5J37A

Crystal structure of 60-mer bfdv capsid protein in complex with single stranded dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
b'FSTNRIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFALDDFLQAVPNPHTLNFEDYRIKLAKMEMRPTGGHYTVQSDGFGHTAVIQDSRITRFKTTADQTQDPLAPFDGAKKWFVSRGFKRLLRPKPQITIEDLTTANQSAALWLNSARTGWIPLQGGPNSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFRQFAPNNPST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beak and feather disease virus capsid protein
publication title Structural insights into the assembly and regulation of distinct viral capsid complexes.
pubmed doi rcsb
source organism Beak and feather disease virus
molecule tags Virus/dna
total genus 36
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.950 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j37A00
5J37A 3JCIA 3R0RA 5J09A 5J36A
chains in the Genus database with same CATH superfamily
1LOEA 4TXWA 3FLTA 2WNVB 4EWDA 5L9BA 3V64A 5J48A 3O1SA 1JI6A 1F2NA 2ZGKA 3VZJA 5LA0A 4Z92B 4I0BA 2WS92 5ANQA 3D5OA 4ZKTB 3FMGA 2CAUA 4L0PA 5FWEA 1LOFA 2QQMA 4LULA 4AHWA 5HXMA 2BNNA 4XFBA 2XJSA 5C33A 2DVAA 2HWE1 5CYYA 5DZFA 4MYEA 1QKQA 5E16A 1Z0HA 2WQ8A 3MW2A 1W3XA 2ORXA 1WCDJ 1BXHA 3E6DA 3I2GA 4PQQA 2CWMA 2WABA 4LA3A 3UT0A 4D7SA 4ASLA 1S0JA 3GBWA 1S0IA 2JG8B 3HIFA 1X33A 4QGLA 5C8CA 1MPXA 1UU4A 4PIZA 2LTNA 1K45A 4Y22B 3ACLA 1W6MB 2B9UA 1W05A 2W1SA 5C70A 5ANNA 4M3CF 4QQ2A 2DCTA 2KA3A 2WNVC 2VNRA 3HT2A 5C4WB 4N9HA 1DIWA 2OT7A 1IZ3A 3VD4A 3TAYA 5C71A 3POFA 5B4XA 4CU7A 2RG4A 4C1XA 4F7ZA 3PVEA 3MF9A 3O5SA 1UZ0A 4UT5A 3VL8A 4E4SA 3HPNA 4B29A 3BTYA 4P9LA 5EP9A 4QGNA 4KL1A 3UYJA 1BMV1 5FJHA 4BE3A 4JHZA 2I2SA 3I3BA 1C5IA 2HWF2 4M4PA 3DYOA 2GC3A 4NOTA 1TE1B 4MV2A 2ZMKA 3M2MA 3MICA 1F8VA 3M3CA 1K42A 4IV3B 3LCPA 2W39A 3HAGA 1GOFA 3G7DA 1Z7S1 4XZPA 2LROA 3CDZB 1OLRA 4QHBA 1FNZA 4S2DA 3KV5A 2BBAA 2HWE3 5DDJ1 5J3UA 4CVUA 4Y4YA 4AFDA 3O1OA 2GMPA 4GQ7A 2FCTA 2IXCA 1IQAA 4TWTA 3J7MA 4ATFA 2PTMA 4F8AA 1XE0A 1IQDC 5FP3A 1HV0A 2GU9A 3DUIA 4DRRA 1PX4A 3ZXFA 3KSCA 1OKQA 4QGMA 2ZHNA 3NAPB 2Y8KA 1SLIA 2PHUA 4IEZA 4UI9L 4CU9A 1DGRA 5FREA 1OD5A 2ZZJA 4LMFA 4Q8LA 4XYXA 5FZOA 3ZX7A 2QQPA 3VBRB 1I5PA 4JC1A 3MHZA 4CU8A 4BYYA 1JZ4A 2ZEZA 3ZFEB 4GJZA 1A8DA 1O4TA 2DYCA 2VW0A 1JMUB 1W9TA 4IV3C 1LECA 5A1LA 1PZ9A 3SH5A 4JQTA 1HN1A 4E9KA 3LDKA 3ZDVA 4DY5A 4JKMA 1XSQA 4HN0A 1H1IA 5L19A 3E97A 1JOBA 1KFXL 4AFAA 3SHRA 1WA6X 3LA2A 4CP9A 5FKCA 5B2GB 4ONUA 4AQ2A 5DMYA 3WF0A 4QX5A 5FKBA 3G6JB 4N9IA 3RZMA 3SISA 5GKAC 3HJRA 3PL0A 3ZYRA 5K0UB 4GMP1 4PDWB 1JZ5A 2NMNA 4QXBA 4OUEA 1XYPA 3QOPA 1C8NA 1TEIA 2RM22 4UFHA 5JXGA 1OVPA 2UWAA 5LWBA 1Z7S3 4Q4Y2 1MS4A 4UF0A 2XPJA 5F7UA 1XE7A 4NRPA 1NE6A 5DDJ3 3FUOA 4OUMA 4C1WA 5FOBB 1H8TC 2XVGA 2BPA2 4Y26A 4JRAA 5FUIA 2WUHA 4D7TA 1PO21 1Y43B 3U0ZA 1F31A 2OQ6A 1RYYA 1VALA 1CQ9A 4QPWA 4FAGA 3I4IA 1IG0A 2VMEA 1C57A 3N36A 3T08A 4XUOA 5FZEA 3ES1A 2BOJA 3POJA 3PIGA 2EIDA 4O61A 1GWMA 1JODA 1W9FA 4RL7A 3WF1A 3MW4A 3FFZA 5C9AA 1BCXA 1HW5A 1CAUB 1REFA 1QIQA 4JGYB 3KT4A 1LU2A 4KG0A 1IS5A 1N1TA 4E4ZA 3M70A 2NZ9A 1AF9A 1FV3A 2BEOA 1VE0A 4YW5A 5DXDA 5AC91 1VAVA 4PDWC 3WG2A 1XSRA 2XL9A 3IM0A 4K1YA 2MHFA 3KV6A 4CPBD 1A6CA 2XJQA 2ZGLA 2IC1A 4KGQA 5FP7A 3CMGA 3KQRA 3OBZA 1AYM3 3IMNA 4CDXB 1VBC1 2HJIA 3W20A 3SMHA 3RZHA 1WCUA 3MLJA 3MIHA 5FMDA 5GZEA 2WLPA 3WD5A 2E32A 1UY0A 3U37A 4PHZA 4M00A 4R8HA 4RGGA 4GMP3 1DFQA 2W1WA 2R7EB 2P4EA 2WNUA 3GCWA 1QXPA 2YC4A 3FN9A 5F5AA 3SCFA 2VVFA 2EVXA 3N7JA 1EV12 5CVRA 5L9VA 3KZ4C 4DMIA 3DPRB 2YPDA 3NO8A 4LKEA 3SQOA 1MS1A 5K9YA 1PO23 1DQ0A 5EQUA 2J1UA 3CBNA 2HWB2 3FE5A 1TZOA 4B7KA 1YCIA 1UMIA 3ZYGA 2IWGB 3NVCA 3IIAA 4JCKA 4P00B 4XDQA 4CDXC 3RPQA 5CG8A 4LHNA 4I30A 3WNLA 4Q0QA 4HN1A 1QY4A 4X8PA 4DO0A 1RUI2 2XJTA 4P02B 3MYXA 4RR3B 2GH2A 1UW8A 4DINB 4MO3M 2OQ7A 1QJEA 4GXLA 3USSA 4BA6A 5AC93 5G04L 2AEZA 4IGQA 1T6GC 1NCQB 3GF6A 4XFHA 1NY72 2GSYA 1Y9MA 3P6BA 3PDQA 2D7FA 1VBC3 3FZ3A 3FWEA 4JQRA 2B8MA 1LODA 3DPRC 5F2SA 1I6XA 5T5OA 3TN91 3IAPA 4S2GA 2YG0A 2EF6A 3R05A 4HVQA 2BNMA 3H8RA 1YQ2A 5B4NA 4EN0A 4COZA 3AXDA 1N1VA 3OGRA 4FOYA 3LF7A 1ENSA 4MGKE 3ON7A 5DN2A 1CZVA 2RJ2A 4FFHA 5FQ0A 1OKOA 1SLTA 2AZ5A 1GR3A 4IE0A 3TNPB 4C0HA 5CFCB 4XUTA 5FFOC 2WINB 5HXVA 2ID4A 3WVJA 5FZAA 4Z82A 4LT5A 2EAKA 2L9LA 1DGWX 3QH7A 2R30A 1O3SA 3H7JA 3R4DB 2Q8CA 5FZIA 4NHYA 1L3JA 1GKBA 3ABZA 1CX1A 3KF3A 4XPVA 4CCKA 3AVSA 3B9IA 1H1AA 3N7MA 3HMYA 4OFGA 5FPUA 3H42B 5GLZA 1EPZA 2GMEA 4BM8A 5EYXA 5GLVA 4YG3A 3VBFB 1H8TA 2ZACA 3ACHA 2HWC1 4LORA 3RJRA 1F9KA 1LEMA 4AHYA 1REDA 1UOFA 3WP5A 1W6PB 1XYNA 4UW6A 4TSVA 2JICA 2WWUA 3FHIB 3UETA 3KB5A 1OVSA 2Y64A 3NNMA 2OW4A 3BGAA 3R4SA 1XBFA 5F32A 3OF1A 4J6GA 2VNVA 3IB3A 4WVVA 3TN93 4AAXA 2RR11 1ZM1A 1UNBA 2V4AA 5FMCA 4WV8A 1M4WA 2Q1FA 5LBCA 4YW4A 4R9CA 1OPOA 3POGA 2LS6A 4ZU4A 1XB9A 2RHPA 2VR4A 4FPFA 3J7HA 5LBBA 2WA3A 2DCZA 3OD4A 2WZR1 1WBFA 4FQZA 4WZFA 5IUQA 3ZXLA 1BEV1 3MZHA 2JWPA 3D8CA 3VBFC 5HBAA 3I2OA 3NKTA 3OEBA 4H7LA 4BQ1A 4K3UA 1DGWA 4DQAA 3WLUA 3WF2A 1B35A 4AK3A 3SITA 1A8MA 1VBB2 4V2VA 1ND3B 4FI9A 1MS9A 3K75B 1AL22 1W6NB 4WVZA 4K7JA 3MIEA 3LIGA 4Q2FA 3R4UA 2WR9A 5DG2A 4R9BA 3R6SA 4CEYB 4BK4A 3ZFGB 4FP2A 4BZ4A 1KJRA 2HWC3 1AX2A 4LNVA 3TEZA 1FOD2 5LB6A 4FTEA 2BUKA 1GICA 5I0SA 4LBKA 1ZVFA 1G9FA 2DF7A 3OGSA 4XFFA 1CAVA 1TVGA 5A3LA 2FDGA 2X8KA 1O5UA 2C1FA 2ZHKA 5CIRA 2J1TA 1HQLA 3ACGA 1PO11 3JCIA 5DZGA 5JAXA 1LOGA 2QE3A 4QDSA 5FZDA 5J09A 2RR13 5KC6A 4L2NA 2JEMA 5LW9A 3V65A 3KHCA 1UQXA 1W6OB 4ES9A 1COV2 2ZEYA 1ND3C 1XU2A 3IIIA 1AZDA 1VMJA 4HVRA 2W1UA 3CJIB 4IXLA 2RVAA 3T2QA 4RGKA 2WZR3 4YZ4A 4CEYC 3ZFGC 1BEV3 1G7YA 3AYDA 4UAPA 3WY6A 3N35A 2XUMA 2ARCA 2XWBB 4HKLA 4QXKA 1HRV1 1OLMA 3ZIXA 2E53A 2W3JA 4GWMA 1JTZX 1UOBA 3ACFA 4PI0A 1K3IA 5FZBA 4A4AA 2CU5A 1JXNA 4XF4A 1UYYA 4LQRA 3FBYA 1JZ2A 1W06A 3WW3A 2CGOA 1QEXA 3PTYA 5G05L 2WWJA 4Y5SA 4LO7A 2E7AA 1O3RA 2XJVA 2WFF2 3MPBA 4I3PA 4N8MA 4YGCA 3ZR6A 4AEMA 3AMQA 2PHRA 1VAMA 2XQRA 1EP0A 4HPKA 4FPEA 2WAOA 3WQ1A 1W6QA 1CAWA 1SCSA 3D82A 4XQDA 4K21A 1SZBA 3P3PA 4QX0A 2JDPA 3UGHA 4MHUA 5FZHA 4MH0E 1Q8OA 2R042 5FUPA 5A32A 1C1FA 1DHKB 2W46A 3CJIC 1D4M2 2VNOA 4TN7A 1QWRA 3VZLA 3U1XA 3KM5A 4BQWA 3CJXA 3VUOA 1AX0A 3WQ7A 3ECQA 4I0WB 5FXXA 3L9JT 3LGRA 4CUCA 1HB4A 2D6PA 1DYOA 3SNMA 5A6XA 1RUC2 4I02A 3VBHC 1PO13 1DZRA 4YVWB 4I09A 3IZOA 2ZJCA 3LA7A 5T52A 3ZVXA 3RMYA 2J1RA 3IPVB 5HI0A 4YM3A 1H30A 3DYPA 1MVQA 1NE4A 2CHHA 2JE8A 4XHXA 2XJUA 2GC1A 1TG7A 2VZPA 3RVHA 2R32A 5F6LB 1N3PA 1FYUA 2VOWA 2Y60A 4CDQB 2X5IC 3VBSB 3X29B 1DF0A 2YFZA 3GXUA 2RE9A 1HRV3 2RMU1 3ILNA 4RQPA 5A33A 2BGOA 3GZAA 4S2HA 3MFAA 3U75A 5LASA 2VUAA 4YVSB 5APAA 2X29A 4CP0A 2YUEA 1CZTA 1S4CA 4P14A 3ZFFB 1XE8A 2QZ2A 4PT6A 3B69A 4OVEA 2Q8DA 1HKDA 3AM2A 4AI2A 4QPGB 1UY4A 4RHV2 4YRDA 2BJSA 3OJBA 1W03A 3O1RA 3TEXA 4DXRA 1OPMA 2EALA 2O8OA 3S7EA 4E2GA 5A3UA 5KWRA 1RITA 4DFSA 1WW5A 5FO8B 2Y38A 3MV11 3O1VA 3FLRA 1XQNA 2DVBA 3I3DA 3ZMNA 4CDQC 5LBFA 1QDCA 3J26N 2GNBA 2CTVA 4XJ9A 4OQ8A 1NX9A 5IAXA 3INAA 3UKVA 3VBSC 3N9LA 5JMOA 1DGLA 1S0BA 2VUJA 3PUAA 4UYBA 1ODMA 3POYA 1W99A 5FPXA 4Y33A 3RZZA 5LA1A 3JB8A 1WLDA 3Q8CA 2RDQA 3KVAA 4WM8A 4YW1A 1QHDA 4FVVA 3ACIA 4YVSC 4PF5A 3GNEA 4QDQA 3ZFFC 5BNPA 2DCYA 1BK0A 2PHTA 4YGEA 1RVF1 4XEZA 4K8RB 3WHUA 2UYBA 3MO4A 3AKSA 2VOKA 5A6YA 2RMU3 5JPMB 2H0BA 1XNDA 1G6NA 1MEC1 4AEKA 3IWZA 4YFWA 1SLBA 2DVFA 3D6EA 2D6NA 1AXKA 2RS12 1NA1B 2RDSA 3SC7X 5FZMA 2IXJA 4LHSA 2WWSA 4CPBA 4JKKA 1GNZA 5EPAA 3MFCA 1ZRFA 1MR5A 2XG3A 1HXS2 4E4DX 1MQTC 4P5YA 2BOIA 1UYXA 3PVBB 5A7SA 1W28A 4IEPA 4AVVA 4M3CA 3NSTA 2QQIA 2C26A 5HCBA 4B4PA 5FZ0A 4E8DA 2BW8A 3VBOC 1V6NA 5C8CB 2QQOA 1CJDA 3S0MA 1RUF1 4U36A 3VBUA 3N4MA 4UXAA 5J7MA 1AR62 1JYTA 3UV9A 4BCUA 1LGNA 2A3WA 1GU3A 5FBJA 4RGAA 2ZHLA 3VHRA 2OPKA 1RUE1 3LE0A 2ZGOA 2ZXQA 5C8WA 1UZYA 4N7IA 1ENQA 4NR1A 4YGDA 1KEXA 1BZWA 4KGGA 1LOFC 2ILMA 4ZONA 4ZZ8A 1RVF3 2H6CA 3IT8A 3H50A 2BP6A 2Z42A 3VDCA 4A44A 3VBHA 1FX5A 4LPLA 2D5FA 5GM0A 3DKWA 1NXD1 2VCAA 3FJSA 4W4ZA 1H4HA 3ZKYA 3KS7A 1O59A 3PU8A 4COWA 3S5AA 2O0OA 1MEC3 2WN2A 3ZOIA 1JN2P 2BWCA 1W8UA 2OZJA 1TME1 2X09A 1CIYA 1W8OA 3EXUA 4PLNA 4EZ4A 1ENXA 2JDZA 2X5IA 5E88A 3KCXA 5BPXA 4OHXA 3KT1A 3URFA 2Q5TA 2VW1A 2OVUA 3ETPA 1J58A 2D40A 3DXTA 3B02A 3VZKA 2A6XA 2GP3A 5AVAA 3VD7A 1IPJA 4QB1A 5IHRA 2XHNA 3A23A 5LEKA 1CN1A 4IV1C 3E5UA 4RN5A 3H8UA 1QQP2 1MS0A 3OUJA 3Q8EA 3W9AA 3ZO0B 1PM7A 3BIWE 5CISA 1IOAA 3PMEA 3J8F2 3NJZA 1ZZCA 2QVSB 4UFJA 3PJYA 4ITCA 4CTEA 3USUA 1RUF3 2W2IA 1GQGA 5JDBA 4XF1A 3WP4A 1KJLA 3TOJA 2E63A 2FHRA 4Q4W1 4XHBA 2XWJB 2XOMA 4R52A 4MX3A 4YM0A 1OHFA 2IVJA 3BPZA 5FZOB 4Y24A 2VZVA 4QX1A 2D3SA 5CNAA 3ZLIA 1J3QA 1H2NA 1RUE3 1L7LA 4Q1PA 1VRH2 5FZ8A 1CGPA 3QD6A 1NOVA 2XBO1 3B7MA 4H3WA 1TMF1 4E4HA 1JUHA 5KXBA 1CPMA 2LRPA 1Q43A 4OI1A 2PFWA 4BH9A 1UX6A 1KD7A 3MUZ1 4XOGA 3ZDSA 3WNKA 1QJY2 4CP9B 1LB2A 3UGGA 1JH5A 2QCSB 3MF6A 5H9RA 3JBG2 5LZ6A 1HB1A 2WS91 1TME3 2WA4A 4JZRA 2WO2A 5FZFA 2Z79A 2IFWA 1PIV2 1NQJA 1RL3A 4Q4V2 4R4XA 5A7OA 3RZJA 3GJBA 3OUHA 3GZTB 4HLTA 4UF0B 2ZKNA 4JVAA 1QGLA 4K8FA 1UZZA 4KQ7A 2IXHA 4JX0A 4D8MA 4COUA 5FYMA 4AAPA 3Q8BA 1NQDA 2W92A 3ZN4A 4BXSV 1PHMA 1W8FA 2AR6A 4QDRA 4QB2A 4M0HA 4ZZ5A 4V2WA 3D4KA 4O65A 5F9TA 2Q0AA 2ES3A 3OYWA 3LSEA 2QFEA 1LHUA 1W9YA 1K5MC 1YFXA 3PUHA 1WBLA 2NP0A 1J1LA 1GZWA 4WBBA 1QOOA 1KDMA 2PHLA 4MADA 1AR81 1LENA 4Q4W3 2VULA 4Z8BA 5C9AB 2WO3A 2ZEXA 1U5ZA 2J1VA 4IE7A 4QHZA 2VQUA 3NV1A 5GZDA 2XL7A 3O12A 2AENA 4BDVB 3V0BA 1HX6A 1YLLA 4K20A 4LBQD 3VBOA 2P17A 2XBO3 1R1ZA 1TMF3 3BOWA 4QAWA 1IPKA 5JIUA 4LOTA 3ITQA 1S0EA 3DECA 2AGSA 4CDUA 4DUWA 3LPGA 2HWF1 3BU0A 2VH9A 4BQYA 4CA9A 3AL6A 5DUXA 4XJAA 3CKHA 2VMHA 4HMZA 4TLFA 1GZCA 4YW6A 2ZOEB 3QBQA 4RD7A 2WS93 3HBKA 4DOUA 1RUG2 1XNAA 3UESA 1KS4A 2WNUB 5FZKA 2TNFA 5DAVA 4HKOA 1ALYA 2I74A 3I2HA 4LE4A 4NPLA 1IG3A 3HNYM 1OC1A 4WZCA 3O1UA 5FV3A 4N7UA 5C9AC 3PUQA 2ARAA 4BQ5A 4K9SA 3CIHA 4V1PA 2BVBA 5A7PA 2PN5A 2VZRA 3NW4A 4FXKB 4PI2A 5ERLA 2YPJA 4D7YA 5FYZA 1JZ3A 5T55A 5DUUA 1WW4A 4UFLA 5I0DA 1PGSA 1R092 1ZNPA 1KDKA 3HBZA 5FPZA 4JTOA 5A80A 3ETQA 1AR83 4IDZA 5IAVA 4IV1A 1VBD1 1SBEA 2C4XA 5E1RA 2OKXA 3T3YA 1OLQA 1POV0 3MV01 2Y6JA 1VB2A 5H9PA 2WNUC 1S2EA 5ACA2 2W9XA 4LA2A 4LJHA 2HLEA 4CDWC 2RDRA 2D43A 5HCFA 5C3PA 5A3WA 5DUVA 2WRAA 4YNIA 4XE9A 2VAUA 3KHBA 4BMBA 4P08A 4FOWA 5J98B 3B94A 3OD0A 5CZKA 4AGVA 5JLVA 3LEGA 4G4FA 3ZMOA 2HWF3 3I49A 1A78A 1RXFA 1EAH2 2B5HA 3PUIA 1RC6A 1T6BX 2VZTA 4KMQA 4D0QA 2D3PA 2XB6C 4H55A 4LK7A 3SCGA 2J42A 2PAKA 5KXCA 1A34A 4QX2A 2ZTNA 4LOSA 4MGYE 1YUDA 2RM21 2FCVA 1HB2A 4IE6A 1V6LA 4Q4Y1 5JR7B 4A6SA 1YQ5A 5FQ0B 2PXJA 2XMLA 1CIWA 3OGVA 3A22A 3OPTA 4NHKA 4QQPA 2QQJA 3QACA 1EUUA 2P37A 4W50A 3WDWA 2EXHA 4WM7C 4AI1A 5HV4A 2A6YA 2IFRA 5FZ6A 2OIIA 2E31A 1YNAA 1AVBA 1ZZ9A 1WCQA 5HPOA 1MZFA 2GP5A 2P2KA 1Y7BA 1QH6A 3NNLA 1E5RA 4NUBA 2V73A 2JB4A 3GGLA 3I3EA 4XW3A 4Q29A 3K4ZA 1LKNA 2VOTA 3O0VA 3B9CA 5EYYA 1H8TB 4DS0A 2E7TA 2PHXA 1VBD3 4TTGA 1RJ7A 3AYEA 4XABA 3MW3A 5LA9A 5EJ1B 1WGPA 1ND2C 1ZBA2 3ZR5A 4FFGA 1K5MA 3BIEA 5JCTA 3CNAA 5DUWA 5FK8A 4G3YC 1AYM1 2FDKA 1XPWA 3NV3A 1XNTA 2UY8A 4AQTA 4KNCA 4L9BA 3DXUA 2FCUA 5JIAA 3P5BA 3U4SA 1JZ7A 4NRQA 4XUNA 4CCNA 1UXZA 5CADA 5HCAA 4QKFA 4P5HA 1FXZA 4N90A 3RMXA 1LHVA 2VQTA 1WCSA 1PVC1 3LSDA 3IAQA 4XBLA 2RM23 1C5HA 2IZWA 2HEWF 4ORFA 1W39A 3C7EA 4Q4Y3 4XCBA 2V5YA 1EV11 1R1A2 3VN4A 3HT1A 4ZXEA 2DVGA 1WLWA 3NWKA 5FAXA 1YI7A 4FP3A 1Q3EA 1S0FA 2E33A 1IHMA 3PUSA 4MHRA 1BMV2 1B35B 1N3OA 1O4ZA 4GAZA 2YYOA 4BHPA 4XF0A 3VDDA 1GNYA 1YXWA 3KV4A 2A3YA 3S7IA 3GHMA 2CYFA 5A3PA 2YFUA 1C1LA 4FFFA 4YM1A 3ZSMA 3WG3A 2J1EA 2AREA 3J4UH 5CFDC 5D21A 3RYKA 2ZX4A 4AE2A 2IXLA 3UGFA 3K4AA 2H0VA 5DDJ2 4LBJA 1YIFA 1D0HA 1JYXA 5FYHA 3J7LA 3ME2A 1SPPA 4I0AA 4QX7A 5FLIA 3GYDA 1IS6A 5FY8A 3T1LA 4AHZA 2XVKA 2NN8A 4AWDA 3KMHA 1UMZA 1ASJ2 1S2KA 1YI9A 3DKQA 4UWDA 2D6MA 2DWRA 1CAVB 1QDOA 2GH8A 4AGGA 4IQPA 2EAAA 3WV6A 3AP4A 2W68A 2SBAA 1D2SA 2XLGA 2R1BA 2HKXA 2W87A 1PNFA 4YW2A 3RG0A 1U5YA 2PYTA 4YZ1A 5JXIA 2P34A 1W2NA 2JDAA 1B35C 3LFMA 1DDLA 1NZCA 3J7NA 4FXGB 1ZBE1 1FI2A 4AVTA 1O7FA 5JZGC 2RS32 5JXHA 3AJYA 3E5XA 5FLHA 4CDWA 1PVC3 1ULCA 3FX3A 3VKMA 2R1DA 1OFSA 3JUUA 1EV13 3LPFA 3O0XA 5BNQA 5E6HA 3OBTA 1GP6A 1JS9A 1LR5A 3BI3A 2EIBA 4GB31 4LO5B 3OGJA 2MEV2 4A42A 4CP2A 1BBT2 2HWB3 2ZGMA 4NWWA 1LGCA 3H1WA 1ZZBA 1POV1 2GN7A 4H14A 3VDAA 1JZ6A 1I1EA 4JDOA 3AMPA 3VBUB 3ZYIB 5K8SA 3AXEA 4OQ9A 1G9BA 4HPKB 1GBGA 5F3EA 5FJKA 1W6QB 1QJX1 3Q8AA 3TRSB 2QDNA 3MEPA 4WM7A 3AZVA 3AC0A 5DZEA 2A6ZA 3CEWA 1L7RA 1RUH1 4NIDA 2OS2A 4WVMA 4KWKA 2WSVA 2YXSA 2UYAA 3ZN6A 5A32B 5CA6A 2A70A 4JGZC 4XJWA 2FZ1A 3VKOA 2ZX1A 4Q0PA 3VD5A 2C9KA 2PHWA 4YZ3A 4GALA 2P5BA 3T4HB 2V09A 1Q8PA 2AH2A 2RJKA 4MGQA 3T2TA 5CU1A 2E7QA 5FRAA 2F4PA 2MPFA 2VMIA 4AVBA 1OUXA 3VZNA 1H6XA 1ZBE3 1ND2A 3BN6A 3WR0A 3NV2A 5GZCA 1YIPA 1CVNA 4Q4X1 5T5PA 1JYWA 4UOJA 5IVVA 1LGBA 2A3XA 3T1MA 1W2OA 4XURA 1PVXA 2YDEA 5FZ4A 3THCA 3N3HA 2QQLA 1MACA 3MLLA 4Z2WA 4RQPB 5BUVA 4GB33 5GLUA 4MGIE 2OPWA 1XNCA 2QTWB 4H2AA 1K12A 5A33B 3BOPA 1UO9A 1VBB1 1RMU2 2OZ6A 3LAGA 1DZQA 1POV3 1V9U2 1DYKA 2G19A 1U12A 2UWCA 5F5CA 2VZ3A 3VDBA 5FTTC 3RGBA 3HOBA 3ZYBA 2NMOA 3KF5A 3U78A 2ERFA 1QJX3 1R081 3WUDA 5JUVA 3RZKA 3THPA 1KRIA 4MGTA 1FMD2 1AYN2 1JHJA 4ZXKA 3DN7A 1RUH3 5JSOA 1CESA 2ADEA 2P1BA 5GLWA 3H3UA 2EA7A 1ULEA 2GNMA 2O1QA 2JENA 5LCWL 2BVVA 3ES4A 2X10A 1JUIA 4W8JA 4X6RB 1W2UA 2DCJA 3IKWA 2HWD1 4D6QA 3NAPA 2ORZA 5CFDA 5C3RA 2D5HA 4RQPC 3PNAA 5KHJA 2WBKA 5CB7A 2HH9A 2J22A 2WT2A 5LY1A 4IEVA 4WM8B 1QXJA 4IEOA 1COV1 4YG0A 4CU6A 3I2IA 3PMSA 3KT7A 3A0NA 1LJ7A 2VOVA 5BNPB 1LHNA 4XXPA 2MNGA 2WNEA 4Q4X3 2DFCA 4AI0A 3N9MA 4M01A 2ARBA 4J25A 1DQ4A 5KR7A 2X53S 1QH7A 1AR92 4DXZA 3NKGA 1Q8QA 2Q1MA 4MXWA 1UD1A 3WCRA 1XXNA 1STMA 4LE3A 5FWJA 5KXDA 4FSJA 1YJLA 4AVCA 4FCAA 1ZZ6A 4FT8A 4XMIA 5I0TA 1OFNA 2Q8EA 3CL1A 1VBB3 3ZYJB 3WP3A 5JZGA 4FPJA 2JDNA 2JDUA 3LDBA 4GZ9A 3SH3A 4XC9A 3O1MA 1JW6A 4PLOA 2VVEA 2N7GA 2ZPXA 4NIGA 2HEYF 4EROA 1OH3A 3EJKA 2BBVA 4PCRA 4LBQA 5LK7B 4CCJA 3WDUA 1R083 1SACA 2VCBA 4AVSA 4C0BA 4NHLA 1JZ8A 1C8M1 1ULPA 2FDFA 2BNOA 4WM8C 2VNGA 3S30A 3T0AA 5J36A 4RYDA 3TB0A 1CWPA 1W04A 2R041 5IK4A 3RFRA 3A7QA 4XFAA 1FATA 3HVDA 4CYDA 3KCYA 4M3CB 4E2QA 5BNPC 5BYNA 4TLGA 3UKNA 4BB3A 1ULOA 2Q1ZB 2VTXA 1JOPA 2DUOA 5A3OA 2HWD3 2EXIA 2JDHA 2OX0A 1GUIA 1XJAA 4IE5A 2WJSA 4LO8A 4OI2A 2G1MA 1UXXX 1S0CA 5FY1A 1R64A 1NCRC 2DCKA 2VBBA 4EN9B 4R4ZA 1COV3 2QZ3A 4KWUA 1OSGA 2HBUA 2VU9A 4LTAA 3E6BA 3GJAA 1ODNA 2VY0A 1QJZA 3AZZA 1KQRA 2YHJA 1LCLA 4JGZA 4LEJA 3JU9A 5FR3A 1J3PA 5D8AC 3A4UA 1VBE1 2F17A 3DCQA 1W8TA 2D44A 3VBHB 5FOJB 3AKQA 5J37A 3VL9A 3AKRA 2VE1A 4PIYA 4CUAA 4C91A 5FXZA 1GZ9A 2JG9C 2RDNA 5F8PA 2R49A 2XGXA 4IETA 1RUNA 1IS3A 5FZLA 4CCEA 4DUVA 2BGCA 5I0RA 4DUXA 1RHI1 1KGYA 2X5IB 4RHV1 4QQOA 3DGTA 3JD72 3VBUC 2B7YA 3ALQA 4HKWA 4PLMA 2JB8A 4XCAA 1QJU2 1QXRA 1SLCA 5IVFA 3A0KA 3HQUA 3MI8A 1C8M3 2WAAA 3JQWA 3UJOA 1RUD2 5IATA 5FP4A 2R043 3POIA 1BK1A 3S57A 4UFIA 5I8YA 2PLV2 2XKOA 4MZUA 3BODA 1SDDB 1V70A 1W0OA 3OY8B 2DURA 4NJ4A 3USUB 1HN0A 5A1AA 2VZSA 2W08A 2WKKA 5A7NA 2FDIA 3B3QE 1ULDA 2EIGA 1UY1A 3HR9A 1C3HA 5L73A 4FOQA 1XC6A 4JKLA 4CP1A 1P8JA 2TEPA 5H9QA 5LK5A 1AR71 3JXSA 2RS51 1WZXA 4QM9A 2HYKA 4XDOA 3KWVA 4ISRA 4B4QA 2JIJA 1GWLA 2BDRA 1VBE3 2Y26A 2Y0IA 3IBMA 3IDAA 3U07A 4DNYA 1JYIA 4DB5A 5FZCA 3H0OA 1O8SA 5A7WA 4O7XA 1OXCA 1J3RA 1Q5OA 1W8NA 3VHOA 3ZYPA 2WDBA 2VW2A 2GN3A 3WG4A 1V6KA 2P3YA 4BISA 3WDYA 4CZSA 1HQNA 5C3OA 3BB6A 5FPAA 2FBEA 1NLQA 1PM4A 2B46X 1RHI3 3H1YA 4I2OA 2ZABA 4MLOA 1GMMA 1VB4A 2OYZA 2B42B 2JDKA 4XIOA 1Y3TA 4A7ZA 2XKPA 4RHV3 4R9DA 5FYCA 3OBAA 3SCHA 3RS6A 2UWBA 3DV8A 5E8AA 1LOBA 2QBXA 1OMIA 5EJZB 3FHAA 3RI8A 4URAA 4RS5A 4ZU5A 5L7OA 3DL3A 3MIFA 1HRV2 4LO6B 5EXOA 4BMEA 4UW5A 4A41A 3P1IA 4XFCA 2FQPA 3WNMA 5LRSA 3OYWB 4OI0A 4N53A 4XACA 5T3NA 3EO6A 2ZBJA 1Y9GA 1E5SA 1DP0A 4IEYA 2EICA 4QXHA 1O91A 1GZWB 4AFBA 3MIBA 5HV0A 1RINA 1XRUA 3CF6E 2VBDA 1AR61 2IUWA 3KD4A 3LB9A 1G9CA 1ZRCA 1T2XA 3U10A 1MQTB 2X05A 2VZUA 1HRI2 4HANA 4XJUA 3IDBB 3V56A 3NNFA 3O0WA 4AYUA 1JYNA 2QKDA 4LXLA 3OTFA 4OMCA 1AR73 4Q27A 4A7KA 4EQVA 2RS53 3V0BB 1EUTA 2D97A 3VBOB 4IEXA 1SFPA 2R062 2BWAA 1GQPA 5EJ3A 1OA4A 2LW8A 4AZZA 1NCRA 2BTVC 2LALA 3DEMA 4Q0VA 4LBMA 4FPOB 3PVNA 1D4VB 1LESA 1O6UA 2ZA9A 4LK6A 3VKNA 3AL5A 4CDUB 1S0DA 2ET1A 1E57A 3HNBM 5F3IA 4W6YA 1LTEA 3OEAA 4DEQA 5T5LA 2CL2A 5JI7A 5D8AA 2LUWA 4HETA 4PIXA 4Z2AA 2KXLA 3M3QA 2VMCA 3RNSA 4AF9A 2DVDA 1JYCA 5FO9B 4XBNA 2JG9A 5EZWA 2Y6LA 2GC2A 1WMXA 2AYHA 4P9YA 4AI3A 4CCMA 3T0DA 1O8PA 3K4DA 1MS5A 3CZJA 4B3NA 3WHTA 2VUDA 3PTRB 2DFBA 4XFIA 3J8F1 4BQ3A 2CDPA 3E1F1 4LIVA 5F6KA 2JKBA 3E5QA 3F95A 4KBZA 2R072 4YYOA 5LEJA 1X82A 4MGSA 5KXEA 2GALA 3HQXA 4CE8A 4QPIC 1AR63 4HK9A 3WX5A 4YW3A 5BNNA 1LHOA 1HDKA 4CDUC 4IV1B 3OGGA 3NQHA 5FYIA 2ZGNA 5LATA 3ATGA 4QD2A 4QKBA 2JD4A 1DG6A 1PZ7A 4OUSA 4M0NA 3CZUA 4I3GA 5FUNA 1NXMA 1N3QA 3AFGA 1UKGA 3VHNA 1CD3G 1UAIA 3RDIA 1FV2A 2BU9A 3CHXA 2OA2A 3K3NA 5FY5A 4P9XA 1S1AA 5D2AA 5L9RA 3BCWA 5FBZA 5JOYA 3SEPA 2W5FA 1MZEA 3LOBA 1NAEA 4XILA 1PNGA 3JBG1 5IVJA 2DV9A 1F15A 4Q0UA 5JMCA 2J7MA 1GQHA 4O9GA 3RI9A 5FZ1A 1PIV1 3WW2A 4YARA 4Q4V1 5FYVA 3RZLA 4MG2A 4Y1VA 1SBFA 3THTA 1VIWB 4XJZA 3AK0A 1RVF2 3WQBA 4NIAA 2W1QA 4MOAA 3KLSA 4CCLA 2VZOA 2QQWA 4MXVA 4LIUA 1ZA4A 2W0XA 1MEC2 2K2SA 4D3WA 1GNHA 2GMMA 4LBLA 4Z07A 4JRLA 4IEQA 3J8F3 1D7PM 2TBVA 3K51A 2QQKA 4BIOA 3O1PA 2KD7A 3M7AA 4AXOA 1GV9A 1OF3A 2ARXA 3U4XA 1CZSA 3K46A 4FO9A 4HZFA 1HIXA 2BFUS 1AJOA 1ZA7A 4XTPA 4TZDA 1VMHA 1W2AX 5CKNA 1MS8A 2G9GA 1VBA1 4D6SA 1W90A 2XONA 3AMNA 1U5IA 2QQNA 3QH6A 1CONA 1YWKA 1X7NA 4NAOA 5E89A 4CCCA 4NN0A 3NJXA 1K5MB 4LHLA 1FPN1 3ZPYA 3D3AA 5ABJA 2A75A 2I45A 2XJRA 4K6BA 3VV1A 4A3ZA 2NM1A 3ZXDA 4JDMA 2UU8A 3LEKA 3ST7A 1IKQA 3UJQA 3OCPA 4KBBA 1PGW2 1W0PA 4HBNA 1OD3A 3HN3A 1RUF2 2ZEWA 3C7FA 2WLQA 3PHMA 4LITA 5DAPA 3N9NA 4YVWA 3JBG3 3GDBA 1PK6C 2VC9A 3KQ4B 4HSJA 1QNYA 2NQYA 4Y20A 3FC0A 4EV0A 4AFCA 3M4FA 4CUBA 1JU3A 1PIV3 1RUE2 2QDRA 4Q4V3 3WXPA 1SLLA 4LR4A 2DU0A 2I07B 2E51A 2AC1A 2QNKA 3HWJA 1KS5A 4QQLA 1E5HA 4HFSA 2QQVA 3I54A 3WINE 1SQ4A 1OOPA 3FL7A 4LO4B 3VD3A 3TEWA 3WQ0A 4HXCA 2NYYA 3OOXA 3WDVA 4COVA 3HNMA 3VDDB 1ZZ8A 5IWFA 2JDMA 1XU1A 5FZ7A 1R091 1RUJ2 3AFKA 3ILRA 3ZSKA 1PGL2 4W65A 4A3XA 3LEMA 4OMDA 4QU2A 1NT0A 3J9SA 4QPGA 1E5IA 4JHTA 4DZGA 4GH4A 1FNYA 3IDCB 3VD9A 2PHDA 3LD8A 2A71A 1SPPB 2OXBA 5DG1A 1VBA3 3NNJA 2NLRA 4FTSA 3MLKA 4A7YA 2WL1A 4CCOA 5ACA1 5JPNB 4JAAA 4KI5M 3TNQA 4CXWA 1FPN3 4R9AA 4C8DA 4URTA 4GKYA 2UY9A 2QQUA 4XF9A 1O4YA 1WMFA 4OZOA 4QPIA 1UZVA 2R6QA 4P9GA 2B45X 4OCTA 1HB3A 1EAH1 3I59A 1PMHX 1W8WA 3K77A 3C7HA 2PQQA 4AVAA 2C0ZA 1V0AA 3U11A 3VDDC 1WWYA 4L92A 3ZIWA 4ZPIA 4CDWB 1SFNA 5DPNA 3W59A 1V00A 1GFF2 1OQDA 3B93A 1YYNA 2VQAA 3LA3A 4BOWA 1ONAA 2KR2A 3AYCA 3FHQA 2ZKLA 4Y3OA 4IEWA 1EPWA 3EBRA 2WZEA 1UPSA 5FZGA 2VUCA 4ZU7A 4MVTA 4ET7A 1ZREA 4HSLA 4ZS2A 5FMOS 1NA1A 1R093 4XVHA 3D0JA 4QHOA 4F83A 1Y4WA 2ZGRA 2EXKA 4WM7B 5EWSA 4D69A 1YEWA 1HV1A 2WT0A 1O3TA 4LKDA 5FLJA 3ILFA 2P6HA 3VLBB 3CQOA 3NNGA 1ZBA1 4LLOA 2Y6FA 3EQEA 4WVMB 1WMDA 3ZN6B 5ACA3 2D3RA 1YC61 4XQWA 2DTYA 4KG8A 1GWKA 1H9WA 2NPIA 2XXZA 3C7OA 3C3VA 4AEDC 1CAXA 4DY3A 5BNOC 4BPZA 1GOHA 1VP6A 2VO5A 5FMBA 5BY5A 4LKSA 3GBGA 3ZXEA 4Y5Z0 1OI6A 4DXSA 1AR82 1UY2A 1EAH3 5EV7A 2YV8A 3V0AA 2PA7A 1BQPA 1ND2B 3HD8B 3RWNA 5T54A 3I3QA 1KFUL 1S0GA 3T30A 4LKFA 1H4GA 1OH4A 2VZ1A 3H7YA 4YGBA 3RQ0A 1R1A1 2ZX2A 1LAJA 1TNFA 2ZGQA 1ZRDA 2G4IA 4X8NA 2FMDA 3R0RA 1LOCA 2XLAA 1LRHA 4JDNA 3I8TA 1NLRA 1VMFA 2R0HA 1PK6A 2AACA 1SLAA 3C7GA 3DYMA 2Y34A 1UZWA 2CDOA 3TWIA 2B4KA 3GCXA 3LDRA 3N9OA 4BK5A 1S55A 5IK8A 1RUOA 3ELNA 1JBCA 2GC0A 2DDUA 2W95A 5JVVA 1J1TA 2JG8C 4HL0A 5FYTA 3WZ1A 5AFBA 3UK9A 4QKDA 2ZX3A 1X8EA 1UU6A 2Z69A 1V6OA 3RYPA 2HWE2 3B00A 4L99A 5JOWA 4ES8A 2A6WA 4LLFA 5C4WC 2RJLA 3K48A 3OBRA 1H2MA 1ZBA3 1OQEA 3ZPOA 5IYYA 1H2LA 1ASJ1 2PMWB 1ULGA 2VXRA 1G8WA 2Y0OA 4NE9A 4QT6A 5T50A 3ZSJA 3AKTA 4CSWA 2RV9A 4RA0A 4YFZA 5CFDB 1WA4A 4XZUG 4Q5OA 2PAEA 2VMGA 3CU7A 3TBDA 3WNXA 1SG3A 1UOJA 5FPLA 5FXVA 2YU2A 5LA2A 3VKFC 4N43A 1YHFA 1UIJA 1VBD2 1ZZ7A 2RS31 3LQCA 1TNRA 1ZRRA 2YZ4A 2UURA 3P3NA 5F5IA 2DBIA 4YWAA 3N9QA 3BU7A 3GALA 2BFUL 2ZGSA 3A21A 1R1A3 2ZX0A 3DF0A 5I91A 1H1MA 2YB7A 1UOGA 3VB9A 3BTXA 4X6QB 3I2DA 4MXWB 1V6MA 1N1SA 2MEV1 1NG0A 3U14A 5DQ0A 1ZX5A 2HWB1 2QJVA 1BBT1 2YBSA 3H3ZA 5AFEA 3NV4A 5FYBA 5JZGB 4GD4A 1UU5A 5FP9A 4UFKA 4YSFA 3GM8A 3WUCA 5IVBA 4Y5TA 4B1MA 3H8XA 1D2QA 2FDJA 1Z7S2 1LHWA 1AHSA 3AP6A 1RUI1 3NAPC 4LBQB 3ZXKA 4TYSA 4Y4RA 4KU7A 2PHFA 5JOXA 1WW7A 2JE9A 4G9SB 5F37A 5KHGA 1DBNA 4OI4A 3W21A 4JTNA 5IK7A 1L7QA 1RB8G 4S2FA 3VBRC 4E27A 1MZ5A 5KHIA 4RFT0 3VGIA 1NY71 4ASMB 3ZFEC 4IESA 1ASJ3 5BV6A 4OZXA 2E26A 2D6KA 3MIGA 4HOOA 4META 5I93A 4Q0SA 1OLME 3APBA 5IVEA 2O8QA 1VR3A 4FPHA 4DXTA 2HYXA 2CGNA 5AVPA 2RS33 4AL9A 1WLCA 3GHNA 5K0UC 4CEWB 4JGZB 3ZYFA 1KXGA 1W0NA 2ZS6B 4AEDA 2GNDA 3T2OA 2GAUA 2A1XA 1WKYA 5BNOA 5C5TA 5FK7A 2K46A 4AI8A 3KVBA 1PZ8A 1VRBA 5FY0A 3MGUA 1AYM2 4HT1T 1ENRA 1VPHA 2W52A 5FY9A 2JX9A 2MEV3 3OY8A 5JXJA 2WNVA 1BBT3 1SCRA 4GIQA 1RMU1 4QU1A 3ASIA 3FUQA 3EB7A 1OQ1A 1V9U1 2ZZQA 2F6BA 2HEVF 1CPNA 4IUGA 2CSGA 1QU0A 2DUQA 1PVC2 2WQ4A 3WDTA 1CAWB 1YRZA 1GP4A 1RUI3 5IK5A 1FMD1 1AYN1 3VKLA 5C7GA 2BGPA 1BKZA 1IPSA 4NMIA 3AJZA 4JGYC 5C5UA 1PO22 3NMBA 3O1TA 4DRVA 5T5JA 1TQ5A 4CEWC 1Q8SA 1F5FA 5SV5A 4KH9A 2JG8A 2BYVE 2FDHA 3AP5A 3B5LB 1RGSA 2VECA 4Y22A 1W6MA 4EWEA 4NWVA 4M4RA 1EYBA 2WO1A 3AZYA 1X50A 4P9IA 3VZMA 5CEHA 3LEIA 2YMZA 2R0FA 3MBWA 2VQ0A 5FMOL 5C4WA 4QKNA 5CBLA 5FCCA 3S5QA 4NPMA 5A7QA 5AC92 5IVYA 1IGOA 1WD3A 1YFUA 4XJ8A 2VM9A 5JSRA 4BJ0A 3PLQA 1H6YA 1AR91 4RSUA 1UX7A 2G9FA 1LOAA 3KCCA 4FTBA 1MZ6A 1VBC2 1DLLA 2XH6A 5F3GA 1YQCA 4P9WA 2JD9A 5A7WB 4DEVA 4E8CA 1OA3A 1ZYBA 1NUKA 2TUNA 3BTAA 4XUPA 4EN7B 1QJFA 1RMU3 1U5XA 1AL21 3HEIA 5JOZA 1V9U3 4FOVA 1SBDA 5BXXA 1ZBE2 2R16A 3ZSEA 4IV3A 3RYRA 2VTXJ 4OLLA 1B09A 4QXCA 2HBTA 1RXGA 4Y1YA 4EJRA 3ZXJA 1FMD3 1AYN3 1W3VA 1OA2A 4NRMA 5FYSA 1URXA 1FOD1 4RS5B 4B8EA 5C3SA 5L7OB 1AXZA 1GOGA 4GB32 4LUKA 4RR3C 5FZ3A 4AFMA 2H6BA 2VG9A 1NLSA 3IN9A 4ZY9A 2A5ZA 3FLPA 4NROA 4IEUA 4N53B 3I7DA 1NCQC 5F1RA 4FPCA 5GLTA 3MUY1 2YBKA 2YROA 4IE4A 4XETA 4ATEA 3N7KA 1QNWA 1RTVA 3UKTA 1UN1A 5IFPA 2WO7A 1K5JA 1QJX2 4PF1A 2ZAHA 1JHNA 2ETEA 3VBRA 4XUQA 3WNNA 2A6VA 1PX3A 1RUH2 5FDBA 1AUYA 1DLCA 4OULA 4PQ9A 1SEFA 3BYWA 4WVWA 3ZFEA 4QB6A 5HCHA 1WMEA 2VJXA 4EYUA 3HN1A 4BQ2A 1AR93 2WZPP 2FMYA 5LBEA 5CFCC 1I9RA 1NCRB 4RS5C 5L7OC 1X9TA 2C24A 1QF3A 2CAVA 4YW7A 3TN92 2P6CA 3FFQA 4QWNA 4M3CE 5FY4A 3BVCA 3Q9OA 1AL23 3POEA 4LHKA 5K0UA 2K9ZA 4K1ZA 1DQ5A 2WFF1 3LZZA 4MSVA 4N53C 4EE2A 1J59A 4PDWA 5KC5A 2ZGTA 2ZMLA 5D8AB 1UMHA 1OUSA 1UY3A 2J1AA 2YGLA 3JD71 4OHVA 3E6CC 4XQ4A 3BUCA 2D6OX 1QJU1 1RJ8A 4Q4X2 3I2KA 3MIDA 2YGMA 2XDVA 2Z5WA 1MVEA 4W6XA 4XIKA 4YZ2A 3H8OA 4B1LA 2JG9B 1FOD3 1RUD1 4NO4A 4NHMA 2P3JA 1NYWA 2Y33A 3I2JA 1D4M1 2C5DA 1F35A 2P3KA 1QOTA 2PLV1 1HJFA 1VJ2A 2C6SA 2JE7A 4H7MA 4BLJA 4EWAA 1SDWA 1UKRA 5F39A 1Q8VA 4DIQA 5J96B 2BERA 1RUC1 2VL4A 1ST8A 3PURA 1FAYA 3BALA 4UW3A 4QX3A 3H3LA 5BNNB 1CAUA 4JGYA 1R082 2HWC2 2WN3A 5I8SA 3W58A 3ZM8A 3W5MA 1LNSA 2Y6GA 2Q30A 4ZHNA 4Y1XA 1J83A 4PJYA 4XBQA 1C4RA 2W47A 4BXFA 4QPYA 1S2BA 5DAXA 4CDXA 5F3CA 5I0UA 2VBPA 4B7EA 2VZQA 1Q56A 2AUYA 1I3HA 2VGDA 2HWD2 2XHKA 4OHWA 5L36A 3T4VA 2RR12 4XF3A 4QQHA 4IL7A 1POQA 2ENRA 4AI9A 1UIKA 3AZXA 2YC0A 4XTMA 3SXWA 4EN6B 2WFF3 4YG6A 2JXAA 2WT1A 5FY7A 4GJYA 1YQ8A 1EY2A 2D93A 2WZR2 3JD73 4EZHA 4W6WA 3M8LA 1QJU3 1BEV2 4HG6B 3AB0A 1YQ6A 3DPRA 3WP6A 2P3IA 5BNNC 3LIHA 4NAMA 1RUD3 4A2UA 2KM2A 1F4AA 3TYJA 5A3MA 3TEYA 1G9DA 1D4M3 1GP5A 2CY6A 3SLIA 3MDPA 2VCMA 2PLV3 4IW3A 3AX4A 3GZEA 2Q8OA 2IXKA 1RUC3 4U2AA 4BU2A 2W91A 2O14A 3SKVA 3POBA 3OSDA 4P9JA 1HRI1 4Q1RA 4A6OA 4RR3A 5GJ6A 1QOSA 3I3MA 1GLHA 2JKXA 1C8M2 5JI9A 5C3QA 1JU4A 4ZS3A 4OYUA 3H9AA 4CEWA 5LRRA 3T09A 2YC2A 1US3A 2XQXA 5KHKA 4AW7A 1NCQA 2R061 4KWJA 4AR2A 5ABJB 1DGRN 1APNA 3ORJA 1V6IA 4NPRA 3WDXA 2W94A 4FPYA 2J1SA 3BKZA 3RSJA 1CJPA 3M3IA 1UF2C 1G9AA 1PO12 5FXWA 5SV8A 3UNPA 1XYOA 4QX8A 5JR2A 3JQXA 2RS11 4Y20B 4BLIA 2FD8A 4UFMA 3Q8FA 4A45A 4CRQA 1FT9A 1V6JA 1Y9QA 4I01A 2JECA 1H2KA 2VVDA 5CFCA 3JZVA 1HXS1 1VBE2 2WYFA 2XVLA 3BPSA 5H9SA 1X36A 4QMAA 2WQZC 4Z1VA 3EMRA 2BQPA 1OOPB 4J1XA 2E9QA 4CCDA 3WF4A 1HQWA 1N47A 4EN8B 1WW6A 3CLPA 1OT5A 1M06G 1AJKA 1IS4A 2V72A 2ZHMA 3LKJA 5ABJC 4HVOA 2R071 4IGOA 1RHI2 2G9ZA 3ZYHA 4HONA 2ZMNA 1HJGA 4MGZE 1WUVA 3AMHA 3VBFA 1W9SA 2F4LA 3QCWA 4GH4B 1AX1A 4XAAA 5A6QA 1BJQA 1HRI3 1MS3A 4YVWC 2WIIB 4AQSA 5CKQA 5K4LA 1DU3D 1UPIA 1W6PA 5JSPA 1DCSA 2WFPA 3LOIA 3ZXAC 3PVOA 3F2ZA 3EHKA 5CKMA 3WEZA 4AGRA 2YY1A 4KWLA 2R063 3POSA 2V4VA 3W5NA 1LEDA 1OURA 4YM2A 1ZRIA 1US2A 3KGLA 1UL9A 1F4HA 1I5ZA 3H1MA 1VAKA 3OG2A 4QPIB 4AEJA 4JV4A 3THDA 5F5QA 3LWCA 3N9PA 3N7LA 3WNOA 1DQ2A 4FQ4A 1OOPC 3L2HA 3I59B 2WYSA 2BV4A 1H8VA 2RS13 4D94A 1U0AA 2VPVA 5TSWA 4BQXA 2WSUA 5IW0A 4AOCA 2IVIB 4Q26A 1AR72 4XFGA 2RS52 1AXYA 1NZIA 2WC2A 1UYPA 2A73B 2JDYA 1PMJX 2LM3A 2V5DA 1UWWA 3WW1A 2VMFA 4L97A 2BRTA 2D98A 1O5LA 3M3OA 4QPGC 1G86A 2VTFA 3T0BA 1HXS3 4GH4C 3WNPA 4KU8A 1UYZA 1QQP1 4CXYA 2CV6A 2RMU2 3OUIA 4L8QA 5FIXA 3KV9A 3JB4C 3OPZA 3AVRA 5K7PA 1C28A 2ET7A 1ND3A 1W8ZA 5FP8A 3ZXGA 1GYKA 1W6NA 1OBNA 1GANA 2R073 1PMIA 2GZWA 3HQRA 1XNBA 4CEYA 3BTZA 1UCXA 2CWSA 4GKXA 3ZFGA 3QLQA 2VD7A 1A3KA 1GZTA 2OUHA 2XLFA 2XJPA 1QMJA 4GWNA 4LBOA 4FAHA 5JWPA 3OPWA 4PBPA 4RFRB 2WNOA 2Z2SB 1VRH1 4ARYA 4B4RA 5A1FA 2GNTA 2ZAAA 4BIFA 1BVP1 3O14A 1YJKA 3WCSA 2WZ8A 4UBGA 1WLTA 3ENRA 3I97A 1X8MA 1J84A 5A6ZA 2E6VA 1CAXB 4BQ4A 5CG9A 2B9VA 1QJY1 1PGW1 2ADDA 3IMMA 1DQ6A 3D0SA 3AKPA 2GDFA 4NIHA 3WSOA 4MUVA 5IFTA 2A7AA 2DBNA 1W6OA 2YU1A 3V0AB 2EXJA 4GWIA 5LY2A 4XAEA 4GULA 1BYHA 4O9EA 3CJIA 1BLZA 2Z4FA 1NA1C 3KGZA 3SKJE 3POWA 2QUOA 1D0GA 1O3QA 5EFUA 3NJVA 1YFYA 1XNKA 3RZGA 4AG4A 2CGPA 4J1WA 2D6LX 4ASKA 1QQP3 1X9PA 2ATFA 1PK6B 3EYPA 5IJRA 2ZGPA 4FPGA 4INDA 3WW4A 5ISLA 3NJYA 5KHHA 2Y6HA 5IVCA 5I8TA 1H0BA 1RIRA 4E2SA 4PBOA 1RUJ1 5DAWA 2B39A 4UW4A 3ROUA 1PGL1 4CXXA 1Z78A 2Q4SA 5A3NA 5C8CC 4XXAA 2VOXA 4IGPA 4LUMA 3GBFA 4NVPA 5FYYA 5J1XA 2DTWA 4C90A 1YO8A 5A3TA 1JOJA 5GZFA 2OUJA 1VRH3 3I2FA 3GZUC 3S6PA 3SH4A 4L11A 3WT3A 2K0GA 3WOGA 3MPPG 1REEA 3M3EA 3LFIA 4ARXA 4OHZA 4YZ5A 1QJY3 4F3JA 3T2PA 2VCCA 4NIIA 1AL0G 4Q8KA 1DZTA 2ZGUA 3IPVA 5GZGA 1KITA 2DU1A 5DABA 1RUG1 4N43B 1SFYA 2PAMA 2PQSA 3FBMA 2ZCWA 2XUEA 3UL2A 3O7OA 4Y1ZA 4BWOA 1JYVA 2JIGA 4CDQA 3AZWA 1ULFA 1DQ1A 4FPKA 4K40A 5FPVA 4FPLA 1OF4A 1CX4A 5IT6A 5FYUA 3VBSA 1LU1A 1BVVA 1YFWA 1SMVA 1VLNA 1NKGA 4XDPA 2VMDA 3SEEA 2SLIA 4GA9A 4Y1UA 3ZN5A 3AYAA 4YVSA 4YLZA 3VHPA 5F2WA 4LBNA 1TME2 3ZFFA 4FBFA 3K3OA 1RUJ3 3C2UA 4NHXA 5GALA 2C9AA 1WD4A 5EIYB 3AMMA 4UBHA 3C8XA 1XOYA 2XR4A 4SLIA 3RJ2X 5KBFA 5CAZA 1N1YA 4XMAA 3PJQA 3B01A 4HK8A 4SBVA 1CR7A 1W9WA 3AP7A 5FZ9A 2CNAA 4YPJA 4GMP0 4N43C 1LULA 3WG1A 2JJ6A 1WCKA 1W2TA 3CO2A 3NRUA 3ZSLA 4OHYA 4COYA 4QM8A 3IDEA 4FFIA 3ZKUA 1W8HA 2YBPA 2EIEA 2VXJA 4CUGA 3NL1A 1DYPA 2AEYA 2DUPA 4GWJA 5EHDA 4D6RA 5DAQA 5C6CA 1GSLA 3PIJA 1IKPA 5FO7B 1SHWB 3K2OA 3M1HA 4Q4W2 3RRDA 3VZOA 4AQ6A 1BHGA 2PELA 1MQTA 1RUG3 3RWKX 5FPBA 3L2YA 2Y6KA 4IERA 1VBA2 3OB8A 4AEDB 2FZ2A 4DPNA 2XBO2 4AHXA 1TMF2 4ISQA 1FPN2 5BNOB 1F5JA 3PU3A 1ACCA 1H9PA 3AP9A 5M0TA 5D1IA 5A70A 3WF3A 2BZDA 2IXIA 1HLCA
chains in the Genus database with same CATH topology
1LOEA 3FLTA 2WNVB 4EWDA 3V64A 5J48A 4Z92B 1F2NA 2ZGKA 3VZJA 4I0BA 2WS92 3D5OA 4ZKTB 3FMGA 2CAUA 1LOFA 4LULA 4AHWA 2BNNA 4XFBA 2XJSA 5C33A 2DVAA 2HWE1 5DZFA 4MYEA 1QKQA 5E16A 1Z0HA 3MW2A 3E6DA 1WCDJ 1BXHA 2CWMA 4LA3A 4D7SA 4ASLA 1S0JA 3GBWA 1S0IA 2JG8B 3HIFA 1X33A 4QGLA 5C8CA 1UU4A 4PIZA 2LTNA 4Y22B 3ACLA 1W6MB 2B9UA 4M3CF 4QQ2A 2DCTA 2KA3A 2WNVC 2VNRA 3HT2A 5C4WB 4N9HA 1DIWA 1IZ3A 3TAYA 4C1XA 4F7ZA 3PVEA 3MF9A 3O5SA 3VL8A 4E4SA 4B29A 4P9LA 4QGNA 4KL1A 1BMV1 4BE3A 2I2SA 1C5IA 2HWF2 2GC3A 4NOTA 1TE1B 4MV2A 2ZMKA 3M2MA 3MICA 1F8VA 3M3CA 4IV3B 3LCPA 2W39A 3HAGA 3G7DA 1Z7S1 4XZPA 4S2DA 4QHBA 1OLRA 1FNZA 2HWE3 5DDJ1 5J3UA 4Y4YA 4AFDA 2GMPA 4GQ7A 2IXCA 4F8AA 1IQAA 4TWTA 4ATFA 2PTMA 1HV0A 2GU9A 3DUIA 4DRRA 3ZXFA 3KSCA 1OKQA 4QGMA 2ZHNA 3NAPB 1SLIA 2PHUA 4IEZA 1DGRA 5FREA 1OD5A 2ZZJA 4Q8LA 4XYXA 2QQPA 3ZX7A 3VBRB 4JC1A 4BYYA 3ZFEB 1A8DA 1O4TA 2DYCA 2VW0A 4IV3C 1LECA 1PZ9A 3SH5A 4E9KA 4DY5A 4HN0A 1H1IA 5L19A 3E97A 1KFXL 4AFAA 3SHRA 3LA2A 5B2GB 4ONUA 4AQ2A 4QX5A 3G6JB 4N9IA 3SISA 5GKAC 3ZYRA 5K0UB 4GMP1 4PDWB 2NMNA 1XYPA 3QOPA 1C8NA 1TEIA 2RM22 2UWAA 1Z7S3 4Q4Y2 1MS4A 2XPJA 1XE7A 5FOBB 1NE6A 5DDJ3 3FUOA 4OUMA 4C1WA 1H8TC 2XVGA 2BPA2 4Y26A 4JRAA 4D7TA 1PO21 1Y43B 3U0ZA 1F31A 1VALA 1CQ9A 4FAGA 3I4IA 3N36A 1C57A 3ES1A 4RL7A 3MW4A 3FFZA 5C9AA 1BCXA 1HW5A 1CAUB 1REFA 4JGYB 3KT4A 1LU2A 4KG0A 1IS5A 1N1TA 4E4ZA 3M70A 2NZ9A 1AF9A 1FV3A 2BEOA 4YW5A 5DXDA 5AC91 1VAVA 4PDWC 3WG2A 2XL9A 3IM0A 4K1YA 2MHFA 1A6CA 2XJQA 2ZGLA 2IC1A 4KGQA 3KQRA 4CDXB 1AYM3 3IMNA 1VBC1 2HJIA 3SMHA 3MLJA 3MIHA 5GZEA 2WLPA 3WD5A 4M00A 4R8HA 4RGGA 4GMP3 1DFQA 2WNUA 1QXPA 3SCFA 2VVFA 2EVXA 3N7JA 1EV12 5CVRA 3KZ4C 4DMIA 3DPRB 3NO8A 1MS1A 5K9YA 1PO23 1DQ0A 2HWB2 3FE5A 4B7KA 1YCIA 3ZYGA 2IWGB 3NVCA 3IIAA 4JCKA 4XDQA 4CDXC 3RPQA 5CG8A 4LHNA 4I30A 4Q0QA 4HN1A 1QY4A 4X8PA 1RUI2 2XJTA 4RR3B 3MYXA 2GH2A 1UW8A 4DINB 4GXLA 3USSA 4BA6A 5AC93 1T6GC 1NCQB 3GF6A 4XFHA 1NY72 2GSYA 2D7FA 1VBC3 3FZ3A 3FWEA 4JQRA 2B8MA 1LODA 3DPRC 5T5OA 1I6XA 3TN91 4S2GA 2EF6A 3R05A 4HVQA 2BNMA 4EN0A 4COZA 3AXDA 1N1VA 4FOYA 1ENSA 4MGKE 5FQ0A 1SLTA 3TNPB 2AZ5A 1GR3A 4C0HA 5CFCB 5FFOC 2WINB 5HXVA 3WVJA 4Z82A 4LT5A 2EAKA 1DGWX 3QH7A 2R30A 1O3SA 3H7JA 3R4DB 1L3JA 1GKBA 4XPVA 3N7MA 3B9IA 1H1AA 4OFGA 3HMYA 5GLZA 1EPZA 2GMEA 4BM8A 5EYXA 5GLVA 4YG3A 3VBFB 1H8TA 2ZACA 2HWC1 3RJRA 1F9KA 1LEMA 4AHYA 1REDA 3WP5A 1W6PB 1XYNA 4UW6A 4TSVA 2JICA 3FHIB 3KB5A 2OW4A 3R4SA 3OF1A 4J6GA 4WVVA 3TN93 2RR11 1ZM1A 4WV8A 1M4WA 4YW4A 4R9CA 1OPOA 4ZU4A 2RHPA 4FPFA 2WA3A 2DCZA 3OD4A 2WZR1 1WBFA 4FQZA 4WZFA 5IUQA 3ZXLA 1BEV1 3MZHA 3D8CA 3VBFC 5HBAA 3NKTA 4H7LA 4BQ1A 4K3UA 1DGWA 4DQAA 3WLUA 4AK3A 1B35A 3SITA 1A8MA 1VBB2 1ND3B 1MS9A 1AL22 1W6NB 4WVZA 4K7JA 3MIEA 4Q2FA 3R4UA 5DG2A 4R9BA 3R6SA 4CEYB 3ZFGB 4FP2A 4BZ4A 1KJRA 2HWC3 1AX2A 4LNVA 1FOD2 4FTEA 2BUKA 1GICA 5I0SA 4LBKA 1ZVFA 1G9FA 2DF7A 4XFFA 1CAVA 5A3LA 2X8KA 1O5UA 2C1FA 2ZHKA 5CIRA 5DZGA 1HQLA 3JCIA 1PO11 5JAXA 1LOGA 2QE3A 5J09A 2RR13 5KC6A 4L2NA 2JEMA 3V65A 1W6OB 4ES9A 1COV2 1ND3C 1XU2A 1AZDA 4HVRA 3CJIB 4IXLA 2WZR3 4YZ4A 4CEYC 3ZFGC 1BEV3 1G7YA 3AYDA 3WY6A 3N35A 2XUMA 2XWBB 4HKLA 4QXKA 1HRV1 3ZIXA 2E53A 4GWMA 1JTZX 1JXNA 4XF4A 3FBYA 3WW3A 2CGOA 3PTYA 4LO7A 2E7AA 1O3RA 2XJVA 2WFF2 3MPBA 4I3PA 4YGCA 4AEMA 3AMQA 2PHRA 1VAMA 4HPKA 1EP0A 4FPEA 3WQ1A 1W6QA 1CAWA 1SCSA 3D82A 4XQDA 4K21A 3P3PA 4MH0E 1Q8OA 2R042 5A32A 1C1FA 1DHKB 4EWEA 3CJIC 1D4M2 2VNOA 3VUOA 1QWRA 3VZLA 3KM5A 3CJXA 1AX0A 3WQ7A 3ECQA 4I0WB 3L9JT 3LGRA 2D6PA 3SNMA 1RUC2 4I02A 3VBHC 1PO13 1DZRA 4YVWB 4I09A 3ZVXA 2ZJCA 3LA7A 5T52A 5HI0A 3RMYA 3IPVB 4YM3A 1H30A 1MVQA 1NE4A 4XHXA 2XJUA 2GC1A 2R32A 5F6LB 1N3PA 1FYUA 2VOWA 4CDQB 2X5IC 3VBSB 3X29B 1DF0A 2RE9A 1HRV3 2RMU1 3ILNA 4RQPA 5A33A 3GZAA 4S2HA 3MFAA 2VUAA 4YVSB 2X29A 4CP0A 4P14A 3ZFFB 1XE8A 2QZ2A 3B69A 4OVEA 1HKDA 3AM2A 4AI2A 4QPGB 4RHV2 4YRDA 3OJBA 1OPMA 2EALA 2O8OA 3S7EA 4E2GA 5KWRA 1RITA 4DFSA 1WW5A 5FO8B 2Y38A 3FLRA 1XQNA 2DVBA 3ZMNA 4CDQC 1QDCA 3J26N 2GNBA 2CTVA 4XJ9A 3INAA 3UKVA 3VBSC 1DGLA 1S0BA 2VUJA 3POYA 5FPXA 3RZZA 3JB8A 1WLDA 4YW1A 4WM8A 1QHDA 4FVVA 4YVSC 4PF5A 3GNEA 3ZFFC 5BNPA 2DCYA 2PHTA 4YGEA 1RVF1 4XEZA 3WHUA 2UYBA 3AKSA 2VOKA 2RMU3 5JPMB 2H0BA 1XNDA 1G6NA 1MEC1 4AEKA 3IWZA 4YFWA 1SLBA 2DVFA 3D6EA 2D6NA 1AXKA 2RS12 1NA1B 2IXJA 2WWSA 1GNZA 3MFCA 1ZRFA 1MR5A 2XG3A 1HXS2 4E4DX 1MQTC 3PVBB 4IEPA 4AVVA 4M3CA 3NSTA 5HCBA 4B4PA 2BW8A 3VBOC 1V6NA 5C8CB 1CJDA 3S0MA 1RUF1 4U36A 3VBUA 3N4MA 4UXAA 5J7MA 1AR62 3UV9A 4BCUA 1LGNA 2A3WA 4RGAA 2ZHLA 3VHRA 2OPKA 1RUE1 2ZGOA 5C8WA 1UZYA 4N7IA 1ENQA 4NR1A 4YGDA 1BZWA 4KGGA 1LOFC 2ILMA 1RVF3 2H6CA 3IT8A 3H50A 2Z42A 3VBHA 1FX5A 2D5FA 5GM0A 3DKWA 1NXD1 3FJSA 1H4HA 4COWA 3KS7A 2O0OA 1MEC3 1JN2P 2BWCA 2OZJA 1TME1 3EXUA 4PLNA 1ENXA 2JDZA 2X5IA 5E88A 3KCXA 5BPXA 4OHXA 3KT1A 3URFA 2Q5TA 2VW1A 2OVUA 1J58A 2D40A 3VZKA 3B02A 2A6XA 5AVAA 1IPJA 5LEKA 1CN1A 4IV1C 3E5UA 3H8UA 1QQP2 1MS0A 3W9AA 3ZO0B 1PM7A 3BIWE 1IOAA 3PMEA 3J8F2 3NJZA 1ZZCA 2QVSB 3PJYA 4ITCA 4CTEA 3USUA 1RUF3 1GQGA 5JDBA 4XF1A 3WP4A 1KJLA 3TOJA 2E63A 2FHRA 4Q4W1 4XHBA 2XWJB 4R52A 4MX3A 4YM0A 1OHFA 3BPZA 4Y24A 2D3SA 5CNAA 1J3QA 1H2NA 1RUE3 4Q1PA 1VRH2 1CGPA 3QD6A 1NOVA 2XBO1 3B7MA 4H3WA 1TMF1 1JUHA 5KXBA 1CPMA 4OI1A 1Q43A 2PFWA 4BH9A 1UX6A 1KD7A 4XOGA 3ZDSA 1QJY2 1LB2A 1JH5A 2QCSB 3MF6A 5H9RA 3JBG2 2WS91 1TME3 2WA4A 2Z79A 2IFWA 1PIV2 1NQJA 1RL3A 4Q4V2 4R4XA 3GZTB 4HLTA 2ZKNA 4JVAA 1QGLA 4K8FA 1UZZA 4KQ7A 2IXHA 4COUA 3ZN4A 1NQDA 1PHMA 2AR6A 5F9TA 4M0HA 3D4KA 2Q0AA 2ES3A 3OYWA 3LSEA 2QFEA 1LHUA 1YFXA 1K5MC 2NP0A 1WBLA 1J1LA 1GZWA 4WBBA 1QOOA 1KDMA 2PHLA 1AR81 1LENA 4Q4W3 2VULA 4Z8BA 5C9AB 1U5ZA 5GZDA 3NV1A 2XL7A 3O12A 2AENA 3V0BA 1HX6A 1YLLA 4K20A 4LBQD 3VBOA 2P17A 2XBO3 1R1ZA 1TMF3 3BOWA 1IPKA 5JIUA 1S0EA 2AGSA 4CDUA 2HWF1 2VH9A 5DUXA 4XJAA 2VMHA 4HMZA 4TLFA 1GZCA 2ZOEB 3QBQA 4RD7A 2WS93 4DOUA 1RUG2 1KS4A 2WNUB 2TNFA 4HKOA 1ALYA 2I74A 4LE4A 4WZCA 4N7UA 5C9AC 4K9SA 4V1PA 2BVBA 2PN5A 3NW4A 4FXKB 2YPJA 4D7YA 5T55A 5DUUA 1WW4A 1PGSA 1R092 1ZNPA 1KDKA 3HBZA 5FPZA 4JTOA 3ETQA 1AR83 4IV1A 1VBD1 1SBEA 5E1RA 1OLQA 1POV0 1VB2A 5H9PA 2WNUC 5ACA2 4LA2A 4CDWC 2D43A 5HCFA 5DUVA 4YNIA 4XE9A 4BMBA 4FOWA 5J98B 3B94A 3OD0A 4AGVA 5JLVA 4G4FA 3ZMOA 2HWF3 1A78A 1EAH2 2B5HA 1RC6A 2D3PA 2XB6C 4H55A 3SCGA 2PAKA 5KXCA 2ZTNA 4MGYE 1YUDA 2RM21 1V6LA 4Q4Y1 5JR7B 5FQ0B 1CIWA 4NHKA 4QQPA 3QACA 2P37A 3WDWA 2EXHA 4WM7C 4AI1A 2A6YA 2IFRA 2OIIA 1YNAA 1AVBA 1ZZ9A 1MZFA 2P2KA 1Y7BA 1QH6A 2V73A 4XW3A 4Q29A 3O0VA 1LKNA 3B9CA 5EYYA 1H8TB 4DS0A 2E7TA 2PHXA 1VBD3 1RJ7A 3AYEA 3MW3A 1WGPA 1ND2C 1ZBA2 1K5MA 5JCTA 3CNAA 5DUWA 4G3YC 1AYM1 3NV3A 2UY8A 4AQTA 4KNCA 4L9BA 5JIAA 5CADA 5HCAA 4P5HA 1FXZA 4N90A 3RMXA 1LHVA 1WCSA 1PVC1 3LSDA 4XBLA 2RM23 1C5HA 2IZWA 2HEWF 4ORFA 1W39A 4Q4Y3 2V5YA 1EV11 1R1A2 3VN4A 3HT1A 2DVGA 1WLWA 3NWKA 5FAXA 1YI7A 4FP3A 1Q3EA 1S0FA 1BMV2 1IHMA 1B35B 1N3OA 1O4ZA 2YYOA 4BHPA 4XF0A 3VDDA 1YXWA 2A3YA 3S7IA 3GHMA 2CYFA 1C1LA 4YM1A 3ZSMA 3WG3A 2AREA 3J4UH 5CFDC 3RYKA 2ZX4A 4AE2A 2IXLA 5DDJ2 2H0VA 4LBJA 1YIFA 1D0HA 4I0AA 3ME2A 5FLIA 3GYDA 1IS6A 3T1LA 4AHZA 2XVKA 2NN8A 4AWDA 3KMHA 1UMZA 1ASJ2 1S2KA 1YI9A 2D6MA 2DWRA 1CAVB 1QDOA 2GH8A 4AGGA 4IQPA 2EAAA 3WV6A 3AP4A 2W68A 2SBAA 1D2SA 2XLGA 2R1BA 2HKXA 4YW2A 1PNFA 3RG0A 4YZ1A 1U5YA 2PYTA 2P34A 1B35C 1DDLA 1NZCA 4FXGB 1ZBE1 1FI2A 4AVTA 1O7FA 5JZGC 2RS32 3AJYA 3E5XA 5FLHA 4CDWA 1PVC3 1ULCA 3FX3A 3VKMA 2R1DA 1OFSA 3JUUA 1EV13 5BNQA 3O0XA 3OBTA 1LR5A 4GB31 4LO5B 3OGJA 2MEV2 4CP2A 1BBT2 2HWB3 2ZGMA 4NWWA 1LGCA 3H1WA 1ZZBA 1POV1 2GN7A 4H14A 1I1EA 4JDOA 3AMPA 3ZYIB 5K8SA 3AXEA 1G9BA 4HPKB 1GBGA 1W6QB 1QJX1 3TRSB 2QDNA 3MEPA 4WM7A 3AZVA 5DZEA 2A6ZA 3CEWA 1RUH1 4WVMA 4KWKA 2WSVA 2YXSA 2UYAA 3ZN6A 5A32B 5CA6A 2A70A 4JGZC 4XJWA 2FZ1A 3VKOA 2ZX1A 4Q0PA 2PHWA 4YZ3A 4GALA 2V09A 1Q8PA 2AH2A 2RJKA 3T2TA 5CU1A 2E7QA 5FRAA 2F4PA 2MPFA 2VMIA 4AVBA 1ZBE3 1ND2A 3WR0A 3NV2A 5GZCA 1YIPA 1CVNA 4Q4X1 5T5PA 1LGBA 2A3XA 3T1MA 1PVXA 2YDEA 3N3HA 1MACA 3MLLA 4Z2WA 4RQPB 5BUVA 4GB33 5GLUA 4MGIE 1XNCA 5A33B 3BOPA 1VBB1 1RMU2 2OZ6A 3LAGA 1DZQA 1POV3 1V9U2 1DYKA 1U12A 2UWCA 5FTTC 2NMOA 2ERFA 1QJX3 1R081 3WUDA 1KRIA 3THPA 1FMD2 1AYN2 4ZXKA 3DN7A 1RUH3 5JSOA 1CESA 5GLWA 3H3UA 2EA7A 1ULEA 2GNMA 2O1QA 2JENA 2BVVA 3ES4A 1JUIA 4X6RB 1W2UA 2DCJA 3IKWA 2HWD1 3NAPA 5CFDA 2D5HA 4RQPC 3PNAA 5KHJA 5CB7A 2WT2A 4IEVA 4WM8B 1QXJA 4IEOA 1COV1 4YG0A 3PMSA 3KT7A 3A0NA 1LJ7A 2VOVA 5BNPB 1LHNA 4XXPA 2MNGA 2WNEA 4Q4X3 2DFCA 4AI0A 4M01A 2ARBA 1DQ4A 2X53S 1QH7A 1AR92 4DXZA 3NKGA 1Q8QA 2Q1MA 4MXWA 1UD1A 3WCRA 1XXNA 5KXDA 4LE3A 4FSJA 1YJLA 4AVCA 4FCAA 1ZZ6A 4FT8A 4XMIA 5I0TA 1OFNA 3CL1A 1VBB3 3ZYJB 3WP3A 5JZGA 4FPJA 3SH3A 1JW6A 4PLOA 2VVEA 2N7GA 2ZPXA 2HEYF 4EROA 3EJKA 2BBVA 4PCRA 4LBQA 5LK7B 3WDUA 1R083 1SACA 4AVSA 4C0BA 4NHLA 1C8M1 2BNOA 4WM8C 2VNGA 3S30A 5J36A 3TB0A 2R041 5IK4A 4XFAA 1FATA 4CYDA 5BNPC 3KCYA 4M3CB 4E2QA 5BYNA 3UKNA 2Q1ZB 2DUOA 3VBUB 2HWD3 2EXIA 4LO8A 4OI2A 5BY5A 2WJSA 1S0CA 1NCRC 2DCKA 4EN9B 4R4ZA 1COV3 2QZ3A 1OSGA 2VU9A 4LTAA 3E6BA 4LEJA 2VY0A 4JGZA 1QJZA 3AZZA 1KQRA 2YHJA 1LCLA 4CEWA 3JU9A 1J3PA 5D8AC 3A4UA 1VBE1 5FOJB 2D44A 3VBHB 3AKQA 5J37A 3VL9A 3AKRA 4PIYA 4C91A 1GZ9A 2JG9C 2R49A 2XGXA 4IETA 1RUNA 1IS3A 2BGCA 5I0RA 1RHI1 2X5IB 4RHV1 4QQOA 3DGTA 3JD72 3VBUC 2B7YA 3ALQA 4HKWA 4PLMA 1QJU2 1QXRA 1SLCA 3A0KA 3MI8A 1C8M3 3JQWA 3UJOA 1RUD2 2R043 1BK1A 5I8YA 2PLV2 2XKOA 4MZUA 3BODA 1V70A 1W0OA 3OY8B 2DURA 3USUB 2W08A 2WKKA 3B3QE 1ULDA 2EIGA 3HR9A 1C3HA 5L73A 4FOQA 4CP1A 2TEPA 5LK5A 5H9QA 1AR71 2RS51 4QM9A 2HYKA 4ISRA 4B4QA 1VBE3 2Y26A 2Y0IA 3IBMA 1JYIA 3U07A 4DNYA 4DB5A 3H0OA 1J3RA 1Q5OA 3VHOA 3ZYPA 2VW2A 2GN3A 3WG4A 1V6KA 3WDYA 4CZSA 1HQNA 3BB6A 2FBEA 2B46X 1RHI3 3H1YA 4I2OA 2ZABA 4MLOA 1VB4A 2OYZA 4A7ZA 2B42B 4XIOA 1Y3TA 2XKPA 4RHV3 4R9DA 3SCHA 3RS6A 2UWBA 3DV8A 5E8AA 1LOBA 3RI8A 1OMIA 4RS5A 4ZU5A 5L7OA 3DL3A 3MIFA 1HRV2 4LO6B 5EXOA 4BMEA 4UW5A 4XFCA 2FQPA 5LRSA 3OYWB 4OI0A 4N53A 5T3NA 3EO6A 2ZBJA 4IEYA 1O91A 1GZWB 4AFBA 3MIBA 1RINA 1XRUA 3CF6E 3KD4A 1AR61 3LB9A 1G9CA 1ZRCA 3U10A 3V56A 1MQTB 1HRI2 4HANA 4XJUA 3IDBB 3O0WA 4AYUA 2QKDA 4Q27A 3OTFA 1AR73 4A7KA 2RS53 3V0BB 2D97A 3VBOB 4IEXA 2R062 2BWAA 5EJ3A 1OA4A 1NCRA 2BTVC 2LALA 4Q0VA 4LBMA 4FPOB 3PVNA 1D4VB 1LESA 2ZA9A 3VKNA 4CDUB 1S0DA 2ET1A 1E57A 4W6YA 1LTEA 5T5LA 2CL2A 5JI7A 5D8AA 2LUWA 4HETA 4PIXA 2KXLA 3M3QA 3RNSA 4AF9A 2DVDA 1JYCA 5FO9B 4XBNA 2JG9A 5EZWA 2GC2A 4P9YA 2AYHA 4AI3A 1MS5A 4B3NA 3WHTA 4XFIA 2DFBA 3J8F1 5F6KA 2JKBA 3E5QA 2R072 4YYOA 5LEJA 1X82A 5KXEA 2GALA 3HQXA 4QPIC 1AR63 4HK9A 3WX5A 4YW3A 5BNNA 1LHOA 1HDKA 4CDUC 4IV1B 3OGGA 2ZGNA 3ATGA 4QD2A 2JD4A 1DG6A 1PZ7A 4OUSA 4M0NA 4I3GA 1NXMA 1N3QA 3AFGA 1UKGA 3VHNA 1CD3G 1UAIA 3RDIA 1FV2A 2OA2A 4P9XA 1S1AA 3BCWA 5FBZA 5JOYA 1MZEA 3LOBA 4XILA 1PNGA 3JBG1 2DV9A 4Q0UA 5JMCA 4O9GA 1GQHA 3RI9A 1PIV1 3WW2A 4YARA 4Q4V1 4Y1VA 1SBFA 3THTA 1VIWB 4XJZA 3AK0A 1RVF2 3KLSA 4MXVA 1ZA4A 2W0XA 1MEC2 2K2SA 4D3WA 1GNHA 2GMMA 4LBLA 4Z07A 4JRLA 4IEQA 3J8F3 2TBVA 3K51A 4BIOA 3M7AA 4AXOA 1GV9A 2ARXA 3U4XA 4FO9A 4HZFA 1HIXA 2BFUS 1AJOA 4XTPA 4TZDA 1MS8A 2G9GA 1VBA1 3AMNA 1U5IA 3QH6A 1CONA 1YWKA 1X7NA 5E89A 4NN0A 4LHLA 1K5MB 3ZPYA 1FPN1 5ABJA 2A75A 2I45A 2XJRA 4K6BA 3VV1A 2NM1A 3ZXDA 4JDMA 2UU8A 3ST7A 3UJQA 1IKQA 3OCPA 4KBBA 1PGW2 1W0PA 4HBNA 3VZNA 1RUF2 3PHMA 2WLQA 4YVWA 3JBG3 1PK6C 4HSJA 1QNYA 2NQYA 4Y20A 3FC0A 4EV0A 4AFCA 3M4FA 1PIV3 1RUE2 2QDRA 4Q4V3 3WXPA 1SLLA 4LR4A 2DU0A 2I07B 2E51A 2QNKA 3HWJA 1KS5A 4QQLA 4HFSA 3I54A 3WINE 1SQ4A 1OOPA 4LO4B 3WQ0A 3WDVA 2NYYA 4COVA 3VDDB 1ZZ8A 1XU1A 1R091 1RUJ2 3AFKA 3ILRA 3ZSKA 1PGL2 4W65A 4A3XA 4QU2A 3J9SA 4QPGA 4DZGA 4GH4A 1FNYA 3IDCB 2PHDA 2A71A 5DG1A 1VBA3 2NLRA 4FTSA 3MLKA 4A7YA 2WL1A 5ACA1 5JPNB 4JAAA 3TNQA 1FPN3 4R9AA 4URTA 4GKYA 2UY9A 4XF9A 1O4YA 1WMFA 4QPIA 2R6QA 4P9GA 2B45X 1EAH1 3I59A 2PQQA 4AVAA 2C0ZA 3U11A 3VDDC 4L92A 3ZIWA 4CDWB 1SFNA 3W59A 1V00A 1GFF2 1OQDA 3B93A 1YYNA 2VQAA 3LA3A 4BOWA 1ONAA 3AYCA 2ZKLA 4IEWA 1EPWA 3EBRA 1UPSA 4ZU7A 4MVTA 1ZREA 4HSLA 5FMOS 1NA1A 1R093 3D0JA 4F83A 2ZGRA 2EXKA 4WM7B 5EWSA 4D69A 1HV1A 2WT0A 1O3TA 5FLJA 3ILFA 3VLBB 1ZBA1 4LLOA 3EQEA 4WVMB 3ZN6B 1WMDA 5ACA3 2D3RA 4XQWA 2DTYA 4KG8A 2NPIA 1H9WA 4AEDC 4DY3A 3C3VA 1CAXA 5BNOC 4BPZA 1VP6A 3ZXEA 3GBGA 4Y5Z0 1OI6A 1AR82 1EAH3 5EV7A 2YV8A 3V0AA 2PA7A 1BQPA 1ND2B 3HD8B 3RWNA 5T54A 1KFUL 1S0GA 1H4GA 3H7YA 4YGBA 3RQ0A 1R1A1 2ZX2A 1TNFA 2ZGQA 1ZRDA 2G4IA 4X8NA 2FMDA 3R0RA 1LOCA 2XLAA 1LRHA 4JDNA 3I8TA 1NLRA 2R0HA 1PK6A 1SLAA 3TWIA 5IK8A 1RUOA 1S55A 3ELNA 1JBCA 2GC0A 5JVVA 1J1TA 2JG8C 4HL0A 3WZ1A 5AFBA 3UK9A 2ZX3A 1X8EA 1UU6A 2Z69A 1V6OA 3RYPA 2HWE2 3B00A 4L99A 5JOWA 4ES8A 2A6WA 4LLFA 5C4WC 2RJLA 3K48A 3OBRA 1H2MA 1ZBA3 1OQEA 1H2LA 1ASJ1 2VXRA 1ULGA 4QT6A 1G8WA 2Y0OA 5T50A 3ZSJA 3AKTA 4RA0A 4YFZA 5CFDB 1WA4A 2PAEA 2VMGA 3CU7A 3TBDA 3WNXA 3VKFC 4N43A 1YHFA 1UIJA 1VBD2 1ZZ7A 2RS31 1TNRA 1ZRRA 2YZ4A 2UURA 3P3NA 3BU7A 3GALA 2BFUL 2ZGSA 3DF0A 1R1A3 2ZX0A 5I91A 1H1MA 4X6QB 3I2DA 4MXWB 1V6MA 1N1SA 2MEV1 1NG0A 1ZX5A 2HWB1 2QJVA 1BBT1 3H3ZA 5AFEA 3NV4A 5JZGB 1UU5A 4YSFA 3WUCA 1D2QA 1Z7S2 1LHWA 1AHSA 3AP6A 1RUI1 3NAPC 4LBQB 3ZXKA 4TYSA 4KU7A 2PHFA 5JOXA 1WW7A 2JE9A 4G9SB 5KHGA 1DBNA 4OI4A 4JTNA 5IK7A 1RB8G 4S2FA 3VBRC 4E27A 1MZ5A 5KHIA 4RFT0 3VGIA 1NY71 4ASMB 3ZFEC 4IESA 1ASJ3 5BV6A 4OZXA 2D6KA 3MIGA 4META 5I93A 4Q0SA 3APBA 2O8QA 1VR3A 4FPHA 2CGNA 5AVPA 2RS33 1WLCA 3GHNA 5K0UC 4CEWB 4JGZB 1KXGA 2ZS6B 4AEDA 2GNDA 2GAUA 5BNOA 4AI8A 1PZ8A 3MGUA 1AYM2 4HT1T 1ENRA 2W52A 2JX9A 2MEV3 3OY8A 2WNVA 1BBT3 1SCRA 4GIQA 1RMU1 3ASIA 3FUQA 1OQ1A 1V9U1 2ZZQA 2F6BA 2HEVF 1CPNA 1QU0A 2DUQA 1PVC2 2WQ4A 3WDTA 1CAWB 1YRZA 1RUI3 5IK5A 1FMD1 1AYN1 3VKLA 1BKZA 3AJZA 4JGYC 1PO22 4DRVA 5T5JA 1TQ5A 4CEWC 1Q8SA 1F5FA 5SV5A 4KH9A 2JG8A 2BYVE 3AP5A 3B5LB 1RGSA 2VECA 4Y22A 1W6MA 4NWVA 1EYBA 3AZYA 1X50A 4P9IA 3VZMA 2YMZA 2R0FA 5C4WA 2VQ0A 5FMOL 5CBLA 5FCCA 5AC92 1IGOA 1WD3A 1YFUA 4XJ8A