3THPA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
333
structure length
304
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVRRVKHFGYKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASEKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylated DNA repair protein alkB homolog 8
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 57
structure length 304
sequence length 333
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thpA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thpA01
1L3KA 2YH0A 2N7CA 4ED5A 2CPYA 3SDEB 2MPUA 1D9AA 4WF9Q 2MZRA 3Q2TC 3BS9A 2VOPA 1H2VZ 1NJIT 3S6EA 1YI2S 3MUVP 4OZ1A 2J76E 2MQPA 3P49B 2XB2D 1YTYA 2MGZA 4W92B 3R27A 2HVZA 2G1DA 2LKZA 3U1LA 3MD3A 3VAKA 4WFAQ 2MQMA 1D8ZA 1X5SA 2WBRA 2DGTA 1P27B 5GAEU 3PIPQ 2MB0B 4M5DB 1OIAA 5LJ5Y 1UW4A 3DLLQ 2MKKA 1AUDA 3J7ZT 1YJ9S 1WEZA 1OPIA 2RU3A 1R8PA 1VC0A 3G71S 2OSRA 2J0SD 1H6KX 2M4MA 1UFWA 3ULHA 2DHAA 3US5A 1X4EA 2DITA 3PIOQ 1Q86T 1U1RA 2KM8C 1WELA 2KVIA 2AYEA 2DH7A 3LPYA 3UCUP 1JJ2R 1U6FA 2DNGA 1YJWS 1X0FA 1JJHA 2MQOA 3CCUS 1VQ7S 1XN9A 1SJFA 1M90T 2U1AA 4IOAQ 2FY1A 4EGLA 3CC7S 2RRBA 2CQPA 4CIOA 3EX7B 2RVJA 1N52B 4QU7A 2I38A 3DXBA 3MI7X 2KM8B 3THTA 2M88A 2K8GA 2ZJRQ 1SJRA 2I2YA 2LEBA 3UWTA 3UCZP 2E44A 3UE2A 1WHYA 2E5JA 3HHNB 2AYMA 1U1QA 1WTBA 1URNA 2QA4S 5DDPC 3NNCA 1WG4A 2CQIA 1VC6A 5DDQC 1X4HA 2AD9A 5CXTA 1NO8A 1KQSR 3BO4A 2RRAA 4IO9Q 1X4FA 2MJNA 1X5PA 2DNZA 1X4CA 5GAGU 3P6YC 4YB1P 2MKCA 2O3DA 1CVJA 3MUTP 2DGQA 2LA6A 4RU2A 2KG1A 3CCSS 2DGXA 2FHOB 1U2FA 2CQ3A 2M70A 2DNHA 2DNPA 3CUNA 4LIRA 5IM0B 2K3KA 2CPIA 2RQCA 3MOJB 1U1OA 2L9WA 2JX2A 4IUFA 4LJMA 4WFBQ 2MZSA 2CPFA 3G96A 2MSTA 4PR6A 3NNHA 2X1AA 1QVFR 2YTCA 1VQOS 1KC8T 2DNYA 3THPA 2DHSA 2ZJQQ 1VQ6S 5IFMA 3UD4P 3LQVA 3H2UB 2KFYA 2BZ2A 3U1MA 5GADU 2M7SA 1M5PC 2MZJA 2YWKA 4TU7A 2NLWA 1ZH5A 4C4WA 4TLQA 1KOHA 1DRZA 2MQQA 3MURP 3FEYB 1QVGR 2Q79A 3L3CA 3G8TA 2KYXA 2DK2A 1X5OA 1NU4A 1PO6A 1VBYA 2KRBA 1Q81T 2HYIB 3CMES 2KXHA 2VOOA 3EGZA 1KD1T 1U1LA 1N88A 2N3LA 1FT8A 1Q7YT 1M1KT 1FO1A 2LXUA 5LSLA 2XNRA 2D9PA 3R1HA 4BS2A 2DNQA 1M5VC 2QEXS 2RQ4A 4WFNQ 3RW7A 3B4MA 5HL7Q 2KH9A 4PKDB 2MXYA 1G2EA 1K73T 1WI8A 1X4GA 1W2BR 1U1PA 3VAGA 1X4BA 3CC2S 1PGZA 2M52A 4UQTA 3CXCR 2OTJS 2MKSA 2RS8A 2OSQA 2DHXA 4U67Q 3CD6S 1M5OC 2KN4A 5IM0A 3VAJA 3VAHA 1VQPS 5DDRC 2CPXA 2HGNA 2LQ5A 1R8HA 2KI2A 3UCGA 1WF0A 4QPTA 2DNNA 1VQ4S 3NS5A 4A8XA 3MD1A 2MY8A 3NNAA 2AYBA 2BOPA 2KXNB 2XS7A 4QQBA 3P5TL 3SXLA 3MUMP 1U1KA 1ZZFA 1A9NB 1VBZA 5EN1A 1N54B 2DGSA 1SJ4P 4Y0FA 4ERDA 4IOCQ 3CCMS 1U6BA 5LSOA 4ZKAA 1FJEB 2KHCA 3SDEA 1FJCA 2DGWA 1H2UX 3P3DA 2N82B 3CF5Q 2M0GB 2D9OA 2MZTA 1DBDA 3SMZA 2EVZA 3V4MA 1WG5A 2ADCA 4F26A 2DO0A 4OZ0A 4YUDA 3MXHP 1O0PA 2LA4A 4LMZA 3MDFA 1DHMA 2MKIA 2LMIA 5IQQA 2M9KA 2CQHA 2GO9A 2LEAA 3CULA 3CCLS 4WCEQ 1WF2A 5H1SV 2CQDA 5LXYA 1VQNS 1VQ8S 5DETA 2A3JA 1OWXA 1KOOA 2OTLS 1BY9A 1HL6A 2DISA 4Y00A 4CH0S 2DIVA 3H2VE 3ZZYA 1M5KC 2CQBA 2JWNA 2DO4A 2LCWA 2X1GA 5DM6Q 1SXLA 2AYGA 1YWXA 3TO8A 2G0CA 1FHTA 3D2WA 3UD3P 3VALA 3CMAS 2X1BA 3VAFA 2PE8A 1VC5A 5BJRA 2CQCA 3S7RA 2JVOA 4F02A 2F9DA 2FC9A 2M2BA 1SJQA 1ZZNA 2MKHA 2MY7A 1FXLA 2E5HA 1F9FA 2DGOA 2MKJA 3CCVS 2G4BA 2KXFA 3VF0B 2J8AA 1X4AA 5GMKa 4FXVA 2CPJA 3ZZZA 4CQ1A 3S8SA 3J7YU 1FJ7A 2HGMA 3Q2SC 1WI6A 3G9CA 1U1MA 2UP1A 4CH1A 2DGUA 1S72S 2DB1A 4FXWA 2SXLA 3TYTA 3CCRS 3G6ES 1DZ5A 2V94A 1WHVA 2YH1A 2LXIA 1Q82T 4V19X 1X4DA 1WEXA 2GHPA 3JB9k 3EGNA 3BO3A 2CPEA 2L08A 2DNKA 2MHNA 1VQMS 2DNLA 4J5OA 5LXRA 3CCES 2M8HA 2EK6A 1P1TA 2XS2A 2JVRA 1FNXH 4Z2XA 2XSFA 1VQ5S 2M8DB 2F3JA 1VQ9S 5JVHQ 5DM7Q 2EK1A 2MJUA 2VODA 1WHXA 2CQ0A 3N9UC 5FJ4A 2D3OR 1WEYA 5CA5A 2DGVA 3CCQS 1SJ3P 1K9MT 3S01A 1YHQS 1YIJS 2DNMA 2CQ2A 2QFJA 2HGLA 3NS6A 2ADBA 5GVQA 2OIHA 2CQGA 2L41A 3BEGB 2XS5A 2XNQA 2KRRA 4UY8T 2DH9A 3RW6A 2B0GA 2RS2A 1VQLS 4F25A 3VAIA 3FEXB 4P6QA 5CYJA 1UAWA 2CPZA 2DHGA 3OW2R 2MZQA 2RT3A 2YKAA 2JRSA 2MQLA 1B7FA 4W90B 2MMYA 2PEHA 1H2TZ 2LYVA 2E5IA 4TU8A 2CPDA 2MZ1A 2J0QD 3IRWP 1UP1A 2ERRA 5JVGQ 3TP2A 3I56S 2MGZB 1WF1A 2RNEA 1N8RT 2HZCA 4QU6A 2CQ1A 2DNRA 2N3OA 4TU9A 2VONA 3K0JA 3VAMA 2FC8A 2OJ3A 2U2FA 1JMTA 3G8SA 2MQNA 1S79A 2KU7A 3CTRA 1JJ4A 1HD1A 1RK8A 3CC4S 3HI9A 4WKRA 2F9JA 5ITHA 3IWNC 1YITS 5GAHU 3NMRA 4PRFA 2LECA 1A7GE 5DDOC 2DH8A 1HA1A 1IQTA 1WG1A 2E5GA 2DNOA 4YOEA 3R1LA 3B4DA 1X5TA 1YJNS 2CJKA 4C0OC 2KT5A 3CPWR 2MSSA 4C7QA 2DIUA 5LJ3Y 3G4SS 3BO2A 4WIIA 1K8AT 1WHWA 1RKJA 1VQKS 1HD0A 2CQ4A 1QM9A 5D78A 1U1NA 2RUGA 1VBXA 5D77A 2MYFA 2FPHX 2ZJPQ 2KG0A 1OO0B 5MLCV 3CCJS 3I55S 5HO4A 2CPHA 1WWHA 2NZ4A 2X1FA
chains in the Genus database with same CATH superfamily
3RZGA 4HR2A 2EBEA 2XBPA 1ASJ2 3E2EA 3MCOA 2MZRA 2R071 2DCJA 2UVUA 5AJ3J 1QDOA 4DV7J 2J8SA 2YPYA 3MO4A 3C14B 3CJ8A 1TQLA 3D0HE 4CU8A 1AR62 1HXS1 1U0HA 3N6MA 3UN5A 1X5SA 3VGVA 1EYBA 1L7RA 4UFHA 4XDOA 4IV1B 2WL1A 1ZBE1 4M5IA 2VBYA 4CP9A 4E8CA 4ARYA 3DHWC 1K0TA 2PQQA 4RNNA 1YZ6A 1H6KX 3FK4A 1R0BG 4BB3A 1WC1A 2BE2A 1XC6A 2EFPA 4DF8A 4BQ3A 4DV6J 4UF0B 1COV3 4KAIA 3SQGB 1QE1B 2VFRA 1VR3A 5FO9B 1U12A 5G0RB 4KKOB 1RAGB 2WVDA 3EX7B 1K45A 4QU7A 4ORFA 1SBDA 5FUPA 5JI7A 2K8GA 2N4DA 3BM7A 4Q4W3 4Z1VA 1HJFA 2V8GA 2G0IA 3DOLB 3IGVA 4YNIA 5DG8A 3CL1A 3GIKA 3RUBL 1N36J 1RABB 1N47A 4ANDA 1CR7A 4EWAA 2G13A 3BV8A 2ZPXA 4FDFA 3SCLE 4IKAA 4WM7C 6FDRA 1WW7A 2CDQA 3P6YC 2BVVA 1HNVB 1W7WA 1LFWA 4B3TJ 5ETMA 1R083 3LGHA 2Z56B 3ZM8A 4PLOA 4PEOA 4CCNA 1PIEA 1RUC2 4YGCA 3ICLA 2GJIA 4F4KA 2XWBB 1OA3A 3T6JA 1URRA 1HX6A 3OPZA 3RG0A 3PX4A 2LROA 4TYBA 3H5UA 1S1TA 4WVMB 3BR9A 4U7UK 4EWDA 3N9OA 4LE3A 3FGVA 3HFZB 2PXJA 1W9SA 2WFPA 4A7KA 4OX6A 3PG9A 1VISA 1W26A 2MZJA 1LULA 4BMBA 2B43A 4IW3A 2YC2A 4QWNA 4CUAA 2ZBIA 1GQEA 3R6SA 3GV7B 4RBTA 1EHWA 1GMVA 3VKFC 4DV3F 3L3CA 2VW1A 1BYHA 3CJKB 1Q81T 3KM5A 4QPXA 2O8QA 4AFCA 3PU8A 2WR9A 4LE4A 1UMIA 4LF1A 4YPJA 1LOAA 3WW1A 1BLZA 2FMYA 5CVRA 2O01C 5HL7Q 2HWD2 1HNXF 4JP8A 5FUNA 2QT7A 4YVSA 2V8PA 2C2EA 1PJ7A 3TW0A 1N5YB 5D3GB 2DHXA 3AYAA 5A3LA 3B6BA 1GZCA 3OFEA 4N5SA 3KMHA 1RAFB 1RGSA 1WGPA 3T08A 3C7FA 2QV6A 3UVJA 2KR2A 3HP6A 1DF0A 5CYMB 1UZZA 2PC6A 4EYHB 1TFYA 4DZ6A 3SXLA 1U1KA 2V2VA 2EAAA 2YU1A 3O1PA 1H74A 1QUVA 1XE0A 3EMRA 1PGSA 2WN3A 3Q9OA 3KXDA 2AMCB 3R6GB 2W95A 1S2KA 1DZQA 4LO8A 3D5OA 5CA6A 1JZ5A 2AEJA 1NCRB 1H2UX 5FY1A 5I3QA 1FJGJ 2GALA 3TN91 3QT8A 3PR4A 2VZRA 3ZYBA 3W2WA 1Z4UA 1X33A 3KK2B 1VGYA 3I9ZA 3V4MA 5J2NA 3B9IA 2ADCA 2UUWA 3MDFA 4L8QA 1RHI3 2JE8A 4CLKA 3ZYGA 3DM2A 4W98A 1K5MB 3DPRB 3NGDA 1CPNA 4Q4Y2 5IC6B 4Z7CA 1GOFA 5GLTA 1H4HA 4ETZA 2CQDA 4ED0A 1G9CA 3E01B 2W01A 3LF0A 5DETA 3NGTA 1PILA 4IEXA 3VKNA 1IPSA 4C8ZA 2ZWPA 4A6SA 2JWNA 4AL5A 3TUPA 4NLPA 3TB0A 2VB6A 4I6WA 2QN6B 1KKHA 2XI3A 1SL0A 3GJTB 4PIYA 1AR63 3W63A 4IG3B 3D67A 4KY3A 4M5NA 1FD2A 2A0FB 2BRLA 2WZR1 2MKHA 2FJBB 3NBPA 4HI2A 4ECUA 2VBWA 3MTKA 2EIDA 2J8AA 1U5ZA 2PD1A 1F60B 4FPJA 3ZFFC 1KDMA 1GU3A 3JD72 2F63A 3H8RA 1RMU2 2VAUA 3MFAA 1S7HA 2FYXA 3QJPA 4I4BA 5C8CB 1S49A 2DURA 4NHXA 3DLGB 3INAA 5CG9A 5ETTA 2V94A 1WHVA 5JJBA 4QKDA 4V19X 5L73A 4DUYJ 5KAKA 4IE0A 4JKKA 2WVCA 3KJVA 1XMOF 4Q0BB 1OOPA 4HKQA 2G1HA 2YKMA 4OL8A 1RXGA 3L9ZA 4CDWA 4PJYA 2A1XA 1Y4ZB 1VQYA 4JHTA 5HROA 4KNCA 1KHWA 2J22A 2AJ4A 2D3OR 1EAH1 4AT1B 1NK8A 4UFIA 4RW9A 2AYHA 1HFEL 2HHSA 1KVJA 1LV5A 2Q43A 1YI9A 4E0DA 1OSGA 4JI6J 3BEGB 1H1AA 3R7BB 3ZYPA 2UWCA 3UI3A 1KDKA 3HN1A 1GXTA 2EVXA 4N43B 4AEKA 1LW0B 1UZ0A 1TUWA 1APSA 5T5OA 1B0TA 5JXIA 4ET7A 5JPMB 3AKRA 4FS1A 2DVFA 3RYKA 3FRZA 1JUIA 1S1XB 1C5IA 4OJ1A 5J36A 2DYAA 4DXSA 3HDSA 2ES3A 4QU6A 1NCQC 3BOWA 4FNIA 3HHEA 1HN1A 1XXNA 3D0JA 4TXWA 1FKAF 4X6QB 4AOCA 2DJWA 3QQCD 3KS7A 4CCOA 4B29A 4X4OA 3OFFA 4GJZA 3C7HA 3A13A 4Q4X2 1VBD2 4RW4A 3VBFB 3MPDA 3N35A 3S5AA 1GMWD 3A3NB 5DGBA 2BWCA 5D0HA 3WDOA 5I42B 2DH8A 3PEJA 4JDOA 4C0OC 1Z0HA 4C98A 1DTQB 1FE4A 2RJ2A 4Y5TA 5CU1A 2ORZA 1VQKS 4YFZA 2GQ2A 2Y6JA 3C6TA 1U1NA 2MHFA 2MLXA 3M6VA 3IN9A 3RZLA 2HWD3 2VR4A 2A6ZA 1POV0 4C91A 4DJBA 4B3SF 1L3SA 1SZBA 1XQIA 4OUMA 4HHHA 2I2SA 3CDAA 1R0AB 1QKQA 3AMPA 1TME1 5EX3A 1QLNA 2Q8DA 2VVEA 1WC5A 2NPFA 1WMFA 2W46A 3FSYA 2FVSA 3OD2A 4Q2LA 3R0RA 4HTJA 4KSEB 3KLSA 1TKXA 2A3WA 2XB2D 4NE9A 4Y24A 1AROP 3KGZA 4LF4F 3MD3A 3C8YA 2W5FA 2VKRA 3DN9A 1KDNA 1P27B 5F8IA 1ZETA 4M5DB 1V3RA 2HWE2 4KBIA 1CAUA 4PXDA 3GJAA 1BQMB 4AQ6A 1IS4A 4RS5C 1I6JA 2QQNA 5L19A 4HANA 2WRMA 4UFKA 3P5BA 2NZ9A 2B56A 4D3GA 3KKFA 3W66A 2XR4A 2PFDA 2WNVB 3OHAA 1O6UA 3LKJA 2VPWB 3OGGA 3HLUA 2D3ZA 1SB6A 5DZ7A 3PIOQ 4TNOA 5HXVA 4JAAA 1S12A 1V5VA 2AYEA 4Q4Y3 3DI6B 1H8TC 1ULRA 1YJWS 1MR5A 2V8VA 1HN0A 4PI2A 2U1AA 3JSBA 3T9NA 5I0UA 1TR0A 2HWB1 2QA4G 3OHBA 3VDDC 2WQ4A 4C8NA 2VTFA 3E1F1 1H30A 4OZJA 5KG5A 1MMNA 2WO2A 4CP1A 4JUZA 1UO9A 2OMLA 1WHYA 4JBCA 2HHTA 2BUKA 3BH7B 4C97A 3O5TB 3W59A 2BNOA 1WMDA 5FO7B 3EYPA 5CXTA 1I3OB 2JDYA 4NIHA 3G6XA 3T3YA 4ES1A 1LEDA 1WBFA 4UW5A 1TMMA 4YW4A 3M30A 3NCQA 3NGRA 4ZVGA 5FYZA 4YSFA 2DGQA 3CCSS 4ZHRA 3WF4A 4KPYA 3AOBA 1RMU3 1MZEA 1I9RA 1MS4A 1U6ZA 1EQ0A 4L74A 3W58A 3ZXLA 2DHHA 1X9TA 4Y28C 1RP5A 1GQHA 2D3PA 2OT7A 3VBRB 2FJXA 4DV5F 1YO8A 2HZVA 1TMF1 2CV6A 3SHRA 1ZBA1 2R8IA 4JI7F 3GILA 4R8UA 3A0NA 2NLWA 4DV0J 5T5LA 4YDXA 2IBOA 3CJ0A 1A78A 2JE9A 4H14A 1OLQA 3TYJA 3MLKA 1XSQA 4AHZA 1SQGA 2WLQA 5TSWA 4B7EA 1O8BA 1MWQA 4BOWA 3OTOF 5DO2A 3KOAA 3KNAA 2IY5B 2KXHA 1N34F 1FWPA 4TYSA 1P9QC 1EARA 2I74A 1LTEA 4XC9A 2Y9HA 2WQZC 3A8EA 1JUHA 1RUJ2 2RQ4A 3NLCA 4QWCA 2MHEA 3I5BA 4FXKB 4NLXA 1W6MB 3MV11 1TNFA 2ZD1B 3TWZA 4R0EA 4ZCIA 1CZSA 1RWMB 4MGTA 1UF2C 3NV4A 1REGX 2FCTA 4M5KA 4N7TA 3ISND 4IESA 1PBUA 1R64A 3AFGA 3MGUA 1F2GA 1HW5A 5FWEA 2KXNB 4B3OA 2W39A 4Q4X3 1ULEA 2LQ9A 1A9NB 1VBD3 1VLYA 1TEIA 1JHJA 5DQ0A 3H1YA 5LL6d 1IKWA 4U36A 1FX4A 4IV3B 4OQ8A 4AXJA 2YDEA 3LFMA 1PYOB 1ZZ7A 4K3UA 4I64A 1NEEA 4QR2A 3RZJA 1KR4A 5IVEA 4OX9J 2DTJA 9ATCB 4BIOA 1C0TA 3WF3A 2HEYF 1X8DA 2XHWA 4KGQA 5JSPA 2ZH2A 3RBDA 1XYNA 1WF2A 1QDCA 3RB0A 4IEQA 3U4SA 4OULA 2RJZA 1OJ4A 3BGUA 2GQQA 3TBDA 2DISA 2VOWA 3BN4A 3MHYA 3N28A 2DO4A 3FQLA 2AYGA 4NRQA 1X9SA 1AF9A 1IKXB 2BDPA 4A8KA 2OELA 1FHTA 1NKBA 1NT0A 2ZC4A 4NASA 1TVGA 1QHDA 2Y6GA 1XNDA 3F2ZA 3DRSA 4M95A 2PHTA 1QY7A 2M2BA 5F9NA 4DOUA 1ZZNA 2MY7A 3WEZA 3ZXAC 2GGPB 3I97A 4L3KA 5KFFA 4XHXA 4SLIA 2ZBCA 1HMVB 3VQTA 2AZ3A 2HVDA 4PLNA 1WMEA 3QLHB 5RUBA 4XDDA 1UOJA 3GFXA 4DFMA 1FJ7A 3N6NA 2FDJA 1F31A 1CS4A 1WI6A 5KXBA 2YUEA 3H25A 3V65A 2PN5A 3S7EA 2ACMA 5I0SA 2COLA 2Q6CA 4UUXA 3AQOA 2OQ6A 4NYZA 3R97A 2W25A 5FP9A 3QIPB 3HBKA 1JXLA 4DSFA 3BO3A 1TUGB 4FP3A 2FD2A 1XTZA 1Y11A 1UPPA 2DNLA 3BPSP 4GKKF 2E7AA 4BMEA 4TQSA 2ID4A 4NRTA 3R4UA 1U8WA 4DL7A 5KFLA 4BQYA 1BMV1 1VQ9S 1EZZB 4CI0B 3HBZA 5F8NA 1C4RA 4A3XA 2DGVA 1OT5A 1W6OB 3ZFVA 1YIJS 4RYDA 5EPAA 5HI0A 3PDNA 4KV8A 2W87A 2W1UA 4XFBA 1PO11 1FKOA 3ZSJA 2BOIA 5E1RA 1QJU3 1HWUA 1OLMA 5LBEA 3ZOIA 3I9V9 4LF9F 5IK8A 1JLFA 1RUH1 1AR73 4IG0A 2CPZA 1REFA 3FQKA 3ETQA 2PGCA 2KDOA 2CHHA 4Y33A 4CDQC 3C7OA 1U5XA 2QMWA 5D15A 3M3OA 4NZ0A 3IRWP 4H2AA 5JVGQ 1V6MA 2DU1A 1OUSA 4N8OA 4BA6A 4YVSC 4TU9A 5ETOA 1JMUB 2A5ZA 3J7HA 2B3TB 2XO7A 2OJ3A 4JI5J 1MQTB 3OYWB 2VQ0A 3RU0A 5HMYA 1HD1A 1VPHA 2OPWA 1HNWJ 2F9JA 2IVIB 3ILFA 4ENOA 3M2UA 2OW4A 5C3PA 2HHWA 3QBCA 5DDOC 1IQTA 5B0EA 3I8TA 3SLIA 2E5GA 5L9NA 2WQ8A 3R1LA 2D43A 2I5JB 3JQKA 4PXCA 1K8AT 1XRUA 4BM8A 4P5YA 4DFKA 3RBEA 4V2WA 2D69A 5F8PA 1RUJ3 2RUGA 2QYGA 3EVWA 3MR5A 4Y1UA 2NM1A 1T3OA 2YXLA 2ORXA 4YFUA 2QQKA 4H4KA 2GSYA 5J1PA 1CIYA 1E6YB 5IT9Y 1B99A 2NZ4A 3ZDSA 4LHLA 2HLUA 2WYFA 1C4AA 4B9UA 2DBNA 5DAQA 3HMJG 2XCAA 2QZ3A 1VRH2 1XMQF 3K2YA 2J9CA 1YI2S 3V5RA 2KB2A 2F4FA 4ID5A 1QOTA 4Y2AA 4X4TA 2OX0A 3IR5B 2C3MA 3KUHA 4OZLA 5FMCA 2CWMA 2F40A 3RVHA 5FLHA 1D8ZA 4RW8B 5ADZA 3HCXA 3VHRA 3ACLA 2W0XA 4LF7F 2A18A 3C46A 3MLLA 1US3A 1F5CA 2LW8A 1H0HB 1Y9QA 1T7PA 1T2XA 3I2DA 1UPMB 1S9GB 1WEZA 3ILNA 1X31C 4UTGA 1FV2A 4NO4A 4OJHA 5ETPA 3G71S 1U7LA 4BDPA 2K3IA 3ZNUA 3US5A 3K59A 4QOTA 5KFBA 2WFF1 1OFSA 1PVXA 2I0XA 1XMBA 4FOWA 2IVJA 3W5MA 4Q8EA 1QF3A 1CZTA 2KVIA 1AZDA 1WD4A 4ED6A 4XUOA 3POIA 3H4DA 4XXPA 1S0FA 5FBZA 3DGVA 5IW0A 4QIWD 4HHJA 2IC3B 3CJ2A 4O44A 4Z92B 2VG6A 5BV6A 1YKWA 2E7TA 2V4QA 1VJ2A 1N52B 4IGPA 1YGYA 4Y22A 1NK9A 3KHCA 1O5LA 1YQ2A 4RFRB 3L09A 1QOSA 1AR91 4NHMA 2FVPA 5KFXA 5HVHA 1CULB 3FUYA 3IBCB 4XW3A 4IQPA 5DG2A 3OQ2A 5BYRA 3BIWE 4NLOA 1OOPC 1S6QB 5FOJB 4PG8A 4QB2A 1SUQA 4CDWC 1KBRA 5LSRA 5CAZA 5BNPA 4ECXA 4PDWA 5A1FA 3N0VA 3BF4A 2XONA 1WACA 2BKNA 2K9ZA 3MIBA 2HEWF 1U4BA 4JI2J 3DYPA 3NV2A 4GQ7A 1DTTA 2CJXB 4LRCA 3H7HB 4IH6A 2WZPP 3HVWA 4USMA 2XO6A 3JZVA 1D0HA 3CUNA 3R9LA 2KT3A 2Y0BB 3MPPG 5A3UA 4AFFA 3WX4A 4F0MA 3KG1A 4LLOA 2RIJA 3TZZA 4ATFA 4B3RJ 3BSOA 1QVFR 3WDWA 5J2QB 2BANA 4F4AA 3LA3A 4U2AA 4CTAB 1RWOB 4X62J 5FRAA 2XGQA 2ZBQA 1RUNA 1HQEB 3PW7A 4UFJA 2A6YA 3A22A 3ZX7A 4CCDA 2ZDOA 1IG3A 2X8KA 5FY4A 2R8GA 3LEGA 1ULCA 2WT2A 2F8EX 4HN1A 1NZCA 4Q27A 1TKDA 3L7PA 1QD1A 3DOMB 3J80U 2JKXA 2EC2A 4PXEA 3LZZA 4QXKA 2Y6FA 1XR7A 1IJEB 2ZEYA 5MAOA 4FBUA 2Y8YA 4GO5X 2N3LA 4RUAA 2XYPB 4BS2A 4PI0A 3T4VA 4EN7B 4DQQA 1SQ4A 2PMWA 4C11A 1X4GA 4C90A 4Q0SA 4WXOA 1GANA 2FLNA 2V4AA 4UQTA 4FFHA 4OI0A 3RMYA 1I5OB 2XMUA 4MKBA 3VAHA 4NA1A 4DR5J 1IKYB 4FF3A 3TUJC 1R7IA 5C71A 4B1LA 2OFHX 2E7WA 4D7YA 1W9TA 1LQ9A 3KF3A 1ONAA 3M6UA 2W9CA 3AJDA 1FDDA 4GKXA 1FFGB 4NVPA 2HVIA 1H2MA 3ZPOA 2WT0A 1D9FA 2AUYA 4ERDA 3KWMA 4DNYA 3IBFB 1QTMA 4WYWA 5K9FA 2H51B 3CSKA 4DI6A 4NE9C 3CF5Q 4TY8A 4FOVA 4ECVA 2M0GB 3ZTOA 1COV1 1ZAXA 3EB7A 2LU2A 4HVRA 3BKFA 3SMZA 2KXLA 4OMFG 1UL3A 2XLJA 4Y65A 5IVFA 1TL4A 1HQUB 2A73B 4NEYA 3M3CA 5BYSA 2QQMA 3GF6A 2GNTA 2B4OA 4GO7X 2HFUA 2X05A 2IWGB 4PABA 1CJVA 3WDUA 2QZ8A 2RAQA 5DLFA 3GU0A 3AODA 2R30A 1YIFA 3Q83A 3FLPA 2DT9A 1H7XA 4RHV3 1CBKA 2JLGA 2FZGB 1YFWA 3VQSA 2IRXA 1VRH3 2HWF2 3ENRA 3WX5A 4Q7AA 4FBTA 2JDNA 3OBTA 3CZUA 4LKFA 3NEKA 3JSMA 4FN5A 4HLBA 2ASYA 1JTZX 2PE8A 2PDAA 3U0ZA 3MCMA 4M5MA 2OEJA 3QIDA 3NKYA 1UWBB 3M7AA 4W65A 1NYWA 2ZMNA 1R081 3KT1A 4Y26A 4A6OA 2WVEA 3NGSA 1Q8SA 3QOPA 2E5HA 1N5TA 3IAM9 4QZVB 4I30A 1PGL1 4YG0A 5C42B 4O61A 4JTNA 1QDUB 2UVRA 4MZUA 3DCQA 3RWNA 3N5FA 4LUKA 1QU0A 2AJFE 2QJVA 2AKWB 3MIGA 1X8MA 4JYAF 4EN8B 1J5EJ 1YXWA 1ZZCA 4GAZA 4BDVB 2N7YA 4QGLA 3BYRA 3DOKB 3CNAA 4OI6A 3CCRS 4F4XA 4I67A 4NXNJ 3LA0A 2J1SA 3D28A 4QMAA 3KV6A 4TN2A 1M5HA 4RZRA 3JB9k 5J09A 2MHNA 2ZKTA 3BU0A 2GMMA 3CCES 2PSZA 2G2YA 3K2OA 2OI2A 5E88A 2EK6A 1P1TA 1IS3A 3RMXA 2Q1ZB 1U09A 4LBLA 1S9EB 2D7FA 5K14A 3KK1A 1AJKA 5EDWA 1EJ7L 3S5QA 2FVCA 3DU5A 4A3ZA 5E0OA 4RFT0 1B7YB 4OI2A 5AXMA 2VQEJ 1XBFA 1RTIB 5IJRA 2HGLA 4B9TA 1PGW1 1HV0A 2VZTA 5J98B 3RYRA 5LM7E 3O2IA 5EWFA 1U5YA 4GB31 3PRDA 1W28A 3RZMA 3GV8B 2WUHA 5A8KA 3EM1A 1VBC3 1YJLA 4LHNA 5DPNA 1FTRA 2KL8A 5I3UA 1KONA 3MM7A 4U8VA 1J1TA 1UP1A 2ERRA 3OL7A 3I56S 2AGQA 3LF7A 3MIEA 4GRSA 5C4WA 5IK5A 2HNYA 3HD2A 3FFIA 1FX2A 2FDGA 2DNRA 5KG1A 4LXLA 4O7XA 2ABYA 5FMDA 1Y00A 4O3NA 1A8DA 4DZDA 4M0NA 5C8WA 3FJ2A 2HQDA 1IZ3A 3U11A 4I2PA 2BBEA 2YZ4A 4CLYA 2QLWA 1AJOA 5KR7A 4QYRA 1TL3A 3B01A 2W2IA 3HVTA 5LA2A 3KV4A 3WNKA 2J7UA 2ZACA 1SKUB 1UNBA 3W3SA 5F5IA 2FJAB 4JGZA 2ZNYA 1FOD2 4YY3F 4IGOA 3B4DA 3QGPA 2ATFA 2OQ7A 1RHI1 2H65B 3VDCA 1LU2A 1Y7BA 5KFPA 3VZNA 5T7LB 3K5NA 4META 5DZ6A 4IEVA 3NNFA 5K9YA 1ZPWX 3JQMA 3D82A 1F35A 4DR4F 1S0CA 2PHDA 2YNHA 2CAVA 1J1LA 2XJPA 5B4NA 2E9QA 1D1UA 4R5PA 3FJSA 2XDVA 2VUGA 4FYWB 3Q22A 4U9RA 5FIIA 2CPYA 1WTFA 4CEYA 3MM6B 4TVAB 4CM2A 1OA2A 2D6PA 4USVA 3ES4A 4YYOA 1CESA 3TEXA 3OBAA 4B4RA 4LQ3A 4JV5F 3AXDA 3IZOA 1KS5A 1UPSA 2HYKA 3UR0A 3AXKA 4QD2A 1SH2A 3A8JA 2XH6A 4KO0A 3H42B 3QH6A 1F9EB 2WBRA 3OJSA 3WBZA 3EXYA 5CD4H 3KHRA 3ILOA 4WVVA 1JX4A 3MBWA 4JI1F 2JE7A 2HHUA 3Q8YA 1MZ5A 5BPXA 4WU3A 1XB9A 2QJ3A 3OUJA 5EXOA 3FHIB 1RB0A 2ZWOA 1X7NA 4DL2A 3M8LA 4DPNA 1EPZA 2O8OA 4M01A 1UZDA 4XE9A 2A2CA 2ZH6A 1R1A2 2RS52 1MZFA 2HWC2 1JN2P 2ZGRA 2NXCA 3LAMA 3MM5A 1E5IA 1O3QA 2F17A 3NNGA 1U48A 3EPIA 5FR3A 1WCQA 1Q4RA 2ADDA 2WZEA 2XMMA 2W47A 4EGLA 2F4PA 3MM9A 2HNDA 4DSIA 2RDDA 1LWXA 1RUG3 3RBXA 4OZ3A 3V0AA 2NUHA 4Y2IA 3VZMA 1RE1B 4FPEA 3AA9A 2RHSB 2FZKB 2XY7A 4QJVA 4XFGA 1N6QB 4JB8B 1WCKA 3X29B 2PYTA 1O3RA 2HMIA 4UOCA 3DRRA 1DURA 1X4HA 1CN1A 2OPQB 1W3XA 4XJAA 2Y64A 1X4FA 2B7YA 3NS7B 3T1LA 3A1YG 3P6BA 3THDA 5FK7A 5CCLA 3L4BC 5FYCA 4PQUA 2D44A 4CE8A 2GHWA 4CDUA 1VJWA 3AVRA 3ORJA 3H59A 1HW9A 1K12A 4C0HA 2DYCA 3I2JA 1N48A 2DNPA 4AFBA 1YK9A 3C8XA 1K44A 1CSJA 4DCPB 3O6QA 2RQCA 5L7OB 1IR1A 2E6VA 1Q78A 4JV2A 1R0CB 4CYDA 5AC92 2DRAA 2OGUA 3OL6A 2RMU2 5C25A 1JKHB 2PHRA 3K4ZA 1KC8T 5C33A 1UU4A 4KBBA 4DSJA 4C3LA 3BR8A 2YY1A 3WP3A 1Q5VA 1FPN1 2BZ2A 3AJ2A 3OVAA 2HFSA 3U1MA 5GADU 2ENRA 3WP4A 1FKPB 2PA8D 4DV1J 4LO5B 3WC2A 2B9EA 4ZDNA 1F5AA 1AZSA 2YWFA 4TLQA 3NL1A 4K4XA 3MURP 4ZJOA 4O23A 1VK8A 3ZFGA 1CPMA 1G9BA 1GMWA 3G8TA 2ZGLA 4Y3OA 4KQ7A 2HQFA 2GZOA 4LBQB 4QQHA 4DFJA 4IFVB 4IEYA 5FWJA 1GWKA 1HBOA 1L3JA 1CQNA 3POTB 1Q7YT 4BISA 1FT8A 3X1LB 2Q4SA 1JLBA 1O6XA 2A6MA 4DPOA 3BDPA 5J96B 1RAAB 3IT8A 1WKJA 3UYJA 3T09A 3CXCR 4PYDA 4XABA 1IBKF 2J7WA 3ZDVA 4Q2FA 4ZK7M 3N9MA 2JB8A 4H4KC 1ZM2A 5A7SA 4ILRA 1ZM1A 4KRWA 2KI2A 5DDJ3 3J8F1 1QJX2 5F6LB 1QQP2 3SEOA 2NCKL 1VBB1 2NYHA 4HZFA 2HBZB 5J1EB 1OY9A 5E3QA 2PHXA 5B2GB 3MMCB 4XUTA 2JFKA 1ND2B 2E1PA 1JQGA 1J83A 1FOD3 4F83A 1RKIA 1OLME 4CO1A 2XZTB 3S6PA 3KMSA 3KQRA 2FGOA 2P3YA 3E51A 3BN7A 2O1PA 5L1KA 3NNMA 3JB8A 5IK7A 3KNGA 2MZTA 2LQ8A 3VD7A 4Q4Y1 1DBDA 4HI1A 1S6PB 2DRDA 3C14A 2XJSA 3SKJE 4YUDA 3CD5A 2QSFA 1IG0A 1ACMB 4DV4J 3ZMOA 3BUCA 1GMUA 3DYAA 1YUDA 4QAWA 4NIAA 2FUG9 2M9KA 2GNKA 2I6WA 3CCLS 5ABJB 1RVF3 2BE9B 4OMCA 5F8LA 3KLGB 3GZTB 2HVHA 2VUJA 5KHGA 1RT7A 4CLUA 3UV9A 4K4ZA 3OB8A 3VZOA 4OYIA 5HCAA 3ELNA 2X1GA 2XMKA 3UPFA 3QZ8A 1SHWB 2Z58B 3SSQA 3LW5C 3ATGA 4NHKA 5DQGA 2FJWA 2Y0OA 3V0BA 3RB3A 1VBE2 3UD3P 4CPBA 2OLWA 1QE1A 3SQGA 3DLEB 4I02A 5H9FJ 4UY85 2GW8A 4BQ4A 1DIWA 3ZIWA 4F02A 2F9DA 4KKOA 4ZVQB 1H9PA 3DFEA 1FRMA 2AEMA 1RMU1 3OVSA 2W94A 2DGOA 1FK9A 5LMNF 3OUIA 5IV4A 3VF0B 1J3PA 2C2ZB 1YYNA 4LEJA 2ZKUA 1C2PA 2Z57B 2GP5A 3PTRB 5BNPC 4PDWC 4TN7A 2HS3A 4KPCA 3DOLA 2GN3A 2OPSB 1X36A 2RS53 4Q2MA 2HWC3 2X5IA 2DGUA 3I3QA 5GZEA 1QTNB 4Z37A 4JCKA 1MW7A 5D2AA 4ZS6A 5B0BA 2QLXA 3TEWA 1HNVA 3NOCA 1FTCA 2ZMLA 4CP0A 2C0ZA 3M8QA 5FKBA 4IERA 4U6PA 3OVBA 4FBFA 4FPLA 4J9PA 1U26A 3FZ2A 4PG7A 3BYPA 1WORA 2CKWA 1UVJA 2YV8A 3RQ0A 4YS2A 3E6BA 4J9OA 1HRV1 3LWMA 3GR1A 1X82A 4KWLA 5A3WA 3O1VA 4OLOA 3R5BA 3BOPA 4XIKA 3OR1B 4DR7J 4Z7YA 1QH7A 4ZPAA 3ME2A 4NYOA 3POSA 2CFXA 1KHVA 3ZTSA 5E89A 4AYBD 2W8KA 2YQ3A 2DFCA 4Z2WA 1ULGA 5JZGB 1S6OA 3FHAA 3HO1A 1YBAA 4G9SB 4M94A 2W2PP 1ZX5A 2D74B 4YN3B 4L75A 2X53S 2JJ4D 2RT3A 2DVBA 4W90B 1S2BA 3I4IA 3UJOA 3NRUA 5AC93 5FY0A 4CU9A 1RSCA 1J58A 3P3PA 2J0QD 2KD7A 3PR5B 2MGZB 1UYYA 5FZGA 1Y3KA 1NHKL 3KHHA 2DBBA 4B7KA 2FHMA 4NLYA 1N33J 1ROFA 1SBEA 3T41A 5JXJA 3G8SA 4Y20A 3E5XA 5J2PB 2C9AA 5FY9A 4C3MA 1ZTWA 2JDJA 3IWNC 2ALYB 4ILLA 1QY4A 1RCXB 4DR1J 4AFDA 4Z82A 5HSPA 1HJGA 3IXQA 1SKWA 4QDRA 3U10A 1C1FA 1A6LA 4EEYA 2CJKA 4YHHJ 4CLLA 1UCXA 4A41A 2ACYA 5CYMA 2Y1IA 1NK5A 4N53C 4P2MA 4DR2J 3R2DJ 1DQAA 4W4ZA 4UUWA 4I0BA 4CCLA 4IRDA 2KG0A 1LHUA 4FF2A 1POV1 4HSJA 2Y60A 5HVGA 2YXSA 4S2FA 1AXYA 3M70A 3LEMA 3HVRA 3SDEB 2WBMA 5CCMA 5KXCA 3PHEA 4NPOA 4YMEA 1RWNB 5EIYB 1DQ5A 3DGPB 5DG9A 3M32A 1UKGA 3KK2A 3RDIA 1QJX3 4YZ4A 2M5YA 2ZNZA 4XTTA 1PYTA 5C3OA 1L7QA 3LSDA 2YKPA 3THCA 1QJEA 1YTYA 2ZCWA 3VHPA 2GNBA 3OY8B 3G82A 2MQMA 4DX6A 2C3YA 4MLOA 3I49A 2P3KA 4A8OA 3E01A 4UBGA 3DLLQ 3U78A 1S59A 4AI0A 1PBAA 5CKQA 3U1XA 2RU3A 4GKJJ 1N3PA 1CX1A 2F8HA 4E98A 2QKDA 1W8WA 4LVOP 1VRUB 1U1RA 3WG1A 4DB5A 3I59A 1S4EA 3EZOA 3HPOA 3KYLA 2CJ9A 1N3OA 4CXYA 1VQ7S 5H9FK 1ZA1B 3HVDA 5FXXA 4KWJA 1OUXA 3LWCA 3GDBA 5D21A 3ENAA 1SCJB 3C16B 4EN9B 1IBCB 3UWTA 1Q8IA 1POQA 2FY8A 2DPJA 1RJ8A 1B0VA 3LIHA 3TEYA 5HQ8A 3HHNB 1KD7A 3DLGA 3GFZA 1U1QA 5FLXU 4K4VA 1WWYA 3K51A 2OPPA 3B5LB 4M1KA 3W9JA 1QJU1 3MM8A 3FHQA 4JGYA 4CVUA 2Y8WA 5F8MA 1IKQA 4IO9Q 4KU7A 3KHLA 1KS2A 3T1YF 4A2UA 1AR71 2Z5WA 1Z1ZA 5IUQA 4QKNA 3WR0A 2XVKA 4F0HA 5AE3A 1S1VB 3TN92 1YJ7A 2DGXA 2JG8B 2XKPA 1E5SA 5IVYA 4KH0B 4ELVA 1VAKA 3AYCA 5GALA 5JIAA 4E2QA 4FZVA 1SCRA 2GZWA 1YRXA 4PLMA 2MQ8A 1PC4A 4UZBA 5KOXA 2MZSA 5GAHI 4IOBA 1PMJX 3I96A 1V70A 2ALZA 4PG6A 2QGFB 4LRAA 5L9VA 4MX3A 2YTCA 2VUCA 1Y0HA 4X4UA 1BK0A 2HW3A 3LIGA 2WONB 3M2VB 2FDIA 1K0VA 2OYZA 2ILYA 3SMHA 3UD4P 5HPOA 2VBDA 3SZ2A 4NN0A 4MGKE 4IRKA 5C9AA 4N43A 1M5PC 1LW0A 1QGLA 5C4WC 1A34A 4K59A 1W9YA 1AYN1 3MEGA 4K20A 3PTYA 4BIFA 3C3VA 4XDPA 1ZPVA 3FEYB 2FDHA 4MGSA 2DK2A 4E4SA 1RUJ1 2KRBA 3D7SB 2ILZA 3AJZA 5LWBA 2W52A 1RWXB 1N88A 2RM21 4JGZC 3VZHA 2JC1A 3GCWA 2RQKA 5T55A 1URXA 3APBA 4P08A 4M63A 3PIGA 2QMXA 4OFGA 3CU7A 2J5AA 4PQQA 5B09A 4XHBA 3T1AA 4L9BA 4AAXA 5I42A 2FVRA 2IA6A 4F67A 2YB7A 2EEYA 3E6CC 1BJQA 4E8DA 4Y1YA 2JD4A 3AYDA 4DG1A 1T02A 4R9CA 3VWSA 5JOWA 1S6UA 3BYWA 3TI0A 3DU6A 1WOPA 1REVA 1JYIA 4X8PA 2Y33A 2FDKA 1JLQB 3RYLA 2CWSA 2W2QP 4ECTA 2WSVA 4CEYC 3G8QA 1OHFA 1KFUL 2FCUA 4NXMJ 5FKCA 1IWGA 2H4YB 4Y0FA 2QSWA 3CO9A 4PZVA 3ZZPA 1EAH2 3ZXKA 3P96A 5FXWA 1PK6B 2LVWA 2AP6A 3UDVA 5K8PA 5F8HA 1NDLA 2HURA 2DCUB 4MK9A 4DMIA 5LB6A 1GNKA 2SBAA 1WOOA 3D6MB 4UOJA 2DPIA 3DL3A 4XBNA 3UESA 1PG5B 3MEDA 4HACA 4ED1A 3C2UA 2CG8A 1KQKA 4M5DA 3V4IB 5FZOB 3GB0A 3VBOA 4EO6A 3IWZA 4WM7B 1BY9A 1VAMA 1HL6A 1XYPA 3GBGA 2XUMA 3KGLA 3TEGA 3C7GA 4XIOA 2NZCA 4IEPA 5LATA 5C5UA 3TO8A 1N3QA 5D0RA 1FXDA 2FZCB 3MGJA 1RUE1 3ACIA 3DI6A 2XZWA 2Y6HA 4NROA 1I6XA 2VMCA 3W2VA 3FCVA 3IN5A 1RA7A 4COVA 3H8OA 1HYSB 1BVP1 2VOVA 1PSDA 3PVBB 3OLBA 5LBFA 1YJVA 2B5JB 5CAAA 3GIRA 2Y3YA 2CPJA 1ZREA 2B46X 3Q23A 2E1AA 5LK5A 2VH9A 4A7ZA 1U1MA 4CDUC 1Z78A 4WWSA 4P9XA 1TME2 5LY2A 2CA9A 4U7UD 2CNAA 4ZN3A 3MIHA 2WOMB 3FX3A 2A10A 3Q8UA 3JQWA 1TMJA 4KHPJ 3DDNA 1BD6A 2AGOA 5E41A 2HFNA 4X8NA 2IXHA 3C3LA 1CAWB 3B9CA 1NQJA 1WEYA 4DBQA 4CCHA 2W9BA 5KT6A 4ZIVA 3VBRA 3TVKA 4KH9A 1DARA 4LR7A 3O3LA 4P9SA 4A8SA 1AXKA 3VKMA 2YNIB 2UUBJ 3ZFGC 3F41A 1UY3A 4AE5A 1U5IA 2GMLA 3D66A 4DSKA 2W1BA 3KT7A 1BKZA 2OD4A 1KWMA 3IC1A 2UXBJ 2KFNA 2VA3A 1SQFA 3VGUA 1D2SA 2W4DA 5KFNA 1X7VA 4M5LA 3KV9A 3LANA 1AX1A 2W1WA 5EYYA 5A7NA 5FZ6A 4XAKA 4XF9A 1LWFA 3ILLA 3AC0A 3RRHA 3I3EA 2RNEA 5A33A 6FD1A 1FMD2 4XF4A 1HLCA 3F73A 2HWB2 2HZCA 5LBBA 4PIZA 2CQ1A 1WA6X 2FC8A 2KTQA 1W8TA 4MXWA 1W8OA 1JLAA 4ZN1A 3IBWA 1H3DA 2VPXB 3PYGA 2WW4A 3FWEA 1W6NA 2VQFF 3LCPA 4NI2B 1IBMJ 2FHRA 2BQPA 2Y26A 2ZD1A 4FPKA 1YITS 5CZVA 4DQIA 4NLUA 4LIVA 2K7JA 1S0VA 3I5AA 2XJQA 2ZGUA 4MK8A 4XFAA 2KVQE 2KT5A 4N41A 2D5FA 4C7QA 2VZUA 1ZTTA 4YW6A 2VHGA 4R4XA 2VG9A 3MECA 1CJDA 4YW7A 3VD3A 2FPHX 2XB6C 5DGAA 2XJVA 4RHV1 4I0WB 3QRQA 1VRH1 4P9YA 2JD9A 4DL3A 5J2MA 1LW2B 1V6NA 4TLFA 2GMHA 5I8YA 1W3VA 5ETKA 1ZBA2 3Q8PB 4CNYA 2UWBA 3T30A 1N32F 3BGFA 4LRFA 4WZCA 3G6JB 3ZFFB 3MUVP 4AEMA 3IG1B 4D6SA 3TVYA 2D93A 3I2FA 2VTXA 2NMNA 1S4FA 3PTWA 4LFCF 1V3ZA 1EAH3 1IBLF 1UOGA 4X65J 1OVPA 3GZ7A 4JOUA 3KHGA 1H1MA 1IR0A 1OD3A 3WT3A 3MFHA 3VHNA 1UW4A 1M5SA 4QQPA 2GJFA 4ZITA 5L38A 3GLJA 3I31A 4XZUG 1VC0A 2D41A 4U96A 2J0SD 1RT6B 4NAOA 4YFWA 1IUJA 1CG2A 1W99A 4QX8A 3WQ7A 2VFSA 1JJHA 2IAJB 2A70A 3USUB 3SFUA 3TX8A 4HG6B 1ULFA 2DBIA 4GWNA 4QX7A 4USUA 4KG0A 1W8UA 2X5IC 3G86A 5L36A 1HMVA 1N5SA 4YW3A 4ZU7A 2ZH5A 1JW6A 3M9NB 4QXHA 1UY1A 1N56A 1F2NA 2V63A 2OZ6A 1WC3A 1HR0F 5A6WA 4NLGA 2X3GA 1KRIA 1TFWA 3CD0A 2CZVC 3VBUB 5DDQC 1YNAA 2IM2A 2XYGB 4L99A 3EZ5A 3BO4A 3BTZA 3QIPA 5IWFA 4CLFA 5F9LA 1X5PA 2BEOA 4QX1A 1UFKA 4YM1A 4NJ4A 2LA6A 3CO0P 1NCQB 2W2OP 1VBC1 1KVIA 1T9UA 5F2SA 2XSJA 2VZPA 5A32A 4M3CF 2DNHA 4DX7A 1K1QA 4FQ4A 4AVCA 5GM0A 5F3ZA 2YQ0A 1LWEA 1BCXA 3AKPA 2HVEA 1U1OA 2L9WA 1XNTA 4ED3A 2DR8A 2WBKA 4CCMA 1OPOA 1AYM3 3QCWA 3RTVA 4I68A 5KT4A 2RKIA 4WIQA 1RYYA 1UIJA 1F9KA 5J48A 1RI7A 5FYBA 2PN6A 2BW7A 1P8GA 4BXSV 2D3SA 2JFDA 2YNGB 3JTNA 2A6VA 3WD5A 1F6TA 4KQZA 4B3RF 4QGNA 1Z2LA 3FUQA 1XIQA 1SC1B 4A45A 2XGXA 5FDLB 1ULPA 2OHDA 4QWBA 3POEA 1LB2A 4B3MJ 1TK0A 2H3EB 4KHMA 2E9ZA 2OPRA 2XC9A 4ZCKA 1VBKA 2RF2A 3BPZA 1LOGA 3FN9A 3M1HA 1GAOA 3V6HA 1Q95G 3ISNC 2KYXA 3H50A 1JU4A 3EZUA 3NCRA 5IWAF 4K4WA 1QXJA 4ZPIA 4ZLLA 1HARA 4IXLA 4F04B 1NG0A 4EYUA 4P71A 3DRPA 1D4VB 1M1KT 1MQTA 3OYWA 4RQPB 3R2CJ 1F3VA 4M00A 2QEXS 3IS9B 3PJ9A 1MU2B 2BV4A 2W7AA 4Y2MA 3MPYA 3HKZD 1XNQJ 4LF6F 4MK7A 4YR2A 4QIFA 1HB3A 2LALA 2FBEA 4UT4A 1V00A 3VL9A 4ZPDA 3HFVA 4DN9A 1FMD3 4DV2J 4A48A 2I5JA 3CD6S 2VE1A 4RS5B 2VZSA 4IR1A 3QFHA 3UKVA 1R8HA 2ZM6J 3M9OB 5JR2A 2B9YA 4QPTA 4CUGA 2KM2A 2WRAA 4HL0A 3WP6A 5FMOL 5KFEA 1VBZA 3ENQA 2O67A 2GC3A 4LLFA 2DGSA 1E6YA 1SJ4P 1S0JA 2C4XA 2CIMA 1SMVA 3SEEA 1A8MA 3I82A 5C5JA 4PXBA 4QXBA 4WK3A 3QACA 2R7SA 4OHWA 3IO1A 1KJRA 1APNA 3TUIC 1PO12 3OUYB 3AFKA 5F41A 4WK1A 2CTVA 1DGWA 2ARCA 3VDDB 1LK5A 2XG3A 2D7SA 3NSTA 2WAAA 4QX2A 3PUIA 1JBCA 2XXZA 3HEIA 3T5JA 3UJQA 2WNUA 5DUWA 1SV5B 1RHUB 1RUH2 2LA4A 1GP4A 3OOXA 4YB7A 4WTOB 1BQXA 4RW8A 3ADAC 1XSRA 2CQHA 1RUG1 2YKNB 3RWKX 1W9FA 3IP0A 3LP2A 3J4UH 4OI3A 1T03A 1O5JA 1FESA 3PMSA 2WCXA 3DMJB 4JI4F 3AVSA 1VE0A 3WXPA 1N1YA 1G9FA 1UQXA 3CMGA 1S76D 2RJKA 1NY71 4FTBA 5FP4A 1SXLA 1B35A 3R4DB 2BKOA 1U2CA 1FX5A 1ZM9A 4ICLB 4EO8A 4RW7A 3AK0A 5JDBA 1S55A 3I4PA 5JIUA 4LT5A 4QPWA 1D0GA 4ZPBA 3R7SB 2VJUA 5B0AA 1VC5A 5DUXA 3CW2C 1KTVA 4DS4A 1SACA 2JEIA 4GWMA 2IC3A 3OEAA 2FC9A 1S0EA 4LMFA 2ERFA 2HFVA 3HULA 3QGHA 2EFNA 1NXD1 4FXVA 2R7WA 1PHMA 1BEV2 3L2YA 2F4VJ 4JGYC 2JIGA 4MGQA 4CQ1A 1CULA 3L9JT 2J42A 2HGMA 4J9NA 3J7LA 3ACFA 2DXEA 1S6QA 3O0VA 2QUOA 3JYTA 4YGDA 1FDAA 3Q89A 2R2UA 5FZDA 4NIIA 5LK7B 2OIIA 2QQIA 4Y5Z0 4O0IA 2WVFA 1WW4A 2KYZA 3I87A 3QAUA 1PZ7A 1YBUA 3WW2A 1HLWA 2L08A 4X4SA 3T2TA 2ZBRA 1MSWD 3VVTA 1YQ5A 3IM0A 1RZMA 3TOJA 2NLRA 3A4UA 5AFBA 2IYIA 2WAQD 2ZE2B 1H1IA 5K5MA 1LHOA 1KLNA 2DUQA 3N9UC 4RNMA 5C9AC 4N43C 4PYAA 5KFQA 4X4QA 2CQ2A 4CTAA 5GVQA 3K5LA 2OIHA 2CQGA 4K21A 3KFWX 3RGIA 3TNPB 1MWYA 3R5GA 2BA9A 5D8AA 2WFF2 5KG3A 4WTYA 2YKAA 2FTRA 2MQLA 3FMBA 3R7NB 4AAPA 3Q86A 5DDJ1 3QT7A 4GIQA 3RPQA 4NIDA 4Q44A 3AMMA 2WINB 2YWWA 3WQ1A 4GMP0 2V9WA 5SV5A 1N8RT 2N4CA 4F3QA 4WM8A 2QQOA 5JXGA 2BPA2 2APOA 2OUJA 2BU9A 3AKSA 2XPJA 2QLJB 1FOD1 1MVQA 3CC4S 2Y34A 1RT1B 4MIWA 4CP9B 3W9AA 1WKKA 4HKOA 1Y5IB 1RUI3 3PMEA 4UAPA 4C8LA 1E5HA 2HFZA 3A3OB 5DAXA 3P4UB 4FF4A 5F8JA 2BE2B 2IJNA 4OJ3A 2HRYA 1IKYA 1GX5A 2DEIA 3EGVA 2H5IB 4LSNA 1RVF1 2QIFA 1HBUB 3ZNJ1 1ODMA 5FMOS 2MYFA 4G3YC 1XQNA 2B9UA 4FKXA 1NPPA 4PWUA 2GAHC 4XUNA 2Y0IA 4QCLA 3D6HB 4HH0A 2CPHA 2QTWB 1GTEA 3OTBA 2HRTA 2HHVA 2WVBA 1JH5A 2ASLA 3PO5A 1S1AA 3CIZA 5ETLA 1U8SA 4EBCA 1C3HA 1O3SA 2D3RA 4QU2A 4DUVA 4DXTA 1KLMA 2XG8A 3BBFA 2ROGA 1VP6A 1J27A 3VBOC 4AQYF 3J7YI 3WHTA 2CGPA 2D6KA 4HT5A 1TELA 2AREA 2G1DA 1UTAA 4GWIA 5A6XA 3A8IA 5KC5A 4PBOA 4XEZA 3Q8AA 4G65A 1SH0A 2B8MA 3GIMA 4UFLA 1GZWB 1PO13 3J7ZT 1GFF2 1DGLA 2RS51 4PG4A 2HWC1 3KLIA 4EWTA 1OI6A 3BB6A 1HRI3 4Y1XA 4EV0A 5GAEI 2JDZA 2GIRA 2GX8A 1YRTA 2GH2A 3WC0A 2R49A 1M06G 2YG0A 4YR3A 1RA6A 3IMMA 4QW9A 3CDZB 1DG6A 5C5TA 4EZ6A 3ZTRA 3CT9A 2KFZA 4F3OA 1SJFA 4I7FA 1YFUA 2DCZA 1J2VA 5C42A 1TAQA 4DCOB 5LEKA 2QO3A 2RVJA 1CLFA 1RWVB 2I38A 3DXBA 4F4WA 4XQWA 5JLVA 3QT6A 2P9GA 3NQHA 2ZOEB 1VMHA 3HQUA 3MR2A 4MHRA 3VUOA 3D68A 3LP0A 4BHQA 3WQBA 4I01A 4FTSA 2NP0A 4CDQB 1QAJA 2MJNA 2C6SA 5K8MA 3RZKA 1BEV3 2H0BA 5FPVA 3LQCA 2YKQA 1RDRA 3D3CJ 3VBRC 2LU1A 1AB8A 3T1MA 3S57A 1XR5A 3TNQA 3FSXA 2D5HA 2JG9B 1QXPA 3LB9A 4NMLA 4P7VA 2D6MA 4BZ4A 3UVJB 2HHHJ 2RQMA 4DL0C 2MSTA 1RTIA 2HIQA 4FS2A 4BQ1A 2VMHA 2VQAA 3P5BP 1HBNA 2JLEA 4OCTA 2ZJQQ 1BHNA 2ZEZA 4BQXA 2NREA 5HANA 3VN4A 2M7SA 3UW1A 3L2HA 2YWKA 4FPIA 3MZHA 4F36A 1DRZA 5F32A 2GHVC 4JDNA 4QPGC 3W2WB 4AHXA 4C0BA 3C2PA 1O8PA 3W9IA 4USTA 5J2NB 3H8YA 1W90A 2C42A 1GYKA 3IWLA 4DX5A 2VG7B 1B64A 3MIDA 3DM2B 3GM8A 2NS1B 5JMNA 4L97A 2VDIA 3HVAA 4MYUA 1M5VC 5KFWA 3MMBA 3JBG1 3B4MA 4PHZA 2YC4A 4PKDB 2XQCA 2VQUA 1RACB 5DZEA 1K73T 1U1PA 1Y5NB 2ZVSA 3CC2S 3BQ2A 1J3RA 5IK4A 3AOCA 1QJX1 4ZJQA 5F3IA 1UEVA 5H9QA 3MIFA 1C1LA 1AUSL 2J9DE 1NZ8A 3DLKA 3PJQA 4K0KF 2VMFA 1GX6A 2VVDA 2V50A 2VJXA 4AEDA 5CIRA 1QOOA 1LOUA 3MUMP 1IVZA 3HAGA 3NBPB 1XOYA 4QBUA 5EN1A 3RAQA 4GMP3 4CUBA 3O1UA 3WCRA 3H1MA 4XCBA 4C3KA 2ZAAA 2CADA 4KR0B 2BZDA 4Y2KA 2VUAA 4ISRA 5GMDA 4HVQA 1TKTB 2N82B 1MNEA 2UU9F 1PGW2 4W8JA 3VV2B 4LFAF 3IM8A 5IVBA 3PKMA 3WW4A 5FZ9A 1GR3A 1X9MA 3BCWA 2ZUAA 4PPZA 4GB32 4JI0F 1ZRDA 2R7VA 5HJYA 3MXHP 2XWXA 2Y6KA 2ZGPA 4WPAA 1DGWX 1FFWB 4K1YA 4ECYA 1OOPB 5KFCA 1JB0C 3QMQA 4W6XA 2YKMB 2E5LF 2VCCA 1M1GA 4CDWB 2OKQA 2HNZA 2EG2A 4IH5A 1VFJA 5L9RA 2V2ZA 2R9LA 5GZCA 2J1EA 1Q53A 2R7OA 2XMTA 4A46A 4LR8A 3OTCA 5DM6Q 1UZVA 2C22A 2PFWA 4RW9B 3CJQA 2KA3A 5IVVA 3LEKA 4YVWA 5FYVA 4IEOA 4I3PA 3HHLD 4FYDA 1QJZA 1QSSA 4DV3J 4JC1A 3S7RA 3BODA 4DPXA 4ITCA 4LF8F 1SJQA 4Y1VA 1VIWB 4LT6A 1C8NA 2OEMA 5BNNB 2R2RA 4JV1A 1RHI2 4P02B 1Q8QA 4DFPA 2GC2A 4O9EA 5BNQA 4NCAA 1QWRA 5KFAA 3RR8A 1HNXJ 2B5HA 4ZKTB 3U14A 1OBNA 2OO4A 5F0WA 3M6WA 4AR2A 4AK3A 3TJ9A 2SXLA 3TYTA 2ATCB 3FRYA 3FBYA 1V6OA 2YH1A 2OH2A 2DTYA 3IKWA 3VB9A 2P5VA 3FZ3A 3W5YA 4URGA 4PWDB 5FY5A 4RW4B 2EFOA 2UUAF 2VDHA 1T6BX 2VGDA 5FZLA 5A3NA 2M8HA 1S9FA 3JSYA 2GN7A 2C9KA 1LAJA 2J1UA 1VQ5S 4TLRA 5C24A 5L7OA 3DEMA 2LM3A 2ZXQA 2CQ0A 5CISA 4XMAA 2DEJA 3HF5A 4WJBA 1SJ3P 1K9MT 5GZDA 2HAFA 3C6TB 4RX6A 3SCKE 7FDRA 3UK9A 3PJWA 5DAPA 1HQWA 2QFJA 2ADBA 1LNSA 5FMBA 1OQDA 4PT6A 2RDJA 3IR6B 4ALZA 2RS2A 5KTQA 3VAIA 2W9XA 4KBZA 3EE3A 2CL2A 4YM3A 1BQNA 5T3NA 2KJWA 1B7FA 5ETVA 1F9HA 2UZAA 1MQTC 2LYVA 5CYYA 5EWSA 3BGOP 2XLFA 4LBQA 4GVBA 2AW0A 2ZBPA 4FI9A 2NXJA 3AMHA 3PUSA 3LPFA 5FYMA 5KFGA 3URFA 1W0PA 3MF9A 4HKLA 1C57A 2IXIA 4EWEA 5D6GA 1CAUB 3CTRA 4BK5A 4ZS3A 3Q8SB 3ETOA 2LRPA 5HLFB 5HK4A 3G6YA 3O14A 2P4EA 4XUQA 2BYVE 4OZ5A 1UY4A 4BCAA 4WZFA 1S0DA 5IAXA 1HA1A 2J1TA 3CO2A 2WSEC 2DNOA 1OF3A 2V9KA 1PO22 1PAEX 1PNGA 3BQ1A 2QQJA 4JV0A 3M8SA 4M5HA 2W92A 5J1EA 5A0YA 2LFVA 3WIUA 3ETMA 1HHTP 3MMCA 1NUEA 1ND2A 2E9TA 5KC6A 2R0FA 2FLPA 1SPBP 2WNUC 3HM9A 2ZBJA 2VZ1A 2DFBA 1D9AA 1XMOJ 2B42B 1SIWB 2HKEA 3OXGA 1S6PA 1T11A 2HWTA 2RS31 3BS9A 1H2VZ 1XNRF 1FPN2 1JI6A 1VAVA 1K3IA 2K1RA 4IRCA 1Z2ZA 3H4BA 2WKKA 3M30B 4WFXA 2LKZA 4LK7A 3N4MA 1GSLA 3KLFA 5ABJA 4GULA 1ALYA 3UDEA 4ZHRB 3KLGA 3PIPQ 1B35C 2DCKA 1AX2A 4G1PA 2ZHMA 2EXUA 4USKA 2PLV2 5K0UC 2MEWA 2MKKA 2BJ9A 1ZAWA 2RE1A 2WW8A 3H5YA 4UW3A 3DHXA 4IQMA 4NRPA 2O1QA 4GB33 1PNFA 3ZVXA 4D3HA 2BP6A 3DLEA 1HIYA 2CJYB 2DH7A 1MS3A 5H9SA 1X0FA 5L1JA 2J1AA 3TA1A 3CCUS 2JECA 4R8UB 1QH6A 1Z7S1 2DY1A 3N79A 5CKMA 4YRDA 1BVVA 3DGTA 3HXMA 5CEHA 3AB4B 2H5JB 3J8F2 3PJXA 2V8HA 1VBB2 5CG8A 3AKTA 4LA3A 4OX7A 4Q8KA 2P6TA 5DDPC 3HK2A 1DZTA 1WG4A 4ZPWR 3M7VA 3T2QA 3PXGa 2RRAA 2G9ZA 2EXHA 3SCHA 3ZLIA 1S1UA 2ZC3A 1CVJA 3E6DA 4BLJA 1NJYA 2AX0A 3D1OA 1LENA 2BOJA 4IE7A 4ECSA 2D3UA 3UT0A 4YGEA 2PAMA 3I0SA 5F6KA 4B3SJ 3THVA 4NLVA 2G19A 3VBSC 3OR1A 4YZ3A 1W06A 4QU1A 5D8AC 1E6VB 3MMAA 3PW4A 2R061 5U47A 2X1AA 4DQSA 4B3OB 1RWUA 2VY0A 3ZZUA 3OTFA 4E27A 2OZJA 1VQ6S 2XMVA 3PYDA 1XNKA 1IKWB 5HMWA 2Z2YB 2KFYA 4J1XA 1Q8PA 2D97A 2ZAHA 4NR1A 2Q8OA 3WHUA 4LF4J 4C4WA 1G86A 2IMOA 3AJYA 1KOHA 3Q0AA 3EWGA 4LO4B 5DUVA 1BZWA 1Q8LA 4WM8C 1KTQA 2Z2MA 4ZVUB 1TL1A 3G2XA 5F1RA 4ZU4A 1LHNA 3WDTA 5AXKA 1F1BB 2EPIA 1R3NA 1NU4A 4EBEA 1IR2A 4YB5A 3S0MA 5AVAA 1SVDA 3OV7A 4S2GA 2HBQB 4R0JA 1H72C 1AX0A 4DWIA 1SIZA 4WFNQ 2R041 4FXGB 5JOZA 1S57A 4FFFA 2YX4A 4E2GA 1Y9MA 3EVMA 3RW7A 4CLSA 4DR6F 4RUHA 1NK7A 3ZZTA 3SCJE 3N7LA 1UA0A 1JOPA 3GHMA 4R9DA 3V81A 2AJQA 3WSOA 1MZ6A 4G6VB 3WY6A 3GZEA 3B00A 2KN4A 3BGRB 4ZP8A 4EZ4A 4XFHA 4B9LA 3PM9A 5DDRC 5D1IA 2LQ5A 4J91A 2IXCA 3UCGA 2C2DA 4CDXB 2D6LX 2H1YA 5A6YA 5LMUF 1SLBA 1DLOA 2P5BA 1ZA2B 2D40A 2GS8A 3MR3A 2W9AA 3IMNA 2F4LA 5FZIA 1HRV2 3MF5A 1T9VA 4ES2A 4ZKAA 3ZN6A 2R7EB 2HLTA 2VD7A 4XBQA 2ZEWA 3SDEA 4BC7A 1YLLA 4RA0A 4OQ9A 1PO23 3PU3A 2B4KA 4LBPA 1UXXX 1TKZA 4RL7A 1JLGB 2QMUB 4GZ9A 2YROA 3GZUC 1IKVA 3M3QA 4AWDA 3H98A 1IOAA 3I2HA 4OZ0A 4BYYA 1YFYA 5IQQA 2XJUA 2JWPA 4PIXA 4CEWA 2XVGA 3BREA 4BPZA 5F7UA 1RAEB 4DV5J 1FFSB 4KGKA 1K42A 4RWXA 1KOOA 3I2GA 5A1AA 2CQBA 5J37A 1FPN3 2OKXA 5CNAA 5FCCA 5DUUA 2X1BA 3HT2A 4CCEA 1HNZF 3MLJA 3MZIA 4L3NA 2K06A 4XAEA 6AT1B 4PF1A 2PLV3 1JK9B 1JLFB 4R25A 2FQPA 4YB6A 1UVIA 3LDBA 5CH7B 1N34J 3PVOA 4Q26A 3VDAA 4A8YA 4CTEA 3TVZA 5CFCB 1ENSA 4XO0A 3S8SA 1NX9A 1AYM1 4CH7A 1C28A 4LRBA 2RG4A 1MLAA 3QATA 1JU3A 3OD0A 1UJ5A 3WF1A 4CH1A 4BXFA 2A3XA 3NKGA 4W50A 3MCSA 1S97A 1RT2A 4NZ6A 2EI5A 1DZ5A 5A3MA 3EJMA 1ICEB 3GR0A 1YJUA 3O1LA 2Q6BA 1X4DA 2AT1B 1S1VA 4RNHA 2VVFA 5E8AA 2JG8A 3PVNA 1UAIA 4YM2A 4XF1A 3J8F3 4AHWA 3M2UB 2UUTA 2VMGA 1VBB3 2JVRA 4LQ9A 3DXUA 5CZXA 4LA2A 4MIBA 3QGGA 4NEZA 4AGRA 1M0SA 4Q0VA 2L9NA 2BMBA 1WHXA 1YLXA 4MT1A 4PCQA 2IXJA 1YHQS 4DS0A 3VZIA 1QIQA 4DUZF 2WONA 1OQ1A 4XYXA 1UN1A 4S0MA 2ARXA 4HT7A 2G0JA 1VR6A 2E32A 3ET6A 2YWGA 4CU6A 4F3MA 1RT3A 1FMD1 4EBDA 4IEUA 2PI5A 3DLBA 2UUBF 4KTQA 3KG4A 2R1DA 1Q8KA 5F5QA 4NCBA 5HCBA 4W6YA 4CPBD 4ID5B 3N6LA 3I54A 3ENVA 3MW3A 3BSCA 4G1QA 2V67A 1TVRA 5L9XA 2AEZA 3VAMA 1OLRA 3GHNA 3LALA 1GZ9A 2CDPA 3M4XA 5FD1A 2I9SA 2MQNA 3LGRA 4BC9A 2N7GA 3D54A 4JTOA 4H4OB 4AI1A 2MTLA 3H40A 1OF4A 4TSVA 2H48B 2FGCA 3R05A 1YHFA 1CQMA 4PUOA 1QJU2 3H3UA 4XPCA 4PRFA 4L0PA 4F0KA 3ZKUA 4AEDC 2QQLA 7FD1A 1C8M2 2J6UA 1AR72 4Y2CA 1KFXL 1JLQA 1QAYA 5LJ3Y 2AEFA 2JNJA 2VC9A 4DF4A 1DY3A 3M6XA 3JXOA 2E51A 4DXLA 1CWPA 5D77A 1B70B 3IR7B 2C5DA 3LFIA 1RHJB 4O4GB 4UWDA 3BIEA 2YBVA 1JYCA 2AZ1A 3H9AA 5A6QA 2B7CB 3A21A 3IAPA 5EV7A 3M8PA 2W7OA 5ETQA 2GVDA 1PK6A 1KFDA 3GJSB 5KFTA 1IKPA 1I5PA 2OP5A 3OXFA 1W2UA 2G1MA 2AJ2A 4GKKJ 4ARXA 2VOPA 1HNIA 1UFLA 1GNZA 4QKFA 3W61A 3I5CA 5BNPB 4PDWB 3GIJA 4Q8FA 3R27A 2HVZA 1HRV3 4FPHA 2RHPA 2ARAA 1AYN2 4WE1B 1H9WA 4CCKA 1ND3A 3MTJA 1EP4A 1T3NA 1DQ8A 1LOBA 3ROUA 4YVWC 3AZZA 2EWHA 3KQ4B 4OV6A 2Z79A 1I51B 4LF9J 1FCAA 3AQPA 2RM22 2IZWA 2DUPA 1QAIA 3H7YA 3EGWB 3K8VA 3UR3C 1R6YA 2ZJCA 2BANB 1OKOA 4FVMA 3UNPA 1RAOA 2R2SA 3UCUP 1JWWA 3ENWA 4ETXA 3M4FA 4P72A 2WWSA 2HLEA 4XBLA 2MQOA 1DP0A 2FY1A 4LBMA 4RGAA 2H4WB 4F2SA 1LODA 3LTOA 5JOXA 3O0XA 4OIXA 2ET7A 5DN2A 2X10A 1C1BB 5BYNA 3FLTA 2M88A 3FDSA 1NXMA 1KQGB 4KGGA 4X64F 2JHEA 2BGOA 4Y1ZA 3IDAA 1ZRFA 3FSIA 2JDHA 1KS4A 2JDKA 2GFFA 1R43A 3FKBA 3OJUA 3LA7A 4FT8A 2NPIA 2RJLA 1WSVA 3WUDA 5L7OC 3HFKA 2JEFA 3LOIA 4YB1P 4C11B 4NMIA 2BRKA 3I0RA 3IBMA 5DMYA 3ITHA 4HL9A 4IFYB 4WKYA 2G9OA 4N56A 5F8GA 1CIWA 1DQ1A 4AVAA 1CC8A 4COWA 3KVAA 1DBNA 4W4MA 3CMQA 5GAGI 3QJJA 4WFYA 2HQIA 4UW2A 1EKRA 1POV3 3ELHA 1GQPA 4PR6A 5DG7A 1D2QA 2QFEA 1RU2A 5KG0A 1Y10A 4XAAA 1HPZA 3GJQB 2YNIA 2YBKA 4ES8A 2ZH8A 4V19J 3MHZA 4MKAA 5KFRA 1HDKA 1RUI1 3ZN4A 4N53B 4I6YA 3QZ7A 1FRKA 4DN0A 1EX8A 1MROA 1RUE2 1RCOB 4LF7J 2HFOA 3ZFEB 1YRUA 1SC4B 3Q8VA 2KT2A 2UY8A 4CA9A 2UU8A 4EQVA 3QGIA 4JKMA 2V5DA 4AL6A 4B3MF 2B9XA 4CT8A 2VMDA 1HKAA 2FJEB 3M3IA 2J7KA 3DC2A 1CJVB 3EDRB 4ED2A 3KD4A 1B3TA 2VPZB 1NMEB 3QH7A 1HWKA 3R1HA 2ZH4A 1DDLA 1LXJA 2UUCF 1WI8A 1QSLA 3QWUA 1W2BR 3J26N 5B4XA 2DR7A 1L7LA 1T95A 3DRYA 5CKNA 1XERA 1PGZA 3T0BA 3NKTA 2XWJB 3LD8A 3NW4A 1ZNPA 4LBJA 1FVSA 1UZYA 3PCOB 3JSMB 5IM0A 5FZEA 1NSAA 5J1NA 2MPFA 3T19A 1ND2C 7AT1B 1UX7A 4Q45A 2HBYB 1W6QA 2ZABA 4OX8A 3NNAA 3MD1A 4MVTA 4A8FA 1UMJA 3P5TL 2ZZQA 4XJUA 2K2PA 1N54B 5KT7A 3LP1B 3JB4C 2H6BA 5FJHA 1UJ6A 2QE3A 1C8M3 1HRI1 3VHOA 3FL7A 4OLPA 5IS2A 3VBHB 1FXZA 1LGBA 5EWGA 5CFDA 5DG1A 4Q0QA 1R27B 3T1HJ 4DUWA 3E5QA 3P45B 5I4MA 2PAEA 2DO0A 4ZLNA 2XI2A 1Y4WA 2BJDA 3TA2A 2JSXA 2UWAA 2LEAA 2ARBA 3VTIA 4A4JA 1QSYA 3QSIA 3IIAA 3GFHA 1NA1B 4QPIA 1KEKA 1VQ8S 2WK4A 2UVWA 5ANNA 2XULA 2DUOA 1US2A 5K14B 3T4HB 3QD6A 2Z2ZA 1M5KC 5L1LA 5FXZA 5BXXA 1YWXA 4OYXA 2FJVA 1R31A 1OYDA 3WNNA 2GH8A 3N9QA 5HXMA 5EWEA 2B4VA 5F5CA 1AYN3 3T2OA 1EV12 1C4CA 1NAEA 2IAJA 1BEV1 3USUA 3MAAA 1RYRA 2JEJA 4H4MB 2P6HA 1SKSA 3PW0A 3D6FB 1WC4A 1W9WA 3UKNA 3K7RA 3N36A 2YNFA 5GMKa 3AZWA 2WABA 2RM23 2XMAA 3SI8A 5I3UB 1YQCA 3MM7B 4GH4B 1O3TA 1HB1A 4J9VA 4KH1B 3ITQA 4ZVHA 5C4WB 2HNYB 3MICA 3VBUA 3GNEA 3FFIB 2BJ3A 5BUVA 4RHV2 1IWAA 3R5DA 4EK2A 1NHVA 3G6ES 5F5AA 2LXFA 2Y38A 3WCSA 4MXVA 1NK6A 4XQDA 1NBEB 1VHIA 4K5SA 2CAJA 4I2PB 1WEXA 3M8ZA 2UV8A 1UXZA 1TL3B 2K0GA 1BWVA 2DNKA 1VQMS 1G4CA 4M3CB 2ROEA 4UZCA 3ISZA 3SFGA 4DINB 3CJRA 3NJYA 4USHA 4JGZB 3SCIE 4YGBA 3CJIA 4USWA 2M8DB 1U24A 1BMQB 1FNMA 3H8UA 4CLTA 2B39A 1QAXA 1U0AA 1LCLA 1ENRA 2HEVF 3S01A 4GJYA 2VFUA 3MF6A 2EFGA 5JMOA 4ED8A 2G4IA 2X51A 1S1WA 4RBVA 2YNHB 4JI8F 2VPYB 3GALA 4C9DA 2XNQA 4R5PB 1VRTA 2Y0SD 3D9BA 1SPPB 2R7XA 5EX0A 2B0GA 4F25A 5FDLA 1UAWA 4AG4A 4CEYB 1NK0A 3KSCA 1CAVA 2GCFA 3D4KA 4DUTA 1D3WA 5I0RA 4Y34A 1KVKA 3MR6A 1YQHA 5GLVA 2LQBA 2BW8A 3NJXA 3TP2A 1RWPB 4EE2A 3W8GA 3UKTA 4URTA 4KO0B 4RQPA 4GMP1 2VV5A 1HQLA 1MMDA 5KHJA 2JC0A 4DY3A 5EP9A 1GOGA 1JZ7A 1XBWA 2CVIA 4TZDA 1MU2A 1W2NA 3ONQA 4LBHA 5LCWL 1RUE3 1S4CA 3PO4A 4YM0A 3JXSA 2JH3A 3M05A 4F7VA 2HBRB 3CCZA 3BSNA 4XCAA 3PIJA 5IC4B 1EKSA 1C0UB 2P17A 2ZKNA 3PLQA 4X66F 1ZA7A 2MSSA 3ZSKA 1R8CA 4OHVA 2MEV3 3FBCA 3O44A 3W7BA 5EHHA 1VBC2 4LFBJ 4FP2A 3K89A 1D09B 5D78A 4JYAJ 3MM9B 1BGXT 4F3JA 2HNDB 2NYIA 4OZXA 2ZHOA 4ZONA 2ZJPQ 5FYIA 5FUIA 1SLAA 3V0AB 1JLCB 4WV8A 3FC0A 3J7MA 4Q1RA 3O1OA 1WWHA 2XJTA 5M2RA 4AI9A 3OUYA 5KT2A 2OXBA 4QX0A 3VDDA 2NQYA 4Q4V2 4CEWC 4G4FA 3DRRB 4ANCA 4Q29A 1PZ9A 1NXIA 3HR9A 3UDLA 5GLWA 2MQPA 3P49B 2MDAA 4HKWA 4KGXB 1DLLA 3UFCX 2YKNA 4FO9A 1GP5A 4RBUA 4DL6A 4PQUB 4DRVA 1H98A 5T14A 2ET1A 1ZRRA 1RTJA 5GAEU 3HHLA 3OXLA 4NMXA 4XOGA 5A80A 2GA7A 3L7OA 1OIAA 5KFIA 1AA1B 4TYAA 4CNZA 2DR9A 1RUSA 2YMZA 5K8NA 1WW6A 3PV8A 3OR2A 5F3CA 2OFGX 2VOXA 2EALA 3AP7A 2NMOA 4LRDA 4YLZA 3HWJA 4GVLA 3W60A 1UFWA 4B08A 5E7OB 4A47A 3BJYA 4ICLA 4HDHA 2E7QA 1UZWA 5KXEA 1OSDA 2FHJD 1Q86T 1QJFA 1WELA 1QJY2 2DNGA 3T3FA 2HWIA 3JCIA 3W1YC 1S77D 3FBEA 4HHUA 3FVYA 4YG6A 2IJRA 2RRBA 5H9PA 3FC9A 1AZSB 2IFWA 3TAMA 2VC1A 1WLCA 2KM8B 4HK9A 2AU0A 4LIUA 1PCAA 3P8BB 1ZS6A 5B7WA 3S7IA 2ZA9A 5K20B 1PMHX 5ERLA 5FPUA 2E5JA 2XLKA 1TU0B 3O7OA 4ASKA 1EV13 1HBOB 2UXCJ 2E31A 4E4ZA 3RJ2X 3KDOA 5DJBA 4QIGA 2AD9A 4JQTA 5C7PA 1IM6A 5A6ZA 1FRHA 4AL9A 4YY3J 5B0CA 5FP8A 3K75B 5I3PA 1X4CA 1EPWA 3M2RB 4RU2A 2ZHKA 3AMNA 3J9SA 1P8JA 3RFRA 1NPRA 1LGCA 4DR4J 3BGAA 3KLEB 4LIRA 2E53A 1S0GA 1UX6A 2B8PA 4H3WA 1R8BA 1RUG2 1RISA 1Y43B 3OLAA 4UF4A 2ASDA 5LOQA 2VNGA 3PVEA 4LIWA 1HWLA 4HVOA 2QBXA 2FDFA 5IT9U 3CQOA 3NAPB 4JV5J 1NY72 2WA3A 1F8VA 2HG4A 5FPAA 4D69A 1ZH5A 4XETA 4JKLA 3GYGA 2H5EA 1PJ6A 4TTGA 2NSBA 1PAUB 3AAWB 1MMLA 4V1Ak 4QGMA 2ZGTA 3KLHB 1GEHA 1ST8A 3CDEA 3WNPA 1WMXA 4FNHA 4JI1J 4ZVRB 3Q8FA 3CMES 3C66A 2VOOA 4K8RA 5E3RA 4RKUC 2CWXA 2HQGA 3DYAB 1F4HA 1CEZA 3CJXA 2EF6A 3R3TA 4P9IA 2LXUA 3KVBA 3PW2A 4BU2A 4JI3F 1G7CB 1BXNA 4ZCLA 1RT7B 1RT1A 2KH9A 2MXYA 2Z8QA 1SFPA 3SKVA 5LASA 5A8RA 2BEFA 4BQ5A 4NLRA 1TZ0A 4XK8C 5E3PA 5C3QA 1JXNA 3SSSA 2AGPA 3V0BB 2BNNA 3CBNA 3IAS9 1CPZA 3D0GE 1WF0A 3C6UB 2DNNA 4C6AA 3NWKA 1HBUA 4FXDA 2NXNA 1NKEA 2EKYA 3CHXA 4DCJB 2BOPA 1PK6C 1SDDB 2XS7A 2C2MB 1ENQA 4LF5F 5APAA 1FK9B 2XHCA 4M5JA 4LKDA 2ZZNA 1RYSA 2QTWA 4DLEA 2VG5A 1SC6A 4ZP7A 5B0FA 4FAHA 4DR3J 4K5RA 5KFMA 4CO5A 2DGWA 1CJUB 4HYKA 2QL7B 2UVVA 4LUBA 2X5IB 1S0IA 3QJLA 4NCGA 2VF3A 1ND3C 2XBO3 1PC5A 2LP4A 1VMJA 3LAKA 1STMA 4NRMA 4JVAA 1WG5A 4N7UA 3LDRA 1O0PA 3R4SA 1UWAA 4ZVEA 2HSEB 1OS5A 1S10A 2LMIA 3M8QB 3SV4A 2ROPA 4UOHA 2W2MP 1I94F 5CZKA 4K2XA 1Y5LB 5DDJ2 2FZ1A 2W91A 1GZWA 4LBNA 3D1HA 2GMJA 4ZVFA 2HRUA 2IBKA 1XU1A 4Q4V3 2DY9A 4CM0A 2QA2A 3NOGA 5AE2A 2GVZA 4U7CA 4RW6B 2F5GA 1HI0P 5IT6A 1WSRA 1Q7LB 3GCWP 4BQ2A 2FIUA 5C2CA 1GTHA 2XHNA 3N7MA 2RDRA 2NXEA 2EKNA 3MAHA 1MS0A 3HT3A 1PVC1 3CKHA 2CQCA 5BJRA 1ZZ9A 3ZXDA 1RJ7A 3MR7A 1GKBA 5FOBB 5I91A 2KZZA 5AE1A 3B93A 2Z30B 4PAAA 3TEHB 3H20A 1JLEB 5FXVA 2E66A 2AX1A 3VCDA 3T5HA 1XJAA 2V4JA 3A3PB 4LF2A 5E2QA 3CCVS 1OH3A 1UZHA 3HMYA 1BUXA 5GADI 4I2QB 4A44A 4LSZB 4X6RB 1V6HA 5C70A 4P73A 1RVF2 4AVVA 3DF0A 1QJY3 4M4PA 4EN6B 1JZ2A 1U0SA 4GALA 2RSQA 2YPJA 4CDQA 1E57A 1IBKJ 2WS91 4Y20B 2RDSA 5F2WA 3TQEA 1CQ9A 4V2VA 3POYA 1W2OA 2WB1D 3BBCA 5C7GA 1RWWB 4X4RA 2BX6A 3S30A 5FZKA 1NK4A 5AJ3F 4DV7F 1U45A 1EB0A 2JG9A 2KJVA 3JTPA 3GE9A 5A2QY 3O1MA 5HBAA 1GWLA 3EXCX 4QIVA 4CLPA 5D4OA 1RTDB 5E6HA 4RR3B 2IVFB 4B9VA 4LR4A 1WNEA 3UDCA 3QT5A 2XQXA 2AIRB 1WCDJ 3O1SA 3NMBA 2DWRA 2DH9A 3UGGA 4LITA 3CJSA 3W65A 2VFVA 4AW7A 1NHUA 1YZ7A 2C1FA 3EXUA 3I2OA 3B78A 4F8AA 4TKTA 4H7MA 2BVZA 2JRSA 4DV6F 3M32B 2PHLA 4JZRA 2CZ9A 3H1WA 4URQU 5KG7A 4TU8A 2Q5TA 4IEWA 2ZFHA 3KT4A 5FY8A 2HIYA 2VG7A 5AFEA 3VLBB 3G82B 4P52A 3AP4A 1LECA 3K0JA 1R1ZA 4DLGA 4EN0A 1WJ9A 1A3KA 5A7QA 3SIPB 2PEBA 4L11A 3SYZA 4J9LA 1ASJ3 1EETA 3LSEA 3J81Y 3WG3A 4BHPA 5SZTA 5GLZA 1PO21 1WC0A 4FKYA 8ATCB 1NLSA 3KCYA 3K4AA 5HV0A 1N36F 2E1CA 3OSPA 2UY9A 1WG1A 4LBOA 3GMGA 3BBBA 3I2IA 5LMNJ 2OUHA 4YOEA 1X5TA 1GV9A 5CABA 3I59B 1J5OA 3J7A1 4B3TF 1RKJA 1BBT1 3U37A 2AR6A 2B9WA 1N0UA 4IE5A 4Y3CA 4KFBB 3W5ZA 4FCAA 1EAYC 5CFDC 4ILMA 3RG6A 4C1XA 4DXRA 1BQPA 4N76A 4RJVA 3R8YA 5FV3A 1L3KA 3VD5A 1TKTA 3GV5B 1MWZA 2K2SA 3DLHA 4K4SA 2FB0A 1K5JA 3MEEB 4MTPA 3WP5A 1XR6A 1LK7A 2VCMA 1W6PA 4NLDA 2OPPB 4MGIE 5FPZA 5GKAC 1X0PA 3GWCA 3MM8B 4BQWA 3GPAA