4JHTA

Crystal structure of alkb in complex with 5-carboxy-8-hydroxyquinoline (iox1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
b'PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title 5-Carboxy-8-hydroxyquinoline is a broad spectrum 2-oxoglutarate oxygenase inhibitor which causes iron translocation
doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4jhtA00
3O1SA 3I3QA 3RZHA 4IE7A 4NPLA 4NIDA 3RZMA 4O7XA 4NRQA 3T3YA 2FDKA 3S57A 3RZJA 3LFMA 4RFRB 3I2OA 3BIEA 4NRPA 3I49A 4IE5A 3BTYA 3BI3A 4IE0A 3O1TA 4QKFA 4CXYA 4IE6A 4JHTA 4OCTA 4QKBA 4QHOA 4NPMA 3H8XA 3BU0A 4NIIA 2FDHA 4ZS3A 3I3MA 2FDGA 4MGTA 4ZS2A 4QKDA 3BUCA 4NROA 4QKNA 3O1MA 3RZLA 3H8OA 3O1PA 4O61A 3O1RA 2FDFA 2FDJA 3BKZA 4IDZA 5F8PA 3S5AA 4NIHA 2FDIA 3O1OA 4CXWA 3KHBA 3RZGA 3T4HB 3O1UA 2FD8A 3BTXA 3KHCA 4ZHNA 4CXXA 4NRMA 4NIGA 3T4VA 5DABA 4NJ4A 2IUWA 4IE4A 3BTZA 4MG2A 3RZKA 3H8RA 3O1VA
chains in the Genus database with same CATH superfamily
3O14A 4BA6A 2DCZA 4BLJA 3H3ZA 4QPIC 1XOYA 1ALYA 4UW5A 2VMIA 5BNNC 3P1IA 5FZ6A 3ZR5A 4YVSA 3KVBA 2Z79A 5AVPA 2W91A 1RUE1 1WCQA 2EF6A 5JOXA 5DN2A 2CV6A 1K5JA 1K45A 3WV6A 3JBG2 4YVWB 3OB8A 1CIWA 3HQRA 1JHJA 4AQ2A 1AL21 1F5FA 3K3OA 2XBO2 4LA2A 2VH9A 4AG4A 1C8NA 4BWOA 1XJAA 3OF1A 3BIWE 1W9FA 1FV3A 1WBLA 4XTPA 3TN93 1PGL2 1YQCA 2YZ4A 3WINE 4JCKA 3MUY1 1DHKB 1V0AA 1VBE3 2LRPA 5FZ3A 2VECA 1QMJA 4ZPIA 1NYWA 2RMU3 5C8WA 2R0FA 1ENXA 2QZ3A 2X53S 5F5CA 2MHFA 1L7RA 1XSQA 3FFZA 3ZSLA 2Q8CA 2R0HA 3T30A 3CBNA 4QXBA 3VZJA 1CAVA 3V0AA 4XFFA 3BODA 3FHAA 1VIWB 1EYBA 1QJX3 1C57A 2DVBA 2RHPA 1DCSA 3I2DA 2AR6A 4R4ZA 1CR7A 5A3OA 3RG0A 2DFCA 3AXEA 2ZX2A 1ONAA 2B42B 3MLKA 1GU3A 1Q5OA 2Y6FA 4FSJA 3KGLA 1LCLA 2VVFA 4YZ5A 5ERLA 1VE0A 3FBMA 2ZZJA 3GXUA 3OG2A 1ST8A 3FL7A 3J8F3 4AEDB 2PHFA 3VBSB 3H8XA 4FPYA 5FQ0B 5JVVA 3FLRA 1PGW2 3C8XA 3KM5A 5D1IA 2ZGKA 4CCLA 4F83A 3H1WA 4XEZA 5DDJ2 1DYKA 1WKYA 2WINB 2BVBA 4QXCA 2UY9A 3PVNA 2Y6KA 2WJSA 1RHI1 2RS52 1NXMA 4UT5A 2A1XA 3BUCA 1BMV2 2VMDA 1UZ0A 4YW4A 4CRQA 5J98B 4B4PA 2IVIB 3WF4A 3PURA 2VXRA 3WCSA 1J84A 1F35A 2PHWA 3NW4A 2E7TA 5ABJB 4MHUA 3DPRC 1UOBA 3AZZA 5FXZA 4YZ3A 5HXMA 2XL7A 3VKLA 4K7JA 5FZ4A 4NIHA 5F6LB 5B4XA 1FPN1 4M00A 5GLWA 4ZKTB 4GH4C 4CDXC 4AE2A 3BGAA 1DYPA 4OVEA 1QJU2 4Y26A 2NPIA 1V6NA 4HMZA 1RUOA 2RS31 1UY2A 5C33A 5C8CC 4UW3A 2BGPA 5JAXA 5FPXA 3MI8A 1UIJA 4CEWA 1QJEA 4CXXA 2QZ2A 4RS5B 4Z1VA 4BQWA 4OUSA 1NCRC 4LE4A 4RR3A 1NLRA 1V6KA 2QQUA 4IEQA 3U07A 1GOFA 2HWE3 1OURA 3AYDA 3AVRA 4OI1A 3I2JA 2Q8EA 2VCCA 1VPHA 1ZBA1 4GWJA 3M4FA 2JG8B 3SISA 1PVC3 2WNUB 2J1EA 1SLTA 3POBA 4N9HA 4Y1XA 2W3JA 1LOFA 4RL7A 3ZFFA 3I2GA 2JG9B 4LKSA 1NE6A 1KD7A 4YW3A 3VZNA 2VTXA 1GMMA 2I2SA 3LOIA 3HWJA 2A5ZA 4Q4X1 1WA6X 4RQPB 5GZCA 3PJYA 1RUF2 1XNCA 2SLIA 2GN3A 2ZCWA 4XUOA 2CGPA 1IKQA 2GNDA 3SH5A 5HI0A 1EUTA 1UWWA 1J3QA 5LBFA 4IUGA 3CJIA 2VQ0A 2B9UA 4HVOA 3UGGA 1AJOA 3OUIA 1LGCA 3CF6E 5FYSA 5F2WA 4UFKA 3PTRB 2JB4A 1EV13 1VBB3 2C4XA 2ZGMA 3AFKA 4WV8A 5A1FA 2D7FA 3DCQA 1PGSA 2XWJB 4LITA 2WNOA 3GHNA 1UMHA 4M01A 2W1UA 3I59B 3THTA 4OHWA 2YGLA 1WZXA 2WZPP 2Q5TA 3V65A 4PLMA 3JD71 3VDDB 4GIQA 1X9TA 2WIIB 1O5UA 5DZEA 2ZS6B 1F8VA 2OVUA 4HT1T 2WFF2 4IW3A 4OMDA 5H9RA 1GP4A 4PDWB 4IGQA 3ZVXA 4CU9A 1JZ7A 5DZFA 1HRV1 2JE9A 2ZX0A 1RC6A 2RS13 3FJSA 1OQ1A 4QKBA 4LE3A 1QJY3 5FBZA 3URFA 4JGYC 4QMAA 2BWAA 1CJDA 3O0XA 4HSLA 5K0UC 2DBNA 3BU0A 2W46A 1C8M2 3MZHA 2IXHA 2Y8KA 3MDPA 4QDQA 2WNEA 3HAGA 3SMHA 2YPJA 3M2MA 3VN4A 1N1TA 4LO8A 1S4CA 2ADDA 2FZ2A 3JCIA 3B9IA 3OUHA 2XJQA 2WNVA 1SZBA 4AAPA 2BOIA 2O8OA 2GMEA 5L7OA 4QPGA 3VDAA 1QNYA 2WSVA 3M3QA 4IERA 3HN1A 1B09A 4H7LA 5IVVA 1RUG1 3SC7X 1JS9A 4CYDA 3CL1A 1YNAA 1JN2P 4GJZA 5EFUA 4X6QB 2D6OX 1TE1B 2K0GA 1Z7S3 2C9AA 3J7HA 4KG8A 2D6LX 3I2FA 2QQLA 5A1AA 3WP3A 5HCHA 4MUVA 4WVVA 1XSRA 1C28A 3EO6A 2P6CA 3AJZA 3PMSA 3J7MA 4XABA 4ZONA 3QCWA 3UGHA 4A4AA 1RUD1 2P5BA 4CP0A 2VAUA 4A45A 2LS6A 1CD3G 1GZWB 1IOAA 3NNJA 3WQ0A 4FPLA 1Y43B 4C0BA 1MZEA 4F8AA 4Y5TA 5C9AC 4JTNA 4IV3C 3VBUA 5FXWA 4WVMA 4YW2A 1EUUA 3ABZA 3GYDA 4R9CA 4IV1A 3OGVA 3M70A 4AQ6A 1CX1A 1YLLA 3WNLA 4XURA 1C1LA 1S0FA 2JE8A 2WKKA 1NA1B 3C2UA 4P9JA 1LB2A 4BQ4A 4XFGA 1FXZA 1SPPA 1HQLA 3WY6A 1AF9A 2Q8OA 5JXJA 3H8RA 1KFXL 1QGLA 2YDEA 1W9YA 4LK7A 4META 5F5QA 1SLBA 4KWLA 4LTAA 4NHKA 4AHYA 1LOBA 2XLAA 3PJQA 2X5IB 5M0TA 3CIHA 1CX4A 1XE7A 4XF0A 4B29A 3WD5A 5F9TA 1E5IA 2EIEA 4YRDA 4W65A 3FC0A 3DECA 4JRAA 4JX0A 5H9SA 1RUE2 4XZUG 3I3QA 1AXKA 1A78A 1QDCA 3GZAA 3HQXA 5DG2A 3AL5A 3WQ1A 3DN7A 4W4ZA 2UU8A 1XQNA 3ACGA 1BKZA 3LFIA 4HVRA 4PF1A 1N1YA 1PIV3 4DIQA 4EN8B 4BOWA 1AL22 3RS6A 3ZFGB 4E4DX 3IAPA 4CPBD 2B7YA 3RWNA 5CYYA 4AVAA 3S7EA 4NOTA 3KT4A 2VVDA 4M3CA 3ZYFA 3LPGA 3AM2A 3ZSEA 2C26A 5A3NA 3ZO0B 5I8SA 2PAEA 1W8TA 4RGAA 1AR61 4CDWC 2B45X 1QJZA 4INDA 1HX6A 1D2SA 1V6LA 3CU7A 3LKJA 3Q9OA 4QPIA 5T5JA 3HPNA 5IT6A 5FLHA 5JZGB 2IXLA 4MZUA 4NAOA 5C70A 2WL1A 4WZCA 2VOVA 2WQ4A 2W1SA 4Q8KA 3N4MA 5GKAC 4QKFA 5FV3A 5BY5A 5IYYA 2A70A 1DFQA 2R041 1HB4A 4WM7A 1JTZX 1OKQA 2EALA 4FOVA 4MGYE 4S2DA 1GNHA 4IGPA 5D2AA 5FZGA 3R6SA 4C0HA 3KZ4C 1XU1A 4HSJA 1VALA 3WOGA 2FMYA 2IXJA 5KHKA 4COUA 2B4KA 4DXTA 4HKOA 2QFEA 4DZGA 1JYCA 1RUJ1 2VCBA 3WF0A 2JIJA 3EJKA 4L99A 4HK9A 3GZTB 1K3IA 2HEYF 4K40A 4K1YA 4CUAA 4ARXA 3PIJA 2YFZA 5FMBA 3JZVA 1QKQA 2QCSB 5A70A 5E89A 3GGLA 2Y33A 2GN7A 4QX0A 5EZWA 4WZFA 5FCCA 4W6YA 4YWAA 1RHI2 1H30A 4MGIE 1ULEA 4MGTA 1OD3A 4AFDA 5EPAA 3PLQA 1DGRN 3SCGA 1LU1A 1E5HA 2OPKA 1IKPA 2GC3A 2VW2A 4DFSA 3PMEA 3C7HA 1N47A 1TQ5A 2G9ZA 2H0BA 3T0DA 1CPMA 3B3QE 3MW4A 3MIHA 5F6KA 4BM8A 1HV0A 4XE9A 1W0NA 2HWD3 4N8MA 2VY0A 2E53A 2PA7A 2XUEA 4LO7A 2JJ6A 3RPQA 3WP6A 4A3XA 2WBKA 4YM0A 2DF7A 1FPN2 4XJ8A 4D69A 5L36A 5LW9A 3BKZA 2PHUA 2FDIA 1LESA 5AC91 1MS0A 1UZVA 3AYAA 1OF4A 2RS32 1I5PA 3C7FA 4ASKA 4OUMA 2Q1FA 2ZX3A 1JI6A 3D3AA 2HBTA 1IS4A 1AX0A 1QU0A 4FP2A 2ENRA 3GZUC 3RVHA 3POWA 3WG4A 1XU2A 4E4HA 4XUTA 4FCAA 2VZUA 2JDAA 4Y1VA 1PM7A 2A3YA 5A33A 2VUAA 2WFPA 1ZBA2 1SFNA 1AJKA 2D6KA 3ACHA 3VKMA 3K75B 1RIRA 2I74A 1F2NA 2VL4A 1SBEA 1FX5A 4N53B 3VL9A 3WW3A 4PI2A 2RM21 2DCYA 4KQ7A 1JBCA 1AR83 1VAKA 3WHUA 4CDUA 1R64A 2GP5A 1CJPA 3BOPA 3M3CA 2YU2A 4YGEA 4GH4A 2QQPA 1US2A 2E6VA 1UMIA 2IFWA 4Q4X2 4PIXA 3O1SA 3ZX7A 4BIFA 5CBLA 1MVQA 1X7NA 3BPSA 3NQHA 3RWKX 1JZ4A 4DEVA 3SH4A 2R49A 3AZVA 4FOYA 5APAA 1F15A 1LGBA 3LA2A 4AVTA 2KXLA 3HT2A 1Q43A 4JGZB 5I0UA 3VZLA 4Q4Y3 1RTVA 2E7AA 1ZA4A 2YV8A 3KMHA 1ODMA 3H1MA 1O7FA 2VULA 4AQSA 4B1MA 4RFRB 1RUC1 4JDOA 1JUIA 1LU2A 2DUQA 3KF3A 2CDOA 1FAYA 3JD72 4B8EA 1W0OA 2WC2A 5A3UA 1JZ6A 3ZYPA 2W52A 4COWA 1LEMA 4RGGA 1U5IA 5J96B 3PVOA 2K2SA 3AKSA 2BNOA 4XTMA 3KT7A 1ZRCA 5I8YA 1Y9GA 2EXKA 1QY4A 1HRV2 4Q0QA 4XAEA 4O9GA 3GBWA 4IE6A 2N7GA 4HFSA 3AP5A 3E5QA 2V73A 2XR4A 4ZY9A 4LJHA 2NM1A 2OZ6A 3CNAA 5A80A 2P6HA 5JZGA 4GD4A 2GH8A 1JZ2A 2DVFA 5A3LA 3OOXA 4CP1A 2NP0A 1N1SA 2GNBA 4UYBA 3OBTA 5I0SA 4FP3A 3TYJA 4QB2A 4XFHA 1VMHA 1W6NA 3ELNA 2D6PA 3BPZA 2VXJA 4MADA 2DURA 1Z78A 2R16A 1PZ8A 2O0OA 4PCRA 5KXDA 1KS4A 3A0KA 1OOPC 5GZDA 2AACA 1VAVA 1ENQA 1RUG2 2WR9A 3E5UA 5T54A 3ZOIA 5JMCA 1EAH3 4QKDA 3ZIWA 4XW3A 4L92A 3GJBA 4U2AA 3NJZA 1FMD3 3FHQA 4AEKA 2WN2A 5A3PA 2VZRA 5BNPB 2HWF1 2MEV1 3N9QA 1SG3A 1GLHA 2IC1A 3H3LA 4O61A 1T2XA 4Z2AA 1JW6A 4L2NA 2PTMA 1N1VA 3CJXA 1AHSA 2FDJA 1PO11 4Q4W1 2D3RA 5FY4A 3WW4A 4QXHA 2PHRA 3VBRA 4GWNA 3VL8A 4SLIA 2H6CA 4GB33 2JKBA 2VBBA 1RUD2 5IVBA 4Q2FA 3B93A 1T6GC 2NN8A 4MV2A 4URTA 1HW5A 3O1UA 5BNOA 1W8HA 4QU2A 4AI1A 4E4ZA 2ARCA 4CEWC 4BDVB 1ND2B 2XHNA 1S0DA 2HBUA 1BXHA 4FVVA 4NIAA 3RZZA 5AVAA 5LBBA 2HWC1 2RDSA 1YJLA 1ZBE3 4RR3C 2R32A 1JOJA 1S0CA 4MGSA 3U4XA 5CA6A 4L97A 3OGRA 4Y20B 3VDBA 3INAA 1SACA 3D82A 3MYXA 3OJBA 4QPYA 3U14A 1YXWA 3MIEA 2WO1A 4GZ9A 4AYUA 1O3TA 5A32B 4YM2A 1HXS1 2WS91 3HNMA 1H2NA 5F3CA 1LOFC 3BB6A 3ZFFC 3KCCA 5LCWL 3Q8BA 5JDBA 4D7SA 5IVCA 3ETPA 4AI0A 4FTSA 3D0JA 1KS5A 4WM8A 4XIOA 1G9AA 4ZXEA 1MZ5A 3MBWA 3NV2A 3WNNA 1MVEA 4LO6B 4IEXA 5AFEA 2VM9A 2EAAA 4EV0A 3SCHA 5KC5A 4QX8A 2VMHA 1R091 1H9PA 4IV3A 2Q8DA 2W39A 1LHVA 3KLSA 4WBBA 4HONA 5DPNA 1A8DA 1IZ3A 3S57A 1W05A 2BEOA 3OD4A 4P5HA 2EXHA 5DUXA 2XJPA 4L11A 3W59A 1YFUA 1AR62 4AZZA 5SV8A 5FUPA 3AYCA 1ND3B 4NRPA 5DMYA 1XBFA 1TNFA 2RR13 3I49A 4KWKA 4EJRA 4IE5A 1VBE1 4AEJA 4LKDA 3P6BA 2PQSA 2XVKA 3J7NA 2PFWA 1ZRRA 2RMU1 4I3PA 5A7WB 1WA4A 4QXKA 4TZDA 1ZNPA 1Q8OA 5GLTA 3WG2A 2ET7A 3L2HA 5FP7A 4HZFA 4OMCA 4AI2A 1V6OA 2IFRA 3I97A 1JYTA 2WT0A 1OVPA 2HH9A 1RUJ2 2XLGA 3DKWA 3MF6A 4HANA 1QJX1 3LEMA 3AJYA 3NNGA 2QKDA 3VD7A 1VBD3 1GQHA 3POJA 2A75A 1FV2A 1YQ2A 2UWBA 2LALA 4Y3OA 3NMBA 4XFIA 4YZ1A 2H6BA 1SLIA 2WNVC 3K77A 3NJYA 4RD7A 3OY8B 5IFTA 3MLJA 5EHDA 5L73A 1VP6A 5LWBA 3G6JB 2JIGA 2PHXA 1D2QA 1TMF1 4H7MA 4P9YA 1UXZA 4RGKA 1QH7A 1UN1A 3J7LA 4WVZA 3UV9A 4BHPA 4PLNA 1DF0A 2YBKA 4FO9A 5KHIA 4BMEA 3ZFEB 3RZLA 1FI2A 5E1RA 2ZA9A 2JDPA 5K8SA 1W6QA 1LULA 4EE2A 2XL9A 3WF3A 4YGCA 4UFIA 4IDZA 5F8PA 5AC92 5ANNA 4IEZA 3W9AA 3O1OA 3THDA 4Y22A 3WDUA 1H4HA 3AZXA 1G8WA 3T4HB 1PZ9A 2ZHKA 1DQ6A 1Z0HA 2FHRA 3VHRA 3FE5A 4DPNA 5JI9A 1UYYA 2J1RA 2ZGUA 1K42A 1GV9A 1YC61 5ACA2 2XQXA 3OCPA 4ZHNA 3T0BA 2ZBJA 2D5HA 3VBUC 3JQXA 4IV1C 1KJRA 4DXZA 3DYOA 4NIGA 2A6YA 5CKMA 2ZEWA 3N9LA 4V2VA 3WQBA 1GICA 5JR2A 3DGTA 1B35B 2LM3A 4JQRA 3OEAA 5JMOA 5LY1A 1G9DA 5D8AA 2RM22 5CFDA 4FFIA 3ZN6B 3FUOA 1PO23 3WQ7A 1W0PA 2HWE1 4KGGA 5FP9A 5FZOA 3ZLIA 3IWZA 1O4YA 1U0AA 3TNPB 4F3JA 1JHNA 3KS7A 4JTOA 1PVC1 2YBSA 5FLIA 4OI0A 1YYNA 5BNQA 2XDVA 3VKOA 2BU9A 2ZX1A 2CAVA 3J9SA 1VAMA 4M4RA 5FY9A 4KMQA 2BYVE 2GALA 5DZGA 4AK3A 3AKPA 2W2IA 3K4AA 1ZX5A 4OUEA 1A34A 4XDPA 1UMZA 1GZCA 5KHGA 3J26N 4NRQA 1Y9QA 4GWIA 4HLTA 3AP6A 4XF9A 4YVWA 1RUC2 1MEC1 5FDBA 5IK7A 1ULOA 2CWMA 3UETA 5DDJ3 2OIIA 3VBHB 3IAQA 2MNGA 1WGPA 3ZN4A 3I2OA 4LPLA 2JECA 1EV11 1Q8SA 1VBB1 4CPBA 3EYPA 1FOD3 3NO8A 2GU9A 5EQUA 4CCDA 2B8MA 4X8PA 4EYUA 3WNPA 4GJYA 3O1TA 2XMLA 3DKQA 4RHV3 4D6QA 3UKNA 4WM7C 1IPSA 1DYOA 4XXPA 2JDKA 5C3PA 5CB7A 4AHWA 1NCQB 3WNXA 1S1AA 1J1LA 1JOPA 2Y0IA 4QHOA 4TWTA 5F1RA 4Q5OA 2BWCA 3HT1A 4AHXA 1AR71 1GP6A 1XPWA 4N7IA 1AX2A 4CEYB 3KV9A 3QH7A 4AGGA 1QJU3 1QJY1 1RMU1 2GSYA 3H9AA 4M0HA 5FY5A 4AEDA 1LJ7A 3VBSA 1W2OA 5FQ0A 3I3MA 1R083 3DF0A 3VD4A 1I6XA 4B7KA 1ULPA 3C3VA 5B4NA 4Y1UA 1Y4WA 1LHNA 1BEV3 5FZ8A 2UURA 2HWF2 1RL3A 3FZ3A 2ZX4A 2MEV2 3NNMA 4P5YA 5FWEA 3O1MA 1LOAA 4XMIA 2Y0OA 3B5LB 5FZEA 4UF0B 1PO12 1AYM3 4Q4W2 4YZ4A 5F32A 4NE9A 4D7TA 3BYWA 2L9LA 1NQJA 4N7UA 2YB7A 5ABJA 4BYYA 4S2HA 3HVDA 4XVHA 2DU1A 2WO3A 4U36A 1GUIA 5J09A 1NY71 5C3RA 4E9KA 2WUHA 3E6DA 5CISA 2VD7A 3D5OA 1RUF3 2ZPXA 1BCXA 1PVXA 4LBLA 3PUSA 4LUMA 2VVEA 1IPKA 1OOPA 3WF2A 4MLOA 5FO7B 2V4AA 4R9BA 2DCJA 1LOEA 4LBQB 3SEEA 2WWJA 2YUEA 2WA4A 1VMFA 2HWC2 2OT7A 1MZ6A 3KT1A 4ORFA 3LB9A 4LQRA 1PK6B 2YMZA 1X36A 4HKLA 4ZU4A 3VD3A 1G9CA 2C5DA 2R063 4RS5A 4X6RB 5FZ9A 1HLCA 4CCMA 4RA0A 5C3OA 4NR1A 2JDYA 4PI0A 1HXS2 3KV6A 4LO5B 2CL2A 2WS92 4Q0PA 3HNBM 4E27A 3UGFA 3DEMA 4EN6B 4MVTA 2JG8A 2VMEA 3UNPA 4CDUC 1WMEA 2WNUA 2WRAA 4CCOA 4QX3A 3E5XA 5F39A 4AGRA 4QU1A 2WFF3 4W6XA 5D21A 2VTFA 3AMMA 1NXD1 2YFUA 4D7YA 4EQVA 2BUKA 1KXGA 1R092 1XYNA 2AH2A 4CU7A 3ZMNA 1NOVA 1WMDA 2QDRA 3GDBA 4I30A 3N7KA 4MGZE 4XJ9A 4E2GA 4NIDA 2HWB3 3R0RA 2GZWA 4O7XA 5FYIA 1NLSA 1WW6A 4LBMA 3IIAA 3EBRA 3POIA 3IIIA 4RQPA 3U10A 2J7MA 2GC1A 1C8M3 1PIV1 2YHJA 1RUNA 4CU8A 4N43C 1PX4A 1UX6A 1BBT1 4NVPA 3W58A 3I54A 1JODA 4AGVA 4CVUA 1OPOA 2NZ9A 1Q8PA 2JD9A 4QQLA 1MS1A 1PHMA 1VBE2 3ZPYA 3V64A 2QE3A 1DQ4A 3PUHA 4YW1A 3C7OA 4FPKA 5T52A 2NMOA 2RMU2 3F95A 4IE0A 4K6BA 4LK6A 3TRSB 2E51A 1XNBA 3VDDA 2G4IA 2QQWA 4BCUA 4KNCA 2PLV3 3D6EA 3LSEA 2X09A 4I02A 4CXYA 5I93A 2ZEYA 3AXDA 3DUIA 3KV4A 1QJX2 4RFT0 4LKEA 1O8PA 1VBC3 3FMGA 1GANA 5JZGC 3AKQA 5A6QA 1CZTA 3Q8FA 4PT6A 5LA9A 1UY3A 2JENA 2YU1A 4LHSA 1C3HA 3CLPA 5A7PA 3LEIA 4P9IA 2P1BA 1JYIA 2PMWB 3OGJA 1RUI3 3A0NA 3VKNA 1WMXA 5FZ1A 2PHTA 4I3GA 3SQOA 5J7MA 4FQ4A 1F31A 1GZ9A 3NV3A 3JB8A 3O0VA 4XQDA 1W28A 1SDDB 1TMF2 1YQ8A 2IXIA 2XWBB 3NAPB 4QM9A 5FXXA 3MIFA 3BCWA 3O5SA 2GNTA 2PYTA 4CU6A 1K5MB 2Y38A 1QXJA 3OYWA 3SCFA 1TG7A 1G9FA 1D4VB 1CVNA 3RJ2X 1SBFA 2ZEXA 3LD8A 3CMGA 1LRHA 5A3TA 1VBA1 3MIDA 3J4UH 4O9EA 4EWDA 5IAXA 1YHFA 1UD1A 3POSA 4KU8A 5FY1A 5A3WA 5IHRA 2ORXA 2F17A 1XC6A 5CVRA 2VMFA 5FZLA 3AKTA 3VBRC 1HQWA 2DVGA 3OEBA 4I01A 4P14A 3K46A 1RUE3 1ZZBA 2Y60A 2VU9A 5IFPA 3ZXAC 4QHBA 3N9PA 5H9PA 1QF3A 1DG6A 2C0ZA 1W9WA 5BNOC 2G1MA 4DEQA 3KQRA 4HN1A 4GA9A 3BTXA 3B01A 1WD4A 4KH9A 2AGSA 2YG0A 1MQTB 2P2KA 2C9KA 1GZWA 2D40A 4BQ5A 1JYWA 4OULA 5LZ6A 5IWFA 4E2QA 4GMP3 2J42A 1UF2C 1OUSA 2AYHA 2HEVF 2IUWA 4Q4V1 4FTEA 2OXBA 5IUQA 2FCTA 2HWE2 5DUUA 1W3VA 1NA1A 2RDRA 3IB3A 3PNAA 2CSGA 3QBQA 4FPGA 4XCBA 4Y4YA 2VUCA 1V6MA 3VZKA 1KQRA 1PVC2 4CDQB 3V0BB 3MFAA 3ZXJA 2PQQA 1DQ1A 1FNZA 5FY0A 1OI6A 4IEYA 3WF1A 4M4PA 2ZGNA 2K9ZA 4WM8C 1SEFA 4JZRA 4NUBA 2P3IA 3S7IA 2BNMA 3B00A 5H9QA 4LORA 4RSUA 3LEGA 3APBA 3MICA 4Q0UA 4GMP0 1MEC2 2DFBA 2FDKA 3ZFGA 3RZJA 5A1LA 2B9VA 5FTTC 1I9RA 2BERA 1W2UA 2BTVC 1W8NA 3B02A 3BVCA 4Q4Y1 2IZWA 4EWEA 3AK0A 1EV12 1LGNA 1VBB2 5L9BA 4XUQA 5L7OB 2BGOA 5LBEA 4QPGB 3BIEA 3K2OA 3C7GA 2HLEA 4P9WA 1FNYA 4IEUA 3MW3A 3VLBB 2PAMA 2X10A 5BUVA 3OBRA 1I3HA 1W8WA 2FCVA 2WZR1 1LHOA 1BYHA 3BTAA 1HN1A 1NKGA 1S0EA 2ZGLA 2VZSA 3WR0A 1GP5A 2GNMA 1AR72 5DUVA 3FWEA 4A6SA 5C4WB 4IETA 5AFBA 3TEZA 2A73B 2JDNA 1QJY2 1RMU2 1HKDA 2Y6HA 2HJIA 3I7DA 3T1LA 4BK5A 5J1XA 4LBKA 4EZHA 3O0WA 2ZEZA 4OLLA 2QJVA 3PVEA 1DLCA 1L7QA 4UFMA 2W9XA 1OD5A 1LR5A 2PXJA 2ZACA 3PU3A 3QH6A 3R4DB 4MOAA 3WXPA 3W5NA 4JVAA 3NWKA 3ITQA 5E6HA 3I2KA 4PBOA 1YIFA 4H3WA 4QB6A 3HJRA 2WZEA 2XB6C 4G9SB 5CFCB 2VOKA 3DV8A 4A42A 3POGA 1ZBA3 2F4PA 1ZZ6A 5JXHA 5FYTA 3WUDA 2E32A 3E1F1 1C1FA 1ZA7A 4LR4A 1H8TC 3R05A 3ZXDA 1UPIA 3H8OA 1W6MB 2FZ1A 3I3EA 1EAH1 2IXCA 3T0AA 4EZ4A 2BOJA 3A23A 1WLWA 2ET1A 4B3NA 1NY72 2ZZQA 4Q4X3 3M3OA 5CADA 3WW1A 4R8HA 4DUXA 3PTYA 4HETA 4JHZA 4QDRA 4LBQD 2KA3A 4ZZ8A 4MH0E 1KRIA 2R071 3OBAA 4K8FA 4Y5SA 2HYKA 1RUH1 4DUVA 4J1XA 2ATFA 3IDBB 4GB31 5JSOA 5I8TA 4AFCA 4RN5A 4PJYA 5CAZA 1HV1A 1CIYA 4MXWB 2Y6LA 3CZJA 3WNMA 3SXWA 3N9OA 2CWSA 3VKFC 2B5HA 4V2WA 3UYJA 2DCTA 5HCFA 2RDQA 4LIVA 2JD4A 3VBOB 5D8AC 4QPIB 5CFDC 1W99A 4HPKB 4NWWA 5BNNB 3D0SA 4N53A 1W6PB 1S0IA 5F3GA 3UT0A 2QQKA 3NKTA 3ZYJB 4ES8A 1GWLA 2P3YA 5GJ6A 1HIXA 3HNYM 4LBNA 3OPZA 2TBVA 1E57A 4XFBA 3UJQA 2R30A 4ZU7A 5G05L 2DBIA 1S2BA 3P3NA 3Q8CA 4Y24A 5IW0A 1GYKA 4IE7A 3UJOA 1YUDA 3RZMA 4CCEA 5IK5A 2XPJA 3POFA 2W87A 1PIV2 5ACA1 2WWSA 3E97A 5GLUA 1TEIA 3AVSA 3RGBA 4ASLA 4BMBA 1BBT2 1TME3 5DQ0A 1GOHA 4YVWC 2QQVA 4JDMA 4JGZA 2CNAA 4XXAA 4COVA 3EHKA 1URXA 3GZEA 4Q26A 2DYCA 1XNDA 1NT0A 1JOBA 4BQ2A 3RI8A 1W8OA 4AF9A 3ZDSA 4KWJA 3GALA 5IVFA 1CZVA 4FFHA 2D3SA 1U5YA 1GFF2 4LOSA 3AP4A 5BXXA 1RUG3 2BZDA 5C6CA 3LOBA 4CCNA 1X82A 4AAXA 1COV3 2RVAA 1LAJA 4Y1ZA 4OI2A 4URAA 1HJFA 1HN0A 1OH3A 1RVF1 2YY1A 3MIBA 2RR11 1MZFA 2UYAA 2D5FA 4GAZA 4QD2A 5LY2A 5CG8A 3IN9A 1CONA 4XACA 1KDKA 3UL2A 4OZXA 4Y4RA 4AEMA 5FP3A 5E16A 2BW8A 1VB2A 4K3UA 1M06G 4Y5Z0 1QEXA 1YI9A 2WAAA 4HK8A 4N43A 2ZAHA 1STMA 2AEYA 3LDBA 1GNYA 1SLAA 2RV9A 2DTYA 4LO4B 1D4M1 5DXDA 3RMYA 2WO2A 3MO4A 4AEDC 3VBSC 4ET7A 2MPFA 1VBD1 2E7QA 2DUPA 5FY8A 5IK4A 1UIKA 5T55A 1FT9A 4OHVA 3MPPG 1WBFA 5FOJB 1HB3A 2QQJA 1QXPA 2Z42A 3A21A 1HQNA 1DLLA 3IMMA 3LF7A 2P3KA 2VNRA 1JZ3A 1SBDA 4KG0A 3WX5A 2RE9A 3DPRB 3FHIB 3AYEA 3IDAA 3NV4A 4QKNA 1UY0A 2FQPA 1VBA2 3HR9A 3LDKA 5EV7A 5F37A 1MACA 2JX9A 3MIGA 1CZSA 3O1RA 1ULCA 5TSWA 5LRRA 3O7OA 1CESA 2VZ3A 3LA3A 4GH4B 2Y26A 5BNPA 1G7YA 3H50A 4CDXB 5ABJC 1Y7BA 5A7SA 1CAUB 2ORZA 1H2KA 3W20A 5C8CB 3KHBA 4YW7A 2JXAA 4ISRA 5C5UA 2EXJA 1UZYA 2ZTNA 4ES9A 1ZZCA 4QGNA 5ANQA 5FZDA 4ZXKA 1NCRB 3OGSA 4LOTA 4A3ZA 3IBMA 4BIOA 1EPWA 4LHLA 3VBFB 2JDHA 3IM0A 4C8DA 1H1MA 3A22A 3F2ZA 3I2IA 3LGRA 3RJRA 1V6IA 3PUIA 1HRI1 3EMRA 4X8NA 4Q4V2 2Z69A 3BOWA 4DY5A 1ND2A 1WMFA 2Z5WA 5C3SA 4RS5C 4XPVA 2YPDA 3RFRA 2P37A 4XAAA 2D97A 5EJ3A 4FPHA 4Y20A 4YFWA 1JMUB 2XVLA 3TAYA 2GDFA 3KSCA 3QACA 2JG8C 4AXOA 3VB9A 1UKRA 2WNUC 5A32A 2R043 1POV3 3HD8B 3RI9A 1PO21 2F6BA 1JU3A 4B4QA 3WDXA 5KWRA 4CZSA 2JG9C 4K9SA 1ULDA 2RDNA 3ZXKA 2VC9A 2DTWA 3TNQA 3LWCA 2ARBA 2LROA 3KF5A 3PUQA 3FUQA 1AYN1 4J25A 2DV9A 1LEDA 2ID4A 4D3WA 3TEYA 5J48A 1WW4A 1OA2A 3HIFA 1O59A 3BALA 2QDNA 1CAWB 1NAEA 1ZYBA 2VO5A 4QWNA 4RQPC 5A7OA 5FZ0A 4Q4Y2 1W9SA 2H0VA 1YFXA 4FPJA 1QQP1 1V9U1 3ZXLA 4QX1A 3USUB 1YCIA 3Q8AA 5EYXA 3H0OA 2IVJA 1AR91 5FYCA 1NZCA 4XQ4A 2ZXQA 4DRVA 1PZ7A 4B1LA 4QQPA 4GKYA 2W08A 5CEHA 2WQZC 5K9YA 1ND3A 2EVXA 3GM8A 1A6CA 2V5YA 2WZR2 4S2FA 4GULA 3VDDC 3LEKA 4S2GA 2CY6A 2WWUA 3NAPC 4IQPA 1DIWA 1FOD1 1WCDJ 3H7YA 4JGYB 3GCXA 2Y34A 5A7WA 1V00A 4A6OA 2BRTA 4B4RA 4CP9B 5K0UB 1VJ2A 1UKGA 4OCTA 1R1A3 3OD0A 2A3XA 4PDWC 2X8KA 4RHV1 4AFBA 1ASJ3 2XJRA 4C91A 4V1PA 3IMNA 4DY3A 2ZGTA 1DZQA 1UOFA 1ULFA 4MYEA 4OYUA 1GNZA 3V56A 4CCKA 3GHMA 3TN91 1H8VA 5JSRA 4I2OA 4PQ9A 1GQGA 4KBZA 4AQTA 1BK0A 1O4ZA 2DWRA 3ACLA 4JKLA 1UY4A 1JYVA 1HJGA 3DXTA 3OY8A 2JEMA 1R081 4OHXA 3PHMA 3GNEA 2D44A 1EAH2 2X29A 1UU6A 1UY1A 5I0RA 3DL3A 1J3RA 2O1QA 4FPFA 3C7EA 2ZJCA 4ISQA 4Q29A 4OQ9A 2SBAA 1H4GA 2HEWF 1BEV1 4PBPA 3ZFEA 3ST7A 4CUCA 1EY2A 1VRH3 2OQ6A 1VB4A 2VNVA 1N3PA 4CP2A 4ATFA 1AYM1 4AI3A 2R072 1ODNA 1RUH2 4UI9L 3KCYA 3J8F1 5C9AB 4GB32 1LOGA 4IV3B 4DXRA 4UWDA 2ARXA 4F7ZA 2EAKA 2W1WA 4C90A 4FFFA 3LSDA 2AREA 1YI7A 1OLRA 2GAUA 3MGUA 4CCJA 3MV11 1H8TA 1H6XA 5BPXA 3B7MA 5JPMB 3NVCA 2KD7A 2YC4A 4HVQA 2BBVA 5LRSA 4XUNA 1I5ZA 3AMNA 3LIGA 3JXSA 1GBGA 1NA1C 1WD3A 2IWGB 1W6OB 5FZCA 4EWAA 2XKOA 1B35A 1NQDA 1YO8A 4R9AA 2J1SA 1O3QA 1WCUA 2YROA 4KGQA 3ZN6A 2VZQA 1IS5A 2PHLA 5C5TA 2D93A 4D94A 1YWKA 5DAPA 2X5IC 1N3QA 3JBG3 4ONUA 5FAXA 3HOBA 2GMPA 1NG0A 4HG6B 4UBHA 2E63A 4XBNA 1JH5A 3IPVB 2XBO3 4FFGA 5GLZA 5DAXA 3USSA 2VE1A 3CZUA 4H2AA 2BFUL 3AFGA 3NSTA 4AR2A 3ZFGC 2HWB1 5FUNA 4CDWB 4DQAA 4L0PA 5FZAA 3EXUA 3B94A 4KWUA 5F7UA 2EA7A 1US3A 3KCXA 5T5LA 2VBDA 5C4WC 2J1AA 3QD6A 4CUBA 2DVDA 1A3KA 1W39A 5FO8B 2YYOA 1UOGA 4FPCA 4UOJA 5L9VA 2ZGOA 3VBHA 2XJUA 2GC2A 5SV5A 4RYDA 3U0ZA 1IQDC 3S6PA 1RVF2 3JUUA 2RR12 5A7QA 2NLRA 2MEV3 2R6QA 4D6SA 5FRAA 2Z4FA 4EN0A 1YQ5A 4KBBA 2OX0A 2VOXA 1WCSA 1PO13 1ZRFA 2J1UA 2WDBA 4FOQA 5IVYA 4XDQA 1EP0A 2PLV1 5FP8A 4Y22B 1YFYA 3HMYA 2C6SA 2PN5A 1SLLA 1SMVA 3RSJA 1D4M2 3BU7A 3ORJA 1UYZA 2YBPA 1VBC1 1W04A 1MPXA 1SCSA 2Q4SA 1QNWA 1RYYA 1VBD2 2VUDA 3MPBA 4JQTA 4CEYA 3LPFA 4XJUA 5K7PA 4OQ8A 2ARAA 2WLQA 2V5DA 2VNGA 2RS53 5JIUA 1RUI1 1OUXA 3OPWA 5J37A 1HB1A 2WABA 3NJVA 5DG1A 4YW6A 3WSOA 4A7ZA 2QQIA 1OH4A 4LBJA 4QB1A 2WYFA 5KBFA 2VZTA 1OKOA 1AXYA 4LULA 1LHWA 2Q0AA 4YG3A 1DP0A 4IEOA 3X29B 4AVBA 3VHOA 4ZZ5A 5FYYA 5FO9B 2W0XA 4TN7A 3VDCA 5FIXA 1OHFA 5FP4A 4Z2WA 3HN3A 4UF0A 5E8AA 2RS11 1YFWA 2DVAA 3RQ0A 1N3OA 1GWKA 2OUJA 4CXWA 5EXOA 1R093 4JAAA 3OGGA 2XXZA 3UESA 3AZYA 5I91A 3R4UA 4PHZA 2FD8A 3TOJA 2A7AA 2ZKNA 3M3IA 1REFA 3QLQA 3I2HA 1CAXB 4MO3M 1HRI2 2CU5A 5DUWA 3U75A 4XJAA 2JWPA 4SBVA 4BU2A 4LBQA 3BN6A 4QDSA 2W92A 5EIYB 4L9BA 5IVJA 3A7QA 1DGLA 4NJ4A 1OLMA 4DS0A 4P08A 3GBGA 1ZRDA 1PK6A 2WT2A 2P3JA 1RJ8A 4GMP1 2BJSA 4NAMA 5EYYA 1XRUA 4N53C 2WT1A 2F4LA 1PO22 4YVSB 1Z7S1 4DNYA 2JICA 1LENA 5KXEA 2D3PA 1UYPA 3ES1A 5FK7A 4IGOA 2R7EB 1UL9A 4COZA 1OQDA 3ALQA 3M3EA 3LAGA 1G86A 1AYN2 1C5IA 5FYZA 3WZ1A 1XYOA 2ZOEB 1AVBA 3DYPA 4NPLA 3VUOA 4COYA 3SHRA 1LOCA 1U12A 3KGZA 1W8UA 1OSGA 1O6UA 4G3YC 3TEXA 2VG9A 4JC1A 1WCKA 2I07B 4AOCA 4CSWA 2WQ8A 1W2AX 3ILNA 3PL0A 4UFJA 5T5PA 1QQP2 1V9U2 1IHMA 2A71A 2XG3A 4CUGA 2C24A 2AZ5A 1OT5A 4JGZC 1C5HA 4Q0VA 1QH6A 4BISA 5HXVA 1AR92 3LCPA 1UYXA 1VMJA 5FYVA 1W03A 1YEWA 2UY8A 2WSUA 3N7LA 5A6XA 3MUZ1 1TMF3 3K3NA 4XILA 1CAVB 3V0AB 5J36A 2OPWA 4Z07A 5FOBB 4PF5A 2WLPA 3WG3A 4YSFA 3MW2A 4QX5A 3WG1A 3BTYA 1ZREA 2JG9A 2A6WA 3LIHA 2JDUA 4GALA 5EJ1B 1FOD2 3KB5A 1KDMA 5DAQA 3D8CA 2WA3A 4AFAA 1YRZA 2JKXA 4HKWA 5FPBA 2LW8A 1L3JA 4TLFA 1H1AA 3ACIA 1Q8VA 4RHV2 4XFAA 2AEZA 5CIRA 1TZOA 4ZU5A 5IAVA 4JHTA 5LK7B 2WZ8A 1IG3A 2P34A 1XNTA 4IEPA 1JUHA 1F4AA 1O8SA 1RINA 2CGNA 3AP9A 5FJKA 2BPA2 1MS5A 2Y6JA 2RJLA 3SLIA 1VLNA 2QBXA 2EXIA 1YIPA 1V6JA 3TN92 1OOPB 2EIDA 3RDIA 4YGDA 1O5LA 4XCAA 4ZS3A 5FZ7A 3ZKUA 4YZ2A 2ILMA 2ZGPA 2ZGQA 5LA2A 5F5IA 2FDGA 2NYYA 5FYUA 3U11A 1POQA 4DRRA 4Q8LA 3ZYBA 3I59A 1R082 2Q30A 3CKHA 3ZPOA 3AP7A 3NAPA 1BJQA 3P3PA 4XOGA 3LDRA 1K5MA 1D0HA 2UWAA 3ACFA 3S0MA 1BEV2 4Z82A 3O1PA 3NKGA 3JU9A 4NHMA 4PDWA 2CAUA 4UFLA 1K12A 4QM8A 4EROA 1JZ8A 5FYBA 1LECA 1H9WA 3VHNA 2FDFA 1E5RA 5BNPC 4QX7A 1AYM2 1QIQA 1AXZA 3NJXA 4XIKA 2WN3A 3ETQA 3IKWA 1P8JA 5CKQA 3J8F2 1XE8A 4B7EA 2Q1MA 2DDUA 2J1VA 4CEWB 1X33A 1OA4A 4Z8BA 1FATA 5GALA 4LBOA 3N7MA 2QVSB 4HXCA 3LZZA 4RR3B 2VMCA 4FXKB 4XJWA 1O4TA 1REDA 3A4UA 5LASA 1MEC3 3R4SA 1VRBA 2BGCA 3ILFA 2VJXA 1CWPA 2BFUS 3N3HA 1MQTA 1QDOA 1ND2C 2W5FA 1H6YA 4XC9A 1A8MA 1J83A 4A2UA 1O3SA 3ZFFB 3ES4A 4P9LA 3H42B 4KI5M 2R062 4QQOA 3B9CA 4YPJA 3H8UA 4M3CE 1IQAA 1H2MA 3ON7A 2C1FA 5A3MA 5JCTA 1RXFA 3RRDA 4HL0A 2HWD1 1NZIA 4I0AA 1SLCA 3S5QA 1HB2A 4BQXA 4UBGA 4CDQA 3V0BA 5CKNA 4NHXA 5J3UA 1W2TA 5L19A 1AL23 2YC2A 3CJIB 4KL1A 5LEJA 2ZABA 3T09A 1PM4A 3POEA 3RZHA 4A7YA 4K8RB 4UXAA 1AR73 5JUVA 4BZ4A 1Q3EA 4FTBA 2DUOA 4A44A 1RMU3 2HWB2 4XHBA 1OMIA 3T3YA 1DGRA 2CTVA 2RJKA 2ZHLA 4AL9A 3N35A 3LFMA 3NV1A 3POYA 5FWJA 1UZZA 1KJLA 1KFUL 2W1QA 3ILRA 1TME1 1REEA 1J59A 1UO9A 3ZYHA 2OZJA 2LUWA 3WEZA 1WUVA 2GH2A 4LUKA 3OYWB 4EN7B 5EP9A 3SKVA 3ZXEA 1Y3TA 1ZZ7A 2X05A 1ND3C 3K4DA 1AR81 3AB0A 2X5IA 1OC1A 2A3WA 5L9RA 1COV1 1DZTA 2CGOA 1NX9A 1UOJA 3ME2A 5FREA 4LA3A 1OLQA 3FLPA 2PLV2 3THCA 2B39A 4I0WB 5C71A 1X8EA 1U5XA 3I8TA 1ENRA 1VBC2 1F4HA 4IL7A 4DUWA 1D7PM 2WNVB 5FMDA 5C4WA 5C7GA 1LTEA 1QHDA 2VQTA 2GC0A 1RHI3 5FZFA 3JQWA 1RUI2 1IS6A 5JSPA 1NE4A 4J1WA 1QOTA 2ZHMA 4D0QA 5GM0A 1S0JA 5HCAA 5FKCA 4TLGA 4JKKA 1UU5A 2NMNA 3PUAA 4N9IA 4JV4A 3M7AA 4BPZA 1NUKA 1GQPA 1QOSA 1JZ5A 4FQZA 5HV4A 2XKPA 4N90A 1DQ2A 5GZGA 5CFCA 2XJVA 2D6MA 5FPLA 1WLTA 4Q1RA 5FLJA 3DXUA 1S55A 1FPN3 4NHLA 4MX3A 4AW7A 2VNOA 4QHZA 2RS12 3ZFEC 1W6MA 1WLCA 3OPTA 4YM1A 2FCUA 2RS33 2VMGA 1X9PA 5IJRA 3SITA 3TBDA 3ZN5A 1J3PA 4GXLA 4XDOA 1QOOA 3WP5A 2GP3A 1PMHX 5FZBA 3VZMA 2XLFA 2VCMA 3THPA 3VBUB 4AVVA 2GMMA 5FMOL 5B2GB 4IV1B 4W8JA 2Z2SB 3KQ4B 5FZHA 3FN9A 1BBT3 2LTNA 3GCWA 4QT6A 4AWDA 4I0BA 4NRMA 3RMXA 1SPPB 2ERFA 1Q56A 5DABA 4WVWA 5ISLA 4MXWA 4AI8A 3TWIA 1W3XA 3BTZA 1FMD1 4P9XA 4DB5A 3RZKA 1Z7S2 5LA0A 1B35C 3VBOA 2VGDA 3SEPA 3TEWA 4HPKA 4R4XA 5G04L 3MHZA 5BNNA 1ZVFA 1RXGA 2VZOA 1W6PA 4YGBA 2E26A 4FI9A 1DZRA 5CU1A 1KEXA 4H14A 5LBCA 1POV1 1UU4A 2XVGA 2CYFA 3MFCA 4PQQA 5FBJA 2OQ7A 3NNLA 2YC0A 2A6XA 4M3CB 4IXLA 1ZZ8A 4QGLA 5GLVA 4BQ3A 3N7JA 3T2TA 3S30A 4YFZA 4D6RA 4E2SA 5JOWA 3CDZB 1SFPA 3L2YA 3U37A 1KITA 4CTEA 4Q27A 3JD73 5HBAA 1O3RA 2AUYA 2G19A 1ZBE1 4AI9A 5FMCA 5FPZA 1DBNA 2RJ2A 3WHTA 4D8MA 4BK4A 5T3NA 1OQEA 1BLZA 3ZM8A 3WP4A 1GWMA 1JYNA 3W5MA 3VBHC 4KU7A 4WVMB 4WM7B 1X8MA 2ETEA 4K1ZA 5GZEA 4IEWA 1HRV3 2YGMA 3BI3A 5F2SA 4UFHA 1VBA3 4UW4A 4XF1A 4BXSV 4W6WA 4XFCA 4MSVA 2O8QA 3ENRA 5A6YA 2BVVA 3CEWA 3ECQA 2D98A 1ULGA 2YXSA 2Y6GA 2QNKA 4H55A 4TSVA 3AMPA 4IESA 1GZTA 3PVBB 3KV5A 4BLIA 4YG6A 4NPMA 1UZWA 1NCQC 3U1XA 1W90A 4BQYA 5HPOA 5E88A 1R1A1 2CDPA 1OFSA 4BE3A 5IATA 1IG0A 5IK8A 2FDHA 1ASJ1 4J6GA 2UYBA 4CEYC 3VD9A 3N9MA 4LNVA 3RYRA 5EJZB 4XYXA 3VBFC 2ZHNA 2D6NA 2ZMKA 2E33A 1BQPA 4R52A 2UWCA 3EB7A 2PAKA 4OI4A 4YLZA 1H2LA 2OA2A 2OS2A 3H3UA 2K46A 4Q4V3 4XJZA 2QQNA 1MS9A 5A6ZA 1UNBA 1M4WA 5JXIA 1OFNA 1SHWB 2FBEA 3LA7A 2B46X 5LK5A 2EICA 4LXLA 4NWVA 3DPRA 3E6BA 5KXBA 2W95A 4L8QA 4UW6A 4C1WA 1SQ4A 1XXNA 4QGMA 5JR7B 2W47A 3N36A 1RUD3 1BHGA 3M8LA 3S5AA 5CG9A 3NL1A 3ZIXA 2VW0A 3U4SA 4LHNA 4CDXA 1W9TA 1VRH1 2ZMLA 1CAUA 4HBNA 2JB8A 5T5OA 5KHJA 1W8FA 1ZRIA 4YVSC 2QTWB 3N9NA 5FXVA 2R1BA 3B69A 3VZOA 5C8CA 1JYXA 3SH3A 5KC6A 4K20A 5A33B 2VOTA 5HCBA 3VGIA 3MF9A 1NCRA 5F3EA 4YM3A 3AMQA 3WNKA 3T2QA 3VBFA 3EQEA 1RITA 3MV01 4XQWA 1CN1A 1ZZ9A 3WCRA 4AFMA 4TTGA 2CHHA 4CDUB 4IE4A 1PK6C 1DQ5A 4I09A 2VR4A 3O1VA 4NMIA 4LT5A 1ACCA 2HWD2 3OBZA 1CPNA 4IEVA 4GWMA 1RGSA 2ZGRA 2WZR3 4DMIA 3WDTA 3DYMA 3Q8EA 1WW5A 2XUMA 3K51A 2A6VA 1SCRA 2OKXA 2P17A 1QWRA 1XYPA 1OA3A 4NN0A 3T1MA 3CHXA 4N43B 1RB8G 2XGXA 5FUIA 5IVEA 2OYZA 1W06A 3JBG1 4UAPA 4BJ0A 3VHPA 4NPRA 4AHZA 4BH9A 3UKTA 4AVSA 1H0BA 4FOWA 3ZSMA 3H7JA 1AR63 2EIBA 3LE0A 2XBO1 3O12A 4CE8A 4DXSA 1CAWA 2A6ZA 3OUJA 1TME2 4XZPA 1PGL1 2G9FA 1SDWA 1PNFA 2VCAA 1S0GA 3CO2A 4P00B 3ZSJA 3GF6A 3USUA 1QJFA 3PU8A 3AX4A 1AR82 2XJSA 3JB4C 1XE0A 1TNRA 2V72A 2WAOA 3ZYIB 3ZXFA 4OZOA 1G6NA 4YG0A 1GSLA 2V4VA 1COV2 4P02B 2RG4A 4DINB 5CNAA 4C1XA 2R1DA 2JDMA 3FX3A 3KWVA 4FPOB 1RUJ3 4LIUA 4LLOA 1O91A 5EWSA 2E9QA 4TYSA 1MS4A 1MR5A 2VOWA 2XJTA 2AENA 4JGYA 4PLOA 2BV4A 1UPSA 4QQ2A 1WWYA 2ZAAA 5K0UA 4CP9A 2NQYA 1W6NB 2R073 3WDVA 1RUH3 3W21A 4K21A 4NIIA 1OF3A 1XNAA 2HKXA 2BDRA 2OUHA 4Q1PA 1SFYA 4XMAA 4YYOA 5JOZA 1J1TA 4ARYA 1UW8A 4LMFA 1UXXX 1LODA 1PGW1 5I0TA 1GOGA 1POV0 1C4RA 5FMOS 4XF3A 3I4IA 2V09A 4FAHA 5DDJ1 4XBLA 3T08A 3WVJA 1BVP1 1XB9A 5FZIA 4ZS2A 2PELA 4BQ1A 2JE7A 2ZMNA 5HV0A 1G9BA 2I45A 2RS51 4LLFA 2VQAA 4PIYA 4YNIA 1BMV1 1L7LA 1V70A 3CQOA 5C3QA 1OXCA 1K5MC 3UKVA 3WDWA 1T6BX 4AVCA 4JRLA 3VBRB 5AC93 4A41A 5F5AA 1Y9MA 1OPMA 1GKBA 5FYMA 1TVGA 2VQUA 2DCKA 3AMHA 4BXFA 4LKFA 2G9GA 5FK8A 1UX7A 3HBKA 5BNOB 2D43A 4Y1YA 2E31A 3ZXGA 4JDNA 4XUPA 5F3IA 4BB3A 3RZGA 1ENSA 3NRUA 5JXGA 5JIAA 1UCXA 5ACA3 1QJU1 5LATA 1H1IA 5FKBA 1W2NA 1DQ0A 5C9AA 5JOYA 3KHCA 3WW2A 4QAWA 3I3BA 4LEJA 3K4ZA 3ATGA 3NNFA 5BYNA 2VBPA 4FPEA 1S2KA 3CJIC 2ZKLA 3E6CC 1FYUA 1IS3A 2RM23 2VUJA 1MQTC 5FYHA 3GJAA 4E4SA 1KGYA 3AZWA 1FMD2 3QOPA 1DGWX 4MG2A 3T2PA 3T2OA 5KHHA 4ATEA 1AZDA 3ROUA 4DO0A 4WM8B 3IDEA 4OHYA 3WNOA 1RVF3 1S0BA 1W6OA 4YARA 1APNA 1I1EA 1PMJX 1NLQA 5KR7A 5DAVA 3AL6A 3MLLA 4R9DA 4CDQC 2R042 4JKMA 1AUYA 3H1YA 2OW4A 3SKJE 1DGWA 4XETA 5A7NA 5JPNB 3M1HA 1RUF1 4M0NA 3RYPA 2TUNA 1LNSA 2W68A 4HN0A 1RUC3 3KVAA 5LEKA 1IPJA 3IPVA 1D4M3 3ZYRA 3VV1A 3MEPA 2BBAA 1ZBE2 2BQPA 2O14A 4G4FA 4MGQA 4MHRA 2QQMA 2VZVA 5GZFA 1ZM1A 1F9KA 1IGOA 2KR2A 3HEIA 2XONA 4GQ7A 4GKXA 4OFGA 2TNFA 2R061 1HDKA 3HQUA 4CDWA 3RYKA 3IZOA 1F5JA 2BNNA 2PHDA 3OSDA 4E8DA 2HYXA 2XHKA 1MS8A 1R1ZA 4NHYA 4ASMB 1D0GA 1E5SA 5LA1A 5K4LA 4LHKA 5L7OC 4QPGC 5KXCA 4FAGA 2FMDA 2Y64A 2WFF1 3ASIA 2VZPA 2XOMA 3WDYA 2QUOA 4QQHA 1BVVA 2DU0A 3AC0A 3K48A 3UK9A 3WT3A 3ZYGA 3FBYA 4FXGB 5LB6A 3HBZA 2AC1A 4M3CF 5FZKA 3AKRA 2VW1A 1WW7A 3ZKYA 1J58A 2VZ1A 5FPUA 2P4EA 2QQOA 1R1A2 4TXWA 2WO7A 2XQRA 4NO4A 1ASJ2 1OLME 5DAWA 5BV6A 5FZMA 1C8M1 1YJKA 1PX3A 1UQXA 4HOOA 5FPAA 1X50A 3OTFA 2WYSA 5FR3A 1YQ6A 3FFQA 1Q8QA 5JI7A 3G7DA 3P5BA 1EPZA 1HRI3 2TEPA 3VD5A 2VTXJ 5JLVA 3PDQA 4ITCA 1H8TB 1VR3A 2HWF3 4W50A 3ZR6A 1CQ9A 4NROA 2ZGSA 4Q0SA 5FPVA 1S2EA 1RJ7A 1JXNA 4XF4A 5CFCC 1W6QB 3I3DA 4Q4W3 5FJHA 1MS3A 2J1TA 3ZDVA 3SNMA 2KM2A 4FBFA 1WLDA 2J22A 2JDZA 1JU4A 2XH6A 3KD4A 5T50A 4A7KA 5FY7A 2Q1ZB 4DOUA 3PIGA 1NCQA 1LHUA 3WUCA 3LQCA 1VRH2 4FT8A 4PIZA 3IDCB 1OVSA 1AYN3 3TB0A 1U5ZA 1QXRA 1OBNA 3RNSA 4O65A 3L9JT 1UAIA 3U78A 5FFOC 5CZKA 1BK1A 2ADEA 4E8CA 2HWC3 5JWPA 1XNKA 2BP6A 4EN9B 2IXKA 3FLTA 1DDLA 4Y33A 3GBFA 1BZWA 1QQP3 1V9U3 2EIGA 4CCCA 2ES3A 1PMIA 1LKNA 2VPVA 5D8AB 1CAXA 4XBQA 4QX2A 5CFDB 4P9GA 1HXS3 1AR93 3T4VA 1DU3D 2WS93 4XHXA 4Z92B 1GR3A 1PNGA 3WLUA 1W8ZA 2W94A 4YW5A 5FZOB 1AL0G 4MXVA 4CA9A 4QPWA 1CGPA 3ZMOA 4OHZA 5I0DA 3D4KA 3ZSKA 4MGKE 3IT8A 3VBOC 1AX1A
chains in the Genus database with same CATH topology
3O1SA 3I3QA 3RZHA 4IE7A 4NPLA 4NIDA 3RZMA 4O7XA 4NRQA 3T3YA 2FDKA 3S57A 3RZJA 3LFMA 4RFRB 3I2OA 3BIEA 4NRPA 3I49A 4IE5A 3BTYA 3BI3A 4IE0A 3O1TA 4QKFA 4CXYA 4IE6A 4JHTA 4OCTA 4QKBA 4QHOA 4NPMA 3H8XA 3BU0A 4NIIA 2FDHA 4ZS3A 3I3MA 2FDGA 4MGTA 4ZS2A 4QKDA 3BUCA 4NROA 4QKNA 3O1MA 3RZLA 3H8OA 3O1PA 4O61A 3O1RA 2FDFA 2FDJA 3BKZA 4IDZA 5F8PA 3S5AA 4NIHA 2FDIA 3O1OA 4CXWA 3KHBA 3RZGA 3T4HB 3O1UA 2FD8A 3BTXA 3KHCA 4ZHNA 4CXXA 4NRMA 4NIGA 3T4VA 5DABA 4NJ4A 2IUWA 4IE4A 3BTZA 4MG2A 3RZKA 3H8RA 3O1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1S A;  3I3Q A;  3RZH A;  4IE7 A;  4NPL A;  4NID A;  3RZM A;  4O7X A;  4NRQ A;  3T3Y A;  2FDK A;  3S57 A;  3RZJ A;  3LFM A;  4RFR B;  3I2O A;  3BIE A;  4NRP A;  3I49 A;  4IE5 A;  3BTY A;  3BI3 A;  4IE0 A;  3O1T A;  4QKF A;  4CXY A;  4IE6 A;  4JHT A;  4OCT A;  4QKB A;  4QHO A;  4NPM A;  3H8X A;  3BU0 A;  4NII A;  2FDH A;  4ZS3 A;  3I3M A;  2FDG A;  4MGT A;  4ZS2 A;  4QKD A;  3BUC A;  4NRO A;  4QKN A;  3O1M A;  3RZL A;  3H8O A;  3O1P A;  4O61 A;  3O1R A;  2FDF A;  2FDJ A;  3BKZ A;  4IDZ A;  5F8P A;  3S5A A;  4NIH A;  2FDI A;  3O1O A;  4CXW A;  3KHB A;  3RZG A;  3T4H B;  3O1U A;  2FD8 A;  3BTX A;  3KHC A;  4ZHN A;  4CXX A;  4NRM A;  4NIG A;  3T4V A;  5DAB A;  4NJ4 A;  2IUW A;  4IE4 A;  3BTZ A;  4MG2 A;  3RZK A;  3H8R A;  3O1V A; 
#chains in the Genus database with same CATH topology
 3O14 A;  4BA6 A;  2DCZ A;  4BLJ A;  3H3Z A;  4QPI C;  1XOY A;  1ALY A;  4UW5 A;  2VMI A;  5BNN C;  3P1I A;  5FZ6 A;  3ZR5 A;  4YVS A;  3KVB A;  2Z79 A;  5AVP A;  2W91 A;  1RUE 1;  1WCQ A;  2EF6 A;  5JOX A;  5DN2 A;  2CV6 A;  1K5J A;  1K45 A;  3WV6 A;  3JBG 2;  4YVW B;  3OB8 A;  1CIW A;  3HQR A;  1JHJ A;  4AQ2 A;  1AL2 1;  1F5F A;  3K3O A;  2XBO 2;  4LA2 A;  2VH9 A;  4AG4 A;  1C8N A;  4BWO A;  1XJA A;  3OF1 A;  3BIW E;  1W9F A;  1FV3 A;  1WBL A;  4XTP A;  3TN9 3;  1PGL 2;  1YQC A;  2YZ4 A;  3WIN E;  4JCK A;  3MUY 1;  1DHK B;  1V0A A;  1VBE 3;  2LRP A;  5FZ3 A;  2VEC A;  1QMJ A;  4ZPI A;  1NYW A;  2RMU 3;  5C8W A;  2R0F A;  1ENX A;  2QZ3 A;  2X53 S;  5F5C A;  2MHF A;  1L7R A;  1XSQ A;  3FFZ A;  3ZSL A;  2Q8C A;  2R0H A;  3T30 A;  3CBN A;  4QXB A;  3VZJ A;  1CAV A;  3V0A A;  4XFF A;  3BOD A;  3FHA A;  1VIW B;  1EYB A;  1QJX 3;  1C57 A;  2DVB A;  2RHP A;  1DCS A;  3I2D A;  2AR6 A;  4R4Z A;  1CR7 A;  5A3O A;  3RG0 A;  2DFC A;  3AXE A;  2ZX2 A;  1ONA A;  2B42 B;  3MLK A;  1GU3 A;  1Q5O A;  2Y6F A;  4FSJ A;  3KGL A;  1LCL A;  2VVF A;  4YZ5 A;  5ERL A;  1VE0 A;  3FBM A;  2ZZJ A;  3GXU A;  3OG2 A;  1ST8 A;  3FL7 A;  3J8F 3;  4AED B;  2PHF A;  3VBS B;  3H8X A;  4FPY A;  5FQ0 B;  5JVV A;  3FLR A;  1PGW 2;  3C8X A;  3KM5 A;  5D1I A;  2ZGK A;  4CCL A;  4F83 A;  3H1W A;  4XEZ A;  5DDJ 2;  1DYK A;  1WKY A;  2WIN B;  2BVB A;  4QXC A;  2UY9 A;  3PVN A;  2Y6K A;  2WJS A;  1RHI 1;  2RS5 2;  1NXM A;  4UT5 A;  2A1X A;  3BUC A;  1BMV 2;  2VMD A;  1UZ0 A;  4YW4 A;  4CRQ A;  5J98 B;  4B4P A;  2IVI B;  3WF4 A;  3PUR A;  2VXR A;  3WCS A;  1J84 A;  1F35 A;  2PHW A;  3NW4 A;  2E7T A;  5ABJ B;  4MHU A;  3DPR C;  1UOB A;  3AZZ A;  5FXZ A;  4YZ3 A;  5HXM A;  2XL7 A;  3VKL A;  4K7J A;  5FZ4 A;  4NIH A;  5F6L B;  5B4X A;  1FPN 1;  4M00 A;  5GLW A;  4ZKT B;  4GH4 C;  4CDX C;  4AE2 A;  3BGA A;  1DYP A;  4OVE A;  1QJU 2;  4Y26 A;  2NPI A;  1V6N A;  4HMZ A;  1RUO A;  2RS3 1;  1UY2 A;  5C33 A;  5C8C C;  4UW3 A;  2BGP A;  5JAX A;  5FPX A;  3MI8 A;  1UIJ A;  4CEW A;  1QJE A;  4CXX A;  2QZ2 A;  4RS5 B;  4Z1V A;  4BQW A;  4OUS A;  1NCR C;  4LE4 A;  4RR3 A;  1NLR A;  1V6K A;  2QQU A;  4IEQ A;  3U07 A;  1GOF A;  2HWE 3;  1OUR A;  3AYD A;  3AVR A;  4OI1 A;  3I2J A;  2Q8E A;  2VCC A;  1VPH A;  1ZBA 1;  4GWJ A;  3M4F A;  2JG8 B;  3SIS A;  1PVC 3;  2WNU B;  2J1E A;  1SLT A;  3POB A;  4N9H A;  4Y1X A;  2W3J A;  1LOF A;  4RL7 A;  3ZFF A;  3I2G A;  2JG9 B;  4LKS A;  1NE6 A;  1KD7 A;  4YW3 A;  3VZN A;  2VTX A;  1GMM A;  2I2S A;  3LOI A;  3HWJ A;  2A5Z A;  4Q4X 1;  1WA6 X;  4RQP B;  5GZC A;  3PJY A;  1RUF 2;  1XNC A;  2SLI A;  2GN3 A;  2ZCW A;  4XUO A;  2CGP A;  1IKQ A;  2GND A;  3SH5 A;  5HI0 A;  1EUT A;  1UWW A;  1J3Q A;  5LBF A;  4IUG A;  3CJI A;  2VQ0 A;  2B9U A;  4HVO A;  3UGG A;  1AJO A;  3OUI A;  1LGC A;  3CF6 E;  5FYS A;  5F2W A;  4UFK A;  3PTR B;  2JB4 A;  1EV1 3;  1VBB 3;  2C4X A;  2ZGM A;  3AFK A;  4WV8 A;  5A1F A;  2D7F A;  3DCQ A;  1PGS A;  2XWJ B;  4LIT A;  2WNO A;  3GHN A;  1UMH A;  4M01 A;  2W1U A;  3I59 B;  3THT A;  4OHW A;  2YGL A;  1WZX A;  2WZP P;  2Q5T A;  3V65 A;  4PLM A;  3JD7 1;  3VDD B;  4GIQ A;  1X9T A;  2WII B;  1O5U A;  5DZE A;  2ZS6 B;  1F8V A;  2OVU A;  4HT1 T;  2WFF 2;  4IW3 A;  4OMD A;  5H9R A;  1GP4 A;  4PDW B;  4IGQ A;  3ZVX A;  4CU9 A;  1JZ7 A;  5DZF A;  1HRV 1;  2JE9 A;  2ZX0 A;  1RC6 A;  2RS1 3;  3FJS A;  1OQ1 A;  4QKB A;  4LE3 A;  1QJY 3;  5FBZ A;  3URF A;  4JGY C;  4QMA A;  2BWA A;  1CJD A;  3O0X A;  4HSL A;  5K0U C;  2DBN A;  3BU0 A;  2W46 A;  1C8M 2;  3MZH A;  2IXH A;  2Y8K A;  3MDP A;  4QDQ A;  2WNE A;  3HAG A;  3SMH A;  2YPJ A;  3M2M A;  3VN4 A;  1N1T A;  4LO8 A;  1S4C A;  2ADD A;  2FZ2 A;  3JCI A;  3B9I A;  3OUH A;  2XJQ A;  2WNV A;  1SZB A;  4AAP A;  2BOI A;  2O8O A;  2GME A;  5L7O A;  4QPG A;  3VDA A;  1QNY A;  2WSV A;  3M3Q A;  4IER A;  3HN1 A;  1B09 A;  4H7L A;  5IVV A;  1RUG 1;  3SC7 X;  1JS9 A;  4CYD A;  3CL1 A;  1YNA A;  1JN2 P;  4GJZ A;  5EFU A;  4X6Q B;  2D6O X;  1TE1 B;  2K0G A;  1Z7S 3;  2C9A A;  3J7H A;  4KG8 A;  2D6L X;  3I2F A;  2QQL A;  5A1A A;  3WP3 A;  5HCH A;  4MUV A;  4WVV A;  1XSR A;  1C28 A;  3EO6 A;  2P6C A;  3AJZ A;  3PMS A;  3J7M A;  4XAB A;  4ZON A;  3QCW A;  3UGH A;  4A4A A;  1RUD 1;  2P5B A;  4CP0 A;  2VAU A;  4A45 A;  2LS6 A;  1CD3 G;  1GZW B;  1IOA A;  3NNJ A;  3WQ0 A;  4FPL A;  1Y43 B;  4C0B A;  1MZE A;  4F8A A;  4Y5T A;  5C9A C;  4JTN A;  4IV3 C;  3VBU A;  5FXW A;  4WVM A;  4YW2 A;  1EUU A;  3ABZ A;  3GYD A;  4R9C A;  4IV1 A;  3OGV A;  3M70 A;  4AQ6 A;  1CX1 A;  1YLL A;  3WNL A;  4XUR A;  1C1L A;  1S0F A;  2JE8 A;  2WKK A;  1NA1 B;  3C2U A;  4P9J A;  1LB2 A;  4BQ4 A;  4XFG A;  1FXZ A;  1SPP A;  1HQL A;  3WY6 A;  1AF9 A;  2Q8O A;  5JXJ A;  3H8R A;  1KFX L;  1QGL A;  2YDE A;  1W9Y A;  4LK7 A;  4MET A;  5F5Q A;  1SLB A;  4KWL A;  4LTA A;  4NHK A;  4AHY A;  1LOB A;  2XLA A;  3PJQ A;  2X5I B;  5M0T A;  3CIH A;  1CX4 A;  1XE7 A;  4XF0 A;  4B29 A;  3WD5 A;  5F9T A;  1E5I A;  2EIE A;  4YRD A;  4W65 A;  3FC0 A;  3DEC A;  4JRA A;  4JX0 A;  5H9S A;  1RUE 2;  4XZU G;  3I3Q A;  1AXK A;  1A78 A;  1QDC A;  3GZA A;  3HQX A;  5DG2 A;  3AL5 A;  3WQ1 A;  3DN7 A;  4W4Z A;  2UU8 A;  1XQN A;  3ACG A;  1BKZ A;  3LFI A;  4HVR A;  4PF1 A;  1N1Y A;  1PIV 3;  4DIQ A;  4EN8 B;  4BOW A;  1AL2 2;  3RS6 A;  3ZFG B;  4E4D X;  3IAP A;  4CPB D;  2B7Y A;  3RWN A;  5CYY A;  4AVA A;  3S7E A;  4NOT A;  3KT4 A;  2VVD A;  4M3C A;  3ZYF A;  3LPG A;  3AM2 A;  3ZSE A;  2C26 A;  5A3N A;  3ZO0 B;  5I8S A;  2PAE A;  1W8T A;  4RGA A;  1AR6 1;  4CDW C;  2B45 X;  1QJZ A;  4IND A;  1HX6 A;  1D2S A;  1V6L A;  3CU7 A;  3LKJ A;  3Q9O A;  4QPI A;  5T5J A;  3HPN A;  5IT6 A;  5FLH A;  5JZG B;  2IXL A;  4MZU A;  4NAO A;  5C70 A;  2WL1 A;  4WZC A;  2VOV A;  2WQ4 A;  2W1S A;  4Q8K A;  3N4M A;  5GKA C;  4QKF A;  5FV3 A;  5BY5 A;  5IYY A;  2A70 A;  1DFQ A;  2R04 1;  1HB4 A;  4WM7 A;  1JTZ X;  1OKQ A;  2EAL A;  4FOV A;  4MGY E;  4S2D A;  1GNH A;  4IGP A;  5D2A A;  5FZG A;  3R6S A;  4C0H A;  3KZ4 C;  1XU1 A;  4HSJ A;  1VAL A;  3WOG A;  2FMY A;  2IXJ A;  5KHK A;  4COU A;  2B4K A;  4DXT A;  4HKO A;  2QFE A;  4DZG A;  1JYC A;  1RUJ 1;  2VCB A;  3WF0 A;  2JIJ A;  3EJK A;  4L99 A;  4HK9 A;  3GZT B;  1K3I A;  2HEY F;  4K40 A;  4K1Y A;  4CUA A;  4ARX A;  3PIJ A;  2YFZ A;  5FMB A;  3JZV A;  1QKQ A;  2QCS B;  5A70 A;  5E89 A;  3GGL A;  2Y33 A;  2GN7 A;  4QX0 A;  5EZW A;  4WZF A;  5FCC A;  4W6Y A;  4YWA A;  1RHI 2;  1H30 A;  4MGI E;  1ULE A;  4MGT A;  1OD3 A;  4AFD A;  5EPA A;  3PLQ A;  1DGR N;  3SCG A;  1LU1 A;  1E5H A;  2OPK A;  1IKP A;  2GC3 A;  2VW2 A;  4DFS A;  3PME A;  3C7H A;  1N47 A;  1TQ5 A;  2G9Z A;  2H0B A;  3T0D A;  1CPM A;  3B3Q E;  3MW4 A;  3MIH A;  5F6K A;  4BM8 A;  1HV0 A;  4XE9 A;  1W0N A;  2HWD 3;  4N8M A;  2VY0 A;  2E53 A;  2PA7 A;  2XUE A;  4LO7 A;  2JJ6 A;  3RPQ A;  3WP6 A;  4A3X A;  2WBK A;  4YM0 A;  2DF7 A;  1FPN 2;  4XJ8 A;  4D69 A;  5L36 A;  5LW9 A;  3BKZ A;  2PHU A;  2FDI A;  1LES A;  5AC9 1;  1MS0 A;  1UZV A;  3AYA A;  1OF4 A;  2RS3 2;  1I5P A;  3C7F A;  4ASK A;  4OUM A;  2Q1F A;  2ZX3 A;  1JI6 A;  3D3A A;  2HBT A;  1IS4 A;  1AX0 A;  1QU0 A;  4FP2 A;  2ENR A;  3GZU C;  3RVH A;  3POW A;  3WG4 A;  1XU2 A;  4E4H A;  4XUT A;  4FCA A;  2VZU A;  2JDA A;  4Y1V A;  1PM7 A;  2A3Y A;  5A33 A;  2VUA A;  2WFP A;  1ZBA 2;  1SFN A;  1AJK A;  2D6K A;  3ACH A;  3VKM A;  3K75 B;  1RIR A;  2I74 A;  1F2N A;  2VL4 A;  1SBE A;  1FX5 A;  4N53 B;  3VL9 A;  3WW3 A;  4PI2 A;  2RM2 1;  2DCY A;  4KQ7 A;  1JBC A;  1AR8 3;  1VAK A;  3WHU A;  4CDU A;  1R64 A;  2GP5 A;  1CJP A;  3BOP A;  3M3C A;  2YU2 A;  4YGE A;  4GH4 A;  2QQP A;  1US2 A;  2E6V A;  1UMI A;  2IFW A;  4Q4X 2;  4PIX A;  3O1S A;  3ZX7 A;  4BIF A;  5CBL A;  1MVQ A;  1X7N A;  3BPS A;  3NQH A;  3RWK X;  1JZ4 A;  4DEV A;  3SH4 A;  2R49 A;  3AZV A;  4FOY A;  5APA A;  1F15 A;  1LGB A;  3LA2 A;  4AVT A;  2KXL A;  3HT2 A;  1Q43 A;  4JGZ B;  5I0U A;  3VZL A;  4Q4Y 3;  1RTV A;  2E7A A;  1ZA4 A;  2YV8 A;  3KMH A;  1ODM A;  3H1M A;  1O7F A;  2VUL A;  4AQS A;  4B1M A;  4RFR B;  1RUC 1;  4JDO A;  1JUI A;  1LU2 A;  2DUQ A;  3KF3 A;  2CDO A;  1FAY A;  3JD7 2;  4B8E A;  1W0O A;  2WC2 A;  5A3U A;  1JZ6 A;  3ZYP A;  2W52 A;  4COW A;  1LEM A;  4RGG A;  1U5I A;  5J96 B;  3PVO A;  2K2S A;  3AKS A;  2BNO A;  4XTM A;  3KT7 A;  1ZRC A;  5I8Y A;  1Y9G A;  2EXK A;  1QY4 A;  1HRV 2;  4Q0Q A;  4XAE A;  4O9G A;  3GBW A;  4IE6 A;  2N7G A;  4HFS A;  3AP5 A;  3E5Q A;  2V73 A;  2XR4 A;  4ZY9 A;  4LJH A;  2NM1 A;  2OZ6 A;  3CNA A;  5A80 A;  2P6H A;  5JZG A;  4GD4 A;  2GH8 A;  1JZ2 A;  2DVF A;  5A3L A;  3OOX A;  4CP1 A;  2NP0 A;  1N1S A;  2GNB A;  4UYB A;  3OBT A;  5I0S A;  4FP3 A;  3TYJ A;  4QB2 A;  4XFH A;  1VMH A;  1W6N A;  3ELN A;  2D6P A;  3BPZ A;  2VXJ A;  4MAD A;  2DUR A;  1Z78 A;  2R16 A;  1PZ8 A;  2O0O A;  4PCR A;  5KXD A;  1KS4 A;  3A0K A;  1OOP C;  5GZD A;  2AAC A;  1VAV A;  1ENQ A;  1RUG 2;  2WR9 A;  3E5U A;  5T54 A;  3ZOI A;  5JMC A;  1EAH 3;  4QKD A;  3ZIW A;  4XW3 A;  4L92 A;  3GJB A;  4U2A A;  3NJZ A;  1FMD 3;  3FHQ A;  4AEK A;  2WN2 A;  5A3P A;  2VZR A;  5BNP B;  2HWF 1;  2MEV 1;  3N9Q A;  1SG3 A;  1GLH A;  2IC1 A;  3H3L A;  4O61 A;  1T2X A;  4Z2A A;  1JW6 A;  4L2N A;  2PTM A;  1N1V A;  3CJX A;  1AHS A;  2FDJ A;  1PO1 1;  4Q4W 1;  2D3R A;  5FY4 A;  3WW4 A;  4QXH A;  2PHR A;  3VBR A;  4GWN A;  3VL8 A;  4SLI A;  2H6C A;  4GB3 3;  2JKB A;  2VBB A;  1RUD 2;  5IVB A;  4Q2F A;  3B93 A;  1T6G C;  2NN8 A;  4MV2 A;  4URT A;  1HW5 A;  3O1U A;  5BNO A;  1W8H A;  4QU2 A;  4AI1 A;  4E4Z A;  2ARC A;  4CEW C;  4BDV B;  1ND2 B;  2XHN A;  1S0D A;  2HBU A;  1BXH A;  4FVV A;  4NIA A;  3RZZ A;  5AVA A;  5LBB A;  2HWC 1;  2RDS A;  1YJL A;  1ZBE 3;  4RR3 C;  2R32 A;  1JOJ A;  1S0C A;  4MGS A;  3U4X A;  5CA6 A;  4L97 A;  3OGR A;  4Y20 B;  3VDB A;  3INA A;  1SAC A;  3D82 A;  3MYX A;  3OJB A;  4QPY A;  3U14 A;  1YXW A;  3MIE A;  2WO1 A;  4GZ9 A;  4AYU A;  1O3T A;  5A32 B;  4YM2 A;  1HXS 1;  2WS9 1;  3HNM A;  1H2N A;  5F3C A;  1LOF C;  3BB6 A;  3ZFF C;  3KCC A;  5LCW L;  3Q8B A;  5JDB A;  4D7S A;  5IVC A;  3ETP A;  4AI0 A;  4FTS A;  3D0J A;  1KS5 A;  4WM8 A;  4XIO A;  1G9A A;  4ZXE A;  1MZ5 A;  3MBW A;  3NV2 A;  3WNN A;  1MVE A;  4LO6 B;  4IEX A;  5AFE A;  2VM9 A;  2EAA A;  4EV0 A;  3SCH A;  5KC5 A;  4QX8 A;  2VMH A;  1R09 1;  1H9P A;  4IV3 A;  2Q8D A;  2W39 A;  1LHV A;  3KLS A;  4WBB A;  4HON A;  5DPN A;  1A8D A;  1IZ3 A;  3S57 A;  1W05 A;  2BEO A;  3OD4 A;  4P5H A;  2EXH A;  5DUX A;  2XJP A;  4L11 A;  3W59 A;  1YFU A;  1AR6 2;  4AZZ A;  5SV8 A;  5FUP A;  3AYC A;  1ND3 B;  4NRP A;  5DMY A;  1XBF A;  1TNF A;  2RR1 3;  3I49 A;  4KWK A;  4EJR A;  4IE5 A;  1VBE 1;  4AEJ A;  4LKD A;  3P6B A;  2PQS A;  2XVK A;  3J7N A;  2PFW A;  1ZRR A;  2RMU 1;  4I3P A;  5A7W B;  1WA4 A;  4QXK A;  4TZD A;  1ZNP A;  1Q8O A;  5GLT A;  3WG2 A;  2ET7 A;  3L2H A;  5FP7 A;  4HZF A;  4OMC A;  4AI2 A;  1V6O A;  2IFR A;  3I97 A;  1JYT A;  2WT0 A;  1OVP A;  2HH9 A;  1RUJ 2;  2XLG A;  3DKW A;  3MF6 A;  4HAN A;  1QJX 1;  3LEM A;  3AJY A;  3NNG A;  2QKD A;  3VD7 A;  1VBD 3;  1GQH A;  3POJ A;  2A75 A;  1FV2 A;  1YQ2 A;  2UWB A;  2LAL A;  4Y3O A;  3NMB A;  4XFI A;  4YZ1 A;  2H6B A;  1SLI A;  2WNV C;  3K77 A;  3NJY A;  4RD7 A;  3OY8 B;  5IFT A;  3MLJ A;  5EHD A;  5L73 A;  1VP6 A;  5LWB A;  3G6J B;  2JIG A;  2PHX A;  1D2Q A;  1TMF 1;  4H7M A;  4P9Y A;  1UXZ A;  4RGK A;  1QH7 A;  1UN1 A;  3J7L A;  4WVZ A;  3UV9 A;  4BHP A;  4PLN A;  1DF0 A;  2YBK A;  4FO9 A;  5KHI A;  4BME A;  3ZFE B;  3RZL A;  1FI2 A;  5E1R A;  2ZA9 A;  2JDP A;  5K8S A;  1W6Q A;  1LUL A;  4EE2 A;  2XL9 A;  3WF3 A;  4YGC A;  4UFI A;  4IDZ A;  5F8P A;  5AC9 2;  5ANN A;  4IEZ A;  3W9A A;  3O1O A;  3THD A;  4Y22 A;  3WDU A;  1H4H A;  3AZX A;  1G8W A;  3T4H B;  1PZ9 A;  2ZHK A;  1DQ6 A;  1Z0H A;  2FHR A;  3VHR A;  3FE5 A;  4DPN A;  5JI9 A;  1UYY A;  2J1R A;  2ZGU A;  1K42 A;  1GV9 A;  1YC6 1;  5ACA 2;  2XQX A;  3OCP A;  4ZHN A;  3T0B A;  2ZBJ A;  2D5H A;  3VBU C;  3JQX A;  4IV1 C;  1KJR A;  4DXZ A;  3DYO A;  4NIG A;  2A6Y A;  5CKM A;  2ZEW A;  3N9L A;  4V2V A;  3WQB A;  1GIC A;  5JR2 A;  3DGT A;  1B35 B;  2LM3 A;  4JQR A;  3OEA A;  5JMO A;  5LY1 A;  1G9D A;  5D8A A;  2RM2 2;  5CFD A;  4FFI A;  3ZN6 B;  3FUO A;  1PO2 3;  3WQ7 A;  1W0P A;  2HWE 1;  4KGG A;  5FP9 A;  5FZO A;  3ZLI A;  3IWZ A;  1O4Y A;  1U0A A;  3TNP B;  4F3J A;  1JHN A;  3KS7 A;  4JTO A;  1PVC 1;  2YBS A;  5FLI A;  4OI0 A;  1YYN A;  5BNQ A;  2XDV A;  3VKO A;  2BU9 A;  2ZX1 A;  2CAV A;  3J9S A;  1VAM A;  4M4R A;  5FY9 A;  4KMQ A;  2BYV E;  2GAL A;  5DZG A;  4AK3 A;  3AKP A;  2W2I A;  3K4A A;  1ZX5 A;  4OUE A;  1A34 A;  4XDP A;  1UMZ A;  1GZC A;  5KHG A;  3J26 N;  4NRQ A;  1Y9Q A;  4GWI A;  4HLT A;  3AP6 A;  4XF9 A;  4YVW A;  1RUC 2;  1MEC 1;  5FDB A;  5IK7 A;  1ULO A;  2CWM A;  3UET A;  5DDJ 3;  2OII A;  3VBH B;  3IAQ A;  2MNG A;  1WGP A;  3ZN4 A;  3I2O A;  4LPL A;  2JEC A;  1EV1 1;  1Q8S A;  1VBB 1;  4CPB A;  3EYP A;  1FOD 3;  3NO8 A;  2GU9 A;  5EQU A;  4CCD A;  2B8M A;  4X8P A;  4EYU A;  3WNP A;  4GJY A;  3O1T A;  2XML A;  3DKQ A;  4RHV 3;  4D6Q A;  3UKN A;  4WM7 C;  1IPS A;  1DYO A;  4XXP A;  2JDK A;  5C3P A;  5CB7 A;  4AHW A;  1NCQ B;  3WNX A;  1S1A A;  1J1L A;  1JOP A;  2Y0I A;  4QHO A;  4TWT A;  5F1R A;  4Q5O A;  2BWC A;  3HT1 A;  4AHX A;  1AR7 1;  1GP6 A;  1XPW A;  4N7I A;  1AX2 A;  4CEY B;  3KV9 A;  3QH7 A;  4AGG A;  1QJU 3;  1QJY 1;  1RMU 1;  2GSY A;  3H9A A;  4M0H A;  5FY5 A;  4AED A;  1LJ7 A;  3VBS A;  1W2O A;  5FQ0 A;  3I3M A;  1R08 3;  3DF0 A;  3VD4 A;  1I6X A;  4B7K A;  1ULP A;  3C3V A;  5B4N A;  4Y1U A;  1Y4W A;  1LHN A;  1BEV 3;  5FZ8 A;  2UUR A;  2HWF 2;  1RL3 A;  3FZ3 A;  2ZX4 A;  2MEV 2;  3NNM A;  4P5Y A;  5FWE A;  3O1M A;  1LOA A;  4XMI A;  2Y0O A;  3B5L B;  5FZE A;  4UF0 B;  1PO1 2;  1AYM 3;  4Q4W 2;  4YZ4 A;  5F32 A;  4NE9 A;  4D7T A;  3BYW A;  2L9L A;  1NQJ A;  4N7U A;  2YB7 A;  5ABJ A;  4BYY A;  4S2H A;  3HVD A;  4XVH A;  2DU1 A;  2WO3 A;  4U36 A;  1GUI A;  5J09 A;  1NY7 1;  5C3R A;  4E9K A;  2WUH A;  3E6D A;  5CIS A;  2VD7 A;  3D5O A;  1RUF 3;  2ZPX A;  1BCX A;  1PVX A;  4LBL A;  3PUS A;  4LUM A;  2VVE A;  1IPK A;  1OOP A;  3WF2 A;  4MLO A;  5FO7 B;  2V4A A;  4R9B A;  2DCJ A;  1LOE A;  4LBQ B;  3SEE A;  2WWJ A;  2YUE A;  2WA4 A;  1VMF A;  2HWC 2;  2OT7 A;  1MZ6 A;  3KT1 A;  4ORF A;  3LB9 A;  4LQR A;  1PK6 B;  2YMZ A;  1X36 A;  4HKL A;  4ZU4 A;  3VD3 A;  1G9C A;  2C5D A;  2R06 3;  4RS5 A;  4X6R B;  5FZ9 A;  1HLC A;  4CCM A;  4RA0 A;  5C3O A;  4NR1 A;  2JDY A;  4PI0 A;  1HXS 2;  3KV6 A;  4LO5 B;  2CL2 A;  2WS9 2;  4Q0P A;  3HNB M;  4E27 A;  3UGF A;  3DEM A;  4EN6 B;  4MVT A;  2JG8 A;  2VME A;  3UNP A;  4CDU C;  1WME A;  2WNU A;  2WRA A;  4CCO A;  4QX3 A;  3E5X A;  5F39 A;  4AGR A;  4QU1 A;  2WFF 3;  4W6X A;  5D21 A;  2VTF A;  3AMM A;  1NXD 1;  2YFU A;  4D7Y A;  4EQV A;  2BUK A;  1KXG A;  1R09 2;  1XYN A;  2AH2 A;  4CU7 A;  3ZMN A;  1NOV A;  1WMD A;  2QDR A;  3GDB A;  4I30 A;  3N7K A;  4MGZ E;  4XJ9 A;  4E2G A;  4NID A;  2HWB 3;  3R0R A;  2GZW A;  4O7X A;  5FYI A;  1NLS A;  1WW6 A;  4LBM A;  3IIA A;  3EBR A;  3POI A;  3III A;  4RQP A;  3U10 A;  2J7M A;  2GC1 A;  1C8M 3;  1PIV 1;  2YHJ A;  1RUN A;  4CU8 A;  4N43 C;  1PX4 A;  1UX6 A;  1BBT 1;  4NVP A;  3W58 A;  3I54 A;  1JOD A;  4AGV A;  4CVU A;  1OPO A;  2NZ9 A;  1Q8P A;  2JD9 A;  4QQL A;  1MS1 A;  1PHM A;  1VBE 2;  3ZPY A;  3V64 A;  2QE3 A;  1DQ4 A;  3PUH A;  4YW1 A;  3C7O A;  4FPK A;  5T52 A;  2NMO A;  2RMU 2;  3F95 A;  4IE0 A;  4K6B A;  4LK6 A;  3TRS B;  2E51 A;  1XNB A;  3VDD A;  2G4I A;  2QQW A;  4BCU A;  4KNC A;  2PLV 3;  3D6E A;  3LSE A;  2X09 A;  4I02 A;  4CXY A;  5I93 A;  2ZEY A;  3AXD A;  3DUI A;  3KV4 A;  1QJX 2;  4RFT 0;  4LKE A;  1O8P A;  1VBC 3;  3FMG A;  1GAN A;  5JZG C;  3AKQ A;  5A6Q A;  1CZT A;  3Q8F A;  4PT6 A;  5LA9 A;  1UY3 A;  2JEN A;  2YU1 A;  4LHS A;  1C3H A;  3CLP A;  5A7P A;  3LEI A;  4P9I A;  2P1B A;  1JYI A;  2PMW B;  3OGJ A;  1RUI 3;  3A0N A;  3VKN A;  1WMX A;  5FZ1 A;  2PHT A;  4I3G A;  3SQO A;  5J7M A;  4FQ4 A;  1F31 A;  1GZ9 A;  3NV3 A;  3JB8 A;  3O0V A;  4XQD A;  1W28 A;  1SDD B;  1TMF 2;  1YQ8 A;  2IXI A;  2XWB B;  3NAP B;  4QM9 A;  5FXX A;  3MIF A;  3BCW A;  3O5S A;  2GNT A;  2PYT A;  4CU6 A;  1K5M B;  2Y38 A;  1QXJ A;  3OYW A;  3SCF A;  1TG7 A;  1G9F A;  1D4V B;  1CVN A;  3RJ2 X;  1SBF A;  2ZEX A;  3LD8 A;  3CMG A;  1LRH A;  5A3T A;  1VBA 1;  3MID A;  3J4U H;  4O9E A;  4EWD A;  5IAX A;  1YHF A;  1UD1 A;  3POS A;  4KU8 A;  5FY1 A;  5A3W A;  5IHR A;  2ORX A;  2F17 A;  1XC6 A;  5CVR A;  2VMF A;  5FZL A;  3AKT A;  3VBR C;  1HQW A;  2DVG A;  3OEB A;  4I01 A;  4P14 A;  3K46 A;  1RUE 3;  1ZZB A;  2Y60 A;  2VU9 A;  5IFP A;  3ZXA C;  4QHB A;  3N9P A;  5H9P A;  1QF3 A;  1DG6 A;  2C0Z A;  1W9W A;  5BNO C;  2G1M A;  4DEQ A;  3KQR A;  4HN1 A;  4GA9 A;  3BTX A;  3B01 A;  1WD4 A;  4KH9 A;  2AGS A;  2YG0 A;  1MQT B;  2P2K A;  2C9K A;  1GZW A;  2D40 A;  4BQ5 A;  1JYW A;  4OUL A;  5LZ6 A;  5IWF A;  4E2Q A;  4GMP 3;  2J42 A;  1UF2 C;  1OUS A;  2AYH A;  2HEV F;  2IUW A;  4Q4V 1;  4FTE A;  2OXB A;  5IUQ A;  2FCT A;  2HWE 2;  5DUU A;  1W3V A;  1NA1 A;  2RDR A;  3IB3 A;  3PNA A;  2CSG A;  3QBQ A;  4FPG A;  4XCB A;  4Y4Y A;  2VUC A;  1V6M A;  3VZK A;  1KQR A;  1PVC 2;  4CDQ B;  3V0B B;  3MFA A;  3ZXJ A;  2PQQ A;  1DQ1 A;  1FNZ A;  5FY0 A;  1OI6 A;  4IEY A;  3WF1 A;  4M4P A;  2ZGN A;  2K9Z A;  4WM8 C;  1SEF A;  4JZR A;  4NUB A;  2P3I A;  3S7I A;  2BNM A;  3B00 A;  5H9Q A;  4LOR A;  4RSU A;  3LEG A;  3APB A;  3MIC A;  4Q0U A;  4GMP 0;  1MEC 2;  2DFB A;  2FDK A;  3ZFG A;  3RZJ A;  5A1L A;  2B9V A;  5FTT C;  1I9R A;  2BER A;  1W2U A;  2BTV C;  1W8N A;  3B02 A;  3BVC A;  4Q4Y 1;  2IZW A;  4EWE A;  3AK0 A;  1EV1 2;  1LGN A;  1VBB 2;  5L9B A;  4XUQ A;  5L7O B;  2BGO A;  5LBE A;  4QPG B;  3BIE A;  3K2O A;  3C7G A;  2HLE A;  4P9W A;  1FNY A;  4IEU A;  3MW3 A;  3VLB B;  2PAM A;  2X10 A;  5BUV A;  3OBR A;  1I3H A;  1W8W A;  2FCV A;  2WZR 1;  1LHO A;  1BYH A;  3BTA A;  1HN1 A;  1NKG A;  1S0E A;  2ZGL A;  2VZS A;  3WR0 A;  1GP5 A;  2GNM A;  1AR7 2;  5DUV A;  3FWE A;  4A6S A;  5C4W B;  4IET A;  5AFB A;  3TEZ A;  2A73 B;  2JDN A;  1QJY 2;  1RMU 2;  1HKD A;  2Y6H A;  2HJI A;  3I7D A;  3T1L A;  4BK5 A;  5J1X A;  4LBK A;  4EZH A;  3O0W A;  2ZEZ A;  4OLL A;  2QJV A;  3PVE A;  1DLC A;  1L7Q A;  4UFM A;  2W9X A;  1OD5 A;  1LR5 A;  2PXJ A;  2ZAC A;  3PU3 A;  3QH6 A;  3R4D B;  4MOA A;  3WXP A;  3W5N A;  4JVA A;  3NWK A;  3ITQ A;  5E6H A;  3I2K A;  4PBO A;  1YIF A;  4H3W A;  4QB6 A;  3HJR A;  2WZE A;  2XB6 C;  4G9S B;  5CFC B;  2VOK A;  3DV8 A;  4A42 A;  3POG A;  1ZBA 3;  2F4P A;  1ZZ6 A;  5JXH A;  5FYT A;  3WUD A;  2E32 A;  3E1F 1;  1C1F A;  1ZA7 A;  4LR4 A;  1H8T C;  3R05 A;  3ZXD A;  1UPI A;  3H8O A;  1W6M B;  2FZ1 A;  3I3E A;  1EAH 1;  2IXC A;  3T0A A;  4EZ4 A;  2BOJ A;  3A23 A;  1WLW A;  2ET1 A;  4B3N A;  1NY7 2;  2ZZQ A;  4Q4X 3;  3M3O A;  5CAD A;  3WW1 A;  4R8H A;  4DUX A;  3PTY A;  4HET A;  4JHZ A;  4QDR A;  4LBQ D;  2KA3 A;  4ZZ8 A;  4MH0 E;  1KRI A;  2R07 1;  3OBA A;  4K8F A;  4Y5S A;  2HYK A;  1RUH 1;  4DUV A;  4J1X A;  2ATF A;  3IDB B;  4GB3 1;  5JSO A;  5I8T A;  4AFC A;  4RN5 A;  4PJY A;  5CAZ A;  1HV1 A;  1CIY A;  4MXW B;  2Y6L A;  3CZJ A;  3WNM A;  3SXW A;  3N9O A;  2CWS A;  3VKF C;  2B5H A;  4V2W A;  3UYJ A;  2DCT A;  5HCF A;  2RDQ A;  4LIV A;  2JD4 A;  3VBO B;  5D8A C;  4QPI B;  5CFD C;  1W99 A;  4HPK B;  4NWW A;  5BNN B;  3D0S A;  4N53 A;  1W6P B;  1S0I A;  5F3G A;  3UT0 A;  2QQK A;  3NKT A;  3ZYJ B;  4ES8 A;  1GWL A;  2P3Y A;  5GJ6 A;  1HIX A;  3HNY M;  4LBN A;  3OPZ A;  2TBV A;  1E57 A;  4XFB A;  3UJQ A;  2R30 A;  4ZU7 A;  5G05 L;  2DBI A;  1S2B A;  3P3N A;  3Q8C A;  4Y24 A;  5IW0 A;  1GYK A;  4IE7 A;  3UJO A;  1YUD A;  3RZM A;  4CCE A;  5IK5 A;  2XPJ A;  3POF A;  2W87 A;  1PIV 2;  5ACA 1;  2WWS A;  3E97 A;  5GLU A;  1TEI A;  3AVS A;  3RGB A;  4ASL A;  4BMB A;  1BBT 2;  1TME 3;  5DQ0 A;  1GOH A;  4YVW C;  2QQV A;  4JDM A;  4JGZ A;  2CNA A;  4XXA A;  4COV A;  3EHK A;  1URX A;  3GZE A;  4Q26 A;  2DYC A;  1XND A;  1NT0 A;  1JOB A;  4BQ2 A;  3RI8 A;  1W8O A;  4AF9 A;  3ZDS A;  4KWJ A;  3GAL A;  5IVF A;  1CZV A;  4FFH A;  2D3S A;  1U5Y A;  1GFF 2;  4LOS A;  3AP4 A;  5BXX A;  1RUG 3;  2BZD A;  5C6C A;  3LOB A;  4CCN A;  1X82 A;  4AAX A;  1COV 3;  2RVA A;  1LAJ A;  4Y1Z A;  4OI2 A;  4URA A;  1HJF A;  1HN0 A;  1OH3 A;  1RVF 1;  2YY1 A;  3MIB A;  2RR1 1;  1MZF A;  2UYA A;  2D5F A;  4GAZ A;  4QD2 A;  5LY2 A;  5CG8 A;  3IN9 A;  1CON A;  4XAC A;  1KDK A;  3UL2 A;  4OZX A;  4Y4R A;  4AEM A;  5FP3 A;  5E16 A;  2BW8 A;  1VB2 A;  4K3U A;  1M06 G;  4Y5Z 0;  1QEX A;  1YI9 A;  2WAA A;  4HK8 A;  4N43 A;  2ZAH A;  1STM A;  2AEY A;  3LDB A;  1GNY A;  1SLA A;  2RV9 A;  2DTY A;  4LO4 B;  1D4M 1;  5DXD A;  3RMY A;  2WO2 A;  3MO4 A;  4AED C;  3VBS C;  4ET7 A;  2MPF A;  1VBD 1;  2E7Q A;  2DUP A;  5FY8 A;  5IK4 A;  1UIK A;  5T55 A;  1FT9 A;  4OHV A;  3MPP G;  1WBF A;  5FOJ B;  1HB3 A;  2QQJ A;  1QXP A;  2Z42 A;  3A21 A;  1HQN A;  1DLL A;  3IMM A;  3LF7 A;  2P3K A;  2VNR A;  1JZ3 A;  1SBD A;  4KG0 A;  3WX5 A;  2RE9 A;  3DPR B;  3FHI B;  3AYE A;  3IDA A;  3NV4 A;  4QKN A;  1UY0 A;  2FQP A;  1VBA 2;  3HR9 A;  3LDK A;  5EV7 A;  5F37 A;  1MAC A;  2JX9 A;  3MIG A;  1CZS A;  3O1R A;  1ULC A;  5TSW A;  5LRR A;  3O7O A;  1CES A;  2VZ3 A;  3LA3 A;  4GH4 B;  2Y26 A;  5BNP A;  1G7Y A;  3H50 A;  4CDX B;  5ABJ C;  1Y7B A;  5A7S A;  1CAU B;  2ORZ A;  1H2K A;  3W20 A;  5C8C B;  3KHB A;  4YW7 A;  2JXA A;  4ISR A;  5C5U A;  2EXJ A;  1UZY A;  2ZTN A;  4ES9 A;  1ZZC A;  4QGN A;  5ANQ A;  5FZD A;  4ZXK A;  1NCR B;  3OGS A;  4LOT A;  4A3Z A;  3IBM A;  4BIO A;  1EPW A;  4LHL A;  3VBF B;  2JDH A;  3IM0 A;  4C8D A;  1H1M A;  3A22 A;  3F2Z A;  3I2I A;  3LGR A;  3RJR A;  1V6I A;  3PUI A;  1HRI 1;  3EMR A;  4X8N A;  4Q4V 2;  2Z69 A;  3BOW A;  4DY5 A;  1ND2 A;  1WMF A;  2Z5W A;  5C3S A;  4RS5 C;  4XPV A;  2YPD A;  3RFR A;  2P37 A;  4XAA A;  2D97 A;  5EJ3 A;  4FPH A;  4Y20 A;  4YFW A;  1JMU B;  2XVL A;  3TAY A;  2GDF A;  3KSC A;  3QAC A;  2JG8 C;  4AXO A;  3VB9 A;  1UKR A;  2WNU C;  5A32 A;  2R04 3;  1POV 3;  3HD8 B;  3RI9 A;  1PO2 1;  2F6B A;  1JU3 A;  4B4Q A;  3WDX A;  5KWR A;  4CZS A;  2JG9 C;  4K9S A;  1ULD A;  2RDN A;  3ZXK A;  2VC9 A;  2DTW A;  3TNQ A;  3LWC A;  2ARB A;  2LRO A;  3KF5 A;  3PUQ A;  3FUQ A;  1AYN 1;  4J25 A;  2DV9 A;  1LED A;  2ID4 A;  4D3W A;  3TEY A;  5J48 A;  1WW4 A;  1OA2 A;  3HIF A;  1O59 A;  3BAL A;  2QDN A;  1CAW B;  1NAE A;  1ZYB A;  2VO5 A;  4QWN A;  4RQP C;  5A7O A;  5FZ0 A;  4Q4Y 2;  1W9S A;  2H0V A;  1YFX A;  4FPJ A;  1QQP 1;  1V9U 1;  3ZXL A;  4QX1 A;  3USU B;  1YCI A;  3Q8A A;  5EYX A;  3H0O A;  2IVJ A;  1AR9 1;  5FYC A;  1NZC A;  4XQ4 A;  2ZXQ A;  4DRV A;  1PZ7 A;  4B1L A;  4QQP A;  4GKY A;  2W08 A;  5CEH A;  2WQZ C;  5K9Y A;  1ND3 A;  2EVX A;  3GM8 A;  1A6C A;  2V5Y A;  2WZR 2;  4S2F A;  4GUL A;  3VDD C;  3LEK A;  4S2G A;  2CY6 A;  2WWU A;  3NAP C;  4IQP A;  1DIW A;  1FOD 1;  1WCD J;  3H7Y A;  4JGY B;  3GCX A;  2Y34 A;  5A7W A;  1V00 A;  4A6O A;  2BRT A;  4B4R A;  4CP9 B;  5K0U B;  1VJ2 A;  1UKG A;  4OCT A;  1R1A 3;  3OD0 A;  2A3X A;  4PDW C;  2X8K A;  4RHV 1;  4AFB A;  1ASJ 3;  2XJR A;  4C91 A;  4V1P A;  3IMN A;  4DY3 A;  2ZGT A;  1DZQ A;  1UOF A;  1ULF A;  4MYE A;  4OYU A;  1GNZ A;  3V56 A;  4CCK A;  3GHM A;  3TN9 1;  1H8V A;  5JSR A;  4I2O A;  4PQ9 A;  1GQG A;  4KBZ A;  4AQT A;  1BK0 A;  1O4Z A;  2DWR A;  3ACL A;  4JKL A;  1UY4 A;  1JYV A;  1HJG A;  3DXT A;  3OY8 A;  2JEM A;  1R08 1;  4OHX A;  3PHM A;  3GNE A;  2D44 A;  1EAH 2;  2X29 A;  1UU6 A;  1UY1 A;  5I0R A;  3DL3 A;  1J3R A;  2O1Q A;  4FPF A;  3C7E A;  2ZJC A;  4ISQ A;  4Q29 A;  4OQ9 A;  2SBA A;  1H4G A;  2HEW F;  1BEV 1;  4PBP A;  3ZFE A;  3ST7 A;  4CUC A;  1EY2 A;  1VRH 3;  2OQ6 A;  1VB4 A;  2VNV A;  1N3P A;  4CP2 A;  4ATF A;  1AYM 1;  4AI3 A;  2R07 2;  1ODN A;  1RUH 2;  4UI9 L;  3KCY A;  3J8F 1;  5C9A B;  4GB3 2;  1LOG A;  4IV3 B;  4DXR A;  4UWD A;  2ARX A;  4F7Z A;  2EAK A;  2W1W A;  4C90 A;  4FFF A;  3LSD A;  2ARE A;  1YI7 A;  1OLR A;  2GAU A;  3MGU A;  4CCJ A;  3MV1 1;  1H8T A;  1H6X A;  5BPX A;  3B7M A;  5JPM B;  3NVC A;  2KD7 A;  2YC4 A;  4HVQ A;  2BBV A;  5LRS A;  4XUN A;  1I5Z A;  3AMN A;  3LIG A;  3JXS A;  1GBG A;  1NA1 C;  1WD3 A;  2IWG B;  1W6O B;  5FZC A;  4EWA A;  2XKO A;  1B35 A;  1NQD A;  1YO8 A;  4R9A A;  2J1S A;  1O3Q A;  1WCU A;  2YRO A;  4KGQ A;  3ZN6 A;  2VZQ A;  1IS5 A;  2PHL A;  5C5T A;  2D93 A;  4D94 A;  1YWK A;  5DAP A;  2X5I C;  1N3Q A;  3JBG 3;  4ONU A;  5FAX A;  3HOB A;  2GMP A;  1NG0 A;  4HG6 B;  4UBH A;  2E63 A;  4XBN A;  1JH5 A;  3IPV B;  2XBO 3;  4FFG A;  5GLZ A;  5DAX A;  3USS A;  2VE1 A;  3CZU A;  4H2A A;  2BFU L;  3AFG A;  3NST A;  4AR2 A;  3ZFG C;  2HWB 1;  5FUN A;  4CDW B;  4DQA A;  4L0P A;  5FZA A;  3EXU A;  3B94 A;  4KWU A;  5F7U A;  2EA7 A;  1US3 A;  3KCX A;  5T5L A;  2VBD A;  5C4W C;  2J1A A;  3QD6 A;  4CUB A;  2DVD A;  1A3K A;  1W39 A;  5FO8 B;  2YYO A;  1UOG A;  4FPC A;  4UOJ A;  5L9V A;  2ZGO A;  3VBH A;  2XJU A;  2GC2 A;  5SV5 A;  4RYD A;  3U0Z A;  1IQD C;  3S6P A;  1RVF 2;  3JUU A;  2RR1 2;  5A7Q A;  2NLR A;  2MEV 3;  2R6Q A;  4D6S A;  5FRA A;  2Z4F A;  4EN0 A;  1YQ5 A;  4KBB A;  2OX0 A;  2VOX A;  1WCS A;  1PO1 3;  1ZRF A;  2J1U A;  2WDB A;  4FOQ A;  5IVY A;  4XDQ A;  1EP0 A;  2PLV 1;  5FP8 A;  4Y22 B;  1YFY A;  3HMY A;  2C6S A;  2PN5 A;  1SLL A;  1SMV A;  3RSJ A;  1D4M 2;  3BU7 A;  3ORJ A;  1UYZ A;  2YBP A;  1VBC 1;  1W04 A;  1MPX A;  1SCS A;  2Q4S A;  1QNW A;  1RYY A;  1VBD 2;  2VUD A;  3MPB A;  4JQT A;  4CEY A;  3LPF A;  4XJU A;  5K7P A;  4OQ8 A;  2ARA A;  2WLQ A;  2V5D A;  2VNG A;  2RS5 3;  5JIU A;  1RUI 1;  1OUX A;  3OPW A;  5J37 A;  1HB1 A;  2WAB A;  3NJV A;  5DG1 A;  4YW6 A;  3WSO A;  4A7Z A;  2QQI A;  1OH4 A;  4LBJ A;  4QB1 A;  2WYF A;  5KBF A;  2VZT A;  1OKO A;  1AXY A;  4LUL A;  1LHW A;  2Q0A A;  4YG3 A;  1DP0 A;  4IEO A;  3X29 B;  4AVB A;  3VHO A;  4ZZ5 A;  5FYY A;  5FO9 B;  2W0X A;  4TN7 A;  3VDC A;  5FIX A;  1OHF A;  5FP4 A;  4Z2W A;  3HN3 A;  4UF0 A;  5E8A A;  2RS1 1;  1YFW A;  2DVA A;  3RQ0 A;  1N3O A;  1GWK A;  2OUJ A;  4CXW A;  5EXO A;  1R09 3;  4JAA A;  3OGG A;  2XXZ A;  3UES A;  3AZY A;  5I91 A;  3R4U A;  4PHZ A;  2FD8 A;  3TOJ A;  2A7A A;  2ZKN A;  3M3I A;  1REF A;  3QLQ A;  3I2H A;  1CAX B;  4MO3 M;  1HRI 2;  2CU5 A;  5DUW A;  3U75 A;  4XJA A;  2JWP A;  4SBV A;  4BU2 A;  4LBQ A;  3BN6 A;  4QDS A;  2W92 A;  5EIY B;  4L9B A;  5IVJ A;  3A7Q A;  1DGL A;  4NJ4 A;  1OLM A;  4DS0 A;  4P08 A;  3GBG A;  1ZRD A;  1PK6 A;  2WT2 A;  2P3J A;  1RJ8 A;  4GMP 1;  2BJS A;  4NAM A;  5EYY A;  1XRU A;  4N53 C;  2WT1 A;  2F4L A;  1PO2 2;  4YVS B;  1Z7S 1;  4DNY A;  2JIC A;  1LEN A;  5KXE A;  2D3P A;  1UYP A;  3ES1 A;  5FK7 A;  4IGO A;  2R7E B;  1UL9 A;  4COZ A;  1OQD A;  3ALQ A;  3M3E A;  3LAG A;  1G86 A;  1AYN 2;  1C5I A;  5FYZ A;  3WZ1 A;  1XYO A;  2ZOE B;  1AVB A;  3DYP A;  4NPL A;  3VUO A;  4COY A;  3SHR A;  1LOC A;  1U12 A;  3KGZ A;  1W8U A;  1OSG A;  1O6U A;  4G3Y C;  3TEX A;  2VG9 A;  4JC1 A;  1WCK A;  2I07 B;  4AOC A;  4CSW A;  2WQ8 A;  1W2A X;  3ILN A;  3PL0 A;  4UFJ A;  5T5P A;  1QQP 2;  1V9U 2;  1IHM A;  2A71 A;  2XG3 A;  4CUG A;  2C24 A;  2AZ5 A;  1OT5 A;  4JGZ C;  1C5H A;  4Q0V A;  1QH6 A;  4BIS A;  5HXV A;  1AR9 2;  3LCP A;  1UYX A;  1VMJ A;  5FYV A;  1W03 A;  1YEW A;  2UY8 A;  2WSU A;  3N7L A;  5A6X A;  3MUZ 1;  1TMF 3;  3K3N A;  4XIL A;  1CAV B;  3V0A B;  5J36 A;  2OPW A;  4Z07 A;  5FOB B;  4PF5 A;  2WLP A;  3WG3 A;  4YSF A;  3MW2 A;  4QX5 A;  3WG1 A;  3BTY A;  1ZRE A;  2JG9 A;  2A6W A;  3LIH A;  2JDU A;  4GAL A;  5EJ1 B;  1FOD 2;  3KB5 A;  1KDM A;  5DAQ A;  3D8C A;  2WA3 A;  4AFA A;  1YRZ A;  2JKX A;  4HKW A;  5FPB A;  2LW8 A;  1L3J A;  4TLF A;  1H1A A;  3ACI A;  1Q8V A;  4RHV 2;  4XFA A;  2AEZ A;  5CIR A;  1TZO A;  4ZU5 A;  5IAV A;  4JHT A;  5LK7 B;  2WZ8 A;  1IG3 A;  2P34 A;  1XNT A;  4IEP A;  1JUH A;  1F4A A;  1O8S A;  1RIN A;  2CGN A;  3AP9 A;  5FJK A;  2BPA 2;  1MS5 A;  2Y6J A;  2RJL A;  3SLI A;  1VLN A;  2QBX A;  2EXI A;  1YIP A;  1V6J A;  3TN9 2;  1OOP B;  2EID A;  3RDI A;  4YGD A;  1O5L A;  4XCA A;  4ZS3 A;  5FZ7 A;  3ZKU A;  4YZ2 A;  2ILM A;  2ZGP A;  2ZGQ A;  5LA2 A;  5F5I A;  2FDG A;  2NYY A;  5FYU A;  3U11 A;  1POQ A;  4DRR A;  4Q8L A;  3ZYB A;  3I59 A;  1R08 2;  2Q30 A;  3CKH A;  3ZPO A;  3AP7 A;  3NAP A;  1BJQ A;  3P3P A;  4XOG A;  3LDR A;  1K5M A;  1D0H A;  2UWA A;  3ACF A;  3S0M A;  1BEV 2;  4Z82 A;  3O1P A;  3NKG A;  3JU9 A;  4NHM A;  4PDW A;  2CAU A;  4UFL A;  1K12 A;  4QM8 A;  4ERO A;  1JZ8 A;  5FYB A;  1LEC A;  1H9W A;  3VHN A;  2FDF A;  1E5R A;  5BNP C;  4QX7 A;  1AYM 2;  1QIQ A;  1AXZ A;  3NJX A;  4XIK A;  2WN3 A;  3ETQ A;  3IKW A;  1P8J A;  5CKQ A;  3J8F 2;  1XE8 A;  4B7E A;  2Q1M A;  2DDU A;  2J1V A;  4CEW B;  1X33 A;  1OA4 A;  4Z8B A;  1FAT A;  5GAL A;  4LBO A;  3N7M A;  2QVS B;  4HXC A;  3LZZ A;  4RR3 B;  2VMC A;  4FXK B;  4XJW A;  1O4T A;  1RED A;  3A4U A;  5LAS A;  1MEC 3;  3R4S A;  1VRB A;  2BGC A;  3ILF A;  2VJX A;  1CWP A;  2BFU S;  3N3H A;  1MQT A;  1QDO A;  1ND2 C;  2W5F A;  1H6Y A;  4XC9 A;  1A8M A;  1J83 A;  4A2U A;  1O3S A;  3ZFF B;  3ES4 A;  4P9L A;  3H42 B;  4KI5 M;  2R06 2;  4QQO A;  3B9C A;  4YPJ A;  3H8U A;  4M3C E;  1IQA A;  1H2M A;  3ON7 A;  2C1F A;  5A3M A;  5JCT A;  1RXF A;  3RRD A;  4HL0 A;  2HWD 1;  1NZI A;  4I0A A;  1SLC A;  3S5Q A;  1HB2 A;  4BQX A;  4UBG A;  4CDQ A;  3V0B A;  5CKN A;  4NHX A;  5J3U A;  1W2T A;  5L19 A;  1AL2 3;  2YC2 A;  3CJI B;  4KL1 A;  5LEJ A;  2ZAB A;  3T09 A;  1PM4 A;  3POE A;  3RZH A;  4A7Y A;  4K8R B;  4UXA A;  1AR7 3;  5JUV A;  4BZ4 A;  1Q3E A;  4FTB A;  2DUO A;  4A44 A;  1RMU 3;  2HWB 2;  4XHB A;  1OMI A;  3T3Y A;  1DGR A;  2CTV A;  2RJK A;  2ZHL A;  4AL9 A;  3N35 A;  3LFM A;  3NV1 A;  3POY A;  5FWJ A;  1UZZ A;  1KJL A;  1KFU L;  2W1Q A;  3ILR A;  1TME 1;  1REE A;  1J59 A;  1UO9 A;  3ZYH A;  2OZJ A;  2LUW A;  3WEZ A;  1WUV A;  2GH2 A;  4LUK A;  3OYW B;  4EN7 B;  5EP9 A;  3SKV A;  3ZXE A;  1Y3T A;  1ZZ7 A;  2X05 A;  1ND3 C;  3K4D A;  1AR8 1;  3AB0 A;  2X5I A;  1OC1 A;  2A3W A;  5L9R A;  1COV 1;  1DZT A;  2CGO A;  1NX9 A;  1UOJ A;  3ME2 A;  5FRE A;  4LA3 A;  1OLQ A;  3FLP A;  2PLV 2;  3THC A;  2B39 A;  4I0W B;  5C71 A;  1X8E A;  1U5X A;  3I8T A;  1ENR A;  1VBC 2;  1F4H A;  4IL7 A;  4DUW A;  1D7P M;  2WNV B;  5FMD A;  5C4W A;  5C7G A;  1LTE A;  1QHD A;  2VQT A;  2GC0 A;  1RHI 3;  5FZF A;  3JQW A;  1RUI 2;  1IS6 A;  5JSP A;  1NE4 A;  4J1W A;  1QOT A;  2ZHM A;  4D0Q A;  5GM0 A;  1S0J A;  5HCA A;  5FKC A;  4TLG A;  4JKK A;  1UU5 A;  2NMN A;  3PUA A;  4N9I A;  4JV4 A;  3M7A A;  4BPZ A;  1NUK A;  1GQP A;  1QOS A;  1JZ5 A;  4FQZ A;  5HV4 A;  2XKP A;  4N90 A;  1DQ2 A;  5GZG A;  5CFC A;  2XJV A;  2D6M A;  5FPL A;  1WLT A;  4Q1R A;  5FLJ A;  3DXU A;  1S55 A;  1FPN 3;  4NHL A;  4MX3 A;  4AW7 A;  2VNO A;  4QHZ A;  2RS1 2;  3ZFE C;  1W6M A;  1WLC A;  3OPT A;  4YM1 A;  2FCU A;  2RS3 3;  2VMG A;  1X9P A;  5IJR A;  3SIT A;  3TBD A;  3ZN5 A;  1J3P A;  4GXL A;  4XDO A;  1QOO A;  3WP5 A;  2GP3 A;  1PMH X;  5FZB A;  3VZM A;  2XLF A;  2VCM A;  3THP A;  3VBU B;  4AVV A;  2GMM A;  5FMO L;  5B2G B;  4IV1 B;  4W8J A;  2Z2S B;  3KQ4 B;  5FZH A;  3FN9 A;  1BBT 3;  2LTN A;  3GCW A;  4QT6 A;  4AWD A;  4I0B A;  4NRM A;  3RMX A;  1SPP B;  2ERF A;  1Q56 A;  5DAB A;  4WVW A;  5ISL A;  4MXW A;  4AI8 A;  3TWI A;  1W3X A;  3BTZ A;  1FMD 1;  4P9X A;  4DB5 A;  3RZK A;  1Z7S 2;  5LA0 A;  1B35 C;  3VBO A;  2VGD A;  3SEP A;  3TEW A;  4HPK A;  4R4X A;  5G04 L;  3MHZ A;  5BNN A;  1ZVF A;  1RXG A;  2VZO A;  1W6P A;  4YGB A;  2E26 A;  4FI9 A;  1DZR A;  5CU1 A;  1KEX A;  4H14 A;  5LBC A;  1POV 1;  1UU4 A;  2XVG A;  2CYF A;  3MFC A;  4PQQ A;  5FBJ A;  2OQ7 A;  3NNL A;  2YC0 A;  2A6X A;  4M3C B;  4IXL A;  1ZZ8 A;  4QGL A;  5GLV A;  4BQ3 A;  3N7J A;  3T2T A;  3S30 A;  4YFZ A;  4D6R A;  4E2S A;  5JOW A;  3CDZ B;  1SFP A;  3L2Y A;  3U37 A;  1KIT A;  4CTE A;  4Q27 A;  3JD7 3;  5HBA A;  1O3R A;  2AUY A;  2G19 A;  1ZBE 1;  4AI9 A;  5FMC A;  5FPZ A;  1DBN A;  2RJ2 A;  3WHT A;  4D8M A;  4BK4 A;  5T3N A;  1OQE A;  1BLZ A;  3ZM8 A;  3WP4 A;  1GWM A;  1JYN A;  3W5M A;  3VBH C;  4KU7 A;  4WVM B;  4WM7 B;  1X8M A;  2ETE A;  4K1Z A;  5GZE A;  4IEW A;  1HRV 3;  2YGM A;  3BI3 A;  5F2S A;  4UFH A;  1VBA 3;  4UW4 A;  4XF1 A;  4BXS V;  4W6W A;  4XFC A;  4MSV A;  2O8Q A;  3ENR A;  5A6Y A;  2BVV A;  3CEW A;  3ECQ A;  2D98 A;  1ULG A;  2YXS A;  2Y6G A;  2QNK A;  4H55 A;  4TSV A;  3AMP A;  4IES A;  1GZT A;  3PVB B;  3KV5 A;  4BLI A;  4YG6 A;  4NPM A;  1UZW A;  1NCQ C;  3U1X A;  1W90 A;  4BQY A;  5HPO A;  5E88 A;  1R1A 1;  2CDP A;  1OFS A;  4BE3 A;  5IAT A;  1IG0 A;  5IK8 A;  2FDH A;  1ASJ 1;  4J6G A;  2UYB A;  4CEY C;  3VD9 A;  3N9M A;  4LNV A;  3RYR A;  5EJZ B;  4XYX A;  3VBF C;  2ZHN A;  2D6N A;  2ZMK A;  2E33 A;  1BQP A;  4R52 A;  2UWC A;  3EB7 A;  2PAK A;  4OI4 A;  4YLZ A;  1H2L A;  2OA2 A;  2OS2 A;  3H3U A;  2K46 A;  4Q4V 3;  4XJZ A;  2QQN A;  1MS9 A;  5A6Z A;  1UNB A;  1M4W A;  5JXI A;  1OFN A;  1SHW B;  2FBE A;  3LA7 A;  2B46 X;  5LK5 A;  2EIC A;  4LXL A;  4NWV A;  3DPR A;  3E6B A;  5KXB A;  2W95 A;  4L8Q A;  4UW6 A;  4C1W A;  1SQ4 A;  1XXN A;  4QGM A;  5JR7 B;  2W47 A;  3N36 A;  1RUD 3;  1BHG A;  3M8L A;  3S5A A;  5CG9 A;  3NL1 A;  3ZIX A;  2VW0 A;  3U4S A;  4LHN A;  4CDX A;  1W9T A;  1VRH 1;  2ZML A;  1CAU A;  4HBN A;  2JB8 A;  5T5O A;  5KHJ A;  1W8F A;  1ZRI A;  4YVS C;  2QTW B;  3N9N A;  5FXV A;  2R1B A;  3B69 A;  3VZO A;  5C8C A;  1JYX A;  3SH3 A;  5KC6 A;  4K20 A;  5A33 B;  2VOT A;  5HCB A;  3VGI A;  3MF9 A;  1NCR A;  5F3E A;  4YM3 A;  3AMQ A;  3WNK A;  3T2Q A;  3VBF A;  3EQE A;  1RIT A;  3MV0 1;  4XQW A;  1CN1 A;  1ZZ9 A;  3WCR A;  4AFM A;  4TTG A;  2CHH A;  4CDU B;  4IE4 A;  1PK6 C;  1DQ5 A;  4I09 A;  2VR4 A;  3O1V A;  4NMI A;  4LT5 A;  1ACC A;  2HWD 2;  3OBZ A;  1CPN A;  4IEV A;  4GWM A;  1RGS A;  2ZGR A;  2WZR 3;  4DMI A;  3WDT A;  3DYM A;  3Q8E A;  1WW5 A;  2XUM A;  3K51 A;  2A6V A;  1SCR A;  2OKX A;  2P17 A;  1QWR A;  1XYP A;  1OA3 A;  4NN0 A;  3T1M A;  3CHX A;  4N43 B;  1RB8 G;  2XGX A;  5FUI A;  5IVE A;  2OYZ A;  1W06 A;  3JBG 1;  4UAP A;  4BJ0 A;  3VHP A;  4NPR A;  4AHZ A;  4BH9 A;  3UKT A;  4AVS A;  1H0B A;  4FOW A;  3ZSM A;  3H7J A;  1AR6 3;  2EIB A;  3LE0 A;  2XBO 1;  3O12 A;  4CE8 A;  4DXS A;  1CAW A;  2A6Z A;  3OUJ A;  1TME 2;  4XZP A;  1PGL 1;  2G9F A;  1SDW A;  1PNF A;  2VCA A;  1S0G A;  3CO2 A;  4P00 B;  3ZSJ A;  3GF6 A;  3USU A;  1QJF A;  3PU8 A;  3AX4 A;  1AR8 2;  2XJS A;  3JB4 C;  1XE0 A;  1TNR A;  2V72 A;  2WAO A;  3ZYI B;  3ZXF A;  4OZO A;  1G6N A;  4YG0 A;  1GSL A;  2V4V A;  1COV 2;  4P02 B;  2RG4 A;  4DIN B;  5CNA A;  4C1X A;  2R1D A;  2JDM A;  3FX3 A;  3KWV A;  4FPO B;  1RUJ 3;  4LIU A;  4LLO A;  1O91 A;  5EWS A;  2E9Q A;  4TYS A;  1MS4 A;  1MR5 A;  2VOW A;  2XJT A;  2AEN A;  4JGY A;  4PLO A;  2BV4 A;  1UPS A;  4QQ2 A;  1WWY A;  2ZAA A;  5K0U A;  4CP9 A;  2NQY A;  1W6N B;  2R07 3;  3WDV A;  1RUH 3;  3W21 A;  4K21 A;  4NII A;  1OF3 A;  1XNA A;  2HKX A;  2BDR A;  2OUH A;  4Q1P A;  1SFY A;  4XMA A;  4YYO A;  5JOZ A;  1J1T A;  4ARY A;  1UW8 A;  4LMF A;  1UXX X;  1LOD A;  1PGW 1;  5I0T A;  1GOG A;  1POV 0;  1C4R A;  5FMO S;  4XF3 A;  3I4I A;  2V09 A;  4FAH A;  5DDJ 1;  4XBL A;  3T08 A;  3WVJ A;  1BVP 1;  1XB9 A;  5FZI A;  4ZS2 A;  2PEL A;  4BQ1 A;  2JE7 A;  2ZMN A;  5HV0 A;  1G9B A;  2I45 A;  2RS5 1;  4LLF A;  2VQA A;  4PIY A;  4YNI A;  1BMV 1;  1L7L A;  1V70 A;  3CQO A;  5C3Q A;  1OXC A;  1K5M C;  3UKV A;  3WDW A;  1T6B X;  4AVC A;  4JRL A;  3VBR B;  5AC9 3;  4A41 A;  5F5A A;  1Y9M A;  1OPM A;  1GKB A;  5FYM A;  1TVG A;  2VQU A;  2DCK A;  3AMH A;  4BXF A;  4LKF A;  2G9G A;  5FK8 A;  1UX7 A;  3HBK A;  5BNO B;  2D43 A;  4Y1Y A;  2E31 A;  3ZXG A;  4JDN A;  4XUP A;  5F3I A;  4BB3 A;  3RZG A;  1ENS A;  3NRU A;  5JXG A;  5JIA A;  1UCX A;  5ACA 3;  1QJU 1;  5LAT A;  1H1I A;  5FKB A;  1W2N A;  1DQ0 A;  5C9A A;  5JOY A;  3KHC A;  3WW2 A;  4QAW A;  3I3B A;  4LEJ A;  3K4Z A;  3ATG A;  3NNF A;  5BYN A;  2VBP A;  4FPE A;  1S2K A;  3CJI C;  2ZKL A;  3E6C C;  1FYU A;  1IS3 A;  2RM2 3;  2VUJ A;  1MQT C;  5FYH A;  3GJA A;  4E4S A;  1KGY A;  3AZW A;  1FMD 2;  3QOP A;  1DGW X;  4MG2 A;  3T2P A;  3T2O A;  5KHH A;  4ATE A;  1AZD A;  3ROU A;  4DO0 A;  4WM8 B;  3IDE A;  4OHY A;  3WNO A;  1RVF 3;  1S0B A;  1W6O A;  4YAR A;  1APN A;  1I1E A;  1PMJ X;  1NLQ A;  5KR7 A;  5DAV A;  3AL6 A;  3MLL A;  4R9D A;  4CDQ C;  2R04 2;  4JKM A;  1AUY A;  3H1Y A;  2OW4 A;  3SKJ E;  1DGW A;  4XET A;  5A7N A;  5JPN B;  3M1H A;  1RUF 1;  4M0N A;  3RYP A;  2TUN A;  1LNS A;  2W68 A;  4HN0 A;  1RUC 3;  3KVA A;  5LEK A;  1IPJ A;  3IPV A;  1D4M 3;  3ZYR A;  3VV1 A;  3MEP A;  2BBA A;  1ZBE 2;  2BQP A;  2O14 A;  4G4F A;  4MGQ A;  4MHR A;  2QQM A;  2VZV A;  5GZF A;  1ZM1 A;  1F9K A;  1IGO A;  2KR2 A;  3HEI A;  2XON A;  4GQ7 A;  4GKX A;  4OFG A;  2TNF A;  2R06 1;  1HDK A;  3HQU A;  4CDW A;  3RYK A;  3IZO A;  1F5J A;  2BNN A;  2PHD A;  3OSD A;  4E8D A;  2HYX A;  2XHK A;  1MS8 A;  1R1Z A;  4NHY A;  4ASM B;  1D0G A;  1E5S A;  5LA1 A;  5K4L A;  4LHK A;  5L7O C;  4QPG C;  5KXC A;  4FAG A;  2FMD A;  2Y64 A;  2WFF 1;  3ASI A;  2VZP A;  2XOM A;  3WDY A;  2QUO A;  4QQH A;  1BVV A;  2DU0 A;  3AC0 A;  3K48 A;  3UK9 A;  3WT3 A;  3ZYG A;  3FBY A;  4FXG B;  5LB6 A;  3HBZ A;  2AC1 A;  4M3C F;  5FZK A;  3AKR A;  2VW1 A;  1WW7 A;  3ZKY A;  1J58 A;  2VZ1 A;  5FPU A;  2P4E A;  2QQO A;  1R1A 2;  4TXW A;  2WO7 A;  2XQR A;  4NO4 A;  1ASJ 2;  1OLM E;  5DAW A;  5BV6 A;  5FZM A;  1C8M 1;  1YJK A;  1PX3 A;  1UQX A;  4HOO A;  5FPA A;  1X50 A;  3OTF A;  2WYS A;  5FR3 A;  1YQ6 A;  3FFQ A;  1Q8Q A;  5JI7 A;  3G7D A;  3P5B A;  1EPZ A;  1HRI 3;  2TEP A;  3VD5 A;  2VTX J;  5JLV A;  3PDQ A;  4ITC A;  1H8T B;  1VR3 A;  2HWF 3;  4W50 A;  3ZR6 A;  1CQ9 A;  4NRO A;  2ZGS A;  4Q0S A;  5FPV A;  1S2E A;  1RJ7 A;  1JXN A;  4XF4 A;  5CFC C;  1W6Q B;  3I3D A;  4Q4W 3;  5FJH A;  1MS3 A;  2J1T A;  3ZDV A;  3SNM A;  2KM2 A;  4FBF A;  1WLD A;  2J22 A;  2JDZ A;  1JU4 A;  2XH6 A;  3KD4 A;  5T50 A;  4A7K A;  5FY7 A;  2Q1Z B;  4DOU A;  3PIG A;  1NCQ A;  1LHU A;  3WUC A;  3LQC A;  1VRH 2;  4FT8 A;  4PIZ A;  3IDC B;  1OVS A;  1AYN 3;  3TB0 A;  1U5Z A;  1QXR A;  1OBN A;  3RNS A;  4O65 A;  3L9J T;  1UAI A;  3U78 A;  5FFO C;  5CZK A;  1BK1 A;  2ADE A;  4E8C A;  2HWC 3;  5JWP A;  1XNK A;  2BP6 A;  4EN9 B;  2IXK A;  3FLT A;  1DDL A;  4Y33 A;  3GBF A;  1BZW A;  1QQP 3;  1V9U 3;  2EIG A;  4CCC A;  2ES3 A;  1PMI A;  1LKN A;  2VPV A;  5D8A B;  1CAX A;  4XBQ A;  4QX2 A;  5CFD B;  4P9G A;  1HXS 3;  1AR9 3;  3T4V A;  1DU3 D;  2WS9 3;  4XHX A;  4Z92 B;  1GR3 A;  1PNG A;  3WLU A;  1W8Z A;  2W94 A;  4YW5 A;  5FZO B;  1AL0 G;  4MXV A;  4CA9 A;  4QPW A;  1CGP A;  3ZMO A;  4OHZ A;  5I0D A;  3D4K A;  3ZSK A;  4MGK E;  3IT8 A;  3VBO C;  1AX1 A; 
#chains in the Genus database with same CATH homology
 3O1S A;  3I3Q A;  3RZH A;  4IE7 A;  4NPL A;  4NID A;  3RZM A;  4O7X A;  4NRQ A;  3T3Y A;  2FDK A;  3S57 A;  3RZJ A;  3LFM A;  4RFR B;  3I2O A;  3BIE A;  4NRP A;  3I49 A;  4IE5 A;  3BTY A;  3BI3 A;  4IE0 A;  3O1T A;  4QKF A;  4CXY A;  4IE6 A;  4JHT A;  4OCT A;  4QKB A;  4QHO A;  4NPM A;  3H8X A;  3BU0 A;  4NII A;  2FDH A;  4ZS3 A;  3I3M A;  2FDG A;  4MGT A;  4ZS2 A;  4QKD A;  3BUC A;  4NRO A;  4QKN A;  3O1M A;  3RZL A;  3H8O A;  3O1P A;  4O61 A;  3O1R A;  2FDF A;  2FDJ A;  3BKZ A;  4IDZ A;  5F8P A;  3S5A A;  4NIH A;  2FDI A;  3O1O A;  4CXW A;  3KHB A;  3RZG A;  3T4H B;  3O1U A;  2FD8 A;  3BTX A;  3KHC A;  4ZHN A;  4CXX A;  4NRM A;  4NIG A;  3T4V A;  5DAB A;  4NJ4 A;  2IUW A;  4IE4 A;  3BTZ A;  4MG2 A;  3RZK A;  3H8R A;  3O1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...