4JHTA

Crystal structure of alkb in complex with 5-carboxy-8-hydroxyquinoline (iox1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 5-Carboxy-8-hydroxyquinoline is a broad spectrum 2-oxoglutarate oxygenase inhibitor which causes iron translocation
doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4jhtA00
4RFRB 4IDZA 5F8PA 4NPLA 4NRQA 4ZHNA 2FDHA 4NIDA 3I49A 4CXWA 4QKDA 4CXYA 3RZHA 4NPMA 3S57A 4QHOA 4NIIA 3I3QA 2FDIA 2IUWA 3KHBA 3BTXA 3T4HB 3H8XA 3RZMA 4QKBA 4IE0A 5DABA 3O1OA 3H8RA 3I2OA 3BKZA 4NIGA 3BU0A 3LFMA 4QKNA 3S5AA 3KHCA 4NJ4A 4QKFA 4IE7A 3H8OA 4O7XA 3O1MA 3BTYA 4IE4A 3O1PA 4OCTA 3O1UA 4IE5A 3O1RA 3O1SA 2FDKA 2FDGA 3RZLA 4CXXA 4O61A 2FDJA 3I3MA 3RZJA 2FD8A 3O1VA 3T3YA 3BTZA 4MGTA 3T4VA 4JHTA 4ZS2A 3BIEA 3RZKA 4NROA 4ZS3A 3BUCA 2FDFA 4NRMA 3O1TA 3RZGA 4NRPA 4NIHA 4IE6A 4MG2A 3BI3A
chains in the Genus database with same CATH superfamily
4NHXA 2UYBA 1W90A 4OULA 5FY5A 2VQAA 1YQ2A 5T50A 2ATFA 2EIGA 4QPIB 1SEFA 4QHZA 5I0RA 5FK7A 3J8F2 3WF4A 1EP0A 4Z92B 4Q4X2 3B9IA 4FOYA 4CU8A 1JOBA 3NJZA 2X5IB 5GZFA 1KEXA 4MGSA 2X53S 3J7HA 4HKOA 2CSGA 5C71A 1XU2A 3CF6E 3N4MA 4ZU5A 2ZX4A 2ZGTA 3LIHA 2QQMA 3H1WA 3NKGA 1DZRA 2VOTA 4FQZA 4NAOA 4AI3A 1RUE1 1RUI1 2ET1A 3LEKA 4QX1A 1IG0A 3OBRA 1QEXA 3RDIA 3U1XA 4Y1ZA 5A1LA 5KXDA 3ZXGA 1S0GA 2C9KA 4JRAA 3LFIA 4QPYA 3ZDSA 4ES9A 1AHSA 1CAWA 3D82A 3PHMA 2WSVA 2GP3A 3AYCA 5FY0A 4FAHA 1SFNA 2ORXA 3ZSMA 4CDXB 4RS5B 2VPVA 4K3UA 4EN8B 3FE5A 1VBA3 3H3LA 2FDIA 2IUWA 3F95A 4CDUA 1AYN1 2X09A 1PX3A 2CHHA 2O0OA 5C4WA 2E32A 1CONA 1J3QA 3VBUA 2B42B 5DUWA 4RA0A 3ZMNA 5JSRA 3MICA 1POQA 3VBUB 1LOEA 2EICA 4GKXA 2PHDA 2ES3A 1DFQA 1KS4A 1PO12 5FY4A 1RUI2 1E5RA 2P3JA 2WZR1 1JZ5A 1X33A 1GOHA 3WW2A 4WVWA 3DEMA 3IDEA 1G86A 4W6YA 1CAXB 2J1RA 2RR13 4GWIA 5FPXA 5IK5A 4YVSA 5KHIA 4M3CF 4GA9A 4JV4A 3K2OA 2TBVA 2VW1A 2Q8EA 3WG1A 4JTOA 5KBFA 1XRUA 1W0PA 3GNEA 2ZHMA 1ND2C 3ACIA 1J3RA 1YIFA 1NA1A 3NJVA 1VBC3 3OYWB 3DYMA 5FPBA 2AEZA 4BQ4A 1A3KA 4PT6A 1NA1B 1W3VA 4B4PA 1FOD1 5DAXA 5T55A 2JDZA 2OPWA 3OTFA 5DUVA 1NT0A 5KHKA 2ZMKA 3KMHA 1NA1C 4YGBA 2YC2A 4V1PA 1DZQA 4FOVA 1VRH1 1US3A 2W92A 2X05A 4M0HA 4AEJA 5HBAA 4GXLA 4YVSC 1OBNA 3IPVB 5FZ8A 4P5HA 5IVVA 2ZPXA 2B4KA 4P02B 3UKVA 1HB3A 2EVXA 4ITCA 4W6WA 2VOVA 2HWC1 4BM8A 2VUCA 3WEZA 1LB2A 4ISQA 5EXOA 5FP9A 2XG3A 1MVEA 1XB9A 3WT3A 3AMMA 2Z42A 3LAGA 5CISA 3H42B 1MS8A 1S2KA 1NLQA 1ZYBA 3ZIXA 5ABJA 4AVTA 4WM8C 2GNBA 4A42A 5CG8A 3ASIA 1VIWB 2ZS6B 2CAVA 4FOQA 4EN0A 1KRIA 1X8EA 1WCKA 4XMAA 4AWDA 2GNDA 2NQYA 3MIDA 3ZN4A 4CEYB 3O1RA 3MO4A 2PAMA 4Y1XA 4CDUC 1H9WA 2PHRA 3I59A 3Q9OA 4CEYC 1XC6A 1NCRB 2V4AA 4FP2A 5FZMA 2YC4A 1JUIA 5GZGA 3K46A 4UFHA 3ZPOA 3LGRA 1ZRDA 4QB2A 1D7PM 2VVDA 1YQ6A 1VBB3 1DGLA 5FXWA 3RYRA 1Q3EA 2WT1A 3DXTA 3T2PA 3FHAA 4PIXA 3VBFC 1MS0A 4QX0A 4YGEA 4AF9A 5LA0A 1U5ZA 3ATGA 4P9JA 3N7LA 4D3WA 2WA3A 3B01A 3ACGA 1XPWA 3H3UA 2BGOA 2WN2A 5FP3A 4NIDA 4YW3A 3WXPA 4YG3A 2VE1A 3VZOA 2QDNA 5JDBA 2QVSB 3PJQA 2ET7A 2QQIA 3I3BA 4QX7A 1DZTA 5FYCA 1FNZA 2ZTNA 2WWUA 2XJPA 4JGZB 1NOVA 4K8RB 1MPXA 1NG0A 1XE8A 4IQPA 1A34A 3ACFA 2ZAAA 2Y26A 5CAZA 1I9RA 4AVCA 4IW3A 2RS32 5EPAA 2WZ8A 3KD4A 3G7DA 3WCSA 2WT2A 4A2UA 1CX1A 4UFMA 4CU6A 4NPLA 4HPKA 1XE7A 2VZOA 3N9QA 4IL7A 4QU2A 2VZSA 4YG6A 2PHTA 3T09A 1B09A 4MGYE 1RMU2 1GWLA 3E5UA 2AR6A 4Q0QA 1UU6A 3AP6A 3POBA 5FLJA 1HDKA 5FOBB 5JOWA 3NJXA 4FFHA 1R1ZA 5IVYA 4GB32 1X50A 2PHWA 2BNMA 1MZ6A 3MUY1 5FZKA 2YBSA 2I45A 2XJVA 3CZJA 4BA6A 4AVBA 2EIEA 4O9EA 1R083 3HNYM 1A8DA 1G8WA 1L7LA 3GCXA 4XIKA 4RGAA 1A78A 1RITA 2XPJA 1CAVB 4O65A 3BPSA 5I8TA 4DUVA 2ZGKA 5F39A 1KGYA 1L7QA 1UIJA 1LOCA 3L9JT 4IV1C 1OA4A 1SG3A 2VXRA 5T5OA 4MVTA 4AZZA 4DUWA 5J3UA 1KFUL 1OURA 3BYWA 1FOD2 1FMD3 2EAKA 3MUZ1 5D8AC 5IVBA 1BBT2 3BOPA 1TQ5A 2K46A 4LBJA 1HN0A 5IW0A 4QX3A 2ZGLA 2CL2A 2QE3A 2PELA 3E6BA 3VD3A 1QH6A 1OXCA 4EV0A 1RUE3 3HOBA 4KWJA 3ZO0B 3CJIB 2QZ3A 4CUCA 5JIUA 1BMV2 3VDDC 1LAJA 4Y20B 4XUPA 4M3CE 2ZMNA 5G04L 4F83A 1SCSA 4C1WA 2W52A 1XNCA 1Z7S2 1WCSA 2BWAA 2VBBA 3GBGA 4WM7B 3O1TA 3LSEA 5HI0A 4L11A 3VKOA 4LIUA 4D7TA 4CXYA 2J1VA 4NHYA 1L7RA 5H9PA 2WNEA 4AEDA 5ACA3 1DGRA 5LBFA 4CUGA 3I2FA 3RNSA 1ULGA 1EPWA 3ES1A 2JDAA 1U5YA 2ARXA 1NXD1 3LD8A 3MYXA 4JX0A 4XF4A 5FWJA 4RHV2 3PURA 1ZZBA 4PLNA 1AYM3 2J1EA 4ONUA 4QXKA 4YW1A 2PN5A 5FIXA 2GN3A 4XZUG 3BCWA 3RS6A 3LA3A 2Y6GA 4QQLA 5AVAA 2AACA 5K7PA 1W6MA 2NLRA 3AKQA 4IEQA 3S7EA 4BMBA 2RS53 3ACLA 3FLRA 1RIRA 4GH4C 4BQWA 1YQ8A 1DQ5A 4Y22A 4FCAA 1NCRA 4ASLA 1GU3A 5LW9A 4IE6A 5F5AA 1CX4A 4Y5TA 5JI7A 5EQUA 4EYUA 5LEKA 4XFCA 5A7OA 2HBUA 4XPVA 4AI2A 4AQ2A 4CP1A 4XBLA 2D40A 3UKNA 3HPNA 5HV0A 1ZBA3 2R6QA 3Q8EA 2VMIA 1D2SA 2FQPA 5E16A 1R081 2VTFA 2Y8KA 1PO23 1RUD3 1H6XA 3I8TA 4XETA 3E1F1 3FWEA 5BNPC 5JZGB 1HRI1 4DNYA 1W2AX 1QJU3 2RS13 4RHV1 4FPGA 3POFA 3W21A 4QPIC 4BU2A 4KU8A 4AE2A 1ZBE3 3JB4C 4DMIA 3B94A 1O4ZA 2Y64A 1GQGA 1SMVA 1H1AA 1TG7A 1ZA7A 4FI9A 3C3VA 5E8AA 1PGW2 3Q8AA 2WFF1 5A3PA 3AVSA 1LGNA 1A8MA 1LOGA 1VBE1 2WWSA 4BXSV 2V5DA 2B8MA 4N53C 3H1YA 4LBQA 3U11A 1CJPA 2MHFA 4FXKB 5CIRA 4NE9A 3PL0A 4W50A 2WIIB 1C8M3 1D4M3 2Q4SA 4Y33A 1W8WA 3ZYGA 4BYYA 3R0RA 1YIPA 1SACA 3HQUA 4FPHA 4RQPC 1IZ3A 4CDQA 1G7YA 1HXS2 3P6BA 5FO7B 5C8CC 3VBHC 5FYMA 3WF1A 1D0HA 2VCBA 3VBRC 4E2GA 1RUH2 3M8LA 2VY0A 5JPMB 3RZKA 3BUCA 1TMF2 2AH2A 2WC2A 1GNHA 2WSUA 1W05A 4LO7A 4QXBA 5J96B 1O3QA 2GAUA 1WW4A 4IERA 2UURA 4NOTA 3NSTA 2KD7A 1PHMA 4A45A 2BUKA 3AZWA 1V9U1 3HN1A 3ROUA 5C5TA 4DIQA 4N43B 2HWD3 4PQQA 5A7SA 2VNVA 2XBO2 4IV1A 3UNPA 4GD4A 1H30A 1EAH2 3VKFC 1ZRFA 3WY6A 5IFPA 5F3CA 4F3JA 4HFSA 3LEGA 1DYKA 2RE9A 4M00A 4BQ3A 1W99A 1REDA 1O8SA 2BOJA 1XOYA 2BU9A 3M3IA 4XUNA 1M06G 2J1TA 3POGA 4HMZA 2YC0A 1UY3A 1PNFA 2PHFA 5FP4A 3RZGA 1LCLA 1CZVA 4W4ZA 1JZ2A 3GCWA 3NV3A 1ASJ2 1LOFA 4URAA 2DDUA 4QPGB 3ZLIA 2ZCWA 4QQOA 1YFWA 4ZZ8A 4K20A 2BFUS 2ZEXA 3GZAA 1E5IA 5FP7A 1FT9A 2D3PA 5FY8A 1H1IA 3P1IA 2VGDA 1APNA 3RI9A 4Z1VA 1J84A 1HIXA 2VECA 3V56A 4AVAA 3U14A 2XLAA 1QJY2 3I59B 2OA2A 1Y9QA 2YB7A 3BIWE 5IVCA 4N53B 2W47A 4XZPA 1O3TA 3LCPA 2ZXQA 4B4RA 4G4FA 2WNOA 3AXEA 2C6SA 4D0QA 5T5JA 4WM8B 3INAA 2NZ9A 3KCXA 4FPKA 1PNGA 5A80A 1UQXA 1NKGA 5EYXA 5C8CB 3SMHA 3HEIA 3T0AA 4LE4A 1ULPA 4Y24A 2XLFA 5J09A 3GJAA 3LSDA 2DU1A 3A0NA 1LESA 2Z5WA 1EY2A 2IXKA 3C8XA 4LKSA 5BY5A 2PLV2 2HEYF 1NY72 3HNBM 5GZEA 4GMP3 2DUPA 3ZYHA 1FPN1 3OBTA 3QH6A 1CQ9A 2RS33 3ORJA 3KSCA 5IVEA 2PHUA 5GJ6A 4N9IA 4FPEA 1DGRN 2DVFA 1COV3 1OI6A 3UGFA 2FCUA 3WX5A 3WNLA 1X8MA 4FTEA 4U36A 1MS4A 5CADA 4CUAA 1GFF2 2YBPA 3UETA 3K51A 3KQRA 5F2WA 2Q8CA 3RGBA 1OUSA 2OS2A 2YHJA 3POIA 5J7MA 3WOGA 1G9DA 5DABA 1ZA4A 4MGZE 2VVEA 2YY1A 4NIHA 3KV6A 1CIYA 2QQKA 3U75A 2C0ZA 1V0AA 1O59A 2PLV1 1YEWA 4PDWC 4QPGC 4YM0A 1WLDA 2B9VA 2PHLA 4YZ1A 2VAUA 2B46X 5JUVA 4COUA 3DGTA 2AENA 4MV2A 4ZS3A 2VU9A 2XWBB 1JYCA 1VAMA 5FFOC 3TEZA 3V0AB 4Q29A 4RGKA 1NLSA 2D3RA 3BN6A 4RFRB 5BPXA 3H8RA 3AKTA 4CRQA 1W8ZA 3AJZA 2UU8A 2ZABA 3K77A 4QGNA 3VHPA 3AL5A 4XUTA 2Y34A 4BQ1A 1EAH1 4ORFA 3OYWA 5HCAA 2RDNA 1DYOA 3AB0A 4L97A 3RMXA 3VHOA 4DFSA 1YQCA 3T1LA 1YRZA 1R1A2 1W9FA 3WW1A 1I1EA 2ARCA 1GP4A 2I2SA 4Q4Y1 4IV3B 1W8HA 5B2GB 4IEZA 2PA7A 1N1SA 3K4DA 5FMCA 1O5UA 5HCFA 1YC61 3WINE 3I97A 3ILFA 1ASJ1 2W87A 3WW3A 3ZYIB 5IT6A 4ZZ5A 4NVPA 5LK5A 5FP8A 4CCOA 4HONA 2RHPA 3EHKA 3ZDVA 1WBLA 3POYA 2R062 1W9YA 2GNMA 3CJIC 4OI4A 3WHUA 2OQ7A 4KMQA 3RRDA 1ZRCA 1UXXX 1GWMA 1K12A 5JSPA 5LRRA 2VZTA 4CPBA 2WAOA 5FY7A 4C91A 1WLCA 4NJ4A 4XBNA 2ZACA 3WQ1A 1FI2A 4CUBA 3DPRC 2VMCA 2BNNA 4KWLA 2A5ZA 3WNNA 2WZPP 3BPZA 4J25A 1P8JA 2Z69A 1ZZ8A 3C7HA 4FTBA 1I3HA 1C1FA 1C28A 3K3NA 2GMPA 4Q4W1 3SC7X 1XYNA 5JR7B 2JXAA 1S4CA 4PCRA 1QDOA 1WW5A 1W0OA 1YHFA 4WM8A 3EBRA 2WQ4A 3ILNA 1V6OA 3M3EA 5LATA 3KT4A 5BNOC 5EJZB 1W9TA 4I01A 4Q0VA 3T0DA 3J8F1 1F8VA 1SFPA 2ID4A 5L9BA 4Q4V1 4MH0E 3WQ7A 1CJDA 1QJY1 1YJLA 3DL3A 3GBFA 2K9ZA 4Q8LA 3ZFFC 4R9DA 4M01A 1J58A 1Y9GA 5FZEA 1H8TB 1MEC3 1OT5A 3WDTA 4A7YA 4EQVA 1ZZ7A 1HV0A 3HAGA 3OUJA 2VQUA 4QT6A 2VJXA 1OLME 4N9HA 3NNJA 5FYHA 5LRSA 3WF2A 2VCCA 3OB8A 4NPRA 5FYUA 3SH4A 2R063 5EYYA 4AQSA 1HX6A 4Y26A 5F5QA 5FPZA 4C0BA 4XJZA 3HWJA 4IV3C 1HV1A 2A75A 1QOSA 4LORA 4XJUA 1XNTA 4QDQA 4XHBA 3WHTA 2C1FA 4MOAA 3E6CC 1UOGA 1HRV1 4RS5A 2D6NA 1YFYA 2IVIB 2JG8A 3IZOA 3DF0A 5H9SA 1VLNA 5FYZA 4UFJA 2XVGA 3N7MA 3O0XA 3IKWA 4YYOA 3ZVXA 1NE4A 5SV8A 1NAEA 4JRLA 1JYWA 2Y0OA 2Z2SB 5KXCA 3UL2A 1W9WA 2GSYA 5FZ6A 3W5MA 5FZIA 3W58A 2OZ6A 2JE9A 1D0GA 1O4YA 4LO5B 4XXAA 2HWC2 5EP9A 5JCTA 4AG4A 4Q4W3 2BERA 3QACA 4OZOA 1G6NA 5A6QA 5C3PA 1W8FA 1IQDC 1SCRA 1WMXA 2HWD2 3M2MA 3NRUA 5FY1A 3VBOB 3SH3A 1AR91 3U4SA 4AVSA 1QKQA 2R042 4Z2AA 2BBVA 5DG2A 3CL1A 3VBOC 5F37A 3A0KA 4E4SA 4Y5SA 4CEWA 4DY3A 4I0WB 1LHWA 1JZ6A 5A33B 3N9MA 3T08A 2OT7A 2XHKA 1V9U3 3S6PA 2O8OA 2SBAA 2ZX2A 1UZ0A 1LODA 1RHI1 3URFA 1F31A 2W68A 1QF3A 4IEUA 1F35A 3GF6A 5FZ9A 1GMMA 1PGW1 5JAXA 2GNTA 1CAUB 1Z7S1 3FBYA 3ENRA 1VE0A 1RVF2 3S57A 1XU1A 2Y6KA 4N7IA 1CAUA 3JBG2 5F3EA 4KGQA 1RUF3 2D6LX 2FMYA 3ZOIA 1ULCA 4UT5A 5JOYA 4NMIA 3AXDA 5FZ7A 3BU0A 4UOJA 2J22A 3H8OA 2VNOA 2ZZJA 1R082 3CLPA 2RG4A 5LY2A 5A3TA 3GGLA 3WSOA 3AMHA 2HWC3 2VZ1A 4UF0B 4MZUA 4YZ4A 2E33A 2WFF3 4RS5C 1BCXA 2BWCA 1PVC3 1OLRA 3TRSB 1VRH3 1K42A 4HETA 2JDPA 5FZ1A 3J7MA 1V6LA 2TNFA 3AMPA 4XCAA 1W3XA 1X36A 3TN92 2RS51 1AR71 4GIQA 5FZDA 4IETA 3PMEA 4K40A 1V6IA 3PIGA 1SLCA 1WA4A 5F1RA 1NCQB 3I7DA 4Q4V2 1PO21 1RUD1 2D97A 4Y1UA 2PLV3 3K48A 1OPOA 5L19A 4PBOA 2GZWA 3JCIA 3N9NA 4YW7A 2LW8A 5FJHA 3ZYFA 5DAVA 1SPPA 1V6MA 3BGAA 1UY0A 4L2NA 3ZXLA 1YCIA 5G05L 3RWNA 2YGLA 3H7JA 2ZKLA 4P9XA 4OCTA 4E8DA 3O1UA 4TTGA 2Z4FA 2W1WA 1LULA 5GLTA 4B1MA 4AGVA 3HN3A 2HWE3 2Q5TA 4HANA 4AOCA 5KHGA 2JIGA 2XKOA 5FZHA 5J98B 1S1AA 3MV01 4CDXA 4CP2A 1IG3A 1QXPA 5L73A 4AFAA 2D98A 3K3OA 2QJVA 4LBQB 3LWCA 4MYEA 3WZ1A 1US2A 3MDPA 4IGQA 4UI9L 4Z2WA 5IAXA 5J36A 2P1BA 1W28A 3EJKA 1N1VA 1JU3A 1DHKB 2W1SA 1DQ6A 5FREA 2WNUB 4B4QA 1QGLA 2WUHA 4FFIA 1JYXA 4K6BA 3F2ZA 2BRTA 5GKAC 4Q5OA 1VBA1 1BHGA 3AZZA 4HSJA 3HJRA 4XCBA 4C0HA 2JB8A 2WZR2 1QMJA 2VZVA 2YPJA 3TWIA 3VHRA 1ND3B 1ZZ9A 4IEYA 3LA2A 4Q1RA 3WUDA 3SKVA 4D7SA 4LTAA 2RJKA 3OPTA 2EXHA 4YW6A 1RUG2 1RUI3 1EUTA 1LNSA 2FDHA 2Y60A 4IV1B 2EAAA 3FX3A 5CU1A 1N3QA 1S0FA 3JZVA 4GJZA 1SDDB 4IE0A 2MEV2 3T2QA 3I2OA 2JECA 2QKDA 4FAGA 3ZXDA 1W6OA 1WCQA 5EFUA 1X9TA 3EMRA 2HKXA 3LB9A 5JXJA 3N9LA 4MO3M 1W6OB 1VBC2 4CE8A 2JIJA 2VMHA 1IGOA 4PI0A 4CTEA 1H8TC 3IPVA 4A3ZA 3RYPA 1SBEA 3CMGA 2R0FA 3NAPC 4JGYB 3DYPA 5A7WB 2JD9A 1LKNA 3IB3A 2ZX0A 3LEMA 4H7MA 1DLLA 5A7WA 4N90A 4I2OA 1UZVA 4DQAA 3IMMA 4E2QA 4HOOA 1TME3 1UYPA 1SLTA 2R073 1K5JA 1W2OA 4LLOA 1BEV3 1SBDA 4AYUA 1BJQA 5FJKA 5A3MA 3PMSA 1JODA 1Z0HA 5FLIA 1PVC1 5C3QA 3S5AA 1OFNA 4CU9A 2VG9A 2B9UA 4OZXA 1OKOA 1YNAA 4DY5A 5F3GA 5CFCC 3ES4A 3ME2A 2D5HA 2VW2A 4PJYA 1YYNA 2CDPA 3KM5A 1RUG3 4UAPA 5GLZA 2GH2A 4P5YA 2ZOEB 3PUHA 4FPFA 2NMNA 2D43A 1F2NA 3NMBA 5A3OA 5JXGA 3R4UA 2H6CA 4DOUA 4F7ZA 1PGL1 4H14A 2WYSA 3LA7A 2J1AA 1JHJA 2RM22 5LZ6A 1XNDA 1H8VA 2A6ZA 2YGMA 1RC6A 3EQEA 3I2GA 5FPUA 5JMCA 2VW0A 2P6CA 4AHWA 1IQAA 3N35A 1WMEA 5FYIA 2LTNA 4CCMA 1ZM1A 2HWF3 4RQPA 2V09A 1DU3D 4FOWA 3BTYA 4Q4Y2 3SCGA 3S5QA 3ZXAC 2WS91 1OH3A 1AR61 3IAPA 5IATA 2D6PA 2UYAA 3I2IA 3ZN6A 3X29B 5FQ0B 3T0BA 1TVGA 5KXEA 2E7QA 5FUPA 1AL23 1TME2 3HNMA 3ZN6B 2AYHA 3IIIA 1MZEA 1UKGA 4I02A 2R49A 3SHRA 4H2AA 3U10A 1IS5A 4E2SA 5IK4A 2UWAA 1ZBE1 3OJBA 5D2AA 1VAVA 2R071 4DINB 4BJ0A 3WP5A 4XFFA 2JDNA 5FAXA 4YZ5A 2WO1A 4CCLA 2FCTA 2JJ6A 3SNMA 1EV11 2RJLA 4AL9A 2Y6HA 2ERFA 3AMNA 4TLFA 1V6NA 4KI5M 3WCRA 2XLGA 5T5PA 2ADDA 2IXHA 1Q8QA 5JVVA 3VBHB 5IYYA 1MZ5A 5FZLA 1UY2A 4P00B 2Q1MA 3J4UH 2XL7A 1R091 4NN0A 4FPLA 3IMNA 3KT1A 1J1LA 3B93A 3RZJA 3FJSA 4LMFA 3DN7A 2CU5A 1XYPA 1K5MC 4KU7A 2UWBA 2GALA 1FOD3 2ZHNA 4XW3A 2DBNA 2HWF2 5KR7A 1DIWA 2A6YA 2XQXA 3B5LB 3OY8A 3QLQA 4Z8BA 2XBO1 3V0BA 3OGVA 3KWVA 2EXJA 5C3SA 1UZZA 1GSLA 3MF9A 3MIBA 2HEVF 4XUQA 1WCUA 2N7GA 5C33A 4HBNA 4BHPA 3RJ2X 1BLZA 4N7UA 1GLHA 4YW2A 3RZLA 3LIGA 5AC92 3VN4A 3ABZA 5E1RA 1VMJA 3VDAA 1Q8PA 1WBFA 4PHZA 3MPPG 2A3YA 4A4AA 4NIAA 5GM0A 4AVVA 4BQXA 3IAQA 2ZHKA 5F7UA 3WLUA 2WYFA 4B7EA 5JZGC 1BK1A 2A3XA 4QM9A 5C70A 1S0BA 5DZEA 3ZR5A 2IVJA 3VBRA 1REFA 1G9CA 3B7MA 5HV4A 1QJZA 4XVHA 1QWRA 5ACA2 3FLTA 5F5IA 3OD0A 4UFIA 1AYN3 3NW4A 3OOXA 4JDNA 2BYVE 1VBA2 4QKFA 1OH4A 2RV9A 3WG4A 1W6MB 5B4XA 3WG2A 3W9AA 1FAYA 4C8DA 1Q8OA 2ZMLA 2X29A 3OEAA 2A7AA 3PVNA 3I2DA 4LA2A 3T1MA 4Z07A 3VL9A 4AFCA 1BVVA 4JAAA 4JQTA 1HJFA 4N53A 3TEYA 4M3CA 5FPVA 2XHNA 1BXHA 4LO8A 1PO13 3AZYA 1SFYA 2PAEA 4OHVA 3JUUA 1OOPA 1BK0A 1AVBA 4BDVB 5K8SA 2LS6A 3WNXA 4ZU4A 4OUSA 4ASMB 3ITQA 4NIIA 3UJOA 1YUDA 1AR73 2Y6LA 4LBNA 1VRBA 1W6PA 4KWUA 2B39A 4QPIA 2W1QA 4YM1A 1QJU2 1W0NA 2RS12 3ALQA 1UZYA 3H7YA 2BDRA 3VZKA 3AP5A 4R4ZA 4ZPIA 5AC93 2L9LA 1JYTA 3AMQA 3LQCA 3WP3A 2VMFA 4NHLA 2YYOA 1SZBA 2FZ1A 2W2IA 2DCJA 4QX8A 4Z82A 5CZKA 4ET7A 4DB5A 3ZFFB 1XSQA 5A1AA 3DCQA 5BNNB 3POSA 4MGKE 5HXVA 2JG9A 2XL9A 3RMYA 4Q0PA 3VL8A 2E26A 1ZBE2 3FFZA 1S2EA 5DAWA 1UOJA 1GZCA 2JE8A 1RUJ2 1RUF1 1VBD2 1ZVFA 1UU5A 4CSWA 5A1FA 4CXWA 3ZYBA 3RZHA 4AAXA 1ULFA 4LBMA 2JICA 4NO4A 3LPGA 4K8FA 1POV1 4XFHA 3UT0A 4JZRA 3LZZA 1AXKA 5DAPA 3ZXEA 4EN7B 4KH9A 2P6HA 2BZDA 4LHLA 4AW7A 5J37A 1W9SA 4KWKA 2G9ZA 3TBDA 4XTMA 4BWOA 1YLLA 5DG1A 4HVQA 1TMF3 4ZXKA 2XUMA 4XF9A 1VBB2 1VBB1 2VMDA 5KXBA 4MGTA 4CP9B 5FBJA 4PIYA 4EN6B 5C5UA 4IEWA 3VBFA 1WA6X 1XNAA 1HB1A 1VBE2 4CZSA 3RYKA 5A3LA 1AR72 4AQTA 1LHUA 3LPFA 3OG2A 3EYPA 3PLQA 4IEPA 4P9WA 4QDSA 2NYYA 3B02A 4OUMA 1OUXA 3N9OA 3THCA 1UPIA 1TNFA 2A73B 3MEPA 4QX5A 1MQTB 2C5DA 4WV8A 5CA6A 5I8YA 4OI1A 2XBO3 1IS3A 1HRI2 3TB0A 4YFWA 1FPN3 3J26N 4GJYA 4OMDA 4GMP1 4QHBA 5IVFA 1IHMA 1JUHA 5A3UA 5FZBA 1G9AA 4R9AA 4HLTA 3MV11 3A21A 1OF4A 1PIV2 4X8NA 5GALA 5K9YA 1JZ4A 1RUNA 3Q8CA 2SLIA 1VP6A 4XURA 1HW5A 3ZSKA 2GP5A 2WO2A 4CCCA 3LOBA 2E63A 3HBZA 4YNIA 4FVVA 1Y7BA 3C7OA 2JG8C 4MSVA 4WVZA 2TUNA 4HL0A 5J1XA 2DCZA 3LFMA 2ZZQA 3W5NA 1UPSA 1RJ7A 1H1MA 1V70A 3UGHA 4B29A 4B8EA 3WP4A 3C2UA 4QQPA 4XAAA 1W6QA 3FHIB 2FMDA 3PNAA 1Y43B 5I0TA 1ND2A 1VB4A 1J83A 1QH7A 2VUJA 4XFIA 4RFT0 2K0GA 4JKLA 4XIOA 1R093 4PI2A 1CZSA 3J8F3 1PM7A 4M3CB 4L92A 5FZ0A 2QQJA 4QXHA 3POWA 1AR63 5C9AA 4TYSA 1SPPB 5CVRA 2DCKA 2O1QA 1V9U2 1EV13 5FYTA 1PZ7A 3K4ZA 1YQ5A 1Q8VA 1KXGA 1UKRA 1AX2A 3KHCA 2P3YA 3ZYPA 1W6PB 2C24A 2JDYA 2NN8A 1IPSA 5C4WC 1COV2 3RSJA 1BZWA 4K21A 3E97A 4MHUA 2J1UA 4JGZA 4KGGA 3DPRA 4DPNA 2R041 4G9SB 2CV6A 2R1BA 4XACA 1X82A 2K2SA 2XJQA 4GWNA 2Y0IA 4E4ZA 3KB5A 2WS93 1DDLA 1RUG1 3M3OA 2DF7A 3QBQA 4XOGA 5L7OB 4DEVA 1TMF1 3MPBA 2ZGPA 5A7QA 4ARXA 1AL0G 2IXJA 1OVSA 2I07B 1QXRA 3KHBA 1XNBA 2V4VA 3MIFA 2W1UA 2CWSA 4NHMA 3M3QA 4XDQA 4Y1YA 4BOWA 4CDQB 5IHRA 3ZX7A 5DQ0A 3HT2A 3WNKA 1FYUA 2NPIA 4XMIA 1BBT1 4RYDA 4EZHA 2KA3A 2QCSB 4EWAA 1AR93 1S0EA 1IS4A 2CTVA 2DBIA 3OEBA 4XQ4A 1UN1A 3IDCB 5ABJC 3ZM8A 2VTXA 5JI9A 1UYZA 3V0AA 3LDKA 5C9AC 3MHZA 4NRMA 2I74A 3ZKUA 3TAYA 2CY6A 3OY8B 5DN2A 4CP9A 3FZ3A 3S0MA 1EV12 1RYYA 2HWB1 4XABA 1CESA 3PUSA 1NZCA 1ZRRA 1CD3G 2XVKA 4QQ2A 2VMEA 4UW6A 2KM2A 3BKZA 2JDKA 3AKPA 1ST8A 1WW7A 4IV3A 2YPDA 4BK5A 4COZA 2Q30A 2CYFA 4TLGA 1AR83 2A3WA 2JDMA 1ZBA2 1QJX3 1R1A3 1W2UA 1MR5A 2QZ2A 2OIIA 2WKKA 1KS5A 2VBPA 2XWJB 4OHXA 4UBHA 3NWKA 1OPMA 2ZEZA 1PO11 2WN3A 1E5SA 4QPGA 1VJ2A 5K0UC 1G9BA 3ZN5A 4U2AA 4W6XA 3I2JA 2A6XA 1E5HA 5FZCA 4NWWA 3WVJA 1RUC2 4DXRA 1UYYA 4LHKA 2WQ8A 3EO6A 3JBG1 4BQYA 4AEDB 1AXYA 5K4LA 4K1ZA 4XF3A 5BNOA 5JWPA 3ECQA 5I93A 2B7YA 3PTYA 2DV9A 2EA7A 1RUH3 1G9FA 2VXJA 2C4XA 5L7OC 3GJBA 4LUKA 2RS31 1KJLA 4CXXA 3USUB 4EROA 2PAKA 1RUH1 4YVWB 1AYM1 2R30A 3AZXA 4PBPA 3BODA 4P9YA 4TXWA 3THDA 4COYA 4NROA 2JKBA 2R7EB 4YVWC 1PZ9A 2YXSA 4QD2A 2OYZA 4D6RA 3IN9A 1LR5A 1O3RA 3MI8A 1OMIA 1XBFA 3BTAA 1IPKA 2ZGMA 3Q8BA 3VKNA 4JDMA 2E51A 3RWKX 3KCCA 4Y1VA 5C9AB 4OFGA 3WR0A 2VH9A 1LENA 1GZ9A 2IXIA 1QQP3 4AGRA 4Q27A 3M70A 4R8HA 1GP6A 1DG6A 1R1A1 2PXJA 2ZGNA 3MW2A 3WF3A 1W8UA 2WR9A 3K4AA 2E53A 2W46A 4LHNA 1O8PA 2D6OX 1ASJ3 1XXNA 4IGPA 1E57A 3O14A 4BCUA 5JOXA 1UZWA 2B45X 2HWE1 1LGBA 1BEV2 1JI6A 3KZ4C 2VR4A 3OPZA 4KG0A 4QGLA 2XXZA 2E31A 4CCJA 4I09A 4FO9A 1LU2A 3VZNA 2ZGOA 4AI1A 4XQDA 1J59A 2XONA 4CYDA 5F3IA 4BIOA 2D6MA 2MEV1 4WBBA 4BLJA 3WD5A 4LHSA 4RN5A 3U07A 1LECA 4WVMA 1B35A 3M1HA 4OI2A 4N43C 3LKJA 4EJRA 1TE1B 1PMHX 3USSA 4AHYA 3KT7A 4RL7A 3P3PA 2XJUA 4WVMB 1PX4A 1C1LA 3GDBA 4LJHA 4TWTA 3WDUA 5J48A 3VKMA 4GB33 3RQ0A 2VCAA 1CR7A 4A3XA 3AYEA 3Q8FA 2W0XA 3WQ0A 1XSRA 1OLMA 3D6EA 3K75B 3GBWA 1ODMA 2TEPA 1UO9A 3JB8A 4ZY9A 4CA9A 1H2MA 3CU7A 5EIYB 1VALA 2DVBA 2OVUA 3W20A 4Q4W2 3KGZA 2CGOA 5A6YA 1OD3A 1MQTA 1BQPA 5GLVA 4OYUA 2YBKA 2HWF1 5FYBA 2GDFA 3D4KA 2JE7A 2HH9A 4A7ZA 1GKBA 4KL1A 1DGWA 2BGPA 2FBEA 3MIHA 1DQ1A 3PVEA 3BB6A 4R9BA 5IJRA 3WDWA 1PIV3 1UF2C 1Z7S3 2WO3A 1BBT3 2NM1A 4XJWA 5A32A 3SISA 4QM8A 4IEXA 3UYJA 4BXFA 3CJXA 3T4VA 1COV1 5FXXA 1UMIA 5GLUA 3SQOA 3I54A 3MFAA 3NKTA 3QOPA 2G19A 3SEEA 3AC0A 1UX7A 4QGMA 1SHWB 1RTVA 1NLRA 4YFZA 3CBNA 1W6NB 1ALYA 1XJAA 3QD6A 1UL9A 5JSOA 1DQ4A 2VQTA 3CEWA 1IKQA 2XOMA 4YARA 3AKSA 4OI0A 3WDVA 1W6QB 4ZKTB 3MW4A 3FMGA 3IT8A 2WNUC 4PF5A 1N1TA 2PHXA 1AYM2 1JU4A 1EYBA 1POV0 1TME1 1UXZA 4UXAA 5FZ4A 2WAAA 4MXVA 5BV6A 1FV2A 2R061 4XYXA 2WFF2 4XFAA 3WV6A 1MZFA 2RMU2 2D6KA 5DDJ2 3BI3A 1GBGA 2PQSA 4LLFA 4MXWA 2CNAA 5JR2A 5JOZA 2JG9C 1WZXA 3KF3A 4JDOA 5ISLA 3I3QA 3UGGA 4ATEA 2RR11 3R6SA 2RR12 3FHQA 1FATA 4XC9A 2P3IA 3AL6A 1T6GC 3PVOA 3U4XA 5FKCA 3ZFEA 1ULOA 2JENA 4AFMA 4DEQA 4I30A 1NCRC 1JZ3A 5FYVA 3IDBB 3JQWA 3MFCA 4BK4A 1RINA 2OPKA 1DYPA 1H4HA 2GMMA 2QNKA 5FDBA 3E5XA 2VD7A 3I2KA 1LEMA 1UX6A 3BIEA 3WDYA 1NX9A 1C5IA 2XQRA 2WBKA 3ACHA 2P3KA 3CIHA 4HPKB 2DVAA 1AX1A 2YFZA 3TN91 5LCWL 1UD1A 1ZNPA 4Q0SA 1HQNA 2GU9A 3E6DA 4WVVA 2ZKNA 4C90A 1MEC1 2D5FA 2JG8B 2VOXA 2W94A 1V6JA 3H0OA 4Q0UA 3LE0A 2DCTA 1BVP1 4AFBA 3UV9A 3AKRA 1AR92 2WZR3 4AEDC 2JDHA 1OFSA 2R1DA 1S2BA 1WCDJ 2PTMA 4IE7A 4CP0A 2XVLA 1Z78A 3CNAA 4PF1A 1BYHA 4TN7A 4MGQA 2AUYA 5L9RA 2DURA 1JW6A 3DYOA 4DRRA 5IK8A 1WD3A 2BPA2 2HLEA 3CZUA 4X6RB 2FDGA 2FZ2A 5H9QA 3IM0A 2MPFA 1RGSA 5DDJ3 4S2DA 3RFRA 4QMAA 3VBHA 5JXIA 1ZX5A 3OF1A 1S0CA 3DKWA 4HN0A 2GH8A 3D0SA 2Q1ZB 4CDQC 3FL7A 2ZGUA 5E88A 4LQRA 4IDZA 5FMOS 1ENXA 4CCKA 5FUNA 3MLLA 2WNVC 1N1YA 2VM9A 2ARBA 2DUOA 2UY8A 3KQ4B 4YW5A 2ARAA 3VBSA 1S55A 5CFCB 5GZCA 4J1XA 1GNYA 2OXBA 3ZYJB 1W03A 4YVSB 4ISRA 1JYIA 1AR82 1KITA 3A22A 3A4UA 1MEC2 4XJ9A 2DTYA 5FPLA 5CFCA 2FCVA 4J1WA 3HD8B 3I4IA 1SQ4A 1F4AA 3KF5A 3VD9A 3O1PA 1EAH3 2VUAA 2YZ4A 3QCWA 4Q26A 2UY9A 3UKTA 5AC91 2GC2A 5B4NA 5I0DA 5KHHA 3DECA 4E9KA 4H55A 1CWPA 1MS5A 1K5MA 2C26A 1WLTA 3S30A 1H4GA 4EWEA 5T5LA 1B35C 1QNWA 4MUVA 1L3JA 4B7KA 2IWGB 3NJYA 4NPMA 5BNOB 3GZEA 1LRHA 1TZOA 3WNPA 2P2KA 3D8CA 3NAPA 1C57A 2QQVA 1GANA 2XR4A 2QQUA 5C7GA 1UOFA 3GM8A 1ZBA1 2EXKA 1C3HA 3C7GA 1AJOA 2XB6C 4YSFA 4LBKA 4HK9A 2RDSA 1RJ8A 5ABJB 1UYXA 3HMYA 2DU0A 2R16A 2J42A 2BQPA 3SITA 4MLOA 2VQ0A 4BPZA 3R4SA 4YW4A 4L8QA 4EN9B 4UFLA 3UK9A 5KHJA 3FBMA 4QDRA 4XFGA 1K45A 2WWJA 4KNCA 4CPBD 5CFDB 4P9LA 3PUAA 1W04A 1YO8A 1RUOA 2HWB2 3TEWA 3C7FA 2VZRA 5HCHA 2YDEA 4H7LA 4B1LA 2O8QA 1RHI3 3N9PA 5FMOL 1IPJA 4Q4X3 3FUQA 5FMBA 4COWA 4CU7A 4YG0A 3RZMA 2WLQA 5FO9B 2F17A 3MIEA 4IUGA 1ODNA 2R043 3U78A 3CKHA 4NAMA 1ZZCA 2G1MA 5JLVA 3AYAA 3KVAA 2OQ6A 5EJ3A 5DMYA 4R4XA 1QU0A 1W2TA 2E7AA 3RI8A 1RUE2 1N47A 4QWNA 4D8MA 5L7OA 4GH4B 4BQ5A 4E4HA 1HJGA 5I0UA 1HKDA 5BNNA 4MG2A 4W8JA 1RUF2 1RUJ1 1VBD1 2V73A 3HIFA 4S2HA 5F8PA 2VTXJ 3MZHA 5DZGA 1AL22 3KS7A 1D4VB 5C3OA 3DUIA 1IKPA 1MQTC 5FWEA 3OGGA 4LITA 3O1OA 2DVGA 2LUWA 4FQ4A 1RVF3 4E8CA 1U0AA 2V72A 1REEA 2HJIA 1HQWA 1W8TA 3NVCA 1AX0A 5K0UA 1PVC2 2ZAHA 4IE4A 4I3GA 1DLCA 4QQHA 4XTPA 1R092 2WFPA 4AK3A 2AEYA 4BH9A 4HVRA 2QBXA 5LB6A 3I3MA 2LRPA 1HB4A 3I3DA 3MLJA 5APAA 1ENRA 1RHI2 3E5QA 4ZXEA 2ZX1A 1WGPA 1VBC1 2ZHLA 4LK6A 3GHNA 4D6SA 2YFUA 5LA1A 2P4EA 2VZ3A 4N43A 4QPWA 4SBVA 3NV2A 3VDDB 4PLOA 4YGDA 1LTEA 1QIQA 3U37A 1O3SA 3O12A 3CQOA 2WLPA 1PO22 1RUD2 2PFWA 1SLBA 2A70A 2CAUA 4NUBA 1WKYA 1LEDA 4Q4V3 1FX5A 5LEJA 3VD7A 3T30A 4Y4RA 3NO8A 3HQRA 2KR2A 4YM3A 3VDBA 3A7QA 1UMHA 4INDA 3LDRA 1RXGA 3O7OA 2DWRA 2NMOA 3NNFA 2Z79A 4LXLA 3MF6A 1QDCA 2WS92 4ZS2A 2GC1A 2Y6FA 2WJSA 4MGIE 3SH5A 5FZAA 3RJRA 3UESA 1EPZA 5BUVA 2BBAA 3VBUC 1PGSA 5FZOB 1WD4A 4A41A 5KC6A 4UWDA 4QKDA 4FFGA 1GQHA 3AP9A 3MW3A 2BP6A 3NV4A 5JIAA 3NV1A 2JD4A 5H9RA 2Q8OA 3VD5A 3B3QE 1JYVA 5C3RA 1RVF1 4YPJA 3NAPB 1UIKA 1C8M1 1D4M1 1WWYA 2YROA 2EIDA 4YVWA 3W59A 4DO0A 4JQRA 4JGZC 2BJSA 4EZ4A 1PMIA 2PYTA 4CEWC 1YJKA 4AQ6A 5HCBA 5FXZA 4CEYA 3IWZA 5FZ3A 3SCHA 3L2HA 4BISA 4UF0A 4LEJA 5KC5A 1F5JA 1CN1A 4MXWB 1S0DA 2ADEA 2WL1A 3P3NA 1LGCA 2RDQA 4LK7A 4Y22B 3AFGA 1IS6A 4UBGA 1DCSA 3FC0A 1QJU1 1H2KA 2RS11 4V2VA 4ZU7A 3ZFEB 4ZONA 4LA3A 3ZSEA 1V6KA 4GZ9A 4M4RA 4UW3A 4UYBA 5GZDA 1JZ8A 2IFRA 2W39A 3BALA 3LOIA 4I0BA 4NIGA 1QJX2 5IAVA 1GNZA 1LOBA 1WW6A 2XDVA 1QHDA 2IFWA 3EXUA 5LASA 5BYNA 1DBNA 1H2LA 3OGSA 2W5FA 5CBLA 2JG9B 5FQ0A 3I2HA 4Y5Z0 4XFBA 3GZTB 2DTWA 1CAWB 2DFBA 4JCKA 1QXJA 3T2TA 3NQHA 4M0NA 1PK6B 2FDFA 1ZRIA 2WINB 2ZGQA 5ANNA 4AAPA 1RUC3 3KV4A 4ARYA 4D94A 5EV7A 2YU1A 1RMU3 4URTA 4ZHNA 1VPHA 3ST7A 4CDUB 2W3JA 4G3YC 4XDOA 3ZSJA 3WF0A 1UY1A 1B35B 1JN2P 1QOOA 3JD71 1OVPA 3BTXA 1QOTA 4GALA 4A44A 5ERLA 4IEOA 1FXZA 2KXLA 3WW4A 3NNLA 4QB1A 4P9GA 2EIBA 4LPLA 4AHZA 4K1YA 5JPNB 5FZFA 4FTSA 2YUEA 3PTRB 2HBTA 1HLCA 3CDZB 5LBEA 2QQOA 1OC1A 1ENSA 2P17A 2R0HA 4O61A 3VBFB 4DXZA 5K0UB 4F8AA 2FD8A 4FP3A 4LIVA 1GUIA 2QFEA 3B69A 4WM7C 2RM23 1NYWA 3OD4A 4K7JA 1DQ2A 4HK8A 4LBQD 5EHDA 4JGYC 1DP0A 5DDJ1 5A3NA 4NRQA 1JYNA 1LOAA 4E27A 1PMJX 4LULA 1CAVA 1QY4A 3OGJA 3SLIA 2WABA 5E89A 1FNYA 1QQP1 5A7PA 1PM4A 4QKBA 3KV9A 2VNRA 4OUEA 3H1MA 5FBZA 2A1XA 5FXVA 1TEIA 4DXSA 5FK8A 3VD4A 3HQXA 5A32B 4DXTA 5DUUA 4XXPA 2XKPA 5ACA1 1Q56A 3O1SA 2D93A 3THPA 2Y6JA 1K5MB 5KWRA 1FPN2 1CPNA 5IWFA 4L9BA 3BTZA 1I5ZA 3CJIA 5LBCA 1W06A 1BMV1 2VBDA 2B5HA 2VZUA 5D21A 1Q43A 1CIWA 4FFFA 1IOAA 1CVNA 4JGYA 3ILRA 1VB2A 4O9GA 4LKFA 4WM7A 5F6KA 5HPOA 4PQ9A 1KQRA 4LR4A 2JX9A 2VNGA 4AEKA 1KFXL 3VLBB 2HEWF 1QJFA 2RM21 1HQLA 3H8XA 3PVBB 2VCMA 5FPAA 2RJ2A 3ZFGB 4P08A 1YFXA 1ND2B 2OW4A 5LY1A 4AI0A 3JXSA 4OQ8A 3HVDA 1W2NA 5FYSA 1I6XA 1EUUA 2BTVC 3TN93 4XDPA 5D8AB 5FTTC 1MS9A 3FFQA 1CZTA 5IFTA 1DGWX 3USUA 2XMLA 5LBBA 1X7NA 4TZDA 1MS3A 1KDMA 1W8NA 4GULA 3DV8A 4GWJA 4MX3A 2OZJA 1U5IA 4XQWA 3V64A 4D7YA 4MADA 1GV9A 1NE6A 1OA3A 5A6XA 1J3PA 1NZIA 1XYOA 1PZ8A 1OD5A 1AL21 2EF6A 2BEOA 4DUXA 1SLLA 4PDWA 2OX0A 1C4RA 3HBKA 1JOJA 4A6OA 3TEXA 3ZFFA 4FPOB 2YMZA 3NNMA 4RQPB 2OKXA 1HB2A 1MACA 4P9IA 2F4LA 4HZFA 3ZXKA 1LU1A 3R05A 3FLPA 4K9SA 3UJQA 4AFDA 5TSWA 2BVVA 3V65A 1V00A 2HWE2 1OHFA 3M4FA 3VZMA 2DYCA 2NP0A 3HR9A 5C6CA 2IC1A 2ZGRA 1AUYA 3ETQA 3GALA 2ZEYA 1HRV2 4AEMA 1Q8SA 1AYN2 1GZWB 3N3HA 4S2FA 5HXMA 3SKJE 4TSVA 1F4HA 3P5BA 3ZKYA 4OLLA 3OCPA 3OBZA 1GZWA 2EXIA 2FHRA 4L0PA 1GP5A 1HXS3 2ORZA 4QKNA 4HKWA 2YU2A 5AVPA 2WRAA 1GWKA 3PIJA 2LROA 1N3OA 3H3ZA 4CCNA 5C4WB 1T6BX 3TNPB 1K3IA 5BXXA 1XE0A 1OA2A 2W95A 3H9AA 1HXS1 1OKQA 4OQ9A 4OVEA 5CEHA 5FR3A 1H6YA 1NQJA 1O7FA 1X9PA 4JHZA 5FUIA 1WMFA 4S2GA 4L99A 1BEV1 1PIV1 3WP6A 3AVRA 3RVHA 2WDBA 4QHOA 1R64A 2V5YA 2ETEA 1YWKA 3BVCA 5A3WA 1CAXA 4RR3A 4R52A 1AJKA 5E6HA 3PJYA 2GC0A 2GC3A 3A23A 5A6ZA 4LUMA 2X10A 3CO2A 4XILA 4ATFA 2VVFA 3VUOA 3V0BB 2PQQA 3U0ZA 1UNBA 1NUKA 3N7KA 4V2WA 3ZXFA 2MEV3 2ZEWA 3M3CA 4YLZA 2VULA 5FY9A 5SV5A 3OBAA 2E6VA 2HYKA 2ZA9A 3B9CA 3ZSLA 5AFEA 4D6QA 2PMWB 4PLMA 4RSUA 2IZWA 1CGPA 5JMOA 2CWMA 1F5FA 1LHOA 2VOKA 1LOFC 1ND3C 4XJAA 2DUQA 2JB4A 4LT5A 2DCYA 2J7MA 4CDWC 5CYYA 4BE3A 4X6QB 1ENQA 2W91A 2HYXA 4UFKA 3JD72 4ASKA 3D3AA 1UW8A 1Y4WA 3AJYA 3TNQA 3ZPYA 4UW5A 4HN1A 2D44A 3N36A 1OOPC 3VKLA 3ZYRA 1RL3A 3VBRB 2ZX3A 3AYDA 1QNYA 4WZCA 5D1IA 4BLIA 3ZFGA 4IE5A 4OHZA 5BNQA 5DPNA 5F9TA 5CFDA 1M4WA 3JU9A 4BMEA 4X8PA 3IBMA 2JEMA 3IIAA 3POJA 4HG6B 1GOFA 3LDBA 5LWBA 3VBSC 3TOJA 1VR3A 2DVDA 4GAZA 2Q1FA 2WT0A 4PIZA 1W8OA 1OF3A 2BW8A 2LM3A 1OLQA 2X5IC 1NCQA 1SLAA 2Y33A 3ON7A 4A6SA 5BNNC 4HVOA 3I49A 4CCDA 4LBOA 2JKXA 2D7FA 1QQP2 4DZGA 1BKZA 2VL4A 5C8CA 3WQBA 1ONAA 5JZGA 4I0AA 4RD7A 3J9SA 5T54A 1FMD1 1URXA 1KD7A 2JWPA 3VZLA 5EJ1B 5A70A 4I3PA 3QH7A 1ZREA 5L9VA 1Y9MA 2X5IA 2Y38A 4PDWB 1OQDA 1PK6A 1Y3TA 4GWMA 1O91A 2OUHA 3J7LA 4JHTA 3JQXA 2XJRA 4OMCA 3KGLA 4SLIA 3C7EA 4P14A 4NRPA 4QU1A 3JD73 5CKMA 2QQLA 3J7NA 1O6UA 1NQDA 1YFUA 4LKDA 3N7JA 1JHNA 4LNVA 4UW4A 4XE9A 1AR81 1O5LA 4KBBA 4W65A 3RZZA 3WNOA 4COVA 5FLHA 3POEA 2RDRA 4FPJA 1RUC1 4Y3OA 5DAQA 4AR2A 4CDWA 3OSDA 3TYJA 3JBG3 4AI8A 3AK0A 5AFBA 5BNPA 1AXZA 1ND3A 2ZBJA 3PUQA 1D2QA 4H3WA 4CDWB 2QDRA 3DKQA 2C9AA 4JC1A 4YWAA 1DQ0A 5BNPB 2HWB3 1ULEA 4DS0A 3D5OA 3T3YA 3O0VA 1U12A 4IGOA 4LBLA 2AC1A 1H2NA 1H9PA 4XHXA 2XUEA 4EE2A 1UMZA 2RS52 5DUXA 5FCCA 5M0TA 2AGSA 1VRH2 5C8WA 4J6GA 4WZFA 4Q8KA 1A6CA 1RMU1 2H0BA 3ETPA 3PUIA 1OSGA 2EALA 3KCYA 1AZDA 2WZEA 3GXUA 4RR3C 3ZIWA 3T4HB 4A7KA 5IK7A 4LE3A 5IUQA 3VDCA 2A71A 3LF7A 3MIGA 3KLSA 5F5CA 4RR3B 2XJSA 3SXWA 1JZ7A 1KJRA 2AZ5A 1S0JA 5FMDA 4KQ7A 2MNGA 1AF9A 5FYYA 1F15A 1STMA 3GZUC 4LKEA 1JBCA 1WLWA 5DXDA 3AZVA 1PK6C 1S0IA 4HT1T 5ANQA 4IESA 3SEPA 4IXLA 2WNVA 2X8KA 4DRVA 3PU8A 1HN1A 4Y20A 3VV1A 5F2SA 2BVBA 4YRDA 1XNKA 5CG9A 2OUJA 4NWVA 2VOWA 1YI7A 5FV3A 4FXGB 1KDKA 5I91A 3H8UA 5A7NA 2H6BA 5F6LB 4JKKA 1QJEA 3VZJA 2ZJCA 4YZ2A 3THTA 1DF0A 1H0BA 3ZMOA 3OPWA 4FBFA 1O4TA 1CPMA 2QQNA 2W08A 3PDQA 2A6VA 3APBA 4AI9A 1NCQC 5JXHA 1GZTA 1OQ1A 4XJ8A 1C8M2 1D4M2 2F4PA 5D8AA 4AHXA 1MS1A 2FDJA 2P5BA 2RMU3 1JTZX 3BU7A 3PU3A 5CFDC 2G9GA 1I5PA 3ZFGC 4XF1A 4BIFA 2XH6A 3DXUA 4CCEA 4FPYA 2Q8DA 3O0WA 2BV4A 2VZPA 4AGGA 2P34A 5LK7B 2ENRA 4XF0A 2WA4A 5FRAA 2IXLA 4YZ3A 1UCXA 5I0SA 1W39A 3I3EA 5CKQA 1JXNA 4XEZA 4GQ7A 2BNOA 4BQ2A 2BGCA 3M7AA 5FKBA 1YXWA 2D3SA 1JOPA 1U5XA 4LO4B 3L2YA 5EZWA 3WUCA 1UWWA 4KBZA 3ZFEC 2VMGA 3RPQA 5T52A 2CDOA 4LO6B 5I8SA 3WG3A 3AX4A 4CVUA 3WNMA 2VC9A 2GN7A 4MHRA 1H8TA 2E9QA 4HXCA 1J1TA 1GICA 4B3NA 4EWDA 2O14A 1F9KA 3SCFA 2BOIA 3D0JA 5DZFA 5CKNA 1HRV3 5GLWA 4LOTA 1LJ7A 2R072 3B00A 2XGXA 4N8MA 4HKLA 3DPRB 4JVAA 2HWD1 2G9FA 2W9XA 3GHMA 4GH4A 3R4DB 1RB8G 2BFUL 2UWCA 4BB3A 2VUDA 3HT1A 1RUJ3 1VBD3 4META 4IEVA 2P37A 2VO5A 2F6BA 2WNUA 5T3NA 3CHXA 2YG0A 3O1MA 2QUOA 1JMUB 1NY71 4XBQA 5CB7A 3OUHA 5F32A 3ZR6A 4BZ4A 1PVXA 3WDXA 2CGPA 3MLKA 2FDKA 4HSLA 3FUOA 3OGRA 4JKMA 1QJY3 4NHKA 3O1VA 1ZZ6A 1SDWA 4YM2A 1UU4A 1GR3A 4FPCA 3ELNA 5CNAA 2JDUA 2RMU1 3O5SA 2RVAA 3VBSB 4QB6A 3VB9A 3ZXJA 1FV3A 2GMEA 3AFKA 1GYKA 1C8NA 1SLIA 2LALA 3AP7A 4E4DX 3IDAA 5FO8B 4LOSA 4KG8A 3FN9A 1VBE3 1N3PA 1LHVA 4GMP0 4RGGA 3VBOA 1C5HA 3BOWA 2H0VA 2R32A 5FZGA 3VDDA 1JH5A 2XJTA 4QX2A 1WMDA 1UY4A 2WO7A 4O7XA 4CEWB 3RG0A 2ZGSA 2Q0AA 1YI9A 3VHNA 2E7TA 1WUVA 5A33A 1FMD2 4CDXC 1ULDA 2QTWB 1XQNA 1HRI3 4QAWA 4Q4Y3 2QQWA 2VZQA 1T2XA 3VGIA 1TNRA 3AP4A 2J1SA 2A6WA 4OHWA 5L36A 1SBFA 2CGNA 1GOGA 1UAIA 4FT8A 1UOBA 4YGCA 5LA2A 4FSJA 1W6NA 4JTNA 4Y4YA 1VMFA 2WNVB 4GKYA 4Q4X1 2YV8A 1QJX1 2G4IA 2ILMA 3T2OA 3LEIA 1LHNA 5FZOA 3EB7A 3H50A 1GQPA 4Q1PA 1VMHA 4R9CA 4AXOA 5EWSA 4ES8A 2WQZC 1PGL2 1ACCA 1MVQA 2AREA 2QQPA 4NR1A 1POV3 3NNGA 4GB31 5LA9A 4C1XA 5FOJB 1RXFA 3MBWA 4RHV3 3GYDA 1OQEA 1VAKA 3NL1A 2IXCA 4M4PA 5IVJA 3KVBA 1NXMA 3OUIA 1Q5OA 3KV5A 4XAEA 4Q2FA 3AM2A 1OOPB 1JS9A 4D69A 1AR62 2DFCA 3MGUA 4QXCA 4XUOA 3S7IA 4OHYA 3G6JB
chains in the Genus database with same CATH topology
4RFRB 4IDZA 5F8PA 4NPLA 4NRQA 4ZHNA 2FDHA 4NIDA 3I49A 4CXWA 4QKDA 4CXYA 3RZHA 4NPMA 3S57A 4QHOA 4NIIA 3I3QA 2FDIA 2IUWA 3KHBA 3BTXA 3T4HB 3H8XA 3RZMA 4QKBA 4IE0A 5DABA 3O1OA 3H8RA 3I2OA 3BKZA 4NIGA 3BU0A 3LFMA 4QKNA 3S5AA 3KHCA 4NJ4A 4QKFA 4IE7A 3H8OA 4O7XA 3O1MA 3BTYA 4IE4A 3O1PA 4OCTA 3O1UA 4IE5A 3O1RA 3O1SA 2FDKA 2FDGA 3RZLA 4CXXA 4O61A 2FDJA 3I3MA 3RZJA 2FD8A 3O1VA 3T3YA 3BTZA 4MGTA 3T4VA 4JHTA 4ZS2A 3BIEA 3RZKA 4NROA 4ZS3A 3BUCA 2FDFA 4NRMA 3O1TA 3RZGA 4NRPA 4NIHA 4IE6A 4MG2A 3BI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RFR B;  4IDZ A;  5F8P A;  4NPL A;  4NRQ A;  4ZHN A;  2FDH A;  4NID A;  3I49 A;  4CXW A;  4QKD A;  4CXY A;  3RZH A;  4NPM A;  3S57 A;  4QHO A;  4NII A;  3I3Q A;  2FDI A;  2IUW A;  3KHB A;  3BTX A;  3T4H B;  3H8X A;  3RZM A;  4QKB A;  4IE0 A;  5DAB A;  3O1O A;  3H8R A;  3I2O A;  3BKZ A;  4NIG A;  3BU0 A;  3LFM A;  4QKN A;  3S5A A;  3KHC A;  4NJ4 A;  4QKF A;  4IE7 A;  3H8O A;  4O7X A;  3O1M A;  3BTY A;  4IE4 A;  3O1P A;  4OCT A;  3O1U A;  4IE5 A;  3O1R A;  3O1S A;  2FDK A;  2FDG A;  3RZL A;  4CXX A;  4O61 A;  2FDJ A;  3I3M A;  3RZJ A;  2FD8 A;  3O1V A;  3T3Y A;  3BTZ A;  4MGT A;  3T4V A;  4JHT A;  4ZS2 A;  3BIE A;  3RZK A;  4NRO A;  4ZS3 A;  3BUC A;  2FDF A;  4NRM A;  3O1T A;  3RZG A;  4NRP A;  4NIH A;  4IE6 A;  4MG2 A;  3BI3 A; 
#chains in the Genus database with same CATH topology
 4NHX A;  2UYB A;  1W90 A;  4OUL A;  5FY5 A;  2VQA A;  1YQ2 A;  5T50 A;  2ATF A;  2EIG A;  4QPI B;  1SEF A;  4QHZ A;  5I0R A;  5FK7 A;  3J8F 2;  3WF4 A;  1EP0 A;  4Z92 B;  4Q4X 2;  3B9I A;  4FOY A;  4CU8 A;  1JOB A;  3NJZ A;  2X5I B;  5GZF A;  1KEX A;  4MGS A;  2X53 S;  3J7H A;  4HKO A;  2CSG A;  5C71 A;  1XU2 A;  3CF6 E;  3N4M A;  4ZU5 A;  2ZX4 A;  2ZGT A;  3LIH A;  2QQM A;  3H1W A;  3NKG A;  1DZR A;  2VOT A;  4FQZ A;  4NAO A;  4AI3 A;  1RUE 1;  1RUI 1;  2ET1 A;  3LEK A;  4QX1 A;  1IG0 A;  3OBR A;  1QEX A;  3RDI A;  3U1X A;  4Y1Z A;  5A1L A;  5KXD A;  3ZXG A;  1S0G A;  2C9K A;  4JRA A;  3LFI A;  4QPY A;  3ZDS A;  4ES9 A;  1AHS A;  1CAW A;  3D82 A;  3PHM A;  2WSV A;  2GP3 A;  3AYC A;  5FY0 A;  4FAH A;  1SFN A;  2ORX A;  3ZSM A;  4CDX B;  4RS5 B;  2VPV A;  4K3U A;  4EN8 B;  3FE5 A;  1VBA 3;  3H3L A;  2FDI A;  2IUW A;  3F95 A;  4CDU A;  1AYN 1;  2X09 A;  1PX3 A;  2CHH A;  2O0O A;  5C4W A;  2E32 A;  1CON A;  1J3Q A;  3VBU A;  2B42 B;  5DUW A;  4RA0 A;  3ZMN A;  5JSR A;  3MIC A;  1POQ A;  3VBU B;  1LOE A;  2EIC A;  4GKX A;  2PHD A;  2ES3 A;  1DFQ A;  1KS4 A;  1PO1 2;  5FY4 A;  1RUI 2;  1E5R A;  2P3J A;  2WZR 1;  1JZ5 A;  1X33 A;  1GOH A;  3WW2 A;  4WVW A;  3DEM A;  3IDE A;  1G86 A;  4W6Y A;  1CAX B;  2J1R A;  2RR1 3;  4GWI A;  5FPX A;  5IK5 A;  4YVS A;  5KHI A;  4M3C F;  4GA9 A;  4JV4 A;  3K2O A;  2TBV A;  2VW1 A;  2Q8E A;  3WG1 A;  4JTO A;  5KBF A;  1XRU A;  1W0P A;  3GNE A;  2ZHM A;  1ND2 C;  3ACI A;  1J3R A;  1YIF A;  1NA1 A;  3NJV A;  1VBC 3;  3OYW B;  3DYM A;  5FPB A;  2AEZ A;  4BQ4 A;  1A3K A;  4PT6 A;  1NA1 B;  1W3V A;  4B4P A;  1FOD 1;  5DAX A;  5T55 A;  2JDZ A;  2OPW A;  3OTF A;  5DUV A;  1NT0 A;  5KHK A;  2ZMK A;  3KMH A;  1NA1 C;  4YGB A;  2YC2 A;  4V1P A;  1DZQ A;  4FOV A;  1VRH 1;  1US3 A;  2W92 A;  2X05 A;  4M0H A;  4AEJ A;  5HBA A;  4GXL A;  4YVS C;  1OBN A;  3IPV B;  5FZ8 A;  4P5H A;  5IVV A;  2ZPX A;  2B4K A;  4P02 B;  3UKV A;  1HB3 A;  2EVX A;  4ITC A;  4W6W A;  2VOV A;  2HWC 1;  4BM8 A;  2VUC A;  3WEZ A;  1LB2 A;  4ISQ A;  5EXO A;  5FP9 A;  2XG3 A;  1MVE A;  1XB9 A;  3WT3 A;  3AMM A;  2Z42 A;  3LAG A;  5CIS A;  3H42 B;  1MS8 A;  1S2K A;  1NLQ A;  1ZYB A;  3ZIX A;  5ABJ A;  4AVT A;  4WM8 C;  2GNB A;  4A42 A;  5CG8 A;  3ASI A;  1VIW B;  2ZS6 B;  2CAV A;  4FOQ A;  4EN0 A;  1KRI A;  1X8E A;  1WCK A;  4XMA A;  4AWD A;  2GND A;  2NQY A;  3MID A;  3ZN4 A;  4CEY B;  3O1R A;  3MO4 A;  2PAM A;  4Y1X A;  4CDU C;  1H9W A;  2PHR A;  3I59 A;  3Q9O A;  4CEY C;  1XC6 A;  1NCR B;  2V4A A;  4FP2 A;  5FZM A;  2YC4 A;  1JUI A;  5GZG A;  3K46 A;  4UFH A;  3ZPO A;  3LGR A;  1ZRD A;  4QB2 A;  1D7P M;  2VVD A;  1YQ6 A;  1VBB 3;  1DGL A;  5FXW A;  3RYR A;  1Q3E A;  2WT1 A;  3DXT A;  3T2P A;  3FHA A;  4PIX A;  3VBF C;  1MS0 A;  4QX0 A;  4YGE A;  4AF9 A;  5LA0 A;  1U5Z A;  3ATG A;  4P9J A;  3N7L A;  4D3W A;  2WA3 A;  3B01 A;  3ACG A;  1XPW A;  3H3U A;  2BGO A;  2WN2 A;  5FP3 A;  4NID A;  4YW3 A;  3WXP A;  4YG3 A;  2VE1 A;  3VZO A;  2QDN A;  5JDB A;  2QVS B;  3PJQ A;  2ET7 A;  2QQI A;  3I3B A;  4QX7 A;  1DZT A;  5FYC A;  1FNZ A;  2ZTN A;  2WWU A;  2XJP A;  4JGZ B;  1NOV A;  4K8R B;  1MPX A;  1NG0 A;  1XE8 A;  4IQP A;  1A34 A;  3ACF A;  2ZAA A;  2Y26 A;  5CAZ A;  1I9R A;  4AVC A;  4IW3 A;  2RS3 2;  5EPA A;  2WZ8 A;  3KD4 A;  3G7D A;  3WCS A;  2WT2 A;  4A2U A;  1CX1 A;  4UFM A;  4CU6 A;  4NPL A;  4HPK A;  1XE7 A;  2VZO A;  3N9Q A;  4IL7 A;  4QU2 A;  2VZS A;  4YG6 A;  2PHT A;  3T09 A;  1B09 A;  4MGY E;  1RMU 2;  1GWL A;  3E5U A;  2AR6 A;  4Q0Q A;  1UU6 A;  3AP6 A;  3POB A;  5FLJ A;  1HDK A;  5FOB B;  5JOW A;  3NJX A;  4FFH A;  1R1Z A;  5IVY A;  4GB3 2;  1X50 A;  2PHW A;  2BNM A;  1MZ6 A;  3MUY 1;  5FZK A;  2YBS A;  2I45 A;  2XJV A;  3CZJ A;  4BA6 A;  4AVB A;  2EIE A;  4O9E A;  1R08 3;  3HNY M;  1A8D A;  1G8W A;  1L7L A;  3GCX A;  4XIK A;  4RGA A;  1A78 A;  1RIT A;  2XPJ A;  1CAV B;  4O65 A;  3BPS A;  5I8T A;  4DUV A;  2ZGK A;  5F39 A;  1KGY A;  1L7Q A;  1UIJ A;  1LOC A;  3L9J T;  4IV1 C;  1OA4 A;  1SG3 A;  2VXR A;  5T5O A;  4MVT A;  4AZZ A;  4DUW A;  5J3U A;  1KFU L;  1OUR A;  3BYW A;  1FOD 2;  1FMD 3;  2EAK A;  3MUZ 1;  5D8A C;  5IVB A;  1BBT 2;  3BOP A;  1TQ5 A;  2K46 A;  4LBJ A;  1HN0 A;  5IW0 A;  4QX3 A;  2ZGL A;  2CL2 A;  2QE3 A;  2PEL A;  3E6B A;  3VD3 A;  1QH6 A;  1OXC A;  4EV0 A;  1RUE 3;  3HOB A;  4KWJ A;  3ZO0 B;  3CJI B;  2QZ3 A;  4CUC A;  5JIU A;  1BMV 2;  3VDD C;  1LAJ A;  4Y20 B;  4XUP A;  4M3C E;  2ZMN A;  5G04 L;  4F83 A;  1SCS A;  4C1W A;  2W52 A;  1XNC A;  1Z7S 2;  1WCS A;  2BWA A;  2VBB A;  3GBG A;  4WM7 B;  3O1T A;  3LSE A;  5HI0 A;  4L11 A;  3VKO A;  4LIU A;  4D7T A;  4CXY A;  2J1V A;  4NHY A;  1L7R A;  5H9P A;  2WNE A;  4AED A;  5ACA 3;  1DGR A;  5LBF A;  4CUG A;  3I2F A;  3RNS A;  1ULG A;  1EPW A;  3ES1 A;  2JDA A;  1U5Y A;  2ARX A;  1NXD 1;  3LD8 A;  3MYX A;  4JX0 A;  4XF4 A;  5FWJ A;  4RHV 2;  3PUR A;  1ZZB A;  4PLN A;  1AYM 3;  2J1E A;  4ONU A;  4QXK A;  4YW1 A;  2PN5 A;  5FIX A;  2GN3 A;  4XZU G;  3BCW A;  3RS6 A;  3LA3 A;  2Y6G A;  4QQL A;  5AVA A;  2AAC A;  5K7P A;  1W6M A;  2NLR A;  3AKQ A;  4IEQ A;  3S7E A;  4BMB A;  2RS5 3;  3ACL A;  3FLR A;  1RIR A;  4GH4 C;  4BQW A;  1YQ8 A;  1DQ5 A;  4Y22 A;  4FCA A;  1NCR A;  4ASL A;  1GU3 A;  5LW9 A;  4IE6 A;  5F5A A;  1CX4 A;  4Y5T A;  5JI7 A;  5EQU A;  4EYU A;  5LEK A;  4XFC A;  5A7O A;  2HBU A;  4XPV A;  4AI2 A;  4AQ2 A;  4CP1 A;  4XBL A;  2D40 A;  3UKN A;  3HPN A;  5HV0 A;  1ZBA 3;  2R6Q A;  3Q8E A;  2VMI A;  1D2S A;  2FQP A;  5E16 A;  1R08 1;  2VTF A;  2Y8K A;  1PO2 3;  1RUD 3;  1H6X A;  3I8T A;  4XET A;  3E1F 1;  3FWE A;  5BNP C;  5JZG B;  1HRI 1;  4DNY A;  1W2A X;  1QJU 3;  2RS1 3;  4RHV 1;  4FPG A;  3POF A;  3W21 A;  4QPI C;  4BU2 A;  4KU8 A;  4AE2 A;  1ZBE 3;  3JB4 C;  4DMI A;  3B94 A;  1O4Z A;  2Y64 A;  1GQG A;  1SMV A;  1H1A A;  1TG7 A;  1ZA7 A;  4FI9 A;  3C3V A;  5E8A A;  1PGW 2;  3Q8A A;  2WFF 1;  5A3P A;  3AVS A;  1LGN A;  1A8M A;  1LOG A;  1VBE 1;  2WWS A;  4BXS V;  2V5D A;  2B8M A;  4N53 C;  3H1Y A;  4LBQ A;  3U11 A;  1CJP A;  2MHF A;  4FXK B;  5CIR A;  4NE9 A;  3PL0 A;  4W50 A;  2WII B;  1C8M 3;  1D4M 3;  2Q4S A;  4Y33 A;  1W8W A;  3ZYG A;  4BYY A;  3R0R A;  1YIP A;  1SAC A;  3HQU A;  4FPH A;  4RQP C;  1IZ3 A;  4CDQ A;  1G7Y A;  1HXS 2;  3P6B A;  5FO7 B;  5C8C C;  3VBH C;  5FYM A;  3WF1 A;  1D0H A;  2VCB A;  3VBR C;  4E2G A;  1RUH 2;  3M8L A;  2VY0 A;  5JPM B;  3RZK A;  3BUC A;  1TMF 2;  2AH2 A;  2WC2 A;  1GNH A;  2WSU A;  1W05 A;  4LO7 A;  4QXB A;  5J96 B;  1O3Q A;  2GAU A;  1WW4 A;  4IER A;  2UUR A;  4NOT A;  3NST A;  2KD7 A;  1PHM A;  4A45 A;  2BUK A;  3AZW A;  1V9U 1;  3HN1 A;  3ROU A;  5C5T A;  4DIQ A;  4N43 B;  2HWD 3;  4PQQ A;  5A7S A;  2VNV A;  2XBO 2;  4IV1 A;  3UNP A;  4GD4 A;  1H30 A;  1EAH 2;  3VKF C;  1ZRF A;  3WY6 A;  5IFP A;  5F3C A;  4F3J A;  4HFS A;  3LEG A;  1DYK A;  2RE9 A;  4M00 A;  4BQ3 A;  1W99 A;  1RED A;  1O8S A;  2BOJ A;  1XOY A;  2BU9 A;  3M3I A;  4XUN A;  1M06 G;  2J1T A;  3POG A;  4HMZ A;  2YC0 A;  1UY3 A;  1PNF A;  2PHF A;  5FP4 A;  3RZG A;  1LCL A;  1CZV A;  4W4Z A;  1JZ2 A;  3GCW A;  3NV3 A;  1ASJ 2;  1LOF A;  4URA A;  2DDU A;  4QPG B;  3ZLI A;  2ZCW A;  4QQO A;  1YFW A;  4ZZ8 A;  4K20 A;  2BFU S;  2ZEX A;  3GZA A;  1E5I A;  5FP7 A;  1FT9 A;  2D3P A;  5FY8 A;  1H1I A;  3P1I A;  2VGD A;  1APN A;  3RI9 A;  4Z1V A;  1J84 A;  1HIX A;  2VEC A;  3V56 A;  4AVA A;  3U14 A;  2XLA A;  1QJY 2;  3I59 B;  2OA2 A;  1Y9Q A;  2YB7 A;  3BIW E;  5IVC A;  4N53 B;  2W47 A;  4XZP A;  1O3T A;  3LCP A;  2ZXQ A;  4B4R A;  4G4F A;  2WNO A;  3AXE A;  2C6S A;  4D0Q A;  5T5J A;  4WM8 B;  3INA A;  2NZ9 A;  3KCX A;  4FPK A;  1PNG A;  5A80 A;  1UQX A;  1NKG A;  5EYX A;  5C8C B;  3SMH A;  3HEI A;  3T0A A;  4LE4 A;  1ULP A;  4Y24 A;  2XLF A;  5J09 A;  3GJA A;  3LSD A;  2DU1 A;  3A0N A;  1LES A;  2Z5W A;  1EY2 A;  2IXK A;  3C8X A;  4LKS A;  5BY5 A;  2PLV 2;  2HEY F;  1NY7 2;  3HNB M;  5GZE A;  4GMP 3;  2DUP A;  3ZYH A;  1FPN 1;  3OBT A;  3QH6 A;  1CQ9 A;  2RS3 3;  3ORJ A;  3KSC A;  5IVE A;  2PHU A;  5GJ6 A;  4N9I A;  4FPE A;  1DGR N;  2DVF A;  1COV 3;  1OI6 A;  3UGF A;  2FCU A;  3WX5 A;  3WNL A;  1X8M A;  4FTE A;  4U36 A;  1MS4 A;  5CAD A;  4CUA A;  1GFF 2;  2YBP A;  3UET A;  3K51 A;  3KQR A;  5F2W A;  2Q8C A;  3RGB A;  1OUS A;  2OS2 A;  2YHJ A;  3POI A;  5J7M A;  3WOG A;  1G9D A;  5DAB A;  1ZA4 A;  4MGZ E;  2VVE A;  2YY1 A;  4NIH A;  3KV6 A;  1CIY A;  2QQK A;  3U75 A;  2C0Z A;  1V0A A;  1O59 A;  2PLV 1;  1YEW A;  4PDW C;  4QPG C;  4YM0 A;  1WLD A;  2B9V A;  2PHL A;  4YZ1 A;  2VAU A;  2B46 X;  5JUV A;  4COU A;  3DGT A;  2AEN A;  4MV2 A;  4ZS3 A;  2VU9 A;  2XWB B;  1JYC A;  1VAM A;  5FFO C;  3TEZ A;  3V0A B;  4Q29 A;  4RGK A;  1NLS A;  2D3R A;  3BN6 A;  4RFR B;  5BPX A;  3H8R A;  3AKT A;  4CRQ A;  1W8Z A;  3AJZ A;  2UU8 A;  2ZAB A;  3K77 A;  4QGN A;  3VHP A;  3AL5 A;  4XUT A;  2Y34 A;  4BQ1 A;  1EAH 1;  4ORF A;  3OYW A;  5HCA A;  2RDN A;  1DYO A;  3AB0 A;  4L97 A;  3RMX A;  3VHO A;  4DFS A;  1YQC A;  3T1L A;  1YRZ A;  1R1A 2;  1W9F A;  3WW1 A;  1I1E A;  2ARC A;  1GP4 A;  2I2S A;  4Q4Y 1;  4IV3 B;  1W8H A;  5B2G B;  4IEZ A;  2PA7 A;  1N1S A;  3K4D A;  5FMC A;  1O5U A;  5HCF A;  1YC6 1;  3WIN E;  3I97 A;  3ILF A;  1ASJ 1;  2W87 A;  3WW3 A;  3ZYI B;  5IT6 A;  4ZZ5 A;  4NVP A;  5LK5 A;  5FP8 A;  4CCO A;  4HON A;  2RHP A;  3EHK A;  3ZDV A;  1WBL A;  3POY A;  2R06 2;  1W9Y A;  2GNM A;  3CJI C;  4OI4 A;  3WHU A;  2OQ7 A;  4KMQ A;  3RRD A;  1ZRC A;  1UXX X;  1GWM A;  1K12 A;  5JSP A;  5LRR A;  2VZT A;  4CPB A;  2WAO A;  5FY7 A;  4C91 A;  1WLC A;  4NJ4 A;  4XBN A;  2ZAC A;  3WQ1 A;  1FI2 A;  4CUB A;  3DPR C;  2VMC A;  2BNN A;  4KWL A;  2A5Z A;  3WNN A;  2WZP P;  3BPZ A;  4J25 A;  1P8J A;  2Z69 A;  1ZZ8 A;  3C7H A;  4FTB A;  1I3H A;  1C1F A;  1C28 A;  3K3N A;  2GMP A;  4Q4W 1;  3SC7 X;  1XYN A;  5JR7 B;  2JXA A;  1S4C A;  4PCR A;  1QDO A;  1WW5 A;  1W0O A;  1YHF A;  4WM8 A;  3EBR A;  2WQ4 A;  3ILN A;  1V6O A;  3M3E A;  5LAT A;  3KT4 A;  5BNO C;  5EJZ B;  1W9T A;  4I01 A;  4Q0V A;  3T0D A;  3J8F 1;  1F8V A;  1SFP A;  2ID4 A;  5L9B A;  4Q4V 1;  4MH0 E;  3WQ7 A;  1CJD A;  1QJY 1;  1YJL A;  3DL3 A;  3GBF A;  2K9Z A;  4Q8L A;  3ZFF C;  4R9D A;  4M01 A;  1J58 A;  1Y9G A;  5FZE A;  1H8T B;  1MEC 3;  1OT5 A;  3WDT A;  4A7Y A;  4EQV A;  1ZZ7 A;  1HV0 A;  3HAG A;  3OUJ A;  2VQU A;  4QT6 A;  2VJX A;  1OLM E;  4N9H A;  3NNJ A;  5FYH A;  5LRS A;  3WF2 A;  2VCC A;  3OB8 A;  4NPR A;  5FYU A;  3SH4 A;  2R06 3;  5EYY A;  4AQS A;  1HX6 A;  4Y26 A;  5F5Q A;  5FPZ A;  4C0B A;  4XJZ A;  3HWJ A;  4IV3 C;  1HV1 A;  2A75 A;  1QOS A;  4LOR A;  4XJU A;  1XNT A;  4QDQ A;  4XHB A;  3WHT A;  2C1F A;  4MOA A;  3E6C C;  1UOG A;  1HRV 1;  4RS5 A;  2D6N A;  1YFY A;  2IVI B;  2JG8 A;  3IZO A;  3DF0 A;  5H9S A;  1VLN A;  5FYZ A;  4UFJ A;  2XVG A;  3N7M A;  3O0X A;  3IKW A;  4YYO A;  3ZVX A;  1NE4 A;  5SV8 A;  1NAE A;  4JRL A;  1JYW A;  2Y0O A;  2Z2S B;  5KXC A;  3UL2 A;  1W9W A;  2GSY A;  5FZ6 A;  3W5M A;  5FZI A;  3W58 A;  2OZ6 A;  2JE9 A;  1D0G A;  1O4Y A;  4LO5 B;  4XXA A;  2HWC 2;  5EP9 A;  5JCT A;  4AG4 A;  4Q4W 3;  2BER A;  3QAC A;  4OZO A;  1G6N A;  5A6Q A;  5C3P A;  1W8F A;  1IQD C;  1SCR A;  1WMX A;  2HWD 2;  3M2M A;  3NRU A;  5FY1 A;  3VBO B;  3SH3 A;  1AR9 1;  3U4S A;  4AVS A;  1QKQ A;  2R04 2;  4Z2A A;  2BBV A;  5DG2 A;  3CL1 A;  3VBO C;  5F37 A;  3A0K A;  4E4S A;  4Y5S A;  4CEW A;  4DY3 A;  4I0W B;  1LHW A;  1JZ6 A;  5A33 B;  3N9M A;  3T08 A;  2OT7 A;  2XHK A;  1V9U 3;  3S6P A;  2O8O A;  2SBA A;  2ZX2 A;  1UZ0 A;  1LOD A;  1RHI 1;  3URF A;  1F31 A;  2W68 A;  1QF3 A;  4IEU A;  1F35 A;  3GF6 A;  5FZ9 A;  1GMM A;  1PGW 1;  5JAX A;  2GNT A;  1CAU B;  1Z7S 1;  3FBY A;  3ENR A;  1VE0 A;  1RVF 2;  3S57 A;  1XU1 A;  2Y6K A;  4N7I A;  1CAU A;  3JBG 2;  5F3E A;  4KGQ A;  1RUF 3;  2D6L X;  2FMY A;  3ZOI A;  1ULC A;  4UT5 A;  5JOY A;  4NMI A;  3AXD A;  5FZ7 A;  3BU0 A;  4UOJ A;  2J22 A;  3H8O A;  2VNO A;  2ZZJ A;  1R08 2;  3CLP A;  2RG4 A;  5LY2 A;  5A3T A;  3GGL A;  3WSO A;  3AMH A;  2HWC 3;  2VZ1 A;  4UF0 B;  4MZU A;  4YZ4 A;  2E33 A;  2WFF 3;  4RS5 C;  1BCX A;  2BWC A;  1PVC 3;  1OLR A;  3TRS B;  1VRH 3;  1K42 A;  4HET A;  2JDP A;  5FZ1 A;  3J7M A;  1V6L A;  2TNF A;  3AMP A;  4XCA A;  1W3X A;  1X36 A;  3TN9 2;  2RS5 1;  1AR7 1;  4GIQ A;  5FZD A;  4IET A;  3PME A;  4K40 A;  1V6I A;  3PIG A;  1SLC A;  1WA4 A;  5F1R A;  1NCQ B;  3I7D A;  4Q4V 2;  1PO2 1;  1RUD 1;  2D97 A;  4Y1U A;  2PLV 3;  3K48 A;  1OPO A;  5L19 A;  4PBO A;  2GZW A;  3JCI A;  3N9N A;  4YW7 A;  2LW8 A;  5FJH A;  3ZYF A;  5DAV A;  1SPP A;  1V6M A;  3BGA A;  1UY0 A;  4L2N A;  3ZXL A;  1YCI A;  5G05 L;  3RWN A;  2YGL A;  3H7J A;  2ZKL A;  4P9X A;  4OCT A;  4E8D A;  3O1U A;  4TTG A;  2Z4F A;  2W1W A;  1LUL A;  5GLT A;  4B1M A;  4AGV A;  3HN3 A;  2HWE 3;  2Q5T A;  4HAN A;  4AOC A;  5KHG A;  2JIG A;  2XKO A;  5FZH A;  5J98 B;  1S1A A;  3MV0 1;  4CDX A;  4CP2 A;  1IG3 A;  1QXP A;  5L73 A;  4AFA A;  2D98 A;  3K3O A;  2QJV A;  4LBQ B;  3LWC A;  4MYE A;  3WZ1 A;  1US2 A;  3MDP A;  4IGQ A;  4UI9 L;  4Z2W A;  5IAX A;  5J36 A;  2P1B A;  1W28 A;  3EJK A;  1N1V A;  1JU3 A;  1DHK B;  2W1S A;  1DQ6 A;  5FRE A;  2WNU B;  4B4Q A;  1QGL A;  2WUH A;  4FFI A;  1JYX A;  4K6B A;  3F2Z A;  2BRT A;  5GKA C;  4Q5O A;  1VBA 1;  1BHG A;  3AZZ A;  4HSJ A;  3HJR A;  4XCB A;  4C0H A;  2JB8 A;  2WZR 2;  1QMJ A;  2VZV A;  2YPJ A;  3TWI A;  3VHR A;  1ND3 B;  1ZZ9 A;  4IEY A;  3LA2 A;  4Q1R A;  3WUD A;  3SKV A;  4D7S A;  4LTA A;  2RJK A;  3OPT A;  2EXH A;  4YW6 A;  1RUG 2;  1RUI 3;  1EUT A;  1LNS A;  2FDH A;  2Y60 A;  4IV1 B;  2EAA A;  3FX3 A;  5CU1 A;  1N3Q A;  1S0F A;  3JZV A;  4GJZ A;  1SDD B;  4IE0 A;  2MEV 2;  3T2Q A;  3I2O A;  2JEC A;  2QKD A;  4FAG A;  3ZXD A;  1W6O A;  1WCQ A;  5EFU A;  1X9T A;  3EMR A;  2HKX A;  3LB9 A;  5JXJ A;  3N9L A;  4MO3 M;  1W6O B;  1VBC 2;  4CE8 A;  2JIJ A;  2VMH A;  1IGO A;  4PI0 A;  4CTE A;  1H8T C;  3IPV A;  4A3Z A;  3RYP A;  1SBE A;  3CMG A;  2R0F A;  3NAP C;  4JGY B;  3DYP A;  5A7W B;  2JD9 A;  1LKN A;  3IB3 A;  2ZX0 A;  3LEM A;  4H7M A;  1DLL A;  5A7W A;  4N90 A;  4I2O A;  1UZV A;  4DQA A;  3IMM A;  4E2Q A;  4HOO A;  1TME 3;  1UYP A;  1SLT A;  2R07 3;  1K5J A;  1W2O A;  4LLO A;  1BEV 3;  1SBD A;  4AYU A;  1BJQ A;  5FJK A;  5A3M A;  3PMS A;  1JOD A;  1Z0H A;  5FLI A;  1PVC 1;  5C3Q A;  3S5A A;  1OFN A;  4CU9 A;  2VG9 A;  2B9U A;  4OZX A;  1OKO A;  1YNA A;  4DY5 A;  5F3G A;  5CFC C;  3ES4 A;  3ME2 A;  2D5H A;  2VW2 A;  4PJY A;  1YYN A;  2CDP A;  3KM5 A;  1RUG 3;  4UAP A;  5GLZ A;  2GH2 A;  4P5Y A;  2ZOE B;  3PUH A;  4FPF A;  2NMN A;  2D43 A;  1F2N A;  3NMB A;  5A3O A;  5JXG A;  3R4U A;  2H6C A;  4DOU A;  4F7Z A;  1PGL 1;  4H14 A;  2WYS A;  3LA7 A;  2J1A A;  1JHJ A;  2RM2 2;  5LZ6 A;  1XND A;  1H8V A;  2A6Z A;  2YGM A;  1RC6 A;  3EQE A;  3I2G A;  5FPU A;  5JMC A;  2VW0 A;  2P6C A;  4AHW A;  1IQA A;  3N35 A;  1WME A;  5FYI A;  2LTN A;  4CCM A;  1ZM1 A;  2HWF 3;  4RQP A;  2V09 A;  1DU3 D;  4FOW A;  3BTY A;  4Q4Y 2;  3SCG A;  3S5Q A;  3ZXA C;  2WS9 1;  1OH3 A;  1AR6 1;  3IAP A;  5IAT A;  2D6P A;  2UYA A;  3I2I A;  3ZN6 A;  3X29 B;  5FQ0 B;  3T0B A;  1TVG A;  5KXE A;  2E7Q A;  5FUP A;  1AL2 3;  1TME 2;  3HNM A;  3ZN6 B;  2AYH A;  3III A;  1MZE A;  1UKG A;  4I02 A;  2R49 A;  3SHR A;  4H2A A;  3U10 A;  1IS5 A;  4E2S A;  5IK4 A;  2UWA A;  1ZBE 1;  3OJB A;  5D2A A;  1VAV A;  2R07 1;  4DIN B;  4BJ0 A;  3WP5 A;  4XFF A;  2JDN A;  5FAX A;  4YZ5 A;  2WO1 A;  4CCL A;  2FCT A;  2JJ6 A;  3SNM A;  1EV1 1;  2RJL A;  4AL9 A;  2Y6H A;  2ERF A;  3AMN A;  4TLF A;  1V6N A;  4KI5 M;  3WCR A;  2XLG A;  5T5P A;  2ADD A;  2IXH A;  1Q8Q A;  5JVV A;  3VBH B;  5IYY A;  1MZ5 A;  5FZL A;  1UY2 A;  4P00 B;  2Q1M A;  3J4U H;  2XL7 A;  1R09 1;  4NN0 A;  4FPL A;  3IMN A;  3KT1 A;  1J1L A;  3B93 A;  3RZJ A;  3FJS A;  4LMF A;  3DN7 A;  2CU5 A;  1XYP A;  1K5M C;  4KU7 A;  2UWB A;  2GAL A;  1FOD 3;  2ZHN A;  4XW3 A;  2DBN A;  2HWF 2;  5KR7 A;  1DIW A;  2A6Y A;  2XQX A;  3B5L B;  3OY8 A;  3QLQ A;  4Z8B A;  2XBO 1;  3V0B A;  3OGV A;  3KWV A;  2EXJ A;  5C3S A;  1UZZ A;  1GSL A;  3MF9 A;  3MIB A;  2HEV F;  4XUQ A;  1WCU A;  2N7G A;  5C33 A;  4HBN A;  4BHP A;  3RJ2 X;  1BLZ A;  4N7U A;  1GLH A;  4YW2 A;  3RZL A;  3LIG A;  5AC9 2;  3VN4 A;  3ABZ A;  5E1R A;  1VMJ A;  3VDA A;  1Q8P A;  1WBF A;  4PHZ A;  3MPP G;  2A3Y A;  4A4A A;  4NIA A;  5GM0 A;  4AVV A;  4BQX A;  3IAQ A;  2ZHK A;  5F7U A;  3WLU A;  2WYF A;  4B7E A;  5JZG C;  1BK1 A;  2A3X A;  4QM9 A;  5C70 A;  1S0B A;  5DZE A;  3ZR5 A;  2IVJ A;  3VBR A;  1REF A;  1G9C A;  3B7M A;  5HV4 A;  1QJZ A;  4XVH A;  1QWR A;  5ACA 2;  3FLT A;  5F5I A;  3OD0 A;  4UFI A;  1AYN 3;  3NW4 A;  3OOX A;  4JDN A;  2BYV E;  1VBA 2;  4QKF A;  1OH4 A;  2RV9 A;  3WG4 A;  1W6M B;  5B4X A;  3WG2 A;  3W9A A;  1FAY A;  4C8D A;  1Q8O A;  2ZML A;  2X29 A;  3OEA A;  2A7A A;  3PVN A;  3I2D A;  4LA2 A;  3T1M A;  4Z07 A;  3VL9 A;  4AFC A;  1BVV A;  4JAA A;  4JQT A;  1HJF A;  4N53 A;  3TEY A;  4M3C A;  5FPV A;  2XHN A;  1BXH A;  4LO8 A;  1PO1 3;  3AZY A;  1SFY A;  2PAE A;  4OHV A;  3JUU A;  1OOP A;  1BK0 A;  1AVB A;  4BDV B;  5K8S A;  2LS6 A;  3WNX A;  4ZU4 A;  4OUS A;  4ASM B;  3ITQ A;  4NII A;  3UJO A;  1YUD A;  1AR7 3;  2Y6L A;  4LBN A;  1VRB A;  1W6P A;  4KWU A;  2B39 A;  4QPI A;  2W1Q A;  4YM1 A;  1QJU 2;  1W0N A;  2RS1 2;  3ALQ A;  1UZY A;  3H7Y A;  2BDR A;  3VZK A;  3AP5 A;  4R4Z A;  4ZPI A;  5AC9 3;  2L9L A;  1JYT A;  3AMQ A;  3LQC A;  3WP3 A;  2VMF A;  4NHL A;  2YYO A;  1SZB A;  2FZ1 A;  2W2I A;  2DCJ A;  4QX8 A;  4Z82 A;  5CZK A;  4ET7 A;  4DB5 A;  3ZFF B;  1XSQ A;  5A1A A;  3DCQ A;  5BNN B;  3POS A;  4MGK E;  5HXV A;  2JG9 A;  2XL9 A;  3RMY A;  4Q0P A;  3VL8 A;  2E26 A;  1ZBE 2;  3FFZ A;  1S2E A;  5DAW A;  1UOJ A;  1GZC A;  2JE8 A;  1RUJ 2;  1RUF 1;  1VBD 2;  1ZVF A;  1UU5 A;  4CSW A;  5A1F A;  4CXW A;  3ZYB A;  3RZH A;  4AAX A;  1ULF A;  4LBM A;  2JIC A;  4NO4 A;  3LPG A;  4K8F A;  1POV 1;  4XFH A;  3UT0 A;  4JZR A;  3LZZ A;  1AXK A;  5DAP A;  3ZXE A;  4EN7 B;  4KH9 A;  2P6H A;  2BZD A;  4LHL A;  4AW7 A;  5J37 A;  1W9S A;  4KWK A;  2G9Z A;  3TBD A;  4XTM A;  4BWO A;  1YLL A;  5DG1 A;  4HVQ A;  1TMF 3;  4ZXK A;  2XUM A;  4XF9 A;  1VBB 2;  1VBB 1;  2VMD A;  5KXB A;  4MGT A;  4CP9 B;  5FBJ A;  4PIY A;  4EN6 B;  5C5U A;  4IEW A;  3VBF A;  1WA6 X;  1XNA A;  1HB1 A;  1VBE 2;  4CZS A;  3RYK A;  5A3L A;  1AR7 2;  4AQT A;  1LHU A;  3LPF A;  3OG2 A;  3EYP A;  3PLQ A;  4IEP A;  4P9W A;  4QDS A;  2NYY A;  3B02 A;  4OUM A;  1OUX A;  3N9O A;  3THC A;  1UPI A;  1TNF A;  2A73 B;  3MEP A;  4QX5 A;  1MQT B;  2C5D A;  4WV8 A;  5CA6 A;  5I8Y A;  4OI1 A;  2XBO 3;  1IS3 A;  1HRI 2;  3TB0 A;  4YFW A;  1FPN 3;  3J26 N;  4GJY A;  4OMD A;  4GMP 1;  4QHB A;  5IVF A;  1IHM A;  1JUH A;  5A3U A;  5FZB A;  1G9A A;  4R9A A;  4HLT A;  3MV1 1;  3A21 A;  1OF4 A;  1PIV 2;  4X8N A;  5GAL A;  5K9Y A;  1JZ4 A;  1RUN A;  3Q8C A;  2SLI A;  1VP6 A;  4XUR A;  1HW5 A;  3ZSK A;  2GP5 A;  2WO2 A;  4CCC A;  3LOB A;  2E63 A;  3HBZ A;  4YNI A;  4FVV A;  1Y7B A;  3C7O A;  2JG8 C;  4MSV A;  4WVZ A;  2TUN A;  4HL0 A;  5J1X A;  2DCZ A;  3LFM A;  2ZZQ A;  3W5N A;  1UPS A;  1RJ7 A;  1H1M A;  1V70 A;  3UGH A;  4B29 A;  4B8E A;  3WP4 A;  3C2U A;  4QQP A;  4XAA A;  1W6Q A;  3FHI B;  2FMD A;  3PNA A;  1Y43 B;  5I0T A;  1ND2 A;  1VB4 A;  1J83 A;  1QH7 A;  2VUJ A;  4XFI A;  4RFT 0;  2K0G A;  4JKL A;  4XIO A;  1R09 3;  4PI2 A;  1CZS A;  3J8F 3;  1PM7 A;  4M3C B;  4L92 A;  5FZ0 A;  2QQJ A;  4QXH A;  3POW A;  1AR6 3;  5C9A A;  4TYS A;  1SPP B;  5CVR A;  2DCK A;  2O1Q A;  1V9U 2;  1EV1 3;  5FYT A;  1PZ7 A;  3K4Z A;  1YQ5 A;  1Q8V A;  1KXG A;  1UKR A;  1AX2 A;  3KHC A;  2P3Y A;  3ZYP A;  1W6P B;  2C24 A;  2JDY A;  2NN8 A;  1IPS A;  5C4W C;  1COV 2;  3RSJ A;  1BZW A;  4K21 A;  3E97 A;  4MHU A;  2J1U A;  4JGZ A;  4KGG A;  3DPR A;  4DPN A;  2R04 1;  4G9S B;  2CV6 A;  2R1B A;  4XAC A;  1X82 A;  2K2S A;  2XJQ A;  4GWN A;  2Y0I A;  4E4Z A;  3KB5 A;  2WS9 3;  1DDL A;  1RUG 1;  3M3O A;  2DF7 A;  3QBQ A;  4XOG A;  5L7O B;  4DEV A;  1TMF 1;  3MPB A;  2ZGP A;  5A7Q A;  4ARX A;  1AL0 G;  2IXJ A;  1OVS A;  2I07 B;  1QXR A;  3KHB A;  1XNB A;  2V4V A;  3MIF A;  2W1U A;  2CWS A;  4NHM A;  3M3Q A;  4XDQ A;  4Y1Y A;  4BOW A;  4CDQ B;  5IHR A;  3ZX7 A;  5DQ0 A;  3HT2 A;  3WNK A;  1FYU A;  2NPI A;  4XMI A;  1BBT 1;  4RYD A;  4EZH A;  2KA3 A;  2QCS B;  4EWA A;  1AR9 3;  1S0E A;  1IS4 A;  2CTV A;  2DBI A;  3OEB A;  4XQ4 A;  1UN1 A;  3IDC B;  5ABJ C;  3ZM8 A;  2VTX A;  5JI9 A;  1UYZ A;  3V0A A;  3LDK A;  5C9A C;  3MHZ A;  4NRM A;  2I74 A;  3ZKU A;  3TAY A;  2CY6 A;  3OY8 B;  5DN2 A;  4CP9 A;  3FZ3 A;  3S0M A;  1EV1 2;  1RYY A;  2HWB 1;  4XAB A;  1CES A;  3PUS A;  1NZC A;  1ZRR A;  1CD3 G;  2XVK A;  4QQ2 A;  2VME A;  4UW6 A;  2KM2 A;  3BKZ A;  2JDK A;  3AKP A;  1ST8 A;  1WW7 A;  4IV3 A;  2YPD A;  4BK5 A;  4COZ A;  2Q30 A;  2CYF A;  4TLG A;  1AR8 3;  2A3W A;  2JDM A;  1ZBA 2;  1QJX 3;  1R1A 3;  1W2U A;  1MR5 A;  2QZ2 A;  2OII A;  2WKK A;  1KS5 A;  2VBP A;  2XWJ B;  4OHX A;  4UBH A;  3NWK A;  1OPM A;  2ZEZ A;  1PO1 1;  2WN3 A;  1E5S A;  4QPG A;  1VJ2 A;  5K0U C;  1G9B A;  3ZN5 A;  4U2A A;  4W6X A;  3I2J A;  2A6X A;  1E5H A;  5FZC A;  4NWW A;  3WVJ A;  1RUC 2;  4DXR A;  1UYY A;  4LHK A;  2WQ8 A;  3EO6 A;  3JBG 1;  4BQY A;  4AED B;  1AXY A;  5K4L A;  4K1Z A;  4XF3 A;  5BNO A;  5JWP A;  3ECQ A;  5I93 A;  2B7Y A;  3PTY A;  2DV9 A;  2EA7 A;  1RUH 3;  1G9F A;  2VXJ A;  2C4X A;  5L7O C;  3GJB A;  4LUK A;  2RS3 1;  1KJL A;  4CXX A;  3USU B;  4ERO A;  2PAK A;  1RUH 1;  4YVW B;  1AYM 1;  2R30 A;  3AZX A;  4PBP A;  3BOD A;  4P9Y A;  4TXW A;  3THD A;  4COY A;  4NRO A;  2JKB A;  2R7E B;  4YVW C;  1PZ9 A;  2YXS A;  4QD2 A;  2OYZ A;  4D6R A;  3IN9 A;  1LR5 A;  1O3R A;  3MI8 A;  1OMI A;  1XBF A;  3BTA A;  1IPK A;  2ZGM A;  3Q8B A;  3VKN A;  4JDM A;  2E51 A;  3RWK X;  3KCC A;  4Y1V A;  5C9A B;  4OFG A;  3WR0 A;  2VH9 A;  1LEN A;  1GZ9 A;  2IXI A;  1QQP 3;  4AGR A;  4Q27 A;  3M70 A;  4R8H A;  1GP6 A;  1DG6 A;  1R1A 1;  2PXJ A;  2ZGN A;  3MW2 A;  3WF3 A;  1W8U A;  2WR9 A;  3K4A A;  2E53 A;  2W46 A;  4LHN A;  1O8P A;  2D6O X;  1ASJ 3;  1XXN A;  4IGP A;  1E57 A;  3O14 A;  4BCU A;  5JOX A;  1UZW A;  2B45 X;  2HWE 1;  1LGB A;  1BEV 2;  1JI6 A;  3KZ4 C;  2VR4 A;  3OPZ A;  4KG0 A;  4QGL A;  2XXZ A;  2E31 A;  4CCJ A;  4I09 A;  4FO9 A;  1LU2 A;  3VZN A;  2ZGO A;  4AI1 A;  4XQD A;  1J59 A;  2XON A;  4CYD A;  5F3I A;  4BIO A;  2D6M A;  2MEV 1;  4WBB A;  4BLJ A;  3WD5 A;  4LHS A;  4RN5 A;  3U07 A;  1LEC A;  4WVM A;  1B35 A;  3M1H A;  4OI2 A;  4N43 C;  3LKJ A;  4EJR A;  1TE1 B;  1PMH X;  3USS A;  4AHY A;  3KT7 A;  4RL7 A;  3P3P A;  2XJU A;  4WVM B;  1PX4 A;  1C1L A;  3GDB A;  4LJH A;  4TWT A;  3WDU A;  5J48 A;  3VKM A;  4GB3 3;  3RQ0 A;  2VCA A;  1CR7 A;  4A3X A;  3AYE A;  3Q8F A;  2W0X A;  3WQ0 A;  1XSR A;  1OLM A;  3D6E A;  3K75 B;  3GBW A;  1ODM A;  2TEP A;  1UO9 A;  3JB8 A;  4ZY9 A;  4CA9 A;  1H2M A;  3CU7 A;  5EIY B;  1VAL A;  2DVB A;  2OVU A;  3W20 A;  4Q4W 2;  3KGZ A;  2CGO A;  5A6Y A;  1OD3 A;  1MQT A;  1BQP A;  5GLV A;  4OYU A;  2YBK A;  2HWF 1;  5FYB A;  2GDF A;  3D4K A;  2JE7 A;  2HH9 A;  4A7Z A;  1GKB A;  4KL1 A;  1DGW A;  2BGP A;  2FBE A;  3MIH A;  1DQ1 A;  3PVE A;  3BB6 A;  4R9B A;  5IJR A;  3WDW A;  1PIV 3;  1UF2 C;  1Z7S 3;  2WO3 A;  1BBT 3;  2NM1 A;  4XJW A;  5A32 A;  3SIS A;  4QM8 A;  4IEX A;  3UYJ A;  4BXF A;  3CJX A;  3T4V A;  1COV 1;  5FXX A;  1UMI A;  5GLU A;  3SQO A;  3I54 A;  3MFA A;  3NKT A;  3QOP A;  2G19 A;  3SEE A;  3AC0 A;  1UX7 A;  4QGM A;  1SHW B;  1RTV A;  1NLR A;  4YFZ A;  3CBN A;  1W6N B;  1ALY A;  1XJA A;  3QD6 A;  1UL9 A;  5JSO A;  1DQ4 A;  2VQT A;  3CEW A;  1IKQ A;  2XOM A;  4YAR A;  3AKS A;  4OI0 A;  3WDV A;  1W6Q B;  4ZKT B;  3MW4 A;  3FMG A;  3IT8 A;  2WNU C;  4PF5 A;  1N1T A;  2PHX A;  1AYM 2;  1JU4 A;  1EYB A;  1POV 0;  1TME 1;  1UXZ A;  4UXA A;  5FZ4 A;  2WAA A;  4MXV A;  5BV6 A;  1FV2 A;  2R06 1;  4XYX A;  2WFF 2;  4XFA A;  3WV6 A;  1MZF A;  2RMU 2;  2D6K A;  5DDJ 2;  3BI3 A;  1GBG A;  2PQS A;  4LLF A;  4MXW A;  2CNA A;  5JR2 A;  5JOZ A;  2JG9 C;  1WZX A;  3KF3 A;  4JDO A;  5ISL A;  3I3Q A;  3UGG A;  4ATE A;  2RR1 1;  3R6S A;  2RR1 2;  3FHQ A;  1FAT A;  4XC9 A;  2P3I A;  3AL6 A;  1T6G C;  3PVO A;  3U4X A;  5FKC A;  3ZFE A;  1ULO A;  2JEN A;  4AFM A;  4DEQ A;  4I30 A;  1NCR C;  1JZ3 A;  5FYV A;  3IDB B;  3JQW A;  3MFC A;  4BK4 A;  1RIN A;  2OPK A;  1DYP A;  1H4H A;  2GMM A;  2QNK A;  5FDB A;  3E5X A;  2VD7 A;  3I2K A;  1LEM A;  1UX6 A;  3BIE A;  3WDY A;  1NX9 A;  1C5I A;  2XQR A;  2WBK A;  3ACH A;  2P3K A;  3CIH A;  4HPK B;  2DVA A;  1AX1 A;  2YFZ A;  3TN9 1;  5LCW L;  1UD1 A;  1ZNP A;  4Q0S A;  1HQN A;  2GU9 A;  3E6D A;  4WVV A;  2ZKN A;  4C90 A;  1MEC 1;  2D5F A;  2JG8 B;  2VOX A;  2W94 A;  1V6J A;  3H0O A;  4Q0U A;  3LE0 A;  2DCT A;  1BVP 1;  4AFB A;  3UV9 A;  3AKR A;  1AR9 2;  2WZR 3;  4AED C;  2JDH A;  1OFS A;  2R1D A;  1S2B A;  1WCD J;  2PTM A;  4IE7 A;  4CP0 A;  2XVL A;  1Z78 A;  3CNA A;  4PF1 A;  1BYH A;  4TN7 A;  4MGQ A;  2AUY A;  5L9R A;  2DUR A;  1JW6 A;  3DYO A;  4DRR A;  5IK8 A;  1WD3 A;  2BPA 2;  2HLE A;  3CZU A;  4X6R B;  2FDG A;  2FZ2 A;  5H9Q A;  3IM0 A;  2MPF A;  1RGS A;  5DDJ 3;  4S2D A;  3RFR A;  4QMA A;  3VBH A;  5JXI A;  1ZX5 A;  3OF1 A;  1S0C A;  3DKW A;  4HN0 A;  2GH8 A;  3D0S A;  2Q1Z B;  4CDQ C;  3FL7 A;  2ZGU A;  5E88 A;  4LQR A;  4IDZ A;  5FMO S;  1ENX A;  4CCK A;  5FUN A;  3MLL A;  2WNV C;  1N1Y A;  2VM9 A;  2ARB A;  2DUO A;  2UY8 A;  3KQ4 B;  4YW5 A;  2ARA A;  3VBS A;  1S55 A;  5CFC B;  5GZC A;  4J1X A;  1GNY A;  2OXB A;  3ZYJ B;  1W03 A;  4YVS B;  4ISR A;  1JYI A;  1AR8 2;  1KIT A;  3A22 A;  3A4U A;  1MEC 2;  4XJ9 A;  2DTY A;  5FPL A;  5CFC A;  2FCV A;  4J1W A;  3HD8 B;  3I4I A;  1SQ4 A;  1F4A A;  3KF5 A;  3VD9 A;  3O1P A;  1EAH 3;  2VUA A;  2YZ4 A;  3QCW A;  4Q26 A;  2UY9 A;  3UKT A;  5AC9 1;  2GC2 A;  5B4N A;  5I0D A;  5KHH A;  3DEC A;  4E9K A;  4H55 A;  1CWP A;  1MS5 A;  1K5M A;  2C26 A;  1WLT A;  3S30 A;  1H4G A;  4EWE A;  5T5L A;  1B35 C;  1QNW A;  4MUV A;  1L3J A;  4B7K A;  2IWG B;  3NJY A;  4NPM A;  5BNO B;  3GZE A;  1LRH A;  1TZO A;  3WNP A;  2P2K A;  3D8C A;  3NAP A;  1C57 A;  2QQV A;  1GAN A;  2XR4 A;  2QQU A;  5C7G A;  1UOF A;  3GM8 A;  1ZBA 1;  2EXK A;  1C3H A;  3C7G A;  1AJO A;  2XB6 C;  4YSF A;  4LBK A;  4HK9 A;  2RDS A;  1RJ8 A;  5ABJ B;  1UYX A;  3HMY A;  2DU0 A;  2R16 A;  2J42 A;  2BQP A;  3SIT A;  4MLO A;  2VQ0 A;  4BPZ A;  3R4S A;  4YW4 A;  4L8Q A;  4EN9 B;  4UFL A;  3UK9 A;  5KHJ A;  3FBM A;  4QDR A;  4XFG A;  1K45 A;  2WWJ A;  4KNC A;  4CPB D;  5CFD B;  4P9L A;  3PUA A;  1W04 A;  1YO8 A;  1RUO A;  2HWB 2;  3TEW A;  3C7F A;  2VZR A;  5HCH A;  2YDE A;  4H7L A;  4B1L A;  2O8Q A;  1RHI 3;  3N9P A;  5FMO L;  1IPJ A;  4Q4X 3;  3FUQ A;  5FMB A;  4COW A;  4CU7 A;  4YG0 A;  3RZM A;  2WLQ A;  5FO9 B;  2F17 A;  3MIE A;  4IUG A;  1ODN A;  2R04 3;  3U78 A;  3CKH A;  4NAM A;  1ZZC A;  2G1M A;  5JLV A;  3AYA A;  3KVA A;  2OQ6 A;  5EJ3 A;  5DMY A;  4R4X A;  1QU0 A;  1W2T A;  2E7A A;  3RI8 A;  1RUE 2;  1N47 A;  4QWN A;  4D8M A;  5L7O A;  4GH4 B;  4BQ5 A;  4E4H A;  1HJG A;  5I0U A;  1HKD A;  5BNN A;  4MG2 A;  4W8J A;  1RUF 2;  1RUJ 1;  1VBD 1;  2V73 A;  3HIF A;  4S2H A;  5F8P A;  2VTX J;  3MZH A;  5DZG A;  1AL2 2;  3KS7 A;  1D4V B;  5C3O A;  3DUI A;  1IKP A;  1MQT C;  5FWE A;  3OGG A;  4LIT A;  3O1O A;  2DVG A;  2LUW A;  4FQ4 A;  1RVF 3;  4E8C A;  1U0A A;  2V72 A;  1REE A;  2HJI A;  1HQW A;  1W8T A;  3NVC A;  1AX0 A;  5K0U A;  1PVC 2;  2ZAH A;  4IE4 A;  4I3G A;  1DLC A;  4QQH A;  4XTP A;  1R09 2;  2WFP A;  4AK3 A;  2AEY A;  4BH9 A;  4HVR A;  2QBX A;  5LB6 A;  3I3M A;  2LRP A;  1HB4 A;  3I3D A;  3MLJ A;  5APA A;  1ENR A;  1RHI 2;  3E5Q A;  4ZXE A;  2ZX1 A;  1WGP A;  1VBC 1;  2ZHL A;  4LK6 A;  3GHN A;  4D6S A;  2YFU A;  5LA1 A;  2P4E A;  2VZ3 A;  4N43 A;  4QPW A;  4SBV A;  3NV2 A;  3VDD B;  4PLO A;  4YGD A;  1LTE A;  1QIQ A;  3U37 A;  1O3S A;  3O12 A;  3CQO A;  2WLP A;  1PO2 2;  1RUD 2;  2PFW A;  1SLB A;  2A70 A;  2CAU A;  4NUB A;  1WKY A;  1LED A;  4Q4V 3;  1FX5 A;  5LEJ A;  3VD7 A;  3T30 A;  4Y4R A;  3NO8 A;  3HQR A;  2KR2 A;  4YM3 A;  3VDB A;  3A7Q A;  1UMH A;  4IND A;  3LDR A;  1RXG A;  3O7O A;  2DWR A;  2NMO A;  3NNF A;  2Z79 A;  4LXL A;  3MF6 A;  1QDC A;  2WS9 2;  4ZS2 A;  2GC1 A;  2Y6F A;  2WJS A;  4MGI E;  3SH5 A;  5FZA A;  3RJR A;  3UES A;  1EPZ A;  5BUV A;  2BBA A;  3VBU C;  1PGS A;  5FZO B;  1WD4 A;  4A41 A;  5KC6 A;  4UWD A;  4QKD A;  4FFG A;  1GQH A;  3AP9 A;  3MW3 A;  2BP6 A;  3NV4 A;  5JIA A;  3NV1 A;  2JD4 A;  5H9R A;  2Q8O A;  3VD5 A;  3B3Q E;  1JYV A;  5C3R A;  1RVF 1;  4YPJ A;  3NAP B;  1UIK A;  1C8M 1;  1D4M 1;  1WWY A;  2YRO A;  2EID A;  4YVW A;  3W59 A;  4DO0 A;  4JQR A;  4JGZ C;  2BJS A;  4EZ4 A;  1PMI A;  2PYT A;  4CEW C;  1YJK A;  4AQ6 A;  5HCB A;  5FXZ A;  4CEY A;  3IWZ A;  5FZ3 A;  3SCH A;  3L2H A;  4BIS A;  4UF0 A;  4LEJ A;  5KC5 A;  1F5J A;  1CN1 A;  4MXW B;  1S0D A;  2ADE A;  2WL1 A;  3P3N A;  1LGC A;  2RDQ A;  4LK7 A;  4Y22 B;  3AFG A;  1IS6 A;  4UBG A;  1DCS A;  3FC0 A;  1QJU 1;  1H2K A;  2RS1 1;  4V2V A;  4ZU7 A;  3ZFE B;  4ZON A;  4LA3 A;  3ZSE A;  1V6K A;  4GZ9 A;  4M4R A;  4UW3 A;  4UYB A;  5GZD A;  1JZ8 A;  2IFR A;  2W39 A;  3BAL A;  3LOI A;  4I0B A;  4NIG A;  1QJX 2;  5IAV A;  1GNZ A;  1LOB A;  1WW6 A;  2XDV A;  1QHD A;  2IFW A;  3EXU A;  5LAS A;  5BYN A;  1DBN A;  1H2L A;  3OGS A;  2W5F A;  5CBL A;  2JG9 B;  5FQ0 A;  3I2H A;  4Y5Z 0;  4XFB A;  3GZT B;  2DTW A;  1CAW B;  2DFB A;  4JCK A;  1QXJ A;  3T2T A;  3NQH A;  4M0N A;  1PK6 B;  2FDF A;  1ZRI A;  2WIN B;  2ZGQ A;  5ANN A;  4AAP A;  1RUC 3;  3KV4 A;  4ARY A;  4D94 A;  5EV7 A;  2YU1 A;  1RMU 3;  4URT A;  4ZHN A;  1VPH A;  3ST7 A;  4CDU B;  2W3J A;  4G3Y C;  4XDO A;  3ZSJ A;  3WF0 A;  1UY1 A;  1B35 B;  1JN2 P;  1QOO A;  3JD7 1;  1OVP A;  3BTX A;  1QOT A;  4GAL A;  4A44 A;  5ERL A;  4IEO A;  1FXZ A;  2KXL A;  3WW4 A;  3NNL A;  4QB1 A;  4P9G A;  2EIB A;  4LPL A;  4AHZ A;  4K1Y A;  5JPN B;  5FZF A;  4FTS A;  2YUE A;  3PTR B;  2HBT A;  1HLC A;  3CDZ B;  5LBE A;  2QQO A;  1OC1 A;  1ENS A;  2P17 A;  2R0H A;  4O61 A;  3VBF B;  4DXZ A;  5K0U B;  4F8A A;  2FD8 A;  4FP3 A;  4LIV A;  1GUI A;  2QFE A;  3B69 A;  4WM7 C;  2RM2 3;  1NYW A;  3OD4 A;  4K7J A;  1DQ2 A;  4HK8 A;  4LBQ D;  5EHD A;  4JGY C;  1DP0 A;  5DDJ 1;  5A3N A;  4NRQ A;  1JYN A;  1LOA A;  4E27 A;  1PMJ X;  4LUL A;  1CAV A;  1QY4 A;  3OGJ A;  3SLI A;  2WAB A;  5E89 A;  1FNY A;  1QQP 1;  5A7P A;  1PM4 A;  4QKB A;  3KV9 A;  2VNR A;  4OUE A;  3H1M A;  5FBZ A;  2A1X A;  5FXV A;  1TEI A;  4DXS A;  5FK8 A;  3VD4 A;  3HQX A;  5A32 B;  4DXT A;  5DUU A;  4XXP A;  2XKP A;  5ACA 1;  1Q56 A;  3O1S A;  2D93 A;  3THP A;  2Y6J A;  1K5M B;  5KWR A;  1FPN 2;  1CPN A;  5IWF A;  4L9B A;  3BTZ A;  1I5Z A;  3CJI A;  5LBC A;  1W06 A;  1BMV 1;  2VBD A;  2B5H A;  2VZU A;  5D21 A;  1Q43 A;  1CIW A;  4FFF A;  1IOA A;  1CVN A;  4JGY A;  3ILR A;  1VB2 A;  4O9G A;  4LKF A;  4WM7 A;  5F6K A;  5HPO A;  4PQ9 A;  1KQR A;  4LR4 A;  2JX9 A;  2VNG A;  4AEK A;  1KFX L;  3VLB B;  2HEW F;  1QJF A;  2RM2 1;  1HQL A;  3H8X A;  3PVB B;  2VCM A;  5FPA A;  2RJ2 A;  3ZFG B;  4P08 A;  1YFX A;  1ND2 B;  2OW4 A;  5LY1 A;  4AI0 A;  3JXS A;  4OQ8 A;  3HVD A;  1W2N A;  5FYS A;  1I6X A;  1EUU A;  2BTV C;  3TN9 3;  4XDP A;  5D8A B;  5FTT C;  1MS9 A;  3FFQ A;  1CZT A;  5IFT A;  1DGW X;  3USU A;  2XML A;  5LBB A;  1X7N A;  4TZD A;  1MS3 A;  1KDM A;  1W8N A;  4GUL A;  3DV8 A;  4GWJ A;  4MX3 A;  2OZJ A;  1U5I A;  4XQW A;  3V64 A;  4D7Y A;  4MAD A;  1GV9 A;  1NE6 A;  1OA3 A;  5A6X A;  1J3P A;  1NZI A;  1XYO A;  1PZ8 A;  1OD5 A;  1AL2 1;  2EF6 A;  2BEO A;  4DUX A;  1SLL A;  4PDW A;  2OX0 A;  1C4R A;  3HBK A;  1JOJ A;  4A6O A;  3TEX A;  3ZFF A;  4FPO B;  2YMZ A;  3NNM A;  4RQP B;  2OKX A;  1HB2 A;  1MAC A;  4P9I A;  2F4L A;  4HZF A;  3ZXK A;  1LU1 A;  3R05 A;  3FLP A;  4K9S A;  3UJQ A;  4AFD A;  5TSW A;  2BVV A;  3V65 A;  1V00 A;  2HWE 2;  1OHF A;  3M4F A;  3VZM A;  2DYC A;  2NP0 A;  3HR9 A;  5C6C A;  2IC1 A;  2ZGR A;  1AUY A;  3ETQ A;  3GAL A;  2ZEY A;  1HRV 2;  4AEM A;  1Q8S A;  1AYN 2;  1GZW B;  3N3H A;  4S2F A;  5HXM A;  3SKJ E;  4TSV A;  1F4H A;  3P5B A;  3ZKY A;  4OLL A;  3OCP A;  3OBZ A;  1GZW A;  2EXI A;  2FHR A;  4L0P A;  1GP5 A;  1HXS 3;  2ORZ A;  4QKN A;  4HKW A;  2YU2 A;  5AVP A;  2WRA A;  1GWK A;  3PIJ A;  2LRO A;  1N3O A;  3H3Z A;  4CCN A;  5C4W B;  1T6B X;  3TNP B;  1K3I A;  5BXX A;  1XE0 A;  1OA2 A;  2W95 A;  3H9A A;  1HXS 1;  1OKQ A;  4OQ9 A;  4OVE A;  5CEH A;  5FR3 A;  1H6Y A;  1NQJ A;  1O7F A;  1X9P A;  4JHZ A;  5FUI A;  1WMF A;  4S2G A;  4L99 A;  1BEV 1;  1PIV 1;  3WP6 A;  3AVR A;  3RVH A;  2WDB A;  4QHO A;  1R64 A;  2V5Y A;  2ETE A;  1YWK A;  3BVC A;  5A3W A;  1CAX A;  4RR3 A;  4R52 A;  1AJK A;  5E6H A;  3PJY A;  2GC0 A;  2GC3 A;  3A23 A;  5A6Z A;  4LUM A;  2X10 A;  3CO2 A;  4XIL A;  4ATF A;  2VVF A;  3VUO A;  3V0B B;  2PQQ A;  3U0Z A;  1UNB A;  1NUK A;  3N7K A;  4V2W A;  3ZXF A;  2MEV 3;  2ZEW A;  3M3C A;  4YLZ A;  2VUL A;  5FY9 A;  5SV5 A;  3OBA A;  2E6V A;  2HYK A;  2ZA9 A;  3B9C A;  3ZSL A;  5AFE A;  4D6Q A;  2PMW B;  4PLM A;  4RSU A;  2IZW A;  1CGP A;  5JMO A;  2CWM A;  1F5F A;  1LHO A;  2VOK A;  1LOF C;  1ND3 C;  4XJA A;  2DUQ A;  2JB4 A;  4LT5 A;  2DCY A;  2J7M A;  4CDW C;  5CYY A;  4BE3 A;  4X6Q B;  1ENQ A;  2W91 A;  2HYX A;  4UFK A;  3JD7 2;  4ASK A;  3D3A A;  1UW8 A;  1Y4W A;  3AJY A;  3TNQ A;  3ZPY A;  4UW5 A;  4HN1 A;  2D44 A;  3N36 A;  1OOP C;  3VKL A;  3ZYR A;  1RL3 A;  3VBR B;  2ZX3 A;  3AYD A;  1QNY A;  4WZC A;  5D1I A;  4BLI A;  3ZFG A;  4IE5 A;  4OHZ A;  5BNQ A;  5DPN A;  5F9T A;  5CFD A;  1M4W A;  3JU9 A;  4BME A;  4X8P A;  3IBM A;  2JEM A;  3IIA A;  3POJ A;  4HG6 B;  1GOF A;  3LDB A;  5LWB A;  3VBS C;  3TOJ A;  1VR3 A;  2DVD A;  4GAZ A;  2Q1F A;  2WT0 A;  4PIZ A;  1W8O A;  1OF3 A;  2BW8 A;  2LM3 A;  1OLQ A;  2X5I C;  1NCQ A;  1SLA A;  2Y33 A;  3ON7 A;  4A6S A;  5BNN C;  4HVO A;  3I49 A;  4CCD A;  4LBO A;  2JKX A;  2D7F A;  1QQP 2;  4DZG A;  1BKZ A;  2VL4 A;  5C8C A;  3WQB A;  1ONA A;  5JZG A;  4I0A A;  4RD7 A;  3J9S A;  5T54 A;  1FMD 1;  1URX A;  1KD7 A;  2JWP A;  3VZL A;  5EJ1 B;  5A70 A;  4I3P A;  3QH7 A;  1ZRE A;  5L9V A;  1Y9M A;  2X5I A;  2Y38 A;  4PDW B;  1OQD A;  1PK6 A;  1Y3T A;  4GWM A;  1O91 A;  2OUH A;  3J7L A;  4JHT A;  3JQX A;  2XJR A;  4OMC A;  3KGL A;  4SLI A;  3C7E A;  4P14 A;  4NRP A;  4QU1 A;  3JD7 3;  5CKM A;  2QQL A;  3J7N A;  1O6U A;  1NQD A;  1YFU A;  4LKD A;  3N7J A;  1JHN A;  4LNV A;  4UW4 A;  4XE9 A;  1AR8 1;  1O5L A;  4KBB A;  4W65 A;  3RZZ A;  3WNO A;  4COV A;  5FLH A;  3POE A;  2RDR A;  4FPJ A;  1RUC 1;  4Y3O A;  5DAQ A;  4AR2 A;  4CDW A;  3OSD A;  3TYJ A;  3JBG 3;  4AI8 A;  3AK0 A;  5AFB A;  5BNP A;  1AXZ A;  1ND3 A;  2ZBJ A;  3PUQ A;  1D2Q A;  4H3W A;  4CDW B;  2QDR A;  3DKQ A;  2C9A A;  4JC1 A;  4YWA A;  1DQ0 A;  5BNP B;  2HWB 3;  1ULE A;  4DS0 A;  3D5O A;  3T3Y A;  3O0V A;  1U12 A;  4IGO A;  4LBL A;  2AC1 A;  1H2N A;  1H9P A;  4XHX A;  2XUE A;  4EE2 A;  1UMZ A;  2RS5 2;  5DUX A;  5FCC A;  5M0T A;  2AGS A;  1VRH 2;  5C8W A;  4J6G A;  4WZF A;  4Q8K A;  1A6C A;  1RMU 1;  2H0B A;  3ETP A;  3PUI A;  1OSG A;  2EAL A;  3KCY A;  1AZD A;  2WZE A;  3GXU A;  4RR3 C;  3ZIW A;  3T4H B;  4A7K A;  5IK7 A;  4LE3 A;  5IUQ A;  3VDC A;  2A71 A;  3LF7 A;  3MIG A;  3KLS A;  5F5C A;  4RR3 B;  2XJS A;  3SXW A;  1JZ7 A;  1KJR A;  2AZ5 A;  1S0J A;  5FMD A;  4KQ7 A;  2MNG A;  1AF9 A;  5FYY A;  1F15 A;  1STM A;  3GZU C;  4LKE A;  1JBC A;  1WLW A;  5DXD A;  3AZV A;  1PK6 C;  1S0I A;  4HT1 T;  5ANQ A;  4IES A;  3SEP A;  4IXL A;  2WNV A;  2X8K A;  4DRV A;  3PU8 A;  1HN1 A;  4Y20 A;  3VV1 A;  5F2S A;  2BVB A;  4YRD A;  1XNK A;  5CG9 A;  2OUJ A;  4NWV A;  2VOW A;  1YI7 A;  5FV3 A;  4FXG B;  1KDK A;  5I91 A;  3H8U A;  5A7N A;  2H6B A;  5F6L B;  4JKK A;  1QJE A;  3VZJ A;  2ZJC A;  4YZ2 A;  3THT A;  1DF0 A;  1H0B A;  3ZMO A;  3OPW A;  4FBF A;  1O4T A;  1CPM A;  2QQN A;  2W08 A;  3PDQ A;  2A6V A;  3APB A;  4AI9 A;  1NCQ C;  5JXH A;  1GZT A;  1OQ1 A;  4XJ8 A;  1C8M 2;  1D4M 2;  2F4P A;  5D8A A;  4AHX A;  1MS1 A;  2FDJ A;  2P5B A;  2RMU 3;  1JTZ X;  3BU7 A;  3PU3 A;  5CFD C;  2G9G A;  1I5P A;  3ZFG C;  4XF1 A;  4BIF A;  2XH6 A;  3DXU A;  4CCE A;  4FPY A;  2Q8D A;  3O0W A;  2BV4 A;  2VZP A;  4AGG A;  2P34 A;  5LK7 B;  2ENR A;  4XF0 A;  2WA4 A;  5FRA A;  2IXL A;  4YZ3 A;  1UCX A;  5I0S A;  1W39 A;  3I3E A;  5CKQ A;  1JXN A;  4XEZ A;  4GQ7 A;  2BNO A;  4BQ2 A;  2BGC A;  3M7A A;  5FKB A;  1YXW A;  2D3S A;  1JOP A;  1U5X A;  4LO4 B;  3L2Y A;  5EZW A;  3WUC A;  1UWW A;  4KBZ A;  3ZFE C;  2VMG A;  3RPQ A;  5T52 A;  2CDO A;  4LO6 B;  5I8S A;  3WG3 A;  3AX4 A;  4CVU A;  3WNM A;  2VC9 A;  2GN7 A;  4MHR A;  1H8T A;  2E9Q A;  4HXC A;  1J1T A;  1GIC A;  4B3N A;  4EWD A;  2O14 A;  1F9K A;  3SCF A;  2BOI A;  3D0J A;  5DZF A;  5CKN A;  1HRV 3;  5GLW A;  4LOT A;  1LJ7 A;  2R07 2;  3B00 A;  2XGX A;  4N8M A;  4HKL A;  3DPR B;  4JVA A;  2HWD 1;  2G9F A;  2W9X A;  3GHM A;  4GH4 A;  3R4D B;  1RB8 G;  2BFU L;  2UWC A;  4BB3 A;  2VUD A;  3HT1 A;  1RUJ 3;  1VBD 3;  4MET A;  4IEV A;  2P37 A;  2VO5 A;  2F6B A;  2WNU A;  5T3N A;  3CHX A;  2YG0 A;  3O1M A;  2QUO A;  1JMU B;  1NY7 1;  4XBQ A;  5CB7 A;  3OUH A;  5F32 A;  3ZR6 A;  4BZ4 A;  1PVX A;  3WDX A;  2CGP A;  3MLK A;  2FDK A;  4HSL A;  3FUO A;  3OGR A;  4JKM A;  1QJY 3;  4NHK A;  3O1V A;  1ZZ6 A;  1SDW A;  4YM2 A;  1UU4 A;  1GR3 A;  4FPC A;  3ELN A;  5CNA A;  2JDU A;  2RMU 1;  3O5S A;  2RVA A;  3VBS B;  4QB6 A;  3VB9 A;  3ZXJ A;  1FV3 A;  2GME A;  3AFK A;  1GYK A;  1C8N A;  1SLI A;  2LAL A;  3AP7 A;  4E4D X;  3IDA A;  5FO8 B;  4LOS A;  4KG8 A;  3FN9 A;  1VBE 3;  1N3P A;  1LHV A;  4GMP 0;  4RGG A;  3VBO A;  1C5H A;  3BOW A;  2H0V A;  2R32 A;  5FZG A;  3VDD A;  1JH5 A;  2XJT A;  4QX2 A;  1WMD A;  1UY4 A;  2WO7 A;  4O7X A;  4CEW B;  3RG0 A;  2ZGS A;  2Q0A A;  1YI9 A;  3VHN A;  2E7T A;  1WUV A;  5A33 A;  1FMD 2;  4CDX C;  1ULD A;  2QTW B;  1XQN A;  1HRI 3;  4QAW A;  4Q4Y 3;  2QQW A;  2VZQ A;  1T2X A;  3VGI A;  1TNR A;  3AP4 A;  2J1S A;  2A6W A;  4OHW A;  5L36 A;  1SBF A;  2CGN A;  1GOG A;  1UAI A;  4FT8 A;  1UOB A;  4YGC A;  5LA2 A;  4FSJ A;  1W6N A;  4JTN A;  4Y4Y A;  1VMF A;  2WNV B;  4GKY A;  4Q4X 1;  2YV8 A;  1QJX 1;  2G4I A;  2ILM A;  3T2O A;  3LEI A;  1LHN A;  5FZO A;  3EB7 A;  3H50 A;  1GQP A;  4Q1P A;  1VMH A;  4R9C A;  4AXO A;  5EWS A;  4ES8 A;  2WQZ C;  1PGL 2;  1ACC A;  1MVQ A;  2ARE A;  2QQP A;  4NR1 A;  1POV 3;  3NNG A;  4GB3 1;  5LA9 A;  4C1X A;  5FOJ B;  1RXF A;  3MBW A;  4RHV 3;  3GYD A;  1OQE A;  1VAK A;  3NL1 A;  2IXC A;  4M4P A;  5IVJ A;  3KVB A;  1NXM A;  3OUI A;  1Q5O A;  3KV5 A;  4XAE A;  4Q2F A;  3AM2 A;  1OOP B;  1JS9 A;  4D69 A;  1AR6 2;  2DFC A;  3MGU A;  4QXC A;  4XUO A;  3S7I A;  4OHY A;  3G6J B; 
#chains in the Genus database with same CATH homology
 4RFR B;  4IDZ A;  5F8P A;  4NPL A;  4NRQ A;  4ZHN A;  2FDH A;  4NID A;  3I49 A;  4CXW A;  4QKD A;  4CXY A;  3RZH A;  4NPM A;  3S57 A;  4QHO A;  4NII A;  3I3Q A;  2FDI A;  2IUW A;  3KHB A;  3BTX A;  3T4H B;  3H8X A;  3RZM A;  4QKB A;  4IE0 A;  5DAB A;  3O1O A;  3H8R A;  3I2O A;  3BKZ A;  4NIG A;  3BU0 A;  3LFM A;  4QKN A;  3S5A A;  3KHC A;  4NJ4 A;  4QKF A;  4IE7 A;  3H8O A;  4O7X A;  3O1M A;  3BTY A;  4IE4 A;  3O1P A;  4OCT A;  3O1U A;  4IE5 A;  3O1R A;  3O1S A;  2FDK A;  2FDG A;  3RZL A;  4CXX A;  4O61 A;  2FDJ A;  3I3M A;  3RZJ A;  2FD8 A;  3O1V A;  3T3Y A;  3BTZ A;  4MGT A;  3T4V A;  4JHT A;  4ZS2 A;  3BIE A;  3RZK A;  4NRO A;  4ZS3 A;  3BUC A;  2FDF A;  4NRM A;  3O1T A;  3RZG A;  4NRP A;  4NIH A;  4IE6 A;  4MG2 A;  3BI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...