4JHTA

Crystal structure of alkb in complex with 5-carboxy-8-hydroxyquinoline (iox1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 5-Carboxy-8-hydroxyquinoline is a broad spectrum 2-oxoglutarate oxygenase inhibitor which causes iron translocation
doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4jhtA00
3RZKA 3RZHA 3BU0A 4CXWA 4QKDA 4O61A 4ZHNA 4NPLA 3T3YA 4QKFA 3O1OA 3O1MA 3O1VA 4OCTA 3BKZA 3BUCA 3I49A 3BTXA 3O1TA 3H8XA 3BTYA 3BIEA 3RZGA 4IE0A 4NIGA 4NIHA 3RZLA 4QHOA 3T4HB 3RZMA 4CXYA 4JHTA 4MG2A 3BI3A 5DABA 4NJ4A 3T4VA 3O1UA 3H8RA 4ZS2A 3S5AA 4QKBA 5F8PA 4IE6A 3LFMA 4NROA 4O7XA 3H8OA 3RZJA 2FDHA 3S57A 3O1SA 4NPMA 3KHBA 4NRPA 4IDZA 2FDGA 4IE7A 4IE5A 2FDIA 3I3QA 4NIIA 4NRMA 3O1RA 3BTZA 4IE4A 2FDJA 3I2OA 3I3MA 4MGTA 3O1PA 4NRQA 2IUWA 4RFRB 2FDKA 4QKNA 4NIDA 4CXXA 2FD8A 4ZS3A 2FDFA 3KHCA
chains in the Genus database with same CATH superfamily
2I07B 2BQPA 3I59B 4HPKA 5HV0A 4EV0A 2VMHA 4QPGB 5L7OC 3V64A 1GSLA 1PK6A 3VL8A 3ACFA 2XJSA 5IYYA 1ND3C 4CUGA 4XJ9A 3OPWA 2VZRA 1LODA 5KHJA 1POV1 5FP7A 1LGCA 2ZMLA 2QTWB 4I01A 4CCLA 1EYBA 5FWEA 2A75A 1NLRA 3HEIA 4BQ5A 4B7KA 2LW8A 2O8OA 3ZN4A 1MS1A 4C8DA 4GH4C 1JOPA 1ULOA 1IS6A 4BE3A 3MDPA 2KXLA 3K3OA 1SCRA 4A6SA 5BNNB 5EZWA 3VBHC 3V65A 3O1PA 2WT0A 5FYYA 4YW6A 3ZYGA 5DAVA 4OFGA 4TLFA 2EAAA 5E88A 1HQNA 3JBG2 2WNEA 4IERA 2TNFA 4RFT0 3O5SA 5DN2A 1OURA 3O12A 4LIUA 4XFIA 3WINE 4C0HA 5FXXA 1FV3A 5B4XA 4Y4RA 3QBQA 5H9PA 4A4AA 1SMVA 3MEPA 2BWAA 5I8TA 5JXIA 2WC2A 4Q4V2 4ASMB 1NCQC 2ZMKA 4CDXC 3RYRA 1C3HA 1PX4A 3I2FA 3ZSJA 4YFZA 3R0RA 3KV6A 1WBLA 3D0JA 4A41A 1QGLA 3HWJA 1YI7A 3THPA 3Q8EA 4MHUA 3SQOA 2WNVA 2PHRA 1RUOA 3M3CA 5A6YA 1LOFC 3H3UA 3I3QA 5C71A 4DQAA 4QDSA 1S0BA 2VOTA 2YFUA 3WDVA 5JZGB 4DNYA 4CCCA 3ZFEC 3VUOA 3I2KA 1O59A 2AREA 5LASA 5AC91 2ZZJA 2TEPA 1WMDA 4XILA 5EHDA 5T5JA 1O6UA 1CIYA 2YGLA 1JYXA 2B39A 3U07A 2DTWA 4OYUA 3ZYFA 3LIHA 4QPIA 4DUWA 4V2WA 1RIRA 2MNGA 5LBFA 4QT6A 2WLQA 2VW1A 4B8EA 4UF0A 2WINB 4JRAA 3HBZA 5CNAA 5AC92 4DEQA 4WM8A 3FMGA 3PJYA 1GANA 2JICA 1JOBA 4ITCA 4RS5B 3K3NA 5FZMA 3N9QA 3FHIB 4QX5A 1HKDA 1W9WA 4UW3A 4AR2A 1DGLA 1JZ7A 3CIHA 4ONUA 5FY7A 5FZKA 1SDWA 2UY8A 1Q8OA 2RS31 3CJIA 1OHFA 5T5PA 1PVXA 4HPKB 3WY6A 3FUOA 3TBDA 2BRTA 4CXXA 1KDMA 2PHWA 2W3JA 2ARXA 3NJZA 4P9JA 2YY1A 3NMBA 4NPLA 1BMV1 1KGYA 1QH7A 3VBUC 2J1VA 3I3DA 1NQJA 3OGRA 4UAPA 4TZDA 3AXDA 2WRAA 2QZ3A 2DUPA 3ZPOA 4PHZA 5DABA 5I0DA 2D97A 2Y0OA 4GD4A 4XTMA 3WHTA 5C3QA 1E5RA 5DAQA 1B35B 1OFNA 3S6PA 4OMCA 3WNXA 2DCKA 4LK7A 5B4NA 3AP5A 4AEMA 3W58A 3PMEA 1OXCA 2O14A 4ES9A 1DFQA 1GZCA 2W1SA 4LKDA 4ZXEA 1XSQA 3RVHA 1J83A 3AMPA 4E8DA 2ZX4A 4K8FA 1ASJ3 4CDWC 5CISA 1M06G 1AYM1 2B8MA 1H9WA 1UYPA 1VB4A 2BYVE 2X10A 1IQAA 3FHQA 3LF7A 5JOWA 4Q4W3 3ZKYA 3B02A 2BVBA 4QPIC 1REFA 1VP6A 3TAYA 2CWMA 2MEV1 4BQ3A 4YZ1A 1ZREA 3NV3A 2ZXQA 3OTFA 4Z2WA 1VRH2 2R1BA 3BIWE 3UKNA 1ST8A 1RTVA 2GH2A 3KHBA 1WGPA 4MGQA 3ZFGA 3H50A 1UZYA 2HKXA 4HETA 2CDPA 4LBKA 4ATEA 5DZGA 1GNZA 4XURA 2NMOA 3ZOIA 4YM1A 1NCRA 5C70A 4HVRA 3AKQA 3P6BA 1SEFA 3R05A 3IKWA 3C7EA 1Q8VA 2OKXA 4KQ7A 4ZHNA 1OA4A 3CHXA 1VBA1 4META 5KC6A 3SH5A 4BQXA 2WZ8A 1BZWA 1PK6C 2ZGLA 4LT5A 2D6LX 1QJFA 1W8UA 4MYEA 1U5IA 2G4IA 3C8XA 1KEXA 4IEZA 4LLFA 1WCDJ 3JBG3 4XZPA 4YVSA 2V4VA 1VBA2 1A6CA 1I1EA 2RVAA 3ZYIB 1YUDA 2ZOEB 1RUH2 1W6OA 2ZA9A 3MYXA 4HKWA 5CFCA 5HPOA 3ZFFC 1UMHA 3I2OA 2A73B 1V9U1 3VDDB 2PLV2 2CU5A 2R0HA 2XH6A 1RHI2 5K0UA 2ZGMA 1OA2A 2F17A 3WF0A 1V6NA 3ZN5A 3HOBA 1N3OA 4Y1YA 3DXUA 3DV8A 3VL9A 5IWFA 2QQLA 1PO12 2B7YA 1R1ZA 4OHXA 4S2GA 3ZDSA 3W5NA 4MLOA 1O7FA 3RYKA 1C4RA 1V9U2 1LHNA 2YPJA 1DQ2A 1XNKA 1I9RA 5KHKA 1PZ9A 1LTEA 5EJZB 3H8OA 4A3XA 4M4RA 3KD4A 1EV12 3BVCA 2J1TA 4ZY9A 2VC9A 3R6SA 3PUQA 4JKMA 5LK5A 2JENA 4QGLA 1K42A 2W39A 3WNLA 3SH4A 4XBQA 1ULCA 3R4SA 1LOEA 1UXXX 1CAXB 2P3YA 1CZTA 3WF3A 5AFBA 5C5UA 1DDLA 1UY3A 1PIV3 3EO6A 4L97A 1IZ3A 5BPXA 2Q8CA 4ZU7A 1LEDA 3FZ3A 3LOBA 1VAVA 5CG9A 4HVQA 4UW6A 2VVFA 4QGMA 1RMU2 2HWC2 3H1WA 3ZMNA 1BEV1 1DG6A 1V00A 3N9LA 2Q1ZB 2YFZA 4IUGA 3JCIA 1SLCA 2OT7A 1UPIA 4AQSA 2PMWB 4CDQC 2IWGB 3PUIA 5C9AB 1LENA 3BOWA 4Y3OA 1K45A 1PO23 1ZBE1 3GHNA 5FP3A 3ZM8A 4KG0A 2XBO1 2AZ5A 3O7OA 3NKTA 2IFRA 3HJRA 2JD4A 4O9GA 4YW4A 5GZGA 1CONA 1R1A2 1DYOA 1UIKA 3ACLA 4FTSA 1UOJA 2WYFA 2MEV3 4BLJA 4GB32 3HR9A 4DY5A 4CU8A 3Q8CA 4D6RA 2UYAA 3T0DA 2PAMA 4E4DX 3ENRA 4BU2A 4NHKA 4W65A 3H3LA 4ATFA 4W50A 2XJQA 1YFWA 3CLPA 5ISLA 3URFA 2BOIA 1YQ2A 3GXUA 2A3XA 2H6BA 4LO6B 4E8CA 3UKVA 1R091 4DRRA 2D5FA 2R072 1Q3EA 3CMGA 3SLIA 3ZXJA 3TEZA 1KXGA 1RVF2 4RHV2 4BZ4A 4JHZA 1UY1A 3I2GA 1ACCA 1LGNA 4AYUA 4HFSA 1MEC1 4KL1A 4MGSA 3VZKA 5E8AA 1PHMA 1CAWA 2FD8A 1ZZ7A 4FPYA 1N1VA 1NA1C 2OUHA 3WNKA 5C9AC 3PNAA 3BU0A 1WMEA 4NHXA 1ZZCA 1V6KA 3KT4A 2JB4A 3BKZA 4QM9A 1AXYA 4FFFA 1OUXA 4XAEA 5IVVA 5FMDA 4N7UA 3VB9A 2ZGPA 5A1LA 1B09A 4DS0A 1ASJ2 4ZKTB 2FMDA 4QXBA 4GA9A 1SFYA 1MQTB 3PIGA 2DCZA 3GCWA 2YU1A 3R4DB 4EE2A 5FYMA 5J7MA 1LB2A 2BVVA 5IK5A 1DCSA 1UMIA 3EBRA 3T0AA 2P4EA 2UY9A 2JDPA 3JD73 3LGRA 5JR7B 2RJKA 1RYYA 2E7TA 4CCDA 2ARCA 2WN2A 4IESA 2WUHA 3DL3A 4XUPA 3OYWB 1YQ6A 1ND2B 2UYBA 1NAEA 3FLTA 1FNZA 4HK8A 4N8MA 3VV1A 1VBC1 1WLWA 2WKKA 4CXWA 1AYM2 2XB6C 4IEPA 1X9TA 1JYWA 3WF2A 4JAAA 2RR12 4XXPA 3LEGA 2VNRA 4FFGA 4KNCA 4PF1A 2W47A 5IATA 3VDBA 4QGNA 4AVAA 3MLJA 4HMZA 2J1EA 4LUKA 2ZJCA 1AL0G 4J1XA 4XTPA 1F9KA 2DDUA 3MIEA 1AYN3 2E53A 2R1DA 4NRPA 3GZAA 5ANNA 4IE5A 1IS3A 1GWMA 3E97A 1UYYA 3N7MA 5BY5A 1OQ1A 1RUE2 3ROUA 2P3JA 3J8F1 2E6VA 1VR3A 1S0EA 2ET1A 2VZSA 1JYNA 5FO8B 1PZ8A 3N9MA 4GWIA 4OZOA 1GU3A 4XZUG 2OPWA 3WEZA 2YBPA 1D4M1 2AH2A 2HWF3 1HRV2 3CDZB 3L2YA 4NO4A 2P6CA 2E32A 1OBNA 2VUCA 3AVSA 4FP2A 4RD7A 1VBE2 4UW4A 5EPAA 4XFAA 5FZHA 4URAA 2R7EB 3ZVXA 3MIBA 1CZVA 2J22A 3O14A 4D3WA 1QU0A 3K4DA 1PO13 1MEC2 4HONA 1P8JA 1OF4A 1Z7S1 3RMXA 1SLBA 4Y33A 1LOFA 2RG4A 4PI2A 4L9BA 3ZR5A 4NIIA 2WNOA 1IGOA 2VQUA 4LBQB 2A6VA 4AZZA 4BLIA 3N7LA 1O3TA 4H3WA 4B29A 3U4SA 2JB8A 1PMJX 2V4AA 2GP3A 4OHVA 5J3UA 1L7LA 4FO9A 4QKFA 3UNPA 3RI9A 3ECQA 4BQ1A 1ZRCA 4PDWB 4LBJA 1WCKA 3GGLA 4XF1A 4Z8BA 5C8CC 3J7MA 2W1QA 3KLSA 2W52A 4IW3A 1UCXA 2R30A 2XONA 1AR63 2IXHA 4CEYA 1CD3G 2BNNA 4NROA 3BPSA 1RXGA 3QLQA 2PN5A 4R9BA 1O8PA 1WW6A 1VBD1 2EALA 2RDNA 3FN9A 1UYXA 4YG3A 3U75A 2GMPA 1DZQA 1QQP3 2ZTNA 4QQPA 4LK6A 3I4IA 4AWDA 1QHDA 1CPMA 3IBMA 1WCUA 1Y9QA 3AKPA 2E9QA 2UU8A 4N43C 1EY2A 1NCRC 2DUQA 5C6CA 1GQHA 3DXTA 1OF3A 5F3GA 5BNQA 4NIHA 4PIXA 3LB9A 4AI2A 4LBOA 3ZFGC 1RGSA 4P9LA 3WF1A 4AEDB 4UWDA 3VBUB 1OOPC 4XQDA 4BK5A 4C90A 4YZ2A 1J59A 1TNFA 1JYVA 1ULPA 3NJVA 3MW2A 1QJY3 3IDAA 3OEBA 3LEIA 1HRI3 3CL1A 5HCFA 2BGPA 1BYHA 4JDMA 2WO7A 4O7XA 3S57A 1C1FA 3AK0A 1J3RA 2VO5A 3NO8A 4Q0QA 2LROA 5EP9A 2GMEA 1J3PA 2K46A 4QU1A 1YQ5A 3VBFC 1BK1A 5JIAA 1AR71 2FDKA 1QF3A 2ZX0A 2QQOA 4FQ4A 5GJ6A 1ULGA 1TMF3 2RMU2 4WM8C 1WCSA 4XE9A 1AL21 3WP5A 2OXBA 3C7HA 3JQXA 3SITA 5JOZA 2RS52 1Z0HA 5FYUA 4YZ3A 4Q4W1 1BVVA 2PXJA 4LO5B 4AOCA 3FLRA 3UGFA 4NVPA 1AL23 3MLLA 4K1YA 3B9CA 2YYOA 3DEMA 2HWE3 1JODA 1NX9A 1H4HA 3AJZA 4KBBA 2W1UA 1QEXA 2ERFA 1V6JA 3ZYRA 3ZFEB 2R063 5JZGC 4CP1A 3H1YA 3N9PA 4N53B 5FYVA 4CYDA 2BJSA 1ZBE3 2UWBA 2HEWF 3OBTA 4IV1A 3TN93 4Y1UA 3VKFC 2GC1A 2EF6A 2C6SA 3OYWA 2ZHLA 5FZ6A 5HCBA 1OMIA 3E5UA 4AVSA 3MW4A 1RUH1 2WA3A 2D7FA 2NP0A 1CJPA 4BXFA 4D94A 1CAUB 4CP0A 5KXDA 1UWWA 3AYEA 2A3WA 2B9VA 1HB3A 4GJZA 2DURA 4K8RB 1NLQA 4XFGA 2OUJA 2RR13 5KC5A 3FFZA 2FQPA 1VBD3 3K4AA 4HT1T 1X8EA 1N1YA 4Q4V3 5ABJB 5BNOB 1RC6A 1W0OA 5L36A 3OBRA 4DUVA 4O65A 4H2AA 4B3NA 1X8MA 3H9AA 2Z2SB 5HXMA 1WWYA 2E51A 4ARXA 4ZONA 1XNAA 4D69A 2PYTA 3SHRA 1HXS1 5A3PA 1QJU2 3J9SA 4HSJA 1AR81 4KBZA 3MIGA 3H8XA 1HV1A 1ENSA 2IVIB 1LU1A 2DVDA 3GZUC 4HANA 5FMOL 3ON7A 2Q1MA 2VOVA 4HKLA 5EXOA 3V0AA 4MV2A 4QKBA 4WM7A 4YGBA 1AR72 5EYYA 3T1LA 1H2LA 1UQXA 1GV9A 2W87A 2PELA 5EWSA 3Q8AA 1RINA 1GOFA 4CCOA 2XLGA 2X5IA 4XXAA 1AHSA 4RQPA 2OPKA 3NAPC 5FMOS 1W2AX 1ND3B 3SMHA 1D0GA 4Q4Y2 3OG2A 1AR91 1N3PA 2LM3A 1FMD3 5A3LA 1UU5A 2VMIA 2Z5WA 4YVSC 3DPRB 3AB0A 1HRV1 1F2NA 3AZWA 5IHRA 1POV3 4L2NA 4IGPA 3JUUA 1DU3D 4Q8LA 4C1WA 3WW1A 4PIYA 3MIFA 1WW4A 2J1RA 3SNMA 1BKZA 1PM4A 5IT6A 1Y3TA 5F9TA 1H4GA 3KVBA 4AF9A 1KD7A 3AFGA 4J6GA 2HWD2 4OUMA 4W6YA 2I45A 1KFUL 3WP4A 1CJDA 1ENQA 5SV8A 5DUWA 1AR62 3LAGA 2BNMA 3WCSA 4RGGA 5GALA 1ND3A 4K7JA 1RUJ3 1SLLA 2FZ1A 2QBXA 1DYKA 2VQTA 4R8HA 4CEYB 4DB5A 4EROA 1OH4A 2ZGOA 3GZEA 4QKNA 4CU6A 4EN8B 2RV9A 5GLTA 4YM3A 3ABZA 3OF1A 2BFUL 3GNEA 4YW1A 1DGRN 4XJAA 5TSWA 4AI0A 4YGEA 5JXJA 3ZFFB 2OVUA 2WQ8A 5CEHA 4AQTA 1CGPA 1XSRA 5IK4A 2XKOA 1Y9MA 4WM7B 4IEWA 4NPRA 2BGCA 3NV2A 3VBOA 2JECA 1RUC1 3POWA 4XMAA 1A8DA 1QJY2 1C1LA 1R1A3 3J7NA 5L73A 3RFRA 4ASKA 1OLRA 2QKDA 4CPBD 3U10A 1YIPA 2OIIA 1V0AA 1JI6A 1MS3A 1UY2A 4GB33 4OULA 4CCEA 4F3JA 2P5BA 5FZ7A 3VD4A 1H1AA 2HWE2 4WZFA 5CYYA 3WDUA 5FY0A 4FPJA 4LMFA 5FY5A 1YQCA 4CA9A 2ZS6B 4K21A 4H7LA 1RUI2 4CDUB 5CADA 3NL1A 1TMF2 2RMU3 3B94A 5J09A 2ZEYA 2J7MA 4I0AA 4B4PA 4AAXA 3ZN6B 3BPZA 5IK8A 2G9ZA 1RVF3 4Q1PA 1T2XA 3AKRA 4DO0A 4TSVA 5E6HA 1H1MA 4A42A 3AYDA 3VBHB 3MICA 2B9UA 5IK7A 2P2KA 4LHKA 1GZWB 3N4MA 1S2BA 1APNA 2VW0A 4XFFA 3S0MA 2VZQA 1R093 1XU2A 2OS2A 1VPHA 4CU9A 3O0WA 1HB2A 5F7UA 1L7RA 3LSEA 1X33A 3WQ1A 4XF9A 1FYUA 4YGDA 1VBA3 4AVTA 4CEWB 3ACGA 1NA1A 4FPEA 3TN92 2RS51 3BUCA 1D2SA 3KMHA 5DDJ1 2HWD1 1RVF1 3ITQA 3QH6A 3MZHA 4ARYA 2FZ2A 4GQ7A 1BJQA 3S7IA 4MGZE 5L7OB 2PLV3 4MG2A 3L2HA 5ABJC 4MVTA 1AXZA 2G19A 4QX8A 1B35C 2QQVA 3N7JA 2DVGA 1XNTA 1H2KA 2ET7A 5FY9A 2VOXA 4H55A 3O1RA 1W2UA 2MPFA 2WSVA 3C3VA 4XHBA 1ZX5A 1POQA 2WFF1 3UJQA 4N9IA 3VKOA 4EQVA 3JZVA 3I7DA 2UURA 1CAVA 1AR73 3OB8A 4RSUA 5GKAC 4D6SA 4W6WA 2DUOA 3NV1A 3LIGA 5FY4A 1S0CA 1HW5A 2VW2A 1QJU3 1J84A 5FTTC 4IXLA 1PVC1 4ZS2A 1O3SA 4G9SB 4QXHA 5JVVA 3RS6A 5A33B 3M3IA 1R082 4WVWA 1O3RA 2HWE1 4DPNA 1DQ6A 1SLIA 1QJX2 2QQIA 2VNVA 2VR4A 5JCTA 1X36A 2HWF2 2BV4A 5FOJB 3I2IA 2WDBA 1S0FA 2EVXA 3HNBM 4OCTA 4Q2FA 4LE3A 3T09A 5JXGA 1WLTA 5KHGA 1AR82 3C7OA 3MO4A 1CAUA 1FMD2 1AZDA 2Y8KA 2QQMA 4WVZA 1E5HA 4MO3M 1LECA 3ACIA 3NSTA 1LHOA 4YM2A 2R16A 2VG9A 2Y38A 1GZWA 3O1UA 4ISQA 1NQDA 2E63A 3I54A 1GP6A 2YHJA 4Z2AA 5HCHA 3RPQA 1GWLA 1D4M2 1VBC2 3WDYA 4CCKA 3KCYA 1PNGA 3D8CA 2WO3A 1X82A 2A70A 4QM8A 3AP4A 4YPJA 1F15A 4DY3A 4LOTA 1Q8PA 2W94A 2DF7A 2WZR1 2XL9A 3KV9A 4M3CF 1RMU1 4YVSB 1JU3A 1Z7S2 2EXJA 3AMQA 1MQTC 4BHPA 2IFWA 1K3IA 1S1AA 5CBLA 1UXZA 2C9AA 5BNPC 2NM1A 1LCLA 2H0BA 2VCAA 3KCCA 1W3XA 4HG6B 2D3RA 5A3MA 1H8TA 4CPBA 1JW6A 2A5ZA 4Y26A 3INAA 4QQHA 3VN4A 4XUNA 3LEKA 1JZ4A 3W5MA 2VXJA 4EN6B 1C5HA 1AR61 1VB2A 4XACA 3MIDA 4XC9A 4RQPC 3ES4A 1MS4A 4Q1RA 2ZMNA 1LNSA 2FDIA 5LA1A 1BHGA 2V73A 1RUI3 2QUOA 3OGJA 3GCXA 1J1LA 1W6MB 3B5LB 1BXHA 4DEVA 4XIKA 3H7JA 5I0UA 4F8AA 3K4ZA 2HH9A 1VMJA 1F35A 2VNOA 4E4HA 1TQ5A 1FX5A 4JGYA 4CUCA 3T2TA 4NWVA 2I2SA 1LEMA 3KV4A 2NQYA 1Y43B 1OVPA 2MHFA 2P17A 4IEVA 3VHOA 3V0AB 4A7ZA 2ZHNA 4RHV1 2DVFA 3N35A 1F5JA 1YXWA 2B46X 2XVLA 4P00B 1QJX1 3K2OA 4Q26A 4SLIA 4OHYA 5FUNA 2D6NA 2EIGA 1SACA 2PHTA 2FCUA 3G7DA 5IVFA 5LBEA 5GLUA 2ID4A 5FPVA 1ZBA3 1Q8SA 4DXRA 1N3QA 2VGDA 1WMXA 3V0BA 2A6YA 4KWJA 2QFEA 3RYPA 1DYPA 4DXZA 4AQ6A 2WT1A 3RZLA 5I91A 1LAJA 3H1MA 5EJ3A 3AP6A 4NAMA 3MIHA 1GUIA 3HNMA 5JR2A 3POYA 4R9DA 4BOWA 2WN3A 2WT2A 1CN1A 5JLVA 1W9FA 3QOPA 1ZBE2 1IPKA 2CDOA 3D3AA 3OUHA 4PLNA 4XETA 3DKWA 5K9YA 4Z82A 4FFIA 3CQOA 2W9XA 4MH0E 5HCAA 1R1A1 4BDVB 2CGPA 4GJYA 2ZGRA 1UU4A 3QCWA 1NXD1 2Y26A 3KCXA 3RZHA 4O61A 4XFBA 1AVBA 3BIEA 4QX2A 1R083 1CESA 3CJIC 4XUTA 5IW0A 5FO9B 3L9JT 1VE0A 2TBVA 2XVKA 5I8SA 2NLRA 2HEYF 1MPXA 1DHKB 2C5DA 2BPA2 1FNYA 4NIGA 2IXKA 3GBWA 1XOYA 1BMV2 4JCKA 2ADDA 5CFCC 1RUF3 2ADEA 5DAXA 4HLTA 4COWA 1PGL2 5KXBA 1F4HA 2EXIA 2JIJA 4Y1VA 3ZYBA 2WFF2 4XW3A 2D44A 3I2JA 4BQ4A 2ZGNA 2PHXA 4M3CE 2HWB2 4Y20B 4ZU5A 3WW2A 1PK6B 4KG8A 4M4PA 4MGKE 4J25A 1LESA 1QKQA 1OPOA 1TZOA 1E57A 1RHI1 2DFCA 4HN0A 1UIJA 2JXAA 4BISA 4LA2A 3J4UH 4JGZC 4N43A 2G9FA 2R042 3FUQA 5CAZA 3B69A 1W04A 4IV3C 4NE9A 5A32A 4INDA 4OHWA 3PJQA 4KGQA 3ZXLA 1UZWA 2WZR3 4JTOA 3PTRB 4KU8A 1WZXA 5HBAA 2LRPA 2BBAA 4M3CA 3C2UA 3U78A 5HI0A 1OFSA 2XJUA 2DBNA 3K77A 3LDRA 3OUJA 5FFOC 4K1ZA 5FUPA 5F2SA 1GQPA 3APBA 4LUMA 2ZGKA 5L9RA 4PDWC 2YC0A 5FPAA 4WV8A 1GMMA 1UKGA 4OI4A 4W6XA 3SCHA 4CDXA 5A6XA 4QHBA 3Q8FA 4C91A 5A7SA 2P3IA 3VZJA 1STMA 3NAPA 5GZCA 1U5XA 1Z7S3 1X50A 2Y6JA 2XDVA 1PO11 1XQNA 2VMDA 1QNYA 3WDWA 4QPYA 1OPMA 2BU9A 2CAUA 2JE8A 2DYCA 2EXKA 3VBHA 3WOGA 1JUHA 3F2ZA 4BB3A 2Y6HA 2GDFA 3WP3A 4IDZA 3B9IA 2ZKNA 3MF6A 4GH4A 1I5PA 5A7OA 3BTZA 5LBBA 1FT9A 3ZFEA 5KBFA 1W06A 5LATA 5DMYA 5JPNB 5A6ZA 1QIQA 3NNGA 4B4RA 5BNPB 5JI9A 4Y4YA 4UOJA 5CB7A 4CDUA 2PAKA 1QJEA 2Q1FA 4UFLA 3J8F3 2O0OA 5FZGA 5BXXA 4HOOA 3VBRB 2WWUA 5BYNA 3VLBB 1DQ4A 3UT0A 3HQXA 3ZXDA 3LQCA 1YYNA 3PTYA 2PHLA 4JGYC 2EXHA 3TEYA 2DFBA 2HYXA 3HAGA 3ES1A 5FK7A 1C5IA 3W20A 1WBFA 3AZVA 4CDWB 4AAPA 1S2KA 1AR92 4MGIE 4NR1A 3ZXGA 2ORXA 4JQRA 1S0GA 3IMMA 1WW5A 3N9NA 4CZSA 2AENA 1UPSA 3GZTB 5C8CA 5GZDA 4TN7A 2GNDA 3A0KA 4UF0B 4KU7A 3HN3A 1RUD2 1OT5A 2IXCA 4NRQA 4AVVA 3NJXA 5C9AA 3LPGA 2GH8A 4QHZA 5K4LA 1HIXA 3ZSLA 5A3NA 3ZSKA 3POBA 1V9U3 2P1BA 2PLV1 3IDBB 4KH9A 4BJ0A 4HK9A 3T4HB 4QAWA 5FIXA 5IAXA 1W3VA 5FZDA 1JH5A 3AX4A 4QB6A 3IIIA 1L3JA 2SLIA 1AX0A 3OGGA 1PZ7A 4I0BA 2AUYA 1HB1A 4RGAA 2IXLA 5EQUA 5CVRA 5FK8A 1VBB1 1A34A 4IE7A 1X7NA 3AMNA 1AYM3 2JWPA 4OQ9A 3K75B 3N9OA 1JU4A 1NY72 2BW8A 1SLTA 2JDNA 5FYIA 2VMGA 5A3WA 4Q0SA 1GWKA 3KHCA 3PVEA 3KQ4B 3AL6A 2VMFA 3NNJA 3OGVA 2H6CA 5FZAA 3VBSC 4BQ2A 3O1MA 2VE1A 4QMAA 5FYTA 2WL1A 5DXDA 1CX4A 4WZCA 1X9PA 1AYN2 2VUJA 3NKGA 4CUBA 4QDQA 1QOTA 3AXEA 3HQRA 1RITA 1VBB3 4CDQA 1RMU3 1ZZ9A 3AZXA 2OX0A 2XXZA 3BODA 4IEYA 2HBUA 5T54A 4ASLA 2CGNA 1WA6X 2BBVA 3I2DA 4Q8KA 1TE1B 3OOXA 4FCAA 1RUI1 5F1RA 3AMHA 2D6OX 5BNPA 4Q4X2 5LY1A 2PQSA 1HXS2 1W99A 1LJ7A 4WVMB 1RUF2 2JG8B 1QWRA 4P08A 4FT8A 5C4WB 1JZ2A 3GHMA 4GULA 4CEWC 1PO21 5FRAA 2D6KA 3DYPA 2ZEZA 3KGLA 4S2FA 1MEC3 1BQPA 4EWAA 1YFUA 3ILNA 5DQ0A 2WZR2 3EB7A 4E27A 4FPHA 2MEV2 1W6NA 2HWB3 1GFF2 1SBFA 4OUEA 1HRI1 4RS5A 4YZ4A 4FPKA 4IEUA 4KI5M 4NJ4A 4PF5A 3BB6A 3OBAA 4OUSA 1GQGA 4GAZA 5APAA 5EFUA 2B45X 4K6BA 3WQ7A 1QJX3 4YM0A 1UX6A 2XMLA 3WSOA 4DFSA 1WW7A 2R043 2ZEWA 2XHNA 1DQ1A 3O0VA 4JTNA 1KS4A 4A44A 3FFQA 4LKSA 5C3OA 2AGSA 2R073 1HDKA 2RJ2A 4B1MA 3A21A 5JMOA 3NW4A 1W0PA 4P14A 5FPBA 4BCUA 4PI0A 2Z4FA 5LA9A 3C7FA 5FYBA 2JDKA 4UYBA 4D0QA 1HJFA 5A32B 3WD5A 1F4AA 1LHWA 3M1HA 4XCAA 4HL0A 4PCRA 2WQ4A 2FCVA 2HEVF 1CAWB 4L8QA 2EIDA 1YRZA 2QCSB 2QQUA 1GNYA 4JX0A 3SEPA 3LA2A 2RM22 3HT2A 1SQ4A 1O91A 3M8LA 4K9SA 2PQQA 3IZOA 3DKQA 3OGSA 2NYYA 3AZZA 5H9QA 4M00A 2Y60A 2VL4A 4PT6A 4AVCA 3FHAA 1W8FA 3BGAA 4LEJA 2D3SA 4S2DA 5SV5A 3BOPA 2QQKA 5BUVA 1W8TA 2VZ3A 3D6EA 5KHIA 3EJKA 4QX1A 1AYN1 3RZZA 5CFDA 1CAXA 1CVNA 5G04L 2BNOA 2W1WA 3OUIA 1XE7A 5T5LA 1W9SA 2BDRA 2A6WA 1R081 1REDA 5AVAA 4CEYC 4XFHA 1NYWA 3GYDA 4W4ZA 4I0WB 3E6DA 3JBG1 4FVVA 1HQWA 2WAAA 2WS92 3ILRA 2Q8DA 5FLJA 3KZ4C 1UO9A 2R32A 3ZDVA 4QPWA 3BI3A 3WW3A 1MS0A 1RUD3 3SKVA 3WDTA 1AUYA 1KDKA 2VVEA 2C1FA 1OQEA 3WNOA 3WV6A 3ZYHA 4FXKB 3WT3A 1KS5A 3O1SA 1W8NA 1D2QA 3QACA 1H2NA 3GBFA 4AXOA 4WVMA 1H8VA 1ULFA 4N53C 3VZMA 5CIRA 4CDWA 2A6XA 4QPGA 3UKTA 1RJ7A 4XOGA 3I3MA 4FTBA 1XYOA 2VBDA 3BYWA 5JSPA 4FPGA 4UI9L 3DYOA 1ZA7A 3QD6A 2D93A 1J1TA 1QY4A 3USUA 2F4PA 1RUE3 1VBE3 3WCRA 1RXFA 5IFPA 5GM0A 2VMEA 3AYCA 3TYJA 2XLAA 3CU7A 4MXWA 2Z69A 5ACA1 1W2NA 1WA4A 3N3HA 4OZXA 4GMP3 1VAMA 3LE0A 3VZOA 5K8SA 4V2VA 5FZCA 3HVDA 2XQRA 3MGUA 3OPTA 2EICA 2TUNA 3AMMA 3ATGA 5I0SA 2Z79A 4AK3A 3V0BB 2VTXJ 1WD4A 3WG2A 4SBVA 2YXSA 1W90A 4DMIA 2BEOA 4C0BA 1V6LA 2RS13 4IGOA 3OCPA 4COZA 3VBRC 2ES3A 2J1AA 2VOKA 3EQEA 2CGOA 3OY8B 2ZAAA 5EIYB 4E9KA 1ULEA 1LRHA 3ZFGB 4AEDC 3WLUA 1UU6A 1FOD1 1OA3A 5CA6A 1HN1A 3DCQA 4BMEA 3THDA 5FOBB 3M2MA 3T1MA 1DLLA 1ZRRA 3PURA 4NHMA 2BERA 5FY1A 3S30A 5C4WC 2HYKA 2V72A 2X05A 2WO2A 1ZZ8A 3Q8BA 4RYDA 5A70A 5DUXA 4YW3A 4LPLA 1URXA 2NPIA 1FPN1 3DYMA 3PVBB 3WDXA 4LLOA 1HQLA 1W03A 2DWRA 5IVCA 3AKSA 3WNMA 2GNMA 2ENRA 3PVNA 1C57A 1QQP2 3CZUA 3ME2A 2GSYA 4LKFA 4QX7A 5DDJ3 5D1IA 2Q8EA 1AJKA 3T2QA 4B7EA 4P9IA 4NIDA 5C8CB 5JSOA 2E7AA 5JAXA 3P3NA 1SBDA 3VBUA 2XUMA 2OW4A 1RUNA 4XDPA 1WLCA 5FJKA 1CX1A 1IPJA 5F6LB 4Q29A 3THCA 5J96B 4LITA 2Q8OA 1Q8QA 3LFMA 1WKYA 2QDNA 1ODMA 1NCQA 2WYSA 5EV7A 1BBT1 4IQPA 4Q0UA 2QJVA 4NHLA 4XFCA 5A7WA 2NMNA 5T5OA 4CP2A 1O5LA 1RUJ1 4MXWB 4XBLA 2YB7A 3A7QA 3S5QA 3VGIA 5JSRA 5A7NA 1SPPB 2A7AA 1MVQA 1YJLA 3LWCA 4I2OA 2J1SA 2GC3A 3ASIA 1A8MA 1QJZA 3NQHA 5C3PA 3KGZA 2GMMA 2ZHKA 3ALQA 3VBSA 4LR4A 4CDQB 1H2MA 5F3EA 2YV8A 4G3YC 4UBGA 3E6BA 4AGRA 2VVDA 4CCJA 3RNSA 3I3BA 3FLPA 3IDEA 3KSCA 3LOIA 2YGMA 3E6CC 3KM5A 5F6KA 4P9WA 1BEV3 3GM8A 3LDBA 2YG0A 2X8KA 4LNVA 3WNNA 1YNAA 2XJRA 3B3QE 5T52A 1DQ0A 3EHKA 1W8HA 2FMYA 2ZX2A 5K0UB 5A6QA 4GWMA 4FAHA 1TNRA 4CP9A 2B5HA 2XJTA 2W08A 2DVBA 1RL3A 3A22A 4AFBA 5JMCA 5FZBA 4CDXB 2R062 3ZIXA 1W05A 3TRSB 4FPFA 1QDOA 1PIV1 4JRLA 4YWAA 5F39A 3D0SA 5HXVA 4CCMA 4E4ZA 1C8M3 3Q9OA 2DTYA 2RE9A 4XABA 5L19A 2WNUC 5FKBA 1US3A 3T2PA 1LULA 2F6BA 3IDCB 1HN0A 3UV9A 2GNTA 2KA3A 3OSDA 5BNNC 1RUH3 2D40A 2WR9A 1LGBA 4N7IA 2WZEA 4PBOA 3RSJA 1FAYA 4Y22A 5F5QA 5FXZA 3ZO0B 2XUEA 1QMJA 2Y6GA 1BCXA 1OI6A 2ZBJA 1RHI3 4B4QA 4CSWA 4AHYA 4YVWB 4LIVA 4BH9A 5LCWL 1OOPB 2WA4A 2OQ7A 3RMYA 1QXJA 4IEQA 1ULDA 4MOAA 5M0TA 2K2SA 5AFEA 2RHPA 3FL7A 4PJYA 5E89A 2CTVA 3WR0A 5FPUA 3O1OA 1WMFA 1DGWX 3ZKUA 2FDGA 1FMD1 2YC2A 1W6PB 1MS9A 2W0XA 1AR93 1NT0A 1NZIA 1RJ8A 1S2EA 3SCFA 1FOD3 1EAH3 5LA2A 3WQ0A 2QQWA 5EJ1B 3K46A 3M3EA 5ERLA 4JDOA 2GC0A 2WFPA 4U2AA 1Y4WA 3THTA 5F3CA 4K3UA 1ENXA 3ZIWA 3PHMA 3RDIA 1G7YA 5DUVA 4RGKA 1PVC3 4BIFA 1ZA4A 2GP5A 2VTXA 1EV11 1CPNA 4KGGA 4OHZA 4OI2A 4DINB 5KXEA 1NUKA 4HXCA 4ET7A 5LEKA 1H8TB 5FJHA 4MGTA 4A7YA 2Q0AA 1VMFA 2D43A 3SC7X 3J26N 3DN7A 5FY8A 2VCBA 5CKNA 4QU2A 4GIQA 1QXPA 2WJSA 1LOGA 1K5MB 4PDWA 1GP5A 4GKYA 3B7MA 5G05L 2E33A 4RQPB 2XOMA 4JV4A 5DZEA 5FREA 2WBKA 1NE4A 3T4VA 3OEAA 4LBQA 2ZEXA 3ZYJB 3TEXA 3OJBA 5C3RA 3K48A 1A78A 3U11A 1S4CA 3D82A 5FKCA 5T3NA 4AEJA 5JZGA 5F2WA 1LOBA 4JGZA 1ZYBA 4QX0A 3ZXKA 5LY2A 2PAEA 1ZZBA 2ATFA 1LOAA 2JE7A 2RJLA 4PBPA 4FSJA 1YIFA 3KVAA 1MVEA 1O3QA 1U5ZA 4YW2A 4LQRA 3M70A 1OLMA 4S2HA 1C8NA 2ILMA 1VALA 4L99A 1ZVFA 2VOWA 5E1RA 3WG3A 2VQ0A 2ZABA 4LKEA 4XAAA 3ZLIA 4TTGA 5DDJ2 4PQQA 2C26A 2XWBB 5I8YA 2QQNA 4YSFA 2KM2A 3NNFA 1XJAA 1TG7A 1XE8A 5CFCB 5ACA3 4XJUA 1AXKA 4WBBA 5JOXA 2X09A 1XE0A 1HV0A 5ABJA 4JKKA 3LA3A 1S55A 3VHNA 2VZUA 1ODNA 4EN9B 4EYUA 2C24A 5DAPA 5ANQA 3SXWA 3WX5A 4AVBA 2VUAA 3LEMA 1NG0A 4IE4A 1N47A 1OOPA 2JD9A 2XBO3 4LBQD 2J42A 2V5YA 1G9FA 3H7YA 4GZ9A 1JBCA 3PU8A 5GLWA 3WVJA 2YDEA 1DBNA 1NKGA 4WM7C 1ND2C 4XUQA 2UWAA 5IVJA 2DU1A 3VD5A 4JKLA 1D4M3 2HWF1 1EPZA 4I30A 4JQTA 2D5HA 1Y7BA 4QHOA 4RN5A 2K9ZA 3VD3A 4I3GA 3EYPA 4UBHA 4JVAA 4LULA 2JDHA 2HWC1 1CWPA 1BBT2 2VTFA 1UOGA 1C8M2 1IG0A 4XMIA 1JHJA 2W5FA 4FFHA 1UD1A 3ETPA 5FR3A 3WUCA 3IAQA 3MI8A 5DPNA 1HB4A 1HRI2 2JDAA 2W46A 2XKPA 5GLVA 2DVAA 2GN7A 2FBEA 3B93A 1D0HA 3LDKA 1J58A 1U5YA 2LUWA 3MPBA 4URTA 1NA1B 2BFUS 3SISA 1W8WA 1A3KA 1VIWB 4P9YA 5H9RA 2OQ6A 1FXZA 4IE0A 2DU0A 4GB31 1W6NB 2KR2A 4AGVA 1VRH3 4RA0A 4LHLA 1WCQA 3HPNA 1EUTA 3RRDA 1DLCA 5FYHA 1BK0A 3I59A 5CU1A 5FDBA 2VNGA 3JU9A 4E2GA 1N1SA 2JDUA 3PU3A 3NAPB 1AF9A 2CNAA 4X6RB 5IAVA 1AL22 3ACHA 4IV1C 4YVWC 4QQLA 2AR6A 3VDCA 5FO7B 3VHRA 2QNKA 5FPLA 2RDQA 4ZU4A 2VMCA 1QXRA 2XHKA 5JOYA 1G86A 5FZ3A 3VDDA 2XLFA 5FZ8A 4A45A 2WNVC 4O9EA 2XG3A 4GWNA 3USUB 4LE4A 5F32A 1TVGA 1JHNA 3POIA 3MFAA 3ELNA 3SCGA 4LO8A 1H1IA 4YNIA 4Y5SA 1UKRA 1NLSA 1ZBA2 4Q0VA 4LJHA 2JKBA 3PUAA 1FOD2 2IXIA 3KB5A 4BQYA 4EN0A 4CVUA 2AACA 3M7AA 2JG9A 1IKQA 2VECA 3MV11 5DUUA 1IS4A 1H9PA 3HQUA 2KD7A 1UYZA 3OBZA 3VZLA 1UZVA 3J7HA 1NXMA 3LSDA 4QDRA 4CTEA 5FZ1A 4FP3A 5KXCA 3WZ1A 3WG4A 2Q5TA 4Q4X3 4L11A 4RR3B 1JUIA 1KITA 3BTYA 2YMZA 3AZYA 4I3PA 4YRDA 4BMBA 5C33A 4QB1A 2G9GA 3VD9A 1JMUB 1O4ZA 3K51A 4A3ZA 3E5XA 2VZOA 3MLKA 2BWCA 2YBSA 5L7OA 1UW8A 1YLLA 1DQ5A 1XNCA 3UK9A 2RS33 1XNDA 2Y0IA 3DECA 1CR7A 1AJOA 3AL5A 4M0HA 3U0ZA 1JYIA 1O8SA 1Z78A 1EV13 4AI9A 3SKJE 3R4UA 5IUQA 4CEWA 1KJRA 1I3HA 4HKOA 1ND2A 1K5MC 3KS7A 1W8ZA 2P37A 3DUIA 3H8UA 5FCCA 5D8AB 4BQWA 3PL0A 3BALA 1B35A 1KRIA 5GZFA 1GYKA 4RL7A 1ZZ6A 2GALA 1ZRFA 4ZXKA 4D7YA 2ZGTA 2I74A 2QQPA 3BTAA 4NAOA 5JXHA 4BA6A 1H8TC 3POEA 2DV9A 1G9AA 4TXWA 1H0BA 4AEDA 5BNNA 3NJYA 3M4FA 4Q27A 2XBO2 2ZGSA 3MHZA 1VBE1 4BXSV 2JDYA 4E2QA 5EYXA 1ZM1A 1W2TA 4AFDA 3USSA 1W6OB 4TWTA 1KQRA 2DCTA 2QVSB 1NE6A 3I97A 3NVCA 5FZ4A 4DOUA 4FAGA 1K5MA 1YHFA 1LHVA 3HNYM 5A33A 2UWCA 1OKOA 1PO22 5F5IA 1MZEA 2HWD3 2JDZA 3O0XA 4IEOA 5F37A 3TB0A 1PGL1 2HBTA 1W39A 4OVEA 1IKPA 4F7ZA 5C7GA 3IM0A 1CZSA 3PVOA 2Q30A 1OD3A 5E16A 1MZFA 3N36A 4LTAA 1SBEA 4AQ2A 4JDNA 2OZJA 2Z42A 1NCRB 1PGSA 2A71A 5I0TA 3RZJA 1IPSA 1KFXL 1QJY1 2P6HA 1O4TA 1SHWB 4QPIB 3DF0A 4FOQA 4MHRA 1OLME 1QOSA 1BBT3 2R041 3M3QA 1OC1A 1SFNA 2GC2A 4MZUA 3W59A 1G9DA 1PNFA 1YQ8A 2IUWA 4FPOB 4CCNA 4R9AA 1S0DA 5FMBA 3LCPA 4JC1A 4GKXA 1OH3A 3FX3A 3HMYA 3PIJA 4U36A 5CKQA 2R49A 1UL9A 4OQ8A 5T50A 3VBOC 2HWB1 1TMF1 3ZYPA 4AEKA 4AG4A 4LBLA 2W2IA 1ENRA 1QQP1 5FPXA 1EUUA 1EPWA 4LHNA 4MGYE 2H0VA 4UT5A 1V6OA 5F5AA 2W68A 3NWKA 4XF3A 1OQDA 1UNBA 3ZPYA 3H8RA 5F8PA 4Y20A 1FPN3 4RS5C 2QQJA 4BPZA 1U12A 4XF4A 1JS9A 1TME2 4A7KA 1XPWA 1RUF1 3HBKA 4CDUC 3ST7A 1XC6A 3ETQA 4ZS3A 1W6PA 1XBFA 5DAWA 5LA0A 2WS91 2GN3A 4XUOA 2XL7A 1GBGA 3LD8A 3ZXAC 3MFCA 3TNQA 4D6QA 2ZCWA 4ISRA 5FUIA 3SEEA 1LHUA 2XJVA 4RR3C 4ZZ5A 3HN1A 4EN7B 3FJSA 5LW9A 3N7KA 3CO2A 1PIV2 5FZOB 1YCIA 4EJRA 3KT7A 2P3KA 1PGW2 3POSA 4D8MA 1ZRDA 3ILFA 4Q4Y3 3A4UA 4N90A 5GZEA 2HWC3 4Q0PA 1UY0A 5KHHA 1GOHA 2JG9C 2X5IC 4XPVA 5C3SA 5JDBA 1UMZA 4CUAA 1COV1 1RUG3 2ZKLA 2VPVA 5H9SA 3VBOB 1HRV3 2A3YA 2HLEA 4R4XA 4B1LA 5CG8A 1Q43A 4LORA 1HX6A 3AM2A 1MR5A 1IQDC 3HD8B 4YGCA 4JGYB 1YFYA 3H42B 3IN9A 4FTEA 1BVP1 4I02A 3VBFB 2X29A 4AFMA 1RUE1 3FBYA 4Y24A 4IV3A 3TOJA 3TWIA 3W21A 4COVA 3C7GA 4QQ2A 5A3UA 5CFDB 5I0RA 2VUDA 4GH4B 1SFPA 3J7LA 2QE3A 2NN8A 4GXLA 4CP9B 2FDHA 3POJA 3CNAA 3D5OA 3PUSA 2BOJA 4YVWA 5LEJA 3T0BA 2XR4A 2EAKA 2CSGA 4FPCA 2VZ1A 1PMIA 4AL9A 4LXLA 4P02B 2VH9A 4FOVA 3ZSMA 5FPZA 4AFAA 4N53A 1RUD1 2O1QA 5D8AA 1VBB2 3DPRC 5FZ0A 2CAVA 3RG0A 1EAH1 2ZHMA 2QZ2A 4QKDA 5A1FA 4Y5Z0 5K7PA 5LK7B 2CYFA 2K0GA 3RZGA 2WO1A 2RDSA 4YARA 4DUXA 4Z1VA 1W0NA 3KQRA 3POGA 1K12A 2E31A 3WNPA 4UFIA 4UXAA 1FV2A 1TEIA 2R0FA 3FC0A 3HT1A 2YROA 2JIGA 2JG8C 1DZRA 3AVRA 3GF6A 4GWJA 4YG0A 3WG1A 5L9VA 3I8TA 1UN1A 1IOAA 3MUZ1 3CKHA 3F95A 5CFDC 4LHSA 5J98B 1VRBA 5FWJA 3J8F2 4UFHA 3UGHA 1MZ5A 1IS5A 4H14A 5IJRA 2AEYA 4YG6A 3ZSEA 2PHFA 3IT8A 1VBC3 1CAVB 1F5FA 2PFWA 3NV4A 1HJGA 4NWWA 5FZFA 5IVEA 1JZ5A 1JOJA 3IWZA 2ZPXA 2JG9B 1AX2A 2CY6A 1G9BA 4XHXA 2C0ZA 3MF9A 4CXYA 2EIBA 4JHTA 3VBSB 3MW3A 2ZX1A 2JEMA 2JG8A 4XQ4A 3RQ0A 5J48A 4OMDA 2E7QA 3AYAA 3ZN6A 3H3ZA 4CU7A 3D4KA 2E26A 4IV3B 4KWLA 4OI1A 2Y64A 1XYPA 5LRSA 3GBGA 1SG3A 1PMHX 4LBNA 2RMU1 4L0PA 4A2UA 1UX7A 1K5JA 4DRVA 2D3PA 2G1MA 1WUVA 2VBBA 2LTNA 3AJYA 3POFA 5CZKA 3VBRA 3ZMOA 4Q5OA 4J1WA 4Q4W2 4FOWA 3NRUA 2XPJA 2NZ9A 2WAOA 4AHXA 2ZACA 3W9AA 3CBNA 3NNLA 3PDQA 4YW7A 4ES8A 3CJIB 4QB2A 2WQZC 4XYXA 1ONAA 3AKTA 3IAPA 3GDBA 4ORFA 5DZFA 2ZX3A 4ZPIA 4AI8A 1R64A 4KWKA 2PHUA 4QWNA 2HJIA 2YC4A 1REEA 2P34A 4X8NA 1TME3 4NIAA 4YLZA 1Q5OA 4WM8B 4XF0A 4QD2A 2VZPA 3PMSA 4XVHA 3LPFA 5BNOA 3M3OA 3GJAA 2R071 5LBCA 2QDRA 1EAH2 2WWSA 3MUY1 1RUC2 2CHHA 4ZZ8A 4P5YA 4P9GA 4JZRA 1JN2P 4BIOA 5FP9A 2WS93 3WW4A 4MSVA 1VJ2A 1GR3A 5IFTA 1UZZA 3GALA 4R4ZA 1NY71 5B2GB 1C8M1 5FZLA 4AI1A 4W8JA 3ZX7A 3T3YA 3LZZA 1OUSA 4FQZA 4COYA 1I6XA 3O1TA 2VZTA 1UAIA 1JZ8A 5D2AA 2Y33A 3BCWA 1Y9GA 4HVOA 3E5QA 4OI0A 1EP0A 1VBD2 2WZPP 4N43B 3RWKX 1W9YA 3FWEA 4DXSA 2ZZQA 1OSGA 1UOBA 1HXS3 2IVJA 2W92A 1H6YA 3U1XA 1RB8G 3JB4C 1AR83 2VAUA 1DZTA 4PQ9A 2D6PA 5FLIA 4FBFA 5F3IA 2CWSA 1XB9A 1W6QA 3GJBA 2GZWA 4X8PA 3NNMA 4Q4V1 5J36A 2VCMA 3VHPA 2V09A 1DF0A 4BYYA 2C9KA 1JZ6A 2VBPA 2FDFA 1RUG2 1GP4A 1MACA 4YFWA 5FYCA 5LRRA 3PUHA 1JZ3A 4GALA 4X6QB 4BM8A 1CQ9A 3RZMA 3ZR6A 4QXKA 1W6MA 3UL2A 2RR11 2C4XA 3JXSA 5KWRA 3VZNA 3DGTA 2W91A 2DCYA 4NOTA 2O8QA 1W28A 2LALA 4NHYA 4IE6A 2RS12 4WVVA 5FYSA 4UFJA 4Z92B 1QJU1 3ZXEA 2IXJA 2BGOA 3LA7A 2JE9A 3WP6A 4D7SA 1VLNA 4QX3A 3VD7A 5FBZA 1J3QA 4GMP0 3T2OA 5C8WA 2YBKA 2JKXA 3G6JB 1QNWA 5FZOA 4JGZB 2YZ4A 2F4LA 3FBMA 3RGBA 4A6OA 5JPMB 2ARAA 2DCJA 3DPRA 3ZFFA 4AHWA 1SLAA 2Y6LA 1ZNPA 5D8AC 3LFIA 2FCTA 3FE5A 4XQWA 3AFKA 5FP8A 4KWUA 5J1XA 4FPLA 1T6BX 4XJ8A 5A80A 1F31A 4M01A 5A7PA 4BWOA 2RS32 3IIAA 2XJPA 4C1XA 2RS53 3RJRA 4EWDA 4M3CB 2VM9A 4MUVA 1ZBA1 4XEZA 4LO4B 4EZHA 4N9HA 2L9LA 4IL7A 1GZTA 2ZGQA 1XU1A 2Y6FA 2OYZA 4MADA 3CEWA 3QH7A 4AHZA 2ETEA 1MS8A 2D6MA 1U0AA 1JTZX 3VKLA 2J1UA 3BTXA 5C4WA 4TYSA 2XQXA 1PM7A 2BZDA 4XCBA 4YW5A 1E5SA 4IETA 5FYZA 1UOFA 4MX3A 1D7PM 1SPPA 3V56A 5GLZA 2WNUB 1IG3A 4R52A 4UW5A 5I93A 1SCSA 3TNPB 2WSUA 4L92A 1OVSA 4MXVA 1W8OA 2X5IB 3WQBA 4M0NA 3KV5A 3UESA 5JI7A 3IMNA 2PTMA 2V5DA 4RR3A 1YFXA 1GOGA 1COV3 1IHMA 1RUG1 2CV6A 3P5BA 2OA2A 2DBIA 5A3OA 1XXNA 2WWJA 1BEV2 1US2A 1FI2A 2WNVB 1PX3A 2ZAHA 5FZ9A 3U4XA 5KR7A 1TME1 2WABA 2Y34A 4Y22B 2BUKA 2ARBA 3JQWA 3MBWA 3OD4A 3RJ2X 1LR5A 4CE8A 2RS11 1QDCA 1F8VA 4AW7A 3JD72 1VRH1 2JJ6A 2EA7A 5FAXA 1AX1A 2VD7A 4IV1B 1RUC3 4UFMA 4PIZA 3BN6A 2AC1A 1S0IA 5LB6A 1DP0A 1GKBA 1V6MA 2EIEA 5BV6A 3IPVB 3P3PA 3UJOA 5A3TA 3WXPA 1POV0 4NPMA 1GNHA 2IZWA 1VAKA 3KT1A 2R6QA 4H7MA 4K40A 1KJLA 2B42B 4GMP1 4YZ5A 1T6GC 2YU2A 3KF3A 3MPPG 5DG2A 4YYOA 3BU7A 3EMRA 2GNBA 2PHDA 3A0NA 4AI3A 2VQAA 4PLMA 1SDDB 3RZKA 5FXVA 2D98A 1L7QA 1FATA 3O1VA 1ZRIA 3OY8A 1UY4A 4HZFA 2VJXA 4NUBA 5FV3A 3VKNA 2FHRA 1D4VB 4Y1XA 2CL2A 4D7TA 2B4KA 2YUEA 3A23A 1FPN2 3AP7A 3H0OA 5AVPA 1M4WA 3B01A 2GU9A 1DIWA 4BK4A 2WFF3 4XIOA 1YI9A 2RDRA 3KWVA 1H30A 5FXWA 1MS5A 1V6IA 2XWJB 3CF6E 3PLQA 1H6XA 3ORJA 4IGQA 4XBNA 4IEXA 5FZEA 3U14A 1MZ6A 3JB8A 4LA3A 2X53S 3UETA 3X29B 4P5HA 4RFRB 4HBNA 4K20A 4DXTA 4EWEA 4PLOA 3S7EA 1YJKA 1QH6A 3HIFA 5FLHA 5FQ0A 2Y6KA 1NZCA 1WLDA 1Q56A 4Y1ZA 3I49A 1RUJ2 1PVC2 1YWKA 5AC93 1G9CA 1UF2C 4UFKA 5LZ6A 4CRQA 1OLQA 4QPGC 2YPDA 3CJXA 1GICA 3SH3A 2VULA 1LU2A 1W6QB 3ZXFA 5K0UC 4Y5TA 5JIUA 4FI9A 2WIIB 4F83A 1JYTA 5FP4A 4G4FA 1YO8A 2ZGUA 1O4YA 1HLCA 3P1IA 3AC0A 4LO7A 4AGGA 4NRMA 5DG1A 1GLHA 2PA7A 1N1TA 1VMHA 1XNBA 2AYHA 2FDJA 3CZJA 1DGWA 2SBAA 3MV01 2BTVC 2IC1A 2GAUA 1ALYA 2ORZA 1NOVA 4RHV3 3WHUA 4P9XA 3VDAA 4EZ4A 3JD71 3EXUA 1C28A 1OKQA 4COUA 4DIQA 1JYCA 1GZ9A 2OZ6A 2AEZA 2Q4SA 3IB3A 4AE2A 3UGGA 2VXRA 4Z07A 4HN1A 3T08A 2XVGA 4FXGB 1SZBA 1XYNA 5A1AA 1BLZA 2JDMA 3TEWA 4NN0A 4AFCA 2VU9A 1LKNA 4I09A 5LWBA 1OD5A 4Q4X1 3WUDA 3WF4A 5A7QA 3E1F1 3VDDC 5BNOC 4OLLA 5FBJA 2JX9A 1JXNA 5HV4A 1PGW1 2BP6A 3AP9A 3OPZA 1I5ZA 2W95A 1UZ0A 3RI8A 3TN91 4R9CA 1LOCA 4LBMA 1QOOA 4QQOA 4Q4Y1 5IVYA 1W2OA 1YEWA 4NMIA 5ACA2 5JUVA 5J37A 3OD0A 2R061 5CKMA 3UYJA 1E5IA 1O5UA 1S0JA 2XGXA 2A1XA 2LS6A 3I3EA 4XDOA 5F5CA 5FMCA 2A6ZA 3I2HA 5D21A 1XRUA 4HSLA 5IVBA 1R092 4E2SA 4XJWA 2VCCA 4QXCA 1G6NA 2RM21 4LOSA 3RWNA 1COV2 2VY0A 2WLPA 4KMQA 4FOYA 1G8WA 1DGRA 3T30A 1YC61 3S5AA 5FQ0B 1MQTA 4V1PA 3VBFA 2N7GA 5C5TA 1V70A 2VZVA 4E4SA 5FZIA 1W9TA 1NCQB 2WNUA 5A7WB 2RM23 1WD3A 4TLGA 3VKMA 1CIWA 4DZGA 4XJZA 3U37A 3IPVA 5L9BA 5T55A 3B00A 4XDQA 5JWPA 3KF5A 1ASJ1 3LKJA
chains in the Genus database with same CATH topology
3RZKA 3RZHA 3BU0A 4CXWA 4QKDA 4O61A 4ZHNA 4NPLA 3T3YA 4QKFA 3O1OA 3O1MA 3O1VA 4OCTA 3BKZA 3BUCA 3I49A 3BTXA 3O1TA 3H8XA 3BTYA 3BIEA 3RZGA 4IE0A 4NIGA 4NIHA 3RZLA 4QHOA 3T4HB 3RZMA 4CXYA 4JHTA 4MG2A 3BI3A 5DABA 4NJ4A 3T4VA 3O1UA 3H8RA 4ZS2A 3S5AA 4QKBA 5F8PA 4IE6A 3LFMA 4NROA 4O7XA 3H8OA 3RZJA 2FDHA 3S57A 3O1SA 4NPMA 3KHBA 4NRPA 4IDZA 2FDGA 4IE7A 4IE5A 2FDIA 3I3QA 4NIIA 4NRMA 3O1RA 3BTZA 4IE4A 2FDJA 3I2OA 3I3MA 4MGTA 3O1PA 4NRQA 2IUWA 4RFRB 2FDKA 4QKNA 4NIDA 4CXXA 2FD8A 4ZS3A 2FDFA 3KHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZK A;  3RZH A;  3BU0 A;  4CXW A;  4QKD A;  4O61 A;  4ZHN A;  4NPL A;  3T3Y A;  4QKF A;  3O1O A;  3O1M A;  3O1V A;  4OCT A;  3BKZ A;  3BUC A;  3I49 A;  3BTX A;  3O1T A;  3H8X A;  3BTY A;  3BIE A;  3RZG A;  4IE0 A;  4NIG A;  4NIH A;  3RZL A;  4QHO A;  3T4H B;  3RZM A;  4CXY A;  4JHT A;  4MG2 A;  3BI3 A;  5DAB A;  4NJ4 A;  3T4V A;  3O1U A;  3H8R A;  4ZS2 A;  3S5A A;  4QKB A;  5F8P A;  4IE6 A;  3LFM A;  4NRO A;  4O7X A;  3H8O A;  3RZJ A;  2FDH A;  3S57 A;  3O1S A;  4NPM A;  3KHB A;  4NRP A;  4IDZ A;  2FDG A;  4IE7 A;  4IE5 A;  2FDI A;  3I3Q A;  4NII A;  4NRM A;  3O1R A;  3BTZ A;  4IE4 A;  2FDJ A;  3I2O A;  3I3M A;  4MGT A;  3O1P A;  4NRQ A;  2IUW A;  4RFR B;  2FDK A;  4QKN A;  4NID A;  4CXX A;  2FD8 A;  4ZS3 A;  2FDF A;  3KHC A; 
#chains in the Genus database with same CATH topology
 2I07 B;  2BQP A;  3I59 B;  4HPK A;  5HV0 A;  4EV0 A;  2VMH A;  4QPG B;  5L7O C;  3V64 A;  1GSL A;  1PK6 A;  3VL8 A;  3ACF A;  2XJS A;  5IYY A;  1ND3 C;  4CUG A;  4XJ9 A;  3OPW A;  2VZR A;  1LOD A;  5KHJ A;  1POV 1;  5FP7 A;  1LGC A;  2ZML A;  2QTW B;  4I01 A;  4CCL A;  1EYB A;  5FWE A;  2A75 A;  1NLR A;  3HEI A;  4BQ5 A;  4B7K A;  2LW8 A;  2O8O A;  3ZN4 A;  1MS1 A;  4C8D A;  4GH4 C;  1JOP A;  1ULO A;  1IS6 A;  4BE3 A;  3MDP A;  2KXL A;  3K3O A;  1SCR A;  4A6S A;  5BNN B;  5EZW A;  3VBH C;  3V65 A;  3O1P A;  2WT0 A;  5FYY A;  4YW6 A;  3ZYG A;  5DAV A;  4OFG A;  4TLF A;  2EAA A;  5E88 A;  1HQN A;  3JBG 2;  2WNE A;  4IER A;  2TNF A;  4RFT 0;  3O5S A;  5DN2 A;  1OUR A;  3O12 A;  4LIU A;  4XFI A;  3WIN E;  4C0H A;  5FXX A;  1FV3 A;  5B4X A;  4Y4R A;  3QBQ A;  5H9P A;  4A4A A;  1SMV A;  3MEP A;  2BWA A;  5I8T A;  5JXI A;  2WC2 A;  4Q4V 2;  4ASM B;  1NCQ C;  2ZMK A;  4CDX C;  3RYR A;  1C3H A;  1PX4 A;  3I2F A;  3ZSJ A;  4YFZ A;  3R0R A;  3KV6 A;  1WBL A;  3D0J A;  4A41 A;  1QGL A;  3HWJ A;  1YI7 A;  3THP A;  3Q8E A;  4MHU A;  3SQO A;  2WNV A;  2PHR A;  1RUO A;  3M3C A;  5A6Y A;  1LOF C;  3H3U A;  3I3Q A;  5C71 A;  4DQA A;  4QDS A;  1S0B A;  2VOT A;  2YFU A;  3WDV A;  5JZG B;  4DNY A;  4CCC A;  3ZFE C;  3VUO A;  3I2K A;  1O59 A;  2ARE A;  5LAS A;  5AC9 1;  2ZZJ A;  2TEP A;  1WMD A;  4XIL A;  5EHD A;  5T5J A;  1O6U A;  1CIY A;  2YGL A;  1JYX A;  2B39 A;  3U07 A;  2DTW A;  4OYU A;  3ZYF A;  3LIH A;  4QPI A;  4DUW A;  4V2W A;  1RIR A;  2MNG A;  5LBF A;  4QT6 A;  2WLQ A;  2VW1 A;  4B8E A;  4UF0 A;  2WIN B;  4JRA A;  3HBZ A;  5CNA A;  5AC9 2;  4DEQ A;  4WM8 A;  3FMG A;  3PJY A;  1GAN A;  2JIC A;  1JOB A;  4ITC A;  4RS5 B;  3K3N A;  5FZM A;  3N9Q A;  3FHI B;  4QX5 A;  1HKD A;  1W9W A;  4UW3 A;  4AR2 A;  1DGL A;  1JZ7 A;  3CIH A;  4ONU A;  5FY7 A;  5FZK A;  1SDW A;  2UY8 A;  1Q8O A;  2RS3 1;  3CJI A;  1OHF A;  5T5P A;  1PVX A;  4HPK B;  3WY6 A;  3FUO A;  3TBD A;  2BRT A;  4CXX A;  1KDM A;  2PHW A;  2W3J A;  2ARX A;  3NJZ A;  4P9J A;  2YY1 A;  3NMB A;  4NPL A;  1BMV 1;  1KGY A;  1QH7 A;  3VBU C;  2J1V A;  3I3D A;  1NQJ A;  3OGR A;  4UAP A;  4TZD A;  3AXD A;  2WRA A;  2QZ3 A;  2DUP A;  3ZPO A;  4PHZ A;  5DAB A;  5I0D A;  2D97 A;  2Y0O A;  4GD4 A;  4XTM A;  3WHT A;  5C3Q A;  1E5R A;  5DAQ A;  1B35 B;  1OFN A;  3S6P A;  4OMC A;  3WNX A;  2DCK A;  4LK7 A;  5B4N A;  3AP5 A;  4AEM A;  3W58 A;  3PME A;  1OXC A;  2O14 A;  4ES9 A;  1DFQ A;  1GZC A;  2W1S A;  4LKD A;  4ZXE A;  1XSQ A;  3RVH A;  1J83 A;  3AMP A;  4E8D A;  2ZX4 A;  4K8F A;  1ASJ 3;  4CDW C;  5CIS A;  1M06 G;  1AYM 1;  2B8M A;  1H9W A;  1UYP A;  1VB4 A;  2BYV E;  2X10 A;  1IQA A;  3FHQ A;  3LF7 A;  5JOW A;  4Q4W 3;  3ZKY A;  3B02 A;  2BVB A;  4QPI C;  1REF A;  1VP6 A;  3TAY A;  2CWM A;  2MEV 1;  4BQ3 A;  4YZ1 A;  1ZRE A;  3NV3 A;  2ZXQ A;  3OTF A;  4Z2W A;  1VRH 2;  2R1B A;  3BIW E;  3UKN A;  1ST8 A;  1RTV A;  2GH2 A;  3KHB A;  1WGP A;  4MGQ A;  3ZFG A;  3H50 A;  1UZY A;  2HKX A;  4HET A;  2CDP A;  4LBK A;  4ATE A;  5DZG A;  1GNZ A;  4XUR A;  2NMO A;  3ZOI A;  4YM1 A;  1NCR A;  5C70 A;  4HVR A;  3AKQ A;  3P6B A;  1SEF A;  3R05 A;  3IKW A;  3C7E A;  1Q8V A;  2OKX A;  4KQ7 A;  4ZHN A;  1OA4 A;  3CHX A;  1VBA 1;  4MET A;  5KC6 A;  3SH5 A;  4BQX A;  2WZ8 A;  1BZW A;  1PK6 C;  2ZGL A;  4LT5 A;  2D6L X;  1QJF A;  1W8U A;  4MYE A;  1U5I A;  2G4I A;  3C8X A;  1KEX A;  4IEZ A;  4LLF A;  1WCD J;  3JBG 3;  4XZP A;  4YVS A;  2V4V A;  1VBA 2;  1A6C A;  1I1E A;  2RVA A;  3ZYI B;  1YUD A;  2ZOE B;  1RUH 2;  1W6O A;  2ZA9 A;  3MYX A;  4HKW A;  5CFC A;  5HPO A;  3ZFF C;  1UMH A;  3I2O A;  2A73 B;  1V9U 1;  3VDD B;  2PLV 2;  2CU5 A;  2R0H A;  2XH6 A;  1RHI 2;  5K0U A;  2ZGM A;  1OA2 A;  2F17 A;  3WF0 A;  1V6N A;  3ZN5 A;  3HOB A;  1N3O A;  4Y1Y A;  3DXU A;  3DV8 A;  3VL9 A;  5IWF A;  2QQL A;  1PO1 2;  2B7Y A;  1R1Z A;  4OHX A;  4S2G A;  3ZDS A;  3W5N A;  4MLO A;  1O7F A;  3RYK A;  1C4R A;  1V9U 2;  1LHN A;  2YPJ A;  1DQ2 A;  1XNK A;  1I9R A;  5KHK A;  1PZ9 A;  1LTE A;  5EJZ B;  3H8O A;  4A3X A;  4M4R A;  3KD4 A;  1EV1 2;  3BVC A;  2J1T A;  4ZY9 A;  2VC9 A;  3R6S A;  3PUQ A;  4JKM A;  5LK5 A;  2JEN A;  4QGL A;  1K42 A;  2W39 A;  3WNL A;  3SH4 A;  4XBQ A;  1ULC A;  3R4S A;  1LOE A;  1UXX X;  1CAX B;  2P3Y A;  1CZT A;  3WF3 A;  5AFB A;  5C5U A;  1DDL A;  1UY3 A;  1PIV 3;  3EO6 A;  4L97 A;  1IZ3 A;  5BPX A;  2Q8C A;  4ZU7 A;  1LED A;  3FZ3 A;  3LOB A;  1VAV A;  5CG9 A;  4HVQ A;  4UW6 A;  2VVF A;  4QGM A;  1RMU 2;  2HWC 2;  3H1W A;  3ZMN A;  1BEV 1;  1DG6 A;  1V00 A;  3N9L A;  2Q1Z B;  2YFZ A;  4IUG A;  3JCI A;  1SLC A;  2OT7 A;  1UPI A;  4AQS A;  2PMW B;  4CDQ C;  2IWG B;  3PUI A;  5C9A B;  1LEN A;  3BOW A;  4Y3O A;  1K45 A;  1PO2 3;  1ZBE 1;  3GHN A;  5FP3 A;  3ZM8 A;  4KG0 A;  2XBO 1;  2AZ5 A;  3O7O A;  3NKT A;  2IFR A;  3HJR A;  2JD4 A;  4O9G A;  4YW4 A;  5GZG A;  1CON A;  1R1A 2;  1DYO A;  1UIK A;  3ACL A;  4FTS A;  1UOJ A;  2WYF A;  2MEV 3;  4BLJ A;  4GB3 2;  3HR9 A;  4DY5 A;  4CU8 A;  3Q8C A;  4D6R A;  2UYA A;  3T0D A;  2PAM A;  4E4D X;  3ENR A;  4BU2 A;  4NHK A;  4W65 A;  3H3L A;  4ATF A;  4W50 A;  2XJQ A;  1YFW A;  3CLP A;  5ISL A;  3URF A;  2BOI A;  1YQ2 A;  3GXU A;  2A3X A;  2H6B A;  4LO6 B;  4E8C A;  3UKV A;  1R09 1;  4DRR A;  2D5F A;  2R07 2;  1Q3E A;  3CMG A;  3SLI A;  3ZXJ A;  3TEZ A;  1KXG A;  1RVF 2;  4RHV 2;  4BZ4 A;  4JHZ A;  1UY1 A;  3I2G A;  1ACC A;  1LGN A;  4AYU A;  4HFS A;  1MEC 1;  4KL1 A;  4MGS A;  3VZK A;  5E8A A;  1PHM A;  1CAW A;  2FD8 A;  1ZZ7 A;  4FPY A;  1N1V A;  1NA1 C;  2OUH A;  3WNK A;  5C9A C;  3PNA A;  3BU0 A;  1WME A;  4NHX A;  1ZZC A;  1V6K A;  3KT4 A;  2JB4 A;  3BKZ A;  4QM9 A;  1AXY A;  4FFF A;  1OUX A;  4XAE A;  5IVV A;  5FMD A;  4N7U A;  3VB9 A;  2ZGP A;  5A1L A;  1B09 A;  4DS0 A;  1ASJ 2;  4ZKT B;  2FMD A;  4QXB A;  4GA9 A;  1SFY A;  1MQT B;  3PIG A;  2DCZ A;  3GCW A;  2YU1 A;  3R4D B;  4EE2 A;  5FYM A;  5J7M A;  1LB2 A;  2BVV A;  5IK5 A;  1DCS A;  1UMI A;  3EBR A;  3T0A A;  2P4E A;  2UY9 A;  2JDP A;  3JD7 3;  3LGR A;  5JR7 B;  2RJK A;  1RYY A;  2E7T A;  4CCD A;  2ARC A;  2WN2 A;  4IES A;  2WUH A;  3DL3 A;  4XUP A;  3OYW B;  1YQ6 A;  1ND2 B;  2UYB A;  1NAE A;  3FLT A;  1FNZ A;  4HK8 A;  4N8M A;  3VV1 A;  1VBC 1;  1WLW A;  2WKK A;  4CXW A;  1AYM 2;  2XB6 C;  4IEP A;  1X9T A;  1JYW A;  3WF2 A;  4JAA A;  2RR1 2;  4XXP A;  3LEG A;  2VNR A;  4FFG A;  4KNC A;  4PF1 A;  2W47 A;  5IAT A;  3VDB A;  4QGN A;  4AVA A;  3MLJ A;  4HMZ A;  2J1E A;  4LUK A;  2ZJC A;  1AL0 G;  4J1X A;  4XTP A;  1F9K A;  2DDU A;  3MIE A;  1AYN 3;  2E53 A;  2R1D A;  4NRP A;  3GZA A;  5ANN A;  4IE5 A;  1IS3 A;  1GWM A;  3E97 A;  1UYY A;  3N7M A;  5BY5 A;  1OQ1 A;  1RUE 2;  3ROU A;  2P3J A;  3J8F 1;  2E6V A;  1VR3 A;  1S0E A;  2ET1 A;  2VZS A;  1JYN A;  5FO8 B;  1PZ8 A;  3N9M A;  4GWI A;  4OZO A;  1GU3 A;  4XZU G;  2OPW A;  3WEZ A;  2YBP A;  1D4M 1;  2AH2 A;  2HWF 3;  1HRV 2;  3CDZ B;  3L2Y A;  4NO4 A;  2P6C A;  2E32 A;  1OBN A;  2VUC A;  3AVS A;  4FP2 A;  4RD7 A;  1VBE 2;  4UW4 A;  5EPA A;  4XFA A;  5FZH A;  4URA A;  2R7E B;  3ZVX A;  3MIB A;  1CZV A;  2J22 A;  3O14 A;  4D3W A;  1QU0 A;  3K4D A;  1PO1 3;  1MEC 2;  4HON A;  1P8J A;  1OF4 A;  1Z7S 1;  3RMX A;  1SLB A;  4Y33 A;  1LOF A;  2RG4 A;  4PI2 A;  4L9B A;  3ZR5 A;  4NII A;  2WNO A;  1IGO A;  2VQU A;  4LBQ B;  2A6V A;  4AZZ A;  4BLI A;  3N7L A;  1O3T A;  4H3W A;  4B29 A;  3U4S A;  2JB8 A;  1PMJ X;  2V4A A;  2GP3 A;  4OHV A;  5J3U A;  1L7L A;  4FO9 A;  4QKF A;  3UNP A;  3RI9 A;  3ECQ A;  4BQ1 A;  1ZRC A;  4PDW B;  4LBJ A;  1WCK A;  3GGL A;  4XF1 A;  4Z8B A;  5C8C C;  3J7M A;  2W1Q A;  3KLS A;  2W52 A;  4IW3 A;  1UCX A;  2R30 A;  2XON A;  1AR6 3;  2IXH A;  4CEY A;  1CD3 G;  2BNN A;  4NRO A;  3BPS A;  1RXG A;  3QLQ A;  2PN5 A;  4R9B A;  1O8P A;  1WW6 A;  1VBD 1;  2EAL A;  2RDN A;  3FN9 A;  1UYX A;  4YG3 A;  3U75 A;  2GMP A;  1DZQ A;  1QQP 3;  2ZTN A;  4QQP A;  4LK6 A;  3I4I A;  4AWD A;  1QHD A;  1CPM A;  3IBM A;  1WCU A;  1Y9Q A;  3AKP A;  2E9Q A;  2UU8 A;  4N43 C;  1EY2 A;  1NCR C;  2DUQ A;  5C6C A;  1GQH A;  3DXT A;  1OF3 A;  5F3G A;  5BNQ A;  4NIH A;  4PIX A;  3LB9 A;  4AI2 A;  4LBO A;  3ZFG C;  1RGS A;  4P9L A;  3WF1 A;  4AED B;  4UWD A;  3VBU B;  1OOP C;  4XQD A;  4BK5 A;  4C90 A;  4YZ2 A;  1J59 A;  1TNF A;  1JYV A;  1ULP A;  3NJV A;  3MW2 A;  1QJY 3;  3IDA A;  3OEB A;  3LEI A;  1HRI 3;  3CL1 A;  5HCF A;  2BGP A;  1BYH A;  4JDM A;  2WO7 A;  4O7X A;  3S57 A;  1C1F A;  3AK0 A;  1J3R A;  2VO5 A;  3NO8 A;  4Q0Q A;  2LRO A;  5EP9 A;  2GME A;  1J3P A;  2K46 A;  4QU1 A;  1YQ5 A;  3VBF C;  1BK1 A;  5JIA A;  1AR7 1;  2FDK A;  1QF3 A;  2ZX0 A;  2QQO A;  4FQ4 A;  5GJ6 A;  1ULG A;  1TMF 3;  2RMU 2;  4WM8 C;  1WCS A;  4XE9 A;  1AL2 1;  3WP5 A;  2OXB A;  3C7H A;  3JQX A;  3SIT A;  5JOZ A;  2RS5 2;  1Z0H A;  5FYU A;  4YZ3 A;  4Q4W 1;  1BVV A;  2PXJ A;  4LO5 B;  4AOC A;  3FLR A;  3UGF A;  4NVP A;  1AL2 3;  3MLL A;  4K1Y A;  3B9C A;  2YYO A;  3DEM A;  2HWE 3;  1JOD A;  1NX9 A;  1H4H A;  3AJZ A;  4KBB A;  2W1U A;  1QEX A;  2ERF A;  1V6J A;  3ZYR A;  3ZFE B;  2R06 3;  5JZG C;  4CP1 A;  3H1Y A;  3N9P A;  4N53 B;  5FYV A;  4CYD A;  2BJS A;  1ZBE 3;  2UWB A;  2HEW F;  3OBT A;  4IV1 A;  3TN9 3;  4Y1U A;  3VKF C;  2GC1 A;  2EF6 A;  2C6S A;  3OYW A;  2ZHL A;  5FZ6 A;  5HCB A;  1OMI A;  3E5U A;  4AVS A;  3MW4 A;  1RUH 1;  2WA3 A;  2D7F A;  2NP0 A;  1CJP A;  4BXF A;  4D94 A;  1CAU B;  4CP0 A;  5KXD A;  1UWW A;  3AYE A;  2A3W A;  2B9V A;  1HB3 A;  4GJZ A;  2DUR A;  4K8R B;  1NLQ A;  4XFG A;  2OUJ A;  2RR1 3;  5KC5 A;  3FFZ A;  2FQP A;  1VBD 3;  3K4A A;  4HT1 T;  1X8E A;  1N1Y A;  4Q4V 3;  5ABJ B;  5BNO B;  1RC6 A;  1W0O A;  5L36 A;  3OBR A;  4DUV A;  4O65 A;  4H2A A;  4B3N A;  1X8M A;  3H9A A;  2Z2S B;  5HXM A;  1WWY A;  2E51 A;  4ARX A;  4ZON A;  1XNA A;  4D69 A;  2PYT A;  3SHR A;  1HXS 1;  5A3P A;  1QJU 2;  3J9S A;  4HSJ A;  1AR8 1;  4KBZ A;  3MIG A;  3H8X A;  1HV1 A;  1ENS A;  2IVI B;  1LU1 A;  2DVD A;  3GZU C;  4HAN A;  5FMO L;  3ON7 A;  2Q1M A;  2VOV A;  4HKL A;  5EXO A;  3V0A A;  4MV2 A;  4QKB A;  4WM7 A;  4YGB A;  1AR7 2;  5EYY A;  3T1L A;  1H2L A;  1UQX A;  1GV9 A;  2W87 A;  2PEL A;  5EWS A;  3Q8A A;  1RIN A;  1GOF A;  4CCO A;  2XLG A;  2X5I A;  4XXA A;  1AHS A;  4RQP A;  2OPK A;  3NAP C;  5FMO S;  1W2A X;  1ND3 B;  3SMH A;  1D0G A;  4Q4Y 2;  3OG2 A;  1AR9 1;  1N3P A;  2LM3 A;  1FMD 3;  5A3L A;  1UU5 A;  2VMI A;  2Z5W A;  4YVS C;  3DPR B;  3AB0 A;  1HRV 1;  1F2N A;  3AZW A;  5IHR A;  1POV 3;  4L2N A;  4IGP A;  3JUU A;  1DU3 D;  4Q8L A;  4C1W A;  3WW1 A;  4PIY A;  3MIF A;  1WW4 A;  2J1R A;  3SNM A;  1BKZ A;  1PM4 A;  5IT6 A;  1Y3T A;  5F9T A;  1H4G A;  3KVB A;  4AF9 A;  1KD7 A;  3AFG A;  4J6G A;  2HWD 2;  4OUM A;  4W6Y A;  2I45 A;  1KFU L;  3WP4 A;  1CJD A;  1ENQ A;  5SV8 A;  5DUW A;  1AR6 2;  3LAG A;  2BNM A;  3WCS A;  4RGG A;  5GAL A;  1ND3 A;  4K7J A;  1RUJ 3;  1SLL A;  2FZ1 A;  2QBX A;  1DYK A;  2VQT A;  4R8H A;  4CEY B;  4DB5 A;  4ERO A;  1OH4 A;  2ZGO A;  3GZE A;  4QKN A;  4CU6 A;  4EN8 B;  2RV9 A;  5GLT A;  4YM3 A;  3ABZ A;  3OF1 A;  2BFU L;  3GNE A;  4YW1 A;  1DGR N;  4XJA A;  5TSW A;  4AI0 A;  4YGE A;  5JXJ A;  3ZFF B;  2OVU A;  2WQ8 A;  5CEH A;  4AQT A;  1CGP A;  1XSR A;  5IK4 A;  2XKO A;  1Y9M A;  4WM7 B;  4IEW A;  4NPR A;  2BGC A;  3NV2 A;  3VBO A;  2JEC A;  1RUC 1;  3POW A;  4XMA A;  1A8D A;  1QJY 2;  1C1L A;  1R1A 3;  3J7N A;  5L73 A;  3RFR A;  4ASK A;  1OLR A;  2QKD A;  4CPB D;  3U10 A;  1YIP A;  2OII A;  1V0A A;  1JI6 A;  1MS3 A;  1UY2 A;  4GB3 3;  4OUL A;  4CCE A;  4F3J A;  2P5B A;  5FZ7 A;  3VD4 A;  1H1A A;  2HWE 2;  4WZF A;  5CYY A;  3WDU A;  5FY0 A;  4FPJ A;  4LMF A;  5FY5 A;  1YQC A;  4CA9 A;  2ZS6 B;  4K21 A;  4H7L A;  1RUI 2;  4CDU B;  5CAD A;  3NL1 A;  1TMF 2;  2RMU 3;  3B94 A;  5J09 A;  2ZEY A;  2J7M A;  4I0A A;  4B4P A;  4AAX A;  3ZN6 B;  3BPZ A;  5IK8 A;  2G9Z A;  1RVF 3;  4Q1P A;  1T2X A;  3AKR A;  4DO0 A;  4TSV A;  5E6H A;  1H1M A;  4A42 A;  3AYD A;  3VBH B;  3MIC A;  2B9U A;  5IK7 A;  2P2K A;  4LHK A;  1GZW B;  3N4M A;  1S2B A;  1APN A;  2VW0 A;  4XFF A;  3S0M A;  2VZQ A;  1R09 3;  1XU2 A;  2OS2 A;  1VPH A;  4CU9 A;  3O0W A;  1HB2 A;  5F7U A;  1L7R A;  3LSE A;  1X33 A;  3WQ1 A;  4XF9 A;  1FYU A;  4YGD A;  1VBA 3;  4AVT A;  4CEW B;  3ACG A;  1NA1 A;  4FPE A;  3TN9 2;  2RS5 1;  3BUC A;  1D2S A;  3KMH A;  5DDJ 1;  2HWD 1;  1RVF 1;  3ITQ A;  3QH6 A;  3MZH A;  4ARY A;  2FZ2 A;  4GQ7 A;  1BJQ A;  3S7I A;  4MGZ E;  5L7O B;  2PLV 3;  4MG2 A;  3L2H A;  5ABJ C;  4MVT A;  1AXZ A;  2G19 A;  4QX8 A;  1B35 C;  2QQV A;  3N7J A;  2DVG A;  1XNT A;  1H2K A;  2ET7 A;  5FY9 A;  2VOX A;  4H55 A;  3O1R A;  1W2U A;  2MPF A;  2WSV A;  3C3V A;  4XHB A;  1ZX5 A;  1POQ A;  2WFF 1;  3UJQ A;  4N9I A;  3VKO A;  4EQV A;  3JZV A;  3I7D A;  2UUR A;  1CAV A;  1AR7 3;  3OB8 A;  4RSU A;  5GKA C;  4D6S A;  4W6W A;  2DUO A;  3NV1 A;  3LIG A;  5FY4 A;  1S0C A;  1HW5 A;  2VW2 A;  1QJU 3;  1J84 A;  5FTT C;  4IXL A;  1PVC 1;  4ZS2 A;  1O3S A;  4G9S B;  4QXH A;  5JVV A;  3RS6 A;  5A33 B;  3M3I A;  1R08 2;  4WVW A;  1O3R A;  2HWE 1;  4DPN A;  1DQ6 A;  1SLI A;  1QJX 2;  2QQI A;  2VNV A;  2VR4 A;  5JCT A;  1X36 A;  2HWF 2;  2BV4 A;  5FOJ B;  3I2I A;  2WDB A;  1S0F A;  2EVX A;  3HNB M;  4OCT A;  4Q2F A;  4LE3 A;  3T09 A;  5JXG A;  1WLT A;  5KHG A;  1AR8 2;  3C7O A;  3MO4 A;  1CAU A;  1FMD 2;  1AZD A;  2Y8K A;  2QQM A;  4WVZ A;  1E5H A;  4MO3 M;  1LEC A;  3ACI A;  3NST A;  1LHO A;  4YM2 A;  2R16 A;  2VG9 A;  2Y38 A;  1GZW A;  3O1U A;  4ISQ A;  1NQD A;  2E63 A;  3I54 A;  1GP6 A;  2YHJ A;  4Z2A A;  5HCH A;  3RPQ A;  1GWL A;  1D4M 2;  1VBC 2;  3WDY A;  4CCK A;  3KCY A;  1PNG A;  3D8C A;  2WO3 A;  1X82 A;  2A70 A;  4QM8 A;  3AP4 A;  4YPJ A;  1F15 A;  4DY3 A;  4LOT A;  1Q8P A;  2W94 A;  2DF7 A;  2WZR 1;  2XL9 A;  3KV9 A;  4M3C F;  1RMU 1;  4YVS B;  1JU3 A;  1Z7S 2;  2EXJ A;  3AMQ A;  1MQT C;  4BHP A;  2IFW A;  1K3I A;  1S1A A;  5CBL A;  1UXZ A;  2C9A A;  5BNP C;  2NM1 A;  1LCL A;  2H0B A;  2VCA A;  3KCC A;  1W3X A;  4HG6 B;  2D3R A;  5A3M A;  1H8T A;  4CPB A;  1JW6 A;  2A5Z A;  4Y26 A;  3INA A;  4QQH A;  3VN4 A;  4XUN A;  3LEK A;  1JZ4 A;  3W5M A;  2VXJ A;  4EN6 B;  1C5H A;  1AR6 1;  1VB2 A;  4XAC A;  3MID A;  4XC9 A;  4RQP C;  3ES4 A;  1MS4 A;  4Q1R A;  2ZMN A;  1LNS A;  2FDI A;  5LA1 A;  1BHG A;  2V73 A;  1RUI 3;  2QUO A;  3OGJ A;  3GCX A;  1J1L A;  1W6M B;  3B5L B;  1BXH A;  4DEV A;  4XIK A;  3H7J A;  5I0U A;  4F8A A;  3K4Z A;  2HH9 A;  1VMJ A;  1F35 A;  2VNO A;  4E4H A;  1TQ5 A;  1FX5 A;  4JGY A;  4CUC A;  3T2T A;  4NWV A;  2I2S A;  1LEM A;  3KV4 A;  2NQY A;  1Y43 B;  1OVP A;  2MHF A;  2P17 A;  4IEV A;  3VHO A;  3V0A B;  4A7Z A;  2ZHN A;  4RHV 1;  2DVF A;  3N35 A;  1F5J A;  1YXW A;  2B46 X;  2XVL A;  4P00 B;  1QJX 1;  3K2O A;  4Q26 A;  4SLI A;  4OHY A;  5FUN A;  2D6N A;  2EIG A;  1SAC A;  2PHT A;  2FCU A;  3G7D A;  5IVF A;  5LBE A;  5GLU A;  2ID4 A;  5FPV A;  1ZBA 3;  1Q8S A;  4DXR A;  1N3Q A;  2VGD A;  1WMX A;  3V0B A;  2A6Y A;  4KWJ A;  2QFE A;  3RYP A;  1DYP A;  4DXZ A;  4AQ6 A;  2WT1 A;  3RZL A;  5I91 A;  1LAJ A;  3H1M A;  5EJ3 A;  3AP6 A;  4NAM A;  3MIH A;  1GUI A;  3HNM A;  5JR2 A;  3POY A;  4R9D A;  4BOW A;  2WN3 A;  2WT2 A;  1CN1 A;  5JLV A;  1W9F A;  3QOP A;  1ZBE 2;  1IPK A;  2CDO A;  3D3A A;  3OUH A;  4PLN A;  4XET A;  3DKW A;  5K9Y A;  4Z82 A;  4FFI A;  3CQO A;  2W9X A;  4MH0 E;  5HCA A;  1R1A 1;  4BDV B;  2CGP A;  4GJY A;  2ZGR A;  1UU4 A;  3QCW A;  1NXD 1;  2Y26 A;  3KCX A;  3RZH A;  4O61 A;  4XFB A;  1AVB A;  3BIE A;  4QX2 A;  1R08 3;  1CES A;  3CJI C;  4XUT A;  5IW0 A;  5FO9 B;  3L9J T;  1VE0 A;  2TBV A;  2XVK A;  5I8S A;  2NLR A;  2HEY F;  1MPX A;  1DHK B;  2C5D A;  2BPA 2;  1FNY A;  4NIG A;  2IXK A;  3GBW A;  1XOY A;  1BMV 2;  4JCK A;  2ADD A;  5CFC C;  1RUF 3;  2ADE A;  5DAX A;  4HLT A;  4COW A;  1PGL 2;  5KXB A;  1F4H A;  2EXI A;  2JIJ A;  4Y1V A;  3ZYB A;  2WFF 2;  4XW3 A;  2D44 A;  3I2J A;  4BQ4 A;  2ZGN A;  2PHX A;  4M3C E;  2HWB 2;  4Y20 B;  4ZU5 A;  3WW2 A;  1PK6 B;  4KG8 A;  4M4P A;  4MGK E;  4J25 A;  1LES A;  1QKQ A;  1OPO A;  1TZO A;  1E57 A;  1RHI 1;  2DFC A;  4HN0 A;  1UIJ A;  2JXA A;  4BIS A;  4LA2 A;  3J4U H;  4JGZ C;  4N43 A;  2G9F A;  2R04 2;  3FUQ A;  5CAZ A;  3B69 A;  1W04 A;  4IV3 C;  4NE9 A;  5A32 A;  4IND A;  4OHW A;  3PJQ A;  4KGQ A;  3ZXL A;  1UZW A;  2WZR 3;  4JTO A;  3PTR B;  4KU8 A;  1WZX A;  5HBA A;  2LRP A;  2BBA A;  4M3C A;  3C2U A;  3U78 A;  5HI0 A;  1OFS A;  2XJU A;  2DBN A;  3K77 A;  3LDR A;  3OUJ A;  5FFO C;  4K1Z A;  5FUP A;  5F2S A;  1GQP A;  3APB A;  4LUM A;  2ZGK A;  5L9R A;  4PDW C;  2YC0 A;  5FPA A;  4WV8 A;  1GMM A;  1UKG A;  4OI4 A;  4W6X A;  3SCH A;  4CDX A;  5A6X A;  4QHB A;  3Q8F A;  4C91 A;  5A7S A;  2P3I A;  3VZJ A;  1STM A;  3NAP A;  5GZC A;  1U5X A;  1Z7S 3;  1X50 A;  2Y6J A;  2XDV A;  1PO1 1;  1XQN A;  2VMD A;  1QNY A;  3WDW A;  4QPY A;  1OPM A;  2BU9 A;  2CAU A;  2JE8 A;  2DYC A;  2EXK A;  3VBH A;  3WOG A;  1JUH A;  3F2Z A;  4BB3 A;  2Y6H A;  2GDF A;  3WP3 A;  4IDZ A;  3B9I A;  2ZKN A;  3MF6 A;  4GH4 A;  1I5P A;  5A7O A;  3BTZ A;  5LBB A;  1FT9 A;  3ZFE A;  5KBF A;  1W06 A;  5LAT A;  5DMY A;  5JPN B;  5A6Z A;  1QIQ A;  3NNG A;  4B4R A;  5BNP B;  5JI9 A;  4Y4Y A;  4UOJ A;  5CB7 A;  4CDU A;  2PAK A;  1QJE A;  2Q1F A;  4UFL A;  3J8F 3;  2O0O A;  5FZG A;  5BXX A;  4HOO A;  3VBR B;  2WWU A;  5BYN A;  3VLB B;  1DQ4 A;  3UT0 A;  3HQX A;  3ZXD A;  3LQC A;  1YYN A;  3PTY A;  2PHL A;  4JGY C;  2EXH A;  3TEY A;  2DFB A;  2HYX A;  3HAG A;  3ES1 A;  5FK7 A;  1C5I A;  3W20 A;  1WBF A;  3AZV A;  4CDW B;  4AAP A;  1S2K A;  1AR9 2;  4MGI E;  4NR1 A;  3ZXG A;  2ORX A;  4JQR A;  1S0G A;  3IMM A;  1WW5 A;  3N9N A;  4CZS A;  2AEN A;  1UPS A;  3GZT B;  5C8C A;  5GZD A;  4TN7 A;  2GND A;  3A0K A;  4UF0 B;  4KU7 A;  3HN3 A;  1RUD 2;  1OT5 A;  2IXC A;  4NRQ A;  4AVV A;  3NJX A;  5C9A A;  3LPG A;  2GH8 A;  4QHZ A;  5K4L A;  1HIX A;  3ZSL A;  5A3N A;  3ZSK A;  3POB A;  1V9U 3;  2P1B A;  2PLV 1;  3IDB B;  4KH9 A;  4BJ0 A;  4HK9 A;  3T4H B;  4QAW A;  5FIX A;  5IAX A;  1W3V A;  5FZD A;  1JH5 A;  3AX4 A;  4QB6 A;  3III A;  1L3J A;  2SLI A;  1AX0 A;  3OGG A;  1PZ7 A;  4I0B A;  2AUY A;  1HB1 A;  4RGA A;  2IXL A;  5EQU A;  5CVR A;  5FK8 A;  1VBB 1;  1A34 A;  4IE7 A;  1X7N A;  3AMN A;  1AYM 3;  2JWP A;  4OQ9 A;  3K75 B;  3N9O A;  1JU4 A;  1NY7 2;  2BW8 A;  1SLT A;  2JDN A;  5FYI A;  2VMG A;  5A3W A;  4Q0S A;  1GWK A;  3KHC A;  3PVE A;  3KQ4 B;  3AL6 A;  2VMF A;  3NNJ A;  3OGV A;  2H6C A;  5FZA A;  3VBS C;  4BQ2 A;  3O1M A;  2VE1 A;  4QMA A;  5FYT A;  2WL1 A;  5DXD A;  1CX4 A;  4WZC A;  1X9P A;  1AYN 2;  2VUJ A;  3NKG A;  4CUB A;  4QDQ A;  1QOT A;  3AXE A;  3HQR A;  1RIT A;  1VBB 3;  4CDQ A;  1RMU 3;  1ZZ9 A;  3AZX A;  2OX0 A;  2XXZ A;  3BOD A;  4IEY A;  2HBU A;  5T54 A;  4ASL A;  2CGN A;  1WA6 X;  2BBV A;  3I2D A;  4Q8K A;  1TE1 B;  3OOX A;  4FCA A;  1RUI 1;  5F1R A;  3AMH A;  2D6O X;  5BNP A;  4Q4X 2;  5LY1 A;  2PQS A;  1HXS 2;  1W99 A;  1LJ7 A;  4WVM B;  1RUF 2;  2JG8 B;  1QWR A;  4P08 A;  4FT8 A;  5C4W B;  1JZ2 A;  3GHM A;  4GUL A;  4CEW C;  1PO2 1;  5FRA A;  2D6K A;  3DYP A;  2ZEZ A;  3KGL A;  4S2F A;  1MEC 3;  1BQP A;  4EWA A;  1YFU A;  3ILN A;  5DQ0 A;  2WZR 2;  3EB7 A;  4E27 A;  4FPH A;  2MEV 2;  1W6N A;  2HWB 3;  1GFF 2;  1SBF A;  4OUE A;  1HRI 1;  4RS5 A;  4YZ4 A;  4FPK A;  4IEU A;  4KI5 M;  4NJ4 A;  4PF5 A;  3BB6 A;  3OBA A;  4OUS A;  1GQG A;  4GAZ A;  5APA A;  5EFU A;  2B45 X;  4K6B A;  3WQ7 A;  1QJX 3;  4YM0 A;  1UX6 A;  2XML A;  3WSO A;  4DFS A;  1WW7 A;  2R04 3;  2ZEW A;  2XHN A;  1DQ1 A;  3O0V A;  4JTN A;  1KS4 A;  4A44 A;  3FFQ A;  4LKS A;  5C3O A;  2AGS A;  2R07 3;  1HDK A;  2RJ2 A;  4B1M A;  3A21 A;  5JMO A;  3NW4 A;  1W0P A;  4P14 A;  5FPB A;  4BCU A;  4PI0 A;  2Z4F A;  5LA9 A;  3C7F A;  5FYB A;  2JDK A;  4UYB A;  4D0Q A;  1HJF A;  5A32 B;  3WD5 A;  1F4A A;  1LHW A;  3M1H A;  4XCA A;  4HL0 A;  4PCR A;  2WQ4 A;  2FCV A;  2HEV F;  1CAW B;  4L8Q A;  2EID A;  1YRZ A;  2QCS B;  2QQU A;  1GNY A;  4JX0 A;  3SEP A;  3LA2 A;  2RM2 2;  3HT2 A;  1SQ4 A;  1O91 A;  3M8L A;  4K9S A;  2PQQ A;  3IZO A;  3DKQ A;  3OGS A;  2NYY A;  3AZZ A;  5H9Q A;  4M00 A;  2Y60 A;  2VL4 A;  4PT6 A;  4AVC A;  3FHA A;  1W8F A;  3BGA A;  4LEJ A;  2D3S A;  4S2D A;  5SV5 A;  3BOP A;  2QQK A;  5BUV A;  1W8T A;  2VZ3 A;  3D6E A;  5KHI A;  3EJK A;  4QX1 A;  1AYN 1;  3RZZ A;  5CFD A;  1CAX A;  1CVN A;  5G04 L;  2BNO A;  2W1W A;  3OUI A;  1XE7 A;  5T5L A;  1W9S A;  2BDR A;  2A6W A;  1R08 1;  1RED A;  5AVA A;  4CEY C;  4XFH A;  1NYW A;  3GYD A;  4W4Z A;  4I0W B;  3E6D A;  3JBG 1;  4FVV A;  1HQW A;  2WAA A;  2WS9 2;  3ILR A;  2Q8D A;  5FLJ A;  3KZ4 C;  1UO9 A;  2R32 A;  3ZDV A;  4QPW A;  3BI3 A;  3WW3 A;  1MS0 A;  1RUD 3;  3SKV A;  3WDT A;  1AUY A;  1KDK A;  2VVE A;  2C1F A;  1OQE A;  3WNO A;  3WV6 A;  3ZYH A;  4FXK B;  3WT3 A;  1KS5 A;  3O1S A;  1W8N A;  1D2Q A;  3QAC A;  1H2N A;  3GBF A;  4AXO A;  4WVM A;  1H8V A;  1ULF A;  4N53 C;  3VZM A;  5CIR A;  4CDW A;  2A6X A;  4QPG A;  3UKT A;  1RJ7 A;  4XOG A;  3I3M A;  4FTB A;  1XYO A;  2VBD A;  3BYW A;  5JSP A;  4FPG A;  4UI9 L;  3DYO A;  1ZA7 A;  3QD6 A;  2D93 A;  1J1T A;  1QY4 A;  3USU A;  2F4P A;  1RUE 3;  1VBE 3;  3WCR A;  1RXF A;  5IFP A;  5GM0 A;  2VME A;  3AYC A;  3TYJ A;  2XLA A;  3CU7 A;  4MXW A;  2Z69 A;  5ACA 1;  1W2N A;  1WA4 A;  3N3H A;  4OZX A;  4GMP 3;  1VAM A;  3LE0 A;  3VZO A;  5K8S A;  4V2V A;  5FZC A;  3HVD A;  2XQR A;  3MGU A;  3OPT A;  2EIC A;  2TUN A;  3AMM A;  3ATG A;  5I0S A;  2Z79 A;  4AK3 A;  3V0B B;  2VTX J;  1WD4 A;  3WG2 A;  4SBV A;  2YXS A;  1W90 A;  4DMI A;  2BEO A;  4C0B A;  1V6L A;  2RS1 3;  4IGO A;  3OCP A;  4COZ A;  3VBR C;  2ES3 A;  2J1A A;  2VOK A;  3EQE A;  2CGO A;  3OY8 B;  2ZAA A;  5EIY B;  4E9K A;  1ULE A;  1LRH A;  3ZFG B;  4AED C;  3WLU A;  1UU6 A;  1FOD 1;  1OA3 A;  5CA6 A;  1HN1 A;  3DCQ A;  4BME A;  3THD A;  5FOB B;  3M2M A;  3T1M A;  1DLL A;  1ZRR A;  3PUR A;  4NHM A;  2BER A;  5FY1 A;  3S30 A;  5C4W C;  2HYK A;  2V72 A;  2X05 A;  2WO2 A;  1ZZ8 A;  3Q8B A;  4RYD A;  5A70 A;  5DUX A;  4YW3 A;  4LPL A;  1URX A;  2NPI A;  1FPN 1;  3DYM A;  3PVB B;  3WDX A;  4LLO A;  1HQL A;  1W03 A;  2DWR A;  5IVC A;  3AKS A;  3WNM A;  2GNM A;  2ENR A;  3PVN A;  1C57 A;  1QQP 2;  3CZU A;  3ME2 A;  2GSY A;  4LKF A;  4QX7 A;  5DDJ 3;  5D1I A;  2Q8E A;  1AJK A;  3T2Q A;  4B7E A;  4P9I A;  4NID A;  5C8C B;  5JSO A;  2E7A A;  5JAX A;  3P3N A;  1SBD A;  3VBU A;  2XUM A;  2OW4 A;  1RUN A;  4XDP A;  1WLC A;  5FJK A;  1CX1 A;  1IPJ A;  5F6L B;  4Q29 A;  3THC A;  5J96 B;  4LIT A;  2Q8O A;  1Q8Q A;  3LFM A;  1WKY A;  2QDN A;  1ODM A;  1NCQ A;  2WYS A;  5EV7 A;  1BBT 1;  4IQP A;  4Q0U A;  2QJV A;  4NHL A;  4XFC A;  5A7W A;  2NMN A;  5T5O A;  4CP2 A;  1O5L A;  1RUJ 1;  4MXW B;  4XBL A;  2YB7 A;  3A7Q A;  3S5Q A;  3VGI A;  5JSR A;  5A7N A;  1SPP B;  2A7A A;  1MVQ A;  1YJL A;  3LWC A;  4I2O A;  2J1S A;  2GC3 A;  3ASI A;  1A8M A;  1QJZ A;  3NQH A;  5C3P A;  3KGZ A;  2GMM A;  2ZHK A;  3ALQ A;  3VBS A;  4LR4 A;  4CDQ B;  1H2M A;  5F3E A;  2YV8 A;  4G3Y C;  4UBG A;  3E6B A;  4AGR A;  2VVD A;  4CCJ A;  3RNS A;  3I3B A;  3FLP A;  3IDE A;  3KSC A;  3LOI A;  2YGM A;  3E6C C;  3KM5 A;  5F6K A;  4P9W A;  1BEV 3;  3GM8 A;  3LDB A;  2YG0 A;  2X8K A;  4LNV A;  3WNN A;  1YNA A;  2XJR A;  3B3Q E;  5T52 A;  1DQ0 A;  3EHK A;  1W8H A;  2FMY A;  2ZX2 A;  5K0U B;  5A6Q A;  4GWM A;  4FAH A;  1TNR A;  4CP9 A;  2B5H A;  2XJT A;  2W08 A;  2DVB A;  1RL3 A;  3A22 A;  4AFB A;  5JMC A;  5FZB A;  4CDX B;  2R06 2;  3ZIX A;  1W05 A;  3TRS B;  4FPF A;  1QDO A;  1PIV 1;  4JRL A;  4YWA A;  5F39 A;  3D0S A;  5HXV A;  4CCM A;  4E4Z A;  1C8M 3;  3Q9O A;  2DTY A;  2RE9 A;  4XAB A;  5L19 A;  2WNU C;  5FKB A;  1US3 A;  3T2P A;  1LUL A;  2F6B A;  3IDC B;  1HN0 A;  3UV9 A;  2GNT A;  2KA3 A;  3OSD A;  5BNN C;  1RUH 3;  2D40 A;  2WR9 A;  1LGB A;  4N7I A;  2WZE A;  4PBO A;  3RSJ A;  1FAY A;  4Y22 A;  5F5Q A;  5FXZ A;  3ZO0 B;  2XUE A;  1QMJ A;  2Y6G A;  1BCX A;  1OI6 A;  2ZBJ A;  1RHI 3;  4B4Q A;  4CSW A;  4AHY A;  4YVW B;  4LIV A;  4BH9 A;  5LCW L;  1OOP B;  2WA4 A;  2OQ7 A;  3RMY A;  1QXJ A;  4IEQ A;  1ULD A;  4MOA A;  5M0T A;  2K2S A;  5AFE A;  2RHP A;  3FL7 A;  4PJY A;  5E89 A;  2CTV A;  3WR0 A;  5FPU A;  3O1O A;  1WMF A;  1DGW X;  3ZKU A;  2FDG A;  1FMD 1;  2YC2 A;  1W6P B;  1MS9 A;  2W0X A;  1AR9 3;  1NT0 A;  1NZI A;  1RJ8 A;  1S2E A;  3SCF A;  1FOD 3;  1EAH 3;  5LA2 A;  3WQ0 A;  2QQW A;  5EJ1 B;  3K46 A;  3M3E A;  5ERL A;  4JDO A;  2GC0 A;  2WFP A;  4U2A A;  1Y4W A;  3THT A;  5F3C A;  4K3U A;  1ENX A;  3ZIW A;  3PHM A;  3RDI A;  1G7Y A;  5DUV A;  4RGK A;  1PVC 3;  4BIF A;  1ZA4 A;  2GP5 A;  2VTX A;  1EV1 1;  1CPN A;  4KGG A;  4OHZ A;  4OI2 A;  4DIN B;  5KXE A;  1NUK A;  4HXC A;  4ET7 A;  5LEK A;  1H8T B;  5FJH A;  4MGT A;  4A7Y A;  2Q0A A;  1VMF A;  2D43 A;  3SC7 X;  3J26 N;  3DN7 A;  5FY8 A;  2VCB A;  5CKN A;  4QU2 A;  4GIQ A;  1QXP A;  2WJS A;  1LOG A;  1K5M B;  4PDW A;  1GP5 A;  4GKY A;  3B7M A;  5G05 L;  2E33 A;  4RQP B;  2XOM A;  4JV4 A;  5DZE A;  5FRE A;  2WBK A;  1NE4 A;  3T4V A;  3OEA A;  4LBQ A;  2ZEX A;  3ZYJ B;  3TEX A;  3OJB A;  5C3R A;  3K48 A;  1A78 A;  3U11 A;  1S4C A;  3D82 A;  5FKC A;  5T3N A;  4AEJ A;  5JZG A;  5F2W A;  1LOB A;  4JGZ A;  1ZYB A;  4QX0 A;  3ZXK A;  5LY2 A;  2PAE A;  1ZZB A;  2ATF A;  1LOA A;  2JE7 A;  2RJL A;  4PBP A;  4FSJ A;  1YIF A;  3KVA A;  1MVE A;  1O3Q A;  1U5Z A;  4YW2 A;  4LQR A;  3M70 A;  1OLM A;  4S2H A;  1C8N A;  2ILM A;  1VAL A;  4L99 A;  1ZVF A;  2VOW A;  5E1R A;  3WG3 A;  2VQ0 A;  2ZAB A;  4LKE A;  4XAA A;  3ZLI A;  4TTG A;  5DDJ 2;  4PQQ A;  2C26 A;  2XWB B;  5I8Y A;  2QQN A;  4YSF A;  2KM2 A;  3NNF A;  1XJA A;  1TG7 A;  1XE8 A;  5CFC B;  5ACA 3;  4XJU A;  1AXK A;  4WBB A;  5JOX A;  2X09 A;  1XE0 A;  1HV0 A;  5ABJ A;  4JKK A;  3LA3 A;  1S55 A;  3VHN A;  2VZU A;  1ODN A;  4EN9 B;  4EYU A;  2C24 A;  5DAP A;  5ANQ A;  3SXW A;  3WX5 A;  4AVB A;  2VUA A;  3LEM A;  1NG0 A;  4IE4 A;  1N47 A;  1OOP A;  2JD9 A;  2XBO 3;  4LBQ D;  2J42 A;  2V5Y A;  1G9F A;  3H7Y A;  4GZ9 A;  1JBC A;  3PU8 A;  5GLW A;  3WVJ A;  2YDE A;  1DBN A;  1NKG A;  4WM7 C;  1ND2 C;  4XUQ A;  2UWA A;  5IVJ A;  2DU1 A;  3VD5 A;  4JKL A;  1D4M 3;  2HWF 1;  1EPZ A;  4I30 A;  4JQT A;  2D5H A;  1Y7B A;  4QHO A;  4RN5 A;  2K9Z A;  3VD3 A;  4I3G A;  3EYP A;  4UBH A;  4JVA A;  4LUL A;  2JDH A;  2HWC 1;  1CWP A;  1BBT 2;  2VTF A;  1UOG A;  1C8M 2;  1IG0 A;  4XMI A;  1JHJ A;  2W5F A;  4FFH A;  1UD1 A;  3ETP A;  5FR3 A;  3WUC A;  3IAQ A;  3MI8 A;  5DPN A;  1HB4 A;  1HRI 2;  2JDA A;  2W46 A;  2XKP A;  5GLV A;  2DVA A;  2GN7 A;  2FBE A;  3B93 A;  1D0H A;  3LDK A;  1J58 A;  1U5Y A;  2LUW A;  3MPB A;  4URT A;  1NA1 B;  2BFU S;  3SIS A;  1W8W A;  1A3K A;  1VIW B;  4P9Y A;  5H9R A;  2OQ6 A;  1FXZ A;  4IE0 A;  2DU0 A;  4GB3 1;  1W6N B;  2KR2 A;  4AGV A;  1VRH 3;  4RA0 A;  4LHL A;  1WCQ A;  3HPN A;  1EUT A;  3RRD A;  1DLC A;  5FYH A;  1BK0 A;  3I59 A;  5CU1 A;  5FDB A;  2VNG A;  3JU9 A;  4E2G A;  1N1S A;  2JDU A;  3PU3 A;  3NAP B;  1AF9 A;  2CNA A;  4X6R B;  5IAV A;  1AL2 2;  3ACH A;  4IV1 C;  4YVW C;  4QQL A;  2AR6 A;  3VDC A;  5FO7 B;  3VHR A;  2QNK A;  5FPL A;  2RDQ A;  4ZU4 A;  2VMC A;  1QXR A;  2XHK A;  5JOY A;  1G86 A;  5FZ3 A;  3VDD A;  2XLF A;  5FZ8 A;  4A45 A;  2WNV C;  4O9E A;  2XG3 A;  4GWN A;  3USU B;  4LE4 A;  5F32 A;  1TVG A;  1JHN A;  3POI A;  3MFA A;  3ELN A;  3SCG A;  4LO8 A;  1H1I A;  4YNI A;  4Y5S A;  1UKR A;  1NLS A;  1ZBA 2;  4Q0V A;  4LJH A;  2JKB A;  3PUA A;  1FOD 2;  2IXI A;  3KB5 A;  4BQY A;  4EN0 A;  4CVU A;  2AAC A;  3M7A A;  2JG9 A;  1IKQ A;  2VEC A;  3MV1 1;  5DUU A;  1IS4 A;  1H9P A;  3HQU A;  2KD7 A;  1UYZ A;  3OBZ A;  3VZL A;  1UZV A;  3J7H A;  1NXM A;  3LSD A;  4QDR A;  4CTE A;  5FZ1 A;  4FP3 A;  5KXC A;  3WZ1 A;  3WG4 A;  2Q5T A;  4Q4X 3;  4L11 A;  4RR3 B;  1JUI A;  1KIT A;  3BTY A;  2YMZ A;  3AZY A;  4I3P A;  4YRD A;  4BMB A;  5C33 A;  4QB1 A;  2G9G A;  3VD9 A;  1JMU B;  1O4Z A;  3K51 A;  4A3Z A;  3E5X A;  2VZO A;  3MLK A;  2BWC A;  2YBS A;  5L7O A;  1UW8 A;  1YLL A;  1DQ5 A;  1XNC A;  3UK9 A;  2RS3 3;  1XND A;  2Y0I A;  3DEC A;  1CR7 A;  1AJO A;  3AL5 A;  4M0H A;  3U0Z A;  1JYI A;  1O8S A;  1Z78 A;  1EV1 3;  4AI9 A;  3SKJ E;  3R4U A;  5IUQ A;  4CEW A;  1KJR A;  1I3H A;  4HKO A;  1ND2 A;  1K5M C;  3KS7 A;  1W8Z A;  2P37 A;  3DUI A;  3H8U A;  5FCC A;  5D8A B;  4BQW A;  3PL0 A;  3BAL A;  1B35 A;  1KRI A;  5GZF A;  1GYK A;  4RL7 A;  1ZZ6 A;  2GAL A;  1ZRF A;  4ZXK A;  4D7Y A;  2ZGT A;  2I74 A;  2QQP A;  3BTA A;  4NAO A;  5JXH A;  4BA6 A;  1H8T C;  3POE A;  2DV9 A;  1G9A A;  4TXW A;  1H0B A;  4AED A;  5BNN A;  3NJY A;  3M4F A;  4Q27 A;  2XBO 2;  2ZGS A;  3MHZ A;  1VBE 1;  4BXS V;  2JDY A;  4E2Q A;  5EYX A;  1ZM1 A;  1W2T A;  4AFD A;  3USS A;  1W6O B;  4TWT A;  1KQR A;  2DCT A;  2QVS B;  1NE6 A;  3I97 A;  3NVC A;  5FZ4 A;  4DOU A;  4FAG A;  1K5M A;  1YHF A;  1LHV A;  3HNY M;  5A33 A;  2UWC A;  1OKO A;  1PO2 2;  5F5I A;  1MZE A;  2HWD 3;  2JDZ A;  3O0X A;  4IEO A;  5F37 A;  3TB0 A;  1PGL 1;  2HBT A;  1W39 A;  4OVE A;  1IKP A;  4F7Z A;  5C7G A;  3IM0 A;  1CZS A;  3PVO A;  2Q30 A;  1OD3 A;  5E16 A;  1MZF A;  3N36 A;  4LTA A;  1SBE A;  4AQ2 A;  4JDN A;  2OZJ A;  2Z42 A;  1NCR B;  1PGS A;  2A71 A;  5I0T A;  3RZJ A;  1IPS A;  1KFX L;  1QJY 1;  2P6H A;  1O4T A;  1SHW B;  4QPI B;  3DF0 A;  4FOQ A;  4MHR A;  1OLM E;  1QOS A;  1BBT 3;  2R04 1;  3M3Q A;  1OC1 A;  1SFN A;  2GC2 A;  4MZU A;  3W59 A;  1G9D A;  1PNF A;  1YQ8 A;  2IUW A;  4FPO B;  4CCN A;  4R9A A;  1S0D A;  5FMB A;  3LCP A;  4JC1 A;  4GKX A;  1OH3 A;  3FX3 A;  3HMY A;  3PIJ A;  4U36 A;  5CKQ A;  2R49 A;  1UL9 A;  4OQ8 A;  5T50 A;  3VBO C;  2HWB 1;  1TMF 1;  3ZYP A;  4AEK A;  4AG4 A;  4LBL A;  2W2I A;  1ENR A;  1QQP 1;  5FPX A;  1EUU A;  1EPW A;  4LHN A;  4MGY E;  2H0V A;  4UT5 A;  1V6O A;  5F5A A;  2W68 A;  3NWK A;  4XF3 A;  1OQD A;  1UNB A;  3ZPY A;  3H8R A;  5F8P A;  4Y20 A;  1FPN 3;  4RS5 C;  2QQJ A;  4BPZ A;  1U12 A;  4XF4 A;  1JS9 A;  1TME 2;  4A7K A;  1XPW A;  1RUF 1;  3HBK A;  4CDU C;  3ST7 A;  1XC6 A;  3ETQ A;  4ZS3 A;  1W6P A;  1XBF A;  5DAW A;  5LA0 A;  2WS9 1;  2GN3 A;  4XUO A;  2XL7 A;  1GBG A;  3LD8 A;  3ZXA C;  3MFC A;  3TNQ A;  4D6Q A;  2ZCW A;  4ISR A;  5FUI A;  3SEE A;  1LHU A;  2XJV A;  4RR3 C;  4ZZ5 A;  3HN1 A;  4EN7 B;  3FJS A;  5LW9 A;  3N7K A;  3CO2 A;  1PIV 2;  5FZO B;  1YCI A;  4EJR A;  3KT7 A;  2P3K A;  1PGW 2;  3POS A;  4D8M A;  1ZRD A;  3ILF A;  4Q4Y 3;  3A4U A;  4N90 A;  5GZE A;  2HWC 3;  4Q0P A;  1UY0 A;  5KHH A;  1GOH A;  2JG9 C;  2X5I C;  4XPV A;  5C3S A;  5JDB A;  1UMZ A;  4CUA A;  1COV 1;  1RUG 3;  2ZKL A;  2VPV A;  5H9S A;  3VBO B;  1HRV 3;  2A3Y A;  2HLE A;  4R4X A;  4B1L A;  5CG8 A;  1Q43 A;  4LOR A;  1HX6 A;  3AM2 A;  1MR5 A;  1IQD C;  3HD8 B;  4YGC A;  4JGY B;  1YFY A;  3H42 B;  3IN9 A;  4FTE A;  1BVP 1;  4I02 A;  3VBF B;  2X29 A;  4AFM A;  1RUE 1;  3FBY A;  4Y24 A;  4IV3 A;  3TOJ A;  3TWI A;  3W21 A;  4COV A;  3C7G A;  4QQ2 A;  5A3U A;  5CFD B;  5I0R A;  2VUD A;  4GH4 B;  1SFP A;  3J7L A;  2QE3 A;  2NN8 A;  4GXL A;  4CP9 B;  2FDH A;  3POJ A;  3CNA A;  3D5O A;  3PUS A;  2BOJ A;  4YVW A;  5LEJ A;  3T0B A;  2XR4 A;  2EAK A;  2CSG A;  4FPC A;  2VZ1 A;  1PMI A;  4AL9 A;  4LXL A;  4P02 B;  2VH9 A;  4FOV A;  3ZSM A;  5FPZ A;  4AFA A;  4N53 A;  1RUD 1;  2O1Q A;  5D8A A;  1VBB 2;  3DPR C;  5FZ0 A;  2CAV A;  3RG0 A;  1EAH 1;  2ZHM A;  2QZ2 A;  4QKD A;  5A1F A;  4Y5Z 0;  5K7P A;  5LK7 B;  2CYF A;  2K0G A;  3RZG A;  2WO1 A;  2RDS A;  4YAR A;  4DUX A;  4Z1V A;  1W0N A;  3KQR A;  3POG A;  1K12 A;  2E31 A;  3WNP A;  4UFI A;  4UXA A;  1FV2 A;  1TEI A;  2R0F A;  3FC0 A;  3HT1 A;  2YRO A;  2JIG A;  2JG8 C;  1DZR A;  3AVR A;  3GF6 A;  4GWJ A;  4YG0 A;  3WG1 A;  5L9V A;  3I8T A;  1UN1 A;  1IOA A;  3MUZ 1;  3CKH A;  3F95 A;  5CFD C;  4LHS A;  5J98 B;  1VRB A;  5FWJ A;  3J8F 2;  4UFH A;  3UGH A;  1MZ5 A;  1IS5 A;  4H14 A;  5IJR A;  2AEY A;  4YG6 A;  3ZSE A;  2PHF A;  3IT8 A;  1VBC 3;  1CAV B;  1F5F A;  2PFW A;  3NV4 A;  1HJG A;  4NWW A;  5FZF A;  5IVE A;  1JZ5 A;  1JOJ A;  3IWZ A;  2ZPX A;  2JG9 B;  1AX2 A;  2CY6 A;  1G9B A;  4XHX A;  2C0Z A;  3MF9 A;  4CXY A;  2EIB A;  4JHT A;  3VBS B;  3MW3 A;  2ZX1 A;  2JEM A;  2JG8 A;  4XQ4 A;  3RQ0 A;  5J48 A;  4OMD A;  2E7Q A;  3AYA A;  3ZN6 A;  3H3Z A;  4CU7 A;  3D4K A;  2E26 A;  4IV3 B;  4KWL A;  4OI1 A;  2Y64 A;  1XYP A;  5LRS A;  3GBG A;  1SG3 A;  1PMH X;  4LBN A;  2RMU 1;  4L0P A;  4A2U A;  1UX7 A;  1K5J A;  4DRV A;  2D3P A;  2G1M A;  1WUV A;  2VBB A;  2LTN A;  3AJY A;  3POF A;  5CZK A;  3VBR A;  3ZMO A;  4Q5O A;  4J1W A;  4Q4W 2;  4FOW A;  3NRU A;  2XPJ A;  2NZ9 A;  2WAO A;  4AHX A;  2ZAC A;  3W9A A;  3CBN A;  3NNL A;  3PDQ A;  4YW7 A;  4ES8 A;  3CJI B;  4QB2 A;  2WQZ C;  4XYX A;  1ONA A;  3AKT A;  3IAP A;  3GDB A;  4ORF A;  5DZF A;  2ZX3 A;  4ZPI A;  4AI8 A;  1R64 A;  4KWK A;  2PHU A;  4QWN A;  2HJI A;  2YC4 A;  1REE A;  2P34 A;  4X8N A;  1TME 3;  4NIA A;  4YLZ A;  1Q5O A;  4WM8 B;  4XF0 A;  4QD2 A;  2VZP A;  3PMS A;  4XVH A;  3LPF A;  5BNO A;  3M3O A;  3GJA A;  2R07 1;  5LBC A;  2QDR A;  1EAH 2;  2WWS A;  3MUY 1;  1RUC 2;  2CHH A;  4ZZ8 A;  4P5Y A;  4P9G A;  4JZR A;  1JN2 P;  4BIO A;  5FP9 A;  2WS9 3;  3WW4 A;  4MSV A;  1VJ2 A;  1GR3 A;  5IFT A;  1UZZ A;  3GAL A;  4R4Z A;  1NY7 1;  5B2G B;  1C8M 1;  5FZL A;  4AI1 A;  4W8J A;  3ZX7 A;  3T3Y A;  3LZZ A;  1OUS A;  4FQZ A;  4COY A;  1I6X A;  3O1T A;  2VZT A;  1UAI A;  1JZ8 A;  5D2A A;  2Y33 A;  3BCW A;  1Y9G A;  4HVO A;  3E5Q A;  4OI0 A;  1EP0 A;  1VBD 2;  2WZP P;  4N43 B;  3RWK X;  1W9Y A;  3FWE A;  4DXS A;  2ZZQ A;  1OSG A;  1UOB A;  1HXS 3;  2IVJ A;  2W92 A;  1H6Y A;  3U1X A;  1RB8 G;  3JB4 C;  1AR8 3;  2VAU A;  1DZT A;  4PQ9 A;  2D6P A;  5FLI A;  4FBF A;  5F3I A;  2CWS A;  1XB9 A;  1W6Q A;  3GJB A;  2GZW A;  4X8P A;  3NNM A;  4Q4V 1;  5J36 A;  2VCM A;  3VHP A;  2V09 A;  1DF0 A;  4BYY A;  2C9K A;  1JZ6 A;  2VBP A;  2FDF A;  1RUG 2;  1GP4 A;  1MAC A;  4YFW A;  5FYC A;  5LRR A;  3PUH A;  1JZ3 A;  4GAL A;  4X6Q B;  4BM8 A;  1CQ9 A;  3RZM A;  3ZR6 A;  4QXK A;  1W6M A;  3UL2 A;  2RR1 1;  2C4X A;  3JXS A;  5KWR A;  3VZN A;  3DGT A;  2W91 A;  2DCY A;  4NOT A;  2O8Q A;  1W28 A;  2LAL A;  4NHY A;  4IE6 A;  2RS1 2;  4WVV A;  5FYS A;  4UFJ A;  4Z92 B;  1QJU 1;  3ZXE A;  2IXJ A;  2BGO A;  3LA7 A;  2JE9 A;  3WP6 A;  4D7S A;  1VLN A;  4QX3 A;  3VD7 A;  5FBZ A;  1J3Q A;  4GMP 0;  3T2O A;  5C8W A;  2YBK A;  2JKX A;  3G6J B;  1QNW A;  5FZO A;  4JGZ B;  2YZ4 A;  2F4L A;  3FBM A;  3RGB A;  4A6O A;  5JPM B;  2ARA A;  2DCJ A;  3DPR A;  3ZFF A;  4AHW A;  1SLA A;  2Y6L A;  1ZNP A;  5D8A C;  3LFI A;  2FCT A;  3FE5 A;  4XQW A;  3AFK A;  5FP8 A;  4KWU A;  5J1X A;  4FPL A;  1T6B X;  4XJ8 A;  5A80 A;  1F31 A;  4M01 A;  5A7P A;  4BWO A;  2RS3 2;  3IIA A;  2XJP A;  4C1X A;  2RS5 3;  3RJR A;  4EWD A;  4M3C B;  2VM9 A;  4MUV A;  1ZBA 1;  4XEZ A;  4LO4 B;  4EZH A;  4N9H A;  2L9L A;  4IL7 A;  1GZT A;  2ZGQ A;  1XU1 A;  2Y6F A;  2OYZ A;  4MAD A;  3CEW A;  3QH7 A;  4AHZ A;  2ETE A;  1MS8 A;  2D6M A;  1U0A A;  1JTZ X;  3VKL A;  2J1U A;  3BTX A;  5C4W A;  4TYS A;  2XQX A;  1PM7 A;  2BZD A;  4XCB A;  4YW5 A;  1E5S A;  4IET A;  5FYZ A;  1UOF A;  4MX3 A;  1D7P M;  1SPP A;  3V56 A;  5GLZ A;  2WNU B;  1IG3 A;  4R52 A;  4UW5 A;  5I93 A;  1SCS A;  3TNP B;  2WSU A;  4L92 A;  1OVS A;  4MXV A;  1W8O A;  2X5I B;  3WQB A;  4M0N A;  3KV5 A;  3UES A;  5JI7 A;  3IMN A;  2PTM A;  2V5D A;  4RR3 A;  1YFX A;  1GOG A;  1COV 3;  1IHM A;  1RUG 1;  2CV6 A;  3P5B A;  2OA2 A;  2DBI A;  5A3O A;  1XXN A;  2WWJ A;  1BEV 2;  1US2 A;  1FI2 A;  2WNV B;  1PX3 A;  2ZAH A;  5FZ9 A;  3U4X A;  5KR7 A;  1TME 1;  2WAB A;  2Y34 A;  4Y22 B;  2BUK A;  2ARB A;  3JQW A;  3MBW A;  3OD4 A;  3RJ2 X;  1LR5 A;  4CE8 A;  2RS1 1;  1QDC A;  1F8V A;  4AW7 A;  3JD7 2;  1VRH 1;  2JJ6 A;  2EA7 A;  5FAX A;  1AX1 A;  2VD7 A;  4IV1 B;  1RUC 3;  4UFM A;  4PIZ A;  3BN6 A;  2AC1 A;  1S0I A;  5LB6 A;  1DP0 A;  1GKB A;  1V6M A;  2EIE A;  5BV6 A;  3IPV B;  3P3P A;  3UJO A;  5A3T A;  3WXP A;  1POV 0;  4NPM A;  1GNH A;  2IZW A;  1VAK A;  3KT1 A;  2R6Q A;  4H7M A;  4K40 A;  1KJL A;  2B42 B;  4GMP 1;  4YZ5 A;  1T6G C;  2YU2 A;  3KF3 A;  3MPP G;  5DG2 A;  4YYO A;  3BU7 A;  3EMR A;  2GNB A;  2PHD A;  3A0N A;  4AI3 A;  2VQA A;  4PLM A;  1SDD B;  3RZK A;  5FXV A;  2D98 A;  1L7Q A;  1FAT A;  3O1V A;  1ZRI A;  3OY8 A;  1UY4 A;  4HZF A;  2VJX A;  4NUB A;  5FV3 A;  3VKN A;  2FHR A;  1D4V B;  4Y1X A;  2CL2 A;  4D7T A;  2B4K A;  2YUE A;  3A23 A;  1FPN 2;  3AP7 A;  3H0O A;  5AVP A;  1M4W A;  3B01 A;  2GU9 A;  1DIW A;  4BK4 A;  2WFF 3;  4XIO A;  1YI9 A;  2RDR A;  3KWV A;  1H30 A;  5FXW A;  1MS5 A;  1V6I A;  2XWJ B;  3CF6 E;  3PLQ A;  1H6X A;  3ORJ A;  4IGQ A;  4XBN A;  4IEX A;  5FZE A;  3U14 A;  1MZ6 A;  3JB8 A;  4LA3 A;  2X53 S;  3UET A;  3X29 B;  4P5H A;  4RFR B;  4HBN A;  4K20 A;  4DXT A;  4EWE A;  4PLO A;  3S7E A;  1YJK A;  1QH6 A;  3HIF A;  5FLH A;  5FQ0 A;  2Y6K A;  1NZC A;  1WLD A;  1Q56 A;  4Y1Z A;  3I49 A;  1RUJ 2;  1PVC 2;  1YWK A;  5AC9 3;  1G9C A;  1UF2 C;  4UFK A;  5LZ6 A;  4CRQ A;  1OLQ A;  4QPG C;  2YPD A;  3CJX A;  1GIC A;  3SH3 A;  2VUL A;  1LU2 A;  1W6Q B;  3ZXF A;  5K0U C;  4Y5T A;  5JIU A;  4FI9 A;  2WII B;  4F83 A;  1JYT A;  5FP4 A;  4G4F A;  1YO8 A;  2ZGU A;  1O4Y A;  1HLC A;  3P1I A;  3AC0 A;  4LO7 A;  4AGG A;  4NRM A;  5DG1 A;  1GLH A;  2PA7 A;  1N1T A;  1VMH A;  1XNB A;  2AYH A;  2FDJ A;  3CZJ A;  1DGW A;  2SBA A;  3MV0 1;  2BTV C;  2IC1 A;  2GAU A;  1ALY A;  2ORZ A;  1NOV A;  4RHV 3;  3WHU A;  4P9X A;  3VDA A;  4EZ4 A;  3JD7 1;  3EXU A;  1C28 A;  1OKQ A;  4COU A;  4DIQ A;  1JYC A;  1GZ9 A;  2OZ6 A;  2AEZ A;  2Q4S A;  3IB3 A;  4AE2 A;  3UGG A;  2VXR A;  4Z07 A;  4HN1 A;  3T08 A;  2XVG A;  4FXG B;  1SZB A;  1XYN A;  5A1A A;  1BLZ A;  2JDM A;  3TEW A;  4NN0 A;  4AFC A;  2VU9 A;  1LKN A;  4I09 A;  5LWB A;  1OD5 A;  4Q4X 1;  3WUD A;  3WF4 A;  5A7Q A;  3E1F 1;  3VDD C;  5BNO C;  4OLL A;  5FBJ A;  2JX9 A;  1JXN A;  5HV4 A;  1PGW 1;  2BP6 A;  3AP9 A;  3OPZ A;  1I5Z A;  2W95 A;  1UZ0 A;  3RI8 A;  3TN9 1;  4R9C A;  1LOC A;  4LBM A;  1QOO A;  4QQO A;  4Q4Y 1;  5IVY A;  1W2O A;  1YEW A;  4NMI A;  5ACA 2;  5JUV A;  5J37 A;  3OD0 A;  2R06 1;  5CKM A;  3UYJ A;  1E5I A;  1O5U A;  1S0J A;  2XGX A;  2A1X A;  2LS6 A;  3I3E A;  4XDO A;  5F5C A;  5FMC A;  2A6Z A;  3I2H A;  5D21 A;  1XRU A;  4HSL A;  5IVB A;  1R09 2;  4E2S A;  4XJW A;  2VCC A;  4QXC A;  1G6N A;  2RM2 1;  4LOS A;  3RWN A;  1COV 2;  2VY0 A;  2WLP A;  4KMQ A;  4FOY A;  1G8W A;  1DGR A;  3T30 A;  1YC6 1;  3S5A A;  5FQ0 B;  1MQT A;  4V1P A;  3VBF A;  2N7G A;  5C5T A;  1V70 A;  2VZV A;  4E4S A;  5FZI A;  1W9T A;  1NCQ B;  2WNU A;  5A7W B;  2RM2 3;  1WD3 A;  4TLG A;  3VKM A;  1CIW A;  4DZG A;  4XJZ A;  3U37 A;  3IPV A;  5L9B A;  5T55 A;  3B00 A;  4XDQ A;  5JWP A;  3KF5 A;  1ASJ 1;  3LKJ A; 
#chains in the Genus database with same CATH homology
 3RZK A;  3RZH A;  3BU0 A;  4CXW A;  4QKD A;  4O61 A;  4ZHN A;  4NPL A;  3T3Y A;  4QKF A;  3O1O A;  3O1M A;  3O1V A;  4OCT A;  3BKZ A;  3BUC A;  3I49 A;  3BTX A;  3O1T A;  3H8X A;  3BTY A;  3BIE A;  3RZG A;  4IE0 A;  4NIG A;  4NIH A;  3RZL A;  4QHO A;  3T4H B;  3RZM A;  4CXY A;  4JHT A;  4MG2 A;  3BI3 A;  5DAB A;  4NJ4 A;  3T4V A;  3O1U A;  3H8R A;  4ZS2 A;  3S5A A;  4QKB A;  5F8P A;  4IE6 A;  3LFM A;  4NRO A;  4O7X A;  3H8O A;  3RZJ A;  2FDH A;  3S57 A;  3O1S A;  4NPM A;  3KHB A;  4NRP A;  4IDZ A;  2FDG A;  4IE7 A;  4IE5 A;  2FDI A;  3I3Q A;  4NII A;  4NRM A;  3O1R A;  3BTZ A;  4IE4 A;  2FDJ A;  3I2O A;  3I3M A;  4MGT A;  3O1P A;  4NRQ A;  2IUW A;  4RFR B;  2FDK A;  4QKN A;  4NID A;  4CXX A;  2FD8 A;  4ZS3 A;  2FDF A;  3KHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...