4YWAA

Structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title Structural Insight into Multivalent Galactoside Binding to Pseudomonas aeruginosa Lectin LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4ywaA00
3ZYHA 4CP9B 2LROA 1W8WA 2Q1FA 3ZYFA 4YWAA 4CPBD 1W8UA 1UOJA 1OH3A 4LK7A 3ORJA 2O14A 4YW6A 2VXJA 4LKFA 3ZYBA 4BQ3A 2K46A 1GWMA 1W90A 1WCUA 3F95A 1WZXA 4LK6A 4BQ5A 1GWKA 1HN0A 2WYFA 2JWPA 1W8TA 1WMXA 2KR2A 4CP9A 4A6SA 1V0AA 1GWLA 4LKDA 4YW7A 4LKEA 1L7LA 2C24A 5D21A 4BQ2A 2LRPA 4AL9A 4LJHA 1OKOA 3UT0A 4CPBA 4BQ4A 1W8ZA 1W9FA
chains in the Genus database with same CATH superfamily
3ZYHA 3C7EA 2PN5A 5KXEA 3NV1A 1SLBA 1W8WA 1CIWA 1NY71 4N53B 3ZYJB 1CN1A 3CMGA 4RGGA 3W20A 3WUDA 2O8OA 2F6BA 4QWNA 5GLVA 4CCJA 4CCOA 1W6MB 1YQ2A 1ULCA 5AC91 1AL21 1H8TA 2Y38A 1VBC3 2C1FA 2QQNA 3GZTB 5EWSA 1EUTA 4W8JA 3E1F1 2VVEA 5FMOL 2YHJA 2RS11 4AXOA 3I3EA 1V9U1 2XJRA 4L8QA 4Y20B 2J22A 2GN7A 1KITA 5IVJA 5CA6A 2PAMA 3VKFC 5JSOA 3FBMA 2RE9A 3W5NA 1KDMA 2VUJA 3AVRA 5IVBA 2VL4A 4E9KA 3GZEA 3H42B 4PHZA 3Q9OA 1YQ5A 4F3JA 4OULA 2VW0A 3WNPA 1RUH1 4FOQA 2R071 4FFHA 4LLOA 3WF4A 1JZ8A 1BVVA 1HV0A 2J1EA 1J83A 5J96B 4CDWB 5I0RA 2HWE1 1LECA 1S0DA 5F3EA 1NCQA 1W3VA 2ZA9A 2EXKA 4XJZA 1MZEA 4LIVA 1BZWA 4IEXA 1W9SA 5A33A 5IW0A 1PM7A 3KF5A 2P3JA 1H0BA 1NE4A 3SXWA 2YROA 5ABJB 1QNYA 2ZACA 1W3XA 5FV3A 1X8MA 4D3WA 1VE0A 3DXTA 1S2KA 1SCSA 4IE7A 4XVHA 4AEDC 4GJYA 3NJYA 1CAWB 3RZHA 1ND2A 2VUCA 3ZM8A 4DINB 1AYM1 2GNTA 1RGSA 4RYDA 1AR63 3T0BA 1KJLA 2TEPA 2VR4A 3L9JT 2D44A 4RGKA 3VLBB 1W9FA 3PIGA 3WNLA 3FZ3A 2YC2A 4A45A 2AEZA 2ZGMA 4NHKA 3QACA 5B4XA 5JWPA 1O4TA 2CTVA 2GC3A 2XBO3 3FLRA 1Y9MA 3KM5A 1C4RA 1JOJA 1COV1 2WIIB 1HDKA 4LBNA 4IEOA 1AYN1 1K5MB 2P17A 5FY5A 1FPN2 2ZEZA 3M8LA 5IT6A 2VGDA 2WFF1 2WKKA 1XXNA 1EY2A 3MF9A 1OD5A 3ES4A 4UW4A 2X5IA 3CQOA 4YG0A 3DV8A 2R6QA 5FIXA 1E5IA 1EAH3 1R64A 2VULA 2A3YA 5CU1A 3O14A 2AR6A 5DG1A 3A0NA 4OYUA 4OZXA 3S30A 4A7KA 5IK4A 1OPMA 2X10A 3AP9A 4ARXA 3VZOA 4XBLA 1LHOA 2VMGA 2MPFA 4FO9A 1LHVA 3ZPYA 4I3PA 1LU1A 3I4IA 2JECA 1X36A 1ZRRA 2WINB 3R6SA 5KHKA 1MQTB 4PF5A 1AX1A 1CAVA 3NKGA 5JZGA 1UQXA 1XNAA 5LRSA 5FY8A 2BQPA 1F2NA 1Q3EA 1BVP1 4EWAA 4DRVA 5FZ9A 3GXUA 2X8KA 5BNOC 1JZ7A 4CP9B 1JBCA 3CEWA 2R0HA 5LY2A 3BIEA 2DBNA 3JD73 1QJX3 1ZBA1 4FTBA 5FYBA 3PJYA 4YGDA 4WM8A 5CB7A 3IT8A 4XUPA 3ETQA 2DU1A 5FUIA 1G7YA 1LRHA 2EAKA 2AENA 2GP5A 2XVKA 3D5OA 5I0DA 1MS5A 4LIUA 3OUIA 5E89A 4BK4A 3T1LA 1VJ2A 4O61A 3OY8B 5FZ0A 3UJQA 5HV0A 2HBTA 4Z07A 3FJSA 3GBGA 4N53A 5IAVA 3VDDC 1QMJA 1C28A 5L9RA 4Z2WA 1RC6A 2ID4A 4DXTA 1W6MA 3FHQA 4OMCA 4AL9A 1UAIA 5L73A 4YPJA 1AR62 4Y5SA 2ARXA 5T5LA 1CJPA 2YGMA 2CAUA 1DGRN 2V73A 5FXZA 3VBHB 4FOVA 1O4YA 1WMDA 5FZEA 3WG4A 3MV01 2G1MA 1D0HA 2WQZC 2XL9A 5FZKA 3SC7X 1ACCA 1CZTA 4Y20A 5FK7A 1ODNA 3B9IA 2QQMA 2YBSA 1LHWA 1W39A 4CRQA 1GNZA 4YRDA 3DKWA 4ONUA 1C8M1 1S4CA 3VZJA 2IXIA 1IG3A 2Q8CA 5C8CC 4M3CB 3TAYA 1ENSA 1HJFA 1YIFA 4QXHA 4CDWA 4QX7A 5GLUA 3FUOA 4BDVB 5HCHA 1YQ6A 1OLMA 1EAH2 3VB9A 4JTNA 3MIBA 4A3XA 1DGWA 2P6HA 3NWKA 1JXNA 1CD3G 2JDNA 3J7HA 5ABJA 5FPAA 2G19A 5FZLA 4XACA 2Q8DA 1O6UA 2D6NA 4XF4A 1H8VA 1RL3A 1G9BA 1VAKA 4MXVA 4MG2A 1YNAA 4DS0A 1CAWA 1XNBA 1QJU2 4UFLA 3KSCA 1N3QA 3CO2A 5IAXA 2XLAA 1I1EA 1NZCA 2CU5A 4AI8A 3EO6A 3S57A 4DQAA 3BN6A 1RUI3 1RUJ1 1UYPA 3M3CA 5F39A 2D6KA 1UYYA 4Q4Y1 1AHSA 3WHTA 1K5MA 1IGOA 3VGIA 2JDYA 2NPIA 2I74A 2XKOA 3NV3A 2IVIB 2HWF3 4AGRA 2NQYA 3LCPA 5FKBA 4EN8B 1A8DA 1STMA 3O1VA 2BYVE 4BQ1A 4KMQA 2R7EB 1RUD1 2QVSB 3WG1A 1JUIA 2WAOA 3POIA 5BNOB 1YRZA 4KH9A 2ZMLA 4R9BA 4QDRA 2A6XA 1H4GA 2MNGA 2EAAA 2VZ3A 3J7MA 1HB3A 1IPKA 1O7FA 4XFAA 1HKDA 1UF2C 1A8MA 1HRI1 3DKQA 5CG9A 4TWTA 3N9QA 5JPNB 5FXVA 2H0BA 1OUXA 2I2SA 1OFNA 1RMU3 2QKDA 2Q8OA 4LLFA 3WUCA 3VDDB 3LA3A 5EIYB 4IE4A 2VUAA 4LBKA 5JDBA 3GNEA 3LF7A 5GZEA 1AXYA 1QU0A 1W03A 2ZZJA 1Q8QA 3WCRA 2R32A 1SLLA 2R063 4GMP3 4L99A 2RVAA 3T1MA 1TMF1 4DFSA 1NQJA 2GP3A 3E5QA 3IKWA 2A70A 5EP9A 2C5DA 2VMHA 3PLQA 5FXWA 4CP9A 1CX1A 5J09A 4QX0A 1JYVA 5GJ6A 1XB9A 3CIHA 4Q0UA 1DIWA 2E51A 2IXLA 2BOIA 1FMD3 2W47A 4UFKA 3AZVA 1DHKB 3T2QA 5F3IA 2R042 4F83A 1CZSA 3IWZA 4BQ4A 5C8CB 3T4HB 2TNFA 4UW3A 3OY8A 5IJRA 2DVBA 3JXSA 3FHIB 4RA0A 5A7WB 2GC1A 4FPCA 1RUG3 2D3SA 1F31A 3D8CA 1VBE2 4EN9B 1ENRA 3ZYGA 2CWSA 2QDNA 2D6PA 4LK7A 4WV8A 4HG6B 4XZUG 3HD8B 4UI9L 1FOD3 4DEVA 1SBEA 5T5OA 4XTMA 4AVAA 1RUF1 1SPPB 3ZMOA 2BUKA 3LD8A 4K9SA 4XABA 2PMWB 5EPAA 2DCJA 3ON7A 1W06A 3K48A 4EROA 2R0FA 3I54A 3H0OA 3N7KA 3ZXLA 3KCXA 1YUDA 3ZN4A 4CXXA 2YY1A 1G9DA 1UY2A 4Q2FA 3JB8A 3BIWE 5CNAA 4DO0A 2DDUA 1OBNA 3H9AA 4YW1A 4W4ZA 3HMYA 3AMNA 3VUOA 3O1UA 1XYOA 3BU7A 4M3CA 4QB6A 5C3OA 1YQ8A 1O59A 2IWGB 4MGYE 4QAWA 5EJ3A 3IMNA 3GZAA 3M3OA 4B4QA 1PK6B 1UXZA 4Q4W2 5FBJA 2GMPA 2FDFA 1XNDA 2ZGTA 2AZ5A 5DZFA 1FNZA 3O7OA 3H1YA 2K0GA 2G9GA 2H6BA 1RVF2 4HONA 4N7IA 4V2WA 4XF3A 3WD5A 5FWEA 1DQ1A 2BU9A 4Q26A 5SV5A 2C24A 4CDQB 2FDKA 3AKTA 4A44A 3DYMA 4ET7A 1ULPA 2WN2A 3J7NA 2OXBA 4HBNA 2NZ9A 3WQ1A 3WP5A 1G9CA 1C1FA 1RMU2 5A3WA 2E63A 5L19A 4Q0SA 2WNVC 2Z79A 5AC93 3ZX7A 1AL23 2RJLA 3AYCA 1LKNA 1PNGA 1OF4A 1NT0A 1SZBA 2R062 4W6WA 2XJPA 4CU6A 4FAHA 1JYCA 1POV3 2RS13 1GWMA 1TNFA 2D3RA 3KVBA 1V9U3 2P2KA 1W99A 2QQUA 3R4DB 2B45X 1LJ7A 5FXXA 1HRV3 2O1QA 1NLRA 2PXJA 3IDCB 2ETEA 3HT1A 3K4AA 4GB31 4JAAA 1JS9A 2ZEYA 2YV8A 5EV7A 5DDJ1 4IEQA 2ZPXA 2P6CA 1VALA 3MIFA 3HWJA 5BNOA 1QOSA 1RUH3 2B42B 5LEJA 2R073 4OHXA 2GZWA 3RZJA 2UU8A 4XMIA 2HWE3 1F9KA 4MOAA 3FX3A 4MGIE 3S6PA 1RUG2 3RZLA 2HLEA 3AJZA 3V56A 3ZO0B 4V1PA 4XC9A 4A2UA 3SMHA 4YVWC 3OD4A 5A1FA 2YPJA 1H2MA 5CKNA 1OA2A 4LA3A 4IEYA 4R9CA 3VDDA 3S7IA 4NPRA 1WBFA 5DUVA 3WQ7A 1RUC1 1AYM3 4HN1A 2V4VA 2Y64A 1GNYA 4CUBA 5TSWA 1H6XA 5EHDA 3SH4A 3V64A 4XHXA 1ZZ6A 1AZDA 2IUWA 4Q27A 1TME1 3WNOA 4NRPA 2WQ4A 2OQ7A 3EQEA 5AFEA 2QE3A 3LDRA 5FWJA 2ILMA 4KU8A 1AYN3 1RITA 1RUE2 2WFF3 4L92A 5C3SA 3I3QA 4CU9A 4FPEA 2Y6JA 1Q43A 5C8CA 1SDDB 1C3HA 4DXRA 3VKMA 4GWNA 4Q4X2 1VRBA 4CCMA 4L2NA 1WMXA 2JG9C 5A7WA 2RM22 3NSTA 4ITCA 2WC2A 5J37A 1OOPC 4FAGA 2ATFA 2XVGA 4P14A 2CDPA 1N1VA 1VBB3 4KU7A 4DXZA 1DLCA 3MHZA 3DL3A 5I0SA 5C6CA 1J84A 2VE1A 2IFRA 2V09A 2HWC1 1IPSA 2YC4A 1RXFA 4EN6B 4QPYA 1SPPA 5JIUA 3MW2A 3N4MA 2ZHKA 1LENA 4QPGC 4AGGA 1BK1A 2A6WA 1XYNA 1NCRC 3U14A 2A6ZA 4H3WA 1O3TA 1DU3D 1DZTA 4IQPA 5FYHA 2AEYA 3O1SA 4O9GA 3RZKA 2OZ6A 2R16A 2JB4A 4CE8A 1V9U2 2WNVB 5GLZA 2EVXA 4BXSV 1JYWA 2HH9A 4XW3A 5LBBA 3HBZA 3WEZA 1QJX1 3H1WA 4CUAA 3QBQA 1I6XA 3P1IA 1VBA1 5C5UA 4M01A 1PK6A 4IEZA 1OVSA 4I0WB 1IS3A 3IIAA 4P5YA 1RUH2 3A22A 4PLMA 5JMOA 1FAYA 2R072 5JXJA 2VMEA 3POWA 4FQ4A 5K0UB 2Q4SA 1ZBA3 1EV11 3C2UA 2IXKA 2HWE2 2RDQA 2YG0A 1NX9A 1OFSA 2Q1FA 4N9HA 1AR92 1XYPA 2GALA 4FPFA 5JSRA 1PMJX 1GMMA 3DCQA 1QF3A 4NPLA 4COVA 3HR9A 5BXXA 4EE2A 1GKBA 2WFPA 5JI9A 1GWKA 4CCLA 3M2MA 5D2AA 4LBMA 2FMYA 4Y1YA 4MGTA 2HBUA 2LTNA 2XDVA 3B01A 3JZVA 5FCCA 3SHRA 1AJOA 1SFPA 4X8NA 5FY7A 3PUSA 2YBPA 3KV5A 2QTWB 3Q8EA 5FBZA 2JDHA 5GZFA 4YVWB 4DPNA 2BWAA 4YM1A 2BPA2 1AVBA 1OKOA 1PM4A 2JE7A 4AAPA 1TZOA 3MW3A 1ULOA 3WW3A 5FYYA 3TN91 3H8OA 1UD1A 4FP2A 5FTTC 5BV6A 2X53S 4IGPA 2VCAA 3I2GA 2WNUC 4CUCA 1COV2 1YJKA 4TLFA 1GOHA 1VR3A 5BPXA 1AYN2 3K75B 4IW3A 1C8M3 4CDXC 2EXJA 2NM1A 4IE6A 3BCWA 1PGW2 4CP2A 5B4NA 1HW5A 5F1RA 1AXKA 1S0CA 3PURA 2WWUA 1GBGA 5FPZA 1GP4A 1B09A 4WVWA 3E5XA 3GHMA 4EJRA 3I2KA 4A6SA 5JXHA 4UAPA 4D6QA 1I5PA 3HJRA 2W87A 1XNKA 4KI5M 3AVSA 1AR81 2W91A 1XU1A 1R091 3WNNA 3UJOA 4MXWB 4A42A 4AHZA 1OOPB 1N1TA 4YLZA 4UBGA 4GXLA 1DQ5A 1MZFA 3PTYA 4XUTA 2A7AA 1JN2P 4E8CA 1JODA 1VIWB 4CVUA 1RUJ3 3LPFA 3NNJA 5FQ0B 1SMVA 2D6MA 2PHRA 4XUQA 4Q4Y3 3CHXA 3DYOA 4YZ3A 3WDVA 1NCRB 1OH4A 2SLIA 1R1A1 2D6OX 2L9LA 3TBDA 4LKDA 1UU6A 2BP6A 2ZX2A 2Z4FA 2EA7A 4AOCA 1MVEA 3J8F2 5C3RA 2XJVA 1NCQB 2YU1A 3BPZA 1W8ZA 2IVJA 4KQ7A 1YYNA 2RV9A 3H3LA 4KNCA 4DRRA 1RUD3 4FI9A 2VOTA 1P8JA 2VPVA 2WT0A 4CPBD 5FKCA 5FZGA 5CKQA 4EWDA 2VQAA 4DEQA 3MEPA 4DNYA 2B9VA 3IAPA 1LOGA 3ZKYA 5F5QA 1APNA 1ND2B 5IHRA 1G8WA 1BJQA 4CCEA 3RZMA 1HRI3 2YBKA 4NHMA 4KWUA 2W92A 4RL7A 2XJTA 5DPNA 5DUXA 5LATA 3RS6A 3SKVA 2WNEA 3V0AB 3QH7A 5J98B 4P5HA 1AX0A 2JDAA 4M4PA 3I3MA 3PUQA 1UU4A 1Q8OA 3TEZA 3NKTA 3RWKX 1DYPA 1OQDA 4AK3A 4IGQA 2BGPA 1TG7A 3VBOC 4WVMB 1W8HA 2W08A 2WNVA 3U37A 5FPLA 4F7ZA 3N3HA 2MHFA 1U0AA 3M70A 4I3GA 4QGLA 3RGBA 2F4LA 4COZA 2C4XA 3EHKA 1TMF3 3NNFA 1OLQA 1POQA 5D8AC 3U4SA 1ULFA 3B02A 1LOCA 3KT7A 4P9XA 3J9SA 2CDOA 4JKLA 3VBFC 4B3NA 4GD4A 4LK6A 2D5HA 3IDEA 3O1TA 5HXMA 2SBAA 1NZIA 4XAAA 1JZ3A 1CJDA 1W8TA 1OVPA 1VBD1 3NNMA 4HOOA 5JPMB 3DEMA 1L3JA 5FYMA 5EYYA 4BM8A 1PVC1 4C0HA 4CEYC 4JDNA 4AQTA 1D0GA 2VZPA 2PQQA 1HQNA 1T6BX 1ZNPA 3H7YA 2RHPA 4ZU5A 1OF3A 4LT5A 4MH0E 2AH2A 1QJZA 1Z78A 3TEXA 3HNYM 1PIV2 3ILRA 4FPLA 3H3ZA 5T52A 4AVVA 4H2AA 5HCFA 2BNNA 4LMFA 5L9BA 1QQP1 1NA1C 4C1XA 1UNBA 1OI6A 2CNAA 1DQ4A 3VN4A 4FFFA 1E57A 4YVWA 1RUF3 4QXBA 1QJY1 2ORXA 3AZYA 4IL7A 3CF6E 1YC61 5IVCA 1U5IA 5DQ0A 2XJQA 4LE3A 2P4EA 5GLWA 2B39A 2WWSA 2E7TA 1YFXA 1LHNA 3WQBA 2JEMA 5FZ4A 3VDBA 3AMQA 4RQPB 2ZHMA 1E5SA 1Q5OA 1DZRA 4XQWA 1BCXA 1V00A 3KV6A 1ENXA 2Z5WA 4WM8B 3D0JA 1IQDC 3PVEA 4TXWA 1F35A 2W9XA 1JZ2A 3VBUC 2WBKA 3LA2A 1QNWA 2YGLA 4P9WA 5JCTA 2EF6A 5BNPC 4ORFA 1RHI1 2XLFA 2VMIA 3H7JA 3LEIA 4ATFA 3ENRA 3HN3A 1O5LA 5LBFA 5DMYA 1G9AA 3RDIA 1MPXA 5F5AA 3ZIXA 2VZSA 2XG3A 1Y4WA 4MXWA 4AI0A 1OOPA 3O1RA 1HRI2 1HN1A 3LKJA 1UW8A 4IXLA 2WSVA 1VRH2 4NRQA 3INAA 3JBG1 2W1WA 3J26N 1POV1 3KD4A 2PQSA 3WP6A 2HJIA 1KGYA 2E33A 3AP7A 2WO2A 3BOPA 3VD4A 3Q8FA 1NXD1 1XNTA 4JGYC 5EXOA 1HRV1 5FQ0A 4DB5A 1FV3A 2P1BA 4CCCA 1VP6A 3K2OA 3TYJA 3SQOA 1LAJA 3ZSJA 1NCRA 4HSLA 4MZUA 1CESA 3LWCA 4I01A 1MEC3 2WA3A 3CU7A 4WZCA 5E88A 5FO8B 1UY3A 2VAUA 3ZSKA 5LA0A 3VBOB 4YW5A 1GU3A 4LQRA 5F9TA 4HMZA 4EV0A 2VMCA 3HBKA 4PCRA 1J3PA 1YIPA 4GB33 1HN0A 2LS6A 4LUKA 1UPSA 3WSOA 2AYHA 5DDJ3 3U10A 5D8AB 3LB9A 1PGL1 5FPXA 1DYKA 1JI6A 1HB2A 4EN0A 4F8AA 3VBFB 3RMXA 5A6ZA 3G6JB 5JOZA 1ZZ7A 1RYYA 4G3YC 4N9IA 2WWJA 3RSJA 3K77A 3P3NA 2ZGUA 5EJ1B 4D7TA 4K40A 3CLPA 4JQTA 4NWVA 4JTOA 4P9LA 5LWBA 4HKWA 3V0AA 1RUOA 1M06G 4GMP0 4B1LA 1GANA 2D7FA 1GNHA 1YFUA 2P34A 3PMSA 5LZ6A 2FDIA 1W8OA 4XE9A 2ZGKA 1RUF2 1W8UA 2DTYA 2ZGOA 4GAZA 4UYBA 5LA1A 3MIGA 4BK5A 4H55A 4WVMA 5EJZB 1NE6A 1IS4A 1RUC3 2VBDA 4ZXKA 5A7NA 3LOBA 1JOPA 4PDWC 1KXGA 2PHFA 1NA1B 1CONA 2VUDA 4D8MA 2ZKNA 5FZCA 2FDHA 2Y6KA 4HFSA 5C5TA 4Y4RA 3ITQA 1K42A 1TME3 3OJBA 1D4VB 4WZFA 1OMIA 3ACHA 1CZVA 2BDRA 1V6KA 2EIEA 2WNUA 4XDQA 5F2SA 4QMAA 1VBB1 4O65A 4FTSA 2KXLA 1CAUB 1ND3C 3T2OA 4CDXA 1O8SA 2Z42A 5SV8A 5FOBB 4OVEA 2ZCWA 4AI3A 4FCAA 4KL1A 3U0ZA 2Y6FA 2PLV1 5FYZA 3T0AA 2QQWA 2AGSA 2RMU1 1WZXA 4R52A 4LHSA 4QM8A 5T3NA 1YFYA 3VBUB 3R4SA 1VBC2 4S2HA 4Y24A 2ZBJA 3R4UA 5EFUA 3ZN6B 4LHLA 1PO21 5BNPB 2Y26A 2HWC3 3M3IA 4MHUA 3NO8A 1WA6X 3TEYA 1WCQA 2BGOA 4Q4V1 5FZDA 1XQNA 1H1AA 4ZU4A 3H8RA 2VH9A 3DYPA 1GZTA 1ASJ3 3APBA 3PVBB 4YG3A 2Y6HA 4LUMA 4LBLA 1FYUA 5F3GA 4FQZA 5C7GA 2JIGA 3P3PA 1RJ7A 5DUWA 4JGYB 5AVPA 4RQPA 2RS51 4G4FA 5BYNA 4NIAA 3ZFEC 4Y22B 5CEHA 1VBA3 1WMFA 1S1AA 1ZBE1 1LOBA 3IDAA 2JWPA 2WLPA 5DDJ2 3ETPA 1XU2A 3THCA 2VD7A 3VHNA 2H0VA 3SCHA 2YFZA 2OQ6A 4FXKB 1EV13 1Q8VA 2GSYA 2B46X 3DPRC 3WXPA 5I91A 4HVRA 5G04L 3B00A 4IUGA 2Y6GA 4UXAA 4PF1A 3EXUA 2DCTA 1MACA 2JD4A 1R081 1SACA 2PHLA 2E7AA 3LEGA 4ZU7A 4A7ZA 4LORA 4OHVA 5FY9A 4AEDB 4D0QA 4ZY9A 5L9VA 1NOVA 2XBO2 3M3EA 4B1MA 5A70A 1RUC2 3MBWA 2B5HA 5FYUA 2BTVC 4AEJA 1Z7S1 4ZPIA 1QXPA 1HQWA 1GYKA 2J1SA 1HLCA 3B9CA 5EQUA 4PBPA 4XFCA 5A3OA 3NJZA 5T54A 1TME2 1YCIA 3TN93 3VBOA 3WDYA 4LULA 2K2SA 2ET7A 5LK5A 3WQ0A 1BBT3 1DZQA 1QOTA 3FC0A 3TRSB 1QXJA 3GCXA 5A3NA 5DAVA 4FVVA 5D8AA 4E2QA 2HWD1 3N9LA 3OOXA 3POEA 4OI4A 1KS5A 5KC5A 2VO5A 4YGBA 3OYWB 3VBFA 2VOVA 1JHJA 3NVCA 4IGOA 4CXYA 4KGGA 1OH3A 2ADEA 4QB1A 3E6BA 3P6BA 4LO6B 2BFUS 2CWMA 3SLIA 2GH8A 1ZRIA 2E7QA 4MUVA 5JOWA 4BWOA 1JW6A 5FZ6A 5A32B 1AR83 3LDKA 4E4HA 1R093 4DY3A 4XF1A 5LA2A 1JHNA 4P08A 3C7GA 3VBRC 2P5BA 5K8SA 3AZXA 4XJUA 1T6GC 4R8HA 4Y1UA 1UYXA 3K46A 4GULA 2ZKLA 5C3PA 1UOGA 4LA2A 2DVFA 2VZ1A 2BW8A 3AKSA 1OHFA 2EIDA 2FCUA 1NA1A 3IPVB 3MIEA 2WS91 1K12A 4GWIA 1LULA 3ASIA 1BEV3 5FP3A 2W1UA 4AVTA 3JD72 4XFBA 1QJX2 3ZMNA 1W9TA 3NAPC 1R1A3 2P3YA 1D7PM 4XHBA 2JDZA 1S0BA 2ZGLA 1VBA2 4QM9A 4XILA 2LM3A 4QKNA 3IB3A 1CAUA 2GNDA 5DAPA 1U5YA 3PU8A 3VZLA 3PDQA 1V6NA 4LBJA 3UKVA 1WW6A 1DYOA 1U12A 2PHXA 4K7JA 3ZFEB 4ARYA 4QXKA 4BIFA 2LRPA 1OT5A 4XJ9A 2RR11 2A3XA 3AKQA 4OLLA 1SBFA 4MGZE 3VBUA 3ZXEA 3ELNA 2W1SA 4ISQA 3PMEA 3HNBM 3OGRA 3ZN6A 5BNPA 2VCCA 3A4UA 4J25A 1CWPA 3DPRB 2B9UA 1LTEA 2YC0A 4Y26A 5ERLA 3WV6A 4Q0QA 4OHYA 3ILFA 1AR71 3CKHA 3VBSC 2VNRA 2VNOA 1J59A 1VMFA 3N9NA 2VXRA 5BNNC 3DGTA 5I8TA 1Y7BA 2IXHA 3HPNA 3G7DA 1GUIA 1V6OA 4UFJA 4L97A 5IVYA 3RYKA 3VHRA 4WVVA 2VQ0A 5JR2A 3FN9A 3ZVXA 4JGYA 1UIJA 1N47A 2ORZA 4ZZ8A 3TN92 4JKMA 1N3PA 2VBBA 4NO4A 4AHWA 1GQGA 2J7MA 4Y22A 2E53A 2VY0A 4WM7C 2DCZA 5LK7B 2RG4A 4H7MA 2ZEXA 1W0OA 4MV2A 4PJYA 1DFQA 5F2WA 1X9PA 2QBXA 2CHHA 2YFUA 5A7PA 2KA3A 3UKNA 1TEIA 1VBD3 5DAWA 2RJKA 3GF6A 5JAXA 1ZREA 3OBAA 3OTFA 4CU8A 1PVC3 2WO3A 2WQ8A 1US3A 3ABZA 4MGQA 2Y60A 4QT6A 2Z69A 2ZMKA 4XUNA 5FR3A 1LNSA 3Q8CA 2OX0A 3WDXA 4CDUC 1R092 1RUI2 3O12A 2JG8C 4KG0A 2ZGQA 4AEDA 4DXSA 4I2OA 1V6LA 3PL0A 1ODMA 3JB4C 4LBOA 5FZFA 1QQP3 4GH4C 2WT1A 1K3IA 2BFUL 3ZXDA 3WNMA 1Y9QA 1QJY3 3IBMA 4JGZC 5HI0A 4FSJA 4UFIA 4YZ2A 3V0BB 4PIZA 2HWF2 3AJYA 3KB5A 5J36A 5H9SA 4TYSA 2FD8A 3C7HA 2EALA 4COUA 3WG2A 1R1A2 3AL6A 4OQ8A 4RS5C 3SH5A 1ZZBA 3VKLA 3DUIA 3KGLA 4TTGA 3OYWA 1MZ5A 2ET1A 2WL1A 3OCPA 5BUVA 1FPN1 4HETA 4KBBA 4SBVA 4XCBA 3WHUA 1WD3A 3GCWA 3AZZA 3UGHA 4XUOA 3J4UH 2HEVF 1RINA 5ACA1 4AEMA 1DDLA 1YJLA 1ND3A 2VECA 3KQ4B 1DGWX 4BCUA 5A32A 2JDUA 1RHI3 2QJVA 3SISA 4M0NA 4W6XA 4QPIC 3A21A 3NNGA 5IK7A 1A6CA 3S5QA 1ZYBA 1MS8A 1C5IA 3DF0A 3RJRA 2K9ZA 2D3PA 2ERFA 2JE9A 2VZQA 3DN7A 1QGLA 3JBG3 4MX3A 3ZXAC 4URAA 3TB0A 1IS6A 3IPVA 4N43C 4XFHA 1MEC1 1REEA 4H14A 5DZGA 3I8TA 5F37A 3C7FA 3KVAA 4YSFA 3BU0A 4RHV1 3WDTA 5J7MA 2HYKA 2J1RA 1VAVA 2WAAA 4XF9A 4AGVA 5BNNB 3ZYRA 5A6XA 1FMD2 1GP6A 3H8UA 3W21A 4CPBA 4YG6A 1QIQA 2FZ2A 1QJEA 3HAGA 4XJ8A 2YXSA 2VNVA 3LE0A 2DFCA 5A6YA 5IVEA 5C8WA 4DUXA 2YUEA 5HPOA 3ZFEA 2XPJA 1RJ8A 2I45A 3T2PA 3B93A 3BB6A 4FOWA 3BYWA 4FP3A 4BQ3A 1PVC2 1AUYA 4MGKE 4Z92B 1YLLA 4CSWA 1GFF2 1DLLA 1W05A 3EB7A 1FOD2 2A75A 4QX5A 5E16A 5FMCA 5IUQA 5LW9A 3ZPOA 2Y8KA 2CV6A 4TZDA 2PHDA 5A7QA 3RNSA 3DPRA 1W2UA 2JXAA 2XOMA 1N3OA 2ZOEB 4FPOB 1O91A 4AI9A 4FPHA 4NHLA 3AYDA 4UOJA 2ARCA 2QZ2A 2WRAA 2DVGA 4ES8A 4PQ9A 4CDUB 2BZDA 4NN0A 4EQVA 1QJY2 3WF1A 2JG8B 3H3UA 2VG9A 4MADA 2UURA 2ZMNA 3JCIA 1EP0A 2QQVA 4EN7B 5JVVA 2B4KA 1UKRA 1UMIA 3BPSA 2PAKA 4JGZB 3MZHA 4A4AA 3VZKA 3FE5A 2FMDA 2ZEWA 3D0SA 5FREA 5KWRA 1G86A 3MUZ1 4SLIA 3I59B 1W6NB 1G9FA 1BMV2 1ZZ9A 4HK9A 1UXXX 1UZYA 2ENRA 3H50A 2E9QA 4LBQD 4NHYA 4BA6A 3AYEA 3OEBA 4TSVA 2GN3A 2CY6A 2KD7A 4AYUA 4E4SA 1NY72 1H30A 1VB4A 4N8MA 3ZOIA 2ZABA 2W5FA 2PLV3 4PQQA 4CP0A 4E27A 1D2QA 1VMJA 2RMU3 2HYXA 1AL22 4I09A 4J1XA 5AC92 5I8YA 2DUOA 2BEOA 1UOJA 1ASJ1 3HNMA 3MYXA 2PA7A 2VOKA 3RFRA 3OBZA 1LGNA 1H6YA 3JBG2 1PO23 3POJA 4S2FA 4NPMA 4BYYA 4Z2AA 1V70A 2RS12 1ZZCA 5FLHA 4QPIB 2MEV1 3URFA 1QJU1 1FT9A 2KR2A 4Q4V3 3VBRA 4AZZA 3V0BA 1EUUA 1SHWB 1HRV2 1QHDA 4GIQA 4YW4A 5E8AA 2C9AA 3M3QA 3A23A 3AZWA 1YHFA 3WINE 3ALQA 2GMEA 4N43B 3VDAA 4RFRB 2XQRA 4COYA 1HB1A 4XQ4A 1RIRA 3LZZA 3U75A 1H9PA 5CYYA 1FATA 3AP6A 1JZ5A 2RS53 4P9IA 3LOIA 3UK9A 4AR2A 4GWMA 2OA2A 3MIDA 3NAPA 3WNXA 1ZBE3 1I9RA 5FYTA 4DUWA 2XHNA 2O14A 4YGEA 3GM8A 1PGL2 2CYFA 1H1IA 5GLTA 2WABA 5FLJA 1W90A 4W50A 5KBFA 4WVZA 1S0IA 1Y9GA 5CBLA 1CPNA 3I3DA 4YARA 2YPDA 1VLNA 3I2FA 3MLKA 4FXGB 3D3AA 1IQAA 1O8PA 1XSRA 2ADDA 3ILNA 4YZ4A 3VD5A 1AYM2 4Y4YA 2B8MA 3HIFA 1YEWA 2O8QA 2CGPA 4CUGA 1R083 4BXFA 1H2LA 4RGAA 3KF3A 1ZA7A 1LOAA 4XAEA 1MZ6A 1C8NA 3ATGA 3PU3A 2BVVA 1OLME 2XJUA 1GOGA 5FYVA 3RVHA 1SLTA 1BBT1 1HXS3 3I2JA 3MDPA 4YWAA 1Z7S3 3VBSA 1KFXL 3VD7A 1H2KA 4CA9A 5BNNA 4AAXA 2ZS6B 3KT1A 2WFF2 4KGQA 1LB2A 3IN9A 2BGCA 3AC0A 4QKBA 1QDCA 4YFWA 1BQPA 1W9YA 3GALA 4XPVA 3FL7A 3B94A 2OIIA 1OLRA 2WZR3 3GBFA 1S0JA 3N9OA 4Z1VA 2D98A 5CFDC 2ARAA 4EZ4A 3CZJA 1VBB2 5B2GB 2HWD3 3BKZA 2XUMA 4WM7A 1W0NA 4KWLA 4QPWA 1U5XA 1JUHA 3WCSA 2JG9B 1JTZX 2DURA 5JXGA 4IEUA 4NIGA 5BY5A 2PLV2 4H7LA 2R041 2BBVA 1WLDA 2D6LX 1N1SA 2V72A 4QX3A 3MICA 5G05L 3PVOA 3ZYBA 4DY5A 1PO22 3KLSA 1VBE1 4JRAA 4MSVA 1F5JA 1YWKA 2VVDA 4CDUA 5F7UA 2DU0A 2JG8A 1XJAA 1BEV1 4C0BA 4Q4V2 4QPGB 4XIKA 5E1RA 4AI2A 2R1BA 3BODA 2P37A 3EBRA 4MVTA 2JKBA 4FT8A 2OUJA 5K7PA 1DGRA 1K5JA 2WS93 4R9AA 2W1QA 4NRMA 1OQ1A 2FDJA 2XR4A 5H9QA 2XVLA 4JGZA 3WY6A 5JZGC 2PTMA 5A3LA 2VJXA 2DYCA 1KJRA 1NG0A 1ZBA2 2RDSA 4NOTA 3I59A 1W6NA 2OT7A 3AMHA 4DOUA 3I2OA 1S0GA 1JZ4A 1UO9A 2W68A 1ZBE2 4LKSA 2D5FA 1J3QA 1NUKA 1V6IA 1WCKA 1UZ0A 3MFCA 4JHZA 4ZS3A 4RS5A 2VXJA 5A7OA 1PO11 2ZTNA 4JDOA 3L2HA 4XCAA 3U78A 2J42A 4OI1A 3WOGA 1LOFC 1SFNA 1W6OB 2GC2A 4OHZA 3KGZA 4Q4W1 1SBDA 5FJHA 1KRIA 4LPLA 1F4HA 4QXCA 5A3MA 5FLIA 5GALA 3SKJE 2RR13 1M4WA 2PHUA 5DAXA 3IMMA 1JYNA 3GYDA 1RVF1 2OW4A 1TE1B 2VMFA 5CVRA 1S2EA 5A7SA 5C4WC 1SLAA 2IZWA 4QPIA 5F5CA 1K45A 3OUJA 3WVJA 2ZGRA 1AR73 2TUNA 4JRLA 4AVSA 4COWA 3AP5A 2E32A 2Y33A 3NV4A 1WGPA 2YYOA 3T2TA 2W94A 1LGBA 1C8M2 1GQPA 4N43A 5FOJB 1UY0A 1XBFA 3USUA 2AUYA 3POBA 4QHOA 1Z0HA 5FMBA 3ZSMA 2VQTA 4Z82A 3Q8BA 1VB2A 3ZR6A 4FTEA 3J7LA 4ZKTB 5IWFA 2WNUB 4E8DA 1V0AA 2Q1ZB 4QKFA 4FFGA 5A3TA 3N9MA 4IEVA 4CDXB 4KWJA 2FBEA 1S55A 3PVNA 2HWD2 2WZ8A 1IHMA 3VHPA 5LY1A 3VV1A 1VMHA 1BK0A 5C3QA 2ES3A 4CCDA 2DCKA 4OHWA 2W52A 5FPUA 5CFDB 3FMGA 2WR9A 4BQWA 5CISA 3LGRA 2ZAHA 4JV4A 3OG2A 1BLZA 4U2AA 3RZZA 4HSJA 3NL1A 2UWCA 2OS2A 1UX7A 2E31A 2K46A 5CG8A 5LBEA 3F2ZA 4TN7A 4JC1A 1RUJ2 4Y33A 4MYEA 1XSQA 4OQ9A 2E26A 1AX2A 5KHJA 1UCXA 1URXA 2BOJA 4OCTA 1ZRCA 1HV1A 2I07B 3MLJA 4Q4Y2 3SCGA 4I02A 4CCNA 4BMBA 5DABA 3DECA 1NLQA 1A3KA 2W39A 3FHAA 1E5HA 2WS92 4XFGA 3K51A 2PFWA 4Y5TA 3H1MA 2P3IA 3T3YA 5IATA 3PUIA 4AFAA 2YU2A 4IV1C 4GWJA 4Z8BA 3KWVA 1AL0G 2R30A 4YW2A 3CJIC 4ES9A 3O1OA 1RUD2 2UYAA 4MGSA 3ZYFA 5A6QA 1H9WA 1GZWB 4M00A 1B35C 2G4IA 3OGJA 2J1TA 3MPBA 1FX5A 1XNCA 3D4KA 3UYJA 1F15A 1O3SA 3O5SA 4BQ5A 1FPN3 5LEKA 2JG9A 1RUE1 3JU9A 1C5HA 5HCAA 1XE7A 3RYPA 1GICA 4B8EA 5ACA3 4Q4X1 4XDOA 1OSGA 1L7LA 3N7JA 2EIGA 1NKGA 5ANQA 4YVSC 2RM21 2AREA 1RB8G 3I7DA 1ZM1A 4HK8A 1WLWA 1OURA 1I5ZA 4CDQC 3VHOA 1E5RA 3LA7A 1F5FA 2VC9A 4QPGA 5CAZA 2WDBA 4NR1A 3RI9A 1W28A 5FZ1A 1AR72 4NIHA 2VW2A 3JQXA 5IFPA 3OUHA 4Q0VA 3UL2A 1FXZA 2DVAA 1TMF2 3GJAA 2OUHA 2B7YA 3OEAA 4RD7A 4C1WA 1F8VA 3RJ2X 1MQTC 3THTA 5C4WB 4CP1A 3CNAA 4URTA 5LB6A 2UYBA 1R1ZA 2HWB1 4RHV3 3SH3A 1I3HA 3A0KA 3BALA 5FZIA 4BHPA 3ZKUA 4ISRA 4XFIA 4XOGA 1W8NA 4QDQA 1HQLA 1PGSA 1SQ4A 3PIJA 5KHHA 3OF1A 1X9TA 1W6OA 1BHGA 1PX3A 5T50A 3KMHA 3RMYA 4ZHNA 1REFA 2CAVA 4OZOA 1SG3A 4Y3OA 4CEYB 3BTYA 1X50A 1CPMA 4AFDA 3LEKA 3GJBA 2A6YA 3NMBA 1LR5A 3BVCA 1Q56A 4LR4A 3RYRA 4QU1A 2VZVA 2CSGA 4K8RB 1AR91 3OPTA 5GKAC 5BNQA 3WX5A 5A1LA 2ZHNA 4IV3C 4NE9A 3E6CC 3T0DA 4IDZA 2GH2A 1UL9A 1PZ9A 4V2VA 3VBHC 5AVAA 1KS4A 2W46A 3KS7A 2ZHLA 4GKYA 4MO3M 4HZFA 3FFQA 4IE0A 5ANNA 3ROUA 4DMIA 1BYHA 1J1TA 4FFIA 4NIIA 5C9AC 1SLIA 2EICA 3M1HA 2RDNA 5AFBA 3CL1A 4E2GA 4Q29A 2VZUA 4LBQB 3JUUA 4UFHA 4OI2A 4R4XA 2OPKA 1ZZ8A 2JX9A 5F6KA 4K1ZA 5J1XA 4IEWA 1PZ8A 1WMEA 5FYIA 2X29A 1GV9A 5JUVA 1JYXA 1CGPA 2E6VA 3SITA 4IV1B 4MHRA 1C57A 1QY4A 4IEPA 4RR3C 4HVQA 1GQHA 4NJ4A 4HL0A 3AXEA 1PGW1 3CJIB 5CFDA 5T55A 4DUVA 2BERA 3AK0A 3HQUA 3ZDSA 1G6NA 3POSA 1B35B 5ACA2 1J3RA 2VTFA 4NAMA 4Q1RA 2GDFA 1BKZA 2HKXA 1SLCA 1FNYA 1CQ9A 2FHRA 3Q8AA 4FOYA 2VMDA 3LQCA 4YNIA 4CYDA 3ACGA 3MIHA 2HEYF 3POFA 1LESA 1W6PB 2XHKA 1ZRFA 2ZJCA 4BLJA 3R05A 2TBVA 4YVSB 2J1AA 5T5PA 4C8DA 3U4XA 1MEC2 5FYCA 2MEV3 2QZ3A 1DCSA 3TNPB 1QJU3 3HQXA 1AF9A 3K3OA 2Z2SB 3K4DA 3ORJA 3NJXA 1SDWA 4P9GA 4XETA 4IE5A 3MGUA 2DUPA 4RHV2 3KCYA 2HEWF 3PNAA 4OI0A 4GB32 4HVOA 2W3JA 4BOWA 4BPZA 3UGGA 5K9YA 5L36A 4DIQA 4YW7A 3R0RA 1GZWA 2C9KA 2FZ1A 2RS31 4BJ0A 2JKXA 1RUNA 3S7EA 4NUBA 4INDA 2OZJA 3AM2A 2G9ZA 1QH6A 4Q0PA 4XXAA 1O4ZA 3USSA 5KXDA 1V6JA 2CGNA 2YMZA 3ACIA 3MW4A 3J8F1 2NLRA 1IKQA 1POV0 4AFCA 2VCMA 4LHKA 1LOFA 1XPWA 1X82A 4XXPA 4BU2A 3ZYPA 4BLIA 1JU3A 1XE0A 3AKPA 4YM2A 1RTVA 1ZA4A 5KHIA 5LCWL 3BI3A 4XJAA 1HXS1 1WUVA 3I49A 3SCFA 3JQWA 2OYZA 2C6SA 3WZ1A 1W0PA 1YQCA 5HCBA 2GAUA 4NROA 4QD2A 3H8XA 5C4WA 3RPQA 4CU7A 1NYWA 2DVDA 2WZR1 4IV3B 4LE4A 4PDWB 2V5YA 4OUMA 1J58A 4QB2A 4BH9A 5C71A 3EMRA 1IS5A 3HOBA 4HN0A 3FBYA 1MS1A 1WW4A 5C9AB 5APAA 2CGOA 3QH6A 3GGLA 1LOEA 2JDKA 4I0BA 4PLOA 3ZXGA 4B7KA 1UZZA 1V6MA 3IDBB 5JIAA 3WF0A 2BWCA 2VZTA 5CIRA 4LTAA 4TLGA 4GALA 3E6DA 5D1IA 3VD3A 4QKDA 5I8SA 5F6LB 4YFZA 3B3QE 1ND3B 4CEYA 4CEWC 3BTXA 3QCWA 4XJWA 3O0VA 3WNKA 1OD3A 2VQUA 4KBZA 3MI8A 1FI2A 1RXGA 1QDOA 1WCDJ 1ZVFA 2HWC2 2XWJB 4QQOA 3OD0A 4RR3B 1TQ5A 4XFFA 4Y1XA 5CZKA 3FFZA 3UV9A 2ZGSA 1H2NA 2NMOA 2R043 1D4M1 5ISLA 4GKXA 1N1YA 2N7GA 2LW8A 3OBTA 4S2DA 1ASJ2 1A78A 4EWEA 3WT3A 4Q5OA 2XH6A 3ACFA 1IG0A 1ENQA 1W9WA 1VBE3 3T09A 3D6EA 1PIV1 3VL8A 4EYUA 4O7XA 1F4AA 1UYZA 2MEV2 2VZRA 4X6RB 1IZ3A 1D2SA 4K3UA 5FZ7A 2XJSA 4XIOA 3UNPA 2X05A 1OQEA 5FZHA 3OBRA 3ZFFC 1WW5A 2VTXA 4LBQA 3ZXFA 3CZUA 1QWRA 3O0WA 4M0HA 4YM3A 3T08A 5FZMA 3KZ4C 3QOPA 1NLSA 1QH7A 2DF7A 3N35A 4UF0B 5K4LA 1C1LA 4PI0A 5CKMA 1HX6A 1FV2A 1PX4A 3HVDA 4D69A 3CBNA 4QQ2A 4IV1A 1IKPA 1EV12 5FUNA 1PK6C 2VZOA 3SNMA 5FP4A 3X29B 1ULDA 3MO4A 1YFWA 2XXZA 3RQ0A 4HXCA 3U11A 3CJIA 4W6YA 2JJ6A 3B7MA 5F8PA 5H9RA 1B35A 1PO13 3O1PA 2WN3A 4N90A 5IVVA 3UESA 4Q4W3 4HT1T 5GZGA 1NQDA 2Q1MA 2WJSA 2JDPA 3GZUC 5FY4A 1XOYA 4AQ6A 4UW6A 2KM2A 2DWRA 5JMCA 1W6PA 5LBCA 1RVF3 5JSPA 4W65A 5FZAA 4YVSA 3VKOA 3N7MA 1WWYA 2DTWA 2J1VA 4GZ9A 3LFIA 3N7LA 4LHNA 1VAMA 1W04A 2W0XA 3FWEA 3C8XA 3EYPA 3I97A 5FY0A 4CDQA 1VRH1 2IFWA 2A6VA 3N36A 3I2HA 4G9SB 3PJQA 4U36A 1BBT2 2D93A 3I2IA 4XF0A 4AHXA 3KQRA 4RSUA 1MQTA 2LROA 4B7EA 4XDPA 5FO9B 5KXCA 4J6GA 3HEIA 1UIKA 4OUSA 5FPVA 2VVFA 3KT4A 5LA9A 4AVCA 2UY9A 4JCKA 4D94A 5C33A 1OUSA 5E6HA 4YZ5A 4BIOA 1YO8A 2D43A 4QQHA 4E2SA 4XMAA 1L7QA 2WYSA 3N9PA 4BB3A 1AR82 1AXZA 1EPZA 5A80A 5JOYA 1QOOA 3WW2A 1WW7A 4QDSA 2PYTA 4CEWB 2RJ2A 4PT6A 4ATEA 3T30A 5IVFA 4L0PA 2BJSA 2NYYA 5JI7A 4JVAA 1NXMA 1UPIA 3VBRB 3LFMA 4UBHA 1LEMA 3E5UA 2OPWA 3ECQA 4P9JA 1UY1A 1BEV2 5FFOC 4Y1VA 5LRRA 2YZ4A 3U1XA 4IV3A 4PDWA 2DCYA 3QD6A 5F32A 3POYA 5FRAA 3VBHA 3LSDA 1W2OA 1WD4A 1W6QB 2XL7A 2Y6LA 3QLQA 4P9YA 4AQSA 3ZFGC 4BQYA 3O1MA 3S0MA 5C9AA 4LEJA 1S0EA 5FP7A 3ZXJA 4X6QB 5HV4A 3BTAA 2Q5TA 2DFBA 3ZFFB 4CTEA 5IK8A 2WUHA 3NAPB 2VOXA 4K6BA 4QX8A 3THPA 2AACA 5EYXA 5GZDA 2GMMA 1SCRA 2QCSB 2F4PA 4N7UA 3MPPG 3THDA 3WW1A 4AQ2A 1IPJA 1CIYA 2ZX4A 1OA3A 1PO12 1GOFA 1MS4A 1VPHA 1JOBA 1WLTA 2Y34A 1RUE3 2C0ZA 3AFGA 4RR3A 4P00B 3NRUA 2VNGA 4B4RA 3RI8A 1W2TA 3AXDA 3F95A 4CZSA 1U5ZA 4Q4X3 4R9DA 1JH5A 2GU9A 3IIIA 4UWDA 1DP0A 4NMIA 2RM23 2IXJA 1A34A 4K1YA 4X8PA 1ZRDA 4E4DX 2WT2A 1VBC1 4QGMA 3W58A 3ZN5A 4LNVA 3MV11 3OGVA 3VBSB 5CFCC 1WA4A 3AMMA 5I0TA 2JD9A 4D7YA 4JZRA 4PBOA 1GP5A 1LGCA 2BNOA 5EZWA 1REDA 2IXCA 1KD7A 3UKTA 4NWWA 4UF0A 3ZXKA 2UWBA 2HWB3 2BBAA 2BV4A 1DQ6A 4YW6A 1VBD2 5KXBA 2C26A 2RDRA 1MS3A 1DQ0A 1PMHX 4WM7B 1WLCA 3UETA 4AWDA 4PIYA 5K0UC 1H4HA 2UY8A 3RWNA 3WDUA 1PHMA 3ZYIB 1GWLA 3IAQA 5KHGA 1QKQA 4L9BA 2DUQA 4I30A 2W2IA 4QQPA 2XB6C 2NN8A 3KV9A 4OUEA 4QX2A 5I0UA 1QQP2 1WKYA 1KQRA 1XC6A 3W5MA 2ZX1A 4Q1PA 4OFGA 3KHCA 3S5AA 1DBNA 4JQRA 3EJKA 1J1LA 4PIXA 3WDWA 1QXRA 2DBIA 4S2GA 2G9FA 1AR93 1AR61 2W95A 2A3WA 3TNQA 5A3UA 4GH4B 1BXHA 2XMLA 3RG0A 4PI2A 1OXCA 4UFMA 4AVBA 1GR3A 3KCCA 3OGGA 1ST8A 1UOBA 2WYFA 1IOAA 4QHZA 2XBO1 3M7AA 5IYYA 4QX1A 2BVBA 2FCVA 5IFTA 5DN2A 3O0XA 4B29A 4C90A 3WLUA 2JICA 2WA4A 2ZAAA 3MF6A 4AE2A 4PLNA 3SEEA 4BQ2A 3K3NA 3MFAA 1PVXA 4LJHA 5FP9A 4RS5B 3ZFGB 5HBAA 2GC0A 2J1UA 1PZ7A 2JENA 3HQRA 1YI9A 1RHI2 4JKKA 5L7OC 1COV3 1HJGA 2EXHA 4BMEA 1S0FA 5I93A 4C91A 1X33A 1EAH1 2DV9A 3BGAA 3LSEA 4J1WA 1X7NA 2R1DA 4NHXA 3BTZA 4UW5A 4FPGA 4HPKB 1X8EA 3TWIA 1CVNA 2ZX0A 4CEWA 2QNKA 3BUCA 5T5JA 2QQPA 4ZS2A 5M0TA 2A5ZA 2LUWA 3WF3A 1DQ2A 3VDCA 4AFMA 1H8TC 2ZGNA 5FZ3A 1O3RA 4AG4A 3OSDA 1Y3TA 2QQKA 5FZOB 2IC1A 2Y0IA 1NAEA 2QQIA 3C3VA 2ZZQA 2JDMA 3OPWA 4FPKA 1CR7A 1SEFA 4AW7A 3GBWA 3KHBA 5FZ8A 4D6RA 1W6QA 3B5LB 3USUB 5H9PA 1WBLA 4LKEA 4K8FA 1EYBA 4Q8KA 2WNOA 2HWB2 1QJFA 5FMDA 3ZFFA 5CFCB 3P5BA 4QHBA 5GM0A 3LIGA 4LKFA 4XYXA 1JYIA 1MS0A 4XBQA 1HB4A 1LU2A 3MLLA 4BE3A 1UX6A 4RFT0 3JD71 4KWKA 2RS33 3ZDVA 2JB8A 3ES1A 4QGNA 5J3UA 3M4FA 1NCQC 3T4VA 1ZX5A 3IM0A 3ACLA 1PNFA 3PUAA 1KEXA 1UMZA 2A73B 2ZX3A 2R49A 3NQHA 5FP8A 1Q8SA 1LCLA 2JIJA 4LOSA 3GDBA 4A41A 1OKQA 1SFYA 2X09A 3CJXA 3J8F3 5FZBA 2WZPP 3ZSEA 4GJZA 3PUHA 1TVGA 3RRDA 4YZ1A 1ND2C 1CX4A 2PAEA 5FUPA 2QQOA 5A1AA 2XLGA 1UWWA 1OPOA 4XEZA 4JX0A 2YDEA 4IESA 1YI7A 4AEKA 2QQLA 2WSUA 5F3CA 4ASMB 5DZEA 4GQ7A 4JDMA 1W2NA 4IERA 1GZCA 2VOWA 2OKXA 3WP3A 4LXLA 5D21A 2LALA 2ARBA 2X5IC 2F17A 3A7QA 2D97A 4GA9A 4XQDA 5FO7B 1DF0A 3UT0A 5FY1A 3MUY1 2WZEA 4MLOA 3E97A 1HIXA 3BOWA 4AHYA 2VU9A 3AKRA 2A71A 2WO7A 3GHNA 3LAGA 3LDBA 2QUOA 4AI1A 1CAXB 4FPYA 1OC1A 3OB8A 2RMU2 2FCTA 4A6OA 5FK8A 2XWBB 5LASA 3WF2A 1UZWA 4JHTA 4K21A 4ZXEA 4YYOA 1XE8A 5DAQA 5FPBA 5L7OB 3UGFA 4FPJA 4LO8A 4CXWA 5FDBA 1DG6A 3CDZB 3KV4A 1JZ6A 1D4M3 2CL2A 1GSLA 4EZHA 4RN5A 1O5UA 4GH4A 3L2YA 4K20A 2OVUA 1ONAA 3LPGA 4Y5Z0 2UWAA 1RUI1 1UN1A 1Q8PA 5KC6A 1W8FA 3TEWA 4XBNA 2VTXJ 1MVQA 1PIV3 1H8TB 2VBPA 3IZOA 5DXDA 1US2A 3OGSA 2WO1A 1H1MA 2XQXA 1YXWA 2RS52 5JXIA 4QQLA 4B4PA 4L11A 1PMIA 1S2BA 4XZPA 2FQPA 3ZSLA 5DG2A 3FLPA 2GNMA 2HWF1 5HXVA 4A7YA 2PHTA 4QU2A 4RQPC 3ZFGA 1WCSA 4NVPA 3FLTA 2RS32 3HN1A 3NV2A 4ASLA 4WM8C 2Y0OA 3AFKA 1W2AX 2V5DA 5C70A 2YB7A 2QDRA 1OA4A 1UU5A 1MR5A 2Q30A 3VKNA 2V4AA 4HPKA 5IK5A 3WP4A 4N53C 3NJVA 4A3ZA 1ALYA 3C7OA 1R082 4UT5A 2NP0A 4YW3A 2XGXA 4I0AA 3B69A 3PTRB 4ASKA 5FJKA 3AL5A 5FMOS 5JOXA 2BNMA 1EPWA 3AB0A 1LEDA 5A33B 2D40A 4HKOA 4P02B 5F5IA 1L7RA 3AMPA 1AJKA 3I3BA 4YGCA 1UKGA 1UOFA 1HXS2 1RMU1 3POGA 5FZOA 3SEPA 1Z7S2 3U07A 3W9AA 3ZIWA 3FUQA 2GNBA 4CCKA 1ULEA 3HT2A 2WLQA 3VZMA 2QQJA 1WCUA 1QEXA 3K4ZA 4M3CF 2JE8A 5GZCA 3NW4A 3VZNA 3LEMA 4E4ZA 1VRH3 2R061 2VCBA 4GMP1 4HKLA 5JR7B 4M4RA 3ZR5A 2WZR2 2VM9A 3I2DA 4LOTA 3RZGA 5CFCA 3AX4A 4NAOA 3WR0A 4HANA 4IETA 4AF9A 2XKPA 2XONA 3LIHA 4XURA 4NIDA 1ULGA 3DXUA 2BRTA 4CDWC 5CADA 5DUUA 1UZVA 1UY4A 3ZLIA 5JLVA 2Q0AA 1FMD1 4META 4D7SA 3VD9A 4KG8A 2A1XA 3ST7A 2X5IB 5ABJC 4BZ4A 4M3CE 4LO7A 2FDGA 4WBBA 5K0UA 5J48A 1JMUB 1RUG1 5A3PA 2VW1A 1KFUL 1LHUA 3ME2A 4OMDA 1GZ9A 2PELA 1JU4A 3AYAA 2NMNA 3OPZA 4Q8LA 4FBFA 4R4ZA 1D4M2 2O0OA 3TOJA 1FOD1 3PHMA 4ZONA 4Y1ZA 1Y43B 4BQXA 2H6CA 4DZGA 1MS9A 2EIBA 2ZXQA 1K5MC 3AP4A 3WW4A 2AC1A 4O9EA 4HLTA 1CAVB 4LO5B 3W59A 4ZZ5A 3WG3A 1GLHA 5JZGB 1T2XA 4AFBA 1UMHA 4LITA 5FYSA 4YM0A 1DGLA 1TNRA 4D6SA 2EXIA 2ZGPA 3D82A 4XTPA 2Q8EA 1CAXA 1XRUA 2RR12 5KR7A 1LODA 1O3QA 2XUEA 2P3KA 5FAXA 1BMV1 4LO4B 3VL9A 1KDKA 3V65A 5L7OA 2PHWA 4BISA 3NNLA 1JYTA 2QFEA
chains in the Genus database with same CATH topology
3ZYHA 4CP9B 2LROA 1W8WA 2Q1FA 3ZYFA 4YWAA 4CPBD 1W8UA 1UOJA 1OH3A 4LK7A 3ORJA 2O14A 4YW6A 2VXJA 4LKFA 3ZYBA 4BQ3A 2K46A 1GWMA 1W90A 1WCUA 3F95A 1WZXA 4LK6A 4BQ5A 1GWKA 1HN0A 2WYFA 2JWPA 1W8TA 1WMXA 2KR2A 4CP9A 4A6SA 1V0AA 1GWLA 4LKDA 4YW7A 4LKEA 1L7LA 2C24A 5D21A 4BQ2A 2LRPA 4AL9A 4LJHA 1OKOA 3UT0A 4CPBA 4BQ4A 1W8ZA 1W9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYH A;  4CP9 B;  2LRO A;  1W8W A;  2Q1F A;  3ZYF A;  4YWA A;  4CPB D;  1W8U A;  1UOJ A;  1OH3 A;  4LK7 A;  3ORJ A;  2O14 A;  4YW6 A;  2VXJ A;  4LKF A;  3ZYB A;  4BQ3 A;  2K46 A;  1GWM A;  1W90 A;  1WCU A;  3F95 A;  1WZX A;  4LK6 A;  4BQ5 A;  1GWK A;  1HN0 A;  2WYF A;  2JWP A;  1W8T A;  1WMX A;  2KR2 A;  4CP9 A;  4A6S A;  1V0A A;  1GWL A;  4LKD A;  4YW7 A;  4LKE A;  1L7L A;  2C24 A;  5D21 A;  4BQ2 A;  2LRP A;  4AL9 A;  4LJH A;  1OKO A;  3UT0 A;  4CPB A;  4BQ4 A;  1W8Z A;  1W9F A; 
#chains in the Genus database with same CATH topology
 3ZYH A;  3C7E A;  2PN5 A;  5KXE A;  3NV1 A;  1SLB A;  1W8W A;  1CIW A;  1NY7 1;  4N53 B;  3ZYJ B;  1CN1 A;  3CMG A;  4RGG A;  3W20 A;  3WUD A;  2O8O A;  2F6B A;  4QWN A;  5GLV A;  4CCJ A;  4CCO A;  1W6M B;  1YQ2 A;  1ULC A;  5AC9 1;  1AL2 1;  1H8T A;  2Y38 A;  1VBC 3;  2C1F A;  2QQN A;  3GZT B;  5EWS A;  1EUT A;  4W8J A;  3E1F 1;  2VVE A;  5FMO L;  2YHJ A;  2RS1 1;  4AXO A;  3I3E A;  1V9U 1;  2XJR A;  4L8Q A;  4Y20 B;  2J22 A;  2GN7 A;  1KIT A;  5IVJ A;  5CA6 A;  2PAM A;  3VKF C;  5JSO A;  3FBM A;  2RE9 A;  3W5N A;  1KDM A;  2VUJ A;  3AVR A;  5IVB A;  2VL4 A;  4E9K A;  3GZE A;  3H42 B;  4PHZ A;  3Q9O A;  1YQ5 A;  4F3J A;  4OUL A;  2VW0 A;  3WNP A;  1RUH 1;  4FOQ A;  2R07 1;  4FFH A;  4LLO A;  3WF4 A;  1JZ8 A;  1BVV A;  1HV0 A;  2J1E A;  1J83 A;  5J96 B;  4CDW B;  5I0R A;  2HWE 1;  1LEC A;  1S0D A;  5F3E A;  1NCQ A;  1W3V A;  2ZA9 A;  2EXK A;  4XJZ A;  1MZE A;  4LIV A;  1BZW A;  4IEX A;  1W9S A;  5A33 A;  5IW0 A;  1PM7 A;  3KF5 A;  2P3J A;  1H0B A;  1NE4 A;  3SXW A;  2YRO A;  5ABJ B;  1QNY A;  2ZAC A;  1W3X A;  5FV3 A;  1X8M A;  4D3W A;  1VE0 A;  3DXT A;  1S2K A;  1SCS A;  4IE7 A;  4XVH A;  4AED C;  4GJY A;  3NJY A;  1CAW B;  3RZH A;  1ND2 A;  2VUC A;  3ZM8 A;  4DIN B;  1AYM 1;  2GNT A;  1RGS A;  4RYD A;  1AR6 3;  3T0B A;  1KJL A;  2TEP A;  2VR4 A;  3L9J T;  2D44 A;  4RGK A;  3VLB B;  1W9F A;  3PIG A;  3WNL A;  3FZ3 A;  2YC2 A;  4A45 A;  2AEZ A;  2ZGM A;  4NHK A;  3QAC A;  5B4X A;  5JWP A;  1O4T A;  2CTV A;  2GC3 A;  2XBO 3;  3FLR A;  1Y9M A;  3KM5 A;  1C4R A;  1JOJ A;  1COV 1;  2WII B;  1HDK A;  4LBN A;  4IEO A;  1AYN 1;  1K5M B;  2P17 A;  5FY5 A;  1FPN 2;  2ZEZ A;  3M8L A;  5IT6 A;  2VGD A;  2WFF 1;  2WKK A;  1XXN A;  1EY2 A;  3MF9 A;  1OD5 A;  3ES4 A;  4UW4 A;  2X5I A;  3CQO A;  4YG0 A;  3DV8 A;  2R6Q A;  5FIX A;  1E5I A;  1EAH 3;  1R64 A;  2VUL A;  2A3Y A;  5CU1 A;  3O14 A;  2AR6 A;  5DG1 A;  3A0N A;  4OYU A;  4OZX A;  3S30 A;  4A7K A;  5IK4 A;  1OPM A;  2X10 A;  3AP9 A;  4ARX A;  3VZO A;  4XBL A;  1LHO A;  2VMG A;  2MPF A;  4FO9 A;  1LHV A;  3ZPY A;  4I3P A;  1LU1 A;  3I4I A;  2JEC A;  1X36 A;  1ZRR A;  2WIN B;  3R6S A;  5KHK A;  1MQT B;  4PF5 A;  1AX1 A;  1CAV A;  3NKG A;  5JZG A;  1UQX A;  1XNA A;  5LRS A;  5FY8 A;  2BQP A;  1F2N A;  1Q3E A;  1BVP 1;  4EWA A;  4DRV A;  5FZ9 A;  3GXU A;  2X8K A;  5BNO C;  1JZ7 A;  4CP9 B;  1JBC A;  3CEW A;  2R0H A;  5LY2 A;  3BIE A;  2DBN A;  3JD7 3;  1QJX 3;  1ZBA 1;  4FTB A;  5FYB A;  3PJY A;  4YGD A;  4WM8 A;  5CB7 A;  3IT8 A;  4XUP A;  3ETQ A;  2DU1 A;  5FUI A;  1G7Y A;  1LRH A;  2EAK A;  2AEN A;  2GP5 A;  2XVK A;  3D5O A;  5I0D A;  1MS5 A;  4LIU A;  3OUI A;  5E89 A;  4BK4 A;  3T1L A;  1VJ2 A;  4O61 A;  3OY8 B;  5FZ0 A;  3UJQ A;  5HV0 A;  2HBT A;  4Z07 A;  3FJS A;  3GBG A;  4N53 A;  5IAV A;  3VDD C;  1QMJ A;  1C28 A;  5L9R A;  4Z2W A;  1RC6 A;  2ID4 A;  4DXT A;  1W6M A;  3FHQ A;  4OMC A;  4AL9 A;  1UAI A;  5L73 A;  4YPJ A;  1AR6 2;  4Y5S A;  2ARX A;  5T5L A;  1CJP A;  2YGM A;  2CAU A;  1DGR N;  2V73 A;  5FXZ A;  3VBH B;  4FOV A;  1O4Y A;  1WMD A;  5FZE A;  3WG4 A;  3MV0 1;  2G1M A;  1D0H A;  2WQZ C;  2XL9 A;  5FZK A;  3SC7 X;  1ACC A;  1CZT A;  4Y20 A;  5FK7 A;  1ODN A;  3B9I A;  2QQM A;  2YBS A;  1LHW A;  1W39 A;  4CRQ A;  1GNZ A;  4YRD A;  3DKW A;  4ONU A;  1C8M 1;  1S4C A;  3VZJ A;  2IXI A;  1IG3 A;  2Q8C A;  5C8C C;  4M3C B;  3TAY A;  1ENS A;  1HJF A;  1YIF A;  4QXH A;  4CDW A;  4QX7 A;  5GLU A;  3FUO A;  4BDV B;  5HCH A;  1YQ6 A;  1OLM A;  1EAH 2;  3VB9 A;  4JTN A;  3MIB A;  4A3X A;  1DGW A;  2P6H A;  3NWK A;  1JXN A;  1CD3 G;  2JDN A;  3J7H A;  5ABJ A;  5FPA A;  2G19 A;  5FZL A;  4XAC A;  2Q8D A;  1O6U A;  2D6N A;  4XF4 A;  1H8V A;  1RL3 A;  1G9B A;  1VAK A;  4MXV A;  4MG2 A;  1YNA A;  4DS0 A;  1CAW A;  1XNB A;  1QJU 2;  4UFL A;  3KSC A;  1N3Q A;  3CO2 A;  5IAX A;  2XLA A;  1I1E A;  1NZC A;  2CU5 A;  4AI8 A;  3EO6 A;  3S57 A;  4DQA A;  3BN6 A;  1RUI 3;  1RUJ 1;  1UYP A;  3M3C A;  5F39 A;  2D6K A;  1UYY A;  4Q4Y 1;  1AHS A;  3WHT A;  1K5M A;  1IGO A;  3VGI A;  2JDY A;  2NPI A;  2I74 A;  2XKO A;  3NV3 A;  2IVI B;  2HWF 3;  4AGR A;  2NQY A;  3LCP A;  5FKB A;  4EN8 B;  1A8D A;  1STM A;  3O1V A;  2BYV E;  4BQ1 A;  4KMQ A;  2R7E B;  1RUD 1;  2QVS B;  3WG1 A;  1JUI A;  2WAO A;  3POI A;  5BNO B;  1YRZ A;  4KH9 A;  2ZML A;  4R9B A;  4QDR A;  2A6X A;  1H4G A;  2MNG A;  2EAA A;  2VZ3 A;  3J7M A;  1HB3 A;  1IPK A;  1O7F A;  4XFA A;  1HKD A;  1UF2 C;  1A8M A;  1HRI 1;  3DKQ A;  5CG9 A;  4TWT A;  3N9Q A;  5JPN B;  5FXV A;  2H0B A;  1OUX A;  2I2S A;  1OFN A;  1RMU 3;  2QKD A;  2Q8O A;  4LLF A;  3WUC A;  3VDD B;  3LA3 A;  5EIY B;  4IE4 A;  2VUA A;  4LBK A;  5JDB A;  3GNE A;  3LF7 A;  5GZE A;  1AXY A;  1QU0 A;  1W03 A;  2ZZJ A;  1Q8Q A;  3WCR A;  2R32 A;  1SLL A;  2R06 3;  4GMP 3;  4L99 A;  2RVA A;  3T1M A;  1TMF 1;  4DFS A;  1NQJ A;  2GP3 A;  3E5Q A;  3IKW A;  2A70 A;  5EP9 A;  2C5D A;  2VMH A;  3PLQ A;  5FXW A;  4CP9 A;  1CX1 A;  5J09 A;  4QX0 A;  1JYV A;  5GJ6 A;  1XB9 A;  3CIH A;  4Q0U A;  1DIW A;  2E51 A;  2IXL A;  2BOI A;  1FMD 3;  2W47 A;  4UFK A;  3AZV A;  1DHK B;  3T2Q A;  5F3I A;  2R04 2;  4F83 A;  1CZS A;  3IWZ A;  4BQ4 A;  5C8C B;  3T4H B;  2TNF A;  4UW3 A;  3OY8 A;  5IJR A;  2DVB A;  3JXS A;  3FHI B;  4RA0 A;  5A7W B;  2GC1 A;  4FPC A;  1RUG 3;  2D3S A;  1F31 A;  3D8C A;  1VBE 2;  4EN9 B;  1ENR A;  3ZYG A;  2CWS A;  2QDN A;  2D6P A;  4LK7 A;  4WV8 A;  4HG6 B;  4XZU G;  3HD8 B;  4UI9 L;  1FOD 3;  4DEV A;  1SBE A;  5T5O A;  4XTM A;  4AVA A;  1RUF 1;  1SPP B;  3ZMO A;  2BUK A;  3LD8 A;  4K9S A;  4XAB A;  2PMW B;  5EPA A;  2DCJ A;  3ON7 A;  1W06 A;  3K48 A;  4ERO A;  2R0F A;  3I54 A;  3H0O A;  3N7K A;  3ZXL A;  3KCX A;  1YUD A;  3ZN4 A;  4CXX A;  2YY1 A;  1G9D A;  1UY2 A;  4Q2F A;  3JB8 A;  3BIW E;  5CNA A;  4DO0 A;  2DDU A;  1OBN A;  3H9A A;  4YW1 A;  4W4Z A;  3HMY A;  3AMN A;  3VUO A;  3O1U A;  1XYO A;  3BU7 A;  4M3C A;  4QB6 A;  5C3O A;  1YQ8 A;  1O59 A;  2IWG B;  4MGY E;  4QAW A;  5EJ3 A;  3IMN A;  3GZA A;  3M3O A;  4B4Q A;  1PK6 B;  1UXZ A;  4Q4W 2;  5FBJ A;  2GMP A;  2FDF A;  1XND A;  2ZGT A;  2AZ5 A;  5DZF A;  1FNZ A;  3O7O A;  3H1Y A;  2K0G A;  2G9G A;  2H6B A;  1RVF 2;  4HON A;  4N7I A;  4V2W A;  4XF3 A;  3WD5 A;  5FWE A;  1DQ1 A;  2BU9 A;  4Q26 A;  5SV5 A;  2C24 A;  4CDQ B;  2FDK A;  3AKT A;  4A44 A;  3DYM A;  4ET7 A;  1ULP A;  2WN2 A;  3J7N A;  2OXB A;  4HBN A;  2NZ9 A;  3WQ1 A;  3WP5 A;  1G9C A;  1C1F A;  1RMU 2;  5A3W A;  2E63 A;  5L19 A;  4Q0S A;  2WNV C;  2Z79 A;  5AC9 3;  3ZX7 A;  1AL2 3;  2RJL A;  3AYC A;  1LKN A;  1PNG A;  1OF4 A;  1NT0 A;  1SZB A;  2R06 2;  4W6W A;  2XJP A;  4CU6 A;  4FAH A;  1JYC A;  1POV 3;  2RS1 3;  1GWM A;  1TNF A;  2D3R A;  3KVB A;  1V9U 3;  2P2K A;  1W99 A;  2QQU A;  3R4D B;  2B45 X;  1LJ7 A;  5FXX A;  1HRV 3;  2O1Q A;  1NLR A;  2PXJ A;  3IDC B;  2ETE A;  3HT1 A;  3K4A A;  4GB3 1;  4JAA A;  1JS9 A;  2ZEY A;  2YV8 A;  5EV7 A;  5DDJ 1;  4IEQ A;  2ZPX A;  2P6C A;  1VAL A;  3MIF A;  3HWJ A;  5BNO A;  1QOS A;  1RUH 3;  2B42 B;  5LEJ A;  2R07 3;  4OHX A;  2GZW A;  3RZJ A;  2UU8 A;  4XMI A;  2HWE 3;  1F9K A;  4MOA A;  3FX3 A;  4MGI E;  3S6P A;  1RUG 2;  3RZL A;  2HLE A;  3AJZ A;  3V56 A;  3ZO0 B;  4V1P A;  4XC9 A;  4A2U A;  3SMH A;  4YVW C;  3OD4 A;  5A1F A;  2YPJ A;  1H2M A;  5CKN A;  1OA2 A;  4LA3 A;  4IEY A;  4R9C A;  3VDD A;  3S7I A;  4NPR A;  1WBF A;  5DUV A;  3WQ7 A;  1RUC 1;  1AYM 3;  4HN1 A;  2V4V A;  2Y64 A;  1GNY A;  4CUB A;  5TSW A;  1H6X A;  5EHD A;  3SH4 A;  3V64 A;  4XHX A;  1ZZ6 A;  1AZD A;  2IUW A;  4Q27 A;  1TME 1;  3WNO A;  4NRP A;  2WQ4 A;  2OQ7 A;  3EQE A;  5AFE A;  2QE3 A;  3LDR A;  5FWJ A;  2ILM A;  4KU8 A;  1AYN 3;  1RIT A;  1RUE 2;  2WFF 3;  4L92 A;  5C3S A;  3I3Q A;  4CU9 A;  4FPE A;  2Y6J A;  1Q43 A;  5C8C A;  1SDD B;  1C3H A;  4DXR A;  3VKM A;  4GWN A;  4Q4X 2;  1VRB A;  4CCM A;  4L2N A;  1WMX A;  2JG9 C;  5A7W A;  2RM2 2;  3NST A;  4ITC A;  2WC2 A;  5J37 A;  1OOP C;  4FAG A;  2ATF A;  2XVG A;  4P14 A;  2CDP A;  1N1V A;  1VBB 3;  4KU7 A;  4DXZ A;  1DLC A;  3MHZ A;  3DL3 A;  5I0S A;  5C6C A;  1J84 A;  2VE1 A;  2IFR A;  2V09 A;  2HWC 1;  1IPS A;  2YC4 A;  1RXF A;  4EN6 B;  4QPY A;  1SPP A;  5JIU A;  3MW2 A;  3N4M A;  2ZHK A;  1LEN A;  4QPG C;  4AGG A;  1BK1 A;  2A6W A;  1XYN A;  1NCR C;  3U14 A;  2A6Z A;  4H3W A;  1O3T A;  1DU3 D;  1DZT A;  4IQP A;  5FYH A;  2AEY A;  3O1S A;  4O9G A;  3RZK A;  2OZ6 A;  2R16 A;  2JB4 A;  4CE8 A;  1V9U 2;  2WNV B;  5GLZ A;  2EVX A;  4BXS V;  1JYW A;  2HH9 A;  4XW3 A;  5LBB A;  3HBZ A;  3WEZ A;  1QJX 1;  3H1W A;  4CUA A;  3QBQ A;  1I6X A;  3P1I A;  1VBA 1;  5C5U A;  4M01 A;  1PK6 A;  4IEZ A;  1OVS A;  4I0W B;  1IS3 A;  3IIA A;  4P5Y A;  1RUH 2;  3A22 A;  4PLM A;  5JMO A;  1FAY A;  2R07 2;  5JXJ A;  2VME A;  3POW A;  4FQ4 A;  5K0U B;  2Q4S A;  1ZBA 3;  1EV1 1;  3C2U A;  2IXK A;  2HWE 2;  2RDQ A;  2YG0 A;  1NX9 A;  1OFS A;  2Q1F A;  4N9H A;  1AR9 2;  1XYP A;  2GAL A;  4FPF A;  5JSR A;  1PMJ X;  1GMM A;  3DCQ A;  1QF3 A;  4NPL A;  4COV A;  3HR9 A;  5BXX A;  4EE2 A;  1GKB A;  2WFP A;  5JI9 A;  1GWK A;  4CCL A;  3M2M A;  5D2A A;  4LBM A;  2FMY A;  4Y1Y A;  4MGT A;  2HBU A;  2LTN A;  2XDV A;  3B01 A;  3JZV A;  5FCC A;  3SHR A;  1AJO A;  1SFP A;  4X8N A;  5FY7 A;  3PUS A;  2YBP A;  3KV5 A;  2QTW B;  3Q8E A;  5FBZ A;  2JDH A;  5GZF A;  4YVW B;  4DPN A;  2BWA A;  4YM1 A;  2BPA 2;  1AVB A;  1OKO A;  1PM4 A;  2JE7 A;  4AAP A;  1TZO A;  3MW3 A;  1ULO A;  3WW3 A;  5FYY A;  3TN9 1;  3H8O A;  1UD1 A;  4FP2 A;  5FTT C;  5BV6 A;  2X53 S;  4IGP A;  2VCA A;  3I2G A;  2WNU C;  4CUC A;  1COV 2;  1YJK A;  4TLF A;  1GOH A;  1VR3 A;  5BPX A;  1AYN 2;  3K75 B;  4IW3 A;  1C8M 3;  4CDX C;  2EXJ A;  2NM1 A;  4IE6 A;  3BCW A;  1PGW 2;  4CP2 A;  5B4N A;  1HW5 A;  5F1R A;  1AXK A;  1S0C A;  3PUR A;  2WWU A;  1GBG A;  5FPZ A;  1GP4 A;  1B09 A;  4WVW A;  3E5X A;  3GHM A;  4EJR A;  3I2K A;  4A6S A;  5JXH A;  4UAP A;  4D6Q A;  1I5P A;  3HJR A;  2W87 A;  1XNK A;  4KI5 M;  3AVS A;  1AR8 1;  2W91 A;  1XU1 A;  1R09 1;  3WNN A;  3UJO A;  4MXW B;  4A42 A;  4AHZ A;  1OOP B;  1N1T A;  4YLZ A;  4UBG A;  4GXL A;  1DQ5 A;  1MZF A;  3PTY A;  4XUT A;  2A7A A;  1JN2 P;  4E8C A;  1JOD A;  1VIW B;  4CVU A;  1RUJ 3;  3LPF A;  3NNJ A;  5FQ0 B;  1SMV A;  2D6M A;  2PHR A;  4XUQ A;  4Q4Y 3;  3CHX A;  3DYO A;  4YZ3 A;  3WDV A;  1NCR B;  1OH4 A;  2SLI A;  1R1A 1;  2D6O X;  2L9L A;  3TBD A;  4LKD A;  1UU6 A;  2BP6 A;  2ZX2 A;  2Z4F A;  2EA7 A;  4AOC A;  1MVE A;  3J8F 2;  5C3R A;  2XJV A;  1NCQ B;  2YU1 A;  3BPZ A;  1W8Z A;  2IVJ A;  4KQ7 A;  1YYN A;  2RV9 A;  3H3L A;  4KNC A;  4DRR A;  1RUD 3;  4FI9 A;  2VOT A;  1P8J A;  2VPV A;  2WT0 A;  4CPB D;  5FKC A;  5FZG A;  5CKQ A;  4EWD A;  2VQA A;  4DEQ A;  3MEP A;  4DNY A;  2B9V A;  3IAP A;  1LOG A;  3ZKY A;  5F5Q A;  1APN A;  1ND2 B;  5IHR A;  1G8W A;  1BJQ A;  4CCE A;  3RZM A;  1HRI 3;  2YBK A;  4NHM A;  4KWU A;  2W92 A;  4RL7 A;  2XJT A;  5DPN A;  5DUX A;  5LAT A;  3RS6 A;  3SKV A;  2WNE A;  3V0A B;  3QH7 A;  5J98 B;  4P5H A;  1AX0 A;  2JDA A;  4M4P A;  3I3M A;  3PUQ A;  1UU4 A;  1Q8O A;  3TEZ A;  3NKT A;  3RWK X;  1DYP A;  1OQD A;  4AK3 A;  4IGQ A;  2BGP A;  1TG7 A;  3VBO C;  4WVM B;  1W8H A;  2W08 A;  2WNV A;  3U37 A;  5FPL A;  4F7Z A;  3N3H A;  2MHF A;  1U0A A;  3M70 A;  4I3G A;  4QGL A;  3RGB A;  2F4L A;  4COZ A;  2C4X A;  3EHK A;  1TMF 3;  3NNF A;  1OLQ A;  1POQ A;  5D8A C;  3U4S A;  1ULF A;  3B02 A;  1LOC A;  3KT7 A;  4P9X A;  3J9S A;  2CDO A;  4JKL A;  3VBF C;  4B3N A;  4GD4 A;  4LK6 A;  2D5H A;  3IDE A;  3O1T A;  5HXM A;  2SBA A;  1NZI A;  4XAA A;  1JZ3 A;  1CJD A;  1W8T A;  1OVP A;  1VBD 1;  3NNM A;  4HOO A;  5JPM B;  3DEM A;  1L3J A;  5FYM A;  5EYY A;  4BM8 A;  1PVC 1;  4C0H A;  4CEY C;  4JDN A;  4AQT A;  1D0G A;  2VZP A;  2PQQ A;  1HQN A;  1T6B X;  1ZNP A;  3H7Y A;  2RHP A;  4ZU5 A;  1OF3 A;  4LT5 A;  4MH0 E;  2AH2 A;  1QJZ A;  1Z78 A;  3TEX A;  3HNY M;  1PIV 2;  3ILR A;  4FPL A;  3H3Z A;  5T52 A;  4AVV A;  4H2A A;  5HCF A;  2BNN A;  4LMF A;  5L9B A;  1QQP 1;  1NA1 C;  4C1X A;  1UNB A;  1OI6 A;  2CNA A;  1DQ4 A;  3VN4 A;  4FFF A;  1E57 A;  4YVW A;  1RUF 3;  4QXB A;  1QJY 1;  2ORX A;  3AZY A;  4IL7 A;  3CF6 E;  1YC6 1;  5IVC A;  1U5I A;  5DQ0 A;  2XJQ A;  4LE3 A;  2P4E A;  5GLW A;  2B39 A;  2WWS A;  2E7T A;  1YFX A;  1LHN A;  3WQB A;  2JEM A;  5FZ4 A;  3VDB A;  3AMQ A;  4RQP B;  2ZHM A;  1E5S A;  1Q5O A;  1DZR A;  4XQW A;  1BCX A;  1V00 A;  3KV6 A;  1ENX A;  2Z5W A;  4WM8 B;  3D0J A;  1IQD C;  3PVE A;  4TXW A;  1F35 A;  2W9X A;  1JZ2 A;  3VBU C;  2WBK A;  3LA2 A;  1QNW A;  2YGL A;  4P9W A;  5JCT A;  2EF6 A;  5BNP C;  4ORF A;  1RHI 1;  2XLF A;  2VMI A;  3H7J A;  3LEI A;  4ATF A;  3ENR A;  3HN3 A;  1O5L A;  5LBF A;  5DMY A;  1G9A A;  3RDI A;  1MPX A;  5F5A A;  3ZIX A;  2VZS A;  2XG3 A;  1Y4W A;  4MXW A;  4AI0 A;  1OOP A;  3O1R A;  1HRI 2;  1HN1 A;  3LKJ A;  1UW8 A;  4IXL A;  2WSV A;  1VRH 2;  4NRQ A;  3INA A;  3JBG 1;  2W1W A;  3J26 N;  1POV 1;  3KD4 A;  2PQS A;  3WP6 A;  2HJI A;  1KGY A;  2E33 A;  3AP7 A;  2WO2 A;  3BOP A;  3VD4 A;  3Q8F A;  1NXD 1;  1XNT A;  4JGY C;  5EXO A;  1HRV 1;  5FQ0 A;  4DB5 A;  1FV3 A;  2P1B A;  4CCC A;  1VP6 A;  3K2O A;  3TYJ A;  3SQO A;  1LAJ A;  3ZSJ A;  1NCR A;  4HSL A;  4MZU A;  1CES A;  3LWC A;  4I01 A;  1MEC 3;  2WA3 A;  3CU7 A;  4WZC A;  5E88 A;  5FO8 B;  1UY3 A;  2VAU A;  3ZSK A;  5LA0 A;  3VBO B;  4YW5 A;  1GU3 A;  4LQR A;  5F9T A;  4HMZ A;  4EV0 A;  2VMC A;  3HBK A;  4PCR A;  1J3P A;  1YIP A;  4GB3 3;  1HN0 A;  2LS6 A;  4LUK A;  1UPS A;  3WSO A;  2AYH A;  5DDJ 3;  3U10 A;  5D8A B;  3LB9 A;  1PGL 1;  5FPX A;  1DYK A;  1JI6 A;  1HB2 A;  4EN0 A;  4F8A A;  3VBF B;  3RMX A;  5A6Z A;  3G6J B;  5JOZ A;  1ZZ7 A;  1RYY A;  4G3Y C;  4N9I A;  2WWJ A;  3RSJ A;  3K77 A;  3P3N A;  2ZGU A;  5EJ1 B;  4D7T A;  4K40 A;  3CLP A;  4JQT A;  4NWV A;  4JTO A;  4P9L A;  5LWB A;  4HKW A;  3V0A A;  1RUO A;  1M06 G;  4GMP 0;  4B1L A;  1GAN A;  2D7F A;  1GNH A;  1YFU A;  2P34 A;  3PMS A;  5LZ6 A;  2FDI A;  1W8O A;  4XE9 A;  2ZGK A;  1RUF 2;  1W8U A;  2DTY A;  2ZGO A;  4GAZ A;  4UYB A;  5LA1 A;  3MIG A;  4BK5 A;  4H55 A;  4WVM A;  5EJZ B;  1NE6 A;  1IS4 A;  1RUC 3;  2VBD A;  4ZXK A;  5A7N A;  3LOB A;  1JOP A;  4PDW C;  1KXG A;  2PHF A;  1NA1 B;  1CON A;  2VUD A;  4D8M A;  2ZKN A;  5FZC A;  2FDH A;  2Y6K A;  4HFS A;  5C5T A;  4Y4R A;  3ITQ A;  1K42 A;  1TME 3;  3OJB A;  1D4V B;  4WZF A;  1OMI A;  3ACH A;  1CZV A;  2BDR A;  1V6K A;  2EIE A;  2WNU A;  4XDQ A;  5F2S A;  4QMA A;  1VBB 1;  4O65 A;  4FTS A;  2KXL A;  1CAU B;  1ND3 C;  3T2O A;  4CDX A;  1O8S A;  2Z42 A;  5SV8 A;  5FOB B;  4OVE A;  2ZCW A;  4AI3 A;  4FCA A;  4KL1 A;  3U0Z A;  2Y6F A;  2PLV 1;  5FYZ A;  3T0A A;  2QQW A;  2AGS A;  2RMU 1;  1WZX A;  4R52 A;  4LHS A;  4QM8 A;  5T3N A;  1YFY A;  3VBU B;  3R4S A;  1VBC 2;  4S2H A;  4Y24 A;  2ZBJ A;  3R4U A;  5EFU A;  3ZN6 B;  4LHL A;  1PO2 1;  5BNP B;  2Y26 A;  2HWC 3;  3M3I A;  4MHU A;  3NO8 A;  1WA6 X;  3TEY A;  1WCQ A;  2BGO A;  4Q4V 1;  5FZD A;  1XQN A;  1H1A A;  4ZU4 A;  3H8R A;  2VH9 A;  3DYP A;  1GZT A;  1ASJ 3;  3APB A;  3PVB B;  4YG3 A;  2Y6H A;  4LUM A;  4LBL A;  1FYU A;  5F3G A;  4FQZ A;  5C7G A;  2JIG A;  3P3P A;  1RJ7 A;  5DUW A;  4JGY B;  5AVP A;  4RQP A;  2RS5 1;  4G4F A;  5BYN A;  4NIA A;  3ZFE C;  4Y22 B;  5CEH A;  1VBA 3;  1WMF A;  1S1A A;  1ZBE 1;  1LOB A;  3IDA A;  2JWP A;  2WLP A;  5DDJ 2;  3ETP A;  1XU2 A;  3THC A;  2VD7 A;  3VHN A;  2H0V A;  3SCH A;  2YFZ A;  2OQ6 A;  4FXK B;  1EV1 3;  1Q8V A;  2GSY A;  2B46 X;  3DPR C;  3WXP A;  5I91 A;  4HVR A;  5G04 L;  3B00 A;  4IUG A;  2Y6G A;  4UXA A;  4PF1 A;  3EXU A;  2DCT A;  1MAC A;  2JD4 A;  1R08 1;  1SAC A;  2PHL A;  2E7A A;  3LEG A;  4ZU7 A;  4A7Z A;  4LOR A;  4OHV A;  5FY9 A;  4AED B;  4D0Q A;  4ZY9 A;  5L9V A;  1NOV A;  2XBO 2;  3M3E A;  4B1M A;  5A70 A;  1RUC 2;  3MBW A;  2B5H A;  5FYU A;  2BTV C;  4AEJ A;  1Z7S 1;  4ZPI A;  1QXP A;  1HQW A;  1GYK A;  2J1S A;  1HLC A;  3B9C A;  5EQU A;  4PBP A;  4XFC A;  5A3O A;  3NJZ A;  5T54 A;  1TME 2;  1YCI A;  3TN9 3;  3VBO A;  3WDY A;  4LUL A;  2K2S A;  2ET7 A;  5LK5 A;  3WQ0 A;  1BBT 3;  1DZQ A;  1QOT A;  3FC0 A;  3TRS B;  1QXJ A;  3GCX A;  5A3N A;  5DAV A;  4FVV A;  5D8A A;  4E2Q A;  2HWD 1;  3N9L A;  3OOX A;  3POE A;  4OI4 A;  1KS5 A;  5KC5 A;  2VO5 A;  4YGB A;  3OYW B;  3VBF A;  2VOV A;  1JHJ A;  3NVC A;  4IGO A;  4CXY A;  4KGG A;  1OH3 A;  2ADE A;  4QB1 A;  3E6B A;  3P6B A;  4LO6 B;  2BFU S;  2CWM A;  3SLI A;  2GH8 A;  1ZRI A;  2E7Q A;  4MUV A;  5JOW A;  4BWO A;  1JW6 A;  5FZ6 A;  5A32 B;  1AR8 3;  3LDK A;  4E4H A;  1R09 3;  4DY3 A;  4XF1 A;  5LA2 A;  1JHN A;  4P08 A;  3C7G A;  3VBR C;  2P5B A;  5K8S A;  3AZX A;  4XJU A;  1T6G C;  4R8H A;  4Y1U A;  1UYX A;  3K46 A;  4GUL A;  2ZKL A;  5C3P A;  1UOG A;  4LA2 A;  2DVF A;  2VZ1 A;  2BW8 A;  3AKS A;  1OHF A;  2EID A;  2FCU A;  1NA1 A;  3IPV B;  3MIE A;  2WS9 1;  1K12 A;  4GWI A;  1LUL A;  3ASI A;  1BEV 3;  5FP3 A;  2W1U A;  4AVT A;  3JD7 2;  4XFB A;  1QJX 2;  3ZMN A;  1W9T A;  3NAP C;  1R1A 3;  2P3Y A;  1D7P M;  4XHB A;  2JDZ A;  1S0B A;  2ZGL A;  1VBA 2;  4QM9 A;  4XIL A;  2LM3 A;  4QKN A;  3IB3 A;  1CAU A;  2GND A;  5DAP A;  1U5Y A;  3PU8 A;  3VZL A;  3PDQ A;  1V6N A;  4LBJ A;  3UKV A;  1WW6 A;  1DYO A;  1U12 A;  2PHX A;  4K7J A;  3ZFE B;  4ARY A;  4QXK A;  4BIF A;  2LRP A;  1OT5 A;  4XJ9 A;  2RR1 1;  2A3X A;  3AKQ A;  4OLL A;  1SBF A;  4MGZ E;  3VBU A;  3ZXE A;  3ELN A;  2W1S A;  4ISQ A;  3PME A;  3HNB M;  3OGR A;  3ZN6 A;  5BNP A;  2VCC A;  3A4U A;  4J25 A;  1CWP A;  3DPR B;  2B9U A;  1LTE A;  2YC0 A;  4Y26 A;  5ERL A;  3WV6 A;  4Q0Q A;  4OHY A;  3ILF A;  1AR7 1;  3CKH A;  3VBS C;  2VNR A;  2VNO A;  1J59 A;  1VMF A;  3N9N A;  2VXR A;  5BNN C;  3DGT A;  5I8T A;  1Y7B A;  2IXH A;  3HPN A;  3G7D A;  1GUI A;  1V6O A;  4UFJ A;  4L97 A;  5IVY A;  3RYK A;  3VHR A;  4WVV A;  2VQ0 A;  5JR2 A;  3FN9 A;  3ZVX A;  4JGY A;  1UIJ A;  1N47 A;  2ORZ A;  4ZZ8 A;  3TN9 2;  4JKM A;  1N3P A;  2VBB A;  4NO4 A;  4AHW A;  1GQG A;  2J7M A;  4Y22 A;  2E53 A;  2VY0 A;  4WM7 C;  2DCZ A;  5LK7 B;  2RG4 A;  4H7M A;  2ZEX A;  1W0O A;  4MV2 A;  4PJY A;  1DFQ A;  5F2W A;  1X9P A;  2QBX A;  2CHH A;  2YFU A;  5A7P A;  2KA3 A;  3UKN A;  1TEI A;  1VBD 3;  5DAW A;  2RJK A;  3GF6 A;  5JAX A;  1ZRE A;  3OBA A;  3OTF A;  4CU8 A;  1PVC 3;  2WO3 A;  2WQ8 A;  1US3 A;  3ABZ A;  4MGQ A;  2Y60 A;  4QT6 A;  2Z69 A;  2ZMK A;  4XUN A;  5FR3 A;  1LNS A;  3Q8C A;  2OX0 A;  3WDX A;  4CDU C;  1R09 2;  1RUI 2;  3O12 A;  2JG8 C;  4KG0 A;  2ZGQ A;  4AED A;  4DXS A;  4I2O A;  1V6L A;  3PL0 A;  1ODM A;  3JB4 C;  4LBO A;  5FZF A;  1QQP 3;  4GH4 C;  2WT1 A;  1K3I A;  2BFU L;  3ZXD A;  3WNM A;  1Y9Q A;  1QJY 3;  3IBM A;  4JGZ C;  5HI0 A;  4FSJ A;  4UFI A;  4YZ2 A;  3V0B B;  4PIZ A;  2HWF 2;  3AJY A;  3KB5 A;  5J36 A;  5H9S A;  4TYS A;  2FD8 A;  3C7H A;  2EAL A;  4COU A;  3WG2 A;  1R1A 2;  3AL6 A;  4OQ8 A;  4RS5 C;  3SH5 A;  1ZZB A;  3VKL A;  3DUI A;  3KGL A;  4TTG A;  3OYW A;  1MZ5 A;  2ET1 A;  2WL1 A;  3OCP A;  5BUV A;  1FPN 1;  4HET A;  4KBB A;  4SBV A;  4XCB A;  3WHU A;  1WD3 A;  3GCW A;  3AZZ A;  3UGH A;  4XUO A;  3J4U H;  2HEV F;  1RIN A;  5ACA 1;  4AEM A;  1DDL A;  1YJL A;  1ND3 A;  2VEC A;  3KQ4 B;  1DGW X;  4BCU A;  5A32 A;  2JDU A;  1RHI 3;  2QJV A;  3SIS A;  4M0N A;  4W6X A;  4QPI C;  3A21 A;  3NNG A;  5IK7 A;  1A6C A;  3S5Q A;  1ZYB A;  1MS8 A;  1C5I A;  3DF0 A;  3RJR A;  2K9Z A;  2D3P A;  2ERF A;  2JE9 A;  2VZQ A;  3DN7 A;  1QGL A;  3JBG 3;  4MX3 A;  3ZXA C;  4URA A;  3TB0 A;  1IS6 A;  3IPV A;  4N43 C;  4XFH A;  1MEC 1;  1REE A;  4H14 A;  5DZG A;  3I8T A;  5F37 A;  3C7F A;  3KVA A;  4YSF A;  3BU0 A;  4RHV 1;  3WDT A;  5J7M A;  2HYK A;  2J1R A;  1VAV A;  2WAA A;  4XF9 A;  4AGV A;  5BNN B;  3ZYR A;  5A6X A;  1FMD 2;  1GP6 A;  3H8U A;  3W21 A;  4CPB A;  4YG6 A;  1QIQ A;  2FZ2 A;  1QJE A;  3HAG A;  4XJ8 A;  2YXS A;  2VNV A;  3LE0 A;  2DFC A;  5A6Y A;  5IVE A;  5C8W A;  4DUX A;  2YUE A;  5HPO A;  3ZFE A;  2XPJ A;  1RJ8 A;  2I45 A;  3T2P A;  3B93 A;  3BB6 A;  4FOW A;  3BYW A;  4FP3 A;  4BQ3 A;  1PVC 2;  1AUY A;  4MGK E;  4Z92 B;  1YLL A;  4CSW A;  1GFF 2;  1DLL A;  1W05 A;  3EB7 A;  1FOD 2;  2A75 A;  4QX5 A;  5E16 A;  5FMC A;  5IUQ A;  5LW9 A;  3ZPO A;  2Y8K A;  2CV6 A;  4TZD A;  2PHD A;  5A7Q A;  3RNS A;  3DPR A;  1W2U A;  2JXA A;  2XOM A;  1N3O A;  2ZOE B;  4FPO B;  1O91 A;  4AI9 A;  4FPH A;  4NHL A;  3AYD A;  4UOJ A;  2ARC A;  2QZ2 A;  2WRA A;  2DVG A;  4ES8 A;  4PQ9 A;  4CDU B;  2BZD A;  4NN0 A;  4EQV A;  1QJY 2;  3WF1 A;  2JG8 B;  3H3U A;  2VG9 A;  4MAD A;  2UUR A;  2ZMN A;  3JCI A;  1EP0 A;  2QQV A;  4EN7 B;  5JVV A;  2B4K A;  1UKR A;  1UMI A;  3BPS A;  2PAK A;  4JGZ B;  3MZH A;  4A4A A;  3VZK A;  3FE5 A;  2FMD A;  2ZEW A;  3D0S A;  5FRE A;  5KWR A;  1G86 A;  3MUZ 1;  4SLI A;  3I59 B;  1W6N B;  1G9F A;  1BMV 2;  1ZZ9 A;  4HK9 A;  1UXX X;  1UZY A;  2ENR A;  3H50 A;  2E9Q A;  4LBQ D;  4NHY A;  4BA6 A;  3AYE A;  3OEB A;  4TSV A;  2GN3 A;  2CY6 A;  2KD7 A;  4AYU A;  4E4S A;  1NY7 2;  1H30 A;  1VB4 A;  4N8M A;  3ZOI A;  2ZAB A;  2W5F A;  2PLV 3;  4PQQ A;  4CP0 A;  4E27 A;  1D2Q A;  1VMJ A;  2RMU 3;  2HYX A;  1AL2 2;  4I09 A;  4J1X A;  5AC9 2;  5I8Y A;  2DUO A;  2BEO A;  1UOJ A;  1ASJ 1;  3HNM A;  3MYX A;  2PA7 A;  2VOK A;  3RFR A;  3OBZ A;  1LGN A;  1H6Y A;  3JBG 2;  1PO2 3;  3POJ A;  4S2F A;  4NPM A;  4BYY A;  4Z2A A;  1V70 A;  2RS1 2;  1ZZC A;  5FLH A;  4QPI B;  2MEV 1;  3URF A;  1QJU 1;  1FT9 A;  2KR2 A;  4Q4V 3;  3VBR A;  4AZZ A;  3V0B A;  1EUU A;  1SHW B;  1HRV 2;  1QHD A;  4GIQ A;  4YW4 A;  5E8A A;  2C9A A;  3M3Q A;  3A23 A;  3AZW A;  1YHF A;  3WIN E;  3ALQ A;  2GME A;  4N43 B;  3VDA A;  4RFR B;  2XQR A;  4COY A;  1HB1 A;  4XQ4 A;  1RIR A;  3LZZ A;  3U75 A;  1H9P A;  5CYY A;  1FAT A;  3AP6 A;  1JZ5 A;  2RS5 3;  4P9I A;  3LOI A;  3UK9 A;  4AR2 A;  4GWM A;  2OA2 A;  3MID A;  3NAP A;  3WNX A;  1ZBE 3;  1I9R A;  5FYT A;  4DUW A;  2XHN A;  2O14 A;  4YGE A;  3GM8 A;  1PGL 2;  2CYF A;  1H1I A;  5GLT A;  2WAB A;  5FLJ A;  1W90 A;  4W50 A;  5KBF A;  4WVZ A;  1S0I A;  1Y9G A;  5CBL A;  1CPN A;  3I3D A;  4YAR A;  2YPD A;  1VLN A;  3I2F A;  3MLK A;  4FXG B;  3D3A A;  1IQA A;  1O8P A;  1XSR A;  2ADD A;  3ILN A;  4YZ4 A;  3VD5 A;  1AYM 2;  4Y4Y A;  2B8M A;  3HIF A;  1YEW A;  2O8Q A;  2CGP A;  4CUG A;  1R08 3;  4BXF A;  1H2L A;  4RGA A;  3KF3 A;  1ZA7 A;  1LOA A;  4XAE A;  1MZ6 A;  1C8N A;  3ATG A;  3PU3 A;  2BVV A;  1OLM E;  2XJU A;  1GOG A;  5FYV A;  3RVH A;  1SLT A;  1BBT 1;  1HXS 3;  3I2J A;  3MDP A;  4YWA A;  1Z7S 3;  3VBS A;  1KFX L;  3VD7 A;  1H2K A;  4CA9 A;  5BNN A;  4AAX A;  2ZS6 B;  3KT1 A;  2WFF 2;  4KGQ A;  1LB2 A;  3IN9 A;  2BGC A;  3AC0 A;  4QKB A;  1QDC A;  4YFW A;  1BQP A;  1W9Y A;  3GAL A;  4XPV A;  3FL7 A;  3B94 A;  2OII A;  1OLR A;  2WZR 3;  3GBF A;  1S0J A;  3N9O A;  4Z1V A;  2D98 A;  5CFD C;  2ARA A;  4EZ4 A;  3CZJ A;  1VBB 2;  5B2G B;  2HWD 3;  3BKZ A;  2XUM A;  4WM7 A;  1W0N A;  4KWL A;  4QPW A;  1U5X A;  1JUH A;  3WCS A;  2JG9 B;  1JTZ X;  2DUR A;  5JXG A;  4IEU A;  4NIG A;  5BY5 A;  2PLV 2;  4H7L A;  2R04 1;  2BBV A;  1WLD A;  2D6L X;  1N1S A;  2V72 A;  4QX3 A;  3MIC A;  5G05 L;  3PVO A;  3ZYB A;  4DY5 A;  1PO2 2;  3KLS A;  1VBE 1;  4JRA A;  4MSV A;  1F5J A;  1YWK A;  2VVD A;  4CDU A;  5F7U A;  2DU0 A;  2JG8 A;  1XJA A;  1BEV 1;  4C0B A;  4Q4V 2;  4QPG B;  4XIK A;  5E1R A;  4AI2 A;  2R1B A;  3BOD A;  2P37 A;  3EBR A;  4MVT A;  2JKB A;  4FT8 A;  2OUJ A;  5K7P A;  1DGR A;  1K5J A;  2WS9 3;  4R9A A;  2W1Q A;  4NRM A;  1OQ1 A;  2FDJ A;  2XR4 A;  5H9Q A;  2XVL A;  4JGZ A;  3WY6 A;  5JZG C;  2PTM A;  5A3L A;  2VJX A;  2DYC A;  1KJR A;  1NG0 A;  1ZBA 2;  2RDS A;  4NOT A;  3I59 A;  1W6N A;  2OT7 A;  3AMH A;  4DOU A;  3I2O A;  1S0G A;  1JZ4 A;  1UO9 A;  2W68 A;  1ZBE 2;  4LKS A;  2D5F A;  1J3Q A;  1NUK A;  1V6I A;  1WCK A;  1UZ0 A;  3MFC A;  4JHZ A;  4ZS3 A;  4RS5 A;  2VXJ A;  5A7O A;  1PO1 1;  2ZTN A;  4JDO A;  3L2H A;  4XCA A;  3U78 A;  2J42 A;  4OI1 A;  3WOG A;  1LOF C;  1SFN A;  1W6O B;  2GC2 A;  4OHZ A;  3KGZ A;  4Q4W 1;  1SBD A;  5FJH A;  1KRI A;  4LPL A;  1F4H A;  4QXC A;  5A3M A;  5FLI A;  5GAL A;  3SKJ E;  2RR1 3;  1M4W A;  2PHU A;  5DAX A;  3IMM A;  1JYN A;  3GYD A;  1RVF 1;  2OW4 A;  1TE1 B;  2VMF A;  5CVR A;  1S2E A;  5A7S A;  5C4W C;  1SLA A;  2IZW A;  4QPI A;  5F5C A;  1K45 A;  3OUJ A;  3WVJ A;  2ZGR A;  1AR7 3;  2TUN A;  4JRL A;  4AVS A;  4COW A;  3AP5 A;  2E32 A;  2Y33 A;  3NV4 A;  1WGP A;  2YYO A;  3T2T A;  2W94 A;  1LGB A;  1C8M 2;  1GQP A;  4N43 A;  5FOJ B;  1UY0 A;  1XBF A;  3USU A;  2AUY A;  3POB A;  4QHO A;  1Z0H A;  5FMB A;  3ZSM A;  2VQT A;  4Z82 A;  3Q8B A;  1VB2 A;  3ZR6 A;  4FTE A;  3J7L A;  4ZKT B;  5IWF A;  2WNU B;  4E8D A;  1V0A A;  2Q1Z B;  4QKF A;  4FFG A;  5A3T A;  3N9M A;  4IEV A;  4CDX B;  4KWJ A;  2FBE A;  1S55 A;  3PVN A;  2HWD 2;  2WZ8 A;  1IHM A;  3VHP A;  5LY1 A;  3VV1 A;  1VMH A;  1BK0 A;  5C3Q A;  2ES3 A;  4CCD A;  2DCK A;  4OHW A;  2W52 A;  5FPU A;  5CFD B;  3FMG A;  2WR9 A;  4BQW A;  5CIS A;  3LGR A;  2ZAH A;  4JV4 A;  3OG2 A;  1BLZ A;  4U2A A;  3RZZ A;  4HSJ A;  3NL1 A;  2UWC A;  2OS2 A;  1UX7 A;  2E31 A;  2K46 A;  5CG8 A;  5LBE A;  3F2Z A;  4TN7 A;  4JC1 A;  1RUJ 2;  4Y33 A;  4MYE A;  1XSQ A;  4OQ9 A;  2E26 A;  1AX2 A;  5KHJ A;  1UCX A;  1URX A;  2BOJ A;  4OCT A;  1ZRC A;  1HV1 A;  2I07 B;  3MLJ A;  4Q4Y 2;  3SCG A;  4I02 A;  4CCN A;  4BMB A;  5DAB A;  3DEC A;  1NLQ A;  1A3K A;  2W39 A;  3FHA A;  1E5H A;  2WS9 2;  4XFG A;  3K51 A;  2PFW A;  4Y5T A;  3H1M A;  2P3I A;  3T3Y A;  5IAT A;  3PUI A;  4AFA A;  2YU2 A;  4IV1 C;  4GWJ A;  4Z8B A;  3KWV A;  1AL0 G;  2R30 A;  4YW2 A;  3CJI C;  4ES9 A;  3O1O A;  1RUD 2;  2UYA A;  4MGS A;  3ZYF A;  5A6Q A;  1H9W A;  1GZW B;  4M00 A;  1B35 C;  2G4I A;  3OGJ A;  2J1T A;  3MPB A;  1FX5 A;  1XNC A;  3D4K A;  3UYJ A;  1F15 A;  1O3S A;  3O5S A;  4BQ5 A;  1FPN 3;  5LEK A;  2JG9 A;  1RUE 1;  3JU9 A;  1C5H A;  5HCA A;  1XE7 A;  3RYP A;  1GIC A;  4B8E A;  5ACA 3;  4Q4X 1;  4XDO A;  1OSG A;  1L7L A;  3N7J A;  2EIG A;  1NKG A;  5ANQ A;  4YVS C;  2RM2 1;  2ARE A;  1RB8 G;  3I7D A;  1ZM1 A;  4HK8 A;  1WLW A;  1OUR A;  1I5Z A;  4CDQ C;  3VHO A;  1E5R A;  3LA7 A;  1F5F A;  2VC9 A;  4QPG A;  5CAZ A;  2WDB A;  4NR1 A;  3RI9 A;  1W28 A;  5FZ1 A;  1AR7 2;  4NIH A;  2VW2 A;  3JQX A;  5IFP A;  3OUH A;  4Q0V A;  3UL2 A;  1FXZ A;  2DVA A;  1TMF 2;  3GJA A;  2OUH A;  2B7Y A;  3OEA A;  4RD7 A;  4C1W A;  1F8V A;  3RJ2 X;  1MQT C;  3THT A;  5C4W B;  4CP1 A;  3CNA A;  4URT A;  5LB6 A;  2UYB A;  1R1Z A;  2HWB 1;  4RHV 3;  3SH3 A;  1I3H A;  3A0K A;  3BAL A;  5FZI A;  4BHP A;  3ZKU A;  4ISR A;  4XFI A;  4XOG A;  1W8N A;  4QDQ A;  1HQL A;  1PGS A;  1SQ4 A;  3PIJ A;  5KHH A;  3OF1 A;  1X9T A;  1W6O A;  1BHG A;  1PX3 A;  5T50 A;  3KMH A;  3RMY A;  4ZHN A;  1REF A;  2CAV A;  4OZO A;  1SG3 A;  4Y3O A;  4CEY B;  3BTY A;  1X50 A;  1CPM A;  4AFD A;  3LEK A;  3GJB A;  2A6Y A;  3NMB A;  1LR5 A;  3BVC A;  1Q56 A;  4LR4 A;  3RYR A;  4QU1 A;  2VZV A;  2CSG A;  4K8R B;  1AR9 1;  3OPT A;  5GKA C;  5BNQ A;  3WX5 A;  5A1L A;  2ZHN A;  4IV3 C;  4NE9 A;  3E6C C;  3T0D A;  4IDZ A;  2GH2 A;  1UL9 A;  1PZ9 A;  4V2V A;  3VBH C;  5AVA A;  1KS4 A;  2W46 A;  3KS7 A;  2ZHL A;  4GKY A;  4MO3 M;  4HZF A;  3FFQ A;  4IE0 A;  5ANN A;  3ROU A;  4DMI A;  1BYH A;  1J1T A;  4FFI A;  4NII A;  5C9A C;  1SLI A;  2EIC A;  3M1H A;  2RDN A;  5AFB A;  3CL1 A;  4E2G A;  4Q29 A;  2VZU A;  4LBQ B;  3JUU A;  4UFH A;  4OI2 A;  4R4X A;  2OPK A;  1ZZ8 A;  2JX9 A;  5F6K A;  4K1Z A;  5J1X A;  4IEW A;  1PZ8 A;  1WME A;  5FYI A;  2X29 A;  1GV9 A;  5JUV A;  1JYX A;  1CGP A;  2E6V A;  3SIT A;  4IV1 B;  4MHR A;  1C57 A;  1QY4 A;  4IEP A;  4RR3 C;  4HVQ A;  1GQH A;  4NJ4 A;  4HL0 A;  3AXE A;  1PGW 1;  3CJI B;  5CFD A;  5T55 A;  4DUV A;  2BER A;  3AK0 A;  3HQU A;  3ZDS A;  1G6N A;  3POS A;  1B35 B;  5ACA 2;  1J3R A;  2VTF A;  4NAM A;  4Q1R A;  2GDF A;  1BKZ A;  2HKX A;  1SLC A;  1FNY A;  1CQ9 A;  2FHR A;  3Q8A A;  4FOY A;  2VMD A;  3LQC A;  4YNI A;  4CYD A;  3ACG A;  3MIH A;  2HEY F;  3POF A;  1LES A;  1W6P B;  2XHK A;  1ZRF A;  2ZJC A;  4BLJ A;  3R05 A;  2TBV A;  4YVS B;  2J1A A;  5T5P A;  4C8D A;  3U4X A;  1MEC 2;  5FYC A;  2MEV 3;  2QZ3 A;  1DCS A;  3TNP B;  1QJU 3;  3HQX A;  1AF9 A;  3K3O A;  2Z2S B;  3K4D A;  3ORJ A;  3NJX A;  1SDW A;  4P9G A;  4XET A;  4IE5 A;  3MGU A;  2DUP A;  4RHV 2;  3KCY A;  2HEW F;  3PNA A;  4OI0 A;  4GB3 2;  4HVO A;  2W3J A;  4BOW A;  4BPZ A;  3UGG A;  5K9Y A;  5L36 A;  4DIQ A;  4YW7 A;  3R0R A;  1GZW A;  2C9K A;  2FZ1 A;  2RS3 1;  4BJ0 A;  2JKX A;  1RUN A;  3S7E A;  4NUB A;  4IND A;  2OZJ A;  3AM2 A;  2G9Z A;  1QH6 A;  4Q0P A;  4XXA A;  1O4Z A;  3USS A;  5KXD A;  1V6J A;  2CGN A;  2YMZ A;  3ACI A;  3MW4 A;  3J8F 1;  2NLR A;  1IKQ A;  1POV 0;  4AFC A;  2VCM A;  4LHK A;  1LOF A;  1XPW A;  1X82 A;  4XXP A;  4BU2 A;  3ZYP A;  4BLI A;  1JU3 A;  1XE0 A;  3AKP A;  4YM2 A;  1RTV A;  1ZA4 A;  5KHI A;  5LCW L;  3BI3 A;  4XJA A;  1HXS 1;  1WUV A;  3I49 A;  3SCF A;  3JQW A;  2OYZ A;  2C6S A;  3WZ1 A;  1W0P A;  1YQC A;  5HCB A;  2GAU A;  4NRO A;  4QD2 A;  3H8X A;  5C4W A;  3RPQ A;  4CU7 A;  1NYW A;  2DVD A;  2WZR 1;  4IV3 B;  4LE4 A;  4PDW B;  2V5Y A;  4OUM A;  1J58 A;  4QB2 A;  4BH9 A;  5C71 A;  3EMR A;  1IS5 A;  3HOB A;  4HN0 A;  3FBY A;  1MS1 A;  1WW4 A;  5C9A B;  5APA A;  2CGO A;  3QH6 A;  3GGL A;  1LOE A;  2JDK A;  4I0B A;  4PLO A;  3ZXG A;  4B7K A;  1UZZ A;  1V6M A;  3IDB B;  5JIA A;  3WF0 A;  2BWC A;  2VZT A;  5CIR A;  4LTA A;  4TLG A;  4GAL A;  3E6D A;  5D1I A;  3VD3 A;  4QKD A;  5I8S A;  5F6L B;  4YFZ A;  3B3Q E;  1ND3 B;  4CEY A;  4CEW C;  3BTX A;  3QCW A;  4XJW A;  3O0V A;  3WNK A;  1OD3 A;  2VQU A;  4KBZ A;  3MI8 A;  1FI2 A;  1RXG A;  1QDO A;  1WCD J;  1ZVF A;  2HWC 2;  2XWJ B;  4QQO A;  3OD0 A;  4RR3 B;  1TQ5 A;  4XFF A;  4Y1X A;  5CZK A;  3FFZ A;  3UV9 A;  2ZGS A;  1H2N A;  2NMO A;  2R04 3;  1D4M 1;  5ISL A;  4GKX A;  1N1Y A;  2N7G A;  2LW8 A;  3OBT A;  4S2D A;  1ASJ 2;  1A78 A;  4EWE A;  3WT3 A;  4Q5O A;  2XH6 A;  3ACF A;  1IG0 A;  1ENQ A;  1W9W A;  1VBE 3;  3T09 A;  3D6E A;  1PIV 1;  3VL8 A;  4EYU A;  4O7X A;  1F4A A;  1UYZ A;  2MEV 2;  2VZR A;  4X6R B;  1IZ3 A;  1D2S A;  4K3U A;  5FZ7 A;  2XJS A;  4XIO A;  3UNP A;  2X05 A;  1OQE A;  5FZH A;  3OBR A;  3ZFF C;  1WW5 A;  2VTX A;  4LBQ A;  3ZXF A;  3CZU A;  1QWR A;  3O0W A;  4M0H A;  4YM3 A;  3T08 A;  5FZM A;  3KZ4 C;  3QOP A;  1NLS A;  1QH7 A;  2DF7 A;  3N35 A;  4UF0 B;  5K4L A;  1C1L A;  4PI0 A;  5CKM A;  1HX6 A;  1FV2 A;  1PX4 A;  3HVD A;  4D69 A;  3CBN A;  4QQ2 A;  4IV1 A;  1IKP A;  1EV1 2;  5FUN A;  1PK6 C;  2VZO A;  3SNM A;  5FP4 A;  3X29 B;  1ULD A;  3MO4 A;  1YFW A;  2XXZ A;  3RQ0 A;  4HXC A;  3U11 A;  3CJI A;  4W6Y A;  2JJ6 A;  3B7M A;  5F8P A;  5H9R A;  1B35 A;  1PO1 3;  3O1P A;  2WN3 A;  4N90 A;  5IVV A;  3UES A;  4Q4W 3;  4HT1 T;  5GZG A;  1NQD A;  2Q1M A;  2WJS A;  2JDP A;  3GZU C;  5FY4 A;  1XOY A;  4AQ6 A;  4UW6 A;  2KM2 A;  2DWR A;  5JMC A;  1W6P A;  5LBC A;  1RVF 3;  5JSP A;  4W65 A;  5FZA A;  4YVS A;  3VKO A;  3N7M A;  1WWY A;  2DTW A;  2J1V A;  4GZ9 A;  3LFI A;  3N7L A;  4LHN A;  1VAM A;  1W04 A;  2W0X A;  3FWE A;  3C8X A;  3EYP A;  3I97 A;  5FY0 A;  4CDQ A;  1VRH 1;  2IFW A;  2A6V A;  3N36 A;  3I2H A;  4G9S B;  3PJQ A;  4U36 A;  1BBT 2;  2D93 A;  3I2I A;  4XF0 A;  4AHX A;  3KQR A;  4RSU A;  1MQT A;  2LRO A;  4B7E A;  4XDP A;  5FO9 B;  5KXC A;  4J6G A;  3HEI A;  1UIK A;  4OUS A;  5FPV A;  2VVF A;  3KT4 A;  5LA9 A;  4AVC A;  2UY9 A;  4JCK A;  4D94 A;  5C33 A;  1OUS A;  5E6H A;  4YZ5 A;  4BIO A;  1YO8 A;  2D43 A;  4QQH A;  4E2S A;  4XMA A;  1L7Q A;  2WYS A;  3N9P A;  4BB3 A;  1AR8 2;  1AXZ A;  1EPZ A;  5A80 A;  5JOY A;  1QOO A;  3WW2 A;  1WW7 A;  4QDS A;  2PYT A;  4CEW B;  2RJ2 A;  4PT6 A;  4ATE A;  3T30 A;  5IVF A;  4L0P A;  2BJS A;  2NYY A;  5JI7 A;  4JVA A;  1NXM A;  1UPI A;  3VBR B;  3LFM A;  4UBH A;  1LEM A;  3E5U A;  2OPW A;  3ECQ A;  4P9J A;  1UY1 A;  1BEV 2;  5FFO C;  4Y1V A;  5LRR A;  2YZ4 A;  3U1X A;  4IV3 A;  4PDW A;  2DCY A;  3QD6 A;  5F32 A;  3POY A;  5FRA A;  3VBH A;  3LSD A;  1W2O A;  1WD4 A;  1W6Q B;  2XL7 A;  2Y6L A;  3QLQ A;  4P9Y A;  4AQS A;  3ZFG C;  4BQY A;  3O1M A;  3S0M A;  5C9A A;  4LEJ A;  1S0E A;  5FP7 A;  3ZXJ A;  4X6Q B;  5HV4 A;  3BTA A;  2Q5T A;  2DFB A;  3ZFF B;  4CTE A;  5IK8 A;  2WUH A;  3NAP B;  2VOX A;  4K6B A;  4QX8 A;  3THP A;  2AAC A;  5EYX A;  5GZD A;  2GMM A;  1SCR A;  2QCS B;  2F4P A;  4N7U A;  3MPP G;  3THD A;  3WW1 A;  4AQ2 A;  1IPJ A;  1CIY A;  2ZX4 A;  1OA3 A;  1PO1 2;  1GOF A;  1MS4 A;  1VPH A;  1JOB A;  1WLT A;  2Y34 A;  1RUE 3;  2C0Z A;  3AFG A;  4RR3 A;  4P00 B;  3NRU A;  2VNG A;  4B4R A;  3RI8 A;  1W2T A;  3AXD A;  3F95 A;  4CZS A;  1U5Z A;  4Q4X 3;  4R9D A;  1JH5 A;  2GU9 A;  3III A;  4UWD A;  1DP0 A;  4NMI A;  2RM2 3;  2IXJ A;  1A34 A;  4K1Y A;  4X8P A;  1ZRD A;  4E4D X;  2WT2 A;  1VBC 1;  4QGM A;  3W58 A;  3ZN5 A;  4LNV A;  3MV1 1;  3OGV A;  3VBS B;  5CFC C;  1WA4 A;  3AMM A;  5I0T A;  2JD9 A;  4D7Y A;  4JZR A;  4PBO A;  1GP5 A;  1LGC A;  2BNO A;  5EZW A;  1RED A;  2IXC A;  1KD7 A;  3UKT A;  4NWW A;  4UF0 A;  3ZXK A;  2UWB A;  2HWB 3;  2BBA A;  2BV4 A;  1DQ6 A;  4YW6 A;  1VBD 2;  5KXB A;  2C26 A;  2RDR A;  1MS3 A;  1DQ0 A;  1PMH X;  4WM7 B;  1WLC A;  3UET A;  4AWD A;  4PIY A;  5K0U C;  1H4H A;  2UY8 A;  3RWN A;  3WDU A;  1PHM A;  3ZYI B;  1GWL A;  3IAQ A;  5KHG A;  1QKQ A;  4L9B A;  2DUQ A;  4I30 A;  2W2I A;  4QQP A;  2XB6 C;  2NN8 A;  3KV9 A;  4OUE A;  4QX2 A;  5I0U A;  1QQP 2;  1WKY A;  1KQR A;  1XC6 A;  3W5M A;  2ZX1 A;  4Q1P A;  4OFG A;  3KHC A;  3S5A A;  1DBN A;  4JQR A;  3EJK A;  1J1L A;  4PIX A;  3WDW A;  1QXR A;  2DBI A;  4S2G A;  2G9F A;  1AR9 3;  1AR6 1;  2W95 A;  2A3W A;  3TNQ A;  5A3U A;  4GH4 B;  1BXH A;  2XML A;  3RG0 A;  4PI2 A;  1OXC A;  4UFM A;  4AVB A;  1GR3 A;  3KCC A;  3OGG A;  1ST8 A;  1UOB A;  2WYF A;  1IOA A;  4QHZ A;  2XBO 1;  3M7A A;  5IYY A;  4QX1 A;  2BVB A;  2FCV A;  5IFT A;  5DN2 A;  3O0X A;  4B29 A;  4C90 A;  3WLU A;  2JIC A;  2WA4 A;  2ZAA A;  3MF6 A;  4AE2 A;  4PLN A;  3SEE A;  4BQ2 A;  3K3N A;  3MFA A;  1PVX A;  4LJH A;  5FP9 A;  4RS5 B;  3ZFG B;  5HBA A;  2GC0 A;  2J1U A;  1PZ7 A;  2JEN A;  3HQR A;  1YI9 A;  1RHI 2;  4JKK A;  5L7O C;  1COV 3;  1HJG A;  2EXH A;  4BME A;  1S0F A;  5I93 A;  4C91 A;  1X33 A;  1EAH 1;  2DV9 A;  3BGA A;  3LSE A;  4J1W A;  1X7N A;  2R1D A;  4NHX A;  3BTZ A;  4UW5 A;  4FPG A;  4HPK B;  1X8E A;  3TWI A;  1CVN A;  2ZX0 A;  4CEW A;  2QNK A;  3BUC A;  5T5J A;  2QQP A;  4ZS2 A;  5M0T A;  2A5Z A;  2LUW A;  3WF3 A;  1DQ2 A;  3VDC A;  4AFM A;  1H8T C;  2ZGN A;  5FZ3 A;  1O3R A;  4AG4 A;  3OSD A;  1Y3T A;  2QQK A;  5FZO B;  2IC1 A;  2Y0I A;  1NAE A;  2QQI A;  3C3V A;  2ZZQ A;  2JDM A;  3OPW A;  4FPK A;  1CR7 A;  1SEF A;  4AW7 A;  3GBW A;  3KHB A;  5FZ8 A;  4D6R A;  1W6Q A;  3B5L B;  3USU B;  5H9P A;  1WBL A;  4LKE A;  4K8F A;  1EYB A;  4Q8K A;  2WNO A;  2HWB 2;  1QJF A;  5FMD A;  3ZFF A;  5CFC B;  3P5B A;  4QHB A;  5GM0 A;  3LIG A;  4LKF A;  4XYX A;  1JYI A;  1MS0 A;  4XBQ A;  1HB4 A;  1LU2 A;  3MLL A;  4BE3 A;  1UX6 A;  4RFT 0;  3JD7 1;  4KWK A;  2RS3 3;  3ZDV A;  2JB8 A;  3ES1 A;  4QGN A;  5J3U A;  3M4F A;  1NCQ C;  3T4V A;  1ZX5 A;  3IM0 A;  3ACL A;  1PNF A;  3PUA A;  1KEX A;  1UMZ A;  2A73 B;  2ZX3 A;  2R49 A;  3NQH A;  5FP8 A;  1Q8S A;  1LCL A;  2JIJ A;  4LOS A;  3GDB A;  4A41 A;  1OKQ A;  1SFY A;  2X09 A;  3CJX A;  3J8F 3;  5FZB A;  2WZP P;  3ZSE A;  4GJZ A;  3PUH A;  1TVG A;  3RRD A;  4YZ1 A;  1ND2 C;  1CX4 A;  2PAE A;  5FUP A;  2QQO A;  5A1A A;  2XLG A;  1UWW A;  1OPO A;  4XEZ A;  4JX0 A;  2YDE A;  4IES A;  1YI7 A;  4AEK A;  2QQL A;  2WSU A;  5F3C A;  4ASM B;  5DZE A;  4GQ7 A;  4JDM A;  1W2N A;  4IER A;  1GZC A;  2VOW A;  2OKX A;  3WP3 A;  4LXL A;  5D21 A;  2LAL A;  2ARB A;  2X5I C;  2F17 A;  3A7Q A;  2D97 A;  4GA9 A;  4XQD A;  5FO7 B;  1DF0 A;  3UT0 A;  5FY1 A;  3MUY 1;  2WZE A;  4MLO A;  3E97 A;  1HIX A;  3BOW A;  4AHY A;  2VU9 A;  3AKR A;  2A71 A;  2WO7 A;  3GHN A;  3LAG A;  3LDB A;  2QUO A;  4AI1 A;  1CAX B;  4FPY A;  1OC1 A;  3OB8 A;  2RMU 2;  2FCT A;  4A6O A;  5FK8 A;  2XWB B;  5LAS A;  3WF2 A;  1UZW A;  4JHT A;  4K21 A;  4ZXE A;  4YYO A;  1XE8 A;  5DAQ A;  5FPB A;  5L7O B;  3UGF A;  4FPJ A;  4LO8 A;  4CXW A;  5FDB A;  1DG6 A;  3CDZ B;  3KV4 A;  1JZ6 A;  1D4M 3;  2CL2 A;  1GSL A;  4EZH A;  4RN5 A;  1O5U A;  4GH4 A;  3L2Y A;  4K20 A;  2OVU A;  1ONA A;  3LPG A;  4Y5Z 0;  2UWA A;  1RUI 1;  1UN1 A;  1Q8P A;  5KC6 A;  1W8F A;  3TEW A;  4XBN A;  2VTX J;  1MVQ A;  1PIV 3;  1H8T B;  2VBP A;  3IZO A;  5DXD A;  1US2 A;  3OGS A;  2WO1 A;  1H1M A;  2XQX A;  1YXW A;  2RS5 2;  5JXI A;  4QQL A;  4B4P A;  4L11 A;  1PMI A;  1S2B A;  4XZP A;  2FQP A;  3ZSL A;  5DG2 A;  3FLP A;  2GNM A;  2HWF 1;  5HXV A;  4A7Y A;  2PHT A;  4QU2 A;  4RQP C;  3ZFG A;  1WCS A;  4NVP A;  3FLT A;  2RS3 2;  3HN1 A;  3NV2 A;  4ASL A;  4WM8 C;  2Y0O A;  3AFK A;  1W2A X;  2V5D A;  5C70 A;  2YB7 A;  2QDR A;  1OA4 A;  1UU5 A;  1MR5 A;  2Q30 A;  3VKN A;  2V4A A;  4HPK A;  5IK5 A;  3WP4 A;  4N53 C;  3NJV A;  4A3Z A;  1ALY A;  3C7O A;  1R08 2;  4UT5 A;  2NP0 A;  4YW3 A;  2XGX A;  4I0A A;  3B69 A;  3PTR B;  4ASK A;  5FJK A;  3AL5 A;  5FMO S;  5JOX A;  2BNM A;  1EPW A;  3AB0 A;  1LED A;  5A33 B;  2D40 A;  4HKO A;  4P02 B;  5F5I A;  1L7R A;  3AMP A;  1AJK A;  3I3B A;  4YGC A;  1UKG A;  1UOF A;  1HXS 2;  1RMU 1;  3POG A;  5FZO A;  3SEP A;  1Z7S 2;  3U07 A;  3W9A A;  3ZIW A;  3FUQ A;  2GNB A;  4CCK A;  1ULE A;  3HT2 A;  2WLQ A;  3VZM A;  2QQJ A;  1WCU A;  1QEX A;  3K4Z A;  4M3C F;  2JE8 A;  5GZC A;  3NW4 A;  3VZN A;  3LEM A;  4E4Z A;  1VRH 3;  2R06 1;  2VCB A;  4GMP 1;  4HKL A;  5JR7 B;  4M4R A;  3ZR5 A;  2WZR 2;  2VM9 A;  3I2D A;  4LOT A;  3RZG A;  5CFC A;  3AX4 A;  4NAO A;  3WR0 A;  4HAN A;  4IET A;  4AF9 A;  2XKP A;  2XON A;  3LIH A;  4XUR A;  4NID A;  1ULG A;  3DXU A;  2BRT A;  4CDW C;  5CAD A;  5DUU A;  1UZV A;  1UY4 A;  3ZLI A;  5JLV A;  2Q0A A;  1FMD 1;  4MET A;  4D7S A;  3VD9 A;  4KG8 A;  2A1X A;  3ST7 A;  2X5I B;  5ABJ C;  4BZ4 A;  4M3C E;  4LO7 A;  2FDG A;  4WBB A;  5K0U A;  5J48 A;  1JMU B;  1RUG 1;  5A3P A;  2VW1 A;  1KFU L;  1LHU A;  3ME2 A;  4OMD A;  1GZ9 A;  2PEL A;  1JU4 A;  3AYA A;  2NMN A;  3OPZ A;  4Q8L A;  4FBF A;  4R4Z A;  1D4M 2;  2O0O A;  3TOJ A;  1FOD 1;  3PHM A;  4ZON A;  4Y1Z A;  1Y43 B;  4BQX A;  2H6C A;  4DZG A;  1MS9 A;  2EIB A;  2ZXQ A;  1K5M C;  3AP4 A;  3WW4 A;  2AC1 A;  4O9E A;  4HLT A;  1CAV B;  4LO5 B;  3W59 A;  4ZZ5 A;  3WG3 A;  1GLH A;  5JZG B;  1T2X A;  4AFB A;  1UMH A;  4LIT A;  5FYS A;  4YM0 A;  1DGL A;  1TNR A;  4D6S A;  2EXI A;  2ZGP A;  3D82 A;  4XTP A;  2Q8E A;  1CAX A;  1XRU A;  2RR1 2;  5KR7 A;  1LOD A;  1O3Q A;  2XUE A;  2P3K A;  5FAX A;  1BMV 1;  4LO4 B;  3VL9 A;  1KDK A;  3V65 A;  5L7O A;  2PHW A;  4BIS A;  3NNL A;  1JYT A;  2QFE A; 
#chains in the Genus database with same CATH homology
 3ZYH A;  4CP9 B;  2LRO A;  1W8W A;  2Q1F A;  3ZYF A;  4YWA A;  4CPB D;  1W8U A;  1UOJ A;  1OH3 A;  4LK7 A;  3ORJ A;  2O14 A;  4YW6 A;  2VXJ A;  4LKF A;  3ZYB A;  4BQ3 A;  2K46 A;  1GWM A;  1W90 A;  1WCU A;  3F95 A;  1WZX A;  4LK6 A;  4BQ5 A;  1GWK A;  1HN0 A;  2WYF A;  2JWP A;  1W8T A;  1WMX A;  2KR2 A;  4CP9 A;  4A6S A;  1V0A A;  1GWL A;  4LKD A;  4YW7 A;  4LKE A;  1L7L A;  2C24 A;  5D21 A;  4BQ2 A;  2LRP A;  4AL9 A;  4LJH A;  1OKO A;  3UT0 A;  4CPB A;  4BQ4 A;  1W8Z A;  1W9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...