4JHTA

Crystal structure of alkb in complex with 5-carboxy-8-hydroxyquinoline (iox1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title 5-Carboxy-8-hydroxyquinoline is a broad spectrum 2-oxoglutarate oxygenase inhibitor which causes iron translocation
doi rcsb
source organism Escherichia coli
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4jhtA00
4NIDA 3O1TA 4NPLA 3BU0A 3RZMA 3RZHA 2FD8A 4MG2A 3BTYA 4O61A 4NPMA 3H8OA 4ZHNA 4QKFA 3T3YA 3KHBA 4RFRB 4QKBA 5DABA 3BKZA 4NIHA 4NRMA 2FDIA 3I3MA 4MGTA 4IE4A 4O7XA 3O1MA 4IE7A 2FDJA 3BTXA 3O1VA 4QHOA 2FDHA 2FDGA 4JHTA 3O1UA 4CXXA 4IDZA 3BI3A 4IE5A 3I49A 4NRQA 4CXWA 3RZKA 3RZLA 4NIGA 4NROA 2FDFA 3O1SA 3KHCA 3BIEA 4NJ4A 4NIIA 3O1PA 4NRPA 2FDKA 3BTZA 3H8XA 3I2OA 3LFMA 3BUCA 3H8RA 3I3QA 4ZS3A 3O1RA 3O1OA 4ZS2A 4CXYA 2IUWA 3RZJA 4OCTA 4QKNA 3S5AA 4IE0A 4QKDA 3RZGA 5F8PA 3S57A 4IE6A 3T4VA 3T4HB
chains in the Genus database with same CATH superfamily
3K3NA 4CEYB 1GYKA 3RI8A 4AVSA 1ZBE2 1JODA 4YM3A 3BIWE 1N3QA 4WZFA 5E6HA 5H9RA 3RZMA 4MG2A 4ORFA 4BQYA 4G3YC 2FMDA 1PNFA 1TZOA 1YQ5A 4Y5TA 1NA1B 4LBQB 4QQLA 3BN6A 1W3VA 2IVIB 1UYPA 4Q4V1 4RYDA 4E8CA 2EXJA 4XFFA 2P2KA 4YM2A 2BRTA 1RUH3 3NNJA 4IXLA 4FOVA 3VZJA 3AYDA 1VBA2 1RUD1 1MEC1 1ENSA 2K2SA 4HVQA 3IAQA 2CDPA 4ISRA 1BHGA 4ZY9A 4CU9A 2PFWA 1AR81 5D8AC 2RJLA 4HPKA 1UN1A 2UWCA 5LWBA 5F9TA 2NMNA 3VBHA 5K7PA 2OT7A 1K42A 1KXGA 1G9FA 1LTEA 1YFXA 1WW6A 3G6JB 1ODNA 2VG9A 3AZVA 1A8MA 4INDA 4ONUA 1RGSA 2WAAA 5DXDA 4UI9L 2C4XA 4Q1RA 4V2VA 2ORXA 4UFMA 2FCUA 3SMHA 4BK4A 4KG8A 3NL1A 4YW7A 2W95A 2JDYA 1FI2A 1WLTA 1SCRA 4QXHA 3VZOA 1AZDA 2JE8A 3VZKA 4BU2A 4CUCA 1HXS3 1SZBA 4LT5A 5EHDA 3LIGA 5J36A 2AYHA 5CADA 1VBE1 1F31A 2R0HA 2A3XA 1W6QB 5F5CA 5FBZA 4CE8A 2A70A 1RUI3 2XDVA 1ASJ3 2ENRA 4XF3A 5FWJA 4LITA 5CFDA 2XVGA 2VMEA 4XZUG 2H6BA 3WF2A 5C8CA 2DCZA 3USSA 5FYZA 3SKJE 4KQ7A 1UIKA 3HOBA 4JGZB 5C70A 3OY8B 2PAMA 5D8AA 5LBFA 5A33B 4XQWA 2D6PA 4M3CE 3VZNA 1WCSA 2ZX1A 4AL9A 1V9U3 4YW5A 1CAVB 5A7SA 3T1LA 1Q56A 3WHUA 1SBFA 2LTNA 4LLOA 3O14A 3K48A 3U10A 1QJFA 1ZX5A 1XNTA 1W8OA 3POYA 1AR93 3VKLA 3SH5A 4LBNA 2VW1A 2WQ8A 4FP3A 2B9UA 2OZ6A 3P6BA 3KT7A 3VKFC 3OPTA 4XDQA 3IMMA 1OOPC 1PMHX 1R081 3KQ4B 1GP4A 1QXRA 3MPPG 5ACA2 3B5LB 1MQTC 2W2IA 3M3CA 4OZOA 4XTMA 4XFIA 4R9CA 5E8AA 3I2KA 1F35A 3ZFEA 1HJGA 2QTWB 4RSUA 1SLBA 3VHPA 4UT5A 3V0BB 2VUAA 4NE9A 1QJU2 1ZBA1 2TBVA 2AEYA 5FLHA 1V6OA 2JWPA 1AR63 4MGYE 1NLSA 1T6BX 1OH3A 2VNGA 3TEWA 2ZX0A 5JZGB 3QH7A 4IGPA 1NZIA 4FI9A 3HT1A 4C90A 4I0WB 2D3RA 3FLTA 3NSTA 4PDWC 4FXKB 4FPCA 5ANQA 2HYKA 3USUB 3VUOA 2JKXA 3ZLIA 5C9AB 3AJZA 3DPRC 3NNMA 4WV8A 3DXUA 1ND3A 4B7EA 1LU2A 5FO8B 1SPPA 1LOGA 3S5QA 1W9TA 5T3NA 5AVPA 2PA7A 1MQTA 1DZQA 1K12A 2O1QA 5FP4A 1QJX2 2W1WA 2JEMA 4LKEA 5T54A 3S7EA 1MS4A 1JZ3A 2YFZA 3PIJA 1MS3A 3NAPC 4XVHA 4XUNA 3WW1A 4GAZA 3FBMA 4A45A 5LCWL 4NRMA 4QM8A 4LORA 3KF5A 1VJ2A 2GNMA 1CZSA 4LKSA 2O8OA 4P00B 5FJKA 5FLJA 3U1XA 4MGTA 2CAVA 2XKOA 4AQ6A 1W05A 3WVJA 3ZPOA 2HWC2 2WFF1 1RB8G 1RIRA 1LHWA 1QKQA 2DU1A 3IIAA 3NJVA 3BOPA 3OD4A 3ZVXA 5IYYA 5ANNA 5JCTA 1PIV2 3AKRA 2WZR2 3IB3A 5B2GB 2FCVA 1DYKA 1APNA 4XFBA 4BQXA 3BTXA 2VMFA 4JV4A 4SLIA 4BA6A 5AFBA 1RUC2 2WT2A 5EJZB 4AVBA 4IUGA 1EV12 5A6QA 1RJ7A 3J7LA 4XJUA 4EWAA 2HEVF 1W6MA 1PZ9A 3VN4A 3IDBB 1O5LA 2RMU2 4IV3B 3B93A 3I3BA 3UESA 3N7KA 1NA1A 3C7OA 3JCIA 4LBQA 3U14A 3H3LA 3VBRC 4OHVA 3WF4A 4CZSA 2RHPA 4XYXA 2QVSB 4IEOA 3U37A 4XXPA 3AZXA 1YHFA 3ZXEA 1S1AA 3ZSEA 4CP0A 1BEV1 3SITA 5HCBA 5EJ1B 1DBNA 1PVC2 5FYHA 1V6MA 4V2WA 2VW2A 3LCPA 2QZ3A 2Y6JA 3AFGA 2ZX2A 1XU1A 2QQMA 2YV8A 4N53C 4RFT0 3O1SA 4QU2A 4Q8KA 1GOGA 2RDRA 5A1AA 1XQNA 5IFPA 3TRSB 5LB6A 2Q5TA 2WYFA 2WBKA 2WZPP 1GV9A 4XDOA 1EUTA 4XZPA 1RC6A 5FZEA 5LEKA 2YG0A 2R042 1RUG3 1ACCA 2XWJB 1UU4A 3AKPA 1GUIA 2B45X 3R0RA 2WT0A 3D3AA 4IQPA 2DBIA 1V6IA 1SHWB 1EAH3 2GP5A 3EHKA 2ATFA 3RYKA 2BVVA 4LUMA 4W65A 1UX7A 2BQPA 2JG9C 1UXXX 1K45A 2BFUL 3B69A 1W28A 3KQRA 3DYMA 3WEZA 2UU8A 1OQ1A 2JD9A 2A71A 4LEJA 4GQ7A 5FPVA 5FRAA 5FZLA 3S5AA 4O65A 5BNPC 3A0NA 1H8TA 3RG0A 4Z1VA 3RZGA 2BP6A 2NPIA 2IC1A 2CGNA 4QPIB 5H9PA 4WM7A 3ZO0B 1H2NA 2JDHA 3VBOC 2DTWA 3F95A 4FPYA 2QDRA 3TEYA 1WLCA 2RJKA 4IE6A 3OEBA 5A7WB 3DCQA 3T0DA 3CHXA 2ZMNA 4JGZA 2R072 3KV5A 1PGW2 4LKDA 1Y9GA 1VAVA 3TNPB 4BZ4A 4KWUA 3ACHA 3NO8A 1LKNA 2XUEA 2R30A 2D93A 1QHDA 5APAA 1OURA 1BBT1 1ZBE3 1SACA 2BVBA 4YM0A 3OPZA 1WCUA 1OF3A 3PUSA 1REEA 1XB9A 2RS31 2WA3A 5C3QA 4Q0SA 4B4QA 3SH3A 2VNRA 3MW2A 3JBG2 1PX3A 3ENRA 3UL2A 1D4VB 1N1SA 2P3IA 5EYXA 5A7OA 1OC1A 5C3PA 1JYXA 3GBFA 3VDAA 4P9LA 5A32B 4BQ5A 2JENA 1FXZA 1Y9QA 5J98B 3ATGA 1VBA3 1YNAA 1QXJA 1YFWA 5T5JA 1H4GA 1GWLA 3DKWA 4QQ2A 1WCDJ 2ZABA 3Q8BA 4PBOA 3I2DA 3VL9A 2SLIA 1OUSA 4D3WA 1DGRA 2PHUA 5BNNA 2XJQA 4MXVA 2WJSA 2OW4A 5GM0A 4QQPA 3U78A 1RUD3 3DF0A 1VMFA 1VE0A 4W50A 2VOXA 5FZOB 3PUHA 1V6LA 1AX0A 4XUOA 3USUA 2RV9A 5KWRA 3OGRA 5ABJC 1VMHA 2VZTA 3VLBB 4EE2A 1BCXA 5DAVA 1AR83 3NW4A 4FPLA 3KV9A 5J96B 1JBCA 4HKWA 3OYWB 1TMF2 1N3PA 1QH6A 1YO8A 2XHKA 5JLVA 3V0AB 2ET1A 3POGA 1RUF2 1UZWA 3H1MA 5J7MA 1GWKA 4HSLA 2YU1A 1NLQA 3B00A 4RQPA 3AP7A 2VXJA 4EV0A 3BI3A 4Y22A 5DZEA 1ZA4A 5FYUA 4E4ZA 3I49A 1X8EA 3FFQA 5EP9A 4H55A 2MEV2 3RMXA 4Q4X2 3T09A 2XPJA 3HPNA 5FZMA 3RZKA 5CB7A 4OHYA 1HQNA 2Q1MA 1COV2 1PZ7A 2NMOA 4HANA 1O3SA 5A3MA 4B4PA 1ULEA 2PHXA 3CJIB 2VZRA 2JDPA 5D21A 4R9BA 1GMMA 4TSVA 4BQ4A 3CEWA 1J1TA 3BTZA 2YMZA 2XKPA 1CESA 2YFUA 3C7EA 2DCYA 4FPHA 1QDCA 3THTA 2AZ5A 3W9AA 3ZYGA 3HQXA 1LOEA 1XNCA 4NHMA 3O0WA 1D7PM 1JU3A 3K4AA 5EV7A 1V6JA 2ZGRA 3PMEA 4L0PA 5B4XA 5I0RA 5JOYA 3MDPA 4U2AA 3JQXA 2VO5A 3OEAA 4FPGA 4N9IA 3H9AA 3ZXLA 2UYAA 1JZ4A 1OKQA 4CDQC 3GYDA 4QPYA 1E5SA 4CUGA 5FR3A 3R05A 4A4AA 5A1FA 1HDKA 4Y24A 4X6RB 2HWB1 1ND2A 4GH4C 5HXVA 1J84A 4JAAA 4M01A 1RXFA 4FVVA 3T4HB 4FBFA 1Z7S3 3ZN5A 1OQEA 3B3QE 4GB32 5KBFA 4CTEA 1ZRCA 1LHOA 1ZBA3 5FZGA 2VZ3A 3VBUA 1YC61 2YC2A 3BCWA 1CX4A 4Q8LA 4XJ9A 1F5JA 4TZDA 4QPWA 2WZEA 4QB2A 1S0FA 3QD6A 2WWSA 1M06G 1BK0A 2VBBA 1U5YA 3ZN6A 5IVBA 1XXNA 1DYOA 1TEIA 4JTNA 4KG0A 4KNCA 3E6BA 3LSEA 3IZOA 5JXGA 3W58A 4QKBA 1QJX3 4UFKA 2ADEA 2Y26A 4Y5Z0 1GP5A 3RZZA 3DEMA 4QM9A 1CR7A 3LEKA 1L7RA 2X29A 4N7IA 4MGIE 5J48A 1LOCA 3RWKX 4MYEA 4HVRA 4JVAA 4NAOA 5JVVA 2J1EA 4IV1A 2HWC3 4UYBA 2GMEA 5FREA 2CHHA 3EMRA 3MYXA 4ASMB 2CNAA 1W2TA 1PGL2 2PLV2 1PIV3 5C4WB 2WZR3 3N7MA 3FLPA 3PVBB 1XNDA 2BU9A 3Q9OA 2NM1A 4QPGC 4ZU5A 5A3NA 4N43C 4M0NA 4QU1A 5LK5A 1NY71 3VDDB 1RUC3 1GOHA 2VOVA 1WMEA 1EV13 1QY4A 3LQCA 4R4XA 4LBJA 1AYM1 1NCRB 4CU7A 5CAZA 4MV2A 4MSVA 3IM0A 1RITA 1WMDA 2ES3A 2WUHA 4D7YA 1CIYA 1GFF2 4IEUA 5LA0A 1HXS1 1AVBA 1ZVFA 2C1FA 4X8PA 4XABA 1UAIA 2DCJA 5FP8A 5K0UB 2YBPA 4HVOA 2UY9A 2Y0OA 4Y1VA 3ZIXA 3AVRA 3S7IA 1N3OA 1UOGA 1UYXA 3MW4A 1HB1A 3OG2A 1PVC3 1JHNA 4Q4Y1 1WWYA 4QQHA 1NE6A 2G19A 2OQ6A 4JKMA 4QDQA 2YROA 1AJKA 3VBSC 3FFZA 4FQ4A 3WCSA 1OFSA 3HNYM 4QPGA 4QD2A 2DVBA 1HB4A 5I0SA 1DZTA 1JUHA 1VB2A 4QGMA 1V9U1 2XLAA 1Q8OA 3FUOA 1ST8A 3HT2A 1BEV3 4BE3A 1CAXB 1QGLA 1XRUA 4JDMA 1PO12 1G9AA 1G9CA 3H7JA 4U36A 2HWD2 4Z8BA 2R043 1NCQC 4Y1ZA 2JB8A 1AR91 2JG8A 2ZTNA 4PIYA 4TXWA 4IESA 3AL6A 4CXYA 2HEWF 1X9TA 4X6QB 5K4LA 4D0QA 4JRLA 4Q26A 2VTXA 1QIQA 3SKVA 1BYHA 4MXWA 3MW3A 5BY5A 1W8NA 1JI6A 3I4IA 3V0AA 1U12A 3WG2A 1E5RA 2XUMA 4HONA 2A3YA 1Q8QA 5DMYA 2EXHA 2YHJA 3KLSA 2CWMA 3PJQA 4GWNA 4YVWA 3FX3A 5LRRA 4RR3B 3ZSJA 3S30A 5K9YA 3H3ZA 5FZBA 4YG0A 3U4SA 2JX9A 1AL22 1AXYA 3IBMA 2GN3A 3N9LA 3WDUA 1AR61 3RYRA 3ZOIA 1TNFA 1KS5A 1DLLA 2R073 2LRPA 3ELNA 3KT4A 4E2GA 4OHZA 3I54A 4NPMA 1YEWA 3HWJA 4FFGA 4GWJA 2OZJA 4DPNA 1H2MA 1JXNA 4NAMA 2RS12 5T52A 1W6PA 4WM8B 4RFRB 1FT9A 1BQPA 1HN1A 2PQSA 2IXCA 2ZGSA 3ACGA 3B02A 3POWA 4KL1A 1HB2A 2UYBA 2AEZA 4META 4PLNA 3VL8A 4J6GA 1VMJA 3CQOA 4NIHA 3CL1A 4HL0A 1S0IA 3JB4C 2Y6KA 3EO6A 4XUTA 3L2YA 2SBAA 3X29B 4A7KA 2BWAA 2VMHA 2XLGA 5AC93 1ZZ8A 4NMIA 3WCRA 3VD3A 2RS33 3IDEA 5EFUA 2WLPA 1FPN2 1RHI2 3GZTB 4XF4A 5FQ0B 3W21A 4AZZA 1L7QA 1NUKA 2Z4FA 4LHSA 1KQRA 3SXWA 4JDOA 4JHZA 1NX9A 5FDBA 1KDKA 5A3OA 1VBD2 3VHNA 1W9SA 3GHMA 2G4IA 3J8F2 4HLTA 5DUXA 5GZFA 1G86A 4IGOA 3ZXKA 5T5LA 3VZLA 2WNOA 4LO4B 1OD5A 2WKKA 3P3PA 4GA9A 1C8M3 1KEXA 4Q4W3 2RM22 3GGLA 4YW4A 1CZTA 3S6PA 1F9KA 2VU9A 4XJWA 2LM3A 1JTZX 2WNUA 2ZKLA 1A34A 1OXCA 4A3XA 4IEPA 4DO0A 4CUBA 2Q8DA 2IFRA 1M4WA 1DLCA 2PN5A 1RUF3 1RMU1 2ADDA 1OF4A 2Y38A 5DQ0A 1RUJ2 1XJAA 5FKBA 1ZZ9A 3HNMA 4UF0B 1R1A2 4CEWA 2Y6GA 4Z2AA 2PAEA 2V09A 4GULA 5A3PA 1QEXA 2XJRA 4CYDA 3BVCA 4Q4X3 2QQNA 2GAUA 2R0FA 4NIIA 4AI0A 2YDEA 1SQ4A 1RL3A 4NRPA 1COV3 3P5BA 1FMD2 5IK5A 3EB7A 4LHKA 5L7OA 4GWMA 1NZCA 2R32A 1Q8SA 2F17A 2FHRA 4FPKA 4OMCA 4CP1A 2A75A 2UURA 3I3QA 3T0BA 3H8RA 4YZ3A 1S2BA 4I2OA 3BODA 1NXMA 2WSUA 3AKQA 5FLIA 2PELA 4A2UA 4EZHA 1POV3 2WO7A 3AMMA 1HIXA 1RUG1 2E63A 5KHIA 3WP5A 2IZWA 2D40A 4OCTA 1XSRA 3LDKA 1QDOA 4BLJA 3LGRA 4KI5M 4C0BA 1MS9A 5C5TA 4AF9A 1RXGA 2VMIA 3AZWA 1KRIA 2VECA 3KMHA 2DVGA 4BJ0A 2RR12 3QBQA 1JYVA 1GNHA 1JZ7A 2JJ6A 2AUYA 5K0UA 4DMIA 4OUMA 1UKRA 4AQTA 1J58A 1OQDA 1UIJA 5FMCA 4EROA 2YBKA 2P37A 3FMGA 3WUCA 2B8MA 4KMQA 2AH2A 3BTYA 2AREA 3MEPA 5CVRA 1S2KA 2TEPA 1LESA 4DY5A 3T1MA 3DN7A 1CWPA 3ON7A 3PMSA 3N36A 5IJRA 4JDNA 1I5ZA 2ZGMA 4BH9A 4FTEA 3UJQA 5CIRA 3U4XA 4QGLA 3RQ0A 1PK6C 1DU3D 4XFHA 4SBVA 1NOVA 1ULCA 1ZBE1 2ZGOA 3VHOA 2QQJA 4LO6B 4E9KA 3AKTA 1HJFA 1C1LA 4JQTA 2FDIA 5FY1A 1NG0A 3R4UA 2ZAAA 4CCMA 5IATA 3LD8A 1YQ6A 5F37A 5FFOC 1I5PA 3WDYA 5ABJA 3VBHC 5FO9B 4FT8A 5JMCA 1W6NB 2ZGNA 4UBGA 1RUE2 3C3VA 1OA2A 2C9AA 4JTOA 2IXHA 2VQUA 1YJLA 4PDWB 2G9FA 2DWRA 1VBA1 1YCIA 3WNPA 1W2UA 5JUVA 1HQWA 1X82A 4QHOA 4XF1A 5HV4A 5L19A 2V72A 3DPRB 4AGRA 3ZKYA 1RUNA 1NE4A 4AFAA 3NV2A 4C91A 3PLQA 4AWDA 1PK6A 3LPFA 5CFDC 2VBPA 2VVEA 2XONA 1W39A 3J4UH 5C8CC 5LA9A 4AI9A 5I0DA 1UY4A 1KDMA 5IHRA 3Q8EA 1H2KA 1S4CA 2GDFA 1C5HA 1DFQA 1G6NA 1HRI2 2I2SA 2JDMA 3TNQA 1JS9A 2A3WA 4NRQA 3BGAA 1JYIA 3M70A 1AYM3 4A42A 3UETA 4UOJA 2VVDA 3C7HA 4HZFA 5JPNB 3MZHA 2QZ2A 3RPQA 1LHUA 3AXEA 1JH5A 3R4SA 4KBZA 4QAWA 4BB3A 2DURA 4QDRA 2PTMA 1WCQA 3LFMA 2WN3A 5FUPA 5FPBA 4BCUA 1K5MB 2X5IA 1Q5OA 2BWCA 4CDUB 2DVDA 2VQTA 4OYUA 4ZS3A 4CP9A 2RS53 2VZ1A 3OGSA 2IXKA 2YC4A 3O1OA 1D2SA 4NHKA 3ZFEC 4RGAA 2HWF3 5F7UA 1XBFA 4Q4Y3 4ZS2A 2R1BA 3I2HA 3FLRA 2EXIA 1CN1A 1LRHA 3OJBA 4N9HA 5F6LB 2DTYA 1WZXA 4CU8A 2MNGA 2HH9A 3CLPA 3VBRB 1B35A 1BKZA 2QQIA 3IPVB 4GWIA 5FYBA 1ZRFA 1VRH2 5FZIA 2WLQA 2VZPA 5BNOA 2D3PA 3LEGA 3NV3A 2DUPA 5ACA1 5FV3A 4C1XA 3WDVA 2VXRA 4YW1A 3WW3A 3VKOA 1GZWA 4YVSA 1WW5A 1L7LA 1LGCA 3J7MA 4YW2A 2O14A 5H9QA 1IGOA 2VM9A 4N53B 1ND3C 4DEVA 1QJU1 1QMJA 3OGVA 1AL23 3T2PA 4LIUA 1VBE2 3ZFFB 2WAOA 3K77A 3KCXA 4A6OA 4Y1UA 2ZX3A 4Y4YA 1Z7S1 1LCLA 3MV11 3HVDA 1SBEA 3N9NA 2QFEA 3Q8FA 1W90A 4QXBA 2W87A 3T3YA 4CDWA 2YUEA 4LJHA 5ISLA 1HB3A 4BOWA 4AI8A 3GHNA 2JG9B 2WR9A 1UOJA 4LLFA 1WA4A 3BKZA 4L97A 5CFCB 2WWJA 4B4RA 1SDDB 1C3HA 4BLIA 2QQPA 3ZFGA 5BNPB 1CVNA 1O4YA 1QU0A 4UW6A 1EP0A 3BB6A 4OI4A 1QJX1 4UFIA 5EJ3A 5LBCA 4AAPA 4K8RB 3VBOB 2XL7A 5J37A 3AYCA 5FUNA 1GBGA 2NYYA 1OKOA 2BERA 3AKSA 2QDNA 1O3TA 1RHI3 4CEYC 5CEHA 1GQPA 1HV0A 4Y20B 3HR9A 2F4LA 3T2QA 2BYVE 4HN1A 1BMV2 4P14A 3ZYFA 5IK8A 1JW6A 4MHUA 1RTVA 2IXJA 1AR72 3RI9A 3VDBA 1SLCA 2OIIA 2PHLA 3F2ZA 1UOBA 2HBUA 2HWC1 4X8NA 4FOWA 4CDXA 2V4AA 5F5AA 2XOMA 4OUEA 1BZWA 1NA1C 3W20A 1AX1A 4IEWA 4COUA 1IKPA 5JSOA 3THPA 4XFCA 1PIV1 1H1MA 2WZR1 2YY1A 1BVVA 3B7MA 5IVVA 2D43A 1CJPA 3POSA 1RUC1 4AFBA 4DUVA 3H3UA 4LTAA 3ZYIB 1EV11 4P5YA 4OI2A 3KVAA 1DYPA 3LE0A 3MFAA 1QJEA 3L9JT 2RMU1 4QX2A 3ZPYA 2P3KA 2VULA 3LFIA 4JGYB 1W8WA 1RUJ3 1R092 2B5HA 4LHLA 3SLIA 2FDFA 3URFA 3KB5A 4URTA 2D5HA 1AYN3 1N1TA 2XWBB 3MFCA 3CO2A 4NJ4A 3NVCA 5FZ7A 1S0EA 3AFKA 4CEYA 2WABA 4FPJA 1UY3A 2Y34A 1A8DA 4MADA 4NHXA 5IWFA 2Y0IA 2P17A 1W6NA 1QQP2 2LS6A 3MIHA 3A22A 1RMU3 3H8XA 4LULA 2B7YA 3JU9A 4GD4A 2F4PA 3ZYHA 1SEFA 3RDIA 4AHXA 2WNVB 4HKLA 1PVC1 2V73A 4WVZA 3ZXGA 5CG9A 1A6CA 1G9DA 4CCOA 3N9OA 1PVXA 1ULDA 2GH2A 5FYYA 2OX0A 4AFCA 5A6ZA 2BPA2 2FZ2A 1I3HA 1HQLA 5FXVA 2Q4SA 4TLFA 3E6CC 1JZ2A 2IUWA 1H8TC 5A3LA 1H4HA 1ZRIA 2XLFA 2B46X 1YIFA 4WM7C 2R041 4RHV2 4LO7A 4NVPA 2W91A 3NNFA 1BK1A 4UBHA 1VIWB 2ZKNA 1PX4A 4LHNA 3WDXA 2RJ2A 3M7AA 4AVAA 4ZZ5A 5FZCA 1K5JA 1U0AA 4OQ9A 1U5ZA 2D6OX 1C4RA 2CL2A 2WQZC 4JGZC 1CAWB 2J22A 2ZAHA 4EN9B 1YXWA 3UGGA 5F3EA 4GIQA 3SCHA 4BMEA 1VAKA 4P9GA 5T5PA 4Y1YA 1UWWA 4COVA 2LROA 1J3QA 1X36A 4COYA 5FPXA 2VJXA 2IVJA 1K3IA 1DCSA 4QXKA 5IT6A 2EA7A 5I0UA 3OGJA 3OBRA 1H1IA 1VBB2 1PO22 4E2SA 1O8SA 1W6QA 3KCCA 2R071 1NAEA 3AP6A 2WRAA 1PGW1 1IPSA 1K5MA 1RVF2 1ZRRA 3O12A 4NO4A 4CDUA 1IG3A 3WF0A 1W6OB 4CVUA 3LB9A 4YW6A 2D3SA 3HNBM 3ST7A 3WW2A 3JB8A 1SLIA 1JYWA 1NKGA 1Z78A 1US3A 3DKQA 3OY8A 2FZ1A 4IE4A 5A33A 4CDQB 2EXKA 1Q3EA 4Q0UA 1Y9MA 2R7EB 5BNNC 1ONAA 3N7JA 4L2NA 1CAVA 2ZX4A 5EPAA 4BM8A 1H6XA 1F5FA 2AACA 3M3EA 4I09A 2A6WA 4Q29A 4QHBA 2XGXA 1OLMA 3I3EA 4G4FA 3JBG1 4GH4B 5DZFA 5E16A 3AP9A 4FXGB 5EXOA 1OA4A 4GMP0 1F4AA 5AC91 1LULA 3D5OA 4H2AA 1OVSA 1LAJA 1RUOA 3ILRA 3QOPA 1H8VA 2VL4A 3ZM8A 1XU2A 3H50A 5CKNA 3GBGA 2EF6A 4QB6A 1XYNA 3ZDSA 2W3JA 5HPOA 1S0BA 3POJA 1OH4A 3R6SA 3ZFFA 4FOQA 4W6YA 2OKXA 4L11A 4QDSA 1XSQA 4DUXA 3ALQA 3ECQA 1W8ZA 2E31A 4RQPC 4ZPIA 3VD4A 4E27A 3PURA 5FY0A 3V0BA 4Q4W1 1C8M1 3JD72 4BQ1A 4NN0A 4QQOA 1J83A 4AHWA 2OQ7A 2W92A 5GZCA 2B9VA 2QQLA 4B3NA 1DQ1A 1TME2 5CNAA 5L36A 3NJZA 5DAXA 1W8FA 5CFCA 4DXRA 5JZGA 5A3TA 4S2GA 1BBT2 1J3RA 5FPZA 3VBFB 1WCKA 1H9WA 1RUF1 3BIEA 4XQ4A 5KXCA 4PF5A 4AHYA 1JYCA 3RFRA 5C9AA 2A73B 2FDKA 2TUNA 1HLCA 2WDBA 1O3QA 4BIOA 2W47A 4ASLA 3BUCA 3DGTA 3SCGA 2EIGA 2MEV1 1UMIA 4Q4X1 4EWEA 2OVUA 2P3JA 1KGYA 4Y20A 1COV1 4N43B 4AOCA 4W6WA 4AFMA 1G7YA 1D4M2 1V6KA 5DUVA 3FHQA 1E5HA 3RVHA 1A78A 4QWNA 2ZZJA 4YZ4A 1SBDA 4HK8A 2P34A 4A41A 4DZGA 4MOAA 5F2WA 1SLTA 5HXMA 1DGRN 1W06A 4AXOA 1KFXL 5FZ0A 5A3WA 4P5HA 4K1ZA 1ND2C 1POV1 3ZR6A 1VB4A 1HKDA 3MLLA 5FAXA 1XNAA 3LOBA 5JI7A 1DP0A 2QJVA 1VRH3 4HETA 4KBBA 3SISA 1H0BA 2FBEA 3T4VA 2QKDA 5DG2A 3IT8A 2OPWA 2ZHLA 2WQ4A 4OQ8A 1EY2A 1HX6A 2ZOEB 2AC1A 3VBUC 1CQ9A 3FC0A 2V5YA 1PM4A 3VBSB 2E53A 1RJ8A 1BXHA 2NN8A 4BQ2A 1ZREA 1I9RA 5ACA3 3I2GA 4XJZA 3WNNA 1UXZA 3B94A 4IV3A 4MX3A 3NV4A 3RWNA 4QKFA 5FYCA 2C26A 3LIHA 3OGGA 2HWE2 1NCQB 1OLME 1W04A 4GB31 5F6KA 3ZXJA 3HQUA 4PQQA 5FZHA 4K1YA 4NR1A 1QJU3 1CIWA 1KJLA 2VUJA 5DABA 5HCHA 5I8YA 1XYOA 2JB4A 5T50A 4TN7A 1LOAA 1VR3A 3LZZA 3TWIA 2ID4A 4IEXA 2WS92 3W5MA 5IVFA 3OD0A 3IDAA 4V1PA 4Y3OA 5FY5A 5T5OA 3PVNA 1CPMA 4D8MA 4QPIC 1POV0 4IV1C 4NWWA 5BV6A 2A6YA 3FJSA 3PNAA 5DZGA 1WUVA 2XG3A 2ERFA 2HEYF 3PTRB 4RS5B 3P3NA 4Q5OA 4AEDB 3ASIA 1UU5A 1ZA7A 3NKGA 1VALA 4WVMB 4KU7A 2IXLA 5LK7B 4XXAA 1CAWA 4YW3A 4XHBA 3OUJA 2E7QA 2I74A 2WA4A 2XJUA 2ZPXA 4HBNA 3IAPA 3INAA 4HFSA 1JYTA 1FOD2 1OHFA 1S0JA 3AMPA 3AZZA 5GLWA 1QJY2 1OMIA 1AR73 4PCRA 2QQVA 4JHTA 4XCBA 2AR6A 4XHXA 4I02A 2NQYA 3BU7A 4RGGA 2VOWA 1YJKA 5A80A 3UK9A 3PU8A 1XPWA 3LWCA 3LDRA 4BHPA 2JDUA 1PZ8A 2KR2A 2B42B 3DV8A 2ARAA 3POBA 2VE1A 2X8KA 4QPIA 4COWA 2C0ZA 2ET7A 4ZZ8A 1F8VA 2HYXA 3LA3A 1O5UA 2J1AA 5I93A 4F8AA 3N9QA 4AR2A 4NIGA 4Z92B 2FCTA 3CF6E 1NXD1 5A7WA 3WQ0A 1TG7A 3IWZA 4IEQA 4MGQA 5F3IA 2XBO2 5FY7A 4D6QA 4DXSA 5HCFA 2KXLA 1R093 3THCA 2A6ZA 1XE8A 2IFWA 2GP3A 2VZVA 5HBAA 5EWSA 2E51A 2DCKA 4L9BA 1EPZA 2A6XA 5LATA 3WZ1A 1GR3A 1NQJA 3K2OA 2JDKA 4D69A 5IK7A 2RMU3 4MLOA 3WR0A 1LECA 2JG8C 2ZEXA 4ATEA 1REFA 2DVFA 2RDSA 1KITA 3I3DA 1UZZA 3V56A 2VMCA 4AQSA 5FZ9A 3CKHA 4BK5A 4P08A 2G9ZA 4QXCA 1RUH2 5DPNA 3K75B 4XILA 2QQKA 3HAGA 3IN9A 4XC9A 2BGPA 3EJKA 2RS51 5A32A 1HRV2 4Q0QA 3ZYJB 2W9XA 4YVWC 1IPJA 3WHTA 1W2OA 2HWF1 1JZ5A 2HWD1 4P02B 1WD4A 4L92A 4RHV3 3W59A 5F5IA 2CDOA 3NJXA 3WF1A 5J1XA 4R8HA 3AMHA 3PTYA 3IDCB 4UWDA 5DUWA 4IERA 4JRAA 1JMUB 4NIDA 3ZIWA 5FXWA 4TYSA 2P6CA 3MLJA 1X9PA 5JDBA 3K46A 4LIVA 4XOGA 3NV1A 4XPVA 2FD8A 4NIAA 5KR7A 1JOPA 4N90A 4Q0PA 5FZOA 1AHSA 4YZ2A 1H2LA 5JMOA 2HLEA 3LEMA 5KHGA 4M3CB 4QX8A 2BTVC 5SV8A 1AL21 3NQHA 3OYWA 4WVWA 4EWDA 4LKFA 2X53S 2XJPA 3ORJA 2H0VA 4GMP3 1UMHA 4AVVA 1RUI2 1PO23 3N7LA 1AL0G 1ASJ2 3H0OA 2PQQA 1LOBA 3WX5A 1LU1A 5FYSA 5C5UA 3TYJA 1PM7A 5DAWA 5FZDA 3K4ZA 3T2OA 2GC0A 1S0GA 3ES4A 4XIOA 4CCDA 1WA6X 3I2FA 1CAUB 3PVEA 5CISA 4O7XA 2UY8A 1UF2C 4AVTA 1IG0A 4OMDA 5G05L 4FTBA 2ZS6B 1UOFA 4LNVA 5KHJA 1UZVA 2XB6C 2ZCWA 1FYUA 1ENXA 1WW4A 3CJIA 3T0AA 3V65A 4XMAA 1W9WA 3VB9A 3WF3A 4LA3A 1ZZ7A 3DUIA 3OBTA 5GALA 3T30A 2QQOA 2X09A 4JZRA 1MVQA 3AYEA 3EBRA 1KFUL 4YWAA 4Q1PA 1MR5A 5LBBA 2QNKA 2XR4A 2P6HA 3DECA 1SLLA 1RHI1 1UQXA 3D0JA 3D6EA 3GCXA 2WNUC 5FP3A 1D0HA 1HW5A 3JBG3 2WNEA 2XL9A 4MVTA 3KVBA 3ZXAC 5LW9A 4ASKA 4CCEA 1XYPA 2YB7A 4Z2WA 2ARXA 5EQUA 4FFHA 1V0AA 2ZGQA 4CEWC 1UU6A 1FNYA 1UPIA 1J1LA 2D6NA 4HN0A 3JD73 4S2HA 3VKMA 4AW7A 5KC5A 4I30A 1W2AX 4O9GA 4B1MA 4DNYA 4HPKB 4NWVA 5F2SA 1QNYA 3CDZB 1KJRA 3VBHB 5L7OC 1WLDA 3N9MA 3ILFA 3JUUA 5GLVA 4DB5A 2BV4A 2CSGA 1LOFA 1GU3A 4ZKTB 1TNRA 2IWGB 3E5UA 1UYZA 2XHNA 5IUQA 3TN92 5JWPA 1H6YA 2GNBA 1RUJ1 2RDNA 4AEDA 2P3YA 1OD3A 1ULOA 1R1A1 4AK3A 5FZ6A 1NT0A 2DF7A 1AYN1 2Y64A 3J7HA 3TB0A 1KD7A 4AI3A 2I45A 5C33A 1TMF3 2Q1FA 3O1RA 1ENQA 1EUUA 2RVAA 3C2UA 3WDWA 4CPBA 4D7SA 2DCTA 2D98A 3KWVA 3C8XA 3AK0A 1L3JA 1FMD1 1D4M3 2VUDA 1NCRC 4HMZA 5CFDB 5KC6A 4P9WA 4QKNA 3WQ1A 4LO8A 5C8CB 5ERLA 3WUDA 4E4HA 3H8UA 3ETQA 3KD4A 4IL7A 1IZ3A 4EN6B 2MEV3 2Z79A 2F6BA 5JXHA 2W5FA 3KS7A 5D8AB 5F8PA 3LAGA 2WFPA 4A44A 2VOTA 1DIWA 2C6SA 1V6NA 3ACFA 3AC0A 5FMBA 1S55A 5K0UC 2BBAA 1W8UA 4D7TA 4LQRA 3TOJA 4COZA 1EYBA 3HN3A 4I01A 2W1SA 4M4RA 3C7FA 4OULA 2EAAA 2JECA 5JIAA 4EN8B 3GZAA 4WBBA 4KWJA 5LY1A 5C4WA 2D44A 4FP2A 2R062 2WSVA 3GZUC 5LASA 3WNXA 2CGPA 3UGFA 1JU4A 5JIUA 3ZMOA 3AP5A 3LKJA 3VDDA 4E2QA 4WZCA 2PHFA 2ZGKA 2VR4A 3MGUA 2EIBA 2W68A 5FYMA 4GKXA 5FKCA 3LSDA 1NCRA 4NPRA 2OUHA 2NLRA 3KHBA 3UT0A 3WNLA 2XJTA 3C7GA 4YARA 2Y6LA 5FXZA 2DDUA 3ZFEB 3KSCA 1GQHA 5BPXA 2OYZA 3Q8CA 5CG8A 3ZSKA 1C5IA 3H1YA 4YYOA 3D82A 4F3JA 1SDWA 5I8TA 1T6GC 2DYCA 3VGIA 3D0SA 4HXCA 4RR3C 4GB33 1CD3G 4DRRA 2G9GA 4FOYA 4AEKA 2XVLA 1JUIA 2JDNA 3M1HA 1OOPB 4NOTA 2XXZA 4UW5A 2FDHA 1SPPB 1CAXA 1RUG2 2R1DA 5HI0A 1MQTB 1YQ8A 4FPOB 1MS8A 1YI9A 1RUE1 2JD4A 4FCAA 2JE7A 1FOD3 4LBLA 3TBDA 4RGKA 1EAH2 1ULGA 2AGSA 4A7YA 2Y8KA 1S2EA 4XFGA 4BQ3A 2J7MA 4BXFA 4RA0A 4IDZA 4LBQD 5F3CA 3SHRA 1UY2A 2VUCA 5GLTA 2LUWA 4FFFA 2YGLA 4MGSA 1ULPA 1W9FA 4FAGA 1VBC2 2Q30A 3GJAA 2CY6A 1QXPA 5JXJA 5DDJ2 2GH8A 2JDAA 2XJSA 4RR3A 2XJVA 5JSPA 2W1QA 3LPGA 4NROA 3O1PA 4OHXA 3O0XA 2PLV3 3ILNA 2CV6A 4P9YA 2E32A 1LR5A 4YG6A 1O59A 2DUOA 3RGBA 2X5IC 4AE2A 5FPUA 3N4MA 1FNZA 5FUIA 1IS5A 1W8TA 1BJQA 2RDQA 1O91A 5FP7A 2E26A 2JIJA 1W6MB 4HG6B 1O4ZA 4Y4RA 2GC1A 5FZ3A 2ARCA 3ROUA 1V00A 3RJRA 3BTAA 4WM8A 3NAPB 2D6KA 1B35C 4UW4A 1AXZA 4YZ5A 3RZJA 4ES9A 4M0HA 3OPWA 4FPFA 3G7DA 5BNOC 5IK4A 3D8CA 3K51A 3RYPA 3PU3A 5I91A 3JZVA 2GALA 3QACA 3ZSMA 3GBWA 3KF3A 2VMGA 3M3QA 4YVSC 2ZGUA 1HRV3 1DG6A 1QH7A 4M4PA 3GF6A 5D1IA 3RJ2X 4DY3A 4HK9A 1OLRA 1YQ2A 4Q4V2 4AI1A 5FQ0A 2VQ0A 1C8NA 2EALA 3EXUA 4LXLA 4QX1A 1IQDC 1ZZ6A 4XFAA 4BQWA 1SFPA 4CCJA 2VD7A 5DAQA 3PUQA 2EICA 2D6MA 2ZGPA 1ZYBA 1RUD2 2KM2A 1MEC2 1VRH1 5AVAA 5JR2A 4QGNA 5F3GA 5FXXA 1PO13 4BXSV 4KGQA 5FJHA 3AZYA 5JPMB 2HWD3 4OI0A 2VMDA 2VZUA 2VCBA 3CNAA 3E6DA 3THDA 5A6XA 4DRVA 5J3UA 4CDWC 1GQGA 1AR82 4IEVA 2YYOA 1YYNA 3WP6A 4XUQA 2D7FA 4N7UA 1Z0HA 3N9PA 4FTSA 3VDCA 2A7AA 4LE3A 5FZKA 4UW3A 4Z07A 4DINB 3ZFGC 3VD9A 1X50A 1H8TB 4I0AA 2DFBA 4K9SA 4WM7B 4KH9A 3FN9A 4UF0A 1UKGA 3WNKA 2CAUA 4OFGA 2DU0A 3NKTA 5IFTA 1X7NA 4XURA 5GZGA 5FZ1A 5JR7B 4K20A 2XQRA 3KGZA 4XJAA 5JSRA 4MGKE 3OUIA 4YGBA 4CDXC 2WO1A 1QOOA 3KV4A 2CU5A 1FV2A 5KXDA 4BDVB 2RS13 1POQA 3LF7A 2K46A 4JCKA 2B4KA 5LBEA 2BOJA 5FZ8A 3JXSA 3BALA 3ACLA 2R49A 5C71A 1LENA 4AFDA 2OPKA 1DQ6A 1O4TA 3LDBA 4O9EA 1BMV1 1MZFA 1JN2P 4KWLA 5B4NA 2VQAA 3KV6A 1AR71 5LZ6A 4UXAA 1Y7BA 1WBFA 4I0BA 1DGWX 1QF3A 3FUQA 4LUKA 3LEIA 1ALYA 4BISA 2QCSB 2ZXQA 3HJRA 4OUSA 4OZXA 1FPN3 1R082 3GDBA 4PLMA 5E89A 4DIQA 3VHRA 4EQVA 4YFZA 3WQBA 4DEQA 2W94A 1J59A 5BNNB 1S0CA 1UW8A 1Y3TA 1SFYA 1GSLA 1VBD3 3ZSLA 1Z7S2 3J8F3 1OT5A 5FMOS 3E5QA 5IAVA 3OOXA 1ZBA2 4AYUA 1WW7A 1KS4A 1PHMA 3TN93 4AI2A 1DHKB 2RM23 3AL5A 4D6SA 1DQ5A 3POEA 1R091 3PUAA 3H42B 3PDQA 2FMYA 1OOPA 3KZ4C 1XNKA 1OBNA 1MZEA 5FPAA 1QQP1 3TEXA 3D4KA 4RQPB 4QMAA 4GALA 1W9YA 4Y22B 1STMA 2VPVA 4J25A 5IVEA 4I3PA 1R1A3 1URXA 4CUAA 4LE4A 1ODMA 3VD7A 4W6XA 2O0OA 2YBSA 3AXDA 3GNEA 4ATFA 4KU8A 4PIZA 1FMD3 4XUPA 5F39A 4XF9A 3O1TA 4LO5B 4PDWA 1GNZA 1E5IA 1FX5A 4Z82A 4H7MA 3ITQA 4NPLA 4RHV1 2TNFA 2VVFA 2O8QA 1WD3A 5ABJB 4HKOA 4CCCA 3A23A 2GMPA 2YPJA 2HJIA 4MZUA 1LEDA 3DPRA 5FY9A 1GANA 4MHRA 3HEIA 2BBVA 2R063 4EN0A 2MHFA 2OA2A 2ARBA 3BYWA 1K5MC 4E4DX 4CDUC 3M3OA 3POIA 2WFF2 1OVPA 2AENA 4TWTA 1PNGA 1YUDA 4HOOA 3WG4A 2ZACA 5FY8A 4A3ZA 2Z2SB 1AJOA 1NLRA 1XNBA 3AX4A 2C24A 2QUOA 4D6RA 1H1AA 2QBXA 2BNMA 5FY4A 4XF0A 1YWKA 3NAPA 4YG3A 2PHWA 4IEYA 1GZ9A 2Y6FA 2ZHNA 4H7LA 2BJSA 2RR13 1SMVA 3NMBA 4GMP1 5J09A 1VBB1 1PO21 3UKNA 3WP4A 2LW8A 5FZ4A 4E8DA 1ND2B 1OA3A 1ZNPA 3IKWA 4XAAA 2VGDA 3VD5A 3RNSA 4CU6A 3O1MA 1RVF1 5JOZA 1CX1A 1W03A 1LGNA 1N1YA 1ULFA 4BPZA 3M4FA 5C3RA 2VCCA 4Q2FA 5EYYA 2C9KA 1F4HA 4M3CF 3VBUB 4OVEA 4QT6A 1WGPA 3A0KA 1LGBA 1DF0A 3H1WA 2G1MA 3O5SA 4LBOA 5H9SA 3MV01 3ZFFC 2LALA 5AFEA 1BEV2 1REDA 4Y1XA 3MPBA 4OHWA 3ZN6B 3WLUA 3UV9A 2H0BA 3J26N 3K4DA 5E1RA 5EZWA 2IXIA 3O1UA 5KHKA 3B9CA 1LJ7A 3FWEA 2A1XA 3AVSA 3PJYA 4KWKA 5C3SA 2CTVA 3VBRA 3IPVA 2GU9A 3MUY1 4IE5A 1GKBA 4MGZE 1MACA 2PHDA 3HMYA 1JHJA 4QX0A 4EN7B 2GC2A 5HCAA 3EQEA 1OUXA 4FAHA 5CFCC 5JZGC 1S0DA 2I07B 2VW0A 2XH6A 4Q0VA 3KGLA 1AF9A 4AG4A 4PIXA 5FMDA 1VBC3 1RUE3 2OUJA 4AVCA 4WVVA 2WC2A 4IV1B 5L73A 5C3OA 2W08A 5DDJ3 5C9AC 4RD7A 4DS0A 5L9BA 1JZ6A 3I2JA 3UNPA 4A7ZA 4G9SB 3JD71 4N53A 5L9RA 2OS2A 3B01A 3QLQA 3SC7X 2W0XA 3L2HA 1FV3A 1LHNA 3H7YA 5FBJA 4I3GA 1W2NA 4AQ2A 1TME1 4H3WA 1YI7A 5FIXA 5HV0A 4C1WA 3ME2A 2A6VA 2XMLA 2HBTA 2VNOA 4XTPA 1IQAA 2PHTA 4YM1A 2V5DA 3ZN4A 3S0MA 3MF6A 1HRI3 2JG9A 1ZRDA 5JOWA 1TMF1 2ZA9A 3NNLA 4MUVA 5KHHA 2WO3A 1TE1B 3PUIA 4P9IA 4FSJA 3SEEA 3AP4A 3W5NA 5BNPA 1JZ8A 1IPKA 2YC0A 1D4M1 3MIBA 1AUYA 2Q8CA 1UYYA 3UKTA 5AC92 2ETEA 2ZBJA 2RS32 2YU2A 4FQZA 3VBOA 4JGYC 1MZ6A 3P1IA 3ZYRA 1E57A 1IS3A 1YFUA 3NRUA 4Q4V3 4QPGB 3UJOA 2B39A 3RZHA 1C1FA 1CPNA 4BWOA 2ORZA 3VKNA 3IMNA 3PL0A 3RRDA 4IV3C 4JKLA 4QB1A 5SV5A 1XE0A 1MEC3 4ZHNA 1IS6A 2WNVC 4Q4W2 1C8M2 3IIIA 4L99A 3VV1A 2D6LX 4EZ4A 4XBNA 2JG8B 2WL1A 1X8MA 5IVJA 2YZ4A 1ZZCA 5CZKA 3MBWA 1OLQA 4CCLA 1W8HA 3WINE 4MXWB 3NJYA 4XETA 2R6QA 5F1RA 2ZGLA 3MIEA 4QX5A 4K6BA 1MS5A 5CYYA 2WO2A 2UWBA 1GZTA 2BNOA 4YVWB 2C5DA 1IS4A 4JGYA 1IHMA 3AB0A 1I1EA 2VH9A 2HWE1 4LK6A 5LEJA 4PBPA 4R9AA 5BUVA 4CSWA 5KXBA 2QQUA 3EYPA 1TQ5A 1VBE3 4NUBA 3J7NA 4TLGA 3B9IA 2ZMLA 3O1VA 1RYYA 1BVP1 2BEOA 1U5XA 2WS91 1H9PA 4S2FA 4URAA 3E5XA 1VPHA 2BGOA 2Z69A 1X33A 2WNVA 1QOTA 2ZMKA 2VC9A 3N3HA 1WMFA 1XE7A 4FPEA 2FDGA 4TTGA 2J1UA 2E7AA 4K8FA 2GSYA 4KGGA 5GLZA 1W6PB 4C8DA 3SH4A 2VCMA 3SQOA 3U75A 1LEMA 3LA2A 1VAMA 1V70A 2V4VA 4OLLA 1ZM1A 4CA9A 4JC1A 4R52A 4XJ8A 2NZ9A 3UKVA 4XDPA 1U5IA 2VTFA 4CCNA 4M00A 3RSJA 4CPBD 5DUUA 5A7PA 4HSJA 2VZQA 1FOD1 1G8WA 1DQ2A 3M8LA 1D0GA 1LHVA 3ZR5A 1QJY1 4ZONA 2ZEYA 4UAPA 2BOIA 5BYNA 2W52A 3K3OA 3FHIB 3ZXFA 2Q8OA 2PYTA 3KHCA 1JOJA 2GNTA 1QWRA 1R083 1MVEA 1OFNA 1GOFA 1OSGA 3FE5A 1CJDA 3MICA 5BXXA 2VZOA 4RN5A 3BPSA 3RMYA 5LRSA 5A3UA 2VTXJ 3DYOA 4PHZA 3WD5A 1Q43A 3HIFA 2H6CA 4LOTA 2D97A 2CWSA 2EIDA 1YQCA 4UFLA 2GZWA 5FPLA 5KXEA 3SCFA 1ENRA 3PVOA 5FYTA 4PT6A 3POFA 2NP0A 3WY6A 3WNOA 4C0HA 1UCXA 2DFCA 2PLV1 3R4DB 1PGL1 1N47A 5TSWA 2HWB2 1HV1A 3UYJA 3VZMA 3WNMA 2XBO1 1UD1A 3SEPA 3OCPA 4PLOA 4XEZA 2J1SA 1LODA 2GN7A 2WNUB 4D94A 4F7ZA 1W6OA 1WKYA 4MO3M 4ISQA 2DVAA 3E97A 5GJ6A 4ARYA 1IOAA 2L9LA 4XBQA 4IE0A 2QQWA 4H14A 2EIEA 1SLAA 3WXPA 5F5QA 4L8QA 4CEWB 3HD8B 4CDQA 3DXTA 3GM8A 4BIFA 1C28A 5DG1A 5CA6A 1UZ0A 1YFYA 2PAKA 3DYPA 5CKMA 3U11A 2ZZQA 1Q8VA 1OPMA 5FWEA 4GH4A 1RUH1 5IW0A 5F32A 3Q8AA 3VBFC 1QQP3 4PJYA 5FYVA 5G04L 5L7OB 1CZVA 1HRV1 1UL9A 2XVKA 4LOSA 3HBKA 3M3IA 1Y4WA 1HN0A 4YGCA 4AGVA 1VRBA 3GXUA 2PHRA 2BUKA 3WP3A 3H8OA 2GC3A 4JQRA 2J1RA 4XACA 4B8EA 3CJXA 5JI9A 4ARXA 3O7OA 4R9DA 3CMGA 3ACIA 1PO11 4MH0E 3WSOA 2WFF3 1N1VA 3CU7A 3MUZ1 5FK8A 2X05A 5K8SA 3WOGA 3I59B 1QNWA 3OTFA 3QCWA 4JX0A 1J3PA 2GNDA 3I3MA 3MLKA 3HN1A 4AHZA 2E6VA 2YXSA 3ZKUA 3AJYA 1NY72 2WT1A 1AX2A 1FAYA 2ZEWA 3WT3A 5FOBB 1JOBA 2RG4A 3CZJA 4XAEA 2KD7A 3CJIC 1CGPA 4YFWA 4IE7A 1AYM2 4XIKA 3VBFA 1RUI1 2FDJA 3I7DA 4ITCA 1ASJ1 3AMQA 1OI6A 2RE9A 3RS6A 1G9BA 4CRQA 1LNSA 2ZHMA 3ZDVA 2MPFA 5DN2A 5I8SA 2CYFA 1HXS2 1RINA 2K9ZA 2Z5WA 1A3KA 3ETPA 2VCAA 2WYSA 5FMOL 3WDTA 1VBB3 2Y6HA 5GZDA 4DXZA 5A7NA 5FK7A 3NNGA 1YIPA 4N43A 4XE9A 1Y43B 1UX6A 1RVF3 1GP6A 5FO7B 2RS52 3OBAA 4OI1A 1SFNA 1O7FA 2QE3A 2YGMA 2Y60A 4GJZA 2HWF2 4GZ9A 1DZRA 1F15A 4Q4Y2 3A4UA 4CXXA 2Q0AA 2PXJA 3KCYA 2K0GA 4NHYA 4PI0A 2WIIB 3ZYBA 1NYWA 2RS11 2ZGTA 4YGEA 3WG3A 5IVCA 1V9U2 4LBMA 1GZCA 2VY0A 1TVGA 3U0ZA 4LA2A 4CXWA 2VBDA 5LA2A 4ZU4A 2VOKA 2GMMA 1DGWA 4N8MA 3PHMA 1GNYA 1OPOA 3AYAA 4DUWA 1LOFC 5FCCA 4LPLA 1AR92 2WZ8A 3ABZA 5FZAA 4YZ1A 3BPZA 3UGHA 3O0VA 4P9XA 5CKQA 3MO4A 4RS5C 1D2QA 3DL3A 4AEDC 5GZEA 2UWAA 4AAXA 1W0OA 2P4EA 4K40A 2CGOA 1FPN1 4LBKA 2WINB 3LA7A 3VBSA 1GWMA 1FATA 3I2OA 3OUHA 2BNNA 1MPXA 1YLLA 4B1LA 1R1ZA 4EYUA 1GLHA 4YLZA 1VBD1 4EJRA 1UO9A 1W99A 3PIGA 3J8F1 5A70A 4ZU7A 2WN2A 1PK6B 2EVXA 4FFIA 3GCWA 4Q27A 3I2IA 1I6XA 3I97A 4PI2A 1NCQA 2KA3A 2Q1ZB 5LY2A 1EPWA 3GJBA 1VP6A 3CZUA 3TN91 2N7GA 2RM21 3FL7A 1AR62 1W3XA 5IVYA 3QH6A 1PGSA 4K21A 5A1LA 2J1VA 2ILMA 3AM2A 1O3RA 1F2NA 3ZMNA 4HT1T 4DQAA 1TME3 1XOYA 2ZEZA 2XQXA 2BDRA 2WWUA 4QX3A 3S57A 4IEZA 2J42A 1BBT3 2JIGA 4UFHA 4CCKA 5E88A 1WMXA 4E4SA 3I8TA 4RS5A 2E7TA 1CONA 3ZX7A 4JKKA 5C4WC 4WVMA 1UY0A 3MF9A 4NHLA 2JE9A 4IETA 2VNVA 5JAXA 5LA1A 3BU0A 1W0PA 5T55A 2PMWB 3MI8A 3NWKA 3VDDC 1DQ4A 4GXLA 4O61A 3KT1A 3MHZA 2X5IB 2A5ZA 3E1F1 3ZXDA 1PMJX 5M0TA 2BFUS 4BMBA 5C8WA 4CP9B 3BOWA 2FQPA 4YGDA 3WQ7A 1O6UA 4YPJA 5BNQA 3OBZA 5C7GA 3ZYPA 4W8JA 5EIYB 1UPSA 2JICA 1LB2A 1W0NA 2Z42A 2R061 1B35B 3A21A 3SNMA 5C6CA 4IW3A 3GZEA 3FHAA 2DUQA 5BNOB 3OB8A 3CIHA 4ET7A 4XCAA 4PQ9A 5FTTC 3LOIA 1UZYA 3N35A 1SCSA 2JXAA 2W1UA 5FYIA 4K7JA 4AGGA 4F83A 1WLWA 2W39A 3TEZA 5FP9A 1GZWB 4YVSB 3T08A 1UMZA 1WBLA 4LK7A 4LR4A 5JOXA 1DQ0A 4UFJA 1AYN2 4RL7A 4XQDA 3MIDA 4XMIA 2RR11 2J1TA 2JKBA 4J1XA 4Y26A 1MS1A 4CP2A 1IKQA 1QOSA 4XW3A 3MIGA 2ZHKA 1RMU2 1QJZA 1UY1A 4J1WA 2ZJCA 4K3UA 4DOUA 1DDLA 3CBNA 2D5FA 2EAKA 4B29A 3TAYA 1MZ5A 3HBZA 2HWE3 1GICA 4CDWB 2R16A 5FZFA 2BZDA 3J9SA 1H30A 4ZXKA 5A6YA 5JXIA 3HQRA 2DBNA 2BGCA 1O8PA 2WS93 3M2MA 4DFSA 1XC6A 3V64A 4GKYA 2OXBA 3GALA 1YRZA 3OSDA 1VLNA 3ZFGB 1T2XA 3I59A 2Q8EA 1AXKA 2VZSA 2P1BA 3RZLA 2VAUA 4S2DA 1EAH1 5IAXA 3OF1A 1ND3B 1SG3A 3FZ3A 2BW8A 2HKXA 1B09A 2Y33A 3ES1A 5D2AA 4AEJA 4ES8A 5FOJB 5A7QA 1DGLA 5GKAC 5GLUA 1VBC1 4AEMA 3AMNA 3A7QA 1QJY3 5DDJ1 4CDXB 1PMIA 4M3CA 2P5BA 4WM8C 1MS0A 5DAPA 4QX7A 4P9JA 3WV6A 1P8JA 3KM5A 5L9VA 1JYNA 3U07A 2E9QA 4R4ZA 2W46A 4DXTA 3MIFA 4ZXEA 2X10A 1NQDA 3WG1A 2HWB3 3T2TA 2YPDA 2E33A 1US2A 1C57A 4QHZA 4Y33A 1BLZA 1Q8PA 4LMFA 4XBLA 4A6SA 4GJYA 4QKDA 4W4ZA 5CU1A 4YRDA 4YSFA 3WW4A 1CAUA 3FBYA 4Y5SA 4IGQA 4BYYA 4YNIA 2JDZA 1UNBA 5CBLA 5I0TA 1ZZBA 1R64A 3JQWA 4PF1A 4B7KA 1HRI1 2XBO3 2DV9A 4FO9A 3APBA
chains in the Genus database with same CATH topology
4NIDA 3O1TA 4NPLA 3BU0A 3RZMA 3RZHA 2FD8A 4MG2A 3BTYA 4O61A 4NPMA 3H8OA 4ZHNA 4QKFA 3T3YA 3KHBA 4RFRB 4QKBA 5DABA 3BKZA 4NIHA 4NRMA 2FDIA 3I3MA 4MGTA 4IE4A 4O7XA 3O1MA 4IE7A 2FDJA 3BTXA 3O1VA 4QHOA 2FDHA 2FDGA 4JHTA 3O1UA 4CXXA 4IDZA 3BI3A 4IE5A 3I49A 4NRQA 4CXWA 3RZKA 3RZLA 4NIGA 4NROA 2FDFA 3O1SA 3KHCA 3BIEA 4NJ4A 4NIIA 3O1PA 4NRPA 2FDKA 3BTZA 3H8XA 3I2OA 3LFMA 3BUCA 3H8RA 3I3QA 4ZS3A 3O1RA 3O1OA 4ZS2A 4CXYA 2IUWA 3RZJA 4OCTA 4QKNA 3S5AA 4IE0A 4QKDA 3RZGA 5F8PA 3S57A 4IE6A 3T4VA 3T4HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NID A;  3O1T A;  4NPL A;  3BU0 A;  3RZM A;  3RZH A;  2FD8 A;  4MG2 A;  3BTY A;  4O61 A;  4NPM A;  3H8O A;  4ZHN A;  4QKF A;  3T3Y A;  3KHB A;  4RFR B;  4QKB A;  5DAB A;  3BKZ A;  4NIH A;  4NRM A;  2FDI A;  3I3M A;  4MGT A;  4IE4 A;  4O7X A;  3O1M A;  4IE7 A;  2FDJ A;  3BTX A;  3O1V A;  4QHO A;  2FDH A;  2FDG A;  4JHT A;  3O1U A;  4CXX A;  4IDZ A;  3BI3 A;  4IE5 A;  3I49 A;  4NRQ A;  4CXW A;  3RZK A;  3RZL A;  4NIG A;  4NRO A;  2FDF A;  3O1S A;  3KHC A;  3BIE A;  4NJ4 A;  4NII A;  3O1P A;  4NRP A;  2FDK A;  3BTZ A;  3H8X A;  3I2O A;  3LFM A;  3BUC A;  3H8R A;  3I3Q A;  4ZS3 A;  3O1R A;  3O1O A;  4ZS2 A;  4CXY A;  2IUW A;  3RZJ A;  4OCT A;  4QKN A;  3S5A A;  4IE0 A;  4QKD A;  3RZG A;  5F8P A;  3S57 A;  4IE6 A;  3T4V A;  3T4H B; 
#chains in the Genus database with same CATH topology
 3K3N A;  4CEY B;  1GYK A;  3RI8 A;  4AVS A;  1ZBE 2;  1JOD A;  4YM3 A;  3BIW E;  1N3Q A;  4WZF A;  5E6H A;  5H9R A;  3RZM A;  4MG2 A;  4ORF A;  4BQY A;  4G3Y C;  2FMD A;  1PNF A;  1TZO A;  1YQ5 A;  4Y5T A;  1NA1 B;  4LBQ B;  4QQL A;  3BN6 A;  1W3V A;  2IVI B;  1UYP A;  4Q4V 1;  4RYD A;  4E8C A;  2EXJ A;  4XFF A;  2P2K A;  4YM2 A;  2BRT A;  1RUH 3;  3NNJ A;  4IXL A;  4FOV A;  3VZJ A;  3AYD A;  1VBA 2;  1RUD 1;  1MEC 1;  1ENS A;  2K2S A;  4HVQ A;  3IAQ A;  2CDP A;  4ISR A;  1BHG A;  4ZY9 A;  4CU9 A;  2PFW A;  1AR8 1;  5D8A C;  2RJL A;  4HPK A;  1UN1 A;  2UWC A;  5LWB A;  5F9T A;  2NMN A;  3VBH A;  5K7P A;  2OT7 A;  1K42 A;  1KXG A;  1G9F A;  1LTE A;  1YFX A;  1WW6 A;  3G6J B;  1ODN A;  2VG9 A;  3AZV A;  1A8M A;  4IND A;  4ONU A;  1RGS A;  2WAA A;  5DXD A;  4UI9 L;  2C4X A;  4Q1R A;  4V2V A;  2ORX A;  4UFM A;  2FCU A;  3SMH A;  4BK4 A;  4KG8 A;  3NL1 A;  4YW7 A;  2W95 A;  2JDY A;  1FI2 A;  1WLT A;  1SCR A;  4QXH A;  3VZO A;  1AZD A;  2JE8 A;  3VZK A;  4BU2 A;  4CUC A;  1HXS 3;  1SZB A;  4LT5 A;  5EHD A;  3LIG A;  5J36 A;  2AYH A;  5CAD A;  1VBE 1;  1F31 A;  2R0H A;  2A3X A;  1W6Q B;  5F5C A;  5FBZ A;  4CE8 A;  2A70 A;  1RUI 3;  2XDV A;  1ASJ 3;  2ENR A;  4XF3 A;  5FWJ A;  4LIT A;  5CFD A;  2XVG A;  2VME A;  4XZU G;  2H6B A;  3WF2 A;  5C8C A;  2DCZ A;  3USS A;  5FYZ A;  3SKJ E;  4KQ7 A;  1UIK A;  3HOB A;  4JGZ B;  5C70 A;  3OY8 B;  2PAM A;  5D8A A;  5LBF A;  5A33 B;  4XQW A;  2D6P A;  4M3C E;  3VZN A;  1WCS A;  2ZX1 A;  4AL9 A;  1V9U 3;  4YW5 A;  1CAV B;  5A7S A;  3T1L A;  1Q56 A;  3WHU A;  1SBF A;  2LTN A;  4LLO A;  3O14 A;  3K48 A;  3U10 A;  1QJF A;  1ZX5 A;  1XNT A;  1W8O A;  3POY A;  1AR9 3;  3VKL A;  3SH5 A;  4LBN A;  2VW1 A;  2WQ8 A;  4FP3 A;  2B9U A;  2OZ6 A;  3P6B A;  3KT7 A;  3VKF C;  3OPT A;  4XDQ A;  3IMM A;  1OOP C;  1PMH X;  1R08 1;  3KQ4 B;  1GP4 A;  1QXR A;  3MPP G;  5ACA 2;  3B5L B;  1MQT C;  2W2I A;  3M3C A;  4OZO A;  4XTM A;  4XFI A;  4R9C A;  5E8A A;  3I2K A;  1F35 A;  3ZFE A;  1HJG A;  2QTW B;  4RSU A;  1SLB A;  3VHP A;  4UT5 A;  3V0B B;  2VUA A;  4NE9 A;  1QJU 2;  1ZBA 1;  2TBV A;  2AEY A;  5FLH A;  1V6O A;  2JWP A;  1AR6 3;  4MGY E;  1NLS A;  1T6B X;  1OH3 A;  2VNG A;  3TEW A;  2ZX0 A;  5JZG B;  3QH7 A;  4IGP A;  1NZI A;  4FI9 A;  3HT1 A;  4C90 A;  4I0W B;  2D3R A;  3FLT A;  3NST A;  4PDW C;  4FXK B;  4FPC A;  5ANQ A;  2HYK A;  3USU B;  3VUO A;  2JKX A;  3ZLI A;  5C9A B;  3AJZ A;  3DPR C;  3NNM A;  4WV8 A;  3DXU A;  1ND3 A;  4B7E A;  1LU2 A;  5FO8 B;  1SPP A;  1LOG A;  3S5Q A;  1W9T A;  5T3N A;  5AVP A;  2PA7 A;  1MQT A;  1DZQ A;  1K12 A;  2O1Q A;  5FP4 A;  1QJX 2;  2W1W A;  2JEM A;  4LKE A;  5T54 A;  3S7E A;  1MS4 A;  1JZ3 A;  2YFZ A;  3PIJ A;  1MS3 A;  3NAP C;  4XVH A;  4XUN A;  3WW1 A;  4GAZ A;  3FBM A;  4A45 A;  5LCW L;  4NRM A;  4QM8 A;  4LOR A;  3KF5 A;  1VJ2 A;  2GNM A;  1CZS A;  4LKS A;  2O8O A;  4P00 B;  5FJK A;  5FLJ A;  3U1X A;  4MGT A;  2CAV A;  2XKO A;  4AQ6 A;  1W05 A;  3WVJ A;  3ZPO A;  2HWC 2;  2WFF 1;  1RB8 G;  1RIR A;  1LHW A;  1QKQ A;  2DU1 A;  3IIA A;  3NJV A;  3BOP A;  3OD4 A;  3ZVX A;  5IYY A;  5ANN A;  5JCT A;  1PIV 2;  3AKR A;  2WZR 2;  3IB3 A;  5B2G B;  2FCV A;  1DYK A;  1APN A;  4XFB A;  4BQX A;  3BTX A;  2VMF A;  4JV4 A;  4SLI A;  4BA6 A;  5AFB A;  1RUC 2;  2WT2 A;  5EJZ B;  4AVB A;  4IUG A;  1EV1 2;  5A6Q A;  1RJ7 A;  3J7L A;  4XJU A;  4EWA A;  2HEV F;  1W6M A;  1PZ9 A;  3VN4 A;  3IDB B;  1O5L A;  2RMU 2;  4IV3 B;  3B93 A;  3I3B A;  3UES A;  3N7K A;  1NA1 A;  3C7O A;  3JCI A;  4LBQ A;  3U14 A;  3H3L A;  3VBR C;  4OHV A;  3WF4 A;  4CZS A;  2RHP A;  4XYX A;  2QVS B;  4IEO A;  3U37 A;  4XXP A;  3AZX A;  1YHF A;  3ZXE A;  1S1A A;  3ZSE A;  4CP0 A;  1BEV 1;  3SIT A;  5HCB A;  5EJ1 B;  1DBN A;  1PVC 2;  5FYH A;  1V6M A;  4V2W A;  2VW2 A;  3LCP A;  2QZ3 A;  2Y6J A;  3AFG A;  2ZX2 A;  1XU1 A;  2QQM A;  2YV8 A;  4N53 C;  4RFT 0;  3O1S A;  4QU2 A;  4Q8K A;  1GOG A;  2RDR A;  5A1A A;  1XQN A;  5IFP A;  3TRS B;  5LB6 A;  2Q5T A;  2WYF A;  2WBK A;  2WZP P;  1GV9 A;  4XDO A;  1EUT A;  4XZP A;  1RC6 A;  5FZE A;  5LEK A;  2YG0 A;  2R04 2;  1RUG 3;  1ACC A;  2XWJ B;  1UU4 A;  3AKP A;  1GUI A;  2B45 X;  3R0R A;  2WT0 A;  3D3A A;  4IQP A;  2DBI A;  1V6I A;  1SHW B;  1EAH 3;  2GP5 A;  3EHK A;  2ATF A;  3RYK A;  2BVV A;  4LUM A;  4W65 A;  1UX7 A;  2BQP A;  2JG9 C;  1UXX X;  1K45 A;  2BFU L;  3B69 A;  1W28 A;  3KQR A;  3DYM A;  3WEZ A;  2UU8 A;  1OQ1 A;  2JD9 A;  2A71 A;  4LEJ A;  4GQ7 A;  5FPV A;  5FRA A;  5FZL A;  3S5A A;  4O65 A;  5BNP C;  3A0N A;  1H8T A;  3RG0 A;  4Z1V A;  3RZG A;  2BP6 A;  2NPI A;  2IC1 A;  2CGN A;  4QPI B;  5H9P A;  4WM7 A;  3ZO0 B;  1H2N A;  2JDH A;  3VBO C;  2DTW A;  3F95 A;  4FPY A;  2QDR A;  3TEY A;  1WLC A;  2RJK A;  4IE6 A;  3OEB A;  5A7W B;  3DCQ A;  3T0D A;  3CHX A;  2ZMN A;  4JGZ A;  2R07 2;  3KV5 A;  1PGW 2;  4LKD A;  1Y9G A;  1VAV A;  3TNP B;  4BZ4 A;  4KWU A;  3ACH A;  3NO8 A;  1LKN A;  2XUE A;  2R30 A;  2D93 A;  1QHD A;  5APA A;  1OUR A;  1BBT 1;  1ZBE 3;  1SAC A;  2BVB A;  4YM0 A;  3OPZ A;  1WCU A;  1OF3 A;  3PUS A;  1REE A;  1XB9 A;  2RS3 1;  2WA3 A;  5C3Q A;  4Q0S A;  4B4Q A;  3SH3 A;  2VNR A;  3MW2 A;  3JBG 2;  1PX3 A;  3ENR A;  3UL2 A;  1D4V B;  1N1S A;  2P3I A;  5EYX A;  5A7O A;  1OC1 A;  5C3P A;  1JYX A;  3GBF A;  3VDA A;  4P9L A;  5A32 B;  4BQ5 A;  2JEN A;  1FXZ A;  1Y9Q A;  5J98 B;  3ATG A;  1VBA 3;  1YNA A;  1QXJ A;  1YFW A;  5T5J A;  1H4G A;  1GWL A;  3DKW A;  4QQ2 A;  1WCD J;  2ZAB A;  3Q8B A;  4PBO A;  3I2D A;  3VL9 A;  2SLI A;  1OUS A;  4D3W A;  1DGR A;  2PHU A;  5BNN A;  2XJQ A;  4MXV A;  2WJS A;  2OW4 A;  5GM0 A;  4QQP A;  3U78 A;  1RUD 3;  3DF0 A;  1VMF A;  1VE0 A;  4W50 A;  2VOX A;  5FZO B;  3PUH A;  1V6L A;  1AX0 A;  4XUO A;  3USU A;  2RV9 A;  5KWR A;  3OGR A;  5ABJ C;  1VMH A;  2VZT A;  3VLB B;  4EE2 A;  1BCX A;  5DAV A;  1AR8 3;  3NW4 A;  4FPL A;  3KV9 A;  5J96 B;  1JBC A;  4HKW A;  3OYW B;  1TMF 2;  1N3P A;  1QH6 A;  1YO8 A;  2XHK A;  5JLV A;  3V0A B;  2ET1 A;  3POG A;  1RUF 2;  1UZW A;  3H1M A;  5J7M A;  1GWK A;  4HSL A;  2YU1 A;  1NLQ A;  3B00 A;  4RQP A;  3AP7 A;  2VXJ A;  4EV0 A;  3BI3 A;  4Y22 A;  5DZE A;  1ZA4 A;  5FYU A;  4E4Z A;  3I49 A;  1X8E A;  3FFQ A;  5EP9 A;  4H55 A;  2MEV 2;  3RMX A;  4Q4X 2;  3T09 A;  2XPJ A;  3HPN A;  5FZM A;  3RZK A;  5CB7 A;  4OHY A;  1HQN A;  2Q1M A;  1COV 2;  1PZ7 A;  2NMO A;  4HAN A;  1O3S A;  5A3M A;  4B4P A;  1ULE A;  2PHX A;  3CJI B;  2VZR A;  2JDP A;  5D21 A;  4R9B A;  1GMM A;  4TSV A;  4BQ4 A;  3CEW A;  1J1T A;  3BTZ A;  2YMZ A;  2XKP A;  1CES A;  2YFU A;  3C7E A;  2DCY A;  4FPH A;  1QDC A;  3THT A;  2AZ5 A;  3W9A A;  3ZYG A;  3HQX A;  1LOE A;  1XNC A;  4NHM A;  3O0W A;  1D7P M;  1JU3 A;  3K4A A;  5EV7 A;  1V6J A;  2ZGR A;  3PME A;  4L0P A;  5B4X A;  5I0R A;  5JOY A;  3MDP A;  4U2A A;  3JQX A;  2VO5 A;  3OEA A;  4FPG A;  4N9I A;  3H9A A;  3ZXL A;  2UYA A;  1JZ4 A;  1OKQ A;  4CDQ C;  3GYD A;  4QPY A;  1E5S A;  4CUG A;  5FR3 A;  3R05 A;  4A4A A;  5A1F A;  1HDK A;  4Y24 A;  4X6R B;  2HWB 1;  1ND2 A;  4GH4 C;  5HXV A;  1J84 A;  4JAA A;  4M01 A;  1RXF A;  4FVV A;  3T4H B;  4FBF A;  1Z7S 3;  3ZN5 A;  1OQE A;  3B3Q E;  4GB3 2;  5KBF A;  4CTE A;  1ZRC A;  1LHO A;  1ZBA 3;  5FZG A;  2VZ3 A;  3VBU A;  1YC6 1;  2YC2 A;  3BCW A;  1CX4 A;  4Q8L A;  4XJ9 A;  1F5J A;  4TZD A;  4QPW A;  2WZE A;  4QB2 A;  1S0F A;  3QD6 A;  2WWS A;  1M06 G;  1BK0 A;  2VBB A;  1U5Y A;  3ZN6 A;  5IVB A;  1XXN A;  1DYO A;  1TEI A;  4JTN A;  4KG0 A;  4KNC A;  3E6B A;  3LSE A;  3IZO A;  5JXG A;  3W58 A;  4QKB A;  1QJX 3;  4UFK A;  2ADE A;  2Y26 A;  4Y5Z 0;  1GP5 A;  3RZZ A;  3DEM A;  4QM9 A;  1CR7 A;  3LEK A;  1L7R A;  2X29 A;  4N7I A;  4MGI E;  5J48 A;  1LOC A;  3RWK X;  4MYE A;  4HVR A;  4JVA A;  4NAO A;  5JVV A;  2J1E A;  4IV1 A;  2HWC 3;  4UYB A;  2GME A;  5FRE A;  2CHH A;  3EMR A;  3MYX A;  4ASM B;  2CNA A;  1W2T A;  1PGL 2;  2PLV 2;  1PIV 3;  5C4W B;  2WZR 3;  3N7M A;  3FLP A;  3PVB B;  1XND A;  2BU9 A;  3Q9O A;  2NM1 A;  4QPG C;  4ZU5 A;  5A3N A;  4N43 C;  4M0N A;  4QU1 A;  5LK5 A;  1NY7 1;  3VDD B;  1RUC 3;  1GOH A;  2VOV A;  1WME A;  1EV1 3;  1QY4 A;  3LQC A;  4R4X A;  4LBJ A;  1AYM 1;  1NCR B;  4CU7 A;  5CAZ A;  4MV2 A;  4MSV A;  3IM0 A;  1RIT A;  1WMD A;  2ES3 A;  2WUH A;  4D7Y A;  1CIY A;  1GFF 2;  4IEU A;  5LA0 A;  1HXS 1;  1AVB A;  1ZVF A;  2C1F A;  4X8P A;  4XAB A;  1UAI A;  2DCJ A;  5FP8 A;  5K0U B;  2YBP A;  4HVO A;  2UY9 A;  2Y0O A;  4Y1V A;  3ZIX A;  3AVR A;  3S7I A;  1N3O A;  1UOG A;  1UYX A;  3MW4 A;  1HB1 A;  3OG2 A;  1PVC 3;  1JHN A;  4Q4Y 1;  1WWY A;  4QQH A;  1NE6 A;  2G19 A;  2OQ6 A;  4JKM A;  4QDQ A;  2YRO A;  1AJK A;  3VBS C;  3FFZ A;  4FQ4 A;  3WCS A;  1OFS A;  3HNY M;  4QPG A;  4QD2 A;  2DVB A;  1HB4 A;  5I0S A;  1DZT A;  1JUH A;  1VB2 A;  4QGM A;  1V9U 1;  2XLA A;  1Q8O A;  3FUO A;  1ST8 A;  3HT2 A;  1BEV 3;  4BE3 A;  1CAX B;  1QGL A;  1XRU A;  4JDM A;  1PO1 2;  1G9A A;  1G9C A;  3H7J A;  4U36 A;  2HWD 2;  4Z8B A;  2R04 3;  1NCQ C;  4Y1Z A;  2JB8 A;  1AR9 1;  2JG8 A;  2ZTN A;  4PIY A;  4TXW A;  4IES A;  3AL6 A;  4CXY A;  2HEW F;  1X9T A;  4X6Q B;  5K4L A;  4D0Q A;  4JRL A;  4Q26 A;  2VTX A;  1QIQ A;  3SKV A;  1BYH A;  4MXW A;  3MW3 A;  5BY5 A;  1W8N A;  1JI6 A;  3I4I A;  3V0A A;  1U12 A;  3WG2 A;  1E5R A;  2XUM A;  4HON A;  2A3Y A;  1Q8Q A;  5DMY A;  2EXH A;  2YHJ A;  3KLS A;  2CWM A;  3PJQ A;  4GWN A;  4YVW A;  3FX3 A;  5LRR A;  4RR3 B;  3ZSJ A;  3S30 A;  5K9Y A;  3H3Z A;  5FZB A;  4YG0 A;  3U4S A;  2JX9 A;  1AL2 2;  1AXY A;  3IBM A;  2GN3 A;  3N9L A;  3WDU A;  1AR6 1;  3RYR A;  3ZOI A;  1TNF A;  1KS5 A;  1DLL A;  2R07 3;  2LRP A;  3ELN A;  3KT4 A;  4E2G A;  4OHZ A;  3I54 A;  4NPM A;  1YEW A;  3HWJ A;  4FFG A;  4GWJ A;  2OZJ A;  4DPN A;  1H2M A;  1JXN A;  4NAM A;  2RS1 2;  5T52 A;  1W6P A;  4WM8 B;  4RFR B;  1FT9 A;  1BQP A;  1HN1 A;  2PQS A;  2IXC A;  2ZGS A;  3ACG A;  3B02 A;  3POW A;  4KL1 A;  1HB2 A;  2UYB A;  2AEZ A;  4MET A;  4PLN A;  3VL8 A;  4J6G A;  1VMJ A;  3CQO A;  4NIH A;  3CL1 A;  4HL0 A;  1S0I A;  3JB4 C;  2Y6K A;  3EO6 A;  4XUT A;  3L2Y A;  2SBA A;  3X29 B;  4A7K A;  2BWA A;  2VMH A;  2XLG A;  5AC9 3;  1ZZ8 A;  4NMI A;  3WCR A;  3VD3 A;  2RS3 3;  3IDE A;  5EFU A;  2WLP A;  1FPN 2;  1RHI 2;  3GZT B;  4XF4 A;  5FQ0 B;  3W21 A;  4AZZ A;  1L7Q A;  1NUK A;  2Z4F A;  4LHS A;  1KQR A;  3SXW A;  4JDO A;  4JHZ A;  1NX9 A;  5FDB A;  1KDK A;  5A3O A;  1VBD 2;  3VHN A;  1W9S A;  3GHM A;  2G4I A;  3J8F 2;  4HLT A;  5DUX A;  5GZF A;  1G86 A;  4IGO A;  3ZXK A;  5T5L A;  3VZL A;  2WNO A;  4LO4 B;  1OD5 A;  2WKK A;  3P3P A;  4GA9 A;  1C8M 3;  1KEX A;  4Q4W 3;  2RM2 2;  3GGL A;  4YW4 A;  1CZT A;  3S6P A;  1F9K A;  2VU9 A;  4XJW A;  2LM3 A;  1JTZ X;  2WNU A;  2ZKL A;  1A34 A;  1OXC A;  4A3X A;  4IEP A;  4DO0 A;  4CUB A;  2Q8D A;  2IFR A;  1M4W A;  1DLC A;  2PN5 A;  1RUF 3;  1RMU 1;  2ADD A;  1OF4 A;  2Y38 A;  5DQ0 A;  1RUJ 2;  1XJA A;  5FKB A;  1ZZ9 A;  3HNM A;  4UF0 B;  1R1A 2;  4CEW A;  2Y6G A;  4Z2A A;  2PAE A;  2V09 A;  4GUL A;  5A3P A;  1QEX A;  2XJR A;  4CYD A;  3BVC A;  4Q4X 3;  2QQN A;  2GAU A;  2R0F A;  4NII A;  4AI0 A;  2YDE A;  1SQ4 A;  1RL3 A;  4NRP A;  1COV 3;  3P5B A;  1FMD 2;  5IK5 A;  3EB7 A;  4LHK A;  5L7O A;  4GWM A;  1NZC A;  2R32 A;  1Q8S A;  2F17 A;  2FHR A;  4FPK A;  4OMC A;  4CP1 A;  2A75 A;  2UUR A;  3I3Q A;  3T0B A;  3H8R A;  4YZ3 A;  1S2B A;  4I2O A;  3BOD A;  1NXM A;  2WSU A;  3AKQ A;  5FLI A;  2PEL A;  4A2U A;  4EZH A;  1POV 3;  2WO7 A;  3AMM A;  1HIX A;  1RUG 1;  2E63 A;  5KHI A;  3WP5 A;  2IZW A;  2D40 A;  4OCT A;  1XSR A;  3LDK A;  1QDO A;  4BLJ A;  3LGR A;  4KI5 M;  4C0B A;  1MS9 A;  5C5T A;  4AF9 A;  1RXG A;  2VMI A;  3AZW A;  1KRI A;  2VEC A;  3KMH A;  2DVG A;  4BJ0 A;  2RR1 2;  3QBQ A;  1JYV A;  1GNH A;  1JZ7 A;  2JJ6 A;  2AUY A;  5K0U A;  4DMI A;  4OUM A;  1UKR A;  4AQT A;  1J58 A;  1OQD A;  1UIJ A;  5FMC A;  4ERO A;  2YBK A;  2P37 A;  3FMG A;  3WUC A;  2B8M A;  4KMQ A;  2AH2 A;  3BTY A;  2ARE A;  3MEP A;  5CVR A;  1S2K A;  2TEP A;  1LES A;  4DY5 A;  3T1M A;  3DN7 A;  1CWP A;  3ON7 A;  3PMS A;  3N36 A;  5IJR A;  4JDN A;  1I5Z A;  2ZGM A;  4BH9 A;  4FTE A;  3UJQ A;  5CIR A;  3U4X A;  4QGL A;  3RQ0 A;  1PK6 C;  1DU3 D;  4XFH A;  4SBV A;  1NOV A;  1ULC A;  1ZBE 1;  2ZGO A;  3VHO A;  2QQJ A;  4LO6 B;  4E9K A;  3AKT A;  1HJF A;  1C1L A;  4JQT A;  2FDI A;  5FY1 A;  1NG0 A;  3R4U A;  2ZAA A;  4CCM A;  5IAT A;  3LD8 A;  1YQ6 A;  5F37 A;  5FFO C;  1I5P A;  3WDY A;  5ABJ A;  3VBH C;  5FO9 B;  4FT8 A;  5JMC A;  1W6N B;  2ZGN A;  4UBG A;  1RUE 2;  3C3V A;  1OA2 A;  2C9A A;  4JTO A;  2IXH A;  2VQU A;  1YJL A;  4PDW B;  2G9F A;  2DWR A;  1VBA 1;  1YCI A;  3WNP A;  1W2U A;  5JUV A;  1HQW A;  1X82 A;  4QHO A;  4XF1 A;  5HV4 A;  5L19 A;  2V72 A;  3DPR B;  4AGR A;  3ZKY A;  1RUN A;  1NE4 A;  4AFA A;  3NV2 A;  4C91 A;  3PLQ A;  4AWD A;  1PK6 A;  3LPF A;  5CFD C;  2VBP A;  2VVE A;  2XON A;  1W39 A;  3J4U H;  5C8C C;  5LA9 A;  4AI9 A;  5I0D A;  1UY4 A;  1KDM A;  5IHR A;  3Q8E A;  1H2K A;  1S4C A;  2GDF A;  1C5H A;  1DFQ A;  1G6N A;  1HRI 2;  2I2S A;  2JDM A;  3TNQ A;  1JS9 A;  2A3W A;  4NRQ A;  3BGA A;  1JYI A;  3M70 A;  1AYM 3;  4A42 A;  3UET A;  4UOJ A;  2VVD A;  3C7H A;  4HZF A;  5JPN B;  3MZH A;  2QZ2 A;  3RPQ A;  1LHU A;  3AXE A;  1JH5 A;  3R4S A;  4KBZ A;  4QAW A;  4BB3 A;  2DUR A;  4QDR A;  2PTM A;  1WCQ A;  3LFM A;  2WN3 A;  5FUP A;  5FPB A;  4BCU A;  1K5M B;  2X5I A;  1Q5O A;  2BWC A;  4CDU B;  2DVD A;  2VQT A;  4OYU A;  4ZS3 A;  4CP9 A;  2RS5 3;  2VZ1 A;  3OGS A;  2IXK A;  2YC4 A;  3O1O A;  1D2S A;  4NHK A;  3ZFE C;  4RGA A;  2HWF 3;  5F7U A;  1XBF A;  4Q4Y 3;  4ZS2 A;  2R1B A;  3I2H A;  3FLR A;  2EXI A;  1CN1 A;  1LRH A;  3OJB A;  4N9H A;  5F6L B;  2DTY A;  1WZX A;  4CU8 A;  2MNG A;  2HH9 A;  3CLP A;  3VBR B;  1B35 A;  1BKZ A;  2QQI A;  3IPV B;  4GWI A;  5FYB A;  1ZRF A;  1VRH 2;  5FZI A;  2WLQ A;  2VZP A;  5BNO A;  2D3P A;  3LEG A;  3NV3 A;  2DUP A;  5ACA 1;  5FV3 A;  4C1X A;  3WDV A;  2VXR A;  4YW1 A;  3WW3 A;  3VKO A;  1GZW A;  4YVS A;  1WW5 A;  1L7L A;  1LGC A;  3J7M A;  4YW2 A;  2O14 A;  5H9Q A;  1IGO A;  2VM9 A;  4N53 B;  1ND3 C;  4DEV A;  1QJU 1;  1QMJ A;  3OGV A;  1AL2 3;  3T2P A;  4LIU A;  1VBE 2;  3ZFF B;  2WAO A;  3K77 A;  3KCX A;  4A6O A;  4Y1U A;  2ZX3 A;  4Y4Y A;  1Z7S 1;  1LCL A;  3MV1 1;  3HVD A;  1SBE A;  3N9N A;  2QFE A;  3Q8F A;  1W90 A;  4QXB A;  2W87 A;  3T3Y A;  4CDW A;  2YUE A;  4LJH A;  5ISL A;  1HB3 A;  4BOW A;  4AI8 A;  3GHN A;  2JG9 B;  2WR9 A;  1UOJ A;  4LLF A;  1WA4 A;  3BKZ A;  4L97 A;  5CFC B;  2WWJ A;  4B4R A;  1SDD B;  1C3H A;  4BLI A;  2QQP A;  3ZFG A;  5BNP B;  1CVN A;  1O4Y A;  1QU0 A;  4UW6 A;  1EP0 A;  3BB6 A;  4OI4 A;  1QJX 1;  4UFI A;  5EJ3 A;  5LBC A;  4AAP A;  4K8R B;  3VBO B;  2XL7 A;  5J37 A;  3AYC A;  5FUN A;  1GBG A;  2NYY A;  1OKO A;  2BER A;  3AKS A;  2QDN A;  1O3T A;  1RHI 3;  4CEY C;  5CEH A;  1GQP A;  1HV0 A;  4Y20 B;  3HR9 A;  2F4L A;  3T2Q A;  2BYV E;  4HN1 A;  1BMV 2;  4P14 A;  3ZYF A;  5IK8 A;  1JW6 A;  4MHU A;  1RTV A;  2IXJ A;  1AR7 2;  3RI9 A;  3VDB A;  1SLC A;  2OII A;  2PHL A;  3F2Z A;  1UOB A;  2HBU A;  2HWC 1;  4X8N A;  4FOW A;  4CDX A;  2V4A A;  5F5A A;  2XOM A;  4OUE A;  1BZW A;  1NA1 C;  3W20 A;  1AX1 A;  4IEW A;  4COU A;  1IKP A;  5JSO A;  3THP A;  4XFC A;  1PIV 1;  1H1M A;  2WZR 1;  2YY1 A;  1BVV A;  3B7M A;  5IVV A;  2D43 A;  1CJP A;  3POS A;  1RUC 1;  4AFB A;  4DUV A;  3H3U A;  4LTA A;  3ZYI B;  1EV1 1;  4P5Y A;  4OI2 A;  3KVA A;  1DYP A;  3LE0 A;  3MFA A;  1QJE A;  3L9J T;  2RMU 1;  4QX2 A;  3ZPY A;  2P3K A;  2VUL A;  3LFI A;  4JGY B;  1W8W A;  1RUJ 3;  1R09 2;  2B5H A;  4LHL A;  3SLI A;  2FDF A;  3URF A;  3KB5 A;  4URT A;  2D5H A;  1AYN 3;  1N1T A;  2XWB B;  3MFC A;  3CO2 A;  4NJ4 A;  3NVC A;  5FZ7 A;  1S0E A;  3AFK A;  4CEY A;  2WAB A;  4FPJ A;  1UY3 A;  2Y34 A;  1A8D A;  4MAD A;  4NHX A;  5IWF A;  2Y0I A;  2P17 A;  1W6N A;  1QQP 2;  2LS6 A;  3MIH A;  3A22 A;  1RMU 3;  3H8X A;  4LUL A;  2B7Y A;  3JU9 A;  4GD4 A;  2F4P A;  3ZYH A;  1SEF A;  3RDI A;  4AHX A;  2WNV B;  4HKL A;  1PVC 1;  2V73 A;  4WVZ A;  3ZXG A;  5CG9 A;  1A6C A;  1G9D A;  4CCO A;  3N9O A;  1PVX A;  1ULD A;  2GH2 A;  5FYY A;  2OX0 A;  4AFC A;  5A6Z A;  2BPA 2;  2FZ2 A;  1I3H A;  1HQL A;  5FXV A;  2Q4S A;  4TLF A;  3E6C C;  1JZ2 A;  2IUW A;  1H8T C;  5A3L A;  1H4H A;  1ZRI A;  2XLF A;  2B46 X;  1YIF A;  4WM7 C;  2R04 1;  4RHV 2;  4LO7 A;  4NVP A;  2W91 A;  3NNF A;  1BK1 A;  4UBH A;  1VIW B;  2ZKN A;  1PX4 A;  4LHN A;  3WDX A;  2RJ2 A;  3M7A A;  4AVA A;  4ZZ5 A;  5FZC A;  1K5J A;  1U0A A;  4OQ9 A;  1U5Z A;  2D6O X;  1C4R A;  2CL2 A;  2WQZ C;  4JGZ C;  1CAW B;  2J22 A;  2ZAH A;  4EN9 B;  1YXW A;  3UGG A;  5F3E A;  4GIQ A;  3SCH A;  4BME A;  1VAK A;  4P9G A;  5T5P A;  4Y1Y A;  1UWW A;  4COV A;  2LRO A;  1J3Q A;  1X36 A;  4COY A;  5FPX A;  2VJX A;  2IVJ A;  1K3I A;  1DCS A;  4QXK A;  5IT6 A;  2EA7 A;  5I0U A;  3OGJ A;  3OBR A;  1H1I A;  1VBB 2;  1PO2 2;  4E2S A;  1O8S A;  1W6Q A;  3KCC A;  2R07 1;  1NAE A;  3AP6 A;  2WRA A;  1PGW 1;  1IPS A;  1K5M A;  1RVF 2;  1ZRR A;  3O12 A;  4NO4 A;  4CDU A;  1IG3 A;  3WF0 A;  1W6O B;  4CVU A;  3LB9 A;  4YW6 A;  2D3S A;  3HNB M;  3ST7 A;  3WW2 A;  3JB8 A;  1SLI A;  1JYW A;  1NKG A;  1Z78 A;  1US3 A;  3DKQ A;  3OY8 A;  2FZ1 A;  4IE4 A;  5A33 A;  4CDQ B;  2EXK A;  1Q3E A;  4Q0U A;  1Y9M A;  2R7E B;  5BNN C;  1ONA A;  3N7J A;  4L2N A;  1CAV A;  2ZX4 A;  5EPA A;  4BM8 A;  1H6X A;  1F5F A;  2AAC A;  3M3E A;  4I09 A;  2A6W A;  4Q29 A;  4QHB A;  2XGX A;  1OLM A;  3I3E A;  4G4F A;  3JBG 1;  4GH4 B;  5DZF A;  5E16 A;  3AP9 A;  4FXG B;  5EXO A;  1OA4 A;  4GMP 0;  1F4A A;  5AC9 1;  1LUL A;  3D5O A;  4H2A A;  1OVS A;  1LAJ A;  1RUO A;  3ILR A;  3QOP A;  1H8V A;  2VL4 A;  3ZM8 A;  1XU2 A;  3H50 A;  5CKN A;  3GBG A;  2EF6 A;  4QB6 A;  1XYN A;  3ZDS A;  2W3J A;  5HPO A;  1S0B A;  3POJ A;  1OH4 A;  3R6S A;  3ZFF A;  4FOQ A;  4W6Y A;  2OKX A;  4L11 A;  4QDS A;  1XSQ A;  4DUX A;  3ALQ A;  3ECQ A;  1W8Z A;  2E31 A;  4RQP C;  4ZPI A;  3VD4 A;  4E27 A;  3PUR A;  5FY0 A;  3V0B A;  4Q4W 1;  1C8M 1;  3JD7 2;  4BQ1 A;  4NN0 A;  4QQO A;  1J83 A;  4AHW A;  2OQ7 A;  2W92 A;  5GZC A;  2B9V A;  2QQL A;  4B3N A;  1DQ1 A;  1TME 2;  5CNA A;  5L36 A;  3NJZ A;  5DAX A;  1W8F A;  5CFC A;  4DXR A;  5JZG A;  5A3T A;  4S2G A;  1BBT 2;  1J3R A;  5FPZ A;  3VBF B;  1WCK A;  1H9W A;  1RUF 1;  3BIE A;  4XQ4 A;  5KXC A;  4PF5 A;  4AHY A;  1JYC A;  3RFR A;  5C9A A;  2A73 B;  2FDK A;  2TUN A;  1HLC A;  2WDB A;  1O3Q A;  4BIO A;  2W47 A;  4ASL A;  3BUC A;  3DGT A;  3SCG A;  2EIG A;  2MEV 1;  1UMI A;  4Q4X 1;  4EWE A;  2OVU A;  2P3J A;  1KGY A;  4Y20 A;  1COV 1;  4N43 B;  4AOC A;  4W6W A;  4AFM A;  1G7Y A;  1D4M 2;  1V6K A;  5DUV A;  3FHQ A;  1E5H A;  3RVH A;  1A78 A;  4QWN A;  2ZZJ A;  4YZ4 A;  1SBD A;  4HK8 A;  2P34 A;  4A41 A;  4DZG A;  4MOA A;  5F2W A;  1SLT A;  5HXM A;  1DGR N;  1W06 A;  4AXO A;  1KFX L;  5FZ0 A;  5A3W A;  4P5H A;  4K1Z A;  1ND2 C;  1POV 1;  3ZR6 A;  1VB4 A;  1HKD A;  3MLL A;  5FAX A;  1XNA A;  3LOB A;  5JI7 A;  1DP0 A;  2QJV A;  1VRH 3;  4HET A;  4KBB A;  3SIS A;  1H0B A;  2FBE A;  3T4V A;  2QKD A;  5DG2 A;  3IT8 A;  2OPW A;  2ZHL A;  2WQ4 A;  4OQ8 A;  1EY2 A;  1HX6 A;  2ZOE B;  2AC1 A;  3VBU C;  1CQ9 A;  3FC0 A;  2V5Y A;  1PM4 A;  3VBS B;  2E53 A;  1RJ8 A;  1BXH A;  2NN8 A;  4BQ2 A;  1ZRE A;  1I9R A;  5ACA 3;  3I2G A;  4XJZ A;  3WNN A;  1UXZ A;  3B94 A;  4IV3 A;  4MX3 A;  3NV4 A;  3RWN A;  4QKF A;  5FYC A;  2C26 A;  3LIH A;  3OGG A;  2HWE 2;  1NCQ B;  1OLM E;  1W04 A;  4GB3 1;  5F6K A;  3ZXJ A;  3HQU A;  4PQQ A;  5FZH A;  4K1Y A;  4NR1 A;  1QJU 3;  1CIW A;  1KJL A;  2VUJ A;  5DAB A;  5HCH A;  5I8Y A;  1XYO A;  2JB4 A;  5T50 A;  4TN7 A;  1LOA A;  1VR3 A;  3LZZ A;  3TWI A;  2ID4 A;  4IEX A;  2WS9 2;  3W5M A;  5IVF A;  3OD0 A;  3IDA A;  4V1P A;  4Y3O A;  5FY5 A;  5T5O A;  3PVN A;  1CPM A;  4D8M A;  4QPI C;  1POV 0;  4IV1 C;  4NWW A;  5BV6 A;  2A6Y A;  3FJS A;  3PNA A;  5DZG A;  1WUV A;  2XG3 A;  2ERF A;  2HEY F;  3PTR B;  4RS5 B;  3P3N A;  4Q5O A;  4AED B;  3ASI A;  1UU5 A;  1ZA7 A;  3NKG A;  1VAL A;  4WVM B;  4KU7 A;  2IXL A;  5LK7 B;  4XXA A;  1CAW A;  4YW3 A;  4XHB A;  3OUJ A;  2E7Q A;  2I74 A;  2WA4 A;  2XJU A;  2ZPX A;  4HBN A;  3IAP A;  3INA A;  4HFS A;  1JYT A;  1FOD 2;  1OHF A;  1S0J A;  3AMP A;  3AZZ A;  5GLW A;  1QJY 2;  1OMI A;  1AR7 3;  4PCR A;  2QQV A;  4JHT A;  4XCB A;  2AR6 A;  4XHX A;  4I02 A;  2NQY A;  3BU7 A;  4RGG A;  2VOW A;  1YJK A;  5A80 A;  3UK9 A;  3PU8 A;  1XPW A;  3LWC A;  3LDR A;  4BHP A;  2JDU A;  1PZ8 A;  2KR2 A;  2B42 B;  3DV8 A;  2ARA A;  3POB A;  2VE1 A;  2X8K A;  4QPI A;  4COW A;  2C0Z A;  2ET7 A;  4ZZ8 A;  1F8V A;  2HYX A;  3LA3 A;  1O5U A;  2J1A A;  5I93 A;  4F8A A;  3N9Q A;  4AR2 A;  4NIG A;  4Z92 B;  2FCT A;  3CF6 E;  1NXD 1;  5A7W A;  3WQ0 A;  1TG7 A;  3IWZ A;  4IEQ A;  4MGQ A;  5F3I A;  2XBO 2;  5FY7 A;  4D6Q A;  4DXS A;  5HCF A;  2KXL A;  1R09 3;  3THC A;  2A6Z A;  1XE8 A;  2IFW A;  2GP3 A;  2VZV A;  5HBA A;  5EWS A;  2E51 A;  2DCK A;  4L9B A;  1EPZ A;  2A6X A;  5LAT A;  3WZ1 A;  1GR3 A;  1NQJ A;  3K2O A;  2JDK A;  4D69 A;  5IK7 A;  2RMU 3;  4MLO A;  3WR0 A;  1LEC A;  2JG8 C;  2ZEX A;  4ATE A;  1REF A;  2DVF A;  2RDS A;  1KIT A;  3I3D A;  1UZZ A;  3V56 A;  2VMC A;  4AQS A;  5FZ9 A;  3CKH A;  4BK5 A;  4P08 A;  2G9Z A;  4QXC A;  1RUH 2;  5DPN A;  3K75 B;  4XIL A;  2QQK A;  3HAG A;  3IN9 A;  4XC9 A;  2BGP A;  3EJK A;  2RS5 1;  5A32 A;  1HRV 2;  4Q0Q A;  3ZYJ B;  2W9X A;  4YVW C;  1IPJ A;  3WHT A;  1W2O A;  2HWF 1;  1JZ5 A;  2HWD 1;  4P02 B;  1WD4 A;  4L92 A;  4RHV 3;  3W59 A;  5F5I A;  2CDO A;  3NJX A;  3WF1 A;  5J1X A;  4R8H A;  3AMH A;  3PTY A;  3IDC B;  4UWD A;  5DUW A;  4IER A;  4JRA A;  1JMU B;  4NID A;  3ZIW A;  5FXW A;  4TYS A;  2P6C A;  3MLJ A;  1X9P A;  5JDB A;  3K46 A;  4LIV A;  4XOG A;  3NV1 A;  4XPV A;  2FD8 A;  4NIA A;  5KR7 A;  1JOP A;  4N90 A;  4Q0P A;  5FZO A;  1AHS A;  4YZ2 A;  1H2L A;  5JMO A;  2HLE A;  3LEM A;  5KHG A;  4M3C B;  4QX8 A;  2BTV C;  5SV8 A;  1AL2 1;  3NQH A;  3OYW A;  4WVW A;  4EWD A;  4LKF A;  2X53 S;  2XJP A;  3ORJ A;  2H0V A;  4GMP 3;  1UMH A;  4AVV A;  1RUI 2;  1PO2 3;  3N7L A;  1AL0 G;  1ASJ 2;  3H0O A;  2PQQ A;  1LOB A;  3WX5 A;  1LU1 A;  5FYS A;  5C5U A;  3TYJ A;  1PM7 A;  5DAW A;  5FZD A;  3K4Z A;  3T2O A;  2GC0 A;  1S0G A;  3ES4 A;  4XIO A;  4CCD A;  1WA6 X;  3I2F A;  1CAU B;  3PVE A;  5CIS A;  4O7X A;  2UY8 A;  1UF2 C;  4AVT A;  1IG0 A;  4OMD A;  5G05 L;  4FTB A;  2ZS6 B;  1UOF A;  4LNV A;  5KHJ A;  1UZV A;  2XB6 C;  2ZCW A;  1FYU A;  1ENX A;  1WW4 A;  3CJI A;  3T0A A;  3V65 A;  4XMA A;  1W9W A;  3VB9 A;  3WF3 A;  4LA3 A;  1ZZ7 A;  3DUI A;  3OBT A;  5GAL A;  3T30 A;  2QQO A;  2X09 A;  4JZR A;  1MVQ A;  3AYE A;  3EBR A;  1KFU L;  4YWA A;  4Q1P A;  1MR5 A;  5LBB A;  2QNK A;  2XR4 A;  2P6H A;  3DEC A;  1SLL A;  1RHI 1;  1UQX A;  3D0J A;  3D6E A;  3GCX A;  2WNU C;  5FP3 A;  1D0H A;  1HW5 A;  3JBG 3;  2WNE A;  2XL9 A;  4MVT A;  3KVB A;  3ZXA C;  5LW9 A;  4ASK A;  4CCE A;  1XYP A;  2YB7 A;  4Z2W A;  2ARX A;  5EQU A;  4FFH A;  1V0A A;  2ZGQ A;  4CEW C;  1UU6 A;  1FNY A;  1UPI A;  1J1L A;  2D6N A;  4HN0 A;  3JD7 3;  4S2H A;  3VKM A;  4AW7 A;  5KC5 A;  4I30 A;  1W2A X;  4O9G A;  4B1M A;  4DNY A;  4HPK B;  4NWV A;  5F2S A;  1QNY A;  3CDZ B;  1KJR A;  3VBH B;  5L7O C;  1WLD A;  3N9M A;  3ILF A;  3JUU A;  5GLV A;  4DB5 A;  2BV4 A;  2CSG A;  1LOF A;  1GU3 A;  4ZKT B;  1TNR A;  2IWG B;  3E5U A;  1UYZ A;  2XHN A;  5IUQ A;  3TN9 2;  5JWP A;  1H6Y A;  2GNB A;  1RUJ 1;  2RDN A;  4AED A;  2P3Y A;  1OD3 A;  1ULO A;  1R1A 1;  4AK3 A;  5FZ6 A;  1NT0 A;  2DF7 A;  1AYN 1;  2Y64 A;  3J7H A;  3TB0 A;  1KD7 A;  4AI3 A;  2I45 A;  5C33 A;  1TMF 3;  2Q1F A;  3O1R A;  1ENQ A;  1EUU A;  2RVA A;  3C2U A;  3WDW A;  4CPB A;  4D7S A;  2DCT A;  2D98 A;  3KWV A;  3C8X A;  3AK0 A;  1L3J A;  1FMD 1;  1D4M 3;  2VUD A;  1NCR C;  4HMZ A;  5CFD B;  5KC6 A;  4P9W A;  4QKN A;  3WQ1 A;  4LO8 A;  5C8C B;  5ERL A;  3WUD A;  4E4H A;  3H8U A;  3ETQ A;  3KD4 A;  4IL7 A;  1IZ3 A;  4EN6 B;  2MEV 3;  2Z79 A;  2F6B A;  5JXH A;  2W5F A;  3KS7 A;  5D8A B;  5F8P A;  3LAG A;  2WFP A;  4A44 A;  2VOT A;  1DIW A;  2C6S A;  1V6N A;  3ACF A;  3AC0 A;  5FMB A;  1S55 A;  5K0U C;  2BBA A;  1W8U A;  4D7T A;  4LQR A;  3TOJ A;  4COZ A;  1EYB A;  3HN3 A;  4I01 A;  2W1S A;  4M4R A;  3C7F A;  4OUL A;  2EAA A;  2JEC A;  5JIA A;  4EN8 B;  3GZA A;  4WBB A;  4KWJ A;  5LY1 A;  5C4W A;  2D44 A;  4FP2 A;  2R06 2;  2WSV A;  3GZU C;  5LAS A;  3WNX A;  2CGP A;  3UGF A;  1JU4 A;  5JIU A;  3ZMO A;  3AP5 A;  3LKJ A;  3VDD A;  4E2Q A;  4WZC A;  2PHF A;  2ZGK A;  2VR4 A;  3MGU A;  2EIB A;  2W68 A;  5FYM A;  4GKX A;  5FKC A;  3LSD A;  1NCR A;  4NPR A;  2OUH A;  2NLR A;  3KHB A;  3UT0 A;  3WNL A;  2XJT A;  3C7G A;  4YAR A;  2Y6L A;  5FXZ A;  2DDU A;  3ZFE B;  3KSC A;  1GQH A;  5BPX A;  2OYZ A;  3Q8C A;  5CG8 A;  3ZSK A;  1C5I A;  3H1Y A;  4YYO A;  3D82 A;  4F3J A;  1SDW A;  5I8T A;  1T6G C;  2DYC A;  3VGI A;  3D0S A;  4HXC A;  4RR3 C;  4GB3 3;  1CD3 G;  4DRR A;  2G9G A;  4FOY A;  4AEK A;  2XVL A;  1JUI A;  2JDN A;  3M1H A;  1OOP B;  4NOT A;  2XXZ A;  4UW5 A;  2FDH A;  1SPP B;  1CAX A;  1RUG 2;  2R1D A;  5HI0 A;  1MQT B;  1YQ8 A;  4FPO B;  1MS8 A;  1YI9 A;  1RUE 1;  2JD4 A;  4FCA A;  2JE7 A;  1FOD 3;  4LBL A;  3TBD A;  4RGK A;  1EAH 2;  1ULG A;  2AGS A;  4A7Y A;  2Y8K A;  1S2E A;  4XFG A;  4BQ3 A;  2J7M A;  4BXF A;  4RA0 A;  4IDZ A;  4LBQ D;  5F3C A;  3SHR A;  1UY2 A;  2VUC A;  5GLT A;  2LUW A;  4FFF A;  2YGL A;  4MGS A;  1ULP A;  1W9F A;  4FAG A;  1VBC 2;  2Q30 A;  3GJA A;  2CY6 A;  1QXP A;  5JXJ A;  5DDJ 2;  2GH8 A;  2JDA A;  2XJS A;  4RR3 A;  2XJV A;  5JSP A;  2W1Q A;  3LPG A;  4NRO A;  3O1P A;  4OHX A;  3O0X A;  2PLV 3;  3ILN A;  2CV6 A;  4P9Y A;  2E32 A;  1LR5 A;  4YG6 A;  1O59 A;  2DUO A;  3RGB A;  2X5I C;  4AE2 A;  5FPU A;  3N4M A;  1FNZ A;  5FUI A;  1IS5 A;  1W8T A;  1BJQ A;  2RDQ A;  1O91 A;  5FP7 A;  2E26 A;  2JIJ A;  1W6M B;  4HG6 B;  1O4Z A;  4Y4R A;  2GC1 A;  5FZ3 A;  2ARC A;  3ROU A;  1V00 A;  3RJR A;  3BTA A;  4WM8 A;  3NAP B;  2D6K A;  1B35 C;  4UW4 A;  1AXZ A;  4YZ5 A;  3RZJ A;  4ES9 A;  4M0H A;  3OPW A;  4FPF A;  3G7D A;  5BNO C;  5IK4 A;  3D8C A;  3K51 A;  3RYP A;  3PU3 A;  5I91 A;  3JZV A;  2GAL A;  3QAC A;  3ZSM A;  3GBW A;  3KF3 A;  2VMG A;  3M3Q A;  4YVS C;  2ZGU A;  1HRV 3;  1DG6 A;  1QH7 A;  4M4P A;  3GF6 A;  5D1I A;  3RJ2 X;  4DY3 A;  4HK9 A;  1OLR A;  1YQ2 A;  4Q4V 2;  4AI1 A;  5FQ0 A;  2VQ0 A;  1C8N A;  2EAL A;  3EXU A;  4LXL A;  4QX1 A;  1IQD C;  1ZZ6 A;  4XFA A;  4BQW A;  1SFP A;  4CCJ A;  2VD7 A;  5DAQ A;  3PUQ A;  2EIC A;  2D6M A;  2ZGP A;  1ZYB A;  1RUD 2;  2KM2 A;  1MEC 2;  1VRH 1;  5AVA A;  5JR2 A;  4QGN A;  5F3G A;  5FXX A;  1PO1 3;  4BXS V;  4KGQ A;  5FJH A;  3AZY A;  5JPM B;  2HWD 3;  4OI0 A;  2VMD A;  2VZU A;  2VCB A;  3CNA A;  3E6D A;  3THD A;  5A6X A;  4DRV A;  5J3U A;  4CDW C;  1GQG A;  1AR8 2;  4IEV A;  2YYO A;  1YYN A;  3WP6 A;  4XUQ A;  2D7F A;  4N7U A;  1Z0H A;  3N9P A;  4FTS A;  3VDC A;  2A7A A;  4LE3 A;  5FZK A;  4UW3 A;  4Z07 A;  4DIN B;  3ZFG C;  3VD9 A;  1X50 A;  1H8T B;  4I0A A;  2DFB A;  4K9S A;  4WM7 B;  4KH9 A;  3FN9 A;  4UF0 A;  1UKG A;  3WNK A;  2CAU A;  4OFG A;  2DU0 A;  3NKT A;  5IFT A;  1X7N A;  4XUR A;  5GZG A;  5FZ1 A;  5JR7 B;  4K20 A;  2XQR A;  3KGZ A;  4XJA A;  5JSR A;  4MGK E;  3OUI A;  4YGB A;  4CDX C;  2WO1 A;  1QOO A;  3KV4 A;  2CU5 A;  1FV2 A;  5KXD A;  4BDV B;  2RS1 3;  1POQ A;  3LF7 A;  2K46 A;  4JCK A;  2B4K A;  5LBE A;  2BOJ A;  5FZ8 A;  3JXS A;  3BAL A;  3ACL A;  2R49 A;  5C71 A;  1LEN A;  4AFD A;  2OPK A;  1DQ6 A;  1O4T A;  3LDB A;  4O9E A;  1BMV 1;  1MZF A;  1JN2 P;  4KWL A;  5B4N A;  2VQA A;  3KV6 A;  1AR7 1;  5LZ6 A;  4UXA A;  1Y7B A;  1WBF A;  4I0B A;  1DGW X;  1QF3 A;  3FUQ A;  4LUK A;  3LEI A;  1ALY A;  4BIS A;  2QCS B;  2ZXQ A;  3HJR A;  4OUS A;  4OZX A;  1FPN 3;  1R08 2;  3GDB A;  4PLM A;  5E89 A;  4DIQ A;  3VHR A;  4EQV A;  4YFZ A;  3WQB A;  4DEQ A;  2W94 A;  1J59 A;  5BNN B;  1S0C A;  1UW8 A;  1Y3T A;  1SFY A;  1GSL A;  1VBD 3;  3ZSL A;  1Z7S 2;  3J8F 3;  1OT5 A;  5FMO S;  3E5Q A;  5IAV A;  3OOX A;  1ZBA 2;  4AYU A;  1WW7 A;  1KS4 A;  1PHM A;  3TN9 3;  4AI2 A;  1DHK B;  2RM2 3;  3AL5 A;  4D6S A;  1DQ5 A;  3POE A;  1R09 1;  3PUA A;  3H42 B;  3PDQ A;  2FMY A;  1OOP A;  3KZ4 C;  1XNK A;  1OBN A;  1MZE A;  5FPA A;  1QQP 1;  3TEX A;  3D4K A;  4RQP B;  4QMA A;  4GAL A;  1W9Y A;  4Y22 B;  1STM A;  2VPV A;  4J25 A;  5IVE A;  4I3P A;  1R1A 3;  1URX A;  4CUA A;  4LE4 A;  1ODM A;  3VD7 A;  4W6X A;  2O0O A;  2YBS A;  3AXD A;  3GNE A;  4ATF A;  4KU8 A;  4PIZ A;  1FMD 3;  4XUP A;  5F39 A;  4XF9 A;  3O1T A;  4LO5 B;  4PDW A;  1GNZ A;  1E5I A;  1FX5 A;  4Z82 A;  4H7M A;  3ITQ A;  4NPL A;  4RHV 1;  2TNF A;  2VVF A;  2O8Q A;  1WD3 A;  5ABJ B;  4HKO A;  4CCC A;  3A23 A;  2GMP A;  2YPJ A;  2HJI A;  4MZU A;  1LED A;  3DPR A;  5FY9 A;  1GAN A;  4MHR A;  3HEI A;  2BBV A;  2R06 3;  4EN0 A;  2MHF A;  2OA2 A;  2ARB A;  3BYW A;  1K5M C;  4E4D X;  4CDU C;  3M3O A;  3POI A;  2WFF 2;  1OVP A;  2AEN A;  4TWT A;  1PNG A;  1YUD A;  4HOO A;  3WG4 A;  2ZAC A;  5FY8 A;  4A3Z A;  2Z2S B;  1AJO A;  1NLR A;  1XNB A;  3AX4 A;  2C24 A;  2QUO A;  4D6R A;  1H1A A;  2QBX A;  2BNM A;  5FY4 A;  4XF0 A;  1YWK A;  3NAP A;  4YG3 A;  2PHW A;  4IEY A;  1GZ9 A;  2Y6F A;  2ZHN A;  4H7L A;  2BJS A;  2RR1 3;  1SMV A;  3NMB A;  4GMP 1;  5J09 A;  1VBB 1;  1PO2 1;  3UKN A;  3WP4 A;  2LW8 A;  5FZ4 A;  4E8D A;  1ND2 B;  1OA3 A;  1ZNP A;  3IKW A;  4XAA A;  2VGD A;  3VD5 A;  3RNS A;  4CU6 A;  3O1M A;  1RVF 1;  5JOZ A;  1CX1 A;  1W03 A;  1LGN A;  1N1Y A;  1ULF A;  4BPZ A;  3M4F A;  5C3R A;  2VCC A;  4Q2F A;  5EYY A;  2C9K A;  1F4H A;  4M3C F;  3VBU B;  4OVE A;  4QT6 A;  1WGP A;  3A0K A;  1LGB A;  1DF0 A;  3H1W A;  2G1M A;  3O5S A;  4LBO A;  5H9S A;  3MV0 1;  3ZFF C;  2LAL A;  5AFE A;  1BEV 2;  1RED A;  4Y1X A;  3MPB A;  4OHW A;  3ZN6 B;  3WLU A;  3UV9 A;  2H0B A;  3J26 N;  3K4D A;  5E1R A;  5EZW A;  2IXI A;  3O1U A;  5KHK A;  3B9C A;  1LJ7 A;  3FWE A;  2A1X A;  3AVS A;  3PJY A;  4KWK A;  5C3S A;  2CTV A;  3VBR A;  3IPV A;  2GU9 A;  3MUY 1;  4IE5 A;  1GKB A;  4MGZ E;  1MAC A;  2PHD A;  3HMY A;  1JHJ A;  4QX0 A;  4EN7 B;  2GC2 A;  5HCA A;  3EQE A;  1OUX A;  4FAH A;  5CFC C;  5JZG C;  1S0D A;  2I07 B;  2VW0 A;  2XH6 A;  4Q0V A;  3KGL A;  1AF9 A;  4AG4 A;  4PIX A;  5FMD A;  1VBC 3;  1RUE 3;  2OUJ A;  4AVC A;  4WVV A;  2WC2 A;  4IV1 B;  5L73 A;  5C3O A;  2W08 A;  5DDJ 3;  5C9A C;  4RD7 A;  4DS0 A;  5L9B A;  1JZ6 A;  3I2J A;  3UNP A;  4A7Z A;  4G9S B;  3JD7 1;  4N53 A;  5L9R A;  2OS2 A;  3B01 A;  3QLQ A;  3SC7 X;  2W0X A;  3L2H A;  1FV3 A;  1LHN A;  3H7Y A;  5FBJ A;  4I3G A;  1W2N A;  4AQ2 A;  1TME 1;  4H3W A;  1YI7 A;  5FIX A;  5HV0 A;  4C1W A;  3ME2 A;  2A6V A;  2XML A;  2HBT A;  2VNO A;  4XTP A;  1IQA A;  2PHT A;  4YM1 A;  2V5D A;  3ZN4 A;  3S0M A;  3MF6 A;  1HRI 3;  2JG9 A;  1ZRD A;  5JOW A;  1TMF 1;  2ZA9 A;  3NNL A;  4MUV A;  5KHH A;  2WO3 A;  1TE1 B;  3PUI A;  4P9I A;  4FSJ A;  3SEE A;  3AP4 A;  3W5N A;  5BNP A;  1JZ8 A;  1IPK A;  2YC0 A;  1D4M 1;  3MIB A;  1AUY A;  2Q8C A;  1UYY A;  3UKT A;  5AC9 2;  2ETE A;  2ZBJ A;  2RS3 2;  2YU2 A;  4FQZ A;  3VBO A;  4JGY C;  1MZ6 A;  3P1I A;  3ZYR A;  1E57 A;  1IS3 A;  1YFU A;  3NRU A;  4Q4V 3;  4QPG B;  3UJO A;  2B39 A;  3RZH A;  1C1F A;  1CPN A;  4BWO A;  2ORZ A;  3VKN A;  3IMN A;  3PL0 A;  3RRD A;  4IV3 C;  4JKL A;  4QB1 A;  5SV5 A;  1XE0 A;  1MEC 3;  4ZHN A;  1IS6 A;  2WNV C;  4Q4W 2;  1C8M 2;  3III A;  4L99 A;  3VV1 A;  2D6L X;  4EZ4 A;  4XBN A;  2JG8 B;  2WL1 A;  1X8M A;  5IVJ A;  2YZ4 A;  1ZZC A;  5CZK A;  3MBW A;  1OLQ A;  4CCL A;  1W8H A;  3WIN E;  4MXW B;  3NJY A;  4XET A;  2R6Q A;  5F1R A;  2ZGL A;  3MIE A;  4QX5 A;  4K6B A;  1MS5 A;  5CYY A;  2WO2 A;  2UWB A;  1GZT A;  2BNO A;  4YVW B;  2C5D A;  1IS4 A;  4JGY A;  1IHM A;  3AB0 A;  1I1E A;  2VH9 A;  2HWE 1;  4LK6 A;  5LEJ A;  4PBP A;  4R9A A;  5BUV A;  4CSW A;  5KXB A;  2QQU A;  3EYP A;  1TQ5 A;  1VBE 3;  4NUB A;  3J7N A;  4TLG A;  3B9I A;  2ZML A;  3O1V A;  1RYY A;  1BVP 1;  2BEO A;  1U5X A;  2WS9 1;  1H9P A;  4S2F A;  4URA A;  3E5X A;  1VPH A;  2BGO A;  2Z69 A;  1X33 A;  2WNV A;  1QOT A;  2ZMK A;  2VC9 A;  3N3H A;  1WMF A;  1XE7 A;  4FPE A;  2FDG A;  4TTG A;  2J1U A;  2E7A A;  4K8F A;  2GSY A;  4KGG A;  5GLZ A;  1W6P B;  4C8D A;  3SH4 A;  2VCM A;  3SQO A;  3U75 A;  1LEM A;  3LA2 A;  1VAM A;  1V70 A;  2V4V A;  4OLL A;  1ZM1 A;  4CA9 A;  4JC1 A;  4R52 A;  4XJ8 A;  2NZ9 A;  3UKV A;  4XDP A;  1U5I A;  2VTF A;  4CCN A;  4M00 A;  3RSJ A;  4CPB D;  5DUU A;  5A7P A;  4HSJ A;  2VZQ A;  1FOD 1;  1G8W A;  1DQ2 A;  3M8L A;  1D0G A;  1LHV A;  3ZR5 A;  1QJY 1;  4ZON A;  2ZEY A;  4UAP A;  2BOI A;  5BYN A;  2W52 A;  3K3O A;  3FHI B;  3ZXF A;  2Q8O A;  2PYT A;  3KHC A;  1JOJ A;  2GNT A;  1QWR A;  1R08 3;  1MVE A;  1OFN A;  1GOF A;  1OSG A;  3FE5 A;  1CJD A;  3MIC A;  5BXX A;  2VZO A;  4RN5 A;  3BPS A;  3RMY A;  5LRS A;  5A3U A;  2VTX J;  3DYO A;  4PHZ A;  3WD5 A;  1Q43 A;  3HIF A;  2H6C A;  4LOT A;  2D97 A;  2CWS A;  2EID A;  1YQC A;  4UFL A;  2GZW A;  5FPL A;  5KXE A;  3SCF A;  1ENR A;  3PVO A;  5FYT A;  4PT6 A;  3POF A;  2NP0 A;  3WY6 A;  3WNO A;  4C0H A;  1UCX A;  2DFC A;  2PLV 1;  3R4D B;  1PGL 1;  1N47 A;  5TSW A;  2HWB 2;  1HV1 A;  3UYJ A;  3VZM A;  3WNM A;  2XBO 1;  1UD1 A;  3SEP A;  3OCP A;  4PLO A;  4XEZ A;  2J1S A;  1LOD A;  2GN7 A;  2WNU B;  4D94 A;  4F7Z A;  1W6O A;  1WKY A;  4MO3 M;  4ISQ A;  2DVA A;  3E97 A;  5GJ6 A;  4ARY A;  1IOA A;  2L9L A;  4XBQ A;  4IE0 A;  2QQW A;  4H14 A;  2EIE A;  1SLA A;  3WXP A;  5F5Q A;  4L8Q A;  4CEW B;  3HD8 B;  4CDQ A;  3DXT A;  3GM8 A;  4BIF A;  1C28 A;  5DG1 A;  5CA6 A;  1UZ0 A;  1YFY A;  2PAK A;  3DYP A;  5CKM A;  3U11 A;  2ZZQ A;  1Q8V A;  1OPM A;  5FWE A;  4GH4 A;  1RUH 1;  5IW0 A;  5F32 A;  3Q8A A;  3VBF C;  1QQP 3;  4PJY A;  5FYV A;  5G04 L;  5L7O B;  1CZV A;  1HRV 1;  1UL9 A;  2XVK A;  4LOS A;  3HBK A;  3M3I A;  1Y4W A;  1HN0 A;  4YGC A;  4AGV A;  1VRB A;  3GXU A;  2PHR A;  2BUK A;  3WP3 A;  3H8O A;  2GC3 A;  4JQR A;  2J1R A;  4XAC A;  4B8E A;  3CJX A;  5JI9 A;  4ARX A;  3O7O A;  4R9D A;  3CMG A;  3ACI A;  1PO1 1;  4MH0 E;  3WSO A;  2WFF 3;  1N1V A;  3CU7 A;  3MUZ 1;  5FK8 A;  2X05 A;  5K8S A;  3WOG A;  3I59 B;  1QNW A;  3OTF A;  3QCW A;  4JX0 A;  1J3P A;  2GND A;  3I3M A;  3MLK A;  3HN1 A;  4AHZ A;  2E6V A;  2YXS A;  3ZKU A;  3AJY A;  1NY7 2;  2WT1 A;  1AX2 A;  1FAY A;  2ZEW A;  3WT3 A;  5FOB B;  1JOB A;  2RG4 A;  3CZJ A;  4XAE A;  2KD7 A;  3CJI C;  1CGP A;  4YFW A;  4IE7 A;  1AYM 2;  4XIK A;  3VBF A;  1RUI 1;  2FDJ A;  3I7D A;  4ITC A;  1ASJ 1;  3AMQ A;  1OI6 A;  2RE9 A;  3RS6 A;  1G9B A;  4CRQ A;  1LNS A;  2ZHM A;  3ZDV A;  2MPF A;  5DN2 A;  5I8S A;  2CYF A;  1HXS 2;  1RIN A;  2K9Z A;  2Z5W A;  1A3K A;  3ETP A;  2VCA A;  2WYS A;  5FMO L;  3WDT A;  1VBB 3;  2Y6H A;  5GZD A;  4DXZ A;  5A7N A;  5FK7 A;  3NNG A;  1YIP A;  4N43 A;  4XE9 A;  1Y43 B;  1UX6 A;  1RVF 3;  1GP6 A;  5FO7 B;  2RS5 2;  3OBA A;  4OI1 A;  1SFN A;  1O7F A;  2QE3 A;  2YGM A;  2Y60 A;  4GJZ A;  2HWF 2;  4GZ9 A;  1DZR A;  1F15 A;  4Q4Y 2;  3A4U A;  4CXX A;  2Q0A A;  2PXJ A;  3KCY A;  2K0G A;  4NHY A;  4PI0 A;  2WII B;  3ZYB A;  1NYW A;  2RS1 1;  2ZGT A;  4YGE A;  3WG3 A;  5IVC A;  1V9U 2;  4LBM A;  1GZC A;  2VY0 A;  1TVG A;  3U0Z A;  4LA2 A;  4CXW A;  2VBD A;  5LA2 A;  4ZU4 A;  2VOK A;  2GMM A;  1DGW A;  4N8M A;  3PHM A;  1GNY A;  1OPO A;  3AYA A;  4DUW A;  1LOF C;  5FCC A;  4LPL A;  1AR9 2;  2WZ8 A;  3ABZ A;  5FZA A;  4YZ1 A;  3BPZ A;  3UGH A;  3O0V A;  4P9X A;  5CKQ A;  3MO4 A;  4RS5 C;  1D2Q A;  3DL3 A;  4AED C;  5GZE A;  2UWA A;  4AAX A;  1W0O A;  2P4E A;  4K40 A;  2CGO A;  1FPN 1;  4LBK A;  2WIN B;  3LA7 A;  3VBS A;  1GWM A;  1FAT A;  3I2O A;  3OUH A;  2BNN A;  1MPX A;  1YLL A;  4B1L A;  1R1Z A;  4EYU A;  1GLH A;  4YLZ A;  1VBD 1;  4EJR A;  1UO9 A;  1W99 A;  3PIG A;  3J8F 1;  5A70 A;  4ZU7 A;  2WN2 A;  1PK6 B;  2EVX A;  4FFI A;  3GCW A;  4Q27 A;  3I2I A;  1I6X A;  3I97 A;  4PI2 A;  1NCQ A;  2KA3 A;  2Q1Z B;  5LY2 A;  1EPW A;  3GJB A;  1VP6 A;  3CZU A;  3TN9 1;  2N7G A;  2RM2 1;  3FL7 A;  1AR6 2;  1W3X A;  5IVY A;  3QH6 A;  1PGS A;  4K21 A;  5A1L A;  2J1V A;  2ILM A;  3AM2 A;  1O3R A;  1F2N A;  3ZMN A;  4HT1 T;  4DQA A;  1TME 3;  1XOY A;  2ZEZ A;  2XQX A;  2BDR A;  2WWU A;  4QX3 A;  3S57 A;  4IEZ A;  2J42 A;  1BBT 3;  2JIG A;  4UFH A;  4CCK A;  5E88 A;  1WMX A;  4E4S A;  3I8T A;  4RS5 A;  2E7T A;  1CON A;  3ZX7 A;  4JKK A;  5C4W C;  4WVM A;  1UY0 A;  3MF9 A;  4NHL A;  2JE9 A;  4IET A;  2VNV A;  5JAX A;  5LA1 A;  3BU0 A;  1W0P A;  5T55 A;  2PMW B;  3MI8 A;  3NWK A;  3VDD C;  1DQ4 A;  4GXL A;  4O61 A;  3KT1 A;  3MHZ A;  2X5I B;  2A5Z A;  3E1F 1;  3ZXD A;  1PMJ X;  5M0T A;  2BFU S;  4BMB A;  5C8W A;  4CP9 B;  3BOW A;  2FQP A;  4YGD A;  3WQ7 A;  1O6U A;  4YPJ A;  5BNQ A;  3OBZ A;  5C7G A;  3ZYP A;  4W8J A;  5EIY B;  1UPS A;  2JIC A;  1LB2 A;  1W0N A;  2Z42 A;  2R06 1;  1B35 B;  3A21 A;  3SNM A;  5C6C A;  4IW3 A;  3GZE A;  3FHA A;  2DUQ A;  5BNO B;  3OB8 A;  3CIH A;  4ET7 A;  4XCA A;  4PQ9 A;  5FTT C;  3LOI A;  1UZY A;  3N35 A;  1SCS A;  2JXA A;  2W1U A;  5FYI A;  4K7J A;  4AGG A;  4F83 A;  1WLW A;  2W39 A;  3TEZ A;  5FP9 A;  1GZW B;  4YVS B;  3T08 A;  1UMZ A;  1WBL A;  4LK7 A;  4LR4 A;  5JOX A;  1DQ0 A;  4UFJ A;  1AYN 2;  4RL7 A;  4XQD A;  3MID A;  4XMI A;  2RR1 1;  2J1T A;  2JKB A;  4J1X A;  4Y26 A;  1MS1 A;  4CP2 A;  1IKQ A;  1QOS A;  4XW3 A;  3MIG A;  2ZHK A;  1RMU 2;  1QJZ A;  1UY1 A;  4J1W A;  2ZJC A;  4K3U A;  4DOU A;  1DDL A;  3CBN A;  2D5F A;  2EAK A;  4B29 A;  3TAY A;  1MZ5 A;  3HBZ A;  2HWE 3;  1GIC A;  4CDW B;  2R16 A;  5FZF A;  2BZD A;  3J9S A;  1H30 A;  4ZXK A;  5A6Y A;  5JXI A;  3HQR A;  2DBN A;  2BGC A;  1O8P A;  2WS9 3;  3M2M A;  4DFS A;  1XC6 A;  3V64 A;  4GKY A;  2OXB A;  3GAL A;  1YRZ A;  3OSD A;  1VLN A;  3ZFG B;  1T2X A;  3I59 A;  2Q8E A;  1AXK A;  2VZS A;  2P1B A;  3RZL A;  2VAU A;  4S2D A;  1EAH 1;  5IAX A;  3OF1 A;  1ND3 B;  1SG3 A;  3FZ3 A;  2BW8 A;  2HKX A;  1B09 A;  2Y33 A;  3ES1 A;  5D2A A;  4AEJ A;  4ES8 A;  5FOJ B;  5A7Q A;  1DGL A;  5GKA C;  5GLU A;  1VBC 1;  4AEM A;  3AMN A;  3A7Q A;  1QJY 3;  5DDJ 1;  4CDX B;  1PMI A;  4M3C A;  2P5B A;  4WM8 C;  1MS0 A;  5DAP A;  4QX7 A;  4P9J A;  3WV6 A;  1P8J A;  3KM5 A;  5L9V A;  1JYN A;  3U07 A;  2E9Q A;  4R4Z A;  2W46 A;  4DXT A;  3MIF A;  4ZXE A;  2X10 A;  1NQD A;  3WG1 A;  2HWB 3;  3T2T A;  2YPD A;  2E33 A;  1US2 A;  1C57 A;  4QHZ A;  4Y33 A;  1BLZ A;  1Q8P A;  4LMF A;  4XBL A;  4A6S A;  4GJY A;  4QKD A;  4W4Z A;  5CU1 A;  4YRD A;  4YSF A;  3WW4 A;  1CAU A;  3FBY A;  4Y5S A;  4IGQ A;  4BYY A;  4YNI A;  2JDZ A;  1UNB A;  5CBL A;  5I0T A;  1ZZB A;  1R64 A;  3JQW A;  4PF1 A;  4B7K A;  1HRI 1;  2XBO 3;  2DV9 A;  4FO9 A;  3APB A; 
#chains in the Genus database with same CATH homology
 4NID A;  3O1T A;  4NPL A;  3BU0 A;  3RZM A;  3RZH A;  2FD8 A;  4MG2 A;  3BTY A;  4O61 A;  4NPM A;  3H8O A;  4ZHN A;  4QKF A;  3T3Y A;  3KHB A;  4RFR B;  4QKB A;  5DAB A;  3BKZ A;  4NIH A;  4NRM A;  2FDI A;  3I3M A;  4MGT A;  4IE4 A;  4O7X A;  3O1M A;  4IE7 A;  2FDJ A;  3BTX A;  3O1V A;  4QHO A;  2FDH A;  2FDG A;  4JHT A;  3O1U A;  4CXX A;  4IDZ A;  3BI3 A;  4IE5 A;  3I49 A;  4NRQ A;  4CXW A;  3RZK A;  3RZL A;  4NIG A;  4NRO A;  2FDF A;  3O1S A;  3KHC A;  3BIE A;  4NJ4 A;  4NII A;  3O1P A;  4NRP A;  2FDK A;  3BTZ A;  3H8X A;  3I2O A;  3LFM A;  3BUC A;  3H8R A;  3I3Q A;  4ZS3 A;  3O1R A;  3O1O A;  4ZS2 A;  4CXY A;  2IUW A;  3RZJ A;  4OCT A;  4QKN A;  3S5A A;  4IE0 A;  4QKD A;  3RZG A;  5F8P A;  3S57 A;  4IE6 A;  3T4V A;  3T4H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...