5J37A

Crystal structure of 60-mer bfdv capsid protein in complex with single stranded dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
b'FSTNRIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFALDDFLQAVPNPHTLNFEDYRIKLAKMEMRPTGGHYTVQSDGFGHTAVIQDSRITRFKTTADQTQDPLAPFDGAKKWFVSRGFKRLLRPKPQITIEDLTTANQSAALWLNSARTGWIPLQGGPNSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFRQFAPNNPST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beak and feather disease virus capsid protein
molecule tags Virus/dna
source organism Beak and feather disease virus
publication title Structural insights into the assembly and regulation of distinct viral capsid complexes.
pubmed doi rcsb
total genus 36
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.950 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j37A00
5J36A 3R0RA 5J37A 5J09A 3JCIA
chains in the Genus database with same CATH superfamily
3INAA 5FP7A 4O9GA 4CE8A 2ORZA 4NPMA 2NN8A 5FXXA 5DAWA 2RS53 3N3HA 5FY0A 5F1RA 1XE7A 3A23A 4M3CA 5EYXA 4AK3A 5C8WA 5LW9A 1S0BA 4HFSA 1TE1B 1GWMA 5FPLA 1GKBA 4GMP1 1XU2A 1MVQA 3J7LA 1UZYA 4FP3A 3VBUA 1ZBE2 1PM4A 2GAUA 3MI8A 1H4GA 2CWMA 1PM7A 1IKPA 1PO21 1Y9GA 4GWMA 4JTNA 3ZXLA 3KM5A 4KU8A 5J96B 2D93A 5FWJA 5JWPA 5FP8A 3T2OA 2XXZA 3D82A 3TN91 4FPCA 4Q0UA 3TWIA 4K21A 3VD4A 3RZLA 5LY1A 1COV3 2X53S 1QJY3 1QXJA 1VBD3 1WWYA 3PUQA 5E89A 1YJKA 2XQXA 4P08A 1UY1A 3AJYA 2VL4A 4IEXA 1COV2 1XNKA 4WVMB 5FZ7A 1PVC2 4YYOA 4P9WA 1MACA 5JI7A 1SZBA 4PF5A 2CY6A 3IPVA 5LY2A 1OOPB 5FYVA 3U1XA 5GM0A 3LF7A 1MQTA 1YFUA 2KR2A 4IEWA 1EAH3 1GZ9A 1PZ9A 1ZZ9A 1AX1A 1ZBE3 2OT7A 3IIIA 3ABZA 3E6DA 4MGIE 4ZY9A 3WF3A 3FUOA 2R041 4PIYA 4CDQB 3G6JB 3Q8EA 3ZFEB 5JOWA 4JQRA 1NE6A 4S2FA 4TYSA 4COUA 1RYYA 4CYDA 4JHZA 2W68A 4CPBA 2MHFA 4P9XA 4CU8A 3BKZA 4AFDA 2I74A 2ES3A 2WYFA 5CG9A 4RHV3 1AZDA 1K5MA 3ME2A 4F7ZA 5FBJA 4Q4Y2 2GSYA 2JECA 3ES1A 3SKVA 3AYEA 4M3CE 3VLBB 3D5OA 2I45A 2WAOA 4LBQA 3ZKYA 4IE0A 2CNAA 2OUJA 1B35B 1V6JA 4Q0VA 1AR92 1SEFA 1XBFA 2B7YA 3M3OA 1RGSA 5C9AC 2JB4A 2A5ZA 3EBRA 2TEPA 1GQPA 1JBCA 4ZZ5A 3WHTA 3MW2A 1LOAA 1H2LA 4DY5A 4G9SB 3AZWA 3ITQA 3GZAA 1L3JA 1OT5A 3F95A 3W9AA 4P5YA 4AI8A 4E4DX 1YIFA 4Y1VA 3VHRA 4RGKA 4EV0A 4GA9A 4JDMA 4QDRA 4R8HA 4D6SA 1WW7A 2CAVA 2ZHMA 4R52A 4I3GA 3DXTA 1AR61 3ON7A 5HCBA 4CCCA 3B69A 3GBFA 4YARA 4BH9A 5FZ0A 5T50A 2C5DA 5C3QA 2WJSA 5F3IA 2Z5WA 4DINB 3OB8A 3VKOA 1QWRA 4O7XA 4CU7A 2Q8OA 2Y38A 4IGPA 4FI9A 5LBEA 3RYPA 4Z2AA 1QJX3 4GXLA 5JXHA 4OUMA 2HYKA 4LNVA 2ADEA 4QGLA 4LO4B 1X33A 2D6LX 4EN9B 3B02A 1BEV1 3FFQA 4QPIB 4QX7A 3WQ1A 5JCTA 3ZFEA 2ARCA 4QPIC 1QF3A 2H6BA 2KXLA 4XQ4A 1GP6A 4Y5TA 3VDDA 4A4AA 1O4YA 4XTPA 2KA3A 1ENXA 1K5MB 3SCFA 4AVTA 4M4RA 3V0AA 4YW7A 2GDFA 3K77A 1A8MA 1AYN2 5BY5A 5AC93 3BU7A 5A3OA 1HB2A 4E2GA 2XHNA 2B45X 2RS32 2D98A 1RMU1 1WMDA 1C5IA 1LTEA 5FYMA 3ILNA 1LHWA 5F2WA 5IVEA 2B46X 4FOVA 5F39A 1NLRA 1F15A 3FLPA 4MXVA 5JOYA 5JMCA 1F31A 2E51A 2MPFA 2D3PA 1ND3B 2YXSA 5I8SA 4RA0A 1MS8A 1PO13 1UXZA 2PN5A 2XGXA 2JD9A 3CDZB 2E32A 4H7MA 2GC3A 1AJOA 2QCSB 3SNMA 3K48A 1W9TA 4QPGC 3WNPA 4XOGA 4QGNA 2WZR1 1Q3EA 5HV0A 2HBUA 4GWNA 4YVWC 3LPFA 3ZYPA 3K3NA 1KS5A 3ZSLA 3POIA 4IV3C 3C7HA 4G3YC 1YUDA 1SDWA 1N3PA 3O5SA 1O5UA 4YM0A 1V6KA 3RZHA 2ENRA 1LOBA 4UBHA 2OKXA 5EJ3A 4EWAA 1ND3A 3DN7A 2IXHA 1MZFA 1WLTA 1EV12 1NT0A 2Q0AA 1YFWA 3MF6A 3ZN6B 4Q4Y3 5F3EA 3WP6A 3WV6A 5FZ6A 2C1FA 3I3MA 1KD7A 4MGKE 1UIJA 2ZOEB 3AZYA 1C8M1 3BVCA 2JIGA 5FZEA 2DCZA 2DCTA 1IS5A 2JXAA 3OSDA 1JYWA 3O12A 1W2UA 2J1TA 4PBPA 2DU0A 2XJVA 4HONA 4QM8A 1AR63 3AZXA 1HQWA 3M3EA 3WQBA 4AHWA 2PHRA 3OBTA 2DTYA 1SHWB 2ZEYA 4IESA 1LU1A 4H3WA 2JDKA 1QDCA 3QBQA 3SHRA 1Z0HA 4FQZA 1VAMA 2VBDA 3M4FA 4QDSA 4CZSA 5D1IA 5A1LA 5L7OC 1YEWA 4Z92B 2AEYA 1JZ8A 1D4VB 2V72A 1ALYA 1UYZA 1SBDA 1IPJA 4N43A 1DLLA 4YZ2A 5LBCA 5CZKA 2WNVC 3AMHA 1M4WA 1R081 4V2WA 2ZZQA 4AFAA 4YLZA 3AKPA 4EN7B 5J3UA 1XNAA 1CX1A 3KD4A 3RVHA 3RDIA 4M00A 2WZ8A 5DG1A 2RMU1 2J42A 2C9KA 5CIRA 2QQMA 3MPPG 1DZRA 2VR4A 3AB0A 2R0FA 3AZVA 5FZ4A 4BHPA 5K7PA 3VHOA 4P9JA 2VW0A 3B9CA 5LBFA 3I2OA 1GYKA 2B9VA 4D6RA 3V0BB 3FL7A 1JHJA 1UOFA 3H7YA 4CP1A 3TEZA 4OUSA 2PA7A 4AQSA 2E33A 2XH6A 3FUQA 3UKTA 1ODNA 4EN6B 1NUKA 2WNEA 2XHKA 4UBGA 1A34A 5FZIA 1W3XA 2IZWA 2YPJA 4NWVA 1HXS1 1V6NA 5F6LB 4DXZA 5FREA 2K2SA 1H8VA 1H2MA 3NW4A 3WSOA 4CEWB 3CEWA 1W9WA 1YQ6A 2W1QA 2VZUA 3B9IA 3ZPYA 3SC7X 4I09A 4QB1A 4X6RB 1VB2A 2PHTA 2ZX1A 4WM7C 1QH6A 4PLNA 2WNUA 4P9IA 2JWPA 2JD4A 2Y64A 4E4HA 4FTEA 1JODA 4RHV1 4RYDA 4WM7B 1ND2A 4OHXA 2RDSA 4DPNA 1G7YA 1OF4A 1OVPA 2OPKA 3PU3A 5FV3A 2DYCA 2VUDA 2IC1A 1O3TA 3POGA 2P3IA 3ST7A 5A6YA 1OI6A 2D6OX 2Y33A 1RUJ3 2YBPA 3GCXA 4U36A 3EMRA 1E57A 1LOGA 4UFHA 1XYPA 1X36A 3KF5A 1AR82 2YC0A 2WAAA 4QT6A 4CEWA 2DVAA 4B29A 2EIDA 3AM2A 1ZZ8A 4FTBA 3ACHA 4P00B 5IWFA 3V64A 3NJVA 5IK4A 1GWKA 3LCPA 3P5BA 2WFF2 5FTTC 5FY1A 1ULPA 2V73A 2XJSA 1JOJA 3QD6A 1RHI2 3PL0A 4H14A 1PIV2 4XUQA 5G05L 3WNNA 4AAPA 3LGRA 3MYXA 1V6LA 4JGYB 4CEWC 3A0NA 3DPRB 5E16A 1NQDA 2HWC3 1SMVA 2YPDA 4CDXB 2FDFA 3LPGA 1GZCA 4TWTA 2OIIA 4QX1A 4XF1A 5F2SA 2EA7A 3JB8A 1H0BA 3MIEA 3V0AB 5JOZA 5JMOA 1HB3A 2MNGA 5LEKA 1MS1A 2W47A 2ZGTA 1DU3D 1S55A 1ST8A 3C7EA 2W0XA 3NNFA 1HN0A 3LSEA 2WKKA 3ASIA 3NV2A 3U4XA 2QE3A 2WWSA 4AI1A 2DFCA 5A70A 5KBFA 1UOJA 1JU4A 5IVBA 3ZYFA 1HRI1 4Y4YA 4TN7A 1C5HA 1CQ9A 2Y26A 3N7LA 2ZGQA 4BISA 5FY4A 4HVQA 3PJQA 3D8CA 1TME3 1UZWA 2UWBA 2J22A 1CAUA 3RZMA 4O65A 2WNVB 3WY6A 1LECA 3SH4A 3RNSA 3EQEA 4RL7A 3QLQA 1OXCA 1R091 1FPN1 4XEZA 1AJKA 3C2UA 4MADA 4ZKTB 2RM22 4AWDA 5JIUA 3AKSA 3M3CA 4AGGA 5JXGA 2WNUB 1NXD1 5J7MA 2OYZA 2MEV2 2PHXA 2BP6A 1W2OA 4QX0A 4FOWA 2FDKA 1NCQB 3O1UA 5GZFA 1AR73 5FYTA 2VNOA 4JTOA 4TTGA 2J1AA 2OS2A 4QXHA 5FPBA 1RUF1 1CD3G 2QVSB 2EICA 5DDJ2 1K3IA 1SCSA 4UFIA 5FZ3A 1BK1A 4WM8A 1HRV2 2CL2A 5BNOA 5IVVA 3A21A 5JUVA 1R64A 1GU3A 1PGW2 1HB4A 5FYYA 5JSRA 1EYBA 4M4PA 4C0HA 1ASJ3 1LHOA 3NQHA 3KCYA 5DZFA 3WG3A 4DO0A 4EJRA 3BCWA 2ETEA 1VBD2 4NIDA 1W6MB 1MZEA 2R061 2HWD3 3MIFA 4ET7A 1B09A 2HJIA 1CWPA 3MFCA 2DBNA 3WX5A 1H8TB 1HXS3 3EYPA 5FYIA 3EJKA 5FMOL 1H6XA 3W58A 2X29A 3J7HA 2R062 2YYOA 2CSGA 1VBD1 4AZZA 3ZOIA 2VUAA 3USUB 1O4ZA 1SFNA 4MVTA 5CG8A 3ACFA 4DMIA 2CGPA 2OW4A 1TMF3 2RS13 5FPAA 4QD2A 1RUG3 4CTEA 3WG4A 1FMD1 3SISA 3WDWA 3E5QA 2YBSA 1PZ7A 1XOYA 3UJOA 1VIWB 3H50A 3V56A 1FT9A 3K4AA 1WBFA 3AMNA 1LU2A 1W8OA 3LA7A 2GMEA 1RUG1 4LEJA 3R0RA 3KCCA 3AL6A 4XDPA 1XYNA 4IERA 1H8TA 5FY8A 2D43A 1VBE2 4PDWA 5JI9A 4MXWB 5IK8A 4BLIA 1RUH2 2VBBA 2FCVA 4AFMA 2MEV1 1AXYA 5JZGC 2GMMA 1AYM2 4GALA 3VZJA 2HWF2 5HCAA 1W28A 3LD8A 4B7EA 5LRSA 1HRI3 1AR72 2DVFA 2YC2A 3M7AA 4RS5B 4B3NA 1YYNA 4G4FA 3VL8A 3WF2A 1LOCA 2PAKA 4PDWC 4PF1A 3BU0A 3POYA 2AZ5A 1W05A 3FFZA 1CAXA 4UYBA 3MEPA 5IVJA 4RN5A 2OVUA 3W5MA 2J1SA 3H42B 2VZTA 1G8WA 2W1SA 3VKMA 4KGGA 2DURA 2QQPA 2EIGA 3N4MA 4ES9A 1W0OA 3NV3A 3EXUA 1W6MA 1W8UA 3LEMA 1F5FA 2P3KA 2XKOA 4KH9A 2EIEA 1W8NA 3J8F1 3VGIA 4JDOA 1W04A 1BHGA 5FZ8A 3P3PA 4R9CA 1C3HA 1EPZA 1ZRCA 1T6GC 2W3JA 5FK8A 3PVNA 3ZXJA 2VZPA 5AVAA 4BQ1A 4TSVA 1WKYA 1SACA 1TG7A 3WW1A 1FOD2 1JZ3A 4XMIA 4GB33 4NVPA 5EIYB 5C9AA 4HANA 5F6KA 2VUJA 5FZKA 1F8VA 4LLOA 3OGVA 1SBEA 3ZFFB 4D69A 1VRH3 4Z82A 3WLUA 4DXRA 5LK7B 2L9LA 2VULA 2IVJA 3LA2A 1QJX1 4QB2A 4RSUA 2W92A 1WCKA 1RL3A 2ZGMA 1XYOA 4KNCA 1ONAA 1A6CA 2BNMA 1JOBA 1HIXA 1HDKA 2WFF1 5K4LA 2NMNA 2Q1ZB 4CEYA 1Q8SA 4XILA 4LTAA 5F3CA 1QJX2 3PTRB 1W6QB 1EY2A 1REFA 3ZXAC 5FXWA 3ZSKA 1EP0A 2ZA9A 3T30A 1NXMA 1GSLA 1L7RA 2VZRA 3MHZA 3OG2A 2RHPA 3P6BA 2ZEXA 4IL7A 2B8MA 2ARXA 2VNRA 1XNBA 2GN7A 1TMF1 2RS11 4N9HA 1H1IA 2FDJA 4CCEA 5A32A 4NUBA 3ZFEC 1V70A 4I01A 4ARXA 1XNTA 1ND2B 1WD3A 5L7OB 4XVHA 2VZ1A 4E4SA 3RZJA 1DCSA 4CXXA 4JKLA 1KRIA 5F32A 2JDUA 1CR7A 5K8SA 4HPKB 4W4ZA 2PLV3 1QQP1 3JU9A 4Y22B 3PU8A 1Z78A 5GJ6A 2VXJA 5K0UA 1ODMA 4CU9A 3UKVA 2EXKA 2D7FA 4JV4A 1UQXA 3RI8A 4Q27A 1OLMA 2UYBA 1IS6A 3BYWA 1AF9A 1MS0A 5JPNB 3LB9A 4IV1A 4D8MA 1JYIA 4MO3M 2BEOA 2HWB2 1JZ4A 1DQ1A 2ZX3A 4UAPA 3BN6A 1REEA 5C33A 5FPXA 4PT6A 1ZBA1 3ZFFC 2W94A 5BNNB 2JG8B 4PJYA 3JD72 5EJZB 2HWB1 4DS0A 2D40A 5GZCA 1WMEA 2BV4A 4S2GA 4W6YA 2JDPA 4KBZA 3SMHA 2YU2A 5J48A 5A7NA 2BPA2 1R082 3ZFFA 1POV0 4IV3A 3I3DA 2R043 2XKPA 4MGTA 3I3EA 2RM23 2BUKA 4JAAA 4H55A 1Q56A 5KHHA 3NAPC 2CU5A 3APBA 3RWKX 4F3JA 5CVRA 2JEMA 2QZ3A 5C4WA 1ND3C 4AI3A 3RI9A 2Q8DA 4PHZA 1QNWA 3AFGA 1IG0A 1LHUA 2AR6A 2BVBA 2YG0A 1S0GA 4LHNA 1Q8PA 3ZMOA 1ZA7A 3ZSMA 2ZGKA 3MO4A 3VHPA 2VTXJ 2VZOA 3J4UH 4FPJA 4BM8A 3NAPA 1JU3A 2PLV2 3VDBA 3SEEA 3BUCA 4AQ2A 5C4WC 2FHRA 2DBIA 1DQ0A 1DG6A 5E1RA 2QUOA 5FP9A 3CJIB 2ARAA 4HVRA 3JQXA 3O1PA 4I30A 5FUPA 3LSDA 3FE5A 2ZPXA 4EE2A 2XJUA 3SXWA 3PIGA 4YVSA 1YQ8A 5CFDC 2AREA 4NOTA 3S0MA 3UGGA 2ZS6B 3LZZA 4QPWA 5FOBB 1CIYA 3MZHA 2R32A 3IM0A 3ES4A 1GOHA 1I5PA 1OQ1A 4N43C 5DABA 3Q8AA 4XJUA 3UV9A 3G7DA 1LB2A 3IAQA 3HT1A 4M3CB 1RVF2 3H3UA 1AX0A 3JBG3 3NKTA 4CP9A 2SBAA 3VKFC 1UMIA 1CPMA 2YV8A 1RMU3 1R092 1WLWA 2GC0A 2BBAA 2XWBB 4NRQA 1OD5A 1OQEA 5FKCA 4AF9A 1PGL2 4AOCA 5LA1A 4XDQA 3AL5A 3TEWA 3AP7A 1GNHA 4W6WA 2ZXQA 3ZM8A 1W6PA 3MLJA 2XL7A 3ZO0B 1BVP1 1AVBA 4ZS2A 4Y33A 2VM9A 5FQ0A 1QJY1 2YUEA 3THCA 4JX0A 2WA4A 1BK0A 1C57A 4UW6A 4ZU7A 3KV9A 2VJXA 3VBRB 3VBOB 1LULA 4FQ4A 5FXZA 1YJLA 1NZIA 3VBSC 5HCHA 3J7NA 3U0ZA 2BFUL 4QQHA 4MYEA 2JDMA 3D0SA 3LOBA 1MEC2 1ZBA3 4D3WA 1F9KA 4L11A 4EWEA 5GZGA 3NMBA 1O5LA 4PLOA 5CYYA 1ULGA 3GZUC 5CBLA 3PMEA 3FC0A 3H1YA 2YGMA 4LBJA 4MSVA 3PLQA 3CJIA 4LUKA 2WNUC 1JN2P 5IYYA 1WD4A 3DYMA 2VMIA 4MH0E 2I07B 2BFUS 1ND2C 2W9XA 3FJSA 3Q8BA 4HSJA 3T0AA 4BMBA 2ET7A 1IOAA 1D7PM 5ISLA 1IPSA 4BXSV 1ZZCA 5FYUA 3C7FA 3LKJA 5BNPC 1QJEA 4AAXA 4EN0A 3JXSA 3T4VA 4AGVA 1S4CA 2YFZA 3FWEA 3KCXA 4PBOA 4WZFA 1OURA 3OD0A 2SLIA 3E97A 4EQVA 4QPGA 1OF3A 5JXIA 1RUE1 1WA4A 3OGGA 4BCUA 5ACA2 3PUHA 3NJXA 4FO9A 4YZ1A 4YVWA 2DCKA 4CA9A 5AFBA 2WRAA 4XF0A 2ZGSA 2VMCA 2VTXA 2RR11 5IFTA 2VOVA 1DDLA 1D4M2 3DPRC 5T55A 1LRHA 5HXVA 3H7JA 4AI0A 1QOSA 2CDPA 5FKBA 2PLV1 5TSWA 1RUC3 1O7FA 3ILRA 1W8WA 2P1BA 1KDMA 3PNAA 2XUMA 1QJZA 4HL0A 1NCRB 4XBLA 2C0ZA 3DUIA 2EF6A 5A3WA 1JOPA 2F4LA 3WQ7A 3ZYGA 4CDWA 1UIKA 2XLAA 2RDQA 4IGOA 5CFCA 1DYKA 2XDVA 4OYUA 4QHOA 1AR91 3VDCA 3RMYA 3VBHA 3RFRA 4DIQA 1Q8VA 4A7YA 1NAEA 2B39A 4YGCA 3UT0A 5BYNA 2G19A 2RR12 3K2OA 4ES8A 2XLFA 4GH4B 1HXS2 1PGW1 5IW0A 4RFRB 3UYJA 4Y26A 1W6PB 2C24A 2XL9A 2P37A 2RJ2A 4HZFA 5A1AA 5CFCC 4PI0A 2FD8A 4RR3B 1EUTA 1RUF2 2ZHKA 4OMDA 4IXLA 1DZTA 2WR9A 1D2QA 4GMP3 4Q1RA 1H4HA 4ZXKA 1ZBA2 5F5QA 3TOJA 4BLJA 4XZUG 5EXOA 5E88A 4YW5A 2A1XA 1G9FA 4LA2A 2RM21 2VNGA 4Y5Z0 4F83A 2RMU2 1FPN2 2WWJA 4CCMA 2LUWA 4CCOA 2WLPA 2G1MA 2P4EA 1PVC1 3RSJA 1DLCA 2BGOA 3U11A 4A45A 3NWKA 3VHNA 1JYCA 3GM8A 4JRAA 4XIKA 3W21A 2X10A 1LHVA 4UFLA 4UFKA 3I2FA 3KB5A 1DGRN 1PMHX 2HWB3 2VQAA 3H8OA 3MLKA 3OTFA 2O0OA 4DQAA 3DYOA 1PO11 3GZTB 4XCBA 3VBFC 2E63A 2NLRA 2VAUA 1O91A 2E31A 2XMLA 4WM8C 5A33B 2HWF3 3WNXA 5JAXA 5BNOC 4IQPA 3UNPA 1DYPA 1FNYA 3NAPB 1C8NA 3M2MA 3HIFA 1CGPA 2RVAA 4AXOA 4AYUA 1Y43B 1NCRC 4RD7A 3GALA 3A7QA 3H3ZA 3VBFA 3OYWB 2F4PA 5FFOC 5FO8B 4XJ8A 1OKOA 4Y1YA 3I97A 2W95A 3KV6A 4KU7A 5I8YA 1OA3A 2Y60A 2Q5TA 1UX7A 1AHSA 4P02B 4QKNA 4XURA 4D6QA 3R4SA 3AMMA 1NCRA 4BZ4A 5BUVA 5LA0A 4DUVA 1M06G 5C6CA 4LBOA 2IXKA 1CESA 3WDXA 1KJLA 4CUCA 5KXEA 2WABA 2UU8A 3UKNA 4CCJA 3T2PA 2R063 3U10A 5C3RA 4R9AA 3KMHA 4YZ5A 3T0DA 2WC2A 3GBWA 3RJRA 4OVEA 2PHWA 2ZX4A 5J37A 1YC61 4Y1XA 3ZMNA 2AENA 4DEQA 2EXIA 2ZGOA 3IMMA 5C9AB 4YW4A 2XBO3 2LROA 3I59B 3ZSEA 4Q29A 5LZ6A 1PMIA 3BTYA 1H8TC 2QQVA 1MZ5A 3UGFA 3J7MA 5FYCA 4NPRA 2R6QA 4ORFA 1HRV3 2QTWB 4N53B 1JXNA 3BB6A 5LA9A 1YIPA 2VZQA 3U75A 2XPJA 1OLRA 3KSCA 1PO12 3ETPA 5A33A 3FHQA 1FAYA 2Z2SB 4LITA 3WW3A 4CDQC 1FPN3 1PK6B 2R30A 2WSVA 1RUC1 3ZYJB 4IGQA 1FATA 2VOXA 2R16A 5A3TA 1J1TA 1RITA 4C90A 4I0BA 1EAH1 4XMAA 3E6CC 3ZFGA 4LMFA 1OFNA 1YI9A 4AEJA 5CEHA 3FLRA 3TBDA 2QBXA 2BNNA 2IXIA 5HCFA 2E7QA 1E5HA 5A3PA 1RUF3 1WCSA 5FR3A 2XJPA 1S2KA 1YHFA 4LT5A 2WN2A 4QKBA 5BXXA 4M0HA 4BIFA 2D5HA 1ULCA 2XVGA 3CJXA 1A78A 5A7SA 2VVEA 5I91A 3O1MA 3NNLA 3H8RA 1YLLA 2P17A 3ACGA 3AFKA 4QU2A 4SBVA 5IVFA 1JTZX 1VMJA 1VBE1 2NQYA 3HMYA 3PMSA 4QPGB 2QFEA 4XETA 5DAQA 3OJBA 5CB7A 4A2UA 3AVRA 5EFUA 5FP3A 2JE8A 5A6QA 4E8CA 1QEXA 1SFYA 3AYCA 3PVBB 1ZX5A 2YROA 3HT2A 1LNSA 4W8JA 5I0UA 5EV7A 4K1ZA 1MPXA 1EAH2 5CISA 1BKZA 1QKQA 3V65A 4GKYA 4ISRA 1QIQA 1US3A 2AYHA 2G9FA 1PNGA 3N9LA 4XW3A 2VG9A 3C3VA 3OEBA 3WW4A 3LWCA 3ZYIB 4GMP0 3WZ1A 1LOFA 1KGYA 2YZ4A 4ISQA 2QQUA 2ZAAA 3HN3A 1GOFA 3J9SA 1J3PA 3RZZA 2LS6A 3NL1A 2PAMA 5ACA3 1TMF2 2RS12 2QQLA 3LE0A 4Q1PA 4D94A 1U5ZA 4BK5A 1FNZA 4QX2A 4YW3A 4HKLA 4COVA 3OGRA 4FAHA 1WZXA 5D21A 3AKRA 4FFGA 5FMCA 4IV3B 4LBNA 1TNFA 3LAGA 5A6XA 1G86A 5FLHA 2ZGLA 1W6OB 3ACLA 4XUPA 3FN9A 3VB9A 2LW8A 4YFWA 4IDZA 1STMA 3QOPA 1W9FA 4JGYA 5FZGA 2WDBA 3WW2A 1QXPA 5K9YA 1FOD3 3I2DA 2PHLA 1HN1A 1K12A 1MZ6A 5T5PA 4D7SA 3RJ2X 1JHNA 2R042 2GALA 5J1XA 1VLNA 2UURA 2ZGPA 4YM1A 1CONA 1HX6A 1YI7A 2FMDA 1JUHA 4OCTA 4NRPA 1G6NA 5T5LA 2HLEA 2J1RA 3QH6A 4QXCA 1E5RA 5C7GA 4IV1C 2H0VA 3JQWA 5FZOB 2D3RA 1JI6A 3FHIB 1K5JA 5IFPA 3JD73 1O8SA 1XU1A 1KJRA 4IEUA 3WDVA 4YFZA 5ERLA 1VE0A 3SH5A 3IAPA 1PGSA 3M3QA 4XBNA 5FZCA 1ULEA 3PIJA 4XFBA 4AR2A 2WO2A 4I0AA 1NYWA 5D8AC 5JVVA 1QDOA 5IHRA 1RXGA 3E5XA 1HRI2 1QJY2 2JICA 2WT1A 2GP5A 4XF9A 1VR3A 3TAYA 1AYN1 3MIGA 4Q0PA 2W1UA 2XJTA 5C70A 2ERFA 4UWDA 3I3BA 4NHYA 4AFCA 1RXFA 4HT1T 2NMOA 2ATFA 2RG4A 1E5IA 2A71A 3IMNA 5DXDA 4QX5A 2XJQA 2J1VA 4AL9A 5DN2A 2V5YA 1ULDA 5IVCA 2HWF1 2Q8EA 1YFXA 2PFWA 3SQOA 2W91A 2VVDA 1QOTA 1IKQA 2A3YA 2OZ6A 2XLGA 3CL1A 2BGPA 1E5SA 3ZIWA 4AVVA 2VCCA 1WLDA 2E26A 3Q8CA 2DTWA 4AGRA 1WW5A 1UU6A 4GH4A 2RR13 1UPSA 4RQPB 2HKXA 4L9BA 2VOTA 1DQ6A 3U4SA 1J83A 1F4HA 2BWCA 2OX0A 4BOWA 1IS3A 2E9QA 4I2OA 1CJPA 1R1A1 1D0HA 2W5FA 3OGJA 4QGMA 4LIUA 2C4XA 4HK9A 5FY9A 4E4ZA 3PVOA 2VMHA 4HK8A 1AR62 4Y4RA 2ADDA 4V2VA 3I2JA 3VBRC 3BIWE 1B35C 2WFF3 4YVSB 1KQRA 4LBKA 3SLIA 5IAVA 1O8PA 4CEYB 2W46A 2W39A 4LBLA 3EB7A 4C1WA 3HWJA 4L99A 1CAUB 2OUHA 2P3YA 3ALQA 4YZ4A 3VL9A 4LOSA 4RQPA 1FYUA 1UNBA 4LE3A 1W3VA 1B35A 1DGRA 4DOUA 4AEDC 3GJAA 4UW5A 5B4XA 3ZXGA 4Q4W1 1I6XA 2WT2A 3ATGA 2B5HA 3ZKUA 3UGHA 2LTNA 3B93A 1D4M1 4FXGB 2H6CA 4P9LA 1UYXA 5JR2A 4ONUA 2P5BA 4BIOA 3DYPA 1VBC1 5ACA1 3U37A 4YW6A 1YXWA 4FT8A 1APNA 2VNVA 2VPVA 2WLQA 1JUIA 2QJVA 1H1MA 2ZAHA 3B01A 3I2IA 3IB3A 5DDJ1 4BWOA 1JYVA 4KWUA 3PURA 4R4XA 4QQ2A 2RDNA 4FFIA 1XC6A 2FDGA 4LUMA 3WDTA 5DAPA 3IT8A 1A8DA 3VZLA 1XXNA 4B1LA 2JENA 1W6NB 4UW4A 4XAEA 4XYXA 4YWAA 3WP3A 3PUAA 3K46A 1J58A 4I3PA 3RWNA 4AEKA 3QCWA 1OA4A 4FPYA 1COV1 2LALA 5KC6A 4A44A 2Z42A 4ZHNA 1U12A 2Z79A 5B2GB 4XFHA 2Y6KA 3MIDA 3ZDSA 4M3CF 4R9BA 1KFUL 5AFEA 1VBE3 1RUC2 3TN92 4PQ9A 1RUI2 3HBKA 4GZ9A 1ULFA 4N9IA 1GNZA 1QJU3 2K0GA 1NZCA 3DXUA 4P9YA 3THTA 3IDAA 3N7JA 3IPVB 3WF4A 2YC4A 2GH2A 2O1QA 3N9OA 1KITA 2A6ZA 3GHNA 3L9JT 3OBRA 4LKFA 1PX4A 1WCUA 2JG9C 1RHI3 2DUQA 1DF0A 1UPIA 3O1SA 4ASMB 3I4IA 4QXBA 3L2HA 2D6PA 1PGL1 5SV8A 2JDNA 4GWJA 1N1SA 1D2SA 2P2KA 2YBKA 5GKAC 1Y9MA 5J09A 2UWCA 2V4VA 4FFFA 2OQ6A 5DAVA 4DZGA 4LK7A 1LGCA 4FTSA 2Q8CA 2C6SA 4ASKA 3ZYHA 1AR83 2HYXA 1XSQA 2Q1FA 2UY9A 2RS51 3CZJA 3OPTA 3TRSB 5LCWL 1SPPB 4XFAA 3MUY1 4Q4V1 1VMFA 2VOKA 2TBVA 3KVAA 2Y34A 4IEPA 4NIAA 1H2KA 2HWD1 3I2HA 2VD7A 2XQRA 5KXDA 3I2KA 3NVCA 1XNDA 1G9AA 3K51A 4LULA 2O8QA 3U07A 4N7IA 3OCPA 3E6BA 4CRQA 3O1TA 1QGLA 2AUYA 4JKMA 1DGWX 1OBNA 1QOOA 4JVAA 5JLVA 1AR93 2PYTA 4YVSC 5FY7A 4B4PA 5LATA 2W2IA 4DY3A 3FLTA 1OLME 3LIGA 1UW8A 2Y6FA 4BMEA 4PIXA 3AYDA 2A6VA 3MW3A 4RHV2 4AHZA 4Y1ZA 1BMV1 3OY8A 1UMZA 4WZCA 3LEKA 4LBMA 5KXBA 1GP5A 4XF3A 3WG2A 5GLVA 1RMU2 3AZZA 5JSPA 2WSUA 2ZEZA 4YNIA 5FZ9A 5F3GA 5A1FA 5EWSA 1DGWA 3IN9A 4EYUA 1YQ5A 2WWUA 2GNTA 2R1DA 3MICA 4ZZ8A 4Q2FA 4N7UA 2JDHA 2DU1A 4JGZB 5FCCA 1W0NA 4KG8A 4CCLA 4BQ4A 5CA6A 1UOBA 4JGZC 4Q4W3 1W9YA 3S7EA 4DRRA 3GCWA 2O14A 2ZCWA 5FO9B 1D0GA 3H1WA 4N43B 4YW1A 2VQTA 1IHMA 4R9DA 4QXKA 3U14A 1CZTA 1RB8G 2CGNA 1XPWA 4X6QB 1S0JA 3OY8B 5HI0A 4S2HA 1UZVA 1VBC3 4ITCA 3VBSA 3AP5A 3S6PA 2IFWA 4D7YA 1WCQA 5FYSA 5L19A 1SPPA 1IZ3A 2DVDA 3HD8B 3ZIXA 1I1EA 1O3SA 2BQPA 3PUSA 4FVVA 2FDHA 4ASLA 4J25A 4XIOA 2GH8A 2GNBA 3HAGA 3QH7A 4YVWB 2CAUA 1FXZA 5EPAA 1C28A 5I0TA 4BQ5A 2VW2A 3X29B 2YMZA 3CJIC 4FPGA 4FPKA 4MGSA 1YRZA 2A6WA 1KS4A 1FMD2 1SDDB 1PX3A 1W9SA 3KQ4B 3WDUA 3O14A 4B4QA 5A3UA 2DFBA 3M3IA 3O1RA 3BPSA 4NHMA 2VW1A 1QQP2 5CU1A 4NIIA 5FP4A 1SLCA 5M0TA 3AKQA 1WLCA 1HV0A 1VBB3 3TEXA 2HEWF 3HQXA 2DVGA 3E1F1 1J84A 1VRH1 3AVSA 2WS92 4WM8B 4CDXC 4JRLA 2WYSA 2YU1A 5FZLA 1RUI3 1W90A 3KGZA 4QKFA 3NNJA 5FZ1A 3O0XA 2DVBA 4GIQA 2IXJA 1L7QA 5CKNA 1XRUA 3VBUB 5LASA 1NOVA 1CAXB 2JB8A 1O4TA 3AYAA 5JZGB 3BPZA 2UYAA 4Q4V3 4OZOA 4CUGA 2ZACA 4FFHA 1C8M2 2VU9A 3JUUA 4NHXA 2K9ZA 4E8DA 5FOJB 3ZXDA 1GZTA 2B4KA 5JXJA 4Q4Y1 4GH4C 2H0BA 5DZGA 2F6BA 3MDPA 1RUE2 5F9TA 1VB4A 1BZWA 2JE7A 2XUEA 1F35A 4O9EA 5IT6A 1MS5A 1AL22 4CDWC 3I7DA 1HKDA 2YY1A 2XG3A 1VBA1 4EWDA 3SH3A 1MS3A 5FZDA 4BPZA 4NWWA 4GB32 5E6HA 3CHXA 3VBHC 4DRVA 3ZFGC 1K45A 2CHHA 2D6NA 1UO9A 5FMBA 1MQTB 2B42B 2JKXA 3BGAA 3URFA 3KS7A 1TZOA 3LEIA 4LLFA 1AXZA 4LO5B 3MBWA 1BCXA 2VCMA 2Y6LA 3KHBA 1FV2A 1QQP3 3PUIA 5FJHA 3A22A 2FZ1A 3O1VA 3BALA 4EZHA 4AE2A 4IE7A 1MEC1 1X9TA 3POBA 4PCRA 3W5NA 4LXLA 4UFJA 4X8NA 4FPEA 3MGUA 1WW4A 5CAZA 3FBYA 5DZEA 3POFA 3WR0A 2XB6C 2RJKA 3TEYA 4XC9A 1BBT1 3R6SA 4LBQB 3MV01 1OH4A 1UCXA 4AVAA 2RS31 1PK6C 3MFAA 1PO22 2A75A 3HPNA 1RIRA 3EHKA 2XBO2 1DFQA 4XFGA 4NN0A 2J1UA 2HWE3 2GN3A 4K40A 4HOOA 2A6XA 1X7NA 2RV9A 3CMGA 3A4UA 1AR71 3B94A 4CCNA 2JG8C 3GDBA 3OUHA 5JPMB 2GNMA 4IE4A 4Y20B 4YG6A 1CAWA 1RVF1 4MV2A 2PMWB 4PQQA 4BJ0A 4UF0B 4NIHA 1BEV2 3C7GA 3WF1A 4HPKA 1XE0A 1OUSA 2LRPA 1RUH1 2G9GA 4FPLA 2ID4A 2IWGB 1C1FA 1AX2A 2VMFA 2X05A 3HEIA 1RUG2 2X09A 3RYKA 1JYTA 3IDCB 2QNKA 1W2AX 2CGOA 1LESA 1P8JA 1W6NA 4L8QA 3ZX7A 2R072 2JJ6A 3E5UA 3R4UA 3D0JA 4M01A 2BOJA 1G9BA 4YW2A 1EV13 1VJ2A 2IXLA 1GOGA 4OQ8A 1KFXL 2IVIB 1NA1A 3K3OA 5FJKA 3AX4A 4JGYC 3HR9A 3IKWA 4YG3A 2GMPA 4XJWA 1OVSA 4P5HA 4Y20A 5FPZA 1ACCA 4CUAA 5BNNA 4OI0A 3K4ZA 3LEGA 1BYHA 1ZZBA 3ROUA 5EQUA 1BLZA 3ZN5A 3VDDB 4FAGA 3OPWA 5IUQA 2JDYA 3R05A 4QX3A 5GALA 5LBBA 4N90A 2VY0A 3J26N 1DP0A 3AKTA 2VQUA 5FYZA 1QNYA 1WW6A 1C1LA 4FP2A 4QAWA 1MVEA 2DV9A 5T3NA 4IETA 1S2BA 5LK5A 3BIEA 5DUVA 5D8AB 4Q0SA 3JB4C 1QXRA 4JDNA 3ZVXA 4MLOA 1WCDJ 1N1VA 3T09A 4F8AA 2WO3A 1HRV1 3JBG1 2UWAA 5FIXA 1JZ5A 1GUIA 5H9SA 1X50A 2MEV3 3FZ3A 1S0FA 1Z7S3 1VMHA 4XQDA 1XB9A 3MIHA 1ZA4A 4CP2A 4L2NA 3UJQA 2QDNA 2WZPP 1GV9A 3BODA 3JD71 3RZGA 1BQPA 4UFMA 2RJLA 1UZZA 3ENRA 2E7TA 4OFGA 1V6OA 5DPNA 4IUGA 1PO23 1AL0G 1ZVFA 5FDBA 4D7TA 3VV1A 2AACA 2B9UA 5A7PA 2DWRA 4PDWB 4OQ9A 4XHXA 1TME1 3ELNA 4HETA 5L9RA 4I02A 1DIWA 4LKSA 2VO5A 2J1EA 1X9PA 3LA3A 5A7QA 5IK7A 3MW4A 4LJHA 2RE9A 3ILFA 1H2NA 2V09A 1WMFA 1OLQA 2X8KA 1IG3A 1OA2A 2PELA 2WN3A 1CAVA 3LFMA 4XE9A 5L73A 4Y1UA 4CEYC 1ZBE1 1OOPA 3B3QE 2ZX0A 3NO8A 1D4M3 4C0BA 4JZRA 2E53A 4QB6A 5DUUA 4JCKA 4Q8KA 4WVWA 2TNFA 2ZGUA 4QU1A 1V9U2 4A7ZA 2VVFA 1NA1B 2BYVE 4K6BA 1NCQA 3KV5A 3RMXA 1S1AA 3FX3A 3DEMA 4E9KA 1RUE3 3H8UA 4HN1A 2LM3A 4OHWA 4TLFA 5C5UA 1H9PA 1JMUB 2YFUA 2ZGRA 5I0RA 1LOFC 4RQPC 1V0AA 4MUVA 1EV11 1SBFA 3AC0A 2EXHA 2WQ8A 4IE5A 1V6IA 2WO1A 1GBGA 2QQOA 1NCQC 4FCAA 1OD3A 1H6YA 2D97A 2DF7A 1Q8OA 1LODA 1UD1A 3TYJA 4A7KA 4ZONA 3VD7A 5APAA 2C9AA 2CV6A 4WV8A 4OMCA 3GJBA 5FZAA 1CVNA 1DBNA 1LCLA 3FMGA 5K0UC 2P34A 3KGLA 2QZ2A 4PIZA 1NLQA 2AH2A 1F5JA 1GZWA 1UX6A 4IEZA 4XPVA 2JDAA 2XR4A 3LQCA 4LORA 1I5ZA 1FOD1 3ZYRA 5FLJA 4A6OA 3N9PA 2ET1A 1S0CA 2A3WA 5FLIA 2Y0OA 4IE6A 3NKGA 5SV5A 2XOMA 2X5IA 4AHYA 4EROA 4YGDA 1UY4A 4LK6A 3FBMA 3WG1A 2IFRA 3SKJE 4YGBA 4META 3GF6A 3J8F2 3O0WA 3NNGA 1AUYA 3PDQA 1VAKA 2HH9A 4K8RB 4OI2A 2HBTA 4W6XA 4XJZA 1PVXA 2KM2A 3SEPA 3WF0A 3DKQA 2ZZJA 3VBOC 1ENQA 4BQ3A 2DUOA 4K1YA 2PQSA 1WGPA 1PZ8A 2PTMA 2XVKA 3H9AA 1X8EA 1T6BX 5GZEA 3CNAA 3NV1A 1AYM3 2C26A 1SLLA 1SG3A 1PIV3 1EPWA 3HNYM 1JZ6A 2BBVA 4K9SA 4MZUA 4U2AA 5EJ1B 1ZM1A 4ARYA 2ARBA 4KWKA 2XVLA 4HG6B 3VBOA 4X8PA 2VMEA 4Y24A 4AG4A 1JYNA 1IQAA 3O1OA 1AYM1 1UMHA 3WDYA 3N35A 5GLZA 3ZXFA 5BNQA 2ZKLA 4JC1A 1YCIA 2WQZC 5EHDA 5AC91 1U5IA 3DV8A 4AW7A 4COWA 5FO7B 5C8CA 4GWIA 4URAA 1ASJ1 4DNYA 4Z2WA 2P3JA 3WINE 4IV1B 5A3NA 2FDIA 1J3QA 1SLTA 5ABJA 4XCAA 4BXFA 3B00A 2JDZA 1SLBA 5HV4A 1RTVA 3V0BA 1FI2A 3ZR5A 3B5LB 4I0WB 3AP6A 3USSA 2ZMLA 3HN1A 5C8CC 1GP4A 1XQNA 4DB5A 4HSLA 2DCYA 4MXWA 5H9RA 3WD5A 1LKNA 1FX5A 1OUXA 5ABJC 1IQDC 4Y22A 2ZKNA 1NKGA 1RJ7A 2XJRA 1R1A3 1W2TA 4DUWA 5KR7A 4XDOA 3ZSJA 5B4NA 3POEA 3A0KA 3WNKA 5HPOA 3ZFGB 1ASJ2 1O59A 2WA3A 3JCIA 3MPBA 3VBUC 3VZNA 3ETQA 4AVCA 2VECA 3CQOA 3JZVA 4PI2A 4HKWA 5AVPA 1R083 5FUIA 4TLGA 2R0HA 4OUEA 4GD4A 4IEOA 2PQQA 4OULA 1VAVA 2AC1A 2PHUA 3WUCA 5FBZA 4BYYA 5I0SA 5L9VA 4JQTA 2I2SA 1NG0A 4YGEA 4ZXEA 2NPIA 3DCQA 3GYDA 1W8ZA 2ILMA 4ATFA 5CFCB 4LO7A 3LDBA 4NHKA 1HW5A 1OMIA 3I3QA 1UL9A 2OZJA 5ANQA 3KV4A 4A42A 4AEDA 4IEQA 2VMGA 4NRMA 5FMOS 1PVC3 3AJZA 1SCRA 4RFT0 1POQA 1TEIA 1NE4A 1UXXX 1CN1A 1UY2A 3BTXA 1ULOA 3N9QA 3CBNA 5JZGA 5KHIA 5A7WA 1LAJA 4GJZA 4GAZA 2IXCA 3POSA 3GNEA 2VGDA 4JGZA 4OZXA 1W0PA 2BOIA 5T54A 3W59A 4E2SA 1MS9A 4XFCA 5A3MA 3T0BA 1I9RA 1W8HA 2CDOA 5F5CA 2R1BA 1TQ5A 4XZPA 5LA2A 1K42A 3WT3A 1K5MC 2FZ2A 4NHLA 1DZQA 4QMAA 5ANNA 3DGTA 2OA2A 2WFPA 1ZRIA 1YQCA 1AYN3 1ENSA 4GKXA 3RS6A 2J7MA 4AI2A 3OD4A 5JR7B 5C8CB 5T5JA 1UWWA 4GB31 4MGQA 4CXYA 3HQUA 1Y4WA 1L7LA 1VBA2 2EVXA 5F8PA 4B7KA 5FUNA 2Y8KA 4XQWA 1V6MA 2OXBA 3WNOA 1KXGA 1O3QA 4XFFA 1WBLA 1T2XA 1Q43A 3IDBB 4N8MA 3QACA 2HWC2 4INDA 3PVEA 4RR3C 2YB7A 4C8DA 4AHXA 5KHJA 2W1WA 2FCTA 4CUBA 2DCJA 3ECQA 4V1PA 4J1WA 4ZU5A 4DFSA 3Q9OA 1UU5A 2A3XA 3GBGA 3H0OA 4H2AA 5A3LA 2VC9A 1LENA 1BXHA 4XTMA 4UI9L 5J98B 2CTVA 2ZGNA 5KHKA 4KWJA 1RUD3 5DQ0A 3RQ0A 2BNOA 1PIV1 3SITA 1N1YA 1RHI1 4UOJA 3T2QA 1EUUA 4FBFA 1JZ2A 4WBBA 1JYXA 4B1MA 4DXTA 4O61A 2JG9A 3WCRA 4J6GA 5FZOA 1VRH2 4XF4A 2KD7A 1ZZ7A 1S2EA 4BQ2A 3I2GA 2OQ7A 1QHDA 1LEMA 2Q4SA 5IATA 4H7LA 4XUNA 5H9PA 4YG0A 1OC1A 5LWBA 5EYYA 5A7WB 1Q5OA 1ZRDA 5IK5A 1WMXA 1AR81 3CLPA 3N7MA 1NX9A 4QPIA 1MEC3 1H1AA 1NY71 2P6HA 3P1IA 4LE4A 4YPJA 4AQTA 4Y5SA 1LEDA 4Q26A 4KQ7A 3WHUA 5G04L 3K75B 1I3HA 2BJSA 5BNOB 2NYYA 1J59A 3MIBA 3KT4A 1QJFA 1VPHA 2AEZA 3VD9A 2A6YA 5JIAA 3FHAA 1RUOA 4SLIA 2JG9B 1O3RA 4NAMA 3AMQA 3LDRA 2JKBA 3T2TA 2W87A 4NJ4A 2R073 3SCHA 4AI9A 5KC5A 4ZPIA 1VBA3 3IIAA 3S57A 2BU9A 2BERA 5DAXA 4UT5A 4A41A 2DUPA 2ZABA 1YO8A 1DHKB 1WA6X 5I8TA 5T5OA 3F2ZA 4CDWB 4ATEA 5A6ZA 4K7JA 1RVF3 3JBG2 4WVMA 5A80A 1ENRA 1OKQA 1BEV3 1W39A 1XJAA 2WNOA 3OGSA 2D6KA 4LHSA 4Q8LA 3TNQA 1G9CA 4BB3A 4CP9B 5GLUA 1GQGA 2Q30A 4PLMA 1X82A 1Z7S2 1PK6A 4NROA 4Q4X3 2XONA 3ZXKA 4FOYA 1U5XA 3N36A 3HJRA 2VH9A 4JKKA 5T52A 2CWSA 5IJRA 3VD5A 2FCUA 2HWE2 2GC1A 2O8OA 4YZ3A 3VZOA 1GNYA 1LJ7A 3MUZ1 1MQTC 3UETA 1XE8A 3B7MA 3HVDA 1SLAA 1POV3 1ZNPA 3GHMA 2EAAA 4AVSA 1BBT3 3KHCA 1VBB1 4IEVA 4IW3A 4XACA 3C7OA 4DEVA 2JIJA 3RYRA 1RINA 4QM9A 1LR5A 2WL1A 4UF0A 4W50A 1RUNA 4MG2A 3KT1A 1BJQA 5IVYA 2A70A 1WUVA 3D6EA 5EZWA 3WOGA 3H1MA 5FRAA 4HMZA 3I54A 2FMYA 3THPA 4L0PA 2EALA 1H9WA 1X8MA 3S30A 1RC6A 2VCBA 3WVJA 1HB1A 4C91A 2E6VA 1F4AA 3CO2A 3KF3A 2TUNA 3OYWA 2VQ0A 3MLLA 3WXPA 1RUD1 1S0EA 4TZDA 2ZBJA 2E7AA 1JZ7A 3AK0A 1HJFA 3O7OA 3KLSA 2G9ZA 5BNNC 4KGQA 5L7OA 2BWAA 1XNCA 3TB0A 3ZN6A 4QX8A 4Z1VA 1DQ4A 1YQ2A 5DDJ3 1AL23 1IS4A 3GXUA 4Q0QA 5FK7A 1V9U1 3ZPOA 1DQ5A 2HWC1 4A3ZA 4CDXA 3OPZA 3M70A 5DUWA 1BVVA 3Q8FA 5H9QA 1RUD2 4XFIA 4HLTA 4AEDB 2GNDA 5BNPB 5CFDA 1CAVB 3UL2A 3WEZA 1HJGA 5FZMA 1GICA 5JSOA 1CZSA 1UF2C 2RDRA 4GJYA 4A3XA 1BBT2 2ZMNA 3I59A 3H8XA 4OLLA 4QQPA 4CDQA 1GANA 3CZUA 1TVGA 3BI3A 3ORJA 3EO6A 4B8EA 4E2QA 1CX4A 2QDRA 1CZVA 2BRTA 3KZ4C 1LGBA 3CF6E 2WZR2 3AXDA 5DG2A 1GR3A 3THDA 3TN93 2Z4FA 4P9GA 5JDBA 3VZKA 4KMQA 1O6UA 1KEXA 2VTFA 2YDEA 3ZLIA 5KHGA 1F2NA 2QQJA 5FZHA 2D6MA 4XUTA 3VDDC 4CP0A 3POJA 4NAOA 4NPLA 2PHFA 1NLSA 3KQRA 4N53C 4HXCA 1SQ4A 3BOPA 4EZ4A 2DDUA 2HWE1 2VUCA 3OUJA 1UY0A 4RGGA 3OF1A 1MS4A 2PXJA 2ZHNA 5CNAA 3BTAA 4BA6A 4Q4X1 3U78A 1DGLA 5A32B 4EN8B 2WZR3 4N53A 4M0NA 3MF9A 5GLTA 3I8TA 3N9MA 2ZTNA 1UAIA 1V00A 1OHFA 4DUXA 1VBC2 5CKQA 2VBPA 4LOTA 4YM3A 4LHKA 5LB6A 1G9DA 1UKGA 4AVBA 1HLCA 4QHBA 3RGBA 3ZYBA 4AQ6A 2A73B 5K0UB 1UZ0A 2WINB 3RG0A 2GZWA 3HBZA 1U0AA 4FOQA 2NM1A 1OOPC 4D0QA 1ZRRA 2XWJB 4CXWA 4BK4A 1OPOA 1PMJX 3OBAA 4LO8A 3K4DA 1LOEA 4XJAA 4CCKA 2PHDA 2Y6GA 5BNPA 5C71A 4Z8BA 5GLWA 1SLIA 3IZOA 1JW6A 2FQPA 2HEYF 2WS91 4A6SA 4C1XA 1FV3A 5JOXA 3ZXEA 4B4RA 1NQJA 1W8TA 3UK9A 3WP4A 3OEAA 2ZMKA 5FYHA 4QKDA 5F5AA 5LRRA 1CAWB 4DXSA 4QQOA 4E27A 4HVOA 1H30A 5I0DA 2JG8A 2D3SA 3HNBM 1UY3A 4Q5OA 5I93A 2QKDA 2ZEWA 5DUXA 4Y3OA 2W08A 3DPRA 1ZYBA 4XXPA 1N1TA 4JHTA 5A7OA 5C5TA 1SFPA 5L9BA 5FAXA 3MV11 4AEMA 1R1A2 2CYFA 5CFDB 1UYPA 2R071 1CJDA 4XHBA 1UN1A 3I49A 3VBFB 3VZMA 4FPFA 3S5AA 1V9U3 3IWZA 4XXAA 1C4RA 2QQWA 1W2NA 1W03A 2PAEA 4LHLA 1JS9A 2A7AA 2IUWA 5FXVA 3T3YA 4LPLA 2Y0IA 3OBZA 4RS5C 2VOWA 4KI5M 4XBQA 5C4WB 1NA1C 4XABA 3ZN4A 1GZWB 2Y6HA 2Q1MA 1DYOA 5E8AA 4YRDA 4COZA 1REDA 3OOXA 4BQXA 2K46A 4CDUC 2EIBA 4BU2A 2ZX2A 1Q8QA 1UOGA 1GWLA 2WUHA 1PHMA 2X5IC 5CKMA 2P6CA 4XUOA 5KWRA 2GP3A 3H3LA 2VCAA 4J1XA 4YM2A 3GGLA 4QPYA 2ZHLA 1A3KA 2ORXA 5FZBA 4FPHA 2XBO1 4RS5A 1URXA 1OFSA 4FPOB 3VKNA 1POV1 4UXAA 4CPBD 2WNVA 2WZEA 2V5DA 5GZDA 4Q4X2 4CDUA 1GFF2 4LKDA 5D8AA 4LO6B 3OUIA 1QMJA 5EP9A 3T4HB 1W8FA 2BTVC 3NV4A 1BMV2 3NNMA 4HKOA 2R7EB 4MGZE 4NMIA 1JH5A 1N47A 3ZDVA 3WQ0A 2N7GA 5F5IA 5KXCA 2EAKA 1PNFA 3N9NA 4NIGA 5F7UA 2BZDA 2QQNA 2G4IA 4OI4A 4YSFA 2V4AA 1OH3A 3CKHA 5C3SA 3LFIA 4CDUB 4OI1A 1YWKA 3S5QA 5LEJA 1S0IA 1IPKA 3RRDA 2HWD2 2WBKA 2RMU3 4L97A 2BVVA 4WVVA 5FYBA 3W20A 3POWA 2BW8A 5ABJB 3DECA 4QHZA 5J36A 3HOBA 1AL21 3ZR6A 4XAAA 2VXRA 4P14A 4BE3A 2RS52 3VUOA 3PJYA 4IEYA 4WM7A 2OPWA 3WP5A 2VE1A 1GMMA 1DQ2A 5FPUA 4XJ9A 1J3RA 3VBRA 1UYYA 2JX9A 1OPMA 3DL3A 1KDKA 3M1HA 4S2DA 3VD3A 4AFBA 1RJ8A 3TNPB 3T08A 3PHMA 1N3OA 1QY4A 4K8FA 4K3UA 1QU0A 3N7KA 4QDQA 4URTA 1W6QA 5FPVA 3AXEA 5FZFA 2WIIB 2WQ4A 2WT0A 3VKLA 3CIHA 5L36A 4Z07A 5HXMA 1LGNA 4RGAA 3S7IA 3IBMA 3KT7A 5DMYA 1OSGA 3O0VA 4K20A 4GULA 3WUDA 3DF0A 4ZS3A 1CPNA 4NO4A 5FMDA 3HNMA 1QH7A 4KL1A 1ZRFA 4MGYE 1GLHA 2Z69A 1Y9QA 1YFYA 5FWEA 1S0DA 5C3OA 2NZ9A 1HQLA 1RUI1 4ZU4A 3L2YA 4QQLA 3USUA 4MOAA 3M8LA 4WVZA 5BV6A 2W52A 2WO7A 3LDKA 1MR5A 1RUJ1 1Y3TA 1QJU2 2WS93 4LA3A 1R1ZA 1TME2 3VBSB 4CVUA 1VBB2 3GZEA 2BDRA 3NRUA 1XSRA 4MHUA 2GU9A 2YGLA 4NR1A 2FBEA 4NE9A 4UW3A 3NJYA 3NSTA 4MHRA 4L92A 2RS33 1OQDA 1N3QA 1W06A 5HBAA 1FMD3 5AC92 1IGOA 4CSWA 5BPXA 2R49A 4LIVA 3AP9A 1US2A 5C3PA 4MX3A 2BGCA 4OHZA 4HBNA 4LBQD 1Z7S1 4LKEA 3R4DB 5D2AA 1HQNA 1VALA 1J1LA 2X5IB 3J8F3 4FXKB 4KBBA 3AP4A 1TNRA 3P3NA 1YNAA 1VP6A 5FY5A 3BTZA 2AGSA 3KVBA 3DKWA 3VBHB 4OHVA 3ACIA 2HEVF 1Y7BA 3WNMA 1W99A 4Q4W2 1UKRA 3SCGA 5CADA 2VZVA 3AMPA 2JE9A 3D3AA 4RR3A 2YHJA 3T1LA 4FSJA 2F17A 3WCSA 2GC2A 3CU7A 4LQRA 4BDVB 4TXWA 5FQ0B 3UESA 1W6OA 4BQYA 3LIHA 2VMDA 1U5YA 4R4ZA 2Y6JA 4KG0A 2VZ3A 2NP0A 5F37A 1QJU1 1RUJ2 1NY72 2ZJCA 4OHYA 1LHNA 4KWLA 3RZKA 3KWVA 2EXJA 1GQHA 2D44A 2D5FA 3HQRA 4CCDA 5IAXA 1ZREA 1VRBA 1HV1A 4COYA 1R093 2UY8A 3C8XA 1C8M3 2QQIA 3WNLA 1AXKA 2QQKA 4LR4A 4Q4V2 4QWNA 4CU6A 1ZZ6A 4W65A 3VN4A 1UU4A 4BQWA 3BOWA 4GQ7A 3NJZA 1CIWA 1RUH3 3RPQA 3T1MA 2VZSA 3D4KA 3LOIA 3IDEA 3VDAA 3PTYA 4HN0A
chains in the Genus database with same CATH topology
3INAA 4O9GA 2NN8A 2RS53 3N3HA 5F1RA 1XE7A 4M3CA 5EYXA 4AK3A 5C8WA 1S0BA 4HFSA 1TE1B 1GKBA 4GMP1 1XU2A 1MVQA 1UZYA 4FP3A 3VBUA 1ZBE2 2GAUA 3MI8A 1H4GA 2CWMA 1PM7A 1IKPA 1PO21 3ZXLA 4GWMA 4JTNA 5J96B 3KM5A 4KU8A 2D93A 5JWPA 3D82A 3TN91 4FPCA 4Q0UA 3TWIA 4K21A 1COV3 2X53S 1QJY3 1QXJA 1VBD3 5E89A 4AVVA 4LT5A 1YJKA 3AJYA 4WVMB 4IEXA 1COV2 1XNKA 1PVC2 4YYOA 4P9WA 1MACA 5JI7A 4PF5A 2CY6A 3IPVA 1OOPB 5GM0A 1MQTA 1YFUA 4IEWA 1EAH3 1GZ9A 1PZ9A 1ZZ9A 1AX1A 1ZBE3 4MGIE 3E6DA 3FUOA 2R041 4PIYA 4CDQB 3G6JB 3ZFEB 5JOWA 4JQRA 1NE6A 4S2FA 4TYSA 4COUA 4CYDA 2W68A 2MHFA 4P9XA 4AFDA 2I74A 2ES3A 5CG9A 4RHV3 1AZDA 1K5MA 3ME2A 4F7ZA 4Q4Y2 2GSYA 2JECA 3ES1A 3AYEA 4M3CE 3VLBB 3D5OA 2I45A 4LBQA 2CNAA 2OUJA 1B35B 1V6JA 4Q0VA 1AR92 1SEFA 2B7YA 3M3OA 1RGSA 5C9AC 2A5ZA 3EBRA 2TEPA 1JBCA 3WHTA 3MW2A 1LOAA 1H2LA 4DY5A 4G9SB 3AZWA 3GZAA 1L3JA 3W9AA 4AI8A 4E4DX 1YIFA 4Y1VA 3VHRA 4EV0A 4GA9A 4JDMA 4R8HA 1WW7A 2CAVA 2ZHMA 4R52A 4I3GA 1AR61 5HCBA 3B69A 3GBFA 4YARA 4BH9A 5T50A 2C5DA 2WJSA 2Z5WA 4DINB 3VKOA 1QWRA 2Q8OA 2Y38A 3RYPA 1QJX3 4GXLA 4OUMA 2HYKA 4LNVA 4QGLA 4LO4B 1X33A 2D6LX 4EN9B 3B02A 1BEV1 3FFQA 4QPIB 3WQ1A 5JCTA 3ZFEA 4QPIC 1QF3A 2H6BA 2KXLA 4XQ4A 3VDDA 1O4YA 4XTPA 2KA3A 1ENXA 1K5MB 3SCFA 4AVTA 3V0AA 2GDFA 1A8MA 1AYN2 5BY5A 5AC93 3BU7A 4E2GA 2B45X 2RS32 2D98A 1RMU1 1WMDA 1C5IA 1LTEA 3ILNA 1LHWA 2B46X 4FOVA 1NLRA 3FLPA 4MXVA 5JOYA 5JMCA 1F31A 2E51A 2MPFA 2D3PA 1ND3B 2YXSA 5I8SA 4RA0A 1MS8A 1PO13 2PN5A 2XGXA 4H7MA 2GC3A 1AJOA 2QCSB 3SNMA 3K48A 4QPGC 4XOGA 4QGNA 2WZR1 1Q3EA 4GWNA 4YVWC 3ZYPA 1KS5A 3ZSLA 4IV3C 4G3YC 1YUDA 1SDWA 1N3PA 3O5SA 1O5UA 4YM0A 1V6KA 2ENRA 1LOBA 4UBHA 4EWAA 5EJ3A 1ND3A 3DN7A 2IXHA 1MZFA 1WLTA 1EV12 2Q0AA 1YFWA 3MF6A 3ZN6B 4Q4Y3 3WP6A 3WV6A 2C1FA 1KD7A 4MGKE 1UIJA 2ZOEB 3AZYA 1C8M1 2DCZA 2DCTA 1IS5A 2JXAA 3O12A 1W2UA 4PBPA 2DU0A 2XJVA 4QM8A 1AR63 3AZXA 1HQWA 3M3EA 4AHWA 2PHRA 3OBTA 2DTYA 4IESA 1LU1A 4H3WA 1QDCA 3QBQA 3SHRA 1Z0HA 4FQZA 1VAMA 3M4FA 4CZSA 5L7OC 5D1IA 4Z92B 1D4VB 1ALYA 1SBDA 1IPJA 4N43A 1DLLA 4YZ2A 2WNVC 3AMHA 1M4WA 1R081 4AFAA 2ZZQA 4YLZA 3AKPA 4EN7B 5J3UA 3KD4A 3RDIA 4M00A 5DG1A 2RMU1 5CIRA 3MPPG 1DZRA 3AZVA 3AB0A 2R0FA 4BHPA 5K7PA 3VHOA 4P9JA 2VW0A 3B9CA 1GYKA 3V0BB 3H7YA 4CP1A 4OUSA 2PA7A 4AQSA 3UKTA 2XH6A 3FUQA 4EN6B 2WNEA 2XHKA 4UBGA 2IZWA 2YPJA 4NWVA 1HXS1 1V6NA 5F6LB 4DXZA 5FREA 2K2SA 1H8VA 1H2MA 3NW4A 4CEWB 3CEWA 3ZPYA 3B9IA 4I09A 4X6RB 1VB2A 2PHTA 2ZX1A 4WM7C 1QH6A 4PLNA 2WNUA 4P9IA 4FTEA 2JD4A 4RHV1 4WM7B 1ND2A 4OHXA 4DPNA 1G7YA 2OPKA 2DYCA 1O3TA 2IC1A 2P3IA 3ST7A 1OI6A 2D6OX 1RUJ3 4U36A 1E57A 1LOGA 1XYPA 1X36A 1AR82 2YC0A 4QT6A 4CEWA 2DVAA 4B29A 3AM2A 1ZZ8A 4FTBA 3V64A 5IK4A 3LCPA 2WFF2 5FTTC 2V73A 2XJSA 1JOJA 3QD6A 1RHI2 4H14A 1PIV2 3LGRA 3MYXA 1V6LA 4JGYB 4CEWC 3A0NA 3DPRB 5E16A 1NQDA 2HWC3 1SMVA 4CDXB 1GZCA 4TWTA 2OIIA 4XF1A 2EA7A 3JB8A 1H0BA 3MIEA 3V0AB 5JOZA 5LEKA 2MNGA 1MS1A 2ZGTA 4GH4A 1DU3D 1S55A 2W0XA 3U4XA 3LSEA 2WKKA 3ASIA 3NV2A 2QE3A 2WWSA 4AI1A 2DFCA 5KBFA 1HRI1 4Y4YA 1C5HA 1CQ9A 2Y26A 3N7LA 2ZGQA 4HVQA 3PJQA 3D8CA 1TME3 2UWBA 1CAUA 2WNVB 3WY6A 1LECA 3SH4A 3RNSA 3EQEA 4RL7A 3QLQA 4XEZA 1R091 1FPN1 5TSWA 1AJKA 3C2UA 4ZKTB 2RM22 4AWDA 5JIUA 3AKSA 3M3CA 4AGGA 2WNUB 1NXD1 5J7MA 2OYZA 2MEV2 2PHXA 4FOWA 1NCQB 5GZFA 1AR73 2VNOA 4JTOA 1RUF1 1CD3G 2QVSB 5DDJ2 1SCSA 1BK1A 4WM8A 1HRV2 2CL2A 5BNOA 1PGW2 5JSRA 1EYBA 4C0HA 1ASJ3 1LHOA 3KCYA 5DZFA 3WG3A 4EJRA 3BCWA 2ETEA 1VBD2 2R061 1W6MB 1MZEA 2HWD3 3MIFA 1B09A 2HJIA 3MFCA 3WX5A 1H8TB 1HXS3 3EJKA 5FMOL 3W58A 2X29A 2R062 2YYOA 1VBD1 2VUAA 3USUB 1O4ZA 1SFNA 4MVTA 5CG8A 4DMIA 2CGPA 2OW4A 1TMF3 2RS13 4QD2A 1RUG3 4CTEA 3WG4A 1FMD1 3SISA 3WDWA 3E5QA 1PZ7A 3UJOA 1VIWB 3H50A 3V56A 1FT9A 1WBFA 3AMNA 1LU2A 3LA7A 2GMEA 1RUG1 4LEJA 3R0RA 3KCCA 1XYNA 4IERA 1H8TA 2D43A 1VBE2 4PDWA 5JI9A 4MXWB 5IK8A 4BLIA 1RUH2 4AFMA 2MEV1 1AXYA 5JZGC 2GMMA 1AYM2 4GALA 3VZJA 2HWF2 5HCAA 4B7EA 5LRSA 1HRI3 1AR72 2DVFA 3M7AA 4RS5B 4B3NA 1YYNA 4G4FA 3VL8A 1LOCA 2PAKA 4PDWC 3POYA 2AZ5A 3FFZA 1CAXA 3MEPA 2OVUA 1G8WA 3VKMA 4KGGA 2DURA 2QQPA 2EIGA 3N4MA 4ES9A 1W0OA 3NV3A 3EXUA 1W6MA 1F5FA 2P3KA 2XKOA 4KH9A 3VGIA 3J8F1 4JDOA 3P3PA 4R9CA 1C3HA 1EPZA 1ZRCA 1T6GC 3PVNA 3ZXJA 5AVAA 4BQ1A 4TSVA 1SACA 3WW1A 1FOD2 4XMIA 4GB33 4NVPA 5C9AA 4HANA 5F6KA 2VUJA 1F8VA 4LLOA 1SBEA 3ZFFB 4D69A 1VRH3 4Z82A 3WLUA 5LK7B 2VULA 3LA2A 4RSUA 1QJX1 1WCKA 1RL3A 2ZGMA 1XYOA 4KNCA 1ONAA 1A6CA 1HIXA 2BNMA 1HDKA 2WFF1 2NMNA 2Q1ZB 4CEYA 1Q8SA 4XILA 4LTAA 1QJX2 1W6QB 1EY2A 1REFA 3ZXAC 3ZSKA 1EP0A 2ZA9A 1NXMA 1GSLA 2RHPA 4IL7A 2B8MA 2ARXA 2VNRA 1XNBA 2GN7A 1TMF1 2RS11 4N9HA 1H1IA 5A32A 3ZFEC 1V70A 4I01A 1ND2B 1WD3A 5L7OB 4E4SA 1KRIA 1CR7A 5K8SA 4HPKB 2PLV3 1QQP1 3JU9A 4Y22B 5GJ6A 1Z78A 5K0UA 3UKVA 2EXKA 2D7FA 4JV4A 3RI8A 4Q27A 2UYBA 1IS6A 1AF9A 1MS0A 5JPNB 3LB9A 4IV1A 1JYIA 2BEOA 2HWB2 1DQ1A 2ZX3A 5C33A 1REEA 5FPXA 3ZFFC 1ZBA1 5BNNB 2JG8B 4PJYA 3JD72 4DS0A 2HWB1 2D40A 5GZCA 1WMEA 4W6YA 4S2GA 3SMHA 5J48A 2BPA2 1R082 3ZFFA 1POV0 4IV3A 2R043 2XKPA 2RM23 2BUKA 4JAAA 4H55A 1Q56A 5KHHA 3NAPC 3APBA 4F3JA 5CVRA 2JEMA 2QZ3A 5C4WA 1ND3C 4AI3A 3RI9A 1QNWA 3AFGA 1LHUA 2AR6A 2BVBA 1S0GA 4LHNA 1Q8PA 3ZMOA 3ZSMA 2ZGKA 3VHPA 4BM8A 3J4UH 4FPJA 3NAPA 2PLV2 4AQ2A 5C4WC 2FHRA 1DQ0A 1DG6A 5E1RA 2QUOA 3CJIB 4HVRA 3JQXA 4I30A 3LSDA 3FE5A 2ZPXA 2XJUA 3SXWA 4YVSA 5CFDC 2AREA 4NOTA 3S0MA 2ZS6B 3LZZA 5FOBB 3MZHA 2R32A 3IM0A 3ES4A 1OQ1A 4N43C 4XJUA 3UV9A 3G7DA 1LB2A 4M3CB 3HT1A 1RVF2 3H3UA 1AX0A 3JBG3 3NKTA 2SBAA 3VKFC 1CPMA 2YV8A 1RMU3 1R092 1WLWA 2GC0A 2XWBB 4AF9A 1PGL2 1OD5A 1OQEA 4XDQA 3AP7A 1GNHA 4W6WA 1W6PA 3MLJA 2XL7A 3ZO0B 1BVP1 1AVBA 5FQ0A 1QJY1 2YUEA 2WA4A 1C57A 4UW6A 4ZU7A 3VBRB 3VBOB 1LULA 4FQ4A 1YJLA 3VBSC 3U0ZA 2BFUL 4QQHA 4MYEA 3D0SA 3LOBA 1MEC2 1ZBA3 4D3WA 1F9KA 4L11A 4EWEA 5GZGA 1O5LA 4PLOA 1ULGA 3GZUC 5CBLA 3PMEA 3FC0A 3H1YA 2YGMA 4LBJA 4MSVA 3PLQA 3CJIA 4LUKA 2WNUC 1JN2P 1WD4A 2VMIA 4MH0E 2I07B 2BFUS 1ND2C 3FJSA 4BMBA 4HSJA 2ET7A 1IOAA 1ZZCA 5BNPC 3LKJA 4EN0A 4AGVA 3KCXA 4WZFA 3FWEA 4PBOA 3OD0A 2SLIA 3E97A 4QPGA 1RUE1 1WA4A 3OGGA 4BCUA 5ACA2 4FO9A 4YZ1A 4YVWA 2DCKA 5AFBA 4XF0A 2ZGSA 2RR11 2VOVA 1DDLA 1D4M2 3DPRC 5T55A 1LRHA 5HXVA 3H7JA 4AI0A 1QOSA 2PLV1 1RUC3 1O7FA 3ILRA 1KDMA 3PNAA 2XUMA 1QJZA 4HL0A 1NCRB 4XBLA 2C0ZA 3DUIA 2EF6A 3WQ7A 4CDWA 3ZYGA 1UIKA 2XLAA 5CFCA 1DYKA 1AR91 3RMYA 3VBHA 1Q8VA 4A7YA 2B39A 4YGCA 5BYNA 2RR12 4ES8A 2XLFA 4GH4B 1HXS2 1PGW1 4Y26A 1W6PB 4HZFA 2XL9A 2P37A 5CFCC 4RR3B 1RUF2 2ZHKA 4IXLA 1DZTA 1D2QA 4GMP3 4Q1RA 1H4HA 4ZXKA 1ZBA2 5F5QA 3TOJA 4BLJA 5EXOA 5E88A 4YW5A 1G9FA 4LA2A 2RM21 2VNGA 4Y5Z0 4F83A 2RMU2 1FPN2 2LUWA 2WLPA 1PVC1 3RSJA 3U11A 3NWKA 3VHNA 1JYCA 4JRAA 4XIKA 1LHVA 3KB5A 1DGRN 2HWB3 2VQAA 3MLKA 3OTFA 2O0OA 4DQAA 1PO11 3GZTB 3VBFC 2E63A 2NLRA 1O91A 5A33B 5JAXA 4WM8C 2HWF3 3WNXA 5BNOC 4IQPA 1DYPA 1FNYA 3NAPB 1C8NA 3M2MA 3HIFA 1CGPA 4AXOA 4AYUA 1Y43B 1NCRC 4RD7A 3GALA 3H3ZA 3VBFA 3OYWB 2F4PA 5FFOC 5FO8B 4XJ8A 4Y1YA 4KU7A 5I8YA 1OA3A 2Q5TA 1AHSA 3R4SA 3AMMA 1NCRA 4BZ4A 5BUVA 1M06G 5C6CA 4LBOA 2IXKA 1CESA 3WDXA 1KJLA 5KXEA 2UU8A 3UKNA 2R063 3U10A 4R9AA 3KMHA 4YZ5A 2WC2A 3GBWA 3RJRA 4OVEA 2PHWA 2ZX4A 5J37A 4Y1XA 3ZMNA 2AENA 2EXIA 2ZGOA 5C9AB 4YW4A 2XBO3 3I59B 3ZSEA 4Q29A 1PMIA 1H8TC 1MZ5A 4NPRA 2R6QA 4ORFA 1HRV3 4N53B 1JXNA 3BB6A 1YIPA 2XPJA 1OLRA 3KSCA 1PO12 5A33A 1FAYA 2Z2SB 3WW3A 4CDQC 1FPN3 2WSVA 1PK6B 2R30A 1RUC1 3ZYJB 1FATA 2VOXA 2R16A 1J1TA 1RITA 4C90A 4I0BA 1EAH1 4XMAA 3E6CC 3ZFGA 1OFNA 1YI9A 4AEJA 3FLRA 3TBDA 2BNNA 2IXIA 5HCFA 2E7QA 1RUF3 1WCSA 2XJPA 1S2KA 1YHFA 5BXXA 4M0HA 4BIFA 2D5HA 1ULCA 2XVGA 3CJXA 1A78A 5I91A 2VVEA 1YLLA 2P17A 3AFKA 4QU2A 4SBVA 1JTZX 1VBE1 2NQYA 3HMYA 3PMSA 4QPGB 2QFEA 4XETA 5CB7A 3OJBA 4A2UA 5EFUA 1SFYA 3AYCA 3PVBB 1ZX5A 2YROA 3HT2A 5I0UA 5EV7A 4K1ZA 1EAH2 1BKZA 1QKQA 3V65A 4GKYA 4ISRA 2AYHA 2G9FA 1PNGA 4XW3A 2VG9A 3C3VA 3WW4A 3LWCA 3ZYIB 4GMP0 3WZ1A 1LOFA 2YZ4A 4ISQA 2ZAAA 3J9SA 1J3PA 3RZZA 3NL1A 2PAMA 5ACA3 1TMF2 2RS12 4Q1PA 4D94A 1U5ZA 1FNZA 4YW3A 4HKLA 4COVA 4FAHA 3AKRA 4IV3B 4LBNA 1TNFA 3LAGA 1G86A 5FLHA 2ZGLA 3ACLA 1W6OB 4YFWA 3QOPA 4JGYA 3WW2A 1QXPA 5K9YA 1FOD3 3I2DA 2PHLA 1MZ6A 5T5PA 4D7SA 3RJ2X 1JHNA 2R042 2GALA 1VLNA 2UURA 2ZGPA 4YM1A 1CONA 1HX6A 1YI7A 2FMDA 1JUHA 1G6NA 5T5LA 3QH6A 4IV1C 2H0VA 3JQWA 2D3RA 3FHIB 3JD73 1XU1A 1KJRA 4IEUA 3WDVA 4YFZA 3SH5A 1PGSA 3M3QA 4XBNA 1ULEA 4XFBA 4I0AA 1NYWA 5D8AC 5JVVA 1QDOA 3E5XA 1HRI2 1QJY2 2JICA 2WT1A 4XF9A 1VR3A 3TAYA 1AYN1 3MIGA 4Q0PA 2XJTA 2ERFA 4AFCA 4HT1T 2NMOA 2ATFA 2A71A 3IMNA 5DXDA 4QX5A 2XJQA 2V5YA 1ULDA 2HWF1 1YFXA 2PFWA 2VVDA 1QOTA 1IKQA 2A3YA 2OZ6A 2XLGA 3CL1A 3ZIWA 1WLDA 2DTWA 4AGRA 1WW5A 1UU6A 2RR13 1UPSA 4RQPB 2HKXA 4L9BA 1DQ6A 4BOWA 2BWCA 4I2OA 1IS3A 2E9QA 1CJPA 1R1A1 1D0HA 3OGJA 4QGMA 4HK9A 4E4ZA 3PVOA 2VMHA 4HK8A 1AR62 3VBRC 3BIWE 1B35C 2WFF3 4YVSB 1KQRA 4LBKA 3SLIA 4CEYB 2W39A 4LBLA 4C1WA 3HWJA 4L99A 1CAUB 2OUHA 4YZ4A 3ALQA 3VL9A 4RQPA 1FYUA 4LE3A 1B35A 1DGRA 4DOUA 4AEDC 4UW5A 3ZXGA 4Q4W1 1I6XA 2WT2A 3ATGA 2B5HA 2LTNA 3B93A 1D4M1 4FXGB 2H6CA 4P9LA 4ONUA 4BIOA 1VBC1 5ACA1 1YXWA 4FT8A 1APNA 2VPVA 5DDJ1 2WLQA 1JUIA 2QJVA 1H1MA 2ZAHA 3B01A 4BWOA 4R4XA 4QQ2A 4LUMA 3WDTA 3IT8A 1A8DA 3VZLA 1XXNA 2JENA 1W6NB 4UW4A 4XYXA 3WP3A 1J58A 4I3PA 3RWNA 4AEKA 3QCWA 1OA4A 4FPYA 1COV1 2LALA 5KC6A 2Z42A 1U12A 2Z79A 5B2GB 4XFHA 3MIDA 3ZDSA 4M3CF 4R9BA 1KFUL 5AFEA 1VBE3 1RUC2 3TN92 4PQ9A 1RUI2 4N9IA 1ULFA 1GNZA 1QJU3 2K0GA 1NZCA 4P9YA 3THTA 3N7JA 3IPVB 2GH2A 2O1QA 1KITA 2A6ZA 3GHNA 3L9JT 3OBRA 2JG9C 1RHI3 2DUQA 1DF0A 1UPIA 4ASMB 3I4IA 3L2HA 2D6PA 1PGL1 5SV8A 1N1SA 1D2SA 2P2KA 5GKAC 5J09A 2UWCA 4DZGA 1LGCA 4FTSA 1AR83 2UY9A 2RS51 3TRSB 4XFAA 4Q4V1 2VOKA 2TBVA 4IEPA 1H2KA 2HWD1 5KXDA 1G9AA 3NVCA 1XNDA 3K51A 4LULA 2O8QA 3U07A 4N7IA 3OCPA 3E6BA 4CRQA 1QGLA 2AUYA 1DGWX 1QOOA 4JVAA 5JLVA 1AR93 2PYTA 4YVSC 4B4PA 4DY3A 3FLTA 4BMEA 1UW8A 4PIXA 3AYDA 2A6VA 3MW3A 4RHV2 4AHZA 4Y1ZA 1BMV1 3OY8A 1UMZA 4WZCA 4LBMA 5KXBA 4XF3A 3WG2A 5GLVA 1RMU2 3AZZA 5JSPA 2WSUA 4YNIA 5EWSA 1DGWA 3IN9A 2GNTA 2R1DA 3MICA 4Q2FA 4N7UA 2DU1A 4JGZB 5FCCA 4KG8A 5CA6A 4JGZC 4Q4W3 4DRRA 3S7EA 2ZCWA 5FO9B 1D0GA 3H1WA 4N43B 4YW1A 1IHMA 4R9DA 4QXKA 1RB8G 2CGNA 4X6QB 1S0JA 3OY8B 5HI0A 1VBC3 4ITCA 3VBSA 3AP5A 2IFWA 4D7YA 5L19A 1IZ3A 2DVDA 3HD8B 3ZIXA 1I1EA 1O3SA 2BQPA 4FVVA 4ASLA 4XIOA 2GH8A 2GNBA 3HAGA 3QH7A 4YVWB 2CAUA 1FXZA 1C28A 5I0TA 2VW2A 3X29B 2YMZA 3CJIC 4FPGA 4FPKA 1YRZA 2A6WA 1KS4A 1FMD2 3WDUA 4B4QA 3O14A 2DFBA 3M3IA 4NHMA 2VW1A 1QQP2 5CU1A 1SLCA 3AKQA 1WLCA 1HV0A 1VBB3 2HEWF 3HQXA 2DVGA 4CDXC 1VRH1 4WM8B 2WS92 4JRLA 1RUI3 3KGZA 3O0XA 2DVBA 4GIQA 2IXJA 1XRUA 3VBUB 1NOVA 1CAXB 1O4TA 3AYAA 5JZGB 3BPZA 2UYAA 4Q4V3 2ZACA 5FOJB 1C8M2 2VU9A 3JUUA 2K9ZA 3ZXDA 4Q4Y1 4GH4C 2H0BA 5DZGA 2F6BA 3MDPA 1RUE2 5F9TA 1VB4A 1BZWA 2JE7A 4O9EA 5IT6A 1MS5A 1AL22 4CDWC 3I7DA 1HKDA 2YY1A 2XG3A 1VBA1 4EWDA 3SH3A 1MS3A 4BPZA 4NWWA 4GB32 3VBHC 4DRVA 3ZFGC 2D6NA 1MQTB 2B42B 3URFA 3KS7A 4LLFA 1AXZA 4LO5B 1BCXA 1FV2A 1QQP3 2FZ1A 3BALA 4AE2A 1MEC1 4PCRA 4X8NA 4FPEA 3MGUA 1WW4A 5CAZA 3FBYA 5DZEA 3WR0A 2XB6C 2RJKA 1BBT1 3R6SA 4LBQB 4AVAA 1UCXA 2RS31 1PK6C 3MFAA 1PO22 2A75A 1RIRA 3EHKA 2XBO2 1DFQA 4XFGA 4NN0A 2HWE3 2GN3A 4K40A 2A6XA 1X7NA 3A4UA 1AR71 3B94A 2JG8C 5JPMB 2GNMA 4Y20B 4YG6A 1CAWA 1RVF1 4MV2A 1BEV2 4HPKA 4FPLA 1RUH1 2G9GA 2IWGB 1C1FA 1AX2A 1RUG2 3RYKA 3IDCB 2QNKA 2CGOA 1LESA 1W6NA 4L8QA 3ZX7A 2R072 2JJ6A 3E5UA 3R4UA 3D0JA 4M01A 1G9BA 4YW2A 1EV13 1VJ2A 2IXLA 1KFXL 1NA1A 3AX4A 4JGYC 3HR9A 3IKWA 4YG3A 2GMPA 4XJWA 4P5HA 4Y20A 5FPZA 4OI0A 5BNNA 1BYHA 1ZZBA 3ROUA 3ZN5A 3VDDB 4FAGA 5IUQA 3R05A 5GALA 4N90A 2VY0A 3J26N 3AKTA 1QNYA 1WW6A 1C1LA 4FP2A 1MVEA 2DV9A 5T3NA 4IETA 1S2BA 5LK5A 5DUVA 5D8AB 4Q0SA 3JB4C 1QXRA 4JDNA 3ZVXA 4MLOA 1WCDJ 1N1VA 4F8AA 1HRV1 3JBG1 2UWAA 5H9SA 1X50A 2MEV3 3FZ3A 1S0FA 1Z7S3 4XQDA 3MIHA 1ZA4A 4CP2A 4L2NA 3UJQA 2QDNA 2WZPP 1GV9A 3BODA 3JD71 1BQPA 2RJLA 1UZZA 3ENRA 2E7TA 4OFGA 1V6OA 1PO23 1AL0G 1ZVFA 5FDBA 4D7TA 3VV1A 2B9UA 2DWRA 4PDWB 4XHXA 1TME1 3ELNA 4HETA 4I02A 1DIWA 3LA3A 5IK7A 3MW4A 2RE9A 3ILFA 1H2NA 2V09A 1WMFA 1OLQA 2X8KA 1OA2A 2PELA 1CAVA 4XE9A 5L73A 4Y1UA 4CEYC 1ZBE1 1OOPA 3B3QE 2ZX0A 3NO8A 1D4M3 4C0BA 2E53A 5DUUA 4JCKA 4Q8KA 4WVWA 2ZGUA 2TNFA 4A7ZA 1V9U2 2VVFA 1NA1B 2BYVE 4K6BA 1NCQA 3RMXA 1S1AA 3FX3A 4E9KA 1RUE3 3H8UA 4HN1A 2LM3A 4OHWA 4TLFA 1H9PA 2ZGRA 5I0RA 1LOFC 4RQPC 4MUVA 1EV11 1SBFA 2EXHA 1V6IA 1GBGA 1NCQC 4FCAA 2DF7A 2D97A 1Q8OA 1LODA 1UD1A 3TYJA 4A7KA 2C9AA 2CV6A 4WV8A 1CVNA 1DBNA 1LCLA 3FMGA 5K0UC 2P34A 3KGLA 2QZ2A 4PIZA 1F5JA 2AH2A 1GZWA 1UX6A 4IEZA 4XPVA 3ZYRA 1I5ZA 1FOD1 5FLJA 2ET1A 1S0CA 2A3WA 5FLIA 2Y0OA 3NKGA 5SV5A 2X5IA 4AHYA 4EROA 4YGDA 3FBMA 3WG1A 2IFRA 4YGBA 4META 3GF6A 3J8F2 3O0WA 4OI2A 1AUYA 4S2HA 1VAKA 4XJZA 3S6PA 4W6XA 1PVXA 2KM2A 2ZZJA 3VBOC 1ENQA 2DUOA 4K1YA 1WGPA 1PZ8A 2PTMA 2XVKA 3H9AA 1X8EA 5GZEA 3CNAA 3NV1A 1AYM3 1SLLA 1PIV3 1EPWA 2BBVA 4K9SA 4MZUA 4U2AA 1ZM1A 2ARBA 4KWKA 2XVLA 3VBOA 4X8PA 4AG4A 4Y24A 1IQAA 1AYM1 3WDYA 3ZXFA 3N35A 5GLZA 5BNQA 2ZKLA 4JC1A 1YCIA 2WQZC 5AC91 1U5IA 3DV8A 4AW7A 4COWA 5FO7B 5C8CA 1ASJ1 4DNYA 4Z2WA 2P3JA 3WINE 4IV1B 1J3QA 1SLTA 5ABJA 3B00A 2JDZA 1SLBA 1RTVA 3V0BA 1FI2A 3B5LB 4I0WB 3AP6A 3USSA 2ZMLA 3HN1A 5C8CC 1XQNA 4DB5A 4HSLA 2DCYA 4MXWA 5H9RA 3WD5A 1LKNA 1FX5A 5ABJC 4Y22A 2ZKNA 1RJ7A 2XJRA 1R1A3 3ZSJA 3A0KA 3ZFGB 1ASJ2 3MPBA 2WA3A 3JCIA 3VBUC 3VZNA 3ETQA 4AVCA 2VECA 3JZVA 4HKWA 5AVPA 1R083 2R0HA 4IEOA 2PQQA 4OULA 1VAVA 2PHUA 3WUCA 4BYYA 5FBZA 5I0SA 2I2SA 1NG0A 4YGEA 2NPIA 3GYDA 2ILMA 4ATFA 5CFCB 4LO7A 4NHKA 1HW5A 1OMIA 1UL9A 2OZJA 4AEDA 4IEQA 2VMGA 5FMOS 1PVC3 3AJZA 1SCRA 4RFT0 1TEIA 1NE4A 1CN1A 5JZGA 5KHIA 2IXCA 3POSA 3GNEA 2VGDA 4JGZA 4OZXA 1W0PA 5T54A 3W59A 4E2SA 1MS9A 4XFCA 5A3MA 1I9RA 2R1BA 1TQ5A 4XZPA 3WT3A 1K5MC 2FZ2A 4NHLA 1DZQA 4QMAA 3DGTA 2OA2A 2WFPA 1AYN3 1ENSA 4GKXA 3RS6A 4AI2A 5C8CB 3OD4A 5JR7B 5T5JA 4GB31 1VBA2 2EVXA 4B7KA 4XQWA 1V6MA 1KXGA