAA 3O1VA 3ECQA 2JENA 3CQOA 4W8JA 1W9SA 2RMU2 5IAVA 5IW0A 4DXSA 1OUSA 3LGRA 4UFHA 1OF3A 4NIHA 4LHKA 5CFDA 2UU8A 4KWLA 3D5OA 1ZBA3 4CDQA 2C5DA 2BGPA 4U36A 1DZRA 1HQWA 1QEXA 2J1VA 4YLZA 3EQEA 5CAZA 1YC61 1Y9MA 3H7JA 1UZZA 2ZMNA 5FZ6A 2JDAA 2HWB1 2XDVA 2QQPA 1XPWA 3PVEA 2IXCA 2GC3A 2BEOA 1HXS1 3MEPA 4OHVA 1UZYA 1S0FA 4FT8A 5H9SA 4XOGA 5J96B 5LB6A 4HG6B 3OUHA 1AL0G 1GNYA 2XLAA 5IK7A 1H2LA 1YIPA 3GALA 1VRH3 5DZGA 3RZHA 3KM5A 2DVAA 3KGLA 4Q4W1 2JDHA 1EV12 4XMIA 3O1RA 3ALQA 4E4ZA 1N3PA 4XQWA 3ZIWA 2VCMA 1SQ4A 4CP9B 5J7MA 1RMU2 4CPBD 4B29A 4Y4RA 5FYHA 5C33A 3KQRA 3CZUA 4WVVA 1HIXA 1VBB2 1RC6A 5F5QA 1RVF2 4R9BA 4TSVA 1VBD2 1RUI2 4FFIA 4P9YA 5A7NA 1WMFA 1ZRIA 2JDYA 2RJKA 2VY0A 2PQSA 4GWNA 5F2SA 2CAUA 3VZMA 4DFSA 2B9UA 2UYAA 2D6NA 2JG8C 5C3PA 1VJ2A 5FWJA 1UWWA 1NLQA 2GMMA 1WW4A 5HXVA 2WNUA 5LEJA 3I59B 3NV2A 1JXNA 4XBLA 2QNKA 4QB6A 3NNFA 5DUXA 1YHFA 1NZIA 2Y33A 1N1VA 3SLIA 2ZOEB 4YFZA 1JZ5A 4JRLA 4AW7A 1LEMA 1CPNA 2XBO2 2DVGA 2OQ6A 5CIRA 4A41A 1VAKA 1ZZ8A 2BBAA 5FMOS 4CZSA 2JB4A 3H1MA 1P8JA 3ZSJA 1D2QA 2VW2A 4B4RA 3S5AA 1MEC1 2BWCA 2WO3A 2Q8DA 3NNJA 1VBE3 5DDJ3 4C0BA 3ELNA 1W8HA 2VBBA 3W59A 2FZ2A 1FYUA 2VMFA 4EE2A 2ZX1A 3U78A 4HKOA 1PVC1 1GWLA 4BLJA 4BWOA 2ZPXA 4W50A 4EN8B 1WLDA 1W6PB 1Z7S1 4AEDB 3O1MA 4HPKB 4X8NA 3RZJA 2OPWA 1H6XA 2X53S 4NR1A 5ACA3 2WAOA 2WWUA 3BOWA 4PDWC 4BQ5A 1JTZX 4URTA 2FZ1A 5GALA 1NY72 4XUPA 2VW0A 5FPUA 3ZLIA 2VZPA 1AL23 1PIV3 2IXKA 1N47A 4IV1C 3VBRC 2FDJA 4ASKA 1ASJ1 1JZ2A 2TNFA 4CXXA 4KG8A 3KHBA 4LK6A 5FYYA 2YG0A 1IKPA 2RR13 2PHFA 2W39A 1V0AA 1RYYA 3I3EA 2BDRA 4B4PA 2XJSA 1YEWA 2DVDA 5KC6A 3WNLA 3GZEA 1MS5A 3PU8A 3MIDA 3OYWB 4PLOA 4NN0A 3WQ0A 1CZVA 3H7YA 3VL8A 1L3JA 4KQ7A 5JVVA 3W5NA 2BGCA 1ZZ9A 3I3DA 5L7OA 5A3LA 1HRI2 2MPFA 3O12A 5G04L 1E5RA 3ZYFA 4YSFA 4BB3A 2W95A 3I49A 1AYM2 2WYSA 5FUNA 3T3YA 2VMCA 2WZPP 4EWAA 4D94A 2W1UA 3LDBA 3B9IA 5DG1A 1TNFA 3ZKUA 1DZQA 4CPBA 5E89A 1XB9A 1LTEA 1W05A 4AR2A 3NAPA 4AFBA 3I97A 2ZHNA 3N9PA 3T2OA 1JZ7A 4DO0A 2G19A 4COUA 1V6KA 2WBKA 2HBUA 4K8RB 4Q0PA 2XUMA 2WT2A 2DVBA 1ODMA 3W21A 1UCXA 1AR63 2ES3A 3AVSA 2VVFA 1W6OB 3UESA 1H9WA 3MICA 2DU1A 4AF9A 3IKWA 4L9BA 4QX3A 4HKWA 1POV0 5EWSA 1G6NA 3EBRA 4XZUG 3H8RA 4PLNA 1UQXA 1RUE1 3C7HA 4HK8A 3T30A 4BPZA 5LK7B 1HN1A 5A33A 3DXUA 1APNA 1EUUA 3IN9A 3IB3A 1WLCA 4YGCA 1RUOA 5ERLA 3T1LA 1AX2A 1ND3C 1RHI1 1CZTA 4RHV1 4A7YA 3FBYA 4K7JA 4YARA 5F5CA 5F5IA 1CAVA 4CE8A 5J3UA 1WA4A 2WNVA 5JI9A 4ARXA 3N36A 2RS12 1GR3A 5CFCC 4XQ4A 3AYDA 4OHWA 1PGL2 3MW4A 1YYNA 2ZACA 3QOPA 5I8SA 1PK6B 2RJLA 3ST7A 2HWF1 4Y1UA 4NPMA 4S2FA 1W28A 5GLZA 3U4XA 3MLLA 1AJOA 1MEC3 3U11A 3BPSA 3LEKA 5FP7A 3TYJA 5FZ0A 3DYOA 4TWTA 4WM7A 1WMEA 1FMD2 1GKBA 1KDMA 1UU4A 1NA1B 3G6JB 2NPIA 3LF7A 4FPHA 3VB9A 2ZX2A 3WCSA 5FY0A 2BGOA 1PO22 5LCWL 1R1A1 1R081 1PVC3 5BNNA 1HLCA 4RSUA 5FYUA 1H2KA 1ZBE2 4YVWC 5HCFA 3U07A 1QF3A 4MXWA 3NWKA 1H1IA 2ATFA 3OGGA 4YZ3A 1MZ5A 1HW5A 4GH4B 5JZGC 2RS32 1NKGA 1IPSA 1XNTA 4YVSB 4DIQA 1CD3G 3KV5A 1ZZCA 4FPYA 3TB0A 1PZ9A 1U5XA 1BVVA 2K46A 4FPCA 3I2IA 5FY9A 4YZ4A 4QPIB 3NKTA 1O91A 4WVMB 2WFF1 3SC7X 4JGYA 1YJKA 4CEYA 2F17A 2OKXA 2AC1A 2H0BA 3M8LA 2R043 2WQ4A 3HIFA 1O3QA 2W9XA 5AFBA 4H55A 2QFEA 1JZ6A 1GQGA 2JDNA 2IXLA 2VTXJ 4J25A 5FK7A 3VBOB 5HI0A 4FQZA 1ZVFA 3A22A 5CKQA 1H9PA 4OFGA 4BIFA 4Q4Y1 2W2IA 2WJSA 4NIGA 1EY2A 4IQPA 5A3OA 4M3CF 4MV2A 4PF5A 3ZFEC 1AYN2 4H7MA 4IE5A 4MXVA 5GLWA 4QX0A 4XBQA 1K5JA 2E7QA 3WD5A 3TAYA 5E8AA 1DG6A 2CSGA 4R9CA 1RIRA 3I59A 4B1LA 2QKDA 3GZUC 4NIAA 1FPN2 1RUD2 4P5HA 1LOGA 2ET7A 5FP3A 1UY0A 4QDRA 5FUIA 4HLTA 1RUJ2 3O1PA 2YZ4A 3WF1A 4L8QA 2A6YA 4XVHA 5DXDA 1RUF2 4YW6A 2ZHMA 3NJVA 3U4SA 3MI8A 2YPJA 3CJIB 3AFKA 1ZYBA 1RUNA 3P3NA 3DV8A 4YM3A 4AVCA 4HSJA 5F6KA 4DXRA 2XHNA 4AHXA 4C0HA 2XVKA 3M2MA 3MO4A 2A3XA 1POV3 4NWVA 4O65A 3KGZA 3ZMNA 2A3WA 2W94A 3LSEA 3ILNA 4KWJA 1UX6A 2ZTNA 2RMU3 4LBJA 5LK5A 2XUEA 1RL3A 1IS4A 4XMAA 4Q5OA 3OBRA 2VTFA 4NOTA 2VZTA 2VOTA 2R1DA 3PL0A 3I3QA 2CWMA 2W46A 1T6BX 3MLJA 2HWF3 4TYSA 3ZYGA 1TMF1 3NNMA 1GQHA 4P00B 4A44A 3O0VA 2F6BA 2QQOA 4AEDC 2BYVE 1UX7A 4P5YA 1OUXA 4B4QA 2YFUA 4N43B 2MEV1 3VBHB 4N9IA 1R1A3 1R083 2J7MA 5K9YA 4EWDA 5K0UA 2DFBA 2UWBA 1U0AA 3VBSB 5D1IA 4Y1YA 4FP2A 4RQPC 5LATA 5C3SA 2I07B 3N9OA 1PM4A 3IDCB 1HN0A 4LOSA 3ZPOA 5FP8A 3WY6A 1HB4A 4Y5TA 4X6QB 3L2YA 3AMNA 3JBG1 2PYTA 3AP6A 1COV3 4C90A 5FYVA 1VB4A 3WQ7A 5I8TA 2BWAA 2VCCA 5IVBA 5JPMB 2AGSA 1RVF3 4BMEA 4KWUA 3AC0A 3HN1A 3WG4A 2YFZA 5F37A 1UYPA 1SPPB 4RFRB 1VMJA 3ACGA 5BNOB 1FOD1 1B09A 1KS4A 5I0UA 5FYCA 5FPVA 3IDAA 3WW4A 1PO11 5JR2A 2RM22 3KB5A 4KMQA 4RN5A 5A70A 3FBMA 3E5QA 3M3EA 1O59A 4MOAA 5KHIA 1UY4A 1LOCA 4QB1A 3U14A 3WW3A 4FTBA 1CJDA 3K2OA 3ORJA 3I2KA 2XBO3 1W2OA 3AYEA 4I2OA 4CU7A 2B39A 4XJAA 4XJ9A 3U37A 5CKNA 5IWFA 5I0DA 4IV3A 4IEZA 1VBA2 4GQ7A 2R49A 1YQCA 4FPOB 4PBOA 5FO7B 4JTOA 4CDXA 4RL7A 5L9BA 1PMHX 5LZ6A 1JOJA 1E5SA 4AEJA 2BBVA 1ND2C 2A71A 3DL3A 2JD9A 4IW3A 3ZN4A 1JMUB 4Q2FA 4PQ9A 4Z2WA 4I09A 3JCIA 4XZPA 4YW7A 1G9BA 3VBFB 2HLEA 5LY1A 5AVPA 4M3CE 3TEYA 5FZDA 1BMV2 4IGPA 2DDUA 2YBSA 3AMPA 4CUGA 4DEVA 5FZHA 1AR91 1NOVA 3LPFA 3KF3A 4FSJA 1XE0A 4G4FA 5FJKA 4E4HA 2XQRA 4AI8A 5JAXA 2IXIA 2OPKA 5I0SA 4Q4X1 1QOOA 2CGNA 4AGRA 4ASMB 4GZ9A 4YM2A 1OI6A 2GNBA 1BHGA 1GICA 4QQHA 4R4XA 4GMP0 3RNSA 4CEWB 1H2MA 5FREA 2BVVA 3JXSA 5C8CA 1PK6C 2XJUA 4UW5A 2WNEA 2VNGA 5KHJA 4JX0A 5I0TA 4CU8A 3ZXKA 2BV4A 2V4AA 3AMHA 2X05A 2RS53 1VPHA 3A23A 4WVZA 3JUUA 3R4SA 5C9AB 1CESA 3WV6A 4GMP1 2CDOA 3V0BA 5EP9A 1TME1 4L11A 1WA6X 2LM3A 3U10A 3C7GA 4HT1T 4QWNA 2R071 1O7FA 1XNAA 3VBUB 4QPIA 2MEV3 2JDMA 2ZMLA 3LFMA 3TWIA 2RV9A 5F6LB 5FZKA 3OTFA 1JU3A 1PGSA 1SMVA 2R062 3IDBB 3J7MA 4WV8A 3IAPA 4HONA 4JRAA 1K42A 5FPLA 1W2NA 1UXXX 4JZRA 2OS2A 4KBBA 1YNAA 1HJFA 1W0NA 3MUZ1 1B35A 4W65A 3ITQA 1O8SA 4CDWB 1CWPA 3FUQA 4IEOA 1JI6A 1UU6A 2D43A 5LRRA 2FCTA 1S0IA 5FXVA 4GB31 4LA2A 4OUEA 4A3ZA 2ZGSA 4CRQA 1UYYA 4AAPA 3KT4A 4XW3A 5ISLA 5EQUA 2EF6A 4MSVA 4XUNA 1EPZA 2PHLA 2NLRA 2VECA 2XJTA 4HKLA 1EUTA 2ORZA 1PO13 4L97A 3WHTA 3LWCA 4UBGA 3ZFFC 4OHZA 1S0EA 1CAWA 1EAH2 2P3JA 3H0OA 1ENSA 2GP5A 2JDKA 5LWBA 1GSLA 4Q29A 1W8FA 4BHPA 2VNOA 5H9QA 1QJU2 2D40A 1R1ZA 5GLVA 5ABJA 4LJHA 1I3HA 4A7ZA 2EIDA 4QD2A 1H2NA 2VZVA 2Q8EA 2ZGTA 4KU8A 1DF0A 4XJUA 1C4RA 1W6QA 2ZGRA 3WT3A 1QNYA 1QXPA 1FMD3 3C7EA 4OI1A 3KVBA 3BTAA 3Q9OA 2BERA 3LSDA 1YQ2A 1UL9A 1DQ4A 3CMGA 3LOBA 3POFA 1YQ8A 1G9FA 5CKMA 1W99A 1LGCA 4XYXA 1ZBE3 2PXJA 1H8VA 5T50A 3IMNA 2IFWA 1LOAA 1FNYA 3N7MA 5IFPA 5FZOA 4K3UA 1PZ7A 3KT1A 3LQCA 4ZXKA 3WDTA 3FC0A 5JUVA 5F5AA 1ZZBA 4XCBA 1X36A 3ZPYA 2Q4SA 4IEVA 4RGKA 3PDQA 2KXLA 2VUCA 2ZGUA 1QQP2 5SV8A 4R8HA 4CCNA 4Q0VA 2EICA 1S0DA 5LA0A 1XYNA 3KCXA 4JTNA 1IPKA 2X29A 4FOVA 1OT5A 1V9U2 2QDRA 3PVBB 1QJY3 4FFHA 3ZN5A 1CZSA 5LA2A 2J1SA 4UW6A 3ZOIA 3N3HA 3VN4A 1NYWA 2HWB2 4NJ4A 1D4M2 2JB8A 1VBC1 1OD5A 2GC0A 4BCUA 5H9PA 4GWMA 4BXSV 2HWC2 2O8QA 5FRAA 1LOBA 3AKSA 4GMP3 5JDBA 4DZGA 3BODA 4LUKA 4HN0A 2LUWA 2WIIB 4N43C 1XE8A 1DCSA 1UO9A 2Z79A 3C8XA 4P08A 2VM9A 3VBHC 3WSOA 3V0AA 1DQ6A 1NLRA 3J26N 4XILA 3I2FA 3CF6E 4Q4W2 5FBJA 1J59A 5FPXA 4PI0A 2AEZA 3BTZA 4QXBA 2OZ6A 4DOUA 1L7QA 3EYPA 2FCUA 1Q8OA 3QCWA 3OUJA 1ZBA1 1C8NA 1G9DA 3OGVA 1RUD3 1SBEA 4ZXEA 4L92A 1LHWA 3T08A 3AMMA 4BISA 2CGOA 5FP9A 4KGQA 2BPA2 1RUF3 5JCTA 4LR4A 5CG9A 4DXTA 1LHNA 2EXKA 3IM0A 5F3IA 3WW2A 3P5BA 2VMEA 2Y6KA 4UAPA 3KSCA 1VRH1 4DY3A 2I45A 4YRDA 5IT6A 2JEMA 4RYDA 1V70A 2ADDA 2ZZQA 3POWA 5CVRA 2O0OA 3OD4A 3LDKA 1DGLA 3SISA 3UKTA 4E4DX 4YZ2A 4XUQA 5L7OB 2XMLA 2Y26A 4AHYA 4YPJA 4A7KA 3FLTA 5FK8A 4CDUA 1MS3A 3SNMA 4ISRA 1HX6A 2VNRA 2XKOA 4UFJA 1HDKA 5GJ6A 5FTTC 4F7ZA 5EPAA 2NMOA 4R4ZA 1SZBA 2XG3A 2Q1FA 3RG0A 3E6BA 4OYUA 5FBZA 1Z7S2 2Y60A 3DPRA 3EMRA 4OUMA 2CHHA 4HL0A 4QM8A 1Y3TA 1OC1A 2XJVA 2ZHKA 3VBFC 5GLTA 3ES1A 5JSOA 2OQ7A 4LE3A 3ZR6A 3VDDA 5LA1A 5F2WA 5C70A 5C4WA 4FFFA 1D0HA 3AB0A 3T0BA 5F3CA 1WW6A 2Q30A 3ACHA 3DEMA 5C6CA 1JYTA 4QXKA 2F4PA 1AZDA 5L9RA 1VBE1 1CQ9A 1STMA 4NROA 2K9ZA 1NCQA 1O8PA 2XVGA 3ZO0B 3LAGA 4S2GA 3OGRA 3ZYJB 4BIOA 1JZ8A 2D6MA 3MFAA 1BBT3 4HSLA 1S1AA 4Q1RA 3IDEA 3VBUA 2VVEA 3AZXA 3POSA 5ACA1 2O14A 1YFUA 1YO8A 1LHVA 1S2EA 4GIQA 2BW8A 3I2JA 3T2QA 2WNVB 3SH5A 4MZUA 4BQXA 1GZWA 4YG3A 5C9AC 2QBXA 1AL21 1PIV1 4A45A 2AYHA 2RG4A 4Z2AA 3BALA 3HVDA 2V5DA 5KHGA 1UOGA 1O3TA 2O8OA 5FKBA 2A6XA 4OZOA 4QX7A 4WM7B 2RR11 2E7TA 2VMGA 5K7PA 1SFPA 2ZGQA 4NUBA 3KCCA 1W9TA 2XL9A 4IEYA 2XL7A 4LBNA 3MIBA 1DZTA 4D6QA 1UAIA 4MGSA 4RGAA 3M3CA 3BIWE 5BNNB 1Q8QA 3OPZA 1QIQA 4Q0SA 3C3VA 3B5LB 2J42A 4LBMA 1RJ7A 2YUEA 4MXWB 2OVUA 3ZFGC 2PA7A 2ZABA 1GV9A 3V56A 4DUXA 1ZREA 1RUE2 4CYDA 2WSUA 5A6QA 4BQWA 2WDBA 1OLQA 4AVBA 4WBBA 3NJYA 1OLMA 3KT7A 4UFMA 2ZMKA 2A6WA 1CAUA 1KDKA 2Q1ZB 1Y9QA 3TEWA 1RHI2 1DQ2A 1DU3D 2X5IB 4BQ3A 2ENRA 4C1WA 5C7GA 5CFDC 3OSDA 3RWKX 4Y33A 4HXCA 1WGPA 3BCWA 3T0AA 4CEYB 4JGYB 4ES9A 4CDQC 3OGJA 1AR61 3THCA 1WCSA 2D7FA 2EIBA 3AXDA 4CUAA 4GA9A 3NV4A 1WLTA 3F95A 3PIJA 4MYEA 4XFGA 2DFCA 4IEWA 3N7JA 1YWKA 3ZSMA 4Q8KA 5FQ0A 3J9SA 3KCYA 5IVVA 1JH5A 1HB1A 1LCLA 3MIHA 3E5UA 3NNLA 3GJBA 4QDSA 1AX0A 1S0BA 5GZFA 4P02B 1BZWA 1ULPA 1UPSA 1U5ZA 3C2UA 3VDCA 4ES8A 1TE1B 1C28A 1A3KA 1MVQA 3AKRA 1OD3A 2PHDA 3KV4A 4I0BA 4YG0A 2JG8A 4BU2A 2BFUL 2CGPA 2YB7A 2OYZA 3UYJA 2VZRA 3R05A 1WMXA 4PT6A 1PZ8A 1OQEA 1HV1A 1HRV2 3I2GA 2Q8CA 1KRIA 1D4VB 3L9JT 1NE6A 3IPVA 4F83A 3PUAA 5J98B 1W8UA 4AFDA 5JSRA 1NX9A 3VKMA 3WP3A 2D5FA 5EHDA 5L36A 2WNUC 1W9WA 4XF1A 5DQ0A 2G4IA 1MQTA 5A7WA 3U1XA 1OPOA 4AK3A 5A3PA 4K8FA 2ZS6B 3VDAA 1ULOA 1H8TC 4CXWA 3APBA 4CU9A 4D69A 1X33A 3HJRA 5T5LA 2YYOA 2XJRA 1ZRDA 4A4AA 1OBNA 2VCAA 1O5LA 4IXLA 5CU1A 5HV0A 1N1SA 2WWSA 2JECA 3ZXJA 2TUNA 5FR3A 3LEGA 1SCRA 5E6HA 1CIYA 2VUJA 1CAXA 2VQUA 3VBRA 4FBFA 1OHFA 4XUOA 2P34A 1T6GC 3K4DA
chains in the Genus database with same CATH topology
4CCNA 3N9PA 4EZHA 5FP3A 4DO0A 5FV3A 5FZBA 4CCLA 5FZ6A 5FZ9A 2XDVA 5FJKA 4E4HA 5A7OA 4QX8A 4QX7A 5FZFA 3U4SA 3AVSA 5FYIA 5KR7A 4NUBA 4CCKA 5A1FA 3PU3A 3AVRA 4V2WA 4D6QA 4IGOA 5FZCA 5IVCA 4XDPA 5FY5A 5FZMA 2OT7A 4QXHA 3DXUA 5A3WA 3PUQA 5FXXA 2OX0A 5FZLA 4Y4RA 5FYHA 5FBJA 2XUEA 5IVEA 5FYZA 4C8DA 1VRBA 5FY7A 4LIVA 3LD8A 4D6SA 5FZ7A 4QXBA 5A7NA 4HOOA 2YBPA 3NJYA 4QWNA 3KV6A 5F2SA 5F5CA 5F3EA 5F5IA 3N9NA 5FJHA 4D6RA 4URAA 5FWJA 5FUPA 2GP3A 5FZKA 4Y3OA 5F39A 4BISA 5LW9A 4Y33A 5FP9A 2P5BA 5A7SA 4HONA 4CCJA 4UF0B 5FPLA 5FP7A 5FZ0A 2OS2A 5F3IA 2OQ6A 5FYSA 5IVJA 3AL5A 2VD7A 4CSWA 5A7WB 5FY0A 3N9OA 3ZPOA 3N9QA 5A3TA 5IVFA 2Q8DA 5FP8A 5FPBA 5IVVA 5FXVA 2YPDA 5FYUA 5CEHA 5FY4A 5IVYA 2XMLA 4AAPA 3PTRB 5FY8A 5FYVA 5LY2A 5ISLA 4XDOA 5FZ4A 3U78A 5FZOB 5IVBA 5FYMA 4QXCA 3AL6A 4GAZA 4BXFA 3N9LA 3KV4A 2WWUA 4DIQA 5F37A 3KV5A 4EZ4A 2GP5A 5FZ1A 5A80A 4BU2A 5FWEA 4LXLA 4LITA 5FYBA 4CCOA 5LWBA 5FYCA 5FPVA 5A7PA 2WWJA 3UYJA 3ZLIA 5A3NA 5FPUA 5FY9A 4ASKA 5FPAA 3KVAA 4TN7A 2Q8CA 3OPWA 3DXTA 3N9MA 5ANQA 2Q8EA 3K2OA 3K3NA 2OQ7A 5FYYA 5FZIA 4UF0A 5FZGA 3PUAA 3OPTA 3PUSA 5F2WA 3KVBA 5FZ8A 2YU2A 4CCMA 5F3CA 3KV9A 5F3GA 5IWFA 3PU8A 5A7WA 4GJYA 5F32A 5FP4A 4GJZA 5FY1A 2W2IA 5A3PA 2PXJA 3RVHA 5FZAA 5K4LA 5FYTA 4EYUA 2YU1A 5IW0A 5FZ3A 3PURA 5FXWA 5FUNA 4GD4A 3K3OA 5FZOA 5LY1A 4IGQA 2YBKA 4QU1A 3LDBA 4LIUA 5F5AA 4V2VA 5FZDA 5FXZA 5E6HA 4IGPA 2XXZA 5FZEA 5A7QA 4AI9A 3PDQA 2YBSA 5A1LA 4CUGA 5FZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCN A;  3N9P A;  4EZH A;  5FP3 A;  4DO0 A;  5FV3 A;  5FZB A;  4CCL A;  5FZ6 A;  5FZ9 A;  2XDV A;  5FJK A;  4E4H A;  5A7O A;  4QX8 A;  4QX7 A;  5FZF A;  3U4S A;  3AVS A;  5FYI A;  5KR7 A;  4NUB A;  4CCK A;  5A1F A;  3PU3 A;  3AVR A;  4V2W A;  4D6Q A;  4IGO A;  5FZC A;  5IVC A;  4XDP A;  5FY5 A;  5FZM A;  2OT7 A;  4QXH A;  3DXU A;  5A3W A;  3PUQ A;  5FXX A;  2OX0 A;  5FZL A;  4Y4R A;  5FYH A;  5FBJ A;  2XUE A;  5IVE A;  5FYZ A;  4C8D A;  1VRB A;  5FY7 A;  4LIV A;  3LD8 A;  4D6S A;  5FZ7 A;  4QXB A;  5A7N A;  4HOO A;  2YBP A;  3NJY A;  4QWN A;  3KV6 A;  5F2S A;  5F5C A;  5F3E A;  5F5I A;  3N9N A;  5FJH A;  4D6R A;  4URA A;  5FWJ A;  5FUP A;  2GP3 A;  5FZK A;  4Y3O A;  5F39 A;  4BIS A;  5LW9 A;  4Y33 A;  5FP9 A;  2P5B A;  5A7S A;  4HON A;  4CCJ A;  4UF0 B;  5FPL A;  5FP7 A;  5FZ0 A;  2OS2 A;  5F3I A;  2OQ6 A;  5FYS A;  5IVJ A;  3AL5 A;  2VD7 A;  4CSW A;  5A7W B;  5FY0 A;  3N9O A;  3ZPO A;  3N9Q A;  5A3T A;  5IVF A;  2Q8D A;  5FP8 A;  5FPB A;  5IVV A;  5FXV A;  2YPD A;  5FYU A;  5CEH A;  5FY4 A;  5IVY A;  2XML A;  4AAP A;  3PTR B;  5FY8 A;  5FYV A;  5LY2 A;  5ISL A;  4XDO A;  5FZ4 A;  3U78 A;  5FZO B;  5IVB A;  5FYM A;  4QXC A;  3AL6 A;  4GAZ A;  4BXF A;  3N9L A;  3KV4 A;  2WWU A;  4DIQ A;  5F37 A;  3KV5 A;  4EZ4 A;  2GP5 A;  5FZ1 A;  5A80 A;  4BU2 A;  5FWE A;  4LXL A;  4LIT A;  5FYB A;  4CCO A;  5LWB A;  5FYC A;  5FPV A;  5A7P A;  2WWJ A;  3UYJ A;  3ZLI A;  5A3N A;  5FPU A;  5FY9 A;  4ASK A;  5FPA A;  3KVA A;  4TN7 A;  2Q8C A;  3OPW A;  3DXT A;  3N9M A;  5ANQ A;  2Q8E A;  3K2O A;  3K3N A;  2OQ7 A;  5FYY A;  5FZI A;  4UF0 A;  5FZG A;  3PUA A;  3OPT A;  3PUS A;  5F2W A;  3KVB A;  5FZ8 A;  2YU2 A;  4CCM A;  5F3C A;  3KV9 A;  5F3G A;  5IWF A;  3PU8 A;  5A7W A;  4GJY A;  5F32 A;  5FP4 A;  4GJZ A;  5FY1 A;  2W2I A;  5A3P A;  2PXJ A;  3RVH A;  5FZA A;  5K4L A;  5FYT A;  4EYU A;  2YU1 A;  5IW0 A;  5FZ3 A;  3PUR A;  5FXW A;  5FUN A;  4GD4 A;  3K3O A;  5FZO A;  5LY1 A;  4IGQ A;  2YBK A;  4QU1 A;  3LDB A;  4LIU A;  5F5A A;  4V2V A;  5FZD A;  5FXZ A;  5E6H A;  4IGP A;  2XXZ A;  5FZE A;  5A7Q A;  4AI9 A;  3PDQ A;  2YBS A;  5A1L A;  4CUG A;  5FZH A; 
#chains in the Genus database with same CATH topology
 2XLG A;  4K21 A;  1DYK A;  2VMD A;  2P3Y A;  4Q4V 3;  2YC2 A;  4AWD A;  2J22 A;  1RUC 2;  3FE5 A;  1LB2 A;  3A7Q A;  2WNO A;  3DEC A;  5EFU A;  3I2H A;  1O3R A;  1O4Y A;  3OF1 A;  3FFQ A;  2MHF A;  5KBF A;  5KR7 A;  1OMI A;  2KA3 A;  5K0U B;  2BVB A;  3ZDV A;  2R0F A;  2R04 1;  3IWZ A;  4PQQ A;  3MF9 A;  2GH2 A;  5A6X A;  1F35 A;  1MS9 A;  1YI7 A;  2PLV 2;  3CKH A;  3RYK A;  4CXY A;  4XFF A;  1RUG 1;  1XJA A;  5IUQ A;  1ZA7 A;  3SCH A;  1SDD B;  1LOD A;  3CL1 A;  3VL9 A;  5I0R A;  3I4I A;  4OMD A;  4QXH A;  2B9V A;  3Q8F A;  4AZZ A;  3K48 A;  3LIH A;  1V6O A;  1S4C A;  4OI4 A;  4EN7 B;  1OLR A;  1R09 2;  2RHP A;  4ATF A;  1JYN A;  3O7O A;  5EJ3 A;  3MIF A;  4LIV A;  2C24 A;  4ZON A;  5HCH A;  5AC9 3;  4JGZ C;  3VHN A;  1K5M A;  2HYK A;  3KV6 A;  1UNB A;  3H50 A;  1KQR A;  4KU7 A;  4I3G A;  1QQP 3;  3WHU A;  4DPN A;  4NHL A;  5GZC A;  5IAT A;  5IHR A;  5LBC A;  3VZN A;  4BDV B;  1OQD A;  1V9U 3;  3WUC A;  5M0T A;  2ARC A;  2QQV A;  4OQ9 A;  2VMH A;  3E6D A;  1QDC A;  4DQA A;  1ZX5 A;  1OFS A;  2PHR A;  3KZ4 C;  4AOC A;  3POG A;  5HBA A;  3OB8 A;  1AXK A;  5GZD A;  3NAP C;  4BM8 A;  3AYA A;  1FAY A;  4IV3 B;  4G9S B;  4Q0Q A;  1W04 A;  4AVV A;  3CLP A;  3MFC A;  4JKK A;  4KWK A;  3N9Q A;  4XTP A;  2VG9 A;  1Q56 A;  1SLL A;  3GJA A;  4A3X A;  3VHO A;  4CDX B;  1DLL A;  1BEV 2;  1POV 1;  2ETE A;  4RS5 A;  4XUT A;  3IAQ A;  1ONA A;  3WCR A;  4XF3 A;  3R4D B;  2I74 A;  3VD7 A;  5BNP A;  1WMD A;  4XDO A;  2RMU 1;  1E5I A;  2WO2 A;  3USS A;  1QH7 A;  3JBG 2;  3B94 A;  1YFY A;  5TSW A;  3WNM A;  1ULG A;  3BOP A;  2P17 A;  5CFC A;  2PMW B;  4LIT A;  1VE0 A;  2D93 A;  2ARX A;  3M1H A;  3AMQ A;  2WWJ A;  4ARY A;  3RJR A;  2HWD 3;  3PIG A;  1BVP 1;  3MPP G;  3OEA A;  1Q43 A;  5A3M A;  2DVF A;  2BOI A;  3EO6 A;  3OBZ A;  1FOD 2;  3ASI A;  3BB6 A;  3OPW A;  3N9M A;  3RSJ A;  4BK4 A;  4CCE A;  3S57 A;  1RJ8 A;  1RIN A;  3UJO A;  2ZGL A;  4IEU A;  1AUY A;  2WNV C;  5FMC A;  1C8M 3;  2IWG B;  3JQX A;  2XHK A;  4COV A;  2K2S A;  4E2G A;  4OLL A;  4K40 A;  1V6L A;  2W87 A;  3HPN A;  3AFG A;  5C8C B;  3FJS A;  3GF6 A;  3V0A B;  1NE4 A;  3T0D A;  5F32 A;  3W20 A;  3UKV A;  3HAG A;  3J7N A;  4WM7 C;  4E8D A;  4KH9 A;  5K4L A;  1COV 1;  4ERO A;  2WL1 A;  2E63 A;  1XOY A;  3ILR A;  4RD7 A;  4FOQ A;  2GNM A;  3V0B B;  1VBB 1;  4XXA A;  3D6E A;  1OH4 A;  2GN3 A;  4LA3 A;  1AR8 2;  1RVF 1;  1YI9 A;  5T5O A;  1VBD 1;  1G7Y A;  4AYU A;  4FAG A;  1GNH A;  1DIW A;  1H4G A;  3Q8C A;  5BNN C;  2X5I A;  2HEV F;  3IMM A;  1OVS A;  1ZM1 A;  4IE7 A;  5A1L A;  2ZBJ A;  2HEY F;  1HV0 A;  1C1F A;  2RDR A;  2CL2 A;  2BJS A;  2Y6L A;  2ZX4 A;  2D5H A;  4UW3 A;  2WS9 2;  4YM0 A;  1AR9 2;  4DRR A;  3LEM A;  1RUG 3;  4LO7 A;  4YW4 A;  3RI9 A;  3ZKY A;  2ZEX A;  3J7H A;  2XBO 1;  3ETP A;  2D3P A;  1B35 B;  1NCR A;  4K20 A;  4MGQ A;  4CCK A;  3OBT A;  3PU3 A;  4COW A;  4QU2 A;  3ZN6 B;  4NID A;  2RVA A;  4XBN A;  1A34 A;  1JU4 A;  5IVC A;  1UIK A;  2IVJ A;  2A3Y A;  4NHX A;  5LRS A;  1NT0 A;  1X8M A;  1MS1 A;  5DG2 A;  3S7I A;  4JGY C;  2DV9 A;  4CEY C;  3ZFE A;  1UMI A;  3UT0 A;  1S0C A;  1XNK A;  3AKT A;  1MZ6 A;  4OHX A;  4XC9 A;  5A3W A;  3J8F 3;  3S7E A;  1U12 A;  1VMF A;  4I30 A;  3UET A;  1GZC A;  2BU9 A;  4D7Y A;  4C8D A;  1VRB A;  3HQU A;  5BXX A;  1Q8S A;  2C0Z A;  3M70 A;  3ZSE A;  1CAW B;  1US2 A;  2WA3 A;  4UWD A;  2VUA A;  1OKO A;  4FOW A;  3RMX A;  4EN6 B;  3AP9 A;  5FAX A;  1AR7 2;  1JZ3 A;  4R52 A;  4FPG A;  1GUI A;  2VNV A;  3RZM A;  1YXW A;  1NY7 1;  1ZZ7 A;  3FHI B;  3JD7 3;  5FJH A;  4BMB A;  2JX9 A;  4D6R A;  1TME 2;  5FUP A;  5ABJ B;  3FMG A;  4TZD A;  1D0G A;  1XBF A;  5DAV A;  1WZX A;  2GC1 A;  1W6Q B;  3LA7 A;  4MGK E;  4P14 A;  1UZ0 A;  3UNP A;  4AFA A;  2E31 A;  3AL5 A;  4A2U A;  4XET A;  3ZR5 A;  2RDQ A;  3C7F A;  4CSW A;  2WUH A;  1IS5 A;  1GNZ A;  2EAL A;  3NV3 A;  4JHT A;  2VZS A;  3WUD A;  5FPB A;  2QJV A;  4QHO A;  1OOP A;  3KMH A;  3RZK A;  2DF7 A;  4MGY E;  2RS5 1;  3VHR A;  1ZZ6 A;  1PNG A;  3DN7 A;  4FXK B;  3MW3 A;  4OUL A;  5FZO B;  1AYM 1;  4QXC A;  4AFM A;  3DYM A;  3H3L A;  2WN3 A;  3O0X A;  4GAZ A;  3GNE A;  5AFE A;  3LOI A;  4PJY A;  3I2D A;  2UY9 A;  3CBN A;  2HEW F;  2ZX0 A;  3GDB A;  4EZ4 A;  5FZ1 A;  4COZ A;  1LEN A;  1RGS A;  2F4L A;  2ZZJ A;  2VBP A;  5T5J A;  3JQW A;  1PNF A;  1GLH A;  2VAU A;  3RQ0 A;  1NXM A;  1OLM E;  1BKZ A;  3DXT A;  1QXR A;  1GP6 A;  1S0J A;  1F9K A;  2EAA A;  2EXJ A;  3EHK A;  1MAC A;  5FOJ B;  5A3U A;  2AEY A;  1W8O A;  1EV1 3;  4RQP A;  1V6M A;  2L9L A;  2E32 A;  2AAC A;  4GUL A;  2R32 A;  1RMU 3;  2HWE 2;  3H42 B;  5T3N A;  1N1T A;  3T2P A;  1VBB 3;  1XXN A;  2ADE A;  4GWJ A;  2BNN A;  1DBN A;  1QJX 2;  1BCX A;  2GAL A;  2Q0A A;  2XJQ A;  1VBD 3;  1RUI 3;  4IUG A;  3RVH A;  4FPF A;  3TNP B;  3WVJ A;  1IQA A;  3TN9 2;  2XOM A;  2LTN A;  3CHX A;  4Y24 A;  3TRS B;  2W1Q A;  5A6Y A;  3GBF A;  4PHZ A;  2WR9 A;  4LBQ D;  1E5H A;  4NRM A;  3BU0 A;  2B45 X;  3DCQ A;  1BQP A;  5CA6 A;  2W0X A;  5FXZ A;  2EXI A;  5C3R A;  5A7Q A;  1GP5 A;  1I9R A;  3DUI A;  4NII A;  3BKZ A;  5DZE A;  4YZ1 A;  4YW1 A;  5J1X A;  4AEK A;  2JXA A;  1XYP A;  4PCR A;  4Y22 B;  1PGL 1;  1IZ3 A;  1HRV 3;  2ET1 A;  3QAC A;  5T5P A;  3BYW A;  1GP4 A;  2VZO A;  2WQZ C;  2DUQ A;  2DBI A;  5A7O A;  1F4A A;  3WNX A;  4YM1 A;  4Z07 A;  5FYI A;  1XQN A;  1FMD 1;  2W08 A;  4LKE A;  2YDE A;  4BYY A;  3ZXL A;  2FMD A;  1LU1 A;  2SBA A;  1JYV A;  1N1Y A;  4I01 A;  4Y20 A;  3PUI A;  1PO2 1;  5HXM A;  2JG9 A;  1WWY A;  1ND2 A;  2AUY A;  3ENR A;  4OUS A;  2WIN B;  1JBC A;  4JCK A;  1VBC 2;  5IYY A;  4WM8 A;  1ZBE 1;  3D0J A;  1O4Z A;  1ZNP A;  2IFR A;  2VXR A;  2WLQ A;  4RR3 A;  5AVA A;  4BH9 A;  2XWB B;  4CDU B;  4DB5 A;  4MUV A;  2VCB A;  4IV3 C;  4RFT 0;  5IK5 A;  3WG3 A;  4XE9 A;  2W3J A;  4A42 A;  4CDX C;  2K0G A;  2NZ9 A;  3GBW A;  5FKC A;  3ZSL A;  4TTG A;  2OW4 A;  5F3E A;  4YFW A;  3DPR B;  1GZT A;  4CP2 A;  1W2U A;  2R0H A;  4BQ4 A;  2KM2 A;  3HQX A;  4UFK A;  3H8U A;  2ZGM A;  4I3P A;  1QJY 1;  4O9G A;  3CNA A;  4AQ6 A;  3VDD B;  2KD7 A;  2WZR 2;  3GGL A;  4LLF A;  3VGI A;  5C4W B;  2A75 A;  4M00 A;  5FDB A;  2DUO A;  5FFO C;  5IVJ A;  4X6R B;  5DMY A;  5C3Q A;  1DP0 A;  1PMI A;  2WO7 A;  3PUH A;  5D8A A;  1W2A X;  4QGM A;  1H1M A;  2EVX A;  3POE A;  1HRI 3;  5IK4 A;  1NA1 C;  5EZW A;  3B93 A;  4N7U A;  3N7K A;  1AYM 3;  1V6N A;  1NCQ B;  3VKO A;  3VD5 A;  1QOT A;  2CTV A;  4QGN A;  3LA2 A;  2CNA A;  2RDS A;  4QT6 A;  4PBP A;  3TNQ A;  1R09 3;  3OD0 A;  4FPJ A;  4AQT A;  3VKF C;  1VB2 A;  4AQ2 A;  2XQX A;  2LW8 A;  4N53 A;  4HAN A;  4BE3 A;  1IS6 A;  5C71 A;  1RIT A;  2PAK A;  4LO5 B;  1BLZ A;  1F4H A;  3PTY A;  4GH4 C;  4CCO A;  1GZW B;  1WKY A;  4JVA A;  3FLP A;  4YVS C;  3NVC A;  4FI9 A;  1RUD 1;  4LBQ A;  5T52 A;  2E33 A;  3WXP A;  1RUJ 1;  4G3Y C;  3W5M A;  3A0K A;  1S2K A;  1C3H A;  1XYO A;  1DGR A;  1RUF 1;  2QQN A;  1CJP A;  1GAN A;  3LZZ A;  3ZN6 A;  3ZYR A;  3A21 A;  4D0Q A;  4QPI C;  4QPG B;  5FZ8 A;  1HB2 A;  5JXJ A;  3K75 B;  1N3O A;  4CCM A;  2C1F A;  2VU9 A;  1PX3 A;  3NO8 A;  1J1L A;  3NRU A;  4BQY A;  4W6X A;  1US3 A;  4LUL A;  2XH6 A;  2WAA A;  4CCC A;  3VBO C;  2A70 A;  3P1I A;  4XIK A;  3I54 A;  4EYU A;  2IUW A;  1B35 C;  3ZFF A;  2RDN A;  5FZ3 A;  3PUR A;  1VBE 2;  2G9Z A;  5DDJ 2;  2JE9 A;  4H14 A;  4LOT A;  2D3S A;  1MR5 A;  2RS1 3;  2NM1 A;  4AHW A;  1UPI A;  3M4F A;  1F5F A;  1WW5 A;  3PJQ A;  4C1X A;  4XDQ A;  4E2S A;  3MBW A;  5FZE A;  5DZF A;  1CAU B;  3J7L A;  4C91 A;  1T2X A;  4LK7 A;  1WD3 A;  3ATG A;  3NNG A;  4MH0 E;  5ACA 2;  4XFA A;  3O1U A;  1POQ A;  2P3I A;  1RUH 2;  4MG2 A;  1LOF A;  4WZF A;  2VZQ A;  5IFT A;  1OUR A;  3FHA A;  1PO2 3;  2CYF A;  2XKP A;  4NO4 A;  1PIV 2;  1UIJ A;  5A1F A;  1KFX L;  2WZ8 A;  1SLA A;  4AHZ A;  4FQ4 A;  3RYR A;  4LQR A;  2RR1 2;  3CJI C;  1KIT A;  4FP3 A;  5FQ0 B;  2VUD A;  4BJ0 A;  4QGL A;  2RS3 3;  2TBV A;  3HWJ A;  2DTW A;  2YRO A;  3NMB A;  1ENX A;  4GKY A;  1BBT 1;  1TEI A;  2GME A;  1UN1 A;  1J3P A;  1LRH A;  5EV7 A;  2BP6 A;  2JG8 B;  2DTY A;  2Q1M A;  4NAM A;  2O1Q A;  2NN8 A;  4LTA A;  3Q8B A;  3SMH A;  5FO8 B;  2OXB A;  5HV4 A;  3CIH A;  3DGT A;  2WSV A;  2WZE A;  2RM2 1;  5E1R A;  4EJR A;  1HKD A;  4O61 A;  5LW9 A;  4GAL A;  1SLT A;  1XU1 A;  4BK5 A;  4AGV A;  4XJ8 A;  1QGL A;  3IPV B;  1HXS 2;  2ARE A;  1JYC A;  2D98 A;  5KC5 A;  4JC1 A;  2LAL A;  4AQS A;  1I6X A;  1ENQ A;  1GZ9 A;  5FYS A;  3VD3 A;  5GKA C;  3PHM A;  4N7I A;  4IND A;  1MQT B;  5A7W B;  2WT0 A;  4KBZ A;  1XC6 A;  3BIE A;  1TQ5 A;  2Y0I A;  2BZD A;  1VBA 1;  3T4H B;  5IVF A;  1AYN 3;  5CBL A;  2V73 A;  1AR6 2;  3VBS C;  1WD4 A;  2Y6G A;  4QKN A;  3S30 A;  1FV2 A;  1SBD A;  4TXW A;  3T09 A;  2Y6J A;  4FVV A;  3O5S A;  5FO9 B;  5FY8 A;  5D21 A;  1G9A A;  1PVX A;  1DFQ A;  4PDW B;  5KWR A;  3I3M A;  1D7P M;  1FX5 A;  2Z69 A;  4ZZ8 A;  2GC2 A;  1FPN 3;  1SFN A;  2AZ5 A;  1PGW 1;  1QMJ A;  4FXG B;  2B46 X;  2BOJ A;  1RUJ 3;  1KS5 A;  3VBR B;  1CAX B;  1DLC A;  1NQD A;  4XF0 A;  4Y22 A;  3WX5 A;  3ZYI B;  5IAX A;  1BMV 1;  3H9A A;  3WQB A;  3POB A;  5JOW A;  2Q5T A;  2QQW A;  3LFI A;  5A3N A;  4DNY A;  3P3P A;  1LES A;  3OEB A;  2YHJ A;  5BNO C;  5F7U A;  1C5I A;  3WDW A;  3HT2 A;  5JI7 A;  4D8M A;  2XWJ B;  5KXB A;  2QDN A;  4F8A A;  1IS3 A;  4BA6 A;  2J1E A;  1CR7 A;  2WQ8 A;  2VBD A;  2P37 A;  2BNO A;  2DBN A;  3ZYB A;  4YWA A;  1ULE A;  3IIA A;  1K3I A;  2VZ3 A;  2YU2 A;  1H6Y A;  3B00 A;  3HN3 A;  3JZV A;  3KLS A;  4TLG A;  3VD4 A;  1VIW B;  2RE9 A;  4QKF A;  2YV8 A;  1MEC 2;  1SCS A;  3O1T A;  1W3X A;  2BTV C;  2FD8 A;  2R16 A;  1W8Z A;  2H6B A;  4GJZ A;  4AVT A;  4JHZ A;  1AVB A;  5B2G B;  2TEP A;  4B3N A;  3RFR A;  1QDO A;  1V6J A;  5FYT A;  2W47 A;  3VZK A;  4P9J A;  2VR4 A;  1PVC 2;  5FLI A;  4W6Y A;  3WQ1 A;  3WP5 A;  4LKD A;  1XNB A;  4LO4 B;  2Z2S B;  3H3U A;  4ASL A;  1OF4 A;  4BOW A;  1K5M B;  2B42 B;  2P3K A;  4QU1 A;  2N7G A;  2WA4 A;  5H9R A;  4AI9 A;  4YGB A;  1A8D A;  3SQO A;  3G7D A;  4FPL A;  4XEZ A;  4OCT A;  4CDU C;  1ASJ 2;  4J6G A;  5FV3 A;  1W39 A;  1UU5 A;  3J4U H;  4V1P A;  1Y9G A;  4H7L A;  4QX8 A;  4JDO A;  5FZF A;  2VQT A;  5CYY A;  3DPR C;  3USU B;  4MAD A;  4PIZ A;  4E27 A;  5JOY A;  2HWE 3;  1UY2 A;  4V2W A;  5FZC A;  1XNC A;  5FY5 A;  1FAT A;  4CEW C;  1IHM A;  2NQY A;  4Y4Y A;  1QJX 3;  1YRZ A;  4RS5 B;  3VDD C;  4XXP A;  2A6Z A;  2OT7 A;  5C4W C;  5BNP B;  4NMI A;  3S5Q A;  2OX0 A;  3WNN A;  2PHW A;  1X82 A;  5DUV A;  4OMC A;  4CTE A;  5BNQ A;  1GYK A;  3AJY A;  1JN2 P;  5L19 A;  5FY7 A;  1XRU A;  2RM2 3;  4B7E A;  2QTW B;  1C5H A;  4UXA A;  3KS7 A;  5CB7 A;  2FDI A;  1EAH 1;  2YBP A;  1NXD 1;  4YZ5 A;  4FPK A;  5CFC B;  5JPN B;  2W68 A;  4HN1 A;  1NCQ C;  1XSR A;  3FN9 A;  3WNK A;  2RJ2 A;  3KQ4 B;  1UXZ A;  1QJU 1;  1UD1 A;  1V00 A;  2DCZ A;  4IL7 A;  1WW7 A;  4HET A;  1W90 A;  1TVG A;  1Y7B A;  4Q4V 1;  4XJW A;  3VBU C;  4LBK A;  4QHZ A;  4QQ2 A;  4QPG A;  2NYY A;  4ZS3 A;  3ZVX A;  4DY5 A;  4Z1V A;  4Q0U A;  3III A;  5SV5 A;  4UT5 A;  1VBA 3;  3W9A A;  2WT1 A;  4EV0 A;  4UOJ A;  1AX1 A;  4NHK A;  2GSY A;  2XJP A;  1WCU A;  3ES4 A;  3FLR A;  1REF A;  2C4X A;  4M01 A;  2GDF A;  4M0H A;  2G9F A;  1WCQ A;  2DCY A;  4CDW C;  2JKX A;  1OA3 A;  3ZFG A;  1ACC A;  1REE A;  5BPX A;  3P6B A;  5FY4 A;  5JZG B;  3ILF A;  1I5Z A;  2ZGK A;  1Q8V A;  2W1W A;  1DQ0 A;  3CDZ B;  3RRD A;  2HJI A;  3UV9 A;  2WKK A;  2E6V A;  3KD4 A;  3B7M A;  1KGY A;  1JOP A;  3I7D A;  4XHB A;  5AC9 1;  4NE9 A;  4MVT A;  4RHV 2;  4AI3 A;  3WP6 A;  1XSQ A;  5A80 A;  3ZXE A;  4LXL A;  2UUR A;  3ZXD A;  5A7P A;  1QQP 1;  2VPV A;  2EIE A;  2ZHL A;  1FT9 A;  4SLI A;  4QX2 A;  3OUI A;  1ENR A;  1F2N A;  1OKQ A;  2G1M A;  1V9U 1;  2P6C A;  3PJY A;  2HWF 2;  3LPG A;  3MHZ A;  1OH3 A;  5FZG A;  2LRP A;  2WZR 3;  1AF9 A;  2Z4F A;  1NCR B;  3SEP A;  3SEE A;  5ANN A;  2FDF A;  3WP4 A;  3TEZ A;  1D4M 1;  3A4U A;  4MO3 M;  4K9S A;  1R1A 2;  1R08 2;  2HWC 1;  5FLJ A;  3PLQ A;  2ERF A;  4XPV A;  3ZDS A;  5FP4 A;  1LKN A;  4HMZ A;  2R1B A;  5FY1 A;  3ZFE B;  5JMO A;  3ACI A;  3HNM A;  2DUP A;  4LBO A;  3WNO A;  4LHN A;  1LGN A;  4UFI A;  4XF4 A;  1R64 A;  2GNT A;  3AKP A;  4P9W A;  3ZX7 A;  5FCC A;  3KHC A;  3AYC A;  3AKQ A;  4BQ1 A;  1COV 2;  5J48 A;  3HOB A;  1KJL A;  4IER A;  4JV4 A;  4E9K A;  2R06 3;  3UJQ A;  1W8T A;  3H8O A;  2QQU A;  1JYI A;  1CIW A;  4JAA A;  1HJG A;  3K51 A;  1QXJ A;  3JU9 A;  2HWD 1;  2ZKN A;  3MIE A;  2E7A A;  3E6C C;  5T55 A;  2YXS A;  3K4A A;  1JYW A;  4ITC A;  1Q5O A;  4Q1P A;  3QLQ A;  2I2S A;  2V72 A;  3RGB A;  3BPZ A;  4O9E A;  4LLO A;  1UOF A;  3ZSK A;  2WFF 2;  1UOJ A;  4Y5S A;  2VOW A;  2JIG A;  1AXY A;  4W6W A;  5KXC A;  1SG3 A;  2C9K A;  1VAM A;  3F2Z A;  3X29 B;  1MS8 A;  1SHW B;  1ST8 A;  3JB8 A;  4KNC A;  4W4Z A;  3UK9 A;  4LO8 A;  3VZJ A;  1W6N B;  2QZ3 A;  1C8M 1;  1UMH A;  3MZH A;  3VHP A;  1Q3E A;  1QJZ A;  4XDP A;  2LS6 A;  3ME2 A;  1H8T A;  1OOP B;  3DYP A;  4UI9 L;  4PDW A;  4Q4Y 2;  3ZXG A;  2Y64 A;  1EAH 3;  4OZX A;  1QJE A;  3WEZ A;  1DGR N;  1PHM A;  4B1M A;  3LDR A;  5EYX A;  2H6C A;  4IV1 A;  1MQT C;  1QJU 3;  3LD8 A;  2WLP A;  1BK0 A;  1URX A;  1XU2 A;  2CAV A;  3FZ3 A;  1YIF A;  4LBL A;  3HR9 A;  4M3C A;  5J36 A;  3AP5 A;  1GMM A;  3KWV A;  4A6O A;  2QQI A;  4IE0 A;  3WR0 A;  3VDB A;  3HNY M;  2ZEZ A;  3OY8 A;  2ZEW A;  3WIN E;  1DGW X;  4DIN B;  2R7E B;  4M0N A;  1RUH 3;  1A78 A;  4MHU A;  5E16 A;  3WNP A;  1JW6 A;  1LR5 A;  4TLF A;  4AGG A;  2P1B A;  3ZYP A;  2VO5 A;  2EAK A;  2AH2 A;  1UY1 A;  4RQP B;  5A6Z A;  1M4W A;  3HNB M;  3PVO A;  1JUI A;  3CEW A;  4FTE A;  1SLC A;  2IC1 A;  1YFW A;  4B7K A;  1GBG A;  2PN5 A;  1BJQ A;  4YNI A;  5A3T A;  4DMI A;  1PM7 A;  2JJ6 A;  2UYB A;  4YG6 A;  1C57 A;  5CNA A;  1AXZ A;  3IT8 A;  4N90 A;  4UW4 A;  2DYC A;  2QQM A;  2EA7 A;  4P9L A;  5LY2 A;  3J8F 1;  3UKN A;  3GHN A;  3BTY A;  2ARA A;  1XE7 A;  2DUR A;  3POY A;  3MIG A;  4JGZ A;  5EYY A;  4ZZ5 A;  5L7O C;  3BUC A;  3ACL A;  3WG1 A;  1F31 A;  2RS5 2;  2ZGO A;  3O1S A;  1LED A;  1QU0 A;  1UMZ A;  3L2H A;  4S2D A;  5FYB A;  1TMF 2;  1DGW A;  3K46 A;  1GOH A;  3JD7 1;  5EJZ B;  4NPR A;  5FPA A;  5I8Y A;  2QE3 A;  2E51 A;  4FCA A;  4XQD A;  2HWB 3;  2QUO A;  1D4M 3;  3USU A;  2NP0 A;  5JMC A;  1K5M C;  1HXS 3;  4XFB A;  3LCP A;  2MEV 2;  2W92 A;  4ORF A;  4NVP A;  2HWC 3;  3CJX A;  1RTV A;  4UF0 A;  2X10 A;  1LUL A;  4COY A;  1EPW A;  2YC0 A;  4AG4 A;  3TOJ A;  2WO1 A;  2GMP A;  4QKB A;  4Y20 B;  5CZK A;  5DUW A;  3A0N A;  3MW2 A;  1LGB A;  1J83 A;  5F3G A;  2JG9 B;  3T2T A;  4A6S A;  4Q4W 3;  4Y1V A;  1ND2 B;  4CU6 A;  1ND3 A;  4E8C A;  1O5U A;  1FI2 A;  4QPY A;  4WM8 B;  3LE0 A;  3N35 A;  4DS0 A;  4RR3 B;  5BUV A;  1F15 A;  1O6U A;  4IEP A;  3RJ2 X;  4J1X A;  1YJL A;  3D8C A;  2YU1 A;  4Y1Z A;  1IG0 A;  1UYZ A;  4AVA A;  4LHS A;  5GZG A;  3K3O A;  4XAC A;  3BGA A;  4EWE A;  3BU7 A;  4IGQ A;  4KI5 M;  5FIX A;  3OCP A;  1W6M A;  4V2V A;  5J37 A;  2GH8 A;  2XXZ A;  1VMH A;  4RS5 C;  1PX4 A;  3FL7 A;  3GBG A;  2PHT A;  1PO1 2;  2FCV A;  2J1A A;  1BK1 A;  2XGX A;  3WZ1 A;  1H0B A;  5BNP C;  1ZRR A;  2A7A A;  5JXH A;  1WBL A;  1W9F A;  2A73 B;  1S0G A;  3V64 A;  3HBZ A;  4PF1 A;  1JYX A;  1ALY A;  4MHR A;  4RA0 A;  4YVW A;  1EV1 1;  2FDK A;  5D8A B;  2Q8O A;  3Q8E A;  4MGT A;  5C5T A;  3CZJ A;  1LOE A;  5JZG A;  1RMU 1;  3POI A;  3SCF A;  3ABZ A;  2ZGP A;  4YW3 A;  3EXU A;  1MZF A;  1W8N A;  5FPZ A;  3WLU A;  5DAX A;  1IG3 A;  2CV6 A;  1RUI 1;  1HB3 A;  3B02 A;  5GM0 A;  5FXX A;  2V4V A;  1VP6 A;  3LA3 A;  4IDZ A;  3WF2 A;  2XLF A;  2R6Q A;  3D0S A;  1Z7S 3;  4L2N A;  4ZU4 A;  4E2Q A;  4EQV A;  5HCB A;  4N53 B;  5DPN A;  2YGL A;  2Z5W A;  1GFF 2;  4MX3 A;  4LKS A;  5FZ7 A;  1TNR A;  3B9C A;  4FO9 A;  2J1R A;  5JIU A;  4R9D A;  3M3O A;  3N9N A;  3TBD A;  3WF3 A;  1U5I A;  2VZU A;  3GM8 A;  4LBQ B;  4LNV A;  1W8W A;  2VOK A;  3SHR A;  4E4S A;  4OI0 A;  1ASJ 3;  1UZV A;  4FOY A;  2WYF A;  1HRV 1;  5FMO L;  2P5B A;  5A7S A;  3PNA A;  3SKJ E;  5CAD A;  4L0P A;  2X5I C;  4Q4X 2;  2XR4 A;  4NHM A;  4QQL A;  5JIA A;  1YUD A;  2ID4 A;  4JKL A;  1CX1 A;  2D6L X;  1K12 A;  3QD6 A;  2VD7 A;  2ORX A;  1QJY 2;  2KR2 A;  4WZC A;  4NWW A;  5F9T A;  2W91 A;  3HT1 A;  4DRV A;  2UWA A;  3D4K A;  2B4K A;  1PMJ X;  2B8M A;  2EIG A;  2VW1 A;  5EIY B;  2QVS B;  2B7Y A;  2XVL A;  1NCR C;  2VXJ A;  2J1U A;  4NHY A;  5IVY A;  3ZFF B;  4CP9 A;  4AXO A;  2QQL A;  1QWR A;  1EP0 A;  1DDL A;  2JWP A;  1X50 A;  4LPL A;  2HBT A;  1VAL A;  2CU5 A;  2VOV A;  2W5F A;  1SLB A;  3AL6 A;  2YC4 A;  5LBB A;  1W06 A;  1JOD A;  5DAP A;  4XFC A;  2R07 2;  4NPL A;  5FWE A;  4R9A A;  4KG0 A;  1QJF A;  5T54 A;  2Y0O A;  3NJZ A;  1OXC A;  4XAE A;  3RYP A;  2OUH A;  2QQJ A;  5F1R A;  4TN7 A;  1RUC 1;  2OII A;  2D6P A;  3B69 A;  1WCD J;  1W6N A;  3Q8A A;  5HCA A;  1CVN A;  3TEX A;  2D6O X;  3OPT A;  3PUS A;  5GLU A;  5JLV A;  3GCW A;  3C7O A;  5BYN A;  1C1L A;  1YCI A;  1NQJ A;  5IK8 A;  1WLW A;  3O1O A;  1E57 A;  1KFU L;  1WUV A;  2C9A A;  4OVE A;  3LKJ A;  1X7N A;  2PLV 1;  1HRI 1;  4PLM A;  3OJB A;  3UGF A;  1RUE 3;  4DUW A;  5JOZ A;  1OSG A;  3DKQ A;  4GB3 2;  1LHO A;  2WAB A;  1OFN A;  3AZW A;  3N7L A;  4PIY A;  5DN2 A;  3OGS A;  4YW5 A;  5L73 A;  3MV1 1;  3WDV A;  2ZGN A;  1ULF A;  1YQ6 A;  3KF5 A;  3I8T A;  1YQ5 A;  5FXW A;  1R09 1;  3IBM A;  4GD4 A;  3WF0 A;  4AED A;  1W6P A;  1RHI 3;  2ZAH A;  4HPK A;  4PI2 A;  4RHV 3;  1OOP C;  1DHK B;  1GU3 A;  1QH6 A;  3H3Z A;  4U2A A;  3RMY A;  4EZH A;  1YFX A;  1AHS A;  4MLO A;  3FWE A;  1LJ7 A;  1CN1 A;  4I02 A;  4D7T A;  2SLI A;  1KXG A;  1UOB A;  2C26 A;  2P4E A;  1D2S A;  3THT A;  3SCG A;  1XND A;  3H1Y A;  1ODN A;  4D3W A;  2CY6 A;  4FTS A;  3AVR A;  3NV1 A;  4AE2 A;  3SIT A;  1IKQ A;  1CX4 A;  3QBQ A;  3E5X A;  2VGD A;  4IGO A;  5K0U C;  3OYW A;  2PAM A;  2A1X A;  1NZC A;  4QMA A;  1J1T A;  4QB2 A;  1BEV 1;  5FZM A;  1UKG A;  1HQL A;  3PUQ A;  2VUL A;  4YW2 A;  3ZXA C;  3ZIX A;  3K77 A;  1NAE A;  1SBF A;  4P9G A;  1UZW A;  3S0M A;  2VE1 A;  3HD8 B;  2WRA A;  3VZL A;  1KD7 A;  1FNZ A;  2RS1 1;  1J58 A;  3MDP A;  1BBT 2;  1QY4 A;  1W0P A;  2G9G A;  4IEX A;  2A5Z A;  3WDU A;  5JXG A;  4AEM A;  2Y6F A;  1RXG A;  1N3Q A;  1W3V A;  1X9T A;  5DUU A;  4Y3O A;  4HVR A;  1LAJ A;  5DAQ A;  4GKX A;  1RB8 G;  2WFF 3;  2A6V A;  3NW4 A;  4AVS A;  1OQ1 A;  2PAE A;  3HBK A;  1W6O A;  1SDW A;  3MLK A;  5LBE A;  3MF6 A;  3O14 A;  3ROU A;  3URF A;  1ULD A;  5JXI A;  2PEL A;  3FX3 A;  3ZXF A;  4Q4Y 3;  2DWR A;  2ILM A;  2ARB A;  5CG8 A;  2RS3 1;  4HVO A;  4K6B A;  1NLS A;  3MUY 1;  3MV0 1;  1DQ5 A;  1K45 A;  2B5H A;  4JDN A;  3VZO A;  1MPX A;  1H4H A;  3R6S A;  2VZ1 A;  2JIC A;  3UGH A;  2PHX A;  1UY3 A;  1FXZ A;  2JG9 C;  2P2K A;  1AR8 1;  2V09 A;  2AR6 A;  4ONU A;  3N9L A;  3WW1 A;  3PME A;  4EN0 A;  4XCA A;  1RUC 3;  2JE7 A;  4WM8 C;  1ZBA 2;  4YGE A;  3ZYH A;  1Y43 B;  4RR3 C;  1OVP A;  1PGW 2;  4OQ8 A;  4Y1X A;  4IE4 A;  3M7A A;  1OPM A;  3O0W A;  2DCJ A;  3NST A;  1IPJ A;  4QX5 A;  2DCT A;  1PK6 A;  4XAA A;  2WS9 1;  4MET A;  1SEF A;  4K1Z A;  2GND A;  2PLV 3;  3GCX A;  4XF9 A;  3VLB B;  4D7S A;  4ZU7 A;  1EYB A;  4MGZ E;  2HYX A;  1NA1 A;  2DCK A;  5KHK A;  3GZT B;  1VRH 2;  2JE8 A;  3U0Z A;  1GQP A;  2OZJ A;  2IXH A;  4AFC A;  1AYN 1;  3BI3 A;  1I5P A;  4QHB A;  5B4N A;  5D2A A;  5C8C C;  3VD9 A;  2AEN A;  4ISQ A;  3GZA A;  4CP1 A;  1JS9 A;  4CCD A;  2HH9 A;  3BTX A;  1O3S A;  1W9Y A;  3RZL A;  4FFG A;  5D8A C;  3NL1 A;  2VTX A;  5EXO A;  2MNG A;  2YY1 A;  1FPN 1;  2UY8 A;  4GH4 A;  4K1Y A;  5B4X A;  2BNM A;  3W58 A;  2NMN A;  1JZ4 A;  1VR3 A;  3EJK A;  4YVS A;  2ZJC A;  1AR7 1;  1TMF 3;  4CA9 A;  2EXH A;  4LUM A;  1HQN A;  4H2A A;  1X9P A;  4XUR A;  1V6I A;  1QOS A;  1NG0 A;  5I91 A;  5JSP A;  3ACF A;  2BQP A;  4LE4 A;  4LHL A;  5A32 B;  1Z0H A;  3EB7 A;  5FZB A;  3WG2 A;  1YLL A;  5FZ9 A;  3WF4 A;  4CCL A;  5BV6 A;  4N53 C;  1ZRC A;  1CGP A;  3THD A;  1Q8P A;  4UYB A;  1LNS A;  4Q27 A;  3HEI A;  5FMD A;  4WVM A;  4IET A;  3M3I A;  2ZCW A;  3M3Q A;  1BEV 3;  1J84 A;  4BLI A;  4QPW A;  4CUB A;  1SAC A;  2BUK A;  2YGM A;  4GXL A;  4P9I A;  3IZO A;  3VBO A;  1NUK A;  3ZFG B;  3RWN A;  3JBG 3;  2FHR A;  2D6K A;  4I0W B;  2Y8K A;  3LB9 A;  4UFL A;  3T1M A;  2D97 A;  5A1A A;  3MGU A;  4MGI E;  3AJZ A;  3MPB A;  1CPM A;  5DAW A;  5EJ1 B;  2VL4 A;  4ZS2 A;  2BRT A;  2R30 A;  2Y34 A;  4HOO A;  1VLN A;  2VQA A;  2UWC A;  2E9Q A;  1FOD 3;  3VKN A;  2P6H A;  4ZPI A;  3SH3 A;  5CFD B;  4AL9 A;  4NRP A;  3FUO A;  2VJX A;  1W2T A;  3AX4 A;  4URA A;  3VUO A;  1AL2 2;  4O7X A;  2ZEY A;  4CDQ B;  1QKQ A;  5F8P A;  2XPJ A;  2D44 A;  3AZZ A;  3ETQ A;  4JKM A;  4M4R A;  3WDY A;  4YYO A;  3RI8 A;  4CCJ A;  5ABJ C;  4HK9 A;  1MS0 A;  3AZV A;  1DQ1 A;  1RED A;  2E53 A;  2XON A;  4Q4V 2;  4XJZ A;  1KEX A;  3CJI A;  1H1A A;  1CON A;  3I3B A;  5JWP A;  2JDP A;  4WVW A;  1L7R A;  4KL1 A;  3SH4 A;  2HWE 1;  5E88 A;  1LOF C;  2ZX3 A;  2H0V A;  1VAV A;  4BQ2 A;  2ZAA A;  1QJX 1;  1AR8 3;  1DYO A;  2YPD A;  3QH6 A;  4J1W A;  4RGG A;  4HBN A;  4Z8B A;  1GOF A;  3D82 A;  5CEH A;  5L9V A;  2JIJ A;  3PTR B;  1Y4W A;  4JQT A;  3TN9 1;  3ZMO A;  4LT5 A;  5FZ4 A;  3FHQ A;  5DAB A;  2IVI B;  3E97 A;  4LMF A;  5FYM A;  5CIS A;  3WDX A;  2E26 A;  2GZW A;  1W0O A;  3CU7 A;  4PIX A;  3ZM8 A;  3BVC A;  3HQR A;  5JOX A;  1L7L A;  1G9C A;  4N9H A;  2WS9 3;  1AR9 3;  3RZZ A;  4ZHN A;  3FFZ A;  4FAH A;  3I2O A;  1JHN A;  5AC9 2;  3AXE A;  2ZXQ A;  1SLI A;  3AZY A;  4XTM A;  4DXZ A;  2FMY A;  1GWM A;  4Q4X 3;  1AJK A;  4KGG A;  1WBF A;  5FZI A;  4N43 A;  2WNU B;  1J3R A;  3VBH A;  4NRQ A;  1IGO A;  1JHJ A;  1BXH A;  3KV9 A;  2YMZ A;  1TG7 A;  3VBS A;  2QCS B;  4I0A A;  4JQR A;  2IXJ A;  3OG2 A;  4IES A;  5IJR A;  1H8T B;  5GZE A;  1MZE A;  3DKW A;  3AP4 A;  1G86 A;  2JDU A;  3NKG A;  1S55 A;  3S6P A;  1F5J A;  1SFY A;  5J09 A;  2Z42 A;  4DEQ A;  4F3J A;  4IV1 B;  1AR7 3;  3WOG A;  2W1S A;  4CUC A;  1TME 3;  2CWS A;  4ZKT B;  4M3C B;  4IE6 A;  2YBK A;  1JOB A;  4LIU A;  3VV1 A;  1GOG A;  2ZA9 A;  2Y6H A;  2R07 3;  1W03 A;  2GN7 A;  2BFU S;  5BNO A;  1SPP A;  2GU9 A;  4CP0 A;  3OY8 B;  4XIO A;  3UGG A;  1KJR A;  2FQP A;  3GYD A;  4Q26 A;  1S2B A;  2LRO A;  3RZG A;  1MVE A;  2XB6 C;  5C5U A;  5C3O A;  5FLH A;  5JR7 B;  4QDQ A;  5KXE A;  2HWD 2;  2PHU A;  3ON7 A;  2WZR 1;  4ZU5 A;  1UKR A;  4QX1 A;  3T4V A;  4Z82 A;  1A6C A;  3OBA A;  1ZA4 A;  2WFP A;  1GWK A;  5HPO A;  1BYH A;  3B3Q E;  3RDI A;  3AM2 A;  4ET7 A;  2OUJ A;  3B01 A;  4LO6 B;  4GB3 3;  5KXD A;  1C8M 2;  5LA9 A;  2HKX A;  3R4U A;  4GWI A;  4JDM A;  1G8W A;  2OA2 A;  2QQK A;  4YGD A;  1A8M A;  4M4P A;  1ZRF A;  2W52 A;  1ULC A;  3JB4 C;  5FZL A;  2FBE A;  1LHU A;  4JGZ B;  1M06 G;  3QH7 A;  3UL2 A;  3V65 A;  5FYZ A;  5IVE A;  5FMB A;  1UW8 A;  3DF0 A;  4D6S A;  4P9X A;  4NAO A;  4AI1 A;  4N8M A;  3AP7 A;  3VBF A;  5APA A;  1X8E A;  5C8W A;  3LEI A;  2JD4 A;  3CO2 A;  3SKV A;  3H1W A;  2R06 1;  1UF2 C;  4HFS A;  4Y26 A;  4Q8L A;  3K4Z A;  4ATE A;  4LEJ A;  4QAW A;  2PQQ A;  4CVU A;  3INA A;  4LKF A;  1TZO A;  5LBF A;  2GP3 A;  2IZW A;  3GXU A;  4QQP A;  3N4M A;  5F39 A;  4AAX A;  2VMI A;  3NAP B;  4UF0 B;  4OHY A;  4QM9 A;  2VVD A;  5K8S A;  4B8E A;  2V5Y A;  4HZF A;  2QZ2 A;  3U75 A;  2R04 2;  4IEQ A;  3PMS A;  1I1E A;  4Y5Z 0;  2D3R A;  3HMY A;  2C6S A;  1OA4 A;  4OI2 A;  4CEW A;  2DU0 A;  3TN9 3;  2GAU A;  3R0R A;  1ND3 B;  5BY5 A;  1RUG 2;  4EN9 B;  3D3A A;  2CDP A;  2JKB A;  1QNW A;  3LIG A;  2PTM A;  3THP A;  5LAS A;  3PVN A;  4Z92 B;  3GHM A;  3MYX A;  4ZY9 A;  4BZ4 A;  1WCK A;  4AI2 A;  5LEK A;  4QQO A;  1JUH A;  3E1F 1;  1IOA A;  2WC2 A;  4AI0 A;  5C9A A;  2VH9 A;  2VC9 A;  3POJ A;  4X8P A;  4XAB A;  3NJX A;  4FPE A;  1IQD C;  2PFW A;  2WN2 A;  3BN6 A;  4S2H A;  5DDJ 1;  3VKL A;  4HVQ A;  4BXF A;  1W6M B;  2VQ0 A;  1RXF A;  3J8F 2;  2FDH A;  4XFH A;  5A32 A;  3RPQ A;  5G05 L;  1Z78 A;  1MS4 A;  3AK0 A;  3SXW A;  1O4T A;  3KVA A;  4UBH A;  4LOR A;  2Y38 A;  1RUH 1;  1CAV B;  2JDZ A;  1OA2 A;  4QKD A;  3NQH A;  1LEC A;  5ANQ A;  4L99 A;  3JD7 2;  2ZKL A;  3K3N A;  1LU2 A;  1QHD A;  1J3Q A;  2VOX A;  5A33 B;  4YVW B;  3RS6 A;  2J1T A;  1VBC 3;  1F8V A;  1U5Y A;  1DYP A;  2X09 A;  4CDW A;  5FOB B;  4GJY A;  4QPG C;  1FV3 A;  5I93 A;  3H8X A;  3OOX A;  2X8K A;  4SBV A;  4H3W A;  5KHH A;  2FDG A;  4XFI A;  1UYX A;  4XHX A;  1H30 A;  4DUV A;  5FZA A;  3O1V A;  3ECQ A;  2JEN A;  3CQO A;  4W8J A;  1W9S A;  2RMU 2;  5IAV A;  5IW0 A;  4DXS A;  1OUS A;  3LGR A;  4UFH A;  1OF3 A;  4NIH A;  4LHK A;  5CFD A;  2UU8 A;  4KWL A;  3D5O A;  1ZBA 3;  4CDQ A;  2C5D A;  2BGP A;  4U36 A;  1DZR A;  1HQW A;  1QEX A;  2J1V A;  4YLZ A;  3EQE A;  5CAZ A;  1YC6 1;  1Y9M A;  3H7J A;  1UZZ A;  2ZMN A;  5FZ6 A;  2JDA A;  2HWB 1;  2XDV A;  2QQP A;  1XPW A;  3PVE A;  2IXC A;  2GC3 A;  2BEO A;  1HXS 1;  3MEP A;  4OHV A;  1UZY A;  1S0F A;  4FT8 A;  5H9S A;  4XOG A;  5J96 B;  5LB6 A;  4HG6 B;  3OUH A;  1AL0 G;  1GNY A;  2XLA A;  5IK7 A;  1H2L A;  1YIP A;  3GAL A;  1VRH 3;  5DZG A;  3RZH A;  3KM5 A;  2DVA A;  3KGL A;  4Q4W 1;  2JDH A;  1EV1 2;  4XMI A;  3O1R A;  3ALQ A;  4E4Z A;  1N3P A;  4XQW A;  3ZIW A;  2VCM A;  1SQ4 A;  4CP9 B;  5J7M A;  1RMU 2;  4CPB D;  4B29 A;  4Y4R A;  5FYH A;  5C33 A;  3KQR A;  3CZU A;  4WVV A;  1HIX A;  1VBB 2;  1RC6 A;  5F5Q A;  1RVF 2;  4R9B A;  4TSV A;  1VBD 2;  1RUI 2;  4FFI A;  4P9Y A;  5A7N A;  1WMF A;  1ZRI A;  2JDY A;  2RJK A;  2VY0 A;  2PQS A;  4GWN A;  5F2S A;  2CAU A;  3VZM A;  4DFS A;  2B9U A;  2UYA A;  2D6N A;  2JG8 C;  5C3P A;  1VJ2 A;  5FWJ A;  1UWW A;  1NLQ A;  2GMM A;  1WW4 A;  5HXV A;  2WNU A;  5LEJ A;  3I59 B;  3NV2 A;  1JXN A;  4XBL A;  2QNK A;  4QB6 A;  3NNF A;  5DUX A;  1YHF A;  1NZI A;  2Y33 A;  1N1V A;  3SLI A;  2ZOE B;  4YFZ A;  1JZ5 A;  4JRL A;  4AW7 A;  1LEM A;  1CPN A;  2XBO 2;  2DVG A;  2OQ6 A;  5CIR A;  4A41 A;  1VAK A;  1ZZ8 A;  2BBA A;  5FMO S;  4CZS A;  2JB4 A;  3H1M A;  1P8J A;  3ZSJ A;  1D2Q A;  2VW2 A;  4B4R A;  3S5A A;  1MEC 1;  2BWC A;  2WO3 A;  2Q8D A;  3NNJ A;  1VBE 3;  5DDJ 3;  4C0B A;  3ELN A;  1W8H A;  2VBB A;  3W59 A;  2FZ2 A;  1FYU A;  2VMF A;  4EE2 A;  2ZX1 A;  3U78 A;  4HKO A;  1PVC 1;  1GWL A;  4BLJ A;  4BWO A;  2ZPX A;  4W50 A;  4EN8 B;  1WLD A;  1W6P B;  1Z7S 1;  4AED B;  3O1M A;  4HPK B;  4X8N A;  3RZJ A;  2OPW A;  1H6X A;  2X53 S;  4NR1 A;  5ACA 3;  2WAO A;  2WWU A;  3BOW A;  4PDW C;  4BQ5 A;  1JTZ X;  4URT A;  2FZ1 A;  5GAL A;  1NY7 2;  4XUP A;  2VW0 A;  5FPU A;  3ZLI A;  2VZP A;  1AL2 3;  1PIV 3;  2IXK A;  1N47 A;  4IV1 C;  3VBR C;  2FDJ A;  4ASK A;  1ASJ 1;  1JZ2 A;  2TNF A;  4CXX A;  4KG8 A;  3KHB A;  4LK6 A;  5FYY A;  2YG0 A;  1IKP A;  2RR1 3;  2PHF A;  2W39 A;  1V0A A;  1RYY A;  3I3E A;  2BDR A;  4B4P A;  2XJS A;  1YEW A;  2DVD A;  5KC6 A;  3WNL A;  3GZE A;  1MS5 A;  3PU8 A;  3MID A;  3OYW B;  4PLO A;  4NN0 A;  3WQ0 A;  1CZV A;  3H7Y A;  3VL8 A;  1L3J A;  4KQ7 A;  5JVV A;  3W5N A;  2BGC A;  1ZZ9 A;  3I3D A;  5L7O A;  5A3L A;  1HRI 2;  2MPF A;  3O12 A;  5G04 L;  1E5R A;  3ZYF A;  4YSF A;  4BB3 A;  2W95 A;  3I49 A;  1AYM 2;  2WYS A;  5FUN A;  3T3Y A;  2VMC A;  2WZP P;  4EWA A;  4D94 A;  2W1U A;  3LDB A;  3B9I A;  5DG1 A;  1TNF A;  3ZKU A;  1DZQ A;  4CPB A;  5E89 A;  1XB9 A;  1LTE A;  1W05 A;  4AR2 A;  3NAP A;  4AFB A;  3I97 A;  2ZHN A;  3N9P A;  3T2O A;  1JZ7 A;  4DO0 A;  2G19 A;  4COU A;  1V6K A;  2WBK A;  2HBU A;  4K8R B;  4Q0P A;  2XUM A;  2WT2 A;  2DVB A;  1ODM A;  3W21 A;  1UCX A;  1AR6 3;  2ES3 A;  3AVS A;  2VVF A;  1W6O B;  3UES A;  1H9W A;  3MIC A;  2DU1 A;  4AF9 A;  3IKW A;  4L9B A;  4QX3 A;  4HKW A;  1POV 0;  5EWS A;  1G6N A;  3EBR A;  4XZU G;  3H8R A;  4PLN A;  1UQX A;  1RUE 1;  3C7H A;  4HK8 A;  3T30 A;  4BPZ A;  5LK7 B;  1HN1 A;  5A33 A;  3DXU A;  1APN A;  1EUU A;  3IN9 A;  3IB3 A;  1WLC A;  4YGC A;  1RUO A;  5ERL A;  3T1L A;  1AX2 A;  1ND3 C;  1RHI 1;  1CZT A;  4RHV 1;  4A7Y A;  3FBY A;  4K7J A;  4YAR A;  5F5C A;  5F5I A;  1CAV A;  4CE8 A;  5J3U A;  1WA4 A;  2WNV A;  5JI9 A;  4ARX A;  3N36 A;  2RS1 2;  1GR3 A;  5CFC C;  4XQ4 A;  3AYD A;  4OHW A;  1PGL 2;  3MW4 A;  1YYN A;  2ZAC A;  3QOP A;  5I8S A;  1PK6 B;  2RJL A;  3ST7 A;  2HWF 1;  4Y1U A;  4NPM A;  4S2F A;  1W28 A;  5GLZ A;  3U4X A;  3MLL A;  1AJO A;  1MEC 3;  3U11 A;  3BPS A;  3LEK A;  5FP7 A;  3TYJ A;  5FZ0 A;  3DYO A;  4TWT A;  4WM7 A;  1WME A;  1FMD 2;  1GKB A;  1KDM A;  1UU4 A;  1NA1 B;  3G6J B;  2NPI A;  3LF7 A;  4FPH A;  3VB9 A;  2ZX2 A;  3WCS A;  5FY0 A;  2BGO A;  1PO2 2;  5LCW L;  1R1A 1;  1R08 1;  1PVC 3;  5BNN A;  1HLC A;  4RSU A;  5FYU A;  1H2K A;  1ZBE 2;  4YVW C;  5HCF A;  3U07 A;  1QF3 A;  4MXW A;  3NWK A;  1H1I A;  2ATF A;  3OGG A;  4YZ3 A;  1MZ5 A;  1HW5 A;  4GH4 B;  5JZG C;  2RS3 2;  1NKG A;  1IPS A;  1XNT A;  4YVS B;  4DIQ A;  1CD3 G;  3KV5 A;  1ZZC A;  4FPY A;  3TB0 A;  1PZ9 A;  1U5X A;  1BVV A;  2K46 A;  4FPC A;  3I2I A;  5FY9 A;  4YZ4 A;  4QPI B;  3NKT A;  1O91 A;  4WVM B;  2WFF 1;  3SC7 X;  4JGY A;  1YJK A;  4CEY A;  2F17 A;  2OKX A;  2AC1 A;  2H0B A;  3M8L A;  2R04 3;  2WQ4 A;  3HIF A;  1O3Q A;  2W9X A;  5AFB A;  4H55 A;  2QFE A;  1JZ6 A;  1GQG A;  2JDN A;  2IXL A;  2VTX J;  4J25 A;  5FK7 A;  3VBO B;  5HI0 A;  4FQZ A;  1ZVF A;  3A22 A;  5CKQ A;  1H9P A;  4OFG A;  4BIF A;  4Q4Y 1;  2W2I A;  2WJS A;  4NIG A;  1EY2 A;  4IQP A;  5A3O A;  4M3C F;  4MV2 A;  4PF5 A;  3ZFE C;  1AYN 2;  4H7M A;  4IE5 A;  4MXV A;  5GLW A;  4QX0 A;  4XBQ A;  1K5J A;  2E7Q A;  3WD5 A;  3TAY A;  5E8A A;  1DG6 A;  2CSG A;  4R9C A;  1RIR A;  3I59 A;  4B1L A;  2QKD A;  3GZU C;  4NIA A;  1FPN 2;  1RUD 2;  4P5H A;  1LOG A;  2ET7 A;  5FP3 A;  1UY0 A;  4QDR A;  5FUI A;  4HLT A;  1RUJ 2;  3O1P A;  2YZ4 A;  3WF1 A;  4L8Q A;  2A6Y A;  4XVH A;  5DXD A;  1RUF 2;  4YW6 A;  2ZHM A;  3NJV A;  3U4S A;  3MI8 A;  2YPJ A;  3CJI B;  3AFK A;  1ZYB A;  1RUN A;  3P3N A;  3DV8 A;  4YM3 A;  4AVC A;  4HSJ A;  5F6K A;  4DXR A;  2XHN A;  4AHX A;  4C0H A;  2XVK A;  3M2M A;  3MO4 A;  2A3X A;  1POV 3;  4NWV A;  4O65 A;  3KGZ A;  3ZMN A;  2A3W A;  2W94 A;  3LSE A;  3ILN A;  4KWJ A;  1UX6 A;  2ZTN A;  2RMU 3;  4LBJ A;  5LK5 A;  2XUE A;  1RL3 A;  1IS4 A;  4XMA A;  4Q5O A;  3OBR A;  2VTF A;  4NOT A;  2VZT A;  2VOT A;  2R1D A;  3PL0 A;  3I3Q A;  2CWM A;  2W46 A;  1T6B X;  3MLJ A;  2HWF 3;  4TYS A;  3ZYG A;  1TMF 1;  3NNM A;  1GQH A;  4P00 B;  4A44 A;  3O0V A;  2F6B A;  2QQO A;  4AED C;  2BYV E;  1UX7 A;  4P5Y A;  1OUX A;  4B4Q A;  2YFU A;  4N43 B;  2MEV 1;  3VBH B;  4N9I A;  1R1A 3;  1R08 3;  2J7M A;  5K9Y A;  4EWD A;  5K0U A;  2DFB A;  2UWB A;  1U0A A;  3VBS B;  5D1I A;  4Y1Y A;  4FP2 A;  4RQP C;  5LAT A;  5C3S A;  2I07 B;  3N9O A;  1PM4 A;  3IDC B;  1HN0 A;  4LOS A;  3ZPO A;  5FP8 A;  3WY6 A;  1HB4 A;  4Y5T A;  4X6Q B;  3L2Y A;  3AMN A;  3JBG 1;  2PYT A;  3AP6 A;  1COV 3;  4C90 A;  5FYV A;  1VB4 A;  3WQ7 A;  5I8T A;  2BWA A;  2VCC A;  5IVB A;  5JPM B;  2AGS A;  1RVF 3;  4BME A;  4KWU A;  3AC0 A;  3HN1 A;  3WG4 A;  2YFZ A;  5F37 A;  1UYP A;  1SPP B;  4RFR B;  1VMJ A;  3ACG A;  5BNO B;  1FOD 1;  1B09 A;  1KS4 A;  5I0U A;  5FYC A;  5FPV A;  3IDA A;  3WW4 A;  1PO1 1;  5JR2 A;  2RM2 2;  3KB5 A;  4KMQ A;  4RN5 A;  5A70 A;  3FBM A;  3E5Q A;  3M3E A;  1O59 A;  4MOA A;  5KHI A;  1UY4 A;  1LOC A;  4QB1 A;  3U14 A;  3WW3 A;  4FTB A;  1CJD A;  3K2O A;  3ORJ A;  3I2K A;  2XBO 3;  1W2O A;  3AYE A;  4I2O A;  4CU7 A;  2B39 A;  4XJA A;  4XJ9 A;  3U37 A;  5CKN A;  5IWF A;  5I0D A;  4IV3 A;  4IEZ A;  1VBA 2;  4GQ7 A;  2R49 A;  1YQC A;  4FPO B;  4PBO A;  5FO7 B;  4JTO A;  4CDX A;  4RL7 A;  5L9B A;  1PMH X;  5LZ6 A;  1JOJ A;  1E5S A;  4AEJ A;  2BBV A;  1ND2 C;  2A71 A;  3DL3 A;  2JD9 A;  4IW3 A;  3ZN4 A;  1JMU B;  4Q2F A;  4PQ9 A;  4Z2W A;  4I09 A;  3JCI A;  4XZP A;  4YW7 A;  1G9B A;  3VBF B;  2HLE A;  5LY1 A;  5AVP A;  4M3C E;  3TEY A;  5FZD A;  1BMV 2;  4IGP A;  2DDU A;  2YBS A;  3AMP A;  4CUG A;  4DEV A;  5FZH A;  1AR9 1;  1NOV A;  3LPF A;  3KF3 A;  4FSJ A;  1XE0 A;  4G4F A;  5FJK A;  4E4H A;  2XQR A;  4AI8 A;  5JAX A;  2IXI A;  2OPK A;  5I0S A;  4Q4X 1;  1QOO A;  2CGN A;  4AGR A;  4ASM B;  4GZ9 A;  4YM2 A;  1OI6 A;  2GNB A;  1BHG A;  1GIC A;  4QQH A;  4R4X A;  4GMP 0;  3RNS A;  4CEW B;  1H2M A;  5FRE A;  2BVV A;  3JXS A;  5C8C A;  1PK6 C;  2XJU A;  4UW5 A;  2WNE A;  2VNG A;  5KHJ A;  4JX0 A;  5I0T A;  4CU8 A;  3ZXK A;  2BV4 A;  2V4A A;  3AMH A;  2X05 A;  2RS5 3;  1VPH A;  3A23 A;  4WVZ A;  3JUU A;  3R4S A;  5C9A B;  1CES A;  3WV6 A;  4GMP 1;  2CDO A;  3V0B A;  5EP9 A;  1TME 1;  4L11 A;  1WA6 X;  2LM3 A;  3U10 A;  3C7G A;  4HT1 T;  4QWN A;  2R07 1;  1O7F A;  1XNA A;  3VBU B;  4QPI A;  2MEV 3;  2JDM A;  2ZML A;  3LFM A;  3TWI A;  2RV9 A;  5F6L B;  5FZK A;  3OTF A;  1JU3 A;  1PGS A;  1SMV A;  2R06 2;  3IDB B;  3J7M A;  4WV8 A;  3IAP A;  4HON A;  4JRA A;  1K42 A;  5FPL A;  1W2N A;  1UXX X;  4JZR A;  2OS2 A;  4KBB A;  1YNA A;  1HJF A;  1W0N A;  3MUZ 1;  1B35 A;  4W65 A;  3ITQ A;  1O8S A;  4CDW B;  1CWP A;  3FUQ A;  4IEO A;  1JI6 A;  1UU6 A;  2D43 A;  5LRR A;  2FCT A;  1S0I A;  5FXV A;  4GB3 1;  4LA2 A;  4OUE A;  4A3Z A;  2ZGS A;  4CRQ A;  1UYY A;  4AAP A;  3KT4 A;  4XW3 A;  5ISL A;  5EQU A;  2EF6 A;  4MSV A;  4XUN A;  1EPZ A;  2PHL A;  2NLR A;  2VEC A;  2XJT A;  4HKL A;  1EUT A;  2ORZ A;  1PO1 3;  4L97 A;  3WHT A;  3LWC A;  4UBG A;  3ZFF C;  4OHZ A;  1S0E A;  1CAW A;  1EAH 2;  2P3J A;  3H0O A;  1ENS A;  2GP5 A;  2JDK A;  5LWB A;  1GSL A;  4Q29 A;  1W8F A;  4BHP A;  2VNO A;  5H9Q A;  1QJU 2;  2D40 A;  1R1Z A;  5GLV A;  5ABJ A;  4LJH A;  1I3H A;  4A7Z A;  2EID A;  4QD2 A;  1H2N A;  2VZV A;  2Q8E A;  2ZGT A;  4KU8 A;  1DF0 A;  4XJU A;  1C4R A;  1W6Q A;  2ZGR A;  3WT3 A;  1QNY A;  1QXP A;  1FMD 3;  3C7E A;  4OI1 A;  3KVB A;  3BTA A;  3Q9O A;  2BER A;  3LSD A;  1YQ2 A;  1UL9 A;  1DQ4 A;  3CMG A;  3LOB A;  3POF A;  1YQ8 A;  1G9F A;  5CKM A;  1W99 A;  1LGC A;  4XYX A;  1ZBE 3;  2PXJ A;  1H8V A;  5T50 A;  3IMN A;  2IFW A;  1LOA A;  1FNY A;  3N7M A;  5IFP A;  5FZO A;  4K3U A;  1PZ7 A;  3KT1 A;  3LQC A;  4ZXK A;  3WDT A;  3FC0 A;  5JUV A;  5F5A A;  1ZZB A;  4XCB A;  1X36 A;  3ZPY A;  2Q4S A;  4IEV A;  4RGK A;  3PDQ A;  2KXL A;  2VUC A;  2ZGU A;  1QQP 2;  5SV8 A;  4R8H A;  4CCN A;  4Q0V A;  2EIC A;  1S0D A;  5LA0 A;  1XYN A;  3KCX A;  4JTN A;  1IPK A;  2X29 A;  4FOV A;  1OT5 A;  1V9U 2;  2QDR A;  3PVB B;  1QJY 3;  4FFH A;  3ZN5 A;  1CZS A;  5LA2 A;  2J1S A;  4UW6 A;  3ZOI A;  3N3H A;  3VN4 A;  1NYW A;  2HWB 2;  4NJ4 A;  1D4M 2;  2JB8 A;  1VBC 1;  1OD5 A;  2GC0 A;  4BCU A;  5H9P A;  4GWM A;  4BXS V;  2HWC 2;  2O8Q A;  5FRA A;  1LOB A;  3AKS A;  4GMP 3;  5JDB A;  4DZG A;  3BOD A;  4LUK A;  4HN0 A;  2LUW A;  2WII B;  4N43 C;  1XE8 A;  1DCS A;  1UO9 A;  2Z79 A;  3C8X A;  4P08 A;  2VM9 A;  3VBH C;  3WSO A;  3V0A A;  1DQ6 A;  1NLR A;  3J26 N;  4XIL A;  3I2F A;  3CF6 E;  4Q4W 2;  5FBJ A;  1J59 A;  5FPX A;  4PI0 A;  2AEZ A;  3BTZ A;  4QXB A;  2OZ6 A;  4DOU A;  1L7Q A;  3EYP A;  2FCU A;  1Q8O A;  3QCW A;  3OUJ A;  1ZBA 1;  1C8N A;  1G9D A;  3OGV A;  1RUD 3;  1SBE A;  4ZXE A;  4L92 A;  1LHW A;  3T08 A;  3AMM A;  4BIS A;  2CGO A;  5FP9 A;  4KGQ A;  2BPA 2;  1RUF 3;  5JCT A;  4LR4 A;  5CG9 A;  4DXT A;  1LHN A;  2EXK A;  3IM0 A;  5F3I A;  3WW2 A;  3P5B A;  2VME A;  2Y6K A;  4UAP A;  3KSC A;  1VRH 1;  4DY3 A;  2I45 A;  4YRD A;  5IT6 A;  2JEM A;  4RYD A;  1V70 A;  2ADD A;  2ZZQ A;  3POW A;  5CVR A;  2O0O A;  3OD4 A;  3LDK A;  1DGL A;  3SIS A;  3UKT A;  4E4D X;  4YZ2 A;  4XUQ A;  5L7O B;  2XML A;  2Y26 A;  4AHY A;  4YPJ A;  4A7K A;  3FLT A;  5FK8 A;  4CDU A;  1MS3 A;  3SNM A;  4ISR A;  1HX6 A;  2VNR A;  2XKO A;  4UFJ A;  1HDK A;  5GJ6 A;  5FTT C;  4F7Z A;  5EPA A;  2NMO A;  4R4Z A;  1SZB A;  2XG3 A;  2Q1F A;  3RG0 A;  3E6B A;  4OYU A;  5FBZ A;  1Z7S 2;  2Y60 A;  3DPR A;  3EMR A;  4OUM A;  2CHH A;  4HL0 A;  4QM8 A;  1Y3T A;  1OC1 A;  2XJV A;  2ZHK A;  3VBF C;  5GLT A;  3ES1 A;  5JSO A;  2OQ7 A;  4LE3 A;  3ZR6 A;  3VDD A;  5LA1 A;  5F2W A;  5C70 A;  5C4W A;  4FFF A;  1D0H A;  3AB0 A;  3T0B A;  5F3C A;  1WW6 A;  2Q30 A;  3ACH A;  3DEM A;  5C6C A;  1JYT A;  4QXK A;  2F4P A;  1AZD A;  5L9R A;  1VBE 1;  1CQ9 A;  1STM A;  4NRO A;  2K9Z A;  1NCQ A;  1O8P A;  2XVG A;  3ZO0 B;  3LAG A;  4S2G A;  3OGR A;  3ZYJ B;  4BIO A;  1JZ8 A;  2D6M A;  3MFA A;  1BBT 3;  4HSL A;  1S1A A;  4Q1R A;  3IDE A;  3VBU A;  2VVE A;  3AZX A;  3POS A;  5ACA 1;  2O14 A;  1YFU A;  1YO8 A;  1LHV A;  1S2E A;  4GIQ A;  2BW8 A;  3I2J A;  3T2Q A;  2WNV B;  3SH5 A;  4MZU A;  4BQX A;  1GZW A;  4YG3 A;  5C9A C;  2QBX A;  1AL2 1;  1PIV 1;  4A45 A;  2AYH A;  2RG4 A;  4Z2A A;  3BAL A;  3HVD A;  2V5D A;  5KHG A;  1UOG A;  1O3T A;  2O8O A;  5FKB A;  2A6X A;  4OZO A;  4QX7 A;  4WM7 B;  2RR1 1;  2E7T A;  2VMG A;  5K7P A;  1SFP A;  2ZGQ A;  4NUB A;  3KCC A;  1W9T A;  2XL9 A;  4IEY A;  2XL7 A;  4LBN A;  3MIB A;  1DZT A;  4D6Q A;  1UAI A;  4MGS A;  4RGA A;  3M3C A;  3BIW E;  5BNN B;  1Q8Q A;  3OPZ A;  1QIQ A;  4Q0S A;  3C3V A;  3B5L B;  2J42 A;  4LBM A;  1RJ7 A;  2YUE A;  4MXW B;  2OVU A;  3ZFG C;  2PA7 A;  2ZAB A;  1GV9 A;  3V56 A;  4DUX A;  1ZRE A;  1RUE 2;  4CYD A;  2WSU A;  5A6Q A;  4BQW A;  2WDB A;  1OLQ A;  4AVB A;  4WBB A;  3NJY A;  1OLM A;  3KT7 A;  4UFM A;  2ZMK A;  2A6W A;  1CAU A;  1KDK A;  2Q1Z B;  1Y9Q A;  3TEW A;  1RHI 2;  1DQ2 A;  1DU3 D;  2X5I B;  4BQ3 A;  2ENR A;  4C1W A;  5C7G A;  5CFD C;  3OSD A;  3RWK X;  4Y33 A;  4HXC A;  1WGP A;  3BCW A;  3T0A A;  4CEY B;  4JGY B;  4ES9 A;  4CDQ C;  3OGJ A;  1AR6 1;  3THC A;  1WCS A;  2D7F A;  2EIB A;  3AXD A;  4CUA A;  4GA9 A;  3NV4 A;  1WLT A;  3F95 A;  3PIJ A;  4MYE A;  4XFG A;  2DFC A;  4IEW A;  3N7J A;  1YWK A;  3ZSM A;  4Q8K A;  5FQ0 A;  3J9S A;  3KCY A;  5IVV A;  1JH5 A;  1HB1 A;  1LCL A;  3MIH A;  3E5U A;  3NNL A;  3GJB A;  4QDS A;  1AX0 A;  1S0B A;  5GZF A;  4P02 B;  1BZW A;  1ULP A;  1UPS A;  1U5Z A;  3C2U A;  3VDC A;  4ES8 A;  1TE1 B;  1C28 A;  1A3K A;  1MVQ A;  3AKR A;  1OD3 A;  2PHD A;  3KV4 A;  4I0B A;  4YG0 A;  2JG8 A;  4BU2 A;  2BFU L;  2CGP A;  2YB7 A;  2OYZ A;  3UYJ A;  2VZR A;  3R05 A;  1WMX A;  4PT6 A;  1PZ8 A;  1OQE A;  1HV1 A;  1HRV 2;  3I2G A;  2Q8C A;  1KRI A;  1D4V B;  3L9J T;  1NE6 A;  3IPV A;  4F83 A;  3PUA A;  5J98 B;  1W8U A;  4AFD A;  5JSR A;  1NX9 A;  3VKM A;  3WP3 A;  2D5F A;  5EHD A;  5L36 A;  2WNU C;  1W9W A;  4XF1 A;  5DQ0 A;  2G4I A;  1MQT A;  5A7W A;  3U1X A;  1OPO A;  4AK3 A;  5A3P A;  4K8F A;  2ZS6 B;  3VDA A;  1ULO A;  1H8T C;  4CXW A;  3APB A;  4CU9 A;  4D69 A;  1X33 A;  3HJR A;  5T5L A;  2YYO A;  2XJR A;  1ZRD A;  4A4A A;  1OBN A;  2VCA A;  1O5L A;  4IXL A;  5CU1 A;  5HV0 A;  1N1S A;  2WWS A;  2JEC A;  3ZXJ A;  2TUN A;  5FR3 A;  3LEG A;  1SCR A;  5E6H A;  1CIY A;  2VUJ A;  1CAX A;  2VQU A;  3VBR A;  4FBF A;  1OHF A;  4XUO A;  2P34 A;  1T6G C;  3K4D A; 
#chains in the Genus database with same CATH homology
 4CCN A;  3N9P A;  4EZH A;  5FP3 A;  4DO0 A;  5FV3 A;  5FZB A;  4CCL A;  5FZ6 A;  5FZ9 A;  2XDV A;  5FJK A;  4E4H A;  5A7O A;  4QX8 A;  4QX7 A;  5FZF A;  3U4S A;  3AVS A;  5FYI A;  5KR7 A;  4NUB A;  4CCK A;  5A1F A;  3PU3 A;  3AVR A;  4V2W A;  4D6Q A;  4IGO A;  5FZC A;  5IVC A;  4XDP A;  5FY5 A;  5FZM A;  2OT7 A;  4QXH A;  3DXU A;  5A3W A;  3PUQ A;  5FXX A;  2OX0 A;  5FZL A;  4Y4R A;  5FYH A;  5FBJ A;  2XUE A;  5IVE A;  5FYZ A;  4C8D A;  1VRB A;  5FY7 A;  4LIV A;  3LD8 A;  4D6S A;  5FZ7 A;  4QXB A;  5A7N A;  4HOO A;  2YBP A;  3NJY A;  4QWN A;  3KV6 A;  5F2S A;  5F5C A;  5F3E A;  5F5I A;  3N9N A;  5FJH A;  4D6R A;  4URA A;  5FWJ A;  5FUP A;  2GP3 A;  5FZK A;  4Y3O A;  5F39 A;  4BIS A;  5LW9 A;  4Y33 A;  5FP9 A;  2P5B A;  5A7S A;  4HON A;  4CCJ A;  4UF0 B;  5FPL A;  5FP7 A;  5FZ0 A;  2OS2 A;  5F3I A;  2OQ6 A;  5FYS A;  5IVJ A;  3AL5 A;  2VD7 A;  4CSW A;  5A7W B;  5FY0 A;  3N9O A;  3ZPO A;  3N9Q A;  5A3T A;  5IVF A;  2Q8D A;  5FP8 A;  5FPB A;  5IVV A;  5FXV A;  2YPD A;  5FYU A;  5CEH A;  5FY4 A;  5IVY A;  2XML A;  4AAP A;  3PTR B;  5FY8 A;  5FYV A;  5LY2 A;  5ISL A;  4XDO A;  5FZ4 A;  3U78 A;  5FZO B;  5IVB A;  5FYM A;  4QXC A;  3AL6 A;  4GAZ A;  4BXF A;  3N9L A;  3KV4 A;  2WWU A;  4DIQ A;  5F37 A;  3KV5 A;  4EZ4 A;  2GP5 A;  5FZ1 A;  5A80 A;  4BU2 A;  5FWE A;  4LXL A;  4LIT A;  5FYB A;  4CCO A;  5LWB A;  5FYC A;  5FPV A;  5A7P A;  2WWJ A;  3UYJ A;  3ZLI A;  5A3N A;  5FPU A;  5FY9 A;  4ASK A;  5FPA A;  3KVA A;  4TN7 A;  2Q8C A;  3OPW A;  3DXT A;  3N9M A;  5ANQ A;  2Q8E A;  3K2O A;  3K3N A;  2OQ7 A;  5FYY A;  5FZI A;  4UF0 A;  5FZG A;  3PUA A;  3OPT A;  3PUS A;  5F2W A;  3KVB A;  5FZ8 A;  2YU2 A;  4CCM A;  5F3C A;  3KV9 A;  5F3G A;  5IWF A;  3PU8 A;  5A7W A;  4GJY A;  5F32 A;  5FP4 A;  4GJZ A;  5FY1 A;  2W2I A;  5A3P A;  2PXJ A;  3RVH A;  5FZA A;  5K4L A;  5FYT A;  4EYU A;  2YU1 A;  5IW0 A;  5FZ3 A;  3PUR A;  5FXW A;  5FUN A;  4GD4 A;  3K3O A;  5FZO A;  5LY1 A;  4IGQ A;  2YBK A;  4QU1 A;  3LDB A;  4LIU A;  5F5A A;  4V2V A;  5FZD A;  5FXZ A;  5E6H A;  4IGP A;  2XXZ A;  5FZE A;  5A7Q A;  4AI9 A;  3PDQ A;  2YBS A;  5A1L A;  4CUG A;  5FZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...