3THPA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
333
structure length
304
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVRRVKHFGYKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASEKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB homolog 8
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 304
sequence length 333
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thpA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thpA01
1QM9A 2KH9A 4WF9Q 2GHPA 1ZH5A 1SJ4P 3HHNB 4CH0S 1HA1A 5CYJA 3G6ES 2CPEA 3J7YU 3MUMP 2RQCA 2DGQA 2MKHA 3MOJB 2RS8A 5D77A 1SJFA 1FT8A 1VQPS 5HL7Q 1CVJA 3CD6S 2ZJPQ 1P27B 2M88A 1YJ9S 2DGWA 1K9MT 2KVIA 2OJ3A 4BS2A 2CQIA 2RS2A 4P6QA 2SXLA 3RW6A 1SJQA 1UAWA 2OSQA 2DNYA 3CCES 3BS9A 3DXBA 2XS7A 2XNRA 3VAMA 2DNKA 2X1BA 2NLWA 2K8GA 2XNQA 2MB0B 1JMTA 2KG1A 2CQ0A 2VOOA 2QFJA 4LMZA 2CPZA 3S7RA 4QQBA 1A9NB 4J5OA 1VQ7S 1YWXA 3G96A 3UCZP 2G0CA 2DIVA 4V19X 1VQOS 2EK6A 2VOPA 3L3CA 2QEXS 2PE8A 2KHCA 4TU7A 2D9PA 4TLQA 1HD0A 5ITHA 2DIUA 2DGUA 2HYIB 2KG0A 2WBRA 1VQ5S 5DDPC 1WHXA 1KD1T 1FNXH 1YJWS 3G8SA 2FPHX 3B4DA 3S01A 2CPDA 2EVZA 2MQOA 3VAKA 2HGNA 1U6BA 2DNMA 1X4EA 1DZ5A 1NO8A 2MZJA 2M4MA 2LECA 2MGZA 2DITA 1X5TA 2X1GA 1X4CA 1X4AA 3B4MA 2MQQA 2E5JA 3SMZA 2E5GA 3VAJA 4YUDA 1FJEB 1IQTA 4F02A 2AYEA 2LEBA 1NJIT 2CQ3A 2FC9A 1KQSR 4TU9A 4IUFA 2CQDA 2KU7A 2DB1A 3TP2A 3U1LA 1NU4A 5IM0A 4U67Q 3VAHA 1M90T 2MZQA 3ULHA 5GAHU 1SJ3P 5DM6Q 1WWHA 2ADBA 5FJ4A 2KXNB 1FO1A 2DGVA 1A7GE 1P1TA 1AUDA 2V94A 4Z2XA 2M8DB 1X5PA 1URNA 3FEYB 5LXYA 2LEAA 4W92B 1YTYA 1WHYA 1N8RT 1VQNS 2MKIA 3CULA 2CQGA 2AD9A 2J0SD 2M70A 2MZ1A 2CPIA 4PR6A 2YWKA 1KOOA 1VQ4S 3CF5Q 3R27A 1RKJA 1Q86T 3Q2SC 1PGZA 2EK1A 5JVGQ 2L9WA 3VF0B 4CIOA 2UP1A 2E5HA 3CC7S 2XB2D 5EN1A 2MKKA 1SJRA 3RW7A 1K8AT 2KXHA 3MI7X 3S6EA 3J7ZT 1H2VZ 3CCSS 1S72S 1M5PC 2QA4S 1RK8A 2CQ4A 1L3KA 3CCMS 5GAGU 1DBDA 2N3LA 3CCVS 2AYMA 4QU7A 3THPA 4C4WA 2HGMA 2N7CA 1WHVA 3VAIA 1N54B 2N82B 2HVZA 2MJUA 1WEZA 4CQ1A 1Q7YT 5GMKa 2K3KA 2KYXA 2Q79A 2JVOA 2G1DA 2LCWA 3VALA 2M9KA 2CQ1A 5LJ3Y 1FXLA 2MKCA 2KN4A 2KM8B 4UQTA 5LJ5Y 2DNQA 2VONA 3NNAA 1K73T 3MXHP 2CPFA 2MXYA 2DO0A 2CPXA 1UP1A 5LXRA 1FJCA 2PEHA 1W2BR 1WF0A 2MZSA 2DHXA 2DH8A 4A8XA 3CCLS 2CPYA 2DGTA 4OZ0A 3P3DA 1M1KT 1X4GA 2YTCA 4LIRA 2LKZA 2MGZB 3BO3A 2DNNA 1H2TZ 1O0PA 1DHMA 2J76E 2CPJA 4EGLA 2MKSA 3ZZYA 4WFAQ 2J0QD 4CH1A 4PRFA 2DH7A 1VQLS 4F25A 2D9OA 2CQCA 3UCUP 3S8SA 3CCUS 2MY7A 1R8HA 3HI9A 5JVHQ 2MJNA 2B0GA 5IFMA 1WHWA 3BO2A 3NS5A 1WTBA 5CA5A 3H2UB 2MQNA 2A3JA 4FXWA 4UY8T 3NNHA 2LA6A 4QPTA 5IM0B 2E44A 3PIOQ 4ED5A 2MYFA 1X4BA 3NS6A 2MSTA 2I38A 4WKRA 1OWXA 1F9FA 2LYVA 1U1OA 3P49B 3LPYA 2MQMA 1WG5A 1KOHA 1XN9A 2KFYA 2XS2A 2OSRA 3MURP 2HGLA 2DNGA 2RVJA 3R1LA 3CCJS 2ZJRQ 1QVFR 2NZ4A 3ZZZA 2FC8A 3EX7B 1JJ4A 1R8PA 1YIJS 1FJ7A 2XSFA 2LQ5A 3UD4P 1HL6A 2DGXA 3D2WA 3NMRA 2DNLA 3MDFA 1U1LA 2MY8A 1VC6A 4LJMA 1WG4A 3CMAS 3U1MA 3JB9k 5HO4A 2LA4A 2LMIA 2M0GB 3H2VE 1B7FA 2DO4A 1S79A 1M5VC 2F9DA 2F9JA 2YKAA 3UWTA 2CJKA 2XS5A 4WFBQ 4TU8A 3MD3A 1X5SA 2CPHA 4WFNQ 2MMYA 1U6FA 3Q2TC 1X4FA 1H6KX 2J8AA 2MZTA 3UD3P 3G71S 2DNRA 1UFWA 3THTA 1VQ6S 1M5OC 1WELA 2DH9A 1WI8A 2FHOB 2DHAA 3I56S 2F3JA 2MHNA 5DDRC 2JX2A 5GVQA 2JVRA 4YB1P 1N88A 1U1QA 3DLLQ 2ZJQQ 1YITS 2OIHA 2LXUA 2I2YA 1X4DA 2M52A 3CMES 3VAGA 2YH0A 4WCEQ 1N52B 1VC5A 1VBZA 2KI2A 2MZRA 3MD1A 2KRBA 1U2FA 2O3DA 4WIIA 5GAEU 1U1NA 3UCGA 5GADU 5LSOA 3CUNA 1VQ8S 2CQHA 2YH1A 2MKJA 2DNZA 2RQ4A 3CC4S 1ZZNA 5D78A 2U1AA 1YJNS 2U2FA 1VQ9S 2DNHA 4YOEA 2DNOA 3TYTA 2BOPA 3K0JA 1G2EA 1M5KC 1UW4A 3V4MA 5DETA 4OZ1A 4C7QA 4ZKAA 1FHTA 2E5IA 1PO6A 2HZCA 5IQQA 2KM8C 1U1RA 3PIPQ 1VBYA 5LSLA 2X1FA 1WEXA 1VC0A 1DRZA 2DGSA 3CCQS 2DK2A 1BY9A 3US5A 3R1HA 2KXFA 2G4BA 5BJRA 1YHQS 2JWNA 4RU2A 1H2UX 4W90B 3SXLA 3IRWP 1WF1A 3I55S 1YI2S 1X4HA 3SDEB 2RRBA 3G9CA 2CQBA 4FXVA 1OIAA 3CXCR 1Q82T 1WF2A 1VBXA 3SDEA 2GO9A 2MPUA 2KT5A 3FEXB 2L41A 1D9AA 1U1MA 3N9UC 5CXTA 4PKDB 2ERRA 2RU3A 1ZZFA 2AYBA 3EGNA 2D3OR 2MQPA 1QVGR 3P6YC 2OTLS 2DGOA 3EGZA 2OTJS 2M7SA 4IOCQ 4Y0FA 1D8ZA 2CQPA 2RRAA 2MQLA 4C0OC 2KRRA 2DISA 1KC8T 3IWNC 3P5TL 3LQVA 1WEYA 3CPWR 2N3OA 5DM7Q 4QU6A 1JJ2R 3MUVP 3BO4A 1Q81T 2CQ2A 2L08A 1VQMS 2M8HA 2VODA 3OW2R 4F26A 2M2BA 1X0FA 5DDQC 2MSSA 5DDOC 4ERDA 3TO8A 1U1PA 1U1KA 3CTRA 1VQKS 1X5OA 2FY1A 1SXLA 2RNEA 4M5DB 2JRSA 1WG1A 2DHGA 2X1AA 3BEGB 3UE2A 3G4SS 1OO0B 2ADCA 3CCRS 3NNCA 2BZ2A 5MLCV 1HD1A 2RT3A 1WI6A 1JJHA 5H1SV 3G8TA 3CC2S 3VAFA 2DHSA 2AYGA 2LXIA 4IO9Q 1OPIA 2RUGA 4IOAQ 2DNPA 4Y00A 3MUTP
chains in the Genus database with same CATH superfamily
2CJYB 1DZRA 3J7YU 5FXVA 2HHTA 1C8M1 2EW9A 2W94A 2Q1FA 3HIFA 1QAIA 1J84A 2W87A 1ODNA 4ZP9A 3N4MA 1RWMB 5LM7E 2XQCA 2Y6JA 4KYZA 4Z7YA 3D6TB 2GALA 4RW9B 1PK6C 2ZX3A 2FDFA 4URGA 5FOBB 5FYCA 5J2PB 2B39A 1WMEA 4HN0A 5DQ0A 1DGWX 2VOTA 3KGLA 3T1YF 2E29A 5LRSA 1UY4A 4GB33 2W2IA 3DLGA 1C8NA 4F4XA 5DLGA 1TMMA 4KPCA 5FYMA 1YQ2A 5A7NA 4LIWA 2CUYA 4XAAA 2NXEA 4M0HA 2VUDA 5L9XA 2HFUA 3T3YA 2XSJA 1SC4B 3CNQP 3LAMA 4Q4W3 1YRXA 3V65A 2UWBA 2GC8A 4KGZB 1UYPA 4BQ1A 3UDCA 1X4CA 2HNDB 2R7RA 2VASA 2B4KA 2YQ3A 1CWPA 5BNQA 4M5NA 3Q0AA 3N4WA 4PCQA 4MGIE 1REDA 3KGZA 4G1PA 5IZHA 2R7OA 1KONA 1RVF1 3OBAA 4KWLA 5EX3A 4FZVA 4QQPA 3ITQA 3KM5A 4I7FB 4F04B 1RADB 1W6MA 1XMQJ 4U67Q 4KHRA 3HF5A 4QX3A 5D4OA 3MAHA 4YMEA 1OPMA 4BWMA 3N9MA 4MO3M 3VBRB 2AUYA 1RJ7A 4Q4V3 5CA6A 2HWD3 2RHQB 5BNPB 2GHWA 1ASJ1 4ATNA 1HBMA 3EHKA 4N8NA 4NLPA 1ZM3A 4XUQA 2ZGQA 1S12A 4GH4C 2PI5A 1RUF3 4C8LA 1PYTA 2CDRB 2E5LJ 4QU1A 4FYYB 4FS2A 1JKHA 3PURA 3G6YA 3Q9OA 3TAQA 4EZ4A 3ZTQA 4KJIA 5LOQA 5AE2A 1L3VA 1C8M2 5T3NA 4PI2A 2CJAA 2V5DA 1H2NA 2Y6LA 4S2HA 3MDPA 2PSZA 3V81A 4Y6IA 3CCMS 4RHV1 1RHKB 2JG8C 3WNXA 2DXFA 3AMNA 3THPA 2K2SA 3EZUA 1SV5B 2VZRA 3I2HA 4A8KA 4PXBA 4MSVA 2YQ0A 4S0MA 1W6OA 4NIGA 2KL8A 2WTFA 2XHWA 3ISZA 4DL6A 1AXZA 1S1XA 3EMTA 1QOOA 2W46A 1S10A 2MKCA 4ANDA 4USMA 2HWE3 1R0CB 5KT3A 3RRKA 2Y6HA 4JGYB 3VZNA 4AXOA 2VONA 2R7TA 4EQVA 2CPFA 5A6XA 3U14A 4Z2WA 3A4UA 2RHPA 1KJRA 1FJCA 3ISNC 5KBFA 2AQ4A 4CO1A 4K4VA 3NY0A 4IGQA 4L73A 2WAAA 4FNIA 2MNGA 3MF9A 4L97A 4ZVEA 3DN9A 2QMWA 1Q8PA 3FLRA 4D8MA 4AYUA 3WNLA 3ZZYA 4WFAQ 4NWVA 2H48B 3OGJA 3U7JA 4YY3F 1RI7A 4FF1A 5A3LA 3SI8A 1J2VA 4E8DA 4NL5A 3DLBA 3GBFA 1XQIA 2WZEA 4KY3A 5EQUA 1GX6A 1S1WB 1HW5A 2E7XA 2A2CA 5KFQA 2A3JA 4L8QA 3RG0A 4CXYA 2HWIA 5K8OA 1QJY3 1S97A 2UXBJ 4F4ZA 4DV1F 2ZOGA 1NXIA 1EV13 4K59A 1QJX3 2P6CA 2QQWA 1RYYA 1EIYB 5CKMA 2LYVA 3VCDA 3POFA 3IDEA 4OUMA 1KOHA 3CJKA 3ACLA 4X8NA 1HJFA 3PM9A 1DFQA 3NOCA 3R1LA 1K1SA 1F2HA 5D2AA 1VBC3 2RS12 1JNZB 4Q29A 2DVDA 2HJIA 3KCYA 1JODA 1R8PA 3H5SA 4IH6A 1GMMA 3UD4P 3D2WA 5FZ7A 1LW0B 3HNBM 3PG9A 2LA4A 3ZO7A 1WKKA 3K5OA 3QSIA 3CHXA 3URFA 5FUNA 4O0NA 2KKHA 1EP0A 3MR5A 1GNYA 3UWTA 3NAPB 1QSYA 4OZ2A 1SVDA 1JI6A 3MIHA 2CPHA 1GMUA 2VBBA 2XLFA 3U1XA 1PAEX 4GJZA 5FKCA 1SL2A 1RAOA 1WELA 2ZHBA 1TMF3 1NZIA 1OVSA 5T54A 1M0SA 1DP0A 1W6NB 4RHV2 1WD3A 2XHKA 3T5KA 2KFNA 4KHPF 4NXMF 4EK2A 3VBOA 1JZ3A 1GTEA 3EVMA 1YJRA 4RBTA 4B17A 1UKUA 1U5YA 1U24A 4JRLA 3SCLE 3TUPA 1OYDA 2JECA 1VI7A 2YPYA 3VAGA 1S2BA 2GC2A 4H4KA 4LBIA 5CFCA 1DARA 1KQFB 4N56A 1Y3TA 3GG1A 1HQWA 2DXEA 4RYDA 4JQTA 2EFNA 4BU2A 2H5EA 2Z2YB 5D78A 3EDRB 1N0VC 2U1AA 1BQPA 3SEPA 2C3YA 4YOEA 3TI0A 4C97A 1CJTA 4RW6B 1PO6A 3WX8A 3M1VB 1PGSA 2ILZA 2CA9A 2HWF3 4O4GA 1JLCA 5KFXA 2D41A 4AQ2A 2CXEA 1XXNA 1BC6A 1C1BB 1OA2A 1VC0A 1AR93 3WNPA 2IDEA 3H9AA 5IT4A 1YFWA 4R8HA 2LS6A 4JTNA 1R091 2W39A 3AX4A 5FLHA 3IC1A 1UL9A 2KXFA 1PBAA 2G4BA 2ROGA 2D6MA 2EFOA 1TVRA 5MAOA 4Q43A 3WC2A 3U07A 2DHHA 2IIHA 2WDBA 1CONA 2DXDA 1SB6A 1FMD3 1WF1A 3VD5A 1B35B 3TYJA 4DR4F 2VAUA 2O1QA 3CXCR 4NHLA 4P9WA 1WKJA 1PM4A 2WHOA 1UCXA 4EWAA 3KG1A 1HNXF 4HACB 4XJ8A 1RUE3 1VBXA 3SDEA 2ZC3A 4CP1A 4OJ1A 3UR3C 2E53A 1OLME 3G82A 3N7MA 2OTLS 2ZBIA 4AI1A 3JB4C 3MZIA 3DGTA 3QT8A 3HR9A 4HL0A 2RRAA 5CYMB 3ZN5A 4UZBA 4L6V3 1PGL1 2FVSA 2PELA 3DGPB 3J7YI 1S55A 1CQNA 3E97A 1MMDA 3RZHA 3JXOA 3MPYA 5C33A 1TKTB 3BO4A 4FXKB 4DCPB 4R9BA 4P9GA 4NE9C 4E2FB 4GULA 5B4NA 5KT6A 3T1MA 2CZVC 2MEWA 3WDVA 1VQKS 5B0EA 2XHNA 3CJ2A 3ZFFC 1SXLA 5DMYA 2POKA 3GCXP 3KSCA 3UN5A 2XGXA 5KG4A 5BXXA 2XDVA 1VS3A 4CYUA 2RT3A 1VBB2 2GMLA 5H1SV 4UFLA 5J1EA 3B5LB 3NL1A 2C5DA 2HSEB 1WCSA 1SACA 3HHNB 3I4HX 3GFZA 2YKOA 3G6ES 5K7PA 2Q1LA 3MUMP 2VG5B 4G9SB 1T3OA 5I3UA 3WSOA 3CZJA 2OUJA 4CPBA 2YKMB 4NMXA 4P7VA 2GIFA 2RS2A 2DFCA 4MH8A 4IG0B 3RBZA 1FRXA 3ZOIA 4GKKF 3PJXA 1X31C 4GO5X 4FNHA 4YG3A 1S1TB 4BC9A 1T6BX 4PXDA 3BSCA 2MB0B 3KT7A 2KG1A 2CQ0A 1TQ5A 2XVGA 4ARXA 1PJ7A 2ADDA 4EROA 1R092 4FOVA 5C3PA 1AROP 4PYAA 2IXCA 1R8BA 2K3IA 4BPZA 3O1TA 2EPIA 1JZ6A 1UOFA 3EICA 1DU3D 4NCBA 2IHR1 1UY1A 4U8VA 5FZ9A 3J81Y 4OJGA 3JD72 2EVZA 1U6BA 1GXLA 5F8LA 3TZZA 5CQGA 4LVOP 3BGAA 2YWWA 1M1HA 4U7UK 1NKCA 4DB5A 3UDVA 4CSWA 2DBBA 1OI6A 2E5JA 5ACA3 4XMIA 1HNZJ 4CDXB 1FATA 3QBCA 3UI3A 3K57A 1H1MA 4UT5A 5IVYA 4BMBA 3EYZA 5FZ1A 2HS4A 3OBRA 3LPEA 4DN9A 3NVCA 3QRQA 5LASA 1WZXA 3GONA 5BNOA 1PBUA 4X65F 3MW4A 3WEZA 1S1AA 3VAHA 3GIJA 3USUB 1N5SA 4L2NA 1IPKA 3OSPA 5HMWA 3DLJA 3JSMB 1PX4A 1SBDA 4EMDA 2ZX4A 4LF6J 3KLFA 4ZVPB 3NV4A 2B51A 3JBG1 1UW8A 3ZFFA 3PV8A 2ZMKA 4DUTA 4WV8A 1V0AA 2UYBA 4AW7A 1RVF3 1I5ZA 3POEA 1KGYA 4TVAB 4R8UB 1N47A 4FPJA 4O3QA 2PEBA 1JYCA 3CMQA 2K46A 1LWEB 1Q86T 2EK1A 5JVGQ 4D7SA 5F6LB 2VCMA 4Q8EA 4USUA 2BE2A 3VGVA 1CQ9A 3EDQB 5A3NA 1K8AT 3DM2A 2ZD1B 2VD7A 4KU8A 4I2PB 1ASJ3 1L3KA 3HXMA 2QRRA 2DBIA 1DLOA 5KFZA 4CO2A 5M2PA 1QJHA 4FAGA 5KG0A 3DRPB 2A1BA 4M5IA 4CM2A 3ZPOA 5LMUF 5KHGA 5A32A 1QNYA 1YI9A 1NNDA 2YU1A 3BTZA 5FPXA 2K3KA 5GMKa 4RFRB 2GJFA 4OV1A 1EAH2 3N6LA 2R3VA 1AUSL 2KN4A 1PMHX 3OYWA 4OYXA 3OD2A 5FZFA 5B7WA 1RTDB 4K50A 4WVMA 1BBT2 4K40A 3SSRA 1RT6A 2YDEA 4I2OA 3MMJA 1N0UA 4AOCA 2P3YA 1BQMA 1S1UB 4H4MB 1DQ4A 1UJ5A 5AVAA 4LULA 2OEJA 5HN0A 3QT5A 4OQ9A 4QXKA 3H3UA 1CGPA 3B93A 3PJWA 3B82A 3HT1A 2VU9A 1XE8A 2YBVA 4P9XA 3I2FA 4RW4B 4DHVA 1ZTTA 5EFUA 1TE1B 3DDIA 1FNOA 3C7FA 2VG6A 1YRUA 3H2UB 2CZ4A 3HD8B 4ILRA 2WK4A 2VCCA 1R082 3VHQA 3WVJA 1EARA 1OKOA 2HFNA 5KTQA 2DCZA 4GVLA 1BUXA 3ZSMA 4CPBD 4U95A 2VICA 1U1OA 1U12A 2EIGA 4G4FA 3AP4A 4ZLPA 1K45A 1RZMA 2J5AA 1U47A 3PNAA 2PHXA 5KT5A 4ZP7A 3FVYA 4B3MF 4DV2J 4DQAA 1IKYB 4RN5A 1K47A 2VA3A 2VNGA 1S6PB 2YWEA 1RHI3 2H9ZA 5LMNF 1AL23 2BGOA 3BCWA 2QSFA 3U1MA 2E9RX 3H0OA 5A0YA 4OZXA 4JV5J 3DCAA 3ONQA 1MWQA 1BLZA 4MJKA 4QDRA 3H1MA 4Z82A 2YX1A 4MKYA 1Q8BA 1NK8A 4ZHNA 4G1IA 1HXS1 4WK1A 1TFWA 3THTA 1WWYA 1M5OC 4LOSA 4XUPA 4HT7A 5ADZA 3I56S 2RKIA 4DIQA 3V0BA 2AF6A 1PX3A 1LK5A 1WW5A 2VZPA 2BJ9A 4YEAA 4WM8C 3ZX7A 4Q8FA 3NAPC 2CG4A 4MK8A 4QGLA 4LK6A 4CCCA 4DRRA 2H0VA 3I7DA 2LUWA 1CESA 2J1RA 3ZTSA 1I6JA 3HX9A 4UF4A 2EALA 4A47A 3JTPA 4CU7A 4NEZA 1Q4RA 3RI8A 3DHWC 3GIIA 3CD7A 3BGOP 4J91A 4CUBA 1RBAA 5HJYA 2QDNA 4LLOA 1IUJA 2BGPA 4AEDB 3VZMA 1FKPB 1R0BG 1U8SA 4UW4A 4ECZA 3NWKA 2YPJA 3H50A 5I0UA 1VQ9S 2F8MA 4Q0UA 2HNZA 3T2TA 2PMZD 4JKLA 3BTXA 3QIPB 1UMJA 4C7QA 2A70A 5AC91 4O61A 1K44A 1AYM1 1ACCA 1K5MA 3HFZB 1BXHA 1NLSA 4TNOA 2GU9A 1VALA 3B02A 4BYYA 5DPNA 3QGPA 4MIWA 3WX5A 4B9TA 2D74B 3AB0A 2GQ2A 4A8WA 5DUVA 3OSNA 4Y1VA 1FK9B 3ENWA 5JUMA 2QG9B 3SZ2A 4Q8LA 5THWA 1KITA 1IPJA 4AQ6A 2VM9A 5A33A 1T03B 1D4VB 1J59A 2O01C 1C4RA 1RU2A 3KDNA 1P8JA 1JLAA 1YYNA 4HZFA 1JUHA 2HKXA 4YARA 1WF2A 4AZZA 3D4KA 2B5JA 3A8IA 4F8RA 4EEYA 5DZ6A 3RB0A 3FEXB 4G6VB 3V0AA 4K6BA 2HKEA 4X4SA 3OL6A 3M3QA 3WDUA 1J58A 2E7WA 5A8KB 3PX0A 5IVJA 2OTJS 1WC0A 4OYZA 3LOIA 4PIXA 2JEIA 5KG5A 3K5MA 2XKOA 3VN4A 2EEYA 2YROA 3DXUA 4XJZA 1UVNA 2N3OA 1NCLA 4YW2A 2B7BB 1SHWB 1C0TA 3KT4A 1HBNA 4CP0A 3ASIA 2D7SA 2HHHF 3ELHA 3HSDA 5C42A 2YC2A 3N3HA 3KHRA 3H8OA 4DF8A 2A3XA 1UVLA 1IKXA 1HXS2 1MZFA 2W8LA 3GBGA 3A3NB 1B09A 3IPVA 5A7SA 2AX1A 1WI6A 1EY2A 4M4RA 4KQZA 4GIQA 5IC4B 2XUEA 1UPMB 1WW6A 5FY8A 1JW6A 4ICLB 1ZBTA 4AEMA 3SEOA 4FSJA 2Y1LB 1SIWB 2WO7A 4XZPA 5ETNA 2GVDB 3CIHA 1RHQB 2PHWA 4WM8A 3T09A 2ZGUA 3MOJB 4TXWA 1F2GA 4GMP3 2PA3A 2COLA 4FBUA 2PHDA 1V9U3 3KS7A 1YJ9S 4GKJJ 2RRNA 2N4CA 3IR5B 4MFBB 4ZZ8A 3POJA 2WNUA 2DNYA 1ZS6A 2V4JB 2VFUA 4P9YA 2NLWA 3L9JT 2EXIA 4FKYA 2FZGB 3MM8B 4GC7A 5AC92 1H1IA 3RJ2X 1AYM2 3VDDA 4PUOA 3G96A 4YZ1A 2NMNA 3ZC4A 3GJTB 1A0OB 2L3MA 4DR1F 1BK1A 3H98A 2WVCA 2ZGKA 2D9PA 4TLQA 2VQTA 4B7EA 2PD1A 3POBA 4NLOA 3W1YC 2ES3A 3RZMA 5A2QY 1LNQA 1SDDB 2QQVA 3KLGA 4YGBA 3POSA 3AQOA 3IS9A 4NLVA 1OMSA 3HT2A 3JS9A 4J6GA 2CPDA 3O1LA 3OTOF 2KYZA 4A6SA 2HWTA 2LECA 5KXDA 2UUAF 5GM0A 3SMHA 1JOBA 2NZCA 4JI1F 3U4XA 2ORZA 4FYWB 2JDYA 1COV2 3DMJA 2UWCA 4N9HA 1F4AA 2CVEA 3TZXA 4NI2A 2XHCA 3GE9A 4LITA 3SSQA 3RGIA 2ROEA 3DNCA 3UW1A 3P8BB 2VO5A 4TTGA 3CO0P 3N5FA 4HXCA 2J1VA 5GAHU 4CU6A 2XY7A 1JZ5A 1U2CA 2MLYA 4N7TA 3FQKA 2VUGA 2V94A 5EDWA 2BW8A 2WZR1 1X5PA 3RVHA 4TY8A 3U11A 3MIFA 1IR0A 3AT1B 2ZGNA 2GN3A 1TP7A 2MKIA 4JV0A 2GHVC 1F60B 3I59B 1J5OB 1RSCA 2M70A 2KD7A 2PAEA 5I0DA 1B0PA 2FQQB 4I0BA 3QO9B 3MF5A 2ASDA 1HBUA 1L3JA 4XDOA 2EAAA 5A3UA 2QE5A 2E5HA 4I30A 1CZSA 5F3ZA 3NKYA 2VVEA 3ZKYA 3IBMA 1FE4A 3NS7B 1RT4A 5L9BA 1S9GA 1FRIA 1RK8A 3JBG3 4M8LA 2CGPA 3DRYA 3A1YG 5LRRA 2GJIA 2C3OA 4CUGA 2N7CA 2OUHA 3R9LA 1NHKL 5JZGC 3N01A 3D6EA 2O0OA 3W2VA 3LP0B 1YBTA 1SKSA 1W2IA 4KGXB 3ORJA 1AVBA 4ETXA 2VVFA 4NRMA 2M9KA 4ASKA 1T7PA 4K2JA 4NHXA 3EXUA 4MK9A 4USTA 5C4WB 2IVJA 4BLIA 2UXDJ 1HRV2 5IT6A 2LQJA 1H1AA 5LBBA 2G1HA 1NB2A 2F4FA 2HZAA 4P72A 2ZAAA 4OZ0A 2VA2A 1AR82 1PZ9A 1XMOF 1S48A 3H1WA 1IXKA 5KFHA 2WFPA 1W3VA 3TNQA 5CKNA 1OFNA 5FDLB 4XPVA 2D97A 2WAOA 2XCPA 1UWBB 1I94F 3TVKA 1FA0A 1UZDA 2E7TA 2XY5A 1GBGA 4QYZJ 1NDCA 4F7VA 2NXCA 2HQFA 5IFMA 2F40A 5CFDB 2XH6A 2DU0A 4LNVA 4GWMA 1WC4A 3MHZA 1LFPA 1T6GC 3V6HA 4RNHA 1G1XA 2AEYA 2JB4A 3OQ2A 3CF6E 2B8PA 4LQRA 2WVFA 3RR8A 2CNLB 2VPWB 3KLVA 4M01A 5F9TA 3FFIA 4LBLA 3CQOA 2VZVA 1XN9A 4H55A 2XS2A 2VQEJ 2UUWA 3FRZA 2RE1A 2IC3A 1W6PA 3I3EA 2R041 1QVFR 2Z42A 1MEC3 2XWXA 1WORA 4G65A 5K8SA 3EX7B 2JDAA 2P9EA 3MEDA 5C25A 5I91A 1AR61 2PHRA 5DDJ2 1VK3A 5C3OA 3WDTA 4CM0A 2RDQA 4RSUA 4A41A 3BH6B 1TK5A 2WW8A 3RJMB 2YKAA 5C24B 1UA1A 4CDWC 1SCRA 4K4WA 4ECQA 1RWXB 2Q43A 5H9FK 1RUD1 1LU2A 4B9VA 4UT4A 3K46A 5EUHA 3HMYA 1SZBA 4N8MA 4ET7A 5JXJA 1KTQA 4P74A 3UVJB 3PKYA 2VNRA 4XUNA 2HS0A 4B3SJ 1N88A 5F8HA 3I9V9 5I4MA 5FOJB 3O8WA 2I2YA 4Q45A 4NLGA 1DQ2A 3NRUA 4KG0A 4HLTA 4GWJA 3RB4A 1VB2A 5HANA 5GAEU 1U1NA 3UCGA 1W06A 2HH9A 2WZ1A 3C46A 2CQHA 1GQEA 3O3LA 3CJIB 4XTTA 2RVAA 1E6VA 3THDA 3K2YA 2ZWPA 1BJQA 3J8F2 5DQGA 5KFPA 5GZGA 2P2CB 4DV5F 3DOLA 3M8WA 3ZXGA 3QJLA 2C4XA 3X3UA 2BQPA 2VXRA 4AE5A 2HBTA 4AEDC 2X1FA 1ULRA 2D5HA 3C7HA 3MR3A 5FZEA 4HMZA 3MM9B 4ZCLA 1HWIA 3LAKA 3HNYM 4RR3C 3KQRA 4KU7A 2WNVA 4HYKA 4RPFA 1GKBA 1H2UX 1HNWF 2HQGA 4N76A 1CQMA 1MS1A 2LDIA 3TVYA 3AKQA 4JI4F 3IN5A 3H7JA 1S0MA 3W58A 4JI5J 1HQUB 2ROPA 2VC9A 5HATA 2R062 3RYPA 2JEJA 4I68A 2H51B 5HVFA 2VECA 1W8NA 2ERRA 3M2UA 4ANCA 2ZVIA 4NLSA 2R042 2WZ8A 2R072 2Q66A 1C4CA 4I6AA 3H2LA 3UYJA 4NXNJ 4ZLJA 1KEXA 1R1A1 2F5GA 4N53C 1H8TC 3E5QA 3DPRB 1N5YA 5ABJC 1NDKA 1JXNA 1MN9A 4QU6A 1S9FA 2RH3A 2CAUA 2WNOA 4K1ZA 2RB7A 2PTMA 1IBLF 2L48A 3BGRB 4RGGA 5J1NA 3GU0A 3K4AA 3T0BA 1RBLA 5LY1A 2PFDA 4CDWA 3UE2A 4KWKA 3OTEA 2RR11 2VDHA 3I54A 2VDIA 5C2CA 3RAQA 1LOCA 1MLAA 2W25A 2NQPA 3UV9A 3BPZA 4F2RA 3ME2A 4BIFA 3G7DA 1K5JA 4AL9A 5IVBA 3VAFA 1KRIA 4E2GA 3PW5A 1U0AA 4HVOA 3QACA 1OPIA 5CYJA 5L9RA 1PIV1 4TLRA 3RTVA 4C1WA 4DPWA 3K5LA 2V67A 3GJRB 4DR7F 4F0HA 2DGWA 4OYIA 3ZYPA 4X66J 2XCAA 2CQIA 2D6KA 1LOUA 1YFYA 1UXXX 3GJQB 1MACA 2I74A 2V4RA 5ACA2 1J27A 1UAWA 3AD7C 4CLWA 3HLUA 1V6KA 3DLEB 3VAMA 1EP4B 4QPGB 4XBNA 2ZEXA 1ONAA 1AR72 5FYVA 2QFJA 1BEV1 5HI7A 1OY9A 1W03A 5C5TA 4XFHA 2W9BA 3TVZA 2BBEA 5DAVA 1YC61 2HWHA 4MVTA 4XW3A 4MYEA 3ZZRA 4ZPIA 3EO6A 2PE8A 3G6XA 1SLLA 2QZ2A 3W3SA 3KYLA 1POV1 4Y5SA 2DGUA 4DXZA 3GHMA 5LBFA 5IV3A 1H73A 2W4PA 4RU9A 2ZH7A 1Q8LA 5HVGA 3NGKA 1NCQC 3PJ9A 5EPAA 1N5TA 5K0UB 1JZ2A 2YFZA 4BCAA 4JI8J 5GAHI 1EHWA 3CE8A 1KHVA 3S01A 2RJLA 2YWGA 1S0VA 2DNMA 3Q8BA 3VZJA 1X4EA 2RUSA 2XB6C 3NKTA 3LWMA 4HVQA 2QFIA 1DYOA 3HQUA 1Y9GA 1ICEB 2X1GA 5FO7B 1ACMB 1X4AA 1FXDA 3I4IA 2AMCB 1HI1A 2PGCA 1FNMA 4COWA 5JUVA 4CDUA 2VZ1A 1R1A2 5KG2A 4IQXA 1FXRA 3BOPA 1KRPA 3I3MA 4YVSB 3FDSA 4I3PA 2VPVA 2WVEA 5CG9A 2KT2A 3MECB 4USVA 3KHHA 4FP3A 4AI3A 3T1AA 2E51A 3R4DB 1OSCA 5KFWA 3HHLB 3MMBA 3AXDA 3E5XA 4WYWA 3MLKA 3DXTA 5F3EA 2RILA 5T14A 3VBHB 1RTHB 4WJBA 2F6BA 2XWBB 1N8RT 1AB8A 3GDBA 2QQMA 2GMPA 5I3QA 2AGOA 1GZ9A 4AFDA 3FK4A 3I2KA 3D0GE 1OT5A 1SPPA 2JEFA 3I0RA 1FRHA 3NNJA 5ISLA 2XB2D 1ENSA 1RLCL 4ENOA 4DQQA 3PLQA 2OPSA 1H6XA 2C2OB 2KXHA 5FZDA 4OMFG 3IMQJ 5F8PA 1M5PC 2WZR3 2EICA 5FYUA 2GMEA 2QQNA 1OH4A 2J6UA 1QAJA 3VHRA 3CCVS 4R9CA 4LFAJ 1O4ZA 3IDAA 1WHVA 1IKWB 4LUMA 1T9WA 4GWIA 3AMPA 5JWPA 2QQPA 2MJUA 3LB9A 1FX2A 4LFCF 3HMJG 4BMEA 4YR3A 1BE4A 3MLLA 4LR4A 3UDEA 2OQ7A 5C8CC 2VMHA 4CA9A 4AFCA 1MQTB 2OXBA 3RBEA 4LOTA 4NIIA 5LJ5Y 2YZ4A 1W90A 4OHZA 2QE3A 3WY6A 2MXYA 1FNYA 5FK7A 3SCHA 5ETVA 4XHXA 2V9KA 4YPJA 2OMOA 4CCDA 1YZ6A 4ZPTR 4FXDA 3CCLS 2IMWP 3SXWA 3W61A 1RHI2 4AVAA 1B7YB 4LBKA 3T6BA 1LU1A 1NCQA 1ZZ8A 2MGZB 2VMGA 5GALA 1XR6A 1HN1A 3AXEA 4YNIA 3DLHA 4CH1A 4NRPA 3ROUA 3VQSA 3BH7B 2Z56B 4EZHA 2IM1A 1F35A 5HJXA 5IVEA 3LGNA 1WDTA 4IE0A 5FJHA 1CD3G 3B00A 1MNEA 5FP7A 4IFVB 1QJU2 4RLEA 2V8PA 4PPDA 4HHJA 3H7HB 4IV3B 3USSA 2F4VJ 2Q3PA 4ZXKA 1X9SA 1N6QA 4DV6F 3V6JA 4CLPA 4IV1C 3TR5A 2VGDA 2OSRA 1XNKA 4Q4X1 2IJRA 1WLCA 2E9ZA 4PG6A 3SCGA 4I02A 2FC8A 2VOXA 2FD2A 5F39A 5KFDA 3R8YA 4Q2MA 3ZTOA 2O8OA 1FRLA 3T2PA 2EC0A 3OHBA 1FOD1 2RF2A 1OXCA 2R7QA 5CZVA 1H6YA 1X5SA 1JJCB 4DUYF 2V4AA 5A8RA 3HAGA 3QMQA 3H59A 3RRHA 3TWIA 2OKQA 4WTOB 3OFFA 2F3JA 4LXLA 3ZIXA 5GVQA 1AR63 1FVSA 3R05A 4RW7A 2HFSA 2V34A 4U96A 1NA1C 1B0TA 2J0XA 3CDEA 1S2EA 1T8EA 3GFHA 5EJ1B 4O23A 3KNAA 2ZJQQ 3LP1B 1NZAA 2JLFA 2M52A 3TAYA 3WCRA 2PMHA 1VC5A 4ATFA 1FAYA 1TNFA 4NASA 4RUBA 1RUD3 4WIIA 1W7WA 5KHJA 5BR8J 2ZZMA 4DR6J 2X5IC 4DPXA 3I32A 3EVWA 2TBVA 3FJ2A 2ARAA 2VQFF 1HWUA 3Q8AA 1YJNS 3GYXB 1SI9A 3TYTA 1LW2B 1QJFA 3GFXA 1U0HB 3ZZTA 3LDKA 3BB6A 2XJRA 2HNYB 2VQ0A 2HURA 2JC0A 1VBYA 2E7QA 1A6LA 5KFAA 1H30A 4NPMA 1RUJ1 1VMBA 3HT3A 5FMOS 3TEXA 3RZLA 4Y4YA 4RWWA 4X2BA 5J3UA 2Z2MA 4KHPJ 1SLAA 3GPAA 1Z2LA 1ULEA 3ETQA 4KO0A 4I67A 5FIXA 1Y3KA 4JGZC 2ZEZA 4W6YA 1SLIA 1XNQF 1UKGA 3NV1A 1MS8A 4DBQA 3I55S 5D8AB 1LEOA 3F0NA 3RRGA 1Q82T 4ZA1A 2JH3A 4Y1YA 1VMJA 4ZPBA 1D9AA 2LTNA 4RUAA 4LBOA 4QB6A 5D6GA 4B3TF 4O3SA 3A4TA 3BUCA 1QHDA 4CEYB 1S5ZA 1NSPA 1QVGR 4B9UA 1FKAF 5J2QA 1BQNB 4OX9J 4IV1A 3EGZA 2Z2ZA 1POQA 4IOCQ 2Y9HA 5K4LA 3GZUC 1V9U2 1EPZA 1GH8A 1ZRFA 3GALA 1W25A 4DI6A 3PVBB 5BNNA 3MOZA 2DISA 1NZ8A 2VNVA 1OHFA 2CWMA 2YU2A 3W9AA 4K8RA 1FOD2 1DTTA 2KXLA 3GP9A 3N7LA 1UVKA 3FHIB 4NROA 4ID5A 3PEHA 3M2RA 3GIRA 5K14A 2JG9B 2VCAA 3RQ0A 3SQOA 3W8PA 2ATCB 4N77A 4KBIA 2FY1A 3HJRA 3OBTA 4LF5F 1I5PA 3HHDA 1V9OA 1NY72 5J98B 4O44A 5FK8A 2QLBB 1IQAA 4PLMA 1BMQB 2DHSA 4DL7A 5HQ8A 4ANEA 2VG9A 4IO9Q 4B4PA 5HV0A 2Q8EA 2ZVSA 1ND3B 2QVSB 2UY8A 4MK7A 1WCKA 1NA1A 1T2XA 1DHKB 3KJNB 2IVFB 5HL7Q 3P5BA 2ETEA 1DFDA 5LSRA 1CVJA 3H8XA 2RJZA 4XE9A 3K3NA 4WXOA 1JLFB 1SUQA 4CDQC 3K7RA 4L9BA 1SKUB 2GNDA 2ILYA 3CCES 2X5IA 2XNRA 2K8GA 1RT5B 4AHZA 1JMTA 5E3PA 1U2RA 2GCFA 4YZ3A 2MEV1 1LWCB 1Y5IB 1TTHB 2ZGTA 4FP9A 1PIV3 2GVZB 1SQ4A 4RUHA 3UCZP 3QAUA 2DIVA 1VQOS 1YLXA 1XNRF 1KKHA 2Y8YA 3HP6A 4Y2IA 2PO4A 3HVTB 3RYKA 3P96A 2VOWA 1D1UA 2VW0A 3EJMA 2Q0AA 2D3UA 4QX8A 3WQ7A 1TME3 3GHNA 2XMAA 4RA0A 3JQMA 4AAXA 5DDPC 4EYHB 1WHXA 1GXUA 4R4XA 4WWSA 2A6OA 3FCHA 2FQPA 1UN1A 1G86A 1LGCA 4NRQA 4IDKB 1BEV3 1NO8A 2MZJA 1F8VA 3R5BA 1FYUA 2V8VA 1MVQA 2WS91 1UWAA 4K5SA 2ZOFA 2ZNYA 5J7MA 5B4XA 3OD4A 4AI2A 4LF1A 5F32A 2KJVA 1UJ4A 2E5GA 2VNOA 2GC1A 1POV3 4QIEA 3AM2A 4GKKJ 3PYDA 2ZBRA 4ER8A 1CPZA 4Q1RA 2Y38A 4IUFA 1OY8A 1W26A 4Z92B 4HT1T 3U1LA 4BZ4A 2BNOA 5IJRA 4A46A 2RDRA 1O6UA 4CRQA 3EZ5A 2Z79A 1STMA 2QMXA 4RX6A 5AVPA 4I7FA 4J9PA 1SJ3P 1UY0A 4JHZA 2ADBA 1N5QA 4M95A 2ZJCA 3UL2A 4QPIC 4LHSA 3Q8FA 4AGRA 1LFWA 1H38A 4ES9A 4W65A 3UNGC 4EWDA 5BNPA 4DFJA 4V19J 4C8NA 2AD9A 3C6UB 3KV5A 2EFQA 3UFCX 2RS33 5HROA 4C48A 3VUOA 3I5CA 2L9WA 2DTJA 3M8LA 3J4UH 4ZIVA 2MKKA 4YFUA 4AQYF 2XMTA 3CEWA 2YBPA 4B29A 1E5IA 1XB9A 1QE1B 3ZDSA 5KXBA 2UV8A 1LQ9A 5IT9Y 1LEDA 3O12A 2JJ4D 4HI1A 2E1MC 2HK3A 1FJGF 3MEEB 4EBDA 1SV5A 2MEV2 1NKBA 5HK4A 2YVSA 2JVOA 1LODA 1OUXA 4NHMA 3RBXA 1YDLA 3TAMB 4WE1A 3VD7A 2YC0A 1YUDA 4PG8A 1Y7BA 4KFBB 4IW3A 3ZYHA 4IGOA 1F0XA 2ENRA 2AH2A 2J9DE 3PW7A 3ALQA 5DJBA 3BPSA 3JQJA 4AVVA 2A3WA 5L1IA 1M1KT 1HV0A 3VKNA 1XC9A 2NZ9A 4XYXA 4MZUA 1DHMA 2QV6A 2XVLA 1PZ8A 2MKSA 1UWWA 3JSYA 4A6OA 2CNAA 3LCPA 5AXKA 5FZGA 4ZP6A 3QQCD 2MJNA 1IBKF 4AXIA 3BO2A 5FYZA 1DYKA 5FZBA 2ID4A 4DPOA 3W62A 4YHHF 1OD5A 1ULDA 3T9NA 3W2WA 4RFT0 4CEWB 5KC6A 3D68A 1S0GA 5B0GA 4K0KF 3GCWA 3FHQA 2C1EB 3AOCA 3MM6B 3DKWA 1HYSB 2VC0A 1LENA 4DXLA 2KFYA 3IR7B 1NJYA 1TKXB 3MURP 2QLFB 2NZ4A 3EJKA 2HEVF 1E5SA 2JFDA 4LF9J 1RUI2 2B46X 1QQP2 5FBZA 3VDCA 2I9SA 4ELVA 4DNYA 4IV3C 1HL6A 4QMAA 4QPIA 4LJMA 3HZEA 5FP9A 2NS1B 2A5ZA 3AODA 4ZJOA 3JB9k 4H54A 1VP6A 4A42A 1F1BB 1LW0A 4I0WB 4B7KA 1OH3A 2CJKA 4P9JA 4A8FA 1LRHA 1NLQA 1JXVA 4PDWC 4LT5A 1UZZA 3AK0A 1X4FA 2JHEA 5FIIA 3UNYA 2J7MA 2LFVA 4JI3F 4PXCA 4I3GA 2QQKA 4Q4X3 1RUH3 2RD5C 2PMWA 2O5DA 2WOMA 5JOXA 4K21A 2FJAB 1EB0A 4KNCA 3SV3A 1PCAA 4BBYA 4X62F 1YFXA 1K0TA 1NCRC 2I8EA 2RQMA 1W6NA 4JI6J 1YJLA 1SL0A 4YW7A 1PYSB 2R7UA 3OCPA 4BOWA 2KHDA 3Q8UA 1WA6X 4LRCA 3ON7A 1DCSA 5T52A 3DHXA 5CCMA 4ZS3A 5H9PA 3R2CJ 5CIRA 2XJPA 4Q2LA 1U2FA 2BQRA 4LO5B 1HBOB 3M8ZA 1GX5A 3NBPB 2QBXA 3WNNA 3AZZA 3GQCA 4NYOA 4FO9A 2ZH9A 5JXGA 1TG7A 4XUTA 5DS7A 1XE0A 1JLEB 3EZOA 3V4MA 5LW9A 2BERA 2HHUA 4P2MA 4B3RF 4AFMA 3IRXB 1HNIB 1LHVA 3M1VA 1LKZA 4O3PA 1WOOA 4Y20B 2ZZTA 2GH8A 3FWEA 4DV7F 3WOGA 1M4WA 1S77D 4ZY9A 1C1BA 4WM7C 1HPZB 4DJBA 1IBMF 3Q83A 5DG9A 3M7AA 4V1Ak 2XMWA 4NPLA 5BJRA 2LROA 1W8WA 1YGYA 1D3WA 1YEWA 4OYUA 3OTDA 2ZTNA 2AEJA 4BQYA 2CWSA 4JCKA 1YX2A 3MM7A 2AWZA 2ATLA 2BANB 2ALZA 4FXVA 5KFRA 5J1XA 5LK5A 2BQ3A 2JD4A 2HK2A 4Y22A 2G2ZA 4URQU 5CD4A 2HHSA 2BV4A 2DEJA 1U48A 3HOBA 1HHSA 5LWBA 2DF7A 4IFYA 2LEPA 2YWHA 2B9UA 1H8VA 3MW3A 1RTJB 1RUJ3 2DCTA 5K9FA 3D0JA 4QX0A 5LEJA 2RM21 4ZVFA 4K4YA 4DR2F 4C0OC 2VU5A 1JN2P 3ZZUA 3CVKA 2GQQA 4DUZJ 4DLGA 3AMMA 1CX4A 3M7VA 1T9UA 3OV7A 3VB9A 1X0FA 2MSSA 5B0DA 5A6ZA 4P5YA 3K4DA 4UXAA 5E6HA 4A44A 1TKTA 4OCTA 2XLJA 2RNEA 1HRI2 1GTHA 2JDUA 2W0XA 2P17A 2R7XA 5FZLA 3JSBA 4PDWA 4RS5C 2IJFA 5E1RA 1NLKL 1ZTWA 2GX8A 3TWZA 3PTWA 1KVKA 3FNNA 1F5FA 4EZ6A 5FY9A 2ZM6F 4OVEA 3MFHA 4CH0S 4Y1XA 3RRDA 4JOUA 2XMLA 1Y43B 5D77A 1FT8A 2G1MA 2RS51 1S1VB 2BTVC 5L38A 1HI8A 1VQPS 2EC2A 3J7MA 5EWGA 2DVAA 2CWXA 2VMDA 2VG5A 2FVPA 1W8OA 2QGFB 5DAXA 5CABA 5HCHA 3POIA 4O65A 1J5EF 5KT7A 2ASYA 1RT1B 3RW6A 1WMDA 4C8OA 3V2UC 2YKMA 2XS7A 5RUBA 4W8JA 5J96B 1JHJA 1RAJA 5KC5A 5I0SA 4P14A 4LMZA 4UOGA 4LF2A 1REFA 3OLBA 1CZVA 1AL0G 4H4OB 3A21A 2YV8A 4H14A 5E8AA 4A45A 1VQYA 1BK0A 1D7PM 5L7OB 1AYEA 4RNFA 1IN0A 2FMYA 3AHPA 4Z1VA 3DOKA 4TU7A 3NL0A 3ZM8A 3T30A 3HQRA 1Y00A 4MXWB 1YHFA 4NZ0A 1DYPA 4D6RA 2FCTA 1LECA 1LCLA 1Q8SA 2PLV2 3H42A 4WM7A 4R25A 3SFGA 3SH3A 1KD1T 5FLXY 2YNGB 4GVBA 4DY5A 1Y3JA 2VE1A 4QIVA 4Y1UA 4NX9A 3N35A 4HN1A 3EGWB 3BI3A 2BBVA 1DQ6A 4KGVB 2W1SA 2HFVA 5KFLA 3WP4A 1W2OA 1X5TA 2KZMA 1UYXA 1JLBB 4JI0F 4K4ZA 1AX1A 3T2OA 2XTJP 2IXIA 1EYBA 2Q8DA 1PVC1 2OPKA 4ZDNA 1FNZA 2JDMA 4FOWA 4CTAB 3U0ZA 3VZOA 2Z8QA 3VGIA 4RNMA 3HO1A 2KU7A 2DB1A 4PQ9A 4USHA 3R97A 4CDXA 1EKRA 3CDWA 3O6QA 2WJSA 5IM0A 3RFRA 1WBLA 2DR8A 3O0XA 3RG6A 1GUIA 3D3BJ 1LKNA 3M8YA 3ULHA 4MUVA 1US3A 5DM6Q 5JAXA 1H2KA 2P5VA 2HMIA 4QHBA 4NUBA 3USUA 4F36A 4JTOA 4DR1J 5F8MA 2WS93 3TEZA 3ZTPA 5JCTA 4W92B 2X05A 1D2SA 3KTQA 2Y64A 1CAUA 5T55A 1SKRA 2P6SA 3LW5C 4CLUA 1LWXA 3AB2B 2BEOA 4HK9A 3T1LA 2I1RA 4NLRA 3IWLA 1RUG2 3ZXLA 4JUZA 3M9MB 3Q2SC 1JYTA 4ZITA 1GR3A 2UP1A 4R8UA 2RS52 3EPIA 1FTRA 4YM3A 3TRGA 3M1HA 3QGHA 5H9SA 2DTYA 4YVWB 2XOMA 1MROB 5C9AA 2N3LA 1URRA 2ZD1A 1IVZA 3DKQA 2VPZB 3CB4A 3GG0A 3ECQA 1DQ5A 2VW1A 3WQPA 2YC4A 4AR2A 1Y4WA 3DRPA 4DG1A 3TUIC 1F2NA 3KLEA 1FXZA 1O8BA 2A0FB 2AEZA 4C98A 3H5UA 4ZS6A 3RR7A 4LO8A 3GIKA 2XY6A 3VQTA 1HV1A 2W9CA 3UKVA 3TQ1A 4RL1A 5E3QA 2IFRA 5BYNA 1SFNA 1W2BR 2MZSA 1LXNA 1BMV1 4BHPA 1S1UA 3D66A 4K7JA 1VBA2 4H4MA 5FYTA 3JAMY 1B64A 4QKDA 1B3TA 3OJSA 4EE2A 4LIRA 1Q8OA 1S0BA 1H2TZ 3ATGA 3G6VA 2GH2A 4OFZA 3KHGA 4AHXA 3QLQA 5FCCA 4TZDA 4KSEB 2OP5A 2C9AA 3CCTA 5JVHQ 2B0GA 4XEZA 1WHWA 4RW4A 2B8MA 2JKBA 2CGOA 5CA5A 2FDHA 2PXJA 4MGQA 3S5QA 1QSSA 3T5HA 3FQLA 4EYUA 2KVQE 1W6MB 2X10A 4QGMA 4QXCA 2B4UA 3NS6A 2VC1A 2I38A 3CJ4A 5FP4A 1OFSA 4CCLA 5AFEA 1XR7A 4YG0A 3E01B 1NXMA 2OPRA 4IESA 1XJAA 4J9SA 5B0AA 1PO13 3OOXA 4COVA 4IUGA 3M3CA 2DNGA 3R6GB 1PMJX 1HBMB 5GAGI 1JJ4A 2WBMA 1ZZ9A 5JMCA 4J9MA 3AA8A 4XHBA 2DGXA 3NMRA 2D1CA 4LBMA 3ZFGA 3R7NB 1KVJA 2UURA 3M3EA 3CMAS 2K1RA 1S59A 1XMOJ 4WZQA 2XLKA 2BJEA 1GNHA 1S6PA 1DBNA 1JKHB 2DD8S 3WT3A 1WCDJ 3O1MA 2QNKA 3AL5A 2HBZB 3N9NA 5F9NA 3MIBA 1AHSA 2MMYA 2V5YA 3S30A 3FMGA 4KQ7A 1CJDA 1RXGA 2HAFA 4XJAA 4N8OA 2VZOA 2FHOB 4D7YA 3I0SB 4QB1A 1Z78A 5CCLA 3J81U 3C14B 2D69A 2HBRB 2W2QP 2MHNA 2JX2A 1W9FA 4IH5A 3LAGA 3RZZA 1APSA 4RGAA 3D6MB 4N7IA 4DR5J 2DFBA 4NMLA 2BJDA 1YITS 1S1XB 1PK6B 3O0VA 4BA6A 4G3IA 4PG5A 3MLJA 1IG3A 2MLZA 2O3DA 2QIFA 4UOFA 1SLTA 4MV2A 5FUIA 3QNWB 1YG0A 2MKJA 4F0MA 2RQ4A 2ZBCA 1FKPA 3EVOA 3WG1A 2W8KA 4DEVA 2DNHA 3Q8VA 1G3OA 2BOPA 3NLCA 5L8RC 3T9ZA 5KFYA 2V09A 1OPZA 4ZJLA 1BHNA 1DGWA 5DETA 3IT8A 5EZWA 3U02A 4ZKAA 3DU6A 4LF7J 3CIZA 3WG4A 1U1RA 3KKFA 5FMBA 4WU2A 4JKMA 1W28A 1OQ6A 4YLZA 4OYOA 2OKXA 4UW2A 3SQOP 2J9CA 1BY9A 5M0TA 2Y6GA 1YHQS 1Q8VA 1REGX 3FMWA 1U45A 1FK9A 2UXCF 4LO6B 1FDNA 2DU1A 3N7KA 5F37A 5FPLA 3WF3A 5C70A 3OB8A 1NXD1 3J7AN 1JOPA 1HIXA 1T03A 2RDSA 3CJKB 3BU7A 1HQ2A 2L41A 1DQ9A 3WUCA 1U1MA 3N9UC 2KTQA 1Q8QA 1RTIB 3EGNA 1DQ1A 2KB2A 3Q24A 2UY9A 3P5BP 4FPFA 5FO8B 1OJ4A 5A8KA 4X64J 4JX0A 2BKOA 2I45A 1NQJA 3ILOA 3AXKA 3AQPA 4GH4B 3EUNA 1Q81T 3UGFA 4WZFA 3DV8A 1T05A 5C2GA 4DL3A 3RB3A 2C2KB 3TO8A 1VB4A 5EWFA 4RBVA 1NSAA 3NJVA 2JRSA 1WG1A 4DCJB 1O8PA 3BEGB 1FPN1 2BYVE 1HJGA 3OBIA 3HBKA 4ILLA 4QQLA 2DRBA 2WONB 2RM23 4P73A 2QQLA 1AFIA 1OLMA 3ZDVA 2JG8B 2A10A 3S7EA 4IOAQ 4XFFA 4DU7A 2XYGB 2WYSA 1CZTA 4ICLA 3PR4A 4XJ9A 2DGQA 5AXLA 1TK8A 1TEIA 2RS8A 3R3TA 3FBFA 4LFBJ 4MGKE 2ZDPA 5IK8A 2OJ3A 2UYAA 4DV0F 4P6QA 3W66A 4LF8J 1GWMA 1V6MA 4Q4Y3 4MFBA 3D3AA 2JLGA 2BA9A 2I07B 3QJJA 1OA3A 2Z4FA 4NIAA 1O7FA 2WB4A 2YBSA 1MS3A 4OYPA 4V19X 3L7PA 3GYDA 1Q0NA 4PPZA 2X51A 2ZH6A 4ZXEA 4QU2A 1TKDA 3PUQA 1TVRB 1RTZA 2Z0GA 2B6AB 1VRBA 4BJ0A 1JZ4A 4LLFA 3IDBB 4ED0A 2RQKA 1WD4A 2QN6B 2WFF1 2VG7B 4RZRA 3G82B 3ZYJB 4X6QB 1QEXA 5CHCB 1VAVA 2ZUGA 2B45X 1DG6A 1I1GA 1H7WA 3RU0A 1ENQA 1SBEA 4QDSA 2MQQA 4QB2A 5FBJA 4ECYA 4IOBA 4BK5A 4ES3A 1Z7S2 1GAOA 1RUOA 4GZ9A 2P1BA 3DEMA 2EI5A 3E1F1 5LZ6A 1KP6A 2GA7A 2QCSB 3RB6A 3CEDA 3OR1B 2BVVA 2Y8KA 4QX1A 4BQWA 2BUKA 4KGGA 2J1EA 4PT6A 1WWHA 4Q5VA 1R43A 1A7GE 1OOPC 1FPN2 4DR3J 2ZEJA 2ZFHA 2AYHA 2W2NP 5FREA 1WHYA 3IR6B 5J1EB 5L39A 3D5MA 5EX0A 3ZXJA 4ED7A 2HYKA 4CUCA 3Q8EA 1QGLA 3CD5A 4ZP8A 3WBZA 1UVMA 1F6TA 1D4M1 1J5OA 2WC2A 5IK4A 1NK4A 3BBBA 3MAAB 1NZCA 2VBXA 3OTCA 2UU9J 4DY3A 2WUHA 3NCPA 3FMBA 2PHTA 2YKQA 1YQHA 3GGLA 4GAZA 4JVAA 4GXLA 1APNA 3HSGA 2JE8A 3LUYA 1YXWA 1JHNA 3OEBA 3ET6B 1ALYA 1BHGA 3RDIA 1UMHA 3KV9A 2C9KA 3SC7X 3VBSA 1TK0A 4FI9A 2O14A 4AWDA 2M3DA 5F8IA 5FMOL 3N28A 3NEKA 4DX6A 3V5RA 1QUVA 3ZNUA 1UJ6A 4HDGA 3AZXA 2CQ1A 5IAXA 4A8MP 2A6XA 3B9IA 2XXZA 3QRRA 3M2MA 1VIOA 3N6NA 4HKQA 5IT0A 2GS8A 1V00A 1TNRA 4K9SA 4IDZA 1REVA 2DO0A 1ZBA2 3KVAA 3M6WA 5C4WA 4HR2A 1WF0A 1UIKA 4QR2A 4KH1B 4FYVB 2R8JA 4ED4A 5LA2A 5IAVA 5C5JA 3ILIA 4UOCA 1ZBE2 5FZCA 1GFF2 1WNEA 2J1UA 1NHVA 3D67A 1KDKA 4QQOA 2YTCA 1FCAA 1U49A 5ANNA 2E5LF 1RT7A 4RUCA 4ZVHA 2ATFA 4PRFA 3HDSA 3KK3B 1S4FA 3UCUP 4QYRA 5FDLA 4A8QA 1JYNA 1YSJA 4KL1A 1UWBA 2N4DA 1WTBA 1HWLA 5CFDA 2FJVA 3MW2A 2LA6A 1RMU3 2BP6A 3LO3A 2CL2A 3PMEA 3QSYB 1CR7A 4J9UE 3VTIA 1F9FA 1YJKA 3LPYA 2IVIB 1CG2A 3C3LA 4FFFA 4K3UA 4RL7A 4DRVA 2ZGRA 1KFSA 1HN0A 1U5ZA 1PJ5A 3GJSB 4B3NA 1HLCA 3KJQB 3ZFFB 4FPHA 2ZJRQ 1NK0A 3LF7A 3AXMA 3AAWB 3ETPA 1HMVA 3LE0A 4LEJA 1DTQB 1OOPA 4PQAA 2QLJB 2ET7A 3WP6A 4IEWA 4LF4F 1VBD3 5CISA 4LSLA 3SCJE 1Y9QA 1FDAA 5B08A 2XJTA 5IV4A 4BXSV 4B9NA 2KJWA 4MHUA 4CO4A 3MEKA 3NWGA 5ETKA 1HB1A 1AW0A 1N3OA 5FY0A 1UTAA 2NP0A 1KR4A 1D2QA 2BE2B 3M30B 3VBUC 5KFFA 1PC5A 1MU2B 4LUBA 2FVRA 5A2QU 3KMQA 2YY3A 5SV8A 2RDJA 4N9IA 4X8PA 3FCWA 1DLOB 1T94A 3U4SA 2BXJA 3K2OA 5A6QA 2Y0IA 1IJEB 2WIIB 5JI7A 3CL1A 4DUWA 4XJUA 3HJFA 3H1YA 1H2MA 3D3CJ 2ARXA 3RZGA 1NSKL 3TN93 1N33J 2UXBF 3IG1B 2FHKA 2NSCA 4QKNA 2CIMA 4LPLA 5KG7A 2KI2A 3MD1A 2Q8OA 2VZUA 1ZRDA 5DZ7A 1L7LA 1XNAA 4MOAA 1RT6B 2ACMA 1QJEA 1WOSA 2W1BA 4I09A 3L7OA 3MV11 1ZZNA 4TLFA 3FBBA 3JCIA 3OBZA 1R64A 2R16A 5DUUA 3ZYFA 4QPXA 1RIRA 2B7CB 2P5BA 2P3IA 2HEWF 2LALA 4OHYA 3VZKA 3HZGA 5IQQA 4DUYJ 2ZACA 3PIPQ 3POYA 3LIGA 4JDMA 4I2QA 1WC5A 1SCSA 1SIZA 3FUQA 5E33A 4FVVA 3DRRA 3CCQS 1HQEA 2FZCB 1LOAA 1AYN3 3NAHA 3OEAA 3PUSA 4ZK7M 5D15A 2JWNA 3I2DA 3LGMA 4MKAA 3CDAA 1WKYA 1V3RA 1TL1B 4B3OA 2WN2A 3GV7B 2CQBA 2IVYA 1JZ7A 1YJTA 2KFZA 2HVHA 2D3OR 3OJBA 2OUGA 3V6KA 2OAUA 4QQHA 4X4VA 5IYYA 4NZ7A 4ZVTB 4GQ7A 2R4FA 4ALZA 1SMVA 5C5UA 1LOFA 3LQVA 2EAKA 2ZH1A 2CAVA 4PZVA 4GALA 4DOUA 5KG6A 3DPRA 2CY6A 4NLYA 1RUC1 3Q22A 4LR7A 3OHAA 1X5OA 3ILRA 3AVSA 3LEGA 2RS11 1HHQA 3CCRS 3VBUA 3BGRA 1S99A 4QYZK 3V0BB 2C2ZB 2TNFA 3MPWA 4X4QA 4DL4A 2BU9A 2YYOA 1FDBA 3I2OA 4L72B 1XNQJ 2BR0A 3ZXFA 5LY2A 1R8CA 2VR4A 2AJ4A 2MQ8A 5IVVA 2NUUG 2F17A 2DNPA 4X4NA 1JWWA 1PO22 3SQGB 1ZH5A 1J3PA 2P6TA 3K3OA 4N43C 3PDNA 2MKHA 2E1AA 4B3TJ 1YRZA 3IP0A 3NCQA 1OLQA 1JU3A 3VBOC 4CP2A 1P27B 3EPGA 2ZJPQ 3WC0A 3GR1A 4FBFA 4IG3A 1QOSA 1MG7A 2NN8A 3CZUA 2GNBA 1CSJA 1Q5YA 1PZ7A 2OD6A 2HNZB 1C5HA 2IAJA 3QYYA 3DXBA 2IXKA 3I3DA 2X1BA 4ID8A 3ELNA 2W01A 1C1LA 1RXFA 4H4KC 5CFCC 3NCRA 3SYZA 3DLEA 1EP4A 3POTA 3G86A 4B4RA 4QPGA 5GLZA 1SC6A 5KAKA 3L2YA 4CLKA 1UXZA 1C3HA 2VOPA 2EK6A 2JOQA 3LDBA 3SEEA 4RQPC 4WZMA 4J37A 5HMXA 2XBO1 1HD0A 2ZE2B 2PHUA 4F67A 3WW1A 5F3CA 3ILLA 1XEZA 4K4UA 1JLAB 2FVQA 4LKEA 3VZHA 2B5JB 3J9SA 2ZGSA 3TOQA 2X29A 2NM1A 3CJSA 4DQIA 4MHRA 3IM8A 2M4MA 1OSDA 3PVXA 2VFVA 2DITA 1KS5A 5KHIA 2AZ1A 3B4MA 4YR2A 4DPYA 4UF0B 3VZIA 1T02A 3SMZA 4FTBA 1CIWA 4KR0B 1HQNA 4BHQA 1FJEB 3E5UA 4QR0A 5D4PA 4F02A 3LALA 1GOGA 1ZA4A 2ZMNA 2WSFC 2D6NA 3HKWA 3CDUA 3AD8C 5C42B 1X9PA 4XETA 3LZZA 2D5FA 4FPGA 3KWVA 4JI7J 2JE7A 3AZWA 1RUC2 1GMVA 2NYHA 1ULCA 3O5SA 4WVZA 3ZXDA 2DGVA 2AGSA 2LU2A 3HVWA 1P1TA 4O3NA 5J36A 3PRBA 2R7WA 3QT6A 2FBEA 5GLWA 2EA7A 3SIPB 4JQRA 5FAXA 2XJUA 3ZSKA 2BW7A 3HHLA 1V6HA 2YNIA 3ACFA 3ZKUA 2Z57B 4W6XA 3SISA 1LK7A 3PIGA 3M3IA 4WM8B 1GU3A 4XXPA 2EG2A 4UZCA 5FKBA 5HCAA 3FUYA 5CZXA 3LGHA 1VQ4S 3PRDA 4ZHRA 3CF5Q 1QWRA 5HBAA 2CNKB 1FKOB 2ASLA 4BQXA 3K58A 1CJUB 4QW9A 2WSVA 5IATA 3RW7A 4N43A 1UVJA 2D43A 5E89A 1ENRA 3N0VA 3S6EA 1VBB1 4RR5A 1UKRA 3E6CC 3R5AA 3R2DJ 2WNUB 5JXSA 3LP2A 4OYWA 2EVXA 3I97A 3R4SA 1HNZF 3I2GA 3QJPA 1ZRRA 4OQ8A 4OZLA 3K4ZA 4DSFA 1T9YA 1RWOB 1WD6A 1D4M3 3DF0A 3GV8B 1IKVB 1RJ8A 1Y5LB 2Q79A 3KDOA 1Q8KA 2VMFA 1O8SA 2RMU2 2V6AA 3OXLA 4OX6A 4J9QA 3P6BA 3VALA 1IGOA 3MM5B 3NGUA 1HWKA 2XMJA 2H4YB 5IXUA 1Y9OA 3KCXA 1VBKA 1LOEA 4N5SA 4I01A 2V2VA 1CJKB 1YJUA 2XBO2 3F44A 5HXMA 2AU0A 4LF6F 2I5JB 4WKYA 3BIEA 1RTVA 3KLGB 3NJYA 4OLOA 4RQPA 4TYAA 4ZMMA 3WIUA 4DXRA 3P3DA 4QBUA 3ZYRA 3J80Y 4FFGA 4XBQA 1QDUB 1ZYQA 4JAAA 4ECXA 4MKBA 5L36A 4EGLA 2WN3A 3LPGA 4YWAA 2HFZA 1NK9A 1IKQA 2Z2SB 2YBKA 4PHZA 3Q8PB 2DH7A 5IUQA 4YSFA 2C6SA 4F25A 5FUPA 1CX1A 5K20B 3RJRA 2ZC4A 4CLYA 4MGYE 5GLUA 4PWDB 1DQ0A 3PUAA 3BYRA 4MIAA 5CH7B 2WLQA 5T5OA 2HHVA 2MQNA 2UVWA 2D98A 4EBCA 1CULB 3JD71 3NNLA 3AKSA 1NJZA 2ZS6B 5KHKA 4AL7A 2B9EA 4S2FA 1OWXA 1N3PA 1QKQA 2Z5WA 3Q8CA 3QCWA 4YW6A 1JXEA 2E6VA 1O5UA 3HBZA 4TY8B 1IKPA 4CP9A 1H74A 5JOYA 4XTMA 3ZR6A 2OD4A 2YQ1A 5BNOC 2L9DA 3NRBA 1LESA 5DZEA 2XSFA 2GP3A 4CWBA 1NK7A 1PNGA 2DNLA 3RWKX 2C28A 5KWRA 4L11A 2XG8A 4U9RA 4DPUA 3JQWA 4A2UA 1T9XA 3H25A 1M5VC 3LFIA 1HR0J 4WFBQ 3GMGA 1HNVB 5CZKA 1N34F 1OKQA 3SLIA 3KK1A 1RT4B 3M6XA 2WKKA 2ZGMA 4M5DA 4K4XA 1UFWA 4K7QA 3LEIA 2VJXA 2FCVA 3MCMA 1GNKA 1NB7A 3VKFC 3ZFEC 1UQXA 1QH7A 4QT6A 4Q0BB 1RCXB 3ZXEA 2GP5A 3WF2A 1VRTA 2B42B 3JB8A 4Q1PA 5IFPA 1V6NA 3DRSB 4ZLLA 2YMZA 4FTEA 2PFWA 2FJXA 3LP1A 4CRJA 5GZCA 3THCA 5DABA 4XPEA 2ALYB 3QRPA 4D6QA 3IGVA 3IDCB 4NA2A 1HWJA 4NHYA 4DV2F 5A1LA 2JDNA 1LNSA 5M2RA 4KGMA 5FV3A 5I42A 1EAH1 3KZ4C 4A3ZA 2HZCA 5A7WA 4JV5F 3AOBA 3HHLD 1U0HA 2KM8C 1BWEA 1D9DA 1WEXA 1ZM2A 2GNTA 1C8M3 2DUOA 2HNYA 3K8VA 3PXGa 2DGSA 4NVPA 1BBT1 4XMAA 2XMMA 1VISA 1MS9A 4L0PA 1PKUA 4U8YA 1ZPWX 4HLBA 4Q0QA 3G8QA 4FFHA 2PA8D 4Y3OA 4JDNA 2CYFA 4QKFA 3L9ZA 4IYQA 3VD4A 3ZN4A 3FFIB 5EJZB 5D8HB 2JSXA 1TL7B 2RMLA 2AT1B 1JU4A 3W5YA 4IR1A 4OFGA 3KJVB 1LGNA 1FFSB 1GT8A 2IC3B 1VCTA 2GNMA 3J7NA 2JC1A 1KLMA 3MEGB 1DF0A 4YG6A 1DY3A 2XVKA 2ZH2A 3ZYGA 3PJYA 1H7XA 3MEDB 3ZMNA 1D8ZA 3LQCA 4E4SA 2YNFB 5HV4A 3OPZA 1R081 1KNZA 4JYAJ 1JUIA 1T0TV 4CU8A 1NJXA 4QIFA 5C8WA 5FPVA 3VL9A 4QM9A 4NZ6A 1UD1A 1N1VA 1JJ2R 1WJ9A 4B3RJ 2M8HA 2CNNB 2XMKA 3PFEA 4Y2KA 2X8KA 3KLHB 5IWFA 4DV7J 2HEYF 4KTQA 1XPWA 4QPYA 5EWEA 1WCUA 4D94A 2BZ2A 1BVP1 5I8YA 1ZETA 4NWBA 3OLAA 2XYHB 4M94A 4PBOA 1O3QA 5D0EA 3FSIA 3KT1A 3A8JA 4Y2AA 5C71A 5JZGB 1RJJA 3ZFEA 2CPEA 1ZA2B 3IGNA 3DDKA 3LD8A 2ZUAA 4EZ9A 2XG3A 2M88A 2RS13 1JXLA 4BS2A 1QU0A 3SHRA 2NSBA 3BQ0A 3I6PA 1JLFA 3GF6A 2DNKA 4YDXA 2DPJA 1ZZ6A 2VOKA 2XKPA 2JDZA 2EIEA 4O4RA 1KN6A 1AF9A 2VPYB 3I5BA 4U36A 4B8EA 4ECTA 4RW8A 3UKTA 4IKAA 4IRCA 5J09A 2W1WA 2CZ9A 2FUG9 5ETPA 4C11B 1LOGA 2KHCA 2WNVB 1QH6A 2FB0A 1KVIA 3WDWA 4USWA 4RHV3 1FESA 2DIUA 1ZZ7A 3FC0A 3MTKA 4DL2A 4DWIA 1VAKA 4EN7B 1UPSA 2LM3A 3OUIA 3MFCA 4J1XA 1K5MC 2VUCA 2ZM6J 2I0XA 2AX0A 1FDDA 2HGNA 4F3JA 1DZ5A 3M2UB 3R5GA 4OQJA 3VBFC 1UZ0A 4AG4A 1O3TA 2WSCC 1VR3A 4IDKA 3JYTA 4HPKB 3HJVA 5JOZA 2Y34A 3OPKA 4OJ3A 2HPUA 5DUWA 4CE8A 2VB6A 4YUDA 3ZSJA 4GKJF 3Q89A 1T9TA 1EETA 1OUSA 2DYCA 5J48A 1KQSR 3TP2A 2VTXA 1AJKA 3FX3A 4DMIA 4FT8A 2B3TB 4LE4A 3D0SA 1CAVA 3BGFA 5FJ4A 4L76A 3WQ0A 1Z4UA 4CDWB 1FO1A 2HWB2 2G0JA 2XYPB 4HBNA 1UYYA 4DOZA 3LA0A 2G9OA 5G0RB 4A8OA 2IUWA 4UWDA 2QDRA 2QX0A 5FZIA 2E9TA 1GXTA 1V6JA 4ZU4A 1VBE2 2ILMA 5KFUA 3H0PA 2UUBF 4U6PA 2YWFA 3H40A 4PR6A 2YWKA 3C6UA 4MTPA 4C0HA 1TU0B 3CBNA 1LHUA 1BXNA 3ENVA 4USJC 2VZSA 4L3NA 4YM0A 3C6TA 2ZDOA 4G1QB 2R8GA 8AT1B 1F5AA 4YS2A 1H9WA 1H2VZ 5A8WA 3CCSS 2V2QA 2JFKA 2QA4S 2WO1A 1XIQA 1Q3EA 1K12A 5IC6B 4DSKA 1XYNA 1QE1A 3GZAA 3QWUA 3N6MA 4F4WA 1LXJA 2HVZA 4FOYA 3QH7A 4YW4A 2IWGB 2HWC2 4CQ1A 3ES1A 4WP9A 3MPVA 2AACA 4OLPA 4C8KA 2G1DA 3OUHA 1SLBA 4Q4W1 4A8SA 1VRH2 2WNUC 2ZXQA 4I64A 5IWAJ 3HSZA 1EPWA 3TA1A 1AXKA 3NNAA 3D0HE 4ISRA 3LWLA 4H2AA 2C2RA 2IDLA 5C3RA 3ILNA 3VHOA 2HQIA 4OIXA 3WD5A 3BKFA 3TAMA 3D7SB 1LGBA 1OS5A 4RR3B 1NX9A 1UX6A 2FDJA 5LL6d 1GP5A 1GZTA 1R3NA 4O9EA 1J1TA 3VDDC 1JLQB 2A3YA 2W7AA 2N7YA 3MR7A 1PVXA 2PI4A 2YUEA 3GZEA 7FD1A 2IXHA 1VE0A 5DG2A 1W05A 1WW7A 3SH4A 5JSRA 4FKXA 1KDMA 2XI2A 2WBKA 1RINA 3PHEA 5JIAA 1O3SA 4Q4V1 3S8SA 5JI9A 4DQSA 3LANA 2QKDA 4PIYA 3VBFA 2BE7D 1CC8A 3A12A 3J7A1 1X9TA 5ETTA 5FZOA 3EXYA 4MMOA 3MMAA 2XJSA 3I4PA 1RUF1 1N56A 4N53B 1H8TB 5ABJB 4UOJA 5DUXA 2J1AA 2MPFA 1U02A 4CEWA 2XC9A 3MMBB 3BKUA 4TYBA 3LOBA 5FY4A 4WBFA 2HGLA 1R093 3MM6A 1Y7PA 1HYSA 1Q7LB 3V6DA 1COV1 1TKXA 3M32B 1FJ7A 3QD6A 3AJ2A 3BGUA 3FZ2A 2UXDF 2ZKLA 1VJWA 2XEXA 2JIGA 2EIDA 4GJYA 1SPPB 3G87A 2M0GB 3JD73 3I0RB 2R7VA 1SDWA 3U1NA 4UUWA 2OEMA 2YKNB 5L9VA 1IQDC 3A0NA 1M06G 2NR0A 4DLEA 2X53S 4FPIA 4XXAA 2VL1A 3W21A 3DYMA 2BQUA 4P00B 3I2JA 1N1SA 2C0ZA 3FRYA 1VQ6S 4PQQA 3FKBA 4GB32 2DHAA 1PSDA 4CTEA 1PJ6A 1CEZA 4F8AA 3KUHA 3MMCB 5J2MB 1FVQA 2VKRA 4K1YA 4CO3A 3E6BA 1Q16B 1ZM9A 3VKMA 4UYBA 4PXEA 5E7OB 1X4DA 3NP5A 1G6NA 3VHNA 3M05A 1ZX5A 5T7LB 4Q4W2 3JXSA 2MZRA 3PCOB 3N79A 4P2FA 3I8TA 4IEVA 4JI2J 2OPQB 3RAXA 5K8MA 2VQEF 1C1CA 5JJBA 4JV1A 4FQ4A 1CBKA 4LTAA 1TV6B 3BDPA 9ATCB 3CO2A 2EKYA 3CC4S 2Y1JA 4AVSA 1Q8IA 3IBCB 1HBOA 3IAM9 4M63A 3PYEA 1QJY1 1NCQB 1AA1B 3NBPA 1KD7A 5B0FA 4CT8A 1B99A 2CYYA 1JLEA 4I56A 1HRV1 1HNIA 2Y3YA 4Q4V2 2LQ8A 2HWD2 1O6XA 1VBC1 4CCKA 1RWWB 3PYGA 1HFEL 3JTOA 2XZTB 3RSJA 1MZ6A 2QL5B 1HPZA 2HVEA 5FXXA 3K5PA 1AR81 3NO8A 4FCAA 1RUF2 4OI2A 3PW4A 4B3SF 1C5IA 2XL7A 4DUXA 2YNHB 1JH5A 2M5YA 1IQZA 5CXTA 4DXSA 5IT9U 3WZ1A 1OSGA 1BBT3 3PHMA 4LKFA 2WL1A 1HHTP 1NE6A 3MHYA 4Y0FA 3QLHA 1TMF1 3VHPA 3I87A 1KTVA 1B0VA 3UN3A 2UV8G 1RISA 1YWKA 1GLHA 4K4TA 1E6YB 1H0BA 1WEYA 3OPTA 3T1HF 3I2IA 4H3WA 4CZSA 1TL3B 1MS4A 3S6PA 2QLXA 2V8GA 2CQ2A 4Y33A 1UEVA 2ZHOA 3C15A 2J9EA 4EYIB 2Q1ZB 5DDOC 1Q5VA 2QZ8A 4Q0SA 4YRDA 3BJYA 1HIYA 5JR2A 4YFWA 2Q6CA 2HWE2 5GMEA 3B54A 1C2PA 1EZZB 4H7LA 4DQPA 1Y9MA 3K48A 5DDJ1 3I9ZA 2IXLA 4AL6A 5LATA 1C0UB 4KH0B 8ATCB 2V2KA 3BYPA 2DCJA 3LEKA 4RD7A 2RSQA 3M8PA 2W91A 1QM9A 3TQEA 2KH9A 4A4JA 2GHPA 1AXYA 1LEMA 2HWF1 5L19A 1XSRA 4L75A 2XO6A 1S7IA 4JI5F 5C8CB 4HDHA 4YN3B 4HEA9 3H4DA 1AR91 2IPOB 3ETMA 2K2PA 3AJYA 3ZVXA 1CJVA 1NPRA 1S1VA 4DSJA 2A6YA 3AD9C 3F41A 3WW4A 5FWJA 4NRUA 5JXIA 1SJQA 3PMSA 2NREA 3HPOA 1QTMA 1NSQA 4NXNF 4FPLA 4HHUA 4ISQA 1RYSA 2XNQA 1RT1A 3CJXA 2ZKTA 3A3PB 1QJY2 5C3SA 5FWEA 3GZ7A 3MF6A 1XNCA 4ASLA 3WW2A 1EV12 2YY1A 3PW2A 2IFXA 1QJX2 4QQBA 4J5OA 3CT9A 4ILMA 4PQUB 1W2AX 4RGKA 3AYAA 2E32A 1RAIB 2VFRA 2WT0A 3K59A 1DQAA 1NH8A 4H4OA 4GMKA 3W65A 3O7OA 3SCFA 4V2WA 3WHTA 1FI2A 1VBC2 4KO0B 3D28A 4IO1A 3FBYA 4IEUA 3TZYA 2QT7A 3J8F1 2X09A 4J90A 4MXWA 5AJ3J 4P9LA 2FHJA 4ZVSB 2G19A 5F0WA 2YNGA 4WTYA 3HEIA 3W60A 1OF4A 1NHUA 4BLJA 2CTVA 4N41A 4M5JA 2WNVC 3PX4A 5A70A 4AAPA 2V4QA 3TA0A 3EXCX 5J2QB 4IV1B 3M9OB 5E0OA 2VBPA 1LWFA 4DV0J 3QZ8A 1JLBA 5I0TA 4MGZE 3FEZA 3OUYA 1TMF2 4OMDA 4QJVA 2FC9A 2P37A 1DTTB 4CTAA 4Y3CA 4DV3J 2JDJA 1JYIA 4C3LA 2ABYA 4ID5B 3OTBA 1W0PA 2R061 1SCJB 4M3CE 2HG4A 3P4UB 2FLPA 2WINB 2UUCJ 2VBZA 5J1PA 3BZQA 2HZVA 2YKPA 2R071 4UBGA 1GQHA 2OPWA 1NPKA 1W0NA 2HLEA 4LO7A 4X4RA 3QZ7A 1PMIA 3CULA 3AB4B 1RT3B 3QFWA 1X7VA 5FZKA 4OHVA 3VD9A 3AP9A 4JI8F 3UO0A 1NA1B 2EBGA 4IRDA 2HWF2 4E2SA 3VF0B 4P9SA 2BOAA 4EUVA 1QLNA 3T19A 1SJRA 5CB7A 3TX8A 3C7OA 3NGRA 1AR92 4OZOA 3UR0A 2JDKA 3ACIA 1SUQB 4QWAA 1S72S 4FVCA 4RJVA 3LF0A 3MPDA 2XZWA 3OGVA 4Q8KA 1IG0A 5F2SA 2X5IB 2Q1MA 4XDCA 3FLPA 4YVWA 2F8EX 5E3AA 4NAOA 2EXJA 1MROA 1WEZA 1FMD2 4WZCA 1VQSA 3IM0A 1N32J 2QFEA 3HVRA 4MYUA 2C2NA 3LGRA 2ASJA 1RUE2 2A71A 4FVMA 1FXLA 1OQ3A 2Z4PA 2JB8A 2VMEA 1HXS3 4O9GA 1BVVA 4KKOB 1T3NA 2E26A 1U26A 4M5KA 5ACA1 3ZYBA 3S0MA 1UP1A 2VH9A 1BWVA 4NCAA 4A8XA 2NYIA 1AR71 2VKZG 2R1BA 4JGZB 3IWXA 5H9QA 2W3JA 2YHJA 1H3DA 3WNMA 1ULOA 4B1MA 1AXQA 3U10A 4DSIA 3DU5A 3BTYA 5FZ8A 2DR9A 3X1LB 4FF3A 3SSSA 4NR1A 4EFAC 3MCNA 5HPOA 4GD4A 1HLWA 3HHEA 4F3QA 1REEA 4NRTA 4MGTA 3NG8A 3BN4A 3UGHA 1UF2C 1WSVA 1IS4A 4YR0A 4LFAF 3PIOQ 2ZGLA 2Z58B 5AC93 3FCVA 3O1PA 1AYM3 4M00A 1DLCA 2J9DA 4MIBA 3E01A 4CDUC 4R0EA 5FPBA 2HFOA 5A80A 5D0HA 4LHLA 1UCNA 4BIOA 2YXSA 4TWTA 4DX7A 2KM2A 2QYCA 2ZEWA 3H90A 5HROB 3C8YA 1S79A 1RACB 3OXGA 4TU8A 4PYDA 2Z69A 5F5QA 2AKWB 3MD3A 2V63A 2FY8A 3VV1A 1UU4A 2D40A 2ZOMA 4FPOB 1H6KX 2JZ5A 2AC1A 1WC6A 5JIUA 5CADA 4IQMA 2QJ3A 1KFUL 2FHJD 5FLXU 4L99A 4OI1A 3IAQA 4UFIA 2DKOB 1COV3 1IR2A 4AGVA 2N7GA 4CDQB 2AJ1A 2W47A 5DDRC 3I0SA 4OZNA 3AKPA 3JTNA 3VZLA 3C14A 1SBRA 3AP5A 4QCLA 4BQ3A 2PHLA 2F4VF 4W4ZA 5KFMA 3OR2A 2BPA2 1N52B 4CCEA 1N36J 4DFSA 3PR5B 1NPPA 1PK6A 4WE1B 4OZ3A 1Q78A 5FP8A 4I69A 2JXAA 3MWBA 1VQ8S 3DECA 3ENAA 4XO0A 4F3MA 2X7IA 1RQ0A 4LF4J 5D4NA 2ZH8A 4NN0A 5LBCA 4D6SA 1G2EA 3AFKA 3G2XA 3TX0A 2A6WA 1QXJA 5A7QA 3I3BA 3AJZA 5ETRA 1G9FA 3C7GA 3VR1A 4MX3A 5HLFA 3AH6A 1SEFA 1DRZA 1UU6A 4W6WA 3RS6A 2VZ3A 5FXWA 3D1HA 3R1HA 3MICA 4ARYA 2BKNA 1LHWA 3KWMA 3OUJA 2YX7A 1AFJA 1JYWA 2VPXB 2SLIA 1RHI1 5E88A 2VZ9A 1RAEB 1RVF2 5L73A 1AL21 4FYXB 3W2WB 4DZDA 4ZCMA 3M8RA 2OH2A 1RGSA 4NYZA 3KLIB 4L92A 5FZ4A 1Z0HA 1WSRA 4PKDB 3C8XA 4LBQA 1EX8A 2R32A 2PIIA 3P6YC 4DSLA 1HRV3 2VMIA 1JLGB 3FFZA 1RTIA 5T5PA 2CQPA 2H5JB 2KT3A 4QPIB 2MQLA 1ASJ2 2HRYA 1QJU1 5BR8F 4KV8B 4DR6F 3SFUA 1K0VA 3GFYA 1H2LA 4YZ5A 4DFKA 1UA0A 2J6TA 3QOPA 4EN8B 1AR83 2A6ZA 5DM7Q 2QZ3A 3S5AA 3H8UA 2DT9A 1HB4A 1V6LA 4OI6A 2E7VA 1ND2C 1OF3A 1OQEA 2Y6FA 5FZHA 3S57A 8RUCA 3T1YJ 2WO2A 2GN7A 1GWLA 4GH4A 4FF2A 2JX9A 1U1KA 2XWJB 2PMWB 2FLOA 1EKSA 2JJ6A 2WOMB 2P2KA 1BZWA 2JENA 4J1WA 3NNCA 4HG6B 5DAWA 1P9YA 5CYQB 3JAMU 4OI0A 1G9DA 2WONA 5EGYA 2P9GA 3BOWA 2O8QA 2IRYA 4TLGA 1N5VA 1VLYA 3AZVA 2JG8A 2Q8CA 3SCIE 3DYPA 2RJKA 2MTLA 5JMNA 1O91A 3GLJA 1ITPA 2RHSB 5KFCA 3KCCA 1NRKA 5IW0A 2KVIA 2R1DA 4LA3A 2AHOB 2E1PA 2W9AA 4NCGB 1M5SA 4OX9F 2VTXJ 5DDJ3 4NA3A 4BB3A 5G04L 1UPPA 3DRXA 5A3OA 3O2IA 4HONA 1SBFA 2OI2A 4XUOA 2CPZA 2H1YA 4XFCA 3E8OA 4JV2A 4F4KA 2ZA9A 2B5HA 2KZZA 3AZYA 4C9DA 2GMJA 5HMZA 1Q1KA 3OFHA 3HKZD 5BYSA 1W8FA 4BLGA 4Y65A 2DJWA 1UZV