3N35A

Erythrina corallodendron lectin mutant (y106g) with n-acetylgalactosamine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
242
structure length
242
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGGGYLGIFNNSKQDNSYQTLGVEFDTFSNQWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPETND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Modification of the sugar specificity of a plant lectin: structural studies on a point mutant of Erythrina corallodendron lectin.
pubmed doi rcsb
source organism Erythrina corallodendron
total genus 50
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n35A00
5FREA 3NWKA 4XXAA 4Q8LA 1BJQA 4C1WA 2JE7A 3WUDA 4FPJA 1UKGA 5CA6A 3N35A 1MZ5A 1MACA 1KRIA 2D6LX 1S0BA 1ULCA 2ZHNA 4ZKTB 4FPKA 2CY6A 2UWAA 3AP6A 3FUOA 3WV6A 1Y7BA 3AYEA 4XXPA 4XBQA 2VW2A 4BOWA 1QMJA 1YIFA 1HQWA 4TYSA 2D43A 3BIWE 4FPEA 5JOXA 3VUOA 3I4IA 1BKZA 3ILRA 4LBJA 3MW3A 1G9FA 5CBLA 4JC1A 1QDOA 1KDKA 1WBLA 1LCLA 1G8WA 3ZSKA 4F83A 1LENA 3WDTA 3BOPA 3RSJA 1WLWA 2DVAA 3O0WA 2D44A 4LBMA 3B9CA 5KXCA 1GKBA 1N3OA 4W65A 1G86A 4ITCA 4YG3A 5EWSA 5EYXA 1G9BA 4FOQA 4GWMA 2ZABA 2ZGKA 3OJBA 4U36A 4XJ8A 1IS4A 2ES3A 3ILFA 2EXKA 3FLRA 5CAZA 2NMNA 2VUAA 3D6EA 3I8TA 3AP7A 4K21A 4YFZA 3NV4A 5SV8A 2R0HA 1ENSA 5JOYA 2EAKA 3M3OA 1W6MA 1C1LA 3AP4A 5DUVA 4YZ5A 4JRAA 4OZXA 4DFSA 1G9CA 3WDVA 1RIRA 4M3CA 4GKYA 1GNZA 3WHUA 1WD4A 2PHRA 2A7AA 2PHUA 5JOWA 1ULEA 1HQLA 1LOFA 1SBDA 2GNTA 1DZQA 4ISRA 3UJOA 1KJRA 1LHNA 3ZYPA 1C4RA 3GALA 2NYYA 3WLUA 5IK7A 1AX1A 1CPMA 4YZ1A 1J1TA 3ILNA 4CZSA 3ZXKA 5JOZA 1AX2A 1HLCA 1EPWA 1ENQA 4WV8A 1O4ZA 5T5JA 1NLSA 1DQ0A 2UU8A 4C1XA 1IKQA 1UZZA 1V6IA 1S0DA 2AREA 3U4XA 3HR9A 2DURA 2GDFA 3DUIA 1SLIA 3B00A 4R9CA 5DZFA 5DZEA 3HN1A 1YRZA 4XJZA 2OVUA 3N7MA 3AZWA 5FRAA 5F9TA 1Z0HA 4RA0A 1VIWB 4GA9A 1LGNA 3WOGA 1CR7A 1NXD1 2JECA 2NP0A 2W68A 1N1YA 4FPLA 4LBKA 1UN1A 4PBOA 4YG0A 3ZSLA 2P2KA 3USUA 5DZGA 5E8AA 1VLNA 1ONAA 5GLWA 2YROA 1DYKA 4FPGA 3PVEA 3AJZA 1W0OA 4FPCA 5T5PA 3V65A 1KJLA 1S0FA 4XIKA 4Y1YA 2E7TA 4LBQA 1WW5A 3JUUA 3WDWA 3OYWB 4YGEA 2E7QA 4XBLA 3VKLA 3N7KA 5DUWA 3WCSA 2JKBA 1QOSA 2WLQA 2AYHA 1QU0A 1S0IA 3TB0A 2CWMA 1IS5A 2AR6A 5IK4A 2D3SA 1AXZA 2ZGUA 2UWBA 1LOFC 2W08A 3AYAA 3VKNA 1CESA 4R9DA 2ZHLA 4RL7A 1HDKA 1LEDA 4XJAA 5H9RA 5JLVA 2CNAA 1QF3A 1W6PB 2ZA9A 3IPVA 4D69A 2NN8A 4Y1XA 5E88A 1UAIA 2WNEA 4LBLA 1GSLA 1S0CA 1AVBA 2RHPA 1V6JA 2D3RA 4K20A 4R9AA 5DG1A 3INAA 3PVOA 1F31A 4P9WA 1DQ2A 1WD3A 4XYXA 5GLZA 3V0AA 5JDBA 1GBGA 1N1TA 2SBAA 2A5ZA 3B69A 4K1YA 2AH2A 5T55A 4Y22A 4YZ2A 3N7LA 1O4YA 1MVQA 1DFQA 2EXIA 3M1HA 4FP3A 4Y26A 5GZFA 1AX0A 1CJPA 4H55A 1Q8SA 4NO4A 2A3WA 5EYYA 1FATA 1JW6A 3FLPA 2D6NA 2GN3A 1SBEA 2JJ6A 4M3CF 4M3CE 2GMPA 3QLQA 4BLJA 2D7FA 2KM2A 4UW4A 3ZPYA 1W6NA 4Q8KA 1JUIA 4FQ4A 1URXA 2WT2A 4XDQA 1BXHA 2ARXA 3H0OA 1GANA 2WKKA 3IMNA 4Q1RA 4Y1UA 4YFWA 4FQZA 4P14A 2A6YA 5L73A 1WLCA 4Q27A 2CYFA 1SBFA 5T5OA 1LOEA 3M3CA 1SLBA 1FNYA 2ZGOA 5GZDA 1LTEA 3R4UA 2DUOA 5T54A 3OY8B 2ZMNA 1GV9A 2ZHKA 1WBFA 4XJ9A 4AVTA 3AZYA 4YM3A 4WVWA 4YW4A 2PHXA 2UWCA 4P9YA 3N3HA 1H9PA 1GZCA 3A0NA 5KXBA 2AENA 1DLLA 2WQZC 3W58A 1V6KA 2DYCA 2UURA 1WW4A 4SLIA 1VAMA 2R1DA 3O12A 1N1SA 1PZ9A 3O5SA 4XJUA 1XQNA 1BZWA 3ZSMA 4BPZA 1CVNA 2YXSA 2FHRA 3KM5A 1W6QA 2V5YA 3V0BB 3AZXA 4FPOB 1LHUA 3AFKA 2EF6A 3FLTA 3M3EA 4GKXA 1KQRA 5GM0A 4YW5A 4ZXKA 2WT0A 2OUHA 1LEMA 1Q8PA 2D6OX 1DHKB 2EXJA 3WDUA 3MW4A 1FAYA 2Q5TA 3ZYRA 1ZA4A 2BQPA 3M2MA 4AGVA 4BMBA 2OW4A 2GNMA 5F5QA 3OGGA 2DWRA 1YYNA 5GLUA 2GALA 1MS4A 1S1AA 3FFZA 3UL2A 3WZ1A 4TZDA 3ASIA 4XE9A 4BM8A 1W6OB 1KITA 2EALA 2ZKNA 5DG2A 5T5LA 3KQRA 2VH9A 1QOTA 1MVEA 2G4IA 3LSDA 1IOAA 2Z42A 1SFYA 2GN7A 3V64A 1AJKA 1H30A 1RINA 1WCSA 4Z8BA 3WG2A 1BYHA 2YV8A 4DS0A 2ZACA 2CWSA 2P37A 3AXDA 3POSA 2GNBA 2ZBJA 3BODA 3SISA 3WCRA 3ZXLA 2VW1A 4BMEA 1DQ5A 4Q1PA 2DTYA 1MS0A 5H9QA 1Q8VA 2SLIA 1GICA 1BQPA 1U0AA 4LBQD 1S0GA 1R1ZA 1CONA 2JDZA 2W39A 1I1EA 1GZWB 3AXEA 1DQ1A 4M00A 4MYEA 3VKMA 1UX6A 3WG4A 4Y1ZA 2D6PA 1V00A 3T2TA 1FYUA 2ZGMA 2R0FA 2AGSA 1LHWA 1Q8QA 1ENRA 2R1BA 2YZ4A 4UW5A 4YZ4A 2WT1A 4XMIA 3NV2A 3AZZA 1UZYA 1FX5A 3RS6A 3ZSJA 2ZGTA 3B01A 1UPSA 4UW3A 3APBA 3T1MA 3RRDA 1MS1A 1DYPA 2ZMLA 5IK5A 3N7JA 1DGLA 1QKQA 4GXLA 1YO8A 2P34A 1LJ7A 1OQ1A 5GALA 3AP5A 1JYCA 2DVBA 4GALA 1W0PA 4YW1A 3GNEA 1D0HA 4R9BA 5DXDA 5H9SA 1OKQA 1SLCA 2EIGA 3O0VA 3AJYA 4LBOA 3D4KA 4P9XA 4Y20A 4M01A 1I3HA 3OYWA 4I30A 1LOCA 1SACA 2A6WA 2A71A 5GLVA 3RMYA 1FV3A 2C5DA 2EXHA 4KBBA 5HCFA 3SITA 4JCKA 1HKDA 1YXWA 2C9AA 1GNHA 3IN9A 1A3KA 2E6VA 3B3QE 2AUYA 1WLDA 2DTWA 1LECA 3OBRA 3RMXA 1LHVA 4FPYA 1DQ6A 4UW6A 2PHTA 3MW2A 5DUUA 2ZGPA 1FNZA 5T52A 1A8DA 1G9DA 4AWDA 1LU2A 2A6ZA 1G9AA 1ULDA 4XZPA 1QNYA 5BYNA 4YM1A 1APNA 1LOGA 1QOOA 2XB6C 3C2UA 4FOYA 5E89A 1N3QA 3VKFC 2R49A 2D6MA 1LHOA 2ZMKA 1N47A 4XOGA 1GZ9A 4XBNA 3QCWA 1Z78A 1QNWA 4ATFA 3MPPG 3T1LA 1S0EA 1ZM1A 2DUPA 1A78A 2ZHMA 3N36A 3WUCA 4U2AA 2DVFA 1V6OA 2A3YA 1B09A 5DUXA 3ENRA 3POYA 4XIOA 5JMCA 4Q26A 2DV9A 2ZAAA 3ZXJA 2ZGNA 5CNAA 1SLTA 1WUVA 5H9PA 3TAYA 5IK8A 2PHWA 1DIWA 1W6QB 4YZ3A 1V6NA 3OY8A 2DVGA 1IKPA 1C57A 3FUQA 1JXNA 3LCPA 3ZXFA 3WG3A 4YG6A 2WJSA 1W6MB 3AX4A 3MEPA 5GZEA 3PMEA 3VKOA 4DQAA 2DVDA 2GMMA 1SLAA 4XHBA 1LGCA 4YW2A 1AJOA 5LK5A 4AVSA 2VU9A 1PZ7A 1MR5A 5CB7A 4M3CB 3VV1A 3FBYA 3PJQA 4FVVA 2PELA 2ZZJA 4WVVA 1C1FA 1LESA 1X50A 1AF9A 1LODA 2JE9A 1CPNA 5JVVA 3SH4A 4GWNA 2NM1A 3WNXA 1GYKA 4PQ9A 1Q56A 4PCRA 3Q9OA 1LGBA 1AXKA 1AZDA 1JN2P 1TEIA 2WSUA 3ATGA 3HMYA 2VW0A 1UMZA 2GNDA 1CIWA 5IT6A 3V0BA 4FP2A 4AVVA 4CRQA 1CN1A 3DGTA 4K1ZA 3NV1A 2B7YA 4YGBA 2YY1A 2HYKA 4CTEA 3AYCA 1CQ9A 2LTNA 1SCRA 1WW7A 2XG3A 2I2SA 2ZGLA 3SH5A 3M3QA 4BQ1A 3IKWA 4ASMB 1G7YA 2A6VA 1RITA 2W52A 3RG0A 4L8QA 1SCSA 1MS3A 3O0XA 1LU1A 1GLHA 4LBNA 4HANA 3USUB 2D3PA 5AVAA 4XMAA 2ZGQA 1D2SA 5HCAA 2FMDA 4ISQA 3SNMA 3ZXEA 2H0BA 1W6OA 3OPZA 1SLLA 5KXDA 3POWA 3WVJA 3WDXA 4XTPA 3OBTA 1V6LA 2VY0A 4XTMA 1JBCA 1JOJA 2JD4A 3WG1A 4YGCA 2ZGSA 4LBQB 1V6MA 1WW6A 5GLTA 4FOWA 1H9WA 2CTVA 1MZ6A 2YMZA 4FOVA 2TEPA 4YM0A 4Y24A 4DPNA 3JU9A 4YGDA 1IS3A 3A0KA 4AYUA 3UJQA 4BLIA 2NZ9A 2VXRA 1S0JA 3AP9A 1AXYA 1N3PA 3UK9A 2OUJA 3R4SA 1ULFA 1ULGA 1VAVA 2DUQA 1FV2A 1JHNA 4NOTA 1PZ8A 2NMOA 4PBPA 3D5OA 3AYDA 2PHFA 5GZCA 3WHTA 4AGGA 4XILA 3IPVB 4IQPA 4DRVA 3AK0A 1GZWA 4XJWA 2DU1A 4Y1VA 4Y20B 5GJ6A 4AGRA 2D6KA 3V0AB 1LULA 4ATEA 5HCBA 2E51A 3NV3A 1YI7A 1VALA 2CL2A 3SH3A 1MS9A 4Y22B 4DRRA 3CNAA 2ARBA 3L2YA 1F9KA 1KDMA 2ZGRA 4YM2A 4HL0A 2P3KA 4XHXA 2DU0A 2WSVA 1LOAA 2E53A 3ZVXA 1IS6A 3W59A 1JYIA 1F5FA 3PVNA 3RQ0A 1W6NB 5IUQA 3LSEA 3SLIA 3R05A 1W6PA 4FPHA 4Q2FA 1OFSA 3IM0A 1QGLA 3WDYA 4FPFA 5EXOA 1N1VA 4PF5A 1DBNA 2V73A 5GZGA 1MS5A 1DQ4A 1MS8A 2A70A 4WZFA 3A4UA 1QDCA 5KXEA 4YW3A 2ERFA 2P3IA 2A3XA 2P3JA 2R16A 4YLZA 2GMEA 2A6XA 2ENRA 1Q8OA 3BTAA 1UL9A 3AZVA 1LOBA 5T50A 2A75A 2LALA
chains in the Genus database with same CATH superfamily
4E8CA 3TEWA 1OXCA 2RMU1 2NLRA 3NWKA 1LR5A 4Q8LA 3ZYHA 5C8CC 3JB8A 3DV8A 2XL7A 3LA3A 2BZDA 1AR81 4OMDA 3IT8A 5FMDA 5J1XA 4HN0A 4DIQA 2WFF1 3S5AA 4FPKA 2UWAA 3AP6A 1X7NA 4Y4RA 1H1AA 2PXJA 4EZHA 3AYEA 2XDVA 4HT1T 4CDWA 1HB4A 2HWF3 3W9AA 1QMJA 4BOWA 1HQWA 1RUG2 2QQPA 1O59A 3BIWE 1BKZA 2VMEA 4GULA 5FK8A 4PI0A 1VMHA 3HBKA 1G9FA 1QQP1 3OF1A 3NNGA 2O14A 4AI1A 4AFAA 1X33A 2Q0AA 5CISA 3OUJA 3P3PA 4AQSA 3OGJA 1PGL1 3FBMA 3VBUA 3T4VA 5C3RA 1ZZCA 3POGA 4QPIB 5I0RA 3DKWA 3OD0A 1RUI1 1F4HA 1W2TA 4FI9A 4LK6A 5EWSA 2VXJA 1R081 4I0WB 4FOQA 4XJ8A 4BZ4A 1IS4A 4XF9A 5CG8A 1QH7A 5CFCA 2EXKA 4CU7A 3VHRA 3MZHA 3MFAA 2VNVA 1WA4A 2NMNA 2VUAA 5FYSA 1JZ8A 3AP7A 4XUQA 4P9LA 5B2GB 3J7HA 4EJRA 1UZ0A 5A3WA 2R0HA 4A6OA 2EAKA 4QD2A 1C1LA 3AP4A 1TNRA 5B4NA 1D7PM 1NCQB 1R1A3 4DFSA 5C9AA 3WDVA 3I54A 4PHZA 5IVBA 1G9CA 1RIRA 3PMSA 5LEKA 5BPXA 5FWJA 3H8RA 4M3CA 3WHUA 2WN2A 1ULEA 1HQLA 1LOFA 2GC0A 4ISRA 4QX8A 3UJOA 3VBFB 5BYNA 1LHNA 1C4RA 2Y33A 1H6YA 4AQ6A 4CYDA 1J1TA 3SCFA 3ZXKA 4CZSA 4Y5Z0 3AC0A 4CUAA 5I8TA 1RXGA 4CDWC 1O4ZA 4QAWA 2VTFA 5T5JA 4PLOA 1RJ8A 1IKQA 1V6IA 1OD3A 3BI3A 3D8CA 3HOBA 3WNPA 2JDAA 3KV4A 2GDFA 1OA3A 1SLIA 3B00A 3KB5A 3POIA 3RI8A 5EJ1B 1YCIA 3GCXA 4GH4A 4NRPA 4QHBA 2ZEXA 1JZ6A 2OVUA 1ASJ3 2UY8A 3RZMA 1REDA 4RA0A 3SHRA 2OQ7A 3WOGA 4A42A 1W2OA 2E33A 1VBB3 2R063 3VBUC 1ODNA 2TNFA 3BALA 2W68A 4EQVA 4KNCA 4AG4A 4HKLA 1JOPA 1RUH3 4OHYA 4I0BA 5BNNA 5E8AA 4BHPA 1C8NA 4Q4V3 3ITQA 5GLWA 5CFCC 1OA4A 3PVEA 3VLBB 4PDWB 2FDJA 5HI0A 1S0FA 3I2IA 2ZOEB 3DPRB 4XIKA 4C0HA 4HVOA 3JUUA 4JGYB 1F15A 5A1FA 4AFMA 2FD8A 4YGEA 3LA7A 5IFPA 2R042 2MEV1 3KHBA 1K3IA 4B7EA 1J83A 5C9AC 5DUWA 1S0IA 5HV4A 1J3PA 1IS5A 1PHMA 3KV6A 1W3VA 5K4LA 1UD1A 1JODA 4S2HA 1AXZA 4J1WA 2JKXA 1LOFC 3FX3A 1CESA 4R9DA 1O8SA 4QQPA 4RL7A 1LEDA 5FXXA 1PO11 5J96B 5C7GA 1J59A 1PVC1 4Y1XA 3VBRC 2ET1A 4UFIA 3RVHA 2VQTA 1S0CA 1UW8A 3KT4A 4O9GA 2D3RA 4LEJA 1XBFA 3SKJE 5FJKA 3PVOA 1VB4A 4GH4C 2E32A 1A34A 4PJYA 2SBAA 5F39A 3B69A 2VZUA 3HNMA 1CX1A 1OSGA 4RR3B 4Y3OA 5T55A 3VGIA 4CCLA 1BBT3 3H1WA 5FZ8A 1DFQA 5LATA 2CAUA 1AR73 1AR63 1RYYA 5B4XA 3A7QA 3UKTA 1SBEA 2JJ6A 1K45A 2RDNA 2X10A 2PHDA 3I59B 2D7FA 2VAUA 3AKTA 3CF6E 3UT0A 5BNNC 4FQ4A 1URXA 4Q1RA 4JZRA 1HJGA 4NIDA 2HEYF 1DGRN 1UWWA 2A6YA 2V4VA 1WLCA 5FZMA 4BQ2A 1QWRA 3CEWA 5ABJA 4N7UA 5KHIA 1RL3A 4A7KA 2R073 4Q5OA 5GZDA 2JDKA 3B93A 2Q8OA 1MEC3 5FBJA 2R30A 2YPJA 3M8LA 4V2WA 4YW4A 2B9VA 2PHXA 4RS5B 3RDIA 5CIRA 4P9YA 5KXBA 2DDUA 2XBO1 2B9UA 4HPKB 4NIGA 1U5IA 5FUPA 4J1XA 3E97A 2XJRA 2DYCA 4FAGA 1ALYA 3GZEA 4IGOA 3O12A 1L7QA 2OIIA 3ZSEA 4XUPA 1OH3A 1YJLA 1BZWA 3MFCA 3ZSMA 5BV6A 5FPXA 3RJ2X 1RHI1 3F2ZA 4AHWA 2AZ5A 3KM5A 5FYHA 1F8VA 2WWUA 5KHHA 3U1XA 1UKRA 5FO8B 5DAWA 2YBPA 4FPOB 3V0BB 1LHUA 1TG7A 3LAGA 3N9OA 3WF4A 3KQ4B 4GKXA 2FDIA 1KQRA 3I97A 4H7MA 5JMOA 1HRV3 2WT0A 1W9SA 4KG8A 4NE9A 4YNIA 3RZHA 1LEMA 2WWJA 1OKOA 4IEZA 5LBBA 3H42B 2YU1A 2Q5TA 3ZYRA 3ALQA 5FMBA 2Z4FA 2YGLA 4QPIA 3S30A 1RXFA 4G3YC 2FDHA 3OGGA 2DWRA 3NJZA 5GLUA 1W8TA 2GALA 3UL2A 3WZ1A 2QDNA 1AYM3 3GJAA 2WNUB 4QXHA 1VBD1 4XE9A 2WIIB 1W6OB 1EPZA 2EALA 2ZKNA 5FYYA 5T5LA 4LKDA 4FO9A 2XVKA 3K48A 3WP6A 1X36A 1QOTA 2VMIA 5JI7A 1U12A 3ZN6B 4TN7A 1VBA2 2Z42A 3V64A 5HBAA 5JPMB 4UWDA 1AJKA 4LJHA 4COZA 1OF4A 1H2KA 1NCQA 1BYHA 2RR13 2DF7A 2YV8A 2ZACA 4QXBA 4LOSA 3AXDA 3POBA 3ZXLA 4LIVA 1V70A 3EHKA 4BMEA 5BNOB 3VBFA 2VM9A 2DTYA 4A3XA 3NAPB 1BQPA 2KR2A 2AC1A 2WS93 4XETA 1R1ZA 3OGRA 1GZTA 4KU8A 4YWAA 5FYCA 5FXWA 4TSVA 1I1EA 1UF2C 1RUF2 3AXEA 4CVUA 4Y33A 1VRH1 3ON7A 4MZUA 3CJXA 4Y1ZA 3WG4A 3FFQA 4LLFA 2R0FA 4A3ZA 2AGSA 2RE9A 3M3IA 1GWKA 3RYKA 1ENRA 1ZZ9A 2R1BA 2YZ4A 2ZAHA 3VZNA 5KBFA 4GZ9A 3ZSJA 2ZGTA 1K5MB 5EZWA 3RRDA 4G9SB 2FZ1A 3AB0A 3BN6A 3N7JA 3GZUC 4QPIC 1LJ7A 2A73B 1W0PA 4LA2A 2DFBA 3GZAA 5CFDB 1BHGA 2LM3A 3EXUA 3E6DA 5DXDA 1W9YA 3J7MA 4PDWA 4QB1A 1OKQA 2EIGA 4UFMA 5H9SA 3AJYA 3DPRA 4LBOA 2WZR2 2Y6HA 5FO9B 4P9XA 4JGYA 3HPNA 1JUHA 3LGRA 3VD4A 3BUCA 1RVF2 2GAUA 3UESA 2A71A 4NROA 1YQ8A 1NCQC 3RZZA 4LKSA 2VZSA 1QJY3 1YXWA 2C9AA 5DAVA 4D0QA 4HOOA 1BMV1 1GNHA 4LORA 2XLFA 3OTFA 3ZDVA 1AYN2 2XJPA 3VBFC 4KU7A 2AUYA 3ZR6A 1OH4A 3H8XA 3ZKUA 4MGQA 5FZFA 3WP5A 3UKNA 2VCBA 4FPYA 2W92A 4O9EA 4UW6A 2Z79A 3J7LA 4ZXEA 2VZRA 1CAXB 5FZDA 1M4WA 2X53S 5KC6A 1A8DA 3ZIWA 5A3NA 2WO2A 2UYBA 4QX3A 1POV0 3GCWA 4CUBA 3LE0A 1UU5A 3W20A 1APNA 1BVP1 2XB6C 4FOYA 4QHOA 1QJZA 4CXXA 2HWF2 4RR3A 3RZJA 5FZKA 2R49A 1FPN1 1N47A 3I3BA 3I2HA 3MPPG 1H4HA 1OQEA 4QXCA 4D94A 2DUPA 2RS13 3I59A 5AC91 5C71A 3D0SA 2XL9A 1EUUA 2JEMA 2A3YA 5FYBA 4CDUB 4O61A 1NQJA 1C8M1 3ENRA 1RUE3 2P4EA 4UFLA 1WMDA 3U0ZA 2ZAAA 1JYXA 1PIV3 3BTXA 1DGWX 5JXJA 1FMD3 1WMFA 4PDWC 1NUKA 2WC2A 3OUHA 4LOTA 3DPRC 3K75B 5CNAA 1RUOA 5FPVA 1SLTA 4UFKA 1HXS3 1PGW1 4JGYC 2H6BA 3U07A 4KG0A 2Q8DA 1TMF2 1W6QB 2HKXA 1XJAA 4CCCA 2WNOA 2DVGA 1C57A 1L7RA 3FUQA 3NMBA 4A45A 4DXZA 3MI8A 1RUJ1 2WJSA 2X5IB 3MEPA 3MIBA 5K8SA 1CZTA 5K9YA 2DVDA 5C5UA 1BEV3 1SLAA 2PLV1 4RS5A 4XHBA 4UT5A 1HX6A 4YW2A 1NCRB 2CV6A 2YHJA 2VU9A 4NIHA 3N9MA 2VMFA 4HPKA 3T2QA 1R1A2 3FBYA 1PO21 1R64A 3PJQA 4IXLA 2XHKA 1AF9A 4ZY9A 2JE9A 1W8HA 4KGGA 5JVVA 4OMCA 4PQ9A 4JV4A 4GQ7A 1LGBA 1H0BA 1UQXA 3VD3A 1AZDA 4KWJA 1RMU3 3ZMNA 4XCAA 4P9JA 2CDOA 3V0BA 3UYJA 3ZXGA 1W99A 4RR3C 4YGBA 2YY1A 5FP8A 3AYCA 2X09A 2XH6A 5FUIA 2WZPP 5J37A 1DCSA 4GWJA 4QKFA 1WW7A 4IESA 2OS2A 3VZJA 3J8F1 1KFUL 5FKBA 4BQ1A 3M3QA 4H14A 5C3SA 2VNOA 1ZX5A 1Y9MA 2A6VA 1RITA 2W52A 3NQHA 4NUBA 1SHWB 3RG0A 1ASJ2 3HWJA 3S0MA 3Q8EA 1SDWA 1W8ZA 3AMMA 5C8CB 1GLHA 1VBB2 3KD4A 2ATFA 2D3PA 2R062 5HCAA 1NE4A 2P6HA 4ISQA 2WNUA 2H0BA 1W6OA 2EA7A 3OPZA 4BE3A 3POWA 1RUH2 3OBTA 1V6LA 4Q4V2 5FZIA 2WFPA 1W3XA 4Q4X3 4YGCA 2BEOA 4OI4A 4KH9A 3ZN6A 1VBC3 3SCHA 4CE8A 3U14A 5KC5A 1C5IA 4XFFA 3PJYA 2VGDA 4A6SA 2YMZA 4FOVA 5FP7A 4RS5C 2ZX2A 3A0KA 3C7EA 1JU3A 3FHQA 2NZ9A 1S0JA 1MQTB 1AXYA 3AP9A 3U10A 1JZ5A 2OUJA 1DP0A 2CDPA 5BNOA 1C28A 5J36A 4P5HA 4A7YA 5JIUA 1YIPA 4IV1A 1K5JA 3T08A 3NAPA 3D5OA 2PHFA 1GFF2 3NJXA 4I02A 5FLIA 3WHTA 4AGGA 4BQXA 1NAEA 4XILA 4NHMA 5I0UA 4IQPA 2Y60A 4QHZA 4IE5A 5I91A 2DCTA 1IPJA 4XDOA 5IHRA 5IWFA 4M0NA 1ZBA3 3JBG1 1LULA 2ZTNA 4ATEA 4AVBA 1H6XA 4B1LA 2WQ8A 1YI7A 1NKGA 2VMHA 2HWD1 2ZXQA 4CP9B 3N9LA 1K5MA 3W21A 4LNVA 3EMRA 4DO0A 1DLCA 2P3KA 1D4M1 2YC0A 4IE7A 4A41A 3ZIXA 2DU0A 1BBT2 1WKYA 2L9LA 5EIYB 1EY2A 2E63A 3W59A 1AR72 1AR62 2CU5A 2WNUC 5G05L 5CFDA 2VMDA 4HVQA 1UYZA 4JAAA 3CIHA 1QGLA 5APAA 3ZYFA 4FPFA 3N4MA 1V9U3 1ENXA 5CVRA 4IV3B 1DQ4A 1MS8A 4WZFA 5D21A 3VHOA 3ETPA 5F5IA 2R16A 1RUG1 3CKHA 4K7JA 3RPQA 3WW2A 2R072 4LITA 1UL9A 1OURA 2VNGA 5BNOC 2A75A 1OLQA 4DY5A 4ORFA 1J3QA 3MIDA 1MEC2 3LDBA 3NAPC 4UFJA 5A6YA 4BIOA 3WUDA 4QQ2A 1COV3 3ZYJB 4RFT0 4L97A 2CGPA 4ZKTB 1CAXA 2IUWA 2XUEA 2ZHNA 4KI5M 4B3NA 4DUVA 2O8QA 3FUOA 5C6CA 3WV6A 3TEXA 4XW3A 4XXPA 2F4PA 4XBQA 2VW2A 2I45A 1TE1B 1YIFA 4FXGB 4QKDA 2B4KA 3BIEA 3KMHA 2W2IA 2IFWA 5FMCA 3CZJA 1GP6A 3CDZB 3KSCA 3MW3A 1JI6A 4A44A 2OX0A 1K5MC 3MUZ1 5FUNA 5CBLA 1QDOA 4COUA 2X8KA 1LCLA 3ROUA 5FMOS 3ACLA 2R32A 1LENA 4MLOA 4NJ4A 5FJHA 3WDTA 3L2HA 1HRV2 2BPA2 4CDUA 3BOPA 5D8AB 3RSJA 4DY3A 4LBMA 4EN7B 3FJSA 3B9CA 2R6QA 4W4ZA 4BIFA 1GKBA 3HVDA 4W65A 3N9PA 2VD7A 3IDCB 4YG3A 5EYXA 1ZREA 4QM9A 4U36A 2OZJA 2ES3A 1E5IA 3RI9A 2RMU3 3HQRA 4UOJA 3VBRB 3URFA 3WP4A 1DYOA 4AZZA 4QT6A 4GAZA 4YFZA 3ME2A 4IGPA 1AR83 1W2NA 4YRDA 4CCKA 3KT7A 2VULA 2X5IA 2YC2A 3I2GA 5DUVA 5JOYA 3OGSA 4JRAA 4OZXA 4PLMA 3C8XA 1UXXX 1NCRA 4OLLA 3W5NA 3OBAA 3LKJA 4AI3A 5FWEA 2PHRA 1XNDA 1OUXA 2A7AA 2RR12 2Q4SA 4QDSA 3THCA 5LZ6A 1W2UA 3PUIA 1SBDA 5J09A 3WLUA 4WVMB 1GQHA 3AKQA 2ZS6B 2QQNA 3ILNA 1OUSA 1PMHX 1AX2A 1HLCA 1EPWA 2GH8A 3M7AA 4WV8A 2YB7A 4CCEA 4GIQA 1DQ0A 2WS92 4RFRB 5LRRA 1S0DA 3CBNA 4XABA 1GU3A 2WR9A 3HR9A 4AAXA 5F5AA 4R9CA 2WZEA 3HBZA 1NYWA 2QQOA 1RUI3 1UZVA 3CO2A 2BNOA 4XJZA 2F4LA 1OT5A 1RUC1 1Z0HA 2R041 2C24A 4OI1A 1DZRA 4CDUC 2JECA 2NP0A 1L3JA 2VTXA 2J1UA 2KXLA 1EYBA 3DYOA 5SV5A 4LBKA 1ZYBA 5JSOA 1UN1A 3GM8A 5C8CA 1H4GA 5F32A 3CZUA 2D93A 4LXLA 1VLNA 1LAJA 3WQ1A 1YI9A 2YROA 1RUD3 4EE2A 4FPGA 1Z7S3 4B8EA 1JYVA 3PUSA 4L99A 5FZ4A 1NG0A 1R093 3AMHA 1KJLA 1W9TA 1ZZ6A 2YBSA 2E7TA 3ETQA 4Y1YA 4RHV3 2IXKA 2X5IC 3OCPA 2E7QA 3KZ4C 4JVAA 4YW7A 2ZZQA 3WCSA 2WLQA 1NCRC 5ACA3 2VZOA 4X6RB 5L19A 3TB0A 1MQTA 5FPAA 4ARYA 4JHTA 2Y8KA 2UWBA 1UOFA 1XPWA 2ZGUA 4QDQA 5FXZA 2OKXA 2W08A 1LKNA 1QJY2 1JYWA 1ZRDA 2ZHLA 1XE7A 1LB2A 5JLVA 3VL9A 1O6UA 1QF3A 1W6PB 1YFUA 2W47A 2VO5A 4RGKA 2NN8A 3WW1A 4D69A 4DB5A 4DEVA 2Y6GA 1PM7A 1UAIA 5A3LA 2BDRA 3RWKX 3L9JT 1QIQA 5CG9A 1JZ2A 4R9AA 3VD9A 3TYJA 4OUSA 1WD3A 2C1FA 2PAMA 4XYXA 4RQPB 4MGTA 5JDBA 3VZLA 1GBGA 1SEFA 4E2GA 1AR93 4CEWC 4CP9A 5I93A 4OUEA 1A6CA 4H2AA 4J6GA 4YZ2A 4MGIE 4EN8B 5FY5A 5I8YA 3E5XA 1WMXA 1W28A 1YQ2A 1FATA 2IWGB 3E5QA 3FLPA 3I3DA 4M3CF 5FO7B 5LBFA 4FFFA 1IG0A 2GMPA 4BLJA 3WXPA 2KM2A 3ZPYA 2RVAA 4YARA 4QQOA 2J1VA 2ARXA 2RS12 1GANA 3MICA 4GMP1 4PF1A 4P14A 3I7DA 2EIEA 4AHZA 5A6XA 3W5MA 2DFCA 2GSYA 2JIGA 2TBVA 1SBFA 1RUE2 1LOEA 2F6BA 3M3CA 4IV3A 1JU4A 3E6BA 4JGZB 1SLBA 1FNYA 2ET7A 2ZGOA 1JMUB 4EN0A 1FMD2 3P6BA 1LTEA 3LEIA 2DUOA 4RN5A 4HKOA 4QX7A 4ZS2A 4Z1VA 3NKGA 3BTZA 5FTTC 2ZHKA 5JR7B 4X8NA 4EYUA 1RTVA 4YM3A 1MQTC 3N9NA 3WR0A 4IEQA 5FLHA 4BH9A 2UWCA 5FZ3A 1GQPA 2O0OA 4CCMA 3HEIA 4R8HA 1GZCA 3A0NA 5F6KA 3VZMA 4S2DA 1BEV2 2C26A 1QXRA 3P1IA 5FZHA 1V6KA 4QKNA 3RFRA 3X29B 1OVPA 1CGPA 2H0VA 4KWUA 1WW4A 1HIXA 5EHDA 1RUNA 1N1SA 2VL4A 3M4FA 4D3WA 4XJUA 2VBDA 1L7LA 5KHGA 4AVAA 5JUVA 2QBXA 4QM8A 1H2MA 3C7OA 3ZPOA 2BFUS 4JQTA 1K42A 3K46A 1PMIA 4XF3A 1RGSA 4OCTA 4C0BA 3AFKA 2VJXA 1RMU2 3FLTA 1YC61 3POFA 4IEWA 3SMHA 2VECA 1J3RA 5EPAA 2IXCA 4OQ8A 5GM0A 3O1OA 4JTNA 4CUGA 1VBA1 2J1TA 4FT8A 5A7PA 4GB33 2K2SA 4BK4A 5D8AA 3M2MA 3ACHA 5LA0A 2OW4A 2GH2A 3NO8A 2GNMA 3LWCA 5F5QA 1HB2A 1YYNA 2RM23 1MS4A 3FFZA 2HWC2 4LT5A 4BM8A 3A23A 4IV3C 2RJ2A 1KITA 4Q0UA 5DG2A 3VBRA 3KQRA 4Z2AA 1GOGA 2VH9A 2XVLA 1ZBE3 4NVPA 1MVEA 1IOAA 1CAUA 2GN7A 1X82A 2XLGA 3KF3A 4Q4X2 2DCKA 4Q0QA 2HWE3 2CWSA 2VCMA 3ZM8A 1VBC2 3POSA 3R6SA 2GNBA 2ZBJA 3BODA 3VD7A 4COWA 3O1UA 3H8UA 4PIYA 2VW1A 4MGSA 4ZZ5A 3ABZA 4IE6A 2JB8A 2KA3A 4M0HA 2C9KA 1GICA 4WVMA 4IEPA 1UU6A 4MHRA 1KFXL 3WEZA 4AI2A 2WL1A 4WVZA 1JS9A 5AVPA 2D5FA 1UO9A 1DQ1A 4M00A 4BQ5A 1XE8A 5AFEA 2YYOA 3U37A 1WLTA 1FYUA 1OHFA 2WN3A 2ZGMA 1LHWA 2ORZA 1FOD1 1Q8QA 2WZR1 4HSJA 1UXZA 2HBUA 4UW5A 4XMIA 3NV2A 2LS6A 4AEKA 1RVF1 1FX5A 1ZBA2 3RS6A 5L9VA 3WW3A 1VBD3 3T1MA 3ZXDA 5JZGB 1DF0A 1DYPA 2BBVA 2QQLA 5KHKA 5KR7A 4CA9A 3B5LB 2IVIB 5D8AC 4GXLA 2Y34A 3K77A 2XJTA 1AYN1 2QE3A 2ILMA 3A22A 4UFHA 4JHZA 5GALA 3D82A 1JYCA 1OF3A 1J84A 1D0HA 3K3NA 4CXYA 3KV5A 3GHNA 3BOWA 3MPBA 4P9GA 1UOGA 2VVFA 4QXKA 3O0VA 4COVA 3D4KA 5J98B 4Y20A 4XQWA 4M01A 1I3HA 4AL9A 1PMJX 5FKCA 4MHUA 1LOCA 2A6WA 2XJSA 5FYMA 3UGGA 3RMYA 3ZMOA 1V9U2 4KBBA 2BTVC 3SITA 4JCKA 1HKDA 4N53B 3MLLA 3NJVA 2HWF1 3IN9A 2V5DA 2DTWA 3OBRA 2VZQA 4TLGA 3RMXA 3WQ7A 1SQ4A 3JD73 4QU1A 4OI2A 3TN91 4NRQA 2C4XA 3NJYA 5F6LB 3THDA 4K9SA 1XNAA 2ZGPA 3NNFA 4HETA 3AL5A 2QZ3A 3JXSA 2EIBA 1COV2 1GOHA 3RJRA 3WQ0A 4CSWA 4AWDA 1LU2A 2HYXA 4D6RA 2A6ZA 1PK6B 4XZPA 4K6BA 4RQPA 3SEEA 1QNYA 4YM1A 3O14A 4PQQA 1LOGA 4OHWA 2QJVA 1TMF1 1W0NA 2FMYA 2A1XA 5JXHA 2D6MA 2ZJCA 1KGYA 2GP5A 4PI2A 1VAKA 2NPIA 5FY4A 3RWNA 1QNWA 1LRHA 4ATFA 2VBPA 1GNYA 3T1LA 5LK7B 1S0EA 3JQXA 3PTYA 5FZGA 3AMNA 2B5HA 1NZIA 2UY9A 2RS33 4IL7A 2Q8EA 5IFTA 5IVJA 5FMOL 4Z07A 4DOUA 3KVBA 1B09A 5DUXA 1NA1B 1BK0A 3POYA 1SZBA 1GWMA 4DZGA 1R1A1 5F5CA 4B4PA 1HRI3 1X9PA 5LA2A 5FQ0B 2Y26A 2ZGNA 5IW0A 4F8AA 3TAYA 1Y9QA 5FYZA 1YJKA 4IW3A 4NHYA 4XF1A 1IKPA 5FYIA 1C5HA 3WSOA 3ST7A 3PU8A 2RMU2 4YG6A 2PHLA 1W6MB 3AX4A 3J9SA 4H3WA 5FPZA 3VKOA 4JKLA 5FOBB 3DF0A 1ULOA 1AR82 3LDRA 4M4RA 4AVSA 5BUVA 1MR5A 4Y5SA 4ZU5A 2ZZJA 1LESA 1LODA 3SH4A 2NM1A 3WY6A 1GYKA 1ASJ1 2RDRA 5IVCA 2LROA 3ZN4A 2OQ6A 1AXKA 3ATGA 2WSUA 1VBB1 1XOYA 3HMYA 4UI9L 1OLME 2R061 5JXIA 2GNDA 1XYOA 4RQPC 4LA3A 4AVCA 5IT6A 3LA2A 1STMA 3WQBA 4AVVA 4FFGA 3DGTA 1RUH1 1QJU3 4K1ZA 4MUVA 4Q4V1 2HYKA 2Y6LA 3SEPA 1SCRA 1PGL2 4BWOA 1UY2A 2XG3A 4P00B 4XUNA 2ZGLA 2P5BA 2YGMA 3MIHA 4C90A 3ACIA 1ZNPA 2ID4A 4XF4A 4L8QA 3MV01 1MS3A 2G1MA 3O0XA 3USUB 2XR4A 2ZGQA 4AI0A 4WBBA 4AQTA 4JGZC 2PLV3 2CGOA 3SKVA 2W87A 4EV0A 3IAPA 2BOIA 5I0DA 1JOJA 3WG1A 4E2SA 4LBQB 4MGKE 4FFHA 1V6MA 1RUD2 4XC9A 5JR2A 1Z7S2 4FOWA 4YYOA 4DEQA 4WM7B 1QH6A 2CTVA 4HVRA 1R092 1MZ6A 1OA2A 4B29A 3SXWA 4DPNA 1JYTA 3LDKA 4Q4W3 1SPPB 1W03A 4RHV2 4W8JA 4AYUA 2IVJA 3AVRA 4BLIA 1UX7A 3GBFA 1VAVA 1JHNA 5FY7A 5ACA2 4HLTA 4NOTA 4I2OA 1PZ8A 4PBPA 2RDSA 2Q1ZB 3VZKA 1OVSA 3FMGA 3IPVB 2BGOA 2CSGA 4D7TA 4DRVA 1AR61 1O4TA 3GHMA 4QX2A 5IVEA 2FDFA 3O1MA 5CEHA 2XHNA 1TME3 2XMLA 2D6KA 4I3PA 1KEXA 3MF9A 3VDCA 3V0AB 4CEYB 1Q5OA 2JDPA 4HONA 2JE8A 3SH3A 1CAVB 2BRTA 3R4DB 1V0AA 4B1MA 3TEYA 1XSRA 2Y6JA 1ZA7A 3CNAA 5JZGA 3L2YA 1IQDC 1KDMA 2VPVA 1YFWA 4YM2A 2XJVA 1AR92 1PNFA 4YPJA 5KHJA 2R071 4IUGA 4YVWB 4E4DX 3I3QA 3I2FA 2JENA 1JYNA 3ZVXA 2HWB1 2OT7A 1JYIA 1F5FA 5A3PA 1HW5A 3PVNA 3RQ0A 1W6NB 3MYXA 5IUQA 3Q8FA 3R05A 3VL8A 4FPHA 4Q2FA 2BW8A 2VE1A 3IM0A 4MSVA 4NRMA 1SFPA 4DINB 4RD7A 5LEJA 4PF5A 1DBNA 1XYPA 4O65A 3ZXAC 4ET7A 5GZGA 3IZOA 1ZZBA 3A4UA 3JB4C 3R0RA 4XFHA 2WBKA 5EJZB 2BOJA 1CWPA 5LWBA 2QKDA 2ERFA 2JB4A 3GBWA 2P3JA 2IXHA 1ND2B 2GMEA 4N53A 4SBVA 2Q8CA 4IEUA 3VBOB 5JAXA 5JXGA 3DXUA 1LOBA 1US2A 1YQ5A 2OZ6A 4R4ZA 4ZXKA 1B35B 4GJZA 5FREA 4XXAA 1EV13 2VG9A 2DCJA 2UYAA 4QGLA 2JE7A 4MXWB 4LTAA 4FPJA 3S5QA 1UKGA 2XKOA 1ZRCA 1QJX3 5IVFA 3N35A 1GR3A 5C3OA 1MPXA 2HWD3 4J25A 1RJ7A 1HRV1 1ULCA 1YWKA 1Y9GA 1IGOA 1XSQA 4LO4B 5DDJ3 1Y7BA 5FPBA 4AI8A 1PK6A 4IEOA 4FTEA 1UYXA 2XJQA 3CJIC 4TYSA 2D43A 4Q4Y3 3VUOA 3LOBA 5EJ3A 3I4IA 2Q1MA 5DMYA 3CL1A 1AHSA 2BU9A 3CQOA 4LBJA 2RDQA 2QCSB 1BK1A 2BFUL 2XVGA 4JC1A 4N7IA 4BQ4A 4NAMA 1KDKA 1QHDA 1WBLA 3H9AA 4W6XA 4OQ9A 5JZGC 4OFGA 1G8WA 3J26N 2D97A 3TOJA 3ZSKA 4L0PA 2BP6A 3THTA 5FIXA 2ZX0A 1NA1A 4LE4A 4K8RB 3UV9A 1WLWA 5A3OA 2D44A 3OOXA 4ZONA 1NZCA 4GB32 5KXCA 1G86A 1UZWA 5FR3A 3H50A 1G9BA 1CX4A 2WYSA 4GWMA 1ZZ8A 2ZABA 3HQUA 5L9RA 1VBE1 3FLRA 3C7HA 5F8PA 2RM22 3I8TA 3DECA 2ZX4A 2IXJA 2WS91 4N53C 1VJ2A 1ENSA 2O8OA 3O1SA 3M3OA 1W6MA 4YZ5A 3BYWA 5A7QA 5JWPA 2VUJA 1ZBE2 4BYYA 2YBKA 4CEWB 3ZKYA 1O3SA 2Q30A 3E6CC 2OPWA 1U5YA 1VB2A 1SMVA 5JOWA 1WMEA 2GNTA 2HWE2 1DZQA 1QXPA 1KJRA 1UMIA 3I2JA 3GALA 4RGGA 2NYYA 5I8SA 2QQIA 1CPMA 2WNVC 4H7LA 3WNKA 4DUXA 4CCNA 2RS53 1ENQA 1SG3A 1PK6C 5M0TA 4C1XA 5C33A 2XPJA 1UZZA 4LHSA 1YQ6A 2AREA 2JWPA 3B02A 2DURA 2WQ4A 3D0JA 5DZFA 1CZSA 3HN1A 5D2AA 5DZEA 3ZFEB 1VP6A 4LHNA 4NR1A 5FRAA 3N7MA 4EROA 1EAH1 1T6BX 1ACCA 1ND3C 4GA9A 4OHZA 4BK5A 1NX9A 4QPYA 3WF0A 1NA1C 3OBZA 4NHXA 3FWEA 4FPLA 1UMHA 1VBD2 4I09A 4EN6B 4YG0A 3ZSLA 4AFCA 3USUA 2V72A 2Y38A 4BXSV 1QJY1 2QQJA 4LE3A 4P08A 3WD5A 4D7SA 3LIHA 2Y64A 4N43B 1O3TA 3OG2A 4QX5A 4XUTA 1W0OA 4FPCA 3H7YA 5T5PA 3V65A 2WAOA 4LBQA 3T0DA 4K40A 3P3NA 3OYWB 2RG4A 4WM7A 1VR3A 4XBLA 5ANQA 3VKLA 1F4AA 4JKMA 5FBZA 2JKBA 1QOSA 1SPPA 4XQ4A 1AUYA 2ZEWA 2CWMA 1D4VB 2AR6A 2E9QA 4KWLA 2VZ3A 4RSUA 3WF3A 5IK4A 3USSA 2Y6KA 4FTBA 5A3MA 1OC1A 2YG0A 3AYAA 4ES9A 5FCCA 3ELNA 5H9RA 5F3IA 4XJAA 3HIFA 3VN4A 2CNAA 2ZA9A 3IPVA 3K51A 4S2FA 5JPNB 3WW4A 2W1WA 1NT0A 1RUC3 3JD72 1GSLA 2B46X 1AVBA 2RS11 4COYA 1V6JA 2WYFA 1JTZX 4K20A 5FZ6A 4C91A 1VMFA 3INAA 3V0AA 1F31A 3LFMA 2HBTA 5K0UB 3BU0A 4CEYA 1RUE1 3POEA 2A5ZA 4JRLA 4MGZE 1CAVA 2AH2A 3JZVA 2VOTA 5FZEA 3HJRA 2XLAA 5A1LA 2FDGA 3AKSA 1O4YA 1MVQA 2EXIA 3M1HA 4FP3A 4QWNA 1QJEA 2PA7A 1AX0A 3I3EA 4H55A 4Y26A 5GZFA 5IJRA 3LOIA 4CDXB 4HG6B 1Q8SA 1M06G 4YVWA 4HK9A 4OYUA 5FAXA 1JW6A 4E2QA 2D6NA 1NLQA 4UW4A 4IGQA 1HN0A 1W6NA 4Q8KA 4XDQA 2P17A 1BXHA 3H0OA 4Y1UA 2WKKA 1W8FA 1YEWA 2RS32 1BEV1 2YC4A 3B9IA 3IMNA 4PLNA 4YFWA 5L73A 4Q27A 2CYFA 4XPVA 2ZPXA 3U11A 5IVVA 1HRI2 4WM7C 5LY2A 2QQVA 2Z69A 1O91A 4QKBA 1AL23 1ND2A 3QACA 1GV9A 2X29A 4AVTA 3AZYA 2WABA 3H3ZA 4WVWA 5FY0A 1RMU1 2XJUA 4KGQA 4MX3A 4E4ZA 3N3HA 4META 2B8MA 2AENA 5EV7A 4MXWA 4UXAA 4LIUA 1DLLA 2WQZC 2ZX3A 3W58A 3O1VA 3ORJA 2UURA 4LO8A 2O1QA 2R1DA 3KCCA 1WA6X 1PZ9A 1UY0A 4UYBA 2FDKA 1HB1A 1CVNA 2FHRA 2OYZA 4M4PA 5A7NA 2HWC1 2K0GA 1W6QA 4I01A 4CEYC 2V5YA 4NHKA 3AZXA 1AYM2 1NQDA 2EF6A 3I2DA 2I07B 3CHXA 4AFDA 1W8UA 1DZTA 2WFF3 3OD4A 4QPWA 3V56A 3ES4A 4YVWC 4E27A 5F37A 4N9HA 1QJU2 2OUHA 1POV1 3OB8A 3TWIA 1Q8PA 4GWIA 2P1BA 3ZX7A 2D6OX 1DHKB 2EXJA 2WZ8A 4IERA 4TLFA 3T09A 3BPSA 3MW4A 3WDUA 4ASKA 1VBC1 1ZA4A 2BQPA 2XXZA 4AGVA 4BMBA 4TWTA 4MXVA 1PGW2 2G9ZA 2FCVA 4LULA 3IMMA 4WM8B 3VHPA 3OGVA 4TZDA 1S1AA 1XE0A 3C3VA 1QQP3 5EFUA 5A7WB 4XVHA 5DAPA 2JG8B 2G4IA 2PLV2 1ND2C 3LSDA 4HBNA 3VBOC 5DABA 1SFYA 2JXAA 5LBCA 3HD8B 3VBSB 1RINA 1WCSA 3WG2A 1B35C 4CEWA 2P37A 1R083 3KF5A 3S6PA 2YUEA 2VOKA 3BU7A 4ZHNA 3O1RA 3VDDB 5LA1A 2BV4A 3THPA 1DQ5A 4IDZA 4Q4W2 4Q1PA 3H8OA 1MS0A 1OOPB 3S7EA 2XWBB 4BU2A 1O3RA 1U0AA 4AQ2A 4HXCA 4LR4A 4LBQD 1S0GA 3Q8BA 4JDNA 3TNQA 3IIAA 2G19A 3JQWA 2JDZA 2MNGA 4BISA 1E5HA 5FYTA 1I5ZA 3KGLA 4MYEA 1UX6A 4NN0A 5CADA 5LY1A 2D6PA 1V00A 2PAEA 4BQYA 4Q0VA 4CP1A 3GF6A 4F7ZA 3ZFEA 1WWYA 2BGCA 5BNQA 2W1SA 4YZ4A 2WT1A 3AZZA 1UCXA 3MIGA 1TME2 3OSDA 3LEKA 5A32B 1UPSA 4UW3A 3APBA 1V9U1 3KGZA 1MS1A 2IFRA 1UIJA 2QNKA 2HEWF 4NPMA 1DGLA 1QKQA 2QQWA 1YO8A 3IB3A 5D1IA 1UY3A 1OQ1A 4K8FA 3AP5A 3MIFA 2DVBA 3GBGA 1YFXA 4GALA 4DUWA 4R9BA 4CCJA 5AFBA 4N43A 1SLCA 1REEA 3QH7A 4CU8A 2QTWB 5C4WB 3BKZA 3OYWA 1G6NA 1COV1 4NIIA 3FL7A 4I30A 4AEJA 4N9IA 2QDRA 5GLVA 3TBDA 5A33B 1OPMA 5DAQA 1FV3A 2C5DA 2VMCA 5FDBA 5IATA 5A7OA 5FV3A 1KS4A 2W9XA 1T6GC 2GZWA 4KMQA 2D5HA 4CCDA 1YUDA 1A3KA 1UYYA 2WINB 1NLRA 1WLDA 2H6CA 3PNAA 4FAHA 1U5ZA 5ISLA 5A6ZA 1FOD3 3T30A 2MEV3 1EV12 5A80A 4P02B 2W1QA 5T52A 4DMIA 2C0ZA 1WCUA 2Y6FA 3LD8A 3ZFGB 1QJX2 3GJBA 1G9DA 2BYVE 5FZ0A 5FZ7A 2N7GA 1ULDA 5K0UA 2F17A 1PIV2 1IG3A 1AYN3 3AFGA 4UBHA 3ZFEC 4DXTA 1UOBA 4E8DA 5DDJ2 1QOOA 3C2UA 4XF0A 3DYMA 5E89A 1HXS2 1PO13 3VKFC 3IIIA 3KLSA 1WGPA 2ZMKA 4Q4Y2 1GZ9A 4XBNA 1TQ5A 2EAAA 1PVC3 1Z78A 4CDXA 1WCQA 2J22A 2VZ1A 2KD7A 4XEZA 2BGPA 3CU7A 5JSPA 2ZHMA 3WUCA 2CAVA 3G6JB 4U2AA 2DCZA 2DVFA 1S55A 5CKNA 5F3CA 4XIOA 4Q26A 2DV9A 3FC0A 1JHJA 4N43C 1Q43A 3ZXJA 4AK3A 1GUIA 3IAQA 4AEDC 2JDNA 1XRUA 1UYPA 1MZEA 1WUVA 5H9PA 2DCYA 5IK8A 1W39A 2PHWA 4YZ3A 1V6NA 4JKKA 2K46A 1GQGA 3B7MA 1NY72 1JXNA 4XZUG 5FZAA 2PYTA 3WNNA 3TN93 4AW7A 3WG3A 4DQAA 5GZEA 2B42B 1S4CA 2RJKA 3PMEA 5KWRA 2JDYA 2WUHA 4QB2A 3U78A 1LGCA 2AEYA 1FXZA 5LK5A 3QD6A 1AL0G 2BNNA 3DL3A 3H7JA 5I0TA 5CB7A 5G04L 2ADEA 3QH6A 3IDEA 1C1FA 1YNAA 1CPNA 1TMF3 4ZS3A 2GU9A 5DPNA 2XOMA 1TEIA 1JN2P 3MF6A 2VW0A 5CKMA 1UMZA 4IEYA 5FZOB 1ULPA 5K0UC 1E5RA 2X05A 2XBO3 2RS52 3F95A 4FP2A 4CRQA 3NKTA 2VTXJ 4ZU7A 1RUF1 3LFIA 3NV1A 2B7YA 2W3JA 1E5SA 4X8PA 1I6XA 2PTMA 3KV9A 1CQ9A 2LTNA 2P3YA 1RUD1 5T3NA 4JX0A 4CDXC 1Z7S1 4YVSB 1R091 4W6WA 3SH5A 3UGFA 3AKRA 4BQWA 1OQDA 1G7YA 2D40A 1RHI3 1GWLA 2IZWA 3HAGA 4RHV1 5L9BA 1MZFA 5FY9A 3VDAA 2ZKLA 1TZOA 4QX0A 4YW6A 3PHMA 4LBNA 4IE4A 4HANA 4WM8A 5HXVA 3ZLIA 5ACA1 3NL1A 4XMAA 1D2SA 2FMDA 3SNMA 5A7WA 3I3MA 5JCTA 1SLLA 3WVJA 4XTPA 1HV0A 5J3UA 3DKQA 2BWAA 3ACGA 2VQAA 2JG8A 4MVTA 2WRAA 1WCDJ 5GLTA 5C3PA 1H9WA 3VBSA 3CJIB 3T2PA 4RYDA 5BNPB 4YM0A 2VOWA 3JU9A 4YGDA 3J4UH 5FOJB 4KWKA 2VXRA 5FP3A 3VDDA 1N3PA 5BY5A 2VC9A 3FZ3A 3R4SA 1SDDB 1ULFA 2DUQA 1W9WA 2Z2SB 3BTYA 3MV11 1OOPA 3EBRA 4AI9A 1O5UA 1AR91 5LBEA 5IYYA 3MLKA 2NQYA 1DU3D 5BXXA 1P8JA 3PUQA 1I9RA 3AK0A 2YFZA 3MDPA 4DNYA 1H8VA 2W46A 4Y1VA 5GJ6A 1RUC2 2E51A 1C3HA 3NV3A 1VPHA 2CL2A 5A32A 1W04A 4Y22B 3AKPA 4L2NA 5DAXA 5LA9A 2RV9A 5DQ0A 4LUMA 3PURA 3GGLA 1VRH3 1LOAA 1ZZ7A 4V1PA 1HJFA 2JG9B 4A2UA 1IS6A 4WM8C 3WNOA 1W90A 3LSEA 1W6PA 1PGSA 4NHLA 4NAOA 2JD9A 4LO5B 1OFSA 2WNVB 3WDYA 2QQUA 4AEMA 1W8OA 1N1VA 2JG8C 2TUNA 2V73A 5C4WA 1UNBA 3FHAA 1ZVFA 5A33A 3VBSC 4TTGA 2D98A 2PQSA 5KXEA 4CUCA 3RZKA 4YW3A 2A3XA 2XONA 2V4AA 4KBZA 2A6XA 5FPLA 4A7ZA 2VBBA 2K9ZA 1K12A 3VDDC 2PAKA 5JSRA 5T50A 4QGMA 3J7NA 4QQLA 2LALA 1AL22 5FFOC 1OOPC 1UY4A 1BJQA 4C1WA 1ND3B 4Y5TA 2PQQA 2VQUA 5CA6A 2BJSA 1MZ5A 1MACA 2BBAA 1KRIA 2D6LX 1S0BA 4BB3A 2CY6A 3ZFGA 3VBHB 1H2LA 4GB31 4HMZA 4JGZA 2AACA 4NPRA 1IZ3A 3WT3A 4FPEA 5JOXA 5FPUA 2HWB3 3ILRA 4HK8A 3M70A 2LRPA 2EICA 1I5PA 2G9FA 2RM21 3VZOA 1W05A 1X8MA 1TNFA 3MO4A 3LF7A 4Z2WA 2XQXA 3OUIA 4F83A 5EQUA 3K4DA 3E1F1 5ANNA 1ZBE1 2WFF2 4QGNA 1QXJA 2DVAA 1ZRIA 3O0WA 4G4FA 2P6CA 4FBFA 3ZO0B 1OLRA 1O5LA 4AHYA 4OI0A 1N3OA 1W9FA 3ES1A 4ITCA 1PX4A 2HWE1 1HV1A 4RGAA 3ACFA 1FPN3 2ZGKA 3OJBA 3S7IA 4X6QB 1CAWB 5C4WC 3ILFA 5CAZA 3SCGA 4XAEA 4MADA 3D6EA 5AC93 4K21A 4IEVA 1QQP2 4LO6B 4C8DA 2ARAA 3NV4A 5SV8A 3MLJA 3ZYGA 2PFWA 2YPDA 2WA3A 2XQRA 1C8M3 1OFNA 2VVDA 2HH9A 4AFBA 2J42A 2W95A 2WWSA 3KVAA 1W8WA 3AM2A 4GKYA 1GNZA 3WINE 1WD4A 1RUI2 2PHUA 1R082 2VVEA 5TSWA 3ZYPA 4AXOA 3TEZA 4D8MA 5IK7A 3KWVA 2W1UA 1AX1A 5F3GA 3S57A 4YZ1A 3ZFGC 5JOZA 1RUJ3 5ABJC 1FT9A 4QPGB 4XDPA 1XYNA 3RZLA 2W94A 4Q0SA 1NLSA 2JDUA 2UU8A 3C7FA 5FZOA 5FZ9A 3U4XA 3PIJA 4ZU4A 3DUIA 4QX1A 1PO23 2YFUA 4W50A 4EWDA 1A8MA 2BVVA 1YRZA 5A6QA 1CZVA 1H1MA 4LK7A 4YVSA 4LPLA 3AZWA 4ZPIA 5F9TA 1W2AX 3H3LA 2BNMA 5CKQA 1VIWB 1LGNA 4HN1A 5A70A 1VBE3 1CR7A 1NXD1 2VQ0A 4IV1B 4CDQB 3LB9A 1N1YA 2B45X 4PBOA 1SFNA 2HJIA 1F35A 4Z92B 2LUWA 2P2KA 5LW9A 4UF0B 5DZGA 3ZYIB 3PUHA 2ZEYA 1BBT1 1ONAA 1DG6A 3BPZA 1DYKA 5A3UA 1AR71 5CYYA 2XKPA 3AJZA 1PVXA 3J8F3 5DN2A 4CPBA 1O3QA 1WW5A 2BUKA 3WDWA 3JD71 1S2KA 2Y0IA 3HQXA 3U75A 3CJIA 3HNYM 5BNPA 3EJKA 2YDEA 3N7KA 3CMGA 4BQ3A 2FZ2A 2AYHA 2J1EA 1QU0A 4V2VA 5FY1A 4MV2A 1US3A 2D3SA 2Q1FA 2Z5WA 5LRSA 1ZRFA 4MO3M 2C6SA 3ZR5A 1D0GA 3FN9A 3VKNA 4GJYA 1HDKA 3NNJA 3T2OA 4UBGA 4EZ4A 1JH5A 3TNPB 1MEC1 3H1MA 5JI9A 1PM4A 3KS7A 4FCAA 5E88A 4LKFA 1EAH3 5FZ1A 2WNEA 3Q8CA 4LBLA 5I0SA 1FOD2 3AMQA 3SC7X 2RS31 5A7SA 2RHPA 2MEV2 2QVSB 5DG1A 4OVEA 5K7PA 1HB3A 4P9WA 5GLZA 1DQ2A 1N1TA 3UNPA 4K1YA 3RYPA 1XU1A 4YVSC 2V09A 1HRI1 2WAAA 5HPOA 4Y22A 3O1TA 1IPSA 3N7LA 3EO6A 3MIEA 3Q8AA 4AOCA 1CJPA 1DDLA 1XNBA 3CLPA 3NRUA 1NE6A 3BCWA 2VOVA 2A3WA 3LEGA 2DBNA 3MBWA 3NW4A 1PO12 2GN3A 1Y3TA 4K3UA 2JG9A 5EYYA 4M3CE 3QLQA 4BDVB 4R52A 1PVC2 4FFIA 4EN9B 3JBG3 1JUIA 2WT2A 3GXUA 4XAAA 2GP3A 4FQZA 2WNVA 2BERA 4P9IA 5FLJA 4L9BA 2WDBA 4NWVA 5T5OA 3WF2A 1CD3G 2MHFA 4ASLA 4BA6A 3AMPA 1D4M3 5F7UA 1S2BA 3R4UA 4XUOA 5T54A 3OY8B 1H1IA 3RYRA 5BNPC 4MGYE 1Y43B 2ZMNA 3OEBA 4CP2A 4JTOA 1WBFA 3H3UA 4XJ9A 5GKAC 5L7OB 1AYM1 2PMWB 3RNSA 3IDBB 4QB6A 3NNMA 3PDQA 3TN92 1H9PA 1YHFA 3ZFFB 1ND3A 3DN7A 3ECQA 1O7FA 3HT1A 3LQCA 2GC2A 4XCBA 1QJU1 2VCAA 2MPFA 2ETEA 1GOFA 4SLIA 1VAMA 2VZVA 1RUG3 2RR11 4XACA 5J48A 4XFIA 2XUMA 3IDAA 4BXFA 3O5SA 3HN3A 1XQNA 2OPKA 3VBHA 4BPZA 5FQ0A 2YXSA 4IEXA 4MH0E 1VRBA 4B4QA 3OEAA 3VD5A 1Q3EA 1CJDA 5J7MA 1JZ7A 4LMFA 4OHVA 3T0AA 3M3EA 1OMIA 3ZYBA 2IC1A 2XBO2 4AE2A 2CGNA 3IWZA 3LPGA 4NMIA 2ADDA 4YW5A 4D6QA 4BCUA 1UPIA 4DXRA 2IXIA 4URTA 5LASA 2JG9C 3DXTA 1IPKA 4MG2A 5IAVA 4LHKA 5C70A 3WNLA 1FAYA 2BVBA 1KD7A 2DBIA 3RZGA 4INDA 5FZCA 4OZOA 3LZZA 4Q4W1 1H8TB 1RHI2 2W0XA 5L36A 2JIJA 1DGRA 2PN5A 2VR4A 3ASIA 1CAWA 4FXKB 5JIAA 5LB6A 2B39A 3POJA 4ZZ8A 3QBQA 3ZOIA 3OPWA 1XNKA 3MUY1 3B94A 2JX9A 2J1AA 1GMMA 3O1PA 3DEMA 4UAPA 2LW8A 4GD4A 5FYUA 4ONUA 3RGBA 1H30A 3EYPA 4Z8BA 2BWCA 4DS0A 2VUDA 2QUOA 3AL6A 4PT6A 3WCRA 4OHXA 3SISA 2J1SA 1TME1 2HWC3 3BVCA 5FY8A 5H9QA 1BCXA 1Q8VA 4CPBD 2SLIA 1OPOA 1VE0A 3VBHC 1XXNA 1CONA 4NPLA 4QPGA 3TRSB 1HN1A 2W39A 3FE5A 1F5JA 1GZWB 1POV3 1H2NA 3VKMA 4AEDB 1J58A 4QQHA 4Q0PA 1XNTA 4I3GA 3T2TA 4URAA 4XFCA 3H1YA 2WLPA 1W8NA 4CU9A 4XQDA 2QZ2A 5C5TA 2EIDA 4R4XA 1UZYA 4EWEA 5IAXA 4GMP0 2VMGA 3B01A 4DXSA 5F1RA 1BLZA 2ZMLA 4NWWA 4EWAA 5IK5A 4CDQA 1QY4A 2P34A 4Z82A 4CU6A 4UF0A 4YW1A 3PTRB 3GNEA 2WA4A 1VRH2 4JQRA 5FP4A 3PL0A 2J7MA 4LLOA 4OULA 4O7XA 3PVBB 2R043 3IBMA 1EV11 2WO7A 3PU3A 4AR2A 3WF1A 3C7GA 2FQPA 1QJX1 3KHCA 1SACA 1GP5A 5CZKA 2EXHA 5HCFA 1WCKA 1PIV1 1FMD1 1DGWA 1POQA 1YFYA 3OPTA 5DDJ1 3K4AA 4OUMA 4TXWA 4W6YA 1HXS1 1ZRRA 3UGHA 2E6VA 3B3QE 4Q4Y1 4KL1A 2RJLA 2FBEA 4B4RA 1QJFA 1LECA 1JOBA 4IETA 1LHVA 1UU4A 3T0BA 3KCXA 3G7DA 1DQ6A 1HQNA 3NVCA 1XNCA 2PHTA 3MW2A 5DUUA 3A21A 2WO1A 4QPGC 4AHXA 1FNZA 1VMJA 4N8MA 2FCTA 4CCOA 1BVVA 3KCYA 4LO7A 3PUAA 5F2WA 4CDWB 1XC6A 1G9AA 1JZ4A 4ASMB 2G9GA 3PIGA 4NO4A 1BMV2 2W5FA 4QDRA 4QU2A 5IVYA 4XFGA 5A3TA 1KS5A 1N3QA 1IQAA 4XOGA 3VBOA 1LHOA 1NY71 2HWB2 3QCWA 5F2SA 2E7AA 5F3EA 3E5UA 2VUCA 4IV1C 1B35A 1D2QA 1ZM1A 2VOXA 4CDQC 2ZCWA 5A1AA 5C8WA 1A78A 4HZFA 3N36A 1V6OA 3VBUB 5JMCA 1UOJA 3MGUA 5FZBA 1W06A 1FI2A 4S2GA 1F2NA 4LHLA 3BGAA 1PNGA 3ZN5A 4ES8A 5CFCB 4MOAA 1DIWA 2YU2A 3T3YA 4Y4YA 3OY8A 4E4SA 1FPN2 2CHHA 3T4HB 3LCPA 3ZXFA 3HNBM 2RS51 5L7OA 4LQRA 5CU1A 4GMP3 5AC92 2GC1A 2GMMA 5C9AB 2I74A 4IE0A 1AJOA 1C8M2 1PX3A 1PZ7A 3ZFFA 1YLLA 4M3CB 2GC3A 3VV1A 4Q4X1 4FVVA 2PELA 4WVVA 1OBNA 2E31A 1XB9A 5CFDC 1QEXA 1X50A 2W91A 4B7KA 3WNXA 5HV0A 4GWNA 4JDMA 1Q56A 4PCRA 3WNMA 1S2EA 3Q9OA 3GDBA 4PIZA 3VB9A 3I2KA 5E6HA 1CIWA 2XWJB 1RUJ2 5FXVA 1CN1A 1X9TA 2FCUA 5FYVA 1CAUB 1EUTA 5E1RA 1LNSA 2QQKA 1WZXA 1XU2A 4GH4B 4CP0A 4LKEA 4CTEA 1RB8G 1EP0A 1NOVA 3K3OA 1PO22 2I2SA 2JDMA 3IKWA 3MHZA 1UY1A 1ZBA1 1ST8A 4FTSA 2JICA 3HT2A 3DCQA 1SCSA 1LU1A 5FK7A 1H8TA 1VBE2 2EVXA 5AVAA 5FP9A 5BNNB 3ZXEA 1OD5A 4HSLA 4LUKA 1J1LA 1VBA3 3WDXA 5KXDA 4Q29A 4D7YA 3KT1A 3JCIA 3N9QA 2VY0A 2HLEA 1JBCA 2JD4A 3D3AA 1RC6A 4XTMA 1T2XA 2ZGSA 4HFSA 1WW6A 3NNLA 4N90A 5HCHA 2HEVF 4NIAA 3J8F2 5L7OC 1O8PA 2VCCA 4XFBA 3SQOA 1TVGA 3O7OA 3I2OA 2TEPA 5FZLA 4Y24A 1IS3A 2VNRA 4WZCA 3UJQA 3ZFFC 3UK9A 3I49A 2JDHA 1ULGA 3VDBA 1KXGA 2WO3A 1FV2A 1GP4A 2NMOA 4XURA 1OI6A 3AYDA 2OA2A 1RUF3 5GZCA 4FSJA 4L11A 3U4SA 3WX5A 5ERLA 4E4HA 1GZWA 4I0AA 4XJWA 1OLMA 2VZTA 2DU1A 4AEDA 3DYPA 4Y20B 4AGRA 2QQMA 4E9KA 4CXWA 2ORXA 1EAH2 5HCBA 4PIXA 4YSFA 1VALA 1YQCA 3P5BA 1MS9A 2ARCA 3VHNA 4DRRA 1E57A 2ARBA 2J1RA 5HXMA 1F9KA 1Y4WA 2ZGRA 3FHIB 5LCWL 4HL0A 3K2OA 4HKWA 4XHXA 1UIKA 2Y0OA 4D6SA 5C3QA 2WSVA 3BB6A 2AEZA 4QMAA 2E53A 2ZEZA 4KQ7A 3UETA 1REFA 3PLQA 1AL21 1H8TC 2IXLA 3GYDA 3NSTA 3ZDSA 4ARXA 2WZR3 3SLIA 2E26A 2XGXA 3AVSA 4F3JA 5E16A 4P5YA 1RVF3 3EB7A 3GZTB 1JZ3A 1NXMA 3JBG2 4L92A 1ODMA 3LIGA 2ZX1A 1IHMA 5EXOA 5ABJB 2OXBA 2HWD2 1MS5A 2A70A 3EQEA 3LEMA 3UKVA 4AF9A 4AAPA 3QOPA 1QDCA 5EP9A 4XFAA 4BJ0A 4A4AA 2P3IA 1X8EA 4YLZA 2R7EB 2ENRA 1D4M2 1Q8OA 3LPFA 4JDOA 3BTAA 1U5XA 3AZVA 2QFEA 1CIYA 3K4ZA 2VZPA 3WP3A
chains in the Genus database with same CATH topology
2RMU1 3NWKA 2NLRA 1LR5A 4Q8LA 5C8CC 3JB8A 3DV8A 2XL7A 3LA3A 1AR81 3IT8A 4HN0A 2WFF1 4FPKA 2UWAA 3AP6A 1X7NA 1H1AA 3AYEA 4HT1T 4CDWA 3W9AA 2HWF3 4BOWA 1QMJA 1HQWA 1RUG2 2QQPA 3BIWE 1BKZA 4GULA 1G9FA 1QQP1 3OF1A 4AI1A 4AFAA 1X33A 2Q0AA 3P3PA 4AQSA 3OGJA 1PGL1 3FBMA 3VBUA 1ZZCA 4QPIB 5I0RA 3DKWA 3OD0A 1RUI1 5EWSA 1R081 4I0WB 4FOQA 4XJ8A 1IS4A 4XF9A 5CG8A 1QH7A 5CFCA 2EXKA 3VHRA 3MFAA 1WA4A 2NMNA 2VUAA 3AP7A 4P9LA 5B2GB 4EJRA 2R0HA 2EAKA 4QD2A 1C1LA 3AP4A 1TNRA 4Z92B 1NCQB 1R1A3 4DFSA 5C9AA 3WDVA 3I54A 1G9CA 1RIRA 3PMSA 5LEKA 5BPXA 4M3CA 3WHUA 1ULEA 1HQLA 1LOFA 2GC0A 4ISRA 3UJOA 3VBFB 5BYNA 1LHNA 1C4RA 4AQ6A 4CYDA 1J1TA 3SCFA 3ZXKA 4CZSA 4Y5Z0 5I8TA 4CDWC 1O4ZA 5T5JA 4PLOA 1RJ8A 1IKQA 1V6IA 3D8CA 2GDFA 1OA3A 1SLIA 3B00A 3KB5A 3RI8A 1YCIA 4GH4A 4QHBA 2OVUA 1ASJ3 2UY8A 1REDA 4RA0A 3SHRA 3WOGA 1VBB3 2R063 3VBUC 2TNFA 3BALA 2W68A 4KNCA 4AG4A 4HKLA 1RUH3 4OHYA 4I0BA 5BNNA 5E8AA 4BHPA 1C8NA 4Q4V3 5GLWA 5CFCC 1OA4A 3PVEA 3VLBB 4PDWB 5HI0A 1S0FA 2ZOEB 3DPRB 4XIKA 4C0HA 4HVOA 3JUUA 4JGYB 4AFMA 4YGEA 3LA7A 2R042 2MEV1 4B7EA 5C9AC 5DUWA 1S0IA 1J3PA 1IS5A 1PHMA 1UD1A 4S2HA 1AXZA 4J1WA 1LOFC 3FX3A 1CESA 4R9DA 4QQPA 4RL7A 1LEDA 1PO11 5J96B 1J59A 1PVC1 4Y1XA 3VBRC 2ET1A 1S0CA 1UW8A 3KT4A 4O9GA 2D3RA 4LEJA 3PVOA 1VB4A 4GH4C 4PJYA 2SBAA 3B69A 1OSGA 4RR3B 5T55A 3VGIA 1BBT3 3H1WA 1DFQA 2CAUA 1AR73 1AR63 3UKTA 1SBEA 2JJ6A 3I59B 2PHDA 2D7FA 3AKTA 3CF6E 5BNNC 4FQ4A 1URXA 4Q1RA 2HEYF 1DGRN 2A6YA 1WLCA 1QWRA 3CEWA 5ABJA 4N7UA 1RL3A 4A7KA 2R073 5GZDA 3B93A 2Q8OA 1MEC3 2R30A 2YPJA 3M8LA 4YW4A 2PHXA 4RS5B 3RDIA 5CIRA 4P9YA 5KXBA 2XBO1 2B9UA 4HPKB 1U5IA 4J1XA 3E97A 2XJRA 2DYCA 4FAGA 1ALYA 3O12A 2OIIA 3ZSEA 1YJLA 3MFCA 1BZWA 3ZSMA 5BV6A 5FPXA 3RJ2X 1RHI1 4AHWA 2AZ5A 3KM5A 1F8VA 5KHHA 1UKRA 5FO8B 3V0BB 4FPOB 1LHUA 3LAGA 4GKXA 1KQRA 4H7MA 1HRV3 2WT0A 4KG8A 4YNIA 1LEMA 4IEZA 2Q5TA 3ZYRA 3ALQA 2YGLA 4QPIA 3S30A 4G3YC 3OGGA 2DWRA 3NJZA 5GLUA 2GALA 3WZ1A 3UL2A 2QDNA 1AYM3 2WNUB 4XE9A 1VBD1 2WIIB 1W6OB 1EPZA 2EALA 2ZKNA 5T5LA 4FO9A 2XVKA 3K48A 3WP6A 1X36A 1QOTA 2VMIA 5JI7A 1U12A 3ZN6B 1VBA2 2Z42A 3V64A 5HBAA 5JPMB 1AJKA 4COZA 1H2KA 1NCQA 1BYHA 2RR13 2DF7A 2YV8A 2ZACA 3AXDA 3ZXLA 1V70A 3EHKA 4BMEA 5BNOB 3VBFA 2DTYA 4A3XA 3NAPB 1BQPA 2WS93 4XETA 1R1ZA 4KU8A 4TSVA 1I1EA 1UF2C 1RUF2 3AXEA 1VRH1 4MZUA 3WG4A 3CJXA 4Y1ZA 3FFQA 4LLFA 2R0FA 2AGSA 2RE9A 3M3IA 3RYKA 1ENRA 1ZZ9A 2R1BA 2YZ4A 2ZAHA 3VZNA 5KBFA 3ZSJA 2ZGTA 1K5MB 5EZWA 3RRDA 4G9SB 2FZ1A 3AB0A 3N7JA 3GZUC 4QPIC 1LJ7A 2A73B 1W0PA 4LA2A 2DFBA 3GZAA 5CFDB 2LM3A 3EXUA 3E6DA 5DXDA 4BZ4A 4PDWA 5H9SA 1OKQA 2EIGA 5FO9B 3AJYA 3DPRA 4LBOA 2WZR2 4P9XA 4JGYA 3LGRA 1JUHA 1RVF2 2GAUA 2A71A 1NCQC 3RZZA 1QJY3 1YXWA 2C9AA 1BMV1 1GNHA 2XLFA 3OTFA 1AYN2 2XJPA 3VBFC 4KU7A 2AUYA 3WP5A 3UKNA 4FPYA 4O9EA 4UW6A 2Z79A 1CAXB 1M4WA 2X53S 5KC6A 1A8DA 3ZIWA 2UYBA 1POV0 1UU5A 1APNA 1BVP1 2XB6C 4FOYA 1QJZA 2HWF2 4RR3A 2R49A 1FPN1 1N47A 3MPPG 1H4HA 1OQEA 4D94A 2DUPA 2RS13 3I59A 5AC91 3D0SA 2XL9A 2JEMA 2A3YA 4CDUB 1NQJA 1C8M1 3ENRA 1RUE3 3U0ZA 1WMDA 2ZAAA 1PIV3 1DGWX 1FMD3 1WMFA 4PDWC 2WC2A 3DPRC 5CNAA 1RUOA 1SLTA 3U07A 1HXS3 1PGW1 4JGYC 2H6BA 4KG0A 1TMF2 1W6QB 2HKXA 2DVGA 1C57A 3FUQA 4DXZA 3MI8A 1RUJ1 2WJSA 2X5IB 3MEPA 3MIBA 5K8SA 5K9YA 2DVDA 1BEV3 1SLAA 2PLV1 4RS5A 4XHBA 4YW2A 1HX6A 1NCRB 2CV6A 2YHJA 2VU9A 4HPKA 1R1A2 3FBYA 1PO21 3PJQA 4IXLA 2XHKA 1AF9A 2JE9A 4KGGA 5JVVA 4PQ9A 4JV4A 4GQ7A 1LGBA 1H0BA 1AZDA 4KWJA 1RMU3 3ZMNA 4P9JA 3V0BA 3ZXGA 4RR3C 4YGBA 2YY1A 3AYCA 2XH6A 2WZPP 5J37A 1WW7A 4IESA 3VZJA 3J8F1 1KFUL 4BQ1A 3M3QA 4H14A 2VNOA 1ZX5A 2A6VA 1RITA 2W52A 3RG0A 1ASJ2 3HWJA 3S0MA 1SDWA 3AMMA 5C8CB 1GLHA 1VBB2 3KD4A 2ATFA 2D3PA 2R062 5HCAA 1NE4A 4ISQA 2WNUA 2H0BA 1W6OA 2EA7A 3OPZA 4BE3A 3POWA 1RUH2 3OBTA 1V6LA 4Q4V2 2WFPA 4Q4X3 4YGCA 2BEOA 4OI4A 4KH9A 3ZN6A 1VBC3 3SCHA 5KC5A 1C5IA 4XFFA 3PJYA 2VGDA 2YMZA 4FOVA 4RS5C 2ZX2A 3A0KA 2NZ9A 1S0JA 1MQTB 1AXYA 3AP9A 3U10A 2OUJA 5BNOA 1C28A 5J36A 4P5HA 4A7YA 5JIUA 1YIPA 4IV1A 3NAPA 3D5OA 2PHFA 1GFF2 5FLIA 4I02A 3WHTA 4AGGA 5I0UA 4XILA 4NHMA 4IQPA 5I91A 2DCTA 1IPJA 4M0NA 1ZBA3 3JBG1 1LULA 2ZTNA 4ATEA 4AVBA 1YI7A 2VMHA 2HWD1 1K5MA 4LNVA 2P3KA 1D4M1 2YC0A 3ZIXA 2DU0A 1BBT2 1EY2A 2E63A 3W59A 1AR72 1AR62 2WNUC 5CFDA 4HVQA 4JAAA 1QGLA 4FPFA 3N4MA 1V9U3 1ENXA 5CVRA 4IV3B 1DQ4A 1MS8A 4WZFA 3VHOA 2R16A 1RUG1 4K7JA 3RPQA 3WW2A 2R072 1UL9A 2VNGA 5BNOC 2A75A 1OLQA 4DY5A 4ORFA 1J3QA 3MIDA 1MEC2 3NAPC 4BIOA 3WUDA 4QQ2A 1COV3 3ZYJB 4RFT0 4L97A 2CGPA 4ZKTB 1CAXA 2ZHNA 4B3NA 2O8QA 3FUOA 5C6CA 3WV6A 4XW3A 4XXPA 2F4PA 4XBQA 2VW2A 2I45A 1TE1B 1YIFA 4FXGB 3KMHA 2IFWA 3KSCA 3MW3A 5CBLA 1K5MC 1QDOA 4COUA 2X8KA 1LCLA 3ROUA 5FMOS 3ACLA 2R32A 1LENA 4MLOA 3WDTA 3L2HA 1HRV2 2BPA2 4CDUA 3BOPA 5D8AB 3RSJA 4DY3A 4LBMA 4EN7B 3FJSA 3B9CA 2R6QA 4BIFA 1GKBA 4W65A 3IDCB 4YG3A 5EYXA 1ZREA 4QM9A 4U36A 2OZJA 2ES3A 3RI9A 2RMU3 3VBRB 3URFA 3WP4A 4QT6A 4YFZA 3ME2A 1AR83 4YRDA 3KT7A 2VULA 2X5IA 5DUVA 5JOYA 4JRAA 4OZXA 4PLMA 1NCRA 4OLLA 3LKJA 4AI3A 2PHRA 1XNDA 2RR12 2A7AA 2Q4SA 1W2UA 1SBDA 5J09A 3WLUA 4WVMB 1GQHA 3AKQA 2ZS6B 3ILNA 5JSRA 1AX2A 1HLCA 1EPWA 2GH8A 3M7AA 4WV8A 4GIQA 1DQ0A 2WS92 5LRRA 1S0DA 3HR9A 4R9CA 3HBZA 1NYWA 1RUI3 3CO2A 2BNOA 4XJZA 1RUC1 1Z0HA 2R041 4OI1A 1DZRA 4CDUC 2JECA 2NP0A 1L3JA 2KXLA 1EYBA 5SV5A 4LBKA 1ZYBA 5JSOA 1UN1A 5C8CA 1H4GA 2D93A 1VLNA 3WQ1A 1YI9A 2YROA 1RUD3 4FPGA 1Z7S3 4B8EA 4L99A 1NG0A 1R093 3AMHA 1KJLA 3ETQA 1ZZ6A 4Y1YA 2E7TA 4RHV3 2IXKA 2X5IC 3OCPA 2E7QA 3KZ4C 4JVAA 2ZZQA 3WCSA 2WLQA 1NCRC 5ACA3 4X6RB 5L19A 3TB0A 1MQTA 2ZGUA 2UWBA 1ZRDA 2W08A 1LKNA 1QJY2 2ZHLA 1XE7A 1LB2A 5JLVA 3VL9A 1QF3A 1W6PB 1YFUA 3WW1A 4DB5A 4D69A 2NN8A 1PM7A 1UAIA 5A3LA 3L9JT 5CG9A 4R9AA 3TYJA 4OUSA 1WD3A 2C1FA 2PAMA 4XYXA 4RQPB 5JDBA 3VZLA 1GBGA 1SEFA 4E2GA 1AR93 4CEWC 5I93A 1A6CA 4YZ2A 4J6GA 4MGIE 4EN8B 5I8YA 3E5XA 1FATA 2IWGB 3E5QA 3FLPA 4M3CF 5FO7B 4BLJA 2GMPA 3WXPA 2KM2A 3ZPYA 4YARA 4QQOA 2ARXA 2RS12 1GANA 3MICA 4GMP1 4P14A 3I7DA 3MZHA 4AHZA 2DFCA 2GSYA 2TBVA 1SBFA 1RUE2 1LOEA 2F6BA 3M3CA 4IV3A 4JGZB 3E6BA 1SLBA 1FNYA 2ET7A 2ZGOA 4EN0A 1FMD2 1LTEA 2DUOA 4Z1VA 4HKOA 3NKGA 5FTTC 2ZHKA 5JR7B 4X8NA 1RTVA 4YM3A 1MQTC 3WR0A 4IEQA 5FLHA 4BH9A 2UWCA 2O0OA 4R8HA 1GZCA 3A0NA 5F6KA 3VZMA 4S2DA 1BEV2 1QXRA 1V6KA 3X29B 1CGPA 2H0VA 1WW4A 1HIXA 1RUNA 1N1SA 3M4FA 4D3WA 4XJUA 5KHGA 4AVAA 4QM8A 1H2MA 2BFUS 1PMIA 4XF3A 1RGSA 4C0BA 3AFKA 1RMU2 3FLTA 3SMHA 4IEWA 2VECA 1J3RA 2IXCA 5GM0A 4JTNA 1VBA1 4FT8A 4GB33 2K2SA 5D8AA 3M2MA 2OW4A 2GH2A 3NO8A 2GNMA 3LWCA 5F5QA 1YYNA 2RM23 1MS4A 3FFZA 2HWC2 4LT5A 4BM8A 4IV3C 4Q0UA 1KITA 5DG2A 3VBRA 3KQRA 2VH9A 2XVLA 1ZBE3 4NVPA 1MVEA 1IOAA 1CAUA 2GN7A 1X82A 2XLGA 4Q4X2 2DCKA 4Q0QA 2HWE3 2CWSA 1VBC2 3POSA 3R6SA 2GNBA 2ZBJA 3BODA 4COWA 3H8UA 4PIYA 2VW1A 2KA3A 4M0HA 1GICA 4WVMA 4IEPA 1UU6A 1KFXL 4AI2A 2WL1A 4WVZA 5AVPA 2D5FA 1DQ1A 4M00A 1XE8A 5AFEA 2YYOA 1WLTA 1FYUA 1OHFA 2ZGMA 1LHWA 4HSJA 1FOD1 1Q8QA 2WZR1 4UW5A 4XMIA 3NV2A 4AEKA 1RVF1 1FX5A 1ZBA2 3RS6A 3WW3A 1VBD3 3T1MA 3ZXDA 5JZGB 1DF0A 1DYPA 2BBVA 5KHKA 3B5LB 5D8AC 4GXLA 2XJTA 1AYN1 2QE3A 2ILMA 5GALA 3D82A 1JYCA 1D0HA 3GHNA 3BOWA 3MPBA 4P9GA 2VVFA 4QXKA 3O0VA 3D4KA 5J98B 4Y20A 4XQWA 4M01A 1I3HA 1LOCA 2A6WA 2XJSA 3ZMOA 3RMYA 1V9U2 4KBBA 2BTVC 3SITA 4JCKA 1HKDA 4N53B 3MLLA 2HWF1 3IN9A 2DTWA 3OBRA 3RMXA 3WQ7A 1SQ4A 3JD73 4OI2A 3TN91 5F6LB 4K9SA 2ZGPA 4HETA 2QZ3A 1COV2 3RJRA 3WQ0A 4AWDA 1LU2A 2A6ZA 1PK6B 4XZPA 4K6BA 4RQPA 1QNYA 4YM1A 3O14A 1LOGA 4OHWA 2QJVA 1TMF1 2FMYA 2D6MA 2ZJCA 1VAKA 2NPIA 3RWNA 1QNWA 1LRHA 4ATFA 3T1LA 5LK7B 1S0EA 3JQXA 3PTYA 3AMNA 2B5HA 2UY9A 2RS33 4IL7A 5FMOL 4Z07A 4DOUA 1B09A 5DUXA 1NA1B 3POYA 4DZGA 1R1A1 4B4PA 1HRI3 5FQ0B 2Y26A 2ZGNA 4F8AA 3TAYA 1Y9QA 1YJKA 4XF1A 1IKPA 1C5HA 3ST7A 2RMU2 4YG6A 2PHLA 1W6MB 3AX4A 3J9SA 4H3WA 5FPZA