4JHTA

Crystal structure of alkb in complex with 5-carboxy-8-hydroxyquinoline (iox1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title 5-Carboxy-8-hydroxyquinoline is a broad spectrum 2-oxoglutarate oxygenase inhibitor which causes iron translocation
doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4jhtA00
3I49A 4IE0A 3S5AA 4IE4A 3BTYA 4IE5A 4IE6A 4IE7A 4NRQA 3RZLA 4NPMA 3H8RA 4NPLA 3O1UA 2IUWA 4CXXA 4QKFA 3H8XA 4QKBA 2FDGA 3I3MA 5F8PA 3O1VA 3RZHA 3BIEA 2FDFA 3BKZA 3O1RA 2FDIA 3S57A 3O1SA 4QKNA 3BTXA 4CXWA 3O1PA 4RFRB 3RZJA 4IDZA 3T4VA 4NRMA 4OCTA 4JHTA 3BTZA 4NJ4A 3RZGA 3O1MA 4NIDA 4ZS3A 3O1OA 4O61A 3T3YA 4NROA 3T4HB 4MG2A 2FDHA 4NIIA 3RZMA 4CXYA 3O1TA 4NIHA 3I2OA 5DABA 4O7XA 3BUCA 3RZKA 4NIGA 4ZHNA 2FDJA 4ZS2A 4QHOA 3I3QA 4QKDA 3H8OA 2FD8A 3LFMA 3BU0A 4NRPA 4MGTA 3KHCA 3KHBA 3BI3A 2FDKA
chains in the Genus database with same CATH superfamily
2YFUA 4PI0A 4R9BA 4QPIA 4CP0A 1DYOA 2B45X 2GDFA 2Y8KA 3HN1A 4XILA 1JOPA 5FY8A 2E26A 4BK5A 2R1BA 4Q27A 5I0RA 4BB3A 4BU2A 4JRAA 1U5YA 3ILFA 3SCFA 3OY8B 2W52A 2GC1A 2E32A 2XUEA 2Y6JA 1AR93 2YROA 2RE9A 2VBBA 3GJAA 4CDQA 2PAKA 5FZIA 1CIWA 4DUVA 2E33A 1UKRA 2UWAA 2WZR2 1O3TA 1XNKA 3BIWE 4QQOA 5D8AA 1WW4A 3ES1A 1OLME 2C0ZA 4YW5A 4B4PA 1PO11 1PGW2 4LBOA 2NMNA 2V4AA 2AYHA 3DYPA 3SITA 3H8XA 1URXA 3T2OA 1DG6A 5K0UA 3VDDB 4DRVA 4MGIE 3WNNA 3AFGA 1W0OA 1CR7A 1K42A 1ZZ9A 3PHMA 3WQ1A 2RM22 2C6SA 3OB8A 1LTEA 3VBUB 3VBFC 3Q8EA 4XBNA 5AC93 1UL9A 4J25A 4QPWA 4OVEA 4R9DA 1DFQA 3C7FA 3NAPC 3LD8A 4RHV1 4Q4X2 2E31A 1PK6B 1W9FA 3BPZA 3JUUA 1W8NA 4AHXA 3HBZA 2CDOA 4UF0A 1KDMA 2J1RA 2KXLA 1BEV3 4P00B 3NQHA 1IPSA 4ZY9A 4EYUA 3POSA 4HT1T 2VE1A 3HQXA 4GAZA 4Q4Y2 5J96B 2QQWA 4P9XA 3J8F3 5CKMA 3TEXA 3PMEA 3UETA 1YLLA 4BJ0A 4OHVA 3WZ1A 3VUOA 2X8KA 4AE2A 5T50A 1K5MB 3VBRA 4CEWB 1J58A 4ATFA 2XOMA 3I59A 3IDCB 3KGZA 1E5HA 2VPVA 1ST8A 1IS3A 3ECQA 5JZGA 4TLGA 5FO9B 3LAGA 2HWF2 4DOUA 1FOD3 2VZTA 3DPRB 2VNOA 3T1MA 1DDLA 1AR91 3ZN6A 2JB4A 3APBA 3I2IA 3HNMA 1XB9A 2WNUB 3T09A 4CUBA 2XKOA 5IT6A 5L7OA 2Y6GA 1WW5A 4INDA 3ZKUA 4ZU7A 5HCAA 1A8MA 3HPNA 1WBLA 2D40A 3TYJA 2P3KA 5C5TA 3P3NA 4LBNA 4LQRA 5A32A 4E8CA 3J26N 4RS5A 5IK4A 2AUYA 1OF4A 4IERA 1KJRA 4D7SA 3VKMA 3R4DB 2W87A 3ATGA 1UOFA 5JXGA 1ND3A 1W9WA 2W5FA 3T0DA 1CJPA 4YW3A 5DXDA 5AC91 4KWJA 5EJ3A 1QKQA 4Q2FA 1POV3 1CX4A 2J1SA 4YGEA 1G8WA 2VMFA 3BI3A 5EQUA 3GDBA 4AFBA 1JOJA 4DO0A 5ABJC 1BEV1 1RITA 3Q8FA 3TB0A 3RDIA 4AEDB 3N7JA 4ATEA 4AEMA 1OLQA 5LZ6A 1A34A 2X10A 2RDNA 1VRH3 1UMHA 4FBFA 4IE5A 1D2QA 3J8F1 1T6BX 3I8TA 5T5JA 1IKQA 1HX6A 4QXBA 5C3OA 4RGGA 3E5QA 5C9AC 1LOGA 5H9QA 4Y4RA 2BZDA 1PNFA 2C26A 1XOYA 1KFXL 1OSGA 3E97A 2Q0AA 1GSLA 2VG9A 5D21A 3JQWA 3B02A 1N3PA 5C4WA 1NCQA 3VDDC 1GNHA 1OBNA 4NPMA 1QY4A 3I2JA 3WINE 1WWYA 4MZUA 1FOD1 1HRI3 2W0XA 3VBSC 1LEDA 3VBUC 3ZFGB 1JODA 2EALA 3HNBM 3ILRA 3AB0A 4CDWC 5FXWA 2P6CA 4R9AA 3RI9A 1I3HA 3BVCA 4XUNA 5C33A 1UXZA 4CCJA 1RL3A 4NHLA 4XIOA 4BQ5A 2IXCA 5BUVA 2FCTA 4R8HA 2Q8DA 3LIGA 2P5BA 1FT9A 2VOKA 1UYXA 4OYUA 3LSDA 1X50A 4QGMA 1NLSA 4XFIA 1LENA 1YIFA 3IWZA 1J1LA 2JIJA 2VW0A 3HBKA 3QLQA 1W9TA 3LEMA 4XTPA 1Y4WA 4AI8A 3ZSJA 2CU5A 3ZVXA 3FUOA 5EWSA 5B4XA 1YNAA 1FPN3 2TEPA 2Y0IA 2YBKA 4K21A 4BXFA 1JYIA 1POV1 3QOPA 2RV9A 3R4SA 3BOWA 3ZXGA 3VZMA 3OUIA 4KMQA 2YUEA 1EUUA 4XC9A 5JR2A 5C3QA 4DZGA 2VU9A 1V6NA 2W08A 4WM8A 3DPRC 2W9XA 4QDRA 5E16A 4FPEA 1NOVA 2ZEXA 4LBMA 4X8NA 3ZYGA 2VCBA 2WNUC 3JCIA 2PFWA 3OUHA 3O1OA 1YQ6A 3ZFEB 1VJ2A 1VRH1 4CP1A 3ZMNA 1DQ2A 2BGPA 4K1YA 1GOFA 5FPAA 2PN5A 5DAWA 4XF9A 5EYXA 2HWE3 1O91A 4XDOA 4QQLA 4EZ4A 1LOFA 2ETEA 1S0GA 5CFDB 4HFSA 5J37A 3ETPA 5KHHA 2BBVA 3BTAA 1JYTA 1BCXA 5EP9A 2BNMA 4AVVA 4GH4B 4YM1A 4UAPA 4GA9A 4P5HA 4JGZA 2NZ9A 3I2FA 5FZ8A 1HRI1 2EIBA 4BZ4A 1LHVA 2WS92 4NHYA 1UN1A 4A3ZA 1KS5A 1RUG3 4XMAA 4CU8A 4D7YA 1NY71 1OMIA 3GGLA 1W6OA 2WKKA 5LA2A 1J1TA 1JW6A 3ZLIA 4ZS2A 4EN0A 4B7KA 2B42B 2XONA 4JAAA 2WABA 4N9IA 2W46A 1BXHA 5IWFA 1UY1A 3WNMA 2ZCWA 4O9EA 4IEPA 4XW3A 5FZOA 1RUOA 3TAYA 1DIWA 1H1AA 3AMHA 4KWKA 2GNBA 4OUEA 1GP5A 1H30A 2JE9A 5ACA2 3VBOA 4IV3A 3CL1A 1FPN1 4FTEA 5FZ1A 1JZ6A 3H3ZA 3N7KA 1RUI2 5FRAA 2J42A 4JDNA 1FAYA 1QHDA 2ZEWA 1HB1A 4IE6A 4P9GA 5KWRA 3RJ2X 1SDDB 1JZ7A 1J84A 2ZGTA 3WF4A 3GALA 4YZ2A 2DFCA 5FMDA 2F4PA 2E63A 3X29B 1RUH3 5FZ6A 1V70A 4XPVA 3OYWA 5LK7B 4LHLA 3OF1A 3PUAA 3CJIB 4LNVA 2HWE1 3DXUA 3FC0A 3J7MA 4I30A 4M4RA 4TWTA 4AHZA 1RXGA 4W65A 5ISLA 4RQPA 1BLZA 2Y6FA 3SNMA 4LE3A 4CZSA 1JS9A 2DCZA 2Y64A 1VBD3 4GB33 4QX7A 4OI1A 1Q8VA 5F2SA 4HPKB 4YNIA 3SISA 3RZHA 4Y1UA 2D44A 3Q8CA 4WVMA 4YW7A 4ONUA 2P3JA 2HEWF 2V73A 4QDQA 3UV9A 4JDMA 2XQRA 4QX8A 2WBKA 5A7QA 1MS0A 1UZZA 2RVAA 1RUG1 3OUJA 4PDWA 1N1YA 2GSYA 2ZBJA 4CPBD 4LKDA 4AVAA 3DYMA 2FDIA 1LOBA 1U12A 4FVVA 2B9UA 2BV4A 2CWMA 2WUHA 4F3JA 3GBWA 2BNOA 1XNTA 3U37A 3USUB 5IK7A 1AR72 3M3CA 4DXSA 3TNPB 2YZ4A 1X36A 3O1PA 2VQ0A 4HG6B 1D4M2 3L2YA 1XU2A 3KT4A 2WO2A 5FUPA 3S7IA 3WY6A 2VTXA 3AMMA 1PVC2 3PUHA 3TOJA 3WUCA 1EPZA 2FMDA 1I9RA 5FP7A 2Z5WA 4UT5A 3WG2A 3ZFEC 3W5NA 4FPHA 3AZVA 5JOZA 1R1A3 1NLQA 5CFDC 3OBRA 3RSJA 4AI0A 3RS6A 2YB7A 1Q3EA 4MGSA 1DQ0A 5CBLA 3HD8B 1XNAA 5F37A 2D6OX 4GH4C 3NNJA 4ZZ8A 2FZ2A 1RMU3 4FPOB 2VZ3A 3WG3A 1GZWA 4XQDA 4OI0A 4WM7B 2JD9A 4GD4A 3Q9OA 1RUH1 2JG8A 4XF4A 1O7FA 3M1HA 2P34A 2HH9A 3JU9A 4CXYA 1ZZBA 2Q8EA 4PQ9A 5FXZA 3MPPG 4LUKA 5A3UA 2IXIA 3WDUA 1AVBA 2ZAHA 2E53A 3TN92 4A7KA 3RQ0A 4CTEA 2BDRA 3BCWA 3IMMA 4A7ZA 4FPKA 1ASJ2 1R092 2D6NA 1QOTA 3DYOA 4M01A 5FMOS 5FPZA 1VBD1 4GB31 5FYIA 3U11A 5FR3A 3AKPA 4CCMA 1WKYA 3SKVA 1BKZA 1OA3A 1PMJX 3UJQA 2DUOA 4UI9L 2LTNA 1A3KA 2XJUA 4QQPA 4UW3A 4FPFA 1XRUA 4MGKE 2F17A 2GC2A 3N9NA 3PU8A 4AFMA 3CO2A 2VUAA 5DG2A 1CN1A 1NUKA 5A3LA 2FCUA 1K5JA 4JQTA 3B94A 1DGWA 1MR5A 2PTMA 2AACA 4IEWA 5E88A 5DG1A 5FY0A 3U1XA 2MEV3 5FK8A 2GC0A 1TMF3 2YC0A 4AOCA 1V6IA 1V6OA 3H7YA 2LUWA 2R062 2P1BA 3N7LA 2FHRA 5IW0A 5FQ0A 4BXSV 3MIDA 3PIGA 4XHXA 2DTYA 1VBA2 3ABZA 1Z7S2 1J83A 3ZKYA 1R1A1 2X5IA 3A0KA 5JSRA 1BJQA 4KGGA 2ZX3A 4YW4A 1OHFA 4EJRA 2UY8A 3IT8A 4MO3M 1UU5A 2XXZA 4AVTA 4HETA 1AX0A 3KS7A 4B7EA 3H0OA 4PBOA 3S5QA 1RMU1 3ZFFA 2ZGSA 4DMIA 5BNNB 1O3QA 2WYFA 2W1UA 4C8DA 2CYFA 1LEMA 3C3VA 2GNDA 4W6WA 3TEYA 2WR9A 5IJRA 4NIAA 4RR3B 2VNGA 1ZZ6A 1O4ZA 3CJXA 1RGSA 5LA1A 3ES4A 3I7DA 1V6LA 3NJYA 4MGZE 2XGXA 1W2OA 1TG7A 2YPDA 4CEYA 1FMD2 3H1MA 4F83A 1SBDA 2TUNA 2A7AA 3MW4A 4HVQA 3SEEA 4Z1VA 4IEVA 5SV8A 5HV4A 1I5PA 5F5IA 4EN6B 5FZCA 4EQVA 5CFCC 4AI3A 2OA2A 1RYYA 4YARA 3VZKA 2DBNA 1CJDA 4LO4B 3JZVA 5A70A 1VBE3 4YW6A 4YVWB 1AR63 2ZGPA 3AP7A 1B35B 2W2IA 4DUXA 3FLRA 2ZPXA 3ZXKA 2UWCA 2WZEA 4BHPA 2GC3A 5C8CA 4QB1A 1DZRA 1RUC3 2JG9B 4HK9A 1ZRRA 4NHKA 4GWNA 3ACGA 4JGYB 4YVSA 3H7JA 3R4UA 3KCCA 3THDA 4DNYA 2AENA 1GR3A 3BTZA 4AFCA 2DCKA 5DUVA 2MEV1 4I0BA 2JDMA 1TMF1 2E7TA 5GZEA 1UXXX 2IVJA 5A3MA 4LJHA 5JMCA 2QQIA 2GMPA 2BVBA 4PF1A 3ZYPA 2BPA2 5DN2A 2DF7A 4YFZA 4YRDA 2W1WA 4PHZA 1NA1B 4OMDA 4W8JA 5J98B 4EWAA 4DPNA 1YFUA 4KQ7A 1NZIA 5CKQA 3ZYBA 2F4LA 2EXJA 1ULFA 1XJAA 2A6VA 4K8FA 4AQ2A 3T2QA 2NP0A 1TVGA 1IKPA 1AJOA 1QH7A 2QQJA 4H2AA 4AXOA 3SCHA 4ZZ5A 5IK5A 4PI2A 3IPVB 4BQXA 3E6DA 2OPWA 5DPNA 4COVA 4KWLA 4CP2A 1ULDA 4XZUG 1Y9GA 3AX4A 4TLFA 3N35A 2D97A 4FTSA 2OUHA 5GZCA 2G19A 1K12A 1GICA 3RI8A 3NV4A 1NT0A 1YI9A 4LOSA 2WN3A 3JD72 5EFUA 5T54A 2AGSA 5ERLA 2D6PA 1JH5A 4CDUB 2D93A 1JYXA 2ZMLA 3I3QA 3ST7A 1SFYA 3H8OA 1JHNA 4I09A 5FYVA 1E5RA 4AK3A 3FFQA 5K7PA 3ZFGC 2DFBA 2B39A 1VBE1 4Q0QA 4K3UA 1AR61 4BQWA 1MQTB 2YU1A 4Y1XA 3V0BA 4N43C 4RL7A 4NJ4A 4Y1YA 5CADA 2JDKA 4QPGB 1MS9A 1SLTA 5CIRA 4LO5B 1RUC1 2BVVA 4NMIA 5FZHA 4QPIB 3J7LA 5FZ4A 2XB6C 4PCRA 3OOXA 3UGGA 1NZCA 1SFNA 2OS2A 4M4PA 1BMV2 5LEJA 5KHKA 5M0TA 3J7NA 4XUQA 4K7JA 2Z4FA 3IDBB 4KBBA 3A7QA 1W8UA 3M3OA 4IXLA 1IHMA 5JLVA 4Q1RA 2AEZA 4MV2A 4CDQB 2H6BA 3VKFC 5G05L 1AYM3 1XSRA 2MHFA 3AKTA 3GJBA 5LBFA 4M00A 2PELA 1QH6A 2WINB 1J59A 1OLRA 3AL5A 5FPBA 2PXJA 2VMDA 4J1WA 4RYDA 3VHOA 1V9U2 3MLJA 3WF0A 1MEC3 4Q26A 1LU1A 2QCSB 2P4EA 4J6GA 4YVWC 5K0UB 1B35C 5FFOC 1JOBA 4MLOA 5LA0A 2PQSA 2WNVA 3BIEA 5A3PA 5K8SA 1PGL1 1SPPA 4YZ3A 3GYDA 1YRZA 5C8WA 2WN2A 2JG9C 3K4DA 3WW4A 1WCDJ 3D0JA 1LU2A 1JXNA 1X9TA 3MGUA 3B93A 2QQLA 4K6BA 5FLHA 5DQ0A 5FO7B 5F5QA 4YFWA 3KGLA 2UYAA 1EPWA 1ZYBA 3A22A 3EB7A 4RFT0 2QBXA 5FYHA 3VBHC 1UO9A 3ZIWA 4CP9A 3JB4C 4AWDA 3TEZA 1MZ5A 1A78A 4UF0B 4KL1A 5FOJB 1S2KA 3HAGA 4P14A 1GYKA 1SBFA 2VMIA 4PLMA 1YQ8A 3WW2A 5FY1A 1HW5A 4CVUA 1OOPC 3H3LA 4MXWB 3P1IA 4AI9A 3INAA 4HK8A 5DAXA 2F6BA 5JXHA 1U0AA 1NE4A 2RR13 4JKKA 1SEFA 2ZS6B 1YFYA 2ZEZA 5DZFA 3VBRB 4AL9A 3BGAA 4Q4V3 3K46A 1NYWA 5CKNA 3I59B 5HXMA 4D94A 3THPA 2DTWA 2WL1A 4P02B 4Q1PA 5APAA 5IVYA 5JZGB 1WW6A 2BOIA 3P6BA 1WA4A 4HKLA 1D0GA 2Y6LA 1QDOA 5JWPA 3RG0A 5E89A 2LS6A 3RZMA 1W6NA 1F15A 1VPHA 4KH9A 4WV8A 1AYM1 4QXHA 2HBTA 4JCKA 4JDOA 2VOXA 1PO12 3QACA 5JI7A 4MHUA 3VD7A 4CDUC 3RRDA 1W39A 3QD6A 3CDZB 3KD4A 4FOWA 4O65A 2VH9A 3WV6A 5A7WA 1W3XA 2Z79A 5FOBB 2XJRA 5FP9A 4XCBA 2P6HA 3EBRA 3UKTA 1EV13 5IYYA 1MS5A 1MEC1 2WSUA 3A23A 4XFAA 1OH4A 4RS5B 2D98A 4Q0SA 3FN9A 2ZTNA 2WSVA 4QKDA 4QPGC 3JBG3 3THTA 4HANA 5GJ6A 4LULA 3AJZA 5KHIA 1SCRA 3ILNA 2A70A 4XF3A 2JEMA 1YFXA 4WVWA 2J1AA 1H9PA 2TBVA 3TBDA 3PU3A 4W6YA 2Q8CA 2H0VA 2FDKA 1S4CA 4A45A 1QJFA 4MSVA 4Q4W2 3DN7A 1LJ7A 1Q56A 2VMCA 4Y1VA 4EZHA 1G86A 4K1ZA 1JZ2A 4FAGA 1SLIA 1G9BA 1BVVA 5FZFA 1OD3A 5E6HA 4XACA 1GV9A 3WOGA 5A3WA 4SBVA 2GH8A 1LHWA 1KD7A 2RR11 1R1ZA 3LSEA 5KXDA 3B9CA 4Q4V1 1Z78A 2OQ7A 1ZRIA 3R05A 1O3SA 5C4WB 1AR92 4K8RB 1RUJ3 4Y24A 1QQP3 1PZ7A 1PVXA 5LA9A 2EIEA 2W94A 2YBPA 2ZA9A 1RIRA 1APNA 3DEMA 3DUIA 2RS13 2B8MA 4W6XA 4XFGA 3LFIA 3ZMOA 2ZX1A 1VAVA 5BNOC 3ELNA 1VBC3 3NJZA 4FPCA 1W9YA 2BOJA 2K9ZA 3AZWA 1HQLA 3OPTA 4COYA 5GLVA 1EV11 1Y3TA 2K2SA 4CSWA 2W3JA 4BQ2A 4OUMA 2ATFA 2XJTA 1W6MA 3WF2A 3ZDVA 3J4UH 3N9MA 1JMUB 3CU7A 5FZGA 1QJY3 3JBG1 1HJGA 1HN1A 2UYBA 3ZYHA 5AC92 3BODA 3LOBA 3LCPA 2ZX2A 4Y4YA 4FOYA 3AZYA 1YCIA 4FOVA 3VKNA 2NMOA 2WQZC 3T30A 3UKNA 5FMOL 1US3A 3AXDA 1JTZX 2A5ZA 2J1UA 4CYDA 3URFA 4BQ3A 3POJA 1HJFA 3WNPA 4LO6B 4XQ4A 4IEUA 4MXVA 4QU2A 1BEV2 1OURA 1HQNA 3S30A 2NM1A 2UY9A 4YGBA 5FKCA 4HKOA 1MS4A 5C6CA 4WM8B 5JOXA 5J36A 1VE0A 2DVAA 4LR4A 4BIOA 3U4XA 2YHJA 3J8F2 4QX1A 1HB2A 3K75B 4D6QA 2E7AA 1PNGA 2RHPA 4LK7A 4AFDA 2VECA 1AYN3 4H7MA 3AJYA 3QBQA 4JQRA 3C7OA 5B2GB 2XG3A 2Y6HA 2ENRA 2VXRA 1TEIA 2WYSA 3ZXEA 3EYPA 2NQYA 1N1VA 5FREA 2CGPA 1YO8A 2D3SA 4JGZB 1RUJ1 1QQP1 1W2UA 2WO3A 3AYDA 3WUDA 4OLLA 1CAWA 4QX0A 2X05A 2DVFA 3D5OA 5LWBA 1QF3A 2RS11 2JDPA 1VMHA 1HRV2 2R043 4BLIA 1KJLA 1W8ZA 1STMA 2PHDA 3K77A 4RGAA 1G9AA 1F4AA 4C0BA 1OQ1A 2KR2A 1VBC1 1AXKA 1W6OB 3OPZA 2FD8A 1MZEA 1WLCA 3W58A 3LFMA 2A3XA 2ZGKA 4KGQA 5FPUA 1KS4A 3HVDA 1QOOA 4Q0PA 5JVVA 5SV5A 4JZRA 3HQUA 2OKXA 3ZR5A 2XJQA 1AX1A 3KCXA 4ARYA 5FZOB 2QNKA 4HBNA 4ZXKA 1UPSA 1QJY1 4BPZA 4LORA 4CDXC 1CESA 1O8SA 3VBOB 1JU3A 2CTVA 2RMU2 3LPGA 1WBFA 3AXEA 3MBWA 3POYA 4IV3B 4NUBA 2HKXA 4XJAA 3WHUA 2LROA 4BDVB 3PL0A 2QQNA 4N8MA 5KXBA 2X53S 2MNGA 4OULA 2WZ8A 1JYCA 4JHZA 4C1XA 1CIYA 1V6MA 2I07B 5GZDA 3SH3A 1HKDA 3FZ3A 3VBFA 5A3NA 4G4FA 4QHZA 4N53B 4WZFA 1XYNA 3CIHA 4PBPA 4CUGA 5LRSA 5TSWA 1AL23 1TME3 3NAPA 4HXCA 1VB2A 3D82A 4ET7A 4MYEA 1MS8A 1ZBA3 2C24A 1DYKA 2IUWA 2J22A 1OLMA 3A0NA 3WNKA 4IGQA 1AYN1 3LDRA 2RS53 2J1EA 2O14A 4YGDA 4CPBA 1LNSA 1OQDA 1V00A 4RQPB 4YWAA 5I0UA 4DXRA 1XNBA 3IAPA 1UQXA 1FI2A 4U36A 5FUNA 1UZWA 2IVIB 2V5YA 2SLIA 4KNCA 1JZ3A 1RUNA 4EV0A 1GLHA 1Q8QA 4BMEA 4WVMB 1PO23 2VAUA 3FE5A 1LHUA 1H9WA 1GZTA 5K9YA 5DAPA 1NY72 5FY4A 1WD4A 2EXKA 1VLNA 3H9AA 3I2HA 3E5XA 3IN9A 5FY5A 4PDWB 2R041 5H9RA 1YIPA 3ZSEA 5HCHA 3AYAA 2QQUA 2YBSA 3GXUA 2ARXA 2D43A 2QQVA 4MX3A 4OHXA 4XJWA 3AZXA 3K4AA 2W68A 3HT1A 1GBGA 1SLAA 2WFF3 3NJVA 1E5IA 4OCTA 4TZDA 4Y22A 4BLJA 1S0IA 3KQ4B 2D6KA 1ND2B 1FPN2 3V0AA 3UL2A 1J3RA 4V2VA 1RUF3 3AK0A 1LCLA 3UGHA 1PIV3 1PK6C 4YZ4A 5CU1A 5A7OA 1W6QA 4Y26A 5FPXA 1SLCA 3I2KA 3I3DA 3AP6A 2ZGMA 5IK8A 1IS4A 1UKGA 1YEWA 1H2NA 1RVF3 2FDHA 2ZOEB 4NWVA 2HWD3 5F5AA 2HWE2 1LULA 1S0FA 1K5MC 3OG2A 1OXCA 1AL21 1TME1 2BBAA 1QMJA 5L73A 2QZ3A 1DGWX 4I3PA 4XURA 4CEWC 1ZBA1 3I2OA 4CCNA 3PIJA 4LBJA 2PHRA 3LIHA 4J1XA 2RS51 3SEPA 1VBB3 4I01A 3UNPA 4FPJA 5ABJA 3G6JB 4H55A 4L9BA 2QQKA 3C7EA 5EYYA 4BQ1A 4OFGA 4PT6A 2BNNA 3NKTA 4AGRA 2GNTA 1HV1A 3AP9A 4QHOA 1XE7A 5CNAA 3RYRA 3MIHA 3NWKA 1PO21 1RUG2 1MVQA 1W0PA 5C9AA 3UYJA 4LBLA 3RMXA 4MGTA 3U14A 1ZBE3 1XE8A 2I74A 3IM0A 3VDDA 1AXYA 2CSGA 2CY6A 5JAXA 2OQ6A 1LECA 2R073 2Q30A 2Z2SB 3TNQA 3DV8A 4B1LA 3VBSA 2XQXA 3VBUA 2YC4A 3ZXDA 1LGNA 3CLPA 1REDA 2P3YA 3ZPYA 4CDWA 2WFF1 1PM7A 1A6CA 1LHNA 2JICA 4QMAA 4IE4A 4AGVA 2XLFA 4N53C 2GNMA 4E2SA 2A6XA 1VP6A 5FQ0B 1BYHA 3HWJA 3ZYFA 3OD4A 1W0NA 1SG3A 5A7NA 1RUF1 2JECA 1O4TA 4NRQA 4Q8LA 3B5LB 2PHWA 1DP0A 2X5IB 1PIV1 5GZGA 1CZVA 3USSA 2R6QA 5FJHA 4GULA 3THCA 1JU4A 1LR5A 4QDSA 4WBBA 5FYMA 2BEOA 2D3PA 2YYOA 1POV0 3ZFFB 4AEDC 3KWVA 5GALA 1RUH2 2A1XA 2WLQA 4YG3A 1MZFA 1PM4A 1RVF1 1DGRN 1OQEA 4LKEA 5L9BA 4UFJA 2VBPA 2HWD1 2EXHA 3MICA 1PMIA 4QGLA 1CZSA 2XJSA 1R083 4OI2A 5F2WA 4UXAA 5F3GA 4URAA 3D8CA 1H6YA 1UMZA 5DDJ3 1VBD2 1VBB1 3DPRA 4CCEA 3HT2A 3WG4A 3BKZA 1SBEA 3FBMA 5I0TA 2WNUA 4CCCA 4DEQA 3VLBB 3BTXA 1TNRA 3KV9A 4QB6A 2A3YA 5FY7A 1ND2C 1OF3A 2PLV3 2Y60A 1OC1A 1DQ1A 1KXGA 3U78A 4OHYA 3HN3A 4NVPA 1ZBE1 4HN1A 1ZVFA 2WAAA 4LIUA 2BERA 4A3XA 2VMHA 1JYWA 4GMP3 1SHWB 4S2HA 4YVSB 3RYKA 1W2AX 3AZZA 5FBZA 3RZGA 2XJVA 2R071 3I97A 5BNPB 4IV1B 4ZU4A 1UU4A 2VOWA 2RJKA 4TSVA 1ZNPA 3VZJA 5CA6A 3SC7X 1WGPA 4ZS3A 3J9SA 4NHMA 1X82A 4FTBA 4AQSA 2P3IA 2BRTA 5DUXA 1SCSA 3T3YA 1R1A2 2CGNA 5JXIA 4HL0A 1H4GA 2Y6KA 2BTVC 2SBAA 1GWMA 4XAEA 3GNEA 3M2MA 3QH6A 2WJSA 1PHMA 1RUI3 3KB5A 4P9JA 4BA6A 2JD4A 3HMYA 3MEPA 5FXVA 3VD9A 5FYZA 5FIXA 4E4ZA 2AH2A 3T2PA 2VZVA 2H6CA 4JV4A 1NCRB 4L97A 4MHRA 1RINA 2Y0OA 3MUZ1 2CAUA 1YHFA 3PNAA 1U5XA 4Z07A 3WF1A 2C1FA 4HSJA 2D6MA 1C8NA 1I6XA 3K3OA 2YXSA 2D3RA 2ORXA 1Q8PA 3AMQA 5FYCA 3RZKA 1C4RA 2WFPA 1R081 2R30A 4YSFA 2FDJA 2ARAA 1UNBA 3ZOIA 2HJIA 2XL9A 3SCGA 1CPNA 4H3WA 5DDJ1 4D8MA 1BK0A 1G9DA 4XUOA 3MFCA 2O0OA 3C2UA 2QJVA 4XEZA 5FUIA 3ZYRA 4R4XA 5B4NA 1UIJA 4XHBA 1OD5A 4M0HA 3V0BB 3KVAA 2XHKA 3LB9A 2PLV1 3ZYJB 4E8DA 1EUTA 2GN3A 1U5ZA 5LB6A 2AEYA 2WA3A 4V1PA 4AG4A 3O5SA 3ZO0B 4E4DX 1Q8SA 2OT7A 3NW4A 4X6QB 5CISA 5JPNB 3DXTA 4GMP1 5F3IA 2MEV2 4XF0A 1TMF2 1D0HA 5JOWA 3NJXA 1H8VA 1YC61 4IE7A 3NNFA 3O0WA 2R16A 1MVEA 4FFGA 1RB8G 4C1WA 2GN7A 2A6WA 2LM3A 2W92A 1QDCA 4QGNA 1RJ8A 1YI7A 2G9GA 2Q5TA 3PDQA 5JXJA 2VOTA 3CQOA 4M3CB 1H4HA 2ID4A 3PURA 4FFIA 2PHFA 5FPVA 5LY2A 3WDVA 4DINB 3OGJA 4XCAA 1RUI1 1UYYA 3NNMA 4WVVA 4BIFA 1W2NA 2WQ8A 3POGA 3MI8A 3OEBA 3T0AA 3LF7A 3P5BA 4XAAA 2DVGA 2RDSA 3ZFEA 2GMEA 2ZGQA 4IEZA 1CD3G 4L92A 4Y5TA 3PUSA 4JTNA 4L0PA 3KVBA 2RDQA 3G7DA 1EAH3 5CFDA 3CJIC 2WNVB 1W6PA 4MGYE 1BBT3 1CAUA 1SPPB 3J7HA 4FQ4A 1UY4A 5IVBA 1TQ5A 1W3VA 2JWPA 1S55A 3IMNA 4NWWA 4GH4A 4QKNA 5J7MA 4U2AA 3VZOA 1C3HA 2NYYA 5HV0A 3EJKA 4IETA 4FP3A 1W8OA 4FI9A 4XYXA 3ZN4A 5BNPC 2CNAA 1VBE2 4IV1C 1GFF2 4NHXA 2JIGA 1AR62 1GKBA 4XBLA 3N3HA 4AHWA 3S0MA 2BP6A 4CP9B 5BY5A 4LBQB 4D3WA 1DQ4A 3M4FA 3PVNA 3EO6A 1RUC2 3A21A 3ACIA 4OQ9A 3IAQA 4CCOA 3MYXA 4ASKA 2IXKA 4QB2A 1C8M3 3SH4A 5JSOA 1VALA 4O61A 1W05A 3GBGA 5H9SA 5IFPA 3ZSLA 3UT0A 2ZGUA 2JDZA 3OSDA 4KU8A 3O0VA 3PUIA 2VW2A 4NROA 2P17A 4DXZA 2E6VA 1NCRC 1NQDA 1S0JA 2E9QA 4FFFA 1GWKA 3NO8A 5A3OA 2VL4A 1DZTA 2IFRA 1OFSA 3HR9A 4A6SA 1W6NB 1KDKA 4QU1A 3VD3A 3WP4A 4D6SA 3NVCA 5FZLA 5LW9A 4AHYA 5KBFA 2ZGLA 1AL0G 3IZOA 2QDNA 2RDRA 2VNVA 3BUCA 3DKQA 1WW7A 5A7WB 4WM7C 3ZIXA 2FQPA 2K0GA 5GLTA 4UFMA 2ET7A 1PGL2 4IEOA 4M3CE 1EAH1 1WUVA 2BYVE 3VL9A 1ULCA 5FYBA 1BBT1 1YQ5A 4D7TA 1H1MA 2VVFA 1COV3 1V0AA 2HWC3 1OA2A 3KHBA 2GALA 4YYOA 3W20A 2W1QA 4K20A 3AMPA 1UPIA 3BOPA 1O59A 2JDUA 1BZWA 2BFUS 3GCWA 2PA7A 4RSUA 5IVJA 1BQPA 4AAPA 2YPJA 3LA3A 3ACHA 1EYBA 3PTYA 5KHGA 2IXJA 2DVDA 5KC6A 2HWB3 3CZUA 2E7QA 2VZQA 4AEKA 1L7LA 1DBNA 1H8TB 3SHRA 3AM2A 2V09A 5CFCA 5EHDA 4P9WA 4TN7A 3CMGA 3W59A 1UAIA 1C8M1 4GWMA 4JC1A 3N4MA 2OPKA 3MHZA 4N7UA 4BOWA 5A1FA 3RZLA 1W8HA 1C1LA 3AYCA 1LOAA 4AQTA 3M8LA 1FNYA 1FX5A 3K51A 1O6UA 3RJRA 4FO9A 5GZFA 1QJX3 2HBUA 4FT8A 3L9JT 1AYM2 4JX0A 1DLCA 1QXPA 2C9AA 2DVBA 2IXLA 2VXJA 5FZ7A 3O1VA 1CAVA 1ENXA 3LQCA 2EF6A 3LE0A 1GNYA 3GZTB 2XLAA 5GKAC 2B5HA 3H50A 2FDFA 1UY3A 4YGCA 1J3QA 3Q8AA 5BNNC 2WZPP 2E51A 1MZ6A 3CNAA 4HZFA 1MEC2 4OMCA 1REEA 5JI9A 4META 4UW4A 1TZOA 3OGGA 3FUQA 4RR3C 2V5DA 3DKWA 5HCFA 1QXRA 4N9HA 3U0ZA 2NLRA 2EAAA 4DQAA 1CQ9A 1WD3A 1IOAA 3FHQA 3LWCA 2P2KA 3KZ4C 1ENSA 2VZUA 1LOCA 1COV1 5D8AB 1C28A 2HWC1 1ENRA 5C3RA 5GLUA 3UJOA 2LW8A 4Y5SA 3EXUA 5JCTA 4GQ7A 2JX9A 3AMNA 4XJUA 3KMHA 4XVHA 1D4VB 3DL3A 4OZXA 5IVEA 5JMOA 1HXS3 3FX3A 3I2DA 1UIKA 1LOEA 2VZRA 1QWRA 2Y33A 4PIYA 5C3SA 5FYTA 1REFA 4E2QA 3ZXFA 2XBO3 3N9QA 5LATA 2HWB1 2CGOA 3FMGA 1ULEA 4JGYC 3CKHA 4B29A 2CAVA 2RR12 3VKLA 1ACCA 4FQZA 4FXGB 1YUDA 4MADA 3ZFGA 2PYTA 4NIHA 2GAUA 2D5FA 4N43A 2WNEA 4I0AA 4NOTA 4NR1A 1QIQA 2A75A 4N90A 3RYPA 4MVTA 1UYZA 2HYXA 1NA1C 4DIQA 1QNWA 2AREA 1QJX1 3VD4A 5A7SA 3AKQA 4BQ4A 2LALA 1CAWB 2A6ZA 5IATA 3VDBA 4DS0A 4AVBA 3Q8BA 4NIGA 4BE3A 2BU9A 3NRUA 2HLEA 4KBZA 5CYYA 4GKYA 2VULA 5BXXA 2YGLA 1NAEA 4AEJA 4I2OA 3VKOA 3T1LA 2JDNA 1OUSA 2QZ2A 1JI6A 1EV12 1V9U3 3K48A 5FZMA 2G9ZA 4RR3A 5FYSA 4NPRA 1F9KA 1KEXA 3ORJA 4LPLA 2VY0A 2BGOA 3KF3A 2VCMA 3ZN6B 3FHAA 3JBG2 2XWJB 3NV2A 3WQ0A 5AFBA 1CONA 2BGCA 5L7OB 2OX0A 5IAXA 1H8TC 5KC5A 1AR83 3PJQA 2XUMA 4QX5A 1W28A 2LRPA 2IZWA 2XVLA 1M06G 4I02A 2RS33 3BTYA 4QXKA 1FATA 2ZJCA 2OZJA 2B7YA 4XTMA 4YVWA 3A4UA 3NNGA 4XJ9A 1B35A 1MACA 3RWKX 3IIIA 2I2SA 4AQ6A 1MQTC 4QM8A 5A32B 1HXS1 3WCSA 4E27A 4LBKA 3GHMA 2Q1ZB 1WCUA 2XVGA 2QFEA 3IIAA 2KM2A 4IGPA 2JG9A 2XBO1 2ZGRA 1ND3B 5A3TA 2L9LA 3MO4A 3QCWA 4QX3A 3M3QA 5FXXA 2HYKA 4ZONA 4X6RB 4QPIC 4BH9A 4Z2WA 4RHV2 4COZA 3F2ZA 4FP2A 3ROUA 4CXXA 3P3PA 1NG0A 3NAPB 3NSTA 4UWDA 4QKFA 1DQ5A 5JIAA 3V64A 3VBHA 4W4ZA 3R6SA 4LOTA 2W1SA 3B69A 2YG0A 4LA2A 1UF2C 2VQTA 1D7PM 2Q1FA 1RUJ2 1RHI3 1QQP2 1XYPA 1YYNA 2VZOA 3FBYA 3TRSB 3WEZA 1OOPA 1QJU3 1NA1A 4IEXA 4LHNA 4Q29A 4CDQC 4EN8B 3NV3A 3OBAA 3I2GA 2ZHKA 3O1RA 2VUDA 2RS12 1O5LA 1RUD3 5D8AC 4BCUA 3PVBB 2ZKNA 1SLLA 2VMGA 1UWWA 3IPVA 4XUTA 5I93A 1LRHA 1IG0A 1W8FA 2WT2A 1LHOA 1V9U1 1XSQA 3ACFA 5K0UC 1NCQB 2VTXJ 2ZEYA 2XPJA 3N9LA 4NRMA 4P5YA 2VQUA 3NKGA 4JVAA 2D7FA 1T6GC 2WQ4A 3VDAA 1QJY2 1ZM1A 1SZBA 3PTRB 4Y22B 4L11A 1N3OA 1CAXA 1WLTA 4QQHA 1AR81 4CDUA 1X8EA 4UFHA 5CB7A 2VM9A 5FZDA 1OPMA 4UOJA 3VV1A 1VIWB 1WCQA 2RS31 4Q5OA 4Y20A 1SACA 1S0DA 2YDEA 2HEYF 2XL7A 4IEQA 4HLTA 3WP6A 4XQWA 4XFFA 2EA7A 4HN0A 3TWIA 3O1SA 1W6QB 3GHNA 4Q4W3 5CZKA 3H42B 1RUE3 3ASIA 1WA6X 3MIFA 4QPGA 4YLZA 1VMFA 3DECA 2VVEA 1IG3A 4AVSA 3BU7A 4A44A 3O7OA 2DU0A 3RGBA 4Z8BA 4LO7A 2DCTA 2VTFA 5IUQA 2EXIA 3KT7A 1AYN2 2XKPA 3POIA 4GWJA 5FP8A 2B4KA 3VBRC 2OUJA 4PJYA 3DGTA 4QD2A 2QTWB 3O12A 2I45A 3ZYIB 1GQHA 4KG0A 5JZGC 5CG8A 3SXWA 5ABJB 3L2HA 4G9SB 1RHI1 4KI5M 4DEVA 2DU1A 1CGPA 3HQRA 1QJU1 2JJ6A 5EPAA 2XWBB 4XJ8A 4CUCA 5AVPA 1ONAA 5L7OC 2R0HA 4K9SA 4TXWA 1RUD1 5L9VA 4MGQA 2R042 3FLTA 5C9AB 2VZ1A 1IQAA 1C5IA 3WNOA 2WO1A 4LIVA 1VRBA 3ZN5A 4A42A 4OHZA 3M3EA 4BWOA 2ZX0A 3LKJA 3WP5A 1FOD2 3E1F1 2EVXA 4RS5C 1L7QA 3ZXJA 3DCQA 4GKXA 1LAJA 1ZRFA 5KXEA 3VBSB 2DYCA 2P37A 2CHHA 3LEIA 3RFRA 1ND3C 3PMSA 4CDWB 2WZR3 2JKXA 3FJSA 2BQPA 1YQCA 4FXKB 3VHRA 2VQAA 5BNOA 1OA4A 3K4ZA 3M7AA 3LOIA 3D0SA 1WMDA 2PQQA 3KT1A 3MW2A 2FCVA 1X9PA 4CA9A 3I3EA 3VL8A 2JB8A 5KR7A 2UU8A 1G9FA 1HDKA 2WT0A 3AP5A 2N7GA 3HNYM 2YV8A 4Q4W1 4GIQA 1RUE1 2KA3A 2RM23 2XHNA 4MXWA 5HI0A 3MUY1 2XMLA 1BK1A 1M4WA 1QJEA 1AL22 1TME2 4GZ9A 4V2WA 3POEA 4DY5A 4ASMB 1ZBA2 4LKSA 4A7YA 5F9TA 4DFSA 5FTTC 4Q4X3 2CV6A 2RS52 4FPGA 4LA3A 2ZABA 4LBQD 4IL7A 1GWLA 1ZZ7A 4QPYA 1QXJA 5C4WC 1NCQC 1N47A 3JXSA 1WMEA 4JKMA 4IEYA 4LITA 1VRH2 5A6QA 1AXZA 4TTGA 1N1TA 1OFNA 1X7NA 4M0NA 4Q4Y3 4B4QA 1UW8A 1PO22 3ME2A 2RJLA 3OYWB 3TEWA 4NN0A 3CBNA 2ZZJA 3W9AA 1IS6A 2UWBA 5EV7A 4EN7B 4GXLA 3RZJA 1UU6A 2YGMA 1HRV3 1F31A 2XDVA 4F7ZA 5I8TA 1DZQA 4XFCA 2JENA 3NV1A 5DZEA 1UZVA 2DCYA 4A2UA 4JTOA 3KCYA 1WLWA 2Y34A 2HWF3 1HRI2 1CWPA 1PX3A 2WFF2 5DAVA 2XH6A 3CF6E 3OBTA 4K40A 4D6RA 3CZJA 4BQYA 5BNQA 2WZR1 4CCDA 3PLQA 2HEVF 1RUF2 5FLIA 1QNYA 1AF9A 5FBJA 1UCXA 4LO8A 3E6CC 1N3QA 1PIV2 2RMU3 3T4HB 4ORFA 2DCJA 4AR2A 5F3EA 1GQPA 1PGW1 1XXNA 2QQMA 2ZZQA 3IDAA 1RJ7A 1OVSA 5FKBA 1PX4A 1JHJA 2QVSB 4KG8A 4ZXEA 3WP3A 3WW1A 2BFUL 2WWJA 4Q0UA 4R9CA 4XFHA 1VMJA 4FOQA 1ULGA 1K3IA 4WM8C 5A33A 3WLUA 2JDAA 4XZPA 4LHKA 1RVF2 2RM21 1W2TA 3EQEA 2HWD2 5A7PA 4O7XA 3MIBA 3MW3A 4CDXA 1FV3A 1HB4A 3I4IA 5FLJA 1ZA7A 1L7RA 3NNLA 1LOFC 2FBEA 2QDRA 2A6YA 5G04L 3IBMA 3ALQA 1Z0HA 2Q1MA 4Q4X1 3K2OA 4HMZA 1VBB2 4XXAA 5FZ9A 4AYUA 5J1XA 2GZWA 1MS3A 1UOJA 1HLCA 2WRAA 3SKJE 4OHWA 4FPYA 5F6KA 1GZWB 4JGZC 3VB9A 2PAMA 5AFEA 3VGIA 2EIDA 3OGVA 1SFPA 4Q4Y1 4IGOA 4PLNA 3OGRA 2JG8B 2J1VA 4P9YA 1W90A 4I3GA 1YFWA 1R64A 3JQXA 1ZBE2 4IE0A 5F5CA 1HRV1 4XABA 3OY8A 2OW4A 3WF3A 4D69A 3MIGA 1G7YA 3BN6A 5C71A 2ZHLA 2R072 3K3NA 2ADEA 3D4KA 3LEKA 4YPJA 2HWF1 2V72A 3ZM8A 1ZZCA 1L3JA 5A6YA 3GZAA 4E9KA 3FWEA 4B3NA 4ITCA 1H1IA 1OPOA 2GU9A 2DUQA 3VBOC 1F35A 2OXBA 4IV3C 2WLPA 3ZDSA 3O1UA 1DCSA 1LGBA 4DB5A 2JE8A 2PHUA 1DQ6A 5ANQA 2DUPA 2RMU1 3ENRA 4LK6A 1Q43A 1XNCA 3LDBA 4HVRA 1H2LA 4RD7A 1J3PA 3F95A 1KGYA 3HIFA 3T2TA 5HPOA 5F8PA 1WCSA 4ISQA 3FFZA 4ASLA 1ZRCA 3KM5A 3MPBA 1CPMA 5I8SA 3AVRA 4X8PA 1WLDA 1NX9A 4XETA 4N7IA 5IVVA 4YM0A 3O0XA 2J1TA 3MLKA 3RMYA 3OGSA 3RVHA 1QEXA 5A6XA 1PK6A 1OKQA 1R082 1W6PB 2VNRA 2WC2A 1CAUB 3BALA 3OEAA 3S57A 2WA4A 1HB3A 3GF6A 2QQOA 3B00A 2OVUA 5DDJ2 2ERFA 4URTA 3RZZA 2TNFA 4RQPC 1OKOA 4XMIA 5LCWL 5D1IA 3NL1A 4Y5Z0 5LBEA 2K46A 5HBAA 4XUPA 2JE7A 1BVP1 4B1MA 2PMWB 1S0BA 4AGGA 4C90A 3LZZA 5BYNA 3MIEA 4PIZA 4Y1ZA 1K5MA 2PHTA 5HCBA 2PLV2 3UKVA 2VZSA 4CEWA 4IESA 1SQ4A 1GP6A 4PDWC 3QH7A 1FXZA 4CEYB 2VBDA 2VW1A 4HSLA 4BISA 1EP0A 1UD1A 3BPSA 4PF5A 4UFLA 5J09A 1K45A 2R1DA 4GB32 4L8QA 3U75A 4CE8A 2QKDA 1YQ2A 2DURA 5IVFA 3FL7A 1I5ZA 3B01A 1C1FA 1H0BA 2C5DA 5KXCA 5F1RA 3T08A 5DZGA 3WNXA 3ON7A 1XYOA 1W03A 4DXTA 4DY3A 5FZ3A 4MG2A 2WS93 2ZAAA 1NLRA 2IFWA 2XVKA 5C8CB 3O1TA 1KRIA 4EE2A 1OI6A 3POBA 2DBIA 2WT1A 4Z2AA 1FNZA 2O8QA 4LXLA 4NO4A 2RJ2A 1G9CA 5L19A 5K4LA 4TYSA 4GJYA 5F6LB 1NXD1 2R49A 1UX7A 5DABA 4FCAA 2WO7A 1AX2A 4DRRA 5DMYA 5JIUA 3C8XA 2IC1A 1IZ3A 5C70A 2YU2A 1ODNA 3ZX7A 4B8EA 4ZHNA 1DYPA 4N53A 3GM8A 5FY9A 4SLIA 5FCCA 5ACA3 1Y9MA 4HONA 2JG8C 1HIXA 2O8OA 5FMBA 1JUHA 5FZAA 3WHTA 3BU0A 4UW5A 3AYEA 4IW3A 4NRPA 2NN8A 5A6ZA 2VUJA 4XFBA 2Y26A 2JKBA 4LUMA 2AR6A 1RMU2 4CCKA 5I0DA 2G1MA 3PJYA 3RWNA 4AEDA 3I49A 4M3CF 4UW6A 4UYBA 4QAWA 2B9VA 4YM3A 3S5AA 2QQPA 1O8PA 3ZPOA 4G3YC 3B3QE 1FV2A 5T55A 1TNFA 2PHXA 3DF0A 3W5MA 5J48A 4YZ5A 4XF1A 1IPJA 5C3PA 5FMCA 1DGRA 2JDHA 1GUIA 5CFCB 5FDBA 2EICA 1HN0A 4RA0A 3PVEA 1X33A 1XC6A 3H8RA 2VCAA 4W50A 3D6EA 5T5PA 2G4IA 1ND2A 4ZPIA 2WS91 5F7UA 4NE9A 3GCXA 1SLBA 4ARXA 5JUVA 5LK5A 3SQOA 3OJBA 4ES8A 2X5IC 1AHSA 4UBHA 2ZMNA 3POWA 3WG1A 1AR73 4JRLA 3WCRA 1CAVB 3OBZA 4CCLA 4Q8KA 1ZREA 2AZ5A 3NMBA 2XJPA 1D4M3 1YWKA 3ZFFC 2ZHMA 4C91A 2BWCA 4D0QA 5H9PA 3BYWA 5A1AA 5E8AA 1PVC3 1QU0A 4CXWA 4QWNA 1EAH2 1UOBA 1Q8OA 3LEGA 4MH0E 4QM9A 4RFRB 3B7MA 3PVOA 1BBT2 4OUSA 5FYYA 1PZ9A 5ACA1 4R4ZA 2JDYA 4LEJA 2ILMA 3T0BA 4P9IA 3T4VA 4CEYC 4PIXA 4CU9A 1JN2P 4XDQA 3H1WA 4RN5A 5EJ1B 5FYUA 1JYVA 3O1MA 1C5HA 3OPWA 3R0RA 5D2AA 3MF9A 3SMHA 4NAMA 3MV01 3U07A 1KQRA 1V6KA 1OT5A 4C0HA 5C8CC 2V4VA 1XBFA 5T5OA 1PZ8A 5LBBA 3UESA 4BYYA 1UZ0A 5I8YA 1VB4A 1UX6A 3TN93 1NQJA 2A3WA 4Z92B 2W95A 1GP4A 1C8M2 4YVSC 2VOVA 4I0WB 5I0SA 2IXHA 1ASJ3 1OVPA 1R093 1O5UA 2QUOA 4NIIA 1PGSA 2ZACA 4FAHA 5DUWA 1GQGA 1LKNA 3WDYA 1B09A 4L99A 2YFZA 5HXVA 2OYZA 1ULOA 2Z42A 2Z69A 4WVZA 4AW7A 4N43B 4GMP0 5GLZA 1HQWA 5C5UA 2ZMKA 5FZBA 4LE4A 4MUVA 1DHKB 4QQ2A 1GANA 1W8TA 1UMIA 4ZKTB 5F3CA 4KWUA 3E6BA 3KQRA 4H7LA 1TE1B 5FAXA 1AR71 2G9FA 2C4XA 2GH2A 4YZ1A 1RTVA 4OZOA 2YMZA 3ITQA 4L2NA 4EWDA 3OTFA 1LESA 2DDUA 1D4M1 2VO5A 2VC9A 1GMMA 2R063 4OI4A 2OZ6A 3U10A 1PVC1 2PHLA 2Q8OA 5DAQA 5IFTA 2RG4A 1VBA3 1Z7S3 4COUA 5I91A 2MPFA 2ORZA 1XE0A 3CHXA 4YW1A 2VUCA 4YG0A 1COV2 2HWC2 3WSOA 4Y33A 4ISRA 5EXOA 1F8VA 1GZ9A 2QE3A 1UY2A 4YW2A 1ALYA 3KV6A 1GZCA 1VR3A 4EWEA 4XJZA 1NXMA 4CRQA 4XE9A 1CX1A 1XQNA 5BPXA 3V65A 3B9IA 4XXPA 5FV3A 2FZ1A 1RXFA 3GZEA 4O9GA 4YM2A 3CJIA 4A4AA 3UK9A 3WT3A 3KV5A 1JZ5A 2HWB2 2BWAA 1F5FA 1FMD3 4AI2A 4AAXA 2WAOA 5GM0A 3KF5A 3TN91 3U4SA 2UURA 1US2A 1S1AA 4HPKA 1H2KA 4QKBA 4AI1A 5BNPA 5LY1A 5J3UA 1ASJ1 1IS5A 1R091 2R7EB 4IV1A 3WD5A 3VBHB 3LA7A 5L9RA 3FHIB 5FZKA 3RNSA 1NE6A 1W8WA 2H0BA 1QGLA 1E5SA 2KD7A 5AVAA 3RPQA 1OH3A 3S6PA 1HV0A 3KLSA 1X8MA 2CDPA 2ARCA 1QJX2 1QJZA 1ZX5A 1ENQA 5CVRA 1OOPB 4BM8A 5LEKA 1PMHX 3N7MA 4NAOA 3USUA 1DGLA 1NKGA 1W06A 5T52A 1DU3D 4XDPA 2ET1A 2WDBA 3VZLA 2XR4A 2ZKLA 2ARBA 2VJXA 3CEWA 1YJLA 5FZ0A 4IUGA 1WMFA 5CG9A 2AC1A 4CUAA 2ZHNA 1DF0A 1NCRA 4LLOA 1CZTA 3LA2A 3WDTA 2A71A 1Q5OA 1ZA4A 2R061 2NPIA 1JZ4A 4QXCA 2EIGA 4JHTA 1ZZ8A 5FO8B 2WNVC 5JDBA 1GOHA 1VBA1 1JYNA 1Z7S1 4LMFA 1G6NA 5FPLA 4AZZA 3BB6A 2EAKA 2WWUA 4UFKA 5T3NA 4P08A 1XPWA 1ZRDA 1CAXB 4XOGA 1IGOA 3WR0A 3KV4A 4H14A 5JOYA 4WM7A 4Y20B 4JKLA 5L36A 2JXAA 4FSJA 5DUUA 4F8AA 1HXS2 4CU7A 2DV9A 1T2XA 3WXPA 3SH5A 4QHBA 2XBO2 1W6MB 4Q0VA 4A41A 3C7HA 1IPKA 1EY2A 1FMD1 1YJKA 3JD73 3N9PA 1W9SA 1WZXA 4E4SA 4HVOA 1UY0A 5LBCA 1LODA 4MOAA 5EIYB 1AUYA 1KFUL 4CU6A 3AFKA 2PAEA 3JB8A 1O3RA 5EZWA 1P8JA 4PLOA 3VDCA 2A73B 2B46X 1CVNA 3E5UA 3I54A 1LGCA 4LKFA 1IQDC 2J7MA 1E57A 5CEHA 3HEIA 1H2MA 3OCPA 4M3CA 3H1YA 2FMYA 4BK4A 3AKRA 3HJRA 5A1LA 1FYUA 3KHCA 5LRRA 1S2EA 1Y43B 2Q4SA 2ADDA 5T5LA 3H3UA 4XBQA 1KITA 5C7GA 1LB2A 4Y3OA 4Q4V2 2XLGA 4Z82A 1ODMA 3AC0A 3MLLA 2ZGOA 1W99A 2WNOA 4AF9A 3MV11 3ZXLA 1D2SA 3MFAA 1JUIA 3I3BA 4HKWA 3MDPA 4S2FA 4PQQA 3KSCA 1WCKA 3LDKA 1AR82 3MF6A 1S0EA 4A6OA 3PUQA 5ANNA 2ES3A 1GOGA 3ZSMA 5FP3A 2RS32 1JBCA 5BNNA 2WIIB 5BNOB 3WW3A 3GBFA 5IHRA 1GU3A 5CAZA 3IB3A 1W04A 3N36A 5KHJA 4OQ8A 4NPLA 3VN4A 5E1RA 1Y7BA 4LBQA 4UBGA 2R0FA 4COWA 3M70A 3ZR6A 5A80A 1I1EA 2X29A 3WDXA 2FDGA 4HOOA 2X09A 3ACLA 2VMEA 1SDWA 3I3MA 4LTAA 4QT6A 2CL2A 3MZHA 4S2GA 3JD71 2VVDA 1JZ8A 4DUWA 4P9LA 3IKWA 1WMXA 5BV6A 4AVCA 3H8UA 4LHSA 3ETQA 5F32A 1VAKA 3IDEA 3HOBA 2OIIA 4LLFA 3WNLA 5JSPA 2ZGNA 3POFA 4YG6A 4XIKA 2BJSA 3UGFA 2W91A 4GJZA 4RGKA 1RHI2 5FJKA 1O4YA 2DWRA 1BHGA 3V56A 1QJU2 1SMVA 2BW8A 4QX2A 3WQBA 3VBFB 1UOGA 4E4HA 1V6JA 4IQPA 3S7EA 2R32A 3AL6A 4JGYA 4EN9B 1F5JA 1RUD2 1XNDA 2GMMA 3D3AA 1QOSA 2CWSA 4GWIA 4IDZA 3VHNA 2D5HA 1F2NA 4FFHA 1Y9QA 4E2GA 1BMV1 1VAMA 1H6XA 5FZEA 4ES9A 2BUKA 4NIDA 2VGDA 4FPLA 3W21A 2VCCA 3ZSKA 5LASA 5GLWA 1S0CA 4WZCA 3O14A 4KU7A 3WX5A 3ZXAC 2WWSA 5EJZB 1PO13 1C57A 4ZU5A 1VBC2 3SLIA 4BMBA 2GP5A 3AKSA 3AVSA 3VD5A 5FWJA 1ULPA 2ZXQA 2ZX4A 1N1SA 5FWEA 5JR7B 4B4RA 2Y38A 2W47A 1AZDA 3EMRA 3WVJA 4R52A 3LPFA 1RUE2 2W39A 2VR4A 4GALA 1GNZA 2IWGB 5FK7A 1A8DA 1UYPA 4AFAA 5A33B 3AP4A 1H8TA 5IAVA 1DLLA 3M3IA 3WDWA 1XU1A 4CDXB 3V0AB 4RHV3 3VZNA 1POQA 1OUXA 2VZPA 3WQ7A 1MS1A 3FLPA 2D6LX 3LGRA 3N9OA 4UFIA 1MPXA 4S2DA 5F39A 1U5IA 1MQTA 2VD7A 2YC2A 5FP4A 3EHKA 4LT5A 3OD0A 4EROA 1AJKA 1YXWA 3C7GA 1F4HA 1RC6A 2GP3A 1S2BA 2C9KA 2YY1A 3GZUC 5IVCA 2O1QA 3VHPA 1UZYA 5JPMB
chains in the Genus database with same CATH topology
3I49A 4IE0A 3S5AA 4IE4A 3BTYA 4IE5A 4IE6A 4IE7A 4NRQA 3RZLA 4NPMA 3H8RA 4NPLA 3O1UA 2IUWA 4CXXA 4QKFA 3H8XA 4QKBA 2FDGA 3I3MA 5F8PA 3O1VA 3RZHA 3BIEA 2FDFA 3BKZA 3O1RA 2FDIA 3S57A 3O1SA 4QKNA 3BTXA 4CXWA 3O1PA 4RFRB 3RZJA 4IDZA 3T4VA 4NRMA 4OCTA 4JHTA 3BTZA 4NJ4A 3RZGA 3O1MA 4NIDA 4ZS3A 3O1OA 4O61A 3T3YA 4NROA 3T4HB 4MG2A 2FDHA 4NIIA 3RZMA 4CXYA 3O1TA 4NIHA 3I2OA 5DABA 4O7XA 3BUCA 3RZKA 4NIGA 4ZHNA 2FDJA 4ZS2A 4QHOA 3I3QA 4QKDA 3H8OA 2FD8A 3LFMA 3BU0A 4NRPA 4MGTA 3KHCA 3KHBA 3BI3A 2FDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I49 A;  4IE0 A;  3S5A A;  4IE4 A;  3BTY A;  4IE5 A;  4IE6 A;  4IE7 A;  4NRQ A;  3RZL A;  4NPM A;  3H8R A;  4NPL A;  3O1U A;  2IUW A;  4CXX A;  4QKF A;  3H8X A;  4QKB A;  2FDG A;  3I3M A;  5F8P A;  3O1V A;  3RZH A;  3BIE A;  2FDF A;  3BKZ A;  3O1R A;  2FDI A;  3S57 A;  3O1S A;  4QKN A;  3BTX A;  4CXW A;  3O1P A;  4RFR B;  3RZJ A;  4IDZ A;  3T4V A;  4NRM A;  4OCT A;  4JHT A;  3BTZ A;  4NJ4 A;  3RZG A;  3O1M A;  4NID A;  4ZS3 A;  3O1O A;  4O61 A;  3T3Y A;  4NRO A;  3T4H B;  4MG2 A;  2FDH A;  4NII A;  3RZM A;  4CXY A;  3O1T A;  4NIH A;  3I2O A;  5DAB A;  4O7X A;  3BUC A;  3RZK A;  4NIG A;  4ZHN A;  2FDJ A;  4ZS2 A;  4QHO A;  3I3Q A;  4QKD A;  3H8O A;  2FD8 A;  3LFM A;  3BU0 A;  4NRP A;  4MGT A;  3KHC A;  3KHB A;  3BI3 A;  2FDK A; 
#chains in the Genus database with same CATH topology
 2YFU A;  4PI0 A;  4R9B A;  4QPI A;  4CP0 A;  1DYO A;  2B45 X;  2GDF A;  2Y8K A;  3HN1 A;  4XIL A;  1JOP A;  5FY8 A;  2E26 A;  4BK5 A;  2R1B A;  4Q27 A;  5I0R A;  4BB3 A;  4BU2 A;  4JRA A;  1U5Y A;  3ILF A;  3SCF A;  3OY8 B;  2W52 A;  2GC1 A;  2E32 A;  2XUE A;  2Y6J A;  1AR9 3;  2YRO A;  2RE9 A;  2VBB A;  3GJA A;  4CDQ A;  2PAK A;  5FZI A;  1CIW A;  4DUV A;  2E33 A;  1UKR A;  2UWA A;  2WZR 2;  1O3T A;  1XNK A;  3BIW E;  4QQO A;  5D8A A;  1WW4 A;  3ES1 A;  1OLM E;  2C0Z A;  4YW5 A;  4B4P A;  1PO1 1;  1PGW 2;  4LBO A;  2NMN A;  2V4A A;  2AYH A;  3DYP A;  3SIT A;  3H8X A;  1URX A;  3T2O A;  1DG6 A;  5K0U A;  3VDD B;  4DRV A;  4MGI E;  3WNN A;  3AFG A;  1W0O A;  1CR7 A;  1K42 A;  1ZZ9 A;  3PHM A;  3WQ1 A;  2RM2 2;  2C6S A;  3OB8 A;  1LTE A;  3VBU B;  3VBF C;  3Q8E A;  4XBN A;  5AC9 3;  1UL9 A;  4J25 A;  4QPW A;  4OVE A;  4R9D A;  1DFQ A;  3C7F A;  3NAP C;  3LD8 A;  4RHV 1;  4Q4X 2;  2E31 A;  1PK6 B;  1W9F A;  3BPZ A;  3JUU A;  1W8N A;  4AHX A;  3HBZ A;  2CDO A;  4UF0 A;  1KDM A;  2J1R A;  2KXL A;  1BEV 3;  4P00 B;  3NQH A;  1IPS A;  4ZY9 A;  4EYU A;  3POS A;  4HT1 T;  2VE1 A;  3HQX A;  4GAZ A;  4Q4Y 2;  5J96 B;  2QQW A;  4P9X A;  3J8F 3;  5CKM A;  3TEX A;  3PME A;  3UET A;  1YLL A;  4BJ0 A;  4OHV A;  3WZ1 A;  3VUO A;  2X8K A;  4AE2 A;  5T50 A;  1K5M B;  3VBR A;  4CEW B;  1J58 A;  4ATF A;  2XOM A;  3I59 A;  3IDC B;  3KGZ A;  1E5H A;  2VPV A;  1ST8 A;  1IS3 A;  3ECQ A;  5JZG A;  4TLG A;  5FO9 B;  3LAG A;  2HWF 2;  4DOU A;  1FOD 3;  2VZT A;  3DPR B;  2VNO A;  3T1M A;  1DDL A;  1AR9 1;  3ZN6 A;  2JB4 A;  3APB A;  3I2I A;  3HNM A;  1XB9 A;  2WNU B;  3T09 A;  4CUB A;  2XKO A;  5IT6 A;  5L7O A;  2Y6G A;  1WW5 A;  4IND A;  3ZKU A;  4ZU7 A;  5HCA A;  1A8M A;  3HPN A;  1WBL A;  2D40 A;  3TYJ A;  2P3K A;  5C5T A;  3P3N A;  4LBN A;  4LQR A;  5A32 A;  4E8C A;  3J26 N;  4RS5 A;  5IK4 A;  2AUY A;  1OF4 A;  4IER A;  1KJR A;  4D7S A;  3VKM A;  3R4D B;  2W87 A;  3ATG A;  1UOF A;  5JXG A;  1ND3 A;  1W9W A;  2W5F A;  3T0D A;  1CJP A;  4YW3 A;  5DXD A;  5AC9 1;  4KWJ A;  5EJ3 A;  1QKQ A;  4Q2F A;  1POV 3;  1CX4 A;  2J1S A;  4YGE A;  1G8W A;  2VMF A;  3BI3 A;  5EQU A;  3GDB A;  4AFB A;  1JOJ A;  4DO0 A;  5ABJ C;  1BEV 1;  1RIT A;  3Q8F A;  3TB0 A;  3RDI A;  4AED B;  3N7J A;  4ATE A;  4AEM A;  1OLQ A;  5LZ6 A;  1A34 A;  2X10 A;  2RDN A;  1VRH 3;  1UMH A;  4FBF A;  4IE5 A;  1D2Q A;  3J8F 1;  1T6B X;  3I8T A;  5T5J A;  1IKQ A;  1HX6 A;  4QXB A;  5C3O A;  4RGG A;  3E5Q A;  5C9A C;  1LOG A;  5H9Q A;  4Y4R A;  2BZD A;  1PNF A;  2C26 A;  1XOY A;  1KFX L;  1OSG A;  3E97 A;  2Q0A A;  1GSL A;  2VG9 A;  5D21 A;  3JQW A;  3B02 A;  1N3P A;  5C4W A;  1NCQ A;  3VDD C;  1GNH A;  1OBN A;  4NPM A;  1QY4 A;  3I2J A;  3WIN E;  1WWY A;  4MZU A;  1FOD 1;  1HRI 3;  2W0X A;  3VBS C;  1LED A;  3VBU C;  3ZFG B;  1JOD A;  2EAL A;  3HNB M;  3ILR A;  3AB0 A;  4CDW C;  5FXW A;  2P6C A;  4R9A A;  3RI9 A;  1I3H A;  3BVC A;  4XUN A;  5C33 A;  1UXZ A;  4CCJ A;  1RL3 A;  4NHL A;  4XIO A;  4BQ5 A;  2IXC A;  5BUV A;  2FCT A;  4R8H A;  2Q8D A;  3LIG A;  2P5B A;  1FT9 A;  2VOK A;  1UYX A;  4OYU A;  3LSD A;  1X50 A;  4QGM A;  1NLS A;  4XFI A;  1LEN A;  1YIF A;  3IWZ A;  1J1L A;  2JIJ A;  2VW0 A;  3HBK A;  3QLQ A;  1W9T A;  3LEM A;  4XTP A;  1Y4W A;  4AI8 A;  3ZSJ A;  2CU5 A;  3ZVX A;  3FUO A;  5EWS A;  5B4X A;  1YNA A;  1FPN 3;  2TEP A;  2Y0I A;  2YBK A;  4K21 A;  4BXF A;  1JYI A;  1POV 1;  3QOP A;  2RV9 A;  3R4S A;  3BOW A;  3ZXG A;  3VZM A;  3OUI A;  4KMQ A;  2YUE A;  1EUU A;  4XC9 A;  5JR2 A;  5C3Q A;  4DZG A;  2VU9 A;  1V6N A;  2W08 A;  4WM8 A;  3DPR C;  2W9X A;  4QDR A;  5E16 A;  4FPE A;  1NOV A;  2ZEX A;  4LBM A;  4X8N A;  3ZYG A;  2VCB A;  2WNU C;  3JCI A;  2PFW A;  3OUH A;  3O1O A;  1YQ6 A;  3ZFE B;  1VJ2 A;  1VRH 1;  4CP1 A;  3ZMN A;  1DQ2 A;  2BGP A;  4K1Y A;  1GOF A;  5FPA A;  2PN5 A;  5DAW A;  4XF9 A;  5EYX A;  2HWE 3;  1O91 A;  4XDO A;  4QQL A;  4EZ4 A;  1LOF A;  2ETE A;  1S0G A;  5CFD B;  4HFS A;  5J37 A;  3ETP A;  5KHH A;  2BBV A;  3BTA A;  1JYT A;  1BCX A;  5EP9 A;  2BNM A;  4AVV A;  4GH4 B;  4YM1 A;  4UAP A;  4GA9 A;  4P5H A;  4JGZ A;  2NZ9 A;  3I2F A;  5FZ8 A;  1HRI 1;  2EIB A;  4BZ4 A;  1LHV A;  2WS9 2;  4NHY A;  1UN1 A;  4A3Z A;  1KS5 A;  1RUG 3;  4XMA A;  4CU8 A;  4D7Y A;  1NY7 1;  1OMI A;  3GGL A;  1W6O A;  2WKK A;  5LA2 A;  1J1T A;  1JW6 A;  3ZLI A;  4ZS2 A;  4EN0 A;  4B7K A;  2B42 B;  2XON A;  4JAA A;  2WAB A;  4N9I A;  2W46 A;  1BXH A;  5IWF A;  1UY1 A;  3WNM A;  2ZCW A;  4O9E A;  4IEP A;  4XW3 A;  5FZO A;  1RUO A;  3TAY A;  1DIW A;  1H1A A;  3AMH A;  4KWK A;  2GNB A;  4OUE A;  1GP5 A;  1H30 A;  2JE9 A;  5ACA 2;  3VBO A;  4IV3 A;  3CL1 A;  1FPN 1;  4FTE A;  5FZ1 A;  1JZ6 A;  3H3Z A;  3N7K A;  1RUI 2;  5FRA A;  2J42 A;  4JDN A;  1FAY A;  1QHD A;  2ZEW A;  1HB1 A;  4IE6 A;  4P9G A;  5KWR A;  3RJ2 X;  1SDD B;  1JZ7 A;  1J84 A;  2ZGT A;  3WF4 A;  3GAL A;  4YZ2 A;  2DFC A;  5FMD A;  2F4P A;  2E63 A;  3X29 B;  1RUH 3;  5FZ6 A;  1V70 A;  4XPV A;  3OYW A;  5LK7 B;  4LHL A;  3OF1 A;  3PUA A;  3CJI B;  4LNV A;  2HWE 1;  3DXU A;  3FC0 A;  3J7M A;  4I30 A;  4M4R A;  4TWT A;  4AHZ A;  1RXG A;  4W65 A;  5ISL A;  4RQP A;  1BLZ A;  2Y6F A;  3SNM A;  4LE3 A;  4CZS A;  1JS9 A;  2DCZ A;  2Y64 A;  1VBD 3;  4GB3 3;  4QX7 A;  4OI1 A;  1Q8V A;  5F2S A;  4HPK B;  4YNI A;  3SIS A;  3RZH A;  4Y1U A;  2D44 A;  3Q8C A;  4WVM A;  4YW7 A;  4ONU A;  2P3J A;  2HEW F;  2V73 A;  4QDQ A;  3UV9 A;  4JDM A;  2XQR A;  4QX8 A;  2WBK A;  5A7Q A;  1MS0 A;  1UZZ A;  2RVA A;  1RUG 1;  3OUJ A;  4PDW A;  1N1Y A;  2GSY A;  2ZBJ A;  4CPB D;  4LKD A;  4AVA A;  3DYM A;  2FDI A;  1LOB A;  1U12 A;  4FVV A;  2B9U A;  2BV4 A;  2CWM A;  2WUH A;  4F3J A;  3GBW A;  2BNO A;  1XNT A;  3U37 A;  3USU B;  5IK7 A;  1AR7 2;  3M3C A;  4DXS A;  3TNP B;  2YZ4 A;  1X36 A;  3O1P A;  2VQ0 A;  4HG6 B;  1D4M 2;  3L2Y A;  1XU2 A;  3KT4 A;  2WO2 A;  5FUP A;  3S7I A;  3WY6 A;  2VTX A;  3AMM A;  1PVC 2;  3PUH A;  3TOJ A;  3WUC A;  1EPZ A;  2FMD A;  1I9R A;  5FP7 A;  2Z5W A;  4UT5 A;  3WG2 A;  3ZFE C;  3W5N A;  4FPH A;  3AZV A;  5JOZ A;  1R1A 3;  1NLQ A;  5CFD C;  3OBR A;  3RSJ A;  4AI0 A;  3RS6 A;  2YB7 A;  1Q3E A;  4MGS A;  1DQ0 A;  5CBL A;  3HD8 B;  1XNA A;  5F37 A;  2D6O X;  4GH4 C;  3NNJ A;  4ZZ8 A;  2FZ2 A;  1RMU 3;  4FPO B;  2VZ3 A;  3WG3 A;  1GZW A;  4XQD A;  4OI0 A;  4WM7 B;  2JD9 A;  4GD4 A;  3Q9O A;  1RUH 1;  2JG8 A;  4XF4 A;  1O7F A;  3M1H A;  2P34 A;  2HH9 A;  3JU9 A;  4CXY A;  1ZZB A;  2Q8E A;  4PQ9 A;  5FXZ A;  3MPP G;  4LUK A;  5A3U A;  2IXI A;  3WDU A;  1AVB A;  2ZAH A;  2E53 A;  3TN9 2;  4A7K A;  3RQ0 A;  4CTE A;  2BDR A;  3BCW A;  3IMM A;  4A7Z A;  4FPK A;  1ASJ 2;  1R09 2;  2D6N A;  1QOT A;  3DYO A;  4M01 A;  5FMO S;  5FPZ A;  1VBD 1;  4GB3 1;  5FYI A;  3U11 A;  5FR3 A;  3AKP A;  4CCM A;  1WKY A;  3SKV A;  1BKZ A;  1OA3 A;  1PMJ X;  3UJQ A;  2DUO A;  4UI9 L;  2LTN A;  1A3K A;  2XJU A;  4QQP A;  4UW3 A;  4FPF A;  1XRU A;  4MGK E;  2F17 A;  2GC2 A;  3N9N A;  3PU8 A;  4AFM A;  3CO2 A;  2VUA A;  5DG2 A;  1CN1 A;  1NUK A;  5A3L A;  2FCU A;  1K5J A;  4JQT A;  3B94 A;  1DGW A;  1MR5 A;  2PTM A;  2AAC A;  4IEW A;  5E88 A;  5DG1 A;  5FY0 A;  3U1X A;  2MEV 3;  5FK8 A;  2GC0 A;  1TMF 3;  2YC0 A;  4AOC A;  1V6I A;  1V6O A;  3H7Y A;  2LUW A;  2R06 2;  2P1B A;  3N7L A;  2FHR A;  5IW0 A;  5FQ0 A;  4BXS V;  3MID A;  3PIG A;  4XHX A;  2DTY A;  1VBA 2;  3ABZ A;  1Z7S 2;  1J83 A;  3ZKY A;  1R1A 1;  2X5I A;  3A0K A;  5JSR A;  1BJQ A;  4KGG A;  2ZX3 A;  4YW4 A;  1OHF A;  4EJR A;  2UY8 A;  3IT8 A;  4MO3 M;  1UU5 A;  2XXZ A;  4AVT A;  4HET A;  1AX0 A;  3KS7 A;  4B7E A;  3H0O A;  4PBO A;  3S5Q A;  1RMU 1;  3ZFF A;  2ZGS A;  4DMI A;  5BNN B;  1O3Q A;  2WYF A;  2W1U A;  4C8D A;  2CYF A;  1LEM A;  3C3V A;  2GND A;  4W6W A;  3TEY A;  2WR9 A;  5IJR A;  4NIA A;  4RR3 B;  2VNG A;  1ZZ6 A;  1O4Z A;  3CJX A;  1RGS A;  5LA1 A;  3ES4 A;  3I7D A;  1V6L A;  3NJY A;  4MGZ E;  2XGX A;  1W2O A;  1TG7 A;  2YPD A;  4CEY A;  1FMD 2;  3H1M A;  4F83 A;  1SBD A;  2TUN A;  2A7A A;  3MW4 A;  4HVQ A;  3SEE A;  4Z1V A;  4IEV A;  5SV8 A;  5HV4 A;  1I5P A;  5F5I A;  4EN6 B;  5FZC A;  4EQV A;  5CFC C;  4AI3 A;  2OA2 A;  1RYY A;  4YAR A;  3VZK A;  2DBN A;  1CJD A;  4LO4 B;  3JZV A;  5A70 A;  1VBE 3;  4YW6 A;  4YVW B;  1AR6 3;  2ZGP A;  3AP7 A;  1B35 B;  2W2I A;  4DUX A;  3FLR A;  2ZPX A;  3ZXK A;  2UWC A;  2WZE A;  4BHP A;  2GC3 A;  5C8C A;  4QB1 A;  1DZR A;  1RUC 3;  2JG9 B;  4HK9 A;  1ZRR A;  4NHK A;  4GWN A;  3ACG A;  4JGY B;  4YVS A;  3H7J A;  3R4U A;  3KCC A;  3THD A;  4DNY A;  2AEN A;  1GR3 A;  3BTZ A;  4AFC A;  2DCK A;  5DUV A;  2MEV 1;  4I0B A;  2JDM A;  1TMF 1;  2E7T A;  5GZE A;  1UXX X;  2IVJ A;  5A3M A;  4LJH A;  5JMC A;  2QQI A;  2GMP A;  2BVB A;  4PF1 A;  3ZYP A;  2BPA 2;  5DN2 A;  2DF7 A;  4YFZ A;  4YRD A;  2W1W A;  4PHZ A;  1NA1 B;  4OMD A;  4W8J A;  5J98 B;  4EWA A;  4DPN A;  1YFU A;  4KQ7 A;  1NZI A;  5CKQ A;  3ZYB A;  2F4L A;  2EXJ A;  1ULF A;  1XJA A;  2A6V A;  4K8F A;  4AQ2 A;  3T2Q A;  2NP0 A;  1TVG A;  1IKP A;  1AJO A;  1QH7 A;  2QQJ A;  4H2A A;  4AXO A;  3SCH A;  4ZZ5 A;  5IK5 A;  4PI2 A;  3IPV B;  4BQX A;  3E6D A;  2OPW A;  5DPN A;  4COV A;  4KWL A;  4CP2 A;  1ULD A;  4XZU G;  1Y9G A;  3AX4 A;  4TLF A;  3N35 A;  2D97 A;  4FTS A;  2OUH A;  5GZC A;  2G19 A;  1K12 A;  1GIC A;  3RI8 A;  3NV4 A;  1NT0 A;  1YI9 A;  4LOS A;  2WN3 A;  3JD7 2;  5EFU A;  5T54 A;  2AGS A;  5ERL A;  2D6P A;  1JH5 A;  4CDU B;  2D93 A;  1JYX A;  2ZML A;  3I3Q A;  3ST7 A;  1SFY A;  3H8O A;  1JHN A;  4I09 A;  5FYV A;  1E5R A;  4AK3 A;  3FFQ A;  5K7P A;  3ZFG C;  2DFB A;  2B39 A;  1VBE 1;  4Q0Q A;  4K3U A;  1AR6 1;  4BQW A;  1MQT B;  2YU1 A;  4Y1X A;  3V0B A;  4N43 C;  4RL7 A;  4NJ4 A;  4Y1Y A;  5CAD A;  2JDK A;  4QPG B;  1MS9 A;  1SLT A;  5CIR A;  4LO5 B;  1RUC 1;  2BVV A;  4NMI A;  5FZH A;  4QPI B;  3J7L A;  5FZ4 A;  2XB6 C;  4PCR A;  3OOX A;  3UGG A;  1NZC A;  1SFN A;  2OS2 A;  4M4P A;  1BMV 2;  5LEJ A;  5KHK A;  5M0T A;  3J7N A;  4XUQ A;  4K7J A;  2Z4F A;  3IDB B;  4KBB A;  3A7Q A;  1W8U A;  3M3O A;  4IXL A;  1IHM A;  5JLV A;  4Q1R A;  2AEZ A;  4MV2 A;  4CDQ B;  2H6B A;  3VKF C;  5G05 L;  1AYM 3;  1XSR A;  2MHF A;  3AKT A;  3GJB A;  5LBF A;  4M00 A;  2PEL A;  1QH6 A;  2WIN B;  1J59 A;  1OLR A;  3AL5 A;  5FPB A;  2PXJ A;  2VMD A;  4J1W A;  4RYD A;  3VHO A;  1V9U 2;  3MLJ A;  3WF0 A;  1MEC 3;  4Q26 A;  1LU1 A;  2QCS B;  2P4E A;  4J6G A;  4YVW C;  5K0U B;  1B35 C;  5FFO C;  1JOB A;  4MLO A;  5LA0 A;  2PQS A;  2WNV A;  3BIE A;  5A3P A;  5K8S A;  1PGL 1;  1SPP A;  4YZ3 A;  3GYD A;  1YRZ A;  5C8W A;  2WN2 A;  2JG9 C;  3K4D A;  3WW4 A;  1WCD J;  3D0J A;  1LU2 A;  1JXN A;  1X9T A;  3MGU A;  3B93 A;  2QQL A;  4K6B A;  5FLH A;  5DQ0 A;  5FO7 B;  5F5Q A;  4YFW A;  3KGL A;  2UYA A;  1EPW A;  1ZYB A;  3A22 A;  3EB7 A;  4RFT 0;  2QBX A;  5FYH A;  3VBH C;  1UO9 A;  3ZIW A;  4CP9 A;  3JB4 C;  4AWD A;  3TEZ A;  1MZ5 A;  1A78 A;  4UF0 B;  4KL1 A;  5FOJ B;  1S2K A;  3HAG A;  4P14 A;  1GYK A;  1SBF A;  2VMI A;  4PLM A;  1YQ8 A;  3WW2 A;  5FY1 A;  1HW5 A;  4CVU A;  1OOP C;  3H3L A;  4MXW B;  3P1I A;  4AI9 A;  3INA A;  4HK8 A;  5DAX A;  2F6B A;  5JXH A;  1U0A A;  1NE4 A;  2RR1 3;  4JKK A;  1SEF A;  2ZS6 B;  1YFY A;  2ZEZ A;  5DZF A;  3VBR B;  4AL9 A;  3BGA A;  4Q4V 3;  3K46 A;  1NYW A;  5CKN A;  3I59 B;  5HXM A;  4D94 A;  3THP A;  2DTW A;  2WL1 A;  4P02 B;  4Q1P A;  5APA A;  5IVY A;  5JZG B;  1WW6 A;  2BOI A;  3P6B A;  1WA4 A;  4HKL A;  1D0G A;  2Y6L A;  1QDO A;  5JWP A;  3RG0 A;  5E89 A;  2LS6 A;  3RZM A;  1W6N A;  1F15 A;  1VPH A;  4KH9 A;  4WV8 A;  1AYM 1;  4QXH A;  2HBT A;  4JCK A;  4JDO A;  2VOX A;  1PO1 2;  3QAC A;  5JI7 A;  4MHU A;  3VD7 A;  4CDU C;  3RRD A;  1W39 A;  3QD6 A;  3CDZ B;  3KD4 A;  4FOW A;  4O65 A;  2VH9 A;  3WV6 A;  5A7W A;  1W3X A;  2Z79 A;  5FOB B;  2XJR A;  5FP9 A;  4XCB A;  2P6H A;  3EBR A;  3UKT A;  1EV1 3;  5IYY A;  1MS5 A;  1MEC 1;  2WSU A;  3A23 A;  4XFA A;  1OH4 A;  4RS5 B;  2D98 A;  4Q0S A;  3FN9 A;  2ZTN A;  2WSV A;  4QKD A;  4QPG C;  3JBG 3;  3THT A;  4HAN A;  5GJ6 A;  4LUL A;  3AJZ A;  5KHI A;  1SCR A;  3ILN A;  2A70 A;  4XF3 A;  2JEM A;  1YFX A;  4WVW A;  2J1A A;  1H9P A;  2TBV A;  3TBD A;  3PU3 A;  4W6Y A;  2Q8C A;  2H0V A;  2FDK A;  1S4C A;  4A45 A;  1QJF A;  4MSV A;  4Q4W 2;  3DN7 A;  1LJ7 A;  1Q56 A;  2VMC A;  4Y1V A;  4EZH A;  1G86 A;  4K1Z A;  1JZ2 A;  4FAG A;  1SLI A;  1G9B A;  1BVV A;  5FZF A;  1OD3 A;  5E6H A;  4XAC A;  1GV9 A;  3WOG A;  5A3W A;  4SBV A;  2GH8 A;  1LHW A;  1KD7 A;  2RR1 1;  1R1Z A;  3LSE A;  5KXD A;  3B9C A;  4Q4V 1;  1Z78 A;  2OQ7 A;  1ZRI A;  3R05 A;  1O3S A;  5C4W B;  1AR9 2;  4K8R B;  1RUJ 3;  4Y24 A;  1QQP 3;  1PZ7 A;  1PVX A;  5LA9 A;  2EIE A;  2W94 A;  2YBP A;  2ZA9 A;  1RIR A;  1APN A;  3DEM A;  3DUI A;  2RS1 3;  2B8M A;  4W6X A;  4XFG A;  3LFI A;  3ZMO A;  2ZX1 A;  1VAV A;  5BNO C;  3ELN A;  1VBC 3;  3NJZ A;  4FPC A;  1W9Y A;  2BOJ A;  2K9Z A;  3AZW A;  1HQL A;  3OPT A;  4COY A;  5GLV A;  1EV1 1;  1Y3T A;  2K2S A;  4CSW A;  2W3J A;  4BQ2 A;  4OUM A;  2ATF A;  2XJT A;  1W6M A;  3WF2 A;  3ZDV A;  3J4U H;  3N9M A;  1JMU B;  3CU7 A;  5FZG A;  1QJY 3;  3JBG 1;  1HJG A;  1HN1 A;  2UYB A;  3ZYH A;  5AC9 2;  3BOD A;  3LOB A;  3LCP A;  2ZX2 A;  4Y4Y A;  4FOY A;  3AZY A;  1YCI A;  4FOV A;  3VKN A;  2NMO A;  2WQZ C;  3T30 A;  3UKN A;  5FMO L;  1US3 A;  3AXD A;  1JTZ X;  2A5Z A;  2J1U A;  4CYD A;  3URF A;  4BQ3 A;  3POJ A;  1HJF A;  3WNP A;  4LO6 B;  4XQ4 A;  4IEU A;  4MXV A;  4QU2 A;  1BEV 2;  1OUR A;  1HQN A;  3S30 A;  2NM1 A;  2UY9 A;  4YGB A;  5FKC A;  4HKO A;  1MS4 A;  5C6C A;  4WM8 B;  5JOX A;  5J36 A;  1VE0 A;  2DVA A;  4LR4 A;  4BIO A;  3U4X A;  2YHJ A;  3J8F 2;  4QX1 A;  1HB2 A;  3K75 B;  4D6Q A;  2E7A A;  1PNG A;  2RHP A;  4LK7 A;  4AFD A;  2VEC A;  1AYN 3;  4H7M A;  3AJY A;  3QBQ A;  4JQR A;  3C7O A;  5B2G B;  2XG3 A;  2Y6H A;  2ENR A;  2VXR A;  1TEI A;  2WYS A;  3ZXE A;  3EYP A;  2NQY A;  1N1V A;  5FRE A;  2CGP A;  1YO8 A;  2D3S A;  4JGZ B;  1RUJ 1;  1QQP 1;  1W2U A;  2WO3 A;  3AYD A;  3WUD A;  4OLL A;  1CAW A;  4QX0 A;  2X05 A;  2DVF A;  3D5O A;  5LWB A;  1QF3 A;  2RS1 1;  2JDP A;  1VMH A;  1HRV 2;  2R04 3;  4BLI A;  1KJL A;  1W8Z A;  1STM A;  2PHD A;  3K77 A;  4RGA A;  1G9A A;  1F4A A;  4C0B A;  1OQ1 A;  2KR2 A;  1VBC 1;  1AXK A;  1W6O B;  3OPZ A;  2FD8 A;  1MZE A;  1WLC A;  3W58 A;  3LFM A;  2A3X A;  2ZGK A;  4KGQ A;  5FPU A;  1KS4 A;  3HVD A;  1QOO A;  4Q0P A;  5JVV A;  5SV5 A;  4JZR A;  3HQU A;  2OKX A;  3ZR5 A;  2XJQ A;  1AX1 A;  3KCX A;  4ARY A;  5FZO B;  2QNK A;  4HBN A;  4ZXK A;  1UPS A;  1QJY 1;  4BPZ A;  4LOR A;  4CDX C;  1CES A;  1O8S A;  3VBO B;  1JU3 A;  2CTV A;  2RMU 2;  3LPG A;  1WBF A;  3AXE A;  3MBW A;  3POY A;  4IV3 B;  4NUB A;  2HKX A;  4XJA A;  3WHU A;  2LRO A;  4BDV B;  3PL0 A;  2QQN A;  4N8M A;  5KXB A;  2X53 S;  2MNG A;  4OUL A;  2WZ8 A;  1JYC A;  4JHZ A;  4C1X A;  1CIY A;  1V6M A;  2I07 B;  5GZD A;  3SH3 A;  1HKD A;  3FZ3 A;  3VBF A;  5A3N A;  4G4F A;  4QHZ A;  4N53 B;  4WZF A;  1XYN A;  3CIH A;  4PBP A;  4CUG A;  5LRS A;  5TSW A;  1AL2 3;  1TME 3;  3NAP A;  4HXC A;  1VB2 A;  3D82 A;  4ET7 A;  4MYE A;  1MS8 A;  1ZBA 3;  2C24 A;  1DYK A;  2IUW A;  2J22 A;  1OLM A;  3A0N A;  3WNK A;  4IGQ A;  1AYN 1;  3LDR A;  2RS5 3;  2J1E A;  2O14 A;  4YGD A;  4CPB A;  1LNS A;  1OQD A;  1V00 A;  4RQP B;  4YWA A;  5I0U A;  4DXR A;  1XNB A;  3IAP A;  1UQX A;  1FI2 A;  4U36 A;  5FUN A;  1UZW A;  2IVI B;  2V5Y A;  2SLI A;  4KNC A;  1JZ3 A;  1RUN A;  4EV0 A;  1GLH A;  1Q8Q A;  4BME A;  4WVM B;  1PO2 3;  2VAU A;  3FE5 A;  1LHU A;  1H9W A;  1GZT A;  5K9Y A;  5DAP A;  1NY7 2;  5FY4 A;  1WD4 A;  2EXK A;  1VLN A;  3H9A A;  3I2H A;  3E5X A;  3IN9 A;  5FY5 A;  4PDW B;  2R04 1;  5H9R A;  1YIP A;  3ZSE A;  5HCH A;  3AYA A;  2QQU A;  2YBS A;  3GXU A;  2ARX A;  2D43 A;  2QQV A;  4MX3 A;  4OHX A;  4XJW A;  3AZX A;  3K4A A;  2W68 A;  3HT1 A;  1GBG A;  1SLA A;  2WFF 3;  3NJV A;  1E5I A;  4OCT A;  4TZD A;  4Y22 A;  4BLJ A;  1S0I A;  3KQ4 B;  2D6K A;  1ND2 B;  1FPN 2;  3V0A A;  3UL2 A;  1J3R A;  4V2V A;  1RUF 3;  3AK0 A;  1LCL A;  3UGH A;  1PIV 3;  1PK6 C;  4YZ4 A;  5CU1 A;  5A7O A;  1W6Q A;  4Y26 A;  5FPX A;  1SLC A;  3I2K A;  3I3D A;  3AP6 A;  2ZGM A;  5IK8 A;  1IS4 A;  1UKG A;  1YEW A;  1H2N A;  1RVF 3;  2FDH A;  2ZOE B;  4NWV A;  2HWD 3;  5F5A A;  2HWE 2;  1LUL A;  1S0F A;  1K5M C;  3OG2 A;  1OXC A;  1AL2 1;  1TME 1;  2BBA A;  1QMJ A;  5L73 A;  2QZ3 A;  1DGW X;  4I3P A;  4XUR A;  4CEW C;  1ZBA 1;  3I2O A;  4CCN A;  3PIJ A;  4LBJ A;  2PHR A;  3LIH A;  4J1X A;  2RS5 1;  3SEP A;  1VBB 3;  4I01 A;  3UNP A;  4FPJ A;  5ABJ A;  3G6J B;  4H55 A;  4L9B A;  2QQK A;  3C7E A;  5EYY A;  4BQ1 A;  4OFG A;  4PT6 A;  2BNN A;  3NKT A;  4AGR A;  2GNT A;  1HV1 A;  3AP9 A;  4QHO A;  1XE7 A;  5CNA A;  3RYR A;  3MIH A;  3NWK A;  1PO2 1;  1RUG 2;  1MVQ A;  1W0P A;  5C9A A;  3UYJ A;  4LBL A;  3RMX A;  4MGT A;  3U14 A;  1ZBE 3;  1XE8 A;  2I74 A;  3IM0 A;  3VDD A;  1AXY A;  2CSG A;  2CY6 A;  5JAX A;  2OQ6 A;  1LEC A;  2R07 3;  2Q30 A;  2Z2S B;  3TNQ A;  3DV8 A;  4B1L A;  3VBS A;  2XQX A;  3VBU A;  2YC4 A;  3ZXD A;  1LGN A;  3CLP A;  1RED A;  2P3Y A;  3ZPY A;  4CDW A;  2WFF 1;  1PM7 A;  1A6C A;  1LHN A;  2JIC A;  4QMA A;  4IE4 A;  4AGV A;  2XLF A;  4N53 C;  2GNM A;  4E2S A;  2A6X A;  1VP6 A;  5FQ0 B;  1BYH A;  3HWJ A;  3ZYF A;  3OD4 A;  1W0N A;  1SG3 A;  5A7N A;  1RUF 1;  2JEC A;  1O4T A;  4NRQ A;  4Q8L A;  3B5L B;  2PHW A;  1DP0 A;  2X5I B;  1PIV 1;  5GZG A;  1CZV A;  3USS A;  2R6Q A;  5FJH A;  4GUL A;  3THC A;  1JU4 A;  1LR5 A;  4QDS A;  4WBB A;  5FYM A;  2BEO A;  2D3P A;  2YYO A;  1POV 0;  3ZFF B;  4AED C;  3KWV A;  5GAL A;  1RUH 2;  2A1X A;  2WLQ A;  4YG3 A;  1MZF A;  1PM4 A;  1RVF 1;  1DGR N;  1OQE A;  4LKE A;  5L9B A;  4UFJ A;  2VBP A;  2HWD 1;  2EXH A;  3MIC A;  1PMI A;  4QGL A;  1CZS A;  2XJS A;  1R08 3;  4OI2 A;  5F2W A;  4UXA A;  5F3G A;  4URA A;  3D8C A;  1H6Y A;  1UMZ A;  5DDJ 3;  1VBD 2;  1VBB 1;  3DPR A;  4CCE A;  3HT2 A;  3WG4 A;  3BKZ A;  1SBE A;  3FBM A;  5I0T A;  2WNU A;  4CCC A;  4DEQ A;  3VLB B;  3BTX A;  1TNR A;  3KV9 A;  4QB6 A;  2A3Y A;  5FY7 A;  1ND2 C;  1OF3 A;  2PLV 3;  2Y60 A;  1OC1 A;  1DQ1 A;  1KXG A;  3U78 A;  4OHY A;  3HN3 A;  4NVP A;  1ZBE 1;  4HN1 A;  1ZVF A;  2WAA A;  4LIU A;  2BER A;  4A3X A;  2VMH A;  1JYW A;  4GMP 3;  1SHW B;  4S2H A;  4YVS B;  3RYK A;  1W2A X;  3AZZ A;  5FBZ A;  3RZG A;  2XJV A;  2R07 1;  3I97 A;  5BNP B;  4IV1 B;  4ZU4 A;  1UU4 A;  2VOW A;  2RJK A;  4TSV A;  1ZNP A;  3VZJ A;  5CA6 A;  3SC7 X;  1WGP A;  4ZS3 A;  3J9S A;  4NHM A;  1X82 A;  4FTB A;  4AQS A;  2P3I A;  2BRT A;  5DUX A;  1SCS A;  3T3Y A;  1R1A 2;  2CGN A;  5JXI A;  4HL0 A;  1H4G A;  2Y6K A;  2BTV C;  2SBA A;  1GWM A;  4XAE A;  3GNE A;  3M2M A;  3QH6 A;  2WJS A;  1PHM A;  1RUI 3;  3KB5 A;  4P9J A;  4BA6 A;  2JD4 A;  3HMY A;  3MEP A;  5FXV A;  3VD9 A;  5FYZ A;  5FIX A;  4E4Z A;  2AH2 A;  3T2P A;  2VZV A;  2H6C A;  4JV4 A;  1NCR B;  4L97 A;  4MHR A;  1RIN A;  2Y0O A;  3MUZ 1;  2CAU A;  1YHF A;  3PNA A;  1U5X A;  4Z07 A;  3WF1 A;  2C1F A;  4HSJ A;  2D6M A;  1C8N A;  1I6X A;  3K3O A;  2YXS A;  2D3R A;  2ORX A;  1Q8P A;  3AMQ A;  5FYC A;  3RZK A;  1C4R A;  2WFP A;  1R08 1;  2R30 A;  4YSF A;  2FDJ A;  2ARA A;  1UNB A;  3ZOI A;  2HJI A;  2XL9 A;  3SCG A;  1CPN A;  4H3W A;  5DDJ 1;  4D8M A;  1BK0 A;  1G9D A;  4XUO A;  3MFC A;  2O0O A;  3C2U A;  2QJV A;  4XEZ A;  5FUI A;  3ZYR A;  4R4X A;  5B4N A;  1UIJ A;  4XHB A;  1OD5 A;  4M0H A;  3V0B B;  3KVA A;  2XHK A;  3LB9 A;  2PLV 1;  3ZYJ B;  4E8D A;  1EUT A;  2GN3 A;  1U5Z A;  5LB6 A;  2AEY A;  2WA3 A;  4V1P A;  4AG4 A;  3O5S A;  3ZO0 B;  4E4D X;  1Q8S A;  2OT7 A;  3NW4 A;  4X6Q B;  5CIS A;  5JPN B;  3DXT A;  4GMP 1;  5F3I A;  2MEV 2;  4XF0 A;  1TMF 2;  1D0H A;  5JOW A;  3NJX A;  1H8V A;  1YC6 1;  4IE7 A;  3NNF A;  3O0W A;  2R16 A;  1MVE A;  4FFG A;  1RB8 G;  4C1W A;  2GN7 A;  2A6W A;  2LM3 A;  2W92 A;  1QDC A;  4QGN A;  1RJ8 A;  1YI7 A;  2G9G A;  2Q5T A;  3PDQ A;  5JXJ A;  2VOT A;  3CQO A;  4M3C B;  1H4H A;  2ID4 A;  3PUR A;  4FFI A;  2PHF A;  5FPV A;  5LY2 A;  3WDV A;  4DIN B;  3OGJ A;  4XCA A;  1RUI 1;  1UYY A;  3NNM A;  4WVV A;  4BIF A;  1W2N A;  2WQ8 A;  3POG A;  3MI8 A;  3OEB A;  3T0A A;  3LF7 A;  3P5B A;  4XAA A;  2DVG A;  2RDS A;  3ZFE A;  2GME A;  2ZGQ A;  4IEZ A;  1CD3 G;  4L92 A;  4Y5T A;  3PUS A;  4JTN A;  4L0P A;  3KVB A;  2RDQ A;  3G7D A;  1EAH 3;  5CFD A;  3CJI C;  2WNV B;  1W6P A;  4MGY E;  1BBT 3;  1CAU A;  1SPP B;  3J7H A;  4FQ4 A;  1UY4 A;  5IVB A;  1TQ5 A;  1W3V A;  2JWP A;  1S55 A;  3IMN A;  4NWW A;  4GH4 A;  4QKN A;  5J7M A;  4U2A A;  3VZO A;  1C3H A;  2NYY A;  5HV0 A;  3EJK A;  4IET A;  4FP3 A;  1W8O A;  4FI9 A;  4XYX A;  3ZN4 A;  5BNP C;  2CNA A;  1VBE 2;  4IV1 C;  1GFF 2;  4NHX A;  2JIG A;  1AR6 2;  1GKB A;  4XBL A;  3N3H A;  4AHW A;  3S0M A;  2BP6 A;  4CP9 B;  5BY5 A;  4LBQ B;  4D3W A;  1DQ4 A;  3M4F A;  3PVN A;  3EO6 A;  1RUC 2;  3A21 A;  3ACI A;  4OQ9 A;  3IAQ A;  4CCO A;  3MYX A;  4ASK A;  2IXK A;  4QB2 A;  1C8M 3;  3SH4 A;  5JSO A;  1VAL A;  4O61 A;  1W05 A;  3GBG A;  5H9S A;  5IFP A;  3ZSL A;  3UT0 A;  2ZGU A;  2JDZ A;  3OSD A;  4KU8 A;  3O0V A;  3PUI A;  2VW2 A;  4NRO A;  2P17 A;  4DXZ A;  2E6V A;  1NCR C;  1NQD A;  1S0J A;  2E9Q A;  4FFF A;  1GWK A;  3NO8 A;  5A3O A;  2VL4 A;  1DZT A;  2IFR A;  1OFS A;  3HR9 A;  4A6S A;  1W6N B;  1KDK A;  4QU1 A;  3VD3 A;  3WP4 A;  4D6S A;  3NVC A;  5FZL A;  5LW9 A;  4AHY A;  5KBF A;  2ZGL A;  1AL0 G;  3IZO A;  2QDN A;  2RDR A;  2VNV A;  3BUC A;  3DKQ A;  1WW7 A;  5A7W B;  4WM7 C;  3ZIX A;  2FQP A;  2K0G A;  5GLT A;  4UFM A;  2ET7 A;  1PGL 2;  4IEO A;  4M3C E;  1EAH 1;  1WUV A;  2BYV E;  3VL9 A;  1ULC A;  5FYB A;  1BBT 1;  1YQ5 A;  4D7T A;  1H1M A;  2VVF A;  1COV 3;  1V0A A;  2HWC 3;  1OA2 A;  3KHB A;  2GAL A;  4YYO A;  3W20 A;  2W1Q A;  4K20 A;  3AMP A;  1UPI A;  3BOP A;  1O59 A;  2JDU A;  1BZW A;  2BFU S;  3GCW A;  2PA7 A;  4RSU A;  5IVJ A;  1BQP A;  4AAP A;  2YPJ A;  3LA3 A;  3ACH A;  1EYB A;  3PTY A;  5KHG A;  2IXJ A;  2DVD A;  5KC6 A;  2HWB 3;  3CZU A;  2E7Q A;  2VZQ A;  4AEK A;  1L7L A;  1DBN A;  1H8T B;  3SHR A;  3AM2 A;  2V09 A;  5CFC A;  5EHD A;  4P9W A;  4TN7 A;  3CMG A;  3W59 A;  1UAI A;  1C8M 1;  4GWM A;  4JC1 A;  3N4M A;  2OPK A;  3MHZ A;  4N7U A;  4BOW A;  5A1F A;  3RZL A;  1W8H A;  1C1L A;  3AYC A;  1LOA A;  4AQT A;  3M8L A;  1FNY A;  1FX5 A;  3K51 A;  1O6U A;  3RJR A;  4FO9 A;  5GZF A;  1QJX 3;  2HBU A;  4FT8 A;  3L9J T;  1AYM 2;  4JX0 A;  1DLC A;  1QXP A;  2C9A A;  2DVB A;  2IXL A;  2VXJ A;  5FZ7 A;  3O1V A;  1CAV A;  1ENX A;  3LQC A;  2EF6 A;  3LE0 A;  1GNY A;  3GZT B;  2XLA A;  5GKA C;  2B5H A;  3H50 A;  2FDF A;  1UY3 A;  4YGC A;  1J3Q A;  3Q8A A;  5BNN C;  2WZP P;  2E51 A;  1MZ6 A;  3CNA A;  4HZF A;  1MEC 2;  4OMC A;  1REE A;  5JI9 A;  4MET A;  4UW4 A;  1TZO A;  3OGG A;  3FUQ A;  4RR3 C;  2V5D A;  3DKW A;  5HCF A;  1QXR A;  4N9H A;  3U0Z A;  2NLR A;  2EAA A;  4DQA A;  1CQ9 A;  1WD3 A;  1IOA A;  3FHQ A;  3LWC A;  2P2K A;  3KZ4 C;  1ENS A;  2VZU A;  1LOC A;  1COV 1;  5D8A B;  1C28 A;  2HWC 1;  1ENR A;  5C3R A;  5GLU A;  3UJO A;  2LW8 A;  4Y5S A;  3EXU A;  5JCT A;  4GQ7 A;  2JX9 A;  3AMN A;  4XJU A;  3KMH A;  4XVH A;  1D4V B;  3DL3 A;  4OZX A;  5IVE A;  5JMO A;  1HXS 3;  3FX3 A;  3I2D A;  1UIK A;  1LOE A;  2VZR A;  1QWR A;  2Y33 A;  4PIY A;  5C3S A;  5FYT A;  1REF A;  4E2Q A;  3ZXF A;  2XBO 3;  3N9Q A;  5LAT A;  2HWB 1;  2CGO A;  3FMG A;  1ULE A;  4JGY C;  3CKH A;  4B29 A;  2CAV A;  2RR1 2;  3VKL A;  1ACC A;  4FQZ A;  4FXG B;  1YUD A;  4MAD A;  3ZFG A;  2PYT A;  4NIH A;  2GAU A;  2D5F A;  4N43 A;  2WNE A;  4I0A A;  4NOT A;  4NR1 A;  1QIQ A;  2A75 A;  4N90 A;  3RYP A;  4MVT A;  1UYZ A;  2HYX A;  1NA1 C;  4DIQ A;  1QNW A;  2ARE A;  1QJX 1;  3VD4 A;  5A7S A;  3AKQ A;  4BQ4 A;  2LAL A;  1CAW B;  2A6Z A;  5IAT A;  3VDB A;  4DS0 A;  4AVB A;  3Q8B A;  4NIG A;  4BE3 A;  2BU9 A;  3NRU A;  2HLE A;  4KBZ A;  5CYY A;  4GKY A;  2VUL A;  5BXX A;  2YGL A;  1NAE A;  4AEJ A;  4I2O A;  3VKO A;  3T1L A;  2JDN A;  1OUS A;  2QZ2 A;  1JI6 A;  1EV1 2;  1V9U 3;  3K48 A;  5FZM A;  2G9Z A;  4RR3 A;  5FYS A;  4NPR A;  1F9K A;  1KEX A;  3ORJ A;  4LPL A;  2VY0 A;  2BGO A;  3KF3 A;  2VCM A;  3ZN6 B;  3FHA A;  3JBG 2;  2XWJ B;  3NV2 A;  3WQ0 A;  5AFB A;  1CON A;  2BGC A;  5L7O B;  2OX0 A;  5IAX A;  1H8T C;  5KC5 A;  1AR8 3;  3PJQ A;  2XUM A;  4QX5 A;  1W28 A;  2LRP A;  2IZW A;  2XVL A;  1M06 G;  4I02 A;  2RS3 3;  3BTY A;  4QXK A;  1FAT A;  2ZJC A;  2OZJ A;  2B7Y A;  4XTM A;  4YVW A;  3A4U A;  3NNG A;  4XJ9 A;  1B35 A;  1MAC A;  3RWK X;  3III A;  2I2S A;  4AQ6 A;  1MQT C;  4QM8 A;  5A32 B;  1HXS 1;  3WCS A;  4E27 A;  4LBK A;  3GHM A;  2Q1Z B;  1WCU A;  2XVG A;  2QFE A;  3IIA A;  2KM2 A;  4IGP A;  2JG9 A;  2XBO 1;  2ZGR A;  1ND3 B;  5A3T A;  2L9L A;  3MO4 A;  3QCW A;  4QX3 A;  3M3Q A;  5FXX A;  2HYK A;  4ZON A;  4X6R B;  4QPI C;  4BH9 A;  4Z2W A;  4RHV 2;  4COZ A;  3F2Z A;  4FP2 A;  3ROU A;  4CXX A;  3P3P A;  1NG0 A;  3NAP B;  3NST A;  4UWD A;  4QKF A;  1DQ5 A;  5JIA A;  3V64 A;  3VBH A;  4W4Z A;  3R6S A;  4LOT A;  2W1S A;  3B69 A;  2YG0 A;  4LA2 A;  1UF2 C;  2VQT A;  1D7P M;  2Q1F A;  1RUJ 2;  1RHI 3;  1QQP 2;  1XYP A;  1YYN A;  2VZO A;  3FBY A;  3TRS B;  3WEZ A;  1OOP A;  1QJU 3;  1NA1 A;  4IEX A;  4LHN A;  4Q29 A;  4CDQ C;  4EN8 B;  3NV3 A;  3OBA A;  3I2G A;  2ZHK A;  3O1R A;  2VUD A;  2RS1 2;  1O5L A;  1RUD 3;  5D8A C;  4BCU A;  3PVB B;  2ZKN A;  1SLL A;  2VMG A;  1UWW A;  3IPV A;  4XUT A;  5I93 A;  1LRH A;  1IG0 A;  1W8F A;  2WT2 A;  1LHO A;  1V9U 1;  1XSQ A;  3ACF A;  5K0U C;  1NCQ B;  2VTX J;  2ZEY A;  2XPJ A;  3N9L A;  4NRM A;  4P5Y A;  2VQU A;  3NKG A;  4JVA A;  2D7F A;  1T6G C;  2WQ4 A;  3VDA A;  1QJY 2;  1ZM1 A;  1SZB A;  3PTR B;  4Y22 B;  4L11 A;  1N3O A;  1CAX A;  1WLT A;  4QQH A;  1AR8 1;  4CDU A;  1X8E A;  4UFH A;  5CB7 A;  2VM9 A;  5FZD A;  1OPM A;  4UOJ A;  3VV1 A;  1VIW B;  1WCQ A;  2RS3 1;  4Q5O A;  4Y20 A;  1SAC A;  1S0D A;  2YDE A;  2HEY F;  2XL7 A;  4IEQ A;  4HLT A;  3WP6 A;  4XQW A;  4XFF A;  2EA7 A;  4HN0 A;  3TWI A;  3O1S A;  1W6Q B;  3GHN A;  4Q4W 3;  5CZK A;  3H42 B;  1RUE 3;  3ASI A;  1WA6 X;  3MIF A;  4QPG A;  4YLZ A;  1VMF A;  3DEC A;  2VVE A;  1IG3 A;  4AVS A;  3BU7 A;  4A44 A;  3O7O A;  2DU0 A;  3RGB A;  4Z8B A;  4LO7 A;  2DCT A;  2VTF A;  5IUQ A;  2EXI A;  3KT7 A;  1AYN 2;  2XKP A;  3POI A;  4GWJ A;  5FP8 A;  2B4K A;  3VBR C;  2OUJ A;  4PJY A;  3DGT A;  4QD2 A;  2QTW B;  3O12 A;  2I45 A;  3ZYI B;  1GQH A;  4KG0 A;  5JZG C;  5CG8 A;  3SXW A;  5ABJ B;  3L2H A;  4G9S B;  1RHI 1;  4KI5 M;  4DEV A;  2DU1 A;  1CGP A;  3HQR A;  1QJU 1;  2JJ6 A;  5EPA A;  2XWB B;  4XJ8 A;  4CUC A;  5AVP A;  1ONA A;  5L7O C;  2R0H A;  4K9S A;  4TXW A;  1RUD 1;  5L9V A;  4MGQ A;  2R04 2;  3FLT A;  5C9A B;  2VZ1 A;  1IQA A;  1C5I A;  3WNO A;  2WO1 A;  4LIV A;  1VRB A;  3ZN5 A;  4A42 A;  4OHZ A;  3M3E A;  4BWO A;  2ZX0 A;  3LKJ A;  3WP5 A;  1FOD 2;  3E1F 1;  2EVX A;  4RS5 C;  1L7Q A;  3ZXJ A;  3DCQ A;  4GKX A;  1LAJ A;  1ZRF A;  5KXE A;  3VBS B;  2DYC A;  2P37 A;  2CHH A;  3LEI A;  3RFR A;  1ND3 C;  3PMS A;  4CDW B;  2WZR 3;  2JKX A;  3FJS A;  2BQP A;  1YQC A;  4FXK B;  3VHR A;  2VQA A;  5BNO A;  1OA4 A;  3K4Z A;  3M7A A;  3LOI A;  3D0S A;  1WMD A;  2PQQ A;  3KT1 A;  3MW2 A;  2FCV A;  1X9P A;  4CA9 A;  3I3E A;  3VL8 A;  2JB8 A;  5KR7 A;  2UU8 A;  1G9F A;  1HDK A;  2WT0 A;  3AP5 A;  2N7G A;  3HNY M;  2YV8 A;  4Q4W 1;  4GIQ A;  1RUE 1;  2KA3 A;  2RM2 3;  2XHN A;  4MXW A;  5HI0 A;  3MUY 1;  2XML A;  1BK1 A;  1M4W A;  1QJE A;  1AL2 2;  1TME 2;  4GZ9 A;  4V2W A;  3POE A;  4DY5 A;  4ASM B;  1ZBA 2;  4LKS A;  4A7Y A;  5F9T A;  4DFS A;  5FTT C;  4Q4X 3;  2CV6 A;  2RS5 2;  4FPG A;  4LA3 A;  2ZAB A;  4LBQ D;  4IL7 A;  1GWL A;  1ZZ7 A;  4QPY A;  1QXJ A;  5C4W C;  1NCQ C;  1N47 A;  3JXS A;  1WME A;  4JKM A;  4IEY A;  4LIT A;  1VRH 2;  5A6Q A;  1AXZ A;  4TTG A;  1N1T A;  1OFN A;  1X7N A;  4M0N A;  4Q4Y 3;  4B4Q A;  1UW8 A;  1PO2 2;  3ME2 A;  2RJL A;  3OYW B;  3TEW A;  4NN0 A;  3CBN A;  2ZZJ A;  3W9A A;  1IS6 A;  2UWB A;  5EV7 A;  4EN7 B;  4GXL A;  3RZJ A;  1UU6 A;  2YGM A;  1HRV 3;  1F31 A;  2XDV A;  4F7Z A;  5I8T A;  1DZQ A;  4XFC A;  2JEN A;  3NV1 A;  5DZE A;  1UZV A;  2DCY A;  4A2U A;  4JTO A;  3KCY A;  1WLW A;  2Y34 A;  2HWF 3;  1HRI 2;  1CWP A;  1PX3 A;  2WFF 2;  5DAV A;  2XH6 A;  3CF6 E;  3OBT A;  4K40 A;  4D6R A;  3CZJ A;  4BQY A;  5BNQ A;  2WZR 1;  4CCD A;  3PLQ A;  2HEV F;  1RUF 2;  5FLI A;  1QNY A;  1AF9 A;  5FBJ A;  1UCX A;  4LO8 A;  3E6C C;  1N3Q A;  1PIV 2;  2RMU 3;  3T4H B;  4ORF A;  2DCJ A;  4AR2 A;  5F3E A;  1GQP A;  1PGW 1;  1XXN A;  2QQM A;  2ZZQ A;  3IDA A;  1RJ7 A;  1OVS A;  5FKB A;  1PX4 A;  1JHJ A;  2QVS B;  4KG8 A;  4ZXE A;  3WP3 A;  3WW1 A;  2BFU L;  2WWJ A;  4Q0U A;  4R9C A;  4XFH A;  1VMJ A;  4FOQ A;  1ULG A;  1K3I A;  4WM8 C;  5A33 A;  3WLU A;  2JDA A;  4XZP A;  4LHK A;  1RVF 2;  2RM2 1;  1W2T A;  3EQE A;  2HWD 2;  5A7P A;  4O7X A;  3MIB A;  3MW3 A;  4CDX A;  1FV3 A;  1HB4 A;  3I4I A;  5FLJ A;  1ZA7 A;  1L7R A;  3NNL A;  1LOF C;  2FBE A;  2QDR A;  2A6Y A;  5G04 L;  3IBM A;  3ALQ A;  1Z0H A;  2Q1M A;  4Q4X 1;  3K2O A;  4HMZ A;  1VBB 2;  4XXA A;  5FZ9 A;  4AYU A;  5J1X A;  2GZW A;  1MS3 A;  1UOJ A;  1HLC A;  2WRA A;  3SKJ E;  4OHW A;  4FPY A;  5F6K A;  1GZW B;  4JGZ C;  3VB9 A;  2PAM A;  5AFE A;  3VGI A;  2EID A;  3OGV A;  1SFP A;  4Q4Y 1;  4IGO A;  4PLN A;  3OGR A;  2JG8 B;  2J1V A;  4P9Y A;  1W90 A;  4I3G A;  1YFW A;  1R64 A;  3JQX A;  1ZBE 2;  4IE0 A;  5F5C A;  1HRV 1;  4XAB A;  3OY8 A;  2OW4 A;  3WF3 A;  4D69 A;  3MIG A;  1G7Y A;  3BN6 A;  5C71 A;  2ZHL A;  2R07 2;  3K3N A;  2ADE A;  3D4K A;  3LEK A;  4YPJ A;  2HWF 1;  2V72 A;  3ZM8 A;  1ZZC A;  1L3J A;  5A6Y A;  3GZA A;  4E9K A;  3FWE A;  4B3N A;  4ITC A;  1H1I A;  1OPO A;  2GU9 A;  2DUQ A;  3VBO C;  1F35 A;  2OXB A;  4IV3 C;  2WLP A;  3ZDS A;  3O1U A;  1DCS A;  1LGB A;  4DB5 A;  2JE8 A;  2PHU A;  1DQ6 A;  5ANQ A;  2DUP A;  2RMU 1;  3ENR A;  4LK6 A;  1Q43 A;  1XNC A;  3LDB A;  4HVR A;  1H2L A;  4RD7 A;  1J3P A;  3F95 A;  1KGY A;  3HIF A;  3T2T A;  5HPO A;  5F8P A;  1WCS A;  4ISQ A;  3FFZ A;  4ASL A;  1ZRC A;  3KM5 A;  3MPB A;  1CPM A;  5I8S A;  3AVR A;  4X8P A;  1WLD A;  1NX9 A;  4XET A;  4N7I A;  5IVV A;  4YM0 A;  3O0X A;  2J1T A;  3MLK A;  3RMY A;  3OGS A;  3RVH A;  1QEX A;  5A6X A;  1PK6 A;  1OKQ A;  1R08 2;  1W6P B;  2VNR A;  2WC2 A;  1CAU B;  3BAL A;  3OEA A;  3S57 A;  2WA4 A;  1HB3 A;  3GF6 A;  2QQO A;  3B00 A;  2OVU A;  5DDJ 2;  2ERF A;  4URT A;  3RZZ A;  2TNF A;  4RQP C;  1OKO A;  4XMI A;  5LCW L;  5D1I A;  3NL1 A;  4Y5Z 0;  5LBE A;  2K46 A;  5HBA A;  4XUP A;  2JE7 A;  1BVP 1;  4B1M A;  2PMW B;  1S0B A;  4AGG A;  4C90 A;  3LZZ A;  5BYN A;  3MIE A;  4PIZ A;  4Y1Z A;  1K5M A;  2PHT A;  5HCB A;  2PLV 2;  3UKV A;  2VZS A;  4CEW A;  4IES A;  1SQ4 A;  1GP6 A;  4PDW C;  3QH7 A;  1FXZ A;  4CEY B;  2VBD A;  2VW1 A;  4HSL A;  4BIS A;  1EP0 A;  1UD1 A;  3BPS A;  4PF5 A;  4UFL A;  5J09 A;  1K45 A;  2R1D A;  4GB3 2;  4L8Q A;  3U75 A;  4CE8 A;  2QKD A;  1YQ2 A;  2DUR A;  5IVF A;  3FL7 A;  1I5Z A;  3B01 A;  1C1F A;  1H0B A;  2C5D A;  5KXC A;  5F1R A;  3T08 A;  5DZG A;  3WNX A;  3ON7 A;  1XYO A;  1W03 A;  4DXT A;  4DY3 A;  5FZ3 A;  4MG2 A;  2WS9 3;  2ZAA A;  1NLR A;  2IFW A;  2XVK A;  5C8C B;  3O1T A;  1KRI A;  4EE2 A;  1OI6 A;  3POB A;  2DBI A;  2WT1 A;  4Z2A A;  1FNZ A;  2O8Q A;  4LXL A;  4NO4 A;  2RJ2 A;  1G9C A;  5L19 A;  5K4L A;  4TYS A;  4GJY A;  5F6L B;  1NXD 1;  2R49 A;  1UX7 A;  5DAB A;  4FCA A;  2WO7 A;  1AX2 A;  4DRR A;  5DMY A;  5JIU A;  3C8X A;  2IC1 A;  1IZ3 A;  5C70 A;  2YU2 A;  1ODN A;  3ZX7 A;  4B8E A;  4ZHN A;  1DYP A;  4N53 A;  3GM8 A;  5FY9 A;  4SLI A;  5FCC A;  5ACA 3;  1Y9M A;  4HON A;  2JG8 C;  1HIX A;  2O8O A;  5FMB A;  1JUH A;  5FZA A;  3WHT A;  3BU0 A;  4UW5 A;  3AYE A;  4IW3 A;  4NRP A;  2NN8 A;  5A6Z A;  2VUJ A;  4XFB A;  2Y26 A;  2JKB A;  4LUM A;  2AR6 A;  1RMU 2;  4CCK A;  5I0D A;  2G1M A;  3PJY A;  3RWN A;  4AED A;  3I49 A;  4M3C F;  4UW6 A;  4UYB A;  4QAW A;  2B9V A;  4YM3 A;  3S5A A;  2QQP A;  1O8P A;  3ZPO A;  4G3Y C;  3B3Q E;  1FV2 A;  5T55 A;  1TNF A;  2PHX A;  3DF0 A;  3W5M A;  5J48 A;  4YZ5 A;  4XF1 A;  1IPJ A;  5C3P A;  5FMC A;  1DGR A;  2JDH A;  1GUI A;  5CFC B;  5FDB A;  2EIC A;  1HN0 A;  4RA0 A;  3PVE A;  1X33 A;  1XC6 A;  3H8R A;  2VCA A;  4W50 A;  3D6E A;  5T5P A;  2G4I A;  1ND2 A;  4ZPI A;  2WS9 1;  5F7U A;  4NE9 A;  3GCX A;  1SLB A;  4ARX A;  5JUV A;  5LK5 A;  3SQO A;  3OJB A;  4ES8 A;  2X5I C;  1AHS A;  4UBH A;  2ZMN A;  3POW A;  3WG1 A;  1AR7 3;  4JRL A;  3WCR A;  1CAV B;  3OBZ A;  4CCL A;  4Q8K A;  1ZRE A;  2AZ5 A;  3NMB A;  2XJP A;  1D4M 3;  1YWK A;  3ZFF C;  2ZHM A;  4C91 A;  2BWC A;  4D0Q A;  5H9P A;  3BYW A;  5A1A A;  5E8A A;  1PVC 3;  1QU0 A;  4CXW A;  4QWN A;  1EAH 2;  1UOB A;  1Q8O A;  3LEG A;  4MH0 E;  4QM9 A;  4RFR B;  3B7M A;  3PVO A;  1BBT 2;  4OUS A;  5FYY A;  1PZ9 A;  5ACA 1;  4R4Z A;  2JDY A;  4LEJ A;  2ILM A;  3T0B A;  4P9I A;  3T4V A;  4CEY C;  4PIX A;  4CU9 A;  1JN2 P;  4XDQ A;  3H1W A;  4RN5 A;  5EJ1 B;  5FYU A;  1JYV A;  3O1M A;  1C5H A;  3OPW A;  3R0R A;  5D2A A;  3MF9 A;  3SMH A;  4NAM A;  3MV0 1;  3U07 A;  1KQR A;  1V6K A;  1OT5 A;  4C0H A;  5C8C C;  2V4V A;  1XBF A;  5T5O A;  1PZ8 A;  5LBB A;  3UES A;  4BYY A;  1UZ0 A;  5I8Y A;  1VB4 A;  1UX6 A;  3TN9 3;  1NQJ A;  2A3W A;  4Z92 B;  2W95 A;  1GP4 A;  1C8M 2;  4YVS C;  2VOV A;  4I0W B;  5I0S A;  2IXH A;  1ASJ 3;  1OVP A;  1R09 3;  1O5U A;  2QUO A;  4NII A;  1PGS A;  2ZAC A;  4FAH A;  5DUW A;  1GQG A;  1LKN A;  3WDY A;  1B09 A;  4L99 A;  2YFZ A;  5HXV A;  2OYZ A;  1ULO A;  2Z42 A;  2Z69 A;  4WVZ A;  4AW7 A;  4N43 B;  4GMP 0;  5GLZ A;  1HQW A;  5C5U A;  2ZMK A;  5FZB A;  4LE4 A;  4MUV A;  1DHK B;  4QQ2 A;  1GAN A;  1W8T A;  1UMI A;  4ZKT B;  5F3C A;  4KWU A;  3E6B A;  3KQR A;  4H7L A;  1TE1 B;  5FAX A;  1AR7 1;  2G9F A;  2C4X A;  2GH2 A;  4YZ1 A;  1RTV A;  4OZO A;  2YMZ A;  3ITQ A;  4L2N A;  4EWD A;  3OTF A;  1LES A;  2DDU A;  1D4M 1;  2VO5 A;  2VC9 A;  1GMM A;  2R06 3;  4OI4 A;  2OZ6 A;  3U10 A;  1PVC 1;  2PHL A;  2Q8O A;  5DAQ A;  5IFT A;  2RG4 A;  1VBA 3;  1Z7S 3;  4COU A;  5I91 A;  2MPF A;  2ORZ A;  1XE0 A;  3CHX A;  4YW1 A;  2VUC A;  4YG0 A;  1COV 2;  2HWC 2;  3WSO A;  4Y33 A;  4ISR A;  5EXO A;  1F8V A;  1GZ9 A;  2QE3 A;  1UY2 A;  4YW2 A;  1ALY A;  3KV6 A;  1GZC A;  1VR3 A;  4EWE A;  4XJZ A;  1NXM A;  4CRQ A;  4XE9 A;  1CX1 A;  1XQN A;  5BPX A;  3V65 A;  3B9I A;  4XXP A;  5FV3 A;  2FZ1 A;  1RXF A;  3GZE A;  4O9G A;  4YM2 A;  3CJI A;  4A4A A;  3UK9 A;  3WT3 A;  3KV5 A;  1JZ5 A;  2HWB 2;  2BWA A;  1F5F A;  1FMD 3;  4AI2 A;  4AAX A;  2WAO A;  5GM0 A;  3KF5 A;  3TN9 1;  3U4S A;  2UUR A;  1US2 A;  1S1A A;  4HPK A;  1H2K A;  4QKB A;  4AI1 A;  5BNP A;  5LY1 A;  5J3U A;  1ASJ 1;  1IS5 A;  1R09 1;  2R7E B;  4IV1 A;  3WD5 A;  3VBH B;  3LA7 A;  5L9R A;  3FHI B;  5FZK A;  3RNS A;  1NE6 A;  1W8W A;  2H0B A;  1QGL A;  1E5S A;  2KD7 A;  5AVA A;  3RPQ A;  1OH3 A;  3S6P A;  1HV0 A;  3KLS A;  1X8M A;  2CDP A;  2ARC A;  1QJX 2;  1QJZ A;  1ZX5 A;  1ENQ A;  5CVR A;  1OOP B;  4BM8 A;  5LEK A;  1PMH X;  3N7M A;  4NAO A;  3USU A;  1DGL A;  1NKG A;  1W06 A;  5T52 A;  1DU3 D;  4XDP A;  2ET1 A;  2WDB A;  3VZL A;  2XR4 A;  2ZKL A;  2ARB A;  2VJX A;  3CEW A;  1YJL A;  5FZ0 A;  4IUG A;  1WMF A;  5CG9 A;  2AC1 A;  4CUA A;  2ZHN A;  1DF0 A;  1NCR A;  4LLO A;  1CZT A;  3LA2 A;  3WDT A;  2A71 A;  1Q5O A;  1ZA4 A;  2R06 1;  2NPI A;  1JZ4 A;  4QXC A;  2EIG A;  4JHT A;  1ZZ8 A;  5FO8 B;  2WNV C;  5JDB A;  1GOH A;  1VBA 1;  1JYN A;  1Z7S 1;  4LMF A;  1G6N A;  5FPL A;  4AZZ A;  3BB6 A;  2EAK A;  2WWU A;  4UFK A;  5T3N A;  4P08 A;  1XPW A;  1ZRD A;  1CAX B;  4XOG A;  1IGO A;  3WR0 A;  3KV4 A;  4H14 A;  5JOY A;  4WM7 A;  4Y20 B;  4JKL A;  5L36 A;  2JXA A;  4FSJ A;  5DUU A;  4F8A A;  1HXS 2;  4CU7 A;  2DV9 A;  1T2X A;  3WXP A;  3SH5 A;  4QHB A;  2XBO 2;  1W6M B;  4Q0V A;  4A41 A;  3C7H A;  1IPK A;  1EY2 A;  1FMD 1;  1YJK A;  3JD7 3;  3N9P A;  1W9S A;  1WZX A;  4E4S A;  4HVO A;  1UY0 A;  5LBC A;  1LOD A;  4MOA A;  5EIY B;  1AUY A;  1KFU L;  4CU6 A;  3AFK A;  2PAE A;  3JB8 A;  1O3R A;  5EZW A;  1P8J A;  4PLO A;  3VDC A;  2A73 B;  2B46 X;  1CVN A;  3E5U A;  3I54 A;  1LGC A;  4LKF A;  1IQD C;  2J7M A;  1E57 A;  5CEH A;  3HEI A;  1H2M A;  3OCP A;  4M3C A;  3H1Y A;  2FMY A;  4BK4 A;  3AKR A;  3HJR A;  5A1L A;  1FYU A;  3KHC A;  5LRR A;  1S2E A;  1Y43 B;  2Q4S A;  2ADD A;  5T5L A;  3H3U A;  4XBQ A;  1KIT A;  5C7G A;  1LB2 A;  4Y3O A;  4Q4V 2;  2XLG A;  4Z82 A;  1ODM A;  3AC0 A;  3MLL A;  2ZGO A;  1W99 A;  2WNO A;  4AF9 A;  3MV1 1;  3ZXL A;  1D2S A;  3MFA A;  1JUI A;  3I3B A;  4HKW A;  3MDP A;  4S2F A;  4PQQ A;  3KSC A;  1WCK A;  3LDK A;  1AR8 2;  3MF6 A;  1S0E A;  4A6O A;  3PUQ A;  5ANN A;  2ES3 A;  1GOG A;  3ZSM A;  5FP3 A;  2RS3 2;  1JBC A;  5BNN A;  2WII B;  5BNO B;  3WW3 A;  3GBF A;  5IHR A;  1GU3 A;  5CAZ A;  3IB3 A;  1W04 A;  3N36 A;  5KHJ A;  4OQ8 A;  4NPL A;  3VN4 A;  5E1R A;  1Y7B A;  4LBQ A;  4UBG A;  2R0F A;  4COW A;  3M70 A;  3ZR6 A;  5A80 A;  1I1E A;  2X29 A;  3WDX A;  2FDG A;  4HOO A;  2X09 A;  3ACL A;  2VME A;  1SDW A;  3I3M A;  4LTA A;  4QT6 A;  2CL2 A;  3MZH A;  4S2G A;  3JD7 1;  2VVD A;  1JZ8 A;  4DUW A;  4P9L A;  3IKW A;  1WMX A;  5BV6 A;  4AVC A;  3H8U A;  4LHS A;  3ETQ A;  5F32 A;  1VAK A;  3IDE A;  3HOB A;  2OII A;  4LLF A;  3WNL A;  5JSP A;  2ZGN A;  3POF A;  4YG6 A;  4XIK A;  2BJS A;  3UGF A;  2W91 A;  4GJZ A;  4RGK A;  1RHI 2;  5FJK A;  1O4Y A;  2DWR A;  1BHG A;  3V56 A;  1QJU 2;  1SMV A;  2BW8 A;  4QX2 A;  3WQB A;  3VBF B;  1UOG A;  4E4H A;  1V6J A;  4IQP A;  3S7E A;  2R32 A;  3AL6 A;  4JGY A;  4EN9 B;  1F5J A;  1RUD 2;  1XND A;  2GMM A;  3D3A A;  1QOS A;  2CWS A;  4GWI A;  4IDZ A;  3VHN A;  2D5H A;  1F2N A;  4FFH A;  1Y9Q A;  4E2G A;  1BMV 1;  1VAM A;  1H6X A;  5FZE A;  4ES9 A;  2BUK A;  4NID A;  2VGD A;  4FPL A;  3W21 A;  2VCC A;  3ZSK A;  5LAS A;  5GLW A;  1S0C A;  4WZC A;  3O14 A;  4KU7 A;  3WX5 A;  3ZXA C;  2WWS A;  5EJZ B;  1PO1 3;  1C57 A;  4ZU5 A;  1VBC 2;  3SLI A;  4BMB A;  2GP5 A;  3AKS A;  3AVS A;  3VD5 A;  5FWJ A;  1ULP A;  2ZXQ A;  2ZX4 A;  1N1S A;  5FWE A;  5JR7 B;  4B4R A;  2Y38 A;  2W47 A;  1AZD A;  3EMR A;  3WVJ A;  4R52 A;  3LPF A;  1RUE 2;  2W39 A;  2VR4 A;  4GAL A;  1GNZ A;  2IWG B;  5FK7 A;  1A8D A;  1UYP A;  4AFA A;  5A33 B;  3AP4 A;  1H8T A;  5IAV A;  1DLL A;  3M3I A;  3WDW A;  1XU1 A;  4CDX B;  3V0A B;  4RHV 3;  3VZN A;  1POQ A;  1OUX A;  2VZP A;  3WQ7 A;  1MS1 A;  3FLP A;  2D6L X;  3LGR A;  3N9O A;  4UFI A;  1MPX A;  4S2D A;  5F39 A;  1U5I A;  1MQT A;  2VD7 A;  2YC2 A;  5FP4 A;  3EHK A;  4LT5 A;  3OD0 A;  4ERO A;  1AJK A;  1YXW A;  3C7G A;  1F4H A;  1RC6 A;  2GP3 A;  1S2B A;  2C9K A;  2YY1 A;  3GZU C;  5IVC A;  2O1Q A;  3VHP A;  1UZY A;  5JPM B; 
#chains in the Genus database with same CATH homology
 3I49 A;  4IE0 A;  3S5A A;  4IE4 A;  3BTY A;  4IE5 A;  4IE6 A;  4IE7 A;  4NRQ A;  3RZL A;  4NPM A;  3H8R A;  4NPL A;  3O1U A;  2IUW A;  4CXX A;  4QKF A;  3H8X A;  4QKB A;  2FDG A;  3I3M A;  5F8P A;  3O1V A;  3RZH A;  3BIE A;  2FDF A;  3BKZ A;  3O1R A;  2FDI A;  3S57 A;  3O1S A;  4QKN A;  3BTX A;  4CXW A;  3O1P A;  4RFR B;  3RZJ A;  4IDZ A;  3T4V A;  4NRM A;  4OCT A;  4JHT A;  3BTZ A;  4NJ4 A;  3RZG A;  3O1M A;  4NID A;  4ZS3 A;  3O1O A;  4O61 A;  3T3Y A;  4NRO A;  3T4H B;  4MG2 A;  2FDH A;  4NII A;  3RZM A;  4CXY A;  3O1T A;  4NIH A;  3I2O A;  5DAB A;  4O7X A;  3BUC A;  3RZK A;  4NIG A;  4ZHN A;  2FDJ A;  4ZS2 A;  4QHO A;  3I3Q A;  4QKD A;  3H8O A;  2FD8 A;  3LFM A;  3BU0 A;  4NRP A;  4MGT A;  3KHC A;  3KHB A;  3BI3 A;  2FDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...