5FZDA

Crystal structure of the catalytic domain of human jarid1b in complex with l-2-hydroxyglutarate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with L-2-Hydroxyglutarate
rcsb
source organism Homo sapiens
total genus 145
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzdA01
4Y4RA 5A7QA 4QXCA 2XDVA 5FZIA 3U78A 3PTRB 4QX7A 5FP8A 4LIVA 5A1FA 4C8DA 5F5IA 5FZEA 4D6SA 5FZFA 3KV5A 4BISA 3AVSA 2XUEA 3OPWA 4CCJA 5A80A 5FPAA 5FZ6A 4DIQA 4URAA 2WWJA 5FXWA 4D6RA 5CEHA 5FZOA 5FYCA 4DO0A 3DXUA 4QX8A 5FYHA 4XDOA 5ANQA 4V2VA 3AL5A 5FY5A 5FYYA 5A7SA 3LD8A 5FY4A 5IVYA 5FZCA 2YU1A 5FXZA 5FUNA 4Y3OA 3ZPOA 5F32A 5A7WA 3KV4A 4AI9A 2PXJA 5FV3A 2VD7A 4ASKA 5FPUA 4UF0B 4LIUA 5F2WA 5FZLA 5FZAA 5IVJA 4CSWA 5A3WA 5FZMA 4QXBA 2OX0A 3N9LA 3U4SA 2GP3A 3PUAA 4QWNA 5LWBA 3N9MA 5FXXA 5FY7A 2OQ6A 4IGPA 4LXLA 5FYBA 3DXTA 4TN7A 3PU8A 5F2SA 2GP5A 5IVFA 2XMLA 4XDPA 2P5BA 5FPLA 5FY9A 5FXVA 4CCMA 5LY1A 3KV9A 4HONA 4LITA 2Q8CA 3NJYA 3ZLIA 5FZ4A 5LW9A 4QU1A 3N9OA 2Q8EA 4IGQA 5FY1A 5FP3A 2W2IA 5FZBA 5F3EA 5FZ3A 5A3TA 5FUPA 5F5AA 5FYZA 5IVEA 2YBPA 2YU2A 3KVBA 4BU2A 4UF0A 5IW0A 5FPVA 4V2WA 4NUBA 4EYUA 4GD4A 3PU3A 3N9PA 5FBJA 4CCKA 5FY8A 5A7NA 4GJZA 3N9QA 5K4LA 5A7PA 5ISLA 3K3OA 4GAZA 5FJKA 5FP4A 5FZ7A 5FZHA 5IWFA 5FP7A 3UYJA 4D6QA 5IVVA 3RVHA 4CCNA 5LY2A 5KR7A 5F3IA 4IGOA 5FWJA 3K2OA 3K3NA 3LDBA 5FP9A 5FYIA 5FYMA 5FWEA 4BXFA 5FZKA 5FZDA 3OPTA 3AVRA 5FZGA 5F3GA 5F5CA 5FZ0A 5A3NA 2OT7A 4CCOA 5FZ8A 5A7OA 5FYSA 4EZ4A 1VRBA 4CCLA 5F3CA 5IVCA 5FZ9A 4GJYA 5A1LA 3PUSA 5A3PA 2OS2A 5FZOB 3PUQA 2YPDA 4CUGA 2WWUA 5FZ1A 2OQ7A 2Q8DA 2YBSA 5FPBA 3KVAA 3PDQA 3AL6A 5FYVA 5FJHA 5FYTA 4EZHA 5IVBA 5E6HA 5F37A 4QXHA 5FYUA 5A7WB 4AAPA 2XXZA 4E4HA 5FY0A 2YBKA 3PURA 4HOOA 4Y33A 5F39A 3KV6A 3N9NA
chains in the Genus database with same CATH superfamily
5KXEA 5GLUA 4K21A 2XLGA 1W8WA 3G6JB 4OULA 2AGSA 2DWRA 3AB0A 3GHNA 3HNBM 4LNVA 2VM9A 5EYXA 1G6NA 4BXSV 3OJBA 1RL3A 4META 5IFPA 1CWPA 5JSOA 2WWJA 1CN1A 3CJIA 3Q8EA 1FATA 3ZMNA 1LOBA 2VQAA 1PZ9A 2D6KA 2HEVF 3POJA 1Q8VA 1US2A 1BJQA 3ZN5A 1WW5A 4NIDA 4LE3A 3C8XA 1IQDC 5HPOA 1KGYA 2VUJA 1IGOA 4XAEA 1T2XA 2WJSA 5L7OC 2DBIA 3SITA 3ZR5A 2OYZA 5FPUA 3QACA 3J7NA 1AX0A 3CKHA 4P9YA 2PAEA 4MV2A 3A21A 3BODA 2WT1A 3UETA 1WLCA 2PHDA 1YIFA 2BGPA 2VZUA 3ALQA 1LOFC 2RS32 4AEJA 2H6BA 1XE7A 3R4UA 4FFIA 5FXXA 2VZQA 4RS5B 1O6UA 1N3QA 5C4WC 4PLMA 4XJAA 5FYBA 3LOIA 2X05A 2AR6A 3M2MA 3VBOA 4BQ5A 2YUEA 5GLWA 4E4DX 2PHUA 2ARXA 4TSVA 4YG6A 1LCLA 1STMA 2BRTA 2RS13 4A3ZA 4HONA 3ZFFB 2WA3A 1Q8SA 3L2YA 5FZ4A 4EV0A 1RVF3 4OHZA 1RUE3 4BOWA 1TME1 5DPNA 4NPMA 2VMGA 3WZ1A 2JKXA 2Y6HA 4OCTA 4WVMA 2BDRA 1UZWA 2ATFA 4C0BA 4HZFA 3RGBA 4LKDA 4AGVA 4CP2A 3AZXA 4EROA 4Y4YA 3UJOA 4YRDA 3EYPA 3I3DA 3ZXFA 1CESA 1VB2A 5BNPA 5C9AA 5K9YA 5LK5A 4OQ8A 2CV6A 3UYJA 1RUJ3 2F4LA 5F6KA 3MUZ1 3AJYA 2G4IA 4KU8A 3VHOA 1CPNA 4Q0QA 2P3KA 4RQPC 1OOPB 2DF7A 3TNPB 4JGZA 2RS52 4L97A 4CCEA 5IYYA 4HVOA 2WZEA 4QPGA 1HW5A 5DUVA 2JDNA 3DPRB 4KG8A 4KWKA 3BGAA 3LA7A 1EAH1 2ZS6B 3B69A 4LUKA 3MYXA 1W05A 4XF9A 4Z07A 5FUIA 3WCRA 1UOBA 3OCPA 4P9WA 1X9PA 5FZ8A 2V4AA 3O0XA 1RXGA 5IAVA 1JU3A 2WS93 5IATA 1OH3A 2RR13 4WVVA 1ZBA3 1D4VB 2XJVA 4AHYA 1FOD2 5L19A 3ETQA 5AVAA 1OUXA 1GFF2 1GU3A 1ND2B 1UCXA 2VU9A 3ZN6B 1DLCA 4AGGA 2ZGQA 4OI0A 3V65A 2PHXA 2WO1A 4B1MA 1CAWB 4YLZA 5GLVA 3QD6A 1DU3D 1VP6A 1ZYBA 3I8TA 4L2NA 3VBHC 4AQTA 4IE4A 3K4AA 4NOTA 1AVBA 1IS4A 3WF0A 1NLRA 4Z1VA 4QAWA 3SCHA 2FDFA 4MGKE 4E4HA 1Q56A 2RM21 4Q0UA 1OVPA 2R30A 4LLOA 2VOXA 1NOVA 4CUCA 3ZFGB 2EIDA 1OD5A 3ZX7A 4NRQA 3JZVA 1R64A 5ABJB 2UWCA 2HYKA 2BWCA 5JIAA 3JBG2 4KWJA 3VKNA 1J3PA 2WN3A 3H7YA 1KJLA 3T2OA 3OUHA 1UXZA 2XWBB 4GH4A 2K2SA 4LE4A 4QGMA 1BBT3 2Q8OA 1LGCA 1BEV2 3GBGA 4P5YA 3T0DA 2QNKA 2VJXA 2WWSA 3LIGA 2D43A 1SDWA 5M0TA 1REEA 2AYHA 4XDOA 5C7GA 2B45X 3M4FA 1HQLA 3GZUC 3D8CA 3IWZA 4AHWA 1QQP1 5EHDA 4YW2A 5HI0A 2DUOA 3KV4A 4XPVA 3ZYHA 3TOJA 1UYYA 2K0GA 3IBMA 3VBSC 3RSJA 1CVNA 2MHFA 4LKEA 4Q2FA 1JU4A 1LODA 3C3VA 5KHHA 4X6RB 1WMEA 1YQ8A 3LA2A 2W5FA 4WZFA 2UWAA 1O5UA 1V6KA 4S2DA 4BQYA 4LUMA 5H9SA 4CEWA 2RMU3 1MACA 4JGYB 4KG0A 5BXXA 4E2GA 2ES3A 1ZRIA 3H9AA 4YG3A 2NN8A 1H1IA 2VMFA 2GNDA 2JE7A 1MQTC 2P5BA 4LBOA 2HWE1 5K0UA 5I8SA 3WNPA 3LA3A 4AVVA 2BOJA 5KBFA 3LDRA 1KDKA 1S0BA 3NJVA 3OF1A 2Y38A 2D97A 4LHLA 5DDJ1 3NKTA 5GKAC 2ZABA 2Y0IA 1AYM1 2RE9A 5HCHA 4UF0A 1EUUA 2DCYA 3AKTA 3SH3A 3UKNA 3ZIXA 1VE0A 3E6BA 2A1XA 1ZZ6A 5KHKA 1UIJA 2LROA 2EAKA 2W91A 2CWMA 3ZSMA 3POYA 5JXHA 2W1WA 2JXAA 3M3CA 3PVBB 1VBA2 2O8OA 5A33A 5J48A 1RJ7A 1LHWA 2HWC3 5FZ7A 3SCGA 4EE2A 5K8SA 1W0NA 2OIIA 3C7EA 1VMJA 5JZGB 3CZJA 3AM2A 3UKVA 3TAYA 3WT3A 3GDBA 5FYIA 1WMXA 3WDXA 4B29A 4I0AA 3MV01 3WNLA 1XNBA 2EVXA 4HK9A 1PGL1 4BK4A 5HV4A 3MIDA 4F7ZA 4YZ3A 1RUF1 2R063 2NM1A 4CP1A 5DZEA 2VPVA 4DXRA 4EZ4A 3LAGA 3OGJA 1PO12 3NL1A 2B9UA 5FZ9A 3VD4A 2E7TA 5LK7B 3RZGA 1EYBA 3WNNA 1UPIA 1QU0A 4RS5C 4XMIA 4BB3A 4C0HA 3VBFB 4CUGA 5DXDA 1JYNA 3USUA 1CR7A 1GZWB 1IKPA 1HRI1 3D5OA 3KVAA 2AACA 4AYUA 5I8YA 1POQA 4W50A 4MZUA 2V4VA 4AFAA 2R16A 3O1UA 2HWD2 1TMF2 4M3CA 2PAKA 2DCKA 3GZEA 2J42A 2JB4A 4HOOA 3GZAA 4QHOA 5DAQA 3ZXEA 3ZYJB 4AGRA 1K42A 2QDRA 4DY3A 2MEV2 2JG9B 2XL7A 5H9RA 4CU9A 3PTRB 3MIFA 1AX1A 4XJ8A 1JHNA 2OZ6A 4FPCA 4MSVA 4XC9A 2VECA 1NE6A 3VL9A 1GBGA 5LA9A 2RS33 2V72A 3O1OA 1SLBA 3ZXJA 4FAHA 5C8CC 1AL22 2RDSA 3DYOA 3GCXA 1WCUA 5FY5A 1NXD1 1QH6A 2E26A 1NLQA 4LK6A 1PK6B 1EPWA 1OOPC 1QY4A 2A6WA 4OI4A 4D8MA 3RYRA 3UV9A 3LFMA 4YZ5A 3O0VA 4GMP0 3R05A 1QJU2 1PGSA 3DPRC 1NQJA 5C5UA 3NVCA 4NWVA 3ZXKA 4DINB 3NQHA 1UZYA 2ZGOA 4I01A 3VHPA 4ZXKA 2GMMA 3AKPA 3NMBA 4ISQA 3EXUA 2WR9A 4XCAA 5LWBA 4XVHA 2IXJA 4LPLA 1KRIA 2QKDA 2VNRA 3U37A 4BLJA 1ND2C 4MVTA 2LRPA 3DEMA 5CKMA 3I2DA 1RINA 3AMHA 3NNLA 4BIFA 4ZS3A 3PU8A 2Q1MA 1CJDA 1SBDA 3IAPA 3U14A 2XMLA 4CCMA 3RWKX 4HN1A 4IV1A 2AUYA 2BNOA 3LPFA 3SH5A 2KA3A 4IGQA 4A2UA 1V9U1 5ACA2 3H42B 4ZU4A 2VAUA 3WW2A 5IK8A 1W6PA 2RS53 1PZ7A 4Q0VA 4XE9A 4IE5A 5ABJC 4OHVA 5C5TA 3JQWA 1M4WA 1DQ0A 1VPHA 5GJ6A 3V56A 2PHRA 4A3XA 2QQVA 3PU3A 4W6YA 3PMEA 4YM0A 4Y5TA 2YGMA 4YW7A 3BB6A 3SLIA 3T2QA 4Z2WA 3VD9A 1QJEA 4LA3A 5JLVA 1CONA 2QZ3A 3V0BB 1CGPA 5FZHA 2ZAAA 2K46A 1FOD3 2CY6A 3MFAA 2WC2A 3PTYA 1F35A 3U1XA 3WNKA 4YW5A 3AZVA 2AZ5A 1AR71 5FYMA 5FREA 2L9LA 4H55A 2VW2A 4WBBA 1RUC1 1VJ2A 2Y6KA 2JB8A 4NRMA 4UFJA 1NE4A 4LHKA 2UYBA 3RYPA 1W9YA 2E31A 4M3CF 3MF6A 5F9TA 1R091 4A7YA 1KEXA 2BQPA 2XQXA 4DOUA 3WOGA 4Q5OA 1ZZ8A 1F4HA 2JE8A 3FBMA 3LF7A 3ON7A 4MGZE 2HBUA 3JQXA 4AEDC 3E6CC 5LA2A 1DYOA 1RUD1 1LGBA 1X50A 4CU6A 1UMZA 2RG4A 1O8SA 1W2AX 3J4UH 1ALYA 3MBWA 3PDQA 3ZSKA 3H0OA 5ANNA 2B5HA 2JENA 4MXWA 5FO8B 1BEV3 1VBE3 2Y6GA 1DBNA 3NAPB 5HXVA 4DUWA 5L9BA 2OVUA 3ACLA 3I54A 3POFA 4C90A 4U2AA 4GB31 2VOWA 3IDAA 4Q4Y3 4PT6A 4RD7A 2Y33A 1MS9A 3LSDA 4LIVA 5JXIA 4ITCA 1TME2 1QJY2 1JYXA 1PGW2 4JKLA 4LO7A 3WP3A 1DGLA 3C7GA 1XSQA 4HG6B 4Y1VA 3O1VA 2PHLA 4Y26A 2GDFA 2Y60A 4M3CE 4IERA 5JZGC 1SDDB 4YVSB 4FBFA 5FLIA 1V00A 3WG2A 1TE1B 5DN2A 4WM8A 3K75B 4PBOA 1PZ8A 2QTWB 4QB1A 1LOGA 1CZVA 1Y9QA 4ASKA 3RZLA 5GLZA 2JDZA 5BNQA 1HXS1 1OF4A 3CNAA 5BNNA 1UNBA 4LT5A 5CG9A 3UGGA 3KSCA 3A22A 2RJ2A 2FDKA 2Q5TA 3N9LA 1QJFA 2VGDA 4NROA 3VBOC 2DCTA 3S30A 1I5ZA 1EPZA 4LXLA 2FHRA 3BTYA 1QDCA 4AVCA 1VBA3 3MIBA 4R52A 1ZZ9A 2W3JA 4XDPA 2VCBA 1JYCA 3SCFA 3VKFC 1Z0HA 2OKXA 2LW8A 4LBJA 4COVA 3VD3A 3WV6A 5J96B 1COV1 1HB2A 2ZCWA 4HETA 2JG9C 4A6OA 2YC2A 4QDSA 4QU2A 2OW4A 1SBFA 2F6BA 1AR61 5IHRA 4XBLA 2C9KA 4JAAA 1PO13 5JSPA 4ATFA 4XZPA 1MS1A 2GC0A 4Q4W2 1BYHA 3AXDA 5JVVA 3SMHA 4BMBA 2XWJB 2GNMA 2W68A 2YB7A 4FFHA 5D8AA 2ARBA 1MZ5A 3PJQA 4RR3A 3RVHA 5FMOS 2VZPA 1ENQA 1GWLA 2W46A 3QCWA 4JX0A 3K2OA 3K3NA 1V6OA 4BXFA 3OD0A 2ZGPA 4B7KA 4UW6A 4NR1A 1CX1A 3UT0A 2YFUA 3K4DA 3U0ZA 4PIXA 3LEGA 4YM1A 3WX5A 3LGRA 5GZGA 1C3HA 1U5ZA 1UWWA 3POSA 3OGSA 2HWD3 1TMF3 5LEJA 3J8F1 4RA0A 4H3WA 2QUOA 1GOHA 2A5ZA 1QQP2 1SLAA 2LM3A 5FIXA 4FO9A 5APAA 2UYAA 3AMQA 5LRSA 5DUXA 4AEMA 2P1BA 4A42A 2TBVA 1UU4A 2YPDA 3TWIA 2UWBA 3WP6A 1PO22 5D1IA 2GN3A 1UOFA 3ZSLA 2QDNA 3I2KA 5EQUA 3W59A 1D0GA 4QT6A 1FV3A 1LNSA 1SFPA 1UU5A 3DGTA 3LSEA 4BZ4A 4CA9A 1VLNA 1WCKA 4GALA 1W2TA 1AL23 5A7WB 4NIIA 3SHRA 4AAPA 1OLMA 1NY72 2X29A 4N8MA 4XFCA 3ZM8A 4ATEA 2H6CA 3OPZA 1DYKA 4FP2A 4XFFA 4Y33A 1W9TA 2HWE2 2IXIA 4FAGA 2P2KA 2YGLA 5A7QA 2XR4A 4QXCA 4Y20A 1HDKA 2X10A 3U78A 1DQ6A 4EN8B 1M06G 1QJU3 2A7AA 3ACFA 3DF0A 4MGQA 4L9BA 1FPN1 4XUOA 4KI5M 4NPRA 5F5IA 2XONA 5FZFA 2E9QA 2QZ2A 2Y6FA 3WW1A 2ZHMA 5JI9A 3THCA 2XUMA 4JTNA 1NG0A 4AF9A 4DIQA 1ENSA 1O4YA 1PVXA 2E33A 1O4TA 4RHV3 3WG4A 2YPJA 4KGQA 1S0JA 4Y1ZA 3P1IA 4XZUG 2A3YA 4NO4A 2WYFA 3AKSA 2OA2A 1LOEA 1R1ZA 4F8AA 1DLLA 1JZ5A 2JG8B 2XJRA 2IUWA 3E97A 4YGBA 4NVPA 1GZ9A 5FZCA 4A44A 4LTAA 4NHMA 4K7JA 5C71A 4JDMA 3HPNA 4PBPA 5J98B 5F7UA 1RUG2 2WO2A 4A41A 3AMMA 4YM3A 2JJ6A 2J1VA 3CLPA 5ACA3 3T30A 1PGL2 2RJLA 2VQTA 2GMEA 1PMHX 3SC7X 3HBZA 5J09A 1ZZCA 5EV7A 1YUDA 2ZX2A 3N9MA 4FSJA 2BOIA 1W6OB 1QIQA 3MPPG 3E6DA 4WZCA 1DIWA 4Y1XA 3VDAA 2LS6A 4YM2A 1HKDA 3AK0A 4AXOA 4BQ2A 5IVFA 1VAKA 5FY9A 2HWB1 3ROUA 5LY1A 1LRHA 4YVWA 3NAPC 3ACGA 4QU1A 2VNGA 5IAXA 4J1WA 1NUKA 1EV11 1RMU2 2W2IA 5T5OA 4AQSA 1MPXA 1V0AA 2VCAA 1L7RA 3NSTA 1CAVA 1SLLA 1DF0A 1W2OA 1YQ2A 1HB1A 2CTVA 2R071 3KVBA 4P9GA 5BNOA 3VD7A 4UW5A 4FOQA 5L9VA 4LOTA 2MNGA 3RFRA 4NHKA 5JI7A 1UY4A 4IV3A 2G9FA 2WQZC 3IDBB 2ZEYA 4DXZA 2YROA 3AYAA 2PA7A 2W52A 4FTSA 2GNBA 5IWFA 3P6BA 4OHWA 5BYNA 2IXKA 2JX9A 3R6SA 4Q0PA 2B9VA 2ZGKA 2WQ4A 1HB3A 1P8JA 1ODNA 3SISA 1DQ5A 3WF1A 5LCWL 4R9CA 1YQCA 3CIHA 5FZDA 1XYPA 2WZR2 3D0SA 1H2NA 2WIIB 4IE6A 3IZOA 4M4PA 4TWTA 4CCDA 1PMIA 4Y22B 3ZYPA 1OQ1A 1LHUA 2ZACA 3WF2A 3S57A 4AVBA 5CIRA 1TQ5A 4MYEA 4QGLA 2ORXA 5FKCA 3AMPA 3GZTB 1O3RA 3LPGA 5FZOB 1QWRA 4F3JA 1RHI1 2DBNA 3HQRA 3T1LA 2BBVA 2C24A 1QJY3 1FYUA 2VTXJ 1OT5A 3MGUA 1YIPA 4AHXA 4JRAA 4OQ9A 4RSUA 4XBQA 5FAXA 2DU0A 5A1AA 5KHIA 4FPGA 3TEYA 4JDNA 1DHKB 1MEC1 1K3IA 3V0AB 1SFNA 3KZ4C 3ZXLA 1OQDA 2JD9A 1H1MA 3VBSB 5FZIA 3ZFEB 4QHBA 1HIXA 3WNXA 4H14A 1RYYA 1GP4A 2GC3A 1S0EA 3W58A 4M01A 2VCCA 1RUI1 1SLIA 4Z92B 4GWJA 1KITA 1GV9A 3BYWA 4P00B 4GKXA 5C3QA 4HLTA 1QJX2 4PIZA 1OLME 4W6WA 1KFXL 2LTNA 2W08A 2R043 2WLQA 3FWEA 4HKOA 3LD8A 3ZYIB 4FT8A 4P14A 2Y6JA 1FNZA 4QX1A 4DZGA 1N47A 3POGA 5DG2A 1LU2A 3Q8CA 2D5FA 5CKNA 3H8RA 1UAIA 1AR72 4Q4X2 1ZA7A 2V09A 3AFKA 1E5IA 3E5XA 3KQRA 2GALA 5LA0A 4BQWA 5IVJA 1VALA 1X7NA 2JE9A 4UYBA 4AL9A 3ACIA 5EPAA 3THDA 1QGLA 4FQZA 4M4RA 1QF3A 1EY2A 4KMQA 1K5JA 2ENRA 2WYSA 1N1SA 3NRUA 1W8NA 1NCRB 3C7OA 4XF0A 1W2NA 3MEPA 4IEVA 3DXTA 4G3YC 2HJIA 4IV1C 1RUOA 2Y8KA 4Q4W3 3JCIA 3H1MA 1ASJ1 3VZMA 1S2EA 1JXNA 2BTVC 3ES4A 4ZHNA 5LW9A 3GCWA 4TZDA 2Y0OA 3POIA 2X5IB 1YEWA 2JD4A 1DP0A 2P3JA 4AEKA 4AVTA 4L99A 2VR4A 3TYJA 2D5HA 3VKMA 3MV11 5F5AA 3O1MA 1HJGA 4BU2A 2VZOA 4NAOA 1O3SA 2YV8A 3OY8B 1RXFA 1QOOA 2CAVA 2BJSA 1AR93 2DYCA 4CCKA 2Q1ZB 1QQP3 4EN9B 2WNUB 3WHTA 1BZWA 5E88A 4D6QA 4N9IA 5FTTC 2ZGUA 3S6PA 1U5YA 3HIFA 4P02B 1G7YA 1PO23 5A3MA 1PVC2 4O9EA 2JG8C 1N1VA 2PAMA 3RRDA 2DTWA 1DQ1A 5HBAA 5KXDA 1IG3A 3VLBB 4WM7B 5FZKA 3ZDSA 4COUA 5EYYA 3AVRA 3OBRA 3LCPA 1OVSA 2EXHA 4BJ0A 4K20A 4CCOA 3HVDA 4HPKB 3TB0A 4XFGA 4CXWA 4BK5A 4KWLA 3WP4A 4E8CA 4BH9A 3E5QA 4RGAA 3OBZA 5IT6A 3UKTA 2VMDA 4BE3A 4JQRA 3LB9A 2VXRA 1HXS2 1JUHA 4FPJA 4CDQA 5EJZB 5JMOA 4URTA 1ONAA 3VBUA 3LE0A 3LKJA 3PUHA 3H1YA 2Q8DA 1NCQA 1K5MA 2Z2SB 4JRLA 5C8CB 3GJAA 5HXMA 5FYVA 1AJKA 2WO3A 4Y5Z0 5FJHA 5IVBA 2HWF3 2VXJA 3B5LB 3TNQA 5DAVA 1CIYA 1GWKA 1Y43B 3MW4A 3UGHA 3WP5A 3A0KA 3KLSA 2Z79A 4NN0A 1CAXB 1DYPA 4A45A 3I59B 5C8WA 1S1AA 1UY0A 1ULEA 2QQLA 2DFBA 2XB6C 1QXJA 1YFUA 3AP5A 1REFA 5FP8A 4IDZA 1RUG3 5CZKA 1NA1A 1Y3TA 1ZRDA 5BY5A 2IZWA 1LJ7A 4LBQB 3AVSA 1AR83 4UFIA 4OI1A 1COV2 3OPWA 2JDKA 4IW3A 3LDKA 1W6NB 1F8VA 2FMYA 5FZ6A 1C4RA 2Q1FA 4D6RA 3ORJA 1HB4A 1VBB1 2Q4SA 4XCBA 4PDWB 3IPVB 1W0OA 1IG0A 2VE1A 2VVFA 5EIYB 1F5JA 5A70A 1NZCA 5IVYA 1C28A 4XIKA 1KJRA 2DTYA 1VBC1 4UXAA 1ZZBA 1WLTA 4OHYA 1BCXA 1SFYA 2VD7A 2RVAA 1BVVA 1IHMA 1UMIA 3CEWA 4N43A 1RMU3 1ZX5A 2CL2A 2VOTA 2RV9A 3S5AA 3THPA 3K77A 4CDUB 4MG2A 4DRRA 3MFCA 3PUAA 1W3VA 4QWNA 1MS4A 1VBD1 3D0JA 2GU9A 4R4ZA 1GYKA 3EHKA 4N53B 5CU1A 4JKKA 5LA1A 4O65A 4B1LA 4BQ4A 4MH0E 4YZ2A 2FDJA 4TN7A 5T55A 5A3UA 3MIHA 3O1SA 4M0NA 3PIJA 1WCDJ 4P9IA 2BU9A 5FPLA 3WDUA 3H8UA 4LITA 1UPSA 4LO6B 2PTMA 3BOWA 2NZ9A 4PI2A 1QNWA 3RPQA 2EIBA 5CFDB 4A7KA 1AXYA 2JDUA 3WHUA 3SQOA 5LEKA 3VD5A 3EB7A 3I2FA 4CDWA 3MICA 3ZFEC 2WZR3 2X8KA 4Y5SA 5A6ZA 3VHNA 4BWOA 3PVOA 2ZZQA 1D4M1 4O61A 2ZX3A 3BU0A 5FK7A 4XJ9A 4CCCA 4GJZA 4IXLA 5FK8A 4ARYA 4AEDB 2VVEA 3IMNA 4RR3C 1W6MB 2C0ZA 1JBCA 3PVEA 1FPN2 1W03A 5FP7A 5FQ0A 1XRUA 2QFEA 5LASA 1LGNA 4MXVA 3FMGA 4FPLA 1W6QA 4P9JA 3ZYBA 4I3GA 2WNVA 4XF1A 5T50A 3OPTA 1YQ6A 3ASIA 1H8TA 5F3GA 4IEXA 2QQJA 2W95A 2OT7A 3IKWA 3O5SA 1RGSA 1HRV2 3D3AA 5GM0A 4A6SA 5A1LA 5DMYA 2XJSA 3CJIB 5AC91 5FOBB 1APNA 1RVF1 1RUE1 2ZGNA 2ZHKA 3GM8A 1J84A 1UZVA 4GZ9A 4CRQA 1UY2A 1NCRC 1WMFA 4CU7A 2ZEWA 3M3IA 2XVLA 1G9DA 2EXJA 2G9ZA 3JD71 3RZJA 4NIGA 5E6HA 4HVRA 2P37A 3C7HA 1QJX3 4IETA 2KR2A 4CPBA 2OUJA 3I3BA 3CBNA 2X5IC 4LO8A 3MW3A 2HWB2 1CIWA 1RUJ1 1H0BA 4FPKA 3LOBA 4ZS2A 4QMAA 2XDVA 1MS3A 4JVAA 5A1FA 4QX7A 5T54A 1EV12 1AR73 4Q4X3 4RL7A 5FZEA 1AJOA 3JB8A 1ZBE1 1ULPA 1UYXA 4CCJA 5JOXA 1OF3A 5A3LA 3N36A 3RMXA 4QX5A 2BPA2 3VBOB 1JHJA 2WNUC 2WN2A 1GP5A 3HT1A 1Y7BA 4QB2A 5DUWA 1RUH1 5GALA 2WS91 4QKFA 3VKLA 3FLTA 5B2GB 1WKYA 2RR11 1GQHA 2NLRA 5DAXA 1AUYA 2WAOA 2JDPA 1WGPA 3R4DB 3CHXA 4AQ6A 2YU1A 1AZDA 4WM7C 4WVMB 1U5IA 2PELA 4J1XA 1UKGA 3LEMA 5EJ1B 1OUSA 2ARCA 4HMZA 1W28A 4I30A 3AZZA 4BIOA 5I0RA 4RYDA 2HLEA 2OX0A 1IZ3A 4Q26A 4MGIE 5LBBA 5K7PA 3OBAA 5BNPB 2KXLA 4Z8BA 5C9AB 3BTZA 3EBRA 3NW4A 4L8QA 1FNYA 3M3QA 4FPFA 2W1UA 1O91A 1SEFA 1KXGA 3DCQA 4RGGA 3VB9A 1QH7A 1OSGA 1RIRA 4CEYA 3ILNA 3Q8AA 1JUIA 1QDOA 2GP5A 4K9SA 1K45A 3N7LA 1S0DA 4JGZB 5FXVA 1W04A 1H6YA 4QPGB 2VVDA 5BUVA 1JYTA 1V6IA 4DQAA 1PVC3 5BNOC 3TEWA 3D6EA 3BPSA 3RJRA 2BVVA 5FZ3A 1PIV2 1NQDA 3POBA 5AFEA 1JOJA 1J3RA 4ASMB 4V1PA 2YU2A 1ZZ7A 3ZYGA 3WF4A 3POEA 4KL1A 1MEC2 5IK5A 2G9GA 4KBZA 5FO9B 3BIWE 2D98A 1RTVA 1XNAA 5A7PA 1SPPA 2XG3A 3K3OA 4GXLA 1C8M2 1AF9A 4ZZ8A 2PFWA 3C2UA 1HXS3 2P6CA 1A8MA 1HQNA 1C1LA 1UX6A 2IC1A 2VG9A 3AMNA 4I3PA 2XLAA 1TNFA 4OZXA 2O1QA 4PDWC 3T4HB 4FPOB 5FWJA 3BUCA 4NHYA 5GZCA 3ENRA 2WFPA 3AP4A 4JV4A 1S0GA 1L7QA 1YO8A 2FCUA 4HANA 2WA4A 5ERLA 4AW7A 2PN5A 3HWJA 3J7MA 4GH4B 4LHSA 1UKRA 4ZY9A 4I0WB 4OUMA 4CDUC 2E53A 5LBEA 3B94A 4L92A 4FFFA 4IE7A 1N3PA 3A23A 5AFBA 3UESA 5A32A 3P5BA 1JYIA 1KS4A 4FP3A 4TXWA 4N53C 2ZPXA 2TUNA 1NYWA 1COV3 1OXCA 2YBSA 5T5LA 3SKVA 3U10A 3LWCA 1ULFA 3W21A 2BERA 3A7QA 2CHHA 4XHBA 1K12A 5A6XA 3PMSA 4XQWA 3I2GA 4QB6A 2I74A 1QMJA 1J58A 5CFDC 3NNJA 4ISRA 1BVP1 2HWC1 3OYWA 3WF3A 4UFMA 4CPBD 1ASJ2 2XKOA 4LKFA 1I5PA 4H7MA 3WDWA 5CAZA 3L2HA 2ZGRA 2IVJA 2BNNA 3APBA 4CEWB 3JXSA 4JZRA 3AX4A 2DVAA 2QCSB 3JBG3 4BQ1A 1ZM1A 2R061 2WINB 1OH4A 5FYCA 5K0UB 5FOJB 1MVQA 5C4WA 4A4AA 2WQ8A 4QQOA 5FY4A 1A8DA 2ZEZA 5EJ3A 5J37A 1YHFA 4XHXA 1SZBA 4QD2A 1Z7S1 1WD4A 4XXAA 4D3WA 1N1YA 3OEBA 4XJUA 3ZKUA 4DY5A 3GALA 4UBGA 1JOPA 1XBFA 4UF0B 3W9AA 5F2WA 4UFLA 2A3WA 3FFZA 3HT2A 3HMYA 4NHLA 4LK7A 1OFSA 4CSWA 1D7PM 1W0PA 2VC9A 1EP0A 1UIKA 3Q8FA 2C4XA 4U36A 5A33B 1X8EA 3CJIC 5HCBA 1NT0A 2KD7A 3HJRA 5C8CA 2Q0AA 5FY7A 1DQ2A 1IS5A 1OKQA 4IGPA 1GOFA 2HYXA 3VKOA 1OI6A 3I2HA 4UWDA 1POV3 1SQ4A 5B4XA 5EFUA 1H30A 3AC0A 4IEUA 2XLFA 1C57A 4UW4A 1ND3A 1XE0A 3WINE 3PLQA 3S0MA 1ULGA 3HBKA 2VMCA 1GZCA 1MVEA 4RQPA 2RS31 1YWKA 5FP3A 4AR2A 1JW6A 5BV6A 3BTXA 1TNRA 4NIHA 1G9CA 1OPOA 2IVIB 5A3TA 1IPJA 5FUPA 5JR2A 1H8VA 5FRAA 4PQ9A 2AREA 2VZSA 4GMP3 3CJXA 4B7EA 1EAH2 2JDHA 4MHUA 3POWA 3TRSB 4YGDA 3MHZA 1HRV3 3USUB 3VZKA 1W3XA 4GAZA 3NV1A 4YNIA 5FJKA 4UAPA 3KQ4B 4PQQA 4E4SA 5CFCA 4FI9A 5SV8A 4X6QB 4FOYA 1MZ6A 4M3CB 3Q8BA 5H9QA 4E2SA 3PL0A 5KXCA 1VRH1 3K46A 1ZVFA 3VBHA 2QE3A 2YG0A 4CP9A 1MR5A 1YNAA 2J1AA 3KCYA 4IEQA 3KHBA 2Y26A 1B35A 4PLNA 4GWIA 2DCJA 4Z82A 1JZ8A 3VDDA 5E8AA 2CGPA 3VV1A 1ULDA 5A3NA 3TN91 4OYUA 3T09A 5JWPA 5FYSA 1VRBA 2VTFA 2HWB3 1VBC2 2G1MA 2QBXA 1D2SA 2RM22 2YDEA 3FUQA 3M1HA 4P08A 4PI0A 4S2FA 3N35A 4CDQC 2IFWA 3N7JA 3PUSA 3S7EA 2J1EA 3VBUC 5BNPC 1BXHA 5C9AC 5L7OA 1K5MC 2PLV1 2VZTA 4LBLA 4R8HA 2YYOA 1EV13 2WWUA 3MI8A 3EMRA 5C3SA 2R0FA 5FZ1A 2VW1A 3WDTA 2CDOA 1S2BA 2OXBA 4OI2A 4CXYA 3KHCA 4XXPA 4JC1A 1VAVA 1E57A 5C33A 4JGZC 4EZHA 1CAUA 3WQBA 1AL0G 2R32A 3HOBA 4QPGC 5EXOA 2EIEA 2J1RA 3HD8B 1W2UA 3IAQA 1W8FA 2A6XA 1ZREA 1FOD1 4ASLA 3KV6A 5I91A 4GIQA 4QXKA 2PYTA 1FXZA 4IEPA 1J59A 1D2QA 4B4QA 1NLSA 2VBDA 3A4UA 5DAPA 1TVGA 3U75A 4YW1A 1DZTA 1AXKA 2O8QA 1DFQA 2FDIA 1FAYA 2F4PA 2MEV3 1GP6A 4XFHA 4BPZA 3DKQA 4DPNA 4CDXA 1WBFA 1HJFA 2XH6A 4PF1A 4I2OA 4CZSA 3NO8A 4XTMA 1LHVA 1FX5A 4CE8A 2WABA 4NJ4A 1D4M2 2D3SA 1SCSA 3DXUA 4XYXA 4HVQA 3FE5A 1A3KA 4QQ2A 4IV1B 2VUCA 1V6LA 1XPWA 2E51A 1MQTA 2VBPA 5IFTA 2XQRA 5KC5A 1SMVA 2GN7A 1OA4A 2QQIA 1W6PB 4N43C 5EP9A 5F32A 5JAXA 3CQOA 5E16A 4Q1PA 4DNYA 4OUSA 5FZLA 2R6QA 5FZAA 2PMWB 1G9FA 3URFA 5J36A 1RUNA 2EF6A 5C70A 2DV9A 1VBE1 2ZXQA 4GH4C 4QDQA 2FDGA 3U11A 1GSLA 1PIV3 5DDJ2 1NX9A 3KM5A 2H0VA 4AWDA 2CSGA 4TTGA 1AYM2 2K9ZA 2E7QA 1FT9A 2ADDA 4HXCA 4FQ4A 2B8MA 4Q4Y1 3HNYM 4QQLA 4K8RB 5AC92 1JZ4A 4AE2A 1L3JA 1C8M3 3KCXA 3T3YA 5KXBA 1FI2A 5L36A 4BQXA 1YI7A 3DUIA 3J9SA 2ZHLA 3JD72 1UW8A 2UY8A 3RQ0A 2B46X 3R4SA 4OVEA 3I3QA 1UMHA 4QQHA 5T3NA 5JMCA 2W47A 1WMDA 4MGTA 4COYA 3LQCA 1KS5A 1URXA 4EYUA 4GD4A 4AFMA 4FOVA 2J22A 4AQ2A 4CEWC 1GQPA 1RUF2 3N9QA 1WWYA 4XTPA 1LKNA 3NNGA 4MXWB 1GMMA 5K0UC 4RS5A 3FLPA 1ZBE2 2W1QA 3ZVXA 2ZKNA 1LEMA 2WUHA 2ZMKA 3M7AA 3O1TA 1X8MA 4L11A 4E2QA 3BPZA 4JQTA 5FP9A 5CYYA 1CJPA 5GZDA 2NP0A 4LBMA 4MADA 2Y34A 1RUH2 3AFGA 3RS6A 3UK9A 1US3A 1HRI2 2JEMA 2WS92 4HL0A 4KNCA 3ZFFA 4DEQA 4A7ZA 2RR12 3NKGA 4TLFA 3I7DA 1YJLA 2ETEA 3ABZA 1IQAA 1O5LA 4FXKB 4YZ4A 1ASJ3 1MZEA 2QQKA 1KFUL 3H7JA 2BYVE 3BTAA 4XILA 4QPIA 4XIOA 4DUVA 2ET7A 1VAMA 2WFF1 2ORZA 1GNZA 3GJBA 5TSWA 4P5HA 4CXXA 1S0CA 2GNTA 4DB5A 1CPMA 1I6XA 5FMDA 1HV0A 3AKQA 2A6YA 3M70A 4WM8B 1XNKA 4XUPA 2RDRA 2R1DA 2YHJA 3G7DA 3I2OA 4CUAA 2GH8A 2XJTA 2PHWA 2DVDA 4K8FA 4O7XA 4EN0A 5BNNB 1LOCA 1OOPA 2GMPA 4DFSA 4OMDA 1UYPA 4KH9A 1H6XA 1KD7A 2WAAA 3DPRA 2WDBA 1TZOA 4LO4B 1H4GA 2I07B 1X36A 1Q8QA 3AYDA 4IEOA 3MO4A 2V73A 4DRVA 2GZWA 3THTA 1G9AA 4Q29A 5IJRA 3M3OA 1WD3A 2A75A 4NHXA 5A80A 2C26A 1Q8PA 3H8OA 3ZR6A 3BCWA 2UU8A 2VZ3A 1WZXA 1TMF1 1TME3 3ZN4A 5CEHA 1ZRCA 1A6CA 1ND2A 4QX8A 5FYHA 3ZN6A 5KWRA 4QX0A 1JH5A 1F9KA 1PHMA 3USSA 4AVSA 1CAWA 2WNEA 3KD4A 1YYNA 1AHSA 4ET7A 3KS7A 1H9WA 2PXJA 4IEWA 5C3OA 3LZZA 5CISA 4AI1A 2W39A 2XOMA 3ZFGA 3NNMA 5A3WA 2PQSA 1QOTA 1SLTA 1W8HA 3OUJA 3OG2A 4HN0A 3RWNA 1AL21 1V9U2 2J1UA 3U4SA 4HSLA 2DU1A 4C91A 4YYOA 1J1TA 4IQPA 4CEYC 5CBLA 4P9LA 5D8AB 2ZX1A 3VN4A 5C3RA 4RR3B 3LEKA 4YW4A 2CWSA 4MGYE 4AK3A 1LENA 4QGNA 5FR3A 1ULCA 1EAH3 2B7YA 2BVBA 4OHXA 1QJU1 2GH2A 4QHZA 4FPYA 2ZA9A 2WSVA 1AYN1 2Q8CA 1DGWX 3EQEA 4LEJA 4XJWA 5FY1A 3OGRA 1WCQA 4RHV1 3VHRA 1LB2A 2XGXA 2ZOEB 5FYZA 3QOPA 2YBPA 4YGCA 4EQVA 4KQ7A 5IW0A 2VW0A 4V2WA 2HWC2 1RUC2 3D4KA 4RFT0 1LHOA 2EXKA 3O1PA 4ZXEA 2FD8A 1YXWA 4WVZA 4EN6B 2FZ2A 2W94A 1UZZA 2RM23 3SEPA 5FFOC 4FTBA 1XC6A 3N7MA 4LA2A 4D7YA 1R092 1PX3A 4ZKTB 2ZGTA 2ZGSA 2D6NA 2ZMLA 3ES1A 3GBFA 3HNMA 4JGYA 1F4AA 4MOAA 4PLOA 2RJKA 2XBO1 2R062 4J6GA 5DAWA 1RUD2 2VUAA 5T5PA 1TEIA 1W99A 4OUEA 1ENRA 1DZQA 4Y20B 5FMOL 4XAAA 1R081 5H9PA 2VH9A 5ABJA 1HX6A 1Z7S2 3KGZA 3M3EA 3FN9A 3B02A 4QX2A 3B3QE 4EN7B 2D93A 1JTZX 4GB32 2P6HA 3MZHA 1GR3A 1W90A 2AEYA 2NYYA 5CB7A 3N3HA 2VNOA 2BW8A 1UL9A 2BNMA 4FFGA 2XJQA 1UN1A 3INAA 3AL6A 4AG4A 2Y64A 2YFZA 4IEZA 2XPJA 3JUUA 5JZGA 1D4M3 4QXHA 2JIJA 3BKZA 3T08A 1JZ7A 2J1SA 2VO5A 3ATGA 1AX2A 2BGOA 3KMHA 2OPKA 5DQ0A 1DG6A 2W92A 4QKDA 4UT5A 3MLJA 1W39A 4LBKA 5I0UA 2IXCA 1LOAA 3R0RA 1MZFA 2GC1A 2A6ZA 2RHPA 5J7MA 4AI8A 4E4ZA 1JZ2A 2HWE3 3C7FA 1SG3A 3RZMA 4YW3A 5DG1A 5DDJ3 1DGRA 2JECA 4Q4V1 3S5QA 1CZSA 3SKJE 3H8XA 3IIIA 1BKZA 3BIEA 4YZ1A 1AYM3 3VBFA 1XNCA 2WRAA 4V2VA 4YVWB 1GZWA 2W0XA 3UGFA 1EUTA 1QOSA 2QQMA 2P3YA 2D6OX 5AC93 5I0TA 5DUUA 5CADA 1JI6A 1CAVB 1QJY1 5BNOB 2P3IA 4XBNA 1XNTA 1PGW1 3P3PA 4BDVB 1MS0A 1VRH2 4K1ZA 4QPIB 1XU1A 2CAUA 3JD73 1OHFA 3OSDA 4I09A 4IV3B 5FZMA 4QM9A 5JIUA 2JG9A 2OUHA 1SACA 3EO6A 3E1F1 5CVRA 3TN92 5JPNB 3B7MA 1GICA 3K51A 5FKBA 4N7UA 3VDCA 5JSRA 4IESA 4MGSA 1PMJX 2BV4A 1ND3C 1RUF3 4M00A 5T5JA 1AR62 1ZRFA 2PLV2 5JUVA 4WM8C 4LQRA 5F5QA 1I1EA 3LIHA 4QKBA 1ZBE3 5DZGA 1GANA 3IM0A 1FMD1 1PK6A 4QX3A 5BNNC 5FZBA 2XVKA 4IEYA 3SH4A 1SHWB 1XYOA 5KHJA 3VGIA 1RUH3 2VOKA 2R041 2Z4FA 1HRI3 1GOGA 5FPVA 4QDRA 3MIEA 2WZ8A 1V6NA 3TEXA 3WVJA 4QPWA 1YC61 4M0HA 3DL3A 5CFCC 1R1A1 1OMIA 1S0FA 1XE8A 3J8F2 4PCRA 4FPEA 1Q8OA 2WT0A 5A3OA 4CCNA 5LY2A 2AC1A 3NWKA 4CTEA 1W06A 5JDBA 3H1WA 3VBRA 1B35C 1TG7A 3JB4C 4LMFA 1XJAA 5FWEA 3Q9OA 1X9TA 1YLLA 1WW4A 3VDDC 3AZWA 2PHFA 4HBNA 3HN3A 3RZKA 1UQXA 3UJQA 5F5CA 5F8PA 5T52A 3ITQA 3KGLA 2VTXA 4Q4W1 1LU1A 5F3CA 1IKQA 3SEEA 2IXHA 3SNMA 4LO5B 4UFHA 3ZKYA 4CCLA 2YXSA 1LTEA 1A34A 2ZGLA 1WLDA 2BFUL 3AP7A 2HBTA 2PHTA 3F95A 2CNAA 1I3HA 3AKRA 5D8AC 1S55A 3H3LA 5L73A 1H2MA 1VBE2 4XQ4A 1CD3G 1V6MA 1GNHA 3I3EA 3ZXGA 4OLLA 4LJHA 2DFCA 3V0BA 4N90A 3TEZA 4YPJA 1OD3A 5F39A 1AR91 3WW4A 2XXZA 4Q4Y2 5FY0A 2YBKA 3RZHA 3GF6A 3FC0A 1ODMA 1BK1A 2EICA 3ILFA 4NAMA 2C1FA 4PJYA 2WBKA 1V6JA 2W9XA 3ZSEA 5LBFA 2OS2A 3CDZB 5JCTA 3CU7A 3WLUA 1NAEA 4TYSA 4XOGA 5FLJA 4KWUA 1PO21 1HQWA 4CDXC 1OC1A 2RS11 3T0AA 2P4EA 5F6LB 3ZXAC 4BISA 5FMCA 2D7FA 2N7GA 2R49A 1PX4A 4XEZA 1W8UA 1UXXX 1V9U3 3NV2A 3WUCA 4Y1YA 1NY71 3IDEA 1QJZA 3DECA 4XQDA 4ZU5A 5LZ6A 1ENXA 2R0HA 5ANQA 5HCFA 1OKOA 4EWAA 2VBBA 2Z42A 4EWDA 1ZA4A 1OPMA 3U4XA 3IT8A 1GQGA 2B4KA 4MHRA 2NPIA 3ETPA 4C1WA 3GYDA 3F2ZA 3NAPA 3NJXA 5JOZA 4AI9A 1IPKA 3FZ3A 4Z2AA 1Y9MA 2XJPA 4LIUA 4D7TA 4QQPA 3QBQA 2HWF1 5IK7A 3H50A 4DMIA 2GAUA 1RJ8A 4R9AA 2PQQA 1OLQA 2AH2A 2ZAHA 4HK8A 4XFIA 1UOGA 3WG3A 1LAJA 1RUC3 2R072 3FUOA 4LHNA 4R9BA 4B4PA 1H1AA 2DVBA 4DS0A 3O7OA 2WFF2 1RUG1 1LESA 2A70A 2WT2A 2ZJCA 1VMFA 4JCKA 3I3MA 1R093 3SXWA 1AR81 3K48A 2HEYF 2VCMA 1ZBA1 2YZ4A 4O9GA 4S2HA 4YVSA 2JWPA 3HN1A 4YFWA 2VMHA 3RYKA 3T4VA 4CP0A 1WW7A 2G19A 1GUIA 1HV1A 4W8JA 2DDUA 4DEVA 3GHMA 4AI2A 4AI0A 1O3QA 1RUD3 2ZBJA 4ES8A 1WCSA 2WO7A 4EJRA 4Q27A 5FO7B 4NUBA 1CQ9A 4CDQB 5FBJA 4GULA 4S2GA 1Z7S3 3VBUB 1OA3A 3VDBA 3WQ1A 1NCQB 1GLHA 1K5MB 3OGGA 1OFNA 2O0OA 3RMYA 1SBEA 4QPYA 3WNMA 4OFGA 2GC2A 1RMU1 4GB33 5KR7A 2WNOA 4YVWC 1YI9A 2J7MA 4YW6A 1QXRA 3ZFFC 4SBVA 1RHI2 5IK4A 3W5MA 3H3ZA 1JZ3A 3MW2A 4G9SB 3O1RA 2C9AA 2QQNA 1BBT1 1BHGA 1UF2C 2ET1A 3LFIA 4K6BA 5E89A 5JXGA 1C8NA 2R1BA 1GKBA 1NA1B 1O8PA 3M8LA 4QPIC 5D2AA 1BMV1 4IV3C 1F2NA 1POV0 5D21A 2E6VA 3B00A 4FVVA 1PM7A 1U0AA 4L0PA 1XU2A 5GZEA 5A6YA 1PM4A 1W9WA 2NMNA 5A3PA 2P34A 4XFAA 1NKGA 1RB8G 4MUVA 1DGWA 2W1SA 3BOPA 2YC4A 2OQ7A 5E1RA 3WUDA 3UNPA 2ARAA 2EAAA 2LUWA 2WZR1 4BYYA 2DVGA 4FPHA 1ST8A 1E5RA 1RUI2 5FYTA 1OA2A 3OB8A 2WZPP 3E5UA 2V5YA 3ZDVA 2XL9A 4ZU7A 4N43B 1NXMA 2BP6A 2EIGA 2OZJA 2RMU1 1W9FA 1AYN2 3N9NA 3O12A 4NIAA 4FOWA 1Y4WA 4OMCA 2D44A 2MPFA 5JPMB 3HR9A 1S0IA 3ZIWA 4RHV2 4UBHA 3W20A 1VRH3 2EA7A 3KV5A 1OBNA 2D3PA 1DQ4A 4W65A 2RDQA 3PUIA 4BMEA 4URAA 2JKBA 4P9XA 4AVAA 2ZTNA 5LBCA 2ADEA 3VBRB 3FX3A 2VL4A 4LLFA 3WY6A 3TN93 2DVFA 5FYYA 3FBYA 4CU8A 3DV8A 1AXZA 1AR63 3PIGA 2Y6LA 4W4ZA 2Z69A 3ZPYA 5FXZA 2PLV3 4E27A 2BGCA 5A7WA 5LRRA 1XOYA 1BLZA 5FV3A 3ZFGC 3WEZA 1W8OA 1YRZA 4CDWB 2ZGMA 2JDAA 2A6VA 2XBO2 3IN9A 2VMIA 3AZYA 3WQ7A 2FMDA 5JOWA 1GWMA 3OGVA 4XFBA 1C1FA 1QJX1 4XJZA 5B4NA 2GP3A 2XKPA 2A3XA 4Y24A 1IS6A 1R082 4ZONA 2JDMA 3IB3A 1UX7A 2C5DA 2HH9A 2XJUA 4XDQA 1LOFA 5FQ0B 5I8TA 1JYWA 4BQ3A 4NPLA 2CDPA 2VMEA 4X8PA 3VL8A 3HEIA 3DKWA 3RDIA 1W6QB 1G9BA 3J8F3 2DURA 3MF9A 1UY3A 2WNVB 4ORFA 4RN5A 4Q4X1 3T0BA 1W8ZA 1CX4A 1XB9A 1H8TB 3N9OA 2JG8A 4HKLA 4NMIA 3B01A 4G4FA 4C1XA 5F3EA 1XYNA 3NV3A 4AHZA 2D6PA 1T6GC 3ZMOA 3FHAA 4LBNA 3FLRA 4AI3A 4BLIA 3J7HA 5DZFA 2RDNA 3KWVA 3MDPA 3WG1A 2C6SA 4ZPIA 3N9PA 5IUQA 2X53S 1RC6A 2W87A 2SBAA 5KC6A 4LKSA 4R4XA 4UW3A 1UOJA 4JGYC 3QH6A 1YFYA 2CGNA 3PVNA 4YFZA 5IVVA 1JYVA 1W6OA 3WDVA 5I0SA 5F3IA 3WDYA 3FL7A 3GBWA 5CG8A 1ZRRA 3LDBA 4Q4V2 1FPN3 2O14A 3AJZA 4FCAA 3BN6A 1YFXA 5HV0A 3PJYA 3QH7A 1Q5OA 1X33A 2B42B 2FZ1A 4SLIA 1YFWA 2EALA 4H2AA 1ULOA 4Q8KA 5G05L 2JIGA 3KF5A 4NRPA 4EWEA 5A7OA 2IFRA 3FJSA 3VZJA 3ZXDA 4XF4A 3T2TA 4GJYA 1WW6A 2IWGB 1VB4A 4XMAA 2CU5A 1QKQA 2XHNA 5CKQA 1PVC1 2D3RA 3BVCA 3CMGA 3I2JA 3ZO0B 2YMZA 1YCIA 4D69A 3FHQA 4AFDA 2YY1A 4K3UA 2WSUA 3VZOA 1REDA 3B9CA 3WXPA 1IOAA 4AFBA 3GXUA 4Y1UA 5J1XA 1PNFA 2R7EB 2VULA 2DUQA 2H0BA 4AZZA 1VBB2 3ELNA 5F1RA 3V64A 4LR4A 5FLHA 4COZA 4K40A 2LALA 3B93A 1A78A 3ZSJA 4CVUA 3W5NA 2UURA 4GWMA 2HKXA 2CYFA 1E5SA 1FMD2 1LHNA 2QQWA 4Y22A 4C8DA 4YARA 4FTEA 1Y9GA 1YQ5A 3CF6E 3AYEA 4XUTA 5JR7B 4D6SA 1Z78A 1UU6A 3K4ZA 2OPWA 2TNFA 4CEYB 2R042 3VBFC 1NCQC 3J7LA 3DYMA 2ZEXA 1FV2A 5FZOA 1LECA 1IPSA 3VUOA 3KT7A 2RS51 3ZYFA 3I49A 1R1A2 2R073 1VBD2 3AL5A 4PHZA 5A7SA 1LEDA 4R9DA 1PNGA 2WFF3 3H3UA 3KT1A 4JKMA 5GZFA 4N9HA 1HLCA 5FUNA 2DUPA 3RZZA 3ZPOA 1YJKA 5I0DA 1Q3EA 3N4MA 2BUKA 1NA1C 1W8TA 1XSRA 3V0AA 5A6QA 2VZVA 4YG0A 1UD1A 3VBSA 4CUBA 3ZFEA 1SPPB 4HKWA 5FMBA 1U12A 1MS5A 3DYPA 4NWWA 4I02A 1DDLA 2OQ6A 5SV5A 1DCSA 1WUVA 4XETA 4Q1RA 5F2SA 3AXEA 4D7SA 1S2KA 4LBQD 4H7LA 1PK6C 3CO2A 3KB5A 4W6XA 3EJKA 1JMUB 3NJYA 3ZLIA 2XVGA 3RI8A 4XW3A 4DXTA 3JBG1 1H9PA 2ZZJA 3ME2A 1RHI3 2X09A 1JOBA 1AR92 5DABA 2AENA 1LR5A 1X82A 1UY1A 4QM8A 4E9KA 1N3OA 3IIAA 1QNYA 2GSYA 3VZNA 3MLLA 5IVEA 4I0BA 4D94A 4COWA 1WLWA 1BEV1 4MLOA 4FXGB 4MX3A 4YGEA 1VMHA 1I9RA 3RNSA 5A32B 4YWAA 4DXSA 3I97A 5FY8A 5A7NA 4AAXA 4OZOA 4LORA 1XNDA 2VUDA 2WLPA 3B9IA 4WV8A 2F17A 1G8WA 3DN7A 3QLQA 1OLRA 1MEC3 2RS12 4ZZ5A 2ZMNA 1CZTA 4LOSA 3VBRC 2VZ1A 3UL2A 3FHIB 4BCUA 4XUNA 5C6CA 2D6LX 4UOJA 3ZYRA 2DCZA 1NCRA 3D82A 1RVF2 1RUE2 2CGOA 2VQUA 5HCAA 4ONUA 5LB6A 1G86A 2E7AA 3OYWB 2JICA 2FQPA 1RUI3 1T6BX 5CA6A 3VZLA 4CDWC 1QXPA 5FZGA 5FZ0A 5BPXA 2X5IA 2UY9A 1POV1 2QVSB 5J3UA 4GQ7A 4E8DA 3KT4A 5IVCA 2BEOA 5G04L 5C3PA 4BHPA 1AYN3 3AP9A 4GWNA 2VY0A 1F5FA 3I4IA 3RG0A 2VOVA 3OEAA 1RUJ2 3OBTA 3OY8A 4RFRB 4JHTA 1O7FA 3WNOA 2HWF2 4Q0SA 4JTOA 5C4WB 1L7LA 2VNVA 2ERFA 4HSJA 3WR0A 4JHZA 2Z5WA 3T2PA 2WNUA 2WNVC 3HQUA 1QHDA 4X8NA 2FCTA 4GMP1 5F37A 2AEZA 1KDMA 2JDYA 3P3NA 3PURA 1HRV1 1H8TC 1SLCA 1DGRN 4XF3A 3WQ0A 1UZ0A 1D0HA 1B09A 4WM7A 1Q43A 1AR82 2E63A 4Y4RA 1H4HA 1ZBA2 3RJ2X 1UYZA 4UI9L 3ST7A 4D0QA 1VBA1 3CZUA 2XBO3 4AFCA 2QQUA 4PF5A 1F15A 3AP6A 3IDCB 4HPKA 2XUEA 4LULA 4TLGA 5FPAA 3WCSA 3I2IA 5FXWA 1RITA 3AYCA 2BBAA 4BA6A 4CYDA 1J1LA 1R083 1XQNA 4DO0A 3HAGA 1ND3B 5JOYA 4GA9A 1WBLA 1BK0A 3WW3A 3A0NA 2BWAA 2ILMA 2WL1A 1JN2P 5GLTA 3RI9A 4RQPB 4B3NA 2XHKA 4BM8A 1F31A 3OUIA 4XABA 4Y3OA 1PO11 1JZ6A 2ZHNA 1MS8A 2J1TA 2YC0A 1H2KA 1CAXA 2A73B 1BQPA 3BU7A 3WSOA 4YSFA 3I59A 4XACA 5FDBA 3MUY1 4MO3M 2ZX0A 1BBT2 3O0WA 4QXBA 5I93A 3T1MA 1O4ZA 4XURA 1KQRA 1OQEA 5FPZA 4F83A 5CFCB 2BZDA 4ES9A 1BMV2 4LBQA 5L9RA 1IS3A 1W9SA 1WA4A 3NV4A 4XUQA 1W6NA 2QQOA 3OD4A 2HWD1 3BI3A 4KBBA 2P17A 1SCRA 5KHGA 4YVSC 1J3QA 3J26N 3VBHB 4GKYA 3MLKA 3U07A 1LULA 4CP9B 4PDWA 3IPVA 2MEV1 2E32A 3KV9A 1B35B 1C5HA 4PIYA 1QEXA 3GNEA 3ACHA 3PHMA 2BFUS 5FBZA 2Q8EA 3VDDB 3ZOIA 1S4CA 1VR3A 4ARXA 3HQXA 2Q30A 4Q4V3 1NZIA 3CL1A 5FCCA 2V5DA 1WA6X 4KGGA 1OURA 5EZWA 5L7OB 2I45A 1JS9A 2B39A 1J83A 2QJVA 4AOCA 2SLIA 3OOXA 2RMU2 1DZRA 4RGKA 1N1TA 2ZKLA 1ZNPA 4IL7A 5K4LA 4CDUA 4JDOA 2IXLA 5ISLA 2VZRA 3MIGA 1GNYA 5FP4A 2D40A 3TBDA 1CAUB 2FBEA 3KF3A 3N7KA 4IE0A 4N53A 3WD5A 1PIV1 4K1YA 4IGOA 1C5IA 1O59A 1V70A 1UO9A 4HT1T 1ACCA 3S7IA 4NE9A 3ILRA 2WKKA 1JODA 4N7IA 2VQ0A 2HEWF 3IMMA 5CFDA 4UFKA 1VBB3 5FPXA 1U5XA 2I2SA 2KM2A 1HN0A 2TEPA 1C8M1 3ECQA 2NQYA 3NJZA 3X29B 3JU9A 4CDXB 1H2LA 1VIWB 2EXIA 5CNAA 3PNAA 3FFQA 3L9JT 1O3TA 3NNFA 4INDA 3PUQA 1FMD3 2FCVA 2A71A 3KCCA 4Q8LA 1VBC3 4B8EA 5LATA 4IUGA 2ZX4A 2FDHA 5EWSA 4AEDA 4HFSA 5FPBA 1XXNA 4DUXA 1W6MA 4QKNA 3O14A 4B4RA 1GZTA 5ACA1 3GGLA 1MQTB 2ID4A 3BALA 4J25A 5FYUA 4KU7A 5JXJA 1E5HA 1HN1A 1R1A3 1VBD3 3LEIA 3OTFA 4WVWA 5AVPA 2D6MA 2QQPA 3MPBA 2NMOA
chains in the Genus database with same CATH topology
4Y4RA 5A7QA 4QXCA 2XDVA 5FZIA 3U78A 3PTRB 4QX7A 5FP8A 4LIVA 5A1FA 4C8DA 5F5IA 5FZEA 4D6SA 5FZFA 3KV5A 4BISA 3AVSA 2XUEA 3OPWA 4CCJA 5A80A 5FPAA 5FZ6A 4DIQA 4URAA 2WWJA 5FXWA 4D6RA 5CEHA 5FZOA 5FYCA 4DO0A 3DXUA 4QX8A 5FYHA 4XDOA 5ANQA 4V2VA 3AL5A 5FY5A 5FYYA 5A7SA 3LD8A 5FY4A 5IVYA 5FZCA 2YU1A 5FXZA 5FUNA 4Y3OA 3ZPOA 5F32A 5A7WA 3KV4A 4AI9A 2PXJA 5FV3A 2VD7A 4ASKA 5FPUA 4UF0B 4LIUA 5F2WA 5FZLA 5FZAA 5IVJA 4CSWA 5A3WA 5FZMA 4QXBA 2OX0A 3N9LA 3U4SA 2GP3A 3PUAA 4QWNA 5LWBA 3N9MA 5FXXA 5FY7A 2OQ6A 4IGPA 4LXLA 5FYBA 3DXTA 4TN7A 3PU8A 5F2SA 2GP5A 5IVFA 2XMLA 4XDPA 2P5BA 5FPLA 5FY9A 5FXVA 4CCMA 5LY1A 3KV9A 4HONA 4LITA 2Q8CA 3NJYA 3ZLIA 5FZ4A 5LW9A 4QU1A 3N9OA 2Q8EA 4IGQA 5FY1A 5FP3A 2W2IA 5FZBA 5F3EA 5FZ3A 5A3TA 5FUPA 5F5AA 5FYZA 5IVEA 2YBPA 2YU2A 3KVBA 4BU2A 4UF0A 5IW0A 5FPVA 4V2WA 4NUBA 4EYUA 4GD4A 3PU3A 3N9PA 5FBJA 4CCKA 5FY8A 5A7NA 4GJZA 3N9QA 5K4LA 5A7PA 5ISLA 3K3OA 4GAZA 5FJKA 5FP4A 5FZ7A 5FZHA 5IWFA 5FP7A 3UYJA 4D6QA 5IVVA 3RVHA 4CCNA 5LY2A 5KR7A 5F3IA 4IGOA 5FWJA 3K2OA 3K3NA 3LDBA 5FP9A 5FYIA 5FYMA 5FWEA 4BXFA 5FZKA 5FZDA 3OPTA 3AVRA 5FZGA 5F3GA 5F5CA 5FZ0A 5A3NA 2OT7A 4CCOA 5FZ8A 5A7OA 5FYSA 4EZ4A 1VRBA 4CCLA 5F3CA 5IVCA 5FZ9A 4GJYA 5A1LA 3PUSA 5A3PA 2OS2A 5FZOB 3PUQA 2YPDA 4CUGA 2WWUA 5FZ1A 2OQ7A 2Q8DA 2YBSA 5FPBA 3KVAA 3PDQA 3AL6A 5FYVA 5FJHA 5FYTA 4EZHA 5IVBA 5E6HA 5F37A 4QXHA 5FYUA 5A7WB 4AAPA 2XXZA 4E4HA 5FY0A 2YBKA 3PURA 4HOOA 4Y33A 5F39A 3KV6A 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y4R A;  5A7Q A;  4QXC A;  2XDV A;  5FZI A;  3U78 A;  3PTR B;  4QX7 A;  5FP8 A;  4LIV A;  5A1F A;  4C8D A;  5F5I A;  5FZE A;  4D6S A;  5FZF A;  3KV5 A;  4BIS A;  3AVS A;  2XUE A;  3OPW A;  4CCJ A;  5A80 A;  5FPA A;  5FZ6 A;  4DIQ A;  4URA A;  2WWJ A;  5FXW A;  4D6R A;  5CEH A;  5FZO A;  5FYC A;  4DO0 A;  3DXU A;  4QX8 A;  5FYH A;  4XDO A;  5ANQ A;  4V2V A;  3AL5 A;  5FY5 A;  5FYY A;  5A7S A;  3LD8 A;  5FY4 A;  5IVY A;  5FZC A;  2YU1 A;  5FXZ A;  5FUN A;  4Y3O A;  3ZPO A;  5F32 A;  5A7W A;  3KV4 A;  4AI9 A;  2PXJ A;  5FV3 A;  2VD7 A;  4ASK A;  5FPU A;  4UF0 B;  4LIU A;  5F2W A;  5FZL A;  5FZA A;  5IVJ A;  4CSW A;  5A3W A;  5FZM A;  4QXB A;  2OX0 A;  3N9L A;  3U4S A;  2GP3 A;  3PUA A;  4QWN A;  5LWB A;  3N9M A;  5FXX A;  5FY7 A;  2OQ6 A;  4IGP A;  4LXL A;  5FYB A;  3DXT A;  4TN7 A;  3PU8 A;  5F2S A;  2GP5 A;  5IVF A;  2XML A;  4XDP A;  2P5B A;  5FPL A;  5FY9 A;  5FXV A;  4CCM A;  5LY1 A;  3KV9 A;  4HON A;  4LIT A;  2Q8C A;  3NJY A;  3ZLI A;  5FZ4 A;  5LW9 A;  4QU1 A;  3N9O A;  2Q8E A;  4IGQ A;  5FY1 A;  5FP3 A;  2W2I A;  5FZB A;  5F3E A;  5FZ3 A;  5A3T A;  5FUP A;  5F5A A;  5FYZ A;  5IVE A;  2YBP A;  2YU2 A;  3KVB A;  4BU2 A;  4UF0 A;  5IW0 A;  5FPV A;  4V2W A;  4NUB A;  4EYU A;  4GD4 A;  3PU3 A;  3N9P A;  5FBJ A;  4CCK A;  5FY8 A;  5A7N A;  4GJZ A;  3N9Q A;  5K4L A;  5A7P A;  5ISL A;  3K3O A;  4GAZ A;  5FJK A;  5FP4 A;  5FZ7 A;  5FZH A;  5IWF A;  5FP7 A;  3UYJ A;  4D6Q A;  5IVV A;  3RVH A;  4CCN A;  5LY2 A;  5KR7 A;  5F3I A;  4IGO A;  5FWJ A;  3K2O A;  3K3N A;  3LDB A;  5FP9 A;  5FYI A;  5FYM A;  5FWE A;  4BXF A;  5FZK A;  5FZD A;  3OPT A;  3AVR A;  5FZG A;  5F3G A;  5F5C A;  5FZ0 A;  5A3N A;  2OT7 A;  4CCO A;  5FZ8 A;  5A7O A;  5FYS A;  4EZ4 A;  1VRB A;  4CCL A;  5F3C A;  5IVC A;  5FZ9 A;  4GJY A;  5A1L A;  3PUS A;  5A3P A;  2OS2 A;  5FZO B;  3PUQ A;  2YPD A;  4CUG A;  2WWU A;  5FZ1 A;  2OQ7 A;  2Q8D A;  2YBS A;  5FPB A;  3KVA A;  3PDQ A;  3AL6 A;  5FYV A;  5FJH A;  5FYT A;  4EZH A;  5IVB A;  5E6H A;  5F37 A;  4QXH A;  5FYU A;  5A7W B;  4AAP A;  2XXZ A;  4E4H A;  5FY0 A;  2YBK A;  3PUR A;  4HOO A;  4Y33 A;  5F39 A;  3KV6 A;  3N9N A; 
#chains in the Genus database with same CATH topology
 5KXE A;  5GLU A;  4K21 A;  2XLG A;  1W8W A;  3G6J B;  4OUL A;  2AGS A;  2DWR A;  3AB0 A;  3GHN A;  3HNB M;  4LNV A;  2VM9 A;  5EYX A;  1G6N A;  4BXS V;  3OJB A;  1RL3 A;  4MET A;  5IFP A;  1CWP A;  5JSO A;  2WWJ A;  1CN1 A;  3CJI A;  3Q8E A;  1FAT A;  3ZMN A;  1LOB A;  2VQA A;  1PZ9 A;  2D6K A;  2HEV F;  3POJ A;  1Q8V A;  1US2 A;  1BJQ A;  3ZN5 A;  1WW5 A;  4NID A;  4LE3 A;  3C8X A;  1IQD C;  5HPO A;  1KGY A;  2VUJ A;  1IGO A;  4XAE A;  1T2X A;  2WJS A;  5L7O C;  2DBI A;  3SIT A;  3ZR5 A;  2OYZ A;  5FPU A;  3QAC A;  3J7N A;  1AX0 A;  3CKH A;  4P9Y A;  2PAE A;  4MV2 A;  3A21 A;  3BOD A;  2WT1 A;  3UET A;  1WLC A;  2PHD A;  1YIF A;  2BGP A;  2VZU A;  3ALQ A;  1LOF C;  2RS3 2;  4AEJ A;  2H6B A;  1XE7 A;  3R4U A;  4FFI A;  5FXX A;  2VZQ A;  4RS5 B;  1O6U A;  1N3Q A;  5C4W C;  4PLM A;  4XJA A;  5FYB A;  3LOI A;  2X05 A;  2AR6 A;  3M2M A;  3VBO A;  4BQ5 A;  2YUE A;  5GLW A;  4E4D X;  2PHU A;  2ARX A;  4TSV A;  4YG6 A;  1LCL A;  1STM A;  2BRT A;  2RS1 3;  4A3Z A;  4HON A;  3ZFF B;  2WA3 A;  1Q8S A;  3L2Y A;  5FZ4 A;  4EV0 A;  1RVF 3;  4OHZ A;  1RUE 3;  4BOW A;  1TME 1;  5DPN A;  4NPM A;  2VMG A;  3WZ1 A;  2JKX A;  2Y6H A;  4OCT A;  4WVM A;  2BDR A;  1UZW A;  2ATF A;  4C0B A;  4HZF A;  3RGB A;  4LKD A;  4AGV A;  4CP2 A;  3AZX A;  4ERO A;  4Y4Y A;  3UJO A;  4YRD A;  3EYP A;  3I3D A;  3ZXF A;  1CES A;  1VB2 A;  5BNP A;  5C9A A;  5K9Y A;  5LK5 A;  4OQ8 A;  2CV6 A;  3UYJ A;  1RUJ 3;  2F4L A;  5F6K A;  3MUZ 1;  3AJY A;  2G4I A;  4KU8 A;  3VHO A;  1CPN A;  4Q0Q A;  2P3K A;  4RQP C;  1OOP B;  2DF7 A;  3TNP B;  4JGZ A;  2RS5 2;  4L97 A;  4CCE A;  5IYY A;  4HVO A;  2WZE A;  4QPG A;  1HW5 A;  5DUV A;  2JDN A;  3DPR B;  4KG8 A;  4KWK A;  3BGA A;  3LA7 A;  1EAH 1;  2ZS6 B;  3B69 A;  4LUK A;  3MYX A;  1W05 A;  4XF9 A;  4Z07 A;  5FUI A;  3WCR A;  1UOB A;  3OCP A;  4P9W A;  1X9P A;  5FZ8 A;  2V4A A;  3O0X A;  1RXG A;  5IAV A;  1JU3 A;  2WS9 3;  5IAT A;  1OH3 A;  2RR1 3;  4WVV A;  1ZBA 3;  1D4V B;  2XJV A;  4AHY A;  1FOD 2;  5L19 A;  3ETQ A;  5AVA A;  1OUX A;  1GFF 2;  1GU3 A;  1ND2 B;  1UCX A;  2VU9 A;  3ZN6 B;  1DLC A;  4AGG A;  2ZGQ A;  4OI0 A;  3V65 A;  2PHX A;  2WO1 A;  4B1M A;  1CAW B;  4YLZ A;  5GLV A;  3QD6 A;  1DU3 D;  1VP6 A;  1ZYB A;  3I8T A;  4L2N A;  3VBH C;  4AQT A;  4IE4 A;  3K4A A;  4NOT A;  1AVB A;  1IS4 A;  3WF0 A;  1NLR A;  4Z1V A;  4QAW A;  3SCH A;  2FDF A;  4MGK E;  4E4H A;  1Q56 A;  2RM2 1;  4Q0U A;  1OVP A;  2R30 A;  4LLO A;  2VOX A;  1NOV A;  4CUC A;  3ZFG B;  2EID A;  1OD5 A;  3ZX7 A;  4NRQ A;  3JZV A;  1R64 A;  5ABJ B;  2UWC A;  2HYK A;  2BWC A;  5JIA A;  3JBG 2;  4KWJ A;  3VKN A;  1J3P A;  2WN3 A;  3H7Y A;  1KJL A;  3T2O A;  3OUH A;  1UXZ A;  2XWB B;  4GH4 A;  2K2S A;  4LE4 A;  4QGM A;  1BBT 3;  2Q8O A;  1LGC A;  1BEV 2;  3GBG A;  4P5Y A;  3T0D A;  2QNK A;  2VJX A;  2WWS A;  3LIG A;  2D43 A;  1SDW A;  5M0T A;  1REE A;  2AYH A;  4XDO A;  5C7G A;  2B45 X;  3M4F A;  1HQL A;  3GZU C;  3D8C A;  3IWZ A;  4AHW A;  1QQP 1;  5EHD A;  4YW2 A;  5HI0 A;  2DUO A;  3KV4 A;  4XPV A;  3ZYH A;  3TOJ A;  1UYY A;  2K0G A;  3IBM A;  3VBS C;  3RSJ A;  1CVN A;  2MHF A;  4LKE A;  4Q2F A;  1JU4 A;  1LOD A;  3C3V A;  5KHH A;  4X6R B;  1WME A;  1YQ8 A;  3LA2 A;  2W5F A;  4WZF A;  2UWA A;  1O5U A;  1V6K A;  4S2D A;  4BQY A;  4LUM A;  5H9S A;  4CEW A;  2RMU 3;  1MAC A;  4JGY B;  4KG0 A;  5BXX A;  4E2G A;  2ES3 A;  1ZRI A;  3H9A A;  4YG3 A;  2NN8 A;  1H1I A;  2VMF A;  2GND A;  2JE7 A;  1MQT C;  2P5B A;  4LBO A;  2HWE 1;  5K0U A;  5I8S A;  3WNP A;  3LA3 A;  4AVV A;  2BOJ A;  5KBF A;  3LDR A;  1KDK A;  1S0B A;  3NJV A;  3OF1 A;  2Y38 A;  2D97 A;  4LHL A;  5DDJ 1;  3NKT A;  5GKA C;  2ZAB A;  2Y0I A;  1AYM 1;  2RE9 A;  5HCH A;  4UF0 A;  1EUU A;  2DCY A;  3AKT A;  3SH3 A;  3UKN A;  3ZIX A;  1VE0 A;  3E6B A;  2A1X A;  1ZZ6 A;  5KHK A;  1UIJ A;  2LRO A;  2EAK A;  2W91 A;  2CWM A;  3ZSM A;  3POY A;  5JXH A;  2W1W A;  2JXA A;  3M3C A;  3PVB B;  1VBA 2;  2O8O A;  5A33 A;  5J48 A;  1RJ7 A;  1LHW A;  2HWC 3;  5FZ7 A;  3SCG A;  4EE2 A;  5K8S A;  1W0N A;  2OII A;  3C7E A;  1VMJ A;  5JZG B;  3CZJ A;  3AM2 A;  3UKV A;  3TAY A;  3WT3 A;  3GDB A;  5FYI A;  1WMX A;  3WDX A;  4B29 A;  4I0A A;  3MV0 1;  3WNL A;  1XNB A;  2EVX A;  4HK9 A;  1PGL 1;  4BK4 A;  5HV4 A;  3MID A;  4F7Z A;  4YZ3 A;  1RUF 1;  2R06 3;  2NM1 A;  4CP1 A;  5DZE A;  2VPV A;  4DXR A;  4EZ4 A;  3LAG A;  3OGJ A;  1PO1 2;  3NL1 A;  2B9U A;  5FZ9 A;  3VD4 A;  2E7T A;  5LK7 B;  3RZG A;  1EYB A;  3WNN A;  1UPI A;  1QU0 A;  4RS5 C;  4XMI A;  4BB3 A;  4C0H A;  3VBF B;  4CUG A;  5DXD A;  1JYN A;  3USU A;  1CR7 A;  1GZW B;  1IKP A;  1HRI 1;  3D5O A;  3KVA A;  2AAC A;  4AYU A;  5I8Y A;  1POQ A;  4W50 A;  4MZU A;  2V4V A;  4AFA A;  2R16 A;  3O1U A;  2HWD 2;  1TMF 2;  4M3C A;  2PAK A;  2DCK A;  3GZE A;  2J42 A;  2JB4 A;  4HOO A;  3GZA A;  4QHO A;  5DAQ A;  3ZXE A;  3ZYJ B;  4AGR A;  1K42 A;  2QDR A;  4DY3 A;  2MEV 2;  2JG9 B;  2XL7 A;  5H9R A;  4CU9 A;  3PTR B;  3MIF A;  1AX1 A;  4XJ8 A;  1JHN A;  2OZ6 A;  4FPC A;  4MSV A;  4XC9 A;  2VEC A;  1NE6 A;  3VL9 A;  1GBG A;  5LA9 A;  2RS3 3;  2V72 A;  3O1O A;  1SLB A;  3ZXJ A;  4FAH A;  5C8C C;  1AL2 2;  2RDS A;  3DYO A;  3GCX A;  1WCU A;  5FY5 A;  1NXD 1;  1QH6 A;  2E26 A;  1NLQ A;  4LK6 A;  1PK6 B;  1EPW A;  1OOP C;  1QY4 A;  2A6W A;  4OI4 A;  4D8M A;  3RYR A;  3UV9 A;  3LFM A;  4YZ5 A;  3O0V A;  4GMP 0;  3R05 A;  1QJU 2;  1PGS A;  3DPR C;  1NQJ A;  5C5U A;  3NVC A;  4NWV A;  3ZXK A;  4DIN B;  3NQH A;  1UZY A;  2ZGO A;  4I01 A;  3VHP A;  4ZXK A;  2GMM A;  3AKP A;  3NMB A;  4ISQ A;  3EXU A;  2WR9 A;  4XCA A;  5LWB A;  4XVH A;  2IXJ A;  4LPL A;  1KRI A;  2QKD A;  2VNR A;  3U37 A;  4BLJ A;  1ND2 C;  4MVT A;  2LRP A;  3DEM A;  5CKM A;  3I2D A;  1RIN A;  3AMH A;  3NNL A;  4BIF A;  4ZS3 A;  3PU8 A;  2Q1M A;  1CJD A;  1SBD A;  3IAP A;  3U14 A;  2XML A;  4CCM A;  3RWK X;  4HN1 A;  4IV1 A;  2AUY A;  2BNO A;  3LPF A;  3SH5 A;  2KA3 A;  4IGQ A;  4A2U A;  1V9U 1;  5ACA 2;  3H42 B;  4ZU4 A;  2VAU A;  3WW2 A;  5IK8 A;  1W6P A;  2RS5 3;  1PZ7 A;  4Q0V A;  4XE9 A;  4IE5 A;  5ABJ C;  4OHV A;  5C5T A;  3JQW A;  1M4W A;  1DQ0 A;  1VPH A;  5GJ6 A;  3V56 A;  2PHR A;  4A3X A;  2QQV A;  3PU3 A;  4W6Y A;  3PME A;  4YM0 A;  4Y5T A;  2YGM A;  4YW7 A;  3BB6 A;  3SLI A;  3T2Q A;  4Z2W A;  3VD9 A;  1QJE A;  4LA3 A;  5JLV A;  1CON A;  2QZ3 A;  3V0B B;  1CGP A;  5FZH A;  2ZAA A;  2K46 A;  1FOD 3;  2CY6 A;  3MFA A;  2WC2 A;  3PTY A;  1F35 A;  3U1X A;  3WNK A;  4YW5 A;  3AZV A;  2AZ5 A;  1AR7 1;  5FYM A;  5FRE A;  2L9L A;  4H55 A;  2VW2 A;  4WBB A;  1RUC 1;  1VJ2 A;  2Y6K A;  2JB8 A;  4NRM A;  4UFJ A;  1NE4 A;  4LHK A;  2UYB A;  3RYP A;  1W9Y A;  2E31 A;  4M3C F;  3MF6 A;  5F9T A;  1R09 1;  4A7Y A;  1KEX A;  2BQP A;  2XQX A;  4DOU A;  3WOG A;  4Q5O A;  1ZZ8 A;  1F4H A;  2JE8 A;  3FBM A;  3LF7 A;  3ON7 A;  4MGZ E;  2HBU A;  3JQX A;  4AED C;  3E6C C;  5LA2 A;  1DYO A;  1RUD 1;  1LGB A;  1X50 A;  4CU6 A;  1UMZ A;  2RG4 A;  1O8S A;  1W2A X;  3J4U H;  1ALY A;  3MBW A;  3PDQ A;  3ZSK A;  3H0O A;  5ANN A;  2B5H A;  2JEN A;  4MXW A;  5FO8 B;  1BEV 3;  1VBE 3;  2Y6G A;  1DBN A;  3NAP B;  5HXV A;  4DUW A;  5L9B A;  2OVU A;  3ACL A;  3I54 A;  3POF A;  4C90 A;  4U2A A;  4GB3 1;  2VOW A;  3IDA A;  4Q4Y 3;  4PT6 A;  4RD7 A;  2Y33 A;  1MS9 A;  3LSD A;  4LIV A;  5JXI A;  4ITC A;  1TME 2;  1QJY 2;  1JYX A;  1PGW 2;  4JKL A;  4LO7 A;  3WP3 A;  1DGL A;  3C7G A;  1XSQ A;  4HG6 B;  4Y1V A;  3O1V A;  2PHL A;  4Y26 A;  2GDF A;  2Y60 A;  4M3C E;  4IER A;  5JZG C;  1SDD B;  4YVS B;  4FBF A;  5FLI A;  1V00 A;  3WG2 A;  1TE1 B;  5DN2 A;  4WM8 A;  3K75 B;  4PBO A;  1PZ8 A;  2QTW B;  4QB1 A;  1LOG A;  1CZV A;  1Y9Q A;  4ASK A;  3RZL A;  5GLZ A;  2JDZ A;  5BNQ A;  1HXS 1;  1OF4 A;  3CNA A;  5BNN A;  1UNB A;  4LT5 A;  5CG9 A;  3UGG A;  3KSC A;  3A22 A;  2RJ2 A;  2FDK A;  2Q5T A;  3N9L A;  1QJF A;  2VGD A;  4NRO A;  3VBO C;  2DCT A;  3S30 A;  1I5Z A;  1EPZ A;  4LXL A;  2FHR A;  3BTY A;  1QDC A;  4AVC A;  1VBA 3;  3MIB A;  4R52 A;  1ZZ9 A;  2W3J A;  4XDP A;  2VCB A;  1JYC A;  3SCF A;  3VKF C;  1Z0H A;  2OKX A;  2LW8 A;  4LBJ A;  4COV A;  3VD3 A;  3WV6 A;  5J96 B;  1COV 1;  1HB2 A;  2ZCW A;  4HET A;  2JG9 C;  4A6O A;  2YC2 A;  4QDS A;  4QU2 A;  2OW4 A;  1SBF A;  2F6B A;  1AR6 1;  5IHR A;  4XBL A;  2C9K A;  4JAA A;  1PO1 3;  5JSP A;  4ATF A;  4XZP A;  1MS1 A;  2GC0 A;  4Q4W 2;  1BYH A;  3AXD A;  5JVV A;  3SMH A;  4BMB A;  2XWJ B;  2GNM A;  2W68 A;  2YB7 A;  4FFH A;  5D8A A;  2ARB A;  1MZ5 A;  3PJQ A;  4RR3 A;  3RVH A;  5FMO S;  2VZP A;  1ENQ A;  1GWL A;  2W46 A;  3QCW A;  4JX0 A;  3K2O A;  3K3N A;  1V6O A;  4BXF A;  3OD0 A;  2ZGP A;  4B7K A;  4UW6 A;  4NR1 A;  1CX1 A;  3UT0 A;  2YFU A;  3K4D A;  3U0Z A;  4PIX A;  3LEG A;  4YM1 A;  3WX5 A;  3LGR A;  5GZG A;  1C3H A;  1U5Z A;  1UWW A;  3POS A;  3OGS A;  2HWD 3;  1TMF 3;  5LEJ A;  3J8F 1;  4RA0 A;  4H3W A;  2QUO A;  1GOH A;  2A5Z A;  1QQP 2;  1SLA A;  2LM3 A;  5FIX A;  4FO9 A;  5APA A;  2UYA A;  3AMQ A;  5LRS A;  5DUX A;  4AEM A;  2P1B A;  4A42 A;  2TBV A;  1UU4 A;  2YPD A;  3TWI A;  2UWB A;  3WP6 A;  1PO2 2;  5D1I A;  2GN3 A;  1UOF A;  3ZSL A;  2QDN A;  3I2K A;  5EQU A;  3W59 A;  1D0G A;  4QT6 A;  1FV3 A;  1LNS A;  1SFP A;  1UU5 A;  3DGT A;  3LSE A;  4BZ4 A;  4CA9 A;  1VLN A;  1WCK A;  4GAL A;  1W2T A;  1AL2 3;  5A7W B;  4NII A;  3SHR A;  4AAP A;  1OLM A;  1NY7 2;  2X29 A;  4N8M A;  4XFC A;  3ZM8 A;  4ATE A;  2H6C A;  3OPZ A;  1DYK A;  4FP2 A;  4XFF A;  4Y33 A;  1W9T A;  2HWE 2;  2IXI A;  4FAG A;  2P2K A;  2YGL A;  5A7Q A;  2XR4 A;  4QXC A;  4Y20 A;  1HDK A;  2X10 A;  3U78 A;  1DQ6 A;  4EN8 B;  1M06 G;  1QJU 3;  2A7A A;  3ACF A;  3DF0 A;  4MGQ A;  4L9B A;  1FPN 1;  4XUO A;  4KI5 M;  4NPR A;  5F5I A;  2XON A;  5FZF A;  2E9Q A;  2QZ2 A;  2Y6F A;  3WW1 A;  2ZHM A;  5JI9 A;  3THC A;  2XUM A;  4JTN A;  1NG0 A;  4AF9 A;  4DIQ A;  1ENS A;  1O4Y A;  1PVX A;  2E33 A;  1O4T A;  4RHV 3;  3WG4 A;  2YPJ A;  4KGQ A;  1S0J A;  4Y1Z A;  3P1I A;  4XZU G;  2A3Y A;  4NO4 A;  2WYF A;  3AKS A;  2OA2 A;  1LOE A;  1R1Z A;  4F8A A;  1DLL A;  1JZ5 A;  2JG8 B;  2XJR A;  2IUW A;  3E97 A;  4YGB A;  4NVP A;  1GZ9 A;  5FZC A;  4A44 A;  4LTA A;  4NHM A;  4K7J A;  5C71 A;  4JDM A;  3HPN A;  4PBP A;  5J98 B;  5F7U A;  1RUG 2;  2WO2 A;  4A41 A;  3AMM A;  4YM3 A;  2JJ6 A;  2J1V A;  3CLP A;  5ACA 3;  3T30 A;  1PGL 2;  2RJL A;  2VQT A;  2GME A;  1PMH X;  3SC7 X;  3HBZ A;  5J09 A;  1ZZC A;  5EV7 A;  1YUD A;  2ZX2 A;  3N9M A;  4FSJ A;  2BOI A;  1W6O B;  1QIQ A;  3MPP G;  3E6D A;  4WZC A;  1DIW A;  4Y1X A;  3VDA A;  2LS6 A;  4YM2 A;  1HKD A;  3AK0 A;  4AXO A;  4BQ2 A;  5IVF A;  1VAK A;  5FY9 A;  2HWB 1;  3ROU A;  5LY1 A;  1LRH A;  4YVW A;  3NAP C;  3ACG A;  4QU1 A;  2VNG A;  5IAX A;  4J1W A;  1NUK A;  1EV1 1;  1RMU 2;  2W2I A;  5T5O A;  4AQS A;  1MPX A;  1V0A A;  2VCA A;  1L7R A;  3NST A;  1CAV A;  1SLL A;  1DF0 A;  1W2O A;  1YQ2 A;  1HB1 A;  2CTV A;  2R07 1;  3KVB A;  4P9G A;  5BNO A;  3VD7 A;  4UW5 A;  4FOQ A;  5L9V A;  4LOT A;  2MNG A;  3RFR A;  4NHK A;  5JI7 A;  1UY4 A;  4IV3 A;  2G9F A;  2WQZ C;  3IDB B;  2ZEY A;  4DXZ A;  2YRO A;  3AYA A;  2PA7 A;  2W52 A;  4FTS A;  2GNB A;  5IWF A;  3P6B A;  4OHW A;  5BYN A;  2IXK A;  2JX9 A;  3R6S A;  4Q0P A;  2B9V A;  2ZGK A;  2WQ4 A;  1HB3 A;  1P8J A;  1ODN A;  3SIS A;  1DQ5 A;  3WF1 A;  5LCW L;  4R9C A;  1YQC A;  3CIH A;  5FZD A;  1XYP A;  2WZR 2;  3D0S A;  1H2N A;  2WII B;  4IE6 A;  3IZO A;  4M4P A;  4TWT A;  4CCD A;  1PMI A;  4Y22 B;  3ZYP A;  1OQ1 A;  1LHU A;  2ZAC A;  3WF2 A;  3S57 A;  4AVB A;  5CIR A;  1TQ5 A;  4MYE A;  4QGL A;  2ORX A;  5FKC A;  3AMP A;  3GZT B;  1O3R A;  3LPG A;  5FZO B;  1QWR A;  4F3J A;  1RHI 1;  2DBN A;  3HQR A;  3T1L A;  2BBV A;  2C24 A;  1QJY 3;  1FYU A;  2VTX J;  1OT5 A;  3MGU A;  1YIP A;  4AHX A;  4JRA A;  4OQ9 A;  4RSU A;  4XBQ A;  5FAX A;  2DU0 A;  5A1A A;  5KHI A;  4FPG A;  3TEY A;  4JDN A;  1DHK B;  1MEC 1;  1K3I A;  3V0A B;  1SFN A;  3KZ4 C;  3ZXL A;  1OQD A;  2JD9 A;  1H1M A;  3VBS B;  5FZI A;  3ZFE B;  4QHB A;  1HIX A;  3WNX A;  4H14 A;  1RYY A;  1GP4 A;  2GC3 A;  1S0E A;  3W58 A;  4M01 A;  2VCC A;  1RUI 1;  1SLI A;  4Z92 B;  4GWJ A;  1KIT A;  1GV9 A;  3BYW A;  4P00 B;  4GKX A;  5C3Q A;  4HLT A;  1QJX 2;  4PIZ A;  1OLM E;  4W6W A;  1KFX L;  2LTN A;  2W08 A;  2R04 3;  2WLQ A;  3FWE A;  4HKO A;  3LD8 A;  3ZYI B;  4FT8 A;  4P14 A;  2Y6J A;  1FNZ A;  4QX1 A;  4DZG A;  1N47 A;  3POG A;  5DG2 A;  1LU2 A;  3Q8C A;  2D5F A;  5CKN A;  3H8R A;  1UAI A;  1AR7 2;  4Q4X 2;  1ZA7 A;  2V09 A;  3AFK A;  1E5I A;  3E5X A;  3KQR A;  2GAL A;  5LA0 A;  4BQW A;  5IVJ A;  1VAL A;  1X7N A;  2JE9 A;  4UYB A;  4AL9 A;  3ACI A;  5EPA A;  3THD A;  1QGL A;  4FQZ A;  4M4R A;  1QF3 A;  1EY2 A;  4KMQ A;  1K5J A;  2ENR A;  2WYS A;  1N1S A;  3NRU A;  1W8N A;  1NCR B;  3C7O A;  4XF0 A;  1W2N A;  3MEP A;  4IEV A;  3DXT A;  4G3Y C;  2HJI A;  4IV1 C;  1RUO A;  2Y8K A;  4Q4W 3;  3JCI A;  3H1M A;  1ASJ 1;  3VZM A;  1S2E A;  1JXN A;  2BTV C;  3ES4 A;  4ZHN A;  5LW9 A;  3GCW A;  4TZD A;  2Y0O A;  3POI A;  2X5I B;  1YEW A;  2JD4 A;  1DP0 A;  2P3J A;  4AEK A;  4AVT A;  4L99 A;  2VR4 A;  3TYJ A;  2D5H A;  3VKM A;  3MV1 1;  5F5A A;  3O1M A;  1HJG A;  4BU2 A;  2VZO A;  4NAO A;  1O3S A;  2YV8 A;  3OY8 B;  1RXF A;  1QOO A;  2CAV A;  2BJS A;  1AR9 3;  2DYC A;  4CCK A;  2Q1Z B;  1QQP 3;  4EN9 B;  2WNU B;  3WHT A;  1BZW A;  5E88 A;  4D6Q A;  4N9I A;  5FTT C;  2ZGU A;  3S6P A;  1U5Y A;  3HIF A;  4P02 B;  1G7Y A;  1PO2 3;  5A3M A;  1PVC 2;  4O9E A;  2JG8 C;  1N1V A;  2PAM A;  3RRD A;  2DTW A;  1DQ1 A;  5HBA A;  5KXD A;  1IG3 A;  3VLB B;  4WM7 B;  5FZK A;  3ZDS A;  4COU A;  5EYY A;  3AVR A;  3OBR A;  3LCP A;  1OVS A;  2EXH A;  4BJ0 A;  4K20 A;  4CCO A;  3HVD A;  4HPK B;  3TB0 A;  4XFG A;  4CXW A;  4BK5 A;  4KWL A;  3WP4 A;  4E8C A;  4BH9 A;  3E5Q A;  4RGA A;  3OBZ A;  5IT6 A;  3UKT A;  2VMD A;  4BE3 A;  4JQR A;  3LB9 A;  2VXR A;  1HXS 2;  1JUH A;  4FPJ A;  4CDQ A;  5EJZ B;  5JMO A;  4URT A;  1ONA A;  3VBU A;  3LE0 A;  3LKJ A;  3PUH A;  3H1Y A;  2Q8D A;  1NCQ A;  1K5M A;  2Z2S B;  4JRL A;  5C8C B;  3GJA A;  5HXM A;  5FYV A;  1AJK A;  2WO3 A;  4Y5Z 0;  5FJH A;  5IVB A;  2HWF 3;  2VXJ A;  3B5L B;  3TNQ A;  5DAV A;  1CIY A;  1GWK A;  1Y43 B;  3MW4 A;  3UGH A;  3WP5 A;  3A0K A;  3KLS A;  2Z79 A;  4NN0 A;  1CAX B;  1DYP A;  4A45 A;  3I59 B;  5C8W A;  1S1A A;  1UY0 A;  1ULE A;  2QQL A;  2DFB A;  2XB6 C;  1QXJ A;  1YFU A;  3AP5 A;  1REF A;  5FP8 A;  4IDZ A;  1RUG 3;  5CZK A;  1NA1 A;  1Y3T A;  1ZRD A;  5BY5 A;  2IZW A;  1LJ7 A;  4LBQ B;  3AVS A;  1AR8 3;  4UFI A;  4OI1 A;  1COV 2;  3OPW A;  2JDK A;  4IW3 A;  3LDK A;  1W6N B;  1F8V A;  2FMY A;  5FZ6 A;  1C4R A;  2Q1F A;  4D6R A;  3ORJ A;  1HB4 A;  1VBB 1;  2Q4S A;  4XCB A;  4PDW B;  3IPV B;  1W0O A;  1IG0 A;  2VE1 A;  2VVF A;  5EIY B;  1F5J A;  5A70 A;  1NZC A;  5IVY A;  1C28 A;  4XIK A;  1KJR A;  2DTY A;  1VBC 1;  4UXA A;  1ZZB A;  1WLT A;  4OHY A;  1BCX A;  1SFY A;  2VD7 A;  2RVA A;  1BVV A;  1IHM A;  1UMI A;  3CEW A;  4N43 A;  1RMU 3;  1ZX5 A;  2CL2 A;  2VOT A;  2RV9 A;  3S5A A;  3THP A;  3K77 A;  4CDU B;  4MG2 A;  4DRR A;  3MFC A;  3PUA A;  1W3V A;  4QWN A;  1MS4 A;  1VBD 1;  3D0J A;  2GU9 A;  4R4Z A;  1GYK A;  3EHK A;  4N53 B;  5CU1 A;  4JKK A;  5LA1 A;  4O65 A;  4B1L A;  4BQ4 A;  4MH0 E;  4YZ2 A;  2FDJ A;  4TN7 A;  5T55 A;  5A3U A;  3MIH A;  3O1S A;  4M0N A;  3PIJ A;  1WCD J;  4P9I A;  2BU9 A;  5FPL A;  3WDU A;  3H8U A;  4LIT A;  1UPS A;  4LO6 B;  2PTM A;  3BOW A;  2NZ9 A;  4PI2 A;  1QNW A;  3RPQ A;  2EIB A;  5CFD B;  4A7K A;  1AXY A;  2JDU A;  3WHU A;  3SQO A;  5LEK A;  3VD5 A;  3EB7 A;  3I2F A;  4CDW A;  3MIC A;  3ZFE C;  2WZR 3;  2X8K A;  4Y5S A;  5A6Z A;  3VHN A;  4BWO A;  3PVO A;  2ZZQ A;  1D4M 1;  4O61 A;  2ZX3 A;  3BU0 A;  5FK7 A;  4XJ9 A;  4CCC A;  4GJZ A;  4IXL A;  5FK8 A;  4ARY A;  4AED B;  2VVE A;  3IMN A;  4RR3 C;  1W6M B;  2C0Z A;  1JBC A;  3PVE A;  1FPN 2;  1W03 A;  5FP7 A;  5FQ0 A;  1XRU A;  2QFE A;  5LAS A;  1LGN A;  4MXV A;  3FMG A;  4FPL A;  1W6Q A;  4P9J A;  3ZYB A;  4I3G A;  2WNV A;  4XF1 A;  5T50 A;  3OPT A;  1YQ6 A;  3ASI A;  1H8T A;  5F3G A;  4IEX A;  2QQJ A;  2W95 A;  2OT7 A;  3IKW A;  3O5S A;  1RGS A;  1HRV 2;  3D3A A;  5GM0 A;  4A6S A;  5A1L A;  5DMY A;  2XJS A;  3CJI B;  5AC9 1;  5FOB B;  1APN A;  1RVF 1;  1RUE 1;  2ZGN A;  2ZHK A;  3GM8 A;  1J84 A;  1UZV A;  4GZ9 A;  4CRQ A;  1UY2 A;  1NCR C;  1WMF A;  4CU7 A;  2ZEW A;  3M3I A;  2XVL A;  1G9D A;  2EXJ A;  2G9Z A;  3JD7 1;  3RZJ A;  4NIG A;  5E6H A;  4HVR A;  2P37 A;  3C7H A;  1QJX 3;  4IET A;  2KR2 A;  4CPB A;  2OUJ A;  3I3B A;  3CBN A;  2X5I C;  4LO8 A;  3MW3 A;  2HWB 2;  1CIW A;  1RUJ 1;  1H0B A;  4FPK A;  3LOB A;  4ZS2 A;  4QMA A;  2XDV A;  1MS3 A;  4JVA A;  5A1F A;  4QX7 A;  5T54 A;  1EV1 2;  1AR7 3;  4Q4X 3;  4RL7 A;  5FZE A;  1AJO A;  3JB8 A;  1ZBE 1;  1ULP A;  1UYX A;  4CCJ A;  5JOX A;  1OF3 A;  5A3L A;  3N36 A;  3RMX A;  4QX5 A;  2BPA 2;  3VBO B;  1JHJ A;  2WNU C;  2WN2 A;  1GP5 A;  3HT1 A;  1Y7B A;  4QB2 A;  5DUW A;  1RUH 1;  5GAL A;  2WS9 1;  4QKF A;  3VKL A;  3FLT A;  5B2G B;  1WKY A;  2RR1 1;  1GQH A;  2NLR A;  5DAX A;  1AUY A;  2WAO A;  2JDP A;  1WGP A;  3R4D B;  3CHX A;  4AQ6 A;  2YU1 A;  1AZD A;  4WM7 C;  4WVM B;  1U5I A;  2PEL A;  4J1X A;  1UKG A;  3LEM A;  5EJ1 B;  1OUS A;  2ARC A;  4HMZ A;  1W28 A;  4I30 A;  3AZZ A;  4BIO A;  5I0R A;  4RYD A;  2HLE A;  2OX0 A;  1IZ3 A;  4Q26 A;  4MGI E;  5LBB A;  5K7P A;  3OBA A;  5BNP B;  2KXL A;  4Z8B A;  5C9A B;  3BTZ A;  3EBR A;  3NW4 A;  4L8Q A;  1FNY A;  3M3Q A;  4FPF A;  2W1U A;  1O91 A;  1SEF A;  1KXG A;  3DCQ A;  4RGG A;  3VB9 A;  1QH7 A;  1OSG A;  1RIR A;  4CEY A;  3ILN A;  3Q8A A;  1JUI A;  1QDO A;  2GP5 A;  4K9S A;  1K45 A;  3N7L A;  1S0D A;  4JGZ B;  5FXV A;  1W04 A;  1H6Y A;  4QPG B;  2VVD A;  5BUV A;  1JYT A;  1V6I A;  4DQA A;  1PVC 3;  5BNO C;  3TEW A;  3D6E A;  3BPS A;  3RJR A;  2BVV A;  5FZ3 A;  1PIV 2;  1NQD A;  3POB A;  5AFE A;  1JOJ A;  1J3R A;  4ASM B;  4V1P A;  2YU2 A;  1ZZ7 A;  3ZYG A;  3WF4 A;  3POE A;  4KL1 A;  1MEC 2;  5IK5 A;  2G9G A;  4KBZ A;  5FO9 B;  3BIW E;  2D98 A;  1RTV A;  1XNA A;  5A7P A;  1SPP A;  2XG3 A;  3K3O A;  4GXL A;  1C8M 2;  1AF9 A;  4ZZ8 A;  2PFW A;  3C2U A;  1HXS 3;  2P6C A;  1A8M A;  1HQN A;  1C1L A;  1UX6 A;  2IC1 A;  2VG9 A;  3AMN A;  4I3P A;  2XLA A;  1TNF A;  4OZX A;  2O1Q A;  4PDW C;  3T4H B;  4FPO B;  5FWJ A;  3BUC A;  4NHY A;  5GZC A;  3ENR A;  2WFP A;  3AP4 A;  4JV4 A;  1S0G A;  1L7Q A;  1YO8 A;  2FCU A;  4HAN A;  2WA4 A;  5ERL A;  4AW7 A;  2PN5 A;  3HWJ A;  3J7M A;  4GH4 B;  4LHS A;  1UKR A;  4ZY9 A;  4I0W B;  4OUM A;  4CDU C;  2E53 A;  5LBE A;  3B94 A;  4L92 A;  4FFF A;  4IE7 A;  1N3P A;  3A23 A;  5AFB A;  3UES A;  5A32 A;  3P5B A;  1JYI A;  1KS4 A;  4FP3 A;  4TXW A;  4N53 C;  2ZPX A;  2TUN A;  1NYW A;  1COV 3;  1OXC A;  2YBS A;  5T5L A;  3SKV A;  3U10 A;  3LWC A;  1ULF A;  3W21 A;  2BER A;  3A7Q A;  2CHH A;  4XHB A;  1K12 A;  5A6X A;  3PMS A;  4XQW A;  3I2G A;  4QB6 A;  2I74 A;  1QMJ A;  1J58 A;  5CFD C;  3NNJ A;  4ISR A;  1BVP 1;  2HWC 1;  3OYW A;  3WF3 A;  4UFM A;  4CPB D;  1ASJ 2;  2XKO A;  4LKF A;  1I5P A;  4H7M A;  3WDW A;  5CAZ A;  3L2H A;  2ZGR A;  2IVJ A;  2BNN A;  3APB A;  4CEW B;  3JXS A;  4JZR A;  3AX4 A;  2DVA A;  2QCS B;  3JBG 3;  4BQ1 A;  1ZM1 A;  2R06 1;  2WIN B;  1OH4 A;  5FYC A;  5K0U B;  5FOJ B;  1MVQ A;  5C4W A;  4A4A A;  2WQ8 A;  4QQO A;  5FY4 A;  1A8D A;  2ZEZ A;  5EJ3 A;  5J37 A;  1YHF A;  4XHX A;  1SZB A;  4QD2 A;  1Z7S 1;  1WD4 A;  4XXA A;  4D3W A;  1N1Y A;  3OEB A;  4XJU A;  3ZKU A;  4DY5 A;  3GAL A;  4UBG A;  1JOP A;  1XBF A;  4UF0 B;  3W9A A;  5F2W A;  4UFL A;  2A3W A;  3FFZ A;  3HT2 A;  3HMY A;  4NHL A;  4LK7 A;  1OFS A;  4CSW A;  1D7P M;  1W0P A;  2VC9 A;  1EP0 A;  1UIK A;  3Q8F A;  2C4X A;  4U36 A;  5A33 B;  1X8E A;  3CJI C;  5HCB A;  1NT0 A;  2KD7 A;  3HJR A;  5C8C A;  2Q0A A;  5FY7 A;  1DQ2 A;  1IS5 A;  1OKQ A;  4IGP A;  1GOF A;  2HYX A;  3VKO A;  1OI6 A;  3I2H A;  4UWD A;  1POV 3;  1SQ4 A;  5B4X A;  5EFU A;  1H30 A;  3AC0 A;  4IEU A;  2XLF A;  1C57 A;  4UW4 A;  1ND3 A;  1XE0 A;  3WIN E;  3PLQ A;  3S0M A;  1ULG A;  3HBK A;  2VMC A;  1GZC A;  1MVE A;  4RQP A;  2RS3 1;  1YWK A;  5FP3 A;  4AR2 A;  1JW6 A;  5BV6 A;  3BTX A;  1TNR A;  4NIH A;  1G9C A;  1OPO A;  2IVI B;  5A3T A;  1IPJ A;  5FUP A;  5JR2 A;  1H8V A;  5FRA A;  4PQ9 A;  2ARE A;  2VZS A;  4GMP 3;  3CJX A;  4B7E A;  1EAH 2;  2JDH A;  4MHU A;  3POW A;  3TRS B;  4YGD A;  3MHZ A;  1HRV 3;  3USU B;  3VZK A;  1W3X A;  4GAZ A;  3NV1 A;  4YNI A;  5FJK A;  4UAP A;  3KQ4 B;  4PQQ A;  4E4S A;  5CFC A;  4FI9 A;  5SV8 A;  4X6Q B;  4FOY A;  1MZ6 A;  4M3C B;  3Q8B A;  5H9Q A;  4E2S A;  3PL0 A;  5KXC A;  1VRH 1;  3K46 A;  1ZVF A;  3VBH A;  2QE3 A;  2YG0 A;  4CP9 A;  1MR5 A;  1YNA A;  2J1A A;  3KCY A;  4IEQ A;  3KHB A;  2Y26 A;  1B35 A;  4PLN A;  4GWI A;  2DCJ A;  4Z82 A;  1JZ8 A;  3VDD A;  5E8A A;  2CGP A;  3VV1 A;  1ULD A;  5A3N A;  3TN9 1;  4OYU A;  3T09 A;  5JWP A;  5FYS A;  1VRB A;  2VTF A;  2HWB 3;  1VBC 2;  2G1M A;  2QBX A;  1D2S A;  2RM2 2;  2YDE A;  3FUQ A;  3M1H A;  4P08 A;  4PI0 A;  4S2F A;  3N35 A;  4CDQ C;  2IFW A;  3N7J A;  3PUS A;  3S7E A;  2J1E A;  3VBU C;  5BNP C;  1BXH A;  5C9A C;  5L7O A;  1K5M C;  2PLV 1;  2VZT A;  4LBL A;  4R8H A;  2YYO A;  1EV1 3;  2WWU A;  3MI8 A;  3EMR A;  5C3S A;  2R0F A;  5FZ1 A;  2VW1 A;  3WDT A;  2CDO A;  1S2B A;  2OXB A;  4OI2 A;  4CXY A;  3KHC A;  4XXP A;  4JC1 A;  1VAV A;  1E57 A;  5C33 A;  4JGZ C;  4EZH A;  1CAU A;  3WQB A;  1AL0 G;  2R32 A;  3HOB A;  4QPG C;  5EXO A;  2EIE A;  2J1R A;  3HD8 B;  1W2U A;  3IAQ A;  1W8F A;  2A6X A;  1ZRE A;  1FOD 1;  4ASL A;  3KV6 A;  5I91 A;  4GIQ A;  4QXK A;  2PYT A;  1FXZ A;  4IEP A;  1J59 A;  1D2Q A;  4B4Q A;  1NLS A;  2VBD A;  3A4U A;  5DAP A;  1TVG A;  3U75 A;  4YW1 A;  1DZT A;  1AXK A;  2O8Q A;  1DFQ A;  2FDI A;  1FAY A;  2F4P A;  2MEV 3;  1GP6 A;  4XFH A;  4BPZ A;  3DKQ A;  4DPN A;  4CDX A;  1WBF A;  1HJF A;  2XH6 A;  4PF1 A;  4I2O A;  4CZS A;  3NO8 A;  4XTM A;  1LHV A;  1FX5 A;  4CE8 A;  2WAB A;  4NJ4 A;  1D4M 2;  2D3S A;  1SCS A;  3DXU A;  4XYX A;  4HVQ A;  3FE5 A;  1A3K A;  4QQ2 A;  4IV1 B;  2VUC A;  1V6L A;  1XPW A;  2E51 A;  1MQT A;  2VBP A;  5IFT A;  2XQR A;  5KC5 A;  1SMV A;  2GN7 A;  1OA4 A;  2QQI A;  1W6P B;  4N43 C;  5EP9 A;  5F32 A;  5JAX A;  3CQO A;  5E16 A;  4Q1P A;  4DNY A;  4OUS A;  5FZL A;  2R6Q A;  5FZA A;  2PMW B;  1G9F A;  3URF A;  5J36 A;  1RUN A;  2EF6 A;  5C70 A;  2DV9 A;  1VBE 1;  2ZXQ A;  4GH4 C;  4QDQ A;  2FDG A;  3U11 A;  1GSL A;  1PIV 3;  5DDJ 2;  1NX9 A;  3KM5 A;  2H0V A;  4AWD A;  2CSG A;  4TTG A;  1AYM 2;  2K9Z A;  2E7Q A;  1FT9 A;  2ADD A;  4HXC A;  4FQ4 A;  2B8M A;  4Q4Y 1;  3HNY M;  4QQL A;  4K8R B;  5AC9 2;  1JZ4 A;  4AE2 A;  1L3J A;  1C8M 3;  3KCX A;  3T3Y A;  5KXB A;  1FI2 A;  5L36 A;  4BQX A;  1YI7 A;  3DUI A;  3J9S A;  2ZHL A;  3JD7 2;  1UW8 A;  2UY8 A;  3RQ0 A;  2B46 X;  3R4S A;  4OVE A;  3I3Q A;  1UMH A;  4QQH A;  5T3N A;  5JMC A;  2W47 A;  1WMD A;  4MGT A;  4COY A;  3LQC A;  1KS5 A;  1URX A;  4EYU A;  4GD4 A;  4AFM A;  4FOV A;  2J22 A;  4AQ2 A;  4CEW C;  1GQP A;  1RUF 2;  3N9Q A;  1WWY A;  4XTP A;  1LKN A;  3NNG A;  4MXW B;  1GMM A;  5K0U C;  4RS5 A;  3FLP A;  1ZBE 2;  2W1Q A;  3ZVX A;  2ZKN A;  1LEM A;  2WUH A;  2ZMK A;  3M7A A;  3O1T A;  1X8M A;  4L11 A;  4E2Q A;  3BPZ A;  4JQT A;  5FP9 A;  5CYY A;  1CJP A;  5GZD A;  2NP0 A;  4LBM A;  4MAD A;  2Y34 A;  1RUH 2;  3AFG A;  3RS6 A;  3UK9 A;  1US3 A;  1HRI 2;  2JEM A;  2WS9 2;  4HL0 A;  4KNC A;  3ZFF A;  4DEQ A;  4A7Z A;  2RR1 2;  3NKG A;  4TLF A;  3I7D A;  1YJL A;  2ETE A;  3ABZ A;  1IQA A;  1O5L A;  4FXK B;  4YZ4 A;  1ASJ 3;  1MZE A;  2QQK A;  1KFU L;  3H7J A;  2BYV E;  3BTA A;  4XIL A;  4QPI A;  4XIO A;  4DUV A;  2ET7 A;  1VAM A;  2WFF 1;  2ORZ A;  1GNZ A;  3GJB A;  5TSW A;  4P5H A;  4CXX A;  1S0C A;  2GNT A;  4DB5 A;  1CPM A;  1I6X A;  5FMD A;  1HV0 A;  3AKQ A;  2A6Y A;  3M70 A;  4WM8 B;  1XNK A;  4XUP A;  2RDR A;  2R1D A;  2YHJ A;  3G7D A;  3I2O A;  4CUA A;  2GH8 A;  2XJT A;  2PHW A;  2DVD A;  4K8F A;  4O7X A;  4EN0 A;  5BNN B;  1LOC A;  1OOP A;  2GMP A;  4DFS A;  4OMD A;  1UYP A;  4KH9 A;  1H6X A;  1KD7 A;  2WAA A;  3DPR A;  2WDB A;  1TZO A;  4LO4 B;  1H4G A;  2I07 B;  1X36 A;  1Q8Q A;  3AYD A;  4IEO A;  3MO4 A;  2V73 A;  4DRV A;  2GZW A;  3THT A;  1G9A A;  4Q29 A;  5IJR A;  3M3O A;  1WD3 A;  2A75 A;  4NHX A;  5A80 A;  2C26 A;  1Q8P A;  3H8O A;  3ZR6 A;  3BCW A;  2UU8 A;  2VZ3 A;  1WZX A;  1TMF 1;  1TME 3;  3ZN4 A;  5CEH A;  1ZRC A;  1A6C A;  1ND2 A;  4QX8 A;  5FYH A;  3ZN6 A;  5KWR A;  4QX0 A;  1JH5 A;  1F9K A;  1PHM A;  3USS A;  4AVS A;  1CAW A;  2WNE A;  3KD4 A;  1YYN A;  1AHS A;  4ET7 A;  3KS7 A;  1H9W A;  2PXJ A;  4IEW A;  5C3O A;  3LZZ A;  5CIS A;  4AI1 A;  2W39 A;  2XOM A;  3ZFG A;  3NNM A;  5A3W A;  2PQS A;  1QOT A;  1SLT A;  1W8H A;  3OUJ A;  3OG2 A;  4HN0 A;  3RWN A;  1AL2 1;  1V9U 2;  2J1U A;  3U4S A;  4HSL A;  2DU1 A;  4C91 A;  4YYO A;  1J1T A;  4IQP A;  4CEY C;  5CBL A;  4P9L A;  5D8A B;  2ZX1 A;  3VN4 A;  5C3R A;  4RR3 B;  3LEK A;  4YW4 A;  2CWS A;  4MGY E;  4AK3 A;  1LEN A;  4QGN A;  5FR3 A;  1ULC A;  1EAH 3;  2B7Y A;  2BVB A;  4OHX A;  1QJU 1;  2GH2 A;  4QHZ A;  4FPY A;  2ZA9 A;  2WSV A;  1AYN 1;  2Q8C A;  1DGW X;  3EQE A;  4LEJ A;  4XJW A;  5FY1 A;  3OGR A;  1WCQ A;  4RHV 1;  3VHR A;  1LB2 A;  2XGX A;  2ZOE B;  5FYZ A;  3QOP A;  2YBP A;  4YGC A;  4EQV A;  4KQ7 A;  5IW0 A;  2VW0 A;  4V2W A;  2HWC 2;  1RUC 2;  3D4K A;  4RFT 0;  1LHO A;  2EXK A;  3O1P A;  4ZXE A;  2FD8 A;  1YXW A;  4WVZ A;  4EN6 B;  2FZ2 A;  2W94 A;  1UZZ A;  2RM2 3;  3SEP A;  5FFO C;  4FTB A;  1XC6 A;  3N7M A;  4LA2 A;  4D7Y A;  1R09 2;  1PX3 A;  4ZKT B;  2ZGT A;  2ZGS A;  2D6N A;  2ZML A;  3ES1 A;  3GBF A;  3HNM A;  4JGY A;  1F4A A;  4MOA A;  4PLO A;  2RJK A;  2XBO 1;  2R06 2;  4J6G A;  5DAW A;  1RUD 2;  2VUA A;  5T5P A;  1TEI A;  1W99 A;  4OUE A;  1ENR A;  1DZQ A;  4Y20 B;  5FMO L;  4XAA A;  1R08 1;  5H9P A;  2VH9 A;  5ABJ A;  1HX6 A;  1Z7S 2;  3KGZ A;  3M3E A;  3FN9 A;  3B02 A;  4QX2 A;  3B3Q E;  4EN7 B;  2D93 A;  1JTZ X;  4GB3 2;  2P6H A;  3MZH A;  1GR3 A;  1W90 A;  2AEY A;  2NYY A;  5CB7 A;  3N3H A;  2VNO A;  2BW8 A;  1UL9 A;  2BNM A;  4FFG A;  2XJQ A;  1UN1 A;  3INA A;  3AL6 A;  4AG4 A;  2Y64 A;  2YFZ A;  4IEZ A;  2XPJ A;  3JUU A;  5JZG A;  1D4M 3;  4QXH A;  2JIJ A;  3BKZ A;  3T08 A;  1JZ7 A;  2J1S A;  2VO5 A;  3ATG A;  1AX2 A;  2BGO A;  3KMH A;  2OPK A;  5DQ0 A;  1DG6 A;  2W92 A;  4QKD A;  4UT5 A;  3MLJ A;  1W39 A;  4LBK A;  5I0U A;  2IXC A;  1LOA A;  3R0R A;  1MZF A;  2GC1 A;  2A6Z A;  2RHP A;  5J7M A;  4AI8 A;  4E4Z A;  1JZ2 A;  2HWE 3;  3C7F A;  1SG3 A;  3RZM A;  4YW3 A;  5DG1 A;  5DDJ 3;  1DGR A;  2JEC A;  4Q4V 1;  3S5Q A;  1CZS A;  3SKJ E;  3H8X A;  3III A;  1BKZ A;  3BIE A;  4YZ1 A;  1AYM 3;  3VBF A;  1XNC A;  2WRA A;  4V2V A;  4YVW B;  1GZW A;  2W0X A;  3UGF A;  1EUT A;  1QOS A;  2QQM A;  2P3Y A;  2D6O X;  5AC9 3;  5I0T A;  5DUU A;  5CAD A;  1JI6 A;  1CAV B;  1QJY 1;  5BNO B;  2P3I A;  4XBN A;  1XNT A;  1PGW 1;  3P3P A;  4BDV B;  1MS0 A;  1VRH 2;  4K1Z A;  4QPI B;  1XU1 A;  2CAU A;  3JD7 3;  1OHF A;  3OSD A;  4I09 A;  4IV3 B;  5FZM A;  4QM9 A;  5JIU A;  2JG9 A;  2OUH A;  1SAC A;  3EO6 A;  3E1F 1;  5CVR A;  3TN9 2;  5JPN B;  3B7M A;  1GIC A;  3K51 A;  5FKB A;  4N7U A;  3VDC A;  5JSR A;  4IES A;  4MGS A;  1PMJ X;  2BV4 A;  1ND3 C;  1RUF 3;  4M00 A;  5T5J A;  1AR6 2;  1ZRF A;  2PLV 2;  5JUV A;  4WM8 C;  4LQR A;  5F5Q A;  1I1E A;  3LIH A;  4QKB A;  1ZBE 3;  5DZG A;  1GAN A;  3IM0 A;  1FMD 1;  1PK6 A;  4QX3 A;  5BNN C;  5FZB A;  2XVK A;  4IEY A;  3SH4 A;  1SHW B;  1XYO A;  5KHJ A;  3VGI A;  1RUH 3;  2VOK A;  2R04 1;  2Z4F A;  1HRI 3;  1GOG A;  5FPV A;  4QDR A;  3MIE A;  2WZ8 A;  1V6N A;  3TEX A;  3WVJ A;  4QPW A;  1YC6 1;  4M0H A;  3DL3 A;  5CFC C;  1R1A 1;  1OMI A;  1S0F A;  1XE8 A;  3J8F 2;  4PCR A;  4FPE A;  1Q8O A;  2WT0 A;  5A3O A;  4CCN A;  5LY2 A;  2AC1 A;  3NWK A;  4CTE A;  1W06 A;  5JDB A;  3H1W A;  3VBR A;  1B35 C;  1TG7 A;  3JB4 C;  4LMF A;  1XJA A;  5FWE A;  3Q9O A;  1X9T A;  1YLL A;  1WW4 A;  3VDD C;  3AZW A;  2PHF A;  4HBN A;  3HN3 A;  3RZK A;  1UQX A;  3UJQ A;  5F5C A;  5F8P A;  5T52 A;  3ITQ A;  3KGL A;  2VTX A;  4Q4W 1;  1LU1 A;  5F3C A;  1IKQ A;  3SEE A;  2IXH A;  3SNM A;  4LO5 B;  4UFH A;  3ZKY A;  4CCL A;  2YXS A;  1LTE A;  1A34 A;  2ZGL A;  1WLD A;  2BFU L;  3AP7 A;  2HBT A;  2PHT A;  3F95 A;  2CNA A;  1I3H A;  3AKR A;  5D8A C;  1S55 A;  3H3L A;  5L73 A;  1H2M A;  1VBE 2;  4XQ4 A;  1CD3 G;  1V6M A;  1GNH A;  3I3E A;  3ZXG A;  4OLL A;  4LJH A;  2DFC A;  3V0B A;  4N90 A;  3TEZ A;  4YPJ A;  1OD3 A;  5F39 A;  1AR9 1;  3WW4 A;  2XXZ A;  4Q4Y 2;  5FY0 A;  2YBK A;  3RZH A;  3GF6 A;  3FC0 A;  1ODM A;  1BK1 A;  2EIC A;  3ILF A;  4NAM A;  2C1F A;  4PJY A;  2WBK A;  1V6J A;  2W9X A;  3ZSE A;  5LBF A;  2OS2 A;  3CDZ B;  5JCT A;  3CU7 A;  3WLU A;  1NAE A;  4TYS A;  4XOG A;  5FLJ A;  4KWU A;  1PO2 1;  1HQW A;  4CDX C;  1OC1 A;  2RS1 1;  3T0A A;  2P4E A;  5F6L B;  3ZXA C;  4BIS A;  5FMC A;  2D7F A;  2N7G A;  2R49 A;  1PX4 A;  4XEZ A;  1W8U A;  1UXX X;  1V9U 3;  3NV2 A;  3WUC A;  4Y1Y A;  1NY7 1;  3IDE A;  1QJZ A;  3DEC A;  4XQD A;  4ZU5 A;  5LZ6 A;  1ENX A;  2R0H A;  5ANQ A;  5HCF A;  1OKO A;  4EWA A;  2VBB A;  2Z42 A;  4EWD A;  1ZA4 A;  1OPM A;  3U4X A;  3IT8 A;  1GQG A;  2B4K A;  4MHR A;  2NPI A;  3ETP A;  4C1W A;  3GYD A;  3F2Z A;  3NAP A;  3NJX A;  5JOZ A;  4AI9 A;  1IPK A;  3FZ3 A;  4Z2A A;  1Y9M A;  2XJP A;  4LIU A;  4D7T A;  4QQP A;  3QBQ A;  2HWF 1;  5IK7 A;  3H50 A;  4DMI A;  2GAU A;  1RJ8 A;  4R9A A;  2PQQ A;  1OLQ A;  2AH2 A;  2ZAH A;  4HK8 A;  4XFI A;  1UOG A;  3WG3 A;  1LAJ A;  1RUC 3;  2R07 2;  3FUO A;  4LHN A;  4R9B A;  4B4P A;  1H1A A;  2DVB A;  4DS0 A;  3O7O A;  2WFF 2;  1RUG 1;  1LES A;  2A70 A;  2WT2 A;  2ZJC A;  1VMF A;  4JCK A;  3I3M A;  1R09 3;  3SXW A;  1AR8 1;  3K48 A;  2HEY F;  2VCM A;  1ZBA 1;  2YZ4 A;  4O9G A;  4S2H A;  4YVS A;  2JWP A;  3HN1 A;  4YFW A;  2VMH A;  3RYK A;  3T4V A;  4CP0 A;  1WW7 A;  2G19 A;  1GUI A;  1HV1 A;  4W8J A;  2DDU A;  4DEV A;  3GHM A;  4AI2 A;  4AI0 A;  1O3Q A;  1RUD 3;  2ZBJ A;  4ES8 A;  1WCS A;  2WO7 A;  4EJR A;  4Q27 A;  5FO7 B;  4NUB A;  1CQ9 A;  4CDQ B;  5FBJ A;  4GUL A;  4S2G A;  1Z7S 3;  3VBU B;  1OA3 A;  3VDB A;  3WQ1 A;  1NCQ B;  1GLH A;  1K5M B;  3OGG A;  1OFN A;  2O0O A;  3RMY A;  1SBE A;  4QPY A;  3WNM A;  4OFG A;  2GC2 A;  1RMU 1;  4GB3 3;  5KR7 A;  2WNO A;  4YVW C;  1YI9 A;  2J7M A;  4YW6 A;  1QXR A;  3ZFF C;  4SBV A;  1RHI 2;  5IK4 A;  3W5M A;  3H3Z A;  1JZ3 A;  3MW2 A;  4G9S B;  3O1R A;  2C9A A;  2QQN A;  1BBT 1;  1BHG A;  1UF2 C;  2ET1 A;  3LFI A;  4K6B A;  5E89 A;  5JXG A;  1C8N A;  2R1B A;  1GKB A;  1NA1 B;  1O8P A;  3M8L A;  4QPI C;  5D2A A;  1BMV 1;  4IV3 C;  1F2N A;  1POV 0;  5D21 A;  2E6V A;  3B00 A;  4FVV A;  1PM7 A;  1U0A A;  4L0P A;  1XU2 A;  5GZE A;  5A6Y A;  1PM4 A;  1W9W A;  2NMN A;  5A3P A;  2P34 A;  4XFA A;  1NKG A;  1RB8 G;  4MUV A;  1DGW A;  2W1S A;  3BOP A;  2YC4 A;  2OQ7 A;  5E1R A;  3WUD A;  3UNP A;  2ARA A;  2EAA A;  2LUW A;  2WZR 1;  4BYY A;  2DVG A;  4FPH A;  1ST8 A;  1E5R A;  1RUI 2;  5FYT A;  1OA2 A;  3OB8 A;  2WZP P;  3E5U A;  2V5Y A;  3ZDV A;  2XL9 A;  4ZU7 A;  4N43 B;  1NXM A;  2BP6 A;  2EIG A;  2OZJ A;  2RMU 1;  1W9F A;  1AYN 2;  3N9N A;  3O12 A;  4NIA A;  4FOW A;  1Y4W A;  4OMC A;  2D44 A;  2MPF A;  5JPM B;  3HR9 A;  1S0I A;  3ZIW A;  4RHV 2;  4UBH A;  3W20 A;  1VRH 3;  2EA7 A;  3KV5 A;  1OBN A;  2D3P A;  1DQ4 A;  4W65 A;  2RDQ A;  3PUI A;  4BME A;  4URA A;  2JKB A;  4P9X A;  4AVA A;  2ZTN A;  5LBC A;  2ADE A;  3VBR B;  3FX3 A;  2VL4 A;  4LLF A;  3WY6 A;  3TN9 3;  2DVF A;  5FYY A;  3FBY A;  4CU8 A;  3DV8 A;  1AXZ A;  1AR6 3;  3PIG A;  2Y6L A;  4W4Z A;  2Z69 A;  3ZPY A;  5FXZ A;  2PLV 3;  4E27 A;  2BGC A;  5A7W A;  5LRR A;  1XOY A;  1BLZ A;  5FV3 A;  3ZFG C;  3WEZ A;  1W8O A;  1YRZ A;  4CDW B;  2ZGM A;  2JDA A;  2A6V A;  2XBO 2;  3IN9 A;  2VMI A;  3AZY A;  3WQ7 A;  2FMD A;  5JOW A;  1GWM A;  3OGV A;  4XFB A;  1C1F A;  1QJX 1;  4XJZ A;  5B4N A;  2GP3 A;  2XKP A;  2A3X A;  4Y24 A;  1IS6 A;  1R08 2;  4ZON A;  2JDM A;  3IB3 A;  1UX7 A;  2C5D A;  2HH9 A;  2XJU A;  4XDQ A;  1LOF A;  5FQ0 B;  5I8T A;  1JYW A;  4BQ3 A;  4NPL A;  2CDP A;  2VME A;  4X8P A;  3VL8 A;  3HEI A;  3DKW A;  3RDI A;  1W6Q B;  1G9B A;  3J8F 3;  2DUR A;  3MF9 A;  1UY3 A;  2WNV B;  4ORF A;  4RN5 A;  4Q4X 1;  3T0B A;  1W8Z A;  1CX4 A;  1XB9 A;  1H8T B;  3N9O A;  2JG8 A;  4HKL A;  4NMI A;  3B01 A;  4G4F A;  4C1X A;  5F3E A;  1XYN A;  3NV3 A;  4AHZ A;  2D6P A;  1T6G C;  3ZMO A;  3FHA A;  4LBN A;  3FLR A;  4AI3 A;  4BLI A;  3J7H A;  5DZF A;  2RDN A;  3KWV A;  3MDP A;  3WG1 A;  2C6S A;  4ZPI A;  3N9P A;  5IUQ A;  2X53 S;  1RC6 A;  2W87 A;  2SBA A;  5KC6 A;  4LKS A;  4R4X A;  4UW3 A;  1UOJ A;  4JGY C;  3QH6 A;  1YFY A;  2CGN A;  3PVN A;  4YFZ A;  5IVV A;  1JYV A;  1W6O A;  3WDV A;  5I0S A;  5F3I A;  3WDY A;  3FL7 A;  3GBW A;  5CG8 A;  1ZRR A;  3LDB A;  4Q4V 2;  1FPN 3;  2O14 A;  3AJZ A;  4FCA A;  3BN6 A;  1YFX A;  5HV0 A;  3PJY A;  3QH7 A;  1Q5O A;  1X33 A;  2B42 B;  2FZ1 A;  4SLI A;  1YFW A;  2EAL A;  4H2A A;  1ULO A;  4Q8K A;  5G05 L;  2JIG A;  3KF5 A;  4NRP A;  4EWE A;  5A7O A;  2IFR A;  3FJS A;  3VZJ A;  3ZXD A;  4XF4 A;  3T2T A;  4GJY A;  1WW6 A;  2IWG B;  1VB4 A;  4XMA A;  2CU5 A;  1QKQ A;  2XHN A;  5CKQ A;  1PVC 1;  2D3R A;  3BVC A;  3CMG A;  3I2J A;  3ZO0 B;  2YMZ A;  1YCI A;  4D69 A;  3FHQ A;  4AFD A;  2YY1 A;  4K3U A;  2WSU A;  3VZO A;  1RED A;  3B9C A;  3WXP A;  1IOA A;  4AFB A;  3GXU A;  4Y1U A;  5J1X A;  1PNF A;  2R7E B;  2VUL A;  2DUQ A;  2H0B A;  4AZZ A;  1VBB 2;  3ELN A;  5F1R A;  3V64 A;  4LR4 A;  5FLH A;  4COZ A;  4K40 A;  2LAL A;  3B93 A;  1A78 A;  3ZSJ A;  4CVU A;  3W5N A;  2UUR A;  4GWM A;  2HKX A;  2CYF A;  1E5S A;  1FMD 2;  1LHN A;  2QQW A;  4Y22 A;  4C8D A;  4YAR A;  4FTE A;  1Y9G A;  1YQ5 A;  3CF6 E;  3AYE A;  4XUT A;  5JR7 B;  4D6S A;  1Z78 A;  1UU6 A;  3K4Z A;  2OPW A;  2TNF A;  4CEY B;  2R04 2;  3VBF C;  1NCQ C;  3J7L A;  3DYM A;  2ZEX A;  1FV2 A;  5FZO A;  1LEC A;  1IPS A;  3VUO A;  3KT7 A;  2RS5 1;  3ZYF A;  3I49 A;  1R1A 2;  2R07 3;  1VBD 2;  3AL5 A;  4PHZ A;  5A7S A;  1LED A;  4R9D A;  1PNG A;  2WFF 3;  3H3U A;  3KT1 A;  4JKM A;  5GZF A;  4N9H A;  1HLC A;  5FUN A;  2DUP A;  3RZZ A;  3ZPO A;  1YJK A;  5I0D A;  1Q3E A;  3N4M A;  2BUK A;  1NA1 C;  1W8T A;  1XSR A;  3V0A A;  5A6Q A;  2VZV A;  4YG0 A;  1UD1 A;  3VBS A;  4CUB A;  3ZFE A;  1SPP B;  4HKW A;  5FMB A;  1U12 A;  1MS5 A;  3DYP A;  4NWW A;  4I02 A;  1DDL A;  2OQ6 A;  5SV5 A;  1DCS A;  1WUV A;  4XET A;  4Q1R A;  5F2S A;  3AXE A;  4D7S A;  1S2K A;  4LBQ D;  4H7L A;  1PK6 C;  3CO2 A;  3KB5 A;  4W6X A;  3EJK A;  1JMU B;  3NJY A;  3ZLI A;  2XVG A;  3RI8 A;  4XW3 A;  4DXT A;  3JBG 1;  1H9P A;  2ZZJ A;  3ME2 A;  1RHI 3;  2X09 A;  1JOB A;  1AR9 2;  5DAB A;  2AEN A;  1LR5 A;  1X82 A;  1UY1 A;  4QM8 A;  4E9K A;  1N3O A;  3IIA A;  1QNY A;  2GSY A;  3VZN A;  3MLL A;  5IVE A;  4I0B A;  4D94 A;  4COW A;  1WLW A;  1BEV 1;  4MLO A;  4FXG B;  4MX3 A;  4YGE A;  1VMH A;  1I9R A;  3RNS A;  5A32 B;  4YWA A;  4DXS A;  3I97 A;  5FY8 A;  5A7N A;  4AAX A;  4OZO A;  4LOR A;  1XND A;  2VUD A;  2WLP A;  3B9I A;  4WV8 A;  2F17 A;  1G8W A;  3DN7 A;  3QLQ A;  1OLR A;  1MEC 3;  2RS1 2;  4ZZ5 A;  2ZMN A;  1CZT A;  4LOS A;  3VBR C;  2VZ1 A;  3UL2 A;  3FHI B;  4BCU A;  4XUN A;  5C6C A;  2D6L X;  4UOJ A;  3ZYR A;  2DCZ A;  1NCR A;  3D82 A;  1RVF 2;  1RUE 2;  2CGO A;  2VQU A;  5HCA A;  4ONU A;  5LB6 A;  1G86 A;  2E7A A;  3OYW B;  2JIC A;  2FQP A;  1RUI 3;  1T6B X;  5CA6 A;  3VZL A;  4CDW C;  1QXP A;  5FZG A;  5FZ0 A;  5BPX A;  2X5I A;  2UY9 A;  1POV 1;  2QVS B;  5J3U A;  4GQ7 A;  4E8D A;  3KT4 A;  5IVC A;  2BEO A;  5G04 L;  5C3P A;  4BHP A;  1AYN 3;  3AP9 A;  4GWN A;  2VY0 A;  1F5F A;  3I4I A;  3RG0 A;  2VOV A;  3OEA A;  1RUJ 2;  3OBT A;  3OY8 A;  4RFR B;  4JHT A;  1O7F A;  3WNO A;  2HWF 2;  4Q0S A;  4JTO A;  5C4W B;  1L7L A;  2VNV A;  2ERF A;  4HSJ A;  3WR0 A;  4JHZ A;  2Z5W A;  3T2P A;  2WNU A;  2WNV C;  3HQU A;  1QHD A;  4X8N A;  2FCT A;  4GMP 1;  5F37 A;  2AEZ A;  1KDM A;  2JDY A;  3P3N A;  3PUR A;  1HRV 1;  1H8T C;  1SLC A;  1DGR N;  4XF3 A;  3WQ0 A;  1UZ0 A;  1D0H A;  1B09 A;  4WM7 A;  1Q43 A;  1AR8 2;  2E63 A;  4Y4R A;  1H4H A;  1ZBA 2;  3RJ2 X;  1UYZ A;  4UI9 L;  3ST7 A;  4D0Q A;  1VBA 1;  3CZU A;  2XBO 3;  4AFC A;  2QQU A;  4PF5 A;  1F15 A;  3AP6 A;  3IDC B;  4HPK A;  2XUE A;  4LUL A;  4TLG A;  5FPA A;  3WCS A;  3I2I A;  5FXW A;  1RIT A;  3AYC A;  2BBA A;  4BA6 A;  4CYD A;  1J1L A;  1R08 3;  1XQN A;  4DO0 A;  3HAG A;  1ND3 B;  5JOY A;  4GA9 A;  1WBL A;  1BK0 A;  3WW3 A;  3A0N A;  2BWA A;  2ILM A;  2WL1 A;  1JN2 P;  5GLT A;  3RI9 A;  4RQP B;  4B3N A;  2XHK A;  4BM8 A;  1F31 A;  3OUI A;  4XAB A;  4Y3O A;  1PO1 1;  1JZ6 A;  2ZHN A;  1MS8 A;  2J1T A;  2YC0 A;  1H2K A;  1CAX A;  2A73 B;  1BQP A;  3BU7 A;  3WSO A;  4YSF A;  3I59 A;  4XAC A;  5FDB A;  3MUY 1;  4MO3 M;  2ZX0 A;  1BBT 2;  3O0W A;  4QXB A;  5I93 A;  3T1M A;  1O4Z A;  4XUR A;  1KQR A;  1OQE A;  5FPZ A;  4F83 A;  5CFC B;  2BZD A;  4ES9 A;  1BMV 2;  4LBQ A;  5L9R A;  1IS3 A;  1W9S A;  1WA4 A;  3NV4 A;  4XUQ A;  1W6N A;  2QQO A;  3OD4 A;  2HWD 1;  3BI3 A;  4KBB A;  2P17 A;  1SCR A;  5KHG A;  4YVS C;  1J3Q A;  3J26 N;  3VBH B;  4GKY A;  3MLK A;  3U07 A;  1LUL A;  4CP9 B;  4PDW A;  3IPV A;  2MEV 1;  2E32 A;  3KV9 A;  1B35 B;  1C5H A;  4PIY A;  1QEX A;  3GNE A;  3ACH A;  3PHM A;  2BFU S;  5FBZ A;  2Q8E A;  3VDD B;  3ZOI A;  1S4C A;  1VR3 A;  4ARX A;  3HQX A;  2Q30 A;  4Q4V 3;  1NZI A;  3CL1 A;  5FCC A;  2V5D A;  1WA6 X;  4KGG A;  1OUR A;  5EZW A;  5L7O B;  2I45 A;  1JS9 A;  2B39 A;  1J83 A;  2QJV A;  4AOC A;  2SLI A;  3OOX A;  2RMU 2;  1DZR A;  4RGK A;  1N1T A;  2ZKL A;  1ZNP A;  4IL7 A;  5K4L A;  4CDU A;  4JDO A;  2IXL A;  5ISL A;  2VZR A;  3MIG A;  1GNY A;  5FP4 A;  2D40 A;  3TBD A;  1CAU B;  2FBE A;  3KF3 A;  3N7K A;  4IE0 A;  4N53 A;  3WD5 A;  1PIV 1;  4K1Y A;  4IGO A;  1C5I A;  1O59 A;  1V70 A;  1UO9 A;  4HT1 T;  1ACC A;  3S7I A;  4NE9 A;  3ILR A;  2WKK A;  1JOD A;  4N7I A;  2VQ0 A;  2HEW F;  3IMM A;  5CFD A;  4UFK A;  1VBB 3;  5FPX A;  1U5X A;  2I2S A;  2KM2 A;  1HN0 A;  2TEP A;  1C8M 1;  3ECQ A;  2NQY A;  3NJZ A;  3X29 B;  3JU9 A;  4CDX B;  1H2L A;  1VIW B;  2EXI A;  5CNA A;  3PNA A;  3FFQ A;  3L9J T;  1O3T A;  3NNF A;  4IND A;  3PUQ A;  1FMD 3;  2FCV A;  2A71 A;  3KCC A;  4Q8L A;  1VBC 3;  4B8E A;  5LAT A;  4IUG A;  2ZX4 A;  2FDH A;  5EWS A;  4AED A;  4HFS A;  5FPB A;  1XXN A;  4DUX A;  1W6M A;  4QKN A;  3O14 A;  4B4R A;  1GZT A;  5ACA 1;  3GGL A;  1MQT B;  2ID4 A;  3BAL A;  4J25 A;  5FYU A;  4KU7 A;  5JXJ A;  1E5H A;  1HN1 A;  1R1A 3;  1VBD 3;  3LEI A;  3OTF A;  4WVW A;  5AVP A;  2D6M A;  2QQP A;  3MPB A;  2NMO A; 
#chains in the Genus database with same CATH homology
 4Y4R A;  5A7Q A;  4QXC A;  2XDV A;  5FZI A;  3U78 A;  3PTR B;  4QX7 A;  5FP8 A;  4LIV A;  5A1F A;  4C8D A;  5F5I A;  5FZE A;  4D6S A;  5FZF A;  3KV5 A;  4BIS A;  3AVS A;  2XUE A;  3OPW A;  4CCJ A;  5A80 A;  5FPA A;  5FZ6 A;  4DIQ A;  4URA A;  2WWJ A;  5FXW A;  4D6R A;  5CEH A;  5FZO A;  5FYC A;  4DO0 A;  3DXU A;  4QX8 A;  5FYH A;  4XDO A;  5ANQ A;  4V2V A;  3AL5 A;  5FY5 A;  5FYY A;  5A7S A;  3LD8 A;  5FY4 A;  5IVY A;  5FZC A;  2YU1 A;  5FXZ A;  5FUN A;  4Y3O A;  3ZPO A;  5F32 A;  5A7W A;  3KV4 A;  4AI9 A;  2PXJ A;  5FV3 A;  2VD7 A;  4ASK A;  5FPU A;  4UF0 B;  4LIU A;  5F2W A;  5FZL A;  5FZA A;  5IVJ A;  4CSW A;  5A3W A;  5FZM A;  4QXB A;  2OX0 A;  3N9L A;  3U4S A;  2GP3 A;  3PUA A;  4QWN A;  5LWB A;  3N9M A;  5FXX A;  5FY7 A;  2OQ6 A;  4IGP A;  4LXL A;  5FYB A;  3DXT A;  4TN7 A;  3PU8 A;  5F2S A;  2GP5 A;  5IVF A;  2XML A;  4XDP A;  2P5B A;  5FPL A;  5FY9 A;  5FXV A;  4CCM A;  5LY1 A;  3KV9 A;  4HON A;  4LIT A;  2Q8C A;  3NJY A;  3ZLI A;  5FZ4 A;  5LW9 A;  4QU1 A;  3N9O A;  2Q8E A;  4IGQ A;  5FY1 A;  5FP3 A;  2W2I A;  5FZB A;  5F3E A;  5FZ3 A;  5A3T A;  5FUP A;  5F5A A;  5FYZ A;  5IVE A;  2YBP A;  2YU2 A;  3KVB A;  4BU2 A;  4UF0 A;  5IW0 A;  5FPV A;  4V2W A;  4NUB A;  4EYU A;  4GD4 A;  3PU3 A;  3N9P A;  5FBJ A;  4CCK A;  5FY8 A;  5A7N A;  4GJZ A;  3N9Q A;  5K4L A;  5A7P A;  5ISL A;  3K3O A;  4GAZ A;  5FJK A;  5FP4 A;  5FZ7 A;  5FZH A;  5IWF A;  5FP7 A;  3UYJ A;  4D6Q A;  5IVV A;  3RVH A;  4CCN A;  5LY2 A;  5KR7 A;  5F3I A;  4IGO A;  5FWJ A;  3K2O A;  3K3N A;  3LDB A;  5FP9 A;  5FYI A;  5FYM A;  5FWE A;  4BXF A;  5FZK A;  5FZD A;  3OPT A;  3AVR A;  5FZG A;  5F3G A;  5F5C A;  5FZ0 A;  5A3N A;  2OT7 A;  4CCO A;  5FZ8 A;  5A7O A;  5FYS A;  4EZ4 A;  1VRB A;  4CCL A;  5F3C A;  5IVC A;  5FZ9 A;  4GJY A;  5A1L A;  3PUS A;  5A3P A;  2OS2 A;  5FZO B;  3PUQ A;  2YPD A;  4CUG A;  2WWU A;  5FZ1 A;  2OQ7 A;  2Q8D A;  2YBS A;  5FPB A;  3KVA A;  3PDQ A;  3AL6 A;  5FYV A;  5FJH A;  5FYT A;  4EZH A;  5IVB A;  5E6H A;  5F37 A;  4QXH A;  5FYU A;  5A7W B;  4AAP A;  2XXZ A;  4E4H A;  5FY0 A;  2YBK A;  3PUR A;  4HOO A;  4Y33 A;  5F39 A;  3KV6 A;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...