1CZSA

Crystal structure of the c2 domain of human coagulation factor v: complex with phenylmercury
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
GCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the membrane-binding C2 domain of human coagulation factor V.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords PROTEIN (COAGULATION FACTOR V)
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1czsA00
2E33A 2WN2A 5DMYA 1WKYA 2QQOA 2J1VA 1T2XA 2WZ8A 1O59A 1L7QA 2DDUA 2J1UA 4QB2A 1CIYA 3A22A 3I2JA 3NJXA 3WSOA 1KEXA 3I3DA 2B9VA 2ZEXA 2W95A 5C7GA 4FI9A 2QQMA 1JYNA 1GOGA 3NNGA 1P8JA 4HG6B 4DXSA 3LEKA 4A41A 2VQUA 5DN2A 2W91A 2VL4A 2VO5A 1UMHA 2JE8A 4LPLA 5LA0A 2VC9A 1F4AA 4ARYA 2Y6HA 4DUVA 3A23A 3VD3A 5IHRA 1JYVA 2ZEZA 1GMMA 3ECQA 1JZ2A 4QDQA 4KI5M 3E1F1 3NJVA 2QQJA 1UY0A 1F4HA 2BGOA 2YG0A 4GWIA 3SKJE 2C9KA 1SDDB 3OB8A 2VM9A 1W99A 3ACIA 3IAPA 3OG2A 3T0AA 2VZPA 3I2FA 2W46A 2WAOA 3T0DA 2WO1A 3BGAA 4A44A 4GZ9A 2C26A 2QQKA 1GOHA 3CQOA 2VQTA 4P02B 1TG7A 4PT6A 4MOAA 1CZTA 1UYXA 3HNBM 4CU6A 5LA2A 3WEZA 1K3IA 3J7HA 5FUIA 1JZ7A 3CZJA 1I5PA 4P00B 2WQ8A 3WNPA 3SEPA 3SEEA 3OGVA 3MUY1 1DLCA 1US2A 1JYWA 4QDRA 3VD4A 4OMCA 4A4AA 5EIYB 3WNNA 2W47A 2OKXA 1HN1A 3UNPA 2YB7A 1GQPA 2RVAA 1UWWA 3DYMA 2J1SA 3ACGA 3JXSA 3ACHA 3K75B 2Y64A 2BGPA 3C7FA 3DECA 2Y6KA 3ETPA 3NQHA 3EYPA 4QAWA 2EIEA 2W3JA 1NUKA 3MUZ1 4XURA 2W87A 2Y6LA 4JKMA 1CZVA 1NKGA 4ARXA 4BJ0A 3GDBA 3THCA 4A6OA 3K4AA 5B4NA 1JZ6A 2CDPA 1SG3A 4TXWA 2LW8A 4M4RA 4PQQA 1DP0A 4P08A 3WNLA 4BK4A 1YQ2A 1WCQA 2VZRA 5IYYA 1NAEA 3ABZA 1J83A 1EUTA 2VTFA 5JUVA 3F2ZA 3HJRA 3K46A 2WZEA 4ZXEA 2R7EB 3P6BA 3U37A 3IIIA 2J1TA 3D3AA 4BXSV 1CZSA 4DUWA 2JD9A 2X09A 3VDBA 1MPXA 4JKKA 2J22A 2YFZA 5LCWL 5I0DA 1XNTA 1ULPA 2VCAA 2XONA 4KMQA 1OF3A 3CIHA 1XPWA 3I3EA 2CDOA 2WO3A 1IQDC 1PMJX 1OD3A 2VZ1A 1EUUA 3CDZB 3EB7A 4LKSA 3NRUA 5JR2A 3T2QA 3T0BA 4XUNA 5HPOA 1BHGA 3LEIA 4PF1A 1PX4A 4CU9A 4XVHA 1UXXX 4OYUA 3MO4A 3K77A 1JZ5A 5IFPA 2VJXA 2VCBA 1JI6A 3GGLA 2YC4A 2W9XA 3IAQA 3HN3A 4MO3M 3A7QA 3FL7A 5EJ1B 1ULOA 4P5YA 3CZUA 5B4XA 4CUAA 3W5MA 1K12A 3FHAA 3MV01 3VD5A 2WO2A 4CU7A 1W8OA 3PUHA 2BERA 1UYYA 3MBWA 4JHZA 1SHWB 3ACFA 3WNOA 2ZEWA 4Z2AA 4D0QA 3VDCA 1UXZA 4JX0A 2VZTA 4QB6A 4OZOA 2J1RA 3I2KA 3GM8A 2ID4A 1XC6A 4DEQA 1XNAA 2ORZA 4XUPA 1KGYA 4RN5A 1JZ4A 1UZ0A 5G04L 5DQ0A 4BK5A 1UYZA 4TTGA 3WF3A 5HXMA 3LEGA 3HNYM 3C8XA 5G05L 4OMDA 2VMDA 2WYSA 4XZUG 4MGQA 1W9WA 3VD7A 1D7PM 1K45A 4W8JA 2JDAA 5J1XA 2W1WA 4OUEA 1W0NA 3DYOA 4AAXA 2W1QA 5DPNA 2C4XA 2YFUA 3CKHA 1UY3A 1OF4A 3THDA 3UESA 5C70A 4BDVB 4DEVA 2YC2A 4CU8A 3CMGA 2VZ3A 3HPNA 3FHQA 2QQIA 3A21A 4UI9L 4ZY9A 2QBXA 1W8NA 2XHNA 5JXHA 5CZKA 4QX3A 1JU3A 2QQNA 3W5NA 2Z4FA 4CUCA 2VZQA 4DUXA 3PUIA 1UY1A 2VZOA 3HEIA 3P1IA 4D8MA 3MV11 2E31A 1JZ3A 2EIBA 3WF0A 5LA1A 1LNSA 4ZZ8A 1UY4A 2W94A 5IJRA 2V4VA 2XQXA 4A42A 1UX7A 2WBKA 3I97A 2HYXA 1L7RA 3LQCA 4ZZ5A 3T09A 2V5DA 2X05A 2VR4A 1OH4A 3C7GA 4XUOA 3HOBA 2W5FA 4W4ZA 3OGSA 2PQSA 4CUBA 4QDSA 2W1SA 4RYDA 2VCCA 2BZDA 4QX1A 5JMOA 4KWUA 1DYOA 3C7OA 1JHJA 4A45A 2HLEA 3FN9A 2W92A 2WAAA 2XOMA 1JYXA 4M4PA 4A3ZA 3WQBA 5JXIA 2ZEYA 2VMCA 4AG4A 4YPJA 5F7UA 1JU4A 2VZSA 3LPFA 1PMHX 4MADA 2E32A 4L0PA 1GU3A 1K42A 2BBAA 3I2GA 5A1AA 2J1EA 4XUQA 4XUTA 1H6XA 2VOTA 4QPWA 5EJZB 4DXRA 3WF1A 3OEAA 2J1AA 3WF4A 2Y6JA 3WNKA 2EICA 2LS6A 3DYPA 3UETA 3WNMA 2W1UA 3GXUA 4DXTA 2WDBA 1R64A 4IUGA 3OBAA 2VMEA 2QQLA 3IB3A 1PX3A 3K4DA 3K4ZA 2VZUA 3LPGA 3BN6A 3WF2A 4GWJA 1GUIA 5CYYA 2Y8KA 4JKLA 1NX9A 2V72A 3OGRA 3AC0A 4LQRA 4UAPA 3I3BA 2JKXA 1J84A 3C7HA 2Y6GA 3I2IA 3SKVA 4QX2A 1CX1A 3LE0A 2ORXA 3ZM8A 2J7MA 2EIDA 1W9SA 1UMIA 3T2PA 5C71A 4MGSA 1RYYA 3HNMA 5JXJA 3OEBA 3VDAA 3T08A 2DCJA 3T2OA 1UY2A 2KD7A 3VD9A 4E8CA 3IDAA 2VZVA 4CVUA 1GNYA 1US3A 1TVGA 2B4KA 4E8DA 4ET7A 4UOJA 4LHSA 2RV9A 1O8SA 3I2HA 1H6YA 2DCKA 2WN3A 2ZXQA 1OT5A 2RJ2A 1O8PA 2L9LA 5IFTA 2WABA 2X10A 1GOFA 2E26A 3C7EA 4QB1A 4W50A 5JXGA 1JZ8A 2WUHA 2VMFA 1W9TA 4QX0A
chains in the Genus database with same CATH superfamily
4UWDA 2GMEA 3EMRA 5FBJA 1H2KA 2QQOA 3SISA 4DPNA 2R30A 2ZHKA 2WZ8A 3E5UA 4BQ1A 1A8MA 1D4M1 4IGPA 5LBCA 3HVDA 5FXVA 4FXKB 3C3VA 2ZGOA 1FPN1 1UAIA 5FPUA 2DURA 4LE4A 3ALQA 1PHMA 3NV2A 5E6HA 2WFPA 3GF6A 4KBBA 5HCFA 3OGJA 1KEXA 3I3DA 1WWYA 3O0VA 4AQ6A 1GNHA 2XJVA 3V0BA 2AC1A 1I1EA 3U10A 4BB3A 4MV2A 1LOFC 4COYA 4FBFA 2DBIA 1ACCA 4FI9A 4QX7A 4ASLA 5C5UA 1S0DA 1GOGA 2WNVA 4DFSA 3O0XA 2AGSA 2OPKA 3AMNA 2FDFA 4A41A 3TNPB 1FNYA 2VQUA 3AL6A 3CJIB 3QACA 5DN2A 4D3WA 4HANA 4BCUA 1IKQA 1FPN3 1AUYA 1QJY2 2ARCA 1O7FA 2JE8A 2UYAA 2Z69A 5LA0A 2VC9A 1ENSA 2GC1A 1W05A 2Q8EA 1WUVA 5FRAA 5L19A 4DRRA 4R9BA 1VBC2 5FZIA 4NPMA 3RZKA 1JYVA 5C9AC 1WD4A 4Q4W3 4AVSA 4FFHA 4XJWA 1GMMA 3GBGA 5JPMB 4QDQA 3PMEA 2IFRA 5D8AC 1H8VA 4NPRA 2YG0A 1F4HA 4XJ9A 1YQCA 1SDDB 1ULEA 5KXCA 3S57A 3OB8A 4S2GA 5I91A 2WINB 5KXDA 3ACIA 1YEWA 1SEFA 2TUNA 3CNAA 2FCVA 2WL1A 3IAPA 1C1FA 2OT7A 4XACA 2ZBJA 3RI9A 3LIHA 3CU7A 3LB9A 3GHMA 3D0JA 3ASIA 5KHKA 1PM4A 2WO1A 3FFZA 5ISLA 1V9U1 4FP2A 2C26A 5FKBA 5FY4A 2WRAA 1QIQA 1W2AX 3K2OA 4RS5B 3KGLA 1GOHA 3AM2A 4WM7B 4CRQA 3WXPA 4DIQA 2VQTA 1C8M3 1H8TA 2BVVA 4XW3A 1UKGA 2ZABA 4YGDA 1DQ2A 5DDJ3 1H1MA 1N1TA 3MEPA 1K3IA 1W8ZA 4FCAA 4V2VA 5LA2A 2Q8CA 3WZ1A 1FATA 3J7NA 1S0FA 1RUH1 3WDXA 4COVA 2HWE2 1Q43A 2JG9A 2XQRA 3SEPA 2AH2A 2RHPA 3MUY1 5BXXA 2V4AA 4COZA 4YW3A 5FYVA 3MIDA 3VD4A 4IEPA 5CU1A 2JDNA 3EXUA 5FZFA 2XR4A 1PIV1 5FZ6A 1TMF1 3OBZA 1YFYA 4MVTA 3WQ0A 1KRIA 2LROA 4XBNA 2OKXA 2R042 2Y26A 1PK6B 4BXFA 1Z78A 2J1SA 2WLPA 4YM0A 3W59A 3ACHA 3DXTA 3QH7A 2FDHA 3DECA 2X8KA 2E7AA 3ETPA 5GLUA 4LO8A 1AR61 2EIEA 1ZRIA 3NKGA 5EQUA 3O1TA 1C3HA 3MUZ1 2XXZA 4QPIC 2BNMA 1W2TA 3UK9A 2HEVF 3BIWE 4JDOA 5F3EA 4LLOA 4E27A 1WCKA 1TEIA 5GZEA 1STMA 1PIV3 1F8VA 5L36A 1PGSA 1OH3A 2CDPA 1SG3A 4BE3A 5T54A 5F3IA 4BZ4A 2CNAA 1O3QA 4GULA 1YFUA 1ULDA 3DPRA 3H1MA 5JIAA 5E89A 1QJY1 2IC1A 2UWBA 4PQQA 3Q9OA 1J1LA 3NNMA 4Z1VA 4K3UA 2VNOA 4QMAA 3H42B 4W6YA 1PO13 1YQ2A 4P9YA 1WCQA 4KWLA 2VZRA 2FMYA 2EXJA 3E5XA 1NAEA 2OXBA 4FXGB 4AI2A 2VECA 2RMU3 2JG9C 4CP2A 3KHCA 2ZGTA 3HJRA 4MYEA 4AVAA 5C3SA 1QQP3 3ZSJA 5FZ3A 3I2DA 2P4EA 1FV3A 2BNOA 1VBC1 1ND2C 3JBG1 4LLFA 4UW5A 2GNDA 4BQ4A 3IIIA 4RFT0 1IS6A 1OSGA 2J1TA 4UF0A 4BXSV 1CZSA 4DUWA 2PHTA 2JD9A 1FI2A 1MPXA 1TMF2 2PXJA 2YU1A 5DAVA 3PMSA 2ZGQA 2MEV2 1NCRA 1ULPA 3WUCA 5IK8A 3BI3A 4KG0A 5JSRA 1H8TC 4WM8A 4QWNA 1PNGA 4FAHA 1XE0A 4URTA 1BVP1 3VL9A 5FUPA 3WDVA 1OF3A 3CIHA 2D5FA 2ZJCA 3I3EA 3OPWA 4FQZA 3MYXA 3LGRA 4Y24A 3JBG3 4YLZA 2G1MA 4HL0A 4O7XA 1NA1B 4R9DA 3GCXA 3UGGA 3ZYHA 4GA9A 4LORA 1VB2A 4H14A 3W21A 1MZ6A 2VGDA 4PHZA 3NRUA 3GZTB 3MZHA 5GKAC 3WY6A 5JI7A 2GNMA 4XF1A 4HXCA 1REEA 2ERFA 4IEXA 4IV3C 4NHKA 4OUSA 1PIV2 3M1HA 3KT4A 5GZFA 4OYUA 5TSWA 2OPWA 2ZX0A 2I45A 3MO4A 4XCAA 4AFCA 4E9KA 5LY1A 2R16A 2VOWA 3NSTA 1CWPA 2VCBA 1VPHA 4CCEA 1SZBA 2ARXA 1NQJA 2YC4A 2X5IB 3GGLA 3IAQA 1MQTA 3A7QA 4M0HA 4XETA 5EJ1B 5SV5A 5B4XA 1NLRA 1H1AA 1XBFA 1IPJA 2Q4SA 3D5OA 3P3PA 3QOPA 3MV01 5FJHA 4CU7A 3BU0A 2HBTA 2X53S 3PUHA 5IK5A 2BERA 1GWLA 1OQEA 1RUJ2 2OQ6A 3RRDA 2D6MA 1UW8A 2XUEA 5T5LA 1APNA 1GZWB 3L9JT 1W04A 3VDCA 1UXZA 2D5HA 4ASKA 4Q0UA 4RQPB 2WNVC 4LA2A 4DINB 3SHRA 4QQ2A 1BYHA 3RI8A 4AAPA 2NMNA 1RHI1 2R0HA 2VUAA 2JXAA 3GM8A 4L97A 2ORZA 1GWMA 2YZ4A 3G6JB 4RGGA 3ZYBA 2JG8B 5KHJA 4RN5A 3VGIA 4DB5A 1VLNA 1FMD3 2WQ4A 1PZ7A 5G04L 4BK5A 1UYZA 3SXWA 2JE7A 4IV3B 4AQTA 2YDEA 3RFRA 4TTGA 4HZFA 3WF3A 2MEV3 3AYAA 4RL7A 3B9IA 3RQ0A 5DAQA 5G05L 3RYPA 1CD3G 4M3CA 1HX6A 4QPIB 3E6BA 2P6CA 3B5LB 3VD7A 4B7EA 1TME2 3N4MA 1YJKA 1GV9A 1YYNA 4PLMA 4BHPA 5LB6A 3ZN6B 4ES9A 4B3NA 2ZS6B 1Q8VA 1QJFA 1W0NA 1RXGA 4ATEA 2XJRA 4LMFA 1RUG3 2KXLA 1PO11 1KS4A 5FWEA 3AZZA 4AAXA 5A70A 2F17A 5A32A 2WLQA 5CFDC 4CSWA 4CXYA 2MEV1 1EPZA 1C5HA 3UESA 4QM8A 4TN7A 4H7LA 4BDVB 5GZCA 2YC2A 3RJRA 5ERLA 4CU8A 1F9KA 5FP8A 4OI2A 4CXXA 3PHMA 4HVRA 4IGQA 5EFUA 2XWBB 5F37A 1YHFA 3AVSA 3M3CA 1QXJA 1U5ZA 3A0KA 5DUWA 4PI2A 1ZREA 2LUWA 5C3OA 2GMMA 1FPN2 2XHNA 5DABA 5LATA 4JAAA 1Y4WA 2CL2A 4QX3A 1ND2A 3ITQA 2XLFA 3OBRA 3POEA 3RZLA 4ZU4A 2VZQA 3VZNA 3M7AA 1HQWA 4TWTA 3N9PA 3LIGA 1NZCA 1CPMA 2I07B 4CEWB 1JOPA 4D6RA 1CGPA 1RC6A 4Q4Y3 4CYDA 4YW7A 5LEJA 1ST8A 3N3HA 3WV6A 1UY1A 2VZOA 3HEIA 5EP9A 1E5HA 2Q1MA 3VBFA 3MV11 1AR91 3EJKA 3RWNA 3VHNA 2EXKA 3H7YA 1LHUA 4K20A 1VBD2 2PHLA 4A42A 5F3CA 1O3RA 3I97A 3WG2A 1LB2A 4JGYA 4GKXA 5JZGC 4ITCA 1L7RA 1WLWA 2UURA 5BUVA 5DG2A 1W6OB 3P5BA 4AEMA 1JXNA 1LOGA 2VR4A 1L7LA 4Q0SA 4JTNA 5FZMA 4DOUA 1AR62 4QPGA 4MZUA 3GHNA 2Y34A 3ME2A 4QDSA 2UYBA 4S2DA 4ZXKA 1QMJA 4CPBD 1J58A 1F31A 4XYXA 3ZYJB 4HETA 3J9SA 5A7WB 5A7WA 4BLJA 4EN8B 3AX4A 2RDNA 4KWUA 3RVHA 5A3LA 1PO23 3U14A 1ZZ6A 4U36A 3JU9A 1D0GA 3LZZA 1HIXA 4UFIA 5FZAA 1JYXA 4GMP0 1UF2C 5FOJB 4WM8B 5CNAA 4A3ZA 4AFAA 3AB0A 4HPKB 3TEWA 3BOWA 1W6PB 4XF0A 1YLLA 2NP0A 2PQQA 5CEHA 4Q1RA 1JU4A 2EAAA 1AR81 1C5IA 1CONA 1FMD1 4URAA 3OUIA 3ZYGA 3GYDA 4YW6A 4E2QA 1Q56A 5A3TA 3B93A 4L0PA 1V6OA 4IETA 4XC9A 1GU3A 2IVJA 3JD71 4ORFA 1PO21 5FO8B 2IVIB 1W03A 1QJZA 2WZPP 2Y0IA 3LAGA 3Q8FA 2WO7A 2J1EA 3VLBB 3B00A 4DXRA 4LR4A 3RGBA 3O1OA 1ULFA 1MS9A 1GNZA 2RR11 4L2NA 4K1ZA 1CAWB 2GC2A 4XFCA 1OHFA 5LASA 4HFSA 1CAXB 2D43A 4S2HA 3THTA 2GZWA 4BH9A 4JDMA 1JOJA 1LULA 3J4UH 4WM7C 4CDWA 4COUA 4A3XA 1AXZA 2RMU1 3RYKA 4DXTA 5C3QA 1XNCA 3V65A 2NLRA 1R64A 2ATFA 4IUGA 3RMXA 3UV9A 3FBMA 2RS12 5HBAA 2VNRA 4TZDA 5IVBA 5EZWA 2WZR3 5AFBA 3IB3A 5FYIA 1NZIA 1PX3A 2ZX2A 4CA9A 5KXEA 1AL21 4Q0QA 1ZNPA 1OVPA 4HSJA 1GKBA 2D7FA 1E57A 3VBRB 1ASJ3 1O3TA 5K0UC 1CN1A 2PLV2 4JKLA 2V72A 1O5LA 1HQLA 3AC0A 3MIEA 4UAPA 3SCFA 3AKSA 1SLTA 2V5YA 1RINA 4BLIA 2LRPA 4IE0A 1J84A 3Q8CA 3RMYA 5A6XA 1LHOA 1J59A 1BBT1 1RUH3 4HN0A 4YFWA 4HBNA 4O9EA 1AR93 5FFOC 4AEDB 5KHGA 3GJBA 5JZGB 3V0AA 4IV3A 2YHJA 4IW3A 1DQ0A 4GJZA 4YVSA 1H4HA 1KDKA 1LU1A 2DU1A 1S1AA 1WCSA 2W0XA 2ZMKA 3JBG2 3R4UA 1RUE2 1FV2A 1H30A 3OEBA 5F6LB 1CX4A 2DUQA 2VNVA 1DIWA 1POV0 2E53A 1WMDA 3VDAA 3AP7A 3T08A 2FDIA 4NWVA 4XAEA 3KVBA 3RG0A 1G9BA 1UY2A 2DCYA 2XLGA 1K5MB 2WNOA 4KNCA 1JYCA 1XE8A 4LO7A 1N3PA 2A71A 4QQPA 4UFJA 1LRHA 3VDDC 3O1UA 2YPDA 2VZVA 4CVUA 4XOGA 3POBA 4Y4YA 1TVGA 2B45X 3IZOA 3FBYA 1AHSA 1CAVA 4ET7A 4XCBA 3VV1A 4EWEA 1YXWA 1H4GA 2JG8C 3CLPA 4M3CF 5F3GA 4L9BA 5FKCA 4E2SA 2ZMNA 2WJSA 5JAXA 3FC0A 1LHVA 3ZFGB 1AR92 4PBOA 2RS11 2HWD2 3KF3A 2WNUC 5LWBA 4N43B 2B5HA 2WABA 5IFTA 1W6MA 2IXHA 4FVVA 4QB1A 5FYMA 4UXAA 2RR13 1XJAA 4W50A 1RB8G 1MEC2 4IEWA 5JXGA 1DYPA 4LKDA 4FOYA 4MH0E 3WDUA 3S0MA 4NJ4A 1JS9A 4P9XA 4QX0A 4BQ3A 3OF1A 5IAXA 5DMYA 2WN2A 2ZGKA 1HB3A 3RJ2X 1WKYA 2YU2A 4P9LA 1T2XA 1ND3A 1Y9QA 3AMQA 1L7QA 2DDUA 2J1UA 3KQ4B 2VQ0A 3MI8A 4LE3A 1N47A 3JD73 2JB4A 2ETEA 5BNPA 3IDEA 3LSDA 5EYXA 1OQ1A 4FPLA 1NOVA 4AEJA 1RUC3 1X8MA 5A33A 2QDNA 3WW3A 4RS5C 1G9FA 4FOWA 5HXVA 3AZWA 4YVWA 4FPGA 4AZZA 1XNBA 3K51A 1YI7A 4XZPA 4EN0A 3E6DA 3ELNA 5LZ6A 2WFF3 1NG0A 4AFBA 3PURA 5ACA2 5C7GA 4LKFA 4UW3A 3V56A 5DG1A 1YO8A 5FZ9A 4LBKA 1SBDA 4HG6B 3VKNA 1K5MC 3LDBA 1IS5A 2ZGRA 4NHLA 3BODA 2RG4A 1MS0A 1SACA 3H3LA 1UIKA 2ZOEB 1F4AA 4NVPA 5IWFA 4QD2A 4OZXA 4Q26A 4DUVA 2KA3A 3DGTA 1HRV1 4I0WB 2RE9A 5A7SA 3S5QA 3ZFGC 4OHXA 2WR9A 5FMBA 2DFBA 2WNUB 4YVSC 4BYYA 1CQ9A 2P2KA 2XGXA 2VBDA 4XDQA 1UD1A 2ZEZA 3WDWA 1VRBA 3WW1A 1NE4A 3ECQA 5I0RA 1PGL2 3UKVA 5DDJ2 1ND3C 2AREA 5KBFA 1H9PA 3VN4A 1UY0A 1J1TA 2BGOA 4RGAA 1DQ4A 3SKJE 2C9KA 1WW4A 1Y7BA 2FBEA 4LKEA 5LK7B 2VM9A 3F95A 3HMYA 1GZCA 3ZFFC 4QKDA 4Z92B 4MGTA 1AYM3 5CA6A 4M3CB 3I3QA 1KFUL 1RJ8A 4CDXB 2Q1FA 1HRV3 2VZPA 2VW2A 3H8UA 1CAWA 2W46A 2WAOA 4I3GA 4BQWA 2NZ9A 4HONA 4Y1YA 1POV1 3K48A 4CDUB 4NHMA 4FSJA 1K5MA 1MVQA 5HCBA 3CQOA 5H9QA 3WD5A 4XFAA 4IEOA 4P02B 2F4PA 5FYBA 4JGYC 2IXKA 4HLTA 5FYHA 3WW2A 3H8OA 3HN1A 3M2MA 4NRPA 1ENXA 1R1A1 1AL0G 1UU5A 1SLLA 4QXBA 4Y1XA 4A7YA 4H3WA 4KQ7A 4CU6A 5ABJB 4YFZA 1DHKB 3WEZA 1H9WA 5FUIA 4CDWB 3CL1A 3WDTA 2BU9A 4YG6A 3WCSA 4P00B 4D69A 1H2LA 2XKPA 2ZKNA 4JZRA 3OGVA 3SEEA 4X8PA 1DLCA 1OA4A 1WLDA 5GLWA 5I8SA 4D6QA 4FFFA 1H2NA 4IV1B 4NWWA 4OMCA 1TMF3 4XQ4A 4A4AA 3MLJA 5H9SA 5AFEA 1HB2A 1NXMA 1UKRA 5EIYB 2LM3A 3WNNA 5FUNA 3HR9A 1OPOA 5FZ4A 1RUD1 3UNPA 4FT8A 1UWWA 2DVDA 3SH5A 2DCTA 1HB1A 1CAVB 3ACGA 4RGKA 2VOKA 3KV9A 1LHNA 4IV1A 4OHVA 4P9WA 5JSPA 1ND3B 2XMLA 5I93A 4WV8A 3NQHA 3EYPA 3Q8EA 5IVVA 1JMUB 4HT1T 2W3JA 4QAWA 2GALA 1OURA 1FAYA 3ZYPA 1XSQA 1OA2A 1U5XA 5DUUA 4RHV1 2R1DA 4BQ5A 4AFDA 1RMU1 3MF9A 3FUOA 4IEYA 2LTNA 5C3PA 4YWAA 2RDQA 1FXZA 3K4AA 4A6OA 5B4NA 1TQ5A 4IE4A 2G19A 4EJRA 4H55A 5GLZA 1KJRA 1WW6A 4FPFA 1W6NB 4IL7A 4OVEA 2A6YA 3KF5A 4W65A 3WP4A 3UJQA 3ORJA 5F6KA 4O65A 4AHYA 2SLIA 2LW8A 1RUC1 4M4RA 1F5FA 3ROUA 4GMP3 4LK7A 1UOGA 4XFIA 2CHHA 3MLKA 4P08A 5DAPA 3OPZA 4XE9A 2CWMA 1Y9GA 1VR3A 4J6GA 3ILFA 3ABZA 1J83A 1S0JA 1EUTA 3ZOIA 4RS5A 1COV3 3BUCA 3VZKA 1A3KA 1RJ7A 5L7OB 3K46A 1LU2A 1B35A 2BJSA 2WZEA 1YRZA 3DKWA 1OLMA 4FOVA 2QNKA 4PDWC 4XIKA 4NAMA 2W2IA 5FZ7A 1UOFA 4XMAA 1LGCA 3VBOC 1Y43B 2YBKA 2X09A 1GLHA 4UW6A 3VDBA 1V6LA 2BPA2 2K0GA 2YFZA 4KGGA 1QJX2 2BVBA 2CU5A 2WSUA 1VAVA 3H50A 3ZKUA 1LOEA 2CGOA 2D44A 2CAVA 2MNGA 2WWUA 2VCAA 3U07A 5FYYA 4LBOA 3VBHA 3ZXDA 5KR7A 4CE8A 1GZTA 2GDFA 4A7KA 1XPWA 1GFF2 1HV0A 3PTYA 4LJHA 1QKQA 4PIZA 2HWB2 5FAXA 5D1IA 2XJTA 4GXLA 2BWCA 2EVXA 2DFCA 1IQDC 3VKLA 4K8FA 1UOJA 1OD3A 2VZ1A 2WWSA 1NCRC 4JQTA 2XHKA 4IXLA 4QX8A 2C1FA 1EUUA 5J96B 3O12A 3PLQA 2B7YA 4AVBA 4YSFA 3NW4A 3H1WA 2RDSA 2LALA 1VBE1 1DLLA 4Q5OA 5BYNA 4NIIA 2NM1A 3LEIA 2BQPA 2VMGA 2W08A 4ES8A 3MHZA 4XVHA 4FO9A 3TWIA 1UXXX 4I0AA 4CCDA 1CAXA 4CU9A 5L7OC 4Q4V3 1OVSA 1BJQA 1HRI2 1CESA 1G86A 2C9AA 3AXDA 4I30A 5CISA 3INAA 2GMPA 1PZ8A 3U11A 4R52A 2WO2A 1DG6A 1ULGA 4OUMA 5GZDA 1W8OA 2Z42A 2O8OA 4RHV3 1BKZA 1W8UA 3IIAA 2VNGA 4JHZA 4LEJA 5FP4A 4QQHA 3SH3A 4ISQA 2FDJA 2D40A 3WNOA 5FO9B 1GWKA 2ZEWA 1QGLA 1WMFA 4JRLA 4YGEA 4CPBA 2ZZJA 4IGOA 5JDBA 1ZA7A 4XPVA 1ENRA 1RUD3 4OZOA 2KR2A 4EN7B 1NY72 3LWCA 3ZXKA 3I2KA 3J8F2 5C9AB 5JMCA 3VBRC 2R073 1XC6A 4N53B 1ZBA2 3USUB 3CF6E 2V09A 4XUPA 1IPKA 1KGYA 2WNEA 4IE7A 3ZKYA 1PGW2 1QJU3 2VAUA 3NAPB 5GLTA 5DQ0A 4R4ZA 1RHI2 1O3SA 2HWD3 2VXJA 2ZHMA 5FZGA 4XDPA 4FPKA 3ZSMA 1OQDA 1VBD3 3O1VA 4N53A 1BXHA 5AVPA 1DQ1A 3HNYM 5HCHA 3OGGA 1DQ6A 2R1BA 4DS0A 4KH9A 2FZ2A 4H2AA 1UQXA 4E2GA 3X29B 2RS13 1D7PM 1K45A 1BMV2 5HV4A 4CDUA 4GWMA 4C90A 5L9VA 1Y3TA 3WCRA 4Q4Y2 4XJ8A 4AEDA 2YUEA 4RFRB 2BGCA 2K9ZA 4B1LA 1QQP2 1ZA4A 2GH8A 5FZOB 3ZIWA 1GQHA 4FTSA 1W8WA 3LFMA 3QH6A 2HWD1 5A1LA 1MS1A 2P5BA 4Z07A 3KT7A 3IMMA 3R4DB 1FOD3 2YFUA 3GJAA 4FPOB 5A7NA 3SH4A 4TYSA 5L9BA 2XVGA 4Q4W2 4DEVA 5EXOA 3C2UA 1C57A 1QOOA 2QQPA 2VZ3A 1VAMA 2QQIA 3AZVA 1AJKA 4D94A 3BPSA 4UI9L 2WS92 3CJIA 2DWRA 4K6BA 1ZBE2 3HT2A 2DUOA 1YI9A 2JDYA 5AVAA 2C24A 2P3YA 4N43C 2DVBA 2WNVB 2YC0A 3B01A 3GZEA 1W06A 1VRH1 1LJ7A 3NNJA 4HKOA 4AGRA 5JSOA 1Z0HA 1V00A 2ZX3A 3FE5A 1DGRN 4CCKA 1J3QA 4CUGA 4FFGA 3TAYA 3I2OA 3DF0A 4LITA 3VBHB 1NT0A 1OLME 3WDYA 4N9IA 2VVFA 3PUIA 3O1SA 4OHWA 3S30A 4HVQA 3P1IA 4XF9A 4D8MA 2I2SA 2NYYA 1REFA 4KU8A 1JZ3A 3GCWA 3PIGA 4XXAA 2JDPA 1MS5A 2P37A 3J7MA 4Y26A 3UKTA 1YNAA 4AOCA 5C4WB 5LA1A 1DFQA 5FPBA 5LRRA 1LGBA 1LNSA 3ATGA 4DY3A 1UY4A 1RVF3 1SBEA 4Z2WA 5FLJA 4E4DX 2V4VA 4YG0A 1FMD2 3UKNA 2EXIA 2ZA9A 4JRAA 1PGL1 3ZFEA 5JLVA 2V5DA 4QHBA 2OZ6A 1YQ6A 3WP6A 1OH4A 5BNOA 3B69A 4XUOA 1OLRA 1QEXA 5FP9A 5GLVA 2ZGSA 1GZ9A 5FZ0A 4Z82A 1QJU1 3VL8A 5I0SA 4W4ZA 4CZSA 5KC6A 5F2SA 4BQXA 4I01A 1ZRDA 3PUAA 5F1RA 1S2EA 1QXPA 2YYOA 4Y5SA 3Q8BA 4FFIA 1SFYA 1GSLA 1PK6A 3S6PA 1H0BA 3VHOA 5CG9A 3C7OA 5D2AA 4A45A 4XIOA 5J09A 1URXA 3LA2A 1SLAA 2HLEA 2GH2A 3D0SA 3FN9A 2W92A 2WAAA 4FPEA 4DY5A 3NV1A 2DUPA 5HI0A 2Z5WA 5JXIA 3PUQA 1JODA 2ZEYA 1COV2 2HEWF 4A6SA 5JOXA 2RS53 2EXHA 4QGLA 4XTMA 1HRI1 1UZWA 1O5UA 1C4RA 2UY9A 2VOXA 2ZGNA 5T55A 1IS4A 3VBUB 2VG9A 5JVVA 5FMOS 1CJPA 3NO8A 4PLNA 1L3JA 5FZ1A 1XYNA 5I8YA 3N36A 2YGMA 1G9DA 1R083 4M01A 2EALA 3CO2A 3LDRA 2BRTA 1SPPB 1K42A 4CEWA 2AR6A 1VALA 3SLIA 4AWDA 3TRSB 1N1YA 1PVC3 3AJZA 4QPWA 5EJZB 2VUJA 3RSJA 3BIEA 4GD4A 4P5HA 4IDZA 3NJZA 3FLTA 4C8DA 1OKQA 3HBKA 5DUXA 4HK8A 1JUHA 3WOGA 3FFQA 1MS8A 1F5JA 1WCUA 2HWC2 1UU4A 2QZ2A 3WNKA 1Y9MA 2ZKLA 3WNMA 3ZPYA 1KS5A 5EYYA 3NL1A 3VDDB 1I5ZA 4UFLA 1MEC1 3BB6A 4XQDA 2GNBA 3DPRB 2WDBA 2R063 3GZAA 3NWKA 1KXGA 1ZBE1 2PHDA 4PQ9A 3PVEA 3V64A 1WBFA 3OBAA 1S0BA 1KFXL 1FX5A 4DZGA 2VMIA 1MS3A 4QXHA 4FQ4A 2RJKA 3MFCA 3LOIA 3M3OA 2DYCA 4KGQA 3K4DA 5ANNA 2ENRA 2JIJA 2VZUA 5FR3A 2A6VA 1JYIA 3HWJA 3HD8B 1X9TA 4GWJA 2XJSA 4HOOA 4WVMA 5C9AA 1AYN3 2ZX4A 4LBLA 1W6QB 2Y8KA 3I49A 4G4FA 5HCAA 4AEDC 4SBVA 2CSGA 5CKQA 2A3YA 3I3BA 3O14A 2CY6A 3J8F1 2FDGA 3ZMOA 1QHDA 3J7LA 4QHOA 1ZBA3 2Y6GA 2G9GA 1DCSA 3SKVA 5J7MA 1NCRB 4UT5A 1YQ8A 1W6MB 1ULCA 5FPZA 4YARA 1CX1A 3MIFA 4YM2A 2ORXA 2C6SA 2XBO1 3W58A 2VE1A 1S0CA 2J7MA 2EIDA 2DV9A 3NJYA 4CEYC 1UMIA 1V6IA 3T2PA 1YUDA 4LIVA 4TLFA 1UCXA 3HT1A 2YMZA 3T4HB 1W28A 2JENA 3POFA 4QKFA 1YCIA 4C0BA 5IW0A 1BK1A 2XL9A 4QU2A 4RHV2 5F5IA 4META 3MW4A 3PUSA 5FZOA 4GJYA 5CG8A 5L7OA 4NO4A 4TSVA 1V6NA 1FYUA 3PNAA 3QCWA 2MPFA 4GKYA 4N43A 5DAWA 1S0GA 4JHTA 3T2OA 2KD7A 1DZTA 3VKFC 4CDWC 3VD9A 1D4VB 3IDAA 3DPRC 2GN7A 2XG3A 5CFCB 4PDWB 2JB8A 3O1MA 2JDMA 2FD8A 3DV8A 4O9GA 1D0HA 1RUC2 4K21A 4YZ1A 5FXXA 1CAUA 1UO9A 2QVSB 2RV9A 4IEQA 5C8CA 3OSDA 1UPSA 2WN3A 4L8QA 1OT5A 2ZXQA 5BNPB 4IE5A 5FDBA 1YIFA 3B7MA 1G8WA 2X5IA 4QQLA 5FY9A 1LAJA 1IKPA 2L9LA 5BV6A 2YY1A 2X10A 4LBMA 4BM8A 4MXWA 3C7EA 5D8AA 4I09A 4EROA 4AGGA 4HKLA 5J36A 1JZ8A 3ZFFB 3ZFFA 4C1WA 2ET1A 2VMFA 4XHXA 5LA9A 5M0TA 2OUHA 1G6NA 5BNQA 2E63A 1DF0A 2J1VA 2ZGLA 2XH6A 4QB2A 1CIYA 2JECA 5F5AA 3RZJA 2VY0A 4BQYA 5K9YA 4CCJA 3WSOA 4CDXA 2AEYA 2BWAA 4LO5B 5FIXA 4D6SA 3OTFA 2FQPA 1EY2A 2VXRA 4XJUA 1A8DA 2B9VA 5CBLA 1ZRFA 2E7QA 1ZM1A 1YFWA 5CIRA 5IAVA 2PHWA 4QM9A 2W95A 2AEZA 2QE3A 2VBPA 3N7KA 1BQPA 1JYNA 1W0OA 1W0PA 1A34A 1P8JA 4RD7A 2FDKA 4DXSA 4AEKA 1MEC3 2GNTA 1EV11 2RJLA 4ZKTB 2R061 3L2YA 1Q8PA 1MVEA 2VO5A 1VBC3 2DVFA 3FX3A 1UMHA 3PIJA 4IE6A 4N9HA 4WVMB 4F83A 5T5JA 4F7ZA 4ARYA 1IZ3A 2Y6HA 3BTAA 4Q29A 1CR7A 3N9NA 4ZPIA 3GBWA 3AKTA 2AUYA 2QDRA 3VD3A 2O14A 5IHRA 2ZAHA 1H2MA 3ES4A 3WQ7A 3I4IA 4NMIA 1BEV3 2AYHA 2JDHA 2VW1A 3UYJA 1WW7A 1JN2P 1YFXA 2ES3A 3NNFA 1JUIA 4ZHNA 4KI5M 5DUVA 5FCCA 2QQJA 3MFAA 1C8M1 1HB4A 3D82A 5EV7A 3RYRA 1VBA1 4D7SA 2IFWA 4CCCA 1W8FA 1QJX3 1R091 3ZFGA 4BMEA 4AI8A 5DDJ1 4CEYB 4LNVA 1B09A 3NNLA 1AYM1 5KC5A 3OG2A 3AKQA 4R4XA 1C8NA 3M3EA 4UW4A 3T0AA 5BY5A 2XJQA 1UIJA 2R32A 2UWCA 5FXWA 3V0BB 1I6XA 1NY71 4JCKA 1Z7S2 2RM22 4K9SA 5LBEA 3BGAA 3HAGA 4GZ9A 5A33B 1HXS2 2VBBA 3T1LA 1WMEA 3POYA 5C8CC 1S2KA 2ZMLA 1TG7A 5A6QA 4NIGA 3ZYFA 4R9AA 1CZTA 1UYXA 3ILNA 3URFA 3KV6A 1EP0A 4IV1C 4ASMB 2Z79A 1QXRA 2HWC3 3HNBM 1VRH2 1MZ5A 4INDA 1LKNA 5EHDA 1KITA 1HLCA 1JZ7A 1Q8OA 1I5PA 1AR72 3WNPA 1WA4A 3ZXGA 1ZRCA 4ISRA 5FMOL 4BU2A 4UFKA 2AENA 1DBNA 2JX9A 2UY8A 5JIUA 2A5ZA 5FJKA 3ZXJA 4YVWB 4GIQA 5JWPA 2P3JA 1PMIA 2W47A 3JQXA 1HJFA 2YB7A 1JOBA 3RZZA 1IOAA 1GQPA 1YC61 2RVAA 1K5JA 3WVJA 4DRVA 3DYMA 3MDPA 3K75B 3WHTA 3C7FA 1UNBA 2JDUA 4IEZA 1ODMA 2A3XA 1G9AA 1QWRA 1W90A 2H0VA 4C1XA 3ZDSA 4GQ7A 4ZU5A 3AKRA 5C8WA 2ZGUA 1WCDJ 2W87A 4QX5A 5T50A 3ZYIB 4AR2A 1CZVA 5JR7B 2Y0OA 5FMDA 3M3IA 3N7JA 1D2QA 1RMU3 3GDBA 4OLLA 4XTPA 4XFHA 2BUKA 3AMPA 3VBHC 4CCNA 5A6ZA 4WM8C 4C91A 3KSCA 2DCZA 2PMWB 4WZFA 4KBZA 2GC3A 1LHWA 3S7EA 3WX5A 4CTEA 2CGPA 1LODA 5FYCA 4GMP1 2BBVA 4LTAA 5J37A 3UL2A 4NHYA 4PJYA 2CWSA 1S4CA 1WZXA 4YW2A 4AE2A 4MGYE 3WNLA 1EAH1 1S0IA 4PDWA 4KWKA 3NKTA 5I0TA 2QZ3A 2EIGA 3ZLIA 3AP5A 2YBPA 1V0AA 2D97A 3OD4A 4FPJA 3M4FA 4YZ5A 2VTFA 5JUVA 3F2ZA 4Y20B 1AYN2 2V73A 1M06G 3H3UA 3KD4A 4P14A 4DNYA 1IG3A 3POGA 3ZXEA 3BCWA 4Q0PA 4CP9B 2ZACA 5FZBA 4GB31 2X5IC 3P6BA 3U37A 3ZMNA 4LBQA 1PVC1 3O1RA 4MX3A 5IK7A 2VCMA 4Y20A 4CP0A 4Q4W1 4JKKA 2J22A 1O6UA 1V9U3 4NPLA 3ZN4A 4GH4C 5I0DA 5LCWL 2VUCA 4UBHA 4Z8BA 3H8RA 2JKBA 3OUJA 1RVF1 3VBFC 1RITA 5JCTA 2DTWA 4LHLA 3D8CA 3PVNA 3MLLA 2WA3A 4MGIE 2PTMA 1QQP1 3ST7A 3FMGA 4ZU7A 2GP3A 2ZGMA 3IT8A 4K1YA 4XJAA 3J8F3 2WO3A 5FZHA 4DMIA 5LBFA 1PMJX 3N9MA 4EZ4A 4J1XA 3O7OA 1DQ5A 2XL7A 3CDZB 3EB7A 1VBE3 5A3NA 5JR2A 2A6XA 2W68A 3PJYA 3T0BA 1WGPA 1X9PA 3IDBB 1XB9A 3ENRA 4XQWA 4XUNA 5FZLA 4N90A 1BHGA 5JOYA 2BDRA 4PF1A 2P3IA 3HQUA 2OZJA 3WG3A 5FZCA 3VKOA 4FTBA 1O4TA 4U2AA 1LOAA 5CB7A 2QQUA 5F8PA 1HN0A 4LBJA 1BVVA 3HN3A 5T5PA 4MO3M 3KHBA 1CPNA 1ULOA 1V70A 1ZBA1 2WQZC 3CZUA 4P5YA 3SCHA 1K12A 2RS31 1W39A 3W5MA 3FHAA 2VTXA 4MXVA 2E51A 4Q8KA 2P1BA 2OUJA 1UYYA 1T6BX 4P9GA 1HDKA 1M4WA 2G9ZA 3IDCB 2ZCWA 3RDIA 4MUVA 3ACFA 1ZYBA 1X8EA 3ZSLA 1ENQA 4D0QA 4A2UA 1OOPA 1OOPB 2VZTA 5JPNB 1RXFA 5LRSA 3TN93 1Z7S1 1A78A 2RM21 4Y4RA 3VZOA 2J1RA 4OFGA 4DEQA 1AR82 1XNAA 5GM0A 5JOWA 3QBQA 4LK6A 5FBZA 1JZ4A 1X7NA 3E97A 1U5IA 1S0EA 2NQYA 4Y5Z0 4BPZA 5DZGA 2CAUA 5HXMA 2QFEA 2SBAA 3BTZA 1VBD1 1XRUA 2IXLA 2IUWA 2VMDA 3HBZA 4XZUG 4MGQA 2GN3A 3BALA 2QKDA 1Z7S3 1TME3 2RM23 4K40A 4LUMA 1DYKA 4W8JA 3U1XA 4CDQB 3KS7A 1RUF1 1VB4A 2HYKA 1OLQA 2JDAA 3KV4A 3N9QA 4YYOA 3SMHA 2EAKA 1YWKA 3KT1A 2E7TA 4S2FA 5FP7A 4YW4A 3GBFA 4AW7A 3BTYA 1YIPA 5FPVA 4QPGB 1ND2B 3DYOA 3ZSEA 3DUIA 4ZS2A 2W1QA 2F4LA 5FYUA 3VHPA 5DPNA 2OA2A 3H3ZA 1VIWB 1XOYA 2RDRA 1OOPC 3THDA 4JGYB 3VZMA 5C70A 4C0HA 5AC93 4EV0A 1KDMA 1BEV2 2R0FA 2ZX1A 2DU0A 4NIDA 4MGKE 1U0AA 3FHQA 2TNFA 1WD3A 3WR0A 3Q8AA 3A21A 4AHWA 1OUXA 3PU8A 2XVKA 1J3PA 4BA6A 1JH5A 5BNPC 2HWB3 4FOQA 4OHZA 3B94A 4XEZA 4Q0VA 1IS3A 3IMNA 1JU3A 1VRH3 2QQNA 3AZYA 3EHKA 3AP9A 3IPVA 4IEUA 3T2TA 4AI0A 4XF3A 4Y33A 3JZVA 2Z4FA 3KVAA 5FO7B 3D4KA 3ZVXA 1H1IA 1RTVA 1C28A 1XU1A 5FREA 1HXS3 1UPIA 2JJ6A 2JG8A 4QQOA 4YGCA 4QGMA 5H9PA 1G7YA 1WLCA 3PTRB 2YPJA 1S2BA 2A1XA 2PHXA 2PA7A 3ZN6A 3ZSKA 1POV3 2VW0A 5I0UA 1HJGA 2R062 5EJ3A 5CKNA 1GP6A 1CIWA 2WT1A 3H0OA 3R0RA 1QH7A 4GB32 4R9CA 5C4WC 1XQNA 2W94A 3MPBA 5IJRA 2HWF3 3W9AA 4NN0A 3PU3A 1UX7A 1LEMA 5K0UA 2RS32 5A7QA 3ZDVA 1VBB1 4YVWC 3T09A 1BLZA 2Q30A 5GALA 1AJOA 5J48A 5DXDA 3WG4A 4FPHA 3ZR5A 3EBRA 5FPXA 5CVRA 2RS33 3MW3A 1EAH2 1C8M2 2W5FA 1HQNA 2D3SA 2PQSA 2YBSA 3H7JA 3OGSA 3WLUA 1R082 2EA7A 4AVCA 5FY7A 2D6KA 2F6BA 1Q3EA 5T52A 1OD5A 3VBUA 1ZZ7A 3PVOA 4F8AA 2BZDA 3M70A 4HN1A 5BNOC 2ADEA 5JMOA 5A7OA 1RUJ1 3JB4C 3LKJA 2BFUS 3ZPOA 4AHZA 3BOPA 5IK4A 2Y38A 1F2NA 2XOMA 4D7TA 2QCSB 3WQBA 3JUUA 2QUOA 2RMU2 2VPVA 3H9AA 5IUQA 5BNNC 2VMCA 4AG4A 3VUOA 4CEWC 1VP6A 4CP1A 4RQPC 3O1PA 2RS51 2VZSA 1IPSA 5FY1A 3OBTA 2ILMA 3V0AB 1QY4A 1LESA 1AX0A 1UYPA 1W2UA 1VBE2 3OYWB 1SQ4A 4YRDA 2E9QA 4Y1ZA 3BKZA 3KM5A 5C4WA 3I2GA 4B8EA 5KHIA 4NE9A 4XUQA 2WYFA 5CFDB 2XPJA 2FHRA 2ZHNA 2ZAAA 4MGZE 1H6XA 4XUTA 3UJOA 4AQSA 4B4QA 5IVFA 1W6OA 3S7IA 1RUI2 5FV3A 3WF1A 3OEAA 1IG0A 2J1AA 4V1PA 1HW5A 1RUG1 5FYSA 1R092 1KJLA 1S55A 2Y6JA 3DN7A 4PIXA 3TB0A 1AR83 3U78A 4H7MA 4RR3B 1AF9A 2B42B 4XBQA 2WT0A 3UETA 1DGLA 3AXEA 1RVF2 4X6QB 2W1UA 5A7PA 2A6WA 4UF0B 4G9SB 4LOSA 2IWGB 3FWEA 4AQ2A 1HXS1 3EO6A 2D3RA 3IM0A 4AI3A 3HIFA 4LBQD 2VMEA 2C5DA 2QQLA 1IGOA 2WFF1 4RSUA 2XJUA 3CEWA 5DZFA 3K4ZA 5T3NA 4B29A 3LPGA 3WF2A 1SLCA 3N9LA 1TZOA 1V6KA 1GUIA 1NA1A 2HWB1 4IERA 3MF6A 3B02A 5CYYA 2Q5TA 1PGW1 1QNWA 5FYZA 1NX9A 3RWKX 2JWPA 4LQRA 4QT6A 4JC1A 2D6LX 3AKPA 1Q8QA 4W6WA 4W6XA 3NAPC 4CDUC 2B9UA 1C1LA 3C7HA 1VBB2 3I2IA 4QX2A 4NRQA 1G9CA 3LA3A 1GICA 5C33A 3LE0A 4OI0A 3KMHA 2WA4A 3TYJA 4OQ9A 1OUSA 4LBNA 2ARAA 1W9SA 1OA3A 2JD4A 2JG9B 1E5RA 4J25A 1CAUB 4NIAA 5C71A 2VVEA 3WUDA 3HNMA 2PLV3 2WSVA 5SV8A 4XBLA 2DBNA 2Y60A 1RUG2 5KHHA 5LEKA 3IBMA 3POIA 1QDOA 4YZ2A 1RUI1 1D2SA 1NCQC 5C6CA 5CADA 1NYWA 1ZZ9A 1ODNA 3AYDA 3KCXA 3LA7A 4XABA 2Y6FA 4E8CA 5CFCC 4M0NA 5ABJA 2VU9A 1NQDA 4Y3OA 2BW8A 1US3A 2B4KA 2QJVA 1F35A 1EPWA 4UOJA 3QLQA 4LHSA 2D6OX 2ZPXA 1W3VA 3I2HA 1H6YA 4KL1A 2VTXJ 5L9RA 1LTEA 2R071 2XB6C 1QJY3 4MLOA 4OULA 1AR73 3K3OA 3I54A 1GOFA 5A3PA 5BPXA 1TNRA 2JEMA 3ON7A 2FZ1A 1B35C 1REDA 4LUKA 1AXKA 2A73B 2RR12 5A1FA 1VMFA 3FLPA 1SHWB 1AX1A 1R1A2 4JGZB 4EZHA 2E33A 3T3YA 2DVAA 4WM7A 1BMV1 1X82A 3ZFEB 1RL3A 4AI1A 5LW9A 1QU0A 1VMHA 2DTYA 1XYOA 1O59A 4E4ZA 5LY2A 1H8TB 4LHNA 3A22A 5K0UB 3I2JA 1D4M3 4BIFA 4MG2A 2Q8DA 3NJXA 3FZ3A 1WW5A 1QOSA 4QPGC 3TN91 3AK0A 3ES1A 1SMVA 2WWJA 2BOJA 1SLBA 4BISA 4XFFA 1YQ5A 4CEYA 3GZUC 2ZEXA 3JD72 5FMCA 3D6EA 3LOBA 4CCOA 4I3PA 5FQ0B 2UWAA 3M3QA 1AVBA 1F15A 2QQMA 1HRI3 3T1MA 4NRMA 3NNGA 3KB5A 5CKMA 1QF3A 3BYWA 3LEKA 2TEPA 3TEYA 1RUE3 2W91A 2QTWB 2TBVA 2VL4A 1JHNA 1N1VA 1PO12 2BV4A 4UFMA 4YZ4A 3U4SA 4BQ2A 5JI9A 1AX2A 4M3CE 1LOFA 3I8TA 3KWVA 4LPLA 4AL9A 4NIHA 1BBT3 2YV8A 3ACLA 1BBT2 4OI4A 1B35B 3VBOB 3SCGA 5E88A 1GP4A 3A23A 4NAOA 3N7LA 4QU1A 3KQRA 3SQOA 1GQGA 1RUOA 3JB8A 4YNIA 4CXWA 2N7GA 2A70A 4EWAA 1JZ2A 1RMU2 1DZRA 1ASJ1 1FOD2 4Y1VA 3E1F1 3NJVA 4UBGA 4XILA 5D8AB 4GWIA 5FLHA 4Q4X1 3QD6A 3LCPA 2VULA 4JGZC 1GANA 5AC91 1W99A 2HEYF 1SFNA 3VBUC 1SCRA 4XAAA 3I2FA 1QNYA 2PELA 2XUMA 3RNSA 3T0DA 1O91A 1AZDA 1LCLA 1WLTA 3IWZA 4A44A 3DKQA 3OOXA 3R4SA 4Q1PA 3PVBB 5IT6A 2QQKA 1KD7A 1X50A 5I8TA 2ZGPA 4NROA 2ET7A 3OYWA 4Q2FA 4PT6A 4Q4X3 1JTZX 4COWA 4MOAA 2HWF1 3APBA 3O0WA 4HPKA 1FNZA 1AXYA 2PYTA 2YGLA 2Y33A 4QPYA 3J7HA 4MHUA 3ZXAC 3CZJA 1RUI3 4ZONA 4XXPA 2WQ8A 1NCQA 2ZTNA 2BNNA 1XSRA 3FLRA 5ACA1 1W6PA 1POQA 1US2A 2G9FA 2P6HA 1JYWA 2YROA 2VOVA 5FPLA 4QDRA 4AVTA 1V9U2 5F5QA 5FZ8A 2K46A 3WT3A 1NLSA 1JW6A 1HN1A 2NPIA 2WZR2 3AFKA 4YM3A 4CCMA 2WIIB 2OIIA 4NUBA 1J3RA 4HMZA 4JGZA 4X8NA 2P3KA 4AK3A 4BIOA 4Q8LA 2NN8A 3JXSA 4WBBA 1RGSA 2Y64A 2BGPA 3WINE 3RZMA 1DDLA 1MZFA 2Y6KA 2JIGA 1XYPA 4QHZA 1NUKA 2XDVA 5FWJA 1HKDA 2CGNA 4XURA 2Y6LA 4JKMA 2Q0AA 1NKGA 2OYZA 5LBBA 4ARXA 3RS6A 1V6JA 1N3OA 1E5IA 2C0ZA 3THCA 3VBSB 4G3YC 4BJ0A 2BEOA 4UYBA 4WVVA 3ZFEC 3A0NA 4NOTA 1JZ6A 4TXWA 3AL5A 4NHXA 5CFCA 3ZR6A 3MGUA 3B3QE 3TBDA 5ABJC 3WQ1A 5EWSA 1DP0A 2HWE3 4L99A 5APAA 1JYTA 1MR5A 4CDXC 2CV6A 3JCIA 4BK4A 4B4PA 5IYYA 4HK9A 4JTOA 1AYN1 2D98A 4V2WA 1W3XA 2A3WA 3CJIC 3FHIB 3J26N 3OJBA 4XDOA 1RUD2 4RR3A 1HV1A 2XLAA 3FJSA 4R8HA 5FZKA 4ZXEA 5JOZA 1BK0A 3P3NA 3I59A 4OCTA 2R7EB 2PAKA 2WNUA 4XF4A 3AMMA 4PBPA 3D3AA 1W8TA 4LHKA 4AI9A 1D4M2 1O4ZA 1SPPA 2GSYA 2HBUA 2WZR1 3OD0A 5K4LA 2H6BA 1DGWA 1VJ2A 4QPIA 3UGFA 5KXBA 3VBSC 2HKXA 4X6RB 2AZ5A 4Y1UA 3LF7A 1QDCA 1XNTA 5IATA 2FCTA 4FPCA 3A4UA 3VBRA 3DEMA 3VDDA 2XONA 1SBFA 4KMQA 3ZX7A 1R1A3 2E6VA 4B1MA 3U0ZA 2JE9A 1DGWX 2D6PA 2CDOA 1W6QA 3N7MA 1PVC2 5C3RA 2D93A 2ZZQA 3LEMA 4WVZA 5FQ0A 1UZYA 5A3OA 3O5SA 3KZ4C 2IXIA 4LKSA 1ALYA 3T2QA 3NV3A 4XFGA 4AXOA 4QXCA 5E1RA 5FK8A 5HPOA 2H6CA 5T5OA 1LECA 1PX4A 1VBA2 5GJ6A 5H9RA 2GC0A 5KWRA 4LA3A 3K77A 1JZ5A 4NR1A 2RS52 5A80A 1SDWA 4K8RB 5IFPA 2VJXA 1I9RA 1AYM2 1JI6A 4YW5A 2W9XA 3FL7A 4CUAA 2B46X 3VD5A 3L2HA 2Q8OA 3SITA 3ZO0B 3MBWA 1MACA 1N3QA 3AFGA 1GBGA 1RUF2 3H8XA 1FT9A 4FTEA 2GU9A 1DU3D 4GH4A 1LR5A 5A6YA 4BMBA 4Z2AA 4CDQA 5F39A 2GAUA 3ETQA 2A6ZA 1DGRA 4JX0A 5J3UA 1XU2A 4QB6A 1XNKA 5DAXA 3SNMA 5IVJA 2ID4A 3MPPG 1LOCA 4A7ZA 2IXCA 3VHRA 1ZRRA 3CBNA 3OCPA 1UZ0A 1UX6A 4IQPA 2OQ7A 1UOBA 1VMJA 1TE1B 3POJA 1ZVFA 3E5QA 5FYTA 4KG8A 3LEGA 4P9JA 4LT5A 2WFF2 3C8XA 3IPVB 4OMDA 2W52A 4Y22A 2VQAA 2WYSA 1IHMA 1W9WA 4GAZA 1XXNA 2JDZA 3LFIA 1RUF3 2PHFA 5C5TA 2R6QA 1UMZA 2VVDA 3ZXLA 3ILRA 5IVEA 1HRV2 1QOTA 3PL0A 1SCSA 5J1XA 3DXUA 2W1WA 2Z2SB 3AP4A 2H0BA 4OUEA 5FXZA 1A6CA 2KM2A 3I59B 4LULA 3OY8B 3OY8A 3UT0A 3AMHA 4K7JA 5B2GB 1NXD1 5F2WA 3KCCA 4LOTA 2C4XA 4LXLA 4P9IA 5EPAA 4OHYA 3CKHA 1UY3A 4Y5TA 1OF4A 2FCUA 1VBA3 2K2SA 4O61A 5JZGA 1R093 1BCXA 1TNFA 1ZBE3 2DF7A 2Q1ZB 2VH9A 3GNEA 3CMGA 3ZN5A 3M8LA 3HPNA 4B4RA 4DO0A 4EE2A 2JICA 5FY5A 3PDQA 4YM1A 3WW4A 2BTVC 4ZY9A 1BEV1 4AVVA 2P34A 1PK6C 1UZZA 2QBXA 3VBOA 5A3WA 5CAZA 1W8NA 3KCYA 1MZEA 3EQEA 4HVOA 4QKNA 5IVYA 1OBNA 5CZKA 5A32B 4DXZA 5JXHA 5IVCA 3W5NA 1MS4A 1ASJ2 1FOD1 3NMBA 2PFWA 4CUCA 1QJX1 2IXJA 1RUE1 1ZZCA 4DUXA 1W2NA 5F32A 1VE0A 2EF6A 1BZWA 3AYCA 3H1YA 3FUQA 4FAGA 4YG3A 3N9OA 4Q4Y1 4B7KA 1YJLA 5FTTC 2BYVE 2E31A 2XBO3 1GP5A 3BPZA 3WHUA 2EIBA 3WF0A 4QGNA 1NE6A 3THPA 2ADDA 4CDQC 2PAMA 4ZZ8A 2P17A 2CTVA 4Q4V1 5GZGA 3IKWA 2XQXA 4TLGA 4BWOA 2WBKA 1SLIA 1IQAA 5E16A 3WNXA 2HYXA 1W8HA 4XMIA 2IZWA 5K8SA 3I3MA 3LQCA 4ZZ5A 2X05A 3OUHA 1T6GC 2XJPA 3POSA 1OC1A 3C7GA 5J98B 3KGZA 5CFDA 3ZYRA 1EYBA 5BNNA 4L92A 5F9TA 3HOBA 4Q4X2 5L73A 1MQTC 4LIUA 2R49A 2XWJB 3TN92 4CUBA 1LGNA 4SLIA 4AFMA 2AACA 2W1SA 2YXSA 4N53C 4RYDA 1QH6A 3W20A 1GR3A 3VBFB 3VZJA 2GP5A 4XJZA 2VCCA 5FK7A 5ANQA 3KV5A 4HSLA 4QX1A 2PHUA 1R1ZA 4E4HA 5BNNB 4N8MA 3TOJA 3E6CC 2I74A 4LO6B 1DYOA 5DZEA 1JHJA 1R081 1ZZ8A 3LD8A 3R05A 2XBO2 4GH4B 4JV4A 4JDNA 4L11A 1RUJ3 4PI0A 4N7UA 3DL3A 1PNFA 4M4PA 3AYEA 4I0BA 2UU8A 3GALA 3LDKA 2ZHLA 1DZQA 3MIHA 5ACA3 5BNOB 4MHRA 1OI6A 2BFUL 5FLIA 4QKBA 4YPJA 5F7UA 1OMIA 2A75A 2BP6A 2DVGA 3LPFA 2HJIA 3VKMA 1U5YA 4XHBA 1PMHX 3HQXA 4MADA 2J42A 3RZGA 3R6SA 2E32A 4DQAA 2WS91 3JQWA 5FOBB 5K7PA 3HQRA 4ATFA 2O1QA 3WG1A 2OX0A 1UZVA 1CJDA 2D3PA 2WC2A 2BBAA 2WKKA 3OPTA 3BU7A 5A1AA 1WMXA 1W9YA 2XVLA 1PZ9A 2VOTA 4F3JA 1EAH3 4AF9A 3AVRA 3WF4A 4YGBA 4YW1A 1UN1A 5AC92 1SFPA 2PHRA 1NCQB 1OXCA 4WZCA 2EICA 3IN9A 2LS6A 2R072 3DYPA 4J1WA 3TEXA 4OQ8A 4AHXA 1XE7A 4RR3C 3I7DA 1OPMA 1ZZBA 3GXUA 2D6NA 2HWF2 1COV1 3RPQA 5HV0A 3MIBA 4I2OA 2BOIA 1RUNA 4GB33 4LO4B 1UL9A 4JQRA 3USSA 1O4YA 1TME1 3LSEA 3ZIXA 1Q8SA 2VD7A 4YZ3A 3N35A 5FP3A 4M00A 5FPAA 2JDKA 2R043 3AZXA 4GWNA 1U12A 3TNQA 1LEDA 2VUDA 1E5SA 3AJYA 3T4VA 4EN9B 3U75A 3K3NA 3BN6A 3SC7X 4E4SA 3G7DA 1AL23 1OKOA 1WA6X 3WP5A 2A7AA 1LOBA 1PVXA 3TEZA 4XFBA 1QJU2 1EV13 2OS2A 3PJQA 3OGRA 4Q4V2 3VBSA 4EYUA 4EWDA 4IESA 2G4IA 1KQRA 4RQPA 4AGVA 1CVNA 5A3MA 2JKXA 4ZS3A 1PM7A 4FP3A 4LBQB 2B8MA 3MW2A 4IEVA 4KU7A 3BTXA 1NA1C 1Q5OA 2R041 2FMDA 4RA0A 1NLQA 4CCLA 4CP9A 1GYKA 4PCRA 4BOWA 1JBCA 2O0OA 2OVUA 4I02A 4KWJA 4MSVA 4ONUA 4PLOA 3WP3A 1X33A 2ARBA 3DCQA 5E8AA 2QQWA 3ZM8A 3B9CA 2MHFA 4QXKA 5C8CB 1RIRA 3BVCA 4Y22B 1N1SA 3POWA 2PLV1 1MQTB 1RYYA 1EV12 4MGSA 1ZX5A 2XKOA 4PIYA 3USUA 3ZXFA 5JXJA 2PAEA 2W39A 4AYUA 1WBLA 4MXWB 3RZHA 5D21A 2DCJA 3U4XA 1AL22 3NAPA 5FZEA 4EQVA 2CYFA 1ONAA 5FY0A 1X36A 1I3HA 2X29A 5A3UA 1XNDA 3NVCA 1OFSA 1V6MA 5F5CA 3S5AA 4JVAA 1W6NA 1PO22 2QQVA 1GZWA 2PN5A 1GNYA 1LENA 4WVWA 4E8DA 2WS93 5LK5A 4EN6B 1O8SA 5FY8A 3AP6A 2O8QA 1UU6A 2VMHA 3CJXA 3CHXA 4PF5A 2DCKA 2NMOA 4YVSB 4UFHA 4OI1A 2RJ2A 4N7IA 1O8PA 1OFNA 3NV4A 5FZDA 1RHI3 3MICA 2HWC1 1VBB3 3KLSA 4GALA 3T30A 1QJEA 2OW4A 1RUH2 3UGHA 3MIGA 3VZLA 2HWE1 4FPYA 2E26A 1AR71 1VAKA 1W2OA 1AR63 4Q27A 4HKWA 3VB9A 2WUHA 2WT2A 1W9FA 1W9TA 2HH9A 4D7YA 2B39A
chains in the Genus database with same CATH topology
2E33A 2WN2A 5DMYA 1WKYA 2QQOA 2J1VA 1T2XA 2WZ8A 1O59A 1L7QA 2DDUA 2J1UA 4QB2A 1CIYA 3A22A 3I2JA 3NJXA 3WSOA 1KEXA 3I3DA 2B9VA 2ZEXA 2W95A 5C7GA 4FI9A 2QQMA 1JYNA 1GOGA 3NNGA 1P8JA 4HG6B 4DXSA 3LEKA 4A41A 2VQUA 5DN2A 2W91A 2VL4A 2VO5A 1UMHA 2JE8A 4LPLA 5LA0A 2VC9A 1F4AA 4ARYA 2Y6HA 4DUVA 3A23A 3VD3A 5IHRA 1JYVA 2ZEZA 1GMMA 3ECQA 1JZ2A 4QDQA 4KI5M 3E1F1 3NJVA 2QQJA 1UY0A 1F4HA 2BGOA 2YG0A 4GWIA 3SKJE 2C9KA 1SDDB 3OB8A 2VM9A 1W99A 3ACIA 3IAPA 3OG2A 3T0AA 2VZPA 3I2FA 2W46A 2WAOA 3T0DA 2WO1A 3BGAA 4A44A 4GZ9A 2C26A 2QQKA 1GOHA 3CQOA 2VQTA 4P02B 1TG7A 4PT6A 4MOAA 1CZTA 1UYXA 3HNBM 4CU6A 5LA2A 3WEZA 1K3IA 3J7HA 5FUIA 1JZ7A 3CZJA 1I5PA 4P00B 2WQ8A 3WNPA 3SEPA 3SEEA 3OGVA 3MUY1 1DLCA 1US2A 1JYWA 4QDRA 3VD4A 4OMCA 4A4AA 5EIYB 3WNNA 2W47A 2OKXA 1HN1A 3UNPA 2YB7A 1GQPA 2RVAA 1UWWA 3DYMA 2J1SA 3ACGA 3JXSA 3ACHA 3K75B 2Y64A 2BGPA 3C7FA 3DECA 2Y6KA 3ETPA 3NQHA 3EYPA 4QAWA 2EIEA 2W3JA 1NUKA 3MUZ1 4XURA 2W87A 2Y6LA 4JKMA 1CZVA 1NKGA 4ARXA 4BJ0A 3GDBA 3THCA 4A6OA 3K4AA 5B4NA 1JZ6A 2CDPA 1SG3A 4TXWA 2LW8A 4M4RA 4PQQA 1DP0A 4P08A 3WNLA 4BK4A 1YQ2A 1WCQA 2VZRA 5IYYA 1NAEA 3ABZA 1J83A 1EUTA 2VTFA 5JUVA 3F2ZA 3HJRA 3K46A 2WZEA 4ZXEA 2R7EB 3P6BA 3U37A 3IIIA 2J1TA 3D3AA 4BXSV 1CZSA 4DUWA 2JD9A 2X09A 3VDBA 1MPXA 4JKKA 2J22A 2YFZA 5LCWL 5I0DA 1XNTA 1ULPA 2VCAA 2XONA 4KMQA 1OF3A 3CIHA 1XPWA 3I3EA 2CDOA 2WO3A 1IQDC 1PMJX 1OD3A 2VZ1A 1EUUA 3CDZB 3EB7A 4LKSA 3NRUA 5JR2A 3T2QA 3T0BA 4XUNA 5HPOA 1BHGA 3LEIA 4PF1A 1PX4A 4CU9A 4XVHA 1UXXX 4OYUA 3MO4A 3K77A 1JZ5A 5IFPA 2VJXA 2VCBA 1JI6A 3GGLA 2YC4A 2W9XA 3IAQA 3HN3A 4MO3M 3A7QA 3FL7A 5EJ1B 1ULOA 4P5YA 3CZUA 5B4XA 4CUAA 3W5MA 1K12A 3FHAA 3MV01 3VD5A 2WO2A 4CU7A 1W8OA 3PUHA 2BERA 1UYYA 3MBWA 4JHZA 1SHWB 3ACFA 3WNOA 2ZEWA 4Z2AA 4D0QA 3VDCA 1UXZA 4JX0A 2VZTA 4QB6A 4OZOA 2J1RA 3I2KA 3GM8A 2ID4A 1XC6A 4DEQA 1XNAA 2ORZA 4XUPA 1KGYA 4RN5A 1JZ4A 1UZ0A 5G04L 5DQ0A 4BK5A 1UYZA 4TTGA 3WF3A 5HXMA 3LEGA 3HNYM 3C8XA 5G05L 4OMDA 2VMDA 2WYSA 4XZUG 4MGQA 1W9WA 3VD7A 1D7PM 1K45A 4W8JA 2JDAA 5J1XA 2W1WA 4OUEA 1W0NA 3DYOA 4AAXA 2W1QA 5DPNA 2C4XA 2YFUA 3CKHA 1UY3A 1OF4A 3THDA 3UESA 5C70A 4BDVB 4DEVA 2YC2A 4CU8A 3CMGA 2VZ3A 3HPNA 3FHQA 2QQIA 3A21A 4UI9L 4ZY9A 2QBXA 1W8NA 2XHNA 5JXHA 5CZKA 4QX3A 1JU3A 2QQNA 3W5NA 2Z4FA 4CUCA 2VZQA 4DUXA 3PUIA 1UY1A 2VZOA 3HEIA 3P1IA 4D8MA 3MV11 2E31A 1JZ3A 2EIBA 3WF0A 5LA1A 1LNSA 4ZZ8A 1UY4A 2W94A 5IJRA 2V4VA 2XQXA 4A42A 1UX7A 2WBKA 3I97A 2HYXA 1L7RA 3LQCA 4ZZ5A 3T09A 2V5DA 2X05A 2VR4A 1OH4A 3C7GA 4XUOA 3HOBA 2W5FA 4W4ZA 3OGSA 2PQSA 4CUBA 4QDSA 2W1SA 4RYDA 2VCCA 2BZDA 4QX1A 5JMOA 4KWUA 1DYOA 3C7OA 1JHJA 4A45A 2HLEA 3FN9A 2W92A 2WAAA 2XOMA 1JYXA 4M4PA 4A3ZA 3WQBA 5JXIA 2ZEYA 2VMCA 4AG4A 4YPJA 5F7UA 1JU4A 2VZSA 3LPFA 1PMHX 4MADA 2E32A 4L0PA 1GU3A 1K42A 2BBAA 3I2GA 5A1AA 2J1EA 4XUQA 4XUTA 1H6XA 2VOTA 4QPWA 5EJZB 4DXRA 3WF1A 3OEAA 2J1AA 3WF4A 2Y6JA 3WNKA 2EICA 2LS6A 3DYPA 3UETA 3WNMA 2W1UA 3GXUA 4DXTA 2WDBA 1R64A 4IUGA 3OBAA 2VMEA 2QQLA 3IB3A 1PX3A 3K4DA 3K4ZA 2VZUA 3LPGA 3BN6A 3WF2A 4GWJA 1GUIA 5CYYA 2Y8KA 4JKLA 1NX9A 2V72A 3OGRA 3AC0A 4LQRA 4UAPA 3I3BA 2JKXA 1J84A 3C7HA 2Y6GA 3I2IA 3SKVA 4QX2A 1CX1A 3LE0A 2ORXA 3ZM8A 2J7MA 2EIDA 1W9SA 1UMIA 3T2PA 5C71A 4MGSA 1RYYA 3HNMA 5JXJA 3OEBA 3VDAA 3T08A 2DCJA 3T2OA 1UY2A 2KD7A 3VD9A 4E8CA 3IDAA 2VZVA 4CVUA 1GNYA 1US3A 1TVGA 2B4KA 4E8DA 4ET7A 4UOJA 4LHSA 2RV9A 1O8SA 3I2HA 1H6YA 2DCKA 2WN3A 2ZXQA 1OT5A 2RJ2A 1O8PA 2L9LA 5IFTA 2WABA 2X10A 1GOFA 2E26A 3C7EA 4QB1A 4W50A 5JXGA 1JZ8A 2WUHA 2VMFA 1W9TA 4QX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E33 A;  2WN2 A;  5DMY A;  1WKY A;  2QQO A;  2J1V A;  1T2X A;  2WZ8 A;  1O59 A;  1L7Q A;  2DDU A;  2J1U A;  4QB2 A;  1CIY A;  3A22 A;  3I2J A;  3NJX A;  3WSO A;  1KEX A;  3I3D A;  2B9V A;  2ZEX A;  2W95 A;  5C7G A;  4FI9 A;  2QQM A;  1JYN A;  1GOG A;  3NNG A;  1P8J A;  4HG6 B;  4DXS A;  3LEK A;  4A41 A;  2VQU A;  5DN2 A;  2W91 A;  2VL4 A;  2VO5 A;  1UMH A;  2JE8 A;  4LPL A;  5LA0 A;  2VC9 A;  1F4A A;  4ARY A;  2Y6H A;  4DUV A;  3A23 A;  3VD3 A;  5IHR A;  1JYV A;  2ZEZ A;  1GMM A;  3ECQ A;  1JZ2 A;  4QDQ A;  4KI5 M;  3E1F 1;  3NJV A;  2QQJ A;  1UY0 A;  1F4H A;  2BGO A;  2YG0 A;  4GWI A;  3SKJ E;  2C9K A;  1SDD B;  3OB8 A;  2VM9 A;  1W99 A;  3ACI A;  3IAP A;  3OG2 A;  3T0A A;  2VZP A;  3I2F A;  2W46 A;  2WAO A;  3T0D A;  2WO1 A;  3BGA A;  4A44 A;  4GZ9 A;  2C26 A;  2QQK A;  1GOH A;  3CQO A;  2VQT A;  4P02 B;  1TG7 A;  4PT6 A;  4MOA A;  1CZT A;  1UYX A;  3HNB M;  4CU6 A;  5LA2 A;  3WEZ A;  1K3I A;  3J7H A;  5FUI A;  1JZ7 A;  3CZJ A;  1I5P A;  4P00 B;  2WQ8 A;  3WNP A;  3SEP A;  3SEE A;  3OGV A;  3MUY 1;  1DLC A;  1US2 A;  1JYW A;  4QDR A;  3VD4 A;  4OMC A;  4A4A A;  5EIY B;  3WNN A;  2W47 A;  2OKX A;  1HN1 A;  3UNP A;  2YB7 A;  1GQP A;  2RVA A;  1UWW A;  3DYM A;  2J1S A;  3ACG A;  3JXS A;  3ACH A;  3K75 B;  2Y64 A;  2BGP A;  3C7F A;  3DEC A;  2Y6K A;  3ETP A;  3NQH A;  3EYP A;  4QAW A;  2EIE A;  2W3J A;  1NUK A;  3MUZ 1;  4XUR A;  2W87 A;  2Y6L A;  4JKM A;  1CZV A;  1NKG A;  4ARX A;  4BJ0 A;  3GDB A;  3THC A;  4A6O A;  3K4A A;  5B4N A;  1JZ6 A;  2CDP A;  1SG3 A;  4TXW A;  2LW8 A;  4M4R A;  4PQQ A;  1DP0 A;  4P08 A;  3WNL A;  4BK4 A;  1YQ2 A;  1WCQ A;  2VZR A;  5IYY A;  1NAE A;  3ABZ A;  1J83 A;  1EUT A;  2VTF A;  5JUV A;  3F2Z A;  3HJR A;  3K46 A;  2WZE A;  4ZXE A;  2R7E B;  3P6B A;  3U37 A;  3III A;  2J1T A;  3D3A A;  4BXS V;  1CZS A;  4DUW A;  2JD9 A;  2X09 A;  3VDB A;  1MPX A;  4JKK A;  2J22 A;  2YFZ A;  5LCW L;  5I0D A;  1XNT A;  1ULP A;  2VCA A;  2XON A;  4KMQ A;  1OF3 A;  3CIH A;  1XPW A;  3I3E A;  2CDO A;  2WO3 A;  1IQD C;  1PMJ X;  1OD3 A;  2VZ1 A;  1EUU A;  3CDZ B;  3EB7 A;  4LKS A;  3NRU A;  5JR2 A;  3T2Q A;  3T0B A;  4XUN A;  5HPO A;  1BHG A;  3LEI A;  4PF1 A;  1PX4 A;  4CU9 A;  4XVH A;  1UXX X;  4OYU A;  3MO4 A;  3K77 A;  1JZ5 A;  5IFP A;  2VJX A;  2VCB A;  1JI6 A;  3GGL A;  2YC4 A;  2W9X A;  3IAQ A;  3HN3 A;  4MO3 M;  3A7Q A;  3FL7 A;  5EJ1 B;  1ULO A;  4P5Y A;  3CZU A;  5B4X A;  4CUA A;  3W5M A;  1K12 A;  3FHA A;  3MV0 1;  3VD5 A;  2WO2 A;  4CU7 A;  1W8O A;  3PUH A;  2BER A;  1UYY A;  3MBW A;  4JHZ A;  1SHW B;  3ACF A;  3WNO A;  2ZEW A;  4Z2A A;  4D0Q A;  3VDC A;  1UXZ A;  4JX0 A;  2VZT A;  4QB6 A;  4OZO A;  2J1R A;  3I2K A;  3GM8 A;  2ID4 A;  1XC6 A;  4DEQ A;  1XNA A;  2ORZ A;  4XUP A;  1KGY A;  4RN5 A;  1JZ4 A;  1UZ0 A;  5G04 L;  5DQ0 A;  4BK5 A;  1UYZ A;  4TTG A;  3WF3 A;  5HXM A;  3LEG A;  3HNY M;  3C8X A;  5G05 L;  4OMD A;  2VMD A;  2WYS A;  4XZU G;  4MGQ A;  1W9W A;  3VD7 A;  1D7P M;  1K45 A;  4W8J A;  2JDA A;  5J1X A;  2W1W A;  4OUE A;  1W0N A;  3DYO A;  4AAX A;  2W1Q A;  5DPN A;  2C4X A;  2YFU A;  3CKH A;  1UY3 A;  1OF4 A;  3THD A;  3UES A;  5C70 A;  4BDV B;  4DEV A;  2YC2 A;  4CU8 A;  3CMG A;  2VZ3 A;  3HPN A;  3FHQ A;  2QQI A;  3A21 A;  4UI9 L;  4ZY9 A;  2QBX A;  1W8N A;  2XHN A;  5JXH A;  5CZK A;  4QX3 A;  1JU3 A;  2QQN A;  3W5N A;  2Z4F A;  4CUC A;  2VZQ A;  4DUX A;  3PUI A;  1UY1 A;  2VZO A;  3HEI A;  3P1I A;  4D8M A;  3MV1 1;  2E31 A;  1JZ3 A;  2EIB A;  3WF0 A;  5LA1 A;  1LNS A;  4ZZ8 A;  1UY4 A;  2W94 A;  5IJR A;  2V4V A;  2XQX A;  4A42 A;  1UX7 A;  2WBK A;  3I97 A;  2HYX A;  1L7R A;  3LQC A;  4ZZ5 A;  3T09 A;  2V5D A;  2X05 A;  2VR4 A;  1OH4 A;  3C7G A;  4XUO A;  3HOB A;  2W5F A;  4W4Z A;  3OGS A;  2PQS A;  4CUB A;  4QDS A;  2W1S A;  4RYD A;  2VCC A;  2BZD A;  4QX1 A;  5JMO A;  4KWU A;  1DYO A;  3C7O A;  1JHJ A;  4A45 A;  2HLE A;  3FN9 A;  2W92 A;  2WAA A;  2XOM A;  1JYX A;  4M4P A;  4A3Z A;  3WQB A;  5JXI A;  2ZEY A;  2VMC A;  4AG4 A;  4YPJ A;  5F7U A;  1JU4 A;  2VZS A;  3LPF A;  1PMH X;  4MAD A;  2E32 A;  4L0P A;  1GU3 A;  1K42 A;  2BBA A;  3I2G A;  5A1A A;  2J1E A;  4XUQ A;  4XUT A;  1H6X A;  2VOT A;  4QPW A;  5EJZ B;  4DXR A;  3WF1 A;  3OEA A;  2J1A A;  3WF4 A;  2Y6J A;  3WNK A;  2EIC A;  2LS6 A;  3DYP A;  3UET A;  3WNM A;  2W1U A;  3GXU A;  4DXT A;  2WDB A;  1R64 A;  4IUG A;  3OBA A;  2VME A;  2QQL A;  3IB3 A;  1PX3 A;  3K4D A;  3K4Z A;  2VZU A;  3LPG A;  3BN6 A;  3WF2 A;  4GWJ A;  1GUI A;  5CYY A;  2Y8K A;  4JKL A;  1NX9 A;  2V72 A;  3OGR A;  3AC0 A;  4LQR A;  4UAP A;  3I3B A;  2JKX A;  1J84 A;  3C7H A;  2Y6G A;  3I2I A;  3SKV A;  4QX2 A;  1CX1 A;  3LE0 A;  2ORX A;  3ZM8 A;  2J7M A;  2EID A;  1W9S A;  1UMI A;  3T2P A;  5C71 A;  4MGS A;  1RYY A;  3HNM A;  5JXJ A;  3OEB A;  3VDA A;  3T08 A;  2DCJ A;  3T2O A;  1UY2 A;  2KD7 A;  3VD9 A;  4E8C A;  3IDA A;  2VZV A;  4CVU A;  1GNY A;  1US3 A;  1TVG A;  2B4K A;  4E8D A;  4ET7 A;  4UOJ A;  4LHS A;  2RV9 A;  1O8S A;  3I2H A;  1H6Y A;  2DCK A;  2WN3 A;  2ZXQ A;  1OT5 A;  2RJ2 A;  1O8P A;  2L9L A;  5IFT A;  2WAB A;  2X10 A;  1GOF A;  2E26 A;  3C7E A;  4QB1 A;  4W50 A;  5JXG A;  1JZ8 A;  2WUH A;  2VMF A;  1W9T A;  4QX0 A; 
#chains in the Genus database with same CATH topology
 4UWD A;  2GME A;  3EMR A;  5FBJ A;  1H2K A;  2QQO A;  3SIS A;  4DPN A;  2R30 A;  2ZHK A;  2WZ8 A;  3E5U A;  4BQ1 A;  1A8M A;  1D4M 1;  4IGP A;  5LBC A;  3HVD A;  5FXV A;  4FXK B;  3C3V A;  2ZGO A;  1FPN 1;  1UAI A;  5FPU A;  2DUR A;  4LE4 A;  3ALQ A;  1PHM A;  3NV2 A;  5E6H A;  2WFP A;  3GF6 A;  4KBB A;  5HCF A;  3OGJ A;  1KEX A;  3I3D A;  1WWY A;  3O0V A;  4AQ6 A;  1GNH A;  2XJV A;  3V0B A;  2AC1 A;  1I1E A;  3U10 A;  4BB3 A;  4MV2 A;  1LOF C;  4COY A;  4FBF A;  2DBI A;  1ACC A;  4FI9 A;  4QX7 A;  4ASL A;  5C5U A;  1S0D A;  1GOG A;  2WNV A;  4DFS A;  3O0X A;  2AGS A;  2OPK A;  3AMN A;  2FDF A;  4A41 A;  3TNP B;  1FNY A;  2VQU A;  3AL6 A;  3CJI B;  3QAC A;  5DN2 A;  4D3W A;  4HAN A;  4BCU A;  1IKQ A;  1FPN 3;  1AUY A;  1QJY 2;  2ARC A;  1O7F A;  2JE8 A;  2UYA A;  2Z69 A;  5LA0 A;  2VC9 A;  1ENS A;  2GC1 A;  1W05 A;  2Q8E A;  1WUV A;  5FRA A;  5L19 A;  4DRR A;  4R9B A;  1VBC 2;  5FZI A;  4NPM A;  3RZK A;  1JYV A;  5C9A C;  1WD4 A;  4Q4W 3;  4AVS A;  4FFH A;  4XJW A;  1GMM A;  3GBG A;  5JPM B;  4QDQ A;  3PME A;  2IFR A;  5D8A C;  1H8V A;  4NPR A;  2YG0 A;  1F4H A;  4XJ9 A;  1YQC A;  1SDD B;  1ULE A;  5KXC A;  3S57 A;  3OB8 A;  4S2G A;  5I91 A;  2WIN B;  5KXD A;  3ACI A;  1YEW A;  1SEF A;  2TUN A;  3CNA A;  2FCV A;  2WL1 A;  3IAP A;  1C1F A;  2OT7 A;  4XAC A;  2ZBJ A;  3RI9 A;  3LIH A;  3CU7 A;  3LB9 A;  3GHM A;  3D0J A;  3ASI A;  5KHK A;  1PM4 A;  2WO1 A;  3FFZ A;  5ISL A;  1V9U 1;  4FP2 A;  2C26 A;  5FKB A;  5FY4 A;  2WRA A;  1QIQ A;  1W2A X;  3K2O A;  4RS5 B;  3KGL A;  1GOH A;  3AM2 A;  4WM7 B;  4CRQ A;  3WXP A;  4DIQ A;  2VQT A;  1C8M 3;  1H8T A;  2BVV A;  4XW3 A;  1UKG A;  2ZAB A;  4YGD A;  1DQ2 A;  5DDJ 3;  1H1M A;  1N1T A;  3MEP A;  1K3I A;  1W8Z A;  4FCA A;  4V2V A;  5LA2 A;  2Q8C A;  3WZ1 A;  1FAT A;  3J7N A;  1S0F A;  1RUH 1;  3WDX A;  4COV A;  2HWE 2;  1Q43 A;  2JG9 A;  2XQR A;  3SEP A;  2AH2 A;  2RHP A;  3MUY 1;  5BXX A;  2V4A A;  4COZ A;  4YW3 A;  5FYV A;  3MID A;  3VD4 A;  4IEP A;  5CU1 A;  2JDN A;  3EXU A;  5FZF A;  2XR4 A;  1PIV 1;  5FZ6 A;  1TMF 1;  3OBZ A;  1YFY A;  4MVT A;  3WQ0 A;  1KRI A;  2LRO A;  4XBN A;  2OKX A;  2R04 2;  2Y26 A;  1PK6 B;  4BXF A;  1Z78 A;  2J1S A;  2WLP A;  4YM0 A;  3W59 A;  3ACH A;  3DXT A;  3QH7 A;  2FDH A;  3DEC A;  2X8K A;  2E7A A;  3ETP A;  5GLU A;  4LO8 A;  1AR6 1;  2EIE A;  1ZRI A;  3NKG A;  5EQU A;  3O1T A;  1C3H A;  3MUZ 1;  2XXZ A;  4QPI C;  2BNM A;  1W2T A;  3UK9 A;  2HEV F;  3BIW E;  4JDO A;  5F3E A;  4LLO A;  4E27 A;  1WCK A;  1TEI A;  5GZE A;  1STM A;  1PIV 3;  1F8V A;  5L36 A;  1PGS A;  1OH3 A;  2CDP A;  1SG3 A;  4BE3 A;  5T54 A;  5F3I A;  4BZ4 A;  2CNA A;  1O3Q A;  4GUL A;  1YFU A;  1ULD A;  3DPR A;  3H1M A;  5JIA A;  5E89 A;  1QJY 1;  2IC1 A;  2UWB A;  4PQQ A;  3Q9O A;  1J1L A;  3NNM A;  4Z1V A;  4K3U A;  2VNO A;  4QMA A;  3H42 B;  4W6Y A;  1PO1 3;  1YQ2 A;  4P9Y A;  1WCQ A;  4KWL A;  2VZR A;  2FMY A;  2EXJ A;  3E5X A;  1NAE A;  2OXB A;  4FXG B;  4AI2 A;  2VEC A;  2RMU 3;  2JG9 C;  4CP2 A;  3KHC A;  2ZGT A;  3HJR A;  4MYE A;  4AVA A;  5C3S A;  1QQP 3;  3ZSJ A;  5FZ3 A;  3I2D A;  2P4E A;  1FV3 A;  2BNO A;  1VBC 1;  1ND2 C;  3JBG 1;  4LLF A;  4UW5 A;  2GND A;  4BQ4 A;  3III A;  4RFT 0;  1IS6 A;  1OSG A;  2J1T A;  4UF0 A;  4BXS V;  1CZS A;  4DUW A;  2PHT A;  2JD9 A;  1FI2 A;  1MPX A;  1TMF 2;  2PXJ A;  2YU1 A;  5DAV A;  3PMS A;  2ZGQ A;  2MEV 2;  1NCR A;  1ULP A;  3WUC A;  5IK8 A;  3BI3 A;  4KG0 A;  5JSR A;  1H8T C;  4WM8 A;  4QWN A;  1PNG A;  4FAH A;  1XE0 A;  4URT A;  1BVP 1;  3VL9 A;  5FUP A;  3WDV A;  1OF3 A;  3CIH A;  2D5F A;  2ZJC A;  3I3E A;  3OPW A;  4FQZ A;  3MYX A;  3LGR A;  4Y24 A;  3JBG 3;  4YLZ A;  2G1M A;  4HL0 A;  4O7X A;  1NA1 B;  4R9D A;  3GCX A;  3UGG A;  3ZYH A;  4GA9 A;  4LOR A;  1VB2 A;  4H14 A;  3W21 A;  1MZ6 A;  2VGD A;  4PHZ A;  3NRU A;  3GZT B;  3MZH A;  5GKA C;  3WY6 A;  5JI7 A;  2GNM A;  4XF1 A;  4HXC A;  1REE A;  2ERF A;  4IEX A;  4IV3 C;  4NHK A;  4OUS A;  1PIV 2;  3M1H A;  3KT4 A;  5GZF A;  4OYU A;  5TSW A;  2OPW A;  2ZX0 A;  2I45 A;  3MO4 A;  4XCA A;  4AFC A;  4E9K A;  5LY1 A;  2R16 A;  2VOW A;  3NST A;  1CWP A;  2VCB A;  1VPH A;  4CCE A;  1SZB A;  2ARX A;  1NQJ A;  2YC4 A;  2X5I B;  3GGL A;  3IAQ A;  1MQT A;  3A7Q A;  4M0H A;  4XET A;  5EJ1 B;  5SV5 A;  5B4X A;  1NLR A;  1H1A A;  1XBF A;  1IPJ A;  2Q4S A;  3D5O A;  3P3P A;  3QOP A;  3MV0 1;  5FJH A;  4CU7 A;  3BU0 A;  2HBT A;  2X53 S;  3PUH A;  5IK5 A;  2BER A;  1GWL A;  1OQE A;  1RUJ 2;  2OQ6 A;  3RRD A;  2D6M A;  1UW8 A;  2XUE A;  5T5L A;  1APN A;  1GZW B;  3L9J T;  1W04 A;  3VDC A;  1UXZ A;  2D5H A;  4ASK A;  4Q0U A;  4RQP B;  2WNV C;  4LA2 A;  4DIN B;  3SHR A;  4QQ2 A;  1BYH A;  3RI8 A;  4AAP A;  2NMN A;  1RHI 1;  2R0H A;  2VUA A;  2JXA A;  3GM8 A;  4L97 A;  2ORZ A;  1GWM A;  2YZ4 A;  3G6J B;  4RGG A;  3ZYB A;  2JG8 B;  5KHJ A;  4RN5 A;  3VGI A;  4DB5 A;  1VLN A;  1FMD 3;  2WQ4 A;  1PZ7 A;  5G04 L;  4BK5 A;  1UYZ A;  3SXW A;  2JE7 A;  4IV3 B;  4AQT A;  2YDE A;  3RFR A;  4TTG A;  4HZF A;  3WF3 A;  2MEV 3;  3AYA A;  4RL7 A;  3B9I A;  3RQ0 A;  5DAQ A;  5G05 L;  3RYP A;  1CD3 G;  4M3C A;  1HX6 A;  4QPI B;  3E6B A;  2P6C A;  3B5L B;  3VD7 A;  4B7E A;  1TME 2;  3N4M A;  1YJK A;  1GV9 A;  1YYN A;  4PLM A;  4BHP A;  5LB6 A;  3ZN6 B;  4ES9 A;  4B3N A;  2ZS6 B;  1Q8V A;  1QJF A;  1W0N A;  1RXG A;  4ATE A;  2XJR A;  4LMF A;  1RUG 3;  2KXL A;  1PO1 1;  1KS4 A;  5FWE A;  3AZZ A;  4AAX A;  5A70 A;  2F17 A;  5A32 A;  2WLQ A;  5CFD C;  4CSW A;  4CXY A;  2MEV 1;  1EPZ A;  1C5H A;  3UES A;  4QM8 A;  4TN7 A;  4H7L A;  4BDV B;  5GZC A;  2YC2 A;  3RJR A;  5ERL A;  4CU8 A;  1F9K A;  5FP8 A;  4OI2 A;  4CXX A;  3PHM A;  4HVR A;  4IGQ A;  5EFU A;  2XWB B;  5F37 A;  1YHF A;  3AVS A;  3M3C A;  1QXJ A;  1U5Z A;  3A0K A;  5DUW A;  4PI2 A;  1ZRE A;  2LUW A;  5C3O A;  2GMM A;  1FPN 2;  2XHN A;  5DAB A;  5LAT A;  4JAA A;  1Y4W A;  2CL2 A;  4QX3 A;  1ND2 A;  3ITQ A;  2XLF A;  3OBR A;  3POE A;  3RZL A;  4ZU4 A;  2VZQ A;  3VZN A;  3M7A A;  1HQW A;  4TWT A;  3N9P A;  3LIG A;  1NZC A;  1CPM A;  2I07 B;  4CEW B;  1JOP A;  4D6R A;  1CGP A;  1RC6 A;  4Q4Y 3;  4CYD A;  4YW7 A;  5LEJ A;  1ST8 A;  3N3H A;  3WV6 A;  1UY1 A;  2VZO A;  3HEI A;  5EP9 A;  1E5H A;  2Q1M A;  3VBF A;  3MV1 1;  1AR9 1;  3EJK A;  3RWN A;  3VHN A;  2EXK A;  3H7Y A;  1LHU A;  4K20 A;  1VBD 2;  2PHL A;  4A42 A;  5F3C A;  1O3R A;  3I97 A;  3WG2 A;  1LB2 A;  4JGY A;  4GKX A;  5JZG C;  4ITC A;  1L7R A;  1WLW A;  2UUR A;  5BUV A;  5DG2 A;  1W6O B;  3P5B A;  4AEM A;  1JXN A;  1LOG A;  2VR4 A;  1L7L A;  4Q0S A;  4JTN A;  5FZM A;  4DOU A;  1AR6 2;  4QPG A;  4MZU A;  3GHN A;  2Y34 A;  3ME2 A;  4QDS A;  2UYB A;  4S2D A;  4ZXK A;  1QMJ A;  4CPB D;  1J58 A;  1F31 A;  4XYX A;  3ZYJ B;  4HET A;  3J9S A;  5A7W B;  5A7W A;  4BLJ A;  4EN8 B;  3AX4 A;  2RDN A;  4KWU A;  3RVH A;  5A3L A;  1PO2 3;  3U14 A;  1ZZ6 A;  4U36 A;  3JU9 A;  1D0G A;  3LZZ A;  1HIX A;  4UFI A;  5FZA A;  1JYX A;  4GMP 0;  1UF2 C;  5FOJ B;  4WM8 B;  5CNA A;  4A3Z A;  4AFA A;  3AB0 A;  4HPK B;  3TEW A;  3BOW A;  1W6P B;  4XF0 A;  1YLL A;  2NP0 A;  2PQQ A;  5CEH A;  4Q1R A;  1JU4 A;  2EAA A;  1AR8 1;  1C5I A;  1CON A;  1FMD 1;  4URA A;  3OUI A;  3ZYG A;  3GYD A;  4YW6 A;  4E2Q A;  1Q56 A;  5A3T A;  3B93 A;  4L0P A;  1V6O A;  4IET A;  4XC9 A;  1GU3 A;  2IVJ A;  3JD7 1;  4ORF A;  1PO2 1;  5FO8 B;  2IVI B;  1W03 A;  1QJZ A;  2WZP P;  2Y0I A;  3LAG A;  3Q8F A;  2WO7 A;  2J1E A;  3VLB B;  3B00 A;  4DXR A;  4LR4 A;  3RGB A;  3O1O A;  1ULF A;  1MS9 A;  1GNZ A;  2RR1 1;  4L2N A;  4K1Z A;  1CAW B;  2GC2 A;  4XFC A;  1OHF A;  5LAS A;  4HFS A;  1CAX B;  2D43 A;  4S2H A;  3THT A;  2GZW A;  4BH9 A;  4JDM A;  1JOJ A;  1LUL A;  3J4U H;  4WM7 C;  4CDW A;  4COU A;  4A3X A;  1AXZ A;  2RMU 1;  3RYK A;  4DXT A;  5C3Q A;  1XNC A;  3V65 A;  2NLR A;  1R64 A;  2ATF A;  4IUG A;  3RMX A;  3UV9 A;  3FBM A;  2RS1 2;  5HBA A;  2VNR A;  4TZD A;  5IVB A;  5EZW A;  2WZR 3;  5AFB A;  3IB3 A;  5FYI A;  1NZI A;  1PX3 A;  2ZX2 A;  4CA9 A;  5KXE A;  1AL2 1;  4Q0Q A;  1ZNP A;  1OVP A;  4HSJ A;  1GKB A;  2D7F A;  1E57 A;  3VBR B;  1ASJ 3;  1O3T A;  5K0U C;  1CN1 A;  2PLV 2;  4JKL A;  2V72 A;  1O5L A;  1HQL A;  3AC0 A;  3MIE A;  4UAP A;  3SCF A;  3AKS A;  1SLT A;  2V5Y A;  1RIN A;  4BLI A;  2LRP A;  4IE0 A;  1J84 A;  3Q8C A;  3RMY A;  5A6X A;  1LHO A;  1J59 A;  1BBT 1;  1RUH 3;  4HN0 A;  4YFW A;  4HBN A;  4O9E A;  1AR9 3;  5FFO C;  4AED B;  5KHG A;  3GJB A;  5JZG B;  3V0A A;  4IV3 A;  2YHJ A;  4IW3 A;  1DQ0 A;  4GJZ A;  4YVS A;  1H4H A;  1KDK A;  1LU1 A;  2DU1 A;  1S1A A;  1WCS A;  2W0X A;  2ZMK A;  3JBG 2;  3R4U A;  1RUE 2;  1FV2 A;  1H30 A;  3OEB A;  5F6L B;  1CX4 A;  2DUQ A;  2VNV A;  1DIW A;  1POV 0;  2E53 A;  1WMD A;  3VDA A;  3AP7 A;  3T08 A;  2FDI A;  4NWV A;  4XAE A;  3KVB A;  3RG0 A;  1G9B A;  1UY2 A;  2DCY A;  2XLG A;  1K5M B;  2WNO A;  4KNC A;  1JYC A;  1XE8 A;  4LO7 A;  1N3P A;  2A71 A;  4QQP A;  4UFJ A;  1LRH A;  3VDD C;  3O1U A;  2YPD A;  2VZV A;  4CVU A;  4XOG A;  3POB A;  4Y4Y A;  1TVG A;  2B45 X;  3IZO A;  3FBY A;  1AHS A;  1CAV A;  4ET7 A;  4XCB A;  3VV1 A;  4EWE A;  1YXW A;  1H4G A;  2JG8 C;  3CLP A;  4M3C F;  5F3G A;  4L9B A;  5FKC A;  4E2S A;  2ZMN A;  2WJS A;  5JAX A;  3FC0 A;  1LHV A;  3ZFG B;  1AR9 2;  4PBO A;  2RS1 1;  2HWD 2;  3KF3 A;  2WNU C;  5LWB A;  4N43 B;  2B5H A;  2WAB A;  5IFT A;  1W6M A;  2IXH A;  4FVV A;  4QB1 A;  5FYM A;  4UXA A;  2RR1 3;  1XJA A;  4W50 A;  1RB8 G;  1MEC 2;  4IEW A;  5JXG A;  1DYP A;  4LKD A;  4FOY A;  4MH0 E;  3WDU A;  3S0M A;  4NJ4 A;  1JS9 A;  4P9X A;  4QX0 A;  4BQ3 A;  3OF1 A;  5IAX A;  5DMY A;  2WN2 A;  2ZGK A;  1HB3 A;  3RJ2 X;  1WKY A;  2YU2 A;  4P9L A;  1T2X A;  1ND3 A;  1Y9Q A;  3AMQ A;  1L7Q A;  2DDU A;  2J1U A;  3KQ4 B;  2VQ0 A;  3MI8 A;  4LE3 A;  1N47 A;  3JD7 3;  2JB4 A;  2ETE A;  5BNP A;  3IDE A;  3LSD A;  5EYX A;  1OQ1 A;  4FPL A;  1NOV A;  4AEJ A;  1RUC 3;  1X8M A;  5A33 A;  2QDN A;  3WW3 A;  4RS5 C;  1G9F A;  4FOW A;  5HXV A;  3AZW A;  4YVW A;  4FPG A;  4AZZ A;  1XNB A;  3K51 A;  1YI7 A;  4XZP A;  4EN0 A;  3E6D A;  3ELN A;  5LZ6 A;  2WFF 3;  1NG0 A;  4AFB A;  3PUR A;  5ACA 2;  5C7G A;  4LKF A;  4UW3 A;  3V56 A;  5DG1 A;  1YO8 A;  5FZ9 A;  4LBK A;  1SBD A;  4HG6 B;  3VKN A;  1K5M C;  3LDB A;  1IS5 A;  2ZGR A;  4NHL A;  3BOD A;  2RG4 A;  1MS0 A;  1SAC A;  3H3L A;  1UIK A;  2ZOE B;  1F4A A;  4NVP A;  5IWF A;  4QD2 A;  4OZX A;  4Q26 A;  4DUV A;  2KA3 A;  3DGT A;  1HRV 1;  4I0W B;  2RE9 A;  5A7S A;  3S5Q A;  3ZFG C;  4OHX A;  2WR9 A;  5FMB A;  2DFB A;  2WNU B;  4YVS C;  4BYY A;  1CQ9 A;  2P2K A;  2XGX A;  2VBD A;  4XDQ A;  1UD1 A;  2ZEZ A;  3WDW A;  1VRB A;  3WW1 A;  1NE4 A;  3ECQ A;  5I0R A;  1PGL 2;  3UKV A;  5DDJ 2;  1ND3 C;  2ARE A;  5KBF A;  1H9P A;  3VN4 A;  1UY0 A;  1J1T A;  2BGO A;  4RGA A;  1DQ4 A;  3SKJ E;  2C9K A;  1WW4 A;  1Y7B A;  2FBE A;  4LKE A;  5LK7 B;  2VM9 A;  3F95 A;  3HMY A;  1GZC A;  3ZFF C;  4QKD A;  4Z92 B;  4MGT A;  1AYM 3;  5CA6 A;  4M3C B;  3I3Q A;  1KFU L;  1RJ8 A;  4CDX B;  2Q1F A;  1HRV 3;  2VZP A;  2VW2 A;  3H8U A;  1CAW A;  2W46 A;  2WAO A;  4I3G A;  4BQW A;  2NZ9 A;  4HON A;  4Y1Y A;  1POV 1;  3K48 A;  4CDU B;  4NHM A;  4FSJ A;  1K5M A;  1MVQ A;  5HCB A;  3CQO A;  5H9Q A;  3WD5 A;  4XFA A;  4IEO A;  4P02 B;  2F4P A;  5FYB A;  4JGY C;  2IXK A;  4HLT A;  5FYH A;  3WW2 A;  3H8O A;  3HN1 A;  3M2M A;  4NRP A;  1ENX A;  1R1A 1;  1AL0 G;  1UU5 A;  1SLL A;  4QXB A;  4Y1X A;  4A7Y A;  4H3W A;  4KQ7 A;  4CU6 A;  5ABJ B;  4YFZ A;  1DHK B;  3WEZ A;  1H9W A;  5FUI A;  4CDW B;  3CL1 A;  3WDT A;  2BU9 A;  4YG6 A;  3WCS A;  4P00 B;  4D69 A;  1H2L A;  2XKP A;  2ZKN A;  4JZR A;  3OGV A;  3SEE A;  4X8P A;  1DLC A;  1OA4 A;  1WLD A;  5GLW A;  5I8S A;  4D6Q A;  4FFF A;  1H2N A;  4IV1 B;  4NWW A;  4OMC A;  1TMF 3;  4XQ4 A;  4A4A A;  3MLJ A;  5H9S A;  5AFE A;  1HB2 A;  1NXM A;  1UKR A;  5EIY B;  2LM3 A;  3WNN A;  5FUN A;  3HR9 A;  1OPO A;  5FZ4 A;  1RUD 1;  3UNP A;  4FT8 A;  1UWW A;  2DVD A;  3SH5 A;  2DCT A;  1HB1 A;  1CAV B;  3ACG A;  4RGK A;  2VOK A;  3KV9 A;  1LHN A;  4IV1 A;  4OHV A;  4P9W A;  5JSP A;  1ND3 B;  2XML A;  5I93 A;  4WV8 A;  3NQH A;  3EYP A;  3Q8E A;  5IVV A;  1JMU B;  4HT1 T;  2W3J A;  4QAW A;  2GAL A;  1OUR A;  1FAY A;  3ZYP A;  1XSQ A;  1OA2 A;  1U5X A;  5DUU A;  4RHV 1;  2R1D A;  4BQ5 A;  4AFD A;  1RMU 1;  3MF9 A;  3FUO A;  4IEY A;  2LTN A;  5C3P A;  4YWA A;  2RDQ A;  1FXZ A;  3K4A A;  4A6O A;  5B4N A;  1TQ5 A;  4IE4 A;  2G19 A;  4EJR A;  4H55 A;  5GLZ A;  1KJR A;  1WW6 A;  4FPF A;  1W6N B;  4IL7 A;  4OVE A;  2A6Y A;  3KF5 A;  4W65 A;  3WP4 A;  3UJQ A;  3ORJ A;  5F6K A;  4O65 A;  4AHY A;  2SLI A;  2LW8 A;  1RUC 1;  4M4R A;  1F5F A;  3ROU A;  4GMP 3;  4LK7 A;  1UOG A;  4XFI A;  2CHH A;  3MLK A;  4P08 A;  5DAP A;  3OPZ A;  4XE9 A;  2CWM A;  1Y9G A;  1VR3 A;  4J6G A;  3ILF A;  3ABZ A;  1J83 A;  1S0J A;  1EUT A;  3ZOI A;  4RS5 A;  1COV 3;  3BUC A;  3VZK A;  1A3K A;  1RJ7 A;  5L7O B;  3K46 A;  1LU2 A;  1B35 A;  2BJS A;  2WZE A;  1YRZ A;  3DKW A;  1OLM A;  4FOV A;  2QNK A;  4PDW C;  4XIK A;  4NAM A;  2W2I A;  5FZ7 A;  1UOF A;  4XMA A;  1LGC A;  3VBO C;  1Y43 B;  2YBK A;  2X09 A;  1GLH A;  4UW6 A;  3VDB A;  1V6L A;  2BPA 2;  2K0G A;  2YFZ A;  4KGG A;  1QJX 2;  2BVB A;  2CU5 A;  2WSU A;  1VAV A;  3H50 A;  3ZKU A;  1LOE A;  2CGO A;  2D44 A;  2CAV A;  2MNG A;  2WWU A;  2VCA A;  3U07 A;  5FYY A;  4LBO A;  3VBH A;  3ZXD A;  5KR7 A;  4CE8 A;  1GZT A;  2GDF A;  4A7K A;  1XPW A;  1GFF 2;  1HV0 A;  3PTY A;  4LJH A;  1QKQ A;  4PIZ A;  2HWB 2;  5FAX A;  5D1I A;  2XJT A;  4GXL A;  2BWC A;  2EVX A;  2DFC A;  1IQD C;  3VKL A;  4K8F A;  1UOJ A;  1OD3 A;  2VZ1 A;  2WWS A;  1NCR C;  4JQT A;  2XHK A;  4IXL A;  4QX8 A;  2C1F A;  1EUU A;  5J96 B;  3O12 A;  3PLQ A;  2B7Y A;  4AVB A;  4YSF A;  3NW4 A;  3H1W A;  2RDS A;  2LAL A;  1VBE 1;  1DLL A;  4Q5O A;  5BYN A;  4NII A;  2NM1 A;  3LEI A;  2BQP A;  2VMG A;  2W08 A;  4ES8 A;  3MHZ A;  4XVH A;  4FO9 A;  3TWI A;  1UXX X;  4I0A A;  4CCD A;  1CAX A;  4CU9 A;  5L7O C;  4Q4V 3;  1OVS A;  1BJQ A;  1HRI 2;  1CES A;  1G86 A;  2C9A A;  3AXD A;  4I30 A;  5CIS A;  3INA A;  2GMP A;  1PZ8 A;  3U11 A;  4R52 A;  2WO2 A;  1DG6 A;  1ULG A;  4OUM A;  5GZD A;  1W8O A;  2Z42 A;  2O8O A;  4RHV 3;  1BKZ A;  1W8U A;  3IIA A;  2VNG A;  4JHZ A;  4LEJ A;  5FP4 A;  4QQH A;  3SH3 A;  4ISQ A;  2FDJ A;  2D40 A;  3WNO A;  5FO9 B;  1GWK A;  2ZEW A;  1QGL A;  1WMF A;  4JRL A;  4YGE A;  4CPB A;  2ZZJ A;  4IGO A;  5JDB A;  1ZA7 A;  4XPV A;  1ENR A;  1RUD 3;  4OZO A;  2KR2 A;  4EN7 B;  1NY7 2;  3LWC A;  3ZXK A;  3I2K A;  3J8F 2;  5C9A B;  5JMC A;  3VBR C;  2R07 3;  1XC6 A;  4N53 B;  1ZBA 2;  3USU B;  3CF6 E;  2V09 A;  4XUP A;  1IPK A;  1KGY A;  2WNE A;  4IE7 A;  3ZKY A;  1PGW 2;  1QJU 3;  2VAU A;  3NAP B;  5GLT A;  5DQ0 A;  4R4Z A;  1RHI 2;  1O3S A;  2HWD 3;  2VXJ A;  2ZHM A;  5FZG A;  4XDP A;  4FPK A;  3ZSM A;  1OQD A;  1VBD 3;  3O1V A;  4N53 A;  1BXH A;  5AVP A;  1DQ1 A;  3HNY M;  5HCH A;  3OGG A;  1DQ6 A;  2R1B A;  4DS0 A;  4KH9 A;  2FZ2 A;  4H2A A;  1UQX A;  4E2G A;  3X29 B;  2RS1 3;  1D7P M;  1K45 A;  1BMV 2;  5HV4 A;  4CDU A;  4GWM A;  4C90 A;  5L9V A;  1Y3T A;  3WCR A;  4Q4Y 2;  4XJ8 A;  4AED A;  2YUE A;  4RFR B;  2BGC A;  2K9Z A;  4B1L A;  1QQP 2;  1ZA4 A;  2GH8 A;  5FZO B;  3ZIW A;  1GQH A;  4FTS A;  1W8W A;  3LFM A;  3QH6 A;  2HWD 1;  5A1L A;  1MS1 A;  2P5B A;  4Z07 A;  3KT7 A;  3IMM A;  3R4D B;  1FOD 3;  2YFU A;  3GJA A;  4FPO B;  5A7N A;  3SH4 A;  4TYS A;  5L9B A;  2XVG A;  4Q4W 2;  4DEV A;  5EXO A;  3C2U A;  1C57 A;  1QOO A;  2QQP A;  2VZ3 A;  1VAM A;  2QQI A;  3AZV A;  1AJK A;  4D94 A;  3BPS A;  4UI9 L;  2WS9 2;  3CJI A;  2DWR A;  4K6B A;  1ZBE 2;  3HT2 A;  2DUO A;  1YI9 A;  2JDY A;  5AVA A;  2C24 A;  2P3Y A;  4N43 C;  2DVB A;  2WNV B;  2YC0 A;  3B01 A;  3GZE A;  1W06 A;  1VRH 1;  1LJ7 A;  3NNJ A;  4HKO A;  4AGR A;  5JSO A;  1Z0H A;  1V00 A;  2ZX3 A;  3FE5 A;  1DGR N;  4CCK A;  1J3Q A;  4CUG A;  4FFG A;  3TAY A;  3I2O A;  3DF0 A;  4LIT A;  3VBH B;  1NT0 A;  1OLM E;  3WDY A;  4N9I A;  2VVF A;  3PUI A;  3O1S A;  4OHW A;  3S30 A;  4HVQ A;  3P1I A;  4XF9 A;  4D8M A;  2I2S A;  2NYY A;  1REF A;  4KU8 A;  1JZ3 A;  3GCW A;  3PIG A;  4XXA A;  2JDP A;  1MS5 A;  2P37 A;  3J7M A;  4Y26 A;  3UKT A;  1YNA A;  4AOC A;  5C4W B;  5LA1 A;  1DFQ A;  5FPB A;  5LRR A;  1LGB A;  1LNS A;  3ATG A;  4DY3 A;  1UY4 A;  1RVF 3;  1SBE A;  4Z2W A;  5FLJ A;  4E4D X;  2V4V A;  4YG0 A;  1FMD 2;  3UKN A;  2EXI A;  2ZA9 A;  4JRA A;  1PGL 1;  3ZFE A;  5JLV A;  2V5D A;  4QHB A;  2OZ6 A;  1YQ6 A;  3WP6 A;  1OH4 A;  5BNO A;  3B69 A;  4XUO A;  1OLR A;  1QEX A;  5FP9 A;  5GLV A;  2ZGS A;  1GZ9 A;  5FZ0 A;  4Z82 A;  1QJU 1;  3VL8 A;  5I0S A;  4W4Z A;  4CZS A;  5KC6 A;  5F2S A;  4BQX A;  4I01 A;  1ZRD A;  3PUA A;  5F1R A;  1S2E A;  1QXP A;  2YYO A;  4Y5S A;  3Q8B A;  4FFI A;  1SFY A;  1GSL A;  1PK6 A;  3S6P A;  1H0B A;  3VHO A;  5CG9 A;  3C7O A;  5D2A A;  4A45 A;  4XIO A;  5J09 A;  1URX A;  3LA2 A;  1SLA A;  2HLE A;  2GH2 A;  3D0S A;  3FN9 A;  2W92 A;  2WAA A;  4FPE A;  4DY5 A;  3NV1 A;  2DUP A;  5HI0 A;  2Z5W A;  5JXI A;  3PUQ A;  1JOD A;  2ZEY A;  1COV 2;  2HEW F;  4A6S A;  5JOX A;  2RS5 3;  2EXH A;  4QGL A;  4XTM A;  1HRI 1;  1UZW A;  1O5U A;  1C4R A;  2UY9 A;  2VOX A;  2ZGN A;  5T55 A;  1IS4 A;  3VBU B;  2VG9 A;  5JVV A;  5FMO S;  1CJP A;  3NO8 A;  4PLN A;  1L3J A;  5FZ1 A;  1XYN A;  5I8Y A;  3N36 A;  2YGM A;  1G9D A;  1R08 3;  4M01 A;  2EAL A;  3CO2 A;  3LDR A;  2BRT A;  1SPP B;  1K42 A;  4CEW A;  2AR6 A;  1VAL A;  3SLI A;  4AWD A;  3TRS B;  1N1Y A;  1PVC 3;  3AJZ A;  4QPW A;  5EJZ B;  2VUJ A;  3RSJ A;  3BIE A;  4GD4 A;  4P5H A;  4IDZ A;  3NJZ A;  3FLT A;  4C8D A;  1OKQ A;  3HBK A;  5DUX A;  4HK8 A;  1JUH A;  3WOG A;  3FFQ A;  1MS8 A;  1F5J A;  1WCU A;  2HWC 2;  1UU4 A;  2QZ2 A;  3WNK A;  1Y9M A;  2ZKL A;  3WNM A;  3ZPY A;  1KS5 A;  5EYY A;  3NL1 A;  3VDD B;  1I5Z A;  4UFL A;  1MEC 1;  3BB6 A;  4XQD A;  2GNB A;  3DPR B;  2WDB A;  2R06 3;  3GZA A;  3NWK A;  1KXG A;  1ZBE 1;  2PHD A;  4PQ9 A;  3PVE A;  3V64 A;  1WBF A;  3OBA A;  1S0B A;  1KFX L;  1FX5 A;  4DZG A;  2VMI A;  1MS3 A;  4QXH A;  4FQ4 A;  2RJK A;  3MFC A;  3LOI A;  3M3O A;  2DYC A;  4KGQ A;  3K4D A;  5ANN A;  2ENR A;  2JIJ A;  2VZU A;  5FR3 A;  2A6V A;  1JYI A;  3HWJ A;  3HD8 B;  1X9T A;  4GWJ A;  2XJS A;  4HOO A;  4WVM A;  5C9A A;  1AYN 3;  2ZX4 A;  4LBL A;  1W6Q B;  2Y8K A;  3I49 A;  4G4F A;  5HCA A;  4AED C;  4SBV A;  2CSG A;  5CKQ A;  2A3Y A;  3I3B A;  3O14 A;  2CY6 A;  3J8F 1;  2FDG A;  3ZMO A;  1QHD A;  3J7L A;  4QHO A;  1ZBA 3;  2Y6G A;  2G9G A;  1DCS A;  3SKV A;  5J7M A;  1NCR B;  4UT5 A;  1YQ8 A;  1W6M B;  1ULC A;  5FPZ A;  4YAR A;  1CX1 A;  3MIF A;  4YM2 A;  2ORX A;  2C6S A;  2XBO 1;  3W58 A;  2VE1 A;  1S0C A;  2J7M A;  2EID A;  2DV9 A;  3NJY A;  4CEY C;  1UMI A;  1V6I A;  3T2P A;  1YUD A;  4LIV A;  4TLF A;  1UCX A;  3HT1 A;  2YMZ A;  3T4H B;  1W28 A;  2JEN A;  3POF A;  4QKF A;  1YCI A;  4C0B A;  5IW0 A;  1BK1 A;  2XL9 A;  4QU2 A;  4RHV 2;  5F5I A;  4MET A;  3MW4 A;  3PUS A;  5FZO A;  4GJY A;  5CG8 A;  5L7O A;  4NO4 A;  4TSV A;  1V6N A;  1FYU A;  3PNA A;  3QCW A;  2MPF A;  4GKY A;  4N43 A;  5DAW A;  1S0G A;  4JHT A;  3T2O A;  2KD7 A;  1DZT A;  3VKF C;  4CDW C;  3VD9 A;  1D4V B;  3IDA A;  3DPR C;  2GN7 A;  2XG3 A;  5CFC B;  4PDW B;  2JB8 A;  3O1M A;  2JDM A;  2FD8 A;  3DV8 A;  4O9G A;  1D0H A;  1RUC 2;  4K21 A;  4YZ1 A;  5FXX A;  1CAU A;  1UO9 A;  2QVS B;  2RV9 A;  4IEQ A;  5C8C A;  3OSD A;  1UPS A;  2WN3 A;  4L8Q A;  1OT5 A;  2ZXQ A;  5BNP B;  4IE5 A;  5FDB A;  1YIF A;  3B7M A;  1G8W A;  2X5I A;  4QQL A;  5FY9 A;  1LAJ A;  1IKP A;  2L9L A;  5BV6 A;  2YY1 A;  2X10 A;  4LBM A;  4BM8 A;  4MXW A;  3C7E A;  5D8A A;  4I09 A;  4ERO A;  4AGG A;  4HKL A;  5J36 A;  1JZ8 A;  3ZFF B;  3ZFF A;  4C1W A;  2ET1 A;  2VMF A;  4XHX A;  5LA9 A;  5M0T A;  2OUH A;  1G6N A;  5BNQ A;  2E63 A;  1DF0 A;  2J1V A;  2ZGL A;  2XH6 A;  4QB2 A;  1CIY A;  2JEC A;  5F5A A;  3RZJ A;  2VY0 A;  4BQY A;  5K9Y A;  4CCJ A;  3WSO A;  4CDX A;  2AEY A;  2BWA A;  4LO5 B;  5FIX A;  4D6S A;  3OTF A;  2FQP A;  1EY2 A;  2VXR A;  4XJU A;  1A8D A;  2B9V A;  5CBL A;  1ZRF A;  2E7Q A;  1ZM1 A;  1YFW A;  5CIR A;  5IAV A;  2PHW A;  4QM9 A;  2W95 A;  2AEZ A;  2QE3 A;  2VBP A;  3N7K A;  1BQP A;  1JYN A;  1W0O A;  1W0P A;  1A34 A;  1P8J A;  4RD7 A;  2FDK A;  4DXS A;  4AEK A;  1MEC 3;  2GNT A;  1EV1 1;  2RJL A;  4ZKT B;  2R06 1;  3L2Y A;  1Q8P A;  1MVE A;  2VO5 A;  1VBC 3;  2DVF A;  3FX3 A;  1UMH A;  3PIJ A;  4IE6 A;  4N9H A;  4WVM B;  4F83 A;  5T5J A;  4F7Z A;  4ARY A;  1IZ3 A;  2Y6H A;  3BTA A;  4Q29 A;  1CR7 A;  3N9N A;  4ZPI A;  3GBW A;  3AKT A;  2AUY A;  2QDR A;  3VD3 A;  2O14 A;  5IHR A;  2ZAH A;  1H2M A;  3ES4 A;  3WQ7 A;  3I4I A;  4NMI A;  1BEV 3;  2AYH A;  2JDH A;  2VW1 A;  3UYJ A;  1WW7 A;  1JN2 P;  1YFX A;  2ES3 A;  3NNF A;  1JUI A;  4ZHN A;  4KI5 M;  5DUV A;  5FCC A;  2QQJ A;  3MFA A;  1C8M 1;  1HB4 A;  3D82 A;  5EV7 A;  3RYR A;  1VBA 1;  4D7S A;  2IFW A;  4CCC A;  1W8F A;  1QJX 3;  1R09 1;  3ZFG A;  4BME A;  4AI8 A;  5DDJ 1;  4CEY B;  4LNV A;  1B09 A;  3NNL A;  1AYM 1;  5KC5 A;  3OG2 A;  3AKQ A;  4R4X A;  1C8N A;  3M3E A;  4UW4 A;  3T0A A;  5BY5 A;  2XJQ A;  1UIJ A;  2R32 A;  2UWC A;  5FXW A;  3V0B B;  1I6X A;  1NY7 1;  4JCK A;  1Z7S 2;  2RM2 2;  4K9S A;  5LBE A;  3BGA A;  3HAG A;  4GZ9 A;  5A33 B;  1HXS 2;  2VBB A;  3T1L A;  1WME A;  3POY A;  5C8C C;  1S2K A;  2ZML A;  1TG7 A;  5A6Q A;  4NIG A;  3ZYF A;  4R9A A;  1CZT A;  1UYX A;  3ILN A;  3URF A;  3KV6 A;  1EP0 A;  4IV1 C;  4ASM B;  2Z79 A;  1QXR A;  2HWC 3;  3HNB M;  1VRH 2;  1MZ5 A;  4IND A;  1LKN A;  5EHD A;  1KIT A;  1HLC A;  1JZ7 A;  1Q8O A;  1I5P A;  1AR7 2;  3WNP A;  1WA4 A;  3ZXG A;  1ZRC A;  4ISR A;  5FMO L;  4BU2 A;  4UFK A;  2AEN A;  1DBN A;  2JX9 A;  2UY8 A;  5JIU A;  2A5Z A;  5FJK A;  3ZXJ A;  4YVW B;  4GIQ A;  5JWP A;  2P3J A;  1PMI A;  2W47 A;  3JQX A;  1HJF A;  2YB7 A;  1JOB A;  3RZZ A;  1IOA A;  1GQP A;  1YC6 1;  2RVA A;  1K5J A;  3WVJ A;  4DRV A;  3DYM A;  3MDP A;  3K75 B;  3WHT A;  3C7F A;  1UNB A;  2JDU A;  4IEZ A;  1ODM A;  2A3X A;  1G9A A;  1QWR A;  1W90 A;  2H0V A;  4C1X A;  3ZDS A;  4GQ7 A;  4ZU5 A;  3AKR A;  5C8W A;  2ZGU A;  1WCD J;  2W87 A;  4QX5 A;  5T50 A;  3ZYI B;  4AR2 A;  1CZV A;  5JR7 B;  2Y0O A;  5FMD A;  3M3I A;  3N7J A;  1D2Q A;  1RMU 3;  3GDB A;  4OLL A;  4XTP A;  4XFH A;  2BUK A;  3AMP A;  3VBH C;  4CCN A;  5A6Z A;  4WM8 C;  4C91 A;  3KSC A;  2DCZ A;  2PMW B;  4WZF A;  4KBZ A;  2GC3 A;  1LHW A;  3S7E A;  3WX5 A;  4CTE A;  2CGP A;  1LOD A;  5FYC A;  4GMP 1;  2BBV A;  4LTA A;  5J37 A;  3UL2 A;  4NHY A;  4PJY A;  2CWS A;  1S4C A;  1WZX A;  4YW2 A;  4AE2 A;  4MGY E;  3WNL A;  1EAH 1;  1S0I A;  4PDW A;  4KWK A;  3NKT A;  5I0T A;  2QZ3 A;  2EIG A;  3ZLI A;  3AP5 A;  2YBP A;  1V0A A;  2D97 A;  3OD4 A;  4FPJ A;  3M4F A;  4YZ5 A;  2VTF A;  5JUV A;  3F2Z A;  4Y20 B;  1AYN 2;  2V73 A;  1M06 G;  3H3U A;  3KD4 A;  4P14 A;  4DNY A;  1IG3 A;  3POG A;  3ZXE A;  3BCW A;  4Q0P A;  4CP9 B;  2ZAC A;  5FZB A;  4GB3 1;  2X5I C;  3P6B A;  3U37 A;  3ZMN A;  4LBQ A;  1PVC 1;  3O1R A;  4MX3 A;  5IK7 A;  2VCM A;  4Y20 A;  4CP0 A;  4Q4W 1;  4JKK A;  2J22 A;  1O6U A;  1V9U 3;  4NPL A;  3ZN4 A;  4GH4 C;  5I0D A;  5LCW L;  2VUC A;  4UBH A;  4Z8B A;  3H8R A;  2JKB A;  3OUJ A;  1RVF 1;  3VBF C;  1RIT A;  5JCT A;  2DTW A;  4LHL A;  3D8C A;  3PVN A;  3MLL A;  2WA3 A;  4MGI E;  2PTM A;  1QQP 1;  3ST7 A;  3FMG A;  4ZU7 A;  2GP3 A;  2ZGM A;  3IT8 A;  4K1Y A;  4XJA A;  3J8F 3;  2WO3 A;  5FZH A;  4DMI A;  5LBF A;  1PMJ X;  3N9M A;  4EZ4 A;  4J1X A;  3O7O A;  1DQ5 A;  2XL7 A;  3CDZ B;  3EB7 A;  1VBE 3;  5A3N A;  5JR2 A;  2A6X A;  2W68 A;  3PJY A;  3T0B A;  1WGP A;  1X9P A;  3IDB B;  1XB9 A;  3ENR A;  4XQW A;  4XUN A;  5FZL A;  4N90 A;  1BHG A;  5JOY A;  2BDR A;  4PF1 A;  2P3I A;  3HQU A;  2OZJ A;  3WG3 A;  5FZC A;  3VKO A;  4FTB A;  1O4T A;  4U2A A;  1LOA A;  5CB7 A;  2QQU A;  5F8P A;  1HN0 A;  4LBJ A;  1BVV A;  3HN3 A;  5T5P A;  4MO3 M;  3KHB A;  1CPN A;  1ULO A;  1V70 A;  1ZBA 1;  2WQZ C;  3CZU A;  4P5Y A;  3SCH A;  1K12 A;  2RS3 1;  1W39 A;  3W5M A;  3FHA A;  2VTX A;  4MXV A;  2E51 A;  4Q8K A;  2P1B A;  2OUJ A;  1UYY A;  1T6B X;  4P9G A;  1HDK A;  1M4W A;  2G9Z A;  3IDC B;  2ZCW A;  3RDI A;  4MUV A;  3ACF A;  1ZYB A;  1X8E A;  3ZSL A;  1ENQ A;  4D0Q A;  4A2U A;  1OOP A;  1OOP B;  2VZT A;  5JPN B;  1RXF A;  5LRS A;  3TN9 3;  1Z7S 1;  1A78 A;  2RM2 1;  4Y4R A;  3VZO A;  2J1R A;  4OFG A;  4DEQ A;  1AR8 2;  1XNA A;  5GM0 A;  5JOW A;  3QBQ A;  4LK6 A;  5FBZ A;  1JZ4 A;  1X7N A;  3E97 A;  1U5I A;  1S0E A;  2NQY A;  4Y5Z 0;  4BPZ A;  5DZG A;  2CAU A;  5HXM A;  2QFE A;  2SBA A;  3BTZ A;  1VBD 1;  1XRU A;  2IXL A;  2IUW A;  2VMD A;  3HBZ A;  4XZU G;  4MGQ A;  2GN3 A;  3BAL A;  2QKD A;  1Z7S 3;  1TME 3;  2RM2 3;  4K40 A;  4LUM A;  1DYK A;  4W8J A;  3U1X A;  4CDQ B;  3KS7 A;  1RUF 1;  1VB4 A;  2HYK A;  1OLQ A;  2JDA A;  3KV4 A;  3N9Q A;  4YYO A;  3SMH A;  2EAK A;  1YWK A;  3KT1 A;  2E7T A;  4S2F A;  5FP7 A;  4YW4 A;  3GBF A;  4AW7 A;  3BTY A;  1YIP A;  5FPV A;  4QPG B;  1ND2 B;  3DYO A;  3ZSE A;  3DUI A;  4ZS2 A;  2W1Q A;  2F4L A;  5FYU A;  3VHP A;  5DPN A;  2OA2 A;  3H3Z A;  1VIW B;  1XOY A;  2RDR A;  1OOP C;  3THD A;  4JGY B;  3VZM A;  5C70 A;  4C0H A;  5AC9 3;  4EV0 A;  1KDM A;  1BEV 2;  2R0F A;  2ZX1 A;  2DU0 A;  4NID A;  4MGK E;  1U0A A;  3FHQ A;  2TNF A;  1WD3 A;  3WR0 A;  3Q8A A;  3A21 A;  4AHW A;  1OUX A;  3PU8 A;  2XVK A;  1J3P A;  4BA6 A;  1JH5 A;  5BNP C;  2HWB 3;  4FOQ A;  4OHZ A;  3B94 A;  4XEZ A;  4Q0V A;  1IS3 A;  3IMN A;  1JU3 A;  1VRH 3;  2QQN A;  3AZY A;  3EHK A;  3AP9 A;  3IPV A;  4IEU A;  3T2T A;  4AI0 A;  4XF3 A;  4Y33 A;  3JZV A;  2Z4F A;  3KVA A;  5FO7 B;  3D4K A;  3ZVX A;  1H1I A;  1RTV A;  1C28 A;  1XU1 A;  5FRE A;  1HXS 3;  1UPI A;  2JJ6 A;  2JG8 A;  4QQO A;  4YGC A;  4QGM A;  5H9P A;  1G7Y A;  1WLC A;  3PTR B;  2YPJ A;  1S2B A;  2A1X A;  2PHX A;  2PA7 A;  3ZN6 A;  3ZSK A;  1POV 3;  2VW0 A;  5I0U A;  1HJG A;  2R06 2;  5EJ3 A;  5CKN A;  1GP6 A;  1CIW A;  2WT1 A;  3H0O A;  3R0R A;  1QH7 A;  4GB3 2;  4R9C A;  5C4W C;  1XQN A;  2W94 A;  3MPB A;  5IJR A;  2HWF 3;  3W9A A;  4NN0 A;  3PU3 A;  1UX7 A;  1LEM A;  5K0U A;  2RS3 2;  5A7Q A;  3ZDV A;  1VBB 1;  4YVW C;  3T09 A;  1BLZ A;  2Q30 A;  5GAL A;  1AJO A;  5J48 A;  5DXD A;  3WG4 A;  4FPH A;  3ZR5 A;  3EBR A;  5FPX A;  5CVR A;  2RS3 3;  3MW3 A;  1EAH 2;  1C8M 2;  2W5F A;  1HQN A;  2D3S A;  2PQS A;  2YBS A;  3H7J A;  3OGS A;  3WLU A;  1R08 2;  2EA7 A;  4AVC A;  5FY7 A;  2D6K A;  2F6B A;  1Q3E A;  5T52 A;  1OD5 A;  3VBU A;  1ZZ7 A;  3PVO A;  4F8A A;  2BZD A;  3M70 A;  4HN1 A;  5BNO C;  2ADE A;  5JMO A;  5A7O A;  1RUJ 1;  3JB4 C;  3LKJ A;  2BFU S;  3ZPO A;  4AHZ A;  3BOP A;  5IK4 A;  2Y38 A;  1F2N A;  2XOM A;  4D7T A;  2QCS B;  3WQB A;  3JUU A;  2QUO A;  2RMU 2;  2VPV A;  3H9A A;  5IUQ A;  5BNN C;  2VMC A;  4AG4 A;  3VUO A;  4CEW C;  1VP6 A;  4CP1 A;  4RQP C;  3O1P A;  2RS5 1;  2VZS A;  1IPS A;  5FY1 A;  3OBT A;  2ILM A;  3V0A B;  1QY4 A;  1LES A;  1AX0 A;  1UYP A;  1W2U A;  1VBE 2;  3OYW B;  1SQ4 A;  4YRD A;  2E9Q A;  4Y1Z A;  3BKZ A;  3KM5 A;  5C4W A;  3I2G A;  4B8E A;  5KHI A;  4NE9 A;  4XUQ A;  2WYF A;  5CFD B;  2XPJ A;  2FHR A;  2ZHN A;  2ZAA A;  4MGZ E;  1H6X A;  4XUT A;  3UJO A;  4AQS A;  4B4Q A;  5IVF A;  1W6O A;  3S7I A;  1RUI 2;  5FV3 A;  3WF1 A;  3OEA A;  1IG0 A;  2J1A A;  4V1P A;  1HW5 A;  1RUG 1;  5FYS A;  1R09 2;  1KJL A;  1S55 A;  2Y6J A;  3DN7 A;  4PIX A;  3TB0 A;  1AR8 3;  3U78 A;  4H7M A;  4RR3 B;  1AF9 A;  2B42 B;  4XBQ A;  2WT0 A;  3UET A;  1DGL A;  3AXE A;  1RVF 2;  4X6Q B;  2W1U A;  5A7P A;  2A6W A;  4UF0 B;  4G9S B;  4LOS A;  2IWG B;  3FWE A;  4AQ2 A;  1HXS 1;  3EO6 A;  2D3R A;  3IM0 A;  4AI3 A;  3HIF A;  4LBQ D;  2VME A;  2C5D A;  2QQL A;  1IGO A;  2WFF 1;  4RSU A;  2XJU A;  3CEW A;  5DZF A;  3K4Z A;  5T3N A;  4B29 A;  3LPG A;  3WF2 A;  1SLC A;  3N9L A;  1TZO A;  1V6K A;  1GUI A;  1NA1 A;  2HWB 1;  4IER A;  3MF6 A;  3B02 A;  5CYY A;  2Q5T A;  1PGW 1;  1QNW A;  5FYZ A;  1NX9 A;  3RWK X;  2JWP A;  4LQR A;  4QT6 A;  4JC1 A;  2D6L X;  3AKP A;  1Q8Q A;  4W6W A;  4W6X A;  3NAP C;  4CDU C;  2B9U A;  1C1L A;  3C7H A;  1VBB 2;  3I2I A;  4QX2 A;  4NRQ A;  1G9C A;  3LA3 A;  1GIC A;  5C33 A;  3LE0 A;  4OI0 A;  3KMH A;  2WA4 A;  3TYJ A;  4OQ9 A;  1OUS A;  4LBN A;  2ARA A;  1W9S A;  1OA3 A;  2JD4 A;  2JG9 B;  1E5R A;  4J25 A;  1CAU B;  4NIA A;  5C71 A;  2VVE A;  3WUD A;  3HNM A;  2PLV 3;  2WSV A;  5SV8 A;  4XBL A;  2DBN A;  2Y60 A;  1RUG 2;  5KHH A;  5LEK A;  3IBM A;  3POI A;  1QDO A;  4YZ2 A;  1RUI 1;  1D2S A;  1NCQ C;  5C6C A;  5CAD A;  1NYW A;  1ZZ9 A;  1ODN A;  3AYD A;  3KCX A;  3LA7 A;  4XAB A;  2Y6F A;  4E8C A;  5CFC C;  4M0N A;  5ABJ A;  2VU9 A;  1NQD A;  4Y3O A;  2BW8 A;  1US3 A;  2B4K A;  2QJV A;  1F35 A;  1EPW A;  4UOJ A;  3QLQ A;  4LHS A;  2D6O X;  2ZPX A;  1W3V A;  3I2H A;  1H6Y A;  4KL1 A;  2VTX J;  5L9R A;  1LTE A;  2R07 1;  2XB6 C;  1QJY 3;  4MLO A;  4OUL A;  1AR7 3;  3K3O A;  3I54 A;  1GOF A;  5A3P A;  5BPX A;  1TNR A;  2JEM A;  3ON7 A;  2FZ1 A;  1B35 C;  1RED A;  4LUK A;  1AXK A;  2A73 B;  2RR1 2;  5A1F A;  1VMF A;  3FLP A;  1SHW B;  1AX1 A;  1R1A 2;  4JGZ B;  4EZH A;  2E33 A;  3T3Y A;  2DVA A;  4WM7 A;  1BMV 1;  1X82 A;  3ZFE B;  1RL3 A;  4AI1 A;  5LW9 A;  1QU0 A;  1VMH A;  2DTY A;  1XYO A;  1O59 A;  4E4Z A;  5LY2 A;  1H8T B;  4LHN A;  3A22 A;  5K0U B;  3I2J A;  1D4M 3;  4BIF A;  4MG2 A;  2Q8D A;  3NJX A;  3FZ3 A;  1WW5 A;  1QOS A;  4QPG C;  3TN9 1;  3AK0 A;  3ES1 A;  1SMV A;  2WWJ A;  2BOJ A;  1SLB A;  4BIS A;  4XFF A;  1YQ5 A;  4CEY A;  3GZU C;  2ZEX A;  3JD7 2;  5FMC A;  3D6E A;  3LOB A;  4CCO A;  4I3P A;  5FQ0 B;  2UWA A;  3M3Q A;  1AVB A;  1F15 A;  2QQM A;  1HRI 3;  3T1M A;  4NRM A;  3NNG A;  3KB5 A;  5CKM A;  1QF3 A;  3BYW A;  3LEK A;  2TEP A;  3TEY A;  1RUE 3;  2W91 A;  2QTW B;  2TBV A;  2VL4 A;  1JHN A;  1N1V A;  1PO1 2;  2BV4 A;  4UFM A;  4YZ4 A;  3U4S A;  4BQ2 A;  5JI9 A;  1AX2 A;  4M3C E;  1LOF A;  3I8T A;  3KWV A;  4LPL A;  4AL9 A;  4NIH A;  1BBT 3;  2YV8 A;  3ACL A;  1BBT 2;  4OI4 A;  1B35 B;  3VBO B;  3SCG A;  5E88 A;  1GP4 A;  3A23 A;  4NAO A;  3N7L A;  4QU1 A;  3KQR A;  3SQO A;  1GQG A;  1RUO A;  3JB8 A;  4YNI A;  4CXW A;  2N7G A;  2A70 A;  4EWA A;  1JZ2 A;  1RMU 2;  1DZR A;  1ASJ 1;  1FOD 2;  4Y1V A;  3E1F 1;  3NJV A;  4UBG A;  4XIL A;  5D8A B;  4GWI A;  5FLH A;  4Q4X 1;  3QD6 A;  3LCP A;  2VUL A;  4JGZ C;  1GAN A;  5AC9 1;  1W99 A;  2HEY F;  1SFN A;  3VBU C;  1SCR A;  4XAA A;  3I2F A;  1QNY A;  2PEL A;  2XUM A;  3RNS A;  3T0D A;  1O91 A;  1AZD A;  1LCL A;  1WLT A;  3IWZ A;  4A44 A;  3DKQ A;  3OOX A;  3R4S A;  4Q1P A;  3PVB B;  5IT6 A;  2QQK A;  1KD7 A;  1X50 A;  5I8T A;  2ZGP A;  4NRO A;  2ET7 A;  3OYW A;  4Q2F A;  4PT6 A;  4Q4X 3;  1JTZ X;  4COW A;  4MOA A;  2HWF 1;  3APB A;  3O0W A;  4HPK A;  1FNZ A;  1AXY A;  2PYT A;  2YGL A;  2Y33 A;  4QPY A;  3J7H A;  4MHU A;  3ZXA C;  3CZJ A;  1RUI 3;  4ZON A;  4XXP A;  2WQ8 A;  1NCQ A;  2ZTN A;  2BNN A;  1XSR A;  3FLR A;  5ACA 1;  1W6P A;  1POQ A;  1US2 A;  2G9F A;  2P6H A;  1JYW A;  2YRO A;  2VOV A;  5FPL A;  4QDR A;  4AVT A;  1V9U 2;  5F5Q A;  5FZ8 A;  2K46 A;  3WT3 A;  1NLS A;  1JW6 A;  1HN1 A;  2NPI A;  2WZR 2;  3AFK A;  4YM3 A;  4CCM A;  2WII B;  2OII A;  4NUB A;  1J3R A;  4HMZ A;  4JGZ A;  4X8N A;  2P3K A;  4AK3 A;  4BIO A;  4Q8L A;  2NN8 A;  3JXS A;  4WBB A;  1RGS A;  2Y64 A;  2BGP A;  3WIN E;  3RZM A;  1DDL A;  1MZF A;  2Y6K A;  2JIG A;  1XYP A;  4QHZ A;  1NUK A;  2XDV A;  5FWJ A;  1HKD A;  2CGN A;  4XUR A;  2Y6L A;  4JKM A;  2Q0A A;  1NKG A;  2OYZ A;  5LBB A;  4ARX A;  3RS6 A;  1V6J A;  1N3O A;  1E5I A;  2C0Z A;  3THC A;  3VBS B;  4G3Y C;  4BJ0 A;  2BEO A;  4UYB A;  4WVV A;  3ZFE C;  3A0N A;  4NOT A;  1JZ6 A;  4TXW A;  3AL5 A;  4NHX A;  5CFC A;  3ZR6 A;  3MGU A;  3B3Q E;  3TBD A;  5ABJ C;  3WQ1 A;  5EWS A;  1DP0 A;  2HWE 3;  4L99 A;  5APA A;  1JYT A;  1MR5 A;  4CDX C;  2CV6 A;  3JCI A;  4BK4 A;  4B4P A;  5IYY A;  4HK9 A;  4JTO A;  1AYN 1;  2D98 A;  4V2W A;  1W3X A;  2A3W A;  3CJI C;  3FHI B;  3J26 N;  3OJB A;  4XDO A;  1RUD 2;  4RR3 A;  1HV1 A;  2XLA A;  3FJS A;  4R8H A;  5FZK A;  4ZXE A;  5JOZ A;  1BK0 A;  3P3N A;  3I59 A;  4OCT A;  2R7E B;  2PAK A;  2WNU A;  4XF4 A;  3AMM A;  4PBP A;  3D3A A;  1W8T A;  4LHK A;  4AI9 A;  1D4M 2;  1O4Z A;  1SPP A;  2GSY A;  2HBU A;  2WZR 1;  3OD0 A;  5K4L A;  2H6B A;  1DGW A;  1VJ2 A;  4QPI A;  3UGF A;  5KXB A;  3VBS C;  2HKX A;  4X6R B;  2AZ5 A;  4Y1U A;  3LF7 A;  1QDC A;  1XNT A;  5IAT A;  2FCT A;  4FPC A;  3A4U A;  3VBR A;  3DEM A;  3VDD A;  2XON A;  1SBF A;  4KMQ A;  3ZX7 A;  1R1A 3;  2E6V A;  4B1M A;  3U0Z A;  2JE9 A;  1DGW X;  2D6P A;  2CDO A;  1W6Q A;  3N7M A;  1PVC 2;  5C3R A;  2D93 A;  2ZZQ A;  3LEM A;  4WVZ A;  5FQ0 A;  1UZY A;  5A3O A;  3O5S A;  3KZ4 C;  2IXI A;  4LKS A;  1ALY A;  3T2Q A;  3NV3 A;  4XFG A;  4AXO A;  4QXC A;  5E1R A;  5FK8 A;  5HPO A;  2H6C A;  5T5O A;  1LEC A;  1PX4 A;  1VBA 2;  5GJ6 A;  5H9R A;  2GC0 A;  5KWR A;  4LA3 A;  3K77 A;  1JZ5 A;  4NR1 A;  2RS5 2;  5A80 A;  1SDW A;  4K8R B;  5IFP A;  2VJX A;  1I9R A;  1AYM 2;  1JI6 A;  4YW5 A;  2W9X A;  3FL7 A;  4CUA A;  2B46 X;  3VD5 A;  3L2H A;  2Q8O A;  3SIT A;  3ZO0 B;  3MBW A;  1MAC A;  1N3Q A;  3AFG A;  1GBG A;  1RUF 2;  3H8X A;  1FT9 A;  4FTE A;  2GU9 A;  1DU3 D;  4GH4 A;  1LR5 A;  5A6Y A;  4BMB A;  4Z2A A;  4CDQ A;  5F39 A;  2GAU A;  3ETQ A;  2A6Z A;  1DGR A;  4JX0 A;  5J3U A;  1XU2 A;  4QB6 A;  1XNK A;  5DAX A;  3SNM A;  5IVJ A;  2ID4 A;  3MPP G;  1LOC A;  4A7Z A;  2IXC A;  3VHR A;  1ZRR A;  3CBN A;  3OCP A;  1UZ0 A;  1UX6 A;  4IQP A;  2OQ7 A;  1UOB A;  1VMJ A;  1TE1 B;  3POJ A;  1ZVF A;  3E5Q A;  5FYT A;  4KG8 A;  3LEG A;  4P9J A;  4LT5 A;  2WFF 2;  3C8X A;  3IPV B;  4OMD A;  2W52 A;  4Y22 A;  2VQA A;  2WYS A;  1IHM A;  1W9W A;  4GAZ A;  1XXN A;  2JDZ A;  3LFI A;  1RUF 3;  2PHF A;  5C5T A;  2R6Q A;  1UMZ A;  2VVD A;  3ZXL A;  3ILR A;  5IVE A;  1HRV 2;  1QOT A;  3PL0 A;  1SCS A;  5J1X A;  3DXU A;  2W1W A;  2Z2S B;  3AP4 A;  2H0B A;  4OUE A;  5FXZ A;  1A6C A;  2KM2 A;  3I59 B;  4LUL A;  3OY8 B;  3OY8 A;  3UT0 A;  3AMH A;  4K7J A;  5B2G B;  1NXD 1;  5F2W A;  3KCC A;  4LOT A;  2C4X A;  4LXL A;  4P9I A;  5EPA A;  4OHY A;  3CKH A;  1UY3 A;  4Y5T A;  1OF4 A;  2FCU A;  1VBA 3;  2K2S A;  4O61 A;  5JZG A;  1R09 3;  1BCX A;  1TNF A;  1ZBE 3;  2DF7 A;  2Q1Z B;  2VH9 A;  3GNE A;  3CMG A;  3ZN5 A;  3M8L A;  3HPN A;  4B4R A;  4DO0 A;  4EE2 A;  2JIC A;  5FY5 A;  3PDQ A;  4YM1 A;  3WW4 A;  2BTV C;  4ZY9 A;  1BEV 1;  4AVV A;  2P34 A;  1PK6 C;  1UZZ A;  2QBX A;  3VBO A;  5A3W A;  5CAZ A;  1W8N A;  3KCY A;  1MZE A;  3EQE A;  4HVO A;  4QKN A;  5IVY A;  1OBN A;  5CZK A;  5A32 B;  4DXZ A;  5JXH A;  5IVC A;  3W5N A;  1MS4 A;  1ASJ 2;  1FOD 1;  3NMB A;  2PFW A;  4CUC A;  1QJX 1;  2IXJ A;  1RUE 1;  1ZZC A;  4DUX A;  1W2N A;  5F32 A;  1VE0 A;  2EF6 A;  1BZW A;  3AYC A;  3H1Y A;  3FUQ A;  4FAG A;  4YG3 A;  3N9O A;  4Q4Y 1;  4B7K A;  1YJL A;  5FTT C;  2BYV E;  2E31 A;  2XBO 3;  1GP5 A;  3BPZ A;  3WHU A;  2EIB A;  3WF0 A;  4QGN A;  1NE6 A;  3THP A;  2ADD A;  4CDQ C;  2PAM A;  4ZZ8 A;  2P17 A;  2CTV A;  4Q4V 1;  5GZG A;  3IKW A;  2XQX A;  4TLG A;  4BWO A;  2WBK A;  1SLI A;  1IQA A;  5E16 A;  3WNX A;  2HYX A;  1W8H A;  4XMI A;  2IZW A;  5K8S A;  3I3M A;  3LQC A;  4ZZ5 A;  2X05 A;  3OUH A;  1T6G C;  2XJP A;  3POS A;  1OC1 A;  3C7G A;  5J98 B;  3KGZ A;  5CFD A;  3ZYR A;  1EYB A;  5BNN A;  4L92 A;  5F9T A;  3HOB A;  4Q4X 2;  5L73 A;  1MQT C;  4LIU A;  2R49 A;  2XWJ B;  3TN9 2;  4CUB A;  1LGN A;  4SLI A;  4AFM A;  2AAC A;  2W1S A;  2YXS A;  4N53 C;  4RYD A;  1QH6 A;  3W20 A;  1GR3 A;  3VBF B;  3VZJ A;  2GP5 A;  4XJZ A;  2VCC A;  5FK7 A;  5ANQ A;  3KV5 A;  4HSL A;  4QX1 A;  2PHU A;  1R1Z A;  4E4H A;  5BNN B;  4N8M A;  3TOJ A;  3E6C C;  2I74 A;  4LO6 B;  1DYO A;  5DZE A;  1JHJ A;  1R08 1;  1ZZ8 A;  3LD8 A;  3R05 A;  2XBO 2;  4GH4 B;  4JV4 A;  4JDN A;  4L11 A;  1RUJ 3;  4PI0 A;  4N7U A;  3DL3 A;  1PNF A;  4M4P A;  3AYE A;  4I0B A;  2UU8 A;  3GAL A;  3LDK A;  2ZHL A;  1DZQ A;  3MIH A;  5ACA 3;  5BNO B;  4MHR A;  1OI6 A;  2BFU L;  5FLI A;  4QKB A;  4YPJ A;  5F7U A;  1OMI A;  2A75 A;  2BP6 A;  2DVG A;  3LPF A;  2HJI A;  3VKM A;  1U5Y A;  4XHB A;  1PMH X;  3HQX A;  4MAD A;  2J42 A;  3RZG A;  3R6S A;  2E32 A;  4DQA A;  2WS9 1;  3JQW A;  5FOB B;  5K7P A;  3HQR A;  4ATF A;  2O1Q A;  3WG1 A;  2OX0 A;  1UZV A;  1CJD A;  2D3P A;  2WC2 A;  2BBA A;  2WKK A;  3OPT A;  3BU7 A;  5A1A A;  1WMX A;  1W9Y A;  2XVL A;  1PZ9 A;  2VOT A;  4F3J A;  1EAH 3;  4AF9 A;  3AVR A;  3WF4 A;  4YGB A;  4YW1 A;  1UN1 A;  5AC9 2;  1SFP A;  2PHR A;  1NCQ B;  1OXC A;  4WZC A;  2EIC A;  3IN9 A;  2LS6 A;  2R07 2;  3DYP A;  4J1W A;  3TEX A;  4OQ8 A;  4AHX A;  1XE7 A;  4RR3 C;  3I7D A;  1OPM A;  1ZZB A;  3GXU A;  2D6N A;  2HWF 2;  1COV 1;  3RPQ A;  5HV0 A;  3MIB A;  4I2O A;  2BOI A;  1RUN A;  4GB3 3;  4LO4 B;  1UL9 A;  4JQR A;  3USS A;  1O4Y A;  1TME 1;  3LSE A;  3ZIX A;  1Q8S A;  2VD7 A;  4YZ3 A;  3N35 A;  5FP3 A;  4M00 A;  5FPA A;  2JDK A;  2R04 3;  3AZX A;  4GWN A;  1U12 A;  3TNQ A;  1LED A;  2VUD A;  1E5S A;  3AJY A;  3T4V A;  4EN9 B;  3U75 A;  3K3N A;  3BN6 A;  3SC7 X;  4E4S A;  3G7D A;  1AL2 3;  1OKO A;  1WA6 X;  3WP5 A;  2A7A A;  1LOB A;  1PVX A;  3TEZ A;  4XFB A;  1QJU 2;  1EV1 3;  2OS2 A;  3PJQ A;  3OGR A;  4Q4V 2;  3VBS A;  4EYU A;  4EWD A;  4IES A;  2G4I A;  1KQR A;  4RQP A;  4AGV A;  1CVN A;  5A3M A;  2JKX A;  4ZS3 A;  1PM7 A;  4FP3 A;  4LBQ B;  2B8M A;  3MW2 A;  4IEV A;  4KU7 A;  3BTX A;  1NA1 C;  1Q5O A;  2R04 1;  2FMD A;  4RA0 A;  1NLQ A;  4CCL A;  4CP9 A;  1GYK A;  4PCR A;  4BOW A;  1JBC A;  2O0O A;  2OVU A;  4I02 A;  4KWJ A;  4MSV A;  4ONU A;  4PLO A;  3WP3 A;  1X33 A;  2ARB A;  3DCQ A;  5E8A A;  2QQW A;  3ZM8 A;  3B9C A;  2MHF A;  4QXK A;  5C8C B;  1RIR A;  3BVC A;  4Y22 B;  1N1S A;  3POW A;  2PLV 1;  1MQT B;  1RYY A;  1EV1 2;  4MGS A;  1ZX5 A;  2XKO A;  4PIY A;  3USU A;  3ZXF A;  5JXJ A;  2PAE A;  2W39 A;  4AYU A;  1WBL A;  4MXW B;  3RZH A;  5D21 A;  2DCJ A;  3U4X A;  1AL2 2;  3NAP A;  5FZE A;  4EQV A;  2CYF A;  1ONA A;  5FY0 A;  1X36 A;  1I3H A;  2X29 A;  5A3U A;  1XND A;  3NVC A;  1OFS A;  1V6M A;  5F5C A;  3S5A A;  4JVA A;  1W6N A;  1PO2 2;  2QQV A;  1GZW A;  2PN5 A;  1GNY A;  1LEN A;  4WVW A;  4E8D A;  2WS9 3;  5LK5 A;  4EN6 B;  1O8S A;  5FY8 A;  3AP6 A;  2O8Q A;  1UU6 A;  2VMH A;  3CJX A;  3CHX A;  4PF5 A;  2DCK A;  2NMO A;  4YVS B;  4UFH A;  4OI1 A;  2RJ2 A;  4N7I A;  1O8P A;  1OFN A;  3NV4 A;  5FZD A;  1RHI 3;  3MIC A;  2HWC 1;  1VBB 3;  3KLS A;  4GAL A;  3T30 A;  1QJE A;  2OW4 A;  1RUH 2;  3UGH A;  3MIG A;  3VZL A;  2HWE 1;  4FPY A;  2E26 A;  1AR7 1;  1VAK A;  1W2O A;  1AR6 3;  4Q27 A;  4HKW A;  3VB9 A;  2WUH A;  2WT2 A;  1W9F A;  1W9T A;  2HH9 A;  4D7Y A;  2B39 A; 
#chains in the Genus database with same CATH homology
 2E33 A;  2WN2 A;  5DMY A;  1WKY A;  2QQO A;  2J1V A;  1T2X A;  2WZ8 A;  1O59 A;  1L7Q A;  2DDU A;  2J1U A;  4QB2 A;  1CIY A;  3A22 A;  3I2J A;  3NJX A;  3WSO A;  1KEX A;  3I3D A;  2B9V A;  2ZEX A;  2W95 A;  5C7G A;  4FI9 A;  2QQM A;  1JYN A;  1GOG A;  3NNG A;  1P8J A;  4HG6 B;  4DXS A;  3LEK A;  4A41 A;  2VQU A;  5DN2 A;  2W91 A;  2VL4 A;  2VO5 A;  1UMH A;  2JE8 A;  4LPL A;  5LA0 A;  2VC9 A;  1F4A A;  4ARY A;  2Y6H A;  4DUV A;  3A23 A;  3VD3 A;  5IHR A;  1JYV A;  2ZEZ A;  1GMM A;  3ECQ A;  1JZ2 A;  4QDQ A;  4KI5 M;  3E1F 1;  3NJV A;  2QQJ A;  1UY0 A;  1F4H A;  2BGO A;  2YG0 A;  4GWI A;  3SKJ E;  2C9K A;  1SDD B;  3OB8 A;  2VM9 A;  1W99 A;  3ACI A;  3IAP A;  3OG2 A;  3T0A A;  2VZP A;  3I2F A;  2W46 A;  2WAO A;  3T0D A;  2WO1 A;  3BGA A;  4A44 A;  4GZ9 A;  2C26 A;  2QQK A;  1GOH A;  3CQO A;  2VQT A;  4P02 B;  1TG7 A;  4PT6 A;  4MOA A;  1CZT A;  1UYX A;  3HNB M;  4CU6 A;  5LA2 A;  3WEZ A;  1K3I A;  3J7H A;  5FUI A;  1JZ7 A;  3CZJ A;  1I5P A;  4P00 B;  2WQ8 A;  3WNP A;  3SEP A;  3SEE A;  3OGV A;  3MUY 1;  1DLC A;  1US2 A;  1JYW A;  4QDR A;  3VD4 A;  4OMC A;  4A4A A;  5EIY B;  3WNN A;  2W47 A;  2OKX A;  1HN1 A;  3UNP A;  2YB7 A;  1GQP A;  2RVA A;  1UWW A;  3DYM A;  2J1S A;  3ACG A;  3JXS A;  3ACH A;  3K75 B;  2Y64 A;  2BGP A;  3C7F A;  3DEC A;  2Y6K A;  3ETP A;  3NQH A;  3EYP A;  4QAW A;  2EIE A;  2W3J A;  1NUK A;  3MUZ 1;  4XUR A;  2W87 A;  2Y6L A;  4JKM A;  1CZV A;  1NKG A;  4ARX A;  4BJ0 A;  3GDB A;  3THC A;  4A6O A;  3K4A A;  5B4N A;  1JZ6 A;  2CDP A;  1SG3 A;  4TXW A;  2LW8 A;  4M4R A;  4PQQ A;  1DP0 A;  4P08 A;  3WNL A;  4BK4 A;  1YQ2 A;  1WCQ A;  2VZR A;  5IYY A;  1NAE A;  3ABZ A;  1J83 A;  1EUT A;  2VTF A;  5JUV A;  3F2Z A;  3HJR A;  3K46 A;  2WZE A;  4ZXE A;  2R7E B;  3P6B A;  3U37 A;  3III A;  2J1T A;  3D3A A;  4BXS V;  1CZS A;  4DUW A;  2JD9 A;  2X09 A;  3VDB A;  1MPX A;  4JKK A;  2J22 A;  2YFZ A;  5LCW L;  5I0D A;  1XNT A;  1ULP A;  2VCA A;  2XON A;  4KMQ A;  1OF3 A;  3CIH A;  1XPW A;  3I3E A;  2CDO A;  2WO3 A;  1IQD C;  1PMJ X;  1OD3 A;  2VZ1 A;  1EUU A;  3CDZ B;  3EB7 A;  4LKS A;  3NRU A;  5JR2 A;  3T2Q A;  3T0B A;  4XUN A;  5HPO A;  1BHG A;  3LEI A;  4PF1 A;  1PX4 A;  4CU9 A;  4XVH A;  1UXX X;  4OYU A;  3MO4 A;  3K77 A;  1JZ5 A;  5IFP A;  2VJX A;  2VCB A;  1JI6 A;  3GGL A;  2YC4 A;  2W9X A;  3IAQ A;  3HN3 A;  4MO3 M;  3A7Q A;  3FL7 A;  5EJ1 B;  1ULO A;  4P5Y A;  3CZU A;  5B4X A;  4CUA A;  3W5M A;  1K12 A;  3FHA A;  3MV0 1;  3VD5 A;  2WO2 A;  4CU7 A;  1W8O A;  3PUH A;  2BER A;  1UYY A;  3MBW A;  4JHZ A;  1SHW B;  3ACF A;  3WNO A;  2ZEW A;  4Z2A A;  4D0Q A;  3VDC A;  1UXZ A;  4JX0 A;  2VZT A;  4QB6 A;  4OZO A;  2J1R A;  3I2K A;  3GM8 A;  2ID4 A;  1XC6 A;  4DEQ A;  1XNA A;  2ORZ A;  4XUP A;  1KGY A;  4RN5 A;  1JZ4 A;  1UZ0 A;  5G04 L;  5DQ0 A;  4BK5 A;  1UYZ A;  4TTG A;  3WF3 A;  5HXM A;  3LEG A;  3HNY M;  3C8X A;  5G05 L;  4OMD A;  2VMD A;  2WYS A;  4XZU G;  4MGQ A;  1W9W A;  3VD7 A;  1D7P M;  1K45 A;  4W8J A;  2JDA A;  5J1X A;  2W1W A;  4OUE A;  1W0N A;  3DYO A;  4AAX A;  2W1Q A;  5DPN A;  2C4X A;  2YFU A;  3CKH A;  1UY3 A;  1OF4 A;  3THD A;  3UES A;  5C70 A;  4BDV B;  4DEV A;  2YC2 A;  4CU8 A;  3CMG A;  2VZ3 A;  3HPN A;  3FHQ A;  2QQI A;  3A21 A;  4UI9 L;  4ZY9 A;  2QBX A;  1W8N A;  2XHN A;  5JXH A;  5CZK A;  4QX3 A;  1JU3 A;  2QQN A;  3W5N A;  2Z4F A;  4CUC A;  2VZQ A;  4DUX A;  3PUI A;  1UY1 A;  2VZO A;  3HEI A;  3P1I A;  4D8M A;  3MV1 1;  2E31 A;  1JZ3 A;  2EIB A;  3WF0 A;  5LA1 A;  1LNS A;  4ZZ8 A;  1UY4 A;  2W94 A;  5IJR A;  2V4V A;  2XQX A;  4A42 A;  1UX7 A;  2WBK A;  3I97 A;  2HYX A;  1L7R A;  3LQC A;  4ZZ5 A;  3T09 A;  2V5D A;  2X05 A;  2VR4 A;  1OH4 A;  3C7G A;  4XUO A;  3HOB A;  2W5F A;  4W4Z A;  3OGS A;  2PQS A;  4CUB A;  4QDS A;  2W1S A;  4RYD A;  2VCC A;  2BZD A;  4QX1 A;  5JMO A;  4KWU A;  1DYO A;  3C7O A;  1JHJ A;  4A45 A;  2HLE A;  3FN9 A;  2W92 A;  2WAA A;  2XOM A;  1JYX A;  4M4P A;  4A3Z A;  3WQB A;  5JXI A;  2ZEY A;  2VMC A;  4AG4 A;  4YPJ A;  5F7U A;  1JU4 A;  2VZS A;  3LPF A;  1PMH X;  4MAD A;  2E32 A;  4L0P A;  1GU3 A;  1K42 A;  2BBA A;  3I2G A;  5A1A A;  2J1E A;  4XUQ A;  4XUT A;  1H6X A;  2VOT A;  4QPW A;  5EJZ B;  4DXR A;  3WF1 A;  3OEA A;  2J1A A;  3WF4 A;  2Y6J A;  3WNK A;  2EIC A;  2LS6 A;  3DYP A;  3UET A;  3WNM A;  2W1U A;  3GXU A;  4DXT A;  2WDB A;  1R64 A;  4IUG A;  3OBA A;  2VME A;  2QQL A;  3IB3 A;  1PX3 A;  3K4D A;  3K4Z A;  2VZU A;  3LPG A;  3BN6 A;  3WF2 A;  4GWJ A;  1GUI A;  5CYY A;  2Y8K A;  4JKL A;  1NX9 A;  2V72 A;  3OGR A;  3AC0 A;  4LQR A;  4UAP A;  3I3B A;  2JKX A;  1J84 A;  3C7H A;  2Y6G A;  3I2I A;  3SKV A;  4QX2 A;  1CX1 A;  3LE0 A;  2ORX A;  3ZM8 A;  2J7M A;  2EID A;  1W9S A;  1UMI A;  3T2P A;  5C71 A;  4MGS A;  1RYY A;  3HNM A;  5JXJ A;  3OEB A;  3VDA A;  3T08 A;  2DCJ A;  3T2O A;  1UY2 A;  2KD7 A;  3VD9 A;  4E8C A;  3IDA A;  2VZV A;  4CVU A;  1GNY A;  1US3 A;  1TVG A;  2B4K A;  4E8D A;  4ET7 A;  4UOJ A;  4LHS A;  2RV9 A;  1O8S A;  3I2H A;  1H6Y A;  2DCK A;  2WN3 A;  2ZXQ A;  1OT5 A;  2RJ2 A;  1O8P A;  2L9L A;  5IFT A;  2WAB A;  2X10 A;  1GOF A;  2E26 A;  3C7E A;  4QB1 A;  4W50 A;  5JXG A;  1JZ8 A;  2WUH A;  2VMF A;  1W9T A;  4QX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...