2VOVA

An oxidized tryptophan facilitates copper-binding in methylococcus capsulatus secreted protein mope. the structure of wild-type mope to 1.35aa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
290
structure length
289
Chain Sequence
GVAEVVETFKNPGTYSSPVINFKIASPPGPGTPIYGPPRDFSGYNKSYSLAIGKTSYYDPTTGTKWNDDTITPVSDGQDIWRGTHTGKWSFFNGKAGDKITLSVQRDAQEASLKGAHPGFILFWRPEGGPLFWAGTQDLDEGQTALPADSDTVIGHVIVQHADWTLQGLPPKADHTAPAGVDTELYPMKPDSYTMYYVDSGYDADKYVASKKLIMHPTAFKGLALNDGTAGAFTKSITLPKTGYYMLYVANVLEVDDWSVDADGKLTTTGEVWEVPAKGCWVNITISKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SURFACE-ASSOCIATED PROTEIN
publication title An Oxidized Tryptophan Facilitates Copper Binding in Methylococcus Capsulatus-Secreted Protein Mope.
pubmed doi rcsb
total genus 70
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11617 Cu-binding_MopE Putative metal-binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1220 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vovA00
2VOXA 4BZ4A 2VOWA 2VOVA
chains in the Genus database with same CATH superfamily
2VUAA 3QH6A 2WZR2 1ZZ7A 3WP4A 3DPRA 2FMYA 1E5HA 3GZTB 1QJY3 3I97A 5F6LB 4YYOA 3T30A 5IFPA 2R1DA 4ZS3A 4K7JA 1YCIA 1SDDB 2D93A 4IE6A 4YM1A 3WF1A 3O12A 1W39A 3ACGA 5A7WB 3MDPA 5IVYA 1CVNA 1OOPA 5DQ0A 4RA0A 5DDJ1 3S30A 2YC4A 4KWKA 1ND2B 3DXUA 3MUZ1 4FPKA 1FMD1 4YVWC 3K4AA 3KF5A 5L7OB 1Q43A 1O91A 2JB4A 3JZVA 1H8TA 2DCKA 3OBZA 3JD73 4ASLA 2XGXA 3IDAA 3VZLA 3MIGA 4G4FA 4XCBA 1MVEA 3ROUA 3ZYBA 4LNVA 1W6PA 3HMYA 1PVC1 1VRH3 2E9QA 2WABA 4PDWC 2ZA9A 2WT2A 4IEUA 3VBSC 2Q1MA 1F2NA 3HBZA 5FZ6A 3POJA 3WEZA 3ORJA 4RQPA 2WZR1 4LBQB 2QKDA 4XEZA 4HKWA 4O65A 2Y6LA 4JGYA 5FY1A 5LA0A 3S7EA 1B35A 1KITA 4AR2A 4ATFA 3LIHA 3AP4A 3BYWA 2R32A 4XUTA 5FLJA 3E5XA 2WA3A 4Y24A 1PIV3 2ZX4A 4AFCA 2Q8EA 2PLV2 4Y5Z0 4AZZA 4Z2AA 3F2ZA 5IT6A 1Y3TA 1ULPA 2WYSA 2ILMA 1O3SA 2Q4SA 3VLBB 3NAPB 4UT5A 2RDNA 1DQ4A 4YW5A 1JXNA 3ZVXA 1W9FA 4LBKA 1CN1A 4Y5SA 3NW4A 5FMCA 1IKQA 4MXVA 5T50A 5C5TA 4HKOA 4XC9A 4QPGB 5C5UA 1VP6A 2D98A 2WL1A 2JG9C 3BOWA 3W21A 3CIHA 4P9IA 3AZWA 1FI2A 5E88A 2BTVC 4HSLA 1DG6A 3UESA 3ZOIA 5F37A 3I49A 5I93A 2X5IC 4YFZA 2HKXA 4PIXA 5JZGB 1UY2A 1WW6A 2PYTA 5CIRA 3O0WA 4JHZA 2VZRA 1XNCA 1OPMA 1HDKA 1W8NA 2BJSA 3UNPA 3CU7A 5AVAA 2DCJA 5CZKA 2Y6GA 2VMEA 5FTTC 5SV8A 5F9TA 1LECA 3N7JA 1O8SA 1OVPA 4B4RA 4D7SA 4BK4A 1OF4A 1CAVA 2Z5WA 1PO13 1H6YA 4S2DA 5FKBA 4LQRA 5FR3A 3ACLA 4IE7A 1RUJ3 1ULOA 3I2GA 5FZFA 2CHHA 3DCQA 3BVCA 3R6SA 4D7TA 2WNEA 2GP5A 3D6EA 1DGWX 3WNOA 4FOWA 2G9ZA 3CLPA 3P3PA 1QJFA 4XCAA 2AACA 5ABJC 3PIJA 1T6BX 4AQTA 4P9WA 4P9LA 3T2OA 3ZYJB 5HCBA 3VBHB 4COYA 4JRAA 1SCRA 4E27A 1POV3 4MGSA 4PIYA 1LGNA 4Q4X3 5F5AA 1SBEA 1YIFA 2OKXA 3RQ0A 4QHBA 3WDVA 3G6JB 4YGCA 5JWPA 3LOBA 2J1TA 1OVSA 2VBPA 4MYEA 4EE2A 3AXDA 3OUJA 2RR12 3Q8BA 4PLMA 5CAZA 1Q5OA 3LSDA 1NY72 1UYXA 3K3OA 3GHMA 5EXOA 3O1OA 3KSCA 3U75A 3ZSKA 5K0UA 5BNNA 5GZEA 1YIPA 2JICA 2VQUA 4HK9A 4YGEA 3WD5A 2ETEA 1ZZBA 2BU9A 5FZHA 4E4ZA 1RUE2 2BNMA 4KNCA 4H55A 1CIYA 3I3EA 5KXEA 1J3PA 4RHV2 2WJSA 2ATFA 3O0XA 5F5CA 4PCRA 1VMFA 2JDHA 3WZ1A 4RFRB 4QD2A 2VW2A 3Q8EA 1EYBA 3ZFGC 2DURA 2H0BA 1V6JA 2YV8A 1S0FA 2AGSA 4Y1UA 4E8CA 5I0SA 5LW9A 2H6BA 5DABA 5TSWA 2JDKA 1ULCA 2LROA 2ZOEB 4AQ2A 1PX4A 2W1WA 2YFUA 1W2AX 3LQCA 2W1QA 1NLSA 3M1HA 4FXGB 2VMFA 4NROA 4KU8A 1YFYA 1C5HA 2RR11 1XSQA 3E6DA 3JXSA 1LOBA 1PX3A 1OD3A 3KQRA 1L7QA 4AG4A 1NY71 2DCYA 3T4HB 4CXWA 4OMCA 3UJOA 1QNYA 2P2KA 2VOTA 2WLPA 2XONA 3VZOA 1V0AA 1WUVA 1OUXA 2QFEA 3U10A 1RUE1 4CEWC 2DUOA 3PJYA 5D8AC 4AEDC 2VULA 1FYUA 4OI0A 1X7NA 4RHV1 1HB4A 4QXHA 4QX2A 2Y33A 4XACA 1UOFA 1Z7S2 4W8JA 5E16A 2FDKA 4MG2A 3J7HA 3ASIA 2VTFA 4BPZA 4AVTA 4BOWA 4BQYA 4OHXA 2VUDA 3C2UA 1DDLA 1JHNA 1SHWB 1GBGA 2WQ8A 3KF3A 4JCKA 5A33B 1VBA2 2J1VA 2V5DA 1YFUA 4JGYC 1YI9A 3AZVA 1CPMA 1EAH2 4A7KA 5DAWA 2J22A 1UY4A 5FYYA 3I4IA 4HETA 3PVBB 3WG4A 1O4YA 4Q4V2 1EUUA 1GP4A 1LR5A 1RMU1 2YB7A 3MW3A 1VBB2 3KCXA 4BQ2A 3BIEA 3MYXA 2HWB3 1ALYA 3MUY1 1GP5A 1ZRCA 4Q8LA 3ILNA 1XNTA 3VBRA 3B7MA 4AAPA 5JCTA 4LE4A 4DY5A 1JZ2A 1RUF3 4O7XA 4NPMA 5F5IA 3QBQA 2YU1A 3GCWA 4FPOB 2WNVA 3PVEA 4WZFA 5DUUA 4DNYA 1ENXA 1K5MB 1Z7S1 4NN0A 2HLEA 2ORZA 3DKWA 5BNOB 1C57A 1YUDA 2VE1A 1KQRA 5BNPB 2NP0A 5FZLA 1R1A3 3NV3A 4WM7C 1R092 1VBA1 4P9XA 4MGZE 1NKGA 1NA1A 5HCAA 1VBD3 2R063 1VE0A 2QQNA 5FWEA 5ANNA 1EAH1 2BFUL 4A7ZA 1ZBA2 2YC0A 3ON7A 4XW3A 2ZEZA 3UGFA 4Q4V1 4JGZB 1VBB1 4XFGA 5BY5A 3WQ1A 3WCSA 2ZS6B 4A44A 3IMNA 4DUWA 1F35A 3AP9A 1DYPA 3ES4A 2VZ3A 3JUUA 4LKEA 3S57A 4IV3C 3WY6A 4LMFA 3RRDA 1BXHA 1ZRRA 1EPWA 4RD7A 4DFSA 5HXMA 2VECA 5GM0A 1P8JA 4Z07A 3CKHA 1W8FA 2UWCA 5FZAA 1V6LA 1WBLA 2JEMA 3ZKYA 4IERA 5KXBA 1QDOA 4OZXA 2BNNA 2PHTA 3APBA 4K20A 1O3RA 1S55A 4XZPA 1HV1A 3KHCA 1R091 3BPZA 1W05A 5FY7A 2HYXA 4QU1A 1I6XA 2KXLA 1W0NA 4NR1A 1N1YA 2C26A 1IOAA 3WF0A 1RUC2 2DF7A 4Q4W2 1IPJA 3CJXA 3H7JA 4OQ8A 4XAAA 1HRI3 1ZBA1 2YBSA 5EQUA 2F6BA 4R9DA 2YXSA 5SV5A 3BOPA 2VOVA 2XDVA 4EJRA 3LCPA 1QNWA 2W87A 3ZFEC 5C8WA 1CGPA 3RWNA 2YUEA 2HEYF 5DUVA 4HONA 2NM1A 3CO2A 2YGLA 1OUSA 4CE8A 3FFZA 1GZ9A 2CTVA 3ATGA 3M4FA 1BBT2 2HWC3 1LGBA 4IL7A 4ORFA 5C70A 4XF9A 2E7TA 4CDQA 1WD4A 4FTBA 1OH4A 1ONAA 2Q1ZB 2GC1A 2XMLA 4M01A 4YG6A 4ZONA 3VHPA 1Z0HA 1WCDJ 5LA2A 5DZEA 3O1PA 4A3XA 3GGLA 4MGQA 1WLWA 2ZX1A 4BJ0A 1BMV1 3T2TA 2P4EA 3ZYIB 1SCSA 1NQDA 4CCCA 5C7GA 1MZ6A 1ZZ8A 1RUC1 4HSJA 3ZXJA 4SLIA 1X8EA 2BUKA 4CEYB 4E9KA 5FPXA 4M3CE 3RI9A 3O14A 4LKSA 3NKTA 5AFBA 5B2GB 3TYJA 1G9BA 4AI1A 1RXGA 1HX6A 1FAYA 2GAUA 3L2YA 4QGLA 3T1LA 2E26A 2WNUA 4KL1A 4N53B 4META 2HH9A 2W52A 3MPPG 3OPTA 1PMJX 1NAEA 1H2NA 1UIKA 4UW4A 2XJPA 2CY6A 1QF3A 3AYCA 4PQQA 4UWDA 2ZMLA 1FV3A 1BBT1 2ZGPA 5FPLA 3TOJA 4AGGA 3ACFA 3FJSA 1BJQA 4GKXA 3WXPA 1D0GA 3FL7A 2V4AA 3WP5A 4BU2A 3ZYPA 5FCCA 2PHDA 2TNFA 2RS52 3TNQA 3E5QA 3WP3A 2IXLA 2D6MA 5LA9A 1KS4A 1BK1A 4DRRA 3NJVA 3T08A 2WS92 1D0HA 1POV0 2XKPA 1H2MA 1VBE2 2XLGA 5LY1A 5C9AA 1WZXA 3ETQA 2VVEA 5L36A 1NG0A 2Y8KA 4XBLA 4XFCA 4QB1A 1REDA 3Q9OA 5JSRA 1REEA 4ZKTB 2X8KA 3V0AB 1YEWA 4RR3C 3VGIA 2ADDA 1EUTA 2PMWB 5FPUA 1YFWA 4B1MA 2JKXA 4D6RA 1TME3 2BOIA 2C4XA 2VC9A 4QXBA 3GHNA 1LNSA 5FIXA 3VBRC 5C4WB 4FTSA 1JW6A 1D2QA 4A2UA 4E2GA 1H1AA 5CEHA 5A3WA 4YFWA 4XJWA 2RS51 3J7MA 4F83A 1VMJA 1AZDA 5AFEA 4Z2WA 1QKQA 2DUPA 1F9KA 3ZO0B 5CFCA 4CUAA 1W6QA 4C91A 4QAWA 5J7MA 1VBE1 2QBXA 1R083 4XABA 1W3VA 4DUVA 4LEJA 1KGYA 2RDRA 2VZTA 4X6QB 1C8M3 2DU1A 1RUD2 4BM8A 1H1MA 1C28A 2VVDA 1HJGA 1LTEA 1TQ5A 4AEKA 2PAMA 1IGOA 2OYZA 1RTVA 2A6VA 1YC61 3DPRB 4IE5A 4KGGA 5LATA 2EALA 1GZCA 5FZ7A 3O0VA 4QQHA 2KR2A 3SQOA 4Y5TA 1ND3B 4DRVA 5HV0A 2P3IA 4EN7B 3SXWA 4OLLA 5DN2A 1X36A 4GH4A 3VKFC 1BEV2 4XOGA 1HRV3 1AR62 5KHKA 1RVF3 1S0IA 2BGCA 3VBUC 4BMEA 1RL3A 2EXIA 2BYVE 3ES1A 2Z2SB 5J3UA 3NRUA 2ZBJA 3OY8A 3I3MA 1R64A 2GMEA 4DZGA 1GOHA 2ZGRA 3LAGA 1QJU3 3IB3A 1W04A 1VIWB 5F2SA 1BYHA 4CU7A 5JI9A 1ZBE2 4KG0A 5JR7B 4B4QA 4XFFA 3KV6A 3V0BA 2EA7A 3OTFA 4M3CA 4ASMB 3VV1A 4AWDA 5L19A 1DIWA 4JTOA 2VCCA 4C0BA 1RUD1 5BV6A 4RQPB 3RMXA 1UOGA 5KHIA 3KCCA 4A41A 2VR4A 2IXHA 2JDPA 2Y0IA 1FOD3 1PZ7A 1V6MA 3A4UA 1UIJA 3AMHA 3VN4A 3TEXA 3SKJE 1S0GA 2FZ1A 1KEXA 3GF6A 4YW7A 1AR83 4Q4Y2 1CIWA 4CU6A 4NIDA 4WVMA 4P5YA 1BEV1 2OUHA 5KHHA 1JYVA 1AR61 1QIQA 4Z8BA 5A6ZA 2WC2A 2XHKA 1W0OA 1OSGA 4YW2A 1HB1A 2PAKA 1VPHA 3FLRA 4O9GA 3USUB 2OXBA 3HEIA 2JXAA 5I91A 2RV9A 3M3QA 4XIOA 3S5AA 1QJZA 3KZ4C 2FDGA 4GMP1 4TWTA 1V00A 4TN7A 3WW4A 2YHJA 2G19A 3QD6A 5FYBA 1WMXA 3AP5A 1N3PA 4I02A 1JH5A 1N1VA 2XBO2 4LXLA 3DYOA 4AHZA 4ZU7A 4QX8A 2ES3A 1BVVA 3VDDB 1ZZ6A 3CEWA 4LLFA 5IVBA 4L9BA 4NO4A 3LA3A 1AL22 3NAPC 5FY0A 2J1EA 3M2MA 3ZPOA 4B7KA 2K0GA 1W6MB 4Y33A 2C1FA 4EWAA 2OIIA 1XNKA 3KVBA 1YFXA 1NCRC 3O1RA 1PVC3 3WHTA 2XLFA 4QPIB 4QHOA 1COV3 4Q4Y1 2BNOA 2AH2A 4QPGC 1NLQA 4TYSA 4XF0A 5FYHA 3ZXKA 1BKZA 4YVWA 2WZR3 3AMQA 1YWKA 3A7QA 3MO4A 3MV01 3D8CA 1CD3G 1T6GC 1HB2A 4HG6B 3WSOA 2VGDA 1GP6A 1XXNA 2NQYA 1J3QA 4K3UA 1N3OA 3UV9A 1QGLA 2YC2A 3AYEA 4PDWA 5DAQA 3MLJA 4N43B 4PT6A 2D6KA 4JKKA 3WVJA 1JYXA 1HQWA 4EROA 3RNSA 2XBO1 3SH5A 4R9AA 5J36A 3FN9A 2J7MA 2IVJA 2OQ7A 5FRAA 5FZOA 5T52A 1AL21 1W8UA 4OULA 2ZGQA 1LU1A 1GNHA 1UPIA 2JDZA 2NYYA 5IWFA 3AL5A 1IZ3A 3AB0A 3HJRA 3KWVA 2ZKNA 4HZFA 2PHXA 1Y9MA 3FBMA 4BWOA 2F4PA 3MF6A 3BTZA 1N47A 2A6WA 2ET7A 3CHXA 4FI9A 4IEQA 2QQVA 2GC0A 4JTNA 1GYKA 4UFLA 3N9OA 1URXA 1AUYA 1Y9GA 2JG8A 4QQPA 1KFXL 2WWUA 3KGZA 3KGLA 1JU3A 4XUOA 4F8AA 1WD3A 3PU3A 2GN7A 2CAVA 4AI2A 5K0UB 2WIIB 5BNNB 5LRRA 1GOGA 1H4GA 4K1YA 3NNLA 5FXXA 4FO9A 4YM2A 1QMJA 1D4VB 2QQKA 4RYDA 3T2PA 4PI2A 1CAUA 1DP0A 5F3IA 4LORA 1W90A 2YY1A 3KM5A 3H8UA 4QGNA 5EJ3A 5IVJA 5HV4A 2JG9A 2PLV3 4NAOA 4PF1A 1F5JA 4AYUA 3M3OA 3FE5A 5GZDA 2X5IA 4CP9B 1A6CA 3UKVA 1DQ1A 2WZ8A 3K75B 3ITQA 2X09A 2NMOA 1G9AA 4HLTA 4Q1PA 5FMBA 3WNNA 1HKDA 1UXXX 4IE4A 3LEGA 2Y6KA 4GKYA 2O8OA 2WO3A 3OPZA 3B9CA 3FHAA 1IS5A 3LFMA 2D44A 4YARA 2R042 5F7UA 3VD9A 3PTYA 3S5QA 4LE3A 3RDIA 2DVDA 2VW0A 4K6BA 1CJDA 2Y6FA 1GWKA 4H3WA 3HN3A 1XB9A 3Q8CA 4QX1A 4KGQA 4JQRA 1NXMA 4YVSC 4AI8A 1QU0A 4LT5A 4R4ZA 2RHPA 5ABJA 1Q8SA 1O3TA 4JV4A 3WP6A 2RM22 2IXCA 5L9BA 2ARXA 4LBOA 4NWVA 3VD5A 4AL9A 1J1LA 4MGTA 4DXRA 1STMA 3BTYA 4FFHA 5HXVA 2UY9A 2GC3A 1W2OA 4CCMA 2RJLA 2GH2A 2W1SA 1OPOA 1W06A 3WUDA 1LHOA 4NPRA 3DXTA 3ME2A 5APAA 4CPBA 5F2WA 1ENSA 2VMIA 5DDJ2 3BODA 3QH7A 4L97A 2R041 3N3HA 4AHYA 1RXFA 3DN7A 1XU1A 2GDFA 1C8NA 1DZTA 3ILRA 4AVAA 3VZNA 3CJIC 4BQWA 2QQUA 2GNDA 3ACHA 5ACA2 1ZM1A 1FNZA 2WNVB 2RR13 1IKPA 4CCNA 2FHRA 4CDUB 1QEXA 4C0HA 3VB9A 3R4SA 5C8CB 3ZFGA 1S4CA 1LU2A 2RM21 5FYUA 2D7FA 4RGAA 2P3JA 2OZJA 2Q0AA 4FPJA 4QQOA 1APNA 1ENRA 1UU5A 3LEMA 4WVZA 4ZU4A 2W92A 1NA1B 4B1LA 1RUE3 4GJYA 4YZ4A 1W2NA 5FZDA 4P08A 3JBG2 2ET1A 3DGTA 4RHV3 5C3RA 1AXZA 1K5MC 5A7QA 3HIFA 4RS5B 2DV9A 2BRTA 3VKLA 1MR5A 3A0NA 2VUCA 5KHGA 4JDNA 4CDXB 2P6HA 3BKZA 2CYFA 4LO7A 5A80A 4I2OA 1O4TA 1FX5A 3MW2A 2HBUA 3RZLA 2VCBA 4KG8A 1QWRA 3OEBA 3ZSLA 4COZA 3UYJA 4CEWA 4S2HA 5FFOC 2NMNA 1TMF2 5D8AA 4AEDA 2J1UA 4H7LA 5ACA1 4IEXA 1O5LA 1UYPA 5E1RA 4L0PA 4UF0A 1H1IA 4AAXA 1D2SA 2Q8CA 2DBIA 2W5FA 3IM0A 4XXPA 5HCFA 1ULDA 2B9UA 1RIRA 1Q8OA 2QQLA 1JN2P 1MACA 2Y26A 4UXAA 3ZYFA 3D0SA 5T5LA 2VNGA 4OMDA 4YZ2A 4Y4RA 4J6GA 5FYTA 2WA4A 4OYUA 4DOUA 4QKFA 1U0AA 3JBG1 3INAA 3ZFFB 3POFA 5J98B 3HT1A 1I1EA 1Z7S3 3FUQA 5JI7A 5J37A 5CVRA 1DGLA 4P9JA 2G4IA 1RGSA 1WLCA 2JG8C 3FLTA 1E57A 3H50A 2JX9A 4OHYA 4B8EA 2ORXA 4HBNA 1VBA3 5KXDA 1DQ0A 2XUEA 5F1RA 1UO9A 5DG2A 4MZUA 1UOJA 5CKNA 1EAH3 1TMF1 3GBWA 1W6NB 1GNYA 3ZMOA 1YQ8A 4GA9A 4C8DA 1ZZCA 1VRBA 4HMZA 2C24A 3JQXA 1RUNA 1VBB3 5A32A 2FDIA 2YG0A 2HWF2 4LJHA 4WM7A 3RWKX 2DVAA 1KJLA 2VPVA 4XHXA 2W2IA 1X50A 3ETPA 5H9PA 3BTXA 3IIIA 3OBTA 4W50A 4CA9A 1UMIA 5I0UA 1S0BA 1QXRA 2WNUB 4AHXA 2J1AA 3CBNA 2ZX0A 2DBNA 1NE6A 2NPIA 3WLUA 2ZACA 4B4PA 1R093 2ZKLA 2FDJA 4IV3A 1JZ6A 1O6UA 1JI6A 1ZRIA 1AJKA 4LBNA 4PQ9A 4XQWA 1VMHA 3RVHA 1MZFA 4BDVB 5A3MA 1AHSA 2LM3A 2EIGA 3VL8A 3LGRA 3AFKA 5IAXA 1ZBA3 3I59B 3Q8FA 4D7YA 4IEPA 1UXZA 4FXKB 5A6QA 1OQEA 3USSA 2LW8A 1NYWA 3SH3A 2A6ZA 4XF1A 2Y6JA 4KWJA 2BZDA 5JAXA 1PVXA 2HWF1 3WCRA 5FK8A 3U07A 1AXYA 3OGGA 4AF9A 2CAUA 4BXSV 4NOTA 1BVP1 1GWMA 5CFDB 3GZUC 5CU1A 1WW7A 4MOAA 1TNFA 2Q30A 3EMRA 4FP3A 4AOCA 2Y34A 3AM2A 5FZ8A 1CR7A 3ZFEA 2ZGSA 3ZSMA 3D4KA 4BQ5A 2IFWA 1HB3A 1EY2A 1J83A 2JD9A 2AEYA 3LSEA 4NRQA 2D40A 4XE9A 1TG7A 2R072 3VKMA 4WVVA 4AGVA 1HV0A 2D6NA 2XJQA 3V56A 4LO8A 1G86A 3HBKA 4K21A 1RUC3 3EJKA 1REFA 4IV1C 4O61A 4Q4W3 3H8OA 3WOGA 4Q2FA 3VDCA 4YSFA 5GZCA 5GLVA 3N35A 4AEMA 5FXVA 5FUPA 4XJ9A 5EIYB 3VBOB 2CDOA 4QPYA 5FPBA 2I74A 3MFAA 1AVBA 3C7FA 2OT7A 3SEEA 1YJLA 2GNMA 1VALA 2A71A 2ZMKA 2PQQA 3ZIXA 2OVUA 1BBT3 1WCSA 2P37A 3OUHA 1WLTA 4CVUA 2JE9A 4QQLA 1NZCA 1XYNA 5T5JA 3OPWA 4XVHA 4CDWC 4QWNA 1RMU2 2O1QA 3KMHA 5CG9A 3SITA 1CX4A 3DYMA 3EQEA 2ZJCA 2BV4A 1IPKA 2R071 2FCTA 3GZAA 1OXCA 4Y1VA 2W47A 5FYIA 4F3JA 3C7GA 5BUVA 3IPVA 4BLJA 4BISA 4GH4B 4LO5B 3BUCA 1CZVA 3N7KA 4D69A 3ELNA 4EZ4A 3T09A 2PQSA 4IUGA 1QXPA 4SBVA 1OI6A 3OY8B 1UYYA 4CXYA 3BPSA 3H8RA 1ND3C 2YBPA 3LA2A 4NHMA 3FC0A 2DTWA 1WMDA 2W91A 5FK7A 3BGAA 1K12A 1RUG2 2I45A 1W2TA 1MS5A 3ZLIA 2VD7A 4C1XA 3P1IA 3AVSA 3B94A 2HEWF 3H3UA 3I2IA 2AENA 3NJZA 1JZ7A 4XMAA 3VUOA 2QQPA 1I5PA 4BB3A 2RS53 2XJRA 5BPXA 1IS6A 5F3CA 1SG3A 5GZGA 4RR3A 1IHMA 5HBAA 1U5XA 3P3NA 2WS93 2XR4A 3LPFA 3MLLA 4LHLA 2Q8OA 3LB9A 1VBE3 2OS2A 3AVRA 4FFFA 4OHVA 4EZHA 4UBGA 1RUI2 4LBJA 4AW7A 1SPPB 4AI3A 1DQ2A 3M3CA 5FJKA 5FPAA 1UU4A 1NCQB 5FOBB 5KR7A 1A78A 2EXJA 3OOXA 1MZ5A 3ZX7A 2QCSB 4MH0E 3I2KA 1UKGA 2ZZQA 1FT9A 2JDMA 2NLRA 1QDCA 2CGOA 3POWA 1XPWA 4A4AA 2YBKA 2C0ZA 3O7OA 4WZCA 1RUG1 1NOVA 1ST8A 1NT0A 5F6KA 1M06G 3I8TA 2PHLA 1WMEA 4RL7A 3WW3A 4BHPA 2EIDA 5FO8B 3LFIA 4CCDA 2VMHA 5FDBA 3HNMA 1U12A 4M0NA 2CU5A 1DZQA 1W99A 3M8LA 3W58A 1MQTC 3WW1A 3ZSJA 3LIGA 4HK8A 3NV2A 1LOFC 1RUI1 2WN2A 3ENRA 2XQXA 3MIHA 4BYYA 5DUXA 2VZSA 4M4RA 1ZX5A 5BNQA 3J8F2 3VBUA 1RUD3 4GULA 4CYDA 5HPOA 1HW5A 4L2NA 3RJ2X 4YVWB 1Y4WA 3SCFA 3TB0A 1J84A 1LESA 1RYYA 4COUA 3H3ZA 3JU9A 1L7LA 4HL0A 4B3NA 2LS6A 4HT1T 3RS6A 3THPA 4K8FA 5CBLA 2VU9A 2A6XA 1OH3A 2QE3A 4N9IA 4QPIC 3MIDA 1BMV2 2VL4A 1BEV3 3VBSB 1V6NA 1AR63 2Y38A 1OLQA 5FP9A 3EHKA 5FZOB 4TZDA 4QX7A 2D3SA 3D0JA 3HQRA 1MPXA 2IC1A 3UGHA 1F15A 3SH4A 5JVVA 2W9XA 3S0MA 4D6SA 1WW4A 1ZBE3 4OUMA 5DAXA 2VUJA 4YNIA 4N43C 1QHDA 1H0BA 4CU9A 1LOGA 2J1RA 1UX7A 2VM9A 1QH7A 3J8F1 3K48A 4EN9B 4LBQA 1GV9A 1WBFA 4K40A 1NXD1 1PO11 5KBFA 2BGOA 4AHWA 4P00B 3V65A 2ZTNA 4QB6A 2WO7A 1W6OA 4AEJA 1LENA 1U5ZA 2OUJA 2AYHA 3PL0A 3H1YA 1ZA7A 4NIAA 3N36A 3WQ7A 4Y1XA 5C3PA 2O14A 1CAUB 2PHFA 4Q4Y3 2DWRA 2VTXA 4DUXA 5J09A 3GJAA 1QJX2 4BE3A 3K77A 2BBAA 2JG9B 4XJ8A 4Q0UA 4QDQA 2YFZA 3A0KA 1ZRDA 1N1TA 1R1ZA 2E6VA 3NAPA 4FCAA 4MHRA 2X5IB 1JZ5A 3OG2A 2AUYA 1XYOA 3B93A 4INDA 4K1ZA 5FREA 1ZNPA 2UY8A 1RHI3 1NCRA 4XMIA 1VBC2 3NMBA 4AE2A 2W08A 1Y9QA 4QPGA 2Z69A 2DYCA 5A6XA 2XBO3 3NJYA 2XVGA 5IVCA 4P9YA 5T5PA 4XUQA 3J7LA 1HQLA 4AI0A 2FDFA 1AL23 1WCUA 2VJXA 2WNOA 2DVGA 2HJIA 3EXUA 2GSYA 1K5JA 3FHIB 2B46X 1UKRA 2ZX2A 2OW4A 3AK0A 3T4VA 2ARCA 1W3XA 1QJX1 1LKNA 4JDMA 2F17A 2YMZA 3AYAA 1PK6C 2XPJA 4JKLA 1QXJA 5IK8A 2V4VA 1ODMA 1RITA 3UKTA 2E33A 3MIBA 4FPFA 2JDYA 3AYDA 5IFTA 1CONA 4UFJA 2VOKA 2QZ3A 3K3NA 1VBC1 3K4DA 4Q1RA 3I7DA 4BQ4A 2ARBA 4XYXA 5FV3A 1QOOA 3VZMA 2WZEA 5FZ4A 3RZGA 2FCVA 2WKKA 2Z4FA 3D82A 1GNZA 2G9GA 4K8RB 4X8PA 3SHRA 2RG4A 3L9JT 1LAJA 1BHGA 1H8VA 4J1WA 2PFWA 3AZXA 3SC7X 4BQ1A 4OQ9A 2EAAA 5CA6A 2VXJA 1OKQA 3I2HA 3AX4A 1DGRA 4X6RB 1OQ1A 3LF7A 1IG3A 1QOSA 4D3WA 4DXZA 1KJRA 2FBEA 4F7ZA 2XLAA 3VD3A 2RS32 4I0BA 1YNAA 1LOCA 5LK5A 4Y22A 4XUNA 3I3QA 4JZRA 5FZMA 1PGSA 4UW6A 3FHQA 4Y20A 3VBFB 5GKAC 4ARYA 2HWD2 3ZFGB 3ZYRA 3O1UA 4NHKA 4IEYA 4LKFA 4WM8B 3QOPA 4DEVA 3NNFA 1GU3A 2W94A 1DLLA 1UAIA 4QKNA 2DFCA 2IXIA 4UYBA 4ASKA 5AC93 5T54A 3T1MA 3U0ZA 1UD1A 3KT7A 4I01A 3WINE 4AFMA 5ERLA 4CRQA 1O3QA 3BN6A 1O59A 2LUWA 1XC6A 2XWBB 4LIUA 4GQ7A 4LUKA 3KT1A 3RMYA 4CDUC 5FPZA 4XURA 5IK4A 3GNEA 2EF6A 2ZGLA 1OOPB 2RS12 5C8CC 3RGBA 2VXRA 4LA3A 2HWB1 4OZOA 1JZ3A 4I0AA 3RYRA 2VZVA 4G3YC 2LTNA 5C3SA 1H8TB 5FYVA 4H2AA 1D7PM 4QKDA 1KXGA 4YVSA 1UQXA 3WF3A 5EJ1B 4CEWB 5D8AB 4AEDB 1WMFA 5JXIA 2RS31 4ISRA 1UY1A 4ONUA 4RS5C 5FQ0A 1W6PB 4YRDA 4UF0B 3WG2A 4DS0A 1O7FA 2R043 4CDXC 2HWD1 4V1PA 1ND2C 1JU4A 1RJ8A 3SISA 5L7OC 2D3PA 2MEV2 5H9RA 4WBBA 4XIKA 2LALA 2Y64A 1X33A 4JGYB 5JXGA 2W3JA 1FV2A 1B35B 3IDBB 4ZZ5A 1XQNA 2OA2A 4I3PA 3KS7A 1VJ2A 3CL1A 5FY9A 4L99A 4A3ZA 5KC5A 1DU3D 3J9SA 2ZEYA 3EB7A 2R1BA 3HQXA 2IVIB 2RS11 4HVRA 2RM23 3MBWA 1ACCA 1C4RA 1OA3A 1TVGA 1MVQA 4PLOA 2VNRA 2HWE2 5JOWA 2WFPA 3WDYA 2GNBA 4OUSA 4RFT0 5GLZA 2WFF2 3AP7A 3CJIA 1KFUL 4JHTA 2V09A 3MFCA 1NX9A 1XRUA 1XSRA 3ZFFC 1AJOA 4ITCA 3WR0A 3C7HA 3GXUA 1W9WA 1M4WA 3I2FA 5DDJ3 2ZXQA 2UYBA 4IEWA 2A1XA 1Y43B 3LOIA 4WM7B 1FMD3 2MEV1 2PXJA 4MXWA 1XE0A 2MNGA 1AYN2 3MHZA 4LK7A 2BVBA 5GLWA 2A5ZA 1KRIA 2JDUA 3M70A 4RGKA 1W8WA 3AC0A 1LB2A 5ACA3 2QQJA 3DV8A 1X9PA 3J26N 5DXDA 5F39A 1K5MA 3TN92 5LB6A 4CUGA 3RYPA 1QOTA 1I9RA 2GH8A 4Y1YA 4ZS2A 3ZXDA 4LO6B 3MIEA 1G9DA 3H42B 2JIGA 2HWE1 5J48A 5IK5A 1WW5A 4XDQA 1C5IA 1CAVB 1KD7A 5JZGC 2HWC1 2A7AA 2WFF1 1RUOA 2JDAA 3WNKA 5I8TA 1SACA 4V2WA 1FATA 2D43A 3JBG3 3LPGA 1HXS2 4HN0A 2WAAA 3ZYGA 1IS3A 3RZKA 3PHMA 2XJVA 3W5MA 1BK0A 2EXKA 2FQPA 1OLME 1CAXA 2BERA 4L92A 5IATA 4JDOA 2VVFA 2V73A 2GNTA 5FXWA 5BYNA 1JOJA 3O1TA 3E1F1 3OBAA 1BQPA 3BIWE 1US2A 2D6LX 3J7NA 3KHBA 3H7YA 5LCWL 4GMP0 4JC1A 1AYN1 5GJ6A 2VOWA 4W6XA 4DY3A 5I8YA 1TMF3 4BQ3A 1VAVA 2UWAA 2YYOA 5FZ1A 2X53S 4EV0A 5JOYA 4MX3A 4UFHA 5FWJA 3TN91 4CP1A 3WQ0A 4YM0A 3EBRA 2R6QA 4E4HA 2N7GA 4GALA 4Y3OA 3B02A 3O1MA 1W8HA 3VBHC 2VO5A 4XFAA 4AQSA 5A70A 4BQXA 1AL0G 1RB8G 1Q8PA 1AX1A 3CNAA 5LEKA 1W28A 1V9U2 3AZYA 1O8PA 1S0CA 2YPDA 3LDBA 4HPKA 4KI5M 4ES9A 2B7YA 4EYUA 5F32A 5CFDC 4MGYE 4NRPA 2QDRA 1HXS1 4YG0A 1F8VA 4LIVA 2ZGNA 5A7NA 1UWWA 1SLAA 4IE0A 3NV4A 4L8QA 2XXZA 3VKOA 3QLQA 2JWPA 3H9AA 1LOEA 3ZXAC 3RZMA 4BIFA 3RJRA 3RZZA 4XF3A 4YZ5A 4XFHA 3ABZA 1AYM2 1A8DA 2K2SA 1T2XA 1LEDA 2B39A 1EV12 1W0PA 3EO6A 3I3BA 3ZN6A 2R16A 5GALA 3WF4A 2XH6A 2D3RA 4QDSA 4P14A 4XJZA 3H3LA 2XVKA 3IMMA 3WV6A 4BCUA 4JKMA 3VBOC 1J1TA 2SLIA 2AC1A 1PZ9A 4W4ZA 5A3NA 4XDOA 4I09A 3CDZB 2HWF3 1DF0A 4FPCA 4CUBA 3SEPA 3RSJA 2GP3A 2XWJB 1DGRN 3IAQA 4NHYA 2P6CA 5DPNA 1A34A 3RI8A 3ZDSA 2C9AA 1DYKA 3IPVB 1MS3A 1V9U1 1ZA4A 1JODA 1IS4A 1OQDA 2MPFA 3NKGA 3NWKA 5CYYA 3WW2A 1XU2A 3G7DA 5FLHA 5FY8A 2YU2A 3QCWA 1CPNA 1V6IA 1L7RA 4RN5A 3PUSA 4LUMA 1J59A 2RDQA 2CV6A 4DB5A 5IVVA 5JUVA 3ZR5A 2UURA 5GZFA 2XHNA 3OF1A 4HN1A 5FUNA 4CTEA 2WR9A 1PGL2 1AYM1 1OLRA 4HANA 3S6PA 3OCPA 4BLIA 3KV9A 1WGPA 2OQ6A 1BLZA 1EV11 3VL9A 3OB8A 1AR92 4XPVA 1IPSA 2F4LA 3CQOA 3JCIA 4RGGA 5IUQA 4Z1VA 2VMDA 2XVLA 4QDRA 1AX2A 1WKYA 3SLIA 1UU6A 1JYWA 5DZFA 3ZN4A 3MPBA 4GAZA 3LZZA 3C7OA 4JQTA 4TTGA 3O1SA 3UETA 5D21A 2QTWB 3VHNA 3ZXEA 3TBDA 3FZ3A 4YZ1A 5LA1A 2IZWA 3KD4A 3VZKA 3SKVA 4QGMA 3OD0A 4IV1A 3TRSB 3E5UA 4YGBA 3VBRB 4JX0A 3GCXA 4OI4A 1AF9A 4URAA 4NRMA 3PLQA 1OLMA 1G6NA 5ISLA 4AVCA 1GICA 1I3HA 1DHKB 5J1XA 4YW3A 1ZRFA 1ZZ9A 5IHRA 2QZ2A 2XJUA 2YDEA 4FAGA 4MGKE 5L9VA 3ZKUA 2R073 3C3VA 4YZ3A 5H9SA 4BH9A 1PNGA 1PGL1 5JPNB 4ISQA 4YGDA 3SNMA 1JYNA 3W5NA 1LHWA 2FZ2A 1AR91 1NCQC 4AFDA 3POIA 4QXKA 1ASJ2 2JE8A 4XETA 1YQ2A 4IETA 2GALA 2VQAA 5FKCA 5HI0A 4EN8B 4X8NA 3E6CC 2WO2A 4CDWA 2C5DA 1MEC2 5KHJA 4COVA 5BNOC 2E63A 1LULA 5BNPC 4JAAA 4LO4B 5FP8A 5A6YA 3WQBA 2AZ5A 1LOAA 2J1SA 1LCLA 4QM8A 4LLOA 3NV1A 2WWSA 2ZGOA 3HPNA 4FAHA 5DUWA 5J96B 1UW8A 3P5BA 1OMIA 3VBUB 3VD4A 1W8ZA 4PBOA 1B09A 2ZCWA 1K3IA 1PO22 1NUKA 2ZEWA 4FT8A 3AKSA 5JXJA 1RMU3 4JGZC 1ND3A 3BU0A 3AKPA 1SDWA 2WWJA 4M0HA 3POGA 4I0WB 3IT8A 3HWJA 2JIJA 1H4HA 5B4NA 4QX3A 3PVOA 2P5BA 2RMU2 3PTRB 5C71A 1ASJ1 3LEIA 4LR4A 5FYSA 2E53A 1WWYA 2QNKA 5GLUA 4CCJA 1GANA 1MEC1 2CWMA 2E7AA 4P02B 5FY5A 3HAGA 3CZUA 3N7LA 4URTA 2B45X 1S0EA 1AR72 1COV1 1RUG3 4AVVA 1LJ7A 3RPQA 1J58A 3R4UA 1LHNA 1UY0A 3N7MA 5LZ6A 4LHKA 1NE4A 5FO9B 1YYNA 2OPKA 4FPYA 4CDQB 1PO21 4N8MA 1TE1B 5IYYA 5JLVA 3URFA 2FD8A 1UCXA 4GWMA 3POYA 4QB2A 3ZR6A 4Q4V3 5FBJA 1W6OB 2VNOA 3POSA 2OZ6A 3B01A 3MF9A 2WZPP 5A1AA 1ULFA 1RUI3 3OYWA 2ADEA 2QQWA 3VDBA 4EN6B 5CISA 2RMU1 2VY0A 1XOYA 4NVPA 1W9YA 2EICA 3IIAA 4P5HA 2EAKA 5EHDA 2B9VA 3FMGA 3USUA 1I5ZA 1FPN2 1S1AA 2GC2A 1UMZA 3OBRA 2D97A 3ZPYA 3JB8A 4GZ9A 1MQTA 4J1XA 4LBQD 4OI2A 3DF0A 1CZSA 1NCRB 2OX0A 1UZZA 4QX0A 5FZ3A 1AR71 1LOFA 1W9SA 4GB32 2VCAA 3THTA 1EPZA 4Q0VA 4COWA 3CMGA 1RINA 4Y26A 4CEYC 3VDDA 3DL3A 4MO3M 2UYAA 4QPWA 3VKNA 5LBEA 1W6MA 3DEMA 4N53C 1V6OA 4UI9L 1GWLA 4IEZA 3K2OA 5EWSA 2BGPA 2X29A 5JOZA 2O0OA 4E8DA 1X82A 5DMYA 4QPIA 4QXCA 4YWAA 1GMMA 3ILFA 4R52A 1VLNA 3WDUA 3DUIA 5C9AB 4ZZ8A 2CNAA 3VDAA 1SFNA 1QQP2 2PLV1 2CSGA 2Y60A 3J8F3 4LKDA 4Y4YA 3NQHA 4ZY9A 1LRHA 5K9YA 3WNPA 4S2GA 1FPN1 3TEYA 3T0DA 3MGUA 4U2AA 2ZGUA 4MVTA 5FO7B 3DECA 3VHRA 4ZPIA 3K46A 4AGRA 1YHFA 4A6OA 5FZCA 5K4LA 2X05A 3H1WA 3GYDA 1SMVA 4N43A 3ZN5A 3W9AA 1XBFA 1DZRA 1HLCA 3N9PA 4GB31 4EWDA 4HKLA 4Q0QA 5JSOA 3NNGA 4IW3A 1JHJA 1IQAA 3PMSA 4I3GA 2RJ2A 2WDBA 4TXWA 3POBA 4CUCA 2P17A 5IAVA 1A8MA 3AL6A 2TUNA 5IJRA 2B8MA 2WT0A 2QVSB 5FZIA 4Q8KA 1CAWA 5CADA 2I07B 2XUMA 1DGWA 3AMMA 3OSDA 5FP3A 3U37A 3R0RA 4LOTA 5CFCB 1W8OA 3AP6A 4FTEA 4EWEA 1W6QB 2DVBA 4Y22B 4QU2A 1S2EA 3I54A 4Y20B 5C6CA 1QQP1 3X29B 1S2KA 1D4M2 1ODNA 1RUH2 4BXFA 3A23A 5C4WC 2JB8A 1SZBA 1WCQA 3FWEA 3GDBA 4FFIA 1YJKA 4LHSA 1GZWA 3B00A 4PJYA 3ALQA 1QJY2 1S2BA 4XBNA 1CX1A 2WUHA 1FXZA 2RJKA 4E2QA 1H2KA 2DTYA 1GQHA 2R0HA 1ENQA 3LEKA 2WBKA 3PUQA 3P6BA 2VMCA 1QJX3 1GQGA 3VBFC 1E5SA 2JKBA 1RJ7A 4IGOA 2VBBA 4WM8C 1MS8A 3MI8A 1UZWA 1G9FA 4CP9A 2VNVA 3ZSEA 4UFKA 2UWBA 3DPRC 3PNAA 5DG1A 3JD72 5JSPA 1ZVFA 2RVAA 3SCGA 1GSLA 2Z42A 2PELA 2BP6A 4NPLA 4N9HA 3IDEA 4QM9A 4YVSB 1VBC3 5A3PA 5EJZB 1TZOA 1UNBA 4TLFA 1UL9A 4BMBA 1VRH2 2E31A 3GBGA 5FQ0B 1OOPC 3V0BB 4YW4A 2I2SA 1D4M1 4HXCA 1RUH1 4TSVA 4CP0A 4M3CB 3NL1A 1WLDA 2P3KA 4LTAA 1PK6A 5EP9A 4NJ4A 5FUIA 5ANQA 5H9QA 4AVBA 3NNMA 1Q3EA 1H8TC 1O4ZA 1QJY1 2R30A 2YGMA 3E97A 1DQ5A 1LODA 3ST7A 5C3QA 1C3HA 2BW8A 3W20A 3VZJA 4D6QA 3M3IA 1PIV2 4K9SA 2VTXJ 2X10A 2ZMNA 5EPAA 4WVMB 1F4HA 2L9LA 4FQZA 3NJXA 2W39A 5LASA 3NSTA 4RQPC 1E5RA 2IXJA 3T2QA 1V70A 3AFGA 3IWZA 4XTPA 3SCHA 2GU9A 1DCSA 3JD71 4JRLA 1DYOA 4L11A 4DPNA 5FYCA 1B35C 1YQ6A 3CJIB 5D2AA 5FY4A 4HVQA 2ZABA 4EQVA 3I2OA 2DVFA 4CCOA 4Q0PA 1Q8VA 5EZWA 4GJZA 3RYKA 1VRH1 1YI7A 2IUWA 5FZKA 3O1VA 2B42B 4DMIA 2ZAAA 3UKNA 3NNJA 4OCTA 3GALA 1HN1A 1GFF2 2MHFA 3AKQA 1YRZA 3D5OA 4MXWB 4NMIA 1WA6X 5EFUA 2P34A 4KBZA 1G8WA 4GIQA 1QH6A 1UN1A 2VZ1A 4UBHA 5F3GA 2RS33 1LEMA 1Q8QA 3E6BA 4CDUA 4MADA 1ZYBA 2EXHA 3UK9A 3ZIWA 4OI1A 5KC6A 1PIV1 3WG1A 5C8CA 5FZEA 2WSUA 3OEAA 4KWUA 4XUPA 2HWD3 2QUOA 1CESA 1K42A 3VDDC 2JDNA 3KLSA 4NIGA 3PDQA 2VAUA 2A70A 4H7MA 1PO12 1JTZX 4FVVA 3T3YA 3MZHA 4UFMA 1DQ6A 4KWLA 4LITA 1RUJ2 1G7YA 5G05L 2KA3A 2PHRA 4RS5A 5A7WA 1UPSA 3DYPA 3T0AA 2CGPA 1UF2C 4PDWB 3ZDVA 3WHUA 2RS13 1HJFA 1CAXB 3IZOA 4CDXA 3DKQA 2WLQA 1ND2A 1NLRA 4FQ4A 4XF4A 5L7OA 4Q0SA 2ZGMA 3N4MA 4OHWA 5G04L 4Q4X2 2VQTA 1S0JA 2V5YA 3KT4A 4I30A 2DCZA 4PI0A 4GMP3 4GWNA 1NQJA 1XJAA 4D94A 2WO1A 5F5QA 5FZ9A 1UX6A 2A6YA 5FYMA 4ET7A 2XKOA 2XL7A 4CCEA 3WDXA 2PA7A 2E7QA 3THCA 5FPVA 3HR9A 4UFIA 3I3DA 2SBAA 3VHOA 5I0RA 4GWIA 1JOBA 2JG8B 3M3EA 5FP7A 1OA2A 2MEV3 3FFQA 4OVEA 2WSVA 4KQ7A 2BOJA 1PM4A 2VH9A 1AXKA 1JOPA 2E51A 4Q26A 5E6HA 1VAMA 4HPKB 4CXXA 4D0QA 1DLCA 2H6CA 2Y6HA 4ARXA 1RUJ1 3ZFFA 4YLZA 2O8QA 5LK7B 2LRPA 3AKRA 3JB4C 3PUAA 2FMDA 4A7YA 5A3OA 1W9TA 1X8MA 5KXCA 3UL2A 2W0XA 1UZVA 2A3XA 4GXLA 5JOXA 4NE9A 4FPGA 2BDRA 2QDNA 1GR3A 4ZXKA 4NUBA 1SFYA 2HWE3 4XHBA 4U36A 2P3YA 5FJHA 5K0UC 1POV1 5BNNC 4Q4X1 1VR3A 2WFF3 4PBPA 4UW5A 2QQOA 3WDTA 1PHMA 3OJBA 1UY3A 3ZN6B 2PTMA 3BI3A 4NWWA 2AREA 1W6NA 2AEZA 1VB4A 3KV5A 4LA2A 4Z82A 3V64A 5LRSA 2WT1A 3SMHA 2NN8A 1SBDA 3PUIA 3WX5A 3CZJA 4AXOA 5K7PA 4NHLA 4IEVA 3VD7A 3U4SA 3AMPA 4XBQA 2CWSA 2GMMA 1CZTA 2G9FA 5JZGA 1AYN3 1KS5A 2VZOA 4DQAA 2ZPXA 4XDPA 4LBMA 5IVFA 3RZHA 4Q4W1 1O5UA 4DIQA 5LEJA 2VZPA 1Y7BA 2WAOA 1LHUA 3WT3A 2EVXA 2YPJA 4ZU5A 3TN93 3WG3A 1GOFA 2JJ6A 4ATEA 1JMUB 4M00A 4CP2A 5DAVA 3PJQA 1HIXA 3MW4A 5ABJB 3B3QE 1UOBA 3HVDA 2WQ4A 1JYTA 5EV7A 4Q5OA 3GM8A 4WV8A 4MV2A 4W65A 3K51A 4C90A 2BBVA 4M4PA 3I59A 4MSVA 4IDZA 4MUVA 1HXS3 2K9ZA 4V2VA 4Q29A 2BFUS 2Z79A 4UW3A 1PMIA 2RDSA 3IBMA 3VBHA 3GZEA 5F8PA 2CGNA 2ENRA 2HWB2 5FLIA 2ID4A 3B5LB 4LHNA 4XFBA 2JD4A 4AQ6A 5DAPA 4IV1B 2Q5TA 4YG3A 5CFDA 4QQ2A 1JYIA 3C7EA 4DO0A 5A7SA 1OFNA 1LHVA 1RUF2 2QQMA 1US3A 3KVAA 4QKBA 3T0BA 2HBTA 1K45A 1JZ4A 5FBZA 4BIOA 4D8MA 1QY4A 1SLTA 2CL2A 4C1WA 5JPMB 1PM7A 5FMDA 4B7EA 1PZ8A 2R0FA 1R1A2 5FXZA 1KDMA 2P1BA 1V9U3 5BXXA 4CPBD 2QQIA 5A3UA 3K4ZA 1SEFA 4XJUA 5EYXA 3EYPA 1ZREA 3KV4A 4XAEA 1VBD2 1XNBA 2JENA 2R062 3KCYA 4IGQA 4KBBA 5FAXA 1POQA 1ULEA 2JE7A 1SLCA 3VBOA 2WNVC 2WQZC 2ZHLA 3CF6E 3N9QA 4R8HA 4Z92B 4NIHA 4CDWB 2ERFA 5E89A 4LOSA 2WS91 5CG8A 1IG0A 3UGGA 1YQCA 4E4DX 1AYM3 3LDRA 2R49A 4M3CF 1LGCA 1SLBA 3BB6A 1WCKA 1EV13 4FPEA 3U1XA 3HQUA 4AFAA 1OD5A 3HT2A 1NA1C 3HN1A 3LA7A 5CKMA 3JQWA 2OPWA 4IEOA 3THDA 4FPLA 3AJZA 1RUF1 3BU7A 3BCWA 4O9EA 3WNMA 1X9TA 2D6OX 1PNFA 2ZGTA 4FFGA 1GQPA 2BQPA 2G1MA 3IN9A 4IXLA 4OUEA 5B4XA 3AMNA 5L73A 4DEQA 1ULGA 1NZIA 2FDHA 1TNRA 1H9PA 1R1A1 1JUHA 1GUIA 3PVNA 4MHUA 1SLIA 2AR6A 4OHZA 3R05A 1JBCA 3UJQA 4N7UA 3LE0A 3AKTA 3OGVA 1VBD1 2R061 4FP2A 2A73B 4CZSA 1SLLA 1H2LA 4KMQA 3WUCA 1HRI2 4XTMA 4E2SA 5CB7A 3BALA 1DFQA 5IK7A 2GN3A 1H6XA 3FLPA 5JIAA 3U78A 3NVCA 5IVEA 3IAPA 4ES8A 5F3EA 5KWRA 3FUOA 3PIGA 5A33A 4XFIA 2W1UA 1XYPA 2QJVA 1FNYA 2HWC2 1AR93 3I2DA 4RSUA 4CCLA 4WVWA 3OGJA 4OFGA 1TEIA 4N90A 4UOJA 4NIIA 3Q8AA 3B9IA 2K46A 1GKBA 2PAEA 4XJAA 1OFSA 4PF5A 5A32B 2XG3A 5L9RA 2W46A 3S7IA 5JIUA 2ZHMA 3HNYM 1WA4A 4R9CA 1SPPA 3OYWB 4AVSA 1W2UA 5T3NA 2IWGB 4QMAA 5AVPA 1NCQA 2D6PA 4DXSA 4CDQC 1MS4A 5CKQA 5GLTA 1HRI1 2XB6C 4A45A 3WF2A 1XNDA 5M0TA 2BPA2 2Q1FA 3I2JA 4BA6A 4BK5A 5BNOA 2XOMA 5BNPA 3TEZA 1MQTB 1RHI2 3ZXLA 4CCKA 3H0OA 1OT5A 1J3RA 1XE8A 2C9KA 1U5IA 1ZBE1 2VBDA 2XL9A 2WRAA 4LBLA 4XXAA 3LWCA 4XQDA 4DINB 3MV11 1SBFA 4IV3B 2VZQA 3N9NA 4NAMA 4TLGA 1GZTA 2B5HA 2EIBA 4FOYA 3PMEA 4QT6A 4R4XA 3OD4A 1Q56A 1ASJ3 1UMHA 2J42A 1MS9A 3O5SA 5FYZA 4HVOA 1MEC3 1OHFA 2BWCA 2WNUC 2ZHNA 4JGZA 5FP4A 4FSJA 4S2FA 1N3QA 3GJBA 5HCHA 2CDPA 4IESA 3LDKA 2Q8DA 4P9GA 4AI9A 1JYCA 3OUIA 3H8XA 1UYZA 1GLHA 1JUIA 2DU0A 5CNAA 5LBCA 4QHZA 4HFSA 1OC1A 2DUQA 5FMOL 1IQDC 4YW1A 2TBVA 3TEWA 1RC6A 1PO23 1HQNA 3OGSA 4AFBA 1A3KA 2H0VA 3ZXFA 3N9MA 2B4KA 2UU8A 3ZFEB 2KM2A 2BWAA 1SQ4A 4PLNA 1RHI1 4A6SA 1JZ8A 5I0TA 2ZHKA 3ACIA 5EYYA 5K8SA 1TME2 4W6WA 3VBSA 2TEPA 1UZ0A 5C9AC 4E4SA 1F4AA 2RMU3 5FOJB 2YROA 5C33A 2YZ4A 3IDCB 4AK3A 3UT0A 4N7IA 4NHXA 1DBNA 3POEA 2VG9A 3HOBA 4YW6A 4W6YA 5LY2A 4B29A 1OA4A 3N9LA 1N1SA 2DFBA 2WYFA 2ZGKA 2XQRA 3HNBM 5A7OA 1CAWB 5LBBA 1YLLA 2IXKA 3AZZA 3MLKA 3TWIA 2JECA 2PN5A 1AR73 5A1LA 1AX0A 3TNPB 3PUHA 3ZMNA 1R082 1VAKA 4IQPA 1H30A 5C3OA 3GBFA 1C8M2 3PURA 2GMPA 3RZJA 3KQ4B 3KB5A 1F5FA 2A3YA 2A75A 1GZWB 4QX5A 1CWPA 4DXTA 4ZXEA 2XJSA 4PHZA 5AC92 4XZUG 2WN3A 2D5HA 3LKJA 4HOOA 3A22A 3FBYA 5D1IA 5FZGA 5CFCC 1G9CA 1HN0A 2ZAHA 4G9SB 1TME1 4EN0A 3H1MA 3WNLA 4KU7A 4PIZA 4CEYA 1HRV2 3L2HA 2D5FA 2GZWA 1PMHX 3PU8A 1RVF2 2WINB 4GD4A 1FPN3 5A3TA 4N53A 2ZEXA 1CQ9A 1U5YA 1KDKA 1MS0A 1QJEA 4MLOA 5FZBA 1MS1A 2VQ0A 4FBFA 4XQ4A 1C1LA 1QJU2 2VCMA 3M7AA 3U14A 4Y1ZA 3OGRA 4GB33 2DDUA 4FOQA 1R081 3ZXGA 5JXHA 4GH4C 2KD7A 4LK6A 5I8SA 5A7PA 3B69A 3MICA 1C8M1 1JS9A 1SFPA 3LD8A 1YQ5A 4CU8A 4JVAA 2W68A 5JR2A 5T55A 4YPJA 1PK6B 1Z78A 5A1FA 4CSWA 1OKOA 2W95A 1OF3A 1UZYA 3U4XA 5DZGA 2VW1A 3RFRA 5AC91 1FOD2 2V72A 3J4UH 2ZX3A 3MEPA 4RR3B 1OBNA 3MIFA 1CJPA 5JDBA 2EIEA 4BZ4A 2VMGA 2HYKA 1MZEA 4ZHNA 2C6SA 3ZYHA 1E5IA 3TAYA 1AR82 3D3AA 4XILA 1PGW2 1QQP3 1BZWA 3AJYA 1HRV1 2XJTA 3NO8A 2HEVF 2BEOA 2ARAA 3ZM8A 5IW0A 5LWBA 1RVF1 2VZUA 4YM3A 3F95A 3C8XA 5FMOS 1EP0A 2VOXA 3QACA 3V0AA 1V6KA 3R4DB 3IKWA 2PHWA 3FX3A 1W03A 2BVVA 3AXEA 4J25A 3BTAA 2Y0OA 5JMOA 3HD8B 1QJU1 4IGPA 2E32A 1YXWA 1YO8A 4A42A 5JMCA 1XE7A 4FOVA 1BCXA 3U11A 5T5OA 5C4WA 3WNXA 4LULA 5LBFA 1FMD2 2NZ9A 4MGIE 2ZZJA 5A3LA 1L3JA 3A21A 3ECQA 4GWJA 5E8AA 1OURA 1XNAA 2R7EB 4UAPA 2IFRA 1VB2A 1FOD1 4FPHA 4LPLA 1C1FA 2DCTA 1F31A 4Q27A 3RG0A 5I0DA 2A3WA 1PVC2 1COV2 1AR81 3VBFA 1PGW1 2RE9A 4H14A 1S0DA 1D4M3 1W8TA 1RUH3 3W59A 4KH9A 3WDWA 5FZ0A 4WM8A 4R9BA 2PHUA 2FCUA 1H9WA
chains in the Genus database with same CATH topology
2VUAA 3QH6A 2WZR2 1ZZ7A 3WP4A 3DPRA 2FMYA 3GZTB 1QJY3 5F6LB 4YYOA 2R1DA 4K7JA 1YCIA 2D93A 4YM1A 3O12A 1W39A 3MDPA 1CVNA 1OOPA 3S30A 4RA0A 5DDJ1 4KWKA 1ND2B 5L7OB 4FPKA 1FMD1 4YVWC 1RUNA 1Q43A 1O91A 3JZVA 1H8TA 2DCKA 3JD73 4ASLA 2XGXA 3VZLA 3MIGA 4G4FA 1MVEA 3ROUA 4LNVA 1W6PA 3HMYA 1PVC1 1VRH3 2E9QA 4PDWC 2ZA9A 2WT2A 4IEUA 3VBSC 2Q1MA 1F2NA 3HBZA 4RQPA 2WZR1 4LBQB 2QKDA 4XEZA 4HKWA 4JGYA 3S7EA 1B35A 1KITA 4ATFA 3AP4A 2R32A 5FLJA 3E5XA 2WA3A 4Y24A 1PIV3 2ZX4A 4AFCA 2PLV2 4Y5Z0 5IT6A 1Y3TA 2ILMA 1O3SA 2Q4SA 3VLBB 3NAPB 1DQ4A 4YW5A 1JXNA 3ZVXA 4LBKA 1CN1A 3NW4A 1IKQA 4MXVA 5T50A 4HKOA 4QPGB 1VP6A 2D98A 2WL1A 2JG9C 3BOWA 4P9IA 3AZWA 1FI2A 5E88A 2BTVC 4HSLA 1DG6A 5I93A 2X5IC 4YFZA 2HKXA 4PIXA 5JZGB 1WW6A 2PYTA 5CIRA 3O0WA 1XNCA 1OPMA 1HDKA 3CU7A 5AVAA 2DCJA 5FTTC 5SV8A 5F9TA 1LECA 3N7JA 4B4RA 4D7SA 1CAVA 2Z5WA 1PO13 4S2DA 3ACLA 1RUJ3 3R6SA 4D7TA 2WNEA 3D6EA 1DGWX 4FOWA 3CLPA 3P3PA 5ABJC 4AQTA 4P9WA 4P9LA 3ZYJB 5HCBA 3VBHB 4COYA 4JRAA 1SCRA 4E27A 1POV3 4PIYA 4Q4X3 1LGNA 1SBEA 1YIFA 3RQ0A 4QHBA 3WDVA 3G6JB 4YGCA 5JWPA 3LOBA 4MYEA 3AXDA 2RR12 4PLMA 5CAZA 1Q5OA 3LSDA 1NY72 3GHMA 5EXOA 3KSCA 3ZSKA 5K0UA 5BNNA 5GZEA 1YIPA 2JICA 4HK9A 4YGEA 3WD5A 2ETEA 1ZZBA 4E4ZA 1RUE2 2BNMA 4KNCA 4H55A 5KXEA 1J3PA 4RHV2 2WJSA 2ATFA 3O0XA 4PCRA 3WZ1A 4QD2A 2VW2A 1EYBA 3ZFGC 2DURA 2H0BA 1V6JA 2YV8A 1S0FA 2AGSA 4Y1UA 5I0SA 2H6BA 5TSWA 1ULCA 2ZOEB 4AQ2A 1NLSA 3M1HA 4FXGB 4KU8A 1YFYA 1C5HA 2RR11 3E6DA 1LOBA 3KQRA 4AG4A 1NY71 2DCYA 3UJOA 1QNYA 2P2KA 2WLPA 3VZOA 1WUVA 3U10A 2QFEA 1RUE1 4CEWC 2DUOA 3PJYA 5D8AC 4AEDC 2VULA 1FYUA 4OI0A 1X7NA 4RHV1 1Z7S2 5E16A 3ASIA 4BPZA 4AVTA 4BOWA 4OHXA 3C2UA 1DDLA 1JHNA 4JCKA 1GBGA 5A33B 1VBA2 1YFUA 4JGYC 1YI9A 3AZVA 1CPMA 1EAH2 4A7KA 3I4IA 4HETA 3PVBB 3WG4A 1O4YA 4Q4V2 1LR5A 1RMU1 3MW3A 1VBB2 3KCXA 3MYXA 2HWB3 1ALYA 1ZRCA 4Q8LA 3ILNA 3VBRA 3B7MA 5JCTA 4LE4A 4DY5A 1RUF3 3QBQA 4WZFA 5DUUA 4FPOB 2WNVA 3PVEA 4DNYA 1ENXA 1K5MB 1Z7S1 4NN0A 3DKWA 5BNOB 1C57A 1YUDA 2NP0A 1KQRA 5BNPB 1R1A3 3NV3A 4WM7C 1R092 1VBA1 4P9XA 4MGZE 1NA1A 5HCAA 1VBD3 2R063 1EAH1 2BFUL 4A7ZA 1ZBA2 2YC0A 4XW3A 4Q4V1 4JGZB 1VBB1 4XFGA 5BY5A 3WQ1A 3WCSA 2ZS6B 3IMNA 3AP9A 3ES4A 1DYPA 3JUUA 4IV3C 3WY6A 3RRDA 1BXHA 1ZRRA 1EPWA 4RD7A 4DFSA 2VECA 5GM0A 4Z07A 2UWCA 1V6LA 1WBLA 2JEMA 4IERA 5KXBA 1QDOA 4OZXA 2BNNA 2PHTA 3APBA 4K20A 1O3RA 1S55A 4XZPA 1HV1A 1R091 3BPZA 3VHOA 1I6XA 2KXLA 4NR1A 1N1YA 1IOAA 1RUC2 2DF7A 4Q4W2 1IPJA 3CJXA 3H7JA 1HRI3 1ZBA1 2F6BA 4R9DA 2YXSA 5SV5A 3BOPA 2VOVA 4EJRA 3LCPA 1QNWA 3ZFEC 1CGPA 5C8WA 3RWNA 2YUEA 2HEYF 5DUVA 2NM1A 3CO2A 2YGLA 3FFZA 1GZ9A 2CTVA 3ATGA 3M4FA 1BBT2 2HWC3 1LGBA 4IL7A 4ORFA 4XF9A 2E7TA 4CDQA 1WD4A 4FTBA 1ONAA 2Q1ZB 2GC1A 4M01A 4YG6A 3VHPA 1Z0HA 1WCDJ 5DZEA 4A3XA 1WLWA 2ZX1A 1BMV1 3T2TA 3ZYIB 1SCSA 1NQDA 1MZ6A 1ZZ8A 1RUC1 4HSJA 3ZXJA 4SLIA 1X8EA 2BUKA 4CEYB 4E9KA 5FPXA 4M3CE 3RI9A 3O14A 5B2GB 3NKTA 5AFBA 3TYJA 1G9BA 4AI1A 4QGLA 1HX6A 1FAYA 2GAUA 3L2YA 3T1LA 2WNUA 4KL1A 4N53B 4META 2W52A 3MPPG 1H2NA 1UIKA 4UW4A 2XJPA 2CY6A 1QF3A 3AYCA 2ZMLA 1FV3A 1BBT1 2ZGPA 3TOJA 4AGGA 3FJSA 1BJQA 4GKXA 3WXPA 1D0GA 3WP5A 3ZYPA 5FCCA 2PHDA 2TNFA 2RS52 3TNQA 3E5QA 3WP3A 2IXLA 2D6MA 1KS4A 1BK1A 4DRRA 2WS92 1D0HA 1POV0 2XKPA 1H2MA 1VBE2 2XLGA 5C9AA 3ETQA 2VVEA 5L36A 1NG0A 4XBLA 4XFCA 1REDA 3Q9OA 5JSRA 1REEA 4ZKTB 2X8KA 3V0AB 3VGIA 4RR3C 1YFWA 1TME3 3GHNA 3VBRC 5C4WB 4FTSA 1JW6A 1D2QA 4A2UA 4E2GA 1H1AA 4YFWA 4XJWA 2RS51 4F83A 1AZDA 5AFEA 4Z2WA 1QKQA 2DUPA 1F9KA 3ZO0B 5CFCA 1W6QA 4C91A 5J7MA 1VBE1 1R083 4LEJA 4X6QB 1C8M3 2DU1A 1RUD2 4BM8A 1H1MA 1C28A 2VVDA 1LTEA 1TQ5A 4AEKA 2PAMA 1IGOA 2OYZA 1RTVA 2A6VA 3DPRB 4KGGA 2EALA 1GZCA 3O0VA 4QQHA 1ND3B 4DRVA 2P3IA 4EN7B 3SXWA 4OLLA 1X36A 4GH4A 3VKFC 1BEV2 4XOGA 1HRV3 1AR62 5KHKA 1RVF3 1S0IA 2BGCA 3VBUC 4BMEA 1RL3A 2EXIA 2BYVE 3ES1A 2Z2SB 5J3UA 2ZBJA 3OY8A 2GMEA 4DZGA 2ZGRA 3LAGA 1QJU3 1VIWB 5JI9A 1BYHA 1ZBE2 4KG0A 5JR7B 4B4QA 4XFFA 3V0BA 2EA7A 3OTFA 4M3CA 4ASMB 3VV1A 4AWDA 5L19A 1DIWA 4JTOA 4C0BA 1RUD1 5BV6A 4RQPB 3RMXA 5KHIA 3KCCA 2IXHA 2Y0IA 1FOD3 1PZ7A 1V6MA 3A4UA 1UIJA 3AMHA 3VN4A 1S0GA 2FZ1A 3GF6A 1AR83 4Q4Y2 1CIWA 4WVMA 1BEV1 2OUHA 5KHHA 1AR61 4Z8BA 2WC2A 2XHKA 1W0OA 1OSGA 4YW2A 3FLRA 2PAKA 4O9GA 3USUB 2JXAA 5I91A 3M3QA 4XIOA 1QJZA 3KZ4C 4GMP1 4TWTA 1V00A 3WW4A 2YHJA 3QD6A 3AP5A 1N3PA 4I02A 1JH5A 1N1VA 2XBO2 4ZU7A 4AHZA 2ES3A 1BVVA 3VDDB 1ZZ6A 3CEWA 4LLFA 4L9BA 4NO4A 3LA3A 1AL22 3NAPC 3M2MA 4B7KA 2K0GA 1W6MB 2C1FA 4EWAA 2OIIA 1XNKA 1YFXA 1NCRC 1PVC3 3WHTA 2XLFA 4QPIB 1COV3 4Q4Y1 2BNOA 2AH2A 4QPGC 4TYSA 4XF0A 3ZXKA 1BKZA 4YVWA 2WZR3 3AMQA 1YWKA 3D8CA 1CD3G 1T6GC 2VGDA 1XXNA 2NQYA 1J3QA 4K3UA 1N3OA 3UV9A 1QGLA 3AYEA 4PDWA 3MLJA 4N43B 2D6KA 3WVJA 1HQWA 4EROA 3RNSA 2XBO1 3SH5A 4R9AA 5J36A 5FRAA 5T52A 1AL21 4OULA 2ZGQA 1LU1A 1GNHA 1UPIA 2JDZA 2NYYA 1IZ3A 3AB0A 4HZFA 2ZKNA 2PHXA 3FBMA 4BWOA 2F4PA 3MF6A 1N47A 2A6WA 2ET7A 4IEQA 4JTNA 2GC0A 1GYKA 1URXA 1AUYA 2JG8A 4QQPA 1KFXL 3KGZA 3KGLA 4F8AA 1WD3A 2GN7A 2CAVA 4AI2A 5K0UB 2WIIB 5BNNB 5LRRA 1H4GA 4K1YA 4FO9A 4YM2A 1QMJA 1D4VB 1CAUA 2YY1A 3KM5A 3H8UA 4QGNA 5EJ3A 2JG9A 2PLV3 1F5JA 4AYUA 3M3OA 3FE5A 5GZDA 2X5IA 1A6CA 3UKVA 1DQ1A 2NMOA 1G9AA 4HLTA 4Q1PA 1HKDA 4GKYA 2O8OA 3OPZA 3B9CA 1IS5A 2D44A 4YARA 2R042 3PTYA 4LE3A 3RDIA 2DVDA 2VW0A 4K6BA 1CJDA 4H3WA 4KGQA 4JQRA 1NXMA 4YVSC 4AI8A 1QU0A 4LT5A 4R4ZA 2RHPA 5ABJA 1Q8SA 1O3TA 4JV4A 3WP6A 2RM22 2IXCA 2ARXA 4LBOA 4NWVA 1J1LA 5HXVA 2UY9A 2GC3A 2RJLA 2GH2A 1OPOA 3WUDA 1LHOA 4NPRA 3ME2A 1ENSA 2VMIA 5DDJ2 3BODA 3QH7A 4L97A 2R041 3N3HA 4AHYA 3DN7A 1XU1A 2GDFA 1C8NA 1DZTA 3ILRA 4AVAA 3VZNA 3CJIC 2GNDA 5ACA2 1ZM1A 1FNZA 2WNVB 2RR13 1IKPA 2FHRA 4CDUB 4C0HA 3R4SA 5C8CB 3ZFGA 1LU2A 2RM21 2D7FA 4RGAA 2P3JA 2OZJA 2Q0AA 4FPJA 4QQOA 1APNA 1ENRA 1UU5A 4WVZA 4ZU4A 1NA1B 1RUE3 4YZ4A 3JBG2 2ET1A 3DGTA 4RHV3 1AXZA 1K5MC 3HIFA 4RS5B 2DV9A 3VKLA 1MR5A 3A0NA 5KHGA 4JDNA 4CDXB 2CYFA 4LO7A 4I2OA 1O4TA 1FX5A 3MW2A 3ZSLA 4KG8A 1QWRA 4COZA 4CEWA 4S2HA 5FFOC 2NMNA 1TMF2 5D8AA 4AEDA 4H7LA 5ACA1 4IEXA 1O5LA 5E1RA 1H1IA 1D2SA 3IM0A 4XXPA 5HCFA 1ULDA 2B9UA 1RIRA 1Q8OA 1JN2P 1MACA 2Y26A 4UXAA 3D0SA 5T5LA 2VNGA 4YZ2A 4J6GA 4DOUA 2WA4A 1U0AA 3JBG1 3INAA 3ZFFB 5J98B 3HT1A 1I1EA 1Z7S3 3FUQA 5JI7A 5J37A 5CVRA 1DGLA 4P9JA 2G4IA 1RGSA 1WLCA 2JG8C 3FLTA 1E57A 3H50A 2JX9A 4OHYA 4B8EA 4HBNA 1VBA3 5KXDA 1DQ0A 5F1RA 5DG2A 4MZUA 1EAH3 1TMF1 3GBWA 1W6NB 3ZMOA 4GA9A 1ZZCA 4HMZA 3JQXA 1VBB3 5A32A 2HWF2 4WM7A 2DVAA 1KJLA 2VPVA 4XHXA 1X50A 5H9PA 3OBTA 5I0UA 1S0BA 1QXRA 2WNUB 4AHXA 2ZX0A 1NE6A 2NPIA 3WLUA 2ZACA 1R093 2ZKLA 4IV3A 4LBNA 1AJKA 4PQ9A 4XQWA 1MZFA 5A3MA 1AHSA 2LM3A 2EIGA 3VL8A 3LGRA 3AFKA 1ZBA3 3I59B 4D7YA 4IEPA 4FXKB 1OQEA 3USSA 1NYWA 3SH3A 2A6ZA 4XF1A 5JAXA 4KWJA 1PVXA 2HWF1 3WCRA 3U07A 1AXYA 3OGGA 4AF9A 2CAUA 4NOTA 1BVP1 5CFDB 3GZUC 5CU1A 1WW7A 1TNFA 2Q30A 4FP3A 3AM2A 3ZFEA 1CR7A 2ZGSA 3ZSMA 3D4KA 2IFWA 1EY2A 3LSEA 4XE9A 2D40A 2R072 3VKMA 4WVVA 4AGVA 1HV0A 2D6NA 2XJQA 3V56A 4LO8A 1G86A 4K21A 1RUC3 3EJKA 1REFA 4IV1C 4Q4W3 3WOGA 4Q2FA 4YSFA 5GZCA 5GLVA 3N35A 4AEMA 4XJ9A 3VBOB 4QPYA 2I74A 3MFAA 1AVBA 1YJLA 2GNMA 1VALA 2A71A 2ZMKA 2PQQA 3ZIXA 2OVUA 1BBT3 1WCSA 2P37A 1WLTA 2JE9A 4QQLA 1NZCA 1XYNA 5T5JA 4CDWC 1RMU2 2O1QA 3KMHA 5CG9A 3SITA 1CX4A 3EQEA 2ZJCA 3GZAA 1IPKA 2R071 4F3JA 4Y1VA 5BUVA 3IPVA 4BLJA 4GH4B 4LO5B 3N7KA 4D69A 3ELNA 1QXPA 4SBVA 1OI6A 3OY8B 1ND3C 3LA2A 4NHMA 3FC0A 2DTWA 1WMDA 1RUG2 2I45A 1MS5A 4C1XA 3B94A 2HEWF 3H3UA 3NJZA 2AENA 2QQPA 4XMAA 3VUOA 2RS53 2XJRA 5BPXA 1IS6A 5GZGA 5HBAA 4RR3A 1IHMA 1U5XA 3P3NA 2WS93 4LHLA 3MLLA 2Q8OA 3LB9A 1VBE3 4OHVA 4UBGA 1RUI2 4LBJA 4AW7A 4AI3A 1DQ2A 3M3CA 1UU4A 1NCQB 5FOBB 1A78A 2EXJA 1MZ5A 3ZX7A 2QCSB 4MH0E 1UKGA 2ZZQA 1FT9A 2NLRA 1QDCA 2CGOA 3POWA 2C0ZA 3O7OA 4WZCA 1RUG1 1NOVA 5F6KA 1M06G 3I8TA 2PHLA 1WMEA 4RL7A 3WW3A 4BHPA 5FO8B 5FDBA 2VMHA 1U12A 4M0NA 3W58A 1DZQA 3M8LA 3WW1A 1MQTC 3ZSJA 4HK8A 3NV2A 1LOFC 1RUI1 3ENRA 3MIHA 4BYYA 5DUXA 1ZX5A 5BNQA 3J8F2 3VBUA 1RUD3 4GULA 4CYDA 1HW5A 4L2NA 3RJ2X 4YVWB 3SCFA 3TB0A 1LESA 4COUA 3H3ZA 3JU9A 4HL0A 4B3NA 4HT1T 3RS6A 3THPA 5CBLA 4K8FA 2VU9A 2A6XA 4QPIC 2QE3A 4N9IA 3MIDA 1BMV2 1BEV3 3VBSB 1V6NA 1AR63 2Y38A 1OLQA 3EHKA 4TZDA 2D3SA 3D0JA 2IC1A 3SH4A 5JVVA 3S0MA 1WW4A 1ZBE3 4OUMA 2VUJA 4YNIA 4N43C 1QHDA 1H0BA 1LOGA 1QH7A 3J8F1 3K48A 4EN9B 4LBQA 1GV9A 1WBFA 4K40A 1NXD1 1PO11 5KBFA 4AHWA 3V65A 2ZTNA 4AEJA 1W6OA 1LENA 1U5ZA 2OUJA 2AYHA 3H1YA 3WQ7A 3N36A 4Y1XA 1CAUB 2PHFA 4Q4Y3 2DWRA 5J09A 1QJX2 4BE3A 2JG9B 4XJ8A 4Q0UA 3A0KA 1ZRDA 1N1TA 1R1ZA 2E6VA 3NAPA 4FCAA 2X5IB 2AUYA 1XYOA 3B93A 4INDA 4K1ZA 5FREA 1ZNPA 2UY8A 1RHI3 1NCRA 4XMIA 1VBC2 4AE2A 2W08A 1Y9QA 4QPGA 2Z69A 2DYCA 2XBO3 2XVGA 4P9YA 5T5PA 1HQLA 4AI0A 1AL23 2DVGA 2HJIA 3EXUA 2GSYA 3FHIB 2B46X 1UKRA 2ZX2A 2OW4A 3AK0A 1QJX1 1LKNA 4JDMA 2YMZA 3AYAA 1PK6C 2XPJA 1QXJA 5IK8A 3UKTA 1RITA 3MIBA 4FPFA 3AYDA 1CONA 2VOKA 2QZ3A 1VBC1 4Q1RA 3I7DA 2ARBA 4XYXA 3VZMA 1QOOA 2WKKA 3D82A 1GNZA 2G9GA 4X8PA 3SHRA 3L9JT 1H8VA 4J1WA 2PFWA 3AZXA 4BQ1A 2EAAA 5CA6A 1OKQA 3AX4A 1DGRA 4X6RB 1OQ1A 4D3WA 4DXZA 1QOSA 1KJRA 2FBEA 4F7ZA 2XLAA 2RS32 4I0BA 1YNAA 1LOCA 5LK5A 4Y22A 1PGSA 4UW6A 4Y20A 3VBFB 5GKAC 2HWD2 3ZFGB 3ZYRA 4NHKA 4IEYA 4WM8B 3QOPA 1DLLA 1UAIA 2DFCA 2IXIA 5AC93 5T54A 3T1MA 3U0ZA 1UD1A 3KT7A 4I01A 3WINE 4AFMA 4CRQA 1O3QA 2LUWA 2XWBB 4GQ7A 4LUKA 3KT1A 3RMYA 4CDUC 5FPZA 5IK4A 3GNEA 2EF6A 2ZGLA 1OOPB 2RS12 5C8CC 2VXRA 4LA3A 2HWB1 4I0AA 3RYRA 4G3YC 2LTNA 1H8TB 1KXGA 4YVSA 4CEWB 5D8AB 4AEDB 1WMFA 2RS31 4ISRA 4ONUA 4RS5C 5FQ0A 1W6PB 4YRDA 3WG2A 4DS0A 1O7FA 2R043 4CDXC 2HWD1 4V1PA 1ND2C 3SISA 1RJ8A 5L7OC 2D3PA 2MEV2 5H9RA 4WBBA 4XIKA 2LALA 1X33A 4JGYB 1FV2A 1B35B 3IDBB 1XQNA 2OA2A 4I3PA 3KS7A 1VJ2A 3CL1A 5KC5A 4L99A 1DU3D 3J9SA 2R1BA 3HQXA 2RS11 4HVRA 2RM23 1C4RA 1OA3A 1MVQA 4PLOA 2VNRA 2HWE2 5JOWA 2WFPA 3WDYA 2GNBA 4OUSA 4RFT0 5GLZA 2WFF2 3AP7A 3CJIA 1KFUL 2V09A 3MFCA 1XRUA 3ZFFC 1AJOA 4ITCA 3WR0A 1M4WA 5DDJ3 2UYBA 4IEWA 1Y43B 3LOIA 4WM7B 1FMD3 2MEV1 4MXWA 2MNGA 1AYN2 2BVBA 5GLWA 2A5ZA 1KRIA 3M70A 1LB2A 5ACA3 3DV8A 3J26N 5DXDA 1K5MA 3TN92 3RYPA 1QOTA 1I9RA 2GH8A 4Y1YA 3ZXDA 4LO6B 3MIEA 1G9DA 2HWE1 5J48A 5IK5A 1WW5A 4XDQA 1C5IA 1CAVB 1KD7A 5JZGC 2HWC1 2A7AA 2WFF1 1RUOA 5I8TA 1SACA 1FATA 2D43A 3JBG3 4HN0A 1HXS2 3ZYGA 1IS3A 3PHMA 2XJVA 2EXKA 2FQPA 1CAXA 4L92A 4JDOA 2VVFA 2V73A 2GNTA 5BYNA 1JOJA 1BQPA 3BIWE 2D6LX 3H7YA 4GMP0 4JC1A 1AYN1 5GJ6A 2VOWA 4W6XA 4DY3A 5I8YA 1TMF3 1VAVA 2UWAA 2YYOA 2X53S 4EV0A 5JOYA 4MX3A 3TN91 4CP1A 3WQ0A 4YM0A 3EBRA 2R6QA 2N7GA 4GALA 3B02A 3VBHC 4XFAA 4AQSA 1AL0G 1RB8G 1Q8PA 1AX1A 3CNAA 5LEKA 1V9U2 3AZYA 4ES9A 1S0CA 4HPKA 5JOZA 2B7YA 5CFDC 4MGYE 2QDRA 1HXS1 4YG0A 1F8VA 2ZGNA 1SLAA 3NV4A 4L8QA 3VKOA 3QLQA 3ZXAC 3H9AA 1LOEA 4BIFA 3RJRA 3RZZA 4XF3A 4YZ5A 4XFHA 1AYM2 1A8DA 2K2SA 1LEDA 2B39A 1EV12 1W0PA 3EO6A 3ZN6A 2R16A 5GALA 2XH6A 2D3RA 4P14A 4XJZA 2XVKA 3WV6A 4BCUA 3VBOC 1J1TA 2SLIA 1PZ9A 4I09A 2HWF3 1DF0A 4FPCA 3RSJA 2XWJB 1DGRN 3RI8A 3ZDSA 1DYKA 2C9AA 3IPVB 1MS3A 1V9U1 1ZA4A 2MPFA 1IS4A 1OQDA 3NKGA 3NWKA 3WW2A 1XU2A 3G7DA 5FLHA 3QCWA 1CPNA 1V6IA 4LUMA 1J59A 2CV6A 4DB5A 2UURA 5GZFA 3OF1A 4HN1A 4CTEA 1PGL2 1AYM1 1OLRA 4HANA 3S6PA 3OCPA 4BLIA 1WGPA 1EV11 3VL9A 1AR92 4XPVA 3JCIA 4RGGA 5IUQA 4Z1VA 2XVLA 1AX2A 3SLIA 1UU6A 5DZFA 3ZN4A 3MPBA 3LZZA 3VHNA 3ZXEA 3TBDA 3FZ3A 4YZ1A 2IZWA 3KD4A 3VZKA 4QGMA 3OD0A 4IV1A 3TRSB 3E5UA 4YGBA 3VBRB 4OI4A 1AF9A 3PLQA 1G6NA 4AVCA 1GICA 1I3HA 1DHKB 1ZRFA 4YW3A 1ZZ9A 2QZ2A 2XJUA 2YDEA 4FAGA 4MGKE 2R073 3C3VA 4YZ3A 5H9SA 4BH9A 1PNGA 1PGL1 5JPNB 4ISQA 4YGDA 3SNMA 1LHWA 2FZ2A 1AR91 1NCQC 4AFDA 4QXKA 1ASJ2 4XETA 4IETA 2GALA 2VQAA 5HI0A 3E6CC 4EN8B 4X8NA 4CDWA 2C5DA 1MEC2 5KHJA 4COVA 5BNOC 2E63A 1LULA 5BNPC 4JAAA 4LO4B 2AZ5A 1LOAA 1LCLA 4QM8A 4LLOA 3NV1A 2WWSA 2ZGOA 4FAHA 5DUWA 5J96B 1UW8A 3VBUB 1OMIA 4PBOA 1B09A 2ZCWA 1PO22 4FT8A 3AKSA 1RMU3 4JGZC 1ND3A 3AKPA 1SDWA 4M0HA 4I0WB 3IT8A 3HWJA 1H4HA 3PVOA 2RMU2 1ASJ1 4LR4A 2E53A 2QNKA 5GLUA 1GANA 1MEC1 2CWMA 2E7AA 3HAGA 3N7LA 4URTA 2B45X 1S0EA 1AR72 1COV1 1RUG3 4AVVA 1LJ7A 3RPQA 1J58A 3R4UA 1LHNA 3N7MA 4LHKA 1NE4A 5FO9B 1YYNA 2OPKA 4FPYA 4CDQB 1PO21 5JLVA 1TE1B 3URFA 1UCXA 4GWMA 3POYA 4Q4V3 1W6OB 2VNOA 3POSA 2OZ6A 3B01A 3MF9A 2WZPP 1ULFA 1RUI3 3OYWA 4EN6B 2RMU1 2VY0A 4NVPA 4P5HA 3IIAA 2EAKA 3FMGA 3USUA 1I5ZA 1FPN2 1S1AA 2GC2A 1UMZA 3OBRA 2D97A 3ZPYA 3JB8A 1MQTA 4J1XA 4LBQD 4OI2A 3DF0A 1NCRB 1UZZA 1AR71 1LOFA 4GB32 3THTA 1EPZA 4Q0VA 4COWA 1RINA 4Y26A 4CEYC 3VDDA 3DL3A 2UYAA 3VKNA 1W6MA 4N53C 1V6OA 4IEZA 5EWSA 2X29A 2O0OA 1X82A 4QPIA 3ILFA 4R52A 3WDUA 1VLNA 3DUIA 5C9AB 2CNAA 1SFNA 1QQP2 2PLV1 3J8F3 4Y4YA 1LRHA 5K9YA 4S2GA 1FPN1 3MGUA 4U2AA 2ZGUA 4MVTA 5FO7B 3VHRA 4AGRA 1YHFA 3H1WA 3GYDA 1SMVA 4N43A 3ZN5A 3W9AA 4GB31 1DZRA 1HLCA 5JSOA 4EWDA 4HKLA 4Q0QA 4I3GA 1IQAA 3PMSA 2P17A 1A8MA 2TUNA 2B8MA 2WT0A 2QVSB 4Q8KA 1CAWA 5CADA 2XUMA 2I07B 1DGWA 3AMMA 3R0RA 5CFCB 3AP6A 4FTEA 4EWEA 1W6QB 2DVBA 4Y22B 4QU2A 3I54A 4Y20B 5C6CA 1QQP1 3X29B 1S2KA 1D4M2 1RUH2 5C4WC 3FWEA 1YJKA 1GZWA 3B00A 4PJYA 3ALQA 1QJY2 1S2BA 4XBNA 1FXZA 2RJKA 4E2QA 1H2KA 2DTYA 1GQHA 2R0HA 1ENQA 1QJX3 1GQGA 3VBFC 2JKBA 1RJ7A 4WM8C 1MS8A 3MI8A 1G9FA 3ZSEA 2UWBA 3DPRC 3PNAA 5DG1A 3JD72 5JSPA 1ZVFA 3SCGA 1GSLA 2Z42A 2PELA 4N9HA 3IDEA 4QM9A 4YVSB 1VBC3 4TLFA 1UL9A 4BMBA 1VRH2 3GBGA 5FQ0B 1OOPC 3V0BB 4YW4A 2I2SA 1D4M1 4TSVA 1RUH1 4CP0A 4M3CB 3NL1A 1WLDA 2P3KA 4LTAA 1PK6A 4AVBA 5H9QA 1Q3EA 1H8TC 1O4ZA 1QJY1 2R30A 2YGMA 3E97A 1DQ5A 1LODA 3ST7A 1C3HA 2BW8A 3VZJA 3M3IA 1PIV2 4K9SA 2ZMNA 4WVMB 4FQZA 2W39A 3NSTA 4RQPC 2IXJA 1V70A 3AFGA 3IWZA 4XTPA 3SCHA 2GU9A 3JD71 4JRLA 4DPNA 4L11A 1B35C 4HVQA 3CJIB 2ZABA 2DVFA 4Q0PA 1Q8VA 5EZWA 3RYKA 1VRH1 1YI7A 2B42B 4DMIA 2ZAAA 3UKNA 3GALA 1GFF2 2MHFA 3AKQA 1YRZA 3D5OA 4MXWB 5EFUA 2P34A 1G8WA 4GIQA 1QH6A 1UN1A 4UBHA 2RS33 1LEMA 1Q8QA 3E6BA 4CDUA 1ZYBA 2EXHA 3UK9A 3ZIWA 4OI1A 5KC6A 1PIV1 3WG1A 5C8CA 2WSUA 2HWD3 2QUOA 1CESA