1CZSA

Crystal structure of the c2 domain of human coagulation factor v: complex with phenylmercury
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
GCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COAGULATION FACTOR V)
publication title Crystal structures of the membrane-binding C2 domain of human coagulation factor V.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1czsA00
2DCKA 2WZEA 2VL4A 1RYYA 2JDAA 4AG4A 3J7HA 4ZZ8A 5IYYA 2L9LA 2VQTA 2W1QA 4XZUG 2C26A 4MGQA 4XUPA 2VZRA 1OT5A 4QAWA 2WZ8A 4A4AA 2QQIA 2Y6JA 2YFZA 2Y6HA 1W9TA 2RV9A 3C7GA 4UOJA 1EUTA 3WNKA 3DYMA 3CQOA 2QQNA 3K77A 3ACGA 4QB2A 2VZ1A 4BK4A 1F4AA 3OG2A 3I3DA 2YC2A 2WYSA 3ACIA 4M4PA 3T2QA 1CZSA 3HEIA 2VJXA 3I2IA 1W8NA 2ZXQA 4MO3M 1GNYA 2CDPA 2W91A 3HPNA 3VDCA 1SG3A 1TG7A 2WAAA 2Y8KA 3HNMA 5IHRA 3NNGA 4DEQA 2QQMA 4ZXEA 4QDRA 2YFUA 2ZEZA 5JXHA 4OUEA 4ZY9A 3LEKA 2J1SA 2W47A 2VO5A 1UWWA 5G04L 3UNPA 3C7FA 5JXIA 4QB6A 5DPNA 3T09A 1GUIA 4DXTA 1W99A 2W3JA 2VZPA 1K3IA 4CUCA 3GDBA 3T0BA 4L0PA 4HG6B 1K45A 1UXXX 3E1F1 4DUWA 3CKHA 2JE8A 2W94A 2VZVA 1KEXA 2J1VA 2QQKA 3FL7A 1JYWA 3GGLA 5IFTA 3K4ZA 2W1UA 4PQQA 1JZ2A 3P6BA 2YG0A 3AC0A 4XUOA 1SHWB 1US2A 4XUNA 1PX4A 2BGPA 2ORXA 4LKSA 3W5MA 3UESA 2JD9A 3WF2A 1JZ3A 3EYPA 4P02B 2V4VA 1O8PA 3VD3A 3SKVA 2J1TA 3WNLA 5B4NA 1KGYA 1JYXA 4XUQA 2VZOA 2OKXA 1JU4A 5DQ0A 1OH4A 1JZ7A 1OF4A 2PQSA 1CX1A 2BGOA 3IDAA 3LQCA 1SDDB 3OEAA 4W4ZA 2Y6LA 5EJZB 1UYXA 3ZM8A 1BHGA 3FN9A 1JI6A 2WBKA 4W8JA 1JHJA 1WKYA 2BERA 3WNOA 4QB1A 1UY1A 4BK5A 3HNYM 3K4DA 3NJVA 2B4KA 3IB3A 1JZ8A 3VDAA 4KI5M 3I3BA 2Y6GA 3SEEA 3VD9A 5JXGA 4IUGA 2QQLA 4KWUA 3WF1A 4E8CA 2QQOA 2WDBA 1H6XA 1YQ2A 3ECQA 3LPFA 1XC6A 3LE0A 3WF0A 1HN1A 3CZJA 3K75B 1UYYA 2DDUA 5CYYA 3W5NA 1P8JA 4TXWA 1K12A 1DYOA 1PX3A 2EIEA 3PUIA 3CDZB 3LPGA 4CU7A 1UYZA 4CU8A 3NJXA 1NAEA 4QDSA 4RYDA 3BN6A 5HPOA 4KMQA 2XQXA 2HLEA 4OZOA 3OGVA 4P5YA 4Z2AA 5EJ1B 1UMHA 4XUTA 1XNAA 2EIDA 2W87A 3MO4A 5IFPA 3K46A 4CU9A 3IAQA 1GOHA 4ARYA 4JKKA 5DN2A 5C71A 4P00B 1UY4A 3MUY1 2VZUA 1OF3A 4P08A 2CDOA 1L7RA 1LNSA 1W9SA 1GU3A 1O59A 2X10A 4CVUA 4OMDA 3WEZA 1EUUA 4JKLA 2W1WA 3C7OA 1IQDC 1GOGA 5LA2A 4DUXA 1UY2A 2WUHA 1GOFA 2VQUA 1DLCA 3C7EA 2X05A 2VM9A 2J22A 2WO1A 4CU6A 3WQBA 4BXSV 3T08A 1J84A 4ARXA 3A23A 3CZUA 3OB8A 2RJ2A 5FUIA 4ZZ5A 2W5FA 1PMHX 3HNBM 2WAOA 2VR4A 2J1AA 1PMJX 3SEPA 4BDVB 2C4XA 2ZEYA 3VD4A 3PUHA 3I3EA 1UX7A 3OGSA 4UAPA 2W46A 3EB7A 1UY3A 1WCQA 2V5DA 3C8XA 4D0QA 2VZ3A 3T0DA 2VC9A 1I5PA 2WABA 3D3AA 2J7MA 5JMOA 2X09A 2VCBA 3WSOA 3DYPA 1W9WA 2E26A 2VMFA 3SKJE 1JYNA 2ZEXA 4CUBA 1O8SA 3ETPA 4QX2A 4MOAA 5F7UA 3ACHA 2KD7A 3IAPA 3BGAA 2W92A 3DYOA 2VTFA 2W95A 1JYVA 3OEBA 2JKXA 4QX0A 1D7PM 2Y64A 2VMEA 3F2ZA 3HOBA 3MBWA 3IIIA 2E33A 3MUZ1 3WF4A 5LA0A 1L7QA 1W8OA 3GM8A 3WNPA 2Y6KA 2QQJA 4AAXA 5J1XA 2RVAA 4XURA 4DEVA 2VZTA 2LW8A 3GXUA 5G05L 3WNMA 5C7GA 1JU3A 3T2PA 3OGRA 4CUAA 4JKMA 1JZ5A 3ABZA 3I2GA 4A41A 3OBAA 1XNTA 3VD7A 4OMCA 4TTGA 1ULOA 4A45A 1JZ6A 4QX3A 5CZKA 2ID4A 5HXMA 3I2HA 3HJRA 1UZ0A 1W0NA 3A22A 4QPWA 1CIYA 1DP0A 3I2FA 1US3A 3FHAA 5JR2A 5JXJA 3CIHA 2V72A 2VOTA 4A44A 1UMIA 3T2OA 3NRUA 3I2KA 3LEIA 2VMDA 5C70A 3JXSA 1CZVA 4A3ZA 2C9KA 2WN3A 3I97A 1NUKA 2BZDA 3LEGA 2WN2A 1K42A 1ULPA 1TVGA 1GMMA 5LCWL 5I0DA 3ACFA 4YPJA 4OYUA 2VZQA 4PT6A 2J1RA 2WQ8A 2BBAA 2XHNA 1NKGA 3A21A 5A1AA 2EIBA 3THDA 2J1UA 4PF1A 4UI9L 2VZSA 2LS6A 2VCAA 3UETA 2DCJA 2W1SA 4DUVA 5JUVA 2B9VA 4LHSA 4QX1A 1OD3A 3VDBA 4DXSA 2YC4A 3HN3A 4DXRA 1JZ4A 2Z4FA 4E8DA 4BJ0A 5LA1A 2ORZA 4MADA 2VMCA 5DMYA 4LPLA 2E31A 1F4HA 3WF3A 2WO3A 3FHQA 2VCCA 2XONA 2J1EA 3DECA 2HYXA 4D8MA 1T2XA 1R64A 2WO2A 4JX0A 4LQRA 1MPXA 1J83A 2R7EB 3P1IA 2XOMA 1GQPA 3U37A 1NX9A 4JHZA 4MGSA 1XPWA 3I2JA 4ET7A 2W9XA 3WNNA 3NQHA 4W50A 4GWJA 3MV11 5IJRA 3VD5A 2QBXA 1H6YA 4GWIA 3A7QA 3THCA 2ZEWA 3MV01 1UY0A 3CMGA 4RN5A 3K4AA 5EIYB 5B4XA 4XVHA 4M4RA 1CZTA 4FI9A 1UXZA 2EICA 2YB7A 4GZ9A 4A42A 2E32A 4QDQA 3T0AA 4A6OA 3C7HA
chains in the Genus database with same CATH superfamily
2VL4A 3DGTA 2JDAA 1QY4A 2UY8A 3J7HA 5FMOS 5FP8A 2RS33 1AR92 2L9LA 4XAAA 1G9FA 2AEZA 2W1QA 3NAPC 4CCDA 4FOVA 2BTVC 5DG2A 4AGGA 4BISA 2DVAA 5JOZA 3LDKA 3VBRC 2VZRA 4ASLA 4OHVA 4PDWC 4QAWA 4OHYA 4D7YA 4Z07A 5L9BA 1CJDA 2VBBA 1IKQA 1WWYA 3DXUA 4L9BA 1NQDA 2YPDA 4O61A 4IDZA 4Z82A 5BPXA 2C0ZA 3T3YA 4AQ6A 4NRQA 3VHNA 1PZ7A 4J25A 1RUD2 5FP9A 4UOJA 2BJSA 3DYMA 2H0BA 5FO7B 2AEYA 3UK9A 4SBVA 4QKNA 1UL9A 4FOWA 3JD71 3ILFA 3AYEA 3O1UA 1OQEA 1S0CA 2FZ2A 2PHTA 3POYA 5H9RA 4QB2A 2UURA 4LA2A 5LK5A 1R092 4AE2A 5DAWA 1RUJ2 3BIEA 2NM1A 3E6CC 3NAPA 4GD4A 1F5FA 3ACIA 1VJ2A 3GJAA 2ARXA 2BYVE 1CZSA 3D0JA 3EO6A 3IDCB 5IK5A 1QH7A 4MVTA 1JUHA 1GNYA 2CDPA 2ZGLA 2QQWA 3NV1A 5FZ8A 3VBUB 1VRH1 4UW4A 1AXZA 4QT6A 3GJBA 1AR62 3U4XA 3JBG2 4XXAA 4EROA 5IT6A 3H8RA 5IHRA 4XFIA 2LALA 2VPVA 1DGWX 4DEQA 3NO8A 1BBT3 3VBUA 2CGNA 1MQTC 2OPKA 4NRPA 3CJXA 2A5ZA 5IK7A 5F37A 1GWKA 2VY0A 2YC0A 1PVC2 2RDSA 3OUIA 3OPTA 4QX5A 4LE4A 1BVVA 2Z79A 2FCTA 2GP3A 2BPA2 3C7FA 5JXIA 2R071 5FQ0B 1FAYA 2FMYA 3H3ZA 1GUIA 4DMIA 2C5DA 2R30A 1XYPA 4X6RB 1W99A 1OH3A 1XNDA 4CUCA 1TNRA 3GDBA 1NT0A 3T0BA 1HXS1 5JSPA 4RGAA 3A0NA 1QXRA 2D3PA 1K45A 1UXXX 4W65A 4AVBA 3RZHA 3E1F1 4YW1A 5SV5A 4DUWA 3ON7A 5EZWA 3MLLA 2G9ZA 5BNNC 3AB0A 2EXHA 3RWKX 5FQ0A 2W94A 2VZVA 1KEXA 2QZ3A 5FY4A 3ZXDA 4BQ1A 2QQKA 3FWEA 4TLFA 2HEVF 1AZDA 1TZOA 5I0RA 1V6LA 3WQ1A 4BMEA 4PIXA 1MZ6A 3P6BA 2B5HA 4JDMA 2BUKA 3H8XA 1UOBA 4E2SA 1PM4A 1SHWB 1US2A 4Q0VA 5FBJA 2VTXJ 3CBNA 3LSDA 4IGPA 4MX3A 5FZCA 2XJRA 2JD9A 1JZ3A 3EYPA 3HMYA 3VZJA 3BU7A 2UYAA 1KDKA 2R043 2PYTA 1OLME 3ZYIB 3KWVA 1QJU3 4MGKE 1SEFA 3APBA 2BOJA 5KHGA 1OHFA 3VBFB 3PUQA 3AVSA 1CAXB 2AUYA 4XEZA 1GP6A 3SCFA 4LNVA 3NKTA 3RZZA 1QIQA 2XWJB 2LUWA 2Y6LA 2ZGPA 5EV7A 1NCRC 3FN9A 1WCDJ 4RHV1 3J4UH 5BY5A 4NIHA 4IV3C 1V0AA 1RHI1 3C2UA 3VBFA 1VBC2 4Q4W3 3KQRA 4K9SA 4OUMA 5F5AA 1U5YA 3OGJA 4RFT0 3ZFGC 3AZXA 2DVDA 4BK5A 1U0AA 5FR3A 5E88A 3HNYM 1UX6A 1DZQA 3ZN4A 2JKBA 4XFFA 3I2DA 4YG3A 3VDAA 4KI5M 1W0OA 3UKTA 4RD7A 1XSQA 2TEPA 5SV8A 3VD9A 2ZS6B 3CHXA 4QHZA 3WF1A 1SCSA 2IXJA 2OIIA 2C6SA 4WM8C 5ISLA 5C8WA 3FFQA 4NE9A 4LBNA 4URAA 4TWTA 1CQ9A 4WVVA 1RJ7A 2FMDA 3KV5A 1W2TA 2IVIB 5CYYA 4ZHNA 4Y1YA 2CWSA 4TXWA 2OUHA 3PDQA 3WCSA 5A6QA 1NA1C 1VP6A 3WP3A 4RS5C 5DUUA 5FRAA 1PO23 4YM3A 1PX3A 1UD1A 2VUAA 2G19A 5EPAA 1ASJ3 1RUI3 4ZS3A 1VAVA 5ERLA 4PLOA 3VZLA 2BWAA 3JQWA 3I7DA 3PL0A 3PUIA 4LA3A 4IEWA 2Q8OA 4UW6A 1UYZA 3THTA 1NAEA 2DV9A 3DKQA 4QDSA 1Y9QA 2JIGA 4RYDA 4OHZA 3QD6A 3KCCA 3WG1A 2XBO2 4IQPA 1X50A 3N9LA 4WM8A 3VKLA 4AVVA 2ARBA 1ND2C 2HLEA 1O91A 2BVVA 4DNYA 2JG9C 1MS8A 2X5IC 3CF6E 1KITA 2DCYA 4IEPA 3OGGA 1GNZA 4P5YA 5EJ1B 1UMHA 4Q4V1 2ZGRA 2PHRA 2GMPA 3UKVA 1IGOA 1SBEA 1ZA4A 3K46A 5FMDA 4AFAA 1NLQA 2JIJA 3S5AA 4RGGA 4DOUA 5C71A 1T6GC 1LOBA 2IXCA 3H9AA 4R4ZA 5C9AC 5KXEA 5T5OA 3ES4A 2ERFA 3ZSJA 5J96B 1ZRCA 4H3WA 2JDNA 3POFA 1ND2A 1KD7A 4I0WB 3AP7A 3D8CA 1GSLA 4P08A 1JW6A 4MSVA 4Y26A 5CB7A 1W9SA 1XU2A 1RUG3 2R063 2X5IA 1O59A 1W9YA 4XJAA 4E4DX 4UFJA 1HN0A 3BVCA 1HB4A 2GNTA 3WEZA 4BXFA 1J3RA 4GAZA 4D7TA 1LB2A 2RR13 5FDBA 3C7OA 3IKWA 3VBSB 1PGL2 3J7LA 2X29A 3PVOA 1UY2A 2P1BA 5BNOC 1V6MA 2WS93 1VE0A 4E4SA 3N9NA 3ZN6B 5LBCA 1UMZA 1MR5A 3C7EA 4BWOA 2DF7A 2VM9A 2WO1A 1VBA2 4CU6A 3HT2A 2ZMKA 4XCBA 1HQWA 3ITQA 3WQBA 5ACA3 4NHLA 1HRV3 5C9AA 3VUOA 1XNBA 2WO7A 4ARXA 4AAPA 3OUHA 3HBKA 1RMU1 1OOPB 3KVBA 2RJ2A 5FUIA 4QPIB 2ZA9A 3TOJA 2GDFA 3ZN6A 5FZBA 2AREA 1NLSA 1O6UA 2D6PA 3I59B 4Q4X1 4AGRA 5A6YA 3HNBM 1W6PB 1KS5A 1VPHA 4M3CE 1EV13 1SZBA 1YQ5A 1OOPA 3DV8A 3SEPA 1TMF2 2QQUA 5BNOA 1LODA 1O5LA 2MEV1 3BYWA 2OW4A 2R041 2PLV3 1LHWA 2R16A 2NYYA 4GKXA 4YFWA 1Q56A 5EWSA 4JV4A 3I59A 4JRAA 3I3EA 1UIJA 1ENQA 1W6PA 2DVFA 2WT2A 4UAPA 3JZVA 3RSJA 1UY3A 1XBFA 2V5DA 2A6XA 2DFCA 1K5MC 3H0OA 4OVEA 3D0SA 4AQTA 3GYDA 2OVUA 1AR93 3T0DA 1W8TA 4P9LA 4B4QA 1PIV2 1PHMA 2JICA 3WLUA 1FV2A 4SLIA 2YBKA 3MIEA 3O12A 5DAPA 1Q5OA 2ES3A 3LAGA 1ENSA 2JDMA 5JMOA 1QXPA 2X09A 2DUQA 3WSOA 4A7YA 1W9WA 4ISQA 1YQ6A 4Q4W1 1JYNA 2HWF1 4CCLA 4LMFA 1D4M2 3IAPA 1JOBA 4XQDA 4YZ4A 2XLAA 3S7EA 2AENA 3DYOA 1RUD3 5KHJA 2R0FA 2VTFA 4KG8A 1JYVA 2GC1A 4EWDA 1V9U2 1CR7A 2V73A 4QXCA 2QFEA 3RFRA 4HVOA 2VMEA 1ZBE2 1UNBA 2D98A 3BPZA 3IIIA 3K3OA 4GXLA 4XAEA 1K5MA 1YWKA 4B29A 4QPGC 5LZ6A 4B4RA 1YI7A 5FZIA 3KQ4B 4D6SA 5F9TA 2Y6KA 1R093 1RUJ3 5FMBA 5F3GA 4NIDA 2TBVA 4E4ZA 1QHDA 1GWMA 5IW0A 1YRZA 5C4WC 1BMV2 4XURA 4CUGA 5HI0A 4YLZA 3FBYA 5LASA 2HEWF 5K4LA 5G05L 1QWRA 2VUCA 3N9OA 5LBFA 4BLIA 2WNUB 5CADA 1PO21 3D82A 2NN8A 1OA2A 4KQ7A 1AR63 1N3QA 3JBG3 1ASJ1 1RUI1 3I2GA 1YI9A 3NKGA 2A71A 4A41A 3SNMA 1XNTA 4QPGA 2EAKA 2WL1A 1GICA 5JAXA 3NV2A 5E8AA 2A3WA 2JXAA 2PTMA 3OY8A 2ID4A 5LWBA 3RZJA 3LSEA 3SC7X 1PVC3 3LDRA 2IVJA 3A22A 3KCYA 4UYBA 4MG2A 4Q8LA 3N3HA 4OI4A 1O3SA 1Y3TA 2VMHA 3FUQA 3ZOIA 4C90A 1EAH2 1UZWA 2LTNA 4U36A 3V65A 2WWUA 3FFZA 5JR2A 2HBUA 4W6WA 3CIHA 4UFMA 4XF0A 4IV1C 4YGCA 4CXWA 2WINB 4HETA 1UMIA 3GZEA 3NRUA 1V6JA 1YNAA 3I2KA 4A2UA 4YZ5A 1A6CA 4AEKA 4DPNA 3UL2A 4MGIE 4A3ZA 3WW3A 4QPYA 2WN3A 2RS32 5C3RA 2OT7A 5L73A 1WLDA 1UU5A 1K42A 1OC1A 1ULPA 5C5UA 4HMZA 2RR11 2D6MA 5KHHA 5ANNA 2PAKA 2XJVA 4EV0A 2BBAA 4ATEA 4CTEA 1PMIA 5C3QA 2O0OA 5F1RA 2WS91 2EVXA 2O14A 1GR3A 2JDZA 3FLPA 4CCNA 3SXWA 1GZWA 2WWSA 4G3YC 4UI9L 1DU3D 4K21A 4UW5A 3PU3A 3USSA 3NNFA 4JZRA 3UETA 2YPJA 3MZHA 5FLHA 1WLWA 1S0EA 1WW5A 4QQHA 1W8WA 3BU0A 1YIFA 3AVRA 3NMBA 4QX1A 3S57A 2ARCA 3AZVA 4OZXA 4Z92B 5C8CB 4FAHA 4AFDA 4YG0A 1PGW1 2W68A 5F3CA 1VBB1 4GALA 2RDNA 3WXPA 1C28A 3AKPA 4HPKA 1W2NA 3B9IA 4GB31 5A7PA 1C5HA 2YGMA 1EV11 2ORZA 2BNMA 1VBC3 2H0VA 2WRAA 2Y34A 4OFGA 5FZ1A 1MS1A 2OA2A 3OCPA 3AZYA 1O4YA 3VKNA 3ROUA 2VVEA 2BGCA 1XSRA 4K3UA 4BH9A 1CWPA 1OPMA 2PLV1 2WO3A 4QHBA 5EYYA 3FHQA 4XJ8A 2VCCA 1DYKA 2VCMA 1AVBA 4NR1A 3BTZA 3DECA 4D8MA 4JDOA 4GWNA 5A80A 1T2XA 3LCPA 4XIKA 1R64A 2QQPA 4NIGA 1HV1A 2WLQA 5CFDC 3RYKA 4B3NA 4XHXA 1AR91 3VZMA 2R7EB 2H6BA 1UAIA 2PQQA 2XOMA 1UW8A 1UYPA 4A7KA 5CKMA 3WDXA 4XDOA 1W39A 4PBPA 5JPNB 1HLCA 2D6NA 3ZR6A 5A7QA 2PHLA 4XF4A 4LTAA 3THPA 4KWJA 3HD8B 1X9TA 1LHOA 1XPWA 4KU7A 3I2JA 2BWCA 4LO7A 5FLIA 5CVRA 3X29B 3BUCA 5FK8A 3H8UA 2XXZA 3NV4A 3NSTA 3T1MA 1H0BA 1ZYBA 1B35B 2VU9A 5CFDA 3VD5A 4DY5A 2ZGNA 1R091 2XBO3 4IESA 1RUJ1 4WV8A 3USUB 3A7QA 3AMHA 4IXLA 1Z7S1 4NIAA 1Y9MA 2ZEWA 4RA0A 5A7NA 3MV01 4MGYE 3HBZA 3R4SA 1UY0A 2GC3A 5CEHA 3O0XA 1B35A 2Q5TA 4CCJA 3K4AA 5J3UA 2PXJA 4HLTA 3H3LA 2CTVA 4M4RA 5FP7A 5C3PA 1OURA 3AXDA 3CJIB 4PI0A 1OA4A 5FPBA 1CZTA 1WZXA 4K8RB 4PLMA 3JBG1 2VNVA 3Q8BA 2ZZQA 4GH4A 3I3MA 4AGVA 3GBGA 1CESA 1ZVFA 1ZRRA 3C7HA 4C1WA 2G9FA 4XJUA 1OLMA 4YW2A 3ZXJA 3BI3A 1RUE1 5F5IA 2XR4A 1FPN1 1W6OB 4JC1A 4OCTA 1OQ1A 4XILA 5F6LB 3TWIA 1UF2C 3UYJA 4CEYC 4MGQA 1IQAA 1PVC1 1UOGA 3E5QA 4Q4Y2 4MH0E 4QXBA 1EY2A 4B7KA 5IK8A 2QDNA 4GIQA 1W2UA 4YNIA 5A33A 2WZ8A 4HN0A 4E27A 4HL0A 4FPYA 2QQIA 2Y6JA 4QQLA 1E5IA 4RGKA 5FY5A 5IAVA 3U4SA 1QOTA 4XTMA 2RV9A 4H2AA 5BXXA 3GCXA 2KM2A 3AP5A 4LITA 1A3KA 4FBFA 3H1MA 3WG3A 4G9SB 3H1YA 1VBE1 5LRRA 1VBA3 3JCIA 1RUOA 4J6GA 1FI2A 5IK4A 1CAVA 3K77A 5JIUA 1OLRA 1QF3A 2DYCA 1PK6C 4AXOA 3I3DA 3KS7A 2YC2A 3B02A 5IVCA 2GN3A 1C8M2 4IL7A 1H30A 5F2WA 1UO9A 2ZMLA 5JZGB 1XB9A 1UPIA 1ONAA 2GAUA 4JHTA 2VJXA 1NZIA 1KJLA 3I2IA 2BNNA 4XFAA 4BQ4A 2SLIA 4ES8A 3MW3A 1TMF3 1IPSA 2JG8B 2W91A 4MXWA 5D8AB 5T3NA 1JMUB 2Y8KA 4XF1A 4FOQA 2Z2SB 1QQP2 2W08A 2IXLA 2QQVA 2P17A 1LU2A 2QQMA 4TZDA 5IWFA 1RUC2 1W9FA 5FYYA 3WD5A 4Z8BA 2ZEZA 2ET7A 2JG8A 3IM0A 5JXHA 4HK8A 3LEKA 1BVP1 2QE3A 4QKDA 3M8LA 1AXKA 1FXZA 1PIV3 4UBHA 5FZ4A 5FZLA 1AJKA 1LKNA 1UWWA 1W2OA 2VO5A 3LA3A 3NVCA 5AFEA 3RQ0A 2VG9A 4AVTA 3KV6A 4D69A 1VBC1 2DVBA 4N43B 3ZIWA 4QB6A 1QNYA 2RJKA 5DPNA 5A3UA 1QXJA 1DQ0A 4XFCA 4AL9A 1D4M3 3LFIA 1K3IA 2CY6A 1HIXA 3WP4A 1PVXA 4AK3A 2ZTNA 1XYNA 1YFUA 2Z42A 3IPVA 1V9U3 1IOAA 2ZHNA 4FXGB 2Y26A 3WV6A 5IVEA 3R4UA 3O5SA 4N43A 5FYHA 1ZBE3 3O0VA 4QU2A 5L9RA 4BCUA 4Q8KA 3B93A 4CPBA 2YV8A 2NPIA 4J1XA 3C3VA 3P3NA 4S2FA 2YROA 2UU8A 2ZHLA 4C0BA 2XL7A 3VHPA 3K4ZA 2RMU1 4Y20B 5FP3A 3TEYA 4LBKA 3POBA 2VUDA 4LKEA 3QH7A 1DGRA 2D6KA 1UU4A 4UW3A 1S1AA 1FMD1 2VBPA 4YFZA 3W5MA 2NQYA 3J26N 4YVSB 2AACA 4HXCA 3WF2A 5FZMA 1DZRA 5KXDA 1AHSA 1LESA 1BXHA 3M3EA 3IMMA 3SKVA 4RFRB 3KGLA 1C1LA 4GJZA 1ALYA 1AF9A 2UWCA 5B4NA 4Y1UA 4WVMB 2VZOA 5FXWA 4LBQB 4FSJA 2XBO1 3M3CA 5H9PA 1JZ7A 5ABJC 5FYBA 1MS3A 2IFRA 3V0BB 3LQCA 4W4ZA 1NE6A 1S2EA 2VW2A 5F5QA 5EJZB 5KR7A 1BHGA 2A75A 5GZGA 1JHJA 2DUOA 3B01A 4WVMA 4LBQA 5FXXA 1AYM2 4EWEA 4JQRA 1XYOA 2BV4A 4XBQA 1EAH3 2OQ6A 3WNOA 3OD4A 4M3CA 4QB1A 3UJOA 1UY1A 4P5HA 5F3IA 1H9WA 3K4DA 1OUSA 2B4KA 1YHFA 3Q8FA 1JZ8A 2VE1A 4DS0A 2ZAAA 1LJ7A 5C3SA 4GWMA 3WNXA 3SEEA 3VKOA 1CONA 3WW4A 2XWBB 4LHKA 5ABJA 1X33A 1H2NA 3FLTA 1DCSA 4R9BA 1MEC2 4E8CA 2QQOA 2WDBA 4EYUA 1H6XA 3KT4A 1A8DA 3ECQA 1UIKA 2ZABA 1XC6A 1S0JA 2CAVA 3LPFA 3WF0A 2NP0A 4LBOA 5FKBA 3K75B 1G9DA 4AI3A 1H8TB 3WUCA 1U12A 3W5NA 1P8JA 3I54A 1CVNA 5AVPA 3O0WA 2R1BA 3ZFEB 1ZZ6A 3PJQA 1A8MA 3BIWE 4QGLA 2EIEA 1AXYA 5FPZA 2PHFA 2ZOEB 2JDKA 3N7LA 1VBA1 3CDZB 5C6CA 4GMP3 2AGSA 4CU8A 4M0NA 1J58A 4N7IA 3AP4A 3ELNA 5A3LA 4MV2A 4R9CA 3SHRA 3VBUC 3IT8A 2XH6A 5D1IA 3VZNA 1XRUA 2DUPA 3ACLA 1A78A 1AYN2 4CXXA 3O1PA 1LGNA 3LIHA 1QJX2 1LEDA 4XUTA 5FYTA 3WOGA 1TMF1 3TB0A 5K9YA 1G9AA 3MO4A 5IFPA 4QWNA 3M3OA 3IAQA 3BTXA 2VVFA 1GANA 1LR5A 2A3XA 2V5YA 4I01A 4C91A 2HH9A 1V6NA 1H1MA 5EHDA 3MW2A 3N7MA 1SDWA 1R082 2D3RA 1EPWA 3BCWA 4QD2A 4ZU4A 1PIV1 4JTNA 4G4FA 1SFPA 4CDUB 1Q8OA 2JEMA 2KA3A 3LB9A 5A1LA 1ZBA2 4XJ9A 4AZZA 1YIPA 1OPOA 1NXMA 1MS9A 4L99A 2WFF2 1JYXA 2D5FA 3TN91 5FYIA 4I30A 3PUAA 4DUXA 1D4M1 4NAMA 3WUDA 1HX6A 3AL5A 1OUXA 3B94A 5FYVA 4CDUA 4N53B 3O1VA 3ZFFB 1V9U1 2X05A 1H4HA 3ZSKA 4B1MA 4CDWB 4YVWB 1ZBE1 3N7JA 4N8MA 1MS5A 1OD5A 2FDIA 2WA4A 3CZUA 5IUQA 4AFBA 4ZZ5A 2XVKA 2VECA 3A4UA 1G7YA 1ODNA 1YQ8A 2JJ6A 4AYUA 3BTAA 2YGLA 2W5FA 1BMV1 4IGOA 4H14A 1JHNA 2PFWA 4KBZA 1W06A 3RPQA 2WAOA 3N36A 2VR4A 5T50A 3GZTB 4ZU5A 3VBFC 1PMJX 4BDVB 5KBFA 4P9JA 4X8PA 2ZEYA 3ZSEA 2IC1A 1SACA 2RE9A 4NHKA 5T5JA 4NMIA 2CNAA 2OZ6A 3MIHA 4QHOA 2W46A 3EB7A 1AX0A 1R1ZA 4M3CF 1WCQA 2PHWA 2R1DA 3C8XA 3OBZA 4D0QA 1M06G 1AR82 1YCIA 1IS4A 1W6NB 4BMBA 1BYHA 1W8FA 1I6XA 4CDQB 4UFLA 3OPZA 4LE3A 5E16A 3T30A 3AMPA 3O1RA 2XJUA 4Q4Y3 2E7AA 4E4HA 1SLBA 4XXPA 3DYPA 3OPWA 2VMFA 3SKJE 2NMOA 3VV1A 4CUBA 1O8SA 3ETPA 4YM0A 1EAH1 4QX2A 4MOAA 1W6NA 1CAXA 4Q27A 5FTTC 5F7UA 2P37A 4RR3B 1OI6A 4KWKA 4CPBD 1GLHA 1ZRFA 4W6YA 5FOBB 1W3VA 4DINB 1L7LA 3AX4A 3ZYFA 2ZACA 1D7PM 3W9AA 3WF4A 2XB6C 5LA0A 2XJQA 2E33A 1O4ZA 2Q8EA 1GZTA 4QGMA 5GZFA 2BFUL 2GMMA 2YBSA 2RS31 2VUJA 1S0IA 4FFFA 3NV3A 4FVVA 4PCRA 1OXCA 3CLPA 5FXZA 1C8M3 1FNZA 1S55A 4HZFA 1VAMA 4QM8A 4AW7A 2W52A 4GMP0 2FDHA 1URXA 4DQAA 5I8SA 2A6WA 2B9UA 3OGRA 3PUSA 3VHRA 2OQ7A 3MLKA 4QMAA 4QU1A 4DZGA 5FP4A 2A6YA 2Y0OA 3EMRA 1QQP3 2ZX4A 4AQSA 5FPAA 1Q3EA 1ENRA 2ZKLA 2FDJA 2ZGKA 2R32A 1RUC3 4YYOA 4CP2A 4RQPB 4A45A 1JZ6A 5J09A 3ZMOA 5FZEA 5JOWA 3W58A 4M0HA 3PIGA 5GLTA 1UZZA 3I2HA 5HXMA 1YXWA 3S5QA 2FCUA 3EQEA 5CFCB 4LIUA 5FZHA 5FPUA 1FNYA 1W0NA 2ZCWA 2IFWA 4C8DA 1DP0A 5L36A 1W2AX 1N1VA 4AEMA 5F8PA 1AX1A 1RVF2 2XKPA 2V72A 1IZ3A 3DPRB 1D2SA 4A44A 4BQXA 4D94A 4FQZA 5IAXA 4YW4A 3AYDA 1WD4A 2WZR2 4DRRA 1UKRA 3AJYA 3LEIA 1S4CA 2F4LA 1BBT1 1C57A 4KGQA 4Q0UA 3VBSC 1OQDA 1RUF2 3F95A 3BOPA 5HCBA 4MUVA 3LEGA 3GCWA 1VBD2 3BODA 3ZX7A 5JSOA 5I0DA 5B2GB 2VQAA 3KT1A 3KF5A 4PT6A 5LEJA 2J1RA 4KNCA 1GP4A 4TYSA 2GC2A 4AQ2A 1X8EA 1Y7BA 4ORFA 1OOPC 3ZKYA 4FFIA 4QPIC 1K5JA 1LAJA 4HKWA 4Y1ZA 2J1UA 3DXTA 4LEJA 4PF1A 2HEYF 2VZSA 4P9WA 2CGPA 1QEXA 2EIGA 1F31A 1Y4WA 4JGZB 5E1RA 4JTOA 2EALA 3FZ3A 3VBSA 4BQYA 4AR2A 1O3TA 4OULA 5JUVA 2JWPA 2B9VA 5DUWA 4EN7B 3POJA 4N7UA 1SQ4A 1HQNA 1H8VA 2VBDA 4KL1A 4EQVA 2Y6FA 3HN3A 2WSUA 3Q9OA 3M7AA 2BFUS 4DIQA 4E8DA 3W59A 1ULEA 3VZKA 5I0SA 2NZ9A 5DMYA 1ZREA 1AYM3 4OUSA 4AVAA 1U5ZA 1SFNA 4XJWA 2C1FA 4WVZA 4QPIA 4NPLA 1C4RA 4LUKA 3H1WA 4B1LA 3LOBA 4CEWB 3EJKA 2XONA 4Y1XA 3ASIA 3JD72 1QJU1 1EYBA 1ND3B 2I45A 2KR2A 1J1TA 1HRI2 3OYWB 4JX0A 4Y5SA 4NOTA 4OQ9A 5JI9A 1QH6A 1LU1A 4AF9A 1MEC3 2WSVA 5LCWL 3WHTA 2IXHA 2BDRA 5FZ7A 3ZYGA 4DO0A 3OUJA 1GQPA 1WCUA 4XQ4A 1TEIA 5HBAA 4FPHA 4R52A 1JOPA 1NX9A 2PELA 1J59A 1VRH2 4MGSA 4F3JA 2VOXA 5F39A 2DWRA 4FPJA 4AVSA 2P2KA 1NY72 2VW0A 2Q8DA 4N90A 4TSVA 3AP6A 4GWJA 1DQ6A 3MV11 2N7GA 2WNUC 3M70A 4DRVA 3HVDA 3RGBA 1C8M1 1NZCA 2Q1ZB 5ANQA 2GP5A 1KS4A 2K46A 1HW5A 3OBTA 4RN5A 1AYN3 2D44A 5A3PA 2JDHA 2R072 5B4XA 4XVHA 1QJX3 2PHXA 3TEZA 3RZGA 4FI9A 1G8WA 5GZEA 4FAGA 4LHLA 2MHFA 3VBOB 4GZ9A 1WBLA 2OS2A 1QQP1 3ILNA 2P3YA 4A42A 3S7IA 4QDQA 4A6OA 2PHDA 1JYTA 4Z2WA 2DCKA 1RUC1 5IATA 1RYYA 5F6KA 2EXIA 2Z69A 2WNUA 2XJPA 4FO9A 1R083 4WM7B 2ZGSA 5IYYA 3KB5A 1CPMA 1UCXA 2C26A 2W0XA 2WIIB 3N9MA 1ZM1A 2VXRA 5DZFA 1F2NA 1W8UA 1DQ5A 1T6BX 1ZBA3 2W2IA 4PIYA 1C8NA 2AR6A 3SISA 3DEMA 1TE1B 2WFF3 5BNPB 3MLJA 1O3RA 4WM7A 2O1QA 1EP0A 3PJYA 1W9TA 1AX2A 4UFIA 2OPWA 1W3XA 5FPVA 3VHOA 2WZPP 3WNKA 2QJVA 1UN1A 3AKSA 1SPPB 4OI0A 4IE7A 3OTFA 2QCSB 1C3HA 5BNPA 5DAQA 3RDIA 4YZ2A 4HKLA 1G86A 3GALA 4PHZA 3WDYA 5FBZA 1ZNPA 2VZ1A 4O7XA 3OG2A 4EWAA 5TSWA 3ZYPA 2WYSA 3AMMA 1GYKA 4CDXB 1SPPA 3NNLA 4RHV2 3T1LA 2TUNA 2R061 1RUG1 1S0GA 4IEZA 1MACA 5DZGA 3N4MA 3HEIA 2RS12 4UT5A 1W8NA 2CGOA 1MZ5A 4Z1VA 4QGNA 5IVVA 3ZYBA 4A6SA 3VDCA 1SG3A 1TG7A 2WAAA 3GZUC 2GH8A 3HNMA 5FKCA 2VMGA 5A7OA 5C5TA 5C8CC 1AR72 3E97A 1M4WA 5A3NA 3AMQA 3NW4A 3B7MA 5FO9B 5ACA1 3AL6A 1HRV1 4XHBA 4S2GA 2YFUA 1AR83 1W05A 4PJYA 4ZY9A 1W28A 2VGDA 3H7JA 3UGHA 2MNGA 1CJPA 4NHYA 1ULCA 2BQPA 2B39A 2PAEA 4Y3OA 4UXAA 1NLRA 2G4IA 1LTEA 1RTVA 2ZGOA 5FZDA 1IG3A 2YXSA 5I93A 1QDOA 4IEUA 3T09A 4AEDB 1WW4A 2BRTA 2BEOA 4P14A 2EA7A 2GU9A 4QXKA 3WDVA 2W3JA 1LOFA 2VZPA 2XGXA 1JS9A 3K48A 4NO4A 5C8CA 1COV2 1FX5A 4E9KA 4HG6B 2OUJA 4DFSA 1GFF2 3SH4A 2VQ0A 5DXDA 1JOJA 5KC5A 4UWDA 5FUNA 3LD8A 2YDEA 3N9PA 2ZHMA 3WG2A 1SLTA 1VLNA 5A7SA 4MXVA 2AZ5A 4V2VA 5T52A 3VGIA 2J1VA 3VBHB 1FV3A 4I3GA 4PF5A 4CSWA 1MEC1 1Q43A 3GGLA 5FXVA 3V56A 4Y4RA 3PTYA 3QOPA 4PIZA 5DUXA 2W1UA 4YGEA 1JZ2A 1VIWB 1IKPA 2WJSA 5AFBA 5FOJB 3PLQA 5K7PA 2YG0A 2F4PA 3AC0A 4XUOA 5J98B 1OFSA 1POV0 1UU6A 2BGPA 2G1MA 2ORXA 4LKSA 4Q4V2 1B35C 3VBHA 1BQPA 1W6QB 5L7OB 3N9QA 1TQ5A 3E6DA 3WINE 2DTYA 2HWD2 5FWJA 1ST8A 2V4VA 3VD3A 1RUD1 3WT3A 2J1TA 4H55A 1QOSA 5LB6A 3R6SA 2D43A 4LOTA 3WNLA 2GC0A 5LY1A 3O1OA 2VW1A 1LOEA 1POQA 4GH4C 4XUQA 5EJ3A 4I2OA 1N1TA 1JU4A 5DQ0A 3SMHA 1ZRDA 2JENA 3AZZA 3FHIB 3CJIC 1OF4A 1LENA 1N3OA 2PQSA 1CX1A 1QJFA 2BGOA 4V1PA 1FT9A 1PNGA 1UYXA 3ZM8A 2RJLA 1BCXA 2WBKA 4Q0PA 2B8MA 1DZTA 2BERA 2YU1A 3O14A 3RMXA 3KMHA 4YRDA 4Y5TA 5KC6A 3D5OA 1BK0A 3USUA 4XACA 3RZMA 5A6XA 1RVF3 2P3JA 1F15A 3JUUA 4HSJA 1AR61 3VKMA 1F9KA 2GNDA 2XLFA 3FBMA 5LY2A 4IERA 2WZR3 3IB3A 1ACCA 1GP5A 1CPNA 3I3BA 2EAAA 3BTYA 1RMU2 3ZYJB 4IUGA 3ZDSA 2Z5WA 4LULA 1R081 1YFXA 1RUF3 1XQNA 2QQLA 3CJIA 3IMNA 3LA2A 5FZOB 3KV9A 1H9PA 1LOGA 1YQ2A 2WNVB 1WUVA 2IWGB 3AYAA 2WA3A 3EBRA 3LE0A 2VXJA 1VBD3 3UJQA 4EZ4A 2ZPXA 4Q4X2 4LT5A 1ZBA1 4I3PA 3FX3A 1HN1A 3L2YA 5IVFA 1S0FA 3CZJA 4XBLA 1RXFA 1UYYA 2FDKA 1DQ2A 2ET1A 2MEV2 1W6OA 4BQ5A 2E9QA 2DVGA 4HN1A 4NRMA 4XW3A 2BU9A 5JZGC 2TNFA 1BK1A 2RS52 4CU7A 3NJXA 4DY3A 1DQ4A 1C5IA 3ILRA 4W6XA 5F3EA 2NMNA 2VNGA 3PTRB 3AKTA 5HPOA 2JG8C 5CKQA 5D8AC 1FOD2 4I02A 1ZRIA 3ZPOA 3AYCA 2E6VA 3LA7A 4QX8A 5LA9A 4B4PA 1VAKA 4XTPA 3O7OA 3OGVA 3POSA 3D4KA 3MEPA 4AEJA 4KGGA 2HWF2 1HB1A 1CAUB 4BZ4A 2HYKA 2BP6A 3HIFA 3JB8A 4RL7A 5T5LA 3PHMA 1EPZA 3ALQA 4IE6A 1DQ1A 2DU1A 2W87A 2JB4A 1S0BA 1YFYA 3GNEA 4IEXA 4Q26A 4CU9A 1GOHA 3QH6A 5JZGA 2VOKA 2RDRA 5FCCA 4ARYA 5FY0A 1D4VB 1WA6X 3JD73 4QKBA 5JMCA 1CD3G 4Y24A 3LOIA 1CAUA 2ZX3A 4P00B 1HRI3 4N43C 3MUY1 4EN9B 1RUH2 3UKNA 2VZUA 5D8AA 2XJSA 1KDMA 2HKXA 4N9IA 4CP1A 5CKNA 2Q1MA 1L7RA 1RITA 1GU3A 4NPRA 2X10A 4CVUA 3ZYHA 1WLTA 3R4DB 1EUUA 4WZFA 3WY6A 1B09A 1J3QA 2A3YA 3FMGA 1IQDC 1GOGA 4BOWA 5LA2A 1STMA 2YZ4A 1VRH3 1GOFA 4NJ4A 3SCHA 4LHNA 2CV6A 5FY8A 1DLCA 2K2SA 4FFGA 2J22A 5K0UB 2ZGQA 3MYXA 3T08A 3KHCA 1WW7A 4FP2A 3KV4A 3A23A 2B45X 4BLJA 1REFA 1WGPA 1HDKA 4YVSC 2VTXA 1SLCA 2Y0IA 1XE7A 2HJIA 5K0UA 4NWVA 3GF6A 4FPOB 5DABA 4NAOA 5FYZA 2R073 2XJTA 3KD4A 2J1AA 5GLUA 1FATA 2Q4SA 4QQPA 2C4XA 3VD4A 4LJHA 3PUHA 4FQ4A 2X8KA 5I0TA 3RRDA 3P3PA 1QDCA 1LGBA 4HONA 4Y20A 2GALA 2JDUA 1UX7A 1W0PA 2B46X 3CU7A 1S2BA 3Q8AA 4YG6A 5JR7B 4BIOA 4Q0SA 1LGCA 3H42B 4I09A 3OBRA 4JGYB 1TME2 4YVSA 2VZ3A 2VC9A 3VDDB 2D5HA 2P6HA 1I5PA 1OMIA 5CNAA 1R1A2 3IN9A 2WABA 4KBBA 3D3AA 1PNFA 1ENXA 3TNPB 3DKWA 4E2QA 4HVQA 5CG9A 2AYHA 2VCBA 3L2HA 5F5CA 1YYNA 2ZEXA 3GBFA 3ZXEA 4CA9A 1DGLA 3ACHA 1NCQB 2KD7A 2QVSB 1XNKA 1PO12 1RVF1 3BGAA 5FZAA 3VDDA 3V0BA 1H2LA 2W95A 4EN8B 3OEBA 5M0TA 1OA3A 2JKXA 2WZR1 3H3UA 3NNJA 2WYFA 1Q8QA 3MBWA 3J9SA 1LRHA 1L7QA 4BE3A 1W8OA 2Q1FA 2F17A 5CIRA 2OYZA 3PVEA 4UF0B 1H8TC 1MZFA 3PNAA 3P5BA 1NCQA 1RUF1 3MIDA 4IE4A 3QLQA 4L8QA 4WBBA 2QQJA 5A3WA 3WNPA 4AAXA 5GM0A 1GBGA 5J1XA 3ZFEC 2VOWA 3J8F2 4F7ZA 4H7LA 3VL9A 2RVAA 1VBB2 1VBD1 2B7YA 1FYUA 2DFBA 3HR9A 4Q1RA 4RHV3 1DG6A 4RSUA 3ETQA 4Q1PA 2VZTA 4LO4B 3T2TA 2LW8A 3GXUA 2XL9A 4GB32 4DEVA 2RS13 3JU9A 3WNMA 4AI0A 5C7GA 5KXBA 4FOYA 1SMVA 4FPLA 3BKZA 4NPMA 1HJGA 1PGL1 1L3JA 3MIBA 4CUAA 1N1YA 1ULFA 5JOYA 1AR73 1DFQA 3SH3A 3KM5A 1JZ5A 3ZXGA 5A6ZA 2R49A 1PZ9A 4PQ9A 3E6BA 2PA7A 4ONUA 3VD7A 4OMCA 5FZ0A 3HT1A 4TTGA 1H8TA 5EP9A 4LKDA 1JYIA 1BZWA 1ULOA 2GSYA 4S2DA 1KJRA 4QX3A 3DF0A 1SBDA 4MYEA 4UBGA 5LBEA 3ZFEA 5LEKA 4OLLA 1RGSA 5DUVA 3A0KA 3UV9A 3VN4A 1UZ0A 4AOCA 4BHPA 4WVWA 4LK6A 3DCQA 4QPWA 1CIYA 1W90A 2JX9A 1MS4A 3I2FA 1US3A 2DCTA 4XBNA 4XJZA 3G6JB 4FTBA 5JXJA 4EE2A 1GV9A 3NAPB 2VOTA 3NJYA 4XF9A 3SITA 1V6OA 1H2KA 1COV3 4NWWA 1X36A 3WW2A 2ZAHA 2VULA 3KZ4C 4CDUC 2P4EA 4LK7A 3VBRB 2MPFA 1CIWA 4PDWB 1G9BA 4XDPA 1A34A 1HRI1 5C70A 4COYA 4ITCA 5KXCA 4Y33A 2C9KA 3AKQA 4XYXA 1Z7S2 2PAMA 3B5LB 5FZ6A 5L9VA 3PURA 3U0ZA 2Y33A 3CO2A 1NUKA 3KSCA 2WN2A 4QX7A 4N53C 3VBRA 3AP9A 4PDWA 3ZFFC 2W39A 4CDWC 5EXOA 4YVWC 3WR0A 2YBPA 4IE5A 4YPJA 4OYUA 2WQ8A 4Q4V3 3LKJA 4O9GA 2XHNA 1NKGA 5A1AA 5LK7B 2EIBA 4PLNA 4HK9A 2E7QA 3THDA 1ZA7A 2HWD3 2LROA 3D6EA 1JODA 2E53A 4XMIA 3QCWA 1NY71 2HWE2 3AFGA 1AUYA 2LS6A 4INDA 2VCAA 4DB5A 2DBNA 2DCJA 4PBOA 3INAA 3G7DA 1YQCA 2W1SA 5J7MA 1DBNA 3WP6A 2DURA 4DUVA 1RUE2 3Q8CA 1AL22 3PVBB 4LHSA 1FPN2 3HQUA 4HSLA 4P9XA 4R8HA 1NE4A 4Q0QA 3VDBA 3VKFC 2BOIA 1GWLA 3UGGA 4N53A 5FV3A 4DXRA 4HFSA 3ZFFA 5IVJA 1QKQA 3U14A 4CDWA 1JZ4A 4YVWA 4K1ZA 1LECA 3UT0A 4F83A 1QJY2 5LA1A 3WW1A 1MQTB 3ZSLA 2FDFA 2E31A 3POIA 3LGRA 5AC92 4LBJA 4Y5Z0 1VB2A 3MGUA 4IEQA 4CDQC 3MHZA 4X8NA 2VNRA 3IIAA 1VBE2 1MS0A 3ENRA 2FQPA 4KU8A 4FPFA 2D6LX 2J1EA 1F35A 1UZVA 4LBMA 1MQTA 3MIGA 4K6BA 4NHXA 4XQWA 3ZMNA 5LW9A 3ZVXA 4HOOA 2WO2A 3IDEA 1DIWA 1RMU3 3LDBA 5A70A 3TNQA 4AHYA 2YHJA 3AJZA 4S2HA 4LO8A 4RR3C 3KCXA 3RWNA 4Q4X3 5FZ3A 5BNNB 1WD3A 2HWB2 3POWA 5DZEA 5H9SA 1APNA 3ZR5A 2HWC2 4XABA 4O9EA 2A73B 2DU0A 1SBFA 2MEV3 4I0AA 5GZCA 4CDQA 4AI1A 4ET7A 4AHZA 5JPMB 5GLVA 4META 4BIFA 3NQHA 4W50A 5BNNA 1XOYA 2XKOA 4UFKA 4XIOA 3VL8A 2RS53 1RIRA 5HCAA 5IJRA 2QBXA 3J7NA 1H6YA 2ZKNA 3PIJA 4KWLA 4R4XA 4A7ZA 4RR3A 2CSGA 1FOD3 3THCA 2ZGUA 4LORA 4D6RA 1ZX5A 1NG0A 2VVDA 4B8EA 1OSGA 3HQXA 3RVHA 3LIGA 3RI9A 4AHWA 5FJKA 3CMGA 3TAYA 1AL0G 2RS11 1BEV2 3K3NA 1O5UA 2HWF3 3MICA 4H7MA 4CXYA 4RQPC 1UZYA 4IEYA 1UXZA 3W20A 2YB7A 1AR71 1NCRB 1E5HA 4QKFA 1D0GA 3U1XA 2E32A 2D93A 4IV3B 5CFCC 3NNMA 2JD4A 4GMP1 2WZEA 1YEWA 2Y38A 4LUMA 5E89A 3RMYA 5LRSA 4R9DA 4YZ1A 1LHVA 4AG4A 1RUH3 3ZFGB 4ZZ8A 4MGZE 2ADEA 3KVAA 1J1LA 2VQTA 1NCRA 2B42B 4LBQD 2RMU2 2ETEA 3QACA 3DPRC 2OZJA 4XUPA 4XZUG 1QOOA 4IV3A 1ULGA 2CHHA 3OOXA 3Q8EA 4OI1A 3V64A 3ZPYA 1OT5A 2DTWA 4A4AA 1FMD2 3DL3A 4Y4YA 1BKZA 1Q8SA 3EXUA 4RQPA 3ZFGA 3I2OA 2YFZA 2XPJA 2Y6HA 4WM8B 1HKDA 1JBCA 4BA6A 3C7GA 1GQGA 2IZWA 2ZX1A 3AZWA 1COV1 1EUTA 5FK7A 3VB9A 5A7WB 3UGFA 5CFCA 2YY1A 3CQOA 5DDJ2 1I5ZA 2KXLA 5GKAC 3MFCA 4BB3A 2QQNA 4XMAA 3CL1A 4MGTA 2FZ1A 2G9GA 3ACGA 1NA1B 4BK4A 4RS5B 2JDPA 1F4AA 5DAVA 2YU2A 1CX4A 1MVEA 3DPRA 3GHNA 4M4PA 5A7WA 3T2QA 5GLZA 3K2OA 5DG1A 5GJ6A 4TLGA 3WVJA 2GN7A 3R0RA 5FZKA 2ZXQA 4MO3M 3RYRA 4JGZC 4COZA 1Z0HA 2Q0AA 5K8SA 1NA1A 4KG0A 4RS5A 3QBQA 5IVYA 1REDA 2XVGA 2WLPA 3HPNA 2RM22 1ND2B 4XF3A 2HWD1 1NYWA 4JCKA 4MLOA 4K20A 2V09A 2JG9B 1LULA 2X5IB 3NNGA 4NIIA 2JE7A 4L92A 4ZXEA 1V00A 2FHRA 4FPEA 4QDRA 1DGRN 1QJZA 2VH9A 1TME3 4OUEA 2ZX0A 2IXIA 3E5XA 4HBNA 2J1SA 2JG9A 2XDVA 1BJQA 1YJLA 2GZWA 2W47A 4YM1A 5G04L 4COUA 1R1A3 1Q8VA 3UNPA 1ZZ9A 5T5PA 1IS6A 2ADDA 4CEWC 2PMWB 5C9AB 4JGZA 4JVAA 1IS5A 1ND3C 1OBNA 2WNEA 3LEMA 5FMCA 5FREA 4DXTA 3B00A 4BQ3A 4HANA 4CCEA 2YUEA 2BW8A 1PO13 5JDBA 4LKFA 4FT8A 4L0PA 1O4TA 4A3XA 5CG8A 4AFCA 3H7YA 2WC2A 3SH5A 4M01A 3CKHA 4F8AA 2JE8A 2AC1A 1WW6A 1H2MA 4K40A 2LM3A 1UOFA 5BNOB 1X8MA 4YW5A 1HB3A 4BM8A 4FXKB 3KF3A 3FL7A 2OX0A 4P9GA 4URTA 4ZONA 3ZYRA 3J8F3 1JYWA 3FJSA 5IFTA 3H8OA 1VBB3 4CEWA 4PQQA 4U2AA 4CE8A 5FYSA 4L11A 4Q4Y1 4GB33 4PI2A 5HV4A 1ND3A 3OYWA 4JAAA 1V6KA 1GQHA 1PX4A 4XUNA 3ZXLA 1LHUA 2QZ2A 3UESA 3CEWA 4AFMA 4EZHA 2R0HA 4N9HA 4CCMA 3O1MA 4P02B 2WKKA 5I0UA 1O8PA 5FYMA 3MDPA 4P9IA 3WHUA 3O1TA 3RJRA 5AVAA 1W04A 5E6HA 2WFPA 2RS51 4JQTA 5GLWA 1KGYA 2D40A 4HT1T 1POV3 2E51A 2UYBA 3I8TA 4MHUA 2P3KA 5J48A 2OKXA 4FTSA 1OH4A 1W6MB 3ZXFA 5T54A 4NROA 3J7MA 1FOD1 4GKYA 2JECA 3TRSB 2P3IA 3IDAA 3SLIA 1SDDB 3OEAA 3VBOC 5JCTA 2ZGTA 1G6NA 3HQRA 1KFXL 1NOVA 1JI6A 3M2MA 4W8JA 1PM7A 1WKYA 4QQOA 2WT0A 3TN92 1K5MB 1W6MA 1JYCA 1XE8A 2CU5A 3WQ7A 2WR9A 4NN0A 2DCZA 4WM7C 5KHIA 5JSRA 2E63A 1HXS2 3OJBA 3NJVA 1QNWA 1X82A 2UY9A 2I74A 4CYDA 3TEWA 2ATFA 4XE9A 2Y6GA 3PMSA 2UWBA 2A70A 5JXGA 2PN5A 5BNPC 1RUH1 4KWUA 2XG3A 3MPPG 4FP3A 1Z7S3 2WT1A 2XLGA 3HWJA 1W8ZA 2O8OA 3FUOA 1Y43B 4QQ2A 3VBOA 4CCOA 3ZLIA 1YO8A 2ENRA 1IPKA 4MZUA 3R05A 3WQ0A 1YFWA 4K7JA 4QPGB 4NUBA 1S2KA 2DDUA 4JRLA 1W03A 2XMLA 4EN6B 3B9CA 1QGLA 1K12A 1DYOA 2IXKA 3OY8B 5LATA 4XFHA 5LBBA 4AHXA 5BUVA 3S0MA 5C4WB 1ZZBA 4CDXC 2BNOA 3LF7A 4E2GA 1YJKA 2HWE3 4FPKA 2VNOA 1VMHA 1CAWB 2AH2A 3LPGA 4Y1VA 5T55A 3N35A 1RUE3 2D6OX 1AL23 3BN6A 5IVBA 1FPN3 1IS3A 4KMQA 1DGWA 4EJRA 3ZO0B 3ORJA 4Y22B 2EXKA 2XQXA 5FY7A 5C4WA 2C24A 2JB8A 2IUWA 5CAZA 4OZOA 5BV6A 3WCRA 1WA4A 1CAWA 2EXJA 1QJEA 2ZGMA 5FZFA 4AWDA 1QJY3 1RHI2 1BLZA 4YGBA 2QTWB 4Z2AA 5C3OA 3SQOA 3ZKUA 5FPXA 1XNAA 1CGPA 3M3QA 2CYFA 1HB2A 2GNBA 4P9YA 2ZBJA 4Y22A 3U10A 1U5IA 2EIDA 2RG4A 3ME2A 3HN1A 3WDTA 4YARA 4CDXA 1LOFC 2QUOA 1G9CA 1JUIA 3MIFA 1VBE3 3URFA 3AM2A 4JKKA 5EFUA 4FCAA 5DN2A 3AMNA 3ZSMA 1XU1A 3RNSA 3RJ2X 4TN7A 3PVNA 1UY4A 4B7EA 4AEDC 1TME1 1AJOA 2CAUA 4WZCA 1OF3A 3EHKA 3H50A 4IV1B 5FZGA 2J42A 3GBWA 2SBAA 2K9ZA 1LEMA 1WCSA 2Y60A 2CDOA 1VALA 1LNSA 1R1A1 2QKDA 3M4FA 1GZWB 4QM9A 1OKOA 4LO5B 1WMDA 4Q29A 1E57A 4OMDA 5EYXA 2HWB3 2A1XA 4JKLA 5I91A 3TYJA 2W1WA 4ZU7A 1D0HA 2HWC3 1AYM1 4OHXA 4IV1A 4LIVA 2WNOA 4FPCA 1Q8PA 3ATGA 4YGDA 1PO11 2WUHA 3VBHC 3S6PA 3DN7A 5EQUA 1DYPA 2VQUA 1GKBA 3KT7A 4ES9A 2FDGA 4C1XA 2VOVA 3ST7A 1YUDA 3LFMA 1O7FA 1WMXA 4HPKB 4BXSV 3MW4A 5DAXA 1F8VA 1J84A 5J36A 3VZOA 4AEDA 1LCLA 5FJHA 3OB8A 5FPLA 4YW3A 2E7TA 5L7OC 3WX5A 3J8F1 5CA6A 4D6QA 1HJFA 4HVRA 2FBEA 5A3TA 1DLLA 1CN1A 2V4AA 3M1HA 1REEA 2CL2A 1PMHX 4XOGA 1BEV3 4AI2A 4CCCA 1N1SA 1UOJA 2C9AA 3U11A 1N47A 2QNKA 2X53S 3KGZA 1QMJA 3PMEA 1SLLA 3MPBA 1VMFA 2ZZJA 3FC0A 1ODMA 3B69A 1I3HA 1ULDA 3K51A 4R9AA 1SLIA 2BVBA 5GZDA 4FFHA 3OGSA 3WP5A 4GQ7A 1WBFA 5A3MA 3TEXA 1POV1 4D7SA 3ZN5A 1BBT2 5FLJA 1O3QA 2ZX2A 5JWPA 3PU8A 5FY9A 1RB8G 2I2SA 1W6QA 1S0DA 2JDYA 5L7OA 2ARAA 2GMEA 4AVCA 1PGSA 1XJAA 4HKOA 1SCRA 1IPJA 2RMU3 2FCVA 4XETA 4BYYA 4C0HA 1UPSA 5JLVA 2J7MA 4AI8A 3POEA 4ZPIA 1AYN1 1KXGA 1VR3A 2E26A 3KLSA 4K1YA 1FMD3 2D7FA 1QJX1 3WDWA 5CFDB 1DHKB 3BB6A 5JVVA 5CISA 3TBDA 4CCKA 4LXLA 1RJ8A 2W92A 1QU0A 2WNVC 5JOXA 2Q30A 4O65A 5JI7A 4LLFA 4QX0A 4XCAA 4CP9B 3F2ZA 3HOBA 5DDJ3 4ASKA 3ES1A 3MUZ1 5KWRA 4YW6A 3ZXAC 4XFBA 5C33A 4MHRA 1Z78A 3GM8A 1GNHA 4I0BA 1ZZCA 1I1EA 3RZLA 5HXVA 1H1IA 5BYNA 1XE0A 1WMEA 4XC9A 2P34A 4LO6B 4CP9A 4GH4B 4AI9A 3FLRA 1VMJA 2LRPA 4XDQA 5KHKA 3O1SA 2UWAA 1F5JA 5CU1A 2GH2A 1JU3A 2WFF1 4ZXKA 2CWMA 3T2PA 5L19A 3I4IA 5D21A 5FAXA 5FZOA 2RM23 2PHUA 4D3WA 2WNVA 3DUIA 4JKMA 2R042 4BQWA 5FUPA 3ABZA 5HV0A 1DDLA 5A3OA 2HWE1 5CBLA 1QJU2 3OBAA 3RI8A 5A33B 4LLOA 5I8TA 4BQ2A 4ISRA 3LZZA 1AL21 1LOCA 4YWAA 3BALA 3OD0A 4IGQA 5CZKA 3U75A 1E5RA 4LBLA 2EF6A 3RG0A 3RS6A 3L9JT 5FZ9A 2H6CA 3S30A 1DF0A 3HJRA 5BNQA 1LHNA 3AK0A 2VD7A 1X9PA 2NLRA 2XQRA 1HQLA 3MFAA 1QJY1 2Q8CA 5A1FA 4Q4W2 1CAVB 3B3QE 5D2AA 4YSFA 2ZMNA 1VB4A 3FHAA 2XVLA 5AC91 5FYCA 3RYPA 2A6VA 1GZCA 2P6CA 3E5UA 4CEYB 4GJYA 4EN0A 1KRIA 1WLCA 1GZ9A 5JIAA 3T2OA 2WWJA 4X6QB 1ZZ8A 4BPZA 2VMDA 1RINA 4L2NA 3JXSA 4IEOA 1CZVA 4MXWB 1AR81 2ZJCA 1ZZ7A 4CEYA 2BBVA 3I97A 5GALA 4M00A 1OKQA 2BZDA 1IG0A 3AFKA 3GHMA 1OVPA 4UFHA 1RXGA 3CNAA 5J37A 5K0UC 1TNFA 1TVGA 2HWB1 1GMMA 3JB4C 3SCGA 3ACFA 1KQRA 4Q2FA 1VRBA 2VZQA 3I3QA 4COWA 2HWC1 5F2SA 1PK6B 1YC61 1KFUL 1RUNA 2O8QA 4J1WA 3A21A 3WDUA 1WMFA 1PO22 2FD8A 2OXBA 3AXEA 1RC6A 4Q5OA 4YM2A 2HBTA 1ASJ2 1RUI2 4IETA 1H1AA 3FE5A 2QDRA 5FMOL 2DBIA 2K0GA 1JH5A 2RDQA 1LOAA 1SLAA 4IE0A 5FFOC 4OQ8A 1PK6A 4FPGA 3ZIXA 4FTEA 1V70A 1OD3A 4ZKTB 2A7AA 5AC93 4NHMA 1E5SA 4L97A 3NWKA 5HCFA 3VLBB 2I07B 3POGA 4DXSA 2YC4A 4ZS2A 3IPVB 2YMZA 2Z4FA 3WZ1A 5APAA 3KHBA 2D3SA 4BJ0A 1BEV1 4XZPA 4MADA 2ILMA 2VMCA 4IW3A 3TN93 4LPLA 4ATFA 3BOWA 4JDNA 4JGYC 3WG4A 1F4HA 2D97A 3WF3A 4OI2A 1HXS3 1X7NA 4LR4A 2RHPA 1V6IA 3VDDC 4YW7A 3IBMA 3NJZA 5FY1A 2R6QA 2HYXA 1JTZX 1YLLA 3GZAA 1RL3A 2XUMA 3ZDVA 4KH9A 3MI8A 1H4GA 1Y9GA 2A6ZA 1XXNA 2YYOA 3IZOA 1MPXA 4LQRA 3IDBB 1J83A 3N7KA 3P1IA 1NCQC 5F32A 3RZKA 3ZXKA 2R062 1RUG2 2WQ4A 4LOSA 3T4VA 1JN2P 4OHWA 1PZ8A 1SFYA 1OFNA 2RR12 3U37A 2GNMA 2VAUA 4JHZA 4JGYA 3MF6A 1NQJA 4XFGA 1MVQA 2VMIA 4QXHA 3T4HB 3BPSA 2W9XA 2WS92 3WNNA 4GULA 3V0AB 1HV0A 5FWEA 2P5BA 5A32B 1W8HA 5DDJ1 2WQZC 5ACA2 1HRV2 5FIXA 3HAGA 3LWCA 4YZ3A 1NXD1 4DXZA 1U5XA 1JXNA 1UQXA 3W21A 1C1FA 4CZSA 2XHKA 1IHMA 4ASMB 1OLQA 2XUEA 3AKRA 1WCKA 1UKGA 4GWIA 1MZEA 4M3CB 4NVPA 4BU2A 4CRQA 3V0AA 5HCHA 2F6BA 4V2WA 1N3PA 5FYUA 1I9RA 1PGW2 3U78A 4CP0A 4K8FA 5A32A 5I8YA 1D2QA 1XNCA 3M3IA 4GA9A 5EIYB 1RHI3 1EV12 3OF1A 5FO8B 4UF0A 2JE9A 3OSDA 5ABJB 3IWZA 2RM21 4COVA 2EICA 4IEVA 2PLV2 3JQXA 4XPVA 1OVSA 1J3PA 3T0AA 3NL1A 3U07A 3I49A 3MF9A 5H9QA 2Y64A 2ZHKA
chains in the Genus database with same CATH topology
2DCKA 2WZEA 2VL4A 1RYYA 2JDAA 4AG4A 3J7HA 4ZZ8A 5IYYA 2L9LA 2VQTA 2W1QA 4XZUG 2C26A 4MGQA 4XUPA 2VZRA 1OT5A 4QAWA 2WZ8A 4A4AA 2QQIA 2Y6JA 2YFZA 2Y6HA 1W9TA 2RV9A 3C7GA 4UOJA 1EUTA 3WNKA 3DYMA 3CQOA 2QQNA 3K77A 3ACGA 4QB2A 2VZ1A 4BK4A 1F4AA 3OG2A 3I3DA 2YC2A 2WYSA 3ACIA 4M4PA 3T2QA 1CZSA 3HEIA 2VJXA 3I2IA 1W8NA 2ZXQA 4MO3M 1GNYA 2CDPA 2W91A 3HPNA 3VDCA 1SG3A 1TG7A 2WAAA 2Y8KA 3HNMA 5IHRA 3NNGA 4DEQA 2QQMA 4ZXEA 4QDRA 2YFUA 2ZEZA 5JXHA 4OUEA 4ZY9A 3LEKA 2J1SA 2W47A 2VO5A 1UWWA 5G04L 3UNPA 3C7FA 5JXIA 4QB6A 5DPNA 3T09A 1GUIA 4DXTA 1W99A 2W3JA 2VZPA 1K3IA 4CUCA 3GDBA 3T0BA 4L0PA 4HG6B 1K45A 1UXXX 3E1F1 4DUWA 3CKHA 2JE8A 2W94A 2VZVA 1KEXA 2J1VA 2QQKA 3FL7A 1JYWA 3GGLA 5IFTA 3K4ZA 2W1UA 4PQQA 1JZ2A 3P6BA 2YG0A 3AC0A 4XUOA 1SHWB 1US2A 4XUNA 1PX4A 2BGPA 2ORXA 4LKSA 3W5MA 3UESA 2JD9A 3WF2A 1JZ3A 3EYPA 4P02B 2V4VA 1O8PA 3VD3A 3SKVA 2J1TA 3WNLA 5B4NA 1KGYA 1JYXA 4XUQA 2VZOA 2OKXA 1JU4A 5DQ0A 1OH4A 1JZ7A 1OF4A 2PQSA 1CX1A 2BGOA 3IDAA 3LQCA 1SDDB 3OEAA 4W4ZA 2Y6LA 5EJZB 1UYXA 3ZM8A 1BHGA 3FN9A 1JI6A 2WBKA 4W8JA 1JHJA 1WKYA 2BERA 3WNOA 4QB1A 1UY1A 4BK5A 3HNYM 3K4DA 3NJVA 2B4KA 3IB3A 1JZ8A 3VDAA 4KI5M 3I3BA 2Y6GA 3SEEA 3VD9A 5JXGA 4IUGA 2QQLA 4KWUA 3WF1A 4E8CA 2QQOA 2WDBA 1H6XA 1YQ2A 3ECQA 3LPFA 1XC6A 3LE0A 3WF0A 1HN1A 3CZJA 3K75B 1UYYA 2DDUA 5CYYA 3W5NA 1P8JA 4TXWA 1K12A 1DYOA 1PX3A 2EIEA 3PUIA 3CDZB 3LPGA 4CU7A 1UYZA 4CU8A 3NJXA 1NAEA 4QDSA 4RYDA 3BN6A 5HPOA 4KMQA 2XQXA 2HLEA 4OZOA 3OGVA 4P5YA 4Z2AA 5EJ1B 1UMHA 4XUTA 1XNAA 2EIDA 2W87A 3MO4A 5IFPA 3K46A 4CU9A 3IAQA 1GOHA 4ARYA 4JKKA 5DN2A 5C71A 4P00B 1UY4A 3MUY1 2VZUA 1OF3A 4P08A 2CDOA 1L7RA 1LNSA 1W9SA 1GU3A 1O59A 2X10A 4CVUA 4OMDA 3WEZA 1EUUA 4JKLA 2W1WA 3C7OA 1IQDC 1GOGA 5LA2A 4DUXA 1UY2A 2WUHA 1GOFA 2VQUA 1DLCA 3C7EA 2X05A 2VM9A 2J22A 2WO1A 4CU6A 3WQBA 4BXSV 3T08A 1J84A 4ARXA 3A23A 3CZUA 3OB8A 2RJ2A 5FUIA 4ZZ5A 2W5FA 1PMHX 3HNBM 2WAOA 2VR4A 2J1AA 1PMJX 3SEPA 4BDVB 2C4XA 2ZEYA 3VD4A 3PUHA 3I3EA 1UX7A 3OGSA 4UAPA 2W46A 3EB7A 1UY3A 1WCQA 2V5DA 3C8XA 4D0QA 2VZ3A 3T0DA 2VC9A 1I5PA 2WABA 3D3AA 2J7MA 5JMOA 2X09A 2VCBA 3WSOA 3DYPA 1W9WA 2E26A 2VMFA 3SKJE 1JYNA 2ZEXA 4CUBA 1O8SA 3ETPA 4QX2A 4MOAA 5F7UA 3ACHA 2KD7A 3IAPA 3BGAA 2W92A 3DYOA 2VTFA 2W95A 1JYVA 3OEBA 2JKXA 4QX0A 1D7PM 2Y64A 2VMEA 3F2ZA 3HOBA 3MBWA 3IIIA 2E33A 3MUZ1 3WF4A 5LA0A 1L7QA 1W8OA 3GM8A 3WNPA 2Y6KA 2QQJA 4AAXA 5J1XA 2RVAA 4XURA 4DEVA 2VZTA 2LW8A 3GXUA 5G05L 3WNMA 5C7GA 1JU3A 3T2PA 3OGRA 4CUAA 4JKMA 1JZ5A 3ABZA 3I2GA 4A41A 3OBAA 1XNTA 3VD7A 4OMCA 4TTGA 1ULOA 4A45A 1JZ6A 4QX3A 5CZKA 2ID4A 5HXMA 3I2HA 3HJRA 1UZ0A 1W0NA 3A22A 4QPWA 1CIYA 1DP0A 3I2FA 1US3A 3FHAA 5JR2A 5JXJA 3CIHA 2V72A 2VOTA 4A44A 1UMIA 3T2OA 3NRUA 3I2KA 3LEIA 2VMDA 5C70A 3JXSA 1CZVA 4A3ZA 2C9KA 2WN3A 3I97A 1NUKA 2BZDA 3LEGA 2WN2A 1K42A 1ULPA 1TVGA 1GMMA 5LCWL 5I0DA 3ACFA 4YPJA 4OYUA 2VZQA 4PT6A 2J1RA 2WQ8A 2BBAA 2XHNA 1NKGA 3A21A 5A1AA 2EIBA 3THDA 2J1UA 4PF1A 4UI9L 2VZSA 2LS6A 2VCAA 3UETA 2DCJA 2W1SA 4DUVA 5JUVA 2B9VA 4LHSA 4QX1A 1OD3A 3VDBA 4DXSA 2YC4A 3HN3A 4DXRA 1JZ4A 2Z4FA 4E8DA 4BJ0A 5LA1A 2ORZA 4MADA 2VMCA 5DMYA 4LPLA 2E31A 1F4HA 3WF3A 2WO3A 3FHQA 2VCCA 2XONA 2J1EA 3DECA 2HYXA 4D8MA 1T2XA 1R64A 2WO2A 4JX0A 4LQRA 1MPXA 1J83A 2R7EB 3P1IA 2XOMA 1GQPA 3U37A 1NX9A 4JHZA 4MGSA 1XPWA 3I2JA 4ET7A 2W9XA 3WNNA 3NQHA 4W50A 4GWJA 3MV11 5IJRA 3VD5A 2QBXA 1H6YA 4GWIA 3A7QA 3THCA 2ZEWA 3MV01 1UY0A 3CMGA 4RN5A 3K4AA 5EIYB 5B4XA 4XVHA 4M4RA 1CZTA 4FI9A 1UXZA 2EICA 2YB7A 4GZ9A 4A42A 2E32A 4QDQA 3T0AA 4A6OA 3C7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCK A;  2WZE A;  2VL4 A;  1RYY A;  2JDA A;  4AG4 A;  3J7H A;  4ZZ8 A;  5IYY A;  2L9L A;  2VQT A;  2W1Q A;  4XZU G;  2C26 A;  4MGQ A;  4XUP A;  2VZR A;  1OT5 A;  4QAW A;  2WZ8 A;  4A4A A;  2QQI A;  2Y6J A;  2YFZ A;  2Y6H A;  1W9T A;  2RV9 A;  3C7G A;  4UOJ A;  1EUT A;  3WNK A;  3DYM A;  3CQO A;  2QQN A;  3K77 A;  3ACG A;  4QB2 A;  2VZ1 A;  4BK4 A;  1F4A A;  3OG2 A;  3I3D A;  2YC2 A;  2WYS A;  3ACI A;  4M4P A;  3T2Q A;  1CZS A;  3HEI A;  2VJX A;  3I2I A;  1W8N A;  2ZXQ A;  4MO3 M;  1GNY A;  2CDP A;  2W91 A;  3HPN A;  3VDC A;  1SG3 A;  1TG7 A;  2WAA A;  2Y8K A;  3HNM A;  5IHR A;  3NNG A;  4DEQ A;  2QQM A;  4ZXE A;  4QDR A;  2YFU A;  2ZEZ A;  5JXH A;  4OUE A;  4ZY9 A;  3LEK A;  2J1S A;  2W47 A;  2VO5 A;  1UWW A;  5G04 L;  3UNP A;  3C7F A;  5JXI A;  4QB6 A;  5DPN A;  3T09 A;  1GUI A;  4DXT A;  1W99 A;  2W3J A;  2VZP A;  1K3I A;  4CUC A;  3GDB A;  3T0B A;  4L0P A;  4HG6 B;  1K45 A;  1UXX X;  3E1F 1;  4DUW A;  3CKH A;  2JE8 A;  2W94 A;  2VZV A;  1KEX A;  2J1V A;  2QQK A;  3FL7 A;  1JYW A;  3GGL A;  5IFT A;  3K4Z A;  2W1U A;  4PQQ A;  1JZ2 A;  3P6B A;  2YG0 A;  3AC0 A;  4XUO A;  1SHW B;  1US2 A;  4XUN A;  1PX4 A;  2BGP A;  2ORX A;  4LKS A;  3W5M A;  3UES A;  2JD9 A;  3WF2 A;  1JZ3 A;  3EYP A;  4P02 B;  2V4V A;  1O8P A;  3VD3 A;  3SKV A;  2J1T A;  3WNL A;  5B4N A;  1KGY A;  1JYX A;  4XUQ A;  2VZO A;  2OKX A;  1JU4 A;  5DQ0 A;  1OH4 A;  1JZ7 A;  1OF4 A;  2PQS A;  1CX1 A;  2BGO A;  3IDA A;  3LQC A;  1SDD B;  3OEA A;  4W4Z A;  2Y6L A;  5EJZ B;  1UYX A;  3ZM8 A;  1BHG A;  3FN9 A;  1JI6 A;  2WBK A;  4W8J A;  1JHJ A;  1WKY A;  2BER A;  3WNO A;  4QB1 A;  1UY1 A;  4BK5 A;  3HNY M;  3K4D A;  3NJV A;  2B4K A;  3IB3 A;  1JZ8 A;  3VDA A;  4KI5 M;  3I3B A;  2Y6G A;  3SEE A;  3VD9 A;  5JXG A;  4IUG A;  2QQL A;  4KWU A;  3WF1 A;  4E8C A;  2QQO A;  2WDB A;  1H6X A;  1YQ2 A;  3ECQ A;  3LPF A;  1XC6 A;  3LE0 A;  3WF0 A;  1HN1 A;  3CZJ A;  3K75 B;  1UYY A;  2DDU A;  5CYY A;  3W5N A;  1P8J A;  4TXW A;  1K12 A;  1DYO A;  1PX3 A;  2EIE A;  3PUI A;  3CDZ B;  3LPG A;  4CU7 A;  1UYZ A;  4CU8 A;  3NJX A;  1NAE A;  4QDS A;  4RYD A;  3BN6 A;  5HPO A;  4KMQ A;  2XQX A;  2HLE A;  4OZO A;  3OGV A;  4P5Y A;  4Z2A A;  5EJ1 B;  1UMH A;  4XUT A;  1XNA A;  2EID A;  2W87 A;  3MO4 A;  5IFP A;  3K46 A;  4CU9 A;  3IAQ A;  1GOH A;  4ARY A;  4JKK A;  5DN2 A;  5C71 A;  4P00 B;  1UY4 A;  3MUY 1;  2VZU A;  1OF3 A;  4P08 A;  2CDO A;  1L7R A;  1LNS A;  1W9S A;  1GU3 A;  1O59 A;  2X10 A;  4CVU A;  4OMD A;  3WEZ A;  1EUU A;  4JKL A;  2W1W A;  3C7O A;  1IQD C;  1GOG A;  5LA2 A;  4DUX A;  1UY2 A;  2WUH A;  1GOF A;  2VQU A;  1DLC A;  3C7E A;  2X05 A;  2VM9 A;  2J22 A;  2WO1 A;  4CU6 A;  3WQB A;  4BXS V;  3T08 A;  1J84 A;  4ARX A;  3A23 A;  3CZU A;  3OB8 A;  2RJ2 A;  5FUI A;  4ZZ5 A;  2W5F A;  1PMH X;  3HNB M;  2WAO A;  2VR4 A;  2J1A A;  1PMJ X;  3SEP A;  4BDV B;  2C4X A;  2ZEY A;  3VD4 A;  3PUH A;  3I3E A;  1UX7 A;  3OGS A;  4UAP A;  2W46 A;  3EB7 A;  1UY3 A;  1WCQ A;  2V5D A;  3C8X A;  4D0Q A;  2VZ3 A;  3T0D A;  2VC9 A;  1I5P A;  2WAB A;  3D3A A;  2J7M A;  5JMO A;  2X09 A;  2VCB A;  3WSO A;  3DYP A;  1W9W A;  2E26 A;  2VMF A;  3SKJ E;  1JYN A;  2ZEX A;  4CUB A;  1O8S A;  3ETP A;  4QX2 A;  4MOA A;  5F7U A;  3ACH A;  2KD7 A;  3IAP A;  3BGA A;  2W92 A;  3DYO A;  2VTF A;  2W95 A;  1JYV A;  3OEB A;  2JKX A;  4QX0 A;  1D7P M;  2Y64 A;  2VME A;  3F2Z A;  3HOB A;  3MBW A;  3III A;  2E33 A;  3MUZ 1;  3WF4 A;  5LA0 A;  1L7Q A;  1W8O A;  3GM8 A;  3WNP A;  2Y6K A;  2QQJ A;  4AAX A;  5J1X A;  2RVA A;  4XUR A;  4DEV A;  2VZT A;  2LW8 A;  3GXU A;  5G05 L;  3WNM A;  5C7G A;  1JU3 A;  3T2P A;  3OGR A;  4CUA A;  4JKM A;  1JZ5 A;  3ABZ A;  3I2G A;  4A41 A;  3OBA A;  1XNT A;  3VD7 A;  4OMC A;  4TTG A;  1ULO A;  4A45 A;  1JZ6 A;  4QX3 A;  5CZK A;  2ID4 A;  5HXM A;  3I2H A;  3HJR A;  1UZ0 A;  1W0N A;  3A22 A;  4QPW A;  1CIY A;  1DP0 A;  3I2F A;  1US3 A;  3FHA A;  5JR2 A;  5JXJ A;  3CIH A;  2V72 A;  2VOT A;  4A44 A;  1UMI A;  3T2O A;  3NRU A;  3I2K A;  3LEI A;  2VMD A;  5C70 A;  3JXS A;  1CZV A;  4A3Z A;  2C9K A;  2WN3 A;  3I97 A;  1NUK A;  2BZD A;  3LEG A;  2WN2 A;  1K42 A;  1ULP A;  1TVG A;  1GMM A;  5LCW L;  5I0D A;  3ACF A;  4YPJ A;  4OYU A;  2VZQ A;  4PT6 A;  2J1R A;  2WQ8 A;  2BBA A;  2XHN A;  1NKG A;  3A21 A;  5A1A A;  2EIB A;  3THD A;  2J1U A;  4PF1 A;  4UI9 L;  2VZS A;  2LS6 A;  2VCA A;  3UET A;  2DCJ A;  2W1S A;  4DUV A;  5JUV A;  2B9V A;  4LHS A;  4QX1 A;  1OD3 A;  3VDB A;  4DXS A;  2YC4 A;  3HN3 A;  4DXR A;  1JZ4 A;  2Z4F A;  4E8D A;  4BJ0 A;  5LA1 A;  2ORZ A;  4MAD A;  2VMC A;  5DMY A;  4LPL A;  2E31 A;  1F4H A;  3WF3 A;  2WO3 A;  3FHQ A;  2VCC A;  2XON A;  2J1E A;  3DEC A;  2HYX A;  4D8M A;  1T2X A;  1R64 A;  2WO2 A;  4JX0 A;  4LQR A;  1MPX A;  1J83 A;  2R7E B;  3P1I A;  2XOM A;  1GQP A;  3U37 A;  1NX9 A;  4JHZ A;  4MGS A;  1XPW A;  3I2J A;  4ET7 A;  2W9X A;  3WNN A;  3NQH A;  4W50 A;  4GWJ A;  3MV1 1;  5IJR A;  3VD5 A;  2QBX A;  1H6Y A;  4GWI A;  3A7Q A;  3THC A;  2ZEW A;  3MV0 1;  1UY0 A;  3CMG A;  4RN5 A;  3K4A A;  5EIY B;  5B4X A;  4XVH A;  4M4R A;  1CZT A;  4FI9 A;  1UXZ A;  2EIC A;  2YB7 A;  4GZ9 A;  4A42 A;  2E32 A;  4QDQ A;  3T0A A;  4A6O A;  3C7H A; 
#chains in the Genus database with same CATH topology
 2VL4 A;  3DGT A;  2JDA A;  1QY4 A;  2UY8 A;  3J7H A;  5FMO S;  5FP8 A;  2RS3 3;  1AR9 2;  2L9L A;  4XAA A;  1G9F A;  2AEZ A;  2W1Q A;  3NAP C;  4CCD A;  4FOV A;  2BTV C;  5DG2 A;  4AGG A;  4BIS A;  2DVA A;  5JOZ A;  3LDK A;  3VBR C;  2VZR A;  4ASL A;  4OHV A;  4PDW C;  4QAW A;  4OHY A;  4D7Y A;  4Z07 A;  5L9B A;  1CJD A;  2VBB A;  1IKQ A;  1WWY A;  3DXU A;  4L9B A;  1NQD A;  2YPD A;  4O61 A;  4IDZ A;  4Z82 A;  5BPX A;  2C0Z A;  3T3Y A;  4AQ6 A;  4NRQ A;  3VHN A;  1PZ7 A;  4J25 A;  1RUD 2;  5FP9 A;  4UOJ A;  2BJS A;  3DYM A;  2H0B A;  5FO7 B;  2AEY A;  3UK9 A;  4SBV A;  4QKN A;  1UL9 A;  4FOW A;  3JD7 1;  3ILF A;  3AYE A;  3O1U A;  1OQE A;  1S0C A;  2FZ2 A;  2PHT A;  3POY A;  5H9R A;  4QB2 A;  2UUR A;  4LA2 A;  5LK5 A;  1R09 2;  4AE2 A;  5DAW A;  1RUJ 2;  3BIE A;  2NM1 A;  3E6C C;  3NAP A;  4GD4 A;  1F5F A;  3ACI A;  1VJ2 A;  3GJA A;  2ARX A;  2BYV E;  1CZS A;  3D0J A;  3EO6 A;  3IDC B;  5IK5 A;  1QH7 A;  4MVT A;  1JUH A;  1GNY A;  2CDP A;  2ZGL A;  2QQW A;  3NV1 A;  5FZ8 A;  3VBU B;  1VRH 1;  4UW4 A;  1AXZ A;  4QT6 A;  3GJB A;  1AR6 2;  3U4X A;  3JBG 2;  4XXA A;  4ERO A;  5IT6 A;  3H8R A;  5IHR A;  4XFI A;  2LAL A;  2VPV A;  1DGW X;  4DEQ A;  3NO8 A;  1BBT 3;  3VBU A;  2CGN A;  1MQT C;  2OPK A;  4NRP A;  3CJX A;  2A5Z A;  5IK7 A;  5F37 A;  1GWK A;  2VY0 A;  2YC0 A;  1PVC 2;  2RDS A;  3OUI A;  3OPT A;  4QX5 A;  4LE4 A;  1BVV A;  2Z79 A;  2FCT A;  2GP3 A;  2BPA 2;  3C7F A;  5JXI A;  2R07 1;  5FQ0 B;  1FAY A;  2FMY A;  3H3Z A;  1GUI A;  4DMI A;  2C5D A;  2R30 A;  1XYP A;  4X6R B;  1W99 A;  1OH3 A;  1XND A;  4CUC A;  1TNR A;  3GDB A;  1NT0 A;  3T0B A;  1HXS 1;  5JSP A;  4RGA A;  3A0N A;  1QXR A;  2D3P A;  1K45 A;  1UXX X;  4W65 A;  4AVB A;  3RZH A;  3E1F 1;  4YW1 A;  5SV5 A;  4DUW A;  3ON7 A;  5EZW A;  3MLL A;  2G9Z A;  5BNN C;  3AB0 A;  2EXH A;  3RWK X;  5FQ0 A;  2W94 A;  2VZV A;  1KEX A;  2QZ3 A;  5FY4 A;  3ZXD A;  4BQ1 A;  2QQK A;  3FWE A;  4TLF A;  2HEV F;  1AZD A;  1TZO A;  5I0R A;  1V6L A;  3WQ1 A;  4BME A;  4PIX A;  1MZ6 A;  3P6B A;  2B5H A;  4JDM A;  2BUK A;  3H8X A;  1UOB A;  4E2S A;  1PM4 A;  1SHW B;  1US2 A;  4Q0V A;  5FBJ A;  2VTX J;  3CBN A;  3LSD A;  4IGP A;  4MX3 A;  5FZC A;  2XJR A;  2JD9 A;  1JZ3 A;  3EYP A;  3HMY A;  3VZJ A;  3BU7 A;  2UYA A;  1KDK A;  2R04 3;  2PYT A;  1OLM E;  3ZYI B;  3KWV A;  1QJU 3;  4MGK E;  1SEF A;  3APB A;  2BOJ A;  5KHG A;  1OHF A;  3VBF B;  3PUQ A;  3AVS A;  1CAX B;  2AUY A;  4XEZ A;  1GP6 A;  3SCF A;  4LNV A;  3NKT A;  3RZZ A;  1QIQ A;  2XWJ B;  2LUW A;  2Y6L A;  2ZGP A;  5EV7 A;  1NCR C;  3FN9 A;  1WCD J;  4RHV 1;  3J4U H;  5BY5 A;  4NIH A;  4IV3 C;  1V0A A;  1RHI 1;  3C2U A;  3VBF A;  1VBC 2;  4Q4W 3;  3KQR A;  4K9S A;  4OUM A;  5F5A A;  1U5Y A;  3OGJ A;  4RFT 0;  3ZFG C;  3AZX A;  2DVD A;  4BK5 A;  1U0A A;  5FR3 A;  5E88 A;  3HNY M;  1UX6 A;  1DZQ A;  3ZN4 A;  2JKB A;  4XFF A;  3I2D A;  4YG3 A;  3VDA A;  4KI5 M;  1W0O A;  3UKT A;  4RD7 A;  1XSQ A;  2TEP A;  5SV8 A;  3VD9 A;  2ZS6 B;  3CHX A;  4QHZ A;  3WF1 A;  1SCS A;  2IXJ A;  2OII A;  2C6S A;  4WM8 C;  5ISL A;  5C8W A;  3FFQ A;  4NE9 A;  4LBN A;  4URA A;  4TWT A;  1CQ9 A;  4WVV A;  1RJ7 A;  2FMD A;  3KV5 A;  1W2T A;  2IVI B;  5CYY A;  4ZHN A;  4Y1Y A;  2CWS A;  4TXW A;  2OUH A;  3PDQ A;  3WCS A;  5A6Q A;  1NA1 C;  1VP6 A;  3WP3 A;  4RS5 C;  5DUU A;  5FRA A;  1PO2 3;  4YM3 A;  1PX3 A;  1UD1 A;  2VUA A;  2G19 A;  5EPA A;  1ASJ 3;  1RUI 3;  4ZS3 A;  1VAV A;  5ERL A;  4PLO A;  3VZL A;  2BWA A;  3JQW A;  3I7D A;  3PL0 A;  3PUI A;  4LA3 A;  4IEW A;  2Q8O A;  4UW6 A;  1UYZ A;  3THT A;  1NAE A;  2DV9 A;  3DKQ A;  4QDS A;  1Y9Q A;  2JIG A;  4RYD A;  4OHZ A;  3QD6 A;  3KCC A;  3WG1 A;  2XBO 2;  4IQP A;  1X50 A;  3N9L A;  4WM8 A;  3VKL A;  4AVV A;  2ARB A;  1ND2 C;  2HLE A;  1O91 A;  2BVV A;  4DNY A;  2JG9 C;  1MS8 A;  2X5I C;  3CF6 E;  1KIT A;  2DCY A;  4IEP A;  3OGG A;  1GNZ A;  4P5Y A;  5EJ1 B;  1UMH A;  4Q4V 1;  2ZGR A;  2PHR A;  2GMP A;  3UKV A;  1IGO A;  1SBE A;  1ZA4 A;  3K46 A;  5FMD A;  4AFA A;  1NLQ A;  2JIJ A;  3S5A A;  4RGG A;  4DOU A;  5C71 A;  1T6G C;  1LOB A;  2IXC A;  3H9A A;  4R4Z A;  5C9A C;  5KXE A;  5T5O A;  3ES4 A;  2ERF A;  3ZSJ A;  5J96 B;  1ZRC A;  4H3W A;  2JDN A;  3POF A;  1ND2 A;  1KD7 A;  4I0W B;  3AP7 A;  3D8C A;  1GSL A;  4P08 A;  1JW6 A;  4MSV A;  4Y26 A;  5CB7 A;  1W9S A;  1XU2 A;  1RUG 3;  2R06 3;  2X5I A;  1O59 A;  1W9Y A;  4XJA A;  4E4D X;  4UFJ A;  1HN0 A;  3BVC A;  1HB4 A;  2GNT A;  3WEZ A;  4BXF A;  1J3R A;  4GAZ A;  4D7T A;  1LB2 A;  2RR1 3;  5FDB A;  3C7O A;  3IKW A;  3VBS B;  1PGL 2;  3J7L A;  2X29 A;  3PVO A;  1UY2 A;  2P1B A;  5BNO C;  1V6M A;  2WS9 3;  1VE0 A;  4E4S A;  3N9N A;  3ZN6 B;  5LBC A;  1UMZ A;  1MR5 A;  3C7E A;  4BWO A;  2DF7 A;  2VM9 A;  2WO1 A;  1VBA 2;  4CU6 A;  3HT2 A;  2ZMK A;  4XCB A;  1HQW A;  3ITQ A;  3WQB A;  5ACA 3;  4NHL A;  1HRV 3;  5C9A A;  3VUO A;  1XNB A;  2WO7 A;  4ARX A;  4AAP A;  3OUH A;  3HBK A;  1RMU 1;  1OOP B;  3KVB A;  2RJ2 A;  5FUI A;  4QPI B;  2ZA9 A;  3TOJ A;  2GDF A;  3ZN6 A;  5FZB A;  2ARE A;  1NLS A;  1O6U A;  2D6P A;  3I59 B;  4Q4X 1;  4AGR A;  5A6Y A;  3HNB M;  1W6P B;  1KS5 A;  1VPH A;  4M3C E;  1EV1 3;  1SZB A;  1YQ5 A;  1OOP A;  3DV8 A;  3SEP A;  1TMF 2;  2QQU A;  5BNO A;  1LOD A;  1O5L A;  2MEV 1;  3BYW A;  2OW4 A;  2R04 1;  2PLV 3;  1LHW A;  2R16 A;  2NYY A;  4GKX A;  4YFW A;  1Q56 A;  5EWS A;  4JV4 A;  3I59 A;  4JRA A;  3I3E A;  1UIJ A;  1ENQ A;  1W6P A;  2DVF A;  2WT2 A;  4UAP A;  3JZV A;  3RSJ A;  1UY3 A;  1XBF A;  2V5D A;  2A6X A;  2DFC A;  1K5M C;  3H0O A;  4OVE A;  3D0S A;  4AQT A;  3GYD A;  2OVU A;  1AR9 3;  3T0D A;  1W8T A;  4P9L A;  4B4Q A;  1PIV 2;  1PHM A;  2JIC A;  3WLU A;  1FV2 A;  4SLI A;  2YBK A;  3MIE A;  3O12 A;  5DAP A;  1Q5O A;  2ES3 A;  3LAG A;  1ENS A;  2JDM A;  5JMO A;  1QXP A;  2X09 A;  2DUQ A;  3WSO A;  4A7Y A;  1W9W A;  4ISQ A;  1YQ6 A;  4Q4W 1;  1JYN A;  2HWF 1;  4CCL A;  4LMF A;  1D4M 2;  3IAP A;  1JOB A;  4XQD A;  4YZ4 A;  2XLA A;  3S7E A;  2AEN A;  3DYO A;  1RUD 3;  5KHJ A;  2R0F A;  2VTF A;  4KG8 A;  1JYV A;  2GC1 A;  4EWD A;  1V9U 2;  1CR7 A;  2V73 A;  4QXC A;  2QFE A;  3RFR A;  4HVO A;  2VME A;  1ZBE 2;  1UNB A;  2D98 A;  3BPZ A;  3III A;  3K3O A;  4GXL A;  4XAE A;  1K5M A;  1YWK A;  4B29 A;  4QPG C;  5LZ6 A;  4B4R A;  1YI7 A;  5FZI A;  3KQ4 B;  4D6S A;  5F9T A;  2Y6K A;  1R09 3;  1RUJ 3;  5FMB A;  5F3G A;  4NID A;  2TBV A;  4E4Z A;  1QHD A;  1GWM A;  5IW0 A;  1YRZ A;  5C4W C;  1BMV 2;  4XUR A;  4CUG A;  5HI0 A;  4YLZ A;  3FBY A;  5LAS A;  2HEW F;  5K4L A;  5G05 L;  1QWR A;  2VUC A;  3N9O A;  5LBF A;  4BLI A;  2WNU B;  5CAD A;  1PO2 1;  3D82 A;  2NN8 A;  1OA2 A;  4KQ7 A;  1AR6 3;  1N3Q A;  3JBG 3;  1ASJ 1;  1RUI 1;  3I2G A;  1YI9 A;  3NKG A;  2A71 A;  4A41 A;  3SNM A;  1XNT A;  4QPG A;  2EAK A;  2WL1 A;  1GIC A;  5JAX A;  3NV2 A;  5E8A A;  2A3W A;  2JXA A;  2PTM A;  3OY8 A;  2ID4 A;  5LWB A;  3RZJ A;  3LSE A;  3SC7 X;  1PVC 3;  3LDR A;  2IVJ A;  3A22 A;  3KCY A;  4UYB A;  4MG2 A;  4Q8L A;  3N3H A;  4OI4 A;  1O3S A;  1Y3T A;  2VMH A;  3FUQ A;  3ZOI A;  4C90 A;  1EAH 2;  1UZW A;  2LTN A;  4U36 A;  3V65 A;  2WWU A;  3FFZ A;  5JR2 A;  2HBU A;  4W6W A;  3CIH A;  4UFM A;  4XF0 A;  4IV1 C;  4YGC A;  4CXW A;  2WIN B;  4HET A;  1UMI A;  3GZE A;  3NRU A;  1V6J A;  1YNA A;  3I2K A;  4A2U A;  4YZ5 A;  1A6C A;  4AEK A;  4DPN A;  3UL2 A;  4MGI E;  4A3Z A;  3WW3 A;  4QPY A;  2WN3 A;  2RS3 2;  5C3R A;  2OT7 A;  5L73 A;  1WLD A;  1UU5 A;  1K42 A;  1OC1 A;  1ULP A;  5C5U A;  4HMZ A;  2RR1 1;  2D6M A;  5KHH A;  5ANN A;  2PAK A;  2XJV A;  4EV0 A;  2BBA A;  4ATE A;  4CTE A;  1PMI A;  5C3Q A;  2O0O A;  5F1R A;  2WS9 1;  2EVX A;  2O14 A;  1GR3 A;  2JDZ A;  3FLP A;  4CCN A;  3SXW A;  1GZW A;  2WWS A;  4G3Y C;  4UI9 L;  1DU3 D;  4K21 A;  4UW5 A;  3PU3 A;  3USS A;  3NNF A;  4JZR A;  3UET A;  2YPJ A;  3MZH A;  5FLH A;  1WLW A;  1S0E A;  1WW5 A;  4QQH A;  1W8W A;  3BU0 A;  1YIF A;  3AVR A;  3NMB A;  4QX1 A;  3S57 A;  2ARC A;  3AZV A;  4OZX A;  4Z92 B;  5C8C B;  4FAH A;  4AFD A;  4YG0 A;  1PGW 1;  2W68 A;  5F3C A;  1VBB 1;  4GAL A;  2RDN A;  3WXP A;  1C28 A;  3AKP A;  4HPK A;  1W2N A;  3B9I A;  4GB3 1;  5A7P A;  1C5H A;  2YGM A;  1EV1 1;  2ORZ A;  2BNM A;  1VBC 3;  2H0V A;  2WRA A;  2Y34 A;  4OFG A;  5FZ1 A;  1MS1 A;  2OA2 A;  3OCP A;  3AZY A;  1O4Y A;  3VKN A;  3ROU A;  2VVE A;  2BGC A;  1XSR A;  4K3U A;  4BH9 A;  1CWP A;  1OPM A;  2PLV 1;  2WO3 A;  4QHB A;  5EYY A;  3FHQ A;  4XJ8 A;  2VCC A;  1DYK A;  2VCM A;  1AVB A;  4NR1 A;  3BTZ A;  3DEC A;  4D8M A;  4JDO A;  4GWN A;  5A80 A;  1T2X A;  3LCP A;  4XIK A;  1R64 A;  2QQP A;  4NIG A;  1HV1 A;  2WLQ A;  5CFD C;  3RYK A;  4B3N A;  4XHX A;  1AR9 1;  3VZM A;  2R7E B;  2H6B A;  1UAI A;  2PQQ A;  2XOM A;  1UW8 A;  1UYP A;  4A7K A;  5CKM A;  3WDX A;  4XDO A;  1W39 A;  4PBP A;  5JPN B;  1HLC A;  2D6N A;  3ZR6 A;  5A7Q A;  2PHL A;  4XF4 A;  4LTA A;  3THP A;  4KWJ A;  3HD8 B;  1X9T A;  1LHO A;  1XPW A;  4KU7 A;  3I2J A;  2BWC A;  4LO7 A;  5FLI A;  5CVR A;  3X29 B;  3BUC A;  5FK8 A;  3H8U A;  2XXZ A;  3NV4 A;  3NST A;  3T1M A;  1H0B A;  1ZYB A;  1B35 B;  2VU9 A;  5CFD A;  3VD5 A;  4DY5 A;  2ZGN A;  1R09 1;  2XBO 3;  4IES A;  1RUJ 1;  4WV8 A;  3USU B;  3A7Q A;  3AMH A;  4IXL A;  1Z7S 1;  4NIA A;  1Y9M A;  2ZEW A;  4RA0 A;  5A7N A;  3MV0 1;  4MGY E;  3HBZ A;  3R4S A;  1UY0 A;  2GC3 A;  5CEH A;  3O0X A;  1B35 A;  2Q5T A;  4CCJ A;  3K4A A;  5J3U A;  2PXJ A;  4HLT A;  3H3L A;  2CTV A;  4M4R A;  5FP7 A;  5C3P A;  1OUR A;  3AXD A;  3CJI B;  4PI0 A;  1OA4 A;  5FPB A;  1CZT A;  1WZX A;  4K8R B;  4PLM A;  3JBG 1;  2VNV A;  3Q8B A;  2ZZQ A;  4GH4 A;  3I3M A;  4AGV A;  3GBG A;  1CES A;  1ZVF A;  1ZRR A;  3C7H A;  4C1W A;  2G9F A;  4XJU A;  1OLM A;  4YW2 A;  3ZXJ A;  3BI3 A;  1RUE 1;  5F5I A;  2XR4 A;  1FPN 1;  1W6O B;  4JC1 A;  4OCT A;  1OQ1 A;  4XIL A;  5F6L B;  3TWI A;  1UF2 C;  3UYJ A;  4CEY C;  4MGQ A;  1IQA A;  1PVC 1;  1UOG A;  3E5Q A;  4Q4Y 2;  4MH0 E;  4QXB A;  1EY2 A;  4B7K A;  5IK8 A;  2QDN A;  4GIQ A;  1W2U A;  4YNI A;  5A33 A;  2WZ8 A;  4HN0 A;  4E27 A;  4HL0 A;  4FPY A;  2QQI A;  2Y6J A;  4QQL A;  1E5I A;  4RGK A;  5FY5 A;  5IAV A;  3U4S A;  1QOT A;  4XTM A;  2RV9 A;  4H2A A;  5BXX A;  3GCX A;  2KM2 A;  3AP5 A;  4LIT A;  1A3K A;  4FBF A;  3H1M A;  3WG3 A;  4G9S B;  3H1Y A;  1VBE 1;  5LRR A;  1VBA 3;  3JCI A;  1RUO A;  4J6G A;  1FI2 A;  5IK4 A;  1CAV A;  3K77 A;  5JIU A;  1OLR A;  1QF3 A;  2DYC A;  1PK6 C;  4AXO A;  3I3D A;  3KS7 A;  2YC2 A;  3B02 A;  5IVC A;  2GN3 A;  1C8M 2;  4IL7 A;  1H30 A;  5F2W A;  1UO9 A;  2ZML A;  5JZG B;  1XB9 A;  1UPI A;  1ONA A;  2GAU A;  4JHT A;  2VJX A;  1NZI A;  1KJL A;  3I2I A;  2BNN A;  4XFA A;  4BQ4 A;  2SLI A;  4ES8 A;  3MW3 A;  1TMF 3;  1IPS A;  2JG8 B;  2W91 A;  4MXW A;  5D8A B;  5T3N A;  1JMU B;  2Y8K A;  4XF1 A;  4FOQ A;  2Z2S B;  1QQP 2;  2W08 A;  2IXL A;  2QQV A;  2P17 A;  1LU2 A;  2QQM A;  4TZD A;  5IWF A;  1RUC 2;  1W9F A;  5FYY A;  3WD5 A;  4Z8B A;  2ZEZ A;  2ET7 A;  2JG8 A;  3IM0 A;  5JXH A;  4HK8 A;  3LEK A;  1BVP 1;  2QE3 A;  4QKD A;  3M8L A;  1AXK A;  1FXZ A;  1PIV 3;  4UBH A;  5FZ4 A;  5FZL A;  1AJK A;  1LKN A;  1UWW A;  1W2O A;  2VO5 A;  3LA3 A;  3NVC A;  5AFE A;  3RQ0 A;  2VG9 A;  4AVT A;  3KV6 A;  4D69 A;  1VBC 1;  2DVB A;  4N43 B;  3ZIW A;  4QB6 A;  1QNY A;  2RJK A;  5DPN A;  5A3U A;  1QXJ A;  1DQ0 A;  4XFC A;  4AL9 A;  1D4M 3;  3LFI A;  1K3I A;  2CY6 A;  1HIX A;  3WP4 A;  1PVX A;  4AK3 A;  2ZTN A;  1XYN A;  1YFU A;  2Z42 A;  3IPV A;  1V9U 3;  1IOA A;  2ZHN A;  4FXG B;  2Y26 A;  3WV6 A;  5IVE A;  3R4U A;  3O5S A;  4N43 A;  5FYH A;  1ZBE 3;  3O0V A;  4QU2 A;  5L9R A;  4BCU A;  4Q8K A;  3B93 A;  4CPB A;  2YV8 A;  2NPI A;  4J1X A;  3C3V A;  3P3N A;  4S2F A;  2YRO A;  2UU8 A;  2ZHL A;  4C0B A;  2XL7 A;  3VHP A;  3K4Z A;  2RMU 1;  4Y20 B;  5FP3 A;  3TEY A;  4LBK A;  3POB A;  2VUD A;  4LKE A;  3QH7 A;  1DGR A;  2D6K A;  1UU4 A;  4UW3 A;  1S1A A;  1FMD 1;  2VBP A;  4YFZ A;  3W5M A;  2NQY A;  3J26 N;  4YVS B;  2AAC A;  4HXC A;  3WF2 A;  5FZM A;  1DZR A;  5KXD A;  1AHS A;  1LES A;  1BXH A;  3M3E A;  3IMM A;  3SKV A;  4RFR B;  3KGL A;  1C1L A;  4GJZ A;  1ALY A;  1AF9 A;  2UWC A;  5B4N A;  4Y1U A;  4WVM B;  2VZO A;  5FXW A;  4LBQ B;  4FSJ A;  2XBO 1;  3M3C A;  5H9P A;  1JZ7 A;  5ABJ C;  5FYB A;  1MS3 A;  2IFR A;  3V0B B;  3LQC A;  4W4Z A;  1NE6 A;  1S2E A;  2VW2 A;  5F5Q A;  5EJZ B;  5KR7 A;  1BHG A;  2A75 A;  5GZG A;  1JHJ A;  2DUO A;  3B01 A;  4WVM A;  4LBQ A;  5FXX A;  1AYM 2;  4EWE A;  4JQR A;  1XYO A;  2BV4 A;  4XBQ A;  1EAH 3;  2OQ6 A;  3WNO A;  3OD4 A;  4M3C A;  4QB1 A;  3UJO A;  1UY1 A;  4P5H A;  5F3I A;  1H9W A;  3K4D A;  1OUS A;  2B4K A;  1YHF A;  3Q8F A;  1JZ8 A;  2VE1 A;  4DS0 A;  2ZAA A;  1LJ7 A;  5C3S A;  4GWM A;  3WNX A;  3SEE A;  3VKO A;  1CON A;  3WW4 A;  2XWB B;  4LHK A;  5ABJ A;  1X33 A;  1H2N A;  3FLT A;  1DCS A;  4R9B A;  1MEC 2;  4E8C A;  2QQO A;  2WDB A;  4EYU A;  1H6X A;  3KT4 A;  1A8D A;  3ECQ A;  1UIK A;  2ZAB A;  1XC6 A;  1S0J A;  2CAV A;  3LPF A;  3WF0 A;  2NP0 A;  4LBO A;  5FKB A;  3K75 B;  1G9D A;  4AI3 A;  1H8T B;  3WUC A;  1U12 A;  3W5N A;  1P8J A;  3I54 A;  1CVN A;  5AVP A;  3O0W A;  2R1B A;  3ZFE B;  1ZZ6 A;  3PJQ A;  1A8M A;  3BIW E;  4QGL A;  2EIE A;  1AXY A;  5FPZ A;  2PHF A;  2ZOE B;  2JDK A;  3N7L A;  1VBA 1;  3CDZ B;  5C6C A;  4GMP 3;  2AGS A;  4CU8 A;  4M0N A;  1J58 A;  4N7I A;  3AP4 A;  3ELN A;  5A3L A;  4MV2 A;  4R9C A;  3SHR A;  3VBU C;  3IT8 A;  2XH6 A;  5D1I A;  3VZN A;  1XRU A;  2DUP A;  3ACL A;  1A78 A;  1AYN 2;  4CXX A;  3O1P A;  1LGN A;  3LIH A;  1QJX 2;  1LED A;  4XUT A;  5FYT A;  3WOG A;  1TMF 1;  3TB0 A;  5K9Y A;  1G9A A;  3MO4 A;  5IFP A;  4QWN A;  3M3O A;  3IAQ A;  3BTX A;  2VVF A;  1GAN A;  1LR5 A;  2A3X A;  2V5Y A;  4I01 A;  4C91 A;  2HH9 A;  1V6N A;  1H1M A;  5EHD A;  3MW2 A;  3N7M A;  1SDW A;  1R08 2;  2D3R A;  1EPW A;  3BCW A;  4QD2 A;  4ZU4 A;  1PIV 1;  4JTN A;  4G4F A;  1SFP A;  4CDU B;  1Q8O A;  2JEM A;  2KA3 A;  3LB9 A;  5A1L A;  1ZBA 2;  4XJ9 A;  4AZZ A;  1YIP A;  1OPO A;  1NXM A;  1MS9 A;  4L99 A;  2WFF 2;  1JYX A;  2D5F A;  3TN9 1;  5FYI A;  4I30 A;  3PUA A;  4DUX A;  1D4M 1;  4NAM A;  3WUD A;  1HX6 A;  3AL5 A;  1OUX A;  3B94 A;  5FYV A;  4CDU A;  4N53 B;  3O1V A;  3ZFF B;  1V9U 1;  2X05 A;  1H4H A;  3ZSK A;  4B1M A;  4CDW B;  4YVW B;  1ZBE 1;  3N7J A;  4N8M A;  1MS5 A;  1OD5 A;  2FDI A;  2WA4 A;  3CZU A;  5IUQ A;  4AFB A;  4ZZ5 A;  2XVK A;  2VEC A;  3A4U A;  1G7Y A;  1ODN A;  1YQ8 A;  2JJ6 A;  4AYU A;  3BTA A;  2YGL A;  2W5F A;  1BMV 1;  4IGO A;  4H14 A;  1JHN A;  2PFW A;  4KBZ A;  1W06 A;  3RPQ A;  2WAO A;  3N36 A;  2VR4 A;  5T50 A;  3GZT B;  4ZU5 A;  3VBF C;  1PMJ X;  4BDV B;  5KBF A;  4P9J A;  4X8P A;  2ZEY A;  3ZSE A;  2IC1 A;  1SAC A;  2RE9 A;  4NHK A;  5T5J A;  4NMI A;  2CNA A;  2OZ6 A;  3MIH A;  4QHO A;  2W46 A;  3EB7 A;  1AX0 A;  1R1Z A;  4M3C F;  1WCQ A;  2PHW A;  2R1D A;  3C8X A;  3OBZ A;  4D0Q A;  1M06 G;  1AR8 2;  1YCI A;  1IS4 A;  1W6N B;  4BMB A;  1BYH A;  1W8F A;  1I6X A;  4CDQ B;  4UFL A;  3OPZ A;  4LE3 A;  5E16 A;  3T30 A;  3AMP A;  3O1R A;  2XJU A;  4Q4Y 3;  2E7A A;  4E4H A;  1SLB A;  4XXP A;  3DYP A;  3OPW A;  2VMF A;  3SKJ E;  2NMO A;  3VV1 A;  4CUB A;  1O8S A;  3ETP A;  4YM0 A;  1EAH 1;  4QX2 A;  4MOA A;  1W6N A;  1CAX A;  4Q27 A;  5FTT C;  5F7U A;  2P37 A;  4RR3 B;  1OI6 A;  4KWK A;  4CPB D;  1GLH A;  1ZRF A;  4W6Y A;  5FOB B;  1W3V A;  4DIN B;  1L7L A;  3AX4 A;  3ZYF A;  2ZAC A;  1D7P M;  3W9A A;  3WF4 A;  2XB6 C;  5LA0 A;  2XJQ A;  2E33 A;  1O4Z A;  2Q8E A;  1GZT A;  4QGM A;  5GZF A;  2BFU L;  2GMM A;  2YBS A;  2RS3 1;  2VUJ A;  1S0I A;  4FFF A;  3NV3 A;  4FVV A;  4PCR A;  1OXC A;  3CLP A;  5FXZ A;  1C8M 3;  1FNZ A;  1S55 A;  4HZF A;  1VAM A;  4QM8 A;  4AW7 A;  2W52 A;  4GMP 0;  2FDH A;  1URX A;  4DQA A;  5I8S A;  2A6W A;  2B9U A;  3OGR A;  3PUS A;  3VHR A;  2OQ7 A;  3MLK A;  4QMA A;  4QU1 A;  4DZG A;  5FP4 A;  2A6Y A;  2Y0O A;  3EMR A;  1QQP 3;  2ZX4 A;  4AQS A;  5FPA A;  1Q3E A;  1ENR A;  2ZKL A;  2FDJ A;  2ZGK A;  2R32 A;  1RUC 3;  4YYO A;  4CP2 A;  4RQP B;  4A45 A;  1JZ6 A;  5J09 A;  3ZMO A;  5FZE A;  5JOW A;  3W58 A;  4M0H A;  3PIG A;  5GLT A;  1UZZ A;  3I2H A;  5HXM A;  1YXW A;  3S5Q A;  2FCU A;  3EQE A;  5CFC B;  4LIU A;  5FZH A;  5FPU A;  1FNY A;  1W0N A;  2ZCW A;  2IFW A;  4C8D A;  1DP0 A;  5L36 A;  1W2A X;  1N1V A;  4AEM A;  5F8P A;  1AX1 A;  1RVF 2;  2XKP A;  2V72 A;  1IZ3 A;  3DPR B;  1D2S A;  4A44 A;  4BQX A;  4D94 A;  4FQZ A;  5IAX A;  4YW4 A;  3AYD A;  1WD4 A;  2WZR 2;  4DRR A;  1UKR A;  3AJY A;  3LEI A;  1S4C A;  2F4L A;  1BBT 1;  1C57 A;  4KGQ A;  4Q0U A;  3VBS C;  1OQD A;  1RUF 2;  3F95 A;  3BOP A;  5HCB A;  4MUV A;  3LEG A;  3GCW A;  1VBD 2;  3BOD A;  3ZX7 A;  5JSO A;  5I0D A;  5B2G B;  2VQA A;  3KT1 A;  3KF5 A;  4PT6 A;  5LEJ A;  2J1R A;  4KNC A;  1GP4 A;  4TYS A;  2GC2 A;  4AQ2 A;  1X8E A;  1Y7B A;  4ORF A;  1OOP C;  3ZKY A;  4FFI A;  4QPI C;  1K5J A;  1LAJ A;  4HKW A;  4Y1Z A;  2J1U A;  3DXT A;  4LEJ A;  4PF1 A;  2HEY F;  2VZS A;  4P9W A;  2CGP A;  1QEX A;  2EIG A;  1F31 A;  1Y4W A;  4JGZ B;  5E1R A;  4JTO A;  2EAL A;  3FZ3 A;  3VBS A;  4BQY A;  4AR2 A;  1O3T A;  4OUL A;  5JUV A;  2JWP A;  2B9V A;  5DUW A;  4EN7 B;  3POJ A;  4N7U A;  1SQ4 A;  1HQN A;  1H8V A;  2VBD A;  4KL1 A;  4EQV A;  2Y6F A;  3HN3 A;  2WSU A;  3Q9O A;  3M7A A;  2BFU S;  4DIQ A;  4E8D A;  3W59 A;  1ULE A;  3VZK A;  5I0S A;  2NZ9 A;  5DMY A;  1ZRE A;  1AYM 3;  4OUS A;  4AVA A;  1U5Z A;  1SFN A;  4XJW A;  2C1F A;  4WVZ A;  4QPI A;  4NPL A;  1C4R A;  4LUK A;  3H1W A;  4B1L A;  3LOB A;  4CEW B;  3EJK A;  2XON A;  4Y1X A;  3ASI A;  3JD7 2;  1QJU 1;  1EYB A;  1ND3 B;  2I45 A;  2KR2 A;  1J1T A;  1HRI 2;  3OYW B;  4JX0 A;  4Y5S A;  4NOT A;  4OQ9 A;  5JI9 A;  1QH6 A;  1LU1 A;  4AF9 A;  1MEC 3;  2WSV A;  5LCW L;  3WHT A;  2IXH A;  2BDR A;  5FZ7 A;  3ZYG A;  4DO0 A;  3OUJ A;  1GQP A;  1WCU A;  4XQ4 A;  1TEI A;  5HBA A;  4FPH A;  4R52 A;  1JOP A;  1NX9 A;  2PEL A;  1J59 A;  1VRH 2;  4MGS A;  4F3J A;  2VOX A;  5F39 A;  2DWR A;  4FPJ A;  4AVS A;  2P2K A;  1NY7 2;  2VW0 A;  2Q8D A;  4N90 A;  4TSV A;  3AP6 A;  4GWJ A;  1DQ6 A;  3MV1 1;  2N7G A;  2WNU C;  3M70 A;  4DRV A;  3HVD A;  3RGB A;  1C8M 1;  1NZC A;  2Q1Z B;  5ANQ A;  2GP5 A;  1KS4 A;  2K46 A;  1HW5 A;  3OBT A;  4RN5 A;  1AYN 3;  2D44 A;  5A3P A;  2JDH A;  2R07 2;  5B4X A;  4XVH A;  1QJX 3;  2PHX A;  3TEZ A;  3RZG A;  4FI9 A;  1G8W A;  5GZE A;  4FAG A;  4LHL A;  2MHF A;  3VBO B;  4GZ9 A;  1WBL A;  2OS2 A;  1QQP 1;  3ILN A;  2P3Y A;  4A42 A;  3S7I A;  4QDQ A;  4A6O A;  2PHD A;  1JYT A;  4Z2W A;  2DCK A;  1RUC 1;  5IAT A;  1RYY A;  5F6K A;  2EXI A;  2Z69 A;  2WNU A;  2XJP A;  4FO9 A;  1R08 3;  4WM7 B;  2ZGS A;  5IYY A;  3KB5 A;  1CPM A;  1UCX A;  2C26 A;  2W0X A;  2WII B;  3N9M A;  1ZM1 A;  2VXR A;  5DZF A;  1F2N A;  1W8U A;  1DQ5 A;  1T6B X;  1ZBA 3;  2W2I A;  4PIY A;  1C8N A;  2AR6 A;  3SIS A;  3DEM A;  1TE1 B;  2WFF 3;  5BNP B;  3MLJ A;  1O3R A;  4WM7 A;  2O1Q A;  1EP0 A;  3PJY A;  1W9T A;  1AX2 A;  4UFI A;  2OPW A;  1W3X A;  5FPV A;  3VHO A;  2WZP P;  3WNK A;  2QJV A;  1UN1 A;  3AKS A;  1SPP B;  4OI0 A;  4IE7 A;  3OTF A;  2QCS B;  1C3H A;  5BNP A;  5DAQ A;  3RDI A;  4YZ2 A;  4HKL A;  1G86 A;  3GAL A;  4PHZ A;  3WDY A;  5FBZ A;  1ZNP A;  2VZ1 A;  4O7X A;  3OG2 A;  4EWA A;  5TSW A;  3ZYP A;  2WYS A;  3AMM A;  1GYK A;  4CDX B;  1SPP A;  3NNL A;  4RHV 2;  3T1L A;  2TUN A;  2R06 1;  1RUG 1;  1S0G A;  4IEZ A;  1MAC A;  5DZG A;  3N4M A;  3HEI A;  2RS1 2;  4UT5 A;  1W8N A;  2CGO A;  1MZ5 A;  4Z1V A;  4QGN A;  5IVV A;  3ZYB A;  4A6S A;  3VDC A;  1SG3 A;  1TG7 A;  2WAA A;  3GZU C;  2GH8 A;  3HNM A;  5FKC A;  2VMG A;  5A7O A;  5C5T A;  5C8C C;  1AR7 2;  3E97 A;  1M4W A;  5A3N A;  3AMQ A;  3NW4 A;  3B7M A;  5FO9 B;  5ACA 1;  3AL6 A;  1HRV 1;  4XHB A;  4S2G A;  2YFU A;  1AR8 3;  1W05 A;  4PJY A;  4ZY9 A;  1W28 A;  2VGD A;  3H7J A;  3UGH A;  2MNG A;  1CJP A;  4NHY A;  1ULC A;  2BQP A;  2B39 A;  2PAE A;  4Y3O A;  4UXA A;  1NLR A;  2G4I A;  1LTE A;  1RTV A;  2ZGO A;  5FZD A;  1IG3 A;  2YXS A;  5I93 A;  1QDO A;  4IEU A;  3T09 A;  4AED B;  1WW4 A;  2BRT A;  2BEO A;  4P14 A;  2EA7 A;  2GU9 A;  4QXK A;  3WDV A;  2W3J A;  1LOF A;  2VZP A;  2XGX A;  1JS9 A;  3K48 A;  4NO4 A;  5C8C A;  1COV 2;  1FX5 A;  4E9K A;  4HG6 B;  2OUJ A;  4DFS A;  1GFF 2;  3SH4 A;  2VQ0 A;  5DXD A;  1JOJ A;  5KC5 A;  4UWD A;  5FUN A;  3LD8 A;  2YDE A;  3N9P A;  2ZHM A;  3WG2 A;  1SLT A;  1VLN A;  5A7S A;  4MXV A;  2AZ5 A;  4V2V A;  5T52 A;  3VGI A;  2J1V A;  3VBH B;  1FV3 A;  4I3G A;  4PF5 A;  4CSW A;  1MEC 1;  1Q43 A;  3GGL A;  5FXV A;  3V56 A;  4Y4R A;  3PTY A;  3QOP A;  4PIZ A;  5DUX A;  2W1U A;  4YGE A;  1JZ2 A;  1VIW B;  1IKP A;  2WJS A;  5AFB A;  5FOJ B;  3PLQ A;  5K7P A;  2YG0 A;  2F4P A;  3AC0 A;  4XUO A;  5J98 B;  1OFS A;  1POV 0;  1UU6 A;  2BGP A;  2G1M A;  2ORX A;  4LKS A;  4Q4V 2;  1B35 C;  3VBH A;  1BQP A;  1W6Q B;  5L7O B;  3N9Q A;  1TQ5 A;  3E6D A;  3WIN E;  2DTY A;  2HWD 2;  5FWJ A;  1ST8 A;  2V4V A;  3VD3 A;  1RUD 1;  3WT3 A;  2J1T A;  4H55 A;  1QOS A;  5LB6 A;  3R6S A;  2D43 A;  4LOT A;  3WNL A;  2GC0 A;  5LY1 A;  3O1O A;  2VW1 A;  1LOE A;  1POQ A;  4GH4 C;  4XUQ A;  5EJ3 A;  4I2O A;  1N1T A;  1JU4 A;  5DQ0 A;  3SMH A;  1ZRD A;  2JEN A;  3AZZ A;  3FHI B;  3CJI C;  1OF4 A;  1LEN A;  1N3O A;  2PQS A;  1CX1 A;  1QJF A;  2BGO A;  4V1P A;  1FT9 A;  1PNG A;  1UYX A;  3ZM8 A;  2RJL A;  1BCX A;  2WBK A;  4Q0P A;  2B8M A;  1DZT A;  2BER A;  2YU1 A;  3O14 A;  3RMX A;  3KMH A;  4YRD A;  4Y5T A;  5KC6 A;  3D5O A;  1BK0 A;  3USU A;  4XAC A;  3RZM A;  5A6X A;  1RVF 3;  2P3J A;  1F15 A;  3JUU A;  4HSJ A;  1AR6 1;  3VKM A;  1F9K A;  2GND A;  2XLF A;  3FBM A;  5LY2 A;  4IER A;  2WZR 3;  3IB3 A;  1ACC A;  1GP5 A;  1CPN A;  3I3B A;  2EAA A;  3BTY A;  1RMU 2;  3ZYJ B;  4IUG A;  3ZDS A;  2Z5W A;  4LUL A;  1R08 1;  1YFX A;  1RUF 3;  1XQN A;  2QQL A;  3CJI A;  3IMN A;  3LA2 A;  5FZO B;  3KV9 A;  1H9P A;  1LOG A;  1YQ2 A;  2WNV B;  1WUV A;  2IWG B;  3AYA A;  2WA3 A;  3EBR A;  3LE0 A;  2VXJ A;  1VBD 3;  3UJQ A;  4EZ4 A;  2ZPX A;  4Q4X 2;  4LT5 A;  1ZBA 1;  4I3P A;  3FX3 A;  1HN1 A;  3L2Y A;  5IVF A;  1S0F A;  3CZJ A;  4XBL A;  1RXF A;  1UYY A;  2FDK A;  1DQ2 A;  2ET1 A;  2MEV 2;  1W6O A;  4BQ5 A;  2E9Q A;  2DVG A;  4HN1 A;  4NRM A;  4XW3 A;  2BU9 A;  5JZG C;  2TNF A;  1BK1 A;  2RS5 2;  4CU7 A;  3NJX A;  4DY3 A;  1DQ4 A;  1C5I A;  3ILR A;  4W6X A;  5F3E A;  2NMN A;  2VNG A;  3PTR B;  3AKT A;  5HPO A;  2JG8 C;  5CKQ A;  5D8A C;  1FOD 2;  4I02 A;  1ZRI A;  3ZPO A;  3AYC A;  2E6V A;  3LA7 A;  4QX8 A;  5LA9 A;  4B4P A;  1VAK A;  4XTP A;  3O7O A;  3OGV A;  3POS A;  3D4K A;  3MEP A;  4AEJ A;  4KGG A;  2HWF 2;  1HB1 A;  1CAU B;  4BZ4 A;  2HYK A;  2BP6 A;  3HIF A;  3JB8 A;  4RL7 A;  5T5L A;  3PHM A;  1EPZ A;  3ALQ A;  4IE6 A;  1DQ1 A;  2DU1 A;  2W87 A;  2JB4 A;  1S0B A;  1YFY A;  3GNE A;  4IEX A;  4Q26 A;  4CU9 A;  1GOH A;  3QH6 A;  5JZG A;  2VOK A;  2RDR A;  5FCC A;  4ARY A;  5FY0 A;  1D4V B;  1WA6 X;  3JD7 3;  4QKB A;  5JMC A;  1CD3 G;  4Y24 A;  3LOI A;  1CAU A;  2ZX3 A;  4P00 B;  1HRI 3;  4N43 C;  3MUY 1;  4EN9 B;  1RUH 2;  3UKN A;  2VZU A;  5D8A A;  2XJS A;  1KDM A;  2HKX A;  4N9I A;  4CP1 A;  5CKN A;  2Q1M A;  1L7R A;  1RIT A;  1GU3 A;  4NPR A;  2X10 A;  4CVU A;  3ZYH A;  1WLT A;  3R4D B;  1EUU A;  4WZF A;  3WY6 A;  1B09 A;  1J3Q A;  2A3Y A;  3FMG A;  1IQD C;  1GOG A;  4BOW A;  5LA2 A;  1STM A;  2YZ4 A;  1VRH 3;  1GOF A;  4NJ4 A;  3SCH A;  4LHN A;  2CV6 A;  5FY8 A;  1DLC A;  2K2S A;  4FFG A;  2J22 A;  5K0U B;  2ZGQ A;  3MYX A;  3T08 A;  3KHC A;  1WW7 A;  4FP2 A;  3KV4 A;  3A23 A;  2B45 X;  4BLJ A;  1REF A;  1WGP A;  1HDK A;  4YVS C;  2VTX A;  1SLC A;  2Y0I A;  1XE7 A;  2HJI A;  5K0U A;  4NWV A;  3GF6 A;  4FPO B;  5DAB A;  4NAO A;  5FYZ A;  2R07 3;  2XJT A;  3KD4 A;  2J1A A;  5GLU A;  1FAT A;  2Q4S A;  4QQP A;  2C4X A;  3VD4 A;  4LJH A;  3PUH A;  4FQ4 A;  2X8K A;  5I0T A;  3RRD A;  3P3P A;  1QDC A;  1LGB A;  4HON A;  4Y20 A;  2GAL A;  2JDU A;  1UX7 A;  1W0P A;  2B46 X;  3CU7 A;  1S2B A;  3Q8A A;  4YG6 A;  5JR7 B;  4BIO A;  4Q0S A;  1LGC A;  3H42 B;  4I09 A;  3OBR A;  4JGY B;  1TME 2;  4YVS A;  2VZ3 A;  2VC9 A;  3VDD B;  2D5H A;  2P6H A;  1I5P A;  1OMI A;  5CNA A;  1R1A 2;  3IN9 A;  2WAB A;  4KBB A;  3D3A A;  1PNF A;  1ENX A;  3TNP B;  3DKW A;  4E2Q A;  4HVQ A;  5CG9 A;  2AYH A;  2VCB A;  3L2H A;  5F5C A;  1YYN A;  2ZEX A;  3GBF A;  3ZXE A;  4CA9 A;  1DGL A;  3ACH A;  1NCQ B;  2KD7 A;  2QVS B;  1XNK A;  1PO1 2;  1RVF 1;  3BGA A;  5FZA A;  3VDD A;  3V0B A;  1H2L A;  2W95 A;  4EN8 B;  3OEB A;  5M0T A;  1OA3 A;  2JKX A;  2WZR 1;  3H3U A;  3NNJ A;  2WYF A;  1Q8Q A;  3MBW A;  3J9S A;  1LRH A;  1L7Q A;  4BE3 A;  1W8O A;  2Q1F A;  2F17 A;  5CIR A;  2OYZ A;  3PVE A;  4UF0 B;  1H8T C;  1MZF A;  3PNA A;  3P5B A;  1NCQ A;  1RUF 1;  3MID A;  4IE4 A;  3QLQ A;  4L8Q A;  4WBB A;  2QQJ A;  5A3W A;  3WNP A;  4AAX A;  5GM0 A;  1GBG A;  5J1X A;  3ZFE C;  2VOW A;  3J8F 2;  4F7Z A;  4H7L A;  3VL9 A;  2RVA A;  1VBB 2;  1VBD 1;  2B7Y A;  1FYU A;  2DFB A;  3HR9 A;  4Q1R A;  4RHV 3;  1DG6 A;  4RSU A;  3ETQ A;  4Q1P A;  2VZT A;  4LO4 B;  3T2T A;  2LW8 A;  3GXU A;  2XL9 A;  4GB3 2;  4DEV A;  2RS1 3;  3JU9 A;  3WNM A;  4AI0 A;  5C7G A;  5KXB A;  4FOY A;  1SMV A;  4FPL A;  3BKZ A;  4NPM A;  1HJG A;  1PGL 1;  1L3J A;  3MIB A;  4CUA A;  1N1Y A;  1ULF A;  5JOY A;  1AR7 3;  1DFQ A;  3SH3 A;  3KM5 A;  1JZ5 A;  3ZXG A;  5A6Z A;  2R49 A;  1PZ9 A;  4PQ9 A;  3E6B A;  2PA7 A;  4ONU A;  3VD7 A;  4OMC A;  5FZ0 A;  3HT1 A;  4TTG A;  1H8T A;  5EP9 A;  4LKD A;  1JYI A;  1BZW A;  1ULO A;  2GSY A;  4S2D A;  1KJR A;  4QX3 A;  3DF0 A;  1SBD A;  4MYE A;  4UBG A;  5LBE A;  3ZFE A;  5LEK A;  4OLL A;  1RGS A;  5DUV A;  3A0K A;  3UV9 A;  3VN4 A;  1UZ0 A;  4AOC A;  4BHP A;  4WVW A;  4LK6 A;  3DCQ A;  4QPW A;  1CIY A;  1W90 A;  2JX9 A;  1MS4 A;  3I2F A;  1US3 A;  2DCT A;  4XBN A;  4XJZ A;  3G6J B;  4FTB A;  5JXJ A;  4EE2 A;  1GV9 A;  3NAP B;  2VOT A;  3NJY A;  4XF9 A;  3SIT A;  1V6O A;  1H2K A;  1COV 3;  4NWW A;  1X36 A;  3WW2 A;  2ZAH A;  2VUL A;  3KZ4 C;  4CDU C;  2P4E A;  4LK7 A;  3VBR B;  2MPF A;  1CIW A;  4PDW B;  1G9B A;  4XDP A;  1A34 A;  1HRI 1;  5C70 A;  4COY A;  4ITC A;  5KXC A;  4Y33 A;  2C9K A;  3AKQ A;  4XYX A;  1Z7S 2;  2PAM A;  3B5L B;  5FZ6 A;  5L9V A;  3PUR A;  3U0Z A;  2Y33 A;  3CO2 A;  1NUK A;  3KSC A;  2WN2 A;  4QX7 A;  4N53 C;  3VBR A;  3AP9 A;  4PDW A;  3ZFF C;  2W39 A;  4CDW C;  5EXO A;  4YVW C;  3WR0 A;  2YBP A;  4IE5 A;  4YPJ A;  4OYU A;  2WQ8 A;  4Q4V 3;  3LKJ A;  4O9G A;  2XHN A;  1NKG A;  5A1A A;  5LK7 B;  2EIB A;  4PLN A;  4HK9 A;  2E7Q A;  3THD A;  1ZA7 A;  2HWD 3;  2LRO A;  3D6E A;  1JOD A;  2E53 A;  4XMI A;  3QCW A;  1NY7 1;  2HWE 2;  3AFG A;  1AUY A;  2LS6 A;  4IND A;  2VCA A;  4DB5 A;  2DBN A;  2DCJ A;  4PBO A;  3INA A;  3G7D A;  1YQC A;  2W1S A;  5J7M A;  1DBN A;  3WP6 A;  2DUR A;  4DUV A;  1RUE 2;  3Q8C A;  1AL2 2;  3PVB B;  4LHS A;  1FPN 2;  3HQU A;  4HSL A;  4P9X A;  4R8H A;  1NE4 A;  4Q0Q A;  3VDB A;  3VKF C;  2BOI A;  1GWL A;  3UGG A;  4N53 A;  5FV3 A;  4DXR A;  4HFS A;  3ZFF A;  5IVJ A;  1QKQ A;  3U14 A;  4CDW A;  1JZ4 A;  4YVW A;  4K1Z A;  1LEC A;  3UT0 A;  4F83 A;  1QJY 2;  5LA1 A;  3WW1 A;  1MQT B;  3ZSL A;  2FDF A;  2E31 A;  3POI A;  3LGR A;  5AC9 2;  4LBJ A;  4Y5Z 0;  1VB2 A;  3MGU A;  4IEQ A;  4CDQ C;  3MHZ A;  4X8N A;  2VNR A;  3IIA A;  1VBE 2;  1MS0 A;  3ENR A;  2FQP A;  4KU8 A;  4FPF A;  2D6L X;  2J1E A;  1F35 A;  1UZV A;  4LBM A;  1MQT A;  3MIG A;  4K6B A;  4NHX A;  4XQW A;  3ZMN A;  5LW9 A;  3ZVX A;  4HOO A;  2WO2 A;  3IDE A;  1DIW A;  1RMU 3;  3LDB A;  5A70 A;  3TNQ A;  4AHY A;  2YHJ A;  3AJZ A;  4S2H A;  4LO8 A;  4RR3 C;  3KCX A;  3RWN A;  4Q4X 3;  5FZ3 A;  5BNN B;  1WD3 A;  2HWB 2;  3POW A;  5DZE A;  5H9S A;  1APN A;  3ZR5 A;  2HWC 2;  4XAB A;  4O9E A;  2A73 B;  2DU0 A;  1SBF A;  2MEV 3;  4I0A A;  5GZC A;  4CDQ A;  4AI1 A;  4ET7 A;  4AHZ A;  5JPM B;  5GLV A;  4MET A;  4BIF A;  3NQH A;  4W50 A;  5BNN A;  1XOY A;  2XKO A;  4UFK A;  4XIO A;  3VL8 A;  2RS5 3;  1RIR A;  5HCA A;  5IJR A;  2QBX A;  3J7N A;  1H6Y A;  2ZKN A;  3PIJ A;  4KWL A;  4R4X A;  4A7Z A;  4RR3 A;  2CSG A;  1FOD 3;  3THC A;  2ZGU A;  4LOR A;  4D6R A;  1ZX5 A;  1NG0 A;  2VVD A;  4B8E A;  1OSG A;  3HQX A;  3RVH A;  3LIG A;  3RI9 A;  4AHW A;  5FJK A;  3CMG A;  3TAY A;  1AL0 G;  2RS1 1;  1BEV 2;  3K3N A;  1O5U A;  2HWF 3;  3MIC A;  4H7M A;  4CXY A;  4RQP C;  1UZY A;  4IEY A;  1UXZ A;  3W20 A;  2YB7 A;  1AR7 1;  1NCR B;  1E5H A;  4QKF A;  1D0G A;  3U1X A;  2E32 A;  2D93 A;  4IV3 B;  5CFC C;  3NNM A;  2JD4 A;  4GMP 1;  2WZE A;  1YEW A;  2Y38 A;  4LUM A;  5E89 A;  3RMY A;  5LRS A;  4R9D A;  4YZ1 A;  1LHV A;  4AG4 A;  1RUH 3;  3ZFG B;  4ZZ8 A;  4MGZ E;  2ADE A;  3KVA A;  1J1L A;  2VQT A;  1NCR A;  2B42 B;  4LBQ D;  2RMU 2;  2ETE A;  3QAC A;  3DPR C;  2OZJ A;  4XUP A;  4XZU G;  1QOO A;  4IV3 A;  1ULG A;  2CHH A;  3OOX A;  3Q8E A;  4OI1 A;  3V64 A;  3ZPY A;  1OT5 A;  2DTW A;  4A4A A;  1FMD 2;  3DL3 A;  4Y4Y A;  1BKZ A;  1Q8S A;  3EXU A;  4RQP A;  3ZFG A;  3I2O A;  2YFZ A;  2XPJ A;  2Y6H A;  4WM8 B;  1HKD A;  1JBC A;  4BA6 A;  3C7G A;  1GQG A;  2IZW A;  2ZX1 A;  3AZW A;  1COV 1;  1EUT A;  5FK7 A;  3VB9 A;  5A7W B;  3UGF A;  5CFC A;  2YY1 A;  3CQO A;  5DDJ 2;  1I5Z A;  2KXL A;  5GKA C;  3MFC A;  4BB3 A;  2QQN A;  4XMA A;  3CL1 A;  4MGT A;  2FZ1 A;  2G9G A;  3ACG A;  1NA1 B;  4BK4 A;  4RS5 B;  2JDP A;  1F4A A;  5DAV A;  2YU2 A;  1CX4 A;  1MVE A;  3DPR A;  3GHN A;  4M4P A;  5A7W A;  3T2Q A;  5GLZ A;  3K2O A;  5DG1 A;  5GJ6 A;  4TLG A;  3WVJ A;  2GN7 A;  3R0R A;  5FZK A;  2ZXQ A;  4MO3 M;  3RYR A;  4JGZ C;  4COZ A;  1Z0H A;  2Q0A A;  5K8S A;  1NA1 A;  4KG0 A;  4RS5 A;  3QBQ A;  5IVY A;  1RED A;  2XVG A;  2WLP A;  3HPN A;  2RM2 2;  1ND2 B;  4XF3 A;  2HWD 1;  1NYW A;  4JCK A;  4MLO A;  4K20 A;  2V09 A;  2JG9 B;  1LUL A;  2X5I B;  3NNG A;  4NII A;  2JE7 A;  4L92 A;  4ZXE A;  1V00 A;  2FHR A;  4FPE A;  4QDR A;  1DGR N;  1QJZ A;  2VH9 A;  1TME 3;  4OUE A;  2ZX0 A;  2IXI A;  3E5X A;  4HBN A;  2J1S A;  2JG9 A;  2XDV A;  1BJQ A;  1YJL A;  2GZW A;  2W47 A;  4YM1 A;  5G04 L;  4COU A;  1R1A 3;  1Q8V A;  3UNP A;  1ZZ9 A;  5T5P A;  1IS6 A;  2ADD A;  4CEW C;  2PMW B;  5C9A B;  4JGZ A;  4JVA A;  1IS5 A;  1ND3 C;  1OBN A;  2WNE A;  3LEM A;  5FMC A;  5FRE A;  4DXT A;  3B00 A;  4BQ3 A;  4HAN A;  4CCE A;  2YUE A;  2BW8 A;  1PO1 3;  5JDB A;  4LKF A;  4FT8 A;  4L0P A;  1O4T A;  4A3X A;  5CG8 A;  4AFC A;  3H7Y A;  2WC2 A;  3SH5 A;  4M01 A;  3CKH A;  4F8A A;  2JE8 A;  2AC1 A;  1WW6 A;  1H2M A;  4K40 A;  2LM3 A;  1UOF A;  5BNO B;  1X8M A;  4YW5 A;  1HB3 A;  4BM8 A;  4FXK B;  3KF3 A;  3FL7 A;  2OX0 A;  4P9G A;  4URT A;  4ZON A;  3ZYR A;  3J8F 3;  1JYW A;  3FJS A;  5IFT A;  3H8O A;  1VBB 3;  4CEW A;  4PQQ A;  4U2A A;  4CE8 A;  5FYS A;  4L11 A;  4Q4Y 1;  4GB3 3;  4PI2 A;  5HV4 A;  1ND3 A;  3OYW A;  4JAA A;  1V6K A;  1GQH A;  1PX4 A;  4XUN A;  3ZXL A;  1LHU A;  2QZ2 A;  3UES A;  3CEW A;  4AFM A;  4EZH A;  2R0H A;  4N9H A;  4CCM A;  3O1M A;  4P02 B;  2WKK A;  5I0U A;  1O8P A;  5FYM A;  3MDP A;  4P9I A;  3WHU A;  3O1T A;  3RJR A;  5AVA A;  1W04 A;  5E6H A;  2WFP A;  2RS5 1;  4JQT A;  5GLW A;  1KGY A;  2D40 A;  4HT1 T;  1POV 3;  2E51 A;  2UYB A;  3I8T A;  4MHU A;  2P3K A;  5J48 A;  2OKX A;  4FTS A;  1OH4 A;  1W6M B;  3ZXF A;  5T54 A;  4NRO A;  3J7M A;  1FOD 1;  4GKY A;  2JEC A;  3TRS B;  2P3I A;  3IDA A;  3SLI A;  1SDD B;  3OEA A;  3VBO C;  5JCT A;  2ZGT A;  1G6N A;  3HQR A;  1KFX L;  1NOV A;  1JI6 A;  3M2M A;  4W8J A;  1PM7 A;  1WKY A;  4QQO A;  2WT0 A;  3TN9 2;  1K5M B;  1W6M A;  1JYC A;  1XE8 A;  2CU5 A;  3WQ7 A;  2WR9 A;  4NN0 A;  2DCZ A;  4WM7 C;  5KHI A;  5JSR A;  2E63 A;  1HXS 2;  3OJB A;  3NJV A;  1QNW A;  1X82 A;  2UY9 A;  2I74 A;  4CYD A;  3TEW A;  2ATF A;  4XE9 A;  2Y6G A;  3PMS A;  2UWB A;  2A70 A;  5JXG A;  2PN5 A;  5BNP C;  1RUH 1;  4KWU A;  2XG3 A;  3MPP G;  4FP3 A;  1Z7S 3;  2WT1 A;  2XLG A;  3HWJ A;  1W8Z A;  2O8O A;  3FUO A;  1Y43 B;  4QQ2 A;  3VBO A;  4CCO A;  3ZLI A;  1YO8 A;  2ENR A;  1IPK A;  4MZU A;  3R05 A;  3WQ0 A;  1YFW A;  4K7J A;  4QPG B;  4NUB A;  1S2K A;  2DDU A;  4JRL A;  1W03 A;  2XML A;  4EN6 B;  3B9C A;  1QGL A;  1K12 A;  1DYO A;  2IXK A;  3OY8 B;  5LAT A;  4XFH A;  5LBB A;  4AHX A;  5BUV A;  3S0M A;  5C4W B;  1ZZB A;  4CDX C;  2BNO A;  3LF7 A;  4E2G A;  1YJK A;  2HWE 3;  4FPK A;  2VNO A;  1VMH A;  1CAW B;  2AH2 A;  3LPG A;  4Y1V A;  5T55 A;  3N35 A;  1RUE 3;  2D6O X;  1AL2 3;  3BN6 A;  5IVB A;  1FPN 3;  1IS3 A;  4KMQ A;  1DGW A;  4EJR A;  3ZO0 B;  3ORJ A;  4Y22 B;  2EXK A;  2XQX A;  5FY7 A;  5C4W A;  2C24 A;  2JB8 A;  2IUW A;  5CAZ A;  4OZO A;  5BV6 A;  3WCR A;  1WA4 A;  1CAW A;  2EXJ A;  1QJE A;  2ZGM A;  5FZF A;  4AWD A;  1QJY 3;  1RHI 2;  1BLZ A;  4YGB A;  2QTW B;  4Z2A A;  5C3O A;  3SQO A;  3ZKU A;  5FPX A;  1XNA A;  1CGP A;  3M3Q A;  2CYF A;  1HB2 A;  2GNB A;  4P9Y A;  2ZBJ A;  4Y22 A;  3U10 A;  1U5I A;  2EID A;  2RG4 A;  3ME2 A;  3HN1 A;  3WDT A;  4YAR A;  4CDX A;  1LOF C;  2QUO A;  1G9C A;  1JUI A;  3MIF A;  1VBE 3;  3URF A;  3AM2 A;  4JKK A;  5EFU A;  4FCA A;  5DN2 A;  3AMN A;  3ZSM A;  1XU1 A;  3RNS A;  3RJ2 X;  4TN7 A;  3PVN A;  1UY4 A;  4B7E A;  4AED C;  1TME 1;  1AJO A;  2CAU A;  4WZC A;  1OF3 A;  3EHK A;  3H50 A;  4IV1 B;  5FZG A;  2J42 A;  3GBW A;  2SBA A;  2K9Z A;  1LEM A;  1WCS A;  2Y60 A;  2CDO A;  1VAL A;  1LNS A;  1R1A 1;  2QKD A;  3M4F A;  1GZW B;  4QM9 A;  1OKO A;  4LO5 B;  1WMD A;  4Q29 A;  1E57 A;  4OMD A;  5EYX A;  2HWB 3;  2A1X A;  4JKL A;  5I91 A;  3TYJ A;  2W1W A;  4ZU7 A;  1D0H A;  2HWC 3;  1AYM 1;  4OHX A;  4IV1 A;  4LIV A;  2WNO A;  4FPC A;  1Q8P A;  3ATG A;  4YGD A;  1PO1 1;  2WUH A;  3VBH C;  3S6P A;  3DN7 A;  5EQU A;  1DYP A;  2VQU A;  1GKB A;  3KT7 A;  4ES9 A;  2FDG A;  4C1X A;  2VOV A;  3ST7 A;  1YUD A;  3LFM A;  1O7F A;  1WMX A;  4HPK B;  4BXS V;  3MW4 A;  5DAX A;  1F8V A;  1J84 A;  5J36 A;  3VZO A;  4AED A;  1LCL A;  5FJH A;  3OB8 A;  5FPL A;  4YW3 A;  2E7T A;  5L7O C;  3WX5 A;  3J8F 1;  5CA6 A;  4D6Q A;  1HJF A;  4HVR A;  2FBE A;  5A3T A;  1DLL A;  1CN1 A;  2V4A A;  3M1H A;  1REE A;  2CL2 A;  1PMH X;  4XOG A;  1BEV 3;  4AI2 A;  4CCC A;  1N1S A;  1UOJ A;  2C9A A;  3U11 A;  1N47 A;  2QNK A;  2X53 S;  3KGZ A;  1QMJ A;  3PME A;  1SLL A;  3MPB A;  1VMF A;  2ZZJ A;  3FC0 A;  1ODM A;  3B69 A;  1I3H A;  1ULD A;  3K51 A;  4R9A A;  1SLI A;  2BVB A;  5GZD A;  4FFH A;  3OGS A;  3WP5 A;  4GQ7 A;  1WBF A;  5A3M A;  3TEX A;  1POV 1;  4D7S A;  3ZN5 A;  1BBT 2;  5FLJ A;  1O3Q A;  2ZX2 A;  5JWP A;  3PU8 A;  5FY9 A;  1RB8 G;  2I2S A;  1W6Q A;  1S0D A;  2JDY A;  5L7O A;  2ARA A;  2GME A;  4AVC A;  1PGS A;  1XJA A;  4HKO A;  1SCR A;  1IPJ A;  2RMU 3;  2FCV A;  4XET A;  4BYY A;  4C0H A;  1UPS A;  5JLV A;  2J7M A;  4AI8 A;  3POE A;  4ZPI A;  1AYN 1;  1KXG A;  1VR3 A;  2E26 A;  3KLS A;  4K1Y A;  1FMD 3;  2D7F A;  1QJX 1;  3WDW A;  5CFD B;  1DHK B;  3BB6 A;  5JVV A;  5CIS A;  3TBD A;  4CCK A;  4LXL A;  1RJ8 A;  2W92 A;  1QU0 A;  2WNV C;  5JOX A;  2Q30 A;  4O65 A;  5JI7 A;  4LLF A;  4QX0 A;  4XCA A;  4CP9 B;  3F2Z A;  3HOB A;  5DDJ 3;  4ASK A;  3ES1 A;  3MUZ 1;  5KWR A;  4YW6 A;  3ZXA C;  4XFB A;  5C33 A;  4MHR A;  1Z78 A;  3GM8 A;  1GNH A;  4I0B A;  1ZZC A;  1I1E A;  3RZL A;  5HXV A;  1H1I A;  5BYN A;  1XE0 A;  1WME A;  4XC9 A;  2P34 A;  4LO6 B;  4CP9 A;  4GH4 B;  4AI9 A;  3FLR A;  1VMJ A;  2LRP A;  4XDQ A;  5KHK A;  3O1S A;  2UWA A;  1F5J A;  5CU1 A;  2GH2 A;  1JU3 A;  2WFF 1;  4ZXK A;  2CWM A;  3T2P A;  5L19 A;  3I4I A;  5D21 A;  5FAX A;  5FZO A;  2RM2 3;  2PHU A;  4D3W A;  2WNV A;  3DUI A;  4JKM A;  2R04 2;  4BQW A;  5FUP A;  3ABZ A;  5HV0 A;  1DDL A;  5A3O A;  2HWE 1;  5CBL A;  1QJU 2;  3OBA A;  3RI8 A;  5A33 B;  4LLO A;  5I8T A;  4BQ2 A;  4ISR A;  3LZZ A;  1AL2 1;  1LOC A;  4YWA A;  3BAL A;  3OD0 A;  4IGQ A;  5CZK A;  3U75 A;  1E5R A;  4LBL A;  2EF6 A;  3RG0 A;  3RS6 A;  3L9J T;  5FZ9 A;  2H6C A;  3S30 A;  1DF0 A;  3HJR A;  5BNQ A;  1LHN A;  3AK0 A;  2VD7 A;  1X9P A;  2NLR A;  2XQR A;  1HQL A;  3MFA A;  1QJY 1;  2Q8C A;  5A1F A;  4Q4W 2;  1CAV B;  3B3Q E;  5D2A A;  4YSF A;  2ZMN A;  1VB4 A;  3FHA A;  2XVL A;  5AC9 1;  5FYC A;  3RYP A;  2A6V A;  1GZC A;  2P6C A;  3E5U A;  4CEY B;  4GJY A;  4EN0 A;  1KRI A;  1WLC A;  1GZ9 A;  5JIA A;  3T2O A;  2WWJ A;  4X6Q B;  1ZZ8 A;  4BPZ A;  2VMD A;  1RIN A;  4L2N A;  3JXS A;  4IEO A;  1CZV A;  4MXW B;  1AR8 1;  2ZJC A;  1ZZ7 A;  4CEY A;  2BBV A;  3I97 A;  5GAL A;  4M00 A;  1OKQ A;  2BZD A;  1IG0 A;  3AFK A;  3GHM A;  1OVP A;  4UFH A;  1RXG A;  3CNA A;  5J37 A;  5K0U C;  1TNF A;  1TVG A;  2HWB 1;  1GMM A;  3JB4 C;  3SCG A;  3ACF A;  1KQR A;  4Q2F A;  1VRB A;  2VZQ A;  3I3Q A;  4COW A;  2HWC 1;  5F2S A;  1PK6 B;  1YC6 1;  1KFU L;  1RUN A;  2O8Q A;  4J1W A;  3A21 A;  3WDU A;  1WMF A;  1PO2 2;  2FD8 A;  2OXB A;  3AXE A;  1RC6 A;  4Q5O A;  4YM2 A;  2HBT A;  1ASJ 2;  1RUI 2;  4IET A;  1H1A A;  3FE5 A;  2QDR A;  5FMO L;  2DBI A;  2K0G A;  1JH5 A;  2RDQ A;  1LOA A;  1SLA A;  4IE0 A;  5FFO C;  4OQ8 A;  1PK6 A;  4FPG A;  3ZIX A;  4FTE A;  1V70 A;  1OD3 A;  4ZKT B;  2A7A A;  5AC9 3;  4NHM A;  1E5S A;  4L97 A;  3NWK A;  5HCF A;  3VLB B;  2I07 B;  3POG A;  4DXS A;  2YC4 A;  4ZS2 A;  3IPV B;  2YMZ A;  2Z4F A;  3WZ1 A;  5APA A;  3KHB A;  2D3S A;  4BJ0 A;  1BEV 1;  4XZP A;  4MAD A;  2ILM A;  2VMC A;  4IW3 A;  3TN9 3;  4LPL A;  4ATF A;  3BOW A;  4JDN A;  4JGY C;  3WG4 A;  1F4H A;  2D97 A;  3WF3 A;  4OI2 A;  1HXS 3;  1X7N A;  4LR4 A;  2RHP A;  1V6I A;  3VDD C;  4YW7 A;  3IBM A;  3NJZ A;  5FY1 A;  2R6Q A;  2HYX A;  1JTZ X;  1YLL A;  3GZA A;  1RL3 A;  2XUM A;  3ZDV A;  4KH9 A;  3MI8 A;  1H4G A;  1Y9G A;  2A6Z A;  1XXN A;  2YYO A;  3IZO A;  1MPX A;  4LQR A;  3IDB B;  1J83 A;  3N7K A;  3P1I A;  1NCQ C;  5F32 A;  3RZK A;  3ZXK A;  2R06 2;  1RUG 2;  2WQ4 A;  4LOS A;  3T4V A;  1JN2 P;  4OHW A;  1PZ8 A;  1SFY A;  1OFN A;  2RR1 2;  3U37 A;  2GNM A;  2VAU A;  4JHZ A;  4JGY A;  3MF6 A;  1NQJ A;  4XFG A;  1MVQ A;  2VMI A;  4QXH A;  3T4H B;  3BPS A;  2W9X A;  2WS9 2;  3WNN A;  4GUL A;  3V0A B;  1HV0 A;  5FWE A;  2P5B A;  5A32 B;  1W8H A;  5DDJ 1;  2WQZ C;  5ACA 2;  1HRV 2;  5FIX A;  3HAG A;  3LWC A;  4YZ3 A;  1NXD 1;  4DXZ A;  1U5X A;  1JXN A;  1UQX A;  3W21 A;  1C1F A;  4CZS A;  2XHK A;  1IHM A;  4ASM B;  1OLQ A;  2XUE A;  3AKR A;  1WCK A;  1UKG A;  4GWI A;  1MZE A;  4M3C B;  4NVP A;  4BU2 A;  4CRQ A;  3V0A A;  5HCH A;  2F6B A;  4V2W A;  1N3P A;  5FYU A;  1I9R A;  1PGW 2;  3U78 A;  4CP0 A;  4K8F A;  5A32 A;  5I8Y A;  1D2Q A;  1XNC A;  3M3I A;  4GA9 A;  5EIY B;  1RHI 3;  1EV1 2;  3OF1 A;  5FO8 B;  4UF0 A;  2JE9 A;  3OSD A;  5ABJ B;  3IWZ A;  2RM2 1;  4COV A;  2EIC A;  4IEV A;  2PLV 2;  3JQX A;  4XPV A;  1OVS A;  1J3P A;  3T0A A;  3NL1 A;  3U07 A;  3I49 A;  3MF9 A;  5H9Q A;  2Y64 A;  2ZHK A; 
#chains in the Genus database with same CATH homology
 2DCK A;  2WZE A;  2VL4 A;  1RYY A;  2JDA A;  4AG4 A;  3J7H A;  4ZZ8 A;  5IYY A;  2L9L A;  2VQT A;  2W1Q A;  4XZU G;  2C26 A;  4MGQ A;  4XUP A;  2VZR A;  1OT5 A;  4QAW A;  2WZ8 A;  4A4A A;  2QQI A;  2Y6J A;  2YFZ A;  2Y6H A;  1W9T A;  2RV9 A;  3C7G A;  4UOJ A;  1EUT A;  3WNK A;  3DYM A;  3CQO A;  2QQN A;  3K77 A;  3ACG A;  4QB2 A;  2VZ1 A;  4BK4 A;  1F4A A;  3OG2 A;  3I3D A;  2YC2 A;  2WYS A;  3ACI A;  4M4P A;  3T2Q A;  1CZS A;  3HEI A;  2VJX A;  3I2I A;  1W8N A;  2ZXQ A;  4MO3 M;  1GNY A;  2CDP A;  2W91 A;  3HPN A;  3VDC A;  1SG3 A;  1TG7 A;  2WAA A;  2Y8K A;  3HNM A;  5IHR A;  3NNG A;  4DEQ A;  2QQM A;  4ZXE A;  4QDR A;  2YFU A;  2ZEZ A;  5JXH A;  4OUE A;  4ZY9 A;  3LEK A;  2J1S A;  2W47 A;  2VO5 A;  1UWW A;  5G04 L;  3UNP A;  3C7F A;  5JXI A;  4QB6 A;  5DPN A;  3T09 A;  1GUI A;  4DXT A;  1W99 A;  2W3J A;  2VZP A;  1K3I A;  4CUC A;  3GDB A;  3T0B A;  4L0P A;  4HG6 B;  1K45 A;  1UXX X;  3E1F 1;  4DUW A;  3CKH A;  2JE8 A;  2W94 A;  2VZV A;  1KEX A;  2J1V A;  2QQK A;  3FL7 A;  1JYW A;  3GGL A;  5IFT A;  3K4Z A;  2W1U A;  4PQQ A;  1JZ2 A;  3P6B A;  2YG0 A;  3AC0 A;  4XUO A;  1SHW B;  1US2 A;  4XUN A;  1PX4 A;  2BGP A;  2ORX A;  4LKS A;  3W5M A;  3UES A;  2JD9 A;  3WF2 A;  1JZ3 A;  3EYP A;  4P02 B;  2V4V A;  1O8P A;  3VD3 A;  3SKV A;  2J1T A;  3WNL A;  5B4N A;  1KGY A;  1JYX A;  4XUQ A;  2VZO A;  2OKX A;  1JU4 A;  5DQ0 A;  1OH4 A;  1JZ7 A;  1OF4 A;  2PQS A;  1CX1 A;  2BGO A;  3IDA A;  3LQC A;  1SDD B;  3OEA A;  4W4Z A;  2Y6L A;  5EJZ B;  1UYX A;  3ZM8 A;  1BHG A;  3FN9 A;  1JI6 A;  2WBK A;  4W8J A;  1JHJ A;  1WKY A;  2BER A;  3WNO A;  4QB1 A;  1UY1 A;  4BK5 A;  3HNY M;  3K4D A;  3NJV A;  2B4K A;  3IB3 A;  1JZ8 A;  3VDA A;  4KI5 M;  3I3B A;  2Y6G A;  3SEE A;  3VD9 A;  5JXG A;  4IUG A;  2QQL A;  4KWU A;  3WF1 A;  4E8C A;  2QQO A;  2WDB A;  1H6X A;  1YQ2 A;  3ECQ A;  3LPF A;  1XC6 A;  3LE0 A;  3WF0 A;  1HN1 A;  3CZJ A;  3K75 B;  1UYY A;  2DDU A;  5CYY A;  3W5N A;  1P8J A;  4TXW A;  1K12 A;  1DYO A;  1PX3 A;  2EIE A;  3PUI A;  3CDZ B;  3LPG A;  4CU7 A;  1UYZ A;  4CU8 A;  3NJX A;  1NAE A;  4QDS A;  4RYD A;  3BN6 A;  5HPO A;  4KMQ A;  2XQX A;  2HLE A;  4OZO A;  3OGV A;  4P5Y A;  4Z2A A;  5EJ1 B;  1UMH A;  4XUT A;  1XNA A;  2EID A;  2W87 A;  3MO4 A;  5IFP A;  3K46 A;  4CU9 A;  3IAQ A;  1GOH A;  4ARY A;  4JKK A;  5DN2 A;  5C71 A;  4P00 B;  1UY4 A;  3MUY 1;  2VZU A;  1OF3 A;  4P08 A;  2CDO A;  1L7R A;  1LNS A;  1W9S A;  1GU3 A;  1O59 A;  2X10 A;  4CVU A;  4OMD A;  3WEZ A;  1EUU A;  4JKL A;  2W1W A;  3C7O A;  1IQD C;  1GOG A;  5LA2 A;  4DUX A;  1UY2 A;  2WUH A;  1GOF A;  2VQU A;  1DLC A;  3C7E A;  2X05 A;  2VM9 A;  2J22 A;  2WO1 A;  4CU6 A;  3WQB A;  4BXS V;  3T08 A;  1J84 A;  4ARX A;  3A23 A;  3CZU A;  3OB8 A;  2RJ2 A;  5FUI A;  4ZZ5 A;  2W5F A;  1PMH X;  3HNB M;  2WAO A;  2VR4 A;  2J1A A;  1PMJ X;  3SEP A;  4BDV B;  2C4X A;  2ZEY A;  3VD4 A;  3PUH A;  3I3E A;  1UX7 A;  3OGS A;  4UAP A;  2W46 A;  3EB7 A;  1UY3 A;  1WCQ A;  2V5D A;  3C8X A;  4D0Q A;  2VZ3 A;  3T0D A;  2VC9 A;  1I5P A;  2WAB A;  3D3A A;  2J7M A;  5JMO A;  2X09 A;  2VCB A;  3WSO A;  3DYP A;  1W9W A;  2E26 A;  2VMF A;  3SKJ E;  1JYN A;  2ZEX A;  4CUB A;  1O8S A;  3ETP A;  4QX2 A;  4MOA A;  5F7U A;  3ACH A;  2KD7 A;  3IAP A;  3BGA A;  2W92 A;  3DYO A;  2VTF A;  2W95 A;  1JYV A;  3OEB A;  2JKX A;  4QX0 A;  1D7P M;  2Y64 A;  2VME A;  3F2Z A;  3HOB A;  3MBW A;  3III A;  2E33 A;  3MUZ 1;  3WF4 A;  5LA0 A;  1L7Q A;  1W8O A;  3GM8 A;  3WNP A;  2Y6K A;  2QQJ A;  4AAX A;  5J1X A;  2RVA A;  4XUR A;  4DEV A;  2VZT A;  2LW8 A;  3GXU A;  5G05 L;  3WNM A;  5C7G A;  1JU3 A;  3T2P A;  3OGR A;  4CUA A;  4JKM A;  1JZ5 A;  3ABZ A;  3I2G A;  4A41 A;  3OBA A;  1XNT A;  3VD7 A;  4OMC A;  4TTG A;  1ULO A;  4A45 A;  1JZ6 A;  4QX3 A;  5CZK A;  2ID4 A;  5HXM A;  3I2H A;  3HJR A;  1UZ0 A;  1W0N A;  3A22 A;  4QPW A;  1CIY A;  1DP0 A;  3I2F A;  1US3 A;  3FHA A;  5JR2 A;  5JXJ A;  3CIH A;  2V72 A;  2VOT A;  4A44 A;  1UMI A;  3T2O A;  3NRU A;  3I2K A;  3LEI A;  2VMD A;  5C70 A;  3JXS A;  1CZV A;  4A3Z A;  2C9K A;  2WN3 A;  3I97 A;  1NUK A;  2BZD A;  3LEG A;  2WN2 A;  1K42 A;  1ULP A;  1TVG A;  1GMM A;  5LCW L;  5I0D A;  3ACF A;  4YPJ A;  4OYU A;  2VZQ A;  4PT6 A;  2J1R A;  2WQ8 A;  2BBA A;  2XHN A;  1NKG A;  3A21 A;  5A1A A;  2EIB A;  3THD A;  2J1U A;  4PF1 A;  4UI9 L;  2VZS A;  2LS6 A;  2VCA A;  3UET A;  2DCJ A;  2W1S A;  4DUV A;  5JUV A;  2B9V A;  4LHS A;  4QX1 A;  1OD3 A;  3VDB A;  4DXS A;  2YC4 A;  3HN3 A;  4DXR A;  1JZ4 A;  2Z4F A;  4E8D A;  4BJ0 A;  5LA1 A;  2ORZ A;  4MAD A;  2VMC A;  5DMY A;  4LPL A;  2E31 A;  1F4H A;  3WF3 A;  2WO3 A;  3FHQ A;  2VCC A;  2XON A;  2J1E A;  3DEC A;  2HYX A;  4D8M A;  1T2X A;  1R64 A;  2WO2 A;  4JX0 A;  4LQR A;  1MPX A;  1J83 A;  2R7E B;  3P1I A;  2XOM A;  1GQP A;  3U37 A;  1NX9 A;  4JHZ A;  4MGS A;  1XPW A;  3I2J A;  4ET7 A;  2W9X A;  3WNN A;  3NQH A;  4W50 A;  4GWJ A;  3MV1 1;  5IJR A;  3VD5 A;  2QBX A;  1H6Y A;  4GWI A;  3A7Q A;  3THC A;  2ZEW A;  3MV0 1;  1UY0 A;  3CMG A;  4RN5 A;  3K4A A;  5EIY B;  5B4X A;  4XVH A;  4M4R A;  1CZT A;  4FI9 A;  1UXZ A;  2EIC A;  2YB7 A;  4GZ9 A;  4A42 A;  2E32 A;  4QDQ A;  3T0A A;  4A6O A;  3C7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...