5J37A

Crystal structure of 60-mer bfdv capsid protein in complex with single stranded dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
FSTNRIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFALDDFLQAVPNPHTLNFEDYRIKLAKMEMRPTGGHYTVQSDGFGHTAVIQDSRITRFKTTADQTQDPLAPFDGAKKWFVSRGFKRLLRPKPQITIEDLTTANQSAALWLNSARTGWIPLQGGPNSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFRQFAPNNPST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beak and feather disease virus capsid protein
publication title Structural insights into the assembly and regulation of distinct viral capsid complexes.
pubmed doi rcsb
source organism Beak and feather disease virus
molecule tags Virus/dna
total genus 36
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.950 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j37A00
3R0RA 5J36A 5J37A 5J09A 3JCIA
chains in the Genus database with same CATH superfamily
1HB3A 4E8DA 4BJ0A 4W6WA 3WP4A 1NXD1 2QVSB 3BTAA 4LE3A 2A71A 5F39A 5A7WA 3VBSC 4CUCA 3NNMA 2JX9A 1LOCA 5C71A 1VAVA 4S2GA 4A2UA 4Y26A 3ZXEA 5E16A 2RR13 2ZHLA 4COZA 5BNOC 4XBLA 4LIVA 3H9AA 2HWB2 3AMNA 3AL5A 1CAWB 2Q8EA 5KXDA 4M3CE 5FZAA 3ACLA 5HCHA 4YW2A 3JB8A 4K6BA 3PU3A 5FO8B 4B7EA 1GQHA 3DKQA 3OYWA 4IEOA 4QU2A 4X8PA 3WP3A 3ZXKA 3S5QA 3ZX7A 3IIIA 3IMNA 1ENQA 4CDWB 1FPN3 4TZDA 2LS6A 4IV3C 3DN7A 3SNMA 1KITA 2P1BA 3WW3A 3VZKA 4AI3A 2JDYA 2VM9A 4B4RA 3K3NA 4N7IA 4CCOA 2P6HA 2AEYA 1AZDA 3AMMA 3BODA 2R072 2VZRA 4BU2A 2RMU1 2J1TA 4AI2A 3IZOA 1RUJ2 4EZHA 3LKJA 4N53A 1H6YA 1BCXA 1VBB1 4GJYA 4NHXA 2GC2A 1H4GA 4BQWA 1JW6A 5J1XA 2YZ4A 1W9YA 2VNGA 5IWFA 3IT8A 2YPDA 4KWLA 3PIGA 5JZGB 3OUIA 3GJAA 4RD7A 3SKVA 3N7MA 1RUJ1 1C5HA 2VY0A 4AE2A 5FXZA 3UKNA 1CZVA 4HKWA 5FMBA 4HXCA 3LAGA 4XPVA 3RZLA 3GM8A 3MLKA 3WDUA 1K5MB 1AR81 1DZRA 2DFCA 2TUNA 2A3YA 1WA6X 2J1SA 2P34A 1COV3 3WINE 4I2OA 3A23A 2ZEYA 1S0DA 1ZREA 1N1VA 4KBZA 3RI8A 4HG6B 1YQ2A 2Q8CA 2Z2SB 2BNMA 3GBFA 3Q9OA 4ARXA 4KQ7A 1TMF1 2P2KA 3AJYA 2CSGA 1O8SA 4LKEA 2OUHA 3A4UA 2VW2A 4JCKA 4DS0A 3B9IA 3B7MA 2A3XA 2W91A 1S0BA 3T1LA 1WBFA 2G9FA 4F83A 2RDNA 1OKQA 3PVNA 4DY5A 2VR4A 4QKDA 2WZPP 5FQ0A 4C8DA 2W3JA 3GGLA 2WFF1 4XACA 1AXYA 4XBNA 4OHZA 3KVBA 4HANA 3IKWA 4NIAA 4JC1A 1PGL1 3VDDC 4IEPA 4HN0A 1OFSA 1OI6A 2B9VA 2JDAA 3AKSA 3VZLA 1AL0G 3JBG3 2W39A 1LU1A 2WL1A 4JGYA 4MV2A 1MQTB 1W0NA 3HOBA 3A0KA 3OBZA 4XAEA 4XDOA 4TTGA 1M06G 1JYCA 2F17A 2H0VA 2WUHA 2ZGQA 4ET7A 4JKLA 1QOSA 4UW4A 4DINB 1VJ2A 3N9OA 4KGGA 1EAH2 4WM7C 1CPMA 3ENRA 2E9QA 2WWUA 3H0OA 5FMCA 4KL1A 3DL3A 4UFHA 1MVEA 1O4YA 1VAKA 1WGPA 2FDJA 1BKZA 1FMD3 3LPGA 5CB7A 2FDKA 4XCAA 3DECA 1QJY3 3GDBA 5KWRA 1N1TA 3EQEA 4META 5GLWA 3SCHA 4FPFA 2HWB3 3K3OA 1GUIA 4N43B 1GP4A 4COYA 5C4WA 1IG0A 3WV6A 1I1EA 1LB2A 1Z7S1 4UT5A 4JGZA 2WN2A 4X6QB 4GMP0 4GA9A 3OUJA 3ST7A 4EROA 1QHDA 4RYDA 1UAIA 2XL9A 4OHXA 5I0TA 5C3SA 2JE9A 4BLIA 3VN4A 3WG3A 1OUSA 4M4PA 1Q8OA 3K4AA 4Y22B 2VE1A 4CU7A 2VH9A 4B1LA 1W0OA 4EN9B 2XG3A 1H9WA 2RS53 4M0NA 2D3SA 2WQ4A 1VALA 3ZKYA 2W9XA 3I2GA 1V0AA 4PLOA 1C1FA 2VCBA 2XVKA 3EBRA 3H1YA 4FO9A 1CAVA 1IPSA 4AR2A 5F3GA 3JXSA 4AGGA 1JH5A 3VBUC 1HB2A 4QB1A 3ZYPA 2GC3A 1DF0A 5JCTA 3AYEA 1LHWA 3R05A 4XF9A 1H8TA 5LY2A 5L73A 1AYN3 2JIGA 3GZAA 2IVIB 3HQUA 1UCXA 1W8HA 1PX3A 3MDPA 4CEWB 3NWKA 1OLRA 1URXA 3O1OA 2WO2A 3OOXA 5BY5A 3V0AA 1UX6A 2E6VA 2UYBA 3VHRA 4INDA 3E1F1 5A1AA 2CDOA 2G4IA 3G6JB 5FYBA 4AL9A 2XHKA 1VBC2 5A6QA 1CAUB 2CGPA 4E8CA 1KEXA 4Y1VA 5FY5A 1DDLA 2JG8A 1SCSA 1YEWA 4TN7A 2CAVA 3ZSJA 3FMGA 4DB5A 4GWNA 5F8PA 2WWJA 3VBSB 1GOFA 1CPNA 3NAPB 4MVTA 2R063 4Q8LA 4TLFA 3WF2A 2RS31 3W5MA 4HT1T 1DGLA 4LBOA 2ID4A 1MS1A 2PHXA 3PUQA 5FXXA 5AC91 5LCWL 5EPAA 5BNOB 2VVEA 1OHFA 3U1XA 2A75A 1DQ2A 4BM8A 2NMOA 5EQUA 4IGPA 5GALA 5JOYA 2JG9A 1HQLA 4I0AA 1PIV2 1VLNA 2P3KA 2PHLA 4FOQA 4HPKA 2VL4A 4MYEA 4CDQA 2ZKNA 3RZHA 1KQRA 2I2SA 1R1A2 1BMV2 4FPEA 1EAH3 5ACA1 1PIV1 1H1AA 3T3YA 3VL9A 4OI1A 3BTYA 5IAVA 1PMJX 1UL9A 1UY4A 3PUIA 3NKTA 4FPLA 5A32B 4BDVB 5BNNA 5C8CB 2MEV1 3M7AA 4H7MA 1QMJA 1V70A 1MS9A 1EY2A 5FZ8A 1ULPA 2I07B 2VZVA 5F5IA 4W65A 3WNOA 3RZKA 4YVSB 4OZOA 4N9HA 4XIKA 3PIJA 4V2VA 3DXUA 1NT0A 4QT6A 1GOHA 1POQA 2CGOA 3WF1A 1MVQA 2CNAA 3VL8A 5FZFA 4FI9A 1XPWA 4XFCA 4QWNA 1NA1B 3FLTA 4KGQA 4RR3B 3WDVA 4AVVA 2EXJA 3TEXA 1IGOA 1LHNA 3ZSLA 1QQP3 3I2KA 1RUC2 1QH6A 2DVGA 2HLEA 2WZR2 1HJFA 4JRAA 4KG8A 4BE3A 2AZ5A 1UOFA 3IB3A 3ACHA 3ACGA 2WO1A 3N4MA 3H7JA 4KG0A 1JHJA 4DXZA 3QBQA 1FAYA 3VZNA 4YG6A 4EYUA 2WZR1 5KXBA 3L9JT 4IEZA 5A80A 3RWKX 1NQDA 4ZPIA 1POV0 2ADDA 1MS4A 4WVMA 3NO8A 3PL0A 4GMP3 3KV9A 4BQ3A 2X09A 4FPOB 3A7QA 4FFIA 3ZYFA 1V00A 4U36A 1HQNA 3O1VA 3J8F3 2FDFA 2X8KA 3THTA 1JOBA 1WD3A 4JDMA 2X29A 1NLRA 1RUOA 3VDDB 5JI9A 2CY6A 2WNEA 4XQDA 1W8NA 1TNFA 3IM0A 2F6BA 2G1MA 3FBYA 5CZKA 2C1FA 2ZGPA 3WNMA 4GKYA 3O5SA 1BEV2 5I0DA 3VZJA 2VBBA 1VB2A 4DUVA 1ASJ1 4QXKA 3MYXA 3WQBA 3ACIA 4FPYA 4LHNA 3UJQA 4OLLA 1H1IA 3V56A 1W2NA 5C7GA 1NZIA 1F31A 1IS3A 1V6KA 2WDBA 5AVAA 2VZQA 2ARXA 4M3CA 3M3CA 4WM7B 1W8TA 1SLIA 3VZOA 5KHJA 4PF1A 3WCRA 5LATA 4P9JA 5LBFA 2IWGB 5C5TA 5EJ3A 5LRRA 2CHHA 1W6PA 2KM2A 2YC2A 4AI9A 1U5YA 5J96B 5LA0A 2ARCA 1AXZA 3AVSA 4R4ZA 4Q4W2 5JDBA 1SBDA 4XF4A 5CG8A 3CLPA 3N36A 3A21A 4NN0A 4QKFA 3RFRA 5J48A 1ZBE2 2WLPA 2ZOEB 3Q8CA 4IERA 2BZDA 2BEOA 5C8WA 4PIXA 2ZGLA 1LENA 1LOFC 2WNUA 1UXXX 1W6MA 2ZTNA 2RE9A 3J26N 1RUF2 1GNZA 3J4UH 3I3BA 2WNOA 1W99A 2ZGRA 1HXS1 2J22A 5H9QA 1HRV3 1F4HA 3KM5A 2XONA 4PHZA 3BI3A 2J1EA 4I01A 3KV6A 2YROA 2C9AA 4GWJA 2Q1ZB 1RC6A 1NZCA 3D0SA 1DYOA 2QQKA 3VBOC 4MHUA 2BGCA 4PF5A 1JYVA 1Q8VA 2VW0A 2W0XA 2PYTA 1LECA 2R49A 4HONA 2K0GA 4RGKA 2SBAA 3DYOA 2YBKA 1OKOA 5LW9A 4B7KA 2P3JA 4J1WA 3VBUB 2DCKA 1YJKA 1LULA 1ULFA 1XU1A 3B00A 2AENA 3OSDA 1W03A 4OHWA 4OUEA 2OPKA 2Y33A 2VNVA 2VECA 2ZA9A 5IATA 3ZFEA 1JI6A 4CU8A 1V6OA 3HQRA 4QPGC 4UFJA 2OUJA 3JD72 2Y6GA 4AOCA 5ABJC 3ZPYA 4YRDA 4D94A 4MXWA 4E4DX 3ACFA 3WDYA 3LEMA 4RFRB 1HKDA 1MEC2 4UF0A 5FP7A 2WN3A 2PHRA 3OJBA 1UY3A 1LEMA 1ZBA3 2CWMA 4A6SA 3AZWA 3U4XA 4BHPA 5DAXA 1D4M2 3UETA 5K0UC 3DPRC 1VMHA 4UW6A 1PGL2 5CFDA 2VCMA 4EJRA 2VJXA 1DCSA 1SQ4A 2UWBA 2ZPXA 1L3JA 4UAPA 5D8AA 1XE7A 1XRUA 5EZWA 4AHZA 3SHRA 4Q8KA 2WWSA 3MIBA 3RMXA 5CFCC 2E32A 5J98B 2QE3A 1W0PA 1AR92 1UMIA 2CU5A 2VW1A 1GP5A 5T54A 1X50A 3K4DA 1Q8PA 3SEPA 4B1MA 4YNIA 2C24A 1XQNA 1AR73 4LBQD 2D6KA 2HWD1 3FL7A 3NNFA 4XZUG 2R043 4MGTA 3GNEA 5DDJ1 3CBNA 3JU9A 4CCNA 2VZTA 1RUI1 4AAXA 1GBGA 4LOTA 1Y7BA 1GOGA 3MGUA 3OD4A 1U5IA 2IFWA 3KT7A 4H7LA 1POV3 4XTPA 4BLJA 3VDCA 2O14A 4EWAA 1PM7A 2JIJA 4HKOA 2WS93 5DPNA 1JU3A 4LNVA 4C0HA 1QIQA 5T3NA 4R52A 3TN92 4GULA 1DGWX 2N7GA 3PUHA 3T4HB 4PCRA 4XFBA 1NCQB 3ZYHA 1FNYA 2Y6JA 4F3JA 3KF3A 3SKJE 4OI0A 3ZO0B 5JMCA 2Q8OA 1UQXA 3KF5A 3OUHA 4A41A 2PQQA 1RHI2 4HBNA 3T2QA 3ZYRA 4DRVA 1WW6A 3VD4A 1QH7A 1G9CA 1QF3A 2E53A 2J42A 2L9LA 1SLCA 2VBDA 3AKQA 1MZ6A 4HSLA 2O8OA 3C7OA 4FOVA 4URTA 2XQRA 2QUOA 3ZDVA 3EXUA 4KH9A 3CQOA 2XL7A 4QX2A 3LEGA 2D6NA 1IPJA 4L97A 2WNVA 4IEYA 4TSVA 3ATGA 4CSWA 4LBKA 4LO6B 1DFQA 1SZBA 1XYOA 4IEXA 3U37A 3WNLA 2VPVA 3FHAA 1Y4WA 1IG3A 3ROUA 2AEZA 1F8VA 4HOOA 1W8OA 5JOXA 2VTXA 1ZA4A 1GWKA 2VGDA 3AMHA 4PI0A 5FMDA 4D7SA 1EV11 3HNBM 4IDZA 1S0CA 2WO3A 2TEPA 3A22A 1XB9A 2OVUA 4PIZA 2EICA 1UKGA 4LBMA 4CDXA 1WWYA 4UBGA 3LEKA 5FOBB 1CJDA 1DGRN 2VULA 1ZZCA 2DUOA 1NCRA 5LEJA 4Q4Y1 1JHNA 1SFNA 1SLBA 2JDUA 1HRI3 2VCCA 4LBQA 4D8MA 1IKPA 1GZCA 3VKMA 1RUE3 2E7QA 1O4ZA 3I59A 3POIA 1MZFA 4W4ZA 1ZRIA 1RL3A 2YC0A 4NRPA 1RUD2 1UIKA 3OGVA 1FOD2 2P4EA 5F1RA 3I2DA 3HMYA 1CVNA 1AYM3 1EP0A 1LAJA 1AR62 3O1RA 4PJYA 3WDXA 5CKMA 1RUD1 1JZ2A 1Y3TA 3WVJA 4MGSA 4BH9A 1RITA 1QJX2 3GHNA 4ZS3A 3HEIA 5FY9A 4XVHA 4CP9A 4BIOA 3ZPOA 5FFOC 4CDWC 1AR61 2RS12 1C8M2 4JKMA 1IOAA 2E31A 2HWF3 2XWBB 1J3QA 3J7LA 4Z07A 1AL22 3Q8BA 1PZ8A 2QQJA 3BGAA 4XF3A 1HN1A 2WT2A 2GDFA 4LOSA 4ZKTB 4CXYA 3AP5A 4JX0A 2OQ7A 4AEDA 2YXSA 5CEHA 5LK7B 1ZRCA 1S0GA 2JDKA 1R091 1YIPA 4G3YC 4QDSA 5FZ9A 3WSOA 4YZ4A 4YVWB 3K2OA 3SQOA 2LTNA 1XSRA 4P02B 5CADA 4ZONA 1O4TA 2OIIA 4Y20B 3RZJA 3V64A 2Q1MA 3U10A 4AI0A 1ND3C 1VMJA 1JYTA 5FBJA 3FUQA 2XWJB 3D0JA 3KT1A 5ISLA 3PLQA 5F6KA 1QWRA 1W04A 3D4KA 5IVYA 3WD5A 1W6OB 5A1FA 4Y1YA 2WR9A 3POJA 4B4PA 3O1UA 2BFUL 2QQWA 1GANA 5CBLA 5FR3A 3KZ4C 1PO22 4JQRA 4GALA 5L9BA 1SLTA 1OLQA 1DZQA 2DFBA 2XJVA 4PDWC 1HB4A 3CZUA 1K5MC 5EHDA 2YFUA 3PVBB 3ON7A 2WRAA 2A6VA 4FTSA 3NSTA 1G6NA 2VMHA 1UF2C 4EN0A 3MW2A 2YC4A 5FY4A 4I3PA 4LIUA 4ATEA 4LORA 1DP0A 4YG3A 5E1RA 1WA4A 1NLQA 1GZWB 3WG1A 1DIWA 1KFUL 2FMYA 1UD1A 2VVDA 1OQDA 4BB3A 1CAXA 4XOGA 4OHYA 1H4HA 4EE2A 4K40A 4P9IA 5FZDA 4QGMA 3ZOIA 4XHXA 5L7OC 2R30A 4FOWA 3OGRA 2RR12 2DDUA 4P00B 5B4XA 2D6PA 1DQ4A 2DV9A 2GZWA 4NIHA 4MG2A 3B02A 1J1TA 2NN8A 3W21A 4Q27A 3FWEA 1LTEA 1SLAA 3DPRB 1MQTC 2VTXJ 2WKKA 3P6BA 4NAOA 5CFCB 1IQAA 1FPN2 1ND2A 2X5IA 1GMMA 2W52A 3LZZA 5IVEA 3VKNA 5BPXA 5H9SA 1C8NA 3NW4A 2BV4A 2XLAA 4D7YA 3KCYA 1WMDA 4KWJA 1XU2A 2CTVA 1PNGA 2PLV3 3WG4A 4F8AA 4YW4A 5JIAA 1AJOA 4IE7A 2W2IA 4Q4V3 5FYCA 3T0DA 3PHMA 5BNPB 3T0BA 5FUIA 1H2NA 4YGBA 5A7QA 4AYUA 2BNOA 1KDKA 1PVC1 4JQTA 4N43C 3ZYGA 3AP6A 2VXRA 2YY1A 2FDHA 1R083 2WA4A 1E5RA 3LF7A 1BZWA 1MZ5A 4JKKA 4CCCA 4UFIA 1WD4A 1YHFA 2AREA 2RS13 3WEZA 3ILNA 3BYWA 2JD9A 5JOZA 3M2MA 2BFUS 5JXJA 1MR5A 3ZMOA 2DVDA 4Z82A 2FCVA 4PQQA 2WA3A 4BQ2A 1PZ7A 1COV2 1WMEA 4W6XA 5F2WA 1WBLA 4A4AA 2XBO3 5J36A 3M3OA 3QACA 1YQ6A 4KNCA 1VBD1 1RUG1 4N53C 1ZX5A 4G4FA 1REDA 2W1SA 5JZGA 3POFA 4MH0E 1LHVA 2AGSA 3TWIA 4PT6A 1CESA 3CJIA 2UU8A 2VCAA 2VO5A 3FJSA 3OGGA 4QGLA 1PO23 2XQXA 4NVPA 4WVVA 3SLIA 3FHQA 1SPPB 3U14A 4CEWC 5T52A 1J84A 4DXTA 1UPSA 5HXMA 1W2AX 3O7OA 4YM3A 3VBFA 4H55A 4QX5A 4AG4A 3JBG2 3ZN5A 2Y64A 5JSPA 3BKZA 1ODMA 4KI5M 3R4DB 5FZ0A 2PFWA 1VRH3 1QXPA 2ZACA 1PK6B 1Q5OA 3OEAA 4QXBA 5IJRA 2RDRA 5FZOB 2YHJA 3VBRC 4BISA 3AP9A 4BPZA 4WM8A 1O3QA 1YRZA 1CIWA 3KHBA 2A6ZA 1Z0HA 1O91A 5DQ0A 1J58A 4XEZA 1K3IA 3NAPC 1IPKA 1FMD2 2V4AA 3MIDA 4ZU7A 2VQTA 4FFHA 4HSJA 2W68A 1QJY2 5FWEA 3BTXA 4JHTA 1OPOA 1W6QB 2YYOA 5CAZA 3KLSA 4RHV3 3HN1A 1UY1A 5BXXA 3ZXAC 3KMHA 4CEYA 1GZTA 1OOPB 1I5PA 2FZ2A 5FMOS 5LRSA 2ZKLA 1ULDA 2B5HA 1OC1A 3KD4A 4HN1A 5FZCA 1QKQA 1RIRA 3RSJA 2O1QA 2NQYA 2HWB1 5JVVA 2H6CA 5ANNA 2BTVC 4PBOA 2YPJA 1LJ7A 1CQ9A 4YFWA 2Y6FA 3VB9A 4YZ2A 1B35A 2GNMA 3JB4C 4RS5A 4COWA 3UK9A 1VIWB 5CVRA 1UY0A 2RS52 3NV3A 5APAA 3PVOA 5C8CC 1TME3 4BIFA 4O7XA 1C28A 4NRMA 1ZRRA 3UGGA 4P9XA 2NZ9A 1SACA 4QQHA 4Y24A 4YVSC 1DYPA 1ND3B 2J1AA 4D7TA 5F9TA 1LODA 2RS51 5FUPA 4OVEA 4CCDA 2R071 5H9PA 5C4WC 5D1IA 3OBAA 1N1SA 1PMHX 3VD3A 5KC6A 4QPIA 1SFPA 1AYN2 5T5LA 4LHLA 1NA1C 4DUWA 4RR3C 2V09A 5EYYA 1LU2A 3MPBA 4ASLA 4F7ZA 1PO12 2ZGTA 5JAXA 1QJU3 3VHNA 1SG3A 1V9U3 2A6WA 3CMGA 4PDWB 4QQPA 1TEIA 2E7TA 3HD8B 2O0OA 4Q2FA 1AX1A 4R9AA 4Q1PA 3ZIWA 2RJ2A 5FYVA 5A33B 3BB6A 2ET1A 3LIHA 3E5UA 5FBZA 1G7YA 2QDRA 2WFPA 3MV11 4WZFA 2GU9A 4L92A 1PX4A 3NMBA 3E6CC 3E97A 4Y5TA 5T5JA 3J7MA 4CYDA 4UXAA 3MZHA 2GP5A 5KR7A 3USUB 4M0HA 1AHSA 1AX0A 2SLIA 2R062 2DU0A 3RZZA 4ITCA 3BVCA 4IV1A 4UOJA 1W6NA 5L7OB 4QQOA 4OULA 1EYBA 4QDRA 1BVVA 5DZEA 1JUIA 3POGA 3VBHA 4QGNA 2HBTA 1N47A 4WBBA 1XE8A 2CV6A 3O0XA 3DXTA 1H8VA 3AZVA 1GV9A 3H3LA 4YARA 3DV8A 2MPFA 3POWA 3AMPA 1W2OA 4MSVA 2WQ8A 5I91A 4L9BA 2XJTA 3ITQA 3NNLA 3EYPA 2D6LX 4ZXKA 3VBSA 1IQDC 2HKXA 4DXRA 2ZEWA 5BNQA 1X33A 1UOJA 5A7WB 5A7SA 4WV8A 4AK3A 4AVCA 3WHUA 2XKPA 2B46X 2FCTA 2PTMA 2JDHA 1JYNA 1EAH1 4XMIA 2EIEA 2B7YA 2JDZA 3ZVXA 3CF6E 4YM1A 1SLLA 3I97A 3ZSEA 3GF6A 1KGYA 5FY0A 1LHOA 3D8CA 1RINA 4QD2A 1PGW2 5A70A 3BUCA 4IV3A 1HW5A 4MZUA 3IWZA 1ZZBA 1J59A 4QX1A 4TWTA 2DUPA 3U11A 5LBEA 1LHUA 4RQPC 1N1YA 2KR2A 3WNPA 1BBT3 1QQP2 1PGW1 4URAA 1ZRFA 4LXLA 1ZVFA 2RDQA 5LEKA 3V0BA 4UFLA 4I30A 1ZYBA 2J1UA 3J9SA 4Y4RA 3S7IA 3WDTA 1Q3EA 3NNGA 3HPNA 2FQPA 5F3IA 4R9CA 3TEZA 1QQP1 3H8RA 1IKQA 2JB4A 4N53B 1GNHA 3V65A 3O14A 2HWC3 2HWE3 4JDOA 1C5IA 4GB33 5B4NA 1OVPA 1RJ7A 1GLHA 3N35A 2FD8A 1FYUA 5FJKA 4K1ZA 2RMU3 3POSA 5FWJA 2XB6C 2QQLA 3J8F2 1PO13 1VBB3 4IXLA 4QMAA 1TVGA 5FPBA 5IVVA 3ALQA 3RGBA 1IS5A 2WT1A 3R4UA 3VGIA 4GMP1 5EV7A 3T08A 3RQ0A 2C6SA 4CA9A 2E7AA 2MNGA 3TBDA 1UMZA 3JUUA 3NJYA 3U0ZA 5C3RA 2IVJA 5A3WA 3ES4A 3ILRA 3J8F1 2VZPA 3T0AA 5GZFA 3WF4A 2ZGKA 4A7KA 4I3GA 1YIFA 5DZFA 3VBRB 5LA2A 2WJSA 1AR83 2Y26A 5IYYA 4R4XA 5LWBA 1VPHA 2UY8A 3VDAA 3AJZA 5I93A 4MO3M 3H8OA 1VBC1 2ZXQA 1JZ3A 4A7ZA 3TAYA 2XPJA 3OEBA 3VDDA 5FQ0B 3MW4A 3MI8A 1ZNPA 3BU7A 1XJAA 2DVAA 3OTFA 4TXWA 4G9SB 5LASA 4QPYA 3QH7A 5FY8A 4YWAA 4KU8A 4DEVA 1QDCA 4JGYB 2PAMA 1QXJA 4LKDA 4YW6A 1VP6A 3WUDA 2WFF3 3ZLIA 4XJZA 1JXNA 5L19A 1UZWA 1RVF2 3FN9A 3X29B 4WM7A 1JYXA 1F35A 4YM2A 1HRV2 1PM4A 3RI9A 3VBUA 3ZYBA 4AFAA 3O1SA 1YCIA 3WZ1A 4CUAA 2BGPA 2Q1FA 3WDWA 3AXDA 3FBMA 2QQVA 2BRTA 3HT1A 2ZHKA 2VMIA 1R1A1 1OXCA 1HRV1 2GC0A 1NCQC 1T2XA 1ULGA 1UY2A 4OI2A 1BMV1 2DU1A 5A7OA 1SHWB 3ZYJB 1BXHA 3RMYA 2JE7A 5E89A 4LHKA 5HXVA 5C4WB 1PGSA 1LR5A 1UO9A 4JGZB 4EZ4A 1S2BA 1OFNA 4K20A 3VD7A 3H3ZA 1UYYA 4B29A 2WABA 3PU8A 4ISRA 4BMBA 1XNDA 5JOWA 3LA2A 3CO2A 3LSDA 4IEUA 4A45A 2VZ1A 1WKYA 4XBQA 1WW4A 3WF3A 1Z7S3 4GH4C 1RTVA 5DAQA 1C57A 2XJUA 5JSRA 4XXAA 2ZZQA 1JZ4A 3DF0A 2QNKA 2VMCA 2YFZA 1W9TA 3IDBB 4QQ2A 4FPCA 4XUPA 1RUC1 2VMFA 1CAVB 1MPXA 1ZBA2 5CG9A 4S2HA 2XDVA 3WUCA 2X53S 4R9DA 2GN3A 1H1MA 2W08A 2I74A 1H8TB 2VXJA 1J3RA 2YBSA 5LA9A 1OD5A 3W59A 3HNYM 4CZSA 1Y43B 1H30A 1I5ZA 5IUQA 4W6YA 3LIGA 1DGWA 4GXLA 1UZZA 1AR72 2ZAHA 4NHLA 4AQ6A 2R042 3ZXJA 3AFGA 1P8JA 4LE4A 2Z79A 1ZZ7A 1SCRA 2FZ1A 1LRHA 5LB6A 3DYPA 1H6XA 2Z4FA 4XC9A 2JG8B 1AR71 4DNYA 3T2TA 4A6OA 4E4HA 1BEV1 1RUH3 2WSUA 5CIRA 1UXZA 2WS92 2WYSA 5DN2A 5GLZA 2W46A 3GHMA 1WMXA 1FV3A 2ZGNA 1POV1 1HV1A 1VBA2 2QZ2A 3GXUA 5FP4A 3ZIXA 2GNBA 1WW7A 1CN1A 2A70A 2IXKA 1S0EA 4LHSA 3AYCA 4XQWA 2B4KA 3O12A 1HX6A 2QZ3A 4YVWC 4XDPA 5CA6A 2A73B 2WINB 3AVRA 2RS33 1JZ5A 3WQ0A 4Q4W1 4IEVA 1O3SA 1RVF3 3JCIA 2Y38A 4HPKB 5AC93 2Z5WA 1ZBE1 4CDQB 2IFRA 2ZMNA 3OG2A 4DFSA 5DAWA 4IUGA 1G9BA 2BWAA 3I2JA 4RQPB 1H2LA 5FZBA 3SH5A 1UZ0A 3SXWA 4YLZA 2R0FA 1REEA 1RUF1 3T2PA 1C3HA 4IE6A 3WXPA 1XNBA 2QCSB 3PDQA 5FPXA 1JODA 2EAAA 5EWSA 3H8UA 3M3EA 3NJZA 3OY8A 4J6GA 2Q30A 3UESA 2PHUA 3O1MA 5EJZB 4CPBD 5JXHA 1NKGA 2RM22 4X8NA 5ACA3 4UI9L 1EPZA 2DF7A 2UY9A 4FPGA 1VBE3 4SBVA 4WVZA 4CP1A 2IXLA 4IL7A 1IZ3A 2BVVA 3AX4A 1TNRA 1U0AA 1W39A 1GZ9A 4L99A 4OZXA 4AHYA 3VKOA 2WLQA 3NQHA 5FK8A 3RDIA 3BALA 5JIUA 4PBPA 3BCWA 3MLLA 3K75B 1OURA 2GMPA 3RNSA 4CU9A 1HRI2 4NRQA 4LBLA 3P1IA 1GU3A 2RJKA 5T55A 4EQVA 4N7UA 1RUE2 5FLJA 2GN7A 2XVGA 3T09A 3ZFGC 1QEXA 2XMLA 5CKNA 3POBA 2ZGSA 4EN8B 2PHFA 2BDRA 1HRI1 1LEDA 3JD71 1AYM2 1VE0A 2DWRA 2DCZA 4AAPA 4CRQA 2JKBA 1WLTA 2OS2A 4E2QA 3WF0A 3THCA 2EXKA 1MEC1 3NL1A 4OI4A 1XNCA 1Q56A 4QM9A 4HKLA 3W20A 3UJOA 4CDUC 3RYKA 2HEVF 1HJGA 1AYM1 2Y34A 3CL1A 1JN2P 1OD3A 1JS9A 2D40A 2BJSA 3T2OA 3WQ7A 5IK5A 1D4M1 1XYPA 3I7DA 1NUKA 3IN9A 2HWF2 1ULEA 4HLTA 4FFGA 4C90A 4MX3A 1RXGA 1OT5A 3CIHA 2KXLA 4LUKA 1TZOA 2ZEZA 3WX5A 5AFBA 3DYMA 5BNPC 1YO8A 5F32A 1AR91 4CVUA 1WCUA 2ZGUA 3ZFFA 2B8MA 2B39A 4IESA 4XF1A 1LKNA 1WCSA 5DAVA 2P37A 5IK7A 3O1PA 1R1ZA 2VUCA 1H9PA 4MOAA 4OCTA 3LA3A 2BGOA 4M3CB 3HJRA 4IETA 4ES8A 1GYKA 2BP6A 2ZS6B 4CP0A 4E2GA 1DLCA 1RUNA 3INAA 4AEKA 4CCEA 1ASJ3 4OMCA 1W6PB 3TRSB 1U12A 3VKLA 1VBA3 5J7MA 3LDBA 1LOAA 3LPFA 2B9UA 3W9AA 1X7NA 1LNSA 3O0WA 5FYZA 4ZZ8A 4IE0A 5GZDA 4BWOA 5GZGA 1UW8A 1LOFA 3TN91 1WMFA 3NVCA 4CTEA 1KDMA 3NJXA 2WNUB 1W6MB 3ORJA 3ABZA 1NQJA 2DCYA 5C5UA 1RHI1 3FZ3A 4Q4X3 2GAUA 3IPVA 1SDWA 4N9IA 3ETQA 4YGCA 3VBOA 5KHIA 4CUBA 4XFFA 1IS6A 4GH4B 5FZEA 1XBFA 4XABA 3WNNA 2PHWA 2HJIA 3HNMA 3F95A 1HXS3 5T5PA 2VNRA 4QPWA 2RM23 1OUXA 2EIBA 5KXCA 4OUMA 4NWVA 1XE0A 1GQGA 1CJPA 4LTAA 3VHOA 5C33A 4K8FA 4P9LA 4YZ3A 2Y0IA 4LA3A 5IVCA 1GZWA 4HMZA 1ZA7A 4YG0A 3HR9A 4D3WA 1PK6C 5IFTA 3AC0A 2PAEA 4QPGA 2VZSA 5ABJA 3RJRA 2YBPA 3H7YA 3ZFEB 1TQ5A 1GKBA 3R4SA 2QJVA 1I6XA 3LGRA 2VOTA 3RZGA 3FUOA 5GZEA 4AF9A 3KV5A 1QOTA 1UZVA 1T6GC 2BBAA 2PLV2 3FC0A 4GKXA 4JHZA 3S6PA 3VD9A 2YMZA 5DUUA 5IVFA 4Q4V2 4UF0B 5IW0A 4UW3A 5GLUA 3EO6A 5C3OA 3I2IA 1YYNA 5FZ7A 2IUWA 5K0UA 4I0BA 4AQSA 1I3HA 1OOPC 3QH6A 2PLV1 4LLFA 1ENSA 3SH3A 5LK5A 1R082 1O5UA 3TNQA 3VHPA 1DQ6A 1FOD1 1NE4A 2E51A 2OZJA 2XVLA 3AM2A 3HAGA 3NV1A 1LGNA 4NMIA 4BK4A 3P3PA 5CFCA 5CFDB 2JXAA 2XJQA 1XNKA 2ZHMA 5D8AB 2ERFA 3I3MA 2PHTA 1WCDJ 4HZFA 4LMFA 1QU0A 1BQPA 5HCBA 5KHKA 1UZYA 4ASKA 4DO0A 1QJX1 3L2YA 4AHXA 3M4FA 1QOOA 1AX2A 5L9RA 2X05A 2ATFA 2RS11 4A44A 4R9BA 1C8M1 4ISQA 2A7AA 2XBO2 4FTBA 4LBNA 3W58A 1APNA 4HFSA 2RJLA 1AL21 3KVAA 4CUGA 3MIGA 1JZ6A 3MO4A 4XURA 1O3RA 3KWVA 1VRBA 2NPIA 1DQ0A 4QKNA 2ZABA 4HVOA 1YI9A 3SMHA 3LOBA 2DCTA 3CJXA 4MGKE 2DYCA 4N90A 1UYPA 5DDJ3 1Y9QA 1RUI3 1A8DA 2HYXA 5FZKA 4BYYA 2BQPA 2OW4A 3CZJA 1G86A 2AACA 2VOXA 3TNPB 3ZKUA 1D2QA 5FO7B 4XQ4A 1BLZA 2D97A 5DG1A 3UL2A 3U07A 1PO21 3THPA 3FLRA 2PMWB 4COUA 3GCWA 4DEQA 2PELA 3GZUC 1S2KA 4OFGA 3ZYIB 3P3NA 4IEWA 1VRH2 3F2ZA 4LJHA 5CNAA 3POYA 5IAXA 2VMDA 1DYKA 4QQLA 1ALYA 3AYAA 5JUVA 1KS4A 3B3QE 1W3XA 5DZGA 4OUSA 2WNVB 3MPPG 5LZ6A 1A6CA 4W8JA 2H0BA 5C9AC 2CWSA 3KB5A 1JOPA 3ZFGB 1V6JA 4FAGA 1J83A 5EP9A 1DGRA 5A3OA 4AZZA 3WW2A 1S0IA 3Q8EA 4JZRA 5C3PA 1QJEA 3MEPA 3AYDA 5DAPA 4O9GA 4BXFA 4RHV2 2J1VA 5JLVA 5FLIA 1JBCA 4GWMA 1XC6A 4S2FA 1V6LA 2EIGA 2B42B 3WW4A 1W8UA 4BMEA 4FTEA 5FYUA 2ARAA 2RR11 4J25A 1HN0A 2XR4A 4Q0VA 4CDUB 3MF9A 1NCRB 4RHV1 3AK0A 5A3TA 4Z2AA 1EV13 4RGGA 4WM8C 4AQ2A 3QCWA 4FVVA 1BVP1 1RMU3 2JDPA 5EXOA 1QNWA 3DKWA 3FX3A 5J09A 1CWPA 2VQAA 4A7YA 1YUDA 3I59B 3B5LB 4FFFA 3E6DA 3GBWA 2E33A 1FPN1 1TME2 4Q4Y3 1MS3A 1CAWA 3LDKA 1O59A 3GALA 3RS6A 4UFMA 5FIXA 1YFUA 3S30A 3LFMA 4GAZA 4N8MA 5DUVA 4CEYC 2B45X 3E6BA 3WNXA 2BPA2 4V1PA 1D2SA 3LA7A 4AVAA 1UN1A 3PUAA 1HQWA 1TME1 5FZ6A 4CDWA 1NG0A 2IXCA 4SLIA 4GWIA 3JQXA 2CL2A 3OF1A 5E6HA 5A7PA 4XJ9A 5HCFA 4B8EA 1QJU2 3KCCA 5GLVA 5D2AA 1V9U2 3WW1A 5FDBA 2GH2A 3PNAA 4OYUA 5CYYA 3KS7A 1RGSA 3NKGA 3WY6A 3BOWA 1JZ7A 2LALA 4FQZA 3RVHA 4Y33A 4AEDB 1NYWA 5JSOA 3EJKA 4JVAA 4B4QA 1WCQA 4GZ9A 2C4XA 2YV8A 1W2UA 1ND3A 1KJRA 5J3UA 1V9U1 5IK8A 2ZGOA 3EHKA 4AVBA 5EIYB 1SFYA 2DCJA 3OD0A 1ONAA 5I8YA 2Z69A 3AZXA 3TOJA 1COV1 3UGFA 1GR3A 5JR2A 1YXWA 1R093 2GMMA 4FT8A 1DZTA 5FY7A 1KS5A 4EV0A 3ZN6B 4QPIC 4H3WA 1LESA 4CCMA 1W8WA 2IZWA 1K5MA 4FPKA 3IDEA 2J7MA 4KWKA 3THDA 1NY72 3KGZA 4NUBA 2XHNA 2JEMA 3H1WA 2VOKA 2VMEA 2DUQA 4CCJA 1X9TA 1W8FA 4YW7A 2XLGA 2A3WA 4CCLA 4I02A 3CNAA 4LO7A 1JYIA 3ZM8A 4BXSV 2VMGA 3KV4A 5HV0A 4DOUA 1R64A 2AR6A 3OGSA 4ZY9A 2Y8KA 3JBG1 4E4SA 5KC5A 4HVRA 3A0NA 3K77A 2D5FA 4NR1A 3GZEA 2RHPA 4BCUA 4O65A 3NJVA 1CAXB 4IW3A 1N3OA 3IDAA 2WAOA 1AXKA 3BIEA 1F2NA 3HBZA 3ME2A 1UU4A 2E26A 1YQ5A 2QQOA 1RUG2 3KQRA 3I3QA 4L8QA 2RVAA 1MQTA 4CP2A 1FMD1 5IFPA 1WZXA 5DXDA 4JGYC 1G9AA 2FMDA 3N9PA 1DHKB 4K7JA 1QJY1 1YFXA 2C0ZA 4ASMB 2D43A 3UKVA 1F4AA 2JDNA 1ST8A 4BQ5A 2BU9A 1X9PA 2Y6KA 3MFCA 5F2SA 1ND2B 2X5IB 1EUUA 1BBT2 2K2SA 3W5NA 4P08A 1OF4A 3NV2A 4QU1A 4TLGA 3OGJA 1JTZX 5FCCA 5KHGA 4DPNA 1Y9MA 4Y1ZA 5LY1A 4U2AA 4N43A 1OBNA 4IGOA 1BBT1 2BW8A 3SC7X 3KGLA 5J37A 1ZZ9A 5FPLA 1DQ1A 2HWC2 2HWE2 5FZLA 4GB32 3V0BB 2RV9A 3GZTB 1H0BA 4JGZC 3ZN4A 4E27A 4E9KA 1RXFA 5G05L 1E5HA 1MS5A 1U5ZA 2RMU2 4Y22A 4QDQA 4FSJA 4COVA 1VBB2 2HWC1 1PVC3 1CD3G 2HWE1 4GB31 5FRAA 4AFCA 1D0HA 5JR7B 2QQUA 1D4VB 4M4RA 1AYN1 5K7PA 1OLME 4WZCA 1A78A 2TBVA 3HIFA 5GJ6A 3LSEA 1K5JA 1PO11 4LLOA 4MGIE 2QBXA 1AF9A 3AL6A 2A5ZA 2WSVA 1BHGA 3B94A 1SMVA 2ORXA 1UOBA 1A3KA 1AR82 2BOIA 3DGTA 3N3HA 4JTOA 2YDEA 5FZGA 1G9DA 2ZAAA 4CXWA 5DMYA 1Y9GA 1H8TC 1FV2A 4AHWA 3TEYA 4Z92B 2WT0A 3CJIB 4Q1RA 5DUXA 4XDQA 5C9AB 5LBCA 4CEWA 1ZM1A 2EAKA 2D6MA 5H9RA 1VBD3 4HETA 2EXIA 1TMF2 3N7JA 3EMRA 4XYXA 5FKCA 2XKOA 3AFKA 3VBFB 5HBAA 1OF3A 1SEFA 5K4LA 4BQXA 2H6BA 2FDGA 2R061 1CAUA 2W5FA 1IHMA 5FYYA 1CR7A 3HVDA 3UV9A 3LOIA 2EF6A 1FATA 3VBRA 5IHRA 2WFF2 4XIOA 1L7RA 1W2TA 3WT3A 4NHMA 1W06A 4YGDA 5FZHA 4ZHNA 2JG8C 2RG4A 3MUZ1 4ORFA 1S0FA 2AUYA 3B01A 4KU7A 4O9EA 4WM8B 4XTMA 3NAPA 4D6RA 1V6NA 1RYYA 3B69A 1ENRA 1CZTA 4CU6A 5FAXA 4DXSA 3AMQA 1NE6A 2AC1A 3N9QA 5BNOA 1K45A 4EWDA 1KD7A 3C7EA 4NPLA 1C4RA 2HBUA 4BQ1A 1RUG3 1OSGA 2BYVE 3KSCA 5A6ZA 3CHXA 2JB8A 3B93A 3U78A 3WG2A 4CEYB 4Y5Z0 2G9ZA 2JG9C 3KCXA 1JZ8A 3OYWB 4FOYA 3VZMA 4LUMA 2WO7A 4CDQC 5B2GB 3RYPA 3T30A 2ENRA 1YFYA 4FBFA 4ZXEA 1B35B 5A32A 4AGVA 3DCQA 5C8CA 1G9FA 4RS5B 1Z7S2 5L36A 3BU0A 5FYHA 1B09A 4YGEA 2VBPA 4DZGA 5BNNC 5F6LB 4CE8A 4P9GA 4YVSA 1O7FA 3R0RA 4AI1A 4Y5SA 4RL7A 2XXZA 2D93A 3RRDA 2VD7A 3WNKA 3HBKA 2PAKA 4LT5A 1NA1A 4RR3A 2UURA 3FHIB 4HK9A 2P5BA 4QPIB 3MIEA 1LOBA 2XUMA 4DRRA 2CGNA 2Y60A 3EB7A 5E8AA 4Y3OA 2R073 3WP5A 5FREA 2FDIA 1CIYA 3URFA 1D7PM 1SBFA 4K21A 3ES1A 1RUJ3 4I0WB 4Q0QA 5T5OA 4M01A 4DMIA 1PHMA 3IAPA 1US3A 1UYZA 3E5QA 2GSYA 2ZX3A 1WW5A 4XJWA 2KA3A 5FV3A 3WLUA 2BOJA 4FP3A 4XCBA 1F15A 1UOGA 5CKQA 5DABA 3S57A 3B9CA 1X8MA 1X82A 4M3CF 1RUH2 2VUJA 2Q0AA 3I49A 4NOTA 5ERLA 1KRIA 4O61A 4Z2WA 4XUNA 4FXGB 1UX7A 3ECQA 3GYDA 3I2FA 4Q29A 2LUWA 4IV1B 1TMF3 1W6NB 4IGQA 1RUH1 3OBRA 3PTRB 3DEMA 4LQRA 3VBHB 2XJRA 2LRPA 2WZEA 1W9FA 2WQZC 2RS32 2V72A 3AZYA 3ILFA 2Z42A 2Y0OA 3BN6A 5BV6A 5AC92 2QQIA 4LKFA 4YYOA 4QB2A 3UT0A 4E4ZA 2GMEA 2HEWF 3PJYA 5DG2A 4KBBA 2ZMKA 3ZMNA 5BYNA 1RVF1 1JYWA 1JMUB 2V5DA 5M0TA 2VG9A 1YJLA 5IK4A 1US2A 2CYFA 2ZX1A 3T4VA 1DQ5A 5C6CA 1UWWA 5EYXA 2CAUA 4NWWA 4NPRA 2VUAA 1PVXA 5ACA2 3UKTA 2OZ6A 1VBE2 2IXIA 2PQSA 4XILA 4A42A 3GJBA 1WCKA 1L7QA 4OMDA 4NIIA 2WNUC 2EALA 2ZX4A 1BYHA 2MEV2 3OB8A 5I0SA 4FP2A 1OH4A 2DTWA 3BPZA 4IV3B 1PMIA 4RQPA 4AFMA 4YFZA 2PN5A 1W90A 3LDRA 1VBE1 4MGQA 2EIDA 1RJ8A 2WYFA 2F4PA 5FPVA 3UYJA 2R6QA 5FYTA 4HL0A 1DG6A 1GP6A 3WQ1A 3M70A 4YSFA 4BQYA 2R1DA 1FXZA 2VQUA 2JENA 4JDNA 5FK7A 2P3YA 3K48A 2W95A 5D21A 5FZ1A 1AJKA 2YGMA 2YU1A 3C8XA 1GWMA 4IE4A 2JDMA 4V2WA 4DY3A 5F7UA 1TG7A 5DUWA 3C2UA 1V6IA 3AXEA 3O0VA 4LA2A 2XJPA 1ULOA 2R0HA 3ZXLA 3JZVA 4D69A 1YNAA 5FO9B 1ACCA 2ZZJA 1KFXL 2MHFA 1A8MA 1UNBA 1UPIA 1ZBA1 3WHTA 2JKXA 3VV1A 3ZFEC 5G04L 4QX8A 1JOJA 3RJ2X 4JV4A 2W47A 2ES3A 4LEJA 2YU2A 4NPMA 2C5DA 4PLNA 3C7GA 3N9NA 4XXPA 5JXIA 3V0AB 5F5AA 5FPZA 1LGCA 1JU4A 4XJUA 2HH9A 1U5XA 4LO4B 2FHRA 3J7NA 4QHBA 5IT6A 5CISA 3LWCA 2QQMA 5FJHA 2DBIA 5A6XA 1HDKA 1N3QA 5HPOA 2EXHA 5FYSA 1UKRA 1V6MA 1W9WA 4L0PA 2OXBA 2R041 5CFDC 3TYJA 1I9RA 5A3LA 1XNAA 1ODNA 4Z8BA 5D8AC 4JTNA 3ZXDA 4GD4A 1S4CA 2FBEA 4D0QA 3UNPA 3AKPA 4RGAA 1FI2A 1ASJ2 1S2EA 3PUSA 4TYSA 3JQWA 4XJAA 1MZEA 4Q0UA 4J1XA 1M4WA 2WS91 3KQ4B 4YW5A 1VAMA 1FT9A 2A6XA 1SDDB 2GP3A 5A3UA 4XFIA 4AGRA 4E2SA 4D6QA 5F5CA 1VBC3 4RN5A 1OH3A 3AP7A 2JG9B 1HB1A 4NROA 1VBA1 5I0RA 2Q8DA 2OT7A 2XLFA 3FFZA 2P3IA 4OHVA 1UU6A 3ZFFC 3LE0A 5GZCA 2DVBA 2JJ6A 4B3NA 2O8QA 3LFIA 5JMOA 4NHYA 4Q4X2 5BUVA 3TB0A 4XETA 4OQ8A 1QXRA 3FLPA 2VC9A 1RB8G 5FZ3A 4LK6A 1NCQA 1S0JA 5BNNB 1KXGA 4C1WA 2W1UA 4Q0SA 4Q4X1 5GM0A 2EA7A 1EPWA 3H1MA 1HXS2 1T6BX 4Q0PA 2P6CA 4YW3A 1F5JA 1PIV3 3IMMA 1FX5A 1XXNA 1NAEA 4A3ZA 3GBGA 3N7KA 4NIDA 1OLMA 3ELNA 3P5BA 3PMSA 5I0UA 5FPUA 2DBNA 2JE8A 4Y4YA 4UWDA 1R1A3 2MEV3 3ZSMA 4LBJA 4YZ5A 5A3MA 4P9WA 1W28A 2RM21 3LB9A 2BUKA 2JD4A 3LEIA 3J7HA 5FLHA 5GKAC 4GH4A 2TNFA 2VZUA 2WNVC 3LD8A 2ZHNA 1PNFA 2OA2A 2CDPA 4QAWA 2P17A 4LULA 1WUVA 1CX4A 1GNYA 1Z78A 2D6OX 2F4LA 4UYBA 3N9MA 5HI0A 1RUE1 1S55A 5SV8A 4OQ9A 2JICA 1WLDA 4BQ4A 4CDXC 3QLQA 5JPNB 5FP8A 4WVMB 3ZXFA 1NCRC 4BZ4A 5LA1A 4S2DA 3WCSA 1ZRDA 1RUC3 1VB4A 2UWAA 2VAUA 2WZR3 2ARBA 1BK1A 1UIJA 3U4SA 5AFEA 4LK7A 3T1MA 1UYXA 1VMFA 3VKFC 4QKBA 4QM8A 5CU1A 3ASIA 4QXCA 4PIYA 3VLBB 4AFDA 4AQTA 1A34A 3SITA 5JXGA 3I3EA 2PXJA 2LM3A 2HWF1 3BTZA 2V5YA 2OQ6A 2QTWB 1F5FA 2R7EB 3QD6A 2YGLA 3AP4A 4K3UA 1K12A 3ETPA 4I09A 1OVSA 4JRLA 4HK8A 2JECA 1YWKA 2D3RA 1KJLA 4FXKB 4QHZA 1Q8QA 2HWD2 2Q5TA 4Y1XA 2UYAA 5F5QA 1JUHA 5DDJ2 5KXEA 4CPBA 3VDBA 1AVBA 1RUI2 2VU9A 4H2AA 4ZZ5A 2WBKA 3H3UA 3MBWA 3TEWA 2OPWA 3FFQA 4XFAA 3BPSA 3PJQA 3L2HA 3SEEA 2ZGMA 3ZXGA 2QKDA 2W87A 3IAQA 4YPJA 1QGLA 4YZ1A 4YVWA 1BEV3 4AEDC 3FE5A 3NV4A 1OA3A 5FKBA 1O8PA 2NM1A 1UMHA 4IEQA 4FQ4A 1MACA 4Q26A 4Y20A 5K9YA 2I45A 3BIWE 3ZSKA 2YB7A 4XUOA 2E63A 3MUY1 1W6OA 4IQPA 4XE9A 4MGZE 3KHCA 4NE9A 4AI8A 4YM0A 1NX9A 3BOPA 1CZSA 4QHOA 4RSUA 3ZDSA 5IVBA 4P5HA 1ZZ6A 4NJ4A 4EN7B 2PA7A 4Q4W3 2R32A 2D5HA 5A3NA 3SISA 2FCUA 1ZBE3 3MLJA 3OY8B 5L9VA 4NO4A 1YLLA 5A7NA 3H50A 1QJFA 1AUYA 1RUF3 3R6SA 4LO5B 4AFBA 5F3CA 3DUIA 3E5XA 3M3QA 3USSA 4NHKA 4MGYE 2BERA 4FCAA 4AXOA 1J1LA 1MS0A 2ILMA 5EFUA 1E5SA 3CU7A 4QX3A 1EV12 4AEMA 2GC1A 4ZU5A 2IXJA 3I2OA 3ZFGA 2BBVA 4DIQA 4R8HA 1N3PA 1RMU2 3Q8FA 3MIHA 1GSLA 1MS8A 4PI2A 1Q43A 3CDZB 1EUTA 2A1XA 2D3PA 4MXWB 2AYHA 3MF6A 4BOWA 3MW3A 2K9ZA 5FXWA 4C0BA 1CGPA 4Q4Y2 4WVWA 5F3EA 2XH6A 2LROA 3ZR6A 1RMU1 4NIGA 3DPRA 2D44A 4CDUA 2K46A 5FXVA 5JWPA 1OQ1A 4Q4V1 3I54A 2ET7A 3OPZA 1WLCA 3ZR5A 1VR3A 4AVSA 1BK0A 2X10A 3C7HA 3PURA 3JD73 3S0MA 1HLCA 2QFEA 1ND2C 2X5IC 1R081 2W92A 3VD5A 4P5YA 4Y1UA 1NLSA 2RDSA 2W1QA 4CCKA 1MEC3 3K46A 2ZJCA 5BNPA 1DU3D 3M1HA 1G8WA 1K42A 5FP9A 3MV01 4MUVA 4EN6B 4LO8A 3S7EA 4D6SA 2QQPA 1D4M3 2C26A 3D82A 3ZFFB 4XF0A 4C1XA 5A6YA 3D6EA 5FZ4A 2XBO1 4BK5A 2ZX2A 3AKTA 5T50A 1R092 2HWD3 1ENXA 2QQNA 3H8XA 2NP0A 3LQCA 1AR93 1XSQA 2NMNA 2WC2A 2D7FA 5A3PA 1O3TA 2XJSA 1GWLA 1LCLA 5A1LA 4XAAA 4LKSA 4PQ9A 5LBBA 2OYZA 3NRUA 4Z1VA 3AB0A 4C91A 3IIAA 3MHZA 3I8TA 4ES9A 1WLWA 4L2NA 3HWJA 4UW5A 3N7LA 4BA6A 1DLLA 2ZX0A 3OCPA 2YUEA 3SCFA 3APBA 3C7FA 4AVTA 5JI7A 2BVBA 5E88A 1D0GA 4MXVA 4AW7A 5JZGC 2R16A 3AZZA 1C1LA 5FYIA 3ZN6A 4K9SA 4AWDA 1CX1A 4GJZA 1SBEA 4UFKA 5FZIA 2DTYA 3RG0A 3CJIC 2VUDA 1E5IA 3IPVB 1SPPA 5FTTC 5SV5A 1LOEA 3TN93 3VBOB 3MFAA 4W50A 3I2HA 3QOPA 1VRH1 3M3IA 4XFGA 1GICA 4K8RB 3RYRA 2LW8A 2OKXA 3HT2A 1J3PA 1FNZA 2VQ0A 5KHHA 5HV4A 1LGBA 1RHI3 2W1WA 1QJZA 1XOYA 3PTYA 3VBFC 2JWPA 2W94A 3IDCB 3S5AA 2G9GA 4ATFA 4XW3A 1CONA 4CDXB 1PK6A 1YQCA 3HQXA 3Q8AA 5TSWA 3WR0A 2VOVA 5FZOA 4DQAA 3RPQA 1LOGA 2YG0A 3O1TA 4FPHA 4A3XA 1O5LA 4QPGB 2ZCWA 3I3DA 5I8TA 2Y6LA 4Q5OA 4PLMA 1W05A 3U75A 1OA4A 5ABJB 4LBQB 1OA2A 5FY1A 2A6YA 3SH4A 3LCPA 1TE1B 3IBMA 1L7LA 1QY4A 5FPAA 4XZPA 1W3VA 2XOMA 3C3VA 1W6QA 1OQEA 4UBHA 2BNNA 1O6UA 5FP3A 3AKRA 2J1RA 4XUQA 1OOPA 2VNOA 3UGHA 5F37A 3D3AA 3KT4A 4IE5A 5K0UB 1W9SA 1QDOA 2GNTA 4RA0A 3RWNA 2KD7A 1H2MA 1OPMA 1PZ9A 5KBFA 2WAAA 4MADA 1Q8SA 1HV0A 5C70A 2OX0A 4CP9B 4X6RB 2VTFA 5JPMB 4QXHA 2IC1A 2ETEA 4H14A 5HCAA 1S1AA 1YI7A 4QX0A 1PVC2 2Y6HA 4P9YA 3WP6A 1B35C 1RUD3 1ZZ8A 4ARYA 2GH8A 4DUXA 1FOD3 1XYNA 4RS5C 4XHBA 2G19A 3RZMA 1W8ZA 3CEWA 2XGXA 5FMOL 5FYMA 3OPTA 2D98A 3I4IA 2GNDA 2WIIB 1AR63 1QJU1 2UWCA 4ONUA 5FUNA 1X8EA 1YFWA 4XUTA 2ORZA 1YQ8A 4AEJA 5AVPA 1QJX3 1REFA 5EJ1B 2C9KA 2HEYF 5FOJB 3OPWA 2BWCA 2ZBJA 4KMQA 2VOWA 4HVQA 1BJQA 3D5OA 2R1BA 1XNTA 3HN3A 3VUOA 2V73A 1C8M3 4GQ7A 5FZMA 3MIFA 1AL23 3POEA 4PDWA 1DBNA 1VBD2 4LR4A 1GQPA 1NXMA 3K4ZA 3NNJA 4KWUA 1QNYA 2ZMLA 4FAHA 5A33A 3SCGA 2AH2A 4NAMA 2VVFA 2QDNA 2EVXA 1NY71 3MICA 4MLOA 2V4VA 2ZEXA 4ZS2A 3K51A 4LPLA 5GLTA 3GCXA 4L11A 4MHRA 2DVFA 2VZ3A 3USUA 1HIXA 1NOVA 2Q4SA 2VZOA 4XFHA 5I8SA 3WOGA 5C9AA 4CXXA 5L7OA 5K8SA 1X36A 2XUEA 5C3QA 5ANQA 3N9LA 1F9KA 4IV1C 3PMEA 2DURA 4P14A 2ADEA 1OMIA 1IS4A 3OBTA 2HYKA 4GIQA 4QB6A 4M00A 2NYYA 5IVJA 4XJ8A 4QX7A 2GALA 3VBHC 4EWEA 1ULCA 3CKHA 4JAAA 1E57A 4LITA 3PVEA 1H2KA 1YC61 2PHDA 3M8LA 4FPJA 4RFT0 2WZ8A 4XMAA 2IXHA 1UU5A 4YW1A 3G7DA 4ZU4A 3H42B 4K1YA 1GFF2 2NLRA 1STMA
chains in the Genus database with same CATH topology
4W6WA 3WP4A 1NXD1 2QVSB 3BTAA 4LE3A 2A71A 3VBSC 2JX9A 1LOCA 1VAVA 4S2GA 4A2UA 4Y26A 3ZXEA 5E16A 2RR13 2ZHLA 4COZA 5BNOC 4XBLA 3H9AA 2HWB2 3AMNA 1CAWB 5KXDA 4M3CE 3ACLA 4YW2A 3JB8A 4K6BA 5FO8B 4B7EA 1GQHA 3OYWA 4IEOA 4QU2A 4X8PA 3WP3A 3ZXKA 3ZX7A 3IMNA 1ENQA 4CDWB 1FPN3 4TZDA 4IV3C 3DN7A 3SNMA 1KITA 3WW3A 3VZKA 4AI3A 4B4RA 4N7IA 1AZDA 3AMMA 3BODA 2R072 2RMU1 4AI2A 1RUJ2 3LKJA 4N53A 1VBB1 1BCXA 2GC2A 1H4GA 1JW6A 2YZ4A 2VNGA 3IT8A 4KWLA 5JZGB 4RD7A 3N7MA 1RUJ1 1C5HA 2VY0A 4AE2A 3UKNA 4HKWA 3LAGA 4XPVA 3MLKA 3WDUA 1K5MB 1AR81 1DZRA 2DFCA 2TUNA 2A3YA 2P34A 1COV3 3WINE 4I2OA 1ZREA 1S0DA 1N1VA 3RI8A 2Z2SB 2BNMA 3GBFA 3Q9OA 4KQ7A 1TMF1 2P2KA 3AJYA 2OUHA 3A4UA 2VW2A 4JCKA 4DS0A 3B9IA 3B7MA 2A3XA 3T1LA 1S0BA 1WBFA 2G9FA 4F83A 1OKQA 3PVNA 4DY5A 2WZPP 5FQ0A 4OHZA 2WFF1 1AXYA 4XBNA 4HANA 3IKWA 4JC1A 3VDDC 4IEPA 4HN0A 1OFSA 1OI6A 3AKSA 3VZLA 1AL0G 3JBG3 2W39A 1LU1A 2WL1A 4JGYA 4MV2A 1MQTB 3A0KA 1M06G 1JYCA 2H0VA 2ZGQA 4UW4A 1QOSA 4DINB 1VJ2A 4KGGA 1EAH2 4WM7C 1CPMA 3ENRA 2E9QA 3H0OA 4KL1A 3DL3A 1MVEA 1O4YA 1VAKA 1WGPA 1BKZA 1FMD3 5CB7A 1QJY3 5KWRA 1N1TA 3EQEA 4META 5GLWA 3SCHA 4FPFA 2HWB3 4N43B 4COYA 5C4WA 3WV6A 1I1EA 1LB2A 1Z7S1 4JGZA 4X6QB 4GMP0 4GA9A 3ST7A 4EROA 1QHDA 1UAIA 2XL9A 4OHXA 5I0TA 2JE9A 4BLIA 3VN4A 3WG3A 1Q8OA 4Y22B 2VH9A 1W0OA 4EN9B 2XG3A 1H9WA 2RS53 4M0NA 2D3SA 2WQ4A 1VALA 4PLOA 1C1FA 2XVKA 3EBRA 4FO9A 3H1YA 1CAVA 4AGGA 1JH5A 3VBUC 3ZYPA 2GC3A 1DF0A 5JCTA 3AYEA 1LHWA 3R05A 4XF9A 1H8TA 5L73A 1AYN3 3GZAA 1UCXA 3MDPA 4CEWB 3NWKA 1OLRA 1URXA 3V0AA 5BY5A 1UX6A 2E6VA 2UYBA 3VHRA 4INDA 2G4IA 3G6JB 2XHKA 1VBC2 1CAUB 2CGPA 4Y1VA 1DDLA 2JG8A 1SCSA 3ZSJA 2CAVA 3FMGA 4DB5A 4GWNA 3VBSB 1CPNA 3NAPB 4MVTA 2R063 4Q8LA 4TLFA 2RS31 4HT1T 1DGLA 4LBOA 2PHXA 1MS1A 5AC91 5BNOB 2VVEA 1OHFA 2A75A 1DQ2A 4BM8A 2NMOA 5GALA 5JOYA 2JG9A 1HQLA 4I0AA 1PIV2 1VLNA 2P3KA 2PHLA 4FOQA 4HPKA 4MYEA 4CDQA 2ZKNA 1KQRA 2I2SA 1R1A2 1BMV2 4FPEA 1EAH3 5ACA1 1PIV1 1H1AA 3VL9A 4OI1A 1UL9A 3NKTA 4FPLA 5A32B 5BNNA 5C8CB 2MEV1 3M7AA 4H7MA 1QMJA 1V70A 1MS9A 1EY2A 2I07B 4W65A 4YVSB 4N9HA 4XIKA 4QT6A 2CGOA 1MVQA 2CNAA 3VL8A 4XFCA 1NA1B 3FLTA 4KGQA 4RR3B 3WDVA 4AVVA 2EXJA 1IGOA 1LHNA 3ZSLA 1QQP3 1RUC2 1QH6A 2DVGA 2WZR2 4JRAA 4KG8A 4BE3A 2AZ5A 3N4MA 3H7JA 4KG0A 4DXZA 3QBQA 1FAYA 3VZNA 4YG6A 2WZR1 5KXBA 3L9JT 4IEZA 1NQDA 1POV0 1MS4A 4WVMA 3NO8A 4GMP3 4FPOB 1V00A 4U36A 1HQNA 3J8F3 2X8KA 3THTA 1WD3A 4JDMA 2X29A 1NLRA 1RUOA 3VDDB 5JI9A 2CY6A 2WNEA 4XQDA 1TNFA 3IM0A 2F6BA 3FBYA 2C1FA 2ZGPA 4GKYA 3O5SA 1BEV2 3VZJA 1VB2A 1ASJ1 4QXKA 3MYXA 4FPYA 4LHNA 3UJQA 3V56A 4OLLA 1H1IA 1F31A 1IS3A 1V6KA 5AVAA 2ARXA 4M3CA 3M3CA 4WM7B 3VZOA 1SLIA 5KHJA 3WCRA 4P9JA 2IWGB 5EJ3A 5LRRA 1W6PA 2KM2A 1U5YA 5J96B 1AXZA 4R4ZA 4Q4W2 5JDBA 1SBDA 4XF4A 5CG8A 3CLPA 3N36A 4NN0A 5J48A 1ZBE2 2WLPA 2ZOEB 4IERA 2BEOA 5C8WA 4PIXA 2ZGLA 1LENA 1LOFC 2WNUA 2ZTNA 1W6MA 3J26N 2RE9A 3J4UH 1RUF2 1GNZA 2ZGRA 1HXS1 5H9QA 1HRV3 3KM5A 4I01A 2YROA 2C9AA 2Q1ZB 1RC6A 1NZCA 3D0SA 3VBOC 2BGCA 4PF5A 1Q8VA 2VW0A 2W0XA 2PYTA 1LECA 2R49A 2K0GA 2SBAA 4B7KA 2P3JA 4J1WA 3VBUB 2DCKA 1YJKA 1LULA 1ULFA 1XU1A 3B00A 2AENA 4OHWA 2OPKA 2VECA 2ZA9A 3ZFEA 1V6OA 4QPGC 2OUJA 3JD72 5ABJC 3ZPYA 4YRDA 4D94A 4MXWA 4E4DX 3WDYA 1HKDA 1MEC2 2PHRA 3OJBA 1LEMA 1ZBA3 2CWMA 3AZWA 3U4XA 4BHPA 1D4M2 5K0UC 3DPRC 1PGL2 4UW6A 5CFDA 4EJRA 2UWBA 1SQ4A 2ZPXA 5EZWA 1L3JA 4AHZA 5D8AA 1XE7A 1XRUA 4Q8KA 4YFZA 3SHRA 5CFCC 2WWSA 3MIBA 3RMXA 5J98B 2QE3A 1W0PA 1AR92 2VW1A 1PGL1 5T54A 1X50A 1Q8PA 4YNIA 1XQNA 1AR73 4LBQD 2D6KA 2HWD1 2R043 3GNEA 5DDJ1 3JU9A 1RUI1 1GBGA 1Y7BA 3OD4A 3MGUA 1U5IA 2IFWA 3KT7A 4H7LA 1POV3 4XTPA 4BLJA 4EWAA 1PM7A 4HKOA 2WS93 4LNVA 4C0HA 5T3NA 4R52A 3TN92 4GULA 1DGWX 2N7GA 4PCRA 4XFBA 1NCQB 1FNYA 4F3JA 4OI0A 3ZO0B 2Q8OA 2PQQA 1RHI2 4HBNA 3ZYRA 4DRVA 1WW6A 1QH7A 1G9CA 1QF3A 2E53A 1SLCA 3AKQA 1MZ6A 4HSLA 2O8OA 4FOVA 4URTA 2QUOA 3EXUA 4KH9A 2XL7A 2D6NA 1IPJA 4L97A 2WNVA 4IEYA 4TSVA 3ATGA 4LBKA 4LO6B 1DFQA 4IEXA 1XYOA 2VPVA 3ROUA 1F8VA 5JOXA 1ZA4A 2VGDA 3AMHA 4D7SA 1EV11 1S0CA 2TEPA 2OVUA 4PIZA 4LBMA 1UKGA 4CDXA 4UBGA 1CJDA 1DGRN 2VULA 1ZZCA 2DUOA 1NCRA 5LEJA 4Q4Y1 1JHNA 1SFNA 1SLBA 1HRI3 4LBQA 1IKPA 1GZCA 3VKMA 1RUE3 2E7QA 1O4ZA 3I59A 1MZFA 2YC0A 1RL3A 1RUD2 1UIKA 1FOD2 5F1RA 3I2DA 3HMYA 1CVNA 1AYM3 1EP0A 1AR62 4PJYA 3WDXA 1RUD1 1Y3TA 3WVJA 4BH9A 1RITA 1QJX2 3GHNA 4BIOA 5FFOC 4CDWC 1AR61 2RS12 1C8M2 1IOAA 2XWBB 2HWF3 1J3QA 4Z07A 1AL22 1PZ8A 4XF3A 2WT2A 2GDFA 4ZKTB 3AP5A 4AEDA 2YXSA 5LK7B 1ZRCA 1S0GA 1R091 1YIPA 4G3YC 4YZ4A 4YVWB 5CADA 2LTNA 1O4TA 2OIIA 4Y20B 3V64A 2Q1MA 3U10A 4AI0A 1ND3C 3FUQA 2XWJB 3D0JA 3KT1A 3PLQA 5F6KA 1QWRA 3D4KA 3WD5A 1W6OB 4Y1YA 4B4PA 2BFUL 5CBLA 1GANA 3KZ4C 1PO22 4JQRA 4GALA 1SLTA 1OLQA 1DZQA 2DFBA 2XJVA 4PDWC 1K5MC 3PVBB 2A6VA 4FTSA 3NSTA 1G6NA 2VMHA 1UF2C 4EN0A 3MW2A 4I3PA 4ATEA 4YG3A 5E1RA 1WA4A 1GZWB 3WG1A 1DIWA 1KFUL 2FMYA 1UD1A 2VVDA 1OQDA 1CAXA 4XOGA 4OHYA 1H4HA 4K40A 4P9IA 4QGMA 5L7OC 4XHXA 2R30A 4FOWA 2RR12 2D6PA 1DQ4A 2DV9A 2GZWA 3B02A 1J1TA 2NN8A 4Q27A 3FWEA 1LTEA 1SLAA 3DPRB 1MQTC 2WKKA 5CFCB 1IQAA 1FPN2 1ND2A 2X5IA 2W52A 3LZZA 3VKNA 5BPXA 5H9SA 1C8NA 3NW4A 2XLAA 4D7YA 3KCYA 1WMDA 4KWJA 1XU2A 2CTVA 1PNGA 2PLV3 3WG4A 4F8AA 4YW4A 5JIAA 1AJOA 4Q4V3 3PHMA 5BNPB 1H2NA 4YGBA 4AYUA 2BNOA 1KDKA 1PVC1 4N43C 3ZYGA 3AP6A 2VXRA 2YY1A 1R083 2WA4A 1BZWA 1MZ5A 1WD4A 1YHFA 2AREA 2RS13 3ILNA 5JOZA 3M2MA 2BFUS 1MR5A 3ZMOA 2DVDA 4Z82A 2WA3A 1PZ7A 1COV2 1WMEA 4W6XA 1WBLA 2XBO3 5J36A 3M3OA 3QACA 4KNCA 1VBD1 4N53C 1ZX5A 4G4FA 1REDA 5JZGA 4MH0E 1LHVA 2AGSA 3TWIA 1CESA 3CJIA 2UU8A 3OGGA 3FJSA 4QGLA 1PO23 4NVPA 4WVVA 3SLIA 4CEWC 5T52A 1UPSA 3O7OA 4YM3A 3VBFA 4H55A 4QX5A 4AG4A 3JBG2 3ZN5A 5JSPA 3R4DB 2PFWA 1VRH3 1QXPA 2ZACA 1PK6B 1Q5OA 3VBRC 2YHJA 3AP9A 4BPZA 4WM8A 1O3QA 1YRZA 1CIWA 1Z0HA 1O91A 2A6ZA 1J58A 4XEZA 3NAPC 1IPKA 1FMD2 3MIDA 4ZU7A 4HSJA 2W68A 1QJY2 1OPOA 1W6QB 2YYOA 5CAZA 3KLSA 4RHV3 3HN1A 5BXXA 3ZXAC 4CEYA 3KMHA 1OOPB 2FZ2A 5FMOS 5LRSA 2ZKLA 1ULDA 2B5HA 3KD4A 4HN1A 1QKQA 1RIRA 3RSJA 2O1QA 2NQYA 2HWB1 5JVVA 2H6CA 2BTVC 4PBOA 2YPJA 1LJ7A 1CQ9A 4YFWA 4YZ2A 1B35A 2GNMA 3JB4C 4RS5A 4COWA 3UK9A 1VIWB 5CVRA 2RS52 3NV3A 5C8CC 3PVOA 1TME3 4BIFA 1C28A 1ZRRA 4P9XA 2NZ9A 1SACA 4QQHA 4Y24A 4YVSC 1DYPA 1ND3B 4D7TA 5F9TA 1LODA 2RS51 4OVEA 5C4WC 2R071 5H9PA 5D1IA 1N1SA 5KC6A 4QPIA 1AYN2 5T5LA 4LHLA 1NA1C 4F7ZA 4RR3C 2V09A 5EYYA 1LU2A 3MPBA 4ASLA 1PO12 2ZGTA 5JAXA 1QJU3 3VHNA 1V9U3 2A6WA 4PDWB 4QQPA 1TEIA 2E7TA 3HD8B 2O0OA 4Q2FA 1AX1A 4R9AA 4Q1PA 3ZIWA 5A33B 3BB6A 2ET1A 3E5UA 5FBZA 1G7YA 2QDRA 2WFPA 4WZFA 2GU9A 4L92A 3E6CC 3E97A 5T5JA 4CYDA 4UXAA 3USUB 4M0HA 1AHSA 1AX0A 2SLIA 2R062 2DU0A 3RZZA 4ITCA 4IV1A 1W6NA 5L7OB 4QQOA 4OULA 1EYBA 1BVVA 5DZEA 1JUIA 3VBHA 4QGNA 1N47A 4WBBA 1XE8A 2CV6A 3O0XA 1H8VA 3AZVA 1GV9A 4YARA 3DV8A 2MPFA 3POWA 3AMPA 4MSVA 5I91A 4L9BA 2XJTA 3VBSA 2D6LX 4ZXKA 2HKXA 5BNQA 1X33A 4AK3A 4WV8A 4AVCA 3WHUA 2XKPA 2B46X 2PTMA 1EAH1 4XMIA 2JDZA 2B7YA 3ZVXA 3CF6E 4YM1A 1SLLA 3ZSEA 3GF6A 1LHOA 3D8CA 1RINA 4QD2A 1PGW2 4IV3A 1HW5A 4MZUA 3IWZA 1ZZBA 1J59A 4TWTA 2DUPA 3U11A 1LHUA 4RQPC 1N1YA 1BBT3 1QQP2 1PGW1 1ZRFA 1ZVFA 5LEKA 3V0BA 4I30A 1ZYBA 3J9SA 3S7IA 3WDTA 1Q3EA 2FQPA 4R9CA 1QQP1 1IKQA 3V65A 4N53B 1GNHA 3O14A 2HWC3 2HWE3 4JDOA 1C5IA 4GB33 1RJ7A 1GLHA 3N35A 1FYUA 4K1ZA 2RMU3 3POSA 2XB6C 3J8F2 4IXLA 1PO13 1VBB3 4QMAA 3ALQA 1IS5A 2WT1A 3R4UA 3VGIA 4GMP1 5EV7A 3RQ0A 2E7AA 2MNGA 3TBDA 1UMZA 3JUUA 3U0ZA 3ES4A 3ILRA 3J8F1 5GZFA 2ZGKA 4A7KA 4I3GA 1YIFA 5DZFA 3VBRB 2WJSA 1AR83 2Y26A 4R4XA 2UY8A 3AJZA 5I93A 1VBC1 4A7ZA 3TAYA 2XPJA 3VDDA 5FQ0B 3MW4A 3MI8A 1ZNPA 3BU7A 3OTFA 2DVAA 4G9SB 4QPYA 3QH7A 4KU8A 1QDCA 4JGYB 2PAMA 1QXJA 3WUDA 1VP6A 2WFF3 4XJZA 1JXNA 5L19A 1RVF2 3X29B 4WM7A 4YM2A 1HRV2 4AFAA 3RI9A 1YCIA 3WZ1A 3WDWA 3AXDA 3FBMA 3HT1A 2ZHKA 2VMIA 1R1A1 1HRV1 1NCQC 2GC0A 4OI2A 1ULGA 1BMV1 2DU1A 3ZYJB 1BXHA 3RMYA 2JE7A 5E89A 4LHKA 5HXVA 5C4WB 1PGSA 1LR5A 4JGZB 1S2BA 1OFNA 4K20A 3H3ZA 4B29A 4ISRA 4BMBA 1XNDA 5JOWA 3LA2A 3CO2A 3LSDA 4IEUA 4XBQA 1WW4A 1Z7S3 4GH4C 1RTVA 1C57A 2XJUA 5JSRA 4XXAA 2ZZQA 3DF0A 2QNKA 3IDBB 4QQ2A 4FPCA 1RUC1 1CAVB 1ZBA2 5CG9A 4S2HA 3WUCA 2X53S 4R9DA 2GN3A 1H1MA 2W08A 2I74A 1H8TB 1J3RA 3W59A 1OD5A 4CZSA 1Y43B 1H30A 1I5ZA 5IUQA 4W6YA 1DGWA 4GXLA 1UZZA 1AR72 2ZAHA 4NHLA 4AQ6A 2R042 3ZXJA 3AFGA 4LE4A 2Z79A 1ZZ7A 1SCRA 2FZ1A 1LRHA 2JG8B 1AR71 4DNYA 3T2TA 1BEV1 1RUH3 2WSUA 5CIRA 2WS92 5GLZA 3GHMA 1FV3A 2ZGNA 1POV1 1HV1A 1VBA2 2QZ2A 3ZIXA 2GNBA 1WW7A 1CN1A 2A70A 2IXKA 1S0EA 4XQWA 3AYCA 3O12A 1HX6A 2QZ3A 4YVWC 5CA6A 2A73B 2WINB 2RS33 3WQ0A 4Q4W1 4IEVA 1O3SA 1RVF3 3JCIA 2Y38A 4HPKB 5AC93 2Z5WA 1ZBE1 4CDQB 2IFRA 2ZMNA 4DFSA 1G9BA 2BWAA 4RQPB 3SH5A 1H2LA 3SXWA 4YLZA 2R0FA 1REEA 1RUF1 1C3HA 3WXPA 1XNBA 2QCSB 5FPXA 2EAAA 5EWSA 3H8UA 3M3EA 3NJZA 3OY8A 4J6GA 2Q30A 2PHUA 2RM22 4X8NA 5ACA3 1EPZA 2DF7A 2UY9A 4FPGA 1VBE3 4SBVA 4WVZA 4CP1A 2IXLA 4IL7A 1IZ3A 2BVVA 3AX4A 1TNRA 1U0AA 1W39A 1GZ9A 4L99A 4OZXA 4AHYA 3VKOA 2WLQA 3RDIA 3BALA 5JIUA 4PBPA 3BCWA 3MLLA 3RNSA 2GMPA 1HRI2 4LBLA 2RJKA 5T55A 4N7UA 1RUE2 5FLJA 2GN7A 2XVGA 3ZFGC 2ZGSA 4EN8B 2PHFA 1HRI1 1LEDA 3JD71 1AYM2 2DWRA 2DCZA 4CRQA 2JKBA 1WLTA 4E2QA 2EXKA 1MEC1 3NL1A 4OI4A 1XNCA 1Q56A 4QM9A 4HKLA 3UJOA 4CDUC 3RYKA 2HEVF 1AYM1 3CL1A 1JN2P 2D40A 3WQ7A 5IK5A 1D4M1 1XYPA 3I7DA 3IN9A 2HWF2 1ULEA 4HLTA 4C90A 4MX3A 2KXLA 4LUKA 3WX5A 5AFBA 5BNPC 1YO8A 1AR91 2ZGUA 3ZFFA 2B8MA 2B39A 4IESA 4XF1A 1LKNA 1WCSA 2P37A 5IK7A 1R1ZA 1H9PA 3LA3A 4M3CB 4IETA 4ES8A 1GYKA 2ZS6B 4CP0A 4E2GA 1RUNA 3INAA 4AEKA 1ASJ3 1W6PB 3TRSB 1U12A 3VKLA 1VBA3 5J7MA 1LOAA 2B9UA 3W9AA 1X7NA 3O0WA 5GZDA 4BWOA 5GZGA 1UW8A 1LOFA 3TN91 1WMFA 3NVCA 4CTEA 1KDMA 2WNUB 1W6MB 1NQJA 2DCYA 1RHI1 3FZ3A 4Q4X3 2GAUA 3IPVA 1SDWA 4N9IA 3ETQA 4YGCA 3VBOA 5KHIA 4XFFA 1IS6A 4GH4B 2PHWA 2HJIA 1HXS3 5T5PA 2VNRA 2RM23 5KXCA 4OUMA 4NWVA 1GQGA 1CJPA 4LTAA 3VHOA 5C33A 4K8FA 4P9LA 4YZ3A 2Y0IA 4LA3A 1GZWA 4HMZA 4YG0A 3HR9A 4D3WA 1PK6C 2PAEA 4QPGA 5ABJA 3RJRA 3ZFEB 3H7YA 1TQ5A 1GKBA 3R4SA 2QJVA 1I6XA 3LGRA 3FUOA 5GZEA 4AF9A 1QOTA 1T6GC 4GKXA 2PLV2 3FC0A 3S6PA 2YMZA 5DUUA 4Q4V2 4UW3A 5GLUA 3EO6A 1YYNA 5K0UA 4I0BA 4AQSA 1I3HA 1OOPC 3QH6A 2PLV1 4LLFA 1ENSA 3SH3A 5LK5A 1R082 1O5UA 3TNQA 3VHPA 1DQ6A 1FOD1 1NE4A 2E51A 2OZJA 2XVLA 3AM2A 3HAGA 3NV1A 1LGNA 5CFCA 3P3PA 5CFDB 2JXAA 2XJQA 1XNKA 2ZHMA 5D8AB 2ERFA 2PHTA 1WCDJ 4HZFA 1QU0A 1BQPA 5HCBA 5KHKA 1UZYA 1QJX1 3L2YA 4AHXA 3M4FA 1QOOA 1AX2A 2ATFA 2RS11 4R9BA 1C8M1 4ISQA 2A7AA 2XBO2 4FTBA 4LBNA 3W58A 1APNA 4HFSA 2RJLA 1AL21 3MIGA 1O3RA 2NPIA 1DQ0A 2ZABA 4HVOA 1YI9A 3SMHA 3LOBA 2DCTA 3CJXA 4MGKE 2DYCA 4N90A 5DDJ3 1Y9QA 1RUI3 1A8DA 4BYYA 2BQPA 2OW4A 1G86A 2VOXA 3TNPB 1D2QA 5FO7B 4XQ4A 2D97A 5DG1A 3UL2A 3U07A 1PO21 3THPA 3FLRA 4COUA 2PELA 3GZUC 1S2KA 4OFGA 3ZYIB 3P3NA 4IEWA 1VRH2 5CNAA 3POYA 4QQLA 1DYKA 1ALYA 3AYAA 1KS4A 3B3QE 5DZGA 4OUSA 2WNVB 3MPPG 1A6CA 5C9AC 2H0BA 2CWSA 3KB5A 3ZFGB 1V6JA 4FAGA 1DGRA 3WW2A 1S0IA 3MEPA 3AYDA 4O9GA 4RHV2 5JLVA 5FLIA 1JBCA 4GWMA 4S2FA 3WW4A 1V6LA 2EIGA 2B42B 4FTEA 3MZHA 4BMEA 4Q0VA 2RR11 4CDUB 3MF9A 1NCRB 4RHV1 3AK0A 1EV13 4RGGA 4WM8C 4AQ2A 3QCWA 4FVVA 1BVP1 1RMU3 5EXOA 1QNWA 3DKWA 3FX3A 5J09A 2VQAA 4A7YA 1YUDA 3I59B 3B5LB 3E6DA 3GBWA 4Q4Y3 1FPN1 1TME2 1MS3A 1CAWA 3GALA 3RS6A 1YFUA 3S30A 5DUVA 4CEYC 2B45X 3E6BA 3WNXA 2BPA2 4V1PA 1D2SA 3LA7A 4AVAA 1UN1A 1HQWA 1TME1 4CDWA 1NG0A 2IXCA 4SLIA 3JQXA 2CL2A 3OF1A 4XJ9A 5HCFA 4B8EA 1QJU2 3KCCA 5GLVA 1V9U2 3WW1A 5FDBA 2GH2A 3PNAA 3KS7A 1RGSA 3NKGA 3WY6A 3BOWA 2LALA 4FQZA 4AEDB 1NYWA 5JSOA 3EJKA 4JVAA 4B4QA 2YV8A 1W2UA 1ND3A 1KJRA 5J3UA 1V9U1 5IK8A 2ZGOA 3EHKA 4AVBA 1SFYA 2DCJA 3OD0A 1ONAA 5I8YA 2Z69A 3AZXA 3TOJA 1COV1 1GR3A 1YXWA 1R093 2GMMA 4FT8A 1DZTA 4EV0A 1KS5A 3ZN6B 4QPIC 4H3WA 1LESA 2IZWA 1K5MA 4FPKA 3IDEA 4KWKA 1NY72 3KGZA 2JEMA 3H1WA 2VOKA 2DUQA 2XLGA 2A3WA 4I02A 3CNAA 4LO7A 1JYIA 2VMGA 4DOUA 2AR6A 4E4SA 5KC5A 3JBG1 4HVRA 3A0NA 2D5FA 4NR1A 2RHPA 4BCUA 1CAXB 1N3OA 1AXKA 1F2NA 3HBZA 3ME2A 1UU4A 1RUG2 3KQRA 4L8QA 1MQTA 4CP2A 1FMD1 5DXDA 4JGYC 1G9AA 2FMDA 1DHKB 4K7JA 1QJY1 1YFXA 2C0ZA 4ASMB 2D43A 3UKVA 3MFCA 1ND2B 2X5IB 1BBT2 2K2SA 3NV2A 3OGJA 1JTZX 5FCCA 5KHGA 4DPNA 4Y1ZA 4U2AA 4N43A 1BBT1 2BW8A 3KGLA 5J37A 1ZZ9A 1DQ1A 2HWC2 2HWE2 4GB32 3GZTB 4JGZC 1H0BA 4E27A 3ZN4A 4E9KA 1MS5A 1U5ZA 2RMU2 4Y22A 4FSJA 4COVA 1VBB2 2HWC1 1PVC3 1CD3G 2HWE1 4GB31 5FRAA 4AFCA 1D0HA 5JR7B 1D4VB 1AYN1 5K7PA 4WZCA 1A78A 2TBVA 3HIFA 5GJ6A 3LSEA 1PO11 4MGIE 4LLOA 1AF9A 2A5ZA 2WSVA 3B94A 1SMVA 4JTOA 1A3KA 1AR82 3DGTA 3N3HA 1G9DA 2YDEA 2ZAAA 4Z92B 1H8TC 1FV2A 4AHWA 2WT0A 3CJIB 4Q1RA 5DUXA 4XDQA 5C9AB 4CEWA 1ZM1A 2EAKA 2D6MA 5H9RA 1VBD3 4HETA 2EXIA 1TMF2 3N7JA 4XYXA 2XKOA 3AFKA 3VBFB 5HBAA 1SEFA 2H6BA 2R061 1CAUA 1IHMA 1CR7A 3UV9A 3LOIA 2EF6A 1FATA 3VBRA 2WFF2 4XIOA 3WT3A 4NHMA 4YGDA 2JG8C 4ORFA 1S0FA 2AUYA 3B01A 4KU7A 4O9EA 4WM8B 4XTMA 3NAPA 1V6NA 3B69A 1ENRA 5FAXA 3AMQA 1NE6A 5BNOA 4EWDA 1KD7A 1C4RA 4BQ1A 1RUG3 1OSGA 2BYVE 3KSCA 3B93A 3WG2A 4CEYB 4Y5Z0 2JG9C 3KCXA 3OYWB 4FOYA 3VZMA 4LUMA 4CDQC 5B2GB 3RYPA 2ENRA 1YFYA 4FBFA 1B35B 5A32A 4AGVA 5C8CA 1G9FA 4RS5B 1Z7S2 5L36A 1B09A 4YGEA 5BNNC 4DZGA 5F6LB 4P9GA 4YVSA 1O7FA 3R0RA 4AI1A 4RL7A 2D93A 3RRDA 2PAKA 4LT5A 1NA1A 4RR3A 2UURA 3FHIB 4HK9A 4QPIB 3MIEA 1LOBA 2XUMA 4DRRA 2CGNA 5E8AA 2R073 3WP5A 5FREA 3URFA 1SBFA 4K21A 3ES1A 1RUJ3 4I0WB 4Q0QA 5T5OA 4M01A 4DMIA 1PHMA 3E5QA 2GSYA 2ZX3A 1WW5A 4XJWA 2KA3A 3WLUA 4FP3A 3B9CA 1X8MA 1X82A 4M3CF 1RUH2 2VUJA 2Q0AA 1KRIA 4NOTA 4Z2WA 4FXGB 3ECQA 3GYDA 4Q29A 2LUWA 4IV1B 1TMF3 1W6NB 1RUH1 3OBRA 3VBHB 2XJRA 2WQZC 3ILFA 2RS32 3AZYA 2Z42A 2Y0OA 5BV6A 5AC92 4YYOA 4E4ZA 2GMEA 2HEWF 3PJYA 5DG2A 4KBBA 2ZMKA 3ZMNA 5BYNA 1RVF1 2VG9A 1YJLA 5IK4A 2CYFA 2ZX1A 1DQ5A 5C6CA 5EYXA 2CAUA 4NWWA 4NPRA 2VUAA 1PVXA 5ACA2 3UKTA 2OZ6A 1VBE2 2IXIA 4XILA 1WCKA 2WNUC 2EALA 2ZX4A 1BYHA 2MEV2 5I0SA 4FP2A 2DTWA 3BPZA 4IV3B 4RQPA 1PMIA 4AFMA 2PN5A 1VBE1 1RJ8A 2F4PA