3N35A

Erythrina corallodendron lectin mutant (y106g) with n-acetylgalactosamine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
242
structure length
242
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGGGYLGIFNNSKQDNSYQTLGVEFDTFSNQWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPETND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Modification of the sugar specificity of a plant lectin: structural studies on a point mutant of Erythrina corallodendron lectin.
pubmed doi rcsb
source organism Erythrina corallodendron
molecule tags Sugar binding protein
total genus 50
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n35A00
1FNYA 1GZWB 3SNMA 3NV2A 3SLIA 1KRIA 3VKFC 1N1TA 5CBLA 3QLQA 3VUOA 3AZXA 4FPLA 3RMYA 3N7KA 3BTAA 3ZSLA 4YM0A 4ISQA 1GICA 2JJ6A 2V73A 1H9WA 2BQPA 2EAKA 3AZZA 3USUB 4P14A 2H0BA 2DVAA 4FOWA 1S0CA 4DQAA 4YLZA 5CA6A 1JYIA 4HL0A 4BLJA 4C1WA 4XE9A 3WDXA 4FOQA 4XJWA 4KBBA 3U4XA 1H9PA 4YM1A 1WCSA 4R9DA 2VW0A 4Q8KA 2YV8A 5AVAA 5IK4A 5DUUA 4BMEA 1DQ5A 2ARBA 4BPZA 4LBQD 2GMEA 5HCBA 1UZYA 1JBCA 4HANA 1QOOA 3OBTA 5CB7A 1LOFC 4M3CF 5GLVA 1AX2A 1O4YA 2ZKNA 1UKGA 1N1YA 2EXHA 1D2SA 4YG0A 1C1FA 2XG3A 1GKBA 5DXDA 4LBKA 4NO4A 5LK5A 2FMDA 1RIRA 5GLTA 1CR7A 1SBEA 1SLBA 4YG6A 4XBLA 1TEIA 3W58A 1DFQA 1S0JA 2EALA 1C57A 1Q8QA 1DQ0A 1SLCA 1MS5A 2E7QA 2XB6C 1WBLA 3ZSKA 1GZ9A 2PHWA 3LCPA 1CJPA 1D0HA 2NN8A 4M01A 4AGVA 5KXEA 4XBQA 5IK5A 1SLTA 4Q1RA 2GNTA 3IPVA 2ZACA 2EXJA 5T55A 3POYA 4FQ4A 1V6OA 1WD3A 4ZXKA 2NP0A 1S0GA 1ZM1A 3LSEA 2W08A 3INAA 2GN7A 1V6MA 2PHUA 2UWBA 3PMEA 1MZ5A 4GWNA 2D6PA 3WDWA 2AR6A 2C9AA 2W68A 1BQPA 1LOCA 3APBA 1Z0HA 5FREA 5DZFA 3AZWA 5GLUA 3WHTA 1V6NA 1VALA 2NM1A 3IPVB 5GJ6A 1LULA 2AGSA 1JOJA 2ZGLA 5EXOA 4SLIA 5IT6A 2DUQA 2OUJA 1YIFA 3R4SA 4GKXA 4P9YA 2FHRA 4XMIA 4U2AA 4FP3A 5JDBA 2NMNA 2CL2A 4AGGA 3NV1A 3AJZA 4P9XA 4XTMA 2VUAA 4FPKA 4XBNA 3ZXLA 1HQLA 4OZXA 1GNZA 1GYKA 2C5DA 1HLCA 3VV1A 2ZGUA 1S1AA 2DU1A 1QOTA 4K21A 2UWCA 4H55A 1CPNA 3WV6A 2ZBJA 4YZ1A 1Q56A 1LGCA 3IM0A 1JUIA 4FQZA 2R0HA 5KXDA 2YROA 5H9QA 2E6VA 1JYCA 3ILNA 3FLPA 1GNHA 4K1ZA 4UW5A 1H30A 3PVNA 3WCSA 2P3KA 4YW3A 3WDYA 2D3SA 1BYHA 3HMYA 2LALA 4CZSA 2EXKA 3NV3A 2E53A 1WD4A 3ZXEA 1SBFA 5IUQA 3SISA 1V6IA 2A6ZA 1KJLA 2DURA 5F5QA 3ZSMA 4YW2A 2R1BA 3WG4A 2GNMA 3OGGA 2D43A 4JCKA 2UU8A 3AYAA 4Q2FA 2SLIA 3AX4A 1UZZA 4F83A 2OW4A 3V0BA 4DFSA 3N35A 3A4UA 4XJ9A 1CIWA 3KM5A 5T52A 4FPOB 4GXLA 2ZABA 4Y26A 2ZGNA 1MR5A 4AWDA 4XJUA 4FOVA 3KQRA 1DQ1A 1G9CA 1IS3A 3A0KA 3PVEA 4FP2A 5T50A 1Y7BA 3FLTA 2D6LX 3R4UA 2AH2A 2CY6A 2ZHLA 4BLIA 4AYUA 2DUOA 1MS8A 1DYKA 2D6KA 4FPJA 4XOGA 2UURA 1LOBA 2GN3A 1IS4A 2OUHA 2YZ4A 3ASIA 3T2TA 1GLHA 3MW4A 4WVWA 3M3EA 3V0BB 4GA9A 4GALA 1LGNA 1KITA 1A78A 1AXYA 2ES3A 1CESA 3D5OA 1N47A 1SBDA 1FX5A 3SH5A 1J1TA 1FYUA 2NZ9A 4GKYA 1IS5A 2ZGOA 4FPYA 5E88A 2DTYA 4M3CE 3V0AA 2E7TA 3AK0A 4XTPA 3MW3A 4D69A 3ZXFA 5H9RA 5EYXA 3I4IA 4M00A 2AYHA 4CRQA 5IK8A 2DVFA 4K1YA 4YM3A 3WZ1A 3HR9A 1S0DA 1DLLA 1LHOA 3AYEA 3RRDA 3TAYA 2SBAA 5KXBA 4AVTA 1APNA 1ENSA 1VAMA 4NOTA 4ATFA 1VIWB 1OKQA 3WCRA 4Y1ZA 4Q1PA 1JN2P 1EPWA 1S0IA 3V0AB 3RS6A 3WDUA 2W39A 1ULDA 2WJSA 1OQ1A 1QDOA 2A7AA 1DYPA 2DVGA 3I8TA 2DU0A 4RA0A 1SCSA 2AENA 4BMBA 1GSLA 2DVBA 1G9BA 1ENQA 1ONAA 4FPGA 2ZGQA 1DQ4A 4XIKA 3GNEA 2P3IA 5SV8A 2ZGTA 2GMMA 1WW5A 4YM2A 2PHXA 1G7YA 2JE7A 1AXKA 2A6VA 1CVNA 2CWSA 1ULFA 5CAZA 1YYNA 5GZEA 1UL9A 3ZPYA 2D6NA 4PBPA 1SLAA 3QCWA 1BJQA 5T5LA 5T5OA 1F9KA 4Z8BA 1GANA 2JKBA 3N7JA 1V6KA 4Y24A 4JC1A 4YG3A 5HCAA 5GZDA 3WDTA 5CNAA 3O0VA 3FBYA 3O0WA 2YMZA 3WNXA 2WLQA 1AX1A 1KJRA 2ZHNA 1KDMA 2R1DA 3IN9A 4GWMA 4U36A 2AUYA 4YGCA 2JECA 3PVOA 3BOPA 4PF5A 5GLZA 1LEMA 3AXEA 3D6EA 2A3WA 3VKMA 1NLSA 1S0FA 1WLWA 1HKDA 2ZA9A 3H0OA 1WBFA 2Q5TA 1AF9A 3JUUA 3RSJA 2A6WA 3HN1A 1N3PA 4ASMB 1IS6A 1LOFA 2HYKA 1A3KA 1BZWA 2DVDA 2ZGKA 3VKLA 1LESA 3WUCA 3AP7A 5L73A 3T1MA 2D3PA 1DZQA 1QGLA 2DWRA 3CNAA 5H9SA 1V6LA 1SLLA 2A71A 1G9FA 3MPPG 1QKQA 3M3OA 3SITA 1OFSA 2ERFA 1UAIA 2EIGA 3JU9A 2ZZJA 3MEPA 1O4ZA 4YZ2A 4W65A 2RHPA 4XHXA 3WUDA 1I3HA 2NMOA 2ARXA 4BOWA 4LBNA 3ILFA 1S0BA 2ZHKA 4Y20A 4Q27A 3ATGA 3N7MA 2ZAAA 3C2UA 3OBRA 2YY1A 3FFZA 4MYEA 3MW2A 1LU1A 4YZ5A 3RMXA 3DGTA 1JHNA 4Y22A 1HQWA 5DUWA 3V64A 2JE9A 4CTEA 4TYSA 4LBQA 1WUVA 2ZGSA 3M3CA 5GM0A 1DBNA 3POSA 1SCRA 1BXHA 1ULCA 3N36A 2D44A 1Q8SA 4Y20B 2DYCA 1V00A 2JD4A 5EYYA 3FUQA 1NXD1 3AP4A 4WV8A 1W6PA 4XYXA 1G86A 1LOGA 1W6QA 1DHKB 2D7FA 4UW3A 3RQ0A 3WDVA 4ATEA 1W6MA 1LU2A 3M1HA 2PELA 4XXPA 3WG2A 1Z78A 1LJ7A 4Y22B 4Y1UA 3GALA 2LTNA 2WKKA 5JOYA 4LBQB 1F5FA 1IOAA 5JVVA 4K20A 4Y1YA 1AX0A 5DG1A 2TEPA 5FRAA 4WZFA 2VW2A 3WG1A 1AJOA 3WLUA 2A6XA 1YRZA 2P2KA 3AP5A 1IKQA 1YI7A 2VXRA 3DUIA 3FLRA 4L8QA 1V6JA 4R9CA 5JOZA 5JOWA 2WSUA 4LBLA 1MS9A 2ZGRA 1W6PB 1C1LA 4ISRA 1UMZA 1W6QB 4UW6A 3ZYPA 2UWAA 2V5YA 5GZCA 2VU9A 1W6MB 1AXZA 1FAYA 3UL2A 1YO8A 4XMAA 1MS3A 1JXNA 3UK9A 4YW1A 1G9AA 2ZMKA 2OVUA 2WT1A 4XDQA 4YGEA 5EWSA 4FPHA 1LCLA 4R9AA 3ZVXA 3UJOA 3O5SA 2JDZA 3VKNA 1DQ6A 5E89A 1GZCA 4WVVA 1G8WA 1PZ9A 4YW4A 4JRAA 2PHRA 3B00A 3A0NA 2EF6A 4XZPA 3AYCA 2NYYA 1IKPA 1FNZA 2B7YA 2ZMNA 5JLVA 2AREA 1N1SA 1WW6A 2R49A 1JW6A 5GZGA 1QNYA 1W6NA 4DS0A 3AYDA 3UJQA 3O12A 1RITA 2DUPA 2P34A 1ULEA 3ZYRA 2G4IA 2VY0A 2A6YA 3POWA 1A8DA 2A5ZA 2A75A 4LBMA 3OY8A 2WNEA 1CPMA 5DZEA 1WLCA 4FPEA 3AXDA 1DGLA 1MS1A 3B01A 1LOEA 1LHNA 1LHVA 1R1ZA 1AVBA 1YXWA 3WOGA 1MACA 3OJBA 5T54A 3ILRA 2CYFA 1LEDA 1AJKA 1W6NB 5GZFA 4PCRA 2EXIA 2P3JA 1URXA 2VW1A 1C4RA 4LBOA 2WSVA 2W52A 3IMNA 4I30A 4AGRA 2ENRA 1N1VA 4XILA 5T5PA 1XQNA 4Q26A 5KXCA 1QNWA 4FOYA 3TB0A 3OY8B 1MVEA 2A3XA 1LOAA 2PHFA 1MS0A 4PQ9A 1X50A 1W0OA 3OYWA 5E8AA 3RG0A 2WT2A 2GDFA 2GNDA 4YW5A 3V65A 3VKOA 3ENRA 4XJAA 3PJQA 2DTWA 2YXSA 2ZGMA 4UW4A 4FVVA 1G9DA 1SLIA 1LHUA 2GALA 1U0AA 3AZYA 3SH4A 1Q8VA 4FPCA 3T1LA 4XJZA 4YFZA 1WW4A 4YGBA 1UPSA 2P37A 3FUOA 5H9PA 2ZHMA 1MZ6A 4YZ3A 1CN1A 4C1XA 3IKWA 5T5JA 2D6MA 2R16A 3N3HA 3ZXJA 4ZKTB 1N3QA 3OYWB 3ZSJA 1QU0A 3WG3A 2WQZC 2VH9A 5DZGA 5F9TA 4DRRA 1Q8OA 2CTVA 1AZDA 2E51A 5JMCA 2CNAA 1SFYA 1UX6A 1FV3A 1KQRA 1SACA 4R9BA 4Y1XA 1UN1A 1QOSA 4ITCA 1ZA4A 3LSDA 4BQ1A 4YFWA 3B3QE 5BYNA 1HDKA 1QMJA 1F31A 1GV9A 2KM2A 2D6OX 3NWKA 1PZ7A 1W6OA 5GLWA 1W0PA 1LTEA 4YZ4A 1MS4A 1QDCA 2PHTA 4Q8LA 1LGBA 2GNBA 4M3CA 4BM8A 2I2SA 1CONA 2A3YA 2ZGPA 3BODA 3BIWE 2ZMLA 1CQ9A 3AJYA 1N3OA 5HCFA 4PBOA 3B9CA 2D3RA 3D4KA 4LBJA 1S0EA 3B69A 1B09A 1LHWA 1Q8PA 3OPZA 2DV9A 3SH3A 4RL7A 1GBGA 5DG2A 1LENA 2R0FA 4XHBA 1ENRA 4YGDA 1RINA 3NV4A 3O0XA 1FATA 2Z42A 3AFKA 2CWMA 4Y1VA 4AVVA 4DPNA 1ULGA 1W6OB 3AP9A 3Q9OA 4TZDA 1VAVA 1LODA 1GZWA 3AZVA 4M3CB 5DUXA 1KDKA 2WT0A 4DRVA 1PZ8A 4XJ8A 2GMPA 3M3QA 5DUVA 1DIWA 1I1EA 5JOXA 1WW7A 3WHUA 5GALA 1DQ2A 3USUA 1LECA 4IQPA 3M2MA 4XXAA 1BKZA 1WLDA 2A70A 3N7LA 3L2YA 3AP6A 3W59A 4P9WA 1QF3A 4FPFA 3ZXKA 1VLNA 4AVSA 1MVQA 1FV2A 3R05A 4XIOA 5IK7A 3WVJA
chains in the Genus database with same CATH superfamily
4RFT0 1GZWB 1KRIA 4OI0A 5FY1A 3VUOA 1VBA1 3EB7A 1B35C 4OVEA 1KS4A 1H9WA 1VBD3 2WAOA 2ZX2A 3AZZA 4PJYA 4P14A 3USUB 2QJVA 4QM8A 2DVAA 2QCSB 4A3XA 4F7ZA 4DQAA 4LOSA 4EROA 4C1WA 1GWMA 1R1A1 3NAPC 1PIV3 5IWFA 4BLJA 4XFIA 3FWEA 1IQDC 2PQSA 4XE9A 4URTA 3WDXA 1A6CA 4OHYA 1OOPA 3U4XA 4ZZ8A 1WCSA 3O1TA 1RUH1 2W91A 5A3PA 2VW0A 5DUUA 3GCWA 1HN0A 4IE7A 1UZYA 3NMBA 5CB7A 4LKEA 5GLVA 2GP5A 2QQNA 4NMIA 3I59B 1UKGA 3OPTA 4UF0A 3LPFA 5FP4A 4HPKB 2BERA 3SHRA 4C8DA 1J59A 4IE4A 5BXXA 1VBA2 2FMDA 1QJY1 2GSYA 1SBEA 3EXUA 1IPKA 2AZ5A 5FAXA 4FAHA 1SLBA 1JZ2A 1NCQC 1JYVA 3VBUC 4NIAA 1PGL1 1TEIA 3W58A 5A6QA 1R1A2 4UFHA 1SLCA 2HWB3 2WR9A 1MS5A 5FLIA 4L0PA 4F8AA 3ZSKA 1VRH1 4GJYA 1GOFA 1XRUA 3LCPA 4BYYA 1D0HA 1RUH2 2NN8A 3N9LA 1ZX5A 4M01A 1U5YA 3LAGA 3C3VA 1JZ4A 5BPXA 2WO1A 1OSGA 1Q5OA 4JHZA 4L99A 2X05A 1F2NA 3S7EA 3IPVA 3MLLA 4FQ4A 1H4GA 3T0DA 5E1RA 5K0UA 3KVAA 4QDSA 2HWD1 1UXXX 1GQPA 3E5XA 1PVC1 1JZ6A 1OD3A 1UU5A 4E4SA 3ZXGA 1NCRC 4AFDA 2JDMA 4QKNA 1V6MA 3PMEA 2UWBA 3F2ZA 3THCA 3KCYA 1FT9A 5FYIA 1QJY2 3UYJA 5I93A 2C9AA 2B39A 2JG8C 3APBA 4MSVA 3RPQA 5EJZB 5A32A 1PGL2 2UYAA 1WGPA 3NL1A 1VALA 2W92A 5GJ6A 4ZU5A 3MIHA 4ES9A 2AGSA 1JOJA 2ZGLA 4LE4A 4LKSA 2WC2A 1VRH2 4MGYE 1JHJA 1RUI3 4SLIA 2DUQA 5D8AA 2ZX0A 3K51A 3R4SA 2WQ8A 4H7LA 4U2AA 3C7EA 3UGFA 5JDBA 4TTGA 5B2GB 3AJZA 5FK8A 3HPNA 3LD8A 5FYBA 3NKGA 1HQLA 2HWD2 2IUWA 3SEPA 1W8HA 4M4PA 1GYKA 1PVC2 2PAEA 2QNKA 1OQEA 1TE1B 4K21A 4K6BA 1VBB3 5FYYA 2ZBJA 4YZ1A 4EN7B 5A1LA 2QTWB 1LGCA 3IM0A 5LBCA 4FQZA 1ND3B 5KXDA 1QY4A 2TUNA 1GNHA 4GULA 4V1PA 4DEVA 1F35A 3GYDA 5A6XA 5IATA 3MUY1 4MGSA 3S57A 2Y34A 3N9MA 1US2A 3OOXA 1OD5A 2LALA 4QX7A 4NHLA 4RQPC 2EXKA 3U10A 2E53A 1W9YA 1W2UA 1LKNA 2RJKA 4Q4X3 3VDDB 5KHIA 5DAXA 1UW8A 3WR0A 4AEDA 3LWCA 2J1TA 2W46A 3ZFEA 5IVVA 4CCMA 2FDFA 2DURA 3OSDA 3VZLA 3PU8A 1AL0G 2VMCA 2GNMA 3VZMA 4GH4A 5KBFA 2UU8A 3Q8EA 1AYM3 4CDWA 1XYPA 5JXIA 3LFIA 4RHV3 1UZZA 1NKGA 2P6CA 4MX3A 3A4UA 4Q4Y3 3KM5A 4WM7B 3DKQA 4FPOB 2ZABA 3AKQA 5IYYA 1MR5A 1OA2A 5FY0A 2Y6LA 3PVEA 3I7DA 5BNOA 1ULOA 1REEA 1OMIA 2RMU1 3B7MA 2RM23 2YGMA 4IEXA 2DUOA 4AYUA 3GM8A 4JGYC 3JD72 1MS8A 4M4RA 3NNFA 4FPJA 3H50A 2R071 4XOGA 3B5LB 1IS4A 1TME1 1XNAA 2AEZA 3VBFB 4JDNA 3V0BB 3J8F3 4IEOA 2BWAA 2VZ1A 3HN3A 4GA9A 4XFHA 1A78A 3KMHA 3M4FA 2ES3A 1CESA 2GU9A 4WZCA 3O1MA 4CDUB 3RWKX 4D0QA 4GKYA 4AHZA 4IE6A 3WNMA 5AC93 4M3CE 1OUSA 3GBFA 1AR83 3SKVA 3VB9A 2Q8OA 3POIA 5FUPA 4XTPA 3MW3A 4D69A 4HXCA 3W5NA 1ENXA 1OF4A 5EYXA 3I4IA 2VZ3A 4M00A 4DOUA 4XFBA 2DVFA 5TSWA 2AACA 3ZIWA 4IEYA 2B5HA 3HD8B 1PVXA 3GXUA 2RMU2 2SBAA 2MHFA 3RFRA 5C4WA 1APNA 3WW2A 1H2NA 3BVCA 4K8RB 4AVTA 4QGNA 1L7RA 4MADA 5FY4A 4Y1ZA 2VBBA 2R072 1TME2 4HETA 1H1AA 2C26A 1S0IA 3V0AB 2OPKA 4JHTA 2W39A 3RYRA 1ULDA 2WJSA 4B1MA 4JZRA 2DVGA 4A2UA 3ZKUA 4MGZE 1H8TB 1HV1A 5FZ3A 1G9BA 1AR71 4PIZA 2RR13 1UOBA 2WNUB 1DQ4A 2VTFA 4FPGA 4R52A 3OCPA 5DDJ1 2GC0A 2P3IA 1UD1A 4Q4W3 2ZGTA 2FZ2A 1V70A 2ADDA 3MIBA 2VMGA 1AXKA 3CF6E 4QKBA 4NWWA 3T2PA 3VGIA 5A3LA 3HJRA 1W39A 3KD4A 4FFGA 5GZEA 5CAZA 2D6NA 4PBPA 2O14A 3WF1A 1JYWA 2XL7A 3PL0A 2JKXA 3N7JA 4Y24A 4JC1A 2BW8A 3BTYA 5GZDA 1RUE1 5CNAA 3FBYA 3O0WA 3WNXA 3BN6A 3D3AA 2ZHNA 2WIIB 3RDIA 3WY6A 4AR2A 4W6XA 5LA0A 1AR72 2QQLA 3IN9A 4XFCA 2JDYA 1FXZA 1CAXA 4N9HA 4PF5A 4ASLA 4LHLA 3AXEA 1WKYA 3D6EA 3OD0A 5FXXA 2JWPA 1NZIA 5BNPA 1W03A 1W2OA 3VDCA 5CISA 2YBSA 4P5YA 2EICA 2A6WA 3HEIA 5HXMA 5JSOA 3BIEA 1B35B 1YHFA 3I3QA 3VKLA 1BZWA 3ZFGB 2HBUA 5A7PA 1PO11 3WUCA 3RZGA 1AYN1 1QJX3 1RUE2 5J37A 2VNRA 3WNLA 5A6YA 3TEWA 1VMJA 3NAPB 5H9SA 3ZSEA 4EZ4A 4FTBA 1V6LA 1JYNA 1RUD1 4CUCA 1OFSA 5LBFA 4CEWC 4LEJA 2WAAA 5F3GA 1E5RA 5ISLA 1O4ZA 3VHNA 2YBKA 1VMFA 4XHXA 3RZLA 4GMP0 3MO4A 2C4XA 2BOJA 3VBRC 3WUDA 3O7OA 4L2NA 5K4LA 3MV01 4BOWA 2QQOA 2Y8KA 3PTRB 1CAVB 1HJGA 3SCHA 4QD2A 1YLLA 2ZHKA 4Y20A 1PO12 4E8DA 1AYN2 4LA3A 3ATGA 2X53S 3VBUB 4FXGB 5A7OA 1IHMA 1AR93 5FMCA 5LY2A 3MW2A 4AOCA 4NRPA 4QPGA 1GP6A 5BV6A 3WW4A 1I5ZA 1JHNA 1RUD2 4DINB 1HQWA 2BTVC 3LIHA 2J1EA 2JE9A 4QX2A 3VD4A 5FWEA 3RI9A 2QZ2A 1OI6A 3M3CA 1Y3TA 2VZRA 3Q8BA 3FMGA 1C8M1 2P1BA 4Q0VA 3TBDA 4ES8A 2DYCA 1V00A 2JD4A 2PLV1 5FXVA 3K4ZA 3O14A 1NCRB 3FUQA 2XH6A 1ZA7A 3RQ0A 4BQYA 2JG8B 3WG2A 4YVSC 4AHWA 1FOD3 1XU1A 3QOPA 1EY2A 1UF2C 2WABA 2LTNA 2XJRA 1JI6A 1SQ4A 1F5FA 1GNYA 4RS5C 5DG1A 1OH3A 2PAMA 1UKRA 3C8XA 1FMD1 4WZFA 1AJOA 5ABJA 1HXS1 1RUJ1 2R6QA 4AAPA 2A6XA 1YRZA 1H2KA 1YI7A 2I74A 3LZZA 4L8QA 4LNVA 4TWTA 3VBHC 5C6CA 3H8XA 3VHPA 2Y26A 3AKRA 1QJY3 1W6PB 1C1LA 4LITA 3I2DA 3NQHA 4UW6A 1C8M2 5HV4A 4E4ZA 4KGGA 5FZDA 2VU9A 3CJXA 3ORJA 2C1FA 2BDRA 5JZGA 2XR4A 2PLV2 2VVFA 4KI5M 1T2XA 4ZU7A 2IXKA 2WT1A 1MPXA 2HJIA 1RC6A 1WA6X 4E4HA 4R9AA 3O5SA 2WO3A 4WVVA 1G8WA 4YW4A 4JRAA 1VBD1 2HWD3 3I2KA 4RQPB 4HVRA 4XZPA 3AYCA 2NYYA 1PVC3 2B7YA 1FNZA 1FMD2 2ZMNA 1HXS2 1PIV1 1MQTA 1RUJ2 3OEBA 4RGGA 1POV3 1NQDA 4NPRA 4S2DA 3IIAA 1W6NA 3AYDA 1RYYA 1RITA 2DUPA 2WA4A 2OPWA 2P34A 2Y60A 4J25A 1V9U1 4ZPIA 1ZVFA 5KHHA 1A8DA 2PYTA 1DU3D 3KB5A 3ACIA 3OY8A 2K0GA 2CU5A 5CYYA 1LOEA 1W8ZA 5F1RA 1EUTA 1ZZ7A 3RNSA 2HBTA 2ZX3A 4CU8A 1MACA 2LW8A 4NIHA 5F37A 5T54A 5JI7A 1ODMA 2YPDA 1VBD2 2XLAA 4JGYB 4WVZA 3VL8A 4LUMA 4LBOA 4QDQA 1PIV2 4EV0A 2HWB1 2K9ZA 3OD4A 3GDBA 3MF6A 4HN1A 1UYXA 2R7EB 3TB0A 2XHNA 4PQ9A 2A3XA 5E8AA 3RG0A 1MS0A 4Z2AA 3OYWA 3WF3A 3IAQA 2ZKLA 4CU7A 3CU7A 3WP4A 1QQP3 2QZ3A 3T0AA 1V9U2 4RR3C 4XJAA 4O7XA 2DTWA 2HWE3 2VZQA 2ZGMA 3LEMA 4FVVA 1SLIA 4GWIA 4XEZA 3SH4A 3JD73 2YU2A 1OPMA 3ES1A 3T1LA 4XJZA 1WW4A 1YQ6A 1X36A 3KV4A 4YGBA 3FUOA 4I3GA 5A80A 3T2QA 2ZHMA 1YQ2A 4EN6B 2VQTA 3E6DA 4K8FA 3VHRA 1WMFA 3GBWA 4BCUA 4I09A 4ZKTB 1LRHA 4OUSA 3WG3A 4HFSA 2DF7A 4I02A 3U1XA 2HWB2 4LOTA 2CTVA 3I2FA 1RUI1 1SFYA 1W8UA 1UN1A 1ZA4A 3IMMA 3B3QE 1ASJ3 1KXGA 1YFXA 2P3YA 3MLKA 3T30A 1KFXL 1LTEA 1UIJA 4BH9A 1OA4A 2RDRA 1QDCA 1RXFA 2PHTA 4B8EA 5FPUA 5C3PA 2R073 2E32A 2I2SA 1CONA 2A3YA 1VBB1 1IQAA 3BIWE 2ZMLA 3MDPA 4IXLA 3AJYA 3ZKYA 4URAA 1N3OA 5FBJA 3ZLIA 5FMBA 1S0EA 2FCTA 1B09A 4BZ4A 4RL7A 1LENA 4NAOA 3WP6A 1ENRA 2PHDA 2PAKA 2X5IC 5FCCA 2JB4A 4DPNA 3P6BA 1NZCA 3AP9A 2OQ7A 4Q4X1 1VAVA 1RUI2 1GZWA 2UY9A 2ORXA 3CMGA 5DUXA 4DMIA 4E2QA 1QJU3 4NIDA 2JENA 5A1AA 1PZ8A 4AHYA 5DUVA 3EQEA 5JXGA 5FZIA 1DQ2A 2G9ZA 1NLQA 1W3XA 1AYM1 2RE9A 4XXAA 1HB4A 3USUA 4RHV1 4OYUA 4BU2A 4CXXA 3L2YA 1VBB2 4Q4Y1 3NJXA 2JDPA 4P9WA 1QF3A 2V5DA 2GC2A 1MVQA 3R05A 4AVAA 3Q8CA 3KVBA 4BWOA 1OH4A 1FNYA 3SLIA 3NV2A 3VKFC 3AZXA 5ANQA 2RM21 1QJEA 3CQOA 3WXPA 3U75A 1W8OA 2JDUA 1ND2C 3PUIA 2JJ6A 3I59A 4ISQA 1PX3A 2BFUL 2H0BA 4Q4X2 4HPKA 3SCGA 1NLRA 2BGOA 3NNGA 4UBHA 4YLZA 2KR2A 4IEZA 4MH0E 2ID4A 1HRI3 4XUOA 4CEWB 2DCJA 3NKTA 4AI9A 4TSVA 3HIFA 4HKLA 1AYM2 4QB6A 3I2HA 4RHV2 5I8SA 4JGZC 1COV2 4KWKA 2YV8A 5AVAA 4EWAA 5AC91 1YNAA 1S2KA 4Q4Y2 1AR81 4LBQD 4QU1A 3RZZA 1QOOA 1LOFC 3IDCB 3VBRB 1O4YA 2ZKNA 4MLOA 4XETA 1YQCA 4DNYA 3LB9A 1GKBA 5FXZA 5FIXA 5LK5A 2PMWB 4P08A 2RM22 4R4ZA 4AEJA 1OPOA 4K9SA 1RIRA 1CR7A 3MIEA 3BI3A 2GC3A 3CIHA 4AW7A 4YG6A 4NAMA 2L9LA 2NPIA 3TEYA 1H6XA 4D6RA 4AE2A 3LEIA 1DQ0A 2RS13 2ZEXA 5ACA3 5FZ1A 1WBLA 3MBWA 1VMHA 2PHWA 2W94A 5F8PA 4AGVA 5KXEA 5AC92 1SLTA 2RR11 2E7AA 1AR82 2WYSA 1GFF2 2EXJA 4Q4W1 5T55A 2VPVA 1KGYA 4PDWC 4R8HA 2WA3A 4CUGA 4ZXKA 2WZR3 3PU3A 2PFWA 1S0GA 1ZM1A 4NPMA 3INAA 1AUYA 5FYZA 1QJZA 2QQVA 5FZBA 2ZPXA 4GWNA 4YVSB 3WDWA 2D6PA 4ZU4A 5DN2A 3KS7A 4XAEA 4Z1VA 1BQPA 1LOCA 4B3NA 3K4AA 5DZFA 2JG9C 5FUIA 4RS5B 3AC0A 3AZWA 5GLUA 3WHTA 4MGQA 3QBQA 2RS33 1NQJA 1YEWA 2KD7A 1ND3A 3CDZB 3BYWA 4ZHNA 4QXCA 4BXFA 5KHJA 3O1SA 5AFBA 3VD3A 1UY2A 2OUJA 1BVP1 1JTZX 2QKDA 4GKXA 1XSRA 2FHRA 4XMIA 4FP3A 4XDOA 3VBHB 4DB5A 1PX4A 2CL2A 2EIEA 4H2AA 4AGGA 4N53C 4FAGA 4FBFA 4KBZA 4P9XA 4Q4W2 2BU9A 2VUAA 4FPKA 3VDDA 1JUHA 3ZXLA 1OLRA 1SDDB 2CDOA 4YNIA 4A7YA 3EMRA 3ZN5A 2UWCA 4JKKA 3JXSA 4H55A 1CPNA 5L19A 2Y6GA 3FHIB 1JUIA 2ZX1A 4JRLA 3POBA 5H9QA 1ZREA 4L9BA 1H2MA 3FLPA 1H30A 2MNGA 3PVNA 2P3KA 5F5CA 5FP7A 1BYHA 4PLMA 4WM7A 1QJX1 2JEMA 3ETQA 3NJZA 1CX4A 4E4DX 3GZEA 4DUWA 1OHFA 2ZS6B 2Z5WA 3NV3A 3VD9A 1WD4A 3ZXEA 1UU6A 1QXPA 2R063 1KJLA 2JB8A 5F5QA 1I6XA 4QU2A 2D43A 1RTVA 1L7LA 3AYAA 4Q2FA 4QXHA 2HLEA 3VBFA 3FJSA 3V0BA 1UX7A 4DFSA 5A3UA 4JQRA 2VOVA 1W2NA 3VD5A 5T52A 5F3EA 4Y26A 1REDA 3ZN6B 4COWA 4XF9A 2ZGNA 4CDUA 1K42A 1DQ1A 3CLPA 3A0KA 1YWKA 1Y7BA 3FLTA 4W50A 5CVRA 5I0RA 2PQQA 4BLIA 2VMEA 1UZWA 2BWCA 2XJVA 1AR91 2UYBA 3AVRA 4NROA 3FL7A 3H1MA 2UURA 1LOBA 2GN3A 4LO4B 4N43B 5FMDA 3ZN4A 3ASIA 3T2TA 4WVWA 2A73B 4QMAA 1LGNA 4NVPA 1AXYA 1J3RA 1PM7A 1N47A 4RR3B 5F6LB 3X29B 3ACGA 4BISA 5IW0A 4PI0A 2D93A 3SH5A 3NJYA 4KWJA 5JSPA 2BGCA 5E88A 5FP9A 5C8CC 3V0AA 1WCDJ 2WZ8A 3DPRB 5JPNB 3C7GA 2XUEA 3AK0A 4AI8A 1W3VA 1BCXA 4LO5B 4QGLA 1H8TA 1BVVA 4X6RB 1K12A 3PUSA 1UOJA 4K1YA 3RRDA 2WNUA 5LK7B 1FOD1 1RB8G 2OYZA 1V9U3 1NUKA 1VIWB 1XYNA 1AR92 4Y5SA 2XVKA 4Q1PA 4HONA 3W20A 1EPWA 1IPSA 2VZUA 4A4AA 3LA7A 3WDUA 3DYMA 5LWBA 1BEV3 1ZBA3 2A7AA 2ZXQA 1DYPA 1WCUA 3BB6A 5FZOB 2EA7A 5FMOS 3ECQA 4RA0A 5I8TA 4HZFA 3HNBM 2AENA 3OGSA 4L97A 1OVSA 3MIGA 4QPIC 2P5BA 2KA3A 5FYTA 4B7KA 2QE3A 2Y6FA 3ROUA 3AFGA 4X6QB 2ZGQA 4CDQC 5CADA 4XIKA 3GNEA 5IHRA 5LCWL 3UNPA 5LA9A 3BCWA 2GMMA 1WW5A 3NRUA 4LIUA 2Q4SA 2W0XA 2JIJA 4A7KA 3HNMA 2LROA 4Z2WA 3GHMA 1QH6A 3RZKA 1FOD2 1UL9A 3ZPYA 5L9VA 3QCWA 1JOBA 1VBE3 2X5IB 5LRRA 2Y38A 2J22A 1RUC3 3DYOA 5T5OA 4Z8BA 5FZAA 1KS5A 4B4PA 3PLQA 1V6KA 5C3OA 3D0JA 3WDTA 4BB3A 1NE4A 2Y64A 3I2OA 1POV1 4ZS3A 4NUBA 1AX1A 1OLQA 2XJTA 3UKTA 1B35A 4PQQA 3DXTA 3WQBA 1KDMA 5FZ9A 5EHDA 3A7QA 3KWVA 1SMVA 1RXGA 5LATA 3ZFGA 3OUJA 4GZ9A 2VMFA 2R1DA 3IBMA 3UKNA 3WNKA 4U36A 2EAAA 4AI2A 4NIGA 3PVOA 4KGQA 3NAPA 5GLZA 1LEMA 4PF1A 4BIOA 2XQRA 2A3WA 2I45A 2ZA9A 4D7SA 2QDNA 2W1WA 1DG6A 4Y5TA 2ORZA 1ZRDA 1O59A 3JUUA 5FYUA 3RSJA 5C7GA 4N7IA 3E5UA 1E57A 1ND2B 5JIUA 1LESA 3JB8A 1U12A 2VR4A 3IZOA 4JTOA 4P02B 3IAPA 1H6YA 4AFBA 5L73A 4OULA 3TRSB 1DZQA 3P1IA 1UY1A 1W0NA 2DWRA 3CNAA 5DABA 3PJYA 1CAVA 5FQ0B 1EAH3 3MPPG 3I54A 4FO9A 4HMZA 3WQ0A 3I2GA 1QQP1 1UMIA 1XNCA 4JGZB 1Z7S2 3VBUA 2QDRA 5CKNA 2HWE1 3H3UA 3MF9A 4W6YA 4IL7A 1JH5A 3MEPA 4AQ6A 5EFUA 3JD71 3H3LA 1VBC3 4ZS2A 1H4HA 5ERLA 3J7NA 5FZFA 4E9KA 3KGZA 2BVVA 2BP6A 5JSRA 1NT0A 2YHJA 3MHZA 4TXWA 4ZONA 3LF7A 3U07A 1DYOA 1C28A 5L7OC 3VDBA 1PNGA 4IEUA 3KSCA 2K2SA 4LBNA 1RMU3 3ILFA 4CPBA 1O3QA 5A7SA 1COV3 1S55A 1WMDA 4BDVB 4Q27A 3N7MA 1C3HA 2YY1A 4M0HA 5A70A 4EZHA 4MYEA 2BRTA 1LU1A 3TNPB 4YZ5A 1PO23 2JG8A 3CJIC 5DUWA 1QQP2 1ASJ1 2Y0IA 2JXAA 2N7GA 4CP0A 2QQUA 2HWE2 5FYVA 1GWLA 2ZGSA 4SBVA 4PDWB 1BXHA 2IXIA 1SFNA 3N36A 4XCAA 1UY3A 3ZXDA 5J98B 2CSGA 2P17A 4AEKA 1D4VB 1W6PA 1ZZ8A 1G86A 1LOGA 2D7FA 4ATEA 2VBDA 3M1HA 3IDEA 2PELA 5M0TA 1LJ7A 1RUG3 2JG9B 5K7PA 3U11A 2WN3A 4D8MA 4LT5A 1GOGA 2K46A 3GZAA 5JOYA 3AL6A 1IOAA 1HV0A 5JVVA 2C0ZA 4MGIE 1QJU1 3WG1A 3K4DA 2YC0A 2W1QA 1ASJ2 1W05A 2CAUA 2VXRA 3AP5A 3FLRA 1UYZA 4N53B 1W9TA 4RQPA 1MS9A 2YDEA 3KCXA 4ISRA 5FPXA 3POJA 3ZYPA 5HV0A 1W6MB 4E27A 5FZGA 3WNPA 4KQ7A 4P9IA 1X7NA 1AXZA 3B93A 4GMP3 1YO8A 1ZZBA 3OTFA 3SEEA 2OVUA 4Q0SA 2VXJA 2E33A 4IUGA 4XDQA 1O7FA 4YGEA 5JI9A 2NQYA 3DEMA 2JDZA 4BQ3A 2BFUS 5EPAA 5CFDC 2YG0A 4QPWA 5E89A 4ARYA 1GZCA 4LULA 1EP0A 3Q8AA 4NR1A 2CGPA 4CCOA 4G3YC 2IWGB 2AEYA 3A0NA 3PTYA 4K7JA 4PLNA 5JLVA 1QJU2 3T4VA 2AREA 1N1SA 4S2GA 1JW6A 1HRI1 1QNYA 2YC2A 5CU1A 3VD7A 4MG2A 4JGYA 1LR5A 4N7UA 2JDHA 2YU1A 4EN9B 1F4AA 3CZUA 4QX0A 3O12A 2VQAA 1EPZA 3M8LA 2A6YA 3POWA 5BNNC 2BUKA 2G19A 5FZ4A 5A1FA 1CPMA 1XJAA 4WBBA 3CO2A 4MXWB 4UI9L 1R1ZA 5APAA 4LUKA 1AVBA 1YXWA 3OJBA 4KWUA 3H8RA 3ACFA 4QQPA 3IB3A 4QT6A 4AQTA 2B45X 2B8MA 2W3JA 1WWYA 2CYFA 1LEDA 1AJKA 4PCRA 5A7NA 2EXIA 2IXHA 4AL9A 2P3JA 4CE8A 1URXA 5L9RA 1C4RA 5L36A 2WSVA 2RS11 5ACA1 2ENRA 5T5PA 3AMHA 1HRI2 1XQNA 2YFZA 4Q26A 1NX9A 1UY4A 4XCBA 2BGPA 4BIFA 4IV1C 3LEGA 2YYOA 4V2VA 5FPVA 1W9FA 4FFHA 5B4XA 4OI2A 2GDFA 2GNDA 4YW5A 3VKOA 5JXHA 1KD7A 3H7YA 1ACCA 5C8CB 4UW4A 4YARA 2GALA 1U0AA 4E2SA 1Q8VA 4D6QA 5I0UA 2WZR1 5FXWA 1P8JA 3WT3A 3PIGA 4YFZA 3POEA 1BK1A 1MZ6A 4C0HA 4YZ3A 2XHKA 4QM9A 3IKWA 2VNOA 4A44A 1DGRN 2R16A 2WWJA 1N3QA 1QXJA 5DMYA 3RWNA 4IEPA 4NHKA 1IZ3A 1QU0A 3FN9A 4LO8A 2WQZC 3BTXA 1PM4A 2VH9A 2RS31 2RS12 2Z79A 4N9IA 5ACA2 2WZEA 1FV3A 1UX6A 3UKVA 4CEYA 3MGUA 1QOSA 4ITCA 5A6ZA 3LSDA 4BQ1A 4YFWA 3N9QA 4QPIB 4C0BA 3I3DA 2D6OX 1NCQB 1UNBA 3LIGA 5GLWA 4CDQB 1MS4A 4Q8LA 3ZXAC 1LGBA 2GNBA 3KCCA 2WZR2 2R043 2VZOA 1K45A 2XJPA 4R4XA 2ZGPA 3BODA 5DAVA 5FYHA 4CCDA 1PK6C 1UCXA 3VBOC 2RJLA 3WSOA 2E26A 3D4KA 2Q8DA 4I2OA 2XBO1 3OPZA 2DV9A 3H42B 3OB8A 4IERA 1GBGA 5DG2A 4AK3A 1JS9A 2CHHA 4QX3A 1FATA 2Z42A 2Y6JA 4LR4A 4Q0UA 4Y1VA 4IGQA 5A7WB 5I91A 2RS32 5CG8A 1W6OB 2FMYA 2WFPA 3DCQA 3CEWA 4QHOA 4DRVA 5FZCA 3WEZA 4XJ8A 4F3JA 2R061 1DIWA 4CP9B 5JOXA 1F8VA 3WHUA 2VAUA 3DXUA 2ZZQA 3AKPA 4JQTA 5FPBA 1LECA 5CFCC 4IQPA 3M2MA 1BKZA 1MQTC 1QJFA 2VOWA 5FY9A 5A7QA 4CA9A 2PN5A 4LORA 5LBBA 3N7LA 4ZY9A 1ZRFA 5FPLA 3HQRA 4FPFA 1K5JA 4WVMB 4CEWA 2IVIB 1W9SA 1FV2A 4G4FA 2XONA 3POGA 1R083 5IK7A 2XBO2 2DCYA 1S4CA 1L7QA 2V72A 3AM2A 3CKHA 5JXJA 4UBGA 2D98A 3QLQA 4D7YA 4C91A 2HWC1 3N9NA 4LIVA 2XJUA 5FMOL 2RDNA 2QVSB 4YM0A 1GICA 3VBRA 2PA7A 2EAKA 1ZRRA 5FO8B 1UWWA 4BQWA 1S0CA 2F17A 3ZX7A 5KC6A 4HL0A 4MHRA 3MUZ1 4XFGA 2R062 4XJWA 4BXSV 1H9PA 4YM1A 2QQKA 4R9DA 1NOVA 4Q8KA 5LA1A 3KT1A 4OI4A 1T6GC 5FWJA 1DQ5A 4BPZA 3NJVA 2GMEA 5HCBA 2W47A 1JBCA 2VC9A 2ZEZA 3CHXA 1UQXA 3DN7A 4AFCA 3LGRA 1AX2A 3KV5A 1N1YA 2F6BA 1D2SA 4YG0A 2XG3A 5L7OB 1PMHX 4HOOA 5LA2A 4NO4A 3KF3A 4Q4V3 3ZYBA 2HWC2 1Z7S3 2B46X 1O3SA 4XW3A 2WL1A 1JZ3A 4LE3A 3KV9A 4WM8C 2J1SA 1J1LA 2WN2A 3MLJA 4TLGA 4XBLA 4IV3C 1DFQA 1S0JA 1BEV1 1ZBA1 2VQUA 4XAAA 4YVSA 3CJIB 3OGJA 3BU0A 2E7QA 2ZOEB 1GZ9A 3H9AA 4QXBA 3D82A 4Z07A 5CEHA 4RS5A 4YVWC 4XBQA 4Q1RA 4XC9A 2GNTA 2ZACA 4YRDA 2OKXA 1VP6A 4YW7A 1V6OA 3O1OA 4CU6A 4PIXA 4COVA 3H8UA 5HCHA 2VUCA 1CIYA 3TYJA 3SCFA 1VBE1 2F4LA 1RUC1 2ADEA 5LB6A 2P6HA 4AF9A 2W68A 4CDXA 1OXCA 3J4UH 1Z0HA 5FREA 4LK7A 3MZHA 3DYPA 4NRMA 3R0RA 1V6NA 1BEV2 1ZBA2 2NM1A 3NSTA 3VL9A 2WNVC 3TN93 3ZYFA 2DBNA 5J48A 5IT6A 1YIFA 1E5IA 2JE8A 4H7MA 1W8NA 1CAUB 2RS52 4META 3NV1A 3PVBB 1OFNA 5CKMA 4XTMA 4KG0A 5FP3A 3HQXA 3KF5A 1DGRA 1TQ5A 4LO7A 4MZUA 5FLHA 4OZXA 3VBSA 4AFMA 1GNZA 3J9SA 1HLCA 4DIQA 2ZGUA 1YCIA 5FO7B 2DU1A 2D5HA 3ETPA 3NW4A 4XFAA 5JAXA 5FKBA 3WV6A 1Q56A 2VOKA 4COZA 1VBE2 2VG9A 1FPN2 3PMSA 5CFDB 1RUC2 1JYCA 4K1ZA 3WCSA 2ZJCA 2Q8EA 3M7AA 3G7DA 4YW3A 2D3SA 3EYPA 1BK0A 3RYKA 3ZN6A 2RG4A 4Q0QA 1UOGA 5FK7A 3WQ7A 4BK5A 5FJKA 1OBNA 1RJ8A 5IUQA 1EAH1 1O91A 3U0ZA 1AHSA 5EZWA 4EJRA 5BY5A 4Z92B 1PHMA 4XF3A 4O61A 1QIQA 1CJDA 2R1BA 4YW2A 3OGGA 4JCKA 4XF4A 2ARAA 4N43A 1VBC1 2SLIA 3BPSA 5BNNB 4F83A 1K3IA 2XDVA 3J26N 3KLSA 1CIWA 2IZWA 2MEV2 4GXLA 4RR3A 1VB2A 4AWDA 1DGWA 4FOVA 3KQRA 4GAZA 4XJUA 1G9CA 1IS3A 2XLFA 4FP2A 3OBAA 1RMU1 3DPRA 5T50A 5BNQA 1COV1 2AH2A 4XFFA 4UOJA 5C3QA 4K40A 1WMXA 5LBEA 1HN1A 1IG3A 2D6KA 4OUMA 5F2SA 1W8FA 5FLJA 4J6GA 2OUHA 2YZ4A 3KGLA 5A33B 4JDOA 1PO21 1EAH2 3M3EA 2Q0AA 4IV1B 4O9EA 1CAWB 2H0VA 1BMV1 2OZ6A 3PNAA 3D5OA 3ELNA 1HJFA 2O8QA 2X8KA 3LA2A 4RGKA 5IVEA 1OLME 3ZFFC 1VBC2 2NZ9A 4JTNA 4FPYA 2G9GA 2QUOA 1S2BA 2DTYA 3KHBA 4HSLA 2H6CA 2OZJA 1GWKA 5EP9A 4S2FA 4A6SA 2HH9A 1A8MA 2OA2A 5FZOA 5H9RA 5IJRA 5JPMB 2ARCA 2BOIA 4B4RA 4CRQA 1SPPB 3ZM8A 3DF0A 4YM3A 1RMU2 3C7HA 1S0DA 1DLLA 3HR9A 1RVF1 3K46A 5JIAA 3WZ1A 3ZYGA 4CUBA 1RUG1 1ENSA 1VAMA 2E63A 4NOTA 4ATFA 1OKQA 3WCRA 4XZUG 1JU3A 1PGW1 4EWDA 4QKDA 1JN2P 3D0SA 5J36A 1PO22 2Q1FA 5LW9A 4A7ZA 3RS6A 5I0DA 1BMV2 1S2EA 2X5IA 2Y33A 3HAGA 2JIGA 4IEWA 1CD3G 4QX5A 1GSLA 2JDKA 5J1XA 1ENQA 1ONAA 2XOMA 3VZKA 5FPAA 5EQUA 1GQGA 4GMP1 1PK6B 3TWIA 4DXZA 3F95A 3GJAA 4LO6B 1T6BX 2QQJA 2VVEA 4QXKA 3S5QA 3VBOB 4HVQA 3HT2A 4YM2A 2PHXA 1G7YA 3ITQA 2DBIA 1CVNA 4ET7A 4XF0A 2CWSA 2CGOA 1RVF2 1ULFA 2YB7A 3K75B 1JZ7A 1RUG2 1O8PA 1SLAA 5T5LA 1BJQA 4JKLA 3JB4C 5C3SA 1GANA 1PGW2 2B4KA 3FC0A 1I9RA 4YG3A 5FP8A 5HCAA 5C8WA 5LY1A 1E5SA 1CX1A 3O0VA 3OBZA 3LEKA 5C5TA 2WFF3 5JR2A 3HBZA 3L2HA 1HB3A 4OHXA 1G6NA 1ND2A 4BQ5A 1K5MC 5CFCB 2VUDA 2MPFA 1NA1C 2YFUA 2BV4A 4PHZA 4GWMA 1R64A 2AUYA 3ZDVA 4YGCA 1OT5A 1O3RA 5IVJA 3BOPA 4XQWA 4MVTA 1HB1A 2WO2A 1BBT1 5FQ0A 2PXJA 3CZJA 3FHQA 4E8CA 1S0FA 5LZ6A 2OQ6A 3H0OA 2JDAA 1JODA 2GH8A 4JGZA 4MXVA 5C9AC 3U78A 1AF9A 3P5BA 3BGAA 1X82A 3PDQA 2BPA2 5C3RA 3HN1A 4JKMA 1IS6A 1LOFA 4ASMB 3O1UA 2DVDA 3AP7A 2WDBA 3MV11 2VVDA 3T1MA 2C24A 1HW5A 2E9QA 2J1UA 4DEQA 4D7TA 1F4HA 1W8TA 2BEOA 2W9XA 4LJHA 5A3WA 3K48A 1OQDA 1U5XA 2XBO3 5F6KA 3SITA 3W9AA 5A3NA 1JZ8A 5LEJA 2FD8A 2CAVA 5FR3A 2ERFA 4W4ZA 3DECA 4HT1T 1KEXA 3JU9A 5FZ0A 2YUEA 3GZUC 2OX0A 1NE6A 1MEC3 1BBT2 1AR63 3WW3A 1YIPA 3ALQA 3I2IA 4QPYA 1ULPA 5B4NA 2WWUA 4YYOA 3VZNA 5FTTC 3S5AA 2NMOA 3O1PA 1O8SA 4ONUA 4PDWA 3H1WA 1WCKA 2I07B 4HBNA 4WM8B 4OQ8A 1MZEA 3H1YA 3OBRA 1OOPC 3C2UA 4RD7A 4S2HA 4W8JA 4IV3B 4CCCA 3NVCA 1NAEA 3FFZA 1GP4A 2WS93 4CCKA 5AFEA 4OMDA 4YPJA 1VE0A 3RMXA 4DXTA 1EV13 2JG9A 4Y4YA 4G9SB 4YVWB 3V64A 4AAXA 2BNMA 4CCJA 1SEFA 3LA3A 3GHNA 2HWC3 4CTEA 1TZOA 5CG9A 1QHDA 4BQ4A 2DCKA 1H8VA 2R041 1ULCA 3BOWA 4FTSA 1Q8SA 4QX8A 3OF1A 4LQRA 5EYYA 4N53A 3RI8A 1NXD1 3AP4A 1UPIA 4OMCA 4XYXA 2C9KA 1DHKB 3WDVA 1W6MA 1LU2A 5FZHA 4UWDA 1Z78A 4Y22B 4Y1UA 4CVUA 5FZ7A 2BNNA 3K3NA 4BQ2A 4LBQB 4NWVA 2WNVB 2Z69A 4K20A 4Y1YA 5IAVA 2TEPA 5FRAA 4LXLA 2VW2A 4HLTA 5FY8A 3ABZA 2GC1A 5K0UC 2P2KA 5E16A 1IKQA 3DUIA 1YQ8A 5LASA 4D3WA 4R9CA 1H1MA 5FZKA 1J3PA 1HIXA 2WSUA 4LBLA 4ASKA 5JOWA 2XVGA 4MHUA 1UU4A 1UMZA 1W6QB 2R042 1DLCA 3ACLA 1PNFA 3ON7A 4OFGA 5F3IA 5GZCA 4QKFA 4MV2A 3AVSA 2ZTNA 1NY72 4AQ2A 5K9YA 3UGHA 3UL2A 3JQXA 1MS3A 1GU3A 1JXNA 2VD7A 4XMAA 4XVHA 2B9VA 2IVJA 3D8CA 1R081 1G9AA 5EWSA 2XGXA 3ZVXA 3UJOA 3NNMA 2XL9A 3VKNA 2RS53 1DQ6A 3MFCA 4EN8B 3WF2A 4KH9A 5D8AC 3EHKA 1PZ9A 2ZX4A 3UK9A 4BQXA 1UYYA 4IEVA 3N9OA 1H0BA 4MXWA 5C5UA 4FT8A 4IE0A 1IKPA 2WUHA 4RN5A 3T08A 1TNFA 5CKQA 3U37A 4AI0A 1WW6A 3I97A 2BBAA 1EYBA 2R49A 3WQ1A 3LE0A 1FPN3 2EVXA 2IXCA 1R093 3UJQA 4B7EA 1CWPA 1ULEA 5J09A 3E97A 3ZYRA 1QEXA 2VY0A 3EBRA 1NXMA 3OGVA 4XF1A 2NLRA 2A5ZA 2A75A 4LBMA 4QQHA 4AVCA 2D5FA 5F39A 1R082 4FPEA 1VB4A 3A22A 1LHNA 4AXOA 4KL1A 4Q4V1 3WOGA 5C8CA 2X29A 1Z7S1 2ZEWA 3TNQA 1JU4A 4AEDC 3R4DB 1YJLA 4QAWA 3ZFEC 4EYUA 3SQOA 1GP5A 1W06A 3NO8A 4NHYA 1YUDA 4GH4C 2W52A 5FYSA 1O6UA 4I30A 1QWRA 2MEV3 4AGRA 4CDWC 4DUVA 2FDGA 1QNWA 4FOYA 1ZRCA 1LOAA 1YI9A 2IFRA 1O5LA 1C8NA 2RJ2A 3V65A 3ZFFB 3ENRA 3PJQA 1ZBE3 2VTXA 2YXSA 2LM3A 1G9DA 1LHUA 3GGLA 2HEYF 4P9JA 4FPCA 5BNOC 1PMIA 3KT7A 3NNLA 1ZZCA 2P37A 4Q4V2 4QPIA 5H9PA 3GJBA 1NCQA 3T3YA 4CDQA 1OKOA 2ATFA 1SDWA 1UOFA 1O5UA 2JDNA 5T5JA 3TEZA 2CDPA 3AB0A 3MFAA 1US3A 2IXJA 2VULA 4IGOA 5DPNA 4C90A 5A3TA 4LTAA 3ZSJA 4QB1A 4FXKB 4LMFA 4XURA 1Y4WA 5F9TA 1Q8OA 1YFYA 5HBAA 2YGLA 3TN91 2W1UA 5KR7A 1CZTA 4CYDA 1UY0A 4ORFA 1HRV3 4Y1XA 4YWAA 1W9WA 5A7WA 3T2OA 1QMJA 1F31A 4RFRB 2VOTA 3ZOIA 3NWKA 1W6OA 1W0PA 2QQMA 1NCRA 4YZ4A 3I3MA 3HWJA 3HOBA 2VMHA 5J96B 2OIIA 2WYFA 2Z4FA 5C4WC 1CQ9A 2VJXA 5HCFA 1H2LA 4CP9A 1UZ0A 3B9CA 2D3RA 5L9BA 2J42A 3QACA 4LBJA 4B4QA 3B69A 3M3IA 5IAXA 3DV8A 5FJHA 1GUIA 3SH3A 3WW1A 3VN4A 2R0FA 4XHBA 1RINA 1V0AA 3GCXA 3MYXA 3O0XA 3AFKA 3THDA 4WVMA 4AVVA 2BVBA 4XQ4A 1UO9A 2VMDA 3PUHA 3R6SA 3NNJA 3TN92 2VOXA 1D4M3 2HKXA 4TZDA 1LODA 4M3CB 4ZZ5A 3N9PA 2VO5A 5FZLA 1XE0A 1K5MB 2ETEA 2GMPA 4IW3A 1RVF3 5JR7B 1XYOA 1RL3A 5KHKA 1I1EA 1NA1B 2VZTA 1GR3A 3VDAA 1XNTA 3DL3A 2Q8CA 1TMF3 4AFAA 4Q5OA 1HX6A 2JX9A 3PUAA 3I2JA 2EIBA 3MI8A 4DO0A 3W59A 5IVBA 1M4WA 3A21A 3PURA 3KZ4C 5C9AB 2ET7A 1W2AX 1J83A 1ST8A 1YC61 2QQIA 3SNMA 4KU8A 1N1TA 5CBLA 1J3QA 3USSA 4P9LA 4FPLA 3L9JT 3RMYA 3KQ4B 3N7KA 3BTAA 3ZSLA 2V73A 2BQPA 3A23A 4BE3A 4CPBD 3WP5A 1CZSA 2ZEYA 4COUA 4DXSA 4FOWA 3FHAA 5L7OA 3T4HB 5CA6A 4PLOA 2HEWF 1JYIA 4Y5Z0 3GF6A 4FOQA 1RHI3 4KBBA 1J58A 5BNPC 5F5AA 5IK4A 4BMEA 2ARBA 3FE5A 3AMMA 3URFA 3CJIA 5JCTA 4HANA 2G1MA 3OBTA 4XQDA 2QQWA 4M3CF 3J7MA 1NG0A 2WLPA 4NHXA 1NYWA 3E1F1 2EXHA 4XUNA 5K8SA 1XXNA 1C1FA 3TOJA 5DXDA 5C70A 2DCZA 4LBKA 4LKFA 2WNOA 4QWNA 4O65A 3UESA 1X9TA 5GLTA 2TBVA 1UZVA 1OOPB 3B94A 4IEQA 2FCUA 2XLGA 3WP3A 4Y3OA 1BBT3 1DZRA 4P9GA 4KWLA 4NE9A 5JUVA 2Z2SB 1X33A 2X09A 1DGWX 3ZIXA 2EALA 1C57A 1Q8QA 1RUF3 2HWF3 4HN0A 4L11A 4TLFA 4I0AA 2XB6C 5FY5A 1W99A 1Y9MA 1CJPA 2FQPA 2BBVA 1XNBA 4UF0B 3AKSA 3WNNA 5IK5A 4GB33 5FFOC 4CEYC 3ES4A 3POYA 5I0TA 4AZZA 5I8YA 1BLZA 1RJ7A 2QFEA 3J7LA 4H3WA 1WD3A 3WF0A 2NP0A 1IPJA 3IT8A 5FKCA 1CAUA 3LSEA 2W08A 4Q29A 2GN7A 1U5ZA 4MOAA 2PHUA 2YC4A 3AMQA 3QH6A 1MZ5A 1ZNPA 4I0BA 4QPGC 2AR6A 3THTA 2XVLA 1X8EA 3W5MA 5JWPA 2BNOA 2RDQA 2VCCA 4MGTA 5DDJ2 1FI2A 1VRBA 4KNCA 2OXBA 2WFF1 3JQWA 3IPVB 4GWJA 4IE5A 2FDHA 1LULA 4QX1A 3H3ZA 1WCQA 5CFDA 5K0UB 4MUVA 5EXOA 4CXYA 5DAPA 1J84A 3JBG3 3OGRA 4LK6A 5G04L 4BK4A 4P9YA 2J1VA 2R30A 2XQXA 4GIQA 1XNDA 2NMNA 1MZFA 4UFIA 1Y9QA 3C7FA 4P5HA 4QDRA 4XBNA 1OF3A 2OT7A 2Y6KA 5FBZA 1GZTA 5D1IA 2Q1MA 2O1QA 2C5DA 4J1WA 3VV1A 1S1AA 5A32B 1QOTA 1JYXA 4UXAA 1L3JA 5LEKA 2XMLA 2LS6A 2R0HA 4QQLA 5GKAC 2YROA 4CSWA 1OLMA 2E6VA 5BNNA 5D8AB 3ILNA 4UW5A 4QGMA 5ABJC 3VHOA 3B9IA 3WDYA 3HMYA 2WFF2 2WZPP 4CZSA 4FI9A 5FUNA 4QQ2A 1GMMA 3PHMA 1REFA 3BU7A 1SBFA 4NIIA 3SISA 2WRAA 5JZGC 1V6IA 3PUQA 5F3CA 2A6ZA 1IGOA 3FFQA 3T09A 3WG4A 3ZSMA 3ZPOA 5LRSA 5A33A 1MEC1 2IXLA 3AX4A 3S30A 1AR61 3J7HA 2ET1A 2OW4A 3N35A 1GQHA 4IV1A 1CAWA 2XJSA 4XJ9A 1LB2A 2VCMA 1RUNA 1UMHA 3K3OA 1YFUA 3I3EA 4UFLA 1AL21 4OI1A 2G9FA 3H7JA 1W90A 1XC6A 3RYPA 4AEDB 5FPZA 3ZYIB 3R4UA 2D6LX 5HXVA 4ARXA 2CY6A 1VBA3 2ZHLA 3ME2A 4NPLA 3B02A 4NJ4A 3ZFEB 4B1LA 3ZR5A 4FFIA 4BMBA 4CP2A 1DYKA 5IVYA 4GH4B 2WS91 2Y6HA 1SPPA 4CDWB 5HI0A 2FCVA 1GLHA 3MW4A 3ZMNA 3ZR6A 4GALA 1KITA 1R1A3 1SG3A 1EV11 4I3PA 3LDKA 2VCAA 3Q8FA 4JAAA 3RVHA 4CU9A 1SBDA 1XBFA 1RUH3 1MEC2 1FX5A 3FZ3A 5A3MA 4DY5A 1AR62 1J1TA 1FYUA 1IS5A 2ZGOA 5C71A 5JMOA 5BNOB 2E7TA 3MIFA 1UIKA 2VZVA 1JZ5A 3ZXFA 5KWRA 3RGBA 1AL22 3VLBB 2AYHA 3K77A 1E5HA 5FYMA 5IK8A 4OLLA 3TAYA 1LHOA 1TNRA 3AYEA 3CL1A 3ZYJB 4YW6A 3O1VA 4UFMA 1PK6A 3ACHA 3VBOA 5J7MA 4JV4A 2WS92 1I5PA 4DXRA 3FX3A 3LOIA 2H6BA 3POFA 2GH2A 1EV12 4CDXC 1OQ1A 1QDOA 3E5QA 4BJ0A 2E31A 2VTXJ 3SXWA 3I8TA 3WF4A 4COYA 1VRH3 2DU0A 4LLFA 1SCSA 2DVBA 1Y9GA 2RV9A 4FFFA 3SC7X 3KV6A 1X9PA 5C4WB 5SV8A 1HB2A 5D2AA 4LA2A 4AI1A 4CXWA 5F5IA 5CFCA 4D6SA 2W2IA 2JE7A 2A6VA 3T0BA 4EQVA 3ST7A 2VBPA 4HK9A 3VBSC 1YYNA 2RS51 4XPVA 4NRQA 5CZKA 4KG8A 3C7OA 2VE1A 5G05L 1SZBA 1DP0A 4QB2A 1F9KA 3UT0A 4YSFA 1M06G 2JKBA 2QBXA 3E6CC 1ODNA 4XUTA 2AC1A 3VBHA 3ZO0B 5DAQA 4HVOA 4MGKE 1UXZA 2WO7A 2YMZA 2TNFA 2WLQA 2W95A 1KJRA 2A1XA 2CGNA 1FPN1 2XKOA 3RZJA 1OUXA 4PI2A 1R091 3WD5A 5FZMA 4BA6A 3LPGA 1BHGA 2W5FA 3LKJA 2JECA 3QD6A 1ZYBA 5I0SA 2HEVF 2ILMA 4HKWA 4INDA 4NN0A 3MICA 5F7UA 4LHKA 3VKMA 4FSJA 1NLSA 1WLWA 1HKDA 1XPWA 1WBFA 3EJKA 4X8PA 4DY3A 1OC1A 4N43C 2O8OA 2Q5TA 1UYPA 1Q3EA 2CV6A 4JVAA 2RDSA 4I01A 1N3PA 2GZWA 2HYKA 2ZGKA 1A3KA 1U5IA 4LLOA 3IDAA 4J1XA 2FDKA 4OHZA 2UY8A 2D3PA 2VL4A 1X8MA 1CAXB 1QGLA 2MEV1 3HBKA 2BJSA 3AMNA 3DPRC 2Q30A 2XWJB 3ZYHA 3VZOA 1SLLA 4LKDA 2A71A 1G9FA 4UYBA 1QKQA 1R092 1XE8A 1W2TA 3M3OA 4WM8A 4AQSA 2J1AA 4GQ7A 5BNPB 1UAIA 2EIGA 1KFUL 3GZTB 4IV3A 2ZZJA 1ZBE1 1OVPA 3I49A 4YZ2A 4W65A 1SFPA 2RHPA 3ZDSA 3AMPA 2P4EA 1W8WA 3GBGA 1POQA 2LRPA 3JCIA 1D0GA 4D94A 4YVWA 3VZJA 1I3HA 2VM9A 2ARXA 5C33A 1VJ2A 3H8OA 3AKTA 4KMQA 4AHXA 1LNSA 1S0BA 1XE7A 2RMU3 3JZVA 3KHCA 2ZAAA 2JD9A 4LPLA 1TME3 4A41A 1CGPA 1HRV1 2VMIA 3S7IA 3DGTA 1POV0 4UFJA 4Y22A 2FDJA 4E2GA 1TVGA 1O3TA 2D97A 3LDBA 5IVFA 1OA3A 1ZBE2 2B42B 5FYCA 3UETA 4TYSA 4LBQA 4A45A 1WUVA 1LAJA 5FO9B 2WNVA 4CEYB 5GM0A 5KXBA 1DBNA 4O9GA 3POSA 1D7PM 1SCRA 2EIDA 5AVPA 5FOBB 5DAWA 5EJ3A 1ZZ9A 2D44A 4W6WA 4Y20B 5T3NA 3THPA 4HK8A 4OHWA 1F5JA 3HNYM 4PIYA 4XUPA 5KC5A 3RJ2X 4WV8A 4QPGB 1Y43B 2B9UA 1W6QA 2KXLA 4UW3A 2VNVA 2XUMA 2XKPA 4XXPA 4AI3A 2VCBA 5IFPA 5KHGA 4QHBA 3GALA 4V2WA 3V56A 2W1SA 2WKKA 2WQ4A 5DQ0A 4CCNA 5EV7A 1D4M1 1RGSA 3UGGA 5FOJB 1JYTA 1AX0A 1JMUB 3BPZA 3K2OA 1HRV2 2J1RA 3MIDA 3OUIA 3QH7A 4CUAA 1JOPA 3WLUA 5D21A 2PTMA 4PT6A 5F2WA 3P3PA 4Y33A 1V6JA 5JOZA 1TMF1 2ZGRA 3LFMA 4JX0A 5FZEA 3P3NA 2LUWA 1AR73 3BALA 2UWAA 2V5YA 1XNKA 5FV3A 1XU2A 5DDJ3 1F15A 1FAYA 1YFWA 4YW1A 4NHMA 2ZMKA 3J8F1 3W21A 2XXZA 4FPHA 1LCLA 5FZ8A 4DZGA 2DCTA 5ABJB 1ND3C 2XWBB 5IFTA 3S6PA 2OS2A 3O1RA 2PHRA 3B00A 1D4M2 4GJZA 4OUEA 3S0MA 2EF6A 4A42A 4H14A 1RUE3 3OEAA 3VDDC 5JZGB 1HQNA 3RZHA 2J7MA 1PMJX 1RHI1 2Y0OA 5GZGA 1O4TA 4DS0A 1TMF2 3LDRA 4OHVA 5EJ1B 2VQ0A 1WLTA 4RGAA 4UT5A 4M0NA 4A6OA 3ZMOA 2G4IA 2JICA 3HVDA 1GOHA 4A3ZA 2FBEA 4QQOA 2WNEA 3UV9A 5DZEA 4KU7A 1WLCA 4K3UA 5HPOA 3AXDA 1DGLA 4FTEA 1MS1A 3B01A 1STMA 2GAUA 3HQUA 2O0OA 3J8F2 4WM7C 1LHVA 1W04A 1WMEA 3LQCA 5ANNA 3ZFFA 4HG6B 2FZ1A 4ZXEA 4AVBA 3AL5A 1MQTB 4UAPA 2D40A 3KT4A 5E6HA 3ILRA 5FY7A 2XJQA 3CBNA 1W6NB 4TN7A 5GZFA 5IVCA 4Y4RA 3U14A 3M70A 3PIJA 1PO13 3G6JB 1AYN3 2VW1A 1XOYA 2VZPA 2DFCA 2HWF1 1RUF1 2YBPA 3IMNA 4FCAA 3IIIA 1N1VA 4XILA 5SV5A 1RHI2 4XDPA 3VBFC 2V4AA 5KXCA 2FDIA 3OY8B 4RSUA 1MVEA 2PHFA 1Q43A 5GALA 2VECA 1DZTA 1X50A 1W0OA 3WX5A 2WT2A 1RUD3 3DKWA 4IGPA 4BHPA 3BKZA 4B29A 2WWSA 4X8NA 4GB31 4OQ9A 4CDUC 3OPWA 3AZYA 1DF0A 4Z82A 5F32A 3ZFGC 3RZMA 4XACA 5FDBA 2RVAA 1C5IA 4GD4A 1SHWB 1WZXA 1UPSA 4CCEA 2ZAHA 4L92A 1DDLA 1YJKA 2VGDA 1CN1A 1D2QA 4C1XA 5FZ6A 3LOBA 1VR3A 4AEMA 2VZSA 2WINB 2D6MA 1C5HA 1YQ5A 3N3HA 3ZXJA 4JDMA 3N4MA 1QH7A 3OYWB 4XUQA 2RR12 2X10A 3OUHA 5DZGA 4DRRA 2HWF2 1XSQA 1RUF2 4UFKA 2C6SA 4AG4A 2XPJA 1AZDA 2E51A 5JMCA 4CDXB 3U4SA 2CNAA 1AL23 3JBG1 1KQRA 1SACA 2V4VA 4HSJA 4IETA 4Q0PA 4R9BA 5BUVA 1PGSA 4I0WB 1CZVA 1EUUA 2PHLA 3FBMA 1HDKA 4N90A 5BYNA 1TG7A 1GV9A 2KM2A 4GB32 1H8TC 2V09A 1PZ7A 4LHSA 4IESA 4P00B 1H1IA 4MO3M 4EWEA 4M3CA 2GP3A 4BM8A 1C8M3 2R32A 2WNUC 4IDZA 1K5MA 4EE2A 4N8MA 2ZCWA 2PLV3 4PBOA 3SKJE 1NA1A 5CIRA 3VBSB 4DUXA 1ZZ6A 1LHWA 3HT1A 1Q8PA 3MPBA 4OZOA 3EO6A 1A34A 2DDUA 1IG0A 4RYDA 3TEXA 4YGDA 1RUOA 3NV4A 2BYVE 4QHZA 2CWMA 1QXRA 1W28A 3OG2A 1VPHA 1ULGA 1NY71 5C9AA 2QQPA 2BZDA 3Q9OA 4HKOA 4CP1A 3BTZA 1ALYA 2VNGA 1WA4A 3AZVA 2IFWA 3JBG2 2VUJA 4XABA 1KDKA 1FMD3 2WT0A 3IWZA 4EN0A 1HXS3 1RUJ3 2YPJA 3M3QA 3IDBB 1WW7A 1ZRIA 2IC1A 2W87A 3SMHA 2WBKA 3BUCA 3I3BA 2Q1ZB 1WLDA 3WNOA 2HYXA 2DFBA 1XB9A 5EIYB 4LHNA 2F4PA 1QJX2 2A70A 3AP6A 1OURA 5J3UA 3ZXKA 1VLNA 4AVSA 1DCSA 3E6BA 5A3OA 3WINE 4CCLA 4XIOA 3RJRA 4OCTA 1VAKA 3WVJA
chains in the Genus database with same CATH topology
4RFT0 1GZWB 1KRIA 4OI0A 3VUOA 1VBA1 1B35C 4OVEA 1KS4A 1H9WA 1VBD3 2ZX2A 3AZZA 4PJYA 3USUB 4P14A 3ZFGC 2QJVA 4QM8A 2DVAA 2QCSB 4A3XA 4F7ZA 4DQAA 4EROA 1R1A1 3NAPC 1PIV3 4BLJA 4C1WA 4XFIA 3FWEA 4XE9A 3WDXA 4URTA 1A6CA 4OHYA 1OOPA 3U4XA 1WCSA 1RUH1 2VW0A 5DUUA 1UZYA 5CB7A 5GLVA 3I59B 1UKGA 3SHRA 4HPKB 1J59A 5BXXA 1VBA2 2FMDA 1QJY1 2GSYA 1SBEA 3EXUA 1IPKA 2AZ5A 5FAXA 4FAHA 1SLBA 1NCQC 3VBUC 1PGL1 1TEIA 3W58A 1R1A2 1SLCA 2HWB3 5FLIA 1MS5A 4F8AA 3ZSKA 1VRH1 1XRUA 3LCPA 4BYYA 1D0HA 1RUH2 2NN8A 4M01A 1ZX5A 1U5YA 3LAGA 3C3VA 5BPXA 1OSGA 1Q5OA 4L99A 1F2NA 3S7EA 3IPVA 3MLLA 4FQ4A 1H4GA 5E1RA 5K0UA 2HWD1 3E5XA 1PVC1 1UU5A 4E4SA 3ZXGA 1NCRC 4AFDA 1V6MA 3PMEA 2UWBA 3KCYA 1FT9A 5I93A 1QJY2 2C9AA 2B39A 2JG8C 3APBA 4MSVA 3RPQA 5A32A 1PGL2 2UYAA 1WGPA 3NL1A 1VALA 5GJ6A 4ZU5A 3MIHA 4ES9A 2AGSA 1JOJA 2ZGLA 4LE4A 4MGYE 2WC2A 1VRH2 4SLIA 5D8AA 1RUI3 2DUQA 2ZX0A 3K51A 3R4SA 4H7LA 4U2AA 5JDBA 5B2GB 3AJZA 3NKGA 1HQLA 2HWD2 1GYKA 1PVC2 2PAEA 2QNKA 1OQEA 1TE1B 4K21A 4K6BA 1VBB3 2ZBJA 4YZ1A 4EN7B 3IM0A 1LGCA 4FQZA 1ND3B 5KXDA 1QY4A 2TUNA 1GNHA 4GULA 4V1PA 3GYDA 1OD5A 2LALA 4NHLA 4RQPC 2EXKA 3U10A 2E53A 2RJKA 1W2UA 1LKNA 4Q4X3 3VDDB 5KHIA 1UW8A 3WR0A 4AEDA 3LWCA 3ZFEA 2DURA 3VZLA 1AL0G 2GNMA 3VZMA 4GH4A 5KBFA 2UU8A 1AYM3 4CDWA 1XYPA 4RHV3 1UZZA 4MX3A 3A4UA 4Q4Y3 3KM5A 4WM7B 4FPOB 2ZABA 3AKQA 1MR5A 1OA2A 3PVEA 3I7DA 5BNOA 1REEA 1OMIA 2RMU1 3B7MA 2RM23 2YGMA 4IEXA 2DUOA 4AYUA 4JGYC 3JD72 1MS8A 4FPJA 4XOGA 3H50A 2R071 3B5LB 1IS4A 1TME1 3VBFB 4JDNA 3V0BB 3J8F3 4IEOA 2BWAA 4GA9A 4XFHA 1A78A 3KMHA 3M4FA 2ES3A 1CESA 2GU9A 4WZCA 4CDUB 4GKYA 4AHZA 5AC93 4M3CE 3GBFA 1AR83 2Q8OA 4XTPA 3MW3A 4D69A 1ENXA 5EYXA 3I4IA 4M00A 4DOUA 4XFBA 2DVFA 5TSWA 3ZIWA 4IEYA 2B5HA 3HD8B 1PVXA 2RMU2 2SBAA 2MHFA 3WW2A 5C4WA 1APNA 4AVTA 1H2NA 4QGNA 4Y1ZA 2R072 1TME2 4HETA 1H1AA 1S0IA 3V0AB 2OPKA 2W39A 3RYRA 1ULDA 2WJSA 2DVGA 4A2UA 4MGZE 1H8TB 1HV1A 1G9BA 1AR71 4PIZA 2RR13 4FPGA 2WNUB 1DQ4A 4R52A 5DDJ1 3OCPA 2GC0A 2P3IA 1UD1A 4Q4W3 2ZGTA 2FZ2A 1V70A 3MIBA 2VMGA 1AXKA 3CF6E 3VGIA 4NWWA 5A3LA 5CAZA 1W39A 3KD4A 5GZEA 2D6NA 4PBPA 2XL7A 3N7JA 4Y24A 4JC1A 2BW8A 5GZDA 1RUE1 5CNAA 3FBYA 3O0WA 3WNXA 3WY6A 2ZHNA 2WIIB 3RDIA 4W6XA 1AR72 3IN9A 4XFCA 1FXZA 1CAXA 4N9HA 4PF5A 4ASLA 4LHLA 3AXEA 3D6EA 3OD0A 5BNPA 2A6WA 5JSOA 1B35B 1YHFA 3VKLA 1BZWA 3ZFGB 3WUCA 1PO11 1AYN1 1QJX3 1RUE2 5J37A 2VNRA 3NAPB 5H9SA 3ZSEA 4FTBA 1V6LA 1RUD1 1OFSA 4CEWC 4LEJA 1O4ZA 3VHNA 4XHXA 4GMP0 3VBRC 3WUDA 3O7OA 4L2NA 4BOWA 1CAVB 3SCHA 4QD2A 1YLLA 2ZHKA 4Y20A 1PO12 1AYN2 4LA3A 3ATGA 2X53S 3VBUB 4FXGB 1IHMA 1AR93 3MW2A 4QPGA 5BV6A 3WW4A 1I5ZA 1JHNA 1RUD2 4DINB 1HQWA 2BTVC 2JE9A 3RI9A 2QZ2A 1OI6A 3M3CA 1Y3TA 3FMGA 1C8M1 4Q0VA 3TBDA 4ES8A 2DYCA 1V00A 2JD4A 2PLV1 3O14A 1NCRB 3FUQA 2XH6A 3RQ0A 2JG8B 3WG2A 4YVSC 4AHWA 1FOD3 1XU1A 3QOPA 1EY2A 1UF2C 2LTNA 2XJRA 1SQ4A 1F5FA 4RS5C 5DG1A 2PAMA 1UKRA 4WZFA 1FMD1 1AJOA 5ABJA 1HXS1 1RUJ1 2R6QA 2A6XA 1YRZA 1H2KA 1YI7A 2I74A 3LZZA 4L8QA 4LNVA 4TWTA 3VBHC 5C6CA 3VHPA 2Y26A 3AKRA 1QJY3 1W6PB 1C1LA 3I2DA 4UW6A 1C8M2 4E4ZA 4KGGA 2VU9A 3CJXA 2C1FA 5JZGA 2PLV2 2VVFA 4ZU7A 2IXKA 2WT1A 2HJIA 1RC6A 4R9AA 3O5SA 4WVVA 1G8WA 4YW4A 4JRAA 1VBD1 2HWD3 4RQPB 4HVRA 4XZPA 3AYCA 2NYYA 1PVC3 2B7YA 1FNZA 1FMD2 2ZMNA 1HXS2 1PIV1 1MQTA 1RUJ2 4RGGA 1POV3 1NQDA 4NPRA 4S2DA 3IIAA 1W6NA 3AYDA 1RITA 2DUPA 2WA4A 2P34A 1V9U1 1ZVFA 5KHHA 1A8DA 2PYTA 1DU3D 3KB5A 3OY8A 2K0GA 1LOEA 5F1RA 1ZZ7A 3RNSA 2ZX3A 1MACA 5T54A 5JI7A 1VBD2 2XLAA 4JGYB 4WVZA 3VL8A 4LUMA 4LBOA 1PIV2 4EV0A 2HWB1 2K9ZA 3OD4A 3MF6A 4HN1A 3TB0A 4PQ9A 2A3XA 5E8AA 3RG0A 1MS0A 3OYWA 2ZKLA 3CU7A 3WP4A 1QQP3 2QZ3A 1V9U2 4RR3C 4XJAA 2DTWA 2HWE3 2ZGMA 4FVVA 1SLIA 4XEZA 3SH4A 3JD73 1OPMA 3ES1A 3T1LA 4XJZA 1WW4A 4YGBA 1X36A 3FUOA 4I3GA 2ZHMA 4EN6B 3E6DA 4K8FA 3VHRA 1WMFA 3GBWA 4BCUA 4I09A 4ZKTB 1LRHA 4OUSA 3WG3A 4HFSA 2DF7A 4I02A 2HWB2 2CTVA 1RUI1 1SFYA 1UN1A 1ZA4A 3B3QE 1ASJ3 1KXGA 1YFXA 3MLKA 1KFXL 1LTEA 1UIJA 4BH9A 1OA4A 1QDCA 2PHTA 4B8EA 2R073 2I2SA 1CONA 2A3YA 1VBB1 1IQAA 3BIWE 2ZMLA 3MDPA 4IXLA 3AJYA 1N3OA 1S0EA 1B09A 4BZ4A 4RL7A 1LENA 3WP6A 1ENRA 2PHDA 2PAKA 2X5IC 5FCCA 4DPNA 1NZCA 3AP9A 4Q4X1 1VAVA 1RUI2 1GZWA 2UY9A 4DMIA 5DUXA 4E2QA 1QJU3 2JENA 1PZ8A 4AHYA 5DUVA 3EQEA 1DQ2A 3USUA 1AYM1 2RE9A 4XXAA 4RHV1 3L2YA 1VBB2 4Q4Y1 4P9WA 1QF3A 2GC2A 1MVQA 3R05A 4AVAA 4BWOA 1FNYA 3SLIA 3NV2A 3VKFC 3AZXA 2RM21 3WXPA 1ND2C 4ISQA 2JJ6A 3I59A 2BFUL 2H0BA 4Q4X2 4HPKA 3SCGA 1NLRA 4YLZA 4UBHA 4IEZA 4MH0E 1HRI3 4CEWB 2DCJA 3NKTA 4TSVA 3HIFA 4HKLA 1AYM2 4RHV2 5I8SA 4JGZC 1COV2 4KWKA 2YV8A 5AVAA 4EWAA 5AC91 1YNAA 1S2KA 4Q4Y2 1AR81 4LBQD 3RZZA 1QOOA 1LOFC 3IDCB 3VBRB 1O4YA 2ZKNA 4MLOA 4XETA 4DNYA 3LB9A 1GKBA 5LK5A 2RM22 4R4ZA 4AEJA 1OPOA 4K9SA 1RIRA 1CR7A 3MIEA 2GC3A 4AW7A 4YG6A 2NPIA 4AE2A 1DQ0A 2RS13 5ACA3 1WBLA 2PHWA 4AGVA 5KXEA 5AC92 1SLTA 2RR11 2E7AA 1AR82 1GFF2 2EXJA 4Q4W1 5T55A 2VPVA 4PDWC 4R8HA 2WA3A 4ZXKA 2WZR3 2PFWA 1S0GA 1ZM1A 3INAA 1AUYA 1QJZA 2ZPXA 4GWNA 4YVSB 3WDWA 2D6PA 4ZU4A 4Z1VA 3KS7A 1BQPA 1LOCA 4B3NA 5DZFA 2JG9C 4RS5B 3AZWA 5GLUA 3WHTA 3QBQA 2RS33 1NQJA 1ND3A 5KHJA 5AFBA 2OUJA 1BVP1 1JTZX 2QKDA 4GKXA 2FHRA 4XMIA 3VBHB 4FP3A 4DB5A 2CL2A 4AGGA 4FBFA 4N53C 4FAGA 4P9XA 4Q4W2 2VUAA 4FPKA 3VDDA 1JUHA 3ZXLA 1OLRA 4YNIA 4A7YA 3ZN5A 2UWCA 4H55A 1CPNA 5L19A 3FHIB 1JUIA 2ZX1A 4JRLA 5H9QA 1ZREA 4L9BA 1H2MA 3FLPA 1H30A 2MNGA 3PVNA 2P3KA 1BYHA 4PLMA 4WM7A 1QJX1 2JEMA 3ETQA 3NJZA 1CX4A 4E4DX 1OHFA 2ZS6B 2Z5WA 3NV3A 1WD4A 3ZXEA 1UU6A 1QXPA 2R063 1KJLA 5F5QA 1I6XA 4QU2A 2D43A 1RTVA 3AYAA 4Q2FA 3VBFA 3FJSA 3V0BA 4DFSA 4JQRA 2VOVA 5T52A 4Y26A 1REDA 3ZN6B 4COWA 4XF9A 2ZGNA 4CDUA 1DQ1A 3CLPA 3A0KA 1YWKA 1Y7BA 3FLTA 5CVRA 5I0RA 2PQQA 4BLIA 2BWCA 2XJVA 1AR91 2UYBA 3H1MA 2UURA 1LOBA 2GN3A 4LO4B 4N43B 3ZN4A 3ASIA 3T2TA 4WVWA 2A73B 4QMAA 1LGNA 4NVPA 1AXYA 1J3RA 1PM7A 1N47A 4RR3B 5F6LB 3X29B 2D93A 3SH5A 4KWJA 5JSPA 3V0AA 2BGCA 5E88A 5C8CC 1WCDJ 3DPRB 5JPNB 3AK0A 4AI8A 1BCXA 4LO5B 4QGLA 1H8TA 1BVVA 4X6RB 4K1YA 3RRDA 2WNUA 5LK7B 1FOD1 1RB8G 2OYZA 1V9U3 1VIWB 1XYNA 1AR92 2XVKA 4Q1PA 1EPWA 3LA7A 3WDUA 1BEV3 1ZBA3 2A7AA 1DYPA 3BB6A 2EA7A 5FMOS 3ECQA 4RA0A 5I8TA 4HZFA 2AENA 4BMBA 4L97A 3MIGA 4QPIC 2KA3A 4B7KA 5CADA 2QE3A 3ROUA 3AFGA 4X6QB 2ZGQA 4CDQC 4XIKA 3GNEA 3BCWA 2GMMA 1WW5A 2Q4SA 2W0XA 4Z2WA 3GHMA 1QH6A 1FOD2 1UL9A 3ZPYA 3QCWA 1VBE3 5LRRA 2X5IB 2Y38A 5T5OA 1RUC3 4Z8BA 1KS5A 4B4PA 3PLQA 1V6KA 3D0JA 3WDTA 1NE4A 1POV1 1AX1A 1OLQA 2XJTA 3UKTA 1B35A 1KDMA 3ZFGA 1SMVA 3UKNA 2R1DA 3IBMA 4AI2A 4U36A 2EAAA 3PVOA 4KGQA 3NAPA 5GLZA 1LEMA 4BIOA 2A3WA 2I45A 2ZA9A 4D7SA 2QDNA 1DG6A 1ZRDA 3JUUA 3RSJA 4N7IA 3E5UA 1E57A 1ND2B 5JIUA 1LESA 3JB8A 1U12A 4JTOA 4AFBA 5L73A 4OULA 3TRSB 1DZQA 2DWRA 3CNAA 3PJYA 1CAVA 5FQ0B 1EAH3 3MPPG 3I54A 4FO9A 4HMZA 3WQ0A 1QQP1 1XNCA 4JGZB 1Z7S2 3VBUA 2QDRA 2HWE1 3H3UA 3MF9A 4W6YA 4IL7A 1JH5A 3MEPA 4AQ6A 5EFUA 3JD71 1VBC3 1H4HA 4E9KA 3KGZA 2BVVA 5JSRA 2YHJA 3U07A 5L7OC 1C28A 1PNGA 4IEUA 3KSCA 2K2SA 4LBNA 1RMU3 3ILFA 1O3QA 1COV3 1S55A 1WMDA 4Q27A 3N7MA 1C3HA 2YY1A 4M0HA 4MYEA 1LU1A 3TNPB 4YZ5A 1PO23 2JG8A 3CJIC 5DUWA 1QQP2 1ASJ1 2Y0IA 2JXAA 2N7GA 4CP0A 2HWE2 2ZGSA 4SBVA 4PDWB 1BXHA 2IXIA 1SFNA 3N36A 3ZXDA 5J98B 2P17A 4AEKA 1D4VB 1W6PA 1ZZ8A 1G86A 1LOGA 2D7FA 4ATEA 3M1HA 3IDEA 2PELA 1LJ7A 1RUG3 2JG9B 5K7PA 3U11A 4LT5A 3GZAA 5JOYA 1IOAA 1HV0A 5JVVA 2C0ZA 4MGIE 1QJU1 3WG1A 2YC0A 1ASJ2 2CAUA 3AP5A 2VXRA 3FLRA 4N53B 4RQPA 1MS9A 2YDEA 3KCXA 4ISRA 5FPXA 3ZYPA 1W6MB 4E27A 4KQ7A 4P9IA 1X7NA 1AXZA 3B93A 4GMP3 1YO8A 1ZZBA 3OTFA 2OVUA 4Q0SA 4XDQA 1O7FA 4YGEA 5JI9A 2NQYA 2JDZA 2BFUS 5CFDC 5E89A 1GZCA 4LULA 1EP0A 4NR1A 2CGPA 4G3YC 2IWGB 3A0NA 3PTYA 4K7JA 4PLNA 5JLVA 1QJU2 2AREA 1N1SA 4S2GA 1JW6A 1HRI1 1QNYA 5CU1A 4JGYA 1LR5A 4N7UA 4EN9B 3O12A 2VQAA 1EPZA 3M8LA 2A6YA 3POWA