1RUD2

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52084
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rud200
3ZFEC 2IZWA 5L7OC 1R082 4IV1C 1FMD2 1V9U3 4RS5C 2HWD1 4Y4YA 1C8M1 5JZGA 1AYN1 1VRH2 3VBSA 1PGW2 3J8F1 3VBOC 1MEC2 2GSYA 1BEV1 4CDUB 3DPRA 2ZAHA 2ZTNA 1PVC1 1D4M1 1VBB3 4JGZA 1AYM3 1EAH3 2R073 1QJX1 3ZFEA 5CFDC 5L7OA 4PDWC 4SBVA 5LK7B 1PO22 4RS5A 3VBUA 1QJU1 4Z92B 5JZGB 4Q4V2 3TN91 4N53A 3VBOA 3VBSB 2RM21 4GH4B 3DPRB 3VBHC 5A32A 4RFT0 4JGZB 5C4WC 1GFF2 4RHV1 1OOPC 1AL23 3FBMA 4NWWA 1VBA2 3ZFEB 1AL22 2QQPA 1ASJ1 5L7OB 1QJY3 2Y26A 3IDEA 1CJDA 1HX6A 4RS5B 3VBUB 5C9AC 1QJY2 1POV3 4GMP1 4N53B 1NA1A 3VBOB 1R081 5C8CA 1HQNA 1VBE2 3JB4C 2X5IA 3ZFFA 5A32B 5CFCA 1V9U1 1AUYA 1PGW1 1MEC1 5FMOL 4PDWB 1RUH2 2R042 2BBVA 4EJRA 4CDWA 5ABJC 5DDJ2 1VBB1 4QPIC 1SMVA 1AYM1 1EAH1 1NA1B 1ND2C 4CDXC 4YVWA 1B35A 4GB33 5C8CB 2HWF3 2X5IB 4Q4V1 4GB32 3ZFFB 2WFF3 2HWF2 5CFCB 1E57A 3VDDA 5D8AC 1AR73 5FOJB 1NCRA 1VBD3 4CDWB 1ND2A 1VBA1 1AL21 4N43C 4YVWB 1C8M2 1QJY1 2HWE3 4JGYA 2HWC3 1BEV2 1POV1 2HWE2 1VBE1 4QPGA 1PVC2 1D4M2 5ABJB 1NCRB 2RS12 4QPIB 1ND2B 2WLPA 1QJU2 2BUKA 2MEV3 5DDJ1 5K0UA 5AC93 1ZBA3 1RVF3 1HXS3 2HWB3 1X33A 1RVF2 4QPGB 4GB31 2HWF1 2DF7A 2FZ2A 4Q4W2 2WFF1 4WM8C 4RR3C 1ASJ2 5BNPA 1AR71 1MQTC 1RMU2 1VBD1 4IV3A 1V9U2 2XBO3 3ZFGC 3VBFC 2HWE1 4BCUA 4GH4A 4FSJA 1RB8G 2HWC1 5BNPB 1F8VA 4FTBA 2TBVA 1OPOA 2RS11 1VBB2 1AL0G 5BNNC 4Q4Y3 1AYM2 1EAH2 2R072 4IV1A 1HRV3 4IV3B 1ND3C 1HRV2 1Z7S3 2MEV1 1VB4A 4WM8B 4RR3B 1ZBA1 4YVSC 1RVF1 1HXS1 1F2NA 2HWB1 1DDLA 1R1A3 1RHI3 5CFDA 5GKAC 4Q4W1 4PDWA 1R1A2 2WZR3 1FPN3 5J96B 1NCQC 1NG0A 1RHI2 4IV1B 2RR13 1AR83 3NAPC 1RUJ3 1M06G 1RMU1 1QQP3 2RMU3 1BBT3 3VBHA 1K5MC 1NOVA 2RMU2 5C4WA 3CJIC 1BBT2 1OOPA 1QJZA 5BNOC 5BNNB 2XBO1 5CFDB 4CEYC 4GMP0 1PGL2 2BFUL 5C9AA 1ND3B 3M8LA 1PO13 1H8TC 2R071 1PO12 4Q4Y1 3VBHB 1HRV1 1AR93 3CJIA 2XPJA 5C4WB 1OOPB 1HRI3 4CEWC 1Z7S1 2WFF2 1R093 1RUC3 1HRI2 1NCQB 5ABJA 5C9AB 1VAKA 1AR72 4QPIA 2BPA2 3VBRC 1RUE3 1R1A1 4CDXA 1VBD2 1RHI1 1FPN1 1K5MB 2RR11 5FMOS 3CJIB 4FTEA 1AR81 1RUJ1 4LLFA 5D8AA 2HWC2 2FZ1A 2RMU1 1BBT1 3VBRA 2R063 3S6PA 1X36A 4N43A 4CDXB 1PGL1 1EV13 1POV0 1FOD3 1EV12 3JD73 2MEV2 1FOD2 1PO11 1CD3G 1RUF3 3JD72 5AC92 1ZBA2 5D8AB 1HXS2 4WM7C 2HWB2 1AR91 4AEDC 3VBRB 1VBC3 1HRI1 4N43B 1R091 2WS93 1PIV3 1RUC1 2WWSA 2RS53 2RM23 1RUE1 1RUG3 1RUI3 5JZGC 2XBO2 4RQPC 4RR3A 4WM8A 1RUD3 2ZZQA 3DPRC 2RS33 5A33A 1RUD2 1MQTA 4JGZC 1COV3 1OHFA 1R083 1FMD3 2VQ0A 2R061 4Q4Y2 1C8NA 1VRH3 3ZFGA 3VBUC 4WM7B 1EV11 3JBG3 1MEC3 3VBFA 1FOD1 4N53C 1Z7S2 4RQPA 4AEDB 3JBG2 3JD71 5AC91 1RUF1 4FTSA 5A33B 5BNNA 1MQTB 1WCDJ 1PO23 2WZR2 1ND3A 1FPN2 1VBC1 4Q4V3 2PLV3 2RR12 3ZFGB 2WS91 1PIV1 1AR82 3VBFB 2PLV2 1RUJ2 4RQPB 1NA1C 2RS51 4YVSA 5C8CC 1QQP2 1RUG1 2X5IC 3ZFFC 1NY72 5CFCC 1RUI1 1VBA3 1NCQA 1BMV1 1ZBE3 2GH8A 1RUD1 1ZBE2 3NAPA 2RS31 4CDWC 1VBE3 1COV1 1TMF3 1K5MA 4YVSB 1FMD1 4YVWC 1B35C 1TMF2 4CDQC 5BNOA 4Y5Z0 1VRH1 5J98B 1AR92 3JBG1 1RUH3 4CEYA 2R043 1AR63 3VDDC 1R092 5DDJ3 1RUC2 1TME3 1AR62 1H8TA 3NAPB 1NCRC 1TME2 5ACA3 1RUE2 2WZR1 1PO21 3HAGA 5ACA2 4CDQA 2PLV1 4CEWA 5BNOB 4JGYC 2BFUS 4CEYB 3JB8A 1QQP1 4Q4X3 1VB2A 4QPGC 1A6CA 1NY71 4Q4X2 1H8TB 2HWD3 2R062 1C8M3 1AYN3 1ZBE1 1B35B 2HWD2 3J8F3 4CDQB 1AYN2 1BEV3 5K0UC 4CEWB 3J8F2 1PVC3 1D4M3 1RUF2 3VDDB 1TMF1 2RS13 1QJX3 3ZXAC 4CDUC 1QJX2 1QJU3 1RUH1 2R041 1VBC2 5BNPC 3TN93 1AR61 3LOBA 2WS92 1PIV2 3TN92 1TME1 4JGYB 2RS52 2RM22 4IV3C 4WM7A 5ACA1 1IHMA 4RHV3 1RUG2 4Q4W3 4AEDA 1RUI2 4RHV2 3VBSC 1ASJ3 4CDUA 1BMV2 4NWVA 4GH4C 4GMP3 4Q4X1 1W39A 2RS32 1RMU3 5K0UB 1COV2
chains in the Genus database with same CATH superfamily
2YXSA 5LATA 2IZWA 5L7OC 4IV1C 4P9YA 3ZXEA 1V9U3 3ALQA 1UY3A 2GC0A 4QPYA 1C8M1 4BQWA 1LNSA 2ETEA 3EJKA 4MV2A 2XL9A 3LA7A 5FBZA 4AAXA 2QDRA 1PGW2 2XJSA 3ELNA 3J8F1 3VBOC 2JENA 3C7FA 4MG2A 2VMDA 1GSLA 2DTYA 1UX6A 4ASMB 4J1WA 2ZAAA 1PVC1 1D4M1 1GQPA 2Y60A 3NO8A 4QX1A 1DYPA 1AYM3 2YB7A 3OGSA 1ZA7A 3ZFEA 5KWRA 1VMJA 2E7QA 4OULA 1FI2A 4HT1T 4SBVA 1CVNA 4TZDA 2FCVA 4ASKA 1FYUA 1S0EA 2DWRA 4NE9A 1XXNA 5KC6A 4Z92B 1WCSA 5JZGB 2A3XA 3PHMA 3S5QA 5APAA 2XMLA 3ME2A 5AVAA 4LA3A 3FBYA 1GLHA 4XIKA 2RM21 2DU1A 1NLSA 3FJSA 3RSJA 4AI9A 3VBHC 3IPVB 4URAA 2ZMLA 4BQXA 2DTWA 1XE7A 1DGLA 2W1SA 5M0TA 3O5SA 4JGZB 5C4WC 4ORFA 1CIWA 1AL23 1YFUA 5FTTC 4MGIE 1U5IA 1PX4A 3B69A 4QX7A 3SHRA 2QFEA 2E53A 5FXWA 2HKXA 3WQ0A 1QJY3 4XF0A 2BEOA 3IDEA 3KGLA 4RS5B 2PHUA 2ZOEB 5EJ3A 4LO5B 3WNOA 4N53B 3H3UA 1AVBA 1R081 4IEPA 4WZCA 3E5QA 3B3QE 3LDKA 4YNIA 1PM4A 2X5IA 4MZUA 3ZDVA 4BQ2A 5LEJA 2A75A 2ZX2A 1JZ8A 4MHUA 5CAZA 1UZVA 4XURA 1W0PA 2B42B 2ZX4A 4AXOA 1VP6A 1UXXX 4I3PA 4UBHA 1DG6A 3FLTA 4AGRA 4E8CA 4ZKTB 3RZLA 2J7MA 2BBVA 5A7OA 2VCBA 4IL7A 3ETQA 3PIGA 4E8DA 5FYCA 4D6RA 2YMZA 2C24A 1VMHA 1JXNA 2P34A 3MIFA 5A6XA 1ALYA 2EIEA 4FOYA 4B1MA 2WNVC 4GB32 3ZFFB 2HWF2 5CFCB 4X6QB 2Q4SA 5FKCA 3F95A 4DXRA 3WP5A 5C3SA 3KD4A 2RV9A 4N7UA 4AYUA 1TVGA 2IVJA 1AR73 5FOJB 4DMIA 1SLAA 3V0AA 2WINB 4INDA 2BTVC 1IPSA 3ACLA 1VBD3 4XF4A 4CDWB 5A6QA 3VHOA 5JWPA 3KCCA 3WQBA 1Y9MA 1HB3A 4DFSA 4HN1A 4FQZA 3RMYA 4YVWB 1C8M2 1QOOA 4XVHA 5K8SA 1GOGA 3AC0A 2HWE3 3GNEA 3H8UA 3T4VA 4JGYA 1SCSA 2E9QA 3H7YA 5E89A 3VD4A 3VZKA 4NAOA 4GZ9A 5HXMA 3MLLA 1PVC2 1D4M2 1X7NA 4QPGA 4MVTA 5ABJB 1NCRB 3LE0A 4HK9A 2WKKA 3Q8CA 4JRAA 4M0HA 4QPIB 1CGPA 3RYKA 3T2TA 3VZLA 3C2UA 1ND2B 4DY3A 2DVGA 4Q0SA 5JXHA 3FFQA 2BUKA 4NHXA 1YC61 2AREA 3ZYGA 3KT1A 3MIBA 3BUCA 2D44A 2D6NA 1WMEA 4IE6A 3BPZA 3IDBB 5AC93 1CX4A 5T5PA 4TWTA 4DB5A 1WA6X 2IFWA 2D93A 2Y6JA 3KQRA 4K7JA 3THPA 4BISA 5FO9B 3LPFA 2DURA 3VN4A 4PI2A 1HLCA 5FYIA 3NV3A 3EB7A 4ZONA 1XE8A 2FZ2A 1W04A 3HBKA 4FI9A 1QU0A 4Q4W2 4B4QA 3PUSA 5FYMA 3MYXA 1O8SA 4AQ2A 2J1EA 1NQDA 4W6YA 4P14A 4OCTA 1MQTC 1V6LA 3CEWA 3ZPOA 4J25A 3VHNA 2VH9A 3WNKA 3AP5A 2OW4A 3AJZA 3PNAA 4LE3A 5FY0A 3POBA 3ZXKA 2XBO3 5E8AA 1MZ6A 3TRSB 3BCWA 4GH4A 4FSJA 5CKQA 1OQ1A 3BN6A 3POGA 2HWC1 2HYXA 2I07B 5BNPB 5BV6A 4LT5A 2PQQA 2ZGUA 1CPMA 4LHLA 3UK9A 2FHRA 5JOXA 1QHDA 4UF0A 4YW4A 1QWRA 5BNNC 3FX3A 1FNYA 1HRV3 1IPKA 4IV1A 5AVPA 5BPXA 4IV3B 1NT0A 3VDCA 4YGBA 5IVCA 3KHCA 3I97A 1UPSA 1Z7S3 2QZ3A 1ZRFA 3OGJA 4Q5OA 4AZZA 4YVSC 4CUBA 3U0ZA 4CCDA 2EIGA 2GNBA 2FDHA 3NNMA 1GZWB 1R1A3 1GR3A 1TQ5A 2EAAA 1UKRA 2C26A 2GALA 2WO2A 2D98A 5HCFA 3PVOA 3GZEA 5FZ8A 1FPN3 5J96B 4CTEA 1XNCA 4Y1VA 1RHI2 1JYXA 1ZM1A 3A4UA 3GHMA 1MZ5A 5E6HA 1LGNA 2JEMA 4BMBA 1XU2A 4A6SA 2CDOA 3NAPC 4LHKA 4AVCA 3BU7A 4D6SA 1C28A 5FLJA 4K8RB 3T3YA 5CKNA 1RMU1 1H2KA 4TN7A 1AXKA 4Q29A 1QQP3 4E2GA 1BBT3 3VBHA 2OS2A 4BPZA 1W8FA 1HB2A 5FPUA 1U5XA 5C4WA 4DEVA 4FXGB 3H1WA 3AMNA 3I3DA 2IXJA 2J1SA 3J26N 4N9IA 2Y6LA 1SLCA 4OYUA 4UFLA 5CFDB 2GC2A 3QH6A 3CU7A 4RSUA 2BFUL 2XVGA 2QDNA 2JG9B 3LGRA 5C5UA 2YGLA 4JV4A 4K21A 1MPXA 5A3MA 5A3NA 2ZABA 5JIAA 2OYZA 2QQJA 2VNRA 4AHWA 3I59A 4DUWA 1PO12 2C0ZA 3VDBA 3AMMA 2ZEXA 4IEYA 3BTAA 1FV3A 4B7KA 1W2AX 4LBQA 3ZMNA 3CJIA 2E7AA 2PELA 1OOPB 3T1LA 1Q43A 2ET7A 2XHKA 2YBPA 3WG3A 4LO8A 3IM0A 1HRI2 5CISA 1JZ5A 5FZBA 3VD7A 4CP9A 1F5JA 4OLLA 5FK8A 2JB4A 1Y7BA 4E4HA 2UU8A 5JXGA 3LKJA 3U4XA 2BNMA 4D7SA 5JSOA 4QMAA 1YXWA 2VQAA 4PI0A 1W8OA 2ZHLA 3OBAA 4ZXKA 1K5MB 3NW4A 2WNVA 4Q0VA 4YYOA 4A7ZA 5K9YA 5A3LA 4H2AA 5DG1A 1SBFA 2YU2A 4XUQA 3VD9A 3C7GA 4NIHA 4XPVA 4F7ZA 3SXWA 2YYOA 1ONAA 1RUJ1 3DGTA 2J1TA 1ZNPA 2XKPA 2NYYA 3NJZA 3NNJA 2DVDA 2HWC2 2P3YA 4K20A 5I8YA 3BTXA 2EIBA 1EY2A 4MXWA 5FP3A 3IDAA 3POYA 5FPAA 2BV4A 3VBRA 2J1RA 4M00A 1O6UA 2VBPA 3S6PA 3U11A 4BQ4A 5C70A 4L8QA 3S5AA 3OEBA 1GOFA 3NKTA 1E5IA 1FOD3 3V56A 3NJXA 4QHBA 5B2GB 2BVBA 3TEWA 3QBQA 1EV12 3KV6A 2PMWB 2ZEZA 1A8MA 4COYA 5FZAA 1CD3G 1SLIA 2WQ4A 3HR9A 4W8JA 3V0BB 5D8AB 2RDSA 4QM8A 4WM7C 2HH9A 3KVBA 4JTOA 2VMEA 1J3RA 4NHLA 3WDVA 1AR91 1XNKA 3M3OA 1U5ZA 1KDKA 4BM8A 1IG3A 3N36A 1JU3A 5FRAA 1R091 1JODA 3POJA 5B4XA 1RUC1 1AXYA 3EYPA 3NKGA 4LBNA 5F3GA 2E33A 3VGIA 3IMMA 3VZOA 4YZ5A 1OFSA 4LO6B 5F6KA 4Q2FA 1X8EA 5FZ7A 4HVOA 4AFBA 1REEA 2YC2A 5IW0A 1XU1A 3IZOA 4MGSA 4UWDA 1NLQA 3UESA 1RUD3 4DNYA 2BU9A 1UYYA 3DPRC 2VZTA 2RS33 3I2HA 2C4XA 3NV4A 2XR4A 2OPKA 3CZUA 4YG3A 1MQTA 4O7XA 1SLTA 2V5YA 4CU9A 1VE0A 3WW3A 1QF3A 3ZYFA 4KBBA 4AVAA 2CU5A 5F5AA 5A3TA 2VQ0A 2R061 4XF9A 1PGSA 2YY1A 4N7IA 1G9CA 4BA6A 5A80A 3VZMA 1HDKA 2EALA 4YZ1A 3M3EA 2W2IA 4YFZA 4M3CE 3F2ZA 3CZJA 3MGUA 1UU4A 3JBG2 5AC91 2AUYA 1ZREA 3O1VA 4NVPA 4R9AA 4V2WA 5A1AA 3TEXA 3U1XA 3OBTA 4FTSA 1LGCA 4A6OA 2BVVA 5A33B 1N3OA 5BNNA 1D0HA 1LODA 5D2AA 1RUOA 3E1F1 3FFZA 1N3QA 2GC1A 5CEHA 2B45X 2W1QA 3KS7A 3OCPA 3AL6A 3L2HA 2WZR2 1X50A 3I2KA 2Y6KA 3QACA 5CU1A 4AFMA 1D7PM 2XONA 2JDMA 1Q8QA 1PIV1 3VBFB 4XTPA 4ARYA 4Q27A 3WUDA 3EBRA 1NLRA 3DCQA 4QU2A 1RUJ2 4RQPB 1QEXA 4YVSA 3W58A 3BB6A 3ZN6A 5C8CC 2VR4A 1KRIA 1EYBA 1RUG1 5IJRA 2XH6A 4M3CF 3O1TA 1XNAA 4GIQA 2YHJA 1ZZCA 1IQDC 1RUI1 1EUUA 1LGBA 2VCMA 2WWJA 3J4UH 5DAXA 2WJSA 4LBKA 5LA9A 4AEKA 1W2NA 2R1DA 2EA7A 5T52A 2ZGSA 4XDOA 2CAVA 4NR1A 5FY5A 3WQ7A 3NAPA 2WQZC 2HEWF 3ZSEA 4KI5M 4N8MA 4QB6A 1YFYA 4XMAA 3T1MA 4LK6A 1COV1 2BJSA 2OUJA 2ORZA 3CQOA 1CAWB 2QTWB 3DYOA 2VVEA 5KXBA 4JRLA 5LA1A 1VRH1 1BYHA 2XJUA 3E6DA 5EQUA 1AR92 1TG7A 2ET1A 5FFOC 1LENA 2XXZA 3UNPA 5FY4A 4XJ8A 2D6MA 4Q0PA 1WW4A 1DF0A 5LY2A 2VZ3A 3OBZA 1R092 1V6MA 2OQ6A 1W6OA 3VDDC 1RUC2 5LB6A 3T2OA 1TME3 2NLRA 3JQWA 3KB5A 3OUIA 4LQRA 4P9JA 2AR6A 2JDZA 1DQ6A 4XBQA 3O1MA 3H8RA 2PHLA 3FL7A 4ZHNA 1J1TA 4A7YA 5JUVA 3IIIA 4AHZA 1QJEA 1JOJA 4HVRA 1PO21 4TXWA 3RYPA 2XVKA 5ACA2 3DYMA 1JZ2A 5FZIA 4JTNA 2PLV1 3VZNA 3KZ4C 5FYBA 1Q3EA 2W91A 3USUB 3WW2A 1LTEA 4HETA 4CEYB 2EXIA 4OVEA 1IG0A 1QQP1 3N9PA 3ABZA 4UFMA 5F5QA 2V73A 2C6SA 4AQSA 1H8TB 1Y9QA 2E31A 4FPLA 4UW5A 1Q8VA 4FPOB 2R062 1C8M3 4DXTA 1GU3A 4EN0A 5T50A 2ADDA 2JXAA 2QJVA 5FQ0A 1ZBE1 5EIYB 3J8F3 2RE9A 1X8MA 1APNA 3MW4A 4YLZA 2IXIA 4P08A 4BK4A 1PVC3 1D4M3 3NQHA 3NSTA 4O65A 3I3BA 3OGGA 4QT6A 2WO3A 2R0HA 3HQUA 4QWNA 5IATA 5J37A 1DHKB 1ENXA 4JDNA 5BNQA 1QXJA 1GYKA 3V0AB 3BIEA 1CZVA 1DYKA 1QJX2 4P9IA 4CXXA 1FV2A 4IE7A 1RUH1 4Q1PA 2R041 3AVSA 3I3QA 1AR61 3LOBA 3MUZ1 3TAYA 1KJRA 2ZGNA 4FVVA 1PIV2 1WBFA 5FP8A 1S2BA 3N9MA 4JGYB 5FPXA 3RZKA 2A7AA 2PHRA 1H4HA 1UPIA 3U10A 5DG2A 3AZYA 4WM7A 1WD3A 4CU7A 1RUG2 1ZRCA 4OQ8A 5EZWA 4Q4W3 2WC2A 3GHNA 1YLLA 1RUI2 4RHV2 3B7MA 1I9RA 4HPKA 4Y20B 1HIXA 1N1SA 1UWWA 4KGQA 1W6NA 1WGPA 4RFRB 5EYYA 3AX4A 4Q4X1 3JU9A 1W39A 3I2GA 4XILA 3A0KA 3DXUA 3N9LA 4I01A 2R30A 2AYHA 2RHPA 1COV2 3Q8BA 4KG8A 3UGFA 2D5FA 4LKEA 3ZFEC 1FX5A 1REFA 3NRUA 5EPAA 1KEXA 5JVVA 3E5XA 3ACFA 4Y4YA 3WEZA 1MZFA 2JE8A 1FXZA 1AYN1 2Y8KA 1VRH2 4LKSA 2WN3A 1NX9A 1MEC2 2XQXA 3CIHA 1BEV1 4CDUB 3DPRA 3FZ3A 4LUKA 2SBAA 1CAUA 4K9SA 2BWAA 5CA6A 1IS4A 5J48A 4P00B 1OF4A 2XUEA 5CVRA 5IK8A 3ZKUA 5LK7B 1PO22 2X09A 2Z42A 2Q30A 2WNUC 1YJKA 4X6RB 2XLAA 2ZA9A 5DUXA 3J7MA 5FZLA 1WD4A 5KXDA 3TN91 2BGOA 3GDBA 3N7LA 1W3XA 3ZYRA 4TLGA 3VBSB 3NNFA 4XAEA 3AJYA 4HKLA 3C7EA 3MDPA 4GH4B 4PLNA 1B09A 5A32A 3AL5A 3MLKA 5DXDA 5E1RA 5I0UA 2Q0AA 4KU8A 3SKVA 1US3A 2YG0A 4NWWA 1CN1A 5FYHA 2WZPP 1NE4A 1XNBA 1YRZA 3G6JB 1G7YA 3GZUC 1ASJ1 2TUNA 2Y26A 3U4SA 5L7OB 2ENRA 3FLPA 2D6PA 3AMQA 3B9IA 1HX6A 3VBUB 5A7SA 5C9AC 1UY4A 1XNDA 4KL1A 4OUEA 5E88A 4GMP1 1S0FA 3LDBA 3VBOB 4CYDA 5DZEA 4I02A 5C8CA 2JDKA 2X53S 3WP3A 4BMEA 3NL1A 4D7YA 2E7TA 1JOPA 3PMSA 5FUIA 3WDYA 3SH3A 2UYBA 2Z4FA 4M4PA 1PGW1 2W92A 3MFCA 2XB6C 1VR3A 3B01A 2Q1FA 1RUH2 2R042 4OQ9A 2JIJA 4KWLA 5CBLA 5L36A 4DY5A 4PHZA 4UW6A 4AK3A 3RWKX 2VXJA 1Y43B 5K4LA 1F4AA 2ZEWA 3D8CA 4R9DA 1URXA 2YGMA 4W6XA 1EAH1 1NA1B 3T2QA 4CDXC 2VVFA 1J3QA 4HKWA 2Y38A 4WZFA 1A34A 1T2XA 1PHMA 2GN7A 3FHIB 2A1XA 4K1ZA 4YGCA 3GF6A 4XBLA 2FBEA 1IKQA 3BGAA 3DL3A 3VDDA 3GM8A 1KD7A 1OH3A 1CZSA 2W52A 3AK0A 4AVVA 2KD7A 2JG8C 3WD5A 4IE4A 1D2SA 2ZKNA 3M7AA 5F2SA 5FZCA 3KLSA 3URFA 1ULGA 2W94A 5IVYA 5I0DA 3I59B 4C1WA 1JI6A 2EXKA 5DABA 4XCAA 2VY0A 3POWA 2DBNA 1VMFA 3DN7A 5FZ3A 5FO8B 2PN5A 4AFDA 2HWC3 1BEV2 1POV1 3GCXA 1ENSA 2WDBA 4XYXA 2WUHA 2GDFA 5FPLA 4HMZA 1ZVFA 1KS5A 5DMYA 1OA3A 4X8PA 2IWGB 4XFHA 1W99A 4HK8A 5DUVA 5CB7A 5FZ0A 3VKFC 4DRVA 2ZMKA 5AFBA 3FN9A 4Y5TA 1W6MB 3RDIA 1SFPA 3O0WA 5DUUA 2G4IA 5IAXA 2C1FA 2VOKA 1UYPA 3OPWA 3OB8A 3VD3A 2WNVB 1SQ4A 2AH2A 3IDCB 1I1EA 3KCXA 3H50A 4YG6A 1REDA 4CRQA 4JKMA 1H9WA 2WWUA 5FYTA 4EROA 3SCGA 1RVF2 5GLTA 2CY6A 1GV9A 5FK7A 4GB31 4ASLA 2FD8A 2HWF1 2DF7A 4MXWB 5K7PA 1H6YA 2Z69A 4CUGA 2WFF1 1XYPA 3O7OA 3PU8A 1O3RA 4RR3C 1ASJ2 3ROUA 1JW6A 3Q9OA 2NN8A 2FDIA 3C3VA 5F39A 4QGMA 4DIQA 4YW1A 3PL0A 3I2DA 2VM9A 1DZQA 4XDQA 1LESA 3P5BA 1MS3A 2PAEA 3SEEA 3OTFA 3BVCA 3FLRA 3KM5A 4AVSA 1C1FA 3VZJA 3RVHA 2YPDA 1A8DA 5H9SA 5EWSA 4AI0A 5FMDA 4E2QA 1CQ9A 4I0BA 4AHXA 2ZGMA 1LU2A 4AFCA 4GWJA 4D8MA 3LIHA 2VL4A 2JWPA 1UYZA 2VULA 2TBVA 3ACGA 4XW3A 4D3WA 1OPOA 1H6XA 1ENQA 3K48A 4AI2A 1I5PA 3GJBA 4ZY9A 1KS4A 3WDWA 1YCIA 1EAH2 4KGGA 4FFHA 4Z2AA 4MUVA 3WDXA 4NRPA 5A1LA 4QX2A 4R9CA 3NMBA 2WSVA 4FPKA 2CYFA 1H1MA 3NNGA 4OHVA 2K0GA 4LEJA 1C3HA 2MEV1 3WDUA 1FATA 1JUHA 2ZMNA 4Y1YA 3W5MA 3ZVXA 2P4EA 1OLME 2D7FA 1HN1A 2UWBA 2VQUA 1F4HA 1ZBA1 3T0AA 1OD5A 3BODA 2FDFA 4ONUA 1J58A 5ANNA 1F2NA 4L9BA 1UO9A 4META 5JMOA 1LHVA 2H0BA 4Q4W1 2WZR3 3KV9A 4P02B 1NCQC 1UY1A 2WNUA 3UGGA 1GZ9A 2ZEYA 3AYEA 3BKZA 3D4KA 3HVDA 4Z82A 2DCYA 5IYYA 1RUJ3 4GULA 5A3WA 1M06G 2DCZA 1YIPA 1EPZA 2VCAA 5FZGA 2FDKA 3NWKA 4JDOA 3ZYPA 2WABA 5IVFA 1UN1A 2RMU2 2PHXA 1PM7A 2K2SA 3CJIC 5A70A 1E5HA 3HPNA 1JUIA 5BNOC 4XQWA 4BDVB 3I2OA 1H0BA 2PHTA 4LTAA 5FZFA 5BNNB 3LEMA 4NIGA 1IZ3A 5FZDA 4GMP0 1PGL2 4GAZA 4KWJA 4K3UA 5C9AA 5SV5A 5DAPA 2Q8CA 3RQ0A 2VD7A 4K40A 4NPLA 1K12A 4K6BA 5HV0A 4Q4Y1 1DCSA 1WW5A 2A71A 3OD0A 3ZMOA 4P9LA 2W39A 4JX0A 1BVP1 5JPNB 2ZKLA 3AZWA 5KHIA 1AR93 1CWPA 5A6YA 1WUVA 3BTYA 1XSQA 4AR2A 2WFF2 5FPBA 1R093 5LCWL 1RUC3 4AVBA 1DGWA 3WNPA 3GBGA 3WHUA 1DIWA 4XQ4A 1OBNA 3HT1A 1VAKA 1UIKA 2BPA2 2V09A 3CO2A 3B02A 3VBRC 1SG3A 3O1OA 3WG4A 4CDXA 3J7LA 1YI7A 4UXAA 1JYNA 1RHI1 2P6CA 3T2PA 4WVVA 1PK6C 2RR11 2XWBB 3OGVA 3B94A 5FMOS 5FV3A 4CU6A 3TEZA 2QBXA 2ILMA 3HN3A 4QXKA 3THTA 4LLFA 3DV8A 2JG8A 2NZ9A 2W08A 1G8WA 1GP5A 2PQSA 4QKDA 4BLJA 2FZ1A 2WT0A 1PX3A 4J6GA 3HT2A 3VLBB 1ULCA 2R063 2CGPA 1W2TA 2BOIA 5BY5A 3SH5A 5LEKA 3NV1A 4NIDA 2W87A 4COUA 5BYNA 4BIOA 1POV0 3H1MA 4GWMA 4WBBA 4UOJA 1UU6A 4I30A 2RG4A 1GANA 2MEV2 4E4DX 1PMHX 3X29B 3OF1A 3OGRA 1OSGA 1PO11 4XUNA 4Y33A 1DFQA 1W8TA 1YHFA 3JD72 4P5YA 1VJ2A 4JAAA 1ZBA2 2VUDA 3U14A 4HONA 2J22A 3MPBA 1I3HA 4UFJA 1R64A 4AEDC 4XFBA 3O1PA 2PAMA 5GLUA 3C7OA 1LEMA 1HRI1 4IESA 4IGQA 4FXKB 4LO7A 4N43B 4LHNA 3D5OA 5EV7A 2PFWA 4Z8BA 2I45A 1YFXA 1JYVA 3WDTA 1PIV3 1KGYA 1ULPA 2WWSA 5J09A 1VRBA 1AX1A 5A6ZA 2DUPA 5FZKA 2VZQA 4QHOA 3CL1A 1QMJA 4LE4A 1ST8A 2VOWA 4AI1A 2YU1A 3PJQA 3WSOA 1RUE1 4AW7A 1RUG3 2OXBA 5C3RA 2Y34A 1SPPA 4O9EA 3G7DA 1DYOA 1RUI3 3ZYBA 4A41A 5JZGC 3HMYA 1LAJA 2FQPA 3H0OA 5IAVA 5JMCA 1W8NA 3ILNA 5LZ6A 4RR3A 3Q8EA 4LULA 2D5HA 2WN2A 3R4DB 2GMEA 5IK5A 4BJ0A 1LHNA 4DOUA 1W6PA 5AFEA 1GNHA 4OI0A 2R16A 3U78A 4JGZC 1COV3 1OHFA 3ZLIA 4TTGA 3AP9A 1QXPA 5F3CA 3N7MA 3OUJA 4Q4Y2 4JKKA 1JZ6A 4FT8A 1VRH3 2P2KA 2B39A 3ZXGA 3HN1A 4WM7B 1EV11 1RINA 1MEC3 3MIEA 4XUPA 4EN6B 2W68A 4LUMA 4N53C 1O4ZA 4OFGA 1LRHA 4ZS3A 4PIZA 3WNLA 4HPKB 1JBCA 4Y22B 4HSLA 4C90A 4FP2A 5F9TA 5FAXA 1RUF1 4UI9L 4HLTA 3LD8A 1CZTA 4DS0A 4IERA 4GWNA 2VTXA 2Z2SB 4XHXA 5FPVA 1IS5A 5T5LA 1OUXA 1XJAA 1PO23 2DFCA 3SMHA 3MHZA 4B4RA 5J7MA 2XUMA 2I2SA 3MICA 1WLCA 1H1AA 1VBC1 2ARXA 2GNMA 3L9JT 2PLV3 2QQKA 3AMPA 4ZS2A 1OFNA 3D0SA 2RR12 4UW4A 3ZFGB 1OQEA 2WS91 3LA2A 4FPCA 2BP6A 2D6LX 1OLRA 5CKMA 1BVVA 5IVEA 1PNGA 2DVBA 2RS51 4XUOA 3T30A 4CCKA 1YO8A 3SISA 1HQWA 2B9VA 5DAWA 5IT6A 1K45A 2Q8EA 1CAUB 4L99A 3ZFFC 5CFCC 3A22A 4H14A 4E4SA 2JDUA 4LLOA 5FDBA 1NCQA 3VHPA 1CAXA 3O1SA 1ZBE3 3AFGA 4NMIA 4KWKA 2RDQA 4YPJA 3FHAA 4IE0A 3I8TA 4CCOA 3J9SA 4CDWC 1TE1B 5G04L 1QH6A 5HCBA 1OPMA 1IKPA 1BXHA 4QXHA 3MI8A 4WVZA 4YW2A 3IMNA 2BGPA 5JR7B 3AYAA 5C6CA 1HJFA 4DXZA 1FMD1 1YQ8A 4YVWC 5JIUA 5C5TA 1TMF2 1K42A 4NROA 4ES9A 5BNOA 1F5FA 1POQA 4Y5Z0 4YW3A 2YFZA 4S2HA 3PTYA 5JI7A 3A21A 5A7QA 4ZU7A 3JBG1 1RUH3 4YSFA 2R043 1N1VA 1QH7A 1AR63 1AHSA 3ZYIB 1OURA 4P9XA 4IW3A 1MS9A 1DZRA 1NCRC 2IFRA 1DLCA 2NM1A 1RUE2 4R4XA 2WZR1 1XE0A 4E27A 1UMIA 2BRTA 4QXBA 3VKOA 3ILRA 4CDQA 2GNDA 2R49A 2MHFA 1GICA 3H9AA 1W8WA 1V70A 3EO6A 2WL1A 2ZGLA 2XJVA 2D97A 2VW2A 3AVRA 2JD9A 3AMHA 4MH0E 4IETA 2VU9A 2JIGA 4Q4X3 3UKNA 5IFTA 5FP9A 4YM3A 4NHKA 4UYBA 5KHHA 5JXJA 3RZMA 2AEYA 2LTNA 4W50A 3TYJA 1WW7A 1KFXL 1JYTA 4QU1A 3HOBA 1WMXA 3DECA 4HOOA 1W03A 1AYN3 1KITA 2YV8A 1QOTA 1PK6A 2HWD2 1BEV3 1SACA 1G9FA 2GAUA 4CEWB 5K0UC 4A7KA 1GZCA 2VC9A 3BOPA 3RNSA 2ARBA 2DVFA 4K8FA 4RYDA 3ZOIA 4CUCA 1RUF2 2GMMA 4QKBA 3VDDB 3LF7A 4AVTA 4DQAA 2WT2A 5FZ1A 1Y4WA 3ZDSA 1K5JA 1XOYA 1MVEA 3RPQA 5J36A 2WQ8A 5T5OA 2XJRA 1CAVA 5FZMA 1CX1A 1HB4A 3I2FA 4KWUA 1VBC2 2BQPA 4CXWA 1CJPA 3TN93 5BNPC 5FMCA 2QNKA 4F3JA 2EXHA 3U37A 2WS92 4E4ZA 1DLLA 3RI8A 2XJPA 3TNQA 1OI6A 2OX0A 2DFBA 4S2FA 4IEVA 3NJVA 2RS52 2GN3A 4HBNA 4XABA 4IV3C 1O3SA 5LA2A 4FP3A 5ACA1 4QB1A 5JAXA 1C57A 4DRRA 5FP7A 3AKPA 4FPHA 2D6KA 4Y24A 3RMXA 2W5FA 3WX5A 2YBKA 4AEDA 3EMRA 1ASJ3 5A1FA 1W6QA 3K77A 3VL8A 1GP6A 2BBAA 4XJ9A 4NWVA 3M70A 2OPWA 1H4GA 1UW8A 1UKGA 2UYAA 5IK4A 4GMP3 3MW3A 2A70A 3KCYA 4MGZE 1OUSA 1SZBA 4LOTA 2V4AA 1DGRN 2DUQA 4QQ2A 3H8OA 5LBFA 3WUCA 2XJQA 2P3JA 2CSGA 1FMD2 5JZGA 4IXLA 1GQGA 3KF3A 5T54A 4FFFA 1OMIA 5FZ6A 3WP4A 4PIXA 2VTFA 2GSYA 2WZ8A 3CHXA 3IKWA 4FPJA 2XDVA 4FO9A 2VOVA 4XFAA 3W5NA 5FREA 1UL9A 3IPVA 2ZTNA 1UQXA 2E51A 5FZOB 4JGZA 3WCRA 3O1UA 4A44A 1UZ0A 2KR2A 1S4CA 1EAH3 2YROA 3CDZB 1QJX1 5CFDC 2WT1A 4PDWC 5A7NA 4QDQA 3POIA 4HXCA 5JR2A 1XYOA 2N7GA 2P1BA 1UF2C 1QJU1 3BOWA 4RS5A 4YGEA 3OBRA 2JE7A 1QDOA 2ADEA 1W05A 4Q4V2 1DU3D 4N53A 4EV0A 3TEYA 2RDNA 4A42A 3T0DA 1YQ5A 3I49A 2Y6FA 2ZHMA 4FAHA 4BH9A 4CZSA 1OF3A 4AWDA 3WF3A 4RFT0 3N35A 4GKYA 2Q5TA 4XFCA 3RGBA 1GFF2 1ZRRA 1OOPC 2YFUA 2XLGA 4RHV1 4AQTA 4F8AA 4XAAA 5DAQA 2YZ4A 4NPMA 2VZPA 1VBA2 3ZFEB 1AL22 2QQPA 1W9WA 2VJXA 4G4FA 4BYYA 3LEIA 4QGNA 1ULDA 4PCRA 1QJY2 4COVA 1POV3 3R6SA 4LIVA 3WF1A 4CCJA 2J1AA 1US2A 4TLFA 2QCSB 1MVQA 2NQYA 4KMQA 1HQNA 1VBE2 5BXXA 3JB4C 3L2YA 5LBCA 5T55A 4QDRA 5DZGA 2A73B 4IQPA 2LW8A 3ZFFA 4E9KA 5CFCA 3C8XA 1AUYA 4C1XA 1MEC1 1WCKA 4QDSA 5FMOL 3M4FA 3O0XA 3WNMA 2GH2A 3I4IA 2ES3A 5IVVA 1S55A 4EJRA 4CDWA 4PQQA 3WW4A 3B5LB 5DDJ2 1VBB1 4OUMA 3JZVA 3PIJA 2EAKA 2D3SA 3FUQA 2DCKA 1SMVA 4OZOA 1UY2A 4S2DA 4NHMA 4YVWA 4GB33 1QNYA 2BYVE 2HWF3 4XIOA 5FZ9A 2X5IB 1GBGA 1V6IA 2GZWA 3B93A 2WFF3 1W8UA 3U75A 1H1IA 1GQHA 1VLNA 4XBNA 3I3EA 2ZJCA 2HLEA 2UWCA 3OYWA 2FMDA 4JC1A 5D8AC 2DBIA 5L19A 3RG0A 1NCRA 5EFUA 3WV6A 3AKRA 1DQ1A 3Q8AA 4HG6B 1ND2A 3K4DA 1CIYA 2VMFA 5H9RA 4LIUA 1XRUA 4QKNA 5KC5A 1Z78A 1LCLA 5FJKA 4AAPA 1JYCA 3MW2A 3KVAA 2HJIA 4D94A 2HWE2 2J1UA 3LPGA 1XBFA 3FC0A 1O91A 2CAUA 2VZVA 3MO4A 1FAYA 1RXGA 5F37A 1ZZ9A 2CWSA 4JCKA 1NE6A 4L2NA 2DDUA 4C0BA 4W6WA 2RS12 1ZZ7A 3THDA 2YUEA 2ZPXA 2D6OX 2WLPA 5DUWA 1QJU2 2MEV3 3IN9A 1J1LA 3SKJE 3HNMA 2P3IA 5K0UA 4PLOA 2VO5A 3ZPYA 4M4RA 1ZBA3 4B3NA 4TSVA 4AI8A 3APBA 4NRQA 2VNGA 4NJ4A 4OI2A 4GKXA 3FHQA 2JG8B 4QPGB 5GZGA 2JDHA 2D43A 4NAMA 2DV9A 1W9YA 2W1WA 4G9SB 3E6BA 3OOXA 5KR7A 4WM8C 5EP9A 5BNPA 4QB2A 3D3AA 4NIIA 3D82A 3W59A 3ZM8A 4P9GA 1SDWA 4PIYA 4BXSV 1HN0A 3PVNA 5EHDA 1W2UA 4A4AA 4NN0A 3KHBA 4IV3A 4GWIA 5EJZB 3QOPA 4L11A 4IEOA 3KF5A 1H2LA 5FY7A 4ZU5A 5KHKA 3VBFC 4JZRA 3LSDA 1YI9A 2CGNA 4AHYA 2CNAA 5C71A 3AZZA 4BCUA 4XHBA 3WLUA 2WNOA 4PT6A 5JOWA 2VUAA 1F8VA 1GZWA 3BU0A 4FTBA 2W0XA 1HW5A 3K4ZA 1P8JA 2ZCWA 2O8QA 3MIGA 4LHSA 5F3EA 4YRDA 4CVUA 1QOSA 1VBB2 2F4PA 1AL0G 3CLPA 4NPRA 4DO0A 4Q4Y3 4OHWA 4YW6A 2ZZJA 1JYWA 2K46A 2R072 3HNYM 2E6VA 3OPTA 2AACA 3ORJA 2ZBJA 1S2EA 2W1UA 2W95A 4O61A 1ND3C 2B7YA 1HRV2 5B4NA 1N1YA 2X8KA 1SPPB 2Y6HA 1YYNA 4FBFA 2BERA 5JDBA 5CYYA 1BJQA 2HEYF 3EXUA 5FMBA 2CTVA 2VXRA 3IWZA 3MLJA 5EXOA 4RR3B 1RVF1 2LALA 1SBEA 1HXS1 4IEZA 2Q8DA 1RXFA 2HWB1 2WYSA 4OHXA 1DDLA 1V6OA 1W6PB 5FYZA 1RHI3 4UF0B 1S1AA 5CFDA 2QQVA 4PDWA 1R1A2 2ZHKA 5JCTA 3WZ1A 4M3CA 4IV1B 2RR13 4EQVA 3MFAA 3NV2A 4XJUA 4EZHA 3IIAA 2WO1A 3AP7A 3K51A 4EYUA 1WW6A 1BCXA 3BALA 5F2WA 3TWIA 3VHRA 4XQDA 4QQLA 2DCTA 4W65A 1W8HA 5FY8A 3POEA 1R1ZA 1BBT2 1OOPA 4FFIA 1QJZA 2VBBA 5F5CA 4B8EA 1LECA 4D6QA 2SLIA 2PHFA 3POFA 2BWCA 1FT9A 3UETA 3VB9A 4AE2A 4CEYC 2DYCA 1Q8OA 2VOTA 1VAVA 4MADA 4ZPIA 5FIXA 1PO13 1A78A 3N7KA 1H8TC 3ATGA 1VAMA 4LK7A 1WLTA 2BW8A 3WQ1A 2EIDA 2AEZA 4XXAA 4N9HA 4UT5A 5LBBA 3W20A 3VBHB 5C7GA 5C4WB 2ZGRA 5A3UA 1HRI3 4A2UA 1ULOA 3IB3A 3SNMA 3ZXJA 3MUY1 5J1XA 1TEIA 1NCQB 3DKWA 3PDQA 5FPZA 2P5BA 4FFGA 5FZHA 3V65A 1WLWA 3K4AA 2VOXA 2RJKA 1RUE3 1QXRA 1GZTA 3W9AA 2RJLA 2ARCA 1RTVA 4XCBA 5I8SA 5LRSA 2KM2A 3S57A 3MIHA 3IT8A 4CA9A 1HKDA 1O4TA 4LBQB 1W3VA 3M2MA 5GZDA 4Y3OA 3N4MA 3CJIB 1AR81 1VALA 3LQCA 4D69A 3AZXA 1AZDA 2IC1A 2VMGA 3V0BA 1W2OA 3I3MA 3IAQA 5D8AA 2VGDA 2VECA 4XTMA 1RUNA 4CCCA 2B46X 5JLVA 1EP0A 2RMU1 3AFKA 3HQXA 3MEPA 4A3ZA 4CP9B 4XF1A 4QQOA 4LORA 4TYSA 2F6BA 2QQOA 3AKSA 3GJAA 4RGKA 1SBDA 2P17A 3HNBM 5I0SA 1JTZX 1OQDA 2O0OA 1EV13 4J1XA 5HV4A 1PGL1 2UWAA 3FUOA 5EJ1B 4GA9A 4PF1A 4D0QA 1MR5A 1MACA 2Z5WA 1FOD2 2EICA 4AFAA 5HI0A 5JOZA 1S0CA 1RUF3 2ATFA 4DEQA 2ZGPA 1HXS2 4XUTA 3WG1A 2HWB2 1X9PA 1UMZA 5IK7A 4IUGA 1S2KA 1TNRA 1S0BA 3CMGA 3ITQA 3VBRB 4U36A 1QKQA 4B29A 4JDMA 1VBC3 5FLIA 1ODMA 3O1RA 5GLWA 3LA3A 1XQNA 2WS93 5HCAA 2D3RA 1QY4A 4XETA 3S30A 2VMCA 3A7QA 1PK6B 3S7EA 2RS53 1UYXA 5C3OA 2JICA 5CADA 1JS9A 1UY0A 4R9BA 5T3NA 3HBZA 2IXHA 3SLIA 3WG2A 3WINE 3GBWA 1MS0A 2CHHA 5SV8A 2JD4A 4AEMA 4WM8A 1I6XA 1LHUA 4BQ1A 4PBOA 2ZZQA 3WF0A 3WR0A 4R4ZA 1PMIA 5FCCA 5A33A 3VKMA 3LFIA 1OH4A 1RUD2 1E5RA 1WMDA 4YZ2A 4BXFA 4WVMA 5T5JA 2G19A 1FMD3 4B4PA 5KBFA 4QQHA 1C8NA 4IEWA 3AXDA 3M3CA 1UU5A 3VBUC 1QNWA 2VZ1A 3JBG3 3OD4A 1VPHA 3VBFA 2E32A 4RQPA 4AEDB 2GU9A 3H3LA 3JD71 3K3OA 1PMJX 4CPBA 1W6QB 3PTRB 3WHTA 1LB2A 5FXVA 4YARA 1C5HA 2Y64A 3MV11 3LOIA 4NIAA 2ZX3A 3P6BA 4AOCA 1MQTB 3PMEA 2PHDA 3POSA 2NP0A 1DGRA 1ND3A 4Q4V3 2JECA 2G1MA 4SLIA 4LBJA 5FY9A 1C4RA 1AR82 4Q8KA 1RC6A 3PJYA 4Y4RA 3LSEA 3O14A 5FKBA 1CAWA 1H30A 1NA1C 3LIGA 3PUIA 2P6HA 4BZ4A 5IHRA 2A3YA 3KWVA 3CNAA 1CONA 4XJZA 2FMYA 1NXMA 1NY72 3IBMA 1VBA3 4WVWA 4OHYA 4H55A 2QQLA 1XYNA 1BMV1 2LROA 5EYXA 4NHYA 4P9WA 4QXCA 2XKOA 1D4VB 1BZWA 1VBE3 4OUSA 1MS8A 1W8ZA 4YVSB 3N9NA 1B35C 1U0AA 1XC6A 4XEZA 5FXXA 3OY8A 3ZN6B 4CDQC 5C8WA 2EVXA 3OEAA 5J98B 3USUA 1NYWA 5ANQA 2AENA 4MGYE 4CEYA 5H9PA 3LDRA 3UYJA 1GWLA 1NUKA 2YPJA 1UOJA 1W9FA 5F32A 2R32A 5HPOA 1N1TA 5DDJ3 1OA4A 3WNNA 1RGSA 2YC0A 1ENRA 1H8TA 2CV6A 3NAPB 5DPNA 4DUXA 3H42B 2KA3A 5CIRA 2QZ2A 2CGOA 1TME2 4KH9A 5ACA3 4FPEA 1W9SA 4PF5A 1O8PA 3P3PA 4MLOA 1O4YA 3ENRA 4L92A 1V6NA 3J7HA 5GZEA 3K75B 1XSRA 4Z2WA 3T4HB 1KQRA 3FWEA 4LKDA 1JZ4A 3KV5A 2V72A 2RJ2A 3JB8A 5GM0A 2ZHNA 4ZXEA 1OXCA 2ZGOA 4COWA 4P5HA 1W6OB 4RD7A 3R05A 5GALA 3S7IA 1Q8PA 1AXZA 1I5ZA 3ACHA 4CXYA 3QLQA 5FYUA 5LW9A 2VNVA 1GKBA 2VBDA 1L7LA 4A3XA 1XPWA 2JDNA 1SCRA 2XJTA 2W3JA 2XL7A 3HQRA 3J8F2 4Z1VA 4F83A 4N90A 4KNCA 4O9GA 3I54A 1NZCA 2OZ6A 1TMF1 4XMIA 3OYWB 2RS13 2Q1MA 1OT5A 1W06A 1ULEA 1YWKA 1QJX3 2R7EB 2VW1A 4UFIA 4Y20A 5KXEA 3AP6A 2PYTA 4H3WA 4YM2A 2AZ5A 3ZIXA 5IWFA 2OKXA 1LEDA 1D0GA 4AGGA 1QJU3 4JQTA 1D2QA 4Z07A 2JDYA 2P3KA 1GUIA 1Q8SA 2ID4A 5FQ0B 1QJFA 1ZZBA 2UY8A 4LBQD 4MO3M 2FCUA 5JOYA 2DVAA 4OZXA 3RFRA 3JCIA 1OC1A 3KGZA 3WOGA 2RM22 5F3IA 1IHMA 4RHV3 5FJHA 2ZX0A 4ZZ8A 4Q8LA 4UBGA 4DPNA 3IAPA 3QCWA 1ZX5A 4CDUA 1SFYA 1ODNA 4LBOA 1BMV2 2VZSA 3W21A 2J42A 3R4UA 3B00A 4UFHA 2IVIB 5GZCA 4HKOA 4GJZA 4RGGA 3ZSKA 1PNFA 3R4SA 3RI9A 3M3QA 5K0UB 4QD2A 1R082 1OKOA 3I7DA 2XHNA 2R0FA 3RZJA 1S0GA 4RS5C 1W90A 2HWD1 5LASA 2IXKA 3AYDA 4LPLA 3JQXA 4YM1A 2OUHA 1U5YA 4I09A 3VBSA 1SHWB 4LMFA 2FDJA 4XF3A 3RZHA 3NNLA 2EXJA 2ZAHA 3N9QA 1W6NB 4XJAA 1VBB3 2BZDA 3PVEA 3ZO0B 2Q8OA 5I8TA 2R073 1JZ3A 4L0PA 2NMOA 2JKXA 1LOFC 1LOGA 5L7OA 1LOBA 1ZA4A 2UY9A 1O3QA 2HBTA 3K2OA 3VBUA 4IEXA 3CKHA 4E2SA 1IOAA 1UX7A 3HEIA 3VKLA 3OSDA 4QQPA 3VBOA 1JH5A 4Y1XA 1JMUB 2L9LA 1DQ5A 1ZZ6A 5LY1A 4KU7A 2TEPA 1DZTA 2OQ7A 1O3TA 3DPRB 2DUOA 3LCPA 4V1PA 3UGHA 3JXSA 1KDMA 2VUCA 2B5HA 3UL2A 4RL7A 3FBMA 3I2IA 4IEQA 4BWOA 2QKDA 1T6BX 2Z79A 4H7LA 1J84A 1EUTA 2ZXQA 1CJDA 3PLQA 4OMDA 1WWYA 1OLMA 4KG0A 3V64A 3LWCA 1F31A 1EPWA 3LFMA 2O1QA 3K46A 2W47A 3ECQA 1NA1A 4HL0A 1Y3TA 4BB3A 1OVPA 1LOAA 2ZGTA 5CZKA 1V00A 2VE1A 1W9TA 3GZAA 1WCUA 1CESA 5A32B 1V9U1 2VUJA 4DUVA 4LOSA 1L3JA 1RJ7A 2B8MA 1W0OA 5H9QA 3NVCA 2R6QA 3MBWA 3RJRA 1JZ7A 4PDWB 4XFGA 4X8NA 1HB1A 1UZWA 4XOGA 4ES8A 5IVJA 4M3CB 2VMHA 4COZA 5ABJC 5I0RA 1YEWA 4OI1A 3JUUA 2HEVF 4CCLA 4QPIC 5LWBA 1UOGA 2C5DA 2VG9A 4QAWA 2YDEA 1AYM1 1ND2C 1A3KA 4OHZA 2HBUA 5JI9A 2A3WA 1B35A 2WA3A 2XLFA 5C8CB 1RITA 2UURA 3ZXFA 3SCFA 3KT4A 1YQ6A 4WV8A 5I93A 4Q4V1 2B9UA 3UV9A 4DINB 2JB8A 1LJ7A 2JKBA 2Y6GA 1E57A 5CNAA 1GWMA 3H7JA 2WBKA 3RYRA 1JOBA 3WF4A 1W0NA 1K3IA 5FP4A 4QX5A 1H2MA 4OI4A 4I2OA 3GALA 3T09A 4EN9B 4ISRA 2OZJA 3HJRA 1V6JA 1VBA1 1W6MA 1AL21 1YQCA 2NMNA 2H6CA 4N43C 3EHKA 1L7QA 1DQ4A 4PJYA 4EWAA 3KV4A 1QJY1 2B4KA 2LM3A 5A7WA 3E97A 4HANA 4GJYA 2LUWA 5GZFA 1VBE1 3EQEA 1OA2A 2ZX1A 2G9FA 1HJGA 1LR5A 3T08A 2K9ZA 4U2AA 3ES4A 4M0NA 4MSVA 4HFSA 1MZEA 1DGWX 4IDZA 2OA2A 1BK1A 1N47A 1NQJA 2GC3A 1GP4A 4Y1ZA 4EN7B 4AGVA 1ZRIA 4JHZA 5DDJ1 5GLVA 4NO4A 1PVXA 1NZIA 4CU8A 3PUQA 1RVF3 1S0IA 5F5IA 1HXS3 3LZZA 1W28A 4CP2A 2HWB3 5HCHA 1S0JA 1JHJA 3UKTA 1X33A 1FNZA 4XZPA 4LBLA 3MF9A 3OG2A 4LXLA 4MOAA 1G86A 1LOEA 1H2NA 3PUHA 2Y0IA 5A7PA 4EN8B 3OUHA 3O12A 1XNTA 3MZHA 3ON7A 3N3HA 3ZXLA 5KHJA 4YM0A 2A6WA 3MPPG 2WZEA 1CPNA 3FMGA 3A23A 4MGTA 1AR71 5FZEA 4D7TA 4CUAA 3I2JA 3WW1A 3BYWA 5JSRA 1RMU2 1VBD1 4C8DA 3ASIA 1KJLA 4K1YA 2TNFA 3MF6A 2OT7A 1QDCA 3RZZA 2DCJA 5FXZA 1V9U2 1H9PA 3ZFGC 1PZ9A 3OJBA 2HWE1 3N9OA 3DXTA 4Q0QA 1KXGA 2VZOA 3ZIWA 3ZSLA 1RB8G 3Q8FA 3M3IA 3LB9A 1YUDA 1AX0A 4PQ9A 2WFPA 2RS11 3H3ZA 2ZGQA 3T0BA 3CF6E 4RGAA 4BOWA 1AYM2 4NUBA 1SLBA 3UT0A 5L9VA 2LRPA 3KT7A 1S0DA 5ERLA 2JG9C 3DF0A 5FYYA 3WF2A 3VUOA 4EZ4A 1C5IA 4C91A 4DXSA 1VB4A 5IVBA 3P3NA 5GJ6A 2WLQA 3TOJA 1YNAA 3R0RA 4WM8B 3RRDA 2PTMA 1DBNA 4LNVA 1E5SA 3U07A 1V0AA 2WAAA 1RJ8A 2QQWA 2D40A 1LOFA 3SEPA 2ERFA 1YIFA 5GKAC 3WCSA 3ZN5A 4WVMB 2WO7A 3QD6A 1NG0A 3AM2A 2A5ZA 4JHTA 4UAPA 3UJQA 1AR83 1MS5A 2XG3A 3ES1A 5F6LB 4LA2A 4AQ6A 1WBLA 1SDDB 3RS6A 5L73A 2XQRA 4XDPA 1ZYBA 3QH7A 2A6XA 2RMU3 2AC1A 4Y1UA 1AJKA 1K5MC 3BI3A 1ZZ8A 5LA0A 5FLHA 5BUVA 1NOVA 3DEMA 5JSPA 3LEKA 4G3YC 4QPWA 4Y5SA 3CJXA 1BLZA 3SH4A 3ZR5A 4ZU4A 2G9ZA 2WSUA 1Z0HA 4LR4A 2XBO1 4FOQA 1NXD1 1LU1A 2VAUA 1IS6A 4ET7A 3HD8B 5DN2A 5ISLA 3RWNA 4IEUA 2Y33A 2IUWA 4I0AA 3ZSJA 4KQ7A 5G05L 2FCTA 2WNUB 4A45A 1ND3B 3M8LA 4B7EA 3AKQA 3THCA 2GP5A 2PA7A 4IGOA 2ZACA 2R071 5F1RA 2QQIA 2YBSA 4EWDA 2IXLA 2VZUA 1RIRA 2WIIB 1U12A 2ZS6B 2BGCA 5KHGA 1IGOA 1HRV1 1O5UA 4W4ZA 4HVQA 2XPJA 4CEWC 1Z7S1 2PXJA 4QHZA 1GOHA 4AG4A 3ZN4A 2C9AA 2RDRA 4OMCA 3AB0A 3GXUA 4AF9A 2H0VA 4CSWA 1UIJA 4QX8A 3VV1A 4I0WB 2CL2A 4XJWA 5ABJA 5C9AB 1AR72 3PVBB 4QPIA 5C3PA 1R1A1 1VBD2 3AKTA 4R52A 1O5LA 1AX2A 1FPN1 4LBMA 2Y0OA 4YZ3A 1AJOA 4XC9A 4FTEA 2BNNA 3OY8B 1BQPA 4RA0A 3VKNA 3WP6A 4BQ5A 3SC7X 5FOBB 2XWJB 4ATFA 3UJOA 2FDGA 1OKQA 3AXEA 5TSWA 4LO4B 2JDAA 4BE3A 1BBT1 2W46A 2KXLA 4BK5A 2QQNA 4MXVA 4JVAA 3UKVA 5I0TA 2W9XA 4XACA 1BKZA 4JQRA 4CCMA 1X36A 1YFWA 1UAIA 4GD4A 4N43A 5FZ4A 4CDXB 1G9DA 5CG8A 2MNGA 1DQ0A 4CE8A 2HYKA 1NAEA 1F15A 4GQ7A 3MIDA 1UOFA 2QQUA 3JD73 1DP0A 1UD1A 2CWMA 4QX3A 4EE2A 1HQLA 3HIFA 5L9RA 2V5DA 1LULA 1H8VA 2GNTA 5AC92 4NRMA 3TNPB 5L9BA 3ZX7A 1UXZA 2VZRA 4MHRA 2GP3A 4JKLA 4XZUG 3VL9A 2BNOA 3BIWE 1G9AA 3RZGA 1JYIA 4I3GA 1GNZA 4ARXA 3GCWA 4AEJA 2JJ6A 2BOJA 2VQTA 3H1YA 1F9KA 2VCCA 4KBZA 1CR7A 5IUQA 2O14A 1WMFA 4FPYA 1J59A 3LAGA 4PBPA 2RM23 4ZZ5A 3DUIA 1LHOA 3BTZA 1PZ8A 2CDPA 2ARAA 3K3NA 1N3PA 1T6GC 3BPSA 5A3PA 1WZXA 4B1LA 2XBO2 1QGLA 4PLMA 4RQPC 2X05A 3GGLA 4FOVA 4Y22A 1OLQA 1IPJA 1LKNA 4BQYA 2E63A 2GMPA 1G6NA 1MS1A 2VTXJ 1VIWB 1F35A 1BHGA 1R083 3PUAA 3D0JA 4LKFA 2PHWA 2WYFA 3GBFA 4XE9A 4HSJA 4XFFA 2MPFA 4BU2A 3GZTB 5F7UA 3ZFGA 5C3QA 1ULFA 1ACCA 1FOD1 1C1LA 5HXVA 1Z7S2 2X29A 4BHPA 2XVLA 4ISQA 4Y26A 5FUPA 4UW3A 2BDRA 2VW0A 5I91A 4HZFA 4L97A 3VD5A 3RJ2X 1UNBA 1JN2P 2F17A 3ZSMA 1V6KA 2OIIA 5D21A 4BQ3A 1WCDJ 1Q5OA 2D3PA 2XGXA 4YFWA 5JPMB 2F4LA 4CP0A 4YW7A 3PURA 4V2VA 1J3PA 2J1VA 2JG9A 3DYPA 4IGPA 2H6BA 1UMHA 1FPN2 1Y9GA 5A3OA 2VNOA 1UZZA 1GMMA 3E5UA 1BK0A 3WVJA 4YZ4A 2PLV2 1JU4A 2R1BA 4FPFA 1QQP2 3VDAA 4S2GA 1QIQA 2EF6A 3CBNA 2X5IC 4GALA 1ZRDA 3SITA 1HV0A 3WXPA 4ATEA 2DU0A 3ILFA 1RL3A 5DAVA 3ZR6A 1YQ2A 4FQ4A 4Q1RA 1O59A 2JDPA 2GH8A 1RUD1 4NOTA 5LRRA 1ZBE2 2WA4A 4MX3A 4FCAA 1LHWA 2RS31 4CCNA 1UZYA 4YGDA 4ITCA 3FE5A 4EWEA 3SQOA 4UFKA 1TMF3 2JE9A 1K5MA 2OVUA 1L7RA 2XOMA 4HN0A 1SFNA 1SEFA 1WA4A 2V4VA 3WY6A 5FO7B 4YG0A 3E6CC 5LBEA 3J7NA 2AGSA 2G9GA 5E16A 4GXLA 5LK5A 4URTA 3ZKYA 3C7HA 1CAXB 1M4WA 3LEGA 1XB9A 1UOBA 2X10A 3PU3A 1RYYA 4AI3A 3ST7A 5FR3A 1AR62 4DZGA 2WRAA 1TNFA 2A6VA 2WR9A 3AZVA 2ORXA 1LOCA 2JX9A 5GLZA 4MGQA 1SLLA 3HAGA 1IS3A 4R8HA 3P1IA 4CPBD 1YJLA 4CEWA 1OD3A 5BNOB 3AP4A 1WCQA 2RVAA 2BFUS 4JGYC 3A0NA 2P37A 4BLIA 1X9TA 1AF9A 3D6EA 4QX0A 1GWKA 3INAA 1VB2A 2VVDA 4QPGC 4YW5A 1A6CA 2PAKA 3ACIA 3M1HA 1NY71 3N7JA 4Q4X2 5FYSA 1O7FA 5FWEA 5C33A 5J3UA 4MGKE 4XFIA 2VPVA 1Q56A 2HWD3 3WT3A 4CP1A 1UCXA 1J83A 4C0HA 1B35B 5CG9A 4CDQB 4QGLA 1AYN2 3WNXA 2NPIA 3DKQA 4QM9A 3MV01 1JHNA 1NKGA 2WNEA 3H8XA 2A6YA 5IFPA 2I74A 1TZOA 5DZFA 3ZXAC 5FBJA 4CDUC 5KXCA 4QKFA 3KMHA 2O8OA 4FAGA 2A6ZA 1STMA 2IXCA 3ZXDA 2WAOA 4IE5A 5D1IA 2QVSB 5F8PA 4Q26A 4YWAA 3HWJA 3GYDA 3O0VA 1DQ2A 3AYCA 3SCHA 1HV1A 1KFUL 3TN92 2C9KA 1TME1 2QE3A 3TB0A 2ZGKA 4LJHA 3ZYHA 5A7WB 2VMIA 1IQAA 2YC4A 3OPZA 4BIFA 3USSA 4CCEA 5HBAA 1X82A 5DQ0A 2Q1ZB 4RN5A 4FPGA 1GNYA 3B9CA 4Q0UA 4H7MA 5FYVA 3VBSC 3ZYJB 4FOWA 3ETPA 5FWJA 3S0MA 1WKYA 5FUNA 2QUOA 4GH4C 4XXPA 1CAVB 2LS6A 2QQMA 5JXIA 3NJYA 5FZOA 1G9BA 1MS4A 1PZ7A 1OVSA 2E26A 3KQ4B 4LITA 5FY1A 2RS32 1RMU3 3TBDA 1WLDA 4MYEA 4M01A 4AL9A 3KSCA
chains in the Genus database with same CATH topology
2YXSA 2IZWA 5L7OC 4IV1C 4P9YA 3ZXEA 1V9U3 3ALQA 2GC0A 4QPYA 1C8M1 2ETEA 3EJKA 4MV2A 2XL9A 3LA7A 5FBZA 2QDRA 1PGW2 2XJSA 3ELNA 3J8F1 3VBOC 2JENA 1GSLA 2DTYA 1UX6A 4ASMB 4J1WA 2ZAAA 1PVC1 1D4M1 3NO8A 1DYPA 1AYM3 3ZFEA 5KWRA 2E7QA 4OULA 1FI2A 4HT1T 4SBVA 1CVNA 4TZDA 5KC6A 1FYUA 1S0EA 2DWRA 1XXNA 4Z92B 1WCSA 5JZGB 2A3XA 3PHMA 5AVAA 3ME2A 4LA3A 3FBYA 1GLHA 4XIKA 2RM21 2DU1A 1NLSA 3FJSA 3RSJA 3VBHC 3IPVB 2ZMLA 2DTWA 1XE7A 1DGLA 3O5SA 4JGZB 5C4WC 4ORFA 1CIWA 1AL23 1YFUA 5FTTC 4MGIE 1U5IA 3B69A 3SHRA 2QFEA 2E53A 2HKXA 3WQ0A 1QJY3 4XF0A 2BEOA 3IDEA 3KGLA 4RS5B 2PHUA 2ZOEB 5EJ3A 4LO5B 4N53B 3H3UA 1AVBA 1R081 4IEPA 4WZCA 3E5QA 3B3QE 4YNIA 2X5IA 4MZUA 5LEJA 2A75A 2ZX2A 5CAZA 1W0PA 2B42B 2ZX4A 4AXOA 1VP6A 4I3PA 4UBHA 1DG6A 3FLTA 4AGRA 4ZKTB 2BBVA 4IL7A 3ETQA 2YMZA 1JXNA 2P34A 3MIFA 1ALYA 4FOYA 2WNVC 4GB32 3ZFFB 2HWF2 5CFCB 4X6QB 2Q4SA 3WP5A 3KD4A 4N7UA 4AYUA 1AR73 5FOJB 4DMIA 1SLAA 3V0AA 2WINB 4INDA 2BTVC 3ACLA 1VBD3 4XF4A 4CDWB 3VHOA 5JWPA 3KCCA 4DFSA 4HN1A 4FQZA 3RMYA 4YVWB 1C8M2 1QOOA 5K8SA 2HWE3 3GNEA 3H8UA 4JGYA 1SCSA 2E9QA 3H7YA 5E89A 3VZKA 3MLLA 1PVC2 1D4M2 1X7NA 4QPGA 4MVTA 5ABJB 1NCRB 4HK9A 2WKKA 4QPIB 4JRAA 4M0HA 3RYKA 3T2TA 3VZLA 3C2UA 1ND2B 4DY3A 2DVGA 4Q0SA 3FFQA 2BUKA 2AREA 3ZYGA 3KT1A 3MIBA 2D44A 2D6NA 1WMEA 5AC93 3BPZA 3IDBB 1CX4A 5T5PA 4TWTA 4DB5A 2IFWA 2D93A 4K7JA 3KQRA 3THPA 5FO9B 2DURA 3VN4A 1HLCA 3NV3A 2FZ2A 1XE8A 4Q4W2 1QU0A 4B4QA 3MYXA 4AQ2A 1NQDA 4W6YA 4P14A 1MQTC 1V6LA 3CEWA 3VHNA 2VH9A 3AP5A 2OW4A 3AJZA 3PNAA 4LE3A 3ZXKA 2XBO3 5E8AA 1MZ6A 3TRSB 3BCWA 4GH4A 4FSJA 1OQ1A 2HWC1 2I07B 5BNPB 5BV6A 4LT5A 2PQQA 2ZGUA 1CPMA 4LHLA 3UK9A 2FHRA 5JOXA 1QHDA 4YW4A 1QWRA 5BNNC 3FX3A 1FNYA 1HRV3 1IPKA 4IV1A 5AVPA 5BPXA 4IV3B 4YGBA 1UPSA 1Z7S3 2QZ3A 1ZRFA 3OGJA 4YVSC 3U0ZA 2EIGA 2GNBA 1GZWB 1R1A3 1GR3A 1TQ5A 2EAAA 1UKRA 2GALA 2D98A 5HCFA 3PVOA 1FPN3 5J96B 4CTEA 1XNCA 4Y1VA 1RHI2 1ZM1A 3A4UA 3GHMA 1MZ5A 1LGNA 2JEMA 4BMBA 1XU2A 3NAPC 4LHKA 4AVCA 3BU7A 1C28A 5FLJA 1RMU1 1H2KA 1AXKA 4Q29A 1QQP3 4E2GA 1BBT3 3VBHA 4BPZA 1U5XA 5C4WA 4FXGB 3H1WA 3AMNA 4N9IA 2IXJA 3J26N 1SLCA 5CFDB 2GC2A 3QH6A 3CU7A 4RSUA 2BFUL 2XVGA 2QDNA 2JG9B 3LGRA 2YGLA 4JV4A 4K21A 5A3MA 2ZABA 5JIAA 2OYZA 4AHWA 2VNRA 3I59A 1PO12 2C0ZA 3AMMA 4IEYA 3BTAA 1FV3A 4B7KA 4LBQA 3ZMNA 3CJIA 2E7AA 2PELA 1OOPB 3T1LA 1Q43A 2ET7A 2XHKA 3WG3A 4LO8A 3IM0A 1HRI2 1F5JA 4OLLA 1Y7BA 2UU8A 3LKJA 3U4XA 2BNMA 4D7SA 4QMAA 1YXWA 2VQAA 2ZHLA 4ZXKA 1K5MB 3NW4A 2WNVA 4Q0VA 4YYOA 4A7ZA 5K9YA 5A3LA 5DG1A 1SBFA 4XPVA 4F7ZA 3SXWA 2YYOA 1ONAA 1RUJ1 3DGTA 3NJZA 1ZNPA 2XKPA 2NYYA 2DVDA 2HWC2 4K20A 5I8YA 1EY2A 4MXWA 3POYA 3VBRA 4M00A 3S6PA 3U11A 4L8QA 3NKTA 1FOD3 3V56A 4QHBA 2BVBA 3QBQA 1EV12 1A8MA 4COYA 1CD3G 1SLIA 2WQ4A 3HR9A 3V0BB 5D8AB 4QM8A 4WM7C 4JTOA 1J3RA 4NHLA 3WDVA 1AR91 1XNKA 3M3OA 1U5ZA 1KDKA 4BM8A 3N36A 5FRAA 1R091 1RUC1 1AXYA 3NKGA 4LBNA 3VGIA 3VZOA 4YZ5A 1OFSA 4LO6B 5F6KA 4Q2FA 1X8EA 4AFBA 4HVOA 1REEA 1XU1A 1RUD3 4DNYA 3DPRC 3NV4A 2RS33 4YG3A 2OPKA 1MQTA 1SLTA 2V5YA 3WW3A 1QF3A 4KBBA 4AVAA 2VQ0A 2R061 4XF9A 1PGSA 2YY1A 4N7IA 1G9CA 4BA6A 3VZMA 1HDKA 2EALA 4YZ1A 3M3EA 4YFZA 4M3CE 3MGUA 1UU4A 3JBG2 5AC91 2AUYA 1ZREA 4NVPA 4R9AA 3OBTA 4FTSA 1LGCA 2BVVA 5A33B 1N3OA 5BNNA 1D0HA 1LODA 1RUOA 3FFZA 1N3QA 2GC1A 2B45X 3OCPA 3KS7A 3L2HA 2WZR2 1X50A 4AFMA 3QACA 5CU1A 1Q8QA 1PIV1 3VBFB 4XTPA 4Q27A 3WUDA 3EBRA 1NLRA 4QU2A 1RUJ2 4RQPB 4YVSA 3W58A 3BB6A 3ZN6A 5C8CC 1KRIA 1EYBA 1RUG1 2XH6A 4M3CF 4GIQA 2YHJA 1ZZCA 1RUI1 1LGBA 3J4UH 2WJSA 4LBKA 4AEKA 2R1DA 2EA7A 5T52A 2ZGSA 3WQ7A 2CAVA 4NR1A 3NAPA 2WQZC 2HEWF 3ZSEA 1YFYA 4XMAA 3T1MA 1COV1 2OUJA 1CAWB 2VVEA 5KXBA 4JRLA 1VRH1 1BYHA 2XJUA 3E6DA 5FFOC 1AR92 2ET1A 1LENA 4XJ8A 2D6MA 4Q0PA 1WW4A 1DF0A 3VDDC 1R092 1V6MA 1W6OA 1RUC2 1TME3 2NLRA 3JQWA 3KB5A 4P9JA 4XBQA 2AR6A 2JDZA 1DQ6A 2PHLA 1J1TA 4A7YA 4AHZA 1JOJA 4HVRA 1PO21 3RYPA 2XVKA 5ACA2 4JTNA 2PLV1 3VZNA 3KZ4C 1Q3EA 3USUB 3WW2A 1LTEA 4HETA 4CEYB 2EXIA 4OVEA 1QQP1 5F5QA 2V73A 4AQSA 1H8TB 1Y9QA 4UW5A 4FPLA 1Q8VA 4FPOB 2R062 1C8M3 4EN0A 5T50A 2JXAA 2QJVA 5FQ0A 1ZBE1 3J8F3 2RE9A 1X8MA 1APNA 3MW4A 4YLZA 2IXIA 1PVC3 1D4M3 3NSTA 4QT6A 3OGGA 2R0HA 5J37A 1DHKB 1ENXA 4JDNA 5BNQA 1QXJA 1GYKA 3V0AB 1DYKA 1QJX2 4P9IA 1FV2A 1RUH1 4Q1PA 2R041 1AR61 3LOBA 3TAYA 1KJRA 2ZGNA 4FVVA 1PIV2 1WBFA 1S2BA 4JGYB 5FPXA 2A7AA 2PHRA 1H4HA 1UPIA 3U10A 5DG2A 3AZYA 4WM7A 1WD3A 1RUG2 1ZRCA 5EZWA 4Q4W3 2WC2A 3GHNA 1YLLA 1RUI2 4RHV2 3B7MA 1I9RA 4HPKA 4Y20B 1HIXA 1N1SA 4KGQA 1W6NA 1WGPA 5EYYA 3AX4A 4Q4X1 3JU9A 1W39A 4XILA 3A0KA 4I01A 2R30A 2AYHA 2RHPA 1COV2 4KG8A 3ZFEC 2D5FA 1FX5A 1REFA 5JVVA 3E5XA 4Y4YA 1MZFA 1FXZA 1AYN1 1VRH2 1MEC2 1BEV1 4CDUB 3DPRA 3FZ3A 4LUKA 2SBAA 1CAUA 4K9SA 2BWAA 5CA6A 1IS4A 5J48A 5CVRA 5IK8A 5LK7B 1PO22 2Z42A 2Q30A 2WNUC 1YJKA 4X6RB 2XLAA 2ZA9A 5DUXA 1WD4A 5KXDA 3TN91 3N7LA 3ZYRA 3VBSB 3AJYA 4HKLA 3MDPA 4GH4B 4PLNA 1B09A 5A32A 3MLKA 5DXDA 5E1RA 5I0UA 2Q0AA 4KU8A 4NWWA 1CN1A 2WZPP 1NE4A 1XNBA 1YRZA 3G6JB 1G7YA 3GZUC 1ASJ1 2TUNA 2Y26A 5L7OB 2ENRA 3FLPA 2D6PA 3AMQA 3B9IA 1HX6A 3VBUB 5C9AC 1XNDA 4KL1A 5E88A 4GMP1 1S0FA 3VBOB 4CYDA 5DZEA 4I02A 5C8CA 2X53S 3WP3A 4BMEA 3NL1A 4D7YA 2E7TA 3PMSA 3WDYA 3SH3A 2UYBA 1PGW1 3MFCA 2XB6C 1VR3A 3B01A 1RUH2 2R042 5CBLA 5L36A 4KWLA 4DY5A 4UW6A 4AK3A 1Y43B 3D8CA 4R9DA 1URXA 2YGMA 4W6XA 1EAH1 1NA1B 4CDXC 2VVFA 1J3QA 4HKWA 2Y38A 4WZFA 1PHMA 2GN7A 3FHIB 4K1ZA 4YGCA 3GF6A 4XBLA 2FBEA 1IKQA 3DL3A 3VDDA 5B2GB 1KD7A 2W52A 4AVVA 3AK0A 2JG8C 3WD5A 1D2SA 2ZKNA 3M7AA 3KLSA 3URFA 1ULGA 3I59B 4C1WA 2EXKA 2VY0A 3POWA 3DN7A 5FO8B 2PN5A 4AFDA 2HWC3 1BEV2 1POV1 1ENSA 4XYXA 2GDFA 4HMZA 1ZVFA 1KS5A 1OA3A 4X8PA 2IWGB 4XFHA 4HK8A 5AFBA 5DUVA 5CB7A 3VKFC 4DRVA 2ZMKA 3RDIA 1W6MB 3O0WA 5DUUA 2G4IA 2C1FA 2VOKA 2WNVB 1SQ4A 2AH2A 3IDCB 1I1EA 3KCXA 3H50A 4YG6A 1REDA 4CRQA 1H9WA 4EROA 3SCGA 1RVF2 5GLTA 2CY6A 1GV9A 4GB31 4ASLA 2HWF1 2DF7A 4MXWB 5K7PA 2Z69A 2WFF1 1XYPA 3O7OA 1O3RA 4RR3C 1ASJ2 3ROUA 1JW6A 3Q9OA 2NN8A 3C3VA 4QGMA 4YW1A 3I2DA 1DZQA 4XDQA 1LESA 1MS3A 2PAEA 3OTFA 3FLRA 3KM5A 4AVSA 1C1FA 3VZJA 1A8DA 5H9SA 5EWSA 4AI0A 4E2QA 1CQ9A 4I0BA 4AHXA 2ZGMA 1LU2A 4AFCA 2VULA 4D3WA 2TBVA 4XW3A 1OPOA 1ENQA 3K48A 4AI2A 1KS4A 3WDWA 1YCIA 1EAH2 4KGGA 4MUVA 3WDXA 4R9CA 2WSVA 4FPKA 2CYFA 1H1MA 4OHVA 2K0GA 4LEJA 1C3HA 2MEV1 3WDUA 1FATA 1JUHA 2ZMNA 4Y1YA 3ZVXA 2D7FA 2UWBA 1ZBA1 1OD5A 3BODA 4ONUA 1J58A 1F2NA 4L9BA 4META 1LHVA 2H0BA 4Q4W1 2WZR3 1NCQC 2WNUA 1GZ9A 3AYEA 3D4KA 4Z82A 2DCYA 1RUJ3 4GULA 1M06G 2DCZA 1YIPA 1EPZA 3NWKA 4JDOA 3ZYPA 1UN1A 2RMU2 2PHXA 1PM7A 2K2SA 3CJIC 1JUIA 5BNOC 4XQWA 1H0BA 2PHTA 4LTAA 5BNNB 1IZ3A 4GMP0 1PGL2 4KWJA 4K3UA 5C9AA 5SV5A 3RQ0A 4K40A 4K6BA 4Q4Y1 1WW5A 2A71A 3OD0A 3ZMOA 4P9LA 2W39A 5JPNB 1BVP1 2ZKLA 3AZWA 5KHIA 1AR93 1WUVA 2WFF2 1R093 1RUC3 4AVBA 1DGWA 3GBGA 3WHUA 1DIWA 4XQ4A 3HT1A 1VAKA 1UIKA 2BPA2 2V09A 3CO2A 3B02A 3VBRC 3WG4A 4CDXA 1YI7A 4UXAA 1RHI1 4WVVA 1PK6C 2RR11 2XWBB 5FMOS 3B94A 2ILMA 4QXKA 3THTA 4LLFA 3DV8A 2JG8A 2NZ9A 2W08A 1G8WA 4BLJA 2FZ1A 2WT0A 4J6GA 3HT2A 3VLBB 1ULCA 2R063 2CGPA 5BY5A 3SH5A 5LEKA 3NV1A 5BYNA 4COUA 4BIOA 1POV0 3H1MA 4GWMA 4WBBA 1UU6A 4I30A 1GANA 2MEV2 4E4DX 3X29B 3OF1A 1OSGA 1PO11 1DFQA 1YHFA 3JD72 1VJ2A 4JAAA 1ZBA2 3MPBA 1I3HA 4AEDC 4XFBA 2PAMA 5GLUA 1LEMA 1HRI1 4IESA 4FXKB 4LO7A 4N43B 4LHNA 3D5OA 5EV7A 2PFWA 4Z8BA 2I45A 1YFXA 3WDTA 1PIV3 2WWSA 5J09A 1AX1A 2DUPA 3CL1A 1QMJA 4LE4A 2VOWA 4AI1A 3PJQA 1RUE1 4AW7A 1RUG3 4O9EA 3G7DA 1RUI3 5JZGC 3HMYA 2FQPA 3H0OA 5JMCA 3ILNA 4RR3A 4LULA 2D5HA 3R4DB 2GMEA 5IK5A 1LHNA 4DOUA 1W6PA 5AFEA 1GNHA 4OI0A 2R16A 4JGZC 1COV3 1OHFA 3AP9A 1QXPA 3N7MA 4Q4Y2 4FT8A 1VRH3 2P2KA 2B39A 3ZXGA 3HN1A 4WM7B 1EV11 1RINA 1MEC3 3MIEA 4EN6B 2W68A 4LUMA 4N53C 1O4ZA 4OFGA 1LRHA 4PIZA 4HPKB 1JBCA 4Y22B 4HSLA 4C90A 4FP2A 5F9TA 5FAXA 1RUF1 4HLTA 4DS0A 4IERA 4GWNA 2Z2SB 4XHXA 5T5LA 1IS5A 3SMHA 2DFCA 5J7MA 1PO23 4B4RA 2XUMA 2I2SA 3MICA 1WLCA 1H1AA 1VBC1 2ARXA 2GNMA 3L9JT 2PLV3 3AMPA 1OFNA 3D0SA 2RR12 4UW4A 3ZFGB 1OQEA 2WS91 3LA2A 4FPCA 2D6LX 1OLRA 1BVVA 1PNGA 2DVBA 2RS51 1YO8A 3SISA 1HQWA 5IT6A 1CAUB 4L99A 3ZFFC 5CFCC 4H14A 4E4SA 4LLOA 5FDBA 1NCQA 3VHPA 1CAXA 1ZBE3 3AFGA 4KWKA 3I8TA 3J9SA 4CDWC 1TE1B 5HCBA 1QH6A 1OPMA 1IKPA 1BXHA 4WVZA 3MI8A 4YW2A 3IMNA 5JR7B 3AYAA 5C6CA 4DXZA 1FMD1 4YVWC 5JIUA 1TMF2 4ES9A 5BNOA 1F5FA 4Y5Z0 4YW3A 4S2HA 3PTYA 5JI7A 4ZU7A 3JBG1 1RUH3 4YSFA 2R043 1N1VA 1QH7A 1AR63 1AHSA 3ZYIB 4P9XA 1MS9A 1DZRA 1NCRC 2IFRA 2NM1A 1RUE2 4R4XA 2WZR1 4E27A 3VKOA 3ILRA 4CDQA 2GNDA 2R49A 2MHFA 1GICA 3H9AA 1V70A 3EO6A 2WL1A 2ZGLA 2XJVA 2D97A 2VW2A 3AMHA 4MH0E 4IETA 2VU9A 4Q4X3 3UKNA 4YM3A 4NHKA 5KHHA 2LTNA 3TYJA 1WW7A 1KFXL 1AYN3 1KITA 2YV8A 1QOTA 1PK6A 2HWD2 1BEV3 1SACA 1G9FA 2GAUA 4CEWB 5K0UC 4A7KA 1GZCA 3BOPA 1J59A 3RNSA 2ARBA 2DVFA 4K8FA 1RUF2 2GMMA 3VDDB 4AVTA 4DQAA 2WT2A 3ZDSA 1MVEA 3RPQA 5J36A 5T5OA 2XJRA 1CAVA 1VBC2 2BQPA 5BNPC 1CJPA 3TN93 2QNKA 4F3JA 2EXHA 2WS92 4E4ZA 1DLLA 3RI8A 2XJPA 3TNQA 1OI6A 2DFBA 4S2FA 4IEVA 2RS52 2GN3A 4HBNA 4IV3C 1O3SA 4FP3A 5ACA1 5JAXA 1C57A 4DRRA 3AKPA 4FPHA 2D6KA 4Y24A 3RMXA 3WX5A 4AEDA 1ASJ3 1W6QA 3VL8A 4XJ9A 4NWVA 3M70A 1H4GA 1UW8A 1UKGA 2UYAA 5IK4A 4GMP3 3MW3A 2A70A 3KCYA 4MGZE 4QQ2A 1DGRN 2DUQA 3WUCA 2XJQA 2P3JA 1FMD2 5JZGA 4IXLA 1GQGA 5T54A 1OMIA 3WP4A 4PIXA 4FPJA 2GSYA 3IKWA 4XFAA 4FO9A 2VOVA 5FREA 1UL9A 3IPVA 2ZTNA 2E51A 3WCRA 4JGZA 1EAH3 2YROA 1QJX1 5CFDC 2WT1A 4PDWC 1XYOA 2N7GA 3BOWA 1UF2C 1QJU1 4RS5A 4YGEA 3OBRA 2JE7A 1QDOA 4Q4V2 4EV0A 1DU3D 4N53A 2ZHMA 4FAHA 4BH9A 4CZSA 4AWDA 4RFT0 3N35A 4GKYA 2Q5TA 4XFCA 4AQTA 1GFF2 1ZRRA 1OOPC 4RHV1 2XLGA 4F8AA 2YZ4A 1VBA2 3ZFEB 1AL22 2QQPA 4BYYA 4G4FA 4QGNA 1ULDA 4PCRA 1QJY2 4COVA 1POV3 3R6SA 4TLFA 2QCSB 1MVQA 2NQYA 5BXXA 1HQNA 1VBE2 5T55A 3JB4C 3L2YA 5DZGA 2A73B 4IQPA 3ZFFA 4E9KA 5CFCA 4C1XA 1AUYA 1MEC1 1WCKA 5FMOL 3M4FA 3O0XA 2GH2A 3I4IA 2ES3A 1S55A 4EJRA 4CDWA 3WW4A 3B5LB 5DDJ2 1VBB1 4OUMA 3JZVA 2EAKA 2D3SA 3FUQA 2DCKA 1SMVA 4S2DA 4NHMA 4YVWA 4GB33 1QNYA 2BYVE 2HWF3 4XIOA 2X5IB 1GBGA 1V6IA 2GZWA 3B93A 2WFF3 1H1IA 1GQHA 1VLNA 4XBNA 2ZJCA 2UWCA 3OYWA 2FMDA 4JC1A 5D8AC 5L19A 3RG0A 1NCRA 5EFUA 3WV6A 3AKRA 1DQ1A 1ND2A 5H9RA 1XRUA 5KC5A 1Z78A 1LCLA 1JYCA 3MW2A 2HJIA 4D94A 2HWE2 3FC0A 1O91A 2CAUA 1FAYA 1ZZ9A 2CWSA 4JCKA 1NE6A 4L2NA 4C0BA 4W6WA 2RS12 1ZZ7A 2YUEA 2ZPXA 2D6OX 2WLPA 5DUWA 1QJU2 2MEV3 3IN9A 1J1LA 2P3IA 5K0UA 4PLOA 3ZPYA 1ZBA3 4B3NA 4TSVA 4AI8A 3APBA 2VNGA 4OI2A 4GKXA 2JG8B 4QPGB 5GZGA 2D43A