1CZSA

Crystal structure of the c2 domain of human coagulation factor v: complex with phenylmercury
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
b'GCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COAGULATION FACTOR V)
publication title Crystal structures of the membrane-binding C2 domain of human coagulation factor V.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1czsA00
3PUIA 5EJ1B 3HEIA 1F4HA 3CMGA 1D7PM 3VDAA 1J84A 2X05A 3WNLA 4E8CA 4CU6A 2BZDA 3SKJE 2YG0A 1WCQA 5DQ0A 2EIBA 2QQLA 3FHQA 2BBAA 4MGSA 2VZTA 3VD5A 2ORXA 4DXTA 4DEVA 2VZSA 4QX1A 4GZ9A 1JYWA 3W5MA 2VTFA 3THDA 1CZVA 2C26A 4M4RA 4RYDA 5IYYA 5JXGA 3WQBA 3HNMA 2VZVA 1GU3A 3CZUA 4QX2A 4ARXA 1JZ4A 3MBWA 2QBXA 4YPJA 2Y6HA 4A44A 3OGRA 4BXSV 4QX0A 4P08A 1SHWB 1NAEA 2W5FA 3MV01 2W94A 2VR4A 3CZJA 4ARYA 2J1RA 4LHSA 4DXRA 3A21A 1J83A 4OMDA 2YFUA 3PUHA 4ZZ5A 5LCWL 2J22A 3I2FA 3ACIA 2VZUA 2QQKA 2DCJA 1UY4A 4JHZA 1KGYA 2V4VA 1K3IA 3J7HA 2Y8KA 2EICA 2ID4A 4XUPA 2VL4A 4MGQA 1JZ6A 4A3ZA 3HN3A 4BK5A 1XNAA 3U37A 4QDSA 1UYZA 3OEAA 1XNTA 3ZM8A 1H6XA 4LKSA 3JXSA 1UX7A 3P1IA 1W8OA 1L7QA 1WKYA 2ZEWA 4DUWA 1JU4A 3CIHA 4JKKA 3NJXA 3MUZ1 1TG7A 4D8MA 2R7EB 3F2ZA 5EJZB 1H6YA 4AG4A 5B4NA 1F4AA 1UYYA 5CYYA 3IAQA 3I2HA 1GUIA 2ZEYA 3DYMA 4CUAA 3FN9A 5JXHA 2VM9A 3VD3A 4Z2AA 2CDPA 2J1VA 4P02B 4BDVB 3P6BA 4GWIA 1DYOA 2J1UA 2VJXA 3ACFA 1KEXA 1PMHX 3SEEA 3K4AA 4PF1A 2J7MA 4QX3A 4DUVA 3LEGA 3WSOA 2C9KA 3THCA 2VZOA 1BHGA 2Y6JA 3WF4A 2WO2A 1OF3A 3CKHA 5FUIA 5IFTA 4XVHA 3K75B 2WN2A 3VD4A 1GMMA 2E32A 3GM8A 3MUY1 2W47A 1UYXA 4IUGA 3HNBM 4GWJA 3HJRA 3OGSA 3EYPA 2YFZA 3K77A 3GGLA 1JI6A 3NQHA 4P00B 4DXSA 1GNYA 3FL7A 2WAAA 1NKGA 3C7GA 3I2KA 3K46A 1W9TA 1GOFA 3WNPA 1HN1A 1UMHA 1K45A 3OEBA 3MV11 3IDAA 4A41A 1T2XA 2ZXQA 4QB2A 3C7EA 4CU8A 2JE8A 2WABA 3T0AA 4LPLA 2WO1A 2VQTA 3OB8A 4QDRA 2WO3A 3CQOA 4OUEA 3EB7A 1OD3A 2XONA 4ZY9A 3T2QA 3VDCA 2J1SA 4UAPA 1CZTA 4AAXA 2B4KA 5G04L 3LPFA 1UXZA 2VQUA 4JKMA 5IJRA 2W87A 2HLEA 3BN6A 4OYUA 3GXUA 3LEIA 1JYXA 1W9WA 2W1SA 4CVUA 1JYVA 1DLCA 2JKXA 1W9SA 2BERA 2HYXA 4OZOA 4A45A 3A22A 3C7FA 2EIEA 3SKVA 4XUNA 2QQOA 1LNSA 1O8SA 3T0DA 1OH4A 1UY1A 1US3A 5JR2A 2ZEXA 3VD9A 2VO5A 4W8JA 2XHNA 3T2PA 3T09A 2JDAA 1RYYA 2OKXA 4BJ0A 3LEKA 1GOGA 2W91A 2CDOA 3ECQA 4L0PA 1ULOA 2QQNA 2YC2A 5EIYB 5C7GA 4TXWA 3NNGA 3DECA 5JMOA 1EUTA 1JZ2A 4FI9A 1O59A 2W1UA 1OF4A 3WEZA 2LW8A 5C70A 4HG6B 1US2A 4XUTA 2V72A 2YB7A 2V5DA 4P5YA 1XC6A 2J1EA 1GQPA 2VZ3A 2WDBA 1ULPA 3NRUA 3K4ZA 1CX1A 2VC9A 4XZUG 4CUCA 4PQQA 1IQDC 5IFPA 4XUOA 3CDZB 2YC4A 1JU3A 1JHJA 2VMEA 2BGPA 3DYPA 3WF3A 3UNPA 2DDUA 3SEPA 5DPNA 1JZ3A 1I5PA 2XOMA 1O8PA 3WF0A 5G05L 4XUQA 3T08A 1SDDB 2Y6GA 4ZXEA 4UI9L 1UY3A 3ACGA 2RJ2A 3I97A 4KWUA 4A4AA 2VMDA 1P8JA 2WZEA 1JZ8A 2JD9A 4KMQA 4UOJA 3UETA 4E8DA 3HNYM 3FHAA 2C4XA 1EUUA 2WYSA 2VZ1A 3I2JA 2E33A 3AC0A 4PT6A 4D0QA 3GDBA 3LE0A 1UY0A 2J1TA 2XQXA 1UWWA 3BGAA 2Y6KA 5DN2A 5JXIA 3WNMA 1W0NA 3I2GA 2Z4FA 2VCAA 3I3BA 5J1XA 3A7QA 5HPOA 5HXMA 2VMCA 4CU9A 3DYOA 3I3DA 2KD7A 1UMIA 2W1WA 2Y6LA 3I2IA 5JXJA 2W1QA 3OBAA 5I0DA 2E26A 1PX4A 4OMCA 5IHRA 2VZPA 3C7OA 4W50A 4KI5M 2DCKA 2ORZA 4JX0A 3VD7A 4A42A 1UY2A 3WNNA 3HPNA 4RN5A 2QQMA 1XPWA 4MO3M 3HOBA 3WNKA 2L9LA 2WAOA 1JZ7A 2WN3A 2Y64A 4ET7A 5CZKA 3C7HA 3ETPA 5C71A 1NX9A 3W5NA 2VCCA 4M4PA 1R64A 3LQCA 5F7UA 2J1AA 5DMYA 3T0BA 1YQ2A 2W9XA 1UZ0A 2WQ8A 3WF2A 1TVGA 4QPWA 4MADA 2VOTA 2PQSA 4LQRA 5JUVA 2WZ8A 2VCBA 5LA1A 1W8NA 3I3EA 4ZZ8A 1OT5A 4QAWA 3OG2A 4XURA 4QDQA 2BGOA 2LS6A 2RVAA 4QB6A 2W92A 2W3JA 2WBKA 3E1F1 1NUKA 1JYNA 3VDBA 3T2OA 4W4ZA 3IB3A 2WUHA 3IIIA 3IAPA 3D3AA 1SG3A 4TTGA 2W46A 1PMJX 3NJVA 2VMFA 4DEQA 1GOHA 2VZRA 5LA0A 3OGVA 4CUBA 1DP0A 3A23A 3ACHA 5A1AA 3UESA 1CZSA 3C8XA 4QB1A 3MO4A 3WNOA 2B9VA 2QQJA 4JKLA 2W95A 4A6OA 1W99A 2X10A 2VZQA 3K4DA 2QQIA 3WF1A 2EIDA 5LA2A 5B4XA 1L7RA 1K12A 3LPGA 4MOAA 4CU7A 4BK4A 1JZ5A 2ZEZA 1PX3A 2X09A 1UXXX 1CIYA 1K42A 2E31A 4DUXA 1MPXA 3ABZA 2RV9A
chains in the Genus database with same CATH superfamily
4KWLA 2RHPA 2XMLA 3PUIA 5EJ1B 4D7SA 2XKOA 3CMGA 1AJOA 1D7PM 5CKQA 3WNLA 3BUCA 1RUH1 1NLQA 4ATEA 2BZDA 4F83A 2OW4A 4TN7A 1D4M2 4YZ5A 2EIBA 1W6OB 1PVC1 1H9WA 1W0PA 2VQAA 3FHQA 3ZXFA 4MHUA 4Z92B 4DXTA 4FAHA 3PVOA 4QQHA 3RVHA 4DEVA 3RRDA 1FT9A 5BXXA 1MQTC 3W5MA 2ZHKA 1CZVA 2C26A 4K3UA 4M4RA 3PVNA 4N9IA 1JBCA 2I2SA 5ACA3 5FO7B 3D82A 4R9CA 1C8M2 3HNMA 4X6QB 5FMBA 4H7LA 5FREA 4CDWB 3N3HA 1REDA 3K3NA 4G3YC 4MXWA 4RGAA 5J7MA 3AMHA 1JZ4A 3W20A 5IUQA 4HONA 2I74A 4RR3A 3DPRC 1CPNA 4BM8A 4IQPA 4AGRA 2QBXA 1YLLA 4HL0A 5FZ7A 1SDWA 2VH9A 2Y6HA 3OUJA 4GULA 3OGRA 5J3UA 4C90A 2GN3A 2Q30A 1NAEA 1ZM1A 1GZTA 3H3LA 2VR4A 4AEMA 1NCRC 4LHSA 2MEV1 2R32A 3A21A 4UW3A 4CCJA 4OMDA 1PNFA 1RUC2 2HWB3 2WWSA 4K1ZA 2YFUA 1H8TB 1POV0 1AR61 4XCAA 2OVUA 3ZSEA 2PQQA 3VZOA 5IW0A 3RZKA 1YQ6A 3MW3A 3ELNA 2ZKNA 5H9SA 2ZGSA 2JWPA 2WS93 5FMOS 2YHJA 1CAWB 1LULA 2V4VA 3SCHA 3UJQA 1RUG2 2WZR1 4PQ9A 4XMIA 3KZ4C 4AEKA 5ABJC 4XUPA 3BODA 3T2TA 3ZXLA 1D4VB 5FZFA 4KWJA 4W6YA 1JZ6A 2GP5A 3CU7A 3KT7A 4C1WA 5GLTA 4XDOA 3HN3A 1HDKA 2R042 4AVCA 4JGYA 4KG0A 5HCBA 4E27A 3RZLA 5A3OA 1HXS2 3OEAA 3RDIA 4Z1VA 1QEXA 3D5OA 4BISA 2G9FA 1WW4A 5KXDA 3N9QA 1W6MA 4TLFA 5EWSA 5ANQA 1A78A 3VBHB 4F7ZA 4AR2A 4KL1A 1DZQA 2V73A 4YSFA 1KXGA 2D6MA 1RUD3 4XF3A 1BZWA 4YFWA 5CFCC 5CG8A 4WM7C 2DCYA 3FWEA 3CIHA 2ZABA 1H0BA 5F5CA 2OT7A 1SLTA 3B3QE 4JKKA 1GNZA 4RFRB 2R6QA 4Y1XA 5JOWA 3B5LB 5K0UB 4N53B 3NJXA 5HV0A 3M2MA 3TOJA 3MUZ1 3T4VA 1WMEA 1X50A 2DFCA 4IERA 1H1MA 1SMVA 2Z79A 3VZJA 2QQVA 2R7EB 2RS52 1V9U3 2B5HA 3HIFA 4YVSB 5FPAA 4RS5A 4YLZA 1ZRCA 1OI6A 3H1WA 1HJFA 2QZ3A 2VGDA 3IPVB 4S2DA 4CEYA 2XJSA 3KD4A 4ZONA 1OLMA 3NJZA 1IHMA 3FMGA 3TEYA 2RR13 3DYMA 2YBSA 1AXZA 2VM9A 5T52A 3VD3A 1HQLA 5DZEA 4AL9A 5ACA1 3KS7A 1R1A2 4ISQA 4HT1T 3ZXEA 3POSA 1O3QA 2J1VA 1WLWA 3AXEA 1QH7A 2GSYA 3VV1A 2D5FA 1ODMA 1XE0A 5F6LB 4BDVB 2QDRA 4GWIA 4YW6A 4MXWB 1OFSA 2WQZC 3VHNA 1QU0A 3VZKA 4JAAA 3C2UA 4RR3B 4B4PA 2YPDA 5F1RA 4QXHA 3AVSA 3RI8A 2DU0A 2J7MA 2XVLA 3QOPA 4FXGB 1HV1A 4QX3A 5JVVA 2P3KA 3THPA 2RM22 3ZYBA 4FAGA 5E6HA 1HRV2 1VB4A 1W8UA 3N4MA 4Y1UA 1LGNA 4LTAA 5APAA 2HWB1 1ND2A 3THCA 4CDQB 1BHGA 3AX4A 5KHGA 4YW1A 3WDYA 1XB9A 3ZXAC 4XBNA 5FPXA 3MIDA 3CKHA 4JZRA 4UWDA 2OX0A 4CCDA 3VBUC 2D7FA 5FUIA 4QQLA 3VKMA 2WS91 2RDNA 1S2BA 2WN2A 1O5LA 5IVEA 5D8AA 2Q5TA 5KC5A 1GMMA 1BXHA 2E32A 4O7XA 1LEDA 3MUY1 2BNOA 1UYXA 3VKFC 4Q1RA 4PBOA 5ANNA 3HNBM 4XACA 4GWJA 2Q8EA 3IBMA 3OBTA 3R4DB 3FLPA 2EAKA 5EYYA 3EYPA 2YFZA 1JMUB 4M00A 4FSJA 1LENA 1Z7S3 1JI6A 4LUKA 3TN92 1RUD1 3K46A 2CTVA 2JDNA 3WNPA 1GOFA 3ZR5A 1W6MB 2FMYA 4Y33A 5FY1A 1VBC2 1VE0A 1MACA 4O61A 2R072 3MLJA 2ZXQA 3GZUC 4PIZA 5C4WA 2WABA 4RD7A 5DZFA 3FHIB 3NNJA 3J7LA 2JDZA 4UW4A 2VQTA 3KLSA 2XJTA 4P9WA 4BLJA 3UKTA 4DMIA 4I3PA 5JSPA 4NR1A 1V9U1 3W9AA 2VTXA 1SBFA 5HI0A 1AX0A 2WO3A 5FMCA 1RTVA 1PO12 2O8QA 2BJSA 4L97A 1WLDA 3UYJA 4EE2A 4XW3A 2QUOA 2FDIA 2HJIA 2Y6FA 2RR11 4CUGA 4D6SA 2ES3A 1G7YA 4RS5B 4CEYB 2J1SA 3MFCA 4XABA 4R4ZA 3PMEA 2P6HA 4AAXA 2B4KA 2Q8OA 5C5UA 1UXZA 4QGLA 5FJKA 3T1LA 3KHCA 2A3YA 1YXWA 3AM2A 3ES4A 3BN6A 4QQPA 5F5IA 4ZU4A 2UWBA 3UGGA 2EF6A 1VBE1 1WLTA 2P3IA 5F39A 1ZREA 1S0IA 1SLAA 1ZZCA 1ZRIA 2JKXA 5A3PA 4IESA 5FZOB 1RHI2 4AFAA 3ATGA 4M3CA 2BERA 4EJRA 4NUBA 2YROA 2IVJA 4RL7A 2JG9A 3H7JA 3POJA 2EIEA 3PUQA 4IEVA 5CADA 3AP7A 3FUQA 1IS6A 4OFGA 3SKVA 2QQPA 2E9QA 1O8SA 2IXIA 1OH4A 1PZ7A 5LZ6A 1CD3G 4YM1A 3WDXA 1LESA 4OHWA 4QGNA 1F5JA 1G9AA 3VD9A 2JIGA 3V56A 3DXUA 4DPNA 1ENQA 1H4HA 3T2PA 2ET7A 4LKEA 4YGBA 5A7SA 4BJ0A 1BLZA 2ZACA 3AMPA 4LA3A 1R082 2W91A 3BU7A 4JTNA 4L0PA 2ZAHA 5FP8A 4ISRA 4BLIA 3GBGA 2YBKA 5FPUA 3CL1A 3RMYA 4AI0A 5F2WA 3VUOA 1HQNA 5JMOA 4N43A 2JXAA 2YMZA 1PGL2 5D8AB 2QZ2A 4XDQA 5DG2A 4YVWA 1F8VA 4IEXA 1MQTA 2G4IA 1VAVA 4LBMA 1D4M3 2W1UA 2RDQA 1VRH3 5FWEA 1HRI2 3GZAA 1GWKA 3WEZA 4FBFA 4XBLA 1EV12 2ZTNA 2JDYA 1Z7S1 3DXTA 1S0GA 2VUAA 4QWNA 2YB7A 4P5YA 2C24A 3T30A 1WCDJ 4COUA 4C8DA 2J1EA 5T54A 3ZYRA 4CA9A 4UYBA 3LDKA 5FKCA 3AJYA 1S0JA 4AVTA 2E7QA 1C8M3 3DPRA 3QH7A 3NRUA 2WNVC 5FZLA 2OQ7A 2VOWA 1BCXA 3UT0A 3RSJA 5JZGC 5L9VA 4XZUG 4RHV2 1UIKA 2XJVA 1U5IA 1W9YA 3ZVXA 2JDMA 1OKOA 1NCRA 1W6PA 4LHKA 3POWA 3Q8EA 3OBRA 5C4WB 1IQDC 3KB5A 2WNOA 3ILRA 1UZVA 3WXPA 1H4GA 4B7EA 3H8OA 5JPMB 2BU9A 2VQ0A 2A6VA 4IEWA 3ES1A 4QKDA 3AZVA 3ENRA 3WF3A 1HIXA 2DDUA 1E5HA 2D3PA 2WT2A 2XOMA 2EALA 1UOFA 3RFRA 4LIVA 2G1MA 1RUC3 4EV0A 1LCLA 3NWKA 3WF0A 4FTSA 1H2KA 3M8LA 1LU2A 4Q0SA 5HCAA 2Y6GA 1W39A 4HZFA 3IDBB 1XU1A 2HWC2 1Z0HA 1GKBA 3ACGA 1D0HA 3TNQA 5C9AC 4EN8B 4PI0A 1RUG3 3VLBB 3J4UH 1P8JA 4RQPC 3WHTA 1G86A 4RSUA 3E5UA 5FYMA 4IEOA 3BU0A 4E8DA 3HNYM 4NPRA 4M3CB 1AHSA 1YFYA 2C4XA 2R043 4NO4A 3ZFEC 2NZ9A 2WYSA 3I2JA 1HXS3 1SFNA 5CFCA 4G4FA 4QU1A 3S7EA 3OUHA 2QKDA 3MICA 4WM7A 4LBNA 2GZWA 1V6MA 4LXLA 2J1TA 3FBYA 1ULDA 1UWWA 2WA4A 4BXFA 2Y6KA 3PIGA 1W0NA 3J26N 2GNBA 4EN7B 2BDRA 2VCAA 2ZGTA 2GMMA 3OTFA 2UU8A 1N1VA 2B7YA 4S2HA 2AH2A 3JD72 3OD0A 3BIEA 4KU8A 4PBPA 5A1LA 1QF3A 1UN1A 4FFFA 4O9EA 1W3VA 4XF0A 3N35A 2BOIA 2W2IA 4X8PA 5HXMA 4CU9A 4NIHA 4ZXKA 1D4M1 3KVAA 1J3PA 3WDWA 2QCSB 1VRH1 1UMIA 4AI9A 3I2IA 2RS53 1N1YA 2AREA 2Y6LA 2I45A 2CGOA 4G9SB 5J48A 4Z82A 5I0DA 3EBRA 4GMP0 4H55A 1MQTB 5FXWA 3WT3A 1SLCA 2FMDA 1W2NA 5CAZA 2G9ZA 4MV2A 3RJRA 1DZRA 1DLLA 5C8CC 2D6PA 4UFMA 1R1A3 1UOJA 1ZA4A 3RZZA 1C8M1 1RJ7A 5LBCA 1BK0A 2QQMA 4PI2A 4K9SA 4N9HA 5DUUA 4BHPA 1XPWA 4TSVA 3WNKA 2L9LA 2WAOA 3DPRB 1JZ7A 1WW6A 2WN3A 2XQRA 4DFSA 5CZKA 2ZHLA 3C7HA 3ETPA 3BPSA 2GNTA 1NX9A 5FO9B 2JDKA 2VUCA 4B4RA 5J09A 3W5NA 3LQCA 1NCRB 1UL9A 1W6PB 2RS32 4HXCA 5DMYA 1YWKA 3BTXA 5HCFA 2RM23 1UZ0A 3NV3A 4FPJA 1HRV3 4QPWA 3VBUA 1S55A 1OA3A 3CJIB 5CKMA 3WG3A 1RUC1 1POV3 5C3PA 4YYOA 2XJUA 1OMIA 3O0WA 5T5OA 5IVFA 1MS4A 2PQSA 2ZJCA 5JUVA 5HXVA 4IETA 5F5AA 1W9FA 1CPMA 4YGDA 5ABJB 1RUG1 2Z69A 3EXUA 3MFAA 4KNCA 3AYEA 4XURA 4FO9A 2YU1A 1REEA 2BGOA 2LS6A 2RVAA 1LJ7A 2W0XA 4OI1A 5A1FA 2W3JA 4YRDA 5FYTA 4UFHA 2R041 4B4QA 1JYNA 1C8NA 3T2OA 1N1TA 1HXS1 4O9GA 1KRIA 2PHWA 3N36A 1DGLA 2WUHA 5IWFA 3D3AA 1SG3A 4V1PA 4XF1A 3NJVA 3TN93 4D6RA 2XVKA 1CGPA 3LF7A 5CFCB 5LA0A 3OGVA 3MF6A 3P3PA 4WM7B 2AACA 1QQP2 2FDFA 3A0NA 5A1AA 1OQDA 2VXJA 1VBC3 4QB1A 2WRAA 2R073 3BTAA 4Q2FA 5FXXA 1WBLA 1AXYA 4XEZA 1GR3A 4SLIA 1PO22 1S2EA 2QQIA 3K4DA 2Y26A 3OPZA 3M3QA 4CZSA 1JYIA 5BNNC 3LCPA 2EIDA 5LA2A 1IS5A 4IV1C 4DRRA 4IE0A 4XAEA 4JGYC 1U0AA 1RUD2 3OCPA 4Q0UA 3TBDA 3ZR6A 1PO13 2CAVA 1V00A 3AMNA 5FY9A 1V0AA 2PAKA 1F5FA 4BK4A 1I3HA 4LE3A 4P5HA 1UXXX 2QTWB 4FVVA 1DFQA 3ST7A 1R1A1 4DUXA 3ABZA 3PJYA 5IATA 3PTRB 2RMU2 1QJX1 5DUXA 2ZMKA 3T3YA 4E9KA 5I0TA 3ZSLA 4LKFA 2DUPA 5EV7A 2V5YA 1V9U2 1VBD2 1XYNA 3DF0A 4P9YA 4YWAA 4NWWA 3SH4A 1ZZ8A 1GICA 2FCUA 4EZ4A 2A71A 1M06G 2X05A 3RG0A 4CU6A 4A3XA 4L8QA 2VW0A 1ULFA 5A3WA 1RHI3 4PDWC 3AYCA 3POFA 1U12A 1WCQA 2BBAA 4MGSA 1F15A 2CU5A 3MPPG 2ORXA 4Q1PA 2RM21 4TLGA 3AZYA 1HRV1 1JYWA 3TNPB 5E88A 3TYJA 2NYYA 1W2TA 3M4FA 3FX3A 1POV1 5DG1A 3THDA 3KV6A 1VBE2 5FYUA 2WT0A 4M01A 5GLWA 4CP1A 3VBUB 3USSA 4HETA 1R083 3CZUA 2VNRA 1XSQA 1VP6A 3M3OA 1JUHA 1A8MA 1F9KA 1UW8A 5FYCA 5FLHA 3HBKA 1VPHA 2ZGRA 3GALA 5FYYA 4J6GA 2AUYA 3KVBA 1AZDA 4WZCA 3HT1A 1PVXA 3O1VA 4XFHA 5IVCA 3NKTA 1FV2A 1V6KA 4P08A 4O65A 4V2WA 4TWTA 4XXPA 1W04A 1YYNA 2BW8A 4X8NA 4Y4RA 5GZFA 2W94A 4ARYA 1HRI3 1UQXA 4DXRA 1J83A 1ZZ9A 4WVVA 1EV13 2OS2A 4KWKA 4XQWA 5F3IA 3TN91 4BPZA 1YNAA 5A6ZA 1ND2C 3PUHA 1X9TA 4XFAA 1L7LA 2RG4A 4YGCA 1NY72 3FLRA 4ONUA 2QQKA 4Y24A 4Q4Y2 2XH6A 1VBC1 4JHZA 4DY3A 1ZRDA 2R071 1AR92 1S0DA 2YZ4A 3J7HA 5I8TA 2Y8KA 2EICA 2W39A 2VVFA 4RHV3 5JLVA 4MGQA 3MPBA 3PUAA 2ZGPA 5FAXA 4BQ3A 1NXMA 2JB8A 2YPJA 2P3JA 1NQJA 1PO11 2P1BA 5K7PA 1UYZA 3DKWA 4CDQC 1OQ1A 1WA6X 3OYWA 3SCFA 2EXJA 2NQYA 3AKRA 3FUOA 3AP5A 4LKSA 5CIRA 5JSRA 2OUHA 3P5BA 3P1IA 1DYKA 4BQYA 4ZU5A 1TNRA 3AVRA 4I02A 5C9AA 3GJAA 2ZBJA 1JU4A 3OPWA 2XJRA 4RQPA 3UGFA 3MLLA 1G9CA 2HWE2 5T5PA 2Y33A 1Y4WA 2HWC3 4LITA 1RUOA 1YRZA 2DCZA 4UBGA 4QXBA 3H8XA 1VBA2 1RHI1 3ZMNA 5LK7B 3WR0A 3ZFEA 5CBLA 4LO4B 3HT2A 1WD4A 2Q8CA 2VMIA 3ZSKA 1XRUA 1IGOA 1FYUA 3OUIA 4AG4A 5B4NA 1F4AA 2XLAA 2JIJA 2ZX4A 1KDKA 3IAQA 4XJWA 5JOXA 1GUIA 1UOBA 5FXZA 1F2NA 4CSWA 3APBA 2ARCA 2ZAAA 4RGGA 3VHRA 3OPTA 3W59A 4DQAA 3TEWA 2D6KA 4GH4C 3WLUA 4FPLA 3LOIA 3WG2A 1LGBA 4HSLA 5FXVA 2DTWA 2ET1A 2P37A 5C3RA 2DUQA 4P02B 3RZHA 4XHXA 1DYOA 1H30A 3GHMA 4HLTA 4COZA 4L9BA 1ZBA2 4AVBA 3JD73 1PGL1 3RQ0A 2CGPA 3I54A 1WMDA 4YGEA 3SEEA 2JG9C 4QX7A 4YW7A 5C8CA 2ERFA 5IK4A 1HRI1 3LEMA 1ULGA 3EO6A 5FZMA 3T1MA 3WSOA 1EV11 4Y5SA 3SISA 1AL23 2C9KA 4D7YA 1JW6A 1OSGA 2WLQA 5IK7A 1LB2A 2VZOA 2Y6JA 2IFWA 3NNFA 5A33A 4DY5A 5EJ3A 5A6YA 4I3GA 3U78A 2WO2A 1OF3A 1DQ1A 3B94A 4P9IA 2WO7A 2WNVB 1TMF2 2VW1A 1JUIA 1WUVA 4ZHNA 4NHLA 5JZGB 1EAH1 3TEZA 1DQ6A 3N9PA 1E5RA 1VRH2 4RHV1 2AEZA 1ENRA 1ULCA 4N43C 2WNUC 3RJ2X 3U07A 4YVWC 3HJRA 2HEVF 5FYZA 3TB0A 4ZS2A 2VUDA 5FV3A 3WUCA 4CEWC 3OGSA 2AYHA 2JX9A 3K77A 2RS33 4NPLA 3GGLA 1RL3A 2E63A 3NQHA 2R061 4HSJA 2WR9A 4DXSA 2F17A 4NN0A 1NKGA 2VE1A 1X8MA 2A3XA 3OYWB 3WDUA 1K45A 2GH8A 1LHWA 3IDAA 4LR4A 2CNAA 3ZYGA 1T2XA 2D43A 4QB2A 3C7EA 5FK7A 2HWC1 2JE9A 1ONAA 4AZZA 5C9AB 4DRVA 1TEIA 1JH5A 2RDSA 2GMEA 2WO1A 4LPLA 1B35A 1L3JA 4RQPB 3ASIA 4C0BA 1MS0A 3OB8A 3WINE 4C91A 5BNOC 1SLLA 3NV1A 2E7AA 3B02A 4OUEA 2WINB 3HVDA 3ZFEB 5I0UA 2XLFA 4HVQA 3FLTA 4ZY9A 4CPBA 2E6VA 3Q8FA 4PIYA 1CZTA 2CYFA 3AP6A 4LHLA 1NZIA 1KJRA 2HLEA 2DCTA 4KBZA 1QQP3 2UURA 4BU2A 4P9GA 1PIV2 4YM0A 1JYXA 4CVUA 5BNNA 5CISA 1WBFA 5I0RA 4IV1A 4GAZA 3S5AA 1VAMA 3JD71 5FP9A 2D6NA 4AXOA 2A5ZA 3CHXA 1MEC2 3O14A 3SH5A 4DXZA 1H2LA 1PO23 2Q1ZB 3C7FA 4CRQA 1QJY2 4FPGA 3I59A 5FZ8A 3TAYA 3T0DA 1UY1A 1US3A 4GMP3 5FZ0A 5JI7A 1AL21 3I2DA 2YY1A 3ZN4A 2ZEXA 4JGZC 1YQ5A 5C8CB 5A3NA 2VO5A 2OIIA 3HQXA 2JDAA 1CWPA 4FOWA 5BPXA 3GCWA 1GOGA 4OHVA 4INDA 4QKFA 4OUMA 2RMU3 4DNYA 2GDFA 2YC2A 4XDPA 4YM2A 5A33B 4PDWA 5EPAA 3KV5A 3KV9A 5ISLA 1QXJA 1J58A 2ZGMA 1VBD3 2EVXA 1JS9A 3VZMA 3WQ1A 3NNGA 4HPKA 4LORA 3H1YA 1XYOA 2LRPA 5E8AA 1MZ6A 1AX1A 1EUTA 1ULEA 2C9AA 3KCYA 3ZMOA 3N7KA 1TME2 4XILA 3N9MA 5E89A 4HVOA 2JEMA 1XNBA 5FZHA 1HB3A 2RS31 5FYSA 1QJX2 2C0ZA 1US2A 2PAMA 4XUTA 1F31A 2A7AA 4HBNA 1I9RA 1ZYBA 2OZ6A 1PHMA 2IVIB 2WWJA 2PHFA 3ON7A 3KHBA 1GQPA 2R0FA 2V4AA 1WMXA 1VAKA 1VBE3 4QU2A 4GJYA 5FP4A 5I93A 5FY0A 2GNMA 1OD5A 4PIXA 1GSLA 5BNPC 1UCXA 3B9CA 2XJPA 1QJEA 1E5SA 4GQ7A 2XGXA 1Y9MA 5H9QA 5TSWA 1Q43A 1N47A 1YIPA 4FFIA 5DAXA 2WWUA 1SPPA 4UFJA 5L9BA 1LECA 3M3EA 1NLSA 2VU9A 3CDZB 2D40A 4IL7A 3U14A 4H3WA 5JOYA 1QDOA 2BGPA 4Y22A 2VMGA 4QM9A 2PN5A 2K0GA 5F32A 3UNPA 2GU9A 4W6XA 4K21A 1GWLA 1X7NA 2BVBA 4MH0E 5FR3A 5FZIA 1JZ3A 2WC2A 4PCRA 1O8PA 1WMFA 3RMXA 3WD5A 1R1ZA 4P9XA 4X6RB 1QQP1 2HH9A 4Y5Z0 3IMMA 4Q4Y3 3NMBA 3I3MA 1PM7A 2RJ2A 1AR93 3I97A 3LD8A 2WA3A 3W58A 2IUWA 4AEDC 4A4AA 1EY2A 1V6JA 2VMDA 3H8UA 2TBVA 2WZEA 5BNNB 1JZ8A 1PO21 4CDQA 1S0BA 4IV1B 2C1FA 4NIIA 4MHRA 4JGYB 2P34A 1BK1A 1IKQA 3UK9A 3GF6A 4GMP1 4EWAA 1EUUA 3ZSMA 2VZ1A 1OA2A 2MPFA 4IEZA 4XFGA 2J42A 4D0QA 3I59B 2IXKA 1A6CA 1UY0A 1ZNPA 2AEYA 3RGBA 3SH3A 3FFQA 3BGAA 4AHYA 3WNMA 1S0EA 4XFIA 4XMAA 1FATA 4CXXA 5L36A 2RMU1 3X29B 4ZKTB 1YI9A 2R49A 3B9IA 2Z4FA 4EROA 2FCTA 4Z8BA 4UF0A 1VBD1 3A7QA 1QGLA 5JCTA 2HWE3 2A6WA 3VKOA 2CV6A 5L7OC 3AKQA 5GLVA 4I0BA 5JPNB 4PDWB 5IK5A 2VMCA 1VBA3 2ATFA 5FBZA 3USUA 3U1XA 3I3DA 1YQ8A 4HPKB 5C5TA 1RC6A 2W1WA 4P9LA 5IAXA 1MS1A 2YUEA 2QVSB 2IC1A 5FK8A 4LHNA 2FDHA 3ACLA 3BOPA 3WW1A 4AGVA 4LK7A 4OMCA 3DN7A 4GH4A 4QHBA 4EN6B 5IHRA 4HVRA 1NT0A 1PGSA 5EZWA 4IEQA 4ES8A 3VL8A 1GNHA 4CE8A 2JENA 4FQ4A 2DCKA 3VD7A 3AYDA 1UAIA 3HPNA 3HWJA 3WNNA 4MYEA 1TNFA 4FPKA 4BIFA 3SC7X 4NROA 1JYCA 4EZHA 2XBO2 1H1AA 3HOBA 3L9JT 1ZA7A 1G9FA 5FY8A 4OQ9A 3WQ7A 1Y7BA 4CP2A 3S5QA 5FPLA 1JTZX 4P9JA 1ZBA3 5C71A 2JDHA 1BKZA 4Q4W2 5LASA 3V0BA 3R4UA 2VCCA 2BTVC 1R64A 2J1AA 1DU3D 1SPPB 1H9PA 5FZ9A 1O4TA 5FUPA 1XNKA 3WF2A 1ND2B 5CEHA 4HK8A 1CJDA 5BY5A 4Y22B 2P6CA 3D8CA 3ILFA 3OD4A 4IEPA 3AP4A 1STMA 4F8AA 1NY71 5I8YA 5EYXA 4NRMA 5H9PA 4Q4Y1 4JQRA 3RPQA 1LAJA 2WNUA 1OLQA 4QQOA 1TMF3 1X82A 3B93A 1AR91 2LUWA 1W8NA 3I3EA 1VBB2 3MIEA 4CEWA 4CTEA 4QAWA 3OG2A 4CDUA 4XQDA 4YW5A 1W6QA 4QDQA 3ZN5A 5B2GB 3VBFA 4PJYA 2ENRA 1VIWB 1IOAA 1IPSA 2WBKA 3M7AA 4ASMB 4CPBD 4IGPA 1HLCA 2K46A 4BMEA 2VBPA 2G19A 2NMNA 3J9SA 4W4ZA 5GZDA 1WLCA 3ZYPA 1OXCA 4K20A 3M1HA 3IAPA 1KQRA 3AKPA 5A6QA 4YW3A 1M4WA 1XJAA 2LROA 2KM2A 1HB4A 1EAH2 1JYTA 1GOHA 1UMZA 3NW4A 1RMU2 4LULA 3MZHA 4LIUA 3WP6A 4DO0A 3IT8A 5A7PA 3ACHA 3G7DA 3NAPA 1F35A 1G9DA 1QMJA 1ACCA 3UESA 3KWVA 1W8HA 1ZRRA 3C8XA 4YG3A 1MS5A 2NM1A 4I30A 4M0HA 5BNOA 2HWE1 4QXKA 3RWNA 1NLRA 5AC92 2BBVA 2B9VA 4AI3A 4XZPA 1OPOA 4NIDA 3T4HB 1VBA1 1W99A 2X10A 4GWMA 3VBOC 1DYPA 4CP9A 1RVF2 1XNDA 3CLPA 2R062 5C3OA 1C3HA 3ETQA 4LUMA 1HQWA 1VR3A 2DVFA 1OFNA 3GHNA 4MOAA 1K5MC 3R05A 1Y43B 4XTPA 1UPIA 3USUB 3VZNA 1AUYA 4CCKA 2OUJA 1BEV1 4XTMA 1JZ5A 4R52A 2ZEZA 2ZS6B 1CIYA 1YO8A 1MPXA 2ZGOA 2R1DA 4GH4B 3RI9A 4WVZA 2Q1MA 4K1YA 1UX6A 2RV9A 3MIFA 5EXOA 1X33A 2GN7A 3LFIA 1PIV3 3HEIA 2LM3A 1F4HA 3A4UA 2BP6A 1J84A 2BV4A 3VDAA 4I0WB 1JODA 1RJ8A 1ZBA1 4KU7A 1Q8VA 2PHLA 3WQ0A 2JG9B 5F9TA 3VZLA 1W05A 2R0HA 1MEC3 5FJHA 2AR6A 1LHNA 2DVAA 3ZYIB 4JGZA 2QQLA 1Q8QA 4CYDA 5C33A 5JDBA 2DV9A 1COV2 1QJY3 1QOSA 4FOQA 2HEWF 4JDNA 4K40A 4AHXA 3ZFFC 1QY4A 2TUNA 1W03A 1OKQA 2VZSA 1CN1A 3V0BB 1HB2A 4GZ9A 1C57A 1OURA 1CAVA 4Q4V2 4XJ8A 1GP5A 4RYDA 3M3IA 1D2SA 4YZ4A 3WQBA 3CJXA 4JHTA 3J7MA 5C6CA 5IK8A 2VZVA 2XR4A 1GU3A 3J7NA 1GBGA 1YFWA 4JRAA 4MGKE 2NPIA 1IKPA 3E6DA 4QX8A 1TMF1 4QX2A 4ARXA 2ADEA 2VBBA 1Q3EA 4YW4A 1KDMA 1KITA 2D3SA 1UZYA 3TRSB 2D97A 2W68A 5CFDC 3E6CC 2GC0A 4KG8A 3MBWA 4N43B 2WNUB 3POBA 5T50A 4YPJA 4YVWB 1AL22 4A44A 1N1SA 4BXSV 3IDCB 5FFOC 4CEWB 1SHWB 3S0MA 3QACA 5LB6A 3UJOA 1TME3 3OJBA 1W6QB 3MV01 3S6PA 5A3LA 1QXPA 3CZJA 2J1RA 3RS6A 4MX3A 3AL6A 4YZ1A 3K3OA 1QJX3 3ZYHA 5BNPA 1UZWA 4QHOA 1PGW2 4AVVA 3O7OA 3U75A 4ZZ5A 1SCSA 5LCWL 4MLOA 4K8RB 2J22A 3L2HA 3AZZA 3I2FA 3ACIA 2RS13 1UYPA 2VZUA 1GZWA 1W8TA 2XHKA 2ZMNA 3JQXA 3WP4A 4BCUA 5KXBA 3BTYA 4FP3A 5SV5A 4I2OA 1KGYA 1XOYA 3J8F2 4J1WA 1DQ2A 3RYKA 1MVEA 5A32A 2VTXJ 4H2AA 4C1XA 3FZ3A 4NHKA 2YC0A 3WDVA 1Q56A 4BB3A 4ZPIA 3WUDA 4QKBA 1UD1A 2XLGA 5BNOB 3NV4A 4B7KA 1FMD2 2A6ZA 4A3ZA 4CXYA 3I8TA 3ZKYA 5GZGA 2JICA 1E5IA 5CA6A 4GB32 1HJGA 3LSEA 2ZHNA 3POIA 2F4LA 3U37A 3ZX7A 4QDSA 4CP9B 5JMCA 2CSGA 1XNTA 2HBTA 4K8FA 3AFGA 1W28A 1YIFA 4QT6A 4CDXC 3JXSA 4LK6A 4IDZA 2ZZQA 1W8OA 1L7QA 1WKYA 3U11A 4AEDA 3GYDA 2PHUA 2YYOA 2ZEWA 3QBQA 4DUWA 2K2SA 2JG8C 1V6LA 1PIV1 1KFXL 2H0BA 3CF6E 3MIBA 2WL1A 2ZGNA 2ZKLA 4U2AA 1OLME 2O0OA 4PLNA 3WW4A 4CP0A 5KXCA 1B35C 2HWD2 1TG7A 2HWF2 2DWRA 5F8PA 5DDJ2 4DINB 5KHKA 1MEC1 4D8MA 1DHKB 3F2ZA 2JKBA 1UOGA 1H6YA 4N7UA 2WFF1 4XJAA 5FYBA 5GZEA 1QJY1 1UYYA 4S2FA 4XJ9A 4LEJA 2GH2A 3I2HA 1J1TA 2ZEYA 4JGZB 2EXKA 3AK0A 2QQUA 1CVNA 4Z2AA 1IQAA 3WHUA 1YI7A 1CAVB 2XUEA 5L7OA 4WV8A 1MS8A 4FPEA 3VDDA 5GZCA 2ZOEB 2F4PA 3E5QA 3NV2A 2TNFA 3Q8BA 1DG6A 2YU2A 3P6BA 1CQ9A 2J1UA 2ARBA 4OUSA 4QD2A 4Y20A 3ACFA 1KEXA 3ALQA 3MGUA 3E6BA 3WCSA 4E2SA 2WIIB 3PTYA 2KXLA 1PMHX 4A7YA 3PUSA 4AFDA 1FXZA 4PF1A 2A3WA 1TME1 2NN8A 4EWEA 2QE3A 4DUVA 5KXEA 3LEGA 1VALA 3ZPOA 4KGGA 4IW3A 4MVTA 3G6JB 1QIQA 3B7MA 5FPZA 1J3RA 2RS11 4FPHA 3Q9OA 3P3NA 5BNPB 2D44A 1U5YA 4XVHA 3VN4A 3K75B 2X29A 5D2AA 4E4DX 4IGQA 2BYVE 1GZWB 4OHXA 4V2VA 3R6SA 2XDVA 2XBO3 1Y9QA 4BQ1A 3INAA 1W0OA 3GM8A 5A80A 2W47A 4QPGC 1GWMA 2AC1A 1DQ5A 3KGZA 4LBOA 4AWDA 3M3CA 5A32B 4IUGA 4AQ6A 1WZXA 4Q4W3 5FQ0A 4QPIA 2WKKA 4IE6A 1NYWA 4IE7A 4SBVA 2NMOA 3SMHA 3ZDVA 4Y5TA 4A7ZA 3CEWA 2P3YA 2DBNA 4M0NA 4QKNA 1N3QA 5FRAA 3VHOA 5FBJA 3OSDA 2B45X 4ITCA 4P00B 1AVBA 5DUVA 3FL7A 1WCSA 3HR9A 1DQ4A 1MZ5A 1W9TA 2DU1A 1O7FA 1YUDA 2QFEA 5FZAA 1XQNA 4FT8A 1BMV2 1QNWA 4A41A 4BQ2A 1PZ8A 1J3QA 2OPWA 2Y60A 4E4ZA 1OOPC 4CU8A 5KC6A 4AEDB 5L9RA 2JE8A 4COWA 3UL2A 2ILMA 1LHVA 1LOFC 4E2GA 2PLV3 2WZPP 4FOYA 3WDTA 4AEJA 1DQ0A 1H2NA 1ND3C 2B46X 4IEUA 1VBB3 3NKGA 4S2GA 2VY0A 4W65A 4GA9A 5FZ3A 2CAUA 2UYAA 1V70A 1Q8OA 1PMIA 3EB7A 4N8MA 2BNNA 1OD3A 4CCLA 4L92A 4XAAA 1GQGA 3UGHA 3T2QA 3VDCA 4XIOA 1BBT2 1RUJ2 4A2UA 3VHPA 2N7GA 5G04L 3VL9A 5FZGA 2VQUA 1EAH3 1LOCA 3HN1A 1FOD2 1NOVA 1RMU3 4ATFA 2GP3A 5C8WA 4OYUA 3K51A 2IXLA 3LEIA 3VBOA 1DDLA 2V09A 4HKWA 1W9WA 2W1SA 2XL9A 5L7OB 4Y1ZA 1DLCA 4XPVA 2XUMA 5A7WA 1T6BX 4FPYA 5DZGA 5AC93 2HYXA 1K5MA 3AKTA 3AYAA 4LBLA 5FUNA 4OZOA 4JTOA 3BKZA 3A22A 4Q4X2 1OLRA 4W6WA 4Y20B 1RVF3 5EQUA 2R063 4XUNA 2QQOA 1JN2P 2BGCA 2WSVA 1SCRA 2QDNA 3D0JA 3LA3A 2DUOA 4NRPA 2JD4A 3T09A 1LHOA 2OKXA 3LEKA 1C1FA 4NHYA 5FMDA 1YQCA 1PK6C 2GAUA 1X36A 3IN9A 2CDOA 1AR83 3ECQA 4XOGA 3RNSA 1ULOA 5DUWA 2QQNA 2ARAA 2BRTA 1SLBA 1S0CA 3IIAA 5EIYB 5C7GA 2P4EA 4CCOA 5FO8B 2XBO1 1OBNA 4J1XA 4QXCA 1H1IA 2OPKA 4LBKA 3GCXA 1SBDA 3ZFFA 4NE9A 5HV4A 1BEV2 4Q4W1 1JZ2A 3AMQA 4FI9A 1O59A 3DL3A 1OF4A 1LTEA 4FFGA 5HBAA 1COV3 3ZIWA 5C70A 1Y3TA 2YGMA 1BVVA 2ZCWA 1H8VA 2EAAA 4HG6B 4F3JA 3SCGA 2V72A 2NLRA 2V5DA 3IZOA 1OVPA 1XC6A 5JIAA 4AE2A 2Z42A 4NAOA 4Q4V3 5GKAC 1JOBA 5K8SA 4JVAA 2GMPA 4YFZA 5LBBA 1CX4A 5CFDA 2VZ3A 4D6QA 3QCWA 4N7IA 4JDOA 3K4ZA 1G6NA 4XFFA 2PLV1 2P17A 1C1LA 4R9DA 4Q0VA 4CUCA 3NJYA 1VBB1 1K5JA 3GNEA 3POYA 4AFMA 2F6BA 4WZFA 4FXKB 3D6EA 2H0VA 2VOVA 4B8EA 5A7OA 3OF1A 3KSCA 2ZGLA 1ODNA 1TZOA 4GALA 5FZDA 4XUOA 3ZXDA 3WG4A 1NG0A 1JU3A 1JHJA 3LDRA 1RITA 3BB6A 3DYPA 4BIOA 2O14A 5DPNA 1R092 1DGWX 1RMU1 1UKRA 1W8FA 2AZ5A 1ENXA 2WFPA 4GD4A 4UFIA 4XUQA 3T08A 1SDDB 3N7LA 4XHBA 4ZXEA 3LSDA 2ZHMA 1QJFA 3ZYJB 1U5XA 1UF2C 1AF9A 2BFUL 2VECA 3J8F3 1MR5A 2ZA9A 5AC91 1DF0A 3DKQA 3FJSA 5DAQA 4KH9A 3VBOB 1NA1C 4HOOA 5FCCA 4Q0PA 3JB8A 1EYBA 4CDUC 1AL0G 5FYIA 1RVF1 3VBFC 5LA9A 5A7WB 1FMD3 4CDXA 4YVSA 1K5MB 4PF5A 3WW2A 2LALA 3IPVA 4GB33 1A3KA 2VNOA 4J25A 2BFUS 3BI3A 4Q8LA 3PMSA 4GKXA 1XSRA 3N9LA 4XBQA 1LR5A 1N3PA 2IXHA 2JG8A 4OVEA 4LO7A 4LO5B 3ROUA 4AGGA 2C5DA 5DN2A 5JXIA 1AR81 2DURA 2TEPA 4LOSA 3GBWA 3NAPC 3I2GA 3O1UA 1ST8A 2D3RA 1BVP1 1O3SA 1ZBE2 4M3CF 2G9GA 1XU2A 2BWCA 3I3BA 2E53A 3EHKA 1O3TA 4HN0A 2IWGB 5A7NA 3IWZA 3VBSC 2KA3A 2HWD3 4TYSA 3KT1A 2HWF3 1Y9GA 3IM0A 5DDJ3 4LBQA 2VULA 5LRSA 3O5SA 5GLZA 2XG3A 3ZFFB 1COV1 2W1QA 4KGQA 3WP3A 5JXJA 1QJU2 1PX4A 4BQWA 2B42B 2VBDA 4MZUA 2W08A 4Q4V1 1YC61 1LOGA 3CNAA 4B1LA 3C7OA 2VOKA 4W50A 2OZJA 5FMOL 4AK3A 3DV8A 4JX0A 1TE1B 5FZ6A 2Y0OA 3ZXGA 3B69A 5A3UA 5I0SA 1O5UA 2XPJA 1ZZBA 5AVAA 3IKWA 3CJIC 2A6YA 1LOEA 2ARXA 2BWAA 2WFF2 4MO3M 5CFDB 1RIRA 2Y64A 3PDQA 2FQPA 3ILNA 5FP3A 4BWOA 2EXHA 3AMMA 4DOUA 5F37A 3JUUA 2BUKA 1RUI2 3PU8A 4WM8C 1AR71 5A3MA 4MGTA 2AENA 5J98B 5T5JA 4TZDA 2NP0A 4E4HA 3H8RA 4QGMA 1UZZA 4AYUA 3LA2A 3T0BA 2Y34A 3ZYFA 1TVGA 1NXD1 1UU4A 4Y3OA 2IXCA 1PGW1 2DVGA 2O8OA 2X8KA 3AP9A 5FLIA 3ZKUA 2VAUA 4H7MA 1RUF2 2VOTA 2LTNA 3Q8AA 1LKNA 3NNLA 4LQRA 3JQWA 1RUE2 4QPGA 2W52A 2VMHA 1ALYA 3J8F1 2A1XA 3DGTA 4BOWA 2VCBA 2JJ6A 5LA1A 1G8WA 4MGIE 4ZZ8A 1GZ9A 4D69A 3H0OA 3H7YA 1HW5A 1LGCA 1DGRA 1IS4A 3O1MA 4D7TA 2EIGA 4QB6A 4UBHA 2GC2A 2VNVA 1FMD1 5FYHA 2OXBA 3VDBA 4GB31 4NPMA 2RS12 2D93A 5H9RA 1DGRN 2XL7A 1WD3A 4Y1YA 3SQOA 4CDXB 5FZKA 3O1RA 2W46A 1ZRFA 4AI2A 2VMFA 4YG6A 1OOPA 4DEQA 4JRLA 2X5IC 1DP0A 1LOFA 4COVA 2PYTA 2Y0IA 5FWJA 3WX5A 1ND3A 2JG8B 4Z2WA 2D6OX 1C4RA 3I4IA 4HN1A 3ZN6A 3WNOA 5J37A 4HK9A 3POEA 1B35B 4JKLA 4DZGA 5FZOA 2HWD1 3KCCA 2HWF1 1W2OA 5DDJ1 3HQRA 2FCVA 3U4XA 4YG0A 1L7RA 1AYN2 1CAUA 1K12A 4GXLA 1FPN2 1ASJ2 4I01A 4LBQB 3PLQA 1LODA 4EQVA 3I2OA 2R30A 2XWBB 3F95A 4NHMA 1PX3A 1W8WA 1K42A 1RB8G 3VB9A 1CAXA 1BBT3 1RUJ3 2E31A 3KCXA 4JQTA 4UFKA 1OUXA 1D2QA 4LOTA 4QM8A 5I91A 1FOD3 3KQRA 4D94A 4LT5A 3UV9A 4DIQA 3O0VA 5FOJB 2D6LX 1ZZ7A 4PLMA 4E8CA 1JHNA 1MZFA 2GALA 3SKJE 4BMBA 2YG0A 4HFSA 2WNEA 3I49A 1WGPA 1V6OA 5DQ0A 1MVQA 2R16A 4Q4X3 1UO9A 3N7MA 1O4YA 2VZTA 3VD5A 2BPA2 2XVGA 3WZ1A 5D1IA 1YJKA 3O1SA 1PK6A 1XE7A 2DTYA 3FFZA 3JBG2 4QX1A 1OHFA 4AW7A 5CU1A 2PFWA 5LEKA 2FD8A 2VTFA 2E7TA 4EN9B 3BYWA 3EJKA 3NNMA 1CJPA 5FZ4A 5IYYA 1DIWA 4UXAA 5JXGA 3PL0A 3WP5A 3N9NA 1AX2A 4LNVA 4A6SA 2YDEA 2WT1A 5GM0A 4BQXA 3VDDC 4B3NA 1QOTA 4IV3C 1LEMA 2DVDA 1A34A 2CGNA 4E4SA 2VXRA 4QPGB 2HBUA 3ZOIA 2ZGUA 2ZX3A 2OYZA 3GBFA 4QX0A 1BEV3 3SXWA 5FOBB 3MIGA 2W5FA 2A73B 1CIWA 4N90A 2B39A 1C28A 1W90A 4NJ4A 2VCMA 1IS3A 4A7KA 5IVBA 1O4ZA 2PXJA 3BTZA 3MDPA 1ZX5A 3LWCA 2DCJA 1UY4A 5FPBA 1AYM2 4IE5A 1BMV1 1OOPB 4XIKA 2IXJA 2VG9A 5AVPA 1K3IA 5A6XA 1G9BA 1T6GC 1GYKA 5GJ6A 1ND3B 2ID4A 4JC1A 3PVBB 2VL4A 3ZN6B 2XWJB 3VKLA 3S7IA 2ZZJA 5LY1A 2Q8DA 1OPMA 2DVBA 2HKXA 4KBBA 4AFCA 2Y38A 1YFUA 3MW2A 1XNAA 4QPIC 4BK5A 2A70A 3ZM8A 1H6XA 2XJQA 2I07B 3VBRC 3BOWA 5DAVA 1CAUB 2PELA 2WLPA 1NZCA 5A3TA 4RGKA 5GALA 1BBT1 1RUJ1 2DYCA 4Q26A 1UX7A 1R093 5IAVA 1GV9A 2PLV2 2PHTA 1WWYA 3BIWE 1BQPA 3DEMA 3I3QA 1JOPA 3HQUA 5I8SA 1MS9A 1FOD1 1QHDA 3B00A 4XFCA 1S2KA 1NA1A 3ZFGC 4KQ7A 4BZ4A 1GFF2 1PZ9A 1CAXB 5FZCA 4ASLA 4OHYA 1NCQC 3H3ZA 1XNCA 4I09A 4YZ3A 1SLIA 1Q8PA 4PLOA 4LBQD 5JAXA 1WA4A 5F2SA 2RJLA 2YV8A 4U36A 4JDMA 5EJZB 5FZBA 4Q4X1 5J36A 4OQ8A 5CYYA 3OOXA 2VD7A 4AI8A 2RJKA 3KF5A 5C3SA 1S0FA 1IPKA 4R9AA 4CUAA 3FN9A 5JXHA 4XC9A 1AJKA 1PK6B 1GP4A 2OQ6A 1SZBA 3N7JA 4LKDA 5FY5A 2CDPA 2FZ2A 2XKPA 5DAPA 4L2NA 3VBSA 3S30A 3ZSJA 3S57A 5E1RA 4CCNA 4UF0B 5BV6A 4BE3A 5FDBA 1ZBE3 4AQ2A 4ES9A 1EPWA 4R8HA 4ZS3A 1QWRA 3ITQA 5DXDA 3AL5A 2VJXA 3JU9A 4FTEA 4Q5OA 4FTBA 1RUH2 3OBZA 5DABA 4AOCA 3C3VA 1XE8A 4L11A 3K4AA 1PVC2 1RINA 1NE6A 4BH9A 4WVWA 1AR82 1A8DA 3GZTB 4FQZA 3N9OA 1QJU3 3WNXA 3PHMA 4BQ5A 5JI9A 4BQ4A 1APNA 2QQWA 5FY4A 4Y26A 3CJIA 4GWNA 3WF4A 3ZLIA 4CCEA 2GNDA 3SLIA 4CDWC 5IFTA 4K6BA 3TWIA 3W21A 1LRHA 1FNZA 1LOAA 3E97A 1Q8SA 3VD4A 3LA7A 1O91A 1X9PA 4WM8A 4Q0QA 5ABJA 2WFF3 4AQTA 5LATA 4YNIA 4NWVA 4YZ2A 2WYFA 3FC0A 2FBEA 1J59A 1HKDA 4NIGA 5FP7A 2RDRA 4AF9A 3H9AA 4MSVA 1IG0A 3GZEA 5IVYA 4URTA 4P14A 5CVRA 1RUI3 5HCHA 4XF9A 2JECA 2MEV2 1YJLA 3D4KA 1DGWA 1ZZ6A 1HV0A 1N3OA 1GNYA 1SFYA 5J96B 3MW4A 1R091 3AB0A 2WAAA 5E16A 3C7GA 1NQDA 2CWSA 3I2KA 1AR62 1H8TC 1HN1A 1MZEA 1UMHA 2VVDA 3OEBA 3MV11 4NHXA 4QX5A 2OA2A 5FLJA 1RUF3 4ORFA 4URAA 4XE9A 1RXFA 1FAYA 2QJVA 1RUE3 2WZR2 1AR72 4QPYA 1NA1B 3T0AA 3CBNA 2BQPA 4CDUB 2CHHA 2PHRA 4UW5A 3VBFB 3B01A 2JDPA 4QDRA 2JB4A 4MXVA 5FZEA 1FI2A 1YEWA 3CQOA 4AHWA 3AJZA 3GJBA 2XONA 5L73A 2X5IA 3PJQA 2H6BA 1KD7A 2IFRA 4WBBA 2WSUA 2ADDA 2ZX1A 5FPVA 1W8ZA 4UAPA 1IPJA 5AFEA 1VRBA 2P5BA 3VBHC 5C3QA 3RZGA 3KM5A 1HB1A 3LPFA 3ZPYA 4JKMA 3NAPB 5IJRA 4UT5A 1GLHA 2W87A 1RUNA 1B09A 2CWMA 2BOJA 2XXZA 2YBPA 3GXUA 1ZBE1 1VJ2A 3MLKA 4JV4A 4MGZE 1POQA 5JR7B 1QNYA 4RA0A 5EHDA 1JYVA 4CCCA 1W9SA 5K0UC 1RXGA 3KMHA 4N53C 4PHZA 5K4LA 3VBSB 3LB9A 3POGA 4MG2A 5KHHA 1LOBA 4A45A 5IVJA 1DBNA 2DFBA 1X8EA 4B1MA 2VPVA 4OI2A 1J1LA 3R0RA 4YVSC 1KJLA 2P2KA 1LNSA 4OI4A 1AYN3 4AVSA 2VVEA 2ZPXA 3BALA 4R4XA 2MHFA 1QJU1 2RE9A 4XJZA 5D21A 1FPN3 4LLOA 1ASJ3 2MNGA 1DZTA 5JR2A 5M0TA 1SEFA 4NVPA 4MGYE 4W8JA 1C5IA 2VW2A 2FHRA 2XHNA 5EP9A 1RYYA 5ACA2 3UKVA 1W06A 1URXA 5LK5A 1KFUL 4YM3A 1EPZA 3PURA 3LOBA 5LY2A 4OHZA 1SACA 2UY9A 1UNBA 3RZMA 5BYNA 1OA4A 3WY6A 3ZIXA 3WW3A 3ME2A 1U5ZA 5IT6A 4TXWA 4HANA 3D0SA 5F3CA 3O12A 3DECA 4L99A 5T3NA 4CXWA 3HD8B 4WM8B 3LKJA 4GKYA 3M70A 4RR3C 5LBEA 4BA6A 5JOZA 4GIQA 2SLIA 1RUI1 5LEJA 3HMYA 3Q8CA 1FX5A 1MS3A 4FPFA 1XYPA 2UWAA 3LIGA 5CG9A 2D5HA 2CY6A 2HEYF 2LW8A 1H2MA 3WG1A 3LAGA 1UU5A 1REFA 1FV3A 3EQEA 4FFHA 3JBG3 2HWB2 1NE4A 4XXAA 4MUVA 3DUIA 1YHFA 3R4SA 1SBEA 4FP2A 3MYXA 2SBAA 3URFA 4COYA 5DAWA 1VB2A 4IV3A 3RYRA 3SNMA 5F3GA 3E5XA 1XBFA 2WDBA 3OGJA 1RUF1 2Q4SA 3FE5A 1ULPA 2WS92 3VGIA 5KHIA 3ORJA 3OY8A 2B8MA 1VMJA 3WOGA 1RUE1 4AAPA 4IE4A 5A70A 5AFBA 1CX1A 2VC9A 2ZGKA 3BPZA 3LDBA 3UKNA 4XQ4A 5LWBA 4PQQA 1AXKA 4LA2A 3V65A 2JE7A 5L19A 5F6KA 1QKQA 3KQ4B 3H50A 5IFPA 1JOJA 4DS0A 1HX6A 1QH6A 2YC4A 3THTA 2VMEA 5KR7A 2VUJA 5FKBA 4XF4A 2CL2A 4JCKA 1Q5OA 2Q1FA 2EXIA 2RS51 4IXLA 3SEPA 2ZX2A 1I5PA 3PNAA 3AZWA 4EN0A 2UWCA 2X5IB 1YFXA 5FZ1A 2GC3A 1KS4A 3V0AA 1W6NA 2BVVA 5G05L 1OVSA 1ZVFA 1W2UA 2ZMLA 1TQ5A 4YW2A 1AYM3 2ZGQA 4UI9L 1RGSA 1UY3A 1QOOA 4KWUA 4IEYA 2A6XA 3BVCA 5LW9A 1GZCA 2IZWA 3MEPA 4FPOB 1SFPA 4XCBA 2JD9A 4OULA 4Q27A 3U4SA 4KMQA 3VBRA 3K48A 3JCIA 5FY7A 4LO6B 4OLLA 1UIJA 3H42B 3NVCA 4XFBA 4UOJA 5T55A 3UETA 3O1PA 3L2YA 1AYN1 2PHDA 3FHAA 5BNQA 2RR12 4XETA 5IVVA 5K9YA 1FPN1 1ASJ1 2E33A 3AC0A 4LJHA 4PT6A 5FIXA 2BEOA 3GDBA 3ZFGA 4ZU7A 3ZXKA 5ERLA 3AXDA 3LE0A 2A75A 4RS5C 1PM4A 2XQXA 4CEYC 4CCMA 1NCQA 4YARA 5JIUA 5JSOA 4AHZA 3MF9A 2EA7A 2XB6C 4LLFA 4NAMA 1W3XA 3MHZA 2FDKA 1UU6A 1UKGA 3MIHA 4Q29A 4UFLA 5SV8A 4AI1A 4WVMA 2YGLA 3KF3A 4IGOA 3RYPA 4I0AA 1S4CA 5J1XA 3HBZA 4AVAA 4B29A 1JXNA 5FTTC 5HPOA 5BUVA 5JWPA 4QMAA 5T5LA 3SITA 1D0GA 4LMFA 1WCKA 3I7DA 3U0ZA 3DYOA 4NRQA 2B9UA 2KD7A 3VKNA 3SHRA 1CONA 3JZVA 2R1BA 3LZZA 3OBAA 4OZXA 2E26A 3NL1A 3JBG1 4M3CE 1BYHA 4FPCA 2DBIA 3LIHA 2DF7A 4AQSA 1GP6A 2VZPA 4META 1LU1A 1WCUA 3JB4C 3NO8A 4KI5M 2ORZA 5CKNA 4A42A 1UY2A 4RN5A 3VDDB 2WNVA 3WVJA 4IV3B 5EFUA 4ASKA 5F5QA 5JZGA 1OC1A 2O1QA 3KT4A 4NIAA 2PMWB 4E2QA 5LRRA 1W6OA 4UW6A 2WJSA 3OY8B 5F3EA 3PU3A 5GLUA 4ET7A 3KGLA 2WQ4A 1RUH3 2VOXA 3PIJA 3QD6A 4Q8KA 5D8AC 1ENSA 5CB7A 4QQ2A 1QXRA 4H14A 3WCRA 4M4PA 3TEXA 2UY8A 1IG3A 1PVC3 1KS5A 4HKOA 3QLQA 2PA7A 4LE4A 4Y1VA 3RWKX 5F7UA 1Z7S2 1VLNA 1QDCA 4XYXA 1YQ2A 2W9XA 1CESA 1WW7A 2WQ8A 1CR7A 4HMZA 1GANA 2UYBA 4Z07A 4CDWA 4EWDA 3EMRA 2AGSA 3BCWA 3O1TA 4OI0A 1WW5A 4MADA 1I6XA 1I5ZA 1V6NA 4AFBA 3IMNA 1W2AX 1AYM1 2D98A 3V0AB 3KV4A 2WZ8A 2ZX0A 1W6NB 4Y4YA 1OH3A 3LFMA 4NOTA 1V6IA 4RFT0 2QNKA 5LBFA 2PAEA 3AFKA 1OT5A 1EP0A 3A0KA 3AZXA 4BYYA 1GQHA 1OUSA 2X53S 1O6UA 3WV6A 4DB5A 3FBMA 3PVEA 4QPIB 3OGGA 2W92A 2JDUA 5FQ0B 4D3WA 5C4WC 5KWRA 3E1F1 1NUKA 2FZ1A 2C6SA 1SQ4A 4LO8A 3VBRB 1I1EA 3IB3A 1H8TA 2HYKA 1FNYA 3IIIA 2MEV3 2VNGA 4QHZA 2KR2A 4TTGA 1O3RA 1PMJX 4FOVA 1PNGA 2E51A 2FDJA 4GJZA 3LGRA 5CNAA 2VZRA 3H3UA 3O0XA 4EYUA 4CUBA 2Z2SB 1AR63 3A23A 3ZFGB 1CAWA 2Z5WA 3NSTA 4FCAA 3ZXJA 1CZSA 3V64A 1YCIA 1NCQB 4K7JA 3CO2A 3HAGA 3MO4A 3ZDSA 3O1OA 5A7QA 1DCSA 1R081 1UPSA 1VMHA 2Q0AA 5KBFA 3QH6A 2QQJA 2WZR3 1AR73 2W95A 4A6OA 2PHXA 4WVMB 3RZJA 1BJQA 2VZQA 1OQEA 2GC1A 3ZO0B 1E57A 1S1AA 3WF1A 5B4XA 3U10A 1LHUA 2PTMA 1IZ3A 3LPGA 1VMFA 3IDEA 4R9BA 3VBHA 4XJUA 1C5HA 4C0HA 2BNMA 2K9ZA 4LBJA 3H1MA 4CU7A 1Z78A 4NMIA 4OCTA 2FDGA 1QJZA 2YXSA 2X09A 4HKLA 5KHJA 3K2OA 3MI8A 3AKSA 5FYVA 1XXNA 5K0UA 4N53A 2H6CA 2ETEA 3DCQA 1HN0A
chains in the Genus database with same CATH topology
3PUIA 5EJ1B 3HEIA 1F4HA 3CMGA 1D7PM 3VDAA 1J84A 2X05A 3WNLA 4E8CA 4CU6A 2BZDA 3SKJE 2YG0A 1WCQA 5DQ0A 2EIBA 2QQLA 3FHQA 2BBAA 4MGSA 2VZTA 3VD5A 2ORXA 4DXTA 4DEVA 2VZSA 4QX1A 4GZ9A 1JYWA 3W5MA 2VTFA 3THDA 1CZVA 2C26A 4M4RA 4RYDA 5IYYA 5JXGA 3WQBA 3HNMA 2VZVA 1GU3A 3CZUA 4QX2A 4ARXA 1JZ4A 3MBWA 2QBXA 4YPJA 2Y6HA 4A44A 3OGRA 4BXSV 4QX0A 4P08A 1SHWB 1NAEA 2W5FA 3MV01 2W94A 2VR4A 3CZJA 4ARYA 2J1RA 4LHSA 4DXRA 3A21A 1J83A 4OMDA 2YFUA 3PUHA 4ZZ5A 5LCWL 2J22A 3I2FA 3ACIA 2VZUA 2QQKA 2DCJA 1UY4A 4JHZA 1KGYA 2V4VA 1K3IA 3J7HA 2Y8KA 2EICA 2ID4A 4XUPA 2VL4A 4MGQA 1JZ6A 4A3ZA 3HN3A 4BK5A 1XNAA 3U37A 4QDSA 1UYZA 3OEAA 1XNTA 3ZM8A 1H6XA 4LKSA 3JXSA 1UX7A 3P1IA 1W8OA 1L7QA 1WKYA 2ZEWA 4DUWA 1JU4A 3CIHA 4JKKA 3NJXA 3MUZ1 1TG7A 4D8MA 2R7EB 3F2ZA 5EJZB 1H6YA 4AG4A 5B4NA 1F4AA 1UYYA 5CYYA 3IAQA 3I2HA 1GUIA 2ZEYA 3DYMA 4CUAA 3FN9A 5JXHA 2VM9A 3VD3A 4Z2AA 2CDPA 2J1VA 4P02B 4BDVB 3P6BA 4GWIA 1DYOA 2J1UA 2VJXA 3ACFA 1KEXA 1PMHX 3SEEA 3K4AA 4PF1A 2J7MA 4QX3A 4DUVA 3LEGA 3WSOA 2C9KA 3THCA 2VZOA 1BHGA 2Y6JA 3WF4A 2WO2A 1OF3A 3CKHA 5FUIA 5IFTA 4XVHA 3K75B 2WN2A 3VD4A 1GMMA 2E32A 3GM8A 3MUY1 2W47A 1UYXA 4IUGA 3HNBM 4GWJA 3HJRA 3OGSA 3EYPA 2YFZA 3K77A 3GGLA 1JI6A 3NQHA 4P00B 4DXSA 1GNYA 3FL7A 2WAAA 1NKGA 3C7GA 3I2KA 3K46A 1W9TA 1GOFA 3WNPA 1HN1A 1UMHA 1K45A 3OEBA 3MV11 3IDAA 4A41A 1T2XA 2ZXQA 4QB2A 3C7EA 4CU8A 2JE8A 2WABA 3T0AA 4LPLA 2WO1A 2VQTA 3OB8A 4QDRA 2WO3A 3CQOA 4OUEA 3EB7A 1OD3A 2XONA 4ZY9A 3T2QA 3VDCA 2J1SA 4UAPA 1CZTA 4AAXA 2B4KA 5G04L 3LPFA 1UXZA 2VQUA 4JKMA 5IJRA 2W87A 2HLEA 3BN6A 4OYUA 3GXUA 3LEIA 1JYXA 1W9WA 2W1SA 4CVUA 1JYVA 1DLCA 2JKXA 1W9SA 2BERA 2HYXA 4OZOA 4A45A 3A22A 3C7FA 2EIEA 3SKVA 4XUNA 2QQOA 1LNSA 1O8SA 3T0DA 1OH4A 1UY1A 1US3A 5JR2A 2ZEXA 3VD9A 2VO5A 4W8JA 2XHNA 3T2PA 3T09A 2JDAA 1RYYA 2OKXA 4BJ0A 3LEKA 1GOGA 2W91A 2CDOA 3ECQA 4L0PA 1ULOA 2QQNA 2YC2A 5EIYB 5C7GA 4TXWA 3NNGA 3DECA 5JMOA 1EUTA 1JZ2A 4FI9A 1O59A 2W1UA 1OF4A 3WEZA 2LW8A 5C70A 4HG6B 1US2A 4XUTA 2V72A 2YB7A 2V5DA 4P5YA 1XC6A 2J1EA 1GQPA 2VZ3A 2WDBA 1ULPA 3NRUA 3K4ZA 1CX1A 2VC9A 4XZUG 4CUCA 4PQQA 1IQDC 5IFPA 4XUOA 3CDZB 2YC4A 1JU3A 1JHJA 2VMEA 2BGPA 3DYPA 3WF3A 3UNPA 2DDUA 3SEPA 5DPNA 1JZ3A 1I5PA 2XOMA 1O8PA 3WF0A 5G05L 4XUQA 3T08A 1SDDB 2Y6GA 4ZXEA 4UI9L 1UY3A 3ACGA 2RJ2A 3I97A 4KWUA 4A4AA 2VMDA 1P8JA 2WZEA 1JZ8A 2JD9A 4KMQA 4UOJA 3UETA 4E8DA 3HNYM 3FHAA 2C4XA 1EUUA 2WYSA 2VZ1A 3I2JA 2E33A 3AC0A 4PT6A 4D0QA 3GDBA 3LE0A 1UY0A 2J1TA 2XQXA 1UWWA 3BGAA 2Y6KA 5DN2A 5JXIA 3WNMA 1W0NA 3I2GA 2Z4FA 2VCAA 3I3BA 5J1XA 3A7QA 5HPOA 5HXMA 2VMCA 4CU9A 3DYOA 3I3DA 2KD7A 1UMIA 2W1WA 2Y6LA 3I2IA 5JXJA 2W1QA 3OBAA 5I0DA 2E26A 1PX4A 4OMCA 5IHRA 2VZPA 3C7OA 4W50A 4KI5M 2DCKA 2ORZA 4JX0A 3VD7A 4A42A 1UY2A 3WNNA 3HPNA 4RN5A 2QQMA 1XPWA 4MO3M 3HOBA 3WNKA 2L9LA 2WAOA 1JZ7A 2WN3A 2Y64A 4ET7A 5CZKA 3C7HA 3ETPA 5C71A 1NX9A 3W5NA 2VCCA 4M4PA 1R64A 3LQCA 5F7UA 2J1AA 5DMYA 3T0BA 1YQ2A 2W9XA 1UZ0A 2WQ8A 3WF2A 1TVGA 4QPWA 4MADA 2VOTA 2PQSA 4LQRA 5JUVA 2WZ8A 2VCBA 5LA1A 1W8NA 3I3EA 4ZZ8A 1OT5A 4QAWA 3OG2A 4XURA 4QDQA 2BGOA 2LS6A 2RVAA 4QB6A 2W92A 2W3JA 2WBKA 3E1F1 1NUKA 1JYNA 3VDBA 3T2OA 4W4ZA 3IB3A 2WUHA 3IIIA 3IAPA 3D3AA 1SG3A 4TTGA 2W46A 1PMJX 3NJVA 2VMFA 4DEQA 1GOHA 2VZRA 5LA0A 3OGVA 4CUBA 1DP0A 3A23A 3ACHA 5A1AA 3UESA 1CZSA 3C8XA 4QB1A 3MO4A 3WNOA 2B9VA 2QQJA 4JKLA 2W95A 4A6OA 1W99A 2X10A 2VZQA 3K4DA 2QQIA 3WF1A 2EIDA 5LA2A 5B4XA 1L7RA 1K12A 3LPGA 4MOAA 4CU7A 4BK4A 1JZ5A 2ZEZA 1PX3A 2X09A 1UXXX 1CIYA 1K42A 2E31A 4DUXA 1MPXA 3ABZA 2RV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUI A;  5EJ1 B;  3HEI A;  1F4H A;  3CMG A;  1D7P M;  3VDA A;  1J84 A;  2X05 A;  3WNL A;  4E8C A;  4CU6 A;  2BZD A;  3SKJ E;  2YG0 A;  1WCQ A;  5DQ0 A;  2EIB A;  2QQL A;  3FHQ A;  2BBA A;  4MGS A;  2VZT A;  3VD5 A;  2ORX A;  4DXT A;  4DEV A;  2VZS A;  4QX1 A;  4GZ9 A;  1JYW A;  3W5M A;  2VTF A;  3THD A;  1CZV A;  2C26 A;  4M4R A;  4RYD A;  5IYY A;  5JXG A;  3WQB A;  3HNM A;  2VZV A;  1GU3 A;  3CZU A;  4QX2 A;  4ARX A;  1JZ4 A;  3MBW A;  2QBX A;  4YPJ A;  2Y6H A;  4A44 A;  3OGR A;  4BXS V;  4QX0 A;  4P08 A;  1SHW B;  1NAE A;  2W5F A;  3MV0 1;  2W94 A;  2VR4 A;  3CZJ A;  4ARY A;  2J1R A;  4LHS A;  4DXR A;  3A21 A;  1J83 A;  4OMD A;  2YFU A;  3PUH A;  4ZZ5 A;  5LCW L;  2J22 A;  3I2F A;  3ACI A;  2VZU A;  2QQK A;  2DCJ A;  1UY4 A;  4JHZ A;  1KGY A;  2V4V A;  1K3I A;  3J7H A;  2Y8K A;  2EIC A;  2ID4 A;  4XUP A;  2VL4 A;  4MGQ A;  1JZ6 A;  4A3Z A;  3HN3 A;  4BK5 A;  1XNA A;  3U37 A;  4QDS A;  1UYZ A;  3OEA A;  1XNT A;  3ZM8 A;  1H6X A;  4LKS A;  3JXS A;  1UX7 A;  3P1I A;  1W8O A;  1L7Q A;  1WKY A;  2ZEW A;  4DUW A;  1JU4 A;  3CIH A;  4JKK A;  3NJX A;  3MUZ 1;  1TG7 A;  4D8M A;  2R7E B;  3F2Z A;  5EJZ B;  1H6Y A;  4AG4 A;  5B4N A;  1F4A A;  1UYY A;  5CYY A;  3IAQ A;  3I2H A;  1GUI A;  2ZEY A;  3DYM A;  4CUA A;  3FN9 A;  5JXH A;  2VM9 A;  3VD3 A;  4Z2A A;  2CDP A;  2J1V A;  4P02 B;  4BDV B;  3P6B A;  4GWI A;  1DYO A;  2J1U A;  2VJX A;  3ACF A;  1KEX A;  1PMH X;  3SEE A;  3K4A A;  4PF1 A;  2J7M A;  4QX3 A;  4DUV A;  3LEG A;  3WSO A;  2C9K A;  3THC A;  2VZO A;  1BHG A;  2Y6J A;  3WF4 A;  2WO2 A;  1OF3 A;  3CKH A;  5FUI A;  5IFT A;  4XVH A;  3K75 B;  2WN2 A;  3VD4 A;  1GMM A;  2E32 A;  3GM8 A;  3MUY 1;  2W47 A;  1UYX A;  4IUG A;  3HNB M;  4GWJ A;  3HJR A;  3OGS A;  3EYP A;  2YFZ A;  3K77 A;  3GGL A;  1JI6 A;  3NQH A;  4P00 B;  4DXS A;  1GNY A;  3FL7 A;  2WAA A;  1NKG A;  3C7G A;  3I2K A;  3K46 A;  1W9T A;  1GOF A;  3WNP A;  1HN1 A;  1UMH A;  1K45 A;  3OEB A;  3MV1 1;  3IDA A;  4A41 A;  1T2X A;  2ZXQ A;  4QB2 A;  3C7E A;  4CU8 A;  2JE8 A;  2WAB A;  3T0A A;  4LPL A;  2WO1 A;  2VQT A;  3OB8 A;  4QDR A;  2WO3 A;  3CQO A;  4OUE A;  3EB7 A;  1OD3 A;  2XON A;  4ZY9 A;  3T2Q A;  3VDC A;  2J1S A;  4UAP A;  1CZT A;  4AAX A;  2B4K A;  5G04 L;  3LPF A;  1UXZ A;  2VQU A;  4JKM A;  5IJR A;  2W87 A;  2HLE A;  3BN6 A;  4OYU A;  3GXU A;  3LEI A;  1JYX A;  1W9W A;  2W1S A;  4CVU A;  1JYV A;  1DLC A;  2JKX A;  1W9S A;  2BER A;  2HYX A;  4OZO A;  4A45 A;  3A22 A;  3C7F A;  2EIE A;  3SKV A;  4XUN A;  2QQO A;  1LNS A;  1O8S A;  3T0D A;  1OH4 A;  1UY1 A;  1US3 A;  5JR2 A;  2ZEX A;  3VD9 A;  2VO5 A;  4W8J A;  2XHN A;  3T2P A;  3T09 A;  2JDA A;  1RYY A;  2OKX A;  4BJ0 A;  3LEK A;  1GOG A;  2W91 A;  2CDO A;  3ECQ A;  4L0P A;  1ULO A;  2QQN A;  2YC2 A;  5EIY B;  5C7G A;  4TXW A;  3NNG A;  3DEC A;  5JMO A;  1EUT A;  1JZ2 A;  4FI9 A;  1O59 A;  2W1U A;  1OF4 A;  3WEZ A;  2LW8 A;  5C70 A;  4HG6 B;  1US2 A;  4XUT A;  2V72 A;  2YB7 A;  2V5D A;  4P5Y A;  1XC6 A;  2J1E A;  1GQP A;  2VZ3 A;  2WDB A;  1ULP A;  3NRU A;  3K4Z A;  1CX1 A;  2VC9 A;  4XZU G;  4CUC A;  4PQQ A;  1IQD C;  5IFP A;  4XUO A;  3CDZ B;  2YC4 A;  1JU3 A;  1JHJ A;  2VME A;  2BGP A;  3DYP A;  3WF3 A;  3UNP A;  2DDU A;  3SEP A;  5DPN A;  1JZ3 A;  1I5P A;  2XOM A;  1O8P A;  3WF0 A;  5G05 L;  4XUQ A;  3T08 A;  1SDD B;  2Y6G A;  4ZXE A;  4UI9 L;  1UY3 A;  3ACG A;  2RJ2 A;  3I97 A;  4KWU A;  4A4A A;  2VMD A;  1P8J A;  2WZE A;  1JZ8 A;  2JD9 A;  4KMQ A;  4UOJ A;  3UET A;  4E8D A;  3HNY M;  3FHA A;  2C4X A;  1EUU A;  2WYS A;  2VZ1 A;  3I2J A;  2E33 A;  3AC0 A;  4PT6 A;  4D0Q A;  3GDB A;  3LE0 A;  1UY0 A;  2J1T A;  2XQX A;  1UWW A;  3BGA A;  2Y6K A;  5DN2 A;  5JXI A;  3WNM A;  1W0N A;  3I2G A;  2Z4F A;  2VCA A;  3I3B A;  5J1X A;  3A7Q A;  5HPO A;  5HXM A;  2VMC A;  4CU9 A;  3DYO A;  3I3D A;  2KD7 A;  1UMI A;  2W1W A;  2Y6L A;  3I2I A;  5JXJ A;  2W1Q A;  3OBA A;  5I0D A;  2E26 A;  1PX4 A;  4OMC A;  5IHR A;  2VZP A;  3C7O A;  4W50 A;  4KI5 M;  2DCK A;  2ORZ A;  4JX0 A;  3VD7 A;  4A42 A;  1UY2 A;  3WNN A;  3HPN A;  4RN5 A;  2QQM A;  1XPW A;  4MO3 M;  3HOB A;  3WNK A;  2L9L A;  2WAO A;  1JZ7 A;  2WN3 A;  2Y64 A;  4ET7 A;  5CZK A;  3C7H A;  3ETP A;  5C71 A;  1NX9 A;  3W5N A;  2VCC A;  4M4P A;  1R64 A;  3LQC A;  5F7U A;  2J1A A;  5DMY A;  3T0B A;  1YQ2 A;  2W9X A;  1UZ0 A;  2WQ8 A;  3WF2 A;  1TVG A;  4QPW A;  4MAD A;  2VOT A;  2PQS A;  4LQR A;  5JUV A;  2WZ8 A;  2VCB A;  5LA1 A;  1W8N A;  3I3E A;  4ZZ8 A;  1OT5 A;  4QAW A;  3OG2 A;  4XUR A;  4QDQ A;  2BGO A;  2LS6 A;  2RVA A;  4QB6 A;  2W92 A;  2W3J A;  2WBK A;  3E1F 1;  1NUK A;  1JYN A;  3VDB A;  3T2O A;  4W4Z A;  3IB3 A;  2WUH A;  3III A;  3IAP A;  3D3A A;  1SG3 A;  4TTG A;  2W46 A;  1PMJ X;  3NJV A;  2VMF A;  4DEQ A;  1GOH A;  2VZR A;  5LA0 A;  3OGV A;  4CUB A;  1DP0 A;  3A23 A;  3ACH A;  5A1A A;  3UES A;  1CZS A;  3C8X A;  4QB1 A;  3MO4 A;  3WNO A;  2B9V A;  2QQJ A;  4JKL A;  2W95 A;  4A6O A;  1W99 A;  2X10 A;  2VZQ A;  3K4D A;  2QQI A;  3WF1 A;  2EID A;  5LA2 A;  5B4X A;  1L7R A;  1K12 A;  3LPG A;  4MOA A;  4CU7 A;  4BK4 A;  1JZ5 A;  2ZEZ A;  1PX3 A;  2X09 A;  1UXX X;  1CIY A;  1K42 A;  2E31 A;  4DUX A;  1MPX A;  3ABZ A;  2RV9 A; 
#chains in the Genus database with same CATH topology
 4KWL A;  2RHP A;  2XML A;  3PUI A;  5EJ1 B;  4D7S A;  2XKO A;  3CMG A;  1AJO A;  1D7P M;  5CKQ A;  3WNL A;  3BUC A;  1RUH 1;  1NLQ A;  4ATE A;  2BZD A;  4F83 A;  2OW4 A;  4TN7 A;  1D4M 2;  4YZ5 A;  2EIB A;  1W6O B;  1PVC 1;  1H9W A;  1W0P A;  2VQA A;  3FHQ A;  3ZXF A;  4MHU A;  4Z92 B;  4DXT A;  4FAH A;  3PVO A;  4QQH A;  3RVH A;  4DEV A;  3RRD A;  1FT9 A;  5BXX A;  1MQT C;  3W5M A;  2ZHK A;  1CZV A;  2C26 A;  4K3U A;  4M4R A;  3PVN A;  4N9I A;  1JBC A;  2I2S A;  5ACA 3;  5FO7 B;  3D82 A;  4R9C A;  1C8M 2;  3HNM A;  4X6Q B;  5FMB A;  4H7L A;  5FRE A;  4CDW B;  3N3H A;  1RED A;  3K3N A;  4G3Y C;  4MXW A;  4RGA A;  5J7M A;  3AMH A;  1JZ4 A;  3W20 A;  5IUQ A;  4HON A;  2I74 A;  4RR3 A;  3DPR C;  1CPN A;  4BM8 A;  4IQP A;  4AGR A;  2QBX A;  1YLL A;  4HL0 A;  5FZ7 A;  1SDW A;  2VH9 A;  2Y6H A;  3OUJ A;  4GUL A;  3OGR A;  5J3U A;  4C90 A;  2GN3 A;  2Q30 A;  1NAE A;  1ZM1 A;  1GZT A;  3H3L A;  2VR4 A;  4AEM A;  1NCR C;  4LHS A;  2MEV 1;  2R32 A;  3A21 A;  4UW3 A;  4CCJ A;  4OMD A;  1PNF A;  1RUC 2;  2HWB 3;  2WWS A;  4K1Z A;  2YFU A;  1H8T B;  1POV 0;  1AR6 1;  4XCA A;  2OVU A;  3ZSE A;  2PQQ A;  3VZO A;  5IW0 A;  3RZK A;  1YQ6 A;  3MW3 A;  3ELN A;  2ZKN A;  5H9S A;  2ZGS A;  2JWP A;  2WS9 3;  5FMO S;  2YHJ A;  1CAW B;  1LUL A;  2V4V A;  3SCH A;  3UJQ A;  1RUG 2;  2WZR 1;  4PQ9 A;  4XMI A;  3KZ4 C;  4AEK A;  5ABJ C;  4XUP A;  3BOD A;  3T2T A;  3ZXL A;  1D4V B;  5FZF A;  4KWJ A;  4W6Y A;  1JZ6 A;  2GP5 A;  3CU7 A;  3KT7 A;  4C1W A;  5GLT A;  4XDO A;  3HN3 A;  1HDK A;  2R04 2;  4AVC A;  4JGY A;  4KG0 A;  5HCB A;  4E27 A;  3RZL A;  5A3O A;  1HXS 2;  3OEA A;  3RDI A;  4Z1V A;  1QEX A;  3D5O A;  4BIS A;  2G9F A;  1WW4 A;  5KXD A;  3N9Q A;  1W6M A;  4TLF A;  5EWS A;  5ANQ A;  1A78 A;  3VBH B;  4F7Z A;  4AR2 A;  4KL1 A;  1DZQ A;  2V73 A;  4YSF A;  1KXG A;  2D6M A;  1RUD 3;  4XF3 A;  1BZW A;  4YFW A;  5CFC C;  5CG8 A;  4WM7 C;  2DCY A;  3FWE A;  3CIH A;  2ZAB A;  1H0B A;  5F5C A;  2OT7 A;  1SLT A;  3B3Q E;  4JKK A;  1GNZ A;  4RFR B;  2R6Q A;  4Y1X A;  5JOW A;  3B5L B;  5K0U B;  4N53 B;  3NJX A;  5HV0 A;  3M2M A;  3TOJ A;  3MUZ 1;  3T4V A;  1WME A;  1X50 A;  2DFC A;  4IER A;  1H1M A;  1SMV A;  2Z79 A;  3VZJ A;  2QQV A;  2R7E B;  2RS5 2;  1V9U 3;  2B5H A;  3HIF A;  4YVS B;  5FPA A;  4RS5 A;  4YLZ A;  1ZRC A;  1OI6 A;  3H1W A;  1HJF A;  2QZ3 A;  2VGD A;  3IPV B;  4S2D A;  4CEY A;  2XJS A;  3KD4 A;  4ZON A;  1OLM A;  3NJZ A;  1IHM A;  3FMG A;  3TEY A;  2RR1 3;  3DYM A;  2YBS A;  1AXZ A;  2VM9 A;  5T52 A;  3VD3 A;  1HQL A;  5DZE A;  4AL9 A;  5ACA 1;  3KS7 A;  1R1A 2;  4ISQ A;  4HT1 T;  3ZXE A;  3POS A;  1O3Q A;  2J1V A;  1WLW A;  3AXE A;  1QH7 A;  2GSY A;  3VV1 A;  2D5F A;  1ODM A;  1XE0 A;  5F6L B;  4BDV B;  2QDR A;  4GWI A;  4YW6 A;  4MXW B;  1OFS A;  2WQZ C;  3VHN A;  1QU0 A;  3VZK A;  4JAA A;  3C2U A;  4RR3 B;  4B4P A;  2YPD A;  5F1R A;  4QXH A;  3AVS A;  3RI8 A;  2DU0 A;  2J7M A;  2XVL A;  3QOP A;  4FXG B;  1HV1 A;  4QX3 A;  5JVV A;  2P3K A;  3THP A;  2RM2 2;  3ZYB A;  4FAG A;  5E6H A;  1HRV 2;  1VB4 A;  1W8U A;  3N4M A;  4Y1U A;  1LGN A;  4LTA A;  5APA A;  2HWB 1;  1ND2 A;  3THC A;  4CDQ B;  1BHG A;  3AX4 A;  5KHG A;  4YW1 A;  3WDY A;  1XB9 A;  3ZXA C;  4XBN A;  5FPX A;  3MID A;  3CKH A;  4JZR A;  4UWD A;  2OX0 A;  4CCD A;  3VBU C;  2D7F A;  5FUI A;  4QQL A;  3VKM A;  2WS9 1;  2RDN A;  1S2B A;  2WN2 A;  1O5L A;  5IVE A;  5D8A A;  2Q5T A;  5KC5 A;  1GMM A;  1BXH A;  2E32 A;  4O7X A;  1LED A;  3MUY 1;  2BNO A;  1UYX A;  3VKF C;  4Q1R A;  4PBO A;  5ANN A;  3HNB M;  4XAC A;  4GWJ A;  2Q8E A;  3IBM A;  3OBT A;  3R4D B;  3FLP A;  2EAK A;  5EYY A;  3EYP A;  2YFZ A;  1JMU B;  4M00 A;  4FSJ A;  1LEN A;  1Z7S 3;  1JI6 A;  4LUK A;  3TN9 2;  1RUD 1;  3K46 A;  2CTV A;  2JDN A;  3WNP A;  1GOF A;  3ZR5 A;  1W6M B;  2FMY A;  4Y33 A;  5FY1 A;  1VBC 2;  1VE0 A;  1MAC A;  4O61 A;  2R07 2;  3MLJ A;  2ZXQ A;  3GZU C;  4PIZ A;  5C4W A;  2WAB A;  4RD7 A;  5DZF A;  3FHI B;  3NNJ A;  3J7L A;  2JDZ A;  4UW4 A;  2VQT A;  3KLS A;  2XJT A;  4P9W A;  4BLJ A;  3UKT A;  4DMI A;  4I3P A;  5JSP A;  4NR1 A;  1V9U 1;  3W9A A;  2VTX A;  1SBF A;  5HI0 A;  1AX0 A;  2WO3 A;  5FMC A;  1RTV A;  1PO1 2;  2O8Q A;  2BJS A;  4L97 A;  1WLD A;  3UYJ A;  4EE2 A;  4XW3 A;  2QUO A;  2FDI A;  2HJI A;  2Y6F A;  2RR1 1;  4CUG A;  4D6S A;  2ES3 A;  1G7Y A;  4RS5 B;  4CEY B;  2J1S A;  3MFC A;  4XAB A;  4R4Z A;  3PME A;  2P6H A;  4AAX A;  2B4K A;  2Q8O A;  5C5U A;  1UXZ A;  4QGL A;  5FJK A;  3T1L A;  3KHC A;  2A3Y A;  1YXW A;  3AM2 A;  3ES4 A;  3BN6 A;  4QQP A;  5F5I A;  4ZU4 A;  2UWB A;  3UGG A;  2EF6 A;  1VBE 1;  1WLT A;  2P3I A;  5F39 A;  1ZRE A;  1S0I A;  1SLA A;  1ZZC A;  1ZRI A;  2JKX A;  5A3P A;  4IES A;  5FZO B;  1RHI 2;  4AFA A;  3ATG A;  4M3C A;  2BER A;  4EJR A;  4NUB A;  2YRO A;  2IVJ A;  4RL7 A;  2JG9 A;  3H7J A;  3POJ A;  2EIE A;  3PUQ A;  4IEV A;  5CAD A;  3AP7 A;  3FUQ A;  1IS6 A;  4OFG A;  3SKV A;  2QQP A;  2E9Q A;  1O8S A;  2IXI A;  1OH4 A;  1PZ7 A;  5LZ6 A;  1CD3 G;  4YM1 A;  3WDX A;  1LES A;  4OHW A;  4QGN A;  1F5J A;  1G9A A;  3VD9 A;  2JIG A;  3V56 A;  3DXU A;  4DPN A;  1ENQ A;  1H4H A;  3T2P A;  2ET7 A;  4LKE A;  4YGB A;  5A7S A;  4BJ0 A;  1BLZ A;  2ZAC A;  3AMP A;  4LA3 A;  1R08 2;  2W91 A;  3BU7 A;  4JTN A;  4L0P A;  2ZAH A;  5FP8 A;  4ISR A;  4BLI A;  3GBG A;  2YBK A;  5FPU A;  3CL1 A;  3RMY A;  4AI0 A;  5F2W A;  3VUO A;  1HQN A;  5JMO A;  4N43 A;  2JXA A;  2YMZ A;  1PGL 2;  5D8A B;  2QZ2 A;  4XDQ A;  5DG2 A;  4YVW A;  1F8V A;  4IEX A;  1MQT A;  2G4I A;  1VAV A;  4LBM A;  1D4M 3;  2W1U A;  2RDQ A;  1VRH 3;  5FWE A;  1HRI 2;  3GZA A;  1GWK A;  3WEZ A;  4FBF A;  4XBL A;  1EV1 2;  2ZTN A;  2JDY A;  1Z7S 1;  3DXT A;  1S0G A;  2VUA A;  4QWN A;  2YB7 A;  4P5Y A;  2C24 A;  3T30 A;  1WCD J;  4COU A;  4C8D A;  2J1E A;  5T54 A;  3ZYR A;  4CA9 A;  4UYB A;  3LDK A;  5FKC A;  3AJY A;  1S0J A;  4AVT A;  2E7Q A;  1C8M 3;  3DPR A;  3QH7 A;  3NRU A;  2WNV C;  5FZL A;  2OQ7 A;  2VOW A;  1BCX A;  3UT0 A;  3RSJ A;  5JZG C;  5L9V A;  4XZU G;  4RHV 2;  1UIK A;  2XJV A;  1U5I A;  1W9Y A;  3ZVX A;  2JDM A;  1OKO A;  1NCR A;  1W6P A;  4LHK A;  3POW A;  3Q8E A;  3OBR A;  5C4W B;  1IQD C;  3KB5 A;  2WNO A;  3ILR A;  1UZV A;  3WXP A;  1H4G A;  4B7E A;  3H8O A;  5JPM B;  2BU9 A;  2VQ0 A;  2A6V A;  4IEW A;  3ES1 A;  4QKD A;  3AZV A;  3ENR A;  3WF3 A;  1HIX A;  2DDU A;  1E5H A;  2D3P A;  2WT2 A;  2XOM A;  2EAL A;  1UOF A;  3RFR A;  4LIV A;  2G1M A;  1RUC 3;  4EV0 A;  1LCL A;  3NWK A;  3WF0 A;  4FTS A;  1H2K A;  3M8L A;  1LU2 A;  4Q0S A;  5HCA A;  2Y6G A;  1W39 A;  4HZF A;  3IDB B;  1XU1 A;  2HWC 2;  1Z0H A;  1GKB A;  3ACG A;  1D0H A;  3TNQ A;  5C9A C;  4EN8 B;  4PI0 A;  1RUG 3;  3VLB B;  3J4U H;  1P8J A;  4RQP C;  3WHT A;  1G86 A;  4RSU A;  3E5U A;  5FYM A;  4IEO A;  3BU0 A;  4E8D A;  3HNY M;  4NPR A;  4M3C B;  1AHS A;  1YFY A;  2C4X A;  2R04 3;  4NO4 A;  3ZFE C;  2NZ9 A;  2WYS A;  3I2J A;  1HXS 3;  1SFN A;  5CFC A;  4G4F A;  4QU1 A;  3S7E A;  3OUH A;  2QKD A;  3MIC A;  4WM7 A;  4LBN A;  2GZW A;  1V6M A;  4LXL A;  2J1T A;  3FBY A;  1ULD A;  1UWW A;  2WA4 A;  4BXF A;  2Y6K A;  3PIG A;  1W0N A;  3J26 N;  2GNB A;  4EN7 B;  2BDR A;  2VCA A;  2ZGT A;  2GMM A;  3OTF A;  2UU8 A;  1N1V A;  2B7Y A;  4S2H A;  2AH2 A;  3JD7 2;  3OD0 A;  3BIE A;  4KU8 A;  4PBP A;  5A1L A;  1QF3 A;  1UN1 A;  4FFF A;  4O9E A;  1W3V A;  4XF0 A;  3N35 A;  2BOI A;  2W2I A;  4X8P A;  5HXM A;  4CU9 A;  4NIH A;  4ZXK A;  1D4M 1;  3KVA A;  1J3P A;  3WDW A;  2QCS B;  1VRH 1;  1UMI A;  4AI9 A;  3I2I A;  2RS5 3;  1N1Y A;  2ARE A;  2Y6L A;  2I45 A;  2CGO A;  4G9S B;  5J48 A;  4Z82 A;  5I0D A;  3EBR A;  4GMP 0;  4H55 A;  1MQT B;  5FXW A;  3WT3 A;  1SLC A;  2FMD A;  1W2N A;  5CAZ A;  2G9Z A;  4MV2 A;  3RJR A;  1DZR A;  1DLL A;  5C8C C;  2D6P A;  4UFM A;  1R1A 3;  1UOJ A;  1ZA4 A;  3RZZ A;  1C8M 1;  1RJ7 A;  5LBC A;  1BK0 A;  2QQM A;  4PI2 A;  4K9S A;  4N9H A;  5DUU A;  4BHP A;  1XPW A;  4TSV A;  3WNK A;  2L9L A;  2WAO A;  3DPR B;  1JZ7 A;  1WW6 A;  2WN3 A;  2XQR A;  4DFS A;  5CZK A;  2ZHL A;  3C7H A;  3ETP A;  3BPS A;  2GNT A;  1NX9 A;  5FO9 B;  2JDK A;  2VUC A;  4B4R A;  5J09 A;  3W5N A;  3LQC A;  1NCR B;  1UL9 A;  1W6P B;  2RS3 2;  4HXC A;  5DMY A;  1YWK A;  3BTX A;  5HCF A;  2RM2 3;  1UZ0 A;  3NV3 A;  4FPJ A;  1HRV 3;  4QPW A;  3VBU A;  1S55 A;  1OA3 A;  3CJI B;  5CKM A;  3WG3 A;  1RUC 1;  1POV 3;  5C3P A;  4YYO A;  2XJU A;  1OMI A;  3O0W A;  5T5O A;  5IVF A;  1MS4 A;  2PQS A;  2ZJC A;  5JUV A;  5HXV A;  4IET A;  5F5A A;  1W9F A;  1CPM A;  4YGD A;  5ABJ B;  1RUG 1;  2Z69 A;  3EXU A;  3MFA A;  4KNC A;  3AYE A;  4XUR A;  4FO9 A;  2YU1 A;  1REE A;  2BGO A;  2LS6 A;  2RVA A;  1LJ7 A;  2W0X A;  4OI1 A;  5A1F A;  2W3J A;  4YRD A;  5FYT A;  4UFH A;  2R04 1;  4B4Q A;  1JYN A;  1C8N A;  3T2O A;  1N1T A;  1HXS 1;  4O9G A;  1KRI A;  2PHW A;  3N36 A;  1DGL A;  2WUH A;  5IWF A;  3D3A A;  1SG3 A;  4V1P A;  4XF1 A;  3NJV A;  3TN9 3;  4D6R A;  2XVK A;  1CGP A;  3LF7 A;  5CFC B;  5LA0 A;  3OGV A;  3MF6 A;  3P3P A;  4WM7 B;  2AAC A;  1QQP 2;  2FDF A;  3A0N A;  5A1A A;  1OQD A;  2VXJ A;  1VBC 3;  4QB1 A;  2WRA A;  2R07 3;  3BTA A;  4Q2F A;  5FXX A;  1WBL A;  1AXY A;  4XEZ A;  1GR3 A;  4SLI A;  1PO2 2;  1S2E A;  2QQI A;  3K4D A;  2Y26 A;  3OPZ A;  3M3Q A;  4CZS A;  1JYI A;  5BNN C;  3LCP A;  2EID A;  5LA2 A;  1IS5 A;  4IV1 C;  4DRR A;  4IE0 A;  4XAE A;  4JGY C;  1U0A A;  1RUD 2;  3OCP A;  4Q0U A;  3TBD A;  3ZR6 A;  1PO1 3;  2CAV A;  1V00 A;  3AMN A;  5FY9 A;  1V0A A;  2PAK A;  1F5F A;  4BK4 A;  1I3H A;  4LE3 A;  4P5H A;  1UXX X;  2QTW B;  4FVV A;  1DFQ A;  3ST7 A;  1R1A 1;  4DUX A;  3ABZ A;  3PJY A;  5IAT A;  3PTR B;  2RMU 2;  1QJX 1;  5DUX A;  2ZMK A;  3T3Y A;  4E9K A;  5I0T A;  3ZSL A;  4LKF A;  2DUP A;  5EV7 A;  2V5Y A;  1V9U 2;  1VBD 2;  1XYN A;  3DF0 A;  4P9Y A;  4YWA A;  4NWW A;  3SH4 A;  1ZZ8 A;  1GIC A;  2FCU A;  4EZ4 A;  2A71 A;  1M06 G;  2X05 A;  3RG0 A;  4CU6 A;  4A3X A;  4L8Q A;  2VW0 A;  1ULF A;  5A3W A;  1RHI 3;  4PDW C;  3AYC A;  3POF A;  1U12 A;  1WCQ A;  2BBA A;  4MGS A;  1F15 A;  2CU5 A;  3MPP G;  2ORX A;  4Q1P A;  2RM2 1;  4TLG A;  3AZY A;  1HRV 1;  1JYW A;  3TNP B;  5E88 A;  3TYJ A;  2NYY A;  1W2T A;  3M4F A;  3FX3 A;  1POV 1;  5DG1 A;  3THD A;  3KV6 A;  1VBE 2;  5FYU A;  2WT0 A;  4M01 A;  5GLW A;  4CP1 A;  3VBU B;  3USS A;  4HET A;  1R08 3;  3CZU A;  2VNR A;  1XSQ A;  1VP6 A;  3M3O A;  1JUH A;  1A8M A;  1F9K A;  1UW8 A;  5FYC A;  5FLH A;  3HBK A;  1VPH A;  2ZGR A;  3GAL A;  5FYY A;  4J6G A;  2AUY A;  3KVB A;  1AZD A;  4WZC A;  3HT1 A;  1PVX A;  3O1V A;  4XFH A;  5IVC A;  3NKT A;  1FV2 A;  1V6K A;  4P08 A;  4O65 A;  4V2W A;  4TWT A;  4XXP A;  1W04 A;  1YYN A;  2BW8 A;  4X8N A;  4Y4R A;  5GZF A;  2W94 A;  4ARY A;  1HRI 3;  1UQX A;  4DXR A;  1J83 A;  1ZZ9 A;  4WVV A;  1EV1 3;  2OS2 A;  4KWK A;  4XQW A;  5F3I A;  3TN9 1;  4BPZ A;  1YNA A;  5A6Z A;  1ND2 C;  3PUH A;  1X9T A;  4XFA A;  1L7L A;  2RG4 A;  4YGC A;  1NY7 2;  3FLR A;  4ONU A;  2QQK A;  4Y24 A;  4Q4Y 2;  2XH6 A;  1VBC 1;  4JHZ A;  4DY3 A;  1ZRD A;  2R07 1;  1AR9 2;  1S0D A;  2YZ4 A;  3J7H A;  5I8T A;  2Y8K A;  2EIC A;  2W39 A;  2VVF A;  4RHV 3;  5JLV A;  4MGQ A;  3MPB A;  3PUA A;  2ZGP A;  5FAX A;  4BQ3 A;  1NXM A;  2JB8 A;  2YPJ A;  2P3J A;  1NQJ A;  1PO1 1;  2P1B A;  5K7P A;  1UYZ A;  3DKW A;  4CDQ C;  1OQ1 A;  1WA6 X;  3OYW A;  3SCF A;  2EXJ A;  2NQY A;  3AKR A;  3FUO A;  3AP5 A;  4LKS A;  5CIR A;  5JSR A;  2OUH A;  3P5B A;  3P1I A;  1DYK A;  4BQY A;  4ZU5 A;  1TNR A;  3AVR A;  4I02 A;  5C9A A;  3GJA A;  2ZBJ A;  1JU4 A;  3OPW A;  2XJR A;  4RQP A;  3UGF A;  3MLL A;  1G9C A;  2HWE 2;  5T5P A;  2Y33 A;  1Y4W A;  2HWC 3;  4LIT A;  1RUO A;  1YRZ A;  2DCZ A;  4UBG A;  4QXB A;  3H8X A;  1VBA 2;  1RHI 1;  3ZMN A;  5LK7 B;  3WR0 A;  3ZFE A;  5CBL A;  4LO4 B;  3HT2 A;  1WD4 A;  2Q8C A;  2VMI A;  3ZSK A;  1XRU A;  1IGO A;  1FYU A;  3OUI A;  4AG4 A;  5B4N A;  1F4A A;  2XLA A;  2JIJ A;  2ZX4 A;  1KDK A;  3IAQ A;  4XJW A;  5JOX A;  1GUI A;  1UOB A;  5FXZ A;  1F2N A;  4CSW A;  3APB A;  2ARC A;  2ZAA A;  4RGG A;  3VHR A;  3OPT A;  3W59 A;  4DQA A;  3TEW A;  2D6K A;  4GH4 C;  3WLU A;  4FPL A;  3LOI A;  3WG2 A;  1LGB A;  4HSL A;  5FXV A;  2DTW A;  2ET1 A;  2P37 A;  5C3R A;  2DUQ A;  4P02 B;  3RZH A;  4XHX A;  1DYO A;  1H30 A;  3GHM A;  4HLT A;  4COZ A;  4L9B A;  1ZBA 2;  4AVB A;  3JD7 3;  1PGL 1;  3RQ0 A;  2CGP A;  3I54 A;  1WMD A;  4YGE A;  3SEE A;  2JG9 C;  4QX7 A;  4YW7 A;  5C8C A;  2ERF A;  5IK4 A;  1HRI 1;  3LEM A;  1ULG A;  3EO6 A;  5FZM A;  3T1M A;  3WSO A;  1EV1 1;  4Y5S A;  3SIS A;  1AL2 3;  2C9K A;  4D7Y A;  1JW6 A;  1OSG A;  2WLQ A;  5IK7 A;  1LB2 A;  2VZO A;  2Y6J A;  2IFW A;  3NNF A;  5A33 A;  4DY5 A;  5EJ3 A;  5A6Y A;  4I3G A;  3U78 A;  2WO2 A;  1OF3 A;  1DQ1 A;  3B94 A;  4P9I A;  2WO7 A;  2WNV B;  1TMF 2;  2VW1 A;  1JUI A;  1WUV A;  4ZHN A;  4NHL A;  5JZG B;  1EAH 1;  3TEZ A;  1DQ6 A;  3N9P A;  1E5R A;  1VRH 2;  4RHV 1;  2AEZ A;  1ENR A;  1ULC A;  4N43 C;  2WNU C;  3RJ2 X;  3U07 A;  4YVW C;  3HJR A;  2HEV F;  5FYZ A;  3TB0 A;  4ZS2 A;  2VUD A;  5FV3 A;  3WUC A;  4CEW C;  3OGS A;  2AYH A;  2JX9 A;  3K77 A;  2RS3 3;  4NPL A;  3GGL A;  1RL3 A;  2E63 A;  3NQH A;  2R06 1;  4HSJ A;  2WR9 A;  4DXS A;  2F17 A;  4NN0 A;  1NKG A;  2VE1 A;  1X8M A;  2A3X A;  3OYW B;  3WDU A;  1K45 A;  2GH8 A;  1LHW A;  3IDA A;  4LR4 A;  2CNA A;  3ZYG A;  1T2X A;  2D43 A;  4QB2 A;  3C7E A;  5FK7 A;  2HWC 1;  2JE9 A;  1ONA A;  4AZZ A;  5C9A B;  4DRV A;  1TEI A;  1JH5 A;  2RDS A;  2GME A;  2WO1 A;  4LPL A;  1B35 A;  1L3J A;  4RQP B;  3ASI A;  4C0B A;  1MS0 A;  3OB8 A;  3WIN E;  4C91 A;  5BNO C;  1SLL A;  3NV1 A;  2E7A A;  3B02 A;  4OUE A;  2WIN B;  3HVD A;  3ZFE B;  5I0U A;  2XLF A;  4HVQ A;  3FLT A;  4ZY9 A;  4CPB A;  2E6V A;  3Q8F A;  4PIY A;  1CZT A;  2CYF A;  3AP6 A;  4LHL A;  1NZI A;  1KJR A;  2HLE A;  2DCT A;  4KBZ A;  1QQP 3;  2UUR A;  4BU2 A;  4P9G A;  1PIV 2;  4YM0 A;  1JYX A;  4CVU A;  5BNN A;  5CIS A;  1WBF A;  5I0R A;  4IV1 A;  4GAZ A;  3S5A A;  1VAM A;  3JD7 1;  5FP9 A;  2D6N A;  4AXO A;  2A5Z A;  3CHX A;  1MEC 2;  3O14 A;  3SH5 A;  4DXZ A;  1H2L A;  1PO2 3;  2Q1Z B;  3C7F A;  4CRQ A;  1QJY 2;  4FPG A;  3I59 A;  5FZ8 A;  3TAY A;  3T0D A;  1UY1 A;  1US3 A;  4GMP 3;  5FZ0 A;  5JI7 A;  1AL2 1;  3I2D A;  2YY1 A;  3ZN4 A;  2ZEX A;  4JGZ C;  1YQ5 A;  5C8C B;  5A3N A;  2VO5 A;  2OII A;  3HQX A;  2JDA A;  1CWP A;  4FOW A;  5BPX A;  3GCW A;  1GOG A;  4OHV A;  4IND A;  4QKF A;  4OUM A;  2RMU 3;  4DNY A;  2GDF A;  2YC2 A;  4XDP A;  4YM2 A;  5A33 B;  4PDW A;  5EPA A;  3KV5 A;  3KV9 A;  5ISL A;  1QXJ A;  1J58 A;  2ZGM A;  1VBD 3;  2EVX A;  1JS9 A;  3VZM A;  3WQ1 A;  3NNG A;  4HPK A;  4LOR A;  3H1Y A;  1XYO A;  2LRP A;  5E8A A;  1MZ6 A;  1AX1 A;  1EUT A;  1ULE A;  2C9A A;  3KCY A;  3ZMO A;  3N7K A;  1TME 2;  4XIL A;  3N9M A;  5E89 A;  4HVO A;  2JEM A;  1XNB A;  5FZH A;  1HB3 A;  2RS3 1;  5FYS A;  1QJX 2;  2C0Z A;  1US2 A;  2PAM A;  4XUT A;  1F31 A;  2A7A A;  4HBN A;  1I9R A;  1ZYB A;  2OZ6 A;  1PHM A;  2IVI B;  2WWJ A;  2PHF A;  3ON7 A;  3KHB A;  1GQP A;  2R0F A;  2V4A A;  1WMX A;  1VAK A;  1VBE 3;  4QU2 A;  4GJY A;  5FP4 A;  5I93 A;  5FY0 A;  2GNM A;  1OD5 A;  4PIX A;  1GSL A;  5BNP C;  1UCX A;  3B9C A;  2XJP A;  1QJE A;  1E5S A;  4GQ7 A;  2XGX A;  1Y9M A;  5H9Q A;  5TSW A;  1Q43 A;  1N47 A;  1YIP A;  4FFI A;  5DAX A;  2WWU A;  1SPP A;  4UFJ A;  5L9B A;  1LEC A;  3M3E A;  1NLS A;  2VU9 A;  3CDZ B;  2D40 A;  4IL7 A;  3U14 A;  4H3W A;  5JOY A;  1QDO A;  2BGP A;  4Y22 A;  2VMG A;  4QM9 A;  2PN5 A;  2K0G A;  5F32 A;  3UNP A;  2GU9 A;  4W6X A;  4K21 A;  1GWL A;  1X7N A;  2BVB A;  4MH0 E;  5FR3 A;  5FZI A;  1JZ3 A;  2WC2 A;  4PCR A;  1O8P A;  1WMF A;  3RMX A;  3WD5 A;  1R1Z A;  4P9X A;  4X6R B;  1QQP 1;  2HH9 A;  4Y5Z 0;  3IMM A;  4Q4Y 3;  3NMB A;  3I3M A;  1PM7 A;  2RJ2 A;  1AR9 3;  3I97 A;  3LD8 A;  2WA3 A;  3W58 A;  2IUW A;  4AED C;  4A4A A;  1EY2 A;  1V6J A;  2VMD A;  3H8U A;  2TBV A;  2WZE A;  5BNN B;  1JZ8 A;  1PO2 1;  4CDQ A;  1S0B A;  4IV1 B;  2C1F A;  4NII A;  4MHR A;  4JGY B;  2P34 A;  1BK1 A;  1IKQ A;  3UK9 A;  3GF6 A;  4GMP 1;  4EWA A;  1EUU A;  3ZSM A;  2VZ1 A;  1OA2 A;  2MPF A;  4IEZ A;  4XFG A;  2J42 A;  4D0Q A;  3I59 B;  2IXK A;  1A6C A;  1UY0 A;  1ZNP A;  2AEY A;  3RGB A;  3SH3 A;  3FFQ A;  3BGA A;  4AHY A;  3WNM A;  1S0E A;  4XFI A;  4XMA A;  1FAT A;  4CXX A;  5L36 A;  2RMU 1;  3X29 B;  4ZKT B;  1YI9 A;  2R49 A;  3B9I A;  2Z4F A;  4ERO A;  2FCT A;  4Z8B A;  4UF0 A;  1VBD 1;  3A7Q A;  1QGL A;  5JCT A;  2HWE 3;  2A6W A;  3VKO A;  2CV6 A;  5L7O C;  3AKQ A;  5GLV A;  4I0B A;  5JPN B;  4PDW B;  5IK5 A;  2VMC A;  1VBA 3;  2ATF A;  5FBZ A;  3USU A;  3U1X A;  3I3D A;  1YQ8 A;  4HPK B;  5C5T A;  1RC6 A;  2W1W A;  4P9L A;  5IAX A;  1MS1 A;  2YUE A;  2QVS B;  2IC1 A;  5FK8 A;  4LHN A;  2FDH A;  3ACL A;  3BOP A;  3WW1 A;  4AGV A;  4LK7 A;  4OMC A;  3DN7 A;  4GH4 A;  4QHB A;  4EN6 B;  5IHR A;  4HVR A;  1NT0 A;  1PGS A;  5EZW A;  4IEQ A;  4ES8 A;  3VL8 A;  1GNH A;  4CE8 A;  2JEN A;  4FQ4 A;  2DCK A;  3VD7 A;  3AYD A;  1UAI A;  3HPN A;  3HWJ A;  3WNN A;  4MYE A;  1TNF A;  4FPK A;  4BIF A;  3SC7 X;  4NRO A;  1JYC A;  4EZH A;  2XBO 2;  1H1A A;  3HOB A;  3L9J T;  1ZA7 A;  1G9F A;  5FY8 A;  4OQ9 A;  3WQ7 A;  1Y7B A;  4CP2 A;  3S5Q A;  5FPL A;  1JTZ X;  4P9J A;  1ZBA 3;  5C71 A;  2JDH A;  1BKZ A;  4Q4W 2;  5LAS A;  3V0B A;  3R4U A;  2VCC A;  2BTV C;  1R64 A;  2J1A A;  1DU3 D;  1SPP B;  1H9P A;  5FZ9 A;  1O4T A;  5FUP A;  1XNK A;  3WF2 A;  1ND2 B;  5CEH A;  4HK8 A;  1CJD A;  5BY5 A;  4Y22 B;  2P6C A;  3D8C A;  3ILF A;  3OD4 A;  4IEP A;  3AP4 A;  1STM A;  4F8A A;  1NY7 1;  5I8Y A;  5EYX A;  4NRM A;  5H9P A;  4Q4Y 1;  4JQR A;  3RPQ A;  1LAJ A;  2WNU A;  1OLQ A;  4QQO A;  1TMF 3;  1X82 A;  3B93 A;  1AR9 1;  2LUW A;  1W8N A;  3I3E A;  1VBB 2;  3MIE A;  4CEW A;  4CTE A;  4QAW A;  3OG2 A;  4CDU A;  4XQD A;  4YW5 A;  1W6Q A;  4QDQ A;  3ZN5 A;  5B2G B;  3VBF A;  4PJY A;  2ENR A;  1VIW B;  1IOA A;  1IPS A;  2WBK A;  3M7A A;  4ASM B;  4CPB D;  4IGP A;  1HLC A;  2K46 A;  4BME A;  2VBP A;  2G19 A;  2NMN A;  3J9S A;  4W4Z A;  5GZD A;  1WLC A;  3ZYP A;  1OXC A;  4K20 A;  3M1H A;  3IAP A;  1KQR A;  3AKP A;  5A6Q A;  4YW3 A;  1M4W A;  1XJA A;  2LRO A;  2KM2 A;  1HB4 A;  1EAH 2;  1JYT A;  1GOH A;  1UMZ A;  3NW4 A;  1RMU 2;  4LUL A;  3MZH A;  4LIU A;  3WP6 A;  4DO0 A;  3IT8 A;  5A7P A;  3ACH A;  3G7D A;  3NAP A;  1F35 A;  1G9D A;  1QMJ A;  1ACC A;  3UES A;  3KWV A;  1W8H A;  1ZRR A;  3C8X A;  4YG3 A;  1MS5 A;  2NM1 A;  4I30 A;  4M0H A;  5BNO A;  2HWE 1;  4QXK A;  3RWN A;  1NLR A;  5AC9 2;  2BBV A;  2B9V A;  4AI3 A;  4XZP A;  1OPO A;  4NID A;  3T4H B;  1VBA 1;  1W99 A;  2X10 A;  4GWM A;  3VBO C;  1DYP A;  4CP9 A;  1RVF 2;  1XND A;  3CLP A;  2R06 2;  5C3O A;  1C3H A;  3ETQ A;  4LUM A;  1HQW A;  1VR3 A;  2DVF A;  1OFN A;  3GHN A;  4MOA A;  1K5M C;  3R05 A;  1Y43 B;  4XTP A;  1UPI A;  3USU B;  3VZN A;  1AUY A;  4CCK A;  2OUJ A;  1BEV 1;  4XTM A;  1JZ5 A;  4R52 A;  2ZEZ A;  2ZS6 B;  1CIY A;  1YO8 A;  1MPX A;  2ZGO A;  2R1D A;  4GH4 B;  3RI9 A;  4WVZ A;  2Q1M A;  4K1Y A;  1UX6 A;  2RV9 A;  3MIF A;  5EXO A;  1X33 A;  2GN7 A;  3LFI A;  1PIV 3;  3HEI A;  2LM3 A;  1F4H A;  3A4U A;  2BP6 A;  1J84 A;  2BV4 A;  3VDA A;  4I0W B;  1JOD A;  1RJ8 A;  1ZBA 1;  4KU7 A;  1Q8V A;  2PHL A;  3WQ0 A;  2JG9 B;  5F9T A;  3VZL A;  1W05 A;  2R0H A;  1MEC 3;  5FJH A;  2AR6 A;  1LHN A;  2DVA A;  3ZYI B;  4JGZ A;  2QQL A;  1Q8Q A;  4CYD A;  5C33 A;  5JDB A;  2DV9 A;  1COV 2;  1QJY 3;  1QOS A;  4FOQ A;  2HEW F;  4JDN A;  4K40 A;  4AHX A;  3ZFF C;  1QY4 A;  2TUN A;  1W03 A;  1OKQ A;  2VZS A;  1CN1 A;  3V0B B;  1HB2 A;  4GZ9 A;  1C57 A;  1OUR A;  1CAV A;  4Q4V 2;  4XJ8 A;  1GP5 A;  4RYD A;  3M3I A;  1D2S A;  4YZ4 A;  3WQB A;  3CJX A;  4JHT A;  3J7M A;  5C6C A;  5IK8 A;  2VZV A;  2XR4 A;  1GU3 A;  3J7N A;  1GBG A;  1YFW A;  4JRA A;  4MGK E;  2NPI A;  1IKP A;  3E6D A;  4QX8 A;  1TMF 1;  4QX2 A;  4ARX A;  2ADE A;  2VBB A;  1Q3E A;  4YW4 A;  1KDM A;  1KIT A;  2D3S A;  1UZY A;  3TRS B;  2D97 A;  2W68 A;  5CFD C;  3E6C C;  2GC0 A;  4KG8 A;  3MBW A;  4N43 B;  2WNU B;  3POB A;  5T50 A;  4YPJ A;  4YVW B;  1AL2 2;  4A44 A;  1N1S A;  4BXS V;  3IDC B;  5FFO C;  4CEW B;  1SHW B;  3S0M A;  3QAC A;  5LB6 A;  3UJO A;  1TME 3;  3OJB A;  1W6Q B;  3MV0 1;  3S6P A;  5A3L A;  1QXP A;  3CZJ A;  2J1R A;  3RS6 A;  4MX3 A;  3AL6 A;  4YZ1 A;  3K3O A;  1QJX 3;  3ZYH A;  5BNP A;  1UZW A;  4QHO A;  1PGW 2;  4AVV A;  3O7O A;  3U75 A;  4ZZ5 A;  1SCS A;  5LCW L;  4MLO A;  4K8R B;  2J22 A;  3L2H A;  3AZZ A;  3I2F A;  3ACI A;  2RS1 3;  1UYP A;  2VZU A;  1GZW A;  1W8T A;  2XHK A;  2ZMN A;  3JQX A;  3WP4 A;  4BCU A;  5KXB A;  3BTY A;  4FP3 A;  5SV5 A;  4I2O A;  1KGY A;  1XOY A;  3J8F 2;  4J1W A;  1DQ2 A;  3RYK A;  1MVE A;  5A32 A;  2VTX J;  4H2A A;  4C1X A;  3FZ3 A;  4NHK A;  2YC0 A;  3WDV A;  1Q56 A;  4BB3 A;  4ZPI A;  3WUD A;  4QKB A;  1UD1 A;  2XLG A;  5BNO B;  3NV4 A;  4B7K A;  1FMD 2;  2A6Z A;  4A3Z A;  4CXY A;  3I8T A;  3ZKY A;  5GZG A;  2JIC A;  1E5I A;  5CA6 A;  4GB3 2;  1HJG A;  3LSE A;  2ZHN A;  3POI A;  2F4L A;  3U37 A;  3ZX7 A;  4QDS A;  4CP9 B;  5JMC A;  2CSG A;  1XNT A;  2HBT A;  4K8F A;  3AFG A;  1W28 A;  1YIF A;  4QT6 A;  4CDX C;  3JXS A;  4LK6 A;  4IDZ A;  2ZZQ A;  1W8O A;  1L7Q A;  1WKY A;  3U11 A;  4AED A;  3GYD A;  2PHU A;  2YYO A;  2ZEW A;  3QBQ A;  4DUW A;  2K2S A;  2JG8 C;  1V6L A;  1PIV 1;  1KFX L;  2H0B A;  3CF6 E;  3MIB A;  2WL1 A;  2ZGN A;  2ZKL A;  4U2A A;  1OLM E;  2O0O A;  4PLN A;  3WW4 A;  4CP0 A;  5KXC A;  1B35 C;  2HWD 2;  1TG7 A;  2HWF 2;  2DWR A;  5F8P A;  5DDJ 2;  4DIN B;  5KHK A;  1MEC 1;  4D8M A;  1DHK B;  3F2Z A;  2JKB A;  1UOG A;  1H6Y A;  4N7U A;  2WFF 1;  4XJA A;  5FYB A;  5GZE A;  1QJY 1;  1UYY A;  4S2F A;  4XJ9 A;  4LEJ A;  2GH2 A;  3I2H A;  1J1T A;  2ZEY A;  4JGZ B;  2EXK A;  3AK0 A;  2QQU A;  1CVN A;  4Z2A A;  1IQA A;  3WHU A;  1YI7 A;  1CAV B;  2XUE A;  5L7O A;  4WV8 A;  1MS8 A;  4FPE A;  3VDD A;  5GZC A;  2ZOE B;  2F4P A;  3E5Q A;  3NV2 A;  2TNF A;  3Q8B A;  1DG6 A;  2YU2 A;  3P6B A;  1CQ9 A;  2J1U A;  2ARB A;  4OUS A;  4QD2 A;  4Y20 A;  3ACF A;  1KEX A;  3ALQ A;  3MGU A;  3E6B A;  3WCS A;  4E2S A;  2WII B;  3PTY A;  2KXL A;  1PMH X;  4A7Y A;  3PUS A;  4AFD A;  1FXZ A;  4PF1 A;  2A3W A;  1TME 1;  2NN8 A;  4EWE A;  2QE3 A;  4DUV A;  5KXE A;  3LEG A;  1VAL A;  3ZPO A;  4KGG A;  4IW3 A;  4MVT A;  3G6J B;  1QIQ A;  3B7M A;  5FPZ A;  1J3R A;  2RS1 1;  4FPH A;  3Q9O A;  3P3N A;  5BNP B;  2D44 A;  1U5Y A;  4XVH A;  3VN4 A;  3K75 B;  2X29 A;  5D2A A;  4E4D X;  4IGQ A;  2BYV E;  1GZW B;  4OHX A;  4V2V A;  3R6S A;  2XDV A;  2XBO 3;  1Y9Q A;  4BQ1 A;  3INA A;  1W0O A;  3GM8 A;  5A80 A;  2W47 A;  4QPG C;  1GWM A;  2AC1 A;  1DQ5 A;  3KGZ A;  4LBO A;  4AWD A;  3M3C A;  5A32 B;  4IUG A;  4AQ6 A;  1WZX A;  4Q4W 3;  5FQ0 A;  4QPI A;  2WKK A;  4IE6 A;  1NYW A;  4IE7 A;  4SBV A;  2NMO A;  3SMH A;  3ZDV A;  4Y5T A;  4A7Z A;  3CEW A;  2P3Y A;  2DBN A;  4M0N A;  4QKN A;  1N3Q A;  5FRA A;  3VHO A;  5FBJ A;  3OSD A;  2B45 X;  4ITC A;  4P00 B;  1AVB A;  5DUV A;  3FL7 A;  1WCS A;  3HR9 A;  1DQ4 A;  1MZ5 A;  1W9T A;  2DU1 A;  1O7F A;  1YUD A;  2QFE A;  5FZA A;  1XQN A;  4FT8 A;  1BMV 2;  1QNW A;  4A41 A;  4BQ2 A;  1PZ8 A;  1J3Q A;  2OPW A;  2Y60 A;  4E4Z A;  1OOP C;  4CU8 A;  5KC6 A;  4AED B;  5L9R A;  2JE8 A;  4COW A;  3UL2 A;  2ILM A;  1LHV A;  1LOF C;  4E2G A;  2PLV 3;  2WZP P;  4FOY A;  3WDT A;  4AEJ A;  1DQ0 A;  1H2N A;  1ND3 C;  2B46 X;  4IEU A;  1VBB 3;  3NKG A;  4S2G A;  2VY0 A;  4W65 A;  4GA9 A;  5FZ3 A;  2CAU A;  2UYA A;  1V70 A;  1Q8O A;  1PMI A;  3EB7 A;  4N8M A;  2BNN A;  1OD3 A;  4CCL A;  4L92 A;  4XAA A;  1GQG A;  3UGH A;  3T2Q A;  3VDC A;  4XIO A;  1BBT 2;  1RUJ 2;  4A2U A;  3VHP A;  2N7G A;  5G04 L;  3VL9 A;  5FZG A;  2VQU A;  1EAH 3;  1LOC A;  3HN1 A;  1FOD 2;  1NOV A;  1RMU 3;  4ATF A;  2GP3 A;  5C8W A;  4OYU A;  3K51 A;  2IXL A;  3LEI A;  3VBO A;  1DDL A;  2V09 A;  4HKW A;  1W9W A;  2W1S A;  2XL9 A;  5L7O B;  4Y1Z A;  1DLC A;  4XPV A;  2XUM A;  5A7W A;  1T6B X;  4FPY A;  5DZG A;  5AC9 3;  2HYX A;  1K5M A;  3AKT A;  3AYA A;  4LBL A;  5FUN A;  4OZO A;  4JTO A;  3BKZ A;  3A22 A;  4Q4X 2;  1OLR A;  4W6W A;  4Y20 B;  1RVF 3;  5EQU A;  2R06 3;  4XUN A;  2QQO A;  1JN2 P;  2BGC A;  2WSV A;  1SCR A;  2QDN A;  3D0J A;  3LA3 A;  2DUO A;  4NRP A;  2JD4 A;  3T09 A;  1LHO A;  2OKX A;  3LEK A;  1C1F A;  4NHY A;  5FMD A;  1YQC A;  1PK6 C;  2GAU A;  1X36 A;  3IN9 A;  2CDO A;  1AR8 3;  3ECQ A;  4XOG A;  3RNS A;  1ULO A;  5DUW A;  2QQN A;  2ARA A;  2BRT A;  1SLB A;  1S0C A;  3IIA A;  5EIY B;  5C7G A;  2P4E A;  4CCO A;  5FO8 B;  2XBO 1;  1OBN A;  4J1X A;  4QXC A;  1H1I A;  2OPK A;  4LBK A;  3GCX A;  1SBD A;  3ZFF A;  4NE9 A;  5HV4 A;  1BEV 2;  4Q4W 1;  1JZ2 A;  3AMQ A;  4FI9 A;  1O59 A;  3DL3 A;  1OF4 A;  1LTE A;  4FFG A;  5HBA A;  1COV 3;  3ZIW A;  5C70 A;  1Y3T A;  2YGM A;  1BVV A;  2ZCW A;  1H8V A;  2EAA A;  4HG6 B;  4F3J A;  3SCG A;  2V72 A;  2NLR A;  2V5D A;  3IZO A;  1OVP A;  1XC6 A;  5JIA A;  4AE2 A;  2Z42 A;  4NAO A;  4Q4V 3;  5GKA C;  1JOB A;  5K8S A;  4JVA A;  2GMP A;  4YFZ A;  5LBB A;  1CX4 A;  5CFD A;  2VZ3 A;  4D6Q A;  3QCW A;  4N7I A;  4JDO A;  3K4Z A;  1G6N A;  4XFF A;  2PLV 1;  2P17 A;  1C1L A;  4R9D A;  4Q0V A;  4CUC A;  3NJY A;  1VBB 1;  1K5J A;  3GNE A;  3POY A;  4AFM A;  2F6B A;  4WZF A;  4FXK B;  3D6E A;  2H0V A;  2VOV A;  4B8E A;  5A7O A;  3OF1 A;  3KSC A;  2ZGL A;  1ODN A;  1TZO A;  4GAL A;  5FZD A;  4XUO A;  3ZXD A;  3WG4 A;  1NG0 A;  1JU3 A;  1JHJ A;  3LDR A;  1RIT A;  3BB6 A;  3DYP A;  4BIO A;  2O14 A;  5DPN A;  1R09 2;  1DGW X;  1RMU 1;  1UKR A;  1W8F A;  2AZ5 A;  1ENX A;  2WFP A;  4GD4 A;  4UFI A;  4XUQ A;  3T08 A;  1SDD B;  3N7L A;  4XHB A;  4ZXE A;  3LSD A;  2ZHM A;  1QJF A;  3ZYJ B;  1U5X A;  1UF2 C;  1AF9 A;  2BFU L;  2VEC A;  3J8F 3;  1MR5 A;  2ZA9 A;  5AC9 1;  1DF0 A;  3DKQ A;  3FJS A;  5DAQ A;  4KH9 A;  3VBO B;  1NA1 C;  4HOO A;  5FCC A;  4Q0P A;  3JB8 A;  1EYB A;  4CDU C;  1AL0 G;  5FYI A;  1RVF 1;  3VBF C;  5LA9 A;  5A7W B;  1FMD 3;  4CDX A;  4YVS A;  1K5M B;  4PF5 A;  3WW2 A;  2LAL A;  3IPV A;  4GB3 3;  1A3K A;  2VNO A;  4J25 A;  2BFU S;  3BI3 A;  4Q8L A;  3PMS A;  4GKX A;  1XSR A;  3N9L A;  4XBQ A;  1LR5 A;  1N3P A;  2IXH A;  2JG8 A;  4OVE A;  4LO7 A;  4LO5 B;  3ROU A;  4AGG A;  2C5D A;  5DN2 A;  5JXI A;  1AR8 1;  2DUR A;  2TEP A;  4LOS A;  3GBW A;  3NAP C;  3I2G A;  3O1U A;  1ST8 A;  2D3R A;  1BVP 1;  1O3S A;  1ZBE 2;  4M3C F;  2G9G A;  1XU2 A;  2BWC A;  3I3B A;  2E53 A;  3EHK A;  1O3T A;  4HN0 A;  2IWG B;  5A7N A;  3IWZ A;  3VBS C;  2KA3 A;  2HWD 3;  4TYS A;  3KT1 A;  2HWF 3;  1Y9G A;  3IM0 A;  5DDJ 3;  4LBQ A;  2VUL A;  5LRS A;  3O5S A;  5GLZ A;  2XG3 A;  3ZFF B;  1COV 1;  2W1Q A;  4KGQ A;  3WP3 A;  5JXJ A;  1QJU 2;  1PX4 A;  4BQW A;  2B42 B;  2VBD A;  4MZU A;  2W08 A;  4Q4V 1;  1YC6 1;  1LOG A;  3CNA A;  4B1L A;  3C7O A;  2VOK A;  4W50 A;  2OZJ A;  5FMO L;  4AK3 A;  3DV8 A;  4JX0 A;  1TE1 B;  5FZ6 A;  2Y0O A;  3ZXG A;  3B69 A;  5A3U A;  5I0S A;  1O5U A;  2XPJ A;  1ZZB A;  5AVA A;  3IKW A;  3CJI C;  2A6Y A;  1LOE A;  2ARX A;  2BWA A;  2WFF 2;  4MO3 M;  5CFD B;  1RIR A;  2Y64 A;  3PDQ A;  2FQP A;  3ILN A;  5FP3 A;  4BWO A;  2EXH A;  3AMM A;  4DOU A;  5F37 A;  3JUU A;  2BUK A;  1RUI 2;  3PU8 A;  4WM8 C;  1AR7 1;  5A3M A;  4MGT A;  2AEN A;  5J98 B;  5T5J A;  4TZD A;  2NP0 A;  4E4H A;  3H8R A;  4QGM A;  1UZZ A;  4AYU A;  3LA2 A;  3T0B A;  2Y34 A;  3ZYF A;  1TVG A;  1NXD 1;  1UU4 A;  4Y3O A;  2IXC A;  1PGW 1;  2DVG A;  2O8O A;  2X8K A;  3AP9 A;  5FLI A;  3ZKU A;  2VAU A;  4H7M A;  1RUF 2;  2VOT A;  2LTN A;  3Q8A A;  1LKN A;  3NNL A;  4LQR A;  3JQW A;  1RUE 2;  4QPG A;  2W52 A;  2VMH A;  1ALY A;  3J8F 1;  2A1X A;  3DGT A;  4BOW A;  2VCB A;  2JJ6 A;  5LA1 A;  1G8W A;  4MGI E;  4ZZ8 A;  1GZ9 A;  4D69 A;  3H0O A;  3H7Y A;  1HW5 A;  1LGC A;  1DGR A;  1IS4 A;  3O1M A;  4D7T A;  2EIG A;  4QB6 A;  4UBH A;  2GC2 A;  2VNV A;  1FMD 1;  5FYH A;  2OXB A;  3VDB A;  4GB3 1;  4NPM A;  2RS1 2;  2D93 A;  5H9R A;  1DGR N;  2XL7 A;  1WD3 A;  4Y1Y A;  3SQO A;  4CDX B;  5FZK A;  3O1R A;  2W46 A;  1ZRF A;  4AI2 A;  2VMF A;  4YG6 A;  1OOP A;  4DEQ A;  4JRL A;  2X5I C;  1DP0 A;  1LOF A;  4COV A;  2PYT A;  2Y0I A;  5FWJ A;  3WX5 A;  1ND3 A;  2JG8 B;  4Z2W A;  2D6O X;  1C4R A;  3I4I A;  4HN1 A;  3ZN6 A;  3WNO A;  5J37 A;  4HK9 A;  3POE A;  1B35 B;  4JKL A;  4DZG A;  5FZO A;  2HWD 1;  3KCC A;  2HWF 1;  1W2O A;  5DDJ 1;  3HQR A;  2FCV A;  3U4X A;  4YG0 A;  1L7R A;  1AYN 2;  1CAU A;  1K12 A;  4GXL A;  1FPN 2;  1ASJ 2;  4I01 A;  4LBQ B;  3PLQ A;  1LOD A;  4EQV A;  3I2O A;  2R30 A;  2XWB B;  3F95 A;  4NHM A;  1PX3 A;  1W8W A;  1K42 A;  1RB8 G;  3VB9 A;  1CAX A;  1BBT 3;  1RUJ 3;  2E31 A;  3KCX A;  4JQT A;  4UFK A;  1OUX A;  1D2Q A;  4LOT A;  4QM8 A;  5I91 A;  1FOD 3;  3KQR A;  4D94 A;  4LT5 A;  3UV9 A;  4DIQ A;  3O0V A;  5FOJ B;  2D6L X;  1ZZ7 A;  4PLM A;  4E8C A;  1JHN A;  1MZF A;  2GAL A;  3SKJ E;  4BMB A;  2YG0 A;  4HFS A;  2WNE A;  3I49 A;  1WGP A;  1V6O A;  5DQ0 A;  1MVQ A;  2R16 A;  4Q4X 3;  1UO9 A;  3N7M A;  1O4Y A;  2VZT A;  3VD5 A;  2BPA 2;  2XVG A;  3WZ1 A;  5D1I A;  1YJK A;  3O1S A;  1PK6 A;  1XE7 A;  2DTY A;  3FFZ A;  3JBG 2;  4QX1 A;  1OHF A;  4AW7 A;  5CU1 A;  2PFW A;  5LEK A;  2FD8 A;  2VTF A;  2E7T A;  4EN9 B;  3BYW A;  3EJK A;  3NNM A;  1CJP A;  5FZ4 A;  5IYY A;  1DIW A;  4UXA A;  5JXG A;  3PL0 A;  3WP5 A;  3N9N A;  1AX2 A;  4LNV A;  4A6S A;  2YDE A;  2WT1 A;  5GM0 A;  4BQX A;  3VDD C;  4B3N A;  1QOT A;  4IV3 C;  1LEM A;  2DVD A;  1A34 A;  2CGN A;  4E4S A;  2VXR A;  4QPG B;  2HBU A;  3ZOI A;  2ZGU A;  2ZX3 A;  2OYZ A;  3GBF A;  4QX0 A;  1BEV 3;  3SXW A;  5FOB B;  3MIG A;  2W5F A;  2A73 B;  1CIW A;  4N90 A;  2B39 A;  1C28 A;  1W90 A;  4NJ4 A;  2VCM A;  1IS3 A;  4A7K A;  5IVB A;  1O4Z A;  2PXJ A;  3BTZ A;  3MDP A;  1ZX5 A;  3LWC A;  2DCJ A;  1UY4 A;  5FPB A;  1AYM 2;  4IE5 A;  1BMV 1;  1OOP B;  4XIK A;  2IXJ A;  2VG9 A;  5AVP A;  1K3I A;  5A6X A;  1G9B A;  1T6G C;  1GYK A;  5GJ6 A;  1ND3 B;  2ID4 A;  4JC1 A;  3PVB B;  2VL4 A;  3ZN6 B;  2XWJ B;  3VKL A;  3S7I A;  2ZZJ A;  5LY1 A;  2Q8D A;  1OPM A;  2DVB A;  2HKX A;  4KBB A;  4AFC A;  2Y38 A;  1YFU A;  3MW2 A;  1XNA A;  4QPI C;  4BK5 A;  2A70 A;  3ZM8 A;  1H6X A;  2XJQ A;  2I07 B;  3VBR C;  3BOW A;  5DAV A;  1CAU B;  2PEL A;  2WLP A;  1NZC A;  5A3T A;  4RGK A;  5GAL A;  1BBT 1;  1RUJ 1;  2DYC A;  4Q26 A;  1UX7 A;  1R09 3;  5IAV A;  1GV9 A;  2PLV 2;  2PHT A;  1WWY A;  3BIW E;  1BQP A;  3DEM A;  3I3Q A;  1JOP A;  3HQU A;  5I8S A;  1MS9 A;  1FOD 1;  1QHD A;  3B00 A;  4XFC A;  1S2K A;  1NA1 A;  3ZFG C;  4KQ7 A;  4BZ4 A;  1GFF 2;  1PZ9 A;  1CAX B;  5FZC A;  4ASL A;  4OHY A;  1NCQ C;  3H3Z A;  1XNC A;  4I09 A;  4YZ3 A;  1SLI A;  1Q8P A;  4PLO A;  4LBQ D;  5JAX A;  1WA4 A;  5F2S A;  2RJL A;  2YV8 A;  4U36 A;  4JDM A;  5EJZ B;  5FZB A;  4Q4X 1;  5J36 A;  4OQ8 A;  5CYY A;  3OOX A;  2VD7 A;  4AI8 A;  2RJK A;  3KF5 A;  5C3S A;  1S0F A;  1IPK A;  4R9A A;  4CUA A;  3FN9 A;  5JXH A;  4XC9 A;  1AJK A;  1PK6 B;  1GP4 A;  2OQ6 A;  1SZB A;  3N7J A;  4LKD A;  5FY5 A;  2CDP A;  2FZ2 A;  2XKP A;  5DAP A;  4L2N A;  3VBS A;  3S30 A;  3ZSJ A;  3S57 A;  5E1R A;  4CCN A;  4UF0 B;  5BV6 A;  4BE3 A;  5FDB A;  1ZBE 3;  4AQ2 A;  4ES9 A;  1EPW A;  4R8H A;  4ZS3 A;  1QWR A;  3ITQ A;  5DXD A;  3AL5 A;  2VJX A;  3JU9 A;  4FTE A;  4Q5O A;  4FTB A;  1RUH 2;  3OBZ A;  5DAB A;  4AOC A;  3C3V A;  1XE8 A;  4L11 A;  3K4A A;  1PVC 2;  1RIN A;  1NE6 A;  4BH9 A;  4WVW A;  1AR8 2;  1A8D A;  3GZT B;  4FQZ A;  3N9O A;  1QJU 3;  3WNX A;  3PHM A;  4BQ5 A;  5JI9 A;  4BQ4 A;  1APN A;  2QQW A;  5FY4 A;  4Y26 A;  3CJI A;  4GWN A;  3WF4 A;  3ZLI A;  4CCE A;  2GND A;  3SLI A;  4CDW C;  5IFT A;  4K6B A;  3TWI A;  3W21 A;  1LRH A;  1FNZ A;  1LOA A;  3E97 A;  1Q8S A;  3VD4 A;  3LA7 A;  1O91 A;  1X9P A;  4WM8 A;  4Q0Q A;  5ABJ A;  2WFF 3;  4AQT A;  5LAT A;  4YNI A;  4NWV A;  4YZ2 A;  2WYF A;  3FC0 A;  2FBE A;  1J59 A;  1HKD A;  4NIG A;  5FP7 A;  2RDR A;  4AF9 A;  3H9A A;  4MSV A;  1IG0 A;  3GZE A;  5IVY A;  4URT A;  4P14 A;  5CVR A;  1RUI 3;  5HCH A;  4XF9 A;  2JEC A;  2MEV 2;  1YJL A;  3D4K A;  1DGW A;  1ZZ6 A;  1HV0 A;  1N3O A;  1GNY A;  1SFY A;  5J96 B;  3MW4 A;  1R09 1;  3AB0 A;  2WAA A;  5E16 A;  3C7G A;  1NQD A;  2CWS A;  3I2K A;  1AR6 2;  1H8T C;  1HN1 A;  1MZE A;  1UMH A;  2VVD A;  3OEB A;  3MV1 1;  4NHX A;  4QX5 A;  2OA2 A;  5FLJ A;  1RUF 3;  4ORF A;  4URA A;  4XE9 A;  1RXF A;  1FAY A;  2QJV A;  1RUE 3;  2WZR 2;  1AR7 2;  4QPY A;  1NA1 B;  3T0A A;  3CBN A;  2BQP A;  4CDU B;  2CHH A;  2PHR A;  4UW5 A;  3VBF B;  3B01 A;  2JDP A;  4QDR A;  2JB4 A;  4MXV A;  5FZE A;  1FI2 A;  1YEW A;  3CQO A;  4AHW A;  3AJZ A;  3GJB A;  2XON A;  5L73 A;  2X5I A;  3PJQ A;  2H6B A;  1KD7 A;  2IFR A;  4WBB A;  2WSU A;  2ADD A;  2ZX1 A;  5FPV A;  1W8Z A;  4UAP A;  1IPJ A;  5AFE A;  1VRB A;  2P5B A;  3VBH C;  5C3Q A;  3RZG A;  3KM5 A;  1HB1 A;  3LPF A;  3ZPY A;  4JKM A;  3NAP B;  5IJR A;  4UT5 A;  1GLH A;  2W87 A;  1RUN A;  1B09 A;  2CWM A;  2BOJ A;  2XXZ A;  2YBP A;  3GXU A;  1ZBE 1;  1VJ2 A;  3MLK A;  4JV4 A;  4MGZ E;  1POQ A;  5JR7 B;  1QNY A;  4RA0 A;  5EHD A;  1JYV A;  4CCC A;  1W9S A;  5K0U C;  1RXG A;  3KMH A;  4N53 C;  4PHZ A;  5K4L A;  3VBS B;  3LB9 A;  3POG A;  4MG2 A;  5KHH A;  1LOB A;  4A45 A;  5IVJ A;  1DBN A;  2DFB A;  1X8E A;  4B1M A;  2VPV A;  4OI2 A;  1J1L A;  3R0R A;  4YVS C;  1KJL A;  2P2K A;  1LNS A;  4OI4 A;  1AYN 3;  4AVS A;  2VVE A;  2ZPX A;  3BAL A;  4R4X A;  2MHF A;  1QJU 1;  2RE9 A;  4XJZ A;  5D21 A;  1FPN 3;  4LLO A;  1ASJ 3;  2MNG A;  1DZT A;  5JR2 A;  5M0T A;  1SEF A;  4NVP A;  4MGY E;  4W8J A;  1C5I A;  2VW2 A;  2FHR A;  2XHN A;  5EP9 A;  1RYY A;  5ACA 2;  3UKV A;  1W06 A;  1URX A;  5LK5 A;  1KFU L;  4YM3 A;  1EPZ A;  3PUR A;  3LOB A;  5LY2 A;  4OHZ A;  1SAC A;  2UY9 A;  1UNB A;  3RZM A;  5BYN A;  1OA4 A;  3WY6 A;  3ZIX A;  3WW3 A;  3ME2 A;  1U5Z A;  5IT6 A;  4TXW A;  4HAN A;  3D0S A;  5F3C A;  3O12 A;  3DEC A;  4L99 A;  5T3N A;  4CXW A;  3HD8 B;  4WM8 B;  3LKJ A;  4GKY A;  3M70 A;  4RR3 C;  5LBE A;  4BA6 A;  5JOZ A;  4GIQ A;  2SLI A;  1RUI 1;  5LEJ A;  3HMY A;  3Q8C A;  1FX5 A;  1MS3 A;  4FPF A;  1XYP A;  2UWA A;  3LIG A;  5CG9 A;  2D5H A;  2CY6 A;  2HEY F;  2LW8 A;  1H2M A;  3WG1 A;  3LAG A;  1UU5 A;  1REF A;  1FV3 A;  3EQE A;  4FFH A;  3JBG 3;  2HWB 2;  1NE4 A;  4XXA A;  4MUV A;  3DUI A;  1YHF A;  3R4S A;  1SBE A;  4FP2 A;  3MYX A;  2SBA A;  3URF A;  4COY A;  5DAW A;  1VB2 A;  4IV3 A;  3RYR A;  3SNM A;  5F3G A;  3E5X A;  1XBF A;  2WDB A;  3OGJ A;  1RUF 1;  2Q4S A;  3FE5 A;  1ULP A;  2WS9 2;  3VGI A;  5KHI A;  3ORJ A;  3OY8 A;  2B8M A;  1VMJ A;  3WOG A;  1RUE 1;  4AAP A;  4IE4 A;  5A70 A;  5AFB A;  1CX1 A;  2VC9 A;  2ZGK A;  3BPZ A;  3LDB A;  3UKN A;  4XQ4 A;  5LWB A;  4PQQ A;  1AXK A;  4LA2 A;  3V65 A;  2JE7 A;  5L19 A;  5F6K A;  1QKQ A;  3KQ4 B;  3H50 A;  5IFP A;  1JOJ A;  4DS0 A;  1HX6 A;  1QH6 A;  2YC4 A;  3THT A;  2VME A;  5KR7 A;  2VUJ A;  5FKB A;  4XF4 A;  2CL2 A;  4JCK A;  1Q5O A;  2Q1F A;  2EXI A;  2RS5 1;  4IXL A;  3SEP A;  2ZX2 A;  1I5P A;  3PNA A;  3AZW A;  4EN0 A;  2UWC A;  2X5I B;  1YFX A;  5FZ1 A;  2GC3 A;  1KS4 A;  3V0A A;  1W6N A;  2BVV A;  5G05 L;  1OVS A;  1ZVF A;  1W2U A;  2ZML A;  1TQ5 A;  4YW2 A;  1AYM 3;  2ZGQ A;  4UI9 L;  1RGS A;  1UY3 A;  1QOO A;  4KWU A;  4IEY A;  2A6X A;  3BVC A;  5LW9 A;  1GZC A;  2IZW A;  3MEP A;  4FPO B;  1SFP A;  4XCB A;  2JD9 A;  4OUL A;  4Q27 A;  3U4S A;  4KMQ A;  3VBR A;  3K48 A;  3JCI A;  5FY7 A;  4LO6 B;  4OLL A;  1UIJ A;  3H42 B;  3NVC A;  4XFB A;  4UOJ A;  5T55 A;  3UET A;  3O1P A;  3L2Y A;  1AYN 1;  2PHD A;  3FHA A;  5BNQ A;  2RR1 2;  4XET A;  5IVV A;  5K9Y A;  1FPN 1;  1ASJ 1;  2E33 A;  3AC0 A;  4LJH A;  4PT6 A;  5FIX A;  2BEO A;  3GDB A;  3ZFG A;  4ZU7 A;  3ZXK A;  5ERL A;  3AXD A;  3LE0 A;  2A75 A;  4RS5 C;  1PM4 A;  2XQX A;  4CEY C;  4CCM A;  1NCQ A;  4YAR A;  5JIU A;  5JSO A;  4AHZ A;  3MF9 A;  2EA7 A;  2XB6 C;  4LLF A;  4NAM A;  1W3X A;  3MHZ A;  2FDK A;  1UU6 A;  1UKG A;  3MIH A;  4Q29 A;  4UFL A;  5SV8 A;  4AI1 A;  4WVM A;  2YGL A;  3KF3 A;  4IGO A;  3RYP A;  4I0A A;  1S4C A;  5J1X A;  3HBZ A;  4AVA A;  4B29 A;  1JXN A;  5FTT C;  5HPO A;  5BUV A;  5JWP A;  4QMA A;  5T5L A;  3SIT A;  1D0G A;  4LMF A;  1WCK A;  3I7D A;  3U0Z A;  3DYO A;  4NRQ A;  2B9U A;  2KD7 A;  3VKN A;  3SHR A;  1CON A;  3JZV A;  2R1B A;  3LZZ A;  3OBA A;  4OZX A;  2E26 A;  3NL1 A;  3JBG 1;  4M3C E;  1BYH A;  4FPC A;  2DBI A;  3LIH A;  2DF7 A;  4AQS A;  1GP6 A;  2VZP A;  4MET A;  1LU1 A;  1WCU A;  3JB4 C;  3NO8 A;  4KI5 M;  2ORZ A;  5CKN A;  4A42 A;  1UY2 A;  4RN5 A;  3VDD B;  2WNV A;  3WVJ A;  4IV3 B;  5EFU A;  4ASK A;  5F5Q A;  5JZG A;  1OC1 A;  2O1Q A;  3KT4 A;  4NIA A;  2PMW B;  4E2Q A;  5LRR A;  1W6O A;  4UW6 A;  2WJS A;  3OY8 B;  5F3E A;  3PU3 A;  5GLU A;  4ET7 A;  3KGL A;  2WQ4 A;  1RUH 3;  2VOX A;  3PIJ A;  3QD6 A;  4Q8K A;  5D8A C;  1ENS A;  5CB7 A;  4QQ2 A;  1QXR A;  4H14 A;  3WCR A;  4M4P A;  3TEX A;  2UY8 A;  1IG3 A;  1PVC 3;  1KS5 A;  4HKO A;  3QLQ A;  2PA7 A;  4LE4 A;  4Y1V A;  3RWK X;  5F7U A;  1Z7S 2;  1VLN A;  1QDC A;  4XYX A;  1YQ2 A;  2W9X A;  1CES A;  1WW7 A;  2WQ8 A;  1CR7 A;  4HMZ A;  1GAN A;  2UYB A;  4Z07 A;  4CDW A;  4EWD A;  3EMR A;  2AGS A;  3BCW A;  3O1T A;  4OI0 A;  1WW5 A;  4MAD A;  1I6X A;  1I5Z A;  1V6N A;  4AFB A;  3IMN A;  1W2A X;  1AYM 1;  2D98 A;  3V0A B;  3KV4 A;  2WZ8 A;  2ZX0 A;  1W6N B;  4Y4Y A;  1OH3 A;  3LFM A;  4NOT A;  1V6I A;  4RFT 0;  2QNK A;  5LBF A;  2PAE A;  3AFK A;  1OT5 A;  1EP0 A;  3A0K A;  3AZX A;  4BYY A;  1GQH A;  1OUS A;  2X53 S;  1O6U A;  3WV6 A;  4DB5 A;  3FBM A;  3PVE A;  4QPI B;  3OGG A;  2W92 A;  2JDU A;  5FQ0 B;  4D3W A;  5C4W C;  5KWR A;  3E1F 1;  1NUK A;  2FZ1 A;  2C6S A;  1SQ4 A;  4LO8 A;  3VBR B;  1I1E A;  3IB3 A;  1H8T A;  2HYK A;  1FNY A;  3III A;  2MEV 3;  2VNG A;  4QHZ A;  2KR2 A;  4TTG A;  1O3R A;  1PMJ X;  4FOV A;  1PNG A;  2E51 A;  2FDJ A;  4GJZ A;  3LGR A;  5CNA A;  2VZR A;  3H3U A;  3O0X A;  4EYU A;  4CUB A;  2Z2S B;  1AR6 3;  3A23 A;  3ZFG B;  1CAW A;  2Z5W A;  3NST A;  4FCA A;  3ZXJ A;  1CZS A;  3V64 A;  1YCI A;  1NCQ B;  4K7J A;  3CO2 A;  3HAG A;  3MO4 A;  3ZDS A;  3O1O A;  5A7Q A;  1DCS A;  1R08 1;  1UPS A;  1VMH A;  2Q0A A;  5KBF A;  3QH6 A;  2QQJ A;  2WZR 3;  1AR7 3;  2W95 A;  4A6O A;  2PHX A;  4WVM B;  3RZJ A;  1BJQ A;  2VZQ A;  1OQE A;  2GC1 A;  3ZO0 B;  1E57 A;  1S1A A;  3WF1 A;  5B4X A;  3U10 A;  1LHU A;  2PTM A;  1IZ3 A;  3LPG A;  1VMF A;  3IDE A;  4R9B A;  3VBH A;  4XJU A;  1C5H A;  4C0H A;  2BNM A;  2K9Z A;  4LBJ A;  3H1M A;  4CU7 A;  1Z78 A;  4NMI A;  4OCT A;  2FDG A;  1QJZ A;  2YXS A;  2X09 A;  4HKL A;  5KHJ A;  3K2O A;  3MI8 A;  3AKS A;  5FYV A;  1XXN A;  5K0U A;  4N53 A;  2H6C A;  2ETE A;  3DCQ A;  1HN0 A; 
#chains in the Genus database with same CATH homology
 3PUI A;  5EJ1 B;  3HEI A;  1F4H A;  3CMG A;  1D7P M;  3VDA A;  1J84 A;  2X05 A;  3WNL A;  4E8C A;  4CU6 A;  2BZD A;  3SKJ E;  2YG0 A;  1WCQ A;  5DQ0 A;  2EIB A;  2QQL A;  3FHQ A;  2BBA A;  4MGS A;  2VZT A;  3VD5 A;  2ORX A;  4DXT A;  4DEV A;  2VZS A;  4QX1 A;  4GZ9 A;  1JYW A;  3W5M A;  2VTF A;  3THD A;  1CZV A;  2C26 A;  4M4R A;  4RYD A;  5IYY A;  5JXG A;  3WQB A;  3HNM A;  2VZV A;  1GU3 A;  3CZU A;  4QX2 A;  4ARX A;  1JZ4 A;  3MBW A;  2QBX A;  4YPJ A;  2Y6H A;  4A44 A;  3OGR A;  4BXS V;  4QX0 A;  4P08 A;  1SHW B;  1NAE A;  2W5F A;  3MV0 1;  2W94 A;  2VR4 A;  3CZJ A;  4ARY A;  2J1R A;  4LHS A;  4DXR A;  3A21 A;  1J83 A;  4OMD A;  2YFU A;  3PUH A;  4ZZ5 A;  5LCW L;  2J22 A;  3I2F A;  3ACI A;  2VZU A;  2QQK A;  2DCJ A;  1UY4 A;  4JHZ A;  1KGY A;  2V4V A;  1K3I A;  3J7H A;  2Y8K A;  2EIC A;  2ID4 A;  4XUP A;  2VL4 A;  4MGQ A;  1JZ6 A;  4A3Z A;  3HN3 A;  4BK5 A;  1XNA A;  3U37 A;  4QDS A;  1UYZ A;  3OEA A;  1XNT A;  3ZM8 A;  1H6X A;  4LKS A;  3JXS A;  1UX7 A;  3P1I A;  1W8O A;  1L7Q A;  1WKY A;  2ZEW A;  4DUW A;  1JU4 A;  3CIH A;  4JKK A;  3NJX A;  3MUZ 1;  1TG7 A;  4D8M A;  2R7E B;  3F2Z A;  5EJZ B;  1H6Y A;  4AG4 A;  5B4N A;  1F4A A;  1UYY A;  5CYY A;  3IAQ A;  3I2H A;  1GUI A;  2ZEY A;  3DYM A;  4CUA A;  3FN9 A;  5JXH A;  2VM9 A;  3VD3 A;  4Z2A A;  2CDP A;  2J1V A;  4P02 B;  4BDV B;  3P6B A;  4GWI A;  1DYO A;  2J1U A;  2VJX A;  3ACF A;  1KEX A;  1PMH X;  3SEE A;  3K4A A;  4PF1 A;  2J7M A;  4QX3 A;  4DUV A;  3LEG A;  3WSO A;  2C9K A;  3THC A;  2VZO A;  1BHG A;  2Y6J A;  3WF4 A;  2WO2 A;  1OF3 A;  3CKH A;  5FUI A;  5IFT A;  4XVH A;  3K75 B;  2WN2 A;  3VD4 A;  1GMM A;  2E32 A;  3GM8 A;  3MUY 1;  2W47 A;  1UYX A;  4IUG A;  3HNB M;  4GWJ A;  3HJR A;  3OGS A;  3EYP A;  2YFZ A;  3K77 A;  3GGL A;  1JI6 A;  3NQH A;  4P00 B;  4DXS A;  1GNY A;  3FL7 A;  2WAA A;  1NKG A;  3C7G A;  3I2K A;  3K46 A;  1W9T A;  1GOF A;  3WNP A;  1HN1 A;  1UMH A;  1K45 A;  3OEB A;  3MV1 1;  3IDA A;  4A41 A;  1T2X A;  2ZXQ A;  4QB2 A;  3C7E A;  4CU8 A;  2JE8 A;  2WAB A;  3T0A A;  4LPL A;  2WO1 A;  2VQT A;  3OB8 A;  4QDR A;  2WO3 A;  3CQO A;  4OUE A;  3EB7 A;  1OD3 A;  2XON A;  4ZY9 A;  3T2Q A;  3VDC A;  2J1S A;  4UAP A;  1CZT A;  4AAX A;  2B4K A;  5G04 L;  3LPF A;  1UXZ A;  2VQU A;  4JKM A;  5IJR A;  2W87 A;  2HLE A;  3BN6 A;  4OYU A;  3GXU A;  3LEI A;  1JYX A;  1W9W A;  2W1S A;  4CVU A;  1JYV A;  1DLC A;  2JKX A;  1W9S A;  2BER A;  2HYX A;  4OZO A;  4A45 A;  3A22 A;  3C7F A;  2EIE A;  3SKV A;  4XUN A;  2QQO A;  1LNS A;  1O8S A;  3T0D A;  1OH4 A;  1UY1 A;  1US3 A;  5JR2 A;  2ZEX A;  3VD9 A;  2VO5 A;  4W8J A;  2XHN A;  3T2P A;  3T09 A;  2JDA A;  1RYY A;  2OKX A;  4BJ0 A;  3LEK A;  1GOG A;  2W91 A;  2CDO A;  3ECQ A;  4L0P A;  1ULO A;  2QQN A;  2YC2 A;  5EIY B;  5C7G A;  4TXW A;  3NNG A;  3DEC A;  5JMO A;  1EUT A;  1JZ2 A;  4FI9 A;  1O59 A;  2W1U A;  1OF4 A;  3WEZ A;  2LW8 A;  5C70 A;  4HG6 B;  1US2 A;  4XUT A;  2V72 A;  2YB7 A;  2V5D A;  4P5Y A;  1XC6 A;  2J1E A;  1GQP A;  2VZ3 A;  2WDB A;  1ULP A;  3NRU A;  3K4Z A;  1CX1 A;  2VC9 A;  4XZU G;  4CUC A;  4PQQ A;  1IQD C;  5IFP A;  4XUO A;  3CDZ B;  2YC4 A;  1JU3 A;  1JHJ A;  2VME A;  2BGP A;  3DYP A;  3WF3 A;  3UNP A;  2DDU A;  3SEP A;  5DPN A;  1JZ3 A;  1I5P A;  2XOM A;  1O8P A;  3WF0 A;  5G05 L;  4XUQ A;  3T08 A;  1SDD B;  2Y6G A;  4ZXE A;  4UI9 L;  1UY3 A;  3ACG A;  2RJ2 A;  3I97 A;  4KWU A;  4A4A A;  2VMD A;  1P8J A;  2WZE A;  1JZ8 A;  2JD9 A;  4KMQ A;  4UOJ A;  3UET A;  4E8D A;  3HNY M;  3FHA A;  2C4X A;  1EUU A;  2WYS A;  2VZ1 A;  3I2J A;  2E33 A;  3AC0 A;  4PT6 A;  4D0Q A;  3GDB A;  3LE0 A;  1UY0 A;  2J1T A;  2XQX A;  1UWW A;  3BGA A;  2Y6K A;  5DN2 A;  5JXI A;  3WNM A;  1W0N A;  3I2G A;  2Z4F A;  2VCA A;  3I3B A;  5J1X A;  3A7Q A;  5HPO A;  5HXM A;  2VMC A;  4CU9 A;  3DYO A;  3I3D A;  2KD7 A;  1UMI A;  2W1W A;  2Y6L A;  3I2I A;  5JXJ A;  2W1Q A;  3OBA A;  5I0D A;  2E26 A;  1PX4 A;  4OMC A;  5IHR A;  2VZP A;  3C7O A;  4W50 A;  4KI5 M;  2DCK A;  2ORZ A;  4JX0 A;  3VD7 A;  4A42 A;  1UY2 A;  3WNN A;  3HPN A;  4RN5 A;  2QQM A;  1XPW A;  4MO3 M;  3HOB A;  3WNK A;  2L9L A;  2WAO A;  1JZ7 A;  2WN3 A;  2Y64 A;  4ET7 A;  5CZK A;  3C7H A;  3ETP A;  5C71 A;  1NX9 A;  3W5N A;  2VCC A;  4M4P A;  1R64 A;  3LQC A;  5F7U A;  2J1A A;  5DMY A;  3T0B A;  1YQ2 A;  2W9X A;  1UZ0 A;  2WQ8 A;  3WF2 A;  1TVG A;  4QPW A;  4MAD A;  2VOT A;  2PQS A;  4LQR A;  5JUV A;  2WZ8 A;  2VCB A;  5LA1 A;  1W8N A;  3I3E A;  4ZZ8 A;  1OT5 A;  4QAW A;  3OG2 A;  4XUR A;  4QDQ A;  2BGO A;  2LS6 A;  2RVA A;  4QB6 A;  2W92 A;  2W3J A;  2WBK A;  3E1F 1;  1NUK A;  1JYN A;  3VDB A;  3T2O A;  4W4Z A;  3IB3 A;  2WUH A;  3III A;  3IAP A;  3D3A A;  1SG3 A;  4TTG A;  2W46 A;  1PMJ X;  3NJV A;  2VMF A;  4DEQ A;  1GOH A;  2VZR A;  5LA0 A;  3OGV A;  4CUB A;  1DP0 A;  3A23 A;  3ACH A;  5A1A A;  3UES A;  1CZS A;  3C8X A;  4QB1 A;  3MO4 A;  3WNO A;  2B9V A;  2QQJ A;  4JKL A;  2W95 A;  4A6O A;  1W99 A;  2X10 A;  2VZQ A;  3K4D A;  2QQI A;  3WF1 A;  2EID A;  5LA2 A;  5B4X A;  1L7R A;  1K12 A;  3LPG A;  4MOA A;  4CU7 A;  4BK4 A;  1JZ5 A;  2ZEZ A;  1PX3 A;  2X09 A;  1UXX X;  1CIY A;  1K42 A;  2E31 A;  4DUX A;  1MPX A;  3ABZ A;  2RV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...