3THPA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
333
structure length
304
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVRRVKHFGYKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASEKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB homolog 8
total genus 57
structure length 304
sequence length 333
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thpA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thpA01
4QQBA 4Y00A 2DO4A 2MY7A 2DHAA 2MZSA 4FXVA 2MKJA 2CQCA 3SMZA 1YTYA 2O3DA 3VAKA 5D77A 2MKIA 2X1GA 3HI9A 3CUNA 1IQTA 2BZ2A 3OW2R 1H2VZ 2LA4A 1WEXA 5LSOA 3US5A 2K3KA 1YIJS 5EN1A 1VQ9S 4W92B 1VQOS 5ITHA 2MKKA 1SJFA 4M5DB 1JJHA 2DGVA 3MOJB 1K8AT 1ZZFA 3K0JA 1KOHA 3CC7S 1ZH5A 2N82B 2J8AA 1JMTA 3SDEA 1YWXA 2CPDA 3CD6S 1WG1A 4UY8T 4IOAQ 1VQ7S 3SDEB 1WEZA 2E5JA 4F26A 5GAGU 1WF2A 2KYXA 2MZJA 1U6BA 4C4WA 4FXWA 4WFNQ 2NZ4A 4TU8A 1AUDA 3V4MA 4ED5A 3MUTP 2MHNA 3MDFA 2MQNA 2OJ3A 1X5TA 2HGLA 2JWNA 3CCUS 4IO9Q 1X5SA 2DNOA 3UD4P 5DDRC 2CPXA 4OZ0A 1HL6A 1SJQA 1NU4A 1HA1A 4QU7A 5IM0A 3CCJS 2M88A 1U1RA 2LEAA 2MSSA 2I2YA 4F25A 1JJ4A 5HO4A 2MXYA 4LMZA 1X4DA 2DGXA 1VBYA 1P27B 2GHPA 1YITS 2ERRA 1FJEB 2VOPA 4TU7A 3DXBA 1M1KT 1X5PA 1FJ7A 1FO1A 2I38A 2CQGA 5H1SV 5LJ3Y 3ULHA 2CQPA 2CPJA 2KFYA 3G8SA 3S8SA 3P6YC 2DK2A 3THPA 2AD9A 1OPIA 2F9JA 3ZZYA 3CCVS 2M52A 1X4GA 1Q81T 2CPIA 2CQIA 5GMKa 3TP2A 3FEXB 2DHXA 3BO4A 1WF1A 2OSRA 1P1TA 3BEGB 3P49B 1G2EA 2KRRA 2X1FA 1VC5A 2DB1A 2LCWA 2MJUA 2M8DB 1KOOA 2EVZA 1YHQS 2CQ4A 1U6FA 1U1MA 3BO3A 4EGLA 2MGZA 3B4MA 3CF5Q 5MLCV 1WI6A 3R1HA 1UFWA 2KXNB 1PO6A 2J0SD 3BS9A 1KD1T 2QFJA 2ZJRQ 3HHNB 1X4AA 4YUDA 1U1LA 2CQ2A 4IUFA 5IM0B 3N9UC 4PR6A 2DIUA 1OWXA 2CPEA 4WIIA 1VBXA 4WKRA 4TLQA 2FY1A 3CMAS 3CCRS 2DGSA 5D78A 2D9OA 2KG0A 2CQHA 3J7YU 4WFBQ 2KH9A 1A9NB 1S79A 1RKJA 2LEBA 1YI2S 2DNMA 2HVZA 5GVQA 2MY8A 5DM7Q 3UCZP 2KRBA 2LXUA 3H2UB 1DRZA 4UQTA 2MQQA 2DGWA 4U67Q 3J7ZT 1WHWA 2LECA 2J0QD 3VAHA 1DBDA 2DNQA 2KN4A 2XS2A 2U2FA 3UE2A 1X4EA 2LMIA 4C0OC 2FPHX 3FEYB 3VALA 1R8HA 2DITA 1WTBA 1YJNS 2SXLA 2RQCA 5LSLA 2F9DA 1NO8A 2DGTA 4LJMA 2AYMA 3VAIA 3NS6A 5DDPC 4Y0FA 2X1AA 2XB2D 5LJ5Y 3BO2A 2RU3A 3CCQS 5IFMA 1KC8T 2JRSA 2M4MA 1X0FA 2CPFA 2QA4S 1WELA 1VQPS 2YKAA 5LXYA 3EX7B 2DNRA 3LPYA 4WCEQ 2RS8A 3CCMS 2DNLA 2L41A 2KT5A 2ZJQQ 1FHTA 1VQKS 2KXFA 4ZKAA 2HYIB 2CQ1A 4PKDB 2DNHA 4LIRA 1QVGR 4QU6A 2MSTA 4CIOA 1F9FA 1DZ5A 4RU2A 1UW4A 2RQ4A 2FC8A 3Q2SC 2MZTA 3R1LA 1BY9A 2XS7A 1YJWS 2JVOA 2N3LA 5DM6Q 1FXLA 2MZQA 3G8TA 2CJKA 3R27A 2LKZA 1FT8A 2PEHA 3CC4S 2RUGA 1N8RT 1X4CA 2G1DA 4CQ1A 1H2TZ 1UP1A 2MB0B 3CMES 5IQQA 3UCGA 1RK8A 1ZZNA 2G0CA 1WHXA 4IOCQ 2RRBA 2VOOA 3PIOQ 3VAFA 2OIHA 3CTRA 3PIPQ 2KM8C 2MJNA 2OTLS 1X4FA 2MZ1A 4ERDA 1VQ6S 2CPHA 3TO8A 1VC6A 2BOPA 3MD1A 3Q2TC 2MQOA 3NNAA 2DHSA 2JX2A 1S72S 2QEXS 1XN9A 1NJIT 1HD0A 2MKCA 1VBZA 1JJ2R 4W90B 2HGMA 5HL7Q 3G6ES 2MMYA 3LQVA 2J76E 2LYVA 4WF9Q 3G9CA 4PRFA 1K73T 2JVRA 2G4BA 3NNCA 3G4SS 4J5OA 2AYGA 2CQ3A 5BJRA 2DNYA 1OO0B 3S01A 2E5GA 3RW7A 4OZ1A 1VQLS 2MPUA 2DNKA 1M5PC 1CVJA 3UCUP 2N7CA 2CQ0A 1Q7YT 3CCSS 1WF0A 4CH1A 1VQNS 2FHOB 1VQ4S 3UWTA 4P6QA 3CXCR 4C7QA 1QVFR 3U1MA 5DETA 1N52B 2KXHA 2NLWA 5DDOC 1U1NA 2HZCA 5GAEU 2MZRA 3CCES 1VQ8S 2DH8A 1FJCA 2MKHA 2YWKA 5CYJA 3TYTA 2CQBA 1U1OA 2YH1A 2M7SA 4A8XA 3S6EA 3B4DA 1WI8A 2KM8B 2ADBA 2KG1A 1SJRA 3CC2S 1VC0A 3MI7X 2EK1A 4QPTA 1U2FA 1A7GE 3VAJA 2RT3A 1WWHA 2E5HA 1VQ5S 2ADCA 4F02A 2DNPA 1R8PA 1W2BR 2OTJS 2LA6A 3EGZA 2KU7A 2MYFA 1PGZA 1U1QA 1U1KA 1URNA 2VODA 4YOEA 3P5TL 2DNGA 3G71S 2DGQA 1D9AA 2M9KA 1M5VC 2M0GB 1Q86T 2F3JA 3G96A 2RS2A 5JVGQ 5DDQC 2PE8A 3VAMA 2DHGA 2Q79A 2DIVA 2OSQA 2AYEA 1M5KC 1B7FA 5JVHQ 2KVIA 5CXTA 1QM9A 2E44A 4V19X 1N88A 3U1LA 1O0PA 1L3KA 2CPZA 3I56S 3JB9k 3MD3A 3L3CA 1WHVA 1X4BA 2MQMA 3MUMP 1M90T 2YTCA 1K9MT 1DHMA 3NMRA 2U1AA 2LQ5A 2RVJA 1X5OA 1D8ZA 4Z2XA 2D9PA 2K8GA 3UD3P 1X4HA 2MQPA 3CPWR 2DGUA 2E5IA 1UAWA 1KQSR 4WFAQ 4BS2A 1VQMS 2YH0A 1SJ4P 3D2WA 2L08A 4CH0S 1N54B 2DISA 3THTA 2XNRA 2A3JA 2XS5A 5GAHU 1U1PA 2KHCA 2XSFA 2CPYA 3CCLS 5GADU 4YB1P 2MGZB 1WEYA 2FC9A 2M8HA 3NS5A 1H6KX 3EGNA 4TU9A 2XNQA 2MKSA 2RNEA 3VAGA 2CQDA 3SXLA 3ZZZA 2DH7A 2AYBA 5CA5A 2N3OA 1WG4A 2M70A 3MURP 2D3OR 3DLLQ 3S7RA 3VF0B 1H2UX 2RRAA 1OIAA 1WHYA 2DH9A 2DO0A 2M2BA 2ZJPQ 1Q82T 1FNXH 1M5OC 2UP1A 2VONA 3I55S 2LXIA 2HGNA 2MQLA 3CULA 2DNZA 2L9WA 3MXHP 3P3DA 1YJ9S 3MUVP 3IWNC 5FJ4A 2WBRA 5LXRA 2V94A 2B0GA 2DGOA 3IRWP 2X1BA 3RW6A 3H2VE 2EK6A 1HD1A 1SJ3P 2DNNA 2GO9A 1WG5A 2KI2A 3NNHA 1SXLA
chains in the Genus database with same CATH superfamily
2ZEZA 4LIWA 3M3IA 3MV01 1RE1B 3KHBA 1HQWA 2E1RA 4I64A 3QZ8A 2RDJA 1NG0A 2P6SA 1IS3A 1IQTA 3Q8CA 2ADDA 2XJTA 1SL0A 4AWDA 2NPIA 1FFSB 1EPZA 1RTIB 1Z2ZA 1RI7A 4ARXA 5ITHA 2MKKA 2V09A 2YYOA 4HBNA 1S49A 4FN5A 2WLQA 3U11A 1BMQB 4QPXA 5JJBA 1PO11 5A1AA 3MW4A 5F2WA 2DCJA 3MW2A 1SC3B 2O1QA 4UBGA 2GVZA 2HHWA 3WCRA 4EN7B 5JMOA 4C0BA 4XO0A 4YZ1A 2FZGB 5K8MA 2EAKA 1HQNA 5AE1A 4NXMF 4NJ4A 2RM21 1NHVA 1UAIA 4RW8B 2NXJA 3W5YA 3FFZA 4GB33 1UNBA 2ZEWA 3HNBM 3OUYA 1ASJ3 2HWE3 4OZ0A 4MYEA 3RR8A 3VZMA 5HBMB 2PQQA 4FYYB 4CCNA 2BE2B 3Q8VA 5IM0A 4AG4A 1VRTA 5D4LA 3TUPA 2W52A 2YQ1A 2I45A 1R083 4Q4V3 4AUKA 3RPQA 4USIA 1X4DA 4H2AA 1UVJA 1AX1A 1TNRA 2GHPA 1DYPA 2VOPA 1GLHA 4BM8A 1J84A 3MUZ1 4AEDC 1D09B 1FO1A 1N48A 2BUNA 5LEKA 1VALA 4FS2A 3NJYA 6AT1B 3ZO7A 1LCLA 2Q8DA 4ZOSA 2OP5A 2F9JA 3N7KA 1PC4A 2PXJA 5HCAA 4AHXA 4DB5A 4YG3A 1WF1A 3TX0A 3RZZA 3TEHB 3D4KA 1WDDA 4F67A 1YXWA 4EYUA 3NNJA 4QPYA 2WNOA 1R1A2 2P9EA 4PYDA 3LOUA 2PAEA 2XMWA 4PDWC 2HHHJ 2A3XA 4BE3A 1S0OA 5KHHA 1CD3G 4DRRA 1GXTA 4IGPA 3RB0A 5L9RA 1N3QA 4MYTA 4HSJA 4AZZA 2LS6A 4PYAA 3PZPA 3EQEA 3AKRA 2C9AA 4DOUA 4XJ8A 4E9KA 2D9OA 1NYWA 2ERFA 5FZ9A 5C5TA 1ZVFA 2E6VA 2AGQA 3GV5B 2A0FB 3E97A 1S79A 4CDQA 3KD4A 3HNYM 1ZBA1 1JKHB 1UYYA 1W04A 2IPOB 1NKBA 5C5JA 2FDKA 2W1QA 1SCJB 4LF5J 2WHOA 4USVA 3SEEA 2VB6A 5CCLA 4HONA 2BM1A 3GYGA 3F2ZA 4G9SB 2IVMA 1SV5B 3D3AA 3C16A 1GR3A 1GH8A 3RTVA 1WTBA 4URSA 3JXSA 1FV2A 5MAOA 3SQOP 2EG1A 4RSUA 1B0PA 2B51A 5LBFA 4IEXA 4KV8A 3UKTA 4YVWA 1PBAA 3M8RA 1OKQA 3IB3A 3IG1B 4KKOA 4ZA1A 4TN7A 1TEIA 4M94A 3EICA 3A1YG 3S6PA 2TNFA 1LKZA 2E1CA 2M4MA 4KRWA 2YKAA 3KNGA 3GG1A 3OR1B 4QPWA 4JC1A 5E3QA 1C57A 3LPYA 1LW0B 2F1FA 1PVC1 1S0FA 2H5EA 2ZKUA 4MJKA 2KXFA 4Y24A 4QZVB 4CI0B 5A3UA 4UFJA 3KK2B 2B5JA 2XSJB 5FAXA 3S0MA 1G7YA 3MEPA 4XDQA 4RL7A 3HHKA 2QBXA 1BBT2 4OHXA 5ETQA 4DV4J 1TKDA 3RJRA 4ASMB 3R1LA 4J9SA 5FP7A 5FOJB 3LDBA 3JQJA 4MGIE 3QT7A 3Q9OA 5GLTA 5C3RA 5K9YA 3NJZA 2MB0B 2WWJA 1H30A 2HVHA 3I2FA 1M0SA 5DO2A 4QPGC 2Y9HA 4X2BA 3DPRC 1GXLA 5BNOB 2BOJA 3I97A 5T54A 4DUZF 1U49A 2VR4A 1LULA 3TO8A 1H9PA 5ETKA 1RHRB 3LH2S 3MEEB 1RTVA 2CNOB 1OQ1A 2HS3A 2W9CB 1QXPA 1VBC2 1XN9A 2NPFA 2UUWA 1VBZA 2R071 4JGZC 3GFXA 4FPCA 1AT1B 3W2VB 2YQ3A 2HS0A 3W66A 4QX7A 1S6PB 2MHEA 4I0WA 4I6AA 2PAKA 3ZSJA 2YX4A 2PIIA 1S2KA 2Y0OA 1LV5A 3OV7A 1WD4A 4P7VA 4P9SA 1OBNA 5DZEA 1IBKJ 3DXUA 1NK8A 3HHLA 2G9GA 4QX5A 5AFBA 2DVIA 5BNNB 2FHOB 3MPWA 1XNRJ 3QO9A 4PLNA 1C8M2 3JSBA 1YVFA 4GVLA 4LKDA 1BBT3 2V72A 2HWTA 2NLWA 4CDXC 2HEYF 5F5IA 2JE8A 4K40A 3VV2B 4X6RB 1EETB 4CLPA 4K20A 5T41A 2XBO3 1CC8A 2M7SA 5EV7A 2G19A 2RF2B 3UL2A 1B7YB 1OFSA 4DV3J 1MQTC 4PXBA 5FMBA 4UOCA 5JWPA 1TKZA 4ZHRA 2QA2A 4FFHA 4HFSA 4IRKA 4YOEA 4QKBA 5F8MA 3ISNC 1O8BA 3IIAA 4B9TA 1N0UA 2Q1LA 2F3JA 1GT8A 1YNAA 1CN1A 5J2MB 2RE9A 4I1TA 1PC5A 4BU2A 2YNHA 1ZNPA 4AK3A 2O5DA 4QDRA 1OPMA 1BE4A 5JSPA 2LXFA 3I56S 4LKEA 5F41A 2V4QA 1ZA1B 4PF1A 3MBWA 4CLLA 1Q8KA 2GJFA 3FBFA 3I0SB 4RN5A 2GC3A 4CDUB 1OSGA 2IDEA 2MQPA 3NV3A 4GA9A 1CAWA 1XE7A 5A6PA 2B8MA 2Q66A 2FD8A 1OUXA 1N54B 2VTXA 2DISA 3THTA 3MMAB 2UUBF 2XWBB 3HO1A 2NMOA 4DR7J 4Q5OA 1T94A 4ZCIA 2UVUA 1AA1B 1I51B 4BC9A 2GVDA 1QH6A 3UNPA 4UFLA 3CCLS 4AXIA 3SNMA 4N7TA 3NAPB 1P1LA 5FP8A 5FQ0B 3OR2A 1SPPB 4YGBA 5I0SA 3WDOA 1HWJA 2WVCA 3KK2A 2Q43A 5DUXA 5JZGB 3QD6A 3AODA 5FUPA 4YZ3A 1UVKA 4AFBA 1OIAA 5CQGA 1RHI1 1FRMA 3R5BA 1OH4A 3IWNC 3W63A 5FJ4A 1H2KA 4M5JA 3H2VE 5ISLA 2P5VA 2PHFA 4XUQA 4DV1J 1GAOA 5J1PA 5KFBA 3T5KA 1RU1A 4XMIA 4GVBA 2Q3PA 1EYBA 1W8FA 3FFIA 1DQ2A 1RB8G 4HHJA 2MZSA 4GMP0 4P00B 1Q5YA 2B43A 3I8TA 5FIIA 1S9FA 3P3NA 5EIYB 3GJQB 3QT5A 2LA4A 3CJSA 3BVCA 4L97A 3DRSA 4UTGA 3MM9A 4NVPA 2ZJCA 3PYDA 1YQCA 3VD5A 3ZC4A 1HW9A 4RW7B 1DGRN 1AR62 1TL1A 2W7AA 2YFZA 1UY1A 1AR92 1DTQA 4CCOA 1CIWA 4X4PA 1QNWA 3KDNA 4JRLA 2G2YA 2O67A 3H98A 4TN2A 2AEJA 3DPRA 3ZO0B 3MHYA 2OPPB 3IP0A 4M5GA 1DAXA 5C70A 1Y3JA 4FPGA 1NSKL 3W5ZA 1O8SA 4M5IA 2VMCA 4DUTA 1BJQA 4M3CE 4M5DA 1TP7A 1WW5A 2R9LA 2GSYA 2B39A 3H8XA 2GV1A 3LGMA 1LGNA 5HP1B 2JH3A 1HKDA 4HOOA 1XWLA 3V64A 3A21A 4NPRA 1DQ4A 3C7OA 4TXWA 5A3NA 1S6UA 2CTVA 3ET6A 1M1GA 2YFUA 5BYNA 1B0TA 1XTZA 3AKSA 3ZYHA 5J2PB 5ACA3 2Z5WA 2LP4A 4KQZA 2AZ1A 3RRDA 4XIUA 4CDWA 2F5GA 3TX8A 4AL7A 4QX1A 4RUBA 4Y2CA 4HKLA 3MIDA 4XZPA 2FJVA 2QJ3A 5LJ3Y 4K59A 3MWBA 2CQPA 4PHZA 1V9OA 2CPJA 1Y0HA 3HEIA 2LUWA 1DG6A 1ND3B 2JEFA 5DXDA 3H90A 3THPA 4FQZA 2VJVA 4HXCA 2CQIA 1IM6A 5C42A 1Y7BA 2UXDF 3WG3A 3POTA 4HACB 4Y22B 2ZH3A 2JOQA 5LOQA 1T95A 2BMBA 2CDOA 5E8AA 2WYSA 2X1FA 2BW2A 3G82B 1AX0A 1QF3A 1VMJA 1RWUA 2LCWA 3O1RA 2ROEA 1UMHA 2R1BA 3AXEA 1NCQB 2V69A 1UF2C 2EALA 1JTZX 1Z7S3 3W64A 5HQ8A 1PO6A 3TNQA 4L9BA 3ZDSA 4C91A 2CQ2A 3N9UC 3ZPOA 2ZUAA 4NPMA 3DF0A 4QX0A 4WKRA 1ELOA 4MZUA 1XYNA 1NQJA 5K0UB 4NLQA 3EDRB 5C24B 3MGUA 2G9OA 3B7MA 3OTEA 3C16B 3EBRA 3FBMA 3UGFA 1VPHA 2LEBA 1UVIA 2D69A 2DNMA 3B01A 4C48A 4TQSA 2VULA 1HNIA 4I09A 3SH5A 2NYIA 4EQVA 4OX8A 4M1KA 4I30A 4OZ5A 2KHDA 2VQEF 1XQNA 1PAEX 2Z2ZA 3VAHA 3PJWA 3RSJA 2RU9A 4K4VA 2YC4A 5FWJA 4J7CA 4DL2A 4LA2A 4CDXB 1RTIA 3DOMB 2YBSA 2YZ4A 1GQEA 2DTYA 3NGDA 5FDLB 4EZ9A 4DFSA 2QFEA 5L7OC 5LSLA 5A80A 1FVSA 1RXGA 5FDBA 2QE3A 4X4NA 3WNXA 1W9SA 1XPWA 2QMWA 1S0VA 5CIRA 1N33J 3AMQA 3KLFB 4HKWA 1SQGA 5E6HA 2Q4SA 2WFPA 4XHXA 1AUSL 5CU1A 3O1SA 1NHKL 1FKOB 3QAEA 2K2PA 1C5IA 4U6PA 4F8AA 3OD0A 2PTMA 4Y1YA 1AUYA 2YKMB 3LP1B 4ZVSB 2RS8A 4CUBA 3H42B 1CS4A 2RD5C 3NGUA 4W6YA 3LEKA 4PXDA 1MWYA 3MLKA 2WWSA 3ZYIB 1ACMB 1DZRA 1RUD1 2DCZA 2Q30A 4P74A 2JHEA 2EICA 4X8PA 5L7OB 2CJQA 4IDZA 3HVAA 2AGPA 5IK7A 1F9FA 5JXIA 2OQ6A 3JAMU 3GV7B 5FZIA 4LFBJ 3ECQA 5FOBB 5HAOA 2JEIA 4GULA 3KT4A 2MZTA 7FDRA 4YGCA 3T5HA 3GZUC 1RUI1 3JTPA 4GO5X 3DN7A 2YDEA 3VBFA 2KR2A 2O0OA 2QGFB 2AGSA 4OZ2A 2JXAA 2W01A 5A7WB 4XAKA 5C3QA 1M06G 1LXNA 2B45X 2YC0A 4XJWA 3I5BA 1Q8LA 3ZXAC 1WCUA 1J83A 3BZQA 5F3TA 2XCAA 2VQFF 1CJTA 2BOAA 2G0CA 4YFZA 4CO2A 4YHHF 1ZZCA 4FPIA 2E9ZA 1VQ6S 1YUDA 1VC6A 4Q1PA 4CRJA 4WU2A 4O44A 2JX2A 4MK8A 1C0TB 8ATCB 1V6JA 3N79A 1SL2A 2FYXA 1TAQA 5IS2A 3AZXA 3E2EA 1NH8A 2K7JA 1BQNA 4NCGB 3WX8A 3Q8SB 1QE1A 2Y1JA 2HWC1 3ZYBA 3LQCA 2VCBA 2LDIA 5IJRA 2HWIA 1S1UA 4IG0A 5FZ6A 3G6XA 3ILNA 1C5HA 3OL6A 2DU1A 3J7YI 2W8KA 2IWGB 1GP6A 5C42B 5T3NA 3M2RB 3LF0A 3TQ1A 3DEMA 1UCNA 1PNFA 4JTOA 1V00A 4Q4W3 2AIRB 5T14A 4OHWA 4PG6A 2HNYB 3CXCR 4ED8A 3VZIA 2BE7D 1WCSA 4GKJF 4ZVOB 2Q1MA 2PHXA 1CJVA 3ILRA 1U1NA 2KO1A 5KFPA 3UETA 1SLAA 1XE0A 5HVHA 3WW4A 1YRZA 3POJA 3IG1A 1Y9QA 1MZ6A 2YH1A 2HHTA 4QGLA 4BXFA 3J7HA 3TNPB 3NNMA 2P2KA 2N4DA 2VQFJ 1F6TA 5A33A 3WP6A 1URXA 3VAJA 3AKQA 2FTRA 1B09A 2D7SA 4RQPB 3EVMA 3E6DA 5CNAA 1GMWA 2JB8A 1XMQF 3O1MA 1RT6B 5KFYA 2GU9A 5BXXA 4BQ3A 5ETTA 1PGSA 2PE8A 4NPOA 3UPFA 2V4RA 2W24A 4BCAA 2BJ8A 4ZN3A 3N9NA 2EG2A 3LEMA 5JVHQ 1QM9A 2E44A 3VHOA 3SKVA 4FPLA 1T8EA 3L09A 4OYXA 1AF9A 1X9WA 2RKIA 2HRUA 3JB9k 1WHVA 4NL5A 5AXKA 3W8GA 1AR83 3VHPA 5FPAA 2ZZNA 1SBFA 2LQ5A 2HIYA 4GIQA 1RUNA 3M6VA 4JOUA 4FTSA 2V68A 1FMD3 3SEPA 2L08A 3AMPA 1AYM1 2OEKA 2WS93 4K3UA 1Z2LA 5IAXA 3GIJA 4ZVUB 1W3VA 3QZ7A 5F8PA 2KHCA 4BWJA 2BWAA 4NZ7A 4K0KF 5HATA 3M6WA 4OYMA 2W46A 4JI7F 4AEJA 3PNAA 5EYXA 2PHLA 4H55A 3MMCA 3NSTA 1CAUA 1RUE1 3NP5A 4QMAA 3ZFGC 1GZCA 1AL22 3E3XA 3SSSA 1V6NA 3MM8B 3M70A 4AYUA 1KFSA 1M5OC 1MS0A 3GR1A 1HKAA 3ZVXA 5IYYA 3ZSEA 2E7QA 4K9SA 2V8DA 3GSIA 3MM7A 2C2DA 5FZDA 2ZHKA 4XTTA 1SJ3P 3C3VA 1WG5A 4ZMMA 5U47A 1QJY2 1WMFA 3RBDA 2DO4A 4KB7A 1DQ1A 4JKMA 1AFJA 7FD1A 3WDTA 4F0KA 2X1GA 2DVAA 1X9MA 1WEXA 1SH0A 3NNLA 1HYSA 2UWAA 2EC0A 3D0GE 1BGXT 4YLZA 4EBCA 2JJ4D 2C1FA 3V6DB 3K4DA 2ZH2A 5F8LA 3BPDA 1UJ6A 4USKA 1T6BX 2QQKA 5FTTC 2RS52 2BNMA 4IYQA 3NCQA 4S0MA 1J5OA 2RS12 3KMQA 4BJ0A 4KHRA 3PIJA 2HFVA 3V6JA 5DDJ1 2UVWA 4EK2A 1GP5A 4UFHA 4EYIB 1N5YB 2XJVA 1JZ4A 1H7XA 2CPXA 3AXMA 2B4UA 1NU4A 1HRV1 3IGNA 2D5FA 3LP2A 1NSPA 1DGLA 1TUWA 2WO2A 3ACHA 5EPAA 2QQWA 1CJDA 4LF9J 1U26A 2HWB1 2WNVB 5HO4A 3MR5A 2ZKLA 2I2SA 3V0BB 5FUNA 4HVQA 3G87A 3GDBA 3OD2A 2YV8A 3R0RA 1O3QA 1R092 3G8SA 2R7SA 4Q0UA 1DURA 2LQBA 1W7WA 2ZGSA 4JQTA 4RFT0 3OL9A 1EQMA 2NQYA 5GMKa 2DRAA 2B6AB 1AVBA 2R7WA 1M5HA 5BR8J 4PG7A 2PLV2 1OQ6A 3ZNUA 5HXMA 5G04L 5C7PA 4JI0F 3VL9A 2VOXA 3F56A 2B4VA 4ISQA 2M8DB 2QN6B 5FKCA 5KFLA 4W65A 1AR82 3HQUA 3R1HA 3ZM8A 1FE0A 4QGNA 4K2JA 3HHNB 3H40A 3BN6A 1FDDA 5HQLA 5IM0B 1KD7A 4QR0A 4K1YA 2ZC4A 3KJVB 5F6LB 1YJVA 1D4M2 2DXEA 4I2QA 2RDNA 2EW9A 2ILYA 4CZCA 1VR6A 2NM1A 1KDNA 5I3UA 1P8JA 1NLKL 2C3UA 2P9CA 3E8OA 5FYHA 5IVCA 1RAFB 3C2UA 5A7QA 3WC0A 2KRBA 3M8QB 2ZABA 3WLUA 1GU3A 4O3QA 1FMD2 3NGRA 1PO21 2GAHC 2Y0IA 3I3BA 4XIOA 2XCPA 4F4KA 1DQ9A 1NLSA 4K21A 4O9GA 2KN4A 4ANCA 4DCOB 4EFAC 1PZ8A 2JLFA 2RAQA 3NNGA 3FGVA 4QB2A 4GJYA 1XB9A 2MLYA 1UCXA 4TY9A 3SIPB 1DLLA 3ACGA 3NS6A 5DDPC 2ZGQA 1SFPA 3M2VA 3I3QA 3MHZA 1H9WA 4HK8A 4DV0J 1EV12 2HMIB 4MVTA 2WB1D 1FOD1 4CP0A 3M8YA 3KVAA 4Q43A 1DFDA 5JZGC 1ZBA3 4OYBA 2ARXA 1JLBB 4C8KA 2ZBRA 2W9XA 1QJEA 1SEFA 3AVRA 4ONUA 2ZJQQ 4JGZB 5LY1A 1ND2B 2H3EB 2OVUA 1FT9A 5ETLA 4GKKF 4EROA 1QSSA 5A7NA 4N41A 2H1YA 4KO0A 2A6XA 4S2HA 4X4TA 3IWXA 1OA4A 5F1RA 4X66J 3EMRA 1W6NA 3QIPA 5T5OA 4XMAA 2FJBB 1W8OA 4LULA 4RBTA 3DLHA 1L7LA 3NRBA 5KG4A 1D2QA 4Z92B 3QFWA 2QZ2A 2PA8D 2ZITA 4URQU 3D68A 3HT1A 4RLEA 4DQSA 1S1XA 2EFGA 3HXMA 1AZDA 3IWLA 4DQRA 4URTA 2RUGA 1X4CA 5FREA 3BGRA 3H4BA 1V9U3 2IXKA 2D93A 2HAFA 4J9PA 4E2SA 1NX9A 3BGAA 1JNRB 1HMVA 4DL7A 1BQMA 5DQIA 2VCAA 3U1XA 1W8TA 2ADEA 3VBSC 4QU1A 1QDCA 2DKOB 9ATCB 2W91A 3N6MA 5FPUA 1O5JA 4I0BA 2VVEA 4X4SA 2AH2A 3OB8A 3O6QA 4IH6A 4F7VA 2WONB 3WNNA 4OHVA 1J27A 1S1XB 3G6ES 2WSEC 3SFUA 1KFUL 2ZGKA 1NA1B 2XZTB 1JZ7A 4PRFA 1N1YA 1VQSA 2GH8A 4ASLA 1UU6A 3FUOA 3SISA 2GIFA 4Q29A 2RG4A 4B3MJ 2GJIA 5BJRA 2X5IB 5KFJA 1HLWA 1YZ7A 3GZAA 4LIVA 3HF5A 5HV4A 3W3SA 2DNKA 2R2RA 2R063 4Z7YA 4YMEA 2N7CA 5F2SA 5C4WB 3BN7A 1HBNA 4OI0A 2HEKA 4EZ6A 2GW8A 3O1UA 5KG7A 4P6QA 2MPFA 1CZTA 3I96A 1ZM4A 4ZIVA 1FKAF 1W0NA 4QR1A 1ULEA 2HZCA 4KG8A 5C8WA 3HD1A 3OSPA 1NOVA 5C4WA 1B99A 1JOPA 3OBAA 3VBUA 5IOLA 2QA1A 4J1XA 1RVF3 2C42A 5LASA 1XNQJ 1MPXA 4ED7A 4KG0A 5HBMA 3FVYA 2EFVA 4ZCKA 2F4FA 3ILLA 1CC7A 2RT3A 4B3RJ 5C6CA 1MMDA 2OTJS 3HVTB 2QMXA 4RNNA 3GIIA 2WVBA 1XMOJ 5A7PA 4KPYA 2G1MA 1YK9A 1PX4A 1S2EA 2PMWB 1Q53A 2XDVA 2HG4A 2JDYA 5BYQA 4Y1UA 2V8PA 1RUG3 2KVIA 1N88A 4LBNA 4NN0A 3KLGA 2CPZA 1JZ8A 2UU9F 1X4BA 4NIGA 3D66A 1UU5A 4L11A 3TZYA 4X4QA 4MHUA 2ZACA 1A6CA 4DV2F 4IV3A 1X4HA 3KCYA 5HMZA 5FP9A 4LF6F 1KLNA 1P9YA 2P3KA 2ZZMA 4O4GB 1NCQC 2WZR3 4QXKA 3QT8A 1YDLA 1IPJA 2X8KA 4IE0A 1VBA1 3DOLB 1J3QA 3FJ2A 1JX4A 5F3GA 3JU9A 2JJ6A 2NS1B 4P2FA 3CDAA 5FO7B 4WM7C 3TA1A 1MVQA 2YKOA 4WVMB 1ZZBA 5KC5A 3FLPA 4U36A 1VLOA 2DH9A 3UR0A 4NZ6A 4GKYA 2JG9C 4D6QA 1YJ9S 4ECRA 2ARCA 1F2GA 4Q4X1 2W9BA 3KT1A 5T5PA 4XUTA 3WT3A 3AK0A 4I6WA 3OGVA 4WVMA 2VGDA 3G2XA 1SXLA 2ZH5A 3Q83A 2EIGA 2UURA 4QQBA 1NNDA 2UUAJ 2GX8A 4FXVA 4KL1A 3LW5C 3ZYRA 3K5NA 2PI4A 4R0EA 2ASYA 2PFDA 3PW2A 2D3UA 1LU1A 5DDJ2 3AY0A 4DFKA 1ZETA 4V2VA 4RFRB 3R3TA 3NAHA 4EZ4A 2AACA 1RUF1 2LTNA 4ZU7A 3TJ8A 5A6WA 3HT0A 1CX4A 1RUJ2 1BQPA 4X8NA 4LT5A 3RG0A 4H7MA 4JI5F 2BEOA 2R7QA 4B4QA 2FD2A 2L9LA 4NROA 4AQYF 3QFHA 5FBJA 3W5MA 1RTJA 2E5JA 4E0DA 2KYXA 3DOKB 1VRQC 2CWSA 3VD9A 2W2IA 4CEYC 4DUYJ 3HVTA 5IT9U 2AV5A 1KHWA 2VMGA 4QDQA 5A6ZA 2TBVA 4Z1VA 4F50A 2QQNA 5FMOL 1EUTA 3TARA 3HJRA 2HBUA 5CD4H 5IT9Y 4GXLA 2H54B 2OGUA 2E51A 2ILZA 1R0CB 1N3PA 3LWLA 3HWJA 2NR0A 2RMU3 1CJKB 3SBMA 4A48A 3K8VA 4MKVA 2VW1A 1AR63 1FJEB 2DPIA 4OFGA 3PHMA 5DS7A 1FJ7A 3RDIA 1YQ8A 4NMLA 3NGSA 3AA9A 2JDMA 2BQRA 2RS33 4JDOA 2ET7A 4LR9A 1LWFA 2QG9B 4FXKB 4WM8B 4RBUA 1RA7A 1WLCA 1XNBA 3S5QA 2BBEA 1OPIA 1GWKA 3QOPA 4NA2A 1WA6X 3AMHA 4CA9A 4HYKA 4NLOA 5DN2A 1ZA7A 4W98A 4NWWA 2CJXB 1PJ6A 2JG8C 3CO0P 4E2FB 1GWLA 4BPZA 1DTTA 2VASA 1QLNA 4OYOA 2KZMA 2CG4A 1NCRC 1DQ8A 2KXNB 3HFVA 1NXMA 2IM3A 1KD1T 2Y6KA 2BM0A 1NT0A 3CJQA 3ET6B 2WL1A 1OWXA 2FLNA 2X10A 3WHUA 4CM0A 3CCRS 4RGAA 3BKZA 2XMTA 3A3OB 1U7LA 1ZYQA 4NHXA 3B82A 2C2OB 4PXCA 4YNIA 5HPOA 4JI4J 3TAMA 2W95A 3DNCA 1A9NB 2F8HA 2R041 2BRLA 4KH9A 4JI4F 3GFHA 3CDEA 3FC9A 4KQ7A 5KR7A 1Y5IB 2V5DA 1ZZ8A 1VFJA 4HEA9 4K5RA 4CTAB 2QQIA 5AC93 5BV6A 3FQKA 3A22A 1R0AA 5FLXY 2ATFA 3DKWA 1UY4A 4DR2F 4TLRA 1R64A 2LM3A 3W20A 2VOVA 1W9FA 2Q6CA 1CBKA 1W0OA 3RU0A 1X9PA 3T9ZA 4G1PA 5J1NA 4A2UA 2J8SA 3MCSA 4LOTA 1UQXA 5CBLA 5B0EA 2ZEJA 4O9EA 3AA8A 3QNWB 2DGTA 4B3OB 1HQ2A 2ZGNA 5CKQA 1AR91 1W6PA 4ZJLA 1QIQA 1W6QB 3NOGA 2CAVA 2P37A 1KC8T 2VBBA 2JRSA 1FNZA 4YG6A 2BR0A 1GMMA 4XEZA 2VD3A 3ZTSA 5FPXA 3PUSA 2XM3A 4QD2A 1IBLJ 2BQUA 3LPGA 1JBCA 5I91A 1YLXA 2GMEA 4DNYA 1HLCA 5KT5A 1O4TA 4BDPA 1S6OA 3ILIA 2ACYA 2AF6A 5EX0A 3ZN6A 2RHQB 2A6VA 3U7JA 4L99A 2R0HA 1OI6A 3DMJA 2JECA 2D6NA 2LEPA 4LFCJ 1DZ5A 3L95X 3M9OB 2QL9B 4N53C 3ACFA 3RYRA 2CYYA 4CLWA 1TL3A 2VFSA 1MZEA 2C28A 3LP2B 1FXLA 3D3BJ 4D7YA 2J6TA 4OFZA 3H25A 1FT8A 4DI6A 3BQ2A 3OUYB 3AP9A 1MZ5A 1IQDC 1KKHA 5FBZA 5F9LA 3CC4S 2R7XA 3GZ7A 4CLFA 5AVAA 2XO6A 1POV0 3LF7A 4CP2A 1A6LA 1N8RT 2BFUL 1BHNA 3IDEA 4D6SA 2WQ8A 2WLPA 5LA1A 1QY4A 3GTYX 1FTRA 4DPTA 5CA6A 4AGRA 3NV2A 3ZZ0A 3TN91 1HNWJ 5EXOA 3LP0B 4XF3A 3WP4A 5KT6A 3VAFA 3I54A 2VUCA 2H6CA 4JCKA 5FLIA 4E2QA 3QBCA 1KWMA 4CWBA 3FL7A 3S57A 3T09A 1JKHA 1LR5A 1XYPA 2CYFA 3H0PA 5L9VA 2ROGA 5EHDA 4R8UA 2HFSA 3ITHA 3OSDA 4COZA 3QMQA 2CHHA 1V5VA 4Z2WA 1R1A1 1K5MB 3DKDA 3ZNJ1 4OV6A 5JIUA 3I4HX 2H48B 3JUUA 3ZLIA 3I5AA 5EJZB 4ZXKA 1RAGB 2B7YA 1PG5B 3FHIB 4ZCMA 5KFSA 3M3QA 3IO1A 3DMJB 3OFEA 1P9QC 3T41A 1CVJA 3UCUP 4NLDA 5E7OB 1F15A 3Q23A 4YVWC 1LWEA 4X65J 3BSNA 3AB4B 1XIQA 3QCWA 3SLIA 2B46X 5ACA2 1VQ4S 5KFWA 1Z4UA 1HW5A 4KO0B 4FFIA 4X4RA 4ZIWA 5HBAA 4PWUA 1FPN1 1WTFA 3VBFC 4EYHB 4QWDA 5FZKA 3VQSA 3W1YC 1TMF1 3LKJA 2HWF1 1ZPWX 2W1BA 5FXWA 4DZ6A 2J0WA 2J1VA 1R8CA 5E33A 4H14A 3KWVA 3H7HB 1IHMA 3L2YA 3DN9A 5F5QA 2PO4A 3BALA 3NG8A 3CC2S 5DAXA 2D7FA 3KM5A 4HTJA 4CLYA 2QQJA 1O5LA 4QX2A 4RA0A 3PVXA 4DS0A 2H6BA 2OUHA 3S1TA 4H4KC 2QL7B 4R8UB 4B9VA 2UWCA 5DUWA 4OV1A 4IDKB 2DGQA 3IM8A 2WT1A 2IBOA 1S6QB 4U8YA 2VZQA 2DHGA 4ATNA 4QX8A 3UNYA 2AJ0A 1CGPA 5T7LA 1WMXA 2GALA 5LA0A 2APOA 4V19X 2FJXA 4XXPA 5F8NA 5BNOA 1XMQJ 3WUCA 5DG8A 1AJOA 4AT1B 1ZM2A 3M32B 1RTHB 2HURA 2VQTA 1N5SA 4ECYA 4XETA 1UZDA 2DUQA 5I0UA 8AT1B 2R2SA 5BYSA 1NK7A 2G1HA 3ZXKA 4K2XA 1VQMS 2VZ9A 1TKTB 4PPZA 4K7JA 3CLPA 3T2PA 3QH7A 3Q86A 5C2CA 2GA7A 4LK6A 4QKDA 3IPVB 4LLOA 1WKLA 1O3RA 4WE1A 4DZDA 3I82A 5JR7B 3J8F2 3RI8A 3T19A 5IUQA 4YVSC 4K0KJ 5A3LA 1DYOA 1NPKA 2FJEB 1FE4A 4P2XA 3BQ1A 2RRNA 2GAUA 2DBBA 2WRAA 5A32B 3I3DA 4JAAA 3FRZA 1OA2A 4OIXA 4USWA 1RUG2 4BYYA 3VF0B 3UQSA 5C5UA 4N8MA 3VLBB 3FE5A 5BY5A 5C3SA 4Y1ZA 2OHDA 4GC7A 1NY72 4DO0A 3OTFA 2VBDA 5JUVA 2FUG9 4RR3B 5AC92 4CE8A 2EK6A 5CKNA 3WNMA 5H9FJ 4XE9A 1LW0A 4LF5F 1TQLA 3MEKA 1RHKB 4FOWA 5D8AB 4UW3A 2AGOA 4XURA 4UYBA 2X5IA 1QJHA 4F2RA 5FZOA 1SIZA 4U7CA 2ZAAA 2OAUA 3OQ2A 2J1EA 1RAOA 4OZJA 1GMVA 1SJFA 2GGPA 1JU4A 3M32A 5I4MA 5HI7A 3FSYA 1IBLF 2J8AA 2R7OA 1NDPA 4K8RA 1PO22 1S9EA 2V8GA 2J1RA 4NHKA 4E98A 1N56A 4OX9F 3CD6S 3O5SA 4RPFA 3IN9A 1FXDA 3EE3A 3GZTB 1F2NA 1UY0A 1CJTB 2D43A 1HI0P 1JUIA 1MEC1 3V4MA 1COV1 3KHGA 3RFRA 1POV3 3J7NA 4DF4A 2ZE2A 1Q3EA 1VJ2A 4NMXA 1H1IA 1PK6C 4DU7A 4RUCA 2IDLA 1KGYA 1TL7B 5A2QY 1E57A 4C8ZA 4R9CA 4LHKA 1GUIA 3F73A 1GXUA 3CB4A 1EV13 5BNQA 4XPCA 2M88A 3B9IA 4XFBA 4MLOA 2QQPA 4F25A 1Z1ZA 3BDEA 4LMZA 5BNPC 4FO9A 2FQPA 2IC1A 5ABJB 2IHR1 4FP2A 4NOTA 4K7QA 2YNFB 1JJCB 3EGWB 5DPNA 4JI1J 1OMIA 1UXXX 3ULHA 4XDDA 5IXUA 3IDAA 4QQOA 4GB31 2HNYA 3JYTA 2IM2A 3PUQA 1CJVB 2M52A 5FYTA 3BYPA 4N76A 1ZBTA 2QVSB 1YBUA 2XY7A 1WC4A 3N6LA 3FEXB 4MK7A 4TYBA 2DVGA 2R042 4RKUC 4RHV2 1MMLA 2DB1A 3P96A 1HRI2 3K58A 4WE1B 2ZNYA 3ZSMA 1OQEA 4BQYA 3B8HA 2VV5A 4IGOA 2UU9J 1LU2A 5FV3A 2GDFA 5KG2A 5KG0A 2E32A 1BQNB 2FVPA 2DIUA 1HB2A 3FBCA 3LAMA 1S4CA 4RX6A 1GEHA 2OUGA 3OFGA 4QXHA 2RDIA 2XLIA 1HBMA 2W68A 3ZFFB 1G4CA 5B0AA 4XBQA 4UFMA 2XMVA 5I0RA 3QLQA 2YPJA 1N6QB 3J80U 2R8IA 1RTJB 4U7UK 2VHGA 1LESA 5LMNF 3MR2A 5C7GA 5DM7Q 3D67A 2B9UA 3THCA 1JZ2A 2ZGTA 4XQWA 2KL8A 2Z0GA 1FRLA 4MXWB 1J1LA 1FFGB 3ZFEA 4ID5B 5T5LA 3ABZA 3GZEA 4FOQA 3EVWA 2YBVA 3TBDA 3J81j 1JYVA 4QWAA 4E8CA 1FRIA 2XS2A 1OLMA 2R3VA 4ZPVR 4Z37A 2JG8B 2QZ8A 3H5XA 3T0AA 3BKTA 3H4DA 3TUIC 4R9AA 3L9JT 4COYA 5KFAA 3O5TB 4WYWA 2F9DA 2RSQA 1GFF2 3M1VB 2RF2A 2XY5A 3DU6A 3H59A 3HT2A 4NXMJ 3QSYB 2OQ7A 3Q8PB 3JZVA 4HDHA 2XG8A 4JI3J 1J3RA 2A1BA 5KFUA 4TVAB 4NRUA 3BO2A 2KZZA 1QJU3 4BIOA 2ZOEB 4SLIA 3UDCA 2QYCA 2Q8CA 1UX6A 5E3PA 2DYAA 2VIHA 4C3MA 5FZEA 2CZ9A 2KT5A 5J1EB 3R2CJ 4WXOA 2B6AA 1MWZA 2OELA 1MQTA 3MMCB 4GKJJ 5L1JA 1HQEA 4QHBA 1DYKA 4ZONA 4N53B 1W6QA 2HQ3A 1RUH2 2AYHA 3R4SA 5JSOA 4AE5A 4RW6A 5D4OA 2WNVA 1NAQA 3G8TA 4A8SA 3K5OA 1W05A 4JV1A 1DQ5A 1FOD3 2PEHA 4EN9B 1UTAA 1REVB 3QPIA 1KRPA 1BVP1 3IIIA 1ULRA 4CQ1A 5FY0A 3L4BC 2QQOA 1UKRA 2H4YB 4NCGA 1FNMA 1VOMA 1YQHA 3Q24A 4O7XA 5CG8A 2W25A 3I0SA 3PX4A 2V4JB 2HBQB 3A8IA 1RDRA 5FYVA 4E8DA 3R6GB 1KJRA 3RMXA 1FRKA 4W6WA 5AXNA 3GIKA 4B9NA 1T0TV 3FSXA 3Q2TC 5ETPA 4LUBA 2BJ7A 1RAAB 5EDWA 4XJAA 4E27A 3H3ZA 1U8WA 1GOFA 1S0DA 3K48A 2MMYA 2EFNA 4FAHA 4JV2A 4WF9Q 2Y3YA 4EMDA 1S97A 5KHKA 2EBGA 2QIFA 3T6JA 3MAHA 3RB4A 5M2UA 3NNCA 3AJ1A 5D1IA 4LRBA 4OQ8A 3PVEA 1ULDA 3D6FB 2UV8G 2RJZA 1NE4A 2JX9A 4A7ZA 4BK5A 4OZ1A 3RW7A 1VJQA 2XVGA 4NA1A 4UFKA 1JLGA 4KNCA 1IKYA 1NK4A 1K0VA 1G9DA 3IAQA 4WWSA 1ST8A 1GNKA 1VQNS 1N34J 3KV5A 2Y8WA 4DCJB 4NLGA 3TOQA 3GXUA 4GRSA 4CO5A 1AFIA 4I7FA 1N52B 2DTJA 1SLCA 5AE3A 5FQ0A 2CSGA 2C4XA 1PO13 3PUIA 3F0NA 2UWBA 4BWMA 2WA3A 3T2OA 4D69A 3BH6B 1A0OB 1W2TA 3S6EA 1H1AA 2ADBA 3NWGA 2QNKA 4L73A 2ALYB 4QKFA 4C11B 1NKEA 2BANA 1HRI3 2RM23 1MS4A 3JAMY 2E5HA 2B4KA 2ZA9A 3FEZA 3V2UC 3GCXP 1B70B 4PQ9A 1ASJ1 1W28A 1RTHA 5A8WB 2XJRA 3QLHA 1QJU2 1RT5B 2M0GB 5CAAA 3G96A 4XJUA 5FJHA 4AQ2A 2DIVA 2W08A 3CHXA 1F3FA 4YB6A 3W62A 5I3QA 3K5MA 1R081 4Q4V1 1CR7A 4LBQA 2Z30B 3W9JA 4ZHNA 3K17A 3USUB 4CTAA 3AYEA 5HCBA 2A6ZA 3OHAA 3AB0A 4AI1A 4ZPCA 2R32A 3OY8B 2OLWA 1YJRA 1D8ZA 1I6XA 1SIWB 2K0GA 5T50A 2VXJA 4UUWA 1U4BA 3KMSA 4RGKA 1I5OB 1YEWA 2XVKA 1XERA 5FZMA 2W1UA 3D2WA 5C8CA 2XHWA 4RJVA 2MLZA 5F32A 1WKJA 3ELNA 4HVZA 3HVDA 4B1LA 4CYUA 1HV1A 1RUI2 1VK3A 3DLGA 3L9ZA 5AT1B 4DV6J 2VFTA 1FDBA 2XNQA 2Z2MA 3FCHA 3DLEA 4KT0C 1NJWA 2IJFA 5CA5A 2KFNA 5EX3A 1UZHA 4RL1A 4NLUA 1CESA 1WHYA 2DO0A 2RJ2A 4PWWA 3A23A 2JEJA 5DABA 2YKMA 3LP1A 3VKLA 2D6PA 2NZCA 4N8NA 1HHQA 2UXDJ 4O65A 2W1WA 3W58A 1DP0A 1WBLA 2VW0A 1GYKA 4LF7J 2OFGX 3WQ7A 3TAPA 3NNHA 2O8OA 1JZ6A 2RM22 3A12A 4LO4B 3LSDA 4DIQA 1J5EF 3JQXA 1UIJA 1SH2A 5D77A 2MKIA 4XFGA 1H2VZ 4Y2AA 1MNEA 2JDNA 3PVNA 5D4PA 1GFWB 4URAA 4JI2F 3OXFA 5T5JA 1SLLA 4K4SA 1IKVB 3DM2A 1K8AT 1QAXA 1KOHA 1FWLA 2N82B 2VOTA 2HBZB 3SC7X 1JLEA 1G7CB 2CPDA 3IR6B 1WG1A 4LQ3A 2ZZQA 3WBZA 2E63A 4UAPA 1QNYA 3AKPA 3D6MB 1FXZA 4F26A 1STMA 3PURA 2JC1A 1D3WA 2WVEA 1IKVA 2NZ4A 3GJTB 1AR72 1HNZF 1XXNA 3HZEA 3MDFA 2MQNA 4PQUA 1FCAA 2HGLA 4JX0A 2IJRA 4IO9Q 1PK6A 1AJKA 3CF6E 1E6YB 2SBAA 3FHQA 3UD4P 3K2YA 3I2DA 4IDKA 2UUAF 3D1QA 4TYAA 1W06A 4WU3A 3UESA 4COVA 2GIQA 3CL1A 4RO0A 3K57A 2V5HG 1SDDB 4NLXA 1RUF3 2MSSA 4KR0B 1V6HA 4QQPA 2DGXA 3KMHA 4LJHA 5LBCA 4NRTA 5I0TA 4LTAA 5CD4A 1W2UA 3X1LB 2PQSA 3AJ2A 2Y6GA 2BJSA 1OY8A 1SC4B 1NJYA 2KFYA 1SG3A 3JD72 3LDRA 1QAYA 4YZ4A 5E0OA 4GMKA 4Y20A 1KS4A 3MM8A 4MT1A 3N4WA 1Q81T 2CPIA 4C8DA 5D6GA 2IXHA 2IAJA 1XRUA 2VZOA 4DRVA 3ICLA 3AYAA 2FZ1A 3DLGB 4CCMA 5FO8B 3DKQA 5IZHA 1IG3A 2CQ4A 4DEZA 3ELHA 1IBCB 4LE4A 3EZ5A 5E3RA 4YUDA 1U1LA 1IBMJ 3BGFA 2RS32 2YY1A 1T03A 3IKWA 1ZTWA 2V4AA 5CHCB 4O4GA 2XLKA 3TI0A 3VBRB 4YSFA 3KV6A 3LGNA 3GBFA 2F65A 2IYIA 4ED1A 3CCTA 4XQDA 2F7VA 3LA2A 3MIBA 4Q44A 4Q0BA 2LQJA 2EXUA 3WIUA 2AUYA 3OJUA 1LECA 3BTYA 4INDA 3EJMA 3RG6A 3PW5A 3PW7A 3Q8BA 5KFFA 1F2HA 2OI2A 1DRZA 4UQTA 5FR3A 1MVEA 2I1RA 1RT3B 2G13A 2LECA 1OD3A 2AJQA 3A7QA 5HCFA 2V5YA 3IR7B 4OZXA 1VYAA 2YNHB 2AZ3A 3F41A 4LQRA 4WVZA 3UE2A 1OYDA 2DR5A 4RR3C 4FNIA 4BBYA 1LEOA 3JTOA 5EWGA 3ISND 3RAQA 5FZOB 2BU9A 5FXXA 2DCTA 3W5NA 2AYMA 3BSOA 1JZ3A 2A18A 1JNZB 3PRDA 5HMWA 1JIHA 1NXD1 2FHRA 5LJ5Y 2XBO1 4K5SA 1JI6A 5SUHA 4CEWB 1SMVA 1X0FA 1UYPA 4IEPA 4PQQA 4EBDA 4JV5J 4J91A 3GHMA 4QQ2A 3E6CC 2P4EA 3CCMS 1UN1A 4PI0A 3WQ1A 1TAUA 2R7EB 1JXLA 4GZ9A 3OJBA 4QKNA 3O3LA 1HB3A 3PFEA 1Q95G 2FHMA 2CUYA 3SQGB 2DR9A 3WD5A 2VH7A 2MSTA 4SBVA 4N8OA 4AI2A 5EYYA 2ZMKA 3A8JA 4OX6A 1AR93 1VBB3 2JVOA 2BVVA 5FY8A 1A78A 2VG7B 3W8PA 1RXOB 5IT6A 1HBUB 4OJGA 1N5TA 3SCGA 1CPMA 1O5UA 3EHKA 3F44A 4N9HA 1RGSA 5HANA 5KFMA 3KHRA 1H38A 2W4CA 1RSCA 5DLGA 3CIZA 4P5YA 4FXGB 4XBLA 3MPUB 3DL3A 2RS51 1O59A 1JXNA 4ZS6A 3PIPQ 2MJNA 4DR6J 3HSGA 4G3YC 3H50A 2UXBF 3B69A 2WZR2 2ZX2A 3C15A 3IN5A 1QD1A 2XL7A 2R2UA 3V6KA 2WDBA 5A3OA 2EXJA 3H8YA 3NNAA 2ZM6J 2ZHLA 3PDQA 4LR8A 1JJ2R 4RHV3 4W90B 1RUE2 3L7OA 3VBFB 4EZHA 3QLHB 2JIJA 3SCKE 3LWCA 1UWBA 1BC6A 3GV8B 1N32J 4M4RA 4HHUA 1PZ9A 4K4WA 4NCAA 3TA2A 1RAHB 4ZLPA 1G9BA 3G4SS 1ULPA 5ANQA 2IRYA 4ECWA 3AYDA 4WP9A 1JN2P 2VAUA 4DEVA 1Q8OA 2VKRA 3RRHA 2CGOA 2WAOA 3HFZB 1SVDA 1O7FA 2D6MA 2B9YA 1JYCA 2OYZA 1KFDA 2HFNA 3V4IA 2WO7A 1RWVB 3WCSA 1FNOA 4ZK7M 1SBDA 5I8TA 4A8WA 1YQ2A 4COUA 3TVYA 2YX1A 1C1CB 3TRGA 1MWQA 1LWFB 1SKSA 1WW7A 2I9SA 3WP5A 1H8VA 2GVDB 1H0BA 3NW4A 3H20A 2PA7A 2DVBA 5LK7B 3NAPA 4PABA 5DZ6A 3MI7X 4JYAF 4EO6A 1W25A 3CWJA 1A7GE 3ZR6A 5THWA 1A34A 4KV8B 4F02A 1KSPA 4OQJA 3NAPC 4Q4W1 4IV3B 2K06A 3HZGA 3EGZA 5A6XA 2XGXA 1O8PA 4NPLA 5KFZA 2M9KA 4NMIA 5GLZA 2J42A 3OYWA 1BYHA 1U48A 5DG9A 1FPN3 3K2OA 2AYEA 1B7FA 3J7AN 2K2SA 4DSKA 2DY9A 3I3MA 3I49A 4YW5A 3ZTRA 2ZVIA 1M90T 4P71A 4IH5A 4NIDA 2VH9A 2RMU2 2UU8A 1CSJA 2RVJA 1V3RA 1WMEA 4B29A 3DXSX 4Q5VA 1G9CA 3AVSA 1JYTA 3FSIA 1HQLA 2EFPA 3ILOA 5IC6B 4ZVQB 1U1PA 1TL3B 3UGGA 3W61A 3AP5A 4JVAA 2MDAA 3ZXGA 2J7UA 1SPBP 1HNVB 4OI3A 5KXDA 3NS5A 3PR4A 1NK0A 3D1OA 1AR81 3ALQA 4IL7A 4F2SA 4CT8A 1Q8QA 3ZIWA 1YFXA 2O1PA 1E5IA 2A6YA 2C2MB 5SZTA 2RUSA 3VDDC 2HGNA 4XFFA 2MQLA 4KPCA 1QSLA 4P14A 4P9IA 2B0GA 1NCRA 4FYXB 1PYTA 5DAPA 4JHTA 4ZLJA 4YZ5A 1H2NA 2KI2A 3RRGA 4FPKA 1FF2A 4Q0VA 4Y1XA 2YWFA 4J6GA 4RS5B 1I5ZA 4PUOA 2HBTA 5GZCA 3EB7A 3HI9A 3ETMA 1NA1A 1TK5A 3HJVA 1SFNA 3IS9B 2VFVA 2XC9A 4K6BA 3HULA 4M5DB 4EE2A 3H7YA 2F17A 1YRUA 2B5HA 2O14A 1N5YA 1X9TA 1PK6B 2RIJA 4I01A 4JV5F 2DYCA 4C97A 1XK8A 1TMJA 4Y34A 4OQ9A 3WNKA 3DC2A 2PHDA 1GZWA 2D3RA 3HD2A 1PNGA 2W4PA 3KLGB 3HPNA 5L39A 4R4XA 5J2NA 3AL6A 1EKSA 5A0YB 1F1BB 1AUDA 1RHI3 4RW9A 4DX8H 1ZA2B 1UYXA 2YGMA 4OYUA 3PHEA 5H9RA 2RE1A 3PO4A 1SJQA 3LPEA 4OJ1A 1QJX3 3ZTPA 1REEA 3AMMA 1U1RA 3LCPA 2FLPA 5FRAA 2EWHA 3PTWA 2I2YA 5B09A 1X9SA 1GQPA 1X33A 1Z0HA 1OQ3A 5HN0A 3KOAA 4BQ1A 1VB2A 5L38A 4L0PA 4XTMA 4MTPA 4OHZA 5H1SV 1K12A 3OBTA 3VDBA 1SACA 2MQ8A 3AD9C 2QDRA 2W87A 4AVCA 3CDBA 2NYHA 3PR5B 3RZLA 2XKOA 3MO4A 2QTWA 1MEC3 3OVSA 4UZCA 2BJDA 5HQMA 2GC1A 3BTAA 1C8NA 1HBNB 2CKWA 4OYPA 3BEGB 2CVIA 3MZIA 3URFA 5B2GB 5G4DA 2GNDA 4EI2A 2WUHA 1OPZA 2Y0SD 2QO3A 5GAGI 3R5JB 4C3LA 4HMZA 4CNZA 1YIFA 3LEGA 4NR1A 3I2OA 3ENQA 1C2PA 3BTXA 1FD2A 2ZGRA 4C1XA 3EZUA 4XHBA 2B9XA 2NUHA 4LIUA 2WCXA 3VZKA 2VFUA 3MIGA 2HFOA 1UA0A 4F3OA 4CP9B 1T9WA 1TUVA 3MR7A 4DSIA 1R093 5KG3A 3OL7A 1QH7A 4AVTA 1VP6A 2Z42A 2OFHX 4C9DA 5FYZA 3VBOA 1WOOA 2HBYB 2AMCB 5BNPB 5KXCA 5ACA1 3G6JB 3MFIA 3KLEB 3T2TA 3J4UH 1V3SA 2H0BA 2ZGPA 4AXOA 4WP3A 4Z2AA 4EO8A 2W7OA 2X3GA 3QACA 2JZ5A 3IWZA 2Q8EA 2LXUA 2R062 4OI2A 1QU0A 2DY1A 1HV0A 2XOMA 5JOZA 1BXNA 5I93A 5C9AC 5CH7B 1U5XA 5BNPA 4USTA 5CZXA 3KJVA 5HJXA 3K3NA 2WB4A 1YJNS 1OSDA 3DCAA 1W2NA 4P5HA 3DRYA 1RWPB 3A13A 4O61A 1PYSB 2W94A 5A8KA 4YVSB 4C1WA 3CCQS 3NGTA 1UKUA 1ZRCA 1W6MB 4LHLA 4FBTA 4DJBA 2LQ8A 3S7EA 1ZREA 4DN0A 2X05A 3ACIA 1W6NB 5LATA 3QIPB 5FY1A 4I56A 3P5BP 4M3CF 2P17A 3POTB 1YWKA 2OIIA 1LTEA 4IE6A 2VZSA 2HYIB 4G3IA 1BHGA 4CM2A 4K4TA 4LIRA 1RMU1 1QVGR 3BBBA 3VD7A 3H9AA 3KLFA 4BC7A 2VZTA 4KU7A 4I0AA 4KH1B 2XH6A 1HB1A 2WAAA 3DGVA 2C2ZB 3CJXA 1IJFB 1YJWS 2ZKTA 5CVRA 3LFIA 5LWBA 2ZWPA 2X5IC 2Z69A 2BABA 2LROA 4MGKE 1AZSA 2P3IA 1HR0F 5KHGA 2K9ZA 2UVRA 5IWAJ 3VKNA 3LOBA 2PN6A 1NZIA 1NJXA 1NUKA 4RNHA 4CDIA 3W9IA 2WS91 2GJ2A 3QBQA 4KIAA 3J7LA 1TUGB 2HK3A 1ZZNA 1F60B 5FZ8A 3EPGA 2FHJD 1PZ7A 4OUSA 4O44B 1ZPVA 2WS92 2MZ1A 1W2IA 3LO3A 5GALA 1LW2B 1NSAA 5KFDA 3UN5A 4Q2MA 1WCQA 1ND2C 3AQOA 4Q4Y3 1RUE3 4DSFA 2BOPA 1VIXA 1LB2A 3VBRC 1CQNA 1K5MC 3D0HE 3M3CA 3KLSA 1AZSB 1V9U1 2Y6HA 2EAAA 1D7PM 2J76E 2DR8A 1Y9GA 1ENQA 3KWMA 2JVRA 2R6QA 1TZOA 1CJUA 4TY8A 4LO7A 2QE5A 5EWFA 2R4FA 2AYGA 3B94A 5FIXA 2PHWA 2EKNA 2XPJA 1YGYA 2DRDA 2KDOA 3AZZA 2WSVA 2CQ0A 3PJQA 3PKYA 3BGUA 2UUCF 4F83A 4IR1A 3VGVA 2YB7A 3SSRA 4A7KA 1F5CA 1C1CA 3PUAA 4CRQA 5BNNA 3UWTA 2RHPA 2PSZA 5FPVA 3E6BA 1JXEA 1QJX2 1N4LA 2SLIA 1NJZA 1TL5A 4M3CB 1FJCA 4IV1C 1AX2A 1ZX5A 3TYTA 4TQRA 1DFQA 1HQUB 3TA0A 1EIYB 3SCLE 1MS5A 2A5ZA 4C8MA 3POFA 5FO9B 4H4KA 1SKRA 1UY3A 3C7HA 4CU7A 2L9NA 3TANA 5GJ6A 4ZU5A 4DN9A 5A8KB 1CPNA 1M4WA 4K4UA 4QQLA 4QJVA 1QOSA 2ADCA 1Q7LB 3PEHA 3DFEA 3O8WA 4MG2A 5DQHA 3W2VA 1AYN1 5DQGA 4HT7A 1ZTTA 1U1QA 1FESA 3OPTA 4RS5C 4HR2A 3WX4A 5F8JA 3SYZA 5IWFA 3GIRA 1Y9OA 3GCWP 4UF0B 3W2WB 3T3FA 1D8YA 1U45A 1O0PA 3LA7A 1LJ7A 2YUEA 3ZYGA 3NBPB 5JI7A 1OVPA 2BGOA 3Q8AA 4UF4A 3IBFB 4UFIA 4EEYA 5JOYA 1UYZA 1SCSA 2A3WA 2E5IA 1Q8IA 1U2CA 5C3PA 1WWYA 2PLV3 3T08A 2BJEA 1SB6A 1ZRRA 1PMJX 4GH4B 3KT7A 3U1NA 2CU5A 1G86A 1X50A 2XSFA 3GG0A 3WW3A 2ZD1A 1Q56A 2VPXB 3QWPA 4AQYJ 1IZ3A 1X82A 4JI7J 2HHQA 3JXOA 2M8HA 3D0IE 1U09A 4M63A 1QHDA 1WLDA 3CMQA 4TU9A 2MKSA 4LFAF 2ZTNA 2OEJA 3SXLA 3ZZZA 1LGBA 5AJ3F 2AYBA 4IR9A 3Q8UA 5FYCA 4LUMA 2UYBA 2V6AA 4JI1F 3MM7B 2AZ5A 3FBEA 2JEGA 4QOTA 1H72C 5I8SA 1JXVA 1RT2A 2WZR1 4QBUA 1I94J 1VBA3 4KH0B 3RVHA 2GMJA 2HMIA 4AEKA 1LK7A 1JUHA 3RZJA 3HDSA 3BV8A 3OR1A 4B3SF 2ASJA 2ZD1B 1OD5A 1KS5A 3IAPA 1XC6A 1WUVA 3IBMA 1UVLA 3PM9A 3NRUA 3KQRA 2DDUA 4DR3J 4U8VA 2EVXA 2IM1A 4FVCA 1LOAA 2A2CA 4NI2B 4NEZA 3PTRB 2WNVC 5JMCA 1LQ9A 3US5A 2W0XA 2K3KA 4ELTA 4B3OA 4LVNP 1YIJS 2WZEA 2WNUB 1XSQA 4JTNA 1S0GA 2WA4A 4O3OA 4GJZA 4I02A 2HSEB 3ZTQA 3CU7A 3CC7S 2VPYB 1VMFA 4GH4C 3K8WA 3TZWA 4URGA 3UR3C 5AE2A 5CABA 5L36A 1FKPA 1LODA 5EUHA 2OPPA 3M4FA 4ICLB 3JTNA 1TZ0A 3ZXEA 1VQ7S 4P10A 5LBBA 3JQKA 1AYEA 3WX5A 4FF3A 4DFPA 3AFGA 2YGLA 3SV4A 1T3OA 3USUA 4C4WA 2XHCA 2Y1IA 3DYPA 1WUUA 1G9AA 2OT7A 1N1SA 2QQMA 2HH9A 4A8FA 4H4MB 4AAPA 4B3SJ 2KKHA 4I2QB 1JLAA 2OUJA 4J25A 2J5AA 2QZ3A 1D4M1 4RW7A 3IDBB 2BTVC 1Y9MA 3FFQA 3MM9B 4RUHA 3H3LA 3ZFVA 2BFUS 1S0JA 3U4SA 1OPOA 2BANB 4CO4A 1S12A 2MXYA 2YNGA 3MI8A 2ZGLA 1Y11A 2DBNA 3A3PB 5E88A 1FX2A 4JGYA 2BXJA 3M8PB 5KFOA 4QM8A 3GCXA 4R25A 4J9RA 3IA0A 2B8QA 4BISA 2AD9A 4AI8A 3DDNA 1EHWA 3HHLB 5J36A 4IRDA 2LW8A 3KNAA 1N3OA 3LTOA 1IS5A 5FZ0A 2CV6A 3AC0A 4M5KA 3V56A 1G2EA 2IMOA 1RUC2 2XBPA 2EVZA 4AVAA 1U1MA 4DG1A 1HNVA 3VB9A 2K7KA 2YBKA 4IUGA 3ZZOA 1CAWB 1Y5LB 5CFCA 2PN5A 5BNNC 4U96A 2NXCA 3MECA 2HWB3 3RWKX 1ZBE2 1NZAA 2CZ4A 2AEMA 4Q4W2 5KFKA 2PELA 3QH6A 5A0YA 3CD7A 4DQPA 1UU4A 4JHZA 1QOOA 3TAQA 2UXCJ 1QJFA 5IK8A 5J2MA 2OA2A 4YW3A 2DGWA 1E6VB 1W2OA 2R061 4Z07A 5KWRA 3OT9A 3LUYA 4ZVGA 1SI9A 3CKHA 4Y33A 3V6HA 3GYNA 2XJQA 4ZDNA 4H4OA 4MFBB 4CP9A 3CJ5A 1RTDB 2SXLA 2FLLA 3VBRA 2FCVA 2RQCA 4I6YA 2BZDA 4DR1F 3FWEA 3I31A 1REFA 1VRH2 4LE3A 1H8TA 1GX5A 4CUGA 3MDPA 2XB2D 3GJRB 4YM3A 1NK5A 1VLYA 3KF3A 1RVF1 4CEYA 4ZJQA 4QPGB 4AFFA 4P7TA 4LREA 4HN1A 1XQIA 5IVBA 2B9VA 1UFKA 3M3EA 3ZZRA 1R6VA 3WHTA 3MGJA 1DQ6A 1ND3A 3BQ0A 5KG1A 2R16A 1X60A 4CLUA 2J6UA 1YFWA 4HI1A 2W2MP 5LA2A 4BIFA 4CCEA 1UPSA 2DNHA 1TME2 2WTFA 1HWUA 2HLUA 1RINA 2HWD2 4FSJA 1H98A 1PO23 2ZH8A 5GMEA 2AJ2A 3WOGA 1WW4A 3BPSA 3PRBA 1IJEB 1JYIA 1VLNA 2N3LA 3ENWA 2A6OA 1TME1 1YCIA 4X62F 5A3PA 2RR11 2HWHA 4OYWA 3M7AA 2LU1A 1UP1A 3CMES 2WN2A 5FK8A 4DU8A 1LFPA 1OA3A 3FKBA 2OPRA 3C15B 3PIOQ 4HVOA 2XYPB 2RV9A 4CYDA 1X4FA 1H74A 5A3TA 2QMUB 2Z2SB 1RWMB 2CAUA 1UPMB 4RNOA 1RT5A 4N9IA 2IXCA 2VUDA 1T9TA 3MEDA 4USHA 4DQIA 4LORA 1VBD3 1IS6A 3N4MA 4F3JA 2QEXS 1VBB1 2HK2A 1DZTA 1HWIA 2HFZA 3C3LA 2WO3A 2XTJP 3RMYA 2BW8A 1KP6A 5M2PA 1K5JA 2J22A 4LBHA 3H5UA 1HBUA 3ENAA 4FF4A 2ZGUA 4J5OA 2VQEJ 3J80Y 3DI6B 3JD73 1RBOB 4MSVA 4AR2A 5J09A 3MR3A 2OPWA 3N9LA 3PVOA 1HWKA 2G0IA 4TLFA 2YXSA 4I2OA 1IKXB 4NIIA 4F36A 3SITA 3I0RB 1NRKA 3DLKB 2IVJA 3WG2A 3MR6A 2DFBA 3W7BA 4CH1A 2ETEA 1H6YA 5CB7A 1MU2A 2AP6A 1MSWD 2D3PA 2QRRA 3VZNA 1Q8VA 5BNOC 3KJQB 4ZPWR 5A32A 2E29A 2KXHA 4RHV1 2FB0A 2ZH6A 1VQ8S 5K7PA 4XFAA 5FK7A 4FVMA 3SH3A 1KQGB 1MN7A 4OMFG 1PVC2 1HNXJ 3RYLA 1W99A 1CJUB 4W8JA 2EFOA 2C5DA 1GMUA 2Z8QA 2G2OA 2XLGA 2RDQA 2DNPA 3D3CJ 4AF9A 1VBA2 3PX6A 4ES2A 3I2GA 2RILA 1URNA 4RW8A 3R7SB 3MEDB 3WINE 1COV2 2DXDA 3RR7A 1Q86T 1EARA 1YHFA 2HWF3 1TL4A 2W47A 3BJYA 2V63A 1EUUA 1VRUA 2P3JA 3VQTA 4DPYA 4ED0A 1LW2A 2XQXA 4AI9A 4NRMA 2YWEA 2QA4G 2FGCA 2WNUC 4QGMA 1UOJA 2UXBJ 4UOFA 2DU0A 1RTZA 4YFUA 1FFWB 4ES1A 5FLJA 3L3CA 3HVRA 3MUMP 3S7IA 3FRYA 4YR0A 2R0FA 4A3XA 1Q8BA 3M8SA 1ZRIA 2ZX1A 3M30B 2VC0A 2RS31 4QYZJ 1VISA 4CUCA 3GJSB 4ZPAA 2VOKA 1F4AA 1UAWA 5LL6d 5DZ7A 3IAM9 4KJIA 2QL5B 4MK9A 4BQWA 3PHTA 4HPKA 2XR4A 1FDAA 3BIEA 2CL2A 1AXQA 1RHI2 1VRH3 4DUVA 1JYXA 1QQP2 4YB1P 1IBKF 1G3OA 3TEYA 4Y3CA 3NCPA 2W9BB 3ZMOA 4WIQA 1RMU2 5D8AA 1WC6A 4AYBD 1R43A 2XUMA 3BBCA 5A6YA 2GQCA 1GQGA 1HN1A 2VO5A 2J7MA 2RRAA 1Q82T 4ZZ8A 5IAVA 5JZGA 2N7YA 3MMJA 1PHMA 1UW9A 3C6TB 1RUG1 3IRXA 4CCDA 2P6HA 1HI8A 2ZMLA 3UDVA 3AP7A 3LB9A 4YR2A 4XABA 4YW7A 3QAUA 2YNGB 3I9ZA 5H9SA 2ZCWA 3WC2A 1S7IA 1V6KA 5DUUA 1RACB 3DOLA 1ODMA 5F3CA 4HK9A 1SHWB 3WY6A 3MW3A 3FMWA 5FZGA 3ZXFA 4ZPBA 3M1VA 5AVPA 4PQUB 4DQQA 3KHLA 1VQOS 1PKUA 2W9CA 4ZKTB 3DDIA 1R6YA 3GYDA 2L3MA 4I2PA 3Q8QB 1RUC3 1V70A 1MROA 4CDWC 2Q1FA 3JBG1 5GZDA 1Q78A 4F4ZA 2E1MC 1R89A 4G1IA 1GNHA 4FPFA 2NZ9A 1EX8A 2CXEA 2PA3A 2MEV3 5GZFA 4OYZA 1Y10A 4F0HA 1U6BA 3K4ZA 1N6QA 3NY0A 4TLGA 3BDPA 4NUBA 2F8MA 4TU8A 5F6KA 2XYGB 2MHNA 3LSEA 1MROB 3ZYPA 2ZX3A 3ASIA 1QXJA 5KXBA 1AYM2 4E4HA 2CJAA 1RAJA 5L9BA 2E1PA 2DUPA 4LHNA 3KCCA 1HL6A 3MECB 4QR2A 2Q1ZB 1W6OB 2C2RA 1Y7PA 4PCRA 4CUAA 2EF6A 4MV2A 3KLIA 1WNEA 1BUXA 4ZU4A 1JJ4A 2VDIA 4KFBB 4S2FA 4GAZA 3LDKA 3KS7A 5JMNA 4DLEA 1FEHA 1HI1A 2PFFB 2CFXA 1SZBA 2ZBPA 2D74B 4CDUC 3ZOIA 1RT2B 4N53A 2BVZA 2YKNA 1D9FA 2QTWB 2OPQA 3S8SA 1NE6A 3POYA 4J9QA 4F8RA 2BPA2 3BSCA 3OLAA 4DV1F 1WD6A 5I8YA 3RAXA 1QQP1 4HVRA 4GO7X 3V4IB 2W1SA 4L3KA 5ANNA 3TN93 4QU2A 1RHJB 2P6CA 2VNRA 3WNPA 3C7EA 2BV4A 1W6PB 1QJX1 1CX1A 5HSPA 1DQAA 4O0NA 2ZZJA 3V0BA 1RUJ1 4AFDA 1S1AA 3OPWA 3N7LA 5CYYA 2W3JA 1N47A 3P45B 4CCLA 3V81B 4DCPB 3OUIA 2PT0A 4N77A 4WIIA 3OBZA 4IKAA 4A4JA 4Q2LA 4DS5A 5FWEA 1U02A 3RWNA 5K8PA 2ZH9A 3OTDA 1J3PA 2KG0A 1S1TA 1WLTA 2JG8A 1R082 4Q4V2 1VK8A 5LCWL 2ZHOA 4AFAA 1XEZA 2VZ1A 3P8BB 2ZZTA 5CYMA 1YYNA 2VMEA 4UF0A 2NSCA 3PRVA 5JVVA 3D0SA 2V67A 1I6JA 2BJ1A 1F5FA 5K8NA 3Q8RB 3USSA 1JLEB 1UVMA 1DQ0A 4YDDB 2JDHA 2EPIA 4WP8A 2KM2A 1AHSA 2YWGA 2ZS6B 2O01C 5FYSA 4NOHA 4X84A 1HBMB 2VA3A 1M1HA 1WC1A 4ITSA 3T4HB 2E5LJ 1PMHX 1RT4B 3M2UA 4DL3A 1J5EJ 3EUNA 3FDSA 4OZLA 5LT5A 3I2JA 1UMJA 1YJUA 4DL0C 3NXZA 2L48A 2Z4FA 3DRPA 1WBFA 3CMGA 5JXSA 1VQPS 4MGZE 3GR0A 2VZUA 4IRCA 1RWWB 5BXIA 4ZVEA 4L3NA 5IT0A 5G0RB 4B4PA 1F9HA 2FIUA 4MAKA 4B3NA 2A3YA 4AHWA 4MIAA 1RADB 1FK9A 4ILMA 4BHPA 4NXNF 4PKDB 1BK0A 4JZRA 3N7MA 5FYYA 4A41A 3TZZA 2KJWA 1FI4A 1RLCL 1WOSA 2ZEXA 5C9AB 3SHRA 3MIHA 4YGDA 1VAMA 1ZM3A 2FJDB 2EC2A 3FHAA 4FFFA 2CRLA 4QAWA 5AXMA 2FCUA 3LPFA 1A3KA 5JSRA 1KDKA 5T52A 1J2VA 1E6YA 4Y28C 3M1HA 5JUMA 1RU2A 1T7PA 4LF9F 5HP1A 4P52A 1RYYA 4U2AA 5D3GA 3AZYA 3CW2C 1N0VC 5KFXA 4IOCQ 5KFGA 3SZ2A 1C4RA 2WT2A 1R0AB 1UXZA 4B9MA 4XAEA 5J2NB 4PIYA 4D7SA 4EN0A 4Q0BB 4ET7A 2DJWA 1KFXL 2DHSA 3KG4A 3DLJA 1UVNA 1KONA 4FNHA 4WV8A 1GK8A 1TKZB 4ZHRB 5L1KA 4QIVA 2ZWOA 5FLXU 3QGHA 4BHQA 1NK6A 3M7VA 3C46A 1O6XA 2NYYA 2VVDA 3UNGC 2AX1A 1GWMA 1Q43A 2FDGA 2I6WA 5I42B 1W8NA 5FZAA 3O14A 5IK5A 1U47A 1KVJA 1ZA4A 3WDYA 4NCBA 3CQOA 2D98A 4O23A 3T2QA 2Z56B 2R8GA 3R7BB 2MLXA 1RVF2 5E16A 4WFYA 3U1MA 3JSRA 2VQAA 3RGIA 4MADA 1U5ZA 1UX7A 2MZRA 1H73A 2E9TA 1FKOA 2L9DA 3KVBA 3CBNA 1N5VA 4CXYA 4ZVFA 3IBWA 2F4LA 1CAXA 1HW8A 4NO4A 2WBKA 3RZMA 1V6MA 2H9ZA 2BE2A 2XJUA 5D4NA 4LKFA 5A1FA 1D4VB 3AOBA 1VC0A 2YG0A 1U2FA 3CCWA 5FDLA 4HG6B 3SCIE 1R1A3 2E33A 2NMNA 1KEXA 8RUCA 1HDKA 1W2BR 2LA6A 2E9QA 1JZ5A 4FPEA 3M30A 3OY8A 2A75A 4W50A 2BKPA 5FZLA 5DDQC 2KD7A 4WVWA 1Q0NA 3KKFA 1ZM1A 2D5HA 1FDNA 2B9WA 2WYFA 1IWGA 2AJFE 3T1LA 1ZBE1 2NUUG 3MPYA 5FY9A 2ZUGA 1RT1A 1U12A 4CLSA 2Z58B 2HQDA 3TQEA 4E2GA 2D9PA 4ZLLA 3UD3P 3GONA 2HQGA 2J1SA 1KQSR 3OXGA 2C0ZA 3KQ4B 2YH0A 4I67A 1S55A 4LF8F 1ULOA 1X8DA 4KWJA 1UEVA 1VDHA 3BOWA 1RABB 2B4PA 1OOPB 1UFLA 1N1VA 4LR7A 1I1GA 3KLHA 1VIOA 4L6V3 1B35B 2CPYA 4XDPA 2AWZA 2P8IA 3AX4A 4ECZA 1Y3TA 2FC9A 3WP3A 4CDQC 4OLLA 4XK8C 2EBEA 2DH7A 3EVOA 3PL0A 1K3IA 5FXVA 5H9QA 3PMSA 4XZUG 3IMMA 4XCAA 4PLOA 3V65A 3WHIA 4AXJA 7AT1B 3KHHA 4ZP6A 1HIYA 2VMFA 4EBEA 4WK3A 5LXRA 1MS9A 3L7UA 2K1RB 3GP9A 5ABJA 4KGKA 5TSWA 5A6QA 4OX7A 2GMHA 3ZYFA 3DI6A 2GMPA 2JFDA 1S77D 4GB32 1SQEA 4J90A 2BNNA 1TV6B 1TR0A 3UN2A 3SMZA 4AQSA 3T1AA 4A8YA 2MEV2 4P9LA 3AQPA 4TY8B 1K0TA 4N7IA 5B7WA 2I0XA 2KVQE 1G8WA 2K46A 4LF4F 2O8QA 4EJRA 4AEDA 1T05A 3L7PA 1YX2A 3MCNA 3GFYA 2C2NA 1PGW1 3CDWA 4IOAQ 2D6KA 1ICEB 4EU0A 4IERA 2WR9A 2MZJA 2QX0A 5BUVA 1WOPA 1LGCA 1TG7A 1DCSA 3NL0A 2HRYA 2OJ3A 2QUOA 3NO8A 3C66A 1JOJA 3AFKA 1YZ6A 5DZGA 2OO4A 1ZBA2 1LOEA 3ZFFA 4C2MA 2VBYA 3D6TB 3FZ3A 4FDFA 1HXS1 4QWEA 1CJPA 3ZKYA 3OL8A 3UVJA 2VG7A 2ASLA 1ALYA 3U37A 1XR6A 3OFHA 2CWXA 1S1WA 4G6VB 4NRQA 2WRMA 4TU7A 1MQTB 3I6PA 2I38A 3MYXA 5I3PA 5FYUA 2CGPA 2LFVA 3C14A 1UWWA 5BR8F 5D0EA 4RD7A 3O1VA 2XSJA 3FN9A 4PCQA 3CCVS 2GMMA 5FPLA 2Q0AA 5D15A 3TP2A 4UQGA 4HKQA 2DHXA 1WKYA 2OSRA 1P1TA 2YVSA 1IGOA 4FXDA 1UJ4A 4TSVA 4KFBA 4HT1T 5JOWA 1O51A 1KOOA 3MUY1 3BO3A 4DPNA 1CJKA 3BS9A 3T30A 4LO8A 1H3DA 2VC1A 3I59B 4IUFA 2GP5A 4DPWA 5FY4A 2CPEA 1WD3A 2FY1A 3IMNA 3BKFA 2B7CB 2DGSA 3JBG2 3JSMA 2GC2A 3FBYA 4N7UA 5FKBA 1EZZB 4QXBA 1NB2A 1AR71 2BDRA 3PX0A 1MS8A 5GVQA 4N43C 1H7WA 2HHVA 3ZN5A 1I3OB 3FUYA 3QGIA 3CD5A 3W2WA 3MFAA 2ZHAA 3UCZP 3KFWX 4DR1J 1E5SA 4DZGA 3H2UB 1EAH1 4IE7A 5FZ1A 4CCKA 2AEFA 2FZKB 1R8BA 3QRPA 2DNQA 4LEJA 3W59A 1PX3A 1X4EA 1RT6A 3TR5A 3V0AA 3FEYB 3D5OA 1S48A 3M2MA 1CZVA 2R7TA 2B42B 3JCIA 3AB2B 5FYBA 2IMWP 2V34A 4K4XA 1VBC1 1S76D 3BM7A 1OYEA 1NO8A 1WCKA 2QJVA 2FJAB 2CIMA 1POQA 1XE8A 2KT3A 4LA3A 3AJZA 5CYQA 1HQUA 4WKYA 3MAAB 5C2GA 3DECA 2VCCA 2EI5A 3GM8A 5HLFA 2B8PA 3M6XA 3SCFA 1HRI1 5LXYA 3UV9A 4WFXA 4FI9A 3EM1A 3MLJA 5B08A 1N36J 3FZBA 3CZUA 4OZNA 1V6IA 3AAWB 2ILMA 4RNFA 1VQKS 3AHPA 1GV9A 3ZDVA 5JCTA 4HH0A 4OL8A 1BVVA 1S1VA 3IBCB 5ETRA 4W4MA 1T2XA 1S10A 1Q5VA 3CZJA 4L92A 1IKYB 1UW4A 1I5PA 2EXKA 4JP8A 3FJSA 1VBD2 3KYLA 3SEOA 3FC0A 1KS2A 1PIV1 4HN0A 2R30A 2EFQA 4YP3A 3VGIA 1H8TB 2GNMA 3DV8A 2YQ0A 4U95A 3BR8A 1DGWX 5IFPA 1XBFA 3TN92 4FOYA 4YM1A 3AOCA 5ETMA 3B00A 5L9NA 1BCXA 3UCGA 1VBE2 5M0TA 1TNFA 4Y26A 2IA0A 3KUGA 2TUNA 1KNZA 4BCUA 3CIHA 1JHJA 2VOOA 5CZKA 4QHOA 4ES8A 4QCLA 4AFMA 1LEDA 4LBQD 4FVVA 2CNKB 1EP0A 5GZEA 2RDDA 3IAS9 4B3TJ 3OYWB 5B4NA 3MD1A 3ZFGB 4KC5A 1UD1A 3CJ8A 1AL23 3A8KA 4YN3B 1P8GA 1TME3 3LQVA 2M5YA 2AHOB 2BBAA 4IFVA 1REVA 5CFCB 2VF3A 1Q8SA 2ZPXA 1WC0A 2W8LA 5E1RA 3GB0A 3WXPA 3ZFFC 4DG1B 4NLPA 4AD6A 1SQ4A 3HCXA 5K8OA 2IC3B 2HLTA 1L3VA 1VQLS 1VI7A 4CXWA 1L3SA 2ZGMA 4LRDA 2DCKA 1Q7YT 2ZHMA 2GQ2A 4LPLA 3O44A 3ZN6B 2QQUA 5KHIA 2DCYA 4NYPA 4XF9A 3O0VA 1DGWA 2BEFA 2NSBA 3ZN4A 3E5XA 1U2RA 4R52A 4LBOA 4FPJA 3CNAA 4WZFA 3HSZA 2CWKA 4R9DA 3VHQA 4UW4A 3TJ9A 5DETA 3ZXLA 2IRUA 3BBFA 4C98A 2YWKA 4CDWB 2FVQA 3O1LA 3AT1B 4IESA 1Q8PA 3DLEB 5H9PA 2OEMA 1LHUA 4DR5F 3PVBB 2XWJB 4K50A 2GC0A 4E8UA 2OW4A 4FTEA 3NVCA 2KM8B 2ORZA 4Y2IA 1NLRA 4DPXA 3T1HF 4RYDA 3JD71 4QPTA 3I2HA 4Q8KA 2FHJA 3C6UA 1R8PA 4J9UE 1A8DA 2PMZD 1K42A 1AXYA 5J96B 1SC1B 4LBMA 1SH3A 4IE4A 3PYEA 3DOMA 2HWB2 1NSQA 1H2LA 3K75B 1T9UA 4CDXA 2C22A 2Y0BB 3KDOA 2I74A 4IEUA 4LITA 1K1SA 2FZ2A 5KAKA 1JLCA 1UKGA 2VTXJ 3HR9A 1ACCA 3MD3A 5DQ0A 3TAMB 3WF2A 1K9MT 5H9EJ 2VL1A 2U1AA 5E41A 2OXBA 3VBOB 4Z2XA 4O3RA 1UPPA 5L46A 3KLEA 1W26A 5IC4B 1RJ8A 5A8WA 1IKWA 3HN3A 5LBEA 4ENOA 1XC9A 1R0BG 4RWXA 5KXEA 1GKBA 5IVYA 3G86A 1S9GA 4YB5A 1U5YA 4D0QA 2BYVE 1N5QA 1MMNA 1FYUA 2UV8A 5M2RA 3DU5A 3IGVA 4LSNA 2Z2YB 1NCRB 2VG5B 4Q1RA 3VAGA 5FZ3A 2DXFA 3DLBA 3BPZA 3MFHA 4FPRA 2XO7A 4PG4A 4LKSA 5T55A 3VZJA 5KT4A 4RR3A 2LXIA 1WACA