3LOIA

Crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
EEVKRLIALYELTPHPASGGWFRETYRSDVQVEAEGFDGKRSVLTMIYYLMQAGQPDPFHRVKSDETFVHNLGGSMKIHMIHPDGSYSCSILGNPLEHPEARHQVVVPRRVWFAQEVDGYCLASVLVAPGFDFKDFSLGKREELIKEYPQHRDVIMRCTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structures of the apo and GDP-bound forms of a cupin-like protein BbDUF985 from Branchiostoma belcheri tsingtauense
rcsb
source organism Branchiostoma belcheri tsingtauense
molecule tags Unknown function
total genus 40
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3loiA01
3ES1A 3FWEA 3CF6E 2D93A 4XFFA 2PFWA 5I0TA 3LZZA 4MGKE 4Q0PA 4CYDA 2QCSB 5I8TA 3NJZA 4MUVA 2UY8A 1H1MA 1NE6A 4MX3A 2XKOA 3D0SA 1ZZCA 4XEZA 5JSOA 3U11A 1QXJA 3D82A 4UXAA 1ZREA 4HLTA 4WBBA 2GZWA 3LA2A 1J59A 2Y0OA 5JCTA 3LAGA 3H1MA 4E2SA 2GC2A 5LEKA 2Z69A 3QOPA 2PQQA 5FQ0A 1ZRDA 4O9GA 1ZVFA 3NW4A 4XF0A 1LKNA 1DZRA 1ZX5A 4IERA 3RYPA 3ST7A 4MZUA 1O4TA 3EO6A 4R52A 5FCCA 5BY5A 4LEJA 5FPXA 1VR3A 1UIKA 5FLIA 1UW8A 4HVQA 4H7LA 2PAEA 2DCTA 4AXOA 3GBFA 4AQ6A 4UBGA 2Q1ZB 1FI2A 3I59B 4L11A 1EY2A 2XLGA 3HIFA 3IDBB 4DINB 5I8YA 4XFCA 3SXWA 3TNQA 2B8MA 5I93A 2IXLA 1CAVA 2PAKA 4HMZA 4I0BA 3H50A 4QGMA 3GYDA 3I59A 4WZCA 5C6CA 3E97A 1J3PA 2UYAA 5F1RA 4X6RB 2EA7A 2IXHA 4HVRA 4HVOA 4I09A 3WW3A 4PIYA 3EBRA 4FAHA 1OD5A 1VJ2A 1O7FA 2HKXA 4BIFA 5FPZA 4D7TA 4XFGA 3FFQA 4QGNA 4R8HA 4XF1A 2QJVA 4K8FA 3S7EA 2PTMA 3ETQA 3RYKA 1EP0A 3B02A 1Y3TA 4QM9A 4XFHA 3PVBB 1O5UA 3LOIA 2XL7A 1X8EA 1ZZBA 4Q29A 3MPBA 5LRRA 3DKWA 3EJKA 3WW2A 4PIZA 1Q43A 1L3JA 4ORFA 5K8SA 3OF1A 1X82A 1NZCA 2D5FA 3BB6A 1CAWB 3SHRA 4N9HA 2XKPA 3LA3A 3CL1A 4IEOA 2PHLA 3RDIA 4LUMA 4I2OA 3JZVA 4AVCA 1RGSA 1J1LA 3HT1A 1X8MA 4KU7A 4XF4A 3H7YA 4I02A 1ZRFA 3HT2A 3O14A 1RC6A 3OTFA 4MGZE 1Q5OA 5I8SA 4D7SA 3RNSA 2XLFA 3CLPA 5JSRA 3E5UA 4KWLA 4YRDA 2VECA 1VP6A 1CX4A 1V70A 2CAUA 2OA2A 2D40A 2BNMA 1DZTA 2BNOA 4BH9A 3OCPA 1ZRCA 2XGXA 3H9AA 4QX5A 1OMIA 2XL9A 1O3QA 4PJYA 5KHIA 3FE5A 3R6SA 2N7GA 5EZWA 1QWRA 2Z2SB 1UPIA 2VQAA 1GQHA 4AQ2A 3WW1A 1EPZA 1ZNPA 4ONUA 2GU9A 1Y9QA 4LA3A 3KCCA 3UKNA 1YLLA 3DN7A 1QY4A 3C3VA 5I0RA 5BXXA 1H1IA 3WW4A 3PLQA 1U12A 1XE8A 1RTVA 2VPVA 3SCGA 2B9UA 2BEOA 3E6CC 3G7DA 4IEPA 1RUOA 3TNPB 4EWDA 4MV2A 4Z82A 4Z07A 4IEYA 1ZZ9A 2O8QA 3NKTA 2XHKA 4J1XA 4LA2A 4ZU5A 4F7ZA 2FQPA 1WLTA 2F4PA 3CEWA 3IDCB 5KHGA 1YFWA 2Q4SA 4HN1A 3I54A 1PM7A 4OLLA 5JAXA 1DGRA 2PA7A 1UIJA 2QVSB 4QGLA 5D1IA 1XE7A 4KWKA 3H3ZA 4MGYE 2GC1A 2K0GA 4HN0A 3FZ3A 4HZFA 4LULA 4JTOA 2QDRA 3ELNA 3IBMA 3S0MA 2MNGA 3DV8A 3UKTA 4RD7A 5BPXA 2B5HA 2EVXA 4ZU7A 1CAXB 2ET1A 4XFIA 4IEXA 3BCWA 5KHKA 5E16A 4YARA 1YFUA 5J7MA 4ZU4A 2IC1A 1O3TA 5FLHA 4IEWA 2MHFA 3NL1A 2KXLA 3E6BA 1GQGA 4QMAA 4LLOA 2OZJA 4I0AA 4Q0QA 3BU7A 4QM8A 2Q0AA 4EV0A 2IXJA 1J58A 2E9QA 2IXCA 1LR5A 3MZHA 5LRSA 3FX3A 3HQXA 3U10A 1LB2A 3OGJA 4BYYA 3KSCA 1WA4A 4B29A 4TLFA 3H8UA 4JTNA 4JV4A 1CAWA 1NE4A 2H6BA 5KBFA 3VHRA 2WC2A 1IPKA 1OI6A 2ZKLA 4XFBA 3QACA 4N9IA 5CVRA 1YFXA 2O1QA 3NSTA 2H0VA 4KU8A 5T3NA 3EHKA 1CAUB 4MH0E 4FBFA 4IEUA 4MGIE 1SFNA 3ES4A 2MPFA 4PIXA 3SCHA 4P9GA 3RPQA 1PMIA 2XLAA 3KGZA 3M70A 4XFAA 4EWEA 1J3QA 3E6DA 3H1YA 1CAUA 3KMHA 1RUNA 3IWZA 4XF9A 1TQ5A 3UKVA 5FQ0B 1FXZA 5J3UA 2GH2A 3BALA 3S7IA 3SCFA 1DGWA 4IESA 3PNAA 5FDBA 2P17A 5KHHA 2BGCA 3CJXA 2ATFA 4YNIA 3H7JA 2OZ6A 4IEQA 4KL1A 4Q0VA 1CGPA 4EROA 3L2HA 3IIAA 5I0SA 2ET7A 5BV6A 4FAGA 1ZZ7A 2GAUA 4YYOA 1O3RA 2QNKA 1XRUA 1UCXA 5I0UA 5JSPA 4KWJA 1X7NA 2H6CA 4LTAA 1IPJA 2I45A 5LEJA 2PHDA 3KGLA 1J3RA 3U0ZA 1O3SA 4WVZA 4NVPA 1CAVB 1ZZ8A 4A2UA 5BUVA 4HSJA 3ROUA 3BPZA 3D0JA 2K9ZA 4J1WA 2V09A 3I7DA 4META 2CAVA 3N4MA 1G6NA 4YSFA 3USSA 2IXKA 3ZDSA 1YHFA 4AVBA 2D5HA 1NYWA 4XETA 2Q30A 5CU1A 1YWKA 1YUDA 1OFNA 4IEVA 4HBNA 3CO2A 1O5LA 1SEFA 2C0ZA 1YFYA 2WFPA 2CV6A 5I91A 3DL3A 2PYTA 2BNNA 3H3UA 3LWCA 4EWAA 1NXMA 4BHPA 4FT8A 3SMHA 2OPKA 1ZRRA 4OFGA 4E2QA 4F8AA 5JR7B 3FHIB 1WGPA 3H1WA 4IETA 2GC0A 1EYBA 1I6XA 1CAXA 2CGPA 3LA7A 4E2GA 2GC3A 3MYXA 4XF3A 3E5XA 4Q0UA 5CADA 5AVPA 2FMYA 1QXRA 4I01A 3M3IA 2UYBA 2UY9A 5HI0A 4AVAA 1FT9A 1ZZ6A 5EFUA 5J48A 4QXKA 3OD0A 1RL3A 4O9EA 2HJIA 3EQEA 4HSLA 5E1RA 2ZCWA 2BYVE 1HW5A 5C8WA 3RYRA 3MDPA 2IXIA 1SQ4A 3NVCA 3E5QA 1JUHA 2OYZA 4UBHA 4X6QB 2ETEA 3ACLA 1LRHA 4IEZA 4Q0SA 2PAMA 2EAAA 4GULA 5FLJA 3RZZA 5KHJA 1I5ZA 1UD1A 4LUKA 4I3PA 4L2NA 3FJSA 1Q3EA 4JVAA
chains in the Genus database with same CATH superfamily
3ES1A 4P5YA 3CF6E 2D93A 3LZZA 3WQ1A 5FK8A 1C57A 3VBSA 4YFZA 1SCSA 1OLMA 1UNBA 4CYDA 1LHUA 4YFWA 5F3CA 5I8TA 5CG8A 1S4CA 3AXEA 5DUWA 3VGIA 5GZCA 1OLME 1RVF2 2XKOA 3D0SA 4PBPA 5A3OA 3LOBA 3MV01 1KD7A 4XJWA 4BB3A 1ZZCA 4FVVA 2VOKA 4XEZA 4FPKA 4Y20A 5DAVA 1YYNA 4Y1VA 1WLWA 1QXJA 5LA9A 3U11A 2DCZA 1RUE1 2NPIA 3LA2A 2DVFA 4XUOA 5CKQA 4EN7B 2QQNA 4ZKTB 2GC2A 1NLRA 3U4XA 1MS8A 3FLPA 5FQ0A 4OI4A 3NW4A 4LQRA 1WMFA 4XF0A 2J1VA 3S30A 3ZFGB 5CFCA 1VRH1 1MS4A 2OXBA 3APBA 4QPIC 2FD8A 2QZ3A 3SKJE 4FOWA 4QQOA 3AX4A 5FZ9A 2C4XA 3UK9A 2R6QA 4R52A 5FCCA 5IYYA 1IQDC 4LEJA 2ZX1A 3T08A 5FPXA 1TME3 3OGSA 2W68A 4PLOA 4HPKB 2ZOEB 3VBFC 5FZLA 5FLIA 4NIDA 1MZFA 5FREA 2O14A 4AEDC 4Y26A 3BODA 2W1QA 1NX9A 4QX1A 4FQZA 4XDPA 3ZFGA 3ZR6A 2FDGA 2DCTA 4IGQA 3GBFA 4Q27A 2CYFA 5FPAA 3I59B 5HCBA 4L11A 1F9KA 2LRPA 5FP7A 4GH4B 5KXCA 3MW3A 4Y33A 1FPN2 4UYBA 2JDUA 2R043 2E51A 2YGLA 1CZVA 1T2XA 4BOWA 3VKFC 5I93A 2GNMA 1CAVA 3KHCA 1LHWA 2PAKA 4HMZA 2ZHKA 5C3PA 2OT7A 2JWPA 3POSA 1H2KA 1N1TA 4C90A 1N3QA 2WT2A 5G05L 3I59A 2W9XA 3AC0A 5DUXA 4Q2FA 3E97A 1J3PA 3POFA 2UYAA 3ZXFA 5C70A 5F1RA 4X6RB 2IXHA 1RUD2 3I3EA 4HVRA 4XURA 2WKKA 5F5QA 2LM3A 2W52A 2P3JA 3TYJA 1ULFA 3EBRA 4RR3B 2ZEZA 1D4M3 3A23A 4Q4W1 5FPUA 4AQTA 5JVVA 2ARXA 3LFMA 5FPZA 4D7TA 3J7HA 3AJYA 3NQHA 4XTPA 3FFQA 2HYXA 2YBPA 3PU3A 4QGNA 5IJRA 1DQ6A 4K8FA 1CZTA 4CCDA 5FBZA 2PTMA 2P34A 4AGGA 1PVXA 3RYKA 3IIIA 5CBLA 2XPJA 2DVBA 4RR3A 1Y3TA 2MEV2 3AMPA 4RSUA 1HQLA 4XFHA 1TNRA 2RDNA 4XABA 4NHKA 1X8EA 2NMOA 1GICA 3MFAA 3UGHA 3Q8CA 5GLTA 3ZN5A 2VULA 1V6MA 4YG3A 4Q29A 5L73A 1ULPA 2AENA 3DKWA 3WW2A 1Q43A 1L3JA 4FP3A 5SV8A 4AEMA 2J1AA 1F31A 1LJ7A 1JYWA 1JODA 1HQWA 1OPOA 1VMFA 5F9TA 3KV9A 3ZLIA 3FL7A 3KB5A 1X82A 2WA4A 1SCRA 3OF1A 2D5FA 3UETA 3O0VA 4BPZA 4DMIA 4XJ9A 3RWNA 4N9HA 1XXNA 1UX6A 3CL1A 1JHJA 1RUH3 2XXZA 1EAH2 4NOTA 5DAXA 2BWAA 4QQPA 3WP5A 1GSLA 1REEA 1D7PM 2QQWA 3VHNA 1SZBA 2FDFA 3O0XA 3H7YA 2DF7A 3ZOIA 5EJZB 1JZ6A 1R1A3 3MIDA 2P1BA 1QJY2 1RC6A 4MGZE 3PMSA 5F39A 4XACA 2VCBA 4F3JA 2BZDA 3CLPA 4YVWC 4PT6A 2XWBB 4YRDA 4M0NA 1UYXA 1TVGA 3PVEA 4WM8C 3MUY1 4YWAA 5A6ZA 2R072 1CX4A 4N53A 2CAUA 1JZ4A 4XZPA 2D40A 2BNMA 4N43C 4K9SA 2EAKA 3KCXA 3EMRA 4EZHA 1VBD1 1RUC2 2DCYA 4AHYA 4CEWC 2Z4FA 2YUEA 2XGXA 1JYTA 1DU3D 3MW4A 1JN2P 4HK8A 4CRQA 4QX5A 4CE8A 3W58A 4PJYA 2A73B 1GU3A 4JGZB 2N7GA 1W05A 4YW6A 1YI7A 1YXWA 5EZWA 2Z2SB 4LKFA 3M1HA 4LITA 3PUQA 1Z7S1 1GQHA 2VQAA 2CWSA 3VBUC 4QHZA 1EPZA 4I30A 4RQPB 4GWMA 1QQP2 1UYZA 1Y9QA 3WF3A 3KCCA 4AFAA 5BNOA 2DTYA 3TEWA 3HNYM 4N43A 1YLLA 3DN7A 5FKBA 2KA3A 2KM2A 2EALA 1CVNA 1NCRA 3RRDA 2WN2A 4P9IA 5DZEA 3RI8A 3SNMA 4LKDA 2AUYA 5FZDA 5FBJA 3I3QA 4QPGC 4CDWB 3G7DA 4LO6B 5DUVA 4IEPA 2BBVA 3LEMA 4Z82A 3T4HB 3S57A 3NKTA 4F7ZA 4NWVA 5JIAA 4AFMA 1GZ9A 1XSQA 1C5HA 1WLTA 2WNUA 2E7AA 5SV5A 2YBKA 3KD4A 1GNYA 1YFWA 4FOQA 3ACFA 3WR0A 4YM3A 1MQTC 5EJ3A 3THTA 2X8KA 1V00A 1RUD3 3FHAA 4JGYA 1ZYBA 4LO4B 3ZSKA 4LK7A 1JTZX 1M4WA 1DGRA 2FDHA 4CEWB 2NMNA 5BNPB 1FNYA 2QVSB 4OHWA 5LBBA 2JENA 5C7GA 2WL1A 3ACIA 4JKMA 3HWJA 1PIV1 1IPSA 1UKGA 1X50A 2D3RA 3NJVA 1D0HA 3FBYA 4HN0A 4QHOA 3FZ3A 1BBT1 5EXOA 1LOFC 1VBC1 3HBZA 1R093 4JTOA 1SG3A 2QDRA 4W4ZA 3QLQA 2R061 1RMU2 1WCDJ 5E88A 1OA3A 3JBG2 1PO11 3GJAA 4R9BA 3SISA 3GHMA 3PJYA 2VVEA 4CEWA 5BNPA 1HX6A 3JQWA 3ASIA 1DG6A 1MQTA 2B5HA 1MZ6A 2EVXA 1W0NA 2VOWA 4QDSA 4FTEA 4PCRA 2AH2A 5FUIA 4XFIA 4L92A 1EV13 4YW7A 1BEV2 3AP9A 4IV3B 5A32B 2DV9A 1OD3A 1FX5A 4NAOA 1S2EA 2RG4A 3KM5A 4NHYA 4YM0A 5JXGA 5FLHA 2V4VA 2XJTA 3ZPOA 3DYOA 1LHVA 3E6BA 1GQGA 2ES3A 4U2AA 5GLZA 2EF6A 3OOXA 4GJZA 5F5CA 5A7OA 1M06G 3I4IA 2D6KA 4RS5B 2VXRA 5LA2A 1WW5A 4I0AA 5B4XA 3KT1A 4XXAA 2FBEA 2ARCA 3NAPC 3U4SA 5C5UA 1Q8OA 1QJY3 1H8TC 3DXUA 2GH8A 1G9BA 5LRSA 4AHXA 4FFGA 2A70A 3HQXA 1HB2A 4KBZA 4PQQA 4XZUG 2D6MA 1LTEA 3ZX7A 4NPRA 4A4AA 4QKFA 1S0IA 3SH5A 3KVBA 1CZSA 2FHRA 3WZ1A 1FOD1 3WNLA 5KWRA 2YC2A 1ZBE2 1CD3G 4RFT0 2R073 3BUCA 5DXDA 4YVSB 1W2UA 5C4WA 1MS1A 1GOHA 2WC2A 4AI0A 1IPKA 2VUAA 5JUVA 1V0AA 3OBAA 2ZKLA 2RR11 5I0DA 1JYNA 4N9IA 4E8DA 1NG0A 3MLJA 2FCUA 1HXS2 5LWBA 1C8NA 3WDTA 1S0FA 1TMF2 4A7KA 5LK7B 2VJXA 3EHKA 5L36A 4MH0E 2VGDA 4YVSA 5IAXA 3GXUA 5HXMA 4MGIE 5HXVA 4MXWA 2D6LX 4G9SB 3VHPA 2VBDA 3HQUA 3MLKA 4Q4Y2 4AYUA 2JICA 4P9GA 3RPQA 3NJYA 5E16A 1W2AX 3BOWA 1XNAA 3KGZA 1PGL1 3M70A 1SPPB 4IE4A 1OXCA 4JCKA 3AXDA 4OZOA 1C8M1 2E32A 3H1YA 4XF9A 3R05A 1W9WA 1U0AA 4Y3OA 4YGDA 1W6MB 2GH2A 3BALA 4IESA 3WDWA 3MICA 1I9RA 2JDMA 5KHHA 5T54A 4LBQB 2JDHA 5A1FA 4LBNA 3CJXA 2VTXA 1DYOA 1GANA 1UYPA 1Y7BA 3NNJA 4Q1RA 4UW4A 4YNIA 5F3IA 1NQJA 1C1FA 1VBB2 2OZ6A 4Q0VA 4CVUA 3VDCA 4EROA 5KC5A 4DEQA 1CWPA 2DCKA 2RJLA 3L2HA 4JC1A 4DXZA 4FO9A 1BMV2 4BMEA 1W6NA 4V1PA 5JPMB 1ZZ7A 2ERFA 3VBHC 5FYYA 5JDBA 1O3RA 1OQ1A 4QX0A 1ZA7A 3LDKA 5FZ1A 5BYNA 5HCAA 5IVBA 2G9GA 4IDZA 3M8LA 4C1XA 1XRUA 3POWA 4FPHA 1DDLA 4UFIA 2FCVA 2W5FA 3GM8A 1UCXA 2ZMLA 3GZTB 5I0UA 3C7FA 5FZCA 4M4RA 2RM22 3K4ZA 1F2NA 3WX5A 3BIWE 5DAWA 2I45A 4R9CA 2WS92 2X09A 2V5YA 3DPRC 1PVC3 3P3PA 4FPOB 4KWUA 2EXHA 3FFZA 5L9VA 4PDWA 3VD7A 4KNCA 4ZS3A 1ZZ8A 4DEVA 3TOJA 3LIGA 1BVVA 1RMU3 1K5MC 2R49A 3I7DA 3JBG3 4ZHNA 4CDQB 1V9U2 5AC92 4E27A 4QDRA 1A8DA 1QXPA 1LU1A 3ITQA 1ULGA 1W03A 1YJKA 3D5OA 5GZFA 2HEYF 1XYOA 2OIIA 2OKXA 3USSA 5CEHA 4LE4A 1ND3A 4XTMA 1N1SA 2Q30A 1LGCA 5CU1A 3K46A 2VUDA 4IEVA 2P3IA 4HBNA 1BEV3 4YGBA 2A75A 3NNFA 1XQNA 2VZSA 3DPRA 4GWJA 3O1TA 2CV6A 4M3CA 5I91A 1C3HA 2PYTA 1RUJ2 2JG9B 1HKDA 1WD4A 3VZMA 1NXMA 4RHV1 2XJUA 5F6KA 1H2MA 5FPBA 4M3CE 2JG8C 4ES8A 2Y38A 3S6PA 1PX4A 3BVCA 2WO7A 4IE5A 1F4AA 5ANQA 2VCAA 4AFBA 2HEVF 1V6NA 5IFPA 1JZ8A 5FYIA 1CAXA 3J8F3 4CDUB 2QZ2A 4K6BA 5APAA 3VBOA 4XF3A 2JG9A 1YI9A 3E5XA 3OPZA 4Q0UA 2W95A 5KR7A 1UOJA 3RZJA 4FQ4A 1NZIA 2VY0A 3I3DA 4BLIA 2VZTA 4UF0B 2UYBA 3R4UA 3LSDA 4D94A 5EHDA 1AF9A 5CYYA 1CESA 1E57A 2ZAAA 3AKTA 4DUXA 1ZBE3 4Q4V3 3N7LA 3WP3A 3KQ4B 4COYA 2HJIA 2JIGA 2I07B 3EQEA 3N7JA 1UY3A 1W2OA 5FV3A 3K48A 4QXHA 2Y34A 1AX1A 3O1OA 2W39A 3VKNA 3RYRA 2KD7A 3IM0A 2CSGA 3MDPA 1GNHA 3W20A 2ZX0A 3VDAA 1QH7A 1HXS3 1ND2B 4M00A 1JUHA 3TN91 3I3MA 4HETA 3WP6A 1D4VB 2B45X 3O1MA 5LASA 5ABJC 1UMHA 2GDFA 3POYA 4PI2A 4B3NA 5F2SA 3V56A 4A45A 1POV3 4XPVA 4URAA 4GULA 4Q4Y3 4FFHA 1RHI3 4W6XA 4TYSA 3IDEA 2OW4A 4LUKA 4L2NA 1HIXA 3LSEA 3Q8FA 4JX0A 4EQVA 1RYYA 2D6NA 1W6PB 3A0KA 2WT1A 3FWEA 4XFFA 1ASJ3 3VBRA 3NV2A 1H6YA 4BM8A 4DIQA 2LALA 3IN9A 2QCSB 3PURA 2BVBA 3INAA 2OUJA 3B93A 4CPBA 5GLUA 1SACA 3JD72 2UY8A 3V0BA 4OCTA 4G3YC 4MX3A 1VBB3 5IVFA 3LPFA 4Q4X1 1NA1B 3LEGA 1GUIA 5F3EA 4XQDA 3UL2A 3P5BA 4QB1A 1LAJA 4OVEA 1QJU1 1LULA 1ZREA 3M3EA 4E4SA 4AI2A 3FUQA 4WBBA 2QQJA 5A3LA 2YV8A 2D3SA 3AZYA 3POIA 3H1MA 1AXZA 3VDDA 3OJBA 2Z69A 4E2SA 3CJIC 1ENRA 2DVDA 3MGUA 1R1ZA 4IE6A 5FO7B 2CL2A 4O9GA 3BTYA 1KS4A 1UZZA 5L19A 2CY6A 2G9FA 3S5QA 3CNAA 1AL21 4JKKA 2QFEA 1AVBA 1RUE2 1DZRA 1ZX5A 2WS93 2IFRA 3KV5A 4IERA 4KMQA 3ST7A 5C9AA 5JWPA 1O4TA 5DPNA 5F32A 2YU1A 1LGNA 3VZNA 2BUKA 4ES9A 5AFEA 4BDVB 5BY5A 2CDOA 1W6OB 2WFF1 4AGVA 5GALA 5IWFA 5A33B 1VR3A 2ZTNA 3WQ7A 1PZ7A 1V9U3 5AC93 1VRH2 5DAPA 3NNGA 3PVOA 2NM1A 3A0NA 4HVQA 4YZ4A 1DF0A 2GN3A 2XOMA 3ZFEA 1OKOA 4YW4A 3ZIWA 4V2VA 5JOXA 5FYMA 1JMUB 2C26A 4FPYA 4AXOA 4ZS2A 1AR71 2Q1ZB 1H2NA 5HV0A 1FI2A 1VAVA 2RS13 5FP8A 5FZEA 4P9XA 2WABA 4L9BA 2XLGA 3HIFA 3KLSA 4XILA 4Y1ZA 2ENRA 3NKGA 5JI7A 3GZAA 4CDXA 4OHYA 3C7HA 2BOIA 2V5DA 5FZMA 2BWCA 3TNQA 1RUJ3 2B8MA 2VCMA 2IXLA 1SDWA 4QX7A 1KFUL 3BPSA 1G9AA 4NMIA 4XJUA 1QJZA 1WUVA 2VMFA 4SLIA 4C1WA 5FO9B 2HWE2 5D8AB 3GYDA 1JOBA 4B4RA 2WNVC 3OYWA 3WNOA 4CUCA 4CCOA 3HBKA 4DUVA 3URFA 3VZJA 1G86A 3NNLA 2JD4A 4HVOA 1AZDA 5F6LB 3WW3A 1UMZA 3VKMA 2TBVA 3R4SA 5CFDA 1VJ2A 4JDOA 2W46A 1AYN3 5CNAA 1LHOA 1XB9A 3ZFFB 3J7LA 4R8HA 4QWNA 5K9YA 1GBGA 2ZHMA 3ETQA 1IS6A 2RVAA 2WSVA 1REDA 4GALA 1OBNA 1QDCA 2Q1FA 2JE7A 4NROA 4S2GA 2UU8A 5FYVA 2PHTA 4GMP3 1NCQC 3PVBB 3B00A 1O5UA 2RDQA 3LOIA 3PU8A 3IAQA 4V2WA 4WM7C 5B4NA 5BNNC 3ZFFA 2RS31 3M3CA 3VZKA 3MPBA 1W9YA 2HWB1 2BGOA 2ZEWA 3EJKA 4CEYC 4PIZA 3AKRA 1H9PA 1LHNA 4ARXA 3ZXGA 2OX0A 4AZZA 4YZ5A 1XNCA 4QAWA 1COV1 3LB9A 4PQ9A 3VBSC 2V4AA 1V6JA 5FMBA 3UGFA 5FZFA 3ZMOA 1E5RA 1Q8VA 1R081 2XKPA 3LA3A 1AR81 4Z1VA 1LNSA 3DYMA 2HWD1 1GWMA 4D6QA 4PI0A 3BTAA 3T1MA 5BNNA 2JB4A 2F6BA 1ZRFA 3HT2A 4DB5A 2YU2A 3AYAA 4HXCA 5IVEA 2Y0IA 2VMDA 3OPTA 3PUSA 4D7SA 2WWSA 3RNSA 1LESA 1W2TA 3JD73 4QB6A 5GZGA 4M3CF 4GB33 2W0XA 2WR9A 3W5MA 1TZOA 1PO21 2RV9A 3AMHA 3MO4A 5ANNA 3S5AA 1E5HA 4S2FA 1W39A 5CFCC 5IFTA 1V70A 4QD2A 1GLHA 1OH4A 4FPFA 4I3GA 4CUAA 4BH9A 3AKSA 5A3TA 5A7WA 1Y9GA 2B7YA 1WWYA 2Q5TA 2Y26A 3PDQA 2XL9A 4JRAA 1JZ3A 4E4DX 5KHIA 3FE5A 5FZ0A 2ZJCA 3AYEA 5F2WA 1GWLA 2VMGA 1RUE3 1QWRA 3ZFGC 5LA0A 3EB7A 2DU0A 1P8JA 2AC1A 1JUIA 3LPGA 5E8AA 1CIYA 1UPIA 2RJKA 3AFGA 3BGAA 4GA9A 4YZ1A 1VBD2 5EJ1B 1OUXA 3ZYFA 3K2OA 2WJSA 3WCSA 2DBNA 5FZBA 4RGGA 4HK9A 1LOGA 3MFCA 1MEC3 4LA3A 3BOPA 1QJFA 2E63A 4QPYA 1J1TA 4ZONA 3UKNA 1APNA 1QY4A 4Y1XA 1Z7S2 2W87A 1LODA 5T5JA 3HN3A 2BFUL 3VL8A 1PHMA 4PHZA 2W2IA 1RUG3 1C1LA 1Q8QA 3WOGA 5FAXA 5C8CB 3LGRA 3WHTA 4KGQA 2BTVC 4MV2A 4Z07A 3DGTA 4FI9A 2JDNA 1GZWB 4J1XA 2WQZC 4FPGA 4ZU5A 3WF2A 3ZXEA 5A7NA 4ITCA 1PNGA 2F4PA 2HWE3 1E5SA 4HPKA 1TME1 2LROA 5KHGA 1PGW2 3HAGA 3JU9A 3J26N 4HN1A 3I54A 4Y1UA 5C8CA 5EWSA 4QPIB 5J98B 4EN9B 3OG2A 3B3QE 2XG3A 3CU7A 3AKPA 2JIJA 3N9PA 1JOPA 1GZWA 4JAAA 4IXLA 1UOGA 4DUWA 3GALA 1UOFA 4RR3C 4GH4A 4QGLA 4XMIA 2VZ1A 4EN6B 5JOYA 2HEWF 3H3ZA 4MGYE 3VBFB 4AEDB 5C3QA 3N7KA 4A7YA 2DU1A 4LK6A 2QKDA 4IGPA 4UW3A 2R041 2E33A 4HZFA 3N35A 1SMVA 4UFHA 5F5IA 3ELNA 1US2A 1DLLA 2AEZA 3S0MA 3WEZA 2MNGA 4BQWA 3WQBA 3UKTA 3LF7A 1PIV2 2XVGA 5BPXA 1UX7A 2ZGLA 4BJ0A 4ZU7A 5JI9A 1H4HA 4FXKB 1SLCA 2ET1A 2ZPXA 2E7QA 4PF1A 3ZYBA 1VBC2 4S2DA 2ZX4A 3WDUA 3BCWA 3RZHA 4GKYA 5KHKA 2VC9A 2VL4A 4LORA 1PO12 4UT5A 5JR2A 5K0UB 4YARA 2YXSA 4TZDA 4ZU4A 3BTZA 4LO7A 4CUGA 4Q8KA 4AQSA 5FP3A 1OPMA 1O3TA 5CKNA 2J1TA 4COVA 4TSVA 3UJQA 2P3YA 2KXLA 2GN7A 1ZM1A 3L9JT 4LE3A 2VM9A 5FOJB 5DMYA 4LOTA 1Q8SA 3GNEA 2A6XA 2J1RA 2RDSA 4KG0A 4LLOA 5C5TA 1OQDA 2OZJA 4CXXA 5A3WA 4AF9A 4QM8A 5K0UA 3DCQA 5JZGB 2RJ2A 3B7MA 5FXZA 5EYXA 1J58A 2IXCA 3P6BA 4N53C 3UV9A 3GCWA 4LT5A 4QU2A 1HQNA 3FX3A 5K7PA 5FYBA 2IZWA 1G9DA 5H9RA 4P9LA 3SKVA 3GGLA 5FJHA 1I5PA 1WA4A 3KSCA 1MVQA 2DBIA 1A34A 2NN8A 4JTNA 4XC9A 2D6OX 4JV4A 3R4DB 2E6VA 3WUDA 3VD9A 3TB0A 5C3RA 5JZGA 2ZGUA 1XJAA 4HKOA 4MVTA 5FJKA 1ACCA 1HRV1 3WG3A 1ODMA 2XVLA 3VHRA 4FCAA 2WZ8A 3WVJA 4NRQA 1RVF3 1UXXX 3V64A 1OI6A 4FFFA 5FKCA 3QACA 3MLLA 1AL0G 4L0PA 3T3YA 1FOD2 3CMGA 4DXRA 5IK5A 2J1EA 2QQLA 5A6XA 4LKSA 4LHSA 4BLJA 5BNOC 2B42B 3O12A 1R1A1 4WVMB 5CVRA 1MACA 4L99A 3NSTA 2H0VA 5T3NA 1VBA1 1CAUB 1IKQA 1NCRC 3OUJA 5FZAA 3C7GA 1C5IA 1S0GA 1WW7A 4FBFA 2Y6KA 2RR12 4P08A 2PLV2 1W3XA 3KQRA 5A70A 2MPFA 3KVAA 4JQTA 2ZACA 1POQA 3SCHA 1W8TA 1F35A 2DFBA 4AFDA 1HV0A 2VQ0A 1WW6A 2NLRA 1J3QA 4YVWB 1CAUA 1WD3A 3IWZA 2WSUA 1TQ5A 2WNUC 2WBKA 1FXZA 5J3UA 5J37A 4CU6A 1W8FA 4GKXA 4J25A 3QH7A 4OHVA 4EN8B 4JGZA 5FDBA 1AXKA 2VZ3A 1R64A 2RS51 2XJSA 1SDDB 3DYPA 1Y9MA 2ATFA 2D43A 1NKGA 3AFKA 1QJX2 4LNVA 4JGYC 5DZFA 5H9PA 1VBE1 5IT6A 3A21A 1C8M2 4KL1A 1RITA 2W94A 4L8QA 4MLOA 1CGPA 1OLRA 1GP4A 1D2QA 4RQPA 5IVYA 2ET7A 4INDA 1FPN3 1BK0A 2G19A 2XB6C 4YLZA 3ZN6B 4YYOA 3ZYIB 4BA6A 4Q8LA 4DZGA 1X9PA 2ZKNA 1XNBA 4CXYA 2FZ2A 2ZMNA 2VW2A 5KC6A 3IZOA 1LOCA 3M7AA 3U1XA 2WYSA 4COWA 4C91A 1B35B 1D2SA 2YFUA 5JSPA 1VAKA 1X7NA 1DHKB 4ZZ8A 4CDWA 2R7EB 2X53S 2D7FA 1IPJA 1U5IA 3VV1A 4BZ4A 1RUI1 4LIUA 1NLQA 5BNPC 1YO8A 2C24A 3KGLA 3O0WA 4HL0A 4KG8A 4CCCA 1OVSA 3U78A 3J4UH 3RMXA 3ZDVA 4LO5B 1UZ0A 1PK6B 4U36A 5BUVA 4HSJA 3J7MA 1OOPB 3WG4A 4D7YA 2K9ZA 1B35A 2OS2A 2V09A 4MSVA 4NO4A 3AZXA 2A1XA 4QPGB 2R0FA 1G6NA 3N4MA 2W08A 4YSFA 3ENRA 4NIGA 2XMLA 2J42A 4UAPA 1XNDA 1X9TA 3AB0A 4AVBA 1ZBA1 1I1EA 2SLIA 3PTYA 1VBC3 3O5SA 1JYCA 4Y4YA 5EP9A 1PK6A 1OFNA 2MEV3 4AVVA 3I2HA 5A6YA 4DY3A 1OOPA 2JXAA 1PO13 3CO2A 1UZYA 4XUNA 1YIFA 5C3SA 1NY71 1DQ1A 4XCBA 3THDA 1A3KA 3H3UA 2VQUA 1IG0A 1K12A 1LEMA 1R091 4F8AA 1C4RA 1OHFA 3FHIB 3D4KA 4URTA 4NRMA 4RS5C 3H1WA 1SFPA 3RGBA 5AFBA 1O4YA 4IETA 2GC0A 1NT0A 1EYBA 1I6XA 2CGPA 1CR7A 3D3AA 3KF3A 4BK4A 5DZGA 4RHV2 5FMDA 3MYXA 2EIBA 4AI1A 1EAH3 1UQXA 3QD6A 4BQ4A 5G04L 3WSOA 5C4WC 5CADA 2IUWA 2WDBA 3M3QA 4DXSA 1EV11 4KBBA 2YB7A 5ACA1 4IV3A 5A32A 4OZXA 1QIQA 3VD4A 2OQ6A 1N47A 3X29B 4AVAA 1ODNA 3BN6A 4BK5A 5J48A 2FZ1A 4QXKA 2XR4A 4MGQA 4JQRA 2RE9A 2O0OA 3AYDA 3ECQA 5E6HA 4IGOA 3THCA 4RS5A 4YVSC 2DDUA 5E1RA 5JXIA 2ZCWA 4ARYA 4IQPA 1F4HA 2BW8A 4IE7A 1A8MA 1QKQA 4OMCA 4MGTA 4EE2A 4CCEA 1XU1A 5EPAA 3WNNA 3ALQA 3BYWA 3E5QA 1HB3A 1GYKA 2LUWA 1RUC3 2WNOA 3H3LA 3ACLA 1W8NA 3M4FA 3T2QA 3WDVA 4IV1B 2RR13 4QB2A 4IEZA 4Q0SA 5FOBB 2AR6A 2PAMA 2PLV3 3NAPB 2XONA 2EAAA 5FLJA 1WCUA 4AHZA 1UPSA 1H8TB 3M3OA 1QJEA 5FMCA 1SBFA 1I5ZA 2OQ7A 4HANA 4S2HA 3GHNA 1AR91 4I3PA 3BTXA 1RUF2 3WCRA 3WV6A 2G1MA 2LTNA 2W91A 1QQP3 1PM4A 2VOXA 3I8TA 4R9AA 3O1SA 1RXGA 4IV1A 2PFWA 4Z92B 4B4PA 2XQXA 4E4HA 3GZUC 5CG9A 1OURA 2EIDA 2WO3A 3ILFA 4OQ8A 1QJX3 4MUVA 2ZHNA 1NE6A 2DURA 1C8M3 2OUHA 2WYFA 1YIPA 3H8OA 1DYKA 1BQPA 3CIHA 5JSOA 1RB8G 3AYCA 3D82A 2AREA 1XYNA 2GZWA 1SPPA 1PZ9A 2Y0OA 5L7OB 2YZ4A 4PDWC 3LAGA 4KGGA 5FZKA 5LEKA 1QOSA 5LBFA 2DUQA 3QOPA 5JOZA 2PQQA 4Q4X2 5F5AA 1W6MA 1DGRN 1WCSA 3N36A 4IL7A 1VPHA 1UU4A 1QJU2 2HLEA 4LBQA 4XQWA 1LKNA 3Q8BA 3SITA 5JOWA 3RYPA 1AYM2 1QF3A 4MZUA 1UAIA 3WF0A 4BU2A 3IMMA 4WV8A 1ND3C 2OVUA 3QCWA 4CU7A 5L7OA 3EO6A 2R0HA 5T50A 1VAMA 1UIKA 5DDJ2 1ENXA 1N1YA 2VNVA 4UW5A 1UW8A 4P9JA 3JQXA 4FPJA 4A3ZA 1JZ7A 4Y4RA 1CJPA 4H7LA 5FFOC 3RZGA 5CB7A 1GMMA 3AMMA 4H7MA 3WT3A 4M4PA 1US3A 2WFF2 2A71A 2WZR1 3IAPA 2XVKA 1EY2A 1X33A 3D6EA 4CCMA 4P9YA 1YQ8A 1ONAA 4YPJA 3ZVXA 3IPVB 1PMHX 3IDBB 1UZWA 3OY8B 3VBHB 4DINB 4GXLA 1YQ5A 3ZPYA 5I8YA 3JXSA 3N7MA 3RJ2X 3SXWA 3WNXA 3VBOC 1PVC1 3Q8EA 2JG9C 3AP7A 3MIEA 1S0BA 1AR72 3FC0A 3I2OA 1W06A 3H50A 1YCIA 2VR4A 5HBAA 3KWVA 3AL6A 4Z2AA 4CDQA 2YPDA 1W8UA 3UGGA 2EIGA 1UKRA 3PUIA 5C6CA 3JBG1 2R16A 5GKAC 4RGAA 3SH3A 2C6SA 2JE9A 2BDRA 2HBTA 4BMBA 1STMA 1MZ5A 2UWAA 1BXHA 4I09A 4RHV3 3HNMA 5KXEA 3MBWA 4N7IA 1LEDA 1OD5A 2YC4A 5FZIA 4LHLA 2D6PA 3MV11 1O7FA 1K5MB 1VB2A 2HKXA 2VZOA 4NN0A 1BEV1 1QH6A 2VD7A 1HRI1 2D3PA 5JXJA 1T6BX 1OLQA 5FY4A 2QJVA 5A1LA 1KDMA 4Y22B 2ZBJA 4AK3A 1XBFA 2HWC2 2XUMA 3QBQA 3USUB 2WNEA 1O4ZA 4LHNA 3F95A 1FYUA 4QM9A 4UFMA 5HCFA 1GQPA 3U14A 3NRUA 3UJOA 4XVHA 4HKWA 4TTGA 1GOGA 2W1UA 4CDUA 4XBNA 1F15A 3FBMA 1S2BA 3NNMA 4OUMA 1KGYA 2PHRA 3J8F1 3VUOA 2X05A 1OA4A 1O6UA 3OGVA 4C0BA 3SEEA 2JG8B 3POEA 3LQCA 3MUZ1 1AR62 3U75A 2GMEA 4UOJA 4MOAA 4ORFA 4UF0A 1RXFA 1W8HA 3K4AA 3T1LA 5K8SA 2FCTA 1GOFA 3IKWA 1JYVA 4DRVA 2GNTA 1NZCA 3BB6A 3VBRC 1CAWB 3DXTA 3SHRA 4B1MA 2Q8EA 2VCCA 1TMF3 2HWB2 3KV4A 1ZBE1 4ZPIA 4IEOA 4Q4V1 4NUBA 3RDIA 1K3IA 3ZSLA 5C3OA 5H9QA 2WT0A 4LUMA 3CBNA 1T6GC 3ZMNA 3WNMA 1IQAA 1RUF3 3HN1A 3R0RA 1COV2 1H4GA 1X8MA 3OBRA 4XF4A 4AAXA 5B2GB 3T0AA 3VKOA 4WZFA 4BWOA 2VMHA 1EUTA 2L9LA 4LLFA 1ND2A 1Q5OA 5GM0A 1AR82 5FZOB 3K3OA 3LDBA 4K20A 4NIIA 1HXS1 2ZS6B 2HWD2 3ILNA 5IVJA 3VDDC 3E5UA 4QKNA 4AI8A 4KWLA 2WQ8A 2ZGMA 2DUPA 1JZ2A 3DUIA 2YFZA 5FYZA 5LY2A 1NA1C 3LCPA 5A3UA 4N90A 3RMYA 2CHHA 3RS6A 2W1SA 1DQ2A 4ZXEA 3MEPA 5C9AC 5DQ0A 3OEAA 1BK1A 1RHI1 4XQ4A 1DZTA 5DG1A 3WQ0A 3O1VA 2BNOA 3UT0A 3B9CA 1W28A 2YBSA 3OCPA 3HPNA 2RDRA 1W6PA 2BBAA 4QKDA 1PO22 3H9AA 1W99A 3VZOA 1PX3A 5JMOA 1O3QA 1GR3A 2XH6A 3MI8A 3N9NA 3POGA 1ASJ1 4Q5OA 4CPBD 5C33A 5F37A 3ZFEC 1LOEA 3MIFA 1AYM3 3O7OA 5DG2A 4D6RA 4Y5TA 1IZ3A 1DQ4A 3NMBA 1BYHA 1ULEA 2ZGRA 3T2OA 3WW1A 4CCKA 5HV4A 2VU9A 5FP9A 3WF1A 1NA1A 1ZNPA 4ONUA 2BQPA 2GU9A 2BERA 2J1UA 1J84A 2QQMA 2RM23 3B69A 4K1ZA 5H9SA 1REFA 3M2MA 5LBEA 5DDJ3 2VMIA 4CDXC 3ZIXA 1L7LA 4EZ4A 1W8OA 2PHWA 3C3VA 1ZA4A 3TBDA 3C8XA 5I0RA 4NPLA 2PHUA 2WZEA 5BXXA 2NP0A 1JHNA 3WW4A 3WNKA 1RTVA 5LATA 2P3KA 2GP5A 3SCGA 4DOUA 2B9UA 2VO5A 2BEOA 5LZ6A 2PELA 3ME2A 5A7SA 3TNPB 2NQYA 5JIUA 2DUOA 2YG0A 4IEYA 4UFLA 1DQ5A 2F17A 2H0BA 1ZZ9A 2O8QA 2RMU1 2WS91 2XHKA 2YY1A 4LA2A 4MXVA 3ZSJA 1WCKA 4AI3A 2DFCA 1W6OA 3OD4A 5CFDC 2FQPA 5A33A 3CJIB 2ORXA 2P6CA 2YYOA 2Y6GA 1BZWA 4M0HA 1FMD1 3IDCB 3VZLA 4RA0A 3WHUA 4D69A 2ZMKA 1OUSA 1WA6X 2ZGOA 1O8PA 1CJDA 1NUKA 4UWDA 5FK7A 1HB1A 2DWRA 4NIHA 1UY1A 1VLNA 4OLLA 4BQYA 4DXTA 1KS5A 1TE1B 4K21A 3SLIA 2HWF1 1UY2A 4AHWA 4JDNA 4W6YA 4R4XA 5DAQA 3ZYHA 2PA7A 2VH9A 5E89A 4OULA 3U07A 2ID4A 2RS11 1TME2 1XE7A 1OF3A 4XBLA 4B4QA 3HOBA 1ZRIA 1PMJX 2DYCA 5FTTC 3ZFFC 4AWDA 1N1VA 4A41A 5LW9A 3NWKA 2QQPA 3I2GA 2PQSA 3IBMA 5L9RA 2HWC3 2Y60A 5D8AA 4OQ9A 5FMOL 3AVRA 4F83A 2VXJA 3A4UA 1HLCA 4GIQA 1Z78A 3ABZA 1XPWA 4OUSA 2R042 1JBCA 2Y6LA 3UYJA 2VTXJ 5GLVA 1KQRA 3LE0A 4RGKA 3WINE 1XNKA 4Q4W2 1V6LA 2R32A 1AR63 4L97A 3MIBA 4DS0A 4DPNA 2IC1A 1VIWB 1AYN1 2WNVB 2ZX3A 1IS5A 3AL5A 2MHFA 4QX2A 1V6IA 4XJAA 1F8VA 3WLUA 4P00B 2HWB3 3WY6A 3WF4A 1F5JA 5KXDA 4QMAA 3Q9OA 4K40A 1S0DA 4FOVA 3RFRA 3KF5A 2YMZA 2IVIB 1WKYA 4AOCA 3ZYPA 4GMP1 2Q0AA 2R1BA 3N3HA 1GFF2 5LK5A 4EV0A 4OI0A 4YM2A 2NZ9A 1S0CA 1U5ZA 2VQTA 1OF4A 1LR5A 3MZHA 1SBDA 4P14A 4AFCA 2B46X 2X5IB 4W6WA 3U10A 1LOBA 3EXUA 3K4DA 2A6WA 3MPPG 1NLSA 2YROA 2ZGQA 4CU8A 3OGJA 4B29A 1W8ZA 2BOJA 3PHMA 2A3WA 4TLFA 1MS0A 1NCQB 3CKHA 4SBVA 3FLRA 2WUHA 3P1IA 3H8RA 5J1XA 4WM7B 1HJFA 2C9KA 4YW3A 2H6BA 1FATA 2WLPA 2UURA 1J83A 1SBEA 2XBO1 4NIAA 5KBFA 4YG6A 4JRLA 2X5IA 2IWGB 4A6SA 1VRBA 4CEYB 3K3NA 3L2YA 5HCHA 3ZYJB 3NO8A 4EJRA 1SLIA 4NHMA 3OPWA 4XFBA 1POV0 3LIHA 3AZWA 2Z42A 1WLCA 4FP2A 3ZN4A 4Y5SA 1G9FA 2DCJA 1UL9A 1W3VA 1IKPA 3VBSB 1HRV2 3BI3A 1XC6A 1N3PA 1CIWA 2O1QA 5D2AA 3FUOA 4A42A 2WA3A 1XNTA 2Z79A 5CA6A 1IHMA 4A44A 2LW8A 5JMCA 2UWCA 3JD71 4IEUA 2C9AA 5EIYB 3AP4A 4DY5A 3ES4A 4GB31 3ZM8A 4CTEA 1JYXA 4Y20B 4PIXA 1R1A2 4B7EA 4JKLA 2XLAA 2WO2A 4QKBA 1VBA2 4JZRA 4XDOA 3T09A 3TWIA 1RJ7A 2EIEA 3UKVA 5FQ0B 4CCNA 1G9CA 1VRH3 3S7IA 1DGWA 1IGOA 3PNAA 4WVVA 4LIVA 2P17A 4BXSV 5C8CC 5CFCB 2BPA2 2C1FA 4CZSA 5FY1A 4LBJA 3ZXAC 1UZVA 4FOYA 2J7MA 4XJ8A 2VW0A 3AK0A 4B8EA 1W0PA 4GH4C 2BV4A 3ACHA 3ACGA 5A7QA 5A1AA 1MZEA 4FAGA 2GAUA 1MEC1 1OVPA 2RS52 4PF5A 4K3UA 4UFJA 2QNKA 5T5OA 4BISA 3PUAA 4QPWA 1YC61 2VVFA 1H6XA 2IVJA 4KH9A 4AVTA 2Z5WA 1VBE2 1TNFA 4QQHA 4AW7A 2VMCA 1UO9A 4LBLA 3AP5A 5IAVA 2H6CA 5LBCA 2QQOA 1H9WA 1UOBA 1RUG1 4K8RB 3KCYA 2PHDA 2EXKA 2GNBA 3AVSA 2XJVA 1J3RA 5FXXA 1GWKA 2J22A 2XQRA 3OUHA 3U0ZA 1HB4A 2ADEA 4NVPA 4W8JA 1CAVB 2Q1MA 3BPZA 1QOTA 3I2KA 2BVVA 2X29A 2CAVA 1RUI2 3PIGA 2HWE1 1VE0A 1AJKA 4BCUA 4CUBA 3I2DA 4XIOA 2IXKA 3ZDSA 1YHFA 3KHBA 4QPIA 2D5HA 2AZ5A 1GV9A 4H14A 3I49A 3I2JA 2JDAA 1YNAA 2W92A 4XETA 4ZY9A 3NJXA 1YWKA 1YUDA 4Q4W3 1KFXL 2JDZA 4OHZA 4CU9A 5CISA 2GP3A 1DBNA 1O5LA 2TUNA 1SEFA 2C0ZA 3VBFA 2JEMA 5K0UC 4AEDA 4DRRA 1DGLA 4KQ7A 3DL3A 1GNZA 1BBT2 1L7QA 4HOOA 2BNNA 2VUCA 3LWCA 4EWAA 1LECA 1ZBA2 4BHPA 2R062 4BQ3A 3SMHA 2OPKA 4DNYA 3LEIA 2RHPA 4YW5A 3PJQA 5LB6A 4E2QA 1D4M1 4QX8A 2VNOA 2ZGPA 3VN4A 4QU1A 4NHLA 4Y5Z0 3ZSMA 4E4ZA 3EYPA 5ISLA 1G7YA 4HFSA 2XJPA 2FMDA 2VTFA 1NY72 3CQOA 3ETPA 5JZGC 5LY1A 2X10A 4DO0A 4E2GA 1ENQA 4NE9A 3KS7A 5FMOS 1U5XA 3BU0A 1R092 2W1WA 2FMYA 3CDZB 4TXWA 5GJ6A 4GMP0 1QXRA 1VB4A 3LEKA 4I01A 1WMDA 1WLDA 2AEYA 2UY9A 3MHZA 4A3XA 2JX9A 2ILMA 1PGSA 1FT9A 1FV3A 3I97A 1U5YA 5EFUA 1ENSA 2VZVA 2K46A 2EXJA 2QE3A 5EYYA 1KDKA 1XYPA 2EICA 4O9EA 2E31A 4CP1A 3ZXDA 1EV12 1S0JA 2VW1A 4HSLA 5ACA2 3VL9A 1WMXA 3OBTA 1W9FA 3H8XA 2Y6JA 4XXPA 2BYVE 4YGCA 1HW5A 2PMWB 2BRTA 1HN0A 1AHSA 2E7TA 2LS6A 1JZ5A 1SQ4A 1AJOA 1HRV3 1RUH1 3B94A 1EUUA 4QXCA 1QNYA 3HNBM 4UBHA 2OYZA 3RG0A 1AX0A 3RI9A 2VVDA 4TWTA 4DFSA 4LR4A 4D6SA 4BIOA 3FMGA 1LRHA 1RINA 2TNFA 4D0QA 1K5JA 4XOGA 3LFIA 1UYYA 4MO3M 4NPMA 5FRAA 4JGZC 4EN0A 1W9TA 2DVAA 5FZ6A 3RZZA 4N53B 1MPXA 5FXVA 5GZDA 1BJQA 4N8MA 1S2KA 5EQUA 1IS4A 1A6CA 1NOVA 1VBA3 1JU4A 1VBD3 2WAAA 2WQ4A 1YEWA 2Y33A 3FJSA 4HG6B 3HD8B 1KJLA 1RVF1 3WNPA 4RQPC 5J36A 4OMDA 2QQVA 3HMYA 4NRPA 5I0TA 4QT6A 4A6OA 1SLAA 5IHRA 4MGKE 4YW1A 3J7NA 4WVMA 4XJZA 1AX2A 4Q0PA 1Z7S3 3ZKUA 2I2SA 3NJZA 2Q8DA 2ZA9A 4XMAA 1AR92 1H1MA 2AGSA 2VOTA 1KJRA 1QDOA 2BGPA 2C5DA 4WM8B 4CDWC 5IVVA 3IT8A 4TN7A 5T55A 2BU9A 4C0HA 5BNOB 4UXAA 1PGL2 2RS53 4XBQA 4HLTA 4N43B 2YDEA 1C28A 1J59A 1DP0A 1UU6A 5JCTA 1VBE3 1HV1A 4YVWA 5IK8A 1NCRB 4HT1T 3GCXA 1ZRDA 3KT4A 1B35C 1ZVFA 4QQLA 1KRIA 4WM8A 5F7UA 1Z0HA 1NQDA 4RN5A 3VBUB 5A80A 1H8VA 1OT5A 4E8CA 5KXBA 2J1SA 1KITA 1PK6C 2P6HA 2VOVA 4CCLA 1DQ0A 2HYKA 1OOPC 3AKQA 2WNUB 1Q56A 4XIKA 2ADDA 2VUJA 3ZN6A 1RUI3 2BFUS 1FPN1 1KEXA 2WINB 1PGW1 1JI6A 2PAEA 3B01A 1GP6A 3LKJA 3AMQA 4JGYB 3VBUA 4UBGA 4AQ6A 1QGLA 3JB8A 2Q8CA 4CXWA 3ON7A 1K45A 1PIV3 1WMEA 4HONA 4LBMA 5EV7A 2KR2A 2GNDA 3MW2A 3MIHA 2JKBA 4GZ9A 4XFCA 1BBT3 5FIXA 1RUD1 2GALA 4COZA 1ZBA3 2PN5A 3C2UA 2R063 4I0BA 5CZKA 2WZR2 3A7QA 1W0OA 4MADA 1UMIA 3PVNA 4QGMA 2ZGSA 3N9LA 4IV3C 2VZPA 1YJLA 4WZCA 4QPGA 1X36A 2Y6HA 4LPLA 5FPLA 1MQTB 4KI5M 2EA7A 2V73A 1PVC2 1AUYA 4YZ3A 5FUNA 2GMPA 1W8WA 4PIYA 2I74A 4YG0A 4FAHA 3SEPA 2JD9A 2QQIA 3RZLA 3A22A 2WIIB 2MEV1 4N7UA 2JB8A 4BIFA 2VZUA 3IMNA 4XFGA 4XF1A 4D3WA 4ATEA 4P9WA 2ARAA 4LMFA 3T0DA 1VMHA 3TEYA 2PXJA 3S7EA 4ASMB 3SQOA 1EP0A 1QHDA 4XAEA 2IFWA 3B02A 3J9SA 1OSGA 4MYEA 2ZZQA 5ACA3 2FDKA 3BKZA 1IS3A 4YZ2A 4AEKA 1PZ8A 3AZZA 2XL7A 1HRI2 1ULOA 4AEJA 2P4EA 2XUEA 2P37A 1ZZBA 3P3NA 5LRRA 1LOFA 4PLNA 4JHZA 4GWNA 3DECA 1LOAA 1EAH1 3F2ZA 2GMMA 5A3NA 3PTRB 2E53A 3Q8AA 3OBZA 2JJ6A 1FOD3 1XU2A 2QTWB 3DF0A 1NAEA 4XHBA 3GZEA 4IV1C 1JW6A 2WAOA 4XCAA 1QJY1 3J8F2 4GJYA 2V72A 5IK4A 1TG7A 4QDQA 3HJRA 5C4WB 4FTSA 2PHLA 3WD5A 5IUQA 4LO8A 1NXD1 3D8CA 4I2OA 3JZVA 4AGRA 4AVCA 1RGSA 1J1LA 3HT1A 4KU7A 4FFIA 3NV3A 4ISQA 4XDQA 1S1AA 3MF6A 3CHXA 4I02A 5A3PA 1F5FA 2R071 3K77A 3O14A 4BXFA 3OTFA 3ILRA 3TN92 3ZR5A 3ZO0B 4QHBA 1MS9A 1SHWB 5I8SA 5FO8B 4Q4V2 2VZRA 3SC7X 2WZPP 1JOJA 2XLFA 3OB8A 1SLTA 5JSRA 1AR93 2ZEXA 1O59A 1RUC1 1DGWX 2QDNA 3NAPA 2VECA 4MXWB 3HQRA 1FV2A 1YRZA 2WWUA 4JHTA 1VP6A 2PLV1 2VG9A 2OA2A 1H8TA 4DQAA 4AL9A 3H42B 4NHXA 4FXGB 1DCSA 1BHGA 2ZZJA 3N9QA 4LJHA 1VMJA 3AM2A 5L7OC 3JCIA 1HJGA 2A6ZA 5FPVA 3WP4A 2BJSA 1ZRCA 4H55A 5M0TA 1H30A 2PHXA 3VD3A 1OMIA 1QQP1 4Y1YA 4YM1A 4J6GA 1BVP1 4Y24A 3R6SA 3GBWA 1RHI2 2A7AA 2QQKA 2Y64A 4RL7A 4CA9A 1WBLA 2A3XA 2ZX2A 5LA1A 4AQ2A 4OI2A 1QJX1 4CP0A 3OSDA 5C71A 2FDIA 4NWWA 3TEXA 4XUPA 4LOSA 4LBOA 2GSYA 2F4LA 4XE9A 4GQ7A 1WCQA 3ZKYA 5IATA 1W6NB 4O7XA 1ASJ2 1AXYA 3MF9A 3GDBA 4ATFA 2ZEYA 4UI9L 3O1UA 1W2NA 5FY7A 4QXBA 3HVDA 2JKXA 4R4ZA 1URXA 1BKZA 5JXHA 1H1IA 1JU3A 1SFYA 3PLQA 1U12A 1XE8A 4NR1A 1GZTA 4P5HA 2VPVA 4CDQC 1OH3A 1AL22 1RIRA 4LBQD 4ASLA 3E6CC 1BCXA 2QBXA 4BQXA 1RUOA 4MGSA 4EWDA 4AR2A 2TEPA 3RJRA 1A78A 2ZGKA 5A3MA 1S0EA 4UFKA 4PDWB 4IE0A 2DTWA 3W9AA 5FR3A 2WZR3 1PNFA 3CEWA 3O1RA 1XSRA 1MS5A 2ZGTA 2PHFA 5J96B 2Q4SA 2YPJA 1D0GA 2ZAHA 4GWIA 1PM7A 4K1YA 3GBGA 4AG4A 2RMU2 3E1F1 2XHNA 5JAXA 1ND3B 3ZXKA 4W65A 4NAMA 5JLVA 1RMU1 5F3GA 3RZMA 1UIJA 3IDAA 1B09A 5L9BA 1FMD2 3TEZA 5D1IA 4KWKA 3V65A 1CX1A 3KV6A 3IPVA 2GC1A 3DPRB 5FP4A 2R1DA 3OY8A 2K0GA 3VBHA 4A7ZA 4CDUC 4M3CB 1I3HA 3CZJA 4ISRA 5J09A 5FZ3A 1QEXA 2HWF2 1Q8PA 4LULA 1MR5A 5FZ7A 3PL0A 5CAZA 2E26A 3DV8A 4XAAA 2QQUA 2RS12 1W9SA 2EXIA 4OUEA 4AVSA 1VALA 4RD7A 4D8MA 5JPNB 2O8OA 2JECA 1HRI3 1CONA 2BP6A 1YQCA 1CAXB 3N9OA 3WDYA 1OKQA 1V6KA 3POJA 3VBOB 4IEXA 2G9ZA 3RQ0A 3VD5A 4NJ4A 2B4KA 1K5MA 1OC1A 1LU2A 2FDJA 1YFUA 2W3JA 3B9IA 4I0WB 2G4IA 3HR9A 4TLGA 5AVAA 4EYUA 5J7MA 2ZXQA 1W90A 1QOOA 4IEWA 1OFSA 3NL1A 1UN1A 3JUUA 3OEBA 5FY9A 4Y22A 1CN1A 1ND2C 4LKEA 3UNPA 3PMEA 5ERLA 5FZHA 1Y4WA 4XUTA 3USUA 3V0AB 1CPMA 2D98A 1DIWA 1QNWA 4RFRB 2A5ZA 2XDVA 4Q0QA 3BU7A 1UWWA 1IOAA 1AYN2 1UY0A 2RS32 5FY5A 5LCWL 2IXJA 4QX3A 1GZCA 2E9QA 4MHRA 4LXLA 5FYSA 2A6VA 1QU0A 2CGNA 1DLCA 3DEMA 3RWKX 3TN93 2JG8A 3HEIA 1LB2A 4YGEA 4Z8BA 3AJZA 3K51A 3VHOA 1EPWA 2K2SA 4BYYA 1FAYA 1GKBA 3V0AA 1LENA 2JDKA 3H8UA 4R9DA 4MG2A 1CAWA 3LDRA 1R082 3THPA 5FYTA 1NE4A 3ZYRA 2JDYA 1TMF1 2VNGA 3T2TA 4YW2A 5T5LA 3T4VA 2VBPA 4FTBA 5BNQA 3WXPA 2QUOA 1POV1 4PBOA 1RUF1 5IK7A 1Y43B 3RSJA 4Q4Y1 3VBRB 5FYCA 2Q8OA 5FWEA 1W04A 3G6JB 3RVHA 5FZOA 2XBO2 1YFXA 2A6YA 3CZUA 3DKQA 4FPCA 4KU8A 4E9KA 3IB3A 5ABJB 4Q4X3 1WW4A 3V0BB 3FHQA 3MIGA 2VZQA 1JXNA 4XUQA 5T5PA 3UESA 4IUGA 4BQ1A 1SFNA 4IW3A 1N3OA 1QJU3 3I2IA 4AE2A 4OHXA 4ZZ5A 1PMIA 2JDPA 3AZVA 4XFAA 4EWEA 1UY4A 1WBFA 5DABA 5A6QA 2ORZA 1ULDA 3ATGA 3ZYGA 1YQ2A 3E6DA 1VBB1 1S55A 3KMHA 4QQ2A 2CU5A 5GZEA 3VDDB 5ABJA 3W5NA 3B5LB 1RUNA 4AAPA 3AMNA 3N9MA 4GB32 1BMV1 2CGOA 5FZGA 1AL23 4K7JA 3SCFA 3T2PA 2CTVA 3ZXJA 4COUA 2BGCA 3OGRA 2JE8A 5C9AB 2CNAA 1K42A 1LCLA 5IVCA 1AYM1 2VNRA 1MVEA 2OPWA 2WFF3 3H7JA 4IEQA 3BIEA 3KT7A 4HKLA 4BE3A 3H0OA 5T52A 1OA2A 1ST8A 4ET7A 3W59A 3TAYA 4B7KA 3IIAA 5I0SA 1GP5A 2RM21 1DZQA 3I2FA 4O65A 5BV6A 3VDBA 3VLBB 3C7EA 2ZHLA 4FSJA 5DDJ1 4OI1A 3ZFEB 1AR73 2RMU3 4CP9B 4M01A 2VE1A 5D8AC 1UU5A 4KWJA 2W47A 1DYPA 2XJQA 5FXWA 4LTAA 2WN3A 1FMD3 1H2LA 2ZGNA 4W50A 1V9U1 5AC91 5LEJA 1MEC2 1JH5A 4CDXB 3T30A 2A3YA 3W21A 1O3SA 2NYYA 3T0BA 4H3WA 4CCJA 4WVZA 2HWF3 4A2UA 3ROUA 4CP9A 3CJIA 3PUHA 4Z2WA 3KZ4C 3D0JA 4J1WA 1XOYA 4BQ5A 5FYUA 2VMEA 4META 4P02B 1RUG2 2ARBA 2HH9A 2XJRA 3OYWB 1O91A 4FPLA 1RUJ1 2ZABA 1NYWA 4XW3A 3NV4A 4OYUA 4X8NA 2XWJB 5CFDB 1W6QB 2D97A 4LHKA 2VBBA 3OUIA 1DFQA 1YFYA 2CWMA 2WFPA 1XE0A 5FZ4A 2YHJA 4AI9A 2AACA 1HDKA 2B9VA 1O8SA 4FT8A 3PIJA 3ORJA 4G4FA 5FWJA 1ZRRA 4OFGA 5IW0A 4ASKA 4H2AA 1IG3A 3NV1A 3WDXA 5JR7B 1L7RA 2HWC1 2HBUA 1QMJA 3WG1A 3GJBA 1CQ9A 1W6QA 1WGPA 1LGBA 1SLBA 1TEIA 1G8WA 2D44A 2AYHA 5FZ8A 2RS33 4UW6A 1OQEA 3LA7A 2DVGA 3ZXLA 4CP2A 1KXGA 2GC3A 2VAUA 4O61A 2P2KA 2X5IC 5AVPA 1D4M2 1JS9A 1H0BA 4FPEA 4PLMA 4C8DA 3M3IA 3VB9A 1COV3 1AR61 1ULCA 4JDMA 5HI0A 2WNVA 3JB4C 3K75B 3RZKA 3FN9A 2UWBA 5DN2A 5HPOA 1ZZ6A 4GAZA 3POBA 1V6OA 3WG2A 1R083 1UXZA 3WUCA 1AR83 3OD0A 3O1PA 2HWD3 1RL3A 5FUPA 5FY8A 1FNZA 5D21A 1E5IA 1BLZA 5CKMA 2CDPA 3QH6A 1JYIA 2YC0A 2P5BA 2R30A 4WVWA 2WLQA 5TSWA 1ALYA 5CIRA 2WO1A 5K4LA 5BNNB 5C8WA 1RJ8A 2SBAA 4CSWA 4Q1PA 4XYXA 4XHXA 4RYDA 1WZXA 5F8PA 2YGMA 2IXIA 1YQ6A 4GD4A 3NVCA 4X8PA 5A7PA 3OGGA 2XBO3 4MHUA 5DUUA 3VKLA 4ZXKA 3TRSB 1SLLA 4X6QB 1HN1A 4BQ2A 2ETEA 2WWJA 3C7OA 1PO23 3ZSEA 1NCQA 2WRAA 5GLWA 1MS3A 4LBKA 4WM7A 3I3BA 3SH4A 1CPNA 3FLTA 3LD8A 3AP6A 5KHJA 4Q26A 1RUH2 3GF6A 4CEYA 5FYHA 1UD1A 4B1LA 3U37A 1UF2C 5A7WB 1Q3EA 4JVAA 5FY0A 2Y8KA 1H1AA 2B39A 2Y6FA
chains in the Genus database with same CATH topology
3ES1A 3CF6E 2D93A 3LZZA 3WQ1A 1C57A 3VBSA 4YFZA 1SCSA 4CYDA 1LHUA 4YFWA 5I8TA 5CG8A 3AXEA 5DUWA 3VGIA 5GZCA 1RVF2 2XKOA 3D0SA 4PBPA 3LOBA 1KD7A 4XJWA 1ZZCA 4FVVA 2VOKA 4XEZA 4FPKA 4Y20A 1YYNA 4Y1VA 1WLWA 1QXJA 3U11A 2DCZA 1RUE1 2NPIA 3LA2A 2DVFA 4EN7B 4ZKTB 2GC2A 1NLRA 1MS8A 3FLPA 5FQ0A 4OI4A 3NW4A 1WMFA 4XF0A 3S30A 3ZFGB 5CFCA 1VRH1 1MS4A 3APBA 4QPIC 2QZ3A 4FOWA 4QQOA 3AX4A 3UK9A 2R6QA 4R52A 5FCCA 4LEJA 2ZX1A 5FPXA 1TME3 4PLOA 2W68A 4HPKB 2ZOEB 3VBFC 5FLIA 1MZFA 5FREA 4AEDC 4Y26A 3BODA 4FQZA 3ZFGA 2DCTA 3GBFA 4Q27A 2CYFA 3I59B 5HCBA 4L11A 1F9KA 5KXCA 4GH4B 3MW3A 1FPN2 2R043 2E51A 2YGLA 4BOWA 3VKFC 5I93A 2GNMA 1CAVA 1LHWA 2PAKA 4HMZA 2ZHKA 3POSA 1H2KA 1N1TA 4C90A 1N3QA 2WT2A 3I59A 5DUXA 4Q2FA 3E97A 1J3PA 2UYAA 3ZXFA 5F1RA 4X6RB 2IXHA 1RUD2 4HVRA 5F5QA 3TYJA 2WKKA 2LM3A 2W52A 2P3JA 1ULFA 3EBRA 4RR3B 1D4M3 4Q4W1 4AQTA 5JVVA 2ARXA 5FPZA 4D7TA 3AJYA 4XTPA 3FFQA 4QGNA 1DQ6A 4K8FA 5FBZA 2PTMA 2P34A 4AGGA 1PVXA 3RYKA 5CBLA 2XPJA 2DVBA 4RR3A 1Y3TA 2MEV2 3AMPA 4RSUA 1HQLA 4XFHA 1TNRA 4NHKA 1X8EA 2NMOA 1GICA 3MFAA 5GLTA 3ZN5A 2VULA 1V6MA 4YG3A 4Q29A 5L73A 2AENA 3DKWA 3WW2A 1Q43A 1L3JA 4FP3A 5SV8A 4AEMA 1F31A 1LJ7A 1OPOA 1HQWA 5F9TA 3KB5A 1X82A 2WA4A 1SCRA 3OF1A 2D5FA 3O0VA 4BPZA 4DMIA 4XJ9A 3RWNA 4N9HA 1XXNA 1UX6A 3CL1A 1RUH3 1EAH2 4NOTA 2BWAA 4QQPA 3WP5A 1GSLA 1REEA 3VHNA 3O0XA 3H7YA 2DF7A 1R1A3 3MIDA 1QJY2 1RC6A 4MGZE 3PMSA 4F3JA 3CLPA 4YVWC 2XWBB 4YRDA 4M0NA 3PVEA 4WM8C 2R072 1CX4A 4N53A 2CAUA 4XZPA 2D40A 2BNMA 4N43C 4K9SA 2EAKA 3KCXA 1VBD1 1RUC2 2DCYA 4AHYA 2YUEA 2XGXA 1DU3D 3MW4A 1JN2P 4HK8A 4CRQA 4QX5A 3W58A 4PJYA 2A73B 4JGZB 2N7GA 1YI7A 1YXWA 5EZWA 2Z2SB 3M1HA 1Z7S1 1GQHA 2VQAA 2CWSA 3VBUC 1EPZA 4I30A 4RQPB 4GWMA 1QQP2 1Y9QA 4AFAA 3KCCA 5BNOA 2DTYA 4N43A 1YLLA 3DN7A 2KA3A 2KM2A 2EALA 1CVNA 1NCRA 3RRDA 4P9IA 3RI8A 5DZEA 3SNMA 2AUYA 4QPGC 4CDWB 3G7DA 4LO6B 5DUVA 4IEPA 2BBVA 4Z82A 3NKTA 4F7ZA 4NWVA 5JIAA 4AFMA 1GZ9A 1C5HA 1WLTA 2WNUA 2E7AA 5SV5A 3KD4A 1YFWA 4FOQA 3WR0A 4YM3A 1MQTC 5EJ3A 3THTA 2X8KA 1V00A 1RUD3 4JGYA 1ZYBA 4LO4B 3ZSKA 1JTZX 1M4WA 1DGRA 4CEWB 2NMNA 5BNPB 1FNYA 2QVSB 4OHWA 2JENA 2WL1A 3U4XA 3HWJA 1PIV1 1UKGA 1X50A 2D3RA 1D0HA 3FBYA 4HN0A 3FZ3A 1BBT1 5EXOA 1LOFC 1VBC1 3HBZA 1R093 4JTOA 2QDRA 3QLQA 2R061 1RMU2 1WCDJ 5E88A 1OA3A 3JBG2 1PO11 4R9BA 3SISA 3GHMA 3PJYA 2VVEA 4CEWA 5BNPA 1HX6A 3JQWA 3ASIA 1DG6A 1MQTA 2B5HA 1MZ6A 2EVXA 2VOWA 4FTEA 4PCRA 2AH2A 4XFIA 4L92A 1EV13 1BEV2 3AP9A 4IV3B 5A32B 2DV9A 1FX5A 3KM5A 4YM0A 5FLHA 2XJTA 1LHVA 3E6BA 1GQGA 2ES3A 4U2AA 5GLZA 2EF6A 1M06G 3I4IA 2D6KA 4RS5B 2VXRA 1WW5A 4I0AA 3KT1A 4XXAA 2FBEA 3NAPC 1Q8OA 1QJY3 1H8TC 2GH8A 1G9BA 5LRSA 4AHXA 2A70A 3HQXA 2D6MA 1LTEA 3ZX7A 4NPRA 1S0IA 3SH5A 2FHRA 3WZ1A 1FOD1 5KWRA 1ZBE2 1CD3G 4RFT0 2R073 5DXDA 4YVSB 1W2UA 5C4WA 1MS1A 2WC2A 4AI0A 1IPKA 2VUAA 2ZKLA 2RR11 4N9IA 1NG0A 3MLJA 1HXS2 1C8NA 3WDTA 1S0FA 1TMF2 4A7KA 5LK7B 3EHKA 5L36A 4MH0E 2VGDA 4YVSA 4MGIE 5HXVA 4MXWA 2D6LX 4G9SB 3VHPA 3MLKA 4Q4Y2 4AYUA 2JICA 4P9GA 3RPQA 3BOWA 3KGZA 1PGL1 3M70A 4JCKA 3AXDA 1C8M1 3H1YA 4XF9A 3R05A 1U0AA 4YGDA 1W6MB 2GH2A 3BALA 4IESA 3WDWA 3MICA 1I9RA 5KHHA 5T54A 4LBQB 4LBNA 3CJXA 1Y7BA 1GANA 4Q1RA 4UW4A 4YNIA 1NQJA 1C1FA 1VBB2 2OZ6A 4Q0VA 4EROA 5KC5A 2DCKA 2RJLA 3L2HA 4JC1A 4DXZA 4FO9A 1BMV2 4BMEA 1W6NA 4V1PA 5JPMB 1ZZ7A 2ERFA 3VBHC 5JDBA 1O3RA 1OQ1A 5BYNA 5HCAA 2G9GA 1DDLA 3M8LA 4C1XA 1XRUA 3POWA 4FPHA 1UCXA 2ZMLA 3GZTB 5I0UA 2RM22 3WX5A 1F2NA 3BIWE 2I45A 4R9CA 2WS92 3DPRC 2V5YA 4FPOB 1PVC3 3P3PA 2EXHA 3FFZA 4PDWA 4KNCA 1ZZ8A 3TOJA 1BVVA 1RMU3 1K5MC 2R49A 3I7DA 3JBG3 4CDQB 1V9U2 5AC92 4E27A 1A8DA 1QXPA 1LU1A 1ULGA 1YJKA 3D5OA 3USSA 5GZFA 2HEYF 1XYOA 2OIIA 4LE4A 1ND3A 4XTMA 1N1SA 2Q30A 1LGCA 5CU1A 4IEVA 2P3IA 4HBNA 1BEV3 4YGBA 2A75A 1XQNA 3DPRA 2CV6A 4M3CA 5I91A 1C3HA 2PYTA 1RUJ2 2JG9B 1HKDA 1WD4A 3VZMA 1NXMA 4RHV1 2XJUA 5F6KA 1H2MA 4M3CE 2JG8C 4ES8A 2Y38A 3S6PA 4AFBA 2HEVF 1V6NA 1CAXA 3J8F3 4CDUB 2QZ2A 4K6BA 3VBOA 4XF3A 2JG9A 1YI9A 3E5XA 3OPZA 4Q0UA 4FQ4A 2VY0A 4BLIA 2UYBA 3R4UA 3LSDA 4D94A 1AF9A 1CESA 1E57A 2ZAAA 3AKTA 1ZBE3 4Q4V3 3N7LA 3WP3A 4COYA 2HJIA 3EQEA 2I07B 3N7JA 3K48A 1AX1A 2W39A 3VKNA 3RYRA 3IM0A 3MDPA 1GNHA 2ZX0A 1QH7A 1HXS3 1ND2B 4M00A 1JUHA 3TN91 4HETA 3WP6A 1D4VB 2B45X 5ABJC 2GDFA 3POYA 4B3NA 3V56A 1POV3 4XPVA 4GULA 4Q4Y3 1RHI3 4W6XA 4TYSA 3IDEA 2OW4A 4LUKA 4L2NA 1HIXA 3LSEA 2D6NA 1W6PB 3A0KA 2WT1A 3FWEA 4XFFA 1ASJ3 3VBRA 3NV2A 4BM8A 2LALA 3IN9A 2QCSB 2BVBA 3INAA 2OUJA 3B93A 5GLUA 1SACA 3JD72 2UY8A 3V0BA 4G3YC 4MX3A 1VBB3 4Q4X1 1NA1B 4XQDA 3UL2A 4OVEA 1QJU1 1LULA 1ZREA 3M3EA 4E4SA 4AI2A 3FUQA 4WBBA 5A3LA 2YV8A 2D3SA 3AZYA 3H1MA 1AXZA 3VDDA 3OJBA 2Z69A 4E2SA 3CJIC 1ENRA 2DVDA 3MGUA 1R1ZA 5FO7B 2CL2A 4O9GA 1KS4A 1UZZA 5L19A 2CY6A 2G9FA 3CNAA 1AL21 2QFEA 1AVBA 1RUE2 1DZRA 1ZX5A 2WS93 2IFRA 4IERA 3ST7A 5C9AA 5JWPA 1O4TA 4ES9A 1LGNA 3VZNA 2BUKA 5AFEA 5BY5A 1W6OB 2WFF1 4AGVA 5GALA 5A33B 1VR3A 2ZTNA 3WQ7A 1PZ7A 1V9U3 5AC93 1VRH2 3PVOA 2NM1A 3A0NA 4HVQA 4YZ4A 1DF0A 2GN3A 3ZFEA 5JOXA 4YW4A 3ZIWA 4AXOA 4FPYA 1AR71 2Q1ZB 1H2NA 1FI2A 1VAVA 2RS13 4P9XA 4L9BA 2XLGA 3HIFA 3KLSA 4XILA 4Y1ZA 2ENRA 3NKGA 5JI7A 3GZAA 4CDXA 4OHYA 2BWCA 3TNQA 1RUJ3 2B8MA 2IXLA 1SDWA 1KFUL 4XJUA 1QJZA 1WUVA 4SLIA 4C1WA 5FO9B 2HWE2 5D8AB 3GYDA 4B4RA 2WNVC 3OYWA 3URFA 3VZJA 1G86A 2JD4A 4HVOA 1AZDA 5F6LB 3WW3A 1UMZA 3VKMA 2TBVA 3R4SA 5CFDA 1VJ2A 4JDOA 1AYN3 5CNAA 1LHOA 3ZFFB 4R8HA 5K9YA 1GBGA 2ZHMA 3ETQA 1IS6A 2WSVA 4GALA 1REDA 4QD2A 1QDCA 2JE7A 4S2GA 2UU8A 2PHTA 4GMP3 1NCQC 3PVBB 3B00A 1O5UA 3LOIA 4WM7C 5BNNC 3ZFFA 2RS31 3M3CA 3VZKA 3MPBA 2HWB1 3EJKA 4CEYC 4PIZA 3AKRA 1H9PA 1LHNA 3ZXGA 4YZ5A 1XNCA 1COV1 3LB9A 4PQ9A 3VBSC 4Z92B 1V6JA 3ZMOA 1Q8VA 1R081 2XKPA 3LA3A 1AR81 4Z1VA 2HWD1 3BTAA 3T1MA 5BNNA 2F6BA 1ZRFA 3HT2A 4DB5A 3AYAA 2Y0IA 4D7SA 2WWSA 3RNSA 1LESA 3JD73 5GZGA 4M3CF 4GB33 2W0XA 1PO21 3AMHA 4S2FA 1W39A 5CFCC 1V70A 1GLHA 4FPFA 4I3GA 4BH9A 3AKSA 2B7YA 2Q5TA 2Y26A 2XL9A 4JRAA 4E4DX 5KHIA 3FE5A 2ZJCA 3AYEA 3ZFGC 2VMGA 1RUE3 1QWRA 2DU0A 1JUIA 5E8AA 1UPIA 2RJKA 3AFGA 4GA9A 4YZ1A 1VBD2 3WCSA 2WJSA 4RGGA 4HK9A 1LOGA 3MFCA 1MEC3 4LA3A 3BOPA 2E63A 4QPYA 1J1TA 3UKNA 1APNA 1QY4A 4Y1XA 1Z7S2 1LODA 5T5JA 2BFUL 3VL8A 1PHMA 1RUG3 1C1LA 1Q8QA 3WOGA 5FAXA 5C8CB 3LGRA 3WHTA 4KGQA 2BTVC 4MV2A 4Z07A 3DGTA 1GZWB 4J1XA 2WQZC 4FPGA 4ZU5A 3ZXEA 4ITCA 1PNGA 2F4PA 2HWE3 4HPKA 1TME1 5KHGA 1PGW2 3HAGA 3JU9A 3J26N 4HN1A 3I54A 4Y1UA 5C8CA 5EWSA 4QPIB 5J98B 4EN9B 3B3QE 2XG3A 3CU7A 3AKPA 1GZWA 4JAAA 4IXLA 3GALA 4RR3C 4GH4A 4QGLA 4XMIA 4EN6B 5JOYA 2HEWF 3H3ZA 4MGYE 3VBFB 4AEDB 3N7KA 4A7YA 2DU1A 2QKDA 4UW3A 2R041 4HZFA 3N35A 1SMVA 3ELNA 1DLLA 3S0MA 2MNGA 3UKTA 1PIV2 2XVGA 5BPXA 2ZGLA 5JI9A 4ZU7A 1H4HA 4FXKB 1SLCA 2ET1A 2ZPXA 2E7QA 1VBC2 4S2DA 2ZX4A 3WDUA 3BCWA 4GKYA 5KHKA 1PO12 5K0UB 4YARA 2YXSA 4TZDA 4ZU4A 4LO7A 4Q8KA 4AQSA 1OPMA 1O3TA 4COVA 4TSVA 3UJQA 2KXLA 2GN7A 1ZM1A 3L9JT 4LE3A 5FOJB 1Q8SA 3GNEA 2A6XA 4LLOA 4KG0A 1OQDA 2OZJA 4AF9A 4QM8A 5K0UA 5JZGB 3B7MA 5EYXA 1J58A 2IXCA 4N53C 3UV9A 4LT5A 4QU2A 1HQNA 3FX3A 5K7PA 1G9DA 2IZWA 5H9RA 4P9LA 3KSCA 1WA4A 1MVQA 2NN8A 4JTNA 2D6OX 4JV4A 3R4DB 2E6VA 3WUDA 3TB0A 5JZGA 2ZGUA 4HKOA 4MVTA 3WG3A 1HRV1 2XVLA 3VHRA 4FCAA 3WVJA 1RVF3 3V64A 1OI6A 3QACA 3MLLA 1AL0G 1FOD2 5IK5A 5BNOC 4BLJA 2B42B 3O12A 1R1A1 4WVMB 5CVRA 1MACA 4L99A 3NSTA 2H0VA 5T3NA 1VBA1 1CAUB 1IKQA 1NCRC 1C5IA 1S0GA 1WW7A 4FBFA 2RR12 2PLV2 3KQRA 2MPFA 2ZACA 3SCHA 2DFBA 4AFDA 1HV0A 2VQ0A 1WW6A 2NLRA 1J3QA 4YVWB 1CAUA 1WD3A 3IWZA 2WSUA 1TQ5A 2WNUC 5J3UA 1FXZA 5J37A 4GKXA 3QH7A 4OHVA 4EN8B 4JGZA 5FDBA 1AXKA 2RS51 2XJSA 5H9PA 2ATFA 2D43A 3AFKA 5DZFA 1QJX2 4LNVA 4JGYC 1VBE1 5IT6A 1C8M2 4KL1A 1RITA 4MLOA 4L8QA 1CGPA 1OLRA 1D2QA 4RQPA 2ET7A 4INDA 1FPN3 2XB6C 4YLZA 4DZGA 3ZN6B 4YYOA 3ZYIB 4BA6A 4Q8LA 2FZ2A 2ZKNA 1XNBA 2ZMNA 2VW2A 5KC6A 1LOCA 3M7AA 4COWA 4C91A 1B35B 1D2SA 5JSPA 1VAKA 1X7NA 1DHKB 4CDWA 4CEWC 2X53S 1IPJA 1U5IA 2D7FA 3VV1A 4BZ4A 1RUI1 5BNPC 1YO8A 3KGLA 3O0WA 4HL0A 4KG8A 3J4UH 3RMXA 4LO5B 1PK6B 4U36A 5BUVA 4HSJA 1OOPB 3WG4A 4D7YA 2K9ZA 1B35A 2V09A 4MSVA 4NO4A 3AZXA 4QPGB 2R0FA 1G6NA 3N4MA 2W08A 4YSFA 3ENRA 4AVBA 1XNDA 3AB0A 1ZBA1 1I1EA 2SLIA 3PTYA 1VBC3 3O5SA 1JYCA 4Y4YA 1PK6A 1OFNA 2MEV3 4AVVA 4DY3A 1OOPA 2JXAA 1PO13 3CO2A 1UZYA 1YIFA 1NY71 1DQ1A 1A3KA 3H3UA 1LEMA 1R091 4F8AA 1C4RA 1OHFA 3FHIB 3D4KA 4URTA 4RS5C 5AFBA 3H1WA 1O4YA 4IETA 2GC0A 1EYBA 1I6XA 2CGPA 1CR7A 5DZGA 4RHV2 3MYXA 4AI1A 1EAH3 3QD6A 5C4WC 5CADA 3M3QA 1EV11 4KBBA 5ACA1 4IV3A 5A32A 4OZXA 1N47A 3X29B 4AVAA 5J48A 2FZ1A 4QXKA 4JQRA 2RE9A 2O0OA 3AYDA 3ECQA 4RS5A 4YVSC 5E1RA 2ZCWA 4IQPA 2BW8A 1A8MA 1QKQA 1XU1A 3ALQA 3E5QA 1GYKA 2LUWA 1RUC3 3ACLA 3M4FA 3WDVA 4IV1B 2RR13 4IEZA 4Q0SA 5FOBB 2AR6A 2PAMA 2PLV3 3NAPB 2EAAA 5FLJA 4AHZA 1UPSA 1H8TB 3M3OA 1SBFA 1I5ZA 4HANA 4S2HA 3GHNA 1AR91 4I3PA 1RUF2 3WCRA 3WV6A 2LTNA 4R9AA 1QQP3 2VOXA 3I8TA 4IV1A 2PFWA 4B4PA 3GZUC 5CG9A 3ILFA 1QJX3 4MUVA 2ZHNA 1NE6A 2DURA 1C8M3 2OUHA 1YIPA 1DYKA 1BQPA 5JSOA 1RB8G 3AYCA 3D82A 2AREA 1XYNA 2GZWA 1PZ9A 2Y0OA 5L7OB 2YZ4A 4PDWC 3LAGA 4KGGA 5LEKA 1QOSA 2DUQA 3QOPA 5JOZA 2PQQA 4Q4X2 1W6MA 1DGRN 1WCSA 3N36A 4IL7A 1UU4A 1QJU2 4XQWA 4LBQA 5JOWA 1LKNA 3SITA 3RYPA 1AYM2 1QF3A 4MZUA 1UAIA 4WV8A 1ND3C 2OVUA 3QCWA 5L7OA 3EO6A 2R0HA 5T50A 1VAMA 1UIKA 5DDJ2 1ENXA 1N1YA 4UW5A 1UW8A 4P9JA 3JQXA 4FPJA 1CJPA 4H7LA 5FFOC 5CB7A 3AMMA 4H7MA 3WT3A 2WFF2 2A71A 2WZR1 2XVKA 1EY2A 1X33A 3D6EA 4P9YA 1ONAA 3ZVXA 3IPVB 3IDBB 3OY8B 3VBHB 4DINB 4GXLA 3ZPYA 5I8YA 3SXWA 3N7MA 3RJ2X 3WNXA 3VBOC 1PVC1 2JG9C 3AP7A 3MIEA 1S0BA 1AR72 3FC0A 3H50A 1YCIA 5HBAA 4CDQA 2EIGA 1UKRA 5C6CA 3JBG1 2R16A 5GKAC 4RGAA 3SH3A 2JE9A 4BMBA 1MZ5A 2UWAA 1BXHA 4I09A 4RHV3 5KXEA 4N7IA 1LEDA 1OD5A 4LHLA 2D6PA 4NN0A 1O7FA 1K5MB 1VB2A 2HKXA 1BEV1 1QH6A 1HRI1 2D3PA 1OLQA 2QJVA 1KDMA 4Y22B 2ZBJA 4AK3A 2HWC2 2XUMA 3QBQA 3USUB 2WNEA 1O4ZA 4LHNA 1FYUA 4QM9A 5HCFA 3UJOA 4HKWA 4CDUA 4XBNA 3FBMA 1S2BA 4OUMA 2PHRA 3J8F1 3VUOA 1OA4A 4C0BA 2JG8B 1AR62 2GMEA 4ORFA 3T1LA 5K8SA 3IKWA 4DRVA 2GNTA 1NZCA 3BB6A 3VBRC 1CAWB 3SHRA 1TMF3 2HWB2 1ZBE1 4IEOA 4Q4V1 3RDIA 3ZSLA 5H9QA 2WT0A 4LUMA 1T6GC 3ZMNA 1IQAA 1RUF3 3HN1A 3R0RA 1COV2 1H4GA 1X8MA 3OBRA 4XF4A 5B2GB