3THPA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
333
structure length
304
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVRRVKHFGYKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASEKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB homolog 8
total genus 57
structure length 304
sequence length 333
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thpA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thpA01
1OPIA 1UW4A 1D8ZA 2DHXA 3FEYB 2LYVA 2DNZA 1YWXA 3G8SA 3P49B 2DK2A 2L9WA 4TU9A 3TO8A 5ITHA 3UD3P 1KD1T 4FXWA 1X4AA 3D2WA 1HL6A 2AYEA 2CPFA 1X4GA 2J8AA 2RU3A 3VAIA 1YHQS 3ZZYA 3S01A 3G8TA 2KYXA 3U1LA 4CH0S 3CCQS 2DIUA 1WHWA 3G9CA 2M88A 2OSQA 3LQVA 2M2BA 2RS8A 1JJ4A 1H2UX 2DNGA 2YH0A 3CCUS 1X0FA 3SDEB 5GAEU 1FJ7A 3VAHA 2CPXA 1JMTA 1SJQA 2DNMA 2LXUA 2DITA 1UP1A 1RK8A 2X1FA 1U1RA 3S7RA 3MDFA 3R1HA 1QVGR 3P5TL 2XS2A 5H1SV 3MUMP 2MGZB 1X4FA 2CQ1A 2MZ1A 2DGQA 3J7ZT 1SXLA 1H2TZ 2DNNA 2ADBA 3HHNB 3DXBA 1VC0A 3VALA 2NZ4A 2N82B 3CD6S 4U67Q 1L3KA 1KOHA 1NO8A 1K73T 1R8HA 5JVGQ 2MYFA 2E5JA 5LSLA 2OJ3A 2RT3A 2DH7A 5D77A 4OZ0A 1VBYA 2DGSA 3NNHA 2LMIA 1SJRA 2CQ3A 4J5OA 1CVJA 4WKRA 2HGNA 4WFAQ 1SJ3P 2JVRA 1NU4A 1X4EA 2B0GA 4TU7A 2A3JA 1S79A 4IO9Q 1X5OA 2F9DA 2DH8A 1VQOS 3G96A 5CXTA 2DHGA 2RVJA 2MKSA 1M1KT 3S6EA 5GMKa 4UY8T 1U1LA 3FEXB 2MQOA 5GAHU 3VF0B 3CCLS 1QVFR 1H2VZ 5DDRC 2VODA 2NLWA 2HGLA 1UFWA 5DDOC 3ZZZA 2KFYA 3BO3A 1X5TA 1DRZA 4F02A 2XNRA 1VQMS 1VQKS 2RNEA 2KU7A 5EN1A 3NS5A 2MJNA 2KG1A 4F26A 3LPYA 2DHAA 2L41A 2DGWA 3B4DA 2N7CA 1O0PA 2MXYA 2MKCA 1YJWS 4QQBA 2DNOA 4M5DB 1PO6A 1VQPS 3OW2R 3UCGA 1WG4A 2V94A 2DNRA 2DH9A 1YJNS 2KXHA 2MB0B 2LA6A 5LXYA 3EGZA 1WI8A 1UAWA 4CH1A 3H2VE 1X4BA 2DNYA 2M8DB 3CUNA 1URNA 2AD9A 2G4BA 5GADU 2CPDA 1X5PA 2J76E 3NNAA 3CC4S 3NNCA 1KOOA 1YTYA 4TU8A 1OWXA 2CPIA 4QPTA 1A7GE 2HGMA 1M5KC 2MZTA 2M9KA 1RKJA 2FY1A 1WI6A 2HVZA 2CQ4A 2FPHX 2YKAA 2YTCA 2U2FA 4YUDA 2N3OA 3G4SS 4ERDA 5CYJA 1U1NA 2M0GB 3CCMS 5LSOA 2LEBA 3NMRA 2U1AA 4IUFA 1JJHA 2MQNA 2MQQA 2KHCA 3BO4A 2RS2A 3CXCR 1YITS 4A8XA 2X1GA 2M4MA 2PE8A 2D3OR 4V19X 5DM7Q 2E44A 1WG5A 3MI7X 1FNXH 5D78A 2MZSA 3US5A 1BY9A 3U1MA 2GHPA 2CQ0A 2M70A 2DO0A 3VAFA 2XSFA 4C0OC 2AYMA 1P1TA 3CCRS 2J0QD 2CJKA 1YJ9S 5FJ4A 2CQGA 1FHTA 3I56S 3HI9A 2BOPA 3UCUP 4WCEQ 4ED5A 1VQ7S 2I38A 2N3LA 1X5SA 1WWHA 2CQPA 2UP1A 3CCES 1VQ5S 2QEXS 1WG1A 2MMYA 5JVHQ 2DISA 2AYBA 2LEAA 1K9MT 1S72S 2ZJQQ 2VOOA 2I2YA 2E5GA 2KRBA 2MGZA 3IRWP 3BS9A 1F9FA 2CQBA 3EX7B 2ZJPQ 2KM8C 2XS7A 2MZJA 3R1LA 1HD0A 3R27A 2DB1A 3Q2SC 4LIRA 4CQ1A 4P6QA 5LJ5Y 1YI2S 1QM9A 2F3JA 3SDEA 2JWNA 2M7SA 2YWKA 2ADCA 3THPA 2MKKA 2JRSA 4PR6A 4RU2A 3MD3A 3VAGA 4W90B 1WHYA 3VAMA 2MQPA 4IOAQ 2MZRA 5HO4A 1M5OC 2LCWA 1B7FA 2HZCA 2XB2D 1A9NB 1U2FA 3MD1A 3CF5Q 1W2BR 4WF9Q 1WELA 2DNHA 2KH9A 2MQMA 3P3DA 1AUDA 1G2EA 3ULHA 2KXNB 3I55S 1M90T 4C7QA 1H6KX 1VQ8S 3RW6A 2CPEA 1NJIT 5IM0B 2KG0A 2RUGA 2LA4A 1VBZA 3MURP 2MSSA 3MXHP 2G0CA 3CC2S 2L08A 2BZ2A 1VQNS 3K0JA 3BO2A 3CULA 1VQ9S 2DGOA 2MY7A 2OSRA 3N9UC 4PRFA 3Q2TC 2X1BA 2KRRA 2CPHA 3CTRA 3TP2A 2SXLA 1U6BA 2KI2A 1M5VC 1WF2A 2MPUA 3CCJS 2F9JA 3BEGB 3UE2A 1DHMA 2MKJA 2M52A 1OIAA 1KQSR 3S8SA 1JJ2R 2DIVA 2CQHA 1WF0A 2ZJRQ 2DNQA 2DNPA 2CPJA 2PEHA 1Q86T 1FJCA 1K8AT 2CPYA 3PIOQ 2J0SD 2HYIB 1WHVA 1KC8T 2D9OA 2FC9A 2G1DA 1U6FA 2K8GA 5IQQA 2MKIA 3CCVS 2EK6A 2CQIA 3CPWR 1WTBA 1X4DA 2KM8B 2DGUA 4Y0FA 1U1PA 3IWNC 3VAKA 2EK1A 2CPZA 2O3DA 4PKDB 3CMAS 2MSTA 4LJMA 1VC6A 1YIJS 3RW7A 5LJ3Y 3MUTP 3EGNA 3MUVP 3UD4P 2KN4A 2OTLS 1Q81T 2XNQA 3PIPQ 2MY8A 2RQ4A 1FJEB 2MZQA 4UQTA 2LQ5A 1D9AA 4LMZA 1ZZFA 2DNKA 1U1MA 1U1QA 2FHOB 2MKHA 1U1KA 2DO4A 2DHSA 2AYGA 4YB1P 4IOCQ 1VQLS 2XS5A 3G6ES 2DGTA 2KXFA 4CIOA 1FO1A 2LKZA 2JVOA 1WF1A 1OO0B 3CC7S 2DGVA 1N54B 1VBXA 3SMZA 1SJFA 3SXLA 3B4MA 1VC5A 4EGLA 5LXRA 2YH1A 5GVQA 1Q7YT 4WFBQ 3THTA 5DDQC 5CA5A 2MJUA 2D9PA 1N88A 2QA4S 1IQTA 1P27B 3J7YU 2M8HA 2OTJS 2RQCA 1DBDA 2WBRA 5DETA 4BS2A 3CMES 2CQ2A 1ZZNA 2DGXA 1Q82T 1U1OA 4YOEA 1R8PA 1WHXA 4QU7A 2JX2A 5IFMA 3CCSS 1FT8A 1N8RT 2VOPA 3V4MA 1X4HA 2LECA 4FXVA 3UCZP 3DLLQ 1PGZA 3MOJB 2QFJA 2FC8A 1VQ4S 2OIHA 1N52B 2CQCA 4Y00A 2DNLA 4TLQA 5MLCV 4QU6A 3UWTA 4WIIA 1HA1A 1X4CA 1HD1A 2E5IA 2MHNA 1WEZA 2VONA 5DDPC 3H2UB 2RRBA 1VQ6S 4C4WA 5DM6Q 2KT5A 2K3KA 2X1AA 4F25A 1XN9A 2KVIA 4OZ1A 1WEXA 2LXIA 5HL7Q 3VAJA 2CQDA 2EVZA 1SJ4P 2GO9A 2MQLA 2Q79A 3G71S 1FXLA 2ERRA 5IM0A 1M5PC 4Z2XA 3JB9k 3NS6A 4WFNQ 5BJRA 1ZH5A 2RRAA 1WEYA 3TYTA 3P6YC 3L3CA 5GAGU 1DZ5A 2E5HA 4ZKAA 4W92B
chains in the Genus database with same CATH superfamily
4IL7A 3H1MA 1ZZ8A 3GZ7A 1H9PA 5FP9A 2DNZA 2VUDA 2WT0A 3G8SA 5FYUA 4X2BA 5FUPA 2ZABA 1AZSA 1AXYA 4NX9A 2L9DA 2MQ8A 3M8LA 3KCXA 1NB2A 2LM3A 1LQ9A 1PGSA 1HXS1 4CYUB 3C66A 4R5PB 3RZAA 3CVKA 1RUE2 5F8IA 2OSQA 3OVSA 2UXCJ 5C4WB 4PCQA 1W2UA 4ANEA 4IE4A 1UZVA 1JZ8A 3GSIA 1XXNA 1LESA 4URQU 5KT7A 5GAEU 5FFOC 2I6WA 3HT0A 5ETTA 2CPXA 2WLPA 2QZ3A 4DEQA 2DNMA 5BNPC 2VBWA 1RYSA 3PYDA 3MICA 3ISNC 2UYAA 4RW9A 4F2RA 2XS2A 4DSFA 1K1QA 3TARA 1SL0A 3FGVA 1A78A 4XCBA 4PG4A 2ET1A 4ZPDA 1SC4B 4MGYE 1F8VA 5J2PB 3H5SA 1V9OA 1PM7A 3CD6S 2E1AA 4ZVGA 2V8PA 3O1RA 1R8HA 4F36A 4AHXA 4QOTA 3RR8A 1QIQA 2OJ3A 3PM9A 1V5IB 2H5JB 1VBA3 2IXCA 4KC5A 1RE1B 3GE9A 5APAA 1RL3A 3TZZA 1I5ZA 2V4AA 5FPZA 1HRV3 3V0BA 2BNNA 1WLDA 4DLGA 1FRXA 1KQRA 1NU4A 1X4EA 3PUSA 4AL5A 2ZA9A 3I2GA 3IZOA 2DHGA 3OB8A 2XPJA 2NQPA 1MSWD 2RR11 2JB4A 1OF4A 3ZFGA 1PZ8A 4BU2A 3NJVA 4JKMA 3J26N 2GQQA 3ZFEC 3CDWA 2VQEJ 3BM7A 3PNAA 5CA6A 3QBCA 5DDRC 3MIGA 1SLBA 5DQIA 1FXDA 3NO8A 1O3TA 4CLZA 1X5TA 3GSDA 3GG1A 4V2WA 4F02A 4NRMA 1BVVA 4OFGA 4O0IA 3B4DA 2WO7A 4KGGA 4PQ9A 4YGBA 2C4XA 1EJ7L 2Q30A 1KRPA 2F8EX 2YPYA 1QJU3 5CYQB 2V94A 4BLGA 4LF5J 5C9AC 3D67A 1RUD2 4BMEA 2KXHA 5C5JA 1VBE1 3LSDA 2VD7A 2RMLA 3SCJE 1VBB1 1X4BA 2X5IA 5J98B 2HNZA 3JU9A 5I0DA 1HNVB 4DDFA 2M8DB 4MFBB 1N34J 2MLXA 3BPSP 3LAGA 1V6MA 3IR5B 5K14B 5F2SA 4AYBD 3RYLA 4O61A 4P2FA 3TB0A 2I5JA 5AC92 2G13A 3AXDA 4Y34A 2BV3A 4N77A 1U1NA 4JI2J 1N5YB 3KVAA 4BM8A 4DV7F 1OA4A 3PYGA 1KLMB 4UAPA 4LXLA 4OYPA 1YITS 3NRUA 4NA1A 2XYHB 1DP0A 2UVUA 2VCAA 1RUI2 2P9GA 1KFXL 3M30B 1DG6A 1AR71 1R31A 2Y38A 1RHUB 2GHPA 2DO0A 4XUQA 4LF7F 1FNYA 1LGNA 5CVRA 2XL7A 1YJ9S 5AXNA 2RHPA 5FJKA 4HH1A 4FXDA 2VMDA 4LF7J 1UMHA 4ASLA 3CDAA 5LATA 1OXCA 5FLXU 3SZ2A 2YPDA 3OUIA 1K44A 2C26A 2IUWA 4DUZJ 2XLKA 2AYBA 1ZX5A 3ZYJB 5A7SA 1JH5A 1ZYQA 1ZTTA 3U4SA 1PNGA 3EX7B 4Y1ZA 5FPAA 1OFSA 3VBHB 4KH0B 4F7ZA 3UN5A 2C22A 2MZJA 4UW4A 3DOLA 4HYKA 1YYNA 4A4AA 3KJVB 3ZO0B 1YI2S 2WBKA 1QM9A 2F3JA 4W6WA 2W2MP 4PDWC 3S6PA 5F7UA 3L7PA 2B5HA 3IFEA 3ITHB 1RWWB 1H1IA 4B4QA 3AMHA 1B0VA 1XU2A 1NK7A 2OKXA 4FPGA 2QQLA 1RINA 4M8LA 1TQ5A 2GMHA 1LNQA 3TEWA 4IH7A 1RT1A 3EHKA 2MQMA 2HLEA 3LDRA 5FUIA 1RUC3 3IPVA 4DZDA 2NYHA 4XXPA 3B02A 3E97A 3TQ1A 4NLGA 1VS3A 4LPLA 4BK4A 2EFQA 1Q56A 3WQ7A 3VD9A 4DXZA 4N7TA 1Y4WA 1HWIA 4FBTA 1N6QA 1Y9GA 1J1TA 3A4UA 3IWZA 1NSKL 2RDIA 4LBQB 3FBEA 4LR7A 1HKDA 2COLA 2Z2SB 5BNQA 1X8EA 4CDWC 5T5OA 2JG8B 3A3PB 2ZDOA 1NYWA 2CWSA 3VBOC 3T1HF 3K46A 1AR93 2QRRA 1JJ2R 3D54A 1R1A3 4DR3F 3EQEA 3AXKA 2DNQA 2DNPA 3I5AA 5T5LA 5L9VA 1XBFA 4DNYA 2XGPA 4HKWA 1JOJA 3W64A 2VMHA 1WHVA 1FXZA 1KC8T 2NZCA 1LOCA 4USMA 4ED4A 2AV5A 3FCWA 1TMF1 4BIOA 4IG0A 2V6AA 3OGVA 2YNHB 5T3NA 4BDVB 3IWNC 2C5DA 2ZHOA 4F4WA 2HQGA 5A3PA 3FZ2A 1WD3A 1RA6A 3TAQA 1BD6A 1I5OB 2GNTA 2XYPB 1YFUA 5CFDA 2QTWA 3SQGB 4K4ZA 3I2IA 5KAKA 1MS4A 2WABA 2BKPA 3GF6A 3MW4A 2RS52 2G2YA 4COWA 1V9U3 1Q0NA 4Z7CA 4K40A 4DBQA 2WT2A 1SC1B 2B5JB 1QNWA 4KL1A 4FDFA 2DO4A 5FIXA 3M2VA 3FC0A 4LFBJ 4C3LA 1RT7B 5L9XA 2BRKA 4EK2A 1N54B 3A0KA 4TQRA 4ET7A 1VBXA 3OYWB 1EV13 3KDOA 4KT0C 2XJUA 1CSJA 4JTNA 2VZTA 1RYYA 1FKOA 4LIUA 4LBNA 4P5HA 4M5KA 4M3CB 2QA4S 1UX6A 2CIMA 2HWC1 3WP4A 2ASLA 4H7MA 2Q8OA 3DRYA 1HW8A 2HYXA 4YG0A 4A8YA 4BS2A 3J7MA 1AW0A 2B7YA 4YW4A 5BNOB 3TA1A 1PJ5A 3KMQA 1ZBA2 3DRPB 3D1OA 2JX2A 4QU7A 4XJ9A 2PO4A 2B3TB 4DL5A 3NJXA 4H14A 5C2CA 1KJRA 5HROA 2RVAA 2H1YA 4S2DA 4NMLA 1CULB 5A1AA 1GP4A 3JD73 4MK7A 2PFWA 4NIDA 2EXKA 2B9VA 3I0RB 3QH7A 2FCVA 1OS5A 4HEA9 5CD4H 3HHKA 2QNKA 4HG6B 1W39A 5L1IA 4CDUC 4E2FB 1UKGA 1YJRA 3CJRA 1C3HA 1RUE3 2D43A 4ZS3A 5JXHA 1DLCA 3OY8B 2XHCA 5ANQA 2ZVIA 1N3QA 4W6XA 2CNNB 5KFWA 2PQQA 2ZKLA 1XOYA 2HRUA 2P3JA 2B4KA 3T2PA 4IETA 3UN3A 3K77A 3JSMA 2QZ8A 4CTAB 3AZVA 4KGZB 3M9OB 2W01A 2OP5A 3MLKA 1F2NA 3H50A 3VD5A 2RM23 1HYSB 1A34A 4CNYA 3GBWA 2OMOA 5LT5A 2VW2A 2BKOA 3TVYA 2FDFA 2HHPA 2UUCF 2EAAA 2DCKA 2CPFA 5KFGA 4PEOA 1TV6B 2ZGOA 2W91A 5DQHA 4PWDA 4QIGA 1UVKA 1Y5IB 5KFSA 3C3LA 2RR12 4J9PA 2QL7B 2MLYA 2C2RA 1X33A 2XMAA 3NAHA 2UUTA 3WNLA 2O5DA 4Q4V2 4YGEA 2BEOA 3C6UA 4Q43A 2HQCA 4DV2J 1ZPVA 2XB6C 2X1FA 1QXPA 1WCUA 1CAVA 5CH7B 5JXIA 4KRWA 2VY0A 3R1HA 5H1SV 2BW7A 2OPPB 1S6UA 3MUMP 1YQ5A 3VCDA 4FF3A 3CDBA 4ZCIA 1NHKL 4YFUA 3OTOJ 4X65F 4D94A 4ZONA 1RI7A 2ZBIA 1H2TZ 2Z42A 1VC0A 3USUA 3INAA 2EIDA 3GYXB 5IV3A 3HD8B 4RW8A 1QAJA 4M5HA 2OD6A 5D8AA 5DDJ1 1A6LA 1R093 2GJ2A 3GQCA 1QDCA 4A48A 2CQ3A 3JYTB 4LBIA 3CJ0A 2NPFA 2WNOA 3POBA 1CGPA 1GQPA 4N43C 1S79A 1VLYA 3ZFVA 2F40A 4FPHA 2GCFA 4RUAA 5FP3A 2W7AA 4KQZA 1ND2C 3DYAA 4HFSA 5EHDA 3KK2B 3G6YA 4K4YA 2WSEC 4IXLA 4LULA 4HL0A 4QIFA 3BUCA 3OL9A 1H3DA 2QMUB 4Y22B 4DPXA 2HGLA 4NRUA 3LAMA 3Q8QB 3W9HA 4ATNA 3VGTA 2XCAA 3U1NA 2X29A 4DL4A 1CJTB 1ND2A 1YJWS 2F8MA 4QQBA 1PO6A 5K8MA 2B8PA 2W52A 2WZ8A 1V3ZA 2P8IA 2WOMB 2ATFA 3C6TB 1YJNS 1TP7A 2BGCA 4PZVA 3RAMA 4JRAA 4F4YA 5B0CA 4V19J 3H2VE 4L92A 3HHLB 5EGYA 1MEC2 2W7OA 1CJTA 1LU2A 1SDWA 2BYCA 3B9IA 4QW9A 1FE4A 2QLJB 2BX6A 2XM3A 3M8YA 3QAEA 3NNAA 3CC4S 1GZWB 2CAUA 1AA1B 2JD9A 1KQGB 2ORXA 3MIFA 5LA0A 2HVZA 5HAOA 4ERDA 5FCCA 1HBMA 4OUEA 3BSAA 3ZFEA 1GZWA 2GIRA 5F5IA 1R6VA 3NWGA 2VIHA 1DFQA 2ZH5A 2D3ZA 3C7FA 1C8NA 2VZPA 1ULGA 1HBUB 1TMJA 2WSUA 4ARXA 4GAZA 5GLZA 2FJBB 5FDBA 5HCAA 1QSLA 1CQ9A 2HNDB 3HVDA 3E01A 5EWFA 2XVLA 3CJIA 3KLHA 2RJZA 4IGOA 1XC9A 5FJ4A 1QJY2 4MT1A 5JI9A 5LK7B 3I82A 4P75A 1U45A 4IEVA 5FJHA 1QOSA 1XMQF 1RUC2 1WKYA 2WINB 4AVTA 2QQKA 3CJTA 2VMIA 1VQ5S 5L38A 4FP2A 1F1BB 1E57A 3DLEB 4BQ3A 1W99A 5FPBA 1XE8A 1O7FA 5JLVA 5FREA 1JNRB 4J9OA 2ZJPQ 3HX9A 5C42A 3T5KA 3K2YA 1E5HA 2V0NA 2HNZB 2Y9HA 4MSVA 2WZR2 5EX3A 1SBFA 2PHDA 5G0RA 3DLKA 2M7SA 2C2DA 4GMP1 4KE5A 4KMQA 4EN0A 2YWKA 2ZTNA 1T02A 2HWHA 3VAGA 2PMWA 1VBE2 5AVAA 2H5EA 4BQ2A 1VQYA 1W04A 2HZCA 2NXJA 1RUF2 5E5NA 4Q44A 2JEIA 5A33B 3DOKA 4I6YA 3U02A 5A3UA 4JI0J 1JZ6A 3OBIA 3MEGB 1SC3B 3M1VB 5KFCA 2R7WA 4LEJA 4XFGA 1XYNA 2GN3A 5GMDA 3MURP 3T1YJ 1PVC2 5KHIA 2V63A 4OV1A 1YJTA 2BW8A 1JOPA 4K20A 3MECA 3GP9A 1REGX 2FD2A 2H51B 3KV6A 4PRFA 2C1EB 2FD8A 1LOGA 4IFVA 5FY1A 2LS6A 4PF5A 3BTZA 2AEMA 1ODMA 3TP2A 3DGPB 2VD3A 4OZ2A 4DCJB 4HT7A 5HMWA 1JKHA 2IC3B 2R7EB 2VBXA 2NREA 3GV5B 5D8HB 2R7VA 1R6YA 3BOPA 4WTOB 2J1EA 2J7WA 1P8JA 3RZGA 1FRHA 3A8JA 4NE9C 1QJX3 4IE6A 3NAPB 1EV12 5CHCB 3CKHA 1FRKA 1AB8A 1U6ZA 1FOD3 1ZYBA 3DHXA 2BNOA 1RIRA 1YHFA 2HRTA 2TUNA 2G1DA 2KZMA 1QJY3 3Q0AA 1PILA 3RYKA 4IGQA 2ZPXA 2ADEA 3C7EA 4K4UA 3CNAA 4XILA 3GCWP 4K2JA 3IAS9 2HBQB 1EQMA 2VBZA 3CZUA 3FCVA 4LJMA 4GWIA 3UD4P 1KFUL 4AGVA 3U4XA 4TWTA 2BQPA 5I3PA 4JV4A 2XNQA 2D98A 3HKWA 4QPGB 3PW7A 4AEDC 2MZQA 2F17A 5IAXA 3CSKA 3U1XA 5FY8A 3AYCA 3VVUA 5LY1A 1L3TA 1VPHA 2JDKA 3F44A 3D5OA 2OMLA 4UF0A 4JGZB 1NCQC 2W87A 3V64A 3AP7A 2DBNA 1PO23 4FOWA 3UV9A 3KT1A 4CDWA 1VJWA 2GHWA 4IG0B 1B0PA 1FI4A 3Q86A 3EVWA 3H1YA 1PX3A 1RT2A 2FVCA 3MMCB 2ZKNA 1BQMB 3OV7A 2ZH1A 3K59A 2IJFA 3RBXA 4NWVA 3RFRA 2QLWA 1HLCA 2WBRA 1X8MA 3MW2A 3SNMA 2B8MA 1PM4A 1CPMA 2VPXB 5A6YA 1XMOJ 1F3FA 2DCJA 1TVGA 5C4WC 4OYXA 2YX4A 2HYKA 1S12A 5FXZA 5HK4A 1VOMA 1AX1A 5IFMA 3VBUA 4DXRA 2OFGX 4AVAA 2B4VA 1X4HA 3MR7A 1ZBA3 3EZ5A 4X64J 2WR9A 2A6VA 2BJ1A 2ZH2A 4B9SA 5MLCV 1AR73 2CKWA 3ACLA 4L99A 3ET6A 4QHZA 2JL9A 1H2MA 1ONAA 3BKFA 4L9BA 3H2UB 4CT9A 3KLVA 1MS3A 1TFWA 2E33A 3SCGA 1XJAA 2RR13 4OQJA 5KG7A 1X36A 3UT0A 2HWD3 2ZHKA 4AVVA 4IEOA 5C33A 1UVLA 5F3IA 4PABA 1J3RA 2GO9A 3T3YA 2W24A 4XJAA 3Q8AA 3SFGA 1SUQA 1KEKA 5KT5A 4OIXA 2P2CB 1C0UA 2V2ZA 3EICA 3ZFGC 3D0JA 3OJBA 2RRAA 4OZ3A 3M3OA 3W9AA 4B1LA 5KR7A 4GWNA 4ED8A 4BXFA 4M0HA 2G2OA 3H98A 2ZGQA 1FMD2 1K5MB 1LOAA 2F4LA 2C1FA 2OQ6A 2HSEB 2EG1A 2OQ7A 4FPCA 4QX5A 2FIUA 4ED3A 4LRFA 4RWWA 3MF6A 5GAHI 3UL2A 3QATA 1LOBA 4HZFA 1YGYA 1OQ3A 1FKPA 2UVWA 3DECA 3M6VA 2C2NA 3VAIA 4HVQA 3UNPA 3EXUA 1ALYA 3AL5A 3W8GA 4MZUA 4G1QA 5DABA 3OFEA 1QGLA 2A75A 4GH4A 4QT6A 5KG4A 3CCUS 4I2OA 5CNAA 2FVPA 5F8MA 1BUXA 4DN9A 2LXUA 5LMNJ 2XZWA 5IC6B 3ZTPA 1F4HA 2Y0OA 4U9RA 1PAUB 3HHNB 1J5OB 4DXSA 1KOHA 3N9QA 2EC2A 1Q8BA 3BB6A 2MYFA 2Z2ZA 4HL9A 2DH7A 4XACA 4F67A 5FY7A 4C3MA 4DU8A 4OZNA 1Q16B 2BDRA 3POWA 2OZJA 3GR0A 3GZTB 1NKCA 1RT4A 4ECXA 4B3MF 1SV5A 2XLAA 4P9YA 1HRV2 5KFMA 3TN91 1EETB 5FYSA 2LROA 5CYMB 4AI0A 2QCSB 2MQOA 2I07B 3AOCA 3QWUA 4B3OB 1TL3B 4C97A 1FNZA 3LDKA 4BQXA 3BF4A 2W9BA 4TZDA 4CDXA 3VDDA 3C16B 4YGDA 3BO3A 1NK9A 2A3WA 5IVJA 4PIYA 1ZAVA 5FOJB 3U0ZA 4Y28C 2AYHA 4QPXA 4B3OA 2VHGA 4C1XA 3T0AA 1QWRA 1VQPS 2YWGA 4WE1A 3SYZA 5FMOS 4OHXA 3N6NA 4CDXB 2J8SA 1JZ2A 3ZN6B 4OUSA 2BANB 4CLYA 4B9NA 5HVFA 2KL8A 5BPXA 2Y60A 2DKOB 3DN7A 3BTXA 1UY3A 4N7IA 1HPZB 2YGLA 3VZHA 1RUD1 5FLXY 1XR6A 4YG6A 4Q8FA 1M5KC 1EUTA 1S1UA 1VBC1 1L7QA 2EI5A 4BLIA 3OFGA 5GADI 4HK8A 2YKAA 2ZEXA 2NZ9A 2NP0A 4QDSA 3IWLA 2MQNA 3LP1A 3M70A 3BO4A 1R0BG 4JI6F 5DQGA 5A7NA 4DF8A 4Q26A 2AX0A 2DR5A 2W25A 5FLIA 3M9NB 3PNIA 4NRQA 1S4FA 3MM9B 3MI7X 3US5A 1GX5A 2OFHX 2M70A 3H59A 3CMQA 4DV1J 3VV1A 3B01A 5K9YA 4CPBA 2BKNA 5JUMA 2OUHA 1U09A 2CQGA 1FHTA 3PW5A 1RUSA 4LSZB 2K1RB 1SKSA 4QIWD 1BYHA 1HDKA 3ZN4A 1O3SA 2HNYB 2YKQA 2CQPA 2J5AA 1J5EF 2GC0A 1IG3A 1UKUA 5JVHQ 5E0OA 1S72S 3ZFEB 3CGIA 4YW3A 4ES3A 3NNMA 1M5HA 4DV6J 4FXKB 1WTFA 2DB1A 4ENOA 2DCZA 1HWKA 2GNMA 3C19A 4X4TA 3ZTOA 4NLYA 1Q4RA 1ENSA 3V0BB 2MQPA 1Q8SA 4EZHA 3TAMA 4IOAQ 2KKHA 5I91A 1XYOA 4AXOA 5GKAC 2OPRB 1TAUA 4W98A 4RUCA 5FP8A 2B9WA 4K1ZA 4CDUA 3AAWB 2KH9A 2P6SA 4ECYA 1AUDA 4N53A 5HI0A 3E1F1 1M90T 3I55S 4KHPF 1G8WA 3MAQA 2XWXA 5G4DA 2FLLA 1SIZA 2R9LA 1H7XA 1O6UA 5DZGA 2RUGA 1O51A 4BWMA 1O5UA 3VHOA 5LA9A 3BKZA 1KQFB 3CJIB 2YFZA 1CJDA 4BK5A 4GH4C 5EXOA 4B9VA 3WDUA 2BACA 1IPKA 3OL8A 4AFCA 4AEDB 2JICA 3IMMA 3UGGA 2BQRA 3WG2A 1SQEA 2FZGB 5H9EK 4DFKA 2OPSB 3AYAA 2MKJA 3A8IA 4P14A 2WAQD 4W4ZA 5LB6A 1ZM4A 4XQWA 2FLNA 2JJ6A 2BJ3A 2QDRA 3OGRA 1VI7A 4LHKA 3U07A 1CQMA 1QJX2 3GJRB 3RSJA 3ST7A 5A0YB 1R1A2 1AXZA 3UKNA 3FRYA 1P1LA 1W26A 1RUJ1 3NG8A 4YB7A 4MV2A 4Y0FA 3IWXA 4LF4F 2W08A 3BI3A 2YDEA 3NMBA 2E7WA 1CS4A 2WVEA 2XO7A 1MVQA 5JXSA 1E6YB 1RTIA 5BNNB 4MLOA 4N5SA 2OUGA 3ZVXA 3JSYA 1SFPA 4L0PA 3KGLA 4LO5B 2HIYA 3T6BA 2NCKL 2ZUAA 4UQTA 1UEVA 3NXZA 1GMUA 4YEAA 3FJSA 5KOWA 3RMYA 1X9PA 5KFHA 1WZXA 4CRJA 4QWDA 2IAJA 1AYN3 4DV7J 3JD71 3HBZA 1XNQF 3OFHA 3H4DA 3RJRA 2D7SA 1OOPA 5T7LA 1Z1ZA 2VDHA 1F2HA 5CB7A 3GV8B 2QVSB 2IYGA 4K6BA 1RYRA 4UF4A 4RKUC 1YWKA 2C24A 4QB6A 4NJ4A 1GQHA 2VQAA 3SH3A 1P27B 1TZ0A 5DO2A 4DR6F 1DBDA 4QQHA 3FSXA 3PJ9A 4TN7A 1A0OB 1R8BA 3R05A 1O5JA 3HKZD 2HVHA 4K8FA 4UW6A 3NAPA 4K3UA 3T08A 1FMD3 2F63A 5FR3A 1NMEB 3O8WA 3I2HA 5FDLB 5DZEA 2HWB2 1YX2A 3MIEA 1U25A 2F4FA 2OX0A 1Z4UA 2Q43A 2OI2A 1FAYA 1GFF2 1RISA 1WKKA 5A8RB 5ACA3 5D8AC 4AI3A 4PDWB 1PZ7A 1W6OB 1NCQA 2VH9A 3LE0A 4LUKA 1UN1A 2PFDA 6FD1A 4JI7J 2IXLA 5LEKA 4MVTA 1M5PC 5A8KB 3DRRA 3IXQA 2QSWA 3RZHA 3PG9A 3JB9k 1MW7A 4JI7F 5FZEA 3FDSA 3M6UA 1WBLA 2IWGB 1QDUB 2JKBA 3RGBA 2VUJA 3RTVA 1R27B 4O9EA 3GZAA 2JX9A 3QZ7A 1NJYA 2ZD1B 2JEJA 4OZJA 2PDAA 5E3QA 3MEKA 1YWXA 1HHSA 2VB6A 5D0RA 1U8SA 1XNKA 4A8QA 2UV8A 1VGYA 5T54A 3M32B 1FV2A 2DUQA 1Y9OA 5BNPA 5FPLA 1LJ7A 1KLMA 1HQEB 5ETRA 1S97A 4LKEA 2D3O1 4TVAB 2V4VA 1WW6A 2HVIA 2QGFB 4K21A 2IYIA 4Z37A 1NLKL 2B8QA 1OUSA 2IPOB 3G9CA 4OX9J 1NY71 2RS8A 1JJ4A 3IT8A 3V6DB 1D4VB 2C28A 2E31A 5THWA 2QTWB 5CFDB 3SQGA 3RB0A 4DWIA 2UV8G 2WQ8A 3HDSA 3Q8VA 4AUKA 1NJWA 1U5XA 3N36A 2QA4G 2HEYF 4PQQA 3H7HB 1AR61 5FUNA 4IEYA 3H90A 3JUUA 2ADBA 3AODA 1ULCA 2NZ4A 2RS12 2XHWA 5JOXA 4G9SB 1L3KA 3RJMB 3BH6B 2ZBQA 3ZNJ1 1LGBA 2R49A 3TBDA 3I3DA 3GWCA 1VBYA 2QL5B 1NHVA 1TK0A 2J9EA 3CBNA 1WA6X 2JH3A 2PHFA 5KG5A 2VTXJ 2FLOA 4NWWA 3IG1B 3TRSB 5FP4A 2AKWB 5J1EB 2DPIA 2XJRA 2PHWA 3F73A 2ZAAA 1WW5A 5M2PA 3IIAA 1P9QC 2N4CA 2RHSB 4ZP6A 3VF0B 5I8YA 1JLQA 4BBYA 1CZSA 2N7YA 1UVNA 1PC4A 1BLZA 5IS2A 3W58A 2GZOA 2H6CA 1LK5A 3IG1A 3FMBA 5C7GA 4R4ZA 2VH7A 3L7OA 2ZGLA 3M8QA 1VQKS 5EN1A 3NS5A 2KG1A 3KGZA 4EN6B 3HD1A 2JC1A 4AQYJ 3PFOA 2LQJA 4DRRA 5A3NA 3EO6A 2R2RA 2ZXQA 2H4WB 1JODA 4V2VA 1ZA7A 4BISA 1O91A 5F9TA 1WI8A 3DI6A 3QAUA 1IM6A 2W1QA 4R4XA 1H1AA 3RI8A 3RAXA 3P96A 3K2OA 3OD2A 4NYPA 4OI3A 4JV5J 2CPDA 1F3VA 1X5PA 5CYMA 2A10A 3NNCA 4LBQA 3CO0P 1DGWA 5EPAA 2F4VJ 4QKBA 3JSMB 1CESA 2ZACA 4N8MA 5E6HA 4ECTA 4IR1A 2YBPA 1IBLJ 1L3VA 4CCKA 1TNFA 2DY1A 4D0QA 4B1MA 4GKJJ 4RO0A 3EWGA 4I2QB 4A3ZA 5DZ7A 4X8NA 4DRVA 4B9TA 3MM6B 1A8MA 1GXLA 4FPKA 4YW2A 4COYA 1AJKA 2GJIA 5D78A 2BM1A 1T2XA 2R8GA 4RW8B 2AZ5A 2XSFA 3M8WA 3IDAA 3POSA 1S7IA 1GP5A 2J0QD 4CSWA 1FPN2 4GXLA 4YW5A 1LK7A 4UT5A 4QPGC 4SBVA 3ZXAC 2ZH7A 3BGOP 4EFAC 2OA2A 1L7LA 2VG5A 3Q8RB 4MXVA 2JJ4D 1NAQA 2UP1A 3CCES 4QPIC 2W2IA 2IRUA 1SQ4A 4M4RA 2BVVA 3M2UA 4JRLA 3Q83A 2R7XA 1QNYA 1T6GC 4IESA 1CX1A 3RG6A 4BQ5A 3R27A 1PK6B 4LR4A 4WJBA 1IKVB 5LJ5Y 2AHOB 1X9SA 1UFLA 4P08A 4PWUA 1QJU1 1HPZA 3K57A 3I0SB 2XL9A 2YWEA 1NH8A 4UOCA 3C7GA 5FYZA 1M5OC 1EKSA 5I0SA 4X4NA 1QXRA 1D2SA 1RBAA 3PHEA 2VPZB 4KGMA 1KTQA 4WF9Q 4J7CA 3BSNA 1HN0A 2GAGC 2E63A 1G2EA 4Q4W2 3QJLA 5JJBA 3PO5A 3BR8A 1XMQJ 1NJIT 3UW1A 1EQ0A 3HOBA 3OPTA 1Y5NB 1A6CA 2HWD1 3T4VA 2D44A 3MXHP 4GC6A 3KQRA 2G0CA 4NXNJ 1QJU2 2JDNA 4KH9A 4ZP9A 1AFJA 4ZCMA 4CDXC 1Z0HA 4CRQA 3CULA 2BFUL 2VMCA 4B4PA 2DGOA 3FBCA 1DGWX 3VBFA 1YKWA 3FBBA 3OD0A 1X8DA 1LHNA 4JAAA 4P9JA 2KI2A 4LR8A 2FMDA 1SG3A 4ZOSA 5U47A 2JDYA 1VMHA 4A42A 5HVHA 2OPRA 3A7QA 3EGWB 1DIWA 1PYOB 1EAH2 4IV1C 1ZTWA 4FZVA 1VBD2 3WZ1A 1WF0A 3JBG1 2ZJRQ 5FOBB 3J81Y 3C15B 2ZBPA 2AH2A 2PHLA 4LKDA 5KFUA 4HXCA 4MUVA 5KFFA 3EB7A 3GILA 2XQCA 4HVZA 1IKQA 2MKIA 3CCVS 4W6YA 1WGPA 2VOTA 2UY8A 2IMWP 2Y6HA 1SFYA 1U1PA 4EBDA 3NNJA 1K12A 4QWBA 3RRGA 3ISZA 4B3RJ 4FF4A 3SLIA 3QIPB 2ZGSA 1DCSA 3O1UA 5T50A 1SH0A 4I4BA 2GMEA 4OX8A 5DAXA 4WV8A 3CIHA 4OVEA 1V5VA 1PVC3 1D9AA 3O1MA 3FFZA 2NSBA 4K4XA 2RS31 4M0NA 3OTFA 2Q1FA 2IJNA 3OXGA 4J9MA 3F56A 5KXCA 3O6QA 2I74A 2VECA 3MWBA 2CU5A 3WF2A 4IG3B 1OO0B 3GIIA 4YQWA 4CUAA 4DQSA 4ZY9A 2VFVA 3SMZA 3QGIA 1W25A 4DI6A 2HWE3 1B7YB 1TAQA 1PNFA 1Y10A 4DEVA 3GJBA 4GKYA 4ES2A 4JYAJ 3J7LA 3W5XA 3PIGA 4WFBQ 5DDQC 3SH5A 3V6HA 2VV5A 3JSBA 1W2AX 3URFA 3CWJA 3M1VA 4JI8F 2EIBA 1JXLA 2ZHNA 2OTJS 3W8PA 1H8TC 3CDUA 2Z8QA 4DJBA 3AMPA 5HMYA 5DUXA 1JU4A 2JE8A 4OZLA 4YOEA 2BERA 4BB3A 1SI9A 4XVHA 1GMMA 4HTJA 4QR1A 3GJSB 3ZC4A 3FN9A 3VUOA 4NLOA 1D0EA 4CEYA 1OVSA 1FF2A 1PMIA 2V8VA 3PUQA 4DMZA 1LRHA 4CLSA 5A2QY 3CCTA 5ERLA 1ULEA 3MCSA 3LA2A 5LW9A 3WP5A 4F04B 2E1CA 2QC3A 3ITQA 1WEZA 4G4FA 2KT5A 1ND2B 4FT8A 5IT0A 4DCPB 3LZZA 3H8YA 2UXCF 1LW0A 1PK6C 1XN9A 2KVIA 3SMHA 4K7QA 3MECB 5HL7Q 4A7ZA 1RVF2 1ZAWA 1COV2 4KG8A 4IQXA 3GFHA 3TEYA 2ERRA 3HPNA 4WFNQ 3G7DA 4I2PB 5AXLA 2HEVF 3I2JA 4N8NA 1JB0C 3L3CA 4K8RA 5ETMA 2W8KA 3NGUA 4Y5TA 1PMJX 4HVOA 2DR8A 1EP4B 1VAVA 2PN6A 2LXFA 1UXXX 3MUY1 2UURA 1RMU1 3CZJA 3AMMA 2FUG9 2QQIA 1GNKA 3ZTSA 4JDNA 3ZO7A 5L9RA 2D41A 1HL6A 2AYEA 2BJ8A 2E5LF 2VFRA 2GIQA 1VRH3 2NLRA 1EP4A 5L1LA 1K0TA 2OEJA 3V6JA 1S1AA 4ZPVR 3G8TA 3S01A 3U1LA 1XNCA 5HSPA 3TAPA 1WJ9A 2ZX0A 3UKTA 5GMEA 2M88A 2F7VA 4AHZA 5AE2A 1UZDA 2IIHA 5LASA 4E8DA 5KG3A 5CAAA 3W5MA 2UWCA 1JU3A 2P6HA 4P7VA 4BXSV 1UL3A 2CWMA 2AUYA 2QZ2A 5DAQA 4QPGA 2RU9A 1YQHA 3VVTA 1K47A 5J1XA 5LRSA 5DN2A 5JWPA 2YNHA 1YRTA 4LBOA 2BBVA 4E4DX 1C0TA 1AL23 4HN1A 3DHWC 5IK5A 2N82B 3UR3C 4QWNA 5A8WB 1VDHA 4RJVA 1ZA2B 4K4WA 5JDBA 3RRKA 2V72A 1NOVA 1TELA 1NUKA 3H40A 1YJUA 2GC1A 2FQQB 1XBWA 3GCXA 1UZHA 4IKAA 2GQ2A 4WFAQ 1RUC1 3POJA 1IKXA 2FDKA 4URTA 2B0GA 1H0BA 4CO5A 4CO3A 1BKZA 2Q3PA 3OPWA 4JC1A 2RVJA 1NLSA 4Y2CA 2YQ0A 2PI4A 2G9ZA 3IIIA 3GMGA 3KK1A 4CP2A 1MG7A 2VKRA 3B69A 5FXWA 4Q7AA 2HHQA 4J9KA 3GONA 4RHV1 1O4YA 4HANA 5KFZA 3HVTA 3NY0A 2ZEZA 4QJVA 1QUPA 2DHAA 1RABB 1O0PA 4Q8LA 4B29A 2QA2A 1T05B 3P1IA 1NLQA 2C3OA 5KG2A 1K5MA 2Z2LA 5BNOA 3TAYA 3WG3A 4CXWA 2DCLA 3DYPA 1X60A 1QJHA 2YV8A 5CBLA 2XJPA 1HI1A 3WX8A 2VXRA 1OURA 5CCMA 5E89A 4LQRA 3MIDA 1FFGB 4AVBA 4JV1A 5E3CA 2H9ZA 3JCIA 2V8DA 2RAQA 4NL5A 5F37A 5JOYA 4NLRA 2M9KA 3P3PA 1RKJA 1HJGA 1UYZA 1G9FA 1WW7A 1NE4A 1RSCA 4RNFA 4XJZA 1BVP1 5ANNA 5LSOA 3NMRA 2DFBA 1YZ6A 3ELHA 3LALA 1HW9A 4U7CA 2FVSA 3I6PA 1AR62 1UX7A 3R2DJ 1E5SA 4CO1A 2XMKA 2M4MA 3AY0A 3NCRA 5IYYA 1N32F 2XXZA 2UXDJ 2XJSA 3DKDA 1BHNA 2E44A 3WNKA 3SSRA 1Y7BA 5E3AA 3PO4A 5G05L 4B3SJ 3WC0A 2RHQB 3CCRS 4FYWB 4D69A 4JI3F 2EAKA 3WNMA 3KLSA 4P9XA 2YBVA 5C2GA 5CZKA 3PVEA 2G19A 3EUNA 2QA1A 1S9EA 4JGYA 3PKMA 4XJWA 2N3LA 4ZJOA 3ZZTA 5I0RA 4CP9A 1VRUB 2FJVA 4OJGA 3GJQB 3V56A 4TSVA 4EU0A 4NLDA 2BOAA 3MM5A 2SBAA 2AU0A 5JAXA 4UFMA 2Y6GA 1S9EB 4DPWA 1RB8G 2B9EA 2UU9F 3ETMA 4RNHA 2HWF2 5L1KA 1OY9A 2QMWA 3HULA 5SUHA 5BYRA 1VCTA 3SIPB 3W1YC 4Q0VA 3IN9A 3SQOP 2XVGA 2HQ3A 3IGVA 1EAH1 4YM1A 1YQ6A 5A3WA 4ER8A 4DV1F 2RDDA 4IQPA 1IGOA 3MD1A 1NT0A 2PD1A 5JSRA 4LBKA 1FRJA 5FZCA 5J3UA 3ULHA 2GH2A 1UZWA 1HFEL 3LOBA 3FE5A 2AEJA 3E2EA 3D8CA 1HQ2A 3MIBA 2VE1A 1W6MB 1D9FA 3TW0A 2ZX4A 2H6BA 3IA0A 3TN92 2OSRA 1CJVA 2B46X 5AT1B 3DYAB 2QLBB 2I9SA 1ULDA 2QE3A 3RAQA 4BQWA 1T9VA 3EBRA 2HFOA 3BSCA 3NQHA 1IS4A 4QYZJ 4RGGA 4GWJA 1JTZX 2P2KA 5FZ7A 3DFEA 5EDWA 1MVEA 2R2UA 4AD6A 2NXCA 4ES1A 1W06A 4DR4F 3KLGB 4P10A 1C0UB 4DR1F 2ZZJA 2V8GA 1VR6A 3H5YA 4EZ6A 2V5YA 4OYUA 5C24B 4I3GA 2VG9A 3RZMA 3M2RB 5FYTA 5HQLA 1PIEA 2V4JA 1CPNA 1PK6A 2HFUA 2J0WA 5FY9A 4S2HA 3IKWA 3N9LA 3BN4A 1PBUA 4I0WA 4NLVA 5J1NA 3HZGA 4DCOB 2YWHA 1QJX1 1UWBB 3NOCA 1NJXA 3AP6A 2MSTA 3PV8A 4KBZA 5IQ6A 4Y22A 2DEJA 3LPEA 2WZPP 4ZK7M 1HRI3 1FX2A 4Q0PA 3WHUA 2LFVA 3MM9A 5H9SA 1H74A 3ZFFB 2HLUA 2W2OP 5L39A 4FO9A 2Z69A 1W05A 4ILLA 1FVSA 3W9IA 5C7PA 3LPGA 1W9TA 5L73A 2LQ5A 3I4PA 2E7TA 2FYXA 4UOHA 4QKDA 5DAWA 1TMMA 4KGVB 3KK3B 4GO5X 1GXUA 3BR9A 4N47A 3EPIA 3C15A 1RT3A 1FWLA 4HK9A 3LH2S 4AOCA 3BKTA 1REEA 2GZWA 4XIKA 5K20B 3B4MA 4NLPA 3BODA 5CA5A 5C8CC 1N88A 1NEEA 3C8XA 2IVMA 3QIPA 4RGKA 1LHUA 1V0AA 3TQEA 1TK8A 4ED2A 3H3UA 2ZH4A 1ND3C 4AQ2A 3JAMU 2WS92 2CXEA 4DZGA 5CFCB 2CVIA 4ID5B 4XUOA 3LTOA 5HI7A 1S0VA 3OEBA 4YW7A 3TJAA 4H3WA 3ZTRA 1YIFA 3KJFB 1B35B 4DPNA 3ETQA 4NLSA 3PUAA 2ZHMA 1RBOB 1N1TA 4P9IA 5FWJA 3UCZP 4MH0E 2PLV3 4PHZA 3O5SA 3CHXA 1NDPA 3EMRA 3H5UA 4IG3A 3PX0A 3FRZA 4FP3A 2XR4A 2EA7A 2DNLA 4HHHA 4XOGA 2V8HA 3TNPB 4Z82A 3DLKB 3HFKA 2R062 1HD1A 1IPJA 1XWLA 4YN3B 2HKEA 3NWKA 4C4WA 3W5YA 4K9SA 2EIEA 5C71A 5A0YA 1U5YA 2DVGA 3PUIA 3R4SA 1WEXA 1RUH1 3C46A 2RMU1 1UPPA 1X82A 1MZEA 4AL9A 1SJ4P 1WOPA 2MQLA 1GKBA 2RRNA 3I59B 4IEZA 4KTQA 1BEV2 5A3MA 1R43A 2BM0A 4HSJA 4EZ4A 1FESA 4NOTA 1ZH5A 4OJ1A 3SITA 2YY1A 1WEYA 1Q79A 3D3AA 4E9KA 4GVBB 3AB0A 1SKUB 3PR5B 3R4UA 3KSCA 1UW4A 3TX8A 2D40A 3LCPA 1NA1B 1QQP3 5BNOC 3WDOA 2IFRA 2K2SA 4DU7A 2LQBA 3JZVA 5A32B 1YJVA 4M4PA 3B00A 3WD5A 4NHLA 2K2PA 2Y8WA 4NIAA 2IC3A 2ROGA 4Y2MA 4CI0B 4CLWA 3M3CA 4QU1A 4JI1F 2ARAA 1H0HB 4ZPIA 3J80Y 3ZPYA 3GNEA 4A8FA 3TWIA 3VAHA 4RBUA 1K5JA 1VRH1 1SJQA 2PHRA 1JMTA 4ZHNA 4K8RB 2DITA 5ABJA 1C4AA 4PIZA 4OJ3A 4YWAA 1HNIA 1U1RA 5CG9A 1JMUB 3T1YF 2IVJA 2W68A 4FOYA 1LODA 3D3CJ 4CLLA 5KFNA 3SKJE 4H4KC 2MGZB 1X4FA 2VO5A 3LA7A 3MCNA 3N28A 1STMA 1W7WA 2CDOA 3BYPA 4DSKA 1LENA 4XBQA 2RJLA 1G6NA 5JIAA 3WHTA 3WINE 4JI4J 1LW0B 4HETA 2L9NA 2F8HA 4DX6A 4I7FB 3G2XA 2OYZA 1VMBA 3BIWE 5CZXA 2O66A 4AQTA 5F3CA 2DU1A 4JBCA 2ID4A 3GTYX 3EZOA 2UUBF 4X4PA 1E5IA 4UFLA 4ASKA 2OH2A 2CAVA 5I0UA 2C3UA 4ITCA 4RFRB 2HURA 2ZC3A 4OMFG 2BW2A 2CJ9A 4CP0A 3G96A 1OYEA 3JQKA 5GMKa 2AW0A 4PLMA 4NI2A 3VKOA 2R1DA 1RAOA 2VQ0A 4LK6A 1B64A 5I8TA 1U0AA 4L6V3 4P52A 4FPYA 4AEJA 5F1RA 1H2VZ 1NZAA 4LLFA 3WCRA 1AR72 4P9WA 2X7IA 3KUHA 4UFJA 4G1PA 5KFAA 1TL7A 2W1SA 3PVBB 4FN5A 4HN0A 4DPOA 4XO0A 2N7CA 1EYBA 2QFIA 2HAIA 4PYAA 1OOPC 5A8RA 3KG1A 1AFIA 4KKOA 1QY4A 1RUJ3 2GNDA 5KOXA 2MB0B 5IK4A 1EB0A 2EG2A 2IFXA 5LXYA 2ATLA 5JOZA 3BBCA 4RPFA 2KT2A 4YPJA 4XIOA 1R0AB 1URNA 2HWB1 2G4BA 3MM7A 4DV3F 1OKQA 2VOWA 4B9MA 4AVCA 4Y4YA 1JW6A 1RT2B 2WZEA 3PTWA 2AGQA 5F39A 3OBRA 1N5YA 1WI6A 2JDAA 3RUBL 4GC7A 1S1VB 2GVZA 2O1PA 3PW2A 2KD7A 3IS9B 3R3TA 4IUFA 2ZD1A 1MR5A 2KXLA 4AHWA 1VMFA 5GLWA 2CZ4A 1RHI3 1APNA 4WBBA 1T05A 5F5QA 2YWWA 1S48A 5J2PA 1WG5A 1S0GA 3OBAA 2YNIA 3V65A 3ZDSA 1NXD1 3Q8EA 1BY9A 3QNWB 2CQ0A 1RXFA 3KT4A 3GIRA 1P1TA 4H4OA 1SL2A 5IWFA 3QGPA 3OJUA 3W2WA 3QSYB 5D15A 4ECWA 1WMXA 1VQ7S 4HSLA 4O9GA 3WG4A 2VG7B 4ZVPB 1WWHA 3M3QA 4XPVA 3MEEB 3B9CA 4PG6A 4Q8EA 2MMYA 4ZPWR 3AA8A 2Y1JA 4QHBA 3WP3A 2A3XA 3VBHA 2CSGA 3Q24A 4LKFA 3RVHA 2C0ZA 1RCOB 4ZP8A 4QDRA 4C6AA 2BDPA 2J9DA 2EALA 3R1LA 3AJ2A 2HFSA 1S0NA 1BMV1 1JLAB 1CVNA 5IOLA 5ETKA 4Y1YA 2JWNA 2J7MA 5A3TA 4E8UA 3OY8A 2JRSA 4YHHJ 4RU2A 1S76D 1IR1A 2X3GA 1WHYA 1GICA 3CIMA 1U0SA 1ENXA 3D6FB 2PN5A 4QMAA 1I94F 2ZHBA 4CE8A 1NLRA 3BOWA 3DI6B 3CJ5A 1Y7PA 2E66A 4LBPA 3GJAA 2VBDA 1Y43B 3MF5A 3LP0A 2JNJA 4KFBA 3I31A 4MGZE 3NJYA 1HWUA 2QBXA 2YNFB 4AEMA 5IM0B 3WBZA 4QBUA 4B3SF 3AMQA 2BJ9A 4KNCA 2KG0A 2RE9A 4ZHRA 4DY3A 1SVDA 5DPNA 4Y3OA 3CC2S 1RUI1 1SV5B 3VKLA 5K8OA 1LW2A 1OT5A 2CADA 4QD2A 1S1XB 4DL6A 2W4CA 1TL4A 1F5JA 1OSCA 1U6BA 4KAIA 2XMVA 1YQ8A 2XMJA 2GGPA 4UFIA 1OQDA 4ECSA 5HATA 1KGYA 4QB2A 3DUIA 3T1LA 5C3QA 3M4XA 2VW0A 4USTA 4ED1A 1LWFA 1RMU3 3DPRA 4Y5SA 2QQOA 1DTTB 5E3PA 4DUVA 1T3NA 4JV5F 1CAVB 1PZ9A 4NRTA 2DR7A 2ZDPA 1VBD3 2KTQA 2K7JA 4LSNA 2A7AA 2XQRA 3ZYIB 5IQQA 1VBD1 2QE5A 1LWFB 4QQ2A 1TKXB 3OR1A 2KM8B 3HK2A 4WFYA 2BQUA 3P45B 2WFPA 2HBZB 1SC6A 4ETZA 4UOGA 4G3YC 5IK8A 4Y5Z0 2OPQA 2BE2A 4CZCA 4FFGA 2E1RA 2ZHLA 2WS91 3UDCA 4R9CA 4RHV3 4I6WA 1W9WA 2GO8A 1NE6A 1Y11A 2C9KA 4B3TJ 1YC61 3PW0A 1HI0P 3DOMA 1SH2A 1LOFC 5AXMA 2VC9A 2MKHA 3LP1B 3GV7B 2E7XA 2BE2B 4GKJF 1VQLS 3CJIC 3MDPA 1RUG3 1WLCA 2R2TA 2BOIA 2J6SA 3D0HE 4EN9B 1REVA 1OYDA 2PAMA 3P5BP 1SPPA 4KWJA 2Y34A 2XI3A 2VA2A 2CTVA 3GHNA 4LHSA 2HW3A 1VHFA 4HT1T 1Z2LA 3EXYA 4DL7A 3AT1B 1VRBA 2FDNA 1FV3A 4XHXA 1XR5A 1PCAA 4HI2A 1XRUA 2FHMA 3FVYA 4UBHA 3FLTA 4WK3A 5C8CB 2PHXA 4EE2A 1MZ5A 4NWBA 3RU0A 4AYUA 1G9AA 2VDIA 3CE8A 3BV8A 4DX5A 4YB6A 3WLUA 3HCXA 2LECA 1CN1A 1XJWB 4G1IA 5FZDA 4J9QA 1QAXA 4U7UK 4NZ6A 2PYTA 4LLOA 4CLTA 3OSDA 1AJOA 3N3HA 1O8SA 1TG7A 4Y33A 3N7MA 3R0RA 1VALA 4EZ9A 2R4FA 4RUBA 3BPSA 4KO0B 1I1EA 1UYPA 3WW1A 4SLIA 1ZRFA 1S1TB 5B09A 3U14A 1S2KA 3USSA 2RDNA 1FTCA 1UO9A 4RW7A 2LXIA 1UTAA 3H3LA 5DMYA 1CX4A 3BALA 2G4IA 5EYYA 2Z58B 5J48A 3IM0A 4ZPTR 5I42B 3VBFB 2WIIB 4CH7A 4IFYA 4CTAA 5BJRA 1ELOA 5BR8F 1RT6A 3WQPA 2RDJA 3T19A 4JI6J 2G9GA 4HHJA 2UWAA 5F2WA 1NPRA 1N5SA 1KEXA 3HBKA 2JFKA 3VB9A 1GOHA 4WP9A 2WL1A 1R1A1 3CT9A 4FKYA 1ZM3A 4MJKA 1TV6A 4TQSA 2Q0AA 3W21A 1XE0A 3UD5A 1X9MA 2RJ2A 1J3PA 4DB5A 3IRXB 2CYYA 5IT6A 3QGHA 2VULA 1GV9A 1YJ7A 1OI6A 3BDEA 1WC0A 1G1XA 1C8M2 1WWYA 1LWXA 1UZYA 3K51A 3KD4A 3C6UB 1KTVA 3W63A 1FKAF 3MGUA 4FPEA 2OPKA 1Y9QA 5KFEA 1G7YA 5E1RA 2D93A 1XK8A 3LFIA 2V4QA 1YFWA 2A1BA 3TNQA 1UYYA 3O7OA 1DQ0A 1R0CB 3FLRA 1FJGJ 3NNGA 4NPMA 1SKWA 3P8BB 5FZLA 2C42A 3PFEA 1TK5A 4FFIA 1RJ8A 3UVJA 4N76A 2YKMA 4FPOB 1CJKA 1H1MA 4PXEA 1K73T 1IS5A 4X84A 5LSLA 2DF7A 1OKOA 1AR82 1M4WA 3M9MB 2R1BA 3JYTA 3NNHA 3I3EA 4AQ6A 2ORZA 2HGNA 3NOGA 1UYXA 5DG9A 2LW8A 3M3IA 1RHQB 3OLBA 5K0UA 4RW6A 4TU7A 4W4MA 4MK8A 3S6EA 1W8OA 1JLGB 3MZHA 4FBUA 2XMWA 4LRBA 4LBHA 2JENA 1NPPA 1UEUA 5KFRA 4E4HA 2QKDA 5BNNA 5FO9B 2B7CB 2MDAA 2DT9A 1JLGA 4YZ2A 1Y9MA 5CIRA 5DGAA 4OUMA 1XNRJ 4GA9A 5EIYB 4PYDA 4DS4A 3J8F1 4ARYA 2W8LA 3I9V9 4WK1A 2CNLB 1RWXB 4A41A 5RUBA 1LXJA 4CO2A 1U49A 1CG2A 2E51A 1LOFA 1H6XA 2IVIB 3SISA 3BTYA 1HQUB 2A70A 2J1TA 4JI2F 1RVF1 3Q8CA 3NKTA 5I8SA 4GVLA 4L3NA 4Q1PA 4YVSA 1X9TA 5FXVA 3S7IA 2VZVA 2UUBJ 1LHOA 3R7SB 5HXVA 2R16A 4CO4A 2R063 1G9BA 2PT0A 1RUG1 3P5BA 4N9IA 4M5LA 4OYAA 2WN2A 3WX4A 4O7XA 3H20A 1OH4A 1VRQC 5L46A 4F50A 1VAMA 3CO9A 2E9RX 5T55A 3WDWA 3USUB 4D8MA 2C2KB 3ICLA 3O44A 2Q8EA 2HHWA 1M1HA 4F7VA 3M8PB 4FQZA 7AT1B 2HNDA 3C8YA 3DRRB 3WSOA 3GU0A 1RAFB 4LBQD 4N53B 1MQTB 1QJFA 4NZ7A 4F0HA 1S0FA 1BQMA 1W8WA 4RQPB 3N9PA 4DEZA 1VB2A 4J9LA 4Z1VA 4OMDA 1SCJB 4O65A 2BUKA 2A6WA 3GXUA 1HXS2 3U11A 1ZRCA 1AZSB 1NG0A 5JXGA 2JHEA 2X3DA 3M8PA 1IQDC 4BQ1A 3WUCA 2YU1A 4NLXA 4DHVA 1JLCB 3E3XA 2A71A 1DZQA 1UETA 3WT3A 5DLFA 2Y33A 2YC4A 1UOJA 2F1FA 3MPPG 1YBUA 2ENRA 1F5CA 1WKJA 4OCTA 4LQ3A 3VHPA 3KK1B 3NJZA 4OZOA 2BGOA 2HK2A 3PRVA 5F6LB 4QX1A 3HP6A 3AKTA 2WAAA 4CEWB 3P6BA 5H9QA 5A2QU 4W90B 3D28A 5DG7A 5F3EA 2WFF2 3HT1A 3KV4A 2Q1LA 4D7TA 1W2NA 5KC6A 1FD2A 2WO2A 5J7MA 5A1LA 1U2FA 3KKFA 2IHR1 3LOUA 4QX8A 1PBAA 3IS9A 2VQFF 1W8FA 3AA9A 4DV0F 3J7YI 1H6KX 4AG4A 4MGTA 5FTTC 3CQOA 2J42A 3PU8A 1VLNA 4OJHA 2B6AB 2H54B 3DKWA 5FY5A 4AR2A 2DWRA 4ES8A 1MU2A 2ZGRA 4NIHA 3I4HX 1T94A 4USUA 2HIQA 3NS7B 4JI8J 1D09B 1YJKA 1DLLA 1NXIA 3VZNA 1KBRA 5KT4A 4DUXA 2IY5B 4EBCA 3RB6A 1QSSA 3KJVA 4S2GA 3FKBA 4OYIA 5IV4A 5AJ3J 4LF4J 1OD5A 4D3HA 2M52A 3RYRA 4CDQC 1JI6A 1FNOA 5KBFA 2CQHA 1MS0A 1YI7A 4JDMA 2FY8A 1WC5A 2RS11 3NV1A 1EKRA 4FPIA 1NDLA 4NA2A 1KN6A 3NEKA 3FL7A 2CA9A 1GYKA 2ZM6F 5IZHA 1C57A 4OHWA 4F3OA 4KJIA 4ITSA 1RLDA 1Q8VA 1Q8KA 3ILNA 4YZ5A 3VAKA 3PVXA 1HV1A 3WW3A 2G1HA 1BXHA 4YVWB 1W3VA 4WPAA 3NL1A 1DLOA 3WF0A 1FI2A 3TNVA 3BQ0A 3FZ3A 2O0OA 1OHFA 1RU2A 3IAPA 1GWMA 4KH1B 1U1MA 3VWSA 4LFCJ 3Q22A 2XGQA 1RTDB 1POV3 2ZX3A 4ZLLA 2Z4FA 1DQ1A 5FK8A 3EDRB 1XE7A 4KHMA 1T8EA 2LKZA 4N53C 1BK1A 3GHMA 3I3BA 3TEGA 1ULPA 2YYOA 1ZVFA 4HKOA 4Z7YA 4RBVA 4CPBD 5AFBA 1UOBA 4BHQA 3R6GB 3POGA 4CUGA 4EGLA 1S6OA 2YH1A 4FP9A 2XKOA 1XMBA 1RTDA 1Q7YT 2KR2A 2WWJA 2EFVA 3THTA 1RKIA 2Y6FA 2W94A 1GU3A 2K3IA 3KUGA 1TNRA 4A6SA 5D4PA 3UO0A 2WKKA 1F31A 2DGXA 2BPA2 1VBE3 4FCAA 1IKXB 1T3OA 4USJC 3LF7A 1UIJA 1UWAA 1DTTA 2HBUA 3E6DA 1OPOA 1U47A 5F8GA 3SI8A 2P3YA 4TY8A 2A73B 3N79A 2D6MA 3D6MB 5KFIA 1PGZA 1VHIA 1TUVA 1Z78A 2ILMA 3ISND 4MKAA 1D4M1 1VQ4S 2OS2A 2VNVA 4I0AA 4ECVA 3B5LB 1MS9A 4NLTA 3FLPA 4RX6A 4NAOA 5DM6Q 4ZCKA 3OPKA 4O0NA 1KITA 2ACYA 2WLQA 3A1YG 1L5UA 1N1YA 2P37A 1OVPA 2OXBA 1RHJB 2AJ4A 3VLBB 2WK4A 4FVCA 4CUBA 3H8UA 3D6TB 4NZ0A 2KFZA 3ZXWA 2WVFA 2EVZA 4XJUA 3HHDA 2WTFA 3G71S 4EBEA 5A7QA 4FF2A 4PCRA 5JR2A 3PVOA 4AQYF 4A45A 2YHJA 2GIFA 2XJTA 1PSDA 3PX6A 1D4M2 3I87A 3GBGA 2K1RA 2V67A 1G86A 3B82A 2IVFB 4CDIA 2A2CA 2CG8A 3KQ4B 5KHHA 1TQLA 3RZLA 1I94J 4Y2AA 5KG6A 2G1MA 1VYAA 1YLXA 3E5QA 1DAXA 3RQ0A 4OI6A 3BBBA 5D21A 2ZEJA 1IJEB 4DFJA 2VTXA 4AVSA 3KK3A 1FKPB 1W03A 2OUJA 4IRDA 3WEZA 4KSEB 4UXAA 2JIJA 4LBMA 1HBOA 3BDPA 2Y8KA 3ZZYA 1KSPA 1W0PA 1ZREA 1O6XA 2DIUA 3IR6B 4J9RA 5B0DA 1N3OA 1XPWA 4LFCF 4DL2A 1F9HA 2RS32 1JYWA 2EWHA 1XNBA 1Q78A 1LEMA 1H7WA 2DXDA 5ETSA 4JGYB 3BQ1A 4K5SA 4X4OA 3SEOA 3QMQA 4D6RA 2DEIA 4O4GB 1QHDA 4CXYA 2WW8A 5FZ3A 2YX1A 3O0WA 1MN9A 2QJVA 2UXDF 2XZTB 5HVGA 3O5TB 1U0HA 3WNXA 1D2QA 4B17A 3C7HA 3PTYA 2POKA 4ZIVA 1ACCA 1DARA 4PI2A 1FK9A 3NWRA 1NH7A 2YGMA 4IO9Q 1GMVA 2BEFA 4UY8T 1D7PM 1TL3A 1E5RA 3DXSX 4NA3A 2B42B 3NGKA 2QJ3A 4XF3A 2VJVA 4W8JA 5A6XA 1RUG2 1AYM3 1S99A 3CL1A 1TUGB 2C3YA 1QJEA 2BV4A 1A8DA 2KFYA 4F2SA 2ASDA 1N1VA 5JMOA 3VQTA 2KU7A 3I4IA 3HT2A 3AKSA 1V9U2 2PMZD 3LPYA 4E4SA 5BYNA 4F26A 4NMXA 2MXYA 3V5RA 5J09A 3PCOB 4RW4A 1X7NA 3T9ZA 3RBZA 3OTCA 1T11A 3M8RA 3ZN6A 3ZZPA 4TXSA 2HHSA 2YFUA 2HLTA 1TU0B 4PUOA 3WNOA 2Z57B 4KY3A 3UQSA 3CUNA 1NUEA 3MFCA 2W7PA 5JZGC 2W39A 4LO4B 1LWEB 5F9LA 3OR2B 4M5IA 4TU8A 2RUSA 4QPTA 1IBKF 4KWLA 3UVJB 2ZNZA 4NUBA 3GM8A 1HQWA 1IKVA 3N9MA 3PUHA 4B3RF 3VZOA 2WQZC 2HQDA 2BFUS 3CCMS 3EVMA 5J2NA 2LEBA 5B0EA 1JJHA 2R7QA 2VBPA 5HCHA 3PEHA 2ZOFA 1YK9A 4DV6F 4DFSA 4ILRA 3AZXA 5K0UB 2BMBA 3H0PA 5FMCA 5FZHA 4PXDA 2HRYA 1UOGA 3U1MA 2WZR3 1UL9A 5A6QA 3UK9A 1TEIA 4WVMB 3BGRA 5I0TA 3AB2B 4DR2F 4PI0A 4CCNA 1RP5A 3C6TA 2EFOA 1SLLA 2JG9C 3UJOA 3NLCA 1E6VB 1UA1A 3AXEA 3N4MA 1GT8A 4CCHA 5L1JA 4TXWA 2V50A 1XNTA 1VFJA 1YUDA 5CAZA 2VL4A 2XDVA 3SH4A 2CWXA 2MGZA 3AM2A 5M0TA 4K0KF 1VMJA 2IBOA 3HPOA 3MFHA 3APBA 5C70A 2FCUA 2C2ZB 3J7NA 1W3XA 5A6PA 4OI4A 2VL1A 1NDCA 3HVWA 5B0AA 2DTYA 3OTOF 3BJYA 5K8SA 3THPA 2XMTA 4Q45A 1K0VA 2BE7D 3CDZB 3WR0A 3DLGB 4WVZA 2GNKA 1V6KA 1RQ0A 4NEYA 1LV5A 3KOAA 2XONA 1RJ7A 3D0GE 5DDJ3 4Z2AA 3RPQA 4Y6IA 2XLGA 2EIGA 1GQGA 1VK3A 3IGNA 5A8KA 5L8RC 3L2YA 4GULA 2WN3A 5FPVA 2Q1MA 1S49A 2RV9A 3A21A 3MMJA 1ZZ7A 4RR3C 2JDJA 3T1MA 2DCYA 1IOAA 1HARA 5E3RA 1Q95G 1AL0G 2HBYB 2ZEYA 2ALYB 4IERA 3VBOB 1FJGF 3EPGA 1VIXA 2L08A 2EFGA 2FGCA 1P8GA 3SCIE 5A76A 3WDVA 3KK2A 2X51A 3Q2TC 4R5PA 3LIGA 2J0XA 4CEWA 1HHTP 3ZR6A 4IGPA 1SLTA 4Y4RA 1KLNA 4DSEA 3QBQA 5HN0A 1X7VA 2ZE2B 2W9CB 1R8AA 2RE1A 2PMWB 2XBPA 2OELA 2BYVE 2CPJA 5EQUA 5FXXA 1Q86T 1FJCA 5I4MA 2HEWF 1ZBTA 5FMOL 1VR3A 3MEDB 3QRQA 3VQSA 2EK6A 4PBPA 5LY2A 3OTBA 1DF0A 4H4MB 2VC1A 2ZKTA 1ZETA 2WJSA 1NDKA 3AYDA 2EW9A 4JDOA 3O1PA 3RW7A 3MUTP 2R7RA 2OTLS 1Q81T 1YZ7A 2WONB 2VUAA 2WC2A 5IVBA 1NCRC 4OL8A 3IDEA 3ZFGB 4PLNA 4AGGA 1OA3A 2DTJA 2YC2A 4RHV2 2W1BA 2D6LX 2HHVA 1DTQA 3MMBB 5FZMA 1TKZB 1JKHB 3EYZA 2DGTA 1B0TA 2AACA 1HR0F 1JYNA 2KO1A 2W1WA 2HVDA 2QYCA 1HJFA 4IEPA 1OF3A 2FDHA 1KHVA 3QJJA 1MU2B 4P72A 3KHGA 1RITA 2WZ1A 1Q5OA 4C8KA 3MW3A 1SBRA 1Q43A 5G04L 2ZX2A 1J83A 1N33F 4LNVA 1MWQA 2I0XA 4AZZA 4XUNA 2R072 5FQ0A 3DLEA 3LWLA 1GTEA 1R8PA 2Z2YB 4GO7X 1WOSA 1WHXA 5D4NA 2VFTA 1F15A 4HR2A 4EWTA 5C42B 3UDVA 3R7NB 3I9ZA 3BREA 3CIZA 1AUSL 2WW4A 1W9SA 1N52B 2VU9A 4WXOA 3NV2A 3HHLD 4UY85 3WF3A 4QU6A 3UWTA 1XNQJ 1FA0A 4I68A 2ARXA 1OQ1A 2YQ1A 1FDDA 2ATCB 2WNUA 1O3RA 3F41A 2ZH9A 3CJKA 3MR5A 1V00A 1LCLA 4ZZ8A 2IJRA 1KKHA 7FDRA 3UESA 5ETPA 5SZTA 4O3NA 5KXBA 3DYOA 1DYOA 5E41A 4C91A 1C0TB 4NYOA 2M5YA 3W20A 1CS4B 2P3IA 2ZVSA 2VCCA 1PO21 4FAGA 2FHKA 3KJQB 3VGUA 1IUJA 1VIWB 1GXTA 1S9GA 1W6MA 1IBMJ 1OUXA 3LSEA 3NBPA 1OPIA 3N9OA 3DM2B 2PGCA 2EBEA 2XC9A 1JXVA 4KPYA 5J36A 4KQ7A 3L9JT 3CJ2A 3DPRB 3TZWA 1NSPA 1HNXJ 2TEPA 2WHOA 3ZSEA 2ZBCA 3WIVA 1LHWA 3DLHA 1KD1T 4FXWA 2WVDA 3TI0A 3KLIB 4ETXA 1T95A 1EV11 1J84A 4IUGA 5GLTA 3JQMA 4IEXA 5CD4A 5D6GA 5L36A 1YHQS 4ZPCA 2KYXA 1V6NA 2B5JA 4MHUA 4KGXB 1WHWA 2ZGKA 1KXGA 4P9LA 3HVTB 3FWEA 1H2UX 4JX0A 1UKRA 4QGMA 1FJ7A 4L72B 4I09A 2V73A 4OX9F 3AQPA 1MPXA 1KS5A 2Y8YA 5JPMB 2XLIA 3BPZA 2VPWB 3MPWA 5H9FJ 4DG1B 1QLNA 5D3GA 5HPOA 2O14A 3HEIA 1LWCA 1M5SA 4BMBA 5F3GA 3T1AA 2CJQA 2F5GA 4B9LA 4QM9A 1N5VA 1V3RA 4F0MA 4DUTA 2UZAA 3EZUA 2D7FA 3I49A 2Z0GA 2HHTA 4NCBA 5FD1A 1OSDA 1BMQB 3H2LA 5KFPA 2G9OA 2CG4A 1YSJA 4UI9L 1SJRA 4XDQA 4ZPAA 2XY5A 1JIHA 1S4CA 1CEZA 3R6LB 2R30A 1Y3JA 2JLGA 1DZTA 1S2EA 2PMHA 2FCTA 4QPIB 5C24A 2A3JA 2BVZA 4BA6A 4QXHA 3K4ZA 1X5OA 1VQOS 3HXMA 3MPVA 4WYWA 2BVBA 1U1LA 2FLPA 3UGHA 2ZC4A 3LO3A 3TOJA 1EIYB 1S0CA 3CCLS 1VAKA 3BTAA 1PGL1 1VJQA 2B4OA 5F41A 3ENRA 1WMDA 6AT1B 1EAYC 1VBKA 1NK8A 5JZGA 2VG6A 3ZZZA 2Z56B 2BABA 4A8SA 1N36F 2XHKA 1HI8A 4AE5A 3VHRA 1WCQA 3WNPA 1TKTB 2L41A 5D1IA 2MKCA 4OULA 1SB6A 2X05A 5GZGA 3NAPC 3HF5A 3OW2R 5EJZB 4R9AA 1RBLA 2V09A 1JXEA 3OBZA 4I69A 3JTNA 4CP9B 1ASJ3 4U95A 1UCXA 3I54A 4OV6A 4WTYA 2E9TA 4LF6J 4WFXA 2YQ3A 4NLQA 5KFVA 2E32A 4HACA 4NLWA 4AE2A 2Q6CA 4JI5J 1WSVA 1YG0A 1KS2A 2LUWA 1A7GE 4CT8A 3NNFA 4V1PA 5LOQA 2U2FA 5K8NA 4QM8A 2JC0A 5IK7A 2GC8A 2XZDB 4PWDB 3D1QA 2R8HA 2LP4A 3M8ZA 3B8HA 2QQUA 1F6TA 4QWEA 3SHRA 2PE8A 4V19X 4R9DA 2VPYB 2BP6A 3ES4A 2WSFC 4AAPA 1NCLA 4C0OC 5HCFA 2JXAA 4XETA 4GVBA 4OZ5A 4NXNF 4UZCA 4ZS6A 4LRDA 4AL6A 4OYBA 1K1SA 1NM2A 3QSIA 4XFFA 4U8YA 4YMEA 4NRPA 4ED5A 1QDOA 4DQIA 5IVVA 4WKYA 2DXEA 4Q4W1 2QEXS 5DZFA 1JYTA 2A6OA 2OZ6A 2I2YA 2NQYA 2KRBA 2R7SA 4I01A 4MOAA 3IM9A 5KG1A 2BQ3A 2WUHA 1FDBA 4K2XA 4J9NA 3ROUA 3KNAA 5ETOA 4D3WA 3L7UA 4CQ1A 3I0SA 2PI5A 2NN8A 4N7UA 4LHLA 4UYBA 3K89A 4YG3A 3T0DA 1Q7LB 5LMUF 4QKFA 2MZRA 3N7JA 5LEJA 3LD8A 3SSQA 2XB2D 4NHXA 4HOOA 1RB0A 3QFHA 1A9NB 5A7PA 5C8CA 2X10A 1PO11 1C1BA 3OD4A 5KXEA 4O3SA 1SQGA 4HH0A 4PT6A 1WELA 4L74A 4XTMA 2HWE2 1XERA 5LSRA 2KJVA 1GNHA 1PVXA 2XHNA 4YARA 2QYGA 3RW6A 5H9EJ 2C2EA 2X09A 1V70A 3WNNA 1LOEA 5KFOA 3ZFFA 4YVSC 5F0UA 1GK8A 1U8WA 2IXIA 3E5XA 4M3CE 4XFIA 1TL5A 3N9UC 5I93A 2DY9A 1XIQA 1GAOA 1CQNA 4N90A 4PXCA 2O1QA 1GFWB 4IDKB 1QAIA 5CKQA 3OTDA 2VQEF 1DHMA 3OHAA 1U48A 3G6VA 5K7PA 3GIMA 1D3WA 5F3ZA 1D0HA 1GQEA 3RDIA 3S8SA 1AYM2 1QH7A 2Y6KA 4XF0A 2DYCA 4QGNA 3OXLA 1YFXA 3ACIA 4ES9A 2K06A 5CQGA 5KFJA 2J0SD 1PO13 3Q23A 4CVUA 1XNRF 2BGPA 1QKQA 4G6VB 1NPKA 4YVWC 4AFDA 2ZUGA 3HNYM 2ZWOA 4N43B 4CM0A 1ZBE3 1QTMA 1X4DA 3AJYA 1KP6A 2W47A 4XMIA 4DXLA 3LUYA 5HP1B 5FP7A 1RCXB 2ASYA 3GG0A 2Z4PA 4TN2A 1HNVA 4HONA 1Q5YA 2CL2A 3ZTQA 3WC2A 4QAWA 2YMZA 2RQ4A 1W9YA 1DQ5A 1IQZA 2DNKA 5B08A 4JHZA 2FHOB 1JLEA 1U1KA 3WDTA 3ENQA 1WSRA 2C9AA 4CIOA 3I2DA 2WYSA 4YM3A 1JLBB 4QU2A 5BY5A 4JI1J 4NO4A 4AK3A 3ACFA 1O8BA 1N5TA 1SJFA 3D4KA 3ENAA 4RUHA 2FDGA 2CV6A 1J58A 5EUHA 4H4OB 4ORFA 2WSCC 4R8UB 2UVRA 2P1BA 1V9U1 2PAKA 5IFPA 4ATEA 3OVBA 1COV1 1HB4A 2HHXA 1SCRA 1FXRA 1OLMA 2W9CA 3HVRA 2XJQA 1H8VA 4PPZA 3HNBM 4LHNA 1GEHA 2MEV3 4B7EA 1OPMA 2VOPA 4LQ9A 1RHKB 1ND3B 1R081 3ME2A 2OD4A 1GMWD 2OIHA 1AHSA 1PC5A 4DX8H 2CJBA 2R2SA 1RXOB 1NA1C 1BLUA 2YBKA 1FDAA 3OUYB 5DDPC 2WNVA 3A8KA 4XAAA 5A6WA 2RRBA 3HZEA 3TOQA 1NSQA 5IUQA 5F8JA 1MEC3 4JYAF 1R64A 3GZUC 4XFCA 5L9BA 2QLFB 1VRTB 1NAEA 2OEKA 5JCTA 1PIV2 4CDUB 4M5GA 3OPZA 2WRAA 4QIVA 5IW0A 2Q79A 4MG2A 5FZGA 5M2RA 3KB5A 2FJEB 1NJZA 2R043 3QH6A 3P6YC 1FD8A 1TMF3 2NXUA 3TA2A 5FZIA 3MEPA 1WNEA 4JQTA 1T0TV 3HSJA 3FEYB 3HVAA 1LKZA 1B09A 2O8OA 3IPVB 2JSXA 1CJUB 2ERFA 5GAGI 1TE1B 1ZZ6A 2GN7A 4LVNP 3VGSA 3CJKB 2HJIA 3QD6A 3N9NA 4K4SA 1X4AA 4WU2A 1MROA 4FFHA 3O2IA 1MQTC 3UDEA 2ES3A 1RAAB 3R2CJ 3ZXKA 4LF8J 4DFPA 5KHKA 1JXNA 2RU3A 1JK9B 3B78A 2JEFA 1UZ0A 4CH0S 2HVEA 4DV5F 1RUD3 2M2BA 3AZZA 1LXNA 3IMNA 3NVCA 5I3QA 2V5HG 2XY6A 4PJYA 2DRAA 1G3OA 3FSIA 1SQFA 3ZZUA 3LWMA 3SV4A 1WD4A 3N5FA 1BQPA 1DLOB 2AC1A 1AR63 4F3MA 4RNOA 2NS1B 2DURA 3ZYPA 5K8PA 3MEGA 1S1XA 1GP6A 1SBDA 1PAEX 2DVBA 1L3SA 3R9LA 2LEPA 1NZIA 1H8TB 2CGNA 4JHTA 2YU2A 2B4PA 3ACHA 2E5JA 4OQ9A 3KLIA 2RT3A 4Y20B 2G0JA 4M5DA 3KFWX 2DFCA 2VVEA 4BWOA 4IFVB 4J6GA 3O1VA 3UFCX 3FHQA 2ZNYA 1Q5VA 4BOWA 2MTLA 3HD2A 2IAJB 2A2DA 4OLLA 4AI2A 2EKYA 1QU0A 4JUZA 4MK9A 3MM8B 2MKSA 1SL1A 1UY0A 4TYBA 4I02A 1HN1A 5J37A 4MMOA 4UQGA 2WRMA 4GWMA 3F0NA 4XXAA 2AGPA 1REVB 1ZM2A 5HBAA 2HG4A 1LU1A 3GR1A 4BWJA 4Y1XA 5IVEA 3MLLA 1W0NA 3MGJA 1M06G 2EF6A 2FZKB 1IXKA 4RQPC 3M2VB 3V0AB 4TLRA 2GVDA 5DDOC 4LIVA 5J2MB 4DV3J 3H7JA 2JDZA 2RNEA 2NXNA 3DDKA 2MJNA 4CNZA 2HWTA 5B0GA 4QWCA 3TUPA 4LREA 3ACGA 2FJXA 3LWCA 3UCGA 2ZBJA 1CIYA 3DOMB 2DH9A 3V0AA 1N3PA 2DDUA 3ZIXA 2HZVA 3EGZA 4QX3A 3JXSA 2IRXA 1DGRA 4COZA 1APSA 3RG0A 4C8MA 1COV3 1NZ8A 5T52A 4JI5F 3ZNUA 4DPTA 2R42A 5ACA1 3CD5A 3V81B 1HBOB 1HBNB 1WMFA 1SPPB 4Q4Y3 2HGMA 2RF2A 1N0VC 9ATCB 1D1UA 4WFZA 2FY1A 1FRMA 3H8XA 4H7LA 2QO3A 4YUDA 1T03B 1JWWA 2WDBA 3M6WA 4J37A 3R8YA 2JLEA 5FK7A 4UT4A 3MMCA 5HMZA 1J59A 3AQOA 5ETVA 4LBJA 2BBEA 2HWB3 4F4KA 5DM7Q 4MXWB 4BDPA 4IFYB 3KMHA 1RHMB 3LANA 5F32A 3ES1A 3HMJG 2QUOA 4D7YA 3A3OB 2FZ2A 2QFEA 4PG8A 4GB32 2BWCA 1MMDA 3HFVA 2CJKA 3I32A 1IJFB 4WZQA 3B3QE 3T41A 2HH9A 3UCUP 3BQ2A 1SPBP 1W8NA 3AKQA 4EWDA 2MPFA 4MXWA 4RZRA 4XQ4A 4DS0A 5HLFB 3WQBA 1Y5LB 3ZOIA 3VBHC 1R7IA 2JEGA 2UVVA 3S30A 5ETLA 2D74B 2W92A 1V6IA 2J9DE 5F9NA 2R7OA 1UNBA 3GIKA 5IT9U 3QYYA 2W4PA 2QMXA 3TJ9A 2UXBJ 2XTJP 3RWNA 3V6DA 4AEKA 1D9DA 2CAJA 4DR7J 2XS7A 3PACA 4ID8A 3U27A 3GLJA 1QQP2 4P6QA 1O59A 3X29B 1RAJA 2ADCA 5GLUA 4QIEA 3ETOA 1ZNPA 3MD3A 2RM21 4QR0A 4RW4B 3EVOA 4CZSA 1HRV1 1B99A 3PRDA 3NSTA 2R6QA 5A80A 3ZXLA 4M3CA 3VZLA 2I1RA 5C25B 4EI2A 3PZPA 3PRBA 3GDBA 4MX3A 2WAOA 1S0DA 2DNHA 2JIGA 3ILLA 4OFZA 1SDDB 2CNOB 2GX8A 4K50A 4C7QA 1UA0A 1EUUA 4N41A 4C9DA 4IQMA 1CPZA 2BJEA 1MACA 1FERA 3IAM9 3UR0A 2OVUA 3TVKA 2Q4SA 4ZU7A 4LF9F 3AJZA 3FSYA 1AVBA 3MAAA 3CD0A 1VQNS 4F0KA 2RDRA 4FQ4A 1RA7A 5J2NB 4U8VA 1QEXA 2X1BA 3PJXA 1AXKA 4X4VA 1NB7A 2VZQA 3CTRA 1YBAA 2RS13 3C3VA 3GCXP 2XO6A 4YM2A 2MPUA 1FNMA 3CCJS 3L9ZA 1S4EA 1WACA 1KRIA 4JQRA 3JQJA 1RAGB 4M1KA 3UNGC 5AXKA 4O3RA 1CIWA 3HN3A 5FZAA 1H73A 4OX7A 1BQXA 1RTHA 3SEPA 3BZQA 4PG5A 2YROA 4IEQA 1J5OA 5KXDA 1OY8A 1FWPA 1BJQA 1S0OA 4LSLA 2FC9A 3N01A 5GZDA 1UCNA 3VHQA 2VR4A 1ZBA1 1G9DA 4JTOA 3MIHA 2A5ZA 4MHRA 3DXTA 3I2FA 1VC6A 2RILA 3RNSA 3EGNA 2HK3A 4CM2A 3TWZA 3E5UA 3BSOA 2RKIA 3VBSB 2XSJA 5HV0A 5F8HA 5KFQA 2W9AA 1RTZA 4Q4X2 2HWIA 1QY7A 2MY8A 3ASIA 2K9ZA 1RTJA 5C8WA 2ROEA 4RWXA 2CJAA 1W8ZA 5SV5A 4BJ0A 3ZKUA 2R061 4DR1J 1FO1A 2AQ4A 3FMWA 1S1WA 3PYEA 1IWGA 3VBSA 2XSJB 4MYEA 2BJ7A 1FEHA 3AKPA 4XBNA 4HPKA 2JD4A 3CEDA 3HAGA 3EDQB 4FYDA 5LCWL 3K7RA 4YW1A 1VBA1 2VCBA 5KT6A 4YR2A 3H8RA 7FD1A 1SLIA 2ZGMA 1P6TA 2O67A 3I3MA 1YO8A 1RWVB 3AB4B 4FPRA 3DGTA 2P5VA 1U1OA 4LFAJ 4LOTA 4KWUA 2XLFA 3QJPA 4A44A 5FZ4A 4GD4A 3UN2A 3VZIA 3A3NB 1YQ2A 2X5IB 3I2KA 1N1SA 2QFJA