3LOIA

Crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
EEVKRLIALYELTPHPASGGWFRETYRSDVQVEAEGFDGKRSVLTMIYYLMQAGQPDPFHRVKSDETFVHNLGGSMKIHMIHPDGSYSCSILGNPLEHPEARHQVVVPRRVWFAQEVDGYCLASVLVAPGFDFKDFSLGKREELIKEYPQHRDVIMRCTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structures of the apo and GDP-bound forms of a cupin-like protein BbDUF985 from Branchiostoma belcheri tsingtauense
rcsb
source organism Branchiostoma belcheri tsingtauense
molecule tags Unknown function
total genus 40
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3loiA01
2OYZA 2ET7A 3KMHA 1NE6A 3RZZA 3DN7A 3FFQA 3MYXA 1O3TA 4BIFA 3B02A 3USSA 3U10A 3IDBB 2OPKA 2VPVA 4ZU4A 2CAVA 3E97A 3E5QA 5LRSA 4DINB 1YHFA 3HT1A 3IDCB 1ZZ8A 4XF4A 4F8AA 5FLJA 1RUOA 4Q0SA 2D93A 2MPFA 2Z2SB 1DZRA 4N9HA 1HW5A 1VP6A 4EWEA 5LRRA 1UCXA 5LEJA 2BNMA 4IEZA 1H1MA 1X8MA 4HVRA 4NVPA 3ES4A 1X7NA 4A2UA 4MH0E 5JR7B 1O3RA 4JVAA 3LA3A 4EWDA 4PIYA 4Q0QA 3MZHA 3SXWA 4XFCA 1XRUA 4LEJA 1YFXA 3QOPA 3I59B 4N9IA 3RNSA 2Z69A 2QDRA 4HN1A 4LA3A 5C8WA 1CAVB 4YSFA 1SFNA 3MDPA 3HQXA 3DV8A 3HT2A 3TNPB 3H7JA 1LR5A 2QVSB 5JAXA 3RYRA 4UBGA 1I6XA 1SQ4A 3UKNA 5FLIA 2OA2A 3NJZA 5K8SA 3RYKA 3BPZA 2BYVE 2Q0AA 5I93A 2MHFA 4KU7A 3NW4A 1ZZ7A 3C3VA 1CAWB 3E5XA 5BV6A 3LAGA 1Q5OA 4XF1A 4E2SA 4MV2A 3BALA 3ETQA 2VQAA 2GZWA 1J3PA 4HZFA 4E2QA 3SCGA 3VHRA 2IXLA 4R8HA 3ZDSA 1RTVA 4JTOA 5FQ0A 3R6SA 3IIAA 1YFYA 3FZ3A 2E9QA 4I09A 3GYDA 4XF9A 3S7EA 1CAXA 2PYTA 3KGLA 4Z07A 4AVAA 2ZKLA 1ZRCA 1CAUA 3NL1A 3QACA 4OFGA 2GU9A 3CJXA 3EQEA 3IWZA 3UKVA 5FPXA 4L2NA 4D7SA 1WGPA 4QXKA 3E6BA 1TQ5A 1ZX5A 4IEWA 4IERA 3PLQA 3WW4A 3PVBB 2XLAA 3CL1A 1EY2A 3FHIB 2XL9A 5LEKA 1NZCA 3BCWA 4LLOA 2OZJA 3SMHA 2IXCA 1UIJA 5I8TA 5JSPA 4IEQA 2D40A 3O14A 4P9GA 3PNAA 2XLGA 4QGNA 1ZZ9A 3EJKA 1ZRFA 2K0GA 2WC2A 1GQGA 2H6BA 5E1RA 3TNQA 3NVCA 4AVCA 4JTNA 1X82A 5I0TA 5BXXA 4EWAA 1L3JA 4IETA 3FE5A 3M3IA 1OMIA 4AXOA 1O4TA 2ET1A 4EROA 2CV6A 1V70A 2MNGA 4Q0VA 4O9GA 2Q1ZB 4HVOA 1RUNA 3NKTA 3D0JA 1EYBA 1LB2A 1OD5A 3LZZA 1QY4A 4IEXA 3BB6A 2V09A 2PA7A 3KCCA 5KBFA 3D82A 5EZWA 1ZREA 1YLLA 4PJYA 4F7ZA 2GH2A 1ZZ6A 4FBFA 4O9EA 1QXRA 3ACLA 5KHGA 2IXJA 5BY5A 2GC3A 3IBMA 1VR3A 2O1QA 4MGZE 4Z82A 2Q4SA 1PMIA 2PTMA 2UYAA 2UYBA 5J3UA 3I59A 3ELNA 3OCPA 1SEFA 3U11A 2HKXA 1CAVA 4I2OA 4CYDA 1I5ZA 3E6DA 4KWJA 4ORFA 3H1MA 1QXJA 4UBHA 1WLTA 5J7MA 2D5FA 4I0BA 1ZZCA 2EA7A 1Y9QA 2EAAA 3OD0A 4IEUA 1J1LA 4LUMA 1ZZBA 1UIKA 3DL3A 4R52A 2H6CA 2IC1A 2HJIA 1RL3A 3H7YA 5I0RA 2PFWA 1CAWA 1J58A 1YUDA 1Q43A 1XE8A 4PIZA 3KGZA 2C0ZA 1O5LA 3EO6A 3CO2A 3OTFA 4MGYE 4X6RB 2F4PA 2O8QA 4HSJA 4IEPA 4XFHA 4MGKE 4GULA 3DKWA 3EBRA 4WZCA 4HMZA 3CLPA 2OZ6A 4LULA 3JZVA 5KHIA 5T3NA 4H7LA 2XLFA 1OI6A 5FPZA 1UPIA 4J1XA 1H1IA 1Q3EA 5CU1A 3H9AA 4BH9A 3E5UA 2GAUA 3H50A 2PAMA 3RPQA 5FDBA 5FLHA 3FJSA 4FAGA 3KSCA 4MZUA 4QM8A 2GC2A 4ZU5A 4XFGA 1LKNA 1ZNPA 3HIFA 3WW3A 2PAKA 2IXHA 3LOIA 4YRDA 2IXIA 5CVRA 2QNKA 3N4MA 4AQ6A 4AQ2A 2PHDA 2PAEA 3U0ZA 2GC0A 5I8SA 4XEZA 1J3RA 1FXZA 1CGPA 3MPBA 4Q29A 3RDIA 2P17A 3SCFA 1LRHA 4TLFA 4PIXA 2EVXA 3CEWA 1ZRDA 2UY8A 2K9ZA 5I0UA 4WBBA 4D7TA 3LWCA 1EPZA 4AVBA 4IEYA 3NSTA 2PHLA 5AVPA 1YFUA 2IXKA 3ST7A 5I0SA 2GC1A 4HSLA 1O3QA 2FMYA 2BEOA 1WA4A 2ZCWA 4B29A 4META 4FT8A 1X8EA 2XHKA 2Y0OA 3SCHA 4XFBA 4YARA 4MX3A 2KXLA 1RGSA 1G6NA 4BYYA 2DCTA 4X6QB 3H3ZA 3H1WA 3LA2A 3OGJA 3E6CC 3I54A 2Q30A 3WW2A 4J1WA 4Q0PA 4RD7A 1NXMA 2XGXA 4QGMA 4HN0A 5FCCA 1QWRA 3CF6E 1U12A 3H8UA 1GQHA 4EV0A 4KWLA 1IPJA 5J48A 3G7DA 1FI2A 3LA7A 3UKTA 1DGWA 5JCTA 1CX4A 4MGIE 5I8YA 4I3PA 1OFNA 3EHKA 4LUKA 4YNIA 4KL1A 4I01A 4ONUA 5JSOA 4ZU7A 5CADA 3H3UA 1VJ2A 3ES1A 5HI0A 5KHKA 5F1RA 1DGRA 1IPKA 3FWEA 2N7GA 4HBNA 4IEOA 4E2GA 1DZTA 5D1IA 1NE4A 5KHJA 3S0MA 2BGCA 4FAHA 4QMAA 2QJVA 4XF0A 2BNNA 5EFUA 1NYWA 1O5UA 4QM9A 3S7IA 1JUHA 2ATFA 4LTAA 3WW1A 1O7FA 1FT9A 5BPXA 1RC6A 3GBFA 3D0SA 4MUVA 3OF1A 5FQ0B 2CGPA 3I7DA 4XFFA 3M70A 2D5HA 4IEVA 3RYPA 4QX5A 2H0VA 4L11A 2WFPA 3L2HA 1CAXB 4K8FA 2ETEA 4KU8A 2VECA 2PQQA 4LA2A 1J59A 4QGLA 4YYOA 2QCSB 1PM7A 1CAUB 3SHRA 4BHPA 5E16A 2UY9A 4XF3A 4I02A 2FQPA 1UD1A 5C6CA 4UXAA 1J3QA 3ROUA 3H1YA 2XKPA 4HLTA 5I91A 1Y3TA 4KWKA 4Q0UA 2XL7A 1YFWA 2B9UA 4OLLA 2B8MA 2B5HA 4XETA 1ZVFA 4WVZA 4XFIA 1EP0A 5JSRA 1XE7A 1O3SA 4IESA 4XFAA 3FX3A 4JV4A 1YWKA 5KHHA 2BNOA 1ZRRA 3BU7A 4I0AA 2I45A 1UW8A 4HVQA 5BUVA 2XKOA 2CAUA
chains in the Genus database with same CATH superfamily
2L9LA 2OYZA 1NE6A 2ZABA 1JTZX 2XJRA 4QD2A 3GALA 3MYXA 1UKRA 4BQWA 3OYWB 1AL23 4AEDC 4BIFA 2E7QA 3USSA 1UX6A 2YHJA 3BIEA 1BK0A 2YYOA 2VPVA 4ZXEA 1D7PM 3KF3A 1XJAA 2JG8A 3AYAA 1PIV3 1RHI1 2QBXA 5DUVA 3NAPA 4CXYA 3G6JB 3HWJA 4KWUA 2Y6KA 2W52A 2JD9A 4XDQA 2IFRA 1NG0A 1ZBE3 1IHMA 2WS91 3AP9A 3KV9A 1US2A 4PT6A 4Q4V2 3ME2A 1XB9A 5ERLA 3PL0A 3RZLA 2EIEA 3B9CA 4AG4A 2QUOA 1HW5A 1QJFA 2W1UA 5FWJA 1Z7S1 1AYN1 4BE3A 1UU5A 1AF9A 1IG3A 1YNAA 4M0HA 3OUIA 1WLDA 2BNMA 4AAXA 3ZFEB 1H1MA 2VTXJ 3N9PA 1X8MA 4M4PA 4AGRA 4HVRA 3B3QE 2J1AA 1X7NA 1PMJX 3ES4A 5J37A 4COWA 4LOTA 4MH0E 5IFPA 3AMPA 5A1AA 3IM0A 4JVAA 5IVVA 1O3RA 4CCDA 4RGAA 3MZHA 1GNHA 2DWRA 4DNYA 2A71A 3H0OA 2ARCA 4LR4A 4HT1T 2WQ8A 1MS8A 2QTWB 2VGDA 4XFCA 4CCMA 4LEJA 3RNSA 2UURA 1APNA 3I59B 3T09A 2X5IB 2Z69A 5FJHA 4AYUA 2RMU2 2VW2A 2YUEA 3C7EA 3E1F1 4WZFA 3VZNA 1GFF2 4KQ7A 4P08A 4QX3A 4YM3A 5T54A 3MEPA 4YSFA 4UFMA 1KDKA 4DOUA 1SFNA 2ZACA 4Q4W1 1LENA 5FZDA 3LSDA 1B35C 5IK4A 3H7JA 2K2SA 3HQRA 3AKQA 1HB1A 4XXPA 1LU1A 5F3CA 2YU2A 2PLV1 4MLOA 4DXZA 2Q8OA 1I3HA 2P6HA 3PIGA 5F32A 1AXZA 4WM8B 3VZJA 4BQ4A 2D3RA 2ZX2A 3POIA 4Y1UA 4P00B 1Z7S3 1POV0 3LFMA 5GLTA 1AYN3 1H8TA 4XJAA 1HN1A 3OB8A 3NJZA 4XABA 1UPSA 5F5AA 4YVSA 3VBSB 3VHNA 1C1LA 5LY2A 3LPGA 2B4KA 4CE8A 5IVJA 1GKBA 3NW4A 4K40A 1CAWB 5FUPA 3JCIA 3L2YA 3THDA 2VQAA 1BHGA 3UL2A 3I8TA 5C71A 2BGPA 3VHRA 2VMGA 2IXLA 2DTYA 4YZ2A 1MQTA 1V6NA 2J7MA 1LESA 4IV3C 4JTOA 5FQ0A 1FMD1 1AZDA 1K5MB 1YFYA 3IIAA 4GWJA 4Q4W3 4F3JA 1ULDA 4TN7A 1CZTA 3NJXA 3PUQA 4CU8A 3MLKA 3S7EA 3OUHA 2VQUA 2G9FA 4A45A 4DIQA 2BGOA 3MLJA 1I9RA 3MF9A 4KI5M 4M3CE 2PLV3 4EN9B 4PBPA 1W04A 1U5XA 3AM2A 3MICA 1ENRA 2D6LX 3JD72 3I3QA 1XNBA 1A8MA 5F39A 5T5LA 5A6YA 2XUMA 3JQWA 4QHZA 1Q56A 4YGEA 2BFUL 2VL4A 4LLFA 4LKSA 3UKVA 5C70A 1KD7A 5FPXA 2IVIB 4MYEA 2AEZA 4Q4V1 2XG3A 3ILFA 3KHCA 1PO13 4D7SA 1EAH2 1GYKA 3T1MA 1IQDC 1W2OA 2A3YA 3BPSA 3SEPA 3WDVA 5JOYA 3UESA 1JZ7A 2JG9A 4N43A 4LHKA 3PLQA 4ZS2A 1Q8PA 1REEA 3GZAA 1QJX2 3CHXA 1W2TA 1FMD3 2XL9A 4H3WA 4AI8A 1E5SA 5LEKA 2P3IA 1E57A 4TLGA 2OZJA 3DKQA 3MLLA 4EYUA 4D8MA 4QXHA 5I8TA 1SBDA 3ZN6B 4QX1A 2NP0A 4MG2A 5LBEA 3O14A 5KXBA 4TYSA 2RM22 4ZHNA 1PVXA 1QJY1 5IATA 1JYVA 5G05L 1G9CA 1ULEA 4QGNA 5EHDA 1RITA 2VZTA 4LBQD 4QKNA 1RUF1 2ES3A 1VMHA 1LECA 4HONA 4XBNA 5E1RA 3TNQA 2WDBA 3AZVA 4Q4V3 1X82A 3VDBA 5I0TA 3ZOIA 4IETA 3FE5A 3M3IA 1OMIA 2TNFA 3WNLA 5C4WB 2CSGA 1O4TA 2FCVA 4GZ9A 4MXVA 3VGIA 1IS4A 3AMQA 4EROA 2VZRA 1DQ4A 2RJLA 2GALA 4RS5B 2DU1A 1HRV2 4HVOA 3WEZA 3DF0A 2F17A 4QPIB 5DAWA 3OBZA 5DDJ1 3NKTA 3VD7A 3ZR6A 1FNYA 2GH8A 3IT8A 1EYBA 2RS51 4LE3A 1D0GA 4Y20A 3T0BA 4EJRA 1F5JA 2Y26A 3LZZA 1TMF2 2PA7A 2V72A 1W8FA 1LHWA 1IGOA 4OUMA 2Y0IA 4UFIA 1L7QA 2GH2A 4CP9A 3BYWA 1CIYA 4A7YA 4KMQA 5LA0A 2FDGA 1QJY3 2XVGA 2D98A 5FYCA 2WZEA 2VUAA 2VMDA 3VBFC 4GD4A 3UK9A 3PMEA 5FZOB 2V4AA 1F15A 3Q8FA 4LO8A 4YLZA 4XVHA 2O1QA 3ZIXA 2LUWA 2O14A 5CKMA 2JICA 4FTEA 2D6NA 3GNEA 4PQQA 4N53B 2JDAA 2HEVF 1MEC2 4QU1A 4BXFA 1SEFA 5KXEA 3W59A 1GMMA 3VKLA 2WO2A 2BJSA 1LULA 5DDJ3 1UZWA 2O0OA 4KWJA 3DPRC 4RYDA 2BVBA 4FPOB 3AKTA 1QXJA 2Z79A 1GWLA 2RS53 4DY5A 3N7LA 4IL7A 1EAH1 1WLTA 3WR0A 1DYOA 2EXKA 2QQUA 4FPCA 1RJ7A 4I0BA 2GMMA 4C90A 1BZWA 2VAUA 2EAAA 1ZA7A 4XUOA 4LBJA 1LODA 1WBFA 1F8VA 1HJFA 1QJX1 3AKSA 4R52A 4Y4RA 1MS9A 1OKQA 2H6CA 1X36A 5I0RA 4F83A 3O7OA 1OLQA 3BGAA 3S5AA 5CKQA 3WNPA 4J6GA 1J58A 2W68A 4CZSA 4CU9A 4J25A 4OI1A 1DU3D 4QKDA 2C0ZA 2ZGPA 5IVEA 2HBTA 3JB4C 1PK6C 2RM21 2BDRA 5AFEA 3MW4A 2EXJA 1S0BA 1RUH1 3VZOA 1EUTA 5GALA 5LBFA 3CLPA 4CDUB 2OZ6A 4QQLA 4K8RB 3JZVA 5KHIA 1G8WA 1TME2 5T3NA 2NN8A 2W47A 3KWVA 1S0DA 2XLFA 5JIAA 3FBMA 3T08A 5J36A 1EAH3 2F4LA 3AJZA 4R9BA 1OOPA 4AFBA 2P34A 2Y60A 4J1XA 1COV2 1H8VA 1Q3EA 1YEWA 2VTXA 1PVC1 3WF0A 4BH9A 5HCHA 1QJX3 1OD3A 1UOGA 1S0EA 3UJOA 1UWWA 4YW6A 2PAMA 1MZEA 4UT5A 1S0JA 4B7KA 5CFCB 5FMOS 1JHJA 2RDQA 5M0TA 3WP4A 5A3PA 3S57A 5FP9A 2HEWF 1TMF1 5FK8A 3VBOA 3POBA 4P9IA 4FAGA 5GJ6A 4L8QA 2YBSA 3RWKX 3U37A 2GC2A 3ZXDA 2RM23 5TSWA 2VW0A 3WXPA 4CDQB 4CPBD 5JOXA 2TUNA 4FPKA 4NPMA 1W2AX 5GLWA 1RUH3 5A3UA 4YM0A 3T2PA 1QJU2 1N3OA 5HXVA 2J22A 4JGYB 2QNKA 3N4MA 4AQ2A 4P5HA 2YZ4A 4WM7A 2ZBJA 4AQSA 1MEC1 3ENRA 4FFHA 2I2SA 4XEZA 4CDWC 4YW3A 1FXZA 2WNVB 2ZS6B 1CGPA 1PVC3 4K21A 4ASMB 5CNAA 1MVEA 4FQ4A 5IW0A 5T52A 5KR7A 2Y6FA 4DB5A 1SHWB 1OPOA 4EE2A 4PIXA 1HX6A 2YPJA 1TMF3 1SDWA 1M4WA 1JH5A 2WBKA 3ACGA 3M3QA 2K9ZA 5D8AA 5FYVA 2ZJCA 5EWSA 2JDUA 5DQ0A 1QOSA 5BNOB 1XNKA 2FD8A 2DBNA 2WNVC 3I2GA 2BRTA 5GZDA 3WDXA 2UWAA 1UOBA 3BN6A 4KGQA 4ASKA 2PHLA 5AVPA 1IS3A 3AZWA 1YFUA 3X29B 4XAAA 2C26A 2EIGA 2IXKA 4HSLA 2BEOA 1WA4A 4R9AA 5CKNA 4E8CA 3VBUB 4QX8A 4YVWA 3BOPA 4PBOA 4WVWA 5JI9A 1VE0A 2VMEA 3UJQA 1DFQA 1JHNA 4META 2Z42A 1MEC3 5EIYB 3QD6A 2C24A 4W6WA 3RJ2X 3SCHA 3IIIA 1ND2A 1LJ7A 2WQ4A 5A6ZA 4CCCA 4UW4A 4MGQA 4AVVA 3MHZA 1W0PA 1DYKA 4D6QA 2JDMA 3PURA 2DCTA 4X6QB 1CWPA 3H1WA 3POSA 1W8HA 3CQOA 1DP0A 3I54A 3ZXAC 3WW2A 4Q0PA 3K4DA 4CCEA 1C3HA 4RD7A 1MS3A 1NXMA 5EYXA 1COV1 1U5ZA 1ZRIA 3M7AA 3PUIA 4LKEA 1OHFA 4OHVA 3OGRA 4RSUA 2HWD2 3POYA 4LK7A 1BKZA 1BYHA 1UMIA 2ZGKA 2R1DA 3KHBA 4XCBA 3I3MA 4CEWA 5ACA2 1PGL1 4FVVA 1IPJA 1GZWA 4NHMA 2A6YA 1FNZA 2AGSA 3WVJA 3ZMNA 3T30A 2YBKA 2OKXA 1JYXA 2LALA 3AYDA 4LHLA 1VLNA 1DGWA 1K3IA 1W2UA 3VL9A 1NQJA 5F8PA 1CX4A 1TNFA 1WA6X 4MGIE 3WP3A 1VBD2 1K45A 4I3PA 5L9RA 1WCDJ 1JXNA 2RV9A 4I01A 4OYUA 4CU6A 3LCPA 3Q8EA 1X50A 3MGUA 1T6BX 3SKJE 5DZEA 5KHKA 2VZOA 1TME3 1UU6A 2FZ2A 2SLIA 5LWBA 1OF4A 1SCSA 3FWEA 3CBNA 4R9DA 1V6LA 1RVF2 5J98B 2A75A 1DGRN 1COV3 3O0XA 4MADA 1C57A 1UYZA 2JWPA 1E5HA 2QQKA 2YC4A 1S0CA 4KNCA 1XC6A 5F2SA 2RG4A 1YQCA 2RS32 2VNVA 2W08A 2E32A 2WT0A 5HCBA 4P14A 1DQ6A 3ZFFC 3ZYFA 2VC9A 2QJVA 3P3PA 1RUD1 1NYWA 1O5UA 2JECA 1DQ1A 4QM9A 5EFUA 5CFDA 2VXJA 3N9QA 2FZ1A 1EPWA 5A7NA 1GANA 2W0XA 3KQRA 3S6PA 3VZKA 5LY1A 4DMIA 3N36A 5KC6A 1FT9A 5IHRA 3FL7A 3U4SA 1LOFA 4WVVA 4M3CB 3RFRA 3RJRA 1W90A 3MO4A 3ORJA 3V0AA 4LO6B 1RYYA 2B7YA 3OF1A 4XFFA 3M70A 4IEVA 2ZKNA 4XMIA 4LIUA 5C8CA 4BMBA 1JZ8A 4UFJA 1LOGA 2WFPA 1CAXB 2MEV2 4LA2A 3GZTB 3VKOA 1HB3A 2ADDA 2X8KA 4AHXA 4ASLA 5C3QA 5GZEA 4QGLA 4YYOA 4HXCA 5F6KA 1ND3B 3AP6A 3SEEA 1NCQB 2AC1A 2HBUA 5E16A 2UY9A 3J8F2 4FPEA 2BWCA 4QDQA 2J1RA 5FPLA 2QQLA 2HWE2 1VB4A 1S2KA 3RMXA 1UMHA 3H1YA 4JC1A 3MW3A 2ZGUA 4LJHA 1RUD3 1WW6A 3OPWA 2WYFA 1KDMA 4KWKA 2XL7A 4PDWA 1PHMA 2R072 2V5YA 4QXCA 4ZXKA 1GOHA 2Y6LA 2RDRA 4OLLA 4BQXA 1BVP1 3VBHA 2IVJA 2WFF2 2B5HA 1W05A 5DG2A 4GB32 5F2WA 2R16A 1EP0A 1WW5A 3NO8A 2CHHA 2FDFA 4QPGB 1OLME 5FP7A 3NMBA 2KR2A 5JSRA 1IKQA 4OMDA 2JENA 3FLRA 5C7GA 1JZ5A 4JV4A 2QQVA 4Z2AA 3POJA 1H4HA 5KHHA 4LHNA 4E4SA 1AYM1 4CP2A 3LQCA 5F5QA 3BODA 2D43A 4HANA 3K51A 4JGZC 5C33A 5FOJB 1W3XA 4XPVA 3ZLIA 2I45A 1JMUB 5A7SA 4E4HA 2PELA 2ZMKA 2ENRA 1GNZA 4OI4A 1XQNA 3T4HB 4NWVA 5IK8A 2ET7A 2G9GA 3DYOA 1SCRA 2BP6A 5EV7A 3DN7A 3MIGA 5FYBA 4BQ2A 2YMZA 1V6IA 2CDOA 4FPHA 3THTA 4CDXB 1JZ6A 1O3TA 2R041 3O1PA 1LEMA 4XZUG 1SMVA 4HPKB 3GXUA 2XDVA 1UY1A 3B02A 4P9WA 5FYTA 3S5QA 3IAPA 4Y24A 1ASJ2 3U10A 2OPKA 4JCKA 3WZ1A 2QKDA 2PHRA 3CJIC 3BI3A 1BBT1 4ZU4A 2CAVA 2RJKA 3A7QA 3WF2A 1H30A 1GWKA 4GJYA 4NIAA 4BZ4A 4Y4YA 1LOCA 5LRSA 4PI0A 3JU9A 4DINB 1C4RA 1W6OB 5FZ4A 4ZZ8A 3N9OA 1GBGA 4CEYC 4N7UA 4F8AA 3U4XA 3GHMA 3ACFA 5FLJA 2LROA 3W21A 1WCUA 3UYJA 1DCSA 2Z5WA 1AYM3 3FMGA 3POEA 5A6QA 2JDYA 3OY8B 4LBQB 1KFUL 4KBBA 3JUUA 3WHUA 2WNUC 4PLOA 2P2KA 5SV5A 1XU1A 1S2EA 1LGBA 1SZBA 5DPNA 4AI9A 3PVEA 4OI0A 1O8SA 2WZ8A 1MR5A 4UFHA 2VCMA 4UF0B 2WL1A 3W5MA 1XYPA 2LM3A 1OH4A 2R043 1R081 1PMHX 2HLEA 2CL2A 4H7MA 1TVGA 5A1FA 5IFTA 1QNYA 1NA1C 2MEV1 3LSEA 1CN1A 3R05A 5JXHA 1BBT3 4LBNA 3QOPA 5FYIA 4PLNA 1S0GA 1HQNA 5F3IA 3B69A 2BVVA 2QDRA 1GZCA 4LA3A 1KS4A 4DQAA 1OSGA 3J8F1 4AK3A 3VDDC 4LXLA 3LOBA 2ZXQA 3K48A 2A70A 2HWE1 3DV8A 3HT2A 3TNPB 3O1RA 4UAPA 3HBZA 4P9JA 2RDNA 2TEPA 5JI7A 1GP4A 1Q8OA 1ZA4A 4UBGA 3ZYJB 2W1SA 2DCJA 3WQ0A 1SQ4A 4ZY9A 3WT3A 4OHZA 5ABJB 5CBLA 2K46A 5K0UC 5K8SA 2ARBA 1F4HA 3MIBA 4XC9A 3OJBA 2DBIA 2CYFA 1BMV1 4CUGA 3WDWA 3POWA 1R083 3HNBM 4XF1A 4MV2A 3BALA 3AKPA 1H9PA 4UW5A 4COZA 3CZJA 1V9U1 2MEV3 1J3PA 4E8DA 4E2QA 2FDHA 4G9SB 2D6KA 1GU3A 4DUXA 1KRIA 2I74A 3DYMA 4AEKA 3VD9A 1W0OA 5FZCA 3WQ7A 1JW6A 1Y7BA 4Q8LA 4MHUA 2LW8A 3WY6A 3ZDSA 5J1XA 2XVKA 3J8F3 4IQPA 5JZGB 3SC7X 2Q1FA 2VQ0A 2HWE3 2E9QA 2E63A 4I09A 4MGSA 5A7PA 4CP1A 3KV4A 3FUOA 1C8M1 4XF9A 1A8DA 3VD4A 2DUOA 3WQBA 3VBRC 4NPLA 3SISA 4AFMA 5HCFA 3JBG1 3T2OA 1QJZA 1VBB2 1S2BA 5FO8B 4FSJA 1CAUA 3NL1A 1NQDA 2VMIA 3TB0A 4BJ0A 1HXS2 2GU9A 5FBZA 4WVMB 5FKBA 3M4FA 4LT5A 5JZGC 3LKJA 5CYYA 1WGPA 2X53S 1NCRB 4QXKA 4X8PA 5D2AA 5A3OA 3WHTA 5BNPB 4FOWA 1V9U3 1UO9A 3WOGA 3LF7A 1G9DA 3WW4A 1QIQA 4CUCA 1SLAA 3VKFC 1W6NA 4AEDB 3BCWA 5A80A 1T2XA 3M8LA 4TTGA 4GMP1 4QB1A 2CGNA 3BTAA 1C8M3 1D0HA 3ZFGC 2IXCA 4YG0A 2BBAA 1E5RA 4P9LA 1ASJ3 2VZPA 4CTEA 3JBG3 5CB7A 1XNAA 5B4NA 4P9GA 3PNAA 4JHZA 1SLLA 3IAQA 4UYBA 3VD5A 5L7OC 2BOJA 2JKXA 2P4EA 2WLQA 1FOD2 2PMWB 3OYWA 3NVCA 3PHMA 4L0PA 5FXXA 4AVCA 4JTNA 1A3KA 5JUVA 3OBRA 1R092 1LTEA 2WZR2 2YGLA 2DUQA 1VBC2 4AXOA 1SG3A 2RR12 3KB5A 4LO5B 4RQPC 4YW5A 3JXSA 4C1XA 1UF2C 1JOJA 4FOVA 2MNGA 1HKDA 1C28A 4Q0VA 4O9GA 5FYYA 2R062 1GOFA 2Q1ZB 5FWEA 1IS6A 2ZX1A 3H42B 5IVBA 3D0JA 3MV01 2W92A 1LB2A 5DXDA 5FY4A 5CA6A 3ZPOA 4GMP3 4OUEA 4IEXA 1ULPA 3BB6A 2IUWA 5FMOL 2AH2A 2FCUA 3KCCA 5KBFA 2OPWA 5JXJA 3BTZA 3LEKA 1WMEA 2C1FA 1W9TA 2ZEXA 3FUQA 1HDKA 5AC92 3IPVA 3ZFEA 2JDPA 3THPA 4RR3C 2QQNA 1B35B 4GAZA 3O1VA 3IBMA 4XE9A 2OIIA 1UMZA 3WG1A 3ZKUA 5FV3A 1ULFA 4LO7A 1VR3A 3HMYA 5DAQA 2Q4SA 1PMIA 2JE9A 4AHYA 2UYBA 3BVCA 4ZS3A 4FP2A 3QCWA 1BEV2 3VV1A 2XUEA 2WSVA 5C3PA 1RUC2 3VBFB 3I59A 1AHSA 2X5IA 4Q27A 4XACA 3KD4A 1V6KA 2HKXA 2CDPA 1W2NA 3URFA 4RGKA 4P9YA 3ON7A 2OXBA 5LBCA 5ACA1 1I5ZA 2XONA 3HR9A 1OLRA 2B39A 2JG8C 4LPLA 4NHLA 4LNVA 3UGFA 3H1MA 3NAPC 4QPYA 3GZUC 2WO7A 2G9ZA 4Z92B 4IGQA 2D5FA 4WM8A 3GM8A 2D3SA 3B01A 3ZKYA 1QQP1 3AMMA 3U78A 1KFXL 4IEUA 5IAXA 1GQPA 1MVQA 1SACA 1YC61 2KA3A 3GZEA 4IV3B 4LHSA 3D4KA 4A3XA 4BWOA 1UIKA 3DL3A 2XQRA 3VBSA 1DDLA 2IC1A 1RL3A 1UZZA 3H7YA 5EXOA 5C3OA 2PFWA 1CAWA 1ENXA 1YYNA 2WKKA 1PO11 4YGBA 4DUVA 5HPOA 3IMNA 3KGZA 3MIDA 1O5LA 3CO2A 3KQ4B 3WG3A 2ZGNA 3ITQA 3O0WA 4Q26A 2O8QA 4IEPA 3UETA 4A6SA 4B1LA 4MGTA 2DYCA 4GULA 3AXEA 1AX1A 2R32A 3EYPA 1K5MA 2VZVA 3I97A 2H0BA 5ACA3 5EP9A 2YFZA 4W4ZA 1OUSA 4HMZA 3UNPA 4LULA 2DCKA 4LORA 4G4FA 4AFCA 5FZFA 1QOOA 4H7LA 2P6CA 1PX4A 1TZOA 1R091 2GMPA 4LQRA 5FPZA 2BQPA 3WD5A 1REFA 2PHWA 2WINB 2WZR1 5C5TA 1IG0A 3ACHA 1HB2A 3ALQA 4XTPA 5HCAA 1QQP3 1VIWB 3PU8A 2BWAA 3OEBA 3NNGA 4NUBA 5FR3A 2E7TA 5BNNA 4NMIA 4W6XA 3TEXA 2XJPA 1IS5A 4GALA 1DIWA 3RPQA 2QDNA 4QT6A 2X29A 4JQTA 4JRAA 1H8TC 1UY0A 2A73B 3A22A 4YM2A 5FLHA 4YVSC 3FJSA 5H9QA 3WSOA 3HNYM 2VOTA 3KSCA 4FO9A 1XYOA 2O8OA 4MSVA 4A7ZA 5E89A 2ZGOA 3M1HA 5A7QA 3U75A 4QM8A 1XXNA 3PJQA 4D69A 4ISQA 4NAMA 3O1SA 1LKNA 3HIFA 2VNRA 4EZHA 4BDVB 4QU2A 1MQTC 2IXIA 5CVRA 3ZPYA 4BA6A 1W0NA 4PHZA 5GLZA 5A1LA 1R093 4AQ6A 1BEV1 1PZ7A 1HJGA 1YRZA 2WZR3 4D7YA 1H4GA 4KGGA 5I8SA 2VCAA 3T0DA 2RMU1 2YPDA 4XZPA 3RWNA 3RDIA 2QFEA 3M2MA 4D0QA 1DF0A 1JS9A 1OFSA 1QU0A 2R063 3DECA 5FYSA 3T1LA 3KS7A 3PVOA 1CX1A 3AZXA 3PUAA 5IK7A 2EVXA 4DRVA 2RS12 4Y5Z0 2JKBA 3O5SA 2RE9A 5FP4A 2UY8A 4H14A 5C4WA 2GNMA 5HXMA 4RHV2 2ZAAA 4YGCA 4CUBA 4WBBA 4Y22B 1NLQA 1UOFA 1CPMA 4X8NA 4D7TA 1WKYA 4RS5A 1JN2P 3GF6A 1EPZA 2ZMLA 4S2FA 4XAEA 5FPUA 4AVBA 1WUVA 4QPIA 2JG9C 5FYUA 4OHWA 4N43C 3AFKA 3ST7A 1O3QA 2FMYA 2EXHA 3WDUA 5FO7B 1BEV3 4KG8A 2CU5A 5E8AA 2Q1MA 3NV2A 1X8EA 4AFAA 4CXWA 2RMU3 5LATA 3C7OA 4RN5A 3F95A 1PNGA 4YARA 4MX3A 1RGSA 4O61A 1NUKA 4FOQA 5B2GB 3DPRB 4XIOA 5FZOA 4FXKB 2YBPA 3HOBA 5F5IA 5L19A 2JB4A 3HQUA 1B09A 1L7LA 1CJPA 1O8PA 2KD7A 4N53A 5H9RA 4IV1A 2XGXA 2D97A 1S1AA 3J7LA 2Q8CA 1C5IA 3JD71 4XILA 3OD4A 5FCCA 1QWRA 2ZEWA 3H8UA 1S55A 2ZGMA 1GQHA 3T0AA 4YW4A 5GM0A 3GBGA 4KWLA 3ZYBA 2VQTA 4EV0A 1TE1B 1AR92 1W6QA 3RRDA 1BQPA 1HLCA 2QZ2A 1W9SA 4Z1VA 1FI2A 4GH4A 4QAWA 4YWAA 2C5DA 2VU9A 1VB2A 3I2KA 4FPGA 4OHYA 1XYNA 4YW2A 1PK6B 1JOPA 2VXRA 3K46A 1W3VA 3GDBA 1LOBA 1H2MA 2J1EA 3CKHA 5FZ0A 2W1WA 2VW1A 3EXUA 3EHKA 2A7AA 1DG6A 3VHPA 1D2SA 2ORZA 4ATEA 4JKLA 1DLLA 3KV6A 1W8WA 4INDA 1ZBA2 4O7XA 1PO22 3WNXA 2VNGA 4KG0A 3H3UA 1VJ2A 5CADA 1SBEA 5HI0A 3LDBA 4BMEA 3C7GA 2VO5A 4B4RA 3RZJA 1K5JA 3KVAA 3MV11 4HBNA 4IEOA 1BLZA 3ZXKA 4XQDA 1U5IA 2ZHKA 1KQRA 3JD73 5D1IA 4XDOA 4HL0A 4YM1A 3RZKA 3PUSA 3LEMA 3B9IA 2VOXA 4IV1C 4XXAA 4CDUA 3OGSA 5FZAA 1GOGA 3ZM8A 2YY1A 5FUNA 3N35A 2CNAA 1AX2A 2G1MA 3B94A 2VM9A 1AXKA 1REDA 4QMAA 5K9YA 3NWKA 3I2HA 4XURA 2JE7A 2VZ3A 4IE0A 3V65A 1BXHA 4RHV1 5BNQA 3S7IA 4XMAA 4XJ9A 4PCRA 1JUHA 3FFZA 1PZ9A 4QDSA 5DUXA 2GSYA 1HRV1 3WW1A 4KH9A 5BPXA 3WNOA 5CFCA 3IN9A 3TAYA 1DHKB 2GN7A 3FLPA 3HN3A 1IPSA 3I7DA 4QDRA 1UN1A 1Q8VA 4XYXA 4CDWB 3O1OA 3J4UH 1I5PA 5HV0A 4KU8A 4XUTA 1GZTA 1W8TA 2VECA 1WW7A 3WDTA 4CDQA 1OOPB 5LK5A 3WF1A 2CWMA 4XW3A 2WWUA 3W9AA 4EN0A 4MO3M 4NROA 4LMFA 5JR2A 1H2KA 4QX2A 3SHRA 1H6XA 1CR7A 2OX0A 2JX9A 4XF3A 1DQ2A 3NKGA 3J26N 4I02A 2EIBA 4E4ZA 5CG9A 4K7JA 4JGYA 2ARAA 4FTSA 4CP0A 3W20A 4B7EA 1ALYA 2RJ2A 4HLTA 1KXGA 4B4PA 1Y3TA 4HOOA 1LGCA 4Q0UA 4RHV3 5FMCA 4UFLA 3LPFA 1DGWX 4QQHA 5FK7A 4AFDA 1HRV3 1OOPC 2HWF2 1ODMA 1QOTA 3EMRA 4GMP0 1WLCA 2EIDA 4M00A 1H0BA 2ZGLA 2IWGB 1V0AA 1AR91 5A7WB 1CD3G 1S0IA 1XSRA 4AQTA 1NAEA 3KLSA 1O3SA 3FX3A 3OUJA 1YWKA 4AF9A 4AHZA 3AJYA 4COUA 2DTWA 2ZX3A 1NLSA 1ZRRA 1XNTA 3A21A 4NHKA 5A70A 1MS0A 3BU7A 5BNOA 2W5FA 4I0AA 2WAOA 1Q8SA 3VBOC 1W6MB 1X9PA 5BUVA 2HWB2 2JIGA 2XKOA 2CAUA 3D5OA 1G86A 3RQ0A 1ZBA1 3ZXGA 1PO21 2ZEZA 3LEIA 2Y8KA 1G7YA 3IB3A 5A32B 3KM5A 2VZSA 2WQZC 2YB7A 4COVA 2A3XA 1WD4A 4BLJA 2UWBA 2E31A 3AMNA 2DDUA 4Y1VA 2NLRA 4XJUA 4WM7C 2VCBA 3E97A 2NQYA 4M3CF 1RUI2 5C9AA 4FFIA 4D6RA 1AR62 1AR93 2BV4A 1TME1 3HT1A 2GDFA 4BIOA 3JQXA 4BXSV 1Y43B 3IDCB 1ZZ8A 4XF4A 4WV8A 2DFCA 1RUOA 4CA9A 2QQOA 2YDEA 3NV1A 2FBEA 2D93A 3OBTA 2WAAA 4XQWA 3USUB 1HRI2 1XPWA 3WUCA 3NJYA 4S2HA 4XHBA 5F5CA 1PX3A 4ET7A 2BW8A 2J42A 5D8AC 3WG4A 5DMYA 4H55A 1Y9MA 2WT2A 1CESA 1ZBA3 2ZAHA 1PO23 3PTYA 3ATGA 4IEZA 5LEJA 3SNMA 4QQ2A 2OW4A 4XIKA 4NN0A 4BM8A 3VDCA 4FCAA 5FPBA 3R0RA 1AX0A 3WF4A 1UOJA 3LA3A 1FPN2 4GWMA 3K2OA 3O1MA 1JU4A 2EICA 4NO4A 4PIYA 4Q0QA 4XBQA 1JYWA 3DXTA 2QQJA 3SXWA 4W8JA 1KITA 1XRUA 3NNMA 2RVAA 2W9XA 4PLMA 1YFXA 4YG3A 5E88A 2VCCA 4N9IA 4YVWC 1QKQA 4AOCA 1VRBA 1UY2A 2AENA 2PHUA 4IDZA 4ZPIA 3THCA 4FP3A 4UW6A 3ZFFB 5F9TA 5K7PA 1YJLA 1CAVB 1LHUA 2D6MA 5FO9B 1QJU1 2WA3A 1ND2C 2VR4A 3HQXA 2D7FA 3MDPA 4Q1RA 4CCKA 2VTFA 3OSDA 3UT0A 1G9BA 4D3WA 1XOYA 2VD7A 5C9AC 4JAAA 2QVSB 3AYEA 4C1WA 5JAXA 4Q4Y2 4Y5SA 2WLPA 1ONAA 3RYRA 3H8OA 4Y1XA 1ACCA 1I6XA 1JOBA 4Q1PA 5FPAA 1Z78A 3UKNA 3UV9A 5FLIA 4DFSA 4UWDA 1CJDA 4NWWA 3BPZA 2X09A 3J7MA 2BYVE 2Q0AA 1AJKA 2ZHMA 3KCXA 5I93A 4FOYA 4LBKA 3I2DA 4KU7A 4FFFA 1ZZ7A 3C3VA 3CIHA 5BV6A 4CEWC 4NAOA 2GP3A 1Q5OA 1YQ5A 2Q8DA 5T5JA 1SLCA 2GZWA 1PGW2 2JJ6A 4HZFA 5J09A 5DAXA 4R8HA 1WMFA 2HWB1 4M3CA 4IE5A 2ZTNA 4U2AA 2A6WA 3R6SA 1KJRA 3FZ3A 1QJU3 1VBA2 2VVFA 2RDSA 4A41A 3BOWA 3GYDA 1VPHA 1CAXA 2PYTA 4ITCA 3KGLA 2VULA 4GIQA 2VMCA 2HWC2 4C8DA 3APBA 1AVBA 5HV4A 1YIFA 1A34A 1ND3A 2XB6C 3ZIWA 4OFGA 1NCQA 2VBDA 1RUI1 1AR61 1SFYA 2AYHA 2Y38A 1GSLA 5EYYA 5FY5A 4AGVA 2VBPA 2YXSA 3AVRA 3IWZA 1YXWA 1JYIA 5LCWL 2YC2A 4CCOA 1AR72 1T6GC 1ODNA 4JGZB 1UL9A 5FBJA 1Q8QA 3E6BA 5FYHA 1J84A 4BLIA 1HRI1 1JZ2A 3ACIA 3WCSA 3AK0A 4IEWA 5JPMB 2OT7A 4LITA 1UQXA 2HWD1 5CFDC 3PVBB 3WP6A 2HWB3 3WNKA 3TEZA 2R49A 3CL1A 4EQVA 1EY2A 3FHIB 4XBLA 2EF6A 4AI1A 2E51A 3WCRA 4NPRA 1LOFC 5DAVA 4XHXA 1W8NA 4HFSA 1UYPA 3CJIB 5FZ9A 1VBD1 5JSPA 3PJYA 3BIWE 4GXLA 1L7RA 4HG6B 3R4UA 5FTTC 5C8CC 5DUUA 2OVUA 2XLGA 1ZZ9A 3EJKA 1RUI3 1AR63 1ZRFA 4CEYB 2K0GA 3NNLA 4CDXA 2ILMA 1V6OA 1MZFA 3A23A 4HPKA 1FYUA 1VAMA 5BXXA 1RVF1 1L3JA 4EWAA 5IVFA 5JMCA 4Q4Y1 2WNUB 3H8XA 1MS1A 1HRI3 1RUE2 5IJRA 4I30A 2R0FA 4R4XA 3T4VA 2IFWA 1WLWA 2ET1A 2HWD3 4S2GA 2CV6A 2VUJA 4QKFA 3RVHA 2RS31 4CCJA 4PDWC 3ZSLA 5JPNB 1W6OA 1RIRA 2WNEA 4EN6B 2FMDA 4LK6A 4ATFA 1W9YA 3NV3A 3VBHC 1F35A 3ZSEA 1RUNA 3AL5A 1W03A 2WWJA 5FY9A 1NA1B 2C4XA 3LD8A 1RXFA 1V00A 1CIWA 1QY4A 1R1A2 3OY8A 4NOTA 4LBQA 3H8RA 1VBD3 2V09A 1W8ZA 1N1SA 2G19A 1VBE2 2VJXA 4IW3A 5EZWA 1ZREA 4OZOA 2Y6GA 1YLLA 4F7ZA 2AEYA 2ZGTA 1ZZ6A 4YZ3A 3VDDB 4O9EA 4FBFA 2PHXA 1QXRA 4JDMA 3ACLA 4UF0A 3DCQA 1NT0A 1PM4A 5BY5A 2GC3A 4NHYA 1AR82 4MXWB 1QEXA 1R64A 1VBA1 3K4AA 5GLUA 3TBDA 2VH9A 4DS0A 5A3MA 2VMFA 5IVCA 4AWDA 2QQWA 3N7KA 2UYAA 1N1TA 3WX5A 1AL22 1HQLA 1RVF3 2V5DA 4Q4Y3 3K3OA 4HK8A 5K0UB 3OCPA 4DXTA 1DQ5A 3V0BB 1QHDA 3SITA 2JB8A 2RS33 1QH6A 5JLVA 4I2OA 1RB8G 1WW4A 2XJTA 3ZSJA 3P3NA 2A6XA 4NRPA 1LHOA 2Z4FA 1AR71 1HN0A 1JZ3A 1ZBE2 4UBHA 5LB6A 1YQ2A 5FZHA 2WSUA 3ZX7A 5J7MA 2R071 3OGGA 1US3A 5F7UA 1IZ3A 2EA7A 1Y9QA 1JU3A 5FZ3A 2WFF1 3OD0A 4R4ZA 1V6MA 2ZGRA 4XUQA 2A1XA 5ABJA 4GB31 2UWCA 1RINA 4LUMA 4M0NA 5DABA 5GKAC 3ZN4A 2HJIA 3DEMA 4L92A 2AUYA 2X10A 3A0KA 3N3HA 1VBA3 2E53A 2XWBB 1Q43A 3MUZ1 1XE8A 3VBRB 4PIZA 1DZQA 4Q5OA 1H1AA 4Q2FA 3EO6A 3OTFA 4MGYE 4X6RB 2F4PA 4G3YC 4HSJA 3ZO0B 4CSWA 4MGKE 1SPPB 2ZMNA 3ZDVA 3DKWA 4LBLA 3ZVXA 5AFBA 3DXUA 3EBRA 2VOWA 4AE2A 1K42A 1RHI2 5EJ3A 4XJZA 3RZGA 1W6PB 2XR4A 1AR73 2XVLA 2WS92 1AL0G 3HVDA 1ASJ1 1FV3A 1OA4A 5T5PA 2R073 1UPIA 2NM1A 5IWFA 3KT4A 4OVEA 1RUE1 2CWSA 2PHFA 3TEWA 4NIIA 2WFF3 3N7JA 1DBNA 5CU1A 4E9KA 4GQ7A 1HQWA 4GB33 1H9WA 4PQ9A 3Q8BA 1LAJA 1Z7S2 3Q8CA 4K1ZA 4WVMA 1AYN2 3H50A 3ZR5A 4AW7A 1OC1A 1GWMA 4K3UA 1W99A 4YW7A 5EJ1B 3ZYPA 2ZPXA 2AREA 2C9KA 1S4CA 1LGNA 1A6CA 2ZX4A 3ZFGB 1VAVA 5FUIA 5A6XA 1NCRA 4GWIA 5BNPA 3KT1A 5H9PA 3CU7A 4OQ9A 4V2VA 4MZUA 1MZ5A 1W9FA 3TN92 4B8EA 1EV12 4ZU5A 5L7OB 1ZNPA 4OHXA 4QWNA 4URTA 3WW3A 4FPYA 5KWRA 2IXHA 4AEDA 1RXGA 3ZYRA 5A33B 3QH7A 3S30A 2JE8A 1NXD1 4RQPB 5LZ6A 2PHDA 5CISA 3BUCA 5C3SA 2PAEA 4L97A 2GC0A 4Z8BA 3K3NA 1OURA 1RUE3 2PLV2 1J3RA 1JUIA 3MPBA 2VNOA 4ZONA 3BTYA 3AX4A 4ISRA 3SCFA 1LRHA 3VL8A 3RMYA 1LEDA 3MUY1 4HKWA 2ERFA 4CPBA 5DN2A 5AVAA 4RFT0 1ZRDA 4BPZA 4AI3A 1NKGA 3DGTA 5FZGA 3CMGA 3GJAA 2W1QA 3LIGA 1OT5A 2ZZQA 2XHNA 4CCNA 4RR3B 3LWCA 4OUSA 1ENQA 5FZ1A 4DXSA 1F31A 2J1TA 2YV8A 3NSTA 5ANNA 3L9JT 1J1TA 3AZYA 4YGDA 3J7HA 3ZSMA 1AR83 4FPLA 2VG9A 1LNSA 3NNJA 4HKOA 4B4QA 1FMD2 1Y4WA 5J96B 4XUNA 2WABA 4AZZA 3GCWA 4B29A 4CVUA 4FT8A 4DEVA 4BK4A 5G04L 4AVTA 2XHKA 2Y0OA 4PI2A 5GZFA 3N9LA 5F3GA 1B35A 2KXLA 5C5UA 1G6NA 2JG8B 3AXDA 3AB0A 2V73A 2W39A 2DUPA 3NAPB 3AFGA 4BYYA 3N9MA 2ORXA 2DURA 3H3ZA 3OGJA 1O4ZA 1SFPA 4S2DA 2ZGQA 4J1WA 3VBFA 1PNFA 2WWSA 1VBB1 2HH9A 1U0AA 4HKLA 1AJOA 1HXS1 2A5ZA 2E6VA 3A4UA 3TWIA 2I07B 3FN9A 3W58A 2FDJA 1A78A 3KF5A 1I1EA 3C7FA 1Z0HA 5IUQA 2C6SA 5J48A 3IPVB 3K4ZA 4NRMA 5FZMA 5B4XA 1NOVA 1WCQA 2P5BA 3TN91 4IV3A 1EV11 2D3PA 3DYPA 4LUKA 2NMOA 4YZ1A 1GNYA 1G9FA 3ASIA 5FZ7A 1QJY2 1RMU2 5JVVA 1RHI3 2AR6A 2QQPA 2QQIA 3I2JA 3KVBA 4ZU7A 2YU1A 3ES1A 1IQAA 3GCXA 5FXVA 3ZFEC 4OQ8A 1RUF2 1IPKA 2WS93 3K75B 2N7GA 5JOWA 3NQHA 1OF3A 4E2GA 4BU2A 2D6OX 1VBB3 3P1IA 4R9CA 3SH3A 1WBLA 3SKVA 3T2TA 1LCLA 1DZTA 3KV5A 4ARYA 3AMHA 1HXS3 4QKBA 1W39A 1OQ1A 5KHJA 5FY8A 1N3PA 1FV2A 4V2WA 3B93A 1H8TB 1K12A 1AUYA 2X5IC 4FAHA 1FOD1 4K1YA 4AGGA 4GWNA 4B3NA 1R1ZA 4MVTA 4YVSB 5DDJ2 4COYA 1BJQA 1N3QA 2WNOA 2P3YA 1VRH2 4XF0A 3U14A 2LS6A 5T55A 4NR1A 1VBC1 2RS52 5FYZA 3VLBB 2RR11 3HNMA 4O65A 5T50A 4RA0A 4N7IA 3KCYA 3VZMA 1ENSA 3TN93 2WN3A 1EV13 4LTAA 1DYPA 2LRPA 2R061 4TSVA 4WM8C 4EN8B 1RC6A 3GBFA 1YQ8A 5IYYA 2A6VA 1MQTB 2OS2A 2NYYA 3D0SA 3D3AA 3ZXJA 1WCKA 2XJVA 1NX9A 1SLIA 3OG2A 4GKYA 5FQ0B 5FJKA 5H9SA 2CGPA 3Q8AA 1TEIA 3VBSC 1UYXA 4UW3A 2TBVA 2W2IA 3Q9OA 3RYPA 2H0VA 2FDIA 3QLQA 3R4SA 1CQ9A 1OQDA 4K8FA 3RS6A 4OZXA 2GNTA 5F37A 1O59A 3WUDA 1OUXA 5EPAA 3KT7A 5AC91 1J59A 2WYSA 1CZSA 1QJEA 1MZ6A 5FRAA 3HD8B 3O1UA 3DUIA 1YCIA 1FOD3 3M3OA 5BNNB 2FQPA 3AVSA 1UD1A 2D44A 1J3QA 3ZN6A 3ROUA 1K5MC 4PF1A 4RFRB 1OLMA 1UKGA 1RUC1 1ZM1A 4M4RA 1VBC3 2RR13 1FAYA 3IZOA 3NJVA 1YFWA 5GZCA 2B9UA 3H3LA 1D2QA 1PZ8A 1WMDA 2GNBA 4MHRA 3VHOA 2JG9B 1GP5A 4YZ5A 2WN2A 4HK9A 4N43B 5HBAA 1O6UA 4XFIA 3WP5A 5DZFA 2B46X 1XE7A 2Q8EA 4XFAA 3SQOA 1OQEA 1CZVA 1FATA 1GLHA 3HJRA 5BNNC 3PTRB 4JX0A 3POFA 4A7KA 1UXXX 2QE3A 4OMCA 2KM2A 4Y22A 5FFOC 2EXIA 4AL9A 4E27A 4AI0A 4LBMA 4QXBA 5AC93 2YC0A 2YFUA 3FLTA 1RMU1 4BISA 3P6BA 4ZKTB 3S0MA 2WRAA 3KMHA 1UNBA 4XDPA 5FXWA 3RZZA 3LE0A 3C8XA 3PMSA 3FFQA 1YI9A 1RUH2 3LFIA 3MW2A 2CTVA 2P37A 1CONA 4A44A 1H2NA 5D21A 1AXYA 3U07A 2XJQA 1UXZA 1RUC3 2DF7A 2BTVC 3IDBB 2OUJA 2W94A 4UFKA 5ANQA 2VUDA 3F2ZA 4MOAA 1CPNA 4SLIA 3VKNA 2F6BA 3DPRA 1PVC2 1MPXA 2FHRA 1X9TA 2GN3A 3E5QA 5KXDA 1X33A 3LDKA 4LE4A 2B42B 2HYKA 2DVAA 4BK5A 1YHFA 5E6HA 1URXA 5JXIA 5FZ8A 4CUAA 3D6EA 3JB8A 1VRH1 4NIGA 1ST8A 3RSJA 2ZOEB 2R0HA 4Y20B 4Q0SA 1C5HA 2MPFA 2Z2SB 1DZRA 4N9HA 1VP6A 4EWEA 4XQ4A 5LRRA 1UCXA 1GZ9A 3MIFA 4CP9B 5C4WC 1RMU3 1S0FA 4RL7A 3CDZB 2Y6HA 4BQ1A 4RS5C 3M3CA 4CU7A 2B9VA 3IKWA 2J1VA 4NVPA 2R1BA 4A2UA 4QPIC 1RUF3 5JR7B 1PK6A 4EWDA 1ZYBA 1LHNA 2VVDA 1J83A 2CY6A 4QX7A 2JDZA 4QQPA 1M06G 4IV1B 2BU9A 4FI9A 4HN1A 2LTNA 4P5YA 5C8WA 3VN4A 2WJSA 2XH6A 5FREA 4BQYA 5JWPA 5GLVA 3FHQA 4AEMA 3BTXA 1VRH3 2XJSA 1BCXA 1W6QB 2DCYA 1LR5A 4GH4B 4DO0A 2W91A 3CZUA 1JBCA 1Y9GA 5FMBA 4N53C 1MACA 1OH3A 3ZMOA 2ZEYA 3WLUA 2XJUA 3O0VA 2OA2A 3MFAA 5CEHA 2A3WA 5EJZB 3RYKA 4CXXA 4V1PA 4IGPA 2XBO2 5JMOA 2W95A 3OOXA 3OPZA 2RS11 5CAZA 2XQXA 2MHFA 1UAIA 1W28A 3MPPG 2W87A 3E5XA 3LAGA 4E2SA 1EUUA 2VZ1A 3ETQA 3M3EA 1CVNA 4GH4C 3RG0A 1KJLA 3NRUA 3ZYGA 4QQOA 3SCGA 1STMA 4IXLA 1RTVA 1F4AA 3HN1A 1O4YA 2A6ZA 3GBWA 2QZ3A 2ZHNA 4CDWA 1XNCA 4DZGA 4B1MA 5CG8A 5IT6A 4P02B 1YI7A 3AYCA 4XJWA 1IKPA 3MIEA 4Z07A 4UOJA 1W8UA 4AVAA 2ZKLA 1ZRCA 5CIRA 3QACA 3QBQA 3OPTA 2AACA 3HAGA 3ILRA 3TEYA 2JDKA 4FFGA 3CJXA 1YO8A 3EQEA 1D4M2 4EZ4A 2RS13 1PGL2 2YROA 4L2NA 3RGBA 4CDUC 1V6JA 1DLCA 3UGGA 4K20A 2WNVA 4TZDA 5FZKA 2RHPA 3R4DB 4JKKA 2DVGA 1TQ5A 4H2AA 3VBOB 2VVEA 1ZX5A 4IERA 4Q4X2 2W3JA 4AVSA 3V64A 5LBBA 2XLAA 5A7WA 5APAA 2SBAA 2ZX0A 4OI2A 1TG7A 2XOMA 3AKRA 5A3WA 1NZCA 2VE1A 4LLOA 5FY1A 5CFCC 3C2UA 3SMHA 2Y64A 3VDAA 5L9BA 3HEIA 3ETPA 5F3EA 1WZXA 4AHWA 1UIJA 2ZA9A 4XCAA 2XPJA 4IEQA 2OQ6A 2D40A 3PUHA 4WM7B 1W6MA 2VMHA 1NLRA 3MFCA 4CRQA 1DGLA 3I3BA 3ZYHA 1F2NA 3ZYIB 2WC2A 4CDQC 5A32A 5FXZA 1GQGA 2H6BA 3VBUA 3MIHA 2ZHLA 1KEXA 1QH7A 3GJBA 3NNFA 3FC0A 1RUD2 1BK1A 4JGYC 5D8AB 1RUG2 4A4AA 3SH5A 5DUWA 2VOVA 4NE9A 5FOBB 2BPA2 4RGGA 1V70A 5FZBA 2Y6JA 5K4LA 3VB9A 3ZSKA 2R7EB 2XBO1 1OKOA 4I0WB 4URAA 3LEGA 2PHTA 3LGRA 4C91A 1OD5A 2WA4A 3MBWA 3USUA 1HIXA 3IMMA 4GA9A 3TYJA 4GJZA 1D4VB 4YVWB 3D82A 2J1SA 4HETA 3RZMA 1JI6A 4PJYA 2WUHA 5IK5A 3VZLA 1HV0A 4AI2A 3I2FA 5LW9A 5T5OA 1ND2B 5BNOC 2QQMA 5A3TA 5KHGA 2IXJA 3EB7A 5FKCA 4BOWA 2ARXA 1UYYA 1QDOA 4Y33A 5C9AB 3J7NA 5L36A 4MGZE 4Z82A 2FCTA 5JIUA 2PTMA 3RZHA 1QGLA 4NIHA 4L9BA 1ULCA 5DG1A 5J3UA 4UI9L 3VBUC 3WF3A 1N1YA 3OEAA 4IE6A 1VALA 3ELNA 2HYXA 3PU3A 2BFUS 2DVBA 3U11A 3O1TA 3ZFFA 2DVFA 2NMNA 4GKXA 4QHBA 4W65A 1CAVA 3D8CA 4CYDA 2XBO3 1D4M1 2DFBA 3E6DA 4CEWB 1XSQA 4ORFA 4JDOA 4M01A 2YGMA 1GZWB 1ZZCA 1C8NA 4LOSA 4Z2WA 4BQ5A 1AYM2 4Q4X1 3ZXLA 1JYTA 4FXGB 2HWF1 1J1LA 3N9NA 4L99A 3FHAA 1ZZBA 5GZGA 1UY3A 3T3YA 2VZQA 4A3ZA 1UX7A 4EN7B 2NZ9A 1POV1 1YUDA 3T2QA 2BUKA 3VD3A 2GMEA 4YPJA 1ULOA 2R042 1SLBA 3HBKA 4JKMA 2J1UA 3PVNA 3WINE 1C1FA 3A0NA 4W50A 5JXGA 4XFHA 4K6BA 1GICA 2PN5A 5SV8A 1BBT2 1SDDB 1OPMA 3AZZA 3POGA 4IGOA 5LA1A 4WZCA 4N8MA 1D4M3 4C0HA 4FTBA 2JDHA 2W46A 3WNMA 4Y3OA 1OI6A 4YFZA 3WDYA 1BVVA 3TOJA 5CZKA 4QPWA 1RUG1 1H1IA 4DPNA 5CFDB 2DVDA 4Q4X3 1E5IA 2HWF3 3H9AA 3E5UA 5IAVA 4AR2A 2GAUA 1QNWA 1W9WA 4NIDA 3NV4A 3BKZA 1UU4A 1WD3A 5FDBA 2DU0A 4QHOA 2V4VA 1RJ8A 4JGZA 1JYNA 3V0AB 1POV3 2BERA 2R6QA 2ADEA 1W8OA 4XOGA 3C7HA 1WWYA 1R082 1JYCA 3PIJA 1UZYA 4XUPA 5C8CB 1G9AA 1N47A 3UGHA 1LHVA 2P1BA 2XWJB 3MI8A 4QPGA 4XFGA 4A6OA 1VAKA 3INAA 4NRQA 2PAKA 2WZPP 3LOIA 4YRDA 5LASA 5EQUA 3SLIA 4OULA 4ES9A 1FPN1 4PF5A 3CJIA 3K77A 1OA2A 4XJ8A 4A42A 3BU0A 1F9KA 3U0ZA 5ISLA 2BBVA 5IVYA 1RUG3 4PDWB 5LA9A 4Q29A 1MS4A 2D6PA 5LA2A 4FPJA 1RUJ2 2OQ7A 4CEYA 4QB2A 3VBHB 1OVPA 2P17A 4K9SA 1YQ6A 4LBOA 5KXCA 1ND3C 1SLTA 4TLFA 3RI9A 1NCQC 4QX0A 3CEWA 5FZLA 2WNUA 1BMV2 1FX5A 1NY72 4CCLA 5A3NA 1OVSA 4LKDA 2EALA 5I0UA 1SBFA 4JRLA 1YIPA 1POQA 3OGVA 1V9U2 4I3GA 1P8JA 4YFWA 4AAPA 5F6LB 1GUIA 3B5LB 4IEYA 4OCTA 3I4IA 2UU8A 1GV9A 2EAKA 3GGLA 2HEYF 5I0SA 2GC1A 1NA1A 2WIIB 3VKMA 4DXRA 4QPGC 1FPN3 2WR9A 3QH6A 4DUWA 2ZCWA 1PGW1 1C8M2 1MS5A 1UZVA 1VMFA 3OBAA 5BYNA 2AZ5A 4Y1YA 4TWTA 5FIXA 4XFBA 3VDDA 3JBG2 3ZXFA 1QXPA 3V56A 4IUGA 2X05A 4MXWA 4KBZA 3WQ1A 2GNDA 3PDQA 4XTMA 2BOIA 2JDNA 1LOAA 5FMDA 3VUOA 3LA2A 1KGYA 3ABZA 1XNDA 2XXZA 3E6CC 2JXAA 2Q30A 4CDXC 5JOZA 3ZN5A 2HWC1 5K0UA 3V0BA 5L9VA 5FPVA 3ZXEA 2FDKA 4QGMA 1QMJA 4DEQA 4HN0A 5I0DA 1JZ4A 3CF6E 1U12A 2ID4A 1PIV2 2E33A 3CNAA 3IDAA 5FAXA 3J9SA 4D6SA 1DQ0A 5L73A 3O12A 1LU2A 3WV6A 2B45X 2C9AA 3G7DA 4Y1ZA 5FP8A 2JEMA 2YG0A 4TXWA 3TRSB 3LA7A 3UKTA 3W5NA 3I49A 5JCTA 4AEJA 1HV1A 5I8YA 1LOEA 1OXCA 5LK7B 1OFNA 3AL6A 2DCZA 1XE0A 1U5YA 4YNIA 5DZGA 4KL1A 4ONUA 5JSOA 4BQ3A 5JDBA 3AC0A 1N1VA 3VBRA 4DY3A 5F1RA 1QF3A 5FY0A 1DGRA 4ARXA 2NPIA 2VY0A 5A3LA 4IE7A 4LIVA 5A7OA 1F5FA 2HWC3 4BCUA 2VZUA 2OUHA 2JIJA 1SPPA 1NE4A 4JHTA 1RUJ1 4NJ4A 5FZ6A 2WO1A 5JZGA 5FZEA 2IZWA 2ZZJA 2BGCA 2PQSA 5FP3A 1TNRA 1W6PA 1IOAA 1H6YA 3AP5A 3WG2A 2G4IA 1NY71 4ZZ5A 1O91A 2BNNA 3I2IA 3ECQA 2R30A 3MF6A 5C3RA 4IE4A 2E7AA 1XBFA 2JD4A 2WT1A 3HPNA 2ATFA 4DRRA 4FPFA 1O7FA 4SBVA 4BB3A 4NHXA 3P5BA 5ABJC 4FQZA 4MUVA 3ZFGA 1H2LA 2PXJA 2VBBA 2BZDA 1R1A1 2D5HA 3FBYA 4QX5A 5FYMA 1VBE1 2E26A 2Y34A 4L11A 3L2HA 3AP7A 4W6YA 2ETEA 5L7OA 2PQQA 3I3DA 3ILNA 3RI8A 1RUJ3 1GR3A 2QCSB 3AP4A 1PM7A 1CAUB 1UY4A 1AR81 4JZRA 1OA3A 3SH4A 4BHPA 5FZIA 2GP5A 5A33A 1YJKA 2VOKA 4JQRA 1HB4A 4Q4W2 1XU2A 2CGOA 1PGSA 1UZ0A 2P3KA 2Q5TA 2ZGSA 1AL21 3LIHA 4RQPA 4UXAA 5C6CA 1OBNA 2XKPA 5I91A 4P9XA 3GHNA 4U36A 4D94A 4LO4B 4Y5TA 1QQP2 2B8MA 4E4DX 2VUCA 1KS5A 1PIV1 4XETA 1GP6A 1ZVFA 4WVZA 2P3JA 3LDRA 2WO3A 4Q8KA 4YZ4A 1W06A 3U1XA 4LKFA 1ZBE1 2XMLA 1VMJA 1W6NB 4IESA 2DV9A 4Y26A 3B7MA 3I2OA 5KC5A 1WMXA 1JODA 1R1A3 5DAPA 1ULGA 3WNNA 1PO12 2BNOA 5FY7A 3B00A 3N7MA 1VBE3 2Y33A 3IDEA 3KZ4C 3LB9A 4QB6A 4YW1A 4YG6A 1QDCA 4RR3A 4C0BA 1NCRC 5BNPC 3I3EA 1UW8A 4JDNA 4N90A 4ES8A 1WCSA 4HVQA 1NZIA
chains in the Genus database with same CATH topology
2OYZA 1NE6A 2ZABA 1JTZX 2XJRA 4QD2A 3GALA 3MYXA 1UKRA 3OYWB 1AL23 4AEDC 4BIFA 2E7QA 3USSA 1UX6A 2YHJA 2YYOA 2VPVA 2JG8A 3AYAA 1PIV3 1RHI1 5DUVA 3NAPA 3G6JB 3HWJA 2W52A 4XDQA 2IFRA 1NG0A 1ZBE3 1IHMA 2WS91 3AP9A 4Q4V2 3ME2A 3B9CA 4AG4A 2QUOA 1HW5A 1Z7S1 1AYN1 4BE3A 1UU5A 1AF9A 4M0HA 1YNAA 1WLDA 2BNMA 3ZFEB 1H1MA 1X8MA 4AGRA 4HVRA 3B3QE 3ES4A 1X7NA 5J37A 4COWA 4MH0E 1O3RA 3AMPA 3IM0A 4JVAA 4RGAA 3MZHA 1GNHA 2DWRA 4DNYA 2A71A 3H0OA 4LR4A 4XFCA 4HT1T 3VL9A 1MS8A 2VGDA 4LEJA 3RNSA 2UURA 1APNA 3I59B 4AYUA 2X5IB 2Z69A 2RMU2 2VW2A 2YUEA 4WZFA 3VZNA 4YM3A 1GFF2 4KQ7A 5T54A 3MEPA 4YSFA 1KDKA 4DOUA 1SFNA 2ZACA 4Q4W1 1LENA 3LSDA 1B35C 5IK4A 3H7JA 2K2SA 3AKQA 4XXPA 1LU1A 2PLV1 4MLOA 4DXZA 2Q8OA 1I3HA 1AXZA 4WM8B 3VZJA 2D3RA 2ZX2A 4Y1UA 1Z7S3 1POV0 5GLTA 3VBFC 1AYN3 1H8TA 4XJAA 3NJZA 1UPSA 4YVSA 3VBSB 3VHNA 1C1LA 1GKBA 3NW4A 4K40A 1CAWB 3JCIA 3L2YA 2VQAA 3UL2A 3I8TA 3VHRA 2VMGA 2IXLA 2DTYA 4YZ2A 1MQTA 1V6NA 1LESA 4IV3C 4JTOA 5FQ0A 1FMD1 1AZDA 1K5MB 1YFYA 3IIAA 4Q4W3 4F3JA 1ULDA 3MLKA 3S7EA 2G9FA 3MLJA 1I9RA 3MF9A 4M3CE 2PLV3 4EN9B 4PBPA 1U5XA 3AM2A 3MICA 1ENRA 2D6LX 3JD72 1XNBA 1A8MA 5T5LA 2XUMA 3JQWA 1Q56A 4YGEA 2BFUL 4LLFA 3UKVA 1KD7A 5FPXA 4MYEA 4Q4V1 2XG3A 3ILFA 1PO13 4D7SA 1EAH2 1GYKA 3T1MA 2A3YA 5JOYA 3WDVA 2JG9A 4N43A 4LHKA 3PLQA 1Q8PA 1REEA 3GZAA 1QJX2 1FMD3 2XL9A 4H3WA 4AI8A 5LEKA 2P3IA 1E57A 2OZJA 3MLLA 5I8TA 1SBDA 3ZN6B 2NP0A 3O14A 5KXBA 4TYSA 2RM22 1PVXA 1QJY1 1G9CA 1ULEA 4QGNA 1RITA 4LBQD 1RUF1 2ES3A 4XBNA 1LECA 5E1RA 3TNQA 3AZVA 4Q4V3 1X82A 5I0TA 4IETA 3FE5A 3M3IA 1OMIA 2TNFA 5C4WB 1O4TA 3VGIA 4MXVA 1IS4A 3AMQA 4EROA 1DQ4A 2RJLA 2GALA 4RS5B 2DU1A 1HRV2 4HVOA 3DF0A 4QPIB 5DDJ1 3NKTA 1FNYA 2GH8A 3IT8A 1EYBA 2RS51 4LE3A 1D0GA 4Y20A 4EJRA 1F5JA 2Y26A 3LZZA 1TMF2 2PA7A 1LHWA 1IGOA 4OUMA 2Y0IA 2GH2A 4A7YA 1QJY3 2XVGA 2D98A 2VUAA 3UK9A 3PMEA 4LO8A 4YLZA 2O1QA 3ZIXA 2LUWA 4FTEA 2JICA 2D6NA 3GNEA 4N53B 2HEVF 1MEC2 1SEFA 5KXEA 3W59A 3VKLA 1LULA 5DDJ3 2O0OA 4KWJA 3DPRC 2BVBA 4FPOB 3AKTA 1QXJA 2Z79A 2RS53 4DY5A 3N7LA 4IL7A 1EAH1 1WLTA 3WR0A 2EXKA 4FPCA 4I0BA 1RJ7A 2GMMA 4C90A 1BZWA 2EAAA 4LBJA 1LODA 1WBFA 1F8VA 1QJX1 3AKSA 4R52A 1MS9A 1OKQA 2H6CA 1X36A 5I0RA 4F83A 3O7OA 1OLQA 4J6GA 1J58A 2W68A 4CZSA 4OI1A 1DU3D 2C0ZA 2ZGPA 3JB4C 1PK6C 2RM21 5AFEA 3MW4A 2EXJA 1S0BA 1RUH1 3VZOA 5GALA 4CDUB 3CLPA 2OZ6A 4QQLA 3JZVA 5KHIA 1G8WA 1TME2 5T3NA 2NN8A 1S0DA 2XLFA 5JIAA 3FBMA 5J36A 1EAH3 3AJZA 4R9BA 1OOPA 4AFBA 2P34A 4J1XA 1COV2 1H8VA 1Q3EA 1PVC1 4BH9A 1QJX3 1S0EA 3UJOA 2PAMA 1MZEA 5CFCB 1S0JA 4B7KA 5FMOS 3WP4A 2HEWF 1TMF1 3VBOA 4FAGA 4P9IA 5GJ6A 4L8QA 2GC2A 3ZXDA 2RM23 5TSWA 2VW0A 3WXPA 4CDQB 5JOXA 2TUNA 4FPKA 5GLWA 1RUH3 4YM0A 1QJU2 1N3OA 5HXVA 4JGYB 2QNKA 3N4MA 4AQ2A 4P5HA 2YZ4A 4WM7A 2ZBJA 4AQSA 1MEC1 3ENRA 4XEZA 2I2SA 4CDWC 4YW3A 1FXZA 2WNVB 2ZS6B 1CGPA 1PVC3 4K21A 4ASMB 5CNAA 1MVEA 4FQ4A 5T52A 4DB5A 1OPOA 4PIXA 1HX6A 2YPJA 1TMF3 1SDWA 1M4WA 1JH5A 5D8AA 3M3QA 2K9ZA 2ZJCA 5EWSA 1QOSA 5BNOB 1XNKA 2WNVC 5GZDA 3WDXA 2UWAA 4KGQA 2PHLA 5AVPA 1IS3A 3AZWA 1YFUA 3X29B 2EIGA 2IXKA 4HSLA 2BEOA 1WA4A 4R9AA 3VBUB 4YVWA 3BOPA 4PBOA 4WVWA 5JI9A 3UJQA 1DFQA 1JHNA 4META 2Z42A 1MEC3 3QD6A 4W6WA 3RJ2X 3SCHA 1ND2A 1LJ7A 2WQ4A 4UW4A 4AVVA 1W0PA 1DYKA 2DCTA 4X6QB 3H1WA 3POSA 3I54A 3ZXAC 3WW2A 4Q0PA 1C3HA 4RD7A 1MS3A 1NXMA 5EYXA 1COV1 1U5ZA 3M7AA 1OHFA 4OHVA 4RSUA 2HWD2 3POYA 1BKZA 1BYHA 2ZGKA 2R1DA 4CEWA 1PGL1 4FVVA 1IPJA 1GZWA 4NHMA 2A6YA 1FNZA 2AGSA 3WVJA 3ZMNA 2LALA 3AYDA 4LHLA 1VLNA 1DGWA 1W2UA 1NQJA 1CX4A 1TNFA 4MGIE 3WP3A 1VBD2 4I3PA 1WCDJ 1JXNA 4I01A 3LCPA 1X50A 3MGUA 5DZEA 5KHKA 1TME3 1UU6A 2FZ2A 2SLIA 1SCSA 3FWEA 4R9DA 1V6LA 1RVF2 5J98B 2A75A 1DGRN 1COV3 3O0XA 1C57A 4KNCA 1S0CA 2RS32 2WT0A 2W08A 5HCBA 4P14A 1DQ6A 3ZFFC 2QJVA 3P3PA 1RUD1 1NYWA 1O5UA 2JECA 1DQ1A 4QM9A 5EFUA 5CFDA 2FZ1A 1EPWA 3S6PA 1GANA 2W0XA 3KQRA 3VZKA 4DMIA 3N36A 5KC6A 1FT9A 1LOFA 4WVVA 4M3CB 3RJRA 3V0AA 4LO6B 3OF1A 2B7YA 4XFFA 3M70A 4IEVA 2ZKNA 4XMIA 5C8CA 4BMBA 1LOGA 2WFPA 1CAXB 2MEV2 4LA2A 3GZTB 3VKOA 2X8KA 4AHXA 4ASLA 5GZEA 4QGLA 4YYOA 5F6KA 1ND3B 3AP6A 1NCQB 5E16A 2UY9A 3J8F2 4FPEA 2BWCA 2HWE2 1VB4A 1S2KA 3RMXA 4JC1A 3H1YA 3MW3A 2ZGUA 1RUD3 1WW6A 1KDMA 4KWKA 2XL7A 4PDWA 1PHMA 2R072 2V5YA 4ZXKA 4OLLA 1BVP1 3VBHA 2WFF2 2B5HA 5DG2A 4GB32 2R16A 1EP0A 1WW5A 3NO8A 4QPGB 5JSRA 1IKQA 2JENA 3FLRA 4JV4A 1H4HA 5KHHA 4LHNA 4E4SA 1AYM1 4CP2A 5F5QA 3BODA 2D43A 4HANA 3K51A 4JGZC 5C33A 5FOJB 4XPVA 2I45A 2PELA 2ZMKA 2ENRA 1GNZA 4OI4A 1XQNA 5IK8A 4NWVA 2ET7A 2G9GA 1SCRA 5EV7A 3DN7A 3MIGA 2YMZA 1V6IA 4FPHA 3THTA 1O3TA 4CDXB 2R041 1LEMA 1SMVA 4HPKB 3B02A 4P9WA 4Y24A 3U10A 1ASJ2 2OPKA 4JCKA 3WZ1A 2QKDA 2PHRA 3CJIC 1BBT1 4ZU4A 2CAVA 2RJKA 1H30A 4BZ4A 4Y4YA 1LOCA 5LRSA 4DINB 3JU9A 1C4RA 1W6OB 1GBGA 4CEYC 4N7UA 4F8AA 3U4XA 3GHMA 5FLJA 3FMGA 2Z5WA 1AYM3 3OY8B 4LBQB 1KFUL 4KBBA 3JUUA 3WHUA 2WNUC 4PLOA 2P2KA 5SV5A 1XU1A 1LGBA 3PVEA 4OI0A 1MR5A 2WL1A 1XYPA 2LM3A 2R043 1R081 4H7MA 2CL2A 1QNYA 1NA1C 2MEV1 3LSEA 1CN1A 3R05A 1BBT3 4LBNA 3QOPA 4PLNA 1S0GA 1HQNA 3B69A 2BVVA 2QDRA 1GZCA 4LA3A 1KS4A 4DQAA 1OSGA 3J8F1 4AK3A 3VDDC 3LOBA 3K48A 2A70A 2HWE1 3DV8A 3HT2A 3TNPB 3HBZA 4P9JA 2TEPA 5JI7A 1Q8OA 1ZA4A 4UBGA 3ZYJB 2DCJA 3WQ0A 1SQ4A 3WT3A 4OHZA 5ABJB 5CBLA 5K0UC 5K8SA 2ARBA 3MIBA 3OJBA 2CYFA 1BMV1 3WDWA 3POWA 1R083 4XF1A 4MV2A 3BALA 3AKPA 1H9PA 4UW5A 1V9U1 2MEV3 1J3PA 4E2QA 4G9SB 2D6KA 1KRIA 2I74A 4AEKA 1W0OA 3WQ7A 3ZDSA 1JW6A 1Y7BA 4Q8LA 3WY6A 2XVKA 3J8F3 4IQPA 5JZGB 2VQ0A 2HWE3 2E9QA 2E63A 4I09A 4CP1A 3FUOA 1C8M1 4XF9A 1A8DA 2DUOA 3VBRC 4AFMA 3SISA 5HCFA 3JBG1 1QJZA 1VBB2 1S2BA 5FO8B 4FSJA 1CAUA 3NL1A 1NQDA 2VMIA 3TB0A 1HXS2 2GU9A 5FBZA 4WVMB 3M4FA 4LT5A 5JZGC 3LKJA 1WGPA 2X53S 1NCRB 4QXKA 4X8PA 3WHTA 5BNPB 4FOWA 1V9U3 3WOGA 1G9DA 3WW4A 1SLAA 3VKFC 1W6NA 4AEDB 3BCWA 3M8LA 4GMP1 2CGNA 3BTAA 1C8M3 1D0HA 3ZFGC 2IXCA 4YG0A 4P9LA 1ASJ3 4CTEA 3JBG3 5CB7A 4P9GA 3PNAA 1SLLA 5L7OC 2WLQA 3OYWA 1FOD2 3PHMA 4AVCA 3NVCA 4JTNA 1A3KA 3OBRA 1R092 1LTEA 2WZR2 2YGLA 2DUQA 1VBC2 4AXOA 3KB5A 2RR12 4LO5B 4RQPC 4YW5A 4C1XA 1UF2C 1JOJA 4FOVA 2MNGA 1HKDA 1C28A 4Q0VA 4O9GA 2R062 2Q1ZB 1IS6A 2ZX1A 3D0JA 1LB2A 5DXDA 5CA6A 4GMP3 4IEXA 3BB6A 5FMOL 2AH2A 3KCCA 5KBFA 1WMEA 2C1FA 3FUQA 1HDKA 5AC92 3IPVA 3ZFEA 3THPA 4RR3C 1B35B 3IBMA 4XE9A 2OIIA 1UMZA 3WG1A 1ULFA 4LO7A 1VR3A 3HMYA 2Q4SA 1PMIA 2JE9A 4AHYA 2UYBA 4FP2A 3QCWA 1BEV2 3VV1A 2WSVA 1RUC2 3VBFB 3I59A 1AHSA 2X5IA 4Q27A 3URFA 3KD4A 1V6KA 2HKXA 4P9YA 5ACA1 1I5ZA 3HR9A 1OLRA 2B39A 2JG8C 4NHLA 4LNVA 3H1MA 3NAPC 4QPYA 3GZUC 4Z92B 2D5FA 4WM8A 2D3SA 3B01A 1QQP1 3AMMA 1KFXL 4IEUA 1SACA 1MVQA 4BWOA 2KA3A 4FTBA 4A3XA 4IV3B 3D4KA 1DDLA 1UIKA 3DL3A 3VBSA 2IC1A 1RL3A 1UZZA 3H7YA 5EXOA 2PFWA 2WKKA 1CAWA 1ENXA 1YYNA 1PO11 4YGBA 3IMNA 3KGZA 3MIDA 1O5LA 3CO2A 3WG3A 2ZGNA 3O0WA 4Q26A 2O8QA 4IEPA 2DYCA 4GULA 3AXEA 1AX1A 2R32A 1K5MA 2H0BA 5ACA3 4HMZA 4LULA 2DCKA 4AFCA 4G4FA 1QOOA 4H7LA 1R091 2GMPA 5FPZA 2BQPA 3WD5A 1REFA 2PHWA 2WINB 2WZR1 3ALQA 5HCAA 4XTPA 1QQP3 1VIWB 2BWAA 2E7TA 5BNNA 4W6XA 2XJPA 1IS5A 4GALA 1DIWA 3RPQA 2QDNA 4QT6A 2X29A 4JRAA 1H8TC 2A73B 5FLHA 4YM2A 5H9QA 4YVSC 3FJSA 3KSCA 4FO9A 1XYOA 2O8OA 4MSVA 4A7ZA 5E89A 2ZGOA 3M1HA 4QM8A 1XXNA 3PJQA 4D69A 4ISQA 1LKNA 3HIFA 2VNRA 4QU2A 1MQTC 2IXIA 5CVRA 3ZPYA 4BA6A 5GLZA 1R093 4AQ6A 1BEV1 1PZ7A 1YRZA 2WZR3 4D7YA 1H4GA 4KGGA 5I8SA 2RMU1 4XZPA 3RWNA 3RDIA 2QFEA 3M2MA 1DF0A 1OFSA 1QU0A 2R063 3VN4A 4ZKTB 3T1LA 3KS7A 3PVOA 3AZXA 5IK7A 2EVXA 4DRVA 2RS12 4Y5Z0 2JKBA 3O5SA 2RE9A 2UY8A 4H14A 5C4WA 2GNMA 4RHV2 2ZAAA 4YGCA 4WBBA 4Y22B 1CPMA 4X8NA 4D7TA 4RS5A 1JN2P 3GF6A 1EPZA 2ZMLA 4S2FA 4AVBA 1WUVA 4QPIA 2JG9C 4OHWA 4N43C 3AFKA 3ST7A 1O3QA 2FMYA 2EXHA 3WDUA 5FO7B 1BEV3 4KG8A 5E8AA 2Q1MA 3NV2A 1X8EA 4AFAA 2RMU3 4YARA 1PNGA 4MX3A 1RGSA 5B2GB 4FOQA 3DPRB 4XIOA 4FXKB 5L19A 1B09A 1CJPA 4N53A 5H9RA 4IV1A 2XGXA 2D97A 1S1AA 1C5IA 3JD71 4XILA 3OD4A 5FCCA 1QWRA 3H8UA 1S55A 2ZGMA 1GQHA 4EV0A 4YW4A 5GM0A 3GBGA 4KWLA 1TE1B 1AR92 1W6QA 3RRDA 1BQPA 1HLCA 2QZ2A 4Z1VA 1FI2A 4GH4A 2C5DA 2VU9A 1VB2A 4FPGA 4OHYA 1XYNA 4YW2A 1PK6B 2VXRA 1LOBA 1H2MA 2VW1A 3EXUA 3EHKA 2A7AA 1DG6A 3VHPA 1D2SA 4ATEA 4COZA 1DLLA 4INDA 3WNXA 1ZBA2 1PO22 2VNGA 4KG0A 3H3UA 1VJ2A 5CADA 1SBEA 5HI0A 4BMEA 4B4RA 4HBNA 4IEOA 3ZXKA 4XQDA 1U5IA 2ZHKA 1KQRA 3JD73 5D1IA 4YM1A 4HL0A 3B9IA 2VOXA 4IV1C 4XXAA 4CDUA 2YY1A 3N35A 2CNAA 1AX2A 3B94A 1AXKA 1REDA 4QMAA 5K9YA 3NWKA 2JE7A 3V65A 5BNQA 1BXHA 4RHV1 3S7IA 4XMAA 4XJ9A 4PCRA 1JUHA 3FFZA 1PZ9A 5DUXA 2GSYA 1HRV1 3WW1A 4KH9A 5BPXA 5CFCA 3IN9A 3TAYA 1DHKB 2GN7A 3FLPA 3I7DA 1UN1A 1Q8VA 4XYXA 4CDWB 3J4UH 4KU8A 2VECA 1WW7A 3WDTA 4CDQA 1OOPB 5LK5A 2CWMA 4XW3A 3W9AA 4EN0A 1H2KA 3SHRA 1CR7A 4XF3A 2JX9A 5CG9A 1DQ2A 3NKGA 3J26N 4I02A 4E4ZA 4K7JA 4JGYA 4FTSA 4CP0A 4B7EA 1ALYA 4HLTA 1KXGA 4B4PA 1Y3TA 1LGCA 4Q0UA 4RHV3 1DGWX 4QQHA 4AFDA 1HRV3 1OOPC 2HWF2 4GMP0 1QOTA 4M00A 1WLCA 1H0BA 2ZGLA 2IWGB 1AR91 1CD3G 1S0IA 4AQTA 3KLSA 1O3SA 3FX3A 4AHZA 1YWKA 4AF9A 3AJYA 4COUA 2DTWA 2ZX3A 1NLSA 1ZRRA 4NHKA 1MS0A 3BU7A 5BNOA 4I0AA 3VBOC 1Q8SA 1W6MB 5BUVA 2XKOA 2HWB2 2CAUA 3D5OA 1G86A 3RQ0A 1ZBA1 3ZXGA 1PO21 1G7YA 5A32B 3KM5A 2WQZC 4COVA 2A3XA 1WD4A 4BLJA 2UWBA 3AMNA 4Y1VA 2NLRA 4XJUA 4WM7C 3E97A 2NQYA 4M3CF 1RUI2 5C9AA 1AR62 1AR93 1TME1 3HT1A 2GDFA 4BIOA 3JQXA 1Y43B 3IDCB 1ZZ8A 4XF4A 4WV8A 2DFCA 1RUOA 2YDEA 3NV1A 2FBEA 2D93A 3OBTA 4XQWA 3USUB 1HRI2 3WUCA 4S2HA 4XHBA 2BW8A 5D8AC 3WG4A 4H55A 2WT2A 2ZAHA 1CESA 1ZBA3 5LEJA 1PO23 3PTYA 3ATGA 4IEZA 3SNMA 4QQ2A 2OW4A 4XIKA 4NN0A 4BM8A 4FCAA 3R0RA 1AX0A 3LA3A 1FPN2 4GWMA 4NO4A 4PIYA 4Q0QA 4XBQA 3SXWA 1KITA 1XRUA 4YVWC 4PLMA 1YFXA 4YG3A 5E88A 4N9IA 1QKQA 2AENA 2PHUA 4FP3A 4UW6A 3ZFFB 5F9TA 5K7PA 1YJLA 1CAVB 1LHUA 2D6MA 5FO9B 1QJU1 2WA3A 1ND2C 3MDPA 3HQXA 2D7FA 4Q1RA 1G9BA 4D3WA 5C9AC 4JAAA 2QVSB 3AYEA 4C1WA 5JAXA 4Q4Y2 3RYRA 2WLPA 1ONAA 4Y1XA 1I6XA 4Q1PA 1Z78A 3UKNA 3UV9A 5FLIA 4DFSA 1CJDA 4NWWA 3BPZA 2BYVE 2Q0AA 1AJKA 2ZHMA 3KCXA 5I93A 4FOYA 4LBKA 3I2DA 4KU7A 1ZZ7A 3C3VA 5BV6A 4CEWC 1Q5OA 5T5JA 1SLCA 2GZWA 1PGW2 2JJ6A 4HZFA 5J09A 4R8HA 1WMFA 2HWB1 4M3CA 2ZTNA 4U2AA 2A6WA 3R6SA 1KJRA 3FZ3A 1QJU3 1VBA2 2VVFA 3BOWA 3GYDA 1CAXA 2PYTA 4ITCA 3KGLA 2VULA 4GIQA 2HWC2