3THPA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
333
structure length
304
Chain Sequence
b'TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVRRVKHFGYKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASEKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylated DNA repair protein alkB homolog 8
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 57
structure length 304
sequence length 333
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thpA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thpA01
1X5OA 4UQTA 1FO1A 2XNQA 3FEXB 2HGNA 1VQLS 2CPEA 2PE8A 1HL6A 3CF5Q 4F26A 3FEYB 3LQVA 2DNKA 1UW4A 1WEZA 1VBYA 3V4MA 3TO8A 4WCEQ 3RW6A 2FPHX 5HL7Q 3ZZYA 1L3KA 3G6ES 1ZZFA 2M8HA 2DO4A 2MKKA 2J0QD 2AD9A 2K8GA 2KXNB 3MURP 1RK8A 1KOHA 1K8AT 1H6KX 1KQSR 4WF9Q 1R8PA 1U1PA 4FXVA 3HHNB 1WG4A 2ZJQQ 1K73T 2LECA 2OTJS 1U1MA 2KU7A 3SDEA 2Q79A 3I55S 4QQBA 1WWHA 1YWXA 2CQIA 2MQOA 3UCZP 4WIIA 2X1BA 2MQLA 1VQ8S 1JJ4A 1M1KT 3NNHA 4LIRA 3VALA 2M2BA 1D8ZA 2YKAA 2YTCA 3MUTP 4PRFA 1JMTA 1M5PC 5CA5A 2DHSA 3US5A 3VAKA 1YJNS 3CCMS 1B7FA 2CPJA 2RNEA 3VAGA 3Q2TC 2RT3A 3VAHA 3MXHP 2YWKA 1NO8A 2MZJA 1OIAA 4EGLA 4F02A 2LA6A 4OZ0A 2YH1A 1URNA 2LCWA 1M5OC 2E44A 3BS9A 3TP2A 1M5VC 5DDOC 4ED5A 3PIPQ 2CPXA 5D78A 1U1KA 2MQMA 2MB0B 2B0GA 3J7ZT 2L9WA 1O0PA 1PGZA 1FJCA 4ERDA 4QPTA 2RU3A 1RKJA 2E5IA 1N52B 1VQKS 3MDFA 1WELA 3CPWR 3CCES 2L41A 4LJMA 2DNRA 4C0OC 1IQTA 4A8XA 3R1LA 5LXRA 5DDRC 2N3LA 2AYEA 3H2VE 1N88A 1F9FA 3RW7A 1WF1A 2DNLA 2F3JA 2MQQA 1SJRA 2MMYA 2CJKA 1X4EA 5GAHU 1WI6A 3JB9k 2VOOA 2DNNA 2DIUA 2DNHA 3BO3A 2KH9A 3NNCA 2MSTA 2XB2D 5JVHQ 1KOOA 1KD1T 4OZ1A 2QA4S 2MYFA 2MZRA 2A3JA 3MOJB 2CQ0A 4BS2A 2D9PA 3R27A 2EK6A 2KXHA 2XSFA 2MY8A 2YH0A 1VQ4S 3NS5A 1WHWA 2G0CA 5JVGQ 5DM7Q 2DGUA 2GO9A 2LA4A 5D77A 2I2YA 2JVOA 2KXFA 5EN1A 1H2UX 2CQ2A 4IOCQ 3EX7B 5GAGU 2DO0A 1X5PA 3CXCR 1K9MT 3CCUS 2ERRA 1A7GE 3UE2A 2KRRA 3CCVS 5LSLA 1YITS 2MZTA 2K3KA 2X1FA 3MUVP 1WHXA 4J5OA 2JX2A 3S7RA 3B4DA 1HD1A 2BZ2A 3UWTA 3CCQS 2MQNA 2KYXA 4WFNQ 5GAEU 2CQ4A 2VODA 2DNGA 2LEAA 2LKZA 1Q81T 1N54B 1X5TA 4WKRA 2MQPA 3S8SA 1Q86T 4RU2A 2OSRA 2N82B 1WI8A 4PR6A 2MHNA 4W92B 3SXLA 5CXTA 1S79A 1M5KC 3CUNA 1DBDA 2CQHA 3U1MA 2DNQA 2MKIA 3S6EA 4TU9A 1VBZA 3N9UC 2KG1A 1P27B 3BEGB 1JJ2R 2M7SA 5GVQA 2ADBA 2AYMA 2KG0A 2M9KA 1YHQS 3OW2R 3VAFA 4V19X 3MD3A 4P6QA 3UCGA 1D9AA 3G8TA 3CMAS 3PIOQ 2CPDA 2JVRA 2F9JA 1VQ9S 1X4DA 2OTLS 5IQQA 1HA1A 1VQOS 2CPZA 5ITHA 2L08A 2CQDA 2LXUA 5LJ5Y 3MI7X 2XS5A 1X4FA 3ZZZA 3VAMA 3UCUP 2DHXA 2DH7A 2LYVA 2D3OR 2QFJA 2X1GA 1VQ7S 3G9CA 2MY7A 2MKCA 1X4BA 2AYBA 1WHYA 3DXBA 3P49B 1OPIA 2X1AA 2KHCA 2DHGA 2J0SD 2KM8C 1U1QA 1Q82T 2OSQA 4Y0FA 4Y00A 3MUMP 2RRAA 2DGTA 2LEBA 2D9OA 2CQBA 4C7QA 3MD1A 2LMIA 4M5DB 1QVGR 3B4MA 1SJ3P 1SJQA 1WG1A 1QM9A 2E5JA 5IM0B 3H2UB 2N3OA 2CPHA 1DRZA 1SXLA 1Q7YT 2HYIB 2MKJA 2JRSA 4ZKAA 1WG5A 1M90T 2J76E 2KVIA 3G71S 4F25A 3UD4P 3CCLS 3G4SS 5GMKa 2CPFA 3CCSS 1VC5A 3EGNA 2MSSA 1VQPS 1U6BA 5H1SV 1N8RT 3VAIA 4CQ1A 1UFWA 5DETA 1NU4A 4LMZA 2LQ5A 4IUFA 2MGZB 2DNYA 2DISA 3CULA 2DB1A 2DGSA 1VQMS 2MJUA 4TLQA 3HI9A 1FXLA 2G1DA 4IOAQ 1X0FA 1P1TA 3S01A 5IM0A 1H2VZ 1S72S 2DK2A 1X5SA 2FC8A 1FNXH 4W90B 1BY9A 3CCRS 1U1LA 2M4MA 2E5GA 1U1RA 2U2FA 4TU8A 1ZZNA 1VBXA 5DDQC 2OJ3A 3P6YC 1WHVA 1FJEB 2QEXS 3TYTA 3CMES 1WTBA 5FJ4A 1HD0A 2KM8B 2CQPA 1JJHA 1H2TZ 3L3CA 2RQ4A 3CC2S 2M88A 3CC4S 1WF0A 1VQNS 1WEXA 2SXLA 2ZJPQ 1UP1A 2DIVA 2MGZA 3CD6S 2EK1A 2M52A 2O3DA 3THPA 1X4HA 2AYGA 3ULHA 3G8SA 4QU6A 1DZ5A 1YJWS 4QU7A 2HGLA 2MZ1A 2G4BA 2XS2A 3EGZA 2DNOA 3IWNC 1DHMA 3G96A 1FT8A 2J8AA 1YI2S 4C4WA 2LXIA 1WEYA 2FC9A 3BO4A 1G2EA 1UAWA 1YJ9S 2M70A 4PKDB 2VOPA 5DM6Q 2RS2A 1X4GA 1OWXA 1AUDA 1U1NA 1X4CA 2V94A 3DLLQ 2CPIA 4CH0S 2XS7A 3IRWP 3NS6A 3K0JA 5IFMA 2DNZA 3U1LA 4YOEA 3P5TL 2PEHA 5LXYA 4CIOA 1VQ5S 2CPYA 2HVZA 2DGQA 2M0GB 2DHAA 1PO6A 2HZCA 2RQCA 1U1OA 3CC7S 1YIJS 3CCJS 4YUDA 2EVZA 2DH9A 2MXYA 2F9DA 2FHOB 5DDPC 2ZJRQ 2ADCA 2RS8A 3BO2A 2RVJA 2MJNA 5MLCV 2CQ3A 2DGVA 1SJFA 3CTRA 2HGMA 2UP1A 2E5HA 1U2FA 1FJ7A 4FXWA 2CQ1A 2DNMA 2OIHA 3UD3P 2XNRA 5BJRA 2NZ4A 2I38A 2KRBA 2DGWA 2M8DB 3P3DA 4IO9Q 1A9NB 5LJ3Y 3SMZA 2NLWA 2N7CA 3R1HA 1VC0A 5HO4A 3I56S 2MKHA 1W2BR 1XN9A 2FY1A 1ZH5A 3LPYA 3VAJA 2CQCA 2KI2A 4WFBQ 1CVJA 1OO0B 2DNPA 1WF2A 4TU7A 2VONA 1R8HA 2MKSA 1FHTA 1X4AA 1VQ6S 3D2WA 3NMRA 2MPUA 3NNAA 1KC8T 4UY8T 2RRBA 3Q2SC 2DGOA 2JWNA 5LSOA 3THTA 2U1AA 2WBRA 2DITA 2RUGA 1U6FA 4YB1P 4Z2XA 2KFYA 5GADU 4WFAQ 2BOPA 4U67Q 2KT5A 1QVFR 1YTYA 4CH1A 1NJIT 2MZSA 2MZQA 2DH8A 3J7YU 3VF0B 1VC6A 2CQGA 2GHPA 3SDEB 5CYJA 2KN4A 2DGXA 1SJ4P
chains in the Genus database with same CATH superfamily
4PPDA 4OZXA 4B3TF 4W4ZA 4TWTA 4ATFA 4CPBD 2JEFA 3MTKA 4TN2A 4JKKA 1VRTA 4X6QB 3HMYA 3WQ0A 4DUVA 1OFNA 3N01A 1XNBA 2CNNB 5G0RB 5FZKA 3IRXA 2L3MA 3APBA 1VIXA 2BJ7A 1YRZA 3SSSA 2XWJB 3ZVXA 2FD2A 3TW0A 1RWKB 3FCWA 1SPPA 1MZFA 2FHJD 5KG1A 3HN3A 2QVSB 3GZEA 1V70A 1L7QA 4A8QA 3NGRA 4PF5A 1U49A 4JI3J 4Q4W3 1N3OA 1PKUA 1HWIA 2IRYA 4LHSA 1U0SA 4FFGA 1OUXA 2WZR1 4LTAA 4JI1J 4KB7A 3CO2A 1UOGA 2R30A 2B45X 1PC4A 2MZJA 2E9ZA 1N5SA 1TEIA 1QJY3 2ZEYA 3JU9A 3DEMA 1BWVA 1SKWA 2X09A 5KG7A 4DV2J 1EETA 3J7A1 1Q8QA 2BGPA 3B8HA 5D78A 2ZBIA 4NLWA 1AR63 1O0PA 1SDWA 3V0AA 1UKGA 1BQNA 1CJUA 3UR3C 3IWLA 4META 5JDBA 3N5BA 3BODA 1RHUB 3H3UA 3SEEA 2YWGA 4IDKB 5EWGA 4J9KA 3KNGA 4E2QA 4GKKJ 3B82A 2A5ZA 4X65F 2JENA 4K4YA 1AR72 2B3TB 3AODA 4ARXA 3CO9A 4H4OA 1KTQA 1HB4A 3BN6A 2MQQA 1G9FA 3EGWB 1PX4A 1NYWA 4RW9A 2YNFB 3FUYA 4K8RB 4Q1PA 4OUSA 2R3VA 3VBOB 1SIWB 5FRAA 1HDKA 4X4OA 2JG8A 1B64A 2CQ0A 4A3ZA 5J7MA 5K0UC 3ET6A 2JEJA 2VD7A 1Q5OA 4YARA 4AQYJ 4KNCA 5B0CA 5L9NA 5FZFA 5CFCC 3ZZRA 1HRI2 2R0HA 4OHXA 5I0UA 5IVFA 1REDA 5A6ZA 5DM7Q 4U2AA 1XR5A 4KFBB 3MECB 1JYTA 3D1OA 3IKWA 5A2QU 5D3GA 1OMIA 1H2UX 2GNTA 2H54B 2E9QA 2DO0A 3ABZA 4FPLA 1S0IA 5LT5A 2POKA 1Q78A 4COYA 2KFNA 3PUQA 1NK0A 4XUNA 3ZM8A 1C0UA 4XZPA 1NKEA 3AZVA 1IS5A 1CLFA 2B9VA 5JIAA 4XAKA 2VG6A 1GMWA 1T9TA 1OS5A 4W98A 3FN9A 2P17A 3WIVA 5C33A 3W59A 1Z2LA 5C4WC 1MS4A 3AMNA 1VBZA 1B4SA 1V0AA 1F1BB 2RS51 4YFWA 4WM8B 4EK2A 2D41A 3LOIA 4L11A 4YW5A 3AJDA 1O91A 4ES8A 1PO13 4CCOA 1RWVB 4WP3A 4FQZA 3VKNA 1UY4A 1M1GA 2QN6B 5HANA 2A6ZA 2VFTA 1W0NA 1BBT3 1YBAA 2IZWA 4DR2J 2IVJA 1XRUA 3CDWA 1GEHA 4K1YA 3ISNC 5B2GB 3RZGA 4CEWB 3IDCB 1SBDA 2Z4FA 1J59A 1KJRA 2AEYA 3MFAA 4BH9A 3ZDVA 2LUWA 4CCJA 4N53A 4MKVA 1CN1A 5E89A 5KFQA 2MKCA 3NKYA 2J9CA 4C8KA 2HQIA 4RW4A 1GH8A 5K8SA 1HNVB 2Z2SB 2V8PA 2YGMA 4Y0FA 2P1BA 3Q9OA 2QA1A 5CQGA 1LOUA 1C4AA 4NPLA 1D4VB 3HULA 2GQ2A 5T41A 2RE1A 2Z57B 4XFAA 4RUCA 1ND2C 3GV8B 3NV3A 4USMA 2ZH4A 4LKEA 1TAQA 2HHTA 1N3PA 2QQMA 3GIIA 3W2VA 4HLBA 2RAQA 2JFKA 4L8QA 3T9NA 3CCSS 4EYHB 3RMXA 4F2RA 3VKFC 5KG3A 4CQ1A 4JV2A 4S2HA 2DYCA 3DOLA 1GT8A 2Z0GA 4XXPA 1NU4A 2IM1A 5A7WA 1S1WA 1X8EA 3MM5B 5FYIA 1RTJB 2MJUA 1ZA2B 1N6QB 2RS52 5J48A 1S6QA 2FC8A 1UYPA 6AT1B 1UVMA 2M4MA 3QJLA 2VMDA 3OUIA 3R5JB 5F37A 5KHHA 2NQYA 1RBLA 3UK9A 2G9OA 4FYXB 2ZHBA 4EYIB 3ZYHA 3AQPA 3GP9A 1O5UA 2WWSA 4PF1A 3A4TA 1IOAA 2GX8A 2VG5A 5I3PA 4DZDA 2PQQA 1WOSA 3BGUA 5D0HA 1UA0A 3GJTB 1UP1A 2YNHB 2H0VA 2BJEA 2R6QA 1DZ5A 1DQ2A 1OKOA 3L2HA 2G4BA 3S6PA 2BRTA 3H9AA 4R5PB 3T0AA 3TUZC 1Z4UA 5K9YA 3WNLA 2HHHJ 4YZ5A 3DRXA 2EF6A 5KFJA 1KEKA 1K5MA 1O5JA 5IWAF 5A2QY 4E4DX 2GAUA 2DCYA 1MQTB 3LF0A 4DS4A 4IFYA 3H3ZA 5LXYA 2W24A 3HJVA 3KLIB 4LBNA 2ACMA 3DLKB 4NLRA 3J26N 3LEKA 4CO2A 3M1VB 3ETMA 1U1OA 1E6YB 4CRJA 5DRKA 3M9OB 4C8MA 2XBPA 2A1BA 1T8EA 1VJ2A 2FHOB 1S0CA 3NXZA 3HZEA 2RVJA 3EXYA 4C8LA 2DVAA 2VJXA 2ZGQA 2HGMA 5D4OA 4O3QA 5AXMA 3EPIA 2L9NA 4CE8A 4IE5A 1S0MA 4AI8A 1AXYA 4USVA 3VBFB 1TZOA 1RAJA 3PTWA 3N9MA 2RE9A 2FY1A 1KDKA 4NA3A 5J2QB 3VAJA 5FWJA 1CVNA 4H2AA 3KUHA 1VHIA 4AFDA 2IM3A 1QH7A 5FUPA 3TX0A 5KFTA 5CIRA 1JIHA 3M2UA 2OAUA 1JU4A 5EJ1B 2D3SA 1XEZA 1AXZA 1N5VA 4ANDA 1KEXA 2MPUA 2GH2A 4B4RA 5E3AA 4QPXA 1HW8A 4NPRA 4DB5A 4ZU7A 4HYKA 2QZ3A 2KL8A 4YFZA 4X66J 3PCOB 4K40A 5E3PA 4LHNA 4KHPF 4BDVB 2X5IB 2J7UA 4QX3A 2KN4A 3FFIA 4YZ4A 3PRDA 2VM9A 4BIOA 2HGNA 3CJ8A 1CGPA 3FQLA 3CF5Q 4F26A 3IAQA 5JIUA 2HBUA 3TO8A 4UW2A 5C3RA 2VL4A 4RQPC 3GR0A 3RR8A 2IDLA 2K8GA 3B54A 3T4HB 2VCMA 1VK8A 1XMBA 3DNCA 1HHTP 3SZ2A 2CJ9A 4MFBB 1YUDA 1RWMB 3PUHA 2FZ1A 3ISND 1RA7A 1B3TA 2CYYA 4ZS3A 2WFF3 2AEMA 3T1AA 2KU7A 1DTQA 4FOYA 5JR7B 3CL1A 2Y34A 1OLQA 1N1SA 3M9MB 2FHMA 2PAEA 4MGIE 3HD2A 3MM7A 1Y10A 2VMEA 4BCUA 3JS9A 1JMTA 4N8OA 2ZDPA 4CI0B 1NK4A 1JXLA 5BR8F 2FDNA 3Q8SB 1VRH1 3OCPA 2GZWA 4F2SA 3V81B 4JV5J 2VOTA 4Z7YA 4XQWA 5F39A 1K1SA 4NMIA 2E29A 1SQEA 1URNA 3FGVA 3DGTA 4HT1T 3MPWA 2Z2YB 4CLLA 4QPYA 1W6MB 4DUYJ 1JLAA 5FZEA 4XPVA 2XMLA 4TN7A 1UU5A 3U10A 1JYNA 4DFKA 4ERDA 5DDJ3 5IFPA 5KFMA 4PT6A 3IZOA 3T0BA 4ECQA 1HJGA 4BE3A 3WF4A 2ZHMA 5DZEA 4WVWA 4I68A 2HWE3 4V1PA 4ALZA 3ENAA 2VZ1A 2NN8A 2ZX1A 2FQQB 8AT1B 1SJRA 5BNPB 5IV4A 4CO4A 4M94A 4RW6B 3LEGA 4PWUA 1GX6A 2PA8D 1RXGA 1S4EA 3CEWA 5JZGC 4G65A 3CJXA 2JEIA 5BNOC 4N90A 4ILMA 1TME1 3VZIA 3IBFB 1YQCA 1RUOA 1F4HA 3M4XA 5JXGA 2F8EX 1X9TA 1WHWA 1YLLA 3K51A 2G0CA 4OYXA 2AHOB 2B4UA 1LENA 5ERLA 5A1FA 2ALZA 5I0RA 2ZZJA 3K75B 3OB8A 2RJZA 4HK9A 1MG7A 4MXWB 3W5ZA 1U26A 3LOUA 1W04A 3D4JA 3ZFEB 4H4KC 1IBMJ 2ZGSA 4HMZA 1HARA 2QSFA 4AI9A 4XF9A 3KM5A 3S7RA 4UFIA 1QSLA 2HBQB 3CCQS 4FYDA 2MQNA 5C2CA 3MW3A 1QOTA 3AJ1A 1VRH2 1ULCA 4AVVA 2CADA 2BGCA 3DLGA 3S8SA 5CB7A 3M2VA 1Q86T 2WSUA 3NKGA 3DYOA 3SXLA 4LF5J 1PM4A 1DBDA 1B35C 2DNQA 4OYZA 1W8UA 4ZS2A 3NV4A 3AP6A 2D3UA 4KMQA 5DAPA 3FZ2A 2KG1A 2QA2A 3EB7A 2QX0A 2P2KA 3MIGA 5K14B 1Y5LB 2VQ0A 2Z58B 4GKJJ 5G0RA 4ETXA 5D0RA 4CNYA 4AHXA 3IGNA 3P3PA 4PG6A 4RLEA 1FEEA 4PXBA 1N5QA 4QKNA 2NZCA 2FVSA 5KT2A 5B09A 1FNMA 4XMIA 5F3CA 3J81U 1JS9A 3I59B 3UDLA 2F5GA 2XS5A 1NCQC 3ME2A 1RU2A 2JEGA 1WSRA 1LU2A 3M6WA 4OYMA 1NB2A 1UJ5A 4ER8A 1REFA 1VP6A 2A3WA 3KG0A 1V6MA 4YR0A 2H3EB 1TME2 1HQNA 2VBDA 1PYSB 3OY8B 3TUPA 4DPOA 3OTEA 2W68A 3M8PA 4Y4YA 2AYBA 4P14A 4YW2A 4CO1A 3L9JT 4ED1A 4HONA 2WB4A 2J0SD 1FV3A 4BXFA 2HFSA 3F44A 5KOXA 1U8WA 3JSMA 1CAXB 2D9OA 3DU6A 3BGLA 1HKAA 2DCTA 4IG0B 5CCMA 2AGQA 4QKDA 5LMUF 3ILJA 2XJUA 5JLVA 3WNXA 3HHLC 1ZRRA 2DCUB 4Y34A 2J76E 3LCPA 4XF1A 1RUE1 4YQWA 4AHYA 1XYNA 1PCAA 3G4SS 2OPSA 3W3SA 5FO9B 3ZTSA 1IBKJ 1VQPS 1TAUA 5E5NA 5M2RA 1RDRA 1UFWA 4XILA 5DETA 3WZ1A 4LULA 3BUCA 4B1MA 1RKIA 5B4NA 2AYHA 3WY6A 4K2XA 3QOPA 3VBOA 3MMCB 4B9MA 3HKWA 3RZMA 4U7UD 4QPWA 1S10A 2G0JA 3BJYA 1U1LA 4G4FA 3S30A 3GJAA 2E5GA 5MAOA 4KH0B 4CA9A 4YFUA 5DG2A 2A73B 2WUHA 2D6MA 3NCQA 3AD8C 4KFBA 4F8RA 3MECA 5C8WA 1JLCB 3BU0A 5AC93 1WEXA 2Q8DA 1TKTB 1DZRA 1FFGB 1N5TA 2X29A 4Q4V3 4C2MA 5EYYA 2BRLA 4CP1A 2MGZA 2O3DA 2QCSB 2YHJA 4QU6A 4IL7A 1I6JA 4QD2A 1AYEA 3DRYA 4MK7A 4USIA 3N36A 1H8VA 2XHCA 2WO2A 2FDGA 4KGGA 5EWFA 4RR5A 4YB6A 1NNDA 1YX2A 4DPYA 3ZX7A 2BM1A 3LTOA 1QJX3 1UMJA 3DLLQ 4QX5A 2KZZA 2NXEA 3V6DB 1NPKA 3W9JA 3ILRA 3OTDA 2I74A 1WOOA 1FK9A 3RJMB 3OTFA 1VBD1 3FMGA 1UPSA 3O1LA 1MZ5A 3QWPA 2P34A 3KZ4C 1AR83 2FLNA 1RUE2 5IVJA 2CGPA 3U75A 4MJKA 1HQWA 1OOPB 4XBLA 2F9DA 1CC8A 1TQ5A 2A70A 3FRZA 1SJFA 2B43A 3R5CA 2C2EA 5A8KB 1E5SA 5KFZA 2OVUA 1W8OA 5L36A 3QATA 1ASJ1 4LO8A 3UO0A 2I38A 4DI6A 3KV5A 1XOYA 3J8F3 4CDWB 2PHTA 3R6GB 4X84A 2VL1A 1V9U1 4FKYA 2Y0BB 5I3UA 2HVDA 4K4WA 1MEC1 4D69A 2J9EA 4XYXA 2R071 3W5NA 1Y3KA 2VONA 2XQCA 1R8HA 5JAXA 4AF9A 4K0KF 4YVWB 1HFEL 5A8WA 4QYZK 1YJRA 3D5OA 2ZACA 3KNAA 4BU2A 3DXSX 5F6LB 4DFJA 1XU2A 3J81Y 1F2HA 3IO1A 4CP0A 4LF8F 5CKMA 2D6OX 4Q0VA 1QJU1 1RGSA 4GRSA 1G4CA 3ST7A 1IUJA 3LSEA 1JLQB 3K48A 1MSWD 2Y26A 1QJHA 1KHWA 4F3OA 4C1XA 3B78A 3T19A 3CIHA 1QDUB 1OHFA 3DN7A 4FBFA 2CPEA 4NLYA 4Y2KA 1RT1A 3I9V9 1UW4A 4Q0BA 4XJAA 2W95A 3H7YA 2GGPB 3NCRA 2XLGA 2EA7A 3MM5A 1OSGA 2R063 1RTJA 4PWWA 2LXFA 2ZEJA 4FOWA 2J0WA 1EHWA 4NLXA 1VBD2 4XDQA 3BPSP 3TR5A 3WDTA 1DLOB 3WW3A 5AXKA 5DZ7A 3HHNB 2DVFA 4DR7F 1UXXX 4LORA 5FK8A 2W1UA 1UPMB 3NOGA 4ZPIA 5A76A 1JU3A 4URQU 3L7PA 4LIRA 5A32A 3V6HA 1FNOA 2ZZMA 1HWJA 1ASJ2 4ZLPA 1U5ZA 4ID8A 1S1UB 4QB2A 3VBHB 4IYQA 5IVCA 2ZH1A 4RPFA 1V9U2 2CNOB 4D6SA 2QQWA 4R5PA 5C24B 2RMU2 3KFWX 5FPLA 1MEC2 2J1RA 5KFIA 5JWPA 2AP6A 1GSLA 5DAXA 1UKRA 4NA2A 2R072 5IVVA 3PYGA 1W6QB 2XEXA 2G2ZA 3GYXB 1T3OA 4KO0B 2A6WA 1GU3A 4QKFA 4K4UA 1RKJA 4RR3B 5L1IA 1SUQA 4UW4A 3MDFA 1N36J 1MLAA 1FRLA 2L41A 2VOKA 5FYUA 2DNRA 4K4XA 3M3EA 1AYM1 4EWDA 1ZZ9A 3MPDA 4CO5A 2RKIB 3PYEA 2W4CA 3ZNUA 1WC0A 1QJU2 1JH5A 1XR7A 4FF1A 5H9SA 1JZ6A 2JG9B 2QQPA 3D28A 2RUSA 1U02A 1FVQA 3LQCA 1S9EA 1PBAA 1KD1T 4NI2A 5B08A 3ELHA 4OZ1A 2QA4S 3E5XA 2A6XA 2MYFA 1S9GA 2FJDB 1ZAXA 4AQ6A 4E27A 3TRGA 4BBYA 1IZ3A 2J1EA 3SXWA 3ZSJA 2JVOA 1QXPA 2ADDA 4FPOB 3CZUA 1AFJA 3VL9A 5A3UA 1T7PA 4Z1VA 4KSEB 1H0BA 3UETA 2EAAA 2CJXB 4Q8EA 1T03A 4OI2A 2I0XA 5LSLA 3MZHA 2FVPA 3RJ2X 1HN1A 2EBEA 3GPAA 2X1FA 1Q95G 1DZQA 1HD1A 4IE4A 4D0QA 1LODA 3HR9A 1RU1A 2IXCA 1C57A 4A8WA 2LROA 4PXDA 3WQPA 2EXIA 3VD4A 3CHXA 4DZ6A 2VUCA 2J6UA 1NDPA 8RUCA 2VH9A 3RU0A 3B69A 2O0OA 2BQPA 2CQHA 4M0NA 3KK1A 2MKIA 1YQHA 4NWWA 5KXBA 1LAJA 5A3LA 3CDEA 3PYDA 2GV1A 2MLYA 2IVIB 4FTBA 3PXGa 2VCAA 1HQUA 1FKOB 3GCWA 3KLGB 3VAFA 1RUJ1 3MD3A 1W6PB 4MIAA 4AFFA 2PA7A 1AYM2 2IRUA 1FRJA 4YW6A 4XPCA 3ZSEA 2F9JA 4P5HA 1LHOA 5FKBA 2PLV1 1X4DA 5EX0A 4GVLA 4MFBA 2CPZA 1LQ9A 1M5SA 1DQ8A 3CKHA 4DXTA 1HKDA 1KQKA 1YVFA 3SLIA 3SH4A 1NXD1 3R8YA 2XJRA 3UCUP 1A8MA 3D68A 5GLVA 1U8SA 4RW7B 4WM7C 4LREA 2OUJA 2W52A 4GQ7A 2X1GA 2AEZA 4G6VB 2AMCB 5K0UA 4ECSA 1EY2A 1X4BA 2VXJA 4OVEA 4X6RB 2EC0A 1RYRA 1KFUL 3DDKA 4DV5F 2KHCA 1OH4A 5CFCA 4ZVPB 4WZQA 2IYGA 1VBA1 1DBNA 2XYPB 1O6XA 1VCTA 3PL0A 2ZWPA 1F3FA 3GCXP 1R0AB 3D1HA 3USSA 4F50A 2JDPA 3TI0A 1F2NA 2C1FA 2CPHA 1W6MA 3GFZA 3PVOA 3POEA 5EWEA 2RV9A 1H7WA 4D3HA 4IGQA 3OBAA 4HVQA 1MWZA 3HK2A 1AX2A 5D8AB 4JI2F 3CCLS 2HVHA 5GMKa 3DOKB 1NH8A 1TL1B 5IK8A 1S4FA 4MGQA 4CDXB 4HG6B 2IFXA 3VGUA 2DRBA 4QYRA 3QNWB 3HHDA 2VOXA 5C4WA 3ZO0B 3D54A 3W2WB 2DGSA 1UJ6A 4XK8C 2P3JA 2JB4A 3ZZPA 4B08A 4ECVA 2AKWB 1OUSA 4DPUA 1RYSA 1RUJ2 1U1RA 5J96B 2U2FA 3RDIA 4J9OA 3KTQA 4M5HA 1KN6A 2QQUA 5GZFA 2VC0A 4BWJA 1CJPA 4P2MA 2PLV2 2Q66A 3DHXA 2RQ4A 4ISRA 1WF0A 1VQNS 1K1QA 2HNDB 2IMOA 2E51A 5FIIA 2UUBJ 4QCLA 2FYXA 4KGQA 3THPA 2ZBJA 3I3MA 3I5BA 1SHWB 1RB8G 3QO9B 3H8RA 2Q1LA 3CCZA 1KFXL 4EUVA 4AL5A 1YI2S 1OVSA 3IMQJ 1NHVA 5D4NA 2D3PA 2BV3A 1ENRA 5DLGA 1RT3A 1VBA2 4A7ZA 3AA9A 3MEPA 2V94A 2RDSA 5BY5A 2CJAA 2BNMA 3FC0A 3NMAA 3WNKA 4BK4A 2GC8A 2R2RA 2XJPA 3D3AA 4CIOA 2QMXA 4CP2A 4LFCJ 2P3YA 2XWXA 4OLLA 5F32A 1ZM2A 3NRUA 1NE6A 4KQ7A 2AJ1A 3DM2B 4FXDA 5K14A 1MWYA 1IKVA 3THDA 1CC7A 2Y6KA 1ZBA2 3OPWA 2C6SA 2F1FA 4CU7A 1EYBA 4PDWC 1O3QA 2A6OA 2FGOA 4FNIA 5THWA 4QQ2A 4N47A 2XZWA 5HI7A 5LBCA 1H98A 1B99A 4FXWA 1TMF3 5E8AA 2HHUA 3O0VA 4AL9A 1OPZA 2YDEA 2YKMB 3MPYA 1YFUA 2YX4A 2HWD1 3N6NA 3M70A 4AE2A 3WQBA 3OUYB 2CWKA 1G1XA 3JQWA 4WFBQ 4C97A 2HSEB 4GO5X 1BHNA 2H5JB 3CIMA 2DURA 3KKFA 2ZUAA 1TL3B 5IHRA 1JLEB 3GG1A 1FYUA 3UN3A 1CAXA 3D0GE 4OUMA 2LLZA 2RRBA 4IG0A 3PR5B 4LF4J 3Q2SC 2JWNA 1RTIB 2IDEA 4CLYA 4WU3A 3PRVA 1ZRIA 2VFUA 1Q5YA 2P6CA 4XXAA 3ENVA 1N4LA 1UVLA 3RB3A 2LQ9A 1G9AA 2HFOA 1UJ4A 4IH7A 2B8QA 3LP0A 2P5VA 1WW4A 5BYQA 4JYAJ 1ALYA 4OHYA 1Z1ZA 4HVZA 5F8PA 1DGRA 4BA6A 3A8KA 2WHOA 5DN2A 3J80U 4N7TA 3GILA 3WINE 2QDRA 2WNUC 3SCLE 2NCKL 4XQ4A 5C3QA 1N47A 2W87A 2AD9A 4LFAJ 3LAKA 2K3IA 4KKOB 5ETKA 1AZSA 1K8AT 3BOPA 5SV8A 3WDUA 1MNEA 2OO4A 3QGHA 4U6PA 5E1RA 5FDBA 3WX8A 1VQSA 2D40A 1H73A 1J1LA 1GP4A 2ZH3A 3S7EA 2ZBPA 5LRRA 1XE8A 2VHGA 4I3PA 9RUBA 1XE7A 5CHCB 4DR6J 1YWXA 2PMHA 1U12A 1S2BA 4GALA 7FD1A 1RCXB 2XO6A 2J1UA 5SZTA 1RI7A 2DT9A 2WWJA 5A6YA 5FBJA 2HQGA 2RNEA 2RQKA 1PGSA 2HWD2 1T05B 4LR8A 5J1NA 1BLZA 2JLFA 4AEDC 1HRV1 2R7WA 4XDDA 4GA9A 4ZP8A 4ZHNA 3N7LA 4Y5SA 4YGEA 4IV3B 3SEPA 1VBC1 3TP2A 5BYRA 3NVCA 2XZDB 5LW9A 4XF4A 1FRHA 2HFVA 5FZHA 3W8GA 3GXUA 5DG8A 4JGZB 2YKNA 1S99A 3SKJE 2JC1A 5HMXA 3HO1A 1WELA 1X0PA 2J9DE 1TE1B 3ZN6B 1SH2A 2EC2A 1Y3JA 1VAVA 1PK6B 2H1YA 4N9HA 3T5KA 4LFBF 4FPIA 1COV1 1WF1A 3CE8A 3BKFA 3T6JA 1HMVB 3OBZA 4DX6A 1RT5A 3T5HA 3T0DA 4PG5A 2MMYA 5A6PA 2VO5A 4HKLA 3ZZTA 5CEHA 4B3OB 1HRI3 2RS11 3DRSB 3LP2A 4GKKF 2F4VF 2ATCB 3I4HX 1OOPA 2VNRA 2C2OB 3DMJB 2QLXA 2CNKB 4I2PB 4X4TA 5ETLA 1AUYA 4CZSA 4DG1B 1R093 4QX2A 3BGFA 1PHMA 5A8KA 4CUAA 1YFYA 4DSFA 1WUUA 4RQPA 4DR1J 2Y6HA 1GNZA 3NS5A 4J9VA 4L75A 4MYUA 2XQRA 1R8BA 4CDWA 4QX8A 4NX9A 4QWEA 2N4CA 4IOCQ 4EN9B 4AQYF 2EFNA 4DXLA 1BQPA 3WNMA 2ERRA 3VBUC 2R7RA 2K3KA 2R8GA 1KQGB 2D74B 4YVWA 4CCKA 4DV6J 4HL9A 2XJVA 1W6OB 2TUNA 2WQZC 2GQCA 1VBE3 4NJ4A 1BJQA 2VODA 4QPGC 5D15A 4IEXA 4WKRA 2BKPA 3LDRA 3KHBA 4FPJA 2XXZA 1UAIA 2V67A 1WKJA 3AOAA 3TAYA 2DPJA 1HRV2 3M6XA 4IGPA 1JLQA 2ZMLA 1QOOA 5KFLA 3UI3A 1Y00A 4L72B 4AAPA 2FDFA 3R05A 2AR6A 4AGGA 1YRUA 3OL9A 3H1WA 2H5EA 4YMEA 4DN0A 1YHQS 2ZNYA 3HMJG 2GGPA 3DKDA 5DUWA 1DTTA 2HRTA 1UYZA 4EYUA 3RB0A 3OUHA 1L5UA 1NSQA 4UOJA 4A7YA 1COV2 4AEKA 2OTLS 1DLCA 3M32A 5KR7A 4USWA 1T2XA 1OF4A 1DLOA 1I9RA 1EP4B 2LXUA 1XXNA 5CFDB 2V50A 2RS12 4YEAA 4ICLB 1BD6A 5AJ3J 4K4VA 5FBZA 4B3SJ 2VTXJ 5JZGA 1OI6A 4SBVA 4DFPA 1N0UA 3NLCA 4Q26A 2AW0A 1NDKA 3J80Y 1O8BA 5LL6d 4O3PA 4JTNA 5IK5A 1OH3A 1UNBA 2C2DA 4A6OA 4HLTA 2X7IA 1X8MA 1HW5A 4ZVGA 4RL1A 3V65A 3GG0A 3ACGA 2BZDA 3CDBA 2JDNA 3WHUA 1LJ7A 5B0FA 3VBHA 4KHMA 3VCDA 3PTRB 3UD5A 4O0NA 1GWKA 4KWJA 5FMCA 1WG1A 2C2RA 2Y64A 2WL1A 3H2UB 1SXLA 1HJFA 1H4HA 4OZ3A 1ND3B 3BKZA 4WPAA 1W28A 4Q4W1 3M3IA 5F7UA 4RR3A 3ZYFA 1ZZCA 4URAA 4K4TA 5T50A 3A23A 4CP9B 1PZ9A 2RVAA 3I32A 1N0VC 2GVZA 4U8VA 3TQEA 5ISLA 2RKIA 4ZP9A 4CUGA 1NHUA 3O0XA 1LWXA 1TK5A 1H8TC 1IPJA 2LQ5A 2Q43A 1KLMB 1SQ4A 3EWGA 4TYSA 4LQ9A 2E1RA 2H0BA 2V0NA 1W39A 1B35A 1QJY1 2VICA 3BZQA 5D1IA 4KTQA 4B3TJ 1P1TA 5F8JA 4G3IA 1NDCA 4MGZE 1AR61 2P2CB 3FSIA 3QGIA 3KD4A 4FZVA 4IESA 1H2MA 2V8HA 2HEVF 2Y1LB 3TYTA 3OVBA 4NLUA 4ZONA 1HD0A 3DLEA 2YMZA 2CQPA 2KM8B 2B51A 3IPVA 5F3GA 2M88A 4CT8A 5FCCA 2SXLA 2ROGA 3CB4A 2ZGMA 2BJ9A 4TY9A 1PO21 3RZZA 4Y22A 1NCQA 4M01A 4YW7A 3LFIA 5T14A 3D3BJ 1X4HA 2CVIA 3D4KA 1ZZBA 2FLOA 4JGYB 5FYSA 5JMNA 4BISA 3WP3A 4F36A 2XYHB 1I51B 1TKXB 5GLWA 2BEOA 1H3DA 2YKOA 5BNNC 1YC61 1X9PA 3KG1A 5BPXA 1DARA 2WCXA 1US2A 3ZXDA 4AHWA 1H30A 1W9TA 4Q4Y3 5FY9A 4TTGA 2KT2A 3MMBA 1L3JA 4CP5A 3T30A 4YZ3A 3I2OA 1UVKA 1RAIB 2HVZA 2QRRA 4WYWA 2ZC3A 3HHLA 2W47A 4Q4W2 2YNIB 1MMLA 3EMRA 3HNYM 1YIJS 4QWBA 1DGWX 1WMXA 4YUDA 3DFEA 1XJAA 2D6LX 1W03A 4X65J 1W9WA 2BR0A 1S0EA 1M0SA 3ZZUA 4QXHA 1W8WA 3GZAA 2QO3A 2OIHA 4CDUB 3VKLA 5D0GA 1CR7A 1K0TA 3LA7A 2VFVA 1W2AX 4IO9Q 2BANB 4L3NA 4X4RA 4HI2A 1AR62 1U25A 5FPUA 4FN5A 4KHRA 5B0AA 2CQCA 2J1SA 3EICA 1GV9A 4M5IA 3ETQA 1T11A 2KVQE 2O8QA 2D97A 2VTXA 2YY1A 1C1CB 1DIWA 1VPHA 2XC9A 2ZKNA 3OBRA 2DCKA 1BBT1 3OL7A 1FERA 1TNFA 4NRMA 2HRUA 5FP9A 2B7CB 1PO22 4UY8T 3HJFA 1IS3A 3C6UA 4O4GB 3TVYA 3IWXA 1YG0A 4Y26A 3RGIA 2IBOA 2Y8YA 2MEV3 3M8WA 1YTYA 1IVZA 2MZSA 2BKOA 3OD4A 1CJKB 2YV8A 4A6SA 1ZPVA 4DR3J 4INDA 4ED2A 4RWXA 3MIBA 4IE7A 2XNQA 3DOKA 4P10A 2CGNA 1YZ6A 1UX6A 4KGKA 1TL1A 4CDXA 4CT9A 4IE6A 1ZM3A 2PFWA 3RW6A 2XTJP 3POTB 2ZKLA 3ELNA 1L3KA 3S57A 5FYMA 3E3XA 3HSJA 2OUGA 3EUNA 4DV0J 3W2WA 3H50A 3BSNA 4DDFA 1I94F 4JI4F 3AL6A 4MGYE 5F3IA 3GYDA 3OXFA 2HHQA 3B93A 4P9IA 2DRDA 5JSOA 2LDYA 4M4RA 5LA9A 3IA0A 3FJSA 3IFEA 4XFFA 3DHWC 1EZZB 4LO4B 2KYZA 5DO2A 1RAOA 3NQHA 4TLGA 2ARCA 2VMGA 2WNVC 5F3ZA 5IW0A 2GIFA 2R42A 5LEJA 2QL9B 5A6XA 5CG9A 1OJ4A 2CQIA 3DYPA 1K12A 2RDIA 5FOJB 3MMAA 1MR5A 4KWUA 4WIIA 1RE1B 3IN5A 1C4RA 1WWYA 1L3SA 3POWA 4CLSA 1TKZB 2QLJB 4EI2A 2UUAF 4YGDA 4YVSB 4OULA 2W5FA 3LWCA 5FOBB 4YW1A 3VAHA 2RQMA 4QMAA 1RBAA 2FZKB 1AFIA 1HBUB 2YWKA 4X4UA 4EGLA 4DX8H 2YH1A 2XB6C 3RAQA 5CH7B 1XC9A 4Y3CA 2WWUA 3MEEB 1ZA7A 1XNQJ 4UI9L 1UYXA 4ED5A 3O8WA 1O6UA 3ILFA 2DTWA 4W65A 5GZCA 2H65B 1OXCA 4XURA 2L9WA 3PTYA 2BJ1A 4O9EA 4Y5TA 2M5YA 5E0OA 2QTWB 1BMQB 1BBT2 4NL5A 4ED7A 1UZHA 3R0RA 1NT0A 4CEYC 1JXEA 3V64A 4ES3A 2QQVA 4I30A 4X4VA 1TTHB 2DVGA 3EYZA 2N3LA 2OLWA 3ZN4A 3HM9A 1TL7B 1US3A 5FY7A 1QMJA 1X4EA 3DM2A 1IKWB 1WI6A 2BDPA 2DIUA 1RABB 3BO3A 1W90A 3GALA 5F2SA 3I0RB 1FWPA 3T2OA 1CAVB 1RUNA 1IPSA 2MZRA 2X3GA 1BYHA 2HNZA 4FPFA 3KUGA 2ZFHA 4KC5A 3ZOIA 4YW3A 1S0FA 2ZH8A 5FYTA 2WFPA 3MIFA 4BC7A 2EFGA 5FYZA 3O5SA 5EFUA 4DV4F 1LOBA 3UR0A 2VGDA 3KV6A 4OHZA 2IJNA 4HH0A 3UV9A 2ZKUA 3OUYA 3BVCA 1ULRA 9ATCB 1TVRA 2BWAA 3AXKA 4U7UK 3ECQA 5SUHA 1WHXA 1U6ZA 2XGQA 2VBWA 2JX2A 3W20A 5CA6A 3HBKA 3KHGA 1JLBA 1F9EB 4EV0A 5JI9A 1SC1B 3ASIA 2QJ3A 4A2UA 1NK7A 2WO1A 4U96A 2YXLA 4BQ3A 2OSRA 4HK8A 1IWAA 1RITA 1FKPA 1D0HA 3ZMNA 3LANA 4OL8A 4IKAA 3AB4B 2G19A 1SBRA 5I3QA 4O4RA 4CCHA 5KFHA 2DR7A 2ADBA 5FZ1A 2FCVA 4LF2A 3M7VA 5A3NA 4UOHA 3VHRA 3WG1A 1Q53A 3T41A 3OW2R 1GOHA 2DTJA 3O1OA 5IWAJ 2OA2A 3INAA 3ETOA 3EYPA 2VXRA 3FLRA 1ZREA 4UUXA 2CPDA 1UX7A 5FZ4A 5FZIA 4NN0A 4YR2A 2XMJA 4FFIA 1H8TB 4AL6A 5KFFA 4GH4B 1ZYBA 3CDZB 4HKWA 2EVXA 4IEWA 4F3MA 1EP0A 1WMFA 4GWIA 2YBVA 3OHAA 2CSGA 4K8FA 5IJRA 2CU5A 1XBWA 1IQZA 2V5YA 2F7VA 2OD4A 2WSEC 4LRFA 2CWXA 4HI1A 3BTAA 2HK2A 2WRAA 4DMZA 2ZGTA 2BWCA 3E5UA 1S1AA 1VJWA 1QNYA 1QHDA 3V6JA 2GNMA 2R7OA 3NAPB 2EFOA 3NJVA 2ZXQA 3C7GA 2DGTA 2AC1A 4MT1A 1Q0NA 3ACFA 5G05L 3AT1B 4IV3A 3OSPA 1UZYA 2WFF1 1AL23 2NSCA 3SC7X 3T5JA 4LVOP 3V0BB 2VZTA 2JRSA 4ZZ5A 4NHYA 2VZPA 4JGZA 3VDDC 5DAWA 1K42A 1KP6A 3UD4P 1ZRDA 2KB2A 2WONB 3GBFA 2BTVC 3DXTA 1IBLF 2D98A 3KYLA 1VALA 2UVUA 1RHQB 1HMVA 1NCLA 3TZZA 4IUFA 4KHPJ 5HVGA 4B3OA 2ARBA 3RAXA 3NO8A 1E6VA 4HKOA 3LPEA 1IBKF 4XCAA 3QCWA 5A8RB 5APAA 1WUVA 4JKLA 4I2PA 4XUTA 3CCRS 1PJ7A 1R6YA 1F6TA 4ED3A 3GHNA 4DG1A 5DDJ1 1R6VA 2MNGA 4RL7A 4AQTA 3HSGA 1GTEA 2V68A 3RGBA 3U1NA 4JHZA 1M06G 3MLKA 3LPGA 4HFSA 3VTIA 4F7VA 5FJ4A 3BOWA 4LBQB 2XLKA 1S49A 4A8MP 3LPFA 1F2GA 4B9TA 3FBYA 3LWLA 1D2QA 1WMDA 4I2OA 2UYBA 2OGUA 4H14A 1HHSA 5FREA 3DECA 3MPPG 5HXMA 1HQEB 5EUHA 3LDBA 4EMDA 1DHMA 5EWSA 4FYVB 3FQKA 3O44A 1BVVA 4A46A 4F0MA 1W6OA 3AD7C 4JBCA 2CDQA 3SCIE 4E8UA 3ITHB 1YJ9S 2V2KA 4I6YA 3VV1A 3K89A 2I45A 4XAAA 1V5IB 1T6BX 5KC6A 1KS5A 2Y8KA 1CSJA 3IRWP 3BM7A 3NS6A 3K0JA 1LWEB 4XW3A 2XSJA 4COUA 2HLUA 1IG0A 2Z4PA 3M2MA 5CKNA 2JKXA 4YOEA 1VQ5S 2HW3A 2WFF2 4FPRA 2MDAA 2EAKA 3N35A 2DHAA 3ZLIA 1JZ7A 1YIPA 4FTEA 4A8YA 4PBOA 3U1XA 4AGRA 2ZBQA 1DU3D 4LE4A 2VPWB 4ASLA 2MJNA 5T54A 4DSKA 3DRRA 1C1LA 4FDFA 2GJIA 4GXLA 4L9BA 4TLFA 3UD3P 4YG0A 1HPZB 3J81j 4WFYA 3OR2A 3R9LA 3LFMA 4ICLA 1PVC3 4IUGA 2DBNA 5FPXA 2DY9A 5FYYA 3SKVA 4B1LA 3VLBB 5LJ3Y 2E5LF 1K45A 1O4TA 2N7CA 4CXWA 3R1HA 1AZDA 3B6BA 5DABA 4Z37A 5EGYA 5DDJ2 4R9BA 1GBGA 3GSDA 3IDBB 3NV1A 3R5AA 3DU5A 1GQGA 3DPRB 1HBOA 1SACA 3PU8A 4N53C 1S6PB 2X53S 1RWNB 5J1XA 1IR1A 2UZAA 3D0SA 2HBYB 4XJ9A 4ZP6A 3ZKYA 2C22A 2OW4A 1D7PM 3UGGA 2U1AA 2DITA 2R042 2VNGA 3MHYA 1S0OA 1JKHB 4OZLA 1N32F 3UW1A 3PNIA 3DDNA 5KG4A 3LA3A 2OKXA 2B9UA 1RISA 2ENRA 1RAEB 1BHGA 5J2MB 2IWGB 1XU1A 4YP3A 2VQEJ 1ZM1A 4RS5C 3TZWA 3ITQA 4IEQA 2W94A 4ILLA 5CYQB 3BDEA 2QLBB 1FXZA 1ZAWA 4EFAC 3V4MA 3W7BA 3OPKA 3CD7A 2R0FA 5J2NB 2VUGA 4EQVA 2GHVC 3WEZA 4ZOSA 2ZCWA 4QX1A 5DUUA 1PIV2 2QE3A 2XG3A 3OD0A 1ASJ3 1TNRA 4IG3A 1OSDA 1X7VA 4FPGA 3PIJA 2ZJQQ 5I0SA 1B0VA 2OPPB 1JLFB 3M3OA 3ZYGA 3EHKA 2Q79A 3QZ8A 4D3WA 2BQ3A 4PDWA 1CX4A 1UF2C 1V9U3 1NA1B 1PG5B 1OA2A 1VQ8S 2RMU3 2H48B 2JDJA 1Z7S1 2YTCA 4BJ0A 2R073 3QIDA 3TRSB 2HWC1 3MIHA 3BTYA 2AZ5A 3M2RB 1V00A 2ZTNA 2OFGX 4JHTA 1OIAA 5DLFA 4HOOA 2LCWA 3ZFFC 3MHZA 5C9AC 1YI9A 8ATCB 1JI6A 2EIEA 1PVXA 1TKXA 4DX7A 5CZXA 1IKXA 1FJCA 1CAUB 3RAMA 5C25A 1UETA 1VQKS 3P4UB 2DVDA 1UZWA 3ZPYA 4CU6A 3CCES 3H4DA 1PNGA 4D6QA 4IGOA 1VS3A 4C0OC 1H38A 5AC91 5GZEA 3MM9B 3OVAA 4NHKA 3CBNA 4NE9C 5JMOA 4Q4V1 5LMUJ 3UPFA 3T5LA 1ODNA 2CZ9A 2CIMA 3ZSLA 1UQXA 1IJFB 2B39A 3KUEA 3AYDA 2XMUA 3RQ0A 3IAPA 3UL2A 3IR7B 2D3RA 5CYMB 2FD8A 4LUMA 3MPBA 4U36A 2A2DA 1JOPA 2AREA 4UFKA 2NS1B 4FBTA 5FV3A 1LKZA 4NAOA 2GS8A 3GFHA 4KH1B 3I5AA 4QT6A 3PW7A 5CAZA 2WNUA 3J7YI 3OBTA 1SCRA 1JZ3A 1MU2B 1TV6B 1QOSA 1VAKA 1QJEA 4OJ1A 1DFQA 2BANA 1ENSA 2KXFA 1MZ6A 3BPSA 1CJTB 3P96A 1SZBA 3IAM9 1AR81 1Z0HA 1R89A 3ZYJB 1SC6A 2HQFA 1RT6B 4OFGA 5EX3A 1LOEA 5T5PA 2G2YA 1NLQA 3TAMB 4NWVA 1R64A 1VMFA 2P6SA 4RNNA 2BOAA 3B4DA 4I02A 1S59A 1RT7A 1Z7S2 1RXFA 2DJWA 4NWBA 1NUKA 4J91A 2HWC2 3BGOP 1Y11A 3WC2A 5CABA 1W2UA 2LALA 2VQFF 3MOZA 3U14A 2KT3A 3J8F1 1GMWD 4Y28C 5DQIA 5K7PA 5CXTA 1OKQA 4P9WA 4AEDA 1AYM3 4Q27A 2P5BA 4ZK7M 4P9YA 2DUPA 2D93A 1A6CA 3AMQA 3IS9B 1JJ2R 2H4YB 5GVQA 1KXGA 2LW8A 1BGXT 1NJWA 1LV5A 4N43B 3VD5A 1BUXA 4ECZA 4OYOA 3I3EA 3MIDA 4DIQA 3DGVA 1FXRA 2M3DA 1ZZ7A 1Y3TA 3POTA 3PKMA 5FP7A 5AC92 1JZ4A 4Q4V2 5L1JA 1AX0A 1PGL2 3MO4A 3L4BC 2NR0A 1LWFA 3TJ8A 4I0BA 4UF4A 4QOTA 2XMKA 3HEIA 3GYNA 5FJHA 2RDJA 1Q8PA 5FPZA 5J1EA 4QU2A 1LNQA 1SKUB 4B3NA 4NEZA 2AACA 2HS4A 2PFDA 3TWIA 1T0TV 1SI9A 2HIQA 2AF6A 1HLCA 3THVA 2UU9F 2FZGB 4NLTA 5C42B 1RWPB 2R061 2Y60A 2HFNA 3RBEA 3MI8A 3K4DA 4ZJQA 2GIRA 1S7IA 3VR1A 2FDHA 3OFHA 3Q86A 1V9OA 3QRQA 3EDQB 2E5JA 5IM0B 4C98A 1JYWA 1DRZA 2F8HA 1KS2A 4EBEA 1LNSA 2HYIB 3VBUA 4QHZA 4AT1B 3QZ7A 4ZKAA 5ETNA 2HHPA 3OLAA 2QTWA 4F25A 5C8CB 1BK0A 3C15A 1OD5A 3FLPA 3SCHA 1KFDA 4IETA 5F0UA 2FVCA 3RSJA 4DPNA 2ZHNA 3WUDA 3C6TB 3QQCD 2QMWA 1VC5A 4QPGA 4LF8J 3NV2A 5KWRA 3TJ9A 2VKZG 1HNIB 1H9PA 3HHEA 3J8F2 3SCFA 3HPNA 4D8MA 3VQSA 3DYAB 1NSAA 4ES1A 2ZHAA 2J7MA 3GFXA 1C4CA 4ED0A 4UFHA 3FZBA 2PLV3 4P9GA 4FTSA 1UEVA 4UOGA 3WQ1A 1TZ0A 2G4IA 2CHHA 2K06A 2GJFA 2ZVSA 2E31A 4L99A 4R9DA 3LO3A 2P3IA 4DL3A 5KFXA 1W9SA 1UMIA 2RHQB 2XWYA 5A3WA 4WU2A 1LWCB 2GC2A 5HP1B 1J2VA 1RGVA 2RRNA 4DEZA 3WP4A 2ZJPQ 3Q8UA 3IM9A 1FXDA 4CDQC 1HI8A 1NK6A 4DR7J 1VBA3 5ANQA 2WABA 1REVA 1SFPA 2F65A 5EQUA 4Q0QA 2D3O1 4H3WA 3QLHA 3JTPA 4RGGA 3UNGC 1LB2A 4AFCA 4O44A 4J6GA 3ACLA 4QPIB 3BO4A 5FD1A 1MS9A 3AMMA 4PKDB 5L9XA 2R062 1X4GA 1CPMA 4RO0A 3CJ0A 5FP3A 2EALA 1ZBA3 1OLMA 1S1TB 3KMHA 3LIHA 1T95A 2CPYA 3RZHA 2ZWOA 1XNTA 1VGYA 3GIMA 4YZ1A 4IFVA 2EIGA 2EVZA 4B4PA 1C5IA 3AP4A 5CD4A 1WC3A 4LFCF 3HCXA 2RS8A 3R97A 2YU1A 1H8TA 1IN0A 2C42A 2VZQA 1FJ7A 4UBHA 2DNMA 2K1RB 5HK4A 1ZBTA 1G7YA 1V6NA 2BRKA 2DGWA 3HVTB 3RS6A 1H6XA 1GICA 1AXQA 1ROFA 3P3DA 3I3BA 4RUBA 4ZVRB 1FPN2 1NXIA 3ENQA 3I56S 2NYIA 4PABA 3EVOA 3LPYA 4JQRA 2WSFC 1HHQA 1VB2A 1VI7A 4X8PA 3WF0A 1FHTA 2W1SA 3ZR5A 1HX6A 2NUHA 1YJUA 3NSTA 3H20A 2VUJA 3M6VA 1YSJA 2VPVA 3NP5A 2N4DA 3ACHA 2WBRA 4DHVA 4LF9F 2D1CA 4P75A 5LMNF 4RN5A 4OIXA 3JZVA 5FZ8A 4XOGA 3BGRB 4ANCA 4B17A 3JSBA 2YROA 3J7AN 1X5OA 3E1F1 2UXDF 1ULEA 4LF4F 2WONA 4ZPWR 4QAWA 1D9FA 1MVEA 5KFKA 4S2FA 5BXXA 3ZZYA 3D8CA 4PCRA 2GNBA 1YGYA 3MGUA 3UKNA 5HBMB 1IG3A 2NMNA 4C0HA 5H9FK 1HNXF 5HCAA 3GJSB 3BSOA 3FDSA 5KOWA 3IR5B 3UNPA 3D0IE 1PIEA 4A41A 1W0PA 1HW9A 2BE9B 3NNGA 3VBOC 2BQUA 2DFCA 2LECA 1M5HA 3GJRB 4CCEA 4XVHA 4LFAF 3IMMA 3TA0A 3I55S 2HWD3 4CSWA 3WDXA 4MH8A 1NKCA 3CWJA 2X1BA 2JXAA 4JDMA 1IS4A 4LBQA 3ILIA 4PRFA 1GXTA 4B4QA 5IT9U 4PI0A 4LT5A 1JNZB 2WW4A 1R1A3 2IVYA 1YJNS 4M95A 2AJ4A 3GLJA 3BBFA 5H9EJ 1WCUA 4AW7A 1WACA 1WKYA 2VG7B 1NO8A 1VHFA 2LA6A 4OZ0A 1V5VA 4Q5VA 2V73A 4DR5F 4YPJA 4LIWA 3G7DA 5LATA 3PIPQ 1SKSA 2MB0B 4ED6A 1WD6A 1F3VA 2E5IA 1RBOB 3T1YJ 4Y1YA 2XBO3 1AT1B 2GMEA 4ZVQB 2D7SA 1LWEA 4LRCA 1NKGA 3R7NB 4GC7A 3UKVA 2ZA9A 3OR1B 3JYTB 2JHEA 4XDOA 1Q8IA 2W9CA 5KXDA 3JB9k 1G9DA 3D82A 1GQPA 4IEZA 3K7RA 4IQXA 5HPOA 1DDLA 4ID5A 4WM8C 2A10A 4C11B 4J9RA 2OS2A 4Z8BA 2BEFA 4BZ4A 3MEDA 4KE5A 3EZUA 1DLLA 2L9LA 1W8FA 4OYUA 4PQAA 1NK9A 3N6MA 4U9RA 1HPZA 1GXUA 1MW7A 1QIQA 3MR2A 2VCBA 4TZDA 3GDBA 2YKPA 3GMGA 3HN1A 3PJ9A 2W8KA 3H7HB 1Q79A 2XY6A 4CEWC 2Y6LA 4HVOA 2RU9A 2WNVA 1A7GE 1ZNPA 3B94A 3S0MA 4OJHA 3BH6B 2HBTA 4IXLA 2QYGA 1WORA 3C8XA 4KV8B 3JSYA 3JAMY 4ZHRB 2DXDA 1LRHA 1JKHA 2N82B 4PQQA 4E4ZA 4ZKTB 5EHDA 2EXUA 1G8WA 4XUPA 2B9XA 1U48A 5C71A 1YJTA 5J2MA 3S6EA 3H42A 4OYBA 4QQPA 3I8TA 1L3UA 1P27B 3LUYA 3V4IA 1HIXA 1YWKA 4A48A 5FQ0A 1TUWA 4ITCA 2OPRA 3GFYA 2IJRA 5CYQA 4V1Ak 2CAUA 1B0TA 3MCOA 2Z2ZA 2RS13 1KTVA 3W63A 5HAOA 1EQMA 4ECXA 2R7EB 3CMAS 3PIOQ 3VGSA 4Q8FA 4CEYA 3AL5A 3CD5A 1N1YA 3PVXA 5IQQA 1SDDB 1V6JA 2JFDA 4L3KA 3LAGA 4BM8A 5IC6B 1JLGB 1X4FA 4G1IA 2XH6A 3ZC4A 1W2TA 3OTOJ 2DCZA 2OPPA 4XFGA 1UOJA 3NNLA 3PX0A 2V5HG 1OA4A 1GTHA 3VD3A 3SIPB 3LZZA 2OPKA 3M8RA 3QJJA 1E5HA 3LGMA 4QDSA 3DXBA 2I5JA 2C0ZA 3J7MA 5JPMB 4WBFA 2X1AA 1CPZA 2WYFA 4JC1A 2QMUB 1OY6A 1CQMA 2LS6A 2BVZA 5EJZB 2LEBA 3N79A 4PUOB 4XACA 1Y0HA 2IC1A 1XC6A 1QM9A 2W46A 1S4CA 2CXEA 3MR3A 3E2EA 3WX4A 3DF0A 4K20A 5CKQA 1L7RA 3DL3A 3VB9A 3MR5A 2VFRA 3E01B 5ETQA 5A7SA 2WOMA 1JXNA 4X4NA 4J1WA 4EWAA 1I5ZA 3MM9A 1DYKA 4YW4A 5ETOA 3KLVA 3MM8A 4A44A 3H1YA 1VLYA 4XUQA 3MEGB 3AKRA 2VVDA 2GA7A 3LP1B 1RJ8A 4QW8A 2W91A 3MCSA 1MQTC 1NQDA 2GN3A 1CS4B 2W8LA 3BDPA 2ZABA 4LUBA 4YS2A 5CYMA 1Y4ZB 4NHMA 1Y9OA 1QGLA 1AJKA 5HMZA 3B3QE 3QBQA 1VRUB 4H55A 3UN5A 4AEMA 5DDQC 1E57A 1WHVA 4WV8A 4P52A 1MU2A 2OEKA 1TV6A 1H72C 5FZOB 4EBDA 2ZOGA 5A3TA 1REEA 3LALA 1ONAA 2HEWF 7FDRA 3RRGA 4NUBA 5BYSA 2XDVA 3SQOA 3E8OA 4DL2A 1DGRN 3VBSB 4D7YA 1CD3G 2AYGA 1H1MA 3HT0A 1HRI1 5JOWA 3H90A 3VBFC 2HGLA 2IC3A 1S2KA 2EIDA 1EKSA 4NYZA 3M30B 4BQXA 3SSQA 3G96A 2D6PA 4AXOA 1FWLA 4COVA 4BMBA 1ENXA 1CG2A 1AL0G 1R091 4EU0A 1FTRA 4P71A 3N9LA 4USJC 5KAKA 2HH9A 4QGMA 1VMJA 1SEFA 2BFUS 1GZCA 3RBDA 1RT2A 1FAYA 4WBBA 3H4BA 3FK4A 3IS9A 5F8HA 3CJKB 2FGCA 2RM21 3L09A 4K4SA 1FV2A 3VDDA 3T08A 2BA9A 1PMJX 4FI9A 1R3NA 2X5IC 5FPVA 3DKQA 1O51A 3VVUA 2DU1A 3RTVA 1VBE1 2ZC4A 4LFBJ 3K57A 2ZJRQ 1YJKA 3BO2A 4WZMA 2A7AA 4N7UA 4AQSA 5ABJB 3EJMA 3CT9A 2ZGRA 5K4LA 4LSNA 1HYSB 1VQYA 3MPVA 3UDCA 2HEYF 3ZKUA 2KKHA 3IGVA 1FDDA 3RBZA 2XY7A 3QAUA 2F4VJ 5E3RA 2YUEA 3OEBA 3DRPB 4D7TA 5HO4A 2HK3A 1PO23 3A4UA 1NPRA 4F4AA 1U0HA 1V6IA 5IAXA 4AE5A 1LHUA 2WS93 4JVAA 1UIKA 1UA1A 2V4AA 4NHXA 4P7VA 3PNAA 3C46A 3AZXA 3D9BA 3IWZA 1J5OB 3TAPA 1S97A 2XHNA 2EFQA 3H5SA 4FBUA 2R7XA 5KT5A 3Q23A 1J3QA 3WP5A 1G86A 1S12A 3AQOA 3MFIA 3IIIA 3CSKA 3EZ5A 1NJZA 2Z2LA 1RHMB 4WVMB 1IKYB 3J7YU 1WDTA 3VF0B 2VBXA 3L2YA 4ZCKA 3KMSA 5FK7A 2RS33 4L0PA 5C8CA 2FHRA 4NLDA 1J1TA 4EN7B 5F8MA 1R092 3C6TA 1T9WA 3GONA 3PKYA 1YKWA 4EZ6A 5C5JA 1I6XA 3MF5A 2QQNA 3AYEA 2DNKA 2VJUA 4S2GA 2VA2A 4GKYA 4RU9A 1E5RA 3DYAA 2VU9A 1R8AA 2W1BA 4DR3F 3SCKE 1EARA 4NLOA 2KXNB 4I0WB 4DV7F 1MS1A 1V6HA 2VJVA 2A6YA 1XBFA 4NPMA 3KCYA 4DNYA 4LR4A 1RTDB 5LA0A 2VZRA 1RJ7A 2RM22 3BBCA 2IFWA 5BNPC 1NQJA 2WZEA 3CJTA 2W4DA 1ZA1B 2OP5A 4DV0F 5K9FA 3KT1A 4EO6A 2E1AA 1RCOB 5KT6A 4U8YA 4DR4F 5GZGA 3UDVA 1VBE2 2DVIA 1ZETA 2MQOA 5A0YB 2OXBA 3T4VA 3JSRA 1YIFA 4XO0A 5HBAA 2VU5A 3PDQA 3FCVA 5CA5A 2PHWA 3ZSKA 1WTFA 4UWDA 3Q0AA 2D6KA 2FJEB 1FRXA 2ETEA 3LGNA 4WK3A 3M3QA 3VAGA 3HT2A 3MCNA 1F5CA 3D7SB 1Y9QA 1VLOA 3NJYA 5E3QA 1PBUA 3SFUA 3AXMA 4KAIA 4QPIA 3ZFEC 5LRSA 2UURA 2MQMA 3I2DA 5DG1A 4OX8A 3V5RA 3R6SA 3J7ZT 3H25A 4NIAA 3VL8A 2V4JB 2WZ1A 1CIYA 4UXAA 3J9SA 1A6LA 3WG2A 1IKPA 4ZPDA 2AENA 4NIDA 4LSZB 1XNQF 1IQTA 5I8TA 1R27B 2FDIA 4QKBA 2JZ5A 2ZE2A 3CJIB 4NLVA 3H2VE 3Q8FA 3MR7A 2ZBCA 4OZNA 2F3JA 2VOWA 4IQMA 2V09A 4UY85 3S5QA 2CJKA 1W2IA 4F8AA 4RWWA 2XJSA 3AFKA 4OMCA 5HJXA 3Q89A 4C8OA 5F2WA 2DNHA 2DYAA 4F4XA 1W6NA 2XOMA 1W3XA 2APOA 2IY5B 3T3YA 1QTNB 1KOOA 2B4PA 4KGVB 4RS5A 2FTRA 5FPAA 3VBRB 4IEYA 1XNRF 3W60A 3MZIA 2B5JB 4OYWA 4LIUA 1O4ZA 1T3NA 4Y2IA 3PMSA 4I69A 2RR11 3PYFA 1V3ZA 5A33B 2K1RA 3OYWB 3AKPA 3H5UA 3CJ3A 3HVTA 1ZRCA 4CLWA 1BVP1 3ZDSA 5LBBA 4M63A 3BSCA 4Q4Y1 2CYFA 2ZBRA 2E66A 4ZVOB 3AD9C 1S0VA 1Q43A 3EX7B 1FJGF 4BC9A 4MIWA 3B5LB 5JUVA 1LTEA 5DQ0A 4NRPA 5A3PA 2B7BB 3UQSA 2JX9A 3CCVS 3ZFGB 5JXIA 3H0PA 4ITSA 4GVBB 1NCRB 2XWBB 1N34F 2IXHA 3GQCA 1U2CA 2OQ6A 1FESA 2LFVA 4FPHA 2XCPA 2H9ZA 1T6GC 2LU2A 2E7QA 1CONA 3WSOA 1K44A 1M5KC 2PIIA 3ZFFA 5C9AA 3CVKA 3OJBA 4LBMA 3CDUA 1YJLA 1VBB3 3DV8A 1EB0A 2W2OP 3NNFA 4C8YA 2IA0A 3ACIA 1ZTWA 3BKTA 4A7KA 4LT6A 5EJ3A 4KYZA 1YBTA 3U27A 5LOQA 2HFZA 3UCGA 2PN6A 5GLTA 4WE1A 3NNMA 2ZOEB 4B7KA 4NE9A 2ZNZA 3AB2B 4KY3A 3OD2A 1DQ9A 2A3XA 2HQDA 5C5UA 4B9VA 3KLFB 1K0VA 2MEV1 4DOUA 2DUOA 4EWTA 4PG8A 1ULDA 4RGKA 3O5TB 1FATA 3GHMA 5FP4A 1C1BB 3D0JA 1UZVA 1S1VA 1RUG1 2RJKA 3FE5A 3G9CA 4DBQA 3KT7A 3DOMB 1NM2A 5T7LA 3F56A 2ATFA 5F8GA 2RR12 1WHYA 1OPIA 4GD4A 1RHKB 4OZ5A 4YDDB 5I42B 2BE2A 1TFWA 2BJSA 4Q4Y2 1W9FA 2VG7A 2IFRA 1KQRA 1GOGA 2VAUA 4IQPA 2EI5A 1FNYA 1SJQA 1QE1B 3OJUA 1CPNA 4YB5A 1UL9A 1YQ6A 5GM0A 4YLZA 2OMLA 2PC6A 2DFBA 1ZPWX 4WFXA 3KCXA 4Y20A 5KFUA 3HNBM 2IBKA 3GGLA 3LE0A 1LXJA 2XHWA 5B0EA 2HBZB 1G7CB 1NH7A 3SITA 3EGNA 1OPOA 3O3LA 3M1HA 1N8RT 5A80A 4MVTA 4KWKA 5H9RA 3OR1A 5DS7A 2ZGPA 2O14A 4I09A 3TEXA 3DGPA 1I1EA 1VQMS 1UEKA 4TLQA 4WP8A 2BABA 3I3DA 1XR6A 4L97A 5GAEI 4IOAQ 1UN1A 3ZYIB 1VIOA 3G6JB 2BPA2 4FPYA 4MKAA 3MV11 3EXCX 2GP5A 2MPFA 2Y38A 4USUA 2PHXA 2VH7A 5T3NA 4I2QB 5L7OB 1GYKA 2COLA 2YNGA 1ZZNA 1VBXA 2OJ3A 2V8DA 4JI4J 1I94J 1OOPC 4CLFA 2NZ9A 2L48A 4TSVA 2ZGNA 2HWTA 4A4AA 4DF4A 3L3CA 2EKNA 3VHOA 1URRA 2FJVA 1BKZA 2VV5A 2MEV2 3BI3A 4I3GA 3RZAA 4A47A 4OX9F 3QIPB 4CDWC 3PR4A 1YJWS 4N77A 4R8UB 2GCFA 3TQ1A 2YQ3A 1RUG2 3D67A 2JIGA 2Y8WA 4NRTA 4IO1A 2UUAJ 3UKTA 2JD9A 4OI4A 1F35A 2DEIA 4CUBA 3R4SA 2PT0A 3TNPB 2R8JA 3WNPA 2VOPA 2MEWA 2RS2A 2YBSA 1B70B 3OGVA 1NJXA 3M4FA 1XYPA 4YVWC 3X3UA 5KXCA 2YFZA 3IBCB 5A7QA 1RT4B 4ZJLA 1SPBP 3TOQA 2PELA 2DNZA 2X05A 4IV1B 3T1HF 2EFPA 3MM6B 1GP5A 5E16A 5AE1A 2OQ7A 4DL5A 1JXVA 1UCNA 3RR7A 2YB7A 5A1LA 2X51A 1PNFA 2XMMA 3KHHA 2RIJA 4PQUA 1GZWB 3TN91 4UF0B 1GK8A 4LSLA 4YWAA 4C91A 3ZPOA 1JLGA 1QLNA 3USUA 4OJ3A 3JB4C 4QX0A 2ZH6A 1YO8A 4Q2MA 4Y1VA 1TL4A 4IDZA 3SV3A 4F3JA 2XQXA 3VZOA 4ILRA 2CRLA 1XN9A 1NZCA 3DI6B 4HN1A 1AUSL 4FS2A 2R043 4FF2A 4I6AA 1ZZ8A 4KU7A 1JHJA 2HVEA 4CXXA 4KR0B 1P6TA 2MKSA 3JBG3 5C6CA 4ZIWA 4DV4J 2BERA 3IRXB 4CTAB 4X64F 1V3RA 2FCTA 2Q8CA 1WKKA 3CJSA 2HAIA 3KJQB 2JDUA 4OCTA 3DYMA 2DGOA 4ZN3A 3FEZA 4CDQA 1WNEA 4XIOA 1SPPB 4CZCA 2R8IA 5FMOL 5GKAC 3I0SB 3VBHC 1C8M1 3IM0A 3E01A 1NOVA 2F6BA 4USKA 2QG9B 2GHPA 3I87A 4C6AA 5J2PB 5CYJA 4FXKB 1HNZF 1PIV3 3S5AA 1RMU1 2WQ8A 4FAGA 1PGW2 2BKNA 4UOFA 4CCMA 3IBWA 4WCEQ 4L74A 4RR3C 1J3RA 3OFGA 3LP1A 1JUIA 1UZZA 1UWBA 2V72A 1FVSA 1RB0A 3CJQA 2J8SA 2VQEF 4L2NA 4ET7A 3HVAA 3BKUA 4NIHA 4NMLA 2YG0A 2E6VA 2QFIA 3HZGA 1AL21 2JG9C 3IM8A 2ZGKA 1YK9A 1EETB 1RWOB 1WG4A 1VRUA 4AQ2A 4A45A 3LH2S 3M8QA 3SDEA 1IR2A 4ES2A 1V6LA 3OL6A 2QNKA 3V0AB 1BQNB 1CJUB 2A75A 1SLIA 1FMD2 1C5HA 4UTGA 3BH7B 4A3XA 3TN92 1JJ4A 6FDRA 2A6VA 4OI6A 5ACA1 4KGXB 2YKAA 3T6BA 3B7MA 4PIYA 3ZFVA 2V8GA 4H4OB 3G6XA 2RT3A 3RB4A 4JI5F 3HLUA 4RW9B 4LVNP 3A22A 4JTOA 5IVBA 1U5IA 3QGGA 3GIRA 5AT1B 4IERA 4MGTA 5DGAA 2JG8B 3K4AA 1CAWB 5CBLA 1RINA 2B0GA 4C3MA 1IM4A 5LZ6A 2ACYA 2XGXA 3QT6A 3WC0A 4F67A 1N52B 4LF1A 4E2FB 3P5BP 3KDNA 1F5FA 4A8XA 2WTFA 1CQ9A 2XMAA 4N56A 1RHI2 3C14B 5HMYA 2WO3A 2Z30B 5DDRC 1QDOA 4CRQA 2Q1ZB 5D3GB 1C8M2 1U5YA 5K8PA 4UFMA 5FZLA 4MMOA 4DOZA 3SH3A 3E5QA 3D6FB 2H6CA 2QT7A 2KH9A 1RMU2 1T94A 4MH0E 1C0UB 1IBLJ 2DCJA 1S0BA 4M8LA 2GP3A 4FF3A 1C0TB 1HI0P 3R27A 2VG6B 1TELA 2XVLA 1OBNA 3ZO7A 1HYSA 5L39A 1POQA 4DSLA 1FTCA 4XFIA 4IDKA 3WOGA 3BGAA 1YBUA 2WBKA 4KBZA 5D77A 2Q6BA 3FX3A 3POIA 3DRPA 1Z7S3 1EAH3 1WD3A 1KJLA 3CW2C 1AL22 3VZHA 2CQ2A 3L9ZA 4K9SA 1S0NA 2HWC3 2YNFA 4K8RA 2AZ3A 4J90A 1NAQA 3I2IA 2XCAA 4DV3J 4J5OA 3BBBA 4IRCA 2BZ2A 5ACA2 2EEYA 2HQ3A 4XAEA 4LITA 2R4FA 2OT7A 2XL7A 2VBYA 3A1YG 3TEHB 1CESA 3HDSA 2Q4SA 1ZX5A 3VD7A 1YJ7A 1PVC1 2NXCA 4YDXA 2W1QA 4PR6A 5DQHA 1IKYA 5F1RA 3WIUA 4BLGA 4DQAA 3NGDA 4LF6F 1DZTA 4AFMA 4ANEA 2C3PA 1A78A 1U0AA 5BYNA 3IR6B 3BQ2A 1YQ2A 4Q44A 5IAVA 4WP9A 4F3QA 4B3RF 2G9GA 7AT1B 1S76D 2HHWA 4M3CF 3QRPA 4NRQA 1NUEA 5D8AC 1ICEB 4NYPA 3RUBL 4FOVA 4CDXC 1F9HA 1XIQA 4AEJA 2UY9A 5IXUA 2UU8A 5IVYA 4ZCIA 2L08A 5FXZA 1EAYC 2VC9A 3H1MA 5EHHA 3VZJA 2X10A 2MQ8A 5A0YA 4UW6A 4WM8A 4J9SA 4W8JA 2QFJA 4MGSA 2ZM6J 3AZWA 2VZUA 2YC4A 2K2PA 5IT4A 1N33F 3SMHA 4OZJA 3LDKA 5CZKA 4YM1A 1OY9A 2ZAAA 3WP6A 3PW4A 2RD5C 4YY3F 5A7WB 1P8JA 1S1WB 2E5LJ 5FUNA 2W1WA 4P9SA 2LMIA 4HSJA 1SJ3P 3OUJA 3KHLA 5I4MA 2C4XA 2N3OA 4CEWA 4X4SA 3MPUB 2FCUA 2F4FA 3WXPA 2GMJA 2MKJA 1GKBA 1RVF1 2KVIA 4LJHA 1EKRA 4DU8A 1UU6A 1UL3A 2RMU1 3C7HA 4R9CA 5LA2A 4AK3A 3NGKA 5GAGI 1A34A 3RRHA 2CPFA 5A7NA 2W7PA 2HVIA 1KDMA 3ZIWA 1HNVA 1M1HA 3O1VA 1N32J 5IV3A 1PVC2 1Q8LA 1YQ5A 4DSIA 2VG5B 2JSXA 2DEJA 5FP8A 1FI4A 4QQHA 1SL0A 5BUVA 3TEZA 2DB1A 3U4SA 3AKQA 4PG7A 3A3PB 1HV1A 3PM9A 1YNAA 4JI0F 3VKOA 3AX4A 3KHCA 2R2TA 4U95A 5ETTA 5HI0A 4WVZA 2F4PA 2OI2A 3CU7A 3EMTA 1RUC3 1RUSA 3AXDA 4Q7AA 1K5MB 5A33A 1J84A 4B9SA 4NCAA 3CMES 3T2TA 4R0EA 1JJHA 5D2AA 3OXGA 2NMOA 5JSRA 1T9VA 2DIVA 3SQGB 2VVFA 1N6QA 1BLUA 1N48A 3KQ4B 1LK7A 1S9FA 3NBPB 2Z2MA 5L1KA 2XY5A 1PAUB 1HR0F 3GV5B 1FT8A 2J8AA 4C8NA 5KT7A 2LM3A 1SBEA 1K5JA 4XBNA 4BPZA 3KJFB 2C5DA 5KFWA 3LEIA 3QT8A 2AUYA 2PI5A 1X4CA 3ENWA 1PYTA 1U7LA 1JZ8A 2V2VA 3WDWA 1GQEA 3MAHA 1WCSA 4ZY9A 4XDCA 3UJQA 1WJ9A 1QUVA 3BQ0A 2R2SA 4DUXA 2YNHA 2GHWA 3PW2A 5LWBA 2ZVIA 4WZCA 1Q8BA 1J58A 1AW0A 2HIYA 3M8YA 1RVF2 1LGCA 2RJ2A 3CC7S 1UCXA 4D3GA 3M2UB 3EPGA 3HHLD 2W25A 4C8DA 2MXYA 1FPN3 3FWEA 3NMBA 4AG4A 4JI7J 4LRBA 4J9UE 3KSCA 1DQAA 3B00A 2WAOA 1AR93 2QQOA 2W2MP 2QZ8A 3PJQA 1MQTA 4I67A 1RUF1 2WAAA 3C3VA 5FPBA 3H59A 3KLIA 3V56A 1MN7A 3DLKA 3A0NA 2BNNA 5D4LA 3R2DJ 1FX5A 1ZBE2 3RVHA 4JV1A 3M1VA 3DOMA 4CLPA 1P9YA 1JOBA 1E6YA 1NKBA 2ADEA 4MK9A 3N6LA 4DO0A 5KHKA 5CU1A 4KGMA 3T3FA 2WSVA 1VISA 2A0FB 1W3VA 2FJBB 2MKYA 4E8CA 1QD1A 3V6KA 4B9UA 1QE1A 1SLCA 2BW8A 1QAYA 4YB1P 1LXNA 4DX5A 3HQRA 3PVBB 1W0OA 2WYSA 3VBFA 3BPZA 5JXSA 2IA6A 4IV3C 4F04B 1DTQB 2DGXA 5J2QA 2AQ4A 4UZCA 4Z2AA 2Y6GA 3FEXB 2YZ4A 2VQFJ 2R8KA 4P00B 4BQ1A 4JGZC 3LQVA 3MM7B 1WEZA 3A0KA 3WDYA 2GVDB 2ZDOA 5K8MA 1SKRA 3VZNA 4GO7X 4WYLA 4JCKA 2JJ6A 3FHAA 3VDCA 1PK6C 3G87A 3ORJA 1Q4RA 1Q8KA 3MYXA 3ZYBA 1H6KX 2V4QA 4O3NA 4OZ2A 1EX8A 3BIWE 4KG0A 2PSZA 3UGFA 1X33A 3IC1A 5DAVA 3MEKA 4I2QA 3G6VA 2X5IA 1SJ1A 5EDWA 4CO0A 1OVPA 1WWHA 4H7LA 3CMQA 3OEAA 2B6AB 3DDIA 1S1XB 4E8DA 3LWMA 5I93A 2K2SA 5GZDA 2LU1A 1SQGA 2JEMA 2VFSA 1RUF2 1S77D 2VBBA 3RMYA 3FFZA 2KA3A 3POYA 1OYDA 2G1MA 2OX0A 1GWMA 4M0HA 5E2QA 3HBZA 3O12A 3BS9A 1GANA 4WKYA 3RZLA 3RRKA 1RJJA 1DF0A 2AJQA 3PACA 5DDOC 2Y1IA 4C1WA 1VJQA 1RUI3 3G2XA 1U1KA 3LIGA 2OFHX 2UU9J 3A8EA 1PGZA 4IH5A 4A42A 1SC4B 4QGNA 4BQYA 5BNQA 1KWMA 4F83A 3OFEA 2WNOA 1XMQF 5KG2A 4DXSA 4QR0A 4XC9A 3N9QA 3MM6A 2DNLA 3RW7A 2C2KB 1V3SA 4ZLLA 3V81A 1H74A 3T1YF 1X60A 4R9AA 1OQEA 3I7DA 2E9TA 2AEFA 2FDJA 1IHMA 3M7AA 1SQFA 4MLOA 2DTYA 2IXIA 4IEUA 2A3JA 2E53A 3WQ7A 1GZWA 4B29A 5T52A 1DGLA 4UF0A 4BCAA 2ERFA 3GNEA 5FZ9A 2MY8A 3E6CC 1ZBA1 2KXLA 2CV6A 3M2VB 3POSA 4JX0A 5K20B 5JVGQ 4QIVA 4C48A 3RRDA 2AH2A 3R5DA 5BNPA 5FLJA 2H51B 4FVVA 1WC4A 4RW6A 1XE0A 5CFDC 1D2SA 2B7YA 3Q8PB 2OH2A 4GB31 4HVRA 4QX7A 3QPIA 3M3CA 1UY0A 3VDBA 3W5YA 3FFQA 4COWA 2VOVA 4ZMMA 1AA1B 4CXYA 1K3IA 1ZM4A 3UYJA 1S0GA 4I4BA 4CTAA 2QBXA 3WVJA 3WF2A 2BM0A 2FDKA 5GAEU 2DNGA 1MMNA 2MQPA 2JKBA 2OPWA 1VLNA 4E4SA 3I0SA 4ELVA 4MAKA 3E6DA 2HKEA 3MDPA 4KWLA 5I8SA 1VR3A 4MXWA 5J2PA 4CU8A 3MAQA 5FTTC 3W9AA 3J7HA 3SV4A 5M2UA 3ZFEA 2CAVA 4J9MA 1D1UA 3I2KA 1ND3C 3TEWA 3M8PB 4RFT0 4V19X 2Z79A 2DKOB 3QT7A 2ROEA 3CIZA 4LHKA 4ZPAA 2FB0A 5KXEA 1O8SA 1GZ9A 3BV8A 3JSMB 1G6BA 2ZEXA 4WFZA 4DLEA 2E1CA 5L9RA 1NZAA 1QAJA 1A8DA 4UW5A 1SCJB 3FSXA 3ON7A 5AFBA 1DYPA 2Q8EA 4MYTA 2B5HA 2ZAHA 2DH7A 3NCPA 4HEA9 3DI6A 2UWCA 3NGUA 2CNLB 1HQ2A 1QXRA 2D3OR 4QQLA 1Y5NB 4HSLA 2VPZB 2OPSB 1QQP3 3OTOF 5H9QA 4F0KA 2DHGA 5LASA 5J1PA 2KM8C 1JB0C 1DURA 1POV0 2WLPA 3FVYA 2CQBA 4C7QA 3HX9A 3I59A 4GB32 3K5OA 3EZOA 3T2PA 2GMLA 1UPIA 1CAWA 2BBVA 4W6WA 2Q1FA 3HQUA 4AD6A 4JGYC 2ZGUA 4MADA 5FY8A 2H6BA 3OY8A 1Q16B 1H2LA 4FNHA 4GWJA 4QM9A 1UFKA 1VFJA 4NEYA 3GZ7A 3C14A 4LF9J 2MSSA 4CNZA 4PIXA 1U6BA 1R1A1 5LMNJ 1NAEA 2IVMA 2UY8A 2ZD1B 2ID4A 1S6OA 2V2ZA 2MGZB 2VUAA 1BXNA 1IS6A 5KTQA 2UXDJ 2EBGA 1LKNA 4DS0A 2BFUL 5I0DA 1FNXH 4FCAA 1BY9A 4Q0PA 3A3OB 2Q30A 1C0TA 3N9PA 1KSPA 2VF3A 2XBO1 2HHXA 1D4M1 2WZR2 3OBIA 1FJEB 4R4ZA 1HNXJ 3A13A 1H2TZ 2LRPA 4G1QB 2P9GA 4ZLJA 3OTCA 4CDUC 5DZGA 1FK9B 3KHRA 2EK1A 3MMCA 3HAGA 1HI1A 1NSPA 1JYVA 3NS7B 2XS2A 1SVDA 2OMOA 1O7FA 1TFYA 3H98A 1R0BG 2LQ8A 4ZVSB 1IJEB 2JE8A 1D3WA 5DMYA 3AJ2A 3VHPA 2EG1A 3OQ2A 2R7TA 2K7KA 2YXSA 2WKKA 5DM6Q 3Q24A 2V4VA 2D7FA 3RG6A 2CPIA 2HLTA 4YG3A 2ZH5A 1JLCA 4DR5J 4K5SA 4QYZJ 2YPJA 1TKTA 4NXMF 3PHEA 3RG0A 2B8PA 1NX9A 2ZHOA 4MK8A 3U1LA 1Z78A 1RP5A 4C90A 3HVWA 5FY5A 3VGVA 4NZ6A 1DQ6A 3LA2A 3OSNA 4RGAA 5I3UB 2WC2A 1UO9A 3PURA 3LB9A 4GMP1 1GAOA 1WKLA 4MYEA 3FC9A 4HXCA 5J36A 4ECRA 1SH3A 5EV7A 1D0GA 3C16B 3H7JA 3M9NB 1R1A2 5A8WB 3ZIXA 3GM8A 3CTRA 2AV5A 3OJSA 3V6DA 2XNRA 4XUOA 2PHDA 1O5LA 1UVIA 1RAGB 2VD3A 4F4ZA 2QYCA 1FDAA 4NR1A 5FZCA 1DQ4A 3C3LA 5FXVA 3RYPA 5FLIA 3NJZA 2KI2A 3FJ2A 5IZHA 2XBO2 3W8PA 3AYAA 3ES1A 1D4M2 3V2UC 4IE0A 1RT1B 4Q0BB 2ASLA 2PYTA 2UUCF 1ODMA 1WW7A 2NXNA 3SEOA 1KC8T 3U37A 4YVSC 4OI3A 4ATNA 2VE1A 3I97A 3AVSA 1OY8A 4QDRA 4OJGA 2OD6A 3QJPA 2VIHA 1XK8A 2WVDA 1UTAA 1JUHA 4AAXA 2PHRA 4CH1A 4LF7F 4J7CA 4UAPA 1OQDA 4ARYA 3RWKX 1HBNB 1SJ4P 2MLXA 2JIJA 4QWNA 5HQMA 2RM23 3PG9A 2KD7A 2VQTA 4R0JA 3FEYB 4GULA 2WJSA 4PLNA 5A32B 3JXOA 1U09A 4GWMA 5L9VA 1YFWA 4MKBA 1GX5A 4LUKA<