1RUD2

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52084
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
molecule tags Virus
source organism Human rhinovirus 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rud200
4WM8A 2Y26A 1AYN2 4JGZB 5FMOS 1TMF3 5BNNB 4CDUA 1RUJ3 1AL21 1PVC2 5J98B 1BEV1 1RVF1 1PIV3 3VBUB 1NCQB 2BFUS 1OPOA 3ZFEB 5CFDC 1Z7S3 1BBT2 3CJIC 2R043 1BMV1 5A32B 2HWD1 1ND3C 1VBE3 4RR3C 1FPN2 4JGYA 3ZFEA 1RUD2 5C8CA 4IV3C 2HWB2 5JZGC 1HXS1 1VBB3 1GFF2 4RS5B 1COV1 4WM7A 3VBRA 1FMD3 2HWE3 1E57A 1BBT1 2ZTNA 3VBFB 4Q4Y1 1BMV2 1PVC1 5K0UB 3HAGA 3TN91 1X36A 4RQPC 5FMOL 1AUYA 1RUC2 3DPRC 4GH4A 3VDDB 1QJU2 4FTSA 4WM8B 1RUG2 4Q4Y2 5C9AC 1RHI3 2HWC1 1NY71 1RUF3 3VBHB 4WM8C 5CFCB 3VBSA 2HWE1 4Q4W1 2R061 1QJY2 4Q4V2 5ABJB 1DDLA 1HXS2 5GKAC 4Z92B 4CDWA 1M06G 2MEV1 4QPIA 1R082 2BBVA 2HWC2 1RMU1 4CDWC 4GMP1 1VBE1 2WS91 1HX6A 1VBD1 4Q4W2 2RS52 1ZBE3 1RHI1 1EAH2 1W39A 1AR61 1R081 1K5MA 1POV0 4GH4B 4QPGB 5AC91 2RS51 4RQPB 1AR91 1ND2B 4GB31 1QQP3 1MQTB 4GMP3 1RMU2 1F2NA 3J8F3 4Q4V3 2RR13 2DF7A 3VBSB 1V9U1 4QPGA 1RUF2 5LK7B 2RMU2 3DPRB 4LLFA 4WM7C 5AC92 5ABJA 1VB4A 4GMP0 2HWE2 5D8AC 1PO21 5JZGA 1RUI3 1VBD2 1QJY1 5DDJ1 1QJX1 2X5IA 1C8M1 5C9AB 1RUE3 2R072 1R083 1VBC3 5D8AB 3CJIA 1RUC3 4RS5C 3NAPB 1QJZA 4IV3B 1FOD1 1AL23 3JD72 4FTEA 2WS93 4CEWA 1IHMA 1PO12 1H8TB 1QJX2 1R091 1ZBE1 3CJIB 1AR73 1HRI3 1EV13 2HWF2 1AR92 1OOPC 1ND2C 2RR11 1FMD1 2IZWA 4CDXA 1FPN1 1MQTA 1VBA3 4RHV1 1VAKA 5DDJ2 1HXS3 1VBB1 5AC93 1TME3 5K0UC 3ZFGB 1R092 2PLV2 4GB33 1AR83 1HRV3 4N43B 2RR12 4Y4YA 1RB8G 2R073 3JD71 1V9U2 4JGZA 1D4M2 5BNPC 1VRH3 4YVWA 2R071 2RMU1 3JD73 1AYM2 1NOVA 3ZFGA 5C4WB 1QJU3 1NG0A 1NCQA 2WLPA 1QJX3 4GH4C 1NCRB 1OOPB 1X33A 1HQNA 5L7OB 1AR72 1TMF1 2HWF3 4Q4X1 5D8AA 4NWWA 1PO23 2RM22 1H8TC 2XPJA 1PO13 1ZBA3 4RHV3 5CFDB 1VBA1 1FPN3 1VB2A 5FOJB 2HWB3 5C4WA 1VBB2 2RS31 4Y5Z0 2MEV2 4JGYB 5CFCC 2R063 4CEYB 1Z7S2 1H8TA 4RFT0 1BBT3 1FMD2 4N53A 5BNOC 2XBO1 1VBE2 4GB32 1R093 1MEC1 4N43C 3FBMA 1AR82 1NCRC 3ZFGC 1HRI2 3VBFA 2PLV3 1RHI2 3JBG2 5C4WC 1AYM1 4YVWC 4CEYA 4N53B 5BNNA 3ZFFC 4AEDA 5A32A 1R1A2 3VBUA 4IV1C 1RUJ1 4CDQA 3VBOA 4CDUC 1PIV1 2RS32 4YVSC 1AYN3 1MQTC 3M8LA 4WM7B 1TMF2 2XBO3 2GSYA 3VBHA 3VDDC 1FOD2 3IDEA 4CDQB 3VBHC 1OOPA 2MEV3 1RUD1 1F8VA 2WFF3 1EAH3 3VBRB 1COV2 4CDUB 1PGW1 1AR71 4Q4X2 2HWC3 4FSJA 2RS11 3VBOC 4CDQC 4QPIB 4IV1A 3VBUC 1R1A1 3JBG3 1RUF1 4EJRA 5BNNC 2X5IC 2VQ0A 1AR63 1RUC1 1R1A3 1VBC1 4IV1B 1POV3 2PLV1 1AR81 1C8NA 5ABJC 1SMVA 1PVC3 4RS5A 4CEYC 4AEDB 1ASJ3 1HRV1 5CFCA 1PGL2 5J96B 4CDWB 4RR3B 1QQP2 3VBOB 1PGW2 2BFUL 2WFF1 5L7OC 1EV11 1RUE2 1PO11 1COV3 2RS33 2HWF1 4Q4X3 3ZFEC 5A33A 4RR3A 4SBVA 1AYN1 1ZBA1 3JB8A 1AL0G 1B35C 1FOD3 1POV1 5BNPA 1RUI2 2HWD3 1NA1B 1BEV3 1RVF3 1WCDJ 3ZXAC 2WFF2 2FZ1A 2QQPA 2RMU3 2X5IB 1HRV2 3JBG1 1K5MB 5BNPB 2RM21 2RS13 1VBD3 4FTBA 5DDJ3 1QJY3 4BCUA 4Q4Y3 5ACA3 2HWB1 1PGL1 1ND2A 1RUH1 4YVSA 1ZBA2 4CDXC 1RUH3 4QPIC 2RS53 4AEDC 5C9AA 2BPA2 4PDWC 2WZR1 3TN92 1QQP1 2R041 1AR93 1Z7S1 4CEWC 1QJU1 1PO22 2RM23 3NAPA 1MEC2 5A33B 2FZ2A 1VRH1 1D4M3 1RUG1 4N43A 1C8M2 4RQPA 1AYM3 1A6CA 5BNOA 1NA1A 3ZFFA 1ZBE2 1B35A 1TME2 1NY72 2ZZQA 2WZR2 3JB4C 5ACA2 3LOBA 1RUI1 1RMU3 3J8F2 3VBFC 1NCRA 4CEWB 1OHFA 3DPRA 1RUJ2 5L7OA 4Q4V1 1VRH2 5BNOB 1B35B 1ASJ2 2BUKA 1PIV2 4N53C 5C8CC 1RUH2 2WWSA 5JZGB 4QPGC 2RS12 4CDXB 5ACA1 4YVSB 1ND3B 2WS92 4JGZC 1D4M1 1RUG3 4RHV2 3VBRC 1NA1C 1CD3G 4PDWB 4IV3A 1EV12 1RUE1 1C8M3 1CJDA 4JGYC 1NCQC 2R062 1AL22 3NAPC 5C8CB 2HWD2 2ZAHA 1ND3A 1K5MC 1BEV2 1RVF2 4YVWB 3TN93 5CFDA 2TBVA 4PDWA 2WZR3 1TME1 2R042 1VBC2 1MEC3 5K0UA 2GH8A 3J8F1 3ZFFB 2XBO2 1RUD3 4NWVA 3S6PA 1V9U3 1VBA2 4Q4W3 1EAH1 1ASJ1 3VDDA 1HRI1 3VBSC 1AR62
chains in the Genus database with same CATH superfamily
1WGPA 4AVVA 2UU8A 3LD8A 3U4XA 2Y26A 2IFRA 4FPFA 4NHXA 1U5ZA 1WBFA 1ZRCA 4MH0E 3DCQA 4FOWA 5IVCA 4IL7A 1YFXA 2C5DA 4IDZA 1BEV1 1DLCA 4D0QA 3KV4A 3VBUB 4FPJA 2W46A 2Q8EA 3POWA 2BFUS 4QPWA 2RDQA 4HSJA 3JQXA 2XJRA 3PL0A 3WEZA 2R0HA 2GC0A 1ZM1A 5HBAA 2R043 2VULA 4LBQB 5A32B 2D44A 2HWD1 1DQ5A 3NVCA 1ENSA 1SEFA 3S5QA 3T08A 1S0CA 2AENA 2OUHA 5DZFA 1QDCA 2GN7A 4RR3C 3K4AA 5J3UA 1FPN2 2IVIB 1OVPA 4IV3C 4XJZA 5JZGC 4HOOA 3ZMOA 1HXS1 3MO4A 2JEMA 3OYWA 2OQ6A 4Q8KA 2D6LX 4LK6A 2YYOA 4ORFA 1H6YA 4LOTA 1D2QA 4JZRA 4XMIA 1HN0A 3ZYGA 4CTEA 4Q4Y1 3RZMA 5CKNA 3P3NA 4R4XA 5K0UB 3EQEA 5FV3A 1Z78A 2ZMNA 3ETPA 4GKXA 4W4ZA 4L8QA 1PK6C 5GJ6A 5LCWL 4RQPC 5FMOL 2B5HA 4B4PA 1SDWA 3AC0A 4GH4A 3AMMA 4Q29A 4W65A 3VDDB 4NAOA 4C1XA 5CAZA 1JOPA 3U11A 2BQPA 1YLLA 1IS5A 2A6WA 4P02B 1UMIA 4JHTA 3M4FA 5K7PA 1UZYA 3QCWA 4NAMA 2VNRA 4CCNA 1IS4A 1QMJA 3CNAA 4A45A 4HETA 3U10A 5FZAA 2WYFA 3IDBB 1T6BX 3O0XA 4O9EA 4JKMA 2WNOA 2XLAA 4QD2A 4YRDA 4Y22B 3H3LA 5FP8A 5F6LB 2VG9A 3ZM8A 1GKBA 1HW5A 1W6PB 1Q56A 3WQBA 2YZ4A 1KDKA 3AZXA 2WNUB 2XKPA 3MIDA 1TNRA 4NIIA 3T3YA 2MPFA 2SBAA 2MEV1 4XFCA 4YWAA 3LSEA 4I01A 2VZ3A 2HWC2 4CDWC 1N1YA 5A3MA 1R64A 3S57A 2B4KA 2XUEA 1UZWA 4K3UA 2WS91 2WN3A 4QHBA 4R8HA 1WW7A 2FQPA 5E16A 1UZVA 2D97A 2RS52 3MGUA 4CVUA 1H2NA 5E88A 4H55A 1W2UA 5FZ7A 5DUWA 1RHI1 5FKBA 1ST8A 2CU5A 3GCXA 4BMEA 1O3TA 4A7KA 1C4RA 2VNVA 1JW6A 5JOYA 2J7MA 2Y0OA 2WAAA 3A21A 4YGCA 3O1VA 1H4HA 2UY9A 4GQ7A 4EWEA 3AB0A 1DP0A 1POV0 2KXLA 4AF9A 3WHUA 1YNAA 4RYDA 5G04L 1UCXA 1UYYA 5D1IA 1DCSA 4M3CA 1UY4A 2P6HA 1PNGA 4OMCA 4QPGB 2ZEWA 3K77A 2WFPA 5FZ8A 4RQPB 3T1LA 1OLRA 1ND2B 4XFGA 1H1MA 4GMP3 3VZJA 5CG8A 1UU6A 3H3UA 1F2NA 1LHOA 1V6NA 2BOJA 2RDRA 2DF7A 2F4PA 2QJVA 1ODMA 3B3QE 1RJ7A 2VTXJ 2ZEYA 4J1XA 3P1IA 1DGRN 2YHJA 2YU2A 3DPRB 2OT7A 1W3XA 2BVBA 4WM7C 2AUYA 5ABJA 2V4VA 2XLGA 5A7SA 3U78A 5F9TA 1DYKA 2HWE2 3RFRA 1LECA 4AI1A 1RUI3 4OI4A 1X9PA 4D7YA 3I3BA 1QJX1 4COYA 1OKQA 3DYOA 2BVVA 1C8M1 3M1HA 4I09A 1R083 3KCXA 4MHUA 4CCEA 4WVVA 1KGYA 1VBC3 3CJIA 3HQUA 1RUC3 3I59B 5H9SA 4OHYA 3MW4A 4DIQA 3M3OA 3N9LA 3RYKA 4CE8A 1AL23 3RZKA 1Y9QA 3AK0A 2IUWA 3W59A 2D5FA 1J3QA 2BRTA 3WUDA 1REDA 4N7IA 1KS4A 4O7XA 5B4NA 2HEWF 4Z1VA 1GLHA 5FPXA 2KA3A 5I0RA 2A7AA 1R091 2G9ZA 4L2NA 3VZNA 1W8ZA 3BUCA 1OD5A 2HWF2 1OKOA 2FCUA 3NMBA 2WUHA 2A73B 4BOWA 1ND2C 3HNBM 4UBHA 4G3YC 1AJKA 3E5XA 4AGRA 3GXUA 3M7AA 1UY1A 4FXGB 2QQNA 1OH4A 2IZWA 3AMHA 4BYYA 5JCTA 3KQ4B 3N9OA 4HONA 4OZOA 1W04A 4XBLA 3DL3A 4L9BA 1W9WA 1N3QA 4B1MA 1MQTA 3AKPA 5A6YA 1VAKA 4LTAA 5DDJ2 5DABA 1A8DA 1SHWB 2YB7A 1V6MA 4UI9L 3O14A 3ABZA 4FXKB 3ZFGB 5C3QA 2JENA 2VPVA 2E51A 1AR83 1HRV3 2AGSA 4Y4RA 4HLTA 2J1EA 4Y4YA 3ZXJA 3UETA 3WF1A 4AI9A 2R073 1V9U2 4QT6A 3UJQA 1E5SA 3ZXGA 2YGLA 3JD73 4ISQA 4UXAA 4CP2A 4MVTA 1GWLA 3CIHA 2YY1A 1NOVA 4TXWA 1WKYA 1NCQA 2JDKA 1H9WA 3AZZA 2ZS6B 3EXUA 3FFQA 1V0AA 4BK5A 4YM3A 1HQNA 4GAZA 5FZOB 1AR72 1PK6A 2QFEA 5D8AA 4QGNA 1PO23 3AKRA 1H8VA 1ZBA3 2E6VA 5F8PA 4QDSA 2CDOA 2W91A 4FFIA 4QQOA 1WLCA 4M3CF 2D3RA 1GZWA 2DVDA 1TZOA 5JXGA 1QOTA 5FY1A 3U75A 4INDA 4TYSA 3CZUA 3JQWA 2D93A 1OFNA 3I2FA 4Q0VA 3ZYRA 4QQLA 4OZXA 3JZVA 1Z7S2 4AI0A 3KQRA 5BNOC 5DN2A 4CCOA 5JWPA 4MZUA 2Q4SA 4GB32 4KI5M 4FFFA 3FBMA 2E63A 4QWNA 2ORXA 4HKWA 5EXOA 3IIAA 1JU4A 1LGCA 3K75B 1UKGA 1GYKA 5JR7B 4HZFA 2W1SA 1OT5A 1RHI2 4P08A 4K8FA 3UK9A 3JBG2 2YXSA 2A5ZA 4KWLA 4YVWC 5KWRA 3S5AA 4FOQA 2P1BA 2W52A 5CIRA 4CEYA 2FBEA 3PVEA 3BYWA 1O6UA 4XW3A 3WXPA 1YYNA 5AFBA 5JOXA 4AEDA 1K12A 5EHDA 3C8XA 3O1RA 3GALA 2VVEA 4Q0PA 2VL4A 1GP6A 4IV1C 3DYMA 5FUPA 2VCBA 4ZXKA 1C5HA 4CDQA 5FP3A 3VBOA 4Q2FA 2PXJA 2EIGA 3AZWA 4LORA 2EIDA 2RS32 5T5OA 1AYN3 1MQTC 3M8LA 3FL7A 3POEA 3ZOIA 2EIBA 3DV8A 2WT2A 3PHMA 2YFUA 2B9UA 2HYXA 3POBA 1VPHA 3VBHA 5FLIA 1NLSA 3VKFC 4Y22A 2W3JA 3RSJA 3VDDC 1VP6A 3FHAA 3IDEA 3S30A 4XOGA 3VBHC 2GNTA 1HDKA 1PK6B 1RUD1 2IC1A 2Q8OA 4ATEA 2WFF3 1RINA 1LJ7A 1W6PA 4UF0B 3UKTA 1ACCA 1XXNA 4Y5TA 1COV2 2AR6A 4CDUB 4S2FA 1W05A 3M3QA 1OUXA 2W9XA 3O1TA 2OA2A 2R6QA 3HOBA 4OI2A 2RS11 4ZU7A 4YM0A 1XB9A 2OIIA 1BCXA 3VBUC 2ZOEB 3H8XA 5FXZA 4ZHNA 2DCZA 3KWVA 1XE8A 3HBZA 2TEPA 3ZXEA 3VKOA 3FLTA 4EJRA 2G1MA 1KS5A 2VCCA 2X5IC 3VHOA 3IT8A 4FQZA 1R1A3 4DOUA 3UV9A 5FPUA 4E27A 3K51A 1LKNA 2D5HA 2J42A 2YC0A 3I3EA 5F39A 2PLV1 2DUPA 1AR81 1G6NA 3MIBA 4D94A 1F4AA 1RXFA 3KCYA 5ABJC 3WP4A 4NJ4A 4RS5A 5LBFA 1QNWA 3AVRA 2ES3A 3NNFA 4EE2A 1ASJ3 1HQWA 1HRV1 2PHWA 3LQCA 3ZSKA 1W06A 2HBTA 3J7LA 5J96B 2VZTA 5LRRA 1V6OA 1UPIA 3KD4A 3NJXA 4MGYE 2Y34A 1WW4A 5SV5A 2VUCA 4A4AA 1JZ6A 3T30A 4CP9A 3ILRA 4FI9A 4YM1A 2B45X 5H9PA 5ANNA 1W0NA 1YEWA 2LROA 3WDYA 4Z8BA 5L7OC 1Q3EA 1JZ2A 2EA7A 3ZFEC 1WW6A 1XE7A 1S55A 3OPTA 3SKVA 2Z5WA 4WZFA 5I0DA 5J37A 1X82A 3IMMA 1YQ6A 4GWIA 1ZBA1 2CDPA 3I2KA 1AL0G 2WQ4A 3B69A 3W21A 2NLRA 2DVFA 4E9KA 3KF5A 1NA1B 1DGWA 5FLJA 4C91A 4YPJA 2WFF2 4PI0A 5CKQA 2GN3A 5LRSA 3R0RA 4LNVA 1I1EA 4QQPA 2A75A 3VD5A 3KGZA 1U12A 1JXNA 2JD4A 3ON7A 4QXKA 1HRV2 5F3EA 3ZR6A 1H0BA 1BVVA 1VAVA 5KR7A 4M3CE 4UFMA 5FK7A 5LEKA 2R1BA 4C0BA 5LB6A 4AEJA 3ZIWA 4CCJA 3T09A 3U0ZA 5FY5A 2RS13 4IETA 5H9QA 5LBBA 3GYDA 5IK4A 4Z82A 1A8MA 4J6GA 3HMYA 4BCUA 2DBIA 3WD5A 2P3YA 4A7YA 1ZVFA 3B94A 2R30A 1ND2A 4F7ZA 2VZSA 2JDHA 5GLUA 4AVAA 3K46A 2WA4A 1GNHA 4N90A 3SH4A 4WV8A 1MS0A 3NJYA 4AEMA 1MR5A 3OBRA 1W8HA 1NLQA 4QPIC 4OHWA 5C5UA 5C7GA 5FYBA 1VALA 2XJPA 2ZX4A 2WZR1 4CXWA 5IT6A 1JUHA 4L97A 1H1AA 2W1WA 4HN0A 4V2WA 3QD6A 4Q0UA 3UL2A 5HCAA 1W0OA 5B4XA 3H7YA 3VKMA 2WO2A 5T50A 2RM23 3NAPA 1ZZCA 1MS8A 5C3SA 3HQXA 5DUXA 2A6XA 4BWOA 3O1MA 3T2TA 2FZ2A 1VRH1 4IEUA 3KM5A 2XVLA 1D4M3 1FNZA 2VGDA 4N43A 5FPZA 1MPXA 4TWTA 1XNTA 1HV0A 1AYM3 2V09A 4LQRA 5BNOA 1DFQA 1B35A 1TME2 4K20A 2WIIB 1NY72 3B01A 4EN7B 5FZBA 5ACA2 3PLQA 3M3IA 5C33A 3MV01 5FZKA 1RUI1 4YARA 2WZ8A 3BOPA 4KGGA 4CPBD 2V72A 3NSTA 3AXDA 3FUOA 3NV1A 2O14A 1JH5A 1OHFA 5L7OA 4E4HA 3HR9A 5T55A 3ECQA 3N4MA 4EN6B 1W03A 1W6OA 4XJAA 2R0FA 1RUH2 4H2AA 1GQGA 5JZGB 5CU1A 1GOHA 1MS1A 5EWSA 5F7UA 4JKKA 1Q8SA 2WT1A 4TSVA 5K4LA 3AM2A 4AVTA 1GP5A 3MI8A 3HNYM 1LCLA 4YVSB 4IUGA 2NPIA 1LESA 1EUTA 4JGZC 3UYJA 1NQDA 2XLFA 1YXWA 1RUG3 2NYYA 3OD0A 4OLLA 1UXXX 3UT0A 3HVDA 4FCAA 3VBRC 1IPKA 2BW8A 4CP1A 4Q26A 1RUE1 3AMQA 1C8M3 4UAPA 5FFOC 4BH9A 3SITA 1LEMA 4QB6A 4HBNA 4YGBA 1UYZA 4LE4A 1IKQA 5F3GA 4H7MA 2IXJA 4QHZA 4OQ8A 3RZLA 2ZAHA 1RVF2 2C4XA 1ZX5A 3RZJA 1T6GC 1OH3A 4Y1YA 4M4RA 1CX1A 5FXWA 3TN93 3HT2A 3TYJA 2JB4A 4K7JA 3BOWA 3U1XA 5FP4A 2WZR3 1TME1 2R042 3IBMA 5HCBA 3V0BA 2JKXA 2GMPA 1FV2A 3GHNA 1QEXA 2A71A 1VBC2 1QXJA 1MVQA 1MEC3 4XDPA 3HBKA 5CEHA 5I91A 3ZPYA 3ZFFB 2E53A 2WR9A 3AFKA 4XAAA 5G05L 1IGOA 1BZWA 5FY8A 4R52A 1W6MB 3B93A 2ZMLA 1WLTA 2VVFA 1FNYA 5FQ0A 4BQ5A 2GC3A 1ZREA 1AR62 4WM8A 1KQRA 4RFRB 4NE9A 1AYN2 1I5ZA 4OHVA 1QKQA 4PBPA 1UY2A 4JGZB 5FMOS 1TMF3 5L36A 5BNNB 4CDUA 2CHHA 4B29A 5T5LA 1UX7A 2CWMA 4RGGA 4E4ZA 4TLFA 4XC9A 1LHUA 1CIYA 2WZPP 4BMBA 5JOZA 3DXUA 4HMZA 1OPOA 4TTGA 1PVXA 3F2ZA 4KNCA 3GF6A 4OUEA 5CFDC 5A3LA 3FHIB 1BMV1 2WBKA 2VOXA 1VBE3 2G4IA 3SHRA 3O1UA 2QKDA 1JHJA 3NV4A 3VN4A 2Y6FA 3ZFEA 4JQRA 5C8CA 1UD1A 3POIA 4Q0SA 5FXXA 1N1SA 4G4FA 4SLIA 1GFF2 4RS5B 4W6WA 4WM7A 3VBRA 2LUWA 3FLRA 2QVSB 1FMD3 3WF0A 2AACA 2NP0A 2WRAA 1BBT1 3RWKX 4IW3A 2E32A 4U36A 3UGGA 1ZRRA 3R4DB 2VXJA 1PVC1 1UZZA 2DURA 3ZVXA 2C26A 3ELNA 3ETQA 2YG0A 3TN91 1OQ1A 2KR2A 2X10A 2JECA 2VR4A 1RUC2 3FBYA 2EXHA 2WN2A 3RDIA 1QXPA 4MX3A 2MHFA 5F5CA 4Y20A 5GLTA 1HJFA 2VBPA 3S0MA 3IKWA 3N36A 1OI6A 1FAYA 4CPBA 4X6QB 1WMXA 5KHJA 5C3PA 4RSUA 5C9AC 1O5LA 4DINB 2HWC1 1NY71 1UPSA 4A44A 4YZ5A 3LPGA 2XB6C 1EPZA 3EHKA 1C5IA 4XDOA 1Y9MA 2F4LA 2W94A 5IVFA 4Y20B 4GWMA 2HWE1 2OZ6A 1Q8PA 2KM2A 2GDFA 5F5QA 4NHYA 3GM8A 2R16A 3TEZA 2OQ7A 3KCCA 3ZSJA 1JZ3A 5EIYB 5HI0A 4Z92B 4CDWA 2H0BA 1M06G 4QPIA 3Q8CA 2P3KA 4DUVA 1Y3TA 4BU2A 3RZGA 5LBCA 1YFUA 1RMU1 2E26A 3A23A 3WOGA 1U5IA 3ZDSA 4MXWA 2OW4A 3D4KA 1Y43B 4DY3A 4ZONA 1NXMA 1F15A 1HX6A 1VBD1 4Y1VA 4Q4W2 1HV1A 3HT1A 3IN9A 3OUIA 3N9NA 1MS4A 2QQIA 2WNVC 3BALA 3VDAA 3OPZA 3E97A 3P3PA 1ZZ6A 1TNFA 2VMDA 2WQ8A 4B1LA 1R081 1GOGA 5F5IA 2Z2SB 1XOYA 3VHPA 4DY5A 2P5BA 2ZGNA 4O9GA 2PQSA 4RD7A 3B5LB 5A6XA 4CCCA 1REEA 4AI8A 4B8EA 2RS51 2Y0IA 3A7QA 4LOSA 1GSLA 2JE7A 4J25A 2J1SA 4GB31 4Q27A 3ZX7A 3O7OA 4DZGA 2A70A 1JYVA 1DYOA 3ZYPA 1RMU2 3J8F3 4GJZA 5A3NA 2C9AA 1VAMA 4BE3A 4BISA 1L3JA 5I8YA 4GIQA 1XE0A 4L11A 4F3JA 2EXIA 1TE1B 4BQ2A 3D8CA 3J9SA 1RC6A 2JG9C 5LA1A 1RIRA 4K1ZA 1PZ7A 4YNIA 2Y8KA 2ZX2A 1FXZA 3IIIA 4IXLA 4PIXA 4BQXA 4QQHA 1VB4A 4GMP0 4IEWA 1AHSA 4BDVB 2BGOA 4AGVA 1VBD2 1J58A 2JDYA 2VQUA 3NV2A 4IEOA 4N8MA 5A7PA 3WW2A 1W3VA 3TAYA 5D21A 2R072 4MGQA 3N7JA 4FPYA 4QKDA 4OVEA 5D8AB 3ZPOA 3Q8BA 4NRMA 1GZTA 3A4UA 4MGZE 4XF4A 4ZS3A 1OUSA 3NAPB 4XE9A 1ZZ8A 2ZGPA 1QJZA 3AP5A 3POGA 4U2AA 2UWBA 2RDNA 4YW3A 3JD72 4ZZ5A 4P5YA 3RZZA 4DXSA 3ZO0B 1W8UA 3M3EA 3GHMA 4LKEA 4FTEA 2PAMA 1K3IA 2ZA9A 2O8OA 4Y5SA 1H8TB 1QJX2 5KXEA 4JRLA 3ZYBA 1ZBE1 3CJIB 3LSDA 5FZEA 4YW4A 1AR73 2BGCA 2AC1A 3GZTB 3SCFA 4QXCA 4S2HA 2RR11 3WF3A 4LHLA 2VH9A 1OA3A 5H9RA 1BXHA 1ZRIA 1G7YA 3WW4A 2YPJA 3PNAA 4IEQA 1XSQA 1ULEA 5ANQA 1IKPA 2ADEA 5GZDA 4RHV1 4URTA 2WO7A 1HXS3 1UU5A 5M0TA 2PQQA 4UOJA 3RG0A 1IS6A 4AYUA 1W8TA 2PLV2 4GB33 4IEPA 1DZQA 1UKRA 2GZWA 1YIFA 2QQMA 4LBQD 5AVAA 1CWPA 2VW1A 1RB8G 1RITA 3KT4A 5A3PA 4AK3A 1D4M2 4Y1UA 4YVWA 4D6RA 2R071 5GALA 4IQPA 3J7MA 4RL7A 5EQUA 2CSGA 4Q5OA 5LZ6A 5C4WB 1EPWA 2NMNA 1NG0A 3IAQA 2VW0A 4FFGA 1AJOA 2WLPA 3P5BA 2ZKNA 3WNXA 1NCRB 1VJ2A 3WR0A 2XWBB 2HWF3 3IWZA 1OPMA 2RM22 4FVVA 1H8TC 2YBSA 3WW1A 3ZYJB 4KBZA 3BPSA 4CP0A 5CFDB 3DEMA 2W95A 1FPN3 5L9BA 1YHFA 2QBXA 4EWDA 1VBB2 3IPVB 3POYA 4CU7A 3UGHA 4JGYB 2E7AA 1WWYA 1DIWA 3T4HB 5CFCC 3H50A 4CEYB 1WCSA 1H8TA 5A1FA 3TWIA 1GANA 3KF3A 5LA0A 4L92A 1CAXB 1DQ4A 1MEC1 5F3IA 3WSOA 2JKBA 1AR82 2VMCA 5F37A 3B7MA 3VGIA 3BGAA 3ZFGC 4LUKA 4BLJA 3VBFA 4CUCA 4I02A 1W8NA 1U0AA 1RUNA 2ZX3A 5DXDA 4TLGA 2VMIA 5IVJA 2DCJA 3PMSA 4FP2A 4OULA 1LULA 4QX7A 5BNNA 1OA2A 2VZQA 2LALA 1QGLA 2ET1A 3R4SA 4NHMA 4QX5A 3ZFFC 3USUA 3ZN5A 5A32A 3JU9A 5J48A 4LO8A 4O61A 4DUWA 1ZZBA 1NZCA 1G8WA 2VU9A 3Q8EA 3HD8B 2VTFA 4OI0A 3CMGA 4JCKA 4KWUA 2FDFA 1SLBA 4KWJA 1WCUA 5CVRA 5DG1A 3VD9A 2DV9A 3SMHA 3OGVA 4WM7B 3KV6A 4CUBA 2ADDA 4AG4A 2W2IA 1YQ8A 2XBO3 2VMFA 3MZHA 4AAPA 5KHKA 2YGMA 1J1LA 5T5PA 3K2OA 4XCBA 4HL0A 4AVSA 1FOD2 1SZBA 5F2SA 1DBNA 3TEWA 1IZ3A 1ODNA 2A1XA 4QX1A 1BHGA 3OEBA 1PMJX 5F2WA 5KXCA 4AZZA 1EAH3 1DF0A 5FYUA 3VBRB 3VKNA 2DDUA 1O91A 1VE0A 1AR71 3TNQA 2Z4FA 2D43A 4FSJA 1I6XA 2QQLA 3IZOA 4AWDA 3I4IA 2VXRA 4GULA 3K3NA 3C7GA 3ATGA 4XETA 1CAUA 1R1A1 3JBG3 2NQYA 3N3HA 5EYYA 4BQ1A 1NE4A 1ZA7A 4GWNA 1H2MA 3POJA 3KZ4C 3SQOA 4DXZA 3AXEA 5DAVA 5JSPA 2WYSA 3BI3A 5FJHA 2VQ0A 1W6NB 5C3OA 1W8OA 4XPVA 4XCAA 4YW1A 1W8WA 2VOTA 1UMZA 2GNMA 4FPKA 2Q0AA 1SLAA 5F32A 4IV1B 2JB8A 1S1AA 2YFZA 1ULGA 1S0DA 1SMVA 1WW5A 3LDRA 1S0EA 3OYWB 1S2EA 4CEYC 3QLQA 4A3ZA 4P9LA 1HQLA 5K9YA 3PU8A 5FYIA 1AXZA 5DAWA 4A2UA 4D6QA 1LAJA 3VDCA 3CZJA 1PGL2 2KD7A 2PMWB 4CDWB 4D7SA 2ZGQA 5I8TA 5FZHA 5BYNA 4JKLA 3VBOB 3OEAA 5HXVA 2BOIA 5CG9A 3OY8B 4IE7A 2BFUL 4PQ9A 4C0HA 4CCLA 4PLOA 3OJBA 2WNUC 1RUE2 3OBTA 4AW7A 2ZGRA 1COV3 2C0ZA 3W5MA 4QX0A 1XU2A 3AX4A 3BTXA 3B02A 4Q4X3 4Y33A 4QPYA 1YQ5A 3ASIA 3Q8FA 2RV9A 4UW5A 1O3RA 1XPWA 4OUSA 2VM9A 3WX5A 5A3OA 2W92A 2D3PA 4LKDA 4IEXA 4JHZA 5CISA 5BNPA 1RXGA 4GKYA 4C90A 1MZFA 1RVF3 1WCDJ 1JS9A 5FCCA 1SLLA 1DG6A 4ASMB 2NM1A 4CSWA 5HXMA 1KRIA 1XC6A 2VQTA 3CDZB 5I0SA 3MF9A 2OVUA 2RMU3 3O0WA 2TNFA 1RGSA 2Y6HA 1N3PA 1UN1A 5CADA 3ZXDA 2L9LA 3NO8A 4DMIA 3LA2A 3BPZA 3WNKA 4XXPA 3BIEA 1W6OB 1DU3D 2VO5A 2FCVA 3VDBA 2IWGB 1QJY3 1ZA4A 1O3QA 3PUAA 5FREA 3VD4A 3QACA 1LOCA 4NO4A 4ZS2A 5I93A 4FAGA 1QWRA 2HWB1 3Q8AA 1W9TA 1G9BA 2AEZA 2GNBA 3RI8A 1QF3A 2FD8A 1X8EA 4YVSA 2IXIA 3ACHA 1QH7A 4HK9A 4R9DA 4NIAA 2XH6A 3H1YA 1BK0A 4B7EA 1E5RA 5HV4A 4LT5A 3RYPA 3MLKA 4YSFA 2BNNA 3MUZ1 1SACA 5JXJA 1RUH3 3WINE 4QU1A 2WKKA 4KGQA 3K48A 4PCRA 3OG2A 2AZ5A 4LO4B 4C1WA 4PDWC 1GV9A 1SG3A 4R9AA 1W9YA 3VLBB 4CCKA 1AR93 4CEWC 1W99A 1PZ9A 4ARXA 1QJU1 3RZHA 2NN8A 1PO22 4XIKA 2UYBA 2GALA 3FHQA 3VB9A 3V0BB 4NUBA 2WO3A 1RUG1 1SFPA 4V1PA 2P37A 3QBQA 4DS0A 4RQPA 1A6CA 4HPKB 4XYXA 1NA1A 2F6BA 2VCMA 4XFFA 3DYPA 5J36A 2J1TA 1LGNA 1JU3A 4RA0A 2JG9A 2ZZQA 1YC61 2WZR2 2WJSA 3JB4C 5IJRA 1SLCA 2WO1A 3D0JA 4MXVA 4XHXA 4YZ4A 3SCHA 4MHRA 3TBDA 3VV1A 4NIHA 1LU2A 4I0WB 3VBFC 1XNKA 4JX0A 1CVNA 2I07B 1DGLA 1GU3A 1QU0A 4K6BA 2A6ZA 3ZN6A 1VRH2 5GM0A 3D0SA 4J1WA 1B35B 1CX4A 3OD4A 2ZJCA 5FZFA 4QXHA 1NT0A 4O65A 1FV3A 3AMNA 1HKDA 5HCFA 4BXSV 3IPVA 4WZCA 3T0AA 3O5SA 4CDXB 1H2LA 5ACA1 1GICA 3AJZA 1YJLA 1W2AX 3NQHA 2JJ6A 2ZPXA 1Y7BA 3U37A 4XBNA 1YQCA 4QB2A 1X50A 3ILFA 1CD3G 3DKWA 4PDWB 2C24A 2P17A 4XF0A 3C2UA 3A0NA 1YI9A 3DXTA 1CPNA 4JGYC 5JAXA 5BNQA 1BKZA 1NUKA 4UFJA 3ZXKA 4UBGA 2C9KA 4IE5A 3LFIA 1K5MC 1AX2A 2BV4A 5FO9B 2B39A 4K9SA 3VL9A 1GZ9A 5CFDA 1CZVA 3DUIA 5FPLA 3X29B 2EXJA 4LHSA 3E6BA 3WDTA 2Q5TA 3EJKA 5JI7A 2D98A 2QNKA 3BTZA 3CKHA 2ET7A 4DEQA 2P6CA 3IDCB 3W58A 5K0UA 1F35A 1GUIA 2ZZJA 2Q8DA 3TEYA 1LOFC 2XJUA 4QDQA 4B4RA 1VBA2 4G9SB 5IW0A 1D2SA 4Q4W3 3WG2A 1ASJ1 4NPMA 3SISA 3VZMA 1N3OA 3OGJA 4HANA 1WD4A 4HKOA 5LA2A 5IUQA 1I3HA 3MFCA 1LOFA 4JDNA 3ZSLA 3I3MA 2ZABA 4LA3A 3VZKA 3WQ7A 2B7YA 4XFBA 4N9HA 3V0AA 2Z79A 1PIV3 3TOJA 3KMHA 1NCQB 2WLQA 4A7ZA 1SQ4A 1H1IA 2ARCA 4LHNA 3RNSA 3T2PA 3L2YA 2D6KA 2CTVA 2W1QA 4D8MA 1Z7S3 1BBT2 3CJIC 1WMDA 2ATFA 1D4VB 1JBCA 1ND3C 2PHFA 4FP3A 4ZPIA 1MS9A 1NX9A 5FUIA 1FI2A 3VKLA 5A3UA 2QCSB 1UF2C 2UURA 5FWJA 2GP3A 4PHZA 3VZLA 4WVWA 3AZVA 5FBJA 3RJRA 2X09A 1GR3A 3RMYA 5LY1A 2HWB2 2Z42A 3HIFA 1VBB3 4OCTA 3THTA 1JYXA 5GLWA 1ZYBA 3A0KA 3SLIA 2VUDA 4DO0A 5IVEA 1W28A 2G19A 5CKMA 2WDBA 2F17A 2YC4A 4D7TA 1QXRA 4KL1A 3ORJA 4UWDA 3WNNA 3V65A 2ZTNA 1BMV2 3AFGA 3PUIA 3PIJA 5A1AA 4AXOA 3FFZA 1CZSA 3C7OA 2DCTA 1VLNA 3MYXA 3HAGA 4UF0A 3K4DA 2Q8CA 5FDBA 1JZ8A 4XJWA 4LUMA 1CAVA 1X36A 2RJLA 2Y6KA 5JIAA 4DB5A 3WVJA 4LE3A 1PGSA 2Y64A 1AUYA 5FMBA 3CJXA 1H30A 2V5YA 2VOKA 5FWEA 1QJU2 1W6NA 2E33A 4XFAA 4A41A 1G9CA 1ONAA 1E5HA 1P8JA 1OVSA 3AVSA 4M0NA 4FTSA 4E4DX 5BY5A 2Q1MA 1YRZA 4P9IA 1RUG2 3WDVA 3NKGA 3D5OA 4LIUA 1LR5A 1U5YA 3C7EA 3MIHA 3T2OA 2JD9A 2XG3A 3I2HA 2OUJA 5DAQA 3PU3A 4Q0QA 3ME2A 5KHIA 3LFMA 3V0AB 3O12A 1RJ8A 4WM8C 5LASA 4Y1XA 3SC7X 4AFCA 3D3AA 1G9FA 2WNVA 1GNZA 4A6OA 2K2SA 4JC1A 3ITQA 4YLZA 1PM4A 1UMHA 2ZGLA 4Q4W1 4QX8A 3KSCA 5FZCA 4AFDA 4CP9B 4KG8A 4AL9A 5ABJB 4AFAA 3H8OA 2AEYA 1HXS2 5GKAC 3ZKUA 2WABA 3LIGA 2RDSA 4LBMA 4PLNA 2VTXA 2EIEA 1R082 4XF3A 2BBVA 5A7NA 4QM8A 2ZACA 2FDIA 3DN7A 2HJIA 5FP7A 5IAVA 2PHDA 1GOFA 1XSRA 4FPEA 4QM9A 5KC5A 4XTMA 2VUJA 1ZZ9A 2AYHA 4TZDA 2Z69A 2XKOA 2RJKA 3VUOA 2R49A 4KG0A 1R1ZA 1EAH2 1YJKA 1AF9A 3POFA 1W39A 4F8AA 4Q1RA 4W6YA 1AR61 4JTOA 4LEJA 5JIUA 2CAUA 1JYCA 1BQPA 1SDDB 2OPKA 4LMFA 4CUAA 5EJZB 2CGNA 4OI1A 4XFHA 4GH4B 4LBOA 4ASKA 5DMYA 3LE0A 3U14A 3GCWA 2VZOA 2CYFA 4FAHA 1K5JA 4MGSA 1RL3A 2QUOA 3T1MA 3PVOA 1MQTB 1N47A 3NKTA 1MACA 4GZ9A 5FZGA 5IHRA 1CAWA 5A7OA 2XJVA 4K8RB 3VD3A 3IM0A 4Q4V3 5JXIA 3AKTA 2RR13 4LO5B 1LU1A 3VBSB 3N7KA 3MFAA 4Q1PA 1OFSA 1PX3A 3SEPA 5LK7B 5T54A 4RGAA 5A7WB 5C5TA 4LLFA 5AC92 2WNUA 3BTAA 1MS3A 1IQDC 4IERA 2VUAA 1UOBA 4AQTA 1PO21 3PMEA 4BK4A 1UQXA 3BODA 3VHNA 1QJY1 3I2JA 1H2KA 5DDJ1 3L2HA 2ZX0A 5C9AB 1JOBA 1UWWA 1HLCA 1NE6A 1RUE3 3G7DA 2J1RA 5IVVA 4I2OA 2V73A 3SKJE 3WNMA 4PIZA 4YFZA 1DZRA 1Q8OA 5FPBA 4RS5C 2CGOA 2ZGOA 5T3NA 1WLWA 1DQ0A 4GALA 3LDBA 5IK7A 1FOD1 3H7JA 4Z07A 4DEVA 1DQ2A 2J1AA 2TUNA 3KT7A 1QJEA 2WS93 5LWBA 2QTWB 4CEWA 2XJQA 3ZYHA 1AXYA 1PO12 1J84A 1YI7A 2VE1A 1WA4A 1AXKA 1IPJA 2XQXA 4YZ1A 5FO7B 1EV13 1QIQA 1URXA 4PQQA 2GC1A 2WWUA 4QB1A 3MBWA 4HKLA 1XNBA 3EB7A 3SCGA 5L9VA 5F5AA 1L7RA 1FMD1 4E8DA 4YYOA 5JOWA 3PTRB 2VMHA 4CDXA 2D3SA 3W9AA 4AE2A 3FC0A 1UOFA 4XUOA 3T0BA 3B00A 4PF1A 5J09A 2ARAA 3ZIXA 2ARXA 4YG0A 2OXBA 3B9IA 1F4HA 1SBFA 1TME3 3NNJA 5K0UC 1JZ4A 3BB6A 1QY4A 2JDAA 2PA7A 2SLIA 3JUUA 3WQ1A 2G9FA 2DCYA 3AKQA 1GP4A 2R1DA 4FQ4A 4N43B 2RR12 3ACFA 4OHZA 3NNLA 1QJFA 2BP6A 1ULFA 1LHNA 2VMEA 4JGZA 2BNOA 4EYUA 1H6XA 2JG9B 2RMU1 4OMDA 4ZU5A 1SFYA 4H14A 2ETEA 1OLQA 4AQ6A 3N9PA 3N7LA 3ZFGA 3ZXLA 4BQYA 4M0HA 1QJU3 3J4UH 1DLLA 4EQVA 4XIOA 1OLME 4GH4C 1QJX3 1NZIA 4QX2A 2XWJB 1X33A 2JDMA 4YGEA 4MLOA 3TRSB 1TMF1 5L7OB 5LW9A 4NWWA 3WG4A 4QGLA 5CBLA 3WDXA 4RHV3 1VBA1 1VIWB 4X6RB 3E5QA 3BCWA 4XEZA 3UESA 4BZ4A 5FOJB 3DECA 3KT1A 2PFWA 2RS31 3NV3A 4PI2A 2CGPA 2MEV2 3J7HA 1W2OA 1YQ2A 4XUTA 5CYYA 1GBGA 4NPLA 2K0GA 4LBNA 4M00A 4CUGA 5IK8A 4IE4A 4NMIA 4RFT0 1BBT3 1FMD2 3RGBA 4BHPA 2XBO1 2WQZC 3OTFA 1W0PA 1R093 2DUOA 3AYEA 2ORZA 1O8PA 2JICA 2BTVC 2OX0A 3I2DA 3R05A 4XF1A 3RMXA 3WV6A 3WQ0A 5IAXA 3AYAA 3CBNA 2E31A 3PIGA 3N9MA 1O5UA 2PLV3 4KH9A 3WCRA 3O1SA 2WT0A 3GBFA 3LIHA 1G9AA 2QQKA 2E7QA 5FLHA 2DU1A 5KXDA 2PHXA 2XVGA 1OC1A 3QOPA 4EWAA 2YBPA 3LEMA 1PM7A 1QNYA 5DZEA 3K4ZA 5GLVA 1C57A 1WLDA 2W68A 3AYDA 4P9WA 5A3WA 3WF4A 3VBUA 4Z2AA 1G86A 5FZ1A 1LNSA 3PUHA 4B4QA 3EYPA 3KV9A 3PVBB 1BVP1 4H7LA 4CDUC 1CQ9A 1PIV1 4YVSC 5DZGA 4QAWA 3ROUA 1TMF2 2ZCWA 3USUB 5L19A 2Y6LA 1SPPA 2VOVA 2WNEA 4DNYA 2Y60A 2BJSA 3I2OA 3SNMA 2ZMKA 4P9GA 2W08A 4XDQA 4YW6A 5HPOA 1O4TA 1V6LA 4EN9B 1ULDA 1Q8VA 3UJOA 1F8VA 1US2A 3UKVA 4QDRA 1GWKA 1KFXL 3BTYA 4Q4X2 2R7EB 1DZTA 2CL2A 2DTYA 3N9QA 5FZ3A 5JLVA 1J3PA 4IGPA 4CDQC 4QPIB 1Q43A 5JPMB 3IB3A 5LK5A 4YZ2A 2GC2A 3E6DA 2EF6A 4EN0A 4BQ3A 1RUF1 2PN5A 4M4PA 2VVDA 1XBFA 1NXD1 1UNBA 3LGRA 5IATA 1W2NA 4YG6A 4IEZA 4EV0A 1NKGA 1VRBA 1RUC1 5JVVA 1Q5OA 4OUMA 4PT6A 5LY2A 4EROA 1UIJA 3H8UA 1CAUB 2QQOA 1U5XA 5DQ0A 5CA6A 1WD3A 4I3GA 4EZHA 1E5IA 2GMMA 5DAPA 2X8KA 3INAA 1OXCA 3Q9OA 4JAAA 5CFCA 2YUEA 4HVRA 3LF7A 2ILMA 1PZ8A 1Y9GA 1QQP2 4FOYA 4E8CA 1OSGA 3WNLA 1JZ7A 1EY2A 1PNFA 2BGPA 4YW2A 3I7DA 4XURA 1AX0A 1IPSA 3PVNA 4COVA 5FJKA 1C3HA 1EV11 2RS33 3BN6A 1FT9A 1JYNA 3T2QA 4AHWA 5FIXA 2FCTA 1KDMA 4IGQA 5A33A 2ERFA 3EBRA 4SBVA 4JTNA 2B9VA 3KB5A 1AYN1 1QOOA 2JE8A 3JB8A 4HVQA 1POV1 3THDA 3VHRA 2HWD3 5FTTC 3WW3A 3KV5A 2VOWA 1BEV3 2ZHMA 4WVMB 1DQ1A 1FX5A 2LTNA 1UY0A 1TG7A 3T4VA 3LEGA 2H6CA 3H1MA 3NJVA 1CN1A 2JDUA 4FFHA 5FYTA 3ACLA 1W6QA 2I45A 5T52A 1K5MB 1QDOA 1SBDA 1S0GA 1WCKA 1N1VA 1YIPA 3AP4A 5C3RA 5BNPB 3THPA 4IE0A 3WF2A 2BU9A 3ZYFA 2Q1FA 2XDVA 4KBBA 4FTBA 5L73A 1JHNA 5FBZA 1JUIA 4W8JA 3NRUA 3BU7A 3HWJA 1V70A 1S0BA 4GXLA 2VBBA 3LKJA 4UFLA 4ISRA 5GZGA 1RUH1 4CCDA 5LEJA 5F3CA 5ERLA 3WG1A 2CNAA 2PHTA 3LZZA 1LHVA 4JQTA 1ZBA2 4CDXC 2H0VA 3URFA 3GNEA 1ZRFA 4B3NA 2JG8A 1F5JA 2EALA 2ZEXA 2RS53 5DUUA 5C9AA 1UYPA 3C7FA 3HEIA 1UW8A 1O7FA 3TN92 3P6BA 4IEVA 5EJ3A 5C8WA 2IXHA 3PJYA 1J3RA 4BB3A 3WUCA 2P34A 5ISLA 2WC2A 4FO9A 1POQA 4B7KA 1MEC2 1HB3A 5A33B 3J7NA 3N35A 2JDNA 4YFWA 1ZRDA 2Y6GA 2CV6A 2YMZA 4XUNA 3ZFFA 2W47A 1SCRA 4F83A 1NLRA 1ALYA 2LW8A 2NZ9A 1Z0HA 2VZUA 3LOBA 4XHBA 3NNMA 5FY7A 4DUXA 2RE9A 4CEWB 5FZOA 3E5UA 1JI6A 1RUJ2 2XL9A 4XJUA 3UKNA 1WMEA 2VAUA 4Q4V1 3CEWA 1YWKA 2XXZA 4AQSA 4LBJA 2BUKA 2W1UA 5FRAA 2GU9A 1OBNA 3TNPB 2WWSA 1M4WA 3B9CA 4QPGC 4FPCA 2IXKA 3ZSEA 1WBLA 3AL6A 1NYWA 3RVHA 2RS12 1UXZA 1SLTA 5FO8B 3ST7A 2A6VA 1TVGA 3WDUA 3H42B 3OSDA 4YG3A 1ND3B 4HG6B 1O4ZA 3I3DA 2JIGA 4CU8A 4RHV2 2B46X 4AEKA 4LBKA 4R9CA 3K3OA 3JCIA 4IV3A 4FT8A 1CJDA 2JG8B 5A3TA 3HPNA 4LKFA 4XZPA 1HJGA 1NCQC 2D40A 3N7MA 4Y1ZA 4E2GA 1MS5A 5FYSA 3EO6A 1AL22 2QQUA 2OYZA 4LITA 5C8CB 2FMYA 2WL1A 2JDPA 5A80A 4A42A 4YVWB 5FKCA 2PHRA 3A22A 4LXLA 3CL1A 3MIEA 4PDWA 4Y26A 1OURA 4XUPA 3RJ2X 2JX9A 2A3XA 5FR3A 5C70A 3EMRA 2Y33A 3LAGA 1O8SA 1V6IA 4I0AA 2GH8A 4NN0A 5JSRA 2XBO2 2VQAA 4HVOA 4KQ7A 2MNGA 4CCMA 5FY0A 1CAXA 3IMNA 3WCSA 3AP9A 1Y4WA 4LO6B 5EYXA 3VDDA 1EAH1 1SFNA 3VBSC 4AAXA 3H1WA 1UAIA 2ENRA 1T2XA 3OGRA 2Y6JA 4CU6A 4E2QA 1OMIA 4H3WA 4BA6A 3WP3A 4IEYA 4AFMA 3PDQA 1MVEA 1F5FA 2WSUA 3NWKA 4P9YA 5FMCA 3I2GA 4D69A 5AFEA 1RUJ3 3OCPA 1AL21 1PVC2 4CA9A 1W6MA 3TEXA 4AVBA 4Z2WA 4YGDA 1S2BA 5J98B 1RVF1 1YFWA 4DXTA 4AI2A 2XVKA 4D3WA 4K21A 3ZFEB 2ZHLA 1EP0A 1PX4A 2W87A 3PUSA 2Y38A 1RYYA 4QU2A 2WINB 3RWNA 5FYVA 1OF3A 3APBA 2ZGKA 4RN5A 2X53S 2XL7A 2BDRA 4GD4A 4JGYA 4UYBA 1UY3A 1C1FA 1GWMA 1RUD2 3OBZA 3M2MA 4P9XA 3AYCA 1OA4A 2ZX1A 4EN8B 3I49A 1S2KA 1COV1 4LA2A 3ES4A 2E9QA 1JZ5A 4MG2A 2VCAA 1REFA 2HWE3 2WA3A 3MV11 4GWJA 1E57A 3VBFB 3AL5A 3GZAA 2R32A 5FP9A 4LIVA 3ES1A 3MIGA 4GJYA 4QKNA 3LA3A 4W6XA 3LEKA 1GQPA 4P9JA 2XOMA 2YPDA 3CF6E 2VBDA 3RS6A 4CXYA 1K45A 3CQOA 5JPNB 3DPRC 3H9AA 3HN1A 5IYYA 3GZUC 4MADA 5JMOA 1QOSA 3V64A 4WM8B 1XYPA 2WSVA 3MEPA 2BBAA 3PJQA 4L99A 2P4EA 3PTYA 4Q4Y2 3MPPG 4P14A 2P3JA 1GQHA 1XNDA 2DU0A 4COWA 1CAVB 2EICA 1CAWB 1RHI3 4I30A 5FYMA 2PHUA 4ZU4A 1RUF3 1PHMA 3VBHB 5HCHA 5CFCB 4NIGA 1F31A 5J7MA 5JMCA 2VY0A 3VBSA 2ZHNA 3U4SA 2GMEA 2VD7A 2XQRA 2ZGMA 1YFYA 3OGGA 2R061 5T5JA 4CYDA 4E4SA 5IFTA 2FDHA 4CZSA 1QJY2 4XZUG 1W90A 1ZZ7A 2P2KA 3OUHA 4Q4V2 1CESA 1GZCA 2W0XA 3KVBA 5FZLA 1EYBA 3SH3A 1DDLA 5FYZA 3R6SA 4BJ0A 2AH2A 1LRHA 1GMMA 4NVPA 1UOGA 2BEOA 4GMP1 1VBE1 4MYEA 5FZ4A 2X05A 1A34A 2J1UA 2A6YA 3M70A 3LA7A 4NR1A 4NIDA 2BYVE 4WVMA 4RGKA 5FY4A 1ZBE3 4XAEA 4LJHA 3ZN6B 1MZ6A 3DF0A 1YUDA 3MW2A 1RTVA 5IVBA 1HB1A 2ZAAA 1HN1A 4NROA 2H6BA 2XHKA 1K5MA 1KFUL 3CO2A 1RUOA 2QQVA 2O8QA 3MLLA 1PMIA 1L7QA 5APAA 1DHKB 4DRRA 5FPVA 4OYUA 1HB4A 2LS6A 1D0GA 1IG3A 1LGBA 3I54A 3I3QA 5AC91 5KHGA 2QQWA 1K42A 5JUVA 5KXBA 2XUMA 5FYHA 1AR91 4NRPA 1JMUB 3FE5A 3C3VA 1QQP3 2IXLA 1V6KA 2VJXA 3J26N 4UFKA 2HLEA 4GA9A 3W20A 5A6QA 5EZWA 2D6NA 2XGXA 5A70A 1XQNA 2XHNA 1I5PA 4MGKE 1KJRA 4M01A 4ZY9A 2O1QA 2RG4A 1V9U1 2K46A 4QPGA 3E6CC 2EAKA 1RUF2 1WCQA 2A3WA 5FZIA 4A6SA 1LHWA 2RMU2 2FMDA 4XQDA 4XVHA 4E2SA 4IE6A 2DBNA 4CRQA 4META 5D8AC 4OFGA 2DFCA 3MICA 5JZGA 4ONUA 2EAAA 1VMFA 2YC2A 1OQEA 2JXAA 2D6MA 3MLJA 1NQJA 2QZ2A 4XF9A 3H0OA 4AQ2A 2UYAA 2X5IA 3DGTA 3OUJA 4BLIA 1OLMA 4DRVA 1W6QB 3NNGA 2QZ3A 4UW6A 4KWKA 4IESA 2VZRA 4N9IA 2JIJA 2RVAA 1G9DA 1YCIA 4IV3B 4HXCA 4K40A 3UGFA 4ARYA 1XNAA 1CZTA 5LA9A 1OQDA 5KHHA 1LOBA 2PAKA 1IHMA 4P00B 2JWPA 1S4CA 1I9RA 3SXWA 3PUQA 2DTWA 5IK5A 3NW4A 4XXAA 1IOAA 3THCA 1HRI3 2JDZA 4W50A 1AR92 1OOPC 3QH7A 5FYYA 2VZ1A 2UWCA 5C71A 2RJ2A 3WZ1A 2K9ZA 4LK7A 5DAXA 1C1LA 1FATA 1FPN1 3WT3A 1VBA3 4DQAA 4NHLA 1S0JA 1J1TA 1VBB1 3UNPA 4JDMA 5AC93 4ES8A 3FJSA 4BXFA 4MSVA 1ULOA 2DCKA 2QDRA 2OZJA 1R092 1W9SA 3GBWA 4QKBA 5A1LA 4I3PA 3QH6A 3RYRA 4ZXEA 2B42B 2RHPA 4OHXA 3GDBA 2XJSA 2UY8A 2OKXA 4BQ4A 3MHZA 4I0BA 5FZMA 2FDKA 2YDEA 4LR4A 2CY6A 3JD71 3GGLA 2JE9A 3OBAA 4N7UA 3M3CA 4MOAA 1UZ0A 4P5HA 3RPQA 1VRH3 3E1F1 4CU9A 5BNPC 3KS7A 1AYM2 1NAEA 5AVPA 5SV8A 1GZWB 1BK1A 5BPXA 3FZ3A 4AI3A 1V6JA 5KC6A 4LO7A 3GZEA 4KU7A 2GP5A 1LEDA 1CONA 1CR7A 3WDWA 1OOPB 2EVXA 4MGIE 4Q4X1 5CNAA 5TSWA 3AMPA 2P3IA 1PO13 2I74A 2VNGA 5BUVA 2XPJA 1APNA 4FOVA 1BLZA 4LBQA 5E6HA 3WG3A 4CXXA 2HEVF 2W5FA 4XABA 1VB2A 4BPZA 4EZ4A 1AVBA 3LDKA 5EPAA 2HWB3 2HH9A 5C4WA 5FQ0B 4R9BA 3OOXA 4Y5Z0 2BWAA 2VNOA 5EJ1B 2OS2A 2VECA 4LPLA 1XNCA 3AZYA 3LPFA 4XJ9A 2R063 3ILNA 4YZ3A 5EV7A 5FZDA 2ZGUA 4N53A 3WHTA 1W9FA 5GZCA 1VBE2 4FPLA 5JDBA 4QHOA 1JOJA 1UYXA 1X7NA 4N43C 1UX6A 4PLMA 1NCRC 3FN9A 1WMFA 2DUQA 4XQ4A 1HRI2 4OQ9A 4AHYA 4BM8A 4HSLA 5C4WC 4AHZA 3RRDA 4UW3A 1AYM1 4XACA 2VZPA 2PAEA 2YV8A 2ZKLA 4MUVA 4ZKTB 4N53B 1LOGA 1HB2A 1A3KA 2VMGA 1CPMA 3RI9A 5I8SA 3WP6A 5D2AA 1R1A2 1SPPB 5KBFA 2AREA 5FXVA 2N7GA 5A7QA 4HFSA 3SEEA 3H3ZA 4ASLA 5BV6A 4FBFA 5B2GB 2DVGA 3F95A 3I2IA 5FPAA 3ZSMA 1RUJ1 3GJAA 4MGTA 2A3YA 1LOAA 1LODA 1KJLA 4AOCA 3ZXFA 1S0IA 5EFUA 1MZEA 3BU0A 3KHCA 3KVAA 2J22A 1KEXA 2LM3A 3DKQA 1O4YA 2BZDA 4MV2A 4XJ8A 4YM2A 2GSYA 2PTMA 4LHKA 2BNMA 1ENRA 2I2SA 3O0VA 2JG8C 3C7HA 4CDQB 1OOPA 2MEV3 1XYOA 3VL8A 3IAPA 1WZXA 1O59A 3I97A 2Q1ZB 4ATFA 1X9TA 4UFIA 1ULCA 4XFIA 1PGW1 2HWC3 1KXGA 3VBOC 3JXSA 1VR3A 4AGGA 4IV1A 4JVAA 2DVAA 1MZ5A 1JYTA 4XQWA 5CZKA 2IVJA 1TQ5A 5FY9A 2XMLA 4BQWA 3OF1A 3ACGA 4NPRA 4XMAA 2GNDA 5BNNC 3O1PA 3FMGA 4QX3A 2EXKA 1AR63 4FPOB 1H9PA 5JI9A 4ITCA 1QHDA 1X8MA 1VBC1 1XJAA 4IGOA 4S2GA 2PYTA 5JSOA 1POV3 4QKFA 5FZ9A 3OY8A 1C8NA 4Y3OA 2B8MA 1PVC3 1SBEA 1S0FA 4AEDB 1C28A 1IG0A 1L7LA 1US3A 2CWSA 4ZZ8A 3FX3A 2HEYF 4WVZA 5JXHA 3ZN4A 1DQ6A 1SLIA 3OB8A 3VZOA 5DUVA 5F1RA 2ZGSA 1JYWA 4RR3B 1H4GA 3FUQA 5L9RA 2ZBJA 3ACIA 5FMDA 1PGW2 4LBLA 2WFF1 1W2TA 2PHLA 3H8RA 1XU1A 2VW2A 1VMHA 3FWEA 3WLUA 3USSA 1PO11 3CHXA 3D82A 5J1XA 1STMA 3WNOA 5DG2A 4ES9A 2HWF1 4AVCA 4FPHA 1WUVA 2YU1A 4RR3A 2Q30A 4WBBA 1J83A 2G9GA 1BYHA 3HQRA 4DPNA 1CGPA 2IXCA 5E8AA 1B35C 3MIFA 5C6CA 1FOD3 4Q8LA 1PMHX 1JODA 1RUI2 1V00A 2DFBA 2V4AA 1OF4A 2ZEZA 3FLPA 3CU7A 4LULA 4UFHA 3V56A 3ZXAC 3O1OA 5E89A 3R4UA 1ENQA 4NRQA 2FZ1A 4LKSA 3MW3A 1EUUA 2QQPA 1VMJA 2WNVB 2WWJA 2XJTA 2C1FA 2X5IB 4L0PA 2HBUA 4V2VA 2VC9A 3AKSA 3SH5A 3L9JT 4XTPA 3S7IA 1W8FA 3JBG1 4AFBA 1FYUA 2YBKA 5JR2A 3ALQA 4K1YA 1LB2A 1IS3A 2RM21 3I8TA 4HN1A 4NOTA 4PIYA 3GJBA 1VBD3 5DDJ3 1AX1A 3KGLA 1ZNPA 3G6JB 4TN7A 3MF6A 4LLOA 1D7PM 4Q4Y3 5ACA3 5EP9A 5FOBB 1PGL1 1N1TA 1B09A 3BIWE 4C8DA 3T0DA 2FDGA 4MXWB 4KMQA 4AR2A 4BIFA 4BIOA 4URAA 5FYCA 4FPGA 1XYNA 5GLZA 1A78A 1AZDA 3WNPA 3ZR5A 4QMAA 2D6OX 5LBEA 4DXRA 5K8SA 1XRUA 5FK8A 5FAXA 3ZLIA 1UL9A 2X29A 5BXXA 3KLSA 1KITA 3S7EA 5A7WA 4AEDC 2BPA2 5FZ6A 2FDJA 1HIXA 2W39A 1QQP1 2GAUA 2LRPA 2R041 4COUA 1CJPA 2BWCA 1Z7S1 3OPWA 2YROA 3ENRA 4MO3M 5IFPA 4M3CB 1YO8A 2ZGTA 2HKXA 1C8M2 3LOIA 4Y24A 4R4ZA 3HJRA 2ZXQA 1CIWA 2FHRA 2NMOA 1ZBE2 3AP7A 3ZMNA 4HK8A 3I59A 3NJZA 3MDPA 4PF5A 2PELA 4PJYA 2WZEA 1DGWX 2VZVA 1ULPA 4A3XA 1UU4A 3RQ0A 4X8PA 2QE3A 1RMU3 3J8F2 1NCRA 3HN3A 2GH2A 1LTEA 4NHKA 3CLPA 4JRAA 3DPRA 4UW4A 1JYIA 5F6KA 5FUNA 3WP5A 4UT5A 2DYCA 5BNOB 3NL1A 4QXBA 1ASJ2 3ZDVA 1OD3A 1PIV2 4N53C 5C8CC 3KHBA 3WY6A 2O0OA 5DPNA 2WAOA 4DFSA 2QQJA 2DWRA 5IVYA 1F9KA 5IWFA 1UOJA 1IQAA 3AJYA 3OGSA 1WA6X 4XUQA 5I0UA 2WS92 2C6SA 3LCPA 1D4M1 3MPBA 1DYPA 1UO9A 3W5NA 2E7TA 1NA1C 2XONA 2D7FA 4S2DA 2DVBA 1TEIA 2J1VA 5HV0A 3VD7A 3BKZA 1EV12 1ENXA 1GNYA 2IFWA 3AP6A 3BVCA 3LB9A 1Q8QA 3POSA 4JDOA 4YW7A 3ZKYA 4AHXA 1LENA 3MUY1 4QQ2A 1O3SA 1KD7A 1UIKA 2CAVA 2R062 2ZHKA 4X8NA 3TB0A 3NAPC 2HWD2 3HNMA 4XILA 1ND3A 5GZEA 5FZ0A 4D6SA 1BEV2 4PBOA 1JTZX 3D6EA 3LEIA 2QDNA 3PURA 2TBVA 4YW5A 3LWCA 1JN2P 3ZYIB 5CB7A 2UWAA 5E1RA 1J59A 1D0HA 2XR4A 3IDAA 4JV4A 1QH6A 5LATA 4QGMA 2ID4A 4XBQA 4HPKA 3U07A 5I0TA 3J8F1 4COZA 5A6ZA 4KU8A 2HYKA 1RUD3 2OPWA 2V5DA 4NWVA 1BJQA 4HT1T 1V9U3 3S6PA 3GBGA 5GZFA 4ET7A 2D6PA 1DGRA 1HRI1 1SCSA 1LOEA 2BERA 2ARBA
chains in the Genus database with same CATH topology
1WGPA 4AVVA 2UU8A 3U4XA 2Y26A 2IFRA 4FPFA 1U5ZA 1WBFA 1ZRCA 4MH0E 4FOWA 4IL7A 1YFXA 2C5DA 1BEV1 3VBUB 4FPJA 3POWA 2BFUS 4HSJA 3JQXA 2XJRA 2R0HA 2GC0A 1ZM1A 5HBAA 2R043 2VULA 4LBQB 5A32B 2D44A 2HWD1 1DQ5A 3NVCA 1ENSA 1SEFA 1S0CA 2AENA 2OUHA 5DZFA 1QDCA 2GN7A 4RR3C 5J3UA 1FPN2 4IV3C 4XJZA 5JZGC 3ZMOA 1HXS1 2JEMA 3OYWA 4Q8KA 2D6LX 2YYOA 4ORFA 1D2QA 4XMIA 3ZYGA 4CTEA 4Q4Y1 3P3NA 4R4XA 5K0UB 3EQEA 1Z78A 2ZMNA 4GKXA 5GJ6A 4L8QA 1PK6C 4RQPC 5FMOL 2B5HA 4B4PA 1SDWA 4GH4A 3AMMA 4Q29A 4W65A 3VDDB 4C1XA 5CAZA 3U11A 2BQPA 1YLLA 1IS5A 2A6WA 3M4FA 5K7PA 1UZYA 3QCWA 2VNRA 1IS4A 1QMJA 3CNAA 4HETA 3U10A 3IDBB 3O0XA 4O9EA 2XLAA 4QD2A 4YRDA 4Y22B 5F6LB 2VG9A 1GKBA 1HW5A 1W6PB 1Q56A 2YZ4A 1KDKA 3AZXA 2WNUB 2XKPA 3MIDA 1TNRA 2MPFA 2SBAA 2MEV1 4XFCA 3LSEA 4I01A 2HWC2 4CDWC 1N1YA 5A3MA 4K3UA 2WS91 4QHBA 4R8HA 1WW7A 2FQPA 5E16A 2D97A 2RS52 3MGUA 1H2NA 5E88A 4H55A 1W2UA 5DUWA 1RHI1 4BMEA 1O3TA 4A7KA 1C4RA 1JW6A 5JOYA 2Y0OA 4YGCA 1H4HA 2UY9A 4GQ7A 4EWEA 3AB0A 2KXLA 1POV0 4AF9A 3WHUA 1YNAA 1UCXA 5D1IA 4M3CA 1PNGA 4QPGB 3T1LA 2WFPA 4RQPB 1OLRA 1ND2B 4XFGA 1H1MA 4GMP3 3VZJA 5CG8A 1UU6A 3H3UA 1F2NA 1LHOA 1V6NA 2DF7A 2F4PA 2QJVA 3B3QE 1RJ7A 4J1XA 1DGRN 2YHJA 3DPRB 2BVBA 4WM7C 2AUYA 5ABJA 2XLGA 5F9TA 1DYKA 2HWE2 1LECA 4AI1A 1RUI3 4OI4A 4D7YA 1QJX1 4COYA 1OKQA 2BVVA 1C8M1 3M1HA 4I09A 1R083 3KCXA 4WVVA 1VBC3 3CJIA 1RUC3 3I59B 5H9SA 4OHYA 3MW4A 3M3OA 3RYKA 1AL23 1Y9QA 3AK0A 3W59A 2D5FA 1J3QA 3WUDA 1REDA 4N7IA 1KS4A 2HEWF 4Z1VA 1GLHA 5FPXA 2KA3A 5I0RA 2A7AA 1R091 3VZNA 4L2NA 1OD5A 2HWF2 2A73B 4BOWA 1ND2C 4UBHA 4G3YC 1AJKA 3E5XA 4AGRA 3M7AA 4FXGB 4BYYA 5JCTA 2IZWA 3AMHA 4XBLA 3DL3A 4L9BA 1N3QA 1MQTA 3AKPA 1VAKA 4LTAA 5DDJ2 1A8DA 1V6MA 3O14A 4FXKB 3ZFGB 2JENA 2VPVA 2E51A 1AR83 1HRV3 2AGSA 4HLTA 3ZXJA 4Y4YA 2R073 1V9U2 4QT6A 3UJQA 3ZXGA 2YGLA 3JD73 4ISQA 4UXAA 4CP2A 4MVTA 2YY1A 1NOVA 1NCQA 1H9WA 4YM3A 3AZZA 2ZS6B 3EXUA 3FFQA 1HQNA 1AR72 1PK6A 2QFEA 5D8AA 4QGNA 1PO23 3AKRA 1H8VA 1ZBA3 2E6VA 4QQOA 1WLCA 4M3CF 2D3RA 1GZWA 2DVDA 1QOTA 4INDA 4TYSA 3JQWA 2D93A 1OFNA 4Q0VA 3ZYRA 4QQLA 4OZXA 3JZVA 1Z7S2 4AI0A 3KQRA 5BNOC 5JWPA 4MZUA 2Q4SA 4GB32 3FBMA 2E63A 4HKWA 5EXOA 3IIAA 1LGCA 1UKGA 1GYKA 5JR7B 4HZFA 1RHI2 4K8FA 3UK9A 3JBG2 2YXSA 2A5ZA 4KWLA 4YVWC 5KWRA 4FOQA 5CIRA 2W52A 4CEYA 2FBEA 3PVEA 4XW3A 3WXPA 1YYNA 5AFBA 5JOXA 4AEDA 3GALA 2VVEA 4Q0PA 4IV1C 4ZXKA 1C5HA 4CDQA 3VBOA 4Q2FA 2EIGA 3AZWA 5T5OA 2RS32 1AYN3 1MQTC 3M8LA 3DV8A 2WT2A 3PHMA 3VKFC 2B9UA 4EV0A 3VBHA 5FLIA 1NLSA 4Y22A 3RSJA 3VDDC 1VP6A 3IDEA 3S30A 4XOGA 3VBHC 2GNTA 1HDKA 1PK6B 1RUD1 2IC1A 2Q8OA 4ATEA 2WFF3 1RINA 1LJ7A 1W6PA 3UKTA 1XXNA 1COV2 2AR6A 4CDUB 4S2FA 3M3QA 2OA2A 2R6QA 4OI2A 4ZU7A 2RS11 2OIIA 1BCXA 3VBUC 2ZOEB 2DCZA 1XE8A 3HBZA 2TEPA 3ZXEA 3VKOA 3FLTA 4EJRA 1KS5A 2X5IC 3VHOA 3IT8A 4FQZA 1R1A3 4DOUA 3UV9A 4E27A 3K51A 1LKNA 2D5HA 2YC0A 2PLV1 2DUPA 1AR81 1G6NA 3MIBA 4D94A 3KCYA 5ABJC 3WP4A 4RS5A 1QNWA 2ES3A 1ASJ3 1HQWA 1HRV1 2PHWA 3ZSKA 5J96B 5LRRA 1V6OA 1UPIA 3KD4A 4MGYE 1WW4A 5SV5A 3ILRA 4YM1A 2B45X 5H9PA 4Z8BA 3WDYA 5L7OC 1Q3EA 2EA7A 3ZFEC 1WW6A 1XE7A 1S55A 5J37A 2Z5WA 4WZFA 1X82A 1ZBA1 1AL0G 2WQ4A 3B69A 2DVFA 2NLRA 4E9KA 1NA1B 1DGWA 5FLJA 4C91A 2WFF2 5LRSA 2GN3A 3R0RA 4LNVA 1I1EA 4QQPA 2A75A 3KGZA 1U12A 1JXNA 2JD4A 4QXKA 1HRV2 1H0BA 1BVVA 1VAVA 4M3CE 5LEKA 2R1BA 4C0BA 4AEJA 3ZIWA 3U0ZA 2RS13 4IETA 5H9QA 3GYDA 5IK4A 4Z82A 1A8MA 4J6GA 3HMYA 4BCUA 3WD5A 4A7YA 1ZVFA 3B94A 2R30A 1ND2A 4F7ZA 5GLUA 4AVAA 2WA4A 1GNHA 4N90A 3SH4A 4WV8A 1MS0A 4AEMA 1MR5A 3OBRA 4QPIC 4OHWA 1VALA 2XJPA 2ZX4A 2WZR1 5IT6A 1JUHA 4L97A 1H1AA 4HN0A 3QD6A 4Q0UA 3UL2A 5HCAA 1W0OA 3VKMA 3H7YA 5T50A 2RM23 3NAPA 1ZZCA 1MS8A 3HQXA 5DUXA 2A6XA 4BWOA 2FZ2A 3T2TA 1VRH1 4IEUA 3KM5A 2XVLA 1D4M3 1FNZA 2VGDA 4N43A 5FPZA 4TWTA 1HV0A 1AYM3 2V09A 5BNOA 1DFQA 1B35A 1TME2 4K20A 2WIIB 1NY72 3B01A 4EN7B 5ACA2 3PLQA 3M3IA 5C33A 1RUI1 4YARA 3BOPA 4KGGA 3NSTA 3AXDA 3FUOA 3NV1A 1JH5A 1OHFA 5L7OA 3HR9A 5T55A 3ECQA 3N4MA 4EN6B 1W6OA 4XJAA 2R0FA 1RUH2 1GQGA 5JZGB 5CU1A 1MS1A 5EWSA 1Q8SA 2WT1A 4TSVA 3AM2A 4AVTA 3MI8A 1LCLA 4YVSB 1LESA 2NPIA 4JGZC 1NQDA 2XLFA 1YXWA 1RUG3 2NYYA 3OD0A 4OLLA 3VBRC 3ZN6B 4FCAA 1IPKA 2BW8A 4CP1A 4Q26A 1RUE1 3AMQA 1C8M3 5FFOC 4BH9A 3SITA 1LEMA 4HBNA 4YGBA 4LE4A 1IKQA 4H7MA 2IXJA 2ZAHA 1RVF2 1ZX5A 1T6GC 4Y1YA 3TN93 3HT2A 3TYJA 4K7JA 3BOWA 2WZR3 1TME1 2R042 3IBMA 5HCBA 3V0BA 2GMPA 1FV2A 3GHNA 2A71A 1VBC2 1QXJA 1MVQA 1MEC3 5I91A 3ZPYA 3ZFFB 2E53A 3AFKA 1IGOA 1BZWA 4R52A 1W6MB 3B93A 2ZMLA 1WLTA 2VVFA 1FNYA 5FQ0A 2GC3A 1ZREA 1AR62 4WM8A 1KQRA 1AYN2 1I5ZA 4OHVA 1QKQA 4PBPA 4JGZB 5FMOS 1TMF3 5L36A 5BNNB 4CDUA 4B29A 5T5LA 2CWMA 4RGGA 4E4ZA 4TLFA 1LHUA 2WZPP 4BMBA 5JOZA 4HMZA 1OPOA 1PVXA 4KNCA 3GF6A 5CFDC 5A3LA 3FHIB 1BMV1 2VOXA 1VBE3 2G4IA 3SHRA 2QKDA 3NV4A 3VN4A 3ZFEA 4JQRA 5C8CA 1UD1A 4Q0SA 1N1SA 4G4FA 4SLIA 1GFF2 4RS5B 4W6WA 4WM7A 3VBRA 2LUWA 3FLRA 2QVSB 1FMD3 2NP0A 1BBT1 4U36A 1ZRRA 3R4DB 1PVC1 1UZZA 2DURA 3ZVXA 3ELNA 3ETQA 3TN91 1OQ1A 2JECA 1RUC2 3FBYA 2EXHA 3RDIA 1QXPA 4MX3A 2MHFA 4Y20A 5GLTA 3S0MA 3IKWA 3N36A 1OI6A 1FAYA 4X6QB 5KHJA 4RSUA 5C9AC 1O5LA 4DINB 2HWC1 1NY71 1UPSA 4YZ5A 2XB6C 1EPZA 3EHKA 1C5IA 4Y20B 4GWMA 2HWE1 2OZ6A 1Q8PA 2KM2A 2GDFA 5F5QA 2R16A 3ZSJA 3KCCA 5HI0A 4Z92B 4CDWA 2H0BA 1M06G 4QPIA 2P3KA 1Y3TA 1YFUA 1RMU1 3WOGA 1U5IA 3ZDSA 4MXWA 2OW4A 3D4KA 1Y43B 4DY3A 1NXMA 1HX6A 1VBD1 4Y1VA 4Q4W2 1HV1A 3HT1A 3IN9A 1MS4A 2WNVC 3BALA 3OPZA 3E97A 3P3PA 1ZZ6A 1TNFA 1R081 2Z2SB 4DY5A 3VHPA 2ZGNA 4O9GA 4RD7A 3B5LB 1REEA 4AI8A 4B8EA 2RS51 2Y0IA 1GSLA 2JE7A 4Q27A 4GB31 3ZX7A 3O7OA 4DZGA 2A70A 3ZYPA 1RMU2 3J8F3 2C9AA 1VAMA 4BE3A 5I8YA 1L3JA 4GIQA 4L11A 4F3JA 2EXIA 1TE1B 3D8CA 3J9SA 1RC6A 2JG9C 1RIRA 4K1ZA 1PZ7A 4YNIA 2ZX2A 4IXLA 1FXZA 4PIXA 4QQHA 1VB4A 4GMP0 4IEWA 1AHSA 4AGVA 1VBD2 1J58A 3NV2A 4IEOA 3WW2A 3TAYA 2R072 3N7JA 4FPYA 4OVEA 5D8AB 3A4UA 4MGZE 4XF4A 3NAPB 4XE9A 1ZZ8A 2ZGPA 1QJZA 3AP5A 4U2AA 2UWBA 4YW3A 3JD72 3RZZA 3ZO0B 3M3EA 4FTEA 3GHMA 2PAMA 2ZA9A 2O8OA 1H8TB 1QJX2 5KXEA 4JRLA 1ZBE1 3CJIB 3LSDA 4YW4A 1AR73 2BGCA 3GZTB 3SCFA 4S2HA 2RR11 4LHLA 2VH9A 1OA3A 5H9RA 1BXHA 1G7YA 3WW4A 2YPJA 3PNAA 4IEQA 1ULEA 1IKPA 5GZDA 4RHV1 4URTA 1HXS3 1UU5A 2PQQA 3RG0A 1IS6A 4AYUA 4GB33 2PLV2 4IEPA 1DZQA 1UKRA 2GZWA 1YIFA 4LBQD 5AVAA 2VW1A 1RB8G 1RITA 3KT4A 4AK3A 1D4M2 4Y1UA 4YVWA 2R071 5GALA 4IQPA 4RL7A 5C4WB 1EPWA 2NMNA 1NG0A 2VW0A 1AJOA 2WLPA 3WNXA 2ZKNA 1NCRB 1VJ2A 3WR0A 2XWBB 2HWF3 3IWZA 1OPMA 2RM22 4FVVA 1H8TC 3WW1A 3ZYJB 4CP0A 5CFDB 1FPN3 1YHFA 4EWDA 1VBB2 3IPVB 3POYA 4JGYB 2E7AA 1DIWA 5CFCC 3H50A 4CEYB 1WCSA 1H8TA 3TWIA 1GANA 4L92A 1CAXB 1DQ4A 1MEC1 2JKBA 1AR82 3B7MA 3VGIA 3ZFGC 4BLJA 4LUKA 3VBFA 4I02A 1U0AA 1RUNA 2ZX3A 5DXDA 2VMIA 2DCJA 3PMSA 4FP2A 4OULA 1LULA 5BNNA 1OA2A 4NHMA 2LALA 1QGLA 2ET1A 3R4SA 4QX5A 3ZFFC 3ZN5A 3USUA 5A32A 3JU9A 5J48A 4LO8A 1ZZBA 1NZCA 1G8WA 2VU9A 3HD8B 4OI0A 4JCKA 1SLBA 4KWJA 5CVRA 5DG1A 2DV9A 3SMHA 4WM7B 4AG4A 2XBO3 3MZHA 5KHKA 2YGMA 1J1LA 5T5PA 4AVSA 4HL0A 1FOD2 1DBNA 1IZ3A 5KXCA 1EAH3 1DF0A 3VBRB 3VKNA 1O91A 1AR71 3TNQA 2D43A 4FSJA 1I6XA 4AWDA 3I4IA 2VXRA 4GULA 3ATGA 4XETA 1CAUA 1R1A1 3JBG3 2NQYA 3N3HA 5EYYA 4BQ1A 1NE4A 4GWNA 1H2MA 3KZ4C 4DXZA 3AXEA 5JSPA 2VQ0A 1W6NB 4XPVA 4YW1A 1UMZA 2GNMA 4FPKA 2Q0AA 1SLAA 4IV1B 1S1AA 1ULGA 1S0DA 1SMVA 1WW5A 1S0EA 3OYWB 4CEYC 3QLQA 4P9LA 1HQLA 5K9YA 1AXZA 4A2UA 1PGL2 4CDWB 4D7SA 2ZGQA 5I8TA 5BYNA 3VBOB 5HXVA 5CG9A 3OY8B 2BFUL 4PQ9A 4C0HA 4PLOA 3OJBA 2WNUC 1RUE2 3OBTA 4AW7A 2ZGRA 1COV3 2C0ZA 1XU2A 3AX4A 3B02A 4Q4X3 4QPYA 3ASIA 4UW5A 1O3RA 4OUSA 3WX5A 2D3PA 4IEXA 5BNPA 4GKYA 4C90A 1MZFA 1RVF3 1WCDJ 5FCCA 1SLLA 1DG6A 4ASMB 2NM1A 1KRIA 5I0SA 3MF9A 2OVUA 2RMU3 3O0WA 2TNFA 1RGSA 1N3PA 1UN1A 5CADA 3ZXDA 3NO8A 4DMIA 3LA2A 3BPZA 4XXPA 1W6OB 1DU3D 2IWGB 1QJY3 1ZA4A 1O3QA 5FREA 3QACA 1LOCA 4NO4A 5I93A 4FAGA 1QWRA 2HWB1 1G9BA 2GNBA 3RI8A 1QF3A 1X8EA 4YVSA 2IXIA 4R9DA 1QH7A 4HK9A 2XH6A 3H1YA 4B7EA 4LT5A 3RYPA 3MLKA 4YSFA 2BNNA 1SACA 1RUH3 3WINE 2WKKA 4KGQA 3K48A 4PCRA 2AZ5A 4LO4B 4C1WA 4PDWC 1GV9A 4R9AA 3VLBB 1AR93 4CEWC 1PZ9A 1QJU1 2NN8A 1PO22 4XIKA 2UYBA 2GALA 3V0BB 1RUG1 4V1PA 2P37A 3QBQA 4DS0A 4RQPA 1A6CA 4HPKB 4XYXA 1NA1A 2F6BA 4XFFA 5J36A 1LGNA 4RA0A 2JG9A 2ZZQA 2WZR2 2WJSA 3JB4C 1SLCA 3D0JA 4MXVA 3TBDA 4XHXA 4YZ4A 3SCHA 3VV1A 1LU2A 4I0WB 3VBFC 1XNKA 1CVNA 2I07B 1DGLA 1QU0A 4K6BA 2A6ZA 3ZN6A 1VRH2 5GM0A 3D0SA 4J1WA 1B35B 1CX4A 3OD4A 2ZJCA 1FV3A 3AMNA 1HKDA 5HCFA 3IPVA 4WZCA 3O5SA 4CDXB 1H2LA 5ACA1 1GICA 3AJZA 1YJLA 2JJ6A 2ZPXA 1Y7BA 4XBNA 1X50A 3ILFA 1CD3G 3DKWA 4PDWB 2P17A 4XF0A 3C2UA 3A0NA 1YI9A 4JGYC 1CPNA 5JAXA 5BNQA 1BKZA 4UBGA 1K5MC 1AX2A 5FO9B 2B39A 4K9SA 3VL9A 1GZ9A 5CFDA 3DUIA 3X29B 2EXJA 3WDTA 3E6BA 2Q5TA 3EJKA 5JI7A 2D98A 2QNKA 2ET7A 3IDCB 3W58A 5K0UA 2ZZJA 1LOFC 2XJUA 4B4RA 1VBA2 4G9SB 1D2SA 4Q4W3 3WG2A 1ASJ1 3SISA 3VZMA 1N3OA 3OGJA 4HANA 1WD4A 4HKOA 5IUQA 1I3HA 3MFCA 1LOFA 4JDNA 3ZSLA 2ZABA 4LA3A 3VZKA 3WQ7A 2B7YA 4XFBA 4N9HA 3V0AA 2Z79A 1PIV3 3TOJA 3KMHA 1NCQB 2WLQA 4A7ZA 1SQ4A 1H1IA 4LHNA 3RNSA 3L2YA 2D6KA 2CTVA 1Z7S3 1BBT2 3CJIC 1WMDA 2ATFA 1D4VB 1JBCA 1ND3C 2PHFA 4FP3A 3ZXKA 1MS9A 1FI2A 3VKLA 2QCSB 1UF2C 2UURA 3VZLA 4WVWA 3AZVA 3RJRA 1GR3A 3RMYA 2HWB2 2Z42A 3HIFA 1VBB3 3THTA 5GLWA 1ZYBA 3A0KA 3SLIA 4D7TA 1QXRA 4KL1A 3V65A 2ZTNA 1BMV2 3AFGA 4AXOA 3FFZA 2DCTA 1VLNA 3MYXA 3HAGA 5FDBA 4XJWA 4LUMA 1CAVA 1X36A 2RJLA 5JIAA 4DB5A 3WVJA 4LE3A 1PGSA 1AUYA 3CJXA 1H30A 2V5YA 2VOKA 1QJU2 1W6NA 4XFAA 1G9CA 1ONAA 4FTSA 4M0NA 4E4DX 5BY5A 2Q1MA 1YRZA 4P9IA 1RUG2 3WDVA 3NKGA 3D5OA 1LR5A 1U5YA 3MIHA 2XG3A 2OUJA 4Q0QA 3ME2A 5KHIA 3V0AB 3O12A 1RJ8A 4WM8C 4AFCA 4Y1XA 1G9FA 2WNVA 1GNZA 2K2SA 4JC1A 4YLZA 2ZGLA 4Q4W1 3KSCA 4AFDA 4KG8A 5ABJB 4AFAA 1HXS2 5GKAC 4LBMA 4PLNA 2BBVA 1R082 4XF3A 4QM8A 2ZACA 3DN7A 2HJIA 2PHDA 4FPEA 4QM9A 5KC5A 4XTMA 2VUJA 1ZZ9A 2AYHA 4TZDA 2Z69A 2XKOA 2RJKA 3VUOA 2R49A 4KG0A 1R1ZA 1EAH2 1YJKA 1AF9A 1W39A 4F8AA 4Q1RA 4W6YA 1AR61 4JTOA 4LEJA 5JIUA 2CAUA 1JYCA 1BQPA 2OPKA 2CGNA 4OI1A 4XFHA 4GH4B 4LBOA 2CYFA 4FAHA 1RL3A 2QUOA 3T1MA 3PVOA 1MQTB 1N47A 3NKTA 1MACA 1CAWA 2XJVA 3IM0A 4Q4V3 3AKTA 2RR13 4LO5B 1LU1A 3VBSB 3N7KA 3MFAA 4Q1PA 1OFSA 5LK7B 5T54A 4RGAA 4LLFA 5AC92 2WNUA 3BTAA 1MS3A 4IERA 2VUAA 4AQTA 1PO21 3PMEA 3BODA 3VHNA 1QJY1 1H2KA 5DDJ1 3L2HA 2ZX0A 5C9AB 3G7DA 4I2OA 1HLCA 1NE6A 1RUE3 2V73A 4PIZA 4YFZA 1DZRA 1Q8OA 4RS5C 2CGOA 2ZGOA 5T3NA 1WLWA 1DQ0A 4GALA 5IK7A 1FOD1 3H7JA 4Z07A 1DQ2A 2TUNA 3KT7A