1RUD2

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52084
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rud200
4WM8C 1COV2 4CDWB 1NY72 2X5IA 4JGYC 2BFUS 3VBRC 4YVSA 1AYM3 4Q4V1 3VBFC 1CJDA 1NCQB 4RS5C 5K0UA 4CDQA 1ZBE3 4IV1C 5A32B 1ND3A 4RHV3 3VBHC 1ZBE2 4Q4Y1 5ABJC 1X36A 1RUI1 5FMOL 2FZ2A 3ZFGB 1CD3G 2HWB2 1QQP3 4RR3C 1AYN1 3J8F3 1K5MA 3CJIC 4IV3A 5C9AA 1HXS2 1RUG3 4GH4B 1RUG2 2BPA2 3FBMA 2GSYA 2RR13 5DDJ1 4JGZA 5BNOB 5A33A 3TN92 5JZGB 1RUC2 2BFUL 1VBD1 4QPGA 4CEWB 5CFCB 3VBOB 1AR71 4WM8B 1HRV1 3LOBA 4JGYB 5AC91 1PVC3 2WFF3 3VBRB 1R091 2DF7A 5C8CA 4N43C 1NCRA 1PGL2 2RS51 2HWD1 1PO23 1FOD3 1BBT3 1V9U1 1PO22 1POV3 1FOD2 2R063 1MQTC 1RVF3 4RQPB 3VBHB 5BNNC 5BNPC 5ABJB 1PO11 2R062 1RVF2 3JB8A 1R082 1VBE2 2RMU1 2HWC2 1C8M3 3CJIB 2XBO2 1PIV3 1X33A 5D8AA 3VBSA 1RMU3 4WM7A 1PIV2 2HWF3 1NCQC 1RMU2 1PGW2 2X5IC 4GB33 4SBVA 1TMF1 1RUF1 1ASJ1 4CDXA 4FSJA 1HRI3 3JBG3 4PDWA 1VBB3 3JBG2 1AR91 1AR63 1VB2A 1BEV3 1QJU3 1VBB2 5K0UC 5LK7B 2WLPA 4CDQC 4GMP3 1QJU2 4CDXB 1ND3C 3NAPA 4Q4W3 1AR82 3HAGA 1RUJ1 2RS11 1AL23 3M8LA 1AL22 1Z7S2 3JD72 1EV12 1K5MC 1W39A 2Y26A 1QJX1 5C9AC 1MQTB 1COV1 5ACA2 5BNNB 5J96B 1B35A 1AUYA 4Y4YA 3ZFEA 1ZBA1 2PLV1 4LLFA 4QPGC 1AYM2 1VBA1 2HWE3 5GKAC 2X5IB 1BMV2 2MEV3 2HWB1 4YVSB 4RQPC 2WZR3 1EAH3 1RUD3 4RHV2 1VBC3 2WZR2 1VRH3 2R043 3IDEA 1NCRC 1OOPA 1HXS1 4N53A 1FMD3 1VBC2 4Q4X1 5K0UB 4CDQB 5J98B 1ND3B 1QQP2 5L7OA 3J8F2 1GFF2 1VAKA 4Q4V3 1OOPB 1NOVA 5CFDA 1QJZA 3TN91 1RHI1 1K5MB 1RUC1 4EJRA 4IV3B 5C9AB 5D8AC 4RFT0 4WM7C 2RR12 1RUI3 1OHFA 1VB4A 4NWVA 5FOJB 4CDXC 1AYN3 1ND2A 1RUH1 4JGZB 1PGL1 4PDWC 5A33B 1PVC2 2WFF2 4QPGB 1RVF1 1HQNA 3NAPC 1FPN3 1R081 2IZWA 5C4WA 3ZFFA 2ZAHA 5DDJ3 1BBT2 1FPN2 1VBE1 2BUKA 2RM21 4CDUA 5C8CB 2HWC1 4RS5A 1NCRB 2XBO1 1VBD3 4IV1A 1AR73 1R1A1 1HRV3 1VBD2 5C4WB 5AC93 1HRV2 1PGW1 3VBUA 1R093 1C8M2 1MEC1 1B35C 5AC92 2RS33 4RR3A 3ZFEC 2RS32 2HWF2 2RS53 2HWD3 3JBG1 4FTEA 2RS52 1V9U3 2HWD2 1D4M1 4GB32 4YVSC 1RUE1 5D8AB 3VBSB 4WM7B 1PO13 1HRI2 1AR81 1AR62 1BEV2 2BBVA 2RMU3 1H8TA 3DPRA 4PDWB 1TME1 1Z7S1 3JD71 1EV11 4Q4W2 1OOPC 4FTBA 4N53C 2R071 1E57A 5ACA1 2WS91 3NAPB 5L7OC 1TMF3 1RUF3 1ASJ3 2VQ0A 4IV3C 1WCDJ 1RUF2 1ASJ2 1F2NA 1NY71 4QPIA 4N43A 5CFDC 1AR93 3VDDA 4AEDA 1IHMA 1AR92 4YVWA 1AYM1 1NA1A 2FZ1A 5BNPA 4JGZC 4CEYA 1B35B 1RUJ3 2WWSA 2RS13 1ZBE1 3ZFEB 4CDWA 4RHV1 2RS12 2WZR1 1DDLA 2HWE2 2MEV2 1COV3 5C8CC 1QQP1 1NCQA 1EAH2 1RUD2 2GH8A 3J8F1 4Y5Z0 1RB8G 1VRH2 1QJY3 2R042 5A32A 1FMD2 3ZFFC 5C4WC 1QJY2 1ZBA3 1RUG1 4CDUC 3ZFGA 1ZBA2 2PLV3 1SMVA 4N53B 2PLV2 1VBA3 4Q4V2 2RR11 1VBA2 5L7OB 2HWB3 3VBUC 3VBSC 4Q4Y3 5CFDB 4GH4A 3S6PA 4Q4Y2 1HXS3 1RUI2 4Q4X3 1PVC1 2WFF1 1M06G 4Q4X2 1A6CA 5BNOA 1AYN2 2ZTNA 5JZGA 1PO21 4CEWA 5CFCA 3VBOA 1FOD1 4Z92B 1BBT1 1FPN1 4WM8A 1POV1 3TN93 4JGYA 2R061 1ND2B 1H8TC 1RHI3 3DPRC 1RUC3 3VBRA 1RHI2 3VBFA 5DDJ2 4BCUA 1C8M1 1NG0A 1HX6A 1PIV1 4NWWA 4RQPA 1RUH3 3ZFFB 3VBHA 1RMU1 1AR72 5ABJA 2RS31 2HWF1 1RUH2 4CDUB 3VBFB 4QPIC 4RS5B 3VDDC 4GB31 1R092 4AEDC 1C8NA 4IV1B 4YVWC 1HRI1 1NA1C 3CJIA 1OPOA 1R083 1VBB1 3VBUB 1AR61 1AL0G 4CEYC 1BEV1 1VBE3 1QJU1 1V9U2 2RM23 2HWC3 4GMP1 4RR3B 2RM22 4CDWC 1PO12 2XBO3 4Q4W1 1POV0 1R1A3 2TBVA 2RMU2 1R1A2 1AL21 1MEC3 1MEC2 1H8TB 3DPRB 3ZXAC 1D4M3 3ZFGC 1RUE3 1TMF2 1D4M2 2ZZQA 1RUE2 1F8VA 5FMOS 1AR83 1MQTA 5BNNA 2QQPA 2XPJA 3JB4C 1TME3 1Z7S3 3JD73 4N43B 4QPIB 1EV13 4GH4C 1BMV1 1TME2 2HWE1 3VDDB 4AEDB 4GMP0 2R073 2MEV1 1RUJ2 5ACA3 4YVWB 1ND2C 1NA1B 2R072 2WS93 4FTSA 1EAH1 5BNOC 1RUD1 5BNPB 1VBC1 1QJX3 1VRH1 2WS92 2R041 5JZGC 4CEYB 1FMD1 4CEWC 1QJX2 5CFCC 3VBOC 1QJY1
chains in the Genus database with same CATH superfamily
2YU1A 4CDWB 4HK8A 1V6LA 4KG8A 2QNKA 3RS6A 1Q8SA 3MIBA 1UMHA 2BRTA 2HBTA 1PX4A 3GCXA 2ZX0A 4IGQA 4MVTA 4QWNA 3VBRC 4EV0A 1JHJA 2PA7A 2VW1A 2XG3A 3D0SA 3FHIB 5FZIA 3AC0A 2Y6GA 3N9PA 5GZFA 2ZGOA 1PM7A 4M3CE 4XFCA 1CIYA 3KM5A 4G4FA 5K0UA 3WQBA 5J1XA 5JXGA 1CQ9A 4EZHA 2WO1A 1ZBE3 1HQLA 1ZZCA 3MHZA 3L2HA 4FFIA 4OHVA 4OI1A 4A3ZA 3VBHC 4AHYA 1ZBE2 5FMOL 3LWCA 4QKBA 2QZ3A 4NHXA 3TNPB 2GN7A 1JZ8A 4U2AA 3RGBA 3I2IA 4E4ZA 5A3NA 4AI9A 4BQWA 4FPYA 2CGPA 1OA4A 1BQPA 5C9AA 1HN0A 2QQUA 3N9NA 2TNFA 1H1IA 2GAUA 3I3MA 2CAUA 3IIIA 1S2EA 2WDBA 4QB1A 2VO5A 1JZ6A 1UYZA 5LB6A 1WKYA 5DUXA 5E1RA 2JG9B 4LBNA 3CO2A 1GP6A 3ZIXA 3BTZA 3JXSA 4C1XA 3SKJE 4N9HA 3UGHA 5DDJ1 3ZKUA 2XWBB 3L2YA 4JGZA 5IK8A 3RWKX 4QQPA 3TN92 1WLDA 1CVNA 2O8OA 3IIAA 1H0BA 3NNLA 4FFGA 4MGKE 5JZGB 3K77A 4YM3A 1XQNA 2BFUL 3WG4A 4JTOA 3ZX7A 3VKNA 5L9VA 1UCXA 4UOJA 5CFCB 2F4PA 1AX0A 5LA2A 1W0PA 5ERLA 2EIDA 2J7MA 2WFF3 4XQDA 4AVVA 1T2XA 2B4KA 3LZZA 2FD8A 3M70A 2DF7A 2WZPP 2W46A 5FO9B 1O8PA 1OF3A 4CU9A 3O1VA 4B4RA 2HEVF 4MXWA 4QDQA 4ZS2A 3WUCA 3RI9A 5IVCA 5KXCA 2ZX3A 1KJLA 3PL0A 1ZZ8A 5C33A 3ZXGA 2WN3A 5CEHA 2DU1A 1V9U1 4IEPA 4AYUA 4MYEA 1Y9GA 2YPJA 1KJRA 2EVXA 4O7XA 2D3PA 2W94A 3DKWA 1DLCA 2A5ZA 2JDPA 3LKJA 1LECA 2RMU1 3IM0A 2BNMA 2B8MA 2ZJCA 4PI2A 4JKKA 4NO4A 3CJIB 4QXKA 5F3IA 3C7EA 5F6KA 1OQEA 2XBO2 1X33A 4LTAA 2VCBA 2IXHA 4XVHA 3K4DA 1XXNA 2HJIA 4XETA 5A3WA 1RMU3 5FREA 1DGWX 5A7WA 1MS3A 2O8QA 1NCQC 1PNGA 1RMU2 1YEWA 4DOUA 3BCWA 2ZABA 4RN5A 4AAXA 2X29A 4SBVA 5FQ0A 5A7PA 2HEWF 1TMF1 4NHLA 2GC2A 4CDXA 3PU8A 1XPWA 3VLBB 5LW9A 1HRI3 3KLSA 4YG6A 3JBG3 2YDEA 4URAA 2F17A 3JBG2 3FLRA 4X8NA 1QXRA 1VB2A 5FZ7A 5FRAA 2DCJA 4FBFA 1TVGA 4DXZA 1F9KA 3BPZA 3NAPA 4A7YA 1I5ZA 5I93A 4NIDA 4I3PA 1H6YA 1RUJ1 4N8MA 1V6MA 4CP9B 1POQA 1GNHA 2GZWA 5F5CA 4OQ8A 4GJZA 1Z7S2 3JD72 2UWBA 1ZZ6A 2ZHMA 4K8RB 3N35A 1W39A 1QJX1 3E5XA 1COV1 5EJ1B 2DBNA 1LOFC 5BNNB 5BY5A 3MZHA 5LA0A 4OQ9A 1GYKA 2RG4A 2JXAA 1SLLA 1XNCA 4YM2A 1W6QB 1VMFA 3OYWB 4XBQA 2Y64A 4AI2A 5DUVA 4ET7A 1LJ7A 4AVBA 1Q8VA 3FHAA 1KQRA 3TEWA 1CAXA 1BHGA 2ZGRA 4NJ4A 4LLFA 1AYM2 2GALA 2ZAAA 4XCAA 3ZN6B 1VBA1 1JYWA 3N4MA 2JE7A 3LPFA 3AYCA 1TG7A 2QQVA 3OGGA 1SHWB 4MOAA 5BV6A 1R64A 2X5IB 5I0TA 1REFA 1XNTA 1WMXA 1WUVA 2HWB1 4CUCA 4EE2A 2FCUA 1ZZ9A 1DGRN 2WZR3 3VZLA 3LEMA 2WWUA 3AL6A 4I02A 3MBWA 1H1AA 1AVBA 1VRH3 2VXJA 2WZR2 1K12A 1IS4A 1NCRC 1OOPA 2X8KA 1HXS1 2XVKA 1S0BA 4N53A 4PHZA 2YB7A 4CDQB 5J98B 3IZOA 5EJ3A 1ND3B 1S0EA 4EN9B 3VDBA 4DQAA 3WNNA 5FZKA 4F8AA 4XFHA 5L7OA 3BTXA 5KHHA 2W68A 2ZZJA 1ZNPA 4KG0A 1J3QA 2C1FA 2DURA 1QJZA 4RYDA 1H4HA 5FZFA 1SQ4A 2DCZA 2VOXA 1UZWA 4M4RA 1A34A 1RUC1 2F6BA 3SH3A 3U75A 3BODA 4IV3B 3I7DA 3H3LA 4AFMA 2I45A 5D8AC 4RFT0 2FQPA 2K46A 4YGCA 2WSUA 1UOBA 2VNOA 5C7GA 1OURA 2PHWA 3LGRA 3POBA 4MGQA 2UYBA 3FE5A 2ZEZA 3NQHA 4LBOA 5A33B 1YO8A 4Y20B 1J84A 2KD7A 3CZJA 3K48A 2IFWA 3V0AA 1W6PA 2W1WA 4C8DA 3PVNA 4QDSA 1REEA 3ZDSA 1NX9A 3AMMA 5FYIA 1O4ZA 5KHKA 1HQNA 1NYWA 1VAVA 1R081 4QDRA 5C4WA 1LOBA 1VBE1 2RM21 1GOFA 1MZ6A 2TEPA 5C8CB 2HWC1 2OA2A 3OEAA 3TEZA 2UWCA 3KF5A 2AYHA 4AE2A 1VBD3 1DGWA 2W92A 3GCWA 1AR73 5FLIA 1HRV3 1VBD2 2DDUA 5L36A 3MIGA 4HT1T 4Q1PA 1HRV2 4CYDA 2QFEA 1PGW1 5AVAA 4R9DA 3VBUA 1C8M2 1B35C 1UZYA 4B8EA 4B1MA 3GGLA 4D6RA 3ZFEC 3WG3A 1H2LA 2ZOEB 2RS53 3E97A 4CCKA 2X09A 3G7DA 4EN6B 5E8AA 2YGLA 2RS52 1IG3A 1S0DA 3CKHA 4GB32 1UW8A 2FBEA 3BGAA 3FFZA 2ZGPA 3SMHA 1RUOA 3NNMA 1V6KA 1I9RA 4UW3A 4ASKA 4MX3A 1JUIA 1HV0A 4FOWA 4HMZA 4B4PA 5A3UA 3OD0A 1US2A 2ZGMA 4WZCA 3FFQA 4LLOA 1GQPA 1MS0A 2Y6LA 3CIHA 3ORJA 2W47A 3BI3A 3NNFA 3DL3A 1KFUL 1EV11 2QBXA 4Q4W2 3I2FA 3NKTA 2QDNA 4Q0QA 2XMLA 1DYPA 1D7PM 3ACIA 3X29B 5F37A 3MF6A 4GAZA 1G9DA 4ISRA 1W2UA 4E2GA 1B09A 4M00A 4YGDA 1LENA 2V5YA 3KVAA 4OCTA 1LOAA 2J1AA 1F2NA 1WGPA 1A78A 3A4UA 3MFCA 2JG8C 3LDRA 2WR9A 1LHNA 1MS4A 3DKQA 3C7FA 5FYHA 3THPA 3B7MA 1LOEA 4GALA 1DHKB 3TOJA 3USUA 4DINB 1AF9A 2FZ1A 3THDA 4AFAA 3GDBA 5EWSA 4JGZC 3WDUA 5BNPA 1N1TA 3AKPA 5FYUA 3LSEA 4CEYA 4XAEA 4CCEA 2JDZA 3PTYA 4GKYA 4J6GA 4IEUA 2WWSA 3OCPA 4AEKA 2ADEA 3RVHA 1ZBE1 3WNPA 5JXHA 4JX0A 3ZXJA 2J1VA 1DDLA 2FDIA 2W1UA 1Y9MA 2VL4A 4I30A 2HWE2 2MEV2 3WT3A 1W28A 2UWAA 1F35A 4CUBA 4F3JA 3MIEA 3VHPA 2Q0AA 1PX3A 3RPQA 3M3IA 4Y5Z0 1F4AA 2D6NA 3WW3A 3LD8A 4HPKA 1QJY3 2R042 4Y1VA 4ZU7A 5A32A 3GF6A 4JVAA 3ZSLA 1QJY2 1ZBA3 4XBLA 1LGBA 2D6PA 3ZSKA 1UPIA 4LULA 1ZBA2 3NMBA 4QKNA 5HPOA 4OI2A 4E2QA 1JN2P 2E63A 2WIIB 2XGXA 4ISQA 3EYPA 1JU3A 1V70A 3K4ZA 4FPHA 3OGRA 4RFRB 5BPXA 5A7QA 5F6LB 1H2NA 2ARBA 2D93A 3VGIA 1OA2A 1GSLA 1Z0HA 4GA9A 3EBRA 3JZVA 3A7QA 1UYYA 2XL9A 3UETA 2YROA 2BW8A 1VP6A 4AEJA 4AGVA 5LA9A 2YBSA 4ES9A 5LEKA 2RDRA 4LOTA 4GH4A 3V56A 1IPSA 3SEEA 3RFRA 1RINA 5BYNA 5I8SA 1XYNA 2Y6HA 4LHSA 4KBZA 2EXKA 2WFF1 5EFUA 1OQ1A 3VHOA 1A6CA 1LGNA 1S1AA 3DGTA 4YZ1A 2XOMA 4OMCA 4LOSA 4B4QA 2ZTNA 1VE0A 3MV01 3U0ZA 2J1UA 4CEWA 4LO8A 4FFHA 3OGSA 4QHBA 2GH2A 4DXRA 1VMHA 4BDVB 2XUEA 3VBRA 1RJ8A 3BUCA 4LHLA 4QXHA 2D7FA 4XTPA 1O59A 3PNAA 4LBQB 4UFKA 1GZWB 3I2HA 3U11A 3O0WA 5DDJ2 5FYBA 5FZ3A 5JI7A 4L8QA 3U37A 1X82A 1WW6A 5DAWA 1DQ4A 1XBFA 4FQ4A 4UW6A 2W52A 4NWWA 1GUIA 1F5JA 4FO9A 3VBHA 5GZCA 1RMU1 1QY4A 5A6QA 1QGLA 2KR2A 3VBFB 1NZCA 4KWKA 3JU9A 4MHRA 2RJLA 2VZTA 1G7YA 4XDOA 5I0UA 3WF2A 4IV1B 4BE3A 2WKKA 3WF3A 1HRI1 3F95A 3DF0A 1NA1C 4I0BA 2PYTA 4NMIA 5DN2A 1PZ8A 3NNJA 5DXDA 1CZVA 1J3PA 1AL0G 3SCGA 5I8TA 1V9U2 2VUAA 1ENXA 4YZ4A 4BK5A 3I54A 5C6CA 3H8RA 3ZXKA 2YGMA 3R4SA 4RR3B 4XFBA 1V6IA 4XFFA 4IE0A 2Q4SA 1JH5A 4CDWC 4QKFA 5FV3A 5GZDA 2OKXA 4DFSA 5IFPA 1POV0 2VXRA 2WC2A 1R1A3 2TBVA 1LHOA 3LIHA 3WW1A 2E6VA 1I6XA 4R9BA 4WVMB 2RMU2 1R1A2 3VD7A 5I0DA 3QH6A 2OIIA 4COWA 5FZOA 3BOWA 4QX3A 2IXJA 5LWBA 4BXSV 4K7JA 3AVSA 4CU6A 2VOKA 3PVOA 4GWNA 3WNOA 2BEOA 1OKQA 5FWJA 1OBNA 3I2KA 3DPRB 2EXJA 3WNLA 5IVBA 2V73A 3E6DA 4LIUA 2ATFA 3K46A 3ZXAC 5B4NA 2NMNA 4P9YA 1Q3EA 1TMF2 1W6NA 1ZM1A 5FUIA 2JDYA 1TQ5A 4BQYA 2B39A 5LK5A 3UK9A 3J26N 3I97A 5IK5A 3P1IA 1AR83 1EY2A 3URFA 1JZ5A 1OF4A 3AM2A 5LASA 2H6BA 4HONA 4HBNA 1QNWA 3T2PA 3WVJA 2XLAA 4K1ZA 4E4DX 4N7IA 4XIOA 2XPJA 4YW5A 5L73A 4QPIB 2JKBA 4N43B 3UV9A 2FCVA 2OZJA 3WCRA 5D21A 3GJBA 1ONAA 2EIGA 1LNSA 1OH4A 4HKWA 3KS7A 3VDDB 4D7SA 2JG9C 4MHUA 1RUJ2 3T1LA 3AXDA 4IXLA 5FY9A 4MGSA 1R1ZA 3EHKA 1DZQA 3THCA 3DV8A 4AVSA 4CPBA 1QJX3 1SDWA 1VRH1 2WABA 3J7NA 3VHRA 1D2SA 2R16A 4EQVA 5JZGC 3LDBA 5FZ6A 1QJX2 5CFCC 3HD8B 3ZMNA 4JHZA 5I8YA 2GU9A 1DGLA 1COV2 1QJFA 2W08A 3IB3A 5KXEA 1NY72 4Y33A 4BIOA 2ZGUA 2QJVA 3ZDVA 1VJ2A 5ANNA 4KBBA 1QDCA 2CWMA 1CJDA 4FAHA 4SLIA 1YIPA 5K7PA 2VZRA 4O61A 1X50A 3OY8B 4CUGA 2DVAA 1UKRA 1UMIA 2YHJA 4QKDA 1YQ8A 1SACA 4PCRA 2A6YA 4D3WA 3T0AA 2Y8KA 4PLOA 4RHV3 2QQOA 2YC4A 3DCQA 5KXBA 2BVBA 5F2WA 3OG2A 2HLEA 3EXUA 4ATFA 1CD3G 2HWB2 4LQRA 3FUQA 5HXMA 1BCXA 1QQP3 5JPMB 4JAAA 5FUPA 1ZVFA 5F2SA 2YV8A 3OF1A 3A23A 3LA3A 1W03A 3CJIC 4FPFA 1OUSA 5FZBA 1HXS2 1DQ0A 5T54A 4BQ1A 3WDVA 3ZN5A 1LOFA 3HR9A 2D3SA 4ATEA 5JI9A 2WJSA 5ISLA 2VUJA 4ORFA 4TLGA 1IKPA 2VUDA 2VMDA 1Q5OA 4QQHA 1LEDA 2IXCA 3FBMA 4XAAA 4RL7A 1N3OA 2FDHA 1LU1A 5HCHA 1PNFA 4LBKA 2QQJA 5FZLA 3AZXA 4E2SA 1RUC2 3A0KA 2IXLA 2OQ6A 1YI7A 1VBD1 2RDSA 3WHTA 3VBOB 2PHTA 4L99A 1OFSA 1AR71 1E5IA 1HRV1 2OVUA 3J9SA 5DAPA 2OPWA 5IT6A 1VAMA 4CTEA 4LNVA 3RZZA 1PVC3 4L11A 5CKMA 4OHYA 2XVLA 4UBHA 5IFTA 5CBLA 1MVQA 1K5JA 1NKGA 2G19A 3WW2A 3WV6A 2BTVC 2JENA 5FY5A 1YQ6A 1C5HA 4QD2A 4V2WA 1NCRA 3FLTA 2RS51 1SLAA 1W2AX 2Z79A 3KCXA 3N9OA 4N9IA 5HCBA 4AL9A 1CAVA 2R063 4RQPB 5F1RA 3HN1A 4I2OA 2K9ZA 5BNNC 5BNPC 5ABJB 2R062 1LHVA 2B9UA 1SPPB 2E26A 3JB8A 4OHZA 1R082 3ZYHA 5J36A 1O3QA 1LGCA 1MZ5A 1H8VA 3MPBA 3QBQA 1VBE2 2P6HA 4YWAA 3KGLA 1QH6A 1LKNA 2HWC2 4XC9A 4BM8A 2QKDA 1JODA 5I0RA 1UO9A 2P3YA 4YGBA 2DTYA 1Q8PA 2VVFA 2Y0OA 1V6NA 3C3VA 4Y4RA 5D8AA 5EYYA 3VBSA 4D7YA 5FYCA 5IJRA 3D4KA 4LPLA 2FHRA 1OI6A 4I09A 4IESA 1ENQA 1PGW2 1LULA 2WFPA 2X5IC 1FX5A 2BOJA 3ZO0B 1LHWA 5F3CA 1FATA 1O4YA 2YUEA 5EYXA 1OVSA 3LA7A 1UXZA 4NPMA 1JYIA 1W8ZA 3B02A 4EN7B 1AR63 3CU7A 1XU2A 1QJU3 2VTXA 5LK7B 3PUQA 4CDQC 5GLZA 4GMP3 4XF4A 2AACA 1QJU2 4CDXB 2IXIA 1ND3C 1YFYA 1OLQA 2YU2A 1YQ2A 4W6WA 1EPWA 3HMYA 2RVAA 4XACA 2LUWA 2OT7A 3CQOA 4Z2WA 2EIEA 1NQDA 5IHRA 1DQ6A 4BLJA 3LPGA 5FZCA 1GP4A 4DEVA 3ZOIA 1AL23 3D82A 3S7EA 4BQ4A 3WP3A 3GBFA 3M8LA 4MGYE 1AL22 4NVPA 1EV12 3V0BB 4XURA 3WLUA 2VULA 2WT2A 1JYTA 3QH7A 4MG2A 4KQ7A 4XFIA 3RYRA 3KV9A 2VMIA 1WCKA 2VOWA 5J96B 4IEVA 3WOGA 1B35A 3Q8AA 1AUYA 2VH9A 2D5HA 5H9RA 4CCMA 3GZAA 5DPNA 1PK6B 1QWRA 4GWJA 5DAVA 5FPLA 5APAA 3ZFEA 3TB0A 3EMRA 1W0OA 3C8XA 3BKZA 3ZPOA 1ZBA1 4M3CB 2VECA 3PUAA 4COVA 4R52A 1KXGA 2YFZA 5FUNA 3DXUA 2YFUA 4Z07A 3T30A 3I3EA 4A6OA 1CAWA 4B7KA 3MGUA 1GZ9A 3T3YA 3QOPA 3PMEA 5GKAC 1A8DA 3LOIA 5IK7A 1K42A 4AGGA 3HBKA 4B1LA 2CDOA 3C7GA 4YVSB 1KDKA 1DGRA 3LAGA 1HV1A 5JOZA 1W0NA 1RUD3 1DU3D 1YYNA 1JXNA 3B93A 4QU1A 1IPKA 4XFGA 1H9PA 1L7LA 3H1MA 2WNUB 1FMD3 3OBZA 4JDOA 3MF9A 2DTWA 2D40A 1VLNA 4NN0A 3ACHA 3T0BA 3U4XA 1BVP1 1N3PA 4C90A 4BU2A 3O0VA 1GFF2 2J1RA 1VAKA 3I59A 1OOPB 5T3NA 3C7OA 2JG8A 3KT7A 4P9WA 1XOYA 1GQGA 1C28A 4E4HA 3OBAA 2UY8A 1PZ7A 1K5MB 3AKRA 3NJZA 2C9KA 5FIXA 1H6XA 1FNZA 4ZXEA 2ZCWA 4Q2FA 5FPVA 1W90A 5A3OA 5JXIA 2OXBA 1RC6A 4XMIA 1VB4A 2UU8A 4R4ZA 5JUVA 1I5PA 1O7FA 1YFWA 1AYN3 3H0OA 3HEIA 4LORA 1PGL1 1UWWA 2XJPA 2BU9A 2XKPA 2BYVE 4OZXA 1UN1A 3N9MA 4LA3A 2JWPA 4FXKB 1US3A 2DV9A 2JDNA 2WFF2 3I3QA 5CADA 4QPGB 1ZA4A 4Y1YA 3WCSA 3SC7X 5CYYA 4HN1A 1UIKA 3W58A 1MS9A 3G6JB 1KGYA 5T5OA 5T50A 4Q5OA 4XFAA 2DVFA 4Z8BA 5C3RA 3V0AB 3UYJA 2QZ2A 3JQXA 4A3XA 4RS5A 4AFBA 2D98A 5JMCA 2B9VA 2Y38A 4UFLA 3PU3A 3RI8A 3WSOA 4PIYA 2PHUA 4E27A 1R1A1 4IEXA 4D69A 5C4WB 2Y6FA 1OXCA 5FPAA 4AR2A 5IATA 5AC93 3HNMA 5FPUA 1ZYBA 4RGGA 2DVGA 4IEOA 3A0NA 1Q8OA 3SXWA 3H3ZA 5AC92 1VALA 4AI1A 5F5AA 5FZMA 5AFBA 4OI4A 5KHGA 5DMYA 5J37A 3WZ1A 2HWD3 2VD7A 4UBGA 1C1FA 3ILNA 3VDCA 2Z69A 5T5JA 1UKGA 1FT9A 3UGFA 2HWD2 3B9IA 4S2HA 4EWAA 1GWLA 4L97A 1U5YA 4WM7B 2VNVA 1HRI2 2YPDA 2H0BA 4IGOA 4W6XA 5FAXA 3O1UA 2OS2A 2Q8EA 1AR81 5FXVA 4I01A 2CYFA 2DCYA 4PLMA 5CKQA 5FXXA 3L9JT 1JZ3A 2FDFA 4BK4A 2LRPA 4HXCA 1NLSA 4PDWB 4KMQA 1MVEA 5GLWA 5DZFA 2ZKNA 2QQKA 1DQ1A 1WMDA 2ZXQA 3KWVA 1RITA 4UFIA 4QT6A 3IPVB 4XJAA 3U78A 5BNQA 2IWGB 1E57A 1SCRA 1AX1A 4V1PA 3UKTA 1YIFA 4TXWA 4XUNA 4OZOA 1RUF3 1RL3A 2VQ0A 5GZGA 1W2TA 1WA6X 1S55A 1WCDJ 3KV5A 3OPZA 1SFNA 1RUF2 2Q1ZB 1LRHA 1NY71 3S57A 4YSFA 1AR93 3TYJA 5A6XA 4FP2A 4BXFA 1AR92 4IE6A 3WNXA 5CA6A 4I0WB 4R9CA 3AP4A 1NA1A 4AZZA 4H2AA 4X6QB 1UOGA 5K4LA 2P34A 3LCPA 1ENSA 4WZFA 5CZKA 2OYZA 4A7KA 4JV4A 1Q8QA 2P5BA 4CCOA 3KSCA 5F8PA 2PAKA 4GJYA 5B2GB 3OD4A 3WX5A 2A6VA 2RHPA 3I4IA 3ILRA 2X05A 4RHV1 4CDWA 1JBCA 1O5LA 1TE1B 1IQAA 3E6BA 4XDPA 5L9RA 3R0RA 4DRRA 2BGOA 2QQLA 3LQCA 5F9TA 2Z5WA 4OUMA 5A3PA 1QQP1 1K3IA 2VNGA 2VTFA 1WMEA 5FY4A 3TAYA 3B69A 2XQRA 1RB8G 3WG1A 1OT5A 1VRH2 5C3QA 4XF1A 5FO8B 3PTRB 1JUHA 5FO7B 2PHLA 2L9LA 5F3GA 4XHBA 1D4VB 5FCCA 4Q8KA 2R7EB 2VZPA 3H50A 4QB6A 1CAUB 1M4WA 3K2OA 4XDQA 1TEIA 4AVCA 5I0SA 2O1QA 2PLV3 4S2DA 5FBJA 1CIWA 4COUA 1JTZX 1L3JA 1SMVA 3AZWA 3MFAA 2PLV2 3HJRA 4QB2A 1A8MA 1W06A 4RA0A 5LBEA 5BUVA 4INDA 2WZEA 4IETA 3VDAA 4AI8A 2K2SA 1W9SA 1Y7BA 2BGCA 3ZMOA 1I3HA 4FOYA 3JUUA 4LJHA 4A6SA 3OUJA 1GZTA 3VBSC 4BPZA 3RZLA 3IKWA 1AJKA 3A21A 3UJOA 4DRVA 5CFDB 4XW3A 1MR5A 3CBNA 4A41A 4Q4X3 4A4AA 2JG9A 4GD4A 1QJEA 2A70A 1PVC1 3AKTA 3IAQA 3KZ4C 5C3OA 3ZIWA 4CU8A 4Q4X2 2V72A 1REDA 2XLFA 4GWMA 4W8JA 4HETA 3THTA 3FJSA 2VNRA 4O9GA 5JZGA 1DF0A 2VPVA 4AFCA 2A6XA 3INAA 5CFCA 1UY4A 1VIWB 5C5UA 4Z92B 1FPN1 3LA2A 4JC1A 5EQUA 3WNMA 2VU9A 2R061 4NUBA 1ND2B 1QEXA 1RHI3 3DPRC 2NQYA 3POIA 4XIKA 2LALA 5C71A 1CX1A 5SV5A 2UY9A 3RZMA 1GLHA 1RHI2 1ULOA 3POWA 4IE7A 2ARCA 2BNNA 2C24A 4PJYA 1Z78A 3OB8A 4KI5M 4CP2A 1EYBA 4Y22B 4HKLA 1YLLA 4ZPIA 4BCUA 2JIGA 1F4HA 5FWEA 4AHZA 1AXYA 1FV2A 2D6KA 1W05A 4XUTA 2E7QA 1HX6A 2WT0A 3ETPA 4KGGA 2PHDA 3ZYJB 2VM9A 1RUH3 3ZFFB 4A7ZA 2FDJA 1AR72 1SLTA 4W4ZA 4C91A 1RUH2 4TN7A 4CDUB 2E33A 2J1EA 4LK7A 4QPIC 4GQ7A 3D5OA 2QTWB 4LR4A 3VDDC 1ALYA 3PLQA 5FLHA 2ZPXA 1G6NA 3OGJA 2NN8A 2WO7A 4NRPA 3VUOA 3GBGA 5JVVA 1X9TA 3CJIA 1NE6A 2ORXA 1OPOA 2C4XA 2Q1FA 3K51A 3E5UA 4PBPA 3VKOA 3W21A 4LKFA 4QXBA 2BQPA 3HWJA 3VZMA 1AR61 3JCIA 4K40A 4M0NA 2CGNA 4ARYA 4URTA 1QJU1 1XE7A 1MZEA 4GMP1 4NIHA 4IEZA 2EA7A 3UNPA 5GLVA 1JYNA 3W9AA 1CWPA 4OUEA 4DO0A 3AJYA 2XJQA 1OSGA 1WWYA 3T4HB 2P2KA 3OTFA 5FZ4A 3VHNA 5IYYA 4JKLA 1W9WA 1AL21 1JOPA 4DB5A 4COZA 2VR4A 1MEC3 4BQ2A 1W9TA 4IDZA 3WY6A 4DY3A 3ES1A 1LHUA 4IW3A 3MV11 3POEA 1MEC2 3AP6A 1HLCA 4LKDA 3RDIA 5IVEA 2AENA 5FPXA 1XJAA 1URXA 1H8TB 3ZN4A 1UYXA 1JOBA 1D4M3 3Q9OA 1RUE3 4QQLA 3KT1A 4TYSA 4CP9A 2BBAA 3Q8EA 5FZ9A 3T09A 1D4M2 1NZIA 3MIFA 5SV8A 2E7TA 2XDVA 1RUE2 2W3JA 2EIBA 5FOBB 4LO4B 4FQZA 5FMOS 5D2AA 5GJ6A 4A2UA 1PM4A 2QCSB 4OULA 3N7LA 3M4FA 4CCNA 5BNNA 3ACGA 5GLTA 2Q5TA 1TME3 4LKSA 4AFDA 5FXZA 4BOWA 1YQ5A 4DIQA 1TME2 1YNAA 5DUUA 1GICA 4AEDB 3WQ1A 1W6QA 3FL7A 3KV4A 3OYWA 4KU8A 5ACA3 3MIDA 4YVWB 2VC9A 2WS93 2MPFA 1GNYA 3ASIA 4M3CF 4N7UA 1RUD1 4XTMA 1I1EA 1W6OB 2WS92 1KS4A 3LEIA 4NOTA 4BA6A 1FMD1 3ZN6A 4QX7A 4HL0A 3VBOC 5CISA 4LITA 3VL8A 1N3QA 4HK9A 4X6RB 1N1VA 4YM0A 2FMDA 2X5IA 3ZYPA 4QU2A 2BFUS 5T5LA 1W3VA 3FX3A 5DABA 4AW7A 1N1SA 4QXCA 1XE8A 2X53S 1HKDA 3M3OA 2LW8A 4UFMA 1NCQB 4OHWA 1GANA 1IGOA 4RS5C 4ARXA 5KBFA 3AMHA 4CDQA 4LK6A 1LEMA 1UPSA 1PMJX 2WNOA 3DUIA 3GZUC 3LEGA 3MICA 4JDMA 1ND3A 3IWZA 4K1YA 2ZKLA 5ABJC 1X36A 2BV4A 4HANA 5H9QA 3WR0A 3WEZA 3ZFGB 4ZU4A 5FYVA 2VQUA 4B7EA 2BWAA 5FZDA 5J3UA 2VVEA 3NVCA 4Q0VA 2JDHA 3ZM8A 3ZYGA 3NJVA 5JIUA 1AYN1 4NHKA 3J8F3 5FMDA 2IVJA 2WNVB 4YLZA 1RIRA 2VOVA 4CA9A 4IV3A 4AG4A 3SISA 1GR3A 5FP4A 2WO3A 5G04L 4TZDA 1JYVA 2C5DA 2AUYA 1LU2A 4IEWA 5A6ZA 2RV9A 3CLPA 1FNYA 3VN4A 2VCMA 1S2BA 3ILFA 4K21A 1ULPA 5FR3A 5JSOA 1S0CA 2XUMA 1N1YA 2HBUA 4O65A 3WDXA 1H1MA 4QHOA 4UW5A 1KRIA 1W2OA 2NPIA 1H2KA 2RR13 5FY7A 1JW6A 2F4LA 4WVZA 2A6WA 3POGA 4ZXKA 5BNOB 5A33A 4Y20A 3KVBA 1XNAA 5CIRA 4CXWA 4Y24A 4Y5TA 1L7RA 4IEQA 5F3EA 2GMEA 3ZR5A 3N7JA 3MW4A 1OLMA 1Q56A 3MYXA 4P14A 4CP0A 1CONA 4WM8B 1XC6A 4PQQA 1VMJA 2Z4FA 4JGYB 3S30A 5F39A 3HBZA 5AC91 1A3KA 3D8CA 4EWEA 1J59A 5FYSA 1QOSA 1W6MB 1F5FA 1E5SA 2N7GA 2R1DA 3RMYA 1W99A 5IAVA 2P37A 5C8CA 3M3CA 5JLVA 3PURA 3KQRA 2AREA 3UL2A 5E16A 1PGL2 3AXEA 2HWD1 4ZHNA 3S5QA 1Y4WA 1FOD3 3RYPA 1BBT3 4MUVA 3H3UA 4AWDA 1POV3 2XWJB 1H30A 1FOD2 4OMDA 3JQWA 4XABA 3SKVA 1E5HA 3B5LB 3D0JA 4Q0UA 5FMCA 3WP5A 1RUNA 4YARA 1U0AA 5EXOA 1PK6C 2VMEA 4IL7A 3AP9A 4MADA 1WCQA 1W9YA 5A3TA 2C26A 2ERFA 4Y3OA 1GWMA 4ASLA 1UOJA 3IN9A 2DUOA 1STMA 4QX1A 4BIFA 1VPHA 4IUGA 4M01A 4BQ5A 5JOXA 1HJFA 1PIV3 3WXPA 2WA4A 1DYKA 4ZZ5A 3RZGA 1PIV2 2GMMA 2HWF3 4RSUA 4F7ZA 4UW4A 2JE9A 5JIAA 4D94A 4NPLA 4LO6B 1BK1A 2V09A 1RUF1 4OUSA 5JOWA 4A44A 4YZ5A 4FSJA 2YBKA 2QDRA 4P9JA 3UT0A 2W9XA 4NROA 4HOOA 1VBB3 3LFMA 2PTMA 1AR91 1MPXA 1BEV3 1VBB2 2MNGA 3D3AA 4EN8B 2WWJA 2E31A 4EYUA 4HVOA 1S2KA 1W2NA 5HCFA 1AR82 5DZGA 5CG9A 4XQ4A 1XB9A 3WHUA 2PHRA 2VZUA 2G9FA 4YZ3A 1YI9A 2CL2A 3NW4A 2PMWB 5D1IA 2ZMLA 5KC5A 1K5MC 2GC3A 2Y26A 4QGNA 2W1SA 2J1SA 2QE3A 4MLOA 2PHFA 1EP0A 1DZTA 3H8OA 1MQTB 1IPJA 1ZZ7A 1QF3A 3NL1A 4LHNA 3ZR6A 2DFCA 3FHQA 5K9YA 4Q27A 1NXMA 3RSJA 2Z42A 2NP0A 1G86A 2ZX2A 4Q8LA 3J7LA 4HZFA 3RNSA 2DFBA 1SFPA 1V6JA 2PLV1 2GC0A 2ENRA 4EZ4A 3PJQA 4QPGC 3BOPA 2QUOA 2QQIA 3CF6E 5CAZA 1AZDA 4BQXA 3MLKA 1HQWA 1VRBA 4PBOA 1DLLA 4UYBA 1BMV2 3BIWE 3GHNA 1W3XA 3ETQA 3ZSJA 1TZOA 1HN1A 3MDPA 2WAOA 4XYXA 1WLWA 1EAH3 1JS9A 2A75A 2BWCA 3T4VA 4RHV2 1W8WA 4LXLA 3RZKA 3TEXA 2OX0A 5AVPA 1LODA 4Q4X1 5K0UB 3HNBM 1ULDA 2B5HA 2VZOA 3IMMA 5F5IA 3BN6A 1QQP2 3BALA 3CEWA 2KXLA 1CGPA 4UF0A 4P08A 1UIJA 4Y26A 3ZYIB 1XRUA 5JOYA 1WMFA 5DAXA 4HN0A 4Q4V3 4W50A 1NOVA 2B7YA 3DYOA 4QGLA 5A1LA 2ARAA 3I2OA 1SBEA 4CVUA 4CPBD 3RZHA 3SH5A 2VTXJ 2VMFA 2W2IA 2P4EA 1RHI1 4AQ2A 4AQ6A 4EJRA 3QACA 3M7AA 4GXLA 3UKVA 2J1TA 5C9AB 4R8HA 4JRLA 5HV4A 4J1WA 3B00A 3BTAA 3HPNA 4WM7C 4A42A 2YC2A 1RUI3 1IOAA 1W04A 3FN9A 3IBMA 1LCLA 3GXUA 1LOCA 1H9WA 4OVEA 4NWVA 2BDRA 2RE9A 1BJQA 1RUH1 4BJ0A 5F7UA 4JGZB 4OFGA 4PDWC 3BVCA 4LE3A 5HCAA 4H14A 2ET1A 1PVC2 3E5QA 4LBQA 3ST7A 3U1XA 1CZSA 2I07B 3N3HA 2V5DA 4FPEA 1RVF1 4COYA 2JICA 4K8FA 1FPN3 3NV2A 1SG3A 1WA4A 3AMQA 2WQ8A 4XF3A 3V64A 3V65A 2ZAHA 4GULA 2LM3A 4EN0A 3AMPA 2BUKA 1FPN2 3AZYA 3KT4A 3KV6A 2JX9A 3MLLA 3VL9A 4AVAA 4YW1A 2XLGA 1O4TA 4XXAA 2R49A 2W39A 3HT2A 4IE5A 4MXWB 4Y1ZA 3PVEA 4H7LA 2G9ZA 1RYYA 4QQ2A 2BP6A 3OPWA 4IQPA 1UNBA 4TLFA 4IV1A 3VZNA 5C3PA 1U12A 5BXXA 3AYDA 1QMJA 3AYAA 4YW6A 3H42B 3ES4A 1ZRRA 5DUWA 1R093 1MEC1 2O14A 4XF0A 4QX2A 4KWLA 2Q8OA 3OOXA 1JMUB 4ZY9A 1BK0A 4RR3A 2WBKA 4HSJA 3ZLIA 1CR7A 3ZXLA 1OLRA 1ULGA 4J25A 4XUPA 1J3RA 2OW4A 3H1WA 2W95A 1D4M1 4KGQA 1RUE1 4WVMA 4HLTA 1RTVA 2QQNA 1JYXA 1PO13 1F15A 5A7WB 2Y0IA 4BQ3A 1XYOA 4DS0A 1GOHA 1UMZA 3KHBA 5F5QA 4RGAA 5A3LA 3M3QA 3WF4A 2MHFA 4AHWA 1AR62 5FQ0B 5A7OA 3BTYA 1NXD1 4XJ8A 3O0XA 5FZ1A 1GKBA 2AGSA 3DPRA 4PF5A 2VBDA 4QX5A 1GWKA 3K75B 1TME1 2LROA 3T08A 3O1MA 1IS5A 2B45X 4PF1A 1UU4A 1VR3A 4LBLA 1D0GA 1WZXA 3UKNA 4XZUG 1AX2A 3AKSA 4CCLA 5ACA1 1NAEA 4W6YA 3PUSA 3R4UA 4JHTA 2GNBA 2WS91 2XXZA 3NAPB 4HFSA 4S2GA 1ASJ3 2VW2A 3I2GA 4IV3C 3DXTA 2ID4A 2XVGA 1Q43A 1ASJ2 1T6BX 1WW7A 2J22A 1DBNA 4IERA 4K20A 4QPIA 4N43A 4YW7A 4XJWA 3WDYA 5CFDC 3P3PA 2XHKA 2Y60A 3GZTB 4XUOA 3VDDA 1IG0A 4FFFA 1IHMA 4GKXA 4N90A 3SHRA 2JB4A 1DCSA 1DQ2A 3HQUA 4XMAA 2WRAA 3AMNA 4K3UA 3HOBA 3KGZA 3O1SA 5FK8A 1KFXL 1G9BA 4C0BA 2FMYA 3SH4A 3KF3A 2RS13 2I74A 1DQ5A 5A1FA 2A3WA 5DQ0A 2RS12 1O3TA 1D0HA 1SBDA 3A22A 3PJYA 3KCYA 1CAXB 4FAGA 1SLCA 4Y5SA 2Q8DA 4BLIA 4Q0SA 4RGKA 1GP5A 3VZJA 5C8CC 2AEYA 2VY0A 3OY8A 1RUD2 2GH8A 2VCCA 2WSVA 2VG9A 3GBWA 3J8F1 2W91A 1DG6A 2CNAA 3FMGA 3SQOA 3VKFC 4PIXA 1FMD2 3ZFFC 4IE4A 1AJOA 1JOJA 1GBGA 1TNFA 2JIJA 4CDUC 1UY0A 5GLUA 3WP4A 1XSQA 4JCKA 2W0XA 3ZKYA 2ES3A 1PVXA 3WF0A 4N53B 5EPAA 2RR11 3Q8CA 3LEKA 4XF9A 5L7OB 4Q26A 1P8JA 5L9BA 1ZX5A 3ZYFA 2ZMNA 1D2QA 4AOCA 4DXTA 2YMZA 4JQRA 2BVVA 5G05L 5FXWA 2DCKA 2LS6A 3GJAA 4UI9L 1JZ4A 2WL1A 1QDOA 3WINE 4P9IA 4YZ2A 2WLQA 1PMIA 3FC0A 2WQ4A 1OH3A 3N9QA 3MI8A 1YHFA 1C5IA 2IUWA 1AYN2 5JR7B 3CNAA 4JTNA 3T2QA 1DP0A 3VBOA 1FOD1 4D8MA 1BBT1 5T52A 1POV1 3TN93 5FY1A 3K3OA 5JPNB 1H8TC 1C3HA 4XXPA 1CJPA 1LR5A 5TSWA 3POFA 2P3JA 1L7QA 4XHXA 3TBDA 1W6PB 2PAMA 3ZSEA 3ROUA 5FKBA 5AFEA 1RJ7A 1MZFA 3WG2A 4BH9A 3ENRA 4CRQA 1UF2C 5CB7A 2PQSA 4K6BA 3J7MA 2ETEA 1NG0A 3MUY1 4BISA 1PIV1 1ACCA 3ZSMA 3OBRA 4NR1A 4QX8A 4RQPA 5HXVA 5LA1A 5ABJA 4M4PA 2RS31 2HWF1 5LRRA 4GIQA 5EHDA 1SPPA 2DVDA 4JKMA 4UAPA 2ZGTA 4AEDC 3SNMA 3HN3A 5CVRA 3SEPA 1C8NA 3J7HA 3VKLA 4YVWC 5M0TA 1MACA 5IUQA 3ALQA 3W5NA 5IK4A 3B01A 5B4XA 1VBB1 5FY0A 2P3IA 3VBUB 1BEV1 2CWSA 3QLQA 1YUDA 4KWUA 5FP9A 2G9GA 1SEFA 4JQTA 1DFQA 4NAOA 2XBO3 4FCAA 5L19A 2WYSA 1DZRA 2E53A 1NUKA 2WQZC 4Q1RA 1W8UA 5ANQA 1O3RA 1QXPA 5FPBA 3MLJA 1QU0A 3LF7A 2D6LX 3LE0A 1BVVA 1BYHA 3WDTA 1Y43B 3ITQA 4G3YC 3FLPA 1LESA 4FI9A 1XSRA 4FXGB 2XHNA 1W8FA 1GQHA 1BKZA 4LBMA 4OHXA 3ZXEA 3ZVXA 1S0FA 1JZ7A 2Q1MA 5GZEA 3ZFGC 2VBPA 2WA3A 2WAAA 2ZZQA 3J4UH 3P6BA 5FBZA 1U5XA 1F8VA 1H4GA 2HYXA 1OQDA 3AK0A 2WNVC 3UJQA 3V0BA 2D5FA 4BWOA 3MW2A 4E9KA 2OUJA 4YW2A 1H2MA 2JD4A 1OUXA 1UY2A 2LTNA 1UAIA 1U5IA 3PVBB 5A70A 1LOGA 3IDCB 4AQTA 4META 2D43A 3JB4C 3IDBB 1ST8A 1HDKA 1Z7S3 2ZX1A 3JD73 1BMV1 1PK6A 1MS1A 1UU5A 2FDKA 3USUB 2A73B 5GALA 1ZA7A 5HBAA 2DYCA 3E1F1 5FDBA 2R073 3TEYA 1CZTA 3E6CC 5JSPA 3HNYM 3LIGA 3NO8A 1K45A 4CUAA 4M3CA 2R072 2DUPA 4P02B 1EAH1 1UD1A 4NPRA 3B94A 4WBBA 3T2OA 4B3NA 2Q30A 3OEBA 5BNOC 5BNPB 1LB2A 2VW0A 1NT0A 4AAPA 5FJKA 4K9SA 4CEYB 5LRSA 3WDWA 4ES8A 2EICA 4AF9A 4WM8C 3U4SA 2OPKA 2VQTA 5FY8A 4JGYC 1GNZA 1WLCA 2GMPA 2ZHLA 1SZBA 2JDAA 3NJYA 2D6MA 3B9CA 2JDKA 3OPTA 4YVSA 2DVBA 2D3RA 1AYM3 3OBTA 5A7SA 1G9AA 2WNEA 2EALA 4Q4V1 1CX4A 1XE0A 3LFIA 1JU4A 3VBFC 1N47A 1E5RA 3ZXFA 4DUXA 5K8SA 2WNUA 1QOOA 4AEMA 4Z1VA 4HPKB 4IV1C 5DG2A 5A32B 4W65A 4XBNA 4PLNA 5IVVA 4YG0A 2BNOA 5FTTC 4KWJA 4P5HA 5CG8A 4Q4Y1 1W8TA 4LEJA 1RUI1 3TWIA 5JXJA 5J09A 2FZ2A 2EAKA 2R30A 4ITCA 2DWRA 4RR3C 4AQSA 4FVVA 1GZCA 1K5MA 1ULEA 2C9AA 2QQWA 1UZ0A 3ME2A 4PQ9A 3O5SA 5DG1A 2XH6A 1YJLA 2CU5A 4LO7A 4ASMB 2GC1A 4CXXA 1RUG3 3U07A 4QX0A 4DNYA 3MW3A 4GH4B 5KC6A 2W1QA 2V4AA 1RUG2 2BPA2 5EZWA 1ENRA 3RZJA 2GSYA 5FK7A 4DY5A 4YW3A 5FYTA 1G8WA 3AP7A 2VBBA 1KDMA 3KHCA 4YG3A 2ILMA 2XJUA 1XNDA 4NAMA 3GZEA 1OMIA 4QPGA 1UZZA 2R6QA 1C1LA 3KQ4B 4AI3A 4CEWB 1FXZA 2VMHA 1HW5A 1JI6A 4OI0A 3GALA 4MGTA 2ADDA 2A1XA 4G9SB 3LOBA 4LMFA 4V2VA 5IVYA 4BYYA 3VBRB 1PMHX 1OD3A 1AXZA 1R091 3AX4A 3ON7A 4HVRA 1JHNA 1V6OA 3HQXA 1GOGA 1UOFA 2Q8CA 4N43C 3PUIA 5JAXA 2HKXA 1PO23 4HSLA 2WO2A 3DYPA 4LUMA 3LB9A 4YGEA 2V4VA 4HG6B 4JRAA 1PO22 3I2JA 4XJZA 2CV6A 1MQTC 1RVF3 2HYKA 2VMGA 2DBIA 3VBHB 5T55A 5IVJA 5KXDA 2Z2SB 1PO11 1OLME 4C1WA 1RVF2 3MO4A 1AXKA 2JEMA 3R05A 1S0IA 2QVSB 2ZGNA 2W87A 3FBYA 3SITA 4ZONA 2VCAA 3PMSA 1C8M3 3GNEA 3VV1A 3RG0A 3ECQA 2PFWA 1AHSA 4EWDA 3IMNA 3WUDA 2VE1A 4WM7A 1HIXA 3AZVA 5DAQA 4MGZE 4QGMA 4E8CA 1W8OA 2XL7A 3AYEA 3S7IA 1XYPA 4GB33 5IW0A 2NLRA 1YQCA 3H7JA 4I0AA 1ASJ1 3HT1A 4UFJA 1UY1A 1WD4A 2B42B 3SCHA 4PDWA 2BZDA 2RJKA 5FP3A 2CDPA 3MEPA 3ZXDA 2DCTA 1ZZBA 5FZOB 2ZX4A 3IPVA 5K0UC 2W5FA 5A7NA 2WLPA 2QQMA 5CNAA 2BJSA 4UWDA 2ZHNA 2WINB 2VZ1A 3U14A 2ZEYA 1GV9A 3OUIA 1EUTA 4Q4W3 4NIAA 3H8UA 3MPPG 4YNIA 4CZSA 3HAGA 5FPZA 3H9AA 1W6NB 4PT6A 5E6HA 3SCFA 2JECA 3ACLA 2RS11 5A6YA 2E32A 3GM8A 4TWTA 3U10A 1JYCA 5KHIA 3WP6A 4E4SA 2ZMKA 2PELA 3NKGA 1WD3A 1UZVA 4IGPA 2OUHA 5C9AC 4XEZA 1G9CA 1V0AA 3LSDA 3K3NA 5ACA2 4KH9A 2GN3A 2XQXA 4J1XA 1SBFA 4FPLA 1O6UA 2XJTA 1S0GA 2WYFA 1WBLA 4Y4YA 4AVTA 4LA2A 2YXSA 5FKCA 1YWKA 2PXJA 1QH7A 1HB4A 2ZS6B 4WVVA 4FT8A 5I91A 2ZHKA 3S5AA 4DUVA 1IQDC 2JJ6A 2ZACA 2PAEA 2I2SA 2ZBJA 3ELNA 3AFGA 3AJZA 5FLJA 3PIJA 4DUWA 2HWE3 4P00B 3IDAA 2MEV3 1ZRIA 4O9EA 2J42A 4FPCA 4RQPC 4YFZA 2SLIA 1CAUA 4MH0E 3I49A 1NQJA 5JR2A 1VBC3 2EF6A 4DXSA 4QPYA 2R043 3IDEA 3KMHA 4JDNA 4D7TA 3TNQA 4AXOA 1VBC2 3N7KA 1NLRA 2E51A 2KA3A 2JE8A 4JZRA 4WV8A 3VD9A 3J8F2 3HVDA 2EXIA 3HIFA 3EJKA 1WW5A 1BXHA 2UYAA 4XZPA 2UURA 3P3NA 4D6QA 5CFDA 2ZGKA 5LZ6A 3R4DB 2VUCA 4GZ9A 2KM2A 4XCBA 3D6EA 3TN91 2FDGA 5EV7A 4ONUA 1XU1A 1SCSA 2VMCA 4UFHA 3RJRA 5J7MA 4Q29A 1FYUA 4UF0B 1CESA 5J48A 1J1TA 1ULCA 3EB7A 1IZ3A 2RR12 3N9LA 1XNKA 3BPSA 4Y1XA 1YFUA 4BZ4A 1OHFA 4FPJA 4QMAA 1X8MA 2VZVA 2A71A 3O12A 5FOJB 4CDXC 1XNBA 5FZEA 1ND2A 1GMMA 2ET7A 2YY1A 2VGDA 3W59A 3O14A 4D0QA 5LBCA 4LO5B 5JCTA 2FCTA 4TSVA 1W8NA 1HJGA 2PN5A 4FOQA 4ZS3A 3I2DA 3RYKA 3RWNA 3APBA 4Y22A 2O0OA 3M1HA 3AL5A 2R0FA 1YFXA 4FPOB 5IWFA 3VD4A 1SLBA 1UU6A 2YZ4A 3NAPC 4P5YA 2RDQA 2IZWA 3H8XA 3O1RA 2NM1A 3ZFFA 4AI0A 5DDJ3 1BBT2 1OVPA 5C5TA 5LBBA 4CDUA 4B29A 1DIWA 2EAAA 2ZGQA 1BZWA 3WNKA 2SBAA 3K4AA 1KD7A 1YC61 4P9GA 3I8TA 1NCRB 1WCSA 1CPMA 2XBO1 4YW4A 5FYYA 3T1MA 4AGRA 1OKOA 2VZ3A 3OSDA 4MXVA 1EUUA 4NIIA 1KITA 1CAVB 4L92A 5GM0A 3CL1A 4CSWA 1RXGA 5LY1A 1DYOA 3KD4A 3R6SA 4E8DA 2GNMA 2AR6A 3DEMA 3POJA 4LE4A 4QM8A 4LT5A 2XJRA 4RD7A 2RS33 2GP3A 3BU0A 2G1MA 3ZYBA 4P9XA 2RS32 2HWF2 2VZSA 2A3XA 3JBG1 3M2MA 3NWKA 2ZEXA 4DPNA 5FJHA 2IXKA 1WW4A 3CZUA 4MZUA 4FTEA 1V9U3 4XJ9A 3PHMA 2CSGA 4YVSC 5A1AA 1NLQA 3NV3A 4YFWA 2ZGSA 5D8AB 5FZHA 3VBSB 5C3SA 1ZRCA 1ZRDA 2XJVA 5FFOC 2BGPA 1OPMA 4UT5A 3ZYRA 5FZ0A 4XE9A 2G4IA 2WNUC 2HEYF 1SDDB 2CTVA 1BEV2 1ZREA 2BBVA 2RMU3 1JZ2A 5DZEA 1H8TA 2PQQA 3IAPA 3RRDA 3USSA 4QM9A 3VZOA 2VJXA 3POYA 1YJKA 1Z7S1 3F2ZA 1GU3A 2A7AA 2DU0A 3JD71 4P9LA 4Y1UA 4Z82A 1KEXA 2JDMA 3WF1A 1WBFA 4CCDA 5C8WA 1OOPC 3QCWA 3O1OA 4GWIA 4N53C 4ZU5A 4FTBA 2R071 5LATA 2EXHA 4QPWA 3I3BA 5CU1A 4CE8A 3NNGA 2IFRA 2WT1A 3SLIA 5JDBA 5L7OC 1TMF3 4MSVA 3RMXA 1J83A 4KL1A 1IS3A 3FUOA 3LDKA 3GHMA 3T0DA 1O8SA 5FMBA 2YC0A 4X8PA 1SFYA 2Y34A 4LBJA 4LIVA 3Q8FA 1IKQA 3VD3A 4AEDA 2YYOA 2XJSA 5LBFA 3UGGA 4I3GA 2H6CA 3DN7A 4XJUA 4YVWA 4FPGA 4AHXA 5JWPA 2GP5A 1AYM1 2X10A 3PUHA 4BMBA 3WW4A 1HB2A 2JD9A 4ZZ8A 5LEJA 1F31A 3TRSB 1W6OA 3POSA 4FOVA 5FZAA 4FPKA 4YRDA 5CKNA 1B35B 1QXJA 4AK3A 2OQ7A 1RUJ3 2Y6KA 5H9PA 2A6ZA 4UXAA 3N36A 3ZFEB 3DECA 2WZ8A 2Y33A 3MUZ1 4KU7A 4U36A 5HV0A 2E9QA 2WZR1 4CU7A 2XR4A 1ZRFA 1QOTA 1IS6A 3Q8BA 1W8HA 3ZPYA 4LUKA 2ZA9A 5LY2A 3H7YA 4Q0PA 2ZGLA 1UYPA 1COV3 5FZ8A 1PZ9A 3ABZA 3BIEA 4H55A 1NCQA 1CAWB 1UXXX 2JDUA 2WN2A 3GYDA 4QAWA 1EAH2 1ODNA 1V00A 2R32A 2XKOA 2ZEWA 4NRMA 1TNRA 4R4XA 4CCCA 2D6OX 2AEZA 4F83A 2NYYA 5C4WC 3CDZB 1ULFA 1PGSA 2GDFA 1WLTA 1RUG1 2R1BA 4PIZA 1SLIA 3ZFGA 4OLLA 2ARXA 4Z2AA 2P6CA 3PDQA 4YM1A 3O1PA 1LAJA 1VBA3 3CMGA 2PHXA 4Q4V2 1FV3A 5FYZA 2WNVA 4NHMA 2NMOA 1VBA2 1O5UA 2HWB3 1CN1A 1Y3TA 3VBUC 3C2UA 4XUQA 5EIYB 2E7AA 4LHKA 3I59B 4Q4Y3 1RXFA 1UX6A 2VAUA 3OGVA 2JG8B 2TUNA 3S6PA 4Q4Y2 1OD5A 4CP1A 1HXS3 1FAYA 1RUI2 3O7OA 5EJZB 5C70A 3N7MA 1M06G 4FP3A 4XPVA 3AFKA 3MIHA 5KR7A 2RJ2A 5BNOA 2VZQA 1OFNA 1G9FA 3EO6A 1OC1A 4M0HA 4BMEA 2GNTA 4L0PA 1BLZA 1HB1A 3DYMA 5H9SA 2K0GA 1PO21 1UQXA 1GZWA 4XILA 1QIQA 4L2NA 4QHZA 3ACFA 4HKOA 4WM8A 1C4RA 1X7NA 4JGYA 1HB3A 3FZ3A 2A3YA 4L9BA 4YYOA 1S4CA 2C6SA 5T5PA 1RUC3 5IAXA 4NIGA 4DEQA 5FP7A 1W6MA 1PHMA 3VZKA 3RJ2X 3RQ0A 3VBFA 4CCJA 5EP9A 4R9AA 3W20A 1FI2A 1YCIA 1C8M1 4QQOA 3KB5A 3CHXA 3VB9A 3OJBA 5E89A 4D6SA 3BB6A 4LKEA 2AZ5A 4MGIE 4NE9A 1QNYA 1LTEA 1S0JA 1U5ZA 1UX7A 2AC1A 4RS5B 3WQ7A 4EROA 3AP5A 3NSTA 4GB31 1R092 3OUHA 4KNCA 3WQ0A 3CJXA 1WCUA 3C7HA 2WUHA 2CHHA 3KCCA 2NZ9A 5FP8A 4BB3A 4HVQA 5KHJA 3AVRA 2IC1A 1R083 4OYUA 5FZGA 4S2FA 2C0ZA 2H0VA 4NRQA 2CAVA 4CEYC 4MO3M 3O1TA 1VBE3 5F32A 2RM23 2BOIA 2HWC3 2YBPA 5HI0A 2RM22 1KS5A 5A3MA 1PO12 1QKQA 1ODMA 2ORZA 2P3KA 4MV2A 3NRUA 4Q4W1 1UL9A 4LBQD 1UY3A 3AB0A 3M3EA 1QHDA 3NJXA 4ZKTB 2RDNA 2DUQA 3FWEA 1O91A 4XQWA 4IEYA 1X9PA 2OZ6A 4BHPA 5JMOA 5JSRA 4H7MA 1T6GC 3QD6A 3AZZA 1J58A 1OA3A 2D44A 5LCWL 4DMIA 2IVIB 1APNA 4XOGA 3NV4A 1RGSA 3H1YA 1Y9QA 1J1LA 3VKMA 1C57A 1CPNA 2Y6JA 1MS5A 2CGOA 2CY6A 5A80A 3T2TA 5IVFA 4PI0A 4TTGA 1X8EA 2GNDA 4C0HA 3AKQA 3S0MA 2XB6C 4CXYA 1MS8A 5FYMA 1MQTA 2JKXA 3EQEA 3BU7A 3BYWA 2R0HA 4DZGA 2QQPA 1EPZA 2VVDA 4WVWA 5KWRA 1EV13 4GH4C 2VOTA 2HWE1 5E88A 1O3SA 3I3DA 4GMP0 2AH2A 2B46X 2MEV1 4YPJA 3B3QE 2P17A 3VD5A 3WD5A 1YRZA 4A45A 3NV1A 1ND2C 1NA1B 2D97A 2HH9A 3PIGA 2XONA 4FTSA 4NHYA 1YXWA 3P5BA 2BERA 1VBC1 1W9FA 3IT8A 2P1BA 2R041 3HQRA 4H3WA 2JB8A 2YG0A 3UESA 1NE4A 4CEWC 3W5MA 2VQAA 1QJY1 3ATGA
chains in the Genus database with same CATH topology
4CDWB 4HK8A 1V6LA 4KG8A 2QNKA 3RS6A 1Q8SA 3MIBA 4I2OA 4EV0A 2ZX0A 4MVTA 3VBRC 2PA7A 2VW1A 2XG3A 3D0SA 3FHIB 5GZFA 2ZGOA 1PM7A 4M3CE 4XFCA 4G4FA 3KM5A 5K0UA 1CQ9A 1ZBE3 1HQLA 1ZZCA 4OHVA 3L2HA 4OI1A 3VBHC 4AHYA 1ZBE2 5FMOL 3LWCA 2QZ3A 3TNPB 2GN7A 4U2AA 4E4ZA 4FPYA 2CGPA 1OA4A 1BQPA 5C9AA 2TNFA 1H1IA 2GAUA 2CAUA 5DUXA 5E1RA 2JG9B 4LBNA 3CO2A 3ZIXA 4C1XA 5IK8A 4N9HA 5DDJ1 2XWBB 3L2YA 4JGZA 4QQPA 3TN92 1WLDA 1CVNA 2O8OA 3IIAA 1H0BA 4MGKE 5JZGB 4YM3A 1XQNA 2BFUL 3WG4A 4JTOA 3ZX7A 3VKNA 1UCXA 5CFCB 2F4PA 1AX0A 1W0PA 2WFF3 4XQDA 4AVVA 3LZZA 3M70A 2DF7A 2WZPP 5FO9B 2HEVF 4MXWA 5KXCA 3WUCA 3RI9A 2ZX3A 1KJLA 1ZZ8A 5C33A 3ZXGA 2DU1A 1V9U1 4IEPA 4AYUA 4MYEA 2YPJA 1KJRA 2EVXA 2D3PA 3DKWA 2A5ZA 3LKJA 1LECA 2RMU1 3IM0A 2BNMA 2B8MA 2ZJCA 4QXKA 4NO4A 3CJIB 5F6KA 1OQEA 2XBO2 1X33A 4LTAA 2IXHA 1XXNA 2HJIA 4XETA 1RMU3 5FREA 1DGWX 1MS3A 2O8QA 1NCQC 1PNGA 1RMU2 4DOUA 3BCWA 2ZABA 2X29A 4SBVA 5FQ0A 2HEWF 1TMF1 4NHLA 2GC2A 4CDXA 3VLBB 1HRI3 3KLSA 4YG6A 3JBG3 2YDEA 3JBG2 3FLRA 4X8NA 1QXRA 1VB2A 5FRAA 2DCJA 4FBFA 4DXZA 1F9KA 3BPZA 3NAPA 4A7YA 1I5ZA 5I93A 4I3PA 1RUJ1 1V6MA 1GNHA 2GZWA 1Z7S2 3JD72 2UWBA 1ZZ6A 2ZHMA 3N35A 1W39A 1QJX1 3E5XA 1COV1 5BY5A 1LOFC 5BNNB 3MZHA 1GYKA 2JXAA 1SLLA 1XNCA 4YM2A 1W6QB 3OYWB 4XBQA 4AI2A 5DUVA 1LJ7A 4AVBA 1Q8VA 1KQRA 1CAXA 2ZGRA 4LLFA 1AYM2 2GALA 2ZAAA 3ZN6B 1VBA1 3N4MA 2JE7A 3OGGA 3AYCA 5BV6A 2X5IB 5I0TA 1REFA 2HWB1 1WUVA 1ZZ9A 1DGRN 2WZR3 3VZLA 4I02A 1H1AA 1AVBA 1VRH3 2WZR2 1IS4A 1NCRC 1OOPA 2X8KA 1HXS1 2XVKA 1S0BA 4N53A 4CDQB 5J98B 5EJ3A 1ND3B 1S0EA 4EN9B 4DQAA 5L7OA 4F8AA 4XFHA 5KHHA 2W68A 2ZZJA 1ZNPA 4KG0A 1J3QA 2C1FA 2DURA 1QJZA 1H4HA 1SQ4A 2DCZA 2VOXA 1RUC1 2F6BA 3SH3A 3BODA 4IV3B 3I7DA 4AFMA 2I45A 5D8AC 4RFT0 2FQPA 4YGCA 2WSUA 2VNOA 2PHWA 3LGRA 2UYBA 3FE5A 5A33B 4LBOA 1YO8A 4Y20B 3K48A 2IFWA 3V0AA 1W6PA 3PVNA 1REEA 3ZDSA 3AMMA 1O4ZA 5KHKA 1HQNA 1NYWA 1VAVA 1R081 5C4WA 1LOBA 1VBE1 2RM21 1MZ6A 2TEPA 5C8CB 2HWC1 2OA2A 2UWCA 4AE2A 2AYHA 1VBD3 1DGWA 1AR73 5FLIA 1HRV3 1VBD2 5L36A 3MIGA 4HT1T 4Q1PA 1HRV2 4CYDA 2QFEA 1PGW1 5AVAA 4R9DA 3VBUA 1C8M2 1B35C 1UZYA 4B8EA 3ZFEC 3WG3A 1H2LA 2ZOEB 2RS53 3E97A 3G7DA 4EN6B 5E8AA 2YGLA 2RS52 1S0DA 4GB32 1UW8A 2FBEA 3FFZA 2ZGPA 3SMHA 1RUOA 1V6KA 1I9RA 4UW3A 4MX3A 1JUIA 1HV0A 4FOWA 4HMZA 4B4PA 3OD0A 2ZGMA 4WZCA 3FFQA 4LLOA 1MS0A 3DL3A 1KFUL 1EV11 4Q4W2 3NKTA 2QDNA 4Q0QA 1DYPA 3X29B 3MF6A 1G9DA 4ISRA 1W2UA 4E2GA 1B09A 4M00A 4YGDA 1LENA 2V5YA 1LOAA 1F2NA 1WGPA 1A78A 3A4UA 3MFCA 2JG8C 1LHNA 1MS4A 3THPA 3USUA 3TOJA 3B7MA 1LOEA 4GALA 1DHKB 4DINB 1AF9A 2FZ1A 4AFAA 5EWSA 5BNPA 4JGZC 3WDUA 1N1TA 3AKPA 3LSEA 4CEYA 2JDZA 3PTYA 4GKYA 4J6GA 4IEUA 2WWSA 3OCPA 4AEKA 1ZBE1 3ZXJA 1DDLA 4I30A 2HWE2 2MEV2 3WT3A 2UWAA 4F3JA 3MIEA 3VHPA 2Q0AA 3WW3A 3RPQA 3M3IA 4Y5Z0 2D6NA 4HPKA 1QJY3 2R042 4Y1VA 4ZU7A 5A32A 3GF6A 4JVAA 3ZSLA 1QJY2 1ZBA3 4XBLA 1LGBA 2D6PA 3ZSKA 1UPIA 4LULA 1ZBA2 4OI2A 4E2QA 1JN2P 2E63A 2WIIB 2XGXA 4ISQA 4FPHA 1V70A 5BPXA 5F6LB 1H2NA 2ARBA 2D93A 3VGIA 1OA2A 1GSLA 1Z0HA 4GA9A 3EBRA 3JZVA 4AGVA 2XL9A 4EWDA 5JCTA 2YROA 2BW8A 1VP6A 4AEJA 5LEKA 4ES9A 3V56A 4GH4A 5BYNA 1RINA 5I8SA 1XYNA 2EXKA 2WFF1 5EFUA 1OQ1A 3VHOA 1A6CA 1LGNA 1S1AA 3DGTA 4YZ1A 4B4QA 2ZTNA 4CEWA 4LO8A 4QHBA 2GH2A 3VBRA 1RJ8A 4LHLA 2D7FA 4XTPA 3PNAA 4LBQB 1GZWB 3U11A 3O0WA 5DDJ2 5JI7A 4L8QA 1X82A 1WW6A 1DQ4A 4FQ4A 4UW6A 2W52A 4NWWA 1F5JA 4FO9A 3VBHA 5GZCA 1RMU1 1QY4A 1QGLA 3VBFB 1NZCA 4KWKA 3JU9A 2RJLA 1G7YA 5I0UA 4IV1B 4BE3A 2WKKA 1HRI1 3DF0A 1NA1C 4I0BA 2PYTA 1PZ8A 5DXDA 1J3PA 1AL0G 3SCGA 5I8TA 2VUAA 1V9U2 1ENXA 4YZ4A 5C6CA 3I54A 3ZXKA 2YGMA 3R4SA 4RR3B 4XFBA 1V6IA 4XFFA 4CDWC 2Q4SA 1JH5A 4DFSA 5GZDA 1POV0 2VXRA 2WC2A 1R1A3 2TBVA 1LHOA 3WW1A 2E6VA 1I6XA 4R9BA 4WVMB 2RMU2 1R1A2 3QH6A 2OIIA 4COWA 3BOWA 2IXJA 4K7JA 2VOKA 3PVOA 4GWNA 2BEOA 1OKQA 3DPRB 2EXJA 2V73A 3E6DA 2ATFA 3ZXAC 2NMNA 4P9YA 1Q3EA 1TMF2 1W6NA 1ZM1A 1TQ5A 2B39A 5LK5A 3UK9A 3J26N 5IK5A 3URFA 1AR83 1EY2A 3AM2A 2H6BA 4HBNA 1QNWA 3WVJA 2XLAA 4K1ZA 4E4DX 4N7IA 4XIOA 2XPJA 4YW5A 5L73A 4QPIB 2JKBA 4N43B 3UV9A 2OZJA 3WCRA 1ONAA 2EIGA 4HKWA 4D7SA 3KS7A 3VDDB 2JG9C 1RUJ2 3T1LA 3AXDA 4IXLA 1R1ZA 3EHKA 1DZQA 3DV8A 4AVSA 1QJX3 1SDWA 1VRH1 3VHRA 5JZGC 1D2SA 2R16A 1QJX2 5CFCC 3HD8B 3ZMNA 5I8YA 2GU9A 1DGLA 1COV2 2W08A 5KXEA 1NY72 4BIOA 2ZGUA 2QJVA 1VJ2A 4KBBA 1QDCA 2CWMA 1CJDA 4FAHA 4SLIA 1YIPA 5K7PA 1X50A 3OY8B 2DVAA 1UKRA 2YHJA 1SACA 4PCRA 2A6YA 4D3WA 4PLOA 4RHV3 2BVBA 3EXUA 4ATFA 1CD3G 2HWB2 3FUQA 1BCXA 1QQP3 5JPMB 4JAAA 1ZVFA 2YV8A 3OF1A 3LA3A 3CJIC 4FPFA 1HXS2 1DQ0A 5T54A 4BQ1A 3WDVA 3ZN5A 1LOFA 3HR9A 2D3SA 4ATEA 5JI9A 2WJSA 2VUJA 4ORFA 1IKPA 4QQHA 1Q5OA 1LEDA 2IXCA 3FBMA 4RL7A 1N3OA 1LU1A 1PNFA 4LBKA 3AZXA 4E2SA 1RUC2 3A0KA 2IXLA 1YI7A 1VBD1 3WHTA 3VBOB 2PHTA 4L99A 1OFSA 1AR71 1HRV1 2OVUA 3J9SA 5IT6A 1VAMA 4CTEA 4LNVA 3RZZA 1PVC3 4L11A 4OHYA 2XVLA 4UBHA 5CBLA 1MVQA 3WW2A 3WV6A 2BTVC 2JENA 1C5HA 4QD2A 1NCRA 3FLTA 2RS51 1SLAA 2Z79A 3KCXA 4N9IA 5HCBA 1CAVA 2R063 4RQPB 5F1RA 3HN1A 2K9ZA 5BNNC 5BNPC 5ABJB 2R062 1LHVA 2B9UA 3JB8A 5J36A 4OHZA 1O3QA 1R082 1LGCA 1MZ5A 1H8VA 3MPBA 3QBQA 1VBE2 3KGLA 1QH6A 1LKNA 2HWC2 4BM8A 2QKDA 5I0RA 4YGBA 2DTYA 1Q8PA 2VVFA 2Y0OA 1V6NA 3C3VA 5D8AA 5EYYA 3VBSA 4D7YA 3D4KA 2FHRA 1OI6A 4I09A 4IESA 1ENQA 1PGW2 1LULA 2WFPA 2X5IC 1FX5A 3ZO0B 1LHWA 1FATA 1O4YA 2YUEA 5EYXA 3LA7A 1JYIA 3B02A 4EN7B 1AR63 3CU7A 1XU2A 1QJU3 5LK7B 4CDQC 5GLZA 4GMP3 4XF4A 1QJU2 4CDXB 2IXIA 1ND3C 1YFYA 1OLQA 4W6WA 1EPWA 3HMYA 2LUWA 4Z2WA 1NQDA 1DQ6A 4BLJA 1AL23 3D82A 3S7EA 3WP3A 3GBFA 3M8LA 4MGYE 1AL22 4NVPA 1EV12 3V0BB 3WLUA 2VULA 2WT2A 3QH7A 4KQ7A 4XFIA 3RYRA 2VMIA 1WCKA 2VOWA 5J96B 4IEVA 3WOGA 1B35A 1AUYA 2VH9A 2D5HA 5H9RA 3GZAA 1PK6B 1QWRA 3ZFEA 3TB0A 1W0OA 1ZBA1 4M3CB 2VECA 4COVA 4R52A 1KXGA 4Z07A 1CAWA 4B7KA 3MGUA 1GZ9A 3QOPA 3PMEA 5GKAC 1A8DA 3LOIA 5IK7A 4AGGA 4YVSB 1KDKA 1DGRA 3LAGA 1HV1A 5JOZA 1RUD3 1DU3D 1YYNA 1JXNA 3B93A 1IPKA 4XFGA 1H9PA 3H1MA 2WNUB 1FMD3 4JDOA 3MF9A 2DTWA 2D40A 1VLNA 4NN0A 3U4XA 1BVP1 1N3PA 4C90A 3O0VA 1GFF2 1VAKA 3I59A 1OOPB 5T3NA 2JG8A 3KT7A 4P9WA 1GQGA 1C28A 2UY8A 1PZ7A 1K5MB 3AKRA 3NJZA 1FNZA 2ZCWA 4Q2FA 1RC6A 4XMIA 1VB4A 2UU8A 4R4ZA 1O7FA 1YFWA 1AYN3 3H0OA 1PGL1 2XJPA 2XKPA 2BYVE 4OZXA 1UN1A 4LA3A 4FXKB 2DV9A 2WFF2 5CADA 4QPGB 1ZA4A 4Y1YA 3WCSA 4HN1A 1UIKA 3W58A 1MS9A 3G6JB 5T5OA 5T50A 4XFAA 2DVFA 4Z8BA 3V0AB 2QZ2A 3JQXA 4A3XA 4RS5A 4AFBA 2D98A 5JMCA 3RI8A 2Y38A 4PIYA 2PHUA 4E27A 1R1A1 4IEXA 4D69A 5C4WB 5AC93 1ZYBA 4RGGA 2DVGA 4IEOA 3A0NA 1Q8OA 3SXWA 3H3ZA 5AC92 1VALA 4AI1A 5AFBA 4OI4A 5KHGA 5J37A 3WZ1A 2HWD3 4UBGA 1C1FA 3ILNA 2Z69A 5T5JA 1UKGA 1FT9A 2HWD2 3B9IA 4S2HA 4EWAA 4L97A 1U5YA 4WM7B 1HRI2 2H0BA 4W6XA 5FAXA 1AR81 4I01A 2CYFA 2DCYA 4PLMA 3L9JT 1NLSA 4PDWB 1MVEA 5GLWA 5DZFA 2ZKNA 1DQ1A 1WMDA 1RITA 4QT6A 3IPVB 4XJAA 5BNQA 2IWGB 1E57A 1SCRA 1AX1A 4V1PA 3UKTA 1YIFA 1RUF3 1RL3A 2VQ0A 5GZGA 1WCDJ 1S55A 3OPZA 1SFNA 1RUF2 2Q1ZB 1LRHA 1NY71 4YSFA 1AR93 3TYJA 4FP2A 1AR92 3WNXA 5CA6A 4I0WB 4R9CA 3AP4A 1NA1A 4X6QB 2P34A 3LCPA 1ENSA 4WZFA 2OYZA 4A7KA 4JV4A 1Q8QA 3KSCA 2PAKA 5B2GB 3OD4A 3WX5A 2A6VA 2RHPA 3I4IA 3ILRA 4CDWA 4RHV1 1JBCA 1O5LA 1TE1B 1IQAA 3E6BA 3R0RA 4DRRA 5F9TA 2Z5WA 4OUMA 1QQP1 2VNGA 1WMEA 3TAYA 3B69A 1RB8G 3WG1A 1VRH2 5FO8B 4XF1A 1JUHA 5FO7B 2PHLA 4XHBA 1D4VB 5FCCA 4Q8KA 3H50A 1CAUB 1M4WA 4XDQA 1TEIA 4AVCA 5I0SA 2O1QA 2PLV3 4S2DA 1CIWA 4COUA 1JTZX 1L3JA 1SMVA 3AZWA 3MFAA 2PLV2 1A8MA 4RA0A 5BUVA 4INDA 4IETA 4AI8A 2K2SA 1Y7BA 2BGCA 3ZMOA 1I3HA 4FOYA 3JUUA 3VBSC 4BPZA 3IKWA 1AJKA 3UJOA 4DRVA 5CFDB 4XW3A 1MR5A 4Q4X3 2JG9A 2A70A 1PVC1 3AKTA 3KZ4C 3ZIWA 4Q4X2 1REDA 2XLFA 4GWMA 4HETA 3THTA 3FJSA 2VNRA 4O9GA 5JZGA 1DF0A 2VPVA 4AFCA 2A6XA 3INAA 5CFCA 1VIWB 4Z92B 1FPN1 3LA2A 4JC1A 2VU9A 2R061 1ND2B 1RHI3 3DPRC 4XIKA 2NQYA 2LALA 5SV5A 2UY9A 1GLHA 1RHI2 3POWA 2BNNA 4PJYA 1Z78A 4CP2A 1EYBA 4Y22B 4HKLA 1YLLA 4BCUA 4AHZA 1AXYA 1FV2A 2D6KA 2E7QA 1HX6A 2WT0A 4KGGA 3ZYJB 2PHDA 4A7ZA 1RUH3 3ZFFB 1AR72 1SLTA 1RUH2 4CDUB 4QPIC 4GQ7A 3D5OA 4LR4A 3VDDC 1ALYA 3PLQA 5FLHA 2ZPXA 1G6NA 3OGJA 2NN8A 3VUOA 3GBGA 5JVVA 3CJIA 4PBPA 1NE6A 3K51A 1OPOA 3VKOA 3E5UA 3VZMA 2BQPA 3HWJA 1AR61 3JCIA 4K40A 4M0NA 2CGNA 4URTA 1QJU1 1XE7A 1MZEA 4GMP1 4IEZA 2EA7A 5GLVA 3W9AA 3AJYA 2XJQA 1OSGA 2P2KA 3OTFA 3VHNA 1AL21 4DB5A 4COZA 1MEC3 3WY6A 4DY3A 3ES1A 1LHUA 1MEC2 3AP6A 1HLCA 3RDIA 2AENA 5FPXA 1URXA 1H8TB 3ZN4A 1D4M3 3Q9OA 1RUE3 4QQLA 3KT1A 4TYSA 4C91A 5KWRA 1D4M2 3MIFA 5SV8A 2E7TA 1RUE2 5FOBB 4LO4B 4FQZA 5FMOS 5GJ6A 4A2UA 2QCSB 4OULA 3N7LA 3M4FA 5BNNA 5GLTA 2Q5TA 1TME3 4AFDA 4BOWA 1TME2 1YNAA 5DUUA 1GICA 4AEDB 3WQ1A 1W6QA 3OYWA 4KU8A 5ACA3 3MIDA 4YVWB 2WS93 2MPFA 3ASIA 4M3CF 4N7UA 1RUD1 4XTMA 1I1EA 1W6OB 2WS92 1KS4A 4NOTA 4BA6A 1FMD1 3ZN6A 4HL0A 3VBOC 3VL8A 1N3QA 4HK9A 4X6RB 1N1VA 4YM0A 2FMDA 2X5IA 3ZYPA 4QU2A 2BFUS 5T5LA 3FX3A 4AW7A 1N1SA 1XE8A 2X53S 1HKDA 3M3OA 1NCQB 4OHWA 1GANA 1IGOA 4RS5C 5KBFA 3AMHA 4CDQA 1LEMA 1UPSA 3GZUC 3DUIA 3MICA 4JDMA 1ND3A 3IWZA 4K1YA 2ZKLA 5ABJC 1X36A 5H9QA 4HANA 3WR0A 3ZFGB 4ZU4A 4B7EA 2BWAA 5J3UA 2VVEA 3NVCA 4Q0VA 3ZYGA 5JIUA 1AYN1 4NHKA 3J8F3 2WNVB 4YLZA 1RIRA 2VOVA 4IV3A 4AG4A 3SISA 1GR3A 4TZDA 2C5DA 2AUYA 1LU2A 4IEWA 3CLPA 1FNYA 3VN4A 3ILFA 1S2BA 4K21A 5JSOA 1S0CA 2XUMA 1N1YA 3WDXA 1H1MA 1KRIA 4UW5A 2NPIA 1H2KA 2RR13 1JW6A 4WVZA 2A6WA 4ZXKA 5BNOB 5A33A 4Y20A 5CIRA 4Y24A 4IEQA 2GMEA 3N7JA 3MW4A 3MYXA 1Q56A 4P14A 4CP0A 1CONA 4WM8B 4JGYB 3S30A 5AC91 3HBZA 1A3KA 3D8CA 4EWEA 1J59A 1QOSA 1W6MB 1F5FA 2N7GA 2R1DA 3RMYA 5C8CA 2P37A 5JLVA 3M3CA 3KQRA 2AREA 3UL2A 5E16A 1PGL2 3AXEA 2HWD1 1FOD3 3RYPA 1BBT3 4MUVA 3H3UA 4AWDA 1POV3 2XWJB 1H30A 1FOD2 3JQWA 3B5LB 4Q0UA 3D0JA 3WP5A 1RUNA 4YARA 1U0AA 5EXOA 1PK6C 4IL7A 3AP9A 2ERFA 4ASLA 3IN9A 2DUOA 4BIFA 5JOXA 4M01A 1PIV3 3WXPA 2WA4A 1DYKA 1PIV2 2GMMA 2HWF3 4RSUA 4F7ZA 4UW4A 2JE9A 5JIAA 4D94A 4LO6B 1BK1A 2V09A 1RUF1 4OUSA 5JOWA 4YZ5A 4FSJA 2QDRA 4P9JA 1VBB3 2PTMA 1AR91 1BEV3 1VBB2 2MNGA 4EN8B 4HVOA 1S2KA 5HCFA 1AR82 5DZGA 5CG9A 4XQ4A 3WHUA 2PHRA 2G9FA 4YZ3A 1YI9A 2CL2A 3NW4A 5KC5A 5D1IA 2ZMLA 1K5MC 2GC3A 2Y26A 4QGNA 2QE3A 4MLOA 2PHFA 1EP0A 1DZTA 1MQTB 1IPJA 1ZZ7A 1QF3A 3NL1A 4LHNA 2DFCA 5K9YA 4Q27A 1NXMA 3RSJA 2Z42A 2NP0A 1G86A 2ZX2A 4Q8LA 4HZFA 3RNSA 2DFBA 2PLV1 1V6JA 2GC0A 2ENRA 3PJQA 4QPGC 3BOPA 2QUOA 3CF6E 5CAZA 1AZDA 3MLKA 1HQWA 4PBOA 1DLLA 1BMV2 3BIWE 3GHNA 3ETQA 3ZSJA 3MDPA 4XYXA 1WLWA 1EAH3 2A75A 2BWCA 4RHV2 5AVPA 1LODA 4Q4X1 5K0UB 1ULDA 2B5HA