1CZSA

Crystal structure of the c2 domain of human coagulation factor v: complex with phenylmercury
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
GCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords PROTEIN (COAGULATION FACTOR V)
publication title Crystal structures of the membrane-binding C2 domain of human coagulation factor V.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1czsA00
1O8PA 5JXIA 1JHJA 4JHZA 3WEZA 3VD3A 3A21A 3ZM8A 3LPGA 4QDSA 3WSOA 3NRUA 3OEBA 2EIDA 2W95A 2WBKA 5EJZB 3DYMA 2YFZA 2WO2A 4P5YA 2X10A 1GOHA 1EUUA 4KI5M 1K12A 5CZKA 4QB2A 4XVHA 2J1SA 5A1AA 3IIIA 3WF1A 3UETA 1W9SA 3K75B 2VZSA 3VDCA 1XC6A 2QBXA 5G04L 3OG2A 1UXXX 5EJ1B 4BK5A 5IJRA 3MBWA 5JR2A 1TG7A 3K46A 2R7EB 5JXHA 1GOGA 2VR4A 4DEQA 3LE0A 5DN2A 3E1F1 4XUOA 1CZTA 1W8OA 3GGLA 1UMHA 3ECQA 2VZOA 3WNOA 3F2ZA 3T08A 2VZVA 4LPLA 1K42A 4QPWA 3K4AA 1GU3A 2BGOA 1W9TA 4ZY9A 2JE8A 3I2KA 4BJ0A 4DXTA 3VD4A 4DXSA 4QDQA 3WQBA 1KGYA 2YC2A 5LA0A 2QQIA 1CIYA 1UMIA 1NX9A 2B9VA 2BERA 2W1WA 4AAXA 1GQPA 1NKGA 2WAOA 2Y8KA 1XNTA 3ACGA 1RYYA 4MADA 3I2HA 2ORZA 1JZ6A 2WZEA 4CVUA 4L0PA 1DP0A 3WNPA 5JMOA 3UESA 1CZVA 3I97A 4XUNA 1UZ0A 5IFTA 2V72A 3I3BA 2X09A 1JZ3A 4CUAA 2LS6A 4E8DA 2J1RA 2VM9A 3HPNA 4IUGA 4ARYA 1JYWA 2Y6GA 4CU9A 3DYOA 3VDBA 1PX3A 4OUEA 2J1TA 2W5FA 4TXWA 5DPNA 4W8JA 1HN1A 2XONA 4BXSV 1TVGA 4OMDA 4BDVB 2YB7A 3SKJE 2VZPA 2C9KA 2BZDA 4BK4A 3ACIA 3SEEA 2WN2A 2BGPA 3K4ZA 2VQTA 1UYYA 4XUTA 2ID4A 3HNYM 3U37A 1NUKA 1KEXA 2W3JA 2QQKA 1JZ5A 3UNPA 1K45A 3JXSA 2YC4A 2VMEA 4FI9A 1L7QA 1WKYA 2W91A 1O8SA 3WNLA 4LHSA 1ULPA 2CDOA 1JZ2A 2W1SA 5B4NA 3BN6A 4P02B 2J22A 4D8MA 1P8JA 4JKKA 1JYNA 3IAQA 3CQOA 4A3ZA 1UY2A 3IAPA 3VD5A 3ACHA 3LEIA 4UI9L 5F7UA 1JZ4A 5HXMA 1GUIA 5IHRA 2DDUA 3K77A 3T09A 1UYZA 2WDBA 3NQHA 2VCCA 3FN9A 1UYXA 4ZZ5A 4TTGA 3HNBM 2KD7A 5LA2A 5HPOA 2VCAA 2W9XA 3GXUA 2E31A 3NJVA 2J1VA 1OT5A 3T2OA 1OF3A 3NJXA 2WYSA 4XUQA 2XQXA 5JUVA 1JU4A 4A44A 2VQUA 3K4DA 1UY4A 2VMDA 5EIYB 4HG6B 2WO3A 2VOTA 4QAWA 4PT6A 1UXZA 1F4HA 4A4AA 1XNAA 3CKHA 1US3A 2VZ1A 4CUBA 2LW8A 3WF0A 2ORXA 1OD3A 1DYOA 2WUHA 4ZZ8A 3BGAA 1UWWA 4CUCA 3WF3A 4ET7A 2OKXA 1GOFA 1I5PA 4GWJA 4QX2A 2W46A 4JX0A 2Y6HA 3P1IA 3T0AA 2QQOA 3I2IA 4QB6A 4KMQA 1PX4A 2E26A 2WZ8A 4W50A 2HLEA 3A23A 3CMGA 3OGVA 3OGRA 4A6OA 4GZ9A 1O59A 4D0QA 1K3IA 1PMJX 3LQCA 4OZOA 2VO5A 4DUVA 4QX3A 4Z2AA 4UAPA 4AG4A 4P08A 1F4AA 3FL7A 3MO4A 4MO3M 2W1QA 3CZUA 1W9WA 2W87A 2WN3A 1J84A 1W0NA 3GM8A 1MPXA 3C7HA 2ZXQA 5LCWL 1JZ8A 3LEKA 1CZSA 3PUHA 2Z4FA 2RV9A 1IQDC 2V5DA 3J7HA 2VZRA 4LKSA 3MUY1 3D3AA 3OBAA 2VMCA 2VZTA 2W1UA 3HEIA 4LQRA 3WNKA 2BBAA 1L7RA 1YQ2A 3C7OA 1XPWA 1BHGA 3WF4A 2VTFA 3MUZ1 3WNMA 3VD7A 1NAEA 2VMFA 3THDA 1GMMA 3P6BA 1JZ7A 3PUIA 2JD9A 4ZXEA 3C8XA 5CYYA 5C7GA 1OF4A 4QX0A 3OEAA 4QB1A 1GNYA 3ACFA 3ETPA 4RN5A 3CZJA 4UOJA 3WNNA 5JXJA 1J83A 1PMHX 2XHNA 1US2A 4W4ZA 3I3DA 1ULOA 3IB3A 3HN3A 2QQJA 4MGSA 4CU6A 2QQNA 3IDAA 3MV01 3VD9A 2WQ8A 2VJXA 3FHAA 3I2JA 2Y6LA 3HJRA 2EIEA 2W47A 2X05A 1JU3A 2DCKA 2E33A 1JI6A 2Y6JA 3GDBA 3I3EA 4MGQA 4CU7A 5C71A 2ZEYA 3W5NA 2WAAA 3SKVA 4QDRA 2QQLA 4ARXA 2E32A 2EICA 1W8NA 3ABZA 2HYXA 3I2GA 4KWUA 3C7GA 2VZ3A 2Y6KA 4XUPA 5I0DA 3NNGA 3AC0A 3WF2A 1W99A 3C7EA 4RYDA 1R64A 5B4XA 3VDAA 3EYPA 2B4KA 1LNSA 2Y64A 3A22A 4DXRA 4DUWA 5IYYA 5IFPA 3OGSA 2J1EA 2PQSA 4OYUA 4M4RA 3W5MA 2W92A 2WABA 2DCJA 3OB8A 4YPJA 4P00B 4XZUG 2QQMA 4JKLA 1SDDB 2L9LA 3I2FA 2C4XA 3SEPA 1T2XA 2J7MA 2C26A 3FHQA 1SG3A 2YG0A 3MV11 5DMYA 4QX1A 4OMCA 5J1XA 5C70A 2VCBA 2W94A 3T0BA 2J1UA 5G05L 4CU8A 2WO1A 2XOMA 3T0DA 5FUIA 2ZEWA 3DECA 1SHWB 4MOAA 1OH4A 4JKMA 2CDPA 3C7FA 1H6YA 3HOBA 3T2PA 3CIHA 2JDAA 4GWIA 1UY0A 5DQ0A 1UY3A 2RVAA 3DYPA 3LEGA 4M4PA 5LA1A 3T2QA 2EIBA 3HNMA 1EUTA 1JYVA 4A45A 1CX1A 2J1AA 2YFUA 2ZEXA 2ZEZA 2VZUA 1D7PM 1DLCA 5JXGA 1UY1A 4A41A 3EB7A 2VC9A 4DUXA 1H6XA 3THCA 4DEVA 2VZQA 2VL4A 4A42A 1WCQA 3LPFA 4E8CA 4XURA 1JYXA 2V4VA 2RJ2A 3CDZB 1UX7A 4PF1A 4PQQA 3A7QA 2JKXA
chains in the Genus database with same CATH superfamily
2JDHA 2WNUC 1LOGA 5JXIA 1JHJA 2PHTA 3JB4C 1ZRFA 4LBJA 4LBNA 5A6QA 2HJIA 5FUNA 2QZ3A 5FZ7A 4QDSA 3WSOA 4QT6A 3UT0A 3NRUA 1H8VA 4Q26A 1LOCA 1RUC3 2Q1ZB 3J8F3 5FZOB 3VZKA 1MQTC 2LRPA 2VE1A 1FV3A 4KWLA 1XYOA 3AM2A 5EJZB 3MDPA 5FYCA 4AGRA 1E5IA 5BY5A 3KT4A 1BJQA 1XSQA 5IVYA 1EUUA 4I0AA 1RXGA 4V2WA 3ZFEA 2MEV1 2JDNA 3GCXA 1ZBE3 1DGRA 2GC2A 4LR4A 4JTOA 4FP2A 5FP4A 2P3YA 2F6BA 2GMEA 3WF1A 2GN3A 4FBFA 1NZCA 2VZSA 4MGZE 5FPLA 3VDCA 4EQVA 5A6YA 2QBXA 1D0GA 5G04L 5J09A 2WLQA 1UXXX 4LKEA 4MV2A 5CFDC 4RD7A 2V09A 2YY1A 1W6NA 1TG7A 1U12A 4N43A 2WNOA 2XDVA 4RQPC 1VBC1 1VBD2 1OUXA 3PUQA 1RINA 2NM1A 1H4GA 3POIA 3LE0A 3PTYA 3ME2A 3HBZA 5AVAA 1O3RA 1DHKB 2IXJA 4UFHA 1W2NA 1UMHA 3IIAA 3VBOC 5GM0A 3WW1A 2XUEA 2R6QA 2VZOA 4QPGB 3Q9OA 3VBRB 4K3UA 2J42A 4LA2A 4AQSA 5FJHA 1AL22 1CX4A 1R082 1ND3B 1UOBA 1VRBA 3TB0A 4BOWA 4ZY9A 4CCLA 5AC93 5F32A 5C9AA 1L3JA 4FAHA 4FTBA 3ZLIA 3KCCA 4DFSA 2UY8A 3LB9A 3K3NA 2Q8OA 3ZXDA 4QQOA 2JXAA 1T6BX 1LKNA 4FP3A 4NIIA 5CB7A 5A3LA 2ZACA 4YM0A 3GYDA 1CIYA 1IKQA 3RMXA 5C5TA 3ENRA 4F83A 5L7OC 2VNGA 2GH8A 5C3RA 1VBE1 4GULA 4CP1A 1GQPA 4OFGA 1S0BA 3U4XA 1LRHA 4LHKA 4XHBA 1TNRA 3GF6A 1QNWA 5IK8A 1YIPA 1PK6C 4RSUA 1Q8QA 1CAXA 4FTSA 4M3CA 4CDQC 1NG0A 3UYJA 1HXS1 4MADA 1AHSA 1CIWA 3MLKA 3VLBB 1VJ2A 3JCIA 3OD0A 1DP0A 3UESA 1OHFA 1JYCA 4BA6A 5A7WA 1YYNA 3AYDA 3MYXA 3PVEA 2HWC2 3WNXA 3CHXA 2GMMA 4MG2A 1UU4A 2VW1A 5JR7B 2WNVA 1RUH2 3T1MA 1JZ3A 1V6MA 3AXEA 3KVAA 4XF9A 1PVXA 3KT7A 1UIKA 4PLMA 3BU0A 3B9CA 2FDKA 2LS6A 1EP0A 1NLRA 1A8MA 2HWE1 1S4CA 3DPRB 3I2DA 4E8DA 2GC1A 3HPNA 4FO9A 4IUGA 1DQ4A 3SNMA 2BP6A 5C3QA 4LKFA 1W3VA 3K48A 1CQ9A 3UKVA 3TRSB 2G9FA 3U07A 4OUEA 3BIEA 2Q30A 1AR73 2DVBA 4TXWA 5H9SA 1HX6A 1COV3 3BODA 3V56A 5F1RA 1O5UA 1LHWA 2G9ZA 1HN0A 1RB8G 4LTAA 3OJBA 3URFA 2C6SA 4R9AA 4A7KA 2OQ7A 2WFF2 4OMDA 2YB7A 5GLZA 4NIDA 1UU6A 2A6YA 4CDWB 1ZBA1 5DUXA 1QJU3 3ZDSA 2GP3A 4EN8B 2ETEA 3S5AA 1IZ3A 1XE7A 5FXXA 4AI3A 2VUJA 2VQTA 4B8EA 2BBVA 4QQPA 3VUOA 2ID4A 4CP9A 4TYSA 3U37A 1M4WA 1QOSA 3IZOA 4MZUA 4RGGA 1MS1A 1ULDA 4DPNA 2VGDA 5C33A 5I0SA 1GANA 4CDUA 3ALQA 1J1TA 1DIWA 2YC4A 1NQDA 2VOVA 3BOPA 4NMIA 4TSVA 1VB4A 4QWNA 1FMD1 4DRRA 1QQP1 2W91A 3D5OA 4MXVA 1YQ6A 4B7KA 3FUOA 5IK5A 4Y4RA 4LHSA 1ULPA 3LDRA 1IG3A 1RUJ3 3B7MA 3AP5A 1FNZA 4S2HA 4HETA 4JTNA 3EBRA 3BTYA 2R041 2A3WA 1STMA 4D8MA 1P8JA 4K1ZA 1JYNA 4NJ4A 2ARXA 2EALA 1CAUB 2HWD2 3M3CA 4WBBA 1KFXL 1UY2A 4YNIA 5CU1A 3VD5A 3WX5A 3ACHA 4EN6B 1GICA 3RRDA 2AZ5A 4UI9L 5I0TA 5F7UA 4OHYA 4IXLA 1GUIA 4D7SA 1O4ZA 3N4MA 4XE9A 4OLLA 3VZOA 1OVSA 1H2LA 4DINB 3BU7A 2VCCA 3AJZA 1OH3A 3I59A 5C3PA 2EA7A 4AFMA 4C8DA 4IE4A 4Q0SA 3OTFA 1W6PA 4XJZA 3V0BB 3QOPA 4P5HA 2PQQA 3WT3A 2JIJA 1VMFA 1W6MA 3NJZA 3R6SA 3ZFGC 3W5NA 3KMHA 1ND2A 4RS5A 4PQ9A 3FLPA 1SCRA 4JGYA 2VVEA 1OKOA 2ARCA 4CEWC 4NPLA 3NJVA 3SXWA 3P3NA 3OUJA 2J1VA 3POJA 5L73A 2A6VA 3ZKUA 2PHFA 4KU7A 2ZX0A 3H3ZA 2XJPA 3SMHA 4Q4W3 2WYSA 4IW3A 3VBUA 3UGGA 1TMF2 3M8LA 5I0RA 2XQXA 5JUVA 4FPEA 4N7IA 5K7PA 2Z69A 2BJSA 5A7PA 4AI9A 1NXD1 4BLIA 3ZFFC 4QXCA 1ACCA 1BK1A 3GHNA 4FPGA 1X9PA 3IBMA 5H9PA 2XBO1 1NOVA 1GBGA 3WHUA 1VPHA 1C5IA 2O0OA 3W58A 1X9TA 2XMLA 1NCQA 2EXHA 1SPPA 4FXGB 1RUI3 2YHJA 4IV3A 4Z92B 2P17A 3N36A 3V64A 2JENA 1V6IA 2Q5TA 2ADDA 5F3CA 1ZZ8A 1IPKA 4AEDB 1ASJ2 1H8TB 1OURA 1R1ZA 2B9UA 1SDWA 1UWWA 4Y5SA 1W3XA 1CAWB 2WNUA 3OOXA 4MUVA 4S2GA 4BCUA 4EN9B 2VUDA 4XZPA 1GOFA 1O7FA 2WKKA 5FDBA 1I5PA 5EZWA 1JBCA 3P1IA 1BBT2 3J26N 1MQTA 3I2IA 4QB6A 1QJEA 1PX4A 2TBVA 2ZKLA 3BB6A 4Q4V2 1AYM3 3TEZA 3OGRA 4UBHA 3M3OA 4QPIB 5C8CC 1QNYA 1W8FA 1ODMA 4F3JA 4XJ8A 1PMJX 2DUOA 4L11A 3USUA 4H2AA 4UAPA 1V70A 3NV1A 4XCBA 1UOJA 3E97A 3N7JA 2ZAAA 1EAH1 1ZNPA 4P08A 1F5JA 5FZ4A 1JOPA 3U4SA 2FDIA 4FSJA 3POWA 1F4AA 1DG6A 3KHBA 2D6MA 2LTNA 2VW0A 4JRAA 3IWZA 2MPFA 1RUD2 3ZXJA 5A6ZA 2W87A 1CGPA 4BMBA 1W0NA 4Q8LA 4AFDA 1FOD1 4META 3J4UH 1MPXA 2R071 3H1WA 5ACA2 5FOBB 5LCWL 2VOXA 3GBWA 4QQLA 4AEJA 3WQ0A 3RZKA 4XIOA 4HKLA 2AEZA 3KV5A 3LEKA 5TSWA 2Z4FA 4HSJA 4HSLA 5JWPA 2XLFA 2GDFA 2UU8A 2V5DA 2NMOA 2Q1FA 4DIQA 3R4DB 2VY0A 4IV1C 1AL21 1N1SA 1YUDA 2Y33A 4UFIA 1C1LA 3DCQA 3IT8A 3OBAA 3CNAA 5FIXA 1EPWA 3HEIA 4LJHA 4XBLA 2P3KA 3IDCB 4LE3A 4MHUA 4EYUA 3HD8B 1YQ2A 3VHPA 4Q8KA 5DUUA 1UZYA 2PAKA 4WV8A 2XHKA 1BHGA 1XNKA 3LA2A 1RUC2 3LSDA 3J8F2 4YM2A 5HV0A 5EXOA 4KWKA 3RYRA 1NAEA 2IFWA 4CYDA 1AR63 1ONAA 3I2OA 4HK8A 2UYBA 3ETQA 5L7OA 3LAGA 3NWKA 3OY8B 1J3QA 2JE9A 1UMZA 1G7YA 2X5IC 4COUA 2JG8C 3WDYA 3C8XA 4UWDA 1JUHA 3JBG2 3SITA 3EMRA 1PK6A 3OEAA 4JGZB 1GP5A 2WWJA 3ETPA 2R063 2VUAA 3GJBA 4RN5A 4PI0A 4X8PA 4Y20A 1XQNA 4CDQA 2CY6A 5AFEA 1PMHX 5C70A 1D2SA 4Q4X1 3TBDA 4CCMA 3I3DA 1ULOA 3IB3A 4L9BA 1X8MA 3JQXA 5F5QA 4ONUA 2HWC1 2P3JA 3HN3A 4N7UA 4AFAA 4C1XA 4Z82A 2QQNA 3THPA 4Q27A 1AYN3 3O0WA 4CRQA 5CFCB 3FHIB 3MV01 4JDOA 1HV1A 1HRV3 4Y1UA 2VNVA 3POBA 4N53A 3H8RA 1W8WA 4E2QA 3AYCA 2HWF1 3I2JA 4QXHA 2Y6LA 3HJRA 2EIEA 5FXZA 4B3NA 2W47A 3RZLA 5HBAA 1LGBA 3FC0A 1JI6A 1XU2A 4FPJA 3ZXGA 5FKCA 4EE2A 5C71A 3U0ZA 2ZEYA 1PZ8A 4FPCA 1PO21 4NIHA 2R32A 4J25A 4LO5B 3AZXA 2DUQA 3VBHA 3U1XA 5AC92 5J96B 1QOOA 1ZYBA 3H8OA 2WFF1 4NE9A 4RQPB 1UKRA 2A3YA 4AFBA 1Q8VA 2ET1A 4YZ3A 4E2SA 2HYXA 3K2OA 3I2GA 2VECA 5FXWA 4K21A 5BNPA 2VZ3A 2YYOA 1UYPA 1W8HA 1OFNA 1RIRA 4QPGC 4XJUA 4E2GA 3AFGA 3VBRC 1ZVFA 2RMU3 4XYXA 2EF6A 2VH9A 2NZ9A 2K0GA 2O8OA 1ND3C 5I8SA 3MLLA 1FX5A 3UGFA 5FZBA 5A7NA 4RYDA 2YMZA 5I8TA 2RDRA 4XILA 1R64A 1WA6X 1WWYA 2WLPA 1YRZA 1JHNA 1LNSA 3NV3A 1ZZ7A 4DXRA 2IC1A 4XF3A 4Z07A 3OGSA 4R9CA 3UKTA 3WNLA 5DZFA 4NO4A 4YGCA 3O1RA 3AMMA 3KCXA 5JMCA 2J1EA 3MHZA 3ZIWA 1C8M2 5A32A 4M4RA 4M01A 1W39A 4QM9A 2P5BA 1GWLA 2HWD1 4OI4A 2AACA 1RXFA 2IXKA 2WABA 3A4UA 3KB5A 4GKYA 2R49A 2IVIB 3WY6A 4MVTA 2QQMA 3LD8A 2Y6FA 3IPVB 4Y1YA 4GB33 3TN91 1XYPA 1ZA7A 4JKLA 4YW6A 4PF5A 1AR72 3RPQA 1COV2 5IAXA 4AGGA 1T2XA 2ZGUA 3AP7A 5FK8A 4GA9A 1Q3EA 4J6GA 5D8AB 3PTRB 1VRH3 3FHQA 2UURA 3EJKA 5A33A 4KGQA 1KFUL 2KXLA 4IEQA 4KBBA 1RVF2 2P2KA 1X82A 3DPRC 4NAOA 1YFYA 1S0EA 3OPWA 5EHDA 2B42B 3SHRA 4MSVA 3ES4A 3ZFGA 1XYNA 3ZYRA 5E16A 5C3SA 5LW9A 4LHLA 1MZ6A 1QJU2 4WZFA 2BOJA 1SFNA 5CKQA 2WO1A 2XOMA 1O3QA 3UJOA 3KF3A 5FUIA 5FZKA 2BEOA 2ZEWA 3OBTA 3B93A 1DDLA 4IEWA 3MW2A 3Q8FA 4JHTA 2WS93 3PIGA 5LB6A 4YZ1A 1QJZA 1H6YA 4JRLA 5GLVA 3QH7A 3M3QA 5J48A 1KQRA 1W0OA 2VVFA 4LORA 5BYNA 2XL7A 1NT0A 1VBB1 2A6ZA 4GWIA 4MGTA 3ZFFA 5DQ0A 5FQ0A 1UY3A 2ZHKA 1JODA 3LZZA 5FZIA 3ZMNA 4CDWC 3LEGA 4EROA 4XC9A 5JZGB 2PHRA 3RNSA 3ZSJA 1OQ1A 4U36A 1SEFA 1V00A 4A45A 1UZWA 1CX1A 2Q8CA 4BIOA 2YFUA 2XUMA 1OQEA 4BQYA 1D7PM 4HONA 1ZZ6A 4A41A 4YRDA 1XJAA 2VPVA 2XWJB 4NPRA 2VC9A 5L36A 4DUXA 2QZ2A 3AP9A 4IESA 1DZQA 2H6BA 2BWCA 3NKGA 3P3PA 3CBNA 3OGGA 1FPN3 2GU9A 1BBT1 2NLRA 2A75A 2VW2A 4EZ4A 2V4VA 2RJ2A 4XMAA 4OUSA 2FD8A 3BUCA 3PVBB 5GZDA 3A7QA 1LCLA 2JKXA 3APBA 1O8PA 3MICA 4Q0UA 3POYA 2PLV3 1OLME 3WEZA 2D6LX 1Q56A 3V0AB 1WBLA 4YW5A 1UIJA 3POSA 3RZZA 2W95A 4ATEA 2BUKA 1LU1A 3VGIA 2WBKA 3WR0A 4TLFA 3DYMA 4N8MA 2Q0AA 1RUF3 2RS53 5FREA 2JDMA 4Y5TA 2QFEA 1QJFA 2X10A 5CBLA 3VZJA 1GOHA 4GH4B 1K12A 1RHI1 4I3PA 4LOTA 4QU2A 5JOZA 1RUD1 2P4EA 2GMPA 4XBQA 2RR11 1J59A 4IQPA 4XVHA 2IWGB 2RS13 4B4PA 1MEC3 4QQ2A 4XJAA 1W9SA 5T5JA 3RG0A 2EAAA 4E4ZA 4HN0A 1MR5A 1PGL1 3UKNA 3DL3A 1AVBA 1UU5A 2OZJA 5FZHA 1OFSA 4BHPA 2JEMA 2OVUA 2E63A 1RUNA 4P14A 2WT1A 3O5SA 1OPMA 1WW5A 1D4M3 4IV1A 5FY0A 1U5YA 5GLUA 4QXKA 5FK7A 3RI8A 2VR4A 3JD73 5DN2A 3E1F1 4R8HA 2JDPA 1YNAA 3U10A 1W8OA 2DVAA 3GGLA 5E89A 3U75A 2NMNA 5C6CA 1WA4A 3WNOA 3IM0A 3F2ZA 5HCBA 1Z7S1 2Y38A 2YPDA 4ZXKA 1QJY3 3VBFA 2R1BA 4LE4A 1AYM2 5FZLA 2VVDA 3RVHA 1K42A 4WM8B 1GU3A 3MW4A 3KD4A 1G8WA 1URXA 3HBKA 4YGDA 4YW1A 2ZGTA 3ZMOA 3LCPA 2X5IA 5LEJA 2WNEA 2JG8A 4AEDC 2VBPA 1H8TC 2KM2A 3FZ3A 3JBG1 4D7TA 3KSCA 4B29A 1GNHA 1LTEA 1R093 4HKOA 5DDJ1 3C3VA 4HOOA 4MLOA 5KXEA 5LA0A 2QQIA 5F5AA 3VZLA 1JYIA 3T2TA 3MW3A 2B9VA 4AAXA 3N9NA 3ZSLA 5FZOA 5CAZA 5C4WA 2VCMA 4CSWA 4RFRB 1VLNA 1LOFC 2VUCA 1JOBA 4P9LA 1WMEA 4C0BA 1XXNA 2HBUA 4QPIC 3ACGA 3KVBA 1LHOA 3K3OA 5K0UB 5FR3A 3IKWA 3OPZA 1H1IA 1PO12 1DGRN 2WZEA 4L0PA 2HBTA 2GNTA 3GHMA 4NVPA 1K5MB 4A6SA 5JMOA 2A71A 1UNBA 5B2GB 2IXCA 3E5XA 4XUNA 1UZ0A 5F39A 2V72A 2FDFA 4D69A 2EXKA 4BH9A 3JZVA 2XKOA 1OLQA 3UGHA 1HV0A 4OQ9A 2JG9B 3HQRA 5AC91 2EXIA 2D6OX 2IXHA 1OOPB 1DGLA 4ARYA 1JYWA 1KS4A 5FP7A 3SQOA 3GZUC 1EV12 5CG9A 4YVSB 1BMV2 1O4TA 4A7YA 1HIXA 2VBBA 5A70A 1HB3A 2I2SA 1RUG2 1AR62 4QPGA 4XPVA 5KC5A 3FFQA 2PFWA 2EXJA 4YM1A 5FY5A 4DY3A 3FLTA 2Y0IA 5CKMA 2E6VA 4KBZA 4JC1A 1RTVA 3IMNA 2XONA 5F2WA 2JDUA 4AHXA 1YLLA 3GCWA 3SKJE 1YQ8A 2YBSA 4AVBA 2R062 2VZPA 3PJQA 5F2SA 4KGGA 4LT5A 2SLIA 4ATFA 1NLQA 2Z5WA 4BK4A 4NIGA 4UW4A 1AR93 4WM7B 4SLIA 2WN2A 1J1LA 2BGPA 2XLGA 4UYBA 1N3PA 2ZAHA 4FT8A 1BEV3 1WW6A 3HNYM 4Y22A 1SFPA 3KWVA 4FFFA 1KEXA 2UY9A 2ZA9A 4ISRA 3ZYGA 4E9KA 3UNPA 1K45A 1C8M1 1GWKA 3NJYA 5FY4A 3VKLA 2WSUA 4JV4A 2G1MA 2E7AA 4GWNA 5FZDA 2VMEA 5FMOL 1POV3 4OQ8A 1L7QA 1NCRA 1XE0A 3AVRA 4I0BA 4JGZC 4Q4Y2 1E5SA 1W9FA 3B5LB 1Q8SA 4BU2A 4AR2A 1MZEA 5DG2A 1JZ2A 5FY8A 1VB2A 3H7YA 1LU2A 5IVCA 5B4NA 2J22A 4FPLA 1KS5A 1HRI3 2RJLA 2WA3A 2XGXA 4JKKA 4LBKA 4QD2A 3RYPA 2WINB 3WW3A 2D3RA 5CFCC 1TQ5A 4A3ZA 3PUAA 3H3LA 4BQ3A 1TZOA 3IAPA 4LMFA 5FRAA 1QY4A 1RVF1 2A6WA 3DPRA 4CCDA 1V9U3 1VE0A 3D6EA 1JZ4A 1GP4A 2XR4A 2DDUA 4DXZA 3FFZA 2BYVE 3ZYHA 2RMU2 2D6NA 3QACA 4LBLA 1YEWA 3AKPA 3AL5A 5L9RA 1UPIA 4COZA 2RS31 4ZZ5A 2B8MA 1VALA 4U2AA 2E7QA 3HNBM 3ST7A 1CAVB 1PIV3 3PHMA 3RZHA 1HJFA 2DFCA 4Q2FA 1G9FA 2VCAA 1S2BA 2CL2A 1XNCA 4GMP3 3WDVA 2CSGA 3GZAA 1AR83 1YO8A 4XDPA 3E6CC 5D1IA 2VU9A 4AHWA 1OT5A 4IGOA 4RA0A 4IGPA 2DCTA 3CO2A 4RHV3 1AXYA 3ZYJB 4XUQA 4YZ2A 2WO7A 2VQUA 1UY4A 5EIYB 5KXDA 3V65A 1UKGA 3AX4A 1UD1A 2WO3A 4QAWA 4PT6A 5A3NA 2H0BA 2O1QA 4A4AA 3AJYA 1XNAA 4YSFA 1US3A 4DQAA 2FDJA 3B69A 1VRH2 1OD3A 5JOYA 2AENA 5HI0A 3BGAA 1CAUA 2R16A 3OPTA 4R52A 5T50A 4BQ1A 1GNZA 5GJ6A 5T52A 2OKXA 5T5OA 2DBIA 4DZGA 1SLTA 3ZXKA 3OBRA 4GWJA 4KL1A 1UL9A 4JX0A 4I30A 4NHYA 1O3TA 4JQTA 3GBFA 2HLEA 2IVJA 1WBFA 3M2MA 3OGVA 2WS92 4W50A 3WP4A 3PU3A 3VKFC 4UF0A 1K3IA 5D8AC 2V5YA 2DF7A 5KBFA 3ZIXA 3GZEA 4LBQB 3V0BA 1UF2C 2YXSA 2Z79A 4MX3A 1W2TA 1B35A 4Z2AA 4O9EA 2BTVC 2ERFA 3KF5A 2OW4A 4AG4A 2GNBA 4HT1T 4AFCA 2UWAA 5C3OA 5E8AA 2GNDA 3MO4A 4YW2A 1OKQA 5A80A 1O3SA 3BOWA 4I01A 2NN8A 1SLBA 2QQPA 1RJ7A 1VMHA 1YIFA 4AL9A 1OSGA 3CZUA 1QF3A 3ORJA 1J84A 4NIAA 2OA2A 4RR3A 3MFCA 2R30A 4DNYA 3NNFA 4BZ4A 3MIEA 3AVSA 5DABA 4BQ4A 4Y1VA 5KWRA 3WG2A 1PVC3 3KHCA 5FP3A 2FQPA 1FPN2 4DO0A 5JZGC 1CD3G 4CE8A 1IQDC 4WVVA 4LOSA 3MEPA 1JZ8A 3QD6A 2C9AA 4GQ7A 5DZEA 3J7HA 2ZX4A 4XFHA 4K1YA 5JSRA 2VZRA 4NOTA 1VBA2 5FYVA 1RUOA 3Q8CA 1ZRCA 2QVSB 4FPYA 5FYSA 5DG1A 4AEDA 3MIHA 1H8TA 2ARBA 2PHLA 1W6OB 3X29B 1W8ZA 3C7OA 1YFXA 3N9QA 3BTZA 1CAWA 2IXLA 1Y9QA 2WFPA 1NA1A 2JE7A 4XFBA 2ZGQA 1E57A 3WUDA 1G6NA 2AC1A 2PHXA 4EZHA 4XABA 2ZGSA 5IVFA 3BPZA 1RUF2 2MEV3 2RS52 4XQDA 5FP8A 4K40A 4FPKA 3CJXA 2WIIB 5ERLA 4EWEA 4CCNA 1JZ7A 3THTA 4D6RA 4LBOA 2JD9A 4ZXEA 1G9DA 4QPIA 4L8QA 1OF4A 5FPZA 3AYAA 2QQUA 4HFSA 3ACFA 1DLLA 1VP6A 2W52A 1MEC2 4YVWB 5JXJA 3BKZA 4JDNA 1PO11 1AX0A 3AL6A 2Q4SA 3AP4A 3E5QA 5JSOA 1US2A 3KZ4C 2R0FA 1YJKA 1GZWB 5ABJA 1WW4A 2QDRA 1QMJA 2TEPA 2UYAA 4IEYA 1VBC3 4FTEA 4COWA 1PNFA 3NSTA 5FPXA 1D4M2 4IDZA 4CCKA 3N35A 3VD9A 2WZR2 2HEYF 4GH4C 4AI8A 4DY5A 1QJX2 2VJXA 3O1VA 4WVWA 1S2KA 5FZMA 1FXZA 2X05A 1EV11 2Y6JA 2DCKA 3I3EA 5CVRA 1BMV1 5JAXA 4MGQA 4URTA 2ZCWA 1RL3A 5GZFA 3N9OA 3SCHA 1QJY2 1RUG1 4L97A 1CAXB 2K9ZA 4XTMA 5SV5A 4QDRA 4AW7A 4O61A 2P37A 4JVAA 2OS2A 5BNNB 4JCKA 4XTPA 4IL7A 5FZ6A 4QKDA 5CIRA 1W8NA 2ES3A 2AH2A 3NL1A 3C7GA 1VBE3 1EYBA 2D5HA 3HQXA 1EPZA 3WXPA 4A3XA 1HB2A 1N47A 1DQ0A 4XW3A 1SCSA 4Q1RA 4R4ZA 3W59A 3LSEA 2XJVA 4D7YA 2ZX1A 2E51A 3I49A 1HXS3 4FOWA 4WM8C 3WHTA 3WW4A 3OY8A 3QLQA 1S1AA 3N9PA 2W39A 2WRAA 1APNA 1NLSA 1YQCA 5H9QA 5KXCA 3D8CA 5FYIA 5B4XA 3NW4A 3RYKA 4JGZA 4Q4Y1 4AAPA 3KLSA 3A22A 5KHGA 1RUE3 4DUWA 2OT7A 5IYYA 3GNEA 2PYTA 3M4FA 2VMIA 4Y33A 3HT1A 1UZZA 2BFUL 2VULA 3MF6A 2QNKA 1MACA 2PQSA 4R9BA 5JCTA 2W92A 2ZHNA 5CFCA 4N90A 3KV4A 3S57A 3WZ1A 2ZTNA 3AB0A 3I3QA 5FMOS 5K0UC 1V6LA 1BCXA 4XZUG 4AOCA 4CP9B 2BNOA 2BU9A 2L9LA 2NQYA 3L9JT 3SEPA 1K5MC 4PDWB 2XH6A 2HKXA 4XFGA 2C26A 3GBGA 3MIGA 2WQZC 4OZXA 2VD7A 2WL1A 2XVKA 5DMYA 4XEZA 5CFDA 4QX1A 5FYMA 1ZBA3 4OMCA 2JG9C 3M3IA 2F17A 2QUOA 4IE0A 1SLIA 3HN1A 4XMIA 2ZPXA 4P9XA 4RQPA 1QEXA 1OOPC 1VBD1 2DVFA 3NMBA 5T54A 4CP2A 1PHMA 2J1UA 4YVSC 2LALA 1JTZX 1V0AA 4BQ5A 4TLGA 1F8VA 4W65A 3PVOA 3VBOA 1WMFA 2K2SA 2WZPP 2I45A 2H0VA 1YHFA 1RGSA 2A73B 1OMIA 4JKMA 1FMD3 5DAVA 4AVTA 4URAA 2XPJA 3ZXFA 5KR7A 4XXAA 1R081 3BTAA 3CIHA 3H8XA 1NE4A 3RZJA 3PNAA 4UW3A 2YBPA 1V6KA 3T4VA 1DQ2A 2C0ZA 4LIUA 2BNNA 3VB9A 1X7NA 4LLOA 1IQAA 1OA3A 2R043 2XKPA 4S2DA 5SV8A 4WM7C 5DUWA 4LO8A 5I0UA 5A1FA 3HNMA 3MI8A 1IPSA 2Y0OA 5IVEA 3G7DA 4RS5B 3TNQA 1HW5A 4QKBA 2ZEZA 1XNBA 2G9GA 1WLDA 5JXGA 4YFZA 3RMYA 1V9U2 2CYFA 4K7JA 3EO6A 4NAMA 1N3OA 1UZVA 1H6XA 1ZBE2 5FJKA 5FTTC 2XG3A 3VBSB 1H2KA 3AMQA 1OA2A 2VL4A 3J9SA 4A42A 3BALA 4XBNA 4EN7B 2OPWA 1Y4WA 2VG9A 1JYXA 2IUWA 1AL0G 5CNAA 1PIV2 1UX7A 3CDZB 3O0VA 4PF1A 4PQQA 5D8AA 1RUH1 5A3TA 3RJ2X 1UX6A 2W68A 5LK5A 4JHZA 1YFWA 2HWB3 1DCSA 3J7MA 4GJYA 3H8UA 3RSJA 1H2NA 1QXJA 5T5PA 3NO8A 1GSLA 2XB6C 1ENSA 3OEBA 3KQRA 4HMZA 4IEPA 4D6QA 3FLRA 3S0MA 2YFZA 2Z2SB 4G4FA 4NPMA 4LIVA 3WCSA 3VL9A 1WCKA 2PMWB 3WVJA 3ZN6B 1GYKA 2ZZQA 4XAEA 4XDQA 5LY2A 4IEZA 2XBO3 2UWCA 1IGOA 3PVNA 5FZGA 4LNVA 1WGPA 2J1SA 5A1AA 1LR5A 3IIIA 5LZ6A 3UETA 2P1BA 1AXZA 3K75B 5BXXA 2B39A 1XC6A 1SLCA 1YQ5A 5JIAA 3RQ0A 2BWAA 4COYA 3USSA 3OG2A 3AP6A 5JZGA 1GZTA 3IDEA 5FY7A 2O14A 3BYWA 4KG0A 4Z2WA 1NYWA 1A34A 2OX0A 2A7AA 2ILMA 5IJRA 4BK5A 5IVBA 4UFLA 4X6QB 1U5XA 1B09A 3K46A 4KWJA 1VBA1 2FCUA 5FLJA 1GOGA 3OF1A 4HVRA 3GALA 5IUQA 4DEQA 1X33A 3O1TA 4XUOA 1DQ1A 4QHBA 3B9IA 1PZ9A 4M3CF 2G4IA 4YARA 4N9IA 1PMIA 2XLAA 5IK7A 2PAMA 4HPKB 4IEOA 4L2NA 3JUUA 1DU3D 4LK7A 4MXWB 1H2MA 1QWRA 4XQ4A 4BJ0A 3KS7A 3N7KA 1PGW2 4XIKA 5J98B 4EJRA 2D44A 3JQWA 3VD4A 1UOGA 4DXSA 1WLCA 3J7LA 1EAH3 4BPZA 3TAYA 4MGYE 4V2VA 3WQBA 3T4HB 5F6LB 1KD7A 3N7LA 4JDMA 1QHDA 3RZMA 2ZMKA 1K5JA 1R1A3 1UMIA 3FX3A 1F2NA 1NX9A 2W1WA 3KM5A 2CU5A 2OPKA 3U14A 3UV9A 3SH4A 2DU0A 2C24A 2JX9A 5CADA 1XNTA 3LWCA 5FYBA 1FOD3 3ZPYA 4F8AA 3LOBA 1HB4A 2R073 3AMHA 2D6KA 4LO4B 3GJAA 2WZR1 4NRMA 4GH4A 4AXOA 1QJX1 2RM23 3AKRA 4E27A 2ORZA 1S0DA 1JZ6A 4LO7A 1PVC2 2ZX2A 3WP6A 1RMU3 4CVUA 3ZSEA 2ZHMA 3LFMA 3I97A 1X36A 4AI1A 1DQ6A 2ENRA 2X09A 3I3BA 5LRSA 4Y20B 3WDUA 4CEWA 4K8RB 2CGOA 5GLTA 2J1RA 4YG0A 2VM9A 1AUYA 4RFT0 2GZWA 4FOYA 1ULGA 1TMF1 1BYHA 3O1OA 2D98A 2JDZA 3CL1A 3H9AA 2Y6GA 4CU9A 5FLHA 3DN7A 5FAXA 4PJYA 3DYOA 5IT6A 2ZZJA 4BQXA 2J1TA 2W5FA 4N53B 5DPNA 2K46A 5J7MA 1OXCA 2BDRA 3POEA 2MEV2 4Y3OA 1HN1A 2OIIA 1RUJ2 4YLZA 4W8JA 5EYXA 4N9HA 3OYWB 3LDKA 3D0JA 3DUIA 3LIHA 3WD5A 4BXSV 1LECA 1TVGA 1MS3A 4WM8A 3ZOIA 4BDVB 4Q4X3 3LA7A 5JVVA 2VXRA 2I07B 1HQNA 4E4HA 1PM4A 1ASJ1 2BZDA 3M7AA 2HWC3 4GXLA 1U5IA 1WCSA 3ACIA 2YUEA 5A7SA 3VBHB 3SEEA 3N9LA 3D4KA 1AJKA 1VBC2 1GZ9A 3DXUA 1IHMA 1NUKA 1XBFA 4KNCA 1ENQA 4M3CE 5KHIA 2HWF3 5BNPB 4Q4V1 5GLWA 5F8PA 2ZS6B 4M0HA 4NR1A 4YW3A 5C8CA 2ZOEB 1ZX5A 3D82A 3NNLA 5K0UA 1FATA 1PO23 2Y26A 1O8SA 5DUVA 4YVWC 2DUPA 3R05A 2QCSB 5IAVA 1DF0A 4YGEA 3WDWA 2JIGA 1W90A 3JU9A 4PBOA 4BQ2A 2W1SA 5K9YA 1HQLA 3MPBA 3POGA 4P02B 2WFF3 1I6XA 1RC6A 2BFUS 4B7EA 1REEA 5LA9A 4BMEA 1H1MA 3CQOA 1UCXA 1W8TA 3BIWE 4MYEA 4Q4W2 1SZBA 1SACA 4P9YA 1G9CA 1A3KA 5HCHA 2JG9A 4QX8A 1CESA 4M0NA 5F3GA 3RFRA 4AI0A 2JECA 5HXMA 1OOPA 3ZO0B 3LEMA 4I02A 3MIDA 4YVSA 2XJUA 3O1MA 1FAYA 5ACA1 1HJGA 3VHNA 4Y4YA 4NWWA 5F37A 3FN9A 1ZZ9A 3NAPB 4LULA 2VQAA 1UYXA 5EYYA 2YROA 1POV0 1RUI2 5F3EA 5BNNC 1FT9A 1GP6A 2KD7A 5LA2A 3SCGA 3U11A 5HPOA 5J36A 3B3QE 4Q0QA 2CGNA 1C5HA 1ULCA 2W9XA 4ITCA 1GWMA 3GXUA 1W8UA 1WCUA 5T55A 3RS6A 1RUE2 3KV9A 2D43A 3NV4A 4ZPIA 4WM7A 3T1LA 1LOBA 1HDKA 1RUC1 2HWD3 3J8F1 1NQJA 4IE6A 4J1XA 4PCRA 2NPIA 4AHYA 3H1MA 1DZRA 4CTEA 1W6QB 3LFIA 3TN93 5HXVA 2QE3A 4HVOA 2XL9A 4A44A 1PNGA 1IOAA 3K4DA 2VMDA 2XXZA 4PIZA 1CPNA 4IE5A 4R9DA 2F4PA 3O0XA 1ZBE1 2D97A 4HG6B 1UW8A 2VOTA 2FDHA 2XJSA 5L19A 3S5QA 3CKHA 1TME3 4RGKA 2LW8A 5DAXA 4AQ2A 3LF7A 3OBZA 4GMP0 3WF0A 3FWEA 2BNMA 3NNMA 1PIV1 2Y60A 1ZBA2 5FPAA 5IWFA 4RL7A 4TZDA 4CUCA 4QPYA 3E5UA 4AEMA 5I8YA 1HLCA 3VKNA 1I3HA 2GC3A 5FOJB 3S7EA 2W0XA 4X6RB 3RZGA 4HK9A 4G3YC 2JB8A 3WOGA 4QX2A 1QIQA 2W46A 2Y6HA 1NE6A 3AZWA 3T0AA 2QQOA 3NKTA 4PDWC 4KMQA 2GH2A 2E26A 2EIGA 2JICA 2WZ8A 1Q43A 2ZJCA 3CMGA 4GD4A 4AF9A 1VBB3 2WYFA 4GZ9A 1FMD2 5A3UA 4AZZA 4MH0E 4D0QA 5T5LA 4EWDA 3K51A 1W2AX 1WLWA 1QGLA 4OZOA 3A0NA 4NHLA 1Y9GA 4DUVA 1YI9A 5LBCA 3ACLA 1ZREA 2IFRA 1W0PA 1L7LA 1XU1A 2B46X 3TEXA 3T3YA 1OD5A 2CAUA 4GALA 4AI2A 2BQPA 2GAUA 2MNGA 4CEYB 3PL0A 4NRPA 4H3WA 2BGCA 4MO3M 5IK4A 5JPMB 1BQPA 1QOTA 2W1QA 3KGLA 4A7ZA 4CXYA 3VBRA 1W9WA 2WN3A 4XDOA 4AWDA 4XF0A 1SMVA 1C1FA 3M70A 4QKNA 1ZZCA 3GM8A 3SH5A 4BB3A 1ND3A 1QU0A 1LOAA 2ZXQA 1H9WA 1YI7A 1JS9A 1BBT3 1S0CA 1SBFA 3CJIB 1WUVA 5FKBA 2DURA 4GIQA 1CZSA 2CWMA 2OXBA 2DFBA 3HVDA 5A1LA 3WUCA 1CN1A 1WLTA 2YGLA 3VV1A 1GR3A 2VOWA 4OI0A 2P6HA 4RS5C 3EQEA 1J3RA 5A6XA 1BKZA 3SCFA 2VZTA 2W1UA 4Y1ZA 4LQRA 1AYN2 3NVCA 4PLNA 1N1VA 1RJ8A 2VNOA 2XJQA 2ZHLA 2CGPA 1PGW1 2HWB2 1HRV2 1XB9A 1XPWA 3ZN4A 3DF0A 3WF4A 3ZXAC 2VTFA 3VBSC 5JDBA 3WNMA 3AYEA 2QTWB 2ZABA 1JMUB 2RG4A 4XFFA 3RWNA 3VD7A 1IG0A 4HKWA 5FBJA 1RHI3 2VMFA 3THDA 4FPOB 4UFKA 1AR71 1DYPA 1OLRA 5FO8B 1COV1 2RR13 4K8FA 4XF4A 3P6BA 1LESA 4BQWA 4F7ZA 4HL0A 3PUIA 4YG3A 3RDIA 1LGNA 2XBO2 5FYTA 4CDXB 5C7GA 4H14A 4NRQA 4G9SB 2OQ6A 1GNYA 3VBFB 3E6DA 1IS3A 3CZJA 5LBEA 4LBQA 3G6JB 1JW6A 1PVC1 2XHNA 4W4ZA 5FYHA 1REDA 5FZ9A 5A3WA 3WCRA 2E9QA 4LLFA 3FBMA 4QHOA 5LASA 1DGWA 2LUWA 5EV7A 1QJU1 4CU6A 4MGSA 3DEMA 2FCTA 1YJLA 3IDAA 3RGBA 2ADEA 1QH7A 2BPA2 2WQ8A 3B02A 1F15A 3FHAA 3O12A 5C4WB 2WC2A 4PI2A 1ZA4A 2X8KA 1Z7S3 3AZZA 4ZS3A 4ZU4A 1NZIA 1SLAA 1JU3A 3GDBA 3ZN5A 1ZM1A 2FCVA 5F5CA 5J37A 1MS9A 4R4XA 4DOUA 2WAAA 3RWKX 3LGRA 2Q8EA 3KGZA 4CDWA 4B4RA 2C5DA 4OCTA 5BNQA 1RUJ1 3JBG3 2CNAA 4ARXA 3WQ7A 4W6YA 1ULFA 1WMDA 3FJSA 5DDJ3 1EY2A 3L2HA 5CA6A 3TEWA 1EAH2 1V6NA 1GFF2 4QGMA 1W2UA 3IDBB 4A2UA 5JIUA 2FDGA 1W6OA 2FMYA 2XVLA 1Z78A 3KCYA 1JXNA 1R1A2 1ZZBA 1KJLA 4L92A 4XUPA 4GB32 1OQDA 4NHMA 5DAQA 1XSRA 2AGSA 1FOD2 3S6PA 2R072 4IE7A 4YWAA 1Q8OA 3C7EA 5K8SA 3R0RA 5ANNA 4ZONA 2RDSA 4D94A 1XRUA 2RM22 4H7MA 3VDAA 3W20A 3S30A 2JJ6A 4FVVA 1RMU2 5FPUA 3VDDB 2B4KA 4HZFA 2Y64A 3WV6A 3ZSMA 5IFPA 1QDCA 4YVWA 2DTYA 4YG6A 3TWIA 5FMCA 5FZ3A 2P6CA 1GZWA 3T30A 4X8NA 1WZXA 2AUYA 4Y1XA 2BVBA 1XNDA 2Q1MA 3TNPB 4OYUA 5GZEA 3W5MA 2WWSA 3ELNA 4WVMB 5KC6A 3SISA 4Q4W1 5L9VA 3WG3A 1FNYA 5FPVA 4FPFA 1ZRRA 3N3HA 3W9AA 3DV8A 2JDKA 4WVZA 4Y22B 2FZ2A 4B1LA 3ITQA 1NXMA 4ASKA 1IS4A 3TOJA 1KRIA 1E5HA 4CCOA 4LUMA 1A8DA 2C4XA 5JSPA 1CJPA 2GSYA 2J7MA 2YV8A 4QU1A 3H7JA 1NCRB 4QXBA 1Q5OA 1YXWA 3LDBA 4OHZA 3UL2A 1BVVA 1SG3A 3INAA 1RUI1 3MV11 5C8WA 1VAMA 2EAKA 5BNNA 4Q4X2 4Y24A 3ILRA 4C91A 3CU7A 1BZWA 5BPXA 1OA4A 1C57A 2W94A 3EHKA 1J58A 1KITA 1OLMA 1RUE1 4Q29A 4Q5OA 5G05L 3T0BA 3T0DA 4JQRA 3OUHA 1W9YA 4N53C 3FBYA 1C8M3 4LBQD 3WG4A 1DGWX 1SHWB 3MZHA 1ULEA 1OH4A 3ZFEB 2HWF2 2D3PA 2CDPA 3C7FA 1BLZA 1WMXA 4AGVA 1AYM1 2LROA 1CPMA 4DRVA 2W08A 5APAA 5LK7B 3VZMA 4XAAA 1UY0A 2YPJA 4BWOA 5F6KA 1PO22 2PLV2 2AEYA 5ANQA 2RVAA 5LA1A 4QX7A 3AZYA 3B00A 3VBHC 1W6NB 2EIBA 1EUTA 4N43B 2D93A 1JYVA 3ZX7A 1VIWB 4QMAA 1Y9MA 1RVF3 2WQ4A 2ZMNA 4C90A 2DVGA 5BNPC 2E7TA 1W06A 5LEKA 2LM3A 3ES1A 1DLCA 1GV9A 1KDKA 1LOFA 3MF9A 3N9MA 1VR3A 3EB7A 3VKOA 1W2OA 3AK0A 5J3UA 1W03A 4ASMB 2VZQA 1MVQA 3OCPA 5BNOC 1MS8A 4PIYA 2RS33 2RS12 3ZXEA 1WCQA 4IEUA 5DAPA 1O91A 2NYYA 4O9GA 1MS0A 4PDWA 5C9AB 1H4HA 3P5BA 2WSVA 2AYHA 4K6BA 1SQ4A 1CJDA 3VN4A 3WP3A 2A70A 1OC1A 1W04A 1S0GA 2ZGNA 4GAZA 5GKAC 1AJOA 2D7FA 1C8NA 3LIGA 4W6WA 2ARAA 2OUJA 4P9JA 3VD3A 5KHJA 3A21A 4HANA 3GZTB 4GWMA 3ZM8A 2NP0A 3LPGA 2CWSA 3JD72 2VQ0A 2EIDA 3LKJA 2FMDA 4BM8A 1G86A 5EQUA 1DYKA 4H7LA 1FYUA 2WO2A 4P5YA 3NAPC 1KJRA 4XFCA 1AR61 4D3WA 1MZ5A 4KI5M 4M3CB 4ES8A 5CZKA 3TN92 4QB2A 1SLLA 1LGCA 3J7NA 5F3IA 4XCAA 4ZHNA 2QQVA 2ZGMA 3PMEA 4DB5A 3OSDA 4BLJA 5A7WB 1Y3TA 3R4SA 2D3SA 4UF0B 5DXDA 1HB1A 2R061 2WNVB 4UW5A 1R092 4AVCA 1A78A 5EWSA 5A7QA 5C5UA 5T3NA 2BVVA 2VNRA 1TME2 5E6HA 2OZ6A 5EJ1B 4YM3A 1B35B 2HH9A 4FFIA 4LK6A 4KQ7A 3MBWA 5JR2A 1OI6A 2R7EB 5JXHA 2DCZA 1ENRA 1AYN1 1LULA 2BV4A 2G19A 3PURA 4UT5A 1HRV1 2HWB1 2VTXA 1CZTA 3Q8BA 3MGUA 3CF6E 4NHKA 3ECQA 3HIFA 5FXVA 3POFA 3W21A 1LHNA 4AQ6A 4O65A 1RITA 3VBSA 4J1WA 3T08A 2VZVA 1QXRA 4RR3B 1LEMA 4LPLA 2R0HA 4YW7A 1I1EA 4K20A 4QPWA 1VBB2 3K4AA 1LB2A 4ZU7A 2BGOA 5I93A 4V1PA 1W9TA 2JE8A 2VAUA 2HWE3 1JUIA 3H42B 1AZDA 3I2KA 4MHRA 3QH6A 4HBNA 4DXTA 3SH3A 4E4SA 2FZ1A 2ZGLA 2YC0A 2IZWA 4Q0PA 1X8EA 4QDQA 1S2EA 1UQXA 1KGYA 2WA4A 2YC2A 1H30A 5E88A 4HN1A 4QGNA 3BPSA 3WQ1A 2WT2A 1UPSA 3H3UA 2BERA 3FMGA 4B1MA 1T6GC 2R1DA 4CDUB 1BVP1 3M1HA 1NKGA 1LEDA 2WAOA 2Y8KA 4I0WB 5BNOB 1O5LA 3O1UA 1NA1B 4CCEA 1DBNA 2RMU1 2ZGOA 1D0HA 1WD4A 3L2YA 1SFYA 3ZN6A 5KHHA 4AVSA 3ON7A 1RYYA 4Q1PA 3QBQA 4OVEA 2RJKA 3I2HA 3PDQA 5L9BA 3FUQA 1C3HA 1AX2A 2ET7A 3WNPA 4BXFA 3B94A 1CZVA 3AMNA 5IFTA 4INDA 1AR92 5FZCA 4CEYC 1LENA 3VL8A 1F35A 3Q8AA 4CUAA 1FV2A 1BEV2 3C2UA 3ILFA 2FHRA 2ZMLA 5ABJB 5LBFA 1NY72 3VHRA 4WZCA 3WDXA 1QQP3 1QXPA 5AVPA 4OULA 4LITA 5CG8A 2RDQA 1OPOA 3I7DA 1YC61 3VDBA 3CJIC 1PX3A 3DXTA 3I59B 1R1A1 3IN9A 1AF9A 2JD4A 4GB31 1RHI2 4OHWA 1W6PB 1TEIA 2C1FA 2RR12 3N7MA 2ZX3A 1W6MB 4HPKA 2GNMA 4MXWA 1S55A 4W6XA 1JYTA 1HRI2 1ND2B 1PO13 5A3MA 1N1YA 4FXKB 4NHXA 4H55A 1PGL2 4NROA 2CAVA 1VRH1 1CWPA 4JGYB 2C9KA 2RM21 3MFAA 4JZRA 2X29A 5A7OA 1S0JA 1N3QA 1RMU1 3I54A 2PN5A 3K4ZA 4XUTA 1UYYA 3VBUB 5FZFA 4LEJA 3KQ4B 3IPVA 3AFKA 4Y26A 2W3JA 2QQKA 2RHPA 2ZKNA 3A0KA 1JZ5A 3JXSA 5D2AA 2PAEA 3DGTA 5BV6A 1EV13 4ZKTB 1PM7A 2WS91 3H50A 4CDXC 4FI9A 1HQWA 1Z7S2 1ODNA 1WKYA 4ORFA 3VBFC 2YGMA 1SBEA 1RUG3 4FQ4A 5AFBA 5LY1A 2TNFA 1NCQB 1SPPB 5CKNA 4IV3B 1AR82 2CDOA 2RDNA 4PIXA 5HV4A 3ZXLA 4LBMA 3BI3A 5HCAA 2GP5A 3PUSA 3BN6A 5I91A 5LATA 1PGSA 3LOIA 2WNUB 3IAQA 3MLJA 4GJZA 4RHV2 5DDJ2 2GN7A 1ST8A 2YU1A 4QX5A 4XFAA 2DBNA 1S0FA 3LEIA 2YZ4A 1ZRDA 5C4WC 1MQTB 2VMGA 5IHRA 2Z42A 1TNFA 4XJWA 1N1TA 3K77A 1HKDA 5FYYA 4CZSA 1UYZA 2WDBA 1U0AA 1SBDA 3NQHA 2QQWA 4Y5Z0 2ATFA 2PXJA 2ZBJA 1AXKA 4XJ9A 5FPBA 2HEVF 1QH6A 3IMMA 2AR6A 1FPN1 1CVNA 5JOXA 3RJRA 5FP9A 1KDMA 2B5HA 4TTGA 3USUB 5GZCA 1TE1B 3OYWA 4Q4Y3 3PJYA 3AKSA 4FCAA 1POQA 2DTWA 3ATGA 5FWEA 5IVVA 1F5FA 5D21A 4LA3A 4AK3A 4UFMA 4LHNA 1DFQA 1O6UA 2PLV1 4AEKA 1OBNA 2XQRA 2E31A 5CFDB 4AYUA 2JWPA 3T2OA 1Q8PA 1OF3A 3NJXA 4Q0VA 3VZNA 5DZGA 2BOIA 1OVPA 1RUF1 2RS51 1BK0A 1JU4A 3PU8A 4ISQA 3UK9A 1GQHA 2XWBB 3I8TA 4P9WA 3VBOB 4AVVA 4LUKA 3AXDA 4XACA 4MGIE 3VDDC 5LBBA 1UXZA 4DMIA 1F4HA 2GALA 4YW4A 5BNOA 2RS11 1MEC1 1V6JA 3V0AA 4NUBA 2VZ1A 4XF1A 2YU2A 2P3IA 5K4LA 4CUBA 5JOWA 1Y7BA 4KG8A 4NN0A 3H0OA 2ORXA 4IEXA 4PLOA 2W2IA 1H1AA 1DYOA 1PZ7A 2WUHA 4S2FA 1UAIA 1VBD3 4ZZ8A 1LHUA 2BW8A 3LA3A 5JI7A 1D4M1 2V73A 4QGLA 3WF3A 4ET7A 1UO9A 4EWAA 3TEYA 3ZYIB 3O1SA 1IPJA 4UBGA 3JD71 4UFJA 3OUIA 5L7OB 2JDYA 1JN2P 2DCYA 1J3PA 3PLQA 4FOQA 1AL23 2JKBA 3A23A 4CP0A 1R083 4A6OA 4UW6A 1NCRC 1O59A 4IEVA 2ZGRA 3NAPA 3I3MA 1QJY1 1PK6B 1LAJA 4CDQB 3LQCA 4D6SA 2ZGPA 1ZRIA 2VO5A 3E6BA 4MGKE 3JB8A 4QX3A 1XOYA 3CEWA 1IS5A 3OGJA 4K9SA 4I3GA 5HCFA 2VXJA 3ZPOA 2N7GA 3HR9A 3WLUA 5H9RA 1D4VB 2VOKA 5EJ3A 1R091 3FL7A 4TN7A 5A3PA 5EP9A 5JPNB 1A6CA 1TME1 5FBZA 1REFA 2QKDA 4SBVA 3ZFEC 4EV0A 5EPAA 4QKFA 5FZ1A 1F9KA 5CISA 1MS4A 2FBEA 4I09A 5DAWA 4FOVA 1W6QA 4QQHA 5FZAA 3AZVA 1FI2A 1S0IA 1VAKA 2WWUA 3C7HA 1QKQA 1MS5A 3PUHA 4C1WA 2RS32 2RV9A 5LWBA 5IATA 1ALYA 1VMJA 5F9TA 1YFUA 4FFGA 2DYCA 2DVDA 1QDOA 1RUH3 2PHDA 4N43C 3WG1A 4LKSA 4CA9A 5KXBA 3MUY1 3D3AA 5FY1A 1AX1A 2VMCA 4M00A 3BCWA 1Y43B 5FCCA 2BRTA 4ES9A 4FAGA 2BBAA 4HVQA 1L7RA 3OD4A 4IGQA 2WR9A 2SBAA 1LHVA 4ZU5A 4DS0A 3F95A 5FFOC 3MUZ1 4OI2A 1CONA 3R4UA 4FFHA 4YYOA 3ZYPA 4P9GA 5FMBA 2QDNA 2A5ZA 2H6CA 4OI1A 4E4DX 1GMMA 1W28A 5C9AC 2D6PA 3BVCA 1K5MA 4JAAA 2EVXA 3H1YA 3MPPG 5CYYA 4QX0A 4QB1A 4XXPA 4KH9A 4AHZA 4UOJA 3WNNA 1U5ZA 1J83A 3WW2A 2O8QA 3PMSA 1JH5A 3VKMA 3O7OA 1IS6A 1VBE2 1VBA3 1GQGA 5FO9B 1VAVA 1AR91 2QQJA 5A32B 4CEYA 2PHWA 1UOFA 4PBPA 4XQWA 1BEV1 3B01A 5F5IA 4CPBA 5BUVA 1DQ5A 4P9IA 2V4AA 1HXS2 4AE2A 3SLIA 1G9AA 1NY71 2I74A 2P34A 2DWRA 2E33A 3ILNA 4YZ4A 3ZDVA 1POV1 3CJIA 5IVJA 4CU7A 2D40A 2A3XA 2WNVC 3SKVA 2DV9A 3FE5A 2IXIA 2QQLA 5A33B 1B35C 3ZYBA 2E32A 3RI9A 2HWE2 2EICA 4OHVA 4I2OA 3ZFGB 4OUMA 1Z0HA 1HRI1 4OHXA 3ABZA 1LOEA 2PELA 4QHZA 2PA7A 1W05A 3WNKA 2A1XA 4KWUA 2ZGKA 4PHZA 3U78A 4CCJA 4CEWB 2Y6KA 3CLPA 1ENXA 4EN0A 1V9U1 4LXLA 3I4IA 2KA3A 3EXUA 5I0DA 3NNGA 3AC0A 1KXGA 3S7IA 4RR3C 2WZR3 3AKTA 2UWBA 3WF2A 1QJX3 1W99A 2TUNA 2OUHA 4BYYA 4LKDA 2KR2A 2B45X 3KV6A 4YGBA 1H9PA 1F31A 3ZFFB 5FQ0B 2A6XA 2XVGA 3DKWA 3HWJA 4L99A 4CDXA 3ZR5A 1WW7A 3AKQA 3ZKYA 2AREA 3KT1A 3EYPA 3M3EA 4GMP1 2F4LA 1BXHA 2VTXJ 2X53S 5KHKA 1G9BA 1AR81 4YFWA 5FO7B 5JI9A 5FYUA 1CR7A 5M0TA 4HLTA 3WDTA 5FLIA 4CDUC 2XJRA 1TMF3 3NV2A 2HEWF 3QCWA 4TWTA 2OYZA 1NA1C 2Q8DA 4O7XA 4XFIA 2VMHA 4RHV1 2DCJA 1O4YA 2YDEA 3OB8A 1QQP2 3AMPA 1UN1A 4P00B 4HXCA 4ZS2A 5FZ0A 2PHUA 4YPJA 1YCIA 4BIFA 4BISA 4GKXA 1CAVA 1SDDB 2CTVA 3I2FA 2YBKA 5FY9A 1DZTA 4B4QA 4CCCA 2DU1A 4IERA 2R042 4NWVA 4AQTA 1JOJA 1LODA 2XJTA 5C8CB 1I9RA 4LO6B 2HYKA 5LRRA 3TYJA 2YG0A 1ASJ3 1I5ZA 2VBDA 3D0SA 5ABJC 4QM8A 4CXXA 5FWJA 1OUSA 5J1XA 3PIJA 4COVA 2VCBA 5GALA 3ASIA 3HAGA 3ZVXA 5CEHA 1D2QA 2MHFA 5FUPA 3ROUA 4CU8A 3MIFA 5FZEA 2WJSA 5EFUA 3DECA 3ZR6A 4Z8BA 4Q4V3 4MOAA 3O14A 4ASLA 1IKPA 4YZ5A 2QJVA 1MZFA 2CV6A 3HOBA 2RE9A 2B7YA 4CUGA 1X50A 5A3OA 1M06G 3T2PA 5FMDA 2PTMA 1ND2C 2JDAA 3UJQA 4RGAA 4IETA 4KU8A 4BE3A 4JGYC 2Y34A 1LJ7A 5E1RA 3ZSKA 4CPBD 1MVEA 3DYPA 4M4PA 2CHHA 1WD3A 1E5RA 2WT0A 3T2QA 2JB4A 3VDDA 4IV1B 2GC0A 4FPHA 3VBUC 5FZ8A 3SC7X 5FYZA 4CXWA 1GKBA 2J1AA 1GLHA 3VHOA 4AVAA 2ZEXA 3MIBA 3Q8EA 3HQUA 2VZUA 5ISLA 3BTXA 1RUD3 2E53A 3WINE 3O1PA 4XHXA 1UY1A 1WCDJ 3NNJA 4WVMA 4XETA 4C0HA 5IW0A 5ACA3 3THCA 4DEVA 4FQZA 3WP5A 3DKQA 2D5FA 5GZGA 1GZCA 5JLVA 1NCQC 1C28A 4IV3C 1C4RA 1XE8A 4Z1VA 1H0BA 3ZYFA 3HMYA 3LPFA 4E8CA 4XURA 1YWKA 2X5IB 4XOGA 5FV3A 2JG8B 1V6OA 4UXAA 3HT2A 3T09A
chains in the Genus database with same CATH topology
1O8PA 5JXIA 1JHJA 4JHZA 3WEZA 3VD3A 3A21A 3ZM8A 3LPGA 4QDSA 3WSOA 3NRUA 3OEBA 2EIDA 2W95A 2WBKA 5EJZB 3DYMA 2YFZA 2WO2A 4P5YA 2X10A 1GOHA 1EUUA 4KI5M 1K12A 5CZKA 4QB2A 4XVHA 2J1SA 5A1AA 3IIIA 3WF1A 3UETA 1W9SA 3K75B 2VZSA 3VDCA 1XC6A 2QBXA 5G04L 3OG2A 1UXXX 5EJ1B 4BK5A 5IJRA 3MBWA 5JR2A 1TG7A 3K46A 2R7EB 5JXHA 1GOGA 2VR4A 4DEQA 3LE0A 5DN2A 3E1F1 4XUOA 1CZTA 1W8OA 3GGLA 1UMHA 3ECQA 2VZOA 3WNOA 3F2ZA 3T08A 2VZVA 4LPLA 1K42A 4QPWA 3K4AA 1GU3A 2BGOA 1W9TA 4ZY9A 2JE8A 3I2KA 4BJ0A 4DXTA 3VD4A 4DXSA 4QDQA 3WQBA 1KGYA 2YC2A 5LA0A 2QQIA 1CIYA 1UMIA 1NX9A 2B9VA 2BERA 2W1WA 4AAXA 1GQPA 1NKGA 2WAOA 2Y8KA 1XNTA 3ACGA 1RYYA 4MADA 3I2HA 2ORZA 1JZ6A 2WZEA 4CVUA 4L0PA 1DP0A 3WNPA 5JMOA 3UESA 1CZVA 3I97A 4XUNA 1UZ0A 5IFTA 2V72A 3I3BA 2X09A 1JZ3A 4CUAA 2LS6A 4E8DA 2J1RA 2VM9A 3HPNA 4IUGA 4ARYA 1JYWA 2Y6GA 4CU9A 3DYOA 3VDBA 1PX3A 4OUEA 2J1TA 2W5FA 4TXWA 5DPNA 4W8JA 1HN1A 2XONA 4BXSV 1TVGA 4OMDA 4BDVB 2YB7A 3SKJE 2VZPA 2C9KA 2BZDA 4BK4A 3ACIA 3SEEA 2WN2A 2BGPA 3K4ZA 2VQTA 1UYYA 4XUTA 2ID4A 3HNYM 3U37A 1NUKA 1KEXA 2W3JA 2QQKA 1JZ5A 3UNPA 1K45A 3JXSA 2YC4A 2VMEA 4FI9A 1L7QA 1WKYA 2W91A 1O8SA 3WNLA 4LHSA 1ULPA 2CDOA 1JZ2A 2W1SA 5B4NA 3BN6A 4P02B 2J22A 4D8MA 1P8JA 4JKKA 1JYNA 3IAQA 3CQOA 4A3ZA 1UY2A 3IAPA 3VD5A 3ACHA 3LEIA 4UI9L 5F7UA 1JZ4A 5HXMA 1GUIA 5IHRA 2DDUA 3K77A 3T09A 1UYZA 2WDBA 3NQHA 2VCCA 3FN9A 1UYXA 4ZZ5A 4TTGA 3HNBM 2KD7A 5LA2A 5HPOA 2VCAA 2W9XA 3GXUA 2E31A 3NJVA 2J1VA 1OT5A 3T2OA 1OF3A 3NJXA 2WYSA 4XUQA 2XQXA 5JUVA 1JU4A 4A44A 2VQUA 3K4DA 1UY4A 2VMDA 5EIYB 4HG6B 2WO3A 2VOTA 4QAWA 4PT6A 1UXZA 1F4HA 4A4AA 1XNAA 3CKHA 1US3A 2VZ1A 4CUBA 2LW8A 3WF0A 2ORXA 1OD3A 1DYOA 2WUHA 4ZZ8A 3BGAA 1UWWA 4CUCA 3WF3A 4ET7A 2OKXA 1GOFA 1I5PA 4GWJA 4QX2A 2W46A 4JX0A 2Y6HA 3P1IA 3T0AA 2QQOA 3I2IA 4QB6A 4KMQA 1PX4A 2E26A 2WZ8A 4W50A 2HLEA 3A23A 3CMGA 3OGVA 3OGRA 4A6OA 4GZ9A 1O59A 4D0QA 1K3IA 1PMJX 3LQCA 4OZOA 2VO5A 4DUVA 4QX3A 4Z2AA 4UAPA 4AG4A 4P08A 1F4AA 3FL7A 3MO4A 4MO3M 2W1QA 3CZUA 1W9WA 2W87A 2WN3A 1J84A 1W0NA 3GM8A 1MPXA 3C7HA 2ZXQA 5LCWL 1JZ8A 3LEKA 1CZSA 3PUHA 2Z4FA 2RV9A 1IQDC 2V5DA 3J7HA 2VZRA 4LKSA 3MUY1 3D3AA 3OBAA 2VMCA 2VZTA 2W1UA 3HEIA 4LQRA 3WNKA 2BBAA 1L7RA 1YQ2A 3C7OA 1XPWA 1BHGA 3WF4A 2VTFA 3MUZ1 3WNMA 3VD7A 1NAEA 2VMFA 3THDA 1GMMA 3P6BA 1JZ7A 3PUIA 2JD9A 4ZXEA 3C8XA 5CYYA 5C7GA 1OF4A 4QX0A 3OEAA 4QB1A 1GNYA 3ACFA 3ETPA 4RN5A 3CZJA 4UOJA 3WNNA 5JXJA 1J83A 1PMHX 2XHNA 1US2A 4W4ZA 3I3DA 1ULOA 3IB3A 3HN3A 2QQJA 4MGSA 4CU6A 2QQNA 3IDAA 3MV01 3VD9A 2WQ8A 2VJXA 3FHAA 3I2JA 2Y6LA 3HJRA 2EIEA 2W47A 2X05A 1JU3A 2DCKA 2E33A 1JI6A 2Y6JA 3GDBA 3I3EA 4MGQA 4CU7A 5C71A 2ZEYA 3W5NA 2WAAA 3SKVA 4QDRA 2QQLA 4ARXA 2E32A 2EICA 1W8NA 3ABZA 2HYXA 3I2GA 4KWUA 3C7GA 2VZ3A 2Y6KA 4XUPA 5I0DA 3NNGA 3AC0A 3WF2A 1W99A 3C7EA 4RYDA 1R64A 5B4XA 3VDAA 3EYPA 2B4KA 1LNSA 2Y64A 3A22A 4DXRA 4DUWA 5IYYA 5IFPA 3OGSA 2J1EA 2PQSA 4OYUA 4M4RA 3W5MA 2W92A 2WABA 2DCJA 3OB8A 4YPJA 4P00B 4XZUG 2QQMA 4JKLA 1SDDB 2L9LA 3I2FA 2C4XA 3SEPA 1T2XA 2J7MA 2C26A 3FHQA 1SG3A 2YG0A 3MV11 5DMYA 4QX1A 4OMCA 5J1XA 5C70A 2VCBA 2W94A 3T0BA 2J1UA 5G05L 4CU8A 2WO1A 2XOMA 3T0DA 5FUIA 2ZEWA 3DECA 1SHWB 4MOAA 1OH4A 4JKMA 2CDPA 3C7FA 1H6YA 3HOBA 3T2PA 3CIHA 2JDAA 4GWIA 1UY0A 5DQ0A 1UY3A 2RVAA 3DYPA 3LEGA 4M4PA 5LA1A 3T2QA 2EIBA 3HNMA 1EUTA 1JYVA 4A45A 1CX1A 2J1AA 2YFUA 2ZEXA 2ZEZA 2VZUA 1D7PM 1DLCA 5JXGA 1UY1A 4A41A 3EB7A 2VC9A 4DUXA 1H6XA 3THCA 4DEVA 2VZQA 2VL4A 4A42A 1WCQA 3LPFA 4E8CA 4XURA 1JYXA 2V4VA 2RJ2A 3CDZB 1UX7A 4PF1A 4PQQA 3A7QA 2JKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8P A;  5JXI A;  1JHJ A;  4JHZ A;  3WEZ A;  3VD3 A;  3A21 A;  3ZM8 A;  3LPG A;  4QDS A;  3WSO A;  3NRU A;  3OEB A;  2EID A;  2W95 A;  2WBK A;  5EJZ B;  3DYM A;  2YFZ A;  2WO2 A;  4P5Y A;  2X10 A;  1GOH A;  1EUU A;  4KI5 M;  1K12 A;  5CZK A;  4QB2 A;  4XVH A;  2J1S A;  5A1A A;  3III A;  3WF1 A;  3UET A;  1W9S A;  3K75 B;  2VZS A;  3VDC A;  1XC6 A;  2QBX A;  5G04 L;  3OG2 A;  1UXX X;  5EJ1 B;  4BK5 A;  5IJR A;  3MBW A;  5JR2 A;  1TG7 A;  3K46 A;  2R7E B;  5JXH A;  1GOG A;  2VR4 A;  4DEQ A;  3LE0 A;  5DN2 A;  3E1F 1;  4XUO A;  1CZT A;  1W8O A;  3GGL A;  1UMH A;  3ECQ A;  2VZO A;  3WNO A;  3F2Z A;  3T08 A;  2VZV A;  4LPL A;  1K42 A;  4QPW A;  3K4A A;  1GU3 A;  2BGO A;  1W9T A;  4ZY9 A;  2JE8 A;  3I2K A;  4BJ0 A;  4DXT A;  3VD4 A;  4DXS A;  4QDQ A;  3WQB A;  1KGY A;  2YC2 A;  5LA0 A;  2QQI A;  1CIY A;  1UMI A;  1NX9 A;  2B9V A;  2BER A;  2W1W A;  4AAX A;  1GQP A;  1NKG A;  2WAO A;  2Y8K A;  1XNT A;  3ACG A;  1RYY A;  4MAD A;  3I2H A;  2ORZ A;  1JZ6 A;  2WZE A;  4CVU A;  4L0P A;  1DP0 A;  3WNP A;  5JMO A;  3UES A;  1CZV A;  3I97 A;  4XUN A;  1UZ0 A;  5IFT A;  2V72 A;  3I3B A;  2X09 A;  1JZ3 A;  4CUA A;  2LS6 A;  4E8D A;  2J1R A;  2VM9 A;  3HPN A;  4IUG A;  4ARY A;  1JYW A;  2Y6G A;  4CU9 A;  3DYO A;  3VDB A;  1PX3 A;  4OUE A;  2J1T A;  2W5F A;  4TXW A;  5DPN A;  4W8J A;  1HN1 A;  2XON A;  4BXS V;  1TVG A;  4OMD A;  4BDV B;  2YB7 A;  3SKJ E;  2VZP A;  2C9K A;  2BZD A;  4BK4 A;  3ACI A;  3SEE A;  2WN2 A;  2BGP A;  3K4Z A;  2VQT A;  1UYY A;  4XUT A;  2ID4 A;  3HNY M;  3U37 A;  1NUK A;  1KEX A;  2W3J A;  2QQK A;  1JZ5 A;  3UNP A;  1K45 A;  3JXS A;  2YC4 A;  2VME A;  4FI9 A;  1L7Q A;  1WKY A;  2W91 A;  1O8S A;  3WNL A;  4LHS A;  1ULP A;  2CDO A;  1JZ2 A;  2W1S A;  5B4N A;  3BN6 A;  4P02 B;  2J22 A;  4D8M A;  1P8J A;  4JKK A;  1JYN A;  3IAQ A;  3CQO A;  4A3Z A;  1UY2 A;  3IAP A;  3VD5 A;  3ACH A;  3LEI A;  4UI9 L;  5F7U A;  1JZ4 A;  5HXM A;  1GUI A;  5IHR A;  2DDU A;  3K77 A;  3T09 A;  1UYZ A;  2WDB A;  3NQH A;  2VCC A;  3FN9 A;  1UYX A;  4ZZ5 A;  4TTG A;  3HNB M;  2KD7 A;  5LA2 A;  5HPO A;  2VCA A;  2W9X A;  3GXU A;  2E31 A;  3NJV A;  2J1V A;  1OT5 A;  3T2O A;  1OF3 A;  3NJX A;  2WYS A;  4XUQ A;  2XQX A;  5JUV A;  1JU4 A;  4A44 A;  2VQU A;  3K4D A;  1UY4 A;  2VMD A;  5EIY B;  4HG6 B;  2WO3 A;  2VOT A;  4QAW A;  4PT6 A;  1UXZ A;  1F4H A;  4A4A A;  1XNA A;  3CKH A;  1US3 A;  2VZ1 A;  4CUB A;  2LW8 A;  3WF0 A;  2ORX A;  1OD3 A;  1DYO A;  2WUH A;  4ZZ8 A;  3BGA A;  1UWW A;  4CUC A;  3WF3 A;  4ET7 A;  2OKX A;  1GOF A;  1I5P A;  4GWJ A;  4QX2 A;  2W46 A;  4JX0 A;  2Y6H A;  3P1I A;  3T0A A;  2QQO A;  3I2I A;  4QB6 A;  4KMQ A;  1PX4 A;  2E26 A;  2WZ8 A;  4W50 A;  2HLE A;  3A23 A;  3CMG A;  3OGV A;  3OGR A;  4A6O A;  4GZ9 A;  1O59 A;  4D0Q A;  1K3I A;  1PMJ X;  3LQC A;  4OZO A;  2VO5 A;  4DUV A;  4QX3 A;  4Z2A A;  4UAP A;  4AG4 A;  4P08 A;  1F4A A;  3FL7 A;  3MO4 A;  4MO3 M;  2W1Q A;  3CZU A;  1W9W A;  2W87 A;  2WN3 A;  1J84 A;  1W0N A;  3GM8 A;  1MPX A;  3C7H A;  2ZXQ A;  5LCW L;  1JZ8 A;  3LEK A;  1CZS A;  3PUH A;  2Z4F A;  2RV9 A;  1IQD C;  2V5D A;  3J7H A;  2VZR A;  4LKS A;  3MUY 1;  3D3A A;  3OBA A;  2VMC A;  2VZT A;  2W1U A;  3HEI A;  4LQR A;  3WNK A;  2BBA A;  1L7R A;  1YQ2 A;  3C7O A;  1XPW A;  1BHG A;  3WF4 A;  2VTF A;  3MUZ 1;  3WNM A;  3VD7 A;  1NAE A;  2VMF A;  3THD A;  1GMM A;  3P6B A;  1JZ7 A;  3PUI A;  2JD9 A;  4ZXE A;  3C8X A;  5CYY A;  5C7G A;  1OF4 A;  4QX0 A;  3OEA A;  4QB1 A;  1GNY A;  3ACF A;  3ETP A;  4RN5 A;  3CZJ A;  4UOJ A;  3WNN A;  5JXJ A;  1J83 A;  1PMH X;  2XHN A;  1US2 A;  4W4Z A;  3I3D A;  1ULO A;  3IB3 A;  3HN3 A;  2QQJ A;  4MGS A;  4CU6 A;  2QQN A;  3IDA A;  3MV0 1;  3VD9 A;  2WQ8 A;  2VJX A;  3FHA A;  3I2J A;  2Y6L A;  3HJR A;  2EIE A;  2W47 A;  2X05 A;  1JU3 A;  2DCK A;  2E33 A;  1JI6 A;  2Y6J A;  3GDB A;  3I3E A;  4MGQ A;  4CU7 A;  5C71 A;  2ZEY A;  3W5N A;  2WAA A;  3SKV A;  4QDR A;  2QQL A;  4ARX A;  2E32 A;  2EIC A;  1W8N A;  3ABZ A;  2HYX A;  3I2G A;  4KWU A;  3C7G A;  2VZ3 A;  2Y6K A;  4XUP A;  5I0D A;  3NNG A;  3AC0 A;  3WF2 A;  1W99 A;  3C7E A;  4RYD A;  1R64 A;  5B4X A;  3VDA A;  3EYP A;  2B4K A;  1LNS A;  2Y64 A;  3A22 A;  4DXR A;  4DUW A;  5IYY A;  5IFP A;  3OGS A;  2J1E A;  2PQS A;  4OYU A;  4M4R A;  3W5M A;  2W92 A;  2WAB A;  2DCJ A;  3OB8 A;  4YPJ A;  4P00 B;  4XZU G;  2QQM A;  4JKL A;  1SDD B;  2L9L A;  3I2F A;  2C4X A;  3SEP A;  1T2X A;  2J7M A;  2C26 A;  3FHQ A;  1SG3 A;  2YG0 A;  3MV1 1;  5DMY A;  4QX1 A;  4OMC A;  5J1X A;  5C70 A;  2VCB A;  2W94 A;  3T0B A;  2J1U A;  5G05 L;  4CU8 A;  2WO1 A;  2XOM A;  3T0D A;  5FUI A;  2ZEW A;  3DEC A;  1SHW B;  4MOA A;  1OH4 A;  4JKM A;  2CDP A;  3C7F A;  1H6Y A;  3HOB A;  3T2P A;  3CIH A;  2JDA A;  4GWI A;  1UY0 A;  5DQ0 A;  1UY3 A;  2RVA A;  3DYP A;  3LEG A;  4M4P A;  5LA1 A;  3T2Q A;  2EIB A;  3HNM A;  1EUT A;  1JYV A;  4A45 A;  1CX1 A;  2J1A A;  2YFU A;  2ZEX A;  2ZEZ A;  2VZU A;  1D7P M;  1DLC A;  5JXG A;  1UY1 A;  4A41 A;  3EB7 A;  2VC9 A;  4DUX A;  1H6X A;  3THC A;  4DEV A;  2VZQ A;  2VL4 A;  4A42 A;  1WCQ A;  3LPF A;  4E8C A;  4XUR A;  1JYX A;  2V4V A;  2RJ2 A;  3CDZ B;  1UX7 A;  4PF1 A;  4PQQ A;  3A7Q A;  2JKX A; 
#chains in the Genus database with same CATH topology
 2JDH A;  2WNU C;  1LOG A;  5JXI A;  1JHJ A;  2PHT A;  3JB4 C;  1ZRF A;  4LBJ A;  4LBN A;  5A6Q A;  2HJI A;  5FUN A;  2QZ3 A;  5FZ7 A;  4QDS A;  3WSO A;  4QT6 A;  3UT0 A;  3NRU A;  1H8V A;  4Q26 A;  1LOC A;  1RUC 3;  2Q1Z B;  3J8F 3;  5FZO B;  3VZK A;  1MQT C;  2LRP A;  2VE1 A;  1FV3 A;  4KWL A;  1XYO A;  3AM2 A;  5EJZ B;  3MDP A;  5FYC A;  4AGR A;  1E5I A;  5BY5 A;  3KT4 A;  1BJQ A;  1XSQ A;  5IVY A;  1EUU A;  4I0A A;  1RXG A;  4V2W A;  3ZFE A;  2MEV 1;  2JDN A;  3GCX A;  1ZBE 3;  1DGR A;  2GC2 A;  4LR4 A;  4JTO A;  4FP2 A;  5FP4 A;  2P3Y A;  2F6B A;  2GME A;  3WF1 A;  2GN3 A;  4FBF A;  1NZC A;  2VZS A;  4MGZ E;  5FPL A;  3VDC A;  4EQV A;  5A6Y A;  2QBX A;  1D0G A;  5G04 L;  5J09 A;  2WLQ A;  1UXX X;  4LKE A;  4MV2 A;  5CFD C;  4RD7 A;  2V09 A;  2YY1 A;  1W6N A;  1TG7 A;  1U12 A;  4N43 A;  2WNO A;  2XDV A;  4RQP C;  1VBC 1;  1VBD 2;  1OUX A;  3PUQ A;  1RIN A;  2NM1 A;  1H4G A;  3POI A;  3LE0 A;  3PTY A;  3ME2 A;  3HBZ A;  5AVA A;  1O3R A;  1DHK B;  2IXJ A;  4UFH A;  1W2N A;  1UMH A;  3IIA A;  3VBO C;  5GM0 A;  3WW1 A;  2XUE A;  2R6Q A;  2VZO A;  4QPG B;  3Q9O A;  3VBR B;  4K3U A;  2J42 A;  4LA2 A;  4AQS A;  5FJH A;  1AL2 2;  1CX4 A;  1R08 2;  1ND3 B;  1UOB A;  1VRB A;  3TB0 A;  4BOW A;  4ZY9 A;  4CCL A;  5AC9 3;  5F32 A;  5C9A A;  1L3J A;  4FAH A;  4FTB A;  3ZLI A;  3KCC A;  4DFS A;  2UY8 A;  3LB9 A;  3K3N A;  2Q8O A;  3ZXD A;  4QQO A;  2JXA A;  1T6B X;  1LKN A;  4FP3 A;  4NII A;  5CB7 A;  5A3L A;  2ZAC A;  4YM0 A;  3GYD A;  1CIY A;  1IKQ A;  3RMX A;  5C5T A;  3ENR A;  4F83 A;  5L7O C;  2VNG A;  2GH8 A;  5C3R A;  1VBE 1;  4GUL A;  4CP1 A;  1GQP A;  4OFG A;  1S0B A;  3U4X A;  1LRH A;  4LHK A;  4XHB A;  1TNR A;  3GF6 A;  1QNW A;  5IK8 A;  1YIP A;  1PK6 C;  4RSU A;  1Q8Q A;  1CAX A;  4FTS A;  4M3C A;  4CDQ C;  1NG0 A;  3UYJ A;  1HXS 1;  4MAD A;  1AHS A;  1CIW A;  3MLK A;  3VLB B;  1VJ2 A;  3JCI A;  3OD0 A;  1DP0 A;  3UES A;  1OHF A;  1JYC A;  4BA6 A;  5A7W A;  1YYN A;  3AYD A;  3MYX A;  3PVE A;  2HWC 2;  3WNX A;  3CHX A;  2GMM A;  4MG2 A;  1UU4 A;  2VW1 A;  5JR7 B;  2WNV A;  1RUH 2;  3T1M A;  1JZ3 A;  1V6M A;  3AXE A;  3KVA A;  4XF9 A;  1PVX A;  3KT7 A;  1UIK A;  4PLM A;  3BU0 A;  3B9C A;  2FDK A;  2LS6 A;  1EP0 A;  1NLR A;  1A8M A;  2HWE 1;  1S4C A;  3DPR B;  3I2D A;  4E8D A;  2GC1 A;  3HPN A;  4FO9 A;  4IUG A;  1DQ4 A;  3SNM A;  2BP6 A;  5C3Q A;  4LKF A;  1W3V A;  3K48 A;  1CQ9 A;  3UKV A;  3TRS B;  2G9F A;  3U07 A;  4OUE A;  3BIE A;  2Q30 A;  1AR7 3;  2DVB A;  4TXW A;  5H9S A;  1HX6 A;  1COV 3;  3BOD A;  3V56 A;  5F1R A;  1O5U A;  1LHW A;  2G9Z A;  1HN0 A;  1RB8 G;  4LTA A;  3OJB A;  3URF A;  2C6S A;  4R9A A;  4A7K A;  2OQ7 A;  2WFF 2;  4OMD A;  2YB7 A;  5GLZ A;  4NID A;  1UU6 A;  2A6Y A;  4CDW B;  1ZBA 1;  5DUX A;  1QJU 3;  3ZDS A;  2GP3 A;  4EN8 B;  2ETE A;  3S5A A;  1IZ3 A;  1XE7 A;  5FXX A;  4AI3 A;  2VUJ A;  2VQT A;  4B8E A;  2BBV A;  4QQP A;  3VUO A;  2ID4 A;  4CP9 A;  4TYS A;  3U37 A;  1M4W A;  1QOS A;  3IZO A;  4MZU A;  4RGG A;  1MS1 A;  1ULD A;  4DPN A;  2VGD A;  5C33 A;  5I0S A;  1GAN A;  4CDU A;  3ALQ A;  1J1T A;  1DIW A;  2YC4 A;  1NQD A;  2VOV A;  3BOP A;  4NMI A;  4TSV A;  1VB4 A;  4QWN A;  1FMD 1;  4DRR A;  1QQP 1;  2W91 A;  3D5O A;  4MXV A;  1YQ6 A;  4B7K A;  3FUO A;  5IK5 A;  4Y4R A;  4LHS A;  1ULP A;  3LDR A;  1IG3 A;  1RUJ 3;  3B7M A;  3AP5 A;  1FNZ A;  4S2H A;  4HET A;  4JTN A;  3EBR A;  3BTY A;  2R04 1;  2A3W A;  1STM A;  4D8M A;  1P8J A;  4K1Z A;  1JYN A;  4NJ4 A;  2ARX A;  2EAL A;  1CAU B;  2HWD 2;  3M3C A;  4WBB A;  1KFX L;  1UY2 A;  4YNI A;  5CU1 A;  3VD5 A;  3WX5 A;  3ACH A;  4EN6 B;  1GIC A;  3RRD A;  2AZ5 A;  4UI9 L;  5I0T A;  5F7U A;  4OHY A;  4IXL A;  1GUI A;  4D7S A;  1O4Z A;  3N4M A;  4XE9 A;  4OLL A;  3VZO A;  1OVS A;  1H2L A;  4DIN B;  3BU7 A;  2VCC A;  3AJZ A;  1OH3 A;  3I59 A;  5C3P A;  2EA7 A;  4AFM A;  4C8D A;  4IE4 A;  4Q0S A;  3OTF A;  1W6P A;  4XJZ A;  3V0B B;  3QOP A;  4P5H A;  2PQQ A;  3WT3 A;  2JIJ A;  1VMF A;  1W6M A;  3NJZ A;  3R6S A;  3ZFG C;  3W5N A;  3KMH A;  1ND2 A;  4RS5 A;  4PQ9 A;  3FLP A;  1SCR A;  4JGY A;  2VVE A;  1OKO A;  2ARC A;  4CEW C;  4NPL A;  3NJV A;  3SXW A;  3P3N A;  3OUJ A;  2J1V A;  3POJ A;  5L73 A;  2A6V A;  3ZKU A;  2PHF A;  4KU7 A;  2ZX0 A;  3H3Z A;  2XJP A;  3SMH A;  4Q4W 3;  2WYS A;  4IW3 A;  3VBU A;  3UGG A;  1TMF 2;  3M8L A;  5I0R A;  2XQX A;  5JUV A;  4FPE A;  4N7I A;  5K7P A;  2Z69 A;  2BJS A;  5A7P A;  4AI9 A;  1NXD 1;  4BLI A;  3ZFF C;  4QXC A;  1ACC A;  1BK1 A;  3GHN A;  4FPG A;  1X9P A;  3IBM A;  5H9P A;  2XBO 1;  1NOV A;  1GBG A;  3WHU A;  1VPH A;  1C5I A;  2O0O A;  3W58 A;  1X9T A;  2XML A;  1NCQ A;  2EXH A;  1SPP A;  4FXG B;  1RUI 3;  2YHJ A;  4IV3 A;  4Z92 B;  2P17 A;  3N36 A;  3V64 A;  2JEN A;  1V6I A;  2Q5T A;  2ADD A;  5F3C A;  1ZZ8 A;  1IPK A;  4AED B;  1ASJ 2;  1H8T B;  1OUR A;  1R1Z A;  2B9U A;  1SDW A;  1UWW A;  4Y5S A;  1W3X A;  1CAW B;  2WNU A;  3OOX A;  4MUV A;  4S2G A;  4BCU A;  4EN9 B;  2VUD A;  4XZP A;  1GOF A;  1O7F A;  2WKK A;  5FDB A;  1I5P A;  5EZW A;  1JBC A;  3P1I A;  1BBT 2;  3J26 N;  1MQT A;  3I2I A;  4QB6 A;  1QJE A;  1PX4 A;  2TBV A;  2ZKL A;  3BB6 A;  4Q4V 2;  1AYM 3;  3TEZ A;  3OGR A;  4UBH A;  3M3O A;  4QPI B;  5C8C C;  1QNY A;  1W8F A;  1ODM A;  4F3J A;  4XJ8 A;  1PMJ X;  2DUO A;  4L11 A;  3USU A;  4H2A A;  4UAP A;  1V70 A;  3NV1 A;  4XCB A;  1UOJ A;  3E97 A;  3N7J A;  2ZAA A;  1EAH 1;  1ZNP A;  4P08 A;  1F5J A;  5FZ4 A;  1JOP A;  3U4S A;  2FDI A;  4FSJ A;  3POW A;  1F4A A;  1DG6 A;  3KHB A;  2D6M A;  2LTN A;  2VW0 A;  4JRA A;  3IWZ A;  2MPF A;  1RUD 2;  3ZXJ A;  5A6Z A;  2W87 A;  1CGP A;  4BMB A;  1W0N A;  4Q8L A;  4AFD A;  1FOD 1;  4MET A;  3J4U H;  1MPX A;  2R07 1;  3H1W A;  5ACA 2;  5FOB B;  5LCW L;  2VOX A;  3GBW A;  4QQL A;  4AEJ A;  3WQ0 A;  3RZK A;  4XIO A;  4HKL A;  2AEZ A;  3KV5 A;  3LEK A;  5TSW A;  2Z4F A;  4HSJ A;  4HSL A;  5JWP A;  2XLF A;  2GDF A;  2UU8 A;  2V5D A;  2NMO A;  2Q1F A;  4DIQ A;  3R4D B;  2VY0 A;  4IV1 C;  1AL2 1;  1N1S A;  1YUD A;  2Y33 A;  4UFI A;  1C1L A;  3DCQ A;  3IT8 A;  3OBA A;  3CNA A;  5FIX A;  1EPW A;  3HEI A;  4LJH A;  4XBL A;  2P3K A;  3IDC B;  4LE3 A;  4MHU A;  4EYU A;  3HD8 B;  1YQ2 A;  3VHP A;  4Q8K A;  5DUU A;  1UZY A;  2PAK A;  4WV8 A;  2XHK A;  1BHG A;  1XNK A;  3LA2 A;  1RUC 2;  3LSD A;  3J8F 2;  4YM2 A;  5HV0 A;  5EXO A;  4KWK A;  3RYR A;  1NAE A;  2IFW A;  4CYD A;  1AR6 3;  1ONA A;  3I2O A;  4HK8 A;  2UYB A;  3ETQ A;  5L7O A;  3LAG A;  3NWK A;  3OY8 B;  1J3Q A;  2JE9 A;  1UMZ A;  1G7Y A;  2X5I C;  4COU A;  2JG8 C;  3WDY A;  3C8X A;  4UWD A;  1JUH A;  3JBG 2;  3SIT A;  3EMR A;  1PK6 A;  3OEA A;  4JGZ B;  1GP5 A;  2WWJ A;  3ETP A;  2R06 3;  2VUA A;  3GJB A;  4RN5 A;  4PI0 A;  4X8P A;  4Y20 A;  1XQN A;  4CDQ A;  2CY6 A;  5AFE A;  1PMH X;  5C70 A;  1D2S A;  4Q4X 1;  3TBD A;  4CCM A;  3I3D A;  1ULO A;  3IB3 A;  4L9B A;  1X8M A;  3JQX A;  5F5Q A;  4ONU A;  2HWC 1;  2P3J A;  3HN3 A;  4N7U A;  4AFA A;  4C1X A;  4Z82 A;  2QQN A;  3THP A;  4Q27 A;  1AYN 3;  3O0W A;  4CRQ A;  5CFC B;  3FHI B;  3MV0 1;  4JDO A;  1HV1 A;  1HRV 3;  4Y1U A;  2VNV A;  3POB A;  4N53 A;  3H8R A;  1W8W A;  4E2Q A;  3AYC A;  2HWF 1;  3I2J A;  4QXH A;  2Y6L A;  3HJR A;  2EIE A;  5FXZ A;  4B3N A;  2W47 A;  3RZL A;  5HBA A;  1LGB A;  3FC0 A;  1JI6 A;  1XU2 A;  4FPJ A;  3ZXG A;  5FKC A;  4EE2 A;  5C71 A;  3U0Z A;  2ZEY A;  1PZ8 A;  4FPC A;  1PO2 1;  4NIH A;  2R32 A;  4J25 A;  4LO5 B;  3AZX A;  2DUQ A;  3VBH A;  3U1X A;  5AC9 2;  5J96 B;  1QOO A;  1ZYB A;  3H8O A;  2WFF 1;  4NE9 A;  4RQP B;  1UKR A;  2A3Y A;  4AFB A;  1Q8V A;  2ET1 A;  4YZ3 A;  4E2S A;  2HYX A;  3K2O A;  3I2G A;  2VEC A;  5FXW A;  4K21 A;  5BNP A;  2VZ3 A;  2YYO A;  1UYP A;  1W8H A;  1OFN A;  1RIR A;  4QPG C;  4XJU A;  4E2G A;  3AFG A;  3VBR C;  1ZVF A;  2RMU 3;  4XYX A;  2EF6 A;  2VH9 A;  2NZ9 A;  2K0G A;  2O8O A;  1ND3 C;  5I8S A;  3MLL A;  1FX5 A;  3UGF A;  5FZB A;  5A7N A;  4RYD A;  2YMZ A;  5I8T A;  2RDR A;  4XIL A;  1R64 A;  1WA6 X;  1WWY A;  2WLP A;  1YRZ A;  1JHN A;  1LNS A;  3NV3 A;  1ZZ7 A;  4DXR A;  2IC1 A;  4XF3 A;  4Z07 A;  3OGS A;  4R9C A;  3UKT A;  3WNL A;  5DZF A;  4NO4 A;  4YGC A;  3O1R A;  3AMM A;  3KCX A;  5JMC A;  2J1E A;  3MHZ A;  3ZIW A;  1C8M 2;  5A32 A;  4M4R A;  4M01 A;  1W39 A;  4QM9 A;  2P5B A;  1GWL A;  2HWD 1;  4OI4 A;  2AAC A;  1RXF A;  2IXK A;  2WAB A;  3A4U A;  3KB5 A;  4GKY A;  2R49 A;  2IVI B;  3WY6 A;  4MVT A;  2QQM A;  3LD8 A;  2Y6F A;  3IPV B;  4Y1Y A;  4GB3 3;  3TN9 1;  1XYP A;  1ZA7 A;  4JKL A;  4YW6 A;  4PF5 A;  1AR7 2;  3RPQ A;  1COV 2;  5IAX A;  4AGG A;  1T2X A;  2ZGU A;  3AP7 A;  5FK8 A;  4GA9 A;  1Q3E A;  4J6G A;  5D8A B;  3PTR B;  1VRH 3;  3FHQ A;  2UUR A;  3EJK A;  5A33 A;  4KGQ A;  1KFU L;  2KXL A;  4IEQ A;  4KBB A;  1RVF 2;  2P2K A;  1X82 A;  3DPR C;  4NAO A;  1YFY A;  1S0E A;  3OPW A;  5EHD A;  2B42 B;  3SHR A;  4MSV A;  3ES4 A;  3ZFG A;  1XYN A;  3ZYR A;  5E16 A;  5C3S A;  5LW9 A;  4LHL A;  1MZ6 A;  1QJU 2;  4WZF A;  2BOJ A;  1SFN A;  5CKQ A;  2WO1 A;  2XOM A;  1O3Q A;  3UJO A;  3KF3 A;  5FUI A;  5FZK A;  2BEO A;  2ZEW A;  3OBT A;  3B93 A;  1DDL A;  4IEW A;  3MW2 A;  3Q8F A;  4JHT A;  2WS9 3;  3PIG A;  5LB6 A;  4YZ1 A;  1QJZ A;  1H6Y A;  4JRL A;  5GLV A;  3QH7 A;  3M3Q A;  5J48 A;  1KQR A;  1W0O A;  2VVF A;  4LOR A;  5BYN A;  2XL7 A;  1NT0 A;  1VBB 1;  2A6Z A;  4GWI A;  4MGT A;  3ZFF A;  5DQ0 A;  5FQ0 A;  1UY3 A;  2ZHK A;  1JOD A;  3LZZ A;  5FZI A;  3ZMN A;  4CDW C;  3LEG A;  4ERO A;  4XC9 A;  5JZG B;  2PHR A;  3RNS A;  3ZSJ A;  1OQ1 A;  4U36 A;  1SEF A;  1V00 A;  4A45 A;  1UZW A;  1CX1 A;  2Q8C A;  4BIO A;  2YFU A;  2XUM A;  1OQE A;  4BQY A;  1D7P M;  4HON A;  1ZZ6 A;  4A41 A;  4YRD A;  1XJA A;  2VPV A;  2XWJ B;  4NPR A;  2VC9 A;  5L36 A;  4DUX A;  2QZ2 A;  3AP9 A;  4IES A;  1DZQ A;  2H6B A;  2BWC A;  3NKG A;  3P3P A;  3CBN A;  3OGG A;  1FPN 3;  2GU9 A;  1BBT 1;  2NLR A;  2A75 A;  2VW2 A;  4EZ4 A;  2V4V A;  2RJ2 A;  4XMA A;  4OUS A;  2FD8 A;  3BUC A;  3PVB B;  5GZD A;  3A7Q A;  1LCL A;  2JKX A;  3APB A;  1O8P A;  3MIC A;  4Q0U A;  3POY A;  2PLV 3;  1OLM E;  3WEZ A;  2D6L X;  1Q56 A;  3V0A B;  1WBL A;  4YW5 A;  1UIJ A;  3POS A;  3RZZ A;  2W95 A;  4ATE A;  2BUK A;  1LU1 A;  3VGI A;  2WBK A;  3WR0 A;  4TLF A;  3DYM A;  4N8M A;  2Q0A A;  1RUF 3;  2RS5 3;  5FRE A;  2JDM A;  4Y5T A;  2QFE A;  1QJF A;  2X10 A;  5CBL A;  3VZJ A;  1GOH A;  4GH4 B;  1K12 A;  1RHI 1;  4I3P A;  4LOT A;  4QU2 A;  5JOZ A;  1RUD 1;  2P4E A;  2GMP A;  4XBQ A;  2RR1 1;  1J59 A;  4IQP A;  4XVH A;  2IWG B;  2RS1 3;  4B4P A;  1MEC 3;  4QQ2 A;  4XJA A;  1W9S A;  5T5J A;  3RG0 A;  2EAA A;  4E4Z A;  4HN0 A;  1MR5 A;  1PGL 1;  3UKN A;  3DL3 A;  1AVB A;  1UU5 A;  2OZJ A;  5FZH A;  1OFS A;  4BHP A;  2JEM A;  2OVU A;  2E63 A;  1RUN A;  4P14 A;  2WT1 A;  3O5S A;  1OPM A;  1WW5 A;  1D4M 3;  4IV1 A;  5FY0 A;  1U5Y A;  5GLU A;  4QXK A;  5FK7 A;  3RI8 A;  2VR4 A;  3JD7 3;  5DN2 A;  3E1F 1;  4R8H A;  2JDP A;  1YNA A;  3U10 A;  1W8O A;  2DVA A;  3GGL A;  5E89 A;  3U75 A;  2NMN A;  5C6C A;  1WA4 A;  3WNO A;  3IM0 A;  3F2Z A;  5HCB A;  1Z7S 1;  2Y38 A;  2YPD A;  4ZXK A;  1QJY 3;  3VBF A;  2R1B A;  4LE4 A;  1AYM 2;  5FZL A;  2VVD A;  3RVH A;  1K42 A;  4WM8 B;  1GU3 A;  3MW4 A;  3KD4 A;  1G8W A;  1URX A;  3HBK A;  4YGD A;  4YW1 A;  2ZGT A;  3ZMO A;  3LCP A;  2X5I A;  5LEJ A;  2WNE A;  2JG8 A;  4AED C;  2VBP A;  1H8T C;  2KM2 A;  3FZ3 A;  3JBG 1;  4D7T A;  3KSC A;  4B29 A;  1GNH A;  1LTE A;  1R09 3;  4HKO A;  5DDJ 1;  3C3V A;  4HOO A;  4MLO A;  5KXE A;  5LA0 A;  2QQI A;  5F5A A;  3VZL A;  1JYI A;  3T2T A;  3MW3 A;  2B9V A;  4AAX A;  3N9N A;  3ZSL A;  5FZO A;  5CAZ A;  5C4W A;  2VCM A;  4CSW A;  4RFR B;  1VLN A;  1LOF C;  2VUC A;  1JOB A;  4P9L A;  1WME A;  4C0B A;  1XXN A;  2HBU A;  4QPI C;  3ACG A;  3KVB A;  1LHO A;  3K3O A;  5K0U B;  5FR3 A;  3IKW A;  3OPZ A;  1H1I A;  1PO1 2;  1DGR N;  2WZE A;  4L0P A;  2HBT A;  2GNT A;  3GHM A;  4NVP A;  1K5M B;  4A6S A;  5JMO A;  2A71 A;  1UNB A;  5B2G B;  2IXC A;  3E5X A;  4XUN A;  1UZ0 A;  5F39 A;  2V72 A;  2FDF A;  4D69 A;  2EXK A;  4BH9 A;  3JZV A;  2XKO A;  1OLQ A;  3UGH A;  1HV0 A;  4OQ9 A;  2JG9 B;  3HQR A;  5AC9 1;  2EXI A;  2D6O X;  2IXH A;  1OOP B;  1DGL A;  4ARY A;  1JYW A;  1KS4 A;  5FP7 A;  3SQO A;  3GZU C;  1EV1 2;  5CG9 A;  4YVS B;  1BMV 2;  1O4T A;  4A7Y A;  1HIX A;  2VBB A;  5A70 A;  1HB3 A;  2I2S A;  1RUG 2;  1AR6 2;  4QPG A;  4XPV A;  5KC5 A;  3FFQ A;  2PFW A;  2EXJ A;  4YM1 A;  5FY5 A;  4DY3 A;  3FLT A;  2Y0I A;  5CKM A;  2E6V A;  4KBZ A;  4JC1 A;  1RTV A;  3IMN A;  2XON A;  5F2W A;  2JDU A;  4AHX A;  1YLL A;  3GCW A;  3SKJ E;  1YQ8 A;  2YBS A;  4AVB A;  2R06 2;  2VZP A;  3PJQ A;  5F2S A;  4KGG A;  4LT5 A;  2SLI A;  4ATF A;  1NLQ A;  2Z5W A;  4BK4 A;  4NIG A;  4UW4 A;  1AR9 3;  4WM7 B;  4SLI A;  2WN2 A;  1J1L A;  2BGP A;  2XLG A;  4UYB A;  1N3P A;  2ZAH A;  4FT8 A;  1BEV 3;  1WW6 A;  3HNY M;  4Y22 A;  1SFP A;  3KWV A;  4FFF A;  1KEX A;  2UY9 A;  2ZA9 A;  4ISR A;  3ZYG A;  4E9K A;  3UNP A;  1K45 A;  1C8M 1;  1GWK A;  3NJY A;  5FY4 A;  3VKL A;  2WSU A;  4JV4 A;  2G1M A;  2E7A A;  4GWN A;  5FZD A;  2VME A;  5FMO L;  1POV 3;  4OQ8 A;  1L7Q A;  1NCR A;  1XE0 A;  3AVR A;  4I0B A;  4JGZ C;  4Q4Y 2;  1E5S A;  1W9F A;  3B5L B;  1Q8S A;  4BU2 A;  4AR2 A;  1MZE A;  5DG2 A;  1JZ2 A;  5FY8 A;  1VB2 A;  3H7Y A;  1LU2 A;  5IVC A;  5B4N A;  2J22 A;  4FPL A;  1KS5 A;  1HRI 3;  2RJL A;  2WA3 A;  2XGX A;  4JKK A;  4LBK A;  4QD2 A;  3RYP A;  2WIN B;  3WW3 A;  2D3R A;  5CFC C;  1TQ5 A;  4A3Z A;  3PUA A;  3H3L A;  4BQ3 A;  1TZO A;  3IAP A;  4LMF A;  5FRA A;  1QY4 A;  1RVF 1;  2A6W A;  3DPR A;  4CCD A;  1V9U 3;  1VE0 A;  3D6E A;  1JZ4 A;  1GP4 A;  2XR4 A;  2DDU A;  4DXZ A;  3FFZ A;  2BYV E;  3ZYH A;  2RMU 2;  2D6N A;  3QAC A;  4LBL A;  1YEW A;  3AKP A;  3AL5 A;  5L9R A;  1UPI A;  4COZ A;  2RS3 1;  4ZZ5 A;  2B8M A;  1VAL A;  4U2A A;  2E7Q A;  3HNB M;  3ST7 A;  1CAV B;  1PIV 3;  3PHM A;  3RZH A;  1HJF A;  2DFC A;  4Q2F A;  1G9F A;  2VCA A;  1S2B A;  2CL2 A;  1XNC A;  4GMP 3;  3WDV A;  2CSG A;  3GZA A;  1AR8 3;  1YO8 A;  4XDP A;  3E6C C;  5D1I A;  2VU9 A;  4AHW A;  1OT5 A;  4IGO A;  4RA0 A;  4IGP A;  2DCT A;  3CO2 A;  4RHV 3;  1AXY A;  3ZYJ B;  4XUQ A;  4YZ2 A;  2WO7 A;  2VQU A;  1UY4 A;  5EIY B;  5KXD A;  3V65 A;  1UKG A;  3AX4 A;  1UD1 A;  2WO3 A;  4QAW A;  4PT6 A;  5A3N A;  2H0B A;  2O1Q A;  4A4A A;  3AJY A;  1XNA A;  4YSF A;  1US3 A;  4DQA A;  2FDJ A;  3B69 A;  1VRH 2;  1OD3 A;  5JOY A;  2AEN A;  5HI0 A;  3BGA A;  1CAU A;  2R16 A;  3OPT A;  4R52 A;  5T50 A;  4BQ1 A;  1GNZ A;  5GJ6 A;  5T52 A;  2OKX A;  5T5O A;  2DBI A;  4DZG A;  1SLT A;  3ZXK A;  3OBR A;  4GWJ A;  4KL1 A;  1UL9 A;  4JX0 A;  4I30 A;  4NHY A;  1O3T A;  4JQT A;  3GBF A;  2HLE A;  2IVJ A;  1WBF A;  3M2M A;  3OGV A;  2WS9 2;  4W50 A;  3WP4 A;  3PU3 A;  3VKF C;  4UF0 A;  1K3I A;  5D8A C;  2V5Y A;  2DF7 A;  5KBF A;  3ZIX A;  3GZE A;  4LBQ B;  3V0B A;  1UF2 C;  2YXS A;  2Z79 A;  4MX3 A;  1W2T A;  1B35 A;  4Z2A A;  4O9E A;  2BTV C;  2ERF A;  3KF5 A;  2OW4 A;  4AG4 A;  2GNB A;  4HT1 T;  4AFC A;  2UWA A;  5C3O A;  5E8A A;  2GND A;  3MO4 A;  4YW2 A;  1OKQ A;  5A80 A;  1O3S A;  3BOW A;  4I01 A;  2NN8 A;  1SLB A;  2QQP A;  1RJ7 A;  1VMH A;  1YIF A;  4AL9 A;  1OSG A;  3CZU A;  1QF3 A;  3ORJ A;  1J84 A;  4NIA A;  2OA2 A;  4RR3 A;  3MFC A;  2R30 A;  4DNY A;  3NNF A;  4BZ4 A;  3MIE A;  3AVS A;  5DAB A;  4BQ4 A;  4Y1V A;  5KWR A;  3WG2 A;  1PVC 3;  3KHC A;  5FP3 A;  2FQP A;  1FPN 2;  4DO0 A;  5JZG C;  1CD3 G;  4CE8 A;  1IQD C;  4WVV A;  4LOS A;  3MEP A;  1JZ8 A;  3QD6 A;  2C9A A;  4GQ7 A;  5DZE A;  3J7H A;  2ZX4 A;  4XFH A;  4K1Y A;  5JSR A;  2VZR A;  4NOT A;  1VBA 2;  5FYV A;  1RUO A;  3Q8C A;  1ZRC A;  2QVS B;  4FPY A;  5FYS A;  5DG1 A;  4AED A;  3MIH A;  1H8T A;  2ARB A;  2PHL A;  1W6O B;  3X29 B;  1W8Z A;  3C7O A;  1YFX A;  3N9Q A;  3BTZ A;  1CAW A;  2IXL A;  1Y9Q A;  2WFP A;  1NA1 A;  2JE7 A;  4XFB A;  2ZGQ A;  1E57 A;  3WUD A;  1G6N A;  2AC1 A;  2PHX A;  4EZH A;  4XAB A;  2ZGS A;  5IVF A;  3BPZ A;  1RUF 2;  2MEV 3;  2RS5 2;  4XQD A;  5FP8 A;  4K40 A;  4FPK A;  3CJX A;  2WII B;  5ERL A;  4EWE A;  4CCN A;  1JZ7 A;  3THT A;  4D6R A;  4LBO A;  2JD9 A;  4ZXE A;  1G9D A;  4QPI A;  4L8Q A;  1OF4 A;  5FPZ A;  3AYA A;  2QQU A;  4HFS A;  3ACF A;  1DLL A;  1VP6 A;  2W52 A;  1MEC 2;  4YVW B;  5JXJ A;  3BKZ A;  4JDN A;  1PO1 1;  1AX0 A;  3AL6 A;  2Q4S A;  3AP4 A;  3E5Q A;  5JSO A;  1US2 A;  3KZ4 C;  2R0F A;  1YJK A;  1GZW B;  5ABJ A;  1WW4 A;  2QDR A;  1QMJ A;  2TEP A;  2UYA A;  4IEY A;  1VBC 3;  4FTE A;  4COW A;  1PNF A;  3NST A;  5FPX A;  1D4M 2;  4IDZ A;  4CCK A;  3N35 A;  3VD9 A;  2WZR 2;  2HEY F;  4GH4 C;  4AI8 A;  4DY5 A;  1QJX 2;  2VJX A;  3O1V A;  4WVW A;  1S2K A;  5FZM A;  1FXZ A;  2X05 A;  1EV1 1;  2Y6J A;  2DCK A;  3I3E A;  5CVR A;  1BMV 1;  5JAX A;  4MGQ A;  4URT A;  2ZCW A;  1RL3 A;  5GZF A;  3N9O A;  3SCH A;  1QJY 2;  1RUG 1;  4L97 A;  1CAX B;  2K9Z A;  4XTM A;  5SV5 A;  4QDR A;  4AW7 A;  4O61 A;  2P37 A;  4JVA A;  2OS2 A;  5BNN B;  4JCK A;  4XTP A;  4IL7 A;  5FZ6 A;  4QKD A;  5CIR A;  1W8N A;  2ES3 A;  2AH2 A;  3NL1 A;  3C7G A;  1VBE 3;  1EYB A;  2D5H A;  3HQX A;  1EPZ A;  3WXP A;  4A3X A;  1HB2 A;  1N47 A;  1DQ0 A;  4XW3 A;  1SCS A;  4Q1R A;  4R4Z A;  3W59 A;  3LSE A;  2XJV A;  4D7Y A;  2ZX1 A;  2E51 A;  3I49 A;  1HXS 3;  4FOW A;  4WM8 C;  3WHT A;  3WW4 A;  3OY8 A;  3QLQ A;  1S1A A;  3N9P A;  2W39 A;  2WRA A;  1APN A;  1NLS A;  1YQC A;  5H9Q A;  5KXC A;  3D8C A;  5FYI A;  5B4X A;  3NW4 A;  3RYK A;  4JGZ A;  4Q4Y 1;  4AAP A;  3KLS A;  3A22 A;  5KHG A;  1RUE 3;  4DUW A;  2OT7 A;  5IYY A;  3GNE A;  2PYT A;  3M4F A;  2VMI A;  4Y33 A;  3HT1 A;  1UZZ A;  2BFU L;  2VUL A;  3MF6 A;  2QNK A;  1MAC A;  2PQS A;  4R9B A;  5JCT A;  2W92 A;  2ZHN A;  5CFC A;  4N90 A;  3KV4 A;  3S57 A;  3WZ1 A;  2ZTN A;  3AB0 A;  3I3Q A;  5FMO S;  5K0U C;  1V6L A;  1BCX A;  4XZU G;  4AOC A;  4CP9 B;  2BNO A;  2BU9 A;  2L9L A;  2NQY A;  3L9J T;  3SEP A;  1K5M C;  4PDW B;  2XH6 A;  2HKX A;  4XFG A;  2C26 A;  3GBG A;  3MIG A;  2WQZ C;  4OZX A;  2VD7 A;  2WL1 A;  2XVK A;  5DMY A;  4XEZ A;  5CFD A;  4QX1 A;  5FYM A;  1ZBA 3;  4OMC A;  2JG9 C;  3M3I A;  2F17 A;  2QUO A;  4IE0 A;  1SLI A;  3HN1 A;  4XMI A;  2ZPX A;  4P9X A;  4RQP A;  1QEX A;  1OOP C;  1VBD 1;  2DVF A;  3NMB A;  5T54 A;  4CP2 A;  1PHM A;  2J1U A;  4YVS C;  2LAL A;  1JTZ X;  1V0A A;  4BQ5 A;  4TLG A;  1F8V A;  4W65 A;  3PVO A;  3VBO A;  1WMF A;  2K2S A;  2WZP P;  2I45 A;  2H0V A;  1YHF A;  1RGS A;  2A73 B;  1OMI A;  4JKM A;  1FMD 3;  5DAV A;  4AVT A;  4URA A;  2XPJ A;  3ZXF A;  5KR7 A;  4XXA A;  1R08 1;  3BTA A;  3CIH A;  3H8X A;  1NE4 A;  3RZJ A;  3PNA A;  4UW3 A;  2YBP A;  1V6K A;  3T4V A;  1DQ2 A;  2C0Z A;  4LIU A;  2BNN A;  3VB9 A;  1X7N A;  4LLO A;  1IQA A;  1OA3 A;  2R04 3;  2XKP A;  4S2D A;  5SV8 A;  4WM7 C;  5DUW A;  4LO8 A;  5I0U A;  5A1F A;  3HNM A;  3MI8 A;  1IPS A;  2Y0O A;  5IVE A;  3G7D A;  4RS5 B;  3TNQ A;  1HW5 A;  4QKB A;  2ZEZ A;  1XNB A;  2G9G A;  1WLD A;  5JXG A;  4YFZ A;  3RMY A;  1V9U 2;  2CYF A;  4K7J A;  3EO6 A;  4NAM A;  1N3O A;  1UZV A;  1H6X A;  1ZBE 2;  5FJK A;  5FTT C;  2XG3 A;  3VBS B;  1H2K A;  3AMQ A;  1OA2 A;  2VL4 A;  3J9S A;  4A42 A;  3BAL A;  4XBN A;  4EN7 B;  2OPW A;  1Y4W A;  2VG9 A;  1JYX A;  2IUW A;  1AL0 G;  5CNA A;  1PIV 2;  1UX7 A;  3CDZ B;  3O0V A;  4PF1 A;  4PQQ A;  5D8A A;  1RUH 1;  5A3T A;  3RJ2 X;  1UX6 A;  2W68 A;  5LK5 A;  4JHZ A;  1YFW A;  2HWB 3;  1DCS A;  3J7M A;  4GJY A;  3H8U A;  3RSJ A;  1H2N A;  1QXJ A;  5T5P A;  3NO8 A;  1GSL A;  2XB6 C;  1ENS A;  3OEB A;  3KQR A;  4HMZ A;  4IEP A;  4D6Q A;  3FLR A;  3S0M A;  2YFZ A;  2Z2S B;  4G4F A;  4NPM A;  4LIV A;  3WCS A;  3VL9 A;  1WCK A;  2PMW B;  3WVJ A;  3ZN6 B;  1GYK A;  2ZZQ A;  4XAE A;  4XDQ A;  5LY2 A;  4IEZ A;  2XBO 3;  2UWC A;  1IGO A;  3PVN A;  5FZG A;  4LNV A;  1WGP A;  2J1S A;  5A1A A;  1LR5 A;  3III A;  5LZ6 A;  3UET A;  2P1B A;  1AXZ A;  3K75 B;  5BXX A;  2B39 A;  1XC6 A;  1SLC A;  1YQ5 A;  5JIA A;  3RQ0 A;  2BWA A;  4COY A;  3USS A;  3OG2 A;  3AP6 A;  5JZG A;  1GZT A;  3IDE A;  5FY7 A;  2O14 A;  3BYW A;  4KG0 A;  4Z2W A;  1NYW A;  1A34 A;  2OX0 A;  2A7A A;  2ILM A;  5IJR A;  4BK5 A;  5IVB A;  4UFL A;  4X6Q B;  1U5X A;  1B09 A;  3K46 A;  4KWJ A;  1VBA 1;  2FCU A;  5FLJ A;  1GOG A;  3OF1 A;  4HVR A;  3GAL A;  5IUQ A;  4DEQ A;  1X33 A;  3O1T A;  4XUO A;  1DQ1 A;  4QHB A;  3B9I A;  1PZ9 A;  4M3C F;  2G4I A;  4YAR A;  4N9I A;  1PMI A;  2XLA A;  5IK7 A;  2PAM A;  4HPK B;  4IEO A;  4L2N A;  3JUU A;  1DU3 D;  4LK7 A;  4MXW B;  1H2M A;  1QWR A;  4XQ4 A;  4BJ0 A;  3KS7 A;  3N7K A;  1PGW 2;  4XIK A;  5J98 B;  4EJR A;  2D44 A;  3JQW A;  3VD4 A;  1UOG A;  4DXS A;  1WLC A;  3J7L A;  1EAH 3;  4BPZ A;  3TAY A;  4MGY E;  4V2V A;  3WQB A;  3T4H B;  5F6L B;  1KD7 A;  3N7L A;  4JDM A;  1QHD A;  3RZM A;  2ZMK A;  1K5J A;  1R1A 3;  1UMI A;  3FX3 A;  1F2N A;  1NX9 A;  2W1W A;  3KM5 A;  2CU5 A;  2OPK A;  3U14 A;  3UV9 A;  3SH4 A;  2DU0 A;  2C24 A;  2JX9 A;  5CAD A;  1XNT A;  3LWC A;  5FYB A;  1FOD 3;  3ZPY A;  4F8A A;  3LOB A;  1HB4 A;  2R07 3;  3AMH A;  2D6K A;  4LO4 B;  3GJA A;  2WZR 1;  4NRM A;  4GH4 A;  4AXO A;  1QJX 1;  2RM2 3;  3AKR A;  4E27 A;  2ORZ A;  1S0D A;  1JZ6 A;  4LO7 A;  1PVC 2;  2ZX2 A;  3WP6 A;  1RMU 3;  4CVU A;  3ZSE A;  2ZHM A;  3LFM A;  3I97 A;  1X36 A;  4AI1 A;  1DQ6 A;  2ENR A;  2X09 A;  3I3B A;  5LRS A;  4Y20 B;  3WDU A;  4CEW A;  4K8R B;  2CGO A;  5GLT A;  2J1R A;  4YG0 A;  2VM9 A;  1AUY A;  4RFT 0;  2GZW A;  4FOY A;  1ULG A;  1TMF 1;  1BYH A;  3O1O A;  2D98 A;  2JDZ A;  3CL1 A;  3H9A A;  2Y6G A;  4CU9 A;  5FLH A;  3DN7 A;  5FAX A;  4PJY A;  3DYO A;  5IT6 A;  2ZZJ A;  4BQX A;  2J1T A;  2W5F A;  4N53 B;  5DPN A;  2K46 A;  5J7M A;  1OXC A;  2BDR A;  3POE A;  2MEV 2;  4Y3O A;  1HN1 A;  2OII A;  1RUJ 2;  4YLZ A;  4W8J A;  5EYX A;  4N9H A;  3OYW B;  3LDK A;  3D0J A;  3DUI A;  3LIH A;  3WD5 A;  4BXS V;  1LEC A;  1TVG A;  1MS3 A;  4WM8 A;  3ZOI A;  4BDV B;  4Q4X 3;  3LA7 A;  5JVV A;  2VXR A;  2I07 B;  1HQN A;  4E4H A;  1PM4 A;  1ASJ 1;  2BZD A;  3M7A A;  2HWC 3;  4GXL A;  1U5I A;  1WCS A;  3ACI A;  2YUE A;  5A7S A;  3VBH B;  3SEE A;  3N9L A;  3D4K A;  1AJK A;  1VBC 2;  1GZ9 A;  3DXU A;  1IHM A;  1NUK A;  1XBF A;  4KNC A;  1ENQ A;  4M3C E;  5KHI A;  2HWF 3;  5BNP B;  4Q4V 1;  5GLW A;  5F8P A;  2ZS6 B;  4M0H A;  4NR1 A;  4YW3 A;  5C8C A;  2ZOE B;  1ZX5 A;  3D82 A;  3NNL A;  5K0U A;  1FAT A;  1PO2 3;  2Y26 A;  1O8S A;  5DUV A;  4YVW C;  2DUP A;  3R05 A;  2QCS B;  5IAV A;  1DF0 A;  4YGE A;  3WDW A;  2JIG A;  1W90 A;  3JU9 A;  4PBO A;  4BQ2 A;  2W1S A;  5K9Y A;  1HQL A;  3MPB A;  3POG A;  4P02 B;  2WFF 3;  1I6X A;  1RC6 A;  2BFU S;  4B7E A;  1REE A;  5LA9 A;  4BME A;  1H1M A;  3CQO A;  1UCX A;  1W8T A;  3BIW E;  4MYE A;  4Q4W 2;  1SZB A;  1SAC A;  4P9Y A;  1G9C A;  1A3K A;  5HCH A;  2JG9 A;  4QX8 A;  1CES A;  4M0N A;  5F3G A;  3RFR A;  4AI0 A;  2JEC A;  5HXM A;  1OOP A;  3ZO0 B;  3LEM A;  4I02 A;  3MID A;  4YVS A;  2XJU A;  3O1M A;  1FAY A;  5ACA 1;  1HJG A;  3VHN A;  4Y4Y A;  4NWW A;  5F37 A;  3FN9 A;  1ZZ9 A;  3NAP B;  4LUL A;  2VQA A;  1UYX A;  5EYY A;  2YRO A;  1POV 0;  1RUI 2;  5F3E A;  5BNN C;  1FT9 A;  1GP6 A;  2KD7 A;  5LA2 A;  3SCG A;  3U11 A;  5HPO A;  5J36 A;  3B3Q E;  4Q0Q A;  2CGN A;  1C5H A;  1ULC A;  2W9X A;  4ITC A;  1GWM A;  3GXU A;  1W8U A;  1WCU A;  5T55 A;  3RS6 A;  1RUE 2;  3KV9 A;  2D43 A;  3NV4 A;  4ZPI A;  4WM7 A;  3T1L A;  1LOB A;  1HDK A;  1RUC 1;  2HWD 3;  3J8F 1;  1NQJ A;  4IE6 A;  4J1X A;  4PCR A;  2NPI A;  4AHY A;  3H1M A;  1DZR A;  4CTE A;  1W6Q B;  3LFI A;  3TN9 3;  5HXV A;  2QE3 A;  4HVO A;  2XL9 A;  4A44 A;  1PNG A;  1IOA A;  3K4D A;  2VMD A;  2XXZ A;  4PIZ A;  1CPN A;  4IE5 A;  4R9D A;  2F4P A;  3O0X A;  1ZBE 1;  2D97 A;  4HG6 B;  1UW8 A;  2VOT A;  2FDH A;  2XJS A;  5L19 A;  3S5Q A;  3CKH A;  1TME 3;  4RGK A;  2LW8 A;  5DAX A;  4AQ2 A;  3LF7 A;  3OBZ A;  4GMP 0;  3WF0 A;  3FWE A;  2BNM A;  3NNM A;  1PIV 1;  2Y60 A;  1ZBA 2;  5FPA A;  5IWF A;  4RL7 A;  4TZD A;  4CUC A;  4QPY A;  3E5U A;  4AEM A;  5I8Y A;  1HLC A;  3VKN A;  1I3H A;  2GC3 A;  5FOJ B;  3S7E A;  2W0X A;  4X6R B;  3RZG A;  4HK9 A;  4G3Y C;  2JB8 A;  3WOG A;  4QX2 A;  1QIQ A;  2W46 A;  2Y6H A;  1NE6 A;  3AZW A;  3T0A A;  2QQO A;  3NKT A;  4PDW C;  4KMQ A;  2GH2 A;  2E26 A;  2EIG A;  2JIC A;  2WZ8 A;  1Q43 A;  2ZJC A;  3CMG A;  4GD4 A;  4AF9 A;  1VBB 3;  2WYF A;  4GZ9 A;  1FMD 2;  5A3U A;  4AZZ A;  4MH0 E;  4D0Q A;  5T5L A;  4EWD A;  3K51 A;  1W2A X;  1WLW A;  1QGL A;  4OZO A;  3A0N A;  4NHL A;  1Y9G A;  4DUV A;  1YI9 A;  5LBC A;  3ACL A;  1ZRE A;  2IFR A;  1W0P A;  1L7L A;  1XU1 A;  2B46 X;  3TEX A;  3T3Y A;  1OD5 A;  2CAU A;  4GAL A;  4AI2 A;  2BQP A;  2GAU A;  2MNG A;  4CEY B;  3PL0 A;  4NRP A;  4H3W A;  2BGC A;  4MO3 M;  5IK4 A;  5JPM B;  1BQP A;  1QOT A;  2W1Q A;  3KGL A;  4A7Z A;  4CXY A;  3VBR A;  1W9W A;  2WN3 A;  4XDO A;  4AWD A;  4XF0 A;  1SMV A;  1C1F A;  3M70 A;  4QKN A;  1ZZC A;  3GM8 A;  3SH5 A;  4BB3 A;  1ND3 A;  1QU0 A;  1LOA A;  2ZXQ A;  1H9W A;  1YI7 A;  1JS9 A;  1BBT 3;  1S0C A;  1SBF A;  3CJI B;  1WUV A;  5FKB A;  2DUR A;  4GIQ A;  1CZS A;  2CWM A;  2OXB A;  2DFB A;  3HVD A;  5A1L A;  3WUC A;  1CN1 A;  1WLT A;  2YGL A;  3VV1 A;  1GR3 A;  2VOW A;  4OI0 A;  2P6H A;  4RS5 C;  3EQE A;  1J3R A;  5A6X A;  1BKZ A;  3SCF A;  2VZT A;  2W1U A;  4Y1Z A;  4LQR A;  1AYN 2;  3NVC A;  4PLN A;  1N1V A;  1RJ8 A;  2VNO A;  2XJQ A;  2ZHL A;  2CGP A;  1PGW 1;  2HWB 2;  1HRV 2;  1XB9 A;  1XPW A;  3ZN4 A;  3DF0 A;  3WF4 A;  3ZXA C;  2VTF A;  3VBS C;  5JDB A;  3WNM A;  3AYE A;  2QTW B;  2ZAB A;  1JMU B;  2RG4 A;  4XFF A;  3RWN A;  3VD7 A;  1IG0 A;  4HKW A;  5FBJ A;  1RHI 3;  2VMF A;  3THD A;  4FPO B;  4UFK A;  1AR7 1;  1DYP A;  1OLR A;  5FO8 B;  1COV 1;  2RR1 3;  4K8F A;  4XF4 A;  3P6B A;  1LES A;  4BQW A;  4F7Z A;  4HL0 A;  3PUI A;  4YG3 A;  3RDI A;  1LGN A;  2XBO 2;  5FYT A;  4CDX B;  5C7G A;  4H14 A;  4NRQ A;  4G9S B;  2OQ6 A;  1GNY A;  3VBF B;  3E6D A;  1IS3 A;  3CZJ A;  5LBE A;  4LBQ A;  3G6J B;  1JW6 A;  1PVC 1;  2XHN A;  4W4Z A;  5FYH A;  1RED A;  5FZ9 A;  5A3W A;  3WCR A;  2E9Q A;  4LLF A;  3FBM A;  4QHO A;  5LAS A;  1DGW A;  2LUW A;  5EV7 A;  1QJU 1;  4CU6 A;  4MGS A;  3DEM A;  2FCT A;  1YJL A;  3IDA A;  3RGB A;  2ADE A;  1QH7 A;  2BPA 2;  2WQ8 A;  3B02 A;  1F15 A;  3FHA A;  3O12 A;  5C4W B;  2WC2 A;  4PI2 A;  1ZA4 A;  2X8K A;  1Z7S 3;  3AZZ A;  4ZS3 A;  4ZU4 A;  1NZI A;  1SLA A;  1JU3 A;  3GDB A;  3ZN5 A;  1ZM1 A;  2FCV A;  5F5C A;  5J37 A;  1MS9 A;  4R4X A;  4DOU A;  2WAA A;  3RWK X;  3LGR A;  2Q8E A;  3KGZ A;  4CDW A;  4B4R A;  2C5D A;  4OCT A;  5BNQ A;  1RUJ 1;  3JBG 3;  2CNA A;  4ARX A;  3WQ7 A;  4W6Y A;  1ULF A;  1WMD A;  3FJS A;  5DDJ 3;  1EY2 A;  3L2H A;  5CA6 A;  3TEW A;  1EAH 2;  1V6N A;  1GFF 2;  4QGM A;  1W2U A;  3IDB B;  4A2U A;  5JIU A;  2FDG A;  1W6O A;  2FMY A;  2XVL A;  1Z78 A;  3KCY A;  1JXN A;  1R1A 2;  1ZZB A;  1KJL A;  4L92 A;  4XUP A;  4GB3 2;  1OQD A;  4NHM A;  5DAQ A;  1XSR A;  2AGS A;  1FOD 2;  3S6P A;  2R07 2;  4IE7 A;  4YWA A;  1Q8O A;  3C7E A;  5K8S A;  3R0R A;  5ANN A;  4ZON A;  2RDS A;  4D94 A;  1XRU A;  2RM2 2;  4H7M A;  3VDA A;  3W20 A;  3S30 A;  2JJ6 A;  4FVV A;  1RMU 2;  5FPU A;  3VDD B;  2B4K A;  4HZF A;  2Y64 A;  3WV6 A;  3ZSM A;  5IFP A;  1QDC A;  4YVW A;  2DTY A;  4YG6 A;  3TWI A;  5FMC A;  5FZ3 A;  2P6C A;  1GZW A;  3T30 A;  4X8N A;  1WZX A;  2AUY A;  4Y1X A;  2BVB A;  1XND A;  2Q1M A;  3TNP B;  4OYU A;  5GZE A;  3W5M A;  2WWS A;  3ELN A;  4WVM B;  5KC6 A;  3SIS A;  4Q4W 1;  5L9V A;  3WG3 A;  1FNY A;  5FPV A;  4FPF A;  1ZRR A;  3N3H A;  3W9A A;  3DV8 A;  2JDK A;  4WVZ A;  4Y22 B;  2FZ2 A;  4B1L A;  3ITQ A;  1NXM A;  4ASK A;  1IS4 A;  3TOJ A;  1KRI A;  1E5H A;  4CCO A;  4LUM A;  1A8D A;  2C4X A;  5JSP A;  1CJP A;  2GSY A;  2J7M A;  2YV8 A;  4QU1 A;  3H7J A;  1NCR B;  4QXB A;  1Q5O A;  1YXW A;  3LDB A;  4OHZ A;  3UL2 A;  1BVV A;  1SG3 A;  3INA A;  1RUI 1;  3MV1 1;  5C8W A;  1VAM A;  2EAK A;  5BNN A;  4Q4X 2;  4Y24 A;  3ILR A;  4C91 A;  3CU7 A;  1BZW A;  5BPX A;  1OA4 A;  1C57 A;  2W94 A;  3EHK A;  1J58 A;  1KIT A;  1OLM A;  1RUE 1;  4Q29 A;  4Q5O A;  5G05 L;  3T0B A;  3T0D A;  4JQR A;  3OUH A;  1W9Y A;  4N53 C;  3FBY A;  1C8M 3;  4LBQ D;  3WG4 A;  1DGW X;  1SHW B;  3MZH A;  1ULE A;  1OH4 A;  3ZFE B;  2HWF 2;  2D3P A;  2CDP A;  3C7F A;  1BLZ A;  1WMX A;  4AGV A;  1AYM 1;  2LRO A;  1CPM A;  4DRV A;  2W08 A;  5APA A;  5LK7 B;  3VZM A;  4XAA A;  1UY0 A;  2YPJ A;  4BWO A;  5F6K A;  1PO2 2;  2PLV 2;  2AEY A;  5ANQ A;  2RVA A;  5LA1 A;  4QX7 A;  3AZY A;  3B00 A;  3VBH C;  1W6N B;  2EIB A;  1EUT A;  4N43 B;  2D93 A;  1JYV A;  3ZX7 A;  1VIW B;  4QMA A;  1Y9M A;  1RVF 3;  2WQ4 A;  2ZMN A;  4C90 A;  2DVG A;  5BNP C;  2E7T A;  1W06 A;  5LEK A;  2LM3 A;  3ES1 A;  1DLC A;  1GV9 A;  1KDK A;  1LOF A;  3MF9 A;  3N9M A;  1VR3 A;  3EB7 A;  3VKO A;  1W2O A;  3AK0 A;  5J3U A;  1W03 A;  4ASM B;  2VZQ A;  1MVQ A;  3OCP A;  5BNO C;  1MS8 A;  4PIY A;  2RS3 3;  2RS1 2;  3ZXE A;  1WCQ A;  4IEU A;  5DAP A;  1O91 A;  2NYY A;  4O9G A;  1MS0 A;  4PDW A;  5C9A B;  1H4H A;  3P5B A;  2WSV A;  2AYH A;  4K6B A;  1SQ4 A;  1CJD A;  3VN4 A;  3WP3 A;  2A70 A;  1OC1 A;  1W04 A;  1S0G A;  2ZGN A;  4GAZ A;  5GKA C;  1AJO A;  2D7F A;  1C8N A;  3LIG A;  4W6W A;  2ARA A;  2OUJ A;  4P9J A;  3VD3 A;  5KHJ A;  3A21 A;  4HAN A;  3GZT B;  4GWM A;  3ZM8 A;  2NP0 A;  3LPG A;  2CWS A;  3JD7 2;  2VQ0 A;  2EID A;  3LKJ A;  2FMD A;  4BM8 A;  1G86 A;  5EQU A;  1DYK A;  4H7L A;  1FYU A;  2WO2 A;  4P5Y A;  3NAP C;  1KJR A;  4XFC A;  1AR6 1;  4D3W A;  1MZ5 A;  4KI5 M;  4M3C B;  4ES8 A;  5CZK A;  3TN9 2;  4QB2 A;  1SLL A;  1LGC A;  3J7N A;  5F3I A;  4XCA A;  4ZHN A;  2QQV A;  2ZGM A;  3PME A;  4DB5 A;  3OSD A;  4BLJ A;  5A7W B;  1Y3T A;  3R4S A;  2D3S A;  4UF0 B;  5DXD A;  1HB1 A;  2R06 1;  2WNV B;  4UW5 A;  1R09 2;  4AVC A;  1A78 A;  5EWS A;  5A7Q A;  5C5U A;  5T3N A;  2BVV A;  2VNR A;  1TME 2;  5E6H A;  2OZ6 A;  5EJ1 B;  4YM3 A;  1B35 B;  2HH9 A;  4FFI A;  4LK6 A;  4KQ7 A;  3MBW A;  5JR2 A;  1OI6 A;  2R7E B;  5JXH A;  2DCZ A;  1ENR A;  1AYN 1;  1LUL A;  2BV4 A;  2G19 A;  3PUR A;  4UT5 A;  1HRV 1;  2HWB 1;  2VTX A;  1CZT A;  3Q8B A;  3MGU A;  3CF6 E;  4NHK A;  3ECQ A;  3HIF A;  5FXV A;  3POF A;  3W21 A;  1LHN A;  4AQ6 A;  4O65 A;  1RIT A;  3VBS A;  4J1W A;  3T08 A;  2VZV A;  1QXR A;  4RR3 B;  1LEM A;  4LPL A;  2R0H A;  4YW7 A;  1I1E A;  4K20 A;  4QPW A;  1VBB 2;  3K4A A;  1LB2 A;  4ZU7 A;  2BGO A;  5I93 A;  4V1P A;  1W9T A;  2JE8 A;  2VAU A;  2HWE 3;  1JUI A;  3H42 B;  1AZD A;  3I2K A;  4MHR A;  3QH6 A;  4HBN A;  4DXT A;  3SH3 A;  4E4S A;  2FZ1 A;  2ZGL A;  2YC0 A;  2IZW A;  4Q0P A;  1X8E A;  4QDQ A;  1S2E A;  1UQX A;  1KGY A;  2WA4 A;  2YC2 A;  1H30 A;  5E88 A;  4HN1 A;  4QGN A;  3BPS A;  3WQ1 A;  2WT2 A;  1UPS A;  3H3U A;  2BER A;  3FMG A;  4B1M A;  1T6G C;  2R1D A;  4CDU B;  1BVP 1;  3M1H A;  1NKG A;  1LED A;  2WAO A;  2Y8K A;  4I0W B;  5BNO B;  1O5L A;  3O1U A;  1NA1 B;  4CCE A;  1DBN A;  2RMU 1;  2ZGO A;  1D0H A;  1WD4 A;  3L2Y A;  1SFY A;  3ZN6 A;  5KHH A;  4AVS A;  3ON7 A;  1RYY A;  4Q1P A;  3QBQ A;  4OVE A;  2RJK A;  3I2H A;  3PDQ A;  5L9B A;  3FUQ A;  1C3H A;  1AX2 A;  2ET7 A;  3WNP A;  4BXF A;  3B94 A;  1CZV A;  3AMN A;  5IFT A;  4IND A;  1AR9 2;  5FZC A;  4CEY C;  1LEN A;  3VL8 A;  1F35 A;  3Q8A A;  4CUA A;  1FV2 A;  1BEV 2;  3C2U A;  3ILF A;  2FHR A;  2ZML A;  5ABJ B;  5LBF A;  1NY7 2;  3VHR A;  4WZC A;  3WDX A;  1QQP 3;  1QXP A;  5AVP A;  4OUL A;  4LIT A;  5CG8 A;  2RDQ A;  1OPO A;  3I7D A;  1YC6 1;  3VDB A;  3CJI C;  1PX3 A;  3DXT A;  3I59 B;  1R1A 1;  3IN9 A;  1AF9 A;  2JD4 A;  4GB3 1;  1RHI 2;  4OHW A;  1W6P B;  1TEI A;  2C1F A;  2RR1 2;  3N7M A;  2ZX3 A;  1W6M B;  4HPK A;  2GNM A;  4MXW A;  1S55 A;  4W6X A;  1JYT A;  1HRI 2;  1ND2 B;  1PO1 3;  5A3M A;  1N1Y A;  4FXK B;  4NHX A;  4H55 A;  1PGL 2;  4NRO A;  2CAV A;  1VRH 1;  1CWP A;  4JGY B;  2C9K A;  2RM2 1;  3MFA A;  4JZR A;  2X29 A;  5A7O A;  1S0J A;  1N3Q A;  1RMU 1;  3I54 A;  2PN5 A;  3K4Z A;  4XUT A;  1UYY A;  3VBU B;  5FZF A;  4LEJ A;  3KQ4 B;  3IPV A;  3AFK A;  4Y26 A;  2W3J A;  2QQK A;  2RHP A;  2ZKN A;  3A0K A;  1JZ5 A;  3JXS A;  5D2A A;  2PAE A;  3DGT A;  5BV6 A;  1EV1 3;  4ZKT B;  1PM7 A;  2WS9 1;  3H50 A;  4CDX C;  4FI9 A;  1HQW A;  1Z7S 2;  1ODN A;  1WKY A;  4ORF A;  3VBF C;  2YGM A;  1SBE A;  1RUG 3;  4FQ4 A;  5AFB A;  5LY1 A;  2TNF A;  1NCQ B;  1SPP B;  5CKN A;  4IV3 B;  1AR8 2;  2CDO A;  2RDN A;  4PIX A;  5HV4 A;  3ZXL A;  4LBM A;  3BI3 A;  5HCA A;  2GP5 A;  3PUS A;  3BN6 A;  5I91 A;  5LAT A;  1PGS A;  3LOI A;  2WNU B;  3IAQ A;  3MLJ A;  4GJZ A;  4RHV 2;  5DDJ 2;  2GN7 A;  1ST8 A;  2YU1 A;  4QX5 A;  4XFA A;  2DBN A;  1S0F A;  3LEI A;  2YZ4 A;  1ZRD A;  5C4W C;  1MQT B;  2VMG A;  5IHR A;  2Z42 A;  1TNF A;  4XJW A;  1N1T A;  3K77 A;  1HKD A;  5FYY A;  4CZS A;  1UYZ A;  2WDB A;  1U0A A;  1SBD A;  3NQH A;  2QQW A;  4Y5Z 0;  2ATF A;  2PXJ A;  2ZBJ A;  1AXK A;  4XJ9 A;  5FPB A;  2HEV F;  1QH6 A;  3IMM A;  2AR6 A;  1FPN 1;  1CVN A;  5JOX A;  3RJR A;  5FP9 A;  1KDM A;  2B5H A;  4TTG A;  3USU B;  5GZC A;  1TE1 B;  3OYW A;  4Q4Y 3;  3PJY A;  3AKS A;  4FCA A;  1POQ A;  2DTW A;  3ATG A;  5FWE A;  5IVV A;  1F5F A;  5D21 A;  4LA3 A;  4AK3 A;  4UFM A;  4LHN A;  1DFQ A;  1O6U A;  2PLV 1;  4AEK A;  1OBN A;  2XQR A;  2E31 A;  5CFD B;  4AYU A;  2JWP A;  3T2O A;  1Q8P A;  1OF3 A;  3NJX A;  4Q0V A;  3VZN A;  5DZG A;  2BOI A;  1OVP A;  1RUF 1;  2RS5 1;  1BK0 A;  1JU4 A;  3PU8 A;  4ISQ A;  3UK9 A;  1GQH A;  2XWB B;  3I8T A;  4P9W A;  3VBO B;  4AVV A;  4LUK A;  3AXD A;  4XAC A;  4MGI E;  3VDD C;  5LBB A;  1UXZ A;  4DMI A;  1F4H A;  2GAL A;  4YW4 A;  5BNO A;  2RS1 1;  1MEC 1;  1V6J A;  3V0A A;  4NUB A;  2VZ1 A;  4XF1 A;  2YU2 A;  2P3I A;  5K4L A;  4CUB A;  5JOW A;  1Y7B A;  4KG8 A;  4NN0 A;  3H0O A;  2ORX A;  4IEX A;  4PLO A;  2W2I A;  1H1A A;  1DYO A;  1PZ7 A;  2WUH A;  4S2F A;  1UAI A;  1VBD 3;  4ZZ8 A;  1LHU A;  2BW8 A;  3LA3 A;  5JI7 A;  1D4M 1;  2V73 A;  4QGL A;  3WF3 A;  4ET7 A;  1UO9 A;  4EWA A;  3TEY A;  3ZYI B;  3O1S A;  1IPJ A;  4UBG A;  3JD7 1;  4UFJ A;  3OUI A;  5L7O B;  2JDY A;  1JN2 P;  2DCY A;  1J3P A;  3PLQ A;  4FOQ A;  1AL2 3;  2JKB A;  3A23 A;  4CP0 A;  1R08 3;  4A6O A;  4UW6 A;  1NCR C;  1O59 A;  4IEV A;  2ZGR A;  3NAP A;  3I3M A;  1QJY 1;  1PK6 B;  1LAJ A;  4CDQ B;  3LQC A;  4D6S A;  2ZGP A;  1ZRI A;  2VO5 A;  3E6B A;  4MGK E;  3JB8 A;  4QX3 A;  1XOY A;  3CEW A;  1IS5 A;  3OGJ A;  4K9S A;  4I3G A;  5HCF A;  2VXJ A;  3ZPO A;  2N7G A;  3HR9 A;  3WLU A;  5H9R A;  1D4V B;  2VOK A;  5EJ3 A;  1R09 1;  3FL7 A;  4TN7 A;  5A3P A;  5EP9 A;  5JPN B;  1A6C A;  1TME 1;  5FBZ A;  1REF A;  2QKD A;  4SBV A;  3ZFE C;  4EV0 A;  5EPA A;  4QKF A;  5FZ1 A;  1F9K A;  5CIS A;  1MS4 A;  2FBE A;  4I09 A;  5DAW A;  4FOV A;  1W6Q A;  4QQH A;  5FZA A;  3AZV A;  1FI2 A;  1S0I A;  1VAK A;  2WWU A;  3C7H A;  1QKQ A;  1MS5 A;  3PUH A;  4C1W A;  2RS3 2;  2RV9 A;  5LWB A;  5IAT A;  1ALY A;  1VMJ A;  5F9T A;  1YFU A;  4FFG A;  2DYC A;  2DVD A;  1QDO A;  1RUH 3;  2PHD A;  4N43 C;  3WG1 A;  4LKS A;  4CA9 A;  5KXB A;  3MUY 1;  3D3A A;  5FY1 A;  1AX1 A;  2VMC A;  4M00 A;  3BCW A;  1Y43 B;  5FCC A;  2BRT A;  4ES9 A;  4FAG A;  2BBA A;  4HVQ A;  1L7R A;  3OD4 A;  4IGQ A;  2WR9 A;  2SBA A;  1LHV A;  4ZU5 A;  4DS0 A;  3F95 A;  5FFO C;  3MUZ 1;  4OI2 A;  1CON A;  3R4U A;  4FFH A;  4YYO A;  3ZYP A;  4P9G A;  5FMB A;  2QDN A;  2A5Z A;  2H6C A;  4OI1 A;  4E4D X;  1GMM A;  1W28 A;  5C9A C;  2D6P A;  3BVC A;  1K5M A;  4JAA A;  2EVX A;  3H1Y A;  3MPP G;  5CYY A;  4QX0 A;  4QB1 A;  4XXP A;  4KH9 A;  4AHZ A;  4UOJ A;  3WNN A;  1U5Z A;  1J83 A;  3WW2 A;  2O8Q A;  3PMS A;  1JH5 A;  3VKM A;  3O7O A;  1IS6 A;  1VBE 2;  1VBA 3;  1GQG A;  5FO9 B;  1VAV A;  1AR9 1;  2QQJ A;  5A32 B;  4CEY A;  2PHW A;  1UOF A;  4PBP A;  4XQW A;  1BEV 1;  3B01 A;  5F5I A;  4CPB A;  5BUV A;  1DQ5 A;  4P9I A;  2V4A A;  1HXS 2;  4AE2 A;  3SLI A;  1G9A A;  1NY7 1;  2I74 A;  2P34 A;  2DWR A;  2E33 A;  3ILN A;  4YZ4 A;  3ZDV A;  1POV 1;  3CJI A;  5IVJ A;  4CU7 A;  2D40 A;  2A3X A;  2WNV C;  3SKV A;  2DV9 A;  3FE5 A;  2IXI A;  2QQL A;  5A33 B;  1B35 C;  3ZYB A;  2E32 A;  3RI9 A;  2HWE 2;  2EIC A;  4OHV A;  4I2O A;  3ZFG B;  4OUM A;  1Z0H A;  1HRI 1;  4OHX A;  3ABZ A;  1LOE A;  2PEL A;  4QHZ A;  2PA7 A;  1W05 A;  3WNK A;  2A1X A;  4KWU A;  2ZGK A;  4PHZ A;  3U78 A;  4CCJ A;  4CEW B;  2Y6K A;  3CLP A;  1ENX A;  4EN0 A;  1V9U 1;  4LXL A;  3I4I A;  2KA3 A;  3EXU A;  5I0D A;  3NNG A;  3AC0 A;  1KXG A;  3S7I A;  4RR3 C;  2WZR 3;  3AKT A;  2UWB A;  3WF2 A;  1QJX 3;  1W99 A;  2TUN A;  2OUH A;  4BYY A;  4LKD A;  2KR2 A;  2B45 X;  3KV6 A;  4YGB A;  1H9P A;  1F31 A;  3ZFF B;  5FQ0 B;  2A6X A;  2XVG A;  3DKW A;  3HWJ A;  4L99 A;  4CDX A;  3ZR5 A;  1WW7 A;  3AKQ A;  3ZKY A;  2ARE A;  3KT1 A;  3EYP A;  3M3E A;  4GMP 1;  2F4L A;  1BXH A;  2VTX J;  2X53 S;  5KHK A;  1G9B A;  1AR8 1;  4YFW A;  5FO7 B;  5JI9 A;  5FYU A;  1CR7 A;  5M0T A;  4HLT A;  3WDT A;  5FLI A;  4CDU C;  2XJR A;  1TMF 3;  3NV2 A;  2HEW F;  3QCW A;  4TWT A;  2OYZ A;  1NA1 C;  2Q8D A;  4O7X A;  4XFI A;  2VMH A;  4RHV 1;  2DCJ A;  1O4Y A;  2YDE A;  3OB8 A;  1QQP 2;  3AMP A;  1UN1 A;  4P00 B;  4HXC A;  4ZS2 A;  5FZ0 A;  2PHU A;  4YPJ A;  1YCI A;  4BIF A;  4BIS A;  4GKX A;  1CAV A;  1SDD B;  2CTV A;  3I2F A;  2YBK A;  5FY9 A;  1DZT A;  4B4Q A;  4CCC A;  2DU1 A;  4IER A;  2R04 2;  4NWV A;  4AQT A;  1JOJ A;  1LOD A;  2XJT A;  5C8C B;  1I9R A;  4LO6 B;  2HYK A;  5LRR A;  3TYJ A;  2YG0 A;  1ASJ 3;  1I5Z A;  2VBD A;  3D0S A;  5ABJ C;  4QM8 A;  4CXX A;  5FWJ A;  1OUS A;  5J1X A;  3PIJ A;  4COV A;  2VCB A;  5GAL A;  3ASI A;  3HAG A;  3ZVX A;  5CEH A;  1D2Q A;  2MHF A;  5FUP A;  3ROU A;  4CU8 A;  3MIF A;  5FZE A;  2WJS A;  5EFU A;  3DEC A;  3ZR6 A;  4Z8B A;  4Q4V 3;  4MOA A;  3O14 A;  4ASL A;  1IKP A;  4YZ5 A;  2QJV A;  1MZF A;  2CV6 A;  3HOB A;  2RE9 A;  2B7Y A;  4CUG A;  1X50 A;  5A3O A;  1M06 G;  3T2P A;  5FMD A;  2PTM A;  1ND2 C;  2JDA A;  3UJQ A;  4RGA A;  4IET A;  4KU8 A;  4BE3 A;  4JGY C;  2Y34 A;  1LJ7 A;  5E1R A;  3ZSK A;  4CPB D;  1MVE A;  3DYP A;  4M4P A;  2CHH A;  1WD3 A;  1E5R A;  2WT0 A;  3T2Q A;  2JB4 A;  3VDD A;  4IV1 B;  2GC0 A;  4FPH A;  3VBU C;  5FZ8 A;  3SC7 X;  5FYZ A;  4CXW A;  1GKB A;  2J1A A;  1GLH A;  3VHO A;  4AVA A;  2ZEX A;  3MIB A;  3Q8E A;  3HQU A;  2VZU A;  5ISL A;  3BTX A;  1RUD 3;  2E53 A;  3WIN E;  3O1P A;  4XHX A;  1UY1 A;  1WCD J;  3NNJ A;  4WVM A;  4XET A;  4C0H A;  5IW0 A;  5ACA 3;  3THC A;  4DEV A;  4FQZ A;  3WP5 A;  3DKQ A;  2D5F A;  5GZG A;  1GZC A;  5JLV A;  1NCQ C;  1C28 A;  4IV3 C;  1C4R A;  1XE8 A;  4Z1V A;  1H0B A;  3ZYF A;  3HMY A;  3LPF A;  4E8C A;  4XUR A;  1YWK A;  2X5I B;  4XOG A;  5FV3 A;  2JG8 B;  1V6O A;  4UXA A;  3HT2 A;  3T09 A; 
#chains in the Genus database with same CATH homology
 1O8P A;  5JXI A;  1JHJ A;  4JHZ A;  3WEZ A;  3VD3 A;  3A21 A;  3ZM8 A;  3LPG A;  4QDS A;  3WSO A;  3NRU A;  3OEB A;  2EID A;  2W95 A;  2WBK A;  5EJZ B;  3DYM A;  2YFZ A;  2WO2 A;  4P5Y A;  2X10 A;  1GOH A;  1EUU A;  4KI5 M;  1K12 A;  5CZK A;  4QB2 A;  4XVH A;  2J1S A;  5A1A A;  3III A;  3WF1 A;  3UET A;  1W9S A;  3K75 B;  2VZS A;  3VDC A;  1XC6 A;  2QBX A;  5G04 L;  3OG2 A;  1UXX X;  5EJ1 B;  4BK5 A;  5IJR A;  3MBW A;  5JR2 A;  1TG7 A;  3K46 A;  2R7E B;  5JXH A;  1GOG A;  2VR4 A;  4DEQ A;  3LE0 A;  5DN2 A;  3E1F 1;  4XUO A;  1CZT A;  1W8O A;  3GGL A;  1UMH A;  3ECQ A;  2VZO A;  3WNO A;  3F2Z A;  3T08 A;  2VZV A;  4LPL A;  1K42 A;  4QPW A;  3K4A A;  1GU3 A;  2BGO A;  1W9T A;  4ZY9 A;  2JE8 A;  3I2K A;  4BJ0 A;  4DXT A;  3VD4 A;  4DXS A;  4QDQ A;  3WQB A;  1KGY A;  2YC2 A;  5LA0 A;  2QQI A;  1CIY A;  1UMI A;  1NX9 A;  2B9V A;  2BER A;  2W1W A;  4AAX A;  1GQP A;  1NKG A;  2WAO A;  2Y8K A;  1XNT A;  3ACG A;  1RYY A;  4MAD A;  3I2H A;  2ORZ A;  1JZ6 A;  2WZE A;  4CVU A;  4L0P A;  1DP0 A;  3WNP A;  5JMO A;  3UES A;  1CZV A;  3I97 A;  4XUN A;  1UZ0 A;  5IFT A;  2V72 A;  3I3B A;  2X09 A;  1JZ3 A;  4CUA A;  2LS6 A;  4E8D A;  2J1R A;  2VM9 A;  3HPN A;  4IUG A;  4ARY A;  1JYW A;  2Y6G A;  4CU9 A;  3DYO A;  3VDB A;  1PX3 A;  4OUE A;  2J1T A;  2W5F A;  4TXW A;  5DPN A;  4W8J A;  1HN1 A;  2XON A;  4BXS V;  1TVG A;  4OMD A;  4BDV B;  2YB7 A;  3SKJ E;  2VZP A;  2C9K A;  2BZD A;  4BK4 A;  3ACI A;  3SEE A;  2WN2 A;  2BGP A;  3K4Z A;  2VQT A;  1UYY A;  4XUT A;  2ID4 A;  3HNY M;  3U37 A;  1NUK A;  1KEX A;  2W3J A;  2QQK A;  1JZ5 A;  3UNP A;  1K45 A;  3JXS A;  2YC4 A;  2VME A;  4FI9 A;  1L7Q A;  1WKY A;  2W91 A;  1O8S A;  3WNL A;  4LHS A;  1ULP A;  2CDO A;  1JZ2 A;  2W1S A;  5B4N A;  3BN6 A;  4P02 B;  2J22 A;  4D8M A;  1P8J A;  4JKK A;  1JYN A;  3IAQ A;  3CQO A;  4A3Z A;  1UY2 A;  3IAP A;  3VD5 A;  3ACH A;  3LEI A;  4UI9 L;  5F7U A;  1JZ4 A;  5HXM A;  1GUI A;  5IHR A;  2DDU A;  3K77 A;  3T09 A;  1UYZ A;  2WDB A;  3NQH A;  2VCC A;  3FN9 A;  1UYX A;  4ZZ5 A;  4TTG A;  3HNB M;  2KD7 A;  5LA2 A;  5HPO A;  2VCA A;  2W9X A;  3GXU A;  2E31 A;  3NJV A;  2J1V A;  1OT5 A;  3T2O A;  1OF3 A;  3NJX A;  2WYS A;  4XUQ A;  2XQX A;  5JUV A;  1JU4 A;  4A44 A;  2VQU A;  3K4D A;  1UY4 A;  2VMD A;  5EIY B;  4HG6 B;  2WO3 A;  2VOT A;  4QAW A;  4PT6 A;  1UXZ A;  1F4H A;  4A4A A;  1XNA A;  3CKH A;  1US3 A;  2VZ1 A;  4CUB A;  2LW8 A;  3WF0 A;  2ORX A;  1OD3 A;  1DYO A;  2WUH A;  4ZZ8 A;  3BGA A;  1UWW A;  4CUC A;  3WF3 A;  4ET7 A;  2OKX A;  1GOF A;  1I5P A;  4GWJ A;  4QX2 A;  2W46 A;  4JX0 A;  2Y6H A;  3P1I A;  3T0A A;  2QQO A;  3I2I A;  4QB6 A;  4KMQ A;  1PX4 A;  2E26 A;  2WZ8 A;  4W50 A;  2HLE A;  3A23 A;  3CMG A;  3OGV A;  3OGR A;  4A6O A;  4GZ9 A;  1O59 A;  4D0Q A;  1K3I A;  1PMJ X;  3LQC A;  4OZO A;  2VO5 A;  4DUV A;  4QX3 A;  4Z2A A;  4UAP A;  4AG4 A;  4P08 A;  1F4A A;  3FL7 A;  3MO4 A;  4MO3 M;  2W1Q A;  3CZU A;  1W9W A;  2W87 A;  2WN3 A;  1J84 A;  1W0N A;  3GM8 A;  1MPX A;  3C7H A;  2ZXQ A;  5LCW L;  1JZ8 A;  3LEK A;  1CZS A;  3PUH A;  2Z4F A;  2RV9 A;  1IQD C;  2V5D A;  3J7H A;  2VZR A;  4LKS A;  3MUY 1;  3D3A A;  3OBA A;  2VMC A;  2VZT A;  2W1U A;  3HEI A;  4LQR A;  3WNK A;  2BBA A;  1L7R A;  1YQ2 A;  3C7O A;  1XPW A;  1BHG A;  3WF4 A;  2VTF A;  3MUZ 1;  3WNM A;  3VD7 A;  1NAE A;  2VMF A;  3THD A;  1GMM A;  3P6B A;  1JZ7 A;  3PUI A;  2JD9 A;  4ZXE A;  3C8X A;  5CYY A;  5C7G A;  1OF4 A;  4QX0 A;  3OEA A;  4QB1 A;  1GNY A;  3ACF A;  3ETP A;  4RN5 A;  3CZJ A;  4UOJ A;  3WNN A;  5JXJ A;  1J83 A;  1PMH X;  2XHN A;  1US2 A;  4W4Z A;  3I3D A;  1ULO A;  3IB3 A;  3HN3 A;  2QQJ A;  4MGS A;  4CU6 A;  2QQN A;  3IDA A;  3MV0 1;  3VD9 A;  2WQ8 A;  2VJX A;  3FHA A;  3I2J A;  2Y6L A;  3HJR A;  2EIE A;  2W47 A;  2X05 A;  1JU3 A;  2DCK A;  2E33 A;  1JI6 A;  2Y6J A;  3GDB A;  3I3E A;  4MGQ A;  4CU7 A;  5C71 A;  2ZEY A;  3W5N A;  2WAA A;  3SKV A;  4QDR A;  2QQL A;  4ARX A;  2E32 A;  2EIC A;  1W8N A;  3ABZ A;  2HYX A;  3I2G A;  4KWU A;  3C7G A;  2VZ3 A;  2Y6K A;  4XUP A;  5I0D A;  3NNG A;  3AC0 A;  3WF2 A;  1W99 A;  3C7E A;  4RYD A;  1R64 A;  5B4X A;  3VDA A;  3EYP A;  2B4K A;  1LNS A;  2Y64 A;  3A22 A;  4DXR A;  4DUW A;  5IYY A;  5IFP A;  3OGS A;  2J1E A;  2PQS A;  4OYU A;  4M4R A;  3W5M A;  2W92 A;  2WAB A;  2DCJ A;  3OB8 A;  4YPJ A;  4P00 B;  4XZU G;  2QQM A;  4JKL A;  1SDD B;  2L9L A;  3I2F A;  2C4X A;  3SEP A;  1T2X A;  2J7M A;  2C26 A;  3FHQ A;  1SG3 A;  2YG0 A;  3MV1 1;  5DMY A;  4QX1 A;  4OMC A;  5J1X A;  5C70 A;  2VCB A;  2W94 A;  3T0B A;  2J1U A;  5G05 L;  4CU8 A;  2WO1 A;  2XOM A;  3T0D A;  5FUI A;  2ZEW A;  3DEC A;  1SHW B;  4MOA A;  1OH4 A;  4JKM A;  2CDP A;  3C7F A;  1H6Y A;  3HOB A;  3T2P A;  3CIH A;  2JDA A;  4GWI A;  1UY0 A;  5DQ0 A;  1UY3 A;  2RVA A;  3DYP A;  3LEG A;  4M4P A;  5LA1 A;  3T2Q A;  2EIB A;  3HNM A;  1EUT A;  1JYV A;  4A45 A;  1CX1 A;  2J1A A;  2YFU A;  2ZEX A;  2ZEZ A;  2VZU A;  1D7P M;  1DLC A;  5JXG A;  1UY1 A;  4A41 A;  3EB7 A;  2VC9 A;  4DUX A;  1H6X A;  3THC A;  4DEV A;  2VZQ A;  2VL4 A;  4A42 A;  1WCQ A;  3LPF A;  4E8C A;  4XUR A;  1JYX A;  2V4V A;  2RJ2 A;  3CDZ B;  1UX7 A;  4PF1 A;  4PQQ A;  3A7Q A;  2JKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...