3LOIA

Crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
EEVKRLIALYELTPHPASGGWFRETYRSDVQVEAEGFDGKRSVLTMIYYLMQAGQPDPFHRVKSDETFVHNLGGSMKIHMIHPDGSYSCSILGNPLEHPEARHQVVVPRRVWFAQEVDGYCLASVLVAPGFDFKDFSLGKREELIKEYPQHRDVIMRCTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Crystal structures of the apo and GDP-bound forms of a cupin-like protein BbDUF985 from Branchiostoma belcheri tsingtauense
rcsb
source organism Branchiostoma belcheri tsingtauense
total genus 40
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3loiA01
1JUHA 1U12A 4FAHA 4I01A 4EV0A 1DGWA 3H1YA 2XL7A 2H6BA 3PLQA 4D7TA 1NE4A 4E2SA 2Q1ZB 4IEUA 4QM8A 2IXIA 4UXAA 5FCCA 4PIZA 3MPBA 4JTNA 1YLLA 4D7SA 3CJXA 2Z2SB 3UKNA 4O9EA 3DKWA 2VPVA 3ES1A 3RYKA 4AVAA 1OD5A 1X8MA 2IXKA 5FLJA 4HVQA 2PAEA 2GC3A 3SXWA 4AVCA 2O1QA 3E5UA 2PFWA 3LZZA 3RPQA 3IWZA 4BIFA 1ZRDA 4XFGA 3RYRA 4XF4A 1O7FA 2GC2A 1G6NA 1RGSA 5HI0A 3HQXA 4LA3A 1HW5A 3DN7A 3DL3A 2CAVA 4X6QB 3L2HA 5E1RA 4MV2A 2QDRA 3EO6A 2BYVE 5LRSA 1O5UA 5I8YA 2OPKA 1O4TA 1LKNA 1TQ5A 5BXXA 3HT1A 3FFQA 2Q30A 1UW8A 4Z82A 3EJKA 5E16A 1ZZ8A 4HVRA 3D0JA 2Y0OA 1SFNA 3EBRA 3IDBB 2GAUA 5KHGA 1CAXA 2CGPA 1J58A 4XETA 3MDPA 3H3UA 5BY5A 1IPJA 4I0BA 2OZJA 4WZCA 3FWEA 1H1MA 2PYTA 3LOIA 4E2QA 2XL9A 2D93A 2XLAA 3ES4A 2D40A 1RUNA 1PM7A 4XFAA 3N4MA 4OFGA 2F4PA 4IETA 4Q29A 5I8TA 3E97A 5BUVA 2Q0AA 5J7MA 1RL3A 4I3PA 4RD7A 4MGKE 1CX4A 2N7GA 2XKOA 2MNGA 3IDCB 4IEQA 4IERA 2FMYA 3BB6A 3E5XA 4N9HA 3CLPA 1J3QA 4IEVA 1CAUB 2Q4SA 2CV6A 3I59A 2H0VA 1Y9QA 4B29A 4LEJA 2EAAA 2XKPA 3USSA 3SCGA 1XE8A 1ZZ7A 4HBNA 2XGXA 4FAGA 5C8WA 3OF1A 1XE7A 4XEZA 5FLIA 4P9GA 5FQ0B 1RUOA 4QGNA 1RC6A 3FZ3A 3S7IA 5LEJA 1WGPA 2GZWA 3LWCA 2GU9A 4IEOA 3WW1A 1IPKA 5CVRA 4IESA 5EFUA 5C6CA 2IXJA 4LLOA 3U0ZA 4BYYA 3IIAA 2H6CA 4ONUA 3GBFA 1O3RA 3WW3A 3QACA 2PTMA 3M70A 4F8AA 5FDBA 3C3VA 1ZX5A 2C0ZA 1O3QA 1CAWB 3VHRA 1UIJA 5JR7B 2OA2A 1EYBA 3H1WA 4GULA 4YYOA 3SHRA 5KHJA 3CF6E 1SQ4A 2UYAA 4LUMA 1X82A 2BNMA 2K9ZA 4OLLA 4XFBA 4XFCA 3RDIA 5KBFA 3U10A 3D82A 3CL1A 4XFFA 1Q5OA 1YFWA 2GC1A 4K8FA 4YARA 2PAMA 2PQQA 3E5QA 4H7LA 4N9IA 4X6RB 5F1RA 1H1IA 4AVBA 3E6DA 4ZU5A 5FLHA 4J1WA 2ET7A 3R6SA 4IEWA 4Q0QA 5J3UA 1CAVB 1EY2A 4DINB 2PA7A 2E9QA 1X7NA 1WA4A 3NVCA 1UD1A 3ETQA 4XF9A 2B9UA 2BNOA 1YFXA 2IXHA 2QCSB 3MYXA 1ZRFA 5EZWA 3RYPA 5LRRA 3HT2A 2BEOA 4ZU4A 3E6CC 4HZFA 4KL1A 4IEZA 1LRHA 4I2OA 3G7DA 1NYWA 1ZZ6A 3QOPA 3H8UA 4AQ2A 3ACLA 2B5HA 4MGIE 1LB2A 3CO2A 1I6XA 4QX5A 1DZRA 1FXZA 4I02A 5KHKA 1I5ZA 3UKVA 5I8SA 5AVPA 4PIYA 3H3ZA 1ZZBA 4HSJA 2HKXA 2V09A 1J3RA 3KGZA 4BHPA 3BALA 1QXRA 3I54A 1O3SA 3SCFA 3MZHA 2UY9A 4ZU7A 3H9AA 4L2NA 3WW2A 5BV6A 4MGYE 4XFIA 2QJVA 4F7ZA 2XHKA 3NJZA 1CAUA 1ZZCA 3H1MA 3WW4A 2I45A 3JZVA 3SCHA 1GQGA 5FPZA 2P17A 2IXLA 5JCTA 4Q0VA 2ETEA 4J1XA 3UKTA 3RNSA 1CGPA 5FQ0A 3B02A 3BPZA 4L11A 2GH2A 3IBMA 4KWJA 1QY4A 1QXJA 3OTFA 5I91A 4FBFA 5CADA 1O3TA 3PNAA 3KSCA 1EPZA 2Z69A 2ZCWA 3S0MA 4YRDA 4PIXA 2VECA 1UIKA 4LTAA 2D5HA 2XLFA 4Q0UA 3LA3A 1CAWA 4IEXA 1NZCA 1FI2A 1LR5A 2PHDA 5KHIA 1OFNA 1FT9A 4MZUA 4AXOA 4O9GA 1UPIA 3OCPA 2IXCA 4JTOA 4XFHA 2MHFA 1ZVFA 3BU7A 2OYZA 3PVBB 1YFYA 3H50A 3KCCA 4HMZA 4LUKA 2D5FA 4AQ6A 1J59A 4UBGA 4NVPA 5JSOA 4MUVA 3LA2A 1J1LA 4FT8A 1J3PA 2ZKLA 4Z07A 2ET1A 2EA7A 4JV4A 3NKTA 1WLTA 2WC2A 1OMIA 2FQPA 3RZZA 3NL1A 4QGMA 2XLGA 4EWAA 1CAVA 5K8SA 2DCTA 4KWKA 1YHFA 4CYDA 1V70A 2QVSB 3ELNA 3H7JA 4A2UA 4I0AA 1PMIA 2BGCA 2HJIA 3OGJA 4HN1A 4MX3A 4Q0SA 3M3IA 1ZRRA 4EWDA 4YNIA 3S7EA 1XRUA 3CEWA 5KHHA 1L3JA 1YUDA 5CU1A 5JSRA 1DZTA 1RTVA 4QM9A 4KWLA 2BNNA 3NW4A 3KGLA 4META 4BH9A 2WFPA 4QGLA 3U11A 4PJYA 3KMHA 3FHIB 3EHKA 1ZRCA 4HVOA 1Q3EA 4EROA 1VJ2A 2PHLA 2K0GA 3LA7A 4YSFA 5T3NA 5I0SA 3EQEA 2ATFA 2CAUA 5LEKA 1Y3TA 2OZ6A 1NXMA 3HIFA 3NSTA 4R52A 3ST7A 3E6BA 1CAXB 1Q43A 4XF0A 5FPXA 1VP6A 1X8EA 4XF1A 4LA2A 5I0RA 4KU8A 3OD0A 4IEPA 1O5LA 1VR3A 1SEFA 2MPFA 4JVAA 4HSLA 5JAXA 4EWEA 4HN0A 5BPXA 2QNKA 4Q0PA 2KXLA 5I93A 3TNPB 5D1IA 3ROUA 1EP0A 2IC1A 3FE5A 4KU7A 2UY8A 3FX3A 1GQHA 4QXKA 3ZDSA 4WBBA 3FJSA 1ZZ9A 4I09A 3O14A 1DGRA 1ZNPA 2VQAA 4QMAA 2EVXA 3H7YA 5I0UA 5J48A 1UCXA 1YWKA 3I59B 2B8MA 4MGZE 2UYBA 4R8HA 3DV8A 3LAGA 3I7DA 1OI6A 1ZREA 4XF3A 3SMHA 1QWRA 2GC0A 5JSPA 5I0TA 4HLTA 4WVZA 2O8QA 3GYDA 4IEYA 1NE6A 4E2GA 1YFUA 4ORFA 4MH0E 4UBHA 3TNQA 3D0SA 3BCWA 2PAKA 4TLFA 4LULA
chains in the Genus database with same CATH superfamily
2PELA 1NCQA 1JUHA 1FPN1 2NZ9A 2A6ZA 2R0FA 1S2BA 3LE0A 4OCTA 1RUC1 1L7LA 2Z42A 1AJOA 4TYSA 1W0NA 4HKLA 2ZX3A 2WNVB 5IAXA 4R9CA 4WZFA 3KT7A 2V5DA 4G3YC 2XR4A 3H8RA 3PLQA 4OHXA 2ZS6B 1NE4A 3PHMA 3FL7A 5HCAA 2Q1ZB 4IEUA 1Z78A 2Z79A 3K3NA 5L9VA 2JXAA 2NMOA 2CYFA 4UXAA 2WZR3 5CZKA 4AI8A 4PIZA 3MPBA 1S0GA 4JTNA 1G9DA 1BBT2 2JDYA 2VMHA 3O1SA 2YHJA 2J1AA 5DAWA 4KGGA 3DKWA 3IM0A 2YMZA 3IAQA 4CDXA 4CDUA 5K0UC 2EAKA 1F5FA 3RYKA 4YVSB 1YI9A 3POBA 2YB7A 5CFCC 3PVOA 1R1A3 1K45A 2IXKA 1NA1A 2WT1A 4AVSA 5FXWA 1N47A 5FMOL 3IPVB 1PZ8A 2YY1A 4AVCA 1OA3A 1VMHA 3TN91 2O1QA 1V6MA 3MIDA 4XC9A 1S2EA 2WFF2 1W9WA 4MGQA 3VD3A 3UESA 3RYRA 1K5MB 2BGOA 3FN9A 1O7FA 5AC91 5CKMA 2OS2A 1G6NA 1UYPA 4RGGA 3VD4A 2BPA2 2RS31 5HI0A 5C3PA 4H2AA 4LA3A 1HW5A 2XOMA 1ZBE2 2NPIA 4XTMA 2CAVA 1ND3A 2A6YA 4DIQA 3N7JA 1JUIA 2EXHA 1REDA 2W0XA 3EO6A 1VB4A 5LRSA 1RUC2 2WUHA 2ZX0A 1O4YA 2OPKA 5BXXA 4GH4B 2P37A 4GMP3 3FFQA 3V65A 1GANA 2Q30A 3KT1A 2WBKA 4AG4A 1RMU2 2HYKA 3Q8EA 2A70A 1DF0A 1VBC1 3KWVA 5FZMA 5C3QA 1UKGA 3D0JA 3LCPA 3ZVXA 3RZLA 4XJAA 5D8AC 3EBRA 1SFNA 3V56A 3KZ4C 2A7AA 1CAXA 4NROA 3KV9A 4D69A 5HV0A 3H3UA 1W6MA 5BY5A 4AVVA 4WZCA 3WP6A 4E2QA 3ZSLA 1US2A 3UGHA 5JMCA 3SITA 2D93A 2R1BA 1IS3A 3HWJA 1NY71 2QFEA 1RJ7A 2XVLA 4SLIA 5F6KA 5A32A 5JZGA 5L7OB 3N4MA 1W6NB 4OFGA 2JG9B 4B3NA 3ZN6B 4B7KA 2VY0A 5GLTA 1DQ5A 1YCIA 4G4FA 3VBHA 3IAPA 4RQPC 2WT2A 5ANNA 5BUVA 1W6PA 1K5JA 1RYYA 2VMGA 1VRBA 4LK6A 4NPRA 2BOIA 4FOVA 4I3PA 4RD7A 4GJYA 5F8PA 3BYWA 4MGKE 2GNTA 1AYM2 5EV7A 5GLZA 3IDEA 4QHBA 5AC92 5C33A 3KHCA 5A7WA 2ZGUA 5FP8A 5FZHA 5C3OA 4PBOA 3IDCB 1RVF3 2RS32 2XJUA 5DAQA 2FDFA 4IERA 3VDDB 4W65A 1G9CA 5ISLA 4L9BA 2FMYA 3BB6A 3E5XA 2WNUA 5A3TA 1VMFA 5F39A 5F3GA 4AZZA 2BOJA 2DCKA 3KCYA 1WW5A 2E32A 4BMEA 3QLQA 2VW2A 1FAYA 1WZXA 5LB6A 2JB4A 4B1MA 1S0DA 2K2SA 2VZSA 4JRAA 1UU6A 4XDPA 3SH5A 1HLCA 1RUH3 2WR9A 1VBC2 4NRMA 4P9GA 5FQ0B 1XSQA 4LORA 4FOYA 1XOYA 3EMRA 3S7IA 1WGPA 2GZWA 1O8SA 3B5LB 3P3PA 4WM8C 2AH2A 2BBAA 3DXTA 4M3CE 1VAKA 1LGNA 3J8F2 3N9QA 3OGSA 3WW1A 2FDIA 5CVRA 3WY6A 3ACIA 3T08A 1YEWA 3JB4C 5KC5A 1GMMA 3PTYA 5LA1A 2NYYA 2W1SA 3SC7X 1NY72 5ACA2 3ZKUA 2RM23 4ONUA 3GBFA 3USUA 3WW3A 5A7NA 3T4HB 3QACA 1AL21 3D8CA 4H55A 5A1AA 3C3VA 4NAOA 2DWRA 3NJXA 4JKLA 5C9AA 1WCSA 2TNFA 1CAWB 5IVEA 3H1WA 3U78A 1RVF1 4YYOA 1GV9A 5G05L 4Z92B 2ZMLA 2CWSA 5SV5A 1C8NA 2GMPA 3N36A 2D7FA 2CSGA 2UYAA 3VBFC 4FOWA 2ILMA 2XUEA 3ORJA 2XXZA 3J7LA 1XU1A 4HK9A 4Q4Y2 1HRI2 2BTVC 3CJIB 3B9CA 1AR93 4ZZ5A 4CUCA 1H8VA 3PIGA 2K9ZA 3RDIA 2DURA 5KBFA 2AREA 2ZGLA 1RHI3 4IGOA 1MZFA 2JWPA 1GOHA 1VBD3 5EXOA 4C0BA 1GWLA 2XUMA 4OULA 2GC1A 3U37A 2ZHMA 1ONAA 4CDWB 4YARA 5DABA 5GM0A 2PQQA 4H7LA 3ACFA 2MEV1 5F1RA 4MG2A 2P3YA 4AQTA 5T50A 4PDWB 4LIUA 4QPIC 1BXHA 2WS93 4XMIA 2FMDA 2Q8DA 4IEWA 1DU3D 2XJTA 2VZTA 4Q0QA 3GZTB 2TEPA 2DU0A 4DY5A 1TNRA 5FZAA 3TWIA 5TSWA 2YZ4A 2YGLA 1JXNA 3AP7A 4HKWA 3NVCA 3GXUA 2A73B 3ETQA 2VZUA 1GBGA 3FMGA 1AL22 3POJA 1YFXA 2PMWB 4I0WB 1WMDA 2PQSA 2ZXQA 1W6OB 5DZGA 5FMDA 3VBUA 3RMYA 1HKDA 1V9U1 4BXFA 1A34A 2H0BA 4XOGA 3S5AA 2BEOA 2G19A 3E6CC 4KL1A 3PURA 1LRHA 4JC1A 1OOPA 3WF4A 2OXBA 4XDOA 3IMNA 4I2OA 3S30A 1H9PA 5DDJ3 5BNPC 1PNGA 4PF1A 1JI6A 1JZ6A 2XQRA 1ZZ6A 2SLIA 2RDRA 4AFAA 3ALQA 4AQ2A 5GLUA 1KITA 1SBDA 2B46X 3GZEA 4XJZA 1US3A 3VB9A 1I5ZA 4L0PA 5A80A 4D6RA 5I8SA 4COYA 3PUHA 1OPOA 3AZZA 1RUJ2 4FXKB 4A7ZA 3ILFA 1VBE3 4ES8A 4ISQA 4CRQA 2MEV2 3H3ZA 1ZZBA 2GDFA 1W8WA 1YXWA 3FLRA 5FZ9A 2Y6HA 3BALA 3V0BA 3V64A 3HJRA 1R083 3N7KA 4LR4A 1WLWA 3SCFA 2JG8A 2UY9A 2AEYA 1IPSA 5E89A 3ZXLA 1FMD3 3H9AA 5FREA 3WW2A 1R091 4OVEA 2RS51 3OEBA 4DXRA 2EXKA 4MGYE 5GJ6A 1GSLA 5DZFA 5A6QA 3P3NA 1UXZA 2LTNA 4F7ZA 4AAXA 5L73A 3NJZA 2PHRA 5T52A 5CIRA 3B93A 3MGUA 4QAWA 3WQ7A 1ZZCA 3ZIXA 3V0AA 2Z4FA 3POFA 4K20A 3SCHA 4Y20A 2QQUA 4EZ4A 1D0GA 1V9U2 3RWKX 3VBOC 2V5YA 1MEC1 2ETEA 5FPVA 5ABJB 2VZ1A 4QX8A 4OHWA 1CGPA 1VBB3 4L11A 4NAMA 1ENSA 1UX7A 4KBBA 3JD73 3ZYHA 2GH2A 2ZGTA 4XHBA 3ZXFA 3WLUA 2BP6A 4PCRA 5A3NA 4XILA 4OHYA 3IBMA 1QY4A 4XZUG 2WZPP 3W5MA 5FP7A 4QDQA 1EV13 4FBFA 1BHGA 3IDAA 3F95A 4JQTA 3B3QE 5FZEA 1XNDA 3AL6A 4N53B 1W3VA 2VMFA 2OW4A 3DYPA 3VUOA 4HKOA 1BCXA 3X29B 4A42A 4AHWA 3MEPA 5HXVA 4LBNA 2B45X 4P14A 3VZLA 2X10A 5LATA 2P6HA 4K7JA 1MS4A 2HWF1 2JICA 1X36A 2ZMNA 3ABZA 4Q0UA 1WW7A 2QTWB 4D8MA 4QX1A 1W8UA 1FMD1 1UY1A 1NZCA 4D6QA 1FI2A 1FV2A 4WVVA 4XJ9A 3AMQA 5LBEA 4PI2A 2JB8A 1QF3A 1R092 2RS52 1IS5A 2EXJA 3AZVA 5T54A 3UYJA 1H4HA 2G1MA 2D3RA 1UPIA 3OCPA 2MHFA 4JX0A 1PO11 4URTA 4A3ZA 1GNYA 3H3LA 3PVBB 4HMZA 1LHOA 3WNMA 3MF6A 1J59A 1WKYA 3OYWA 4HETA 4Q26A 3MIHA 4TSVA 1Q8SA 3HMYA 3KLSA 1F5JA 1MEC2 2J1SA 2WAOA 2WKKA 3AXEA 4W50A 1NCQB 3I2KA 1JBCA 2XH6A 1C4RA 3PJQA 5IK4A 1EUUA 1U5IA 3DF0A 1EV11 1W9YA 3NKTA 1ACCA 3WQBA 1OMIA 2B4KA 1ENQA 5JIAA 4FP2A 4QGMA 2FZ2A 3GBGA 4UFKA 5FO9B 5LBCA 3JCIA 4DB5A 2A1XA 1QJX2 2JKBA 4COVA 3DKQA 4A2UA 2ZX2A 3ZFFB 3RSJA 5C4WB 5JI9A 3OGJA 1V0AA 4OMCA 1OA4A 2GP5A 3NV3A 4Q0SA 1XNCA 2OUJA 4EWDA 4YNIA 2QQPA 1X9PA 1QJY3 3T1MA 4CSWA 4E4HA 2HWF2 4CDXB 4CDUB 1UU4A 1QXPA 4YZ5A 3WF0A 3CEWA 3PJYA 2IUWA 1I5PA 2W94A 3CQOA 4Q8LA 4U2AA 4LKEA 1ENXA 1FV3A 3ZXEA 1OHFA 1NA1B 3ZYBA 4CP1A 1DZTA 2E31A 1XC6A 3HAGA 5A7SA 3RZMA 2OVUA 1RTVA 1BK0A 1GZTA 3FUQA 2BNNA 3M2MA 4YZ1A 1Y4WA 1D4VB 4QXBA 1VE0A 1PO12 2WFPA 3FUOA 1PMHX 4R4ZA 2A6WA 2E7TA 1DGLA 3EHKA 3C2UA 1ND3B 4FVVA 2PHLA 1WCDJ 4MGSA 4YM2A 2K0GA 3VZNA 1AR82 3KB5A 4RHV1 3CIHA 5FZKA 2VE1A 5T3NA 3ZFGA 4URAA 5I0SA 4N8MA 4A7YA 5EJZB 5G04L 5JPMB 3NSTA 4IDZA 4M4PA 4BK5A 1W2AX 4R52A 4NIIA 4NR1A 1GOFA 2OUHA 1IZ3A 3HNBM 2JKXA 2FCTA 2ZGNA 5FPLA 5A33B 2XPJA 2JDKA 2RMU3 4M3CA 3ZYJB 3LEMA 4B8EA 1CAXB 4CEWA 1EAH1 1IOAA 2AC1A 1W6MB 3A21A 2AENA 2R071 4IEPA 3WZ1A 3WHUA 1VR3A 2MPFA 2D97A 2RR13 3AKQA 5BNQA 3AC0A 2AEZA 2DVAA 5A32B 4A45A 1JHNA 2YG0A 5JZGB 4Y1UA 2WN2A 2R061 2ZGRA 5CFDA 5I93A 3R0RA 2ZEXA 3HOBA 4KU7A 3MLJA 1ZA7A 1W6PB 5FZ4A 4CU8A 2R1DA 3HD8B 2UY8A 3BOPA 1GR3A 3PU3A 2VZ3A 3MUZ1 4QHOA 1HRV1 2EF6A 3PMEA 5F2SA 1JZ8A 2OQ7A 1TME3 3MBWA 3BTXA 1HV0A 1ZZ9A 2J22A 1PGW1 5A7WB 3U1XA 2VOKA 1LOFC 2D43A 3AM2A 4Q4X3 1PK6B 5K0UA 3UV9A 1QH6A 4QMAA 2WNUB 2HH9A 3H7YA 4HONA 4LO5B 2JDHA 4JGYC 5D2AA 5DN2A 2CDOA 2PLV3 2WZEA 2ZGKA 3IB3A 2B8MA 3KD4A 1GU3A 4RHV2 3LAGA 4UT5A 4P9WA 4XBLA 5KXDA 2C4XA 2J7MA 1H2LA 4XPVA 4Y4RA 5FZCA 4YGDA 1NLRA 1F4HA 5DZEA 5I0TA 4WVMB 4ZONA 5J1XA 1H8TA 3GYDA 3LD8A 2VMCA 1HQNA 1HX6A 4E2GA 1OF4A 1EAH2 1HXS1 5BNOC 4CXXA 5IK5A 1VIWB 3TNQA 4AFBA 2R072 1RUE1 2X5IC 1UYZA 2QQOA 2ZACA 5KC6A 4E8CA 4QWNA 4YW7A 3GGLA 1SDWA 2Q8OA 3VZKA 3JBG3 3LFMA 3USUB 3ZFEA 1H9WA 1W2OA 3ZXAC 1X33A 2V4AA 4YZ4A 5FPAA 1DGWA 2R042 3OBTA 5C9AB 2DF7A 5GLVA 1SCRA 1MZEA 3O0XA 4GB33 3KT4A 4AW7A 5F5IA 3I49A 4PQQA 1EPWA 4PI0A 4M00A 1AX2A 1KS5A 3WR0A 1UZWA 1RUD3 1LHWA 1YQ2A 1HRV2 4MSVA 4XUPA 2P1BA 2UU8A 1UO9A 2RJ2A 3AMPA 1PO23 3TBDA 2ZPXA 5EIYB 3MUY1 4FI9A 3MW2A 2PLV1 1PMJX 3RZHA 4ARYA 1YLLA 2Z2SB 4YGCA 2DUOA 4W6YA 1W90A 3UKNA 4CUGA 3T0DA 4ZHNA 1QH7A 4XQDA 2AZ5A 3NKGA 4XVHA 2XONA 3KHBA 3VBHC 1S0CA 1JYXA 1UWWA 3WNKA 2FDJA 1OD5A 1HDKA 1RUG2 1YYNA 3D5OA 4IGQA 4XYXA 5FLJA 3DYOA 2WWSA 2W91A 2L9LA 3MFAA 4QX0A 4KG8A 4P5YA 3IN9A 3SXWA 3WV6A 3LZZA 4XURA 4NN0A 3TYJA 3NAPC 4BIFA 5A3OA 1ZRDA 2V73A 2D6NA 2X53S 1IKPA 1XYNA 4H3WA 1HXS2 1QJU3 1C8M2 1W04A 1NXD1 2DV9A 4Q4W2 3WXPA 1RUE2 4AI2A 1DGRN 4GXLA 4LKSA 1UAIA 1DYPA 3VD9A 4X6QB 2GP3A 2VNVA 4IV1A 5E1RA 1CPMA 2QDRA 3BTYA 1BEV2 2BYVE 3AK0A 3CBNA 2B39A 1O4TA 1LKNA 1TQ5A 1ASJ1 1UZVA 1NQJA 2P34A 2P5BA 4HFSA 3VBUB 1RUD1 2WSUA 4JQRA 3AKSA 1UW8A 4NPMA 1PO21 2WNVC 3APBA 4TWTA 3VD5A 4Z1VA 3I3MA 1ZZ8A 1M4WA 1XNBA 4C1WA 1JZ5A 5L19A 1OOPB 4HANA 2GAUA 1J58A 1QIQA 1QJEA 1WLDA 4XETA 1JZ3A 2RDNA 4BISA 1IPJA 4XUQA 2WQZC 4H7MA 4Q4V1 4HVQA 1H1AA 1XBFA 4LO7A 2OZJA 1AR63 1MZ5A 3FWEA 3LOIA 5IATA 5AFBA 4LBMA 2XLAA 4IV3A 1J83A 3AKRA 2VCCA 2D40A 3HN1A 1RUNA 1SBFA 4XFAA 4BQ2A 4CCEA 3QH7A 4QB6A 4BU2A 4YVSC 5A3LA 1JU3A 2X8KA 4FOQA 2NLRA 3O1OA 4MO3M 2OKXA 3T2QA 3ATGA 2TBVA 4LBQD 4BPZA 4JZRA 2Q0AA 2XBO1 5FOBB 4BE3A 3VBFA 2HYXA 2YBPA 1YNAA 1NAEA 3PU8A 1W8FA 4K6BA 4DS0A 5J7MA 5LA9A 1UYXA 2JD9A 2JG8B 1G9FA 2N7GA 4O7XA 1K5MC 4FPLA 4IEQA 3WHTA 2VUCA 2GH8A 5JOYA 3VZOA 4XZPA 1NLSA 1AHSA 1XQNA 2XMLA 4N9HA 3F2ZA 1J3QA 5F3EA 4IEVA 4P9LA 5L36A 3V0AB 4WM7A 2D6LX 4B4RA 3WT3A 4FTSA 1QQP1 1ZBE3 2HWB3 3USSA 4Y20B 3SCGA 2Q8EA 4GH4C 4OI2A 4QPIA 5FK8A 2YFUA 4F3JA 1XNKA 4KG0A 1MR5A 1UMIA 3MFCA 2VMEA 1AR61 1PVC1 1IPKA 5LK7B 1Q8VA 1W03A 2IXJA 2DUPA 5IVCA 1OUSA 4YW1A 3B9IA 5FMOS 2ZZQA 2V72A 3IIAA 4TTGA 5FFOC 2WA3A 3BPSA 1MS1A 4UFHA 1QGLA 3AYAA 3BVCA 1O3RA 2A71A 2VOVA 5FBZA 5L7OC 4FPCA 4Y5SA 1EUTA 2W08A 2Q8CA 2JG9C 5FDBA 2C0ZA 3VBRA 2E26A 4ASLA 1E5IA 3THTA 2EIDA 2R30A 2XBO2 3NV2A 3VHRA 1UIJA 4NHXA 3GJAA 1OLME 4AI1A 4GULA 1SFYA 3AKPA 2ZJCA 3SHRA 4JAAA 2JIJA 1KDKA 3CF6E 3ZM8A 5KWRA 1SQ4A 1BKZA 2EXIA 1J1TA 4CCNA 5FYIA 3DECA 5D21A 5GZFA 3P5BA 1AYM3 2W1UA 2NN8A 3CDZB 4OLLA 4XFBA 1UY0A 2JDMA 1PX4A 3U10A 4DUVA 1QQP2 2NM1A 4YZ3A 5FP9A 4NWVA 4DEVA 1KJRA 3OYWB 4B4PA 3S6PA 3CL1A 2PHFA 1Q5OA 1TG7A 1YFWA 4O61A 3T09A 4Z2WA 1PIV3 3HR9A 4LO6B 4X6RB 4AHXA 2HWC1 3ZR6A 1WMXA 1YRZA 1C57A 2VD7A 3POYA 3RQ0A 4CZSA 5F7UA 3E6DA 3SKVA 1VLNA 1X9TA 2ZOEB 5FLHA 3FBMA 4MYEA 1CESA 1PVC2 2ET7A 4E8DA 1KEXA 1SDDB 2VULA 2E6VA 5B4NA 1NX9A 1VRH3 5FZOA 2W87A 1FOD3 4UWDA 5FR3A 2E9QA 1WCKA 3J8F3 1AZDA 1X7NA 4GALA 1RINA 1WA4A 3LSEA 1UD1A 2HWD2 5DUUA 4EN0A 4XF9A 4NJ4A 2B9UA 1FPN2 3N9PA 3OG2A 4UW6A 2Y6FA 3MYXA 1ZRFA 5EZWA 3O1UA 4PLNA 5ACA3 3THCA 3MI8A 1NUKA 2XJSA 2FCUA 4QPGA 3TEYA 4EN6B 3N7LA 2BVBA 1GQPA 2Y6JA 3PIJA 1CN1A 5HXMA 2WZR1 4YW5A 3H8OA 3BTZA 4GA9A 4DZGA 2VZRA 3KV6A 1NQDA 2ERFA 3VHNA 5IVFA 4I30A 1NYWA 2FDKA 5HCHA 5FP4A 2WQ4A 3AFGA 3CJIC 3WG1A 5JVVA 1VBA3 5GKAC 1BLZA 1UMZA 4K8RB 1UOJA 4NMIA 1MS8A 2YFZA 1K42A 1S55A 1U5ZA 1R1A1 3J7HA 1DZRA 1FXZA 4I02A 1UOGA 5C3SA 1PNFA 1OKOA 1PZ9A 3PTRB 4PLMA 2ZZJA 3WNXA 2XB6C 5AFEA 2QQKA 4HSJA 2HKXA 2V09A 5A7QA 4CDWC 1H2KA 1AUYA 4YLZA 3TN92 2QZ2A 1NG0A 2DVGA 4JGZA 5IHRA 2JDZA 4LBQA 4YGEA 4PDWC 1LU2A 5C8CA 2C1FA 3AKTA 4LHLA 1E5RA 2VW1A 3ASIA 1WLCA 3NNLA 3K4AA 4L2NA 2P6CA 4OMDA 4BA6A 4LBKA 2G9FA 4M3CB 5E88A 2G9GA 3PUSA 4P00B 4CEYA 4CP9A 1CAUA 1SBEA 5FZFA 4YW3A 1XPWA 3PVNA 4GMP1 2I45A 3K2OA 2RV9A 3PUIA 2IXLA 2W1WA 5EQUA 1PGSA 4YZ2A 1JOJA 4FPOB 2BRTA 1C5IA 1CJDA 3ZOIA 1ZA4A 5H9QA 2HWE3 1UOFA 5CFDB 2WZR2 3GHMA 4KWJA 1GWMA 1SLCA 5FKBA 2JENA 4JHTA 4XUNA 1RUF3 3OTFA 3QBQA 4PT6A 5I91A 5BNNA 1HQWA 1O3TA 2W46A 1POQA 1EPZA 3PUAA 4W6XA 1GZ9A 2DVFA 3VGIA 4FFIA 4M01A 4NRQA 1WBFA 1R1A2 2UURA 3ZYPA 4Q5OA 1AR73 5FPUA 1L7RA 4QXCA 2RS13 3K51A 4YRDA 3ZKYA 2R16A 1OKQA 3LIHA 2VECA 3OB8A 4LTAA 4Z2AA 1B35A 3ZPYA 5F6LB 2PHXA 1GP6A 4Q1PA 4Q2FA 1U5YA 5IYYA 4UAPA 4A44A 2DUQA 2VTXA 1LR5A 3POEA 1WMEA 1RXFA 4RFT0 5KHIA 4BQ3A 5APAA 5FJHA 4BLIA 2Q1MA 4IGPA 3HEIA 4O9GA 3WSOA 1H8TB 2W3JA 1XJAA 4GWIA 4XFHA 2BBVA 1ZVFA 3BU7A 2P3KA 5FXZA 1YFYA 4AEDA 3KCCA 1WD4A 2D5FA 1QOSA 2XQXA 3JUUA 3GBWA 3MPPG 4AQ6A 4CTEA 1N1TA 2EICA 5B2GB 4A4AA 1T6BX 4COZA 1RUH1 5JXGA 3UGGA 1AJKA 5ANQA 1NCRA 3ZN4A 1J3PA 3ZFEB 3UJOA 5ABJC 1TMF3 1GNZA 2NMNA 2I2SA 4E4DX 1MZ6A 2BWAA 2EA7A 4JV4A 1GKBA 2VMIA 1WLTA 3J26N 3Q8FA 2DCJA 2WC2A 1GUIA 3OEAA 2B9VA 3ACGA 3VZJA 1UMHA 2XLGA 3RFRA 4QX3A 4LITA 3KCXA 3WG2A 5FO8B 4QPWA 2RM21 5IK8A 1WW6A 1Q56A 4FFFA 4N53C 4FPEA 4I0AA 4D0QA 1JW6A 4NPLA 5FJKA 2VNGA 1NOVA 3LIGA 1LULA 1ZRRA 3M3QA 4MXVA 2VOTA 4AFMA 5T5LA 4ARXA 1PGL1 1LGBA 3T3YA 3NV1A 2D3SA 1F35A 4BJ0A 3I8TA 2FDGA 5H9PA 5CU1A 4BXSV 3ZFGB 2ZEWA 1CZTA 4S2HA 2W52A 4JHZA 1RVF2 4QM9A 1YO8A 2WNOA 3VKOA 3W20A 4CCOA 5KXEA 1AR91 1ULOA 3OGGA 3NNGA 4KI5M 3R4DB 2IFWA 4JGYA 1POV3 1RHI1 4QGLA 5CG9A 2ZGOA 4NOTA 1STMA 4M0HA 1VBD1 3HQRA 4CDQC 3KMHA 1JN2P 1QOOA 3K48A 1UL9A 1TMF1 3U4SA 4EROA 4AR2A 1RUH2 4IV1B 3WF1A 4S2FA 1X50A 4BMBA 2DBNA 4YSFA 1NCQC 2LS6A 3T1LA 2WS91 4RA0A 3ZXJA 3I2FA 3MIEA 2BW8A 1Y3TA 3T2OA 3HIFA 2XJVA 3OPZA 4Y5Z0 1PM4A 4AF9A 3LDRA 4FPHA 3UETA 4MVTA 5EWSA 2ZTNA 2CGOA 3PUQA 5CEHA 1IHMA 2X5IA 5IVBA 1T6GC 3AYEA 2RM22 1MS3A 5HV4A 5A6ZA 4CA9A 5KXCA 1OQDA 1O4ZA 4HPKA 4JCKA 1C1FA 2YPJA 1OQEA 2VQ0A 4KU8A 3OD0A 4V2VA 5C3RA 3ZFFC 4AVTA 4OYUA 4OZXA 4CP0A 5C4WC 1PGL2 2XVKA 4DUXA 4EE2A 2QDNA 4CUBA 4IV3B 4CXWA 5JAXA 4M0NA 4XMAA 5BYNA 3MO4A 1XYOA 4CDXC 4Q0PA 3UT0A 1NT0A 2KXLA 1W99A 3K4DA 4NHLA 3TEWA 5IFPA 3WP3A 4E9KA 4UF0A 1NA1C 4RN5A 1EP0A 5DDJ1 1VAVA 2C9KA 2VM9A 4BCUA 3K77A 2QUOA 1V00A 1KGYA 1N1YA 2WO1A 1OLMA 4COWA 1IGOA 1BJQA 3VBFB 5LZ6A 1GQHA 4GQ7A 3C7EA 4YWAA 3ZDSA 2RJKA 5C7GA 3HN3A 3FJSA 4I09A 2W95A 1RHI2 1JZ4A 4X8PA 1VBD2 2FBEA 4N7IA 1S1AA 4AOCA 2WO7A 1DGRA 1A6CA 1SG3A 1ZNPA 2VQAA 4Y4YA 3M4FA 5FY8A 2EVXA 5FYVA 1VBE1 3U07A 2QQMA 5I0UA 5J48A 1OF3A 2VCMA 3RI8A 4MGZE 1DYKA 4WM7B 1GZWB 4Y3OA 2WS92 1R081 1YI7A 4ZS3A 3I7DA 3VKNA 3BI3A 3NAPA 5JWPA 1YQ5A 3RGBA 2BGPA 1GICA 4XF3A 3SMHA 1D2SA 1AR83 1QWRA 4G9SB 3BIEA 2BUKA 5DAXA 2YU2A 3MW3A 4HLTA 4WVZA 3WP5A 1O8PA 2YU1A 4NIAA 4AI9A 3I2OA 1UY3A 2QQVA 4XACA 4ZY9A 3ZSJA 4CXYA 2ZEZA 1AF9A 4DFSA 5SV8A 2RHPA 4XIKA 4CUAA 3M8LA 1W2NA 3AZWA 3BCWA 2ORXA 3DPRA 2FD8A 2PAKA 1REFA 4TLFA 5EPAA 4CCDA 1DBNA 1VBB1 1U12A 3JD71 4I01A 2GN3A 4LK7A 3LQCA 5JZGC 2WNVA 1JYTA 5DAVA 2ZX4A 4EV0A 4A6OA 5DDJ2 4R9AA 3VBRB 3S57A 1W8ZA 2VTXJ 2D6KA 5FUNA 2RDQA 5FTTC 3VBSA 3BIWE 2ARAA 5H9SA 2DFCA 4BQWA 5A3PA 4BQYA 2JEMA 5GALA 5LK5A 2A3XA 4R9BA 4QM8A 3WX5A 4AGRA 3INAA 1E5SA 2VW0A 4MGTA 5FCCA 4Y22A 1TE1B 2CDPA 3M7AA 4LBLA 3CJXA 2RE9A 4AFCA 2WSVA 1F31A 1VBE2 4D7SA 4YFZA 1PK6C 1D4M3 4LIVA 1JOBA 1GOGA 2WNUC 5FO7B 2IVJA 3ES1A 1DQ0A 4RS5A 4FPJA 1R082 3W59A 1KJLA 4XHXA 4GKXA 1YQ6A 1OD3A 1JYCA 2Y8KA 1FMD2 1H6YA 2PAEA 2GC3A 3I2HA 3E5UA 5CBLA 1DLLA 2AGSA 3IWZA 2E51A 3M1HA 1JYIA 2WNEA 1KS4A 4XFGA 1ODNA 1QDOA 5IWFA 4BLJA 4LKDA 4XF4A 5LBFA 5K9YA 1ULFA 2QQIA 4PQ9A 2BJSA 4ZKTB 1LGCA 1RGSA 5A3UA 5IAVA 5A7OA 5C70A 3DN7A 4CDQA 3DL3A 1LEDA 3JQWA 2WWJA 3L2HA 4MV2A 1FNYA 2XDVA 3JD72 3RWNA 4R4XA 2ID4A 2ES3A 5CG8A 5I8YA 1Z7S3 3OGVA 3HT1A 2YC0A 4UYBA 3ZYRA 5LA0A 1SPPA 1XU2A 4NHYA 4YVWA 1EV12 5DQ0A 4DUWA 4QPGB 5C9AC 4QB1A 3TRSB 1DZQA 4UW5A 5E16A 4HVRA 4QQLA 3RZGA 2YDEA 4D7YA 4FTEA 2R043 1SZBA 1MQTC 4EZHA 2QKDA 2IFRA 3IDBB 2BERA 3EXUA 1D2QA 2CGPA 1D4M1 3MDPA 2ZX1A 1AYN3 4EJRA 4DRVA 4AQSA 1QJY1 5L9BA 2CL2A 2JX9A 1H1MA 3SEEA 3GDBA 3H42B 2XL9A 4QB2A 2DCYA 4QDSA 1W6NA 2XVGA 2JG9A 3ZDVA 2J1RA 3JB8A 1PM7A 4MOAA 2Y0IA 2OT7A 1OURA 4FPFA 4GMP0 5FY0A 2X05A 5J09A 3O1RA 4BM8A 2F4PA 4Q29A 4LHNA 2AYHA 4LO8A 5I8TA 3IIIA 3E97A 3AYCA 1JZ2A 2E7AA 1RUG3 4AFDA 5EJ1B 1G86A 3L2YA 3SNMA 2GALA 2W92A 4JGZB 4LBQB 1O6UA 4RGAA 5KR7A 5C8CB 1CX4A 1D7PM 5FYTA 4CCKA 3MIBA 1ULPA 2XKOA 5F2WA 1CWPA 1OUXA 1UOBA 1UY2A 3OD4A 3OBAA 3CHXA 1ST8A 3LPFA 4LXLA 4I3GA 1S0FA 3A0NA 3ZR5A 2ORZA 1CAUB 2XWBB 2Q4SA 2CV6A 3NV4A 3VHOA 1XE0A 4CCJA 3OUJA 1SLTA 1WA6X 5FZ3A 4B29A 3JXSA 1HJFA 2YYOA 2J1VA 2XHNA 5LCWL 2Q1FA 3PDQA 4HBNA 4FAGA 1BVVA 3VBUC 5C8WA 5CKNA 5JOXA 4XEZA 3H8XA 2XJRA 2HBUA 4BZ4A 1DQ1A 1AYN1 2RMU1 4QGNA 1PHMA 2JDAA 3FZ3A 5DUWA 5A6YA 5JLVA 3LWCA 2GU9A 1HJGA 4IEOA 1ULGA 4NRPA 1V6IA 4XBNA 3D4KA 5BNNB 1QJY2 3DCQA 5C6CA 3O12A 2RR11 4H14A 5F37A 3O7OA 4K21A 4RL7A 4NHMA 2PHUA 1QJFA 4OUMA 3LEGA 3FLTA 1H30A 4NIGA 3O0VA 3OY8A 4MXWA 4KBZA 4N43C 3BUCA 4D7TA 2PTMA 4F8AA 4Q8KA 1G9BA 3UNPA 4YFWA 3POIA 1B35B 1F4AA 2R062 2VUAA 4RSUA 1OC1A 2VBPA 2WA4A 1W39A 2OA2A 1EYBA 3AP6A 3ZPOA 5D8AA 1TME1 3OBRA 1RUI3 2DU1A 1R1ZA 1R64A 4PHZA 4Q4X1 4LUMA 2JG8C 3TB0A 1PGW2 3ITQA 3M3CA 1LTEA 2VUDA 1LEMA 3ZX7A 2JDNA 3RG0A 3WF2A 1OSGA 3AVRA 3G6JB 3C7GA 4BK4A 4AEDB 1N3PA 3WUCA 1O59A 3Q8AA 3WQ1A 2WABA 3RZKA 2LUWA 1F2NA 1TNFA 1SACA 1XB9A 3CU7A 3C7FA 5JR2A 4RQPA 4KH9A 2Y60A 4K8FA 2VGDA 1NCRB 1A78A 2PAMA 4Y26A 5FYZA 1ND2C 1A3KA 1U0AA 4FCAA 2RMU2 4J6GA 4UW3A 4J1WA 2FZ1A 1CIYA 4MHRA 3R6SA 4EN9B 1LCLA 3KVAA 4ES9A 2RR12 3ZLIA 4D6SA 2PHWA 1GLHA 4AEJA 3LDBA 3A0KA 3Q9OA 3SH3A 2PA7A 1XNTA 4A3XA 3JBG1 1V6JA 5FBJA 1COV3 1BQPA 2W1QA 2D6OX 1BZWA 2VO5A 1HB1A 2BNOA 5ERLA 2IXHA 2IVIB 1YQCA 3AMNA 4GB31 1ZBA3 3PVEA 2W2IA 3ZXDA 5LRRA 1CPNA 2DBIA 3HT2A 1K12A 2D98A 2XJPA 3AP5A 4ZU4A 1N3OA 4XQWA 3WCSA 1TME2 3THPA 2R7EB 1OLQA 4WM8A 2CWMA 4MHUA 4E4ZA 2P2KA 2VOXA 2DVDA 4Q4X2 4QD2A 3MV01 1QNYA 1AX1A 4CCCA 3WDWA 3G7DA 3T0BA 1ZRIA 4P9IA 2PLV2 5FMBA 2WYFA 3H8UA 4C91A 3T30A 5FIXA 1VPHA 3CO2A 1REEA 1I6XA 2WQ8A 5GZDA 5DG1A 5A1LA 5KHKA 2YBSA 5AVPA 1CIWA 5T5PA 1BBT3 4PBPA 1CONA 4P5HA 1AVBA 4QPYA 3KGZA 1WCUA 4IE0A 4BHPA 2QZ3A 1QXRA 1QJU1 1LENA 2A3YA 3I54A 4XAAA 5I0DA 1O3SA 4AAPA 4YW2A 4IE6A 3V0BB 1MVEA 1V6LA 2Y6LA 1QEXA 1COV1 2E33A 3J4UH 5BV6A 3LEKA 1POV0 2Y64A 1U5XA 2WFF3 3PMSA 2LROA 3JBG2 2CHHA 5F3CA 5JOWA 2BFUL 3GF6A 3H1MA 4QDRA 1LECA 2PN5A 3A23A 1F8VA 4MLOA 4GKYA 3VBHB 5HCFA 3WNNA 4GB32 4DNYA 1GQGA 3DYMA 3LEIA 5FPZA 5FZ6A 1W2TA 3B00A 4YG3A 5F5QA 5GLWA 3N9OA 4Q0VA 1ASJ2 5GZEA 2HWD3 1MS9A 3J7MA 3UKTA 1RUD2 2YC4A 4Q1RA 5FYBA 3RNSA 5A1FA 1FPN3 1PO22 4E27A 3POSA 2HEVF 2WWUA 1RUC3 4LKFA 4QKDA 3TAYA 1IG0A 4UF0B 1UU5A 3WNOA 3B01A 1S0BA 4EN7B 1KFXL 1W06A 4DEQA 2OIIA 4FQ4A 1SFPA 1RMU3 2BV4A 5FUIA 3PNAA 4LMFA 5T55A 4Q4V2 3VD7A 1QNWA 3GALA 2EIEA 3ACHA 3SLIA 3MIFA 4COUA 2ZCWA 4IQPA 4BB3A 3S0MA 1S0IA 4YPJA 3WG4A 2Y34A 4PIXA 2HEYF 5FQ0A 2D3PA 1LESA 1LODA 2WYSA 2D5HA 3GCWA 2XLFA 3ZYIB 1D0HA 2JIGA 4XUTA 4DMIA 5CISA 2VNRA 3U75A 3O1TA 2Y6GA 2F17A 4P9YA 5J36A 1SLAA 3NQHA 1ULCA 1ZYBA 2JDPA 3NAPB 1GP5A 4AI0A 5CYYA 1SLBA 2PHDA 5BNPA 2WFF1 1OT5A 1OH3A 1AXYA 1I3HA 2Q5TA 3WP4A 4JKKA 3ZMOA 3FHQA 1FT9A 4MZUA 4LOSA 4L99A 4LJHA 5FV3A 3I2DA 4OUEA 4AGGA 3ILNA 4IXLA 3UGFA 1QOTA 2OYZA 2ZAHA 3H50A 1ZBE1 3I3DA 3VDDC 5AC93 1DGWX 2HWB1 1MPXA 1JYNA 4JDNA 5FWJA 4QU2A 5HCBA 2RS33 4NVPA 1CQ9A 3DPRB 3HPNA 5LY1A 3I2GA 2UWCA 4FT8A 2W47A 4OQ9A 1NZIA 4BIOA 3WEZA 1Z0HA 1JZ7A 4FFGA 1RMU1 5CFDC 5HPOA 2LRPA 4RGKA 3VBSB 3RZZA 1MS0A 3NL1A 1RITA 2RJLA 1AR62 1CAVA 2J1UA 3FBYA 5FY1A 5H9RA 5K8SA 2DCTA 1C3HA 1VBC3 4IW3A 1DIWA 3HNYM 5IUQA 3ZFFA 5C4WA 4BQXA 4CYDA 1ENRA 1V70A 2QVSB 1HIXA 3ELNA 5T5JA 4FSJA 4CU6A 4GWMA 4Y22B 2HBTA 3BTAA 4RFRB 4XJUA 3M3IA 3VBOA 4BQ5A 4QT6A 1XRUA 2WN3A 4RS5B 2DTYA 2JD4A 2BVVA 4CE8A 1L3JA 5A3MA 5JSRA 3ON7A 3HBKA 3W9AA 4B4QA 1RIRA 4N7UA 2DVBA 4KWLA 2D6PA 3VDCA 2WJSA 1AYM1 3ZMNA 2ZGQA 4XUOA 2G9ZA 1JH5A 4CP2A 1H8TC 3NMBA 3NW4A 4S2GA 3ZSKA 2HWB2 3NNMA 3QCWA 3U11A 1KQRA 2KR2A 3FHIB 3OGRA 4Q4Y3 4CDQB 4DXTA 1KDMA 1HRI3 1PIV1 4RR3A 4HL0A 5E6HA 3RJ2X 2ZHLA 3LF7A 3MLKA 3W21A 4GZ9A 3JQXA 3FHAA 4FXGB 4AEKA 2JE8A 1XNAA 2VCAA 1H4GA 3IMMA 4N90A 4QKBA 3ZFEC 4AK3A 2HWC2 4Y1YA 1SPPB 2YXSA 3EQEA 4YVWB 5A7PA 2CAUA 4WVWA 2F4LA 2OZ6A 2Z5WA 3NJYA 4QXHA 5FYSA 1DCSA 3MW4A 5A33A 1VRH1 2ZABA 1S2KA 1WCQA 1FOD1 5FP3A 1IKQA 1GP4A 2WAAA 4CCLA 4BQ4A 1S0EA 3J8F1 3E6BA 4XF0A 2VQUA 3ZYFA 1VP6A 4OHVA 1Y43B 4XF1A 4LA2A 5FY5A 4TZDA 4QQOA 2B7YA 4CEWB 5FRAA 5I0RA 3D6EA 4OQ8A 5ACA1 5IK7A 2C6SA 1SEFA 4JVAA 1CX1A 2ZKNA 2HEWF 4XBQA 2CGNA 2VU9A 3NWKA 4XXAA 5D1IA 1AL23 3ROUA 3TNPB 3GZUC 1HN0A 5CNAA 3JU9A 3FX3A 1VBA1 3DXUA 4Q4Y1 4A7KA 5HBAA 1PK6A 1W9TA 1HRI1 3O14A 5A6XA 2JJ6A 3ECQA 2VR4A 1LOBA 3PL0A 3FFZA 1LU1A 3WUDA 1PIV2 1Y9MA 5K0UB 4GWJA 2ZEYA 4R8HA 2UYBA 3A7QA 1UKRA 2LALA 4EYUA 4IV1C 1AXKA 5CB7A 5CFCB 3E1F1 2VZQA 3BODA 3THDA 1W6QA 2E63A 3D3AA 4S2DA 5JMOA 1YQ8A 1F9KA 1OI6A 1UN1A 2X09A 2VH9A 2CY6A 1RUJ3 1VRH2 2GNMA 2X29A 3LPGA 4WVMA 1FOD2 3WCRA 3WDXA 2MEV3 4AWDA 4L8QA 4IEYA 1WD3A 3WD5A 4TXWA 1YFUA 5EJ3A 1N3QA 2W68A 4ORFA 5DXDA 1B09A 1I9RA 4MADA 1UQXA 3MIGA 2ADEA 4BDVB 3GCXA 5FYMA 4NHKA 2XG3A 3D0SA 4GAZA 5A3WA 3I4IA 4W8JA 4LULA 2FHRA 3LKJA 5J37A 3CZJA 3ZSEA 4IV3C 4FAHA 2HWE1 3OY8B 4MXWB 3RRDA 3WNLA 3LSDA 4QX7A 4M3CF 4DO0A 2ZA9A 2VC9A 5FZDA 2B42B 3SKJE 2F6BA 3BN6A 1RUF1 4EQVA 1MQTA 2P4EA 4YM0A 3H1YA 1V9U3 2DTWA 2XL7A 2VBBA 1ODMA 3KQ4B 2KD7A 2H6BA 5D8AB 1G9AA 3W5NA 1VBA2 3K4ZA 4V2WA 4E2SA 5LWBA 1DHKB 1IS6A 3J9SA 2FDHA 1MS5A 4JKMA 2IXIA 2ENRA 1AR71 2RS11 3OPWA 1BMV1 4L92A 2GMMA 1OA2A 4P08A 4LBOA 2JDUA 4F83A 4O9EA 4Y33A 1BK1A 2VPVA 1Y7BA 2VTFA 4Y1VA 3VL9A 3NRUA 4XAEA 3VV1A 4WM7C 3W58A 1RUJ1 4AVAA 5CAZA 2VZPA 1X8MA 4RQPB 5FYYA 1LOCA 1MACA 1UF2C 3B7MA 4CU9A 1JS9A 4LO4B 5DPNA 4AI3A 4NO4A 2PFWA 1HB4A 3RPQA 4IUGA 1S0JA 2WDBA 1H6XA 4ISRA 1DFQA 3POWA 2GC2A 5EYYA 4Q27A 1DG6A 2VZVA 1LOFA 3AP9A 3KV5A 3CMGA 4FFHA 3HQXA 5FZIA 1R093 3AMMA 3K75B 4AYUA 2RS53 4FTBA 4DQAA 2YUEA 3NNJA 4IE4A 5FZBA 2HWE2 3ETPA 3OUIA 4HXCA 1O5UA 3U4XA 2D44A 4IE5A 4ZXKA 5T5OA 1LJ7A 2NQYA 2O0OA 2UWBA 5GZCA 1KFUL 4A41A 5K7PA 1RUF2 2ZAAA 4V1PA 4HOOA 4K3UA 3ZN5A 2VXRA 2ARBA 3IZOA 4J25A 3EJKA 3HVDA 4Z82A 1MEC3 2DCZA 5F3IA 3VBRC 3VN4A 3WQ0A 1LHNA 2XJQA 3WNPA 3ZSMA 4WM8B 4BWOA 2Y0OA 4QX2A 1LOEA 2FCVA 2WT0A 4QQHA 5BNOA 5KHGA 3J7NA 1AR72 3VKFC 2RS12 1BMV2 1C1LA 4I0BA 3CKHA 5L9RA 1P8JA 4D3WA 4HG6B 2GNDA 1HB2A 1FX5A 1G8WA 2PYTA 3H0OA 4N43A 2XWJB 4XW3A 3KV4A 3ES4A 1SMVA 1SLIA 1QJX3 2A5ZA 3KF3A 3HNMA 1OFSA 4P9XA 5IVVA 1GFF2 2ZGMA 2KA3A 4CDUC 3M3OA 1H2MA 1QKQA 4IETA 1Q8OA 1K3IA 2YGMA 2VBDA 2HWF3 3IKWA 1W28A 1V6OA 5DAPA 2VVDA 1KD7A 1RL3A 2ZGPA 1AR92 4L97A 2CNAA 1POV1 2AUYA 4X8NA 1NKGA 2MNGA 2BU9A 4UI9L 4XXPA 4K1YA 4OI1A 4FO9A 4ATFA 1JOPA 3VKMA 1CR7A 4K40A 1SCSA 3CLPA 3VZMA 1V6KA 1TMF2 2H0VA 3I59A 3QD6A 1Y9QA 3TOJA 4PF5A 1Q8PA 1PO13 2EALA 4LEJA 2EAAA 1ND3C 3KS7A 1G7YA 2C9AA 2XKPA 1ND2A 1JHJA 1OVSA 1XE8A 2GSYA 1ZZ7A 2J1EA 2XGXA 3R4UA 4KNCA 3OF1A 1XE7A 2RG4A 1UX6A 5FLIA 1RUOA 4QPGC 3WDYA 4UFMA 2E7QA 1YIFA 3P6BA 4QPIB 4YM1A 1RC6A 4QKNA 5LEJA 3SH4A 2QQNA 3N35A 4YW6A 5LBBA 1GZCA 5LY2A 1W8HA 1FATA 3ENRA 4IESA 4AEMA 1UZ0A 5C5TA 5EFUA 3U0ZA 4LLOA 5LASA 1QJX1 5IFTA 1LAJA 4BYYA 4GIQA 3K3OA 1YC61 2BZDA 3FLPA 3BKZA 2H6CA 3AX4A 5DG2A 2I07B 4R9DA 3ZIWA 2ADDA 3M70A 3T4VA 2IWGB 1O3QA 1ZX5A 3DEMA 3RJRA 4JDOA 3VLBB 1WMFA 3WDVA 1JTZX 3CNAA 5JIUA 3Q8CA 4ZS2A 5JR7B 1W9FA 2YBKA 4CCMA 5JXIA 2AACA 4LHKA 5FY7A 4ZXEA 5KHJA 5BNPB 3QH6A 4JGZC 1RJ8A 1CZSA 5C8CC 5KXBA 2WZ8A 2A6XA 2QQJA 1IS4A 2VG9A 3ZYGA 4DXZA 2R32A 2EIGA 4XQ4A 2WLQA 3MHZA 1APNA 1X82A 2BNMA 5C71A 4B1LA 4XFCA 1DLCA 4CEYC 1AL0G 1CVNA 3D82A 3TEZA 4YVSA 3U14A 4KMQA 4KWUA 3NO8A 1LNSA 2CU5A 5FKCA 1JYWA 4XFFA 4LT5A 1IQAA 1AR81 1V6NA 3OBZA 5IJRA 2PHTA 3IPVA 1ALYA 4QKFA 4XTPA 2ARCA 5JOZA 1XYPA 2GNBA 3E5QA 3GJBA 2BWCA 3MF9A 4N9IA 1H1IA 2DFBA 4QHZA 4AVBA 4ZU5A 4RHV3 4XCAA 3WOGA 1K5MA 2GN7A 4C90A 2DYCA 1TEIA 5J3UA 3Q8BA 1CAVB 1EY2A 1OH4A 1GNHA 4DINB 5BNNC 1JYVA 2J1TA 2QQWA 4GJZA 3TEXA 1BVP1 4YM3A 2VCBA 3WG3A 3O1VA 2EIBA 5FZOB 4RR3C 1EAH3 4XE9A 1YJKA 1VBB2 4LE3A 5FZ7A 3GNEA 3VBOB 2QCSB 2UWAA 1JODA 2R073 4GH4A 4YGBA 1OPMA 3C8XA 3RYPA 1HQLA 1RB8G 2D6MA 4UW4A 2VJXA 1UXXX 4IL7A 5EYXA 1UPSA 2LM3A 4Y5TA 1B35C 3LFIA 3O5SA 1UZYA 1VB2A 2YC2A 4HK8A 1H0BA 4HZFA 5IVYA 5IW0A 4IEZA 3RI9A 1W3XA 2I74A 2C26A 2R063 2OX0A 4NWWA 2BQPA 2SBAA 1QDCA 3QOPA 4AE2A 2A6VA 3BU0A 5K4LA 3ACLA 4MGIE 1LB2A 1HRV3 2P3JA 2J42A 1SHWB 1C28A 1Y9GA 2RDSA 1ULEA 2VVEA 1TVGA 5L7OA 4QX5A 3KVBA 4UFLA 4E4SA 4UOJA 1PZ7A 4AEDC 4OHZA 2JE9A 3N9NA 4NE9A 3UKVA 3ZN6A 3OPTA 4RR3B 1OVPA 1IG3A 4LPLA 2WRAA 4EN8B 2W9XA 3IT8A 4PIYA 1KXGA 4INDA 1J3RA 5J98B 3URFA 1A8DA 1NCRC 5FZ8A 3N7MA 3POGA 5FZ1A 4ATEA 2TUNA 5DUVA 5EHDA 4CEYB 2P3IA 3MZHA 4O65A 4WV8A 4FPGA 4ZU7A 5FZGA 5JDBA 1OXCA 2R49A 1W8NA 1GWKA 3VDDA 4XFIA 2W39A 2QJVA 1JU4A 3VHPA 2XHKA 4OI4A 4ASMB 2NP0A 1GYKA 3AMHA 1HXS3 2Y26A 3WW4A 1C8M3 1Z7S1 3K46A 4Q4W3 4YG0A 2HLEA 5AVAA 3SEPA 4CP9B 1E57A 1HV1A 1XSRA 3JZVA 1RUE3 1W8OA 3ME2A 4LOTA 2P17A 3UK9A 4D94A 4NIHA 5JCTA 4J1XA 3ZXGA 1WW4A 1W0OA 5M0TA 3AFKA 1VALA 2VAUA 3B02A 2R041 3BPZA 3GM8A 1BEV3 4OUSA 3SQOA 4JDMA 1HB3A 1W8TA 2ZBJA 2K46A 3OOXA 2Y6KA 4LLFA 2KM2A 1QXJA 2BDRA 4XDQA 1DYOA 1DQ2A 1D4M2 5CADA 2ZHKA 1OOPC 1O91A 4W4ZA 3C7OA 3KSCA 1UNBA 5F9TA 2VZOA 2R6QA 4P02B 4XCBA 5FK7A 1LOGA 1YJLA 2ZMKA 2Z69A 4U36A 1YIPA 2Y38A 3EYPA 5IVJA 5JXJA 1DQ4A 1UIKA 1OBNA 3T0AA 2QBXA 4LNVA 4QU1A 3LA3A 3VL8A 1RUG1 3ILRA 1CAWA 3I3EA 4YW4A 4XABA 4IEXA 3ZXKA 2QQLA 1W6QB 3I3BA 2WL1A 3NNFA 4LQRA 5FAXA 1DDLA 3SISA 1WUVA 2O8OA 3GZAA 4AHZA 4CPBD 3RS6A 3KQRA 3T2TA 1OFNA 4DXSA 3L9JT 4YG6A 3AZYA 4AXOA 2VXJA 2VQTA 3WDUA 3CJIA 1C8M1 4JTOA 2G4IA 2IXCA 4Q4W1 5FYCA 2VOWA 4Z8BA 4DY3A 2VMDA 1Z7S2 3AYDA 4FQZA 4W6WA 3MICA 1QMJA 4LUKA 1OLRA 5DUXA 4UBGA 4ZZ8A 1J84A 1HN1A 1QHDA 4AL9A 5LW9A 1JMUB 1BEV1 2PXJA 1UY4A 1IQDC 4QQ2A 5JSOA 3AJYA 3B69A 3HQUA 3LA2A 4MUVA 1J1LA 1F15A 1MVQA 4CDWA 3O1MA 2ZKLA 3AB0A 1H2NA 1KRIA 4Z07A 2ET1A 4PDWA 5FUPA 4XIOA 4JRLA 3KF5A 1ASJ3 1AYN2 1PVXA 1W9SA 5FY9A 1MQTB 1UZZA 1FNZA 5FMCA 2FQPA 3I97A 5FOJB 2A3WA 1C5HA 5FY4A 3WDTA 1RXGA 2E53A 4EWAA 3LOBA 1DQ6A 1CJPA 3UL2A 3CZUA 4KWKA 5B4XA 1YHFA 3NJVA 4TLGA 3LDKA 5JUVA 4Y1ZA 4AGVA 2VL4A 2CTVA 4FP3A 4LHSA 3H7JA 3RVHA 1PMIA 2HJIA 2AR6A 2BGCA 5FPBA 4HN1A 1CD3G 1PX3A 4MX3A 4CVUA 3C7HA 2YROA 4Q4V3 3S7EA 1W6OA 2LW8A 3A4UA 3LB9A 2ZHNA 3I3QA 5CFCA 2VVFA 2ARXA 3AXDA 2GMEA 3AZXA 2YPDA 5CA6A 2QE3A 5KHHA 5IT6A 4P9JA 1YUDA 4K9SA 1RUI1 5J96B 1LOAA 3OSDA 4QQPA 5C5UA 2BFUS 4HT1T 1CZVA 3DUIA 3VDAA 1ZM1A 1XXNA 2RVAA 2XBO3 1LHVA 1I1EA 3A22A 3KGLA 4XJWA 4META 4BH9A 4KQ7A 4NUBA 1AXZA 4ZPIA 2JECA 3P1IA 3WVJA 3RZJA 4PJYA 2W5FA 4ITCA 3WF3A 4ET7A 4JGYB 1ZRCA 5LA2A 4HVOA 1Q3EA 1VJ2A 4IE7A 4Y1XA 3DPRC 3UJQA 3LA7A 5EP9A 3RMXA 3M3EA 5FYHA 4DOUA 3AVSA 2R0HA 5DMYA 1A8MA 1QQP3 4UFJA 5GZGA 2WO3A 3HBZA 5F32A 2ATFA 4TN7A 5LEKA 5FXXA 3OJBA 1NXMA 5FZ0A 2DDUA 2Y33A 3VBSC 1N1VA 4Y24A 3AL5A 1WWYA 1DP0A 2WLPA 3GHNA 4UFIA 4B7EA 3ST7A 4OI0A 2OPWA 3R05A 5BNOB 5JPNB 1Q43A 3AJZA 5FPXA 4KGQA 1X8EA 2X5IB 4SBVA 2C24A 3VKLA 3N9MA 1PVC3 1T2XA 3I2JA 1N1SA 3T2PA 3MLLA 4HPKB 1ZBA1 1O5LA 4N43B 4AHYA 5F5AA 1W0PA 4HSLA 4EWEA 4HN0A 3B94A 5ABJA 5JXHA 5BPXA 2QNKA 1QJZA 3VDBA 1RUI2 1AX0A 1W05A 4RS5C 4C8DA 4FPYA 1L7QA 3FC0A 3R4SA 1SLLA 1ULDA 5CKQA 4GD4A 5E8AA 3BGAA 3I2IA 5JI7A 4PLOA 2IC1A 1BYHA 1VMJA 2OQ6A 3FE5A 2WINB 2VNOA 3O0WA 4QXKA 4WBBA 1QU0A 2JE7A 2ZGSA 4N53A 4C0HA 5FZLA 5FWEA 1M06G 1S4CA 3LGRA 4XJ8A 1BBT1 4CU7A 1GZWA 3BOWA 1E5HA 2VUJA 1VAMA 1URXA 3AP4A 1UCXA 1YWKA 3I59B 4GWNA 2IZWA 1Q8QA 1W2UA 2C5DA 3DV8A 4LE4A 5FXVA 3O1PA 4LBJA 3OUHA 1TZOA 4FPKA 4BQ1A 1ND2B 1NLQA 1UYYA 3EB7A 3S5QA 4DPNA 3ZO0B 1ZREA 1QJU2 4YVWC 1FYUA 2GC0A 3ZFGC 1LHUA 4DRRA 5F5CA 5JSPA 4CPBA 3WINE 2HWC3 1OQ1A 2WIIB 5A70A 2O8QA 1COV2 1NE6A 4M4RA 3TN93 4C1XA 3N9LA 3MV11 4NIDA 4MH0E 3N3HA 3DGTA 4UBHA 2O14A 4OZOA 1ZBA2 4ASKA 5FYUA 4A6SA 4CEWC 2YV8A 4BOWA 1WBLA 2V4VA 2WO2A 3KM5A 4K1ZA 2HWD1 4RYDA 2B5HA 2A75A
chains in the Genus database with same CATH topology
2PELA 1NCQA 1JUHA 1FPN1 2NZ9A 2A6ZA 2R0FA 1S2BA 1RUC1 2Z42A 1AJOA 4TYSA 4HKLA 2ZX3A 2WNVB 4R9CA 4WZFA 3KT7A 4G3YC 3PLQA 4OHXA 2ZS6B 1NE4A 3PHMA 5HCAA 2Q1ZB 4IEUA 1Z78A 2Z79A 2JXAA 2NMOA 2CYFA 4UXAA 2WZR3 4AI8A 4PIZA 3MPBA 1S0GA 4JTNA 1G9DA 1BBT2 2VMHA 2YHJA 4KGGA 3DKWA 3IM0A 2YMZA 4CDXA 4CDUA 5K0UC 2EAKA 1F5FA 3RYKA 4YVSB 1YI9A 5CFCC 3PVOA 1R1A3 2WT1A 2IXKA 1NA1A 4AVSA 1N47A 5FMOL 3IPVB 1PZ8A 2YY1A 4AVCA 1OA3A 3TN91 2O1QA 1V6MA 3MIDA 2WFF2 3RYRA 1K5MB 1O7FA 5AC91 1G6NA 4RGGA 2BPA2 2RS31 5HI0A 4LA3A 1HW5A 1ZBE2 2NPIA 4XTMA 2CAVA 1ND3A 2A6YA 3N7JA 1JUIA 2EXHA 1REDA 2W0XA 3EO6A 1VB4A 5LRSA 1RUC2 2ZX0A 1O4YA 2OPKA 5BXXA 4GH4B 2P37A 4GMP3 3FFQA 3V65A 1GANA 2Q30A 3KT1A 4AG4A 1RMU2 2HYKA 2A70A 1DF0A 1VBC1 1UKGA 3D0JA 3LCPA 3ZVXA 4XJAA 5D8AC 3EBRA 1SFNA 3V56A 3KZ4C 2A7AA 1CAXA 4D69A 3H3UA 1W6MA 5BY5A 4AVVA 4WZCA 3WP6A 4E2QA 3ZSLA 5JMCA 3SITA 2D93A 2R1BA 1IS3A 3HWJA 1NY71 2QFEA 1RJ7A 2XVLA 4SLIA 5F6KA 5A32A 5JZGA 5L7OB 3N4MA 1W6NB 4OFGA 2JG9B 4B3NA 3ZN6B 4B7KA 2VY0A 5GLTA 1DQ5A 1YCIA 4G4FA 3VBHA 4RQPC 2WT2A 5BUVA 1W6PA 2VMGA 4NPRA 4FOVA 4I3PA 4RD7A 4MGKE 2GNTA 1AYM2 5EV7A 5GLZA 3IDEA 4QHBA 5AC92 5C33A 2ZGUA 4PBOA 3IDCB 1RVF3 2RS32 2XJUA 4IERA 3VDDB 4W65A 1G9CA 4L9BA 2FMYA 3BB6A 3E5XA 2WNUA 2DCKA 3KCYA 1WW5A 4BMEA 3QLQA 2VW2A 1FAYA 1S0DA 2K2SA 4JRAA 1UU6A 3SH5A 1HLCA 1RUH3 1VBC2 4P9GA 5FQ0B 4FOYA 3S7IA 1WGPA 2GZWA 3B5LB 3P3PA 4WM8C 2BBVA 2AH2A 4M3CE 4Z8BA 1VAKA 1LGNA 3J8F2 3WW1A 5CVRA 3WY6A 3JB4C 5KC5A 3PTYA 2NYYA 1NY72 5ACA2 2RM23 4ONUA 3GBFA 3USUA 3WW3A 3QACA 1AL21 3D8CA 4H55A 3C3VA 2DWRA 5C9AA 1WCSA 2TNFA 1CAWB 3H1WA 1RVF1 4YYOA 1GV9A 4Z92B 2ZMLA 2CWSA 5SV5A 1C8NA 2GMPA 3N36A 2D7FA 2UYAA 3VBFC 4FOWA 2ILMA 4Q4Y2 1XU1A 4HK9A 1HRI2 2BTVC 3CJIB 3B9CA 1AR93 1H8VA 2K9ZA 3RDIA 2DURA 5KBFA 2AREA 2ZGLA 1RHI3 1MZFA 4C0BA 1VBD3 5EXOA 2XUMA 4OULA 2GC1A 2ZHMA 1ONAA 4CDWB 4YARA 5GM0A 2PQQA 4H7LA 2MEV1 5F1RA 4AQTA 5T50A 4PDWB 4QPIC 1BXHA 2WS93 4XMIA 2FMDA 4IEWA 1DU3D 2XJTA 4Q0QA 3GZTB 2TEPA 2DU0A 4DY5A 1TNRA 3TWIA 5TSWA 2YZ4A 2YGLA 1JXNA 3AP7A 4HKWA 3NVCA 2A73B 3ETQA 3FMGA 1GBGA 4I0WB 1AL22 1YFXA 1WMDA 1W6OB 5DZGA 3VBUA 3RMYA 1HKDA 1V9U1 2H0BA 4XOGA 2BEOA 3E6CC 4KL1A 1LRHA 4JC1A 1OOPA 3IMNA 4I2OA 3S30A 1H9PA 5DDJ3 5BNPC 1PNGA 1ZZ6A 2SLIA 4AFAA 3ALQA 4AQ2A 5GLUA 1KITA 1SBDA 2B46X 4XJZA 1I5ZA 5I8SA 4COYA 1OPOA 3AZZA 1RUJ2 4FXKB 4A7ZA 3ILFA 1VBE3 4ES8A 4ISQA 4CRQA 2MEV2 3H3ZA 1ZZBA 2GDFA 3FLRA 1YXWA 3BALA 3V0BA 3V64A 1R083 3N7KA 4LR4A 1WLWA 3SCFA 2JG8A 2UY9A 5E89A 3ZXLA 1FMD3 3H9AA 5FREA 3WW2A 1R091 4OVEA 2RS51 2EXKA 4MGYE 5GJ6A 1GSLA 5DZFA 3P3NA 2LTNA 4F7ZA 5L73A 3NJZA 2PHRA 5T52A 5CIRA 3B93A 3MGUA 3WQ7A 3V0AA 1ZZCA 3ZIXA 4K20A 3SCHA 4Y20A 1D0GA 1V9U2 3VBOC 2V5YA 1MEC1 2ETEA 5ABJB 4OHWA 1CGPA 1VBB3 4L11A 1ENSA 4KBBA 3JD73 2GH2A 2ZGTA 4XHBA 3ZXFA 3WLUA 4PCRA 4OHYA 4XILA 3IBMA 1QY4A 2WZPP 1EV13 4FBFA 3B3QE 1XNDA 4N53B 2OW4A 3VUOA 4HKOA 1BCXA 3X29B 4AHWA 3MEPA 4LBNA 2B45X 4P14A 3VZLA 4K7JA 4Q0UA 1MS4A 2HWF1 2JICA 1X36A 2ZMNA 4RR3C 1WW7A 1FMD1 1NZCA 1FI2A 1FV2A 4WVVA 4XJ9A 3AMQA 1QF3A 1R092 2RS52 1IS5A 2EXJA 3AZVA 5T54A 1H4HA 2D3RA 1UPIA 3OCPA 2MHFA 1PO11 4URTA 3PVBB 4HMZA 1LHOA 3MF6A 1J59A 3OYWA 4HETA 4Q26A 3MIHA 4TSVA 1Q8SA 3HMYA 3KLSA 1F5JA 1MEC2 2WKKA 3AXEA 1NCQB 1JBCA 2XH6A 1C4RA 3PJQA 5IK4A 1U5IA 3DF0A 1EV11 3NKTA 1OMIA 1ENQA 5JIAA 4FP2A 4QGMA 2FZ2A 3GBGA 5FO9B 3JCIA 4DB5A 1QJX2 2JKBA 4COVA 4A2UA 2ZX2A 3ZFFB 3RSJA 5C4WB 5JI9A 3OGJA 1OA4A 4Q0SA 3NV3A 1XNCA 2OUJA 4EWDA 4YNIA 2QQPA 1QJY3 3T1MA 2HWF2 4CDXB 4CDUB 1UU4A 1QXPA 4YZ5A 3CEWA 3PJYA 4U2AA 4Q8LA 1ENXA 1FV3A 3ZXEA 1OHFA 1NA1B 4CP1A 1DZTA 3HAGA 2OVUA 1RTVA 3FUQA 2BNNA 3M2MA 4YZ1A 1D4VB 1PO12 2WFPA 3FUOA 4R4ZA 2A6WA 2E7TA 1DGLA 3EHKA 3C2UA 1ND3B 4FVVA 2PHLA 1WCDJ 4YM2A 2K0GA 3VZNA 1AR82 3KB5A 4RHV1 5T3NA 5I0SA 3ZFGA 4A7YA 5JPMB 3NSTA 4R52A 4NR1A 2OUHA 1IZ3A 5A33B 2ZGNA 2XPJA 2RMU3 4M3CA 3ZYJB 4B8EA 4CEWA 1CAXB 1EAH1 1IOAA 1W6MB 2AENA 2R071 4IEPA 3WZ1A 3WHUA 1VR3A 2MPFA 2D97A 2RR13 3AKQA 5BNQA 2DVAA 5A32B 1JHNA 5JZGB 4Y1UA 2R061 2ZGRA 5CFDA 5I93A 3R0RA 4KU7A 3MLJA 1W6PB 2R1DA 3HD8B 2UY8A 3BOPA 1GR3A 1HRV1 2EF6A 3PMEA 1TME3 1HV0A 1ZZ9A 1PGW1 2VOKA 1LOFC 2D43A 3AM2A 4Q4X3 1PK6B 5K0UA 3UV9A 1QH6A 4QMAA 2WNUB 5CFCA 3H7YA 4LO5B 4JGYC 2PLV3 2ZGKA 3KD4A 2B8MA 4RHV2 3LAGA 4P9WA 4XBLA 5KXDA 1H2LA 4XPVA 4YGDA 1NLRA 5DZEA 5I0TA 4WVMB 1H8TA 3GYDA 1HQNA 1HX6A 4E2GA 1EAH2 1HXS1 5BNOC 5IK5A 1VIWB 3TNQA 4AFBA 2R072 1RUE1 2X5IC 5KC6A 2ZACA 1SDWA 2Q8OA 3VZKA 3JBG3 3USUB 3ZFEA 1H9WA 3ZXAC 1X33A 4YZ4A 1DGWA 2R042 3OBTA 5C9AB 2DF7A 5GLVA 1SCRA 1MZEA 3O0XA 4GB33 3KT4A 4AW7A 1EPWA 4M00A 1AX2A 1KS5A 3WR0A 1RUD3 1LHWA 4D7TA 1HRV2 4MSVA 2UU8A 3AMPA 1PO23 3TBDA 2ZPXA 3MW2A 2PLV1 1YLLA 2Z2SB 4YGCA 2DUOA 4W6YA 3UKNA 1QH7A 4XQDA 2AZ5A 3NKGA 3VBHC 1S0CA 1OD5A 1HDKA 1RUG2 1YYNA 3D5OA 4XYXA 5FLJA 4HVQA 2WWSA 3MFAA 4KG8A 3WV6A 3IN9A 3SXWA 3LZZA 4NN0A 3TYJA 3NAPC 4BIFA 1ZRDA 2V73A 2D6NA 2X53S 1IKPA 1XYNA 4H3WA 1HXS2 1QJU3 1C8M2 1NXD1 2DV9A 4Q4W2 3WXPA 1RUE2 4AI2A 1DGRN 4GXLA 1UAIA 1DYPA 4X6QB 5E1RA 4IV1A 1CPMA 2QDRA 1BEV2 2BYVE 3AK0A 2B39A 1O4TA 1LKNA 1TQ5A 1ASJ1 1NQJA 2P34A 4HFSA 3VBUB 1RUD1 2WSUA 4JQRA 3AKSA 1UW8A 1PO21 2WNVC 3APBA 4TWTA 4Z1VA 1ZZ8A 1M4WA 1XNBA 4C1WA 5L19A 1OOPB 4HANA 2GAUA 1J58A 4XETA 1WLDA 1IPJA 2WQZC 4H7MA 4Q4V1 1H1AA 4LO7A 2OZJA 1AR63 1MZ5A 3FWEA 3LOIA 5AFBA 4LBMA 2XLAA 4IV3A 3AKRA 2D40A 3HN1A 1RUNA 1SBFA 4XFAA 3QH7A 5A3LA 4YVSC 2X8KA 4FOQA 2NLRA 3ATGA 2TBVA 4LBQD 4BPZA 2Q0AA 2XBO1 5FOBB 4BE3A 3VBFA 4DS0A 1YNAA 5J7MA 4K6BA 2JG8B 1G9FA 2N7GA 1K5MC 4FPLA 4IEQA 3WHTA 5JOYA 2GH8A 3VZOA 4XZPA 1NLSA 1AHSA 1XQNA 4N9HA 1J3QA 4IEVA 4P9LA 5L36A 3V0AB 4WM7A 2D6LX 4B4RA 3WT3A 4FTSA 1QQP1 1ZBE3 2HWB3 3USSA 4Y20B 3SCGA 4GH4C 4OI2A 4QPIA 4F3JA 1XNKA 4KG0A 1MR5A 3MFCA 1AR61 1PVC1 1IPKA 5LK7B 1Q8VA 2IXJA 2DUPA 4YW1A 3B9IA 5FMOS 2ZZQA 3IIAA 5FFOC 2WA3A 1MS1A 1QGLA 3AYAA 1O3RA 2A71A 2VOVA 5FBZA 5L7OC 4FPCA 2W08A 5FDBA 2JG9C 2C0ZA 3VBRA 4ASLA 3THTA 2R30A 2XBO2 3NV2A 3VHRA 1UIJA 4AI1A 4GULA 1SFYA 3AKPA 2ZJCA 3SHRA 4JAAA 1KDKA 3CF6E 5KWRA 1SQ4A 1BKZA 2EXIA 1J1TA 5GZFA 1AYM3 2NN8A 4OLLA 4XFBA 3U10A 1QQP2 2NM1A 4YZ3A 4NWVA 1KJRA 3OYWB 4B4PA 3S6PA 3CL1A 2PHFA 1Q5OA 1YFWA 4Z2WA 1PIV3 3HR9A 4LO6B 4X6RB 4AHXA 2HWC1 1YRZA 3RQ0A 1C57A 3POYA 4CZSA 3E6DA 1VLNA 2ZOEB 5FLHA 3FBMA 4MYEA 1CESA 1PVC2 2ET7A 2VULA 2E6VA 1VRH3 1FOD3 2E9QA 1WCKA 3J8F3 1AZDA 1X7NA 4GALA 1RINA 1WA4A 3LSEA 1UD1A 2HWD2 5DUUA 4EN0A 4XF9A 2B9UA 1FPN2 4UW6A 3MYXA 1ZRFA 5EZWA 4PLNA 5ACA3 3MI8A 2XJSA 4QPGA 4EN6B 3N7LA 2BVBA 1CN1A 2WZR1 4YW5A 4GA9A 4DZGA 1NQDA 2ERFA 3VHNA 4I30A 1NYWA 2WQ4A 3AFGA 3CJIC 3WG1A 5JVVA 1VBA3 5GKAC 1UMZA 1MS8A 1S55A 1U5ZA 1R1A1 1DZRA 1FXZA 4I02A 1PNFA 1PZ9A 4PLMA 2ZZJA 3WNXA 2XB6C 5AFEA 4HSJA 2HKXA 2V09A 4CDWC 1H2KA 1AUYA 4YLZA 3TN92 2QZ2A 1NG0A 2DVGA 4JGZA 2JDZA 4LBQA 4YGEA 4PDWC 1LU2A 5C8CA 2C1FA 3AKTA 4LHLA 2VW1A 3ASIA 1WLCA 4L2NA 4BA6A 4LBKA 2G9FA 4M3CB 5E88A 2G9GA 4CEYA 1CAUA 1SBEA 4YW3A 3PVNA 4GMP1 2I45A 2IXLA 4YZ2A 1PGSA 1JOJA 4FPOB 1C5IA 1CJDA 1ZA4A 5H9QA 2HWE3 5CFDB 2WZR2 3GHMA 4KWJA 1SLCA 2JENA 1RUF3 3OTFA 3QBQA 5I91A 5BNNA 1HQWA 1O3TA 1EPZA 4W6XA 1GZ9A 2DVFA 3VGIA 4M01A 1WBFA 1R1A2 2UURA 3ZYPA 1AR73 2RS13 3K51A 4YRDA 2R16A 1OKQA 2VECA 4LTAA 1B35A 3ZPYA 5F6LB 2PHXA 4Q1PA 4Q2FA 1U5YA 2DUQA 1LR5A 1WMEA 4RFT0 5KHIA 4BLIA 2Q1MA 4O9GA 1H8TB 4XFHA 1ZVFA 3BU7A 2P3KA 1YFYA 4AEDA 3KCCA 1WD4A 2D5FA 1QOSA 3JUUA 3MPPG 3GBWA 4AQ6A 4CTEA 1N1TA 5B2GB 4COZA 1RUH1 1AJKA 1NCRA 3ZN4A 1J3PA 3ZFEB 3UJOA 5ABJC 1TMF3 1GNZA 2NMNA 2I2SA 4E4DX 1MZ6A 2BWAA 2EA7A 4JV4A 1GKBA 2VMIA 1WLTA 3J26N 2WC2A 2DCJA 3VZJA 2XLGA 3KCXA 3WG2A 5FO8B 2RM21 5IK8A 1WW6A 1Q56A 4N53C 4FPEA 4I0AA 1JW6A 2VNGA 1NOVA 1LULA 1ZRRA 3M3QA 4MXVA 4AFMA 1PGL1 5T5LA 1LGBA 3NV1A 2D3SA 3I8TA 5H9PA 5CU1A 4S2HA 2W52A 1RVF2 4QM9A 1YO8A 3VKOA 5KXEA 1AR91 3OGGA 3R4DB 2IFWA 4JGYA 1POV3 1RHI1 4QGLA 5CG9A 2ZGOA 4NOTA 4M0HA 1VBD1 4CDQC 3KMHA 1JN2P 1QOOA 3K48A 1UL9A 1TMF1 4EROA 1RUH2 4IV1B 4S2FA 1X50A 4YSFA 1NCQC 3T1LA 2WS91 4RA0A 3ZXJA 3MIEA 2BW8A 1Y3TA 4AF9A 3HIFA 2XJVA 3OPZA 4Y5Z0 4FPHA 4MVTA 5EWSA 2ZTNA 2CGOA 1IHMA 2X5IA 1T6GC 3AYEA 2RM22 1MS3A 5KXCA 1OQDA 1O4ZA 4HPKA 4JCKA 1C1FA 2YPJA 1OQEA 2VQ0A 4KU8A 3OD0A 3ZFFC 4AVTA 4OZXA 4CP0A 5C4WC 1PGL2 2XVKA 2QDNA 4IV3B 5JAXA 4M0NA 4XMAA 5BYNA 1XYOA 4CDXC 4Q0PA 2KXLA 4NHLA 3WP3A 4E9KA 5DDJ1 1NA1C 1EP0A 1VAVA 4BCUA 2QUOA 1V00A 1N1YA 4COWA 1IGOA 1BJQA 3VBFB 1GQHA 4GQ7A 3ZDSA 2RJKA 3FJSA 4I09A 1RHI2 4X8PA 1VBD2 2FBEA 4N7IA 1S1AA 4Y4YA 1DGRA 1A6CA 1ZNPA 2VQAA 3M4FA 2EVXA 1VBE1 3U07A 5I0UA 5J48A 3RI8A 4MGZE 1DYKA 4WM7B 1GZWB 2WS92 1R081 1YI7A 3VKNA 3I7DA 3NAPA 5JWPA 1GICA 4XF3A 3SMHA 1D2SA 1AR83 1QWRA 4G9SB 2BUKA 3MW3A 4HLTA 4WVZA 3WP5A 3ZSJA 1AF9A 4DFSA 5SV8A 2RHPA 4XIKA 3M8LA 3AZWA 3BCWA 3DPRA 2PAKA 1REFA 4TLFA 1DBNA 1VBB1 1U12A 3JD71 4I01A 2GN3A 5JZGC 2WNVA 2ZX4A 4EV0A 5DDJ2 4R9AA 3VBRB 2D6KA 3VBSA 5FTTC 3BIWE 5H9SA 2DFCA 2JEMA 5GALA 5LK5A 2A3XA 4R9BA 4QM8A 3WX5A 4AGRA 3INAA 2VW0A 5FCCA 4Y22A 1TE1B 3M7AA 4LBLA 3CJXA 2RE9A 4AFCA 2WSVA 1F31A 1VBE2 4D7SA 4YFZA 1PK6C 1D4M3 2WNUC 5FO7B 3ES1A 1DQ0A 4RS5A 4FPJA 1R082 3W59A 1KJLA 4XHXA 4GKXA 1JYCA 1FMD2 2PAEA 2GC3A 3E5UA 5CBLA 1DLLA 2AGSA 3IWZA 2E51A 3M1HA 1JYIA 2WNEA 1KS4A 4XFGA 1QDOA 4BLJA 4XF4A 5K9YA 1ULFA 4PQ9A 4ZKTB 1LGCA 1RGSA 3DN7A 4CDQA 3DL3A 1LEDA 3JQWA 3L2HA 4MV2A 1FNYA 3JD72 3RWNA 4R4XA 2ES3A 5CG8A 5I8YA 1Z7S3 3HT1A 2YC0A 3ZYRA 1XU2A 4YVWA 1EV12 4QPGB 5C9AC 3TRSB 1DZQA 4UW5A 5E16A 4HVRA 4QQLA 2YDEA 4D7YA 4FTEA 2R043 1MQTC 2QKDA 2IFRA 3IDBB 3EXUA 1D2QA 2CGPA 1D4M1 3MDPA 2ZX1A 1AYN3 4EJRA 4DRVA 4AQSA 1QJY1 2CL2A 2JX9A 1H1MA 2XL9A 2DCYA 1W6NA 2XVGA 2JG9A 3JB8A 1PM7A 2Y0IA 4FPFA 4GMP0 5J09A 4BM8A 2F4PA 4Q29A 4LHNA 2AYHA 4LO8A 5I8TA 3E97A 3AYCA 2E7AA 1RUG3 4AFDA 3SNMA 1G86A 3L2YA 2GALA 4JGZB 4LBQB 4RGAA 5C8CB 1CX4A 3MIBA 2XKOA 3OD4A 4I3GA 1S0FA 3A0NA 4CEYB 3VHOA 1CAUB 2XWBB 2Q4SA 2CV6A 3NV4A 1SLTA 4B29A 2YYOA 4HBNA 4FAGA 1BVVA 3VBUC 5C8WA 4XEZA 2XJRA 4BZ4A 1DQ1A 1AYN1 2RMU1 4QGNA 1PHMA 3FZ3A 5DUWA 5JLVA 3LWCA 2GU9A 4IEOA 1ULGA 1V6IA 4XBNA 3D4KA 5BNNB 1QJY2 5C6CA 3O12A 2RR11 4H14A 3O7OA 4K21A 4RL7A 4NHMA 2PHUA 4OUMA 3FLTA