4JHTA

Crystal structure of alkb in complex with 5-carboxy-8-hydroxyquinoline (iox1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title 5-Carboxy-8-hydroxyquinoline is a broad spectrum 2-oxoglutarate oxygenase inhibitor which causes iron translocation
doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4jhtA00
3I3MA 3I2OA 3I3QA 3KHBA 2FDKA 4O61A 4ZS3A 3H8OA 2FDGA 4IDZA 5F8PA 3RZJA 3H8XA 4CXYA 4IE4A 3RZMA 4NIDA 4RFRB 2IUWA 4MGTA 3O1MA 4ZS2A 4NROA 4NRQA 4NIGA 4NIHA 5DABA 4NRMA 3BTXA 2FD8A 3T4VA 4IE5A 3RZHA 3RZKA 4CXWA 3BU0A 3O1VA 3O1TA 4IE6A 3BKZA 3O1OA 4IE0A 2FDHA 4MG2A 4ZHNA 4JHTA 4OCTA 4QKFA 3BI3A 3O1UA 3KHCA 3T3YA 3BIEA 3S57A 3I49A 2FDJA 4NPLA 3T4HB 3BTYA 4O7XA 3BUCA 3LFMA 4IE7A 2FDFA 2FDIA 3BTZA 3H8RA 3O1SA 3S5AA 4QKDA 3O1RA 3RZLA 4NJ4A 4QHOA 4NIIA 4NPMA 3O1PA 4CXXA 3RZGA 4QKBA 4NRPA 4QKNA
chains in the Genus database with same CATH superfamily
1DG6A 3CU7A 3MW4A 3ZXJA 3VKLA 4FPFA 1JZ5A 2VNGA 2UURA 4JHZA 4Y1XA 2CAUA 3CJIC 4LBOA 2YYOA 4M4RA 4XJAA 5A3PA 1NE6A 3C7GA 3VDCA 1ENRA 2QQIA 5F9TA 5JXIA 4OZXA 5IW0A 3DYOA 2JDHA 4CCJA 3LSEA 2WLQA 5ISLA 3H0OA 4K1ZA 3D6EA 2W9XA 4G3YC 1AXYA 3WNMA 5ACA2 1JODA 4HT1T 1JYVA 1PVC3 1SPPB 1ULEA 2Z69A 5CZKA 1H8TA 3NJVA 1QJU3 4KBBA 3TN92 3CKHA 1QJX2 2HWB1 3F2ZA 4RHV2 3SEPA 1MEC1 3FLRA 2LW8A 2WKKA 4YG3A 3N35A 2NMOA 5LRRA 5JI9A 1YCIA 1UW8A 3N7JA 2HWC2 3GM8A 4UBHA 4XXPA 1SEFA 3WF2A 2HWE3 4LEJA 1CAWB 2ZAHA 5FR3A 4NROA 1U0AA 3VZKA 2VUCA 1MS3A 3VBFC 2AC1A 2OZ6A 2HYKA 1J3PA 1E57A 1OVPA 2IXJA 1QF3A 3LDRA 3VBSC 2BGPA 2DCTA 4FOWA 4HN0A 5HI0A 1CX4A 2VMGA 1BHGA 1GNYA 3TRSB 2RS51 2E53A 2WUHA 1LGBA 1HQNA 3AYDA 4JCKA 3JQXA 3GBFA 3Q8BA 2WYFA 4O9GA 5HCAA 4GZ9A 1F5FA 4XUQA 4E8CA 2ZGUA 1FMD2 5FPLA 1J1LA 1PM7A 3Q8EA 3VHPA 1LR5A 2QQWA 3PU3A 4Q27A 4S2HA 4W6YA 4KG8A 2PHLA 1VRH2 4RHV1 5IFTA 1RMU3 1RUC2 3DKQA 4AEDA 2MEV1 2MNGA 4A2UA 1HV0A 2JG9B 5FJHA 1GZ9A 3EBRA 1ND2C 1LHUA 3NRUA 5C8CA 3LAGA 2WSUA 2DBNA 2ZGPA 1VMHA 3GALA 2XONA 5FP9A 2BNOA 4B1MA 1I9RA 4CU7A 1N3OA 2IFRA 2XXZA 1S0EA 3OGSA 5JVVA 4YPJA 4A42A 4RS5A 2H0VA 3T4HB 2BYVE 2YGMA 4PLNA 1XNTA 1ZBE3 3D0JA 3E1F1 3FBMA 3GGLA 1C28A 3UNPA 3E6BA 5FO9B 2FDIA 4AEMA 4P9XA 4NWWA 4KU8A 5KHJA 5EWSA 4GMP3 2VPVA 5A3MA 1HW5A 1QEXA 4IV3B 2JDYA 2PXJA 1DCSA 1WMEA 4KU7A 4B4QA 1UY2A 1XPWA 4FPHA 4IERA 4JGZA 4I0AA 2D40A 1ZRRA 2BOJA 5JCTA 3AMPA 1JH5A 3ZFEB 3VKMA 1YFWA 4FTBA 1W0PA 4D6SA 3GJBA 2DFCA 3VZNA 4NRPA 3WP5A 4LUMA 3QD6A 1AYM2 1C5HA 2YFUA 1VRH1 5GJ6A 2UYAA 3RMYA 4HANA 2PYTA 1Q56A 3IIIA 5BUVA 2ORXA 2VZ1A 5H9PA 1PIV3 2QQVA 3IMMA 1X33A 4D7TA 4AI2A 1W28A 1XYOA 3QOPA 4Y4YA 1XB9A 3BB6A 1WLWA 5GZEA 4GWMA 3OUHA 1C8NA 5DG1A 2OXBA 2D6OX 2VXRA 1CZVA 5H9RA 1ZZ7A 2J22A 2EXHA 3TBDA 3VKFC 4FBFA 5FZIA 4GWIA 4I02A 4JQTA 3KS7A 4YYOA 3NNGA 1GP5A 1UKGA 1O59A 3PURA 1R1A2 4BPZA 4QXHA 3M3QA 2VZUA 1FT9A 3GDBA 1OFSA 1HQLA 2IUWA 1DYKA 1UX7A 4UFKA 3T2TA 1ZRFA 1ULPA 1D2QA 2NPIA 5KXEA 5FXVA 3PU8A 3GCWA 1RC6A 4NIGA 2DU1A 1XYPA 5D8AB 1JZ8A 3MPPG 2RS11 4NRMA 3I54A 4LHLA 1AR72 4UW4A 5LBBA 1F8VA 1NXD1 3PIJA 4YM2A 5JWPA 1AXZA 2DCJA 4YW4A 5T5PA 4CU8A 4R9BA 2XJSA 1UZWA 2Y0IA 1YYNA 3DL3A 1AYM1 2ZGLA 4WM7B 3WHTA 4E4HA 3I2DA 1DQ6A 4BIFA 3VHOA 4AW7A 2WWSA 2ZGTA 4XE9A 1HB2A 1JHJA 3LOIA 5DAXA 4LE3A 3ZXEA 1OUSA 1U12A 2ZS6B 4M3CB 4C91A 1L3JA 2YROA 3BN6A 2CWSA 3SH5A 2BFUL 4N53B 4I2OA 3VDDC 1GICA 3RQ0A 1B09A 4HPKA 4IXLA 1GV9A 1UYPA 5CG9A 4WM8C 1IPSA 2F6BA 4XACA 2OPWA 2Y33A 3VBHB 2Y6LA 3WNOA 1FPN2 1H2NA 1YFXA 5F5CA 1IS6A 3USUB 3ILNA 3T2PA 5LY1A 4DXZA 3Q9OA 1VBC2 1LRHA 2FDJA 4MSVA 3AB0A 1NLQA 1W2UA 1UYZA 1XNDA 1LB2A 2XOMA 2RHPA 3AXEA 3E5QA 1W3VA 5IWFA 5T5OA 4AXOA 4A4AA 3H3UA 3ZO0B 2NM1A 5C70A 1RVF2 2BVVA 4HVRA 2NYYA 2VZOA 4URTA 2A3YA 3D3AA 1RJ7A 3GHMA 3VHNA 1W2NA 2AACA 4BE3A 2PLV3 2RVAA 5A3OA 4OI1A 4AHZA 1CD3G 1SFNA 4BHPA 1GWLA 1SZBA 5JAXA 1RUI1 4QX0A 3AL6A 3SKJE 5JOXA 4BQYA 1BCXA 2XVKA 4NIIA 1HB3A 3JD72 2WZR2 3WT3A 3QH6A 5J48A 1JXNA 4FOQA 1FOD2 4OZOA 4E9KA 1K42A 3MHZA 3ITQA 1P8JA 1Z0HA 4XABA 3S7EA 2JD9A 3OGGA 4COYA 4OI4A 4LBLA 5IVCA 1F31A 4K40A 3WF1A 1OF3A 2R32A 2ZEXA 4K20A 5ABJC 3K75B 3MUY1 2J1RA 2YY1A 3POBA 2PHTA 2B9VA 3CJIB 3MGUA 1W6MB 3ECQA 3LEMA 3R4SA 4DMIA 1VBC1 3V0AA 4AEKA 1EPZA 1TME1 3MPBA 3ZN6A 4IL7A 3U1XA 5H9QA 2J1SA 5EQUA 3PUSA 2K2SA 4UBGA 2R061 4XBNA 4UFLA 4KWJA 2Q4SA 4LPLA 4CCCA 1WCUA 2E7AA 2YXSA 3H42B 1FATA 2E26A 1HX6A 2PMWB 1GZWB 1CQ9A 4L99A 2IWGB 3A21A 4QPGC 1RITA 1AR93 1JN2P 2R073 4FPKA 4MGTA 5AVPA 1IOAA 1UWWA 1UZVA 2W91A 4KGQA 3K48A 2YV8A 3P3NA 5CKQA 4EQVA 1W6PA 2ZEWA 1DQ0A 2WL1A 4H3WA 5KR7A 3AMQA 5HCFA 1MVEA 3LA2A 2WZR1 1GU3A 5KWRA 1W8FA 5AC92 1SDWA 1FOD1 3BALA 1ZZCA 3T0DA 2GZWA 1JOPA 2W3JA 5KXCA 1UNBA 3PL0A 4Z2AA 4NIAA 3VBSB 3M1HA 4QPYA 2R49A 1W6OB 4TLFA 4K9SA 3WF3A 5BNQA 5CBLA 1ZZ8A 3NNMA 2C6SA 3LZZA 2EXJA 2HH9A 5F37A 1UMHA 2W0XA 4QXBA 5FMDA 3CQOA 3SCGA 3W20A 2VBDA 4N43B 3B02A 4MV2A 4QGMA 3JCIA 2EIDA 2CNAA 2D5HA 3VD9A 4MG2A 1AXKA 3AKQA 1EPWA 4ARXA 2VO5A 1T6BX 2JG8B 1YQ6A 3NAPA 3R4DB 1IS4A 4YZ3A 5HXVA 1HRI2 5IFPA 1PK6C 1Q3EA 1TZOA 2RR11 1W39A 1Y9QA 4GWJA 3WDVA 4KBZA 1JUIA 1L7RA 5CA6A 2ORZA 4OUEA 4CDQC 4XBQA 1DQ4A 1YJLA 3PMEA 1WW5A 1W6QA 1ND2B 1PX3A 3DUIA 3T08A 5IVBA 1OPMA 4JKLA 1QNWA 3NSTA 1Q5OA 4M00A 4CDXA 5FPAA 4XIKA 4DQAA 4A7KA 3DPRA 3WW3A 1R092 1W2TA 2DFBA 5CKNA 5F7UA 5CYYA 3VD4A 4L11A 5EYXA 4EJRA 1LOEA 3I2KA 1D4VB 4GA9A 3RZZA 5CAZA 3D82A 1QJZA 2BFUS 3ES4A 1AYN3 5AC91 1BBT2 5FYIA 4CPBD 3KV6A 1ZREA 1KXGA 2I45A 1JYTA 3VBFA 4XUTA 4Q4X3 4LO5B 1VP6A 3ASIA 3N9MA 4XC9A 3ZSKA 2DTYA 4CP1A 5DQ0A 4EN0A 1HN1A 2RJLA 1ZBA2 2IVIB 3WUCA 5GLUA 5KC5A 5FP7A 2WAAA 2VR4A 3FMGA 3B94A 4R9CA 5FQ0A 3RJ2X 5D21A 1O6UA 3AL5A 2VVDA 1JZ7A 2VZPA 3OTFA 2G19A 5B2GB 5C3OA 1H8TC 5J09A 3NKGA 3O7OA 3I3EA 5FUNA 2GH2A 4AVBA 4PIXA 2XKOA 5I0DA 2WDBA 5L7OB 3ZX7A 4EWEA 4YSFA 1LGCA 2P3YA 4CP0A 5HBAA 4LE4A 3SKVA 4LTAA 2RG4A 2A3WA 2PFWA 4XJ9A 4CCLA 1EAH3 1R1ZA 2ZACA 1ZRIA 4MGKE 1HN0A 2AEYA 5DDJ1 2YBKA 3T0BA 5JZGC 4AI8A 2W47A 5EP9A 4EE2A 3UGGA 4UF0A 1WW4A 5E88A 1X8MA 2VXJA 3OJBA 5L36A 2E32A 2RMU3 1MZFA 1BBT1 2JDPA 3OGVA 1HQWA 1UQXA 2C0ZA 2FMYA 1GWKA 3AP9A 3ES1A 5GALA 3MUZ1 5F2SA 1MS1A 1ZBA1 1XBFA 2HLEA 3LWCA 4KWKA 1XU2A 4LBQA 3S7IA 4CDWA 2DVFA 2HWF3 3WNPA 4TWTA 5KHKA 3AFGA 2WFF1 4NHLA 4JRLA 4PIYA 2TUNA 3DGTA 2ET1A 4AFMA 5C33A 1JZ3A 3AK0A 4RGKA 5T52A 1RUNA 5FTTC 4B4RA 1QOOA 1UD1A 2BP6A 4K8FA 3VLBB 1COV3 4PI0A 1CPMA 4DIQA 1BEV3 3AZZA 2XJRA 3ME2A 3K3NA 5DZFA 1DYOA 5CG8A 1UPSA 3HNBM 4J6GA 1IQAA 3LF7A 2PTMA 4Y26A 3TEYA 3J7HA 5C8CC 5BPXA 3OCPA 3O12A 1V6MA 1RUJ1 1YHFA 2GC0A 5DAQA 4CUGA 4YNIA 2JE7A 3IDBB 2Q1ZB 4P5HA 3SITA 3PVNA 1DGLA 3GBGA 2XWJB 4RS5C 1OKOA 2BWAA 4MHUA 1BYHA 4A3XA 2OYZA 1BVP1 4DXSA 1F35A 3MBWA 2AUYA 2W08A 5E89A 3VDDB 2EA7A 2LUWA 1MEC3 2VMIA 1S1AA 2WSVA 3NW4A 4QWNA 3LKJA 4WM8B 3WW1A 4BDVB 2RDRA 4Y3OA 1WMXA 3BGAA 1ULOA 3NV3A 4KG0A 5F1RA 2CWMA 4JGZC 3ZDSA 1VBA2 1Z7S1 4GKYA 3NKTA 2TBVA 4IV1A 1LENA 4ORFA 4TZDA 4META 2VZSA 3POYA 1G8WA 2W68A 3ETPA 1SACA 1NCQA 4E2GA 1LOFA 2JEMA 2Y38A 1G9BA 3LEKA 1ZYBA 5A7SA 3I7DA 3IBMA 1C8M2 4IE7A 1XSQA 1PO11 2WO3A 5KXBA 4K8RB 3VD3A 1W9WA 3DV8A 1QH6A 2JDKA 3WG3A 3V64A 5J96B 4Z82A 1O3RA 4Y1YA 2G1MA 2X5IB 3EB7A 2JKXA 1O5LA 4ZONA 4AQ6A 3KF3A 3U14A 3J7MA 3UGFA 4C1XA 5DN2A 1PZ7A 2CDOA 4XETA 5LA9A 1W6NB 3U4XA 1JHNA 5C8WA 4AR2A 1RUF2 1WW7A 3OGJA 2ZX3A 3CMGA 3LCPA 4P00B 4RHV3 1S0JA 1Q8OA 1RUE2 2MEV3 2VQTA 2P1BA 3AKSA 3IZOA 3WLUA 2YB7A 2V09A 2XVLA 5ABJB 2RJKA 1OLME 1UMIA 2QFEA 2B8MA 4WVMB 1KRIA 3UKNA 2DCZA 3J9SA 4E2SA 4HOOA 3KHCA 1VBA1 2L9LA 1UXZA 1XNBA 1NE4A 3OSDA 4COZA 3OY8A 3E5UA 3DN7A 5K0UA 3KCXA 4WZFA 1IG3A 1FX5A 2O1QA 5BY5A 3RS6A 2PAMA 3M7AA 5A6QA 2WS92 3WQBA 1W8HA 4RN5A 5GLWA 4MXWB 1C8M1 4BQ2A 3SLIA 4R4ZA 3D0SA 2VNOA 3VN4A 1G7YA 4YGDA 2CGOA 1IS5A 4QPGB 2GNBA 4QXCA 4PBOA 2OQ6A 5F6KA 1H1AA 2JDNA 3VZLA 3I2IA 1F4HA 2JIJA 4QQLA 3K3OA 3MV01 1YJKA 1D0GA 5GM0A 4XHXA 3USSA 2HEVF 4YVWA 3WY6A 5L19A 4XUNA 1SG3A 1AL23 1WWYA 4FPLA 1SMVA 4LBJA 5LA0A 4MUVA 5IT6A 5IYYA 2BU9A 2XQRA 3MIHA 3DYPA 4Y1ZA 4I0WB 1RUF1 3PUIA 4IEQA 2KD7A 1ONAA 1KGYA 2C26A 2J1AA 1VRH3 2ZKLA 2D93A 2GNTA 3CZUA 3GHNA 5J3UA 1RUE1 2OUJA 3OBTA 1MZ5A 2A7AA 2XL7A 4K7JA 1X36A 3TEXA 3O1OA 4AFCA 2VZRA 1NCRA 4RA0A 3MIGA 4KH9A 2D3SA 3ZSJA 4Q5OA 3HVDA 1G9FA 1YIFA 4QQPA 3J7NA 1VIWB 4BISA 2WRAA 4GKXA 5FZMA 2EIEA 2XLFA 3AZYA 3ZVXA 4FSJA 1TMF2 2DCKA 1CJDA 2ARAA 4FI9A 2WNOA 2WS91 1VAVA 1PK6B 4CA9A 1Q8SA 4QHBA 4ZZ8A 1LECA 1ACCA 4KGGA 3CNAA 3PVOA 4IESA 4PJYA 4CDQB 5FYTA 4DY5A 4DNYA 1JOBA 3THTA 1PNGA 2ZABA 4F7ZA 2BPA2 3AZVA 5LK7B 1AR81 1JOJA 4OHXA 3MV11 4OQ9A 3ROUA 1V6JA 2RS13 1ODNA 3C8XA 1GUIA 1SLAA 1OOPA 3FX3A 4O7XA 3RDIA 4CCNA 4XTPA 3VGIA 3FLPA 1EV12 3J8F1 5F32A 3ALQA 5ANQA 1H0BA 2WAOA 1TVGA 4Y24A 2BQPA 5FWEA 2ET7A 3VBUA 2PA7A 1UYXA 4RQPA 4AVSA 4JAAA 4F83A 4UI9L 5FUIA 4QKDA 1DHKB 2RS32 3RZLA 3L2HA 4IUGA 4A7YA 2GU9A 2I74A 1LU1A 4CCKA 4NE9A 1W8OA 2JECA 4XFCA 1GZTA 3HAGA 4P9IA 3BODA 1RTVA 1W8NA 4YM0A 4Q0QA 5FZCA 1UIJA 1H8TB 1STMA 1PVXA 3QH7A 2ZHNA 5A3TA 4P9LA 1TMF1 5FLHA 4ZY9A 1JYIA 2XJTA 2BZDA 2P17A 3NNJA 2BGOA 4AFDA 4JKMA 1O3TA 3E5XA 2PAEA 1TQ5A 4I0BA 3U37A 3I3QA 5I8SA 3U78A 4BWOA 2V5DA 3U0ZA 5HCHA 4CCMA 2E9QA 4JTNA 1SFYA 5FZ7A 3IKWA 3ZFGA 3EMRA 2DU0A 4OQ8A 2QCSB 2V5YA 4OYUA 5CU1A 1PZ9A 3U11A 1V6LA 2P3IA 5FLJA 1RUH3 1GYKA 3LE0A 1PGW2 2WYSA 5EIYB 1NUKA 1DIWA 1WLCA 3VL8A 4URAA 2OA2A 4Q1PA 5T5JA 3VDDA 3B69A 1SLIA 3IMNA 2SLIA 4NUBA 4E2QA 1DQ5A 3LDBA 1OBNA 1TEIA 1S0CA 3LIHA 4PDWA 2CDPA 4W8JA 4C0BA 5E6HA 4YWAA 5LBEA 2HKXA 1RUI3 5JR2A 5JOYA 3T09A 4TN7A 2SBAA 2LS6A 2JIGA 4XMAA 1ENSA 1XOYA 3CBNA 3NAPC 1OH3A 2FD8A 1S2KA 4LBNA 3WQ0A 4BZ4A 1H8VA 1VBE2 1D4M3 3AMHA 2HWD2 2W92A 1AJKA 1CAVB 2ZTNA 3IIAA 4JC1A 4XQDA 3QACA 4EZ4A 3BOPA 4AEDB 1W9FA 3CZJA 3U75A 4CEWC 5C8CB 1GSLA 1FV2A 4Q8KA 3VDBA 2GC2A 4CDXC 2FDHA 3DPRC 1J58A 1YC61 1VBC3 3M3IA 4NO4A 5CFCA 1TME3 1H2KA 1ZM1A 4XFBA 3WVJA 4Q26A 2JB4A 2Z79A 3R05A 4NMIA 4RS5B 2RV9A 3BVCA 3POJA 2R063 5A1FA 4XQWA 2I2SA 2XBO2 1PX4A 1GANA 3JBG2 4Q0UA 4PQ9A 4Q4Y2 5A7NA 4UOJA 4LJHA 4GMP0 5LA2A 2YBSA 1HXS1 4GH4A 2DUPA 4M01A 4AVTA 4E4SA 5JZGA 3AKRA 1CAUA 2E6VA 2IZWA 3GZUC 3ZFFC 2GALA 1KS4A 4AVCA 2DTWA 1YO8A 3S57A 1RIRA 1HRV3 2JENA 4JGZB 3V65A 1POQA 2AREA 4EZHA 3FHQA 1RHI3 4ZXKA 5I0TA 3NJYA 2EVXA 4L2NA 2BJSA 4QX3A 2WZR3 2XL9A 2ZKNA 2LM3A 1W8UA 4YW7A 2FQPA 4HN1A 1VBE1 5A7WA 4YZ1A 3ZYBA 4YVSA 2B7YA 2HWD1 1Q8PA 2VMHA 3VBRC 3KCYA 3UETA 3U07A 3IPVA 4LUKA 5A3NA 4XDOA 5ACA1 3MDPA 4LOTA 4Y4RA 2ZAAA 2Q5TA 4FPCA 4HKLA 3TN91 4IETA 3WD5A 3WF0A 3CLPA 1QJX1 1GOGA 1UXXX 1W05A 3JZVA 4MADA 1S2BA 2W39A 1PO22 3ZIWA 2XUMA 3B93A 4QX2A 1EY2A 3SEEA 3P6BA 1G86A 1KFXL 3GXUA 3KMHA 1WW6A 1SLBA 1VMJA 2MPFA 2HWC1 5FO8B 4E27A 1UZZA 3RZGA 1YQ5A 2XPJA 4QQ2A 1NOVA 1UU4A 3JBG1 4Q4Y1 3KV9A 5IVJA 2RR13 2ZGKA 5AFBA 5JSOA 4CDUA 5KXDA 4CYDA 4BQWA 5JMCA 3DCQA 4H14A 2DVBA 1U5ZA 2WO7A 4RGGA 2O14A 3GF6A 5FO7B 1O4ZA 4CDWC 4LR4A 2FZ1A 5FY8A 3RYKA 2ZGOA 3T1LA 5LATA 1GR3A 5FP3A 2JKBA 3DKWA 4YFZA 4LIUA 3ZDVA 3GJAA 3KV5A 4C0HA 1MQTA 2XR4A 1GNZA 4YW5A 2OKXA 5AC93 3VBOA 4IEYA 1TNFA 2EF6A 3WEZA 3MYXA 2I07B 1FMD1 2F17A 3WNLA 3GCXA 2OQ7A 2WWJA 1V9U2 3M8LA 4DY3A 3IAPA 1RUC1 3ZYIB 1IPJA 3J26N 5BNNA 1DQ1A 2QJVA 2P4EA 1KQRA 4HXCA 4YW2A 4QB2A 5FXXA 5D1IA 5FZGA 1PGL2 5IVYA 3ZYJB 1ZA4A 2BBVA 1XJAA 4YM1A 3I4IA 3WDYA 3T4VA 2X29A 1QQP2 1S0FA 3W59A 4HPKB 5LWBA 4BB3A 3HD8B 1CONA 1V00A 2GSYA 3FBYA 3THPA 1BLZA 5FZ0A 3LDKA 2WLPA 5E1RA 3ZXLA 1SCRA 1OFNA 5FZFA 3M3CA 5IK5A 3X29B 1WA6X 1GQGA 4Q29A 2LALA 1UO9A 5JLVA 1R64A 2C1FA 2QVSB 1LKNA 1IKQA 4IV1C 1ZRDA 5C9AA 5DDJ3 1S4CA 2W94A 3ZKYA 2WNUA 4AVVA 4LOSA 1NCQC 1KJRA 1LOFC 4GJZA 4Y20A 5F5QA 5JR7B 2JXAA 4FPOB 4ITCA 5FPXA 2FBEA 2R042 3AMNA 2ZXQA 5BXXA 1ULFA 1BBT3 2JWPA 3BOWA 3IB3A 4RL7A 3T3YA 4A6OA 4B8EA 4OVEA 5KC6A 2NZ9A 4N9HA 2WC2A 2ZHMA 4NHMA 4A41A 1L7QA 2VG9A 2Z2SB 3DEMA 4XURA 4LMFA 4HK9A 1VB2A 3UKTA 4COWA 4XCAA 1ZBA3 2ILMA 1GOFA 1V9U1 4D6RA 1U5XA 2GN7A 3MIBA 1XU1A 1FXZA 1R082 2JDAA 2P2KA 3EO6A 1BK1A 5A3UA 1IS3A 1E5HA 1V0AA 2WFF3 4XF1A 1PGL1 1SCSA 1HJFA 2PHDA 2XGXA 1JYWA 1NQDA 2FZ2A 2A6ZA 1A8MA 4UAPA 3ACIA 2DVAA 3IDCB 4FFIA 4MGIE 3ZYHA 2ZHLA 2H0BA 5SV5A 3RWKX 4QPWA 4YFWA 1UY3A 4LBKA 4AF9A 1KS5A 2DF7A 3UK9A 3ZPYA 1RUJ3 2D5FA 5FP8A 1VBD2 1RJ8A 5FCCA 1MR5A 1OQEA 1R1A1 1RXFA 1UU6A 2WZEA 3IDEA 3KQ4B 3OBRA 3PJYA 3V0AB 5K0UC 4BXFA 3ZN6B 1AJOA 5EJ3A 1JS9A 2YC4A 1SLCA 2QZ2A 5JOZA 3D8CA 3P1IA 1OA2A 3FN9A 1DZTA 5C3RA 2XH6A 2R041 3QCWA 4FO9A 3WDUA 3RWNA 1JUHA 1B35A 2UY8A 2OIIA 4FFGA 1AR71 5E8AA 4DFSA 4J1XA 4A45A 4LK6A 5FREA 1Q43A 3WDWA 2E33A 1Z7S3 1PVC2 3KV4A 1ND3A 4UXAA 3I2GA 4FPGA 4UFMA 1QJU2 1O5UA 1W6PB 4ZS3A 4YVWC 2O8QA 4LIVA 1C1LA 4YG6A 4HKOA 2Q1FA 3WX5A 4M3CF 1NA1A 2NMNA 3ELNA 1CESA 4AWDA 3TNQA 2ATFA 4OI0A 1OSGA 3BYWA 1PO13 1AF9A 4JV4A 4NIDA 1OVSA 2QQUA 2CSGA 4BQ3A 2D6MA 4B7EA 4BJ0A 4Y5Z0 1H9WA 1NCRC 4OULA 4XF4A 2K9ZA 5FK8A 3ZXAC 4Q4V3 1OUXA 1VBD1 5GZFA 1QDCA 1W2OA 3MFCA 4MVTA 1FPN1 2LROA 5CFDA 4BOWA 4AVAA 1NG0A 4BA6A 3NAPB 3CHXA 3N9LA 1ULGA 4Q0VA 4ZXEA 1JMUB 4QQOA 4YGBA 1QXRA 4N9IA 1DBNA 1X9PA 2N7GA 1K3IA 5F5AA 4ZU7A 2WNVA 1CN1A 1ASJ3 3B9IA 4DXTA 4M3CA 1W6QB 5FYCA 4IE6A 5SV8A 4WVWA 4DUWA 1RVF1 3ILFA 4DUXA 2WT2A 2Y26A 1RXGA 1PVC1 1VBA3 4PT6A 4CDXB 4JKKA 4ASLA 2WWUA 3DPRB 3E6DA 3IAQA 2WO1A 4ZHNA 1WCSA 3MF9A 3NO8A 2ZEYA 1JYXA 1CWPA 1OOPC 4NVPA 2B42B 5BV6A 3OOXA 4XCBA 1DGWA 1PMHX 3SH4A 1QOSA 1W9TA 3RI8A 4HSJA 2O0OA 3KT4A 3VBFB 1C8M3 3JD71 3VBUC 4AYUA 5FZ9A 2D6LX 4RQPC 2BGCA 1RUD3 5FYYA 2RDNA 2IXCA 1EYBA 4HETA 2WT1A 1ZBE2 2DVDA 1W0OA 2WQ4A 3PJQA 3FHIB 4QB1A 5FQ0B 1LEMA 2VCCA 3A4UA 3VD5A 1S2EA 2VGDA 3HT1A 5C3PA 2NLRA 3ENRA 3BTYA 1MS4A 2E7TA 4LT5A 2ZOEB 2KM2A 4KWLA 5A7OA 4V1PA 5JSRA 3T0AA 4PBPA 2QQNA 4DS0A 1K45A 1LHOA 1PGSA 3BPSA 3IM0A 1FAYA 3NJZA 2GP5A 3AJYA 4JQRA 5EHDA 4P02B 1BVVA 2VUAA 2VU9A 4IW3A 2J1EA 1MZEA 1TG7A 3UKVA 3TNPB 4QHOA 2EAKA 5HV0A 2OVUA 4Q4W2 1FNZA 3ZFGC 2GH8A 4BXSV 3B5LB 2D43A 4CEWA 1QDOA 5LY2A 4W65A 4HFSA 1JU3A 3RI9A 3D5OA 1NLRA 2VM9A 3PDQA 4UF0B 1OA3A 2XLAA 3OD4A 4YZ5A 3VKNA 5KHHA 1NT0A 3ZPOA 2WS93 1DGRN 2P6CA 1FYUA 5EYYA 5J37A 2XKPA 1C57A 3HNMA 3WG1A 2ZX1A 3KT1A 3O0WA 3PTYA 4IGOA 4LKDA 4W6XA 3WG2A 1GLHA 5FPBA 4PDWC 3ZYGA 2IC1A 3I2OA 1N1TA 4SBVA 2FDKA 4LO8A 4LBQB 3A22A 4OUMA 1QJY2 4CDWB 1GBGA 1S0BA 4XFHA 2VMFA 5CB7A 3ZFFA 1AR83 3HN3A 3SMHA 3SXWA 1ENXA 3VB9A 4AE2A 4EV0A 5FXZA 2FDGA 4AK3A 5JXHA 3WNXA 3ETQA 4CUBA 2VZTA 4CE8A 1LOGA 3SCHA 3J8F3 2W1UA 3I3BA 3K46A 4OHWA 3H8XA 2W1QA 3R6SA 2FHRA 2ZMLA 5G05L 4OHZA 3I2JA 5K8SA 2WO2A 3D4KA 2OS2A 1YUDA 5CADA 4AOCA 4XXAA 1BJQA 1HRI1 1D2SA 4N7IA 1CIWA 3VBRA 3O1MA 1ZZBA 1CIYA 1QJEA 5A6YA 5CFCC 4NHXA 3ZKUA 4NRQA 2W52A 4LITA 4Q4W1 2JE8A 5JPNB 2JDMA 2H6BA 2HBUA 3AZWA 4KNCA 4QDRA 1IGOA 5GZDA 4BLJA 5A32A 1JI6A 2XQXA 3KGZA 4FQZA 4BQ5A 2ZGSA 4HKWA 1UF2C 1EUUA 1ZZ9A 2VOXA 3UT0A 3AM2A 4QPIA 3BIWE 4GH4C 4EN8B 1R091 1W9SA 4BU2A 4BQ4A 4H55A 2VUJA 1QHDA 3KD4A 2WZPP 2ZGRA 4E4ZA 1WCKA 3BKZA 4FTEA 2VAUA 1OF4A 1UOGA 3OUIA 4CCEA 5LCWL 4IV1B 4XZPA 4JX0A 4ET7A 4P9JA 1QJY1 3PVBB 4MGSA 4EWDA 2DV9A 5JSPA 2FCTA 3UJOA 1QGLA 1UOBA 4NWVA 2Y6JA 1NCQB 1M06G 1H1MA 3FE5A 4RFT0 1LOCA 3RVHA 1OD3A 4YVSC 1UKRA 3R4UA 1MPXA 4UWDA 3FLTA 5JXGA 4YW6A 5DAPA 3AKTA 3TAYA 2GN3A 2JB8A 2QQJA 4ONUA 5FLIA 4IQPA 1WD3A 2EIGA 4D8MA 5TSWA 3HN1A 3I49A 4MLOA 5DAVA 3I59A 1W06A 1VBB2 1KEXA 1NX9A 2XJPA 3U4SA 1W8TA 2YG0A 5FWJA 3N4MA 4AQ2A 2PLV2 5FKCA 5BNNB 2VD7A 2DURA 4XAEA 2R7EB 4IEWA 3ST7A 4COVA 5IK7A 4CDUC 2J1UA 4PHZA 1POV0 3ZN4A 4QXKA 1SBDA 4NHKA 3O1SA 2Z5WA 2HWB3 4B29A 1F5JA 2ZZQA 1D7PM 1I5PA 2YPJA 3Q8AA 3O1RA 1W03A 2BVBA 3S5AA 4AHWA 3AP5A 5LW9A 2CHHA 3ZR6A 3UESA 4Q0SA 1WD4A 3E97A 4XF0A 4Y22A 1VAMA 3OY8B 2P3KA 2Q8OA 2XG3A 5K0UB 2QZ3A 4PF1A 3MZHA 1JTZX 1MQTC 2HYXA 2CAVA 3VBOC 3M2MA 3UGHA 1SBEA 2VQ0A 4FXKB 2GAUA 2HBTA 1KDKA 4EROA 1HXS3 4EWAA 2CYFA 5GLZA 1BZWA 2GDFA 3NJXA 3T2OA 4XUPA 5GZGA 2ZX0A 4H7MA 5C4WA 4FTSA 4MHRA 3ZN5A 4BQXA 1UCXA 2WN2A 4W6WA 5A33A 4ARYA 5BNNC 4O61A 3VD7A 2RS53 4K3UA 1DZRA 1OLRA 2Y6GA 4YVWB 1W90A 4QM9A 3ILRA 1VBB1 2XLGA 3SNMA 1JYCA 4WVVA 3T2QA 3ZSLA 5F3CA 3POEA 1Y3TA 2A71A 1LEDA 2PLV1 3UL2A 2R072 3ZXFA 1CZSA 3ACHA 1BQPA 1UN1A 1VBE3 4XOGA 2HWD3 3LIGA 2BTVC 2YBPA 3O5SA 5ERLA 2CGNA 3OPZA 2OW4A 2A6WA 1W3XA 3F95A 3PIGA 5FZOA 3SH3A 2WABA 5ACA3 3FHAA 5LB6A 4OHYA 1UMZA 2VECA 2ID4A 4Y33A 3TN93 3PUAA 1DYPA 1YQCA 1QJX3 4IGPA 1OPOA 2WNEA 3LPGA 3RPQA 1NCRB 5C9AC 5IATA 2A70A 4G4FA 2WNUC 4GQ7A 4Y5TA 5BNOA 4NIHA 5FZDA 3CDZB 4OMDA 4QT6A 5DABA 1XNAA 2HWC3 5FRAA 4FT8A 4BMBA 2V4VA 3WCRA 4ZU5A 3UV9A 1YFUA 4MXVA 2VQAA 2VW1A 1CPNA 5CKMA 5JIAA 3ZYRA 4C8DA 2ERFA 3O1VA 4XW3A 3PHMA 4DPNA 3POFA 4NR1A 5LBCA 4E4DX 1DDLA 2VC9A 5JMOA 2XDVA 2XWBB 1IZ3A 2JX9A 1ENQA 2WT0A 4JHTA 3HQUA 3AVRA 2BWCA 4TSVA 4DUVA 3MIEA 1OOPB 4GXLA 2JJ6A 3FUOA 4NOTA 4BH9A 1KJLA 4CU9A 1OQ1A 1NY72 3ABZA 4BCUA 2R071 2QNKA 2W1WA 5FZAA 3AZXA 2Q8CA 3T1MA 2DYCA 1FMD3 2J1TA 3VBUB 2AEZA 2GNDA 1IHMA 1OT5A 4RQPB 4CRQA 3ZFEC 2Y34A 2DCYA 1CGPA 2PHFA 3AYAA 4XFGA 2VCAA 4D69A 1RUC3 1AYN2 2GMMA 3ATGA 3JB4C 4DEVA 1S0IA 2ZPXA 4WVZA 3VDAA 3WW4A 2UWCA 3AMMA 4Q4X2 4PI2A 5F3IA 2GC1A 3AP7A 4GULA 4QX7A 1T6GC 1IPKA 1PMIA 1QU0A 1XYNA 2BERA 3AFKA 4XPVA 1ULCA 3C2UA 3ZM8A 1QJFA 2A1XA 4MH0E 3K4ZA 1LHNA 4AFBA 5KHGA 1WLTA 4OUSA 4FCAA 1B35C 3KT7A 4B1LA 4BYYA 1WZXA 2VZVA 5FYMA 3OPTA 4LHSA 3LD8A 1X7NA 2GP3A 5LEKA 1ND3C 1H4GA 1VRBA 4HL0A 4NJ4A 1JBCA 3ZFGB 1H4HA 2W1SA 4CXXA 1NA1C 3CO2A 4Z2WA 1Q8VA 1JW6A 4A6SA 3H3LA 4Z1VA 2XJQA 1LTEA 1AR62 4YZ4A 1ULDA 2RDQA 4S2DA 3CJXA 1RUG2 1EAH2 1RGSA 4K1YA 1W99A 3ZR5A 1DZQA 1QXJA 2YUEA 1N1YA 3SISA 3V0BA 1PNFA 2V73A 4AAXA 1HJGA 3A7QA 2C4XA 2RJ2A 4LLOA 4PDWB 1AYM3 1V9U3 3KVAA 4DO0A 2RMU2 4I3PA 1YQ2A 3AC0A 5CFDC 2XUEA 1G9CA 2VMCA 4S2GA 4CCDA 4Q4X1 1YNAA 3HOBA 5JPMB 4L97A 1J3RA 3WW2A 4AQSA 2BBAA 2Y6FA 5K4LA 5FPVA 1K5MA 1QOTA 2RDSA 4QU2A 1UAIA 5GLVA 1XNCA 1S0DA 3PLQA 1Y9MA 4JZRA 2WNVC 1GQHA 4Q1RA 5C3SA 2HWF2 1H6YA 5F5IA 4XILA 1JYNA 3MF6A 2VNVA 1OMIA 2VNRA 4N53C 4F8AA 5BNPA 2PHWA 5APAA 1QH7A 3FZ3A 3HMYA 4XDPA 1GKBA 1R1A3 4CP9A 3W5MA 2AENA 5CFCB 5L9VA 1COV2 2F4LA 3RRDA 1OHFA 4DINB 2ZHKA 3H1YA 1PM4A 3BTAA 4HVOA 1REDA 3NMBA 4P9GA 1UU5A 5FKBA 1CAXA 1URXA 2R16A 1AR61 5LA1A 4WV8A 3DF0A 3HIFA 4GB32 4GH4B 4CUAA 1RUG1 1EAH1 3OYWA 2QBXA 3Q8CA 4KWUA 1CAUB 5JZGB 1AR73 4P14A 1AX2A 3N9NA 3EHKA 1FI2A 3BU7A 4MYEA 2VMEA 1EV11 2Y64A 3G6JB 4N7UA 1H30A 3T30A 5FDBA 2OZJA 1RYYA 4JGYA 5EFUA 1O3QA 3AX4A 5FY9A 5JOWA 1MEC2 3W58A 1X8EA 5T55A 3ZLIA 4OCTA 1A78A 2R0HA 4QKFA 2RS31 4XVHA 1Y4WA 3WNKA 3NQHA 1YIPA 5A7WB 4DXRA 1BXHA 3H7YA 4YVSB 1LAJA 3APBA 4QD2A 3IPVB 2R6QA 2Y0OA 3WP6A 1MS0A 4HZFA 4QMAA 3NNLA 2CY6A 2Y60A 3CF6E 3MI8A 1VBD3 4ZZ5A 4LO7A 5DZEA 3S6PA 5M0TA 1FPN3 5H9SA 4Q2FA 4CZSA 1DQ2A 3KM5A 1O4YA 4HBNA 1SFPA 1YI7A 4CP2A 3TEZA 5FOJB 1LODA 3OB8A 3BTZA 1SDDB 4CDUB 4UW5A 1RUOA 2B9UA 2XB6C 1I3HA 4GB31 3DXTA 1GWMA 1F2NA 5HPOA 4LK7A 3GZTB 4OHVA 4XJWA 1V6IA 1RVF3 5T3NA 5C5UA 1PGW1 3AYCA 3FFQA 2ZX2A 1W9YA 2D44A 1PMJX 4EN6B 4INDA 4D94A 1NKGA 4Z07A 1SBFA 2AYHA 2QQKA 4YRDA 4DZGA 4DOUA 4NPRA 2MEV2 4IGQA 2ENRA 1KD7A 2BNNA 4M0HA 1MQTB 4QKBA 5F39A 4LULA 4CEYA 3VBOB 1WMFA 2K46A 2AZ5A 3JD73 4RR3A 2XHNA 2MHFA 4P9WA 4XJZA 1FOD3 1KFUL 2IXKA 5IAXA 1YWKA 2YC2A 2D7FA 3A0NA 3WHUA 1J1TA 3KHBA 4XFIA 2A6XA 2WA4A 2ZZJA 1N1VA 2EAAA 2G9GA 4RD7A 3UYJA 4IEPA 5T5LA 3W9AA 3ZSMA 4BLIA 1J83A 4XIOA 1QIQA 2WR9A 4A7ZA 2D6KA 4P5YA 1W04A 3LEIA 4XJUA 5F8PA 4QPIC 2P3JA 1VALA 2AH2A 2C9AA 4N43C 1H2MA 2YGLA 4IE4A 4K6BA 2BRTA 1NXMA 2KA3A 3TOJA 1DFQA 1ZVFA 4FP3A 1TNRA 1AL22 1UZ0A 2XBO1 2JG8C 4CCOA 3GYDA 4PIZA 3RJRA 5C9AB 1U5IA 2QKDA 2ARBA 1WLDA 3MO4A 2CGPA 2WNUB 3AP6A 4L92A 1VPHA 1CAVA 4Y20B 2ARXA 2A6YA 3K4DA 5FFOC 4ISRA 4U36A 2W95A 1SPPA 5FBJA 1POV1 3P5BA 1H9PA 3WZ1A 4CXWA 5HV4A 4DB5A 2D3RA 2EXIA 3ZIXA 5A6ZA 4MZUA 3POWA 3PTRB 5B4XA 2TNFA 2ZA9A 1E5SA 2QQMA 3KSCA 1A34A 3JU9A 1CAWA 4N90A 2XJUA 2VTXJ 5FZBA 2KXLA 1L7LA 2QQPA 2ADDA 3FL7A 2WINB 5FZ4A 2A73B 4C90A 1PO21 5DUXA 3WG4A 5IHRA 2G9FA 4PF5A 4UT5A 1REFA 2VJXA 2R0FA 5I8YA 3SCFA 3LEGA 5L9BA 3WCSA 1LJ7A 5LZ6A 4UFHA 2R30A 1HRI3 2P6HA 2RS12 3KB5A 1AL21 3KGLA 2RM22 3ZMNA 3ZOIA 4AZZA 4GIQA 1DGRA 3K77A 4Q4W3 3I3DA 2DDUA 5IVFA 3KF5A 5FMCA 5F3GA 3KVBA 1C5IA 5L7OC 3RG0A 2G9ZA 3LFMA 4HG6B 2BDRA 2JDZA 2VCBA 4XBLA 1R093 1OH4A 1YEWA 4XUOA 4B7KA 3HJRA 2BUKA 3HBKA 4W50A 4ASMB 1B35B 1MVQA 4XF3A 2JG9A 4LO6B 4MGYE 3O0XA 5C4WC 1CVNA 2D97A 2P37A 3CEWA 4FFFA 2GC3A 1ND3B 1VMFA 4GAZA 1MS5A 4WZCA 4C1WA 1W8WA 2W46A 3WQ1A 1QJY3 1XE0A 1V6NA 2X10A 5FPUA 1RB8G 4UW3A 1VLNA 4DRRA 1NA1B 2VUDA 3IN9A 4LA2A 2E51A 1QWRA 3N3HA 2NP0A 5IVVA 1O4TA 4TLGA 4F3JA 2Q0AA 2V72A 4YW3A 4QDSA 1XQNA 4QKNA 5LK5A 5C5TA 2Q8DA 2VOVA 1ZNPA 1Y7BA 4D6QA 2KR2A 4AHYA 4W4ZA 4IV3A 1QQP1 1XC6A 3MLJA 3WDXA 1NYWA 1XE7A 4QDQA 1RUH2 5BNOC 1GOHA 1UPIA 3GZAA 3H50A 4YARA 2RM21 4Y1VA 4ZPIA 4EN9B 3LA3A 5EJ1B 2W5FA 1N3QA 3PNAA 3ZFEA 5CFDB 3HR9A 1A8DA 1YLLA 3ACGA 4IDZA 5FV3A 2P34A 3LFIA 5D2AA 4A44A 1X50A 3RZJA 4XF9A 1TE1B 4X8NA 2OUHA 4Z8BA 1WMDA 2CU5A 1RUI2 1LOBA 1F4AA 4RFRB 2WNVB 2PHRA 2WFPA 5FY1A 4S2FA 3NWKA 3K4AA 3LB9A 4I3GA 4FPYA 3WR0A 5HXMA 5HCBA 1D4M2 2O8OA 2VZ3A 3C7HA 4ZS2A 4ZKTB 3PUHA 5I8TA 3K51A 1HB1A 3KWVA 5A3LA 2QDNA 3ZMOA 3TEWA 4AGGA 2PELA 4LLFA 2G4IA 4IE5A 3RZHA 2VCMA 4DEQA 1R081 5DZGA 5FY4A 1QXPA 4Y5SA 1QKQA 4QX5A 2ZCWA 4ZU4A 3ORJA 3ZXGA 1UY0A 1TME2 4KL1A 2FMDA 3OGRA 2HWE2 5DG2A 5FZ3A 3TWIA 1OLQA 2Y8KA 4CU6A 4LQRA 2R062 3JB8A 1GNHA 1J3QA 3AVSA 5JUVA 4FAGA 3POIA 1RUH1 5JI7A 3S30A 5D8AA 4CPBA 1VBB3 5FYSA 5GZCA 3ACFA 3M4FA 4I09A 3JXSA 5JDBA 4AI3A 1JZ2A 1GMMA 1HRV2 1UX6A 3BI3A 1N47A 3B9CA 4OI2A 4FOVA 4YGEA 2X5IC 2A5ZA 3HWJA 5FJKA 3I2FA 1RHI2 4WM7A 2UWBA 4PQQA 1VJ2A 4CSWA 1NZCA 5EZWA 4BIOA 1F9KA 3AKPA 2GNMA 2ZGQA 4XFFA 1W0NA 4KI5M 5FXWA 3WSOA 1YI9A 1Y43B 2BNMA 3HT2A 5EPAA 3RMXA 3WDTA 1D4M1 2VE1A 3CL1A 2B39A 3POSA 4OLLA 3VKOA 4AL9A 2IVJA 4CEWB 3AYEA 3RYPA 5FUPA 4N53A 4HK8A 4HMZA 2ZX4A 4ES8A 2RE9A 3LOBA 1QJU1 1RMU2 5IVEA 3H1MA 3NVCA 3OG2A 5F6LB 2VMDA 3VBHA 4FOYA 2ZGMA 4AQTA 3H8RA 2QQLA 4NAOA 3C7EA 4LO4B 3WP3A 3W21A 2HWE1 3USUA 4GJYA 1GZCA 4O9EA 3LGRA 5G04L 2D6NA 2VY0A 2XVGA 3ZFFB 2RR12 2YZ4A 5BYNA 4I01A 4NPMA 3MIFA 3O1PA 3OBZA 3N9OA 1I6XA 1K5MC 4BQ1A 1UYYA 4QM8A 1XE8A 1F15A 2J42A 3NL1A 1HRV1 1I1EA 1OXCA 5C71A 1JZ4A 4HSLA 3A23A 2YU1A 3N7LA 5IJRA 1QMJA 5L9RA 1RHI1 1RUF3 4Q0PA 5BNPC 3MIDA 2IXLA 5F2WA 3MLLA 1OQDA 3VBRB 3WOGA 4HLTA 4COUA 2X09A 1RUE3 5A3WA 2YU2A 5GKAC 3J4UH 4AG4A 1H2LA 1S0GA 3S5QA 5A32B 3IWZA 4XFAA 4R4XA 1RL3A 4E8DA 5LEJA 3JUUA 3N7MA 4YLZA 2QE3A 5J7MA 4QPIB 3VV1A 5FAXA 1LULA 4CXYA 5DUUA 3IT8A 4M3CE 1RMU1 4FPEA 1DLCA 3HEIA 3RZMA 4G9SB 2WBKA 5DUWA 1JZ6A 1PIV2 5LASA 4EN7B 3RYRA 1HV1A 3MICA 4JGYC 4PLOA 1ZZ6A 1CX1A 3CJIA 4R52A 1LGNA 5DXDA 1W6MA 1W8ZA 4X8PA 1YFYA 2IFWA 2LTNA 2D3PA 3N36A 2R1DA 4U2AA 4H2AA 3BTXA 3G7DA 4YG0A 2UYBA 3FUQA 2ZMNA 4QX1A 1REEA 3W5NA 1ZBE1 3LQCA 5F3EA 1J59A 1A3KA 3C7OA 4HVQA 4ASKA 1GZWA 5B4NA 2C24A 1GP4A 4GMP1 5DDJ2 5FMOL 4MGQA 1UZYA 2VQUA 5FMBA 4ES9A 2P5BA 2XJVA 3C3VA 5IK8A 3AXDA 2EALA 2UU8A 1WUVA 2QQOA 3N7KA 4Z92B 3I59B 1K5JA 3FC0A 3HNYM 2Y6KA 2OPKA 3OEAA 3RSJA 3VZOA 2V4AA 3DECA 4RGAA 1ALYA 4UFJA 1D0HA 1V6OA 2PHUA 2ZGNA 1G6NA 2BW8A 4LHNA 5CVRA 1E5IA 1V70A 3V56A 5I0SA 3MEPA 5A7QA 2CV6A 1OA4A 3O1UA 5CIRA 3VBSA 3OEBA 1SHWB 3AP4A 1W6OA 3M70A 4UYBA 4FP2A 5K9YA 1ST8A 1VAKA 2PQQA 1TMF3 3Q8FA 2WFF2 1AUYA 2Q1MA 1PIV1 4FXGB 3BIEA 3AJZA 4YW1A 2XHKA 4MX3A 2GMPA 4AEJA 4N43A 1I5ZA 2YHJA 1MACA 4PLMA 3POGA 4R9AA 4QQHA 1US3A 1DF0A 3H1WA 4FPJA 1GP6A 1LHWA 4Y22B 1E5RA 1WKYA 2VVFA 3B01A 3NNFA 2JG8A 4NPLA 2K0GA 5J98B 2VZQA 1UOJA 4XAAA 4CEYC 1XXNA 4MOAA 2UY9A 3TYJA 1RUJ2 1AR63 5JIUA 3TB0A 4RR3C 4TXWA 1RUG3 5IK4A 2ZBJA 3PVEA 1CJPA 1HKDA 4IEXA 2Q8EA 1ND2A 5C4WB 1EV13 3B00A 2VH9A 3P3PA 4DRVA 4AI9A 5A33B 1N1SA 3URFA 1VR3A 4PCRA 1UY4A 1WBLA 2AGSA 4OFGA 1X82A 1S55A 4MO3M 3THCA 1AX0A 1XSRA 1SQ4A 2RS33 3CIHA 2YC0A 2DVGA 5LBFA 1UY1A 3WV6A 4AHXA 2VOWA 5FYZA 1Z7S2 2HEWF 5C6CA 1ODMA 4JTOA 5CEHA 4FVVA 3QLQA 5FOBB 3RFRA 2WQZC 5FZOB 3U10A 5J36A 2X53S 1V6KA 1PZ8A 2WJSA 4NHYA 5FBZA 3NV1A 4CVUA 3FFZA 1UL9A 3DXUA 1FNYA 3SC7X 5BNOB 4M4PA 4IEVA 1KDMA 1PO12 1US2A 2JE9A 2ZEZA 1LU2A 5I0UA 3B3QE 3ZSEA 4AEDC 3NV2A 1WCDJ 5T50A 3GBWA 1VE0A 4QB6A 4IEZA 2ES3A 3ACLA 3LA7A 4YM3A 1AX1A 3WINE 1BK0A 3THDA 1ZA7A 4Q4V2 5FIXA 4YGCA 1UIKA 1EUTA 4GB33 5L7OA 1XNKA 2JD4A 3BPZA 3E6CC 1OURA 4J25A 4J1WA 1DP0A 4V2WA 5A7PA 5FZ8A 3RNSA 1DGWX 2VOTA 1NLSA 2CTVA 1DLLA 1OLMA 1LESA 1FV3A 4QX8A 5FZHA 4YZ2A 5I0RA 2VOKA 3H9AA 2B45X 5FZ6A 2FCVA 2OX0A 2DUQA 4UFIA 2B4KA 1ASJ2 1ZRCA 4JDNA 1W2AX 2PAKA 4NAMA 4WBBA 4X6QB 5C3QA 4XJ8A 4D7YA 1CR7A 2D98A 1YXWA 3MW3A 4L8QA 1G9DA 1AR92 2BOIA 2D6PA 3O14A 5J1XA 4ATFA 1H1IA 3I8TA 3M3OA 5DPNA 2UWAA 2Y6HA 1LCLA 4IE0A 1XRUA 4CUCA 1KITA 5FZLA 3ON7A 5EJZB 2DWRA 1NZIA 2E7QA 4K21A 5FZ1A 5A1AA 3HPNA 3EXUA 5I91A 3PMSA 1MS9A 1WGPA 1O3SA 4LBMA 2YDEA 3WXPA 2YFZA 5L73A 2VBBA 3KLSA 1WA4A 1JU4A 4QGNA 4D7SA 1IKPA 1RINA 1RUD2 3J7LA 1AL0G 3VHRA 2NQYA 3C7FA 4Y1UA 4KQ7A 2VTXA 2W87A 2JG9C 4BK5A 1UOFA 2E63A 2Q30A 4Q4V1 5IAVA 1H6XA 4LKSA 5FMOS 5FY7A 4AI0A 3JBG3 2XBO3 4Q4Y3 5LRSA 4R8HA 2EICA 3HQXA 3LPFA 2WA3A 4GD4A 4XHBA 2YPDA 1AHSA 3MLKA 5AFEA 4L0PA 1DU3D 1GQPA 3EQEA 2QDRA 4XTMA 4BK4A 2C5DA 1LOAA 1POV3 3GNEA 4QGLA 1ASJ1 2VULA 3N9PA 4SLIA 4P9YA 3N9QA 3UJQA 1HLCA 2A6VA 2TEPA 4D0QA 2FDFA 4BMEA 1T2XA 3L9JT 4ISQA 2HEYF 4WM8A 4LBQD 2FCUA 5FY0A 4IV3C 5FZKA 3ZXDA 3V0BB 1AR91 3LSDA 2WN3A 1J84A 1M4WA 4FAHA 2B46X 4RYDA 5DUVA 3OPWA 2WIIB 3WP4A 1WBFA 1G9AA 3GZEA 2LRPA 1HIXA 2Z42A 4AGRA 5FYVA 5EV7A 5DMYA 1CZTA 1K5MB 1PO23 3BCWA 3IDAA 1RUD1 3L2YA 4LORA 1HDKA 4R9DA 5AVAA 5ANNA 3OUJA 4AGVA 5EXOA 1AR82 5C7GA 3KCCA 2A3XA 4FQ4A 3WQ7A 2PN5A 4JRAA 1EP0A 3VUOA 3I3MA 4UW6A 1AZDA 5BNPB 1Z78A 4OMCA 3WF4A 2ETEA 2Z4FA 4CP9B 2X5IA 3WUDA 5KHIA 2BV4A 3J8F2 1O7FA 3OF1A 3SQOA 4N8MA 3ZXKA 3H8OA 2B5HA 1BMV2 3B7MA 2QUOA 3RGBA 1W6NA 5FK7A 3ZYFA 1C4RA 4IEOA 4NN0A 1CAXB 2YMZA 2VBPA 3FWEA 4QAWA 4I30A 1IQDC 5FPZA 2HJIA 4AAPA 2E31A 3OYWB 4BM8A 4KMQA 1X9TA 2X05A 1IG0A 1VB4A 2A75A 2VL4A 4LKEA 5ABJA 3S0MA 1NY71 2WZ8A 4WVMA 2ADEA 2XMLA 4JGYB 4H7LA 4TTGA 1OI6A 4LXLA 4Q8LA 4L9BA 5D8AC 5FYBA 5A80A 4D3WA 5KBFA 3OBAA 4GWNA 4RSUA 1OC1A 2C9KA 4FFHA 2JDUA 1C3HA 4TYSA 4XQ4A 1N3PA 4X6RB 1SLTA 1AYN1 4B4PA 5A6XA 3RZKA 3H7JA 1OKQA 2J1VA 4MXWA 4WM7C 3BU0A 2CL2A 4QU1A 2PQSA 4JDOA 1O91A 1YRZA 4M0NA 4V2VA 1QQP3 5FZEA 4QPGA 3O1TA 2NN8A 1OD5A 2EXKA 5FP4A 1MS8A 1HB4A 3MW2A 1NQJA 3H3ZA 1APNA 2RM23 2DUOA 4A3ZA 5FYUA 1U5YA 3EYPA 2H6CA 3HQRA 4P08A 3ZYPA 2QTWB 3H8UA 1BMV1 2GMEA 5IUQA 2VW2A 3K2OA 4O65A 1BEV2 2R1BA 2EIBA 1QY4A 5JXJA 3QBQA 4LA3A 2ZMKA 4JVAA 3VBHC 1QNYA 4HONA 1O8SA 3R0RA 4LKFA 3M3EA 3O0VA 4JDMA 1K12A 2IXHA 1O8PA 2VW0A 2OT7A 2X8KA 1Q8QA 2PHXA 2R043 2VVEA 4IEUA 5CNAA 2JICA 1PHMA 4LNVA 4EYUA 5FYHA 3MFAA 3A0KA 3EJKA 2ARCA 4AFAA 5A1LA 3WNNA 2VTFA 3JQWA 1AVBA 4QHZA 5E16A 3BUCA 2HWB2 2AR6A 1NAEA 3I2HA 4CEYB 5GLTA 1R083 2ZJCA 2RMU1 1SLLA 1PK6A 2J7MA 4XZUG 4RR3B 4LHKA 1ZX5A 5FY5A 3HBZA 3I97A 4CDQA 1YQ8A 2DBIA 1WCQA 3INAA 3VL9A 4AI1A 1GFF2 1Y9GA 2F4PA 5T54A 4XDQA 1A6CA 3KQRA 3DYMA 1BKZA 1MZ6A 1LHVA 4XYXA 2HWF1 2BEOA 4CTEA 3NV4A 1LNSA 3KZ4C 1HXS2 1C1FA 3VZJA 3VZMA 4GALA 5DAWA 5I93A 4ATEA 3OD0A 2IXIA 2W2IA 3SHRA 4XMIA 3FJSA 1COV1 3PUQA 4XEZA 1BEV1 5A70A 4B3NA 2WQ8A 5CISA 2RS52 4MGZE 5K7PA
chains in the Genus database with same CATH topology
3I3MA 3I2OA 3I3QA 3KHBA 2FDKA 4O61A 4ZS3A 3H8OA 2FDGA 4IDZA 5F8PA 3RZJA 3H8XA 4CXYA 4IE4A 3RZMA 4NIDA 4RFRB 2IUWA 4MGTA 3O1MA 4ZS2A 4NROA 4NRQA 4NIGA 4NIHA 5DABA 4NRMA 3BTXA 2FD8A 3T4VA 4IE5A 3RZHA 3RZKA 4CXWA 3BU0A 3O1VA 3O1TA 4IE6A 3BKZA 3O1OA 4IE0A 2FDHA 4MG2A 4ZHNA 4JHTA 4OCTA 4QKFA 3BI3A 3O1UA 3KHCA 3T3YA 3BIEA 3S57A 3I49A 2FDJA 4NPLA 3T4HB 3BTYA 4O7XA 3BUCA 3LFMA 4IE7A 2FDFA 2FDIA 3BTZA 3H8RA 3O1SA 3S5AA 4QKDA 3O1RA 3RZLA 4NJ4A 4QHOA 4NIIA 4NPMA 3O1PA 4CXXA 3RZGA 4QKBA 4NRPA 4QKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3M A;  3I2O A;  3I3Q A;  3KHB A;  2FDK A;  4O61 A;  4ZS3 A;  3H8O A;  2FDG A;  4IDZ A;  5F8P A;  3RZJ A;  3H8X A;  4CXY A;  4IE4 A;  3RZM A;  4NID A;  4RFR B;  2IUW A;  4MGT A;  3O1M A;  4ZS2 A;  4NRO A;  4NRQ A;  4NIG A;  4NIH A;  5DAB A;  4NRM A;  3BTX A;  2FD8 A;  3T4V A;  4IE5 A;  3RZH A;  3RZK A;  4CXW A;  3BU0 A;  3O1V A;  3O1T A;  4IE6 A;  3BKZ A;  3O1O A;  4IE0 A;  2FDH A;  4MG2 A;  4ZHN A;  4JHT A;  4OCT A;  4QKF A;  3BI3 A;  3O1U A;  3KHC A;  3T3Y A;  3BIE A;  3S57 A;  3I49 A;  2FDJ A;  4NPL A;  3T4H B;  3BTY A;  4O7X A;  3BUC A;  3LFM A;  4IE7 A;  2FDF A;  2FDI A;  3BTZ A;  3H8R A;  3O1S A;  3S5A A;  4QKD A;  3O1R A;  3RZL A;  4NJ4 A;  4QHO A;  4NII A;  4NPM A;  3O1P A;  4CXX A;  3RZG A;  4QKB A;  4NRP A;  4QKN A; 
#chains in the Genus database with same CATH topology
 1DG6 A;  3CU7 A;  3MW4 A;  3ZXJ A;  3VKL A;  4FPF A;  1JZ5 A;  2VNG A;  2UUR A;  4JHZ A;  4Y1X A;  2CAU A;  3CJI C;  4LBO A;  2YYO A;  4M4R A;  4XJA A;  5A3P A;  1NE6 A;  3C7G A;  3VDC A;  1ENR A;  2QQI A;  5F9T A;  5JXI A;  4OZX A;  5IW0 A;  3DYO A;  2JDH A;  4CCJ A;  3LSE A;  2WLQ A;  5ISL A;  3H0O A;  4K1Z A;  3D6E A;  2W9X A;  4G3Y C;  1AXY A;  3WNM A;  5ACA 2;  1JOD A;  4HT1 T;  1JYV A;  1PVC 3;  1SPP B;  1ULE A;  2Z69 A;  5CZK A;  1H8T A;  3NJV A;  1QJU 3;  4KBB A;  3TN9 2;  3CKH A;  1QJX 2;  2HWB 1;  3F2Z A;  4RHV 2;  3SEP A;  1MEC 1;  3FLR A;  2LW8 A;  2WKK A;  4YG3 A;  3N35 A;  2NMO A;  5LRR A;  5JI9 A;  1YCI A;  1UW8 A;  3N7J A;  2HWC 2;  3GM8 A;  4UBH A;  4XXP A;  1SEF A;  3WF2 A;  2HWE 3;  4LEJ A;  1CAW B;  2ZAH A;  5FR3 A;  4NRO A;  1U0A A;  3VZK A;  2VUC A;  1MS3 A;  3VBF C;  2AC1 A;  2OZ6 A;  2HYK A;  1J3P A;  1E57 A;  1OVP A;  2IXJ A;  1QF3 A;  3LDR A;  3VBS C;  2BGP A;  2DCT A;  4FOW A;  4HN0 A;  5HI0 A;  1CX4 A;  2VMG A;  1BHG A;  1GNY A;  3TRS B;  2RS5 1;  2E53 A;  2WUH A;  1LGB A;  1HQN A;  3AYD A;  4JCK A;  3JQX A;  3GBF A;  3Q8B A;  2WYF A;  4O9G A;  5HCA A;  4GZ9 A;  1F5F A;  4XUQ A;  4E8C A;  2ZGU A;  1FMD 2;  5FPL A;  1J1L A;  1PM7 A;  3Q8E A;  3VHP A;  1LR5 A;  2QQW A;  3PU3 A;  4Q27 A;  4S2H A;  4W6Y A;  4KG8 A;  2PHL A;  1VRH 2;  4RHV 1;  5IFT A;  1RMU 3;  1RUC 2;  3DKQ A;  4AED A;  2MEV 1;  2MNG A;  4A2U A;  1HV0 A;  2JG9 B;  5FJH A;  1GZ9 A;  3EBR A;  1ND2 C;  1LHU A;  3NRU A;  5C8C A;  3LAG A;  2WSU A;  2DBN A;  2ZGP A;  1VMH A;  3GAL A;  2XON A;  5FP9 A;  2BNO A;  4B1M A;  1I9R A;  4CU7 A;  1N3O A;  2IFR A;  2XXZ A;  1S0E A;  3OGS A;  5JVV A;  4YPJ A;  4A42 A;  4RS5 A;  2H0V A;  3T4H B;  2BYV E;  2YGM A;  4PLN A;  1XNT A;  1ZBE 3;  3D0J A;  3E1F 1;  3FBM A;  3GGL A;  1C28 A;  3UNP A;  3E6B A;  5FO9 B;  2FDI A;  4AEM A;  4P9X A;  4NWW A;  4KU8 A;  5KHJ A;  5EWS A;  4GMP 3;  2VPV A;  5A3M A;  1HW5 A;  1QEX A;  4IV3 B;  2JDY A;  2PXJ A;  1DCS A;  1WME A;  4KU7 A;  4B4Q A;  1UY2 A;  1XPW A;  4FPH A;  4IER A;  4JGZ A;  4I0A A;  2D40 A;  1ZRR A;  2BOJ A;  5JCT A;  3AMP A;  1JH5 A;  3ZFE B;  3VKM A;  1YFW A;  4FTB A;  1W0P A;  4D6S A;  3GJB A;  2DFC A;  3VZN A;  4NRP A;  3WP5 A;  4LUM A;  3QD6 A;  1AYM 2;  1C5H A;  2YFU A;  1VRH 1;  5GJ6 A;  2UYA A;  3RMY A;  4HAN A;  2PYT A;  1Q56 A;  3III A;  5BUV A;  2ORX A;  2VZ1 A;  5H9P A;  1PIV 3;  2QQV A;  3IMM A;  1X33 A;  4D7T A;  4AI2 A;  1W28 A;  1XYO A;  3QOP A;  4Y4Y A;  1XB9 A;  3BB6 A;  1WLW A;  5GZE A;  4GWM A;  3OUH A;  1C8N A;  5DG1 A;  2OXB A;  2D6O X;  2VXR A;  1CZV A;  5H9R A;  1ZZ7 A;  2J22 A;  2EXH A;  3TBD A;  3VKF C;  4FBF A;  5FZI A;  4GWI A;  4I02 A;  4JQT A;  3KS7 A;  4YYO A;  3NNG A;  1GP5 A;  1UKG A;  1O59 A;  3PUR A;  1R1A 2;  4BPZ A;  4QXH A;  3M3Q A;  2VZU A;  1FT9 A;  3GDB A;  1OFS A;  1HQL A;  2IUW A;  1DYK A;  1UX7 A;  4UFK A;  3T2T A;  1ZRF A;  1ULP A;  1D2Q A;  2NPI A;  5KXE A;  5FXV A;  3PU8 A;  3GCW A;  1RC6 A;  4NIG A;  2DU1 A;  1XYP A;  5D8A B;  1JZ8 A;  3MPP G;  2RS1 1;  4NRM A;  3I54 A;  4LHL A;  1AR7 2;  4UW4 A;  5LBB A;  1F8V A;  1NXD 1;  3PIJ A;  4YM2 A;  5JWP A;  1AXZ A;  2DCJ A;  4YW4 A;  5T5P A;  4CU8 A;  4R9B A;  2XJS A;  1UZW A;  2Y0I A;  1YYN A;  3DL3 A;  1AYM 1;  2ZGL A;  4WM7 B;  3WHT A;  4E4H A;  3I2D A;  1DQ6 A;  4BIF A;  3VHO A;  4AW7 A;  2WWS A;  2ZGT A;  4XE9 A;  1HB2 A;  1JHJ A;  3LOI A;  5DAX A;  4LE3 A;  3ZXE A;  1OUS A;  1U12 A;  2ZS6 B;  4M3C B;  4C91 A;  1L3J A;  2YRO A;  3BN6 A;  2CWS A;  3SH5 A;  2BFU L;  4N53 B;  4I2O A;  3VDD C;  1GIC A;  3RQ0 A;  1B09 A;  4HPK A;  4IXL A;  1GV9 A;  1UYP A;  5CG9 A;  4WM8 C;  1IPS A;  2F6B A;  4XAC A;  2OPW A;  2Y33 A;  3VBH B;  2Y6L A;  3WNO A;  1FPN 2;  1H2N A;  1YFX A;  5F5C A;  1IS6 A;  3USU B;  3ILN A;  3T2P A;  5LY1 A;  4DXZ A;  3Q9O A;  1VBC 2;  1LRH A;  2FDJ A;  4MSV A;  3AB0 A;  1NLQ A;  1W2U A;  1UYZ A;  1XND A;  1LB2 A;  2XOM A;  2RHP A;  3AXE A;  3E5Q A;  1W3V A;  5IWF A;  5T5O A;  4AXO A;  4A4A A;  3H3U A;  3ZO0 B;  2NM1 A;  5C70 A;  1RVF 2;  2BVV A;  4HVR A;  2NYY A;  2VZO A;  4URT A;  2A3Y A;  3D3A A;  1RJ7 A;  3GHM A;  3VHN A;  1W2N A;  2AAC A;  4BE3 A;  2PLV 3;  2RVA A;  5A3O A;  4OI1 A;  4AHZ A;  1CD3 G;  1SFN A;  4BHP A;  1GWL A;  1SZB A;  5JAX A;  1RUI 1;  4QX0 A;  3AL6 A;  3SKJ E;  5JOX A;  4BQY A;  1BCX A;  2XVK A;  4NII A;  1HB3 A;  3JD7 2;  2WZR 2;  3WT3 A;  3QH6 A;  5J48 A;  1JXN A;  4FOQ A;  1FOD 2;  4OZO A;  4E9K A;  1K42 A;  3MHZ A;  3ITQ A;  1P8J A;  1Z0H A;  4XAB A;  3S7E A;  2JD9 A;  3OGG A;  4COY A;  4OI4 A;  4LBL A;  5IVC A;  1F31 A;  4K40 A;  3WF1 A;  1OF3 A;  2R32 A;  2ZEX A;  4K20 A;  5ABJ C;  3K75 B;  3MUY 1;  2J1R A;  2YY1 A;  3POB A;  2PHT A;  2B9V A;  3CJI B;  3MGU A;  1W6M B;  3ECQ A;  3LEM A;  3R4S A;  4DMI A;  1VBC 1;  3V0A A;  4AEK A;  1EPZ A;  1TME 1;  3MPB A;  3ZN6 A;  4IL7 A;  3U1X A;  5H9Q A;  2J1S A;  5EQU A;  3PUS A;  2K2S A;  4UBG A;  2R06 1;  4XBN A;  4UFL A;  4KWJ A;  2Q4S A;  4LPL A;  4CCC A;  1WCU A;  2E7A A;  2YXS A;  3H42 B;  1FAT A;  2E26 A;  1HX6 A;  2PMW B;  1GZW B;  1CQ9 A;  4L99 A;  2IWG B;  3A21 A;  4QPG C;  1RIT A;  1AR9 3;  1JN2 P;  2R07 3;  4FPK A;  4MGT A;  5AVP A;  1IOA A;  1UWW A;  1UZV A;  2W91 A;  4KGQ A;  3K48 A;  2YV8 A;  3P3N A;  5CKQ A;  4EQV A;  1W6P A;  2ZEW A;  1DQ0 A;  2WL1 A;  4H3W A;  5KR7 A;  3AMQ A;  5HCF A;  1MVE A;  3LA2 A;  2WZR 1;  1GU3 A;  5KWR A;  1W8F A;  5AC9 2;  1SDW A;  1FOD 1;  3BAL A;  1ZZC A;  3T0D A;  2GZW A;  1JOP A;  2W3J A;  5KXC A;  1UNB A;  3PL0 A;  4Z2A A;  4NIA A;  3VBS B;  3M1H A;  4QPY A;  2R49 A;  1W6O B;  4TLF A;  4K9S A;  3WF3 A;  5BNQ A;  5CBL A;  1ZZ8 A;  3NNM A;  2C6S A;  3LZZ A;  2EXJ A;  2HH9 A;  5F37 A;  1UMH A;  2W0X A;  4QXB A;  5FMD A;  3CQO A;  3SCG A;  3W20 A;  2VBD A;  4N43 B;  3B02 A;  4MV2 A;  4QGM A;  3JCI A;  2EID A;  2CNA A;  2D5H A;  3VD9 A;  4MG2 A;  1AXK A;  3AKQ A;  1EPW A;  4ARX A;  2VO5 A;  1T6B X;  2JG8 B;  1YQ6 A;  3NAP A;  3R4D B;  1IS4 A;  4YZ3 A;  5HXV A;  1HRI 2;  5IFP A;  1PK6 C;  1Q3E A;  1TZO A;  2RR1 1;  1W39 A;  1Y9Q A;  4GWJ A;  3WDV A;  4KBZ A;  1JUI A;  1L7R A;  5CA6 A;  2ORZ A;  4OUE A;  4CDQ C;  4XBQ A;  1DQ4 A;  1YJL A;  3PME A;  1WW5 A;  1W6Q A;  1ND2 B;  1PX3 A;  3DUI A;  3T08 A;  5IVB A;  1OPM A;  4JKL A;  1QNW A;  3NST A;  1Q5O A;  4M00 A;  4CDX A;  5FPA A;  4XIK A;  4DQA A;  4A7K A;  3DPR A;  3WW3 A;  1R09 2;  1W2T A;  2DFB A;  5CKN A;  5F7U A;  5CYY A;  3VD4 A;  4L11 A;  5EYX A;  4EJR A;  1LOE A;  3I2K A;  1D4V B;  4GA9 A;  3RZZ A;  5CAZ A;  3D82 A;  1QJZ A;  2BFU S;  3ES4 A;  1AYN 3;  5AC9 1;  1BBT 2;  5FYI A;  4CPB D;  3KV6 A;  1ZRE A;  1KXG A;  2I45 A;  1JYT A;  3VBF A;  4XUT A;  4Q4X 3;  4LO5 B;  1VP6 A;  3ASI A;  3N9M A;  4XC9 A;  3ZSK A;  2DTY A;  4CP1 A;  5DQ0 A;  4EN0 A;  1HN1 A;  2RJL A;  1ZBA 2;  2IVI B;  3WUC A;  5GLU A;  5KC5 A;  5FP7 A;  2WAA A;  2VR4 A;  3FMG A;  3B94 A;  4R9C A;  5FQ0 A;  3RJ2 X;  5D21 A;  1O6U A;  3AL5 A;  2VVD A;  1JZ7 A;  2VZP A;  3OTF A;  2G19 A;  5B2G B;  5C3O A;  1H8T C;  5J09 A;  3NKG A;  3O7O A;  3I3E A;  5FUN A;  2GH2 A;  4AVB A;  4PIX A;  2XKO A;  5I0D A;  2WDB A;  5L7O B;  3ZX7 A;  4EWE A;  4YSF A;  1LGC A;  2P3Y A;  4CP0 A;  5HBA A;  4LE4 A;  3SKV A;  4LTA A;  2RG4 A;  2A3W A;  2PFW A;  4XJ9 A;  4CCL A;  1EAH 3;  1R1Z A;  2ZAC A;  1ZRI A;  4MGK E;  1HN0 A;  2AEY A;  5DDJ 1;  2YBK A;  3T0B A;  5JZG C;  4AI8 A;  2W47 A;  5EP9 A;  4EE2 A;  3UGG A;  4UF0 A;  1WW4 A;  5E88 A;  1X8M A;  2VXJ A;  3OJB A;  5L36 A;  2E32 A;  2RMU 3;  1MZF A;  1BBT 1;  2JDP A;  3OGV A;  1HQW A;  1UQX A;  2C0Z A;  2FMY A;  1GWK A;  3AP9 A;  3ES1 A;  5GAL A;  3MUZ 1;  5F2S A;  1MS1 A;  1ZBA 1;  1XBF A;  2HLE A;  3LWC A;  4KWK A;  1XU2 A;  4LBQ A;  3S7I A;  4CDW A;  2DVF A;  2HWF 3;  3WNP A;  4TWT A;  5KHK A;  3AFG A;  2WFF 1;  4NHL A;  4JRL A;  4PIY A;  2TUN A;  3DGT A;  2ET1 A;  4AFM A;  5C33 A;  1JZ3 A;  3AK0 A;  4RGK A;  5T52 A;  1RUN A;  5FTT C;  4B4R A;  1QOO A;  1UD1 A;  2BP6 A;  4K8F A;  3VLB B;  1COV 3;  4PI0 A;  1CPM A;  4DIQ A;  1BEV 3;  3AZZ A;  2XJR A;  3ME2 A;  3K3N A;  5DZF A;  1DYO A;  5CG8 A;  1UPS A;  3HNB M;  4J6G A;  1IQA A;  3LF7 A;  2PTM A;  4Y26 A;  3TEY A;  3J7H A;  5C8C C;  5BPX A;  3OCP A;  3O12 A;  1V6M A;  1RUJ 1;  1YHF A;  2GC0 A;  5DAQ A;  4CUG A;  4YNI A;  2JE7 A;  3IDB B;  2Q1Z B;  4P5H A;  3SIT A;  3PVN A;  1DGL A;  3GBG A;  2XWJ B;  4RS5 C;  1OKO A;  2BWA A;  4MHU A;  1BYH A;  4A3X A;  2OYZ A;  1BVP 1;  4DXS A;  1F35 A;  3MBW A;  2AUY A;  2W08 A;  5E89 A;  3VDD B;  2EA7 A;  2LUW A;  1MEC 3;  2VMI A;  1S1A A;  2WSV A;  3NW4 A;  4QWN A;  3LKJ A;  4WM8 B;  3WW1 A;  4BDV B;  2RDR A;  4Y3O A;  1WMX A;  3BGA A;  1ULO A;  3NV3 A;  4KG0 A;  5F1R A;  2CWM A;  4JGZ C;  3ZDS A;  1VBA 2;  1Z7S 1;  4GKY A;  3NKT A;  2TBV A;  4IV1 A;  1LEN A;  4ORF A;  4TZD A;  4MET A;  2VZS A;  3POY A;  1G8W A;  2W68 A;  3ETP A;  1SAC A;  1NCQ A;  4E2G A;  1LOF A;  2JEM A;  2Y38 A;  1G9B A;  3LEK A;  1ZYB A;  5A7S A;  3I7D A;  3IBM A;  1C8M 2;  4IE7 A;  1XSQ A;  1PO1 1;  2WO3 A;  5KXB A;  4K8R B;  3VD3 A;  1W9W A;  3DV8 A;  1QH6 A;  2JDK A;  3WG3 A;  3V64 A;  5J96 B;  4Z82 A;  1O3R A;  4Y1Y A;  2G1M A;  2X5I B;  3EB7 A;  2JKX A;  1O5L A;  4ZON A;  4AQ6 A;  3KF3 A;  3U14 A;  3J7M A;  3UGF A;  4C1X A;  5DN2 A;  1PZ7 A;  2CDO A;  4XET A;  5LA9 A;  1W6N B;  3U4X A;  1JHN A;  5C8W A;  4AR2 A;  1RUF 2;  1WW7 A;  3OGJ A;  2ZX3 A;  3CMG A;  3LCP A;  4P00 B;  4RHV 3;  1S0J A;  1Q8O A;  1RUE 2;  2MEV 3;  2VQT A;  2P1B A;  3AKS A;  3IZO A;  3WLU A;  2YB7 A;  2V09 A;  2XVL A;  5ABJ B;  2RJK A;  1OLM E;  1UMI A;  2QFE A;  2B8M A;  4WVM B;  1KRI A;  3UKN A;  2DCZ A;  3J9S A;  4E2S A;  4HOO A;  3KHC A;  1VBA 1;  2L9L A;  1UXZ A;  1XNB A;  1NE4 A;  3OSD A;  4COZ A;  3OY8 A;  3E5U A;  3DN7 A;  5K0U A;  3KCX A;  4WZF A;  1IG3 A;  1FX5 A;  2O1Q A;  5BY5 A;  3RS6 A;  2PAM A;  3M7A A;  5A6Q A;  2WS9 2;  3WQB A;  1W8H A;  4RN5 A;  5GLW A;  4MXW B;  1C8M 1;  4BQ2 A;  3SLI A;  4R4Z A;  3D0S A;  2VNO A;  3VN4 A;  1G7Y A;  4YGD A;  2CGO A;  1IS5 A;  4QPG B;  2GNB A;  4QXC A;  4PBO A;  2OQ6 A;  5F6K A;  1H1A A;  2JDN A;  3VZL A;  3I2I A;  1F4H A;  2JIJ A;  4QQL A;  3K3O A;  3MV0 1;  1YJK A;  1D0G A;  5GM0 A;  4XHX A;  3USS A;  2HEV F;  4YVW A;  3WY6 A;  5L19 A;  4XUN A;  1SG3 A;  1AL2 3;  1WWY A;  4FPL A;  1SMV A;  4LBJ A;  5LA0 A;  4MUV A;  5IT6 A;  5IYY A;  2BU9 A;  2XQR A;  3MIH A;  3DYP A;  4Y1Z A;  4I0W B;  1RUF 1;  3PUI A;  4IEQ A;  2KD7 A;  1ONA A;  1KGY A;  2C26 A;  2J1A A;  1VRH 3;  2ZKL A;  2D93 A;  2GNT A;  3CZU A;  3GHN A;  5J3U A;  1RUE 1;  2OUJ A;  3OBT A;  1MZ5 A;  2A7A A;  2XL7 A;  4K7J A;  1X36 A;  3TEX A;  3O1O A;  4AFC A;  2VZR A;  1NCR A;  4RA0 A;  3MIG A;  4KH9 A;  2D3S A;  3ZSJ A;  4Q5O A;  3HVD A;  1G9F A;  1YIF A;  4QQP A;  3J7N A;  1VIW B;  4BIS A;  2WRA A;  4GKX A;  5FZM A;  2EIE A;  2XLF A;  3AZY A;  3ZVX A;  4FSJ A;  1TMF 2;  2DCK A;  1CJD A;  2ARA A;  4FI9 A;  2WNO A;  2WS9 1;  1VAV A;  1PK6 B;  4CA9 A;  1Q8S A;  4QHB A;  4ZZ8 A;  1LEC A;  1ACC A;  4KGG A;  3CNA A;  3PVO A;  4IES A;  4PJY A;  4CDQ B;  5FYT A;  4DY5 A;  4DNY A;  1JOB A;  3THT A;  1PNG A;  2ZAB A;  4F7Z A;  2BPA 2;  3AZV A;  5LK7 B;  1AR8 1;  1JOJ A;  4OHX A;  3MV1 1;  4OQ9 A;  3ROU A;  1V6J A;  2RS1 3;  1ODN A;  3C8X A;  1GUI A;  1SLA A;  1OOP A;  3FX3 A;  4O7X A;  3RDI A;  4CCN A;  4XTP A;  3VGI A;  3FLP A;  1EV1 2;  3J8F 1;  5F32 A;  3ALQ A;  5ANQ A;  1H0B A;  2WAO A;  1TVG A;  4Y24 A;  2BQP A;  5FWE A;  2ET7 A;  3VBU A;  2PA7 A;  1UYX A;  4RQP A;  4AVS A;  4JAA A;  4F83 A;  4UI9 L;  5FUI A;  4QKD A;  1DHK B;  2RS3 2;  3RZL A;  3L2H A;  4IUG A;  4A7Y A;  2GU9 A;  2I74 A;  1LU1 A;  4CCK A;  4NE9 A;  1W8O A;  2JEC A;  4XFC A;  1GZT A;  3HAG A;  4P9I A;  3BOD A;  1RTV A;  1W8N A;  4YM0 A;  4Q0Q A;  5FZC A;  1UIJ A;  1H8T B;  1STM A;  1PVX A;  3QH7 A;  2ZHN A;  5A3T A;  4P9L A;  1TMF 1;  5FLH A;  4ZY9 A;  1JYI A;  2XJT A;  2BZD A;  2P17 A;  3NNJ A;  2BGO A;  4AFD A;  4JKM A;  1O3T A;  3E5X A;  2PAE A;  1TQ5 A;  4I0B A;  3U37 A;  3I3Q A;  5I8S A;  3U78 A;  4BWO A;  2V5D A;  3U0Z A;  5HCH A;  4CCM A;  2E9Q A;  4JTN A;  1SFY A;  5FZ7 A;  3IKW A;  3ZFG A;  3EMR A;  2DU0 A;  4OQ8 A;  2QCS B;  2V5Y A;  4OYU A;  5CU1 A;  1PZ9 A;  3U11 A;  1V6L A;  2P3I A;  5FLJ A;  1RUH 3;  1GYK A;  3LE0 A;  1PGW 2;  2WYS A;  5EIY B;  1NUK A;  1DIW A;  1WLC A;  3VL8 A;  4URA A;  2OA2 A;  4Q1P A;  5T5J A;  3VDD A;  3B69 A;  1SLI A;  3IMN A;  2SLI A;  4NUB A;  4E2Q A;  1DQ5 A;  3LDB A;  1OBN A;  1TEI A;  1S0C A;  3LIH A;  4PDW A;  2CDP A;  4W8J A;  4C0B A;  5E6H A;  4YWA A;  5LBE A;  2HKX A;  1RUI 3;  5JR2 A;  5JOY A;  3T09 A;  4TN7 A;  2SBA A;  2LS6 A;  2JIG A;  4XMA A;  1ENS A;  1XOY A;  3CBN A;  3NAP C;  1OH3 A;  2FD8 A;  1S2K A;  4LBN A;  3WQ0 A;  4BZ4 A;  1H8V A;  1VBE 2;  1D4M 3;  3AMH A;  2HWD 2;  2W92 A;  1AJK A;  1CAV B;  2ZTN A;  3IIA A;  4JC1 A;  4XQD A;  3QAC A;  4EZ4 A;  3BOP A;  4AED B;  1W9F A;  3CZJ A;  3U75 A;  4CEW C;  5C8C B;  1GSL A;  1FV2 A;  4Q8K A;  3VDB A;  2GC2 A;  4CDX C;  2FDH A;  3DPR C;  1J58 A;  1YC6 1;  1VBC 3;  3M3I A;  4NO4 A;  5CFC A;  1TME 3;  1H2K A;  1ZM1 A;  4XFB A;  3WVJ A;  4Q26 A;  2JB4 A;  2Z79 A;  3R05 A;  4NMI A;  4RS5 B;  2RV9 A;  3BVC A;  3POJ A;  2R06 3;  5A1F A;  4XQW A;  2I2S A;  2XBO 2;  1PX4 A;  1GAN A;  3JBG 2;  4Q0U A;  4PQ9 A;  4Q4Y 2;  5A7N A;  4UOJ A;  4LJH A;  4GMP 0;  5LA2 A;  2YBS A;  1HXS 1;  4GH4 A;  2DUP A;  4M01 A;  4AVT A;  4E4S A;  5JZG A;  3AKR A;  1CAU A;  2E6V A;  2IZW A;  3GZU C;  3ZFF C;  2GAL A;  1KS4 A;  4AVC A;  2DTW A;  1YO8 A;  3S57 A;  1RIR A;  1HRV 3;  2JEN A;  4JGZ B;  3V65 A;  1POQ A;  2ARE A;  4EZH A;  3FHQ A;  1RHI 3;  4ZXK A;  5I0T A;  3NJY A;  2EVX A;  4L2N A;  2BJS A;  4QX3 A;  2WZR 3;  2XL9 A;  2ZKN A;  2LM3 A;  1W8U A;  4YW7 A;  2FQP A;  4HN1 A;  1VBE 1;  5A7W A;  4YZ1 A;  3ZYB A;  4YVS A;  2B7Y A;  2HWD 1;  1Q8P A;  2VMH A;  3VBR C;  3KCY A;  3UET A;  3U07 A;  3IPV A;  4LUK A;  5A3N A;  4XDO A;  5ACA 1;  3MDP A;  4LOT A;  4Y4R A;  2ZAA A;  2Q5T A;  4FPC A;  4HKL A;  3TN9 1;  4IET A;  3WD5 A;  3WF0 A;  3CLP A;  1QJX 1;  1GOG A;  1UXX X;  1W05 A;  3JZV A;  4MAD A;  1S2B A;  2W39 A;  1PO2 2;  3ZIW A;  2XUM A;  3B93 A;  4QX2 A;  1EY2 A;  3SEE A;  3P6B A;  1G86 A;  1KFX L;  3GXU A;  3KMH A;  1WW6 A;  1SLB A;  1VMJ A;  2MPF A;  2HWC 1;  5FO8 B;  4E27 A;  1UZZ A;  3RZG A;  1YQ5 A;  2XPJ A;  4QQ2 A;  1NOV A;  1UU4 A;  3JBG 1;  4Q4Y 1;  3KV9 A;  5IVJ A;  2RR1 3;  2ZGK A;  5AFB A;  5JSO A;  4CDU A;  5KXD A;  4CYD A;  4BQW A;  5JMC A;  3DCQ A;  4H14 A;  2DVB A;  1U5Z A;  2WO7 A;  4RGG A;  2O14 A;  3GF6 A;  5FO7 B;  1O4Z A;  4CDW C;  4LR4 A;  2FZ1 A;  5FY8 A;  3RYK A;  2ZGO A;  3T1L A;  5LAT A;  1GR3 A;  5FP3 A;  2JKB A;  3DKW A;  4YFZ A;  4LIU A;  3ZDV A;  3GJA A;  3KV5 A;  4C0H A;  1MQT A;  2XR4 A;  1GNZ A;  4YW5 A;  2OKX A;  5AC9 3;  3VBO A;  4IEY A;  1TNF A;  2EF6 A;  3WEZ A;  3MYX A;  2I07 B;  1FMD 1;  2F17 A;  3WNL A;  3GCX A;  2OQ7 A;  2WWJ A;  1V9U 2;  3M8L A;  4DY3 A;  3IAP A;  1RUC 1;  3ZYI B;  1IPJ A;  3J26 N;  5BNN A;  1DQ1 A;  2QJV A;  2P4E A;  1KQR A;  4HXC A;  4YW2 A;  4QB2 A;  5FXX A;  5D1I A;  5FZG A;  1PGL 2;  5IVY A;  3ZYJ B;  1ZA4 A;  2BBV A;  1XJA A;  4YM1 A;  3I4I A;  3WDY A;  3T4V A;  2X29 A;  1QQP 2;  1S0F A;  3W59 A;  4HPK B;  5LWB A;  4BB3 A;  3HD8 B;  1CON A;  1V00 A;  2GSY A;  3FBY A;  3THP A;  1BLZ A;  5FZ0 A;  3LDK A;  2WLP A;  5E1R A;  3ZXL A;  1SCR A;  1OFN A;  5FZF A;  3M3C A;  5IK5 A;  3X29 B;  1WA6 X;  1GQG A;  4Q29 A;  2LAL A;  1UO9 A;  5JLV A;  1R64 A;  2C1F A;  2QVS B;  1LKN A;  1IKQ A;  4IV1 C;  1ZRD A;  5C9A A;  5DDJ 3;  1S4C A;  2W94 A;  3ZKY A;  2WNU A;  4AVV A;  4LOS A;  1NCQ C;  1KJR A;  1LOF C;  4GJZ A;  4Y20 A;  5F5Q A;  5JR7 B;  2JXA A;  4FPO B;  4ITC A;  5FPX A;  2FBE A;  2R04 2;  3AMN A;  2ZXQ A;  5BXX A;  1ULF A;  1BBT 3;  2JWP A;  3BOW A;  3IB3 A;  4RL7 A;  3T3Y A;  4A6O A;  4B8E A;  4OVE A;  5KC6 A;  2NZ9 A;  4N9H A;  2WC2 A;  2ZHM A;  4NHM A;  4A41 A;  1L7Q A;  2VG9 A;  2Z2S B;  3DEM A;  4XUR A;  4LMF A;  4HK9 A;  1VB2 A;  3UKT A;  4COW A;  4XCA A;  1ZBA 3;  2ILM A;  1GOF A;  1V9U 1;  4D6R A;  1U5X A;  2GN7 A;  3MIB A;  1XU1 A;  1FXZ A;  1R08 2;  2JDA A;  2P2K A;  3EO6 A;  1BK1 A;  5A3U A;  1IS3 A;  1E5H A;  1V0A A;  2WFF 3;  4XF1 A;  1PGL 1;  1SCS A;  1HJF A;  2PHD A;  2XGX A;  1JYW A;  1NQD A;  2FZ2 A;  2A6Z A;  1A8M A;  4UAP A;  3ACI A;  2DVA A;  3IDC B;  4FFI A;  4MGI E;  3ZYH A;  2ZHL A;  2H0B A;  5SV5 A;  3RWK X;  4QPW A;  4YFW A;  1UY3 A;  4LBK A;  4AF9 A;  1KS5 A;  2DF7 A;  3UK9 A;  3ZPY A;  1RUJ 3;  2D5F A;  5FP8 A;  1VBD 2;  1RJ8 A;  5FCC A;  1MR5 A;  1OQE A;  1R1A 1;  1RXF A;  1UU6 A;  2WZE A;  3IDE A;  3KQ4 B;  3OBR A;  3PJY A;  3V0A B;  5K0U C;  4BXF A;  3ZN6 B;  1AJO A;  5EJ3 A;  1JS9 A;  2YC4 A;  1SLC A;  2QZ2 A;  5JOZ A;  3D8C A;  3P1I A;  1OA2 A;  3FN9 A;  1DZT A;  5C3R A;  2XH6 A;  2R04 1;  3QCW A;  4FO9 A;  3WDU A;  3RWN A;  1JUH A;  1B35 A;  2UY8 A;  2OII A;  4FFG A;  1AR7 1;  5E8A A;  4DFS A;  4J1X A;  4A45 A;  4LK6 A;  5FRE A;  1Q43 A;  3WDW A;  2E33 A;  1Z7S 3;  1PVC 2;  3KV4 A;  1ND3 A;  4UXA A;  3I2G A;  4FPG A;  4UFM A;  1QJU 2;  1O5U A;  1W6P B;  4ZS3 A;  4YVW C;  2O8Q A;  4LIV A;  1C1L A;  4YG6 A;  4HKO A;  2Q1F A;  3WX5 A;  4M3C F;  1NA1 A;  2NMN A;  3ELN A;  1CES A;  4AWD A;  3TNQ A;  2ATF A;  4OI0 A;  1OSG A;  3BYW A;  1PO1 3;  1AF9 A;  4JV4 A;  4NID A;  1OVS A;  2QQU A;  2CSG A;  4BQ3 A;  2D6M A;  4B7E A;  4BJ0 A;  4Y5Z 0;  1H9W A;  1NCR C;  4OUL A;  4XF4 A;  2K9Z A;  5FK8 A;  3ZXA C;  4Q4V 3;  1OUX A;  1VBD 1;  5GZF A;  1QDC A;  1W2O A;  3MFC A;  4MVT A;  1FPN 1;  2LRO A;  5CFD A;  4BOW A;  4AVA A;  1NG0 A;  4BA6 A;  3NAP B;  3CHX A;  3N9L A;  1ULG A;  4Q0V A;  4ZXE A;  1JMU B;  4QQO A;  4YGB A;  1QXR A;  4N9I A;  1DBN A;  1X9P A;  2N7G A;  1K3I A;  5F5A A;  4ZU7 A;  2WNV A;  1CN1 A;  1ASJ 3;  3B9I A;  4DXT A;  4M3C A;  1W6Q B;  5FYC A;  4IE6 A;  5SV8 A;  4WVW A;  4DUW A;  1RVF 1;  3ILF A;  4DUX A;  2WT2 A;  2Y26 A;  1RXG A;  1PVC 1;  1VBA 3;  4PT6 A;  4CDX B;  4JKK A;  4ASL A;  2WWU A;  3DPR B;  3E6D A;  3IAQ A;  2WO1 A;  4ZHN A;  1WCS A;  3MF9 A;  3NO8 A;  2ZEY A;  1JYX A;  1CWP A;  1OOP C;  4NVP A;  2B42 B;  5BV6 A;  3OOX A;  4XCB A;  1DGW A;  1PMH X;  3SH4 A;  1QOS A;  1W9T A;  3RI8 A;  4HSJ A;  2O0O A;  3KT4 A;  3VBF B;  1C8M 3;  3JD7 1;  3VBU C;  4AYU A;  5FZ9 A;  2D6L X;  4RQP C;  2BGC A;  1RUD 3;  5FYY A;  2RDN A;  2IXC A;  1EYB A;  4HET A;  2WT1 A;  1ZBE 2;  2DVD A;  1W0O A;  2WQ4 A;  3PJQ A;  3FHI B;  4QB1 A;  5FQ0 B;  1LEM A;  2VCC A;  3A4U A;  3VD5 A;  1S2E A;  2VGD A;  3HT1 A;  5C3P A;  2NLR A;  3ENR A;  3BTY A;  1MS4 A;  2E7T A;  4LT5 A;  2ZOE B;  2KM2 A;  4KWL A;  5A7O A;  4V1P A;  5JSR A;  3T0A A;  4PBP A;  2QQN A;  4DS0 A;  1K45 A;  1LHO A;  1PGS A;  3BPS A;  3IM0 A;  1FAY A;  3NJZ A;  2GP5 A;  3AJY A;  4JQR A;  5EHD A;  4P02 B;  1BVV A;  2VUA A;  2VU9 A;  4IW3 A;  2J1E A;  1MZE A;  1TG7 A;  3UKV A;  3TNP B;  4QHO A;  2EAK A;  5HV0 A;  2OVU A;  4Q4W 2;  1FNZ A;  3ZFG C;  2GH8 A;  4BXS V;  3B5L B;  2D43 A;  4CEW A;  1QDO A;  5LY2 A;  4W65 A;  4HFS A;  1JU3 A;  3RI9 A;  3D5O A;  1NLR A;  2VM9 A;  3PDQ A;  4UF0 B;  1OA3 A;  2XLA A;  3OD4 A;  4YZ5 A;  3VKN A;  5KHH A;  1NT0 A;  3ZPO A;  2WS9 3;  1DGR N;  2P6C A;  1FYU A;  5EYY A;  5J37 A;  2XKP A;  1C57 A;  3HNM A;  3WG1 A;  2ZX1 A;  3KT1 A;  3O0W A;  3PTY A;  4IGO A;  4LKD A;  4W6X A;  3WG2 A;  1GLH A;  5FPB A;  4PDW C;  3ZYG A;  2IC1 A;  3I2O A;  1N1T A;  4SBV A;  2FDK A;  4LO8 A;  4LBQ B;  3A22 A;  4OUM A;  1QJY 2;  4CDW B;  1GBG A;  1S0B A;  4XFH A;  2VMF A;  5CB7 A;  3ZFF A;  1AR8 3;  3HN3 A;  3SMH A;  3SXW A;  1ENX A;  3VB9 A;  4AE2 A;  4EV0 A;  5FXZ A;  2FDG A;  4AK3 A;  5JXH A;  3WNX A;  3ETQ A;  4CUB A;  2VZT A;  4CE8 A;  1LOG A;  3SCH A;  3J8F 3;  2W1U A;  3I3B A;  3K46 A;  4OHW A;  3H8X A;  2W1Q A;  3R6S A;  2FHR A;  2ZML A;  5G05 L;  4OHZ A;  3I2J A;  5K8S A;  2WO2 A;  3D4K A;  2OS2 A;  1YUD A;  5CAD A;  4AOC A;  4XXA A;  1BJQ A;  1HRI 1;  1D2S A;  4N7I A;  1CIW A;  3VBR A;  3O1M A;  1ZZB A;  1CIY A;  1QJE A;  5A6Y A;  5CFC C;  4NHX A;  3ZKU A;  4NRQ A;  2W52 A;  4LIT A;  4Q4W 1;  2JE8 A;  5JPN B;  2JDM A;  2H6B A;  2HBU A;  3AZW A;  4KNC A;  4QDR A;  1IGO A;  5GZD A;  4BLJ A;  5A32 A;  1JI6 A;  2XQX A;  3KGZ A;  4FQZ A;  4BQ5 A;  2ZGS A;  4HKW A;  1UF2 C;  1EUU A;  1ZZ9 A;  2VOX A;  3UT0 A;  3AM2 A;  4QPI A;  3BIW E;  4GH4 C;  4EN8 B;  1R09 1;  1W9S A;  4BU2 A;  4BQ4 A;  4H55 A;  2VUJ A;  1QHD A;  3KD4 A;  2WZP P;  2ZGR A;  4E4Z A;  1WCK A;  3BKZ A;  4FTE A;  2VAU A;  1OF4 A;  1UOG A;  3OUI A;  4CCE A;  5LCW L;  4IV1 B;  4XZP A;  4JX0 A;  4ET7 A;  4P9J A;  1QJY 1;  3PVB B;  4MGS A;  4EWD A;  2DV9 A;  5JSP A;  2FCT A;  3UJO A;  1QGL A;  1UOB A;  4NWV A;  2Y6J A;  1NCQ B;  1M06 G;  1H1M A;  3FE5 A;  4RFT 0;  1LOC A;  3RVH A;  1OD3 A;  4YVS C;  1UKR A;  3R4U A;  1MPX A;  4UWD A;  3FLT A;  5JXG A;  4YW6 A;  5DAP A;  3AKT A;  3TAY A;  2GN3 A;  2JB8 A;  2QQJ A;  4ONU A;  5FLI A;  4IQP A;  1WD3 A;  2EIG A;  4D8M A;  5TSW A;  3HN1 A;  3I49 A;  4MLO A;  5DAV A;  3I59 A;  1W06 A;  1VBB 2;  1KEX A;  1NX9 A;  2XJP A;  3U4S A;  1W8T A;  2YG0 A;  5FWJ A;  3N4M A;  4AQ2 A;  2PLV 2;  5FKC A;  5BNN B;  2VD7 A;  2DUR A;  4XAE A;  2R7E B;  4IEW A;  3ST7 A;  4COV A;  5IK7 A;  4CDU C;  2J1U A;  4PHZ A;  1POV 0;  3ZN4 A;  4QXK A;  1SBD A;  4NHK A;  3O1S A;  2Z5W A;  2HWB 3;  4B29 A;  1F5J A;  2ZZQ A;  1D7P M;  1I5P A;  2YPJ A;  3Q8A A;  3O1R A;  1W03 A;  2BVB A;  3S5A A;  4AHW A;  3AP5 A;  5LW9 A;  2CHH A;  3ZR6 A;  3UES A;  4Q0S A;  1WD4 A;  3E97 A;  4XF0 A;  4Y22 A;  1VAM A;  3OY8 B;  2P3K A;  2Q8O A;  2XG3 A;  5K0U B;  2QZ3 A;  4PF1 A;  3MZH A;  1JTZ X;  1MQT C;  2HYX A;  2CAV A;  3VBO C;  3M2M A;  3UGH A;  1SBE A;  2VQ0 A;  4FXK B;  2GAU A;  2HBT A;  1KDK A;  4ERO A;  1HXS 3;  4EWA A;  2CYF A;  5GLZ A;  1BZW A;  2GDF A;  3NJX A;  3T2O A;  4XUP A;  5GZG A;  2ZX0 A;  4H7M A;  5C4W A;  4FTS A;  4MHR A;  3ZN5 A;  4BQX A;  1UCX A;  2WN2 A;  4W6W A;  5A33 A;  4ARY A;  5BNN C;  4O61 A;  3VD7 A;  2RS5 3;  4K3U A;  1DZR A;  1OLR A;  2Y6G A;  4YVW B;  1W90 A;  4QM9 A;  3ILR A;  1VBB 1;  2XLG A;  3SNM A;  1JYC A;  4WVV A;  3T2Q A;  3ZSL A;  5F3C A;  3POE A;  1Y3T A;  2A71 A;  1LED A;  2PLV 1;  3UL2 A;  2R07 2;  3ZXF A;  1CZS A;  3ACH A;  1BQP A;  1UN1 A;  1VBE 3;  4XOG A;  2HWD 3;  3LIG A;  2BTV C;  2YBP A;  3O5S A;  5ERL A;  2CGN A;  3OPZ A;  2OW4 A;  2A6W A;  1W3X A;  3F95 A;  3PIG A;  5FZO A;  3SH3 A;  2WAB A;  5ACA 3;  3FHA A;  5LB6 A;  4OHY A;  1UMZ A;  2VEC A;  2ID4 A;  4Y33 A;  3TN9 3;  3PUA A;  1DYP A;  1YQC A;  1QJX 3;  4IGP A;  1OPO A;  2WNE A;  3LPG A;  3RPQ A;  1NCR B;  5C9A C;  5IAT A;  2A70 A;  4G4F A;  2WNU C;  4GQ7 A;  4Y5T A;  5BNO A;  4NIH A;  5FZD A;  3CDZ B;  4OMD A;  4QT6 A;  5DAB A;  1XNA A;  2HWC 3;  5FRA A;  4FT8 A;  4BMB A;  2V4V A;  3WCR A;  4ZU5 A;  3UV9 A;  1YFU A;  4MXV A;  2VQA A;  2VW1 A;  1CPN A;  5CKM A;  5JIA A;  3ZYR A;  4C8D A;  2ERF A;  3O1V A;  4XW3 A;  3PHM A;  4DPN A;  3POF A;  4NR1 A;  5LBC A;  4E4D X;  1DDL A;  2VC9 A;  5JMO A;  2XDV A;  2XWB B;  1IZ3 A;  2JX9 A;  1ENQ A;  2WT0 A;  4JHT A;  3HQU A;  3AVR A;  2BWC A;  4TSV A;  4DUV A;  3MIE A;  1OOP B;  4GXL A;  2JJ6 A;  3FUO A;  4NOT A;  4BH9 A;  1KJL A;  4CU9 A;  1OQ1 A;  1NY7 2;  3ABZ A;  4BCU A;  2R07 1;  2QNK A;  2W1W A;  5FZA A;  3AZX A;  2Q8C A;  3T1M A;  2DYC A;  1FMD 3;  2J1T A;  3VBU B;  2AEZ A;  2GND A;  1IHM A;  1OT5 A;  4RQP B;  4CRQ A;  3ZFE C;  2Y34 A;  2DCY A;  1CGP A;  2PHF A;  3AYA A;  4XFG A;  2VCA A;  4D69 A;  1RUC 3;  1AYN 2;  2GMM A;  3ATG A;  3JB4 C;  4DEV A;  1S0I A;  2ZPX A;  4WVZ A;  3VDA A;  3WW4 A;  2UWC A;  3AMM A;  4Q4X 2;  4PI2 A;  5F3I A;  2GC1 A;  3AP7 A;  4GUL A;  4QX7 A;  1T6G C;  1IPK A;  1PMI A;  1QU0 A;  1XYN A;  2BER A;  3AFK A;  4XPV A;  1ULC A;  3C2U A;  3ZM8 A;  1QJF A;  2A1X A;  4MH0 E;  3K4Z A;  1LHN A;  4AFB A;  5KHG A;  1WLT A;  4OUS A;  4FCA A;  1B35 C;  3KT7 A;  4B1L A;  4BYY A;  1WZX A;  2VZV A;  5FYM A;  3OPT A;  4LHS A;  3LD8 A;  1X7N A;  2GP3 A;  5LEK A;  1ND3 C;  1H4G A;  1VRB A;  4HL0 A;  4NJ4 A;  1JBC A;  3ZFG B;  1H4H A;  2W1S A;  4CXX A;  1NA1 C;  3CO2 A;  4Z2W A;  1Q8V A;  1JW6 A;  4A6S A;  3H3L A;  4Z1V A;  2XJQ A;  1LTE A;  1AR6 2;  4YZ4 A;  1ULD A;  2RDQ A;  4S2D A;  3CJX A;  1RUG 2;  1EAH 2;  1RGS A;  4K1Y A;  1W99 A;  3ZR5 A;  1DZQ A;  1QXJ A;  2YUE A;  1N1Y A;  3SIS A;  3V0B A;  1PNF A;  2V73 A;  4AAX A;  1HJG A;  3A7Q A;  2C4X A;  2RJ2 A;  4LLO A;  4PDW B;  1AYM 3;  1V9U 3;  3KVA A;  4DO0 A;  2RMU 2;  4I3P A;  1YQ2 A;  3AC0 A;  5CFD C;  2XUE A;  1G9C A;  2VMC A;  4S2G A;  4CCD A;  4Q4X 1;  1YNA A;  3HOB A;  5JPM B;  4L97 A;  1J3R A;  3WW2 A;  4AQS A;  2BBA A;  2Y6F A;  5K4L A;  5FPV A;  1K5M A;  1QOT A;  2RDS A;  4QU2 A;  1UAI A;  5GLV A;  1XNC A;  1S0D A;  3PLQ A;  1Y9M A;  4JZR A;  2WNV C;  1GQH A;  4Q1R A;  5C3S A;  2HWF 2;  1H6Y A;  5F5I A;  4XIL A;  1JYN A;  3MF6 A;  2VNV A;  1OMI A;  2VNR A;  4N53 C;  4F8A A;  5BNP A;  2PHW A;  5APA A;  1QH7 A;  3FZ3 A;  3HMY A;  4XDP A;  1GKB A;  1R1A 3;  4CP9 A;  3W5M A;  2AEN A;  5CFC B;  5L9V A;  1COV 2;  2F4L A;  3RRD A;  1OHF A;  4DIN B;  2ZHK A;  3H1Y A;  1PM4 A;  3BTA A;  4HVO A;  1RED A;  3NMB A;  4P9G A;  1UU5 A;  5FKB A;  1CAX A;  1URX A;  2R16 A;  1AR6 1;  5LA1 A;  4WV8 A;  3DF0 A;  3HIF A;  4GB3 2;  4GH4 B;  4CUA A;  1RUG 1;  1EAH 1;  3OYW A;  2QBX A;  3Q8C A;  4KWU A;  1CAU B;  5JZG B;  1AR7 3;  4P14 A;  1AX2 A;  3N9N A;  3EHK A;  1FI2 A;  3BU7 A;  4MYE A;  2VME A;  1EV1 1;  2Y64 A;  3G6J B;  4N7U A;  1H30 A;  3T30 A;  5FDB A;  2OZJ A;  1RYY A;  4JGY A;  5EFU A;  1O3Q A;  3AX4 A;  5FY9 A;  5JOW A;  1MEC 2;  3W58 A;  1X8E A;  5T55 A;  3ZLI A;  4OCT A;  1A78 A;  2R0H A;  4QKF A;  2RS3 1;  4XVH A;  1Y4W A;  3WNK A;  3NQH A;  1YIP A;  5A7W B;  4DXR A;  1BXH A;  3H7Y A;  4YVS B;  1LAJ A;  3APB A;  4QD2 A;  3IPV B;  2R6Q A;  2Y0O A;  3WP6 A;  1MS0 A;  4HZF A;  4QMA A;  3NNL A;  2CY6 A;  2Y60 A;  3CF6 E;  3MI8 A;  1VBD 3;  4ZZ5 A;  4LO7 A;  5DZE A;  3S6P A;  5M0T A;  1FPN 3;  5H9S A;  4Q2F A;  4CZS A;  1DQ2 A;  3KM5 A;  1O4Y A;  4HBN A;  1SFP A;  1YI7 A;  4CP2 A;  3TEZ A;  5FOJ B;  1LOD A;  3OB8 A;  3BTZ A;  1SDD B;  4CDU B;  4UW5 A;  1RUO A;  2B9U A;  2XB6 C;  1I3H A;  4GB3 1;  3DXT A;  1GWM A;  1F2N A;  5HPO A;  4LK7 A;  3GZT B;  4OHV A;  4XJW A;  1V6I A;  1RVF 3;  5T3N A;  5C5U A;  1PGW 1;  3AYC A;  3FFQ A;  2ZX2 A;  1W9Y A;  2D44 A;  1PMJ X;  4EN6 B;  4IND A;  4D94 A;  1NKG A;  4Z07 A;  1SBF A;  2AYH A;  2QQK A;  4YRD A;  4DZG A;  4DOU A;  4NPR A;  2MEV 2;  4IGQ A;  2ENR A;  1KD7 A;  2BNN A;  4M0H A;  1MQT B;  4QKB A;  5F39 A;  4LUL A;  4CEY A;  3VBO B;  1WMF A;  2K46 A;  2AZ5 A;  3JD7 3;  4RR3 A;  2XHN A;  2MHF A;  4P9W A;  4XJZ A;  1FOD 3;  1KFU L;  2IXK A;  5IAX A;  1YWK A;  2YC2 A;  2D7F A;  3A0N A;  3WHU A;  1J1T A;  3KHB A;  4XFI A;  2A6X A;  2WA4 A;  2ZZJ A;  1N1V A;  2EAA A;  2G9G A;  4RD7 A;  3UYJ A;  4IEP A;  5T5L A;  3W9A A;  3ZSM A;  4BLI A;  1J83 A;  4XIO A;  1QIQ A;  2WR9 A;  4A7Z A;  2D6K A;  4P5Y A;  1W04 A;  3LEI A;  4XJU A;  5F8P A;  4QPI C;  2P3J A;  1VAL A;  2AH2 A;  2C9A A;  4N43 C;  1H2M A;  2YGL A;  4IE4 A;  4K6B A;  2BRT A;  1NXM A;  2KA3 A;  3TOJ A;  1DFQ A;  1ZVF A;  4FP3 A;  1TNR A;  1AL2 2;  1UZ0 A;  2XBO 1;  2JG8 C;  4CCO A;  3GYD A;  4PIZ A;  3RJR A;  5C9A B;  1U5I A;  2QKD A;  2ARB A;  1WLD A;  3MO4 A;  2CGP A;  2WNU B;  3AP6 A;  4L92 A;  1VPH A;  1CAV A;  4Y20 B;  2ARX A;  2A6Y A;  3K4D A;  5FFO C;  4ISR A;  4U36 A;  2W95 A;  1SPP A;  5FBJ A;  1POV 1;  3P5B A;  1H9P A;  3WZ1 A;  4CXW A;  5HV4 A;  4DB5 A;  2D3R A;  2EXI A;  3ZIX A;  5A6Z A;  4MZU A;  3POW A;  3PTR B;  5B4X A;  2TNF A;  2ZA9 A;  1E5S A;  2QQM A;  3KSC A;  1A34 A;  3JU9 A;  1CAW A;  4N90 A;  2XJU A;  2VTX J;  5FZB A;  2KXL A;  1L7L A;  2QQP A;  2ADD A;  3FL7 A;  2WIN B;  5FZ4 A;  2A73 B;  4C90 A;  1PO2 1;  5DUX A;  3WG4 A;  5IHR A;  2G9F A;  4PF5 A;  4UT5 A;  1REF A;  2VJX A;  2R0F A;  5I8Y A;  3SCF A;  3LEG A;  5L9B A;  3WCS A;  1LJ7 A;  5LZ6 A;  4UFH A;  2R30 A;  1HRI 3;  2P6H A;  2RS1 2;  3KB5 A;  1AL2 1;  3KGL A;  2RM2 2;  3ZMN A;  3ZOI A;  4AZZ A;  4GIQ A;  1DGR A;  3K77 A;  4Q4W 3;  3I3D A;  2DDU A;  5IVF A;  3KF5 A;  5FMC A;  5F3G A;  3KVB A;  1C5I A;  5L7O C;  3RG0 A;  2G9Z A;  3LFM A;  4HG6 B;  2BDR A;  2JDZ A;  2VCB A;  4XBL A;  1R09 3;  1OH4 A;  1YEW A;  4XUO A;  4B7K A;  3HJR A;  2BUK A;  3HBK A;  4W50 A;  4ASM B;  1B35 B;  1MVQ A;  4XF3 A;  2JG9 A;  4LO6 B;  4MGY E;  3O0X A;  5C4W C;  1CVN A;  2D97 A;  2P37 A;  3CEW A;  4FFF A;  2GC3 A;  1ND3 B;  1VMF A;  4GAZ A;  1MS5 A;  4WZC A;  4C1W A;  1W8W A;  2W46 A;  3WQ1 A;  1QJY 3;  1XE0 A;  1V6N A;  2X10 A;  5FPU A;  1RB8 G;  4UW3 A;  1VLN A;  4DRR A;  1NA1 B;  2VUD A;  3IN9 A;  4LA2 A;  2E51 A;  1QWR A;  3N3H A;  2NP0 A;  5IVV A;  1O4T A;  4TLG A;  4F3J A;  2Q0A A;  2V72 A;  4YW3 A;  4QDS A;  1XQN A;  4QKN A;  5LK5 A;  5C5T A;  2Q8D A;  2VOV A;  1ZNP A;  1Y7B A;  4D6Q A;  2KR2 A;  4AHY A;  4W4Z A;  4IV3 A;  1QQP 1;  1XC6 A;  3MLJ A;  3WDX A;  1NYW A;  1XE7 A;  4QDQ A;  1RUH 2;  5BNO C;  1GOH A;  1UPI A;  3GZA A;  3H50 A;  4YAR A;  2RM2 1;  4Y1V A;  4ZPI A;  4EN9 B;  3LA3 A;  5EJ1 B;  2W5F A;  1N3Q A;  3PNA A;  3ZFE A;  5CFD B;  3HR9 A;  1A8D A;  1YLL A;  3ACG A;  4IDZ A;  5FV3 A;  2P34 A;  3LFI A;  5D2A A;  4A44 A;  1X50 A;  3RZJ A;  4XF9 A;  1TE1 B;  4X8N A;  2OUH A;  4Z8B A;  1WMD A;  2CU5 A;  1RUI 2;  1LOB A;  1F4A A;  4RFR B;  2WNV B;  2PHR A;  2WFP A;  5FY1 A;  4S2F A;  3NWK A;  3K4A A;  3LB9 A;  4I3G A;  4FPY A;  3WR0 A;  5HXM A;  5HCB A;  1D4M 2;  2O8O A;  2VZ3 A;  3C7H A;  4ZS2 A;  4ZKT B;  3PUH A;  5I8T A;  3K51 A;  1HB1 A;  3KWV A;  5A3L A;  2QDN A;  3ZMO A;  3TEW A;  4AGG A;  2PEL A;  4LLF A;  2G4I A;  4IE5 A;  3RZH A;  2VCM A;  4DEQ A;  1R08 1;  5DZG A;  5FY4 A;  1QXP A;  4Y5S A;  1QKQ A;  4QX5 A;  2ZCW A;  4ZU4 A;  3ORJ A;  3ZXG A;  1UY0 A;  1TME 2;  4KL1 A;  2FMD A;  3OGR A;  2HWE 2;  5DG2 A;  5FZ3 A;  3TWI A;  1OLQ A;  2Y8K A;  4CU6 A;  4LQR A;  2R06 2;  3JB8 A;  1GNH A;  1J3Q A;  3AVS A;  5JUV A;  4FAG A;  3POI A;  1RUH 1;  5JI7 A;  3S30 A;  5D8A A;  4CPB A;  1VBB 3;  5FYS A;  5GZC A;  3ACF A;  3M4F A;  4I09 A;  3JXS A;  5JDB A;  4AI3 A;  1JZ2 A;  1GMM A;  1HRV 2;  1UX6 A;  3BI3 A;  1N47 A;  3B9C A;  4OI2 A;  4FOV A;  4YGE A;  2X5I C;  2A5Z A;  3HWJ A;  5FJK A;  3I2F A;  1RHI 2;  4WM7 A;  2UWB A;  4PQQ A;  1VJ2 A;  4CSW A;  1NZC A;  5EZW A;  4BIO A;  1F9K A;  3AKP A;  2GNM A;  2ZGQ A;  4XFF A;  1W0N A;  4KI5 M;  5FXW A;  3WSO A;  1YI9 A;  1Y43 B;  2BNM A;  3HT2 A;  5EPA A;  3RMX A;  3WDT A;  1D4M 1;  2VE1 A;  3CL1 A;  2B39 A;  3POS A;  4OLL A;  3VKO A;  4AL9 A;  2IVJ A;  4CEW B;  3AYE A;  3RYP A;  5FUP A;  4N53 A;  4HK8 A;  4HMZ A;  2ZX4 A;  4ES8 A;  2RE9 A;  3LOB A;  1QJU 1;  1RMU 2;  5IVE A;  3H1M A;  3NVC A;  3OG2 A;  5F6L B;  2VMD A;  3VBH A;  4FOY A;  2ZGM A;  4AQT A;  3H8R A;  2QQL A;  4NAO A;  3C7E A;  4LO4 B;  3WP3 A;  3W21 A;  2HWE 1;  3USU A;  4GJY A;  1GZC A;  4O9E A;  3LGR A;  5G04 L;  2D6N A;  2VY0 A;  2XVG A;  3ZFF B;  2RR1 2;  2YZ4 A;  5BYN A;  4I01 A;  4NPM A;  3MIF A;  3O1P A;  3OBZ A;  3N9O A;  1I6X A;  1K5M C;  4BQ1 A;  1UYY A;  4QM8 A;  1XE8 A;  1F15 A;  2J42 A;  3NL1 A;  1HRV 1;  1I1E A;  1OXC A;  5C71 A;  1JZ4 A;  4HSL A;  3A23 A;  2YU1 A;  3N7L A;  5IJR A;  1QMJ A;  5L9R A;  1RHI 1;  1RUF 3;  4Q0P A;  5BNP C;  3MID A;  2IXL A;  5F2W A;  3MLL A;  1OQD A;  3VBR B;  3WOG A;  4HLT A;  4COU A;  2X09 A;  1RUE 3;  5A3W A;  2YU2 A;  5GKA C;  3J4U H;  4AG4 A;  1H2L A;  1S0G A;  3S5Q A;  5A32 B;  3IWZ A;  4XFA A;  4R4X A;  1RL3 A;  4E8D A;  5LEJ A;  3JUU A;  3N7M A;  4YLZ A;  2QE3 A;  5J7M A;  4QPI B;  3VV1 A;  5FAX A;  1LUL A;  4CXY A;  5DUU A;  3IT8 A;  4M3C E;  1RMU 1;  4FPE A;  1DLC A;  3HEI A;  3RZM A;  4G9S B;  2WBK A;  5DUW A;  1JZ6 A;  1PIV 2;  5LAS A;  4EN7 B;  3RYR A;  1HV1 A;  3MIC A;  4JGY C;  4PLO A;  1ZZ6 A;  1CX1 A;  3CJI A;  4R52 A;  1LGN A;  5DXD A;  1W6M A;  1W8Z A;  4X8P A;  1YFY A;  2IFW A;  2LTN A;  2D3P A;  3N36 A;  2R1D A;  4U2A A;  4H2A A;  3BTX A;  3G7D A;  4YG0 A;  2UYB A;  3FUQ A;  2ZMN A;  4QX1 A;  1REE A;  3W5N A;  1ZBE 1;  3LQC A;  5F3E A;  1J59 A;  1A3K A;  3C7O A;  4HVQ A;  4ASK A;  1GZW A;  5B4N A;  2C24 A;  1GP4 A;  4GMP 1;  5DDJ 2;  5FMO L;  4MGQ A;  1UZY A;  2VQU A;  5FMB A;  4ES9 A;  2P5B A;  2XJV A;  3C3V A;  5IK8 A;  3AXD A;  2EAL A;  2UU8 A;  1WUV A;  2QQO A;  3N7K A;  4Z92 B;  3I59 B;  1K5J A;  3FC0 A;  3HNY M;  2Y6K A;  2OPK A;  3OEA A;  3RSJ A;  3VZO A;  2V4A A;  3DEC A;  4RGA A;  1ALY A;  4UFJ A;  1D0H A;  1V6O A;  2PHU A;  2ZGN A;  1G6N A;  2BW8 A;  4LHN A;  5CVR A;  1E5I A;  1V70 A;  3V56 A;  5I0S A;  3MEP A;  5A7Q A;  2CV6 A;  1OA4 A;  3O1U A;  5CIR A;  3VBS A;  3OEB A;  1SHW B;  3AP4 A;  1W6O A;  3M70 A;  4UYB A;  4FP2 A;  5K9Y A;  1ST8 A;  1VAK A;  2PQQ A;  1TMF 3;  3Q8F A;  2WFF 2;  1AUY A;  2Q1M A;  1PIV 1;  4FXG B;  3BIE A;  3AJZ A;  4YW1 A;  2XHK A;  4MX3 A;  2GMP A;  4AEJ A;  4N43 A;  1I5Z A;  2YHJ A;  1MAC A;  4PLM A;  3POG A;  4R9A A;  4QQH A;  1US3 A;  1DF0 A;  3H1W A;  4FPJ A;  1GP6 A;  1LHW A;  4Y22 B;  1E5R A;  1WKY A;  2VVF A;  3B01 A;  3NNF A;  2JG8 A;  4NPL A;  2K0G A;  5J98 B;  2VZQ A;  1UOJ A;  4XAA A;  4CEY C;  1XXN A;  4MOA A;  2UY9 A;  3TYJ A;  1RUJ 2;  1AR6 3;  5JIU A;  3TB0 A;  4RR3 C;  4TXW A;  1RUG 3;  5IK4 A;  2ZBJ A;  3PVE A;  1CJP A;  1HKD A;  4IEX A;  2Q8E A;  1ND2 A;  5C4W B;  1EV1 3;  3B00 A;  2VH9 A;  3P3P A;  4DRV A;  4AI9 A;  5A33 B;  1N1S A;  3URF A;  1VR3 A;  4PCR A;  1UY4 A;  1WBL A;  2AGS A;  4OFG A;  1X82 A;  1S55 A;  4MO3 M;  3THC A;  1AX0 A;  1XSR A;  1SQ4 A;  2RS3 3;  3CIH A;  2YC0 A;  2DVG A;  5LBF A;  1UY1 A;  3WV6 A;  4AHX A;  2VOW A;  5FYZ A;  1Z7S 2;  2HEW F;  5C6C A;  1ODM A;  4JTO A;  5CEH A;  4FVV A;  3QLQ A;  5FOB B;  3RFR A;  2WQZ C;  5FZO B;  3U10 A;  5J36 A;  2X53 S;  1V6K A;  1PZ8 A;  2WJS A;  4NHY A;  5FBZ A;  3NV1 A;  4CVU A;  3FFZ A;  1UL9 A;  3DXU A;  1FNY A;  3SC7 X;  5BNO B;  4M4P A;  4IEV A;  1KDM A;  1PO1 2;  1US2 A;  2JE9 A;  2ZEZ A;  1LU2 A;  5I0U A;  3B3Q E;  3ZSE A;  4AED C;  3NV2 A;  1WCD J;  5T50 A;  3GBW A;  1VE0 A;  4QB6 A;  4IEZ A;  2ES3 A;  3ACL A;  3LA7 A;  4YM3 A;  1AX1 A;  3WIN E;  1BK0 A;  3THD A;  1ZA7 A;  4Q4V 2;  5FIX A;  4YGC A;  1UIK A;  1EUT A;  4GB3 3;  5L7O A;  1XNK A;  2JD4 A;  3BPZ A;  3E6C C;  1OUR A;  4J25 A;  4J1W A;  1DP0 A;  4V2W A;  5A7P A;  5FZ8 A;  3RNS A;  1DGW X;  2VOT A;  1NLS A;  2CTV A;  1DLL A;  1OLM A;  1LES A;  1FV3 A;  4QX8 A;  5FZH A;  4YZ2 A;  5I0R A;  2VOK A;  3H9A A;  2B45 X;  5FZ6 A;  2FCV A;  2OX0 A;  2DUQ A;  4UFI A;  2B4K A;  1ASJ 2;  1ZRC A;  4JDN A;  1W2A X;  2PAK A;  4NAM A;  4WBB A;  4X6Q B;  5C3Q A;  4XJ8 A;  4D7Y A;  1CR7 A;  2D98 A;  1YXW A;  3MW3 A;  4L8Q A;  1G9D A;  1AR9 2;  2BOI A;  2D6P A;  3O14 A;  5J1X A;  4ATF A;  1H1I A;  3I8T A;  3M3O A;  5DPN A;  2UWA A;  2Y6H A;  1LCL A;  4IE0 A;  1XRU A;  4CUC A;  1KIT A;  5FZL A;  3ON7 A;  5EJZ B;  2DWR A;  1NZI A;  2E7Q A;  4K21 A;  5FZ1 A;  5A1A A;  3HPN A;  3EXU A;  5I91 A;  3PMS A;  1MS9 A;  1WGP A;  1O3S A;  4LBM A;  2YDE A;  3WXP A;  2YFZ A;  5L73 A;  2VBB A;  3KLS A;  1WA4 A;  1JU4 A;  4QGN A;  4D7S A;  1IKP A;  1RIN A;  1RUD 2;  3J7L A;  1AL0 G;  3VHR A;  2NQY A;  3C7F A;  4Y1U A;  4KQ7 A;  2VTX A;  2W87 A;  2JG9 C;  4BK5 A;  1UOF A;  2E63 A;  2Q30 A;  4Q4V 1;  5IAV A;  1H6X A;  4LKS A;  5FMO S;  5FY7 A;  4AI0 A;  3JBG 3;  2XBO 3;  4Q4Y 3;  5LRS A;  4R8H A;  2EIC A;  3HQX A;  3LPF A;  2WA3 A;  4GD4 A;  4XHB A;  2YPD A;  1AHS A;  3MLK A;  5AFE A;  4L0P A;  1DU3 D;  1GQP A;  3EQE A;  2QDR A;  4XTM A;  4BK4 A;  2C5D A;  1LOA A;  1POV 3;  3GNE A;  4QGL A;  1ASJ 1;  2VUL A;  3N9P A;  4SLI A;  4P9Y A;  3N9Q A;  3UJQ A;  1HLC A;  2A6V A;  2TEP A;  4D0Q A;  2FDF A;  4BME A;  1T2X A;  3L9J T;  4ISQ A;  2HEY F;  4WM8 A;  4LBQ D;  2FCU A;  5FY0 A;  4IV3 C;  5FZK A;  3ZXD A;  3V0B B;  1AR9 1;  3LSD A;  2WN3 A;  1J84 A;  1M4W A;  4FAH A;  2B46 X;  4RYD A;  5DUV A;  3OPW A;  2WII B;  3WP4 A;  1WBF A;  1G9A A;  3GZE A;  2LRP A;  1HIX A;  2Z42 A;  4AGR A;  5FYV A;  5EV7 A;  5DMY A;  1CZT A;  1K5M B;  1PO2 3;  3BCW A;  3IDA A;  1RUD 1;  3L2Y A;  4LOR A;  1HDK A;  4R9D A;  5AVA A;  5ANN A;  3OUJ A;  4AGV A;  5EXO A;  1AR8 2;  5C7G A;  3KCC A;  2A3X A;  4FQ4 A;  3WQ7 A;  2PN5 A;  4JRA A;  1EP0 A;  3VUO A;  3I3M A;  4UW6 A;  1AZD A;  5BNP B;  1Z78 A;  4OMC A;  3WF4 A;  2ETE A;  2Z4F A;  4CP9 B;  2X5I A;  3WUD A;  5KHI A;  2BV4 A;  3J8F 2;  1O7F A;  3OF1 A;  3SQO A;  4N8M A;  3ZXK A;  3H8O A;  2B5H A;  1BMV 2;  3B7M A;  2QUO A;  3RGB A;  1W6N A;  5FK7 A;  3ZYF A;  1C4R A;  4IEO A;  4NN0 A;  1CAX B;  2YMZ A;  2VBP A;  3FWE A;  4QAW A;  4I30 A;  1IQD C;  5FPZ A;  2HJI A;  4AAP A;  2E31 A;  3OYW B;  4BM8 A;  4KMQ A;  1X9T A;  2X05 A;  1IG0 A;  1VB4 A;  2A75 A;  2VL4 A;  4LKE A;  5ABJ A;  3S0M A;  1NY7 1;  2WZ8 A;  4WVM A;  2ADE A;  2XML A;  4JGY B;  4H7L A;  4TTG A;  1OI6 A;  4LXL A;  4Q8L A;  4L9B A;  5D8A C;  5FYB A;  5A80 A;  4D3W A;  5KBF A;  3OBA A;  4GWN A;  4RSU A;  1OC1 A;  2C9K A;  4FFH A;  2JDU A;  1C3H A;  4TYS A;  4XQ4 A;  1N3P A;  4X6R B;  1SLT A;  1AYN 1;  4B4P A;  5A6X A;  3RZK A;  3H7J A;  1OKQ A;  2J1V A;  4MXW A;  4WM7 C;  3BU0 A;  2CL2 A;  4QU1 A;  2PQS A;  4JDO A;  1O91 A;  1YRZ A;  4M0N A;  4V2V A;  1QQP 3;  5FZE A;  4QPG A;  3O1T A;  2NN8 A;  1OD5 A;  2EXK A;  5FP4 A;  1MS8 A;  1HB4 A;  3MW2 A;  1NQJ A;  3H3Z A;  1APN A;  2RM2 3;  2DUO A;  4A3Z A;  5FYU A;  1U5Y A;  3EYP A;  2H6C A;  3HQR A;  4P08 A;  3ZYP A;  2QTW B;  3H8U A;  1BMV 1;  2GME A;  5IUQ A;  2VW2 A;  3K2O A;  4O65 A;  1BEV 2;  2R1B A;  2EIB A;  1QY4 A;  5JXJ A;  3QBQ A;  4LA3 A;  2ZMK A;  4JVA A;  3VBH C;  1QNY A;  4HON A;  1O8S A;  3R0R A;  4LKF A;  3M3E A;  3O0V A;  4JDM A;  1K12 A;  2IXH A;  1O8P A;  2VW0 A;  2OT7 A;  2X8K A;  1Q8Q A;  2PHX A;  2R04 3;  2VVE A;  4IEU A;  5CNA A;  2JIC A;  1PHM A;  4LNV A;  4EYU A;  5FYH A;  3MFA A;  3A0K A;  3EJK A;  2ARC A;  4AFA A;  5A1L A;  3WNN A;  2VTF A;  3JQW A;  1AVB A;  4QHZ A;  5E16 A;  3BUC A;  2HWB 2;  2AR6 A;  1NAE A;  3I2H A;  4CEY B;  5GLT A;  1R08 3;  2ZJC A;  2RMU 1;  1SLL A;  1PK6 A;  2J7M A;  4XZU G;  4RR3 B;  4LHK A;  1ZX5 A;  5FY5 A;  3HBZ A;  3I97 A;  4CDQ A;  1YQ8 A;  2DBI A;  1WCQ A;  3INA A;  3VL9 A;  4AI1 A;  1GFF 2;  1Y9G A;  2F4P A;  5T54 A;  4XDQ A;  1A6C A;  3KQR A;  3DYM A;  1BKZ A;  1MZ6 A;  1LHV A;  4XYX A;  2HWF 1;  2BEO A;  4CTE A;  3NV4 A;  1LNS A;  3KZ4 C;  1HXS 2;  1C1F A;  3VZJ A;  3VZM A;  4GAL A;  5DAW A;  5I93 A;  4ATE A;  3OD0 A;  2IXI A;  2W2I A;  3SHR A;  4XMI A;  3FJS A;  1COV 1;  3PUQ A;  4XEZ A;  1BEV 1;  5A70 A;  4B3N A;  2WQ8 A;  5CIS A;  2RS5 2;  4MGZ E;  5K7P A; 
#chains in the Genus database with same CATH homology
 3I3M A;  3I2O A;  3I3Q A;  3KHB A;  2FDK A;  4O61 A;  4ZS3 A;  3H8O A;  2FDG A;  4IDZ A;  5F8P A;  3RZJ A;  3H8X A;  4CXY A;  4IE4 A;  3RZM A;  4NID A;  4RFR B;  2IUW A;  4MGT A;  3O1M A;  4ZS2 A;  4NRO A;  4NRQ A;  4NIG A;  4NIH A;  5DAB A;  4NRM A;  3BTX A;  2FD8 A;  3T4V A;  4IE5 A;  3RZH A;  3RZK A;  4CXW A;  3BU0 A;  3O1V A;  3O1T A;  4IE6 A;  3BKZ A;  3O1O A;  4IE0 A;  2FDH A;  4MG2 A;  4ZHN A;  4JHT A;  4OCT A;  4QKF A;  3BI3 A;  3O1U A;  3KHC A;  3T3Y A;  3BIE A;  3S57 A;  3I49 A;  2FDJ A;  4NPL A;  3T4H B;  3BTY A;  4O7X A;  3BUC A;  3LFM A;  4IE7 A;  2FDF A;  2FDI A;  3BTZ A;  3H8R A;  3O1S A;  3S5A A;  4QKD A;  3O1R A;  3RZL A;  4NJ4 A;  4QHO A;  4NII A;  4NPM A;  3O1P A;  4CXX A;  3RZG A;  4QKB A;  4NRP A;  4QKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...