1CZSA

Crystal structure of the c2 domain of human coagulation factor v: complex with phenylmercury
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
GCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the membrane-binding C2 domain of human coagulation factor V.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords PROTEIN (COAGULATION FACTOR V)
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1czsA00
2X05A 2PQSA 4CUCA 3LPFA 5DQ0A 3A23A 3MV01 3WNPA 3ZM8A 2VMDA 3U37A 3P6BA 4CVUA 2CDOA 3FHAA 4JHZA 4ZXEA 1PX4A 2QQIA 4OYUA 5G05L 1RYYA 5LCWL 1O8PA 4DUVA 4XUOA 3ABZA 3BGAA 2W47A 4GZ9A 5IHRA 3C7FA 1H6XA 1JZ4A 2VCAA 1W99A 4BDVB 2VC9A 3GGLA 3C7HA 3SKJE 4JX0A 3WNLA 2WO3A 4XUPA 2WAOA 5C7GA 1W0NA 1UY2A 2WO2A 1DYOA 4QB6A 2VCBA 5DPNA 4ZZ8A 3OGVA 3GXUA 3K4DA 2QQLA 2R7EB 3W5NA 4M4PA 1OF3A 2VM9A 4L0PA 2BGPA 4UAPA 5G04L 3T0AA 4CU9A 1OD3A 3I2IA 3HJRA 2RV9A 5J1XA 3WF0A 2WBKA 2YFUA 3T0DA 2YG0A 3LQCA 2DCKA 3C7OA 1K12A 4P5YA 1PX3A 1GOGA 2VZSA 3VD4A 2J1SA 3CZUA 3UETA 3MUY1 4XUTA 2VTFA 4LPLA 5IYYA 2VJXA 3VDAA 1UZ0A 2C9KA 4MGQA 3WF1A 4DXTA 1K45A 1EUUA 4CU8A 1CZSA 1UXZA 3OG2A 1UY4A 2ZEXA 1JYVA 1GU3A 5F7UA 2ZEWA 3DYMA 3SEEA 1UMHA 3I3EA 3K46A 1UYXA 4OUEA 2EIBA 1UMIA 5IJRA 1KEXA 2ZEZA 1KGYA 1TG7A 2WN3A 4JKMA 4GWIA 2WYSA 1W9SA 4KI5M 1XNTA 3PUHA 3ECQA 3NQHA 1JZ7A 2C26A 4DXRA 3IDAA 4OMDA 2W9XA 2W1QA 1JYNA 3IAPA 3MO4A 4ZZ5A 2ID4A 4JKKA 5HXMA 2Y6LA 2VZOA 1W9WA 1NUKA 3LEGA 3ETPA 1WCQA 5LA2A 2CDPA 3T0BA 4A44A 2BERA 4ZY9A 2WZ8A 1UY1A 1JHJA 5LA0A 3T2OA 2KD7A 4PQQA 1JYWA 1GNYA 3DYOA 5JUVA 3A21A 3K77A 4QDSA 2VCCA 1UWWA 3VD7A 1O8SA 2JE8A 2WN2A 5EJZB 4A41A 2W1UA 2W46A 4PT6A 1PMJX 2BBAA 4A42A 3LE0A 1F4HA 2J1AA 3F2ZA 1K42A 5JXGA 2VZQA 4TXWA 5EJ1B 1JZ5A 3LEKA 4D8MA 3NJVA 4A4AA 2YB7A 4DEQA 3D3AA 1XPWA 3GDBA 2VZ3A 1GMMA 3IAQA 2EIDA 1TVGA 4MO3M 3THDA 4BK5A 3VDCA 4OZOA 3MUZ1 3WF4A 2WUHA 3ACHA 2V72A 3HOBA 2QQKA 2XQXA 4PF1A 3OEBA 2QQJA 2Y8KA 4CU7A 4A45A 2J1EA 2VZVA 4ET7A 2QQOA 1I5PA 1CZVA 1R64A 1CX1A 4LKSA 2VZPA 3K4AA 3EYPA 3HN3A 4DUWA 2XOMA 2J1TA 3T09A 1K3IA 4QB1A 3WF2A 2E33A 5JR2A 4CUAA 2VR4A 3T2QA 3CIHA 2EIEA 2V5DA 2WO1A 2Y64A 1JZ6A 2VQTA 4TTGA 3MV11 2W95A 3HEIA 2ORXA 4W8JA 3OBAA 1H6YA 4W50A 3FN9A 4QDRA 3ACIA 5A1AA 2VZUA 1XC6A 1WKYA 4GWJA 3DECA 5C70A 3NRUA 5DMYA 4AG4A 3JXSA 3NJXA 1OH4A 2DDUA 1J83A 3HNYM 3CKHA 4UI9L 1UXXX 3CZJA 3J7HA 4E8DA 1GUIA 4QX0A 4MADA 1JZ3A 4FI9A 1SDDB 4UOJA 2EICA 4KMQA 2C4XA 4W4ZA 3C8XA 2W91A 1GQPA 1XNAA 1UYZA 3VDBA 1CIYA 2JKXA 3CDZB 1T2XA 3T08A 2QQMA 2BZDA 1L7RA 4QX1A 3WNNA 1SHWB 3UNPA 1P8JA 4XUNA 3W5MA 1F4AA 5DN2A 3PUIA 4QDQA 1JYXA 1NKGA 3CMGA 2XHNA 4ARXA 2W3JA 1LNSA 2L9LA 4Z2AA 2Z4FA 3C7GA 4BK4A 5B4XA 3IIIA 2HLEA 5JMOA 4RN5A 2VOTA 1GOFA 4DUXA 2Y6JA 3I2KA 1O59A 2VMEA 4YPJA 4CU6A 3I2HA 3WSOA 2W92A 2RJ2A 2VQUA 3BN6A 2X10A 2J1UA 2BGOA 3P1IA 4QB2A 3A22A 2VZTA 3WF3A 2WDBA 1UY0A 5HPOA 2VZ1A 1OF4A 3ACFA 2Y6GA 3NNGA 1UX7A 3EB7A 1JZ8A 2J1VA 3MBWA 1US3A 5EIYB 5JXJA 2B4KA 4CUBA 3AC0A 5JXHA 1W9TA 4LQRA 4MGSA 1ULOA 2X09A 3OGSA 1JU3A 2B9VA 5IFPA 2Y6HA 3LEIA 4P00B 3SKVA 2J7MA 2ORZA 1IQDC 2VO5A 2LS6A 3THCA 1W8OA 3FHQA 4ARYA 2VMCA 1PMHX 2YC4A 4A3ZA 3OEAA 1ULPA 3WNOA 4XVHA 3K4ZA 3I3DA 3VD5A 3T2PA 4AAXA 2JDAA 2W5FA 1BHGA 3UESA 2ZEYA 4DEVA 2YFZA 1UYYA 3K75B 4OMCA 1UY3A 1JI6A 2Y6KA 2ZXQA 3DYPA 3IB3A 3VD3A 1OT5A 1MPXA 4MOAA 4D0QA 3HPNA 5IFTA 4DXSA 4KWUA 2QBXA 5B4NA 5LA1A 4P08A 3WEZA 3E1F1 3C7EA 2XONA 3VD9A 1L7QA 4RYDA 5CYYA 5C71A 4QPWA 4M4RA 3GM8A 2WQ8A 4E8CA 2J22A 2DCJA 3I2FA 2J1RA 4QAWA 2WABA 5JXIA 3WNMA 3FL7A 2W1WA 4LHSA 3CQOA 3I2JA 4A6OA 3OB8A 4XZUG 1CZTA 2VL4A 4QX3A 1SG3A 5CZKA 3LPGA 2W87A 1D7PM 1NX9A 3OGRA 3WQBA 2W94A 4QX2A 2JD9A 1JU4A 3A7QA 1GOHA 1HN1A 1NAEA 1DP0A 1W8NA 2HYXA 1US2A 2VMFA 2LW8A 1YQ2A 3SEPA 1J84A 5I0DA 2RVAA 1JZ2A 3I2GA 2WAAA 4JKLA 2VZRA 2OKXA 3I3BA 4IUGA 3WNKA 4HG6B 4BJ0A 1EUTA 2E32A 2W1SA 4P02B 5FUIA 3ACGA 2YC2A 2WZEA 4BXSV 2QQNA 4XUQA 3HNBM 2E31A 2V4VA 2E26A 3HNMA 1DLCA 4XURA 3I97A
chains in the Genus database with same CATH superfamily
1ODMA 1QJU3 1OOPB 1NCRC 1UKRA 1BYHA 1HKDA 4MVTA 4QKBA 5GLVA 3RJ2X 3CLPA 5GZGA 2PTMA 5FLIA 1E5RA 5DQ0A 2ENRA 4O9GA 3MV01 1EV13 2QNKA 2CDOA 1RUG1 3FHAA 4B4QA 1ZBA3 3T3YA 1H30A 3ES4A 4ZXEA 3NJYA 2BBVA 1PX4A 2PHXA 4OYUA 1BBT3 5G05L 1D4M3 3QLQA 4IGQA 4DUVA 4HBNA 4UW6A 4ES9A 1RUD3 4QQ2A 4YVWB 4CDQA 3V56A 4TZDA 2XLAA 5GZCA 3I54A 4YM0A 1EPWA 2W47A 2VH9A 5FZKA 2XQRA 1WMEA 3CF6E 1SLIA 3WDTA 3WLUA 4DB5A 3NMBA 1AX0A 2P4EA 4IETA 3VBOB 5L9RA 1JZ4A 2VCAA 4YGCA 4BDVB 1PMIA 3DPRB 2WINB 3NO8A 4N53C 3C7HA 4LORA 4JHTA 2RS32 3MIBA 3OGGA 1EPZA 1C3HA 3D0SA 1DQ5A 2WWUA 3VN4A 2PHUA 1UY2A 2Z5WA 1DYOA 4COVA 5LEKA 4C1XA 5F6LB 4BISA 4Q26A 4ZZ8A 5FR3A 3OGVA 3O0VA 4Y1VA 4RS5C 4IV1A 3WT3A 4DIQA 3R05A 1W2NA 1OF3A 3QOPA 4META 2FQPA 2QDNA 4FAHA 4L0PA 4UAPA 5IVEA 1HRI2 2WNUA 2HWD1 3IT8A 3LA2A 2GMMA 3DF0A 5GZDA 5K4LA 2HBUA 4CCLA 5C3SA 4CU9A 1AR83 3H7JA 2DTYA 3AXDA 1D0HA 1XE0A 1WGPA 1Q3EA 2W2IA 3Q8BA 3HD8B 1W03A 3HJRA 3VZOA 5BNPA 4CXXA 2WBKA 4MG2A 2YFUA 2YG0A 3AJZA 2W08A 3ZYPA 1Y9GA 3PVOA 1CD3G 1OLRA 1K12A 2VAUA 3CJIB 5FBJA 3GYDA 4GJYA 4GA9A 4P5YA 1PX3A 5IK5A 2VBPA 3MGUA 1BJQA 2KR2A 2P5BA 1S4CA 5FIXA 1A34A 2P2KA 4MH0E 4CRQA 4UYBA 3ZSMA 5A6ZA 3BOPA 1RHI2 4NWWA 2VOKA 4MXWB 1O6UA 1OHFA 1BEV2 2R0HA 3HQXA 4XFCA 3TB0A 4XFGA 4PLNA 1V6IA 1OKOA 4QX5A 2Q8EA 3VBFB 1JUIA 3TN93 5ABJA 4IE5A 4HKWA 4Y20A 1B35C 2C9KA 4MGQA 1CAXA 5FUNA 5GLTA 3BIWE 4MGTA 4IDZA 4QKNA 1ZZ7A 4CU8A 1CZSA 1UXZA 2QVSB 4LA2A 5C3PA 1GP4A 1MS3A 1REEA 1TME2 3FBYA 3OG2A 4NIHA 1R1A2 1OVSA 1JYVA 2WT0A 1GU3A 5F7UA 3IDEA 4GWMA 3WOGA 1H4GA 1UAIA 1FYUA 3U75A 4K9SA 5A7NA 3UKNA 5IWFA 3VKOA 1C57A 1R083 1UMHA 4XFIA 1ZVFA 3AFGA 1LHOA 2VQAA 3K46A 3N4MA 3WV6A 3RI9A 4OHYA 1TMF2 1UMIA 1CGPA 5BUVA 4BMEA 1HV0A 5DG2A 3JUUA 4FQ4A 5A70A 2DCTA 3BALA 4LE3A 2O8QA 3KS7A 3AZWA 4EV0A 4K1YA 1W6MA 3CL1A 1GZ9A 4XIOA 4Z2WA 2VU9A 4ONUA 5IK7A 2WFPA 5JIAA 1X8EA 1NG0A 2PAMA 4DXRA 4FXKB 2R16A 2R062 1KXGA 5KC5A 1KITA 1YFWA 2W1QA 4H14A 3MO4A 3W58A 1ZZ9A 2ID4A 1LKNA 2YMZA 3S7IA 1G9DA 4FTBA 1H8VA 3UT0A 1RUJ1 2PFWA 3EQEA 3MW3A 1Q5OA 1UU6A 1G9BA 3DL3A 4HK9A 2NPIA 2UY9A 2LALA 3NV3A 4OI2A 2RHPA 2RM22 5CFCC 5LA2A 5I0RA 2TUNA 1NE4A 4CEWB 2RR12 3MIEA 1UY1A 4NUBA 2G1MA 2VOXA 2ET1A 4AEDA 1JYWA 2WLPA 4E4ZA 2X53S 4LO8A 4BQ5A 5I0UA 1O5UA 1Y9MA 3G7DA 1KJLA 1PIV3 4IV3C 4BU2A 4FAGA 2R49A 1STMA 2GP3A 2WS91 3HQRA 3LGRA 5LBEA 1TNFA 3WG4A 4XW3A 3QBQA 3K77A 4QDSA 4CP0A 3RZHA 5BNNA 1OURA 1O4YA 1VBE2 3BTXA 1WUVA 1CVNA 1CAXB 2JE8A 2WN2A 5BNOA 2ZZQA 1ULDA 5EJZB 3B7MA 5LRRA 1HRV2 1W8HA 1ZZ8A 1D2QA 1ZX5A 1XQNA 2V5YA 1D4M1 2VBDA 3ZYIB 2J1AA 1K42A 2JXAA 4E2SA 2WFF2 2C9AA 1QJX2 1AYM1 2RJKA 3LEKA 4D8MA 4JRAA 3NJVA 5FP8A 2RMU3 4DEQA 3HMYA 1VRH1 1XPWA 4F8AA 1KDKA 1RUI1 2NMNA 4IEQA 5AFEA 5IVBA 3A4UA 2EALA 4MO3M 3FWEA 2IZWA 5FMBA 4FPJA 1RUOA 2A6VA 5DAPA 2ZAHA 1JYCA 3VDCA 1JOJA 2VOWA 2WT2A 5KWRA 1GBGA 5JR7B 1R082 2IWGB 3O0XA 3RVHA 5I93A 4I30A 1D4VB 4O65A 1QQP1 1ND3C 2JKBA 2C6SA 4RD7A 1W6PB 2YBSA 1C8NA 3USUB 4LJHA 3VV1A 1Z7S1 4UXAA 5IVYA 4ASLA 1CZVA 1DLLA 4UW3A 3T1LA 1AUYA 3WQ1A 2Y0IA 3K4AA 3AM2A 4WM8C 4PF5A 4OUMA 4CPBA 2PAKA 4CCMA 4XIKA 1H4HA 4JRLA 5L7OC 4GKXA 2NM1A 3FX3A 4JGYB 4WBBA 3HWJA 5FZHA 3TYJA 1WMFA 2E33A 2RS31 3RWKX 2VVDA 2YXSA 5JR2A 2JG8C 1LECA 5FZ6A 4CUAA 4F7ZA 1OC1A 1JTZX 4OVEA 4P9XA 1J3QA 3HQUA 3O7OA 5E89A 2EIEA 2V5DA 1KD7A 2B42B 2QQVA 2VQTA 5DDJ3 4EN7B 3MV11 1GKBA 2W95A 3WG3A 4KWLA 3ZN5A 2ORXA 5IUQA 4W8JA 2ERFA 3OBAA 2HWB1 2A71A 4XHXA 1JUHA 4YVWC 4WZCA 3APBA 4W50A 3RFRA 4Z1VA 2BPA2 3P3NA 1XC6A 3D8CA 2JG9A 5J7MA 2VOVA 2A73B 2GNBA 1C8M2 4HSJA 4Y24A 1DYKA 5C70A 1COV2 4YG6A 3WHUA 2C1FA 4PLMA 3TEYA 3I49A 3S5AA 1J83A 1R091 4UI9L 1A78A 4E8DA 2AGSA 1GUIA 4QX0A 1N1VA 2JB8A 5H9RA 2ZKLA 5D8AB 4FBFA 1VBC1 1W6NB 1POQA 4YVSA 2PHWA 4QM8A 4ZXKA 3ZXAC 3LIGA 3V64A 1N3OA 1PVC3 4K20A 3AKSA 2IFRA 1VJ2A 2XUEA 1ZNPA 1XNAA 4MHUA 1UYZA 4PQ9A 4AOCA 3VDBA 1XXNA 1WLCA 1XYPA 2QJVA 2D5HA 4QQHA 3NKGA 1YHFA 2EXHA 3CDZB 1T2XA 1PVC2 3B3QE 3ETQA 4Q4Y3 2VMIA 3O14A 5CG8A 1YFUA 4P5HA 4YLZA 4PJYA 3WNNA 3UNPA 1P8JA 3ZXEA 1KS5A 1LU2A 1KS4A 3J8F3 2GALA 3N7MA 5FZGA 3BI3A 3SHRA 4JDOA 3GZTB 4G3YC 4KU7A 1JYXA 4L92A 5I0TA 2CNAA 3AZYA 4I3GA 4FQZA 1EY2A 2AACA 3AYEA 4QHZA 3O1RA 2R042 2XHNA 5FREA 1H8TA 3TAYA 4AW7A 2NLRA 3PVEA 3AMNA 5FJKA 3GJAA 2VNRA 3VLBB 2Z4FA 3C7GA 3D0JA 4I0BA 3I4IA 4GWNA 1DGRA 1AF9A 3JB8A 1B35A 1EV12 3BTZA 4HN1A 3IIIA 2A1XA 4AQTA 4RSUA 3RSJA 3VBSA 4EYUA 2GC1A 3T4VA 4DUXA 3W21A 5LZ6A 5GKAC 2VVEA 2CYFA 2ZHMA 4Q0VA 1O59A 1PIV1 2JDHA 3HT2A 3R4SA 4YM2A 4HL0A 3KCYA 5TSWA 2O0OA 5CFCA 1ODNA 3NV1A 3SITA 4AVBA 4COUA 1QJY1 5FY4A 3LB9A 1DHKB 2HWF2 3DKWA 4FOVA 1QJFA 3GZUC 4LIUA 4OHVA 3VBHB 1PM4A 1RUE3 1DG6A 4ORFA 1UY0A 2PHLA 4XFFA 3VB9A 3VBUB 1JHNA 1XOYA 4Z07A 5AFBA 4FTEA 5K9YA 2WFF1 1YQCA 2Y33A 2PAEA 1S2EA 4KG8A 5DDJ1 2Y38A 3MBWA 1JZ8A 3NVCA 1D4M2 5KR7A 2EXIA 2B4KA 1ASJ1 3KLSA 1UW8A 2BYVE 3J8F2 5A7PA 4AVSA 1AR72 4P9IA 1QGLA 4LQRA 4W6XA 2I07B 1YNAA 2F17A 4BB3A 1DFQA 1H1AA 1VBA2 1V9U1 2B39A 3RJRA 4UF0A 4YW7A 2G19A 4XOGA 1EAH3 4L99A 3I3MA 1SACA 2K0GA 1GR3A 3NSTA 1CJPA 3PU3A 1S55A 3AMHA 4COYA 1VALA 1Y9QA 4M0HA 2K2SA 5HV4A 1XNDA 4NHXA 1TNRA 4J1XA 1ND3B 2C0ZA 3ZFFA 4FVVA 4J1WA 2HBTA 1QJZA 1HJGA 1LRHA 4XETA 1Q8VA 2E7QA 1NZCA 4NMIA 5IAVA 2VMCA 1ND2C 4N53A 4ARYA 2YC4A 3ZFEA 4FO9A 3PUQA 1Q8OA 1GWLA 1SBDA 1H8TB 2PXJA 4YSFA 4QGNA 1A6CA 5GZFA 2JDAA 1QHDA 1BHGA 4IE0A 5EQUA 1QOSA 4GH4A 4XDOA 4DEVA 2JIGA 3JBG2 1UX6A 3POEA 4XAEA 2IC1A 4XDPA 1C8M3 4YVWA 3RZZA 3AP9A 2ES3A 4EN8B 4EZHA 3H3ZA 4FOYA 5A3MA 5C9AC 2JG9C 3KCXA 3MPPG 4ATEA 4ZKTB 1JI6A 4L97A 2Y6KA 1OUXA 5BYNA 4XF0A 3ZN6B 1TMF1 1UZZA 2GH2A 5L7OA 1C4RA 3ZDSA 4ZU7A 4NR1A 4YW6A 4WVWA 2V73A 3BYWA 5B4NA 3LOIA 4BQ2A 5LA1A 2HEYF 4BQ1A 2MEV1 4XXPA 3WEZA 4BQYA 4CCDA 3KV9A 4HK8A 3BB6A 4MGIE 3RG0A 4AEKA 4ZS2A 5EYYA 5FY9A 1NCRB 1EP0A 4GKYA 4RYDA 1CPNA 5CYYA 2E9QA 3U1XA 3ZFEB 5F3EA 2P3IA 5FP9A 1J3PA 4QHBA 2AR6A 1VBC3 2DCJA 3I2FA 3S0MA 4CCEA 4UWDA 4NIIA 2XVKA 1REDA 5LASA 3LA3A 2AH2A 4Y5TA 4IEWA 1YUDA 2ARXA 1DYPA 2W1WA 2JJ6A 2ZGUA 4HVQA 4IV3A 2Q0AA 2XBO2 3ON7A 4K1ZA 3TEXA 5FY7A 2VNOA 1RUC2 3HIFA 1S0CA 2VNGA 4QX3A 1F15A 1I3HA 1SG3A 2AREA 5CZKA 5ANNA 4EROA 1NXD1 4YW1A 1COV1 3UYJA 4R4XA 1GQHA 5FZFA 2YU2A 2PQQA 4PBPA 2CV6A 2DURA 3D5OA 2BEOA 3A7QA 4ZPIA 5JOYA 2IVJA 1I1EA 1WLWA 1NAEA 3OGJA 2GNTA 1W8NA 3CJIA 3V0BB 4NPRA 1VRBA 3PHMA 2FDHA 5F39A 5FXXA 4PBOA 5K7PA 4GB33 2BVBA 5FP7A 1ST8A 2AEZA 1M4WA 2LW8A 3FHIB 3KWVA 1YQ2A 2XWJB 1UF2C 5T3NA 2MNGA 5I0DA 2OVUA 1LR5A 1K5MA 2K46A 1JOBA 3THTA 1RJ8A 2OKXA 3RDIA 2CAVA 3TBDA 4HG6B 4BJ0A 4WM7A 4FTSA 1B35B 5A7QA 4LITA 3OCPA 1VBC2 2JIJA 4D3WA 1EUTA 1PZ7A 3ITQA 2AYHA 4Q0UA 4YWAA 3WDYA 4XFHA 2WWJA 4RR3C 5FUIA 3WDXA 2V09A 2YC2A 4IL7A 4D7TA 2VUDA 2QQNA 2E31A 5A7WB 3SH4A 5I8SA 2BW8A 3H7YA 1OFSA 2RS13 5FQ0A 2E26A 2IUWA 1N1SA 1XU2A 2CGOA 3FLTA 4EZ4A 4M01A 3UK9A 2EAAA 2XH6A 5EHDA 3N9LA 3CJIC 3PDQA 4LO7A 2HWC1 5L7OB 3N7LA 2WIIB 3WCSA 3I97A 1G9CA 1W0PA 3PLQA 3TRSB 2FDJA 4HONA 3LPFA 3FBMA 2VPVA 5H9QA 3AXEA 3S57A 3A23A 4N9HA 3ZM8A 1TE1B 1VBA1 3JBG3 4CVUA 5KXCA 1DZQA 3ZIWA 4Q4V1 3T1MA 1MACA 4XE9A 1RYYA 3RWNA 4G4FA 3ZPOA 5LCWL 3OD0A 5CA6A 2R043 4WM7B 4AHXA 4N43A 5LATA 3ZMOA 4B4RA 5EXOA 2VTXA 4EN0A 2AC1A 3O0WA 4QPYA 4Y1XA 2YV8A 5GLWA 1SCRA 4GZ9A 1BBT2 1N1YA 3LDKA 5IT6A 2ZX1A 1ZA4A 3KQ4B 3Q8CA 3E6BA 3GHNA 1ALYA 1UIKA 1U5IA 1SFNA 4XBNA 1LHNA 3SKJE 4JX0A 4N53B 3WNLA 5JOZA 1SLAA 1DGWA 1LHWA 5FZ4A 4AEMA 4XUPA 4YZ5A 5C7GA 3B00A 3LIHA 1RHI3 4Z82A 3LAGA 4HT1T 1Z0HA 2VCBA 2QFEA 4CCKA 1GP5A 4NVPA 3VZMA 4MGYE 1BMV1 3W5NA 4M4PA 2NP0A 1FOD1 4YG0A 4A7ZA 3HT1A 5FY8A 5DUVA 2VM9A 2D3SA 5G04L 3T0AA 3PURA 2DWRA 2ZCWA 5JVVA 3PNAA 1OBNA 1QDOA 1RUG3 2YYOA 1QMJA 1SZBA 2EXJA 5A32B 4YYOA 1H9WA 2MEV2 3WHTA 3M4FA 5KHJA 2R1BA 3I2IA 1PZ8A 5D1IA 5FZ9A 1QXPA 4YNIA 3O1VA 2QKDA 1COV3 5J1XA 4C8DA 1H9PA 3WF0A 1UOGA 1VMFA 5LA9A 1X36A 3SLIA 1HXS2 2CWSA 2QQUA 3C7OA 2OQ7A 1NQJA 2VECA 2JDKA 3DEMA 2H6BA 4CSWA 1QOTA 4L8QA 3SC7X 2J1SA 5FP3A 3SISA 2OW4A 2Q1ZB 2ZX4A 3MUY1 5T52A 1LOAA 1G6NA 2A5ZA 4BA6A 4XQ4A 5C4WB 1LOCA 1XNKA 4I01A 5IYYA 4XDQA 1Y4WA 2VJXA 3KT4A 4XBLA 1RJ7A 4Q4W3 5LW9A 4KBZA 1FV2A 3GHMA 4N43B 5FPLA 4OFGA 4AF9A 1UOJA 1GNZA 3WF1A 1CQ9A 2XR4A 1VIWB 3GBFA 1W8WA 4GULA 4LIVA 5FK7A 1RB8G 3NV2A 3THPA 2RS51 2D3RA 1JBCA 2ADDA 3FJSA 1QQP2 2ZZJA 2ZEWA 2P3KA 1TME1 4PCRA 1J59A 4Q4Y2 4RHV3 1UKGA 3TOJA 2XPJA 3Q8EA 1QKQA 3OBRA 4P9GA 3O5SA 4QHOA 2ET7A 5CFDA 1AR71 4YVSB 5D8AC 5IJRA 2ZEZA 4AHZA 1KGYA 2HWB2 1TG7A 3ENRA 3QACA 4CP2A 2EVXA 2VUAA 3T2TA 3I7DA 4E4DX 4LBMA 4GWIA 3B9IA 1W9SA 4Q1PA 3O1SA 1ENRA 5FQ0B 5CISA 2CHHA 3H3UA 4TLFA 3LKJA 2OUJA 4B7EA 1IG0A 1PK6B 3NNLA 2C26A 4CDQC 4EN9B 1PGW1 1MEC3 2W9XA 5EV7A 5E8AA 1RXFA 3O12A 2WQZC 4JKKA 4K8RB 4ZZ5A 1IOAA 5DZEA 5HXMA 2VZOA 1NUKA 4MUVA 2VXRA 3ETPA 2A6ZA 5FZOA 2JICA 4M0NA 1UU5A 5ANQA 1WCQA 2Y60A 4JGYC 4QXBA 1H1MA 4Y26A 1VPHA 5L9BA 2XVLA 4A44A 3VL9A 2BERA 2OIIA 4FPFA 3Q9OA 4WM8B 5C3QA 3T2OA 2HWE3 4PQQA 1BBT1 5E1RA 2ZTNA 3M1HA 5JUVA 3OSDA 3U11A 4BOWA 1O3QA 2ZX0A 5F5QA 2CAUA 5F2SA 3RYPA 5CFDB 5F9TA 3A21A 4BQ4A 1WW4A 4JTOA 2JDPA 1OLMA 1SQ4A 4NPLA 2CL2A 4D69A 4COZA 3EJKA 5H9PA 2TEPA 2SLIA 5CVRA 3POIA 5CIRA 1PMJX 1UL9A 1F4HA 5AVPA 4I3PA 1RUE1 2V4AA 3D4KA 4H3WA 3T30A 1DQ6A 4PHZA 1XSRA 5JXGA 1XNCA 1AXZA 1OPOA 2PHDA 3E5QA 3GZEA 1HRV1 3R0RA 4HN0A 4QPGB 1FOD2 2VMGA 1WCUA 2XKPA 4P9YA 2EA7A 5GALA 3VBSB 5I0SA 5ABJB 3D3AA 4QGMA 5FY5A 1S0JA 4R8HA 2VZ3A 1FT9A 2EIDA 1O7FA 3DN7A 1ULFA 3ILNA 3AP5A 5FZ0A 1GZCA 3JCIA 4MHRA 4YZ3A 3THDA 1CAVA 1FMD3 2ARBA 3KV6A 4RFRB 4AWDA 5I8YA 4I0AA 3OUHA 5CADA 3DCQA 3MUZ1 4H2AA 3WF4A 4KGGA 3OPTA 4PF1A 3FMGA 3HOBA 4YGEA 4ASKA 1R1ZA 4JZRA 3OEBA 3ZYJB 3AMMA 3CJXA 4M00A 5BNPB 5JSRA 1X50A 2GZWA 3PTRB 1IS6A 1QJU1 4IV3B 3F95A 3WW1A 4ET7A 4LK6A 5M0TA 1I5PA 4ZHNA 1R64A 4W6YA 1YRZA 2YPJA 3OF1A 1CX1A 2A3XA 1QJY2 4XYXA 3HN3A 4WV8A 4JV4A 5BV6A 2XOMA 2GDFA 4CYDA 2J1TA 4LBJA 4NHYA 1CESA 5FYUA 5GM0A 4NIGA 1K3IA 2D3PA 3VDDB 1LOFC 5CFCB 5A1LA 4QB1A 5EPAA 2ZKNA 3U78A 2WNOA 4LO5B 1OLME 2VR4A 5JPMB 4MYEA 3LSEA 3CIHA 4AVVA 5LB6A 3QD6A 4XZPA 3EHKA 1OA4A 4ISQA 2AUYA 2HYKA 4AGRA 4TTGA 1AX1A 3ZSKA 3U0ZA 1ONAA 1GFF2 2DVFA 1RIRA 3KD4A 5JSOA 4YZ1A 3POBA 3Q8AA 4PIYA 1H6YA 2D43A 4M3CE 5K0UB 5FZLA 4QGLA 4NIAA 5T5LA 3BCWA 4QPIC 4AFMA 5C3RA 2BDRA 2GN3A 5FWJA 3DPRA 3JXSA 3NJXA 1VB2A 3B9CA 4BM8A 3CKHA 1OFNA 1JN2P 1UXXX 2B9UA 4D6SA 5D8AA 4MADA 4YG3A 4Q8KA 2GP5A 4R9AA 5EP9A 5FYHA 1S0FA 1PO23 4QU2A 1LGNA 3IIAA 1MZ5A 4GJZA 2EICA 1J3RA 2PLV1 1ZRCA 1K5JA 5K8SA 2W91A 4LBQB 5F1RA 1RUF1 1GQPA 2BNMA 1W3VA 2WJSA 4RHV1 1S0DA 4ES8A 3ZMNA 1WW6A 4OLLA 3B93A 1JYIA 2JKXA 3JB4C 4HSLA 5JIUA 5FDBA 3TEZA 1O3RA 1OOPA 2BZDA 4A2UA 1T6GC 3I3QA 4QX1A 4Y20B 4B1LA 4YZ4A 5J48A 4XUNA 2RR11 2ZOEB 1R1A3 5KBFA 2WNVA 2ZGKA 4XJAA 3VHPA 1QNYA 3PUIA 2A6YA 2LRPA 4D94A 1ZBE1 2ZMKA 4KH9A 4CUGA 1IGOA 4JDNA 4Z2AA 4LE4A 4RFT0 1ZBA2 4NIDA 4XAAA 2HEVF 4TN7A 5A3UA 5C33A 4MXVA 3USUA 3GBGA 2ZACA 4CDXC 2ZHKA 5FZMA 5JMOA 4S2GA 3URFA 1MZ6A 1N3PA 2JDNA 4RN5A 2A70A 4AHYA 4S2HA 3OUIA 4EN6B 1VBB1 1H8TC 2F4LA 2GNDA 3ES1A 1JXNA 1W2AX 5JI7A 4YPJA 3WW2A 2JG8A 3I2HA 4CDWB 5KHKA 4E4HA 2W92A 4H7LA 4OUSA 2R072 3BUCA 3VZKA 1J1LA 2VQUA 2H0VA 2X10A 3BN6A 4JGYA 2J1UA 2PHFA 3RYRA 2J42A 1N3QA 1ZYBA 2LUWA 3UKTA 2VD7A 4NHMA 2DBIA 5CFDC 2WKKA 3NKTA 4XMIA 4RGGA 4UFKA 2HJIA 3WF3A 2WDBA 3DUIA 4IV1B 1HB2A 2WZR2 4XCAA 3NV4A 2HWF1 1AR82 5F3GA 3ACFA 2Y6GA 2TBVA 2Q1FA 3U14A 1UX7A 3EB7A 5HI0A 1AR62 1ZRFA 3EMRA 1POV0 3ZYRA 2J1VA 5JMCA 1DZTA 1MS8A 1US3A 4CEWA 4FCAA 4CUBA 3AC0A 2JD4A 4MGSA 3CNAA 3HAGA 1ULOA 1RUC3 1WA6X 1H0BA 4BLIA 5ACA2 3MW4A 2X09A 1E57A 4RL7A 2HWB3 1PGW2 4YM3A 4DFSA 1RXGA 2B9VA 5D2AA 3ASIA 2Y6HA 4C91A 3LEIA 4BYYA 4CDQB 3O1TA 4AGVA 4I02A 1OVPA 4P00B 5IW0A 3M3CA 3SMHA 1POV3 2WSUA 4CP1A 3AMQA 2YHJA 3NNFA 4DNYA 1UD1A 1W9YA 1YFXA 3OTFA 2R041 1RUI3 4CEYA 3WG1A 3RNSA 3THCA 1V6LA 1W8OA 2BV4A 1JYTA 1OXCA 2RDQA 1Q43A 4A3ZA 3WW4A 1IPJA 1DZRA 1ULPA 3GCXA 3WNOA 4YRDA 3K4ZA 1A8DA 2ZMNA 1BK1A 3T2PA 4ASMB 4D6QA 2W5FA 4Q4W2 4GH4B 1G9AA 4OHXA 1LENA 1F8VA 5HCAA 1R1A1 2YFZA 3AKPA 2HEWF 1UYYA 1W0OA 1TQ5A 2VW1A 2P3YA 3ROUA 4R52A 1YEWA 4L11A 3SXWA 4AK3A 4QPIA 3T4HB 4MGKE 2DU1A 1OKQA 1SLCA 3VKMA 3DYPA 3IB3A 2D5FA 5KC6A 3AL6A 3H3LA 1OI6A 2BJSA 4KWUA 4AI3A 1UO9A 3POJA 4PDWB 2AENA 3QH6A 4FPYA 4H7MA 2WZPP 2UYAA 2ATFA 3E1F1 4DOUA 3C7EA 5J98B 4AR2A 4LT5A 3MFAA 1YJKA 4H55A 4NE9A 1AYM3 1L7QA 2Q5TA 5B2GB 1JOPA 4CEYB 3GZAA 1FPN3 1S1AA 4RGKA 2Z69A 1WMXA 4QPWA 4CCJA 1L7LA 2B7YA 3NNJA 3W59A 4E8CA 4GMP0 1V9U2 2J22A 4EQVA 4GH4C 3J7LA 4QX7A 3WNMA 5C5TA 1HV1A 1NLSA 5C9AA 1CAWA 2AEYA 2CGPA 1FAYA 2BOJA 4LHSA 1BQPA 3H8OA 3CQOA 2XLGA 3H8XA 1MR5A 4U36A 4BPZA 4E9KA 1MS1A 1QU0A 1XBFA 3VBRA 3AZZA 1IQAA 3OB8A 4W65A 4HPKB 1HW5A 3NAPC 3E6CC 3RQ0A 3RZKA 1V9U3 1HN0A 2FD8A 1APNA 1C1FA 1YIPA 3N9OA 3OGRA 5FYSA 3V0AA 4ITCA 2JD9A 3MFCA 4COWA 3ATGA 3ILFA 1GOHA 1YLLA 5BNNB 1HN1A 1ASJ3 1UN1A 5FYCA 5T5OA 2JG8B 2XJVA 2ZPXA 2HYXA 1RUE2 1XE7A 3AYCA 1S0BA 3LDBA 4P9JA 3B5LB 4KNCA 4QWNA 5FO9B 5JDBA 2WA4A 2DVDA 3IMMA 4FPGA 2ZA9A 5F3IA 5FV3A 2D93A 3S6PA 3V65A 2YC0A 4IEZA 3ZR6A 1NOVA 1JZ2A 3I2GA 1IZ3A 1W90A 4IV1C 4JKLA 3VL8A 3WNKA 2WL1A 5LK7B 1DCSA 2G9FA 3ZFFC 2HH9A 4BXFA 1YJLA 2XKOA 4HLTA 4Q4V2 5EFUA 4XBQA 2WO7A 1OA3A 3BU0A 1KQRA 2WZEA 4BWOA 3WINE 1V00A 3N7JA 2D6MA 3ALQA 4QXHA 4X6RB 4CDWC 1KDMA 1DQ0A 5H9SA 4URAA 4XUQA 3HNBM 1F9KA 1SFYA 3SCFA 2QQWA 2V4VA 1W6OA 2YGLA 3AJYA 4CDXB 4LK7A 1LEMA 4G9SB 4ZONA 2XVGA 3HNMA 4A7KA 1CONA 1DLCA 3TN91 3RI8A 3H8UA 5FK8A 4E2GA 3BKZA 1OQDA 1RUI2 3IBMA 3AYAA 5DXDA 2D6KA 1X8MA 4FT8A 4Q8LA 5FPZA 3VKFC 3H1YA 2YUEA 2PQSA 3WVJA 3E5UA 1ZZ6A 3MIGA 4CUCA 2XJQA 4NJ4A 5E16A 2Y0OA 1SLTA 2JWPA 2QTWB 2FDFA 4XMAA 5FYYA 1NT0A 2FMYA 3U37A 4HZFA 3ACLA 3M7AA 2EIGA 2ZX3A 4IW3A 3UL2A 1DF0A 1G8WA 2QQIA 2RS53 5L36A 1O8PA 5FZAA 1ZM1A 4XUOA 3ABZA 1U0AA 5CB7A 2FCTA 4IE4A 1PHMA 3WZ1A 2WQ4A 3I2DA 4AQ2A 5IHRA 5JOXA 2ZGLA 1W06A 3PIGA 1DQ2A 1W99A 2VVFA 2VC9A 5IK8A 1VBE3 4AI9A 2ZJCA 3ZXKA 4Q4X2 2WAOA 1W0NA 1YQ8A 1U12A 3KT1A 2Z79A 5I8TA 1W6PA 4QB6A 2XUMA 3IM0A 1UOBA 4TSVA 2WS92 4O61A 3RGBA 4DMIA 4B7KA 1CJDA 3AVSA 1FPN1 5FUPA 3N36A 4NO4A 2PA7A 1PGL2 3RMYA 1AR73 3K4DA 5FZEA 5C8WA 2BTVC 1QF3A 2WA3A 1ZZBA 4P14A 3ZIXA 4NRQA 2ILMA 2BGPA 4URTA 4OHZA 1W05A 4X8PA 3CU7A 5DZGA 3DGTA 3WDUA 2QZ2A 2WC2A 5FOBB 3DXUA 1F31A 4RS5A 1UMZA 4E27A 4AI2A 4QX8A 1SFPA 2ETEA 3S7EA 3WNXA 4Q4V3 5DABA 3T0DA 4IE6A 3LQCA 5CKMA 1FXZA 1Z7S3 2E51A 1EV11 4CDUC 1RHI1 3UGFA 1SPPA 1OPMA 1FMD2 5FP4A 5JSPA 2VTXJ 5J37A 2VTFA 3MICA 2VY0A 5J09A 3SH5A 4B3NA 4NWVA 4IQPA 1OMIA 4FOQA 3TEWA 1UQXA 1PM7A 3H50A 5T55A 3TWIA 4IESA 1ASJ2 3KB5A 3VUOA 1MS4A 5T50A 1VMHA 2WWSA 1AX2A 4K3UA 1K45A 2DVGA 4OCTA 4DXTA 2XDVA 3E6DA 4Q0SA 5CG9A 2RMU1 3VZLA 1HQWA 2CWMA 1CPMA 1UY4A 3NAPA 4K6BA 3JU9A 1LAJA 1OQ1A 4Y4RA 3UV9A 5ABJC 2RS52 5FLJA 1AJOA 1IG3A 3I3EA 1UPIA 1GQGA 1UYXA 1EAH2 4OUEA 2EIBA 1UZYA 4KBBA 5JPNB 4P9WA 1C28A 3RZGA 2BUKA 2HWE2 5GLUA 4LBQA 4Q27A 3VBRB 4CA9A 3N3HA 1WD3A 3ZN6A 1L3JA 2JENA 3ECQA 3OJBA 3U07A 5T54A 5ISLA 1VBB2 3LWCA 2ZGSA 2RS11 3NQHA 5KHHA 4KL1A 1Q8SA 2VNVA 1CAUA 1AL0G 1KFXL 1A8MA 1VBD1 1YIFA 5FMDA 3IAPA 2WZR3 3H0OA 1Q56A 4BZ4A 2BU9A 4WVZA 4YW2A 3VBRC 4IE7A 1W9FA 1SEFA 4Y33A 2OQ6A 2IXJA 3AB0A 1S0IA 2BNNA 3AKTA 1HRI3 2B8MA 2BWAA 3HBKA 5CKQA 1MQTC 2UWCA 3ZYFA 4MGZE 1AL22 4ZY9A 5IVFA 1JHJA 5DDJ2 3ZSLA 1J1TA 3MI8A 4JQRA 2KD7A 4UBHA 4PDWA 4L9BA 3VHOA 2B5HA 4LKFA 4R4ZA 1PK6C 3FUOA 2I74A 2YROA 4AZZA 1ZBE3 1ENQA 1UZVA 4GAZA 4IGPA 5IVVA 2P37A 4RHV2 1CAVB 3GF6A 4KGQA 2GN7A 2Q8DA 2OX0A 1X82A 2IVIB 1O8SA 2VW2A 3VD7A 4CZSA 4A41A 2W1UA 4HVOA 1PO11 1I9RA 1LHVA 2BBAA 3PU8A 3QH7A 4KQ7A 4UT5A 4A42A 4Q2FA 4X6QB 2EF6A 4YVSC 1JMUB 1AYN3 3LZZA 3UGHA 1CIWA 2VZQA 1RUD2 4UFHA 3M3QA 3BTYA 5EJ1B 4FPCA 1YXWA 1VE0A 4QPGA 3K3NA 1VBB3 3N9NA 3TN92 2ZAAA 3U4SA 4V1PA 5FPUA 1NCQA 3NL1A 1ZBE2 4CDWA 1GMMA 1BEV3 1X33A 2X29A 3NW4A 1ND3A 3S30A 4CEYC 3WQ0A 4AFDA 3KHCA 5CU1A 4Q4X1 5F3CA 3M3EA 4WVVA 1W2UA 1W39A 1QIQA 1NLQA 2DV9A 2V72A 2XBO1 2QQKA 2XQXA 2JE7A 3ACHA 1E5SA 2QQJA 3KCCA 2Y8KA 4CU7A 4A45A 2J1EA 2XHKA 5FOJB 2Y6FA 2W39A 3PTYA 5A6YA 3G6JB 1C1LA 1ZZCA 2QQOA 4R9BA 1FV3A 5JLVA 2UURA 4V2VA 5FXWA 4DUWA 1RMU3 1AYM2 1C5IA 3N9QA 4J6GA 3T09A 4DY3A 3C2UA 2JB4A 2R6QA 3POGA 3OOXA 4S2FA 5F8PA 3WF2A 4A7YA 3VGIA 3QCWA 3FZ3A 5FRAA 4PIZA 1AR81 4YFZA 5T5JA 1IS3A 2PLV3 4D7SA 4YARA 2XJRA 3MF9A 2Y64A 1RUNA 5IATA 1CR7A 4M3CA 5BPXA 1JZ6A 1LTEA 4YM1A 5FMCA 2DFBA 5KXEA 4I2OA 3JD72 4AEJA 1C8M1 4XJWA 3SQOA 1WCDJ 1H2MA 4BHPA 3MEPA 2MPFA 4QDRA 3IDCB 2VZUA 2X5IA 3O1PA 1WKYA 3BOWA 3I59B 3EBRA 4GWJA 4NHLA 3DECA 5FTTC 3ZOIA 3BPZA 1QJEA 3NRUA 3HBZA 2CSGA 5DMYA 4FXGB 3ZXDA 2DDUA 3VBOA 3HNYM 2CGNA 3R4DB 1RUC1 3J7HA 5J3UA 2Z42A 2DVBA 3HN1A 1MQTB 2BNOA 1SBFA 2ZGQA 1SDDB 4UOJA 3LDRA 1U5ZA 2A3YA 1RVF1 3KZ4C 4KMQA 4XACA 5LRSA 2C4XA 1W6MB 1EAH1 3D6EA 4HVRA 4Z92B 3ZFGB 1LGBA 2VGDA 1G7YA 1CIYA 2XWBB 2QUOA 5DAWA 3GCWA 1TMF3 3HVDA 4BMBA 1QH7A 4Q4X3 1WCKA 4UF0B 2G4IA 4XQDA 5JI9A 1Z7S2 2DYCA 4DRVA 1L7RA 3FFQA 2WR9A 5FCCA 1SHWB 2QQPA 1M06G 4BE3A 1BVP1 2BP6A 5F5IA 5FLHA 2WNEA 2E7TA 4CDUA 3W5MA 1F4AA 1W04A 1VLNA 5DN2A 3ZFFB 4AFCA 4QDQA 3KT7A 1S2BA 4BCUA 1NKGA 2OPKA 1AR93 1YI9A 4C90A 5FYTA 1NE6A 3B94A 1RUF2 1AYN1 4PI2A 1OH3A 2O8OA 1OD5A 4HMZA 4XFAA 1LNSA 2L9LA 1GANA 1TZOA 1O5LA 5FY1A 4OQ8A 4BK4A 1PO13 3CBNA 3MW2A 2PN5A 5FKBA 1E5IA 2Y26A 4AHWA 4GQ7A 2JECA 1F35A 2OA2A 4DQAA 2HLEA 1RUH2 2P34A 2VOTA 4MXWA 4UFIA 2FHRA 3I2KA 4RQPA 2JEMA 4ATFA 1QWRA 2VMEA 5FXZA 4CU6A 3WSOA 4L2NA 2RR13 2RJ2A 1WBLA 2GC2A 1WWYA 5A33A 4RR3B 2BGOA 4LOTA 4CXWA 4JDMA 1RUJ2 1JH5A 2XJTA 4GB32 5L73A 3E5XA 2P6HA 3WP5A 1ZRDA 4Y5Z0 3KVBA 3ZXJA 5IVJA 1W8TA 3NAPB 5FAXA 3DKQA 3ILRA 1OSGA 3IDBB 1WLTA 5BXXA 1NA1A 1ULGA 4CDUB 1MEC2 3ZXFA 4FFGA 1V6JA 3ZX7A 3NNGA 3WDVA 1WW7A 3ZKUA 5EIYB 1IKPA 2IXCA 1F5FA 1VBD3 1QDCA 2PHTA 3RYKA 5JXJA 1V0AA 5BNOB 3FUQA 4AE2A 2RDNA 3IZOA 5JXHA 1W9TA 4NN0A 2XXZA 3WD5A 4NRPA 3M3IA 2WNUC 2RG4A 3I8TA 3CHXA 4KWKA 3TNQA 4B29A 1CN1A 2CY6A 5FZ3A 5IFPA 1LHUA 2OZ6A 2RS33 3ZYHA 3C3VA 2ZABA 5CBLA 1HQLA 4QPIB 3SKVA 1MEC1 4Y3OA 2KXLA 1IQDC 2P6CA 4RQPB 2QE3A 4QXCA 1JS9A 3MIHA 1NCRA 1SDWA 2O14A 3VKNA 1QH6A 1MS0A 3FHQA 4PDWC 1ZBA1 2C24A 1R093 1Q8QA 3U10A 4QXKA 1UOFA 3O1MA 2FCUA 1MS9A 5DUUA 3WY6A 4C0HA 5A6QA 3SCGA 2ADEA 4FFHA 1W2OA 3UESA 3WR0A 3PUSA 3DXTA 2F4PA 2ZEYA 3WQ7A 2XL7A 4AGGA 1KRIA 2IXHA 3K75B 3MZHA 4AI1A 2R061 2WYFA 4LLFA 3ZDVA 5KHIA 2Y34A 2XJSA 1PZ9A 1NLRA 4XABA 2UU8A 3ZFEC 3H8RA 2ZGRA 1FX5A 1BKZA 3RMXA 4CCOA 3JD73 4ARXA 1BVVA 1PNFA 1MPXA 1KJRA 4MOAA 5DZFA 4Y22B 3KHBA 1FATA 1NQDA 2DVAA 3HPNA 5J96B 2PLV2 1CAUB 1VRH3 4DXSA 4V2WA 1MZEA 2ZGMA 3ELNA 2QBXA 2SBAA 3KF3A 1W6NA 5HV0A 1O3SA 4P08A 3WP6A 4YGBA 3ME2A 1PK6A 1FI2A 1V6OA 4JCKA 2UY8A 4O7XA 1AR61 2XONA 2JX9A 2DTWA 1FMD1 3VD9A 4XJ8A 2BRTA 4BQ3A 4JGZA 4FPEA 3VZJA 4QU1A 5HCBA 1F5JA 4BLJA 4FP2A 3FLPA 2H6CA 4LHNA 2X5IC 3N7KA 1BK0A 5C71A 2JG9B 1RVF3 4LA3A 1X9PA 2WQ8A 2UYBA 1W6QA 4BQWA 2IXIA 4QKDA 3VBSC 1SLLA 5JAXA 2FDIA 4AYUA 5JXIA 4QQLA 3M8LA 3DV8A 3KF5A 3LCPA 3MPBA 5A3PA 3OD4A 4LBOA 4UBGA 3W20A 3X29B 3I2JA 1WD4A 1ND2B 4MZUA 4JC1A 4NHKA 5E6HA 4A6OA 4BIOA 4BQXA 3AYDA 4C0BA 3OUJA 2DBNA 4XZUG 3PUAA 2OT7A 4LLOA 4YW5A 4QMAA 3ZXLA 2VL4A 3EXUA 2JDMA 1Y7BA 5FYIA 3GNEA 3LF7A 5FKCA 4MLOA 2W87A 3POFA 4RS5B 4GXLA 5LEJA 1ZA7A 5A7WA 1FOD3 5FJHA 1A3KA 1NX9A 1Y3TA 5A80A 3WQBA 5AC92 1FPN2 1ZRRA 1NXMA 3H9AA 1JU4A 4ISRA 2WRAA 1BXHA 1NCQB 3WG2A 2RDSA 4AI0A 2GNMA 3DPRC 1ACCA 1US2A 2OPWA 3M2MA 1OA2A 2XL9A 1S0EA 2MHFA 2P1BA 2VMFA 5A7OA 3RRDA 5FBZA 5BNNC 1MVQA 3SEPA 3B69A 1J84A 1AXKA 2WAAA 1CX4A 1QJU2 1GWKA 1HB3A 1F2NA 2AZ5A 1DIWA 4LBQD 3HR9A 4IUGA 1DU3D 1DDLA 4GMP3 1AL23 2NN8A 1ENXA 1VBD2 2E32A 2W1SA 4D6RA 1VMJA 4P02B 2D6PA 2Q4SA 5DUWA 3ZVXA 5FZCA 1ND2A 1RVF2 2RS12 3ACGA 3J7NA 4C1WA 5CAZA 5FZIA 3AP7A 4ZS3A 1K5MC 2YBPA 4AXOA 3GJBA 4Y1ZA 2JDZA 4S2DA 1Y43B 1OOPC 3MDPA 2ZHLA 2KM2A 1W6QB 5AVAA 2PMWB 1NYWA 2XJUA 5IVCA 2IXLA 3BVCA 4XQWA 3PVBB 2I45A 4N8MA 4WZFA 5EZWA 2GU9A 2R073 2ZBJA 3IKWA 2WS93 4Q1RA 3KMHA 2X05A 2XGXA 1H2KA 1MZFA 2P3JA 4UFJA 4OQ9A 3USSA 4A6SA 4EE2A 1W28A 2VG9A 2E6VA 1VP6A 3B02A 3SCHA 4ZU5A 4Q4W1 1O4TA 1RUH3 1R081 3WNPA 1GZWA 2D7FA 4CP9A 5GJ6A 1QEXA 2VMDA 3P6BA 5HCHA 4JHZA 1W6OB 5JZGA 4OHWA 4RQPC 3LOBA 5C6CA 1OLQA 3FLRA 4Y5SA 2E63A 5FPVA 2XMLA 1BEV1 4LKDA 5K0UC 1AR92 2H0BA 1RINA 2F6BA 4WVMA 5FYZA 1MVEA 3BGAA 4XJ9A 1XSQA 4UW4A 3GALA 4XPVA 3O1UA 4UW5A 2HWD3 1DQ4A 3FC0A 2WLQA 3C7FA 1H6XA 3D82A 4HOOA 3KV5A 1GP6A 3GGLA 1AL21 3S5QA 1C5HA 2WO3A 4XF3A 4GB31 4IERA 4K8FA 2GSYA 2Z2SB 2OS2A 3UJOA 3VDDC 1AVBA 1HIXA 1CWPA 2A3WA 4HANA 2WO2A 1MS5A 3IWZA 1ULCA 5DPNA 2DUQA 4HKLA 2ZGOA 5A3LA 2VXJA 3GXUA 2BQPA 4XF4A 3ZO0B 2QQLA 2R7EB 4KG0A 5FMOS 3GBWA 5A3NA 3PVNA 3NJZA 5FWEA 5BNPC 3BPSA 4RGAA 2Q8CA 4F3JA 2FMDA 4IXLA 3W9AA 4E2QA 2E53A 1FNZA 1I5ZA 1OD3A 1QXRA 2D98A 1KFUL 1RUD1 3POSA 4QKFA 1IPKA 2RM21 4QM9A 2LM3A 3A0KA 3VBFA 4CPBD 2LTNA 1O91A 2RV9A 3WCRA 2O1QA 3JQWA 4AFAA 3RPQA 3ZLIA 4EWAA 2OZJA 2OYZA 2DCKA 2R1DA 1Z78A 2DFCA 5FXVA 3VBUC 5FPAA 2PELA 2WZR1 3WP3A 5DAQA 3ZYBA 1LB2A 1GOGA 3ZXGA 2BGCA 2VZSA 3KV4A 3VD4A 4GMP1 5FPBA 2VE1A 3CZUA 4WM7C 3E97A 3UETA 4CE8A 4XUTA 1UIJA 5LBBA 2VW0A 3H42B 4Y4YA 4LPLA 5IK4A 2R071 2W68A 2FZ2A 2I2SA 2DUOA 5GZEA 2DU0A 3VDAA 1UZ0A 5KXBA 5A3WA 2IXKA 1WLDA 4N90A 1PO22 4SLIA 4AVAA 4TLGA 4UFMA 1VAKA 5A3OA 1EUUA 3KSCA 1B09A 1HQNA 3PMSA 4D7YA 2ZEXA 3K51A 4OI4A 1UNBA 2D6LX 2FDKA 3DYMA 1LJ7A 3SEEA 4JGZC 1OUSA 3POYA 4NAOA 2OUHA 3WP4A 2KA3A 1BMV2 3I2OA 1ULEA 1PIV2 1W8UA 3P3PA 1KEXA 3Q8FA 2WNVB 2WN3A 3AK0A 4GIQA 4JKMA 3KGLA 4NPMA 1QNWA 3PIJA 1NY72 4LR4A 5DG1A 4XF1A 2XB6C 2WYSA 3OY8A 2W52A 4KI5M 3ZR5A 1IS5A 1XNTA 3PUHA 5FYVA 1GICA 2N7GA 4EJRA 2GC3A 2QCSB 4FPKA 2FBEA 4LO6B 1IHMA 1JZ7A 4FOWA 1AYN2 4DS0A 4LHLA 3IDAA 4FPOB 4OMDA 1JYNA 1LU1A 1QJY3 2ZGPA 1N1TA 2Q8OA 2Y6LA 1YO8A 3OPZA 1W9WA 4AQSA 5KHGA 1VBE1 3R4UA 5F2WA 2HWF3 3LEGA 3R6SA 4Y1YA 5FO8B 5CNAA 1RGSA 3WUCA 1W2TA 4LXLA 2XLFA 2CDPA 1E5HA 4XXAA 5LK5A 3T0BA 4CTEA 3WUDA 1PVXA 3UGGA 2WZ8A 4IGOA 5LA0A 2ZGTA 1DGLA 1GNYA 1W8FA 4JAAA 4XJZA 1FNYA 1QOOA 3DYOA 1LOBA 4LUMA 3VKLA 5LBFA 2ZGNA 4DRRA 1XYOA 5FYBA 5CEHA 2Q30A 2VCCA 4LMFA 3VHRA 4RA0A 4XTMA 1BLZA 1UWWA 1V6MA 2IFWA 2W46A 2W0XA 1QJX1 4PT6A 3MF6A 2HWD2 1V70A 3LE0A 3MLKA 4Q0PA 4DO0A 4MV2A 4Q4Y1 1RC6A 3F2ZA 3N9PA 5T5PA 1SMVA 4TXWA 3ZN4A 1JZ5A 3JBG1 3P5BA 4LULA 1JW6A 2FCVA 4LEJA 4A4AA 2YB7A 3O1OA 2GAUA 3GDBA 2DCYA 5A7SA 1H1IA 4JQTA 2VCMA 3IAQA 1TVGA 1HXS1 5SV5A 4CXYA 4PIXA 2LROA 1U5XA 5FO7B 5ACA3 5JCTA 3M70A 5DUXA 4BK5A 1K5MB 3JD71 1GWMA 4KU8A 4OZOA 2WUHA 4HPKA 3VBFC 5JWPA 3RZJA 4CCCA 5EYXA 5FZ7A 1G86A 4K21A 1IKQA 2VZVA 4MX3A 2ARAA 5HXVA 3H1WA 5EJ3A 3CEWA 1AR91 1XYNA 3V0BA 5ERLA 3RZLA 4OZXA 4K7JA 4LKSA 2VZPA 1WA4A 3EYPA 2VUCA 3WX5A 1D0GA 2YDEA 5FZ8A 4N7UA 3V0AB 5A33B 1EYBA 4QPGC 1HB1A 2JDYA 1VR3A 2EXKA 4IEYA 4YW4A 5F5AA 4BH9A 5C8CB 1NCQC 3T2QA 4XF9A 3SH3A 4XILA 2BFUL 2WO1A 5JZGB 3ORJA 3HEIA 2RDRA 2RJLA 3AVRA 1VAVA 3K2OA 2JE9A 3FN9A 1GZWB 1UYPA 3ACIA 4CP9B 3ZFGA 1LCLA 2NZ9A 1SBEA 5A1AA 3AX4A 3POWA 2YPDA 3I59A 4Y22A 2ZX2A 3WW3A 4AG4A 5KXDA 5A6XA 1OH4A 1QQP3 5JZGC 3AZVA 4LO4B 1V6NA 3CZJA 4WVMB 4TWTA 4YW3A 1I6XA 2HKXA 3JZVA 1GV9A 2DUPA 1UU4A 3ZSJA 4FI9A 1HLCA 5C8CC 1JZ3A 5AC93 1MQTA 1VB4A 1GYKA 4FFFA 1IPSA 5E88A 3VBOC 1OQEA 3J26N 4W4ZA 1GZTA 3C8XA 4YGDA 4A3XA 4W6WA 1DBNA 5LY2A 1Q8PA 2X5IB 5FZBA 1H2LA 1XNBA 2YBKA 3INAA 5IAXA 1G9FA 2FDGA 4R9CA 1BCXA 4OULA 3VBHC 1URXA 3T08A 5C4WA 2QQMA 2YGMA 2E7AA 4N7IA 4AVTA 1XU1A 2Q1MA 4R9DA 5LY1A 3AP4A 2UWAA 2A6WA 5FZOB 2A75A 5BNQA 5FZDA 2R0FA 5K0UA 5LWBA 1GNHA 4IEVA 4Q0QA 4DY5A 3OYWA 1BZWA 1HRV3 3CMGA 5GLZA 1LODA 4LKEA 4F83A 4FSJA 2W3JA 3K3OA 4U2AA 5APAA 2MEV3 4X8NA 3LFMA 1RUG2 3OPWA 4MSVA 5C3OA 3VDDA 2GMPA 4I0WB 2BWCA 4AQ6A 4QT6A 1RITA 3VZNA 3OBZA 5B4XA 3UKVA 1AHSA 1GOFA 2Y6JA 2OXBA 4IEUA 4M3CF 1QXJA 3PMEA 1LULA 3KQRA 4Q29A 3BIEA 4N43C 1NY71 3J8F1 1LOGA 2B45X 1U5YA 1GSLA 2HWE1 1SCSA 2RM23 1POV1 4XC9A 5FFOC 3LEMA 5A32A 2R30A 3AP6A 3MYXA 5C4WC 3LFIA 5AC91 3P1IA 1GLHA 2G9GA 4QB2A 3L2YA 1YC61 2D6OX 3A22A 1LESA 2JDUA 2VZTA 2WT1A 3PL0A 4FPLA 5FYMA 3KM5A 3AMPA 4HETA 4XFBA 3IN9A 5HPOA 2VQ0A 1RMU1 2VZ1A 3LD8A 1YQ6A 1OF4A 3AKQA 4AVCA 2WNUB 1RL3A 2BOIA 3IMNA 1AJKA 1DGRN 1LOFA 3OYWB 4ZU4A 5HBAA 2C5DA 5BNOC 2A7AA 1UPSA 3WXPA 1NA1C 2BVVA 4AEDB 1HB4A 3J9SA 3A0NA 4KWJA 4TYSA 4B1MA 1JODA 3OGSA 2VUJA 1JU3A 4LOSA 5FPXA 2YZ4A 4YFWA 1CAWB 2NYYA 4YZ2A 4NAMA 1XE8A 3LA7A 3PJYA 2RE9A 3IPVA 2GMEA 3BODA 4XTPA 2FZ1A 4NRMA 2RMU2 5LBCA 2J7MA 2ORZA 2VO5A 1WMDA 2BFUS 1O4ZA 4HKOA 1SLBA 2LS6A 2WFF3 2ZHNA 1DGWX 4JTNA 4IEXA 5DAXA 2G9ZA 3ZYGA 3UJQA 1TME3 2NQYA 3K48A 1PGL1 3AFKA 1YI7A 1PMHX 1W8ZA 1NZIA 1WW5A 2XJPA 2WNVC 3OEAA 4LBNA 4XVHA 5SV8A 3RS6A 5C5UA 5I91A 5JOWA 1WCSA 3I3DA 3VD5A 4IEOA 1RUH1 4AAXA 1AXYA 3AKRA 4LNVA 5F5CA 4Y1UA 1YCIA 2DF7A 4JGZB 1YQ5A 4IEPA 2B46X 4GD4A 1XRUA 5C9AB 4M3CB 5F37A 1LEDA 1LGCA 3BTAA 4OMCA 1LOEA 1PGSA 1UY3A 3FFZA 1RTVA 2XBO3 5ACA1 3NNMA 4WM8A 1X7NA 3VHNA 2ZXQA 2EAKA 4K40A 3VD3A 4E4SA 4EWEA 1OT5A 4N9IA 2QDRA 2NMOA 3N9MA 5HCFA 3MLLA 4B4PA 4D0QA 1QY4A 3OBTA 3TNPB 5IFTA 4LBKA 4NOTA 3MHZA 2CTVA 2X8KA 1N47A 3MLJA 5C8CA 3IPVB 5BY5A 2ZMLA 3BU7A 4JVAA 3ST7A 1HRI1 2VULA 5FZ1A 3U4XA 4FPHA 4LHKA 3OY8B 4AAPA 4DZGA 1RUF3 1UCXA 2R063 3J4UH 2PHRA 3ZFGC 3ZPYA 1SPPB 5J36A 5EWSA 4M4RA 1R092 1X9TA 3GM8A 4EWDA 1PNGA 4CDXA 4QD2A 3VBHA 1PO21 4INDA 1ENSA 2D40A 2K9ZA 4LUKA 2YY1A 4XJUA 1XB9A 3H1MA 4OI1A 1HX6A 2J1RA 2WABA 4QAWA 2D6NA 4CCNA 3FL7A 3KVAA 4SBVA 3ZKYA 1XJAA 2ZS6B 4FP3A 3L2HA 1S2KA 1PVC1 3AL5A 1O3TA 1H2NA 1CZTA 4NROA 5A3TA 2UWBA 4BIFA 2ARCA 4P9LA 3LPGA 2GC0A 5FY0A 4PI0A 4LTAA 3AZXA 1VAMA 3SNMA 1WZXA 1D7PM 1QJX3 2PYTA 5F6KA 4AI8A 2W94A 4QX2A 4HXCA 4AFBA 1ZREA 1J58A 1WBFA 4XEZA 5L9VA 2R32A 2VMHA 2YU1A 4CEWC 1DP0A 1NA1B 4AEDC 5A1FA 3PJQA 1DQ1A 1S0GA 3NWKA 2P17A 4Q5OA 2A6XA 4O9EA 1TEIA 1YWKA 1D2SA 2DCZA 3J7MA 1RUJ3 5L19A 2D97A 4B8EA 4DXZA 1HJFA 4RR3A 5D21A 3EO6A 2VBBA 1YFYA 2RVAA 3L9JT 5DAVA 2CU5A 1VBA3 4OI0A 3JQXA 1T6BX 3KGZA 1YYNA 2VZRA 3LSDA 4XHBA 5FMOL 1V6KA 2D44A 3I3BA 1AZDA 1HXS3 1REFA 1W3XA 4DINB 3VBUA 3FE5A 4XCBA 1HDKA 2HWC3 3B01A 2TNFA 1AR63 1IS4A 1PO12 3M3OA 4Z8BA 1RMU2 2WSVA 3ZSEA 4BXSV 3MIDA 3WDWA 4QQPA 4AL9A 4DPNA 4HFSA 1ZRIA 3MIFA 3CO2A 4J25A 2HWC2 2XG3A 4I09A 4QQOA 4PLOA 2GH8A 5CKNA 5F32A 1UZWA 3RZMA 1VRH2 3N35A 4GALA 4LBLA 4UFLA 4XURA 2QZ3A 4FFIA
chains in the Genus database with same CATH topology
2X05A 2PQSA 4CUCA 3LPFA 5DQ0A 3A23A 3MV01 3WNPA 3ZM8A 2VMDA 3U37A 3P6BA 4CVUA 2CDOA 3FHAA 4JHZA 4ZXEA 1PX4A 2QQIA 4OYUA 5G05L 1RYYA 5LCWL 1O8PA 4DUVA 4XUOA 3ABZA 3BGAA 2W47A 4GZ9A 5IHRA 3C7FA 1H6XA 1JZ4A 2VCAA 1W99A 4BDVB 2VC9A 3GGLA 3C7HA 3SKJE 4JX0A 3WNLA 2WO3A 4XUPA 2WAOA 5C7GA 1W0NA 1UY2A 2WO2A 1DYOA 4QB6A 2VCBA 5DPNA 4ZZ8A 3OGVA 3GXUA 3K4DA 2QQLA 2R7EB 3W5NA 4M4PA 1OF3A 2VM9A 4L0PA 2BGPA 4UAPA 5G04L 3T0AA 4CU9A 1OD3A 3I2IA 3HJRA 2RV9A 5J1XA 3WF0A 2WBKA 2YFUA 3T0DA 2YG0A 3LQCA 2DCKA 3C7OA 1K12A 4P5YA 1PX3A 1GOGA 2VZSA 3VD4A 2J1SA 3CZUA 3UETA 3MUY1 4XUTA 2VTFA 4LPLA 5IYYA 2VJXA 3VDAA 1UZ0A 2C9KA 4MGQA 3WF1A 4DXTA 1K45A 1EUUA 4CU8A 1CZSA 1UXZA 3OG2A 1UY4A 2ZEXA 1JYVA 1GU3A 5F7UA 2ZEWA 3DYMA 3SEEA 1UMHA 3I3EA 3K46A 1UYXA 4OUEA 2EIBA 1UMIA 5IJRA 1KEXA 2ZEZA 1KGYA 1TG7A 2WN3A 4JKMA 4GWIA 2WYSA 1W9SA 4KI5M 1XNTA 3PUHA 3ECQA 3NQHA 1JZ7A 2C26A 4DXRA 3IDAA 4OMDA 2W9XA 2W1QA 1JYNA 3IAPA 3MO4A 4ZZ5A 2ID4A 4JKKA 5HXMA 2Y6LA 2VZOA 1W9WA 1NUKA 3LEGA 3ETPA 1WCQA 5LA2A 2CDPA 3T0BA 4A44A 2BERA 4ZY9A 2WZ8A 1UY1A 1JHJA 5LA0A 3T2OA 2KD7A 4PQQA 1JYWA 1GNYA 3DYOA 5JUVA 3A21A 3K77A 4QDSA 2VCCA 1UWWA 3VD7A 1O8SA 2JE8A 2WN2A 5EJZB 4A41A 2W1UA 2W46A 4PT6A 1PMJX 2BBAA 4A42A 3LE0A 1F4HA 2J1AA 3F2ZA 1K42A 5JXGA 2VZQA 4TXWA 5EJ1B 1JZ5A 3LEKA 4D8MA 3NJVA 4A4AA 2YB7A 4DEQA 3D3AA 1XPWA 3GDBA 2VZ3A 1GMMA 3IAQA 2EIDA 1TVGA 4MO3M 3THDA 4BK5A 3VDCA 4OZOA 3MUZ1 3WF4A 2WUHA 3ACHA 2V72A 3HOBA 2QQKA 2XQXA 4PF1A 3OEBA 2QQJA 2Y8KA 4CU7A 4A45A 2J1EA 2VZVA 4ET7A 2QQOA 1I5PA 1CZVA 1R64A 1CX1A 4LKSA 2VZPA 3K4AA 3EYPA 3HN3A 4DUWA 2XOMA 2J1TA 3T09A 1K3IA 4QB1A 3WF2A 2E33A 5JR2A 4CUAA 2VR4A 3T2QA 3CIHA 2EIEA 2V5DA 2WO1A 2Y64A 1JZ6A 2VQTA 4TTGA 3MV11 2W95A 3HEIA 2ORXA 4W8JA 3OBAA 1H6YA 4W50A 3FN9A 4QDRA 3ACIA 5A1AA 2VZUA 1XC6A 1WKYA 4GWJA 3DECA 5C70A 3NRUA 5DMYA 4AG4A 3JXSA 3NJXA 1OH4A 2DDUA 1J83A 3HNYM 3CKHA 4UI9L 1UXXX 3CZJA 3J7HA 4E8DA 1GUIA 4QX0A 4MADA 1JZ3A 4FI9A 1SDDB 4UOJA 2EICA 4KMQA 2C4XA 4W4ZA 3C8XA 2W91A 1GQPA 1XNAA 1UYZA 3VDBA 1CIYA 2JKXA 3CDZB 1T2XA 3T08A 2QQMA 2BZDA 1L7RA 4QX1A 3WNNA 1SHWB 3UNPA 1P8JA 4XUNA 3W5MA 1F4AA 5DN2A 3PUIA 4QDQA 1JYXA 1NKGA 3CMGA 2XHNA 4ARXA 2W3JA 1LNSA 2L9LA 4Z2AA 2Z4FA 3C7GA 4BK4A 5B4XA 3IIIA 2HLEA 5JMOA 4RN5A 2VOTA 1GOFA 4DUXA 2Y6JA 3I2KA 1O59A 2VMEA 4YPJA 4CU6A 3I2HA 3WSOA 2W92A 2RJ2A 2VQUA 3BN6A 2X10A 2J1UA 2BGOA 3P1IA 4QB2A 3A22A 2VZTA 3WF3A 2WDBA 1UY0A 5HPOA 2VZ1A 1OF4A 3ACFA 2Y6GA 3NNGA 1UX7A 3EB7A 1JZ8A 2J1VA 3MBWA 1US3A 5EIYB 5JXJA 2B4KA 4CUBA 3AC0A 5JXHA 1W9TA 4LQRA 4MGSA 1ULOA 2X09A 3OGSA 1JU3A 2B9VA 5IFPA 2Y6HA 3LEIA 4P00B 3SKVA 2J7MA 2ORZA 1IQDC 2VO5A 2LS6A 3THCA 1W8OA 3FHQA 4ARYA 2VMCA 1PMHX 2YC4A 4A3ZA 3OEAA 1ULPA 3WNOA 4XVHA 3K4ZA 3I3DA 3VD5A 3T2PA 4AAXA 2JDAA 2W5FA 1BHGA 3UESA 2ZEYA 4DEVA 2YFZA 1UYYA 3K75B 4OMCA 1UY3A 1JI6A 2Y6KA 2ZXQA 3DYPA 3IB3A 3VD3A 1OT5A 1MPXA 4MOAA 4D0QA 3HPNA 5IFTA 4DXSA 4KWUA 2QBXA 5B4NA 5LA1A 4P08A 3WEZA 3E1F1 3C7EA 2XONA 3VD9A 1L7QA 4RYDA 5CYYA 5C71A 4QPWA 4M4RA 3GM8A 2WQ8A 4E8CA 2J22A 2DCJA 3I2FA 2J1RA 4QAWA 2WABA 5JXIA 3WNMA 3FL7A 2W1WA 4LHSA 3CQOA 3I2JA 4A6OA 3OB8A 4XZUG 1CZTA 2VL4A 4QX3A 1SG3A 5CZKA 3LPGA 2W87A 1D7PM 1NX9A 3OGRA 3WQBA 2W94A 4QX2A 2JD9A 1JU4A 3A7QA 1GOHA 1HN1A 1NAEA 1DP0A 1W8NA 2HYXA 1US2A 2VMFA 2LW8A 1YQ2A 3SEPA 1J84A 5I0DA 2RVAA 1JZ2A 3I2GA 2WAAA 4JKLA 2VZRA 2OKXA 3I3BA 4IUGA 3WNKA 4HG6B 4BJ0A 1EUTA 2E32A 2W1SA 4P02B 5FUIA 3ACGA 2YC2A 2WZEA 4BXSV 2QQNA 4XUQA 3HNBM 2E31A 2V4VA 2E26A 3HNMA 1DLCA 4XURA 3I97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X05 A;  2PQS A;  4CUC A;  3LPF A;  5DQ0 A;  3A23 A;  3MV0 1;  3WNP A;  3ZM8 A;  2VMD A;  3U37 A;  3P6B A;  4CVU A;  2CDO A;  3FHA A;  4JHZ A;  4ZXE A;  1PX4 A;  2QQI A;  4OYU A;  5G05 L;  1RYY A;  5LCW L;  1O8P A;  4DUV A;  4XUO A;  3ABZ A;  3BGA A;  2W47 A;  4GZ9 A;  5IHR A;  3C7F A;  1H6X A;  1JZ4 A;  2VCA A;  1W99 A;  4BDV B;  2VC9 A;  3GGL A;  3C7H A;  3SKJ E;  4JX0 A;  3WNL A;  2WO3 A;  4XUP A;  2WAO A;  5C7G A;  1W0N A;  1UY2 A;  2WO2 A;  1DYO A;  4QB6 A;  2VCB A;  5DPN A;  4ZZ8 A;  3OGV A;  3GXU A;  3K4D A;  2QQL A;  2R7E B;  3W5N A;  4M4P A;  1OF3 A;  2VM9 A;  4L0P A;  2BGP A;  4UAP A;  5G04 L;  3T0A A;  4CU9 A;  1OD3 A;  3I2I A;  3HJR A;  2RV9 A;  5J1X A;  3WF0 A;  2WBK A;  2YFU A;  3T0D A;  2YG0 A;  3LQC A;  2DCK A;  3C7O A;  1K12 A;  4P5Y A;  1PX3 A;  1GOG A;  2VZS A;  3VD4 A;  2J1S A;  3CZU A;  3UET A;  3MUY 1;  4XUT A;  2VTF A;  4LPL A;  5IYY A;  2VJX A;  3VDA A;  1UZ0 A;  2C9K A;  4MGQ A;  3WF1 A;  4DXT A;  1K45 A;  1EUU A;  4CU8 A;  1CZS A;  1UXZ A;  3OG2 A;  1UY4 A;  2ZEX A;  1JYV A;  1GU3 A;  5F7U A;  2ZEW A;  3DYM A;  3SEE A;  1UMH A;  3I3E A;  3K46 A;  1UYX A;  4OUE A;  2EIB A;  1UMI A;  5IJR A;  1KEX A;  2ZEZ A;  1KGY A;  1TG7 A;  2WN3 A;  4JKM A;  4GWI A;  2WYS A;  1W9S A;  4KI5 M;  1XNT A;  3PUH A;  3ECQ A;  3NQH A;  1JZ7 A;  2C26 A;  4DXR A;  3IDA A;  4OMD A;  2W9X A;  2W1Q A;  1JYN A;  3IAP A;  3MO4 A;  4ZZ5 A;  2ID4 A;  4JKK A;  5HXM A;  2Y6L A;  2VZO A;  1W9W A;  1NUK A;  3LEG A;  3ETP A;  1WCQ A;  5LA2 A;  2CDP A;  3T0B A;  4A44 A;  2BER A;  4ZY9 A;  2WZ8 A;  1UY1 A;  1JHJ A;  5LA0 A;  3T2O A;  2KD7 A;  4PQQ A;  1JYW A;  1GNY A;  3DYO A;  5JUV A;  3A21 A;  3K77 A;  4QDS A;  2VCC A;  1UWW A;  3VD7 A;  1O8S A;  2JE8 A;  2WN2 A;  5EJZ B;  4A41 A;  2W1U A;  2W46 A;  4PT6 A;  1PMJ X;  2BBA A;  4A42 A;  3LE0 A;  1F4H A;  2J1A A;  3F2Z A;  1K42 A;  5JXG A;  2VZQ A;  4TXW A;  5EJ1 B;  1JZ5 A;  3LEK A;  4D8M A;  3NJV A;  4A4A A;  2YB7 A;  4DEQ A;  3D3A A;  1XPW A;  3GDB A;  2VZ3 A;  1GMM A;  3IAQ A;  2EID A;  1TVG A;  4MO3 M;  3THD A;  4BK5 A;  3VDC A;  4OZO A;  3MUZ 1;  3WF4 A;  2WUH A;  3ACH A;  2V72 A;  3HOB A;  2QQK A;  2XQX A;  4PF1 A;  3OEB A;  2QQJ A;  2Y8K A;  4CU7 A;  4A45 A;  2J1E A;  2VZV A;  4ET7 A;  2QQO A;  1I5P A;  1CZV A;  1R64 A;  1CX1 A;  4LKS A;  2VZP A;  3K4A A;  3EYP A;  3HN3 A;  4DUW A;  2XOM A;  2J1T A;  3T09 A;  1K3I A;  4QB1 A;  3WF2 A;  2E33 A;  5JR2 A;  4CUA A;  2VR4 A;  3T2Q A;  3CIH A;  2EIE A;  2V5D A;  2WO1 A;  2Y64 A;  1JZ6 A;  2VQT A;  4TTG A;  3MV1 1;  2W95 A;  3HEI A;  2ORX A;  4W8J A;  3OBA A;  1H6Y A;  4W50 A;  3FN9 A;  4QDR A;  3ACI A;  5A1A A;  2VZU A;  1XC6 A;  1WKY A;  4GWJ A;  3DEC A;  5C70 A;  3NRU A;  5DMY A;  4AG4 A;  3JXS A;  3NJX A;  1OH4 A;  2DDU A;  1J83 A;  3HNY M;  3CKH A;  4UI9 L;  1UXX X;  3CZJ A;  3J7H A;  4E8D A;  1GUI A;  4QX0 A;  4MAD A;  1JZ3 A;  4FI9 A;  1SDD B;  4UOJ A;  2EIC A;  4KMQ A;  2C4X A;  4W4Z A;  3C8X A;  2W91 A;  1GQP A;  1XNA A;  1UYZ A;  3VDB A;  1CIY A;  2JKX A;  3CDZ B;  1T2X A;  3T08 A;  2QQM A;  2BZD A;  1L7R A;  4QX1 A;  3WNN A;  1SHW B;  3UNP A;  1P8J A;  4XUN A;  3W5M A;  1F4A A;  5DN2 A;  3PUI A;  4QDQ A;  1JYX A;  1NKG A;  3CMG A;  2XHN A;  4ARX A;  2W3J A;  1LNS A;  2L9L A;  4Z2A A;  2Z4F A;  3C7G A;  4BK4 A;  5B4X A;  3III A;  2HLE A;  5JMO A;  4RN5 A;  2VOT A;  1GOF A;  4DUX A;  2Y6J A;  3I2K A;  1O59 A;  2VME A;  4YPJ A;  4CU6 A;  3I2H A;  3WSO A;  2W92 A;  2RJ2 A;  2VQU A;  3BN6 A;  2X10 A;  2J1U A;  2BGO A;  3P1I A;  4QB2 A;  3A22 A;  2VZT A;  3WF3 A;  2WDB A;  1UY0 A;  5HPO A;  2VZ1 A;  1OF4 A;  3ACF A;  2Y6G A;  3NNG A;  1UX7 A;  3EB7 A;  1JZ8 A;  2J1V A;  3MBW A;  1US3 A;  5EIY B;  5JXJ A;  2B4K A;  4CUB A;  3AC0 A;  5JXH A;  1W9T A;  4LQR A;  4MGS A;  1ULO A;  2X09 A;  3OGS A;  1JU3 A;  2B9V A;  5IFP A;  2Y6H A;  3LEI A;  4P00 B;  3SKV A;  2J7M A;  2ORZ A;  1IQD C;  2VO5 A;  2LS6 A;  3THC A;  1W8O A;  3FHQ A;  4ARY A;  2VMC A;  1PMH X;  2YC4 A;  4A3Z A;  3OEA A;  1ULP A;  3WNO A;  4XVH A;  3K4Z A;  3I3D A;  3VD5 A;  3T2P A;  4AAX A;  2JDA A;  2W5F A;  1BHG A;  3UES A;  2ZEY A;  4DEV A;  2YFZ A;  1UYY A;  3K75 B;  4OMC A;  1UY3 A;  1JI6 A;  2Y6K A;  2ZXQ A;  3DYP A;  3IB3 A;  3VD3 A;  1OT5 A;  1MPX A;  4MOA A;  4D0Q A;  3HPN A;  5IFT A;  4DXS A;  4KWU A;  2QBX A;  5B4N A;  5LA1 A;  4P08 A;  3WEZ A;  3E1F 1;  3C7E A;  2XON A;  3VD9 A;  1L7Q A;  4RYD A;  5CYY A;  5C71 A;  4QPW A;  4M4R A;  3GM8 A;  2WQ8 A;  4E8C A;  2J22 A;  2DCJ A;  3I2F A;  2J1R A;  4QAW A;  2WAB A;  5JXI A;  3WNM A;  3FL7 A;  2W1W A;  4LHS A;  3CQO A;  3I2J A;  4A6O A;  3OB8 A;  4XZU G;  1CZT A;  2VL4 A;  4QX3 A;  1SG3 A;  5CZK A;  3LPG A;  2W87 A;  1D7P M;  1NX9 A;  3OGR A;  3WQB A;  2W94 A;  4QX2 A;  2JD9 A;  1JU4 A;  3A7Q A;  1GOH A;  1HN1 A;  1NAE A;  1DP0 A;  1W8N A;  2HYX A;  1US2 A;  2VMF A;  2LW8 A;  1YQ2 A;  3SEP A;  1J84 A;  5I0D A;  2RVA A;  1JZ2 A;  3I2G A;  2WAA A;  4JKL A;  2VZR A;  2OKX A;  3I3B A;  4IUG A;  3WNK A;  4HG6 B;  4BJ0 A;  1EUT A;  2E32 A;  2W1S A;  4P02 B;  5FUI A;  3ACG A;  2YC2 A;  2WZE A;  4BXS V;  2QQN A;  4XUQ A;  3HNB M;  2E31 A;  2V4V A;  2E26 A;  3HNM A;  1DLC A;  4XUR A;  3I97 A; 
#chains in the Genus database with same CATH topology
 1ODM A;  1QJU 3;  1OOP B;  1NCR C;  1UKR A;  1BYH A;  1HKD A;  4MVT A;  4QKB A;  5GLV A;  3RJ2 X;  3CLP A;  5GZG A;  2PTM A;  5FLI A;  1E5R A;  5DQ0 A;  2ENR A;  4O9G A;  3MV0 1;  1EV1 3;  2QNK A;  2CDO A;  1RUG 1;  3FHA A;  4B4Q A;  1ZBA 3;  3T3Y A;  1H30 A;  3ES4 A;  4ZXE A;  3NJY A;  2BBV A;  1PX4 A;  2PHX A;  4OYU A;  1BBT 3;  5G05 L;  1D4M 3;  3QLQ A;  4IGQ A;  4DUV A;  4HBN A;  4UW6 A;  4ES9 A;  1RUD 3;  4QQ2 A;  4YVW B;  4CDQ A;  3V56 A;  4TZD A;  2XLA A;  5GZC A;  3I54 A;  4YM0 A;  1EPW A;  2W47 A;  2VH9 A;  5FZK A;  2XQR A;  1WME A;  3CF6 E;  1SLI A;  3WDT A;  3WLU A;  4DB5 A;  3NMB A;  1AX0 A;  2P4E A;  4IET A;  3VBO B;  5L9R A;  1JZ4 A;  2VCA A;  4YGC A;  4BDV B;  1PMI A;  3DPR B;  2WIN B;  3NO8 A;  4N53 C;  3C7H A;  4LOR A;  4JHT A;  2RS3 2;  3MIB A;  3OGG A;  1EPZ A;  1C3H A;  3D0S A;  1DQ5 A;  2WWU A;  3VN4 A;  2PHU A;  1UY2 A;  2Z5W A;  1DYO A;  4COV A;  5LEK A;  4C1X A;  5F6L B;  4BIS A;  4Q26 A;  4ZZ8 A;  5FR3 A;  3OGV A;  3O0V A;  4Y1V A;  4RS5 C;  4IV1 A;  3WT3 A;  4DIQ A;  3R05 A;  1W2N A;  1OF3 A;  3QOP A;  4MET A;  2FQP A;  2QDN A;  4FAH A;  4L0P A;  4UAP A;  5IVE A;  1HRI 2;  2WNU A;  2HWD 1;  3IT8 A;  3LA2 A;  2GMM A;  3DF0 A;  5GZD A;  5K4L A;  2HBU A;  4CCL A;  5C3S A;  4CU9 A;  1AR8 3;  3H7J A;  2DTY A;  3AXD A;  1D0H A;  1XE0 A;  1WGP A;  1Q3E A;  2W2I A;  3Q8B A;  3HD8 B;  1W03 A;  3HJR A;  3VZO A;  5BNP A;  4CXX A;  2WBK A;  4MG2 A;  2YFU A;  2YG0 A;  3AJZ A;  2W08 A;  3ZYP A;  1Y9G A;  3PVO A;  1CD3 G;  1OLR A;  1K12 A;  2VAU A;  3CJI B;  5FBJ A;  3GYD A;  4GJY A;  4GA9 A;  4P5Y A;  1PX3 A;  5IK5 A;  2VBP A;  3MGU A;  1BJQ A;  2KR2 A;  2P5B A;  1S4C A;  5FIX A;  1A34 A;  2P2K A;  4MH0 E;  4CRQ A;  4UYB A;  3ZSM A;  5A6Z A;  3BOP A;  1RHI 2;  4NWW A;  2VOK A;  4MXW B;  1O6U A;  1OHF A;  1BEV 2;  2R0H A;  3HQX A;  4XFC A;  3TB0 A;  4XFG A;  4PLN A;  1V6I A;  1OKO A;  4QX5 A;  2Q8E A;  3VBF B;  1JUI A;  3TN9 3;  5ABJ A;  4IE5 A;  4HKW A;  4Y20 A;  1B35 C;  2C9K A;  4MGQ A;  1CAX A;  5FUN A;  5GLT A;  3BIW E;  4MGT A;  4IDZ A;  4QKN A;  1ZZ7 A;  4CU8 A;  1CZS A;  1UXZ A;  2QVS B;  4LA2 A;  5C3P A;  1GP4 A;  1MS3 A;  1REE A;  1TME 2;  3FBY A;  3OG2 A;  4NIH A;  1R1A 2;  1OVS A;  1JYV A;  2WT0 A;  1GU3 A;  5F7U A;  3IDE A;  4GWM A;  3WOG A;  1H4G A;  1UAI A;  1FYU A;  3U75 A;  4K9S A;  5A7N A;  3UKN A;  5IWF A;  3VKO A;  1C57 A;  1R08 3;  1UMH A;  4XFI A;  1ZVF A;  3AFG A;  1LHO A;  2VQA A;  3K46 A;  3N4M A;  3WV6 A;  3RI9 A;  4OHY A;  1TMF 2;  1UMI A;  1CGP A;  5BUV A;  4BME A;  1HV0 A;  5DG2 A;  3JUU A;  4FQ4 A;  5A70 A;  2DCT A;  3BAL A;  4LE3 A;  2O8Q A;  3KS7 A;  3AZW A;  4EV0 A;  4K1Y A;  1W6M A;  3CL1 A;  1GZ9 A;  4XIO A;  4Z2W A;  2VU9 A;  4ONU A;  5IK7 A;  2WFP A;  5JIA A;  1X8E A;  1NG0 A;  2PAM A;  4DXR A;  4FXK B;  2R16 A;  2R06 2;  1KXG A;  5KC5 A;  1KIT A;  1YFW A;  2W1Q A;  4H14 A;  3MO4 A;  3W58 A;  1ZZ9 A;  2ID4 A;  1LKN A;  2YMZ A;  3S7I A;  1G9D A;  4FTB A;  1H8V A;  3UT0 A;  1RUJ 1;  2PFW A;  3EQE A;  3MW3 A;  1Q5O A;  1UU6 A;  1G9B A;  3DL3 A;  4HK9 A;  2NPI A;  2UY9 A;  2LAL A;  3NV3 A;  4OI2 A;  2RHP A;  2RM2 2;  5CFC C;  5LA2 A;  5I0R A;  2TUN A;  1NE4 A;  4CEW B;  2RR1 2;  3MIE A;  1UY1 A;  4NUB A;  2G1M A;  2VOX A;  2ET1 A;  4AED A;  1JYW A;  2WLP A;  4E4Z A;  2X53 S;  4LO8 A;  4BQ5 A;  5I0U A;  1O5U A;  1Y9M A;  3G7D A;  1KJL A;  1PIV 3;  4IV3 C;  4BU2 A;  4FAG A;  2R49 A;  1STM A;  2GP3 A;  2WS9 1;  3HQR A;  3LGR A;  5LBE A;  1TNF A;  3WG4 A;  4XW3 A;  3QBQ A;  3K77 A;  4QDS A;  4CP0 A;  3RZH A;  5BNN A;  1OUR A;  1O4Y A;  1VBE 2;  3BTX A;  1WUV A;  1CVN A;  1CAX B;  2JE8 A;  2WN2 A;  5BNO A;  2ZZQ A;  1ULD A;  5EJZ B;  3B7M A;  5LRR A;  1HRV 2;  1W8H A;  1ZZ8 A;  1D2Q A;  1ZX5 A;  1XQN A;  2V5Y A;  1D4M 1;  2VBD A;  3ZYI B;  2J1A A;  1K42 A;  2JXA A;  4E2S A;  2WFF 2;  2C9A A;  1QJX 2;  1AYM 1;  2RJK A;  3LEK A;  4D8M A;  4JRA A;  3NJV A;  5FP8 A;  2RMU 3;  4DEQ A;  3HMY A;  1VRH 1;  1XPW A;  4F8A A;  1KDK A;  1RUI 1;  2NMN A;  4IEQ A;  5AFE A;  5IVB A;  3A4U A;  2EAL A;  4MO3 M;  3FWE A;  2IZW A;  5FMB A;  4FPJ A;  1RUO A;  2A6V A;  5DAP A;  2ZAH A;  1JYC A;  3VDC A;  1JOJ A;  2VOW A;  2WT2 A;  5KWR A;  1GBG A;  5JR7 B;  1R08 2;  2IWG B;  3O0X A;  3RVH A;  5I93 A;  4I30 A;  1D4V B;  4O65 A;  1QQP 1;  1ND3 C;  2JKB A;  2C6S A;  4RD7 A;  1W6P B;  2YBS A;  1C8N A;  3USU B;  4LJH A;  3VV1 A;  1Z7S 1;  4UXA A;  5IVY A;  4ASL A;  1CZV A;  1DLL A;  4UW3 A;  3T1L A;  1AUY A;  3WQ1 A;  2Y0I A;  3K4A A;  3AM2 A;  4WM8 C;  4PF5 A;  4OUM A;  4CPB A;  2PAK A;  4CCM A;  4XIK A;  1H4H A;  4JRL A;  5L7O C;  4GKX A;  2NM1 A;  3FX3 A;  4JGY B;  4WBB A;  3HWJ A;  5FZH A;  3TYJ A;  1WMF A;  2E33 A;  2RS3 1;  3RWK X;  2VVD A;  2YXS A;  5JR2 A;  2JG8 C;  1LEC A;  5FZ6 A;  4CUA A;  4F7Z A;  1OC1 A;  1JTZ X;  4OVE A;  4P9X A;  1J3Q A;  3HQU A;  3O7O A;  5E89 A;  2EIE A;  2V5D A;  1KD7 A;  2B42 B;  2QQV A;  2VQT A;  5DDJ 3;  4EN7 B;  3MV1 1;  1GKB A;  2W95 A;  3WG3 A;  4KWL A;  3ZN5 A;  2ORX A;  5IUQ A;  4W8J A;  2ERF A;  3OBA A;  2HWB 1;  2A71 A;  4XHX A;  1JUH A;  4YVW C;  4WZC A;  3APB A;  4W50 A;  3RFR A;  4Z1V A;  2BPA 2;  3P3N A;  1XC6 A;  3D8C A;  2JG9 A;  5J7M A;  2VOV A;  2A73 B;  2GNB A;  1C8M 2;  4HSJ A;  4Y24 A;  1DYK A;  5C70 A;  1COV 2;  4YG6 A;  3WHU A;  2C1F A;  4PLM A;  3TEY A;  3I49 A;  3S5A A;  1J83 A;  1R09 1;  4UI9 L;  1A78 A;  4E8D A;  2AGS A;  1GUI A;  4QX0 A;  1N1V A;  2JB8 A;  5H9R A;  2ZKL A;  5D8A B;  4FBF A;  1VBC 1;  1W6N B;  1POQ A;  4YVS A;  2PHW A;  4QM8 A;  4ZXK A;  3ZXA C;  3LIG A;  3V64 A;  1N3O A;  1PVC 3;  4K20 A;  3AKS A;  2IFR A;  1VJ2 A;  2XUE A;  1ZNP A;  1XNA A;  4MHU A;  1UYZ A;  4PQ9 A;  4AOC A;  3VDB A;  1XXN A;  1WLC A;  1XYP A;  2QJV A;  2D5H A;  4QQH A;  3NKG A;  1YHF A;  2EXH A;  3CDZ B;  1T2X A;  1PVC 2;  3B3Q E;  3ETQ A;  4Q4Y 3;  2VMI A;  3O14 A;  5CG8 A;  1YFU A;  4P5H A;  4YLZ A;  4PJY A;  3WNN A;  3UNP A;  1P8J A;  3ZXE A;  1KS5 A;  1LU2 A;  1KS4 A;  3J8F 3;  2GAL A;  3N7M A;  5FZG A;  3BI3 A;  3SHR A;  4JDO A;  3GZT B;  4G3Y C;  4KU7 A;  1JYX A;  4L92 A;  5I0T A;  2CNA A;  3AZY A;  4I3G A;  4FQZ A;  1EY2 A;  2AAC A;  3AYE A;  4QHZ A;  3O1R A;  2R04 2;  2XHN A;  5FRE A;  1H8T A;  3TAY A;  4AW7 A;  2NLR A;  3PVE A;  3AMN A;  5FJK A;  3GJA A;  2VNR A;  3VLB B;  2Z4F A;  3C7G A;  3D0J A;  4I0B A;  3I4I A;  4GWN A;  1DGR A;  1AF9 A;  3JB8 A;  1B35 A;  1EV1 2;  3BTZ A;  4HN1 A;  3III A;  2A1X A;  4AQT A;  4RSU A;  3RSJ A;  3VBS A;  4EYU A;  2GC1 A;  3T4V A;  4DUX A;  3W21 A;  5LZ6 A;  5GKA C;  2VVE A;  2CYF A;  2ZHM A;  4Q0V A;  1O59 A;  1PIV 1;  2JDH A;  3HT2 A;  3R4S A;  4YM2 A;  4HL0 A;  3KCY A;  5TSW A;  2O0O A;  5CFC A;  1ODN A;  3NV1 A;  3SIT A;  4AVB A;  4COU A;  1QJY 1;  5FY4 A;  3LB9 A;  1DHK B;  2HWF 2;  3DKW A;  4FOV A;  1QJF A;  3GZU C;  4LIU A;  4OHV A;  3VBH B;  1PM4 A;  1RUE 3;  1DG6 A;  4ORF A;  1UY0 A;  2PHL A;  4XFF A;  3VB9 A;  3VBU B;  1JHN A;  1XOY A;  4Z07 A;  5AFB A;  4FTE A;  5K9Y A;  2WFF 1;  1YQC A;  2Y33 A;  2PAE A;  1S2E A;  4KG8 A;  5DDJ 1;  2Y38 A;  3MBW A;  1JZ8 A;  3NVC A;  1D4M 2;  5KR7 A;  2EXI A;  2B4K A;  1ASJ 1;  3KLS A;  1UW8 A;  2BYV E;  3J8F 2;  5A7P A;  4AVS A;  1AR7 2;  4P9I A;  1QGL A;  4LQR A;  4W6X A;  2I07 B;  1YNA A;  2F17 A;  4BB3 A;  1DFQ A;  1H1A A;  1VBA 2;  1V9U 1;  2B39 A;  3RJR A;  4UF0 A;  4YW7 A;  2G19 A;  4XOG A;  1EAH 3;  4L99 A;  3I3M A;  1SAC A;  2K0G A;  1GR3 A;  3NST A;  1CJP A;  3PU3 A;  1S55 A;  3AMH A;  4COY A;  1VAL A;  1Y9Q A;  4M0H A;  2K2S A;  5HV4 A;  1XND A;  4NHX A;  1TNR A;  4J1X A;  1ND3 B;  2C0Z A;  3ZFF A;  4FVV A;  4J1W A;  2HBT A;  1QJZ A;  1HJG A;  1LRH A;  4XET A;  1Q8V A;  2E7Q A;  1NZC A;  4NMI A;  5IAV A;  2VMC A;  1ND2 C;  4N53 A;  4ARY A;  2YC4 A;  3ZFE A;  4FO9 A;  3PUQ A;  1Q8O A;  1GWL A;  1SBD A;  1H8T B;  2PXJ A;  4YSF A;  4QGN A;  1A6C A;  5GZF A;  2JDA A;  1QHD A;  1BHG A;  4IE0 A;  5EQU A;  1QOS A;  4GH4 A;  4XDO A;  4DEV A;  2JIG A;  3JBG 2;  1UX6 A;  3POE A;  4XAE A;  2IC1 A;  4XDP A;  1C8M 3;  4YVW A;  3RZZ A;  3AP9 A;  2ES3 A;  4EN8 B;  4EZH A;  3H3Z A;  4FOY A;  5A3M A;  5C9A C;  2JG9 C;  3KCX A;  3MPP G;  4ATE A;  4ZKT B;  1JI6 A;  4L97 A;  2Y6K A;  1OUX A;  5BYN A;  4XF0 A;  3ZN6 B;  1TMF 1;  1UZZ A;  2GH2 A;  5L7O A;  1C4R A;  3ZDS A;  4ZU7 A;  4NR1 A;  4YW6 A;  4WVW A;  2V73 A;  3BYW A;  5B4N A;  3LOI A;  4BQ2 A;  5LA1 A;  2HEY F;  4BQ1 A;  2MEV 1;  4XXP A;  3WEZ A;  4BQY A;  4CCD A;  3KV9 A;  4HK8 A;  3BB6 A;  4MGI E;  3RG0 A;  4AEK A;  4ZS2 A;  5EYY A;  5FY9 A;  1NCR B;  1EP0 A;  4GKY A;  4RYD A;  1CPN A;  5CYY A;  2E9Q A;  3U1X A;  3ZFE B;  5F3E A;  2P3I A;  5FP9 A;  1J3P A;  4QHB A;  2AR6 A;  1VBC 3;  2DCJ A;  3I2F A;  3S0M A;  4CCE A;  4UWD A;  4NII A;  2XVK A;  1RED A;  5LAS A;  3LA3 A;  2AH2 A;  4Y5T A;  4IEW A;  1YUD A;  2ARX A;  1DYP A;  2W1W A;  2JJ6 A;  2ZGU A;  4HVQ A;  4IV3 A;  2Q0A A;  2XBO 2;  3ON7 A;  4K1Z A;  3TEX A;  5FY7 A;  2VNO A;  1RUC 2;  3HIF A;  1S0C A;  2VNG A;  4QX3 A;  1F15 A;  1I3H A;  1SG3 A;  2ARE A;  5CZK A;  5ANN A;  4ERO A;  1NXD 1;  4YW1 A;  1COV 1;  3UYJ A;  4R4X A;  1GQH A;  5FZF A;  2YU2 A;  2PQQ A;  4PBP A;  2CV6 A;  2DUR A;  3D5O A;  2BEO A;  3A7Q A;  4ZPI A;  5JOY A;  2IVJ A;  1I1E A;  1WLW A;  1NAE A;  3OGJ A;  2GNT A;  1W8N A;  3CJI A;  3V0B B;  4NPR A;  1VRB A;  3PHM A;  2FDH A;  5F39 A;  5FXX A;  4PBO A;  5K7P A;  4GB3 3;  2BVB A;  5FP7 A;  1ST8 A;  2AEZ A;  1M4W A;  2LW8 A;  3FHI B;  3KWV A;  1YQ2 A;  2XWJ B;  1UF2 C;  5T3N A;  2MNG A;  5I0D A;  2OVU A;  1LR5 A;  1K5M A;  2K46 A;  1JOB A;  3THT A;  1RJ8 A;  2OKX A;  3RDI A;  2CAV A;  3TBD A;  4HG6 B;  4BJ0 A;  4WM7 A;  4FTS A;  1B35 B;  5A7Q A;  4LIT A;  3OCP A;  1VBC 2;  2JIJ A;  4D3W A;  1EUT A;  1PZ7 A;  3ITQ A;  2AYH A;  4Q0U A;  4YWA A;  3WDY A;  4XFH A;  2WWJ A;  4RR3 C;  5FUI A;  3WDX A;  2V09 A;  2YC2 A;  4IL7 A;  4D7T A;  2VUD A;  2QQN A;  2E31 A;  5A7W B;  3SH4 A;  5I8S A;  2BW8 A;  3H7Y A;  1OFS A;  2RS1 3;  5FQ0 A;  2E26 A;  2IUW A;  1N1S A;  1XU2 A;  2CGO A;  3FLT A;  4EZ4 A;  4M01 A;  3UK9 A;  2EAA A;  2XH6 A;  5EHD A;  3N9L A;  3CJI C;  3PDQ A;  4LO7 A;  2HWC 1;  5L7O B;  3N7L A;  2WII B;  3WCS A;  3I97 A;  1G9C A;  1W0P A;  3PLQ A;  3TRS B;  2FDJ A;  4HON A;  3LPF A;  3FBM A;  2VPV A;  5H9Q A;  3AXE A;  3S57 A;  3A23 A;  4N9H A;  3ZM8 A;  1TE1 B;  1VBA 1;  3JBG 3;  4CVU A;  5KXC A;  1DZQ A;  3ZIW A;  4Q4V 1;  3T1M A;  1MAC A;  4XE9 A;  1RYY A;  3RWN A;  4G4F A;  3ZPO A;  5LCW L;  3OD0 A;  5CA6 A;  2R04 3;  4WM7 B;  4AHX A;  4N43 A;  5LAT A;  3ZMO A;  4B4R A;  5EXO A;  2VTX A;  4EN0 A;  2AC1 A;  3O0W A;  4QPY A;  4Y1X A;  2YV8 A;  5GLW A;  1SCR A;  4GZ9 A;  1BBT 2;  1N1Y A;  3LDK A;  5IT6 A;  2ZX1 A;  1ZA4 A;  3KQ4 B;  3Q8C A;  3E6B A;  3GHN A;  1ALY A;  1UIK A;  1U5I A;  1SFN A;  4XBN A;  1LHN A;  3SKJ E;  4JX0 A;  4N53 B;  3WNL A;  5JOZ A;  1SLA A;  1DGW A;  1LHW A;  5FZ4 A;  4AEM A;  4XUP A;  4YZ5 A;  5C7G A;  3B00 A;  3LIH A;  1RHI 3;  4Z82 A;  3LAG A;  4HT1 T;  1Z0H A;  2VCB A;  2QFE A;  4CCK A;  1GP5 A;  4NVP A;  3VZM A;  4MGY E;  1BMV 1;  3W5N A;  4M4P A;  2NP0 A;  1FOD 1;  4YG0 A;  4A7Z A;  3HT1 A;  5FY8 A;  5DUV A;  2VM9 A;  2D3S A;  5G04 L;  3T0A A;  3PUR A;  2DWR A;  2ZCW A;  5JVV A;  3PNA A;  1OBN A;  1QDO A;  1RUG 3;  2YYO A;  1QMJ A;  1SZB A;  2EXJ A;  5A32 B;  4YYO A;  1H9W A;  2MEV 2;  3WHT A;  3M4F A;  5KHJ A;  2R1B A;  3I2I A;  1PZ8 A;  5D1I A;  5FZ9 A;  1QXP A;  4YNI A;  3O1V A;  2QKD A;  1COV 3;  5J1X A;  4C8D A;  1H9P A;  3WF0 A;  1UOG A;  1VMF A;  5LA9 A;  1X36 A;  3SLI A;  1HXS 2;  2CWS A;  2QQU A;  3C7O A;  2OQ7 A;  1NQJ A;  2VEC A;  2JDK A;  3DEM A;  2H6B A;  4CSW A;  1QOT A;  4L8Q A;  3SC7 X;  2J1S A;  5FP3 A;  3SIS A;  2OW4 A;  2Q1Z B;  2ZX4 A;  3MUY 1;  5T52 A;  1LOA A;  1G6N A;  2A5Z A;  4BA6 A;  4XQ4 A;  5C4W B;  1LOC A;  1XNK A;  4I01 A;  5IYY A;  4XDQ A;  1Y4W A;  2VJX A;  3KT4 A;  4XBL A;  1RJ7 A;  4Q4W 3;  5LW9 A;  4KBZ A;  1FV2 A;  3GHM A;  4N43 B;  5FPL A;  4OFG A;  4AF9 A;  1UOJ A;  1GNZ A;  3WF1 A;  1CQ9 A;  2XR4 A;  1VIW B;  3GBF A;  1W8W A;  4GUL A;  4LIV A;  5FK7 A;  1RB8 G;  3NV2 A;  3THP A;  2RS5 1;  2D3R A;  1JBC A;  2ADD A;  3FJS A;  1QQP 2;  2ZZJ A;  2ZEW A;  2P3K A;  1TME 1;  4PCR A;  1J59 A;  4Q4Y 2;  4RHV 3;  1UKG A;  3TOJ A;  2XPJ A;  3Q8E A;  1QKQ A;  3OBR A;  4P9G A;  3O5S A;  4QHO A;  2ET7 A;  5CFD A;  1AR7 1;  4YVS B;  5D8A C;  5IJR A;  2ZEZ A;  4AHZ A;  1KGY A;  2HWB 2;  1TG7 A;  3ENR A;  3QAC A;  4CP2 A;  2EVX A;  2VUA A;  3T2T A;  3I7D A;  4E4D X;  4LBM A;  4GWI A;  3B9I A;  1W9S A;  4Q1P A;  3O1S A;  1ENR A;  5FQ0 B;  5CIS A;  2CHH A;  3H3U A;  4TLF A;  3LKJ A;  2OUJ A;  4B7E A;  1IG0 A;  1PK6 B;  3NNL A;  2C26 A;  4CDQ C;  4EN9 B;  1PGW 1;  1MEC 3;  2W9X A;  5EV7 A;  5E8A A;  1RXF A;  3O12 A;  2WQZ C;  4JKK A;  4K8R B;  4ZZ5 A;  1IOA A;  5DZE A;  5HXM A;  2VZO A;  1NUK A;  4MUV A;  2VXR A;  3ETP A;  2A6Z A;  5FZO A;  2JIC A;  4M0N A;  1UU5 A;  5ANQ A;  1WCQ A;  2Y60 A;  4JGY C;  4QXB A;  1H1M A;  4Y26 A;  1VPH A;  5L9B A;  2XVL A;  4A44 A;  3VL9 A;  2BER A;  2OII A;  4FPF A;  3Q9O A;  4WM8 B;  5C3Q A;  3T2O A;  2HWE 3;  4PQQ A;  1BBT 1;  5E1R A;  2ZTN A;  3M1H A;  5JUV A;  3OSD A;  3U11 A;  4BOW A;  1O3Q A;  2ZX0 A;  5F5Q A;  2CAU A;  5F2S A;  3RYP A;  5CFD B;  5F9T A;  3A21 A;  4BQ4 A;  1WW4 A;  4JTO A;  2JDP A;  1OLM A;  1SQ4 A;  4NPL A;  2CL2 A;  4D69 A;  4COZ A;  3EJK A;  5H9P A;  2TEP A;  2SLI A;  5CVR A;  3POI A;  5CIR A;  1PMJ X;  1UL9 A;  1F4H A;  5AVP A;  4I3P A;  1RUE 1;  2V4A A;  3D4K A;  4H3W A;  3T30 A;  1DQ6 A;  4PHZ A;  1XSR A;  5JXG A;  1XNC A;  1AXZ A;  1OPO A;  2PHD A;  3E5Q A;  3GZE A;  1HRV 1;  3R0R A;  4HN0 A;  4QPG B;  1FOD 2;  2VMG A;  1WCU A;  2XKP A;  4P9Y A;  2EA7 A;  5GAL A;  3VBS B;  5I0S A;  5ABJ B;  3D3A A;  4QGM A;  5FY5 A;  1S0J A;  4R8H A;  2VZ3 A;  1FT9 A;  2EID A;  1O7F A;  3DN7 A;  1ULF A;  3ILN A;  3AP5 A;  5FZ0 A;  1GZC A;  3JCI A;  4MHR A;  4YZ3 A;  3THD A;  1CAV A;  1FMD 3;  2ARB A;  3KV6 A;  4RFR B;  4AWD A;  5I8Y A;  4I0A A;  3OUH A;  5CAD A;  3DCQ A;  3MUZ 1;  4H2A A;  3WF4 A;  4KGG A;  3OPT A;  4PF1 A;  3FMG A;  3HOB A;  4YGE A;  4ASK A;  1R1Z A;  4JZR A;  3OEB A;  3ZYJ B;  3AMM A;  3CJX A;  4M00 A;  5BNP B;  5JSR A;  1X50 A;  2GZW A;  3PTR B;  1IS6 A;  1QJU 1;  4IV3 B;  3F95 A;  3WW1 A;  4ET7 A;  4LK6 A;  5M0T A;  1I5P A;  4ZHN A;  1R64 A;  4W6Y A;  1YRZ A;  2YPJ A;  3OF1 A;  1CX1 A;  2A3X A;  1QJY 2;  4XYX A;  3HN3 A;  4WV8 A;  4JV4 A;  5BV6 A;  2XOM A;  2GDF A;  4CYD A;  2J1T A;  4LBJ A;  4NHY A;  1CES A;  5FYU A;  5GM0 A;  4NIG A;  1K3I A;  2D3P A;  3VDD B;  1LOF C;  5CFC B;  5A1L A;  4QB1 A;  5EPA A;  2ZKN A;  3U78 A;  2WNO A;  4LO5 B;  1OLM E;  2VR4 A;  5JPM B;  4MYE A;  3LSE A;  3CIH A;  4AVV A;  5LB6 A;  3QD6 A;  4XZP A;  3EHK A;  1OA4 A;  4ISQ A;  2AUY A;  2HYK A;  4AGR A;  4TTG A;  1AX1 A;  3ZSK A;  3U0Z A;  1ONA A;  1GFF 2;  2DVF A;  1RIR A;  3KD4 A;  5JSO A;  4YZ1 A;  3POB A;  3Q8A A;  4PIY A;  1H6Y A;  2D43 A;  4M3C E;  5K0U B;  5FZL A;  4QGL A;  4NIA A;  5T5L A;  3BCW A;  4QPI C;  4AFM A;  5C3R A;  2BDR A;  2GN3 A;  5FWJ A;  3DPR A;  3JXS A;  3NJX A;  1VB2 A;  3B9C A;  4BM8 A;  3CKH A;  1OFN A;  1JN2 P;  1UXX X;  2B9U A;  4D6S A;  5D8A A;  4MAD A;  4YG3 A;  4Q8K A;  2GP5 A;  4R9A A;  5EP9 A;  5FYH A;  1S0F A;  1PO2 3;  4QU2 A;  1LGN A;  3IIA A;  1MZ5 A;  4GJZ A;  2EIC A;  1J3R A;  2PLV 1;  1ZRC A;  1K5J A;  5K8S A;  2W91 A;  4LBQ B;  5F1R A;  1RUF 1;  1GQP A;  2BNM A;  1W3V A;  2WJS A;  4RHV 1;  1S0D A;  4ES8 A;  3ZMN A;  1WW6 A;  4OLL A;  3B93 A;  1JYI A;  2JKX A;  3JB4 C;  4HSL A;  5JIU A;  5FDB A;  3TEZ A;  1O3R A;  1OOP A;  2BZD A;  4A2U A;  1T6G C;  3I3Q A;  4QX1 A;  4Y20 B;  4B1L A;  4YZ4 A;  5J48 A;  4XUN A;  2RR1 1;  2ZOE B;  1R1A 3;  5KBF A;  2WNV A;  2ZGK A;  4XJA A;  3VHP A;  1QNY A;  3PUI A;  2A6Y A;  2LRP A;  4D94 A;  1ZBE 1;  2ZMK A;  4KH9 A;  4CUG A;  1IGO A;  4JDN A;  4Z2A A;  4LE4 A;  4RFT 0;  1ZBA 2;  4NID A;  4XAA A;  2HEV F;  4TN7 A;  5A3U A;  5C33 A;  4MXV A;  3USU A;  3GBG A;  2ZAC A;  4CDX C;  2ZHK A;  5FZM A;  5JMO A;  4S2G A;  3URF A;  1MZ6 A;  1N3P A;  2JDN A;  4RN5 A;  2A70 A;  4AHY A;  4S2H A;  3OUI A;  4EN6 B;  1VBB 1;  1H8T C;  2F4L A;  2GND A;  3ES1 A;  1JXN A;  1W2A X;  5JI7 A;  4YPJ A;  3WW2 A;  2JG8 A;  3I2H A;  4CDW B;  5KHK A;  4E4H A;  2W92 A;  4H7L A;  4OUS A;  2R07 2;  3BUC A;  3VZK A;  1J1L A;  2VQU A;  2H0V A;  2X10 A;  3BN6 A;  4JGY A;  2J1U A;  2PHF A;  3RYR A;  2J42 A;  1N3Q A;  1ZYB A;  2LUW A;  3UKT A;  2VD7 A;  4NHM A;  2DBI A;  5CFD C;  2WKK A;  3NKT A;  4XMI A;  4RGG A;  4UFK A;  2HJI A;  3WF3 A;  2WDB A;  3DUI A;  4IV1 B;  1HB2 A;  2WZR 2;  4XCA A;  3NV4 A;  2HWF 1;  1AR8 2;  5F3G A;  3ACF A;  2Y6G A;  2TBV A;  2Q1F A;  3U14 A;  1UX7 A;  3EB7 A;  5HI0 A;  1AR6 2;  1ZRF A;  3EMR A;  1POV 0;  3ZYR A;  2J1V A;  5JMC A;  1DZT A;  1MS8 A;  1US3 A;  4CEW A;  4FCA A;  4CUB A;  3AC0 A;  2JD4 A;  4MGS A;  3CNA A;  3HAG A;  1ULO A;  1RUC 3;  1WA6 X;  1H0B A;  4BLI A;  5ACA 2;  3MW4 A;  2X09 A;  1E57 A;  4RL7 A;  2HWB 3;  1PGW 2;  4YM3 A;  4DFS A;  1RXG A;  2B9V A;  5D2A A;  3ASI A;  2Y6H A;  4C91 A;  3LEI A;  4BYY A;  4CDQ B;  3O1T A;  4AGV A;  4I02 A;  1OVP A;  4P00 B;  5IW0 A;  3M3C A;  3SMH A;  1POV 3;  2WSU A;  4CP1 A;  3AMQ A;  2YHJ A;  3NNF A;  4DNY A;  1UD1 A;  1W9Y A;  1YFX A;  3OTF A;  2R04 1;  1RUI 3;  4CEY A;  3WG1 A;  3RNS A;  3THC A;  1V6L A;  1W8O A;  2BV4 A;  1JYT A;  1OXC A;  2RDQ A;  1Q43 A;  4A3Z A;  3WW4 A;  1IPJ A;  1DZR A;  1ULP A;  3GCX A;  3WNO A;  4YRD A;  3K4Z A;  1A8D A;  2ZMN A;  1BK1 A;  3T2P A;  4ASM B;  4D6Q A;  2W5F A;  4Q4W 2;  4GH4 B;  1G9A A;  4OHX A;  1LEN A;  1F8V A;  5HCA A;  1R1A 1;  2YFZ A;  3AKP A;  2HEW F;  1UYY A;  1W0O A;  1TQ5 A;  2VW1 A;  2P3Y A;  3ROU A;  4R52 A;  1YEW A;  4L11 A;  3SXW A;  4AK3 A;  4QPI A;  3T4H B;  4MGK E;  2DU1 A;  1OKQ A;  1SLC A;  3VKM A;  3DYP A;  3IB3 A;  2D5F A;  5KC6 A;  3AL6 A;  3H3L A;  1OI6 A;  2BJS A;  4KWU A;  4AI3 A;  1UO9 A;  3POJ A;  4PDW B;  2AEN A;  3QH6 A;  4FPY A;  4H7M A;  2WZP P;  2UYA A;  2ATF A;  3E1F 1;  4DOU A;  3C7E A;  5J98 B;  4AR2 A;  4LT5 A;  3MFA A;  1YJK A;  4H55 A;  4NE9 A;  1AYM 3;  1L7Q A;  2Q5T A;  5B2G B;  1JOP A;  4CEY B;  3GZA A;  1FPN 3;  1S1A A;  4RGK A;  2Z69 A;  1WMX A;  4QPW A;  4CCJ A;  1L7L A;  2B7Y A;  3NNJ A;  3W59 A;  4E8C A;  4GMP 0;  1V9U 2;  2J22 A;  4EQV A;  4GH4 C;  3J7L A;  4QX7 A;  3WNM A;  5C5T A;  1HV1 A;  1NLS A;  5C9A A;  1CAW A;  2AEY A;  2CGP A;  1FAY A;  2BOJ A;  4LHS A;  1BQP A;  3H8O A;  3CQO A;  2XLG A;  3H8X A;  1MR5 A;  4U36 A;  4BPZ A;  4E9K A;  1MS1 A;  1QU0 A;  1XBF A;  3VBR A;  3AZZ A;  1IQA A;  3OB8 A;  4W65 A;  4HPK B;  1HW5 A;  3NAP C;  3E6C C;  3RQ0 A;  3RZK A;  1V9U 3;  1HN0 A;  2FD8 A;  1APN A;  1C1F A;  1YIP A;  3N9O A;  3OGR A;  5FYS A;  3V0A A;  4ITC A;  2JD9 A;  3MFC A;  4COW A;  3ATG A;  3ILF A;  1GOH A;  1YLL A;  5BNN B;  1HN1 A;  1ASJ 3;  1UN1 A;  5FYC A;  5T5O A;  2JG8 B;  2XJV A;  2ZPX A;  2HYX A;  1RUE 2;  1XE7 A;  3AYC A;  1S0B A;  3LDB A;  4P9J A;  3B5L B;  4KNC A;  4QWN A;  5FO9 B;  5JDB A;  2WA4 A;  2DVD A;  3IMM A;  4FPG A;  2ZA9 A;  5F3I A;  5FV3 A;  2D93 A;  3S6P A;  3V65 A;  2YC0 A;  4IEZ A;  3ZR6 A;  1NOV A;  1JZ2 A;  3I2G A;  1IZ3 A;  1W90 A;  4IV1 C;  4JKL A;  3VL8 A;  3WNK A;  2WL1 A;  5LK7 B;  1DCS A;  2G9F A;  3ZFF C;  2HH9 A;  4BXF A;  1YJL A;  2XKO A;  4HLT A;  4Q4V 2;  5EFU A;  4XBQ A;  2WO7 A;  1OA3 A;  3BU0 A;  1KQR A;  2WZE A;  4BWO A;  3WIN E;  1V00 A;  3N7J A;  2D6M A;  3ALQ A;  4QXH A;  4X6R B;  4CDW C;  1KDM A;  1DQ0 A;  5H9S A;  4URA A;  4XUQ A;  3HNB M;  1F9K A;  1SFY A;  3SCF A;  2QQW A;  2V4V A;  1W6O A;  2YGL A;  3AJY A;  4CDX B;  4LK7 A;  1LEM A;  4G9S B;  4ZON A;  2XVG A;  3HNM A;  4A7K A;  1CON A;  1DLC A;  3TN9 1;  3RI8 A;  3H8U A;  5FK8 A;  4E2G A;  3BKZ A;  1OQD A;  1RUI 2;  3IBM A;  3AYA A;  5DXD A;  2D6K A;  1X8M A;  4FT8 A;  4Q8L A;  5FPZ A;  3VKF C;  3H1Y A;  2YUE A;  2PQS A;  3WVJ A;  3E5U A;  1ZZ6 A;  3MIG A;  4CUC A;  2XJQ A;  4NJ4 A;  5E16 A;  2Y0O A;  1SLT A;  2JWP A;  2QTW B;  2FDF A;  4XMA A;  5FYY A;  1NT0 A;  2FMY A;  3U37 A;  4HZF A;  3ACL A;  3M7A A;  2EIG A;  2ZX3 A;  4IW3 A;  3UL2 A;  1DF0 A;  1G8W A;  2QQI A;  2RS5 3;  5L36 A;  1O8P A;  5FZA A;  1ZM1 A;  4XUO A;  3ABZ A;  1U0A A;  5CB7 A;  2FCT A;  4IE4 A;  1PHM A;  3WZ1 A;  2WQ4 A;  3I2D A;  4AQ2 A;  5IHR A;  5JOX A;  2ZGL A;  1W06 A;  3PIG A;  1DQ2 A;  1W99 A;  2VVF A;  2VC9 A;  5IK8 A;  1VBE 3;  4AI9 A;  2ZJC A;  3ZXK A;  4Q4X 2;  2WAO A;  1W0N A;  1YQ8 A;  1U12 A;  3KT1 A;  2Z79 A;  5I8T A;  1W6P A;  4QB6 A;  2XUM A;  3IM0 A;  1UOB A;  4TSV A;  2WS9 2;  4O61 A;  3RGB A;  4DMI A;  4B7K A;  1CJD A;  3AVS A;  1FPN 1;  5FUP A;  3N36 A;  4NO4 A;  2PA7 A;  1PGL 2;  3RMY A;  1AR7 3;  3K4D A;  5FZE A;  5C8W A;  2BTV C;  1QF3 A;  2WA3 A;  1ZZB A;  4P14 A;  3ZIX A;  4NRQ A;  2ILM A;  2BGP A;  4URT A;  4OHZ A;  1W05 A;  4X8P A;  3CU7 A;  5DZG A;  3DGT A;  3WDU A;  2QZ2 A;  2WC2 A;  5FOB B;  3DXU A;  1F31 A;  4RS5 A;  1UMZ A;  4E27 A;  4AI2 A;  4QX8 A;  1SFP A;  2ETE A;  3S7E A;  3WNX A;  4Q4V 3;  5DAB A;  3T0D A;  4IE6 A;  3LQC A;  5CKM A;  1FXZ A;  1Z7S 3;  2E51 A;  1EV1 1;  4CDU C;  1RHI 1;  3UGF A;  1SPP A;  1OPM A;  1FMD 2;  5FP4 A;  5JSP A;  2VTX J;  5J37 A;  2VTF A;  3MIC A;  2VY0 A;  5J09 A;  3SH5 A;  4B3N A;  4NWV A;  4IQP A;  1OMI A;  4FOQ A;  3TEW A;  1UQX A;  1PM7 A;  3H50 A;  5T55 A;  3TWI A;  4IES A;  1ASJ 2;  3KB5 A;  3VUO A;  1MS4 A;  5T50 A;  1VMH A;  2WWS A;  1AX2 A;  4K3U A;  1K45 A;  2DVG A;  4OCT A;  4DXT A;  2XDV A;  3E6D A;  4Q0S A;  5CG9 A;  2RMU 1;  3VZL A;  1HQW A;  2CWM A;  1CPM A;  1UY4 A;  3NAP A;  4K6B A;  3JU9 A;  1LAJ A;  1OQ1 A;  4Y4R A;  3UV9 A;  5ABJ C;  2RS5 2;  5FLJ A;  1AJO A;  1IG3 A;  3I3E A;  1UPI A;  1GQG A;  1UYX A;  1EAH 2;  4OUE A;  2EIB A;  1UZY A;  4KBB A;  5JPN B;  4P9W A;  1C28 A;  3RZG A;  2BUK A;  2HWE 2;  5GLU A;  4LBQ A;  4Q27 A;  3VBR B;  4CA9 A;  3N3H A;  1WD3 A;  3ZN6 A;  1L3J A;  2JEN A;  3ECQ A;  3OJB A;  3U07 A;  5T54 A;  5ISL A;  1VBB 2;  3LWC A;  2ZGS A;  2RS1 1;  3NQH A;  5KHH A;  4KL1 A;  1Q8S A;  2VNV A;  1CAU A;  1AL0 G;  1KFX L;  1A8M A;  1VBD 1;  1YIF A;  5FMD A;  3IAP A;  2WZR 3;  3H0O A;  1Q56 A;  4BZ4 A;  2BU9 A;  4WVZ A;  4YW2 A;  3VBR C;  4IE7 A;  1W9F A;  1SEF A;  4Y33 A;  2OQ6 A;  2IXJ A;  3AB0 A;  1S0I A;  2BNN A;  3AKT A;  1HRI 3;  2B8M A;  2BWA A;  3HBK A;  5CKQ A;  1MQT C;  2UWC A;  3ZYF A;  4MGZ E;  1AL2 2;  4ZY9 A;  5IVF A;  1JHJ A;  5DDJ 2;  3ZSL A;  1J1T A;  3MI8 A;  4JQR A;  2KD7 A;  4UBH A;  4PDW A;  4L9B A;  3VHO A;  2B5H A;  4LKF A;  4R4Z A;  1PK6 C;  3FUO A;  2I74 A;  2YRO A;  4AZZ A;  1ZBE 3;  1ENQ A;  1UZV A;  4GAZ A;  4IGP A;  5IVV A;  2P37 A;  4RHV 2;  1CAV B;  3GF6 A;  4KGQ A;  2GN7 A;  2Q8D A;  2OX0 A;  1X82 A;  2IVI B;  1O8S A;  2VW2 A;  3VD7 A;  4CZS A;  4A41 A;  2W1U A;  4HVO A;  1PO1 1;  1I9R A;  1LHV A;  2BBA A;  3PU8 A;  3QH7 A;  4KQ7 A;  4UT5 A;  4A42 A;  4Q2F A;  4X6Q B;  2EF6 A;  4YVS C;  1JMU B;  1AYN 3;  3LZZ A;  3UGH A;  1CIW A;  2VZQ A;  1RUD 2;  4UFH A;  3M3Q A;  3BTY A;  5EJ1 B;  4FPC A;  1YXW A;  1VE0 A;  4QPG A;  3K3N A;  1VBB 3;  3N9N A;  3TN9 2;  2ZAA A;  3U4S A;  4V1P A;  5FPU A;  1NCQ A;  3NL1 A;  1ZBE 2;  4CDW A;  1GMM A;  1BEV 3;  1X33 A;  2X29 A;  3NW4 A;  1ND3 A;  3S30 A;  4CEY C;  3WQ0 A;  4AFD A;  3KHC A;  5CU1 A;  4Q4X 1;  5F3C A;  3M3E A;  4WVV A;  1W2U A;  1W39 A;  1QIQ A;  1NLQ A;  2DV9 A;  2V72 A;  2XBO 1;  2QQK A;  2XQX A;  2JE7 A;  3ACH A;  1E5S A;  2QQJ A;  3KCC A;  2Y8K A;  4CU7 A;  4A45 A;  2J1E A;  2XHK A;  5FOJ B;  2Y6F A;  2W39 A;  3PTY A;  5A6Y A;  3G6J B;  1C1L A;  1ZZC A;  2QQO A;  4R9B A;  1FV3 A;  5JLV A;  2UUR A;  4V2V A;  5FXW A;  4DUW A;  1RMU 3;  1AYM 2;  1C5I A;  3N9Q A;  4J6G A;  3T09 A;  4DY3 A;  3C2U A;  2JB4 A;  2R6Q A;  3POG A;  3OOX A;  4S2F A;  5F8P A;  3WF2 A;  4A7Y A;  3VGI A;  3QCW A;  3FZ3 A;  5FRA A;  4PIZ A;  1AR8 1;  4YFZ A;  5T5J A;  1IS3 A;  2PLV 3;  4D7S A;  4YAR A;  2XJR A;  3MF9 A;  2Y64 A;  1RUN A;  5IAT A;  1CR7 A;  4M3C A;  5BPX A;  1JZ6 A;  1LTE A;  4YM1 A;  5FMC A;  2DFB A;  5KXE A;  4I2O A;  3JD7 2;  4AEJ A;  1C8M 1;  4XJW A;  3SQO A;  1WCD J;  1H2M A;  4BHP A;  3MEP A;  2MPF A;  4QDR A;  3IDC B;  2VZU A;  2X5I A;  3O1P A;  1WKY A;  3BOW A;  3I59 B;  3EBR A;  4GWJ A;  4NHL A;  3DEC A;  5FTT C;  3ZOI A;  3BPZ A;  1QJE A;  3NRU A;  3HBZ A;  2CSG A;  5DMY A;  4FXG B;  3ZXD A;  2DDU A;  3VBO A;  3HNY M;  2CGN A;  3R4D B;  1RUC 1;  3J7H A;  5J3U A;  2Z42 A;  2DVB A;  3HN1 A;  1MQT B;  2BNO A;  1SBF A;  2ZGQ A;  1SDD B;  4UOJ A;  3LDR A;  1U5Z A;  2A3Y A;  1RVF 1;  3KZ4 C;  4KMQ A;  4XAC A;  5LRS A;  2C4X A;  1W6M B;  1EAH 1;  3D6E A;  4HVR A;  4Z92 B;  3ZFG B;  1LGB A;  2VGD A;  1G7Y A;  1CIY A;  2XWB B;  2QUO A;  5DAW A;  3GCW A;  1TMF 3;  3HVD A;  4BMB A;  1QH7 A;  4Q4X 3;  1WCK A;  4UF0 B;  2G4I A;  4XQD A;  5JI9 A;  1Z7S 2;  2DYC A;  4DRV A;  1L7R A;  3FFQ A;  2WR9 A;  5FCC A;  1SHW B;  2QQP A;  1M06 G;  4BE3 A;  1BVP 1;  2BP6 A;  5F5I A;  5FLH A;  2WNE A;  2E7T A;  4CDU A;  3W5M A;  1F4A A;  1W04 A;  1VLN A;  5DN2 A;  3ZFF B;  4AFC A;  4QDQ A;  3KT7 A;  1S2B A;  4BCU A;  1NKG A;  2OPK A;  1AR9 3;  1YI9 A;  4C90 A;  5FYT A;  1NE6 A;  3B94 A;  1RUF 2;  1AYN 1;  4PI2 A;  1OH3 A;  2O8O A;  1OD5 A;  4HMZ A;  4XFA A;  1LNS A;  2L9L A;  1GAN A;  1TZO A;  1O5L A;  5FY1 A;  4OQ8 A;  4BK4 A;  1PO1 3;  3CBN A;  3MW2 A;  2PN5 A;  5FKB A;  1E5I A;  2Y26 A;  4AHW A;  4GQ7 A;  2JEC A;  1F35 A;  2OA2 A;  4DQA A;  2HLE A;  1RUH 2;  2P34 A;  2VOT A;  4MXW A;  4UFI A;  2FHR A;  3I2K A;  4RQP A;  2JEM A;  4ATF A;  1QWR A;  2VME A;  5FXZ A;  4CU6 A;  3WSO A;  4L2N A;  2RR1 3;  2RJ2 A;  1WBL A;  2GC2 A;  1WWY A;  5A33 A;  4RR3 B;  2BGO A;  4LOT A;  4CXW A;  4JDM A;  1RUJ 2;  1JH5 A;  2XJT A;  4GB3 2;  5L73 A;  3E5X A;  2P6H A;  3WP5 A;  1ZRD A;  4Y5Z 0;  3KVB A;  3ZXJ A;  5IVJ A;  1W8T A;  3NAP B;  5FAX A;  3DKQ A;  3ILR A;  1OSG A;  3IDB B;  1WLT A;  5BXX A;  1NA1 A;  1ULG A;  4CDU B;  1MEC 2;  3ZXF A;  4FFG A;  1V6J A;  3ZX7 A;  3NNG A;  3WDV A;  1WW7 A;  3ZKU A;  5EIY B;  1IKP A;  2IXC A;  1F5F A;  1VBD 3;  1QDC A;  2PHT A;  3RYK A;  5JXJ A;  1V0A A;  5BNO B;  3FUQ A;  4AE2 A;  2RDN A;  3IZO A;  5JXH A;  1W9T A;  4NN0 A;  2XXZ A;  3WD5 A;  4NRP A;  3M3I A;  2WNU C;  2RG4 A;  3I8T A;  3CHX A;  4KWK A;  3TNQ A;  4B29 A;  1CN1 A;  2CY6 A;  5FZ3 A;  5IFP A;  1LHU A;  2OZ6 A;  2RS3 3;  3ZYH A;  3C3V A;  2ZAB A;  5CBL A;  1HQL A;  4QPI B;  3SKV A;  1MEC 1;  4Y3O A;  2KXL A;  1IQD C;  2P6C A;  4RQP B;  2QE3 A;  4QXC A;  1JS9 A;  3MIH A;  1NCR A;  1SDW A;  2O14 A;  3VKN A;  1QH6 A;  1MS0 A;  3FHQ A;  4PDW C;  1ZBA 1;  2C24 A;  1R09 3;  1Q8Q A;  3U10 A;  4QXK A;  1UOF A;  3O1M A;  2FCU A;  1MS9 A;  5DUU A;  3WY6 A;  4C0H A;  5A6Q A;  3SCG A;  2ADE A;  4FFH A;  1W2O A;  3UES A;  3WR0 A;  3PUS A;  3DXT A;  2F4P A;  2ZEY A;  3WQ7 A;  2XL7 A;  4AGG A;  1KRI A;  2IXH A;  3K75 B;  3MZH A;  4AI1 A;  2R06 1;  2WYF A;  4LLF A;  3ZDV A;  5KHI A;  2Y34 A;  2XJS A;  1PZ9 A;  1NLR A;  4XAB A;  2UU8 A;  3ZFE C;  3H8R A;  2ZGR A;  1FX5 A;  1BKZ A;  3RMX A;  4CCO A;  3JD7 3;  4ARX A;  1BVV A;  1PNF A;  1MPX A;  1KJR A;  4MOA A;  5DZF A;  4Y22 B;  3KHB A;  1FAT A;  1NQD A;  2DVA A;  3HPN A;  5J96 B;  2PLV 2;  1CAU B;  1VRH 3;  4DXS A;  4V2W A;  1MZE A;  2ZGM A;  3ELN A;  2QBX A;  2SBA A;  3KF3 A;  1W6N A;  5HV0 A;  1O3S A;  4P08 A;  3WP6 A;  4YGB A;  3ME2 A;  1PK6 A;  1FI2 A;  1V6O A;  4JCK A;  2UY8 A;  4O7X A;  1AR6 1;  2XON A;  2JX9 A;  2DTW A;  1FMD 1;  3VD9 A;  4XJ8 A;  2BRT A;  4BQ3 A;  4JGZ A;  4FPE A;  3VZJ A;  4QU1 A;  5HCB A;  1F5J A;  4BLJ A;  4FP2 A;  3FLP A;  2H6C A;  4LHN A;  2X5I C;  3N7K A;  1BK0 A;  5C71 A;  2JG9 B;  1RVF 3;  4LA3 A;  1X9P A;  2WQ8 A;  2UYB A;  1W6Q A;  4BQW A;  2IXI A;  4QKD A;  3VBS C;  1SLL A;  5JAX A;  2FDI A;  4AYU A;  5JXI A;  4QQL A;  3M8L A;  3DV8 A;  3KF5 A;  3LCP A;  3MPB A;  5A3P A;  3OD4 A;  4LBO A;  4UBG A;  3W20 A;  3X29 B;  3I2J A;  1WD4 A;  1ND2 B;  4MZU A;  4JC1 A;  4NHK A;  5E6H A;  4A6O A;  4BIO A;  4BQX A;  3AYD A;  4C0B A;  3OUJ A;  2DBN A;  4XZU G;  3PUA A;  2OT7 A;  4LLO A;  4YW5 A;  4QMA A;  3ZXL A;  2VL4 A;  3EXU A;  2JDM A;  1Y7B A;  5FYI A;  3GNE A;  3LF7 A;  5FKC A;  4MLO A;  2W87 A;  3POF A;  4RS5 B;  4GXL A;  5LEJ A;  1ZA7 A;  5A7W A;  1FOD 3;  5FJH A;  1A3K A;  1NX9 A;  1Y3T A;  5A80 A;  3WQB A;  5AC9 2;  1FPN 2;  1ZRR A;  1NXM A;  3H9A A;  1JU4 A;  4ISR A;  2WRA A;  1BXH A;  1NCQ B;  3WG2 A;  2RDS A;  4AI0 A;  2GNM A;  3DPR C;  1ACC A;  1US2 A;  2OPW A;  3M2M A;  1OA2 A;  2XL9 A;  1S0E A;  2MHF A;  2P1B A;  2VMF A;  5A7O A;  3RRD A;  5FBZ A;  5BNN C;  1MVQ A;  3SEP A;  3B69 A;  1J84 A;  1AXK A;  2WAA A;  1CX4 A;  1QJU 2;  1GWK A;  1HB3 A;  1F2N A;  2AZ5 A;  1DIW A;  4LBQ D;  3HR9 A;  4IUG A;  1DU3 D;  1DDL A;  4GMP 3;  1AL2 3;  2NN8 A;  1ENX A;  1VBD 2;  2E32 A;  2W1S A;  4D6R A;  1VMJ A;  4P02 B;  2D6P A;  2Q4S A;  5DUW A;  3ZVX A;  5FZC A;  1ND2 A;  1RVF 2;  2RS1 2;  3ACG A;  3J7N A;  4C1W A;  5CAZ A;  5FZI A;  3AP7 A;  4ZS3 A;  1K5M C;  2YBP A;  4AXO A;  3GJB A;  4Y1Z A;  2JDZ A;  4S2D A;  1Y43 B;  1OOP C;  3MDP A;  2ZHL A;  2KM2 A;  1W6Q B;  5AVA A;  2PMW B;  1NYW A;  2XJU A;  5IVC A;  2IXL A;  3BVC A;  4XQW A;  3PVB B;  2I45 A;  4N8M A;  4WZF A;  5EZW A;  2GU9 A;  2R07 3;  2ZBJ A;  3IKW A;  2WS9 3;  4Q1R A;  3KMH A;  2X05 A;  2XGX A;  1H2K A;  1MZF A;  2P3J A;  4UFJ A;  4OQ9 A;  3USS A;  4A6S A;  4EE2 A;  1W28 A;  2VG9 A;  2E6V A;  1VP6 A;  3B02 A;  3SCH A;  4ZU5 A;  4Q4W 1;  1O4T A;  1RUH 3;  1R08 1;  3WNP A;  1GZW A;  2D7F A;  4CP9 A;  5GJ6 A;  1QEX A;  2VMD A;  3P6B A;  5HCH A;  4JHZ A;  1W6O B;  5JZG A;  4OHW A;  4RQP C;  3LOB A;  5C6C A;  1OLQ A;  3FLR A;  4Y5S A;  2E63 A;  5FPV A;  2XML A;  1BEV 1;  4LKD A;  5K0U C;  1AR9 2;  2H0B A;  1RIN A;  2F6B A;  4WVM A;  5FYZ A;  1MVE A;  3BGA A;  4XJ9 A;  1XSQ A;  4UW4 A;  3GAL A;  4XPV A;  3O1U A;  4UW5 A;  2HWD 3;  1DQ4 A;  3FC0 A;  2WLQ A;  3C7F A;  1H6X A;  3D82 A;  4HOO A;  3KV5 A;  1GP6 A;  3GGL A;  1AL2 1;  3S5Q A;  1C5H A;  2WO3 A;  4XF3 A;  4GB3 1;  4IER A;  4K8F A;  2GSY A;  2Z2S B;  2OS2 A;  3UJO A;  3VDD C;  1AVB A;  1HIX A;  1CWP A;  2A3W A;  4HAN A;  2WO2 A;  1MS5 A;  3IWZ A;  1ULC A;  5DPN A;  2DUQ A;  4HKL A;  2ZGO A;  5A3L A;  2VXJ A;  3GXU A;  2BQP A;  4XF4 A;  3ZO0 B;  2QQL A;  2R7E B;  4KG0 A;  5FMO S;  3GBW A;  5A3N A;  3PVN A;  3NJZ A;  5FWE A;  5BNP C;  3BPS A;  4RGA A;  2Q8C A;  4F3J A;  2FMD A;  4IXL A;  3W9A A;  4E2Q A;  2E53 A;  1FNZ A;  1I5Z A;  1OD3 A;  1QXR A;  2D98 A;  1KFU L;  1RUD 1;  3POS A;  4QKF A;  1IPK A;  2RM2 1;  4QM9 A;  2LM3 A;  3A0K A;  3VBF A;  4CPB D;  2LTN A;  1O91 A;  2RV9 A;  3WCR A;  2O1Q A;  3JQW A;  4AFA A;  3RPQ A;  3ZLI A;  4EWA A;  2OZJ A;  2OYZ A;  2DCK A;  2R1D A;  1Z78 A;  2DFC A;  5FXV A;  3VBU C;  5FPA A;  2PEL A;  2WZR 1;  3WP3 A;  5DAQ A;  3ZYB A;  1LB2 A;  1GOG A;  3ZXG A;  2BGC A;  2VZS A;  3KV4 A;  3VD4 A;  4GMP 1;  5FPB A;  2VE1 A;  3CZU A;  4WM7 C;  3E97 A;  3UET A;  4CE8 A;  4XUT A;  1UIJ A;  5LBB A;  2VW0 A;  3H42 B;  4Y4Y A;  4LPL A;  5IK4 A;  2R07 1;  2W68 A;  2FZ2 A;  2I2S A;  2DUO A;  5GZE A;  2DU0 A;  3VDA A;  1UZ0 A;  5KXB A;  5A3W A;  2IXK A;  1WLD A;  4N90 A;  1PO2 2;  4SLI A;  4AVA A;  4TLG A;  4UFM A;  1VAK A;  5A3O A;  1EUU A;  3KSC A;  1B09 A;  1HQN A;  3PMS A;  4D7Y A;  2ZEX A;  3K51 A;  4OI4 A;  1UNB A;  2D6L X;  2FDK A;  3DYM A;  1LJ7 A;  3SEE A;  4JGZ C;  1OUS A;  3POY A;  4NAO A;  2OUH A;  3WP4 A;  2KA3 A;  1BMV 2;  3I2O A;  1ULE A;  1PIV 2;  1W8U A;  3P3P A;  1KEX A;  3Q8F A;  2WNV B;  2WN3 A;  3AK0 A;  4GIQ A;  4JKM A;  3KGL A;  4NPM A;  1QNW A;  3PIJ A;  1NY7 2;  4LR4 A;  5DG1 A;  4XF1 A;  2XB6 C;  2WYS A;  3OY8 A;  2W52 A;  4KI5 M;  3ZR5 A;  1IS5 A;  1XNT A;  3PUH A;  5FYV A;  1GIC A;  2N7G A;  4EJR A;  2GC3 A;  2QCS B;  4FPK A;  2FBE A;  4LO6 B;  1IHM A;  1JZ7 A;  4FOW A;  1AYN 2;  4DS0 A;  4LHL A;  3IDA A;  4FPO B;  4OMD A;  1JYN A;  1LU1 A;  1QJY 3;  2ZGP A;  1N1T A;  2Q8O A;  2Y6L A;  1YO8 A;  3OPZ A;  1W9W A;  4AQS A;  5KHG A;  1VBE 1;  3R4U A;  5F2W A;  2HWF 3;  3LEG A;  3R6S A;  4Y1Y A;  5FO8 B;  5CNA A;  1RGS A;  3WUC A;  1W2T A;  4LXL A;  2XLF A;  2CDP A;  1E5H A;  4XXA A;  5LK5 A;  3T0B A;  4CTE A;  3WUD A;  1PVX A;  3UGG A;  2WZ8 A;  4IGO A;  5LA0 A;  2ZGT A;  1DGL A;  1GNY A;  1W8F A;  4JAA A;  4XJZ A;  1FNY A;  1QOO A;  3DYO A;  1LOB A;  4LUM A;  3VKL A;  5LBF A;  2ZGN A;  4DRR A;  1XYO A;  5FYB A;  5CEH A;  2Q30 A;  2VCC A;  4LMF A;  3VHR A;  4RA0 A;  4XTM A;  1BLZ A;  1UWW A;  1V6M A;  2IFW A;  2W46 A;  2W0X A;  1QJX 1;  4PT6 A;  3MF6 A;  2HWD 2;  1V70 A;  3LE0 A;  3MLK A;  4Q0P A;  4DO0 A;  4MV2 A;  4Q4Y 1;  1RC6 A;  3F2Z A;  3N9P A;  5T5P A;  1SMV A;  4TXW A;  3ZN4 A;  1JZ5 A;  3JBG 1;  3P5B A;  4LUL A;  1JW6 A;  2FCV A;  4LEJ A;  4A4A A;  2YB7 A;  3O1O A;  2GAU A;  3GDB A;  2DCY A;  5A7S A;  1H1I A;  4JQT A;  2VCM A;  3IAQ A;  1TVG A;  1HXS 1;  5SV5 A;  4CXY A;  4PIX A;  2LRO A;  1U5X A;  5FO7 B;  5ACA 3;  5JCT A;  3M70 A;  5DUX A;  4BK5 A;  1K5M B;  3JD7 1;  1GWM A;  4KU8 A;  4OZO A;  2WUH A;  4HPK A;  3VBF C;  5JWP A;  3RZJ A;  4CCC A;  5EYX A;  5FZ7 A;  1G86 A;  4K21 A;  1IKQ A;  2VZV A;  4MX3 A;  2ARA A;  5HXV A;  3H1W A;  5EJ3 A;  3CEW A;  1AR9 1;  1XYN A;  3V0B A;  5ERL A;  3RZL A;  4OZX A;  4K7J A;  4LKS A;  2VZP A;  1WA4 A;  3EYP A;  2VUC A;  3WX5 A;  1D0G A;  2YDE A;  5FZ8 A;  4N7U A;  3V0A B;  5A33 B;  1EYB A;  4QPG C;  1HB1 A;  2JDY A;  1VR3 A;  2EXK A;  4IEY A;  4YW4 A;  5F5A A;  4BH9 A;  5C8C B;  1NCQ C;  3T2Q A;  4XF9 A;  3SH3 A;  4XIL A;  2BFU L;  2WO1 A;  5JZG B;  3ORJ A;  3HEI A;  2RDR A;  2RJL A;  3AVR A;  1VAV A;  3K2O A;  2JE9 A;  3FN9 A;  1GZW B;  1UYP A;  3ACI A;  4CP9 B;  3ZFG A;  1LCL A;  2NZ9 A;  1SBE A;  5A1A A;  3AX4 A;  3POW A;  2YPD A;  3I59 A;  4Y22 A;  2ZX2 A;  3WW3 A;  4AG4 A;  5KXD A;  5A6X A;  1OH4 A;  1QQP 3;  5JZG C;  3AZV A;  4LO4 B;  1V6N A;  3CZJ A;  4WVM B;  4TWT A;  4YW3 A;  1I6X A;  2HKX A;  3JZV A;  1GV9 A;  2DUP A;  1UU4 A;  3ZSJ A;  4FI9 A;  1HLC A;  5C8C C;  1JZ3 A;  5AC9 3;  1MQT A;  1VB4 A;  1GYK A;  4FFF A;  1IPS A;  5E88 A;  3VBO C;  1OQE A;  3J26 N;  4W4Z A;  1GZT A;  3C8X A;  4YGD A;  4A3X A;  4W6W A;  1DBN A;  5LY2 A;  1Q8P A;  2X5I B;  5FZB A;  1H2L A;  1XNB A;  2YBK A;  3INA A;  5IAX A;  1G9F A;  2FDG A;  4R9C A;  1BCX A;  4OUL A;  3VBH C;  1URX A;  3T08 A;  5C4W A;  2QQM A;  2YGM A;  2E7A A;  4N7I A;  4AVT A;  1XU1 A;  2Q1M A;  4R9D A;  5LY1 A;  3AP4 A;  2UWA A;  2A6W A;  5FZO B;  2A75 A;  5BNQ A;  5FZD A;  2R0F A;  5K0U A;  5LWB A;  1GNH A;  4IEV A;  4Q0Q A;  4DY5 A;  3OYW A;  1BZW A;  1HRV 3;  3CMG A;  5GLZ A;  1LOD A;  4LKE A;  4F83 A;  4FSJ A;  2W3J A;  3K3O A;  4U2A A;  5APA A;  2MEV 3;  4X8N A;  3LFM A;  1RUG 2;  3OPW A;  4MSV A;  5C3O A;  3VDD A;  2GMP A;  4I0W B;  2BWC A;  4AQ6 A;  4QT6 A;  1RIT A;  3VZN A;  3OBZ A;  5B4X A;  3UKV A;  1AHS A;  1GOF A;  2Y6J A;  2OXB A;  4IEU A;  4M3C F;  1QXJ A;  3PME A;  1LUL A;  3KQR A;  4Q29 A;  3BIE A;  4N43 C;  1NY7 1;  3J8F 1;  1LOG A;  2B45 X;  1U5Y A;  1GSL A;  2HWE 1;  1SCS A;  2RM2 3;  1POV 1;  4XC9 A;  5FFO C;  3LEM A;  5A32 A;  2R30 A;  3AP6 A;  3MYX A;  5C4W C;  3LFI A;  5AC9 1;  3P1I A;  1GLH A;  2G9G A;  4QB2 A;  3L2Y A;  1YC6 1;  2D6O X;  3A22 A;  1LES A;  2JDU A;  2VZT A;  2WT1 A;  3PL0 A;  4FPL A;  5FYM A;  3KM5 A;  3AMP A;  4HET A;  4XFB A;  3IN9 A;  5HPO A;  2VQ0 A;  1RMU 1;  2VZ1 A;  3LD8 A;  1YQ6 A;  1OF4 A;  3AKQ A;  4AVC A;  2WNU B;  1RL3 A;  2BOI A;  3IMN A;  1AJK A;  1DGR N;  1LOF A;  3OYW B;  4ZU4 A;  5HBA A;  2C5D A;  5BNO C;  2A7A A;  1UPS A;  3WXP A;  1NA1 C;  2BVV A;  4AED B;  1HB4 A;  3J9S A;  3A0N A;  4KWJ A;  4TYS A;  4B1M A;  1JOD A;  3OGS A;  2VUJ A;  1JU3 A;  4LOS A;  5FPX A;  2YZ4 A;  4YFW A;  1CAW B;  2NYY A;  4YZ2 A;  4NAM A;  1XE8 A;  3LA7 A;  3PJY A;  2RE9 A;  3IPV A;  2GME A;  3BOD A;  4XTP A;  2FZ1 A;  4NRM A;  2RMU 2;  5LBC A;  2J7M A;  2ORZ A;  2VO5 A;  1WMD A;  2BFU S;  1O4Z A;  4HKO A;  1SLB A;  2LS6 A;  2WFF 3;  2ZHN A;  1DGW X;  4JTN A;  4IEX A;  5DAX A;  2G9Z A;  3ZYG A;  3UJQ A;  1TME 3;  2NQY A;  3K48 A;  1PGL 1;  3AFK A;  1YI7 A;  1PMH X;  1W8Z A;  1NZI A;  1WW5 A;  2XJP A;  2WNV C;  3OEA A;  4LBN A;  4XVH A;  5SV8 A;  3RS6 A;  5C5U A;  5I91 A;  5JOW A;  1WCS A;  3I3D A;  3VD5 A;  4IEO A;  1RUH 1;  4AAX A;  1AXY A;  3AKR A;  4LNV A;  5F5C A;  4Y1U A;  1YCI A;  2DF7 A;  4JGZ B;  1YQ5 A;  4IEP A;  2B46 X;  4GD4 A;  1XRU A;  5C9A B;  4M3C B;  5F37 A;  1LED A;  1LGC A;  3BTA A;  4OMC A;  1LOE A;  1PGS A;  1UY3 A;  3FFZ A;  1RTV A;  2XBO 3;  5ACA 1;  3NNM A;  4WM8 A;  1X7N A;  3VHN A;  2ZXQ A;  2EAK A;  4K40 A;  3VD3 A;  4E4S A;  4EWE A;  1OT5 A;  4N9I A;  2QDR A;  2NMO A;  3N9M A;  5HCF A;  3MLL A;  4B4P A;  4D0Q A;  1QY4 A;  3OBT A;  3TNP B;  5IFT A;  4LBK A;  4NOT A;  3MHZ A;  2CTV A;  2X8K A;  1N47 A;  3MLJ A;  5C8C A;  3IPV B;  5BY5 A;  2ZML A;  3BU7 A;  4JVA A;  3ST7 A;  1HRI 1;  2VUL A;  5FZ1 A;  3U4X A;  4FPH A;  4LHK A;  3OY8 B;  4AAP A;  4DZG A;  1RUF 3;  1UCX A;  2R06 3;  3J4U H;  2PHR A;  3ZFG C;  3ZPY A;  1SPP B;  5J36 A;  5EWS A;  4M4R A;  1R09 2;  1X9T A;  3GM8 A;  4EWD A;  1PNG A;  4CDX A;  4QD2 A;  3VBH A;  1PO2 1;  4IND A;  1ENS A;  2D40 A;  2K9Z A;  4LUK A;  2YY1 A;  4XJU A;  1XB9 A;  3H1M A;  4OI1 A;  1HX6 A;  2J1R A;  2WAB A;  4QAW A;  2D6N A;  4CCN A;  3FL7 A;  3KVA A;  4SBV A;  3ZKY A;  1XJA A;  2ZS6 B;  4FP3 A;  3L2H A;  1S2K A;  1PVC 1;  3AL5 A;  1O3T A;  1H2N A;  1CZT A;  4NRO A;  5A3T A;  2UWB A;  4BIF A;  2ARC A;  4P9L A;  3LPG A;  2GC0 A;  5FY0 A;  4PI0 A;  4LTA A;  3AZX A;  1VAM A;  3SNM A;  1WZX A;  1D7P M;  1QJX 3;  2PYT A;  5F6K A;  4AI8 A;  2W94 A;  4QX2 A;  4HXC A;  4AFB A;  1ZRE A;  1J58 A;  1WBF A;  4XEZ A;  5L9V A;  2R32 A;  2VMH A;  2YU1 A;  4CEW C;  1DP0 A;  1NA1 B;  4AED C;  5A1F A;  3PJQ A;  1DQ1 A;  1S0G A;  3NWK A;  2P17 A;  4Q5O A;  2A6X A;  4O9E A;  1TEI A;  1YWK A;  1D2S A;  2DCZ A;  3J7M A;  1RUJ 3;  5L19 A;  2D97 A;  4B8E A;  4DXZ A;  1HJF A;  4RR3 A;  5D21 A;  3EO6 A;  2VBB A;  1YFY A;  2RVA A;  3L9J T;  5DAV A;  2CU5 A;  1VBA 3;  4OI0 A;  3JQX A;  1T6B X;  3KGZ A;  1YYN A;  2VZR A;  3LSD A;  4XHB A;  5FMO L;  1V6K A;  2D44 A;  3I3B A;  1AZD A;  1HXS 3;  1REF A;  1W3X A;  4DIN B;  3VBU A;  3FE5 A;  4XCB A;  1HDK A;  2HWC 3;  3B01 A;  2TNF A;  1AR6 3;  1IS4 A;  1PO1 2;  3M3O A;  4Z8B A;  1RMU 2;  2WSV A;  3ZSE A;  4BXS V;  3MID A;  3WDW A;  4QQP A;  4AL9 A;  4DPN A;  4HFS A;  1ZRI A;  3MIF A;  3CO2 A;  4J25 A;  2HWC 2;  2XG3 A;  4I09 A;  4QQO A;  4PLO A;  2GH8 A;  5CKN A;  5F32 A;  1UZW A;  3RZM A;  1VRH 2;  3N35 A;  4GAL A;  4LBL A;  4UFL A;  4XUR A;  2QZ3 A;  4FFI A; 
#chains in the Genus database with same CATH homology
 2X05 A;  2PQS A;  4CUC A;  3LPF A;  5DQ0 A;  3A23 A;  3MV0 1;  3WNP A;  3ZM8 A;  2VMD A;  3U37 A;  3P6B A;  4CVU A;  2CDO A;  3FHA A;  4JHZ A;  4ZXE A;  1PX4 A;  2QQI A;  4OYU A;  5G05 L;  1RYY A;  5LCW L;  1O8P A;  4DUV A;  4XUO A;  3ABZ A;  3BGA A;  2W47 A;  4GZ9 A;  5IHR A;  3C7F A;  1H6X A;  1JZ4 A;  2VCA A;  1W99 A;  4BDV B;  2VC9 A;  3GGL A;  3C7H A;  3SKJ E;  4JX0 A;  3WNL A;  2WO3 A;  4XUP A;  2WAO A;  5C7G A;  1W0N A;  1UY2 A;  2WO2 A;  1DYO A;  4QB6 A;  2VCB A;  5DPN A;  4ZZ8 A;  3OGV A;  3GXU A;  3K4D A;  2QQL A;  2R7E B;  3W5N A;  4M4P A;  1OF3 A;  2VM9 A;  4L0P A;  2BGP A;  4UAP A;  5G04 L;  3T0A A;  4CU9 A;  1OD3 A;  3I2I A;  3HJR A;  2RV9 A;  5J1X A;  3WF0 A;  2WBK A;  2YFU A;  3T0D A;  2YG0 A;  3LQC A;  2DCK A;  3C7O A;  1K12 A;  4P5Y A;  1PX3 A;  1GOG A;  2VZS A;  3VD4 A;  2J1S A;  3CZU A;  3UET A;  3MUY 1;  4XUT A;  2VTF A;  4LPL A;  5IYY A;  2VJX A;  3VDA A;  1UZ0 A;  2C9K A;  4MGQ A;  3WF1 A;  4DXT A;  1K45 A;  1EUU A;  4CU8 A;  1CZS A;  1UXZ A;  3OG2 A;  1UY4 A;  2ZEX A;  1JYV A;  1GU3 A;  5F7U A;  2ZEW A;  3DYM A;  3SEE A;  1UMH A;  3I3E A;  3K46 A;  1UYX A;  4OUE A;  2EIB A;  1UMI A;  5IJR A;  1KEX A;  2ZEZ A;  1KGY A;  1TG7 A;  2WN3 A;  4JKM A;  4GWI A;  2WYS A;  1W9S A;  4KI5 M;  1XNT A;  3PUH A;  3ECQ A;  3NQH A;  1JZ7 A;  2C26 A;  4DXR A;  3IDA A;  4OMD A;  2W9X A;  2W1Q A;  1JYN A;  3IAP A;  3MO4 A;  4ZZ5 A;  2ID4 A;  4JKK A;  5HXM A;  2Y6L A;  2VZO A;  1W9W A;  1NUK A;  3LEG A;  3ETP A;  1WCQ A;  5LA2 A;  2CDP A;  3T0B A;  4A44 A;  2BER A;  4ZY9 A;  2WZ8 A;  1UY1 A;  1JHJ A;  5LA0 A;  3T2O A;  2KD7 A;  4PQQ A;  1JYW A;  1GNY A;  3DYO A;  5JUV A;  3A21 A;  3K77 A;  4QDS A;  2VCC A;  1UWW A;  3VD7 A;  1O8S A;  2JE8 A;  2WN2 A;  5EJZ B;  4A41 A;  2W1U A;  2W46 A;  4PT6 A;  1PMJ X;  2BBA A;  4A42 A;  3LE0 A;  1F4H A;  2J1A A;  3F2Z A;  1K42 A;  5JXG A;  2VZQ A;  4TXW A;  5EJ1 B;  1JZ5 A;  3LEK A;  4D8M A;  3NJV A;  4A4A A;  2YB7 A;  4DEQ A;  3D3A A;  1XPW A;  3GDB A;  2VZ3 A;  1GMM A;  3IAQ A;  2EID A;  1TVG A;  4MO3 M;  3THD A;  4BK5 A;  3VDC A;  4OZO A;  3MUZ 1;  3WF4 A;  2WUH A;  3ACH A;  2V72 A;  3HOB A;  2QQK A;  2XQX A;  4PF1 A;  3OEB A;  2QQJ A;  2Y8K A;  4CU7 A;  4A45 A;  2J1E A;  2VZV A;  4ET7 A;  2QQO A;  1I5P A;  1CZV A;  1R64 A;  1CX1 A;  4LKS A;  2VZP A;  3K4A A;  3EYP A;  3HN3 A;  4DUW A;  2XOM A;  2J1T A;  3T09 A;  1K3I A;  4QB1 A;  3WF2 A;  2E33 A;  5JR2 A;  4CUA A;  2VR4 A;  3T2Q A;  3CIH A;  2EIE A;  2V5D A;  2WO1 A;  2Y64 A;  1JZ6 A;  2VQT A;  4TTG A;  3MV1 1;  2W95 A;  3HEI A;  2ORX A;  4W8J A;  3OBA A;  1H6Y A;  4W50 A;  3FN9 A;  4QDR A;  3ACI A;  5A1A A;  2VZU A;  1XC6 A;  1WKY A;  4GWJ A;  3DEC A;  5C70 A;  3NRU A;  5DMY A;  4AG4 A;  3JXS A;  3NJX A;  1OH4 A;  2DDU A;  1J83 A;  3HNY M;  3CKH A;  4UI9 L;  1UXX X;  3CZJ A;  3J7H A;  4E8D A;  1GUI A;  4QX0 A;  4MAD A;  1JZ3 A;  4FI9 A;  1SDD B;  4UOJ A;  2EIC A;  4KMQ A;  2C4X A;  4W4Z A;  3C8X A;  2W91 A;  1GQP A;  1XNA A;  1UYZ A;  3VDB A;  1CIY A;  2JKX A;  3CDZ B;  1T2X A;  3T08 A;  2QQM A;  2BZD A;  1L7R A;  4QX1 A;  3WNN A;  1SHW B;  3UNP A;  1P8J A;  4XUN A;  3W5M A;  1F4A A;  5DN2 A;  3PUI A;  4QDQ A;  1JYX A;  1NKG A;  3CMG A;  2XHN A;  4ARX A;  2W3J A;  1LNS A;  2L9L A;  4Z2A A;  2Z4F A;  3C7G A;  4BK4 A;  5B4X A;  3III A;  2HLE A;  5JMO A;  4RN5 A;  2VOT A;  1GOF A;  4DUX A;  2Y6J A;  3I2K A;  1O59 A;  2VME A;  4YPJ A;  4CU6 A;  3I2H A;  3WSO A;  2W92 A;  2RJ2 A;  2VQU A;  3BN6 A;  2X10 A;  2J1U A;  2BGO A;  3P1I A;  4QB2 A;  3A22 A;  2VZT A;  3WF3 A;  2WDB A;  1UY0 A;  5HPO A;  2VZ1 A;  1OF4 A;  3ACF A;  2Y6G A;  3NNG A;  1UX7 A;  3EB7 A;  1JZ8 A;  2J1V A;  3MBW A;  1US3 A;  5EIY B;  5JXJ A;  2B4K A;  4CUB A;  3AC0 A;  5JXH A;  1W9T A;  4LQR A;  4MGS A;  1ULO A;  2X09 A;  3OGS A;  1JU3 A;  2B9V A;  5IFP A;  2Y6H A;  3LEI A;  4P00 B;  3SKV A;  2J7M A;  2ORZ A;  1IQD C;  2VO5 A;  2LS6 A;  3THC A;  1W8O A;  3FHQ A;  4ARY A;  2VMC A;  1PMH X;  2YC4 A;  4A3Z A;  3OEA A;  1ULP A;  3WNO A;  4XVH A;  3K4Z A;  3I3D A;  3VD5 A;  3T2P A;  4AAX A;  2JDA A;  2W5F A;  1BHG A;  3UES A;  2ZEY A;  4DEV A;  2YFZ A;  1UYY A;  3K75 B;  4OMC A;  1UY3 A;  1JI6 A;  2Y6K A;  2ZXQ A;  3DYP A;  3IB3 A;  3VD3 A;  1OT5 A;  1MPX A;  4MOA A;  4D0Q A;  3HPN A;  5IFT A;  4DXS A;  4KWU A;  2QBX A;  5B4N A;  5LA1 A;  4P08 A;  3WEZ A;  3E1F 1;  3C7E A;  2XON A;  3VD9 A;  1L7Q A;  4RYD A;  5CYY A;  5C71 A;  4QPW A;  4M4R A;  3GM8 A;  2WQ8 A;  4E8C A;  2J22 A;  2DCJ A;  3I2F A;  2J1R A;  4QAW A;  2WAB A;  5JXI A;  3WNM A;  3FL7 A;  2W1W A;  4LHS A;  3CQO A;  3I2J A;  4A6O A;  3OB8 A;  4XZU G;  1CZT A;  2VL4 A;  4QX3 A;  1SG3 A;  5CZK A;  3LPG A;  2W87 A;  1D7P M;  1NX9 A;  3OGR A;  3WQB A;  2W94 A;  4QX2 A;  2JD9 A;  1JU4 A;  3A7Q A;  1GOH A;  1HN1 A;  1NAE A;  1DP0 A;  1W8N A;  2HYX A;  1US2 A;  2VMF A;  2LW8 A;  1YQ2 A;  3SEP A;  1J84 A;  5I0D A;  2RVA A;  1JZ2 A;  3I2G A;  2WAA A;  4JKL A;  2VZR A;  2OKX A;  3I3B A;  4IUG A;  3WNK A;  4HG6 B;  4BJ0 A;  1EUT A;  2E32 A;  2W1S A;  4P02 B;  5FUI A;  3ACG A;  2YC2 A;  2WZE A;  4BXS V;  2QQN A;  4XUQ A;  3HNB M;  2E31 A;  2V4V A;  2E26 A;  3HNM A;  1DLC A;  4XUR A;  3I97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...