3THPA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
333
structure length
304
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVRRVKHFGYKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASEKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB homolog 8
total genus 57
structure length 304
sequence length 333
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thpA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thpA01
2ERRA 1WF0A 1WHWA 2CQ2A 1OWXA 2FC8A 3UWTA 2CQBA 3OW2R 2DNLA 2LECA 2XNRA 2DH9A 2FPHX 4WCEQ 1FO1A 5DDRC 1DZ5A 2DNZA 1UP1A 2LYVA 3CCES 2AYGA 2F3JA 2KRRA 1O0PA 2YTCA 2LA4A 2RVJA 2ZJPQ 3RW6A 2HYIB 2M7SA 1YIJS 2DNQA 2DNNA 2JVRA 2M8DB 5LJ5Y 3CULA 4ERDA 2MQPA 3PIOQ 1X5SA 2CQ3A 3SXLA 3NNHA 3BO4A 2RT3A 4W90B 1OIAA 2M88A 2DITA 2CQ1A 2DK2A 1VQ7S 2X1GA 1QVGR 5MLCV 5GAHU 2YKAA 2FHOB 5ITHA 1WEYA 2K3KA 2VOOA 3MDFA 5GAGU 1M5VC 2AYMA 3K0JA 2VONA 1U1KA 2RS8A 3RW7A 3MD3A 2J0QD 2JVOA 2OTJS 1WWHA 4U67Q 2MGZA 2MHNA 2MQOA 2MQQA 5HL7Q 2KH9A 1KD1T 3ZZZA 1X5OA 3MUMP 1YJ9S 1L3KA 2D3OR 3P6YC 1A9NB 4TU7A 2MY7A 2X1AA 4C4WA 2NLWA 1WEXA 5EN1A 2U2FA 4QU7A 1SJRA 1NO8A 2BOPA 2E5JA 1S72S 1WG4A 4V19X 2SXLA 4Z2XA 2MPUA 2LEAA 2J8AA 2XS7A 2YH0A 3LPYA 1HD1A 1KOHA 2XS2A 2KG1A 4RU2A 3VAFA 2CPDA 2DGUA 3CTRA 1VC5A 1DBDA 5IM0B 2E5IA 4WFAQ 1U1MA 3HHNB 3TYTA 2PEHA 2ZJRQ 4YUDA 5CA5A 1U1LA 3Q2TC 2KT5A 2E44A 2QFJA 1X4DA 2X1FA 1VQPS 3NMRA 2MY8A 1X5PA 1QM9A 3H2UB 2KU7A 2A3JA 1UW4A 2CQ0A 2KM8B 4OZ0A 2CPEA 2DIUA 3NNAA 1AUDA 2DGVA 3ULHA 2MZQA 2VODA 2KYXA 2G4BA 1N54B 3DXBA 1NU4A 2YWKA 5GAEU 1WI6A 2Q79A 1WHXA 2ADCA 2RNEA 1ZH5A 1HA1A 2DHGA 1VQ9S 4WIIA 4F26A 2XNQA 5DDPC 2KXNB 2CQCA 1D8ZA 3CMAS 2OSRA 5BJRA 2KVIA 5CYJA 2ZJQQ 1PGZA 1DHMA 5IM0A 2CPFA 4PKDB 3DLLQ 3P5TL 5D77A 3THPA 2RS2A 2EK6A 2E5GA 2J0SD 1U1RA 3D2WA 3U1MA 2BZ2A 5GMKa 1U6FA 2MKJA 3EGNA 3CCMS 2M8HA 3VAKA 2MKSA 2MXYA 3G6ES 2DNGA 2N3OA 2MSSA 1WTBA 2CPIA 1DRZA 1SJ3P 1X4BA 3CC2S 2B0GA 3B4MA 2G0CA 1UFWA 2DGQA 3CCVS 4FXWA 2CPZA 2XB2D 2RRBA 2HGMA 3P3DA 3CCRS 3BO3A 1RKJA 3IWNC 3UD4P 1X5TA 3BS9A 1R8HA 1VBXA 2UP1A 2DNMA 1YITS 3I55S 2CQGA 2CQ4A 1N52B 3CF5Q 2V94A 2PE8A 2LMIA 2EK1A 2DO4A 2HZCA 2KI2A 3L3CA 3MXHP 2CPXA 1RK8A 3NS5A 5HO4A 2GHPA 3N9UC 2QEXS 4OZ1A 4ED5A 3CUNA 1WF2A 3VF0B 3I56S 2RRAA 2RQCA 2MQLA 3G4SS 2N82B 3MOJB 1VC0A 2QA4S 2I2YA 4YOEA 2DGOA 2M9KA 1QVFR 1VQ5S 3S7RA 4BS2A 2FY1A 4QPTA 3SDEB 2MKCA 1H2UX 1VQ8S 3G9CA 5DM6Q 3CCUS 2MQMA 2X1BA 5DM7Q 4TU8A 2N3LA 1N88A 3TP2A 3VAIA 2VOPA 3THTA 3R1HA 3CCJS 4M5DB 3UCZP 3UE2A 2JX2A 2KFYA 2MKIA 4A8XA 4WFBQ 3US5A 1U1QA 2CPHA 2MZTA 2L9WA 1KQSR 1URNA 2M52A 1JMTA 2MZRA 2M2BA 1M5PC 2RQ4A 2XSFA 4J5OA 3BEGB 4TLQA 2MMYA 1P1TA 2DO0A 1WF1A 1SJQA 2MGZB 4CH0S 3MD1A 1WI8A 1WHVA 1WG1A 3EX7B 3B4DA 1KOOA 1VQLS 1HL6A 2OTLS 3HI9A 5IQQA 1YTYA 3NNCA 1Q7YT 1FJCA 2M0GB 3MURP 3H2VE 1YJNS 1G2EA 2DNYA 4EGLA 1OO0B 1X4EA 1NJIT 2DNOA 2M70A 4WFNQ 2CQPA 2KHCA 3SDEA 3U1LA 1VQMS 2G1DA 3CC7S 5DDOC 2MZ1A 2DHAA 3J7YU 1WHYA 1YWXA 1D9AA 2LCWA 2LEBA 2DNRA 2CQIA 3G71S 2DGTA 2DGSA 1Q82T 3PIPQ 1SJ4P 2KG0A 2FC9A 1JJHA 2L41A 1U1OA 4W92B 4CH1A 1CVJA 4YB1P 1U1NA 1K73T 2ADBA 1N8RT 1X4GA 2KRBA 2AYBA 1ZZNA 2MKKA 1FJEB 2DNKA 1YJWS 3CCLS 2EVZA 1H6KX 3VAJA 2LA6A 3VAGA 2DISA 3SMZA 1SXLA 4CQ1A 4Y0FA 4TU9A 1X0FA 1JJ4A 4IO9Q 2CPYA 1B7FA 2DGXA 2MB0B 1F9FA 2O3DA 2N7CA 2XS5A 1YHQS 5LSLA 2AD9A 4IUFA 5FJ4A 2MZSA 2JWNA 1X4AA 3LQVA 3S6EA 3CCSS 2YH1A 1JJ2R 4WF9Q 3FEXB 3MUTP 4UY8T 2DH7A 2I38A 2LKZA 1VBZA 3S01A 5LSOA 3R1LA 2MYFA 3UCGA 5LXYA 3CPWR 1M5KC 2MJNA 4IOAQ 1K9MT 2D9OA 1PO6A 3CMES 4LJMA 2HGNA 3VALA 3UCUP 3BO2A 2DNPA 1VQKS 5D78A 1VQ4S 2LXUA 3IRWP 1A7GE 3UD3P 5DDQC 2DHXA 1WELA 2CPJA 2OJ3A 1VC6A 2KXHA 2OIHA 3S8SA 1U2FA 2CQDA 4PR6A 1X4HA 2KN4A 4UQTA 2AYEA 1R8PA 3CCQS 3J7ZT 3ZZYA 1VQOS 1H2VZ 2U1AA 1OPIA 5H1SV 2K8GA 4Y00A 2MQNA 3VAMA 2CQHA 1IQTA 1U1PA 3R27A 1S79A 5LJ3Y 1VBYA 2F9JA 1M1KT 2J76E 2MJUA 3VAHA 2MKHA 1Q81T 1SJFA 3MUVP 2D9PA 4PRFA 3JB9k 1YI2S 2DGWA 2F9DA 2HVZA 1WEZA 2L08A 4CIOA 1FXLA 4P6QA 4F02A 2RU3A 2KXFA 2MSTA 2JRSA 2RUGA 1FHTA 5IFMA 4LIRA 1KC8T 5JVGQ 1Q86T 3FEYB 3Q2SC 1VQ6S 4WKRA 5GVQA 3EGZA 4IOCQ 3P49B 1FNXH 1P27B 1X4CA 2OSQA 5LXRA 1U6BA 3G96A 2DB1A 3G8TA 1FJ7A 4LMZA 4QU6A 3CC4S 5JVHQ 2LXIA 4ZKAA 2DIVA 2LQ5A 2GO9A 4QQBA 3G8SA 5DETA 3NS6A 2HGLA 2NZ4A 1XN9A 2E5HA 1M90T 3TO8A 1M5OC 1VQNS 1BY9A 2MZJA 3CD6S 3V4MA 5GADU 2M4MA 1UAWA 1W2BR 2WBRA 1X4FA 1ZZFA 4C0OC 3CXCR 1H2TZ 3MI7X 4F25A 4FXVA 2KM8C 4C7QA 2DHSA 2DNHA 2CJKA 1K8AT 2DH8A 1HD0A 1WG5A 5CXTA 1FT8A
chains in the Genus database with same CATH superfamily
1B0VA 2V8GA 3IR6B 3ILFA 4KHPJ 2W9AA 3FFQA 2GP3A 3V0AA 4QPIB 4B9VA 4EZ4A 2JLEA 1NZAA 4IUGA 3GV7B 3ITQA 3K77A 1O0PA 2XQRA 3M9NB 2ZJPQ 2P34A 3VHQA 2D1CA 4NCAA 4BH9A 4BK4A 4MOAA 3R3TA 4RWXA 4LFCJ 3IP0A 5EIYB 2AWZA 4NOHA 1I9RA 2HZAA 1AZSB 3WW2A 1QY4A 4RJVA 1VIOA 1QVGR 5A80A 4KE5A 3LEMA 2IJFA 3CJTA 2WVBA 3MCOA 1WEYA 3HHKA 5T50A 5HROA 5I0UA 5JXSA 1PIV3 4ZVOB 4IEUA 4OFGA 2J0QD 1I1EA 3S7EA 4C8OA 2VVFA 2MGZA 2VL4A 2YPDA 3W63A 2WT0A 1AW0A 1EP0A 3EZOA 3R7BB 3RPQA 2CZVC 2GNDA 2NLWA 3FFIA 2QQPA 4OYBA 2D41A 1NO8A 2D7FA 4Q1RA 1V6LA 1UJ5A 4ARXA 2QMXA 2V8DA 1PNGA 2K0GA 4JP8A 3N6MA 3K5PA 4CCLA 4G9SB 3CQOA 4LNVA 4UWDA 1YJRA 2TBVA 2WAQD 4DL7A 3PG9A 3IWZA 5DUWA 2VZOA 3NQHA 2KG1A 3UYJA 1W6OB 2EW9A 2LRPA 1DBDA 1S0IA 1E6VB 3HHNB 2OPPB 4IH5A 4UW6A 1CAVB 2DV9A 4J91A 5FYHA 3SSSA 1RT7A 4BDVB 3IS9B 4NIAA 1RGSA 3ZFFC 3Q8QB 5LK7B 4A8YA 1EKRA 3T0DA 4ZPVR 5K0UA 4I6YA 2F1FA 3CDEA 4M8LA 2B46X 3G6XA 4GB32 4DV0F 3I2IA 3RDIA 1D0EA 1UY1A 1R89A 4K40A 1OY6A 5GAEU 2HNDA 2VDHA 4AGVA 1Q8OA 3ZMOA 3KHHA 2XG8A 4GALA 3GBGA 2CJ9A 4Q0UA 4B9NA 4RU9A 4IGPA 2G9FA 4D6QA 3O1TA 3PO5A 4MFBA 2BDRA 1YEWA 3H50A 4DS5A 1T94A 2GJ2A 4YB5A 3H42B 2I5JA 3VZJA 4DV1F 3AYEA 5K4LA 1D0HA 3GJRB 3QD6A 5FP3A 1C4CA 2P9EA 4XPEA 4DR4F 1L7LA 3NY0A 1QQP2 2MKJA 4P08A 3IAPA 2B9XA 2JLFA 2BJ1A 1VRH2 1LFPA 1RAJA 4NMXA 3CCRS 3BO3A 3AOAA 1HRV3 3IRXA 5ABJA 3PYGA 1ULRA 5KFVA 1ZRFA 1XERA 2DKOB 2RHPA 3MM7B 3KVBA 2MLXA 2BUNA 2Z8QA 4P2SA 1W04A 2D6KA 2JG9C 3THCA 2B6AA 2ZC3A 1AXQA 4OZ1A 5FDBA 1VISA 1W2AX 2IDEA 1QLNA 2ZWOA 1VC0A 1JLQA 2JDJA 4YVWB 2ASJA 3WDTA 5HP1A 2ZH2A 4O65A 4OLLA 1FEHA 3NAIA 1GWKA 1DAXA 3G9CA 3FBBA 3KJQB 1WORA 4TU8A 3W20A 4CZCA 4RR5A 4AQ6A 2XJPA 4DUYJ 3CCJS 2Z30B 2BW8A 1S55A 4FVVA 2XY7A 4D3GA 4Z07A 1ULEA 4WFBQ 1E6VA 1RSCA 2GC0A 2L9LA 1XMOF 1CAVA 5C42A 1JMTA 1HV1A 1NSQA 2UWCA 1ENRA 3D8CA 1RT7B 4ES3A 1F3VA 1I94F 1FJGF 4FS2A 2VBYA 3OEBA 3USSA 3K7RA 1WI8A 2KA3A 3B4DA 2VF3A 2Z5WA 5DG7A 4J25A 3KG0A 2PN6A 1HWJA 3QSIA 5BR8F 1VR6A 4ICLB 4GKJJ 1FJCA 4KQ7A 2O67A 4P9XA 4LKFA 5BNNC 2E7WA 1G9DA 1JOPA 4DU8A 4AFBA 3DCAA 4X8PA 1JYIA 4NE9A 3QWUA 3UDVA 1HLCA 3RVHA 4UBHA 3ZYIB 9RUBA 4ZXEA 4FP3A 2FZCB 4C3MA 1S4EA 4LBQD 4YM3A 2R7RA 1WGPA 3BALA 2OMOA 3X3UA 3D67A 5CYMB 4JQRA 1BMV1 4LO8A 2W95A 3H42A 3SC7X 5KG4A 1RHQB 1HJFA 2Y8WA 3R6GB 4Z7CA 4IO9Q 4S2HA 2HVHA 3DPRA 1BLUA 1NAEA 1NUKA 1FOD2 4QKFA 4PUOA 2N7CA 1YHQS 1S9FA 2FZKB 1RUH3 4S2FA 2FZGB 3ZYBA 3RWNA 1RT1B 2HRTA 3DOMA 2W9BA 3N01A 2WSUA 4ED2A 1NK9A 2UVWA 1RT2A 4ES9A 3E51A 1XOYA 4L99A 1U5IA 4XUQA 2DVIA 4QM9A 1R1A1 1YFYA 2XLKA 3QRQA 3HBZA 1X60A 3QBQA 2BV3A 4NX9A 1DG6A 1ZBA2 3ILLA 1YLXA 5FUIA 1TMF2 4K21A 3M6UA 2OPQB 2R16A 2FJVA 1UOFA 3R2CJ 3DUIA 5THWA 1UXZA 4ECTA 4XFGA 1YX2A 1NXMA 1VQSA 5HP1B 2A6OA 1VQYA 2CQDA 2ZAHA 5H9SA 3C7OA 2WFF2 1X4HA 1QMJA 3H4BA 5FFOC 3CCQS 3D6FB 3I8TA 2YC0A 4D69A 2OEJA 1SL2A 4AAXA 2XVKA 4DZGA 5JXHA 4OI0A 5FYZA 3KT1A 4Y00A 1LNSA 3KCXA 4JI0J 3SNMA 5FYYA 3ZXKA 3DOLA 2J76E 1ND3B 4FPOB 4K4XA 4DL4A 4ECVA 1KHVA 3TUIC 3OD2A 1PC4A 4PRFA 4K6BA 3DLBA 3D82A 4KTQA 1FXLA 4V2VA 1H98A 1YJVA 1FRLA 2DCUB 2ADEA 4LIRA 1RYYA 4DR2J 1BKZA 3M3IA 2J1EA 3EPIA 2X3GA 2V5YA 2IVYA 3QGIA 4C11A 2FGOA 2LP4A 2Q1LA 1S1WA 1GFF2 1B35B 3AJDA 2W9CB 3MYXA 2R4FA 5FLXY 1CX4A 1UPIA 5DZFA 1Y00A 3JCIA 3KS7A 4IERA 1RAGB 2W01A 2QQUA 1IG3A 3K5OA 2ZH4A 3WUDA 4F3JA 1Y5NB 4OL8A 2A6YA 5HCHA 4UZBA 3K75B 3I4HX 2WS92 2ZZNA 4BM8A 4NA1A 5IT0A 5CYMA 1J1TA 1ZM2A 1WD3A 2WNUC 4ZVEA 4OLOA 2WABA 3DEMA 2FJWA 5I3PA 2IHR1 1HNIB 3DPRB 1EV12 2FHMA 2YUEA 5D0EA 1EPZA 1WCSA 2UXBJ 1NKEA 2DNLA 2FLLA 3ORJA 4OJ3A 3IDBB 5B4XA 4ED7A 1T8EA 2BW2A 5FBJA 1HWIA 3BI3A 2RS12 4BWOA 3A22A 3TQEA 2HFNA 5CAAA 2DVGA 2HEYF 2B4KA 2HWC1 4N53B 4Q0BA 2YTCA 4FP9A 4BQWA 2Z58B 1BZWA 1ULFA 1CAWB 2HYIB 2JE8A 4HG6B 5KG2A 3DOKB 2GN3A 4JKKA 3LQCA 1AJOA 2VZRA 3MPDA 1FTRA 2RDDA 1F9KA 2W5FA 1RLDA 4CCNA 4W50A 3A8JA 3HT3A 1I3OB 2H4WB 2GQ2A 4AE2A 4Q4V2 4YY3F 1XJAA 1LHWA 5JZGB 3U4SA 3HQRA 1R093 1I6XA 5JR7B 3C6TA 4OHWA 4WTOB 1Q78A 3M05A 4WXOA 4K1ZA 1TQ5A 2GS8A 5A0YB 2FY8A 3P45B 3MPUB 1LKZA 5LSRA 4QPGA 3JAMY 3BN4A 3KWVA 4HBNA 2A3WA 3MR6A 3TBDA 5AXMA 2RM22 3TNQA 1OQ6A 2RHSB 2Y1JA 1N3QA 4CUBA 2E5JA 3G8QA 4V19X 1W6QB 2RSQA 4OI1A 4ZY9A 3LPYA 5EFUA 1YRTA 2YNHB 4OZXA 1V6JA 4P9WA 4XFIA 2E7TA 4B4QA 3M3EA 4CO4A 4MVTA 4I6WA 1FKPB 1K5JA 1H2LA 2AIRB 1J5OB 4O0NA 5C3QA 3CJ0A 2CIMA 4NXMJ 1D2SA 1UPPA 5JI7A 5A3NA 2OZ6A 3MPPG 1UNBA 4A3ZA 2J6UA 4OUEA 1SG3A 1IWGA 4LT5A 3V81A 2WC2A 3BGOP 1D4M3 1G86A 5F0WA 1H7XA 4HH1A 2A6WA 3IPVB 4USTA 5IXUA 3ULHA 2VXJA 3O1RA 3WC2A 3IBCB 1TELA 3MAQA 1NK7A 3M2RB 3BQ1A 4XIUA 4CDQC 5KT2A 1X50A 5DZGA 4F50A 2ADCA 2RNEA 4ZS2A 4JBCA 1YFUA 2Y9HA 1GYKA 1UTAA 4J9PA 5GMDA 1TZOA 1J1LA 4USHA 3MHYA 4C0HA 1H38A 3PDNA 5K8MA 2JE9A 4GKXA 5IWAJ 1H72C 4YS2A 2EC0A 4PKDB 4CP0A 4NLPA 3DLLQ 4KHRA 5D77A 2R8HA 2RS2A 2JD9A 2VUAA 1C0TB 3MEPA 1UZ0A 5FZCA 1ICEB 3PRDA 1M1GA 2QLFB 1PGSA 3KFWX 3HWJA 3G6ES 3D28A 1VBE2 4NEYA 1HR0J 2WT1A 1RUH2 4QT6A 3I31A 2IBKA 1FE4A 2PD1A 3I96A 3ZXDA 4JI7J 4DY5A 3GFYA 4QWEA 1XYNA 5FZIA 4AQYJ 5DAPA 1SACA 4KT0C 2GC2A 4AVSA 2V4JB 4MHUA 1YBTA 3VLBB 1OA4A 3D4KA 4TY8B 5U47A 3PX4A 3C15B 3ZYRA 2B8QA 4Q8LA 1Z0HA 3F41A 2I45A 2KI2A 4BIOA 5ETTA 3I2JA 4FKXA 1XR5A 2KM2A 1WF2A 1GT8A 1QXPA 1QAJA 5ERLA 2W1QA 4CTAB 2FY1A 4PWDB 1H2UX 1REGX 5HMZA 5HROB 3CO9A 2YZ4A 1DTQB 1WKYA 1R31A 1G9CA 5A33A 1UZDA 5LY2A 4AHXA 1QJEA 3ELHA 1NCRB 2EXIA 3OXGA 4OZ3A 3MPVA 1BWVA 1RHI1 3ACLA 4P9SA 3USUA 5D8AA 1DF0A 3ZYPA 3UJOA 5CKQA 4XE9A 4QHOA 4BXSV 4TLQA 1RMU2 2Q1MA 2X09A 4UI9L 1WF1A 3M8QB 3B00A 3W5MA 1L3VA 4NPRA 1RUD3 1S6PB 1XU1A 1WA4A 4AXJA 1QQP1 3NLCA 1ZA2B 3JZVA 4MKYA 3DU6A 1JNZB 3PHTA 3U14A 4NRQA 1D8YA 2HHTA 1IQDC 3U27A 3N4WA 4ZPDA 1G6NA 4WV8A 1ZA7A 1K5MC 2DGTA 4PF1A 3E97A 1JJHA 4UY85 2CA9A 2A7AA 1R6YA 3LALA 2MLZA 1YJTA 1MR5A 4MTPA 2EPIA 1RUC3 3LAMA 2MKKA 3O14A 1YJWS 2B51A 1N56A 3N9PA 1H6KX 2B5HA 1SUQA 3WX8A 1UVNA 2LA6A 1VBE3 1LW2A 3VL9A 1SXLA 5B09A 1OYEA 2KJVA 4RZRA 3IM0A 1Q8PA 1MN9A 2WT2A 2LQ9A 2RV9A 3GJTB 3MFCA 3AX4A 5HSPA 3ZIWA 3V6DA 3D54A 3LB9A 2ZNZA 4ZVSB 1QHDA 4IEQA 3KM5A 4C8LA 3RBDA 4DV5F 1ZOTA 1UJ4A 4DEQA 2AP6A 2J9EA 3FQLA 1M5KC 5CADA 1ONAA 2VXRA 4O3SA 3PNIA 4LJMA 1I1GA 5LBFA 2BNOA 4QDRA 3MBWA 4RD7A 4PG4A 2HHHJ 4D7TA 5E7OB 2LW8A 2MPFA 4M5MA 3DC2A 4KNCA 5HXVA 4ZHRA 3DN7A 1N4LA 4UXAA 3CJ5A 1PIV1 1VBB2 3M32B 3TAMA 4LSLA 1FKAF 2VBBA 2YNFB 3MMCA 1ALYA 4QIFA 1RT3B 4GVBA 4D6SA 4USUA 1V3ZA 2DUOA 1AL22 4DMZA 1F4AA 2CNOB 4GH4C 2WOMB 1RUF1 3PU3A 5A6ZA 1FRMA 2B6AB 3DGPB 1K1SA 3GZ7A 3RAMA 3HM9A 4IQMA 2PA7A 2XH6A 3FC0A 1Q81T 4UYBA 4ZVTB 3AB4B 1JW6A 3TNPB 3TNVA 5T52A 2L08A 4CIOA 4DWIA 3R5CA 1KC8T 3MGJA 3VKMA 1PBUA 1EETB 2RS33 4WXWA 3VBRB 1N5YA 3NAHA 3N5BA 4NLOA 4ZPBA 1MSWD 3QIPB 2FD8A 5F3GA 1BLZA 4B3TJ 5AE1A 4OMDA 5KOWA 4HH0A 5DDJ2 2A70A 1MMDA 2WFF1 1NRKA 1WUUA 2VG6A 5DETA 4PXDA 3OUHA 3CJ3A 2W2NP 1RI7A 3KJFB 3JQJA 1QJZA 5EQUA 1O3SA 1QSYA 4BQXA 4TN7A 4DUZJ 3FBEA 1XNDA 4MAKA 1TMF1 1H2TZ 1Q5YA 4I09A 2DHSA 2DTYA 4USIA 5J96B 3SV3A 5J98B 2YXLA 1K8AT 2CWMA 4CXWA 2FIUA 3O0WA 3OGSA 2CFXA 5GJ6A 1CJTB 1XMOJ 3MM8A 4FPGA 4BIFA 5A6PA 5LB6A 3KXDA 1MROA 2W92A 3R05A 1LB2A 3T08A 1CJUA 4X2BA 1XRUA 2QVSB 4AI1A 1UP1A 1NDLA 1UOBA 4NL5A 3CCES 1ITPA 4NPMA 5JOYA 1JLGA 5J2MB 3R4UA 3DHWC 1EV13 1TU0B 4XJ8A 2GSYA 3VDDC 4KHMA 4WU3A 4F04B 1V9U2 2VZVA 4R5PB 3L9ZA 3DNCA 2FCTA 1HNZJ 2M88A 2Y0OA 2YNIB 5DZ6A 5D3GA 3L2HA 2HIYA 3Q0AA 5MLCV 1U09A 3GV5B 4WM7C 5GAHU 1XYPA 1VIWB 4DR5F 3VBOB 2BGCA 2AYMA 2AX0A 1W99A 4E4HA 1G8WA 3OSPA 1RJJA 5FOBB 4DG1B 1DZQA 4WM7B 3B78A 1KD1T 2GDFA 2VD3A 1XTZA 4EMDA 4K8RB 1H2NA 3N7MA 4LE3A 1V6IA 4RO0A 4ES1A 1K0TA 4WJBA 4JI6J 1W9FA 3VDDA 2ZZTA 1WMEA 2A1BA 1GXTA 4PWWA 3WG4A 3VHRA 1NYWA 2HWE1 4MZUA 3TZZA 2E7VA 2IRYA 3HO1A 3DLKB 1KKHA 4CNZA 2BJEA 1AX0A 2LEAA 2ZHBA 3ST7A 3DKQA 4PYDA 1RBOB 4O3RA 2XJQA 2C2ZB 4L8QA 3VAFA 4IETA 4LKEA 5KOXA 1FTCA 2FLNA 1QJU2 3I2HA 5J2QB 4EE2A 1RDRA 1OMIA 5HXMA 2PEHA 4KY3A 4OI2A 1RACB 1WC3A 2ZUGA 4GA9A 4UFHA 4CWBA 4OIXA 1IS3A 4H4OB 1LESA 1C4AA 1H0HB 2CQ0A 3JBG2 2NQPA 2KM8B 3OXFA 2BKPA 4XIOA 5K8OA 1BBT1 5GKAC 3WDUA 3MR2A 1N6QA 5CZKA 3VHNA 2V8HA 2VODA 1CZVA 2DBIA 3ZSJA 1JLAB 4FBFA 1NU4A 1RWOB 4CLTA 4WVZA 4QR2A 1WCUA 1PM4A 4TYSA 4BHPA 3BTYA 5KFUA 3FBYA 1UOGA 3AC0A 1OYDA 5M0TA 1HIXA 5FLHA 5A3TA 4RFRB 4J9VA 4RW7B 3VKOA 3B8HA 2A3XA 2NN8A 4DDFA 5FJKA 3VD3A 3DI6A 3OFGA 4OX9F 3QFWA 1AFIA 3O0XA 3ON7A 1AA1B 3THPA 4OQJA 3UNPA 1S4CA 1GZWA 4IKAA 3ZDSA 1ZM1A 3WIVA 1NJYA 1UF2C 5G05L 2R8IA 4WU2A 2HFSA 4MHRA 2YC4A 2BJ7A 2P1BA 3O1UA 5JSRA 3T5HA 5JSOA 4INDA 1WTBA 5BV6A 1DYPA 2YKMB 3ILOA 4S0MA 3Q23A 1VP6A 1CZSA 3B4MA 2B9WA 1H3DA 1PM7A 4AK3A 4DUWA 4FXWA 3IGVA 3SEEA 4HN1A 2RQMA 3FUQA 4Y22B 2YQ3A 4DQSA 3FBCA 1HLWA 1UY3A 4P9GA 3EXUA 4DV3J 2PE8A 1PO21 2YGLA 2YV8A 5F7UA 3TAQA 5HO4A 2V72A 2HHQA 1QU0A 2UU9F 3OTOJ 4DR6F 4EK2A 2HWC2 4D3HA 3G4SS 1WLTA 2HQIA 4YW6A 1CPNA 4B3RJ 5HBAA 2KJWA 1OLMA 2OLWA 1I6JA 4U6PA 4URAA 4LRDA 2VU5A 3CCUS 4E4ZA 3QQCD 5JZGA 3VAIA 3BTZA 4AXIA 4Y1VA 3V64A 3R1HA 2B9UA 4M5JA 5SV8A 1SQFA 4YVSC 3DLEA 4M5DB 4PG5A 3PW5A 2VZUA 5IW0A 3M30A 4ZDNA 2MZTA 3GG1A 3H8UA 3HVRA 1KNZA 5CZVA 2ZBRA 4X4SA 5KFZA 2DRAA 5KT5A 1GX5A 1Y43B 3RBEA 1W8OA 1M5PC 1SFYA 1SPPB 3L09A 1IKYB 1TL3A 5D4LA 2XSJB 4ILRA 1SIZA 4CP9A 3P1IA 3UKTA 5DUUA 2CKWA 1WG1A 3EX7B 1HL6A 3T3YA 4I0WA 2ZH3A 4LOSA 4ZPWR 1NJWA 2V2VA 4H55A 3MV01 1TMMA 2H0BA 2F4VF 2BRTA 4AVCA 4UOGA 1Y3TA 4I7FB 1OO0B 2DNOA 5HJYA 1APSA 3P6BA 1RTIA 3HEIA 2GP5A 2E1PA 3K59A 1RT5A 2G1DA 4M95A 2HWD3 1ZTTA 1ZZCA 5KFBA 5JOWA 1T9UA 3I2DA 1U1NA 3LIHA 4ANDA 2MEWA 1H6XA 2R32A 4QX0A 3DI6B 1GSLA 3GE9A 2RUSA 3DM2B 4YN3B 2RD5C 3LIGA 1RHI2 4ED1A 2DDUA 5BXIA 4F8RA 3VAGA 4KBBA 4OYWA 1S5ZA 4TU9A 2IA0A 2XZWA 3GIJA 4XAAA 1DQ1A 3RB4A 4TTGA 1ENXA 2MB0B 3OR2A 4CLLA 3SSQA 4OI3A 2C0ZA 5FP8A 1IJEB 4P00B 2HWIA 4QB1A 3KT4A 5E8AA 1FVQA 3OF1A 3RG6A 4N9IA 5I8SA 3A8KA 2WZR3 2TNFA 3R7SB 1H9PA 1L7RA 2NXJA 4HK9A 2AH2A 2K2SA 4UY8T 1LHNA 1VS3A 1VE0A 3AB0A 1LGBA 5LXYA 2ZTNA 4Y22A 3KLIA 2R8KA 3KUHA 2HWC3 1YWKA 1GTHA 2IVMA 1LOEA 1RAAB 2Y38A 1KJRA 1VQKS 1XBFA 2BGPA 3ETMA 1OD5A 4BPZA 1PNFA 1DJ0A 2W87A 4CDUC 1WELA 2CPJA 1VC6A 2HFZA 3M7AA 5CISA 4LREA 2XLFA 4AVBA 2NLRA 3TJ8A 2I74A 2P9CA 1WW6A 1S9GA 2A3YA 1W2NA 3D1HA 4C48A 2K06A 1H2MA 2K8GA 2ZGSA 4OHYA 3CDUA 4CP5A 3HIFA 2JDPA 2GQQA 2OPSA 1VBYA 4EWAA 4CLKA 4Z8BA 3AB2B 4A45A 3M30B 2DCJA 4EWTA 2OQ6A 5F39A 5EJ3A 2CY6A 4IO1A 2KL8A 3MDPA 4YWAA 5BPXA 1RUSA 3PFOA 4KR0B 3ZZPA 3ES4A 5JVGQ 2ZGLA 5F32A 3GFXA 1ULGA 1W7WA 1RQ0A 2DXEA 2BDPA 2HURA 2L3MA 2RDRA 2OSQA 2XGXA 3OV7A 1WC5A 1BK1A 4FQZA 3W5NA 2DB1A 1T95A 1TG7A 2WZPP 4TLRA 5IVBA 5HI0A 4PG8A 2PMWB 1IHMA 4CYUA 2GNBA 1PIV2 2XYHB 3B9CA 2WNUA 2EALA 3T6BA 4HFSA 2DHHA 1LOGA 1M90T 1KQFB 4MFBB 5LBCA 2X5IA 1Q7LB 1CVNA 4TNOA 2W94A 2RU9A 1CAXB 2I5JB 1TP7A 4FXVA 1I3HA 2GVDA 1W2OA 3FLPA 5L1LA 1DIWA 3S0MA 1UX6A 4X4UA 2CQ2A 4PIYA 5KFYA 4IR1A 1LKNA 5KC5A 3UWTA 3LOBA 3OW2R 2AMCB 1NSPA 4EYHB 3O0VA 4PG7A 2D98A 4MSVA 2XNRA 4U7UK 5DLFA 5C3PA 3R5DA 3LFIA 4HT5A 4CLPA 4RLEA 3VBFC 5J09A 4JI2J 1VRH1 1LGNA 2XMMA 3RB3A 4CPBA 2F3JA 1JZ8A 3QJPA 1W9WA 4IEXA 4CSWA 4BYYA 1Z2LA 4Q4Y3 1S1AA 2HEKA 1U5ZA 2E29A 1UW9A 3N28A 1UOJA 5LJ5Y 2WONB 4UT5A 1OH4A 2UYBA 3ZDVA 2CQ3A 1ZRCA 3DN9A 4U8VA 3NNHA 3BO4A 2JIGA 1CZTA 2XWBB 4DMIA 1IKXB 2EA7A 1ZPWX 4YVSB 4ZVRB 3IN5A 2FHOB 2W2QP 3NJYA 1M5VC 3K51A 1LAJA 1JZ6A 4YYOA 1S9GB 3PVBB 4ISRA 2JVOA 1UYPA 3TYJA 4BHQA 3M2UA 4QYZJ 5HL7Q 2UXDF 2KH9A 3ZZZA 4BLGA 1YJ9S 1OQ1A 3MF6A 4I0BA 2EFQA 2FUG9 3MM6A 4DSKA 3PMSA 1NH7A 3I3QA 4NLTA 2D3UA 3NBPB 2YBKA 5IQ6A 4LF5F 4ZVHA 2D93A 5DN2A 1UW8A 3K4AA 1O91A 2ZOGA 3WR0A 1PGW1 5C9AA 4JI5J 1OOPA 5GZFA 3WDOA 2WOMA 2AEZA 4PXEA 3G82B 1GP5A 1LJ7A 3DRPB 3DGPA 2YPJA 1PK6B 3WLUA 1SQEA 4DJBA 4KWLA 1FYUA 1UWAA 3QT7A 3TAYA 3L4BC 4C90A 3MFAA 4NAMA 3ZFGA 2WNUB 4DIQA 4ZIVA 1RHJB 3NO8A 4XFAA 4XBQA 4AVAA 5IK7A 4B1MA 5JSPA 4DL6A 3T41A 4EROA 3PU8A 5DMYA 2TEPA 1LXJA 2QQIA 1CAXA 1ST8A 3NCPA 3WDWA 2OKQA 1IBLJ 4IRKA 2C9AA 3SQOA 2W2OP 3HSZA 4TLGA 1FK9A 3C7EA 4JI8F 3VBUB 3LDKA 3MM9A 1QE1B 5KHJA 4NRPA 2D40A 4XURA 2YX4A 2XC9A 2WLPA 2G1HA 1RT1A 2AYHA 5FXVA 1BGXT 4OV1A 1RT2B 3T2PA 3GHMA 2CWSA 2VFVA 2Z42A 1IPKA 4AUKA 2O66A 2A2DA 2MNGA 3BTXA 3J8F3 3LSEA 4DV2J 1CJTA 5FLJA 2GHVC 3ZVXA 2W3JA 2ZA9A 4JOUA 2IVFB 4ZIWA 4FDFA 3ZFEB 1WSVA 2OI2A 2QTWA 3HR9A 2GQCA 4DFJA 2CPZA 1BCXA 3UL2A 3MR7A 3ZR6A 1EP4A 1MACA 2GNKA 1FJGJ 2NCKL 4QZVB 3LH2S 3I9ZA 1H4HA 5KXBA 3H7YA 1YQ6A 2X3DA 1O8BA 2MTLA 5AXNA 1IXKA 5L1JA 2HWTA 1UL9A 3OBZA 1JIHA 4DV3F 2EFNA 3MMJA 3MPWA 2I9SA 3MW2A 1YQ5A 1OSDA 5HK4A 1SVDA 3OL6A 5L1IA 5D3GB 2C24A 1B0TA 3I54A 4RHV2 1D2QA 2O14A 3TOQA 3ZNUA 1QUVA 4UAPA 3KMQA 4ZK7M 4TQSA 2V50A 5HV0A 3QO9B 1KS2A 1V9U1 1CEZA 1KONA 3JD73 4LJHA 3ZN6B 1P8JA 2JEIA 4IGOA 2JX2A 2W0XA 3HT0A 4V2WA 3CW2C 3KJVA 2W9CA 1URNA 1TVRA 3VDDB 3PX6A 2OD4A 3ZO7A 3C6UB 2H0VA 4H7MA 3A12A 1KTVA 2IXIA 4BISA 2BYVE 3NNJA 2DUPA 4K5SA 2DO0A 3R4DB 1ZAXA 5C4WA 2VG7B 5D0GA 2EFVA 1VQLS 1ZS6A 2BE7D 1UIKA 1Y9OA 1YQCA 4CP2A 2BEFA 1NA1C 3MEEB 1AHSA 2HPUA 1J84A 2VNVA 4DRRA 3D7SB 3L7UA 3VD4A 3C3VA 5C8CB 1TKTB 3AFKA 3IAM9 3H3UA 1NPPA 4FPKA 3OR1B 2OW4A 2DGSA 3B6BA 1HQEA 4XIKA 2IBOA 4MV2A 4QB2A 1KDKA 4J90A 5KFEA 2V2ZA 2WSCC 1OSGA 2R2UA 4IV1A 1T9TA 1F2NA 4E2GA 3OSNA 1XMBA 4AI2A 3FSYA 5F3ZA 3AJ2A 1HNXJ 3NNLA 2OAUA 3UD5A 5LMUJ 3ZPYA 3DOKA 2X53S 3IXQA 1CJKB 2P17A 3BQ2A 2ZD1A 1L3SA 4FYDA 3LP0B 3ME2A 3GJAA 4J9MA 3MUTP 3VBHB 1LK5A 1VALA 2VZSA 4C97A 4K4TA 1AZDA 3ZXWA 1GZWB 4XK8C 3TW0A 2DF7A 3EBRA 2WA4A 2FVCA 1OURA 2WINB 4UW3A 1CLFA 2R072 4NMIA 1R8AA 2HNZA 3CMGA 4LR7A 4W98A 1W6PB 4IE4A 4B4RA 3MI8A 1A7GE 1LV5A 3T2QA 2DHXA 4QPXA 4DFSA 4H3WA 2JSXA 3EYZA 2PELA 1S2BA 4QDSA 2RM21 2VC9A 3OD4A 4ZVPB 2GMHA 3KF5A 2A6MA 2V63A 3QLQA 1GTEA 4XJZA 4OMCA 2MQNA 3U1NA 1NLKL 3FNNA 3FUYA 3H3ZA 4HLBA 4Y5SA 2JFKA 2AEMA 3IM9A 2WWUA 5KFCA 4DFKA 3VZNA 4AZZA 4DEVA 3FZ3A 1F3FA 3WNPA 2J7MA 1TUGB 2YU2A 4IV3C 2IYIA 2WRMA 2Y0IA 2OPRA 2AJ0A 2MSTA 2MHEA 2ROEA 2NS1B 4GD4A 5CHCB 2HHPA 5D15A 2WZR1 3I59B 1PYTA 4DCPB 2FHJD 3FZ2A 1C3HA 4KQZA 3J8F1 2HQCA 3PL0A 1P27B 3E6CC 4BC7A 1XNBA 3D0HE 3QH6A 1C5IA 3LWMA 1FJ7A 1K42A 1FWKA 2HIQA 2OFHX 3BCWA 1QTMA 1TKTA 4CCKA 2BNMA 2NYHA 2AUYA 2VASA 4Z1VA 1P1LA 3T1LA 4DSJA 5LEJA 3DYMA 2J7UA 2PI4A 4QKBA 4UW2A 1WKJA 3TVYA 3V4MA 1Q56A 2Y64A 1X7NA 2P37A 5A2QY 4OZOA 4C0OC 1OJ4A 2OYZA 4DLEA 1SL1A 2AF6A 5A7NA 2A6XA 2YWFA 2FDGA 5FLIA 1U48A 4NRUA 3MIBA 3LDRA 1JYCA 1WF0A 3OXLA 2JZ5A 4BMBA 2PHUA 3MIFA 2X51A 1PX3A 1EQ0A 5FZFA 4H7LA 4CLSA 4MGKE 4P73A 1XYOA 4ZITA 1NK6A 4JDOA 1AX1A 4KH1B 1JX4A 1JXEA 1FI2A 2LYVA 3VBSA 1NH8A 4O44A 1LCLA 3SFGA 3F44A 3M6XA 3ISNC 1HI0P 5GLTA 2BKOA 4HHUA 1NT0A 3M8PB 4P74A 3ZSEA 2VQUA 1G6BA 1TK5A 4CDXA 1I94J 4G6VB 4QYZK 4O4GB 3AJYA 1AL21 3BKFA 1REEA 5IK5A 3M9OB 1R64A 1YFXA 2LLZA 1CJVA 2BQRA 4JRLA 2EFGA 3PKMA 3A21A 2EBEA 2QDRA 5H9QA 3DGVA 4AOCA 2PHWA 4MX3A 4IRCA 2FB0A 1XNCA 1SBFA 3GG0A 5KFWA 4NHXA 1RWPB 1V3RA 3PVEA 4CRQA 4C4WA 5LW9A 3I2OA 4KSEB 1PVC2 1WDTA 3OGRA 4QU7A 2BEOA 2J22A 3ENRA 2F65A 2NQYA 1JU4A 1S72S 4AEDB 2JDZA 4UQGA 2OPRB 5CD4A 4JTOA 1HI8A 5CFDC 2XS7A 1O4TA 1O8SA 4QR1A 1Q95G 1CIWA 1CS4A 5JUVA 1S1TB 2C3PA 2HWB2 3BKUA 2E5IA 3M1HA 1UFLA 2Q5TA 1GLHA 5IT9Y 4XAKA 3JSMA 1W8FA 2AEFA 2QZ3A 4ZPTR 1MQTB 5AVAA 3TZWA 4MH0E 1DCSA 1RUG2 2BUKA 4OUSA 4LRBA 3GALA 3B93A 1U45A 2A6VA 1YXWA 1SQ4A 3H3LA 4CM2A 5FD1A 2XZDB 7FD1A 5HQMA 2IZWA 3KK2B 4M3CE 5FR3A 1J58A 2OPWA 1RUOA 5IFTA 4N47A 1ZVFA 4DLGA 4Y4YA 2AV5A 1VQ9S 2XNQA 3POEA 1W2TA 1POQA 1YNAA 3FCVA 1VYAA 3CMAS 2GNMA 4YZ5A 4WE1A 3QIDA 2RF2B 1W8WA 1MEC1 1RUG1 4WZCA 5CYJA 2ZJQQ 2HBYB 1VI7A 2OELA 2FJBB 5IM0A 2YB7A 3O2IA 1UEUA 1VDHA 3KLEA 4MXWA 2HZVA 1N36F 1XNRF 3LANA 2ROPA 5JI9A 2GVDB 2ZKUA 2XQCA 4NROA 1U1RA 1AR82 1RUD2 5EP9A 3LA7A 4D6RA 2YPYA 1NDCA 1JS9A 5AC93 5HAOA 2XPJA 5FZ6A 4DV1J 3AYAA 1CQ9A 4NIGA 1JZ5A 4IEVA 4LIVA 4O4GA 5L1KA 1ZM3A 2HBTA 5KWRA 1W0PA 2ATLA 1Z7S1 4M01A 4MKVA 3GZUC 1X5TA 4BA6A 3VV1A 5LEKA 4DQQA 4BZ4A 1A6CA 3I55S 5F41A 3U10A 3VQTA 3TANA 5CKMA 3R5BA 1N34F 1QJY2 2LALA 2LMIA 3MXHP 4URGA 2WONA 3E5UA 3J7NA 5FQ0A 3POGA 1T6GC 1U47A 5DQGA 1N3OA 4LBPA 1VMBA 4QPGC 4XF1A 1B35A 1FKOB 3VDAA 2IUWA 4YVSA 3M8ZA 1MS9A 2Y34A 2UXBF 5IFPA 3HMJG 2IPOB 4QKDA 1TKZA 1GNZA 5M2UA 2ZEXA 2XMJA 3D0GE 3P96A 4ES2A 5IVYA 3C66A 1Q1KA 4ZONA 4WM8B 3WD5A 3FBMA 2GAGC 3TEHB 3OBRA 1EETA 4NHYA 4Q8EA 2VMHA 4BQ1A 5EGYA 4DR1J 4GC7A 5JMCA 2R1BA 1NZCA 1OD3A 5A8KA 1Y9QA 1P9QC 2HWB3 1QOTA 4D0QA 2NP0A 5E3CA 2PC6A 3BEGB 5KAKA 4CH0S 2VBXA 4QXBA 5ANNA 1DQ4A 2OTLS 1LOAA 4ZP9A 4WM8C 1JLBB 4NLSA 5FZ1A 1LU2A 4RUCA 1LWCA 1FMD2 2E63A 1TK0A 3ZYJB 1G2EA 1YJUA 5IOLA 2JENA 1NJIT 2QV6A 2K46A 2VTFA 1GQEA 2B7YA 3LAGA 3AH6A 4L11A 4XUNA 3SEPA 5FMCA 1PGW2 4USVA 1YWXA 4JGZB 2DD8S 3G71S 1MPXA 5D4PA 4QX1A 5L9VA 3CJQA 1K44A 1B09A 3PJXA 4ENOA 3AP7A 2KRBA 1RHMB 1DU3D 5KXCA 2HLUA 4MXWB 3PEJA 5K9YA 2ZEJA 3HXMA 3VAJA 1YFWA 3TN93 2QIFA 1RE1B 5I0TA 4YHHJ 1KEXA 1N1SA 3MAAA 5ETPA 2XCPA 2ZEWA 3X1LB 2DGXA 3VQSA 1FK9B 1GNKA 1HHQA 3MFIA 3ZFEC 1PC5A 1JYWA 4IV3A 2YH1A 1IKPA 1R1A3 2VOKA 4KO0A 3FLTA 2I38A 5L9NA 4CCDA 3WIUA 3I97A 3H0OA 2NZ9A 5EZWA 4FF2A 2WNVA 5LBBA 4IOAQ 4GULA 4ZU5A 1OLQA 4PDWC 5FJHA 4QX8A 2WVCA 2DBBA 3BF4A 2VA2A 5E3PA 2J0WA 2V4RA 3IDCB 4LF6J 4AI9A 3NWGA 4R9BA 2ZHOA 1WLWA 3TVZA 1IKQA 3KLSA 3PX0A 4AYBD 1FKOA 2JD4A 3WX4A 2ZE2B 2KN4A 1V6KA 3MIEA 2QSFA 3WCRA 1H2VZ 4KGMA 3C6TB 1Q5OA 2EICA 2ZGKA 1HMVB 3UNGC 1N1VA 4N9HA 1T9XA 2MJUA 2XHNA 3BB5A 2B43A 2PA8D 1IBKF 3ILNA 3ATGA 4ASKA 4PDWA 5J2QA 4X4VA 3H1MA 3ZFGC 1OPZA 2D9PA 2IXLA 4PIZA 2A2CA 3ZYFA 4O23A 2DCYA 4HK8A 1S1XB 4LBHA 2KTQA 3LCPA 3WUCA 1S6UA 1GUIA 5FY7A 5A2QU 1FDAA 2ZBJA 3FEYB 1VQ6S 4XDCA 3NG8A 3GIKA 5KFPA 5AC91 4R0JA 1PO12 4JV4A 3UETA 2ZH9A 2W8LA 1RUE1 2AZ3A 2OD6A 2J9CA 2J5AA 2EIBA 1B70B 5A32B 4RW4B 1FNMA 4Z82A 3CC4S 5JVHQ 2ZH8A 2XG3A 3I3EA 1HWUA 3KDOA 2KKHA 2ENRA 5T54A 4PIXA 3EWGA 2NZ4A 1HNZF 1O3TA 1KBRA 1T9WA 5KFIA 5FY1A 2MKYA 4A48A 4AYUA 4FOVA 2B9YA 2QZ8A 4NZ0A 2M4MA 5F1RA 3OPWA 4YR3A 1ZZFA 4GJZA 4F25A 3NRBA 1GICA 4YGDA 2DH8A 3ENAA 3F2ZA 5C8CA 2BWAA 1F9EB 4FF1A 1RTJB 2V5DA 1IQZA 3MAAB 1QAXA 3U37A 3NMBA 2C22A 2FCUA 1TE1B 2ILZA 4HYKA 3D68A 3S1TA 1HQNA 5LATA 1V6HA 1KLNA 1URXA 3H1WA 2HNYA 3O44A 2Y6JA 1SJ1A 1XNAA 4EN6B 1HIYA 4KO0B 2QA1A 5DUXA 4CTAA 4XZPA 4LFCF 2O0OA 2ILMA 2X7IA 4YRDA 2VVEA 5IVVA 3CD5A 2ALZA 5FREA 4ERDA 1CJKA 3PIOQ 4WIQA 3SMHA 4AAPA 1LWFA 4HMZA 3WG1A 4DQRA 2CJXB 1RHUB 3GCXP 4ETXA 3ZN4A 2B42B 2NMNA 1KFDA 1BBT3 2BX6A 2KT2A 5ITHA 3H7HB 4R0EA 2XJRA 4QWDA 3TUPA 3BOWA 4ISQA 2V4JA 4TY8A 5A6YA 4AFDA 1EX8A 3M8QA 3M4XA 1WUVA 6FD1A 5B0GA 2WFF3 2HBQB 1L3KA 4PABA 1F5BA 3OSDA 5I4MA 4FS1A 1NK0A 2CHHA 1EAYC 2A0FB 4UBGA 2Y33A 1WEXA 4FF3A 3FQKA 4M1KA 4H14A 2VW0A 4PWDA 1B64A 2R2RA 1K45A 1SLTA 1DTQA 1U12A 2J42A 5E89A 5J1NA 3NV1A 1HD1A 1VGYA 1BQPA 3JQKA 3LGNA 1ZZ6A 1ULDA 4LULA 1DGWX 3VDCA 1U0HB 3EDRB 4WFAQ 3G6VA 5MAOA 1AT1B 3WG2A 2J8SA 1E6YB 3D3AA 4I3PA 4B3MJ 3Q2TC 2KT5A 3FHIB 2E44A 2FQQB 4RW4A 4KPYA 3KSCA 4XJUA 4ZPIA 2BXJA 2MY8A 1KDMA 4OZNA 4DU7A 4HN0A 2A3JA 4DV0J 4RGGA 2MDAA 4DEZA 5KC6A 2NUUG 2OEKA 2P2CB 1Y5IB 1EUTA 3PVNA 2MZQA 1YQHA 3WNOA 2WN2A 1QOOA 5CFCC 2KYXA 4I2OA 1NCQC 2FQPA 1DZRA 2IJRA 3CD7A 2NXCA 1ZRRA 2HFUA 3WC0A 2QNKA 4ZJQA 2AGOA 3GNEA 1HA1A 2ZFHA 3KCYA 5J7MA 2HEWF 2JEJA 1ZYBA 5CAZA 3KJNB 4CDUA 1UKGA 2HRUA 2OSRA 4ZN1A 2KD7A 4W6XA 5AVPA 1S1UB 3ZO0B 3FCWA 3I5CA 4UOHA 2WO2A 3NGKA 1U6FA 1N33J 5HLFA 4N7UA 3OFFA 5F5AA 2MXYA 2HAFA 5IUQA 2V34A 3QZ7A 3CJSA 2FDNA 3ET6B 4FXGB 5LM7E 4OHVA 4B9LA 4ED4A 4XQ4A 5DRKA 1ULPA 2XB2D 3KLVA 1RVF2 2G1MA 2QQVA 5FAXA 3V5RA 4QXHA 4DUVA 2AJ2A 2ZZJA 1Y0HA 3PACA 1Y3JA 4EQVA 1W3VA 5KHIA 4HSJA 2K1RA 2V94A 5LY1A 2OEMA 3AL6A 3MM5B 5J1EA 3HBKA 3LA3A 4EUVA 2EKNA 4QIWD 2D69A 5ETSA 1N32J 2OZJA 5CYQA 3KV9A 2VQTA 1NKBA 4HVRA 1ND2A 4NRMA 2JICA 2PHTA 4GXLA 3WW1A 1EQMA 2NYIA 2R9LA 4BS2A 2B5JA 3POTA 4MGYE 2C28A 2VMCA 1KP6A 4UTGA 2W2IA 4RWWA 2HHVA 4NWVA 4RR3A 1VPHA 3EHKA 1RCXB 5EJ1B 2BYCA 2P3KA 4BQ2A 4WVMA 4AHYA 3W1YC 2QN6B 1JLFA 3CBNA 1RUJ2 3TEWA 3C14A 1ZA4A 4SBVA 1PVXA 3AA9A 4CYUB 1E5SA 5DABA 4J5OA 1O3RA 4RQPC 4BJ0A 2Y6HA 3T19A 1WBFA 1Y9GA 1QSSA 1ENQA 5I42B 1KOOA 1V70A 1OFSA 5KBFA 1C57A 3UKVA 1C28A 1DQ9A 1N5YB 2X5IB 4HSLA 4PWUA 3PO4A 2EG1A 5L9RA 3MURP 1LR5A 2EG2A 5C3RA 2VNOA 4KFBB 3MLLA 1JI6A 1JXLA 4WP3A 3QGGA 2DHAA 3FCHA 4DV6J 3LF7A 3BM7A 1UFKA 2P5VA 1U1OA 2LTNA 3OHBA 3KHLA 2HK3A 1PVC3 2GGPA 2VUJA 3H5XA 2HVDA 2QLBB 1X0FA 1KFUL 3PLQA 2B7CB 1UYZA 1B7FA 1TK8A 1IJFB 1HQUB 5I93A 4NIHA 3MM8B 1ZBE2 1KITA 1MVQA 2O8QA 4DG1A 4MLOA 1RWMB 4YM2A 4IUFA 5F5IA 2QYGA 3I5BA 3JXSA 4E4SA 2DT9A 1JJ2R 2AJ4A 5J1XA 4U7UD 3WHTA 1UVIA 1XPWA 1RYSA 3DRXA 2LKZA 1VBZA 4WVWA 4L0PA 1FXDA 3DYAA 3R1LA 4NCBA 5FKBA 1KQKA 1O59A 3U78A 1QD1A 2YBSA 4FPHA 4JHZA 4LF6F 2HGNA 1GZ9A 3KLGA 1FFSB 3KF3A 1S99A 1UMJA 2XJVA 5JOXA 4DXSA 3C8XA 4OVEA 1W6NB 5IJRA 1KN6A 5HBMA 3N7LA 1FCAA 2XBO2 4NLDA 1GMVA 1YI7A 1RITA 1J83A 3WT3A 1R8PA 2RJ2A 4N43C 5L36A 4RN5A 3AD7C 1TMJA 2ZBIA 3G7DA 5I3QA 1MWZA 3H40A 2PAMA 1DTTA 5FCCA 1OOPB 3WCSA 5E88A 4ECRA 3OY8A 3R27A 4XBLA 3GIRA 2VDIA 1UA0A 3LKJA 3JYTA 5H9RA 1N6QB 4RS5B 3ZOIA 4B9MA 4YFZA 4WVMB 1HI1A 3E6BA 1ACCA 3JB9k 3CDAA 3CWJA 2NSBA 4F7VA 5BNOB 2RU3A 1R43A 5F6KA 3D1OA 3GGLA 5FY5A 4PPDA 3UVJB 4KH0B 4P75A 4XPCA 4K7JA 1UVJA 3SSRA 3J7MA 4ITSA 3H5YA 3AYDA 3ENWA 1MS5A 1X4CA 3KTQA 1BHNA 2R6QA 4RNOA 4Q26A 1FOD3 3G96A 1FD8A 5LMNJ 4C1WA 5SZTA 1LEOA 3KK1B 2LQ5A 4QHZA 2GO9A 3UO0A 4OX9J 5GLUA 4DR7F 4WZQA 1T03B 1S9EA 3FHAA 4WZFA 4J9LA 5D8AC 4C91A 2WO3A 2E1RA 1RAOA 4O3QA 3IGNA 1ZBA3 1A78A 3U75A 2WNEA 2IVIB 3WF3A 2ZGTA 1W28A 3E2EA 4P2XA 3K57A 2CJKA 1BXHA 3KHGA 3H8OA 1FT8A 3I0SA 4DR1F 1NNDA 4LQ9A 1G3OA 2CWXA 4W65A 1VBB1 5BNPB 3MW4A 4ZCIA 3EMRA 1PVC1 1NHUA 1NK5A 1QTNB 2C4XA 3MHZA 2RQKA 2H6BA 1XSQA 2LA4A 1IS4A 4LF2A 2WSFC 3RRGA 1JKHB 2GMJA 4RNFA 3WF0A 3ZXAC 1YIJS 1NLSA 3NEKA 1GWLA 3HT2A 2ZKNA 2KZZA 2M8DB 2IWGB 2Q6CA 1W0NA 3PUHA 5ACA3 2RT3A 4K7QA 1X82A 4B9UA 5CBLA 4LO6B 3HQUA 4Q0SA 3Q8UA 4CO3A 1O3QA 3VGVA 5DAQA 1T7PA 1D4M2 1D0GA 5E16A 3O1LA 3E6DA 2E66A 3H8YA 3ZSLA 5AT1B 7FDRA 5DQ0A 3POIA 3K0JA 4A6SA 1S10A 1RUE2 5FY0A 4ID5B 3KK3A 3SISA 1H4GA 2DUQA 3RI8A 1OQ3A 1YZ7A 1HNWF 4O9GA 3WY6A 4MK9A 1XJWB 1DY3A 4J9UE 3VVUA 3HOBA 1TKXB 1X5OA 2MHFA 3R0RA 2DURA 1MNEA 3FRYA 1AL0G 4NA2A 1WNEA 4XF9A 3UESA 1PMJX 3SXWA 4CDQB 5HV4A 4IOBA 1R082 3BYRA 1NQDA 5BNOA 2SXLA 1RT5B 2VOVA 2R1DA 4GIQA 3RB0A 3QH7A 3HAGA 1PBAA 2BFUS 1CPZA 1BQMA 1PJ7A 1NSKL 1HMVA 3AVRA 4KBIA 2E9QA 1UU5A 2DGUA 4XFCA 2YWHA 2YQ1A 2Q4SA 5E3RA 2FZ1A 5GMEA 2CDRB 4GMP0 3EMTA 2DPIA 3RWKX 2XHWA 3S30A 1B4SA 1HWKA 1S1XA 1X4DA 4CVUA 1C1FA 2JC1A 3QLHB 3C2UA 1R6VA 2V09A 5AE3A 3GSIA 5IVFA 3L9JT 5DZEA 2B8MA 2E9ZA 5FIIA 4XILA 4U95A 4YSFA 4ELVA 4H4MB 2CRLA 4IV1B 3DXBA 3W66A 1ZBE3 2CWKA 1FDBA 3WP4A 3MECB 2ZOMA 1X9MA 4JV0A 2XLIA 2ZITA 4G3IA 5CCLA 4P7VA 1J3RA 4AQYF 1OUSA 2LS6A 1LWEA 3HFVA 5JMNA 4UFMA 1C8NA 3POSA 4HR2A 2W1SA 3FRZA 5T41A 1VIXA 4KV8B 4JB8B 1NKCA 1JLQB 2VBPA 1FV2A 2CADA 5DPNA 3FMWA 2I07B 2BE9B 4L73A 1NM2A 4WP9A 4I2PB 4KC5A 1AYM2 2OKXA 3GP9A 3PCOB 2IFXA 1MS4A 4PT6A 1X8DA 4ANCA 3B69A 4QJVA 4UW5A 4LF9F 4DF8A 4WWSA 3E1F1 2QGFB 2VKRA 3M8YA 4P2MA 2E9RX 5ETOA 3OUYB 1XNKA 3KUGA 3P3DA 1Q4RA 4RHV1 2HNYB 2XB6C 5FZEA 4XFHA 4R25A 3I4IA 1UZYA 5JOZA 4BCUA 3FSIA 1W0OA 2XZTB 3EM1A 1N52B 2VNRA 1JXVA 2B4PA 4F36A 2EK1A 3J26N 2HBZB 2CTVA 5DG8A 5A6QA 3ELNA 4XZUG 3DMJB 3UK9A 1MMNA 2EKYA 3D6TB 2BW7A 4ED5A 1FMD1 4XBNA 4WVVA 5G0RB 3PUAA 1S6OA 1NHVA 1BEV3 4JDMA 1T05B 1N32F 4YOEA 4CDQA 3VBFA 3WNNA 4ZLPA 2MQMA 1N88A 4LVOP 1Q53A 4QIEA 2LROA 3I59A 1TL7B 4ECSA 2FMYA 4QHBA 1FX2A 4I0AA 3A4TA 2P6SA 1UXXX 4A44A 4OX6A 4UFLA 4NE9C 4OI4A 5FZHA 4OZ5A 3UNYA 3WHUA 5E1RA 3KV5A 5T3NA 3RZAA 2XSFA 3WF2A 4YB7A 2CYFA 4CU7A 1P1TA 2VPXB 4GAZA 4MK8A 3TA1A 1NCRC 2ZS6B 5EX3A 3HI9A 3TA0A 1G7CB 5J3UA 2NR0A 2RR11 4ECQA 2CGPA 1Q7YT 3PYDA 5SUHA 4OYZA 2BM1A 1RUE3 3MMBA 3POJA 3HHEA 5HQLA 2JG8B 3RGIA 1RU2A 1YK9A 3NAPB 2VZTA 3ZTRA 2VM9A 1BMQB 1HQ2A 1EYBA 3OFEA 4IL7A 4MYEA 4YDDB 4QW8A 3RTVA 1Q82T 2BGOA 1FDNA 3HK2A 1SV5A 4IDKB 2XMLA 1GV9A 2HWF2 1FF2A 2OIIA 1QNYA 4E8CA 1ZZNA 1RHRB 2XDVA 5A3LA 4M0HA 3HVWA 3PXGa 4CCCA 3VGSA 5C42B 3KUEA 2ZAAA 2ZNYA 1FA0A 4DBQA 2H9ZA 2P6HA 1SC1B 3RNSA 3QBCA 1DGWA 1F2GA 1OS5A 1NDKA 1NY71 3T6JA 1JLCB 2VZ1A 3JTNA 4ZVQB 8ATCB 3RBZA 5FJ4A 1S1UA 1X4AA 3LQVA 4DPYA 1X9WA 4LBNA 2E7XA 3NJZA 3J4UH 3FEXB 1WOSA 2C2EA 1UZZA 3DCQA 1FXZA 2QQWA 2Q8CA 1GZCA 3QOPA 5D6GA 1SKSA 2C3YA 2RIJA 1OLRA 2IJNA 3HKZD 1XC6A 4LBQA 4C11B 1NDPA 3DMJA 2AREA 3IRWP 4ZA1A 4GWJA 1QF3A 1IKWA 5DDQC 1LRHA 1QJY3 4MYTA 1EKSA 3GIMA 4F0MA 5F8HA 1NCQB 3RZKA 3P4UB 3W5YA 5JIUA 1LWXA 1EAH3 1UY4A 4EZ6A 1PO23 2QL7B 2UZAA 1T9VA 3SQGB 2LFVA 2ZHKA 1EAH1 2E33A 1FOD1 1KLMB 1VQOS 2K1RB 4U7CA 3G86A 3LE0A 3M2UB 1JXNA 4LE4A 3MM5A 1VLOA 3ISND 4AF9A 2Q66A 1S79A 4MKAA 4AL7A 3MTKA 4AWDA 5FP9A 1MMLA 1Q8BA 1FX5A 3BIEA 2HWB1 1S1VB 4ZJOA 3PIGA 2ZJCA 3GF6A 1ND2B 3JSMB 4C1XA 3N6NA 3WEZA 2BVZA 3VGIA 4U96A 5DGBA 2DR7A 1GQHA 5EUHA 2PLV3 1F6TA 3JU9A 4R9DA 2BABA 3MM9B 4DL0C 2QFIA 2XQXA 3C8YA 1HRV1 1OXCA 3WW4A 3FN9A 2R8JA 1MN7A 2HMIB 3T4HB 3PR4A 2Z2ZA 1OQEA 5EWEA 3KOAA 4XUOA 5A3OA 2VG5A 2JG8A 3NNMA 2ZABA 3FUOA 2W4CA 3AY0A 2GALA 3NAPA 2VJVA 5IWAF 1RGVA 3OPZA 3JB4C 3NS6A 2RMU3 1GFWB 1JJCB 3K2OA 4K4WA 3SV4A 3SYZA 1PZ8A 2J6SA 3WHIA 3TUZC 3DOLB 3GFHA 2JXAA 4XF0A 3DLHA 5GADU 2ZX3A 5CD4H 3AZZA 2LVWA 1DFQA 3KLEB 1W2BR 4META 2OS2A 3LEGA 1DQ0A 4COUA 2CVIA 4RA0A 2MEV2 3D0IE 1TUVA 3NGRA 3LGRA 1U5XA 4XF3A 1PSDA 2Q1ZB 1UPSA 1AR81 3P5BA 4YW2A 3NNGA 1U7LA 3RYKA 2C3UA 3DRRB 1ZRIA 2R3VA 5KFXA 2YKOA 2JG8C 3DRYA 3TI0A 2LECA 5A0YA 2DH9A 1S7HA 3IMQJ 1SBEA 4OQ9A 3KMSA 1HQWA 1HXS3 3TB0A 3RW6A 4LA2A 1QAYA 3BV8A 2BZDA 3GQCA 3I49A 4IXLA 1RP5A 2ZGQA 1BQNA 1X9TA 3SXLA 1MWYA 4LBOA 2BVBA 3S7IA 3EZUA 2WJSA 1P6TA 4LSNA 4DXLA 3FE5A 4RL1A 5L8RC 1M06G 1BJQA 3GDBA 1A6LA 2CDQA 1KS5A 2VQEJ 4WM8A 4CUCA 1RBAA 2EFPA 4JQTA 1HNIA 2WO1A 1NHKL 1RAHB 2RJZA 4HTIA 2UVVA 3T1AA 4DQPA 2MQOA 5EYXA 3VN4A 3T09A 1HRI2 1NK4A 1HBNA 4M00A 4Y2IA 3I3MA 5DG1A 2AQ4A 1A9NB 2HJIA 1X7VA 4Y1YA 1H8TC 2QDNA 1RUF3 2TUNA 3NGTA 3QRRA 1VBC2 5ETRA 2X8KA 2R0HA 3O12A 4Q0BB 3MF9A 2LDYA 3K46A 3KMHA 3EZ5A 1RLCL 3HVTA 2OP5A 3QO9A 2MPUA 4L9BA 1XMQF 1DGRA 5F9NA 3ZYGA 1HNXF 2W68A 2QMUB 2BKNA 1RIRA 3SH4A 1W3XA 4COVA 1UY2A 4M4PA 3OY8B 3W58A 2XS2A 3OHAA 1O4ZA 3KJVB 1U1MA 1SH2A 3VDBA 3UDLA 4IG0B 3AP9A 4JGYA 2Y6GA 5CA5A 3FKBA 5LASA 3JBG1 3MLJA 3ENVA 1RTDA 5A7QA 3RB6A 4WYLA 2ET7A 2HS3A 4M5LA 2KU7A 3VZKA 3UVJA 2HQFA 2PN5A 2YBVA 4Z2AA 1B7YB 1ZBE1 2CPEA 4CEWA 4COWA 2WBMA 3A3NB 4NJ4A 1RTZA 2X29A 2GMLA 2LU2A 1WI6A 5ACA2 5AXKA 5I0DA 4OLPA 4J9KA 3OR1A 3D5OA 1V5IB 4F4WA 2XY5A 3B3QE 1SC4B 3AD8C 1D4M1 3OTDA 5FRAA 1IBLF 2HVEA 2CXEA 5EJZB 4L3NA 2VMEA 1NPRA 3IBMA 5C33A 4ZVUB 4Q8FA 1T3NA 3KLHB 2HFVA 2OVUA 1BC6A 4TYBA 3IWLA 2XY6A 1VBKA 5BYRA 2XMVA 4DR2F 4FOWA 3WQ0A 4ZZ5A 4QMAA 1FWLA 2PDAA 1VBD3 5A33B 3IAQA 4J9RA 3ZSKA 5BNPA 3INAA 3N9MA 5T14A 2DYCA 1LOCA 3IBWA 3VD5A 3M3OA 1ZPVA 4PCQA 3AXKA 3WW3A 3M8RA 4Y34A 4QW9A 4LF8J 1D7PM 2JEFA 2SLIA 2BR0A 4C8DA 4DI6A 2Y1LB 5AXLA 4YG3A 2UUWA 5C24A 4LMFA 3J80U 1KFXL 1W6PA 1R7IA 4JZRA 3L3CA 4M5KA 2X05A 2WW8A 4CTEA 5IVJA 2AJFE 3BH6B 3SEOA 1K0VA 4CEYA 2V8PA 3R5GA 3ZXLA 2HKXA 4NLQA 3I56S 2RJLA 2RRAA 2D5HA 3ZIXA 2IRUA 2I2YA 3PHMA 2GIRA 3HKWA 2PYTA 3HF5A 1TAUA 3SDEB 3SCGA 3QGHA 2PI5A 2GVZA 2IDLA 3TN91 1VLYA 4KAIA 2CYYA 4RGKA 4LEJA 3IIAA 1TKXA 1W05A 1BVP1 1HBOA 3M2MA 4RNHA 5H9EJ 4IG0A 3MPBA 1CGPA 2M52A 1FT9A 3W59A 5D0RA 4CO1A 1SH3A 4M94A 1Y7BA 2MMYA 1D4VB 4LRCA 4KG0A 3W3SA 2WQ8A 4GMKA 2P6TA 2GV1A 2KVQE 2APOA 4URTA 4CA9A 1HXS1 1OA2A 2ZX4A 3DECA 2W24A 2Y6FA 3H9AA 2ZPXA 1YJNS 3OYWA 2KR2A 3MO4A 4N41A 4PF5A 2WYSA 1BEV1 3E8OA 5GZEA 4O44B 1YJLA 2J9DA 5D0HA 3J81j 2DNRA 1C4RA 4FYYB 1AR73 3AZWA 2QBXA 5LA1A 5L19A 2BJ3A 2PAKA 1RAIB 3S5QA 5IK4A 5D8AB 2BANB 3RJRA 1ELOA 2B7BB 5JJBA 2XONA 5ISLA 3MECA 4ELTA 2RE9A 2RE1A 4HONA 1AXZA 1RA6A 1JNRB 1WBLA 3UN3A 1LOFC 1W2UA 2G2ZA 4B9SA 3OJUA 3POWA 4LT6A 2ZHAA 2MZSA 2YHJA 2VA3A 3RZGA 2QL9B 3WQBA 1S0VA 2ZZQA 3SFUA 4A8QA 4F8AA 1US3A 3GONA 3OTFA 4I2PA 3L7PA 4LR4A 4C2MA 3J7YI 3T0AA 1JWWA 2VFRA 1KQRA 4JVAA 3PV8A 1HHTP 1PO6A 2DRDA 3JTPA 3PY8A 1U4BA 2JEGA 3SCFA 2XUEA 4ZJLA 1UIJA 2YPZA 4JV2A 5C5JA 3UD3P 2V5HG 3NKYA 1T6BX 2NUHA 8RUCA 2NYYA 2IYGA 1DQ2A 4EZ9A 4WKYA 2N4CA 5F5CA 3W65A 3W8PA 4PR6A 3ONQA 4A7ZA 1VMFA 3K3NA 2QQMA 2WVDA 4CLFA 5JR2A 4ZS6A 1MZFA 5T5LA 3RZZA 3MZIA 1GXUA 3ECQA 1WTFA 1L3TA 2ZXQA 4IE6A 2CQHA 1YBAA 1OI6A 4FCAA 2WO7A 1U0SA 4OQ8A 4O4RA 2L9DA 5FZDA 5FTTC 5GZDA 1YQ8A 3CZUA 2OUHA 2R49A 1N33F 3AQOA 2GMPA 3TARA 5L7OB 1XR7A 2R2SA 3LP1A 2E5LJ 2VD7A 2KXFA 2GC8A 2ILYA 5A1LA 4N7IA 4CPBD 2RUGA 4MT1A 4I3GA 4R8UA 4D8MA 5DO2A 4K59A 1CS4B 3IA0A 1O6XA 4LF7J 3EGZA 4NIIA 3W2WB 3ETQA 2EXKA 2BA9A 4MADA 1U6BA 3FHQA 3A1YG 5EDWA 4QKNA 3DYOA 4IQXA 1TME1 1QJY1 3QAEA 4I6AA 3NWKA 4NEZA 4QR0A 1C1CB 1AYN3 3W9JA 1S97A 1FPN2 3W9IA 3C19A 2HBRB 3KG4A 4R5PA 1DQ6A 2WVFA 1V00A 3OL8A 4JI8J 2JLGA 1N1TA 2WIIB 2FGCA 4LORA 3OJBA 3M8LA 1BEV2 2UY9A 2O5DA 2XOMA 4DN0A 3CJ4A 4NI2B 4Y2MA 3VBOA 3HULA 1NCLA 2ERRA 1WHWA 1NMEB 5KFJA 4MGZE 4DS0A 2YY3A 4WM7A 2CAUA 3BGLA 3BSNA 2GCFA 4HDHA 4K8RA 4LKDA 3VBRA 1GK8A 2RS13 3D3CJ 2W4PA 1RT6B 1DLCA 4Q4X2 2XI3A 1KFSA 4BK5A 4IE5A 2BE2A 1HBMA 4LLOA 3GZAA 5HCAA 2VQAA 4RQPB 4HHJA 3J7A1 4Y28C 4P9LA 2JVRA 4RBVA 4DPTA 1COV1 2VCAA 2SBAA 3J81Y 2MQPA 2QT7A 1JZ3A 2WR9A 2AT1B 1XNQF 2ZM6J 5DQIA 2C2RA 1JLCA 2XUMA 1Y3KA 3V4IA 2VPVA 1ULCA 1VQ7S 2QX0A 2R061 3ZKYA 4M63A 2CAVA 5KFQA 3FWEA 1HNWJ 2FVQA 2DYAA 4AXOA 5BY5A 5HCFA 1S57A 1H9WA 4CDWC 3MICA 3AOBA 2MEV1 3N9LA 1U5YA 2FDKA 2ZX0A 5FYVA 2R30A 2WAAA 1SFNA 1HKAA 4TU7A 4QM8A 4XPVA 2X1AA 4A4AA 2BRKA 2ZC4A 5EN1A 2U2FA 5J2NA 3EVMA 4IG3B 2J0XA 1ZAVA 3LP1B 1TFWA 4MKBA 1IQAA 4FFFA 3VUOA 4JGZA 2J8AA 2XO7A 2ZGUA 4QXKA 1OQDA 4Y20B 1O7FA 3CTRA 4XMAA 4DQAA 2F40A 4G65A 4XQWA 4O0IA 5KFHA 4J9QA 3CDBA 4HHHA 3AKTA 3MCMA 5E33A 2HLTA 3LSDA 1GU3A 4K4UA 1SC3B 4LSZB 4WK1A 3UKNA 1GKBA 1B99A 3TJAA 1OKOA 1MG7A 4QU1A 4PBPA 4XJWA 1LHVA 1UD1A 3CB4A 1Q8QA 4DX6A 1GMMA 4IFYB 4XHBA 3DOMB 1N54B 3KG1A 1JOJA 2YWKA 1TMF3 1A3KA 4OHZA 1EB0A 1HPZA 4A4JA 3K58A 2ERFA 2WNVB 2N4DA 3PYFA 4NRTA 3SQOP 2GAUA 4V1PA 5DDPC 4QWNA 3T3FA 4NXMF 3DXSX 2WA3A 2V4VA 2NXUA 2V69A 3CJRA 3FDSA 3P3NA 1RWWB 1R0AB 1JYNA 1PGZA 4JKMA 3LUYA 5DDJ3 4B17A 4B9TA 5FK7A 4LK7A 4Q29A 4XHXA 3PMEA 3P5TL 4LFAF 2ZHLA 3ZSMA 5A3PA 2BE2B 1QNWA 3BQ0A 3FVYA 5C2CA 1VRH3 1ACMB 2R7VA 5KFGA 1QH6A 2IFWA 1VAVA 3VKNA 2M8HA 4YVWC 3HLUA 2N3OA 1XNRJ 2IXHA 1BBT2 1DP0A 3WINE 4D94A 4DV2F 4IV3B 1M0SA 2XGQA 1W6NA 4Y1XA 2VICA 2IRXA 1JLAA 1D3WA 3NL0A 2DTWA 2CQGA 2CQ4A 1E57A 2JKXA 3LPGA 1SFPA 5FMDA 3BN7A 4CH7A 2B56A 4PJYA 5BYNA 1IS5A 2QEXS 3WQPA 3BH7B 2OX0A 1MQTC 2J1UA 2JKBA 5EWGA 5M2PA 2RQCA 1DZTA 1NXD1 1HRV2 1DARA 4E98A 1BVVA 3O1OA 1POV3 2P3JA 2DGOA 5HMXA 2RDSA 1V9U3 3JD72 2R7QA 5J2NB 1KSPA 4NLRA 4IG3A 1VQ8S 3AKPA 2G0IA 4USKA 2LXFA 4LO7A 4ASMB 3Q8CA 1CAUB 3DV8A 3AJ1A 4I67A 3HNBM 1ENSA 1HBNB 2KFYA 1UU6A 4LBMA 1UQXA 3RZHA 4Q5OA 2WUHA 2XXZA 1VFJA 3NJXA 2GFFA 3CO0P 1EUUA 4X66F 2B4OA 4XYXA 4AE5A 4M5HA 3M3QA 2QLJB 3OR2B 3IBFB 1I51B 3Q8YA 1NAQA 1WW5A 1D1UA 2EXUA 1YYNA 4CLUA 3DDNA 3E01B 4BU2A 1VJQA 5IQQA 1GQPA 2AGPA 1X9PA 2BTVC 4QGLA 2VQEF 3RRHA 3AXDA 4DR5J 4IFYA 3FFIB 3K5MA 2E32A 3ZFFA 4E8DA 4AGRA 1HPZB 3U1LA 5DDOC 4HLTA 2JG9B 3HFKA 2A6ZA 2CQIA 3A8EA 4EN9B 2I8EA 2R043 1O8PA 3VWSA 3QJLA 4LPLA 1PMHX 4MGIE 1YIFA 2D3SA 1UETA 2E31A 3K8WA 2DNKA 1XSRA 3QGPA 5DG2A 2E1MC 5LMUF 3IO1A 1QQP3 3O1MA 4PLMA 3IIIA 1F9FA 3SKJE 4Y2KA 1ZRDA 4LR9A 2CJYB 1R083 3KVAA 1L7QA 4P9YA 2V68A 2WYFA 4XFBA 4CE8A 2DY1A 4KGGA 2GJFA 3LP2B 1LOUA 3D6HB 4M5IA 1XR6A 3HDSA 4H54A 2KO1A 2MYFA 4XVHA 3VBHC 1V9OA 1VBC1 5LCWL 3HN3A 3M6WA 4OZJA 1W8NA 2H4YB 4A8OA 1CONA 4KU8A 1MZEA 1OC1A 2LEPA 5HCBA 4C6AA 4DXTA 3UCUP 3J7AN 2DU1A 4TXSA 1JK9B 4JAAA 1NOVA 3WF4A 1G7YA 2VJUA 1M4WA 4ILLA 4KGKA 2VUDA 4JI3J 5CA6A 1FMD3 2JDHA 3T9NA 4PI0A 2QA4G 3MAHA 2R8GA 3O8WA 4CUAA 2IC1A 1XU2A 1CSJA 1YLLA 3T1HJ 4C8ZA 3NSTA 3LAKA 5FPXA 2R42A 4N90A 4RR3C 1CIYA 2J1TA 3GR1A 3BODA 3RG0A 4CEYB 1YRXA 5EX0A 1PZ9A 4O61A 3MGUA 1WMFA 3MUVP 5ABJB 4DR3F 2F9DA 3M2RA 2ARXA 2V9KA 5FYIA 4CEWC 3KLIB 2WS93 2RG4A 1U6ZA 1FHTA 2EVXA 3HJFA 1R081 2DVFA 4OJGA 2RMU1 1Q86T 2GZWA 4IOCQ 2GAHC 3UGFA 1E5RA 1OHFA 3A13A 4LHNA 5KHGA 3AD9C 4JV5F 3FMGA 5B0AA 3TRGA 2QG9B 2WBKA 4J1WA 4Y26A 3BREA 1Q8IA 1REVB 1UX7A 2LXIA 2EAAA 1YKWA 4HVQA 4Q4Y2 3A0NA 1HQLA 4DXRA 2FYXA 3RQ0A 4QU2A 5J36A 3W7BA 2RH3A 4OUMA 1NSAA 1QJFA 4XO0A 2MZJA 5HANA 1CR7A 1Z7S3 2ZDPA 2ZH5A 2AGQA 5FMOS 5BNNA 3CXCR 1AR72 3FMBA 1FRKA 2F17A 2FMDA 1SQGA 4HI1A 1VAMA 1UMIA 4BWJA 2V4QA 4IFVB 5L7OC 3B5LB 2BM0A 3AZYA 1UZHA 3IT8A 1XIQA 1PK6C 2C1EB 1QXJA 2VOXA 1C1BA 5DUVA 1NB7A 4NYZA 2CG4A 1Q0NA 1NXIA 2FPHX 1HNVA 5HN0A 1Z7S2 3SLIA 1EJ7L 1T0TV 3QT8A 3KD4A 1W6MA 4GKKF 2JFDA 3DDIA 4LF7F 3NBPA 4OHXA 2KRRA 4MG2A 3LP2A 2BANA 4FXKB 1XE0A 5C25B 5FZ3A 2DNQA 2UV8G 1S6QB 5GAHI 2FLOA 1S77D 1DGLA 2B4VA 4CU8A 4LUMA 2ZUAA 4YDXA 1C0UA 3CU7A 3SH3A 2CQ1A 5L46A 2PQQA 2D6NA 1PK6A 2YKAA 5C9AC 4Z92B 2K3KA 5IV4A 4NLWA 3V0BB 3IMNA 5HMWA 3C14B 5GAEI 1TNRA 5HQ8A 2QFEA 2ZEYA 1HRI1 2AW0A 1TME2 3DU5A 4U67Q 3EO6A 5C5UA 2KFNA 4CO0A 1TAQA 3VR1A 4DV6F 1IKVA 3VBUC 1KQGB 4EN8B 2MY7A 1TFYA 4MGSA 2B45X 4XXPA 4KFBA 2B5JB 3POTB 2C9KA 1JZ7A 3NV3A 4RPFA 4Z2XA 2WSEC 3TAPA 4AEMA 2BPA2 2XYGB 2ASDA 2VNGA 2UURA 1NEEA 3N5FA 4P10A 3DDKA 4XCAA 1VC5A 1RUI2 1RXGA 2HEVF 3MIDA 2UUTA 4JC1A 3HD1A 2UUBF 1VBD2 1JLFB 2AC1A 1WJ9A 3WNKA 4XDDA 1RUG3 1LW2B 1C5HA 2IMWP 2VBWA 5AFEA 5K20B 5IT9U 2X1FA 1QAIA 1AR91 4R8UB 2BJDA 4I68A 1WC0A 3O7OA 3EQEA 4JCKA 4P72A 4A8SA 3RFRA 3CD0A 3MM6B 5CKNA 4IH7A 4IH6A 2F5GA 2RR12 2Q79A 3PZPA 5A3UA 3T9ZA 2HWF3 4A8KA 2H51B 2V73A 2XMAA 1CPMA 4B3SF 5ETNA 5KFMA 4ZS3A 2DHGA 4WIIA 1D8ZA 3T1MA 2ZX2A 4ZVGA 1QKQA 1C8M3 1FX4A 3HSJA 2C5DA 1DHMA 4B1LA 1ZAWA 3EXCX 1HB2A 2VFSA 1W6MB 3F95A 1AJKA 2XHCA 3H59A 3IC1A 4QWBA 3NJVA 4F83A 5LZ6A 2Z0GA 4B02A 4U36A 4CRJA 1SLBA 4EO6A 5GMKa 5C25A 1ASJ1 1IUJA 3M32A 3TAMB 2YWGA 2YNFA 3MMCB 1S6QA 3RMYA 4HACA 3VAKA 4X4OA 1LECA 3AKSA 3NV2A 4LBQB 2JH3A 2DNGA 3OEAA 3IR5B 1KGYA 2ABYA 2B0GA 1ND3C 4DINB 3QWPA 3ZZUA 1W26A 4ECXA 2RRBA 4FOYA 4DSFA 1RT6A 1JZ2A 1JTZX 1S0GA 3J7LA 4QDQA 3TWZA 4GQ7A 2V67A 4PQQA 1R8HA 2CL2A 4TLFA 4CZSA 2VBDA 1YITS 4DPNA 1X36A 2HQGA 3HHLB 2Y6LA 4OCTA 4UOCA 4AEDC 4DL3A 3KLGB 4RGAA 2Y1IA 1N36J 4Q4V3 1ZM9A 1QE1A 5B08A 1YBUA 3CUNA 1MWQA 5C7GA 3DLJA 5FWJA 2ORXA 2WDBA 3HPNA 1R0BG 4AD6A 3DFEA 2A18A 3V4IB 1JOBA 3NAPC 4YARA 1XEZA 4O7XA 4N53A 1FE0A 4K0KF 5LOQA 1QVFR 2WKKA 3URFA 3W9AA 1F2HA 4FFIA 2UVUA 4BDPA 4J37A 3WP3A 4TSVA 3IN9A 3BUCA 3RRKA 1DTTB 2VG6B 3TP2A 5KFDA 1WMXA 5F9LA 4CCHA 1WW7A 2ZACA 3DXUA 2G2YA 3ZFEA 1H8TA 3O3LA 2QTWB 1CG2A 1S0JA 1RJ7A 2CPHA 4X66J 2IA6A 3ZR5A 5I8TA 4I69A 3AMPA 5J2PB 5EPAA 4ATFA 2HQDA 1HFEL 4XF4A 4L2NA 3OGJA 4LVNP 4CT8A 3BGAA 3UN5A 3BYPA 2Q43A 3EE3A 3W8GA 1UCNA 3RYRA 3RI9A 1F31A 4UFJA 2Q6BA 4DX5A 1H1IA 3IB3A 4MIBA 4ED0A 3V56A 4F2RA 3VBHA 4USJC 2AEJA 3RYPA 1X4EA 2VAUA 3FGVA 4CT9A 4F67A 3I82A 1JLEA 2V6AA 5L39A 3H25A 2E26A 3RAQA 2AYBA 5IT4A 2AJQA 5F8PA 5LA9A 3HHLC 1J5OA 4MK7A 1YCIA 3C46A 5FXXA 2AACA 1XMQJ 4LBIA 1TL5A 2CNNB 5EV7A 4N77A 2CPYA 4HPKA 1CJPA 2JEMA 1C8M1 5GADI 4L75A 5F9TA 1UWWA 5C4WB 2VG7A 4Y33A 4YZ1A 4EFAC 2RS11 1S48A 4CDWA 4QBUA 1RWUA 4ZCMA 4ZMMA 5EWFA 3E5QA 2RS53 1S49A 4P71A 3UW1A 5F6LB 3MEDB 2GN7A 3Q9OA 3VKLA 3KKFA 2QZ2A 2C26A 4ZPAA 5SV5A 2CJQA 3CSKA 2I2SA 2MJNA 2XLGA 4K3UA 4Y2CA 5T7LB 2ZGMA 3F56A 2D9OA 3CMES 3VALA 5LT5A 3DRSB 5FZAA 4B08A 3JSBA 4JI3F 1M5HA 2A5ZA 2LXUA 1S4FA 5IC6B 1SKWA 2RS52 5F3IA 3MOZA 2HFOA 2ES3A 5KR7A 5HVGA 2W7AA 4BQ3A 4KGXB 4DCOB 4W8JA 2DVBA 4HEA9 3D66A 4C8NA 4UQTA 4RKUC 2VUGA 2VTXA 3HSDA 3TUJC 3ZZYA 2A71A 1NUEA 4H4OA 4QWAA 3QLHA 4I02A 2CUYA 3MWBA 1TZ0A 2O01C 3UT0A 4HETA 1H74A 3LP0A 2K9ZA 3I3DA 2RILA 5F8LA 5KFFA 5KG1A 4X4NA 1IVZA 3BVCA 2RMLA 3H2LA 3QPIA 3GCWA 1LTEA 1YDLA 3C15A 1IPSA 4JUZA 1IM6A 2HNZB 1OOPC 4YR2A 4ZU4A 2BJ9A 2ZBQA 3H1YA 4AL5A 4C3KA 4JV5J 3LZZA 3VKFC 4NASA 4N43B 4WYWA 1HV0A 5JXJA 2Z57B 3CCTA 2VR4A 2WNVC 1OH3A 4BCAA 1VR3A 1AX2A 1IBKJ 3CF6E 4QQBA 3G8SA 3LOIA 1MVEA 3OJSA 2BQ3A 4LQ3A 4DX7A 1VRUB 4HT7A 4KI5M 4G1PA 4LF1A 4YZ3A 1PO13 3KZ4C 4H4MA 5FZLA 3MI7X 3L7OA 3WXPA 1ZBA1 1WC1A 1QGLA 5DXDA 1ZM4A